5IM0B

Crystal structure of the rna recognition motif of mrna decay regulator auf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein D0
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5im0B00
3CCES 2DHAA 2HGMA 3BS9A 2KM8B 3MUMP 2KHCA 2N3OA 3IWNC 2DGVA 3MDFA 2DGQA 3J7YU 1QVGR 1S79A 3IRWP 3RW7A 3LPYA 3HHNB 2OJ3A 3TO8A 5MLCV 2L41A 2EVZA 2DK2A 1A9NB 1X4DA 2CPEA 2F9DA 3CUNA 5BJRA 3TYTA 1U1QA 3MD1A 1DZ5A 2OTJS 1HD1A 2X1GA 2LA6A 2YKAA 2DNYA 1U1KA 1ZH5A 1NU4A 2QFJA 4WIIA 1JJ2R 2MKHA 1VBZA 2CQDA 2LKZA 2JVOA 1VQ8S 3SDEA 2AYEA 3P3DA 4PKDB 1SJQA 5CA5A 2CQ3A 1M5PC 3H2VE 2XS5A 1WF1A 4FXWA 3I55S 2MQMA 1YTYA 1VC0A 1N54B 2OSQA 2KRBA 5H1SV 2AYGA 2DGTA 4ZKAA 2PE8A 3PIPQ 1WF0A 2CQCA 1N52B 3P5TL 2N82B 2LMIA 3CCMS 1VQLS 3UD4P 2LYVA 3UCGA 3MI7X 4WFAQ 1M5VC 1YJ9S 1QVFR 3G6ES 1N88A 2DH9A 2MZTA 4YOEA 3UCUP 2M7SA 2CPIA 3OW2R 3FEYB 3R1LA 2MQQA 2KM8C 2MKCA 2DNNA 2L08A 1FJEB 2KI2A 1VQ6S 3G4SS 1WG5A 1X4AA 2J76E 1VBYA 2ADBA 2RRBA 2EK1A 2RU3A 2KYXA 4BS2A 3S7RA 2U1AA 2XS7A 2KH9A 2CPZA 2KG1A 1HL6A 2MYFA 3R1HA 2ZJPQ 2DGSA 1WELA 2DITA 1FXLA 2MJUA 2LA4A 1JMTA 5LXRA 2MSSA 4Y00A 1RKJA 2MKIA 3VAHA 2ZJQQ 3CCQS 1X4HA 2DHGA 3CMES 2MB0B 1B7FA 3NS6A 3MUTP 4WFBQ 2FPHX 4TU9A 3CPWR 3J7ZT 4TU7A 4YUDA 2YH0A 2CPXA 2I38A 4QU7A 2N3LA 2A3JA 2MGZB 1PGZA 3EX7B 5DM6Q 5DDQC 5IFMA 5D78A 2D3OR 1H6KX 1D8ZA 4QQBA 2G1DA 2E44A 1O0PA 4ED5A 1U2FA 1X4EA 1WEXA 2CPFA 2KVIA 2MQNA 3CCSS 1FHTA 1ZZFA 2M8HA 2MY7A 3EGNA 2DIUA 3CCVS 2HZCA 1CVJA 2MJNA 5GADU 3CCLS 1FO1A 2XSFA 1SJ3P 3TP2A 2XNQA 3Q2TC 2KXHA 2MXYA 2MKKA 1URNA 2MSTA 2DGWA 4IO9Q 3THTA 1BY9A 4CH0S 2LCWA 1OWXA 3U1MA 1X4CA 5GMKa 2D9OA 2G0CA 3NMRA 3S01A 1N8RT 4IOAQ 2MZJA 3JB9k 2AD9A 2K8GA 1U6BA 2CPDA 2DNGA 1XN9A 2LEBA 2DGUA 4P6QA 3SXLA 2RNEA 1UW4A 2O3DA 1U6FA 4IOCQ 2DISA 2RQ4A 2JRSA 2CPYA 1K8AT 1X4BA 2MY8A 3VAMA 2ADCA 2MKJA 2U2FA 1K73T 1UAWA 1R8HA 4OZ0A 2DIVA 5GAGU 3NNCA 3CCUS 2RUGA 2CPHA 1H2VZ 1P1TA 3VAKA 4QU6A 5DDPC 1F9FA 2PEHA 3HI9A 1U1PA 2OIHA 5FJ4A 2MQLA 3BO3A 2DNZA 1UFWA 5IM0B 1U1LA 2CJKA 1X5SA 2JX2A 4RU2A 3UE2A 2LECA 1WI6A 3D2WA 1WHXA 1KOHA 3NNHA 2F3JA 3BEGB 3G8SA 3S8SA 3P6YC 2RQCA 1WEZA 1HA1A 3MXHP 2M2BA 1YWXA 1OIAA 1VC5A 5HL7Q 3FEXB 3U1LA 3ULHA 2YH1A 3CMAS 2OSRA 1RK8A 1UP1A 2CQHA 4PRFA 4M5DB 2QEXS 2DH8A 2KXNB 2KRRA 4V19X 3CCRS 2LXIA 5DDOC 1M5KC 2MZ1A 1VQKS 1U1RA 4LJMA 3G9CA 3SMZA 1VQOS 5IQQA 3ZZZA 2DNQA 1U1MA 5HO4A 2M52A 1VC6A 3H2UB 2MZRA 2NLWA 2DNOA 2GHPA 4F26A 1X0FA 2YTCA 3MURP 2MKSA 5ITHA 2CQ1A 3G96A 3UWTA 2HYIB 2CQGA 3UD3P 1P27B 3DXBA 1WTBA 4WF9Q 2MQPA 4FXVA 3VF0B 3CD6S 2N7CA 4QPTA 1DBDA 1VQ9S 3DLLQ 3I56S 3VAGA 1M90T 2K3KA 5IM0A 2CQIA 2E5IA 2DHXA 2EK6A 2M9KA 1KQSR 2KG0A 1VQ5S 2XB2D 3NNAA 3THPA 2FC8A 2CQ4A 2CQPA 1QM9A 4ERDA 2E5JA 2CQ2A 4W92B 3UCZP 3VAJA 3R27A 2HGLA 5DETA 5JVGQ 2AYBA 2VOPA 2DNHA 4CIOA 1WHVA 1NO8A 1PO6A 3L3CA 2HGNA 3SDEB 2XNRA 2FY1A 1X5TA 1Q7YT 1WF2A 1FNXH 2M70A 1OPIA 2VONA 2MGZA 1U1NA 4LMZA 1Q82T 2Q79A 2DGXA 1Q86T 1VQ4S 3CTRA 2LQ5A 3K0JA 1FJ7A 1VBXA 2E5HA 4OZ1A 4WKRA 2DNKA 4Z2XA 3S6EA 3G71S 4W90B 4U67Q 2OTLS 1X5OA 2GO9A 1FT8A 1WWHA 2DNMA 1DHMA 2LXUA 2DH7A 3BO4A 1G2EA 2DB1A 2BZ2A 3CC7S 2RS2A 1IQTA 5DDRC 1WI8A 1WEYA 4PR6A 1X5PA 2G4BA 1VQMS 2X1BA 1ZZNA 4F25A 2CQ0A 1X4GA 2J8AA 3MD3A 2L9WA 2MMYA 5D77A 1H2UX 2FHOB 2ZJRQ 2UP1A 3RW6A 2WBRA 4TU8A 1YIJS 1VQNS 2M0GB 2JVRA 1SJFA 4UY8T 2VODA 2M8DB 1S72S 3CF5Q 2CPJA 2X1AA 1SJRA 5LJ5Y 3CC2S 1WG4A 5JVHQ 2NZ4A 3B4DA 4A8XA 2J0QD 2E5GA 1OO0B 2YWKA 3MUVP 1SXLA 1YI2S 3VALA 3BO2A 1KC8T 2DNRA 4YB1P 2ERRA 3US5A 2HVZA 4CH1A 3VAFA 1K9MT 2KXFA 2KU7A 2I2YA 2DHSA 2MZQA 1M1KT 2DNPA 3G8TA 1R8PA 5LSLA 1NJIT 1WG1A 5GAHU 2LEAA 2M4MA 3Q2SC 2RS8A 4CQ1A 2RRAA 1SJ4P 1FJCA 1HD0A 4Y0FA 1A7GE 2V94A 2X1FA 4TLQA 3ZZYA 5LJ3Y 1VQ7S 2FC9A 3NS5A 1YHQS 2MPUA 1D9AA 2CQBA 2RT3A 2RVJA 2AYMA 2BOPA 3CXCR 3CC4S 4C4WA 2KN4A 2DO0A 1KD1T 4WCEQ 2M88A 3MOJB 5CXTA 4LIRA 2KT5A 5CYJA 1H2TZ 2SXLA 1WHWA 1X4FA 2VOOA 2QA4S 1U1OA 2MQOA 4C7QA 1L3KA 1YITS 5LSOA 1YJWS 2XS2A 3PIOQ 2J0SD 2D9PA 4J5OA 2MZSA 4IUFA 2JWNA 4WFNQ 5GVQA 3CCJS 2MHNA 1Q81T 3V4MA 1JJ4A 3LQVA 1DRZA 1WHYA 5EN1A 1KOOA 3EGZA 3VAIA 2DNLA 4UQTA 2KFYA 1AUDA 4C0OC 3CULA 3B4MA 4F02A 1M5OC 2B0GA 5LXYA 4EGLA 2DO4A 2F9JA 5GAEU 1VQPS 1W2BR 5DM7Q 1YJNS 3P49B 2DGOA 3N9UC 1JJHA
chains in the Genus database with same CATH superfamily
3CCES 3EVOA 4HEA9 1S1WB 1D8YA 1ZAVA 2BABA 1F1BB 2HIQA 5AXLA 3EICA 4U8VA 3NGRA 4IFVA 2DGVA 1AXQA 1TV6B 2KB2A 2OD4A 1URRA 2GCFA 1AB8A 4ZPTR 1QTNB 4ER8A 3JQKA 3IRWP 1FWPA 3RW7A 1B0PA 1H74A 2W8KA 3TO8A 2C2RA 4ED3A 2VASA 3CCZA 3NBPB 3QAUA 4DXLA 4PWUA 3ZFVA 1RA7A 1X4DA 2NPIA 1FDAA 4ECZA 1T05B 1RWPB 2F9DA 3MMJA 4O3NA 3DRXA 2CZVC 2LVWA 2QIFA 2J9DA 1FEEA 3TYTA 1LV5A 3HO1A 4PZVA 5AXKA 2XTJP 4U9RA 4F04B 5L9NA 3TI0A 1ZM4A 2DBBA 2P5VA 3NCQA 2ASDA 4N47A 3SBMA 1RTIA 5KFRA 2ZM6F 3F44A 1S0VA 1F0XA 2YKAA 5IZHA 2ZFHA 3WHIA 2IAJA 3HSDA 4U95A 3VQSA 3W1YC 1N5VA 5B0CA 4CLKA 2FLOA 3PYFA 4WIIA 4KT0C 2CNLB 4WFXA 4OI1A 3SSRA 5F3ZA 1Y11A 4DUTA 5B7WA 4B3TF 2QLFB 4I69A 4M5DA 5DQGA 1S6PA 3MCNA 3OVSA 2D3UA 1SKRA 1NDKA 2LKZA 1AUSL 2JVOA 2CA9A 1AA1B 2Q6CA 3LUYA 5J2MA 3PZPA 1EX8A 1S1UA 3SDEA 5KT7A 1SJQA 1KTQA 1JKHA 3TJ8A 1Y4ZB 2IRYA 4DUYF 2EG1A 2CDRB 3T9ZA 1X60A 4NZ6A 3K89A 3I55S 3MM6A 2UVVA 3DLKB 4C8LA 1N54B 4DZDA 2KRBA 5T14A 2E1CA 2H5EA 1TAQA 2PE8A 3QFWA 4AT1B 1N6QA 1UPMB 2FJAB 3FDSA 2CQCA 2GW8A 3CJ5A 4USKA 1N52B 1F5CA 3SSSA 4K2XA 4ID5B 3I6PA 4YB5A 3J81j 3DRPB 1WD6A 4JI7J 4LFBJ 3CCMS 2ZDPA 4PG4A 4CT8A 2RDIA 3TEGA 1K0TA 2QZ8A 1NHKL 4IDKA 4J9UE 5DZ7A 4XIUA 3HT0A 2XMKA 4FYDA 1T9VA 4AL5A 1FE0A 3IRXA 4WFAQ 4OHXA 3UNYA 4DR1F 3OJSA 4LUBA 5LM7E 4PWDB 3FNNA 2WAQD 4B9TA 1VQYA 4PABA 4ID8A 1N34F 1PC4A 4LSNA 1HWIA 4QR2A 3CSKA 4DPWA 2HHQA 2DTJA 4G65A 4MIWA 3TOQA 4JI4J 4B9VA 3NP5A 4M95A 1JLGB 5KFCA 3I5BA 4WP3A 3OW2R 3R1LA 4DZ6A 5EX0A 2KM8C 1S57A 4ENOA 1TK0A 2MKCA 4ZJQA 3SV4A 4YEAA 5I3QA 2J9EA 4RNOA 4NX9A 5KFWA 1WOOA 3G4SS 1FJEB 1X4AA 2YQ3A 4F2RA 2UXCJ 4RNMA 4HYKA 3J7Z5 1TV6A 2EK1A 4MIAA 1JLBB 2BQ3A 4BS2A 4IG3B 4QIFA 5KFQA 4MYUA 4NWBA 3DI6B 3V2UC 1TZ0A 2XS7A 4YR3A 4ELUA 3G6XA 3AXMA 5CYQB 2PFFB 1NAQA 2KG1A 3H5YA 1I1GA 4OLOA 5I4MA 1HQUB 3KHLA 2CG4A 5IT0A 2J7KA 3TA0A 2ZJPQ 1FXLA 2MJUA 4OYXA 5M2PA 3AB4B 5F8IA 1J5OA 4PG5A 2E7VA 1CS4A 2VUGA 4Y00A 4RW8A 1QAYA 1IR2A 3VAHA 1J5EF 3A13A 4JI1J 2NCKL 1X4HA 4ZVTB 4K4YA 3CMES 2PD1A 4E8UA 1FRJA 4X4SA 2MB0B 1XK8A 2YX4A 2D41A 4HTJA 1S9EA 4B9LA 4WFBQ 3C15A 3O44A 3CPWR 4RKUC 3SV3A 1NDCA 1XR7A 4NA2A 2AGQA 3HF5A 2FJDB 1R0BG 4TLRA 3GFYA 2A3JA 3JTPA 1DLOA 1Q16B 2VFTA 5DRKA 4DPOA 3I31A 1O6XA 3R5JB 3NOGA 1TKXB 2JNJA 3EVWA 2HFOA 1K47A 1HQ2A 1Z1ZA 2E44A 2PN6A 2K2PA 3MM8A 5EHHA 3BPDA 2RHQB 5CH7B 3BBFA 1ZZFA 2HK2A 3K5PA 3CIZA 3R6LB 5CCMA 4WTOB 2ZHBA 3EGNA 3KHHA 3CCVS 1PAUB 3AD8C 3C6TA 1O8BA 2MJNA 4HHJA 1RT3A 1LW2A 1SH0A 4ZPCA 1REVA 3CCLS 1IJFB 3HJVA 1FO1A 2UUCF 4W4MA 4IDKB 4MIBA 4LFCJ 1BQMB 4NPOA 2BANA 1KS2A 1RAJA 2C3MA 2WHOA 1U8WA 2LP4A 4KV8A 3TP2A 2HHWA 1E6YB 4USWA 3BZQA 5BYQA 2DYAA 5J2QB 2DGWA 3RU0A 4DL7A 2GO8A 1NEEA 3M8QB 1BY9A 4OHZA 2A2DA 3EE3A 4DV7J 1KRPA 3BPSP 1ZBTA 3QT6A 1TL1A 2CAJA 4KB7A 1WC4A 2OUGA 3NXZA 1YJ7A 4Z7YA 1X4CA 1TQLA 5GMKa 1RAOA 1N8RT 1QDUB 4JI2J 1Q53A 3IBWA 1MMDA 3OL9A 3WIUA 4QWAA 3M9OB 1VOMA 2JC0A 3JB9k 1RLDA 5KFMA 4O3SA 2VV5A 4RW7A 3TUZC 1B64A 1IUJA 5C2GA 4I68A 2O3DA 4YDXA 1S12A 4NEYA 3M8RA 3C14B 2DISA 2RQ4A 1UPPA 3IMQJ 4WFZA 3WX8A 2PSZA 4I7FB 3VAMA 1JLBA 4K5SA 4PG6A 4IR1A 4DR3F 2YNGB 2DR5A 1U26A 2MKJA 4OX7A 2GHWA 1IKYA 2EWHA 4DQPA 3MEGA 4DV1F 1R8HA 2XI3A 3LF0A 4ILMA 3DGPB 4FPRA 2FJWA 4KH0B 2BKPA 1F5BA 1JLQB 2NUUG 4NCGB 5ETOA 3SQGA 4Y2IA 3MM7B 4DUZJ 1D9FA 2GMHA 1TKTA 1H2VZ 2QMWA 4K0KJ 1CBKA 1FKPB 2QO3A 4FYWB 2JZ5A 1HW8A 4HDGA 4IQMA 3N0VA 5DDPC 1F9FA 4KFBA 1XNRF 2G9OA 4BC9A 4KBIA 1RTDB 3PHEA 1UWBA 4N7TA 3EDQB 4M1KA 1RTZA 3RGIA 3TRGA 1XNQF 5F8LA 1UFWA 5IM0B 5KFPA 5H9EK 1P1LA 1S4EA 1X5SA 2P9GA 3GYXB 2JX2A 3MZIA 4ZPBA 5E7OB 1IQZA 1KLMB 1RHJB 1U0SA 3LO3A 3IS9B 3Q8YA 4UT4A 4U7UK 4P2MA 4CT9A 2UXBJ 1F2HA 2GQ2A 2DRAA 2HQGA 4RW4B 1MWYA 2A6OA 1TMMA 3PG9A 2F3JA 3BEGB 3LP2A 4DCOB 3DLHA 1UEUA 4F50A 2XZWA 3ZNUA 3MAQA 2FZKB 4QIWD 4YR0A 4Q8EA 3P6YC 3MECB 3KMSA 1PILA 1HA1A 3BN7A 5BYSA 1UA0A 3PO4A 4IRKA 3MXHP 2YWGA 2ILYA 1J5EJ 3U02A 4WZMA 2PO4A 1BUXA 4A47A 1XBWA 3FEXB 3ULHA 5HL7Q 5BR8J 4S0MA 1HBMB 3QLHA 1MU2A 1QY7A 4X4QA 1QAIA 2OSRA 4K4XA 1VLOA 3MM9B 1T3OA 1TKZA 3M2VA 4DPTA 4HTIA 4C2MA 2R2RA 4QCLA 3BSAA 2DH8A 2KXNB 4K2JA 1H7WA 4HL9A 2R7WA 2ZHAA 4V19X 1U0HB 3LTOA 1RZMA 3A8EA 4ZN3A 3PW5A 3PV8A 2ALYB 4RUBA 4N56A 4AFFA 4LF8F 4NLGA 3VR1A 1SIZA 1C0TA 2KZMA 5F8HA 5F8JA 4KHRA 1ZM3A 3I0SA 5J2PA 4ZVEA 2KTQA 2HWHA 4AE5A 1NSQA 3R7BB 1SQEA 2ACYA 3ICLA 3PXGa 1EETB 3TW0A 2HHVA 5IQQA 4C48A 1SV5B 1HYSA 3BKTA 3QFHA 5IT4A 4B3SF 5HO4A 2G2YA 3PNIA 4LF4J 1CG2A 2F4FA 1VC6A 3ELHA 4I6YA 2RF2A 4RW7B 3NGSA 4ITSA 2GHPA 3CJ4A 3FMWA 2QSWA 3KK1B 1RU1A 2MKSA 1GXTA 4DFJA 3HSZA 4ZPDA 1KWMA 2CQ1A 2Z58B 4X4RA 3UWTA 2W9CB 4DV4F 1BWEA 1P27B 3MMBA 2NR0A 1X7VA 3IG1B 3DLEB 2XMTA 2YWWA 2ASLA 1Y5IB 4CH7A 3ENWA 1IM6A 1L3UA 2C3UA 1S7HA 1APSA 4L6V3 4KHPJ 1JLQA 2IM1A 1IJEB 4JOUA 4NCGA 4OX6A 4TN2A 3CD6S 1JLAA 3CDBA 2FIUA 4N5SA 1FJGF 2B4PA 1GX6A 1M0SA 3MEDA 3F41A 2I0XA 1Y5NB 2IC3A 2YWEA 3VAGA 5D3GB 4CLUA 4ZPAA 1YGYA 2G1HA 1YBTA 3QGHA 3Q23A 3KK2B 5CHCB 1IKXB 5IM0A 3HK2A 2B4VA 1CQNA 2CG8A 1WC0A 2QJ3A 3KJVB 2XY6A 5C24A 1HIYA 2H5JB 3EVMA 2KG0A 3OR2B 2KZZA 4P7TA 3UW1A 3PR5B 1GTEA 2JDJA 4DR5J 1AYEA 1HNXJ 2FC8A 4G1IA 3OXGA 2W2QP 2QA4G 2QG9B 5JVGQ 4UZCA 3W9IA 1XR6A 4GKJJ 5HROB 1S1XB 2V8GA 3W9JA 3OHAA 4ILRA 2XMWA 4LFAF 2DNHA 4OFZA 3WZ0A 4EWTA 4JI6J 1FRKA 2ZNZA 4PWWA 4USVA 2ZD1A 4CIOA 3PACA 4IG3A 4IOCQ 1RYSA 1SH3A 3M2VB 1PO6A 2AX0A 3CDWA 3L3CA 4FBTA 4B3OA 2UXBF 2V0NA 3C16B 1JB0C 1YDLA 1RU2A 3HHLA 3IGVA 4P10A 2WVCA 1RYRA 2FY1A 3IP0A 5CABA 1FNXH 5LOQA 1S6QA 1OPIA 1V6HA 1JLFB 1FXRA 4NRTA 2VONA 1I3OB 3CJ8A 2LQJA 2V63A 1QE1B 3ZXWA 1FD2A 1RSCA 1WC6A 2MGZA 2KO1A 3OR1B 4CO4A 1RI7A 2YBVA 2FB0A 3HCXA 5EX3A 3M8SA 3JYTA 4I2QA 3GV8B 2D74B 4TXSA 1FDDA 2ABYA 2F8EX 3A8IA 4J91A 3W2VA 3CTRA 4A48A 2BJ8A 3M8PA 3K0JA 3DM2A 3MHYA 4I6AA 2Z8QA 1U6ZA 1HQEB 4YB6A 3WDOA 4W90B 2B8QA 4JUZA 2OTLS 2XG8A 3I0RA 1HI0P 2JLGA 1N0VC 1SH2A 2LXUA 2GFFA 2DH7A 1ZYQA 4NXNF 1KVIA 5I3PA 1UKUA 1V9OA 2IJFA 1DTQB 3FQLA 3MMBB 1RAGB 3X3UA 2BZ2A 2R7RA 2ROEA 1JJCB 4USTA 2A18A 4ZN1A 3GFHA 2NXUA 3QRRA 3D0GE 5DDRC 3K59A 1T9TA 2V2QA 2VBXA 2ZC3A 2OEJA 4N77A 5T7LA 4AL6A 3NCPA 3ZTRA 2YKOA 4MH8A 2XC9A 1VQMS 3R2CJ 2G2OA 4N76A 1FCAA 1QJHA 4U7CA 4F25A 1JNRB 4DMZA 3BSNA 2J8AA 3DU6A 4ECXA 2HRUA 1HR0F 1NZ8A 3AD7C 5D77A 4R8UA 2ZJRQ 2UP1A 2H5IB 2PA3A 3TJAA 2Z56B 4DN9A 5D0GA 1RTHB 5J1NA 4TU8A 1ELOA 4DV1J 4KKOB 2M0GB 1GT8A 1R7IA 2JVRA 4WYWA 2W7PA 3R5BA 4FF4A 1SL2A 2V4QA 2M8DB 2DKOB 2GJIA 3H90A 3QO9A 2E29A 3GONA 2W4PA 2HEKA 1NUEA 2CPJA 5DZ6A 2W1BA 3T9NA 3CC2S 2ZWPA 4CYUA 4A8XA 2ZBPA 2MTLA 3O5TB 2GS8A 2J0QD 1R8AA 2FHMA 4Q7AA 3LGNA 2CRLA 4B08A 4WKYA 1EZZB 4G3IA 1S4FA 1GMWD 1QSYA 4B02A 5IS2A 3MTJA 1F9EB 2K7KA 3TAMB 3BV8A 1WKKA 2QC3A 3VALA 2Y0SD 3R5CA 4TY8B 4YB1P 4DQQA 3DRSB 1ZA2B 2ZD1B 3R2DJ 3POTA 3HHEA 2OELA 4C97A 4CDIA 2XI2A 5KG0A 1IBMJ 3T41A 1W7WA 2EKYA 4HLBA 1PBAA 4W98A 4ATNA 2DHSA 1IKWA 2A2CA 2KKHA 2MZQA 3HHLB 1FRMA 1UVKA 4EYIB 2F4VJ 3TZXA 4DX8H 1C1BA 3HVTB 2EC2A 4FPIA 5KG5A 1QUVA 4DF4A 1W25A 1BLUA 3ZZTA 1XTZA 2BACA 2ROPA 2FTRA 3M2RB 2BQUA 3DRRA 4K4VA 2R2UA 1BC6A 3D6HB 1MROB 2BMBA 4LFAJ 2J6SA 2GAGC 3TZZA 2ZC4A 3ET6A 3HD2A 3BSCA 4NZ0A 5JUMA 3CDEA 3HHNB 2V94A 2GIRA 2XGQA 4JI8J 2IVYA 3GSDA 2FZGB 5KG2A 1Y0HA 1EIYB 1XNRJ 1RWXB 4DR4J 2B4OA 2HVEA 2VG7A 3DLGB 1YHQS 3KLEA 5B0GA 1S97A 3MFHA 4P2SA 4LF7F 4J9SA 5IT9U 4BDPA 4NLSA 2VKRA 4RR5A 1DTQA 2BE7D 3GPAA 3CC4S 3MMCB 5AE2A 2KN4A 5A2QY 4GO5X 2VJVA 3D0HE 4DLEA 2FDNA 1JXLA 2ROGA 3HP6A 4OX8A 4NXMJ 3Q86A 5FD1A 5EWEA 4RW6A 4B3RF 1GH8A 5D0HA 2RILA 4DOZA 2JFDA 2B4UA 3MFIA 2EW9A 2OHDA 3NWGA 2W7OA 5ETLA 1YSJA 1EP4B 1Z4UA 4WP8A 4NE9C 5E3AA 1X4FA 4NLVA 5CQGA 1KN6A 3KJFB 3MCSA 1HHSA 2GV1A 2QA4S 1HKAA 1JX4A 3V4IB 2R7OA 4C7QA 2ZWOA 3P4UB 1CJVA 1SVDA 3MMAB 4NOHA 3PIOQ 2J0SD 4RW9A 3VQTA 5HJYA 2HHXA 2EKNA 3UDLA 4PUOA 4USIA 3QGPA 3QRPA 4CYUB 3WX4A 4L75A 5A8RA 5A76A 3CCJS 4LRFA 1OSDA 1RISA 4NCBA 4JYAF 4E0DA 1S49A 4QJVA 3SFUA 3W63A 1X9MA 3SQOP 1KOOA 3TWZA 2VDHA 3BBBA 4DN0A 4XPCA 4ED7A 2I8EA 2P2CB 2WTFA 4KIAA 1HNWJ 2VG5A 2W9AA 2JLFA 1V3SA 2ZNYA 2WONA 3DCAA 1S10A 2YNIB 2DCLA 3WBZA 2KFYA 5KFNA 1SPBP 3FJ2A 3CE8A 1SUQA 3POTB 2C42A 1RABB 4OJHA 4TKTA 5F0UA 4C0OC 5J2NB 2ZH2A 4F02A 2AMCB 1JXEA 1OSCA 3DI6A 5CCLA 3PVXA 2F7VA 4J37A 3PO5A 2DO4A 1P6TA 1HQUA 1JLAB 2VBYA 3NGKA 4YY3J 5AJ3F 3KUHA 2UV8G 1T3NA 4F7VA 3MPYA 4DV4J 4DV7F 3CJ0A 3PEJA 1AT1B 4DCPB 4JI0J 4J9KA 1NSPA 3L7OA 2N3OA 2AT1B 3MDFA 5JMNA 2DGQA 2YNFA 5L1KA 1S79A 2C2EA 3PYDA 5MLCV 2H1YA 4FZVA 3DLGA 4M5IA 4DV5F 5SUHA 2NXEA 2CJYB 4E98A 3Q8PB 3TAQA 5FIIA 3TA2A 5AXNA 4DV3F 1DZ5A 5I42A 2G2ZA 4LF6J 1HD1A 2FUG9 2JH3A 3RRKA 2X1GA 3T1YF 2E5LF 2XMVA 2DNYA 5EDWA 3T1AA 2DR6A 3D0IE 4DSLA 1ZH5A 2KDOA 4V19J 1KONA 4M8LA 4WPAA 2MKHA 1NH8A 3OFHA 1I51B 3TVKA 1GTHA 1FEHA 3LGMA 2CQDA 4RPFA 2AJ4A 3W8PA 4ED1A 2Z2YB 3CNQP 2JC1A 3GG0A 4DL0C 5F9LA 3NBPA 4MKVA 4K50A 1KVJA 2MLYA 2AYEA 1U09A 4PKDB 1LWEA 1M5PC 2IA6A 1CJVB 2A10A 3D6TB 2XS5A 3KLIB 1RWWB 1WF1A 4DR2J 1SL1A 4LF5F 4CO2A 4XDDA 3NAIA 1RAFB 3NGDA 1R0AA 4J9RA 4DSIA 2OSQA 5H1SV 1IM4A 5KFBA 4F3OA 2VICA 1UEVA 3PIPQ 4LRBA 2XWXA 3QQCD 3OTDA 3M8PB 2N82B 1RBLA 3M9NB 6FDRA 1TAUA 2VBWA 3IC1A 3VGTA 4KJIA 3SEOA 4AL7A 5AE3A 3J7YI 4BLGA 1AROP 1TUWA 2V8PA 3CJTA 3O6QA 2EFNA 4PXBA 5DS7A 4CLWA 3UD4P 3CD0A 4PYDA 1S9FA 1ACMB 2VQEF 1G7CB 2XLJA 2W9BA 1YZ7A 3B6BA 2LQ9A 5KFTA 5BR8F 1S1VA 2K06A 4O3RA 2FQQB 2VJUA 4KGKA 4DU7A 2OPRA 2ZOGA 1SKUB 3A8JA 2BEFA 3H20A 3MEGB 3PYGA 3AOCA 3BF4A 4ES3A 2HLUA 1KFDA 1YJ9S 2WCXA 3MM5A 3VGSA 3HVWA 1QVFR 5FDLB 3PCOB 3G6ES 3DLKA 4K0KF 1N88A 2DH9A 2MZTA 4CO3A 2X7IA 3GIKA 1TKTB 4M5GA 3UCUP 3NG8A 1WKLA 2M7SA 4KO0A 2R2SA 1WNEA 3A3PB 5HBMA 1KLNA 2IJRA 1VHFA 2YPYA 3OFEA 3N6NA 4OJGA 2DNNA 2L08A 3JXOA 2AW0A 2KI2A 3AH6A 4K4WA 1D0EA 1RT4B 3IWLA 2XY5A 2UU9J 1VBYA 1WUUA 2ZH4A 1W26A 3U27A 3D66A 3M8WA 4DFKA 3M2UB 2KYXA 2RU3A 4QIEA 1VFJA 4J7CA 4B3SJ 3S7RA 4PAAA 2AKWB 4YN3B 3HHLC 4DV6F 3IS9A 1EJ7L 3I96A 2XCAA 2AQ4A 2CPZA 5HATA 3R1HA 3CDUA 2GQQA 3M4XA 4NXMF 4I0WA 2DGSA 2DITA 2GZOA 3L4BC 4NL5A 3S1TA 3MOZA 1N5TA 3BYPA 1HNXF 2EFOA 3WQPA 3FSYA 5I42B 3BGFA 1JMTA 2A0FB 2ZH3A 3K7RA 1B70B 1HNIB 1RKJA 1RA6A 1QAXA 2C2MB 2OAUA 5B0EA 4DPUA 3CCQS 2DHGA 7FDRA 4Q2LA 4CLPA 4Z7CA 2ZKUA 3AAWB 4C11A 4KH1B 3EYZA 3NS6A 5LMUJ 2POKA 2KL8A 4JI6F 4ZP6A 1LWFA 1PIEA 3D68A 4DDFA 2UUBF 2F8MA 4ZPWR 3J7ZT 4YUDA 1IR0A 2CXEA 2ZH7A 5CYQA 4DSFA 5ETSA 3GFXA 4WE1A 2E1MC 2CWXA 1EQMA 3NAHA 1KDNA 4M5NA 5D78A 4KQZA 5HVGA 2UV8A 2D3OR 2G1DA 4JV0A 4OX9J 1NXIA 1X4EA 5KFKA 3HZEA 2CPFA 4U96A 4CNZA 3HD1A 3ZTSA 2QL9B 3W5YA 2M8HA 2MY7A 2OGUA 3RAMA 4X64F 2Q6BA 1CC7A 3CO9A 4WJBA 3KMQA 2DIUA 2HQFA 3BQ2A 3BGUA 4DWIA 2UXDJ 1IXKA 5GADU 1TVRB 3LWMA 3HSJA 3PY8A 1S48A 2D7SA 2GX8A 3H98A 2ZH5A 2OKQA 3JSMA 5H9EJ 2KXHA 4JV1A 5F0WA 5GAEI 4CZCA 3QPIA 2V4RA 4ED8A 4ZVUB 4TQRA 1URNA 2MSTA 3K2YA 3V6DB 3ISNC 4CTAA 3UN2A 2HBQB 1GAOA 5B0FA 4CH0S 3Q8QB 2XLIA 2GVZA 4DV2J 3K5MA 1SKSA 1HWJA 1OWXA 2R8GA 2R7VA 3AFGA 1J5OB 2PMWA 5K14B 5KFJA 1WC5A 2MHEA 3FK4A 4FP9A 4R5PA 1TFWA 4JV5J 1U45A 1RXOB 1S1TA 3SCLE 2MZJA 3D67A 5THWA 3A1YG 4RUAA 1X31C 3QYYA 4IFYA 3EUNA 3UO0A 1XN9A 2AD9A 5KFZA 2LEBA 2DGUA 3SXLA 1RT3B 3P45B 2PI5A 2JRSA 1TL3B 2HQDA 3HHDA 3AY0A 2A1BA 2H3EB 1RLCL 5T41A 1Q0NA 3EJMA 1T9UA 3DNCA 3TUIC 2VQEJ 4DR7J 1KKHA 1E6YA 4GMKA 4ZP7A 4IR9A 2YY3A 5C25A 4DJBA 2OPQA 3FSXA 4OZ0A 1WC1A 1PYTA 2VC0A 1RT5B 5GAGU 1IBCB 4ZVSB 4ANCA 3AXKA 2CPHA 2LQ8A 4P9SA 2EFPA 4X66F 4QWDA 4QU6A 2YKPA 2P9CA 3NMAA 2V69A 5FJ4A 4Q5VA 1S1XA 4ED4A 2G13A 3ENQA 3Q24A 2WONB 2UU9F 4FYYB 3RBDA 1Q5YA 4X4NA 1DY3A 3GIIA 2ZDOA 4I7FA 2LECA 4ZHRA 2WB4A 1PKUA 1F3FA 1VLYA 2WVFA 4GVBA 3QBCA 4OHVA 4ECTA 2O5DA 1HBUB 1VS3A 2XYPB 1HBOB 3GYGA 3PRBA 3TR5A 3DLBA 3L7UA 1KOHA 1LFWA 3DGPA 5ETKA 3NNHA 1CJTA 1FNMA 2Z2ZA 2V2ZA 2ZH9A 4NLYA 3K5OA 4WP9A 4JI7F 4LFBF 4ZVOB 2BA9A 2BYCA 2CFXA 5C42A 2K1RB 4GC6A 2M2BA 1YWXA 1LWCB 4WK3A 3PW4A 3P96A 3KJNB 4NI2A 3KLGB 2W8LA 1VC5A 4Q0BA 3MAAB 3MR2A 3U1LA 1HHQA 5A8KB 2IAJB 3TUJC 2B7BB 1SJ1A 2ZUAA 4P75A 1RGVA 3RG6A 2YNGA 1RK8A 4MT1A 4BBYA 3RJMB 1IBLF 1VJQA 1UP1A 4ZLJA 4JI5F 1N34J 1S77D 4M5DB 2QEXS 4YS2A 4NXNJ 4EI2A 2VZ9A 2GIQA 3CCRS 3OTEA 2P6TA 4OI3A 3SQGB 3E51A 2ASYA 3NS7B 4Y3CA 5DDOC 3V6DA 3MGJA 1HBNA 2BKOA 3BR8A 2DEJA 1JKHB 3Q89A 4I6WA 4P52A 3VVTA 5ADZA 1G6BA 4O0IA 1U1RA 1UW9A 3PR4A 3G9CA 1JXVA 1RTDA 1OYEA 1FK9B 5L8RC 1VQOS 2QMUB 1SI9A 2OPPA 3VTIA 5A8WA 5SZTA 3ZZZA 2OMOA 3DLJA 2NYHA 2W4DA 4WYLA 4M5LA 1YJRA 4U8YA 4R5PB 4XO0A 3H2UB 1ZA1B 2NLWA 3KG1A 4LR9A 5M2RA 1SIWB 3W9HA 3RZAA 4ZJOA 2H51B 4X84A 3UR3C 1TKZB 1MMLA 1MWQA 4GO7X 4C8KA 8AT1B 4C6AA 2E5LJ 3JTOA 4RWXA 2HYIB 4C8YA 4QYZJ 4WK1A 1BXNA 4HT7A 3RB0A 1U0HA 2BJEA 3DXBA 1XMOJ 2RKIB 3ILLA 4WF9Q 3QO9B 1RWUA 1T94A 3HHLD 4FXVA 3HKZD 4LSLB 3DYAA 1RT5A 4C98A 4ZITA 1R0AB 4EBEA 4B9NA 3K5NA 3FCHA 4LF7J 2V9KA 1WTFA 3AOBA 1PC5A 1T9YA 2XZDB 3LGHA 1RT2B 3DLLQ 4HVZA 1HLWA 3M6UA 2VG6A 2ZVIA 1M90T 4BWMA 2E7XA 4OJ3A 2D1CA 3DOMB 1DQAA 2LXFA 1HW9A 4UOCA 4PXEA 5KFXA 4ZVPB 5B08A 2HVIA 4ED2A 2GQCA 4EUVA 1QLNA 5LL6d 3NNAA 4HH0A 3M30B 2ZOMA 3AA8A 3IR5B 3I0SB 4NEZA 4P2FA 2MLZA 5J2PB 2FVRA 2CQ4A 2EI5A 3QMQA 2HHPA 3I82A 4W92B 2CQ2A 4B3TJ 5E5NA 5DGBA 3FBEA 4E2FB 3HVTA 1VMBA 3VAJA 3R27A 3UCZP 2HGLA 1U47A 4O4RA 3DHWC 7AT1B 4JI1F 2ACMA 1VCTA 4ECWA 3T1HJ 4M94A 2AYBA 1UFKA 2KVQE 4NLXA 1SBRA 2DHHA 1GQEA 4LF1A 1H7XA 1CEZA 2LDYA 1FRLA 3A12A 1UL3A 2PFDA 2KYZA 1HARA 2EPIA 3N6MA 1RT4A 4NI2B 3KLGA 4EZ9A 1RWMB 4OLPA 2HFUA 4LR7A 4ZVFA 1KEKA 5CAAA 1WHVA 1NO8A 2V4JA 1KHWA 3CJSA 3GR0A 4FKXA 1RDRA 1E6VB 1SC6A 2GAHC 3AQOA 4OHWA 3C15B 4X62J 2AHOB 2GMLA 1UVNA 2CADA 2XNRA 1N32F 1Q7YT 3M32A 4OX9F 1WF2A 1X9WA 2UXCF 3G82A 2JLEA 2KJVA 1HBNB 3W2WA 4DFMA 1X8DA 2O67A 3GJQB 1WACA 2DXEA 4A8OA 3OJUA 1U1NA 3W61A 4LMZA 4DPYA 4ANDA 3KK3A 2DGXA 1Q86T 1T7PA 2LQ5A 2VPZB 1U02A 4DR7F 1FJ7A 2E5HA 4IKAA 4DX7A 4DS5A 1N33J 2WSEC 2DNKA 4C11B 2BJ1A 1NBEB 2C2ZB 4IFVB 2HHUA 1FX2A 5C24B 1LW2B 3G71S 1FRHA 4U67Q 4FYVB 2AEJA 4NCAA 2GO9A 2ZBQA 3UVJA 3NGUA 4ZA1A 3LOUA 2WBMA 2XMUA 3FFIA 1C1CB 2I1RA 1K1QA 3SCIE 4F4YA 4B9SA 2B7CB 4DLGA 3CC7S 5HMWA 3JS9A 1RHKB 3A3OB 4IG0A 4NLOA 1M5HA 2IYIA 4O3OA 3RR7A 1XQIA 2XZTB 3GTYX 3NRBA 4PR6A 4PUOB 2OFGX 4K4UA 2YWFA 2KJWA 3T5HA 4K8RA 4J9MA 1ICEB 1UZHA 1W2IA 3JYTB 1ZZNA 1S0OA 1VK3A 2R42A 4JV2A 2PIIA 2QE5A 4OYIA 2OEKA 2HNDA 3MD3A 2VG6B 2IMWP 1H2UX 2FHOB 3M1VB 1ZPWX 1A0OB 2V34A 5KFAA 3RW6A 3C46A 1YJTA 3OV7A 3OT9A 1NCLA 2AV5A 3C19A 4H4MA 5KFHA 4Y6IA 3JSMB 3C16A 4PQAA 1DURA 1BMQB 1KVKA 2NZCA 3QT5A 4ZLLA 3RAXA 1SJFA 4UY8T 2PMHA 3UN5A 2HWIA 3P5BP 3CF5Q 4H4KC 4P74A 1C4AA 3G86A 1SJRA 1VRTA 4IH6A 2X1AA 4ILLA 3EZOA 4ZS6A 1UTAA 1RHQB 2YWKA 2FHJD 1U24A 2IM2A 2K3IA 1VBKA 2Z0GA 3B54A 4I2PB 3MUVP 1SL0A 3B8HA 1MMNA 1N6QB 2R8JA 3DM2B 1S99A 4LF9J 2UVUA 2J8SA 4JI0F 1YI2S 4HT5A 2QX0A 4DG1B 5F9NA 2NXJA 1VK8A 3AJ2A 1B0VA 1GXLA 4HI1A 2YNHA 4P72A 4DV0F 4OYAA 3H4DA 1NSAA 1Q8KA 4J9VA 4CH1A 1UA1A 4ECQA 1IWGA 2IPOB 1U7LA 4V1Ak 3OHBA 2L9NA 2VPXB 2XSJA 2O66A 3TZWA 1M1KT 3G8TA 3MM6B 1KNZA 3T6JA 2XYGB 8ATCB 5LSLA 1QAJA 1HI8A 3OL7A 3DOLB 5G0RB 4MMOA 2EC0A 3ZZPA 1ZAXA 1PJ6A 2RS8A 4M5MA 2J9CA 4ES1A 3NOCA 4TQSA 3OUYB 2XO6A 2HWTA 1V3RA 2Y9HA 2ZE2A 2ZHOA 1SJ4P 4OI4A 1PJ7A 1HD0A 2EEYA 2HQIA 1NDLA 2QRRA 4JI3J 3R6GB 2I5JA 3DRSA 4Y0FA 1A7GE 3G87A 5BYRA 4ECUA 5LJ3Y 1AFJA 2HLTA 4YHHJ 2RDDA 1NSKL 5LMUF 1DTTA 4R0EA 4X62F 2UUBJ 2MPUA 2K7JA 1D9AA 1U2CA 2E7WA 2RT3A 2AYMA 3KLVA 2PT0A 2BOPA 3CXCR 4MK8A 3JAMY 4C4WA 2L3MA 3GSIA 5HQ8A 2DO0A 4H4OA 4WCEQ 4J9NA 4CLSA 4QIGA 5CXTA 2G0IA 1RJJA 1FD8A 1BGXT 4Y2AA 1R43A 1UVLA 1UCNA 3MR6A 1H2TZ 5KG7A 2GVDA 2HVDA 3IAS9 1ZAWA 3M8YA 2FHKA 3I9V9 4WIQA 5KG3A 5IV3A 4U6PA 3AODA 2CJAA 2SXLA 4DUZF 4DR5F 3QJJA 1CSJA 2RF2B 1U8SA 4QWEA 5KT2A 1QSLA 1D3WA 4FXDA 4I64A 3IAM9 3GU0A 3SI8A 4Q45A 4AXJA 4I1TA 4IO1A 2D9PA 2AGOA 5F41A 3OSNA 3EWGA 2O1PA 3H2LA 4K4ZA 3M2RA 5GVQA 1CULA 2ZEJA 4JI5J 2YQ0A 4FVCA 2CWKA 1V5VA 7FD1A 1DRZA 2F5GA 2CZ4A 3EGZA 1DARA 2AWZA 2BVZA 2QLJB 3VAIA 2FVSA 2C2DA 1HPZA 4UW2A 1VRUA 1C0UA 2XBPA 2IC3B 3FGVA 1S9EB 1VDHA 5CD4H 4OYOA 4LF4F 2W2NP 3J81Y 4Q2MA 2IRUA 2ALZA 5GMDA 4EK2A 1BQMA 3KK2A 1IKXA 3LH2S 4P2XA 5L9XA 1Q82T 1AUDA 2IBKA 2IBOA 3CULA 2Y0BB 1BHNA 2B0GA 4Y2CA 2Z2LA 4RNFA 1TL5A 3AA9A 2Y8WA 1N5QA 3G2XA 4EGLA 3AJDA 4TY9A 2VB6A 4QYRA 4WWSA 3MM8B 1NJYA 1VQPS 4NA3A 3EGWB 5DM7Q 2QL7B 4OZJA 1YJNS 3WC2A 3QGIA 5G0RA 3D2WA 2NQPA 1PYOB 1JJHA 3ZZOA 4YB7A 3B82A 4DX6A 1RT1A 3NKYA 4HH1A 3QATA 2JSXA 4OZNA 1YG0A 4ALZA 3HHKA 2OO4A 1UWAA 2V8HA 3MUMP 4QPXA 4HACB 2VQFF 4LF8J 2WOMA 1Q8IA 2VPYB 3ZTQA 2C28A 4FBUA 1R0CB 3CO0P 1L3TA 2FZCB 4KR0B 3VZHA 5HMYA 1WC3A 4TNOA 3MPDA 4KRWA 2OJ3A 5KT3A 2C22A 1JLEB 1MSWD 1UJ5A 2JL9A 2DK2A 4RW9B 3OXFA 3UDCA 4A46A 3H59A 1A9NB 2HRYA 2IIHA 5AT1B 4ANEA 2F4VF 2W24A 4MK7A 3IO1A 1TL1B 2XMMA 5CYMB 4D3HA 1S6UA 1EARA 2ZUGA 3GE9A 1NPKA 2F40A 5E3QA 3MM7A 5KT5A 4ECRA 3NEKA 1JLFA 1NK6A 2XULA 1XMQF 1FFWB 4OZ5A 3OFFA 2UVWA 3PKMA 4WU3A 2HBYB 4TYAA 3AJ1A 1KP6A 3LAMA 4I2QB 5CD4A 2QFJA 2BR0A 3Q8RB 4P73A 2E1RA 3QZ8A 1VBZA 2E1PA 2F63A 3KUEA 1T95A 3MPUB 5ETPA 4NASA 4MYTA 2AJ2A 1VQ8S 1RAEB 4UUXA 4X2BA 1OYDA 2XCPA 3KKFA 2HBRB 2CQ3A 2IFXA 3H2VE 1LW0A 4DV2F 4F0HA 3IM8A 3ZTPA 2J6TA 4C8OA 4C8MA 1YJVA 3KG4A 2W25A 4FXWA 2CIMA 1FKPA 4N8NA 3PFOA 2B3TB 2MQMA 2BRKA 3I9ZA 3GIRA 4CLFA 4C8NA 4UOFA 2DGTA 4ZKAA 4UTGA 2DT9A 3D3CJ 4JI2F 1DQ8A 4LF2A 4IRCA 3P5TL 4RWWA 2F1FA 1UVIA 1S1TB 3DN9A 2LMIA 2FJEB 4XTTA 4ZCKA 4DPXA 2XO7A 4CCHA 2XLKA 1T0TV 2HVHA 3T1YJ 3V81B 1DQ9A 4QZVB 4K4SA 2LYVA 2RD5C 2HS0A 2ZBRA 3CCWA 3UD5A 5I3UA 1EHWA 5K20B 2BRLA 3BH6B 3MI7X 2X3DA 2EFVA 3KYLA 3UI3A 4DR6J 1VR6A 3LP2B 2MDAA 1FXDA 3N4WA 3LW5C 2OPQB 4CLZA 5C25B 2DXFA 2YX1A 1C0TB 1YRUA 3Q8UA 2F8HA 4NLWA 5A6WA 1Q79A 4X66J 3HFZB 2QYCA 4K59A 1VI7A 1XC9A 4X4VA 2EXUA 3HT3A 1EETA 2N4DA 2V67A 5H9FJ 4DEZA 2GGPA 3BR9A 2KT3A 3T19A 1RTJA 1MU2B 4DHVA 4HHUA 3CCTA 3C6UB 4QBUA 1WG5A 2J76E 3KWMA 1N5YA 1G1XA 2ADBA 1WOPA 1HMVB 2EBEA 4OZLA 4CO5A 3QJPA 3LPEA 4NLTA 1NDPA 5KFGA 1CPZA 2W9BB 3J80Y 2ZOFA 2U1AA 5ETVA 2BX6A 2VFRA 1XMBA 3D6FB 3THVA 1JLCB 1HL6A 2LU2A 2HFVA 5AE1A 4GC7A 4A8YA 2VF3A 1N33F 2KFZA 1WELA 1ZS6A 1O5JA 4Y34A 2DXDA 4G1QB 2LA4A 4PPDA 2HW3A 1H0HB 3BQ1A 4F4AA 2R8IA 4J90A 2R3VA 2FGOA 2OEMA 5KFDA 1QSSA 3OLAA 5IC4B 2ZJQQ 1MLAA 4LQ3A 2VL1A 1NK9A 4A8MP 4C3KA 4FF2A 1FJGJ 3CJKA 1OY8A 5A8KA 1RQ0A 3OTBA 4OZ3A 5A0YB 3MUTP 2V68A 4TU9A 4CI0B 4QR1A 2CJ9A 3VGUA 4I56A 4TU7A 2QLXA 4J9OA 3V5RA 2YH0A 2FLPA 1KBRA 5E3CA 4OQJA 5GAHI 3CJ2A 4Q44A 2JEJA 1LW0B 1PGZA 9RUBA 2VHGA 3CJQA 5DDQC 5IFMA 2L9DA 4ZIWA 2BE2B 3H42A 4O3PA 1N4LA 4Q8FA 1U2FA 2KVIA 5D0EA 1QD1A 1RT6A 1FFGB 2OMLA 2EFQA 3GCWP 3P8BB 2AJQA 3H40A 1CVJA 5K8NA 1RAHB 4RBVA 3N6LA 3V81A 1Q7LB 1LWFB 5DLFA 5FLXU 1SJ3P 4ZOSA 1T9XA 4HI2A 1GXUA 3K8WA 5L39A 1IBKF 3Q2TC 4GKKF 3MF5A 2AZ1A 2MXYA 2MKKA 1OMSA 2HMIB 4H4KA 4DL3A 2HQ3A 3JAMU 4IO9Q 4CM0A 4IQXA 3MMAA 3THTA 3V6HA 1TR0A 2LCWA 4OYWA 3U1MA 3F73A 3VZIA 3MCOA 1P8GA 3W66A 1NPRA 5EWGA 2IM0A 5IT9Y 4WXWA 2VDIA 4QOTA 2V9WA 3MPWA 3VGVA 2G0CA 5KFSA 5LSRA 2FJVA 2BJDA 3KDNA 3KOAA 3NMRA 4IOAQ 5HANA 2J6UA 3LWLA 2HZAA 2GJ2A 3D6MB 2K8GA 2DRBA 2CPDA 2DNGA 2YKMA 3TQEA 2DD8S 1NH7A 1RTJB 3TUPA 3O8WA 2RNEA 1U6FA 4IYQA 8RUCA 2CJXB 2HRTA 2UZAA 4A8FA 1CLFA 1X4BA 2MY8A 2B43A 3QT7A 2ADCA 3C66A 2OPSA 1TTHB 3QIPB 1K73T 1FF2A 1SUQB 2V8DA 3CWJA 3KHGA 2JEIA 2DIVA 2NUHA 3I5AA 3LANA 5DLGA 1FRIA 3NNCA 1JLCA 3CCUS 4USUA 2DEIA 2M3DA 1L3VA 3I87A 1YQHA 3GG1A 5D4NA 4ZCMA 1TP7A 2HSEB 2LEPA 1I94F 2PEHA 4Y2MA 4K4TA 1U1PA 1BQXA 2J7WA 4AYBD 2OIHA 3NY0A 2MQLA 4PG7A 2HKEA 1C0UB 4OI6A 5KG1A 5IXUA 3BO3A 2DNZA 2GMJA 3GWCA 1H38A 1HHTP 2CJKA 4LBIA 4PQUB 3LP0B 3T5LA 1BD6A 4RU2A 3DGVA 4TVAB 2V4JB 3E3XA 2FGCA 4CTAB 2DY1A 4QYZK 1TUGB 2OFHX 2PA8D 3HLUA 3PRDA 2LDIA 1IBMF 1CQMA 4LVOP 2HHHF 3GJTB 3L95X 4DL2A 3ILIA 5M2UA 1S0MA 3CJ3A 5C5JA 1XR5A 3VVUA 3G8SA 1B7YB 2OP5A 4NA1A 3FRZA 4QIVA 5J1EB 3S8SA 1UVMA 5HVHA 1IKVA 2VBZA 3OD2A 1KQFB 1OIAA 3TAMA 3PEHA 2UUWA 2IMOA 4JB8B 3GILA 3CMAS 3G6VA 4RUCA 3WC0A 4ZHRB 1NJIT 2KRRA 2WW4A 1V5IB 3CGIA 1S76D 4UOHA 3FBFA 3D9BA 4DBQA 4LSNB 5KTQA 3IA0A 4DR4F 1SCJB 1GMVA 2P8IA 3DXSX 3F0NA 4LJMA 3SMZA 1CC8A 1J2VA 2AJ0A 2HFNA 4EFAC 4HDHA 4GRSA 4KHPF 3A8KA 3BM7A 1FTRA 4KYZA 1I5OB 1RCXB 2UUAJ 4DV5J 2K1RA 2DNQA 2EBGA 5KT4A 1FDBA 2B9YA 1CS4B 3EPGA 3ITHB 2FJXA 3ILOA 2JJ4D 3EZUA 2DNOA 3ET6B 3PRVA 1X0FA 3GYNA 3GZ7A 1H3DA 3JSBA 4PEOA 4RJVA 2ZH1A 4OMFG 1CJUA 4AD6A 4H4MB 4LFCF 2M5YA 2N4CA 3BGLA 1WOSA 3QNWB 2CQGA 2GHVC 4USHA 1VGYA 2AU0A 1C1BB 3ZZUA 5B09A 2YPZA 1HNVA 3ENAA 3M6WA 2MQPA 4LQ9A 3VF0B 1F6TA 2H4YB 3GCXP 4LREA 5ETTA 1NNDA 4OV6A 2N7CA 1YKWA 5B0AA 4CO1A 2GC8A 1FK9A 1DBDA 2CJQA 3MM5B 1FX4A 3RUBL 1I6JA 3RRGA 4I2PA 3ZC4A 3MAAA 1NKEA 1WKJA 3I56S 4L72B 2WW8A 4DUYJ 5HBMB 3R8YA 3W5ZA 4CNYA 1LKZA 2WSFC 3MCMA 2HG4A 4LRCA 5EWFA 3M6XA 5K9FA 2K3KA 4EO8A 4QW9A 4PQUA 3CEDA 2MKYA 2BDPA 2E5IA 3D3BJ 4NMXA 3IXQA 1XMQJ 4MK9A 3OLBA 2QLBB 4C3MA 4YMEA 1LXNA 2QV6A 2YX7A 3KDOA 3I5CA 1H73A 1K44A 1DLOB 3JSYA 2XY7A 2R8KA 1Z2LA 2XEXA 1QM9A 4FDFA 3H25A 5IV4A 1UJ4A 3K5LA 6FD1A 3OBIA 5KAKA 3BDEA 2VIHA 5DETA 2VFUA 1S1WA 3IBFB 3LP1A 1DJ0A 1IWAA 3DKDA 2VOPA 3H5SA 1S9GB 4DR1J 3WIVA 3R5GA 2H48B 3M9MB 4B3MF 1FKOA 2V5HG 3TVZA 3C6UA 1N5YB 1LK7A 1KFSA 2CVIA 2VG5B 4DR2F 5DQIA 2CVEA 3K57A 2FLLA 4JI3F 4LF5J 5HQMA 4F4ZA 4Y65A 2HHTA 2I5JB 1HWKA 2WVDA 3FBBA 2WZ1A 1YRXA 4I4BA 1NB2A 5J2NA 5J2QA 4OI2A 1VQSA 3D28A 3DFEA 2LU1A 3M30A 4OYPA 4JV5F 1Y10A 2OD6A 3CD7A 4ZK7M 1LOUA 1TL4A 1RTIB 1YZ6A 2WK4A 4WE1B 5HK4A 3H4BA 2R9LA 4LRDA 1D1UA 1N36F 4OZ2A 1FA0A 4X4OA 2VPWB 2AIRB 5F3TA 3KLFB 2F65A 2Q79A 1S5ZA 2AX1A 1G3OA 4OZ1A 4WFYA 3PX6A 3BN4A 3JTNA 3UQSA 3PX0A 6AT1B 3S6EA 1QUPA 4OV1A 4MAKA 5J2MB 4FS1A 4JI4F 4URGA 1X5OA 1JK9B 1XEZA 1WWHA 2CNOB 2RQMA 1Z2ZA 2VQFJ 2IM3A 4ZPVR 5EGYA 1JJ2R 1DHMA 2Y1LB 3TARA 2FY8A 3UDEA 4RUHA 1G2EA 1Q78A 3M32B 3N5FA 1RHMB 3K8VA 2FYXA 2PC6A 1PCAA 2RS2A 4DU8A 4JYAJ 1JNZB 1IQTA 1WEYA 1X5PA 2G4BA 1JIHA 3MECA 3BYRA 2CQ0A 1X4GA 1JQGA 1RE1B 2ZITA 3D1HA 4R25A 2MMYA 2ZH8A 4J9LA 1TK8A 2R7TA 4EBDA 1B99A 4XDCA 1G4CA 1PSDA 2BOAA 1FVQA 1KHVA 3QLHB 4HR2A 1YIJS 3IRXB 3H7HB 5D4PA 3U7JA 4PWDA 2VODA 5HAOA 4FYXB 2BW7A 1DAXA 3W60A 2E9RX 1HWUA 4X4TA 2UVRA 5LJ5Y 1WG4A 3LALA 3KLIA 3O3LA 2NZ4A 4RX6A 3B4DA 2ILZA 4BCAA 5HP1A 1PJ5A 3TANA 2B6AA 1D09B 1OO0B 3OQ2A 4YP3A 5D8HB 3MEEB 2RRNA 1CJKA 2CZ9A 1SXLA 1R8BA 2Z57B 4DSEA 3LP1B 1RWKB 3ISND 1F9HA 2FD2A 3QWPA 3VV2B 3ZZRA 1RT1B 2HNDB 4WBFA 2YH1A 3FKBA 4RBUA 3C3LA 3JQJA 3PJ9A 1T11A 1GK8A 2E9TA 3ONQA 2HVZA 4L74A 1LWEB 3VAFA 3MPVA 3ETMA 1ZM2A 2I2YA 2DNPA 4GVBB 1VRTB 4JP8A 2ZBCA 4O44B 4RZRA 2NSBA 2BV3A 4YDDB 4ZCIA 2M4MA 3Q2SC 3VCDA 3MWBA 4CQ1A 1RUSA 5ETRA 2RRAA 2R7XA 2E9ZA 4TYBA 4ZIVA 5IQ6A 1S6OA 1FJCA 1UEKA 1WDDA 1LWCA 4L3NA 4D3GA 3NWRA 1VQKS 3HULA 1T9WA 2C3PA 2YWHA 4TLQA 5G4DA 1VQ7S 2WRMA 2DR7A 4ICLA 4KAIA 2C2NA 2B56A 1WSRA 4DL6A 1RBOB 1YK9A 1WSVA 3M7VA 2RVJA 3I32A 5KFIA 3H8YA 4ZLPA 2DR8A 1YVFA 2W2OP 4KY3A 3E2EA 3DOLA 4KO0B 3UPFA 1VQ6S 1KR4A 4A8QA 1A6LA 1S7IA 2M88A 4KC5A 2IYGA 1RT7A 3IR6B 3N28A 3PKYA 5D3GA 1TELA 1S0NA 2BQRA 4L76A 1RAAB 2QT7A 4UUWA 4ES2A 4F67A 5B0DA 5CYJA 3QAEA 2IDLA 5L1LA 1H98A 1Q4RA 2YNHB 1NK7A 5HI7A 1PBUA 3KTQA 2VOOA 4X4UA 1U1OA 4WU2A 4OL8A 1OS5A 2XSJB 4JBCA 1WDTA 2MQOA 1L3KA 2G0JA 3FQKA 5IWAF 4EYHB 3M8QA 4BHQA 2D69A 1YJWS 2XS2A 1AFIA 1TFYA 4ZDNA 1T05A 3DOKB 4GKJF 3GB0A 1FWKA 3CD5A 2NPFA 5F8NA 2MZSA 5E33A 1F3VA 2HQCA 1YBUA 2KHDA 3VWSA 2PEBA 4WFNQ 1IBLJ 4R0JA 3V4MA 2Q1LA 3FRYA 2CYYA 3E01A 3DYAB 4G6VB 2PMZD 5J1PA 4AQYJ 1HNIA 5HROA 4LIWA 5GAGI 1WHYA 5C7PA 5EN1A 3GQCA 3IWXA 3DDKA 3I4HX 2B9XA 2IVMA 3JSRA 2ZH6A 2HFSA 3D4JA 1RT2A 3OXLA 2RQKA 3KXDA 3T6BA 2DR9A 4O3QA 2HAFA 2BM0A 3GJRB 1N32J 4DQRA 3EDRB 3M6VA 4C0BA 4LRAA 4B3MJ 3GLJA 1VIXA 3GIJA 4MKBA 1ZM9A 2BJ9A 3D54A 2UXDF 1LNQA 3B4MA 3DHXA 4MKYA 1M5OC 1MW7A 1HNVB 2QTWA 1Y9OA 2JOQA 3SYZA 4YQWA 1IR1A 1YLXA 4KGVB 4DG1A 2VA3A 1IN0A 1UWBB 2DGOA 3N9UC 2IVFB 1ULRA 2RUSA 5F8GA 1RB0A 3W2VB 2DHAA 2HGMA 1UZDA 2P6SA 3BS9A 3W62A 2VKZG 3TJ9A 2KM8B 2W2MP 2B5JB 2YKQA 5E3RA 1R3NA 3SSQA 3NL0A 2KHCA 4IFYB 4IH7A 4NLQA 1HQEA 3IWNC 1NZAA 1NHUA 2RJZA 3LA0A 4X65F 3J7YU 4NMLA 1QVGR 3BJYA 3LPYA 3CJKB 1U49A 4KHMA 4UOGA 1RTHA 4O23A 1OQ3A 4RW4A 2L41A 2EVZA 5HSPA 2R8HA 1Q1KA 2CPEA 5KOXA 2FVPA 2YXLA 3BQ0A 3CUNA 2GVZB 1NKCA 1N36J 2QLWA 3R5AA 5BJRA 4RNNA 1CULB 1U1QA 5D15A 2FHJA 2HNZB 2B9EA 4I67A 3HXMA 2R2TA 3MD1A 5T7LB 3HKWA 3PJWA 3G82B 1HR0J 3MR3A 2OTJS 3TX8A 3J7A1 4CLTA 1ZETA 2V6AA 1HPZB 2LA6A 3R7SB 1OPZA 1FDNA 1R89A 3QIDA 1NU4A 1TKDA 2DPIA 4NYPA 1TL3A 1I94J 5KOWA 3TQ1A 2JEGA 2CNKB 1KQKA 4GKKJ 5HLFB 1JLEA 2J0XA 5KFVA 3ENVA 1P9YA 3P3DA 4C0HA 5CA5A 2NREA 3TX0A 4B17A 1HBUA 3QGGA 1HBOA 3EMTA 3FFIB 3FZBA 2JEFA 3CDAA 3DU5A 1TUVA 1YTYA 1OY6A 1J27A 1VC0A 3TAPA 2AYGA 3HVAA 4UZBA 1JLGA 4M5HA 4OIXA 1SV5A 3BB5A 1TL7B 3E01B 4PXCA 5GADI 1T8EA 2IY5B 4ED6A 4F0MA 1WF0A 2YKNB 2Y1RI 4UF4A 4DCJB 4A8SA 4DV0J 3DRRB 2RH3A 3PTWA 2UUAF 1VQLS 1RADB 1TK5A 4RL1A 3UCGA 2QA1A 5DG8A 2RU9A 3HDSA 1LXJA 1NLKL 3DLEA 4WXOA 4MTPA 2BM1A 3IFEA 2MLXA 1IKWB 4LBHA 4LVNP 1M5VC 3FBCA 5E2QA 3FC9A 3RBXA 4FN5A 1SKWA 1M5SA 1CJTB 4BC7A 3KUGA 3EXCX 5DO2A 4PG8A 2BBEA 3O2IA 3QT8A 5KFFA 2BKNA 2Q43A 3RYLA 3CIMA 4EEYA 4YOEA 1JWWA 1FVSA 1NMEB 4ETZA 5C42B 2V2VA 2CPIA 1NM2A 4FNHA 3FEYB 3VAKA 3QRQA 4MKAA 2MQQA 1RWNB 4AQYF 4EBCA 3EXYA 4QWCA 2PDAA 1Q5VA 1LWXA 4NYOA 4RO0A 1PYSB 2YVSA 3FEZA 4YHHF 4J9PA 4AXIA 4DI6A 4ZVRB 3KJVA 2RRBA 1R6VA 3SFGA 3GP9A 1REVB 3IM9A 4ED0A 4B9MA 1XERA 2J0WA 1PAEX 2J7UA 3B78A 2Z4PA 3BH7B 2XHCA 3GJSB 2KH9A 1P9QC 2MYFA 4B9UA 2VD3A 4NLUA 2GA7A 3CMQA 4ZP9A 2ZZMA 3FMBA 1TKXA 2HNZA 1Y00A 3N79A 5GMEA 1ZOTA 4O4GB 3OL6A 1RACB 5LXRA 1B0TA 1F60B 1N5SA 2MSSA 3QZ7A 1OQ6A 2MKIA 3C6TB 1SC1B 3G8QA 3W65A 2RSQA 3U1NA 3T1HF 3OUYA 1NK4A 1HNZJ 2NSCA 1BQNA 1HMVA 3BSOA 4KE5A 4ELTA 4QWBA 2FPHX 1EAYC 2BANB 4FF3A 3R7NB 5E3PA 1HFEL 4M5JA 2W4CA 3EGVA 2J9DE 4IOBA 1K1SA 2AZ3A 5HMXA 3OTOJ 2RIJA 5HLFA 3AB2B 3HFKA 2OH2A 1EKRA 2CPXA 2COLA 1VIOA 2I38A 4K5RA 4LSLA 4YR2A 1ROFA 2MQ8A 2N3LA 4QU7A 1QE1A 2MGZB 3EX7B 5DM6Q 2CNNB 2V50A 3TEHB 3GIMA 1GNKA 1D8ZA 1H6KX 1PG5B 2QYGA 4QQBA 1O0PA 4NZ7A 4ECYA 4ED5A 2X51A 1WEXA 2GGPB 2MQNA 3C8YA 3IR7B 3CCSS 1FHTA 1TL7A 1EB0A 3CB4A 1NKBA 5KFUA 3HFVA 2HZCA 4EZ6A 4DF8A 5LMNJ 2ZKTA 3EZ5A 3R97A 4M63A 1Q95G 3ITHA 3C2PA 2ATLA 1NJXA 3M8ZA 2GVDB 5KFOA 2XSFA 4J9QA 2Z30B 3SZ2A 1M1GA 1S1UB 2XNQA 1U1KA 3HX9A 5C2CA 2H65B 1IKYB 2RB7A 2V8VA 5BXIA 1SB6A 1XMOF 4YY3F 4F8RA 1U4BA 2WVBA 1ITPA 2IRXA 3R5DA 3H5XA 1EQ0A 4P71A 4KTQA 2XQCA 3HSGA 3W2WB 5JJBA 3OL8A 5KFLA 1TU0B 4MJKA 5KG6A 5LT5A 2RE1A 3NGTA 2D9OA 2A6MA 3S01A 4DR6F 3ETOA 4X4PA 3KNAA 3DRPA 4XPEA 4R8UB 1HI1A 1U6BA 1U25A 1RHUB 5K8OA 4P6QA 4Z37A 2Y1IA 2GIFA 1UW4A 5D6GA 4N41A 1B3TA 1E6VA 2CPYA 3Q8VA 1KLMA 1K8AT 2HS3A 1YJUA 1NRKA 3PDNA 3MM9A 5D4LA 2U2FA 3UR0A 1UAWA 3VHQA 5HVFA 4B3RJ 3BGRA 5MAOA 3DOKA 4FVMA 4LF6F 1C1CA 5AJ3J 1LK5A 2BE2A 2C3OA 2B51A 2RUGA 4ZVHA 4DSKA 2HIYA 1GMUA 1P1TA 3KLHB 1MN7A 4F2SA 2GJFA 1K0VA 3SIPB 3D7SB 2HHSA 1WORA 3HI9A 4PXDA 5JXSA 5FLXY 1TMJA 4O4GA 5L38A 5IWAJ 1FFSB 1RAIB 1ZPVA 2QFIA 4X65J 3N5BA 4NYZA 3FVYA 4LSZB 1S9GA 3GV5B 3HPOA 5L1JA 1HBMA 2NYIA 1U1LA 4LF9F 2Z2MA 5A6PA 3M1VA 5D0RA 4HACA 2WOMB 1YBAA 2NXCA 3AOAA 3UE2A 3HVRA 3A3NB 3W7BA 1WI6A 2B8PA 3ISZA 4LBPA 2C2OB 1WHXA 1Y3KA 3RRHA 3UN3A 3RAQA 2W9CA 3IGNA 3BBCA 5EUHA 3H5UA 2ZM6J 2OPRB 3DRYA 4NLPA 2CDQA 2NXNA 4HHHA 2OI2A 2AF6A 3RR8A 5CYMA 4AUKA 3RBEA 1BE4A 2RQCA 1WEZA 4RW8B 4DS4A 3ZNJ1 4H54A 4XK8C 2RDJA 1ZTTA 4HKQA 3K58A 2D3O1 2AJ1A 1X9SA 4OI0A 2W01A 1UFLA 2LFVA 3D5MA 3L9ZA 4FF1A 1YX2A 2BUNA 5U47A 2OPSB 3QIPA 2VG7B 4MFBB 2CQHA 2H54B 2B9WA 2PGCA 4PRFA 5L46A 5KFEA 1UVJA 3JQMA 3L7PA 3IG1A 4NLRA 5E41A 1NPPA 4JI8F 2VFVA 2LXIA 2IA0A 2OLWA 4KGZB 2MZ1A 1M5KC 5L1IA 1U48A 1T02A 5FDLA 2W7AA 1FTCA 2HK3A 2XM3A 4RBTA 2AP6A 2AJFE 4C9DA 2N7YA 1EKSA 1LFPA 4A8KA 1Y7PA 3HZGA 2FJBB 1F5AA 3AHPA 1IKVB 3A4TA 1U1MA 3QJLA 4IH5A 4CP5A 2M52A 1KTVA 4CLLA 3Q8SB 3LP0A 2ZE2B 3BGOP 2MZRA 3K17A 2C2KB 3Q83A 4OYBA 3IBCB 4DL4A 3M2UA 1FESA 4F26A 1L5UA 3R3TA 2YTCA 3MURP 3FCWA 5ITHA 1C2PA 1MN9A 3G96A 3T3FA 4PYAA 4ZVGA 1NK8A 3UD3P 2BW2A 1AZSA 2EG2A 2HNYA 2WB1D 3SCKE 4B3OB 5HMZA 2KT2A 3QSIA 2P9EA 4UQGA 1WTBA 4OHYA 1X0PA 2R7QA 4C3LA 3MEKA 5J1EA 5D4OA 1Y3JA 1S6QB 3DC2A 4YFUA 1FI4A 4QPTA 5ETQA 2IDEA 4NLDA 4DFPA 5ETNA 2MEWA 3W5XA 3MEEA 5KT6A 4EMDA 3OVAA 3CJRA 1VQ9S 1FERA 3T5KA 3MTKA 4OYMA 1H72C 5DG9A 3PJXA 3C14A 2DPJA 3OTOF 4C8ZA 3J81U 4DV6J 4ECSA 2CUYA 2CQIA 1R8CA 2KFNA 2DHXA 4ETXA 2EK6A 4F3QA 1CJUB 1DTTB 2M9KA 1FE4A 3ILJA 1KQSR 1VQ5S 1Q8BA 1F2GA 3PYEA 3FUYA 2PI4A 4M5KA 2XB2D 1OJ4A 3AD9C 3THPA 3BDPA 1XJWB 2ASJA 3HM9A 2CQPA 5E0OA 3FZ2A 3V6KA 5HP1B 1R31A 2AEFA 2E5JA 4H4OB 3HJFA 4ERDA 1N0UA 4O44A 3MR5A 1UJ6A 1RHRB 2CKWA 5LMNF 3W3SA 4Y2KA 1C4CA 1KSPA 4K7QA 4G1QA 3UFCX 1HNZF 2QA2A 1NHVA 3D1OA 2FVQA 2DRDA 2VH7A 4LT6A 2CJBA 2YNFB 1XNQJ 2ZVSA 1TVRA 2HBZB 1VRUB 3CT9A 2Y3YA 2FVCA 4WTYA 2UUTA 1S6PB 1UMJA 1U2RA 2BJ3A 3ZTOA 4ECVA 3I0RB 4MFBA 1OY9A 5K8PA 2HGNA 3SDEB 3EM1A 3D1QA 1RKIA 1X5TA 3V6JA 2BE9B 2M70A 4N8OA 5K14A 3BREA 3KG0A 5A2QU 2LLZA 4KGMA 3OVBA 3TVYA 4L73A 1FWLA 2X3GA 1VQ4S 1DFDA 4ID5A 1FKOB 4ZCLA 1VBXA 4WKRA 4RNHA 5AXMA 1BQNB 4USMA 4Z2XA 1AW0A 3CW2C 4CO0A 9ATCB 2E66A 4CWBA 2ZZNA 2EFGA 1HWLA 1FT8A 1RP5A 2ATCB 2APOA 2DNMA 4ZJLA 3M05A 1MWZA 3Q0AA 3PHTA 3OFGA 4OJ1A 3GFZA 2L48A 2XWYA 5IOLA 1AZSB 2HNYB 4CRJA 4F3MA 1VJWA 3BO4A 2DB1A 1MG7A 4OYZA 4RU9A 1WI8A 2HPUA 1R27B 2RHSB 3W64A 2AGPA 3PW2A 4F4KA 4EO6A 2IHR1 3KLFA 2X1BA 4IRDA 3RTVA 4QR0A 3X1LB 4NRUA 1BWVA 4TY8A 2FLNA 2L9WA 2DJWA 3DMJB 4DR3J 1MROA 3TNVA 1YRTA 2WBRA 2VA2A 4ZMMA 2YKMB 3KK1A 1SC3B 1GMWA 3AQPA 1VQNS 3DDIA 5ETMA 2R4FA 1S1VB 3R9LA 5F8MA 4URSA 4F4XA 2HHHJ 2VU5A 4P7VA 3HMJG 3IN5A 2ZBIA 1R6YA 1UETA 1FKAF 1S72S 3I4PA 3KFWX 4UY85 5JVHQ 3QWUA 1GEHA 3OSPA 1N56A 2Y8YA 2E5GA 4DQIA 1D9DA 3MEDB 1M1HA 2BJ7A 1KQGB 1FRXA 4USJC 2DY9A 1QTMA 4Q0BB 2NS1B 4DL5A 3BO2A 2O01C 3KNGA 2DNRA 1KC8T 2B5JA 3PX4A 2JHEA 3US5A 2ERRA 1HNWF 1NK5A 1T03B 2R7SA 4ZP8A 1EP4A 3OR2A 4CM2A 3RBZA 3T5JA 1K9MT 2R7UA 2KXFA 3N01A 3KLEB 1LQ9A 1NK0A 2KU7A 2QL5B 1SQGA 3BGRB 4Q43A 2QSFA 3RB6A 3V4IA 1NJWA 1NB7A 2QMXA 2H4WB 4ZLNA 2JFKA 2ZZTA 2RKIA 5RUBA 5DG7A 1R8PA 2J5AA 3MMCA 4G1PA 4LR8A 5CZXA 1RWOB 5K5MA 4DX5A 1WG1A 3KLHA 5GAHU 4KSEB 2LEAA 4RLEA 1V3ZA 4DV3J 1B4SA 2OPPB 2UUCJ 5A8WB 5A8RB 4A8WA 1HYSB 1CJKB 4URQU 3MR7A 2YQ1A 2WVEA 4L3KA 4RW6B 4F4WA 2HFZA 3J80U 2D3ZA 3GV7B 5B0BA 5DGAA 2RAQA 2E1AA 2Q3PA 4Y28C 3OPKA 2QN6B 2VC1A 3SCJE 3F56A 4KGXB 5I3UB 2HURA 2X1FA 3DOMA 4F0KA 3ZZYA 3GR1A 1S59A 2YNIA 4KV8B 2FC9A 3MAHA 3OTCA 3NS5A 2C1EB 1WJ9A 4KPYA 2I6WA 2XGPA 2WSCC 3UNGC 3NCRA 5KG4A 5CZVA 4ZVQB 2CQBA 3TA1A 3ZZ0A 3CVKA 2B6AB 2DCUB 4F36A 3KHRA 4FS2A 3GMGA 3RB3A 4U7UD 3E8OA 2Y1JA 3OR1A 3QSYB 4QW8A 2XMJA 1GFWB 2HAIA 1KD1T 3O1LA 3H0PA 1RWVB 3MOJB 1MNEA 1IVZA 3BKUA 2LQBA 2Q66A 1VHIA 1XIQA 3KJQB 2XHWA 1RCOB 2YKNA 4LIRA 1VISA 2KT5A 2XMAA 1ZTWA 2RMLA 3DMJA 4X64J 1SC4B 2BXJA 5DJBA 5HQLA 1WHWA 3W8GA 3Q22A 3FCVA 5H9FK 3L09A 4EU0A 1N48A 4A4JA 4CLYA 5LSOA 1YITS 4DQSA 4DSJA 4PCQA 4FKYA 4O0NA 3J7AN 4J5OA 1IBKJ 4IUFA 2V2KA 2JWNA 5IC6B 4PPZA 2AEMA 2C3YA 1SQFA 4FNIA 1JJ4A 2MHNA 1Q81T 1GX5A 3PW0A 2XYHB 3ZO7A 3LQVA 4KFBB 4BWJA 5KFYA 2DNLA 2GNKA 3BKFA 4KPCA 3TZYA 1XWLA 2HS4A 2HZVA 3RB4A 5HN0A 4ELVA 5A0YA 5K8MA 4UQTA 1RBAA 4KKOA 3EPIA 3UDVA 2DVIA 3AT1B 3G6YA 1Q8LA 4ICLB 5DQHA 1T03A 1NJZA 2H9ZA 2W2PP 4WZQA 3LAKA 2VFSA 3FSIA 3PFEA 3UVJB 2QGFB 1Y5LB 4XAKA 5LXYA 1LEOA 1VYAA 3DDNA 4GVLA 1FNOA 1VRQC 1L3SA 2HMIA 1B7FA 3PM9A 5GAEU 2F9JA 2I9SA 1O51A 1W2BR 3PW7A 1RT6B 1RT7B 4IG0B 3NLCA 5HJXA 3P49B 1REGX 3ADAC 2IJNA 3KK3B
chains in the Genus database with same CATH topology
3CCES 4HEA9 1S1WB 1D8YA 1ZAVA 2BABA 2HIQA 5AXLA 4IFVA 2DGVA 1AXQA 1TV6B 2KB2A 2OD4A 1URRA 2GCFA 4ZPTR 2PFFB 3IRWP 3RW7A 2W8KA 1B0PA 2C2RA 3HHNB 3TO8A 4ED3A 2VASA 3CCZA 3NBPB 3QAUA 4PWUA 3ZFVA 1RA7A 1X4DA 2NPIA 1FDAA 4ECZA 1T05B 2F9DA 3MMJA 4O3NA 3DRXA 2CZVC 2LVWA 2QIFA 2J9DA 1FEEA 3TYTA 1LV5A 3HO1A 5AXKA 4U9RA 5L9NA 2ASDA 3RR7A 3TI0A 1ZM4A 2DBBA 2P5VA 3NCQA 4N47A 1RTIA 5KFRA 2ZM6F 3F44A 1S0VA 1F0XA 2YKAA 5IZHA 2ZFHA 2IAJA 1U1KA 5B0CA 3VQSA 1N5VA 1JJ2R 2FLOA 4WIIA 4WFXA 4KT0C 4OI1A 5F3ZA 3SSRA 4B3TF 5B7WA 1SKRA 4I69A 4M5DA 5DQGA 1S6PA 3OVSA 2D3UA 2LKZA 2JVOA 3PZPA 2Q6CA 3LUYA 5J2MA 1S1UA 3SDEA 5KT7A 1SJQA 1KTQA 1JKHA 1Y4ZB 2IRYA 4DUYF 2EG1A 3T9ZA 4NZ6A 3I55S 3MM6A 2UVVA 3DLKB 4C8LA 1N54B 2KRBA 5T14A 2E1CA 2H5EA 1TAQA 2PE8A 1N6QA 2FJAB 3FDSA 2CQCA 2GW8A 3CJ5A 1N52B 1F5CA 3SSSA 4K2XA 4ID5B 3I6PA 4YB5A 3DRPB 1WD6A 3CCMS 2ZDPA 4PG4A 4CT8A 2RDIA 2QZ8A 4IDKA 4XIUA 2XMKA 4AL5A 1FE0A 3IRXA 4WFAQ 4OHXA 4DR1F 3OJSA 4LUBA 4PWDB 3FNNA 2WAQD 4B9TA 1VQYA 4ID8A 1N34F 1PC4A 4LSNA 1HWIA 4QR2A 3CSKA 2HHQA 2DTJA 4MIWA 3TOQA 4B9VA 3NP5A 4M95A 1JLGB 5KFCA 3I5BA 3OW2R 3R1LA 5EX0A 2KM8C 1TK0A 2MKCA 3SV4A 4YEAA 5I3QA 2J9EA 4RNOA 4NX9A 5KFWA 3G4SS 1FJEB 4F2RA 1X4AA 2YQ3A 1VQ6S 4RNMA 4HYKA 3J7Z5 1TV6A 2EK1A 4MIAA 1JLBB 2BQ3A 4BS2A 4IG3B 4QIFA 5KFQA 4MYUA 4NWBA 3DI6B 3V2UC 1TZ0A 2XS7A 4YR3A 4ELUA 3G6XA 5CYQB 1NAQA 2KG1A 3H5YA 1I1GA 4OLOA 5I4MA 1HQUB 3KHLA 2CG4A 5IT0A 2J7KA 3TA0A 2ZJPQ 1FXLA 2MJUA 5M2PA 3AB4B 5F8IA 1J5OA 4PG5A 2VUGA 4Y00A 4RW8A 1QAYA 3VAHA 1J5EF 1X4HA 3CMES 4K4YA 2PD1A 4E8UA 1FRJA 4X4SA 2MB0B 1XK8A 2YX4A 2D41A 4HTJA 1S9EA 4B9LA 4WFBQ 3O44A 3CPWR 4RKUC 3SV3A 1XR7A 4NA2A 2AGQA 3HF5A 2FJDB 4TLRA 3GFYA 2A3JA 3JTPA 1DLOA 1Q16B 2VFTA 5DRKA 4DPOA 3I31A 1TKXB 3MM8A 2HFOA 2E44A 2PN6A 1Z1ZA 2FLLA 2K2PA 5EHHA 1TK5A 4R5PB 5CH7B 1HYSA 3K5PA 1ZZFA 2HHUA 3CIZA 5CCMA 2ZHBA 3EGNA 3KHHA 3CCVS 3C6TA 1O8BA 2MJNA 4HHJA 1RT3A 1LW2A 1SH0A 4ZPCA 1REVA 3CCLS 1IJFB 1FO1A 2UUCF 4IDKB 4MIBA 1BQMB 4NPOA 2BANA 1KS2A 2WHOA 1RAJA 2C3MA 3TP2A 2HHWA 4KV8A 1E6YB 3BZQA 5BYQA 5J2QB 2DGWA 3RU0A 2GO8A 1NEEA 3M8QB 1BY9A 4OHZA 2A2DA 1QLNA 1ZBTA 1TL1A 4KB7A 1X4CA 1TQLA 5GMKa 1N8RT 1Q53A 3IBWA 1MMDA 3OL9A 4QWAA 3M9OB 3JB9k 1VOMA 2JC0A 5KFMA 4O3SA 2VV5A 4RW7A 3TUZC 1B64A 1IUJA 4I68A 2O3DA 4YDXA 3M8RA 4IOCQ 2DISA 2RQ4A 4WFZA 2PSZA 4I7FB 3VAMA 1JLBA 4K5SA 4PG6A 4IR1A 4DR3F 2YNGB 2DR5A 1U26A 2MKJA 4OX7A 2GHWA 1IKYA 2EWHA 4DQPA 3MEGA 4DV1F 1R8HA 2XI3A 3LF0A 4ILMA 4FPRA 2FJWA 1F5BA 1JLQB 2NUUG 4NCGB 3SQGA 4Y2IA 3MM7B 1D9FA 1TKTA 1H2VZ 2GMHA 2QMWA 4HDGA 1FKPB 2QO3A 4IQMA 2JZ5A 1HW8A 5DDPC 3VAKA 3N0VA 1F9FA 4KFBA 1XNRF 2G9OA 4BC9A 4KBIA 1RTDB 3PHEA 1UWBA 4M1KA 3TRGA 1XNQF 5F8LA 1UFWA 5IM0B 5KFPA 1P1LA 1X5SA 2P9GA 3GYXB 4ZPBA 2JX2A 3MZIA 4AQYF 5E7OB 1IQZA 1KLMB 3LO3A 3IS9B 4U7UK 4CT9A 2GQ2A 2DRAA 4RW4B 1MWYA 2F3JA 3BEGB 3LP2A 3DLHA 1UEUA 4F50A 2XZWA 3MAQA 4QIWD 4YR0A 4Q8EA 3P6YC 3MECB 3KMSA 1PILA 1HA1A 3BN7A 5BYSA 1UA0A 3PO4A 4IRKA 3MXHP 2YWGA 2ILYA 4WZMA 3U02A 2PO4A 5HL7Q 4A47A 1XBWA 3FEXB 3ULHA 2YH1A 1QAIA 1HBMB 3QLHA 1MU2A 1QY7A 4X4QA 2OSRA 4K4XA 3MM9B 1T3OA 1TKZA 3M2VA 4HTIA 4C2MA 2R2RA 4QCLA 3BSAA 2DH8A 2KXNB 2R7WA 1H7WA 4HL9A 4V19X 2ZHAA 4Q8FA 3A8EA 3PW5A 3PV8A 4NLGA 4N56A 4AFFA 4LF8F 2KZMA 3VR1A 1SIZA 1C0TA 5F8HA 4KHRA 1ZM3A 3I0SA 5J2PA 4ZVEA 2KTQA 2HWHA 4AE5A 1SQEA 2ACYA 3ICLA 3PXGa 1EETB 3TW0A 2HHVA 5IQQA 1SV5B 5IT4A 4B3SF 5HO4A 3PNIA 1CG2A 1VC6A 4I6YA 2RF2A 4RW7B 4ITSA 2GHPA 3CJ4A 3FMWA 2QSWA 3KK1B 2MKSA 1GXTA 4DFJA 4ZPDA 2CQ1A 4X4RA 2W9CB 3UWTA 4DV4F 1BWEA 1P27B 3MMBA 2NR0A 1X7VA 3IG1B 3DLEB 2XMTA 2ASLA 1Y5IB 4CH7A 3ENWA 1L3UA 2C3UA 1S7HA 1APSA 4L6V3 1JLQA 2IM1A 1IJEB 4JOUA 4NCGA 4OX6A 4TN2A 3CD6S 3CDBA 1JLAA 2FIUA 4N5SA 1FJGF 2B4PA 1GX6A 1M0SA 3MEDA 3F41A 2I0XA 1Y5NB 2IC3A 2YWEA 3VAGA 5D3GB 4ZPAA 1YGYA 3QGHA 3Q23A 3KK2B 5CHCB 1IKXB 5IM0A 3HK2A 2B4VA 1CQNA 2XY6A 3KJVB 5C24A 2KG0A 3OR2B 2KZZA 4P7TA 3UW1A 3PR5B 1GTEA 2JDJA 2FC8A 4G1IA 3OXGA 2QA4G 5JVGQ 1XR6A 5HROB 1S1XB 2V8GA 3OHAA 4ILRA 2XMWA 4LFAF 2DNHA 4OFZA 3WZ0A 4EWTA 1FRKA 2ZNZA 2ZD1A 4CIOA 3PACA 4IG3A 1RYSA 1SH3A 3M2VB 1PO6A 2AX0A 3CDWA 3L3CA 4FBTA 4B3OA 2UXBF 2V0NA 1JB0C 3HHLA 3IGVA 2FY1A 1RYRA 1FNXH 1S6QA 1OPIA 1V6HA 1JLFB 1FXRA 4NRTA 2VONA 2LQJA 1QE1B 2MGZA 1FD2A 2KO1A 3OR1B 4CO4A 1RI7A 2FB0A 5EX3A 3M8SA 3GV8B 3JYTA 4I2QA 1Q82T 2D74B 4TXSA 1FDDA 2ABYA 2F8EX 3W2VA 3CTRA 4A48A 3M8PA 3K0JA 3DM2A 3MHYA 4I6AA 2Z8QA 1U6ZA 1HQEB 4YB6A 3WDOA 4W90B 4JUZA 2OTLS 2XG8A 3I0RA 1HI0P 2JLGA 1N0VC 1SH2A 2LXUA 2GFFA 2DH7A 1ZYQA 4NXNF 1KVIA 5I3PA 1UKUA 1V9OA 1DTQB 2IJFA 3FQLA 3MMBB 3X3UA 2BZ2A 2R7RA 2ROEA 2A18A 3GFHA 2NXUA 3D0GE 5DDRC 3K59A 2ZC3A 2VBXA 4N77A 5T7LA 4AL6A 3NCPA 2YKOA 4MH8A 2XC9A 1VQMS 4N76A 1FCAA 1QJHA 4U7CA 4F25A 1JNRB 4DMZA 3BSNA 2J8AA 3DU6A 4ECXA