5IM0B

Crystal structure of the rna recognition motif of mrna decay regulator auf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein D0
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5im0B00
3MI7X 1H6KX 2DGWA 2LEAA 3G96A 1D8ZA 2KXFA 3CC7S 2HGLA 4YOEA 2MSSA 4J5OA 5DM7Q 3TYTA 5IFMA 4QPTA 1U1LA 3FEXB 2MQPA 5JVGQ 2YTCA 1HL6A 1H2TZ 4M5DB 2ADBA 3EGZA 3VAIA 1K73T 3Q2TC 2MZJA 2CQ1A 2LYVA 3VALA 2J8AA 4Y00A 1M5VC 1VBYA 2QEXS 1G2EA 1OPIA 4C4WA 5LJ3Y 3SDEB 1QVFR 3G8SA 2V94A 1WF2A 4IO9Q 2CPEA 3NMRA 2MKJA 2VONA 3LQVA 3VAGA 3BO4A 2MPUA 3VAKA 2YH0A 1U1MA 4Y0FA 2RT3A 1U1QA 5GAEU 1M90T 2FC8A 2KRRA 2MGZA 1P1TA 1WF0A 2L08A 2DH7A 1K8AT 1M5OC 4W90B 3THTA 2JX2A 4LIRA 2QFJA 1OIAA 2BZ2A 2DGQA 1N8RT 2DNZA 1SXLA 2DGXA 4P6QA 1X4CA 1X5TA 1H2UX 1ZZNA 1KD1T 1PO6A 1VC5A 3IRWP 2I2YA 2G0CA 5IQQA 2FY1A 3CUNA 1FO1A 1ZH5A 1HD1A 2MQNA 2CQ2A 2HZCA 5IM0B 2DHAA 3S6EA 4WKRA 2PEHA 5DDQC 4QQBA 3ZZZA 1NO8A 1VQOS 2I38A 2MZSA 3CTRA 4CH0S 3UCZP 2PE8A 1XN9A 1DRZA 2MQQA 2RS2A 2RQ4A 1HA1A 3S01A 1VQ6S 2N7CA 1N52B 2FPHX 2KN4A 2CQ3A 1RK8A 2XS2A 2DIVA 3H2UB 2E44A 2M2BA 4IUFA 2KYXA 2CPXA 2DK2A 3VAFA 1Q7YT 3U1MA 3MOJB 5DDOC 2MKSA 1A7GE 3G9CA 3CPWR 5DETA 2MMYA 2F9DA 4QU6A 2NLWA 2KRBA 1N88A 2J76E 2RRBA 2OSRA 3EGNA 3HI9A 3CCLS 3CCRS 1X0FA 3CULA 1SJ3P 2DGOA 2MKHA 2JRSA 5FJ4A 2F3JA 5LSOA 1DBDA 3L3CA 1M5KC 4W92B 5LSLA 4CQ1A 3CCMS 2MKIA 2F9JA 4YUDA 1U2FA 2KXHA 3PIOQ 1WG5A 3CCVS 3Q2SC 2N82B 2CPDA 1YIJS 2E5JA 3UCUP 3CD6S 1FJEB 2U1AA 4WCEQ 5DDRC 1HD0A 2M9KA 1Q82T 4TU9A 3DXBA 3OW2R 2RNEA 2RS8A 1SJRA 3CMAS 4OZ0A 5MLCV 2JWNA 2KM8C 2KU7A 2JVRA 2MZQA 2CQ4A 3RW6A 4CIOA 2G1DA 3G4SS 2DHXA 2XNRA 2ADCA 2MY8A 1UW4A 3FEYB 1X4EA 2AD9A 4WFBQ 1NU4A 2LXUA 1VQ7S 1WEYA 4F26A 3S7RA 2KG0A 1YJ9S 2CJKA 2M70A 2MZRA 1QVGR 2JVOA 3BS9A 1D9AA 2KM8B 1RKJA 1WI6A 2LKZA 2M8HA 3MURP 2GO9A 3CF5Q 3EX7B 2DHSA 5H1SV 5HO4A 2U2FA 2E5GA 2J0QD 2DGUA 2RQCA 5CYJA 1WEZA 1X4AA 1WG1A 2KHCA 3TO8A 1R8HA 1WI8A 5D77A 1WWHA 2OTJS 4TU7A 2FC9A 2CPIA 1WTBA 2KVIA 2CQDA 5LJ5Y 1H2VZ 1X5SA 1OWXA 1ZZFA 1NJIT 2E5HA 2AYGA 4U67Q 2CPFA 3R1HA 2ERRA 1O0PA 2M7SA 3UWTA 2X1GA 2DNHA 2MZ1A 2L41A 4OZ1A 4IOCQ 1X4BA 5GADU 1QM9A 2ZJQQ 3MXHP 2D9PA 2E5IA 2YKAA 2ZJRQ 1FJ7A 5GVQA 3MDFA 2DNKA 2DNRA 1WHXA 4F25A 1FT8A 5CXTA 2CQIA 3MUMP 2YH1A 1P27B 2DB1A 3CXCR 2DH8A 1X5PA 2KFYA 3BO3A 1WHVA 2M88A 4IOAQ 3R1LA 3P6YC 2CQBA 5GAGU 5ITHA 2SXLA 5D78A 1YJNS 2J0SD 3MUTP 1VQ9S 1U1PA 1KC8T 2X1BA 4ZKAA 2MJUA 4LMZA 1FJCA 1DZ5A 2DO4A 1N54B 2EVZA 3VAMA 3IWNC 3NNCA 2QA4S 2MJNA 3CCSS 4BS2A 1UFWA 3I56S 3JB9k 3UD3P 4WFAQ 3J7YU 5IM0A 2L9WA 2M52A 1U1RA 1VBZA 1JJ2R 2VOOA 2XSFA 1JJ4A 2CPZA 1U1NA 3MUVP 1VQLS 4RU2A 1BY9A 5DM6Q 2N3OA 2DHGA 2DNLA 2DITA 2NZ4A 1Q81T 1VC0A 1JMTA 2DNGA 2EK6A 1M1KT 2MHNA 2N3LA 4ED5A 3S8SA 3P49B 3BEGB 2MQOA 2D3OR 1PGZA 3NNHA 1F9FA 2LCWA 3HHNB 4PKDB 1AUDA 5GMKa 1YWXA 3CC2S 2MKKA 1U6FA 2ZJPQ 2X1AA 3SMZA 4YB1P 4TU8A 5EN1A 3R27A 1Q86T 4PR6A 3SXLA 2RVJA 4F02A 2LEBA 2MQMA 4ERDA 2AYMA 1CVJA 4C0OC 2CPJA 2DGSA 1WHYA 2DIUA 2VODA 1VQMS 4QU7A 1YJWS 3US5A 1SJ4P 2AYEA 3CCUS 2OSQA 1WHWA 3G71S 1VBXA 4WFNQ 1VQNS 4FXWA 2OTLS 1VQ5S 1WELA 2YWKA 2CQ0A 1VQ8S 3B4MA 2MXYA 3UCGA 5JVHQ 3SDEA 3ULHA 2AYBA 3BO2A 1W2BR 4WF9Q 2DNPA 3G8TA 2CPYA 1U1KA 3CMES 1X4HA 2GHPA 3RW7A 3ZZYA 3VF0B 2X1FA 1FNXH 2DNQA 2Q79A 1X4FA 1UP1A 1KOHA 3THPA 2LXIA 2FHOB 1K9MT 2M0GB 2UP1A 1YTYA 3P3DA 2LQ5A 2XB2D 1X5OA 4EGLA 2LECA 3NNAA 3V4MA 2KH9A 2WBRA 4UY8T 1VQKS 4PRFA 3PIPQ 1WEXA 2DNOA 3N9UC 1S72S 2DISA 1U1OA 2XS7A 1X4GA 1L3KA 2LA4A 3CCJS 2RRAA 2HYIB 1U6BA 2DGVA 2KG1A 1VQPS 1SJQA 5DDPC 2M8DB 3MD1A 2OIHA 1WF1A 2DNYA 3B4DA 3CCES 1SJFA 1YITS 2OJ3A 1OO0B 1A9NB 2CQHA 2HVZA 1YHQS 4V19X 3LPYA 1YI2S 2G4BA 5LXRA 3UE2A 2CQGA 2K8GA 3CC4S 2HGNA 2D9OA 1UAWA 3MD3A 4FXVA 2DH9A 1M5PC 1WG4A 1VC6A 2HGMA 2LA6A 3H2VE 1JJHA 3G6ES 2A3JA 3DLLQ 2RU3A 4A8XA 3I55S 5BJRA 5LXYA 1R8PA 2BOPA 2B0GA 3VAJA 3NS6A 3J7ZT 4Z2XA 1X4DA 2DGTA 2MGZB 4C7QA 3TP2A 2KT5A 4CH1A 2M4MA 2KI2A 2DNMA 2MY7A 1VQ4S 2CQPA 3D2WA 2CQCA 2DO0A 1FHTA 4WIIA 1KQSR 1B7FA 5CA5A 2EK1A 2MZTA 3P5TL 4UQTA 5HL7Q 3VAHA 2MKCA 3K0JA 1FXLA 3NS5A 2MQLA 4TLQA 2KXNB 1KOOA 2DNNA 2CPHA 1DHMA 2K3KA 2MYFA 3UD4P 2MSTA 4LJMA 3CCQS 2O3DA 1IQTA 2XNQA 1S79A 2MB0B 2XS5A 2RUGA 1URNA 5GAHU 2LMIA 2VOPA 3U1LA
chains in the Genus database with same CATH superfamily
1RJJA 2BKPA 3CO0P 1S1VB 4J9OA 5ETOA 2KXFA 5I3UA 3E3XA 4YOEA 5EHHA 4C8LA 4FVMA 1Y3KA 1WDTA 4YHHJ 4I2PB 2I6WA 3RYLA 3MM9A 2BVZA 3TYTA 4NASA 2BYCA 4I67A 3J7A1 4I6AA 1CJUA 3FEXB 3HHDA 4LVOP 1NZ8A 1B99A 3SSQA 4ECYA 2YTCA 2ZE2A 1TR0A 4R0JA 2QTWA 1RWKB 4K8RA 3UNGC 1T3OA 3BREA 2BDPA 3QQCD 1IKXB 1JLQA 3MM7A 2AP6A 3OTDA 1TZ0A 2J8AA 2WVEA 2HQFA 3N6NA 2CJAA 2VASA 2H51B 4WFZA 5A8WB 5CCLA 3DRPA 3ILLA 4NYZA 4CLPA 2V2QA 3L7OA 4FZVA 5AE1A 3EPGA 1N5YB 3DGPA 1HBOB 4KHPF 1FCAA 1U49A 1QVFR 1F60B 4IDKB 5D15A 4LF7F 1UKUA 1GXUA 2ZH6A 1NK0A 2MQ8A 3ISZA 2H4WB 4H4OB 3CD7A 4FYDA 4ED6A 3LGMA 4Y6IA 4LF6F 2P6TA 2GJFA 3VAGA 2BE2A 1MSWD 5I3QA 1QUVA 4Q2LA 1Y10A 3AQOA 2UUWA 3BO4A 1FRIA 2XSJB 3VAKA 3QJLA 1U1MA 4KC5A 2KKHA 2RT3A 2PMHA 2QL5B 2ZBPA 3NBPB 1U1QA 2R2UA 3ITHA 2FC8A 3Q8PB 2RF2A 2PFDA 3M8YA 4JV0A 2MGZA 2DH7A 5A2QU 4HTIA 3LALA 3F56A 3KMSA 3PX4A 2UUBJ 2FJBB 3JYTB 2QE5A 3AXKA 1RE1B 5F8HA 2J7KA 2XZDB 4DG1A 2DGQA 5HVGA 3OTBA 2R9LA 4F4YA 1LW0A 2HEKA 3PKMA 1X9WA 3RR7A 2YNHA 5D4LA 5HMYA 4OFZA 4A47A 4WZMA 4KPCA 2DGXA 3A4TA 4NI2A 2J7UA 2K7KA 4RPFA 4TKTA 2R7WA 4C8MA 2VG6B 1ZZNA 3G86A 2OMLA 4ZLLA 2W1BA 1H0HB 3HZEA 4IKAA 4QWBA 4DBQA 4ED7A 2BX6A 2JHEA 1N6QB 1S4FA 2I2YA 4PQAA 2BM0A 3EXYA 1C0UA 4NWBA 1SC1B 4D3GA 3ZTSA 4OX9J 2V2ZA 2CQ2A 4MIAA 3MAAA 4LF8J 2CZ4A 5G4DA 3KK2A 2GNKA 2DHAA 2XTJP 2XZWA 3LP1A 2PEHA 2OLWA 4KH0B 4P2FA 5DDQC 2K7JA 2ZBRA 4ZITA 5D3GB 2ZH9A 1AB8A 4CLUA 3TVZA 3GIKA 3D0IE 3DLEB 4MK7A 4U8VA 4QQBA 2W7OA 1L3TA 2DR7A 5DG9A 3RRGA 2EFOA 1TAUA 4WXWA 2MZSA 3AFGA 1RTHA 4FDFA 4AUKA 4X2BA 4QCLA 1HBNA 2PE8A 3DMJA 3SIPB 3DOLB 3BYPA 1BC6A 4DX8H 2FLPA 3EWGA 4OZ2A 2JSXA 2EFNA 2QFIA 3D5MA 4KO0B 4ZHRB 1YQHA 5IXUA 4WFYA 6FD1A 1NSQA 3IRXB 4K59A 5L38A 1UFKA 1NK9A 4U95A 2B4UA 2YY3A 2CQ3A 2B8PA 1U26A 3E2EA 3BSCA 3D6MB 2IDEA 2M5YA 1VOMA 3PG9A 3MGJA 4JV2A 2BOAA 4J9LA 2XBPA 4YB6A 5AE3A 2DK2A 2UZAA 4NA2A 1I5OB 3KLEA 1Q8BA 1SKUB 2JLFA 3AAWB 4LR8A 3K57A 1RAOA 4O4GA 1RU1A 3MOJB 3QMQA 1IUJA 1NPKA 2BJ3A 2Z2YB 3I5AA 2MKSA 4G65A 4ID5B 4DCJB 1J5OA 4LQ3A 1KLMA 2IHR1 5DETA 2I0XA 2BJEA 3ZXWA 3ILOA 1GFWB 1JQGA 1DAXA 2EKYA 2MLZA 2NYHA 1N88A 2D1CA 3HI9A 2FHJD 3CCLS 3CULA 4ENOA 2B7BB 2LDYA 5FDLB 4QYZJ 2MKHA 1Z1ZA 2J9EA 3HHLD 1TKDA 2CXEA 2XMWA 1XK8A 3LP0B 3MEGB 4LUBA 2EG2A 1DBDA 2ABYA 2VG5A 2CWKA 1CQMA 4NE9C 4OX8A 3TEHB 4WWSA 4ZP9A 4FPIA 3KXDA 3UN5A 4CQ1A 4DG1B 4DV0J 4W92B 3N4WA 4YUDA 3I0RB 2A6OA 1REVA 2O1PA 4KH1B 4GKKJ 3T6BA 4X4UA 2CADA 1KP6A 2B7CB 2YPYA 4N7TA 1RP5A 3Q2SC 3GFZA 1YJVA 3CJ2A 1YIJS 2PMWA 5AXKA 3DLHA 5DRKA 2ZUGA 4M94A 2E5JA 1SC3B 2QLXA 4KGXB 4OZ3A 3CD6S 4JI1J 2B3TB 4ANEA 4DV6F 3T5JA 2HZVA 2KFZA 1TKTB 2FJWA 3CO9A 1MROA 4A8WA 2U1AA 2ZNYA 4GMKA 3RAXA 1BWEA 1Y00A 3DRYA 4RZRA 2DHHA 4NMLA 4IRCA 3MOZA 1YKWA 4OX6A 1HD0A 2M9KA 4K5SA 2RS8A 2Z8QA 5ETRA 3CMAS 3NKYA 2JWNA 3TUPA 3AA8A 1XWLA 1ZPVA 2W9CA 2XY5A 3J80Y 1TVRA 2G9OA 2COLA 3DLJA 3FCHA 5C2GA 1RWOB 5HK4A 1URRA 2CQ4A 3QAEA 4LF2A 2RDDA 3H5YA 4DSIA 1IM6A 1WC0A 2LDIA 1NHUA 2YX4A 1FDBA 4PPDA 2ALZA 1HNZF 2BMBA 1VRQC 1HWKA 2XNRA 3AD7C 3D66A 4DN0A 3HSGA 2MY8A 1KVIA 4P2XA 4K4WA 2ZITA 4NLRA 2AD9A 2YKOA 1UFLA 1XR5A 3AY0A 1NMEB 2PEBA 3QGHA 1U8WA 4LIWA 1JLGB 1N48A 4PCQA 5F8LA 4JI5J 3GZ7A 2OPQB 5F3ZA 2KG0A 4B08A 2DRDA 2GJIA 4X62F 3T1HF 4FF1A 2FJVA 5AXLA 1S1UB 1VJQA 2J8SA 1WSVA 3FZ2A 4KBIA 4LF8F 3K7RA 4URQU 5I42A 3OLBA 3TZZA 4RW9B 2FLNA 2LKZA 1FKOA 3ONQA 2RH3A 3KUGA 1UVMA 3MURP 3NWGA 5HMZA 2HFVA 2P8IA 4GC6A 4ETZA 4HHUA 3IR7B 5LMUF 3T9ZA 4DS4A 2HHXA 3QT5A 1UTAA 1YG0A 2E5GA 1D9DA 2J0QD 4I68A 2DGUA 3MECB 2NXEA 5IC6B 1ELOA 1FRXA 5L8RC 2NUHA 5C24B 4DUZJ 4DPYA 3BGOP 7AT1B 2KHCA 4F50A 3B8HA 4F7VA 1S57A 1PC4A 4BC7A 9ATCB 5D77A 1WWHA 5FDLA 3EDRB 4TU7A 2IA0A 3BKTA 1YZ6A 4A46A 4XPCA 3FQKA 1EJ7L 2GMJA 3PYFA 4NCGB 4A8MP 5DQHA 3P8BB 4DL3A 1X5SA 4LQ9A 5HMXA 4ZVPB 3PW4A 2UVRA 2QN6B 2XI3A 1O0PA 1OY6A 2M7SA 4AD6A 3PO4A 2D69A 3G82B 1Q78A 2DNHA 4IOCQ 3RBXA 2DPJA 1X4BA 2P9CA 2ZZTA 2A2CA 4F2RA 2NZCA 4G3IA 1SV5A 2VU5A 3M32A 4ECVA 4DFJA 3WHIA 1N4LA 3N79A 4JI0F 3E01A 3GG0A 4DDFA 2D9PA 2D41A 2E5IA 3I6PA 1FRLA 3TUIC 4ZJQA 2ATLA 2XHWA 5LMNJ 3MMCB 3QYYA 1PYOB 2DNRA 5B09A 4ED3A 3MCSA 5E0OA 5C2CA 4X4NA 3ETOA 2B9XA 4ED2A 3TNVA 1BGXT 3NOCA 2B6AB 1Z2ZA 2HLUA 2YH1A 4H4MA 2AQ4A 4O3SA 2IY5B 1LWFB 1YJRA 4LBHA 4LF5J 2NXUA 5B08A 2HVIA 2VV5A 4I6WA 2PN6A 4P73A 2R8KA 1J5EJ 4ZJOA 4ID8A 3VV2B 2XGQA 2KFYA 1ZTTA 2M88A 2OO4A 2ZBCA 5BXIA 3PRDA 1FRMA 4PUOB 1V3ZA 1NLKL 2Q6BA 2NPFA 3Q83A 3CDEA 2EBGA 4ZIVA 1QAJA 1RTDB 5IS2A 3O1LA 3LTOA 1RHRB 3NGDA 3MUTP 1WOPA 1C0TA 1LWEB 2GAHC 4R0EA 2PGCA 4X4OA 2CG4A 4KPYA 2AMCB 1S1UA 1RT1B 3GFHA 2AJ2A 5GAHI 1KC8T 4DR7J 2Q1LA 2D3ZA 4LMZA 1FI4A 3QWUA 4DN9A 1FJCA 3NXZA 4I2PA 2NPIA 2AJ0A 3TRGA 4YN3B 4CO2A 3PZPA 3GSDA 3AH6A 4HYKA 4FF2A 2QA4S 2BACA 4HHJA 3MR5A 1RHKB 3RBDA 1HQ2A 2V5HG 1G4CA 2MJNA 4TLRA 2HFZA 2VBYA 4TY8B 3IBFB 3C15B 4CLWA 4IFVB 1FXRA 4EO6A 1IBMJ 2KFNA 2O67A 3L09A 5L9XA 3DHXA 3MFIA 1RT7B 4RR5A 3QT7A 3RRHA 4F8RA 4ED8A 5KG7A 1EHWA 2RRNA 1KDNA 4CLYA 3Q8QB 3UD3P 1N5YA 5IM0A 4K4YA 4JP8A 2L9WA 5A8KB 1H3DA 5KT6A 5KFVA 4PPZA 3VZHA 4X62J 4F3MA 3T1HJ 2VOOA 1HNIA 2IRUA 2CJ9A 3N5FA 2VJUA 3TOQA 4ECRA 3T5KA 3HT0A 4O23A 2R7SA 1N32F 2UUCJ 2BJDA 2QC3A 3PR5B 1S0NA 1VQLS 5CAAA 1N0VC 2CNOB 3HFVA 3LP2B 4RU2A 3AHPA 3A12A 5AE2A 1O8BA 1ZM9A 2DPIA 3MMJA 1R89A 1U2CA 2I5JB 2DNLA 1NSKL 3P96A 1Q81T 1FNOA 2JZ5A 5K8OA 1M1KT 1RADB 2ACMA 2MHNA 4ED1A 1NM2A 4LRFA 1S5ZA 1MWQA 4M5JA 2G2ZA 2D3OR 2V8DA 3G6YA 4DUZF 1OPZA 2OP5A 1Q95G 4JUZA 4DR1F 3DN9A 2C22A 2UVWA 4OI0A 5EUHA 2GJ2A 2ASJA 1S9EB 1PIEA 1I51B 2ASYA 2XI2A 3MR2A 1U6FA 2WRMA 1APSA 1RT6B 1RWUA 2V8GA 3G8QA 3SFGA 4QBUA 2VA3A 4C3KA 4ZJLA 2Y1IA 1YVFA 1N6QA 5BYQA 1QSSA 1HWLA 3SMZA 3EVOA 3TX8A 4TU8A 3MMBA 3WQPA 3M8QB 1XNRF 2XO6A 1RTJB 3SXLA 2JH3A 1K0TA 3EMTA 3EZ5A 5HVFA 2DBBA 1V5VA 2LEBA 2DXFA 4NZ7A 2IVFB 2FVQA 3OFFA 3MM6A 3H25A 2V4RA 1NJXA 1GAOA 3HCXA 5K8MA 2OEMA 1RTIA 4RW8A 3KHLA 3HFZB 1S4EA 2WVBA 4RX6A 1C0TB 2VODA 2AEJA 3CVKA 1RT1A 3PYDA 4RJVA 4NXMJ 2WAQD 2ZM6J 1RTHB 2FZKB 4NPOA 4PXDA 1FNMA 2IM2A 3BSOA 3NY0A 4FPRA 5DLFA 2E9RX 2R7QA 3CCUS 2CYYA 2V67A 4ANDA 4TQSA 2HHQA 3NOGA 2FVPA 3DLGA 3ZNJ1 4DQSA 4UZCA 4FXWA 4OV6A 4LF5F 2FB0A 1VQ5S 1HHQA 2A0FB 2KB2A 1WELA 3FC9A 1DJ0A 4L72B 4YY3F 2CQ0A 1RAHB 2YWKA 4CYUA 5AXNA 2XCPA 2MXYA 1T9XA 2F7VA 2AYBA 3PEJA 1ZM2A 3BZQA 3HULA 1YRXA 4DI6A 4MK8A 4FXDA 2VFRA 1WOOA 1C2PA 2AZ1A 4QR2A 4PG5A 2GHPA 4WFXA 4FVCA 3C6UA 4DU7A 5IOLA 5J1EA 3N6MA 4DL5A 2C2EA 3VF0B 1L3VA 1FNXH 2OD6A 2XM3A 3KLGB 1RUSA 1X4FA 3QFWA 1HQUB 4U6PA 4B3SF 4M5NA 3D6FB 4K0KF 1NH7A 3BGRB 3O5TB 3ZFVA 1YTYA 1QTMA 1TV6A 3OTEA 3TAQA 3B82A 3KG0A 2LQ5A 4ECXA 4WYWA 3FSYA 1D1UA 4EGLA 4NRUA 4EZ6A 3C46A 2G2YA 3VGVA 2XB2D 3PEHA 3H4BA 1VFJA 3BQ2A 3HVRA 2CFXA 3OR1B 1UPPA 3J80U 4UY8T 1VQKS 1DTTB 4WTYA 1Q5VA 1TKXA 3OLAA 3MEEB 1U1OA 1RBAA 7FD1A 1JNZB 1Y4ZB 4Z7YA 5F8GA 2HWTA 3FGVA 3I5CA 4F26A 2KG1A 4HH1A 2YKMB 2YQ3A 1G7CB 4Q7AA 5HI7A 1VQPS 5L39A 2HK2A 2MEWA 1UCNA 2GVDA 3CWJA 1RT6A 3FBBA 3FSXA 1FJGF 2FLLA 1UL3A 4NX9A 1RSCA 4O44B 1WF1A 4RNFA 5EX3A 3F41A 1RHJB 4DZDA 2GS8A 1SC4B 4EWTA 1SJFA 2Y9HA 3WIUA 1UEKA 1Q53A 4YS2A 2CQHA 1RU2A 4B02A 1TL3A 4IG3B 4DL6A 4V19X 1SC6A 3M30A 1HWJA 4ZCMA 1KQGB 1HIYA 3QZ7A 2NSCA 4GKJJ 1JKHB 1TVRB 3R6LB 3D3BJ 1FTCA 3FMBA 4IQMA 2DH9A 4KQZA 4DX6A 1BQMB 1VQSA 1TKZA 3I0SB 4LBPA 4B3MJ 1VC6A 3IS9B 1RAJA 4NLSA 4K4UA 3D0HE 5DG7A 3O6QA 3G6ES 4DR1J 3DLLQ 2BA9A 4J9RA 4A8XA 3LWLA 3HP6A 2ZD1A 5F8MA 4C97A 3T6JA 1FRKA 3C16A 1SCJB 3DKDA 3HLUA 2V4JA 4OLOA 5HP1B 2J0XA 2OD4A 3ISND 5HLFB 4PG8A 2BOPA 1OQ6A 2HIQA 5HMWA 4NOHA 1NPRA 2CDQA 2HHSA 1W26A 2DEIA 4B17A 2F4VJ 4N41A 3W64A 2IIHA 2DGTA 1TQLA 1FDAA 1R31A 3I4PA 5CYMB 4CM2A 4MIWA 4CWBA 5IQ6A 5E5NA 2KI2A 5E3CA 5I42B 1HBUA 2DNMA 2MY7A 4RW9A 5JJBA 2DO0A 1VGYA 1WDDA 4H4KC 4WIIA 1KQSR 2LQJA 1NJZA 3C6UB 2K1RB 1OYDA 1HNVA 2HVEA 2EK1A 2MZTA 3CDWA 3GPAA 3P5TL 4HHHA 5D4PA 3SCJE 4ANCA 4WU3A 2NREA 4O0NA 3K0JA 1H72C 2KYZA 4EI2A 5DQGA 4QR1A 3O3LA 2GFFA 2MQLA 2CNKB 1FFGB 3VWSA 3I9ZA 3DOMA 2VQEF 3IM8A 4IG0B 1IKVA 1C1BB 4NLQA 3M8WA 5E3PA 2MYFA 1GTEA 1RWWB 2KO1A 2WOMB 3BN4A 3UD4P 4DR6J 4BWMA 4RBVA 1FX2A 2J9CA 1FKPA 4JOUA 3V6DA 2QLWA 2RUGA 4CLKA 4Q5VA 2ZHBA 3GJRB 3DRRB 3C6TA 4O3OA 5CYQA 1HR0F 5J1NA 4LSLA 2HQ3A 4PWDA 4G1QA 2DGWA 2LEAA 4OI4A 3CNQP 3M9MB 4CLFA 3G96A 3V4IB 5ETTA 1HWUA 5D4NA 3OXGA 3ENQA 1UEVA 3H0PA 2FJAB 1FXDA 1S1WB 2FLOA 3KLIB 1UZDA 5JUMA 4N5SA 4DSEA 5IFMA 2QMWA 3FBFA 3X3UA 1WSRA 3OXFA 1KSPA 1FX4A 4Y65A 3EZOA 3UNYA 2MQPA 3OL6A 3RUBL 3T3FA 1N33F 2A2DA 3ZZPA 4M5DB 1E6YA 1H2TZ 1HL6A 5KTQA 3EGZA 3VGTA 3OHAA 2XWYA 4AT1B 2MZJA 4OI3A 1RLCL 3WX8A 1C1CB 4NLYA 1T03A 1C4AA 4Y00A 4USTA 1Y5LB 4CO1A 4F4WA 1ZBTA 1BQMA 3I0SA 4USJC 1T9TA 3JS9A 1OPIA 2QA4G 3TJAA 4C0HA 4J9SA 4XAKA 3BR9A 3SDEB 2Y8WA 5HJYA 4Y2AA 2H5JB 1WF2A 4KV8A 2CPEA 2DY9A 4RW4A 4IO9Q 4OZLA 3V81A 2MKJA 3TJ8A 5F8JA 4C8NA 4LSNB 2MPUA 1U48A 1T9YA 1RI7A 1RT4A 3OUYB 2BXJA 4RNHA 3QBCA 4Y0FA 1NPPA 3L7UA 4K4TA 2WTFA 4AE5A 1M90T 3B6BA 3BR8A 1X31C 3BYRA 4ES3A 5DGBA 4YR0A 3IAS9 3OFEA 1UWBB 5L1KA 1FWLA 4J90A 3R7NB 3G6XA 4DPOA 4C48A 4ZVFA 1Q8LA 1M5OC 4W90B 3C14A 2ZE2B 1JK9B 3R2DJ 2QFJA 1N0UA 2BJ8A 2LP4A 5KFKA 1GMUA 4F0HA 4DQIA 3I5BA 4FS1A 1RKIA 3IBWA 2H48B 3LUYA 5ETMA 4EU0A 1JLCA 1X4CA 1H2UX 4P9SA 5F41A 4OJHA 1NK5A 1PO6A 1KD1T 4TY8A 3ZZTA 3IRWP 3M2RA 2VDIA 4IO1A 4XK8C 5IQQA 4X66J 2FY1A 2ZBIA 1NKCA 2AKWB 2R8JA 3KYLA 2D3UA 2XZTB 3MPUB 2DXEA 5IT9U 1CLFA 1XTZA 2WOMA 1H7WA 2HZCA 5A8KA 1VLYA 3C8YA 3IAM9 1XMQJ 3E51A 4JI1F 2F4VF 3OT9A 5HQLA 4OI1A 5F8IA 1Q16B 4EMDA 3DRRA 5ETLA 4DR3F 4B3OB 4QR0A 1IXKA 4O4RA 4ECTA 2E1PA 1XC9A 1CS4B 3OXLA 3WC0A 1NO8A 4USMA 3NRBA 1VHFA 3CTRA 2IAJB 5DZ7A 4BWJA 1CJVB 4LFAF 1F5CA 3JQKA 1SBRA 1S6PA 3AA9A 3NG8A 4ZPAA 3V5RA 5DG8A 4WPAA 2UVUA 2RQ4A 1FFSB 2DD8S 1NXIA 2HBZB 3BGLA 1SPBP 2VQEJ 1PBAA 1F9HA 4NI2B 1UJ4A 4HTJA 2N7CA 3Q24A 1N52B 1WKKA 2FPHX 2KN4A 2HRTA 2NXJA 4FKXA 2OPPB 3GIMA 2B51A 1SJ1A 3QO9B 1RK8A 2YNGB 3EICA 4U96A 4CM0A 4DR6F 2XYPB 3U27A 1K8AT 2YPZA 2HHHJ 1LNQA 3N0VA 4DSFA 3T9NA 4IUFA 3MAAB 2RB7A 1RHMB 5T14A 2BANB 3K17A 1D8YA 3LP1B 2ALYB 5G0RB 3R3TA 2R7UA 4Q44A 4JI6J 1OYEA 3MAQA 2E9TA 3OUYA 2IC3A 1RTIB 4MFBB 1NSAA 2F9DA 1BD6A 2IFXA 3KG1A 4KR0B 5GAGI 1XNQJ 2RRBA 3EGNA 3JTNA 3FEZA 1BQXA 3CCRS 1KVJA 2ILZA 1F5BA 2DGOA 2W2OP 4QJVA 4UOHA 3GCWP 4DPWA 4K2XA 1EARA 1I3OB 1SQEA 4ETXA 5LSOA 3UD5A 5KFQA 2QL9B 2O66A 3TR5A 3CT9A 3IWLA 4QWAA 2GHWA 1U2FA 1NDPA 1YJUA 1ZPWX 3LA0A 4GVBB 3D4JA 1LKZA 1NEEA 1A0OB 1JLEB 1N5TA 4NZ0A 2PD1A 3GQCA 3CCVS 3C19A 4CO5A 3PKYA 2HMIB 2CDRB 3R5CA 4X64F 1DQ9A 2GVZA 1F9EB 3UCUP 1FJEB 5JMNA 3D54A 3M6WA 2ASDA 5KFLA 1RCOB 1BQNA 2UU9J 5J2QA 2UXBF 4EBDA 4TU9A 1S9GB 3DXBA 4DOZA 2Z2MA 4F0KA 1J5OB 1SJRA 3DDKA 4JI0J 2HFUA 4OZ0A 1GX6A 2W2NP 3BPSP 4USIA 2RMLA 2HS3A 1ACMB 1RABB 5BYRA 2ZH1A 4ALZA 1EP4A 3SI8A 4DUYF 4ICLB 3MHYA 2CIMA 1IJFB 1HW9A 3WZ0A 4M5IA 4OYZA 5EGYA 3T19A 5KG0A 3NS7B 4KHMA 3G4SS 4NXNJ 2DHXA 1QY7A 2FDNA 2Z4PA 1CG2A 2GO8A 3LGHA 2MLYA 1IKXA 1JLQB 3MM7B 3W65A 2CVIA 2B9YA 1NU4A 1S6OA 2F8MA 2VBXA 3PX6A 2ILYA 5C25B 1VQ7S 2HNYA 1AFIA 2QMXA 5K5MA 2HBYB 2F1FA 2YKMA 3ZZRA 1KWMA 3ILIA 2CJKA 4MTPA 4F67A 1QVGR 3BS9A 2W8LA 3D67A 1NUEA 4CT8A 1XMQF 1HQEA 3R6GB 2BKOA 4E0DA 1CULB 3G2XA 1LEOA 2HNZA 2E7XA 2R2TA 1NNDA 4JI8J 5B0AA 2QRRA 5KFJA 2DHSA 4OJ3A 3FFIA 4X4PA 1J2VA 5H1SV 1B0PA 5BYSA 5HO4A 1SIZA 3TI0A 4OHXA 1G1XA 1IBLJ 1KKHA 3PYEA 2EC0A 4ZN1A 3I4HX 2HIYA 1T02A 2Z2ZA 3NGTA 5CYJA 4KHPJ 1S6QB 4DV4F 5L1JA 1MMNA 4Y2CA 1MU2B 4K4XA 1MLAA 2IVYA 3TO8A 1WI8A 3BN7A 4WU2A 3CJKB 4CTAA 3GV8B 3KUHA 1N56A 2E5LJ 2HRYA 1IBMF 1S48A 1CQNA 3BB5A 3QRRA 1TELA 2CQDA 5LJ5Y 5D0HA 4F0MA 3VGSA 5FLXU 1V3SA 1NJIT 2E5HA 5E3QA 4DSKA 2HLTA 4U67Q 2CPFA 2R7XA 3HJFA 1ITPA 2ERRA 2C2NA 3CJ5A 1YBTA 4MIBA 4ZP7A 4ILLA 2GQCA 2HVHA 1TL1A 2HURA 4OZ1A 2HMIA 3KK3A 1JLFB 4DX5A 5B0DA 2LQBA 2AF6A 5GADU 5D8HB 1QE1A 2YKAA 2P9EA 2CKWA 2YQ1A 5DZ6A 1QJHA 2VUGA 2ZJRQ 2W7AA 1ZOTA 2RF2B 1MG7A 3MDFA 1S9GA 2RDJA 1UZHA 2IMOA 4XO0A 3PTWA 5CXTA 2YNFB 1HKAA 2B56A 5ETPA 2CJYB 2HWIA 4I6YA 1HBOA 2C3MA 4OLPA 2J6TA 1R8AA 1RT2B 2YNHB 3O8WA 3OR2A 3VVUA 3CXCR 4HDGA 1NHVA 1VMBA 1X5PA 4EFAC 4X65J 1RYSA 5C42B 4ZVRB 1YBAA 2IRYA 3F73A 3SV3A 2JC1A 3P6YC 1FKPB 2CQBA 1RWMB 3JXOA 3O2IA 3V6DB 2IMWP 4X4VA 2ZH8A 2IJFA 2LQ9A 3NBPA 5D78A 1R0CB 4PQUB 2P5VA 3TJ9A 1NK4A 2QMUB 1VQ9S 2GIQA 1WORA 1U1PA 3W2VB 4IR9A 1K0VA 1IBKF 2N82B 3HJVA 2UU9F 3KKFA 1NSPA 4NLTA 4C8YA 1LK5A 2X1BA 5JXSA 3JYTA 1KTQA 1WKJA 2FHJA 2MJUA 2DR8A 1S1WA 3KLIA 4NLVA 3FRYA 1DZ5A 2C3UA 5KOXA 2DO4A 4DX7A 1NB2A 1TTHB 2HVDA 3FUYA 3FVYA 3U1NA 3UVJB 3VAMA 1KLMB 3IWNC 1RT3B 4LSZB 3NNCA 4USVA 2V4QA 1RAAB 1HBNB 4NXNF 1RWVB 1JXVA 3DOLA 5HN0A 5H9EJ 1IQZA 3M1VA 1UMJA 1IKYA 1JX4A 2W4DA 2BUNA 2LEPA 4DWIA 1ZS6A 4QIEA 4QWDA 5A8RA 4FBUA 3DYAB 2GC8A 4FS2A 1MU2A 1N5VA 1X8DA 4WFAQ 4PG6A 2JOQA 3J7YU 4WP9A 2BE7D 1RHQB 4OX9F 2R8IA 1U1RA 3EJMA 3K8VA 3M8PB 4NLGA 1R0AA 1XJWB 2Q6CA 3V81B 1FWPA 1GXLA 1PSDA 2PA8D 1EIYB 3JSMA 1LW2A 4NL5A 4PABA 4UOFA 4Y34A 3R5GA 3DOKB 4JI8F 4C8OA 4AQYF 2VPZB 2ZH5A 2AU0A 2L3MA 1FE0A 2DHGA 3ZO7A 2ZOFA 3D6TB 3VQSA 3T1YJ 3CW2C 4ID5A 3WIVA 2NZ4A 1F2HA 3Q8UA 2DNGA 4ATNA 3PHEA 2B4VA 4RUAA 4A8KA 5KFRA 1TK5A 3ICLA 3QGIA 2JL9A 1XEZA 3S8SA 4RUCA 1XIQA 2MQOA 3Q8RB 4JI2F 1QAYA 5KFNA 4WBFA 4J9MA 1YZ7A 1AFJA 2YBVA 4PG7A 5GMKa 3MMAB 3KHHA 2F8HA 5ETNA 2MKKA 2H9ZA 1IM4A 1KLNA 4RW6A 2CJQA 3W1YC 4CP5A 1PC5A 2EC2A 2YKQA 4IFYB 4LT6A 3DLKB 3RRKA 4RO0A 3I0RA 5KFDA 3GV5B 3NAHA 2V0NA 3M2UB 2HWHA 4YB1P 1DQ8A 2AGOA 3AT1B 4PR6A 3KJNB 1C4CA 3W5ZA 1PJ5A 2RVJA 3R7SB 3UN3A 2XMAA 4LFBF 2H1YA 3IA0A 4F4AA 1LV5A 2OPQA 3J81j 1FVSA 3W8PA 1WTFA 4JI7F 2WBMA 2ASLA 2YX1A 1CVJA 1TKTA 3I82A 4RBTA 1MWYA 1R7IA 3W2VA 2FGCA 5I4MA 1VQMS 2ZNZA 4OYAA 1GMVA 3NAIA 4RLEA 3FQLA 1OSDA 4ZCLA 3ZTRA 4GKJF 2AGPA 2PSZA 2CZVC 1PYSB 2XULA 3US5A 3GR1A 3GG1A 2CA9A 3L9ZA 4WP8A 1GTHA 1WHWA 3BM7A 1NCLA 1AZSA 1GXTA 1RT3A 4LR7A 1BMQB 2QSFA 4V1Ak 1XMBA 2WHOA 4GKKF 4M5MA 5HATA 1ZAXA 2CJBA 3Q8VA 3B54A 3UCGA 5JVHQ 2WB1D 3MEDA 4IRDA 3H5XA 2FJEB 1KONA 4IDKA 1VQYA 1HNXJ 4ILMA 4H4OA 4XPEA 2DNPA 4TNOA 3TX0A 1JLGA 4OYXA 3G8TA 2ZC4A 4QIFA 2ZOGA 2ZHOA 5L1LA 3QAUA 3UO0A 3CMES 1X7VA 2ZFHA 2IBKA 3M7VA 5K14A 2YX7A 3DNCA 2OPSA 3DDIA 3KJQB 3RW7A 3ZZYA 3RJMB 2Q79A 1YRTA 5G0RA 4OYWA 2HAIA 1TL4A 3KLVA 1UP1A 2LXFA 2BRLA 1QTNB 2LXIA 2RILA 3RB6A 3PCOB 2H5EA 2WW8A 2ZWOA 4WJBA 5KFAA 1IBCB 2M0GB 2XCAA 1CC8A 4OX7A 3UFCX 4NCBA 4FBTA 2RKIA 4L74A 5KG6A 2EFQA 3NNAA 4JI4J 4UY85 3ENVA 2WBRA 1RWXB 2LFVA 3GSIA 3SQGB 4PXCA 3PIPQ 5L1IA 4ZMMA 2AJQA 5B0EA 1CC7A 2XS7A 3N9UC 2VG6A 3FSIA 1Q8KA 4B3RF 2B6AA 2BW7A 2LA4A 3FZBA 1HNWJ 2RRAA 4NCAA 2GCFA 1KN6A 3TANA 4DR4J 4J9KA 3BV8A 2FZGB 2RDIA 2FVRA 4NYPA 3MD1A 2M8DB 4I0WA 2ZWPA 3FJ2A 3B4DA 2DNYA 2L48A 5J1EB 4IOBA 4O3NA 3KK2B 2Q66A 1FDDA 1YITS 1R6YA 3C66A 1U25A 1S1TA 2EBEA 3VVTA 5DGAA 5D3GA 4ZPWR 2AT1B 3MR6A 1A9NB 2UXCJ 1YHQS 2IDLA 5LMUJ 3LOUA 2HAFA 3HVAA 1DTQB 2CQGA 2K8GA 3CC4S 5H9FK 4EBCA 4OV1A 4UTGA 5ADZA 2JDJA 3K59A 1EP4B 4RUBA 1KEKA 3CJ8A 3DMJB 1WG4A 4YP3A 4C3MA 2HGMA 3H2VE 2HQDA 2C2OB 2VPYB 3A8IA 5KFXA 1S97A 1M0SA 1LQ9A 2UUTA 4JI2J 4E98A 1S59A 4P2MA 4ECSA 1TKXB 2I8EA 2J7WA 3I55S 1UVIA 2A1BA 5BJRA 1YJ7A 5IWAF 4ZOSA 5HQMA 1R8PA 3MM8B 2B0GA 5J2PB 2RSQA 1CSJA 2ZOMA 4BCAA 1SH2A 4DL4A 4A8FA 3ELHA 1S0VA 4HDHA 5E33A 3C3LA 1RT7A 2IYIA 1X4DA 1CJTA 4O44A 3VCDA 3PVXA 4LFBJ 3PY8A 4PUOA 2HHPA 3CGIA 1N36J 3HDSA 3J81Y 2BBEA 2NQPA 1HFEL 2FYXA 2CQCA 3QATA 4AL5A 2HNZB 4DSLA 4ZVOB 3IR5B 1DARA 2F4FA 4FYVB 4ES2A 1VIOA 2O5DA 1GNKA 5LMNF 4OJ1A 2IA6A 3W2WB 3MR7A 1S1XA 2RIJA 3M30B 2PIIA 4PXBA 3TWZA 5HL7Q 1JKHA 3GYXB 1S9FA 3K5MA 1SL1A 4QW9A 1VS3A 2KXNB 4NEYA 1KOOA 3QIDA 1ZTWA 4PYAA 1RZMA 2K3KA 1P9YA 4OYOA 3ZZOA 4R5PA 4B9SA 1U7LA 3AXMA 2VFSA 1J5EF 2JJ4D 4OHYA 3MEKA 3OFGA 2XQCA 3CCQS 1IQTA 4HKQA 3C15A 2OELA 3CJQA 2XMKA 5I3PA 2XS5A 4V19J 2FQQB 2C2RA 4CNYA 2KZMA 1URNA 2NUUG 3W7BA 4XDDA 1Y7PA 2WSCC 4GVLA 5GAHU 1HNXF 2DR6A 4OI2A 1IR2A 4LF6J 4C3LA 3R5JB 1H6KX 1FK9B 4NMXA 2VOPA 4OJGA 1F0XA 3AJDA 2B8QA 1D8ZA 1U0SA 3M2VA 2HGLA 1FWKA 4RWWA 3TEGA 3AJ1A 4F04B 3BSNA 5HJXA 1TMMA 3GJQB 2VZ9A 4QPTA 1U1LA 1BUXA 2KHDA 4IRKA 2LVWA 2OPRA 2HQGA 4OHWA 2QSWA 3UR0A 4NEZA 2ZDPA 3QPIA 2ADBA 4F3QA 4J91A 3G6VA 4IFVA 4F3OA 3Q0AA 2CQ1A 4IG0A 4AXIA 4RUHA 2CG8A 2VG5B 2WW4A 5HBMA 4CT9A 1M5VC 1VBYA 2B5JB 2W25A 2MLXA 4LF9J 3BPDA 2OFHX 2D7SA 5LJ3Y 2OI2A 1U09A 3D7SB 3OL7A 4FKYA 4X4QA 2FD2A 4DV1J 4P71A 1NKEA 1OSCA 3NMRA 4KSEB 5EWGA 3HO1A 3LQVA 1WC3A 1AA1B 3MPDA 4KIAA 4CO4A 4CYUB 4RNNA 2E1CA 4G1QB 3V4IA 3RB3A 5KG4A 4DXLA 4R8UA 2MDAA 3M8QA 4YDDB 1HMVB 3GIIA 2VICA 3W9HA 3QRQA 3T1AA 3R8YA 3PW5A 3TZXA 4JI6F 4J7CA 3M05A 4J9PA 4RW7A 1WACA 1P1TA 1EETB 2IM1A 2YNIB 2L08A 5KFFA 4ELUA 5L46A 4EYHB 4DSJA 4BHQA 3THTA 4KGKA 1E6VB 4LIRA 2FZCB 2K2PA 2JLGA 1E6YB 2B9WA 1FRHA 1OIAA 2BZ2A 3HSZA 2R8HA 1N8RT 1GH8A 4KTQA 4WXOA 2DNZA 1S1XB 3PDNA 1SXLA 1T0TV 1L3UA 1BXNA 1I1GA 1SKRA 1ULRA 4P6QA 2ZVSA 3IGNA 4C6AA 4P7TA 1VC5A 2KZZA 5ETKA 2YWFA 3CIMA 3D28A 2DRAA 1B64A 3MMBB 5IWAJ 2AJFE 3R5DA 1ZH5A 1HD1A 1ZM4A 2AJ1A 5A6PA 5AJ3J 1TMJA 3KFWX 1KHWA 1WC5A 3MEEA 2OH2A 1H98A 5HROB 4ECWA 1A6LA 3FDSA 1S7HA 2IM3A 1UJ6A 2KJVA 3M8PA 1R0AB 2KTQA 4WKRA 1WUUA 4K7QA 4EBEA 3GFXA 3OHBA 2ZH2A 2ZBQA 3G82A 2VKZG 1Z2LA 3SCLE 2AW0A 2GX8A 3HVTA 4LF4J 2BW2A 2UUBF 3HX9A 4MAKA 4O3PA 3ZZZA 1CBKA 1RB0A 1WC1A 2A10A 2DT9A 2E1MC 4I2QA 3V6HA 1JLAA 1TFWA 2XMMA 1HQUA 4DUTA 4HH0A 5DJBA 1XN9A 3IP0A 2MQQA 3PJ9A 1PCAA 1HA1A 4PXEA 5E3AA 5LSRA 2RS2A 3W3SA 1VQ6S 2C3OA 3EZUA 4FYWB 4I56A 1ZA1B 4A8YA 3QZ8A 4IH7A 2R2SA 4YB5A 1I94J 4F4XA 4YY3J 5J2MA 2JEIA 2P2CB 3NCRA 4ZVHA 1NK7A 2H65B 3RU0A 1B0VA 3UN2A 1VBKA 4OZNA 1K47A 2B5JA 3H2UB 4AL7A 1YDLA 3DLKA 3OVAA 1TL7B 2BJ7A 2CPXA 4ZVUB 2C2KB 3VAFA 1Q7YT 1SUQB 3Q89A 3U1MA 3KLGA 1T05A 1VI7A 2GVDB 5C7PA 3U7JA 5K20B 1KHVA 1T9WA 5DDOC 3M9OB 4A8QA 1IVZA 4PEOA 3M32B 2WONB 3CD0A 4G6VB 1CJKB 4DV5F 3KTQA 2H54B 4DEZA 4R8UB 3M4XA 3QT8A 2G0JA 2MMYA 1GEHA 2EWHA 1LWXA 1PYTA 1QSLA 2NLWA 4QU6A 1UEUA 4IG3A 2J76E 5EX0A 3GIJA 4M5LA 2JRSA 3K8WA 3T5LA 2F3JA 4A8SA 2I1RA 1VK3A 1M5KC 4ZA1A 3H20A 5LSLA 1F1BB 2ZH4A 1WC4A 2UXDJ 2MKIA 2F9JA 3D9BA 3DCAA 4OHZA 2E66A 1S49A 1C1BA 1MN9A 2E7VA 4W98A 4UT4A 1UA1A 2EPIA 3TW0A 1N5SA 2CPDA 2FHMA 3CCWA 4H4KA 4LVNP 3C16B 3R97A 3WX4A 4CO3A 4DV1F 3K5PA 3R9LA 3QRPA 4R25A 5EWEA 4B9NA 5I3UB 2QT7A 4RU9A 4ECQA 1LXJA 5CYQB 2IBOA 5DO2A 3TA1A 5DDRC 4USHA 2VFTA 2RNEA 3IGVA 3OW2R 4WE1A 4PWDB 4B3TJ 4Y3CA 1TKZB 2R42A 5D6GA 2JVRA 3IG1B 2YWWA 2MZQA 3DRSA 3FK4A 3HVTB 3MPYA 4J9QA 3RW6A 1Z4UA 4CIOA 4B3MF 2G1DA 2OMOA 2X51A 3DXSX 3QFHA 4I2QB 1KFSA 2QJ3A 3GTYX 2W2QP 3D0GE 3H98A 3IR6B 2WSFC 3CJSA 5HP1A 2OEKA 5D0EA 5KFWA 1HHTP 4E2FB 3DOMB 3A3OB 1UW4A 3FEYB 4ED4A 3MWBA 2VQFJ 4M5GA 4XDCA 1VRTA 1IKVB 1Q79A 3PM9A 4K2JA 5KG5A 4WFBQ 2Y1RI 3QLHA 1HI8A 2LXUA 4ER8A 3P45B 2FY8A 3DGVA 3PFEA 1C0UB 4TXSA 3VGUA 3A1YG 5K8PA 2NR0A 2V34A 5BR8J 2HQIA 1SQGA 4K5RA 2MTLA 2VDHA 4JBCA 4KAIA 3MF5A 2M70A 3A8EA 5LOQA 1YJ9S 3IWXA 1LXNA 2KM8B 1RKJA 1RTJA 1WI6A 2J9DE 1F2GA 3KK1A 5LT5A 3I96A 3L95X 4Y2KA 1EKRA 1Y0HA 3JSYA 4F36A 1TL7A 2OAUA 3LP2A 2M8HA 2KT3A 5IV4A 1S1TB 1T05B 2ATCB 1P8GA 1IJEB 2W2MP 1HBMA 2POKA 2PO4A 3AD9C 3MTKA 4ES1A 2E29A 2R7TA 4P72A 5F9NA 4YFUA 2V9KA 2WCXA 3CJ4A 3VQTA 2RQCA 2DCUB 3KLHB 1S7IA 4HVZA 3UDEA 4PAAA 3OSNA 3QGPA 4ZDNA 1WEZA 3Q8SB 3K58A 5A2QY 1AYEA 3DI6B 4URSA 3F44A 2P9GA 4UOCA 1UVNA 1EB0A 4JV5J 2OTJS 2BRKA 3CIZA 2C42A 2MKYA 3GB0A 1I94F 2FC9A 1GMWD 3LPEA 3U02A 1MW7A 2KVIA 5CD4H 5C25A 1QAIA 1H2VZ 4X84A 4LSLB 5EDWA 1P6TA 2AYGA 1SIWB 1WNEA 3J7AN 3I32A 3GCXP 3NGKA 3W63A 1VYAA 1OQ3A 2GHVC 3UQSA 4CZCA 3R1HA 1HR0J 4EEYA 2QA2A 2MHEA 4GC7A 3KDNA 1CJTB 2MZ1A 3SSRA 2R7VA 4OHVA 4USUA 1UETA 3BBFA 3M6VA 2VG7B 3R5BA 4FN5A 4Z37A 1VHIA 4IYQA 4YR3A 3W62A 3PNIA 3SBMA 5KFTA 1JWWA 1FJ7A 5GVQA 4ZVQB 3T1YF 3IM9A 1G6BA 5D0GA 2IJNA 3DRXA 4U9RA 2DNKA 5D0RA 1WHXA 5K8NA 1ICEB 1AUSL 1P9QC 4WE1B 2GMHA 1FT8A 3KJVB 1TK8A 3E8OA 1VDHA 4KHRA 3FMWA 1B4SA 3HHEA 5A0YA 2IAJA 3MUMP 2Y1JA 4CCHA 1EQ0A 3CCTA 1P27B 5B0GA 4FNIA 1ZM3A 3OR1A 3UDVA 3MM5A 4NLPA 1TUVA 5J1PA 3N28A 4M95A 2DH8A 3BO3A 4N77A 3ISNC 2DR9A 2WVCA 5AXMA 3ZNUA 4HT7A 2DKOB 3ET6B 4ZVEA 3R1LA 1B70B 4DHVA 1HYSB 5ITHA 1ROFA 2HNDB 2XMUA 4CLZA 1YJNS 3C2PA 1U0HB 1JIHA 2RQKA 4QOTA 2P6SA 1KQKA 3G87A 4ZPTR 4YR2A 2VPXB 1JLFA 3HXMA 1QSYA 4YHHF 4ZKAA 3M9NB 3AJ2A 2H3EB 1IKWA 3ZZUA 8AT1B 2PI5A 1T95A 1BWVA 4FF3A 2PFFB 4B3TF 4E8UA 1OJ4A 3ZTQA 3PR4A 4ZN3A 2A18A 3CMQA 4PWWA 2G2OA 4DR2J 3BBBA 4HR2A 3GYGA 4L73A 3W5XA 1JXLA 3UDLA 4DFPA 4BS2A 1V6HA 4DMZA 4DS5A 1REVB 3HFKA 3TUZC 5A8WA 3JB9k 4MMOA 3UI3A 3UPFA 2W7PA 2Y0BB 2GGPA 5CHCB 4ECUA 4LF7J 2CZ9A 2V4JB 2OKQA 3ADAC 3PW7A 3DC2A 1XR7A 3OQ2A 5HLFA 2M52A 4RL1A 3QO9A 1YJTA 2B4PA 2RD5C 4DPXA 1JJ2R 1RT5B 2XSFA 1U4BA 3I31A 2E1RA 3DU6A 2V9WA 4OQJA 4KJIA 3QWPA 3CJTA 2LQ8A 1RACB 3MUVP 5CCMA 2ZDOA 2V8HA 1GMWA 2C3PA 2ADCA 1HMVA 2AHOB 3D1QA 4MYUA 1VCTA 1JB0C 4ITSA 3VTIA 1MN7A 4KB7A 5T7LA 1R6VA 3PXGa 3BH6B 3AB4B 3CCZA 3DDNA 3HHLC 4ED5A 3KNAA 2G0IA 4GO5X 4C8ZA 4DF4A 4WK3A 3CJRA 3BGFA 3LAMA 3P49B 1IR1A 1RYRA 2GZOA 3DGPB 1LW0B 1TAQA 2LCWA 4DR5J 4QPXA 1EAYC 4DV7F 1NDLA 4NYOA 3HHNB 4RKUC 3CC2S 5A8RB 1LWCB 2QL7B 1RCXB 1HNWF 3W8GA 3HHKA 3OJSA 2VL1A 2ZZMA 3ZTOA 1S1VA 1SH3A 4DR4F 2IYGA 2XSJA 4B9UA 3R27A 3TUJC 4Y2MA 3IBCB 5KFPA 2AGQA 2OFGX 3H7HB 2HNYB 1U24A 3MM9B 1N32J 3JTOA 3ZC4A 3IO1A 1LW2B 1RQ0A 4HACA 3HKWA 2IC3B 3AOCA 3DOKA 1HBUB 4FNHA 1Q0NA 1SVDA 2HS4A 3E01B 5F3TA 2CPJA 4K50A 2DGSA 3MZIA 1FA0A 2F40A 9RUBA 4HL9A 2HFOA 3RAQA 3A8KA 2BM1A 2PA3A 5B0FA 1JXEA 2VC1A 3DLEA 2RAQA 2VBWA 4C2MA 1F6TA 3J81U 1WOSA 2IVMA 1P1LA 4KT0C 1FKAF 4X4RA 3HMJG 2BQ3A 4UW2A 4M5DA 2Y1LB 5MAOA 1YJWS 2NS1B 5SUHA 4UOGA 3CB4A 1VQNS 1ZETA 3SEOA 4QZVB 1LOUA 5KT7A 2NCKL 1S0OA 2QLJB 2BJ1A 1S77D 2BR0A 1U02A 4KO0A 2GV1A 3B4MA 1CPZA 5J2MB 4CTAB 2DXDA 5A76A 2AX0A 3SDEA 3ULHA 1T9VA 1W2BR 4X64J 1YBUA 1R8CA 2G13A 1VIXA 1BQNB 2V63A 3C6TB 2XC9A 4MKYA 3KG4A 1U1KA 4KKOA 1FJGJ 3OV7A 3Q2TC 1O51A 1SUQA 3RB4A 3EGWB 2UXBJ 2R7OA 3ENAA 4W4MA 1R8BA 3LF0A 2JEJA 2XG8A 1KOHA 2HPUA 4ZCKA 3MMCA 4L6V3 3THPA 4ZLJA 5IT4A 1RXOB 4NLUA 2KJWA 3KK3B 4QWCA 4DUYJ 3BH7B 3DHWC 5CABA 2UP1A 2W01A 4LRAA 2V69A 1QE1B 1PJ6A 3H42A 3P3DA 5KT3A 3EGVA 3C14B 3SQOP 1K44A 1X0PA 1X5OA 1SQFA 2LECA 3OTOF 2VIHA 5LM7E 3PV8A 3IRXA 5KT4A 1S76D 3V4MA 2IJRA 2HBQB 3D6HB 2KH9A 5IT9Y 3EXCX 4DR2F 2C28A 4PRFA 5E3RA 1Y3JA 2XY6A 2BQRA 1WEXA 2FVCA 2YKNA 1L3KA 3CJKA 3HVWA 3CCJS 1L3SA 3KHRA 4MYTA 4AYBD 4CLLA 1SJQA 1N34F 1RTDA 1TL5A 2R3VA 3PJXA 4DZ6A 2QA1A 5DDPC 4XIUA 3LANA 2N4CA 3KDOA 2OIHA 3DM2B 4I64A 2XLKA 1W2IA 5K14B 3TVKA 1DLOA 3ZTPA 2A6MA 1NDCA 4GRSA 2OJ3A 3FFIB 1OO0B 1NK8A 4GO7X 3BSAA 1TL1B 2HVZA 4HACB 3LPYA 3QIPB 2I5JA 1YI2S 5LXRA 3I87A 2W24A 1T8EA 1AW0A 3H4DA 2D9OA 1UAWA 2RE1A 3UW1A 1IBLF 3HPOA 1I6JA 5F8NA 4ZHRA 3BBCA 1CJVA 3M6XA 3NP5A 3FCVA 1S6PB 4ZS6A 2LA6A 3Q86A 1Y11A 5D4OA 2LU2A 2E5LF 1G3OA 3UVJA 2A3JA 1WJ9A 3GONA 1S9EA 1JLCB 3IC1A 4K4ZA 5KFUA 4C0BA 1FF2A 1PAUB 4Y2IA 4TQRA 3GE9A 3MCMA 3A3NB 1JJCB 5E7OB 4CLSA 1MNEA 4DF8A 3VAJA 3NS6A 4J9UE 3OVBA 3KLFB 4O4GB 2NYIA 1VJWA 2EXUA 3D68A 5KT2A 1TUGB 1Q5YA 3I9V9 1SKSA 5H9FJ 4HEA9 4C11B 5KT5A 3SV4A 3NCQA 2BANA 2KT5A 3HHLB 3TP2A 1FEHA 3MTJA 1BHNA 4MJKA 2ROGA 2CQPA 3KK1B 1FHTA 3CD5A 2W9CB 5CD4A 1J27A 4BLGA 4UZBA 2FGOA 2W4CA 4KKOB 3N01A 1N5QA 4NA1A 4OI6A 4NLXA 3EPIA 1AT1B 1UVLA 1B7FA 3V6JA 4JYAJ 3BQ1A 4G1IA 3FKBA 3NMAA 3BGUA 4TYAA 3HK2A 2MKCA 3SFUA 2RHQB 4ZP8A 1FXLA 3NS5A 1SKWA 4LF1A 4L3NA 2IPOB 4TLQA 3KLHA 3GILA 2W9BB 3QSYB 2FJXA 2DNNA 2XMJA 2YXLA 1SL0A 4X4TA 3MECA 1T9UA 4Q43A 2ZC3A 2UV8G 1ZAVA 2HK3A 3DRPB 4DPUA 3N6LA 3JAMU 2JNJA 1M5HA 2XNQA 3M1VB 1IKYB 3VZIA 1S79A 3W61A 2MB0B 1IR0A 3OTCA 5AJ3F 4DR5F 2R8GA 3NL0A 4NCGA 2YKNB 1XR6A 1UVJA 2HW3A 2CJXB 3GYNA 5M2PA 2VA2A 2LMIA 3MCNA 2ZKTA 3EVWA 2BE2B 3U1LA 3LH2S 3MI7X 3HM9A 3MM6B 5F9LA 3CC7S 3AOBA 1H38A 2MSSA 4P10A 4J5OA 4U7CA 1WD6A 5DM7Q 4FF4A 1HPZA 4RNOA 3JSMB 1XMOJ 1AROP 3W2WA 4OMFG 1DLOB 4USKA 1RDRA 1SB6A 2FJDB 5JVGQ 3EE3A 3ILJA 3VAIA 1K73T 1HLWA 1TP7A 2ZZNA 3QIPA 3P5BP 2XMVA 1JLBA 1Q8IA 4A4JA 5C5JA 3OTOJ 2LYVA 4OYPA 5SZTA 5CZVA 2V8VA 5KG2A 4AXJA 4CI0B 3PHTA 2VFUA 2QEXS 1G2EA 4I7FB 5CZXA 1QAXA 3ENWA 3MM5B 5RUBA 3NWRA 2ZH3A 4DV3J 1LWFA 1RWNB 2YWGA 2LU1A 3HZGA 4C4WA 4NA3A 2FHKA 4HT5A 4NRTA 4ZPCA 3G8SA 3CDAA 2V94A 3OFHA 3LAKA 1KBRA 1M5SA 1FKOB 3NGRA 7FDRA 3NGUA 3SZ2A 2VONA 5ETVA 2WZ1A 3UDCA 3A13A 3QSIA 3MR3A 4OYBA 5GADI 1D3WA 2YH0A 3PFOA 1FE4A 1U0HA 2AV5A 2EG1A 3A3PB 3FNNA 4DFKA 2D3O1 1GT8A 3VALA 5J2QB 2YQ0A 4Q8FA 4YDXA 2QX0A 5GAEU 3H40A 2EW9A 2KRRA 3SSSA 4C11A 4DV5J 4AQYJ 1WF0A 3CJ0A 4ECZA 4DR7F 3HHLA 2CVEA 3L4BC 2OPSB 2Z57B 3D1OA 1SI9A 2OPRB 2JX2A 2XHCA 2X7IA 3EVMA 4HI1A 4G1PA 3BQ0A 2EEYA 1O5JA 2E1AA 2GQQA 2GMLA 2JFDA 3D1HA 2EI5A 4KGMA 3GWCA 1KS2A 4EK2A 4PYDA 4LRCA 3BDPA 3K5LA 2BQUA 3LWMA 1D09B 1FTRA 1B3TA 3PO5A 4AL6A 1CEZA 1X5TA 4M63A 4NLWA 4J9NA 2UXDF 2OUGA 2PI4A 2EFGA 1D9FA 3UR3C 2G0CA 1QUPA 3LW5C 3CUNA 1FO1A 1NAQA 4JV1A 1RLDA 1D0EA 2MQNA 4KGVB 4WTOB 1KRPA 1Q4RA 1U6ZA 4B9TA 3H2LA 1SV5B 1UVKA 1KQFB 3RAMA 1N33J 5IM0B 5CYMA 2R4FA 1RT5A 4KE5A 3S6EA 3SCIE 2BV3A 4O0IA 4O3QA 3KLEB 1S10A 5HANA 3HD1A 3RB0A 2V8PA 4Q2MA 4XTTA 1EX8A 2YNIA 1RAIB 2Q3PA 3TAMB 1VQOS 5K9FA 5B0BA 4I1TA 2RUSA 2I38A 4CH0S 1NDKA 3UCZP 3K2YA 1T3NA 1PGZA 5T7LB 1XNQF 3RG6A 1IWAA 1DRZA 3HSDA 3S01A 5DS7A 3OVSA 3LP0A 3MEGA 3TQEA 1KFDA 4WKYA 3PYGA 2R2RA 1FDNA 4K4VA 3FRZA 5DQIA 1QLNA 1VR6A 8RUCA 1TUWA 2YVSA 4UUXA 4X66F 1K1QA 2HS0A 4IH5A 4QYZK 5F0WA 4QIWD 4JI3F 1LWCA 4U8YA 2XS2A 1HNIB 2DIVA 4CDIA 3KMQA 2E44A 2GIFA 2M2BA 3GIRA 4I7FA 4DPTA 5BR8F 3TA0A 5HROA 1QDUB 4N8OA 3M6UA 1BLUA 1F5AA 2KYXA 3B78A 3CEDA 1XNRJ 2AZ3A 2EFVA 3WC2A 3D3CJ 1XQIA 1OY8A 2BJ9A 1NJWA 4PQUA 1T7PA 1T94A 2WSEC 4O3RA 3R5AA 1A7GE 5T41A 1UJ5A 1DURA 3Q8YA 2N4DA 3GJTB 3CPWR 3G9CA 6AT1B 1XMOF 3HT3A 5DLGA 1U2RA 3RBEA 1JLAB 4MKVA 3K5OA 2HHWA 1O6XA 2XEXA 4LFAJ 4RW8B 1OS5A 4URGA 2KRBA 5KFZA 5U47A 2XLIA 4N47A 3WBZA 2OSRA 2GA7A 1X0FA 1U45A 1NK6A 4B9LA 1DTQA 1SJ3P 4ZVTB 5FJ4A 4KGZB 2CAJA 2XMTA 4DQQA 2QLBB 2YNFA 3L3CA 4DV2F 2X3GA 3N5BA 1RTZA 3MPWA 5CQGA 1RA6A 4JB8B 3CCMS 2KXHA 3PIOQ 4L3KA 1FESA 1WG5A 4R5PB 1PG5B 4UUWA 1YRUA 1ZYQA 4P2SA 5EWFA 3TQ1A 2HHHF 1TK0A 4C98A 3BF4A 3H8YA 1UPMB 1NBEB 3IFEA 2OEJA 4NLDA 4YMEA 1NH8A 2HBRB 2HG4A 2VB6A 1F3FA 3FBCA 4QIVA 4WCEQ 2DY1A 2WONA 4KYZA 4P7VA 3RZAA 4ZLPA 1Q82T 3DLBA 3HF5A 5MLCV 2KM8C 3RGIA 1RISA 2KU7A 1R3NA 3AB2B 4ZPVR 2KVQE 5CH7B 3K5NA 2HHTA 3BGRA 4M8LA 2XLJA 5FD1A 2OGUA 5C24A 3LO3A 2AX1A 5HSPA 1NKBA 1EKSA 1MMLA 1PAEX 2Q43A 1DFDA 2HFNA 3O44A 1HI0P 2KDOA 2FIUA 3CJ3A 3MM8A 5KFHA 5J2PA 1X4EA 3SCKE 2LLZA 3DYAA 1DTTA 1Y9OA 1KR4A 2FUG9 1WEYA 1X60A 2V2VA 2V68A 3H59A 2Y0SD 3PRVA 5HAOA 3S7RA 3T41A 2I9SA 3M8RA 1NZAA 2MZRA 3M2UA 3SYZA 2JVOA 2VD3A 3CE8A 1D9AA 2DJWA 1PKUA 1ZA2B 2J5AA 2V2KA 5J2NA 1RAGB 4F2SA 1NJYA 1N36F 1XERA 4OYIA 1KTVA 3RTVA 2H5IB 4OZJA 2GAGC 6FDRA 2GO9A 2EKNA 3IXQA 3M2VB 3CF5Q 3EX7B 2VPWB 2ZHAA 5KFBA 4M1KA 1S0MA 2U2FA 2OHDA 1X9MA 2AWZA 3CSKA 1FD2A 4PG4A 1W7WA 3AQPA 3TA2A 2DVIA 2J0WA 1FERA 1X4AA 1WG1A 4LBIA 4YEAA 1R8HA 4ZCIA 1NRKA 4DV0F 2VKRA 4TVAB 3GLJA 1VISA 1WKLA 3IS9A 2V50A 2PC6A 2PT0A 3KWMA 2DTJA 4ZPDA 4ED0A 2CPIA 1R43A 2YNGA 4ZK7M 1RAEB 5A6WA 3KUEA 5KFCA 3OSPA 1WTBA 2Z30B 4JI3J 1DY3A 4IFYA 3RBZA 3GV7B 1OWXA 1ZZFA 3ETMA 3MEDB 3T5HA 3F0NA 5KFMA 4C9DA 3JAMY 4N76A 3KNGA 5GAEI 4DV6J 2X1GA 3UWTA 3MFHA 4B3OA 2L41A 2K3IA 5IC4B 3OD2A 3NCPA 2XGPA 1LWEA 4ELVA 3OJUA 2ZEJA 1QM9A 2ZJQQ 5HQ8A 1IBKJ 2H4YB 3MXHP 1UWAA 3HKZD 5FLXY 2DRBA 3KOAA 2W4PA 4M5HA 2R7RA 4IQXA 1LFWA 1HI1A 2BEFA 4K4SA 1RBOB 1HWIA 2AJ4A 2UV8A 2F65A 2B9EA 3NGSA 3AOAA 4BBYA 5LL6d 3PACA 1FFWB 2ROPA 4P52A 4F25A 3J7YI 3QJPA 3QGGA 2W9AA 5THWA 2CQIA 1HW8A 1HNZJ 2QZ8A 2ZD1B 4NZ6A 4L76A 2QYCA 4ZVGA 2QLFB 4QWEA 2DB1A 2W9BA 4DV2J 2OPPA 4EYIB 2VBZA 4DV7J 2L9NA 3H5SA 5HVHA 3SQGA 4OIXA 3GMGA 3AD8C 1WHVA 3QNWB 4HLBA 2UUAF 4Y28C 4WP3A 4IOAQ 3KHGA 4JI5F 1YSJA 4HI2A 4Q8EA 4U7UK 2WK4A 5GAGU 3M8SA 2SXLA 4CNZA 2J0SD 2HHVA 3PJWA 2BABA 1X9SA 3W9JA 5IZHA 3EUNA 4RW7B 1U8SA 3GP9A 1EZZB 1R27B 2ZUAA 2CNLB 4DQRA 4KRWA 1E6VA 3GJSB 2CNNB 2VH7A 4YB7A 4X4SA 2QG9B 1K1SA 1HPZB 3L7PA 3TVYA 4DJBA 2WB4A 1N54B 2DR5A 3RR8A 4LFCJ 2EVZA 3NLCA 3JQJA 1CJKA 2C3YA 1IWGA 2B43A 1M1GA 2RKIB 1F3VA 4ZIWA 5A0YB 2VHGA 3POTA 3CCSS 1JLBB 4DL2A 1KVKA 4QYRA 3R2CJ 4H54A 4QW8A 4WIQA 3X1LB 3OBIA 4J37A 2HSEB 1H74A 1UFWA 4CLTA 3I56S 4X65F 2RQMA 5H9EK 2C1EB 4MKBA 2WVFA 3R7BB 3S1TA 5KFIA 3ET6A 1VLOA 3QT6A 4Q45A 4DL7A 5GMEA 1WC6A 1S99A 1YK9A 3LGNA 5KFOA 1VBZA 1GX5A 4UF4A 4ILRA 4ZPBA 4KV8B 2IRXA 4TN2A 1EQMA 1JJ4A 3IMQJ 2CPZA 2K1RA 4CO0A 1U1NA 1W25A 2YKPA 3OL9A 3EDQB 4PZVA 2E7WA 4LSNA 2CRLA 3ZZ0A 3IN5A 4OYMA 1BY9A 4EUVA 3TARA 3PW2A 1PBUA 5DM6Q 4LF4F 3BKFA 3FCWA 3JSBA 4LR9A 2N3OA 3M8ZA 2HHUA 3CDUA 2DITA 4OZ5A 3DFEA 1VC0A 2J6UA 1RAFB 1JMTA 4FYYB 2EK6A 2N3LA 1S6QA 1SH0A 3BEGB 1H73A 3NNHA 1F9FA 4B9MA 1REGX 3TZWA 2D74B 4PKDB 3DLGB 2CUYA 1AUDA 1YWXA 4N56A 2ZH7A 1YX2A 4L75A 2HRUA 2F5GA 2G1HA 3AODA 4ZVSB 5GMDA 1RWPB 2GGPB 2IM0A 1FEEA 1V5IB 2BKNA 5M2UA 2X1AA 2ZJPQ 2HZAA 4RBUA 4CRJA 2XO7A 4DLGA 1RT4B 2F63A 1N34J 5EN1A 1PJ7A 2FTRA 3FBEA 3PW0A 4J9VA 1H7XA 4ZLNA 1Q86T 2WVDA 5AT1B 4F02A 1B0TA 2O01C 4DCPB 2MQMA 4ERDA 4Q0BB 2UVVA 1FK9A 1GK8A 2C2ZB 2AYMA 2VFVA 3Q22A 2Y8YA 4DR3J 2NSBA 3BKUA 3V2UC 4C0OC 1V3RA 4FP9A 1U47A 1M1HA 1WHYA 3THVA 2M3DA 2DIUA 3TAMA 1B7YB 2VC0A 4QU7A 1C1CA 1TV6B 3P4UB 2N7YA 2Z56B 5KFGA 2B4OA 2DYAA 3W60A 1T03B 2DCLA 1HARA 4LRBA 4PWUA 1VRUA 5E41A 1HBMB 1SJ4P 2AYEA 2GIRA 3IG1A 2OSQA 3MPVA 2HKEA 3G71S 1VBXA 3M2RB 4WFNQ 2KT2A 3TZYA 2OTLS 4RW4B 2DEJA 4D3HA 2XY7A 2C2MB 3POTB 1VQ8S 5C42A 1S6UA 2Y3YA 2UUAJ 3J7Z5 4A48A 1VRTB 4LRDA 1R0BG 1NB7A 5IT0A 5ETSA 3BO2A 4P74A 4BDPA 1RBLA 4N8NA 2YWEA 4WF9Q 2HFSA 2CPYA 2YWHA 4RWXA 1MROB 2F8EX 1KNZA 1X4HA 1RA7A 1UWBA 2AEMA 2UUCF 4JI7J 4U7UD 3KJFB 3OL8A 4WYLA 2X1FA 2XYHB 2DNQA 1YLXA 4WZQA 2W2PP 2NXCA 4A8OA 4OL8A 2FHOB 2GW8A 1TL3B 3DRSB 1EETA 1K9MT 4JYAF 2JLEA 3MAHA 3HD2A 2Z58B 5KG3A 2VJVA 2V6AA 3JSRA 5ETQA 5B7WA 2RU9A 4LFCF 4QIGA 2HQCA 2ZKUA 4ZP6A 5KOWA 3OPKA 4S0MA 1DQAA 4USWA 1FVQA 3BJYA 2ROEA 1RT2A 2GQ2A 3OR2B 4I69A 4CH7A 2C2DA 4YQWA 3QLHB 2JEFA 2VQFF 3KJVA 4KFBA 2DNOA 1S72S 2DISA 1PILA 1TFYA 1X4GA 5F0UA 1RHUB 3BDEA 1JNRB 2HYIB 4RNMA 2DGVA 1U6BA 1TU0B 2JC0A 3JQMA 4WK1A 4GVBA 2W8KA 1UA0A 3QJJA 1ZAWA 1AXQA 2VF3A 4MT1A 2Z0GA 4M5KA 1MMDA 2L9DA 3GR0A 1JLEA 2NXNA 4MKAA 3W66A 4B9VA 2XWXA 2J6SA 3JTPA 1CS4A 1FD8A 3CCES 2E9ZA 1T11A 1CJUB 2KL8A 3H90A 4DU8A 4DQPA 2QV6A 1HHSA 2ZVIA 4Q0BA 2G4BA 4DLEA 1HNVB 3UE2A 3H5UA 1L5UA 2HGNA 4IR1A 1UW9A 1S12A 4NXMF 3MD3A 2ZM6F 1LK7A 4FXVA 4NLOA 5HBMB 1M5PC 3VR1A 3DI6A 2BE9B 5KG1A 3PRBA 4DCOB 4EO8A 4F4KA 4JI4F 2PDAA 4ELTA 4F4ZA 1JJHA 3PX0A 2FVSA 2XYGB 3HSJA 1OMSA 4EZ9A 2QGFB 2ACYA 1XBWA 3EM1A 2RU3A 4JV5F 4UQGA 2AIRB 1VRUB 5LXYA 4B3RJ 1VK8A 2K06A 3WDOA 4DV3F 1FRJA 1Y5IB 3NEKA 4RW6B 5FIIA 2GVZB 4Z7CA 4LREA 4I4BA 3V6KA 3EYZA 3CDBA 3J7ZT 1GQEA 2QYGA 2J9DA 2JFKA 3ITHB 4Z2XA 3DM2A 1Q1KA 2CWXA 2X3DA 2MGZB 2APOA 4C7QA 2EFPA 3K89A 4TYBA 2RHSB 2VG7A 4CH1A 2M4MA 5J2NB 1Q7LB 4MFBA 4BC9A 5KFYA 4DL0C 5B0CA 3D2WA 3Q23A 1VQ4S 5KFEA 1HQEB 1Y5NB 3A8JA 2UXCF 4ICLA 4B3SJ 1CULA 2QIFA 4P75A 2QO3A 4DFMA 4K0KJ 5CA5A 4UQTA 1IN0A 3GFYA 1OY9A 1IKWB 3VAHA 1SL2A 4C8KA 1NHKL 3DU5A 3W9IA 4DV4J 4H4MB 1BE4A 4KY3A 4MK9A 2CPHA 1DHMA 5E2QA 3VHQA 1QD1A 2Z2LA 3MMAA 1AZSB 5L9NA 1YGYA 2PMZD 5KAKA 1MWZA 3GU0A 1RGVA 1LFPA 2MSTA 2O3DA 4FYXB 4LJMA 5IV3A 2JEGA 4LF9F 2HNDA 5M2RA 5KFSA 2RJZA 4IH6A 1HYSA 2AEFA 3KLFA 4TY9A 3W5YA 4AFFA 4KFBB 8ATCB 3MCOA 4MH8A 1V9OA 3TAPA
chains in the Genus database with same CATH topology
1RJJA 1S1VB 4J9OA 2KXFA 5I3UA 3E3XA 4YOEA 5EHHA 4C8LA 4FVMA 1Y3KA 4I2PB 3RYLA 3MM9A 2BVZA 3TYTA 2BYCA 4I67A 3J7A1 4I6AA 3FEXB 3HHDA 4LVOP 3SSQA 4ECYA 2YTCA 2ZE2A 1TR0A 4R0JA 3UNGC 1T3OA 3BREA 2BDPA 1IKXB 1JLQA 3MM7A 2AP6A 3OTDA 1TZ0A 2J8AA 4USIA 3N6NA 5A8WB 2CJAA 2VASA 4WFZA 5CCLA 3DRPA 4NYZA 3L7OA 4FZVA 5AE1A 3EPGA 1N5YB 3DGPA 1HBOB 4KHPF 1FCAA 1QVFR 1F60B 4IDKB 4LF7F 1UKUA 1GXUA 2ZH6A 1NK0A 3ISZA 4H4OB 3CD7A 4FYDA 4ED6A 3LGMA 4Y6IA 4LF6F 2P6TA 3VAGA 2BE2A 1MSWD 5I3QA 1QUVA 4Q2LA 3AQOA 3BO4A 2UUWA 3VAKA 1FRIA 2XSJB 3QJLA 1U1MA 4KC5A 2KKHA 2RT3A 2PMHA 3NBPB 1U1QA 2R2UA 3ITHA 2FC8A 3Q8PB 2RF2A 4JV0A 2MGZA 2DH7A 3PX4A 4HTIA 3LALA 3F56A 3KMSA 2FJBB 3JYTB 2QE5A 5F8HA 2J7KA 4DG1A 4F4YA 2DGQA 3OTBA 2R9LA 3PKMA 1LW0A 1X9WA 3RR7A 2YNHA 5D4LA 5HMYA 4OFZA 4A47A 4WZMA 2DGXA 4TKTA 2R7WA 2J7UA 2K7KA 4DR5F 4C8MA 2VG6B 1ZZNA 3G86A 2OMLA 3HZEA 1H0HB 4IKAA 4QWBA 4DBQA 4ED7A 1N6QB 2JHEA 2I2YA 1S4FA 4PQAA 2BM0A 3EXYA 1C0UA 4NWBA 4D3GA 2CQ2A 4MIAA 2CZ4A 5G4DA 3KK2A 2GNKA 2DHAA 2XZWA 3LP1A 4DL5A 2PEHA 2OLWA 5D3GB 5DDQC 2K7JA 2ZH9A 3TVZA 3GIKA 3D0IE 3DLEB 4MK7A 4QQBA 2W7OA 1L3TA 2DR7A 5DG9A 3RRGA 2EFOA 1TAUA 4WXWA 2MZSA 4AUKA 1RTHA 4X2BA 4QCLA 1HBNA 2PE8A 3DMJA 3DOLB 1BC6A 4DX8H 2FLPA 2JSXA 2EFNA 3D5MA 4KO0B 4ZHRB 1YQHA 5IXUA 4WFYA 6FD1A 5L38A 3IRXB 4K59A 1NK9A 2B4UA 2YY3A 2CQ3A 1U26A 3E2EA 3BSCA 2M5YA 1VOMA 4JV2A 3MGJA 4J9LA 2XBPA 4YB6A 5AE3A 2DK2A 2UZAA 4NA2A 3KLEA 1Q8BA 3K57A 2JLFA 3AAWB 3MOJB 4O4GA 3QMQA 1IUJA 3I5AA 2MKSA 4ID5B 1J5OA 1KLMA 2IHR1 5DETA 2I0XA 2BJEA 1DAXA 2EKYA 1N88A 2D1CA 3HI9A 2FHJD 3CCLS 3CULA 4QYZJ 2B7BB 2LDYA 5FDLB 2MKHA 1Z1ZA 2J9EA 3HHLD 1TKDA 2XMWA 3LP0B 1XK8A 3MEGB 4LUBA 1KVIA 2EG2A 1DBDA 2ABYA 2VG5A 4OX8A 1CQMA 5HBMB 4W92B 4DG1B 4ZP9A 4CQ1A 3N4WA 4YUDA 3I0RB 1REVA 2O1PA 4X4UA 3T6BA 2B7CB 1RP5A 3Q2SC 3GFZA 1YJVA 3CJ2A 1YIJS 5AXKA 3DLHA 5DRKA 2ZUGA 4M94A 2E5JA 2QLXA 3CD6S 2B3TB 4DV6F 3T5JA 2KFZA 1TKTB 2FJWA 3CO9A 1MROA 4A8WA 2U1AA 2ZNYA 4GMKA 3RAXA 1BWEA 1Y00A 3DRYA 4RZRA 4NMLA 4IRCA 3MOZA 4OX6A 1HD0A 2M9KA 4K5SA 2RS8A 2Z8QA 3CMAS 3NKYA 2JWNA 3AA8A 1XWLA 1ZPVA 2W9CA 2XY5A 3J80Y 1TVRA 2G9OA 2COLA 3DLJA 3FCHA 1URRA 2CQ4A 3QAEA 3H5YA 4DSIA 2LDIA 1NHUA 2YX4A 1FDBA 4PPDA 2ALZA 1HNZF 1HWKA 2XNRA 4DN0A 2MY8A 4K4WA 2ZITA 4NLRA 2AD9A 2YKOA 1UFLA 1XR5A 3AY0A 3QGHA 4LIWA 1JLGB 1N48A 4PCQA 5F8LA 3GZ7A 2OPQB 5F3ZA 2KG0A 4B08A 4FF1A 2GJIA 4X62F 3T1HF 2FJVA 5AXLA 1S1UB 3FZ2A 4KBIA 4LF8F 3K7RA 4URQU 5I42A 3OLBA 4RW9B 2FLNA 2LKZA 1FKOA 3ONQA 2RH3A 1UVMA 3MURP 3NWGA 5HMZA 4GC6A 4ETZA 3IR7B 5LMUF 3T9ZA 4DS4A 2HHXA 1YG0A 2E5GA 1D9DA 2J0QD 4I68A 2DGUA 3MECB 5L8RC 1ELOA 1FRXA 5C24B 2NUHA 2KHCA 4F50A 3B8HA 1PC4A 4BC7A 5D77A 1WWHA 5FDLA 4TU7A 2IA0A 4A46A 4XPCA 3FQKA 4NCGB 2GMJA 4A8MP 4DL3A 5DQHA 1X5SA 4LQ9A 5HMXA 3PW4A 2UVRA 2XI3A 1O0PA 2M7SA 3PO4A 1Q78A 2DNHA 4IOCQ 2DPJA 1X4BA 2P9CA 4F2RA 2A2CA 4G3IA 1SV5A 4ECVA 3M32A 4DFJA 1N4LA 3N79A 4JI0F 3E01A 3GG0A 4DDFA 2D9PA 2D41A 2E5IA 3I6PA 1FRLA 3TUIC 2ATLA 2XHWA 3MMCB 3QYYA 2DNRA 5B09A 4ED3A 3MCSA 5E0OA 4X4NA 3ETOA 2B9XA 4ED2A 3TNVA 1BGXT 2YH1A 2B6AB 1Z2ZA 2HLUA 2AQ4A 4H4MA 4O3SA 1LWFB 1YJRA 2HVIA 2NXUA 5B08A 2VV5A 4I6WA 2PN6A 2R8KA 4ID8A 2XGQA 2KFYA 1ZTTA 2M88A 2OO4A 2ZBCA 3PRDA 1FRMA 4PUOB 1V3ZA 2Q6BA 2NPFA 3CDEA 2EBGA 1QAJA 1RTDB 5IS2A 3O1LA 3NGDA 3MUTP 1C0TA 1LWEB 4R0EA 4X4OA 2PGCA 4KPYA 2CG4A 3GFHA 1S1UA 1RT1B 1KC8T 5GAHI 2Q1LA 2D3ZA 4LMZA 3QWUA 4DN9A 1FJCA 4I2PA 2NPIA 2AJ0A 3TRGA 4CO2A 3PZPA 4FF2A 3GSDA 3AH6A 4HYKA 2QA4S 2BACA 4HHJA 3MR5A 3RBDA 2V5HG 2MJNA 4TLRA 2HFZA 2VBYA 4TY8B 4EO6A 4IFVB 1FXRA 2KFNA 2O67A 3L09A 5L9XA 3DHXA 3MFIA 1RT7B 4F8RA 3RRHA 4ED8A 5KG7A 2RRNA 3UD3P 1N5YA 3Q8QB 5IM0A 4K4YA 2L9WA 5A8KB 1H3DA 5KT6A 5KFVA 4PPZA 3VZHA 2VOOA 4F3MA 1HNIA 2IRUA 2CJ9A 3N5FA 3TOQA 4ECRA 3T5KA 4O23A 2R7SA 1N32F 2BJDA 1VQLS 3PR5B 1S0NA 1N0VC 3LP2B 4RU2A 3AHPA 5AE2A 1O8BA 1ZM9A 2DPIA 3MMJA 1R89A 2I5JB 2DNLA 3P96A 1Q81T 1FNOA 2JZ5A 5K8OA 1M1KT 4ED1A 2MHNA 2D3OR 2V8DA 3G6YA 4DUZF 1OPZA 2OP5A 4JUZA 4DR1F 1PGZA 3DN9A 2UVWA 4OI0A 5EUHA 2GJ2A 2ASJA 1S9EB 2ASYA 2XI2A 3MR2A 1U6FA 2WRMA 1APSA 1RT6B 1RWUA 2V8GA 3G8QA 3SFGA 4QBUA 2VA3A 4C3KA 2Y1IA 1YVFA 1N6QA 5BYQA 1QSSA 1HWLA 3SMZA 3TX8A 4TU8A 3MMBA 1XNRF 3M8QB 1RTJB 3SXLA 2JH3A 1K0TA 3EZ5A 2LEBA 2DBBA 2FVQA 4NZ7A 2IVFB 3OFFA 3MM6A 3H25A 2V4RA 1GAOA 5K8MA 1RTIA 4RW8A 3KHLA 4RX6A 1C0TB 2VODA 3CVKA 1RT1A 2WAQD 3BSOA 1RTHB 4NPOA 4PXDA 1FNMA 2IM2A 5DLFA 4FPRA 2E9RX 2R7QA 3CCUS 2CYYA 4TQSA 2HHQA 2FVPA 3DLGA 4DQSA 4FXWA 4LF5F 2FB0A 1VQ5S 2KB2A 1WELA 1DJ0A 4L72B 4YY3F 2CQ0A 2YWKA 5AXNA 2XCPA 2MXYA 2F7VA 2AYBA 3PEJA 1ZM2A 3BZQA 1YRXA 4FXDA 4MK8A 2VFRA 1C2PA 4QR2A 4PG5A 2GHPA 4WFXA 4FVCA 3C6UA 1L3VA 5J1EA 3N6MA 2C2EA 3VF0B 1FNXH 2OD6A 3KLGB 4U6PA 1X4FA 1HQUB 4B3SF 4K0KF 1NH7A 3BGRB 3O5TB 3ZFVA