5IM0B

Crystal structure of the rna recognition motif of mrna decay regulator auf1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
b'MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heterogeneous nuclear ribonucleoprotein D0
molecule tags Rna binding protein
source organism Homo sapiens
publication title Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1.
pubmed doi rcsb
total genus 21
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5im0B00
2DNOA 2PEHA 1Q82T 2J76E 3MDFA 2MZSA 2HYIB 2LXIA 2MQQA 3P5TL 1Q7YT 1H6KX 1YTYA 4BS2A 3I55S 3FEXB 4M5DB 1X0FA 3CMES 2MZTA 5H1SV 3CCJS 2JX2A 1KOOA 4ZKAA 5GMKa 2DNKA 4P6QA 3MD3A 1X4DA 3G9CA 3CCRS 1S79A 2CPHA 3I56S 1YJWS 4F26A 3EX7B 1X4GA 1VBYA 4U67Q 2G0CA 5LSLA 2KVIA 2RRAA 2LXUA 1N8RT 2XB2D 2U2FA 3UCGA 3ULHA 3UWTA 3R27A 3G8TA 2MQNA 1WEXA 2CPEA 5IM0B 2DISA 1YJNS 3PIOQ 1YITS 3CCUS 1DZ5A 2N7CA 1WF1A 2I38A 2E5IA 1X5OA 4EGLA 3P49B 2HGMA 2FHOB 2M2BA 3MI7X 5CYJA 2MKHA 4UY8T 3S7RA 2JVOA 1S72S 1WF2A 2F9JA 2FY1A 5D77A 2KXFA 1H2UX 2CQ3A 2DIVA 2MMYA 2OIHA 3MURP 4PKDB 1SJ4P 1UFWA 2AYEA 2EK6A 1Q81T 1DRZA 1H2VZ 1O0PA 2LEAA 2JVRA 1UAWA 3MD1A 2UP1A 1ZH5A 2HGLA 3SDEB 1WG5A 3G4SS 3MXHP 4WFNQ 1JJ2R 1K9MT 2M52A 3NNHA 3JB9k 5GAEU 1OO0B 2X1FA 1WHXA 2AYMA 2DGWA 2RS2A 2AYBA 5MLCV 3VAFA 3Q2TC 1P1TA 5CA5A 2VONA 2KH9A 2VOPA 3U1LA 1QVFR 2ZJPQ 2M70A 1WELA 4TU7A 2D9OA 3LPYA 4CH0S 2RQCA 2CQHA 1H2TZ 2DHSA 5GAHU 5DM6Q 1WI8A 3P6YC 3Q2SC 2MKSA 3TYTA 1F9FA 2N82B 1FO1A 1JMTA 2MSSA 4RU2A 2MZRA 2LCWA 2DNHA 4PRFA 3VAHA 2JRSA 5DDPC 1VQ9S 3IRWP 3CCVS 3S6EA 1VQNS 2MY7A 1VQLS 2DGQA 2DNMA 4QU6A 2NZ4A 1WHWA 2CQ2A 1R8HA 1X4FA 3UCZP 5DM7Q 1SJRA 1U1LA 2QEXS 2KXNB 1PO6A 2MQPA 3HI9A 3CC7S 3RW7A 2D9PA 4YB1P 2DO0A 1X5SA 2DGOA 1ZZNA 5CXTA 2YH0A 4FXWA 2RU3A 2CPZA 2DGSA 1UW4A 1W2BR 2VOOA 3DXBA 2RQ4A 3CCQS 2VODA 1UP1A 2MQOA 5GADU 1ZZFA 2CQ4A 4Y0FA 2M9KA 1N88A 2KI2A 3MUTP 5LJ3Y 2KM8B 3S8SA 1U1MA 1X4AA 2NLWA 2CQ0A 4TLQA 2QFJA 2CPFA 1WHVA 2B0GA 2EVZA 1VQ7S 2MPUA 3PIPQ 4YUDA 2MKIA 2M8HA 1FXLA 1X4EA 3B4DA 2XNQA 3R1HA 2HVZA 2A3JA 1M1KT 2MKCA 2CQDA 3BS9A 1U2FA 1KOHA 2CPXA 2LMIA 2CPDA 2OSQA 2MJUA 1RKJA 2RRBA 5GVQA 3MUVP 2KHCA 3L3CA 5FJ4A 3CTRA 1WTBA 4Y00A 3BO4A 3NS5A 4CQ1A 3VALA 1YIJS 4WFBQ 1VQPS 2F3JA 2MJNA 3CD6S 4IO9Q 2OTLS 2DO4A 1L3KA 1G2EA 3SMZA 1SXLA 5IFMA 1VQ5S 2CPJA 3MOJB 1B7FA 4C7QA 2KG0A 1SJFA 3H2VE 5DDQC 2MZ1A 1SJQA 3VAIA 3EGZA 2SXLA 2KFYA 3BO2A 3OW2R 2DK2A 2RNEA 4W92B 2RS8A 2LYVA 5LSOA 2N3LA 3VAKA 2FC8A 5DDRC 1VQ8S 1U1PA 2N3OA 1N52B 2OTJS 2J8AA 3NMRA 2HGNA 5HO4A 2DNPA 1K8AT 2YKAA 2E5JA 3BEGB 1VQOS 1VC6A 2KM8C 2L08A 3IWNC 2JWNA 2DH7A 4WCEQ 3HHNB 1FT8A 2M8DB 5IQQA 2MXYA 2DHXA 4F02A 4WKRA 1WG1A 2DGXA 4OZ0A 2M7SA 1X4HA 1A7GE 4FXVA 1DHMA 2MGZA 2X1AA 2DB1A 4OZ1A 1M5KC 1U6FA 1X4CA 3J7YU 1YWXA 4LJMA 2WBRA 4W90B 2DNQA 3VAJA 2CQCA 2CPIA 3US5A 3UD3P 1X5TA 1OWXA 2DH8A 2DH9A 1VQMS 1WEZA 1OPIA 3V4MA 1M5OC 2CQGA 2EK1A 3ZZYA 1VC0A 2GHPA 2KU7A 4A8XA 2MZJA 4TU9A 3CMAS 1N54B 1P27B 5D78A 1CVJA 3NNAA 1M90T 3TO8A 2MQMA 2AD9A 1WG4A 2M0GB 2DNLA 3UE2A 3S01A 1QVGR 3ZZZA 1HL6A 3DLLQ 2K3KA 5DDOC 3THTA 1VQKS 3NS6A 4QU7A 2YTCA 3CCES 2MKJA 2BOPA 1U1RA 4C4WA 1U1QA 2XS5A 2CQBA 2LEBA 1NO8A 4ED5A 2DNNA 2KXHA 3VAMA 5GAGU 2ERRA 2J0QD 3G96A 3UD4P 3NNCA 4C0OC 3CCSS 2J0SD 3SDEA 2AYGA 2DNYA 3CCMS 2BZ2A 2DHGA 2XSFA 1HD1A 3B4MA 5JVHQ 1WI6A 1BY9A 2OSRA 3CF5Q 1AUDA 4F25A 2RT3A 1PGZA 2I2YA 2GO9A 4YOEA 1U6BA 1DBDA 2E5GA 5IM0A 1R8PA 2U1AA 1NU4A 2LKZA 1WHYA 1U1OA 1WEYA 2RUGA 2KT5A 3EGNA 3CXCR 2L9WA 2XNRA 1K73T 3D2WA 5HL7Q 5BJRA 2QA4S 1VQ6S 1KD1T 2CJKA 2PE8A 4IOAQ 4V19X 3G6ES 2XS7A 1KQSR 4CIOA 1Q86T 2KG1A 2LECA 1A9NB 3FEYB 5JVGQ 2CQ1A 2XS2A 4ERDA 2YWKA 4WF9Q 2M88A 2FPHX 1D9AA 2CPYA 1HD0A 5LJ5Y 3J7ZT 1X5PA 2O3DA 2V94A 2E44A 2DHAA 5ITHA 1D8ZA 4PR6A 2X1GA 3G8SA 4IOCQ 1U1KA 1VC5A 5LXRA 2OJ3A 1IQTA 4QPTA 3CC2S 4UQTA 3THPA 2LQ5A 5LXYA 4LIRA 2DNGA 2MYFA 3K0JA 2ZJRQ 2DIUA 2DNZA 4Z2XA 3RW6A 2LA4A 4WFAQ 2MGZB 1FJCA 1KC8T 1YJ9S 2MZQA 4WIIA 1FHTA 3UCUP 3H2UB 3CC4S 4J5OA 1M5VC 2MSTA 3MUMP 1SJ3P 2E5HA 3CUNA 2HZCA 2KYXA 2CQPA 1VBXA 1WF0A 2MKKA 2DNRA 2KN4A 3U1MA 2MQLA 2ADCA 4IUFA 2RVJA 1XN9A 5DETA 1NJIT 1X4BA 3TP2A 2Q79A 1HA1A 1M5PC 1YHQS 3N9UC 1QM9A 1U1NA 3LQVA 1VQ4S 1RK8A 3CULA 2ADBA 4LMZA 1URNA 1JJHA 2F9DA 3CPWR 3G71S 3R1LA 1OIAA 2FC9A 1JJ4A 3SXLA 1YI2S 2L41A 2CQIA 2KRRA 1VBZA 3P3DA 4TU8A 1WWHA 2MB0B 2MY8A 3VF0B 2DGTA 2DITA 4QQBA 2G1DA 2M4MA 3CCLS 2LA6A 1FJEB 2MHNA 2ZJQQ 3VAGA 3BO3A 2DGVA 2YH1A 2K8GA 5EN1A 1FJ7A 2X1BA 4CH1A 2DGUA 1FNXH 2KRBA 2G4BA 2D3OR
chains in the Genus database with same CATH superfamily
1JLAB 3X1LB 2DNOA 2W1BA 3M6XA 3D28A 1FK9A 4P2XA 4NE9C 4P71A 8RUCA 3MDFA 3TUIC 1B3TA 2F40A 2VKZG 2HYIB 4B3TF 1VYAA 3P5TL 1ZTWA 1LWCB 3MECA 1CBKA 2B9EA 5C7PA 2AKWB 3QFHA 3W5YA 3T9ZA 4YMEA 3T5HA 1X9MA 2CNNB 4BS2A 2EXUA 3E01B 1BWEA 2MZTA 1IJEB 1H98A 4K50A 3OL9A 2H3EB 2RQMA 3K8VA 4MKAA 4CTAB 5A6PA 3CCJS 3KK2B 4DV4F 1P1LA 2DNKA 1MWZA 2JEJA 4P6QA 2BJ9A 3NCQA 3A12A 4Q8EA 2ZVSA 3CCRS 4JI1J 3HHLC 3K59A 4LF6J 2E7WA 3F56A 3M2UA 3KJQB 3QWPA 3I56S 1EB0A 4F26A 4DV3F 1T7PA 1FKPA 4IG0B 3HVTB 4QIGA 9ATCB 4U67Q 1DARA 3RR8A 3ZZUA 1GX6A 4F0HA 4EBDA 1HBUB 2B6AB 2V8GA 3DDNA 3FMWA 2RRAA 1N8RT 3UCGA 3BBBA 4CT9A 2L9DA 4AD6A 2MQNA 2WRMA 1X60A 2CPEA 5IM0B 2JOQA 2BM0A 1YJNS 1U8SA 1N5VA 2QTWA 1PCAA 2YX7A 5C24B 3PIOQ 2NS1B 3QRQA 2UVUA 1RBLA 2VBWA 2HZAA 4IRDA 3EVMA 4FVCA 1DZ5A 2VG5A 1R43A 3K7RA 1SKWA 3K5PA 1GNKA 1R8AA 2BQRA 1HW9A 2ZITA 2ZBCA 3LP0B 3MI7X 3UQSA 3IBWA 4MKBA 4OI3A 5JXSA 1HI1A 4C2MA 1RDRA 3S7RA 1FD8A 1K44A 2BDPA 4UY8T 3KXDA 4WE1A 1WF2A 1VRQC 5AT1B 2QV6A 5ADZA 1F1BB 4X4OA 4I69A 1HWJA 2UVRA 1F2GA 2FY1A 4P2SA 4FYWB 4NLDA 1BQMB 1S7IA 4KH1B 2E9RX 5HBMB 4JB8B 4XDDA 3PNIA 4W4MA 4X65J 3RBDA 1ZTTA 1H2UX 1RT7B 4I56A 4ATNA 2GVDA 3D0HE 3BN4A 3H42A 4C9DA 5B0DA 3NL0A 3MPWA 4X66J 1GMWD 4Q0BA 1V3RA 2E1PA 2C2NA 3BBCA 4B3MJ 1U7LA 1S1WA 2RDDA 1JLBB 1VCTA 1HPZB 4OX8A 4PKDB 1SJ4P 2AYEA 1HBMB 4ZPCA 2IJRA 1V5VA 3DRXA 3WIVA 5IC4B 1Q81T 3M1VB 4N7TA 3AOCA 3CMQA 1NHKL 4P10A 2GAHC 4QIVA 2IIHA 3WQPA 4CP5A 4X66F 5J2QB 3CDEA 1HQEA 2JVRA 3W7BA 5B0EA 3OL7A 4WBFA 3X3UA 4RW8B 3BB5A 3SZ2A 4X84A 1HWLA 1RJJA 3QYYA 1D9FA 1K9MT 3CSKA 3D3CJ 4FS1A 1TTHB 3HD2A 2FLNA 3JB9k 4DFPA 4NL5A 2E5LJ 1FVSA 1TKTB 2R7OA 3Q8VA 1LWEA 1V3ZA 4OYOA 2AYBA 5AXLA 4DQPA 3N0VA 4MH8A 1ACMB 2KFZA 1ROFA 2VOPA 2XG8A 2IBKA 3O3LA 4K4TA 1KS2A 2GIFA 3N6LA 1IJFB 1RHMB 2LEPA 2AEJA 4J91A 4LSLB 3JYTA 2M70A 2XHCA 2R8HA 4ECYA 4ED2A 2HZVA 3HJVA 2UV8G 1JB0C 3QSYB 4TU7A 1F60B 2D9OA 3LPYA 4CH0S 4CYUA 5KFCA 4HI2A 4XK8C 2DHSA 5FDLB 4CDIA 3I9V9 5DM6Q 4A8MP 1S0NA 3DLBA 3Q2SC 3TRGA 4DPTA 5I4MA 2MKSA 4HEA9 1XQIA 1FTRA 5FD1A 4NLXA 3TYTA 3NBPA 5KFWA 2N82B 5CD4A 2I5JB 4DV4J 1FO1A 4WXOA 2E9ZA 1ELOA 3R5CA 1NRKA 4ECWA 3DGPA 4KV8A 2JRSA 2EC2A 2VIHA 2VKRA 2D3O1 1QAJA 3DLHA 2EG1A 3HHLD 1RQ0A 3C66A 3NOCA 4L76A 4YB7A 4AXJA 3UDCA 5CQGA 3GJQB 3IRXA 2I0XA 1GAOA 4X4TA 1P8GA 1S0VA 3GU0A 1OQ6A 2DNMA 4PQAA 5KFVA 2ZZMA 2VBXA 3E8OA 1CQNA 1H7WA 1FDDA 3IRXB 4MT1A 5DZ7A 2NZ4A 4Y6IA 4I64A 1N34J 5ETTA 3TUJC 5HVHA 3VGUA 2ZEJA 3KLFA 2JHEA 4F3OA 4L73A 4C8NA 1S4EA 4C97A 2UVWA 4GO7X 4UQGA 3OFEA 2C22A 4WFZA 1FRMA 1U1LA 5K20B 1HARA 1LXJA 2KXNB 2YNFA 4JI3F 1Y5LB 2PC6A 4N76A 1SIWB 2M5YA 3RW7A 3CC7S 1X5SA 4CO5A 3CCTA 2YX4A 3IWLA 3Q8YA 2BM1A 1AFIA 4FXWA 5FDLA 1AZSA 2GVZB 1KEKA 2CWKA 2XC9A 2OFHX 1R0AB 4KGMA 3VGSA 4Q43A 2VODA 3V6JA 1UEVA 5AJ3J 2AX1A 3KUGA 4I1TA 4RW4B 4ZMMA 5A6WA 4TY8A 1LWFB 3KJNB 1IKXB 1SH3A 4Y0FA 4A8WA 2HRTA 1JXVA 5ETMA 3U7JA 3W2WA 5L39A 2GJFA 4DUTA 2IJNA 4X62J 3QGPA 1VLYA 1BE4A 3AT1B 2ZBQA 5D4LA 4TQRA 3OL6A 3M2RA 4DFKA 4M5NA 3NCRA 4LR8A 1U09A 2B7BB 1X4AA 3GP9A 4P52A 4USUA 2CADA 4EFAC 4EEYA 2NLWA 1OPZA 2CPFA 2YBVA 2B0GA 2W2QP 4RW4A 5ETSA 3DM2A 3W63A 3MAQA 2OKQA 3MZIA 1L3VA 5F9NA 8ATCB 1LOUA 4DQQA 2M8HA 2GVZA 2ILYA 5ETOA 2QX0A 4GKJF 3B4DA 1IR0A 3ILOA 1B0VA 3NOGA 2HVZA 2A3JA 2GQ2A 1M1KT 1UVIA 2XS5A 4A8YA 2GJIA 2MKCA 1FX4A 5M2UA 1WNEA 4QZVB 2VDHA 3CO9A 2UXDF 1Q1KA 1REGX 2FDNA 1I3OB 3C14B 4RW6A 2CPDA 2YX1A 3T6BA 3M6WA 5D8HB 4K5RA 4DL0C 4U95A 2HKEA 3M9OB 2DR8A 2E5LF 5IT9Y 1PYTA 2RSQA 5L1JA 4C3KA 2UXBJ 3D0GE 3M2VA 5KFRA 1GK8A 4Y00A 3EPIA 2UXCF 1LW0B 4V1Ak 2KT3A 2YNGA 2IYIA 3NS5A 4NI2A 1QAYA 5K5MA 4ZVGA 5L46A 1RBOB 3KLIA 3Q8QB 3BSOA 1HYSA 2NXNA 5HBMA 1FRHA 5FLXY 1BQMA 4DOZA 4ECRA 3R97A 4PYDA 2F3JA 2MJNA 1Q8LA 2KJVA 1AXQA 4TYAA 3SMZA 2B9WA 5IFMA 2UXCJ 4TKTA 1RABB 5IT9U 3QBCA 2H51B 2A0FB 2H5IB 5A0YB 4IR9A 1MMDA 4MK7A 3VZIA 2PIIA 3NBPB 2KG0A 2KZZA 2DTJA 2JSXA 5KFHA 3U02A 4I6YA 2MZ1A 2QLJB 2LU1A 3AOBA 1WTFA 1RU2A 1OS5A 3IXQA 3BKTA 3NRBA 2QLBB 4OLPA 4WK1A 4TXSA 1NXIA 3UN3A 3W2VA 2KFYA 1T3NA 3OW2R 2DK2A 3HZGA 2ZC4A 2LP4A 4X4SA 1HW8A 4JI8J 5LSOA 3CO0P 1TL7B 3Q86A 4RO0A 5EHHA 1MROA 1SBRA 4LBIA 3VAKA 1VQ8S 1TAQA 4UTGA 2N3OA 3PO4A 1JLQA 1N52B 3B54A 5I3UB 4W98A 2W9CA 2FJWA 1XMOJ 1JNZB 2EKYA 5J1EA 2IM1A 1UWBB 1K8AT 2YKAA 3JSBA 4AL5A 2E5JA 4IDKB 3M9MB 1SC1B 2YWGA 1TKTA 1VC6A 3M2UB 5JUMA 1S9GB 2ZVIA 3LP1B 2VFUA 4GVBB 3CDWA 5D15A 4EZ6A 4ZIWA 3RG6A 2R8GA 2NPIA 3I0SB 4YR3A 4CLSA 4HLBA 4F4WA 2CJXB 3IG1B 1T11A 1U8WA 2G2OA 4RW9A 2R2SA 4USWA 1TQLA 2I9SA 2ZDPA 4NCGB 4OLOA 1WG1A 2DGXA 5HMYA 3Q0AA 3D54A 1TVRA 2YNHB 1DHMA 4FDFA 4NLRA 4TN2A 3TVKA 4N8NA 3WHIA 2MGZA 2C28A 4DR7J 1IN0A 3BPDA 1FK9B 1EKSA 2VUGA 1M5KC 4KGVB 1YRUA 3MMBA 5KFDA 2XCAA 1TK5A 4KFBB 4RNMA 3BJYA 1RGVA 5E3PA 1MWQA 4ENOA 3J7YU 2DY1A 1RWMB 3L09A 4HYKA 1ZETA 2NXUA 5ETVA 4ECSA 2UU9J 3CD0A 4CT8A 2R7XA 3GJRB 1S1TA 5CYQB 4ZVEA 1J5EF 4W90B 2DNQA 3PJWA 2COLA 1FNOA 1PKUA 1S48A 3MEDB 3Q8UA 5U47A 1CPZA 2EC0A 4DPXA 2V67A 2CPIA 3G82A 1OWXA 2RHSB 3UNYA 2V5HG 3TUPA 3OVBA 1C0TB 4OZJA 5M2RA 4HKQA 3V4MA 3HULA 3DU6A 3JSMA 2CQGA 3R7SB 1VC0A 4DX8H 2YNHA 4DUYJ 2GHPA 1KLNA 4A8XA 4ZDNA 1CVJA 3W64A 4NCGA 1JLEB 4AL6A 3TO8A 4ECQA 1BUXA 1YSJA 1WG4A 4Y65A 3VTIA 2M0GB 1N5TA 3HFZB 4RW9B 2ZNZA 3NAHA 4DR2J 2RF2A 3S01A 3W9HA 2HVIA 4ED7A 2FHKA 2BE2A 2K1RB 1RXOB 3THTA 3TNVA 3BM7A 3TZYA 4QU7A 1FRJA 2L48A 2YTCA 5D4NA 4NI2B 4R0EA 1KFDA 4ID5A 4EMDA 1M5HA 4DU8A 2A2CA 3GSIA 3KLEA 1FE4A 2HAIA 1DY3A 3FDSA 1NJYA 2KJWA 3LWMA 2XLKA 2YKNA 3G87A 1U1QA 4C8KA 4DS4A 4C4WA 1SL1A 2LEBA 3UI3A 3LWLA 3QJPA 3C14A 2KXHA 3OTOF 2IMWP 3GYGA 4K7QA 1MROB 2J0SD 2JH3A 2DNYA 1VI7A 2C1EB 3OR1B 4LT6A 4C98A 5B08A 6FDRA 5EGYA 2XSFA 1QE1B 3KYLA 4A8SA 1X31C 4M5GA 3V6DB 1IKVA 4F25A 4H4MB 1CJUA 2RT3A 3W8GA 4ED0A 5H9EJ 4LF4J 1R8BA 4QBUA 3OTOJ 4WPAA 1IKYB 2W4DA 1VHIA 1DBDA 1VJWA 7FDRA 2WOMA 3HKZD 2GNKA 2QL5B 2HAFA 3BBFA 3PCOB 5CYMA 5IV3A 5J1PA 2R7WA 2LKZA 3JQMA 4NRTA 1NLKL 1NSKL 5C2GA 4DV5J 1PIEA 1U0HB 2FVQA 2RDIA 3OT9A 2RUGA 3TQEA 2H5EA 4NA2A 2KT5A 3RRKA 4GO5X 3CXCR 3UO0A 1EARA 1VFJA 2Z2YB 3DN9A 4B02A 3KHHA 2XCPA 2OELA 1K73T 3H2LA 2YKNB 3UVJB 4USMA 3V6HA 1PAUB 3R5JB 4HHUA 3PACA 2XMUA 4FF4A 4NA1A 1KQSR 1H72C 2Q43A 3H59A 2KG1A 1AZSB 2AP6A 4C3MA 5L8RC 1NHUA 1RT2B 2C2DA 2P6SA 2FZGB 2IM2A 1JLCB 1XR5A 2CQ1A 5JVGQ 1TL1B 1RWWB 4H4OA 4ES1A 3RUBL 1M1GA 5F8NA 3UN2A 1RWOB 4ZJQA 5FLXU 4KO0B 4LF9J 2EBEA 3HCXA 5LJ5Y 4IFYA 3MMCB 4PABA 3CJQA 1T9UA 2NPFA 1K0VA 4LUBA 2LDYA 3UDEA 1A6LA 3ENWA 1D8ZA 3TX0A 3T1HF 2MDAA 1U1KA 2B8QA 1WDDA 4OX7A 2W01A 5LXRA 2OJ3A 1UVJA 3THVA 1IQTA 2YQ0A 2GGPB 1VLOA 2VG7A 4QPTA 1VRUA 2VL1A 5KFTA 2J8SA 5EWEA 2DNGA 2A10A 2IM3A 1Q53A 5HQ8A 3K0JA 2D69A 1RADB 3OLBA 4DSJA 3GE9A 2WVCA 3RW6A 3JTNA 5HANA 1I5OB 3QFWA 3PTWA 2LA4A 2DRBA 4WFAQ 3GV8B 4PWDB 2MGZB 4LIWA 4HT7A 4O3PA 4KBIA 2DY9A 2W9AA 2E1MC 2MZQA 1Q7LB 3W1YC 4WIIA 4CZCA 1FHTA 2JJ4D 1JLGA 2MSTA 2KYZA 1SJ3P 5KG7A 1U4BA 2GMLA 5DQHA 3ZTPA 3J80U 3CUNA 2KYXA 4HL9A 4K8RA 4P7VA 3ZTSA 4F4XA 4K4VA 1CJTA 3MAAB 1NSQA 2CQPA 1AW0A 2QMXA 1VBXA 4L3KA 1T9VA 2KN4A 4LQ9A 3U1MA 2OPQB 2B4OA 1V9OA 2NUUG 2HFOA 4Z37A 2H54B 2R9LA 2MQLA 1U24A 2RVJA 4KHRA 1XN9A 5KT5A 1R8CA 2CJAA 2YY3A 4RUBA 4XO0A 5F8HA 2ZWPA 3PVXA 3HSZA 4NLUA 2OD4A 1X4BA 1EZZB 3TP2A 4OYPA 5A2QU 1FRXA 1M5PC 1N5SA 2XMJA 2YQ1A 2Z30B 3R5BA 1YHQS 3CJTA 3VQSA 4I6AA 3PX0A 4B08A 2FY8A 1XC9A 2AWZA 1C1CB 4PYAA 1F6TA 3CULA 2XZDB 1WJ9A 4QWBA 2CDQA 5LL6d 5GAHI 2FZKB 5H9FK 1S49A 1W25A 3DRYA 1URNA 5T14A 1OMSA 1OY8A 1TR0A 1RAAB 2YWFA 5KG0A 3C46A 4N41A 1M1HA 3UPFA 4DR4J 1SH2A 3G71S 4OZ2A 4WIQA 3R1LA 1OIAA 2OGUA 3BR8A 4PPDA 3GPAA 1W7WA 4F4YA 2NSBA 2KVQE 3ELHA 3PKMA 3P3DA 4IG3A 2JFDA 2WVDA 3DFEA 2MB0B 3VF0B 1YRXA 2PN6A 4QQBA 1CSJA 1FVQA 4RNHA 5DGBA 4EWTA 2HWHA 2HQCA 2RD5C 4ZVRB 4IH7A 1WOOA 2BABA 1FJEB 1EETB 3POTB 3PG9A 5B0BA 2YVSA 3OHAA 2DGVA 2DBBA 3H5SA 4NEZA 2ZD1B 2ZH9A 2N4DA 2K3IA 5JMNA 2YH1A 4HVZA 3KLIB 2AHOB 4A46A 4FF2A 2BACA 3C6UA 4KHPJ 5DZ6A 3OBIA 1HWIA 4CH1A 2V9WA 3HHDA 1VS3A 3SQGA 2ZH8A 1SCJB 4MKVA 2XWXA 3I96A 1IBMJ 1Q82T 4YS2A 1HWUA 2HS4A 4F50A 3O1LA 3TJ9A 1QJHA 1GXUA 3FK4A 1APSA 2MZSA 3LF0A 3TUZC 1J2VA 2RUSA 2LXIA 2XYGB 4E8UA 3MFIA 4KO0A 4PXEA 4TQSA 1YTYA 2HHPA 4BBYA 2DR6A 4OHZA 1YZ7A 2P2CB 3T9NA 2R2TA 5E2QA 4B9NA 2GIRA 3MHYA 1HI8A 1KOOA 4ZKAA 1MG7A 1B70B 3NXZA 4ZVPB 3ET6B 1RCOB 1X4DA 1KHVA 5GMKa 4GKKJ 4LFBF 1HHTP 2H4YB 1S79A 4IFVB 4EO6A 2HVEA 4LSNA 2AJ2A 2GQCA 5IOLA 1NK4A 2C2OB 5KFPA 1UWBA 3KLHA 2WVEA 4FNHA 4LRAA 3SV4A 2KVIA 4XDCA 2W4PA 5EX3A 3W9JA 2LXUA 4HR2A 2D1CA 3LOUA 1L3TA 3ULHA 4KJIA 3GJTB 3NP5A 3R27A 3UWTA 4C8LA 5ETKA 4C0BA 4OJ1A 1N6QB 2R8KA 2DISA 1KQGB 3V2UC 3MR2A 5D6GA 3VAJA 1NK5A 2V8VA 4I2QA 4DV1F 3CCUS 2N7YA 4ECTA 3MM6A 1WF1A 2I38A 3J81U 7AT1B 3ISNC 2E5IA 1X5OA 5C2CA 4ECVA 1R3NA 2V4JA 5K9FA 4RU9A 4LREA 2R7RA 2QFIA 5A8KB 4RUCA 1KONA 1QSLA 2GJ2A 4EUVA 4X2BA 5CYJA 3H20A 4KH0B 4QOTA 3MUTP 2DHHA 4UZCA 1HWKA 2RU9A 4U8YA 1FWPA 2R7UA 4X65F 3MM8A 4K5SA 3TA2A 5IC6B 2KXFA 4IH5A 3DLJA 1QD1A 1Y4ZB 3FBFA 3OTEA 5B0FA 4EU0A 4UUWA 4XIUA 3KJVA 2H9ZA 3PJXA 4NYOA 3PZPA 5DO2A 3AA9A 2Y1JA 1S0MA 3HVRA 3FRZA 3OXGA 5KG6A 4JI2F 4QWDA 4KYZA 1HBUA 2B6AA 2D41A 3HZEA 1NM2A 3NG8A 4CLYA 2DIVA 3GFYA 5JJBA 5LOQA 2C2RA 2DXDA 2C42A 1RT4A 1PYSB 3NWGA 2OIHA 3CIZA 4UUXA 2ABYA 2E1RA 3ILJA 4QIFA 2YQ3A 4OJGA 2NUHA 2LLZA 5GAEI 1IBMF 3M6VA 2EK6A 2R8IA 1J5OA 3CCZA 4USHA 4ZHRA 1UCNA 4WZMA 2QLWA 1H2VZ 2HFNA 2W4CA 2ZOMA 3BGRB 1O0PA 2LEAA 2RMLA 3G2XA 1XNQJ 2X3GA 2W2NP 4R25A 3MD1A 1FKOB 3DGVA 3GV5B 3Q24A 1N32J 1B7YB 4OX9F 3TA1A 4YY3F 3SDEB 1WG5A 4TY9A 5KG3A 2WB1D 2HS3A 3CJKA 2HWIA 4HACB 2M52A 1K1QA 4N47A 5AXNA 1S6OA 4AQYJ 1YBAA 3V6KA 4J9KA 4LF8F 4CM0A 1IWAA 2V4RA 1TL3B 2AYMA 2RS2A 4DL4A 3CB4A 1LK5A 2N4CA 4DEZA 5MLCV 5AE2A 1NJZA 4A8FA 4RBVA 4JUZA 1AB8A 3QATA 2WVBA 3KOAA 3AA8A 3LGNA 4KIAA 5DG9A 4OI2A 3D0IE 4PG8A 1KDNA 1KTQA 1RACB 5C42B 4TY8B 1G3OA 2J6TA 4WYWA 4N56A 3OL8A 3N4WA 2R7SA 5J2NA 4DV1J 3KDNA 1RAHB 1T03A 1FWKA 4ZP6A 2RQCA 4ETXA 4K4XA 2VPZB 1WI8A 5RUBA 3HXMA 1JLFB 4FKYA 5H9EK 3M30A 2W8LA 1HQEB 4DQRA 3DLKA 1L3UA 2IRYA 3U1NA 1I94F 2OUGA 1F9FA 2BEFA 2YNFB 4O3NA 1JLFA 1UETA 4HT5A 2MSSA 2DCLA 3PRDA 3IAM9 4MIAA 2ZJPQ 1H38A 4MKYA 1IXKA 1S9GA 3LP1A 3N01A 4JP8A 2FYXA 3BZQA 2IY5B 5ETNA 3PO5A 1DQ9A 2A1BA 2DCUB 3IRWP 1YKWA 2QG9B 2VPWB 1VQNS 4O4RA 2MY7A 2A6MA 1HMVA 5J1EB 3BREA 1QY7A 2DXFA 4K4YA 1HR0J 3PDNA 3BDEA 1KLMB 4YDDB 5DG7A 2UUAF 2X3DA 2ZHOA 2IM0A 1RHJB 5F9LA 4Y2KA 1TMMA 5HN0A 4JI7F 4PWWA 2J7WA 3HF5A 1DURA 5KOXA 2JLGA 2QZ8A 3TJ8A 3OV7A 3MM8B 4DG1A 3UCZP 3DRRB 2QEXS 2F7VA 4NLPA 2ZHAA 5BYRA 3WBZA 4LFBJ 5IZHA 1C2PA 1NPRA 2BOAA 3BV8A 2Y1IA 2DO0A 4DR6J 1N48A 1ZZNA 1IBKF 8AT1B 5A0YA 3AAWB 5CXTA 2RJZA 2V8PA 2YH0A 3OXLA 5D0GA 4CO3A 2RU3A 2CPZA 3D6HB 1J27A 3BYRA 4ZHRB 2RQ4A 4F3MA 4RBTA 4I2QB 5C24A 1GQEA 4TYBA 2ACMA 4LRCA 1N6QA 3W9IA 2VA3A 2CQ4A 1PJ5A 3UN5A 5EX0A 3T5JA 4DR6F 1WOPA 3D3BJ 3R5AA 3RJMB 3DI6B 3KUHA 3K17A 2KI2A 4DV3J 3FFIA 3IO1A 1SUQA 4URQU 5KFQA 1T05A 3P96A 4LFAJ 2KM8B 3PW2A 4WYLA 4L3NA 3MM7A 2ZOFA 3D1QA 3O6QA 1FKPB 1Z2LA 1CG2A 4IG0A 1UW9A 4G1QB 3HLUA 4MYTA 1XTZA 2CQ0A 3C15A 5FIIA 1YX2A 3R8YA 3KJVB 2QFJA 4B3OB 4DUZF 3CW2C 3LUYA 3GIIA 2ZH5A 2MPUA 2OH2A 2OPPB 4JV1A 3M8QB 3GR0A 2XY5A 4YHHJ 2MKIA 4OYWA 5CHCB 4CTAA 2EFNA 2PFFB 1U26A 3FGVA 2CJYB 1JKHB 3QAEA 4OIXA 3MEGB 5A8KA 3M8QA 5HSPA 3K8WA 4URGA 2FJXA 1IKWB 1ZAVA 2AV5A 3DM2B 1CULB 4CM2A 3N6MA 4FS2A 1WC5A 1KOHA 3EMTA 3EE3A 1SQEA 1HPZA 2HSEB 2CPXA 1TELA 4P7TA 3SQOP 3Q83A 7FD1A 2MJUA 1RKJA 2RRBA 1ZAXA 4ELUA 5GVQA 3ITHB 2KHCA 3L3CA 1KKHA 1M5SA 1BWVA 3M2RB 5FJ4A 2MLYA 1R7IA 3CTRA 1S6PB 3HHLA 4RL1A 4RUAA 3Q89A 2WTFA 2F8MA 1E6VB 3WX8A 3W2WB 4CNZA 5KFKA 2CZ9A 1RT7A 3BO4A 2NYIA 2OEJA 2QT7A 3A3NB 4O3OA 3VALA 2AGOA 1WC6A 3DOLA 4MFBB 4WFBQ 1VQPS 4NLOA 4JYAJ 3ZNJ1 5LMUJ 5E7OB 3POTA 3CD6S 2BKNA 1ZPVA 4ITSA 3RU0A 2DO4A 4YR2A 1L3KA 4ZP7A 2Z56B 2CPJA 1D09B 2UXBF 4KRWA 4K4UA 1VK3A 2H1YA 2XYHB 2CRLA 3LP0A 4C7QA 1OY6A 2VDIA 2HS0A 3GCXP 3PHTA 1UZHA 3KG0A 3GV7B 4ER8A 2GIQA 4WFXA 1T3OA 4Y2MA 3DRRA 2ZKTA 3EGZA 2HHQA 5F8JA 3BO2A 4B17A 2HBQB 4CWBA 4DPUA 2B4VA 4MMOA 3DLEA 3FKBA 4W92B 2FJBB 4EK2A 3QGGA 1N36J 4MK8A 4DMZA 5DDRC 5D0RA 2YNIA 2OTJS 2J8AA 3NMRA 2FJVA 1IBLJ 1G7CB 1W26A 4ZITA 2O1PA 5I3QA 1RAFB 3UNGC 3RAMA 2XBPA 1FEEA 4QIEA 1OSCA 4B3TJ 4LFAF 2B56A 2L08A 2HRUA 4HH0A 1S12A 2PGCA 1CJKA 4ICLB 3TEHB 2HIQA 3W3SA 3MGJA 1FT8A 1KBRA 2D7SA 2V34A 2M8DB 1MMLA 1CJTB 2YWWA 5DLGA 1R27B 1U25A 3E01A 1HQUA 5GAGI 2QLFB 2HQGA 3OVAA 1RE1B 2DHXA 5L38A 3C16A 3D68A 1CS4A 3M7VA 3DRPB 1Q5YA 3M32A 1LEOA 1CLFA 1SC4B 1UFKA 2M7SA 2YKPA 4ZCMA 4FXVA 1LV5A 2ZWOA 3O5TB 4DG1B 2X1AA 3D7SB 5D4PA 3JAMY 4ZVUB 2CZVC 4ZVTB 3V81A 4JV5F 4U8VA 3FZ2A 3HSDA 4ZS6A 2E66A 4I6WA 3QIPA 3A1YG 1XR6A 2OEMA 2QGFB 1K0TA 3K5LA 1WC0A 1P9YA 2F1FA 3QLHB 1MWYA 3IR6B 4LJMA 5F0UA 3MCMA 3FQLA 2CQCA 4DPYA 5IT0A 2WSEC 3VAIA 2GGPA 3SSSA 2LFVA 2XSJB 4Q5VA 3MMAA 3HPOA 2VICA 4O4GA 3UD3P 4L72B 4QIWD 1VQMS 2ATLA 3NCPA 1NB2A 4H4KC 4RW7B 1RSCA 2QL9B 4NZ0A 2GAGC 1MMNA 4Y28C 2FZCB 3DDKA 2E7VA 4MK9A 1QSYA 3ZZYA 2F8EX 2YKMA 4TVAB 5G4DA 1XNRJ 3CMAS 4DLGA 3NNAA 5B7WA 1RWVB 4B9TA 2LQ9A 3HMJG 2MQMA 3WIUA 5KT7A 1HBMA 3FMBA 3RB3A 2JDJA 2DNLA 2G1HA 2HLTA 3EM1A 3KFWX 3KNGA 3UE2A 3BGUA 3ZZZA 1HL6A 3BN7A 3CCWA 3P4UB 2K3KA 2QLXA 1VQKS 5D3GA 3RZAA 2ZOGA 3HVAA 2ZZTA 5C42A 4RNOA 3CCES 1OQ3A 1Q8IA 1IBCB 5L9XA 2Z2MA 3EGVA 1C4CA 2HHTA 5D4OA 1WACA 3JSYA 3SFUA 2ZH7A 3DNCA 2BR0A 3N5FA 1NO8A 4ED5A 3JTPA 4JI5J 1E6YA 5GAGU 2HHSA 3HFKA 1PC4A 3UD4P 1Y00A 4FBUA 3CVKA 3DXSX 4KPCA 2CVIA 4O23A 4OI1A 3UD5A 5J2PB 5CYMB 3PX6A 2AYGA 4G1PA 1GFWB 1FNMA 2BZ2A 1P6TA 1RP5A 2AT1B 4RKUC 4C11A 3DU5A 3B4MA 2FVSA 4AQYF 3BQ1A 3AH6A 2OSRA 3B78A 3H5UA 2J9EA 4ZA1A 2I2YA 3MM6B 4YOEA 1QVFR 2BKPA 2ZBPA 3MOZA 4OZ5A 4QR0A 4OX9J 3OSNA 4H4OB 3G6VA 3BSNA 1S6QA 2PD1A 1JX4A 1RWPB 1N56A 2U1AA 1NU4A 4P2MA 3G8QA 4HTJA 2OPSB 3BKFA 4FN5A 3E3XA 1PSDA 2BRLA 4IKAA 3OHBA 4AFFA 3QMQA 3KLGB 4USIA 1VMBA 2CA9A 5F0WA 1ZM9A 4S0MA 3OUYB 5E3CA 5T7LA 2EG2A 5BJRA 2R2RA 1TAUA 2G0IA 1YJTA 5KT6A 3GQCA 2CJKA 5DQGA 4IOAQ 4V19X 2FLPA 3S1TA 1N34F 2O5DA 3ET6A 1XK8A 4CIOA 4B9SA 3HHEA 5IT4A 3W61A 1Q86T 1S4FA 3IWXA 4J9QA 1R0BG 1REVB 1A9NB 3L7PA 2RF2B 1ZBTA 4KGKA 1CJVA 1TKXB 2EBGA 2ZBIA 4ERDA 2ATCB 1KN6A 2PA8D 1Y5IB 4OI0A 4WF9Q 4KHPF 2M88A 3TWZA 1LWCA 1LWXA 2ASLA 1CJUB 3PR5B 2BX6A 3IS9A 4ZN3A 4PQUA 1T0TV 1X5PA 2CIMA 1TMJA 2EFOA 2V94A 2E44A 4OZNA 4N8OA 4EI2A 2ILZA 2YWEA 3OR1A 1RZMA 3LW5C 3E2EA 3QZ8A 2IAJA 2YPYA 2DR7A 3R7NB 1VOMA 4WZQA 1HHSA 3H7HB 4ZVSB 3CC2S 1S57A 4J9VA 2NYHA 4UQTA 4LFCJ 2LQ5A 5AE3A 4YR0A 1HBOA 1YGYA 4AE5A 5B09A 5KFNA 3HK2A 1RISA 1QUVA 1DTQA 2DNZA 3PYDA 4Z2XA 3MMBB 2FHMA 1QDUB 2HFSA 3PRVA 4RPFA 4LFCF 2AMCB 4FKXA 1F5CA 4YDXA 1FJCA 3LP2A 3K57A 2NQPA 1ZS6A 2CJQA 3H2UB 4U7CA 1M5VC 1N33F 3MUMP 5B0GA 2E5HA 5K8MA 2HZCA 4ZLLA 3IG1A 2Y0SD 3TW0A 2CZ4A 3I5CA 1DTTA 3PHEA 2RIJA 2HQIA 4JI8F 6FD1A 2R4FA 1IM6A 3KHGA 2OPRA 4UZBA 2HQDA 1S5ZA 4M5LA 2E1CA 3AXMA 2YXLA 3C6UB 1X9WA 1HA1A 3IMQJ 3MTJA 3R6LB 4F04B 1TP7A 5IQ6A 2HFVA 1QM9A 3UR3C 3LQVA 5L1IA 2EPIA 2OPQA 4KPYA 2A6OA 4A8OA 3QIPB 3K5OA 4E2FB 3KK3A 1BQNB 4YFUA 2PSZA 1TL7A 3WX4A 1NPKA 1BMQB 3GFXA 3MPYA 2PMWA 4YB6A 1H0HB 1S1UB 1B4SA 4NASA 5F8IA 4OJHA 3HP6A 2F9DA 2HNYB 1OSDA 4DFMA 3BPSP 1PJ7A 1UWAA 2B9XA 3ZTRA 3KLVA 4DV6F 4PQUB 3D66A 3DOKA 1QTNB 1ZM4A 4OHVA 1NB7A 2L41A 2CQIA 2KRRA 3FSXA 5HVGA 2WONB 3PEJA 1UPMB 2BANB 3KWMA 3HX9A 2XLIA 5L9NA 3GIMA 1CJVB 2HIYA 2DITA 3EDQB 2UUAJ 2QMUB 2XMKA 5B0CA 3KK1B 3AB4B 4NXMJ 5DRKA 2D74B 3M6UA 2IPOB 2Z4PA 3OR2B 4FPIA 3GIKA 1YJ7A 2XGPA 2XEXA 4OYAA 4IOBA 3VAGA 4Y3CA 4DZ6A 4Z7CA 2VG6B 4LF9F 4NMXA 2J0WA 1U6ZA 4QW8A 1IUJA 2X1BA 2IFXA 2R3VA 2B3TB 3D6MB 3O8WA 3AY0A 4GVLA 4Y34A 5F8LA 2OPRB 3OUYA 2JEGA 1KVIA 3BH6B 2B5JA 3LO3A 2DXEA 4RZRA 1NZ8A 4DV0F 1XMBA 4DF4A 1RAGB 1S1XA 2ZBRA 2J76E 4AUKA 5HP1A 4RW6B 4BDPA 3IC1A 5CZVA 3PR4A 1H73A 4RR5A 1NKCA 2MQQA 3FBCA 4OMFG 1Q7YT 1FFWB 5KTQA 1WORA 3I55S 1TL1A 1YG0A 2FVCA 2RILA 3CMES 5H1SV 5DG8A 1TKZB 3MAHA 3W8PA 3TAQA 1WKJA 1NDPA 2JX2A 4C11B 2BQ3A 1SL2A 3NKYA 2Q1LA 5C5JA 3MD3A 2HPUA 3CDAA 1SVDA 3EZ5A 1O51A 4BLGA 1KRPA 3G9CA 1X0PA 1ZM3A 5EDWA 4ECXA 2CPHA 4CLLA 3PW5A 2BQUA 1NKBA 2ASYA 4QWEA 1E6YB 2YKQA 4HI1A 1YJWS 3HKWA 1C4AA 3EX7B 1X4GA 4DL7A 2BJ3A 4ILMA 4NPOA 3GB0A 1KR4A 5EUHA 4PG7A 1QSSA 3EJMA 5HROB 3H4DA 1N5YA 4QYZJ 2KZMA 4ZPDA 1E6VA 4OI6A 4BC9A 2GMHA 3G8TA 1F5BA 1WEXA 5L1LA 1LWFA 4ZPAA 1CC8A 2BKOA 2VFVA 3PRBA 3I9ZA 4QR1A 3RB0A 3V4IA 1Y0HA 5HQMA 5GMDA 1Q8BA 4M63A 2V8HA 3GCWP 3KJFB 2W7OA 2N7CA 4I67A 4C8ZA 4DR3F 1YJUA 4ILRA 1CULA 1RI7A 5CH7B 3VVTA 1QUPA 4J9PA 3PYFA 4U96A 1HR0F 1D8YA 2DRAA 3P49B 2HGMA 2QC3A 3MM9A 5GMEA 2IVYA 2FHOB 3IM8A 2XO7A 1JLCA 3DHXA 1X9SA 3KKFA 2GCFA 5IXUA 2ACYA 2JVOA 1S72S 3Q8SB 2CNOB 2F65A 4Z7YA 5D77A 1RAJA 2ZUAA 3QO9B 1FKAF 2RHQB 3MCNA 3MMAB 3KLFB 1HI0P 3G6YA 2UVVA 4D3GA 4DCPB 2GMJA 2UV8A 1GMWA 3R6GB 4ID5B 5HROA 1N5YB 1FD2A 2CQ3A 5KFXA 4F0MA 2MMYA 4Q2LA 3FNNA 5A8WB 1HIYA 5J1NA 3JXOA 3W5XA 3EVWA 2QSFA 3TI0A 4O0IA 4P73A 2XO6A 3V81B 1F3FA 1UFWA 1ZA1B 5KFUA 4A8QA 4DSEA 2VPXB 3HSJA 4ZLJA 1OJ4A 2IJFA 4TNOA 4OX6A 3GLJA 1K47A 4IYQA 2W7PA 1KFSA 2BBEA 3LGMA 1KNZA 2AEFA 1IVZA 2C2EA 1B64A 1HQUB 1C0TA 3EUNA 1NK7A 2HGLA 5J2PA 4M5JA 4LF8J 3MXHP 4WFNQ 4FZVA 4UOCA 1NCLA 4ZLPA 1JJ2R 4LR9A 4NX9A 3NNHA 4ICLA 4DV5F 3ZC4A 3Q8RB 5GAEU 1OO0B 3MEDA 2L3MA 4C48A 2VU5A 2R7TA 5I42B 2DGWA 4Y2AA 5CD4H 4PWUA 4LF6F 2E9TA 4FP9A 4DR1J 3VAFA 2RDJA 2B5JB 5CA5A 2VONA 2H48B 2EW9A 1U0SA 1KLMA 1IR1A 1RAEB 4J9NA 1ICEB 3PY8A 1RT3B 2EFQA 2MHEA 4HHJA 3VWSA 5KFOA 2DR5A 3EVOA 2XLJA 1AUSL 2BE7D 2CWXA 2JC0A 1V6HA 2K2PA 1F2HA 4ZPWR 5A8RB 5EWGA 1FI4A 5LSRA 3AD7C 1N0VC 4DI6A 2GV1A 3FUYA 1Q5VA 1H2TZ 3L7OA 4JI6F 2G2ZA 2GZOA 3IR7B 4ZP9A 3R9LA 2VC1A 3P6YC 1BHNA 2I5JA 3AJ2A 3TA0A 2HNZA 2WHOA 1LFWA 1UVNA 4Q44A 1RTDB 2C2MB 3CE8A 3R3TA 3K5MA 2VQFJ 1DJ0A 1JMTA 1RWUA 2HFUA 2NXCA 3M1VA 4PG6A 4KAIA 1YLXA 5ETRA 2LCWA 2DNHA 1AROP 3G86A 4RU2A 1U47A 2V2VA 5HAOA 1VQSA 1EQ0A 1UVKA 1HNVB 3EWGA 1MW7A 5DDPC 1VQ9S 1JLBA 3K2YA 5KFLA 2V2KA 1OYEA 2VFTA 2Y3YA 2ZKUA 3I4HX 1Q79A 4O44B 4N5SA 1RYRA 3E51A 3OJUA 5F8GA 3HFVA 2W9CB 1VQLS 5CYQA 1I94J 4F2SA 1FF2A 1TK8A 2CQ2A 3DLGB 4O44A 5AXKA 3RAQA 4NLGA 1YZ6A 4CLZA 5KFGA 3TVYA 1R8HA 1HNVA 2VC0A 2UZAA 3ITHA 5K8OA 4G3IA 3ZZPA 1X4FA 5CABA 5DM7Q 4Q8FA 1SJRA 2XWYA 3TEGA 1RA7A 1SKUB 2RH3A 4A4JA 4HACA 4DF8A 3MR5A 2J9DE 2YWHA 2O67A 2MQPA 4DR3J 4DSLA 1EP4A 1NAQA 1O5JA 4YB1P 1UJ4A 3HVWA 5T41A 2DGOA 3MEGA 3OFGA 3CDUA 1JKHA 3HDSA 4R8UB 4DHVA 5E41A 4ZVHA 4ED3A 1WOSA 2QRRA 4ZVOB 2HURA 4O3SA 2DGSA 4WTYA 1RHQB 3BSCA 3PW7A 4DXLA 2EFVA 3SSQA 2BJ1A 5KOWA 5KG2A 4GVBA 1UP1A 3J81j 2MQOA 4NOHA 1RTJB 4MJKA 3ENAA 4PEOA 3EICA 4IDKA 5CCLA 2IC3B 2AGPA 2H5JB 4LBPA 4X4QA 2VQEF 2V50A 1N88A 4HH1A 5C25A 1N32F 1KVJA 1SKRA 4Q0BB 2OMOA 5LJ3Y 1HNIB 1VISA 3KDOA 5AE1A 5KFBA 4NEYA 3KLGA 3HJFA 2GVDB 2HHHF 1U1MA 5I42A 1LW2B 2FJEB 1TV6B 3OTBA 1Z1ZA 1JIHA 2CG4A 2FTRA 3ZTQA 4LRDA 4NLQA 1RTJA 1UL3A 1F5AA 2EVZA 4PG5A 5KG5A 4K0KJ 2GX8A 2J0XA 4KY3A 2XY7A 2BUNA 2RKIB 3AJDA 1O8BA 4KQZA 3W2VB 1HFEL 4WK3A 3SCJE 1PBUA 1N5QA 1RT6A 3QNWB 1VRTA 2VH7A 5A76A 2HHHJ 3ZNUA 3SFGA 1SC3B 1X4EA 5SZTA 1EQMA 3FVYA 3M8RA 2GC8A 3FCVA 1LK7A 3TOQA 4LF5F 5G0RA 1UVLA 3MMJA 2CQDA 2EFPA 5A2QY 3BS9A 3EPGA 4Y2CA 3MECB 1FTCA 5KFIA 1B0PA 1MN7A 1YQHA 3QIDA 3PX4A 5CCMA 1VIXA 3QRRA 3SCKE 4A8KA 5A8WA 3MUVP 2E1AA 1JLAA 1UPPA 3ISZA 1XWLA 2BW2A 4PXDA 2DVIA 1HYSB 2P5VA 1VHFA 3AODA 4KGZB 4GRSA 2W24A 4M5HA 4DX6A 1RTZA 2GHVC 3PM9A 4ZOSA 5HLFB 4R5PA 2G9OA 1NSPA 3I0RB 4C8YA 3RGIA 3K5NA 2D3ZA 3MM5B 6AT1B 4KT0C 2BRKA 2DYAA 3OTCA 1V5IB 3BQ0A 2ZH3A 2JC1A 3DOMB 1XMQF 4U6PA 4H54A 1R0AA 2OTLS 4KTQA 1G2EA 1SXLA 4LSNB 3TZXA 4IFVA 1VQ5S 1RTHA 1YJVA 4K59A 2ZH6A 4B9LA 4OHYA 3GZ7A 2AZ3A 4ETZA 4C8OA 4OL8A 4B3MF 3MM9B 1TFWA 1XMOF 3H2VE 5DDQC 3K89A 1S9EA 4GMKA 1HNWJ 3JQJA 5LM7E 2HNZB 1SJQA 1Q0NA 4A48A 2F8HA 3CJ4A 3BDPA 2V9KA 1URRA 3H8YA 1N36F 2NXJA 3GFHA 1SQGA 2DEJA 2WSCC 3LAMA 2W8KA 3PEHA 5ETPA 2HK3A 2X7IA 1SV5A 2LYVA 2QE5A 4GKKF 4KE5A 2FC8A 2HHXA 1RB0A 3TVZA 4N77A 1QTMA 3NLCA 4BHQA 2GFFA 4XTTA 5HO4A 3FFIB 3I6PA 2DNPA 2J7KA 3L7UA 4ZPVR 3H4BA 1S10A 3EYZA 1SIZA 2PA3A 1RT5A 2KKHA 1VQOS 2CDRB 5KFMA 3NGKA 4KV8B 2ZD1A 5M2PA 2FLLA 4DUZJ 2IHR1 2B9YA 2JWNA 2DH7A 4IRCA 4PXCA 5KT2A 2IMOA 1MN9A 3MPVA 4IH6A 5DS7A 4DCOB 3SCLE 3GIJA 4HHHA 1Z4UA 5KFSA 4F02A 2PI5A 4WKRA 3IAS9 4CYUB 1X4HA 5IWAJ 1SKSA 1A7GE 2VF3A 4JV5J 1IQZA 3A8EA 2Z2ZA 2DB1A 1XEZA 1NMEB 3B6BA 1ZPWX 5F41A 1KTVA 3C2PA 2UXDJ 1H74A 2QL7B 3CJ3A 2W2MP 4LSLA 2NSCA 3AHPA 5HQLA 5KT3A 1GTHA 3JYTB 1U48A 2HVHA 2ROGA 1S6UA 1XNQF 2R42A 1NUEA 3CEDA 3IFEA 3RB6A 2MKYA 3BF4A 5LMNF 4JI0J 3J81Y 2W9BA 1WDTA 2WBRA 1IBKJ 2VG6A 3EXYA 3H5YA 4JI7J 3ZZOA 4NZ7A 4B3RJ 4FVMA 2FIUA 2OAUA 2C2ZB 4DN0A 2UUTA 3US5A 4DV7F 3QT5A 2B51A 1WEZA 3ILLA 4F2RA 2APOA 1RTIA 3LANA 4NYZA 1M5OC 4B3SF 3DLKB 2EK1A 2KDOA 4LVOP 4ZJLA 3ZFVA 2MZJA 1RLCL 1N54B 1P27B 4G65A 5D78A 3C16B 1RTHB 3T1YF 1LQ9A 2XMMA 4OI4A 3GG1A 3PW4A 1ZM2A 2CVEA 4WFYA 5KFAA 3D6TB 4OV6A 2L9NA 3TAMB 5AJ3F 4LBHA 3PW0A 5J2NB 3DLLQ 4F8RA 3WDOA 1UFLA 3UDVA 5DDOC 3V4IB 1SL0A 4UOFA 2DD8S 2ZE2B 3MPDA 2IA6A 5BYQA 2PI4A 4FYDA 2BYCA 3F41A 3T5LA 1JXEA 1LFPA 3T1YJ 1U1RA 3HHLB 3AFGA 2J6SA 4DFJA 1Z2ZA 5D0HA 2GQQA 5E3AA 2MLXA 4NLSA 2ZHBA 2DNNA 4URSA 2AJ1A 5BR8J 2ZC3A 5KFJA 1HNXF 2Z0GA 3JAMU 3NNCA 2I6WA 2BXJA 4PZVA 4J90A 3LH2S 3SDEA 2W2PP 4IRKA 1FX2A 2DHGA 1HD1A 1LNQA 4CLWA 3QGIA 3FC9A 2KHDA 3IBCB 4L6V3 2GA7A 1BY9A 4P75A 3GJSB 4WXWA 2WCXA 4F0KA 3DHWC 4XPCA 2VG5B 2AU0A 4ZK7M 4DL6A 3ETOA 2D3UA 1F9HA 3AD8C 2MQ8A 3N6NA 1H3DA 2XTJP 1U6BA 1B0TA 4FPRA 3C15B 1IWGA 4B3OA 4WP9A 4P2FA 5KG1A 5IM0A 4UOHA 5HP1B 1TK0A 1LW2A 3QJLA 2WSFC 3DC2A 2AW0A 3ZTOA 4LR7A 1SI9A 3DOMA 4DV6J 5IV4A 1T05B 2IBOA 4M94A 1HBNB 2CKWA 1EKRA 2IVMA 3AD9C 3IP0A 4KB7A 4J37A 4P72A 4YB5A 4ZN1A 5HL7Q 5DLFA 3MEEA 4FBTA 4GKJJ 2AJQA 4NLYA 2AJ4A 2PE8A 2UUCF 3RBZA 2XS7A 1CQMA 1S6PA 1NHVA 2H4WB 2C3YA 4X4NA 5KFYA 3GONA 4I4BA 2QO3A 4LRFA 2AEMA 4DPOA 2XZTB 1Q78A 4OFZA 2LECA 2XY6A 3GIRA 3TAMA 3FEYB 2IA0A 2Y1RI 3KHLA 4JI4F 4JI6J 2XS2A 4LQ3A 2BANA 3T41A 3PYGA 4KGXB 2FJAB 2V4JB 4OV1A 1IKWA 2IDLA 2FPHX 1D9AA 2CPYA 4X62F 1PYOB 2HEKA 5K14B 2FVRA 4HTIA 3OVSA 1RTIB 1R0CB 1RT6B 2QA2A 4K2XA 2KB2A 1IR2A 2AF6A 2OO4A 3TR5A 3QGHA 2RKIA 4XPEA 3H90A 2FQQB 2X1GA 3KK3B 3G8SA 3DLGA 3JS9A 1VC5A 1FERA 4F3QA 2RQKA 1QLNA 1BD6A 3SI8A 1Q95G 2Q6BA 1IBLF 3C19A 1QVGR 3KG4A 1YJRA 5LXYA 1IM4A 4LIRA 4A47A 3KLHB 3PFOA 4OYMA 1HNIA 3WC2A 2V4QA 4DV2J 2MYFA 2V68A 3LAKA 5I3PA 2ZJRQ 3OFFA 2DIUA 2OPSA 2ASDA 4ED4A 2R7VA 2IC3A 4J9UE 4G6VB 3ZZTA 1NZAA 4I2PA 2HMIB 3MCSA 4YN3B 4RNFA 1YVFA 3JQKA 4DR5J 5BR8F 2W2OP 2BJEA 4MIBA 1HNXJ 1TUWA 5KG4A 3TZWA 1KC8T 3ETMA 1YJ9S 2ROPA 4I7FB 4PCQA 3ENQA 3T1AA 1S77D 3CC4S 3VZHA 2FGOA 4J5OA 4NWBA 3OQ2A 4YQWA 2LXFA 1KVKA 4DPWA 2V2ZA 1S9FA 5HATA 1T03B 2C3PA 4FYXB 3ZO7A 4GC6A 2EFGA 2MKKA 4PAAA 1XERA 3PFEA 2J9CA 1S7HA 2UUBJ 1M0SA 1RT3A 2LQJA 1T9WA 4USVA 4IUFA 2K7JA 1NK6A 3EDRB 2BV3A 2JLFA 3CJ8A 2GW8A 1NJIT 2OLWA 4DL3A 4PUOB 4LF5J 1XNRF 1S76D 2P9GA 2XI2A 5KFEA 1DAXA 1U1NA 3PYEA 2BJ7A 2PMZD 4CLPA 1WC4A 1VQ4S 1RK8A 5SUHA 3H98A 2ZM6J 2GS8A 3BYPA 3TQ1A 3KHRA 1JJHA 2V2QA 1FRIA 4CRJA 4E0DA 1I51B 1S1VB 2WB4A 3CPWR 4IG3B 4O3QA 4QPXA 4OHXA 4ZVFA 1JJ4A 3SXLA 3AQPA 1YI2S 1PC5A 2B8PA 4JI0F 2DT9A 2YKMB 5LMNJ 1RYSA 3NAIA 1S9EB 4M95A 3BGFA 3FBEA 1RWXB 2HLUA 1AA1B 3D67A 3D5MA 4M8LA 2DGTA 3RR7A 2G1DA 2M4MA 2Q6CA 1RU1A 3CCLS 2LA6A 4ELTA 5B0AA 3LGHA 4CCHA 3I0SA 1EJ7L 3IA0A 4J7CA 1SC6A 3M8PB 4CNYA 2MHNA 4BWMA 1N4LA 3ZZ0A 4NXMF 4USKA 3BO3A 4L75A 2V6AA 3MM5A 5E0OA 4ED1A 4OYZA 3KTQA 5HMZA 2W9BB 3NGSA 4TLRA 1PAEX 3FEZA 4ED8A 3CJ2A 1T9XA 5EN1A 2FHJD 3UVJA 1FJ7A 1UKUA 1FNXH 2G2YA 4OYIA 4P74A 3CCVS 2CXEA 2X51A 2G4BA 2F63A 3I82A 2D3OR 2PEHA 4MAKA 1YK9A 1U0HA 2ZNYA 2HNDA 4U9RA 4NLTA 3MAAA 3VR1A 3RBEA 5D0EA 1FDAA 1TL4A 1U45A 2WOMB 1XBWA 1H6KX 3CGIA 4H4KA 4CLUA 1T95A 4B9VA 2V0NA 5F8MA 5J2MA 3FEXB 1UMJA 4H4MA 4M5DB 5DQIA 1X0FA 4QCLA 1DQAA 4PG4A 2NREA 1OY9A 1VRTB 4ES2A 3P5BP 3SIPB 3CJRA 3MF5A 4CLTA 4ZCKA 1N0UA 3NGUA 2FD2A 4J9RA 4DL5A 1D9DA 3M9NB 3QT7A 4F36A 2F4VF 2BVZA 3N79A 1RHKB 2FHJA 2JLEA 5K8PA 4QW9A 1TV6A 1VBYA 3KMQA 2BJ8A 2VB6A 3QAUA 2G0CA 1VRUB 1TUVA 3C6TB 5LSLA 2DEIA 2VZ9A 2XB2D 1GXTA 2V63A 2EEYA 2U2FA 3R2DJ 1LW0A 2FLOA 2ASJA 4RLEA 1FJGF 1EIYB 3GG0A 4NCBA 3DLEB 4DR5F 2HRYA 2BE2B 2K1RA 1FFSB 3IR5B 4DWIA 1YITS 2P6TA 4IFYB 2Z57B 2HFZA 2Z2LA 4GC7A 2AX0A 4DLEA 4WTOB 5EWFA 3CWJA 3FCWA 5DJBA 4EGLA 3MFHA 1LXNA 1L3SA 1TUGB 2WW4A 1VR6A 4F7VA 1UA0A 1BLUA 2M2BA 2CUYA 4DSFA 3RAXA 2MKHA 5E5NA 1EP4B 3A13A 1RT2A 4OZLA 2Q66A 3DYAB 2F9JA 4NZ6A 5E3QA 4LF7J 3R5GA 4AYBD 4HDGA 4NMLA 4O4GB 4DQSA 4JI4J 1TFYA 2ZFHA 2H65B 2M3DA 4ZLNA 3CT9A 2QJ3A 4DSIA 4ZP8A 2P9EA 5HLFA 1MU2B 1GTEA 1T94A 1EETA 3CDBA 4HDHA 1U2CA 1FFGB 3G6XA 4ECUA 1HNZJ 2FB0A 2VQFF 1PILA 2DR9A 3KK1A 2DPIA 2HBYB 3MURP 1FRLA 2CFXA 1NNDA 2IYGA 3HT3A 2QSWA 2B7CB 1SH0A 2WONA 2KTQA 1C1BB 1DRZA 2XM3A 1GMUA 2QA1A 2KL8A 3QWUA 4WU3A 1HNZF 1UEUA 1JK9B 3I4PA 3J7YI 4EYIB 1RTDA 3R7BB 9RUBA 1UAWA 1RAOA 1NPPA 3RB4A 3I31A 2UP1A 4JI2J 4NXNJ 1ZH5A 2UUWA 1RCXB 5CZXA 2A2DA 2ALYB 3TARA 1C0UA 4IO1A 1AYEA 4DV2F 4JV0A 3G4SS 4DSKA 4LF4F 4C8MA 2XQCA 3H25A 1MLAA 1C1CA 2AIRB 4ALZA 4DJBA 4Q45A 2X1FA 3MM7B 3TX8A 1WHXA 4CH7A 2A18A 4KR0B 1I1GA 1SPBP 1ZA2B 3I87A 3Q2TC 1PGZA 1WKLA 1P1TA 3L4BC 4CO0A 4ZPBA 3SQGB 1XR7A 2OFGX 3IGVA 3PXGa 4NRUA 3U1LA 4ANDA 2KH9A 3QQCD 2XMWA 1Q16B 2I8EA 1ZOTA 1NSAA 3ONQA 4X64F 5GADI 4RWWA 2W7AA 3OPKA 2BE9B 4YY3J 3ISND 1EAYC 2HW3A 2VBZA 1WELA 4JV2A 4OHWA 2VASA 2XHWA 4Q7AA 3DGPB 2OD6A 2CQHA 3N5BA 4YHHF 1FJGJ 1RLDA 2AJFE 2BMBA 2E29A 4U7UK 5GAHU 1JLGB 1S59A 1L5UA 1NDKA 3HHKA 1GX5A 2MEWA 3HSGA 3JSMB 1UJ6A 3TANA 2P9CA 2HG4A 1C1BA 2BJDA 3W65A 1FA0A 2MZRA 4NA3A 4LF7F 1B99A 2Q3PA 4PRFA 3EXCX 4DCJB 3VAHA 4X4VA 3IBFB 4UOGA 3OTDA 1S1UA 2IDEA 5HMXA 1KSPA 4WJBA 2VV5A 3S6EA 3GTYX 2J9DA 3LALA 3RBXA 1JQGA 1A0OB 2Y8YA 2ALZA 2DGQA 2VG7B 1HNWF 5MAOA 2YNGB 2YPZA 3ILIA 3H40A 4QU6A 1Y9OA 4RBUA 2PT0A 1HMVB 1WHWA 4CO1A 2IRUA 2F5GA 3M2VB 3M8YA 4DV0J 1VBKA 4KFBA 1YBTA 2FGCA 2HK2A 5CAAA 3Q8PB 1S0OA 4M5KA 2C3OA 1GH8A 2C3UA 1WC3A 1MNEA 5ETQA 4EBEA 1U2RA 1K1SA 1AFJA 4JBCA 4CO4A 1PO6A 3T3FA 2I1RA 2V69A 2D9PA 3HI9A 2EKNA 1CC7A 4B9UA 1R31A 3BH7B 4DL2A 3PJ9A 3FZBA 2MTLA 1RT1B 1R89A 1NKEA 1WD6A 3AQOA 4JI5F 4WP8A 3SEOA 2VHGA 3NMAA 5F3ZA 4ID8A 1UW4A 1W2BR 1HKAA 3DXBA 2XGQA 3LP2B 3CCQS 2CJBA 4DDFA 4K4WA 4M5IA 4NLWA 3PV8A 5GADU 3DKDA 1ZZFA 4I0WA 1WC1A 5HJXA 1GT8A 4DR4F 2M9KA 2HVDA 2NXEA 1Y3KA 2KO1A 2O66A 3FBBA 4DZDA 2J6UA 3OJSA 3KNAA 4X4UA 1FEHA 3S8SA 3DI6A 1TL3A 4QR2A 2HHWA 4PXBA 2DKOB 2LQBA 4TLQA 3SBMA 1WHVA 4J9OA 3H5XA 1MSWD 2C2KB 2ZH2A 3M8SA 4DR1F 1VQ7S 1IKYA 4OYBA 1EX8A 5G0RB 3GMGA 3PIPQ 1RBAA 2RB7A 2ZDOA 4WE1B 3SCIE 1FKOA 1T9TA 4MTPA 4YUDA 4LRBA 1TKZA 1FXLA 2UUBF 1YRTA 3C8YA 3BGRA 4NCAA 2XNQA 3IS9B 4KHMA 3R1HA 1I6JA 3T5KA 3W60A 3BGOP 1TL5A 3KG1A 1JNRB 2V8DA 4ZCIA 3F73A 3JTOA 1U2FA 3CNQP 2AGQA 3F0NA 1TKXA 2CG8A 1VDHA 3QSIA 4Q2MA 2LMIA 4DR7F 2HNDB 4UY85 2OSQA 1VGYA 1WSRA 2QN6B 2VD3A 2G0JA 4DUYF 3VGVA 1WUUA 5LT5A 2OMLA 2OI2A 2JL9A 1WTBA 4B3SJ 4WP3A 1KP6A 5C25B 3HO1A 3F44A 2XYPB 1WSVA 3CJ5A 1XMQJ 4CQ1A 3VVUA 4M5MA 1YIJS 2WK4A 3C6TA 3D4JA 2VA2A 3SSRA 1LKZA 2C3MA 3P45B 2R7QA 1S97A 4AT1B 2XI3A 3CD7A 3GYXB 4IO9Q 2MLZA 4QYZK 1FCAA 2K7KA 3NY0A 4OYXA 1NK8A 4UW2A 3AB2B 1JLEA 3MOJB 2JZ5A 4R8UA 1DFDA 4RNNA 1B7FA 2BW7A 3OSPA 1SJFA 4MIWA 1YBUA 4QJVA 1GXLA 1KWMA 4LF2A 3SV3A 5AXMA 3TZZA 3RRHA 3M30B 2QA4G 4M5DA 5KAKA 3I5BA 1FDNA 4IR1A 2SXLA 3QT8A 2J5AA 2W25A 4YEAA 3V6DA 3OFHA 3Q22A 2O01C 2RNEA 1BC6A 2HQFA 2YKOA 3G82B 4JI1F 1FRKA 2RS8A 1TKDA 2N3LA 1BQNA 1T9YA 1HLWA 3MTKA 3VQTA 1U1PA 1FXDA 3W5ZA 4BCAA 2NCKL 1S1TB 3A8KA 3MWBA 3OD2A 1N33J 1NK9A 2XZWA 2JEFA 2HGNA 4PPZA 2HQ3A 3IGNA 4KC5A 4C3LA 2Y9HA 2B43A 1IKXA 4F4KA 1Y11A 3A3OB 3BEGB 2DRDA 3KLEB 5E3RA 2KM8C 3J80Y 2ZH4A 4B9MA 3IWNC 1TVRB 3M8PA 3M8WA 4WCEQ 2VPYB 3HHNB 3DMJA 4R0JA 3DCAA 5IQQA 1CS4B 1V3SA 1DTTB 5HMWA 2MXYA 3BKUA 1UEKA 3LPEA 1RT1A 3VV2B 3ZZRA 1NDLA 4RW8A 4WKYA 1Y10A 2R2UA 4FXDA 1PG5B 3N28A 4K2JA 3RTVA 4D3HA 4V19J 1RA6A 5E33A 4F4ZA 4OZ0A 4ZPTR 1J5OB 5A8RA 3D9BA 4KKOA 4OZ1A 3KMSA 4ELVA 2POKA 1S1XB 1NEEA 4Y2IA 4RW7A 1W2IA 2VOOA 1RT4B 1U6FA 1X4CA 4FYVB 4EBCA 1R6YA 1DLOB 1YWXA 2E7XA 2Z8QA 4KSEB 5I3UA 1P9QC 3C3LA 1JLQB 2WBMA 4RX6A 1HBOB 3GWCA 3D1HA 2EI5A 3MR3A 4JOUA 2XMVA 2PO4A 4OJ3A 4C0HA 2OEKA 4JYAF 2F4FA 2VFSA 1X5TA 3OLAA 2DH9A 2DH8A 2JFKA 2ROEA 4BC7A 5HJYA 3FSIA 1D1UA 1F9EB 3GSDA 3MR6A 4E98A 1QAXA 4DX7A 1OPIA 1VIOA 4I68A 3B82A 2HWTA 3NS7B 3VCDA 1OYDA 1FWLA 2KU7A 4DS5A 2Y8WA 4TU9A 2QYGA 2QMWA 3DRSB 3DRPA 3M32B 1M90T 4DR2F 2CNKB 2AD9A 3R5DA 2ZZNA 5ETLA 2UUCJ 3UFCX 3UDLA 4ZIVA 1REVA 4X4PA 4RWXA 1KQKA 3IM9A 4ANCA 4UF4A 3FQKA 3NS6A 4DX5A 4YP3A 1DQ8A 4I2PB 1RWKB 4O0NA 1CJKB 1NBEB 1VJQA 3T19A 2GHWA 2HMIA 1MU2A 3ADAC 1RUSA 2HHVA 3CJSA 2MKJA 3B8HA 2BOPA 3MEEB 2XMAA 5T7LB 1TZ0A 1LWEB 1RKIA 4M1KA 3NGDA 4J9LA 1G4CA 3L95X 2CQBA 3NEKA 4USJC 3QO9A 4ANEA 1NJXA 1NJWA 3ZXWA 3BGLA 3AOAA 2ERRA 3VAMA 2J0QD 3G96A 2Y0BB 3L9ZA 1ULRA 4C0OC 3CCSS 5L1KA 3Q23A 1SB6A 1WKKA 4LSZB 3HM9A 1C0UB 3CCMS 4G1IA 2UU9F 5KFFA 3QT6A 3KK2A 4WWSA 4JI3J 3I5AA 4QYRA 5BYSA 5JVHQ 1WI6A 2WAQD 4ZJOA 5J2QA 3CF5Q 2WZ1A 4X64J 1AUDA 4DBQA 3GYNA 1D0EA 5K14A 1NDCA 1U49A 1ZAWA 2GO9A 1NH7A 2LVWA 2EWHA 2ZUGA 3M05A 5HVFA 3UW1A 4EO8A 3QRPA 4K4ZA 5THWA 5IWAF 4UT4A 1UVMA 2E5GA 4CO2A 4PWDA 1R8PA 4EZ9A 5IS2A 1AT1B 1WHYA 2RRNA 1RAIB 4EYHB 2DPJA 1GEHA 3P8BB 1U1OA 1WEYA 1Q4RA 1Y7PA 2KT2A 2NZCA 3A8IA 1JXLA 3EGNA 4DQIA 3R2CJ 1SUQB 2L9WA 2XNRA 4P9SA 3D2WA 1XJWB 3RYLA 1F0XA 1VK8A 4ZVQB 2QA4S 4MYUA 2G13A 4F67A 1VQ6S 4CLFA 1HHQA 4L74A 1KD1T 1ZYQA 3FJ2A 3V5RA 1VQYA 3G6ES 1HBNA 2K06A 2OP5A 5H9FJ 2AQ4A 1CEZA 1T02A 4K0KF 5HK4A 2ZE2A 1PJ6A 2CJ9A 3DYAA 3NGRA 4DU7A 4ZCLA 2NR0A 3CIMA 3LA0A 4XAKA 3BQ2A 4OQJA 1D3WA 2YWKA 3FSYA 2DJWA 4J9SA 2CYYA 3J7A1 1RHRB 1X7VA 1FXRA 5LMUF 1RHUB 4J9MA 1HD0A 1JJCB 3JSRA 2HBZB 1BQXA 2WVFA 3KUEA 4RUHA 3J7ZT 3CD5A 2O3DA 2VBYA 2DHAA 2PMHA 2Y1LB 3CJ0A 4B3RF 5ITHA 1BGXT 3U27A 1UJ5A 3J7AN 2OPPA 3UR0A 4PR6A 4OZ3A 4IOCQ 1F3VA 3M8ZA 3BR9A 2AJ0A 1QAIA 4FYYB 4G1QA 4K4SA 3BSAA 3T1HJ 5KT4A 1G1XA 3W66A 1Q8KA 2GO8A 3OXFA 1UZDA 3THPA 2ADBA 2KFNA 2J7UA 2VFRA 3EZOA 3HVTA 4NLVA 4DN9A 2RAQA 3M4XA 4AXIA 3MEKA 3W62A 2FVPA 1BXNA 3OR2A 4NYPA 2JEIA 1S99A 1U02A 3D1OA 4BWJA 3TJAA 4WU2A 3ENVA 2ZM6F 1S6QB 3NWRA 2PFDA 3EGWB 3A8JA 2ZH1A 1FESA 3AXKA 3MR7A 4LF1A 5J2MB 3DOKB 3UCUP 1IKVB 3DDIA 2IVFB 3DRSA 1FDBA 2HNYA 1QE1A 1SJ1A 2VJUA 1GMVA 1X8DA 5K8NA 2CNLB 2JNJA 2HHUA 3TAPA 1R6VA 2B4UA 1WF0A 2PDAA 3MPUB 2DNRA 1O6XA 3IN5A 1XIQA 4FNIA 1G6BA 2CAJA 4CLKA 3QPIA 2RE1A 2Z58B 3O44A 1FE0A 3FRYA 2R8JA 2ADCA 4ILLA 1SQFA 3FCHA 2HBRB 3A3PB 5DETA 3K58A 3RRGA 3GFZA 3GILA 2XMTA 2XULA 1RT5B 3GR1A 1KQFB 3I32A 2Q79A 3VGTA 4ED6A 4FF1A 2FJDB 5HI7A 2LU2A 1ITPA 5F3TA 1RWNB 2OHDA 3N9UC 4RJVA 2B4PA 3WZ0A 3A4TA 2LDIA 3PKYA 1HQ2A 2IRXA 2QYCA 2YNIB 1T8EA 1DLOA 2BA9A 2QIFA 5D3GB 1NH8A 4IQMA 3CJKB 2VJVA 4F4AA 4LMZA 4O3RA 4U7UD 2LQ8A 1SV5B 3AJ1A 3O2IA 3J7Z5 3MMCA 3T6JA 4DV7J 4QWCA 2VQEJ 4KKOB 2P8IA 3HD1A 1H7XA 2AZ1A 2FC9A 3SYZA 4I7FA 4QWAA 1J5EJ 4FF3A 3LTOA 1YDLA 1UTAA 3MCOA 5BXIA 4AL7A 1VBZA 2PEBA 3EZUA 1S1VA 3H0PA 3NGTA 4TU8A 1WWHA 1UA1A 2MY8A 1EHWA 1Y3JA 3QJJA 1S1WB 1TU0B 3D6FB 3DMJB 3VHQA 1DTQB 5DGAA 4ES3A 4USTA 3ICLA 2XSJA 1JWWA 1PBAA 2ZJQQ 2WW8A 2F4VJ 5KFZA 1NK0A 3QLHA 3DOLB 1KHWA 1Y5NB 4LVNP 2K8GA 3I0RA 4MFBA 4R5PB 4ECZA 4NXNF 4X4RA 3QZ7A 4PUOA 4CI0B 3WC0A 2FUG9 2DGUA 4IQXA 2IAJB 2KRBA 3HT0A 4C6AA
chains in the Genus database with same CATH topology
1JLAB 3X1LB 2DNOA 3M6XA 3D28A 1FK9A 3MDFA 3TUIC 2F40A 2VKZG 2HYIB 4B3TF 3P5TL 1ZTWA 1LWCB 3MECA 1X9MA 4YMEA 3T9ZA 3T5HA 4BS2A 3E01B 1BWEA 2MZTA 1IJEB 1H98A 4K50A 3OL9A 2RQMA 3K8VA 4MKAA 4CTAB 5A6PA 3CCJS 3KK2B 4DV4F 1P1LA 2DNKA 1MWZA 4P6QA 3NCQA 4Q8EA 2ZVSA 3CCRS 3HHLC 3K59A 2E7WA 3F56A 3M2UA 3QWPA 3I56S 4DV3F 4F26A 1T7PA 1FKPA 4IG0B 3HVTB 4QIGA 4U67Q 1DARA 3RR8A 3ZZUA 1GX6A 4EBDA 1HBUB 2B6AB 2V8GA 3DDNA 3FMWA 2RRAA 1N8RT 3UCGA 4CT9A 2L9DA 2MQNA 2WRMA 2CPEA 5IM0B 2JOQA 2BM0A 1YJNS 1U8SA 1N5VA 2YX7A 5C24B 3PIOQ 2NS1B 2UVUA 4IRDA 2VBWA 1DZ5A 4FVCA 2VG5A 1R43A 3K7RA 1SKWA 3K5PA 1GNKA 1R8AA 2BQRA 1HW9A 2ZITA 2ZBCA 3LP0B 3MI7X 3UQSA 3IBWA 4MKBA 4OI3A 5JXSA 1HI1A 4C2MA 1RDRA 3S7RA 1FD8A 2BDPA 4UY8T 4WE1A 1WF2A 5ADZA 2QV6A 4X4OA 4I69A 1HWJA 2UVRA 1F2GA 2FY1A 4P2SA 4NLDA 1BQMB 2E9RX 5HBMB 4XDDA 3PNIA 3RBDA 1ZTTA 1H2UX 1RT7B 4I56A 4ATNA 3D0HE 3BN4A 4C9DA 5B0DA 3NL0A 3MPWA 4Q0BA 1V3RA 1U7LA 1S1WA 1JLBB 4OX8A 1HPZB 4PKDB 1SJ4P 2AYEA 1HBMB 4ZPCA 3DRXA 1Q81T 3M1VB 4QIVA 4X66F 5J2QB 3CDEA 1HQEA 2JVRA 3W7BA 5B0EA 3OL7A 3X3UA 4RW8B 3BB5A 3SZ2A 4X84A 1HWLA 1RJJA 3QYYA 1D9FA 1K9MT 3CSKA 4FS1A 2FLNA 3JB9k 4DFPA 4NL5A 1FVSA 1TKTB 2R7OA 4N76A 1LWEA 1V3ZA 2AYBA 4DQPA 5AXLA 3KMQA 3N0VA 4MH8A 2KFZA 1ROFA 2VOPA 2XG8A 2IBKA 3O3LA 4K4TA 1KS2A 3N6LA 1IJFB 2LEPA 2R8HA 4LSLB 3JYTA 2ZJPQ 4ED2A 2M70A 4ECYA 2UV8G 1JB0C 4TU7A 1F60B 2D9OA 3LPYA 4CH0S 5KFCA 4HI2A 4XK8C 2DHSA 5FDLB 3I9V9 5DM6Q 4A8MP 1S0NA 3DLBA 3Q2SC 3TRGA 5I4MA 2MKSA 4HEA9 5KFWA 1FTRA 5FD1A 4NLXA 3TYTA 3NBPA 2N82B 2I5JB 1FO1A 4WXOA 2E9ZA 1ELOA 3R5CA 1NRKA 4ECWA 3DGPA 4KV8A 2JRSA 2VKRA 1QAJA 3DLHA 2EG1A 3HHLD 3C66A 1RQ0A 4YB7A 4AXJA 3UDCA 5CQGA 3IRXA 2I0XA 1GAOA 4X4TA 1P8GA 1S0VA 1OQ6A 2DNMA 4PQAA 5KFVA 2ZZMA 2VBXA 3E8OA 1CQNA 1H7WA 1FDDA 3IRXB 2NZ4A 4Y6IA 4I64A 3TUJC 4F3OA 3KLFA 2JHEA 4C8NA 4C97A 2UVWA 4GO7X 4UQGA 3OFEA 2C22A 4WFZA 1FRMA 1U1LA 1HARA 1LXJA 2KXNB 2YNFA 4JI3F 1Y5LB 2PC6A 1SIWB 2M5YA 3RW7A 3CC7S 1X5SA 4CO5A 3CCTA 2YX4A 3IWLA 2BM1A 4FXWA 5FDLA 1KEKA 2XC9A 2OFHX 1R0AB 4KGMA 4Q43A 2VODA 3V6JA 1UEVA 2AX1A 4RW4B 4I1TA 4ZMMA 5A6WA 4TY8A 1LWFB 1IKXB 1SH3A 4Y0FA 4A8WA 3W2WA 3U7JA 5L39A 3MUTP 2IJNA 3QGPA 1VLYA 5D4LA 4TQRA 3OL6A 3M2RA 4DFKA 3NCRA 1U09A 2B7BB 1X4AA 4EFAC 4EEYA 2NLWA 1OPZA 2CPFA 4RW4A 2B0GA 3MAQA 3DM2A 1L3VA 2OKQA 3MZIA 5F9NA 1LOUA 4DQQA 2M8HA 2ILYA 4GKJF 3B4DA 1IR0A 1UVIA 1B0VA 2HVZA 2A3JA 2GQ2A 1M1KT 4A8YA 2GJIA 2MKCA 5M2UA 1WNEA 4QZVB 3CO9A 2UXDF 1Q1KA 2FDNA 3T6BA 4RW6A 2CPDA 2YX1A 3M6WA 4K5RA 4DL0C 3M9OB 2DR8A 2E5LF 5IT9Y 2RSQA 5L1JA 4C3KA 3D0GE 3M2VA 5KFRA 3EPIA 4Y00A 2UXCF 1LW0B 2KT3A 2YNGA 2IYIA 3NS5A 5K5MA 1QAYA 3Q8QB 4ZVGA 3BSOA 1HYSA 3KLIA 5HBMA 1FRHA 5FLXY 1BQMA 4DOZA 4ECRA 2F3JA 2MJNA 1Q8LA 2KJVA 1AXQA 4TYAA 3SMZA 2B9WA 5IFMA 4TKTA 4IR9A 5A0YB 1MMDA 4MK7A 3VZIA 2PIIA 3NBPB 2KG0A 2DTJA 2JSXA 5KFHA 3U02A 4I6YA 2MZ1A 2LU1A 4OLPA 1WTFA 3NRBA 1OS5A 3IXQA 3W2VA 3OHAA 3VAIA 4WK1A 4TXSA 2KFYA 1T3NA 3OW2R 2DK2A 3HZGA 2ZC4A 4X4SA 1HW8A 5LSOA 3VAKA 5EHHA 1MROA 1SBRA 1VQ8S 1TAQA 2N3OA 1JLQA 1N52B 5I3UB 2W9CA 2FJWA 1JNZB 2EKYA 5J1EA 2IM1A 1UWBB 1K8AT 2YKAA 3JSBA 4AL5A 2E5JA 4IDKB 3M9MB 2YWGA 1TKTA 1VC6A 3M2UB 1S9GB 3LP1B 2VFUA 3CDWA 4EZ6A 2R8GA 2NPIA 3I0SB 4YR3A 4HLBA 4F4WA 3IG1B 4RW9A 2R2SA 1TQLA 2I9SA 2ZDPA 4NCGB 4OLOA 1WG1A 2DGXA 5HMYA 3Q0AA 3D54A 1TVRA 2YNHB 1DHMA 4TN2A 4NLRA 3TVKA 2MGZA 4N8NA 2C28A 1IN0A 1FK9B 2VUGA 1M5KC 2XCAA 1YRUA 3MMBA 5KFDA 1TK5A 4KFBB 3BJYA 1RGVA 5E3PA 3J7YU 1ZETA 3L09A 4HYKA 2NXUA 4ECSA 3CD0A 4CT8A 2R7XA 1S1TA 5CYQB 4ZVEA 1J5EF 4W90B 2DNQA 3PJWA 2COLA 1FNOA 1S48A 5U47A 3MEDB 1CPZA 2EC0A 2CPIA 1OWXA 2V5HG 3OVBA 1C0TB 4OZJA 5M2RA 4HKQA 3V4MA 3DU6A 3JSMA 2CQGA 1VC0A 4DX8H 2YNHA 2GHPA 1KLNA 4A8XA 4ZDNA 1CVJA 4NCGA 1JLEB 4AL6A 3TO8A 4ECQA 1YSJA 1WG4A 4Y65A 3VTIA 2M0GB 1N5TA 4RW9B 2ZNZA 3NAHA 2RF2A 3S01A 2HVIA 4ED7A 2FHKA 2BE2A 2K1RB 3THTA 3TNVA 4QU7A 3BM7A 1FRJA 2L48A 2YTCA 5D4NA 4R0EA 1KFDA 4ID5A 1M5HA 2A2CA 3KLEA 1FE4A 2HAIA 3FDSA 1NJYA 4C4WA 2KJWA 3LWMA 2XLKA 2YKNA 1U1QA 4C8KA 4DS4A 1SL1A 2LEBA 3UI3A 3LWLA 3QJPA 2KXHA 3OTOF 2IMWP 1MROB 2J0SD 2JH3A 2DNYA 1VI7A 3OR1B 4LT6A 4C98A 5B08A 6FDRA 5EGYA 3KYLA 2XSFA 1QE1B 4A8SA 3V6DB 1IKVA 4F25A 4H4MB 2RT3A 4ED0A 5H9EJ 1R8BA 4QBUA 1IKYB 2W4DA 1DBDA 1VJWA 7FDRA 2WOMA 3HKZD 2GNKA 5J1PA 2R7WA 5CYMA 2LKZA 4NRTA 2FVQA 2RDIA 2RUGA 2H5EA 4NA2A 2KT5A 3RRKA 4GO5X 3CXCR 1VFJA 3DN9A 3KHHA 4B02A 2XCPA 1K73T 3H2LA 2YKNB 3V6HA 3PACA 2XMUA 4FF4A 4NA1A 1KQSR 2Q43A 3H59A 2KG1A 2AP6A 4C3MA 5L8RC 1NHUA 1RT2B 2C2DA 2P6SA 1JLCB 2IM2A 1XR5A 2CQ1A 5JVGQ 1TL1B 4H4OA 4ES1A 5F8NA 4KO0B 2EBEA 5LJ5Y 4IFYA 3MMCB 1K0VA 2NPFA 4LUBA 2LDYA 1A6LA 3ENWA 1D8ZA 3T1HF 2MDAA 1U1KA 4OX7A 5LXRA 2OJ3A 1UVJA 3THVA 1IQTA 2GGPB 2VG7A 4QPTA 1VRUA 2VL1A 5KFTA 5EWEA 2DNGA 2A10A 2IM3A