5IM0B

Crystal structure of the rna recognition motif of mrna decay regulator auf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heterogeneous nuclear ribonucleoprotein D0
publication title Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5im0B00
2XS7A 3VAGA 2CPFA 4Z2XA 2KG1A 3CCUS 2N82B 5LSLA 2LA4A 2MZSA 2DGXA 1X4GA 4WCEQ 1B7FA 5LXRA 1VBXA 2ZJRQ 2KT5A 2MZTA 5BJRA 1YIJS 3MUMP 3J7YU 3ZZZA 1VC5A 2O3DA 2E5IA 1VC0A 3DXBA 3THPA 2CQPA 1M5PC 3HI9A 4C7QA 1U1MA 1U1KA 2MKHA 3H2VE 3EGNA 5GADU 3MXHP 2MHNA 4W90B 1N88A 1NO8A 1WHWA 3CCRS 2RQ4A 2OTLS 1HD1A 3S6EA 2AD9A 3J7ZT 2YH1A 5DM6Q 3U1MA 1YWXA 3S8SA 2Q79A 2JVRA 2CPXA 2KU7A 4WFNQ 2MQNA 1VQ5S 2XNQA 4TU8A 2MJNA 3CC7S 1JMTA 1WEXA 2DGUA 5IFMA 2XB2D 2HGNA 1KOHA 3I56S 2MZ1A 1X4EA 3B4DA 3CF5Q 2CJKA 2DHSA 1WWHA 1SJ3P 4ERDA 2OIHA 3CCMS 2I38A 2YH0A 3BO2A 4P6QA 4OZ0A 1A7GE 1F9FA 1R8HA 2CQHA 3CMES 3VAIA 3MD1A 1ZZNA 2A3JA 4Y00A 1VQ8S 2LMIA 3IWNC 5CXTA 2FC8A 2MPUA 2NZ4A 1X0FA 1U1OA 3G8TA 3P6YC 3CD6S 1YJWS 1U2FA 3V4MA 1U1RA 3UWTA 1FJ7A 3SDEB 2DITA 1K8AT 2MKIA 2DNGA 1FJCA 1WHXA 4UY8T 2RRBA 1YJNS 2MQMA 4TU7A 1VQKS 1OIAA 1X4FA 2HVZA 2MYFA 1QVFR 2DNKA 3UE2A 1WEZA 3THTA 2U1AA 3G6ES 1X4CA 2VOPA 2RVJA 1M5KC 1RKJA 4IOCQ 3VAMA 1OO0B 1M1KT 3HHNB 3TP2A 5EN1A 1WEYA 2DHXA 5MLCV 2CQBA 1H2UX 2DH8A 4FXVA 1YHQS 5IM0B 3NMRA 2UP1A 3UD3P 2NLWA 3VAFA 1VQ7S 2RS2A 2CQ1A 2ADBA 1OWXA 2N7CA 4IO9Q 4LIRA 2KYXA 2KH9A 4LMZA 3SXLA 2WBRA 1VQPS 2N3OA 3PIPQ 2XNRA 3RW6A 2CQDA 3P49B 2U2FA 2RU3A 1WI8A 1X5PA 3SMZA 2FHOB 1VQOS 2CQ4A 1WG4A 2KFYA 3G9CA 1U6BA 2M88A 1D9AA 3U1LA 2ADCA 1WF2A 2CPEA 1X5SA 1H2TZ 2MMYA 3NS5A 2BOPA 1X5TA 2LECA 1UFWA 1DBDA 2FPHX 4IOAQ 2CQGA 2EVZA 4PKDB 2LA6A 5LJ3Y 1Q86T 2CQ3A 3UCZP 2D3OR 3CCES 1PO6A 3US5A 2F9JA 2DNHA 1KOOA 2DNNA 2MY8A 3OW2R 2KRBA 2J76E 1M5VC 3ZZYA 4QU7A 3VALA 2CPYA 2OSQA 2YKAA 1X4DA 2F9DA 2MGZB 3CXCR 2HZCA 2D9PA 5JVHQ 1U1QA 2MQPA 2J0QD 2SXLA 3JB9k 5HO4A 5D78A 2QA4S 1W2BR 4WIIA 5DDRC 1URNA 1X4AA 3B4MA 2QEXS 2J8AA 2X1BA 2MXYA 4ED5A 2DNQA 3BS9A 2CQ2A 1JJ4A 4PRFA 2XS5A 4FXWA 1SJ4P 2MKSA 4YOEA 1FNXH 4F02A 4WFBQ 1NJIT 1D8ZA 5GVQA 1X4HA 2DH9A 2BZ2A 5CYJA 2MKJA 1VQ6S 4EGLA 1S79A 2M8DB 4WKRA 3CUNA 3CMAS 2LKZA 1M5OC 1FHTA 3EGZA 3RW7A 4TU9A 2RT3A 5LSOA 2L08A 5CA5A 3BO4A 1YI2S 3FEYB 3MUTP 1FXLA 2DNOA 3LQVA 2EK1A 2OTJS 2XSFA 5GAHU 2MB0B 3K0JA 2KVIA 2ERRA 2JVOA 2LEBA 4F25A 2QFJA 2X1FA 2B0GA 2DNYA 2KHCA 1WHYA 2MZJA 2ZJPQ 2FY1A 3D2WA 1N8RT 2XS2A 2LQ5A 1ZZFA 3IRWP 2HGMA 3I55S 1HA1A 1JJ2R 4UQTA 1G2EA 2DGVA 1Q81T 1H6KX 2E5GA 4W92B 1QM9A 1X5OA 2DNRA 5HL7Q 1KD1T 1P1TA 2YWKA 4CIOA 3G96A 4PR6A 2MSSA 3G4SS 5DDQC 2DGWA 2KM8C 1DZ5A 3NNHA 1ZH5A 2L41A 2GO9A 4C0OC 3CCQS 3CPWR 2DGOA 2MQOA 2N3LA 2CPJA 1FT8A 5IQQA 1NU4A 2PE8A 5GAGU 3CCVS 3MOJB 1YJ9S 2RS8A 4OZ1A 4C4WA 4A8XA 2E44A 3FEXB 2DISA 1DHMA 2DIVA 1R8PA 1HL6A 2JRSA 1WHVA 2MY7A 1YITS 2VODA 2MJUA 2LXUA 2D9OA 3NS6A 3BO3A 2VONA 4J5OA 1FJEB 3MI7X 3VAKA 3CULA 3UCUP 2M0GB 2OSRA 2RRAA 5DM7Q 2AYEA 3VAHA 3S7RA 1XN9A 2DNLA 2KRRA 4YUDA 3CCJS 3LPYA 2RNEA 5H1SV 3UCGA 1M90T 4QQBA 1WG5A 2DH7A 3NNCA 1P27B 2DHAA 4Y0FA 3CCSS 2CPDA 1H2VZ 2G0CA 2KN4A 2CQIA 5GAEU 2YTCA 3Q2TC 1KQSR 2OJ3A 5GMKa 4QPTA 2LYVA 3P3DA 2MZRA 1FO1A 2PEHA 1VC6A 3SDEA 3BEGB 2DK2A 1CVJA 2AYBA 3VF0B 2DNZA 2KXNB 4IUFA 1WF1A 3MD3A 3MDFA 2DGSA 4QU6A 2LXIA 2AYMA 4TLQA 1VQMS 2V94A 2MKCA 5LXYA 3R1LA 1SXLA 2M2BA 3MURP 2KXFA 2KG0A 2MSTA 1K73T 4CH0S 2K3KA 2CQ0A 3P5TL 1KC8T 2JX2A 2KM8B 3N9UC 1SJRA 2MKKA 1SJQA 2J0SD 1RK8A 1Q7YT 2F3JA 2HGLA 3H2UB 2KI2A 3TYTA 5IM0A 3CC2S 1U1NA 4ZKAA 3CCLS 1UW4A 4WFAQ 1VQLS 1A9NB 2CQCA 5LJ5Y 5DDPC 2MZQA 2DO0A 2GHPA 1U1LA 2E5HA 2DNPA 1QVGR 3CTRA 2CPHA 2M9KA 1DRZA 2HYIB 1O0PA 2I2YA 1S72S 2FC9A 3ULHA 2LEAA 5DDOC 1AUDA 4M5DB 1K9MT 2DB1A 4V19X 4WF9Q 2M70A 1HD0A 2RQCA 1IQTA 3L3CA 1WG1A 2CPIA 4U67Q 1L3KA 4BS2A 4LJMA 1X4BA 1N52B 2JWNA 2M52A 3S01A 4YB1P 3CC4S 2DGTA 3Q2SC 5D77A 2MQLA 2VOOA 1WELA 2MGZA 2AYGA 3TO8A 2G1DA 1BY9A 2DNMA 2M4MA 2MQQA 1U1PA 3DLLQ 1SJFA 1OPIA 1N54B 2E5JA 3VAJA 5FJ4A 1VBZA 2CPZA 2DIUA 1WTBA 3MUVP 4CQ1A 3G8SA 3EX7B 2ZJQQ 5ITHA 5JVGQ 2M7SA 2DO4A 2KXHA 2L9WA 1YTYA 2LCWA 2X1GA 4F26A 2K8GA 1UP1A 2X1AA 3R1HA 2M8HA 2DGQA 1Q82T 1JJHA 2RUGA 4CH1A 1VQ4S 2G4BA 3G71S 1UAWA 4RU2A 3PIOQ 1U6FA 1WF0A 3R27A 1VQNS 1WI6A 3NNAA 5DETA 2DHGA 1VBYA 1PGZA 2EK6A 1VQ9S 3UD4P
chains in the Genus database with same CATH superfamily
5KTQA 3VAGA 2IRYA 4Y28C 4O3QA 1YRTA 2BR0A 3Q22A 1VBXA 2W01A 4EK2A 2ZJRQ 3I5BA 3MHYA 4PABA 1CPZA 4DJBA 3I0SB 3H2VE 1GH8A 2XO6A 3CDEA 4M1KA 3W62A 1P9YA 1G3OA 3WZ0A 4AT1B 3DU6A 2ZOFA 3PRVA 1F2GA 1SC6A 4RU9A 2YX4A 4X4SA 3CC7S 3V6HA 4F36A 3PCOB 3I56S 3I6PA 3UN3A 3RB4A 3MM8A 1SJ3P 3N6MA 2VPYB 5IOLA 1PYTA 1CJKB 4HYKA 2HHSA 9RUBA 3IR7B 4RW4A 2HNZB 1HWLA 4HT7A 2HBQB 4TXSA 3TAPA 1BWEA 3NXZA 4CO4A 5J2MB 2RHQB 5CYMB 2XGPA 2HQFA 2W9AA 2I0XA 3EYZA 3BH6B 2YY3A 2ZUGA 2WB4A 2F8MA 3FK4A 3IGNA 1UCNA 2BKPA 4ED2A 4IOCQ 5HLFA 3M2RA 1SL0A 2WSEC 3NMRA 2D41A 1HARA 1AZSA 3DOKB 2J6SA 4CP5A 4MYUA 4K5RA 2DBBA 2NXCA 1NZAA 4WIQA 4YB5A 1DQ9A 2K2PA 1IKVA 4OHYA 3H5UA 1RT7A 2JEGA 2YWGA 5G4DA 1X5TA 4LF6F 2HSEB 2PMZD 1TUGB 2WONA 3G2XA 2CKWA 5KAKA 1UETA 4HACB 4LRAA 1XMOJ 5M2UA 4Y2CA 3W2WA 4RLEA 2MQPA 6AT1B 3MWBA 5D78A 5DLFA 3TZXA 2JOQA 1N33J 3PJ9A 4LR7A 4HVZA 4ZHRA 3MEEA 2C1EB 2CQ2A 1SJ4P 4DV5F 2VC1A 1VRQC 2Y8WA 4J9VA 4DHVA 4ZJLA 2ZHOA 1JXEA 4Y6IA 1RISA 4DZ6A 1V3ZA 1MSWD 3N4WA 3PYGA 1AW0A 1FHTA 5CD4A 3QT6A 4F50A 2E5LF 1BQNB 2H4YB 2BBEA 1SH2A 2H48B 1HWIA 5EGYA 4W92B 4TQSA 3G96A 3I0RA 1SQFA 4C98A 3J7Z5 1NU4A 3WC0A 4C2MA 5L9XA 4K4SA 1F9EB 3MF5A 1RLCL 2MJUA 4LF4J 2OAUA 3KOAA 3OSNA 2ZBPA 3OL9A 5IZHA 4FF3A 1SKRA 1XEZA 1UJ4A 3ZXWA 3K17A 2RHSB 3HPOA 2OH2A 2W7OA 1RUSA 3Q2TC 1YJ7A 1IBKF 2JNJA 4WTYA 2BE9B 3SDEA 1NHKL 1I3OB 3SV4A 4I0WA 1TL1A 2DGSA 5G0RB 2CXEA 4ZPBA 5CHCB 4TY9A 2GIRA 1Y9OA 1GXTA 5KOWA 2Z0GA 1VR6A 4YS2A 5JUMA 4ELUA 2GQCA 3W2VA 3L95X 5B0FA 2Z2ZA 3AA9A 1S1VB 5HQ8A 4GO5X 1C1CA 2RDJA 4DUZJ 1I94J 3FCVA 4M5DB 3NG8A 2KZZA 1HBUA 2VH7A 1PIEA 2CYYA 4WZMA 2M52A 4LF5J 3SCJE 1XIQA 4FZVA 1QE1B 2YVSA 3BSNA 3J81j 2DIUA 3MTJA 1S6QA 3IO1A 5HVHA 1V3RA 3NWRA 2I5JA 1T9WA 1WF0A 2XBPA 2YNFA 4DR7F 1NPRA 4X62F 3DLEA 5B0CA 2AQ4A 5HQMA 1U26A 2KT5A 3D0HE 3LP1B 1LK7A 2B5JB 2ALYB 1LWFA 3NP5A 5KFHA 1RT5B 4ZVTB 2MDAA 2O5DA 2RIJA 1UVNA 4Q7AA 3RRKA 3EGWB 4TYAA 4I2PB 1M0SA 4OYAA 1E6VA 4CYUB 3U27A 4MKAA 1KHWA 5EX3A 2QL5B 3CO9A 3LWLA 2Q43A 4WFNQ 4N47A 3PEHA 5C2GA 4GKJJ 2MLXA 1J5OA 3KUGA 4CM0A 4I56A 4ED8A 1TP7A 4ED3A 2GFFA 4O4GA 2W2NP 2FHJA 5RUBA 4Y2IA 2W2QP 3DDNA 3OTDA 3RBDA 4DL5A 4B3SJ 3GR0A 3FBCA 2PA8D 3G6YA 2HNDA 1IJEB 3HHLC 4QPXA 2APOA 2E1AA 5KFPA 1EKSA 3VQTA 2HFVA 1RT1A 2U1AA 2WOMA 3T41A 1M1KT 1N6QA 2DHXA 4FXVA 2VA3A 2RU9A 2HHXA 1OWXA 1R8AA 3RU0A 2HRYA 1NDCA 4Q2MA 1JLFA 3AJ1A 3MM9B 1U49A 1S9EA 4UOHA 2PSZA 1S97A 1HNVB 4URGA 2ABYA 1JKHB 4CLYA 1JLQA 3OJUA 2E7WA 3IXQA 1DBDA 2LLZA 4X64J 1CULB 4YFUA 4OMFG 4QU7A 4I2QA 1MU2B 3OTCA 2OSQA 3OVBA 2F9DA 5L46A 2D9PA 2VPXB 2J0QD 2UV8A 4YEAA 2J0WA 3Q83A 1YK9A 4ECVA 3QQCD 1KN6A 1C4CA 2ZH6A 2BANB 4FPIA 3D28A 4WFBQ 4EFAC 5CAAA 2DXDA 2BZ2A 3L4BC 3BR8A 2YKMA 4USTA 4A8WA 1REVA 3CMAS 2LKZA 1SH0A 1GMWD 2JJ4D 2C28A 2IM0A 3HFZB 1FNOA 2OTJS 1JLBA 1GK8A 3OHAA 2X1FA 1FRHA 1X7VA 2MZJA 3CJ0A 1VHIA 3C6UB 3TZYA 1TFWA 4DL4A 4KAIA 2E5GA 5H9FJ 1RT6A 1HLWA 1XMOF 5IQQA 2PE8A 4DQQA 1LW2A 4F4AA 1RYRA 2HW3A 1Y4ZB 3TJ8A 2NSCA 1FXRA 1FRJA 3Q24A 4HEA9 2VICA 5E7OB 5DLGA 2VFRA 3BO3A 2E7VA 2OSRA 4WFZA 5HATA 3VAHA 4NL5A 1MWQA 1BQMA 1AROP 1LWCA 1HI0P 1HBOB 1P9QC 2Y8YA 3T19A 3UVJB 3DRPB 4A46A 3V6KA 1XWLA 3MD3A 4A8FA 2AYMA 2MKCA 1F5CA 3MAAB 2X51A 3D6HB 1RA6A 3N9UC 4P74A 4EBDA 4DR1J 1D9FA 3H2UB 2XZTB 3N28A 1C4AA 3KK3A 2WRMA 1GT8A 3OR1B 5K14A 2QLWA 3ITHB 3PY8A 3LF0A 4RJVA 5BXIA 1JWWA 2R7TA 1K47A 2CPHA 3PO5A 4ZVGA 2FLOA 5KFWA 2W4DA 3ZNJ1 4C3LA 1VK3A 2J9CA 4I4BA 2BQRA 4QWDA 4Y2MA 1Q8BA 5KFXA 3NCRA 2RDDA 4IR9A 5KT3A 2V63A 2ALZA 4KQZA 4YB1P 3F41A 2FGCA 5FD1A 3KLIB 1G4CA 2MQQA 4RBUA 1RLDA 4DWIA 3MUVP 3OVAA 2AF6A 5D3GB 3IGVA 1B0TA 3MM5B 1UAWA 3Q8RB 4ZVHA 2DHGA 1PGZA 4OX9J 3SSRA 2CWKA 2XS7A 1N34J 2HHUA 4NLVA 2DGXA 2DPIA 1FEEA 1C2PA 1DLOA 3H8YA 4USWA 2F65A 2VG6B 4O4RA 4DUZF 1I94F 3MEDB 3V2UC 3WX4A 2YH1A 3BGRA 2QLXA 4DFKA 4X65J 5ETOA 4FBTA 3TEGA 1OPZA 2WW8A 2IYGA 3X1LB 1NSKL 2VD3A 4HHUA 4C8YA 4JP8A 3TVYA 4JB8B 2VF3A 4CDIA 2R7WA 5CXTA 2Q6CA 3K8WA 2AJ1A 2W2PP 1KLMA 1YKWA 3M8PA 1YJWS 3MECA 5BR8J 2BX6A 3IAS9 3HO1A 3NS7B 3CIZA 4MK8A 1X4FA 3ZZRA 1YRUA 5LMNJ 1JJCB 4IYQA 1CC8A 3W5YA 3C15B 4Z7YA 3IN5A 1X4CA 4U7UD 4YB6A 3TX8A 3SQGA 2ZDOA 3TJAA 2HVDA 2ADBA 3GMGA 4QR0A 3WC2A 1FDDA 1C1BA 4NE9C 2M88A 3IC1A 4PXDA 3TOQA 1UFWA 1JXVA 1GTEA 2JLGA 3OW2R 1UTAA 3ZZYA 4CO3A 3KJVA 1RAOA 2CPYA 3OUYB 1NJWA 4EZ9A 4JI8J 2ZM6J 1FKPA 4LT6A 4IRCA 3HT0A 2GC8A 2BVZA 1LFWA 1HBNA 4FN5A 3HZEA 2WCXA 3RTVA 1IKWB 3I82A 2ZNYA 3WX8A 1OYDA 3MGJA 4QOTA 1EKRA 2XHWA 3ILOA 2DH9A 4IFYB 2IA6A 3WIUA 4I7FB 1AA1B 4KGKA 5J2NB 1ITPA 4RW9A 4B08A 2CZ4A 4X4VA 1MNEA 1U2RA 3MMAB 2D7SA 1AB8A 3R5AA 3OHBA 2FY1A 1W7WA 2HNYA 3IRWP 4OYOA 1UJ5A 4RZRA 5I3UA 5B7WA 1T05A 2PFFB 1QM9A 3A8IA 5HL7Q 1IVZA 2K1RB 1ZH5A 1H7WA 1U8SA 4EBCA 1SCJB 2H51B 4DL2A 1M1GA 3QJJA 3EJMA 2VZ9A 3ZFVA 1V6HA 4NLPA 4C4WA 3FEXB 3MMBB 4RUHA 5DO2A 1BMQB 1BXNA 3HT3A 3VAKA 3WIVA 2ZZNA 3M6XA 2XO7A 2AGPA 2RRAA 5IC6B 4ZCIA 4QYZK 1UWBB 2IHR1 3D3CJ 1HPZA 2DR7A 2CZ9A 4Y0FA 2DHAA 3TX0A 1NBEB 2V67A 3BSOA 2KN4A 1QAJA 3LAKA 4Y2KA 3JS9A 2QX0A 4RNNA 3RAMA 1IKYA 1OQ3A 1TMJA 2VBWA 4DV6F 1S1XB 2ZWPA 2A10A 1RTHA 4WK1A 3GJRB 4ILLA 4AQYJ 2ZH8A 4TLQA 2MSTA 1S0MA 4C48A 2V4QA 4CH0S 2DEIA 2NSBA 2IYIA 4KHPJ 2IFXA 3IWLA 1NLKL 1UW4A 4WFAQ 1D9DA 3KJNB 1L3VA 4OYMA 1AT1B 3DLKB 4ZLNA 4RNHA 4OZ3A 1KS2A 3GR1A 3DI6A 4XIUA 2EBGA 1AUDA 1R0CB 4DLGA 3T5LA 4IO1A 2ZOMA 3RB6A 2K3IA 4DSLA 2QGFB 2GJIA 1QSLA 2BJ3A 4DF8A 5A8RB 1D1UA 1VIXA 2MQLA 2DNMA 8ATCB 1PJ6A 3QAUA 3RG6A 4ZPTR 2QA4G 4JV0A 3PYFA 2DO4A 4H4KA 1F5BA 4HDGA 3W60A 2FVRA 1LXNA 4JI2J 4DR3J 2F4VF 4B9VA 4USKA 3HZGA 2HQDA 2CNKB 4UOGA 2FYXA 3CW2C 4E8UA 1X4GA 4ECSA 3C6TB 2YBVA 2W7PA 2R7OA 4C8ZA 4WFXA 1PKUA 4U96A 3FRYA 1QUPA 2QLBB 1CG2A 1WHWA 2EWHA 2UUWA 3J7ZT 3U1MA 1DAXA 4AD6A 1VRTA 4OHXA 1C0UB 4TU8A 3IG1B 3QT7A 1JMTA 1V3SA 4UZBA 3CCWA 2AT1B 3M32A 3CNQP 3B4DA 4UOFA 2LQ9A 1UEVA 3SBMA 3C3LA 3UDCA 3KMSA 2YH0A 3T1HF 2J7KA 2BE7D 4WFYA 2XMTA 5C25A 3I5AA 3OFGA 5LMUJ 3KK2B 4OI2A 5HN0A 4RW6B 3V4MA 1GXLA 3QFWA 3VZIA 2NQPA 1U1RA 4LSZB 2M3DA 2OEKA 2GQ2A 4OX9F 2XY7A 1N34F 2J8SA 1KQFB 2WHOA 4FVCA 1R0AA 3PRDA 1R0BG 1MN9A 1TL7A 4U95A 4WYWA 4L72B 3QSIA 2XTJP 3AFGA 4ILRA 2R8GA 2W2MP 1TKZA 2V8DA 1F0XA 4MMOA 4TN2A 2DH8A 4WXWA 1FKOA 2NLWA 3N6NA 3SXLA 4DFJA 2A2CA 4KH0B 2W9BA 4M5GA 4X65F 2XWXA 2FHOB 3MFIA 4B9NA 3RUBL 1H2TZ 2VQFJ 1JLAA 1WDTA 2HAIA 4O3PA 5B0AA 4JOUA 1M5VC 3PFEA 5AE1A 2AGQA 1Y5IB 3HHKA 4ID8A 4FP9A 4E2FB 2VA2A 2JSXA 2XLKA 2VQEF 4O3RA 1IM4A 1NKBA 4FS1A 3W3SA 2OP5A 3CJRA 4LSNB 1EP4A 1LNQA 2BM0A 3ENQA 4H4MB 3O8WA 2AMCB 3HULA 5ETKA 4B3TJ 3LQVA 1U47A 4U8VA 2ZZMA 4F25A 2ZH5A 4P7VA 5KFZA 3N6LA 1IR1A 4DCJB 3PEJA 4KO0A 5EX0A 1MMLA 4MYTA 3MM7B 3N01A 4CLKA 1B0PA 1P1TA 2YWKA 4NOHA 3VVTA 2HHVA 1Q5VA 3DCAA 4JI8F 4F4WA 1TUVA 5KFOA 3OXLA 4WBFA 3FSIA 4USVA 3P8BB 1R8PA 1HNIB 2CDQA 3DRYA 1NPKA 2HRUA 1FJEB 4C11A 2HHPA 2M0GB 3DMJA 1Y10A 2AYEA 4JBCA 4YUDA 6FDRA 1MMNA 4CTAB 2KZMA 4ECTA 2I6WA 1Y3KA 5I42B 1SC4B 5C42B 4ZPAA 1R89A 3ENVA 5A6PA 4UY85 5BYSA 1WF1A 4CO2A 2HURA 4F4KA 1ULRA 2W1BA 2C22A 2KG0A 3BZQA 2UUBJ 5H9FK 3KWMA 2VG7A 2P2CB 3MFHA 3ZTRA 3K57A 4OYPA 2P9CA 2B4UA 1QAYA 5CD4H 3GYGA 2HQ3A 4KRWA 1IQZA 2CNOB 1S7HA 3AAWB 1A9NB 1E6YB 5DDPC 1S9FA 1U1LA 2F4FA 3DGPA 1H0HB 3ZZUA 4MFBA 1RTDA 4S0MA 4PYAA 1HD0A 2VPWB 1WG1A 1X9SA 2EFGA 1IXKA 2F40A 4DPUA 3W64A 3S01A 3ZNUA 1YSJA 2CVIA 2IJFA 5EDWA 1NB2A 1S9GB 1FE4A 4ZJOA 3KLEA 1WTBA 5ITHA 2L9WA 4AQYF 1JLGB 2HKEA 5KFIA 1MROB 2FLLA 4CH1A 4G3IA 2HMIA 2DKOB 2VDIA 2HQCA 3I9V9 4P9SA 3R27A 3BBBA 3NNAA 4F7VA 1VS3A 2IAJB 2Z57B 2KG1A 4OX7A 2M5YA 2LA4A 1ZM2A 2BKOA 3CDUA 4N8OA 1NDLA 3MMCA 4DR4F 4C9DA 3FVYA 3GYNA 4EBEA 5IWAJ 1P6TA 4M8LA 3D0IE 3GFYA 3U02A 2IMWP 1HWJA 4IG0B 2E9ZA 4ITSA 3OD2A 3BYPA 4FPRA 1R6YA 1NO8A 3F56A 1ZM9A 3CCRS 4DS5A 2OTLS 4RX6A 3S8SA 1RWMB 2FGOA 2JVRA 2KU7A 1RHMB 4QWCA 2J7WA 3EDRB 1TV6B 1K44A 2ZBIA 1TK5A 2QE5A 1HBMA 2HGNA 4CNYA 3NGRA 2RILA 2IC3B 3HHEA 4OJ3A 3CCMS 1IKXA 4ZCKA 3R97A 3CMES 3DYAB 2IM1A 3VAIA 2YNIB 4DX5A 2LMIA 4J9SA 2DXEA 4DR3F 1S1UA 4KPYA 5D8HB 1U2FA 2ZDPA 4CO1A 1RCXB 4PWDB 5F3TA 2AIRB 1YJNS 4NLXA 4PG8A 2DNKA 4CZCA 3DHWC 1RT4A 2GS8A 3G6ES 2A6OA 2OUGA 5EWGA 3TUZC 3QT8A 1Q7LB 5L39A 5MLCV 1IBMJ 3FFIB 2UUCJ 2FZCB 4G1IA 2CQ1A 1X0PA 2BM1A 3BGLA 4JV5J 3K7RA 4LMZA 1CJTB 4LF7J 3MCMA 1UZHA 4NCGA 2WSFC 3CJKA 3TA1A 1WG4A 1KQGB 3LH2S 2VG5B 3D66A 4X2BA 2E1RA 1Y5LB 1Q1KA 3PG9A 1OSDA 3US5A 5A8KB 3D67A 2LVWA 1WC0A 5D15A 5HVGA 1X31C 3HHLB 1LW2B 2QMUB 2DR6A 3K5NA 1BHNA 3G86A 4OL8A 1OY8A 1YZ6A 1DTTA 5CH7B 4B3RJ 2FVPA 3B8HA 5GVQA 2L48A 4RNMA 1IBCB 3QLHA 4IG3A 4TQRA 1KP6A 2H5EA 2EKYA 1FWLA 3KYLA 4TU9A 1APSA 1LW0A 1WOOA 4JV1A 1ZA1B 2UUAJ 2KVIA 2V4RA 4LFBF 1X8DA 3JSMB 2HGMA 1LWEA 2GO8A 1RT3A 1T03A 2KDOA 3UPFA 2DCLA 3A1YG 3KDNA 2EPIA 2UU9J 1FT8A 3CCVS 5ETSA 4UZCA 4LF9J 1YITS 2VODA 4RPFA 3G8QA 3W61A 2BMBA 4I69A 3OQ2A 4EMDA 5EWEA 2B7BB 2YPYA 3NBPB 3LGHA 1TKXA 4DI6A 1N5TA 2GA7A 1CQNA 2A18A 3MTKA 3OLBA 1F6TA 2ZC4A 4PG7A 4OYXA 3KNGA 2FJXA 4LREA 2GVZA 4K4WA 3BEGB 3DC2A 2AYBA 4IUFA 1R43A 4HLBA 4O23A 4QR2A 4DX7A 2O01C 1S48A 2E29A 1O51A 1KVJA 3RJMB 3P5TL 4TY8B 4FYYB 5DGAA 2RF2A 1HQUA 2V50A 3IA0A 5A0YA 2ZVSA 1HQ2A 3G87A 2OFGX 1U8WA 3OTEA 3B6BA 5DDOC 5IC4B 1RHRB 5CCMA 4PQUB 5F9LA 4NRTA 4IKAA 3IM8A 2HBRB 3TW0A 5D4NA 4NYPA 4CLFA 1S99A 2HFNA 3TWZA 5ADZA 1CQMA 2MGZA 3TQEA 4ECUA 3HSZA 4RWWA 4KHRA 2ILYA 2CPZA 2B3TB 1VK8A 1HYSB 1RP5A 3H7HB 4R0JA 4KB7A 2M8HA 4DG1A 2Z8QA 2XSJB 3TVZA 3TUIC 5T7LB 3PIOQ 1WI6A 1FDBA 1U4BA 5HVFA 1DURA 3DOLB 2H3EB 2BW2A 3CCUS 4NPOA 4CM2A 3Q8VA 1V5IB 5J2PA 2FVQA 1H98A 2QZ8A 3PXGa 1VC5A 3D54A 1SKUB 4GKKF 2E5IA 2RDIA 3EDQB 3EVMA 4C7QA 2IVYA 2MKHA 3K58A 3EGNA 3HM9A 3O5TB 5DZ6A 5E3PA 5J1EB 5DM6Q 4DL3A 1YWXA 2AX0A 2VFTA 3KMQA 5D4PA 2HQIA 1Q5YA 4ICLB 2B9XA 2MJNA 3RZAA 4O44A 3W5ZA 1KOHA 2J9DA 3T1YJ 4JI3F 3KG1A 4DFMA 5BYQA 1RAAB 3DRRA 5IT9Y 3AD7C 3KUEA 1N5YB 3GIJA 4PZVA 1K0TA 3VGVA 3CD6S 1FJCA 3IBWA 3PZPA 4QZVB 2HVZA 3H90A 5HP1B 1VLOA 2AU0A 3MEKA 4C3KA 5IWAF 1M5KC 1SJ1A 3CWJA 1R6VA 1SV5A 4LFCJ 4Z7CA 2VL1A 2COLA 5KG7A 2QRRA 2LEPA 2XG8A 9ATCB 4R0EA 3UD3P 4LFAF 4F3MA 4FVMA 4PXCA 2W4PA 2FJVA 5JMNA 2BE2B 3G82A 3V6DB 1OQ6A 1BQXA 2GZOA 3M2VA 2RKIA 2OELA 4MK7A 3H5SA 4B9UA 2CVEA 1XNRJ 2FHMA 2EVZA 1NH7A 5LJ3Y 4DXLA 2IBOA 3O6QA 4YY3F 1RQ0A 3UQSA 2RRNA 3K8VA 1VYAA 1T9XA 2HZCA 4DR6J 4NWBA 1RTIA 5HMXA 4EZ6A 1URRA 2QA4S 4XPCA 4WE1A 4N56A 2QMXA 3I96A 2J0XA 4OHWA 2VKRA 4K4UA 1O6XA 3QIPB 2GVDA 2IIHA 2WTFA 4UUWA 3AJDA 2EI5A 4ZLLA 2H1YA 3D1HA 3PW7A 1T7PA 3QAEA 2M8DB 1Q95G 1S10A 2ACMA 2YXLA 4ATNA 4JV5F 2CJQA 1KTVA 4GC7A 2W24A 2J5AA 4R5PA 4BCAA 1JJ2R 4UQTA 4QBUA 1G2EA 4MKYA 1TKTB 1SIZA 2C2EA 2Y1RI 2R2RA 3LGNA 3EPGA 4MAKA 2CDRB 3HFKA 1KD1T 2CJ9A 5DG9A 3R2DJ 3CCQS 4C8NA 1JLEA 3CJ3A 1NCLA 2ZD1A 4NI2A 3IS9A 4CO5A 1YJ9S 4HTJA 1S1WA 1DHMA 2I8EA 4OV1A 5J1PA 4G1QB 3H0PA 4BLGA 1RTJA 1GX5A 4R8UB 2GX8A 3NS6A 4B3RF 1UVJA 3SFUA 3DKDA 4E0DA 4RNOA 4W98A 1P8GA 5T41A 2KRRA 4FKXA 4NMXA 3ZTSA 1R27B 1YRXA 3ZO7A 2G0IA 1H2VZ 4OLPA 4YP3A 1V5VA 4L73A 1B7YB 4QPTA 2X3DA 3IR5B 2OPRB 3K5PA 1UA0A 4FF1A 5KFJA 2KXNB 2V8HA 1TVRA 4CLPA 2H4WB 4XDDA 5MAOA 2HHTA 3MURP 5HANA 2V2VA 5HBMA 1EARA 2F8HA 3Q89A 2G1HA 4R25A 4ZLPA 1KC8T 2ACYA 4WU3A 2YX7A 2HHQA 1RK8A 3FZ2A 2OPPA 5CQGA 2YKNB 4MIWA 3T9ZA 3SIPB 4DV0J 3IRXA 3CCLS 4DDFA 2UU9F 3JQJA 4J9MA 2EG1A 3I31A 4B3OA 4LF9F 5LL6d 3ULHA 3PRBA 3ISNC 4K59A 1RU2A 1TK0A 1ZBTA 2H5IB 4MK9A 2UZAA 2XZDB 1WC1A 2BJ9A 3Q2SC 4WPAA 5L1JA 1WELA 2HIQA 4DV4F 3QJPA 1CJVA 2FD2A 3WBZA 3GIRA 2YNHA 1NNDA 2W9CB 3I87A 4U9RA 4DUYF 2OPSB 3KLHA 1FJGJ 4H54A 4KH1B 4RW7B 3EX7B 2LU1A 4YDDB 4X66J 5K8MA 4F67A 3R1HA 4V1Ak 3G71S 2IA0A 3I5CA 2FLPA 3OFHA 4RU2A 3EVOA 1CS4A 3EICA 1UW9A 5LT5A 1IBLJ 1VQ8S 2JC0A 2MLYA 1SUQB 1YJUA 2EFNA 4WP3A 1UVMA 1XMQJ 1EAYC 2WW4A 2R7VA 2IDEA 5IT9U 3L7OA 3LP0A 3MM6B 2MZTA 2D1CA 4NLRA 4RUCA 3EM1A 4B02A 2YNGB 3MEGB 5KFSA 3POTB 2EXUA 2C2ZB 1HI1A 2J6TA 4W90B 1B99A 3D0GE 2RQ4A 1DY3A 2VB6A 3VGUA 1RWKB 2CPXA 3TAMA 3BGUA 4DQSA 2ROEA 1FFGB 3FSXA 4IDKA 5IFMA 3GG0A 3PJWA 4E98A 3T5KA 2CJKA 5DQGA 2I38A 4KFBA 3NCPA 4ZPDA 1FA0A 3NRBA 3C14B 2XULA 4P7TA 1WORA 2NZ4A 4EYHB 4PQAA 1V9OA 2AWZA 4UY8T 4O0NA 3FMBA 2RJZA 1EETA 3C19A 3L09A 3UE2A 1XR6A 2ASJA 1RHUB 1LWXA 1RI7A 5LSRA 1UEUA 1QUVA 5C24A 4P72A 1RYSA 2RS2A 3I4PA 4KGZB 1MW7A 1U7LA 1YLXA 3KLGA 4ZVUB 2EC2A 4K50A 1MN7A 3G9CA 4QWBA 3D1OA 1OS5A 2CPEA 3T1YF 2NUUG 1K1QA 2PA3A 5K8PA 1Q86T 3CCES 1PO6A 3DM2A 1OYEA 2VJVA 2JL9A 2WVCA 4ZOSA 3EPIA 4DL7A 3AXKA 3E51A 2LQBA 1ZTTA 1B3TA 2J6UA 1RDRA 2HIYA 2JFKA 4OI3A 4IFVB 4K2JA 2BKNA 1JX4A 1RTZA 3JYTA 3P45B 3TJ9A 2XCPA 4ED6A 5A8WA 1D8ZA 4DR7J 3KLFB 4LFCF 1Q8LA 4Q8EA 3M6UA 3LOUA 4C0BA 1M5OC 4IQXA 5K20B 4DSJA 4NLUA 2DEJA 4NEZA 2RT3A 3KLVA 5KG5A 3BO4A 4KV8B 4RBVA 1S6PB 5KG2A 4M5HA 5B09A 1QSYA 2ASLA 2B0GA 5KFKA 3OR2B 2LQ5A 2OMLA 2V6AA 1UFLA 2C3YA 3BSCA 3QBCA 3V81B 2DNRA 3AQOA 2MSSA 4X4PA 2OO4A 2L41A 2V4JB 5CZXA 3I0SA 4C0OC 2QG9B 2DGOA 3GG1A 4DR6F 2BACA 3MR2A 3W5XA 4LR9A 4K2XA 4U7UK 4Q0BB 3KJFB 3EZUA 4J37A 4D3HA 3DLJA 2RMLA 3D6TB 1RTDB 3TZZA 3KK1B 5AXKA 1TUWA 2R7QA 2KT3A 3A12A 4ZVSB 4YR0A 1RWXB 1M90T 2DH7A 3M05A 1CJKA 4JI4F 2K7KA 2HNZA 3K2YA 4JYAF 3D4JA 5GMKa 2E66A 3MPWA 4KGXB 2IVMA 5J2MA 5CYMA 4KY3A 4DV7F 3PO4A 2V8PA 1PYSB 2YKOA 1N0VC 4K4ZA 1JLCB 2FUG9 1NRKA 2HZAA 4DV3J 2F3JA 2GGPB 5EHHA 3TI0A 2A1BA 1NM2A 2WVEA 3DOKA 2OPQA 2GHPA 2DNPA 2G0JA 1Y00A 4QYRA 4DEZA 1DRZA 1SPBP 2FTRA 2XZWA 1MWYA 1UL3A 1SC3B 3OTBA 2RQMA 5KFDA 4U67Q 1I6JA 4HACA 2XI2A 4ES2A 3AXMA 4DS4A 4F04B 1VBZA 4OYZA 2PN6A 3ETOA 1UJ6A 4B9MA 1Q16B 3QT5A 3UD4P 3NGUA 2HVIA 1IR0A 2ASYA 2MZSA 4DV0F 4DPXA 3LO3A 2JEIA 1NJZA 4J91A 3MCOA 1YG0A 1BQNA 4ANCA 3MUMP 2HS0A 2HBYB 3GCXP 2O67A 1GTHA 4DUTA 2ZNZA 5CCLA 1YZ7A 2L3MA 4P75A 3A13A 3BQ1A 4NXNF 4A8YA 2CJBA 1RZMA 1S59A 1WSVA 4N77A 1CEZA 3T5JA 2XB2D 3M1VB 4ED4A 3M30B 3S1TA 2Z30B 3CF5Q 2DHSA 4AFFA 1XJWB 4QYZJ 1FJGF 4ANEA 3QWUA 4NLGA 2CZVC 1N5QA 4X66F 4OJHA 4Y00A 2RAQA 3VZHA 4K4VA 2CJXB 1PG5B 5AJ3J 1RABB 2XMAA 1IBLF 2Y1IA 1YBUA 3IM9A 2MKIA 1WHXA 3CJ8A 3GIMA 4PWUA 1XMQF 2V69A 1SVDA 1J5EF 4WJBA 3O1LA 1OO0B 1B70B 2XLJA 1FVQA 4CLSA 1VQ7S 3VAFA 2PI4A 1EJ7L 1G1XA 1JIHA 5ETNA 3QYYA 1UVKA 2XNRA 4H4OB 3BPDA 1H74A 1U6BA 1S5ZA 2EFQA 3FMWA 3H98A 1S1VA 2IMOA 1LWEB 5C2CA 2CUYA 2FJWA 4M5LA 1RBAA 2MHEA 4JI1F 2DNHA 2V5HG 1VMBA 1SI9A 2V9WA 1VJWA 2R7RA 4B3MF 1QDUB 3CXCR 1NEEA 5JVHQ 4FYVB 1U25A 3ISZA 2PGCA 5F8HA 3PW5A 1QE1A 3BS9A 4YOEA 4USMA 5L1KA 3QO9B 3UFCX 1X4HA 5LM7E 4ZVRB 3VGTA 4DPYA 3K59A 3HJVA 2AW0A 1YBAA 4WK3A 2FJBB 3TANA 3V5RA 1YI2S 2FHKA 3SSSA 5L1LA 2EK1A 3W7BA 3V4IB 2C3OA 2LEBA 2OD4A 2ZHBA 2HS4A 2CAJA 4A8QA 4Q8FA 1EQ0A 1OY9A 2Q6BA 2WVBA 4CLZA 2B9WA 3LP1A 2B5JA 4EWTA 1RT5A 4C8MA 4CIOA 1ZYQA 3QZ8A 4CT8A 2XLIA 4LRCA 5DGBA 2B8QA 4I2PA 2VASA 1I51B 1N4LA 3CCTA 4CYUA 2FVCA 3HCXA 1N0UA 2MY7A 5KT2A 4J5OA 4JUZA 1OJ4A 3CJSA 2ZBRA 2DD8S 1HNZF 1XN9A 4URQU 4PUOB 5JJBA 4I6YA 4DX6A 3UCGA 1QTNB 2L9NA 3QGIA 2AP6A 2OJ3A 2W2OP 3MOZA 3F0NA 2PI5A 3EXYA 2PEHA 1CVJA 5IT4A 2V9KA 5D6GA 5HMWA 1U45A 1ZM3A 3OXGA 5LXYA 3BGOP 3WDOA 3HVRA 5F9NA 5D4OA 2CQ0A 2YKPA 4XK8C 3VQSA 4DU8A 2MKKA 1RSCA 2KB2A 5HMYA 4FKYA 4F2SA 4KIAA 2LQ8A 4LVNP 4ZKAA 4QWEA 3THVA 2Y0SD 2QV6A 3MM9A 2F63A 1HNVA 1QVGR 1JKHA 2FC9A 1K9MT 2KJVA 3M8YA 3GWCA 3DRSB 4N41A 3HHLD 1CULA 3PV8A 1ZTWA 3QPIA 5E3AA 1MU2A 2DGTA 2CG8A 4GVBB 4ETXA 4UUXA 2IJRA 3GJTB 1XERA 1N54B 2BV3A 3DOMB 2ZE2B 1GAOA 2ZJQQ 1NAQA 1RAGB 2LCWA 4LSLB 4ZVQB 2E1PA 2BANA 4DR5F 2DGQA 4EEYA 2GMJA 3W9IA 3JSBA 2XHCA 4UTGA 5HK4A 4DV3F 2FJEB 2CPFA 4Z2XA 4CWBA 3BF4A 2KFZA 1VQSA 2HVEA 4NLWA 4Q5VA 2CJYB 1B7FA 3FKBA 4X84A 3U7JA 5M2RA 4CLUA 3J7YU 3ZZZA 1HMVB 3DLGB 3L7PA 3DXBA 4BWJA 3C6UA 4DFPA 7FDRA 1JNRB 4A8SA 1NXIA 2P6SA 5GADU 5HJYA 2MHNA 1FTCA 1XR7A 1Y7PA 3W65A 4L3NA 4M5MA 4DF4A 5KFLA 4KR0B 2PD1A 1VQ5S 5HJXA 3M4XA 3T6JA 4ZCMA 2HBZB 1J2VA 4AL7A 2RKIB 2FDNA 3AH6A 2B9YA 4CH7A 1XC9A 4AL6A 5KFNA 1NHVA 3Q8PB 1H3DA 4CT9A 3JQKA 1VRUB 1FJ7A 3CSKA 4DV6J 3I4HX 4LBPA 3NKYA 4TU7A 3C66A 1TKDA 5C5JA 3THTA 2KTQA 2XYGB 2VOPA 4ID5B 2R8KA 1YGYA 3UVJA 3DRPA 3HHNB 3TP2A 3BREA 3TAQA 3R6GB 3EMTA 5IM0B 2UP1A 1RKIA 3MAAA 2KH9A 4NLYA 3JTOA 5CZVA 1RAFB 3J81Y 1WJ9A 3RW6A 1S6OA 3M8QB 2ZVIA 4CI0B 2AEMA 3OR1A 1FK9B 3ITHA 5H9EK 3RGIA 2E7XA 2YPZA 4PKDB 3KHLA 4DSEA 3OSPA 4ZP7A 2F9JA 2XMJA 2MY8A 2KRBA 2J76E 2OEJA 1KQKA 1P1LA 2JDJA 1RWWB 1ROFA 3A3PB 5AJ3F 5DZ7A 1NK8A 2NXUA 4C8OA 2O1PA 4WIIA 1S1WB 2R9LA 1PYOB 2X1BA 3LGMA 2ROGA 1NKCA 1VOMA 4TLRA 3KLIA 2F4VJ 1FRMA 2VUGA 2MKJA 2C2KB 2GAGC 5D3GA 1F60B 1SKSA 1VDHA 4MKBA 3MM5A 4XO0A 2FJDB 3BV8A 1TK8A 2QC3A 5HSPA 4J9LA 3TZWA 4I6WA 4BBYA 3IAM9 1HA1A 3QWPA 3O44A 2VG6A 5FDLB 5K5MA 5D0RA 3G4SS 3NNHA 4DLEA 4YR2A 3TUPA 1GNKA 3MEDA 1RT2B 2RSQA 4OFZA 3DDIA 2BW7A 3KJQB 2KHDA 5GAGU 3RBEA 3Q86A 4OYIA 4OZ1A 1HQEB 1X9MA 3T1HJ 1ZM4A 2GCFA 4DSKA 3AT1B 3E01B 4WTOB 4OHVA 4OLOA 3H25A 1KWMA 4C97A 3LPYA 4ZP9A 4NXMJ 2UXBF 1CJUB 2B6AB 5B08A 1B64A 2LDYA 2PC6A 1T9VA 2KL8A 3RB3A 1KQSR 2XM3A 2MZRA 4PG4A 3N5BA 1XBWA 1M5HA 3KLHB 3G6XA 3W9HA 1UPPA 1HR0J 1JQGA 3QRPA 2KXFA 3C15A 2OMOA 3PYEA 3R5JB 5J2QB 4LF2A 3GU0A 4KPCA 5CABA 3DLHA 1A6LA 2HFSA 1PC5A 4HHJA 5T14A 1UZDA 2ZHAA 1RAJA 3LP2B 2Z2LA 2JFDA 1T9TA 1O0PA 1HI8A 1U48A 2H54B 2LEAA 2WVFA 2OKQA 4A47A 1I1GA 2W8LA 2ZUAA 4V19X 1U0HB 3A8JA 1FKAF 2E9TA 4UW2A 3TNVA 3BDEA 3OUYA 3GILA 4J9UE 2VOOA 3IBCB 1UVIA 2VQEJ 3IFEA 4YQWA 1DTQB 3TO8A 2G1DA 5DS7A 1U1PA 4HR2A 4OJ1A 4RUBA 5IS2A 1HWUA 1IKWA 4G65A 3ZTQA 2K8GA 2FQQB 1QY7A 2RUGA 1U6FA 1MLAA 4IFYA 4W4MA 5DETA 1VBYA 4ZN3A 4I7FA 1EETB 4FBUA 1K1SA 5J2NA 2AJ2A 3TA0A 3MMAA 3C2PA 4OIXA 3UI3A 3THPA 2CQPA 3HI9A 1U1KA 2DRBA 4N7TA 5K8OA 3MAHA 2VV5A 2K1RA 2UV8G 1TL3B 3QRQA 1Q79A 4EU0A 4X4OA 2QYCA 2CNLB 5IV3A 4ZVEA 4P10A 4DR2F 3QRRA 1QTMA 3MMBA 5HAOA 3HVTB 3J81U 1S4EA 3GJSB 1T9YA 4BC7A 4UOCA 3J7A1 1EHWA 1S12A 2B43A 2QLJB 1U24A 4RW8A 3RR8A 2L9DA 1WEZA 4H4KC 3CJ5A 1RWPB 4C3MA 1TU0B 2HK2A 5CYQB 1T9UA 1UVLA 1F2HA 3VVUA 2B4VA 1H2UX 3CB4A 2WB1D 4LIRA 3MCSA 3TA2A 1QAIA 1NSAA 1RBOB 3SMZA 5LOQA 2WVDA 4KKOB 3D1QA 2GMLA 3DLKA 2LA6A 2CQ3A 2D3OR 3ET6B 2DNNA 5E0OA 2BUNA 3M2UA 4J7CA 3Q8SB 3VALA 1X4DA 1S49A 4UT4A 1TL5A 1SL2A 3M7VA 4V19J 4LF8F 3DU5A 3O2IA 4ZPCA 5A8RA 3PW2A 3C16B 3TR5A 4O3SA 1JJ4A 4FXWA 1F3VA 2C3PA 1VGYA 1HKAA 3PKMA 4ANDA 3QGPA 4GO7X 1G6BA 2AEFA 3OLAA 4J9OA 2NZCA 4J9NA 2BJEA 4B9LA 3LAMA 2O66A 4ECQA 2Z56B 2N4CA 2DRAA 1VIOA 3CDAA 4DR4J 5LSOA 3M6WA 2FY8A 5GAHU 2JVOA 5K8NA 2W4CA 4ECZA 3AOCA 4XTTA 3I55S 1NK5A 4K0KF 2FZGB 4TVAB 2DGVA 4MIAA 3PJXA 4JV2A 1FTRA 3C6TA 2EKNA 2W7AA 3FCWA 1X5OA 5JXSA 1BC6A 5DDQC 4QR1A 1FNMA 4ZP6A 2Q3PA 1U09A 3KNAA 3CVKA 3NGDA 2PMWA 2Q66A 2OPQB 3MM8B 4A8XA 1C0UA 4NEYA 5DG7A 3IG1A 5I4MA 3UN2A 2VONA 4HL9A 3CULA 2GV1A 2V0NA 4RW4B 1MWZA 2N4DA 5KFVA 1RADB 1AFJA 2P6TA 1H7XA 4MH8A 1JNZB 3NNCA 5GAEU 4DMZA 4J9QA 2X7IA 5F8JA 3KK2A 2QL9B 4RW6A 4RO0A 5E3CA 1VC6A 5HLFB 3M2RB 5DRKA 2HPUA 5E33A 3VHQA 4F8RA 2LP4A 1AZSB 3K5MA 1OY6A 4LRFA 3CJQA 2J0SD 1HFEL 3FQLA 3H59A 3BYRA 4Y2AA 1IKVB 3JAMY 1RT7B 1SB6A 4DCPB 2P8IA 5ETTA 2ATCB 3QSYB 1NDKA 1BLUA 2WONB 2BABA 3W2WB 2XYHB 1RBLA 1TTHB 3EZOA 4O3NA 4NXMF 2XC9A 3R5CA 3K5OA 3PX4A 4P2MA 4LQ9A 3FJ2A 1XNQF 3ENWA 4ETZA 4ZHRB 3MEEB 2AJQA 3X3UA 1SJFA 2JZ5A 4G1PA 2VPZB 3JTPA 1TELA 4K4TA 4CQ1A 1EIYB 2B4OA 3HKZD 1HR0F 4MTPA 2QTWA 3CJ4A 3EUNA 4RR5A 1NSQA 1HHQA 1WOPA 2JH3A 2X1AA 2G4BA 1HIYA 1R7IA 1DARA 3M9MB 3R7SB 4LSNA 2RB7A 1CLFA 3KHHA 3PNIA 4LFBJ 1LFPA 4H4MA 2YWHA 3VR1A 3RRGA 1S0VA 2HWIA 1NK9A 4PAAA 3CDWA 1IN0A 3NGTA 1FRLA 1WD6A 3EE3A 2BEFA 4HH1A 4C6AA 1VC0A 3QGHA 2P5VA 2H9ZA 3I0RB 3MM7A 3UD5A 4IH7A 4FYWB 2BYCA 1KHVA 4BWMA 1LK5A 4Y65A 4USIA 4B9TA 3BSAA 1BE4A 5E2QA 3LW5C 1KONA 2DCUB 1RHKB 2RUSA 2AX1A 2XEXA 4QJVA 2CWXA 4U7CA 3GB0A 4DL6A 4P6QA 4OZ0A 1HNIA 3M8SA 3IWNC 3FQKA 1Y11A 4USUA 3NCQA 1FWPA 3OL6A 3SDEB 3W8GA 4CTAA 1TL1B 2CRLA 4LVOP 4C8KA 2I9SA 2MQMA 3PM9A 5I42A 4A8OA 5C42A 1Z2LA 5C7PA 1RKJA 1ZOTA 2EFVA 3PVXA 1N5SA 3W2VB 1YHQS 2DY1A 2IRUA 3HK2A 2ZH7A 5IV4A 4IH5A 1S1TA 4JI5F 1WI8A 4QIWD 1KVIA 1C1CB 2KFYA 3SSQA 2MEWA 5B0GA 5KG6A 1X5SA 3E8OA 2AZ3A 3BH7B 3NS5A 5THWA 1E6YA 1HBUB 1ICEB 5EUHA 2B8PA 1RAIB 4NLOA 1H72C 4KJIA 2VFVA 5FLXY 4QCLA 3OBIA 4OZ5A 1KFSA 1U1QA 4RNFA 2SXLA 1C0TA 2HK3A 3AA8A 2VKZG 3BPSP 1S6QB 3KDOA 5F0UA 3FZBA 1S9GA 4NA3A 4Q43A 5D0GA 1KTQA 2I5JB 1QAXA 1UPMB 2FIUA 2YNFB 1IM6A 2YWEA 2NREA 5HMZA 3DLEB 1BWVA 4YN3B 1JLGA 4MT1A 3R7BB 1N5VA 1MROA 1FDNA 2DJWA 2YQ0A 3UR3C 1FX4A 2W25A 3I9ZA 2MB0B 2BA9A 1LWFB 5KFBA 2IAJA 4GKKJ 2C2OB 3A3OB 5IT0A 4FNHA 1ZZFA 2Y1LB 4X4TA 3GV8B 4NA1A 1BGXT 3DDKA 5HI7A 1E6VB 1T02A 2AJFE 3HSDA 2ZEJA 4ZIWA 3HSJA 2YWFA 5F8GA 4IG0A 1NJXA 4EUVA 1TAQA 1J5OB 4M95A 4NZ7A 3QFHA 4JI3J 2RS8A 2C2NA 3R5GA 4O4GB 1RJJA 1TV6A 1IR2A 3HJFA 2V2KA 4K4XA 4ZIVA 2IC3A 5E3QA 3LA0A 5GMDA 2HNDB 4F2RA 2RNEA 3JAMU 1RAEB 2R3VA 3DYAA 3GP9A 2YNIA 3Q8YA 4WKYA 2DHHA 1CC7A 4AUKA 1RT1B 3P3DA 4HKQA 2WOMB 2LXFA 4PWDA 4LBIA 2DNZA 1N6QB 1FFWB 3OT9A 1VQMS 4TYBA 4LFAJ 1B0VA 2X3GA 4ILMA 3TUJC 1D8YA 2JX2A 1JLFB 3JQMA 4USHA 1S9EB 3Q8QB 1Q7YT 3FFIA 4M94A 3E3XA 4QW8A 1JLQB 2WBMA 1VBKA 2F8EX 1CJTA 3DN9A 3PW0A 2MZQA 2IBKA 1FF2A 4DV1J 3HF5A 2I2YA 4YY3J 2VDHA 1PAUB 2VG5A 4I2QB 3JSRA 1R3NA 3FBEA 1WUUA 5A8KA 5F0WA 3NEKA 1UMJA 2Y0BB 1WC3A 4KYZA 1BY9A 1YDLA 3HHLA 3EVWA 1WSRA 4ECYA 2YKMB 4KBIA 1BD6A 1N33F 1REVB 1GMVA 3K89A 2X1GA 1UP1A 3SFGA 1IWAA 2IM3A 4FF2A 4YR3A 1L3SA 1JLBB 4I67A 4MKVA 4QIVA 1WF2A 1VQ9S 3BQ2A 3AOBA 5ETMA 2NPIA 4UQGA 2A0FB 2FZKB 3PTWA 3IBFB 3NAHA 5K9FA 1RE1B 3PX0A 1RGVA 2BRLA 1RT6B 2V34A 4WP9A 2QT7A 3JSMA 3FCHA 1A0OB 4Q44A 2H65B 1LXJA 4PXBA 4OX6A 3VCDA 8AT1B 5J1NA 1T3OA 1VISA 2K7JA 5F3ZA 4N76A 3CCZA 4Y3CA 4ED1A 4P2SA 4HI1A 4KC5A 4DBQA 1BQMB 4I1TA 3RBXA 1R8HA 4LF4F 1GXUA 2A3JA 2HFOA 1LWCB 4PEOA 1S76D 2MPUA 3AODA 2ROPA 5ETPA 1S0NA 3NBPA 3UWTA 3ZZTA 4L3KA 2XMUA 4CRJA 3NY0A 2CIMA 1QJHA 3FBFA 1VI7A 4DU7A 1XMBA 5FLXU 5AXLA 4XAKA 3FRZA 3A8EA 1WEYA 3IMQJ 4ED0A 4ZPWR 1TR0A 2AGOA 4HI2A 3C8YA 4G6VB 3KK3B 4HTIA 4ZJQA 3MR6A 2N7CA 5K14B 4IO9Q 2R8IA 2KYXA 1Z1ZA 3RR7A 1HHTP 4ES3A 4TY8A 1RCOB 2U2FA 3UW1A 4M5JA 3DFEA 3MMJA 2PEBA 3BB5A 5KOXA 2LQJA 2UVWA 4IOAQ 1S6UA 3R5DA 3CD0A 4HDHA 2BJ7A 4PQUA 4DV4J 4D3GA 1F1BB 2QN6B 4DUYJ 1URNA 2AEJA 1PBAA 3B4MA 2QEXS 3CDBA 3SYZA 1AXQA 3T6BA 4LF5F 3J7YI 1SIWB 3AY0A 3KFWX 2NXEA 5FIIA 4A8KA 1FNXH 1NJIT 4P71A 4QIFA 4OJGA 4EGLA 5GADI 1M1HA 4ZVPB 4J9PA 2RD5C 1HYSA 2EFOA 2A6MA 4YHHJ 3R2CJ 2XSJA 1DLOB 5T7LA 2WSCC 2XSFA 2HVHA 3ENAA 2DNYA 4ENOA 3DOLA 7AT1B 4OV6A 2ASDA 4JI7J 1Q81T 1SQGA 3BGRB 5F8IA 5D0EA 2HWHA 2XYPB 2KKHA 4K5SA 1RXOB 4DZDA 5J1EA 2PT0A 2CPJA 4Z37A 2XQCA 3GZ7A 3SZ2A 4JI0J 4KE5A 1Q78A 2JRSA 4ICLA 4GKJF 2EBEA 2LXUA 2IDLA 2AJ0A 1Q8IA 2R8JA 1GEHA 1NUEA 2YWWA 1KLMB 3S7RA 3M8PB 2BOAA 2G2ZA 4BHQA 3BKTA 3MECB 5H1SV 3Q0AA 2WK4A 2AZ1A 1P27B 5AE3A 1N5YA 3CCSS 4ECRA 3AQPA 2VFUA 3EWGA 3KHGA 4B3SF 2LYVA 4IQMA 1FO1A 4YMEA 1NSPA 3MR5A 2EFPA 2GHWA 2HQGA 3SQGB 3H4DA 4QU6A 4JI6J 1ELOA 5HP1A 2V94A 2HG4A 2RE1A 3ICLA 2F1FA 1WKKA 3PX6A 5D4LA 1K73T 2K3KA 4F3QA 5HROA 3KKFA 1AYEA 3E2EA 3GJQB 1C1BB 3MAQA 2HGLA 5HQLA 2KI2A 1FD2A 2FB0A 3CC2S 3UNYA 5KG3A 1Y3JA 3A3NB 3H2LA 3MPVA 3D6MB 2E5HA 2FLNA 2BE2A 3ZZOA 4GVLA 4O0IA 3V6DA 2HYIB 3UDVA 1S72S 3KJVB 3W1YC 1RAHB 1FKPB 3SEOA 1T95A 4X64F 4NYZA 4A8MP 2WAQD 1HBNB 4LJMA 4UF4A 5KFRA 4J9KA 2XWYA 4GMKA 4I6AA 4ELVA 4WYLA 2LU2A 5FJ4A 4DQIA 2P9EA 2VU5A 2KXHA 2ZH1A 3QIPA 4RW9B 4NRUA 1VQNS 4FS2A 2Z2YB 3HVWA 4DOZA 5GAGI 2N82B 2HNYB 4RW8B 2PO4A 2C2MB 5I3UB 1U2CA 1T05B 5LXRA 2GJ2A 2QIFA 1SQEA 3EGVA 3VWSA 3AD8C 3L9ZA 3MR3A 2JLFA 4DV1F 5F8MA 2J7UA 3QMQA 2AJ4A 3W8PA 1M5PC 1U1MA 4L76A 1N88A 4PXEA 1LKZA 1TKTA 2ZC3A 2UVUA 3R5BA 5A6WA 4F3OA 2AD9A 4IH6A 2AKWB 4MIBA 5A2QY 3SV3A 2JC1A 3CO0P 3R3TA 2NUHA 1WWHA 5I3PA 1PSDA 1MG7A 2BQ3A 4DSFA 1HPZB 3O3LA 4G1QA 1G7CB 2V2QA 3M2UB 4PCQA 4R8UA 3HMJG 4JI4J 1JB0C 2FC8A 3KUHA 5F8NA 4JYAJ 3SCLE 3N0VA 2GW8A 2R2UA 1NKEA 1IKYB 2IM2A 3R7NB 3CGIA 1PBUA 1RTHB 2PIIA 4DV7J 1VQKS 1QVFR 3BKUA 2BDPA 1DJ0A 3OFEA 1R8BA 2PFDA 2RVJA 4M5KA 5L9NA 3AD9C 3QGGA 2OPRA 1VCTA 2OLWA 3AB4B 2QYGA 5EN1A 1HWKA 5KT5A 3TQ1A 3FNNA 4NLTA 2VFSA 2VC0A 4DR1F 2YKNA 4AYBD 4X4UA 4TNOA 3DI6B 1D9AA 4DQRA 4M5IA 1JK9B 5ETRA 1YX2A 4X4RA 3OXFA 2HLUA 1RWOB 1W25A 3DGVA 2R7XA 3NWGA 1D0EA 1LOUA 3GCWP 1FI4A 3H5XA 4BC9A 1WC4A 2YKAA 3LUYA 1BUXA 1NB7A 3BQ0A 2J8AA 2NS1B 4WP8A 2MXYA 1PJ5A 4ZVFA 2Z2MA 1T3NA 2DNQA 2LFVA 2XS5A 5M2PA 8RUCA 3DHXA 4F02A 2KVQE 2W9CA 2OPSA 4RW7A 4WKRA 4OI4A 3EGZA 3RW7A 2L08A 5CA5A 3MPUB 1NK0A 3FEYB 1FCAA 2DNOA 4DN0A 1Z2ZA 1SUQA 2ZJPQ 3D2WA 2LDIA 2XS2A 1I5OB 1LQ9A 2W8KA 3ISND 3MM6A 4NXNJ 3HFVA 3CD7A 3NMAA 5SZTA 2YNGA 1UWAA 3MEGA 2QJ3A 1VRTB 3CT9A 4PR6A 3LALA 3POTA 2KM8C 2QFIA 3PR5B 2ZKTA 3L7UA 1RACB 4ZCLA 1XK8A 3M32B 4U6PA 4KHMA 2UVVA 4U8YA 1WHVA 2YQ1A 2D9OA 2Z58B 5C25B 2UUTA 4LBHA 4K7QA 4P52A 4QQBA 1FDAA 3C14A 2GQQA 2CPDA 1R0AB 5E5NA 4YHHF 1TL7B 3GTYX 3LPEA 1XR5A 5B0EA 4OZLA 4ES1A 2GHVC 1J5EJ 4OQJA 4HT5A 1KFDA 1TKZB 2P9GA 2A2DA 4OZJA 5BR8F 5IQ6A 3MDFA 2CNNB 1KNZA 4WZQA 4ZK7M 1S7IA 1FKOB 5LMNF 4JI7F 1KR4A 2XGQA 4F4YA 3UNGC 3N5FA 1FEHA 4Q45A 2W9BB 4I68A 2BXJA 2OGUA 1EB0A 3B54A 4DCOB 3NAIA 1NK4A 5H9EJ 2HRTA 4JI0F 2CQCA 5LJ5Y 2HFZA 2ZZTA 1JLAB 1RWUA 2EW9A 4JI1J 3MR7A 3DRXA 3WQPA 1M5SA 4B3MJ 3QZ7A 4NCBA 3OTOJ 2MTLA 1ZA2B 3F44A 3FGVA 3VV2B 1NH8A 1FESA 4DPWA 2ZKUA 1FRIA 4F0KA 2D74B 4BS2A 1X4BA 2RH3A 5D77A 5GAHI 1UEKA 2ZM6F 3PW4A 2E1CA 1F5AA 2E5JA 4ZN1A 3NGSA 2V8GA 3BDPA 4IFVA 1EP4B 2M7SA 5KFCA 1ZPWX 5KT4A 4JI6F 4DL0C 3LANA 3QATA 3GIIA 4F26A 4ZDNA 3CD5A 1GMUA 1JJHA 5A2QU 3UN5A 3QNWB 3KLFA 1FERA 2IY5B 4CLLA 2NXJA 4KO0B 2C2RA 3MZIA 4HH0A 4P2XA 5KFMA 2ZH3A 4KV8A 5BJRA 4DSIA 5SUHA 1YIJS 4QWAA 1S6PA 4WWSA 1YJVA 3SI8A 4PPDA 3OR2A 2R8HA 4Q2LA 2QA1A 3U1NA 3MXHP 4X4QA 2UXCJ 1HD1A 2XY6A 4ZITA 1AUSL 2Q79A 3V81A 1KBRA 1S1TB 5GAEI 2EG2A 4DN9A 3PKYA 5KG0A 3P4UB 4LRDA 2V4JA 3GE9A 1WNEA 4NLSA 1ZAVA 1S57A 3G6VA 1WEXA 4C11B 2NYIA 3DMJB 1X4EA 3H20A 1HNZJ 2HZVA 2GJFA 4M5NA 5KG4A 4Q0BA 3MD1A 2XMMA 1ZZNA 2IRXA 4ALZA 3KK1A 1X60A 2EC0A 1U1OA 3P6YC 1C0TB 2VHGA 2DITA 1TMMA 3CIMA 2RRBA 3M8ZA 2EEYA 5E3RA 1OIAA 2ZH4A 2MYFA 3HKWA 3H40A 2UXDJ 4CLWA 5AE2A 2OFHX 3KHRA 1D09B 2VG7B 5L8RC 5GMEA 2CQBA 3J7AN 2MKYA 1DQAA 1JLCA 1N56A 2WBRA 5AXMA 3EZ5A 2QMWA 4K4YA 2N3OA 4K8RA 1X5PA 4KHPF 3DGPB 3T3FA 2GGPA 4MFBB 1WTFA 1F3FA 3U1LA 4NA2A 1KDNA 3UR0A 1KKHA 3CEDA 2DTJA 3GFZA 2CQGA 2XCAA 2NXNA 1N36J 1WC5A 2DR5A 3HP6A 3FDSA 1UA1A 3ONQA 2JEJA 4ECXA 3FEZA 1K0VA 4QIEA 5HO4A 3KLEB 2POKA 3R8YA 1X4AA 5ETQA 4C8LA 3NOCA 4OZ2A 3AHPA 1IWGA 3DLBA 4PRFA 4DR5J 2HMIB 1HW8A 4IRDA 1MMDA 1VQ6S 4LRBA 4URSA 2Q1LA 2ZH9A 3FBBA 3MMCB 4JI2F 4FNIA 4P2FA 4FDFA 1FXLA 1DFDA 1FX2A 3K0JA 3UO0A 4FYXB 2KO1A 2QFJA 2HAFA 2KHCA 1N8RT 2WZ1A 3GIKA 4GC6A 4C0HA 3M9OB 2I1RA 2VBYA 5KT7A 2R4FA 2JEFA 3CPWR 4A48A 2N3LA 1HBMB 1SC1B 2K06A 4NMLA 4IRKA 3GQCA 1IKXB 3NLCA 2E44A 1HL6A 3KG4A 1H73A 3GPAA 4ZS6A 2N7YA 3M1VA 3M30A 4IOBA 3UCUP 2G2OA 3H42A 2GIFA 1S1UB 4PG6A 3RYLA 3CCJS 2D3ZA 1R8CA 5L1IA 2CQIA 2YTCA 5LMUF 1RT4B 3J80Y 2Y3YA 4AXIA 4M63A 2R7SA 2R2TA 1W2IA 2ILZA 3AJ2A 3T1AA 2M2BA 1TAUA 2YQ3A 5KFYA 3HVAA 2HHHJ 3D6FB 4O3OA 3PR4A 2QA2A 4NCGB 3CJKB 2D3UA 2E1MC 4DX8H 3NOGA 4AE5A 3TYTA 3OL7A 1KEKA 2R2SA 2QSWA 2DO0A 4EO6A 4H4OA 2GAHC 1H38A 4OYBA 1Y0HA 1GMWA 2M9KA 1REGX 2DB1A 1HNWJ 3H5YA 1JXLA 1Z4UA 3IP0A 4WF9Q 2ZOGA 2VQFF 2Y9HA 4ED7A 2B4PA 3GYXB 3L3CA 1L3KA 1HNXJ 1DTTB 2Y1JA 1QLNA 1OPIA 3VTIA 3GLJA 2DRDA 5BYRA 4ZA1A 3VAJA 3JXOA 3B82A 2DVIA 3QLHB 4IG3B 3P96A 5G0RA 2ZBQA 5KG1A 1J27A 1LW0B 1LEOA 3QO9A 4DV2J 2ZH2A 2DR9A 1CBKA 1TZ0A 3ZZ0A 1RT3B 1T03B 4B3TF 1NPPA 2VIHA 3HSGA 3W63A 3OVSA 2F7VA 3V4IA 3OL8A 2O3DA 5KFFA 5B0BA 6FD1A 3CMQA 2F5GA 4M5DA 5KFTA 5D0HA 3OTOF 2CG4A 3IWXA 3S6EA 4YDXA 2BJDA 1N32J 4ZPVR 2DY9A 3LTOA 3F73A 2DGUA 3BM7A 3V6JA 2KFNA 3N79A 2FHJD 3MPDA 3Q23A 4ERDA 2OIHA 1TKXB 1WACA 2HS3A 3GFHA 4KT0C 1NK6A 4RKUC 1A7GE 2UXBJ 1U0SA 4F4XA 1HHSA 3ZZPA 4NZ6A 3SCIE 3G8TA 2DT9A 4B9SA 1W26A 4PUOA 2GVZB 3ILIA 1UFKA 2R42A 1K8AT 4J90A 4CLTA 2DNGA 2D3O1 4EYIB 1WC6A 3TVKA 1QSSA 2VBXA 4OYWA 1VQYA 1VJQA 4QW9A 3R6LB 2DR8A 3VAMA 2C42A 3TEHB 4KGMA 2RF2B 3SQOP 3OFFA 4NZ0A 1HQUB 1RHJB 3C46A 1YJRA 4LUBA 4AL5A 2XMWA 5A0YB 1PAEX 5DG8A 1FD8A 2UXCF 1NZ8A 5IXUA 2UUBF 1SH3A 3RRHA 1VQPS 2CQDA 3P49B 2BQUA 3GFXA 1QD1A 2OD6A 4NLDA 2CQ4A 1Q4RA 2C3UA 3OPKA 4L6V3 1WDDA 2MMYA 2CA9A 2BOPA 3A4TA 2LECA 3RAXA 2FPHX 1Q53A 3QIDA 2V68A 3T9NA 1OMSA 4IR1A 3VGSA 5DQHA 2MGZB 2RQKA 5F41A 3DRSA 2J9DE 1AFIA 4NX9A 4TKTA 4ED5A 2V8VA 2JHEA 4GVBA 1GQEA 1PILA 4EO8A 4AXJA 4DQPA 4DG1B 2UXDF 1YVFA 1WKJA 3DOMA 2CFXA 2ZE2A 5CYJA 1S79A 3GSDA 3MPYA 2Z4PA 1ZAXA 4LSLA 1S4FA 3A8KA 3MUTP 4OX8A 1RU1A 4RBTA 5J2PB 1FRKA 2ERRA 2HWTA 1WHYA 3PACA 2XMKA 1Q0NA 5F8LA 1NJYA 1L5UA 1HW9A 3GONA 5HROB 1HMVA 1WKLA 3HX9A 3DLGA 2NYHA 1N36F 3J80U 2DGWA 4RL1A 4B17A 3JSYA 2OHDA 3M9NB 1O8BA 3NL0A 4O44B 1FXDA 3HLUA 3W9JA 2VJUA 4DR2J 2DISA 1FFSB 4FYDA 4ZLJA 3DRRB 1SBRA 2ZWOA 2ZBCA 3HD2A 5DM7Q 2XI3A 5I3QA 1X9WA 2DNLA 2OI2A 3AOAA 2OEMA 1TQLA 4USJC 4L74A 1WG5A 3ILLA 4Y34A 1ZPVA 1ZS6A 3CE8A 2XY5A 1GX6A 3ILJA 1NK7A 1F9HA 1L3UA 4XPEA 3CJTA 1VRUA 2QLFB 2DK2A 1SV5B 2IVFB 1S0OA 3R1LA 1D3WA 1SXLA 1ACMB 1T8EA 3B78A 3BBCA 4PPZA 2KT2A 4OI6A 4ID5A 2KYZA 1IUJA 1SJRA 2FVSA 3HDSA 5B0DA 2J9EA 2QL7B 3UDLA 2ZITA 3G82B 1IBMF 5KFEA 4OZNA 5IM0A 2UUCF 1S77D 3M2VB 2H5JB 2G9OA 3QJLA 4LF7F 3R9LA 1NMEB 2BRKA 3M8QA 4GRSA 4FF4A 2D69A 2YKQA 1FK9A 5KFGA 2M70A 1KSPA 1RTIB 3ZTOA 4LF8J 3HXMA 4WE1B 4N5SA 2CPIA 3RB0A 4WU2A 1N52B 1Q8KA 1HBOA 2AYGA 1WOSA 3ZC4A 2M4MA 3DLLQ 2GVDB 1TL4A 5AT1B 5JVGQ 3RBZA 1Q82T 4J9RA 2HHHF 4NASA 3HHDA 5ETVA 1T11A 4R5PB 2QSFA 3UDEA 5LSLA 3BJYA 4K0KJ 2BJ8A 1LV5A 4EI2A 4WCEQ 2UUAF 4KGVB 5L38A 3DNCA 1KRPA 3DXSX 1PC4A 1RWVB 1JLEB 4F0HA 1SKWA 1HNWF 2ZD1B 4NI2B 4WXOA 5FDLA 3IS9B 4HHHA 4RWXA 2NR0A 3M6VA 4ZP8A 4A4JA 2HLTA 2MQNA 2XNQA 1T0TV 1VFJA 2NCKL 2AV5A 3SCKE 1HNXF 1RTJB 2HHWA 3PDNA 4ECWA 3AB2B 1RT2A 3OJSA 1FE0A 3M8WA 4CCHA 2MZ1A 2NPFA 4LF6J 1HQEA 3BO2A 2G13A 1F9FA 2CQHA 3E01A 4L75A 1XTZA 3KG0A 4OHZA 2BJ1A 4OI0A 1DQ8A 2B7CB 3TRGA 3TARA 1X0FA 2R7UA 4DV2F 2JLEA 2ZFHA 3D5MA 1CJUA 2B6AA 1TVRB 3P5BP 4LIWA 2HEKA 3JTNA 5HBMB 4DV5J 4PYDA 3GV5B 1B4SA 5EWFA 3MCNA 3KTQA 2OPPB 3I32A 3Q8UA 1ZETA 1RB0A 3PFOA 1IJFB 3IRXB 2GIQA 4P73A 3PHEA 2GNKA 2E5LJ 5J2QA 4B3OB 2MLZA 4QIGA 4MJKA 3PIPQ 1N32F 1KVKA 2RU3A 1VQOS 3ZTPA 5DQIA 4DPTA 2E9RX 2ADCA 2G2YA 1PCAA 5AXNA 2IJNA 5KFUA 3LP2A 3UCZP 2KJWA 5KFAA 1KOOA 3T5HA 2FJAB 3H4BA 1FRXA 2DPJA 1XNQJ 4KTQA 3KXDA 1CJVB 1U0HA 3JB9k 2YNHB 1U02A 3IR6B 1W2BR 5DDRC 3D9BA 3OV7A 3GSIA 4ER8A 1NDPA 1XQIA 4ZMMA 1DTQA 1EX8A 4X4NA 2MKSA 2ATLA 2C2DA 1CS4B 3FUYA 4RUAA 3LWMA 2VBZA 3ADAC 3CUNA 4CNZA 1Y5NB 3EXCX 1CSJA 4YB7A 3LP0B 1OSCA 1IBKJ 3PHTA 2B56A 4PG5A 3D7SB 1RWNB 1ZAWA 1RHQB 1YJTA 2QO3A 1H6KX 4XDCA 4F0MA 2DYAA 3GV7B 3TAMB 1N48A 1DZ5A 4N8NA 3NGKA 2GO9A 3RAQA 2MQOA 4IDKB 1UKUA 4OI1A 2YX1A 1PJ7A 1GFWB 3BBFA 2GMHA 3MOJB 2XMVA 4KFBB 1EZZB 1NHUA 2DIVA 1TL3A 3FSYA 4F4ZA 5KFQA 3MI7X 2IPOB 5KT6A 2PDAA 1EQMA 4CO0A 1SL1A 4ZVOB 1FWKA 7FD1A 3HVTA 2C3MA 4PWWA 2G0CA 3BKFA 2CADA 1TFYA 2AHOB 4BDPA 3VF0B 5U47A 2LXIA 2PMHA 5C24B 1L3TA 1T94A 5A76A 3PYDA 2KM8B 3KLGB 1YBTA 4X62J 1YQHA 5CYQA 4NLQA 4ELTA 4JI5J 1SJQA 3BN7A 2DXFA 2B51A 1U1NA 1U6ZA 1VQLS 3HD1A 3W66A 1R31A 3DM2B 3CTRA 4DPOA 4KKOA 4KSEB 1XNRF 1KLNA 3CJ2A 2RQCA 1IQTA 1UWBA 3ET6A 2V2ZA 4NYOA 5DJBA 3BN4A 3JYTB 2JWNA 4LF1A 3CC4S 2MQ8A 3ELHA 2UVRA 3D68A 3ETMA 1RA7A 5A8WB 1S1XA 5ETLA 4LR8A 3G8SA 2HFUA 3C16A 1O5JA 3BGFA 1YTYA 3WHIA 3FC9A 3D3BJ 2B9EA 4LQ3A 4FXDA 3BR9A 1VQ4S 3K5LA 1VHFA 1FVSA 2CJAA 1VLYA 4I64A 5E41A 3M8RA 4NCAA 2EK6A
chains in the Genus database with same CATH topology
5KTQA 3VAGA 2FJEB 2CPFA 2IRYA 4Y28C 4O3QA 4Z2XA 5GAGI 2KG1A 4OX7A 1YRTA 2N82B 2M5YA 2HNYB 2LA4A 3BF4A 1VQSA 1ZM2A 4N8OA 3CDUA 4NLWA 4RW8B 2PO4A 3MMCA 3Q22A 5I3UB 4Q5VA 2BR0A 4DR4F 1B7FA 1T05B 5LXRA 4C9DA 1VBXA 4X84A 2ZJRQ 2GJ2A 3FVYA 3GYNA 4EBEA 2QIFA 1SQEA 3U7JA 3I5BA 5M2RA 1P6TA 4M8LA 3VWSA 3D0IE 3MHYA 3ZZZA 3J7YU 3GFYA 3U02A 2IMWP 1HMVB 3MR3A 1HWJA 3DLGB 2JLFA 3L7PA 4IG0B 1CPZA 3DXBA 4BWJA 4DJBA 5F8MA 4DV1F 2J7UA 3C6UA 3QMQA 4ITSA 1JNRB 7FDRA 4DFPA 2AJ4A 4A8SA 1M5PC 3I0SB 1U1MA 3H2VE 2P6SA 1GH8A 4FPRA 3CDEA 4M1KA 5GADU 2MHNA 1R6YA 1N88A 1NO8A 1ZM9A 3F56A 4PXEA 3CCRS 1FTCA 1XR7A 1LKZA 1TKTA 2ZC3A 4DS5A 2OTLS 3R5BA 1G3OA 5A6WA 1Y7PA 3WZ0A 2UVUA 4L3NA 2AD9A 4F3OA 4RX6A 3DU6A 2ZOFA 3S8SA 4DF4A 5KFLA 2FGOA 2JVRA 1F2GA 1SC6A 4IH6A 4KR0B 2KU7A 2PD1A 1VQ5S 4RU9A 4MIBA 5A2QY 2YX4A 4QWCA 3SV3A 3M4XA 2J7WA 1TV6B 3T6JA 2ZBIA 4ZCMA 4X4SA 3CC7S 1TK5A 1J2VA 4AL7A 2QE5A 1HBMA 3V6HA 2HGNA 3I56S 2JC1A 2RKIB 4CNYA 2FDNA 3AH6A 2B9YA 3I6PA 2RILA 4CH7A 1XC9A 3R3TA 2NUHA 3RB4A 2IC3B 3HHEA 4OJ3A 3MM8A 1WWHA 1SJ3P 5I3PA 3CCMS 1PSDA 1IKXA 4ZCKA 2BQ3A 3N6MA 4DSFA 4AL6A 2VPYB 1HPZB 3O3LA 3CMES 3DYAB 4G1QA 1G7CB 2IM1A 3VAIA 3M2UB 2YNIB 4PCQA 4R8UA 3HMJG 5KFNA 1NHVA 3Q8PB 4HYKA 2LMIA 2HHSA 1JB0C 4J9SA 1H3DA 2FC8A 3IR7B 4RW4A 5F8NA 2HNZB 4CT9A 1HWLA 3SCLE 3N0VA 4DR3F 2GW8A 2R2UA 1NKEA 1IKYB 1S1UA 4HT7A 2IM2A 4KPYA 4TXSA 3TAPA 1U2FA 5D8HB 2ZDPA 1BWEA 1VRUB 1FJ7A 3CSKA 4CO4A 5J2MB 5CYMB 4CO1A 3CGIA 4PWDB 2XGPA 3I4HX 1RTHB 5F3TA 2PIIA 3NKYA 1YJNS 2W9AA 4NLXA 4PG8A 2I0XA 4TU7A 1VQKS 3C66A 3EYZA 1TKDA 2YY3A 2DNKA 2ZUGA 1QVFR 4CZCA 2BDPA 1DJ0A 3DHWC 5C5JA 1RT4A 2WB4A 3THTA 3OFEA 2KTQA 1R8BA 3G6ES 2VOPA 2F8MA 2RVJA 3IGNA 4ID5B 2R8KA 5L9NA 4ED2A 4IOCQ 3QGGA 1YGYA 5HLFA 2OPRA 3DRPA 2OLWA 3AB4B 3HHNB 3M2RA 3TP2A 5EWGA 3TUZC 5EN1A 5MLCV 1Q7LB 5L39A 1SL0A 3BREA 3TAQA 3FFIB 2WSEC 1HWKA 5IM0B 2UP1A 3NMRA 2D41A 4G1IA 2CQ1A 1X0PA 1HARA 1RKIA 2BM1A 3BGLA 3K7RA 2KH9A 4LMZA 4NLYA 5KT5A 3JTOA 3DOKB 5CZVA 3TQ1A 3FNNA 4NLTA 3J81Y 4NCGA 2J6SA 2VFSA 3RW6A 1S6OA 2VC0A 2WSFC 4MYUA 3CJKA 4K5RA 2DBBA 1NZAA 4YB5A 4DR1F 3M8QB 3TA1A 1WG4A 2YKNA 4AYBD 4X4UA 4CI0B 4TNOA 1KQGB 1DQ9A 3LH2S 2VG5B 3DI6B 2K2PA 1IKVA 1D9AA 4OHYA 4DQRA 3H5UA 3OR1A 1FK9B 4X2BA 3ITHA 1JK9B 1RT7A 2JEGA 2E1RA 2YWGA 5G4DA 2E7XA 1Y5LB 1Q1KA 1X5TA 4X4RA 3OXFA 4LF6F 1OSDA 2HLUA 4PKDB 2PMZD 3KHLA 4DSEA 3OSPA 1W25A 4ZP7A 3US5A 2F9JA 2XMJA 2MY8A 5A8KB 2WONA 3NWGA 2R7XA 2KRBA 1D0EA 2J76E 2CKWA 5KAKA 1LOUA 1UETA 2LVWA 3H5XA 5M2UA 4BC9A 4Y2CA 2YKAA 1KQKA 1P1LA 2JDJA 3W2WA 4RLEA 2MQPA 1ROFA 3HHLB 3LUYA 1LW2B 5AJ3F 3MWBA 1NK8A 2NXUA 4C8OA 2O1PA 5D78A 5DLFA 1NB7A 4WIIA 1S1WB 3BQ0A 2R9LA 2JOQA 3K5NA 2J8AA 3G86A 2NS1B 4OL8A 2X1BA 3LGMA 2MXYA 2ROGA 1DTTA 4HVZA 4ZVFA 2Z2MA 4ZHRA 3MEEA 2DNQA 1T3NA 1NKCA 5CH7B 2CQ2A 2FVPA 2XS5A 1VOMA 4TLRA 3KLIA 5M2PA 1SJ4P 4DV5F 2VC1A 3DHXA 4F02A 3B8HA 4DHVA 2W9CA 5GVQA 2ZHOA 2L48A 1FRMA 1JXEA 2VUGA 2OPSA 2MKJA 4Y6IA 1RISA 4RNMA 3QLHA 4IG3A 4TQRA 5D3GA 4RW7A 2H5EA 4WKRA 1F60B 2EKYA 4OI4A 1SKSA 4MKBA 3MM5A 1V3ZA 1MSWD 4XO0A 3N4WA 2FJDB 1U45A 1AW0A 1FHTA 3KYLA 1TK8A 3EGZA 3RW7A 4TU9A 1APSA 1LW0A 2L08A 5CA5A 1NK0A 3FEYB 4F50A 2E5LF 1FCAA 2DNOA 1BQNB 4JV1A 4J9LA 2KVIA 2V4RA 4DN0A 4LFBF 1Z2ZA 1SUQA 2BBEA 2ZJPQ 3D2WA 2LDIA 4I6WA 4BBYA 2XS2A 1X8DA 3JSMB 2HGMA 3IAM9 1HA1A 3QWPA 1SH2A 1HWIA 1LQ9A 1LWEA 2W8KA 2GO8A 1RT3A 3ISND 3O44A 3MM6A 2VG6A 5FDLB 1T03A 3CD7A 2KDOA 3UPFA 3NMAA 5EGYA 5SZTA 4W92B 2YNGA 2DCLA 3MEGA 5K5MA 4TQSA 3G96A 1VRTB 3CT9A 4PR6A 3G4SS 3LALA 3POTA 2KM8C 3NNHA 3I0RA 3A1YG 4DLEA 4YR2A 4C98A 1GNKA 2EPIA 3MEDA 3PR5B 2ZKTA 1RT2B 2RSQA 4OFZA 3J7Z5 4ZCLA 1FT8A 1XK8A 3M32B 1NU4A 4U6PA 2KHDA 5GAGU 3RBEA 3CCVS 3WC0A 4KHMA 4OZ1A 1HQEB 4C2MA 2UVVA 1X9MA 5L9XA 4K4SA 1ZM4A 3MF5A 2GCFA 1WHVA 4DSKA 1YITS 2VODA 3E01B 2MJUA 2D9OA 3G8QA 2OAUA 4OHVA 4OLOA 5C25B 3KOAA 3OSNA 4I69A 3OQ2A 3H25A 2UUTA 3OL9A 5EWEA 5IZHA 4FF3A 1SKRA 2B7BB 4C97A 1XEZA 3NBPB 1TKXA 3LPYA 4ZP9A 1UJ4A 1N5TA 4QQBA 2GA7A 2UXBF 1FDAA 1CQNA 2A18A 2GQQA 3MTKA 2B6AB 5B08A 3OLBA 3HPOA 2CPDA 2OH2A 1R0AB 1B64A 2LDYA 2PC6A 5E5NA 4YHHF 2W7OA 2ZC4A 3RB3A 1XR5A 4PG7A 1KQSR 3Q2TC 5B0EA 4OZLA 4ES1A 2GHVC 1IBKF 2MZRA 3KNGA 4OQJA 2FJXA 4PG4A 4HT5A 3N5BA 4WTYA 3SDEA 4K4WA 1XBWA 1M5HA 1KFDA 3BEGB 3DC2A 3KLHB 1TKZB 2P9GA 2A2DA 1TL1A 4I0WA 4OZJA 3SV4A 2AYBA 5BR8F 3G6XA 5IQ6A 1R43A 4HLBA 4O23A 4IUFA 3MDFA 4QR2A 2DGSA 5G0RB 2O01C 1KNZA 4WZQA 4ZPBA 5CHCB 4ZK7M 1S48A 2E29A 1O51A 4TY9A 1FKOB 5LMNF 2KXFA 4JI7F 2GIRA 1KR4A 1Y9OA 1KVJA 2OMOA 2XGQA 1GXTA 4F4YA 3UNGC 3N5FA 3P5TL 5KOWA 2Z0GA 4TY8B 5J2QB 5DGAA 1FEHA 2RF2A 1HQUA 5JUMA 4Q45A 2W9BB 4ELUA 3DLHA 4I68A 2GQCA 3W2VA 2BXJA 3L95X 5B0FA 1A6LA 3IA0A 5A0YA 1PC5A 3AA9A 4HHJA 3NAIA 1NK4A 1S1VB 5T14A 5H9EJ 5HQ8A 2ZVSA 4JI0F 2ZHAA 1RAJA 2CQCA