5IM0B

Crystal structure of the rna recognition motif of mrna decay regulator auf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein D0
publication title Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5im0B00
1D9AA 2LXUA 1X4GA 3NS6A 1U1OA 3G71S 1OO0B 1X5SA 2AYEA 2HGLA 3EX7B 2KM8B 2KFYA 2K3KA 4IOCQ 5LSLA 1DZ5A 1R8PA 1WF2A 2DGSA 2DHGA 3U1MA 2LMIA 4F25A 3UD3P 2DHSA 2MKSA 2X1AA 2DNMA 2HVZA 2XS5A 4FXVA 3CCMS 1D8ZA 5DDRC 2LA6A 1X4CA 1FJ7A 2N3LA 4QPTA 5DDQC 2M70A 1KOOA 3LQVA 2DITA 2HGNA 2KM8C 3CC2S 1U1NA 2Q79A 2YH0A 5CA5A 1N8RT 5LSOA 1U6BA 5D77A 4FXWA 2D9PA 2ZJQQ 1ZZFA 2LQ5A 5LXYA 1DRZA 3FEYB 2EK6A 2QA4S 3V4MA 1VQNS 3MUVP 5D78A 2OTJS 5GAGU 1N88A 2LECA 5LJ3Y 1WTBA 2DO4A 2MQOA 2LA4A 3CCJS 2DNNA 2RU3A 2HYIB 2RUGA 3G8SA 1VBXA 2CQ3A 5CXTA 2D9OA 2MKCA 3CCQS 2M4MA 1K9MT 2OSRA 2ZJRQ 2CPIA 1NJIT 4WCEQ 3UWTA 2OJ3A 3VAHA 1VC0A 3ZZZA 3MOJB 1M5VC 2AYGA 2CQHA 2WBRA 3Q2SC 1U1RA 2MKIA 2J8AA 2ERRA 1HL6A 2M0GB 3TYTA 2DH7A 5DDOC 1U1KA 2RVJA 2GO9A 2J76E 2MJUA 1VQ4S 1WG1A 1WEZA 2FC9A 4ED5A 3P5TL 2FY1A 1BY9A 2HZCA 3PIPQ 2FHOB 1WHYA 5H1SV 2BZ2A 3US5A 2DK2A 2MJNA 1H6KX 1M90T 3CULA 2M88A 2F9DA 1U2FA 1PO6A 2N82B 3G9CA 2E5JA 2KXNB 1U6FA 1WF0A 1VQ6S 1OIAA 2CQ1A 2DNQA 2G1DA 5GADU 2G4BA 3D2WA 2NLWA 3JB9k 3VAGA 2UP1A 2EK1A 2MZJA 2KYXA 4W92B 1U1MA 3SDEA 2FC8A 2O3DA 1VQ8S 2YWKA 2RS2A 1O0PA 2LEBA 4J5OA 5HL7Q 4PRFA 2KRBA 2U1AA 1YIJS 2FPHX 2DGVA 5JVHQ 1KOHA 2L41A 3UCUP 1JMTA 4WKRA 2OTLS 1WEXA 1K8AT 3P6YC 3BO4A 1Q82T 1VBZA 1RKJA 2JVRA 4PKDB 3UCGA 2QFJA 2CPZA 3J7ZT 1RK8A 2X1GA 1X4BA 2EVZA 2MQNA 2LYVA 3ULHA 2MZTA 4C4WA 2CQ4A 1KQSR 2VODA 1OPIA 4CH0S 2DB1A 2DISA 4TLQA 1H2TZ 1X4EA 2JVOA 2MQPA 1NU4A 4WIIA 2DNYA 3MUTP 1JJ2R 4YB1P 3VAIA 2DGOA 2NZ4A 2MYFA 2DIVA 3R1HA 1VQLS 2RQ4A 4M5DB 1VQMS 2CQDA 2RNEA 4QU7A 4BS2A 1VQPS 1WG5A 2DNHA 2XS2A 3CD6S 2E5GA 3LPYA 2CJKA 2DGQA 2YTCA 2MHNA 2KN4A 2M7SA 2CPHA 2DNPA 3NS5A 2LKZA 1YWXA 1AUDA 1VC5A 2DHXA 4QQBA 1N52B 4Z2XA 1WG4A 3CXCR 2MKJA 1K73T 1FJCA 1FO1A 3CCSS 2DNRA 5FJ4A 2CQ2A 1Q86T 2GHPA 4F26A 4LMZA 3IRWP 3CC4S 3CTRA 2J0SD 3MI7X 2XB2D 2B0GA 3PIOQ 1SJ4P 2DO0A 2U2FA 3OW2R 2CPJA 3EGNA 3G8TA 1VQOS 1U1LA 2ADCA 3CUNA 3CCES 1Q7YT 4C7QA 5BJRA 2AYMA 3SDEB 2MKHA 4OZ0A 2MXYA 1L3KA 5CYJA 2M8HA 2MSSA 3UCZP 1WHVA 1W2BR 2E5HA 3G4SS 2OSQA 4U67Q 4WFNQ 1NO8A 2MZ1A 4UY8T 3S6EA 1M5KC 1M5OC 3VF0B 2YKAA 2LXIA 3HHNB 2VOOA 2DNGA 1WWHA 4TU7A 3DXBA 3Q2TC 1X5PA 3CC7S 2J0QD 2MZQA 1WHWA 4EGLA 5LXRA 3I56S 3THTA 3G96A 2KU7A 1FJEB 1VQ5S 4WF9Q 1WHXA 2I38A 1X4AA 3S7RA 3B4DA 3ZZYA 2ZJPQ 1X4DA 4V19X 1JJHA 2MQMA 1X4HA 2MZRA 2KT5A 1X0FA 4CQ1A 3MDFA 4YUDA 1HA1A 3BEGB 5HO4A 2D3OR 5DDPC 2MSTA 1QVFR 2KG1A 1ZZNA 1R8HA 2CQIA 2M9KA 3BS9A 1P27B 4IOAQ 3CPWR 1FT8A 2M2BA 1KC8T 2RRBA 2DGTA 3SMZA 3U1LA 5IFMA 5LJ5Y 1WELA 3NNAA 3S01A 5GAEU 2DGUA 2CQCA 3TP2A 2CPXA 2V94A 3H2VE 3VAKA 4QU6A 2LCWA 2MB0B 2OIHA 2SXLA 1YJNS 3S8SA 2XNRA 1IQTA 4A8XA 1SJ3P 5GVQA 1CVJA 5EN1A 3VALA 2KRRA 1B7FA 4RU2A 3K0JA 2KH9A 5GAHU 1H2UX 2DGXA 1VQ7S 2X1BA 2AD9A 1URNA 2RRAA 3IWNC 3R27A 3NNCA 2BOPA 2MKKA 3P3DA 4IO9Q 3CF5Q 2E44A 2MMYA 1HD0A 2DNLA 1HD1A 2CPYA 4F02A 1YI2S 2VOPA 2X1FA 4Y0FA 5IQQA 1A9NB 2RT3A 4WFAQ 2MY8A 2F9JA 2CPEA 1WF1A 2M52A 2PEHA 1N54B 4OZ1A 2PE8A 1S79A 2E5IA 2CQBA 1FHTA 2CQ0A 2I2YA 1UAWA 1VQ9S 4LJMA 1VQKS 1M5PC 2L08A 1SXLA 2JRSA 3UE2A 3VAMA 3NNHA 4CIOA 1P1TA 1OWXA 1FNXH 2MQQA 2RS8A 1A7GE 3BO3A 3BO2A 3CCVS 3UD4P 2MY7A 5JVGQ 2G0CA 2MGZA 1Q81T 2DNKA 5ITHA 4Y00A 2CPFA 1WI8A 1PGZA 1WEYA 3MXHP 5MLCV 2L9WA 4TU9A 2HGMA 5IM0A 3MURP 3RW6A 3L3CA 3EGZA 3THPA 2CPDA 2DIUA 1X5TA 2DGWA 2YH1A 2ADBA 5DETA 3DLLQ 2N3OA 2CQPA 1F9FA 1KD1T 3P49B 4LIRA 2XSFA 2DNZA 1YTYA 3J7YU 3CCLS 2CQGA 3VAFA 2KXHA 2KG0A 3H2UB 2MZSA 3CMES 3VAJA 4TU8A 1UP1A 1H2VZ 2DH9A 1WI6A 3MD3A 1X4FA 3NMRA 1U1PA 1QVGR 2DNOA 2A3JA 3CCUS 2MQLA 1SJFA 3TO8A 2N7CA 1UFWA 5GMKa 4IUFA 4ERDA 1FXLA 1YITS 1YHQS 1ZH5A 3FEXB 4YOEA 3G6ES 2DH8A 3RW7A 4UQTA 1SJQA 3HI9A 3CCRS 4C0OC 1M1KT 2JX2A 3SXLA 1JJ4A 1DHMA 3I55S 4PR6A 4CH1A 1U1QA 2AYBA 2M8DB 3MUMP 1QM9A 2MPUA 5DM7Q 3R1LA 1G2EA 3CMAS 2KXFA 2F3JA 2DHAA 2VONA 2JWNA 5DM6Q 2MGZB 2RQCA 1X5OA 1YJ9S 1S72S 1VBYA 1SJRA 2QEXS 2K8GA 3MD1A 2KHCA 2KVIA 2XNQA 4ZKAA 4P6QA 1DBDA 4W90B 1UW4A 2KI2A 3B4MA 2XS7A 1XN9A 1VC6A 5IM0B 1YJWS 2LEAA 4WFBQ 3N9UC
chains in the Genus database with same CATH superfamily
5D3GB 1U1OA 1Q79A 5KFYA 3QT5A 3PACA 3OTOF 1XWLA 2ROEA 2X1AA 4FXVA 4HT7A 5DDRC 1U26A 2N3LA 5ETRA 1XC9A 4TKTA 1N8RT 5KG6A 5D77A 2H51B 3FEYB 1WKKA 4PWDB 1IWGA 2FJWA 4V1Ak 3L09A 4JP8A 4ED3A 4OI0A 3GQCA 3DOKB 1RTDA 5C5JA 2D9OA 5CQGA 3FSXA 2BANA 2YX7A 1SKUB 5HAOA 2H5EA 1SQGA 1FRMA 1QTNB 2WBRA 4L72B 1WSVA 4C8ZA 2J8AA 2DH7A 4M5DA 3EPGA 4K4WA 2WVCA 3V6DB 3JXOA 2BQUA 3HVRA 3MEDA 2FJEB 2MJNA 2V9KA 1AZSB 1V9OA 1WF0A 2OMOA 3P5BP 2V68A 3A8KA 1RAFB 2ZNYA 1REVB 1OSDA 2YNGB 1WC5A 1I94J 4JV2A 1BQMA 1KOHA 1CSJA 4JOUA 3LW5C 4DPWA 1S5ZA 1FRIA 3CDUA 5D4NA 3V81A 4RW7B 3DOMA 2CQ4A 1MROA 4G1PA 4DFJA 3BBBA 2IJFA 1H2TZ 3FBCA 1NU4A 5KG7A 1TK8A 2DGOA 2FHKA 2NZ4A 2OKQA 1NK6A 3QNWB 4DUYF 2G0JA 1IWAA 2DGQA 3FQLA 3D1OA 2MHNA 5KOXA 3KUHA 4IFYA 3ISNC 1NPPA 2Q6BA 2GJ2A 1F5BA 3D4JA 1IBMJ 5FDLB 2MHEA 3MAHA 1VK3A 1EKSA 1YSJA 1RAIB 2DO0A 3Q89A 2V4JB 2BE2B 1FVQA 2E5HA 2ZH5A 3I96A 3I0RB 3K5MA 3PX6A 1HW8A 4WPAA 3HHNB 1V3ZA 3QPIA 5HK4A 2VUGA 2H1YA 3QSIA 1WHWA 4RO0A 3ZTPA 4DPOA 3I56S 3ITHB 3I0SB 2OPSB 3ZZOA 1VQ5S 1U6ZA 4Y2CA 3R7BB 2G13A 3N79A 3QATA 4M63A 1JLCA 4EYHB 5KTQA 1NBEB 1HMVA 2CQIA 1T7PA 2P2CB 2CZ4A 1IBLJ 1KTVA 3AODA 3ZZUA 2ZH2A 1IBKJ 2FVPA 2RRBA 1TFWA 3HSDA 4MKYA 3TARA 1Y3KA 2CQCA 3W8GA 3J7Z5 4LSZB 3RYLA 1D0EA 1DURA 4S0MA 2QSFA 5H9EJ 3A8EA 2P8IA 4DR1F 2FJXA 4ETZA 5D0HA 5LM7E 3CCWA 3IBCB 2R8JA 5EN1A 2KRRA 3NG8A 2DGXA 4IG0B 2ZOGA 4ZIVA 1RYRA 5HI7A 1HQUB 2GQ2A 2DNLA 1YI2S 2PA8D 1I94F 1CJTB 3MMAA 3TVYA 3QIPA 2W9CB 1N5TA 2ZBIA 3WDOA 4DV2J 2I2YA 4Q7AA 2XMMA 1SI9A 5KFCA 2NXJA 4DDFA 2KVQE 4WKYA 2ASJA 4ID8A 2AQ4A 5DRKA 4WK1A 4W4MA 1EZZB 1WI8A 3OTCA 5EUHA 5KFGA 4KTQA 4EBEA 3KLIA 2HVEA 3IP0A 2XSFA 3KDOA 2P9EA 3BSNA 1IVZA 5HATA 4WZQA 2EEYA 3C3LA 3TRGA 1HBOA 3HZEA 2EC0A 2FZGB 2C3OA 3LP0B 2NXUA 5E3CA 4GKKF 2E5LF 3CT9A 2KZMA 2AZ3A 1FDAA 3PW2A 4KHRA 4ERDA 5B08A 2VG7B 2HBRB 4HYKA 4LFBF 1CS4B 2Q3PA 4X4PA 1QAYA 3MECB 2JH3A 1X5OA 5GAGI 3TAPA 2HZAA 4DJBA 2KVIA 3GYNA 2Z2LA 2ZC3A 2GIRA 1P9QC 1X4GA 5DZ6A 2R2RA 1WC6A 1UPMB 3DGVA 3MFHA 1FE0A 4X4NA 2IRYA 1LWCB 3D1HA 2ZD1A 4ZP7A 3CJ4A 3CO0P 4J9RA 5HJYA 1ZZFA 2ZJQQ 2ACMA 3OR1A 5M2RA 1Q53A 1VI7A 5AE3A 2V4QA 1S1UA 4X84A 1RHRB 1LW2B 1T0TV 5E3RA 4TN2A 2E1MC 1C0UB 2XO7A 3AH6A 3HHLA 2CPIA 2JSXA 3IGNA 3CJ8A 2CJ9A 2UUCF 3TAMB 1HL6A 4ZDNA 3TWZA 5DDOC 1U1KA 2RVJA 2IBOA 3H5UA 1FKPA 3RRHA 3KJVB 3VZIA 1SCJB 4ATNA 4LR9A 1LKZA 4C8MA 1GXLA 3LWLA 2IMWP 2ALYB 3ZTRA 4WIQA 2DBBA 3DCAA 4W92B 4N41A 2HQIA 2XMAA 4DV3J 1YIJS 3H4DA 2CDQA 5F9LA 3A3NB 2DT9A 3BO4A 1VBZA 1SV5A 1YRTA 3W2VA 1RK8A 3LANA 2D3ZA 2XHCA 1QSYA 3MR2A 2PD1A 2LDYA 1DTTB 2H4YB 3KLFA 4WIIA 1SJ1A 2ZHAA 3BGLA 3OD2A 4BS2A 1Q8LA 3RAMA 5L39A 3BYRA 1CQNA 4OYIA 4QQBA 4ELVA 4Y2MA 1S1TA 3MEGA 4KSEB 3J7YI 3NGUA 4KGZB 2DCLA 2CWXA 2ZVSA 1HKAA 3D0HE 2B0GA 1C1CB 4FN5A 4O3RA 4C3MA 4G1IA 4GVLA 1A6LA 2IDLA 4ZIWA 4RW9A 5D4PA 2XYGB 3I31A 1NO8A 2MZ1A 1VK8A 3D67A 3L4BC 5L9NA 2B7BB 1BUXA 2AZ1A 1SC1B 4EGLA 5HBMB 3F41A 4FYYB 1IKYA 5J2MA 2CVEA 4I0WA 4DPYA 2OLWA 4O44A 1X4HA 2PC6A 2E66A 1PCAA 2HMIB 1S1XA 3AJ2A 2NXNA 4MT1A 4HTJA 3BV8A 2AF6A 3M8PA 1QSSA 2R7VA 1F5AA 6AT1B 2EXUA 2DGTA 2EC2A 2RJZA 4JI1J 2XEXA 2E1RA 3TP2A 3VAKA 4I64A 4H4OA 2OIHA 2EFNA 1RT7B 3OTDA 1V3RA 2Y8YA 4FP9A 1RT2B 4PG8A 2RUSA 1URNA 5JUMA 2NYHA 5CHCB 3FVYA 4C98A 2Y9HA 1AROP 2VHGA 3ILJA 4I1TA 4Y0FA 2DEJA 3R3TA 4KQZA 2AW0A 3CO9A 4IRDA 5HP1B 2IAJB 3PDNA 3PVXA 4OHZA 2R7RA 2J7KA 3FEZA 4ECSA 3IM9A 2F4FA 3ET6A 2XY6A 1F2HA 4AT1B 3SCIE 4FNIA 1MN9A 4WTOB 4XO0A 1PKUA 2BX6A 2R7WA 5KFUA 2LXFA 3T1AA 4B9LA 3BKUA 5K20B 2Z2MA 1S9GA 5LL6d 2DNZA 4OFZA 1IKXB 4USWA 3PO5A 1L3TA 1RLDA 1K1SA 5ETTA 5U47A 2VFVA 2P5VA 3W5YA 2C3MA 3BSCA 1KLMB 1UFKA 5A0YB 4OYMA 2OAUA 2JC0A 2VPZB 3B6BA 1RAOA 1KQKA 3DRYA 1XR7A 4YOEA 5HMYA 1PAUB 5FLXY 4ED4A 3HI9A 3CCRS 2BQ3A 4XIUA 3LGMA 4WU3A 1FDDA 3CDAA 3OV7A 5J1EB 2XMUA 4I69A 2WB1D 2AGQA 4K4VA 4ZHRB 3BSOA 4F36A 1CJVA 1W2IA 1WOSA 1VC6A 3EE3A 1RU1A 3N9UC 1WKLA 1IR0A 5HQMA 2Z56B 2ZBQA 2K3KA 1DZ5A 1TVRA 4JI1F 3I87A 4LFAF 3T1YF 2DHSA 1I5OB 1FNMA 4U96A 5DG8A 2HS4A 2JEIA 1X4CA 4NOHA 3C6TA 4DQRA 2XO6A 3UNGC 2CJYB 2IPOB 2OH2A 4IR9A 1UWAA 4NLUA 4HH1A 4KO0A 2YPYA 5KFPA 1HQEA 3DOLA 5HROA 2HNYB 1ZAVA 1MW7A 2OPQB 5EX3A 2R7XA 2MKCA 4UOCA 4B9VA 4P2FA 1YGYA 1S7IA 2UUBF 1NNDA 2GVDB 1R6VA 5ETNA 3HHDA 1LWEB 3ZZZA 4H4MB 4ZJOA 3C6UB 3OXFA 2R8KA 2MKIA 3D9BA 1C4AA 5FLXU 3K58A 1FRJA 3ILOA 5KFRA 2H9ZA 2WSFC 4Y6IA 3G9CA 1FJGF 2HAIA 4Q2MA 3VCDA 2DNQA 2WSCC 4F4YA 3QO9A 5J1NA 4XDCA 2IVMA 3DGPB 2AJ2A 4N8NA 1J5EF 2KYXA 2VC0A 3B54A 4PRFA 1HBUA 5K14B 1RYSA 5J2NB 1K0VA 3UNYA 8ATCB 3UCUP 2VFSA 3R7SB 3M05A 1RKJA 3LP2B 2FJBB 3ZTOA 4X4TA 3GB0A 2DNYA 2B9YA 3EWGA 3QMQA 2XYPB 3I9V9 4O3SA 1S1WB 4QU7A 3H25A 1KQFB 4DUTA 3LPYA 4JI7J 3LP1B 2CPHA 2OPRB 2YQ1A 2LKZA 2DHXA 4O23A 1WG4A 2EFOA 4CO1A 2LDIA 3PXGa 2VD3A 2R7OA 2BE7D 1VRQC 3M9NB 3OR2B 1UVMA 4J9VA 2U2FA 2CPJA 2Z2ZA 4JI4J 3C8YA 4ID5A 4U9RA 1JKHB 4WJBA 3SV4A 1RCOB 4ZVGA 2ZBCA 3HFVA 3VF0B 1NKBA 3FBEA 4BC9A 1EHWA 1KHVA 1TL7B 2YWEA 3MM6A 1Z2LA 3TANA 5EWEA 1R7IA 2EFGA 2POKA 1TAUA 2BJDA 2QLWA 1NK5A 1ULRA 3GWCA 5HVHA 1V5IB 3O44A 4GMKA 2NXCA 4RW4B 3BEGB 4CDIA 4X4VA 2VV5A 1EIYB 1SC3B 4U8VA 3NAHA 3CPWR 1UEVA 2AWZA 4O0IA 3HFKA 5DG7A 5L38A 3QRQA 1XIQA 4RW6B 4ICLA 3X1LB 1GH8A 2WVEA 4DSJA 2FB0A 4DL3A 4DEZA 4XPCA 2YBVA 3DYAA 3OSPA 2OELA 1S77D 2XHWA 3ZTSA 3VVUA 1RT4A 2R4FA 1KKHA 1SH2A 2UVVA 1VQ7S 1RCXB 1BD6A 5SZTA 1I1GA 2NCKL 3O5TB 2EWHA 4LSLB 5F8GA 3B78A 5K8MA 1UCNA 3V6HA 4NXNJ 4ILRA 3NBPA 4OX9F 1KS2A 3DLEB 1HQ2A 4PXCA 4C8KA 6FDRA 4CRJA 2JRSA 3NNHA 1KLNA 2Q43A 3SV3A 2YKMB 2ZC4A 3TQEA 3BO3A 3KUEA 2MY7A 1PGZA 1CJUA 1DTQB 1P9YA 4Q8EA 5IM0A 2BJ9A 2FLLA 5D3GA 1KFDA 4DL2A 2K7JA 4OJGA 4DUZF 2W2PP 3NP5A 4KV8B 2V2KA 3BPSP 3CMES 4NWBA 3N5FA 2X7IA 2BJ7A 1UPPA 4WXOA 2VBZA 3V5RA 3GMGA 4J7CA 3CCUS 4PWDA 3MFIA 2HWIA 4CLZA 3KHHA 2IJNA 3RW7A 3DOKA 5KFLA 5A6WA 3TVZA 4ZPWR 4HACB 2AIRB 2RQCA 1U45A 3TW0A 2UZAA 1S72S 2C2EA 2XS7A 2JNJA 5A2QY 3V6DA 4U95A 2LXUA 2QV6A 1SKWA 4IOCQ 1AZSA 2L9NA 3EZ5A 4L3NA 1WJ9A 2FHMA 4NPOA 1HW9A 1FJ7A 4YB5A 1TMMA 1REVA 1NPKA 2F40A 3G2XA 1FEEA 2YNGA 5BYQA 3O1LA 5D78A 2LECA 3D6MB 4CM2A 3AOCA 4ZMMA 2MQOA 4IDKB 3R9LA 3PZPA 2HK2A 4NXNF 1G7CB 1WOOA 5CXTA 2UV8G 4RW7A 3W5XA 3MHYA 4DN9A 3CCQS 3D6TB 4FF1A 2ZJRQ 2IM3A 5JXSA 1S6OA 1NJIT 3UWTA 3KJFB 3G6VA 3MAQA 8AT1B 2RHSB 2MQ8A 2HBZB 5KT3A 1YRUA 1UEUA 4IR1A 3AOBA 3K8VA 1SUQB 4JI6J 3SCLE 1WHYA 4GC6A 3HM9A 5GMDA 2ZH8A 3OTEA 4LF5J 5FDLA 3IBFB 3MR5A 3PG9A 1Y4ZB 1RQ0A 4E8UA 3OJSA 4FVMA 1OY8A 1S6PB 2F5GA 1X60A 4WP8A 2V4JA 2BE2A 3PY8A 1TQLA 4J5OA 1YJUA 4RUAA 3I0RA 3K89A 5JVHQ 4C8LA 2N7YA 4WKRA 2RDJA 1NSKL 4OHYA 1RZMA 2KO1A 3D3BJ 4DR2F 4B3SJ 1RJJA 4N77A 4NZ6A 3ITHA 3A8JA 4KPCA 3I0SA 2OPSA 3OL7A 4DSFA 3ZZPA 4UW2A 1SIZA 3Q0AA 4UUWA 3JAMY 3MUTP 1RHQB 2WW8A 2ZKUA 3GG1A 3SQGB 4QW8A 2IDEA 4NX9A 4KB7A 4LRAA 3CCSS 2CQ2A 4IOBA 4LF4J 4LMZA 3CC4S 2W1BA 3AD9C 2DR5A 1URRA 2PDAA 4IH6A 2ZH6A 3M2UB 5HVFA 4IO1A 1AT1B 3NOGA 3Q24A 4DR5F 4PCQA 4WFNQ 4IG0A 3IO1A 1EQ0A 1NRKA 3RB3A 2LXIA 3Q2TC 4IYQA 1HQUA 1UVLA 1CJTA 3LPEA 1YBTA 2VDHA 2W9CA 4U7UD 1VQYA 3KDNA 4NXMF 2W8LA 2FHJD 4X4RA 4V19X 2ZM6J 5BR8J 3FZ2A 3OJUA 4D3GA 2GZOA 1HA1A 3W61A 5CCMA 5D4OA 1N5VA 3WX8A 1C2PA 1N36F 2IM2A 5ETVA 1R0BG 2FJVA 2VQEF 4DV6F 4LVOP 1B0PA 4RU9A 1IR1A 2V4RA 1HNZJ 1VCTA 1RT6B 1QAXA 2HURA 4CZCA 1SH0A 1VJQA 2MKKA 3NGDA 3M9MB 4DR6F 1UA1A 4F02A 3LP0A 4LF7F 2ALZA 3KLHB 2B56A 3IC1A 2PEHA 4B3SF 2RSQA 2ZH9A 1AB8A 2VASA 2VG7A 3FMBA 3BGOP 2GO8A 1X7VA 1CS4A 3W1YC 4Q0BB 2J6UA 2FLOA 3MECA 4RKUC 2A2CA 2UXBF 1YRXA 2CG8A 5FD1A 1WEYA 4JB8B 3W9IA 3CJSA 4GVBB 3OLAA 2QA1A 1KVKA 2ADBA 3JSRA 2IYIA 2CQPA 4XK8C 1F9FA 3T41A 3P45B 2LLZA 2YQ0A 2DRBA 1LWCA 4MKAA 2BVZA 3JS9A 3F44A 4K4ZA 4O4RA 2W2NP 5D0RA 2KFNA 2ZUGA 1UFWA 4EMDA 5IQ6A 1SIWB 1LW2A 3JSBA 1UA0A 2J9DA 2JX2A 1C0UA 3I55S 4PPDA 2BJ3A 4OJHA 3TJ9A 4KFBA 2UVRA 4TQRA 1SQFA 4QOTA 3TAMA 2HQCA 3GR0A 2V69A 2XNQA 1R8AA 1RTJB 3K57A 2V67A 5A8WB 1OJ4A 4PXBA 3WC2A 1MMDA 1WD6A 2AYEA 3KJVA 2HGLA 4K50A 1FWLA 3EX7B 1UW9A 3PYFA 2PGCA 2XM3A 4NLRA 4QWDA 1D8ZA 5T14A 3R5CA 1Y7PA 3CC2S 2HRTA 4M5IA 4FXWA 3DLBA 2C2KB 3MCSA 2QA4S 2D69A 4RZRA 1VQNS 2GAHC 4ZVHA 5KT7A 1TZ0A 4MK9A 1VR6A 4ECUA 3TAQA 1R89A 1SC4B 1RWMB 4MKVA 1RUSA 2VB6A 4ELUA 7FD1A 3CSKA 1B4SA 1DTTA 4FDFA 2KJWA 4DPXA 4BHQA 1T9YA 2Z57B 2O1PA 3ICLA 1VQ4S 1QAJA 3PIPQ 3GFHA 1TV6B 4X4OA 1FRLA 4Z7CA 1U4BA 3ONQA 4OZJA 1U0HB 2GJFA 3LO3A 3C16B 3KMQA 1VQ6S 3AHPA 4NRUA 4QCLA 2NLWA 4NCBA 2RKIB 1FTRA 1C1CA 2RMLA 3JB9k 1UVJA 3BB5A 2OUGA 3NOCA 2DPJA 1NAQA 5KOWA 3GJRB 4RBUA 1HNXF 2L41A 5CD4A 2RRNA 1WEXA 2W2OP 4HR2A 1Q82T 1FERA 2HVDA 4M5LA 4ZPDA 3J7ZT 1J2VA 2X1GA 2ZDOA 1UFLA 2MQNA 5HBMA 1NDKA 2MQPA 2CA9A 1YZ6A 2JDJA 1JJ2R 2V0NA 4R5PB 2NYIA 3TUPA 3R1HA 2HMIA 2N4DA 1GXTA 2PIIA 4P72A 4NYOA 2Y8WA 5HLFB 3GFYA 1N5YB 2E5GA 1T03B 1NB7A 4NA3A 2KN4A 4NLWA 4ECQA 1SC6A 2NPIA 4K5SA 1YZ7A 3MI7X 3NGKA 4WYWA 1RT5B 3EGNA 1QD1A 1RT7A 3CCES 3V6KA 4M5NA 3ZXWA 3VZHA 4OV6A 2XI3A 4A8MP 4J9NA 1WHVA 4WBFA 1RT2A 1ZYQA 2YKAA 2G2OA 3IXQA 4QWEA 2MZQA 1SL0A 5KFZA 4JV5J 2CNNB 1U49A 2VBYA 4H4KC 4DFKA 3OVAA 5KFSA 3AJDA 2QL5B 4K4TA 1GMVA 2ZJPQ 5HP1A 2IAJA 3KG4A 1OPZA 1OY6A 1ZZNA 2K3IA 2HNZB 2O01C 1JLFB 3SMZA 3SI8A 2E7VA 5I42B 2XLKA 3DU6A 3S01A 2EBEA 4K0KF 2ZZTA 3PW4A 2JFDA 3VR1A 1OS5A 2XNRA 5LMNJ 2Q6CA 1RU2A 1KN6A 4QWBA 3UDLA 2BABA 3HCXA 4K5RA 3QT7A 2J7WA 4ZCLA 1IKXA 3VALA 1NDPA 4DFPA 3T1HJ 2BW7A 4L6V3 2XGPA 3R27A 3U7JA 3UQSA 4JI5F 4J9PA 1KLMA 5A0YA 3FRYA 4RUBA 2CQBA 1QTMA 3QGHA 3RZAA 5L1KA 2I6WA 4OV1A 2G1HA 4IRKA 3VGSA 2OEJA 4NEZA 5J1EA 1VISA 4YS2A 1AXQA 3DRSB 1IQZA 2VPYB 3DU5A 1S10A 3H7HB 2XMKA 4ZHRA 4QIWD 3FDSA 2PI5A 3PEHA 2C2NA 1DY3A 3M2VB 5IT9U 2ASLA 2HPUA 1XBWA 4QIEA 5H9FJ 3W62A 2HVIA 4MAKA 3KHLA 1FD8A 5E7OB 1X5TA 2A10A 4B9MA 1D1UA 4ECXA 4B3TJ 1T9TA 2JLEA 2LEPA 2QLFB 3MM5B 4C8YA 3OL6A 4WE1B 1VFJA 2HS0A 5B0CA 1SJFA 2CUYA 1OSCA 4FF3A 3JQMA 5GMKa 4TXSA 3EXCX 2HNYA 2BA9A 4DV5J 2OPQA 1FKOB 2IC3B 4UQTA 3BQ2A 1YJVA 3MM9B 3QFHA 1R8BA 3B82A 4ED6A 2ZBRA 4KGKA 1HBNB 3HULA 2EPIA 4A47A 2GVDA 2ZVIA 2C3PA 3PW5A 2R2SA 1MG7A 1H7WA 1LWEA 4H4MA 2F63A 3C6UA 2XQCA 3AA8A 1BWVA 5I3PA 3GJQB 4YR2A 4QWCA 3M8YA 1UW4A 3B4MA 3H8YA 4M8LA 1ITPA 1NJXA 4LF8J 5ETQA 4KC5A 2RF2B 2GS8A 2OEMA 3UD3P 2AX0A 2LA6A 2HQGA 2CJBA 3DGPA 2M70A 3BPDA 2KM8C 4CLLA 1T95A 1UJ4A 1Y11A 4FYDA 2V8GA 4JI2F 5K8OA 5M2UA 5K14A 5KT4A 4OJ1A 5J2NA 2XI2A 1C4CA 3I4PA 3DHWC 3H2LA 3LP2A 5L1JA 3N6NA 3OSNA 4JYAF 5D6GA 1OYDA 2RDIA 1S1WA 2BBEA 1WEZA 2QLXA 3KNGA 2FUG9 2PT0A 3LP1A 2OPRA 2W2MP 4QBUA 4Q8FA 4P71A 3M8SA 1P1LA 5GAHI 3G8QA 3CD5A 1OIAA 4LT6A 4M5KA 1YJTA 2OPPB 2AEJA 3ILIA 1NDLA 3RR8A 3OXGA 3GSDA 1JKHA 3OT9A 4OZ5A 4OZNA 3RAQA 1U1MA 2O3DA 1VQ8S 2Y1IA 4L76A 5HL7Q 4ILMA 4DCJB 2ZOFA 4I67A 4IQMA 5H9FK 2L48A 4FPIA 2VPWB 1TL7A 4ZVOB 2CPZA 2O5DA 3PRVA 3VGTA 1IN0A 4QR2A 4F0KA 3UO0A 1OPIA 5DLGA 4Q5VA 1YBUA 5B0AA 3DRPB 1MMLA 1AFJA 4Q44A 3SSSA 4RW4A 4U8YA 2OD6A 4RJVA 2UU9J 1PJ6A 2DNHA 3EVWA 4I6WA 3MR7A 2ZBPA 5K5MA 2CJKA 2MLYA 2IRXA 4CO4A 4FF2A 1FKAF 3A13A 1Q8IA 4RW6A 4JI3J 1D3WA 2IVYA 1XMOF 5RUBA 2MLZA 1Q86T 1SJ4P 1RAJA 1X0PA 5EHHA 3ILLA 1KFSA 2ADCA 3HSGA 3SDEB 4U67Q 3AD7C 2H5JB 4LSLA 2XGQA 2W4PA 3MR6A 2J0QD 3NCQA 4B02A 1Y9OA 1JJCB 4DMZA 3DLEA 3K5LA 2VL1A 3D28A 3CWJA 1ZTWA 1UMJA 5E3AA 4DL0C 2BACA 4FBUA 2YKMA 2M9KA 3IR6B 4OYOA 1XNQF 5KFNA 5C7PA 4NEYA 2N4CA 2F4VF 2UXDF 1DTQA 1HI0P 3K5OA 2DGUA 3N4WA 4AUKA 2VQFF 4WWSA 2V94A 3GYGA 4EK2A 3RR7A 1YJNS 4LFCF 1HI1A 1T9WA 3UDCA 3OLBA 1CVJA 3G86A 2R2UA 4EU0A 9RUBA 4HHHA 4KV8A 2YWFA 2HFZA 1RWNB 3OHBA 4GKJF 4FNHA 2WOMB 4B9TA 2YKNB 5EGYA 3R2CJ 3BQ1A 4P73A 4P74A 1KDNA 2WVBA 3BDPA 1JXLA 1VQKS 1M5PC 1OY9A 3UE2A 3T3FA 4HACA 1EARA 4CIOA 2BUNA 4FS1A 3BGUA 1N33F 3C19A 4CLTA 1R0AB 4M5HA 4C48A 2J9CA 2WZ1A 1TL3B 2IBKA 1R6YA 1XMQJ 5MLCV 2AT1B 5GADI 4AQYF 2YX4A 3P4UB 2PMWA 3MPDA 2NUHA 3BREA 4LF6F 5DETA 5BYRA 2H65B 2EFPA 4NYPA 2ILZA 3QBCA 3ELHA 1JNZB 5KT6A 4B3OB 2F8EX 2V2QA 1UP1A 2B5JB 4AFFA 4LF2A 3BH6B 4DV4F 3UN3A 2MQLA 5F8MA 1HNWJ 2AX1A 1RBLA 4IDKA 3GPAA 2KKHA 2C3YA 3UPFA 4C0OC 2RAQA 1GX6A 2P6SA 1G2EA 2VONA 2M5YA 3QGGA 4KO0B 1CEZA 1JLQB 1VBYA 4ZKAA 1RTZA 2YPZA 1U02A 1SUQA 1D9AA 5F8LA 3KLGB 1QUVA 1V5VA 2B4OA 1JB0C 1F9HA 4F2RA 3EM1A 3DC2A 1N5QA 2ZFHA 3OFEA 1BGXT 2DITA 5HMWA 2BKNA 5EWGA 1S6PA 3BZQA 3WIUA 1FXDA 5IXUA 4LIWA 1U7LA 5HANA 2FIUA 4G65A 1GTHA 3ISND 4FKXA 1LFPA 4PYAA 3A4TA 2PA3A 2V63A 4OI2A 4F4WA 2GMJA 1R43A 1NLKL 3R5DA 3OFFA 2AJQA 2OSRA 2XLIA 1IXKA 2B7CB 1VHIA 3DLKB 5DO2A 2FC9A 1DFDA 2UXCJ 3E01B 3SQGA 4KKOB 2HZCA 1IBCB 2FHOB 2VG5B 4K2JA 2EFQA 1SB6A 1NMEB 2KXNB 2ACYA 1S0NA 1B0VA 2QMWA 4ANEA 2D41A 1N5SA 4GRSA 3Q8VA 2QN6B 3R6GB 3CNQP 3M2UA 2YWKA 2DXEA 2EG2A 4KHPF 5DQIA 4LF9J 1X9MA 3UCGA 2E9ZA 4DR4J 2MZTA 3ETMA 1KQSR 2DISA 2P9GA 4E98A 3DLGB 1KQGB 3EGVA 4JBCA 3U1NA 3HT0A 3HK2A 1ZS6A 4DHVA 2QL7B 2IMOA 3RTVA 1RWOB 3HSZA 3L95X 5CCLA 3UN5A 4EO6A 2IIHA 2X3DA 4ED2A 3ZNUA 5FJ4A 4ZLNA 1N34J 5HQ8A 1RWVB 2HS3A 3IRWP 2FVQA 1RT6A 4ZVEA 2O66A 1Q7YT 4JV0A 1TKTB 2CJXB 5BJRA 3KK3B 3OVBA 2HVHA 2HFVA 1M5OC 3MPWA 2CADA 2HIYA 1BC6A 4PUOB 3VGVA 3NEKA 2CYYA 2MTLA 3KLHA 1WHXA 2I38A 2R42A 3SCKE 2E1CA 3QWUA 2WRMA 3SQOP 4ER8A 3RG6A 4Q0BA 4EI2A 1QVFR 2OGUA 4HDGA 4HH0A 1FFGB 5C24B 3GSIA 3CJ0A 4GO7X 1WC0A 5LJ5Y 3JSMB 1ZAXA 3M8QB 1LV5A 4GVBA 4HHUA 4ZVQB 3L7UA 1KONA 4X62J 3H2VE 1Y5NB 4URSA 2LVWA 4O3PA 3RBDA 2NXEA 3C14B 4R0EA 4DCPB 1HR0J 5KT2A 3AXMA 1UWBB 3RU0A 1IM6A 1Y10A 3UVJB 5EDWA 2ZZNA 2CPYA 4J9UE 5AXLA 5KG3A 4IFVB 2F9JA 3I4HX 5LMUJ 1L3VA 3FSIA 1YJ7A 2VBWA 2CQ0A 2FLNA 2RE1A 3M2RB 1VBKA 2RS8A 3UR3C 4I2QB 2CPFA 1N6QB 5DQHA 3MMBB 3KMSA 3MXHP 1RTJA 3RBXA 1TKXB 5A8WA 3NKYA 2PMZD 1KD1T 4PWWA 4NLTA 4B3RF 1YBAA 3J7YU 2KXHA 4X66J 3IS9B 5CAAA 3EJMA 2ZH4A 4HI2A 4WU2A 4QZVB 3KHRA 4P2XA 1QVGR 3MF5A 2E29A 4JI0J 4RUHA 4ED8A 1YITS 5AE1A 1RT1B 1S1VB 2VFRA 1UJ6A 3CD0A 3FFIB 3IA0A 3SXLA 4PG5A 1DHMA 4PR6A 1U1QA 2H5IB 2J9DE 3EUNA 3MUMP 4JI8F 5KAKA 4HTIA 2V6AA 4FYXB 1NH8A 3FZBA 2HHHF 5MAOA 5AT1B 1SJRA 2K8GA 2KHCA 3MD1A 1U48A 2R8GA 2YNHB 3VHQA 3T9NA 4USHA 2GAGC 1TV6A 1PAEX 4KT0C 3MWBA 1U0HA 2BDPA 3C16A 3MR3A 3RB4A 2DNMA 2HVZA 4CI0B 3J81Y 2H3EB 4UT4A 5DDQC 2RKIA 1S12A 2HGNA 3BYPA 4USJC 4KH1B 1O8BA 2YH0A 1U6BA 3HXMA 5BYSA 2LQ5A 3F56A 1DRZA 5IWAJ 3V4MA 4RWXA 4X4UA 3P8BB 2OP5A 3C15B 2DNNA 3AOAA 4DQQA 1PILA 1VBXA 2CQ3A 5LMUF 2I9SA 4J9OA 3EDRB 1NZ8A 5AE2A 4R5PA 2GFFA 4NCGB 2JZ5A 1PC4A 4XDDA 4DQIA 5HLFA 1KTQA 1YX2A 1N5YA 4ED5A 1NJWA 4BDPA 1T03A 1XMBA 1GQEA 1VS3A 1FTCA 4Q43A 4KAIA 1H72C 3KFWX 1UVNA 2GHVC 2VPXB 1AUSL 1Q0NA 1S9EB 2PN6A 3WX4A 1RT5A 3HLUA 3A8IA 4X64J 1HYSB 3QAUA 3HVTB 3M8ZA 2EK1A 4DSKA 3R5AA 2A2DA 2ZUAA 2H54B 3HKWA 4C8OA 3W2WB 3CJ3A 2AHOB 4EZ9A 1T9XA 1HWIA 3MTKA 3J81U 5KFAA 3VWSA 3BH7B 4HL9A 4NYZA 2VODA 1RDRA 1HHQA 3I82A 1WC4A 1LXNA 1X8DA 5G4DA 2KDOA 3R97A 1CC8A 1ZA2B 4NMLA 1VQMS 2QSWA 2HNZA 2YTCA 4CM0A 2V8HA 1TK5A 1DQ9A 1JLFA 2C2RA 3NGRA 5I42A 2DNRA 2XB2D 1RKIA 4K8RA 4DV0J 1RXOB 3CUNA 3X3UA 2BXJA 1KEKA 5L1IA 4F3OA 2FVCA 3HP6A 4K4YA 3K2YA 5L8RC 5IZHA 4AL7A 2HNDB 3MAAB 1K1QA 1N0VC 5L1LA 1WWHA 2W4CA 4PAAA 2EKYA 1IBMF 1XK8A 2VBXA 3THTA 3G96A 1FJEB 4WF9Q 2YKOA 1W25A 2FQQB 2MQMA 3M1VB 2XWXA 1R8HA 2NUUG 1P27B 1RAEB 3DRSA 2YKQA 3THVA 4DQPA 1WELA 3NNAA 2CJAA 3H5YA 1R8CA 2FTRA 2RDDA 3QT6A 3M2VA 1LK5A 1HHSA 4B3MJ 4RPFA 2MB0B 1T94A 4HHJA 2XTJP 4W98A 3AD8C 1LWFB 4PABA 1JLAB 2X1BA 2AD9A 4WP3A 2RRAA 1IBLF 1NZAA 3NNCA 4LREA 1Z2ZA 3MM5A 1OQ6A 1IBKF 4WE1A 2VKZG 2D74B 2X1FA 4IRCA 4C0HA 1RWPB 4FVCA 4K4XA 4AXJA 4TYAA 3ZZ0A 4FYVB 4QYRA 5T7LA 1MU2B 1FRKA 2PE8A 1S79A 1NSPA 3QYYA 3WQPA 1FKOA 4B9UA 2IC3A 1AFIA 3MM9A 2VZ9A 4ECRA 1HBNA 2DXDA 1FNXH 4L75A 4ETXA 3IGVA 4OJ3A 2WB4A 1WC1A 5JJBA 1RABB 3NWRA 3K17A 2B8PA 2V9WA 4DF8A 1AA1B 3CJRA 3OTBA 4DV2F 2B6AB 1RWKB 4KFBB 2RF2A 4Y34A 3P49B 3GIJA 2COLA 2CQGA 1H74A 4DV0F 4TU8A 4ZLPA 2DH9A 4LR8A 3NMRA 3IM8A 3KJQB 3JSYA 5C2CA 4AXIA 1RSCA 3FC9A 1HPZB 4C97A 1ZH5A 3FEXB 3PJWA 4USUA 4ZVSB 4F2SA 1Z4UA 4ITSA 1M1KT 3PM9A 4O3QA 4ZP9A 4DBQA 2M8DB 3MPVA 2DR7A 3AXKA 3R1LA 5CYQB 4DR7J 5F41A 2KXFA 2GCFA 1H38A 3LWMA 2JWNA 2NR0A 1YJ9S 4AYBD 4MYUA 1T3OA 3K5NA 1FA0A 1FFWB 4C3LA 3FK4A 2LEAA 2ZH7A 1TFYA 4P7VA 4F25A 2L3MA 3D68A 2OPPA 3L7PA 1P6TA 4L74A 2I8EA 1EP4B 2BM1A 1KOOA 3RAXA 2Q79A 1QUPA 1BLUA 4WFZA 3QFWA 4CCHA 5KFEA 1KRPA 4DI6A 1GXUA 3EZUA 4OYZA 1J5OB 4MIAA 2HQDA 1S76D 3PX0A 2HHXA 3W5ZA 3M4XA 3TJ8A 3Q8SB 2AYGA 4FYWB 3DRPA 2HSEB 2MDAA 2ERRA 4ZA1A 2V50A 1L3SA 1R0CB 3JYTB 4E0DA 4IQXA 1BY9A 5H1SV 2KL8A 3CGIA 1O6XA 2R7TA 2QG9B 2E5JA 3I5CA 1ZM4A 1KP6A 1UJ5A 2CQ1A 2HRUA 4KIAA 4MIBA 4DLEA 3SDEA 2RS2A 4RNFA 3V6JA 3TUJC 2EVZA 4K4UA 3J7AN 3IMQJ 2APOA 4HLBA 4AE5A 4TLQA 4TLRA 4USIA 2AKWB 4PZVA 2QTWA 2UUAJ 5E3PA 2CQDA 2VU5A 4DV3F 3HHLC 1WG5A 1M5SA 2BKOA 2WVDA 4NCAA 4EO8A 2JHEA 1WKJA 2PEBA 3KKFA 1N52B 4DWIA 1FJCA 1TP7A 3C2PA 3TJAA 8RUCA 5D0EA 4C11B 1E6VB 4CYUB 3HHEA 5EX0A 4DR3J 4ZVTB 1YQHA 4A8YA 4OYXA 1RACB 1EQMA 4C7QA 2YQ3A 2OD4A 2HLUA 4RNMA 5L9XA 1IKWB 3UCZP 4KGMA 5BXIA 1NDCA 3HD1A 4TU7A 3DXBA 3SEOA 5THWA 2WOMA 4LVNP 2FVSA 3IR7B 2YKNA 3M6UA 3LAKA 4FS2A 3DKDA 4LBPA 4C2MA 5E41A 4X65J 1NH7A 2NZCA 2CXEA 1I51B 4IOAQ 3WC0A 2XWYA 3FCHA 1GFWB 1R0AA 1TL3A 2FDNA 5KFDA 4PQUB 5A8KB 2MKYA 2DRAA 3PJXA 5E2QA 5KG2A 1VMBA 3E8OA 3FRZA 1RAGB 2RH3A 2VDIA 2QRRA 3QRRA 5GVQA 2RQKA 3H40A 3GV7B 1PJ5A 4DSEA 4X4QA 3RBEA 4ZPTR 4B3OA 2B5JA 2XZDB 3DN9A 1HD1A 2XCAA 3CJ2A 3D1QA 1NHKL 3W65A 5C25B 3W66A 3PKMA 4CO0A 4NZ0A 2HWTA 3R5GA 3WBZA 2DEIA 1C0TA 4LRFA 4CLFA 5D4LA 2L08A 1FCAA 4DS4A 4LQ9A 2I5JB 4K4SA 3PYEA 3LOUA 1JLEB 4ZLLA 2CVIA 4H54A 4ALZA 4OZLA 2WK4A 3LGNA 1JLQA 3TZZA 4UY85 3ZC4A 1WTFA 2BEFA 2L9WA 4ZOSA 2IFXA 1F9EB 3KLGA 3DLLQ 1HI8A 2N3OA 4YY3J 1N32J 2E7XA 4NE9C 4YB6A 3UD5A 1CLFA 1TL1B 3GE9A 1S6QB 3MTJA 4MYTA 3FMWA 2MZSA 3RRGA 1IUJA 3NGTA 4ZCMA 4OHWA 4I7FB 3LF0A 4BWJA 4P52A 1UETA 3R6LB 2N7CA 2KT2A 2GNKA 3AAWB 3DM2B 5EWFA 2CIMA 1KVIA 3G6ES 3OTOJ 4X2BA 1T8EA 1TKDA 5T41A 2VG6B 4J9MA 4NA2A 2AYBA 2J6TA 2V2ZA 2MEWA 3ZO7A 1U0SA 1SKSA 3ADAC 1Q78A 2W9BB 4NLGA 5HMZA 3H90A 1LOUA 3DLKA 3PR4A 1KNZA 3K8WA 1XN9A 4K2XA 3E01A 4KKOA 2AEFA 2ABYA 4F7VA 3M8WA 2VG5A 4PG6A 2DHGA 1FE4A 3TQ1A 5IC6B 2YX1A 2J0XA 1NSQA 3DDKA 5KG0A 1N56A 5KFJA 4IKAA 2XMWA 2OTJS 3MUVP 1Y3JA 3FUYA 2E9RX 2K1RB 1GK8A 2VIHA 4CWBA 4EUVA 3J7A1 2QYCA 3DLJA 5IT4A 2OJ3A 4FKYA 3VAHA 3DLGA 1GX5A 2DRDA 1ZPWX 3TYTA 3GU0A 2HQFA 4MJKA 2R2TA 4OYAA 5GAEI 2GO9A 2J76E 1L3UA 2B9XA 5KFMA 2KZZA 1HFEL 2B3TB 5G0RB 1FWPA 3US5A 1M90T 3VGUA 5D0GA 5C2GA 1U6FA 5DJBA 5F9NA 2ZKTA 1Q5VA 2AJ0A 1PYOB 4D3HA 2ROPA 1TKTA 4P2MA 4DUYJ 3KK3A 2LEBA 3QT8A 1ICEB 2FPHX 4DPTA 2WW4A 4ZN3A 2RD5C 2A18A 2OTLS 1K8AT 4Y2IA 1RA7A 2VFTA 2PMHA 4PUOA 1X4BA 2W7OA 1ROFA 2QIFA 4C4WA 3IFEA 3AT1B 1NJZA 4YB1P 3UDVA 4CTAB 3BBFA 2RQ4A 4QIGA 4NLXA 3CD7A 3ENQA 5C24A 3MMJA 2FY8A 2W25A 2DNPA 4KYZA 4EWTA 2YWGA 3H59A 1FK9B 2QL9B 1FO1A 3MGJA 3JSMA 2XBPA 3FKBA 4RW8B 3QGPA 3GIRA 3M8QA 1PJ7A 5CABA 2CDRB 3SCJE 1SL1A 3OVSA 3C14A 1BE4A 4ECTA 2AYMA 5CYJA 3R2DJ 1RE1B 2MSSA 4F67A 2IJRA 4YHHJ 3SFUA 1UWBA 1G6BA 4JI7F 3TNVA 5F0WA 3UVJA 3O6QA 2EG1A 4QIVA 4P7TA 4IFVA 1ZA1B 1PG5B 3D0IE 4J9QA 4QIFA 3S7RA 4DL6A 5F3ZA 4DX8H 1X4DA 4JI4F 1R3NA 3BR9A 5IT0A 4DR1J 2YKPA 1X0FA 2QFIA 1N0UA 2GVZB 3ENAA 1FESA 5KFHA 3M2RA 4DQSA 2Y1JA 1FT8A 4I6AA 1TUVA 4I2QA 4Y65A 1N6QA 3MMBA 4CNZA 1N48A 1TKXA 3OUYB 2WVFA 4QU6A 4KH0B 2SXLA 1JQGA 3OL9A 5LT5A 3W8PA 3KJNB 1DQ8A 3RJMB 1Y0HA 4OX6A 3IWNC 3IS9A 1FF2A 4CO2A 2DR9A 2CWKA 3TI0A 1SQEA 4P10A 2F8MA 2Q66A 5IQQA 3G87A 1RT1A 2HAFA 1S1VA 1VQ9S 3FFIA 1TR0A 2K7KA 1TMJA 2YWWA 4UTGA 3M6WA 2V8DA 1Y00A 4LRBA 5IV4A 5ADZA 1JX4A 2NSBA 1Q7LB 2DNKA 5JMNA 4UZBA 3N28A 4QJVA 1EX8A 2YNHA 4GKKJ 2E5LJ 1CPZA 1ZM2A 4UOHA 2DGWA 4RBTA 3GTYX 1X9SA 4LFBJ 1YTYA 3VAFA 1NKCA 1PYSB 2PSZA 2EKNA 3GIKA 1V3SA 4CLWA 5B09A 3TX8A 3A3OB 3DMJB 2RILA 4YHHF 1U1PA 3QZ7A 1S0OA 4DCOB 1BWEA 3NY0A 2X3GA 4XPEA 4CLSA 1M1HA 4RNNA 5SUHA 1TK0A 4RBVA 3S1TA 1FXLA 4PEOA 2FZKB 1YHQS 3C15A 2BQRA 1CBKA 1U2RA 3C46A 3IRXB 1QM9A 3RBZA 2QO3A 2MGZB 4NCGA 2BMBA 5A6PA 4L3KA 2C1EB 3OHAA 2LQBA 2PFFB 1YJWS 1NEEA 4A8FA 1F0XA 4TYBA 2VJVA 3D7SB 5F8IA 3CDBA 1VJWA 3U1MA 2ATLA 1S9EA 3HT3A 2G9OA 3TA1A 4KGXB 1HYSA 5HSPA 2GIQA 3HVTA 2UUCJ 5KFVA 4OX7A 3LAMA 2D9PA 4YN3B 1GMWD 1FD2A 4LRCA 3CJ5A 3KK2B 3W2WA 1K44A 1WTBA 4EFAC 2B43A 1J27A 2GX8A 2HFOA 2HHQA 1XEZA 4ENOA 2LU1A 1RAHB 2M4MA 2DD8S 4B17A 1TKZB 1DLOB 2Y0SD 5KFTA 1F5CA 1U1RA 3BKTA 4HKQA 2M0GB 4QPXA 1RI7A 2OFHX 1Q8KA 3MCMA 2W01A 5LSRA 1U8WA 1RTHB 1U2FA 1PO6A 1BQXA 1D9DA 2XCPA 5F8NA 3MMCB 2HFUA 1HLWA 2G1DA 2Z58B 1ELOA 4ZS6A 1M1GA 2BKPA 3EGWB 3VAGA 2MZJA 3KG0A 4R25A 2FZCB 3HPOA 3Q8RB 2HNDA 3MAAA 3LUYA 4P2SA 4JI6F 4HT5A 3GG0A 3N0VA 2BOAA 2JVRA 2GIFA 3TEHB 4LF5F 1VLOA 4FPRA 4M5MA 2D1CA 1RGVA 1S4EA 4CH0S 2IM1A 5E33A 3W7BA 1RLCL 4I4BA 5E0OA 2W9AA 3M1VA 4L73A 1S0MA 2XS2A 3BGRA 3VQSA 2AP6A 2BJEA 2W7PA 2CAJA 2Q1LA 1RWWB 4PXDA 2O67A 4ANCA 4UF4A 2J0WA 4UUXA 5H9EK 3HHKA 4EZ6A 3FQKA 4RWWA 3G8TA 1U1LA 1VOMA 3IR5B 1NUEA 4WFYA 1F60B 2BW2A 4BWMA 1P8GA 3E51A 1LWFA 2E9TA 1JLAA 4DLGA 4KGVB 3S6EA 1PIEA 3T5LA 3MM7B 2CFXA 5KFFA 1X5PA 4OHVA 3CJKB 4LF4F 3GONA 2BM0A 2D7SA 3ZZYA 1MU2A 2MZRA 4P9SA 1SH3A 2KT5A 2P9CA 4OLPA 4CQ1A 5HO4A 3GLJA 2W7AA 1WNEA 2Z2YB 2V8VA 2YVSA 2KYZA 2CKWA 2IY5B 3F0NA 2RB7A 4BC7A 5E3QA 1T11A 3GFZA 2CPXA 3F73A 2ROGA 3KLEB 2ZM6F 5BR8F 2GMHA 3HKZD 4ECWA 3BF4A 2B6AA 2RQMA 3W9JA 3SFGA 4URQU 2IVFB 2ZE2B 4DS5A 1B7FA 5GAHU 4KRWA 1KSPA 3ZZTA 1WORA 4I56A 2MMYA 2JEJA 4U7UK 6FD1A 1JIHA 3AB2B 3M8RA 2CNLB 3IAS9 4WFAQ 4M95A 4ES3A 1HNZF 3DNCA 3KNAA 1HPZA 2CPEA 2QYGA 2M52A 2WBMA 4OZ1A 3Q8QB 3OL8A 1C1BB 5IV3A 3VAMA 3SZ2A 1RWXB 1Q8BA 2ZHBA 2FYXA 2R9LA 1LW0B 5CYQA 1CJKB 3BO2A 1HNVB 1A0OB 5CYMB 1VRUB 3RW6A 3T6JA 4ZN1A 4ZPBA 2HFSA 1FX2A 1I6JA 2NREA 2YWHA 2ZZMA 1NSAA 2B4PA 3N01A 1RTIB 4TNOA 4CP5A 5I3QA 1GT8A 4HDHA 1UVKA 1EP4A 3Q23A 1IJEB 1WI6A 3DDIA 4G3IA 2WAQD 2KHDA 3IG1B 3W3SA 2ZNZA 2J8SA 3IWXA 1J5OA 1TUGB 4LFAJ 1MLAA 2P6TA 4CH1A 3T1YJ 4KE5A 2ZWPA 3PHTA 3TZWA 1H73A 1K47A 1LEOA 5LOQA 3PRDA 1DBDA 4W90B 3JYTA 2V5HG 2CNKB 2JLFA 4DX5A 1OO0B 1T3NA 2I1RA 4RNOA 2KM8B 2KFYA 2KT3A 2AGOA 3M32B 5KFOA 3QZ8A 3U02A 3EYZA 2ZHOA 2XS5A 1EETB 2UUBJ 2QLBB 1U1NA 3QQCD 4G6VB 2WONB 2DTJA 4ZVRB 1YVFA 2EK6A 2F1FA 1KVJA 4O3OA 4NI2B 2LA4A 5CH7B 3A3PB 4RLEA 2RU3A 3G8SA 1CULB 1FJGJ 4LSNB 2YNFB 4NLQA 1VC0A 4KY3A 3H5XA 3Q2SC 1RISA 4OI1A 1GMUA 1J5EJ 5HJXA 5DG9A 1FDNA 2MJUA 3P5TL 5ETMA 3T19A 1FI4A 3POTB 1NHVA 3SYZA 3CULA 2DK2A 2VA3A 4O3NA 2F9DA 4I6YA 3D66A 3CEDA 5DS7A 4ZITA 3M7VA 3SIPB 4C11A 5GADU 1E6VA 5IT9Y 4CYUA 3BR8A 4TVAB 4WZMA 3SSRA 2FC8A 4C8NA 1F2GA 4O4GB 1IKWA 3M30B 1SPBP 1NK7A 1OMSA 3AQOA 2HRYA 4PKDB 3ZTQA 2DPIA 5I3UB 3Q8UA 1BQNB 2CJQA 2V34A 1NM2A 2EFVA 3JQJA 2DB1A 4J9KA 3V4IA 1X4EA 2EI5A 2VICA 4DX6A 1U47A 1G1XA 3KK1B 2R7UA 1Q4RA 1YJRA 3BJYA 2IA6A 1CC7A 3T5JA 3T9ZA 3ZZRA 2M7SA 1YWXA 4PYDA 4PQUA 3A12A 5A8KA 2W2QP 4F26A 4Q2LA 4ZPCA 3D6FB 2J0SD 3OW2R 4DU7A 1L5UA 3FCWA 2XY7A 9ATCB 1NK0A 4MK7A 3R7NB 1UVIA 4QW9A 1W2BR 3G4SS 3HVAA 4ZVFA 1M5KC 4C0BA 4USMA 1MN7A 2B4VA 4LBIA 4U6PA 3EVMA 4ED1A 3NLCA 3GV8B 3OFHA 3Q83A 4Z7YA 3JTNA 7FDRA 2KU7A 2R3VA 4A48A 5C25A 4DOZA 4J9LA 2K2PA 5C42B 2I0XA 5AJ3J 2I5JA 3OBIA 4DG1B 2JJ4D 2KB2A 3NGSA 1JLEA 3IAM9 4MIWA 4P75A 5T7LB 4JV5F 2B4UA 4IG3B 4OX9J 1JK9B 3KUGA 1LK7A 4ZK7M 3LH2S 3ENVA 1TL1A 3E2EA 2ZWOA 1S6QA 3CDEA 2FGOA 3MCOA 1H2UX 3R5BA 4ANDA 3P3DA 2RHQB 3CF5Q 2E1AA 4I7FA 3CW2C 3W63A 4UQGA 4E2FB 5F0UA 3I6PA 2YNIB 3HDSA 2FVRA 2OEKA 4RNHA 3DM2A 3SBMA 3GJTB 4UZCA 1UAWA 5LMNF 1RT3B 2QT7A 5KFWA 2VG6A 4WP9A 4DUZJ 2E7WA 2MQQA 1HNIB 3T1HF 2HG4A 1A7GE 1DJ0A 4WYLA 3G6YA 2JFKA 2G0CA 5CZXA 1F3VA 3PX4A 2W9BA 1RBAA 2AEMA 3OPKA 1B7YB 3THPA 1S49A 1IKVB 4NRTA 4DXLA 3CIZA 1UZDA 4NL5A 1EJ7L 1WDTA 3IBWA 1E6YB 1EKRA 1IM4A 3VAJA 2HBQB 3AJ1A 4YEAA 2BYCA 2C42A 1X4FA 4TY8B 3AB4B 3NWGA 3NL0A 2A3JA 2LQ9A 1JLBB 3EICA 2K1RA 3LGHA 4B3TF 3U27A 2A6MA 1JLGB 5AJ3F 5AXKA 3G82B 3PRBA 1S48A 2XC9A 2A6OA 4QR0A 1K0TA 1UL3A 1XR5A 2XSJB 4B9NA 2HFNA 4XAKA 5B0EA 5G0RA 2GGPB 4DV5F 2DY9A 3BM7A 2W8KA 4MMOA 1FXRA 2Y1RI 1D8YA 3GILA 2VA2A 4R8UB 3HJVA 4ZCIA 4F04B 2D3UA 1HBMB 4WXWA 2HHVA 1VIXA 3RGIA 3TVKA 4LF8F 3CCJS 2HYIB 3MZIA 3PO4A 3RB6A 2AU0A 4CLYA 4WCEQ 2EW9A 5HMXA 2CQHA 2WCXA 3QLHB 1JXEA 3DRRB 4J37A 3KG1A 4OHXA 3I5BA 4CTAA 4F50A 4KBIA 2UUTA 4CLPA 4EBDA 2KTQA 3PEJA 5I4MA 2ZH1A 2FY1A 1VDHA 1TL5A 3VTIA 2D3O1 2M88A 1FK9A 4AD6A 3PFEA 4DR2J 1VRTB 1OQ3A 4AL6A 2B9EA 4RW8A 1QE1B 2HWHA 3ZFVA 2G4BA 5IS2A 2C22A 1O0PA 2U1AA 2BV3A 2DGVA 4A8KA 1JNRB 3P6YC 4RUCA 2AGPA 4QR1A 1AYEA 2LYVA 2J6SA 1BHNA 5J2QB 4NASA 3RUBL 2HKEA 4UOGA 4BLGA 3VAIA 1WACA 1VQLS 3FGVA 2GVZA 2QE5A 3H4BA 4C9DA 1TTHB 4DR5J 4ZVPB 3PW0A 2H48B 2JLGA 2AJFE 4N47A 1AUDA 2RU9A 3CXCR 1TUWA 5J1PA 5B0FA 2ATCB 4OI3A 3OUYA 2BRKA 1S9FA 1TL4A 1S6UA 3L7OA 4NXMJ 1EB0A 3HD2A 3CJTA 1VQOS 4RX6A 3HMJG 2MKHA 4OZ0A 2UU9F 1N36J 1FWKA 4UY8T 2IA0A 5ETLA 2VQEJ 4DV6J 3CC7S 4JI3F 3M6XA 1VLYA 3MEEB 2IM0A 1FFSB 5HN0A 1O51A 4V19J 3PKYA 1YLXA 3TA0A 5F8JA 2NPFA 1JJHA 3UR0A 2ASYA 4YUDA 1V6HA 2KG1A 3NMAA 5A2QU 4DR6J 3U1LA 2C2OB 3MPYA 4LF7J 1ZTTA 1C0TB 4MFBB 4A4JA 1HWLA 2C2DA 3TZXA 4PPZA 5A8RB 3DFEA 5FIIA 4U7CA 1RB0A 1SVDA 1YG0A 3TUZC 4HVZA 2HEKA 2VKRA 2KH9A 4ECYA 5KFBA 2H4WB 3BBCA 2UXBJ 5KFQA 3DMJA 5DZ7A 1HD0A 2VOPA 2DVIA 3W64A 1WF1A 1N54B 1ZM3A 1LWXA 1XR6A 3FNNA 4J91A 3EXYA 2J5AA 2XMVA 5J2PB 3GYXB 1T05B 3IRXA 3WHIA 3BN7A 2CZVC 2QX0A 2B51A 3CJQA 2FJDB 2MGZA 3JQKA 2QZ8A 3W9HA 2Z0GA 3H42A 5F3TA 3HFZB 3PV8A 4LIRA 4G1QB 1VIOA 3CCLS 3TX0A 2KG0A 3D6HB 3KYLA 3DI6B 4LQ3A 4I2PB 5DLFA 3J80Y 3MD3A 3NS7B 1XMQF 3MPUB 1SBRA 3KK2A 3JAMU 1T02A 1W26A 2XZTB 1SJQA 3N6MA 2ZDPA 5DGAA 4EEYA 1JJ4A 4CT9A 3L9ZA 5DM7Q 1TKZA 1DLOA 3BDEA 4DV7J 2K06A 2WSEC 3GCXP 2HHTA 1IJFB 2G0IA 2KI2A 3H98A 3BGFA 2V8PA 4USVA 1HNWF 3QSYB 1B70B 1H7XA 1RTHA 1RHMB 5LSLA 1WF2A 2HHSA 1H98A 2BR0A 1UEKA 3MMCA 4RR5A 2MKSA 4OYPA 2FLPA 3EPIA 1IR2A 4ECZA 1TELA 1ZOTA 5HVGA 3HZGA 3PR5B 1UKUA 3CE8A 1UZHA 4NZ7A 2DHHA 2OHDA 5LXYA 1DQAA 4FF4A 2F7VA 3D3CJ 3MM8B 5GAGU 2IYGA 2FD2A 2IHR1 1LNQA 1GMWA 3J80U 4OYBA 3TA2A 4J90A 1GAOA 5ETOA 2AJ1A 1NXIA 1HNXJ 3JTOA 4KHMA 2GC8A 4OMFG 2R7SA 3VVTA 1D09B 1QY7A 2UV8A 2J7UA 2UP1A 3DLHA 3GFXA 3H20A 1DAXA 3ISZA 3I5AA 4H4KA 2NQPA 2UXCF 4ED7A 1NHUA 1S0VA 3MM7A 4A46A 4NLOA 2QFJA 1RTDB 4ZVUB 5L46A 3PJ9A 3CJKA 2JL9A 1RAAB 2BANB 1WOPA 1ZAWA 2JVOA 3EVOA 1F6TA 3ETOA 4PQAA 4QYZJ 5D15A 1S59A 4M5DB 1VQPS 4F4KA 4DV7F 4FXDA 4B08A 3CD6S 4ES1A 5M2PA 5A76A 3B8HA 3HVWA 4LF9F 4EBCA 3RB0A 3MEDB 1RBOB 3NS5A 1GTEA 4PG4A 2DXFA 2MKJA 1K73T 1WUUA 4DR4F 4J9SA 2BJ8A 3CTRA 2DKOB 2ASDA 3AFGA 4YP3A 3PIOQ 3KLEA 3I32A 2DY1A 2Y0BB 5CZVA 1M5HA 2MXYA 1L3KA 2ZE2A 1GNKA 2M8HA 1LQ9A 3IN5A 4ECVA 1BQMB 4DU8A 4OL8A 2VOOA 2DNGA 4Y3CA 2GW8A 3HO1A 3NAIA 3V81B 3DOMB 5LXRA 1N34F 1MROB 4YDDB 3K59A 4K0KJ 1X4AA 3PFOA 1U25A 1BMQB 4NLSA 3GV5B 4FZVA 3CMQA 3FCVA 1C1BA 4CO3A 1WDDA 1M0SA 2XG8A 1KR4A 3BS9A 1LW0A 3CDWA 1CJKA 2GHWA 3N6LA 1HNVA 1RA6A 4IFYB 1KC8T 5CYMA 4JI5J 1FRXA 1VRUA 5F8HA 5KG5A 3Q8YA 2HBYB 1NJYA 4Y28C 4TQSA 1XNRJ 2GMLA 2LP4A 1NB2A 4ED0A 2VJUA 2B9WA 1RTIA 2YXLA 4IO9Q 4C6AA 2HZVA 1A9NB 3KOAA 2MY8A 4N7TA 4X62F 1HIYA 3ENWA 3IG1A 3BQ0A 4GO5X 5AXMA 1PYTA 1JLCB 4KR0B 2XMJA 3OFGA 5DQGA 1HR0F 1SXLA 3QAEA 1HMVB 1P1TA 1OWXA 3KTQA 2HQ3A 1FVSA 4DN0A 1NK4A 3UD4P 2LU2A 1JWWA 2HGMA 4K7QA 1YK9A 4YDXA 1REGX 4QYZK 5KG1A 3M32A 2DJWA 3KXDA 1CG2A 3QJLA 2LFVA 2BE9B 2QA2A 3H2UB 1EETA 3PHEA 3A1YG 1UTAA 3K5PA 4LUBA 3O3LA 4DZ6A 3QWPA 1EAYC 3MMAB 2WONA 2DNOA 3QIPB 2OFGX 4CO5A 4USKA 4ZPVR 3LTOA 4NI2A 4OX8A 4OYWA 5KFIA 3UN2A 1CULA 4LSNA 2KFZA 3GZ7A 4ZJLA 4RL1A 3GIIA 3CB4A 4X66F 2YNFA 2MPUA 2NSCA 2F3JA 2DHAA 3BSAA 3HJFA 5DM6Q 1RP5A 4NMXA 4DV1J 4P6QA 5K8NA 4JI2J 4JI0F 4NLPA 3D0GE 4WFBQ 4B9SA 3POTA 3NS6A 1X5SA 1QDUB 1N4LA 3KLIB 1QLNA 4XTTA 2Z30B 1R8PA 2OI2A 3PNIA 4DL5A 5AXNA 4ILLA 2PI4A 5GMEA 4JYAJ 1XNRF 4QPTA 4OIXA 3LQVA 2F65A 1HBOB 1JXVA 5CA5A 1YDLA 1TAQA 4O4GA 3UW1A 3HHLD 1I3OB 3M30A 4X4SA 1FDBA 5LJ3Y 4HEA9 2W4DA 5I3UA 2FJAB 1BQNA 4M5GA 3WIVA 5ETPA 1K9MT 1YKWA 1H0HB 2UVWA 1AW0A 2Z4PA 3D54A 1T9UA 1D9FA 3TOQA 2GA7A 2QGFB 2Z8QA 3O8WA 3KK1A 5IWAF 1WSRA 2C28A 3Q8PB 3MCNA 3FJ2A 2BZ2A 1H6KX 2N82B 1R31A 2CRLA 1Y5IB 3CVKA 2Y3YA 4Y2KA 4N76A 3D2WA 3BGRB 2ZITA 2ZD1B 4OLOA 4OI4A 5E5NA 4GC7A 3OR1B 4A8QA 2JEFA 3BN4A 2QA4G 3P96A 3EMTA 4OI6A 3WZ0A 1RADB 1R27B 1NKEA 2JOQA 3QIDA 1PBAA 1S1UB 4LF1A 4Q45A 1MWYA 1XMOJ 3H0PA 3TZYA 3HHLB 3UI3A 2X51A 4X64F 1U8SA 4MTPA 3D5MA 5C42A 4OZ3A 4M1KA 3GJSB 4DG1A 1FKPB 1ZETA 1QSLA 3ZNJ1 4DV1F 2C2ZB 2DR8A 4Z2XA 5DGBA 2GHPA 3QJJA 4F8RA 2FGCA 4IG3A 1KWMA 4K59A 2JC1A 3E3XA 1Q16B 4BBYA 3UFCX 2C2MB 2QLJB 1MWQA 2QMXA 1XNQJ 4YMEA 2LQJA 1FRHA 1SV5B 3W2VB 3MEKA 1ZPVA 4YR3A 2F4VJ 4YB7A 2E1PA 2UXDJ 5B7WA 3M9OB 2HHPA 2QJ3A 2VQFJ 2YNIA 1MNEA 2Y1LB 4YFUA 3KLFB 3GCWP 4LFCJ 1TU0B 1RT3A 1W7WA 3MDFA 3OR2A 2D3OR 5DDPC 4ELTA 2YY3A 5CD4H 1HNIA 4WK3A 4KJIA 4GKJJ 5IFMA 1S1TB 1OYEA 3MEGB 4DZDA 2UUWA 2G2ZA 1B64A 5GAEU 2DYAA 2KJVA 4IH5A 1LFWA 2LCWA 1IKVA 1X31C 3S8SA 1SKRA 1IQTA 4F3QA 4A8XA 1SJ3P 4RW9B 4RU2A 1FX4A 3K0JA 1E6YA 1N33J 4PWUA 1KHWA 2XYHB 4JV1A 2BOPA 2E44A 5KT5A 3R8YA 2R7QA 4TY8A 3GR1A 4CLKA 1IKYB 3C66A 2RT3A 5J2MB 5KFXA 4AQYJ 3PTWA 1Z1ZA 4NLVA 1SL2A 4B3MF 4O44B 1JLBA 2QC3A 4MKBA 3VQTA 4LF6J 1FHTA 4LJMA 3GP9A 1S1XB 3T6BA 3M8PB 2G2YA 1JLGA 3SSQA 4DPUA 5JVGQ 4ZCKA 1XTZA 1MSWD 5ITHA 4Y00A 2PO4A 1X9WA 1XERA 3G82A 3HSJA 4DV4J 4C3KA 3DDNA 2M3DA 2XZWA 1MMNA 3L3CA 2XSJA 3NRBA 4H4OB 5IOLA 1CQMA 4DL4A 2GGPA 4ZPAA 4M94A 3DHXA 3M6VA 3PYGA 4A8OA 1APSA 4O0NA 3OXLA 2AMCB 5K9FA 2ILYA 4R8UA 3NCRA 4F4ZA 2BJ1A 4EYIB 1HBMA 4AL5A 3Q86A 4WTYA 1S57A 2JEGA 4IUFA 3KHGA 4Z37A 4DSIA 4N8OA 3TR5A 3PYDA 3ET6B 3T5KA 3CMAS 2J9EA 3QLHA 5ETKA 3OQ2A 3DRRA 4DSLA 2QEXS 1ZM9A 3G71S 4CLUA 4DX7A 4ZP8A 1F1BB 5B0DA 1VRTA 2DGSA 2VC1A 1S9GB 5B0GA 2LMIA 1QE1A 4IH7A 1PC5A 4WFXA 1MWZA 1RWUA 3CCMS 1LXJA 3AY0A 4DR7F 4OQJA 1S99A 4LBHA 5LSOA 3LA0A 4NLDA 1N88A 2DO4A 2RUGA 4TY9A 1FNOA 2EBGA 2XY5A 1VYAA 2CZ9A 5J2QA 2B8QA 2VF3A 4MH8A 2OO4A 3MOJB 1M5VC 2IRUA 2MLXA 1VGYA 4HI1A 1CJVB 1B99A 1WG1A 4KHPJ 4USTA 1F3FA 3V4IB 2XMTA 1TVRB 3I9ZA 2ZOMA 1S97A 4PG7A 2WTFA 1VHFA 2CNOB 2GV1A 3C6TB 2GQCA 4F0MA 4DF4A 2R8HA 1HARA 2KRBA 1RHJB 4ES2A 2XLJA 4M5JA 4QWAA 1JMTA 1HQEB 3DOLB 5HROB 1DARA 5HQLA 1T9VA 4R0JA 3MEEA 4NLYA 3ULHA 1BXNA 1Y5LB 2OMLA 3N5BA 2XULA 3FSYA 3H5SA 2R8IA 3JTPA 1FEHA 2MYFA 4CH7A 1U24A 2DIVA 3FBBA 2PFDA 3W60A 2GJIA 2RNEA 3Q22A 4FBTA 4CNYA 3QJPA 3O2IA 2QMUB 3TUIC 1VC5A 3NCPA 3BKFA 2UVUA 1QJHA 4MFBA 4F3MA 3KWMA 4KPYA 2GQQA 3QO9B 1GEHA 5A8RA 2UUAF 4URGA 2L9DA 1VQSA 1H3DA 4OZ2A 2OSQA 1HBUB 3HF5A 3CCTA 3DXSX 1KBRA 2ZEJA 4ZP6A 4BCAA 3FBFA 7AT1B 3K7RA 3PW7A 4DR3F 3V2UC 3B4DA 2RIJA 1XQIA 1G4CA 2MSTA 4ZLJA 5J2PA 4JUZA 1T05A 3LALA 2V2VA 5K8PA 2M2BA 3TEGA 5D8HB 4F4XA 1NK9A 1ACMB 2VH7A 2HLTA 4UOFA 3NXZA 5IC4B 3G6XA 4CT8A 2HHUA 4ID5B 2AV5A 4YR0A 3IWLA 4X65F 4G1QA 5ETSA 3AA9A 1PBUA 1PSDA 3DI6A 2CG4A 2DR6A 4DFMA 1Q1KA 3DRXA 3KLVA 4I2PA 1S7HA 3EDQB 3CIMA 3MM6B 2HW3A 5B0BA 3QGIA 5KG4A 1NK8A 3PCOB 1S4FA 3VV2B 1B0TA 2BRLA 1O5JA 2E5IA 4MK8A 3RRKA 3GIMA 3AQPA 1B3TA 4NA1A 4B3RJ 4N5SA 2W24A 2HHWA 1RHUB 3CCVS 4ICLB 2HIQA 1Q81T 1U09A 1XJWB 3EZOA 4I68A 4PXEA 3T5HA 1Q95G 2NS1B 4LR7A 4TU9A 4A8SA 3MURP 3EGZA 3DYAB 2ZH3A 2CPDA 2DIUA 2YH1A 4F0HA 4DL7A 3UDEA 1ZBTA 1RT4B 4JI8J 2AJ4A 5KFKA 1H2VZ 2A1BA 2HHHJ 1WC3A 2HK3A 2A0FB 2C3UA 4LRDA 3CCZA 3QRPA 1NPRA 4ZJQA 2FHJA 3MM8A 3MOZA 3NBPB 3TO8A 4F4AA 3R5JB 1HWUA 2VFUA 4YY3F 1N32F 2DCUB 2DH8A 4YQWA 1NCLA 1QAIA 1HWKA 1Q5YA 1HWJA 4A8WA 2F8HA 4Y2AA 1G3OA 1U2CA 2LQ8A 3HX9A 1CJUB 1RHKB 4N56A 1HHTP 3J81j 5IM0B 2WHOA
chains in the Genus database with same CATH topology
4XAKA 5B0EA 1MMDA 5D3GB 1WD6A 1U1OA 2AYEA 1TFYA 5G0RA 3KJVA 1Q79A 2HGLA 5KFYA 2GGPB 4DV5F 3EX7B 4K50A 3BM7A 3PACA 4P7VA 3OTOF 2PGCA 2W8KA 4MMOA 4F25A 1XWLA 4NLRA 4QWDA 2ROEA 2X1AA 4FXVA 4HT7A 2L3MA 1D8ZA 1FXRA 2Y1RI 1D8YA 3GILA 5T14A 5DDRC 1U26A 3R5CA 2OPPA 3L7PA 2N3LA 2VA2A 1P6TA 2I8EA 1EP4B 2BM1A 1KOOA 1Y7PA 1XC9A 4R8UB 3RAXA 3CC2S 4ZCIA 2Q79A 4TKTA 1QUPA 1N8RT 5KG6A 1BLUA 4WFZA 5D77A 4FXWA 2D3UA 3DLBA 4CCHA 1HBMB 4WXWA 3MCSA 5KFEA 3FEYB 1KRPA 2QA4S 4RZRA 1VQNS 4PWDB 1GXUA 2FJWA 4ZVHA 5KT7A 2HHVA 1VIXA 1TZ0A 3L09A 4MK9A 3TVKA 4LF8F 4ED3A 4OI0A 3EZUA 3CCJS 2HYIB 3GQCA 4ECUA 1J5OB 4MIAA 3TAQA 3DOKB 1RTDA 3MZIA 5C5JA 2D9OA 5CQGA 3PO4A 1S76D 3FSXA 2BANA 1R89A 2YX7A 3PX0A 2VB6A 3RB6A 2AU0A 2HHXA 4ELUA 3M4XA 2H5EA 7FD1A 3CSKA 1DTTA 4WCEQ 2EW9A 2KJWA 1FRMA 3Q8SB 4BHQA 5HMXA 2AYGA 2CQHA 2WBRA 3DRPA 4L72B 2WCXA 2MDAA 1JXEA 3QLHB 3DRRB 4C8ZA 2J8AA 2ERRA 4ZA1A 2O1PA 4J37A 3KG1A 4OHXA 3I5BA 4CTAA 4F50A 4KBIA 2DH7A 2UUTA 4M5DA 3ICLA 1L3SA 4EBDA 3EPGA 4K4WA 2KTQA 3JYTB 1VQ4S 1QAJA 4E0DA 3V6DB 3PEJA 2BQUA 5I4MA 2ZH1A 2FY1A 4IQXA 1BY9A 3PIPQ 1TL5A 3HVRA 5H1SV 3VTIA 3MEDA 3GFHA 1TV6B 3CGIA 2FJEB 4X4OA 1FRLA 2MJNA 2V9KA 1U4BA 2M88A 3ONQA 4OZJA 1FK9A 3PFEA 2R7TA 1VRTB 1OQ3A 1V9OA 4AL6A 2E5JA 3I5CA 1ZM4A 4RW8A 1QE1B 3LO3A 1WF0A 3KMQA 2OMOA 1VQ6S 2HWHA 1UJ5A 2CQ1A 2HRUA 3ZFVA 3AHPA 2G4BA 4NRUA 4QCLA 2NLWA 4NCBA 2RKIB 4KIAA 5IS2A 1FTRA 1C1CA 2RMLA 2ZNYA 3JB9k 4MIBA 1UVJA 1REVB 1OSDA 4DLEA 3BB5A 2C22A 3SDEA 2RS2A 2DPJA 1O0PA 2YNGB 4RNFA 1NAQA 2U1AA 5KOWA 2BV3A 4JV2A 4RBUA 1BQMA 2DGVA 4A8KA 1KOHA 2L41A 1HNXF 1CSJA 1JNRB 2RRNA 4JOUA 3LW5C 3V6JA 1WEXA 3P6YC 1Q82T 1FERA 4RUCA 3TUJC 4ZPDA 2AGPA 4QR1A 3J7ZT 1J2VA 2X1GA 2EVZA 2ZDOA 4K4UA 1UFLA 2MQNA 1FRIA 3CDUA 5HBMA 2LYVA 5D4NA 3V81A 4RW7B 3DOMA 2J6SA 2CQ4A 1MROA 4G1PA 2APOA 4HLBA 4AE5A 5J2QB 4TLQA 4DFJA 2IJFA 4TLRA 1H2TZ 2MQPA 4USIA 1NU4A 2JDJA 5KG7A 1JJ2R 2V0NA 4R5PB 3VAIA 1TK8A 2DGOA 2FHKA 1WACA 2NZ4A 2NYIA 2OKQA 1NK6A 3R1HA 4DUYF 5E3PA 2N4DA 2HMIA 1GXTA 1VQLS 2PIIA 3FGVA 4NYOA 2CQDA 2QE5A 4DV3F 5HLFB 3H4BA 3GFYA 3HHLC 1WG5A 1N5YB 4C9DA 2E5GA 3PW0A 1M5SA 2JLGA 2DGQA 1T03B 3FQLA 1NB7A 4NCAA 4EO8A 2JHEA 3D1OA 4NA3A 2MHNA 2AJFE 2KN4A 3KKFA 5KOXA 4N47A 4NLWA 4IFYA 3ISNC 1AUDA 2RU9A 4ECQA 1N52B 3CXCR 2Q6BA 4DWIA 1FJCA 2GJ2A 1F5BA 5FDLB 1SC6A 1TP7A 2MHEA 5J1PA 3MAHA 3C2PA 5B0FA 2NPIA 4OI3A 4K5SA 3OUYA 1VK3A 1YSJA 2BRKA 1TL4A 1S9FA 3MI7X 1S6UA 3L7OA 4C11B 1E6VB 3HHEA 3NGKA 4WYWA 2DO0A 5EX0A 1YQHA 1RT5B 3EGNA 4A8YA 1VQOS 4RX6A 3HMJG 1RT7A 3CCES 3V6KA 4C7QA 3VZHA 2YQ3A 2OD4A 2HLUA 4RNMA 2XI3A 5L9XA 2MKHA 4OZ0A 4A8MP 2V4JB 2BE2B 4J9NA 1IKWB 2UU9F 3UCZP 4KGMA 1WHVA 1FVQA 1RT2A 2E5HA 2ZH5A 3I96A 3I0RB 1ZYQA 4UY8T 3K5MA 3PX6A 1HW8A 2YKAA 2IA0A 3HHNB 1V3ZA 3QPIA 3IXQA 4TU7A 3DXBA 4QWEA 3CC7S 2VUGA 3SEOA 5THWA 2WOMA 4LVNP 4JI3F 2MZQA 1SL0A 5KFZA 2FVSA 1WHWA 1VLYA 3M6XA 3IR7B 3MEEB 1U49A 2YKNA 4DPOA 2VBYA 2IM0A 3LAKA 3ITHB 3M6UA 4H4KC 3I56S 4FS2A 4DFKA 5HN0A 3I0SB 2OPSB 1O51A 5KFSA 3ZZOA 3PKYA 3OVAA 4V19J 4C2MA 1VQ5S 4K4TA 3TA0A 1U6ZA 4Y2CA 2ZJPQ 2NPFA 5F8JA 5HP1A 2IAJA 1JJHA 2G13A 3N79A 3UR0A 4M63A 1JLCA 5E41A 4EYHB 2ASYA 5KTQA 3KG4A 1OPZA 4YUDA 1V6HA 1NH7A 2KG1A 1ZZNA 1HMVA 2CQIA 1T7PA 3NMAA 2K3IA 2HNZB 2CZ4A 4IOAQ 3WC0A 2XWYA 1KTVA 3FCHA 3ZZUA 1R0AA 2ZH2A 2O01C 1JLFB 1TL3A 2FVPA 2FDNA 2RRBA 5KFDA 3U1LA 3SMZA 1TFWA 4PQUB 3SI8A 5A8KB 5I42B 2XLKA 3DU6A 2DRAA 3PJXA 3S01A 4MKYA 3MPYA 5E2QA 5KG2A 3TARA 2EBEA 4K0KF 1Y3KA 1C0TB 4MFBB 2CQCA 4A4JA 1ZTTA 1VMBA 1HWLA 3J7Z5 3E8OA 3RYLA 2C2DA 1D0EA 1DURA 4PPZA 3PW4A 2JFDA 2QSFA 3FRZA 3VR1A 5A8RB 3DFEA 1OS5A 2RH3A 5H9EJ 5FIIA 3A8EA 4DR1F 2FJXA 4U7CA 4ETZA 2XNRA 2QRRA 2Q6CA 1KN6A 4QWBA 1YG0A 3UDLA 3CCWA 3TUZC 4HVZA 5GVQA 2BABA 2RQKA 4K5RA 4ZCLA 2J7WA 3H40A 1IKXA 2R8JA 3VALA 2KRRA 2VKRA 3NG8A 4DFPA 5EN1A 2KH9A 3GV7B 4ECYA 2DGXA 4IG0B 4DSEA 4X4QA 5KFBA 3RBEA 4L6V3 2XGPA 3R27A 2ZOGA 4ZPTR 4B3OA 5KFQA 2B5JA 3U7JA 3DMJA 1RYRA 5HI7A 1HQUB 2GQ2A 1HD0A 2DNLA 1HD1A 3DN9A 1YI2S 2VOPA 2PA8D 2XCAA 3UQSA 1I94F 2DVIA 3MMAA 3CJ2A 3D1QA 3TVYA 4J9PA 4JI5F 3QIPA 2W9CB 1KLMA 5A0YA 3FRYA 1WF1A 1N5TA 5C25B 2ZBIA 3PKMA 1N54B 4CO0A 1ZM3A 3WDOA 4NZ0A 2HWTA 1XR6A 2CQBA 3WBZA 2I2YA 1QTMA 3QGHA 4Q7AA 1C0TA 2XMMA 3FNNA 3RZAA 1SI9A 5D4LA 5KFCA 5L1KA 2L08A 2J5AA 3EXYA 1FCAA 2XMVA 4OV1A 4LQ9A 4DS4A 2I5JB 4DDFA 4K4SA 5J2PB 3GYXB 1T05B 3LOUA 4IRKA 4WKYA 3IRXA 3BN7A 2ASJA 1JLEB 2CZVC 4ID8A 2CVIA 2AQ4A 4H54A 5J1EA 4ALZA 2B51A 1AXQA 2FJDB 3DRSB 4OZLA 1IQZA 2VPYB 5DRKA 3DU5A 2MGZA 4WK1A 2WK4A 3LGNA 1JLQA 1WI8A 3OTCA 1S10A 4UY85 2XMKA 3ZC4A 4ZHRA 4QIWD 3FDSA 2PI5A 5EUHA 1WTFA 2L9WA 3PEHA 4ZOSA 2IFXA 5KFGA 4KTQA 2QZ8A 3M2VB 2ASLA 2Z0GA 2HPUA 1XBWA 4QIEA 5H9FJ 2HVIA 4MAKA 3KHLA 1FD8A 5E7OB 4EBEA 1X5TA 5F3TA 2A10A 3KLIA 3KLGA 4B9MA 3DLLQ 1D1UA </