4WFNQ

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 13
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfnQ00
4ZKAA 4WFAQ 1WF1A 3NS6A 4TU8A 5EN1A 4CH0S 1U2FA 1P27B 2DIUA 3CC2S 2KVIA 2LXIA 2AYEA 3LQVA 2CQIA 2LKZA 4UY8T 1JJ2R 2LA6A 1OO0B 3V4MA 4F02A 2E5IA 2KFYA 3DXBA 2KYXA 1VQKS 1FXLA 2X1FA 2MZ1A 3NNAA 2CQ1A 1X4AA 5MLCV 1SJRA 3NS5A 2X1GA 3BO4A 2MMYA 1VC6A 4J5OA 1VQ6S 2GHPA 2J76E 1O0PA 2DIVA 1FNXH 1H2UX 3G4SS 2CQ3A 3SDEB 5IM0B 1X5OA 5DDRC 2X1AA 3NMRA 3S7RA 4TLQA 4IOCQ 2LEBA 3HI9A 4IO9Q 2VOOA 2EK6A 5CA5A 4PRFA 4EGLA 1R8PA 2M8HA 2MKKA 1S79A 1VQ5S 3RW6A 2RVJA 4TU7A 5LJ3Y 5CXTA 2CPIA 5DETA 2FPHX 2JRSA 1VQMS 4QPTA 2ZJPQ 1U1PA 4U67Q 3UD3P 2BOPA 1K73T 2DNPA 2RNEA 4IUFA 2N82B 3EX7B 1WG4A 2CQPA 1SJQA 5DM6Q 3MUTP 2CPDA 1M5KC 3CTRA 4Y00A 3H2VE 1KD1T 2XSFA 1VBYA 2MPUA 3CCLS 1X4FA 5GAGU 1U1NA 3BEGB 3NNCA 1FJEB 3CUNA 2Q79A 2DH9A 1WG1A 2E5HA 2JVRA 1KQSR 2MQMA 1UAWA 4TU9A 2MQOA 3BS9A 2AYBA 1DBDA 2D9PA 4C7QA 2CPZA 1OWXA 2I2YA 2DNRA 3FEYB 3EGZA 1U1RA 5ITHA 2CQCA 4WFBQ 2KU7A 3H2UB 1X5SA 2MZTA 1F9FA 4M5DB 2KXFA 2MQLA 4BS2A 1ZZFA 3B4MA 1JJ4A 3FEXB 1NU4A 2DNOA 1X4DA 2CPJA 5GMKa 4CIOA 5JVGQ 1Q86T 1R8HA 1WELA 2F3JA 3MURP 2M88A 2MJUA 2QA4S 1UW4A 1H2VZ 3MOJB 4QQBA 2JVOA 4PKDB 1OIAA 3CCES 1YJWS 1N8RT 1KOOA 2MQPA 2CJKA 2DGVA 2LXUA 1X5PA 3MD3A 4CQ1A 2OIHA 4CH1A 2KXNB 2KT5A 2FHOB 2E5GA 3UWTA 2DGTA 3MD1A 1VQ9S 1M1KT 5GAHU 3TP2A 2MQNA 5CYJA 1UFWA 3UCGA 1ZZNA 1BY9A 1VQLS 1A9NB 2DNHA 2M70A 2MHNA 2MXYA 3UCZP 2CQ2A 3P6YC 3G96A 1SXLA 2EVZA 2OTLS 1FO1A 1Q7YT 3CF5Q 3P3DA 1VQNS 1U1OA 1VQOS 1JMTA 3Q2SC 4QU7A 2YTCA 2M0GB 4YUDA 1KOHA 1U6BA 2O3DA 4W90B 1U1MA 1DZ5A 2D9OA 3THPA 4YB1P 2DNKA 5LXRA 3J7YU 1VQ8S 3SXLA 3SMZA 2MYFA 1D9AA 1M5OC 3CMES 1QVFR 5LSOA 2K3KA 2L08A 3DLLQ 1D8ZA 1SJFA 3P5TL 5D78A 3IRWP 4P6QA 4IOAQ 3B4DA 2DHGA 1KC8T 2UP1A 1URNA 2D3OR 3G71S 5HL7Q 4YOEA 3CC7S 3VAIA 1YITS 1WWHA 1W2BR 2J0SD 2CQ0A 2XNRA 3S6EA 2CQ4A 2DO0A 1DRZA 2XS2A 1U6FA 1VC0A 2RQCA 3L3CA 2XNQA 1HL6A 1B7FA 2RRBA 5GADU 1YJ9S 3J7ZT 2ADBA 1YJNS 2OSQA 2CQGA 5LJ5Y 5D77A 2V94A 2MKCA 1M90T 4OZ0A 1WHYA 5BJRA 1QVGR 2J0QD 2MZRA 2KG0A 2KG1A 2M7SA 1YI2S 4LJMA 2HYIB 5IFMA 4OZ1A 2JX2A 4Z2XA 2RU3A 1ZH5A 1JJHA 2DHAA 1WHWA 5GAEU 1CVJA 2DGWA 1X4GA 2MKJA 2MKSA 3JB9k 2DNLA 5DDPC 5DM7Q 2XB2D 2DGOA 2K8GA 1L3KA 3VF0B 2CPFA 2L41A 3R1HA 2RT3A 3PIOQ 2E5JA 2GO9A 1U1LA 3TYTA 2L9WA 2KH9A 4Y0FA 3CPWR 2G4BA 2KI2A 3CXCR 5H1SV 2CPYA 1P1TA 4C4WA 1PO6A 2U2FA 2DB1A 3N9UC 1U1KA 4WIIA 2MSTA 2MY7A 1DHMA 1X4CA 3VAKA 1VQPS 4RU2A 2OSRA 2CQDA 1M5PC 2M8DB 2DHXA 1Q82T 3VAMA 1H2TZ 2N7CA 2HVZA 3THTA 1U1QA 5LSLA 1VBXA 2YWKA 3CCJS 2KN4A 2BZ2A 1WF0A 2RS2A 1YTYA 2CPHA 2DH8A 4ED5A 3U1MA 4WFNQ 2G0CA 2F9JA 2KXHA 1N54B 2CQHA 4ERDA 3LPYA 3NNHA 3CCVS 2SXLA 1X4EA 1SJ3P 1FJCA 2DNYA 1WG5A 2EK1A 3SDEA 4WCEQ 3G8SA 4LIRA 2LA4A 2VODA 3VALA 3ZZZA 2MZSA 2PE8A 4WKRA 2LQ5A 1SJ4P 3ULHA 3S01A 2MB0B 5HO4A 2B0GA 2DK2A 2DNMA 3BO3A 2ERRA 1G2EA 3CCMS 4F25A 3OW2R 3G8TA 4PR6A 1YHQS 3G9CA 2YH0A 2RUGA 5LXYA 2OJ3A 2F9DA 3BO2A 1XN9A 3MI7X 3RW7A 1FT8A 2HGLA 2VONA 3CMAS 4C0OC 2HGNA 3CULA 1WEXA 5GVQA 2M9KA 4V19X 1WTBA 3CD6S 3S8SA 2MY8A 2M2BA 1OPIA 1NO8A 2DGXA 2E44A 1VQ4S 2YKAA 2G1DA 2QEXS 1WEZA 2MZQA 4A8XA 2MJNA 3MDFA 3CCUS 3HHNB 2LMIA 2FC8A 1HA1A 1WF2A 2AYMA 2AD9A 1VQ7S 4WF9Q 2ZJQQ 2CPXA 3UCUP 1VC5A 5IQQA 3Q2TC 1WI6A 2MGZB 2FY1A 5FJ4A 2PEHA 3D2WA 2NLWA 2MKHA 1H6KX 2ZJRQ 1AUDA 2KM8C 2DH7A 1WHVA 1YWXA 1QM9A 2LEAA 3TO8A 2KHCA 2LCWA 3VAHA 1WHXA 2JWNA 1N88A 5JVHQ 1WEYA 3K0JA 2RS8A 5DDQC 3CC4S 2MQQA 2I38A 4F26A 3PIPQ 3MUVP 1YIJS 2U1AA 2DNQA 3CCRS 3I55S 2J8AA 1HD0A 1WI8A 3VAGA 5DDOC 3CCSS 2NZ4A 2OTJS 2FC9A 4W92B 1A7GE 3P49B 2N3OA 2M4MA 2MGZA 1X4HA 1IQTA 2X1BA 2XS7A 4QU6A 2WBRA 2HZCA 1UP1A 2CQBA 3U1LA 2DISA 2KM8B 2DNZA 2AYGA 1X5TA 2XS5A 2LYVA 2LECA 2DO4A 2MSSA 3UE2A 2DNNA 3IWNC 2RRAA 2CPEA 2HGMA 2DGSA 2KRRA 1RKJA 1K8AT 1Q81T 2N3LA 2VOPA 3CCQS 3EGNA 4UQTA 3MXHP 2DITA 2DGUA 4FXWA 2M52A 2RQ4A 1X0FA 1PGZA 2DHSA 1FHTA 1K9MT 3R1LA 2MZJA 1NJIT 1RK8A 3VAFA 2A3JA 2DNGA 3G6ES 3VAJA 1N52B 2KRBA 4FXVA 1X4BA 3ZZYA 1M5VC 2QFJA 2DGQA 2ADCA 3R27A 5IM0A 3I56S 2MKIA 1FJ7A 3US5A 1HD1A 1S72S 1VBZA 3UD4P 3MUMP 4LMZA 2YH1A
chains in the Genus database with same CATH superfamily
2XY6A 3RUBL 5I3UB 4KGVB 4WFAQ 1ZETA 1WF1A 3NS6A 4MFBA 4FVCA 4ID8A 1TV6B 4I2QB 2PO4A 4CH0S 1U2FA 1FVSA 5H9EJ 3C16A 4NASA 3V6DB 2IRYA 1P27B 2O66A 1LFPA 3ZZOA 5F8MA 3K5MA 3D6FB 1S1TB 2RAQA 4UY8T 3A8IA 3BBCA 1FRIA 4I0WA 1JJ2R 4F02A 5FJ4A 3M30A 3DXBA 1FWKA 2KYXA 2R7OA 3EE3A 1VQKS 2OH2A 2X1FA 1VMBA 1FXLA 4CLYA 2HHTA 1F2GA 2ZBCA 2BJ3A 4N76A 3W60A 3PZPA 2R8JA 1C2PA 5M2PA 2MMYA 4ECYA 5J2PA 1Q78A 3RAXA 2G2YA 4J5OA 2AJ2A 3G86A 4ICLA 1QTMA 3C3LA 3AAWB 3J7A1 2GX8A 1RHKB 1R8AA 1WKLA 5J2PB 3ISZA 3HKZD 1N33J 4WF9Q 1HQEA 4P2XA 3MOZA 2KT2A 1TU0B 4Y3CA 5KFTA 2H54B 1LKZA 1UEUA 2YQ0A 2ZDOA 3OUYB 5E3CA 4K4ZA 4PQUA 3MTKA 2BJEA 1LW2A 4ZVOB 2X1AA 4DU8A 2B3TB 4M5JA 1JLCA 4HHJA 1PC4A 2PMWA 4BWJA 3WDOA 5DGAA 2DR8A 3AHPA 4IO9Q 4DL5A 2VOOA 1PKUA 4KO0B 2F8MA 2WW4A 4DFMA 5HLFB 2B43A 1Y00A 1N34J 3IS9A 3MEGB 3OFHA 4ILMA 1MROA 4KC5A 4PG8A 2UXBJ 3UW1A 5J2MB 4DL2A 3OXGA 2Z4PA 4BLGA 1Q53A 5GADI 4DV0F 1U7LA 3RW6A 2RVJA 1RWUA 1JLAA 2QRRA 4WBFA 5D4LA 1SKSA 3SCLE 1VRTB 3T41A 2W01A 1DJ0A 2FZCB 3CCZA 3M8YA 5C24A 1SQFA 2J8SA 1C1BB 1PYOB 2RU9A 1DTQB 3EUNA 3VGTA 1Q5VA 1HR0F 2ZJPQ 4GMKA 3Q8VA 4PPZA 4OX9J 3UD3P 2UXDF 3MMBB 1IBMF 3NWRA 2IFXA 1UVJA 3TW0A 2ILYA 2FDNA 3N28A 5GAEI 2JDJA 1NCLA 2BDPA 4CM0A 2F7VA 2QO3A 3OV7A 1FWPA 2LLZA 4AXJA 5D4PA 3OVBA 2AX0A 3W2VB 1M5KC 3H2VE 5D4OA 2ZD1A 3ZFVA 1KD1T 5ETLA 1IKXA 4MIBA 1X4FA 2COLA 5GAGU 5H9FK 3BEGB 2XCPA 1LFWA 2HFUA 1RAHB 2B9YA 4TLRA 1NJYA 1FJEB 4C8YA 2BJ7A 3ONQA 4A47A 5A8KA 1R8CA 2DCUB 2F4VJ 3PYGA 3MCOA 1RLDA 2VASA 1P6TA 4LFAJ 1DQ9A 1UCNA 4OYIA 1KQSR 2MQMA 4Q5VA 3C46A 3P96A 1UAWA 2ZDPA 1APSA 4MIAA 3GV7B 1RYRA 3H90A 2GZOA 4DR5F 3C6TB 4KJIA 3RRHA 2IVMA 4Y28C 5AXNA 4MKBA 3DOKA 4F4XA 3JTPA 3F0NA 5C7PA 4DEZA 1GFWB 1H38A 4XTTA 4LVOP 3D67A 2ZE2B 1WSVA 1FESA 1X7VA 3EVOA 2MLYA 4WFBQ 3MCSA 5KFFA 5KG1A 3AQOA 1HNWJ 2CVIA 1JXVA 2GIFA 2GQCA 2YKNB 5HI7A 3R6LB 1NMEB 1OQ3A 2MQLA 3MECA 1RU1A 1ZZFA 1HR0J 4BS2A 2E7XA 3B4MA 3FEXB 1NZAA 2HFZA 3AOBA 1AFJA 2VB6A 4UY85 1RTIB 2DNOA 3CD0A 3IBCB 2CPJA 2JNJA 2FTRA 4C3MA 4C2MA 3NGSA 5KOWA 3UR0A 1R8HA 1Q86T 4NLGA 1WELA 3BN4A 2EFNA 3FBFA 5KFZA 4A8FA 3HK2A 1EP4A 4U96A 3RB0A 1H2VZ 1XR5A 2PDAA 3PKMA 2YQ1A 3SIPB 4DR2F 1R8BA 2JVOA 2QMUB 5D6GA 3LH2S 2ZH7A 2F1FA 1XBWA 1KHVA 2MQPA 4UOGA 2R2RA 3MEEA 4CLZA 5J1EA 3MD3A 1RT2A 2OIHA 2IVYA 1XQIA 1YZ6A 2E5GA 4ZPBA 2OEMA 4AUKA 3JQJA 3V81A 1FRKA 1S6PB 3TP2A 4DSLA 3RAQA 2IBOA 1UA1A 3EZOA 3KLVA 5CYJA 4H4MB 1ZZNA 1A9NB 2PEBA 4K2JA 2XYGB 2NPFA 3KLGB 2FLNA 1L3VA 4YEAA 4OYOA 5C25B 3QATA 2DNHA 3POTA 2PI5A 1HYSA 2W7OA 2FHKA 2MHNA 2MXYA 2CVEA 4ZCMA 1BQNA 1LOUA 1NPRA 2YKQA 3TAQA 1F2HA 4YDXA 4WFZA 1SXLA 2NUUG 2BW7A 4JI3F 1S7IA 1H72C 3HSGA 3KMSA 3CF5Q 2GHWA 3AQPA 3KK2B 3R97A 1YBTA 3HO1A 4FF4A 2QMXA 3IMQJ 3BKUA 4N8OA 4KFBA 1KDNA 2JL9A 1U1OA 2UXBF 2CJXB 2IAJA 4YUDA 4IRKA 1AT1B 2CJYB 1M5HA 3M6WA 4PXEA 5D0EA 3MUMP 1RT6B 3T1YJ 3DNCA 4Q2MA 4JI4F 3BJYA 4ZPVR 3BDEA 3D6TB 5T7LB 4DF8A 3KDNA 2RILA 1DZ5A 2FZGB 5HROB 2ALYB 1WC6A 2PIIA 3ITHA 4X65F 4CNYA 2NXUA 5BYQA 5CQGA 1N0VC 3ZZTA 4C8LA 3D9BA 3I31A 1TKXB 4NI2B 2QA1A 4WWSA 2GQ2A 4AL6A 4G1QB 5E0OA 3FCVA 3KLIA 3DLKA 5LT5A 3J7YU 3IBWA 4A8YA 3R2DJ 3K8VA 1GEHA 2MYFA 1TKXA 1F1BB 1D9AA 4QWEA 1M5OC 2D74B 2UVVA 3CDWA 4CZCA 1QVFR 4JI7F 5LSOA 8ATCB 2K3KA 2B4VA 2K2PA 1SCJB 2Q6CA 1T9WA 1T94A 2HWTA 3CDBA 3IRWP 1N6QB 5LMNJ 4DR6F 1UMJA 4IOAQ 1F9HA 2HPUA 1G1XA 4IG0B 3JQKA 1RWOB 5KOXA 5IS2A 7AT1B 2RUSA 2POKA 4I6WA 3TNVA 4YOEA 2NZ4A 3VAIA 2VKRA 1K1QA 1YITS 1RT5A 4FN5A 2C2EA 3PW4A 2FVRA 3ISND 2C1EB 3EDQB 3BSOA 4MIWA 1BHNA 4USVA 1B3TA 1DRZA 2UXDJ 2ZUAA 1FNMA 1R0AA 5C25A 2H1YA 2R7QA 2X51A 4FS2A 3ZTOA 5KG0A 3IWXA 1TR0A 2H9ZA 2QG9B 2AP6A 2XNQA 1F9EB 3DHWC 1AXQA 3MMAA 3PRBA 2QA4G 4LFCF 4XPEA 3VV2B 5AE1A 4QIGA 5C2CA 1UWBB 1QSSA 3C14A 3LAMA 5K9FA 4DV5F 1TVRB 2LQBA 4M5GA 3MR7A 4DV7J 2ADBA 2OSQA 2CQGA 4IH6A 2RKIA 2GVDA 2XWXA 2LQ9A 3AB4B 1MG7A 1G7CB 2RMLA 4LIWA 4OZ0A 2WVCA 5HQMA 5E41A 1VJWA 5BJRA 2XMTA 3H8YA 3O44A 4HH0A 1NK9A 2VFRA 4RW6A 3J81Y 2RF2B 1NDCA 2HYIB 1S1VB 2JX2A 2MQ8A 2GQQA 2VG7A 3OXFA 1JJHA 4O4GA 4TYBA 2C3OA 3W8PA 1FA0A 4RO0A 3PXGa 4EI2A 1X4GA 3Q86A 5GAHI 1S1WA 2I6WA 2FVSA 1LW2B 3EWGA 4OQJA 4DF4A 2DNLA 1NSKL 1DQAA 2RRNA 4DUYJ 3T5JA 3RBDA 3W2WB 1TTHB 1LWXA 1V3RA 2DGOA 4NPOA 1FRXA 1UEKA 3OL8A 2CPFA 4OJGA 3JYTA 2O1PA 5EUHA 4YDDB 3PIOQ 4ZVFA 1MROB 3GILA 5KFRA 1VYAA 1KLMA 3LPEA 2HNYB 4OYBA 3JSRA 5KFCA 2XTJP 1WC0A 4Y0FA 2E5LJ 3I6PA 2XG8A 3UQSA 1S6OA 2G4BA 3G82A 2BQ3A 2IYIA 3BR8A 2DXFA 2ZKUA 1YVFA 3F56A 3LUYA 4LBHA 2ASJA 2E1MC 1VLYA 3OFEA 1U1KA 4LF6F 3TX0A 2V8GA 2ZH6A 5E3QA 2MSTA 1IBKJ 3KJVB 3RR7A 1DHMA 1X4CA 4LSLB 1RLCL 3NEKA 3J80U 3VAKA 1N5VA 5FLXU 1VQPS 2QC3A 1UPMB 2CQDA 3MAQA 1M5PC 2ZM6J 1CC8A 2DHXA 3ENQA 1NM2A 1ZOTA 3DOMA 2VUGA 2QLBB 4KO0A 4C3KA 3FJ2A 3MM6A 3THTA 4ZN1A 5ETOA 1S1WB 4USKA 1RTJB 3DI6A 2Z0GA 5LSLA 2V9WA 4OJHA 2P6SA 3G87A 5KFWA 2XMMA 5HK4A 3CD7A 5CABA 2NXNA 2AF6A 2ZUGA 1LWEB 2BZ2A 4MYTA 2P8IA 4ECZA 2KFNA 2DBBA 1WF0A 1Y3KA 1HMVA 4LF1A 4L72B 1BXNA 4LRAA 1VQ9S 2ZH4A 2CADA 4ED5A 2RE1A 3H5SA 1V9OA 2F8EX 3KJNB 3LP0B 4ZDNA 5A8KB 1XMOJ 3LGHA 1N5YB 3HSZA 2ATLA 2KXHA 1N54B 2MKYA 2PSZA 1I5OB 3PHTA 3KUEA 3CJSA 4CO5A 4ERDA 1RBAA 1X4EA 1SJ3P 3TRGA 1SC6A 3T5KA 1JWWA 2AGOA 2DNYA 2HQIA 2EK1A 1UJ6A 2HBYB 3SDEA 1BGXT 3OPKA 1XERA 2HRYA 3G8SA 4O3NA 2DPJA 3HHKA 2KTQA 2VODA 4N7TA 2VPZB 1LWCA 2R8IA 3ZZZA 4U7CA 1VQSA 2I8EA 2MZSA 2PE8A 4C8NA 5DG9A 4YHHJ 4W98A 4AYBD 2LQ5A 2HMIA 1HNZF 1IKYB 3HHLC 3DU5A 3MZIA 2DK2A 5KFUA 4F0KA 4UZCA 3BO3A 5CYMA 2ERRA 2BR0A 2F4VF 1G2EA 4RW7A 1YJRA 3CCMS 4O44B 2AW0A 4F25A 4P2MA 4B9TA 1NDKA 2WVBA 3KG0A 3G9CA 1NBEB 2XBPA 4OX7A 2F9DA 2GFFA 4B02A 4X64J 3E2EA 3BO2A 4N47A 1K0TA 4Y65A 3MMCB 5L9XA 4IDKB 4KH1B 4WXOA 3QRRA 1KSPA 2CJAA 5F9LA 4UUWA 1NB2A 2Y3YA 5B0EA 3L7PA 3MM7B 3CD6S 5ADZA 3DYAA 4UW2A 3SCIE 3U7JA 5AXLA 4ZLLA 3Q24A 2FJWA 1A0OB 1CJTA 3NGTA 2HQFA 1UZHA 3AJDA 4MK8A 3D1OA 4LF8J 2VL1A 3CJ4A 3T5LA 2AMCB 1OPIA 2DTJA 1NO8A 3MM7A 3PG9A 2G1HA 1WC4A 5M2RA 5SUHA 3IGVA 4C48A 5LMNF 2AGQA 1SL2A 2A2CA 2FLLA 5KFMA 3TJ9A 1RAFB 3D28A 3OSNA 3PYEA 2HFVA 1S77D 4R8UB 4OX9F 1FEHA 2GCFA 1S10A 3HHNB 2AEFA 3UD5A 3PFEA 3MAAB 1N5SA 1R7IA 3FRZA 1FTCA 3M6XA 1RTDA 4ES2A 1XNQF 2GGPB 4JB8B 3RYLA 5CYMB 1NK6A 2ZBPA 3CGIA 1SL1A 2ROEA 1YLXA 3NBPA 3SQGB 5HMYA 4LF9F 1HPZA 4Y2KA 5HP1B 1ACMB 2MGZB 1BLUA 2HBQB 2RB7A 4PG6A 2CNOB 2F5GA 3BQ1A 3MEEB 3PEJA 1FD2A 1H6KX 2CRLA 4EMDA 4LFCJ 1WHVA 3CCTA 2LXFA 2R2TA 4NCGB 3TO8A 5B0FA 2HQGA 3CVKA 2IM2A 1XR6A 4ZLPA 4AQYJ 1WOSA 3R7NB 2WVEA 2QN6B 3W65A 1WHXA 4A8QA 2YKOA 1N88A 1RGVA 4ID5B 3Q8UA 1WEYA 1QJHA 3HULA 2RS8A 4DLEA 4K0KF 2W4CA 5IT0A 5F8HA 1FDDA 1RBOB 4HACB 4DUZJ 4JP8A 1SKUB 2GGPA 5KFAA 1QD1A 4Q45A 4JI3J 4F26A 3FBBA 3MUVP 4ZOSA 3NAIA 1NDLA 1RACB 3ET6A 1O6XA 4R8UA 4YR2A 3I55S 2HS3A 1NK8A 1R0BG 3MPVA 3S1TA 1QE1A 1DQ8A 1RT1B 2V34A 4NLYA 1PC5A 3K59A 4TY9A 4ITSA 1FKAF 4KAIA 3A4TA 2CJBA 1HNWF 4CP5A 4RJVA 4UOHA 1TKTB 1UTAA 1X4HA 3I0SA 1D9FA 1IQTA 4XK8C 2X1BA 3GPAA 4CLFA 4WP3A 2RSQA 4N77A 5DQHA 3V5RA 3UFCX 3DYAB 4ID5A 2EC0A 1MU2A 1RT7A 2CQBA 3H7HB 5CYQB 4IH7A 3U1LA 4Q8FA 2DISA 2ZM6F 1S9FA 1S57A 4USUA 1FKPA 5FDLB 4OV6A 1LWCB 1X5TA 2ZZTA 2KHDA 4NMLA 6AT1B 1RE1B 3MPWA 3R7SB 1OMSA 3A8KA 2LYVA 4DR2J 2LECA 2HAIA 2MSSA 2V8DA 2G0JA 2YX1A 4GRSA 1JKHA 3CJRA 5DZ7A 2CPEA 3DGPA 3F44A 4QBUA 4ELTA 3M9NB 1C4AA 1RHQB 5B0DA 2AZ1A 4ES3A 3W9IA 1EJ7L 2ROPA 3O5TB 3CCQS 1NNDA 1R27B 3EGNA 1I51B 3TVZA 2D69A 1IKWA 1RT4A 2OAUA 2RQ4A 1LNQA 1YJTA 1N5QA 4RUAA 1TKDA 1TELA 5F41A 1PGZA 2VFVA 1NKBA 1IBLF 3OD2A 1HLWA 4HT5A 3RTVA 4PZVA 4DU7A 2WCXA 4C8MA 1ZM3A 3RG6A 2A3JA 1QAXA 3Q22A 4LFBJ 4O3RA 1SBRA 3DRXA 3SV3A 3RGIA 1X4BA 3TANA 1SC1B 2BV3A 1M5VC 3OLBA 1BE4A 2P9GA 4YN3B 2ADCA 4A46A 5IOLA 2ZVIA 2UXCJ 1GT8A 4NEZA 2L9NA 1M1GA 1U8SA 5C2GA 3H40A 1S7HA 1VBZA 4DWIA 1DFDA 1OY9A 5B09A 2VIHA 2ZOMA 3OR1B 4M5IA 3PW2A 3M8WA 3CT9A 1KVIA 1V6HA 2B9WA 4TU8A 3WQPA 2ZFHA 4JI4J 3QT5A 5D4NA 5ETTA 4B9MA 1N32J 2G9OA 1RHUB 2VFSA 1MNEA 4JV0A 3TZWA 5KFDA 1CC7A 1B7YB 2M3DA 2PT0A 5HP1A 2CUYA 2JEGA 4MKAA 4EYIB 1D09B 1AROP 2IRXA 2NXJA 2ZC4A 5MLCV 4NLOA 2MZ1A 3DLBA 1SJRA 4M95A 3K5PA 3GJTB 4NA1A 2BJ1A 1UJ5A 1JLFB 1RAGB 4Z37A 1Z1ZA 2E1RA 1VC6A 2J6TA 4ELVA 2GHPA 5HQ8A 1VQ6S 4L76A 3DRSA 3KJVA 2HRUA 2J7UA 4OHVA 5KFJA 2WSEC 4P9SA 2JLFA 3Q8QB 1FDNA 2W2MP 4DSFA 2UXCF 3LTOA 2EC2A 4WZMA 3SDEB 4Z7CA 1CULA 1FE4A 1UJ4A 1X5OA 2OPSA 5L39A 5DDRC 5F3ZA 4PWDB 5KFBA 3BH6B 3S7RA 4J9UE 2W1BA 3OL9A 4IOCQ 1ZM4A 1XEZA 2VU5A 1HNIA 1CULB 5HSPA 4LFBF 4P2FA 3GQCA 2W8LA 5ETKA 2AJFE 1FXDA 2WONB 4H4OB 4PRFA 1Y9OA 3ENWA 1DTTB 1U45A 1O8BA 1R8PA 4LUBA 3RBZA 2FJDB 1VQ5S 2BKNA 1UKUA 2ZHOA 2QX0A 3ILIA 1YJUA 5J2NA 4F3OA 4JV5J 5HVGA 2KL8A 4ZHRA 1KWMA 4TU7A 1SH0A 4PABA 5LJ3Y 4DR3F 5CXTA 4V19J 2J7WA 2HWHA 4EZ6A 2R7RA 2BOAA 2UV8G 1UWBA 3T6JA 5CCLA 2AHOB 5HMZA 3QZ7A 2D7SA 2Z2ZA 2C42A 3JQMA 3WX4A 2FPHX 1MMNA 2ASYA 1UETA 4PG4A 4F3QA 5B0CA 3DDIA 4RPFA 3B82A 3EM1A 3OUYA 3E01B 1X9MA 1T03A 2BOPA 1K73T 3TZZA 4GVBA 4DQRA 2RNEA 4IUFA 2HQDA 2N82B 2OHDA 1WG4A 5J1NA 5LMUJ 1Q5YA 2CQPA 1E6YA 3BR9A 2GMJA 1SJQA 4U9RA 1X60A 4R5PB 2GMLA 2FLPA 2Y8YA 3KLIB 1RWVB 2MLZA 3CB4A 4M5HA 3E3XA 4N56A 4DR1F 3JS9A 2EG1A 2JFKA 2VJUA 1B0PA 2W4DA 4LBIA 4NYOA 2PFDA 4DQQA 2MPUA 3CCLS 3P4UB 1B70B 1X0PA 3PX4A 1KQGB 3V6DA 2FJVA 4J7CA 3NNCA 5DRKA 1PAEX 1PJ7A 1SB6A 4OLOA 3FQLA 3RU0A 5J2NB 1REVA 5JUMA 2EEYA 4F4KA 1HW8A 4DXLA 2DH9A 5J1PA 5DLFA 3L95X 3J80Y 4NLUA 3GU0A 3AOCA 5F8LA 2HVHA 2FD2A 2BE7D 4N8NA 3OTOJ 4CO0A 3BS9A 2C2OB 4ECWA 3B8HA 1HARA 5KFXA 4QWDA 1IR2A 2D9PA 4KPCA 2CPZA 4C7QA 5KFSA 3IM9A 4RW4B 4ELUA 3QZ8A 4YHHF 5I42B 2XQCA 4AXIA 1NLKL 1X31C 3MM9B 2DNRA 4OHXA 3FNNA 3HHLB 3NP5A 5G0RB 3PJWA 1HQEB 4DL4A 4ZP9A 4X62J 1U1RA 1KFDA 2DRDA 3T1AA 2CQCA 2ACYA 2KU7A 2VBXA 4DPOA 4OYAA 4P52A 4AD6A 2KXFA 2VBYA 3MR3A 2JEJA 1JK9B 4JI5F 5A0YB 1HBMA 1RADB 5B0BA 1JJ4A 4WTYA 2PC6A 5KT2A 2FY8A 1SI9A 1FFWB 2NUHA 2JH3A 1NU4A 1WOOA 3JSBA 4K4WA 4DV3J 1N36F 1BWEA 1HBMB 4LF5F 5D0RA 1TAUA 3M2VA 2IM1A 2J9CA 3M32B 2OUGA 3MURP 1HI1A 2M88A 1CPZA 3M8PA 4NRTA 3PACA 4O3OA 2EFGA 4KHMA 1I6JA 3CW2C 2F40A 4FYDA 2JOQA 4QQBA 3KHRA 5KTQA 1YJWS 5EX3A 2IRUA 4F4YA 2O67A 1MW7A 5G0RA 3HXMA 4WPAA 2CJKA 4KTQA 2HHWA 1DLOB 1NJZA 4CT9A 4CQ1A 6FD1A 2UVRA 2OD6A 2KT5A 1HWJA 3IBFB 2WAQD 3TJ8A 3MD1A 1AYEA 3TA0A 4X4TA 3BQ2A 1EARA 1HQUB 2QTWA 2AKWB 3ZTSA 4CTAA 1FD8A 3RRGA 1RTHA 3RB6A 1C4CA 2ZZMA 1T95A 3F73A 3BSAA 3JSYA 1F60B 2KT3A 4ECSA 1VQLS 3UCGA 1C0UA 4DZDA 4M5DA 2EXUA 1PJ6A 3MAAA 5HAOA 3UPFA 3OVAA 1PCAA 2CG4A 4LBPA 4K4VA 3N4WA 2HQCA 4OYPA 1HYSB 2AV5A 3P6YC 3N5BA 3QWPA 1QUPA 5ETVA 2EVZA 1KKHA 2GVDB 2OTLS 1IKXB 1BQXA 1IKWB 4OJ3A 4IFYB 2OFHX 2VG5A 4LF7J 2GV1A 3A8JA 1VQOS 1YRXA 3Q2SC 4HI1A 4ANEA 2GIRA 1ELOA 3BSNA 1U25A 1WUUA 2JC1A 4IFYA 3AJ1A 2VQEF 8AT1B 1F0XA 3SCJE 5L46A 1QUVA 2B5JB 4X84A 3BM7A 1SUQA 2OPQB 2IIHA 2W2PP 3DXSX 2O3DA 2WRMA 1T8EA 3VGSA 1S6UA 4W90B 3CJ0A 2G2OA 1Q0NA 2QT7A 1U09A 2CNKB 2HIYA 3DN9A 1SUQB 2OPQA 5E3PA 8RUCA 3T1YF 1T7PA 1B64A 3ZNJ1 2CDRB 3DHXA 3PHEA 3I82A 1JLBA 2ASDA 2XEXA 3GFZA 4BCAA 3NY0A 1PJ5A 5HVHA 3OTOF 4K4SA 4FDFA 4IFVB 5E2QA 1U2CA 4RNNA 3CMES 2VKZG 1P1LA 1WC3A 3TQ1A 2WK4A 3K2YA 2JEIA 4CRJA 1REVB 1U24A 1RXOB 4OZLA 1OYEA 4DCOB 1D8ZA 3HFZB 3DLLQ 3J7AN 2UU9J 3O6QA 2OD4A 2RHQB 2ZNZA 4O23A 3UNYA 1VRQC 2WBMA 3P5TL 4HTJA 2XMUA 4QJVA 5D78A 2AIRB 2XI2A 4I6AA 4P6QA 1FVQA 4TXSA 1CJKB 2K7JA 1F5CA 4PQAA 2IC3A 4OHZA 3PV8A 4DSIA 2FHMA 1LWFA 1FKOA 3M1VB 4M5KA 3KKFA 2CJ9A 2OPPA 2C2ZB 3T9NA 4DN9A 4JI5J 1H0HB 5KT7A 2Q6BA 2X7IA 2HG4A 1TKTA 1FWLA 1LK5A 1SH3A 2K1RB 1JLBB 3BKFA 5LM7E 2PMZD 4DMZA 3PX6A 3PO5A 4USWA 3WIUA 3LP1A 4DR5J 2YKNA 2J5AA 4NOHA 3PY8A 3BN7A 4MKVA 3V2UC 3OR2B 3H25A 2J0SD 5B0GA 3IAS9 4ENOA 4LF2A 2B6AB 3JXOA 4JUZA 5HROA 1WOPA 2CWKA 5CZXA 1RWXB 2QSFA 5HQLA 2XS2A 2P5VA 1FX4A 1U6FA 1HIYA 1YZ7A 2AJ0A 1EX8A 2GC8A 1NDPA 2W4PA 4H4MA 1VC0A 1B7FA 3KYLA 2DXEA 3FVYA 2RRBA 3FFIB 1R0CB 3RJMB 4Q0BA 2VPWB 5HJXA 1Y5LB 3W9HA 3JAMY 1VS3A 2ATCB 2HNYA 1P8GA 2G0IA 2QFIA 5E5NA 3VWSA 1BD6A 1EZZB 2WVFA 4W4MA 3FCHA 5D77A 5J1EB 4EBCA 2BX6A 1M90T 2HBZB 2QLFB 3KK3A 4DX5A 1ZYQA 1QVGR 2YNGB 5A76A 4J9QA 2M7SA 3W9JA 3KHLA 4DUYF 3BB5A 3N6NA 1YDLA 2A1BA 4I4BA 2DHAA 5K5MA 3SSSA 1WHWA 4TY8B 3M9MB 2VG6A 3KLFB 2J7KA 2XMAA 3D5MA 2DGWA 3THVA 2QLJB 3CMQA 1X8DA 2MKSA 4MYUA 5KG6A 2B4PA 2MDAA 3KMQA 4CNZA 4X65J 5DDPC 2XB2D 2KZZA 4NRUA 2K8GA 1PBAA 2A0FB 1KVJA 3I4PA 3QJJA 1ZM2A 1NPPA 2OP5A 4QWCA 2CFXA 3QIPB 2GJ2A 3HFVA 3FUYA 4F67A 3H20A 2YPZA 1SC4B 1Q1KA 3GSIA 1GTEA 3MEGA 3HZGA 3M7VA 1HMVB 5EGYA 3TYTA 4AL5A 1FK9A 1MN9A 2KH9A 4F2RA 1ICEB 2HHQA 4X2BA 4PPDA 2KI2A 2XMVA 4CLSA 4B17A 2ZWOA 3F41A 3DU6A 1P1TA 1KP6A 3K5OA 3QSYB 2HNZA 1KHWA 1NKEA 4WIIA 3FMBA 2WOMA 1NK0A 5DO2A 5FLXY 4IRDA 5BYRA 1ZH5A 1XMBA 3N6MA 4WKYA 4RU9A 4RKUC 2OSRA 5IWAJ 4IQMA 4B9NA 3OR1A 2FJXA 4UOCA 2M8DB 4KGXB 4PG7A 1Q82T 1FRLA 4K5SA 5D3GA 1H2TZ 1PYTA 4K50A 4QR1A 1C1CB 2BRKA 2NYIA 2P9EA 2PD1A 2HIQA 3I5BA 4NLXA 4A48A 3BPDA 2YWKA 4AQYF 4DS5A 2XI3A 2VHGA 2OPSB 3L9ZA 2Z2MA 3CCJS 1XMOF 2KN4A 2A6OA 2ZH8A 2A6MA 3W2VA 1IQZA 3O8WA 2I9SA 3T1HF 3CD5A 2RS2A 1T3NA 2Q66A 1VBKA 4PUOA 3B78A 1Q8BA 4ZS6A 4K5RA 1I94J 4FBTA 2X3GA 3GSDA 1DTTA 2G0CA 2BE2B 4UTGA 1U48A 4DV5J 3GFXA 4ZPWR 2JC0A 4FZVA 2ZC3A 1Z2LA 1TL3A 1TVRA 2E66A 2VFTA 1QAYA 1ZAWA 3NNHA 1RAIB 1WSRA 1C1BA 3EZUA 3CCVS 1NSQA 2SXLA 5LMUF 4QIVA 5D15A 1AZSA 1WG5A 1UVIA 5A6WA 2D3O1 2UVUA 2GIQA 1RT3B 4FBUA 4LIRA 2BJ9A 2LA4A 3KOAA 1QTNB 2HHHJ 3SSRA 3VALA 1JIHA 3GB0A 4WKRA 4IOBA 3VGVA 3W1YC 5F8JA 2IMOA 5C5JA 5J2QA 4KV8B 1EIYB 1Q8LA 3UVJA 5HO4A 4P74A 5DQGA 1HNIB 2IM3A 4NL5A 1R3NA 3OJSA 3H4DA 1EHWA 1B0TA 2IJFA 1GQEA 2OELA 3IWLA 3KFWX 3OBIA 5L1JA 3D1HA 2ZVSA 3LF0A 4GC7A 1EKRA 3GFHA 3OW2R 2R2UA 3SQOP 1D1UA 2VPYB 1VCTA 1GK8A 4I64A 1G4CA 1SVDA 1TL1B 2WB1D 2RUGA 3HSJA 4ZCIA 4ZHRB 4YFUA 2YNGA 2FVCA 2OJ3A 3K58A 2BANA 2EWHA 3HD2A 3MI7X 3CCUS 5DG7A 2VONA 4C98A 3P8BB 4ECXA 2XWYA 1WEXA 4PXDA 5GVQA 3Q0AA 4DL7A 1WTBA 2BRLA 2UZAA 4QIEA 4I7FA 4MJKA 4LF4F 3S8SA 2B56A 3K57A 2MY8A 2FGOA 2OPPB 2PI4A 1QDUB 3W7BA 3J81j 1TUVA 4ZCKA 3LANA 4ZJOA 4DV2J 3KTQA 4PWDA 1ITPA 1HBUB 2YKAA 1GMWD 2L48A 3CO9A 3QAEA 2XY5A 1WEZA 2IJNA 2O5DA 2W2NP 4G1PA 2WSFC 4E98A 3Q8SB 1OS5A 2BJDA 3AD8C 4Q2LA 4USHA 1HWLA 1LW0A 3MM5B 2LFVA 3MDFA 4KHPJ 5F8NA 1S9GA 2VQFF 3EPGA 1JNRB 1VR6A 2LMIA 4USJC 1QAIA 3EXCX 2FC8A 1IN0A 3HX9A 2HNDA 2AYMA 3TAPA 4IFVA 1GX5A 2R7TA 3GCWP 4NA2A 1NJXA 1VC5A 4L6V3 2UUBJ 3GR0A 4EZ9A 4UOFA 2HVEA 1F3FA 3W62A 3HT3A 2UU9F 1N32F 1K1SA 2FJAB 2VG5B 3Q2TC 2H65B 1Z4UA 2XLJA 3GIIA 3ILOA 3D2WA 3EPIA 2FY1A 1T9YA 5DJBA 1DLOA 4HDHA 2MKHA 3PCOB 4M63A 3QGIA 4KKOA 2ZH2A 2ZJRQ 2VPXB 2DH7A 2Z58B 4K0KJ 1CJVB 1CQNA 3GYGA 3LP2A 1Q8KA 1QM9A 1SPBP 4FNHA 4NMXA 1WNEA 5I3QA 1P9YA 2ZBRA 3AOAA 3BGRA 1WTFA 2KB2A 4ZVSB 5L9NA 4LREA 1NAQA 5HJYA 3H4BA 4RW4A 4YB7A 3SFGA 1JXLA 3H0PA 5DDQC 1JLEA 4JI2J 2K7KA 1LEOA 1EB0A 2CA9A 4TYAA 4F50A 2H51B 2E1CA 2AJQA 1NHKL 1R6YA 2YQ3A 3I9V9 3QNWB 2HHPA 2MQQA 3BQ0A 3GJSB 1ROFA 2I38A 3MMAB 4IG3B 2QL9B 3NXZA 3PIPQ 3DLHA 2HBRB 1QSLA 2U1AA 2DNQA 2B4OA 4NA3A 3CCRS 3KLEB 2NSBA 3ISNC 5DDOC 2OTJS 4U6PA 4W92B 3AY0A 1A7GE 2BEFA 2V8VA 4ZA1A 3UR3C 1L3SA 5EX0A 2NR0A 2R4FA 3P49B 2XHWA 3IR5B 2M4MA 5SZTA 2BBEA 3C6TA 2CNNB 4F8RA 3IG1A 1VRTA 4FP9A 5ETQA 3SZ2A 1HQUA 4CTAB 1KFSA 3DLGB 3FBCA 4I7FB 4ZCLA 2Y9HA 2AX1A 2EPIA 2QL5B 3AA8A 2YNHB 4LRDA 5F9NA 5KFEA 1S0VA 2MLXA 4EBDA 2W2QP 4EO6A 4JYAF 2W9AA 4ED7A 4JI2F 3ITHB 4MK9A 4FYVB 4CLWA 3HHEA 1MWQA 3QBCA 3UI3A 4DUTA 6FDRA 3MAHA 3FSYA 3K7RA 1RAJA 3NOCA 2OEKA 2XLIA 3W5ZA 2V9KA 1YSJA 2RRAA 3CDEA 2HGMA 4A8OA 1JNZB 1K8AT 2UVWA 2C22A 4LR8A 2M5YA 2N3LA 4OZ5A 1MSWD 4OZ3A 5H9FJ 2YWFA 1DARA 3CO0P 4OI0A 5GAGI 3KUGA 2IMWP 3MXHP 1IJFB 2ZH5A 3CIMA 1VISA 3LP0A 3O3LA 1X0FA 3ZTPA 1K44A 5T41A 4X66F 2V4QA 1N5YA 3BH7B 1QSYA 4ZVHA 2Y0BB 3D0HE 4P71A 2DJWA 4C0HA 3E01A 3WBZA 3OTBA 3G6ES 2KRBA 3VAJA 2HWIA 1R31A 4USMA 3ZZYA 3OL7A 2VQFJ 4DV6F 2V69A 2FJEB 3OTCA 1RTZA 1S6PA 5HBMB 2B8PA 4QWBA 2MKIA 4X62F 4F4ZA 5A8WA 4CCHA 1HD1A 1NK5A 5GMDA 3EGWB 3QQCD 3CCWA 3MM8B 4WFXA 3UN2A 1M5SA 3W8GA 3V6JA 4DCJB 4DV1F 4NCAA 4LMZA 4ZKAA 1MWYA 1S9GB 4ZITA 1E6VB 4LF4J 5EN1A 4K4TA 2ZE2A 5U47A 2J9DA 4NWBA 2DIUA 3D68A 1FRMA 2ZNYA 2KVIA 1W26A 4G65A 4PXBA 2LXIA 1IUJA 3LQVA 3UDVA 5L1LA 1C0TB 1TMMA 2V68A 1RQ0A 3TI0A 2CQIA 2DR9A 2LKZA 3FSXA 4Q8EA 5MAOA 2LA6A 3BBBA 1OO0B 4RW8A 1RYSA 5JXSA 2ZHBA 5IV4A 1UL3A 2KFYA 2IBKA 1TFWA 2ZOFA 1LXNA 4OX6A 3GIMA 3LWLA 3NNAA 2EI5A 3GG0A 1VQYA 3NS5A 5F8GA 3N79A 3BO4A 3C2PA 4RW9A 4OL8A 4I2PA 4OYWA 2J76E 2N7YA 3HKWA 3MM8A 3HVTB 2JLEA 3DGVA 1FNOA 3KJQB 1H2UX 4NLTA 2CQ3A 3D54A 4RLEA 1UA0A 3MFHA 3M2RA 1T03B 4B3TJ 5BYSA 3DRPA 5IM0B 3ZZPA 4DN0A 3QFHA 2H5EA 4F2SA 3NMRA 3KG1A 4TLQA 2QGFB 2V4JA 4IO1A 3HI9A 2LEBA 4EFAC 4CO4A 2IVFB 2K06A 3PYDA 5HMXA 2GAGC 2RQKA 2JEFA 1DAXA 4EGLA 3SEOA 3NGUA 4CLTA 3SV4A 2YWEA 3AXMA 4IQXA 2M8HA 1FXRA 3MEDB 4YS2A 2MKKA 4NLRA 1H3DA 2D3ZA 5F0WA 4HVZA 4TNOA 3QYYA 1W25A 5KFKA 4TVAB 3OHAA 4H4KC 4RW9B 2WTFA 1PBUA 2YBVA 3LALA 4CLUA 2KJWA 4U95A 3WC2A 2HNZB 3ZTQA 1YGYA 3HHLD 2HHXA 3V4IB 3RR8A 2NREA 5M2UA 4NZ0A 1IBCB 3T6BA 2BYCA 1H98A 2JRSA 2RQMA 3M8ZA 4TY8A 4J90A 1U1PA 4QPTA 1KTVA 1WDDA 4KT0C 4U67Q 4GC6A 1H7WA 3RB3A 2DNPA 1T02A 5E33A 2UUTA 3A3OB 3MHYA 2PN6A 2ABYA 1OJ4A 1AB8A 1VJQA 2HK3A 5DM6Q 2YXLA 2H4WB 2WONA 1U4BA 4CDIA 5KAKA 2WHOA 3H5YA 3QLHB 3TARA 2VDIA 1HW9A 2PA3A 3CTRA 4Y00A 4DI6A 2V4JB 4WFYA 2CG8A 1QY7A 1RUSA 1C1CA 2XSFA 3Q89A 2ILZA 4OLPA 1X9WA 5D0GA 1RWPB 1T9XA 1PIEA 2I5JA 1HWUA 3BDPA 2B8QA 1VLOA 4DPYA 1RB0A 2DY1A 1MMDA 4FNIA 4WP9A 2Q79A 4FYXB 4B3RF 3RB4A 2KZMA 3UN3A 3A12A 2AU0A 4HTIA 1WG1A 2E5HA 1ZA2B 2EG2A 2JVRA 2E7WA 3VZHA 3T19A 3IO1A 3DFEA 3T9ZA 4BC9A 3T1HJ 3VCDA 1S1XA 2Q3PA 1GXTA 4NYZA 4KRWA 3SFUA 2MQOA 1T05B 4YB5A 4J9OA 2AYBA 2ZOGA 2AGPA 1OWXA 3I4HX 1FRJA 2VG6B 1RU2A 2GO8A 1YK9A 2MTLA 1VGYA 3DDKA 3GV8B 2XSJA 1U8WA 4DL3A 2I2YA 2ZH9A 2VZ9A 4O4GB 5D0HA 2G2ZA 4F4WA 3EGZA 3MCNA 4QPXA 3K17A 4FKXA 3I0RA 1URRA 4RBUA 3WC0A 5C42B 5IC6B 2R9LA 4LRBA 1X5SA 2GNKA 3QIPA 4M5DB 4O3QA 2R7UA 3OTDA 1RZMA 4WU2A 5KT6A 7FDRA 4JBCA 3ILJA 2QMWA 4ED2A 2Y1IA 5GMKa 2EBGA 1S12A 4CIOA 1UVLA 3KK2A 1NRKA 3LW5C 4R25A 3GZ7A 3PEHA 2D3UA 4OX8A 3KDOA 3ILLA 1XNRF 4OI2A 2DT9A 4FF1A 2MJUA 2QA4S 1S99A 1UW4A 2VG7B 5CHCB 2NYHA 3AFGA 2LDIA 4PKDB 2XZDB 3ADAC 3CCES 4CYUA 5L8RC 4HH1A 4KQZA 1N8RT 4EYHB 4ILLA 5KFHA 2EKYA 1N56A 3CSKA 4A8KA 2LXUA 3LP1B 2AJ4A 4FVMA 4CH1A 2YNHA 2BQUA 1TK0A 2FHOB 5K8OA 2DGTA 4ED1A 3CIZA 1M1KT 4CO1A 5A2QU 3C15B 5E3RA 4PYAA 3UVJB 2DPIA 3KLHB 3Q23A 4RL1A 4ZVTB 3DGPB 4KYZA 1TK5A 4B9VA 1BY9A 1XTZA 4WK1A 4CI0B 4RNFA 4DV6J 2C3PA 3CWJA 2KFZA 1NEEA 4DR4F 3I0RB 1SV5A 1B99A 3AXKA 2M70A 3TAMA 3MR5A 3D3CJ 4LVNP 2CQ2A 1VFJA 4PXCA 5DS7A 4DQIA 5B0AA 3TX8A 4DV4J 3ETOA 3QT6A 4L3KA 4U8VA 4B9UA 1FO1A 1B4SA 2LQ8A 4X66J 1Q7YT 4PAAA 4ECTA 3QO9B 3FSIA 1PYSB 4RBVA 4WIQA 4J9MA 4C9DA 1FX2A 2YTCA 1ZBTA 3BZQA 4IG0A 2KYZA 2FHJD 2CZ9A 1SC3B 1U2RA 2WZ1A 2G13A 4X4RA 1U6BA 3G6XA 1FNXH 1EQ0A 4ZP6A 1FI4A 2XYPB 3K5LA 5F3TA 4YMEA 1S49A 1U1MA 4X4QA 1RT3A 1CJVA 5AXMA 1LQ9A 3NCRA 1FKPB 1Y5IB 4PWWA 1IM6A 2NS1B 2R8GA 3THPA 3TEGA 4NLSA 3TA2A 2FUG9 3Q8PB 4DBQA 3QAUA 1HBNB 2NXCA 1X9SA 4YB1P 4QW9A 2YNFB 4HACA 4O3SA 1JLGA 2EFPA 2FGCA 2MHEA 3KNAA 5LXRA 1N33F 4DPUA 3SXLA 1S76D 3PNIA 3SMZA 1I94F 1V3SA 2BKPA 3MECB 4DLGA 4B08A 2HMIB 1JJCB 3W66A 2C28A 4G1IA 1TUWA 4KB7A 2L3MA 3HCXA 5CD4A 2L08A 4YR0A 4Y34A 1TL1A 2V8PA 1Y0HA 3N0VA 5CD4H 3O1LA 2B5JA 3GCXP 3Q83A 4DG1A 3QRQA 1NH7A 2AT1B 3M32A 5KFIA 2DHGA 2IAJB 4WYWA 2NCKL 2YX7A 5T14A 1N5TA 4Y2AA 1RTHB 2HKEA 1YRTA 4QZVB 2YY3A 2E9RX 1JLEB 3NOGA 1T0TV 2D3OR 2WVDA 1HBNA 4RBTA 3HVTA 4QIFA 4ZK7M 1H74A 3G71S 2DR7A 2UUCJ 1NB7A 3CC7S 1E6YB 1U47A 3BKTA 4C11B 5KT3A 1KQKA 5C42A 2CQ0A 3EJMA 2DO0A 3ICLA 1KR4A 2B9XA 4H4OA 2OGUA 5K8NA 4DDFA 2N4CA 3KLGA 1LWEA 1HNVA 2V63A 5KT4A 1IBKF 2V0NA 4WXWA 5DQIA 3L3CA 1VI7A 2CZ4A 3Q8YA 1S1UB 1HL6A 1O5JA 2IJRA 4F4AA 5RUBA 4HDGA 3LA0A 1HPZB 4URQU 1C0TA 3MTJA 4ZP7A 1IJEB 2EBEA 5GADU 3J7ZT 1L5UA 4OV1A 3DRYA 1EETA 4QR0A 3HT0A 1TL3B 3QO9A 5KFYA 1SKWA 4ZJLA 1T9VA 1W7WA 5I3PA 2V94A 2NZCA 3CJ3A 2E5LF 4DV3F 2QSWA 2VC1A 1WHYA 3G8QA 4LSZB 4UT4A 2J0QD 2MZRA 2KG0A 2KG1A 5DLGA 3MCMA 3OVSA 3IRXA 4DFKA 5IFMA 2A10A 1JLQB 2EFVA 4HEA9 4OZ1A 2RU3A 4FXDA 3IN5A 1TZ0A 2W9CA 3WHIA 1AUSL 2KDOA 5I42A 3I5AA 1C0UB 4JI6J 3EGVA 2YNIB 3KLFA 3KLHA 1CLFA 3PR5B 3MM6B 2HLTA 2MKJA 5F8IA 1CJTB 4F0MA 2W9CB 3JB9k 3FKBA 4WU3A 4HL9A 2HLUA 3TWZA 4C6AA 1IKYA 2VFUA 4J9LA 1RTDB 2A18A 3T3FA 3R1HA 3GR1A 2RT3A 1SKRA 4O3PA 2E5JA 1OY8A 3HJFA 3OQ2A 4TN2A 4UUXA 2GO9A 1WJ9A 4WE1B 4TKTA 1U1LA 2OEJA 3IXQA 4J9PA 3PW7A 3MPYA 1F5AA 2L9WA 3D6HB 4J9VA 2ZITA 3CPWR 1CS4B 4ZMMA 4DSEA 3CXCR 1KS2A 4TQRA 2IC3B 3R6GB 2CNLB 2APOA 4JI0J 3GJRB 4RX6A 1CBKA 3NKYA 4C4WA 1RHMB 3VHQA 2W24A 1CJUA 3SCKE 4DQSA 5BR8J 4X4UA 3N9UC 5L1IA 3DCAA 2ZBQA 4OZNA 4JI1F 3OFFA 3JSMB 4NLVA 3DM2A 4DR1J 1BMQB 4ZJQA 2I0XA 2Q43A 3PDNA 3ZO7A 4DS4A 4DFPA 2UUCF 3B6BA 4ECRA 3N5FA 5AJ3F 4GKJJ 1A6LA 2BMBA 5LSRA 4CO2A 2C3YA 2HVZA 2NXEA 2XHCA 2YNFA 3D7SB 3E51A 1GXLA 5ETRA 3ZTRA 1U1QA 3IGNA 1VBXA 2J0WA 3MGJA 5IWAF 2ZD1B 4LT6A 3BGFA 2W7AA 1HNXJ 4DCPB 4NE9C 1RT1A 2DXDA 3IP0A 4MK7A 4KV8A 3AH6A 3OHBA 1Y11A 4OYXA 4OYMA 1YTYA 3KLEA 1ZTWA 4NXNF 4DV4F 3QJLA 1KVKA 2HFSA 3A13A 3I32A 4DPWA 2CPHA 2DH8A 1SQEA 1VHFA 4WYLA 3GE9A 3TEHB 3VGUA 5DG8A 2HFOA 4G6VB 1N4LA 3OXLA 3D0IE 2CQHA 3K5NA 1VK3A 4RWXA 4AL7A 1SL0A 2EW9A 2QL7B 1XWLA 4X4OA 2FVQA 1FJCA 3NCPA 1CG2A 3BGRB 4JI6F 3KHHA 4QYZJ 4Q43A 5ETSA 5D3GB 1WORA 3G6YA 1HFEL 5JJBA 1J2VA 4NLWA 2NQPA 2ALZA 5FDLA 2GJFA 1VRUB 4QW8A 1RABB 1NK7A 1J5EF 4IG3A 1RJJA 1SJ4P 3KK1A 4C97A 3S01A 3M2UB 2XZTB 4MAKA 4P73A 2B0GA 4LF6J 3C14B 4KGKA 1MN7A 5G4DA 3LOUA 3H98A 4ANDA 5FD1A 4ZLJA 4YY3F 4JV5F 3V4IA 3BV8A 1CS4A 4DSJA 3DLEA 1KNZA 1JB0C 2FQQB 3L4BC 4E2FB 2Y8WA 1ZPWX 4NLPA 4JI0F 4K8RA 4RW6B 4OI4A 4ZVPB 5LXYA 3DRSB 3TVYA 1PG5B 3RW7A 1NJWA 3PFOA 3M8PB 5ETNA 2IDLA 3PKYA 2M9KA 2VC0A 1S4EA 2BM1A 1IR1A 2LDYA 4HR2A 4ED8A 4L75A 2D1CA 1R89A 4DX8H 2YKMB 2RIJA 4HKQA 4KSEB 4DR7F 4QR2A 4DV1J 3QT7A 4HHHA 4ALZA 2DGXA 1FFSB 3DMJA 1TKZA 3BGOP 2G1DA 3I9ZA 3KJFB 5ETPA 4DJBA 1IVZA 3UDCA 1GMWA 2C2KB 1T9TA 1TK8A 2V2QA 3W3SA 3X1LB 3POTB 2MJNA 4O0IA 1FE0A 3D1QA 3GONA 3M6VA 4RR5A 4UF4A 3WIVA 2W8KA 2MEWA 4RNHA 4JV1A 3PRVA 4IRCA 1HA1A 2RKIB 1RI7A 4ECVA 1VQ7S 1L3TA 1VHIA 2YVSA 3NAHA 2C2NA 2CPXA 5L38A 3M4XA 4NLDA 3RZAA 2ZJQQ 3UCUP 3WZ0A 2JZ5A 3HZEA 2H4YB 3ELHA 5IQQA 4BHQA 5IZHA 2LVWA 1CJKA 2E1PA 1RCXB 2RD5C 1S1TA 3BF4A 3D66A 3DOLA 4K59A 4BWMA 2OMLA 1WC5A 3KG4A 4J9NA 3ZXWA 2KM8C 5KG2A 4HHUA 1RP5A 4M94A 2LEAA 1U6ZA 3LP2B 3EDRB 1FERA 1SIWB 2HK2A 3MMJA 5KT5A 4ZPDA 4DHVA 1CEZA 2JWNA 3DOKB 1BUXA 5KFGA 2HAFA 7FD1A 3K0JA 2GA7A 3R2CJ 2BVZA 3NGDA 3CC4S 1J27A 3NWGA 2V4RA 4A4JA 2C2MB 2C3UA 1TMJA 4ATNA 3ENAA 3FCWA 3GV5B 1HNVB 1YIJS 4XAKA 1IM4A 2HS4A 3AA9A 3DC2A 4J9KA 1GNKA 3VQSA 2AZ3A 1S5ZA 1HD0A 1WI8A 2B7CB 2VF3A 1NXIA 4GO7X 4OMFG 4N5SA 3CCSS 3VAGA 2B9EA 2V6AA 4GVLA 1CQMA 1FF2A 1ULRA 4LSNB 4CT8A 4B9SA 4OJ1A 2B7BB 4AT1B 2N3OA 2Y1RI 2W9BB 2MGZA 2R42A 1RKIA 3IG1B 1S1XB 1T05A 4QU6A 4OI6A 2DYAA 1HKAA 3D3BJ 5CCMA 2WBRA 3DOMB 2HZCA 1Q16B 1UP1A 3G2XA 4Y6IA 4A8SA 4NCBA 2PGCA 2XM3A 4ECUA 4DR7J 2E29A 2KM8B 1YG0A 4NX9A 2ZKTA 5CAAA 2AYGA 4LQ3A 2QA2A 2XS5A 1REGX 4FYYB 4YP3A 4DX7A 1LW0B 1NKCA 3M6UA 3P5BP 3MWBA 3R9LA 4EO8A 1SV5B 1RA7A 1UW9A 2BW2A 3TAMB 4PWUA 3RBEA 4K7QA 3C8YA 2CWXA 2DNNA 4OI1A 2AQ4A 4DSKA 1RKJA 3GIKA 2BUNA 5HATA 1Y4ZB 1T3OA 1Q81T 4NXMJ 2QV6A 3IR6B 2VOPA 2EFOA 4LR9A 1FK9B 3ZC4A 3HLUA 4AFFA 4UQTA 2W9BA 5AT1B 4GO5X 1RWNB 3CJTA 1Z2ZA 3NGRA 4I69A 4LQ9A 5K14B 2M52A 4J9SA 1FJGF 2IY5B 1EQMA 1FHTA 3GYXB 5J2MA 1QE1B 3R1LA 2RDJA 4G3IA 4URGA 3K8WA 2WOMB 1NJIT 3MMBA 3QPIA 3VAFA 3EVWA 4CLPA 3ZZUA 4I68A 1N52B 2CAJA 1UEVA 2DCLA 2F65A 2YKPA 4I67A 3GWCA 1HBUA 4IKAA 4KBIA 3V6HA 1Q8IA 1UVMA 4DOZA 4CLKA 2DGQA 3EZ5A 5HVFA 2GW8A 2CYYA 3CJQA 4KR0B 1XC9A 2Y1JA 4U7UD 4ZPCA 3US5A 1LK7A 4FPIA 3UD4P 4NXMF 3VTIA 4WTOB 2YH1A 3B54A 1WKKA 2OPRB 1DURA 2XMJA 1SIZA 2RDDA 3ZZRA 3HPOA 3TUPA 4DR6J 2EKNA 4EUVA 4YQWA 3JYTB 4C0BA 3TJAA 4Y2IA 3IM8A 3CC2S 4CWBA 2I5JB 3OFGA 4RNOA 3JTOA 4OZJA 2AYEA 3CJKA 1KBRA 2RDIA 5C24B 4LFAF 3FDSA 3V4MA 1MWZA 5LOQA 2E5IA 2IDEA 1B0VA 3MPUB 5HANA 5IT4A 5K8PA 1RWKB 4N41A 3I5CA 3BSCA 4MT1A 2CQ1A 1X4AA 3HVWA 3U27A 4ILRA 4ED6A 4IYQA 2X1GA 2DKOB 2HS0A 1JQGA 4DUZF 2HEKA 2AEJA 4U7UK 2H48B 4O4RA 2XC9A 4LSLA 4C11A 3C6UB 2DVIA 3KWMA 3JSMA 2VBZA 4GVBB 1KQFB 1AA1B 1O0PA 2DIVA 3IFEA 1GMUA 4P7TA 5H9EK 1GAOA 3KXDA 1N34F 2FB0A 1NK4A 4PYDA 3CE8A 2FZKB 1JLCB 3GYNA 1S0NA 1RTJA 3DI6B 4ZIVA 2HZAA 4ZLNA 3CJKB 1IBLJ 1D8YA 4NYPA 4B3OA 2EK6A 3M05A 5CA5A 1TL5A 3TUJC 3KK1B 1KLMB 3LGNA 4ZPAA 3TUZC 3N6LA 1S79A 3MEDA 1ZS6A 3H2LA 3KUHA 2V2ZA 2CPIA 5DETA 3SYZA 1TUGB 4DFJA 2LEPA 3BPSP 4LF5J 1S9EB 4B3MF 3LGMA 1HI0P 1FKOB 1HQ2A 3EVMA 1T11A 3M1VA 4I1TA 4LRCA 4D3HA 1Q4RA 3NCQA 1N6QA 2F4FA 2HSEB 1RSCA 2QYGA 1Q7LB 1VQMS 3Q8RB 2L9DA 4KHPF 2VA2A 1QAJA 1XJWB 2RF2A 4ER8A 1FDBA 4P10A 1RISA 1IWGA 3C6UA 1V5VA 3EX7B 2CZVC 4I2PB 2XULA 4WJBA 5THWA 5DGBA 2R8HA 1RT6A 3DM2B 4EK2A 1GMVA 2ZH3A 3C66A 1MU2B 1RT7B 5BR8F 2K1RA 5HLFA 4DQPA 3MUTP 5A8WB 2CPDA 1IBMJ 2BM0A 9ATCB 5L1KA 2LU1A 4KPYA 3RRKA 3FFIA 3J7YI 2O01C 1Y7PA 3M8QA 1S0OA 5E7OB 1Y3JA 1VBYA 1S9EA 4JI8J 3FZ2A 3IAM9 1U1NA 1JLAB 1MMLA 4ZVUB 1TL7A 5FIIA 4WE1A 4Q44A 3CUNA 3ET6B 1OPZA 4AE5A 2C2DA 1N36J 2HHVA 2QIFA 3HM9A 2UUWA 3D4JA 3O2IA 5CYQA 4JI7J 4DL0C 3AODA 4TU9A 3DLGA 1YKWA 2NSCA 4QCLA 1UFKA 1Y10A 1CJUB 1ZAXA 1ZPVA 2DRAA 1DBDA 5B7WA 2C2RA 2AWZA 4K2XA 3V6KA 4NZ7A 2JHEA 1J5EJ 2CIMA 3HVRA 2A2DA 2J9DE 2JLGA 3FC9A 2DHHA 1PILA 3FEYB 2OKQA 3OSPA 5KFQA 4E8UA 2RH3A 3L09A 5ITHA 3ZZ0A 4F0HA 2C3MA 3H2UB 2MZTA 2V2VA 3OR2A 3QGPA 1F9FA 4IH5A 5EDWA 5I3UA 5D8HB 3GTYX 1XNRJ 4F3MA 1KLNA 3ETMA 2OI2A 5CZVA 2OLWA 2R7SA 4FF3A 1XIQA 3D6MB 4G1QA 1FTRA 2YWHA 1X4DA 2DD8S 2VH7A 1TQLA 1RHRB 4KGZB 4ANCA 1UVNA 4LRFA 1AW0A 2XMKA 1XK8A 3NGKA 2F3JA 1TAQA 1EAYC 2BJ8A 4H4KA 4DG1B 3MMCA 3GFYA 5IXUA 3RAMA 1FEEA 2KJVA 4R0EA 2KVQE 3MOJB 3VVUA 3N01A 3UO0A 1OIAA 2QYCA 1WKJA 1KOOA 4EEYA 4NXNJ 3W5XA 3KK3B 4KKOB 4ICLB 2DGVA 3H5UA 1YX2A 1D0EA 1X5PA 3DMJB 4CM2A 3FMWA 3DDNA 2KXNB 3UWTA 2VJVA 4GKKJ 5AXKA 1RA6A 1U0SA 5GAHU 3V81B 2DR5A 2MQNA 3DKDA 1UFWA 4XDDA 2HHSA 1DY3A 3TZYA 3LWMA 3UDEA 4ETXA 4J37A 2HFNA 3FGVA 1KTQA 3BREA 3C16B 2DR6A 3UCZP 3I87A 4CLLA 1FCAA 1SH2A 3GP9A 4HYKA 3NMAA 1R6VA 4ZN3A 4RUCA 2JFDA 3G96A 1F5BA 4O44A 1NSAA 4J9RA 5KG5A 3T5HA 2X3DA 5AE2A 3P3DA 3TA1A 4UQGA 4P7VA 1VQNS 1NPKA 3OLAA 1FJGJ 4DR4J 1JMTA 2JSXA 3I0SB 4QU7A 3GLJA 3VVTA 3MEKA 4BC7A 2PFFB 2M0GB 4USIA 5ETMA 1KOHA 2VDHA 2BE2A 3BBFA 2HHUA 4IDKA 3R5CA 2YPYA 2RHSB 3DRRA 3PO4A 2IA6A 4ZVRB 3UDLA 1GXUA 1UFLA 2YWGA 2D9OA 1N0UA 4USTA 1S0MA 3QSIA 4P75A 2K3IA 2Y0SD 3W61A 4V1Ak 4D3GA 2R2SA 1ZTTA 3AD7C 2GVZA 1YQHA 4S0MA 1AZSB 2FLOA 1FRHA 4C8ZA 1HI8A 2V67A 2N4DA 4JYAJ 2UV8A 4A8MP 2IPOB 5IC4B 2CJQA 2Z2YB 3DLKB 1RAAB 2DNKA 2KO1A 3C15A 1JLGB 3IR7B 4RNMA 1VQ8S 4JOUA 2AEMA 4URSA 4J91A 4R5PA 5A0YA 4ES1A 1NH8A 2E9TA 4O0NA 2BXJA 2BACA 4M5MA 1U49A 3KNGA 3PJXA 4LF7F 5JVGQ 4HT7A 4Y2CA 5E3AA 4PUOB 1SJFA 1RWMB 1G3OA 3DRRB 1R43A 2Z57B 4DL6A 1RCOB 2OMOA 3CJ2A 1T9UA 3HSDA 1Q95G 2BE9B 3G4SS 2XY7A 3B4DA 5K20B 4OYZA 3R5GA 1WACA 2IM0A 4RZRA 1KC8T 2UP1A 3M2RB 3VQTA 1URNA 1SQGA 3MR2A 4F36A 1NZ8A 1YBAA 4B9LA 4GKKF 5HL7Q 4ED0A 2GHVC 4PEOA 1WWHA 2W25A 3FBEA 4R0JA 3TVKA 1W2BR 4B3MJ 1OSDA 3GIRA 2VV5A 1JXEA 2CQ4A 3S6EA 2EFQA 2XNRA 5DZ6A 4LF8F 2VBWA 3AB2B 3OT9A 3MM9A 1OQ6A 1NSPA 2RQCA 4XPCA 4OHYA 2P6TA 1AFIA 2IYGA 4ZVQB 2D41A 1YJ9S 1J5OA 2V50A 3EICA 3PM9A 1VIOA 4ZVEA 4ETZA 5A2QY 3M8SA 1YJNS 1S48A 1UPPA 4EBEA 3BYPA 2HNDB 5LL6d 5LJ5Y 2ACMA 2MKCA 3UNGC 1XNQJ 4UZBA 2W7PA 2HVIA 3TZXA 1YI2S 4X4SA 1IWAA 4OFZA 2UUAF 4LJMA 3VR1A 3QWUA 3R5BA 4LR7A 4Z2XA 3J81U 4M1KA 3A3NB 3R7BB 3R8YA 3PW5A 3LAKA 4M5LA 5GAEU 1CVJA 4QOTA 5GMEA 1O51A 3QLHA 1R0AB 3M2UA 5BXIA 5DM7Q 4C8KA 2LP4A 4DPTA 2J6SA 4F7VA 1L3KA 2QZ8A 1TV6A 4I2QA 4MH8A 4QIWD 3VF0B 2L41A 1TP7A 2XLKA 3CJ5A 3LO3A 3PX0A 2OPRA 4ED4A 2Y1LB 4F04B 2YX4A 3MM5A 2IHR1 2Q1LA 3SSQA 3QFWA 4FS1A 4X4PA 4Z7YA 3H42A 4HLBA 4RW8B 3G82B 3FK4A 3AJ2A 3PRDA 4RW7B 5K8MA 2CPYA 5H1SV 4WZQA 2VD3A 3D0GE 1IXKA 3W5YA 4B3TF 1PO6A 1UWAA 2U2FA 2DB1A 4K4UA 4ZIWA 5KFOA 3QRPA 3GG1A 4FPRA 2MY7A 1IKVA 3MF5A 4RU2A 2PA8D 1XR7A 1HHSA 1K47A 3HVAA 1F3VA 1WDTA 4NEYA 2DEIA 3R5AA 1I1GA 4NLQA 4KH0B 1U0HA 3H59A 4MTPA 3CDUA 1VDHA 3VAMA 3MPDA 2N7CA 3HJVA 2VQEJ 2HHHF 2E1AA 2GJIA 4JI1J 3CJ8A 2B51A 2P9CA 2YNIA 2HQ3A 4M5NA 3IA0A 1D9DA 4P2SA 2WB4A 3HP6A 2J0XA 3M8RA 2XO7A 1V5IB 4C3LA 2J6UA 1BQMB 3U1MA 4YR3A 4WFNQ 2XO6A 3U02A 1RT4B 2DEJA 2F9JA 2FYXA 4P72A 4RUHA 2ZHAA 3HHDA 4DV7F 2Z2LA 3EMTA 4KFBB 4XDCA 1NUEA 2I1RA 1DTQA 3HF5A 2E7VA 3LPYA 5HBMA 5A8RA 5KFPA 3MR6A 2XGQA 4E0DA 2XMWA 5F0UA 4IR1A 3K89A 4DPXA 4HI2A 4ZVGA 2BABA 2CDQA 1HNZJ 4PQUB 2LU2A 1JX4A 4WCEQ 2FHJA 1HWIA 3IRXB 2B6AA 1OY6A 2H3EB 1E6VA 5CH7B 5KG3A 3JAMU 2R7VA 3PYFA 2YWWA 4DV2F 1RT5B 3AT1B 4H54A 3PTWA 1YJ7A 2H5JB 1UVKA 2B4UA 3IS9B 2ZZNA 3ULHA 1VIXA 4OHWA 3ENVA 1EKSA 3W2WA 1EETB 2MB0B 1QLNA 3QJPA 3A8EA 4Q0BB 2DNMA 4EWTA 2UUAJ 4KHRA 3M9OB 2QJ3A 2Z56B 4X64F 1WC1A 3BGUA 1RBLA 3VZIA 4IR9A 1GTHA 1JKHB 3E8OA 4LSNA 3G6VA 3G8TA 4QYZK 3OTEA 4PR6A 1YHQS 3FEZA 3HD1A 2P2CB 4U8YA 2FVPA 2HRTA 1WD6A 2YH0A 3A1YG 3TR5A 1XMQJ 3NL0A 1OYDA 4KGMA 1HBOB 4RUBA 3EYZA 1XN9A 5T7LA 3TQEA 1FT8A 2HGLA 4YY3J 2VICA 3CMAS 5EHHA 3DOLB 1JLFA 2HGNA 1IKVB 3BYRA 3QGGA 4C0OC 5B08A 4V19X 3CULA 4DX6A 2OO4A 4TQSA 2HW3A 1IR0A 1S4FA 1FFGB 3FRYA 2JJ4D 2M2BA 2YKMA 3C19A 4XIUA 4ECQA 4WK3A 1LWFB 2IA0A 3PW0A 2E9ZA 2R7XA 4NI2A 2E44A 1F6TA 4XO0A 4A8WA 4ED3A 1FDAA 1RT2B 1VQ4S 1KN6A 2BKOA 4K4XA 4B3SJ 1VOMA 2GVZB 3ZNUA 2QEXS 1BC6A 2GMHA 3X3UA 1BQNB 2V8HA 2MZQA 4A8XA 2H5IB 4LF9J 1M0SA 1RAEB 3NLCA 2WSCC 4MFBB 3DLEB 2XCAA 1PAUB 2FJBB 3PJ9A 1WF2A 4OZ2A 5K14A 2OFGX 2AD9A 4I6YA 1SJ1A 4DV0J 4PG5A 2BA9A 2ZH1A 3RBXA 2QLXA 3NBPB 3SQGA 1TL4A 1J5OB 1S6QA 2ZEJA 1WI6A 5KFNA 5KG4A 1CSJA 3L7OA 2DRBA 1HWKA 1NHUA 2PEHA 3NG8A 1U26A 3NRBA 1G6BA 2CXEA 2NLWA 4YB6A 2WW8A 1ZM9A 2F63A 4L74A 4JV2A 1H7XA 1AUDA 2BANB 2ZBIA 1JLQA 3CDAA 1HBOA 3OJUA 4CYUB 1YWXA 4NCGA 5IV3A 1PSDA 4FYWB 4K4YA 1HHTP 2KHCA 4DZ6A 1GH8A 3NS7B 3IC1A 5HMWA 3FZBA 1RAOA 2LCWA 4I56A 2NPIA 3SBMA 1UZDA 3W64A 3VAHA 2VA3A 2F8HA 4B3SF 3MFIA 2GS8A 4B3OB 5JVHQ 4RWWA 2ASLA 3JTNA 5KFVA 4CH7A 4PCQA 1VK8A 3WX8A 9RUBA 2RJZA 5KG7A 5AJ3J 4GKJF 4X4NA 1LXJA 3HMJG 3DLJA 3QMQA 5IT9Y 3PVXA 2V5HG 1OSCA 1S1UA 3R5DA 4M8LA 5KFLA 3W63A 1U02A 1ZA1B 5JMNA 2UUBF 1VRUA 3BGLA 3TUIC 4NZ6A 5EWFA 3P45B 1TFYA 1Y5NB 2HZVA 1K0VA 2HVDA 3GJQB 4FF2A 1KRPA 2R8KA 1TL7B 1ZAVA 2J8AA 2QLWA 2W2OP 4Q7AA 4ZPTR 2FC9A 4MMOA 1P9QC 1XMQF 1EP4B 1D3WA 5IQ6A 4B3RJ 1KEKA 3AD9C 1L3UA 3M2VB 4C8OA 3J7Z5 4ZP8A 2QE5A 5A8RB 1RDRA 1S6QB 4FKYA 4L73A 5A6PA 2XS7A 5I4MA 4OIXA 3U1NA 1RWWB 4X4VA 4MKYA 1BWVA 3I96A 3L7UA 3H5XA 1YJVA 3A3PB 2XGPA 2DNZA 3GMGA 4QYRA 4QWAA 1W2IA 1KONA 1MLAA 2V2KA 2FIUA 3QIDA 2DY9A 4KE5A 3HHLA 1YRUA 4EU0A 2DO4A 5AE3A 5EWEA 3UE2A 2XSJB 3TOQA 4KY3A 3IWNC 2KRRA 2DGSA 3M8QB 1I3OB 3R3TA 2KKHA 2ROGA 4OI3A 5IT9U 1RTIA 4DR3J 3FQKA 4CO3A 2R7WA 2CKWA 4WP8A 2Z8QA 1S59A 2DITA 2XZWA 3QT8A 3KHGA 2DGUA 4FXWA 4Y2MA 2BQRA 3CEDA 1N48A 2DHSA 2R3VA 4BDPA 1BQMA 3GIJA 1K9MT 2MZJA 3HDSA 1RHJB 3SI8A 3EXYA 4JI8F 1H73A 1V3ZA 1RK8A 1Q79A 2DNGA 3CNQP 4L3NA 1M1HA 3UN5A 2HURA 3M30B 3HFKA 4FXVA 2LQJA 2AJ1A 5HN0A 1TKZB 2ZWPA 5EWGA 2GAHC 4KIAA 3PR4A 2QFJA 1HNXF 3QGHA 2XYHB 1HHQA 4BBYA 1S97A 2PMHA 3R27A 1GX6A 3DRPB 3R5JB 5IM0A 3I56S 1NHVA 1FJ7A 1S1VA 1S72S 5J2QB 1U0HB 1YBUA 1LV5A 2J9EA 2Z30B 3OL6A
chains in the Genus database with same CATH topology
2XY6A 1ZETA 5I3UB 4WFAQ 1WF1A 3NS6A 4MFBA 4FVCA 4ID8A 1TV6B 4I2QB 2PO4A 4CH0S 1U2FA 1FVSA 3V6DB 2IRYA 1P27B 2O66A 1LFPA 3ZZOA 5F8MA 3K5MA 1S1TB 4UY8T 4I0WA 1JJ2R 1FRIA 4F02A 3M30A 3DXBA 2KYXA 2R7OA 1VQKS 1FXLA 2X1FA 2OH2A 2HHTA 1VMBA 1F2GA 2ZBCA 4N76A 3PZPA 2R8JA 1C2PA 5M2PA 2MMYA 4ECYA 5J2PA 1Q78A 3RAXA 1QTMA 4J5OA 3C3LA 3G86A 4ICLA 3J7A1 3AAWB 2GX8A 1R8AA 5J2PB 3ISZA 3HKZD 1HQEA 1NK6A 3MOZA 2KT2A 4Y3CA 5KFTA 3G4SS 4K4ZA 1LKZA 1UEUA 3OUYB 2ZDOA 4PQUA 5E3CA 3MTKA 2BJEA 1LW2A 2X1AA 2B3TB 3WDOA 1JLCA 4HHJA 1PC4A 4BWJA 5DGAA 2DR8A 3AHPA 4IO9Q 4DL5A 2VOOA 4KO0B 2F8MA 5HLFB 4DFMA 2B43A 1Y00A 3IS9A 3MEGB 3OFHA 4ILMA 1MROA 4KC5A 4PG8A 3UW1A 5J2MB 4DL2A 3OXGA 2Z4PA 4DV0F 1Q53A 5GADI 1U7LA 3RW6A 2RVJA 1RWUA 1JLAA 2QRRA 5D4LA 1SKSA 3SCLE 1VRTB 1DJ0A 3CCZA 5C24A 1C1BB 2RU9A 1DTQB 3EUNA 1HR0F 2ZJPQ 4GMKA 4PPZA 3UD3P 2UXDF 3MMBB 1IBMF 2IFXA 1UVJA 3TW0A 2ILYA 2FDNA 3N28A 5GAEI 2JDJA 2BDPA 2F7VA 2QO3A 3OV7A 2LLZA 4AXJA 5D4PA 3OVBA 2AX0A 3W2VB 1M5KC 3H2VE 5D4OA 2ZD1A 3ZFVA 1KD1T 1IKXA 4MIBA 1X4FA 2COLA 5GAGU 3BEGB 1LFWA 2B9YA 4TLRA 1NJYA 1FJEB 4C8YA 3ONQA 4A47A 5A8KA 1R8CA 2DCUB 2VASA 1P6TA 1DQ9A 1KQSR 2MQMA 4Q5VA 3C46A 3P96A 1UAWA 2ZDPA 1APSA 4MIAA 3GV7B 1RYRA 4DR5F 3C6TB 4KJIA 3RRHA 2IVMA 4Y28C 5AXNA 4MKBA 3DOKA 4F4XA 3JTPA 4DEZA 1H38A 4LVOP 2ZE2B 1FESA 1X7VA 4WFBQ 3MCSA 5KFFA 5KG1A 3AQOA 2CVIA 2GQCA 2YKNB 5HI7A 2MQLA 1OQ3A 4BS2A 3MECA 1ZZFA 2E7XA 3B4MA 3FEXB 1NZAA 2HFZA 1AFJA 2VB6A 4UY85 1RTIB 2DNOA 3CD0A 4C3MA 2CPJA 5KOWA 2FTRA 4C2MA 5JVGQ 3UR0A 1Q86T 4C8KA 1R8HA 4NLGA 1WELA 3BN4A 2EFNA 5KFZA 4A8FA 3HK2A 1EP4A 3RB0A 1H2VZ 1XR5A 2PDAA 3PKMA 4DR2F 1R8BA 2JVOA 5D6GA 3LH2S 2ZH7A 2F1FA 1XBWA 1KHVA 2MQPA 2R2RA 3MEEA 5J1EA 3MD3A 1RT2A 2OIHA 2IVYA 2E5GA 4ZPBA 4AUKA 3V81A 1FRKA 1S6PB 3TP2A 4DSLA 3RAQA 2IBOA 1UA1A 3KLVA 5CYJA 4H4MB 1ZZNA 1A9NB 2NPFA 3KLGB 2FLNA 1L3VA 4YEAA 5C25B 2DNHA 3POTA 2PI5A 1HYSA 2W7OA 2FHKA 2MHNA 2MXYA 2CVEA 4ZCMA 1BQNA 1LOUA 2YKQA 3TAQA 4YDXA 4WFZA 1SXLA 2NUUG 4JI3F 3KMSA 3CF5Q 2GHWA 3AQPA 3KK2B 3HO1A 4FF4A 2QMXA 4N8OA 1U1OA 4KFBA 2JL9A 2UXBF 2IAJA 4YUDA 4IRKA 3MUMP 1M5HA 3M6WA 4PXEA 1RT6B 3DNCA 4Q2MA 4JI4F 3BJYA 4ZPVR 3BDEA 5T7LB 4DF8A 2RILA 1DZ5A 5HROB 2PIIA 3ITHA 4X65F 4CNYA 2NXUA 5BYQA 5CQGA 1N0VC 3ZZTA 4C8LA 3I31A 1TKXB 2QA1A 2GQ2A 4AL6A 4G1QB 5E0OA 3KLIA 3DLKA 5LT5A 3J7YU 3IBWA 4A8YA 3K8VA 2MYFA 1TKXA 4QWEA 1D9AA 1M5OC 2UVVA 2D74B 3CDWA 4CZCA 1QVFR 4JI7F 5LSOA 2K3KA 2B4VA 2K2PA 2Q6CA 1T94A 2HWTA 3CDBA 3IRWP 1N6QB 4DR6F 1UMJA 4IOAQ 2HPUA 1G1XA 4IG0B 5KOXA 5IS2A 2POKA 4I6WA 3TNVA 4YOEA 3VAIA 2VKRA 1K1QA 1YITS 1RT5A 4FN5A 2C2EA 3PW4A 2FVRA 3ISND 3BSOA 4MIWA 1DRZA 1FNMA 1R0AA 5C25A 2R7QA 2X51A 4FS2A 5KG0A 3IWXA 3DHWC 1TR0A 2H9ZA 2AP6A 2XNQA 3MMAA 3PRBA 1AXQA 2QA4G 4LFCF 4XPEA 5AE1A 4QIGA 1QSSA 1UWBB 5K9FA 3LAMA 4DV5F 1TVRB 2LQBA 2ADBA 2OSQA 2CQGA 4IH6A 2RKIA 2XWXA 2LQ9A 3AB4B 2RMLA 1G7CB 4LIWA 5E41A 4OZ0A 1VJWA 5BJRA 2XMTA 3H8YA 3O44A 4HH0A 1NK9A 2VFRA 4RW6A 3J81Y 2RF2B 2HYIB 1S1VB 2JX2A 3OXFA 2GQQA 2VG7A 4O4GA 1JJHA 4TYBA 1ZH5A 2C3OA 1FA0A 3PXGa 5GAHI 1X4GA 2FVSA 1S1WA 1LW2B 4OQJA 4DF4A 2DNLA 2RRNA 1DQAA 3T5JA 3RBDA 3W2WB 1V3RA 2DGOA 4NPOA 1FRXA 3OL8A 2CPFA 4OJGA 3JYTA 2O1PA 5EUHA 4YDDB 3PIOQ 4ZVFA 1MROB 3GILA 5KFRA 1KLMA 2HNYB 3JSRA 5KFCA 4Y0FA 3I6PA 2XG8A 3UQSA 1S6OA 2G4BA 2BQ3A 2IYIA 3BR8A 2ZKUA 1YVFA 3F56A 3LUYA 2ASJA 1U1KA 2E1MC 1VLYA 3OFEA 4LF6F 2ZH6A 2V8GA 3RR7A 5E3QA 2MSTA 3KJVB 1DHMA 1X4CA 4LSLB 3VAKA 1VQPS 1N5VA 2CQDA 3MAQA 1M5PC 1CC8A 2DHXA 3ENQA 1ZOTA 3DOMA 2VUGA 4C3KA 4KO0A 3FJ2A 3MM6A 3THTA 1S1WB 3DI6A 1RTJB 2Z0GA 5LSLA 2V9WA 4OJHA 2P6SA 5KFWA 2XMMA 3CD7A 2AF6A 2ZUGA 1LWEB 2BZ2A 4MYTA 4ECZA 2KFNA 2DBBA 1WF0A 1Y3KA 1HMVA 4L72B 2ZH4A 4ED5A 2RE1A 3H5SA 1V9OA 2F8EX 3LP0B 4ZDNA 5A8KB 1N5YB 2ATLA 2KXHA 1N54B 2PSZA 4CO5A 4ERDA 1X4EA 1SJ3P 3TRGA 1SC6A 3T5KA 1JWWA 2AGOA 2DNYA 2HQIA 2EK1A 1UJ6A 3SDEA 1BGXT 3OPKA 1XERA 2HRYA 3G8SA 4O3NA 2DPJA 3HHKA 2KTQA 2VODA 2VPZB 1LWCA 2R8IA 3ZZZA 4U7CA 1VQSA 2I8EA 2MZSA 2PE8A 4C8NA 5DG9A 4AYBD 2LQ5A 2HMIA 1HNZF 1IKYB 3HHLC 3DU5A 3MZIA 2DK2A 5KFUA 3BO3A 2ERRA 2BR0A 5CYMA 2F4VF 1G2EA 4RW7A 1YJRA 3CCMS 4O44B 2AW0A 4F25A 4B9TA 3KG0A 3G9CA 2XBPA 4OX7A 2F9DA 2GFFA 4B02A 3E2EA 3BO2A 4N47A 1K0TA 4Y65A 3MMCB 5L9XA 4IDKB 4WXOA 1KSPA 2CJAA 5F9LA 4UUWA 5B0EA 3L7PA 3MM7B 3CD6S 5ADZA 3DYAA 4UW2A 3SCIE 3U7JA 5AXLA 3Q24A 2FJWA 4MK8A 3D1OA 2VL1A 3CJ4A 3T5LA 1OPIA 1NO8A 2DTJA 3MM7A 5M2RA 5SUHA 3IGVA 5LMNF 2AGQA 1SL2A 2A2CA 2FLLA 5KFMA 3D28A 3OSNA 1S77D 4R8UB 4OX9F 1FEHA 2GCFA 1S10A 3HHNB 3PFEA 1N5SA 1R7IA 3FRZA 1FTCA 3M6XA 1RTDA 4ES2A 1XNQF 2GGPB 3RYLA 5CYMB 3CGIA 1SL1A 2ROEA 3NBPA 3SQGB 5HMYA 4LF9F 1HPZA 4Y2KA 5HP1B 2MGZB 1BLUA 2RB7A 4PG6A 3BQ1A 3MEEB 3PEJA