2LFVA

Solution structure of the spor domain from e. coli damx
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQVQADLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein damX
publication title Nuclear Magnetic Resonance Solution Structure of the Peptidoglycan-Binding SPOR Domain from Escherichia coli DamX: Insights into Septal Localization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05036 SPOR Sporulation related domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sporulation related repeat 2lfvA00
1UTAA 1X60A 2LFVA
chains in the Genus database with same CATH superfamily
3EUNA 4MYUA 2XZTB 1LWXA 1U49A 4USUA 1NH7A 4DUZJ 1Y3KA 5B7WA 4JI7F 4DXLA 1QSYA 3G8TA 5ETRA 3LUYA 5FLXU 2EBEA 3A3OB 1U0HA 3N9UC 2AGQA 3CO0P 2KJWA 5ETPA 2YNHA 2R2UA 3QT6A 4J37A 3TUZC 1VRTB 1KVIA 1UZDA 2QZ8A 4K4TA 3U27A 3TQ1A 3GB0A 2UXDJ 4DSJA 2XGPA 1DURA 4X62F 4FKXA 2XB2D 3CJRA 1UW9A 3BS9A 5K14B 3KKFA 3DFEA 3WDOA 1A7GE 3G6XA 2LXIA 3IR6B 2IC3A 2D3ZA 4DEZA 3SFUA 2A6OA 3GJTB 2MTLA 3UD4P 1MWQA 2ASLA 2HQIA 5H9FJ 1HQ2A 1K44A 4DFMA 2HHPA 4NLOA 3R7NB 3P5BP 3M9OB 2LA6A 1OQ6A 3CDAA 4DDFA 4DQIA 4A8FA 1U8SA 1S0MA 2YNFA 4ITSA 4HHUA 3JQKA 4LR8A 4QR0A 2F9JA 3UD5A 2MLYA 2BJ3A 3TZWA 3K5PA 1FRIA 4JYAJ 3NS7B 2KN4A 4TYBA 3QO9A 2YVSA 4U9RA 4OV1A 3PM9A 3P96A 3DKDA 3KJFB 3EPIA 1CEZA 3MDFA 2Z57B 2QFIA 2JFDA 1KSPA 5IT4A 1IBMF 4DPXA 2KFZA 4WE1A 4ZVFA 5AXLA 1U48A 2LXFA 2E5HA 2ZDPA 1JJHA 2E1AA 2DR7A 1LEOA 4ETXA 3H5UA 2VQFF 1VMBA 1TL1A 2Z2ZA 1B0VA 4IG3B 3MR7A 2QC3A 3DOMA 3FBCA 4CTAA 2A1BA 5JMNA 2LCWA 2BABA 4J9MA 2DTJA 3H98A 1K8AT 1EP4B 1RBAA 3PKYA 4WYLA 1FF2A 2COLA 2XY5A 2HBQB 5D3GB 4U67Q 3RUBL 1IBKJ 2YH1A 3ETMA 3NS6A 2ALYB 1R0AA 1Y4ZB 4DL2A 3BSCA 1RA6A 3B4DA 1X5SA 3D6FB 4C98A 2XI2A 1SH2A 1KHWA 3QGGA 3UDVA 3KLEB 4CLWA 3BQ0A 3MM5A 2B7CB 1YJUA 1VRUB 2V8VA 3GYGA 3NCRA 1Y7PA 5GAGI 1T9VA 2GX8A 2PEHA 4DR2F 3NBPB 3ZTOA 5GMDA 5DS7A 3IBCB 4ID5B 3N4WA 4QQBA 1EKRA 4IRCA 5LT5A 4DFPA 4MK9A 4DR5F 4JI5J 3R5BA 2DY1A 2R7QA 1KQSR 1JXEA 1Z2LA 5KT4A 2AD9A 1FJ7A 4A8OA 1SJ3P 4KTQA 2MKHA 2E5LJ 1HHQA 5K20B 4E8UA 1R8BA 4Q2MA 4JOUA 4QIWD 5CHCB 2IAJB 4FS1A 4EO6A 4FKYA 2ZEJA 4O0NA 3LPEA 3VZHA 2G2ZA 1F60B 1HWIA 4ZK7M 2M8HA 1HHSA 5FLXY 2QO3A 2WSFC 3E01B 1ZPWX 3ZFVA 2B9XA 1H98A 1DY3A 2WBMA 3OL8A 3NNAA 2DJWA 4B02A 4OZJA 4PWWA 5IT9U 2PD1A 2XMKA 2JWNA 2DR9A 2CVIA 4LRAA 4P74A 4ZP9A 2BE2B 2BBEA 2MMYA 2LU1A 1VBXA 2VV5A 3QRPA 5I3UB 4N47A 2YKMB 5IM0B 4OL8A 3K58A 4ZS6A 4DUZF 4KGKA 2IJFA 4LF6J 3VZIA 2GO9A 1VRTA 2ZZTA 4KKOB 3CF5Q 2ZH7A 1N5QA 5DM7Q 2QGFB 3SCJE 2VD3A 2HNYB 5K14A 1BXNA 5KG0A 3PYFA 1KRPA 2E7XA 3LTOA 5IOLA 1QSLA 1WG4A 4HHJA 2AJFE 4P10A 1NK4A 2VOPA 4X4PA 4Q7AA 1SL2A 2CG4A 2LEPA 1H2VZ 3EXCX 2UXDF 2BXJA 3BKFA 2GVZA 2ZBCA 2BE7D 4X65F 2QSFA 2ZHBA 4IOAQ 2LVWA 1P27B 3H42A 2IA0A 2AZ1A 2Q1LA 4WYWA 2D9PA 2DNPA 1OWXA 1YWXA 2KT2A 4G1IA 3ZC4A 5DZ7A 2UVWA 1D8YA 4DR6J 3K59A 3Q0AA 4N5SA 2W2OP 2XZWA 4LFBJ 3I0RB 2NXEA 5KFZA 2MJUA 2W8KA 1S76D 1RT2B 1XJWB 2QL5B 2E7WA 4WZQA 2VH7A 3M30B 4KRWA 4X4SA 4J9SA 1X9WA 3TAMB 3DYAB 1YJVA 5GAEU 2VG7B 3KOAA 1RWKB 4JYAF 2K1RB 1SJ1A 5I42B 2A3JA 4ZVGA 3O2IA 1TU0B 5IV4A 2YNGB 3ZZPA 1T3OA 1NM2A 1IKWB 2MQLA 1SV5B 2LQJA 4IG3A 4DX8H 2OPPB 2YY3A 2JFKA 1EIYB 3GQCA 2R8IA 3NLCA 3BGFA 4DPYA 4HT5A 2DXDA 3A8KA 5B0BA 3MI7X 5A2QU 1ZYQA 2VFTA 2Z30B 1O51A 5D3GA 2WVBA 3W1YC 4K4SA 3NXZA 3FNNA 3UN3A 1VQ8S 3CE8A 3H59A 3FMWA 1ZZFA 1XMOJ 3ZZTA 1NJYA 1FRKA 4X4VA 2P6TA 3N6NA 3OPKA 4CLFA 5HVGA 2ZJRQ 5EWGA 1SVDA 5A6PA 1U2FA 4AQYJ 1IBKF 3KLEA 4HI1A 2B5JB 3OHBA 4QR1A 1VRUA 4AE5A 1S6QB 2HQ3A 2FVRA 5AT1B 4PPDA 4UUXA 3R97A 2HNDB 3H2LA 3Q89A 4M5MA 4ID5A 1X4AA 4MIBA 2HVIA 4UQTA 2N7CA 3VTIA 4O4RA 4RWWA 7FD1A 1HLWA 2QFJA 1UJ6A 2ROEA 3GONA 4LF7J 1EB0A 3QJLA 1VHIA 2UXCF 2VPYB 1S9EB 1EETA 4LVNP 3MHYA 4M8LA 4OX6A 2CDRB 2VASA 1RWPB 2YNIB 4MTPA 1CQMA 3KG0A 2YQ0A 2Y9HA 4JI5F 1FDNA 1CC8A 5IT9Y 1A0OB 5DGAA 2IRUA 4P73A 3NGDA 1MG7A 2IAJA 3HVRA 4YMEA 3MAHA 1V3ZA 5KG5A 3D5MA 2F9DA 3FKBA 4PCQA 1FNXH 1SH3A 3E01A 4QWBA 1MSWD 2FHMA 4QBUA 2JEFA 4FVCA 3BQ2A 4OYXA 4C8NA 2VG6A 3T1YJ 3BSNA 3ZTSA 1GAOA 3C14B 1XC9A 1CVJA 1WHWA 1RHKB 2BE2A 3QJJA 3EDQB 5LJ5Y 1WG5A 5I3UA 2CQPA 4LSZB 2UV8A 1I1GA 2UVVA 4D3GA 2NR0A 3ZZ0A 2AYMA 3P4UB 5IM0A 3W65A 2XMJA 4A8QA 1QAYA 1RHUB 4WFBQ 3MMAB 2A2DA 4KKOA 4F3QA 3GV8B 2FD2A 2CNNB 2BDPA 1Y5NB 1ZAWA 2JSXA 2DGSA 5KAKA 1JJ4A 1YK9A 3QZ8A 2HNYA 2R7XA 1BQMB 1W26A 2NZ4A 1Q82T 5D4PA 2L08A 4C2MA 4LF6F 2CJXB 2QMUB 3HHNB 3PNIA 1RWOB 2DR6A 1UCNA 3FUYA 3J80U 2EFPA 1UZHA 2XWXA 1B4SA 2HRTA 2ZH8A 1LKZA 3JTNA 1HIYA 3QAUA 1G1XA 5DETA 4DF4A 4DV1J 4DL4A 1F2HA 3ZNUA 5A8RA 3TJAA 2E1MC 3MM8B 3UR3C 2B9EA 3QT5A 4JP8A 4U7UK 2J0QD 4JI6J 1X4EA 3QRQA 3LALA 2OHDA 3I0RA 2IM0A 4ILRA 2DIVA 1T7PA 2H4YB 1RT2A 5MLCV 1VQ6S 2WCXA 4DR6F 3M30A 1H7WA 1JLBB 4LFBF 3FQKA 1CG2A 3TAMA 3DYAA 2VG7A 1L3UA 2HMIA 4N41A 4Q43A 2K1RA 2O1PA 3OFHA 5I42A 4P2MA 4ELUA 3PIPQ 2ZC4A 2QL9B 4EUVA 2YNGA 3J7Z5 4DG1B 3KYLA 2WVEA 4PRFA 3J7YU 1IKWA 4CLSA 5A2QY 3AD8C 5ADZA 2DNGA 3MCNA 1SV5A 4B9VA 3WIUA 2OPPA 4FNHA 3G6VA 2XYGB 1DAXA 2W24A 2HZAA 2V50A 1U1NA 1NJZA 1NZAA 1OMSA 1X7VA 3ILOA 2YPZA 2Z58B 3AHPA 1GMWA 2YWKA 4ZJQA 4EU0A 4Q8FA 2KZZA 2Y8WA 4YY3J 2FJBB 3GJRB 1RLDA 4ECTA 2PC6A 3CT9A 4K2XA 4CYUB 1Q79A 2WSEC 3PEJA 4DS4A 1TL4A 1S6PB 2B5JA 1V5IB 4L73A 1VRQC 1CPZA 1XMOF 4F2SA 1S6QA 4L74A 4BC9A 4Z2XA 2AGOA 2WBRA 1RU2A 1YG0A 2HNDA 4IQMA 2W2NP 3OFFA 4USHA 4AQYF 3NNCA 4I6YA 4IRKA 2Z56B 1NDPA 3EYZA 5T14A 1SKSA 1YBAA 4Y65A 2EFGA 3RB6A 2P9CA 4LRCA 3PO4A 2JVRA 3JSRA 3HHDA 1S9EA 5A8WB 2XLIA 5KFVA 2YNIA 5M2RA 2HIQA 1RE1B 2EI5A 4URQU 2XMVA 4B9TA 2AYEA 2R8JA 4LF7F 4BDPA 1NEEA 3IAS9 4QOTA 2ATCB 3TUIC 1RAGB 3VGUA 2HQFA 3CJ5A 3PXGa 4K4XA 3KMQA 3CTRA 5HSPA 3SSRA 4EYHB 2KKHA 3C14A 5E7OB 2JH3A 3IWXA 1YJTA 3LP1A 2CPFA 5C2GA 2IM1A 1O8BA 3HT3A 3KFWX 1BUXA 2B43A 2AJ0A 3GYNA 1OS5A 3SCLE 2DH9A 3G6YA 3T1YF 1HL6A 4LSNB 3MMAA 2P5VA 9ATCB 1S77D 2L48A 4EGLA 3B54A 2CPHA 4TNOA 3TRGA 4LFCJ 3J80Y 1BQMA 3FDSA 4PYDA 3GJSB 1NPRA 2OUGA 2RH3A 4F04B 4J91A 4QIGA 1Q95G 3I82A 1VJWA 5JVHQ 4ES1A 4O3OA 4M63A 4EO8A 2ALZA 5J1NA 4CM0A 4ELVA 3JSMB 5HP1B 4MIAA 2YKPA 4OHXA 3PZPA 4F4ZA 4D3HA 1URNA 4PG5A 2X1AA 1RWMB 3MM8A 1KTQA 2NXUA 2MHEA 1WKLA 4MMOA 5ETKA 1RJJA 5F8HA 1JKHB 5IQ6A 1CULB 5K8OA 2R7RA 3M8QB 2EFQA 4JI4J 2KZMA 2ZDOA 3LGNA 4RU9A 3LWLA 4DV1F 3C66A 3MEDB 1JLBA 2CQHA 4JI6F 2GJFA 2M2BA 4CLYA 4C11B 1BWVA 1ACMB 1SJRA 3VAHA 1GK8A 3WC0A 4DG1A 5DDRC 4UF4A 5F9NA 2O5DA 1SPBP 3ZTQA 3T5HA 3Q2SC 2ZHAA 4ZPVR 3IN5A 2D9OA 5I3QA 1F5BA 2CQDA 3AH6A 1VC5A 3IGVA 4DFJA 3RAQA 1I94J 3NRBA 2HAFA 5KFSA 3IAM9 2ZH2A 5H9FK 2OLWA 3HPOA 1U1OA 2DYAA 2Q6CA 1PJ7A 4MFBB 2C1EB 2QYGA 1NK8A 5J1PA 1VQ4S 1T9UA 2MGZB 1Q4RA 3PW2A 2N3LA 4CYUA 4KPCA 1S6PA 5DQIA 4KB7A 2BQ3A 2AYBA 4YY3F 1B64A 2VJVA 5HQMA 4QIVA 1EQMA 4JUZA 3D6TB 4ECQA 1RHRB 2ZUAA 1FWPA 2BKOA 2VBYA 4OZ3A 4IR9A 1VJQA 5KFPA 2QLXA 3W66A 1R7IA 2F8HA 5D0EA 2R2RA 2KXFA 3G9CA 3W5YA 3HLUA 3O8WA 2HK3A 1TV6B 3D66A 5A8WA 3MPUB 2ZH6A 1REGX 5DJBA 3T5KA 1S57A 2DHHA 1GMWD 2MDAA 4OX9J 4K4YA 2DHXA 4RW4B 3TX8A 2LQ5A 2IRXA 3RRKA 3FEYB 1IXKA 3GMGA 1EKSA 2CPXA 4CH0S 4C48A 2ZD1B 4X2BA 2K06A 3UN2A 2ZHOA 2HHXA 1QDUB 3HJVA 1UVMA 5IZHA 5DQHA 2HKEA 3MXHP 1KEKA 1D9DA 3V5RA 5KG7A 1CSJA 2CIMA 2CJQA 5D4LA 3F41A 4LSNA 3QWPA 1C0UB 4WU3A 3SBMA 4YUDA 4OYAA 3I5CA 4R0EA 2MJNA 3OT9A 3JS9A 2I5JB 3B82A 5BYQA 3OFGA 5IS2A 4DN0A 4WBFA 3OTEA 4IKAA 2R8KA 4O3SA 3G8SA 3NAHA 2VG5B 3HP6A 4TYAA 2XC9A 1YJ7A 2G4BA 1RU1A 2JDJA 1RT7B 2RIJA 2ZOMA 5IFMA 1VCTA 2WB4A 2U2FA 2CPYA 1R8PA 2CWXA 2CDQA 3DC2A 1K47A 4A48A 2P9EA 1T11A 3JSMA 3MD3A 5HP1A 3MUMP 1RA7A 4LSLB 2QRRA 2GIFA 3ET6B 2G2YA 1FI4A 5HMWA 3OD2A 1LW2B 3NKYA 2JLGA 3M6WA 3MEKA 3SSSA 1U45A 2P8IA 1JKHA 1H38A 2ZJPQ 1N56A 1ZH5A 5E33A 5KFXA 3G82B 4GKJJ 3IRWP 1S72S 4IFYB 1LOUA 3A13A 2GVDB 2FY1A 8ATCB 3MUTP 4PQUB 3MEDA 1T95A 1S1UB 5EWEA 1FWLA 2C22A 1HWKA 3KK1B 1IR1A 4C11A 2FVSA 2DRAA 2V0NA 4JI4F 2VB6A 1S0NA 1M1HA 5HVFA 1PBUA 3R5GA 3RAMA 1Q7LB 2JEJA 1HNVB 3M8ZA 4KQZA 2PEBA 1YI2S 3LA0A 2R7SA 1RGVA 1UETA 1REVB 5B0FA 2DNRA 4B3TJ 2Y1RI 2MKIA 1RAIB 1TKDA 3DXBA 3BR9A 4PABA 2W4CA 5KFMA 5G4DA 2GV1A 5F8LA 2MEWA 1NH8A 4DV4J 1SJ4P 4RNOA 3CMAS 5BR8J 2PO4A 1R6YA 3MMJA 1P1TA 4ZVOB 1I94F 5C42B 3C19A 4DSIA 4P7VA 2MGZA 4JV0A 3L7PA 1WEZA 1R8AA 2M7SA 2VDIA 1NKCA 4WP8A 4WKRA 2WOMB 4ECXA 3J7A1 2F8EX 3JQMA 1JLGB 3BJYA 5K8MA 4UTGA 3PHTA 2AYGA 2ZWOA 1OSDA 2H4WB 3JQJA 3G87A 5E2QA 4X4NA 3NMAA 4DX6A 1SKRA 4C9DA 4CO1A 2CQCA 3NG8A 1OY8A 2VPXB 3EJMA 1BQNB 2YWEA 3DLLQ 1YLXA 3QT7A 1L3TA 5CZXA 3H8YA 5F8GA 1VQSA 1T03B 1TV6A 3BGRB 2VF3A 1F0XA 3C16B 4BC7A 4RBVA 3CVKA 3JXOA 5HANA 2FTRA 4UY85 3MAAB 2AF6A 4DV6J 2DGTA 4YHHJ 4RW4A 2RQMA 1YITS 2DNZA 3KUHA 4ZVEA 2CPEA 1GMUA 2M3DA 4FN5A 3TYTA 3X1LB 2A18A 2Z2YB 4PQAA 1M90T 2ZD1A 1R8CA 3IFEA 2F3JA 1TKXB 1AUSL 1KONA 5B08A 1DTQB 2FC8A 1IQTA 3GJQB 4JBCA 4NLXA 4Q8EA 1QJHA 5BXIA 3I9V9 1VISA 1XMBA 3TZYA 5HMYA 3OFEA 1RADB 1RK8A 1C0UA 5HVHA 3CSKA 4GVBB 5GMKa 4P2XA 3N5FA 4PXCA 3ENAA 1Y5IB 2I5JA 3OBIA 2HGMA 2C2KB 3KLIB 2QA4G 1P9QC 4ZPBA 4DR3J 2HRYA 4PG4A 4KC5A 4NRUA 2XMTA 3TUJC 2VG5A 5M2UA 4CO3A 1RDRA 4OYBA 1SL1A 1RT7A 2GQCA 5IV3A 2RB7A 1JLCB 4C8YA 2RDJA 2HYIB 4I56A 2C2ZB 2CQ2A 1CC7A 4LSLA 1QLNA 3ET6A 1LW2A 2HBZB 3MMCB 4JV5J 2UU9J 5IQQA 2DNMA 4CZCA 3HI9A 4L76A 2L9DA 3CCZA 1NK5A 3DHXA 1YVFA 1S1TB 4OFZA 1YZ6A 5E3CA 2GVDA 1F5CA 1B99A 4PQUA 1WC0A 1UA0A 3GP9A 3UQSA 1S1UA 3CPWR 2Q79A 4Q44A 3M2UB 4EFAC 1WUUA 4GKJF 1M5VC 1N36J 3W2VB 4H4KA 3FK4A 3VGVA 2HZVA 3GYXB 4NA2A 4ED5A 4L72B 2CYYA 2KT3A 4UQGA 2M8DB 3U1LA 3L9ZA 2GS8A 1HNVA 1U6ZA 4PR6A 3EPGA 4P72A 3R5CA 4F3OA 2EFVA 2VZ9A 2VFVA 3OXFA 2W9AA 1REVA 2PFFB 2QL7B 1X5OA 2EG1A 2D3UA 3Q8QB 3VQSA 4ZVSB 2GQQA 3MD1A 2XMMA 3B78A 3OVBA 3AA8A 2ABYA 1FKPA 3VQTA 6AT1B 1RT4B 2B4VA 4B3TF 3HSJA 3ILJA 1SKUB 4ZHRB 3TEHB 1S1WB 5C42A 4QU7A 4KAIA 1HNWJ 2JLEA 4DV4F 3ISND 2ZZMA 4WFNQ 4BBYA 5BR8F 2BJ1A 2WOMA 4Z37A 2V94A 1M5PC 4TVAB 2A10A 3Q86A 4EBDA 1JLGA 2AWZA 2CPIA 4WXOA 1JX4A 4F0MA 4NRTA 1UJ5A 1EX8A 3HK2A 4KY3A 4DX7A 4V19J 3NGSA 5HBMB 2NREA 2GJIA 1IM6A 1C1CB 2X51A 2E9RX 3FSIA 1E6VB 1BQNA 2FLPA 4Q45A 4LR9A 3ISZA 1VQ9S 2W2MP 1T03A 1U47A 1XEZA 4ZA1A 3H5XA 3BGRA 4KGZB 2ZWPA 3K5NA 3C16A 4I0WA 4J9LA 2KRBA 2XS7A 5D0GA 3KLGB 2ZKTA 4TXSA 2XO7A 2G0JA 4C8KA 1LWFB 1RZMA 4NLTA 4RZRA 4ED1A 3BDEA 5HK4A 1QAIA 2F8MA 3V81B 2WZ1A 1B3TA 4TQRA 4MYTA 2RRAA 3DRRB 4CNZA 4FF4A 2FJEB 5T7LB 4C8ZA 2UP1A 1KNZA 4CO4A 4DV6F 2HZCA 4YHHF 4PWDB 3QIDA 1TKXA 5KFIA 1KVJA 1DTQA 3HF5A 4R25A 1S7HA 1URRA 5F0WA 1VC6A 1KHVA 1UEUA 2KL8A 2JZ5A 2B51A 2LEBA 4KH1B 1CJUB 5SUHA 1X31C 1U1QA 4GVBA 1FJGJ 4OZ2A 2XY6A 1AXQA 3OR1B 2KVIA 4NZ0A 3JAMY 1HD0A 5B0DA 4B17A 1WI8A 3POTB 4DSKA 2QJ3A 1KD1T 3KLIA 3HSZA 5EGYA 1VBZA 1H3DA 3DU5A 3MECB 4PXBA 2BV3A 3FBEA 1H7XA 2C2MB 3U02A 1B0PA 3JB9k 4DR3F 3SI8A 1LNQA 4ANDA 3EXYA 3K8WA 3HT0A 1VHFA 3IM9A 1JLCA 2BQUA 3T5LA 2DNNA 4ZJOA 4ZCKA 3RYLA 3HULA 2XS5A 3MMCA 3MTKA 2UV8G 1GTHA 3EGZA 1S1TA 1VGYA 3DOKA 5DLFA 1QD1A 1F9HA 2OPQA 4JV5F 2UU9F 4DWIA 3OJUA 2KYZA 4DI6A 2V9KA 3M2UA 3HFKA 2GIRA 2W1BA 1TFWA 2QX0A 2JLFA 3IO1A 4NCAA 3CD0A 2KYXA 2VFUA 4KFBB 5BYSA 1S12A 4FXWA 4W92B 4NCGB 4XO0A 3Q8RB 2OIHA 2IA6A 4GC7A 4F7VA 1WNEA 3MOZA 1HBNB 1NHVA 1N36F 4B9LA 3VAKA 2MLXA 4U96A 3HVTA 1NSPA 3EMTA 2RS2A 1S6UA 3QQCD 4LF5J 1T3NA 5KFCA 1KLNA 1ZTTA 1MN7A 2OSQA 2IRYA 1N5TA 2FDNA 2AEJA 2J8SA 5HMXA 1R27B 4DR7J 2H65B 2JL9A 2XCAA 4HL9A 4GO7X 4ZHRA 1S1WA 5C25B 4HLBA 1JLEB 1UEKA 2FC9A 1FJCA 3PR5B 3K5LA 1S1XB 1T9WA 1TUWA 2DVIA 4X64J 3KNGA 2ZE2B 1R43A 4WFZA 4RNHA 3VAFA 3AOCA 1TKTA 2EEYA 5J2QB 4HHHA 1BC6A 3NEKA 1HNWF 4ZCIA 2YWWA 3M8WA 2BW7A 1GQEA 5HBMA 1FTRA 2VICA 2D3O1 4RKUC 5DDOC 1C1CA 3E3XA 1E6VA 1G6BA 1FFSB 4FPIA 4HKQA 1TAUA 1U09A 4K4WA 3DLEB 2VBWA 2W2QP 4B3RJ 4NWBA 2PI4A 1Y10A 1AROP 2OMLA 2VONA 2VKRA 1SC3B 5E3PA 2WVCA 1AYEA 2D69A 3KLGA 4HYKA 5JXSA 5ETOA 2QG9B 1HKAA 1HMVB 2MHNA 2Q3PA 3S01A 4DZ6A 1CLFA 2QTWA 4I6AA 3V81A 4OJ1A 3F56A 3MR5A 2C28A 2LU2A 3C6UB 1N48A 5T7LA 1RWXB 5C5JA 4DQRA 2FZGB 1CJVB 1YDLA 5D0RA 2QYCA 3VALA 4PWDA 4Y2IA 3THVA 3C3LA 5KTQA 3EZOA 1GFWB 1O0PA 3OVSA 1CJKB 5D4OA 3GIIA 4OZ1A 4M1KA 2MKKA 1C4AA 3R2DJ 1CJUA 3T41A 3SYZA 4WP9A 3VR1A 3WX4A 1X4HA 1NPPA 2W25A 4OZ0A 3GCWP 4OI4A 4DMZA 3D28A 1OIAA 1Q0NA 5GADU 2V8PA 3OR1A 1RT6B 3AFGA 1IWAA 3DOLB 2UUWA 3POTA 3FCWA 2BM1A 1D9AA 4HR2A 4M5IA 2HWHA 1N32J 4KHRA 3MECA 1NKBA 4KT0C 1U1LA 2OTJS 1FJGF 2J5AA 4PG6A 1Y0HA 4DL3A 2RHQB 4RW9B 3L7UA 4L3KA 3RZAA 3QT8A 2ZKUA 4HTJA 2BW2A 2XY7A 1U8WA 4KIAA 3DLKB 3KHGA 4ZCMA 4OX7A 2NUHA 4ZLNA 1YX2A 4UOHA 1JJCB 4L3NA 1R8HA 4FP9A 3UD3P 1F5AA 4B9UA 4A8XA 3LQVA 1FDDA 3CCRS 2E5GA 2IBKA 3GIMA 3M1VB 1M5KC 2CFXA 2KFNA 3DDKA 2GFFA 2HVHA 1LWEB 1YTYA 4DCPB 1LWCA 3W8GA 5ITHA 3KXDA 1GX6A 3MM9A 4AL5A 2OFGX 1PILA 2IC3B 3KG4A 1N4LA 4I68A 2OJ3A 3IMQJ 4CT8A 2G1HA 2GMLA 1HQEB 1XN9A 4OYZA 4GMKA 1YHQS 1M1KT 2B6AA 3PRBA 2J0WA 3FJ2A 4YR0A 2HHQA 4NCGA 2RKIB 2YNFB 5K5MA 1HBNA 1IQZA 2DB1A 1P1LA 4ED3A 2CQGA 2EC0A 4Y28C 3ISNC 4CO0A 2DISA 3IRXB 5HI7A 1IM4A 1FRHA 1Q5VA 1OPIA 1F3FA 4ECUA 5FD1A 2ACYA 3FEXB 3VAJA 3R7BB 2Z8QA 1HA1A 1LK5A 4LF5F 1DJ0A 3JTOA 5C25A 4ELTA 1X4BA 1F6TA 2B3TB 4DHVA 2CPZA 1KQGB 4OYMA 1FE4A 1S9GB 3NOCA 1S1XA 3PYDA 5IT0A 4DR7F 2ZBPA 2ZE2A 1XNQJ 3K57A 3GFHA 4PPZA 2RILA 3BGOP 2W9CB 4L6V3 4YB1P 4C8MA 2XWYA 3VAMA 2VC0A 1BLUA 4OZ5A 1WDDA 1RT5B 4X64F 1BMQB 1WEXA 4F4AA 4F3MA 3QYYA 3UE2A 1X4GA 2DO4A 2MB0B 4ZVPB 3DLEA 4KSEB 5HLFB 4NZ6A 3M8PB 5KT6A 2FGCA 2DNKA 4WFYA 4ZIWA 3CCES 2ZJQQ 3BPSP 2PMZD 2ZBIA 3BBFA 1B7YB 5C24B 1HR0J 4ICLB 2LDYA 4TKTA 4CM2A 1HMVA 5F41A 1ZAXA 4FXDA 4B3RF 2D1CA 2RU9A 3QATA 5AE3A 4EZ6A 2FQQB 2ZH1A 4ED2A 1RBOB 1HD1A 3FSXA 3BYRA 3MM5B 1LXJA 2Y0BB 5E3QA 1X0PA 3C6UA 2CADA 3N01A 5L1KA 4FBUA 3VAGA 4A8WA 1WJ9A 5KFRA 2VU5A 1WTFA 2QLWA 1CJVA 4I6WA 3MOJB 2BRLA 4LIWA 3RBDA 3GG1A 3PYEA 3DCAA 3VF0B 1FRXA 3ULHA 1CJKA 2DGXA 2W9BB 4YP3A 6FDRA 4CLKA 3K89A 2HHVA 3AJ2A 3PVXA 4LRBA 2KU7A 4DPWA 4ZPWR 1NBEB 2DPIA 3MEGB 1IKVA 2WAQD 1RT6A 3W9IA 3DOLA 4ALZA 3HVWA 3CC7S 5LMUJ 1TMJA 3AODA 3K2YA 5T41A 1UVKA 4RW7B 3MEEB 2VUGA 5LSRA 3CJ3A 1FKOB 1WELA 1J5EJ 2V2QA 1CQNA 3Q8UA 2WONB 3MCOA 4ED0A 4RW9A 1HBMB 3LP2B 2HFSA 2BM0A 1N32F 3BH6B 2HLUA 5KFTA 3DLKA 5IWAJ 1VQMS 1Q8BA 3Q8VA 4CLUA 5KFHA 4BWJA 1RTIB 3UNGC 2A0FB 3JSYA 2LLZA 3T1HJ 4RWXA 1AA1B 1VR6A 3IG1B 1GTEA 3I31A 3M1VA 3FGVA 1LWEA 2NXCA 4LJMA 4O0IA 3GIKA 3RR8A 3K0JA 5HAOA 1FRLA 1FCAA 5AE2A 3SV4A 3CC4S 2GVZB 1TL3A 2O66A 3PRVA 1HYSB 4HDHA 3BO2A 2R7OA 1HQEA 5KG1A 1FFGB 1L3VA 5J2MB 2DBBA 1VQPS 4M5DB 3D3CJ 3L09A 2WTFA 3HMJG 3OHAA 2FHKA 1UA1A 1NCLA 3NCPA 2V68A 4DS5A 2IM2A 2RKIA 1IJEB 4R0JA 3CJTA 2QE5A 2JNJA 3GWCA 1RTHB 2YX7A 3CCLS 3M9MB 2V8GA 4W4MA 1NSQA 2LQ9A 3T5JA 3IGNA 1R6VA 2NS1B 3IRXA 5L46A 5KT3A 1F3VA 4J9RA 4DLGA 2BANB 2ZBRA 4H4OA 4NOHA 2HFVA 1FERA 3T6JA 1AZSB 4H4KC 4XDCA 1J2VA 4MKAA 1FXLA 3AQPA 5J2NB 2BJ7A 2BA9A 1O6XA 2XHCA 2AJQA 2RU3A 1X60A 1XR5A 2BX6A 3ITHB 3CDWA 1S9GA 1EHWA 2H48B 2DGWA 4JI0J 2I0XA 4YDDB 4FXVA 2PA3A 3U1NA 3M8RA 3EZUA 5LXYA 3QNWB 1G3OA 2W9CA 3PFOA 1QVFR 2ZOGA 2CKWA 5CD4A 4G6VB 1RT5A 3RRHA 3GV7B 3VGTA 4QYZJ 2EWHA 4NA1A 1XNQF 2DPJA 3ICLA 1ZM4A 3ILIA 4M5KA 4MH8A 5HLFA 3M8PA 2E44A 2YKNB 2LFVA 5C24A 3UPFA 1FFWB 4ICLA 2VODA 3NY0A 4YN3B 1IBLJ 5EX3A 1Z2ZA 3KNAA 1RAOA 2W7PA 3CJQA 4QWAA 2I9SA 4KH0B 1HR0F 4FS2A 1SCJB 2PN6A 5KFKA 3HHKA 2EK6A 4JI8J 4O3RA 4MK8A 1PGZA 4ZN3A 2SXLA 5DZ6A 1TAQA 4RO0A 2W2PP 5DGBA 3K5MA 3PW4A 3U7JA 4ZVHA 1S0OA 2YKAA 3DXSX 3ZZYA 3HDSA 2RRNA 4EK2A 1Q53A 2W9BA 2GA7A 1NLKL 3VGSA 4UZBA 4ECYA 1WACA 1EETB 2VFRA 3GIRA 3FQLA 5H9EJ 3N6LA 1RT1B 3Q8YA 1KQFB 1FXDA 2XMUA 6FD1A 2Y3YA 3MEGA 3HKZD 2HIYA 3UW1A 2W7OA 3BV8A 1NB7A 2DY9A 3OL7A 2IYIA 1NDKA 2V2ZA 4P75A 5KT7A 1RKIA 2RF2B 4RW7A 1U26A 5CH7B 2XMWA 1N8RT 1SIWB 1UFLA 3MEEA 1T0TV 4EMDA 1QTNB 2J7WA 5D4NA 3AY0A 4DCJB 5CYMB 2EC2A 1FKOA 5L8RC 2VG6B 1NSAA 5LMUF 2WONA 3GG0A 1HBMA 2B9YA 3LP2A 4JV2A 4K2JA 2MZTA 5GAGU 2GNKA 3DRPB 3NGRA 1J27A 1W25A 4ZN1A 4WP3A 1I6JA 4IDKB 4K50A 1J5EF 4NXNJ 3W64A 1RTIA 2RDIA 2AGPA 4E0DA 1NJIT 5F8NA 2W7AA 1WDTA 3TZZA 3N0VA 3KLFB 1TMMA 3MTJA 2BKPA 2XM3A 2DR8A 3IG1A 5IWAF 1MW7A 1MN9A 2DK2A 4R5PB 4LUBA 2MQ8A 4ZLPA 2YPYA 4LBHA 1JXLA 4U8YA 4O4GB 4LF8J 4X66J 2BUNA 3T1HF 2BZ2A 2GO8A 4HTIA 1ZM3A 2W01A 2K8GA 2M70A 2AJ4A 1HYSA 2CJ9A 1YBUA 4KR0B 2KT5A 1RAEB 5J2MA 2R4FA 5I4MA 1ZTWA 4P71A 4M5DA 5EWFA 2DEJA 2J6UA 3OUYB 5KFOA 4KHMA 3GR0A 3AT1B 1UWBB 2B0GA 2QMWA 4A46A 1B70B 1J5OB 2FJWA 2HFNA 2DHSA 5A8RB 5LXRA 1RTHA 1TL5A 4M5GA 3W3SA 3V6KA 2HHSA 1PYTA 1RHJB 4DPTA 1RUSA 3BO4A 4DFKA 1BE4A 2BANA 4C6AA 3AD7C 3IR7B 4YDXA 1AZSA 2F1FA 1NJXA 5LJ3Y 5CCLA 5J2NA 5A0YB 1DQ8A 2HWIA 3ZZRA 2HMIB 2JEGA 3PX4A 4P52A 4K59A 1ULRA 5KFJA 3ITHA 3HFZB 1A9NB 5E3RA 4FNIA 2BJ8A 2N4DA 2BACA 5DO2A 4DPUA 2XQCA 2RMLA 1GXTA 4IFVB 4RJVA 4EI2A 3F73A 1EJ7L 4CDIA 2DHAA 4P6QA 1FO1A 3R1HA 4JI0F 2HG4A 4IO1A 4RUAA 3PO5A 1N5SA 1UKUA 4QIFA 1YZ7A 3B4MA 4RL1A 1L3SA 2BVZA 4ED8A 4QZVB 3WQPA 2PSZA 3G71S 1U2CA 4KV8B 2YKNA 2FPHX 4ZPDA 2AQ4A 4U8VA 1N0UA 1BY9A 4OI0A 5ETTA 3ELHA 3LW5C 3MFHA 3TNVA 1S0VA 4OQJA 1NK7A 4LF4J 4H4MB 2BJ9A 4K8RA 3H2UB 2UXBJ 2L41A 2R42A 3PTWA 2DGUA 1IBLF 3M7VA 2ZFHA 3DI6B 3CJ2A 2HHTA 1SXLA 1YIJS 3I32A 5IC4B 2U1AA 1N88A 5DDPC 3KUGA 2V6AA 1HWUA 4JI8F 2MKJA 4F25A 2KDOA 1GX5A 4QW8A 5CXTA 1RT1A 2BKNA 2E66A 1M5SA 3M2RB 1C0TB 2FVCA 3SIPB 4CO2A 3CDEA 1H0HB 1KKHA 4GO5X 2WSCC 5D0HA 1T05B 3KHHA 4ZP6A 2RF2A 1CJTB 3THTA 1NXIA 1WOOA 2MSTA 3PW0A 4OI3A 3I55S 2E5LF 1FEHA 3DLHA 1FX4A 1WSRA 5CYMA 4K7QA 1MWYA 2CQ4A 4GKKJ 3LPYA 4TN2A 5D77A 2FGOA 3LP1B 2N4CA 1APSA 1VI7A 1OQ3A 3DRPA 1MMDA 1QM9A 4IDKA 1UP1A 4PUOA 3UVJB 2KM8B 2ASYA 1KFDA 1X4FA 1F9EB 1Y5LB 4EEYA 4QPTA 4W98A 3KLFA 1H2TZ 3D6HB 5FDLB 3EGWB 2XSFA 1PJ6A 4TQSA 2IPOB 5DG7A 4X4QA 2V63A 4R5PA 4NXNF 3J7ZT 2Y1JA 4O4GA 4Q2LA 4NCBA 1RCXB 2MZSA 4N77A 4K4UA 2QMXA 1PC4A 3R7SB 2Q66A 2I38A 2CJAA 4B3OA 2KG0A 4LIRA 3LANA 4FF1A 1HW8A 2RQ4A 2KHCA 2VL1A 3TJ9A 2AIRB 3JYTB 1UTAA 4C7QA 4LF8F 3RB0A 4JI3J 3OUYA 1WOSA 4X66F 4U6PA 2MSSA 2OPRB 1UWBA 2ZNZA 1RSCA 3E8OA 1J5OA 4OLPA 4QWCA 1SUQB 3A3PB 2DT9A 1JWWA 2RHSB 4B3MJ 3OTCA 4ZITA 1FESA 3QWUA 4J5OA 1CS4B 2RE1A 1I51B 3EZ5A 3DLBA 1YJWS 5A0YA 4FYXB 4PWUA 4AYBD 5C7PA 3IP0A 2PA8D 2XSJB 1U6FA 5DRKA 4AXJA 3UCUP 1W7WA 1XTZA 2HVDA 4EBCA 3P45B 3TX0A 3I5AA 3KLHB 5JVGQ 5HJYA 4IFVA 2ZH5A 1P9YA 3PFEA 5D78A 2WVFA 3BQ1A 2NSBA 3MPDA 4NLYA 3V4MA 2GGPB 3FCHA 2HGLA 3TW0A 5J1EB 4CH7A 3KK3B 1U24A 1NDCA 3SZ2A 5HL7Q 1RABB 2UZAA 5JJBA 4KV8A 1JQGA 1PIEA 2NCKL 5ETQA 3VCDA 1RAHB 4K0KJ 5KFAA 3BSOA 2YX4A 4X84A 3H0PA 5HJXA 4DR1J 5LSOA 4H4MA 1Q7YT 1WC3A 5GAHI 5F8MA 1RKJA 4F0HA 3DI6A 2HPUA 3IR5B 2CA9A 3CDUA 5KFWA 2FZKB 4LF4F 3RAXA 3KDNA 2BEFA 2ZBQA 3Q22A 2UXBF 4BS2A 3MPVA 3PX6A 2C2EA 4KJIA 3I56S 2XYPB 3MR3A 1Q78A 3CW2C 2FUG9 4KHPJ 3Q8PB 2H54B 4MKYA 3M2RA 1C0TA 2YWFA 2PE8A 4CLZA 3OR2B 1T05A 2XS2A 3H2VE 2RAQA 1IR0A 4NLPA 1CJTA 2CUYA 3HM9A 3MUVP 4LBIA 2XNRA 3KTQA 2PMHA 2NZCA 5B0AA 1P6TA 2M4MA 2IVFB 1WG1A 5HROB 3FZBA 1FT8A 3I0SB 3KHLA 3PY8A 3C6TB 1RWNB 5DG8A 3HD2A 2KG1A 2MQQA 4F02A 1LK7A 2CPDA 3HZEA 3BO3A 1IBCB 1K9MT 3UVJA 3SCIE 4GKKF 4C97A 2DRBA 4J90A 3BM7A 2MKSA 3JTPA 2UUAJ 4Y3CA 1NB2A 3QFHA 3PW7A 3M6XA 3PV8A 3L7OA 5EHHA 2WB1D 2KB2A 3R5AA 1D9FA 5FDLA 1QAJA 4WF9Q 1Y9OA 2V5HG 3I6PA 4PG7A 2V4RA 3PJXA 1VBKA 2AEFA 5K9FA 3HKWA 3QJPA 1V3RA 3NMRA 4EBEA 4ZJLA 2DEIA 3MMBB 4DV2J 2MKYA 2DH8A 2OAUA 5F3TA 1S1VB 3BBCA 3N79A 2N3OA 3M6VA 3PW5A 4YOEA 3TR5A 3DGVA 1KC8T 1JMTA 1RWVB 1FVQA 2JRSA 4NMXA 1NHUA 4IRDA 1YSJA 4DL5A 3ENWA 3JYTA 2MY8A 4KPYA 1XIQA 5K8PA 1ZM2A 4W90B 2YKQA 4OHYA 2OPRA 4ZDNA 2CQIA 1SUQA 1FX2A 5AXMA 2X3GA 2CNKB 3M8SA 4JI3F 2F4VJ 1ZS6A 3THPA 4X65J 2R7VA 4ECVA 1CS4A 3AB4B 4AT1B 2VBZA 5KG2A 2FHOB 5B0CA 5LMNJ 1SQGA 4NYPA 1RTDB 2QA1A 4HT7A 1ZPVA 2C3PA 4YR3A 3MM6B 2XSJA 1T9TA 4B3MF 1NRKA 1MMLA 2NLWA 3ZO7A 4WK1A 2BQRA 1Q8LA 1IJFB 4OYWA 2OEJA 3KLHA 1TUVA 3WHIA 2KXNB 2OSRA 2ZNYA 3J81U 3GSIA 2R2SA 3UCGA 1O5JA 2GGPA 4A47A 2XLJA 1JLFB 5J1EA 4QJVA 3KK3A 1C2PA 2C2RA 2D74B 4OI2A 2HNZA 4X4UA 3OSNA 1UMJA 5DM6Q 1TZ0A 1NPKA 4IOCQ 4FDFA 2R7TA 3BGLA 4URGA 2ASDA 2Y0SD 4KE5A 2HQGA 1N54B 3SCKE 2FVPA 4C0BA 2AX1A 2C2DA 4K0KF 5HATA 5M2PA 1U02A 2B8QA 1UVIA 3TVZA 1SJFA 1UFWA 4DR1F 2DGOA 4I7FB 3GR1A 1F9FA 4O3PA 3MCMA 4RNNA 4TU7A 4FYVB 1H73A 1U1PA 2ZZNA 3P8BB 4MIWA 4Y2AA 4ERDA 1WF2A 1DHMA 4IH6A 2MZJA 4GC6A 4XPEA 4TU8A 2IYGA 3KG1A 3MPWA 1OYEA 5KFGA 1RTJB 1XR7A 3HZGA 2YQ3A 3OR2A 4RPFA 5H1SV 3J81j 2BOPA 1W2IA 4RBTA 4KHPF 4C3LA 2MY7A 3FRYA 4QYZK 1DFDA 2XEXA 3EGVA 4J9KA 3BH7B 5CQGA 1S10A 1RYRA 4CO5A 2KXHA 3VWSA 2Z2MA 2UXCJ 4HACB 5HROA 1KLMB 3I0SA 1OY6A 5RUBA 1T9XA 1LV5A 3C6TA 3ZXWA 3W60A 2VA2A 5KT5A 1C1BB 5A76A 2DD8S 2HSEB 1NHKL 1SQFA 4IOBA 3QPIA 1RAAB 2B4PA 2X1BA 2ZH9A 2ADBA 1H2UX 3BF4A 4DUTA 2EW9A 2HBYB 1I5OB 2K3IA 2YWGA 4GRSA 4NI2B 4UOGA 2B56A 3LP0B 5AXKA 1H74A 1VIXA 2VOOA 3GFXA 5KFQA 4J9VA 2DXEA 7AT1B 3RRGA 3CCWA 4X4RA 4N76A 3LOUA 4DQSA 4FYYB 2N82B 2UUAF 4N8OA 4MKBA 5ETLA 3VVTA 2VKZG 1ELOA 4OJGA 5GVQA 3MMBA 4G1QB 1FDAA 4LFCF 3I4PA 2BMBA 1S1VA 4OZLA 1VQLS 5H9EK 1Q86T 1TP7A 1Q5YA 1XERA 2J9EA 2PT0A 4IH5A 1VQYA 2B8PA 3D0HE 4A8KA 2CQ3A 2RQCA 3AJ1A 4DV2F 5CZVA 1RCOB 1U25A 3S8SA 3O3LA 2OD4A 2MLZA 1PAEX 1KS2A 1Y00A 3SEOA 2F63A 5GAEI 1VS3A 2ACMA 2OKQA 3NS5A 3I4HX 1RTDA 2HGNA 4NLQA 3MM6A 4Y0FA 2F4VF 2EK1A 3J81Y 5AE1A 4USKA 4FYDA 3R27A 4ED7A 4ZVQB 1T02A 3I9ZA 4Z7CA 1PG5B 3S7RA 2L9WA 5LMNF 4PAAA 1PYOB 1PYSB 2HHWA 4Y2MA 3VAIA 4U7UD 1U1MA 2CZ4A 3ZTPA 3RU0A 2AJ2A 1UJ4A 4OYIA 2D41A 2VJUA 1JLFA 2CJBA 4XIUA 3BN4A 1NZ8A 4RR5A 1MMNA 4UY8T 1BHNA 3QGHA 1FKPB 1KVKA 2EFNA 5HO4A 2KVQE 3AOAA 1V9OA 4XTTA 3CCQS 7FDRA 4DQPA 4M5JA 5E5NA 3N6MA 4M94A 1S7IA 3C2PA 5E41A 1DARA 3DRSB 4BHQA 3MZIA 1YRUA 2XLKA 1XBWA 1RQ0A 3RB4A 1WC1A 2NUUG 3BZQA 2H5IB 2E9TA 1V5VA 5F3ZA 2J76E 2J9DE 3CXCR 1WF0A 4KO0B 2XHWA 4I7FA 4HVZA 2VFSA 3FSYA 2K3KA 1EP4A 2CAJA 1K73T 3DM2B 2ZUGA 4UW2A 1OSCA 3OTDA 4DQQA 1WF1A 3LAKA 1RTZA 1Q81T 3HCXA 3IS9B 5D8HB 3H40A 4DUYJ 4F0KA 2RJZA 1RTJA 3M8YA 2VPZB 2IFXA 1D0EA 1NNDA 3ETOA 2OP5A 2RS8A 3W7BA 3UDCA 4I1TA 1LFWA 4KGXB 3GFZA 4F4XA 2GQ2A 3W63A 5KFUA 2UVRA 1NK6A 5KFFA 1HNXJ 2D3OR 2UUCJ 4OX9F 2UVUA 4M95A 1G2EA 3NBPA 1BWEA 4HACA 2DCUB 1KLMA 1YBTA 4ZPAA 3CD6S 2DNQA 2HS3A 3C15B 3HXMA 1C1BA 1HNZJ 2XMAA 3RBZA 3UI3A 1OPZA 2LP4A 4C8LA 2E1CA 3HVAA 1HBUB 2R8GA 3TARA 1FE0A 1RYSA 4NL5A 2C3MA 4NI2A 3LP0A 3A1YG 4F4WA 4HEA9 4ZVTB 4F4KA 2FJDB 4O3NA 3D1HA 2WHOA 2YH0A 2WW4A 1QE1B 4KYZA 3GILA 4RX6A 8AT1B 4UUWA 3JAMU 5THWA 4G1QA 4K4VA 2K7JA 5FIIA 1S48A 1KOOA 4DF8A 1S79A 4RUBA 3WC2A 2AP6A 1UL3A 5KFDA 3QMQA 4MAKA 2APOA 2XNQA 2YKMA 4ECWA 1MNEA 4FF3A 2VQEJ 3ZNJ1 5CYJA 1AB8A 2CJKA 4M5NA 4OHZA 3KMSA 4HDGA 3DOKB 3RTVA 3SFGA 1HWLA 2OPQB 3P6YC 5L9XA 3J7AN 3SSQA 4USVA 2HVZA 4QIEA 1WEYA 1RBLA 3J7YI 1XWLA 2FIUA 4DV7J 2E1PA 1TK5A 4IR1A 1M5HA 3SDEB 4QCLA 2OELA 4NLDA 2HRUA 1RB0A 4DN9A 1HBOB 2G9OA 4WWSA 1ZA2B 4USWA 2YKOA 2XBPA 1YGYA 2C3OA 2VA3A 3NCQA 3EX7B 1FK9B 3HVTB 3MFIA 3VVUA 3QSIA 1SQEA 5A8KB 2AMCB 1N5YB 4CI0B 1RISA 4ETZA 2EBGA 1S97A 1RP5A 4IUFA 2CXEA 2MQNA 1HQUB 2DIUA 4I69A 4JI2J 4JB8B 3W5XA 3DRSA 4J9OA 1U2RA 4ED6A 1IUJA 2E5JA 2C2OB 1ICEB 1GMVA 2HW3A 2POKA 2ZOFA 3R5DA 4I67A 2HBRB 3QRRA 1SI9A 4OLOA 1TKTB 3BDPA 3IXQA 2W8LA 2JC1A 4HI2A 2CG8A 1EAYC 4KO0A 4CQ1A 1AW0A 3FZ2A 1FWKA 3GSDA 4LQ9A 3CB4A 3D6MB 1ZETA 3ZZUA 3KUEA 2CRLA 4U95A 3C46A 3DM2A 2VPWB 2YQ1A 2RD5C 2HWTA 2KRRA 4AFFA 2XGQA 4RU2A 2WRMA 2FYXA 3EE3A 4UT4A 3IS9A 1H72C 4YB6A 1YKWA 2OTLS 1VQOS 1JJ2R 2MZ1A 2ZC3A 3V6JA 2K2PA 4RW8B 2EKNA 1KDNA 2A6MA 4LRFA 2J7UA 4FZVA 4DUYF 5FJ4A 3MAQA 3CO9A 5KOXA 3A4TA 2QV6A 2R7WA 1X0FA 2AW0A 3HFVA 3Q83A 1SJQA 4P2FA 3OXGA 1ZA1B 3C15A 3PYGA 1B7FA 1HNXF 1FEEA 3GTYX 4OZNA 2UUCF 3CWJA 1HBUA 3KJVB 1GXLA 3V6HA 4Q0BB 1KP6A 3PEHA 1N0VC 3CC2S 3A8IA 1UWAA 2OEKA 1KOHA 1FNOA 4LVOP 1HNZF 4JI1J 1UPMB 2JX2A 3EVOA 3TJ8A 3NL0A 2CQBA 2RRBA 2JOQA 1ZAVA 1M0SA 1UEVA 2AX0A 3NGTA 1CBKA 2ZH4A 2HLTA 1NK0A 4YR2A 2V4JB 2DCLA 1QE1A 5F8IA 2GCFA 1RT3B 3GV5B 2IY5B 4OHVA 2KM8C 5CYQB 4YQWA 3F0NA 3BN7A 3O44A 1G7CB 1BGXT 5SZTA 2UUTA 3OLAA 1HI1A 2IJNA 4J9UE 2V8DA 1F2GA 2ZVSA 5D15A 2GMJA 4ZPCA 1GNKA 2DITA 2AZ3A 1SIZA 2AJ1A 1UVJA 2PI5A 5F0UA 1ROFA 3OVAA 1TTHB 3BYPA 1SH0A 2YBVA 2QLJB 2J9CA 4NYZA 1JNZB 4IYQA 1LWCB 1UVNA 2VQEF 2NSCA 3MM9B 2FHJA 4QPXA 2V2VA 3CIMA 1WI6A 2UUBJ 1KN6A 3D2WA 4YEAA 2I6WA 3KHRA 3GU0A 3SDEA 3QBCA 4DSFA 2AEMA 2ILYA 1FD8A 3AOBA 2B6AB 4C0OC 3GIJA 2F65A 1N33J 2IVYA 1HBOA 3IA0A 1NK9A 3LAMA 4CCHA 4DV7F 5U47A 3Q2TC 3R5JB 3CCMS 3BBBA 3ILLA 3RJMB 1FK9A 2WK4A 3W8PA 4NMLA 4DR4J 4DU8A 5A8KA 1AFIA 2QLFB 4YB5A 1N5YA 3DN9A 2F4FA 4G65A 3PCOB 1T9YA 2NYHA 3H4BA 5HMZA 4WU2A 4BCAA 4C3KA 4OI1A 3U1MA 1SC1B 1HQUA 3R3TA 2MPUA 1VFJA 1Y11A 1QY7A 3B6BA 2Q6BA 3BREA 2HHUA 1PC5A 4DBQA 1TUGB 4NEZA 4OI6A 4F8RA 2DGQA 4TLRA 1TFYA 2H51B 1D09B 2RDDA 3X3UA 3FMBA 2VHGA 4JI2F 1ZBTA 5HQLA 4J9NA 3ONQA 3D0GE 4WTYA 5B09A 2F7VA 2RNEA 5DLGA 3A8JA 1JNRB 1Z4UA 4BLGA 1N34J 3O1LA 5IC6B 3HSDA 3HHLB 4MJKA 1NU4A 3TVYA 4O44B 1FRJA 4PZVA 3TA0A 1Y3JA 2XCPA 3BGUA 2Q43A 3EDRB 3GE9A 3LWMA 2GIQA 3H4DA 1R31A 4K5SA 3CUNA 4CLLA 2YXLA 4DL6A 4USTA 3WIVA 3CMQA 3P49B 3TI0A 3PG9A 3CD5A 2CNOB 4RW8A 4DV0J 2O67A 4ZLLA 3V6DB 1FJEB 3DDIA 4P9SA 4LREA 5DQGA 2VC1A 5L1LA 2OGUA 2BYCA 4B9SA 2M5YA 4EZ9A 2C3YA 2MXYA 1X9MA 4PXEA 2PIIA 1L5UA 2NXNA 3KJVA 1HWJA 4Q0BA 4FVMA 1MU2B 1NDLA 3FFIB 1DBDA 2NXJA 4DPOA 4AL7A 3V4IB 1IKVB 2V4QA 1Z1ZA 2IMWP 2B7BB 2M0GB 4C3MA 4ZLJA 4IQXA 4QYRA 1G4CA 4FBTA 1TVRB 5KG4A 3TP2A 3Q24A 5ETMA 3T1AA 2V4JA 2RUSA 3UDLA 4JI1F 3BB5A 1ZZNA 1RT3A 2CNLB 4NASA 1EZZB 3JSBA 3HSGA 5CYQA 1X5TA 3R1LA 3Q23A 1K1QA 1U1KA 2HHHJ 1JLAB 2QN6B 3P3DA 3WBZA 3T9NA 1UPPA 1PKUA 1Q8IA 2V2KA 4LRDA 5KG3A 1DQ9A 1TK0A 4ES2A 3CULA 4LMZA 4B3SJ 5KG6A 4F50A 1F1BB 1QVGR 3E51A 2LA4A 2CVEA 2J0SD 3TWZA 3C8YA 3N28A 4B08A 2DHGA 5C2CA 5KOWA 4A8YA 1X4CA 1TL3B 2LECA 4RLEA 2F5GA 2DO0A 3NWGA 2MKCA 3AA9A 4A8MP 3PDNA 3IBWA 3MR6A 1ITPA 4NLVA 3H25A 2UUBF 4E2FB 3PIOQ 3AAWB 2GJ2A 5IXUA 3CJ0A 1ZOTA 2ZH3A 1B0TA 2F40A 3DRXA 2FLLA 5L9NA 3PKMA 5KT2A 1TELA 4CP5A 3FVYA 2V34A 1N33F 1CULA 4ER8A 4H4OB 3QSYB 3M8QA 3CJ4A 4KGMA 4F2RA 4OYPA 1FKAF 4KGVB 4ZIVA 4DR4F 4S0MA 1HFEL 1TKZB 2OH2A 2CQ1A 1VQNS 5LSLA 3GZ7A 2FHJD 4YS2A 3A8EA 2MZRA 5DDQC 3EVWA 1IKYB 2PFDA 3GFYA 4DLEA 4NLRA 3CJ8A 3NGKA 8RUCA 2P9GA 4Y00A 3K7RA 4WFXA 3HHLA 2KHDA 2FVQA 1VLOA 2DNOA 4O44A 3LO3A 2QEXS 2QA2A 2QT7A 3BKUA 2HQCA 2DR5A 2H5EA 1N34F 5F9LA 4QWDA 3AJDA 4TY9A 3EGNA 3QGPA 3SXLA 3D9BA 4MFBA 4DV5J 5B0EA 4WTOB 3PRDA 3R6GB 2Z2LA 3UR0A 1SKWA 3TO8A 1YQHA 2Z4PA 2FLOA 3MPYA 4EWTA 4EYIB 3EM1A 3D3BJ 4ILLA 1X8DA 3M32B 3DHWC 5L38A 3W9JA 3V6DA 1K0TA 3MCSA 1SBRA 2MQPA 2HK2A 4TLQA 2L3MA 2XYHB 4C8OA 4OIXA 2QA4S 4ES3A 2HFZA 2AKWB 2JC0A 4B9NA 4AL6A 2X1GA 4DV0F 1LQ9A 1RLCL 3BSAA 2CJYB 4TU9A 4RNFA 4MK7A 4NLUA 1GT8A 2E9ZA 3OL6A 4X4TA 1FHTA 3PJWA 3G2XA 2OEMA 1E6YB 3ZZZA 2CPJA 3RW7A 1WORA 1MU2A 3B8HA 3FFIA 1IR2A 2AHOB 4J7CA 3V4IA 1DRZA 3IM8A 3L3CA 1QSSA 3R2CJ 1M1GA 3ZTRA 2NQPA 1VYAA 2IHR1 1X4DA 4V19X 3O6QA 4TY8B 5G0RB 1NMEB 2VIHA 3CD7A 5EX0A 1TVRA 1OYDA 3UCZP 4WIIA 3GPAA 2ERRA 3LH2S 3OXLA 4V1Ak 3G8QA 4PEOA 4IH7A 3CCUS 3W2WB 4ZCLA 4UZCA 3GCXP 1JLAA 5BYRA 1JIHA 1P8GA 2R2TA 4K4ZA 1HI0P 1S99A 5KFLA 4RNMA 1XMQJ 2DGVA 3KK2B 4Q5VA 3OTBA 2HHHF 1S5ZA 2I8EA 1AFJA 2GC8A 2KO1A 3S6EA 4QWEA 4ZPTR 3AQOA 1BD6A 4O3QA 3TZXA 1IN0A 2YX1A 4ZP8A 2W4DA 3HD1A 3DLJA 2M9KA 2AV5A 3FCVA 1MROB 3OTOJ 1WTBA 1XR6A 1VQ5S 1EARA 4P2SA 3RBXA 4B3SF 2J8AA 3G86A 3NP5A 2DH7A 4OX8A 3TAPA 5L1JA 2D7SA 3UWTA 3OW2R 1PCAA 2LKZA 2OMOA 5CAAA 3AD9C 1GEHA 1FD2A 4WZMA 3DMJB 3GLJA 1NSKL 1PJ5A 1VQ7S 4LFAJ 4P7TA 4UOFA 3WX8A 2X3DA 1Q1KA 4USIA 2IDLA 4NXMJ 4OJHA 3G82A 1HNIB 4IFYA 4WK3A 2PDAA 2ROGA 3PJ9A 2BOAA 4WPAA 1WHYA 2B4UA 3QFWA 4ECSA 3KK1A 2IBOA 2FJXA 1TKZA 4CT9A 4CLPA 3LGHA 1VOMA 2QSWA 1KFSA 4B9MA 1WSVA 3CJKB 1WC4A 3TEGA 4DSEA 1VC0A 9RUBA 2JEIA 4O23A 2LDIA 4PKDB 1IKYA 5LL6d 3T6BA 4YB7A 4ECRA 2E1RA 4E98A 2L9NA 3AXMA 3HX9A 3NAIA 2DNYA 2FY8A 2R8HA 2GZOA 1D3WA 3BEGB 2ROPA 3H5SA 5K8NA 1NAQA 3R8YA 2EXUA 3NOGA 1A6LA 4ENOA 1WKKA 4QW9A 1LXNA 1V3SA 2IVMA 5ETSA 4RUHA 4LBPA 3L4BC 3R6LB 1GXUA 3H5YA 1WOPA 2KJVA 1C4CA 2Z0GA 2LXUA 4BWMA 2HFOA 3RW6A 2KH9A 2BE9B 2P2CB 3MURP 1PO6A 3A12A 4J9PA 2J7KA 4ATNA 2XI3A 2J6TA 2MQMA 3M32A 3DLGB 5ETNA 2HFUA 3NNHA 4I2PB 4ZVUB 2RQKA 4DV5F 4Z7YA 2KTQA 1TQLA 2R7UA 4RW6B 3SV3A 3I5BA 3R9LA 2CWKA 2G0CA 3DDNA 4OJ3A 2IJRA 4DCOB 1VDHA 3PACA 3QLHB 3OSPA 3CGIA 3M6UA 4CH1A 1OO0B 4DZDA 3VV2B 1JLQB 3FRZA 1GH8A 3D68A 3CCSS 1HARA 2BJDA 1L3KA 2GW8A 3E2EA 4A8SA 4K5RA 4DOZA 3HHLD 5EN1A 4CLTA 1E6YA 3OJSA 1FNMA 5I3PA 1HHTP 4F67A 2CZVC 3ENVA 2AU0A 3QIPB 5BJRA 1PAUB 3MAAA 2X1FA 2GAHC 3OV7A 1NO8A 5CA5A 4TY8A 5G0RA 2VBXA 1IVZA 2P6SA 3NWRA 3MWBA 2LMIA 3D54A 4R8UB 4ZKAA 1HPZB 4LF9J 4HH0A 4NPOA 1WC5A 2EKYA 1R3NA 2BR0A 1KR4A 1K1SA 2WVDA 3CEDA 3W2WA 2I1RA 3A3NB 4Y2KA 3P5TL 5AXNA 4NLGA 1EQ0A 3G6ES 2O01C 3UNYA 4DU7A 1VBYA 2I2YA 4PUOB 1KTVA 2M88A 4UOCA 2E7VA 1JK9B 3KK2A 1U0SA 1AT1B 3W5ZA 1DLOB 1QAXA 4WCEQ 3F44A 2QIFA 3V2UC 1N6QB 1S6OA 2E5IA 3UFCX 3W61A 1IWGA 3UDEA 4LF2A 1XMQF 3I96A 4ZOSA 2DNHA 2DNLA 4G1PA 1MROA 4NA3A 1FVSA 5LOQA 3MR2A 5EDWA 4IG0B 4ZP7A 1XNRJ 4B3OB 2QLBB 1YJNS 3O5TB 5HQ8A 3FBBA 1R89A 5F8JA 1U7LA 1VLYA 1QUPA 1OY9A 2XULA 4KBIA 4ANEA 4NYOA 1TL7B 1FXRA 1LW0B 3W62A 1Q8KA 3K5OA 3RBEA 3LF0A 2OPSB 3OTOF 2Y1LB 3N5BA 4ZVRB 3CMES 1XK8A 2HQDA 3DMJA 1QUVA 4CNYA 2PGCA 1RXOB 3D67A 1R0CB 2HVEA 3M05A 2G1DA 3WZ0A 3SQOP 3EICA 5J2PB 3KJQB 3G96A 1HNIA 4NEYA 2LQ8A 1FA0A 4LFAF 1NKEA 2KI2A 2MYFA 5L1IA 3UN5A 1D8ZA 1W2BR 4NXMF 2HEKA 3AB2B 3BR8A 3W2VA 2ASJA 3CJKA 1WHXA 3TOQA 2RVJA 3TANA 2HS4A 3TA2A 4M5HA 5B0GA 1UW4A 4AD6A 4QU6A 3S1TA 2ZVIA 2Y8YA 2EPIA 1I3OB 2GHWA 3AXKA 3CCJS 5MAOA 1WHVA 3ENQA 2K7KA 2XO6A 1RT4A 2IDEA 3TAQA 4DSLA 5AJ3J 2ZITA 2XG8A 3BKTA 4OYOA 2JHEA 2N7YA 2B4OA 3SQGB 4OMFG 4OV6A 2LYVA 1FTCA 3TVKA 3DLGA 4I2PA 1SB6A 3PR4A 2CQ0A 2V69A 4RUCA 3FBFA 4RW6A 4NLSA 2H3EB 1RAFB 4NX9A 1WKJA 1RWUA 2ILZA 1VIOA 2JJ4D 3QLHA 4FYWB 3TQEA 2YWHA 1RWWB 2ZM6J 1JLQA 3CDBA 5GADI 5HN0A 3RB3A 3EWGA 1S4EA 1DTTB 4XDDA 1VK8A 2M52A 4FF2A 3FC9A 4QR2A 3D4JA 1NUEA 5CD4H 4DV3J 4N8NA 1Q16B 3DGPB 1M5OC 3CCTA 4AUKA 4MKVA 4F26A 1SL0A 3QIPA 4WIQA 5L39A 3CCVS 1X9SA 3K8VA 1LWFA 5LM7E 4F4YA 4OHWA 3M2VB 4USJC 3KLVA 3K17A 1HI8A 3DRRA 4R8UA 4DL7A 4HH1A 1HPZA 3BPDA 1OJ4A 1IKXB 3PHEA 2FJVA 3L95X 1WWHA 2HURA 5A6WA 1AUDA 4NLWA 3RG6A 3IC1A 1ZM9A 3TA1A 4LF9F 2FLNA 3D0IE 1PBAA 1UFKA 4AXIA 2V9WA 4N56A 4XAKA 1DLOA 4WJBA 2HAIA 2H9ZA 3IWLA 1RACB 3RR7A 1N6QA 3FEZA 2B9WA 3KDOA 3OL9A 2X7IA 1T94A 4JI7J 3I87A 3D1OA 4C4WA 3MM7B 2IM3A 4IG0A 5DG9A 4I2QB 1RI7A 4PG8A 4DX5A 2C2NA 2EFOA 4USMA 3QGIA 4L75A 2IMOA 5E0OA 2NYIA 2OO4A 1YJRA 4GVLA 2RT3A 1JXVA 1DZ5A 1TL7A 2G2OA 4M5LA 1XQIA 4C0HA 3ZZOA 1LW0A 1TR0A 2WW8A 1SC6A 1RHQB 2OPSA 1U0HB 4X62J 4IO9Q 4PYAA 1XNRF 2FJAB 4ECZA 3H90A 2G13A 2YNHB 1YRTA 1TK8A 4MT1A 5E3AA 1UVLA 5EUHA 4Y34A 3PX0A 2LEAA 1U6BA 2CZ9A 2KFYA 5J2PA 4CIOA 2MQOA 1X5PA 5GMEA 3W9HA 1MWZA 2ATLA 1UAWA 2FB0A 3OLBA 1WC6A 3M4XA 2OI2A 4NZ7A 3CIZA 3Q8SB 2NPFA 3T3FA 4ZMMA 3T19A 2V67A 1S59A 2YTCA 2BRKA 2OFHX 2V8HA 4KFBA 1S9FA 1SC4B 1YJ9S 4I4BA 2OD6A 4DJBA 1D1UA 3QZ7A 2W4PA 4A4JA 4ILMA 4Y2CA 3MF5A 3EVMA 3KWMA 5KFBA 1IBMJ 3D1QA 4LQ3A 5ETVA 2HNZB 4WKYA 3QO9B 4LR7A 1KQKA 4WXWA 3D7SB 2FZCB 4ED4A 3SMZA 5KFYA 2GAGC 2VQFJ 1S49A 2Y1IA 2C42A 2VDHA 4WE1B 1JLEA 4XK8C 2MZQA 4WFAQ 4U7CA 3SQGA 1N52B 3M9NB 1VK3A 1N5VA 4H54A 2H1YA 1NJWA 3LGMA 3HHLC 4G3IA 1R0BG 2LQBA 2A2CA 2XTJP 1TL1B 3IWNC 5AJ3F 5J2QA 4DL0C 3DOMB 5JUMA 4LF1A 1YRXA 4CTAB 4X4OA 4F36A 1V6HA 1S4FA 2C3UA 3ADAC 3IBFB 2J9DA 1FRMA 2HS0A 3T9ZA 4ID8A 2NPIA 2GHPA 2EG2A 1DTTA 4JV1A 1K0VA 4PXDA 2RUGA 5CABA 1FDBA 1BQXA 1U4BA 1R0AB 3HHEA 2XZDB 2G0IA 2J6SA 3DGPA 3DRYA 3HJFA 2ZM6F 4DR2J 2PMWA 3KJNB 4NE9C 3TUPA 4FPRA 3VHQA 5KFEA 3QAEA 3M2VA 2ADCA 1LFPA 3CNQP 2DRDA 1RHMB 2H5JB 4YFUA 2J0XA 4RBUA 4CWBA 4DR5J 4DV3F 4ANCA 1PSDA 4J9QA 1IKXA 1U1RA 4N7TA 1T8EA 4XPCA 2EVZA 1QTMA 1KBRA 2DXFA 5GAHU 2GMHA 4CRJA 1H6KX 1JB0C 1MLAA 1RAJA 2AT1B 3RGIA 4URSA 2R3VA 4LT6A 3OQ2A 1DQAA 2O3DA 5KFNA 3DU6A 2E29A 3H20A 1KWMA 3NGUA 3HO1A 2JVOA 5D6GA 3US5A 3G4SS 2IIHA 3DNCA 3CJSA 1WD6A 1VQKS 4Y6IA 2DKOB 4I64A 3H7HB 3UO0A 2R9LA 3MGJA 2BJEA 2RSQA 5CCMA 3MM7A 1HW9A 4I2QA 2GHVC
chains in the Genus database with same CATH topology
1UTAA 1X60A 2LFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTA A;  1X60 A;  2LFV A; 
#chains in the Genus database with same CATH topology
 3EUN A;  4MYU A;  2XZT B;  1LWX A;  1U49 A;  4USU A;  1NH7 A;  4DUZ J;  1Y3K A;  5B7W A;  4JI7 F;  4DXL A;  1QSY A;  3G8T A;  5ETR A;  3LUY A;  5FLX U;  2EBE A;  3A3O B;  1U0H A;  3N9U C;  2AGQ A;  3CO0 P;  2KJW A;  5ETP A;  2YNH A;  2R2U A;  3QT6 A;  4J37 A;  3TUZ C;  1VRT B;  1KVI A;  1UZD A;  2QZ8 A;  4K4T A;  3U27 A;  3TQ1 A;  3GB0 A;  2UXD J;  4DSJ A;  2XGP A;  1DUR A;  4X62 F;  4FKX A;  2XB2 D;  3CJR A;  1UW9 A;  3BS9 A;  5K14 B;  3KKF A;  3DFE A;  3WDO A;  1A7G E;  3G6X A;  2LXI A;  3IR6 B;  2IC3 A;  2D3Z A;  4DEZ A;  3SFU A;  2A6O A;  3GJT B;  2MTL A;  3UD4 P;  1MWQ A;  2ASL A;  2HQI A;  5H9F J;  1HQ2 A;  1K44 A;  4DFM A;  2HHP A;  4NLO A;  3R7N B;  3P5B P;  3M9O B;  2LA6 A;  1OQ6 A;  3CDA A;  4DDF A;  4DQI A;  4A8F A;  1U8S A;  1S0M A;  2YNF A;  4ITS A;  4HHU A;  3JQK A;  4LR8 A;  4QR0 A;  2F9J A;  3UD5 A;  2MLY A;  2BJ3 A;  3TZW A;  3K5P A;  1FRI A;  4JYA J;  3NS7 B;  2KN4 A;  4TYB A;  3QO9 A;  2YVS A;  4U9R A;  4OV1 A;  3PM9 A;  3P96 A;  3DKD A;  3KJF B;  3EPI A;  1CEZ A;  3MDF A;  2Z57 B;  2QFI A;  2JFD A;  1KSP A;  5IT4 A;  1IBM F;  4DPX A;  2KFZ A;  4WE1 A;  4ZVF A;  5AXL A;  1U48 A;  2LXF A;  2E5H A;  2ZDP A;  1JJH A;  2E1A A;  2DR7 A;  1LEO A;  4ETX A;  3H5U A;  2VQF F;  1VMB A;  1TL1 A;  2Z2Z A;  1B0V A;  4IG3 B;  3MR7 A;  2QC3 A;  3DOM A;  3FBC A;  4CTA A;  2A1B A;  5JMN A;  2LCW A;  2BAB A;  4J9M A;  2DTJ A;  3H98 A;  1K8A T;  1EP4 B;  1RBA A;  3PKY A;  4WYL A;  1FF2 A;  2COL A;  2XY5 A;  2HBQ B;  5D3G B;  4U67 Q;  3RUB L;  1IBK J;  2YH1 A;  3ETM A;  3NS6 A;  2ALY B;  1R0A A;  1Y4Z B;  4DL2 A;  3BSC A;  1RA6 A;  3B4D A;  1X5S A;  3D6F B;  4C98 A;  2XI2 A;  1SH2 A;  1KHW A;  3QGG A;  3UDV A;  3KLE B;  4CLW A;  3BQ0 A;  3MM5 A;  2B7C B;  1YJU A;  1VRU B;  2V8V A;  3GYG A;  3NCR A;  1Y7P A;  5GAG I;  1T9V A;  2GX8 A;  2PEH A;  4DR2 F;  3NBP B;  3ZTO A;  5GMD A;  5DS7 A;  3IBC B;  4ID5 B;  3N4W A;  4QQB A;  1EKR A;  4IRC A;  5LT5 A;  4DFP A;  4MK9 A;  4DR5 F;  4JI5 J;  3R5B A;  2DY1 A;  2R7Q A;  1KQS R;  1JXE A;  1Z2L A;  5KT4 A;  2AD9 A;  1FJ7 A;  4A8O A;  1SJ3 P;  4KTQ A;  2MKH A;  2E5L J;  1HHQ A;  5K20 B;  4E8U A;  1R8B A;  4Q2M A;  4JOU A;  4QIW D;  5CHC B;  2IAJ B;  4FS1 A;  4EO6 A;  4FKY A;  2ZEJ A;  4O0N A;  3LPE A;  3VZH A;  2G2Z A;  1F60 B;  1HWI A;  4ZK7 M;  2M8H A;  1HHS A;  5FLX Y;  2QO3 A;  2WSF C;  3E01 B;  1ZPW X;  3ZFV A;  2B9X A;  1H98 A;  1DY3 A;  2WBM A;  3OL8 A;  3NNA A;  2DJW A;  4B02 A;  4OZJ A;  4PWW A;  5IT9 U;  2PD1 A;  2XMK A;  2JWN A;  2DR9 A;  2CVI A;  4LRA A;  4P74 A;  4ZP9 A;  2BE2 B;  2BBE A;  2MMY A;  2LU1 A;  1VBX A;  2VV5 A;  3QRP A;  5I3U B;  4N47 A;  2YKM B;  5IM0 B;  4OL8 A;  3K58 A;  4ZS6 A;  4DUZ F;  4KGK A;  2IJF A;  4LF6 J;  3VZI A;  2GO9 A;  1VRT A;  2ZZT A;  4KKO B;  3CF5 Q;  2ZH7 A;  1N5Q A;  5DM7 Q;  2QGF B;  3SCJ E;  2VD3 A;  2HNY B;  5K14 A;  1BXN A;  5KG0 A;  3PYF A;  1KRP A;  2E7X A;  3LTO A;  5IOL A;  1QSL A;  1WG4 A;  4HHJ A;  2AJF E;  4P10 A;  1NK4 A;  2VOP A;  4X4P A;  4Q7A A;  1SL2 A;  2CG4 A;  2LEP A;  1H2V Z;  3EXC X;  2UXD F;  2BXJ A;  3BKF A;  2GVZ A;  2ZBC A;  2BE7 D;  4X65 F;  2QSF A;  2ZHB A;  4IOA Q;  2LVW A;  1P27 B;  3H42 A;  2IA0 A;  2AZ1 A;  2Q1L A;  4WYW A;  2D9P A;  2DNP A;  1OWX A;  1YWX A;  2KT2 A;  4G1I A;  3ZC4 A;  5DZ7 A;  2UVW A;  1D8Y A;  4DR6 J;  3K59 A;  3Q0A A;  4N5S A;  2W2O P;  2XZW A;  4LFB J;  3I0R B;  2NXE A;  5KFZ A;  2MJU A;  2W8K A;  1S76 D;  1RT2 B;  1XJW B;  2QL5 B;  2E7W A;  4WZQ A;  2VH7 A;  3M30 B;  4KRW A;  4X4S A;  4J9S A;  1X9W A;  3TAM B;  3DYA B;  1YJV A;  5GAE U;  2VG7 B;  3KOA A;  1RWK B;  4JYA F;  2K1R B;  1SJ1 A;  5I42 B;  2A3J A;  4ZVG A;  3O2I A;  1TU0 B;  5IV4 A;  2YNG B;  3ZZP A;  1T3O A;  1NM2 A;  1IKW B;  2MQL A;  1SV5 B;  2LQJ A;  4IG3 A;  4DX8 H;  2OPP B;  2YY3 A;  2JFK A;  1EIY B;  3GQC A;  2R8I A;  3NLC A;  3BGF A;  4DPY A;  4HT5 A;  2DXD A;  3A8K A;  5B0B A;  3MI7 X;  5A2Q U;  1ZYQ A;  2VFT A;  2Z30 B;  1O51 A;  5D3G A;  2WVB A;  3W1Y C;  4K4S A;  3NXZ A;  3FNN A;  3UN3 A;  1VQ8 S;  3CE8 A;  3H59 A;  3FMW A;  1ZZF A;  1XMO J;  3ZZT A;  1NJY A;  1FRK A;  4X4V A;  2P6T A;  3N6N A;  3OPK A;  4CLF A;  5HVG A;  2ZJR Q;  5EWG A;  1SVD A;  5A6P A;  1U2F A;  4AQY J;  1IBK F;  3KLE A;  4HI1 A;  2B5J B;  3OHB A;  4QR1 A;  1VRU A;  4AE5 A;  1S6Q B;  2HQ3 A;  2FVR A;  5AT1 B;  4PPD A;  4UUX A;  3R97 A;  2HND B;  3H2L A;  3Q89 A;  4M5M A;  4ID5 A;  1X4A A;  4MIB A;  2HVI A;  4UQT A;  2N7C A;  3VTI A;  4O4R A;  4RWW A;  7FD1 A;  1HLW A;  2QFJ A;  1UJ6 A;  2ROE A;  3GON A;  4LF7 J;  1EB0 A;  3QJL A;  1VHI A;  2UXC F;  2VPY B;  1S9E B;  1EET A;  4LVN P;  3MHY A;  4M8L A;  4OX6 A;  2CDR B;  2VAS A;  1RWP B;  2YNI B;  4MTP A;  1CQM A;  3KG0 A;  2YQ0 A;  2Y9H A;  4JI5 F;  1FDN A;  1CC8 A;  5IT9 Y;  1A0O B;  5DGA A;  2IRU A;  4P73 A;  3NGD A;  1MG7 A;  2IAJ A;  3HVR A;  4YME A;  3MAH A;  1V3Z A;  5KG5 A;  3D5M A;  2F9D A;  3FKB A;  4PCQ A;  1FNX H;  1SH3 A;  3E01 A;  4QWB A;  1MSW D;  2FHM A;  4QBU A;  2JEF A;  4FVC A;  3BQ2 A;  4OYX A;  4C8N A;  2VG6 A;  3T1Y J;  3BSN A;  3ZTS A;  1GAO A;  3C14 B;  1XC9 A;  1CVJ A;  1WHW A;  1RHK B;  2BE2 A;  3QJJ A;  3EDQ B;  5LJ5 Y;  1WG5 A;  5I3U A;  2CQP A;  4LSZ B;  2UV8 A;  1I1G A;  2UVV A;  4D3G A;  2NR0 A;  3ZZ0 A;  2AYM A;  3P4U B;  5IM0 A;  3W65 A;  2XMJ A;  4A8Q A;  1QAY A;  1RHU B;  4WFB Q;  3MMA B;  2A2D A;  4KKO A;  4F3Q A;  3GV8 B;  2FD2 A;  2CNN B;  2BDP A;  1Y5N B;  1ZAW A;  2JSX A;  2DGS A;  5KAK A;  1JJ4 A;  1YK9 A;  3QZ8 A;  2HNY A;  2R7X A;  1BQM B;  1W26 A;  2NZ4 A;  1Q82 T;  5D4P A;  2L08 A;  4C2M A;  4LF6 F;  2CJX B;  2QMU B;  3HHN B;  3PNI A;  1RWO B;  2DR6 A;  1UCN A;  3FUY A;  3J80 U;  2EFP A;  1UZH A;  2XWX A;  1B4S A;  2HRT A;  2ZH8 A;  1LKZ A;  3JTN A;  1HIY A;  3QAU A;  1G1X A;  5DET A;  4DF4 A;  4DV1 J;  4DL4 A;  1F2H A;  3ZNU A;  5A8R A;  3TJA A;  2E1M C;  3MM8 B;  3UR3 C;  2B9E A;  3QT5 A;  4JP8 A;  4U7U K;  2J0Q D;  4JI6 J;  1X4E A;  3QRQ A;  3LAL A;  2OHD A;  3I0R A;  2IM0 A;  4ILR A;  2DIV A;  1T7P A;  2H4Y B;  1RT2 A;  5MLC V;  1VQ6 S;  2WCX A;  4DR6 F;  3M30 A;  1H7W A;  1JLB B;  4LFB F;  3FQK A;  1CG2 A;  3TAM A;  3DYA A;  2VG7 A;  1L3U A;  2HMI A;  4N41 A;  4Q43 A;  2K1R A;  2O1P A;  3OFH A;  5I42 A;  4P2M A;  4ELU A;  3PIP Q;  2ZC4 A;  2QL9 B;  4EUV A;  2YNG A;  3J7Z 5;  4DG1 B;  3KYL A;  2WVE A;  4PRF A;  3J7Y U;  1IKW A;  4CLS A;  5A2Q Y;  3AD8 C;  5ADZ A;  2DNG A;  3MCN A;  1SV5 A;  4B9V A;  3WIU A;  2OPP A;  4FNH A;  3G6V A;  2XYG B;  1DAX A;  2W24 A;  2HZA A;  2V50 A;  1U1N A;  1NJZ A;  1NZA A;  1OMS A;  1X7V A;  3ILO A;  2YPZ A;  2Z58 B;  3AHP A;  1GMW A;  2YWK A;  4ZJQ A;  4EU0 A;  4Q8F A;  2KZZ A;  2Y8W A;  4YY3 J;  2FJB B;  3GJR B;  1RLD A;  4ECT A;  2PC6 A;  3CT9 A;  4K2X A;  4CYU B;  1Q79 A;  2WSE C;  3PEJ A;  4DS4 A;  1TL4 A;  1S6P B;  2B5J A;  1V5I B;  4L73 A;  1VRQ C;  1CPZ A;  1XMO F;  4F2S A;  1S6Q A;  4L74 A;  4BC9 A;  4Z2X A;  2AGO A;  2WBR A;  1RU2 A;  1YG0 A;  2HND A;  4IQM A;  2W2N P;  3OFF A;  4USH A;  4AQY F;  3NNC A;  4I6Y A;  4IRK A;  2Z56 B;  1NDP A;  3EYZ A;  5T14 A;  1SKS A;  1YBA A;  4Y65 A;  2EFG A;  3RB6 A;  2P9C A;  4LRC A;  3PO4 A;  2JVR A;  3JSR A;  3HHD A;  1S9E A;  5A8W B;  2XLI A;  5KFV A;  2YNI A;  5M2R A;  2HIQ A;  1RE1 B;  2EI5 A;  4URQ U;  2XMV A;  4B9T A;  2AYE A;  2R8J A;  4LF7 F;  4BDP A;  1NEE A;  3IAS 9;  4QOT A;  2ATC B;  3TUI C;  1RAG B;  3VGU A;  2HQF A;  3CJ5 A;  3PXG a;  4K4X A;  3KMQ A;  3CTR A;  5HSP A;  3SSR A;  4EYH B;  2KKH A;  3C14 A;  5E7O B;  2JH3 A;  3IWX A;  1YJT A;  3LP1 A;  2CPF A;  5C2G A;  2IM1 A;  1O8B A;  3HT3 A;  3KFW X;  1BUX A;  2B43 A;  2AJ0 A;  3GYN A;  1OS5 A;  3SCL E;  2DH9 A;  3G6Y A;  3T1Y F;  1HL6 A;  4LSN B;  3MMA A;  2P5V A;  9ATC B;  1S77 D;  2L48 A;  4EGL A;  3B54 A;  2CPH A;  4TNO A;  3TRG A;  4LFC J;  3J80 Y;  1BQM A;  3FDS A;  4PYD A;  3GJS B;  1NPR A;  2OUG A;  2RH3 A;  4F04 B;  4J91 A;  4QIG A;  1Q95 G;  3I82 A;  1VJW A;  5JVH Q;  4ES1 A;  4O3O A;  4M63 A;  4EO8 A;  2ALZ A;  5J1N A;  4CM0 A;  4ELV A;  3JSM B;  5HP1 B;  4MIA A;  2YKP A;  4OHX A;  3PZP A;  4F4Z A;  4D3H A;  1URN A;  4PG5 A;  2X1A A;  1RWM B;  3MM8 A;  1KTQ A;  2NXU A;  2MHE A;  1WKL A;  4MMO A;  5ETK A;  1RJJ A;  5F8H A;  1JKH B;  5IQ6 A;  1CUL B;  5K8O A;  2R7R A;  3M8Q B;  2EFQ A;  4JI4 J;  2KZM A;  2ZDO A;  3LGN A;  4RU9 A;  3LWL A;  4DV1 F;  3C66 A;  3MED B;  1JLB A;  2CQH A;  4JI6 F;  2GJF A;  2M2B A;  4CLY A;  4C11 B;  1BWV A;  1ACM B;  1SJR A;  3VAH A;  1GK8 A;  3WC0 A;  4DG1 A;  5DDR C;  4UF4 A;  5F9N A;  2O5D A;  1SPB P;  3ZTQ A;  3T5H A;  3Q2S C;  2ZHA A;  4ZPV R;  3IN5 A;  2D9O A;  5I3Q A;  1F5B A;  2CQD A;  3AH6 A;  1VC5 A;  3IGV A;  4DFJ A;  3RAQ A;  1I94 J;  3NRB A;  2HAF A;  5KFS A;  3IAM 9;  2ZH2 A;  5H9F K;  2OLW A;  3HPO A;  1U1O A;  2DYA A;  2Q6C A;  1PJ7 A;  4MFB B;  2C1E B;  2QYG A;  1NK8 A;  5J1P A;  1VQ4 S;  1T9U A;  2MGZ B;  1Q4R A;  3PW2 A;  2N3L A;  4CYU A;  4KPC A;  1S6P A;  5DQI A;  4KB7 A;  2BQ3 A;  2AYB A;  4YY3 F;  1B64 A;  2VJV A;  5HQM A;  4QIV A;  1EQM A;  4JUZ A;  3D6T B;  4ECQ A;  1RHR B;  2ZUA A;  1FWP A;  2BKO A;  2VBY A;  4OZ3 A;  4IR9 A;  1VJQ A;  5KFP A;  2QLX A;  3W66 A;  1R7I A;  2F8H A;  5D0E A;  2R2R A;  2KXF A;  3G9C A;  3W5Y A;  3HLU A;  3O8W A;  2HK3 A;  1TV6 B;  3D66 A;  5A8W A;  3MPU B;  2ZH6 A;  1REG X;  5DJB A;  3T5K A;  1S57 A;  2DHH A;  1GMW D;  2MDA A;  4OX9 J;  4K4Y A;  2DHX A;  4RW4 B;  3TX8 A;  2LQ5 A;  2IRX A;  3RRK A;  3FEY B;  1IXK A;  3GMG A;  1EKS A;  2CPX A;  4CH0 S;  4C48 A;  2ZD1 B;  4X2B A;  2K06 A;  3UN2 A;  2ZHO A;  2HHX A;  1QDU B;  3HJV A;  1UVM A;  5IZH A;  5DQH A;  2HKE A;  3MXH P;  1KEK A;  1D9D A;  3V5R A;  5KG7 A;  1CSJ A;  2CIM A;  2CJQ A;  5D4L A;  3F41 A;  4LSN A;  3QWP A;  1C0U B;  4WU3 A;  3SBM A;  4YUD A;  4OYA A;  3I5C A;  4R0E A;  2MJN A;  3OT9 A;  3JS9 A;  2I5J B;  3B82 A;  5BYQ A;  3OFG A;  5IS2 A;  4DN0 A;  4WBF A;  3OTE A;  4IKA A;  2R8K A;  4O3S A;  3G8S A;  3NAH A;  2VG5 B;  3HP6 A;  4TYA A;  2XC9 A;  1YJ7 A;  2G4B A;  1RU1 A;  2JDJ A;  1RT7 B;  2RIJ A;  2ZOM A;  5IFM A;  1VCT A;  2WB4 A;  2U2F A;  2CPY A;  1R8P A;  2CWX A;  2CDQ A;  3DC2 A;  1K47 A;  4A48 A;  2P9E A;  1T11 A;  3JSM A;  3MD3 A;  5HP1 A;  3MUM P;  1RA7 A;  4LSL B;  2QRR A;  2GIF A;  3ET6 B;  2G2Y A;  1FI4 A;  5HMW A;  3OD2 A;  1LW2 B;  3NKY A;  2JLG A;  3M6W A;  3MEK A;  3SSS A;  1U45 A;  2P8I A;  1JKH A;  1H38 A;  2ZJP Q;  1N56 A;  1ZH5 A;  5E33 A;  5KFX A;  3G82 B;  4GKJ J;  3IRW P;  1S72 S;  4IFY B;  1LOU A;  3A13 A;  2GVD B;  2FY1 A;  8ATC B;  3MUT P;  4PQU B;  3MED A;  1T95 A;  1S1U B;  5EWE A;  1FWL A;  2C22 A;  1HWK A;  3KK1 B;  1IR1 A;  4C11 A;  2FVS A;  2DRA A;  2V0N A;  4JI4 F;  2VB6 A;  1S0N A;  1M1H A;  5HVF A;  1PBU A;  3R5G A;  3RAM A;  1Q7L B;  2JEJ A;  1HNV B;  3M8Z A;  4KQZ A;  2PEB A;  1YI2 S;  3LA0 A;  2R7S A;  1RGV A;  1UET A;  1REV B;  5B0F A;  2DNR A;  4B3T J;  2Y1R I;  2MKI A;  1RAI B;  1TKD A;  3DXB A;  3BR9 A;  4PAB A;  2W4C A;  5KFM A;  5G4D A;  2GV1 A;  5F8L A;  2MEW A;  1NH8 A;  4DV4 J;  1SJ4 P;  4RNO A;  3CMA S;  5BR8 J;  2PO4 A;  1R6Y A;  3MMJ A;  1P1T A;  4ZVO B;  1I94 F;  5C42 B;  3C19 A;  4DSI A;  4P7V A;  2MGZ A;  4JV0 A;  3L7P A;  1WEZ A;  1R8A A;  2M7S A;  2VDI A;  1NKC A;  4WP8 A;  4WKR A;  2WOM B;  4ECX A;  3J7A 1;  2F8E X;  3JQM A;  1JLG B;  3BJY A;  5K8M A;  4UTG A;  3PHT A;  2AYG A;  2ZWO A;  1OSD A;  2H4W B;  3JQJ A;  3G87 A;  5E2Q A;  4X4N A;  3NMA A;  4DX6 A;  1SKR A;  4C9D A;  4CO1 A;  2CQC A;  3NG8 A;  1OY8 A;  2VPX B;  3EJM A;  1BQN B;  2YWE A;  3DLL Q;  1YLX A;  3QT7 A;  1L3T A;  5CZX A;  3H8Y A;  5F8G A;  1VQS A;  1T03 B;  1TV6 A;  3BGR B;  2VF3 A;  1F0X A;  3C16 B;  4BC7 A;  4RBV A;  3CVK A;  3JXO A;  5HAN A;  2FTR A;  4UY8 5;  3MAA B;  2AF6 A;  4DV6 J;  2DGT A;  4YHH J;  4RW4 A;  2RQM A;  1YIT S;  2DNZ A;  3KUH A;  4ZVE A;  2CPE A;  1GMU A;  2M3D A;  4FN5 A;  3TYT A;  3X1L B;  2A18 A;  2Z2Y B;  4PQA A;  1M90 T;  2ZD1 A;  1R8C A;  3IFE A;  2F3J A;  1TKX B;  1AUS L;  1KON A;  5B08 A;  1DTQ B;  2FC8 A;  1IQT A;  3GJQ B;  4JBC A;  4NLX A;  4Q8E A;  1QJH A;  5BXI A;  3I9V 9;  1VIS A;  1XMB A;  3TZY A;  5HMY A;  3OFE A;  1RAD B;  1RK8 A;  1C0U A;  5HVH A;  3CSK A;  4GVB B;  5GMK a;  4P2X A;  3N5F A;  4PXC A;  3ENA A;  1Y5I B;  2I5J A;  3OBI A;  2HGM A;  2C2K B;  3KLI B;  2QA4 G;  1P9Q C;  4ZPB A;  4DR3 J;  2HRY A;  4PG4 A;  4KC5 A;  4NRU A;  2XMT A;  3TUJ C;  2VG5 A;  5M2U A;  4CO3 A;  1RDR A;  4OYB A;  1SL1 A;  1RT7 A;  2GQC A;  5IV3 A;  2RB7 A;  1JLC B;  4C8Y A;  2RDJ A;  2HYI B;  4I56 A;  2C2Z B;  2CQ2 A;  1CC7 A;  4LSL A;  1QLN A;  3ET6 A;  1LW2 A;  2HBZ B;  3MMC B;  4JV5 J;  2UU9 J;  5IQQ A;  2DNM A;  4CZC A;  3HI9 A;  4L76 A;  2L9D A;  3CCZ A;  1NK5 A;  3DHX A;  1YVF A;  1S1T B;  4OFZ A;  1YZ6 A;  5E3C A;  2GVD A;  1F5C A;  1B99 A;  4PQU A;  1WC0 A;  1UA0 A;  3GP9 A;  3UQS A;  1S1U A;  3CPW R;  2Q79 A;  4Q44 A;  3M2U B;  4EFA C;  1WUU A;  4GKJ F;  1M5V C;  1N36 J;  3W2V B;  4H4K A;  3FK4 A;  3VGV A;  2HZV A;  3GYX B;  4NA2 A;  4ED5 A;  4L72 B;  2CYY A;  2KT3 A;  4UQG A;  2M8D B;  3U1L A;  3L9Z A;  2GS8 A;  1HNV A;  1U6Z A;  4PR6 A;  3EPG A;  4P72 A;  3R5C A;  4F3O A;  2EFV A;  2VZ9 A;  2VFV A;  3OXF A;  2W9A A;  1REV A;  2PFF B;  2QL7 B;  1X5O A;  2EG1 A;  2D3U A;  3Q8Q B;  3VQS A;  4ZVS B;  2GQQ A;  3MD1 A;  2XMM A;  3B78 A;  3OVB A;  3AA8 A;  2ABY A;  1FKP A;  3VQT A;  6AT1 B;  1RT4 B;  2B4V A;  4B3T F;  3HSJ A;  3ILJ A;  1SKU B;  4ZHR B;  3TEH B;  1S1W B;  5C42 A;  4QU7 A;  4KAI A;  1HNW J;  2JLE A;  4DV4 F;  3ISN D;  2ZZM A;  4WFN Q;  4BBY A;  5BR8 F;  2BJ1 A;  2WOM A;  4Z37 A;  2V94 A;  1M5P C;  4TVA B;  2A10 A;  3Q86 A;  4EBD A;  1JLG A;  2AWZ A;  2CPI A;  4WXO A;  1JX4 A;  4F0M A;  4NRT A;  1UJ5 A;  1EX8 A;  3HK2 A;  4KY3 A;  4DX7 A;  4V19 J;  3NGS A;  5HBM B;  2NRE A;  2GJI A;  1IM6 A;  1C1C B;  2X51 A;  2E9R X;  3FSI A;  1E6V B;  1BQN A;  2FLP A;  4Q45 A;  4LR9 A;  3ISZ A;  1VQ9 S;  2W2M P;  1T03 A;  1U47 A;  1XEZ A;  4ZA1 A;  3H5X A;  3BGR A;  4KGZ B;  2ZWP A;  3K5N A;  3C16 A;  4I0W A;  4J9L A;  2KRB A;  2XS7 A;  5D0G A;  3KLG B;  2ZKT A;  4TXS A;  2XO7 A;  2G0J A;  4C8K A;  1LWF B;  1RZM A;  4NLT A;  4RZR A;  4ED1 A;  3BDE A;  5HK4 A;  1QAI A;  2F8M A;  3V81 B;  2WZ1 A;  1B3T A;  4TQR A;  4MYT A;  2RRA A;  3DRR B;  4CNZ A;  4FF4 A;  2FJE B;  5T7L B;  4C8Z A;  2UP1 A;  1KNZ A;  4CO4 A;  4DV6 F;  2HZC A;  4YHH F;  4PWD B;  3QID A;  1TKX A;  5KFI A;  1KVJ A;  1DTQ A;  3HF5 A;  4R25 A;  1S7H A;  1URR A;  5F0W A;  1VC6 A;  1KHV A;  1UEU A;  2KL8 A;  2JZ5 A;  2B51 A;  2LEB A;  4KH1 B;  1CJU B;  5SUH A;  1X31 C;  1U1Q A;  4GVB A;  1FJG J;  4OZ2 A;  2XY6 A;  1AXQ A;  3OR1 B;  2KVI A;  4NZ0 A;  3JAM Y;  1HD0 A;  5B0D A;  4B17 A;  1WI8 A;  3POT B;  4DSK A;  2QJ3 A;  1KD1 T;  3KLI A;  3HSZ A;  5EGY A;  1VBZ A;  1H3D A;  3DU5 A;  3MEC B;  4PXB A;  2BV3 A;  3FBE A;  1H7X A;  2C2M B;  3U02 A;  1B0P A;  3JB9 k;  4DR3 F;  3SI8 A;  1LNQ A;  4AND A;  3EXY A;  3K8W A;  3HT0 A;  1VHF A;  3IM9 A;  1JLC A;  2BQU A;  3T5L A;  2DNN A;  4ZJO A;  4ZCK A;  3RYL A;  3HUL A;  2XS5 A;  3MMC A;  3MTK A;  2UV8 G;  1GTH A;  3EGZ A;  1S1T A;  1VGY A;  3DOK A;  5DLF A;  1QD1 A;  1F9H A;  2OPQ A;  4JV5 F;  2UU9 F;  4DWI A;  3OJU A;  2KYZ A;  4DI6 A;  2V9K A;  3M2U A;  3HFK A;  2GIR A;  2W1B A;  1TFW A;  2QX0 A;  2JLF A;  3IO1 A;  4NCA A;  3CD0 A;  2KYX A;  2VFU A;  4KFB B;  5BYS A;  1S12 A;  4FXW A;  4W92 B;  4NCG B;  4XO0 A;  3Q8R B;  2OIH A;  2IA6 A;  4GC7 A;  4F7V A;  1WNE A;  3MOZ A;  1HBN B;  1NHV A;  1N36 F;  4B9L A;  3VAK A;  2MLX A;  4U96 A;  3HVT A;  1NSP A;  3EMT A;  2RS2 A;  1S6U A;  3QQC D;  4LF5 J;  1T3N A;  5KFC A;  1KLN A;  1ZTT A;  1MN7 A;  2OSQ A;  2IRY A;  1N5T A;  2FDN A;  2AEJ A;  2J8S A;  5HMX A;  1R27 B;  4DR7 J;  2H65 B;  2JL9 A;  2XCA A;  4HL9 A;  4GO7 X;  4ZHR A;  1S1W A;  5C25 B;  4HLB A;  1JLE B;  1UEK A;  2FC9 A;  1FJC A;  3PR5 B;  3K5L A;  1S1X B;  1T9W A;  1TUW A;  2DVI A;  4X64 J;  3KNG A;  2ZE2 B;  1R43 A;  4WFZ A;  4RNH A;  3VAF A;  3AOC A;  1TKT A;  2EEY A;  5J2Q B;  4HHH A;  1BC6 A;  3NEK A;  1HNW F;  4ZCI A;  2YWW A;  3M8W A;  2BW7 A;  1GQE A;  5HBM A;  1FTR A;  2VIC A;  2D3O 1;  4RKU C;  5DDO C;  1C1C A;  3E3X A;  1E6V A;  1G6B A;  1FFS B;  4FPI A;  4HKQ A;  1TAU A;  1U09 A;  4K4W A;  3DLE B;  2VBW A;  2W2Q P;  4B3R J;  4NWB A;  2PI4 A;  1Y10 A;  1ARO P;  2OML A;  2VON A;  2VKR A;  1SC3 B;  5E3P A;  2WVC A;  1AYE A;  2D69 A;  3KLG A;  4HYK A;  5JXS A;  5ETO A;  2QG9 B;  1HKA A;  1HMV B;  2MHN A;  2Q3P A;  3S01 A;  4DZ6 A;  1CLF A;  2QTW A;  4I6A A;  3V81 A;  4OJ1 A;  3F56 A;  3MR5 A;  2C28 A;  2LU2 A;  3C6U B;  1N48 A;  5T7L A;  1RWX B;  5C5J A;  4DQR A;  2FZG B;  1CJV B;  1YDL A;  5D0R A;  2QYC A;  3VAL A;  4PWD A;  4Y2I A;  3THV A;  3C3L A;  5KTQ A;  3EZO A;  1GFW B;  1O0P A;  3OVS A;  1CJK B;  5D4O A;  3GII A;  4OZ1 A;  4M1K A;  2MKK A;  1C4A A;  3R2D J;  1CJU A;  3T41 A;  3SYZ A;  4WP9 A;  3VR1 A;  3WX4 A;  1X4H A;  1NPP A;  2W25 A;  4OZ0 A;  3GCW P;  4OI4 A;  4DMZ A;  3D28 A;  1OIA A;  1Q0N A;  5GAD U;  2V8P A;  3OR1 A;  1RT6 B;  3AFG A;  1IWA A;  3DOL B;  2UUW A;  3POT A;  3FCW A;  2BM1 A;  1D9A A;  4HR2 A;  4M5I A;  2HWH A;  1N32 J;  4KHR A;  3MEC A;  1NKB A;  4KT0 C;  1U1L A;  2OTJ S;  1FJG F;  2J5A A;  4PG6 A;  1Y0H A;  4DL3 A;  2RHQ B;  4RW9 B;  3L7U A;  4L3K A;  3RZA A;  3QT8 A;  2ZKU A;  4HTJ A;  2BW2 A;  2XY7 A;  1U8W A;  4KIA A;  3DLK B;  3KHG A;  4ZCM A;  4OX7 A;  2NUH A;  4ZLN A;  1YX2 A;  4UOH A;  1JJC B;  4L3N A;  1R8H A;  4FP9 A;  3UD3 P;  1F5A A;  4B9U A;  4A8X A;  3LQV A;  1FDD A;  3CCR S;  2E5G A;  2IBK A;  3GIM A;  3M1V B;  1M5K C;  2CFX A;  2KFN A;  3DDK A;  2GFF A;  2HVH A;  1LWE B;  1YTY A;  4DCP B;  1LWC A;  3W8G A;  5ITH A;  3KXD A;  1GX6 A;  3MM9 A;  4AL5 A;  2OFG X;  1PIL A;  2IC3 B;  3KG4 A;  1N4L A;  4I68 A;  2OJ3 A;  3IMQ J;  4CT8 A;  2G1H A;  2GML A;  1HQE B;  1XN9 A;  4OYZ A;  4GMK A;  1YHQ S;  1M1K T;  2B6A A;  3PRB A;  2J0W A;  3FJ2 A;  4YR0 A;  2HHQ A;  4NCG A;  2RKI B;  2YNF B;  5K5M A;  1HBN A;  1IQZ A;  2DB1 A;  1P1L A;  4ED3 A;  2CQG A;  2EC0 A;  4Y28 C;  3ISN C;  4CO0 A;  2DIS A;  3IRX B;  5HI7 A;  1IM4 A;  1FRH A;  1Q5V A;  1OPI A;  1F3F A;  4ECU A;  5FD1 A;  2ACY A;  3FEX B;  3VAJ A;  3R7B B;  2Z8Q A;  1HA1 A;  1LK5 A;  4LF5 F;  1DJ0 A;  3JTO A;  5C25 A;  4ELT A;  1X4B A;  1F6T A;  2B3T B;  4DHV A;  2CPZ A;  1KQG B;  4OYM A;  1FE4 A;  1S9G B;  3NOC A;  1S1X A;  3PYD A;  5IT0 A;  4DR7 F;  2ZBP A;  2ZE2 A;  1XNQ J;  3K57 A;  3GFH A;  4PPZ A;  2RIL A;  3BGO P;  2W9C B;  4L6V 3;  4YB1 P;  4C8M A;  2XWY A;  3VAM A;  2VC0 A;  1BLU A;  4OZ5 A;  1WDD A;  1RT5 B;  4X64 F;  1BMQ B;  1WEX A;  4F4A A;  4F3M A;  3QYY A;  3UE2 A;  1X4G A;  2DO4 A;  2MB0 B;  4ZVP B;  3DLE A;  4KSE B;  5HLF B;  4NZ6 A;  3M8P B;  5KT6 A;  2FGC A;  2DNK A;  4WFY A;  4ZIW A;  3CCE S;  2ZJQ Q;  3BPS P;  2PMZ D;  2ZBI A;  3BBF A;  1B7Y B;  5C24 B;  1HR0 J;  4ICL B;  2LDY A;  4TKT A;  4CM2 A;  1HMV A;  5F41 A;  1ZAX A;  4FXD A;  4B3R F;  2D1C A;  2RU9 A;  3QAT A;  5AE3 A;  4EZ6 A;  2FQQ B;  2ZH1 A;  4ED2 A;  1RBO B;  1HD1 A;  3FSX A;  3BYR A;  3MM5 B;  1LXJ A;  2Y0B B;  5E3Q A;  1X0P A;  3C6U A;  2CAD A;  3N01 A;  5L1K A;  4FBU A;  3VAG A;  4A8W A;  1WJ9 A;  5KFR A;  2VU5 A;  1WTF A;  2QLW A;  1CJV A;  4I6W A;  3MOJ B;  2BRL A;  4LIW A;  3RBD A;  3GG1 A;  3PYE A;  3DCA A;  3VF0 B;  1FRX A;  3ULH A;  1CJK A;  2DGX A;  2W9B B;  4YP3 A;  6FDR A;  4CLK A;  3K89 A;  2HHV A;  3AJ2 A;  3PVX A;  4LRB A;  2KU7 A;  4DPW A;  4ZPW R;  1NBE B;  2DPI A;  3MEG B;  1IKV A;  2WAQ D;  1RT6 A;  3W9I A;  3DOL A;  4ALZ A;  3HVW A;  3CC7 S;  5LMU J;  1TMJ A;  3AOD A;  3K2Y A;  5T41 A;  1UVK A;  4RW7 B;  3MEE B;  2VUG A;  5LSR A;  3CJ3 A;  1FKO B;  1WEL A;  1J5E J;  2V2Q A;  1CQN A;  3Q8U A;  2WON B;  3MCO A;  4ED0 A;  4RW9 A;  1HBM B;  3LP2 B;  2HFS A;  2BM0 A;  1N32 F;  3BH6 B;  2HLU A;  5KFT A;  3DLK A;  5IWA J;  1VQM S;  1Q8B A;  3Q8V A;  4CLU A;  5KFH A;  4BWJ A;  1RTI B;  3UNG C;  2A0F B;  3JSY A;  2LLZ A;  3T1H J;  4RWX A;  1AA1 B;  1VR6 A;  3IG1 B;  1GTE A;  3I31 A;  3M1V A;  3FGV A;  1LWE A;  2NXC A;  4LJM A;  4O0I A;  3GIK A;  3RR8 A;  3K0J A;  5HAO A;  1FRL A;  1FCA A;  5AE2 A;  3SV4 A;  3CC4 S;  2GVZ B;  1TL3 A;  2O66 A;  3PRV A;  1HYS B;  4HDH A;  3BO2 A;  2R7O A;  1HQE A;  5KG1 A;  1FFG B;  1L3V A;  5J2M B;  2DBB A;  1VQP S;  4M5D B;  3D3C J;  3L09 A;  2WTF A;  3HMJ G;  3OHA A;  2FHK A;  1UA1 A;  1NCL A;  3NCP A;  2V68 A;  4DS5 A;  2IM2 A;  2RKI A;  1IJE B;  4R0J A;  3CJT A;  2QE5 A;  2JNJ A;  3GWC A;  1RTH B;  2YX7 A;  3CCL S;  3M9M B;  2V8G A;  4W4M A;  1NSQ A;  2LQ9 A;  3T5J A;  3IGN A;  1R6V A;  2NS1 B;  3IRX A;  5L46 A;  5KT3 A;  1F3V A;  4J9R A;  4DLG A;  2BAN B;  2ZBR A;  4H4O A;  4NOH A;  2HFV A;  1FER A;  3T6J A;  1AZS B;  4H4K C;  4XDC A;  1J2V A;  4MKA A;  1FXL A;  3AQP A;  5J2N B;  2BJ7 A;  2BA9 A;  1O6X A;  2XHC A;  2AJQ A;  2RU3 A;  1X60 A;  1XR5 A;  2BX6 A;  3ITH B;  3CDW A;  1S9G A;  1EHW A;  2H48 B;  2DGW A;  4JI0 J;  2I0X A;  4YDD B;  4FXV A;  2PA3 A;  3U1N A;  3M8R A;  3EZU A;  5LXY A;  3QNW B;  1G3O A;  2W9C A;  3PFO A;  1QVF R;  2ZOG A;  2CKW A;  5CD4 A;  4G6V B;  1RT5 A;  3RRH A;  3GV7 B;  3VGT A;  4QYZ J;  2EWH A;  4NA1 A;  1XNQ F;  2DPJ A;  3ICL A;  1ZM4 A;  3ILI A;  4M5K A;  4MH8 A;  5HLF A;  3M8P A;  2E44 A;  2YKN B;  2LFV A;  5C24 A;  3UPF A;  1FFW B;  4ICL A;  2VOD A;  3NY0 A;  4YN3 B;  1IBL J;  5EX3 A;  1Z2Z A;  3KNA A;  1RAO A;  2W7P A;  3CJQ A;  4QWA A;  2I9S A;  4KH0 B;  1HR0 F;  4FS2 A;  1SCJ B;  2PN6 A;  5KFK A;  3HHK A;  2EK6 A;  4JI8 J;  4O3R A;  4MK8 A;  1PGZ A;  4ZN3 A;  2SXL A;  5DZ6 A;  1TAQ A;  4RO0 A;  2W2P P;  5DGB A;  3K5M A;  3PW4 A;  3U7J A;  4ZVH A;  1S0O A;  2YKA A;  3DXS X;  3ZZY A;  3HDS A;  2RRN A;  4EK2 A;  1Q53 A;  2W9B A;  2GA7 A;  1NLK L;  3VGS A;  4UZB A;  4ECY A;  1WAC A;  1EET B;  2VFR A;  3GIR A;  3FQL A;  5H9E J;  3N6L A;  1RT1 B;  3Q8Y A;  1KQF B;  1FXD A;  2XMU A;  6FD1 A;  2Y3Y A;  3MEG A;  3HKZ D;  2HIY A;  3UW1 A;  2W7O A;  3BV8 A;  1NB7 A;  2DY9 A;  3OL7 A;  2IYI A;  1NDK A;  2V2Z A;  4P75 A;  5KT7 A;  1RKI A;  2RF2 B;  4RW7 A;  1U26 A;  5CH7 B;  2XMW A;  1N8R T;  1SIW B;  1UFL A;  3MEE A;  1T0T V;  4EMD A;  1QTN B;  2J7W A;  5D4N A;  3AY0 A;  4DCJ B;  5CYM B;  2EC2 A;  1FKO A;  5L8R C;  2VG6 B;  1NSA A;  5LMU F;  2WON A;  3GG0 A;  1HBM A;  2B9Y A;  3LP2 A;  4JV2 A;  4K2J A;  2MZT A;  5GAG U;  2GNK A;  3DRP B;  3NGR A;  1J27 A;  1W25 A;  4ZN1 A;  4WP3 A;  1I6J A;  4IDK B;  4K50 A;  1J5E F;  4NXN J;  3W64 A;  1RTI A;  2RDI A;  2AGP A;  4E0D A;  1NJI T;  5F8N A;  2W7A A;  1WDT A;  3TZZ A;  3N0V A;  3KLF B;  1TMM A;  3MTJ A;  2BKP A;  2XM3 A;  2DR8 A;  3IG1 A;  5IWA F;  1MW7 A;  1MN9 A;  2DK2 A;  4R5P B;  4LUB A;  2MQ8 A;  4ZLP A;  2YPY A;  4LBH A;  1JXL A;  4U8Y A;  4O4G B;  4LF8 J;  4X66 J;  2BUN A;  3T1H F;  2BZ2 A;  2GO8 A;  4HTI A;  1ZM3 A;  2W01 A;  2K8G A;  2M70 A;  2AJ4 A;  1HYS A;  2CJ9 A;  1YBU A;  4KR0 B;  2KT5 A;  1RAE B;  5J2M A;  2R4F A;  5I4M A;  1ZTW A;  4P71 A;  4M5D A;  5EWF A;  2DEJ A;  2J6U A;  3OUY B;  5KFO A;  4KHM A;  3GR0 A;  3AT1 B;  1UWB B;  2B0G A;  2QMW A;  4A46 A;  1B70 B;  1J5O B;  2FJW A;  2HFN A;  2DHS A;  5A8R B;  5LXR A;  1RTH A;  1TL5 A;  4M5G A;  3W3S A;  3V6K A;  2HHS A;  1PYT A;  1RHJ B;  4DPT A;  1RUS A;  3BO4 A;  4DFK A;  1BE4 A;  2BAN A;  4C6A A;  3AD7 C;  3IR7 B;  4YDX A;  1AZS A;  2F1F A;  1NJX A;  5LJ3 Y;  5CCL A;  5J2N A;  5A0Y B;  1DQ8 A;  2HWI A;  3ZZR A;  2HMI B;  2JEG A;  3PX4 A;  4P52 A;  4K59 A;  1ULR A;  5KFJ A;  3ITH A;  3HFZ B;  1A9N B;  5E3R A;  4FNI A;  2BJ8 A;  2N4D A;  2BAC A;  5DO2 A;  4DPU A;  2XQC A;  2RML A;  1GXT A;  4IFV B;  4RJV A;  4EI2 A;  3F73 A;  1EJ7 L;  4CDI A;  2DHA A;  4P6Q A;  1FO1 A;  3R1H A;  4JI0 F;  2HG4 A;  4IO1 A;  4RUA A;  3PO5 A;  1N5S A;  1UKU A;  4QIF A;  1YZ7 A;  3B4M A;  4RL1 A;  1L3S A;  2BVZ A;  4ED8 A;  4QZV B;  3WQP A;  2PSZ A;  3G71 S;  1U2C A;  4KV8 B;  2YKN A;  2FPH X;  4ZPD A;  2AQ4 A;  4U8V A;  1N0U A;  1BY9 A;  4OI0 A;  5ETT A;  3ELH A;  3LW5 C;  3MFH A;  3TNV A;  1S0V A;  4OQJ A;  1NK7 A;  4LF4 J;  4H4M B;  2BJ9 A;  4K8R A;  3H2U B;  2UXB J;  2L41 A;  2R42 A;  3PTW A;  2DGU A;  1IBL F;  3M7V A;  2ZFH A;  3DI6 B;  3CJ2 A;  2HHT A;  1SXL A;  1YIJ S;  3I32 A;  5IC4 B;  2U1A A;  1N88 A;  5DDP C;  3KUG A;  2V6A A;  1HWU A;  4JI8 F;  2MKJ A;  4F25 A;  2KDO A;  1GX5 A;  4QW8 A;  5CXT A;  1RT1 A;  2BKN A;  2E66 A;  1M5S A;  3M2R B;  1C0T B;  2FVC A;  3SIP B;  4CO2 A;  3CDE A;  1H0H B;  1KKH A;  4GO5 X;  2WSC C;  5D0H A;  1T05 B;  3KHH A;  4ZP6 A;  2RF2 A;  1CJT B;  3THT A;  1NXI A;  1WOO A;  2MST A;  3PW0 A;  4OI3 A;  3I55 S;  2E5L F;  1FEH A;  3DLH A;  1FX4 A;  1WSR A;  5CYM A;  4K7Q A;  1MWY A;  2CQ4 A;  4GKK J;  3LPY A;  4TN2 A;  5D77 A;  2FGO A;  3LP1 B;  2N4C A;  1APS A;  1VI7 A;  1OQ3 A;  3DRP A;  1MMD A;  1QM9 A;  4IDK A;  1UP1 A;  4PUO A;  3UVJ B;  2KM8 B;  2ASY A;  1KFD A;  1X4F A;  1F9E B;  1Y5L B;  4EEY A;  4QPT A;  4W98 A;  3KLF A;  1H2T Z;  3D6H B;  5FDL B;  3EGW B;  2XSF A;  1PJ6 A;  4TQS A;  2IPO B;  5DG7 A;  4X4Q A;  2V63 A;  4R5P A;  4NXN F;  3J7Z T;  2Y1J A;  4O4G A;  4Q2L A;  4NCB A;  1RCX B;  2MZS A;  4N77 A;  4K4U A;  2QMX A;  1PC4 A;  3R7S B;  2Q66 A;  2I38 A;  2CJA A;  4B3O A;  2KG0 A;  4LIR A;  3LAN A;  4FF1 A;  1HW8 A;  2RQ4 A;  2KHC A;  2VL1 A;  3TJ9 A;  2AIR B;  3JYT B;  1UTA A;  4C7Q A;  4LF8 F;  3RB0 A;  4JI3 J;  3OUY A;  1WOS A;  4X66 F;  4U6P A;  2MSS A;  2OPR B;  1UWB A;  2ZNZ A;  1RSC A;  3E8O A;  1J5O A;  4OLP A;  4QWC A;  1SUQ B;  3A3P B;  2DT9 A;  1JWW A;  2RHS B;  4B3M J;  3OTC A;  4ZIT A;  1FES A;  3QWU A;  4J5O A;  1CS4 B;  2RE1 A;  1I51 B;  3EZ5 A;  3DLB A;  1YJW S;  5A0Y A;  4FYX B;  4PWU A;  4AYB D;  5C7P A;  3IP0 A;  2PA8 D;  2XSJ B;  1U6F A;  5DRK A;  4AXJ A;  3UCU P;  1W7W A;  1XTZ A;  2HVD A;  4EBC A;  3P45 B;  3TX0 A;  3I5A A;  3KLH B;  5JVG Q;  5HJY A;  4IFV A;  2ZH5 A;  1P9Y A;  3PFE A;  5D78 A;  2WVF A;  3BQ1 A;  2NSB A;  3MPD A;  4NLY A;  3V4M A;  2GGP B;  3FCH A;  2HGL A;  3TW0 A;  5J1E B;  4CH7 A;  3KK3 B;  1U24 A;  1NDC A;  3SZ2 A;  5HL7 Q;  1RAB B;  2UZA A;  5JJB A;  4KV8 A;  1JQG A;  1PIE A;  2NCK L;  5ETQ A;  3VCD A;  1RAH B;  4K0K J;  5KFA A;  3BSO A;  2YX4 A;  4X84 A;  3H0P A;  5HJX A;  4DR1 J;  5LSO A;  4H4M A;  1Q7Y T;  1WC3 A;  5GAH I;  5F8M A;  1RKJ A;  4F0H A;  3DI6 A;  2HPU A;  3IR5 B;  2CA9 A;  3CDU A;  5KFW A;  2FZK B;  4LF4 F;  3RAX A;  3KDN A;  2BEF A;  2ZBQ A;  3Q22 A;  2UXB F;  4BS2 A;  3MPV A;  3PX6 A;  2C2E A;  4KJI A;  3I56 S;  2XYP B;  3MR3 A;  1Q78 A;  3CW2 C;  2FUG 9;  4KHP J;  3Q8P B;  2H54 B;  4MKY A;  3M2R A;  1C0T A;  2YWF A;  2PE8 A;  4CLZ A;  3OR2 B;  1T05 A;  2XS2 A;  3H2V E;  2RAQ A;  1IR0 A;  4NLP A;  1CJT A;  2CUY A;  3HM9 A;  3MUV P;  4LBI A;  2XNR A;  3KTQ A;  2PMH A;  2NZC A;  5B0A A;  1P6T A;  2M4M A;  2IVF B;  1WG1 A;  5HRO B;  3FZB A;  1FT8 A;  3I0S B;  3KHL A;  3PY8 A;  3C6T B;  1RWN B;  5DG8 A;  3HD2 A;  2KG1 A;  2MQQ A;  4F02 A;  1LK7 A;  2CPD A;  3HZE A;  3BO3 A;  1IBC B;  1K9M T;  3UVJ A;  3SCI E;  4GKK F;  4C97 A;  2DRB A;  4J90 A;  3BM7 A;  2MKS A;  3JTP A;  2UUA J;  4Y3C A;  1NB2 A;  3QFH A;  3PW7 A;  3M6X A;  3PV8 A;  3L7O A;  5EHH A;  2WB1 D;  2KB2 A;  3R5A A;  1D9F A;  5FDL A;  1QAJ A;  4WF9 Q;  1Y9O A;  2V5H G;  3I6P A;  4PG7 A;  2V4R A;  3PJX A;  1VBK A;  2AEF A;  5K9F A;  3HKW A;  3QJP A;  1V3R A;  3NMR A;  4EBE A;  4ZJL A;  2DEI A;  3MMB B;  4DV2 J;  2MKY A;  2DH8 A;  2OAU A;  5F3T A;  1S1V B;  3BBC A;  3N79 A;  2N3O A;  3M6V A;  3PW5 A;  4YOE A;  3TR5 A;  3DGV A;  1KC8 T;  1JMT A;  1RWV B;  1FVQ A;  2JRS A;  4NMX A;  1NHU A;  4IRD A;  1YSJ A;  4DL5 A;  3ENW A;  3JYT A;  2MY8 A;  4KPY A;  1XIQ A;  5K8P A;  1ZM2 A;  4W90 B;  2YKQ A;  4OHY A;  2OPR A;  4ZDN A;  2CQI A;  1SUQ A;  1FX2 A;  5AXM A;  2X3G A;  2CNK B;  3M8S A;  4JI3 F;  2F4V J;  1ZS6 A;  3THP A;  4X65 J;  2R7V A;  4ECV A;  1CS4 A;  3AB4 B;  4AT1 B;  2VBZ A;  5KG2 A;  2FHO B;  5B0C A;  5LMN J;  1SQG A;  4NYP A;  1RTD B;  2QA1 A;  4HT7 A;  1ZPV A;  2C3P A;  4YR3 A;  3MM6 B;  2XSJ A;  1T9T A;  4B3M F;  1NRK A;  1MML A;  2NLW A;  3ZO7 A;  4WK1 A;  2BQR A;  1Q8L A;  1IJF B;  4OYW A;  2OEJ A;  3KLH A;  1TUV A;  3WHI A;  2KXN B;  2OSR A;  2ZNY A;  3J81 U;  3GSI A;  2R2S A;  3UCG A;  1O5J A;  2GGP A;  4A47 A;  2XLJ A;  1JLF B;  5J1E A;  4QJV A;  3KK3 A;  1C2P A;  2C2R A;  2D74 B;  4OI2 A;  2HNZ A;  4X4U A;  3OSN A;  1UMJ A;  5DM6 Q;  1TZ0 A;  1NPK A;  4IOC Q;  4FDF A;  2R7T A;  3BGL A;  4URG A;  2ASD A;  2Y0S D;  4KE5 A;  2HQG A;  1N54 B;  3SCK E;  2FVP A;  4C0B A;  2AX1 A;  2C2D A;  4K0K F;  5HAT A;  5M2P A;  1U02 A;  2B8Q A;  1UVI A;  3TVZ A;  1SJF A;  1UFW A;  4DR1 F;  2DGO A;  4I7F B;  3GR1 A;  1F9F A;  4O3P A;  3MCM A;  4RNN A;  4TU7 A;  4FYV B;  1H73 A;  1U1P A;  2ZZN A;  3P8B B;  4MIW A;  4Y2A A;  4ERD A;  1WF2 A;  1DHM A;  4IH6 A;  2MZJ A;  4GC6 A;  4XPE A;  4TU8 A;  2IYG A;  3KG1 A;  3MPW A;  1OYE A;  5KFG A;  1RTJ B;  1XR7 A;  3HZG A;  2YQ3 A;  3OR2 A;  4RPF A;  5H1S V;  3J81 j;  2BOP A;  1W2I A;  4RBT A;  4KHP F;  4C3L A;  2MY7 A;  3FRY A;  4QYZ K;  1DFD A;  2XEX A;  3EGV A;  4J9K A;  3BH7 B;  5CQG A;  1S10 A;  1RYR A;  4CO5 A;  2KXH A;  3VWS A;  2Z2M A;  2UXC J;  4HAC B;  5HRO A;  1KLM B;  3I0S A;  1OY6 A;  5RUB A;  1T9X A;  1LV5 A;  3C6T A;  3ZXW A;  3W60 A;  2VA2 A;  5KT5 A;  1C1B B;  5A76 A;  2DD8 S;  2HSE B;  1NHK L;  1SQF A;  4IOB A;  3QPI A;  1RAA B;  2B4P A;  2X1B A;  2ZH9 A;  2ADB A;  1H2U X;  3BF4 A;  4DUT A;  2EW9 A;  2HBY B;  1I5O B;  2K3I A;  2YWG A;  4GRS A;  4NI2 B;  4UOG A;  2B56 A;  3LP0 B;  5AXK A;  1H74 A;  1VIX A;  2VOO A;  3GFX A;  5KFQ A;  4J9V A;  2DXE A;  7AT1 B;  3RRG A;  3CCW A;  4X4R A;  4N76 A;  3LOU A;  4DQS A;  4FYY B;  2N82 B;  2UUA F;  4N8O A;  4MKB A;  5ETL A;  3VVT A;  2VKZ G;  1ELO A;  4OJG A;  5GVQ A;  3MMB A;  4G1Q B;  1FDA A;  4LFC F;  3I4P A;  2BMB A;  1S1V A;  4OZL A;  1VQL S;  5H9E K;  1Q86 T;  1TP7 A;  1Q5Y A;  1XER A;  2J9E A;  2PT0 A;  4IH5 A;  1VQY A;  2B8P A;  3D0H E;  4A8K A;  2CQ3 A;  2RQC A;  3AJ1 A;  4DV2 F;  5CZV A;  1RCO B;  1U25 A;  3S8S A;  3O3L A;  2OD4 A;  2MLZ A;  1PAE X;  1KS2 A;  1Y00 A;  3SEO A;  2F63 A;  5GAE I;  1VS3 A;  2ACM A;  2OKQ A;  3NS5 A;  3I4H X;  1RTD A;  2HGN A;  4NLQ A;  3MM6 A;  4Y0F A;  2F4V F;  2EK1 A;  3J81 Y;  5AE1 A;  4USK A;  4FYD A;  3R27 A;  4ED7 A;  4ZVQ B;  1T02 A;  3I9Z A;  4Z7C A;  1PG5 B;  3S7R A;  2L9W A;  5LMN F;  4PAA A;  1PYO B;  1PYS B;  2HHW A;  4Y2M A;  3VAI A;  4U7U D;  1U1M A;  2CZ4 A;  3ZTP A;  3RU0 A;  2AJ2 A;  1UJ4 A;  4OYI A;  2D41 A;  2VJU A;  1JLF A;  2CJB A;  4XIU A;  3BN4 A;  1NZ8 A;  4RR5 A;  1MMN A;  4UY8 T;  1BHN A;  3QGH A;  1FKP B;  1KVK A;  2EFN A;  5HO4 A;  2KVQ E;  3AOA A;  1V9O A;  4XTT A;  3CCQ S;  7FDR A;  4DQP A;  4M5J A;  5E5N A;  3N6M A;  4M94 A;  1S7I A;  3C2P A;  5E41 A;  1DAR A;  3DRS B;  4BHQ A;  3MZI A;  1YRU A;  2XLK A;  1XBW A;  1RQ0 A;  3RB4 A;  1WC1 A;  2NUU G;  3BZQ A;  2H5I B;  2E9T A;  1V5V A;  5F3Z A;  2J76 E;  2J9D E;  3CXC R;  1WF0 A;  4KO0 B;  2XHW A;  4I7F A;  4HVZ A;  2VFS A;  3FSY A;  2K3K A;  1EP4 A;  2CAJ A;  1K73 T;  3DM2 B;  2ZUG A;  4UW2 A;  1OSC A;  3OTD A;  4DQQ A;  1WF1 A;  3LAK A;  1RTZ A;  1Q81 T;  3HCX A;  3IS9 B;  5D8H B;  3H40 A;  4DUY J;  4F0K A;  2RJZ A;  1RTJ A;  3M8Y A;  2VPZ B;  2IFX A;  1D0E A;  1NND A;  3ETO A;  2OP5 A;  2RS8 A;  3W7B A;  3UDC A;  4I1T A;  1LFW A;  4KGX B;  3GFZ A;  4F4X A;  2GQ2 A;  3W63 A;  5KFU A;  2UVR A;  1NK6 A;  5KFF A;  1HNX J;  2D3O R;  2UUC J;  4OX9 F;  2UVU A;  4M95 A;  1G2E A;  3NBP A;  1BWE A;  4HAC A;  2DCU B;  1KLM A;  1YBT A;  4ZPA A;  3CD6 S;  2DNQ A;  2HS3 A;  3C15 B;  3HXM A;  1C1B A;  1HNZ J;  2XMA A;  3RBZ A;  3UI3 A;  1OPZ A;  2LP4 A;  4C8L A;  2E1C A;  3HVA A;  1HBU B;  2R8G A;  3TAR A;  1FE0 A;  1RYS A;  4NL5 A;  2C3M A;  4NI2 A;  3LP0 A;  3A1Y G;  4F4W A;  4HEA 9;  4ZVT B;  4F4K A;  2FJD B;  4O3N A;  3D1H A;  2WHO A;  2YH0 A;  2WW4 A;  1QE1 B;  4KYZ A;  3GIL A;  4RX6 A;  8AT1 B;  4UUW A;  3JAM U;  5THW A;  4G1Q A;  4K4V A;  2K7J A;  5FII A;  1S48 A;  1KOO A;  4DF8 A;  1S79 A;  4RUB A;  3WC2 A;  2AP6 A;  1UL3 A;  5KFD A;  3QMQ A;  4MAK A;  2APO A;  2XNQ A;  2YKM A;  4ECW A;  1MNE A;  4FF3 A;  2VQE J;  3ZNJ 1;  5CYJ A;  1AB8 A;  2CJK A;  4M5N A;  4OHZ A;  3KMS A;  4HDG A;  3DOK B;  3RTV A;  3SFG A;  1HWL A;  2OPQ B;  3P6Y C;  5L9X A;  3J7A N;  3SSQ A;  4USV A;  2HVZ A;  4QIE A;  1WEY A;  1RBL A;  3J7Y I;  1XWL A;  2FIU A;  4DV7 J;  2E1P A;  1TK5 A;  4IR1 A;  1M5H A;  3SDE B;  4QCL A;  2OEL A;  4NLD A;  2HRU A;  1RB0 A;  4DN9 A;  1HBO B;  2G9O A;  4WWS A;  1ZA2 B;  4USW A;  2YKO A;  2XBP A;  1YGY A;  2C3O A;  2VA3 A;  3NCQ A;  3EX7 B;  1FK9 B;  3HVT B;  3MFI A;  3VVU A;  3QSI A;  1SQE A;  5A8K B;  2AMC B;  1N5Y B;  4CI0 B;  1RIS A;  4ETZ A;  2EBG A;  1S97 A;  1RP5 A;  4IUF A;  2CXE A;  2MQN A;  1HQU B;  2DIU A;  4I69 A;  4JI2 J;  4JB8 B;  3W5X A;  3DRS A;  4J9O A;  1U2R A;  4ED6 A;  1IUJ A;  2E5J A;  2C2O B;  1ICE B;  1GMV A;  2HW3 A;  2POK A;  2ZOF A;  3R5D A;  4I67 A;  2HBR B;  3QRR A;  1SI9 A;  4OLO A;  1TKT B;  3BDP A;  3IXQ A;  2W8L A;  2JC1 A;  4HI2 A;  2CG8 A;  1EAY C;  4KO0 A;  4CQ1 A;  1AW0 A;  3FZ2 A;  1FWK A;  3GSD A;  4LQ9 A;  3CB4 A;  3D6M B;  1ZET A;  3ZZU A;  3KUE A;  2CRL A;  4U95 A;  3C46 A;  3DM2 A;  2VPW B;  2YQ1 A;  2RD5 C;  2HWT A;  2KRR A;  4AFF A;  2XGQ A;  4RU2 A;  2WRM A;  2FYX A;  3EE3 A;  4UT4 A;  3IS9 A;  1H72 C;  4YB6 A;  1YKW A;  2OTL S;  1VQO S;  1JJ2 R;  2MZ1 A;  2ZC3 A;  3V6J A;  2K2P A;  4RW8 B;  2EKN A;  1KDN A;  2A6M A;  4LRF A;  2J7U A;  4FZV A;  4DUY F;  5FJ4 A;  3MAQ A;  3CO9 A;  5KOX A;  3A4T A;  2QV6 A;  2R7W A;  1X0F A;  2AW0 A;  3HFV A;  3Q83 A;  1SJQ A;  4P2F A;  3OXG A;  1ZA1 B;  3C15 A;  3PYG A;  1B7F A;  1HNX F;  1FEE A;  3GTY X;  4OZN A;  2UUC F;  3CWJ A;  1HBU A;  3KJV B;  1GXL A;  3V6H A;  4Q0B B;  1KP6 A;  3PEH A;  1N0V C;  3CC2 S;  3A8I A;  1UWA A;  2OEK A;  1KOH A;  1FNO A;  4LVO P;  1HNZ F;  4JI1 J;  1UPM B;  2JX2 A;  3EVO A;  3TJ8 A;  3NL0 A;  2CQB A;  2RRB A;  2JOQ A;  1ZAV A;  1M0S A;  1UEV A;  2AX0 A;  3NGT A;  1CBK A;  2ZH4 A;  2HLT A;  1NK0 A;  4YR2 A;  2V4J B;  2DCL A;  1QE1 A;  5F8I A;  2GCF A;  1RT3 B;  3GV5 B;  2IY5 B;  4OHV A;  2KM8 C;  5CYQ B;  4YQW A;  3F0N A;  3BN7 A;  3O44 A;  1G7C B;  1BGX T;  5SZT A;  2UUT A;  3OLA A;  1HI1 A;  2IJN A;  4J9U E;  2V8D A;  1F2G A;  2ZVS A;  5D15 A;  2GMJ A;  4ZPC A;  1GNK A;  2DIT A;  2AZ3 A;  1SIZ A;  2AJ1 A;  1UVJ A;  2PI5 A;  5F0U A;  1ROF A;  3OVA A;  1TTH B;  3BYP A;  1SH0 A;  2YBV A;  2QLJ B;  2J9C A;  4NYZ A;  1JNZ B;  4IYQ A;  1LWC B;  1UVN A;  2VQE F;  2NSC A;  3MM9 B;  2FHJ A;  4QPX A;  2V2V A;  3CIM A;  1WI6 A;  2UUB J;  1KN6 A;  3D2W A;  4YEA A;  2I6W A;  3KHR A;  3GU0 A;  3SDE A;  3QBC A;  4DSF A;  2AEM A;  2ILY A;  1FD8 A;  3AOB A;  2B6A B;  4C0O C;  3GIJ A;  2F65 A;  1N33 J;  2IVY A;  1HBO A;  3IA0 A;  1NK9 A;  3LAM A;  4CCH A;  4DV7 F;  5U47 A;  3Q2T C;  3R5J B;  3CCM S;  3BBB A;  3ILL A;  3RJM B;  1FK9 A;  2WK4 A;  3W8P A;  4NML A;  4DR4 J;  4DU8 A;  5A8K A;  1AFI A;  2QLF B;  4YB5 A;  1N5Y A;  3DN9 A;  2F4F A;  4G65 A;  3PCO B;  1T9Y A;  2NYH A;  3H4B A;  5HMZ A;  4WU2 A;  4BCA A;  4C3K A;  4OI1 A;  3U1M A;  1SC1 B;  1HQU A;  3R3T A;  2MPU A;  1VFJ A;  1Y11 A;  1QY7 A;  3B6B A;  2Q6B A;  3BRE A;  2HHU A;  1PC5 A;  4DBQ A;  1TUG B;  4NEZ A;  4OI6 A;  4F8R A;  2DGQ A;  4TLR A;  1TFY A;  2H51 B;  1D09 B;  2RDD A;  3X3U A;  3FMB A;  2VHG A;  4JI2 F;  1ZBT A;  5HQL A;  4J9N A;  3ONQ A;  3D0G E;  4WTY A;  5B09 A;  2F7V A;  2RNE A;  5DLG A;  3A8J A;  1JNR B;  1Z4U A;  4BLG A;  1N34 J;  3O1L A;  5IC6 B;  3HSD A;  3HHL B;  4MJK A;  1NU4 A;  3TVY A;  4O44 B;  1FRJ A;  4PZV A;  3TA0 A;  1Y3J A;  2XCP A;  3BGU A;  2Q43 A;  3EDR B;  3GE9 A;  3LWM A;  2GIQ A;  3H4D A;  1R31 A;  4K5S A;  3CUN A;  4CLL A;  2YXL A;  4DL6 A;  4UST A;  3WIV A;  3CMQ A;  3P49 B;  3TI0 A;  3PG9 A;  3CD5 A;  2CNO B;  4RW8 A;  4DV0 J;  2O67 A;  4ZLL A;  3V6D B;  1FJE B;  3DDI A;  4P9S A;  4LRE A;  5DQG A;  2VC1 A;  5L1L A;  2OGU A;  2BYC A;  4B9S A;  2M5Y A;  4EZ9 A;  2C3Y A;  2MXY A;  1X9M A;  4PXE A;  2PII A;  1L5U A;  2NXN A;  3KJV A;  1HWJ A;  4Q0B A;  4FVM A;  1MU2 B;  1NDL A;  3FFI B;  1DBD A;  2NXJ A;  4DPO A;  4AL7 A;  3V4I B;  1IKV B;  2V4Q A;  1Z1Z A;  2IMW P;  2B7B B;  2M0G B;  4C3M A;  4ZLJ A;  4IQX A;  4QYR A;  1G4C A;  4FBT A;  1TVR B;  5KG4 A;  3TP2 A;  3Q24 A;  5ETM A;  3T1A A;  2V4J A;  2RUS A;  3UDL A;  4JI1 F;  3BB5 A;  1ZZN A;  1RT3 A;  2CNL B;  4NAS A;  1EZZ B;  3JSB A;  3HSG A;  5CYQ A;  1X5T A;  3R1L A;  3Q23 A;  1K1Q A;  1U1K A;  2HHH J;  1JLA B;  2QN6 B;  3P3D A;  3WBZ A;  3T9N A;  1UPP A;  1PKU A;  1Q8I A;  2V2K A;  4LRD A;  5KG3 A;  1DQ9 A;  1TK0 A;  4ES2 A;  3CUL A;  4LMZ A;  4B3S J;  5KG6 A;  4F50 A;  1F1B B;  1QVG R;  3E51 A;  2LA4 A;  2CVE A;  2J0S D;  3TWZ A;  3C8Y A;  3N28 A;  4B08 A;  2DHG A;  5C2C A;  5KOW A;  4A8Y A;  1X4C A;  1TL3 B;  2LEC A;  4RLE A;  2F5G A;  2DO0 A;  3NWG A;  2MKC A;  3AA9 A;  4A8M P;  3PDN A;  3IBW A;  3MR6 A;  1ITP A;  4NLV A;  3H25 A;  2UUB F;  4E2F B;  3PIO Q;  3AAW B;  2GJ2 A;  5IXU A;  3CJ0 A;  1ZOT A;  2ZH3 A;  1B0T A;  2F40 A;  3DRX A;  2FLL A;  5L9N A;  3PKM A;  5KT2 A;  1TEL A;  4CP5 A;  3FVY A;  2V34 A;  1N33 F;  1CUL A;  4ER8 A;  4H4O B;  3QSY B;  3M8Q A;  3CJ4 A;  4KGM A;  4F2R A;  4OYP A;  1FKA F;  4KGV B;  4ZIV A;  4DR4 F;  4S0M A;  1HFE L;  1TKZ B;  2OH2 A;  2CQ1 A;  1VQN S;  5LSL A;  3GZ7 A;  2FHJ D;  4YS2 A;  3A8E A;  2MZR A;  5DDQ C;  3EVW A;  1IKY B;  2PFD A;  3GFY A;  4DLE A;  4NLR A;  3CJ8 A;  3NGK A;  8RUC A;  2P9G A;  4Y00 A;  3K7R A;  4WFX A;  3HHL A;  2KHD A;  2FVQ A;  1VLO A;  2DNO A;  4O44 A;  3LO3 A;  2QEX S;  2QA2 A;  2QT7 A;  3BKU A;  2HQC A;  2DR5 A;  2H5E A;  1N34 F;  5F9L A;  4QWD A;  3AJD A;  4TY9 A;  3EGN A;  3QGP A;  3SXL A;  3D9B A;  4MFB A;  4DV5 J;  5B0E A;  4WTO B;  3PRD A;  3R6G B;  2Z2L A;  3UR0 A;  1SKW A;  3TO8 A;  1YQH A;  2Z4P A;  2FLO A;  3MPY A;  4EWT A;  4EYI B;  3EM1 A;  3D3B J;  4ILL A;  1X8D A;  3M32 B;  3DHW C;  5L38 A;  3W9J A;  3V6D A;  1K0T A;  3MCS A;  1SBR A;  2MQP A;  2HK2 A;  4TLQ A;  2L3M A;  2XYH B;  4C8O A;  4OIX A;  2QA4 S;  4ES3 A;  2HFZ A;  2AKW B;  2JC0 A;  4B9N A;  4AL6 A;  2X1G A;  4DV0 F;  1LQ9 A;  1RLC L;  3BSA A;  2CJY B;  4TU9 A;  4RNF A;  4MK7 A;  4NLU A;  1GT8 A;  2E9Z A;  3OL6 A;  4X4T A;  1FHT A;  3PJW A;  3G2X A;  2OEM A;  1E6Y B;  3ZZZ A;  2CPJ A;  3RW7 A;  1WOR A;  1MU2 A;  3B8H A;  3FFI A;  1IR2 A;  2AHO B;  4J7C A;  3V4I A;  1DRZ A;  3IM8 A;  3L3C A;  1QSS A;  3R2C J;  1M1G A;  3ZTR A;  2NQP A;  1VYA A;  2IHR 1;  1X4D A;  4V19 X;  3O6Q A;  4TY8 B;  5G0R B;  1NME B;  2VIH A;  3CD7 A;  5EX0 A;  1TVR A;  1OYD A;  3UCZ P;  4WII A;  3GPA A;  2ERR A;  3LH2 S;  3OXL A;  4V1A k;  3G8Q A;  4PEO A;  4IH7 A;  3CCU S;  3W2W B;  4ZCL A;  4UZC A;  3GCX P;  1JLA A;  5BYR A;  1JIH A;  1P8G A;  2R2T A;  4K4Z A;  1HI0 P;  1S99 A;  5KFL A;  4RNM A;  1XMQ J;  2DGV A;  3KK2 B;  4Q5V A;  3OTB A;  2HHH F;  1S5Z A;  2I8E A;  1AFJ A;  2GC8 A;  2KO1 A;  3S6E A;  4QWE A;  4ZPT R;  3AQO A;  1BD6 A;  4O3Q A;  3TZX A;  1IN0 A;  2YX1 A;  4ZP8 A;  2W4D A;  3HD1 A;  3DLJ A;  2M9K A;  2AV5 A;  3FCV A;  1MRO B;  3OTO J;  1WTB A;  1XR6 A;  1VQ5 S;  1EAR A;  4P2S A;  3RBX A;  4B3S F;  2J8A A;  3G86 A;  3NP5 A;  2DH7 A;  4OX8 A;  3TAP A;  5L1J A;  2D7S A;  3UWT A;  3OW2 R;  1PCA A;  2LKZ A;  2OMO A;  5CAA A;  3AD9 C;  1GEH A;  1FD2 A;  4WZM A;  3DMJ B;  3GLJ A;  1NSK L;  1PJ5 A;  1VQ7 S;  4LFA J;  4P7T A;  4UOF A;  3WX8 A;  2X3D A;  1Q1K A;  4USI A;  2IDL A;  4NXM J;  4OJH A;  3G82 A;  1HNI B;  4IFY A;  4WK3 A;  2PDA A;  2ROG A;  3PJ9 A;  2BOA A;  4WPA A;  1WHY A;  2B4U A;  3QFW A;  4ECS A;  3KK1 A;  2IBO A;  2FJX A;  1TKZ A;  4CT9 A;  4CLP A;  3LGH A;  1VOM A;  2QSW A;  1KFS A;  4B9M A;  1WSV A;  3CJK B;  1WC4 A;  3TEG A;  4DSE A;  1VC0 A;  9RUB A;  2JEI A;  4O23 A;  2LDI A;  4PKD B;  1IKY A;  5LL6 d;  3T6B A;  4YB7 A;  4ECR A;  2E1R A;  4E98 A;  2L9N A;  3AXM A;  3HX9 A;  3NAI A;  2DNY A;  2FY8 A;  2R8H A;  2GZO A;  1D3W A;  3BEG B;  2ROP A;  3H5S A;  5K8N A;  1NAQ A;  3R8Y A;  2EXU A;  3NOG A;  1A6L A;  4ENO A;  1WKK A;  4QW9 A;  1LXN A;  1V3S A;  2IVM A;  5ETS A;  4RUH A;  4LBP A;  3L4B C;  3R6L B;  1GXU A;  3H5Y A;  1WOP A;  2KJV A;  1C4C A;  2Z0G A;  2LXU A;  4BWM A;  2HFO A;  3RW6 A;  2KH9 A;  2BE9 B;  2P2C B;  3MUR P;  1PO6 A;  3A12 A;  4J9P A;  2J7K A;  4ATN A;  2XI3 A;  2J6T A;  2MQM A;  3M32 A;  3DLG B;  5ETN A;  2HFU A;  3NNH A;  4I2P B;  4ZVU B;  2RQK A;  4DV5 F;  4Z7Y A;  2KTQ A;  1TQL A;  2R7U A;  4RW6 B;  3SV3 A;  3I5B A;  3R9L A;  2CWK A;  2G0C A;  3DDN A;  4OJ3 A;  2IJR A;  4DCO B;  1VDH A;  3PAC A;  3QLH B;  3OSP A;  3CGI A;  3M6U A;  4CH1 A;  1OO0 B;  4DZD A;  3VV2 B;  1JLQ B;  3FRZ A;  1GH8 A;  3D68 A;  3CCS S;  1HAR A;  2BJD A;  1L3K A;  2GW8 A;  3E2E A;  4A8S A;  4K5R A;  4DOZ A;  3HHL D;  5EN1 A;  4CLT A;  1E6Y A;  3OJS A;  1FNM A;  5I3P A;  1HHT P;  4F67 A;  2CZV C;  3ENV A;  2AU0 A;  3QIP B;  5BJR A;  1PAU B;  3MAA A;  2X1F A;  2GAH C;  3OV7 A;  1NO8 A;  5CA5 A;  4TY8 A;  5G0R A;  2VBX A;  1IVZ A;  2P6S A;  3NWR A;  3MWB A;  2LMI A;  3D54 A;  4R8U B;  4ZKA A;  1HPZ B;  4LF9 J;  4HH0 A;  4NPO A;  1WC5 A;  2EKY A;  1R3N A;  2BR0 A;  1KR4 A;  1K1S A;  2WVD A;  3CED A;  3W2W A;  2I1R A;  3A3N B;  4Y2K A;  3P5T L;  5AXN A;  4NLG A;  1EQ0 A;  3G6E S;  2O01 C;  3UNY A;  4DU7 A;  1VBY A;  2I2Y A;  4PUO B;  1KTV A;  2M88 A;  4UOC A;  2E7V A;  1JK9 B;  3KK2 A;  1U0S A;  1AT1 B;  3W5Z A;  1DLO B;  1QAX A;  4WCE Q;  3F44 A;  2QIF A;  3V2U C;  1N6Q B;  1S6O A;  2E5I A;  3UFC X;  3W61 A;  1IWG A;  3UDE A;  4LF2 A;  1XMQ F;  3I96 A;  4ZOS A;  2DNH A;  2DNL A;  4G1P A;  1MRO A;  4NA3 A;  1FVS A;  5LOQ A;  3MR2 A;  5EDW A;  4IG0 B;  4ZP7 A;  1XNR J;  4B3O B;  2QLB B;  1YJN S;  3O5T B;  5HQ8 A;  3FBB A;  1R89 A;  5F8J A;  1U7L A;  1VLY A;  1QUP A;  1OY9 A;  2XUL A;  4KBI A;  4ANE A;  4NYO A;  1TL7 B;  1FXR A;  1LW0 B;  3W62 A;  1Q8K A;  3K5O A;  3RBE A;  3LF0 A;  2OPS B;  3OTO F;  2Y1L B;  3N5B A;  4ZVR B;  3CME S;  1XK8 A;  2HQD A;  3DMJ A;  1QUV A;  4CNY A;  2PGC A;  1RXO B;  3D67 A;  1R0C B;  2HVE A;  3M05 A;  2G1D A;  3WZ0 A;  3SQO P;  3EIC A;  5J2P B;  3KJQ B;  3G96 A;  1HNI A;  4NEY A;  2LQ8 A;  1FA0 A;  4LFA F;  1NKE A;  2KI2 A;  2MYF A;  5L1I A;  3UN5 A;  1D8Z A;  1W2B R;  4NXM F;  2HEK A;  3AB2 B;  3BR8 A;  3W2V A;  2ASJ A;  3CJK A;  1WHX A;  3TOQ A;  2RVJ A;  3TAN A;  2HS4 A;  3TA2 A;  4M5H A;  5B0G A;  1UW4 A;  4AD6 A;  4QU6 A;  3S1T A;  2ZVI A;  2Y8Y A;  2EPI A;  1I3O B;  2GHW A;  3AXK A;  3CCJ S;  5MAO A;  1WHV A;  3ENQ A;  2K7K A;  2XO6 A;  1RT4 A;  2IDE A;  3TAQ A;  4DSL A;  5AJ3 J;  2ZIT A;  2XG8 A;  3BKT A;  4OYO A;  2JHE A;  2N7Y A;  2B4O A;  3SQG B;  4OMF G;  4OV6 A;  2LYV A;  1FTC A;  3TVK A;  3DLG A;  4I2P A;  1SB6 A;  3PR4 A;  2CQ0 A;  2V69 A;  4RUC A;  3FBF A;  4RW6 A;  4NLS A;  2H3E B;  1RAF B;  4NX9 A;  1WKJ A;  1RWU A;  2ILZ A;  1VIO A;  2JJ4 D;  3QLH A;  4FYW B;  3TQE A;  2YWH A;  1RWW B;  2ZM6 J;  1JLQ A;  3CDB A;  5GAD I;  5HN0 A;  3RB3 A;  3EWG A;  1S4E A;  1DTT B;  4XDD A;  1VK8 A;  2M52 A;  4FF2 A;  3FC9 A;  4QR2 A;  3D4J A;  1NUE A;  5CD4 H;  4DV3 J;  4N8N A;  1Q16 B;  3DGP B;  1M5O C;  3CCT A;  4AUK A;  4MKV A;  4F26 A;  1SL0 A;  3QIP A;  4WIQ A;  5L39 A;  3CCV S;  1X9S A;  3K8V A;  1LWF A;  5LM7 E;  4F4Y A;  4OHW A;  3M2V B;  4USJ C;  3KLV A;  3K17 A;  1HI8 A;  3DRR A;  4R8U A;  4DL7 A;  4HH1 A;  1HPZ A;  3BPD A;  1OJ4 A;  1IKX B;  3PHE A;  2FJV A;  3L95 X;  1WWH A;  2HUR A;  5A6W A;  1AUD A;  4NLW A;  3RG6 A;  3IC1 A;  1ZM9 A;  3TA1 A;  4LF9 F;  2FLN A;  3D0I E;  1PBA A;  1UFK A;  4AXI A;  2V9W A;  4N56 A;  4XAK A;  1DLO A;  4WJB A;  2HAI A;  2H9Z A;  3IWL A;  1RAC B;  3RR7 A;  1N6Q A;  3FEZ A;  2B9W A;  3KDO A;  3OL9 A;  2X7I A;  1T94 A;  4JI7 J;  3I87 A;  3D1O A;  4C4W A;  3MM7 B;  2IM3 A;  4IG0 A;  5DG9 A;  4I2Q B;  1RI7 A;  4PG8 A;  4DX5 A;  2C2N A;  2EFO A;  4USM A;  3QGI A;  4L75 A;  2IMO A;  5E0O A;  2NYI A;  2OO4 A;  1YJR A;  4GVL A;  2RT3 A;  1JXV A;  1DZ5 A;  1TL7 A;  2G2O A;  4M5L A;  1XQI A;  4C0H A;  3ZZO A;  1LW0 A;  1TR0 A;  2WW8 A;  1SC6 A;  1RHQ B;  2OPS A;  1U0H B;  4X62 J;  4IO9 Q;  4PYA A;  1XNR F;  2FJA B;  4ECZ A;  3H90 A;  2G13 A;  2YNH B;  1YRT A;  1TK8 A;  4MT1 A;  5E3A A;  1UVL A;  5EUH A;  4Y34 A;  3PX0 A;  2LEA A;  1U6B A;  2CZ9 A;  2KFY A;  5J2P A;  4CIO A;  2MQO A;  1X5P A;  5GME A;  3W9H A;  1MWZ A;  2ATL A;  1UAW A;  2FB0 A;  3OLB A;  1WC6 A;  3M4X A;  2OI2 A;  4NZ7 A;  3CIZ A;  3Q8S B;  2NPF A;  3T3F A;  4ZMM A;  3T19 A;  2V67 A;  1S59 A;  2YTC A;  2BRK A;  2OFH X;  2V8H A;  4KFB A;  1S9F A;  1SC4 B;  1YJ9 S;  4I4B A;  2OD6 A;  4DJB A;  1D1U A;  3QZ7 A;  2W4P A;  4A4J A;  4ILM A;  4Y2C A;  3MF5 A;  3EVM A;  3KWM A;  5KFB A;  1IBM J;  3D1Q A;  4LQ3 A;  5ETV A;  2HNZ B;  4WKY A;  3QO9 B;  4LR7 A;  1KQK A;  4WXW A;  3D7S B;  2FZC B;  4ED4 A;  3SMZ A;  5KFY A;  2GAG C;  2VQF J;  1S49 A;  2Y1I A;  2C42 A;  2VDH A;  4WE1 B;  1JLE A;  4XK8 C;  2MZQ A;  4WFA Q;  4U7C A;  3SQG A;  1N52 B;  3M9N B;  1VK3 A;  1N5V A;  4H54 A;  2H1Y A;  1NJW A;  3LGM A;  3HHL C;  4G3I A;  1R0B G;  2LQB A;  2A2C A;  2XTJ P;  1TL1 B;  3IWN C;  5AJ3 F;  5J2Q A;  4DL0 C;  3DOM B;  5JUM A;  4LF1 A;  1YRX A;  4CTA B;  4X4O A;  4F36 A;  1V6H A;  1S4F A;  2C3U A;  3ADA C;  3IBF B;  2J9D A;  1FRM A;  2HS0 A;  3T9Z A;  4ID8 A;  2NPI A;  2GHP A;  2EG2 A;  1DTT A;  4JV1 A;  1K0V A;  4PXD A;  2RUG A;  5CAB A;  1FDB A;  1BQX A;  1U4B A;  1R0A B;  3HHE A;  2XZD B;  2G0I A;  2J6S A;  3DGP A;  3DRY A;  3HJF A;  2ZM6 F;  4DR2 J;  2PMW A;  3KJN B;  4NE9 C;  3TUP A;  4FPR A;  3VHQ A;  5KFE A;  3QAE A;  3M2V A;  2ADC A;  1LFP A;  3CNQ P;  2DRD A;  1RHM B;  2H5J B;  4YFU A;  2J0X A;  4RBU A;  4CWB A;  4DR5 J;  4DV3 F;  4ANC A;  1PSD A;  4J9Q A;  1IKX A;  1U1R A;  4N7T A;  1T8E A;  4XPC A;  2EVZ A;  1QTM A;  1KBR A;  2DXF A;  5GAH U;  2GMH A;  4CRJ A;  1H6K X;  1JB0 C;  1MLA A;  1RAJ A;  2AT1 B;  3RGI A;  4URS A;  2R3V A;  4LT6 A;  3OQ2 A;  1DQA A;  2O3D A;  5KFN A;  3DU6 A;  2E29 A;  3H20 A;  1KWM A;  3NGU A;  3HO1 A;  2JVO A;  5D6G A;  3US5 A;  3G4S S;  2IIH A;  3DNC A;  3CJS A;  1WD6 A;  1VQK S;  4Y6I A;  2DKO B;  4I64 A;  3H7H B;  3UO0 A;  2R9L A;  3MGJ A;  2BJE A;  2RSQ A;  5CCM A;  3MM7 A;  1HW9 A;  4I2Q A;  2GHV C; 
#chains in the Genus database with same CATH homology
 1UTA A;  1X60 A;  2LFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...