4WFNQ

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfnQ00
1U1PA 2MHNA 2J8AA 2XS2A 2CPFA 5IM0B 1YJWS 3CPWR 3NNHA 4IOAQ 1KOHA 4WKRA 2CQPA 4RU2A 2EVZA 4LMZA 1PGZA 3OW2R 3JB9k 3VF0B 5IQQA 2CQ1A 1AUDA 4OZ1A 2CPHA 2CQ2A 4P6QA 4PKDB 3G8TA 3CCRS 2DHGA 2F9DA 4J5OA 3UD3P 2X1BA 5GAHU 2N82B 2QA4S 1WHXA 3EGNA 2CQCA 2LA4A 5MLCV 1QM9A 3IWNC 1NJIT 3G4SS 1X4CA 3SDEA 2CQHA 2M4MA 4V19X 2PEHA 3CCUS 1K9MT 1ZH5A 4PRFA 5DDPC 1WI6A 1Q86T 2MQOA 3BO2A 1VC6A 3CUNA 3MD1A 1D8ZA 5JVHQ 3CMES 1M5KC 1D9AA 1NO8A 2DNZA 3ZZYA 3RW7A 3UCGA 1RK8A 2AYEA 5DDQC 1YHQS 4YOEA 3HHNB 3U1LA 2LECA 1X4FA 4IUFA 2DHXA 2Q79A 2U1AA 5LSLA 1HL6A 1YITS 3CTRA 5DM6Q 3IRWP 2HZCA 2QFJA 3MD3A 3K0JA 3VAFA 2MZQA 5IM0A 1M90T 1DHMA 2N3LA 4W92B 3R1HA 5GAGU 2CQ3A 5JVGQ 3UCUP 2OSQA 2DNKA 2YWKA 1X4EA 1HD1A 3G71S 3TP2A 2KXFA 2MPUA 2DNPA 1M5OC 3NNCA 4FXVA 3BO3A 1X4BA 1YJNS 1VQKS 2RNEA 2MMYA 2MYFA 2FHOB 2K8GA 2M7SA 3MDFA 2OJ3A 3I55S 4TU9A 2LA6A 5ITHA 1PO6A 1UW4A 2LEAA 2X1GA 3EGZA 2MSSA 2I38A 1VBXA 2J0QD 2MKIA 3BO4A 4W90B 1IQTA 1WHYA 3CCVS 1FT8A 1WHWA 4WFBQ 2E5JA 2ERRA 1VQ8S 1WWHA 4WIIA 2F9JA 2ZJRQ 3S8SA 3G8SA 2MY8A 4UQTA 2DGXA 2RT3A 1HA1A 3CCQS 2DNNA 1S72S 2GHPA 2MQNA 2DNQA 2YH1A 2KVIA 4WFNQ 1JJHA 2E44A 2F3JA 1XN9A 3CCLS 4OZ0A 4U67Q 2CPIA 2KRBA 5LXYA 5LJ3Y 1O0PA 2MKCA 3J7YU 2JVRA 3MUVP 1VQ7S 1U1OA 1FO1A 2RS8A 1FJ7A 4F26A 5LJ5Y 2SXLA 5GMKa 3B4MA 4YUDA 3MUMP 4F02A 3CCMS 2HYIB 2ZJQQ 1VQ5S 1SJ3P 4WF9Q 2KG1A 1H2VZ 1Q82T 2CPZA 1KD1T 5FJ4A 2BOPA 1VC5A 3R27A 3LQVA 2X1AA 2M70A 3D2WA 2XNRA 2CQDA 1VQNS 1R8HA 1WELA 3EX7B 2DK2A 3S6EA 2RS2A 2DH7A 2M8HA 2DNOA 2G0CA 3I56S 2VOOA 3BEGB 3B4DA 3H2UB 1G2EA 1WG4A 2MY7A 1L3KA 2A3JA 2DGUA 2EK6A 4LJMA 2XS7A 4A8XA 1WF2A 2MQQA 3MUTP 2JRSA 1WTBA 4QQBA 2CPXA 1RKJA 1SXLA 2RU3A 4IO9Q 2E5GA 2RRBA 4CQ1A 1KQSR 2EK1A 2MQMA 1WEZA 3NNAA 2VOPA 2DITA 2DHSA 3PIOQ 2CPYA 1VQOS 2UP1A 3CMAS 1WHVA 4Z2XA 3CCES 2DGOA 1FHTA 2DHAA 1U1QA 3RW6A 1SJ4P 1QVGR 1OO0B 1KOOA 2I2YA 1A9NB 2KI2A 1M5PC 3MURP 1U1NA 4C7QA 2DNLA 3MXHP 2MKKA 1R8PA 1X5SA 2G1DA 1URNA 2M52A 3HI9A 5CA5A 2KT5A 3UCZP 2HVZA 3TO8A 2MQLA 3UWTA 1U1RA 4CIOA 2D9PA 4ED5A 1U6FA 3V4MA 1KC8T 2NZ4A 2FC8A 2U2FA 2DIUA 2RUGA 1YJ9S 1H2UX 2MGZB 1N54B 2RVJA 3US5A 2KXNB 4FXWA 3DXBA 3VAMA 2VODA 2CQGA 3SXLA 5HL7Q 2O3DA 4TU8A 5D77A 2CQIA 3CCSS 2MKJA 2JVOA 2YKAA 3BS9A 2XS5A 2MKSA 2CQ0A 2OIHA 2MZRA 1Q7YT 5DM7Q 3CC4S 2KRRA 3NMRA 5GAEU 5D78A 3SMZA 2KH9A 1M5VC 1DBDA 3THTA 1VC0A 1F9FA 3CF5Q 1H6KX 2G4BA 3MI7X 1CVJA 2DNGA 2LMIA 4C0OC 5CXTA 3CC7S 2CPDA 5IFMA 1WEXA 2DH9A 1VQLS 3R1LA 2LEBA 2MJUA 2DO0A 2JWNA 3SDEB 1WI8A 1X5OA 4ZKAA 3MOJB 5GADU 2M0GB 2XNQA 2ADCA 3G9CA 2CPEA 2N7CA 1BY9A 1A7GE 4CH0S 3G6ES 2GO9A 2V94A 2KN4A 2XB2D 2L08A 3PIPQ 2MGZA 2KM8C 4IOCQ 2FC9A 4CH1A 4WFAQ 1YWXA 1FJEB 1X5TA 4QPTA 2LQ5A 4TLQA 1SJFA 2CQ4A 1S79A 2AYMA 2LXIA 2OTLS 2MJNA 1UFWA 3LPYA 3VAGA 2HGMA 5LXRA 2LKZA 3CULA 3NS6A 2DIVA 4TU7A 3J7ZT 2RQCA 3CD6S 2QEXS 1Q81T 2MB0B 1X4AA 1B7FA 1UP1A 1YI2S 2XSFA 2J0SD 1WF1A 5BJRA 1OPIA 4Y00A 3U1MA 1VBZA 1WG5A 3N9UC 4LIRA 2DO4A 5EN1A 1JJ2R 3S7RA 3UE2A 2KFYA 1P1TA 3VAJA 2HGLA 2HGNA 2RQ4A 2MKHA 5H1SV 2MSTA 1JMTA 3THPA 3UD4P 1W2BR 1M1KT 1K73T 2FY1A 2YH0A 1JJ4A 1FNXH 1X4GA 2LYVA 1QVFR 1VQ6S 2MZTA 4F25A 1UAWA 2WBRA 4YB1P 2J76E 2AD9A 1N52B 2DGVA 5GVQA 1U1LA 4QU7A 2K3KA 3CXCR 2MQPA 1HD0A 2DNYA 2DB1A 2MZ1A 2LCWA 1SJQA 2MZJA 2OTJS 1ZZNA 1X4HA 3CCJS 1X0FA 3Q2TC 1OWXA 3VALA 2D9OA 3P3DA 3P5TL 3VAHA 2M88A 1VQ9S 1P27B 2E5IA 2DH8A 1FJCA 3VAKA 3P49B 2KXHA 1YIJS 2DGWA 3H2VE 2X1FA 2AYBA 1NU4A 2DISA 2M2BA 5DDOC 1N8RT 1WF0A 1U1KA 4PR6A 2VONA 4Y0FA 1WG1A 2KU7A 2DGQA 4UY8T 3Q2SC 3NS5A 3G96A 3P6YC 2AYGA 2OSRA 1YTYA 2CPJA 1VQPS 2ADBA 3L3CA 4BS2A 2KG0A 2D3OR 2PE8A 4EGLA 1U1MA 1OIAA 2LXUA 2L41A 3DLLQ 2N3OA 1ZZFA 5DETA 5CYJA 1U6BA 2FPHX 2KYXA 2DNRA 2CQBA 2BZ2A 1N88A 2NLWA 4C4WA 3FEYB 1H2TZ 5DDRC 3VAIA 3ULHA 4M5DB 2JX2A 1VQ4S 2DNMA 1X4DA 2L9WA 2MZSA 1U2FA 3ZZZA 3S01A 2KHCA 2YTCA 1DRZA 1X5PA 2KM8B 1VBYA 4QU6A 3CC2S 4ERDA 1SJRA 2DGTA 2RRAA 2M8DB 2M9KA 1K8AT 2CJKA 2ZJPQ 1DZ5A 3TYTA 1VQMS 2DNHA 2E5HA 2MXYA 4WCEQ 2B0GA 2DGSA 5HO4A 5LSOA 3FEXB 1FXLA 1WEYA
chains in the Genus database with same CATH superfamily
2HKEA 1MROA 1RBLA 3JTPA 4ETXA 3M30B 1SJ1A 1YG0A 3BKUA 3CCRS 2Q3PA 1WD6A 2F9DA 1RWUA 3KUEA 3KNGA 1VDHA 1HW8A 3DCAA 4NLXA 1QM9A 3POTA 2BJ1A 4ID5B 1RBAA 3BO2A 1UA1A 4LF6J 5KFVA 3WIVA 3HJVA 2VFSA 4AQYF 3UCGA 1XMBA 2F7VA 4C97A 3QZ8A 2XMVA 3C46A 4ZVUB 4WWSA 2IAJB 4NXMJ 4P75A 3ICLA 5FLXY 1DHMA 2N3LA 1ZM3A 3RB3A 1GXTA 1VR6A 3LP1A 2R4FA 3K59A 3QSIA 1BXNA 4KO0B 2D1CA 3VGVA 5KFWA 1WNEA 4P71A 5E7OB 3J80U 1VI7A 2B9WA 3BR8A 2MSSA 2I38A 4U7UD 2OPRB 4NCGB 1WHWA 1HNVB 5D3GB 1N34F 2ZH6A 1CJKA 1ZTWA 1C1BB 5KG1A 4UQTA 2DNNA 5EX3A 3GSDA 3KWMA 3O44A 3FSIA 3TX0A 3CCLS 2ZH2A 4ZP8A 3QIPA 1O0PA 3O6QA 5KFMA 5F8GA 1VISA 4YMEA 3UD5A 4AL7A 1J5EF 1KHWA 4J9KA 4X84A 1RT3B 2VFUA 2JHEA 3GPAA 5C42B 3RR7A 2UXCF 1OQ3A 2F65A 3LQVA 2A2DA 4ZP7A 2DK2A 4K4WA 1RE1B 2DCLA 4AYBD 4DSKA 1FK9B 3NCPA 2OPQA 4O3NA 3RRGA 5CABA 1LK7A 3MUTP 4FYVB 5E0OA 3K5PA 1YVFA 1CBKA 1WDDA 3FRYA 4YR3A 4PG5A 4A8FA 4IKAA 4WP8A 3W1YC 3KG1A 2HQFA 5H9FK 1KEKA 2D74B 4WKYA 4Y6IA 1SC4B 2DPIA 3FFIB 4FKXA 2OEMA 3HP6A 5J2QB 4C7QA 2MKKA 2BMBA 4KE5A 3MECB 4JI6F 5A0YB 1UWBA 1U1RA 1M1GA 2AX1A 1IKWA 1KC8T 2XY7A 3GB0A 4NXNJ 2GGPA 2Y1JA 4HHJA 1KFDA 2O5DA 3RBEA 2AF6A 3IAS9 3KHGA 4LRBA 2YWHA 3G82A 2NUUG 2NXEA 2V8HA 2AU0A 3OR2A 1WOOA 1RTDA 1VC0A 2NQPA 1BE4A 4IDKB 3QRQA 2H9ZA 3HKWA 4C0OC 3ENQA 3J7AN 4M5IA 1ZAWA 3F41A 4I7FB 2JLEA 5LMNJ 4ED1A 4WFZA 1FJGJ 3SV4A 4KAIA 1TVRA 1KNZA 2BV3A 2HAFA 2MGZA 4J9PA 1S7HA 4CLWA 3IN5A 4CH1A 1CJUA 3ONQA 1YWXA 2YNHB 3O2IA 2OTLS 2O66A 3BKTA 2HGMA 2VZ9A 2EFNA 2ZKTA 3HHLD 2XO6A 2VKZG 1NPPA 1SIZA 1E6YB 2DO4A 4O3RA 2HGLA 1XWLA 5ETPA 2FJVA 2MTLA 5DLGA 3A12A 4FZVA 2J7UA 2WBRA 5K5MA 3DLBA 1N5YA 1HBMA 1VBKA 4H4OB 2YNFA 4ED4A 5FD1A 3DOMB 1HBNB 5SZTA 2AJQA 1FJCA 2VQEJ 2W2OP 4OV6A 3G86A 1NU4A 2XHCA 5DDOC 4EU0A 2XG8A 4UY8T 1MU2A 1R6YA 4PEOA 1H72C 2VQFF 1T9VA 1CJTB 1J5OB 2ZITA 4GVLA 3BR9A 5CYJA 2ZZTA 4HACA 2X3DA 4B3MJ 3G8QA 2A10A 3A3NB 2NXNA 3DKDA 1H2TZ 1CULB 1OSCA 1S4EA 3BBCA 2A6OA 4IFYB 5MAOA 3DLKB 3LOUA 4UOFA 1MSWD 3DLGB 4KGMA 1X9MA 3ITHB 3TYTA 3CIMA 4A8SA 1IVZA 5HO4A 3QGHA 2HHPA 2YY3A 4GC7A 3CPWR 3ETMA 1FXRA 2C2RA 1CG2A 2OPPB 3ILLA 4KKOB 3BB5A 4WZQA 4C98A 3KDOA 3LGMA 1XK8A 5KTQA 3K5NA 1TL5A 2RILA 3WIUA 2QA4S 2LA4A 4NRUA 2V8VA 1UJ4A 3HHKA 4DR4J 4CZCA 3VR1A 2XYGB 2MLYA 2JJ4D 1N33J 1JKHB 3HZGA 3JAMU 3SCIE 1FRKA 1HPZB 1VFJA 1X4FA 2ZM6J 3T19A 2H4YB 3SBMA 2BACA 2FVSA 4RW8A 5H9EK 3MM8B 4ZVGA 1D09B 3QNWB 4DV1F 3BO3A 3FVYA 4ZCKA 2GJFA 4YP3A 3Q8PB 1UJ6A 5HJYA 1JXEA 1VHIA 2D69A 4KHRA 5ITHA 4WJBA 1SI9A 4OJ3A 1I3OB 2RSQA 2NXUA 1FT8A 1REVB 3T5JA 4B02A 1S72S 2GX8A 4WFNQ 1EJ7L 1FDDA 3KKFA 4NMLA 4PABA 3FBFA 1C0UB 3IMQJ 3NGRA 4HTIA 1VQ5S 1HR0J 2BKOA 4PCQA 2GIRA 3E01B 4QIWD 3UN5A 3AFGA 4LF8F 2FIUA 2UUBJ 1S7IA 4YHHJ 3EX7B 5HROA 1JLFB 1XNRJ 2E1RA 4NLOA 3I56S 1ZPWX 4CNZA 3AOCA 4YS2A 4KTQA 1WTBA 4YDXA 1VQSA 2XWXA 2KFZA 2RU3A 3FJ2A 2RRBA 2EK1A 1WEZA 3M4XA 3PTWA 2WW8A 4YB7A 4USMA 3OHBA 3KK2B 1BGXT 4X4SA 3CMAS 2GAGC 2YKMB 1TZ0A 4OIXA 1P9QC 2R8HA 4Y28C 1PKUA 1R8PA 1FKAF 2QYGA 4CO5A 4DN9A 5BR8J 3V4MA 1SBRA 2KB2A 2KXNB 1SUQB 2CAJA 5IT4A 2GMLA 2JEGA 4YB6A 4DV2F 5KT2A 2YKOA 2R7RA 3H90A 2KH9A 3ILOA 5A6PA 4OL8A 1H6KX 2XMAA 4ENOA 5T14A 5F8LA 2DNGA 4ZCLA 2ALYB 4OHXA 3KLGA 3ZNUA 3EMTA 3QWPA 3SDEB 3DYAA 2AW0A 4ANCA 2V8DA 2OP5A 1U0HA 3LALA 3M05A 4Y65A 2R3VA 3R5JB 3G6ES 3CJ3A 1YDLA 4I6WA 2OELA 4IRDA 4DEZA 4DSLA 4LT6A 5LXRA 3CULA 1Q1KA 3AJDA 4WP9A 2Y0BB 2ZC4A 2QC3A 3GP9A 2CA9A 1Y5NB 3PX4A 2D3O1 2IVYA 4MJKA 2KFYA 2QFIA 1UETA 5B09A 3UD4P 1H3DA 1H7WA 3DRSA 3MMCA 2D7SA 1YJRA 4YB1P 1KLMB 3H4BA 2O1PA 1U1LA 4DF4A 1FD8A 2K3KA 3CXCR 2W01A 3DLHA 4TYBA 2DNYA 4I4BA 4JB8B 2HIQA 2E5IA 2YKQA 3P49B 2GFFA 1MW7A 4DI6A 4E98A 3H2VE 2L9DA 1NPRA 3QWUA 1WG1A 1Q8KA 1EX8A 1SC6A 2OSRA 5KG2A 4AFFA 1VQPS 3L09A 3M6VA 2V67A 3PJWA 3QT5A 2PFFB 3FZBA 4R25A 2HBZB 4O0IA 2BRLA 2KYXA 2ZHOA 3TUZC 3JQMA 5BYQA 3MEGA 4QW8A 3NWRA 3R6LB 1HNZJ 2DRDA 2FY8A 1S6UA 4RUBA 4QU6A 3M2RB 1S12A 1NK9A 4PYDA 4DPUA 4DFPA 3MEKA 4QIEA 2EKYA 4LR9A 4CYUB 1UVIA 1F5CA 3TJ8A 5ETTA 2XS2A 5IM0B 2B4OA 4M5GA 4C8ZA 4P73A 1U09A 4U6PA 3OSPA 3JB9k 4C8MA 9RUBA 3Q22A 3OFEA 3TA1A 2HHHJ 1U24A 4P6QA 3G8TA 4MIWA 2DHGA 1NEEA 4YR0A 3IAM9 4KH1B 4LF5J 4DPYA 2CQCA 1Q5YA 1J27A 3IWNC 2ZBRA 4K4TA 1S1UA 2M4MA 4RLEA 2M5YA 1D9AA 5K8PA 1KTVA 3DDIA 2HMIB 2F4VF 2VHGA 3TAMA 2ABYA 3NBPA 2CADA 2Z2YB 4C0HA 2U1AA 3H7HB 1TL3A 1KRPA 5CZXA 4DPWA 1ICEB 4DQIA 2HFVA 4F3QA 3Q8SB 4NYPA 4DSIA 2EKNA 4K4UA 2HQGA 2MPUA 3IO1A 3RAQA 5HQ8A 1M5OC 3KLHA 4ED3A 1UFLA 1NHUA 4NLDA 3I0SA 1P6TA 1BC6A 1WTFA 2V8GA 3AD9C 2J8SA 3QLHB 4K50A 4RBVA 3GTYX 3BF4A 3KJFB 2ERRA 3M9OB 4LF2A 4DX5A 2R7WA 4GMKA 1XN9A 5ETKA 2PSZA 3UN2A 2BW7A 3SFGA 1S6QA 1W7WA 3I9V9 2CJAA 3DU5A 1KN6A 3GZ7A 4YN3B 3MPYA 3CCMS 1RT7B 4RNFA 4FBTA 3DNCA 4CT8A 3GE9A 1LKZA 1KD1T 1DURA 4UTGA 3I32A 3SEOA 1VRUB 4I2QB 3KK3B 2UVVA 2G0CA 2DRAA 4ZMMA 1G4CA 2MQQA 3DOKB 4B9UA 2HRUA 4NCAA 3PEHA 4KPCA 1CJVB 1T94A 1RT5A 4IO9Q 3HFKA 1S1TA 2RE1A 2XMWA 1TK5A 1T02A 1TV6B 5E2QA 3BM7A 3AODA 2I9SA 3GLJA 3MCSA 1OO0B 4DR2J 1FTRA 4F8RA 2MLXA 2BOAA 3MURP 2COLA 4I64A 1RHMB 2C3OA 4FYYB 1F60B 1VS3A 1JK9B 1VQYA 4ED5A 4A8YA 3CVKA 4DSJA 3T5LA 1U7LA 4CM2A 3CDUA 4BBYA 1Y3KA 2O3DA 5DQIA 5D77A 3K2YA 2YKAA 2XS5A 4U9RA 1X8DA 3DDNA 5IZHA 2VDHA 1OY6A 5J1PA 4IYQA 3FK4A 2OH2A 3GCWP 1B0TA 3GFHA 2CNLB 4LVOP 1WEXA 3VTIA 3R1LA 4H4MB 2RUSA 4P7TA 4WXOA 2HURA 2IY5B 3GJQB 3G9CA 2CPEA 3OTBA 2KJVA 4WP3A 5HQLA 1R8BA 2V94A 2XB2D 2L08A 3PIPQ 4ECVA 4M94A 4NLRA 1TKDA 1VHFA 2XYHB 4NL5A 5B0AA 5H9FJ 4QR0A 4IG3B 2AZ3A 1UL3A 2MB0B 3OXGA 4NYOA 1BWEA 1LWCB 5D4LA 1Q53A 2L3MA 3T41A 2Z58B 5EN1A 3IWLA 1JLGA 2RQ4A 3FQLA 1JMTA 2E5LJ 2R42A 1OSDA 2XQCA 1K73T 2FY1A 5DZ6A 3BDPA 1KVJA 5GVQA 4DR7J 4RW6B 4QJVA 1FCAA 1B64A 1N0VC 1WOSA 2VPZB 2AYBA 4GKJF 2Q66A 3W5ZA 4I68A 1L3TA 3Q2SC 3NOCA 2LQ8A 1FXDA 1UPPA 2VV5A 3PW7A 1MN7A 1IBKF 2FB0A 2C3PA 1HWKA 3GR0A 1BQNB 4AL5A 4JI0F 4J90A 4KGVB 2QSFA 4CLSA 1N5VA 1R27B 3J81U 1K1QA 4U95A 2CG4A 1IN0A 1NKCA 5C5JA 2HHVA 2X51A 2QG9B 4LFCF 2DNMA 3UVJA 5KOXA 4PG7A 4UOCA 1H7XA 4WCEQ 2NCKL 1RTJA 1RUSA 3I4PA 3C2PA 3D67A 5I3QA 1NHVA 2WBMA 4IOAQ 4TN2A 2YBVA 3K17A 5A8RB 3OPKA 2VIHA 4PXEA 1URRA 3TA2A 1Y00A 2K2PA 2QL7B 5D4NA 3MEEB 4K4SA 4C3MA 5HLFB 2ZNZA 3LGHA 1F0XA 5GAHU 2FUG9 4HI1A 4ZCMA 3BDEA 3M2UB 3BBFA 4NEZA 4V19X 2R7QA 2R7OA 3E2EA 4ZLLA 3AB2B 3SV3A 2QA4G 3OLBA 2OFHX 1N5TA 3HDSA 1RTHA 1R0CB 2BX6A 1S9GB 2W4PA 2LECA 2PMHA 4G1IA 4R8UA 3VZIA 4JI4J 3K0JA 5KFZA 4WBFA 3VHQA 2BBEA 5GAGU 3C15B 5KFJA 3MR6A 3T6JA 5IV4A 1LV5A 2HLUA 4NCBA 3U27A 3ZZRA 1QTMA 3UN3A 3T1HJ 3AOBA 2MMYA 2M7SA 4JI8F 3ZTPA 5AXMA 3H5YA 2H5IB 4JBCA 5HP1A 2FD2A 2Y1RI 3MZIA 1EETA 1VBXA 4RUAA 1RQ0A 3AAWB 4LF9J 3QJPA 3GFYA 1WWHA 2C2ZB 3HKZD 2GHPA 2WW4A 4U67Q 2W9BA 5E33A 2KKHA 1EQ0A 1FWKA 1ZPVA 3RBZA 3J7YU 1KQGB 3MTJA 4L74A 1TL4A 3IS9B 5HVHA 3KNAA 4WF9Q 2OGUA 1L3VA 2WONA 3M6WA 3E51A 1P1LA 3R27A 3I82A 4RW4A 2MDAA 3U02A 3FQKA 3DI6B 2A3JA 1UCNA 1NSAA 3VVTA 2VKRA 4M5DA 4KQZA 1T03B 5KAKA 5KT7A 2XEXA 4DV5J 4C8KA 4RKUC 3ZNJ1 2UXBF 2HFNA 3F0NA 2UUTA 3EZ5A 1OS5A 2R2TA 3C16A 4GVBA 1IJFB 2RH3A 1RLDA 1H0HB 2P6TA 1D9DA 2G1HA 1IBLF 4MYTA 1AROP 2EWHA 4M5NA 3R8YA 3CJ8A 4A8WA 4JI1J 3W63A 2XHWA 5HBMB 1S0NA 4LF4J 4CIOA 2FC8A 3CDWA 5B0CA 4R5PA 4IG0B 4OZJA 3A8JA 5DM7Q 3WZ0A 2J0WA 3CIZA 3NMRA 3PXGa 4HT7A 3GU0A 1HARA 4ZCIA 3SYZA 4QW9A 4A8KA 3FUYA 4LF7J 3FMWA 1T11A 5A8KB 2LEBA 2ZOMA 1Y5IB 4JYAF 3D6HB 3I0RA 5F8NA 4DR5F 4N76A 4ZHRA 1BY9A 3H20A 2J7WA 4F50A 5E41A 3MMJA 5F9LA 1R31A 2VBXA 4YY3J 1X5TA 2NXJA 4TLQA 4YB5A 5IT9Y 2B56A 5GADI 3HHLA 4RW7A 1NJXA 2GJIA 2WB1D 3TZYA 2UVUA 3D6TB 3RB0A 2D3ZA 4DHVA 1ITPA 4ZPBA 4R0JA 3MCNA 3THPA 2HNDB 4QR1A 5EX0A 1RWOB 4OZ5A 1VQ6S 2DTJA 2MZTA 4QWAA 4FS2A 4LUBA 1N52B 1RZMA 4LQ9A 5FDLB 1JJCB 2Z30B 1REGX 2DB1A 3C14B 1RLCL 5C25B 3CWJA 3CB4A 1PJ5A 2CJBA 3P5TL 3VAHA 4ZOSA 4CTAB 4DN0A 1SKSA 4EBEA 3OJUA 1DTTA 1FFWB 2KU7A 4EI2A 4YR2A 4DOZA 1IR0A 3ZZTA 3RR8A 1R0AB 2AV5A 1RU1A 3MPWA 3PCOB 2HVHA 1DTQA 3KLIB 2NLWA 5HMYA 1RT1B 4AL6A 2QLBB 5KT3A 3TEGA 2V4JB 1RACB 3QYYA 1SJRA 3MEDA 1YX2A 3U7JA 4Q2LA 4K59A 1FXLA 2BW2A 1QUPA 1FX2A 2BJ8A 1U1PA 4P2XA 2FLNA 3RAMA 1YJWS 1X9SA 3NNHA 1TP7A 1VLOA 4J9LA 2HHUA 5F0UA 3VF0B 3JSYA 3M7VA 2KT2A 4IR1A 2K1RB 4V1Ak 5F8MA 5T7LA 5K14B 4K2XA 3MMAB 4J5OA 3MPUB 1TR0A 3S1TA 4DSEA 3OVSA 3MM7A 4NOHA 1N6QA 2QMWA 1F3VA 3IC1A 1HYSA 1TMJA 5DDPC 4TXSA 1LW2B 4B3RJ 1HIYA 2AKWB 3MD1A 1JLQB 2P8IA 1GAOA 3GIMA 1T05B 1U2CA 3RRKA 3WHIA 1PYOB 3CTRA 3IRWP 3R7BB 2CJYB 1VLYA 3B8HA 1Q8IA 4L3NA 4B9NA 2BQUA 4QYZJ 3NGKA 2BABA 1VCTA 2RDDA 1OMSA 1S76D 4Q0BA 4XK8C 1NLKL 1XMOJ 2ZUGA 1HQ2A 1WC1A 1QAYA 2FHOB 5BXIA 2C42A 3EICA 3QBCA 4HH0A 4NI2A 2Y1IA 3RUBL 4K7QA 1TFWA 2ZJRQ 3HHEA 2QJ3A 3SSRA 2E44A 4OX9F 1CLFA 2UUCJ 2MEWA 5DQHA 3IGNA 1LEOA 3BSOA 2YXLA 1UEVA 5GMKa 4YUDA 4F02A 4WU2A 5I42A 2ZOFA 2VG7B 2RKIB 2VBYA 3KFWX 1JLBA 1C1CB 1XBWA 1RWNB 3R5GA 4DV0F 2UXDJ 2E5LF 2X1AA 3VGUA 1S6PA 1E6VB 2WB4A 5C2GA 4S0MA 5LL6d 2VD3A 1U49A 2C3YA 2V9KA 2XS7A 1HNIA 4CT9A 2IRXA 3Q8YA 1WORA 4KFBB 4DXLA 1NXIA 2ZOGA 5K8MA 3N4WA 3RAXA 4CQ1A 1NZ8A 3VQSA 3KYLA 3CJ0A 2LXFA 2CPYA 4FPRA 1VQOS 5ETOA 3DRXA 4GO5X 3EYZA 3QSYB 3WDOA 1GEHA 1HLWA 1U48A 2KI2A 3M30A 4BC9A 5IXUA 2DNLA 2HS3A 1NDKA 1SIWB 2KT5A 2OKQA 2Z2LA 3HVTB 3KLEA 2NZ4A 2DIUA 1YJ9S 1R3NA 2RVJA 2NYIA 1FKOB 2BKNA 5L9XA 5GAEU 1JNRB 3IR5B 3VVUA 4M95A 1V5IB 3THTA 2G4BA 2A0FB 1XNQF 2HVIA 5DLFA 2DH9A 3PRDA 5JMNA 1MNEA 2O67A 2V4QA 2B43A 3UQSA 2WZ1A 1CC7A 1GNKA 3DOLB 3EGWB 4NLYA 2H51B 2KM8C 3I4HX 1H73A 1GXUA 2XI3A 3CJSA 1NRKA 3OJSA 3PX0A 4RW9B 4NCGA 3NS6A 4G65A 4OYZA 3Q0AA 3NGSA 3JSRA 4Y00A 3NL0A 2EEYA 4O44B 1N4LA 2HQIA 2VUGA 1JQGA 1KVKA 4TNOA 4LREA 4ZJLA 1JLCB 3TX8A 1LNQA 3GYGA 2AP6A 2IYIA 2MQPA 1RT3A 3BN4A 5C42A 5ADZA 3VALA 3BREA 3P3DA 2PIIA 3CCTA 1N32J 2DGWA 5E3QA 1GTEA 3LP2B 3K57A 4RNNA 5DG7A 2H48B 2CPJA 3LH2S 2H1YA 4F67A 3QT6A 3PKMA 2HZVA 1NK5A 4ZVHA 2VA3A 2W2QP 2OHDA 2EG2A 4KH0B 3FFIA 2W2MP 2HVEA 3ZXWA 4OI2A 4DFJA 4I6YA 4KY3A 3POTB 3ULHA 2HFUA 3R3TA 2MZSA 1X4DA 2OPSA 3TQEA 5J2QA 1U2FA 4DPXA 3MECA 5B08A 4M1KA 3WX4A 1VQMS 3K5MA 2H5EA 3SSSA 3GYNA 1DLOB 1FRXA 1LOUA 3GIJA 4HDGA 4WKRA 3D5MA 3R5CA 4OYAA 3TJ9A 2LQJA 3LA0A 4NLPA 3ZTQA 6FD1A 1OYDA 1CSJA 2HNYB 4I7FA 3GFZA 1ZH5A 3KMSA 2C2NA 3KMQA 4DV7J 4KPYA 1CJKB 2AJ1A 3VZHA 1YHQS 2G0IA 2PFDA 4CRJA 1RB0A 4HDHA 1HL6A 3C6TA 4B3TJ 3MD3A 4LFAJ 3QIPB 3FBBA 3B54A 3LW5C 1N36F 2R8IA 1HD1A 2DNPA 4DCOB 1RISA 2VPWB 1OPZA 1HHTP 1FRLA 1E6YA 4JI2F 4HHUA 3DRPA 2MHEA 5IT0A 3AJ1A 4F0MA 4X66J 2VJUA 1XMQJ 1UW9A 4KB7A 4LSNB 1IQTA 1K47A 1WHYA 1ZM2A 3W2WB 1VQ8S 4KHPF 3KHRA 2DGXA 5CYMA 4N56A 3OL7A 4H4OA 1TL7B 5IOLA 3DOMA 2C28A 1HBNA 3OLAA 2CPIA 4KGKA 4ZPAA 3MUVP 3BQ0A 2RS8A 2DXFA 4DUZJ 1O5JA 5A8WB 4ZVFA 2P5VA 2ZJQQ 4H4KC 4DV3F 5DGBA 4DR3J 1CJTA 4L76A 5E3CA 1VC5A 1I94J 4GO7X 2CQDA 1UWBB 1IKWB 1PAEX 2B8QA 1EQMA 2DNOA 3AA9A 4ANDA 3VQTA 3UPFA 5KG6A 3BH7B 3H2UB 4DV4F 2CDQA 1CULA 2RHSB 5F41A 4O4RA 5E3RA 2BJEA 3SQGA 2VPYB 3DLKA 1IBMJ 3OSNA 3DLGA 4WFXA 2E5GA 1QY7A 5KFLA 6FDRA 1NJWA 4USHA 4A48A 1PBAA 2UP1A 4MTPA 2VG5A 4CO1A 2V69A 2OPPA 1PILA 3Q23A 4KKOA 4IH6A 3NY0A 1RT6B 1RCOB 4IFVA 2OO4A 3HPOA 3UCZP 1NJYA 1TMMA 3CSKA 3LTOA 3JQKA 1TVRB 1U6FA 3LGNA 4K0KF 4JOUA 2ZC3A 2MGZB 2DPJA 3VCDA 2RAQA 1CJUB 1EB0A 2B5JB 2FVCA 3TR5A 2MKSA 4JI3F 2VASA 4MK8A 2KRRA 3SMZA 2P9GA 1JKHA 4QIVA 4ZPWR 1SQFA 1HPZA 4RNOA 3IFEA 3KUGA 1LWFB 1NZAA 3A1YG 4NE9C 5B7WA 2UUAJ 2OD6A 4DUYF 3JTNA 4F3MA 1N5YB 1HBMB 3NLCA 5ETSA 5KG3A 4NMXA 1V5VA 4RWXA 3RU0A 2QL9B 1REVA 2RQCA 3W7BA 5B0GA 2XSFA 4O3QA 4UUWA 2PI5A 2DR9A 1WG5A 1ZA1B 1JNZB 1JJ2R 4Z37A 4MKVA 2Z4PA 1C0UA 2G2OA 3V6DB 4HACB 1FNXH 1VIOA 3ILJA 4LRFA 4CO2A 3DGVA 4RR5A 1F2HA 5ETVA 1XQIA 5KFUA 1X4HA 3TAPA 3CJRA 1X0FA 2XY5A 1R7IA 2A6MA 4YEAA 4B3SF 1PCAA 4GKKF 2R8GA 3CD7A 2FZCB 3RTVA 1WF0A 4N77A 4WK3A 2B3TB 4CDIA 2J5AA 3G96A 1YTYA 3ZZ0A 2D3OR 3N0VA 5HMWA 1OIAA 2LXUA 4FYWB 4C8OA 4QIGA 8RUCA 3GILA 4ELVA 3LANA 4DU8A 1AFJA 2AEJA 4DS4A 3KK2A 1NDCA 2XC9A 2FDNA 2V2VA 4PQAA 5JXSA 2CYYA 3LPEA 1NKEA 5M2RA 3UDEA 5CD4A 1VBYA 3KHHA 2DGTA 3D6FB 4WTOB 5DGAA 2EFPA 4DR6F 1O6XA 4K4YA 2J8AA 3KOAA 3EDQB 2OI2A 3EVOA 4DX7A 3M32B 4CO0A 2CPHA 5EWGA 3OTOJ 4PKDB 3HM9A 3WC2A 3MCMA 1HNWF 3JS9A 3TARA 2QZ8A 3B6BA 2B7BB 4RPFA 4ECYA 3SDEA 4F2SA 1BUXA 2FQQB 4OZNA 2BXJA 1M5SA 3M8ZA 3I6PA 3DMJB 1NO8A 2RDIA 4DL0C 3HHNB 1SKUB 1NAQA 4JI7J 1T9UA 1R43A 2DEIA 4JI5F 4G1PA 4CLZA 5IWAJ 2YWKA 1SH3A 1NPKA 4FXVA 1WKJA 3T5KA 4ZVOB 4ZVRB 2FTRA 4MMOA 3PV8A 2ZFHA 1PO6A 1YBUA 2V2QA 4F7VA 2J0QD 3QAEA 3H5XA 1KLMA 2GQQA 4C3KA 4ZLPA 4LFBJ 2HWIA 1FVSA 3CCQS 3BSAA 2CVEA 3K89A 5EGYA 2A18A 2KYZA 2M3DA 2I0XA 3OBIA 2A1BA 1LFPA 1AUSL 1FJ7A 4A46A 1MMNA 2E66A 2WOMB 5KFOA 3KUHA 3MOZA 3G2XA 2R7XA 2DRBA 2F4FA 4DLGA 3HMJG 4FVCA 1CPZA 3R7SB 2M8HA 2VOOA 4K8RA 3IRXA 1L3KA 3AA8A 1S48A 2ZKUA 2W8LA 4JP8A 3M2RA 1D0EA 4N41A 2QA2A 5CZVA 2X3GA 4M8LA 4B08A 4CYUA 1UVKA 4O3PA 4LBIA 3L4BC 1NK8A 2FJAB 1L5UA 1HNXJ 2IDLA 1TFYA 4ICLB 3W2VA 2LVWA 2BUNA 1L3SA 1U0HB 4X65F 3ZTSA 1T3NA 4C9DA 2GMJA 3OL9A 1N54B 5HL7Q 1Q78A 4OYXA 4F4KA 3JYTB 1XR5A 4PQUA 4CM0A 2V50A 3TOQA 3GIRA 2HMIA 2UU9J 2HSEB 1QE1B 4Y2CA 2BE2A 1TKXA 5JJBA 1ACMB 3UR3C 4WIQA 4X62J 1XERA 4X64F 2CPDA 1VQLS 1VJQA 1DQ9A 3RBXA 5B0EA 1S0OA 4P52A 2XZWA 4KRWA 3MMCB 2HS4A 2QLWA 2ZNYA 4Q8EA 5AXKA 4OHVA 1I1GA 1FJEB 5CH7B 2LQ5A 3O1LA 3QLHA 4CLUA 2K06A 3M8QB 4UY85 2W9AA 2MKYA 4OJGA 3FCVA 4E0DA 2V4RA 2QEXS 4QYRA 2LU2A 4TYAA 1GQEA 2XGQA 1WF1A 1VBZA 1X0PA 1FRJA 1WC4A 4EBCA 3R6GB 4HH1A 2XMKA 2E9TA 3BGLA 1JJ4A 1RT7A 1YBAA 4HT5A 1F6TA 4A4JA 2XCAA 1SPBP 3AQOA 1RTIB 2XMMA 2R7TA 5G0RA 2M88A 3A8EA 1G3OA 1RAAB 4JV5F 4I2QA 4NA2A 1RHKB 1UJ5A 3MM5A 1YIJS 3C6UA 2X1FA 1MG7A 1Q5VA 4Y0FA 1RHRB 1NB7A 1CJVA 4EZ9A 3V6KA 3OUYA 2E7WA 5KFEA 4BS2A 3PDNA 1M5HA 2PE8A 5F9NA 2HIYA 2HQ3A 2CJ9A 1NSPA 4USTA 3CJKB 4XAKA 4TQSA 2HHXA 2YKNB 3P5BP 2DKOB 2XULA 1SV5A 2QLFB 3FKBA 1RHQB 2XBPA 1YKWA 2JX2A 1B70B 2FJWA 5HQMA 3ZZZA 2NYHA 1Q8BA 2JLGA 1DRZA 4MAKA 2BJDA 2BJ7A 2XMUA 3ADAC 2GS8A 5CHCB 3TAMB 3NBPB 2PD1A 4KV8B 1G1XA 1NK6A 2QO3A 4E2FB 3HT3A 2CQ2A 3I0SB 2Y8YA 3EGNA 4ZVTB 2FHMA 4H4MA 3ELHA 5A76A 2N7YA 1KTQA 4FF1A 3BSCA 1Y5LB 3RW7A 1KHVA 1UA0A 4YOEA 3TQ1A 1YJTA 4O4GB 1S6QB 3AXKA 3DGPB 4MFBA 4IG3A 5KFYA 3L7OA 5I4MA 2AZ1A 1QAXA 3KXDA 4UZBA 2KXFA 1LWCA 3LUYA 3P96A 3TUIC 4WE1B 2H54B 2K8GA 3FC9A 4A8MP 1NMEB 2I5JB 4I0WA 2LLZA 2Q43A 3F73A 1JLEB 2ASLA 4NYZA 1WKLA 2PI4A 4DFKA 4WIIA 2NXCA 3GIKA 1HMVA 5HN0A 9ATCB 2MY8A 4LBHA 1JB0C 1PC5A 2QIFA 4B9MA 2B9XA 1S1TB 4OYBA 2YPZA 3JSMB 4RL1A 2HYIB 3MCOA 1Z1ZA 2ASJA 3PYFA 1P8GA 4U8YA 3D3CJ 2HQCA 2M70A 1VQNS 5L39A 1W2IA 3M2VB 5DRKA 1G2EA 4ZN1A 1T9YA 4H4KA 4LJMA 1V3SA 3HT0A 4PYAA 4LBPA 1KDNA 1SXLA 5LMUJ 4EUVA 2MQMA 4UT4A 3UNGC 1NKBA 1RAIB 3FCWA 3MWBA 2PT0A 1QSLA 3L7UA 3CCES 1Y11A 2FGCA 5HVGA 2BM0A 2O01C 5FLXU 2QL5B 5A8RA 2ZH3A 2DCUB 1F5AA 3MEEA 1X5SA 2G1DA 5AJ3F 3HVWA 2M52A 4WZMA 5HLFA 3PRVA 3UWTA 3R7NB 3GR1A 1CS4A 4AXJA 4ED6A 4FXWA 3VAMA 3M2UA 5BYRA 3KJQB 4EMDA 2OIHA 1Q7YT 4U7CA 2W2NP 4HR2A 4KIAA 3CF5Q 4LSLA 3D1OA 4A47A 4N8OA 3R5DA 4WFYA 3Q8VA 1QUVA 1TELA 5CXTA 4ECTA 3HD2A 1TL1B 1ZAVA 2VC0A 1XR6A 3C15A 1NBEB 2DY1A 4ZKAA 3EVMA 2VICA 2ADCA 3BGRB 2N7CA 1YJVA 1GX5A 2IRUA 4DV6J 3HVAA 1LW0B 2FLPA 1TUGB 4Y2KA 4Y2IA 1NK0A 1PYSB 4JV2A 1SJFA 2F8EX 4N5SA 4PG8A 2AYMA 1SVDA 4QOTA 1OJ4A 2LKZA 4TU7A 3V81B 1TUVA 1IM6A 4B9LA 4XDCA 3IBCB 1HQUB 3TA0A 3V6JA 3ZTRA 5BJRA 4C8LA 4TY8B 3PO5A 4B9SA 1IKXA 5H1SV 2EFGA 3OFHA 2AJFE 1S59A 2J76E 4AD6A 3W64A 5CQGA 4DF8A 4ZA1A 3LP0B 3I5BA 1AB8A 3T1YF 3Q2TC 1PIEA 5HI7A 1QDUB 1EZZB 1U2RA 4AQYJ 2AGPA 3G6YA 5J2NB 1X9WA 3N5FA 4NZ0A 2YQ1A 2CZ4A 2RU9A 1WC6A 3BGFA 2F5GA 4QPXA 3CO9A 2XSJB 3GCXP 3FEYB 4UUXA 1NJZA 4QWCA 4OHYA 4J7CA 5KFNA 3MMBB 1NHKL 1N34J 2M9KA 5HBMA 4F36A 3DM2A 1RTHB 1KKHA 3N01A 3R2DJ 2JH3A 4IG0A 1WEYA 3OTEA 4R8UB 4F04B 4HYKA 1RA7A 5KT5A 1PAUB 1VK3A 4DDFA 3BQ1A 1PGZA 3OW2R 2CQ1A 1FRHA 1PJ7A 7FD1A 3KTQA 4C8YA 3BKFA 1S6OA 1J5EJ 3QZ7A 3X1LB 2KVQE 3CCWA 4OLPA 5HP1B 5A8KA 3PM9A 1H98A 5D8HB 4TY9A 2UXCJ 1G7CB 1EETB 3W3SA 1K9MT 3GWCA 3MTKA 1F5BA 4DG1A 2RD5C 3NXZA 3BYRA 5AT1B 4Q2MA 3V2UC 3U1LA 5ETMA 5LSLA 1YITS 3G87A 2QFJA 3DRRB 2PMZD 1MMLA 2R2RA 3CJ5A 1RCXB 5D6GA 3MR7A 1Z4UA 3N6MA 3R1HA 1S9EA 4DR1F 2HZAA 1X4EA 2HW3A 3G71S 1X4BA 4DX6A 2KHDA 2ZVIA 5DS7A 3I55S 4TU9A 1YJUA 2LA6A 4RW4B 2PA3A 4X2BA 3KK1B 2HNDA 4JI6J 2MKIA 3BO4A 3IM8A 2AJ4A 2PA8D 4ZP9A 2N4CA 2RHQB 2FJXA 2HBRB 1HA1A 2GVZA 3C14A 5C25A 4WTYA 2I1RA 3RBDA 3OHAA 3D54A 3T3FA 2I6WA 4ELTA 4F26A 2IC3B 4B17A 1Z2ZA 2ZH5A 1HBUA 2B8PA 1HHSA 1TKZA 3KDNA 1H2VZ 1R0AA 2CPZA 2E1CA 2XNRA 4TQRA 1WELA 4LF6F 1WKKA 3NGDA 2V68A 2IA0A 3KLIA 3BEGB 4U8VA 4OI4A 2C22A 1RT1A 3I5CA 4A8XA 4QQBA 2GA7A 4PZVA 3IGVA 3P4UB 1CC8A 2J7KA 1GMVA 4NXMF 1HQEA 2V5HG 2VH7A 1KQSR 3PVXA 1W26A 2WVBA 3B82A 4KT0C 5A2QY 3PIOQ 2RB7A 1TU0B 3MAAB 4FF4A 3SSQA 1BMQB 3KJNB 4ETZA 1QVGR 3NS7B 1U1NA 4ECRA 3BJYA 2GQ2A 3KJVB 4ZHRB 3MMAA 2HVZA 3TO8A 2HEKA 4D3HA 3QFHA 2E29A 1GMUA 2Z0GA 1LW2A 3DC2A 1JLQA 1RAEB 2AGOA 1T05A 3HHLB 4RW7B 2LDYA 3H40A 1C2PA 1YRXA 3GJRB 5L8RC 2ALZA 2RDJA 4QYZK 1KLNA 3R5AA 3Q8QB 4BCAA 2VQFJ 2C2EA 1K44A 3PYEA 4HL9A 4JUZA 2G2ZA 2JWNA 1S10A 1IXKA 1KQKA 1B0PA 4IR9A 1QAJA 3HFVA 2IPOB 2P2CB 4HEA9 1MWYA 2BA9A 2EXUA 4URQU 2ZH9A 3KLVA 4DS5A 4DCJB 1SCJB 4WFAQ 1IUJA 3OTDA 3D1HA 3A4TA 3J7ZT 2HQDA 4ZITA 1VRTA 1VK8A 5ETQA 1RA6A 4M63A 3QT8A 4OHZA 2CRLA 2AWZA 4ED8A 4FYDA 4P10A 3UDLA 1WJ9A 3W9JA 1X4GA 4ZIWA 2HFZA 3FCHA 2VG7A 2RKIA 3DLJA 4I2PB 1HD0A 4NXNF 1OWXA 4ELUA 1RJJA 2BKPA 3H59A 2RF2B 2DISA 2X7IA 2ZHBA 1U1KA 2VONA 3LAMA 2FJDB 3SIPB 2C3MA 4KFBA 2ATCB 4LQ3A 5LMNF 3DLLQ 5T7LB 4DV1J 3HSDA 1U6BA 2OEKA 3BBBA 2DNRA 2DHHA 3NRBA 1FJGF 4C4WA 1N6QB 3SCJE 2G13A 1P9YA 1RWPB 4EEYA 1C4AA 2KM8B 2DR7A 2XWYA 1DZ5A 3R97A 1WACA 2E5HA 2ASDA 1RWWB 5HANA 1YGYA 2LEPA 3QO9B 4NLGA 3CDBA 2B4VA 4ZPCA 5J2MB 2MHNA 4J9QA 1DQAA 4ECWA 4RZRA 2HNZB 3HCXA 1F3FA 4OYOA 2JEFA 1BD6A 4ZVEA 4K4VA 3UR0A 3R5BA 5KFBA 3TJAA 3NG8A 2X1BA 3QPIA 2YPYA 1UFKA 2N4DA 3F44A 4LF8J 1X4CA 2DR6A 2IFXA 5A2QU 3DHXA 4PRFA 2QN6B 2XLJA 3ENAA 3GSIA 1M5KC 2DNZA 3ZZYA 3V4IB 2VQEF 5JUMA 3DOLA 3T9ZA 2WSEC 2W8KA 2DHXA 5GAHI 4ZJOA 2ZVSA 3H0PA 3FZ2A 3UCUP 4J37A 1U0SA 2ZH4A 5I42B 5KFQA 4B3MF 4O44A 1VQKS 5ETRA 1JLBB 2EFQA 2JEIA 1PBUA 1JLCA 1S6PB 3NCQA 5GAGI 1HFEL 3W5YA 1RAJA 1S1WA 1S1XB 1UPMB 2WCXA 1HNIB 4OX6A 3SI8A 3TNVA 3TWZA 2MQNA 1DJ0A 1JJHA 3Q8RB 2QYCA 4DV2J 2KRBA 5LXYA 2UV8A 2YNIB 1N5SA 5HJXA 4DBQA 4F4XA 1VQ7S 2NPFA 2J6SA 3LP2A 2R2UA 3MHYA 3FRZA 3PR5B 2AMCB 1Q7LB 3GFXA 4PUOB 1SJ3P 3BZQA 4BC7A 2RQMA 3B78A 3MM6B 5THWA 4OI1A 4PXDA 5FJ4A 3H5UA 3BSNA 1Y10A 2K7KA 1QJHA 2E9ZA 3P8BB 2IMWP 4DR4F 3KLEB 3J7YI 3S6EA 2VFTA 1N33F 2JZ5A 2Z2MA 1NDPA 3NMAA 4NEYA 3NWGA 4XDDA 3ET6B 2UUWA 4O3OA 4I1TA 2ZM6F 2R7VA 2VOPA 4LR7A 1RT4B 1HWIA 3HF5A 4BWMA 2LDIA 4TVAB 3E3XA 3OV7A 1DLOA 5E3PA 4Z2XA 3PW0A 1FNOA 5KG0A 1S97A 3U1NA 3I5AA 4K5SA 1EKSA 4B3OB 3M9MB 4FNHA 2D9PA 5C2CA 1RT2B 4USUA 2U2FA 4G1QA 1H2UX 2HNYA 2FZKB 3SXLA 4RWWA 5K8OA 2XMTA 4YDDB 1RHUB 1TKTA 2J9CA 2C2OB 4K5RA 3MI7X 4HLBA 2XGPA 2CZVC 4OI0A 3CC7S 3PYGA 3W60A 1HR0F 2VG6A 2BRKA 2JL9A 3GJSB 1VOMA 4PXCA 2Z57B 1QSSA 1Z2LA 2UUBF 1Q8LA 2QT7A 3PHEA 4YHHF 2IJFA 2RMLA 1XNRF 5L1LA 2LQBA 1AZSB 4J9VA 3M9NB 1UEUA 4LSNA 3PW4A 4FDFA 2HRTA 3W2WA 4TKTA 2GAHC 2FZGB 1TL7A 1YI2S 4KSEB 3TVZA 3N9UC 4IOBA 3GONA 3UE2A 4WYLA 4XTTA 3VAJA 2GVDA 2HGNA 1FWPA 2IJRA 4OYMA 2YH0A 4PG6A 5A8WA 4P74A 1PSDA 4F25A 1SH0A 3QRRA 4TLRA 3JAMY 1S57A 5BR8F 4QU7A 5DQGA 4DL5A 2OPSB 1EHWA 2FLOA 3GQCA 3RYLA 1SJQA 4N8NA 2OTJS 1AA1B 3OVAA 3RB4A 1VQ9S 4ALZA 1K0VA 2BANB 4MK9A 2CWKA 2FJBB 2KJWA 2KXHA 2F4VJ 2DXEA 2YX7A 3MM9A 3PFEA 3ZFVA 2F40A 5HVFA 4LIWA 4F2RA 2NS1B 2B51A 5IV3A 3UI3A 3CDAA 1YSJA 3M6XA 3L3CA 2CXEA 1FI4A 5D15A 2PGCA 4OYPA 3LWLA 4WYWA 2BYCA 5I3UA 4LRCA 2EI5A 3H98A 4MK7A 3M1VA 2K3IA 3GV8B 1IJEB 1RT6A 3D28A 2YQ0A 4P2FA 4K2JA 5CYQA 4ZJQA 2MXYA 2DGSA 3TUJC 4Q43A 2CJXB 5DJBA 3PACA 3C6TB 2B5JA 1AT1B 2CPFA 3WC0A 5F3TA 2CQPA 3ISNC 4RU2A 4IH7A 2UVWA 4NRTA 5KT4A 4ZPDA 2EC0A 4ITSA 1JWWA 4MIBA 4P2SA 3DRPB 5CAAA 1MN9A 1LWFA 5DG8A 1NJIT 3K7RA 2CQHA 2FHJD 2H4WB 7AT1B 1RGVA 4J9SA 5GMDA 4ED2A 1U45A 1V6HA 4Q8FA 4LRDA 3UW1A 3OR1A 1X60A 4LSZB 1RK8A 3IG1B 1FVQA 5CYMB 2BQRA 4ECXA 3MFHA 3H25A 5KFSA 2W9CA 5A6WA 5J2PA 2R7SA 3CJ2A 4DQSA 3GG0A 3TRGA 1EIYB 2DNKA 3CW2C 3AHPA 2QTWA 2EG1A 3M8PB 3H5SA 2H65B 5D0RA 5F3ZA 3EDRB 1WC3A 2MLZA 2RNEA 2MYFA 3CD0A 2LEAA 3EPIA 1L3UA 5AXNA 3V6DA 1HNZF 2L48A 1SQEA 1WOPA 2F9JA 2J0XA 4DL7A 3S8SA 2B9YA 3QRPA 4ZVPB 1IR2A 3SQGB 4CNYA 4P2MA 4JV0A 4Q45A 2ZD1B 1RTZA 5AE3A 4OZLA 2W1BA 2OUGA 4RUCA 5LJ3Y 2VF3A 2ILZA 1S0MA 3DDKA 1BWVA 1O8BA 5LJ5Y 5HATA 2HHHF 2VG5B 3A3PB 1S1VB 2DVIA 4FNIA 4OZ2A 4LF5F 3UFCX 4IFVB 4G3IA 2RS2A 2IIHA 2XY6A 2B4PA 3NCRA 2ZZNA 1VYAA 2MY7A 2CNKB 1EP4B 5KFIA 1YZ6A 5ETLA 1WUUA 4BHQA 5SUHA 1DQ8A 2ACYA 2CWXA 1RKJA 5AE2A 3W62A 4EWTA 4X4PA 3RZAA 4DPTA 2XMJA 1RBOB 5KOWA 1XR7A 2KT3A 4HTJA 2ZH8A 1BHNA 3D7SB 1IKYA 1WHVA 3CEDA 1W25A 1Q16B 4P7VA 3MGJA 2VC1A 4OMFG 3M32A 4ECZA 1Y0HA 4OI6A 4CO4A 4NLUA 4PPZA 2OMOA 3AQPA 3W66A 1FRIA 1KR4A 4OQJA 4NPOA 3DXBA 4AXIA 3H42A 3CCSS 4DJBA 2MKJA 4CP5A 3QMQA 4GRSA 5KFPA 3DMJA 3GJTB 3CC4S 3GMGA 4GKJJ 2P9CA 2OFGX 1KS2A 3IR7B 1CVJA 3VV2B 2CNOB 3TVKA 2KL8A 3I31A 1IBKJ 2ZBIA 5IC4B 4JI0J 3DRYA 1ZM4A 2NSCA 4FS1A 3MOJB 4Z7YA 5GAEI 4DZ6A 3AB4B 1LWEB 2ZH7A 4LFCJ 2GO9A 1SL1A 4C2MA 2ZDOA 3GV7B 1X31C 5IC6B 5BYSA 1S79A 3OFFA 4M5KA 2MJNA 3OD2A 1LQ9A 3D0HE 2HWHA 2HK3A 2H5JB 1FF2A 2DEJA 1M1HA 1JLAA 1KBRA 3FBEA 1MWQA 1HHQA 3IBFB 4DR2F 2XZDB 3L9ZA 2J9DA 4OHWA 1IR1A 2CG8A 1FEEA 1AW0A 2WOMA 1C0TB 5L46A 5F0WA 3QGGA 2IDEA 3CD5A 2UV8G 5C24A 1EAYC 2YNGA 4F3OA 2AX0A 3VAKA 2Z8QA 3AD8C 4KR0B 1BQMA 3LF0A 2IMOA 1N8RT 4M5LA 4UOGA 2WVFA 3NS5A 1KVIA 4CLPA 4AT1B 1QLNA 1R8AA 4UQGA 4NX9A 4V19J 3VGSA 1NUEA 2BQ3A 5DETA 2FPHX 2HHSA 2IRYA 3TZWA 4WU3A 4JI8J 2BEFA 3VAIA 1ULRA 2YX4A 2Q1LA 4ICLA 3S01A 5KFFA 4ERDA 3HHLC 4UF4A 4XPEA 1LXNA 1NM2A 1FA0A 5LSOA 3FEXB 4F4ZA 2I8EA 3THVA 4W98A 1KOHA 3JYTA 5IT9U 2VBWA 2IBOA 1A0OB 1QE1A 3FSXA 1FKPA 3G6VA 3FBCA 1IKVA 4FF2A 2F63A 2N82B 2C2DA 4DR7F 4DU7A 3CCUS 5L1KA 3IM9A 2MQOA 1FTCA 5IS2A 1ZTTA 2EC2A 3JSBA 5JVHQ 2KFNA 4NLSA 4PWDB 2ZE2A 2AYEA 3A13A 4EK2A 1HKAA 2VL1A 2UXBJ 2MZQA 3M8QA 2AJ2A 3HVRA 3HFZB 4W92B 3KLFB 1Y7PA 5JVGQ 4ES3A 2BDPA 1U8SA 3EXYA 1IBLJ 3K58A 4OFZA 3Q89A 1SQGA 2B6AB 3CGIA 4F4YA 4ID5A 5J1EB 1BQXA 4Y2AA 3IRXB 3IP0A 1RTIA 1U26A 3MF5A 3C3LA 2RRNA 4ZIVA 4K4XA 4OZ0A 2IAJA 2R7UA 3MUMP 4HVZA 1HBOB 4KGXB 4KO0A 1UTAA 4C11B 3IXQA 4NA1A 3FEZA 3W2VB 4JYAJ 3LAKA 5DO2A 4DR5J 5EWEA 1GH8A 3D2WA 1FNMA 3CJKA 2E1MC 2YWWA 4FBUA 2YKNA 5RUBA 1RYSA 2OPRA 4CLLA 3D3BJ 3B4DA 1HNVA 2E1AA 5D3GA 1WG4A 2DGUA 1C1BA 4EO8A 3SCKE 1T9WA 3DLEB 2GJ2A 4KC5A 1WC5A 2P9EA 4PQUB 4JI4F 4M5MA 3QGIA 4QWEA 2BE2B 4L75A 5GMEA 1TKXB 3TZZA 3ZZUA 1RHJB 1YRTA 4FXDA 4HKQA 4DFMA 4KV8A 3ZC4A 1U1QA 2BJ3A 2ZWOA 3T1HF 2W4CA 3PW5A 1U47A 5KFCA 2HK2A 4EYHB 5CA5A 3EM1A 3GV5B 1WSVA 2MQLA 2W24A 4LF9F 1FK9A 3US5A 1FFSB 1MROB 2KZMA 4R0EA 1ZBTA 2NSBA 2NR0A 4XO0A 1CEZA 3J81Y 4O4GA 1B7YB 2CJQA 2LMIA 3DGPA 3HZEA 3RG6A 1SC1B 1NK7A 3CE8A 2GO8A 1B3TA 2M0GB 1S77D 4EFAC 1UVNA 3OL6A 5A0YA 3QIDA 5KT6A 4WE1A 2I5JA 4IRCA 3H8YA 4XPCA 5G0RB 3EGVA 3TVYA 1JLEA 3TI0A 3MM5B 4DV5F 3C6UB 5EWFA 2GIFA 1HI0P 3LP1B 3AJ2A 1ROFA 3JTOA 1X4AA 4USVA 3ENVA 3I87A 8AT1B 2F8HA 4IDKA 2DD8S 1G6BA 3OUYB 1OY9A 1OPIA 5HMXA 1RAFB 1S9FA 1YQHA 2W2PP 1MWZA 4MH8A 3ETOA 2AHOB 3JSMA 3OL8A 1W2BR 1QAIA 1TQLA 2OD4A 4JI1F 1UAWA 1SV5B 2AD9A 1RDRA 4QBUA 4UZCA 2W7OA 4LF4F 4DUTA 2PDAA 3HULA 1OYEA 2MZJA 1RU2A 3UO0A 2QSWA 2D41A 2YNHA 2DH8A 3M2VA 1PC4A 4QIFA 2M2BA 2L9NA 2B7CB 2Y8WA 2RJZA 4LF7F 3NKYA 2CDRB 3D66A 1YLXA 2QRRA 3K8VA 1KQFB 2W4DA 1Q4RA 1U8WA 1IWGA 3O3LA 4Q5VA 1V3ZA 1D1UA 3PZPA 1N88A 1N48A 2OPQB 2APOA 1VQ4S 4ED0A 4C48A 3CC2S 3FDSA 4YY3F 2CJKA 2B0GA 3D9BA 1RWVB 1FESA 4OX9J 2HFOA 4LRAA 2EFVA 4MFBB 2XTJP 1AUDA 1J5OA 2LQ9A 5KFTA 3ZTOA 3PNIA 1TL1A 4ER8A 3UNYA 4USJC 2GGPB 4DV0J 3EPGA 3QT7A 2POKA 3D0GE 4IFYA 2RQKA 1WI6A 1Q86T 3G82B 1AYEA 3BGRA 1HMVB 3ITHA 3OR2B 4OZ3A 1RTDB 1LW0A 4PPDA 2Q79A 3DHWC 4EBDA 2G2YA 3Q86A 3V81A 3QGPA 2CVIA 4UOHA 1HQUA 2WSFC 3NNCA 2K7JA 4TY8A 5J1NA 1UW4A 2XCPA 2W7AA 2X1GA 4K4ZA 4DQQA 1WSRA 2E5JA 3RJMB 1ZM9A 4J9UE 3LP0A 1O51A 2GCFA 2V63A 2PO4A 3D6MB 2KTQA 2YH1A 2KVIA 1I51B 4MKBA 5U47A 1T9TA 5J2NA 4ECQA 2BJ9A 1AXQA 2AEFA 1VJWA 2BE7D 1NH7A 1FO1A 1XNQJ 3MM8A 1R6VA 1ZAXA 4CLTA 1F9EB 5B0DA 5ETNA 2KG1A 5KFRA 4ZLNA 3PY8A 2YNFB 3HXMA 2ZDPA 4HI2A 3GIIA 2ZUAA 5M2PA 2DH7A 2XSJA 4MYUA 4F0HA 1CS4B 4B3RF 2HBYB 2EK6A 3OQ2A 4F4AA 4L6V3 3PKYA 4RJVA 1MU2B 2CPXA 3EUNA 2XO7A 1RP5A 3H4DA 3MMBA 3TZXA 4ZPTR 2DITA 4LSLB 4J9OA 4URSA 4NASA 1AFIA 1T95A 2HWTA 1FHTA 1B0VA 3MR2A 1XMOF 4MIAA 3E01A 2KDOA 1CQNA 2Y3YA 3WBZA 2Z2ZA 1URNA 1XEZA 4ZPVR 1IBCB 2HLTA 3M8YA 3ZZPA 1LXJA 1JLFA 1T3OA 4KJIA 4FP9A 1DFDA 2Q6BA 1T0TV 3HK2A 2UUCF 2V0NA 1X7VA 5D78A 3K8WA 4Z7CA 4Q44A 3HSGA 3GG1A 1F9FA 1Q79A 2BR0A 1Y4ZB 4BDPA 1NNDA 1HW9A 1OQ6A 3DRRA 5IFMA 2YKMA 2JSXA 1IKXB 7FDRA 5EHHA 2FVQA 3PRBA 3MPDA 3N6NA 1X5OA 3OXFA 4J9MA 2BM1A 2UXDF 2ROGA 1DY3A 2VB6A 3BGOP 5HK4A 1GMWD 2YWGA 3MFIA 1ZETA 2KN4A 1NDLA 3IWXA 4IOCQ 1SUQA 2FLLA 3KK1A 2V9WA 1FEHA 3MAHA 2JC1A 3R9LA 4RW8B 4ZS6A 3CD6S 4YFUA 5C7PA 4QWDA 3TEHB 1B7FA 1APSA 4M5JA 5H9EJ 4LIRA 4ZP6A 4Y3CA 1JIHA 5DZ7A 5K9FA 3L7PA 1YZ7A 4FVMA 2CZ9A 3HSZA 3MR3A 1F2GA 2IC3A 2LU1A 2IVMA 3OTCA 1GXLA 2CKWA 2JFDA 3BYPA 2BVZA 3TW0A 3DM2B 5KFHA 1KONA 3Q83A 3W9HA 8ATCB 2AT1B 2DGQA 2YWFA 4UW2A 2VPXB 1GX6A 1SH2A 1N36J 1KSPA 2CUYA 1ELOA 1ZZFA 5KFGA 1ZA2B 5HROB 4FYXB 1S99A 3MAAA 1GT8A 4JI2J 4I67A 5LSRA 2PN6A 5DDRC 4MKYA 3BN7A 3C66A 1FRMA 4ES1A 1TK0A 1YBTA 2YTCA 3CDEA 3KJVA 4DG1B 4KHPJ 2ZJPQ 4RNMA 3SCLE 2ATLA 1FE4A 4J9NA 4LF1A 2B9EA 5LM7E 4OJ1A 1S9EB 2QX0A 5KFDA 2ZWPA 3DU6A 4KBIA 1RAOA 4DQRA 5KG4A 3AXMA 5L1IA 4RNHA 2F1FA 4DV3J 2Y0SD 2FVPA 4P72A 2FHJA 5D4OA 1SL0A 3G4SS 2F8MA 2ZBQA 2NPIA 2JC0A 2VBZA 3CUNA 1D8ZA 1RSCA 4DV4J 1N32F 1HWLA 1K1SA 1WC0A 4ES2A 5DDQC 1JXLA 3QJJA 2GVZB 4IUFA 2YKPA 3MPVA 3VAFA 3D4JA 5IM0A 3HJFA 3KLGB 4F4WA 1FX4A 4N7TA 5CCMA 3HLUA 3DYAB 2WVEA 3FSYA 4IRKA 2OSQA 4NLTA 4E8UA 4N47A 5KFXA 1HBUB 1IWAA 1TKZB 5EDWA 2JNJA 3BPSP 3MDFA 2OJ3A 2FHKA 2AIRB 3EGZA 4PAAA 3PJXA 3PYDA 4W90B 1LK5A 1SL2A 4K0KJ 1NCLA 4FPIA 4KHMA 4I2PA 2RT3A 1YRUA 5HMZA 1NB2A 4JI3J 3N79A 1HQEB 2MKCA 2RF2A 3OT9A 2JVRA 3TUPA 4X4NA 3QAUA 3DRSB 3NAHA 3AH6A 1XC9A 5IQ6A 1Y3JA 4ED7A 2VA2A 1D8YA 3M8RA 1Q82T 3CT9A 4DUYJ 2E9RX 3Q24A 1R8HA 3L95X 5K20B 2HHQA 4DV7F 2DJWA 2XYPB 4O23A 1VRQC 2HBQB 2ZBPA 2A2CA 2JRSA 4C0BA 4B3TF 1VMBA 3CJ4A 4LFAF 3OXLA 2GQCA 3PJ9A 1XIQA 2DHSA 4I6AA 3LWMA 2JEJA 4C6AA 1S0VA 3J7A1 3QO9A 5M2UA 5J2MA 4EO6A 2DGOA 2CIMA 3RW6A 5KG7A 2HNZA 1KOOA 5K8NA 3MEGB 2DBBA 3HI9A 4X66F 4OV1A 1VRUA 1XMQF 3KK3A 4WPAA 4CLKA 4Q7AA 2H3EB 2VODA 2CQGA 2ZHAA 2CQIA 3DOKA 4ILMA 4B3SJ 4GKKJ 3IR6B 2MZRA 3T6BA 3M8SA 3V4IA 2FJEB 1VRTB 1TV6A 3FGVA 4DUZF 1XJWB 2FVRA 5E3AA 2WRMA 3EZOA 4DQPA 4D3GA 2ROEA 1A6LA 2MJUA 2DO0A 4DR3F 1WI8A 2WVCA 1S1UB 2VJVA 5GADU 1I94F 2EBEA 1OY8A 1A7GE 4CH0S 5LOQA 2GIQA 4LVNP 3KG0A 1TL3B 1TUWA 4QPTA 4URGA 4OYIA 2YWEA 1IBMF 1UFWA 3LPYA 3VAGA 1V9OA 4DR6J 3NEKA 4DL2A 1S1XA 4DPOA 4ATNA 3KG4A 1RAHB 5I3PA 3KLHB 3U1MA 5KG5A 3S7RA 3C8YA 2YNIA 1P1TA 3NOGA 4CO3A 2MSTA 1NH8A 2WSCC 2EFOA 1QVFR 1HNWJ 2OLWA 2DGVA 2HG4A 4PUOA 3QJLA 2V2ZA 3MM6A 1ZOTA 3BPDA 4DL3A 4AUKA 4RU9A 1RI7A 1VGYA 2HS0A 2PC6A 5F8HA 1KFSA 4PR6A 3ET6A 4B9TA 3J81j 3TAQA 2W25A 4JI5J 5D0GA 2EBGA 4EGLA 4CLYA 3V5RA 1U1MA 2Q6CA 3M8WA 4MT1A 2EW9A 2UZAA 1RT4A 4BWJA 3ENWA 2UUAF 2OAUA 3EXCX 4DZDA 4RBUA 6AT1B 2JLFA 3NAIA 4B3OA 4RW6A 4RO0A 1GTHA 3GYXB 1RT5B 4ZDNA 2RRAA 1K8AT 1RT2A 4NLQA 1NSKL 3OVBA 4DL6A 2DYAA 4EYIB 1RYRA 4DWIA 2EVZA 4LMZA 3DXSX 4CWBA 1BQNA 5IQQA 2DXDA 2ACMA 5E5NA 2QGFB 3C19A 1D9FA 1WHXA 2AGQA 5MLCV 5AE1A 2RIJA 2Y1LB 2WHOA 2E7XA 3AT1B 4HHHA 2JFKA 1S1WB 5T41A 1VIXA 4DX8H 3BH6B 4XIUA 1AZSA 2GMHA 5KFKA 2HZCA 2WAQD 3T1AA 2Y9HA 3VWSA 2CQ3A 2QMXA 4OYWA 2HRYA 4ZN3A 2AQ4A 3DFEA 4DMZA 3TP2A 3K5OA 2LP4A 1SKRA 2IJNA 3O8WA 4M5HA 4X65J 1LFWA 3CO0P 3HSJA 4QWBA 4YQWA 3E8OA 2NZCA 1DAXA 2IM0A 1I6JA 3X3UA 3G8SA 2V34A 4JV1A 3PEJA 1S9GA 5L1JA 4X4TA 4WK1A 2BANA 4C3LA 1U6ZA 4P9SA 1JLGB 1N0UA 3ILIA 2SXLA 4ZLJA 3B4MA 3RRHA 3OTOF 4X64J 3JQJA 2E1PA 4OX7A 3NGUA 3PG9A 2IVFB 1JX4A 2IM2A 2QLXA 2BOPA 4B9VA 2HHWA 4G1QB 4ZVQB 2HHTA 3HHDA 1RXOB 1LWXA 2Z56B 1TTHB 2OEJA 1GK8A 4JI7F 2YVSA 3H2LA 3CMQA 3V6HA 1UZHA 4I69A 1TKTB 2JDJA 5IWAF 2V6AA 4X4OA 2JOQA 4PG4A 3MR5A 1EARA 3IS9A 1SJ4P 2VG6B 2YX1A 2I2YA 2D3UA 5HAOA 2DR8A 1GFWB 3MXHP 1DARA 3UVJB 3UDCA 2VDIA 1IQZA 4NZ6A 2RUGA 1RTJB 3RGIA 1BLUA 3DI6A 4LFBF 2KZZA 3J7Z5 4ZK7M 3BS9A 1T03A 4JV5J 5G4DA 5HSPA 4DCPB 1F1BB 2G0JA 2QE5A 5EUHA 3AD7C 1M5VC 3IG1A 3VGTA 4AE5A 4J91A 3EVWA 1T9XA 1RABB 2GNKA 2IM3A 3OFGA 4FN5A 4U7UK 1B99A 4USWA 2GVDB 5F8IA 2J9DE 2AJ0A 2XI2A 4L72B 3M8PA 5KFAA 3R2CJ 3EZUA 3W9IA 2C1EB 1UVJA 4KYZA 2R2SA 2AEMA 4F0KA 1TAQA 4DL4A 2FC9A 1HWUA 5CCLA 2CQ4A 2EPIA 1Y9OA 3CCZA 3MM9B 2DIVA 2ZZMA 4IH5A 1C4CA 2ILYA 2J9EA 2G9OA 2ZEJA 2J0SD 1K0TA 4NZ7A 1PG5B 3KHLA 3UDVA 2ZD1A 3W61A 2MQ8A 3AY0A 1HNXF 4QR2A 4IQXA 1M1KT 4DLEA 5I3UB 3P45B 1S1VA 4OI3A 2HVDA 3M1VB 4MKAA 3SZ2A 2MZ1A 1HWJA 3T5HA 3CCJS 2C2KB 1PYTA 3AOAA 5CYQB 1RAGB 2GC8A 1P27B 5D4PA 2W9BB 5B0FA 3NGTA 3M6UA 3MAQA 4X4UA 3NP5A 1EP4A 2UU9F 3W65A 2ASYA 1B4SA 4ID8A 2HPUA 4PWUA 4LR8A 5L9NA 2ADBA 2P6SA 4X62F 4ECSA 5L38A 2WONB 2XLKA 2QMUB 2L41A 1KWMA 3IA0A 3I9ZA 1UZDA 1MMDA 2HAIA 3PX6A 2IYGA 4EZ6A 3CJQA 1NK4A 1UVLA 1FD2A 4KGZB 1TAUA 5FDLA 4M5DB 1H74A 2GV1A 2L9WA 2OMLA 1J2VA 2KHCA 4OJHA 2IHR1 1SB6A 2VFRA 3OR1B 5D0EA 2M8DB 5AXLA 2BE9B 4CTAA 1RKIA 1HI8A 2GHVC 3C16B 4GVBB 2W9CB 3EWGA 2WTFA 3Q8UA 5J2PB 2FGOA 4IQMA 4U96A 2HFSA 4OZ1A 4IO1A 1Q0NA 1HI1A 3LO3A 4ILLA 1QSYA 1N5QA 3QATA 4CLFA 3UD3P 2ZH1A 2IA6A 3ISZA 4R5PB 2IM1A 4H54A 2PEHA 4L73A 4A8QA 2NREA 3BGUA 1VC6A 1S5ZA 3PHTA 3EE3A 2V4JA 3CMES 1LWEA 4ANEA 1U25A 1R0BG 1FWLA 5B0BA 2V8PA 3O5TB 2LFVA 1N56A 4OLOA 5DM6Q 3W5XA 4NLVA 5D0HA 3WQPA 1M90T 4ZVSB 1H38A 1IM4A 2R8JA 4CH7A 1XTZA 3I0RB 3I96A 4NA3A 2K1RA 1YJNS 2GW8A 5K14A 4RUHA 1RWMB 4W4MA 2B4UA 2ROPA 4FF3A 2C2MB 3A8IA 5AJ3J 4CCHA 4USKA 1S4FA 4Y2MA 3CCVS 4WFBQ 3N6LA 1V3RA 1C0TA 1SC3B 2DNQA 2F3JA 3W8GA 4ILRA 1UVMA 1U1OA 1RADB 2CFXA 1IKYB 4O0NA 2QA1A 2R8KA 3BV8A 2W7PA 1RWKB 3N5BA 3EJMA 2GZOA 3SFUA 3F56A 2R9LA 3PO4A 3SQOP 1DTTB 1WF2A 1Q95G 2J6UA 2XLIA 1R89A 3BQ2A 4ECUA 3NNAA 3JXOA 3HX9A 1YK9A 3N28A 1PJ6A 1DTQB 2ZBCA 2GHWA 1SKWA 2DHAA 3DN9A 1A9NB 1M5PC 1C1CA 4J9RA 3MEDB 1QTNB 1E6VA 3D0IE 3T1YJ 4TU8A 1M0SA 2JVOA 1FDAA 3HO1A 1D3WA 5F8JA 2CQ0A 3J80Y 2E7VA 2CNNB 4PWDA 2DY9A 1DBDA 4FKYA 4Y34A 2DT9A 1UWAA 1JLAB 1QD1A 3G6XA 3MM7B 3CJTA 3KLFA 4NWBA 2WK4A 1HYSB 1S49A 4QCLA 1GMWA 1JXVA 2XNQA 3QQCD 1FE0A 1FERA 5FIIA 4PXBA 3HVTA 4RBTA 1U02A 3T9NA 4X4VA 4X4RA 2V2KA 1WDTA 2YQ3A 3FMBA 2VU5A 2B6AA 5C24B 2UVRA 2YNGB 3K5LA 2LXIA 5J1EA 1FKOA 1YJ7A 2FYXA 2QV6A 1I5OB 1CQMA 2DR5A 1BQMB 4NLWA 5LMUF 3IBWA 2J6TA 4BLGA 4PWWA 1Q81T 1U4BA 1UP1A 2IBKA 4Q0BB 1MLAA 1TK8A 3ZZOA 4G6VB 3FNNA 4I56A 2MKHA 4OX8A 3D1QA 4NI2B 1KP6A 3PW2A 3ISND 3A8KA 2LYVA 1F9HA 1HBOA 2PEBA 4L3KA 3ZO7A 4C11A 2XZTB 4GC6A 4USIA 2LCWA 1ZZNA 1ZS6A 3PR4A 2QLJB 2D9OA 4RX6A 4X4QA 3WX8A 1FDBA 4RW9A 3QFWA 4CI0B 5LT5A 3D68A 3DLEA 3P6YC 1T8EA 2AYGA 1R8CA 3TANA 3A3OB 4DR1J 5CD4H 1EKRA 2KG0A 1FFGB 5DG9A 1NSQA 1FKPB 2PMWA 2N3OA 1IKVB 1UMJA 4QZVB 2C3UA 4C8NA 4WXWA 1RWXB 2CQBA 2BZ2A 1FDNA 4DV6F 2KO1A 1T7PA 3PFOA 2XM3A 3HD1A 1X5PA 4O3SA 2NUHA 1UKUA 3CNQP 4DSFA 2ZE2B 3W8PA 2DNHA 4A8OA 1UEKA 3RB6A 1ZYQA 2VFVA 2WVDA
chains in the Genus database with same CATH topology
1U1PA 1RA7A 1MROA 5KT5A 2FLNA 3RAMA 1YJWS 1X9SA 3NNHA 1VK3A 1TP7A 2EFVA 4DDFA 3JTPA 4MFBB 4ETXA 3BQ1A 4J9LA 1PGZA 2HHUA 3OW2R 3M30B 5F0UA 3VF0B 3JSYA 2CQ1A 1AUDA 1J5OA 1FRHA 2LQ9A 5KFTA 1SJ1A 7FD1A 3KTQA 1YG0A 2KT2A 4C8YA 4IR1A 1S6OA 2K1RB 5F8MA 3CCRS 2Q3PA 5K14B 4K2XA 5T7LA 3MMAB 1WD6A 3QZ7A 2F9DA 3X1LB 4J5OA 1RWUA 3CCWA 4OLPA 1TR0A 3KNGA 1HW8A 3PNIA 3DCAA 1TL1A 3S1TA 4NLXA 4DSEA 4USJC 2GGPB 5HP1B 3OVSA 3MM7A 5A8KA 1QM9A 4NOHA 3PM9A 1N6QA 1H98A 3EPGA 2QMWA 5D8HB 4TY9A 3POTA 1G7CB 1EETB 2POKA 3D0GE 3IC1A 3W3SA 1HYSA 1K9MT 4ID5B 4IFYA 2RQKA 4TXSA 1WI6A 5DDPC 1Q86T 3GWCA 3BO2A 1LW2B 1UA1A 3MTKA 5KFVA 2VFSA 3MD1A 1JLQB 3BGRA 1F5BA 4AQYF 1HMVB 1GAOA 3GIMA 1T05B 4DG1A 2RD5C 3ITHA 3UCGA 1XMBA 3OR2B 2F7VA 4C97A 1RTDB 1LW0A 4PPDA 3QZ8A 2XMVA 4Q2MA 3V2UC 3C46A 3U1LA 3RRKA 2Q79A 3DHWC 4EBDA 5LSLA 1YITS 3CTRA 3IRWP 2QFJA 2IAJB 3DRRB 2PMZD 1MMLA 2R2RA 3CJ5A 3ICLA 5D6GA 5FLXY 1DHMA 1Z4UA 2N3LA 1VLYA 1ZM3A 3N6MA 1GXTA 3B8HA 3RB3A 3R1HA 1S9EA 1Q8IA 4L3NA 4DR1F 3V81A 2BQUA 4B9NA 3LP1A 3QGPA 2CVIA 4QYZJ 2R4FA 3NGKA 3K59A 2BABA 1X4EA 4KO0B 2D1CA 5KFWA 2HW3A 1HQUA 3G71S 1S76D 2WSFC 1WNEA 3NNCA 4Q0BA 1X4BA 4XK8C 2KHDA 2K7JA 5E7OB 2ZUGA 1QAYA 2FHOB 4TY8A 5DS7A 3I55S 4TU9A 2C42A 1YJUA 2LA6A 5J1NA 1UW4A 1VI7A 2XCPA 4RW4B 2B9WA 3BR8A 2PA3A 4X2BA 2W7AA 4HH0A 2X1GA 3KK1B 2Y1IA 4K4ZA 2HNDA 2MSSA 2I38A 4DQQA 2MKIA 3BO4A 2OPRB 2AJ4A 4NCGB 1WHWA 1HNVB 2E5JA 5D3GB 1N34F 2PA8D 2ZH6A 1TFWA 4ZP9A 1ZM9A 2ZJRQ 3HHEA 3LP0A 1ZTWA 1C1BB 1O51A 2GCFA 2N4CA 4UQTA 5KG1A 2FJXA 1HA1A 2PO4A 2DNNA 3SSRA 5EX3A 2KTQA 2YH1A 2KVIA 5C25A 2E44A 4OX9F 3GSDA 3KWMA 3O44A 1CLFA 3FSIA 4WTYA 2I1RA 4MKBA 5DQHA 3CCLS 2ZH2A 5U47A 3IGNA 5J2NA 4ZP8A 3BSOA 3RBDA 3QIPA 1O0PA 3O6QA 5KFMA 4ECQA 1AXQA 5F8GA 3OHAA 1UEVA 3D54A 3T3FA 1VJWA 4ELTA 1NH7A 1FO1A 4F26A 5GMKa 4YUDA 4F02A 2IC3B 4B17A 1Z2ZA 3MM8A 4WU2A 5I42A 4YMEA 2ZH5A 1ZAXA 1HBUA 4AL7A 1J5EF 1KHWA 1HHSA 2ZOFA 2VG7B 1TKZA 4J9KA 2RKIB 4X84A 5B0DA 1RT3B 2VFUA 2KG1A 2VBYA 1H2VZ 5KFRA 3KFWX 1R0AA 3PY8A 2JHEA 1JLBA 1C1CB 1XBWA 2YNFB 3HXMA 2CPZA 2ZDPA 5C42B 4DV0F 2E1CA 3RR7A 4HI2A 2E5LF 2UXCF 1OQ3A 3LQVA 2X1AA 2XNRA 4TQRA 1S6PA 1WELA 3GIIA 2A2DA 4ZP7A 2DK2A 1E6VB 5M2PA 2DH7A 2WB4A 2XSJA 4MYUA 3NGDA 4LF6F 4K4WA 4B3RF 5LL6d 2IA0A 3KLIA 2DCLA 4AYBD 3BEGB 2VD3A 4DSKA 1U49A 1FK9B 4OI4A 2C3YA 2V9KA 2OPQA 2EK6A 3NCPA 3OQ2A 4O3NA 2C22A 2XS7A 1RT1A 3I5CA 4A8XA 3RRGA 4L6V3 1HNIA 3PKYA 4CT9A 1LK7A 3MUTP 5E0OA 4QQBA 1MU2B 2CPXA 1YVFA 2IRXA 3K5PA 2GA7A 3IGVA 3EUNA 3FRYA 2XO7A 4KFBB 4YR3A 1RP5A 3H4DA 3MMBA 1CC8A 2J7KA 4PG5A 4A8FA 4NXMF 1HQEA 2ZOGA 5K8MA 2V5HG 2VH7A 3N4WA 4IKAA 3RAXA 4CQ1A 1KQSR 4ZPTR 3PVXA 3KG1A 3B82A 3VQSA 2DITA 4KT0C 1KEKA 2D74B 4LSLB 4J9OA 3KYLA 3CJ0A 4WKYA 4Y6IA 5A2QY 4URSA 3PIOQ 2RB7A 1AFIA 2LXFA 2CPYA 4FPRA 2DPIA 1VQOS 3FFIB 4FF4A 1T95A 2HWTA 3DRXA 4GO5X 1FHTA 3SSQA 1B0VA 3EYZA 3WDOA 4ETZA 1QVGR 3MR2A 1XMOF 1U48A 2KI2A 4MIAA 3E01A 3HP6A 3M30A 5J2QB 2KDOA 1CQNA 3WBZA 1U1NA 4BC9A 5IXUA 4C7QA 2DNLA 2MKKA 2HS3A 4ECRA 3BJYA 2GQ2A 1SIWB 4KE5A 3MECB 1URNA 1XEZA 4ZPVR 3KJVB 2KT5A 2OKQA 2Z2LA 2HLTA 4JI6F 4ZHRB 3MMAA 2HVZA 3HVTB 3ZZPA 3TO8A 5A0YB 1LXJA 1UWBA 1U1RA 3KLEA 2AX1A 1IKWA 1JLFA 1T3OA 1KC8T 2NZ4A 2XY7A 3GB0A 2DIUA 1YJ9S 4KJIA 4FP9A 2GGPA 2Y1JA 1R3NA 1DFDA 4HHJA 2Q6BA 2RVJA 1KFDA 2O5DA 3RBEA 3HK2A 2AF6A 3IAS9 4D3HA 3KHGA 2E29A 2Z0GA 2NYIA 1FKOB 2YWHA 1LW2A 2NUUG 2UUCF 3DC2A 5L9XA 1JLQA 2V8HA 2AGOA 2V0NA 5GAEU 1JNRB 1X7VA 5D78A 3HHLB 1T05A 3K8WA 4RW7B 3IR5B 2AU0A 3OR2A 4Q44A 4M95A 2LDYA 3GG1A 3THTA 3H40A 1C2PA 1F9FA 1VC0A 1RTDA 2NQPA 4IDKB 1YRXA 2G4BA 2ALZA 2H9ZA 5L8RC 3HKWA 1Q79A 2RDJA 1KLNA 3R5AA 4C0OC 1Y4ZB 2BR0A 3ENQA 4BCAA 3Q8QB 4BDPA 1NNDA 1XNQF 2HVIA 1HW9A 1OQ6A 3DRRA 2C2EA 5DLFA 1ZAWA 5IFMA 2DH9A 2YKMA 3PRDA 3F41A 2JSXA 4HL9A 1IKXB 4I7FB 4JUZA 7FDRA 5EHHA 2JLEA 1MNEA 2JWNA 1S10A 2O67A 2FVQA 3PRBA 3N6NA 1IXKA 1KQKA 1X5OA 3OXFA 2B43A 1B0PA 2BM1A 2V4QA 4J9MA 4ED1A 4IR9A 2UXDF 2ROGA 2VB6A 3UQSA 1QAJA 4HEA9 4WFZA 1MWYA 2YWGA 1CC7A 3SV4A 2BA9A 1GNKA 4KAIA 4URQU 3DOLB 3MFIA 1TVRA 1ZETA 2KN4A 2ZH9A 3EGWB 1KNZA 2BV3A 4NLYA 3KLVA 2MGZA 2KM8C 4J9PA 4DS5A 1S7HA 3I4HX 3IWXA 4IOCQ 1SUQA 3IN5A 4CH1A 1GXUA 3ONQA 4WFAQ 2FLLA 1IUJA 2XI3A 1YWXA 2YNHB 3KK1A 2V9WA 1FEHA 1NRKA 3OTDA 3OJSA 3O2IA 3PX0A 3D1HA 3MAHA 4RW9B 2OTLS 2O66A 4NCGA 2HGMA 2VZ9A 2JC1A 4RW8B 4ZS6A 3NS6A 3J7ZT 2EFNA 3CD6S 4YFUA 1VRTA 1VK8A 4QWDA 2ZKTA 1B7FA 1RA6A 3HHLD 3Q0AA 4M63A 4OHZA 3JSRA 2CRLA 2VKZG 2AWZA 4Y00A 3NL0A 1APSA 5H9EJ 4O44B 1SIZA 4LIRA 4ZP6A 1E6YB 4ED8A 4FYDA 2DO4A 1N4LA 2HQIA 4Y3CA 4O3RA 2VUGA 1JIHA 2HGLA 5K9FA 3UDLA 3L7PA 4TNOA 1XWLA 4FVMA 1JLCB 3TX8A 2FJVA 3MR3A 5DLGA 1F2GA 4FZVA 2IC3A 2J7UA 1X4GA 2HFZA 2WBRA 3FCHA 2LU1A 5K5MA