4WFNQ

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22 in complex with erythromycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfnQ00
4CH1A 3MD1A 4PKDB 2JVRA 1SJRA 1FNXH 1B7FA 4ERDA 3H2UB 2MKHA 4QU7A 1U1OA 3S7RA 1DRZA 1N52B 4ZKAA 2M9KA 2DB1A 3US5A 1K8AT 2KYXA 1FT8A 2CQBA 5GAEU 1M5KC 2DO0A 2DNYA 2DGOA 2F3JA 2QA4S 4UY8T 3FEYB 1WEYA 2J0SD 4M5DB 5BJRA 2M0GB 5CA5A 2N82B 4F26A 1SXLA 1YI2S 3SDEA 2D3OR 5HL7Q 1KOOA 2DGSA 2CQPA 3CUNA 1JJ4A 3CCUS 2E44A 2KG1A 2CPFA 2JX2A 1CVJA 2MQNA 1D9AA 3SDEB 2MKKA 3CCES 2DGWA 1UW4A 2X1AA 4LJMA 2DNGA 2CPIA 3NS5A 2KRRA 1DZ5A 2VOPA 4IOAQ 1QM9A 3CC2S 2CPEA 2DIUA 3P49B 2L9WA 1S79A 2QEXS 1QVFR 2CPJA 2DISA 1VQ5S 1S72S 1FJEB 1WWHA 3VF0B 3J7ZT 2ADCA 3S6EA 5GAGU 2RRAA 5JVHQ 2HGLA 4TU7A 1Q86T 2FC9A 2KN4A 1VQPS 3MUTP 4LMZA 5D78A 2MY8A 3D2WA 4F25A 1UFWA 3TYTA 5GMKa 2OIHA 2CQ3A 5LXRA 2KFYA 3NNAA 1N54B 2MPUA 2DITA 2DNQA 1JJ2R 2KRBA 2NLWA 4WFAQ 1NU4A 2E5JA 1Q82T 1AUDA 3CMAS 3CC7S 1G2EA 2CPZA 2SXLA 1X4AA 3MDFA 2KG0A 1WELA 2LMIA 2CQDA 1XN9A 1M5PC 2X1GA 1VBYA 1KOHA 1VQLS 2J0QD 2DNNA 5GAHU 5IQQA 2KH9A 3G8SA 3THPA 2OTLS 1X4HA 2N7CA 2KM8B 3UCZP 2MZQA 2YWKA 2DNRA 2EK6A 2LECA 3UD4P 2DGVA 3EGNA 1M1KT 3UD3P 2UP1A 2K3KA 5EN1A 2LA4A 1A7GE 2J76E 2KT5A 2OSRA 4WFNQ 4YB1P 1HD1A 2E5HA 5DM7Q 2MHNA 3VAGA 2D9PA 2G0CA 4FXWA 1VQ6S 2GO9A 2PE8A 2MB0B 5ITHA 1YJ9S 2CPDA 3SXLA 2HZCA 3CC4S 3BO2A 1KD1T 2MSTA 3LQVA 5LSOA 3S8SA 2DNPA 4P6QA 3VAFA 1VC5A 3B4DA 3CD6S 3CCMS 4TU8A 4YOEA 2D9OA 3G8TA 2DGTA 1WI8A 2M52A 1P27B 2CJKA 4WIIA 5CYJA 2MQPA 2HGMA 2XNRA 2RRBA 1YJWS 3MUMP 2DHAA 2DH9A 3CCRS 2YKAA 5HO4A 2G4BA 2RQ4A 3CPWR 2U2FA 2A3JA 4Y00A 4TU9A 2I2YA 1X5PA 2M2BA 1X0FA 5FJ4A 3R1LA 2MQQA 1U6FA 2KU7A 3G71S 2GHPA 1VQ7S 2DHSA 5DDPC 3HHNB 4C7QA 2LEAA 1VQMS 2LCWA 3K0JA 4IO9Q 3CULA 5H1SV 3THTA 4W90B 3H2VE 1VQ9S 2FHOB 2AYMA 2F9DA 2MQLA 2M88A 4RU2A 2DNHA 1WG4A 1X4EA 1ZH5A 4F02A 1HL6A 4CQ1A 1VQ8S 5IM0A 2MMYA 3U1MA 4CIOA 2OJ3A 2MZ1A 2RVJA 2KHCA 2LYVA 2ERRA 2J8AA 3EX7B 1FHTA 2XSFA 1U6BA 5LXYA 2VOOA 2L08A 1SJ3P 1X5TA 2BOPA 1WF2A 5LSLA 5IM0B 2XS5A 3NMRA 1SJQA 2ADBA 4FXVA 3P3DA 2CQ0A 1SJ4P 1M5VC 3TO8A 1OO0B 2M7SA 3ZZZA 3G96A 3N9UC 1YTYA 1YWXA 3VAIA 3IWNC 1R8PA 4QU6A 3NNCA 1WHXA 2XNQA 1NJIT 1WG1A 2ZJRQ 2FY1A 1IQTA 3IRWP 1QVGR 1YITS 2M4MA 1WF0A 1FO1A 4V19X 4A8XA 1FXLA 1A9NB 5CXTA 3R1HA 2MKJA 2KXHA 2YTCA 2QFJA 1DHMA 1X4GA 2JWNA 4QPTA 1OWXA 2DNMA 2RT3A 4QQBA 2U1AA 1K9MT 1VC6A 3PIPQ 2RUGA 1WHVA 2DNZA 2B0GA 1RKJA 2XS2A 3EGZA 5DDRC 3J7YU 3CCLS 3ULHA 1U1MA 2OTJS 2AYEA 2WBRA 4EGLA 3L3CA 3BO4A 2DHXA 4W92B 2ZJQQ 2DGXA 2JRSA 3CTRA 1W2BR 1H2TZ 2FC8A 3CMES 3B4MA 2EK1A 2M70A 3I55S 3OW2R 2DO4A 1M5OC 1P1TA 2DK2A 2CQHA 1HA1A 2OSQA 1BY9A 1URNA 3I56S 4IUFA 1F9FA 1SJFA 2DIVA 1X4CA 1X4FA 1VQKS 2O3DA 1WG5A 1Q7YT 3LPYA 2CPXA 1X5OA 2BZ2A 3VAJA 2RNEA 2DNKA 1U1LA 2MZRA 2E5GA 3V4MA 3BEGB 3TP2A 2KI2A 2NZ4A 2CQ2A 2G1DA 1WEZA 4LIRA 2LXIA 4J5OA 1H6KX 5JVGQ 3RW6A 1Q81T 4OZ1A 2AYGA 2JVOA 2MJUA 1WTBA 2KVIA 3MD3A 2KXNB 1OPIA 2FPHX 2VONA 2M8HA 1OIAA 2CQ1A 3SMZA 3BS9A 1U1QA 1FJ7A 4OZ0A 3NNHA 1X4BA 2DGUA 2F9JA 2DGQA 2LA6A 1NO8A 1VBZA 1KC8T 1H2VZ 3VAKA 3CCJS 2XB2D 2YH0A 1ZZNA 1X5SA 1L3KA 4UQTA 2MZSA 4C0OC 2DHGA 2MQMA 2HGNA 1WF1A 2CQ4A 1JJHA 1UP1A 1RK8A 2L41A 1VQOS 1U1PA 1KQSR 2RS8A 2RS2A 5MLCV 1WHYA 2KXFA 4PR6A 1U1KA 1H2UX 2HVZA 3VAHA 1JMTA 2CQIA 1U1NA 2N3LA 1FJCA 1VC0A 3P6YC 2DNOA 4ED5A 1UAWA 4WFBQ 4C4WA 2LXUA 3MUVP 1VQNS 4Z2XA 4CH0S 1U1RA 4WKRA 2MKSA 5IFMA 1VBXA 4Y0FA 1WEXA 2MGZA 4WF9Q 3PIOQ 3HI9A 2RQCA 3DLLQ 2PEHA 3P5TL 2MKIA 2EVZA 3VAMA 4U67Q 4WCEQ 4PRFA 2X1FA 2MZJA 2LEBA 3CCQS 2DH7A 3MI7X 5GVQA 3G6ES 2MGZB 5DDOC 3UCGA 1PO6A 2K8GA 5LJ5Y 3MOJB 2MKCA 2CPYA 4YUDA 3CCSS 2CQGA 1YJNS 1X4DA 1U2FA 4IOCQ 3ZZYA 3VALA 1R8HA 4TLQA 1WHWA 3MXHP 2CQCA 1DBDA 2AYBA 1O0PA 2E5IA 3FEXB 4BS2A 3G9CA 1VQ4S 2MJNA 2X1BA 2VODA 2Q79A 1WI6A 3UWTA 3MURP 5DDQC 3RW7A 2HYIB 2V94A 5DETA 3CXCR 2DNLA 5D77A 3S01A 2ZJPQ 5DM6Q 3Q2TC 3Q2SC 2MYFA 2M8DB 3CCVS 2MQOA 3U1LA 1YIJS 1D8ZA 2MSSA 2MXYA 2KM8C 3DXBA 5LJ3Y 1K73T 2CPHA 3CF5Q 3BO3A 1YHQS 3UCUP 1ZZFA 2LQ5A 3G4SS 1HD0A 2N3OA 2YH1A 2RU3A 5GADU 2AD9A 1N88A 3R27A 2MZTA 2MY7A 3JB9k 2DH8A 1N8RT 1PGZA 2XS7A 1M90T 3NS6A 2I38A 2LKZA 3UE2A
chains in the Genus database with same CATH superfamily
3MD1A 3K8WA 3QGIA 4QU7A 3HHLC 4K4TA 2LXFA 2UVWA 4FDFA 1HBUB 2DGOA 2QA4S 3C8YA 4NYOA 4YHHF 4Y3CA 5HLFB 5KFIA 4TY8A 1X8DA 1RT1B 1U48A 2AW0A 2HQGA 1FX2A 1C1CB 1RTDB 4ID5B 4F67A 3PRVA 2HFSA 5A76A 1CJUA 4RNFA 5DQGA 2ZH7A 4WU3A 3HFKA 1VQ5S 3CNQP 3DRRA 1PC4A 1T9YA 2ZD1A 2RRAA 3UDVA 4QPXA 1GXLA 3TAMB 2YPZA 3CDEA 3PW2A 2BJ8A 3UR0A 2DVIA 3TUPA 4RW7A 1YVFA 4URGA 1RJJA 3CMAS 3TWZA 4K4WA 4DUZF 4JYAF 1VQLS 3G8SA 1RTHA 2HRTA 2IJRA 4RO0A 5B0DA 3UR3C 2LVWA 4RW9B 3QZ8A 3M8YA 2ZHOA 3MM5A 2D74B 3D4JA 1F1BB 1HD1A 1UVJA 5DM7Q 5E5NA 5D3GB 1CJTA 1LWXA 5ADZA 1RHKB 3OR2A 4NRUA 2VPXB 5KG2A 1N6QA 1AROP 4DQPA 4L72B 4UQGA 2IC3B 2B6AA 2JC1A 4YOEA 1S6PB 1C1BB 3CO9A 4CLTA 4GMKA 2HBYB 2I0XA 3M8WA 1NPRA 1S99A 2V69A 3CULA 3TA1A 2DT9A 2FLOA 4RX6A 2BANB 1T95A 3BBCA 4J9LA 2ZH2A 4PAAA 1R6VA 3MTKA 4HR2A 4B9LA 2OJ3A 3TA0A 1MN7A 1TVRA 2IM1A 4DPTA 5LSLA 2HVIA 1FE0A 4NA3A 1YWXA 3IWNC 3T5HA 1SPBP 5B0BA 4X4OA 2M4MA 5I3PA 2ILZA 4C8ZA 1NDCA 4V19X 5ETQA 2GIQA 3VZIA 3OFFA 4HEA9 1NSKL 1S1VB 3M9NB 1HHSA 3KLHB 2RUGA 2LDYA 3J80U 2E1AA 2ZZMA 3NOCA 3IAM9 4KKOB 2JFKA 1D9DA 4W92B 5H9EJ 1DTTB 3DOKA 4IG3B 5J2PB 3RAQA 4KSEB 1P1TA 1RHMB 2ZBRA 4YFUA 4DV5J 3I9V9 4AL7A 4DL6A 4P10A 1MLAA 2C2DA 3UVJA 3BEGB 1VRQC 1ZAXA 2YWHA 4OZLA 2DR9A 2QLWA 5JVGQ 2YKMA 3M8QB 2M8HA 3GIJA 3BS9A 4USIA 2J9DA 3IXQA 3QFWA 2IJNA 4ED8A 1IBCB 3PRDA 3MOZA 1S1WA 5KFWA 2FJWA 5BR8J 2OMOA 3S1TA 3T1HF 3W2VA 4V19J 1RXOB 2HVZA 5D4LA 3CJ8A 2A2DA 2LU1A 1Q53A 4DUYJ 3LP1A 3H8YA 4LREA 2OLWA 4O3PA 3DLHA 4PQUA 1NKCA 1E6VB 3KLEB 4K5RA 1U1RA 1MSWD 3RB0A 4ZHRB 1OYEA 3PYEA 3A3PB 1RAEB 3BSCA 5KG4A 4QIGA 3AFGA 3PHEA 1ZTTA 4DFPA 3UCGA 1FRIA 3DFEA 3UN5A 3V2UC 3LGMA 4IOBA 3M6VA 5J2MB 1O0PA 3GJQB 1VQ4S 2YQ3A 4IR1A 3FQKA 4O0NA 3CXCR 2I5JA 3KUHA 1XR7A 3Q8VA 2GA7A 1YQHA 2M8DB 4KE5A 1Q5YA 5KFFA 1RB0A 1R0AB 3R7NB 2AHOB 2E7VA 1NRKA 5HVHA 2AX1A 4B3RJ 1S0MA 3T5JA 4UT4A 1LNQA 1RLDA 5F0WA 1AB8A 3BPDA 3G8QA 3H5YA 3NS6A 2B4VA 3VV2B 1GTHA 3H2UB 1VI7A 1FKOA 3HPOA 3KYLA 1M5KC 2DO0A 4N76A 2VU5A 4PEOA 1CJKA 2QA4G 3TZXA 4TNOA 5LMUJ 1SXLA 3G2XA 2D3OR 3W2WA 1D8YA 5HL7Q 2CQPA 1CQMA 2KFZA 2CZ4A 3IM8A 2E1PA 4PABA 2AJ1A 3CCES 2V9WA 4RL1A 5A8KB 1P6TA 3MPWA 3K7RA 3ETOA 3QBCA 1S79A 3M6XA 1QVFR 3TZZA 5D0RA 3SCJE 5HBMA 4AYBD 3H98A 1IKVB 4KIAA 1TKXA 1ZBTA 5CHCB 1RT6B 5ETKA 2NLWA 3KK1B 3ZTSA 2O5DA 1NJXA 1AUDA 2ZVSA 1G2EA 4AL6A 5BR8F 3V6DA 3N28A 2X1GA 5AE3A 5K8OA 2OGUA 3N6MA 1IM6A 3AA9A 4DUYF 3T9NA 1DTQA 2BX6A 1YG0A 1JLBA 3R5CA 1JXVA 3PX4A 2H54B 2QJ3A 3M2VB 3A8IA 1SC1B 3AQOA 2B5JB 3F73A 2XLIA 4KV8A 3LWLA 3OR1B 2GVZB 2XM3A 2K2PA 2K3IA 4CP5A 1VC5A 3QT7A 3PV8A 3HVRA 1V3RA 2XO6A 5C5JA 3CCRS 1H73A 2YKAA 2G4BA 2MLYA 4A8QA 4TU9A 4ILMA 2CA9A 4FVCA 1TAUA 2W2QP 4KO0A 1FVSA 4ER8A 2LEAA 3CEDA 2FHMA 5KFRA 4R8UA 2XZTB 1IKWB 3GYNA 1WD6A 4KYZA 3KUEA 2EFNA 4RW8A 3U1MA 4JI3F 2ERRA 3UNYA 2XGPA 2XSFA 4ZVHA 1X5TA 5IM0B 1Y7PA 3MEGB 2FIUA 2B51A 4ELUA 1FEHA 4DV4J 3QWPA 1WHXA 1G3OA 3KLIB 4Q45A 2R7XA 2XZWA 4F4KA 3DMJB 4OQJA 1IQTA 3H7HB 2MEWA 4CO5A 2MKJA 4DS5A 2DXEA 3DRPA 2RT3A 1GK8A 3ZXWA 1S48A 5HROB 5B0FA 3Q8UA 2CNLB 3OJSA 2AYEA 2R42A 4ZLNA 3HHDA 2YNGB 3B4MA 3HVAA 4DSFA 4ZJOA 3BGRB 2DIVA 1EP4A 4E8UA 2O3DA 1SKSA 4PG4A 1SUQA 1KTVA 3P96A 3CJKA 2NZ4A 2KFNA 5U47A 2PMWA 3HHEA 2KVIA 2V8DA 5E0OA 2ZZNA 1FI4A 1C0UB 3EJMA 1XMQF 2A6OA 1KDNA 2XY5A 4OZ0A 1UEKA 2LA6A 3ENQA 2HNDB 2PD1A 1H2VZ 4NXMJ 3CCJS 1RT1A 4M5HA 4P2SA 4ID5A 4CLSA 1RTIA 2QC3A 1U6ZA 2BJ3A 4A8KA 2JHEA 2DNOA 1BQXA 2NR0A 2Z56B 2ZOFA 2RAQA 3OVAA 3TAMA 1B70B 3FBBA 4ZS6A 5IFMA 3VVTA 3LWMA 2XI2A 2ZEJA 3ET6B 3P5TL 1I51B 4KH1B 5KFBA 3JTOA 3MR2A 1N32J 2BJ9A 2MGZB 1BUXA 1S59A 2EW9A 4OHVA 4DMZA 1X9SA 1RT7A 2EC0A 2MKCA 4YUDA 4ED1A 4NMXA 2QSFA 1TKTB 3CCWA 3OVBA 5GMDA 2MJNA 3CJ2A 2J9DE 3JSRA 3RW7A 3WBZA 3MMAB 3HULA 2ZJPQ 3W65A 2MYFA 4PWDB 2UUAF 5D3GA 2HQIA 3T3FA 4KH0B 4DI6A 2PDAA 4NLTA 3HHLA 2YH1A 2DCLA 1BE4A 2EFPA 4DR6J 4ZVEA 2IC3A 3V4IA 2BE2A 5AXKA 4ZP9A 4M1KA 1C1BA 4CH1A 2JVRA 3OPKA 2X51A 3GPAA 1IR1A 3KUGA 1LW2B 4CZCA 2WOMB 1KOOA 4DSLA 2QTWA 1KONA 2CPFA 2OPSA 1REVB 3IR7B 2F65A 4I0WA 1VRUB 1R27B 5KFCA 4XPEA 1U25A 1S72S 1UEUA 3Q86A 1HNWJ 4TU7A 1TL4A 3KG1A 2IYGA 5KFPA 5H9FJ 4DUTA 3SI8A 2Y1LB 4NXMF 4URQU 2E5JA 4RPFA 1KFDA 3NGUA 4YR0A 1S1VA 4JUZA 3KLHA 2R7QA 5CQGA 5BXIA 4HACA 4MIAA 2HHQA 2J6TA 4A8SA 4QCLA 1QDUB 5A2QY 1KSPA 2FYXA 4IG3A 5J2PA 2Q1LA 1RAIB 5KFKA 4QW8A 4X4QA 2ZH1A 4WJBA 3O1LA 3KJNB 1NJWA 4LFAF 2CWXA 2YNIB 3UFCX 5KT6A 1KD1T 3GYXB 4PG6A 2GQ2A 4OYPA 1R6YA 4KFBA 3JSYA 1B3TA 4G1QB 3CJ3A 1SB6A 1LV5A 4KGKA 2HBZB 3OLBA 1MG7A 1BQMA 2H5EA 4E0DA 4WIIA 2XNRA 4WKYA 3TVKA 2A3JA 1X0FA 4OHZA 3OL6A 2EXUA 2IVYA 2AQ4A 3PX0A 2IBOA 2KTQA 2K7JA 4GVLA 2B3TB 2MQLA 3OTDA 3HVTB 3MZIA 2DNHA 1EIYB 1CJVB 4IRKA 2ROPA 1UEVA 2ZE2B 4F4WA 3KLEA 3UD5A 4DV2J 2EFQA 3AXMA 3NP5A 1TL1A 4ZHRA 1C4CA 1F60B 1SJ3P 3DDIA 3FQLA 4J9VA 4JI4F 3HSDA 2HURA 2UUBJ 4H4KC 2HVHA 3VWSA 2FD2A 4Q44A 1TK0A 4OX9J 1KRPA 1QUVA 3HF5A 1WOSA 5J2QA 4Q8FA 4DBQA 2KXHA 4WP8A 4NZ7A 2HQDA 5EWEA 5B08A 2BQ3A 4H4OB 1Y0HA 1RBLA 4DSJA 1Y4ZB 3D3CJ 3CVKA 2IPOB 3PCOB 1W2BR 4USUA 3OW2R 1BY9A 1URNA 3C16A 4FPRA 2X3DA 2HS3A 4K4VA 3W66A 3ZNUA 5THWA 1TMJA 3TP2A 4Y2AA 2CQ2A 1M0SA 3C6TA 3BREA 2G2ZA 2FPHX 5A8RB 5KFTA 4URSA 1VJWA 2NS1B 5CD4A 3D28A 2FVPA 4C3KA 1MROA 4ANDA 1PAUB 1X5SA 4WXOA 1LW0A 1M5SA 2MZSA 2VC1A 1SC3B 5AXLA 2MQMA 1KTQA 5GADI 1WF1A 2CJXB 4C11B 4DV3J 2ZH3A 2RS2A 3AD8C 3A12A 1UTAA 2RDIA 3GR1A 1JMTA 3EZ5A 3JAMY 1FRMA 3PJXA 3DOMA 1ROFA 4PPDA 4Z2XA 2AKWB 1JWWA 3RUBL 2P6SA 4FYYB 2XSJB 4Y0FA 2AGOA 2Z30B 4QIWD 4HTJA 1RT6A 4RNHA 4HI2A 3UDLA 3QO9B 2DH7A 4R0EA 2G0IA 5BYQA 1R31A 2MHEA 4F36A 4ENOA 1O51A 2HAFA 2COLA 4UTGA 3TVZA 2Q79A 3QQCD 1NK0A 4X84A 3OQ2A 2DNLA 4LSLB 4ZCIA 4QZVB 4DV2F 1NHVA 4ZA1A 2MQOA 3JXOA 3KNAA 2B5JA 4K8RA 1RWMB 1WC6A 5CYMB 4ZPCA 2CPHA 5SZTA 2W4CA 2XMTA 4EBCA 3BO3A 3CD0A 5KFEA 4ZVQB 4CH7A 2CXEA 2UUBF 2N3OA 2FVSA 2O01C 4N8NA 1L5UA 1TFYA 2MZTA 1FFGB 4OX9F 3D9BA 4ERDA 4MKYA 3TUJC 4C98A 3ZO7A 3RB6A 1RI7A 4X62J 1EKRA 1HNVA 5A8WB 1IR2A 3MMJA 2BM0A 4ZJLA 4M5DB 4B9VA 3KXDA 2DD8S 3QT6A 3D54A 3DYAB 1KLNA 2YVSA 3CCUS 5L38A 2KG1A 4Q0BA 4KJIA 4AXIA 2VFVA 2A1BA 4RW4B 3OTEA 1UW4A 3KK3A 3OLAA 3PR4A 1F9HA 1XMOF 1HFEL 3OV7A 3SV4A 4UOGA 9RUBA 3NGKA 3J7ZT 3TR5A 6FDRA 4WE1B 1LWCA 3M32A 1FK9A 1WC1A 4L6V3 3MUTP 4LMZA 1UFLA 5J1EA 2HW3A 1SL1A 4PPZA 4NASA 3Q89A 2MPUA 2UUCJ 2KRBA 1X9WA 4DV1J 1VRTB 4UF4A 7FD1A 1SQEA 3NRBA 3IRXB 2BV3A 2BACA 3MCOA 4QIEA 3U7JA 3W60A 3T9ZA 2APOA 4CT9A 1N0UA 1TFWA 3Q8RB 3BN4A 2YNGA 3R9LA 4HDHA 1SQFA 2C2OB 2KT5A 1RQ0A 2E5HA 3IN5A 3IBFB 1DAXA 2VG6A 1GMWA 2IVMA 5HP1B 3SXLA 1DY3A 1H7XA 4M5IA 1RLCL 5E2QA 2EG1A 3LA0A 2B7CB 1C0UA 3CD6S 1WI8A 4PYDA 3CDUA 4DFMA 1ZA1B 5DG8A 1NKEA 4O0IA 2DCUB 3DHWC 5ETOA 2VB6A 3IP0A 3EM1A 3B82A 1L3VA 4F3OA 3UN2A 4LF2A 1RAAB 3PW7A 2P9GA 4KGZB 2HFUA 3MAQA 4F02A 5C2CA 2W8KA 3SQGB 3OTOJ 1WF2A 2BE9B 1NJZA 1M5VC 1FCAA 1R8PA 1V5VA 1WG1A 4M95A 1YJUA 1ZYQA 4U96A 4AT1B 1FKPB 3HD2A 5J1PA 1D3WA 3IS9B 2NXNA 3R6LB 2E9ZA 1PG5B 4YDXA 3DM2A 4DR5J 2JRSA 3NBPB 4HH0A 3M4XA 5F9NA 2VFSA 3I4PA 1SV5A 4WFXA 1O8BA 4KHPJ 3D0HE 4CYUA 2YBVA 1WG5A 2UUCF 1S57A 4NI2B 4DV1F 1N56A 2R7TA 3V4MA 1U4BA 4I2QB 4DPOA 4CCHA 1J5OA 1PBUA 2MJUA 1N33F 3MEEB 3Q24A 5B7WA 2WOMA 2F8EX 3RJMB 5HN0A 2RQMA 4QR1A 2Y9HA 1TAQA 2HGNA 3FC9A 1UP1A 1U1PA 2RS8A 1U1KA 3IGVA 4X66J 3Q8SB 2JEJA 1H0HB 1FDAA 3R6GB 1RWNB 2NYIA 2OUGA 3TANA 5E3PA 1Y5LB 4WK3A 2X1FA 2MZJA 4HHUA 3CCQS 5CZVA 4DOZA 2OFHX 5L9XA 1PJ6A 3MOJB 1DJ0A 1MNEA 4C97A 1U2FA 1QTNB 2ILYA 3SQOP 4ZPAA 4TLQA 3CJ0A 2CQCA 3MM6B 4NLRA 4C8OA 3RRHA 1RT4A 3D3BJ 1YJRA 2QLXA 1NXIA 3FMBA 3GCXP 2V0NA 4OLOA 3OTOF 1D8ZA 5KFZA 2KM8C 3SSSA 3TUIC 3BR8A 2GMLA 3CF5Q 2YNIA 2ZDPA 1CBKA 3UCUP 1R7IA 2Z0GA 2YWWA 4ANEA 3G4SS 3LGHA 5DJBA 4A8MP 4G1QA 3QRPA 3TVYA 1FF2A 3BKFA 2J9CA 3SCLE 2M70A 3TUZC 3C14A 3EGWB 3IGNA 2EPIA 3KKFA 1DRZA 1HMVB 3EPGA 4HLBA 1FT8A 4LR7A 3H40A 4OYIA 5GAEU 4MKAA 4OI2A 2M0GB 4DR5F 3HM9A 4HT7A 2OEJA 4I7FB 1QSLA 1NB7A 1R8AA 3ZZUA 1DQ9A 3WIUA 4LBPA 3HVTA 4OYBA 4DN9A 5JUMA 3HKWA 2ZE2A 2XQCA 4KHPF 3I87A 1E6YB 1HWUA 4I2PB 4FN5A 2QEXS 2QA1A 4PXEA 4LVNP 3WC2A 5HQLA 3DHXA 2Z57B 5IT9U 4FKXA 2AJ0A 1CULA 2KVQE 5IXUA 4KR0B 4MJKA 4A8OA 4BC7A 1FVQA 2KG0A 4X66F 2J0QD 3HZGA 3OXFA 1UL3A 2KM8B 4DV0J 3UCZP 4ECTA 3NL0A 3HSZA 1M1KT 2MTLA 3LALA 4UUWA 1IKYA 2OH2A 2LQJA 4TN2A 5F8MA 1Q5VA 1U47A 3VAGA 4OI3A 2O66A 1N5YB 4FNHA 1U49A 2FTRA 2GZOA 4NXNJ 3DOLB 1X60A 4BBYA 4WTOB 1RU1A 2JC0A 4TVAB 4DSIA 5A8RA 4NE9C 3F41A 4K4ZA 3CSKA 4JI2F 2MDAA 3FUYA 4WBFA 3PO4A 3TJ9A 3QWUA 3GU0A 4DX8H 1VQ7S 5DDPC 4C11A 1F5CA 2LCWA 3K0JA 3WC0A 3RG6A 5K5MA 3TX8A 1OQ6A 4CLLA 2UXDF 2EBEA 4UOFA 5C24A 1X4EA 4E98A 2H65B 3PVXA 4UZCA 3CIMA 1VQ8S 3GTYX 1U7LA 4BWJA 2RB7A 1U6BA 4XIUA 3QO9A 3NAHA 3SFUA 4FXVA 2IM2A 5KFMA 4LSZB 1B4SA 5KT4A 3BDEA 3NNCA 3DCAA 2BA9A 2JNJA 2E7WA 3AOAA 1NAQA 2FJAB 3I96A 3AA8A 3JSMA 4F0HA 4FF3A 3VQSA 3GMGA 1L3SA 3K57A 1LK5A 3ULHA 2V67A 2IM0A 3HSGA 4USHA 3H5XA 3BQ2A 2GQQA 5CYMA 5J2NA 1DLOB 3SSRA 3X1LB 2F5GA 4ZIVA 2UXCF 2DO4A 2XC9A 2OSQA 1FNMA 5MAOA 2GW8A 4ZVOB 5CCMA 2R2UA 1F9FA 1QE1B 2W2PP 1GQEA 1LEOA 3TW0A 2E5GA 1FXDA 1BGXT 4XPCA 2FB0A 1J2VA 1JXEA 2HNYA 4DHVA 1XMBA 2ZDOA 4UY85 4KBIA 1RKIA 1MMLA 1KN6A 2PT0A 4LQ9A 3NG8A 4PWUA 3HP6A 3CJRA 3QLHB 4YP3A 2ZUAA 3A3NB 3MR6A 1TL5A 1DQAA 4RW4A 1RK8A 4P2MA 4B9TA 4NXNF 4FF2A 1WC3A 1WTFA 1VC0A 4MIBA 2OEKA 4DQIA 2Q66A 1VQYA 4XO0A 4C4WA 3KJFB 1S4FA 2B9WA 1YRUA 3KWMA 4PUOB 2MKIA 4F8RA 2OPRA 3MI7X 2VFTA 5GVQA 1F6TA 5AE1A 2HMIB 3CMQA 4ZLPA 3TZYA 4ZVFA 3CCSS 3ZZYA 2GO8A 4I4BA 2CNOB 4YY3F 1AZSB 2AEFA 2IA6A 2VF3A 1FDDA 3MAAB 2HG4A 2MKYA 1KR4A 4J9SA 1NLKL 1UVIA 3WX4A 2IY5B 1N5TA 1JLAB 1TQLA 1WJ9A 2OO4A 1N36J 3HX9A 1GMVA 3TA2A 3CJ5A 3PRBA 2DH8A 1HWLA 4KY3A 3HVWA 3T1AA 1M90T 3D66A 1YBUA 1FNXH 2H51B 2B43A 1N52B 2RRNA 4FVMA 2JLGA 4LVOP 1OS5A 1GEHA 4TY9A 3KTQA 4DV6F 4F26A 2HFZA 2I9SA 2IHR1 2QX0A 1RWVB 2QT7A 3ITHA 4TKTA 2PC6A 4FS2A 4ZCLA 1QJHA 1ZS6A 1SC6A 2JX2A 4RZRA 2MQNA 2EFVA 1XBWA 5KFUA 4ZMMA 4LBIA 1F2HA 1K44A 4YN3B 4RU9A 3SQGA 4HI1A 4CDIA 1NPKA 2CPJA 2FHKA 4J9UE 3ZC4A 4LFCJ 5GAGU 1UPMB 2WVCA 1CJUB 5ETNA 2CJ9A 4ZJQA 4ZITA 3Q8QB 4Q5VA 1PYOB 3DRRB 2ZD1B 1P9QC 3MM7B 3QAUA 3IS9A 1M5PC 2B9YA 4RW7B 1UJ5A 3HJFA 1CEZA 4WTYA 1G6BA 8ATCB 2VL1A 5HMXA 2ZM6F 2V9KA 2LA4A 2IDLA 4ETXA 4DPUA 5DZ7A 2IFXA 1RTHB 2J76E 1Q8BA 2XMMA 2OSRA 4A47A 1FRXA 5ITHA 2CJQA 2HZCA 3MM5B 3W1YC 3IC1A 4GRSA 3OTCA 1CJTB 1RBOB 3LGNA 4P6QA 2BJ1A 4G3IA 3TQEA 3H25A 3FJ2A 4K0KJ 3BF4A 2CJKA 5FD1A 4XAKA 4WPAA 2MQPA 2DHAA 1VJQA 2YKQA 3RTVA 2AGQA 4B9NA 3VGSA 4ZCKA 1S76D 4ITSA 2BEFA 3R1LA 3ISND 1NH8A 2GHPA 1XIQA 1EJ7L 3M8ZA 1RCXB 4RWXA 3LH2S 3ZTPA 5M2UA 1SVDA 1N36F 3UI3A 4CQ1A 3C15A 1HW8A 1HBOA 2OP5A 4FF4A 5EUHA 2RVJA 4QWBA 1TKDA 2E1CA 4EI2A 3J7Z5 2EC2A 4DR4J 2PO4A 2ADBA 1TVRB 3EVWA 2HHXA 1XTZA 4QU6A 2NXEA 1UJ4A 1UJ6A 2UU9J 4F7VA 3MM6A 2ZITA 1KVJA 1RHQB 2CJAA 4NOHA 2IM3A 2UUWA 3W5ZA 4LRFA 3V6KA 4D3HA 4OX8A 1VGYA 2CZVC 2R4FA 2WBRA 4P75A 1ULRA 1H2TZ 3CMES 3MMCA 2VDIA 2G1HA 2VQFJ 3RYLA 3DOKB 4MAKA 2BZ2A 2AMCB 4F0MA 1T0TV 2C3UA 1IBKJ 4I1TA 2HFVA 4S0MA 2LXIA 1FEEA 1S9FA 3ZTRA 2OMLA 5A6WA 3IMQJ 5ETPA 2DGQA 1T3OA 2YKMB 3C2PA 4O4GA 3QIPB 2V8HA 1JLFB 2K06A 3R5DA 3AH6A 4X4PA 3CCTA 2CQ4A 2L41A 3BKTA 8AT1B 1E6YA 1WHYA 3BSAA 1HI0P 4DQQA 2ZVIA 1S1WB 3R7SB 2GAGC 3W2VB 3D6HB 4LF1A 2RIJA 2BRKA 3LP1B 2HQ3A 3CD7A 4OYAA 3DRXA 2Z58B 4WK1A 2J6SA 3QIDA 1YGYA 5EWFA 2WSCC 4DPYA 1HARA 1H38A 1YZ6A 1TL3A 5DDQC 2J7UA 5D77A 2GJ2A 2VBWA 3Q2TC 4EYIB 3CCVS 4CM2A 3EVMA 3F44A 2MXYA 3JQJA 2YNFA 4C8LA 4DR4F 2PI5A 3DOLA 4LT6A 1ZZFA 1S10A 4O44B 3FBEA 2XMUA 3MCNA 1TUVA 3P4UB 2UU9F 3P8BB 2E1RA 4C3LA 3CIZA 1NK6A 3BV8A 4W98A 1UKUA 1G4CA 3ILOA 2DNYA 4DR1F 3ILJA 1B0PA 5H9EK 2B4OA 1PC5A 1QAIA 4DPWA 1CJKB 2VQFF 3U27A 4FXDA 4MMOA 4ZPDA 2KRRA 4GO5X 3HO1A 3HK2A 1IBKF 3FSYA 2JL9A 3HCXA 1TL7A 5M2PA 1WWHA 2V50A 6AT1B 1R8CA 2HGLA 3PY8A 3R97A 5L1IA 3D2WA 5GMKa 1LWFB 4ZLLA 5HBMB 2KFYA 4ZCMA 1IN0A 4DQRA 2PMZD 4GKJF 3MGJA 3OHAA 1NU4A 3OTBA 4ZVUB 3MM8B 3FRZA 1TKXB 1X4AA 3EE3A 3OD2A 4AD6A 2R9LA 4J9NA 4JV2A 2XLJA 2EK6A 3V6DB 3MCSA 3V81B 3SEOA 5E33A 1AUSL 4CM0A 3NGDA 4WFYA 1QE1A 2MHNA 3J80Y 1VHFA 2QLFB 7FDRA 3QT8A 1T9WA 2HQCA 2PE8A 2X3GA 1YJ9S 1JLBB 3CC4S 2R7VA 3N6LA 3S8SA 4FPIA 4KC5A 4CWBA 2GX8A 3SYZA 4CLFA 4X2BA 3HXMA 1P27B 2HZAA 4ZVTB 4IRDA 4Y28C 4MH8A 1QSSA 1KVKA 2C2RA 1U6FA 2D3ZA 3MTJA 2QMWA 4NLVA 2V4RA 4PXBA 3AB2B 4NCAA 4L73A 1FESA 2HHHJ 3PO5A 1AW0A 3BPSP 4Y34A 4KO0B 4JI8F 4KT0C 4RU2A 2L3MA 3UW1A 1S49A 4KGVB 5EWGA 2CIMA 4R8UB 4RBUA 4OHYA 5K14A 5A6PA 4Z7CA 1Q8IA 2V4QA 3BQ1A 2HHVA 4RW8B 3AODA 3DLJA 2BJ7A 4OI0A 4WU2A 5DGBA 3JQKA 1FRJA 4A8XA 1Y00A 2DNMA 2C3YA 4LF6J 2YWGA 2EG2A 1MWQA 2EFGA 2ZBCA 3MPYA 3DGPA 5DDRC 5LM7E 3R2CJ 1W7WA 4J7CA 2FC8A 2E5LJ 2UXBJ 2XCAA 3I55S 2J9EA 2D3UA 2CQHA 2Y0BB 3ICLA 2VKZG 5FLXU 1X4CA 3Q23A 1B64A 4F3QA 2RF2A 2KDOA 3C6UB 1T9XA 2RD5C 4CNZA 5B0GA 3ILLA 4DLGA 1PAEX 2KI2A 1EP4B 4X4NA 4CLWA 2KXNB 4NLOA 3UDEA 3CJKB 3OXGA 4LRAA 4B3TF 2ZNZA 4K5SA 3PDNA 2DGUA 3ZZTA 2BQRA 5KAKA 5FDLB 3PZPA 4NA2A 2N7YA 3K5MA 1BQNA 3DDNA 5ETSA 1TMMA 4F50A 2HK3A 3I0RA 4JV0A 1JLCA 1I3OB 1TKZA 2BXJA 2O1PA 1OY6A 1RTIB 3P45B 4OYWA 5F8LA 4OYOA 2AZ3A 3FDSA 3DN9A 3GIRA 4IR9A 1WSVA 2EVZA 3FCHA 5IWAJ 4OMFG 2D69A 3G6ES 3H90A 3MM7A 1YBAA 3KMQA 2OD4A 5LJ5Y 3GSIA 1FX4A 4EZ9A 1VR6A 2Y1RI 2HHHF 2AYBA 4ECXA 3QAEA 2I6WA 3EYZA 1RT7B 4PG5A 3GZ7A 4B3SF 3I5BA 2NYHA 3T5LA 2Q3PA 3B54A 3GQCA 3JSBA 1HYSA 4KHMA 3BM7A 2CZ9A 4R25A 1D09B 1HD0A 3TI0A 2GHVC 3NLCA 4UW2A 7AT1B 4OJHA 2Y3YA 4RR5A 4IQXA 4OI6A 5L1KA 1NK7A 1NZ8A 3HHLB 4PKDB 3WZ0A 1RHJB 4FBTA 3V4IB 2HBRB 4M5NA 2BE2B 4V1Ak 3DLEA 4LF8J 4DR7J 4ZPTR 2X7IA 2NCKL 4LFBJ 2OFGX 2E5LF 2UXBF 4HKQA 6FD1A 1JJ4A 1XNRJ 2WZ1A 4MT1A 4PG8A 3H0PA 2BE7D 4ZDNA 1HPZA 3NS5A 1DZ5A 3E01A 4KPCA 5HATA 2OPSB 3BDPA 3P49B 1MWYA 1KHWA 2ATLA 2HQFA 4LF9F 5G4DA 3M9MB 4K59A 1JQGA 4QIVA 2NXCA 4LF7J 1NKBA 3TOQA 2KN4A 4WFZA 2MY8A 2W8LA 1K0TA 1U8SA 4RW6B 2CADA 1XEZA 3IBCB 3CC7S 2WCXA 5J1NA 4B3MJ 1HNZJ 3KLGA 1Q7LB 4RNNA 3DLGB 2NUHA 2DNNA 1NDKA 5FIIA 2N7CA 2DNRA 4CTAB 4HACB 1N34J 1S97A 2HBQB 2CRLA 4F4ZA 3LP0A 3SFGA 2GO9A 5IWAF 2C28A 1JB0C 2CPDA 5T7LA 5KFJA 1K47A 4EEYA 4B9UA 3T1YJ 3ZZRA 1W26A 2DNPA 4OJ1A 3W8GA 1RHUB 3N0VA 4RNMA 1S0VA 1HLWA 2HHWA 1NK8A 4DN0A 4GVBB 4KFBB 3IWLA 1YJWS 4OX7A 1GTEA 1FDNA 2RUSA 5HQMA 3W64A 1PIEA 2EKNA 1BQMB 5D0GA 3DC2A 5ETLA 3QIPA 3HSJA 1JLFA 3KLFB 4H4MB 2GIRA 2VG7A 4PZVA 3RB4A 4ECRA 5JMNA 3G87A 1IR0A 4RUAA 4DR2J 2I1RA 3BZQA 3LOUA 4NMLA 2DY9A 1B0TA 4G6VB 1FNOA 2YKPA 2J6UA 1U26A 2PMHA 2MZ1A 2A0FB 1JLEA 5LXYA 3HLUA 2H48B 1TL1B 4IFYB 1YTYA 4LF8F 5K20B 3QJPA 4RLEA 3OFGA 2H4YB 1WC0A 1Z1ZA 3IRWP 1GX5A 4DV7J 1WF0A 2QE5A 4Q2MA 1OWXA 4HH1A 1K9MT 4OHXA 2XMWA 5J2QB 3UDCA 4Z7YA 1QLNA 5KFQA 4CNYA 2XYHB 3FGVA 4RWWA 5K9FA 4LF7F 4O44A 2F1FA 5F8HA 3MF5A 5H9FK 1OSDA 5I4MA 3VZHA 4EMDA 2CPXA 3ENVA 3ONQA 2XMJA 4DSKA 3C16B 4OI4A 4B3MF 4LR9A 4AL5A 2LLZA 5AJ3J 2VONA 2YWFA 2E9TA 3MPVA 5DLGA 4ATNA 2JLFA 2XY7A 3UPFA 3C6TB 4O23A 4JI1J 3PW0A 3M2UA 1HHTP 5D15A 2WSFC 3MR3A 5L1JA 1N34F 2JOQA 4Y2CA 5A0YA 4C0OC 4NLDA 1FD8A 1YRXA 1XJWB 1T03A 1MROB 3PKYA 3BGLA 3MAHA 2VDHA 1F9EB 2B8PA 1LW0B 2F4VJ 1EB0A 3P6YC 4LRBA 3T1YF 3QGPA 4DV5F 1UAWA 2XBPA 3ZZPA 3EGVA 1WUUA 4ZPWR 2RKIA 3HI9A 2CUYA 1LWFA 3LPEA 3DOMB 4D3GA 3T19A 2C2MB 1NEEA 2PFFB 1MN9A 3MM8A 2V4JB 1N4LA 1P8GA 1ICEB 4R0JA 1ZAWA 4XK8C 1HIYA 4NLQA 3QGGA 4DR2F 1CQNA 2AEMA 2QRRA 2W9BA 1XNQJ 5F8IA 5IC6B 2YXLA 2V34A 3D68A 3WIVA 3V81A 3R2DJ 1RDRA 4N77A 3Q2SC 1UETA 4QR0A 4U8VA 5LJ3Y 2KKHA 1EQ0A 2UUTA 3HDSA 4DU7A 1EKSA 1TELA 1N0VC 1RZMA 1SQGA 1IBMJ 3PJ9A 2VBYA 3AD9C 1UA1A 2I38A 3RRKA 1SJRA 1YRTA 2D41A 4DL4A 1U1OA 2IA0A 2CG4A 3QRQA 3KHHA 1HR0J 1K8AT 1GFWB 4MFBA 2DR5A 4ZN3A 2OPQA 2WSEC 5CA5A 1U02A 4JI5J 1HNVB 3D0IE 3ZNJ1 1HI1A 5CH7B 1RT3A 3GFZA 2ZOGA 1KLMA 1RWPB 2C3MA 2MLXA 1SKWA 1CC7A 4F4AA 5IT4A 2AGPA 4DG1A 4Q0BB 4B3RF 3CC2S 4I6WA 3CDBA 5L46A 1X7VA 4P2XA 5KFVA 2HAIA 2HRYA 3KK3B 1K0VA 2FC9A 5IV4A 4QWAA 3BGUA 3MR5A 1S9EB 1S0OA 1UFWA 4JI1F 2CQ3A 1IJFB 1F3FA 1LWCB 3M32B 1FK9B 1NB2A 1RWWB 1UWAA 5L9NA 5LMUF 5J1EB 5G0RB 1XWLA 3KJVA 3M05A 4IKAA 4P73A 4LUBA 3DRYA 5DGAA 1NJYA 3HFZB 2F4VF 2QG9B 3KNGA 5HQ8A 1RA7A 3V5RA 4F2SA 1O6XA 3N5BA 4K4SA 5EN1A 2P9EA 4C8YA 3LUYA 5D4NA 3RB3A 4N47A 3G6VA 4DFKA 4XDDA 3KHRA 4FXWA 1FWKA 3C6UA 4QWCA 4QYZJ 3CW2C 1QAJA 1SCJB 4PQAA 3VTIA 2VG6B 3DRSB 4P74A 5EDWA 2B4UA 3PXGa 3IR6B 1XNQF 2WHOA 2YX7A 4NCBA 3GFXA 5FDLA 4Y00A 1D0EA 3HHKA 3HHNB 2IMWP 1VQMS 4JP8A 4LBHA 3IFEA 3A4TA 2AYMA 3GIIA 3AT1B 2DYAA 3H5SA 3ZTQA 4A8WA 1IBMF 4M5MA 2NSBA 1L3TA 1ACMB 4B9MA 3TEHB 4TYBA 4ES1A 2VOOA 2IRUA 1HR0F 1Q1KA 4Q2LA 3PX6A 2IMOA 4DFJA 3GIMA 3D1HA 4KQZA 2EKYA 1T94A 2CFXA 4F4YA 3J7AN 2KJVA 1RE1B 1YITS 2JSXA 1FXLA 5CXTA 2JWNA 1NH7A 1RTZA 2VKRA 3QSYB 3GB0A 3JTNA 1IWAA 4FKYA 1Y5NB 3NGRA 1J5EJ 3R7BB 2DGXA 3TARA 1OQ3A 2P5VA 3NGTA 3MM9B 3CGIA 4OYXA 2KZZA 4WZQA 3P5BP 2XWXA 4NCGA 4C6AA 3DM2B 2BKNA 1SJFA 1F5AA 3FCWA 1VQKS 3PACA 1NSPA 1SV5B 1SIZA 4DV4F 5KT2A 3IG1A 4I56A 3DKDA 1RT2A 1U0HB 2ASYA 4CYUB 4ZP6A 2JVOA 5GAHI 5IV3A 4B17A 1J5OB 1YKWA 3KDNA 1L3KA 3H42A 2V2VA 2XI3A 1SL2A 3K89A 3PKMA 2Y1IA 1QTMA 2LP4A 5C25A 2NXJA 2P6TA 1RSCA 3FZ2A 2LXUA 3FCVA 3MUVP 1VQNS 3FVYA 4WIQA 4DPXA 3PTWA 3QRRA 1EAYC 4HL9A 1WEXA 1BWVA 2XYPB 2PEHA 2EFOA 2FHJD 4RW6A 3OHBA 1RYRA 5GMEA 4ZOSA 2YNHB 1HNXJ 2VJVA 3HFVA 2CQGA 1JIHA 3DLGA 3MXHP 1HQEA 1NK9A 1Q8KA 2L9DA 4CTAA 3GYGA 1S9GB 2VICA 2F7VA 2H3EB 3G82B 2IBKA 3D1QA 4IG0B 2FJXA 1RT4B 3OFEA 2WB1D 2ATCB 2H4WB 1RAHB 1BC6A 2P8IA 1GT8A 2CJBA 1N32F 2QV6A 4QWDA 1N48A 4GVBA 2ASJA 3M8PB 3QPIA 1OMSA 3ISNC 3KLFA 3C14B 4H4MA 2F3JA 3ZZ0A 4UY8T 3DLKA 1J5EF 4ECQA 2W7OA 1B0VA 4CLZA 1HWKA 3SDEA 1CPZA 3LAMA 3KK2A 2ZHAA 2CVIA 1SI9A 1D9AA 4USMA 1UA0A 1IQZA 1HKAA 1S1XA 2CPEA 2DIUA 4P9SA 2DJWA 2FVCA 1VQSA 4DR6F 3GSDA 4C9DA 2ADCA 1Q95G 4DS4A 3W63A 4I69A 4IFYA 4RUHA 4EU0A 5D78A 1S7IA 1JJCB 3NNAA 1K1SA 3FMWA 1J27A 5BYSA 2JFDA 3QZ7A 1RP5A 1UCNA 2CPZA 2EWHA 1CULB 3EDRB 1OY8A 1FE4A 2WRMA 2ZFHA 1FTCA 1S12A 4K7QA 4JI0J 3I6PA 4YMEA 5F9LA 2UP1A 4OI1A 3LP2A 2V2QA 3WX8A 1S1TA 3PW4A 3W9JA 1RAFB 5EHHA 1IM4A 1HNWF 3VGVA 1IKYB 2Z2YB 4HHHA 2YKNB 2MSTA 1HNXF 5LSOA 3FNNA 2ZOMA 1DURA 2PA3A 3QNWB 4FP9A 4UZBA 1OJ4A 4A4JA 4MK8A 1UWBA 4QBUA 3EXCX 2WBMA 3QATA 3ISZA 3DI6A 4U95A 1HQUA 5AE2A 3WHIA 2U2FA 4DL2A 4Y2IA 1X5PA 2VASA 4M5JA 5H1SV 2FJVA 4DCPB 1RT5A 4QJVA 1AT1B 2HFOA 1JLGA 1ZH5A 3L9ZA 3BYRA 2JH3A 3OXLA 3GG1A 1Q79A 4C8KA 2IIHA 1HNIA 2XO7A 4CIOA 5C24B 1TV6B 2J8AA 3TRGA 2XS5A 1SJQA 3J81Y 1NNDA 1HW9A 4W4MA 2V4JA 2UVVA 4GO7X 5E3QA 3GILA 5K8MA 2CAJA 2LFVA 3AB4B 4F2RA 2W24A 3RRGA 2W9CB 2YTCA 4QQBA 1CG2A 2J8SA 2KJWA 4USVA 5CCLA 3JSMB 2QMXA 3LO3A 1T05B 3CTRA 3BSOA 3PFEA 3T1HJ 4PXCA 2OI2A 2ROEA 2VPYB 5J2NB 1LKZA 1R43A 4N8OA 1V9OA 2D7SA 3C3LA 1VBKA 4FYDA 3J7A1 1M1HA 3JYTA 2AIRB 1U2CA 4ED4A 4LRDA 4Y2MA 3MD3A 2HZVA 4JI7J 2A10A 1IBLJ 1LOUA 3GV5B 2NUUG 3NNHA 1X4BA 4LRCA 4JI0F 3NWGA 2GHWA 4ZVGA 2HNYB 4EWTA 2UVRA 1NSAA 2YH0A 4ECYA 1S5ZA 2DHGA 1JLQB 4L3KA 4X65J 3W61A 2PIIA 3NCPA 2XTJP 4FYVB 2GJIA 2DPJA 2Q6CA 4USTA 5ETTA 1FWLA 1WC4A 4JI6J 1T02A 1S9EA 2QO3A 4ES3A 3TAQA 5L8RC 4P7VA 1KBRA 3EUNA 3R5JB 4OYZA 5G0RA 2G13A 4B3OB 4DX5A 1X4DA 5AXMA 2OPRB 4EYHB 5IT9Y 1DBDA 3J81j 1OSCA 2AEJA 3G9CA 3FEXB 5CAAA 5RUBA 2VODA 3MURP 4DV3F 3PW5A 5GAGI 1ZM4A 2W7AA 3QJJA 5SUHA 3O2IA 2GNKA 4TLRA 3OSNA 2HKEA 2WW4A 3R5AA 1XR6A 4NLYA 1QUPA 2CDQA 1VISA 2MLZA 4L76A 2HWHA 2DR8A 2R7UA 3DRSA 3R27A 1S6QA 1PGZA 2XGQA 2VPWB 2GIFA 2J7WA 2ZWOA 4K4XA 2M9KA 2ZWPA 4ICLA 3PFOA 3MEKA 3FEYB 1WEYA 2BJEA 1C0TA 3K58A 3BJYA 3NKYA 3TEGA 4NPOA 1S1UA 1KQFB 3BH7B 4I6AA 1YSJA 5CYQB 2GC8A 2OELA 2Q43A 2X1AA 3N4WA 3ITHB 3M9OB 2GMHA 3MFHA 4LF5J 4PCQA 4DCOB 2WONB 2CWKA 3BBFA 2DISA 2AJ2A 1MMDA 2KZMA 4USKA 4JI7F 5JVHQ 4L74A 3AXKA 1IBLF 2XLKA 4X62F 2WVFA 3GV7B 1ZAVA 1XR5A 4NYZA 4X4VA 2DITA 2DNQA 4X4SA 3NXZA 2SXLA 4X65F 4QOTA 1KS2A 1WELA 1XK8A 2FLNA 4RNOA 1Y9OA 2AF6A 1ELOA 1X4HA 4YEAA 2YWKA 4BC9A 1VOMA 3QFHA 3MM9A 3I5CA 2GGPB 4JI6F 1SKRA 3GWCA 4X4TA 1UZDA 2R8HA 1VQ6S 5BYRA 4QYRA 5DG9A 3SZ2A 4ED6A 2VZ9A 4MTPA 3BO2A 2E9RX 4JV5J 4P71A 1U0HA 2HVEA 4JI3J 4FF1A 1IJEB 5F8NA 3VAFA 2DY1A 3MR7A 3K59A 2BRLA 2M52A 2A6MA 2QL5B 3WQPA 5EGYA 5HO4A 4RBVA 3RBXA 1Q0NA 5E3CA 2M2BA 1F0XA 4JB8B 4XDCA 1U8WA 4NLXA 4HYKA 2DHSA 2UV8A 2AU0A 3O44A 4I6YA 3THTA 4ETZA 4Q43A 3IAS9 4EK2A 3JS9A 4J9MA 2ROGA 1KQKA 1ZM3A 2F8HA 3POTA 1U0SA 3J81U 3I4HX 1W25A 1VIOA 5I42A 1H3DA 2OAUA 3C15B 3M6UA 1HBOB 1JKHA 3MFIA 2WVEA 3VAIA 2W7PA 2YNHA 3BBBA 1QAYA 4UUXA 2GJFA 2C42A 2QN6B 3R1HA 1XMQJ 5D4PA 1RGVA 4USWA 1VC6A 1S9GA 5M2RA 2VG5A 1MU2B 4KB7A 4KTQA 1X31C 4LF5F 2XS2A 3DNCA 3G82A 3J7YU 1G1XA 3EMTA 4NEYA 4F4XA 1C4AA 4QIFA 4IG0A 2XWYA 1LWEB 3LF0A 1Q7YT 3LPYA 3MMCB 2R2SA 2Z2LA 1CS4B 2MZRA 2PSZA 1TU0B 5KFXA 1LXNA 3M8PA 2AYGA 4OZ1A 1WTBA 1VLYA 2HSEB 4WYLA 4RUCA 2GS8A 1BHNA 2CNNB 2LQ9A 4AUKA 4C8MA 3AJDA 1ZZNA 5D6GA 4BHQA 2GVDA 3AOBA 1KQSR 3CJTA 3LW5C 2YWEA 2BVZA 4O4GB 3K17A 3G6XA 4DXLA 5E7OB 4IQMA 4JV5F 4JOUA 3KDOA 5I3UB 5JXSA 4WFBQ 2HLUA 2UUAJ 4DWIA 2XYGB 4WKRA 1PSDA 2NQPA 1AFIA 1GXUA 4ID8A 4YDDB 1HWIA 1D1UA 2NSCA 2K1RB 1PO6A 3MEDA 3VALA 4CLYA 2CYYA 4IDKA 1X0PA 4DF8A 1HBNA 5DQHA 3KG0A 5IOLA 1FDBA 2I8EA 1I1GA 1KP6A 5DM6Q 1S7HA 4ANCA 3RR8A 2LQ8A 2RHQB 1V5IB 2HS0A 1TL3B 3IBWA 4USJC 4OZNA 1MWZA 1K73T 1YHQS 4ZVRB 1Q8LA 2YKNA 4N41A 2HNZA 2C22A 3VVUA 4YR3A 3M8RA 2AD9A 2YNFB 2HWTA 2F63A 5LT5A 3JB9k 5AXNA 2FLLA 1HBUA 3UE2A 4YR2A 3D6TB 2MKHA 1UFKA 3LAKA 2DB1A 1JNZB 2KYXA 2L48A 3FBCA 2W01A 5HLFA 3ENWA 1WORA 1C1CA 1RTDA 1YI2S 1UVLA 2CDRB 4N7TA 4J9KA 3I0SB 2E44A 2R8IA 2ASLA 4QWEA 2DGWA 3AY0A 4OZJA 1DFDA 4WXWA 3EVOA 4NLSA 4DF4A 3PYFA 1TV6A 4O3QA 4H4KA 5DRKA 3RAXA 4LFAJ 1NM2A 1ZPWX 3H4BA 4F25A 4OZ3A 4KGMA 4CO4A 1TL7B 2PFDA 1BMQB 3AD7C 2OD6A 3BR9A 4YQWA 2W9CA 2FZCB 3BKUA 2LMIA 4RW9A 3L95X 1B7YB 3GP9A 1W2IA 2NPIA 3THPA 3G6YA 4G1PA 3DGVA 4GC6A 4TQRA 1T05A 2N4DA 2VFRA 1YZ7A 4ZLJA 3UD4P 4Y2KA 1SL0A 5E3AA 4E2FB 5T14A 2GV1A 3VCDA 3NCRA 1TK8A 3T6JA 2K7KA 1FKAF 3NS7B 3GFHA 4FS1A 3W8PA 5HI7A 2RDJA 3ADAC 4MIWA 1IVZA 1RA6A 1IXKA 5KG6A 1S6PA 3HZEA 2J0XA 3WDOA 2ZKTA 4IH6A 1CLFA 3Q8PB 3A8KA 3L7UA 1HBMB 1DQ8A 4JI4J 3CWJA 2WVDA 1N5QA 2HGMA 4CI0B 2LDIA 2DH9A 3QSIA 2RQ4A 2H9ZA 3CPWR 3QMQA 1NCLA 1JLQA 4DV0F 1VMBA 1T7PA 1KHVA 4X4RA 2BANA 3O6QA 3FSIA 2IRYA 2ASDA 5KG3A 2UV8G 1WG4A 4NRTA 5E3RA 4P2FA 4UOCA 3SCKE 3K2YA 3JTPA 2UVUA 1FHTA 2BOPA 4N5SA 2BYCA 1SJ4P 2XULA 1OYDA 4B3OA 5K14B 2W2NP 3Q83A 4DU8A 3ZTOA 3IM9A 2DR7A 2UZAA 1YJ7A 3PYGA 4ZIWA 4IO1A 1NDLA 4M5LA 4KKOA 2V68A 3O5TB 1WDDA 4K2XA 4DZDA 1WHVA 4NLUA 1DTTA 2H5IB 3M6WA 1VFJA 2ZJQQ 2RHSB 1K1QA 3DGPB 3V6JA 1EHWA 3ETMA 4IYQA 4IUFA 4OIXA 1LK7A 2FY8A 1WKJA 1Y5IB 3SCIE 3M8QA 1APSA 3BB5A 3H2LA 2G1DA 3N79A 4IRCA 5JJBA 3VGTA 5CABA 3T5KA 3G86A 2RF2B 2VH7A 2J5AA 1D9FA 2B8QA 1JX4A 1FJ7A 5L1LA 2BM1A 4M5GA 2F9JA 5KG5A 2ZH4A 4UQTA 3N01A 3KHLA 5CYQA 1RADB 2NPFA 2W1BA 1E6VA 1U1NA 3BGFA 1BQNB 2WONA 5KFOA 2VIHA 1TK5A 1EX8A 1EZZB 3I0RB 3O3LA 4F3MA 4F0KA 3E51A 1JLCB 1FXRA 1VBXA 1SBRA 1TKZB 4TQSA 3E3XA 1LFWA 1FRLA 4U67Q 1YJTA 4U6PA 3PJWA 1PKUA 2BUNA 5J2MA 4U7CA 1REGX 2CPYA 2KT2A 2CG8A 1F5BA 1VS3A 2LQBA 4BS2A 3H5UA 1JXLA 1VHIA 2ABYA 5KOWA 4NWBA 1DARA 1R0AA 2GGPA 5KG1A 1GMUA 3M1VB 2KO1A 3CJSA 3DXBA 2JJ4D 1S6UA 3OT9A 3BN7A 2RH3A 4LQ3A 3DLBA 3KOAA 2BBEA 2D1CA 1HYSB 1V3ZA 3GLJA 1YBTA 4DEZA 4ED0A 1XMOJ 2FGCA 2XS7A 2W4PA 1I6JA 4KPYA 1B7FA 3U02A 4QR2A 3FZBA 2G9OA 2FJEB 5BJRA 2ACMA 1NK5A 4ZVPB 3U1NA 2DGSA 5A8KA 3DLEB 2ZZTA 3E8OA 1RBAA 2R8KA 3GV8B 3CT9A 4O3RA 3DDKA 3I32A 1Q4RA 3L7OA 2DNGA 1CSJA 2VOPA 5D0EA 1LXJA 3EPIA 1IKVA 4LIWA 3K5LA 1FJEB 1EARA 1HPZB 3E01B 2C2EA 3KK1A 3TYTA 4PXDA 1NPPA 1GNKA 5LXRA 1RWKB 3TNVA 3SBMA 4EO8A 4G1IA 1SKUB 4N56A 4FBUA 4OHWA 2LEPA 3EZOA 4NEZA 3RBEA 4Y65A 1MU2A 2CQDA 1XN9A 2ZBPA 1WACA 3H20A 1Z2ZA 1T9VA 3GFYA 1KKHA 2OTLS 2ACYA 3KLGB 1QAXA 3M2VA 2DGVA 3M2RB 3GJSB 3R5BA 3RR7A 1LWEA 2RU9A 2BJDA 3OR1A 2GVZA 4I68A 2G0CA 3W7BA 4LFCF 3ZZOA 2B9XA 3PYDA 3W3SA 1CS4A 2CKWA 4H54A 3LP0B 1H72C 1UPPA 2DRBA 1WNEA 1GX6A 5F8JA 5T7LB 3B4DA 3CCMS 5FLXY 3PEJA 3Q0AA 4I64A 2VHGA 2WAQD 4NZ6A 2NZCA 2VJUA 3HHLD 1RHRB 4P52A 4J9OA 1FD2A 2I2YA 1EQMA 2V8PA 2MQQA 3HT3A 3GG0A 1PCAA 1IKWA 3HD1A 1P1LA 2VBXA 5ETMA 1RAOA 3H2VE 1FERA 5LSRA 2FHOB 2VG7B 5I3UA 4Q8EA 1U09A 3MECB 3B78A 1Y3KA 1YK9A 1SJ1A 5IM0A 2XG8A 2DPIA 3MEGA 5KFGA 2OHDA 4O3OA 4M8LA 4MKBA 2FUG9 3KLIA 3DU6A 1Y3JA 5C42B 3DMJA 3NMRA 2FZGB 5KT7A 3L09A 2K1RA 4K0KF 3RBDA 3ZZZA 2WK4A 1R0CB 2J7KA 4OV6A 1TR0A 2Y1JA 1JLEB 5HVGA 2FY1A 4IFVB 3OL7A 2C2NA 5HROA 1N33J 5A2QU 1Z2LA 2VA3A 4OLPA 4C0BA 2BR0A 3FBFA 1QY7A 1OY9A 3AJ2A 2U1AA 2DEIA 3GJTB 3PIPQ 1ZETA 2B0GA 2VA2A 3CCLS 4EGLA 4KRWA 3OL8A 5F3TA 3BGRA 4G65A 5KFNA 2LU2A 2HHUA 2POKA 4HT5A 1M5OC 2DK2A 1RWUA 4R5PB 3FRYA 1X4FA 1X5OA 2RNEA 3UO0A 2Z4PA 5B09A 5KT3A 1WEZA 2B7BB 1Q81T 3CCZA 2HNDA 9ATCB 1R0BG 3E2EA 2A2CA 1H7WA 1H98A 5KG7A 3ZFVA 1AYEA 2CQ1A 2VFUA 3SMZA 1NMEB 3QYYA 3K5OA 5LL6d 3VHQA 1NO8A 1YJVA 5LOQA 1VBZA 4DLEA 1KC8T 3I0SA 3RBZA 3M2UB 4PR6A 2Z8QA 1Y11A 4U9RA 1L3UA 2AJQA 4NLGA 5A0YB 1YDLA 1XERA 4L3NA 3OUYB 2QA2A 1T03B 3ET6A 1RWXB 2VUGA 4NLPA 5KFSA 5B0AA 5E41A 2MGZA 3M7VA 3ELHA 4CT8A 3MPUB 3VAMA 4PRFA 1BD6A 4DL0C 3V6HA 1Y10A 2RKIB 5DDOC 2BOAA 1TKTA 2BQUA 2YQ0A 4MKVA 1KEKA 3MMAA 3OJUA 1R8HA 2AP6A 2F40A 1RABB 2AT1B 3FSXA 3CDWA 2RDDA 1IUJA 5ETVA 5KG0A 4PWDA 2FZKB 3NWRA 2ZHBA 1WI6A 5DS7A 2W9AA 5DETA 5K8NA 4J37A 2W9BB 4K2JA 3U1LA 2BDPA 1Q16B 4DJBA 2IRXA 2JEIA 1MMNA 1NZAA 2RU3A 3PHTA 2G2YA 4HHJA 3A8JA 4CO2A 1HBMA 3R8YA 3D7SB 3W5XA 1LW2A 2KU7A 1UZHA 4F04B 4CLUA 3S7RA 5F8GA 1CC8A 1IKXB 2NREA 1KQGB 1KWMA 3QJLA 5DLFA 5DQIA 1REVA 5I3QA 1SH2A 3PNIA 2IJFA 3AAWB 5D4OA 4MFBB 4KGXB 3JAMU 1VK3A 1VRUA 1JK9B 5F0UA 2OPQB 1CVJA 1GAOA 4ECVA 2YPYA 4Q7AA 1RT3B 2M3DA 2QL7B 2HIQA 2F4FA 3KMSA 4WYWA 2W2OP 4YS2A 2O67A 1KLMB 2WVBA 2VC0A 5DO2A 3TQ1A 4UOHA 1TUGB 2CNKB 4DG1B 3K8VA 2XMKA 2ZKUA 1KVIA 2R8GA 5D8HB 1AFJA 1T9UA 5C2GA 2RE1A 2RJZA 3TAPA 3HJVA 2ZH9A 4JI2J 3AJ1A 1VBYA 5GAHU 2V2ZA 4WWSA 2IYIA 2KH9A 3KJVB 2L9NA 2MZQA 3FKBA 3UD3P 1AXQA 2K3KA 4K4YA 4ILRA 4AXJA 1PJ7A 4DZ6A 1T3NA 5HMWA 4YB1P 2UXDJ 2DHHA 2D9PA 3A1YG 2KL8A 1R8BA 1NUEA 4C2MA 1UMJA 3CJ4A 4EBEA 2PEBA 3SSQA 4EO6A 3LQVA 8RUCA 3H4DA 1LQ9A 2D9OA 3C66A 5CYJA 2RRBA 2FJBB 4RBTA 1UVKA 5DG7A 3NCQA 3W62A 3VR1A 2WW8A 2B56A 1CJVA 4P72A 1VQ9S 2ZC3A 4B02A 4HVZA 2F9DA 2FLPA 5HJXA 3KG4A 3D6FB 4DR3J 2GFFA 2QIFA 1GXTA 2UXCJ 2KHCA 2OPPB 2QGFB 3EX7B 2Z2ZA 2CVEA 3P3DA 3TJAA 1ZTWA 3TO8A 1OO0B 3AQPA 2HFNA 5F41A 2ZJRQ 3CO0P 3Q8YA 1T11A 3EICA 1QVGR 4WP9A 4DL7A 4EZ6A 4H4OA 2QFJA 4QPTA 4RUBA 1I94J 4K4UA 3A13A 5HJYA 4RKUC 3DXSX 3K5PA 3AHPA 2HEKA 3EGZA 3M1VA 3BSNA 3BO4A 1S6OA 1ZM2A 2XMAA 4QW9A 1R89A 4IH5A 3HKZD 4DL3A 4DL5A 3RZAA 4BWMA 2PGCA 2JEFA 3VAJA 2DNKA 3N5FA 2RQKA 4I67A 2DRDA 3IR5B 4NCGB 3SV3A 1JNRB 4LIRA 2QLBB 1VYAA 3VGUA 1OIAA 1I5OB 3A8EA 3IG1B 5IS2A 4CLPA 1RT2B 1UVMA 1FWPA 4LF6F 1GMWD 5L39A 1PJ5A 1N5VA 5KFDA 4ECZA 4FYXB 4CRJA 4YY3J 1PYSB 2GMJA 1JJHA 1VQOS 2AV5A 1H2UX 5ETRA 1KNZA 4QYZK 2XSJA 5C25B 4CH0S 2IAJB 3I5AA 3OFHA 1U24A 3PIOQ 2RQCA 4LSNB 3IO1A 1EETB 4WCEQ 2LEBA 1XQIA 4ZN1A 4ECSA 4OV1A 2R8JA 2RMLA 2PA8D 1YJNS 5LMNJ 2QMUB 4LSLA 1RTJB 2E7XA 2E5IA 1URRA 4DR3F 2RILA 1ZOTA 2HYIB 2V94A 3PEHA 3M2RA 3RAMA 4DV6J 2E66A 1HQEB 2OKQA 4OYMA 4O3SA 2P9CA 4AFFA 2FJDB 2WTFA 2BABA 5KFYA 2BW7A 3FFIB 1OPZA 5CD4H 2DTJA 4DQSA 5GADU 4FZVA 2ZH8A 1N8RT 2VPZB 2Y8WA 5A8WA 4ELTA 2ZBIA 4M5DA 1FA0A 4ZKAA 1I94F 3UN3A 1RYSA 3F0NA 2CQBA 1LFPA 3NY0A 3DYAA 4J9QA 3KHGA 3JQMA 2IVFB 4EFAC 2N82B 4OX6A 2AZ1A 4MYTA 2AJ4A 3DLKB 3MECA 4EBDA 2FVQA 3SDEB 2MKKA 3GCWP 3A3OB 2ZM6J 3BGOP 3KK2B 2CPIA 2DXDA 3MMBB 1QM9A 4WE1A 5EX3A 2L9WA 4KAIA 3CE8A 1S1XB 5C42A 1WSRA 3PG9A 1VQPS 2R2TA 1VRTA 3LANA 3IRXA 4IFVA 2Z2MA 1JJ2R 3M30B 2ZBQA 4WFAQ 1Q82T 3EDQB 4DR7F 4LFBF 3MDFA 1XNRF 1KOHA 4DDFA 1HWJA 5KFAA 4DX7A 5HVFA 4FNIA 5EX0A 2ZH5A 3TZWA 1Q78A 2G0JA 1TP7A 1O5JA 3D0GE 4DX6A 1T9TA 2GCFA 2YY3A 1A7GE 5HP1A 4R5PA 3FK4A 2QYCA 4WFNQ 4GC7A 3IA0A 3LP2B 2HHTA 2MB0B 3HMJG 4B9SA 1S1TB 3DU5A 1U2RA 1RAJA 2W25A 3L7PA 5F3ZA 5LMNF 2XHWA 2XZDB 4TU8A 3G8TA 2DGTA 4A8YA 1HNZF 2R3VA 3D6MB 3MUMP 2NXUA 1HHQA 1HQ2A 2KB2A 2KT3A 1UWBB 4AE5A 4ZK7M 5FJ4A 2EBGA 2R7RA 3UNGC 3HT0A 3G71S 4C7QA 4A46A 3DI6B 1HQUB 1NK4A 3IWXA 3OL9A 2FHJA 4W90B 2HPUA 3OUYA 3L4BC 4TY8B 2VV5A 3OSPA 1BLUA 3I82A 1SIWB 2M88A 2C1EB 2QLJB 1NSQA 4B08A 1VLOA 2F8MA 4CO3A 1N5SA 3PR5B 2MMYA 3C19A 1RT5B 2B4PA 5KOXA 2E29A 3X3UA 2ZH6A 1JLGB 2R7WA 2XY6A 2L08A 4C3MA 2ALYB 1HNIB 3G96A 2M7SA 3N9UC 3BQ0A 4ECUA 4ED3A 1FRKA 1FKPA 2XNQA 4ZP7A 1NJIT 1TZ0A 5T41A 1FO1A 1FTRA 1A9NB 3Q22A 3C46A 2CJYB 5HMYA 3NBPA 4X64J 2DNZA 1RKJA 2QYGA 1TUWA 3SIPB 1U1MA 2OTJS 2BMBA 4Z37A 2DHXA 3D67A 3W5YA 2ZUGA 2EK1A 1H74A 2IDEA 1M5HA 1RACB 4NI2A 2Y8YA 4XTTA 4I2QA 2DBBA 2M5YA 4HTIA 1NDPA 3MEEA 3OR2B 5HAOA 1N6QB 4J5OA 1H6KX 5HK4A 2HHSA 1IKXA 2QL9B 4DV7F 1OPIA 4ED2A 5DZ6A 2J0WA 4A48A 3JYTB 1T8EA 2FQQB 2B6AB 4YB6A 5IC4B 1WOPA 1P9YA 4OL8A 4OZ2A 3H59A 3M8SA 2HRUA 2YX1A 1RUSA 2XB2D 2V63A 2V6AA 4BCAA 4ZPVR 2V5HG 5CZXA 3RU0A 1WDTA 4LF4J 3FEZA 1NBEB 4RJVA 2CQIA 1FJCA 3GR0A 2QFIA 3KLVA 4NL5A 4OJ3A 2C3PA 4OZ5A 2A18A 2MKSA 3NAIA 2N4CA 4WF9Q 4ZPBA 5IZHA 5HMZA 4AQYJ 4ES2A 5AJ3F 3GJRB 1G7CB 3W9HA 4BLGA 4PYAA 2K8GA 4GKKJ 2C2KB 5KTQA 3NEKA 1SC4B 3GE9A 4HDGA 3R5GA 3CB4A 3QT5A 2X1BA 4DR1J 1WOOA 3UQSA 2FVRA 4ECWA 3S01A 1IWGA 4PG7A 2V8GA 4M5KA 2BKOA 5C7PA 1YIJS 2MSSA 3ENAA 2V8VA 4CO1A 1X9MA 4JBCA 4TXSA 2JLEA 4L75A 1WKLA 3AOCA 2OEMA 3ILIA 4ALZA 1N88A 5B0EA 1HMVA 2EEYA 1RCOB 3EZUA 4BDPA 4EUVA 2XMVA 3D5MA 2GAHC 3UVJB 2AX0A 4OFZA 1FRHA 3K5NA 5KFLA 4PWWA 1S6QB 3US5A 4OJGA 4X64F 4I7FA 2ZC4A 4GKJJ 1Z4UA 4MK9A 4U8YA 1ITPA 2J0SD 1AA1B 4O4RA 4ICLB 2JEGA 3CUNA 2Q6BA 4TYAA 2D3O1 2HK2A 4I2PA 3T41A 5IQ6A 1GH8A 1C0TB 4Y6IA 1YLXA 4LJMA 1S1UB 3W9IA 4M94A 4IOAQ 2OPPA 3B6BA 3MPDA 1S0NA 4ED7A 3VF0B 2H5JB 3S6EA 3RGIA 5KT5A 4PQUB 4WZMA 1Q86T 3TJ8A 1VCTA 2ALZA 1A6LA 2OIHA 1F3VA 1N54B 2PN6A 4NX9A 2H1YA 4JI5F 3NMAA 4LF4F 1FFSB 2G2OA 2VQEJ 2YX4A 1UVNA 2QZ8A 5IQQA 2P2CB 3MWBA 2HS4A 4JV1A 5AT1B 4ILLA 2LECA 3EGNA 2RSQA 1YX2A 2KHDA 1N5YA 2I5JB 1VDHA 3D1OA 2V2KA 2DXFA 3MHYA 4AQYF 2MQ8A 4JI8J 1PYTA 3QGHA 2EI5A 4ZP8A 4DSEA 3GONA 5K8PA 1RU2A 3NGSA 2PI4A 1S77D 4WP3A 4GKKF 1V3SA 4MYUA 3J7YI 4YB5A 3THVA 1NHKL 4C0HA 1HI8A 1FKOB 5IT0A 1UW9A 2XEXA 5KFHA 1A0OB 3I9ZA 2YKOA 1R3NA 1QSYA 4IO9Q 3W2WB 4KHRA 1RAGB 4FYWB 4O3NA 4U7UD 4MK7A 1U45A 1VIXA 2FDNA 4ELVA 1HL6A 1TTHB 4M63A 2IAJA 1BXNA 2W2MP 4LSNA 2LYVA 5HANA 1EETA 1PILA 4J9RA 2HVDA 5GAEI 2B9EA 1FJGJ 1BWEA 1M1GA 2CQ0A 3POTB 5I42B 4NZ0A 1PBAA 4J9PA 3KJQB 3N6NA 1RTJA 1NHUA 3CJQA 3O8WA 1JKHB 2WB4A 2JDJA 4ZVSB 2XHCA 2AJFE 4B3TJ 1DHMA 1X4GA 1DLOA 1S4EA 3MCMA 2DKOB 2VBZA 4LR8A 3EXYA 1ZPVA 4DCJB 3L3CA 2HWIA 2DRAA 3FFIA 4P7TA 2BW2A 2VD3A 3T6BA 4YHHJ 2C3OA 2VG5B 1DTQB 1SH3A 4J90A 1VK8A 1HA1A 3I56S 1RISA 1QD1A 1F2GA 1WKKA 3F56A 4KV8B 1U1LA 3EWGA 3BH6B 3NOGA 1V6HA 1B99A 3RW6A 4X4UA 2VQEF 2R7SA 3QLHA 3R3TA 2JZ5A 1U1QA 3KFWX 3I31A 2R2RA 4K50A 1RWOB 3LTOA 3VAKA 1ZA2B 2ZNYA 2C2ZB 5MLCV 4DUZJ 2KXFA 4JYAJ 4NYPA 1KFSA 3VAHA 1XC9A 1WC5A 3MMBA 3VQTA 4B3SJ 2GVDB 2AWZA 2N3LA 2Y0SD 1SH0A 4ED5A 4PUOA 3PM9A 2W4DA 3DLLQ 4J91A 2HMIA 1ZM9A 4IH7A 2YQ1A 3M30A 4NA1A 4YB7A 5HSPA 2KYZA 2DR6A 1AZSA 3CDAA 3BYPA 4U7UK 5B0CA 4IOCQ 1MW7A 3MAAA 4C48A 1WHWA 1C2PA 4CO0A 3UWTA 2GQCA 3MEDB 3OVSA 3DRPB 1JLAA 4NLWA 4IDKB 5D0HA 2DEJA 2XCPA 1HBNB 4A8FA 2HLTA 2R7OA 3B8HA 3TX0A 3CD5A 2E1MC 1FJGF 1FFWB 4CLKA 3OBIA 2LQ5A 2BKPA 2QSWA 2HHPA 3GIKA 4LF9J 2MY7A 1SUQB 4C8NA 2HIYA 2LKZA 2FGOA 2HNZB
chains in the Genus database with same CATH topology
3EGWB 3MD1A 3RRKA 1SJRA 3K8WA 3IGNA 1B7FA 3U02A 3QGIA 2EPIA 3KKFA 4QR2A 4QU7A 1YRTA 2D41A 4DL4A 1U1OA 1DRZA 1HMVB 3HHLC 2IA0A 2CG4A 3EPGA 4HLBA 3KHHA 4K4TA 2LXFA 2UVWA 1K8AT 1FT8A 3FZBA 3H40A 5GAEU 4MFBA 2DR5A 1HBUB 2DGOA 2QA4S 4MKAA 2G9OA 2FJEB 3C8YA 4OI2A 2OPQA 2WSEC 5BJRA 2M0GB 5CA5A 4DR5F 3HM9A 1NK5A 4NYOA 3U1NA 4YHHF 4HT7A 4I7FB 2DGSA 1HNVB 4Y3CA 5A8KA 1QSLA 3D0IE 3DLEB 1NB7A 1R8AA 5HLFB 3ZZUA 5KFIA 1DQ9A 4TY8A 1HI1A 5CH7B 1X8DA 1RT3A 1RT1B 3E8OA 3GFZA 3HVTA 1U48A 2AW0A 1C1CB 4DN9A 5JUMA 2ZOGA 3HKWA 1RTDB 4ID5B 1KLMA 2ZE2A 4F67A 2R8KA 2C3MA 1SKWA 3GV8B 1CC7A 3CT9A 4O3RA 4KHPF 3DDKA 3I32A 5IT4A 2AGPA 3I87A 1Q4RA 3L7OA 4DG1A 1E6YB 2DNGA 1CSJA 4Q0BB 4B3RF 4RNFA 2VOPA 1HWUA 1LXJA 4I2PB 4I6WA 5DQGA 3CC2S 3CDBA 2ZH7A 1X7VA 4WU3A 3EPIA 4FN5A 3HFKA 2QEXS 2QA1A 1IKVA 4PXEA 5KFVA 2HAIA 1VQ5S 4LIWA 4LVNP 3K5LA 3WC2A 1FJEB 2HRYA 1HPZB 3KK3B 3DRRA 1PC4A 2ZD1A 2RRAA 3DHXA 1K0VA 4QPXA 1GXLA 3E01B 2C2EA 3TAMB 2FC9A 3KK1A 4QWAA 3CDEA 3BGUA 3MR5A 3PW2A 1S9EB 1S0OA 3UR0A 1UFWA 3TYTA 2AJ0A 4PXDA 2DVIA 4JI1F 2CQ3A 1GNKA 1IJFB 5LXRA 3TNVA 5IXUA 4EO8A 4RW7A 1LWCB 1YVFA 4KR0B 3M32B 4G1IA 1FK9B 5L9NA 4URGA 5J1EB 5G0RB 1XWLA 1RJJA 4MJKA 4N56A 3M05A 4IKAA 4OHWA 4A8OA 3CMAS 2LEPA 4FBUA 4BC7A 1FVQA 4LUBA 4K4WA 2KG0A 3RBEA 4DUZF 4Y65A 1MU2A 4JYAF 2CQDA 1XN9A 3DRYA 4X66F 1VQLS 3HZGA 5DGAA 1WACA 1NJYA 2J0QD 3H20A 2F4VF 1Z2ZA 3KJVA 3G8SA 3KNGA 3GFYA 5HQ8A 1RTHA 3OXFA 1UL3A 2ACYA 2OTLS 2KM8B 3UCZP 1RA7A 3V5RA 4F2SA 4ECTA 3KLGB 1QAXA 3M2VA 3NL0A 2DGVA 5B0DA 3M2RB 2LVWA 4RW9B 3UR3C 3LALA 3QZ8A 3N5BA 1M1KT 4UUWA 4K4SA 5EN1A 2P9EA 1IKYA 3R5BA 2OH2A 2LQJA 3RR7A 4C8YA 1LWEA 2RU9A 3LUYA 2BJDA 4TN2A 2ZHOA 5F8MA 3MM5A 5D4NA 2D74B 3OR1A 1U47A 4I68A 3RB3A 1HD1A 1UVJA 4N47A 5DM7Q 3G6VA 5E5NA 3VAGA 4OI3A 4XDDA 3KHRA 2O66A 4DFKA 2G0CA 3W7BA 4FXWA 5D3GB 4LFCF 3C6UA 1N5YB 4FNHA 1U49A 3ZZOA 2B9XA 2FTRA 5ADZA 4QWCA 3DOLB 3W3SA 2CKWA 4BBYA 3OR2A 4NRUA 2VPXB 4QYZJ 4H54A 2JC0A 5KG2A 3LP0B 1N6QA 1QAJA 4PQAA 1AROP 3VTIA 2VG6B 2DRBA 4DQPA 1WNEA 3DRSB 1GX6A 4DSIA 4L72B 5A8RA 5T7LB 5F8JA 3B4DA 3F41A 5EDWA 4UQGA 4K4ZA 2IC3B 2B4UA 5FLXY 3PXGa 3IR6B 3CCMS 2B6AA 2JC1A 3CSKA 4JI2F 4YOEA 2MDAA 1XNQF 1S6PB 3PEJA 1C1BB 2WHOA 3Q0AA 3CO9A 2YX7A 4I64A 4NCBA 2WAQD 3GFXA 4NZ6A 5FDLA 4GMKA 2I0XA 3PO4A 3HHLD 4J9OA 1FD2A 4Y00A 3QWUA 2I2YA 1S99A 1D0EA 2MQQA 3HT3A 3GG0A 4DX8H 1VQ7S 3HHKA 5DDPC 1IKWA 4C11A 3HHNB 1P1LA 2IMWP 1F5CA 2VBXA 2LCWA 1VQMS 3K0JA 3CULA 3WC0A 3TA1A 5K5MA 2DT9A 1OQ6A 3TX8A 3IFEA 3H2VE 1FERA 2FLOA 2FHOB 2VG7B 4RX6A 2AYMA 5LSRA 5I3UA 4Q8EA 2UXDF 3GIIA 2BANB 1U09A 2EBEA 3MECB 1T95A 3B78A 3H5SA 5C24A 1X4EA 1Y3KA 4E98A 4J9LA 4A8WA 2ZH2A 3PVXA 1SJ1A 3CIMA 1IBMF 1VQ8S 2NSBA 5IM0A 2XG8A 3MTKA 1L3TA 2DPIA 3MEGA 1U7LA 5KFGA 4BWJA 4B9MA 4B9LA 2OJ3A 2RB7A 3TA0A 1TVRA 4O3OA 2IM1A 4M8LA 4TYBA 4MKBA 4ES1A 1U6BA 2VOOA 2IRUA 4XIUA 2FUG9 3KLIA 3QO9A 1HR0F 3DU6A 3NAHA 1Q1KA 1Y3JA 3DMJA 4Q2LA 5C42B 5LSLA 3PX6A 3NMRA 2HVIA 3SFUA 4FXVA 2IM2A 5KT7A 3L09A 2K1RA 4K0KF 5KFMA 2IMOA 3ZZZA 1FE0A 4NA3A 3GIMA 4DFJA 2WK4A 2J7KA 3D1HA 3RBDA 1YWXA 5KT4A 3IWNC 1TR0A 3T5HA 4KQZA 2EKYA 2Y1JA 3BDEA 1T94A 1JLEB 2CFXA 3NNCA 3DCAA 2BA9A 4F4YA 2E7WA 5B0BA 2FY1A 4IFVB 2KJVA 3OL7A 1NAQA 2FJAB 5HROA 4X4OA 3I96A 1YITS 2M4MA 5I3PA 2JSXA 2ILZA 3AA8A 4C8ZA 4V19X 1FXLA 1Z2LA 2GIQA 3VZIA 5CXTA 2VA3A 3OFFA 3JSMA 4HEA9 4OLPA 4C0BA 2BR0A 2JWNA 1NH7A 4FF3A 1QY7A 2VKRA 3AJ2A 2U1AA 1S1VB 3M9NB 3GB0A 1HHSA 3PIPQ 3KLHB 2RUGA 1ZETA 3VQSA 3JTNA 2LDYA 2B0GA 2VA2A 2E1AA 1Y5NB 3GMGA 1L3SA 3K57A 2ZZMA 1LK5A 3ULHA 3CCLS 2IM0A 4EGLA 3IAM9 4KRWA 4USHA 3OL8A 3H5XA 4KKOB 2JFKA 1D9DA 5F3TA 2GQQA 5CYMA 3BQ2A 5J2NA 4W92B 1DLOB 2DGXA 3BGRA 3TARA 5KFNA 1OQ3A 3SSRA 2P5VA 5H9EJ 1DTTB 3MM9B 2LU2A 3X1LB 3CGIA 3DOKA 4IG3B 5J2PB 3RAQA 2HHUA 4KSEB 2POKA 2UXCF 4HT5A 2KZZA 4WZQA 2DO4A 2XC9A 1P1TA 1M5OC 2DK2A 2OSQA 1RWUA 4R5PB 2XWXA 4NCGA 1FNMA 3DM2B 2GW8A 5MAOA 5CCMA 4YFUA 2R2UA 3FRYA 1F9FA 1QE1B 1SJFA 1X4FA 1F5AA 1VQKS 3I9V9 3PACA 4AL7A 4DL6A 1GQEA 1SV5B 1X5OA 1SIZA 2RNEA 2C2DA 3TW0A 4DV4F 2E5GA 3BEGB 1FXDA 5KT2A 1ZAXA 3IG1A 2YWHA 2Z4PA 4I56A 5B09A 1BGXT 5KT3A 4OZLA 1WEZA 1RT2A 2B7BB 2FB0A 4XPCA 2DR9A 2ASYA 2QLWA 5JVGQ 1Q81T 4ZP6A 2JVOA 2YKMA 3CCZA 5GAHI 2HNDA 3M8QB 3E2EA 2A2CA 1J2VA 1H7WA 1H98A 1JXEA 2HNYA 5KG7A 2M8HA 3ZFVA 4DHVA 3GIJA 1XMBA 2ZDOA 2CQ1A 2VFUA 3SMZA 4UY85 3BS9A 4B17A 4USIA 3QYYA 4KBIA 3K5OA 1J5OB 1RKIA 1MMLA 1KN6A 5LL6d 2J9DA 2PT0A 1NO8A 1YJVA 3IXQA 4LQ9A 2IJNA 3NG8A 4ED8A 4DLEA 1VBZA 1KC8T 4PWUA 3HP6A 3QLHB 3I0SA 4YP3A 1L3KA 3PRDA 2XI3A 3MR6A 3MOZA 1S1WA 1TL5A 1SL2A 5KFWA 3PKMA 3M2UB 1DQAA 4RW4A 2Y1IA 2FJWA 1RK8A 2OMOA 3S1TA 4B9TA 3T1HF 1QTMA 4PR6A 3W2VA 2Z8QA 5C25A 4NXNF 2HVZA 4U9RA 5D4LA 1L3UA 4FF2A