2LFVA

Solution structure of the spor domain from e. coli damx
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQVQADLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Protein damX
publication title Nuclear Magnetic Resonance Solution Structure of the Peptidoglycan-Binding SPOR Domain from Escherichia coli DamX: Insights into Septal Localization.
pubmed doi rcsb
source organism Escherichia coli
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05036 SPOR Sporulation related domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sporulation related repeat 2lfvA00
2LFVA 1X60A 1UTAA
chains in the Genus database with same CATH superfamily
3U02A 5D15A 2LQ9A 3OR2A 3G8TA 2XGQA 2IC3A 2MQPA 3MHYA 1D3WA 3MCNA 1C4AA 3DU5A 1PAUB 4ZVRB 4B3TF 3Q8YA 3AOBA 3QGIA 4D3HA 4NXMF 3OTBA 2HGLA 4LF5J 1FDBA 1YBUA 1EKSA 5EDWA 2M9KA 2MZTA 2R8GA 1Q7LB 4AXIA 1FWLA 1S1UB 2AQ4A 2W7PA 2XCPA 2VG5B 4HH0A 2HLUA 1WF0A 5J1EB 1WI6A 1CJTA 5LMNJ 5K9FA 5HVGA 1SJFA 3EZUA 2F8MA 4P7TA 2JSXA 3BYRA 1Y7PA 1CC8A 4ED6A 4WK1A 3R3TA 4MKBA 2H48B 2LLZA 3CCZA 4USKA 3AA9A 5G0RB 1QSLA 1SXLA 4NXNJ 2AYEA 3TZXA 1RTJB 1WWHA 1H7XA 2AYBA 4FYYB 2DXEA 3NL0A 5L8RC 3CJ3A 1U8WA 1TL3B 4Y28C 3MCOA 4ZVOB 5KFEA 3EYZA 4USJC 4QIFA 4B9LA 1XR5A 1IM6A 2KT2A 2XSFA 2JEFA 3KLGA 2IM0A 1S0MA 5FIIA 4USWA 3N28A 3W2WA 2FC8A 4DSIA 4LSLB 2CNLB 4FS2A 4RL1A 4G65A 4DMZA 4H4OB 3IA0A 4KFBA 1JNRB 2YQ0A 1NRKA 2X7IA 1RT3B 2XMWA 1UPMB 3DOLA 2B3TB 4JI3J 3QFHA 4ZCKA 4JI6F 2LXIA 3UNYA 1RZMA 1XMBA 5F8LA 2OMLA 4BC9A 2I0XA 4A46A 3SSSA 1VQKS 2X51A 2VQEJ 5L1KA 1ZOTA 3RR8A 4XK8C 4MK7A 1REGX 2EPIA 2FJDB 4OZ0A 4N41A 2VKRA 2ZKTA 2BANA 3TAQA 3KLVA 3EE3A 1ZA1B 4OYWA 1RAHB 4YB5A 2CA9A 4UUXA 3QRPA 1HNVB 2E7XA 3J7Z5 1LV5A 4WP3A 4DV6J 3AQPA 3O44A 3TI0A 5ETRA 3LWLA 2VPZB 1HWLA 3U27A 4M8LA 2MZQA 4IFVB 3BKFA 4Y3CA 3KOAA 3OUYB 1W25A 4U67Q 3TQEA 2CRLA 1RKIA 3ZZUA 2OPSA 4UOHA 4X64J 3TVYA 3JAMU 4G1PA 1BY9A 5D0EA 2F4VF 1NHVA 4O23A 1D8ZA 1OIAA 2NLWA 1MMDA 1UWBB 2RIJA 4QBUA 1KNZA 4FYDA 1PSDA 3MMAA 5H9EK 2CZVC 1U2FA 2YKOA 3I0SA 3H8YA 2CAJA 3UD4P 3I56S 3LTOA 4DPUA 2KFYA 1SL2A 2KJVA 2K7JA 3VAMA 4NRTA 4L76A 3PZPA 3EPIA 3UDEA 4KO0B 2KRBA 1GMWA 3EDRB 3NCQA 4MFBB 2IAJA 2YWKA 4A47A 2OPPA 3DLGB 1VHFA 1S9EB 4HT7A 4XDDA 2M88A 3DLKA 2ZH3A 3BR8A 1SV5B 2H5IB 2YNHA 2GFFA 5CYQB 1JLAB 1LW2A 1EP4A 1HLWA 4DQIA 2OD6A 5D0GA 1T9VA 1OSDA 2RU9A 1HNZJ 5HBMB 1UZDA 2HQFA 1KTQA 2QMUB 1WC4A 3RUBL 1N33F 1HNIB 3DRXA 4TY8A 2A10A 3BSAA 1URNA 2MPUA 4A8YA 4JI8F 4K0KJ 3VWSA 1Q81T 1OQ3A 5J2PA 1NMEB 4ZCIA 4F0HA 2NR0A 1MWQA 2ZBQA 3C6TB 1IR0A 1TKTA 4ZLJA 2DIUA 2FGCA 4GRSA 1X4DA 2MDAA 1HW9A 3IC1A 1OMSA 1N5YA 2DD8S 3KUHA 3RB6A 1FXRA 2B7CB 1LW0A 4ECSA 5KT3A 2B9XA 1N5VA 3CB4A 1S5ZA 3CEDA 4JOUA 1S1VB 3I32A 2JDJA 3PW2A 2IPOB 4ANEA 1W2BR 2QG9B 4PXEA 2BE7D 1B99A 3NCRA 2GW8A 4DLEA 4YDXA 3R1LA 1ZTTA 2W24A 4C8LA 3AHPA 4M5HA 4C6AA 5L9NA 1U6ZA 1VQ6S 1SC1B 1FWPA 2KI2A 2YX7A 2G2YA 2YKMA 1X4EA 1XTZA 2ASYA 5D77A 1RBLA 3LP0B 5KFXA 1NNDA 2UUCJ 4CP5A 4M5GA 3F41A 2EVZA 2MKKA 4CLKA 1XMQJ 3PDNA 3ZZYA 1REVA 2CYYA 4ED8A 1NB2A 1SUQB 2LQBA 4DWIA 3ENVA 4DV2F 3DOKB 5EGYA 4JI1J 3FCVA 2LQ8A 8RUCA 2E5JA 1FE0A 4H4KA 3RBZA 3BZQA 2DNGA 4EFAC 4HLBA 3BDPA 1KVKA 2HIQA 1RBAA 3NXZA 2OPQB 3D6FB 1JJ4A 3BBCA 4O0IA 1GXTA 1SQFA 2FD2A 2MZJA 2K1RA 1S4EA 3LOUA 2O3DA 1JLBB 2R2SA 5HL7Q 1N0VC 1UW9A 1SCJB 1OQ6A 1L3SA 4YB1P 2PIIA 5BYSA 1UVIA 3N9UC 4AT1B 2NXJA 1PO6A 4PQUB 4F50A 5KFGA 3C8YA 4Q2MA 2AJ4A 1RWNB 1K47A 4QZVB 4RPFA 1OJ4A 4F4AA 1N8RT 3R6LB 4MKVA 3VALA 5IOLA 2B9YA 3MI7X 1NSAA 1R8AA 2E5LF 3FGVA 2DGTA 2BE2A 3D9BA 1KHVA 4ED2A 1JQGA 2DNQA 4RUAA 2W4CA 1U45A 2HNYB 4NA3A 3SV3A 3KLFA 1HQEB 1SVDA 5HLFA 4C3MA 1VQ7S 2R7RA 4ZOSA 2PA3A 3D3BJ 2HFSA 2IVFB 3O5TB 3QJPA 2Z2LA 4XPEA 2Y1JA 3KHRA 1S9GA 3QGHA 3FUYA 2LQJA 3UI3A 2DNLA 1FRMA 3VAIA 3CJ8A 2E9ZA 1CJKA 3DGPA 2VA2A 3BQ2A 3KUEA 4DX7A 5L39A 3AAWB 4PXDA 1GXLA 4Y2CA 5ETSA 3PHTA 1E6VB 3EMTA 4ED5A 3SDEA 5A8KB 4HKQA 2A6OA 3L4BC 1FRIA 1RA6A 1QUPA 2VG6A 4IYQA 3KK3B 2XNQA 2VC1A 3OW2R 3R7BB 2V6AA 1WOPA 2M2BA 3G8SA 1TFYA 4NLPA 1T94A 2OJ3A 1Y5IB 2WVCA 4ID5A 1R8CA 1X4GA 5HSPA 3FRYA 4K4TA 3OXGA 2FZCB 2VDIA 1YHQS 1ZM9A 4X4QA 4DQSA 2CQIA 4A48A 4HT5A 2MJUA 3IBCB 1WC5A 3HVWA 2KYZA 3D6TB 2Q43A 3R2DJ 3NNAA 4K50A 2DXDA 1LWEA 1RT7A 1RDRA 3MMJA 2WW4A 2KXFA 2BMBA 1Q5YA 2NSCA 4LBPA 4XIUA 2D3OR 1AA1B 3SMZA 1UEVA 3HFKA 4ZP8A 2DR7A 3U1NA 4WE1B 5T41A 1Y9OA 1NKEA 1N6QA 2EC0A 1ZZFA 1JLCA 2DY1A 3DYAB 3A12A 4WYWA 3DDKA 4N8NA 4ENOA 4QYZJ 1URRA 3VVTA 4O4GA 3R5CA 2QLXA 2C2KB 1U1LA 1KFDA 4C0OC 2POKA 1UFWA 3DI6A 3VGUA 4UQGA 1CVJA 2C42A 2EEYA 2F65A 1TAQA 1KVIA 1FX4A 3ICLA 4JI7J 3FFIA 4F3QA 1RGVA 3QRQA 1FNXH 5EX3A 2IY5B 2NPIA 3OTOF 2C1EB 4RW9A 2XGPA 3VGSA 3NBPB 1IKVA 3C46A 3TJ9A 5IT9Y 2CZ9A 2W2QP 2YNIB 1TUVA 4B02A 4NI2B 4DSEA 2QMWA 4EO8A 3A8KA 1DBDA 3US5A 3Q24A 2AEMA 2YH1A 2MZSA 3BN7A 1I94F 4W4MA 2BJ9A 1S72S 2B43A 3IBWA 1S10A 1FKAF 1NH7A 2AJ0A 2XSJA 1AT1B 1MMLA 5BJRA 5IM0B 1RAOA 4URSA 2GA7A 3OLAA 2V8HA 1I1GA 4M5DB 3ZTRA 2IMWP 3X1LB 3D1QA 4YS2A 5DG9A 2RB7A 2AP6A 3CDEA 2VICA 2V50A 2RE1A 2LEBA 1R89A 3RW6A 2ALZA 2CZ4A 5CCLA 1VFJA 4IFYA 4QR0A 3E2EA 3DU6A 3T3FA 1UPPA 2D74B 4WJBA 3PEJA 2ATCB 3U7JA 2HS0A 4DS5A 1F9HA 4ZP7A 4OX9J 1IKXB 4Q8FA 2VG7A 1V5IB 2QIFA 4XAKA 1GTHA 4ZVSB 4BS2A 3KTQA 2M70A 4J9NA 3Q8PB 2ZBCA 1AYEA 3W2VA 4C8ZA 2HGMA 2X1FA 1YRTA 2J7WA 4G1QB 2DGXA 2HFZA 5DG7A 4RWXA 4OZ5A 2ZH6A 4ES1A 5DDOC 3C15B 4P2FA 5CYMB 3E01B 3UCGA 1PYSB 4X4SA 2RQ4A 4LFCF 3RBDA 1NSKL 1T3OA 2Z56B 2G1HA 1M90T 4DUYF 3RB0A 4QWBA 5JVHQ 4DV7J 3R97A 2GVZA 1FRXA 3GONA 3N6NA 3KK1B 5JUMA 3J81j 1ZAXA 3LANA 1NDPA 5DLGA 4V19J 2DY9A 4RW8B 2UUBF 2WW8A 1M5HA 4HL9A 2ZNYA 1D8YA 1VCTA 1U25A 4N8OA 3OFEA 2MGZA 3PYEA 4DR2J 2GMJA 3PRVA 2RHSB 4GKKJ 4IH7A 5LM7E 5F8MA 3PYFA 2P9CA 2DBBA 4ZN1A 3D5MA 3V5RA 3M9OB 4DV4F 3THTA 3PFOA 4FP9A 1V3SA 1P6TA 5ETPA 1UFKA 2ZUAA 3GV7B 4PKDB 2I5JA 4G1IA 4IKAA 5IWAJ 3K7RA 2WONA 4ZVPB 4I1TA 1FRLA 1HQUA 3HHLA 3G82B 2QA2A 2DEJA 2ZE2B 5J1PA 5FJ4A 3ILJA 4IDKA 3TR5A 1RT4B 3GPAA 4RBVA 2QA1A 2BV3A 4DQRA 4F4KA 3QPIA 5AE3A 5I42B 2PI5A 3Q2TC 5EX0A 4E8UA 3BH6B 3OSPA 1YWXA 5A0YA 4OX7A 1VYAA 2XZDB 1QE1B 3ET6B 5AJ3F 2AX1A 3GYNA 1TL1A 3C66A 3T5LA 1NK6A 2HK2A 5C24B 4NCGB 1RT2A 4OYBA 1UA1A 3OFFA 2JVOA 1VIOA 4QU7A 4K59A 2JX2A 3HK2A 5BYQA 4OYIA 4IQMA 4PG5A 2RH3A 3DLHA 2UVVA 4ZITA 2DRDA 3QFWA 2CJQA 4GO5X 4FBUA 4NX9A 1S59A 2MTLA 3F0NA 4OI4A 2YBVA 5KG2A 5DQHA 4ELUA 4Y2MA 3FC9A 4CH1A 3DRSA 2HFUA 3CCQS 3UR0A 2F1FA 4KBIA 3D1HA 4A8WA 2DH9A 1FESA 1TKZA 4X66J 1ZS6A 3NOGA 1IVZA 4MIAA 4LF8J 2UXCF 3TUPA 3BDEA 4ZCLA 3C2PA 3RW7A 2HMIB 1RTIA 1GAOA 2YWEA 2A2DA 2VFRA 2XHCA 2RQMA 4J9QA 3VAGA 4GVBA 5H9EJ 3CDAA 1D9FA 1ZBTA 2HS3A 5KFPA 4DSKA 2DPJA 1RWUA 1CJUB 2MKHA 5GADU 3GMGA 3V4IB 4OYPA 5B0BA 1NSQA 1ZH5A 1IR1A 2UXDJ 3WX8A 1NDCA 1RTHB 2X1GA 5F41A 4I56A 3PW5A 1R6VA 3OXFA 4Z2XA 3NNHA 1WF2A 3MPDA 2B4OA 1AZSA 2BEFA 1J5EF 1MU2A 3AODA 3ZFVA 4DPWA 1X9SA 4DFMA 1RHRB 3GV5B 3BEGB 3GIIA 1FK9B 4CYUA 4M94A 4DN9A 4I0WA 4ZPTR 3V4MA 1HWIA 2OPRA 4X4TA 2HRTA 1NPRA 3D66A 5KFIA 9ATCB 2VPWB 3IS9B 2FQQB 4GO7X 4Y2KA 4DSFA 2R9LA 1NJWA 4DQPA 4OHZA 3OHBA 4LRFA 5IT9U 2B4UA 4JV5J 1VQOS 3T5KA 2DCUB 4LBIA 4U8VA 2V94A 2J7UA 1VRUB 3CCSS 3UCZP 1FRJA 3KLIA 3V81B 2W9BB 1QD1A 1TKXB 3IRXA 2JFDA 3L7PA 1R8PA 2VDHA 2KL8A 4PG7A 5KFSA 3THVA 4KGXB 1XR7A 4RNHA 2XBPA 1VHIA 3KLHA 1RCXB 3G9CA 4ECXA 1IBKJ 3CIZA 3OJSA 3NRBA 3DGVA 3PW0A 4NLVA 5C42A 2HK3A 3W1YC 4QJVA 3TA1A 2UP1A 2V63A 1PIEA 4DL0C 2MLZA 3K2YA 5KFQA 2VFVA 5HQMA 4B9NA 3SIPB 1LWCA 2HLTA 1K9MT 3GE9A 2ZOGA 5KG0A 3FQLA 4CRJA 3QGGA 5KT5A 4CIOA 2GVDB 5KFAA 1WTBA 5IC6B 3A3NB 2JZ5A 4OI1A 3HHKA 1ZAVA 1IKWB 2GHPA 3VTIA 2VQEF 2AV5A 1O6XA 4WFNQ 3JSMB 2IDLA 1RUSA 2MSSA 3KWMA 4ETZA 1E6YA 3W65A 2OEJA 5DG8A 2AYMA 2J8AA 1XIQA 4IH6A 3I5AA 2GJIA 2QLBB 4R8UA 3Q23A 1S6PA 3D3CJ 2L9NA 4HI1A 5HK4A 1Z2ZA 3CJRA 1GTEA 3DRPA 3I0RA 3RRKA 3QSIA 1DTTB 2OKQA 1FT8A 3M8PB 4I7FB 1SBRA 4X64F 4ERDA 3SQOP 2DNPA 1BQNB 1MG7A 4U96A 2VB6A 5T14A 2GHWA 1FKPA 4PPDA 1FKOB 4B3TJ 2AZ1A 5IC4B 1FDDA 3W5YA 1NM2A 3IR5B 5AT1B 4NXMJ 2J9DE 2ZBRA 3OTCA 3R6GB 3HKZD 1YRXA 1CBKA 5CZXA 1NSPA 4JI0F 1S0VA 4LRBA 4ED7A 2JVRA 3PYDA 2AT1B 5DJBA 1Y00A 4FDFA 2XMKA 4NYOA 1U48A 1QAYA 1LEOA 2CNOB 4UTGA 3R5GA 3T19A 2VODA 4CDIA 2CADA 3DLEB 2QA4G 5A8WB 3HHDA 1S1UA 4YP3A 2DGVA 3TX0A 1H2TZ 5J1EA 1Q8KA 1HNZF 3CJKB 1VOMA 3R1HA 1F9EB 2KM8C 3BSNA 4IOAQ 3GJQB 2CPFA 1CEZA 1FRKA 1U1MA 4RWWA 4ZVHA 3OFGA 3EXCX 1PCAA 4J9SA 3HO1A 3BGOP 1RAAB 4K0KF 2RNEA 2Y0BB 3R8YA 4FYWB 4A8OA 5G0RA 4OZ2A 2XS5A 4QR2A 2EC2A 2NUUG 1X9MA 1IJEB 3VCDA 3DM2A 4ZHRA 4LR9A 5BXIA 3WIVA 1IBCB 3GJTB 1TL3A 2HZVA 2JLFA 4K2XA 3GSDA 1NEEA 2BOAA 5FLXU 4I2QA 1BD6A 1B0VA 3WC0A 5F8IA 3SZ2A 3PEHA 4JI6J 1FX2A 3NMAA 4X62J 2MY7A 4NASA 1X4HA 5K20B 4NZ6A 4H4OA 3UD3P 3MEDB 4C97A 3NGSA 3W8GA 2J9DA 5FDLB 2G0CA 4KH0B 1JLGB 4KV8B 1S1WB 3R5JB 1RLCL 4J9LA 4DV1F 5D78A 1CPZA 5IXUA 4MIBA 2FJAB 3VVUA 1UVMA 2R7QA 2LA4A 1XMQF 1YJWS 4F3OA 2YQ3A 3GIJA 2XHWA 3ZZPA 3MAAA 3BH7B 4CH0S 3GFXA 2Z30B 1Q95G 4EU0A 5F0WA 3QIDA 5H9FJ 2GIQA 4FXWA 3BO4A 3BR9A 1HNVA 3UD5A 4DCOB 5GMEA 5MLCV 1B0TA 4KY3A 2AKWB 2F4VJ 4FXVA 1HBNB 3W9IA 2XI3A 3HF5A 2E44A 1Q86T 1HR0F 1YSJA 2DRAA 5GVQA 4YB7A 1UKUA 1Z2LA 3SFGA 2J0WA 3THPA 3QIPA 1UCNA 1KOOA 5KFLA 2B7BB 5LXRA 1HA1A 2HQ3A 2QSFA 2HURA 1PC5A 5F0UA 2UV8G 3ETOA 2OMOA 2COLA 2OSRA 4OYMA 3OL6A 1T9UA 3LP2B 4YEAA 1UWBA 1WI8A 4M5JA 3K58A 1KSPA 3CULA 2E29A 1K44A 1M5PC 1TUGB 4FNHA 4PWDB 2RF2A 4C3KA 3Q0AA 4X65J 3P45B 3OHAA 3PHEA 3ZZRA 1OY9A 2D9OA 1QY7A 1DJ0A 2VHGA 4KO0A 4K4WA 3MEEA 5KFFA 2RMLA 3V6HA 4C3LA 4MFBA 2WSCC 3OFHA 1X60A 4X4VA 3GG0A 3NGUA 4K8RA 2JC0A 1QDUB 1SC4B 5C2CA 1H98A 4Y34A 1RP5A 3DLLQ 4ZP6A 5B0EA 4DF8A 2Y3YA 4JI8J 1CULA 4IO1A 1YDLA 1APSA 3I55S 2QSWA 2DGOA 3VR1A 3TVZA 2NQPA 3RRGA 2CJYB 3T9NA 1HBMA 2PC6A 3HVTA 2C2EA 1HNIA 4CH7A 2XEXA 2AZ3A 3BB5A 3C6UB 4ZCMA 1ZPVA 2ZD1A 4RNMA 1ZTWA 1YI2S 3PJWA 2VONA 2HFVA 1DAXA 2CJAA 1A7GE 4NYZA 1RJJA 4PAAA 2OFHX 4QWAA 2E1MC 3SCJE 2V4RA 1U0HB 3OTDA 2ZHAA 3ENWA 3G6ES 2KJWA 2KYXA 3NS5A 1RU2A 3K89A 2VASA 1T05B 5DGAA 2FYXA 2Y0SD 2OP5A 2B56A 1K8AT 3UPFA 2HBRB 2PMZD 4KKOB 2M8DB 4KRWA 3GP9A 3H4BA 1QM9A 4Y00A 1TP7A 4F4ZA 2G4BA 1MW7A 4UQTA 4YUDA 2EFPA 3FEYB 3U1LA 4CO4A 4MKYA 4ZPAA 4FKYA 2IYIA 1W26A 4X4NA 5IQ6A 2R7VA 4RW4B 2V34A 3FRZA 4DV2J 5U47A 3UVJB 2UUTA 3R27A 2CQGA 2WCXA 1K1QA 4KIAA 2MZRA 2IBKA 3OD2A 3CD5A 2N7CA 1VI7A 2R3VA 1H3DA 1QUVA 4LF7J 3KUGA 2MSTA 3K59A 2GJ2A 4GC6A 2XY5A 2YNGB 2HS4A 3BGRB 3TQ1A 3MURP 4NA2A 2DNYA 1NK9A 1T9XA 1R3NA 3CF5Q 3T1HF 1TR0A 3HZEA 3T41A 3QWUA 4K4UA 2LDIA 5DM7Q 3GFYA 1T9YA 1RT1B 2NYIA 4JI7F 4X4PA 3KDNA 4NZ7A 2RUSA 4MIWA 2OPQA 1VBZA 3W63A 5LXYA 1KQFB 2KG1A 4AYBD 1RISA 1KQKA 4OFZA 1O51A 5K8MA 3JS9A 5EWEA 2JL9A 4AE5A 1JLBA 1S1TB 1TMMA 4P72A 1IUJA 3J81Y 4RU2A 1FEHA 1FJCA 2DHAA 2E5LJ 3L3CA 1WDTA 4C8KA 1CJVB 1OPZA 4LR8A 4NLYA 5CHCB 2OD4A 1WKKA 2GIRA 3DRRB 2F4FA 4OV6A 1X5TA 1VRTB 3M8QB 4RW6A 2RILA 1M5SA 1WELA 4J5OA 1SC3B 3I4PA 2HZAA 5FD1A 3BGUA 4ELTA 1HWJA 2HHQA 3CCJS 2RRBA 1D1UA 3ZTSA 4KAIA 3CDBA 4FNIA 2XYHB 3HT3A 3RG6A 4ED4A 2MKJA 1JLFB 2PFDA 2KKHA 1JLQB 4ZLNA 3LQVA 4CLPA 2DCLA 5DQIA 2FIUA 3OVSA 1UEUA 3GFHA 1HQEA 3CCMS 2FHKA 3D0GE 4RUHA 2MHEA 1RHMB 1H38A 2WSEC 1MN7A 4RW7A 3UNGC 4KGKA 3JB9k 1LWFB 1FXLA 1AROP 2V8PA 3RAXA 3BGLA 2RVJA 3N6LA 2A18A 4J37A 1T9TA 3E3XA 2X3GA 2ASDA 5E41A 4LF2A 3TW0A 2RS2A 4KE5A 1U4BA 3GR0A 3M2RB 1M5KC 1F1BB 4IG3A 4P2MA 2QN6B 2WBMA 4NOHA 5KG5A 4OQJA 3FMBA 1JJCB 1DQ8A 2NPFA 4O3NA 4ECTA 5CD4A 3TZZA 2R7XA 2HVEA 4O44A 4FN5A 2Y1RI 4O0NA 2FHJD 2FVQA 1U1PA 5HAOA 5J2NA 1YJ9S 2K06A 3KK3A 4RR5A 3EZ5A 1YZ6A 4LFAJ 3DFEA 2KT5A 4OZNA 2VKZG 1RHUB 2U1AA 3MUMP 3JSYA 1SL0A 1NKBA 4K7QA 4CT9A 3AD7C 2OHDA 3B82A 1ULRA 3ONQA 1QAXA 1S7IA 3M9MB 2R7WA 3ISNC 2EKNA 2QC3A 4WWSA 3DRYA 3H5YA 3QAUA 2PN6A 4YDDB 3Q89A 2HHTA 3RAMA 2VOPA 3IR6B 2BVZA 4YQWA 2IC3B 4A8MP 3I31A 1OY6A 2R7SA 3ZZOA 3NS7B 1OPIA 3SBMA 5CD4H 2HVHA 3QGPA 1U8SA 1LWXA 4B3RJ 2RHQB 4DS4A 5L46A 3EJMA 1UL3A 4WE1A 1ROFA 5J2QA 1L3VA 3K5PA 4NWBA 1UVJA 1F5BA 1M0SA 1I5OB 2K8GA 4M5KA 1CJTB 3QBCA 1T0TV 4LF9F 4ZJOA 2QV6A 5CABA 1IQTA 1N34J 4USVA 2Z58B 2ATLA 1HBUB 4LIRA 1TL7B 1WOOA 1YKWA 3IWNC 2RQKA 4JV1A 1SJ3P 1RWVB 4NRUA 1I94J 3MECB 1VR6A 2OFGX 1XMOF 1U02A 2QYGA 4USTA 3TEHB 3JTNA 2E7VA 3NBPA 3N0VA 4N47A 1FE4A 2JH3A 1YBTA 4M95A 2I8EA 3IRWP 2L41A 3GILA 2YNIA 1HWUA 1FTRA 2VBYA 4NI2A 4MYTA 1NJYA 4FF4A 4PG6A 3HM9A 1RSCA 5HJXA 2CPZA 3MEGA 1KP6A 1R31A 1RWPB 1IN0A 4DPYA 4ES3A 3TUJC 2HRUA 4NMXA 4ANDA 4WTYA 3GIMA 2OSQA 2Z0GA 3ETMA 2V68A 1HBOA 2BZ2A 1S97A 3LPEA 5C5JA 1QTMA 3G2XA 5IM0A 2MY8A 2UU9F 2PDAA 2F9JA 1KHWA 2J9EA 3CNQP 1NJXA 3B78A 1NKCA 4FVMA 1Y5LB 4KFBB 1F2GA 1TK0A 3HSZA 4CTAB 2R8IA 4M1KA 5JJBA 2CPEA 3LH2S 3MAQA 2DGQA 3HX9A 3CC2S 4H54A 3DOLB 4HHUA 5HVHA 2HNDB 5KG6A 4OYZA 2RDJA 5MAOA 4IRCA 3SEOA 2MKYA 2ZZNA 1NK8A 2UVUA 3G6YA 4OL8A 1PJ5A 3IN5A 4ETXA 2QT7A 4ECQA 5F3ZA 1NO8A 2VUGA 4QWCA 4IOBA 3KMQA 2GGPB 4CLLA 4RO0A 2R4FA 3OPKA 1K0VA 4OMFG 1Q53A 2CJXB 2OO4A 2BX6A 2DHGA 4LFCJ 2UXDF 4I2PB 4X84A 1RTDB 3MPVA 2CPYA 3DCAA 8ATCB 2C2ZB 1RAFB 1IBMF 3N5FA 4MK9A 4DUYJ 5F9NA 2AF6A 4DPTA 2UUAF 4NLQA 4QWEA 5I3UA 2LYVA 1I3OB 1S6OA 1GMUA 3C15A 2IFXA 3UDVA 3E01A 2FLNA 2B9WA 1NAQA 1IBLF 2BRLA 2KHCA 2OPSB 2F8HA 2VQFF 2B5JB 2UUBJ 3C14A 2VJUA 4C8NA 3Q86A 2RDDA 4DJBA 2AGQA 3BSCA 1NK4A 2HHPA 2X1BA 3HFVA 3I0SB 1U1NA 5B08A 1Q7YT 5IZHA 2CVEA 4P71A 3JTOA 2B9EA 3CDWA 1PYTA 4RW8A 4E2FB 3L09A 2KU7A 4I6YA 2IAJB 2DVIA 3BJYA 2KO1A 4TLRA 2C28A 1S1XA 1WSVA 1RBOB 1VLYA 3BQ0A 2MXYA 1VK8A 5ITHA 5K8OA 3DLKB 3TYTA 2MKIA 1EZZB 2YNHB 4CZCA 4NYPA 7FDRA 2KB2A 3DHWC 2QL9B 1QAIA 5SUHA 1XN9A 2LP4A 4UY85 1WG4A 5GADI 4YR3A 3GQCA 3WQPA 4ZK7M 3HKWA 4I67A 2CVIA 3I82A 5JXSA 1UEKA 3EGNA 1UETA 2IVMA 4LF6F 2FVPA 3ULHA 1VMBA 3HPOA 3G82A 3PY8A 1KKHA 2PO4A 2ZH9A 2IM2A 4EYHB 3SQGB 3OR1B 1TTHB 1RT4A 1NK5A 1AW0A 4TU7A 3TEGA 4F0KA 2EG1A 4ITSA 4NLTA 4EEYA 4DR7J 5I42A 3AB4B 3MD3A 4XDCA 3JTPA 5AXMA 1NPKA 1TKTB 2WK4A 2ZITA 3QNWB 1NH8A 2W2OP 4DV0F 1QE1A 4OJ1A 3QJLA 1N5YB 1HPZA 1R0CB 2IYGA 2XZTB 1RYRA 2J0SD 3TNVA 3ZC4A 3M2VB 2ZWPA 2AEFA 1UJ4A 2AGPA 1DTQA 3H7HB 1C1CB 2UXCJ 3CCTA 4M5IA 3BV8A 2AWZA 2FY8A 2HBZB 2UVRA 3ILLA 1FDNA 2V2KA 4OYOA 3MM9A 5C25B 1VQPS 4L75A 2DRBA 4EGLA 4EK2A 2FHMA 4U8YA 2JNJA 2AIRB 3BKUA 3EUNA 2DGWA 3TZYA 3CMQA 2GO8A 3D0IE 2BR0A 1RWXB 4KPCA 2DHHA 1HD1A 2HMIA 2HQGA 1NHKL 4DR6J 3BREA 2PA8D 4CO2A 3TANA 1WEZA 3M7VA 3PIPQ 2ZJPQ 1J5EJ 1T9WA 1S48A 4Z37A 2KVIA 1JKHB 2DNOA 3V4IA 2XCAA 5L1LA 3IAM9 2VIHA 4QIVA 4WPAA 4WFAQ 2ILZA 2M8HA 2MJNA 1U6FA 4V19X 3KHHA 2M5YA 3LAKA 4Z7YA 1ELOA 3M8ZA 2K1RB 2CUYA 1IQZA 4A8QA 3LGMA 3HD1A 3DOMA 3TA0A 1KQSR 4DL4A 4USUA 5DRKA 3CD7A 2WVBA 4DL3A 1VC6A 3EDQB 2JLGA 1FK9A 4BCAA 2VFSA 2PT0A 3D68A 3NP5A 2LMIA 1DARA 1Y5NB 3H2UB 3GYGA 3IS9A 4Q7AA 3HJFA 4FXDA 3KJQB 2XLKA 2YTCA 2BE9B 1OS5A 3QRRA 2HAFA 4WP8A 5DZ6A 2WVDA 5CAAA 1FFWB 1RAJA 3MM8B 3W62A 5DM6Q 2DISA 2WVFA 1DRZA 4P7VA 2LXUA 4Y0FA 2NS1B 2KXNB 1HI8A 1U24A 1R0AA 2N3LA 5IS2A 3PRDA 2HZCA 3D4JA 2VC0A 1EAYC 1TKXA 3LF0A 1KN6A 2XMMA 5HI7A 3ZTPA 3Q8RB 2CPHA 4AQYJ 2EFVA 1UVLA 5DO2A 2Z4PA 3HVAA 4YY3F 3K57A 5HLFB 1KQGB 4FYVB 1KEKA 3PX6A 4L3NA 4OI3A 3PW7A 3JSRA 3NCPA 3OV7A 1U26A 2DNZA 4BWMA 3CVKA 4OHYA 5A8RB 1S9GB 4X62F 4Q2LA 5A2QY 3OL9A 3R7SB 2GQ2A 1HL6A 4USHA 4AFFA 2J0QD 2P9EA 2V4JB 2ACYA 4EYIB 4PRFA 2G1DA 3HI9A 1DLOA 2EXUA 3AH6A 5KFRA 3ILOA 3HFZB 3CCES 1K0TA 3CO9A 1IKWA 2ROGA 1B4SA 2VFUA 3MEKA 2N3OA 3CJ0A 2VG6B 4IH5A 3PG9A 4DV5J 3KKFA 2QA4S 1HWKA 4URGA 4EZ9A 2DXFA 4ID5B 4P2XA 1SKWA 3O6QA 2CQ1A 1GMWD 4QW9A 4B17A 2KT3A 1YTYA 2FJWA 2HRYA 3C16B 4KC5A 1A6LA 3PFEA 4KHPF 3M8PA 1NZ8A 1LNQA 3Q8SB 3VQTA 2NXNA 3QJJA 4JI0J 3VZHA 3QZ7A 2WRMA 1BQNA 1R27B 1YGYA 3QWPA 3TJ8A 3PV8A 3IGVA 3I5BA 2LCWA 3NMRA 2MB0B 2ADCA 2H4YB 1RK8A 4DFJA 2Q66A 4X65F 1RQ0A 2OELA 3GG1A 1UAWA 3M05A 1Q4RA 4UY8T 5B09A 2Q6CA 5B0CA 1B0PA 3KYLA 3I5CA 4O3OA 1RWWB 4J9VA 1SJQA 3M8SA 5B7WA 4JI4J 4ED1A 2FJXA 1IR2A 1L5UA 2HHHF 1HMVA 2YNFB 2CNNB 4B08A 3DLEA 4NZ0A 2VPYB 2OEKA 3TARA 1B64A 3LUYA 3KJVB 5EN1A 3G86A 2ROEA 2I9SA 1G2EA 5HO4A 4DUZJ 3J80U 4OI0A 3MPYA 3CMES 2J6SA 2V9KA 4ZN3A 2DT9A 2BDPA 3FEXB 5F3TA 3ZTOA 1RB0A 1Q16B 1DY3A 5KFNA 4R25A 1X4BA 2PE8A 4JI5J 5GAHI 1FTCA 4NMLA 2OH2A 4DR4F 2XSJB 2A3JA 2N4DA 3P4UB 4H4KC 2YVSA 1FEEA 8AT1B 2GNKA 4FF1A 2P9GA 2VOOA 1BUXA 2Y8WA 2J76E 1FA0A 2HWHA 2GO9A 2NYHA 1WC6A 4U7CA 1LFPA 4J9OA 4C98A 2NZCA 2QX0A 2RDIA 3OVAA 4ED3A 3G6VA 1C1BB 1MWZA 4DV1J 4B9VA 1RHQB 3PO4A 3OSNA 4Q45A 5DS7A 2HIYA 2M7SA 4PZVA 4ILMA 3MEDA 4DQQA 4KJIA 3B4DA 2ALYB 3MPWA 5FDLA 4DSLA 4NCAA 2W4PA 4CO1A 1M5VC 4ZLPA 1S1WA 3G96A 5AE2A 4U7UD 2Y8YA 1M5OC 2FY1A 4LF7F 4LRCA 2PFFB 5SZTA 1FJEB 2GJFA 1RAIB 3ZXWA 4RNFA 2W9CA 4KYZA 1HR0J 4J90A 2XZWA 2V5HG 1U1KA 4D3GA 2R2TA 3PTWA 1PILA 3CJTA 4ZPVR 2VA3A 1GNKA 5KTQA 4MTPA 2LVWA 1N36F 1VQ4S 2XI2A 1EQ0A 2YX1A 3GFZA 4DL5A 1LQ9A 3NWGA 3MFIA 3PO5A 1N48A 2K3KA 3CCUS 2CG4A 4ZJQA 2DR5A 3FSXA 2HQCA 5KOXA 1U1RA 3PJXA 4EMDA 3M1VB 1J5OB 2MKSA 2GX8A 4OJ3A 1HARA 1MROA 3H4DA 1KRPA 4KTQA 2CKWA 4W90B 4U6PA 1N5TA 2OTLS 3LP2A 4M5NA 1JLEA 4RUCA 3MM6B 4ANCA 4PWDA 2WSFC 5CYJA 4WTOB 3MM7B 4QCLA 5F8JA 3ISZA 4B9SA 4LBHA 2I5JB 2WONB 4K2JA 3RBEA 1HQUB 4X4UA 3TOQA 2B8PA 4MJKA 2RRNA 7AT1B 1BQMA 1N0UA 3M30A 4DR1J 3DXSX 1BGXT 2H3EB 4NLRA 3VAJA 5L9XA 2FC9A 4NLUA 2QTWA 2FDNA 1HKAA 4U95A 3BQ1A 3J7ZT 4TYAA 3M2UA 5A2QU 2B4PA 2CPXA 4PWWA 1VC0A 5A0YB 3AA8A 3WDOA 1U0SA 2V69A 1TL1B 4LSNA 3HSJA 4QPTA 4CO3A 3UN5A 1RT2B 2A2CA 2VZ9A 5F8HA 1YRUA 1D9DA 3HLUA 3K17A 2LU2A 2CNKB 4J9PA 3M8RA 4YR2A 5HMYA 1H7WA 5GAEU 4ZVTB 2DPIA 2CIMA 1PJ7A 4V1Ak 3DRSB 4LFAF 4DG1B 3QLHB 4CM2A 1WTFA 3MMCB 3CDUA 1XNQF 3BSOA 2Y9HA 4KKOA 3IWXA 4ZVGA 3D54A 1TZ0A 3TZWA 1XNRF 4OYXA 3M32A 1RT6B 1RTIB 2YPZA 2UXBF 1X8DA 2ZNZA 4U9RA 1DHMA 1XJWB 2EBGA 1VQMS 3W9JA 2UZAA 4I4BA 2BBEA 3UVJA 2KZZA 3OTEA 5ADZA 2EFGA 2DGUA 3LP1B 5ETTA 3T1HJ 4WIQA 4PCQA 2RKIA 2X3DA 5H9FK 4K5RA 3EZOA 4B3RF 3VHQA 1VC5A 3N5BA 2YKQA 1AZSB 3P5TL 2HW3A 3K5NA 4EZ6A 3BGRA 1S57A 1RADB 2B8QA 5E3RA 4NEZA 2RQCA 1TQLA 3CD0A 4RNNA 3EXYA 4OHXA 1N34F 4ICLB 4CYUB 4IO9Q 2DR9A 1RT1A 2I1RA 1MWYA 2N7YA 1TL4A 1BLUA 2ZJQQ 4R0JA 1WEXA 2VBWA 3MOZA 5HMZA 4RU9A 1LFWA 3TUZC 1MMNA 2XWXA 5K8NA 4DSJA 2YKNB 2DO0A 5RUBA 2PEHA 2P2CB 3JQMA 1KTVA 4ZA1A 1Y3KA 1T03B 1FFGB 2JEGA 3KLIB 4Q5VA 3A1YG 4HDGA 4LT6A 4CI0B 2IRUA 4I6WA 4ILLA 3DRRA 4MT1A 1VRTA 1RAGB 5D3GA 3M8QA 2C2OB 1YJNS 3AOAA 2I2YA 4B9MA 5L1JA 5C42B 3ELHA 3MUTP 3VV2B 4CCHA 2L9DA 2KG0A 3IG1A 5ETLA 2ADBA 3H59A 3FSYA 1LWCB 2F40A 1EB0A 4CM0A 3FQKA 4PYAA 3BN4A 3KLEA 2H54B 2BW2A 3VAKA 3N4WA 1R8HA 5DGBA 3ENQA 1T95A 3P5BP 2IIHA 3GJRB 2XY6A 5CCMA 1LWFA 2MEWA 1WDDA 2CQ0A 5DQGA 1VBYA 5M2UA 4JI2F 3UFCX 1YBAA 3KHLA 3R5AA 1VQSA 2CQ4A 1E6YB 1UVKA 1NB7A 5KFOA 1U2RA 3M2RA 3T5HA 2VD3A 4TQRA 1A9NB 2ZHOA 4Q44A 5C2GA 4R8UB 2XLIA 3OT9A 3N6MA 1QSYA 1WOSA 1X0PA 4CLFA 1RU1A 2NXUA 3T9ZA 2GCFA 3H25A 1RAEB 1EKRA 4K4YA 2SXLA 3DRPB 3CWJA 4Q8EA 2CWXA 4C11B 1UMJA 3HMJG 2VJVA 4R5PA 2FJVA 5LT5A 3HHLC 1XC9A 2A6MA 1AUDA 3FK4A 3RGIA 4OV1A 3MM5B 3CD6S 1YQHA 2XYPB 2L9WA 1W2IA 4DX5A 1RHKB 2RU3A 2AYGA 3VAFA 3D7SB 3EGZA 3TAMA 2NXEA 2E1RA 4IRKA 4DN0A 3HHLD 2JRSA 2BA9A 1VISA 4TU9A 2BRKA 1GT8A 4LQ9A 5HVFA 4ILRA 4HH1A 2MQOA 3ZZTA 3R9LA 4LF9J 3MR3A 1W7WA 2XNRA 2RAQA 1VIXA 3QYYA 6FD1A 2P6SA 1IWGA 4UOFA 1UP1A 1AFJA 1FFSB 1RCOB 4WBFA 1XMOJ 4ZIVA 3X3UA 2W2MP 5HMXA 2ILYA 4C2MA 1U09A 3M6VA 1RWMB 4L3KA 3FSIA 1WORA 4KT0C 4DL2A 3P96A 4J9MA 4P74A 1HBUA 3MCSA 1TL7A 4JUZA 1DZ5A 1HD0A 4F2RA 3MECA 3QQCD 5F8NA 1NK7A 1UVNA 1UA0A 3ZZZA 5FLXY 3CJQA 1O8BA 4DR7F 1TVRB 2UU9J 3DM2B 2W9AA 4M63A 3ENAA 4ZHRB 5HATA 2DNNA 1QJHA 1G1XA 2MQLA 5I3PA 1FERA 3RAQA 4QIWD 1VS3A 1OO0B 2DNKA 2A0FB 5D4OA 3AFGA 4I2QB 3CE8A 2BYCA 4GMKA 4F04B 4B3SF 2XTJP 2FGOA 5HN0A 3CC7S 3MR2A 4KB7A 5DZ7A 5D0HA 3MAHA 1NCLA 4OI2A 2C3UA 2KM8B 2BJ3A 4CTAA 2CFXA 3GCXP 2A1BA 3S01A 1S7HA 4WCEQ 2QL7B 1NHUA 2DH7A 2ZEJA 4LIWA 2HNDA 4IQXA 4K4SA 4GKJJ 3CJSA 1QLNA 1MNEA 3EGWB 4DR6F 1IBMJ 2ZH4A 3SFUA 1X9WA 2RUGA 9RUBA 2ABYA 2UUAJ 1ZM2A 3MAAB 2D69A 1IKYB 4OX6A 3NGDA 3T6BA 4FF3A 4LF1A 2GGPA 2G13A 1XERA 1T7PA 5IT0A 1C0TA 1IBLJ 4HEA9 1HFEL 4OJGA 3TA2A 4F26A 4I2PA 2ZZTA 1VQ9S 1RTDA 2VQFJ 4OLPA 2IM1A 3S6EA 1C0UB 4ZVUB 3WHIA 1WC1A 4AL6A 4ECZA 1TK8A 3UWTA 3NWRA 2D3ZA 1JXVA 1SKRA 4P10A 5KFMA 1UJ6A 2Z2MA 1F2HA 1VK3A 1JK9B 4DDFA 1ZYQA 1XR6A 3BBFA 3QIPB 4I68A 4OYAA 3BPSP 5KG3A 3T1YJ 4ID8A 3HVRA 2B5JA 4C8OA 5KFJA 4WFXA 3QO9A 2CQ2A 2V9WA 4TLQA 2AGOA 2ZKUA 4RNOA 3FBEA 3P8BB 1X5OA 2RF2B 2AMCB 2LQ5A 2ZC3A 2EK1A 3D28A 4WZQA 3BYPA 1Q78A 2V2VA 3W60A 3I9V9 4J9UE 3KG1A 3MEEB 3ZNUA 5KFUA 2B51A 2BJDA 2DGSA 2ROPA 1KONA 4JV2A 4LF6J 4F0MA 1NDLA 4AQYF 4LREA 3A8IA 5EHHA 2EFNA 2XMAA 3V6KA 1FNMA 3DHXA 5G4DA 4IR9A 5THWA 1CULB 4F7VA 4KHRA 3DDNA 4TYBA 1CS4B 3QZ8A 1AXQA 4QYRA 4E0DA 1HBMB 3HULA 3GLJA 4L74A 2GV1A 1B3TA 4PUOB 3HVTB 2AEJA 2NSBA 4C4WA 4BDPA 4NLXA 5DETA 5T7LA 3V6DB 3SSQA 4DV0J 2VV5A 3IM9A 2ZD1B 3KJFB 4FKXA 3CW2C 5KG7A 3MUVP 2IJRA 3SQGA 3OR1A 4CLWA 1RABB 1SI9A 1VJWA 3KK2A 2D3UA 3UDLA 3GR1A 4YB6A 3TVKA 5HP1B 1S12A 2JOQA 1KLMB 4WYLA 3CIMA 1K73T 3QSYB 4QIEA 3IM8A 3D0HE 2Q79A 2E5GA 1YJUA 5E5NA 1RI7A 4DV5F 4DHVA 4JBCA 4KGVB 4PYDA 3OXLA 4WZMA 2E5HA 2XO7A 3A13A 1SPBP 1IXKA 2EI5A 3VZIA 2OIHA 3M2VA 2VF3A 2AD9A 1HW8A 4HVZA 4XO0A 1C1CA 4ZMMA 4AD6A 4ZPDA 4OZLA 2HVDA 3AOCA 2KFNA 3LPYA 1S76D 3UR3C 4RZRA 5C25A 4P52A 3POTB 2ZDOA 3GJSB 1GK8A 1TU0B 5HROB 1RWKB 3PCOB 2QO3A 3JXOA 4CLUA 3PRBA 3H5UA 2YKPA 5HJYA 4MYUA 1EARA 3JSBA 4I69A 2HHVA 1FD8A 1XBWA 3MR7A 5ETVA 4LVNP 4N5SA 2O1PA 3DXBA 1U2CA 3IAS9 3NGRA 3NGKA 2B0GA 3PM9A 2VG5A 2LXFA 4PABA 4ZPWR 3DMJB 2ZBPA 3MMBB 1EX8A 1JKHA 4L72B 1RT5B 2ZM6F 5J2MB 4JI4F 4H4MB 3D2WA 1Q8IA 2YKAA 4XPCA 4LFBJ 5KFKA 4GC7A 2HHXA 1SC6A 5KFWA 4PWUA 2HGNA 4NA1A 3HD2A 2D7SA 1NJZA 4QU6A 1U1OA 2ZH1A 4DUZF 2I6WA 2QZ8A 3L7UA 1RTJA 4CLZA 1M1HA 2XMVA 4F4XA 2J5AA 2WBRA 4TKTA 4A8KA 4JI5F 1C4CA 4NPOA 1F3VA 4RW6B 1VDHA 3WC2A 4CT8A 4G3IA 2MQ8A 4YY3J 3W5XA 3LGNA 3MM8A 1GH8A 2VH7A 3CCLS 1EQMA 3JQKA 2WTFA 2ZOMA 1PGZA 4LSLA 3B8HA 5CQGA 1JB0C 2F9DA 4TNOA 2JC1A 1BQXA 2C3YA 5DDRC 1RT3A 4RW7B 3NGTA 1GFWB 3AJDA 1HNWF 3M6UA 4F8RA 1T8EA 4CO5A 5A8RA 1WUUA 5HQ8A 3RR7A 2O5DA 4OZ1A 4DU8A 5E7OB 2Z57B 1TMJA 2J6UA 5KFZA 3G71S 3UW1A 3M8WA 2V4JA 4IG3B 5D4PA 2QRRA 2AHOB 4OZ3A 4B3OB 4UZCA 1K1SA 2P8IA 4Q0BB 2BXJA 4O44B 2L3MA 5GAHU 5E0OA 4DL7A 5J2NB 4WFYA 3NEKA 2KN4A 2LFVA 4IFVA 4KHPJ 2C3OA 3TJAA 3OUYA 2JWNA 2FHOB 3W64A 3RJMB 5LMUF 4A8SA 1HNXJ 1MSWD 1N56A 4J9KA 1Y4ZB 3DNCA 2B6AB 5D4NA 1XWLA 2J8SA 1IM4A 1YJTA 3C16A 2W2NP 4CLTA 1BWVA 2OGUA 1SQEA 4ATNA 2VBZA 2W2PP 1RYSA 4C9DA 1KWMA 2J0XA 4DLGA 3O3LA 5B0DA 5CXTA 1EJ7L 4QIGA 2LEAA 5GMDA 4PXBA 3H42A 1MLAA 3RBXA 1NZAA 3CUNA 2QYCA 3DLGA 4PG8A 1S9EA 2HHHJ 5BR8F 5E3CA 2YQ1A 5J2QB 4LF4F 4QQBA 1SV5A 5LJ5Y 1NLKL 5CYQA 3CCVS 3NKYA 1JLAA 1VQNS 5KT2A 4DPOA 4DCJB 1KD1T 4FBTA 1H72C 3IP0A 2J9CA 4DR5J 4BWJA 1SB6A 4AXJA 5HBMA 1NXIA 4LMZA 1S6UA 3PR5B 4DR1F 1HYSB 5EUHA 2YNFA 3R7NB 2HNZB 4WIIA 4DBQA 1H2UX 1KBRA 1EETB 3LWMA 4NLOA 4XTTA 2IM3A 2ZC4A 3KXDA 4HHJA 3KJVA 1TKDA 3AXKA 4DR4J 4GVLA 1WC0A 1YX2A 4JYAF 3TO8A 1FCAA 3QT7A 2K7KA 4IOCQ 3MEGB 2QLFB 3BGFA 3J7YI 3TX8A 3C6TA 4ZP9A 3R5DA 5KFHA 2DIVA 4BHQA 3JQJA 1KS2A 1P27B 4S0MA 2HKEA 4UZBA 1HBOB 3QMQA 4EI2A 4PQAA 4DR3J 1QVGR 2VBXA 1FD2A 2HHUA 2HWIA 2OUGA 2X1AA 4ZJLA 1S1VA 4B3MF 2CPDA 4I6AA 3S1TA 4RX6A 2Q1LA 3PYGA 1OSCA 2PEBA 1WKLA 4NL5A 2YWFA 1JIHA 1PBUA 3MF5A 4UW2A 4K4ZA 3PKYA 2UUWA 2J6TA 3EVMA 3MWBA 2KFZA 1F6TA 4WF9Q 4G6VB 1SIZA 2BQRA 2AW0A 1ZAWA 1C1BA 2WHOA 3LP0A 3AD8C 5LSOA 2G9OA 4Y2IA 2VU5A 1SJ1A 1LK7A 1RXOB 3E8OA 3BF4A 2DJWA 4N56A 1SUQA 1S49A 1ZM3A 2CPJA 3DOKA 4PR6A 3RTVA 2ZH5A 2I38A 3QATA 3OL8A 4YHHF 2W8LA 2W7AA 1X4AA 4AUKA 3H0PA 3UCUP 1WKJA 1TFWA 3D1OA 3MPUB 3DKDA 5LSLA 4RKUC 1ZETA 5K14B 1N36J 4CLYA 7FD1A 1BWEA 2C3MA 5I3UB 2FVCA 1JMTA 2CG8A 5KG4A 1TV6B 4HACB 3HSDA 4ZPCA 1EHWA 1N52B 2WOMB 4F25A 3RZAA 2P5VA 4F36A 1SH2A 5A76A 3ITHB 1WF1A 2HBQB 1FJGJ 3I4HX 1T11A 1FWKA 3C14B 3I6PA 2FJEB 3AJ2A 4C7QA 5L1IA 3G87A 3MD1A 2GS8A 2CQDA 4PPZA 4PQUA 5GAEI 3M4XA 2QFJA 1H6KX 4C0BA 1O5JA 3M1VA 3W61A 1V5VA 4IG0B 1HQ2A 1J5OA 2NCKL 2YX4A 1TAUA 5D8HB 2KVQE 2V67A 1FF2A 3SI8A 1S1XB 2ZH7A 1SJ4P 1Y0HA 5EWGA 5E3PA 3V2UC 2P6TA 1UW4A 4ZS6A 1ZPWX 2K3IA 2HNYA 3MM6A 2BM1A 3D6MB 3K5MA 2PI4A 3MM7A 3FVYA 4DOZA 2MQQA 3E51A 1C2PA 3GWCA 4JV0A 2HFNA 1WACA 4WKYA 2E9TA 4RJVA 4CO0A 1S9FA 1Q8BA 3QT5A 4EO6A 4ECVA 3KFWX 1BC6A 4K5SA 1R8BA 3SCLE 4K4XA 2KZMA 2KHDA 4FPRA 4ZPBA 2BW7A 4URQU 3JYTB 1NUEA 4DUTA 3O2IA 3CTRA 2R8KA 4ZVQB 5LJ3Y 2F5GA 4WU3A 3OLBA 1E6VA 3CCRS 5KFYA 2Y1LB 1VQYA 2AJQA 2LKZA 4TQSA 5A8KA 3VAHA 3SSRA 1HPZB 2MLXA 3KHGA 4F4WA 2V2ZA 1TELA 2R8JA 1DFDA 1S6QB 2PD1A 3AT1B 4ECUA 1XNQJ 5I3QA 1DTQB 3CJ4A 2PMWA 3WBZA 1XNRJ 2OTJS 3W9HA 5AXLA 1VQ5S 3FJ2A 2UXBJ 3LAMA 3J7A1 3MM9B 2HEKA 2ERRA 3OR2B 4DG1A 3QLHA 4UOCA 3GYXB 1Q79A 5GAGU 3MMCA 3ZNJ1 2FLLA 4F02A 4A8XA 2V8DA 5IV3A 3RRHA 3CGIA 2F63A 2BJ8A 3BO2A 5IQQA 4F67A 1UFLA 1RT6A 3HT0A 3CJ5A 2WZ1A 3G8QA 1Y11A 1B70B 2C3PA 1L3KA 3ISND 4LRAA 2O67A 5KT6A 1X4FA 2JHEA 3DYAA 3A8EA 4M5LA 2BABA 3CJ2A 3GTYX 2HSEB 2E1PA 1LXNA 3LP1A 3P49B 2YWHA 1VQLS 2FLPA 3BS9A 2G2OA 4RBUA 4LF5F 1SH3A 1J2VA 2V4QA 1Q0NA 4FS1A 4PXCA 1RLDA 1F5AA 3LO3A 4FYXB 2HVIA 2KXHA 3MR6A 3FDSA 5B0GA 3DOMB 2R7UA 3NAHA 5LMNF 3IWLA 3MDFA 2H9ZA 3BM7A 3M8YA 4ECYA 5KFCA 2EFQA 4ICLA 1U1QA 5C7PA 2QLWA 1WEYA 2DITA 3PVXA 2Q3PA 2FTRA 4WXWA 1Z1ZA 2CJKA 4NXNF 1WC3A 2YKNA 1AUSL 4X4RA 2D3O1 3KLGB 3R2CJ 3OJUA 4UUWA 5EWFA 4LUBA 1R0AB 4M5DA 3W2WB 2H1YA 4F4YA 1T03A 5H1SV 3K5OA 4Z7CA 2E1AA 4FF2A 3CO0P 2FUG9 5L38A 3GV8B 4WP9A 1D0EA 2XLJA 1H74A 3OQ2A 2E7WA 4X4OA 1WHWA 2DB1A 4O3SA 1GMVA 1U49A 5K5MA 1S79A 3S7RA 4DV3J 1R6YA 2YWGA 4R0EA 1GEHA 4JI2J 5GMKa 3AY0A 1N32J 1FNOA 1IKXA 4JP8A 1DLOB 4HI2A 5AXKA 4B9UA 1LXJA 1PG5B 1OY8A 2BANB 3UN2A 2KTQA 1RA7A 4JI3F 2FVSA 5KG1A 2IJFA 2GIFA 2EBEA 4GKJF 4OX8A 2KDOA 3M6XA 1H2VZ 1V3ZA 1YITS 3SYZA 5KAKA 4G1QA 3LALA 4O3QA 1L3UA 4TXSA 2W1BA 4DZ6A 1V9OA 3PXGa 2FJBB 3VQSA 5CYMA 4KR0B 4MKAA 4X2BA 1PC4A 4DV6F 5AE1A 4B9TA 4C11A 2BACA 1F5CA 3ZO7A 4JB8B 2CDRB 4F2SA 1UZHA 1Y10A 5J1NA 3MMAB 2CQPA 1KC8T 1M1GA 4Y65A 3PKMA 3KK1A 2G0JA 3MM5A 5IT4A 1NK0A 2ZH8A 4O4RA 4ZKAA 3WZ0A 3T1YF 2CXEA 2GMHA 4RUBA 2IVYA 1KOHA 4DFKA 2FVRA 3GCWP 1L3TA 4NEYA 1X4CA 1P9QC 1RWOB 1JJ2R 1LKZA 3GIRA 2IRYA 2OPPB 4YFUA 3U1MA 1OWXA 5KT7A 3W3SA 1LK5A 2GAGC 2ZH2A 1R43A 1LW2B 1UTAA 1T3NA 2APOA 2LDYA 1EP4B 5HMWA 1YJVA 4TN2A 5B0AA 2AU0A 1A0OB 4L6V3 2W25A 4ER8A 3FKBA 3J80Y 2RT3A 2OAUA 1HMVB 1FXDA 1VLOA 5DLFA 4TY8B 2ZUGA 5JVGQ 3B4MA 1SKSA 2ZE2A 1FJ7A 4YOEA 3A3PB 1HI1A 2KRRA 3Q8VA 4NLWA 1DURA 3IFEA 2XQCA 5J2PB 4NCBA 4UF4A 3KJNB 4A4JA 1KDNA 1WD6A 3PNIA 3ADAC 3FNNA 4ALZA 5HANA 2BQ3A 3L9ZA 2IRXA 4P9SA 2XWYA 3IO1A 3K5LA 3H2LA 4USIA 3ET6A 2BJ7A 4P75A 2M52A 5C24A 1LW0B 2MZ1A 4NCGA 2HQIA 5KFBA 1ITPA 5LL6d 2C2RA 3N79A 2C22A 3A8JA 4B3SJ 2XY7A 1TVRA 1YVFA 2MMYA 2C2NA 1XEZA 3PJ9A 2D41A 3DC2A 1U47A 2GAHC 2R2UA 1WHVA 2RS8A 4FVCA 3VGVA 1PKUA 2CDQA 4J7CA 3AJ1A 4MK8A 3F56A 4MMOA 1GQEA 1SL1A 4FPIA 2YKMB 4NLDA 3FZ2A 3MR5A 1TUWA 1ZZNA 4PG4A 3W66A 2YPYA 3F44A 1REVB 1RTZA 1CLFA 2D9PA 1N5SA 2BJ1A 3W8PA 5KFTA 3PIOQ 4EBEA 2XS2A 3MTJA 2M3DA 1G4CA 1CJUA 2L48A 4DXLA 5ETQA 3MOJB 2H65B 1YJRA 1JWWA 4UT4A 2QLJB 3NG8A 2E9RX 2UUCF 1RTHA 3GSIA 4ELVA 3CT9A 4O3RA 3EM1A 2ASJA 2W9CB 2WB1D 3NLCA 3EGVA 1KLNA 1F60B 4RBTA 3L95X 4JI1F 1IKYA 5ETNA 3HZGA 4LJMA 5K8PA 1X31C 2XS7A 5E3QA 3O1LA 2XO6A 6FDRA 3IMQJ 1I51B 1C0UA 2ZOFA 4LFBF 3H20A 3HJVA 2XULA 3V6JA 3PW4A 3K0JA 1CQNA 1Q1KA 2ACMA 2JEJA 1DQAA 2YWWA 5D6GA 4KHMA 3ZZ0A 5I4MA 3VGTA 1GXUA 4EUVA 3F73A 1MROB 3PR4A 1VRUA 2BE2B 4ZVEA 4OJHA 2XB2D 2HVZA 3S8SA 3DN9A 4DX8H 3V81A 2W9BA 2DEIA 4EBCA 1JLEB 1SIWB 2Z2ZA 1V3RA 1NPPA 4ZVFA 3KLFB 2ZZMA 1VBXA 3RYLA 1UJ5A 2YH0A 3PX4A 3C3LA 4WK3A 3Q8QB 1S0NA 4LR7A 4AL5A 4BBYA 2H5EA 3AB2B 2FB0A 1N88A 5HQLA 2HHWA 1R0BG 3HXMA 4W92B 3H90A 1S99A 1FDAA 1BQMB 3RU0A 4YN3B 2BJEA 3M30B 1N33J 4YR0A 6AT1B 4IR1A 1CJKB 3DLJA 3DGPB 2DR8A 2D1CA 2MQMA 4L73A 5IV4A 2GVDA 4CQ1A 3M2UB 3SDEB 1VGYA 2HQDA 4TY9A 3SV4A 4I64A 4QW8A 1CS4A 2E1CA 4KH1B 3B6BA 3JSMA 2NZ4A 4PUOA 4LSNB 1S4FA 2BKOA 4Y6IA 3IR7B 3V6DA 1N5QA 1QVFR 1F0XA 3SCKE 2VL1A 3UE2A 5JMNA 2NXCA 2C2DA 2QJ3A 1D09B 1JJHA 3FBCA 2IA6A 1NU4A 2EK6A 4ED0A 5HP1A 3HDSA 2E66A 3Q8UA 1KLMA 2ZHBA 1YK9A 2O66A 4CNYA 3CXCR 2H4WB 4ZLLA 2WVEA 2CQBA 2AJ1A 1Q82T 2JEIA 5KFDA 2K2PA 1DTTA 2GMLA 4KSEB 4I7FA 1P8GA 4OHWA 2VFTA 1V6HA 3NY0A 1LWEB 4M5MA 1RT7B 1HNXF 2M0GB 4EBDA 3UQSA 1TL5A 1XK8A 2DNHA 2CQHA 2FZKB 3TUIC 3M32B 1QSSA 1FKOA 3FBFA 1ZM4A 3EPGA 4P73A 2DHXA 3EVOA 1N6QB 4UOGA 1B7FA 1WG5A 4J91A 1JLCB 1S77D 4YMEA 2BQUA 4O4GB 3MTKA 3AXMA 3POTA 4LSZB 3MFHA 2XM3A 1RE1B 3I87A 1F3FA 5M2RA 5HROA 3DI6B 2RKIB 2DHSA 4FZVA 5E2QA 5KFVA 2NREA 3LGHA 2ZM6J 2ZFHA 4AL7A 1FRHA 3FFIB 4KQZA 1WNEA 1IWAA 3GZ7A 1M1KT 2MLYA 3TAPA 4NLGA 4RW9B 2NUHA 1IJFB 3MCMA 4C0HA 1IKVB 5A8WA 3RB4A 4USMA 1H73A 3CC4S 3DMJA 2AX0A 3MMBA 2ZDPA 1CSJA 1RT5A 4ECWA 1G7CB 4DR5F 5J2MA 2CQCA 3CJKA 1RACB 4H4MA 3LA0A 2BKNA 1O0PA 3QAEA 4K4VA 2IDEA 4DEZA 1UWAA 1HHSA 2N82B 2W4DA 1SJRA 2HWTA 2R7TA 5LOQA 3NAIA 3OBIA 3H40A 2GHVC 4OHVA 3GU0A 3UO0A 1ACMB 2E5IA 4RLEA 1D9AA 1X7VA 3WIUA 2OEMA 4J9RA 2CWKA 3FCWA 3L7OA 2FLOA 1I6JA 5D3GB 4IFYB 4C48A 3MGJA 3T1AA 4DR3F 4P6QA 1YJ7A 3AQOA 2R8HA 3TWZA 2LECA 1RKJA 3K8WA 1J27A 1HNWJ 2BOPA 3IG1B 4DCPB 1VQ8S 4LVOP 3KLEB 3NOCA 2VG7B 4C8MA 3UN3A 2JFKA 3IXQA 2M4MA 2BM0A 1S0OA 4N77A 1FI4A 2BKPA 5KT4A 2RSQA 1HIYA 1JLGA 4KV8A 3W5ZA 2R2RA 3W2VB 3KNAA 3NNCA 3QT8A 2CJ9A 4TU8A 2ZJRQ 2OLWA 5LSRA 2VPXB 4NLSA 1GX6A 2J7KA 5E3AA 4OX9F 2ZBIA 2ZVSA 4ZDNA 2V8GA 4DU7A 2QEXS 3Q83A 2AJFE 3WX4A 3J7AN 4LRDA 3KMSA 2KH9A 4HHHA 2QL5B 3M6WA 1NJIT 4B3OA 1VRQC 2LU1A 3M9NB 3TRGA 1WHYA 2ZVIA 4OLOA 5LMUJ 4BLGA 4Q43A 4Q0BA 2HAIA 3J7YU 3H5XA 2EG2A 1OYDA 4EWTA 4ZIWA 3SCIE 2WB4A 1PYOB 4R5PB 1N54B 5ETOA 1HBNA 2GVZB 4QR1A 4WFBQ 5IFMA 1FJGF 2FZGB 2ZWOA 1U7LA 3H2VE 1B7YB 3CPWR 4IRDA 1HHQA 3IBFB 4QPXA 4DFPA 4HTIA 2FHJA 5DDQC 4DV7F 2MGZB 2B6AA 3TAMB 2MQNA 4E98A 1NBEB 2EFOA 2HFOA 3Q2SC 5BR8J 3MXHP 4LF4J 4WKRA 2L08A 3I96A 3D6HB 2MKCA 5A6PA 1FVQA 5KOWA 4N76A 3A3OB 3H98A 2V8VA 4F3MA 2QGFB 1BMQB 1SKUB 4DL6A 4PEOA 3I9ZA 4DR2F 3HHLB 4GKKF 4QWDA 4C8YA 4IDKB 3OTOJ 1XQIA 4HDHA 2V0NA 4BC7A 1T02A 1NDKA 3AD9C 3EICA 2XMJA 1HHTP 3HHEA 1F9FA 4JYAJ 2PMHA 3B54A 4QOTA 1YG0A 2U2FA 5IWAF 2AJ2A 1BE4A 3EWGA 3KG4A 3C19A 2GQCA 1HYSA 2HBYB 3N01A 5F9LA 4KPYA 2F3JA 2HNZA 5D4LA 3FEZA 4A8FA 3C6UA 1EETA 1BXNA 2Q6BA 1GX5A 2BUNA 3T6JA 1WJ9A 4LQ3A 4U7UK 2HG4A 4OI6A 5CA5A 2XC9A 4B3MJ 2G0IA 1U0HA 2WAQD 1SH0A 2LA6A 4DZDA 2DTJA 2XMUA 1JXEA 4W98A 2IMOA 1EIYB 1T05A 1N4LA 3FMWA 1Q8LA 4WFZA 2GZOA 1CC7A 2XG8A 3TP2A 1TKZB 1PAEX 1PBAA 3MZIA 2DNMA 3O8WA 1P1LA 1QTNB 3A4TA 3CCWA 3R5BA 4KGMA 3D67A 3GIKA 2DYAA 2EKYA 4GVBB 5B0FA 2O01C 1LOUA 3ILIA 1JXLA 3DLBA 5E33A 4RW4A 1CG2A 2UV8A 4MH8A 4DF4A 2F7VA 3P3DA 2V2QA 4X66F 3LW5C 2QMXA 1WHXA 4YHHJ 3K8VA 1Z4UA 2W8KA 1BHNA 4LF8F 2C2MB 2DKOB 1YZ7A 2F8EX 4OIXA 4O3PA 1FVSA 2JLEA 5D0RA 2YNGA 1X5PA 1MU2B 2DNRA 2G2ZA 2HPUA 1C0TB 5ETMA 1WSRA 2IJNA 4CLSA 1MN9A 3T5JA 2UVWA 1P1TA 1SQGA 2JJ4D 5A6WA 1Q5VA 3FZBA 4NE9C 3JAMY 4ES2A 5K14A 4KGZB 3RB3A 2DK2A 2OPRB 3OL7A 4HTJA 5ETKA 3PACA 1AB8A 2W01A 1TV6A 2W7OA 3OVBA 4HACA 2GC8A 5DDPC 2WOMA 3KNGA 2DH8A 2DR6A 1QAJA 3ITHA 1P9YA 5AXNA 1S1TA 2B4VA 2H5JB 2QFIA 1X0FA 3NS6A 3VF0B 4HR2A 4ECRA 1KFSA 3QO9B 1X5SA 3EVWA 1AFIA 2MHNA 4IUFA 4CNZA 1CJVA 1ICEB 3IRXB 2Y1IA 2EW9A 4N7TA 1YLXA 2EWHA 1FO1A 2HYIB 4JV5F 1VBKA 3J81U 1G3OA 5BYRA 3KLHB 4QYZK 3KG0A 3BPDA 1RHJB 4IG0A 4DV4J 5CZVA 5GAGI 4TVAB 1H0HB 3SXLA 2YY3A 2Z8QA 5F8GA 4DPXA 3CSKA 5CH7B 3QT6A 3DDIA 1KVJA 3IGNA 1JNZB 3ZTQA 2LEPA 1JLFA 2R42A 1JLQA 2DO4A 4Y2AA 3H5SA 3FBBA 2Z2YB 4WU2A 1DQ9A 1IBKF 4OZJA 3P6YC 3KDOA 2RRAA 5M2PA 4DV3F 4DX6A 2MYFA 2FPHX 1U6BA 4CWBA 3HCXA 1N32F 5T7LB 3GB0A 2PSZA 1YIJS 5AJ3J 1ZA2B 2IHR1 3UDCA 1FHTA 1Y3JA 3JYTA 4P2SA 3KK2B 2R7OA 1TK5A 1KR4A 1S6PB 1HI0P 4MAKA 2HHSA 1G6BA 3Q22A 1VJQA 3BKTA 2H51B 2ASLA 3I0RB 3HP6A 1OYEA 2RJZA 3G4SS 2CQ3A 2IA0A 3CMAS 2CJBA 3BBBA 2CPIA 3HHNB 2IBOA 1CQMA 4HYKA 2GQQA 2YXLA 2XMTA 1JX4A 2PGCA 3EX7B 1WG1A 3BO3A 2QE5A 1S6QA 1FKPB 1PJ6A 1R7IA 3FCHA 3PX0A 4DI6A 2XYGB 3G6XA 2RD5C 2N4CA 2OI2A 3HSGA 4WXOA 3W7BA
chains in the Genus database with same CATH topology
2LFVA 1X60A 1UTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFV A;  1X60 A;  1UTA A; 
#chains in the Genus database with same CATH topology
 3U02 A;  5D15 A;  2LQ9 A;  3OR2 A;  3G8T A;  2XGQ A;  2IC3 A;  2MQP A;  3MHY A;  1D3W A;  3MCN A;  1C4A A;  3DU5 A;  1PAU B;  4ZVR B;  4B3T F;  3Q8Y A;  3AOB A;  3QGI A;  4D3H A;  4NXM F;  3OTB A;  2HGL A;  4LF5 J;  1FDB A;  1YBU A;  1EKS A;  5EDW A;  2M9K A;  2MZT A;  2R8G A;  1Q7L B;  4AXI A;  1FWL A;  1S1U B;  2AQ4 A;  2W7P A;  2XCP A;  2VG5 B;  4HH0 A;  2HLU A;  1WF0 A;  5J1E B;  1WI6 A;  1CJT A;  5LMN J;  5K9F A;  5HVG A;  1SJF A;  3EZU A;  2F8M A;  4P7T A;  2JSX A;  3BYR A;  1Y7P A;  1CC8 A;  4ED6 A;  4WK1 A;  3R3T A;  4MKB A;  2H48 B;  2LLZ A;  3CCZ A;  4USK A;  3AA9 A;  5G0R B;  1QSL A;  1SXL A;  4NXN J;  2AYE A;  3TZX A;  1RTJ B;  1WWH A;  1H7X A;  2AYB A;  4FYY B;  2DXE A;  3NL0 A;  5L8R C;  3CJ3 A;  1U8W A;  1TL3 B;  4Y28 C;  3MCO A;  4ZVO B;  5KFE A;  3EYZ A;  4USJ C;  4QIF A;  4B9L A;  1XR5 A;  1IM6 A;  2KT2 A;  2XSF A;  2JEF A;  3KLG A;  2IM0 A;  1S0M A;  5FII A;  4USW A;  3N28 A;  3W2W A;  2FC8 A;  4DSI A;  4LSL B;  2CNL B;  4FS2 A;  4RL1 A;  4G65 A;  4DMZ A;  4H4O B;  3IA0 A;  4KFB A;  1JNR B;  2YQ0 A;  1NRK A;  2X7I A;  1RT3 B;  2XMW A;  1UPM B;  3DOL A;  2B3T B;  4JI3 J;  3QFH A;  4ZCK A;  4JI6 F;  2LXI A;  3UNY A;  1RZM A;  1XMB A;  5F8L A;  2OML A;  4BC9 A;  2I0X A;  4A46 A;  3SSS A;  1VQK S;  2X51 A;  2VQE J;  5L1K A;  1ZOT A;  3RR8 A;  4XK8 C;  4MK7 A;  1REG X;  2EPI A;  2FJD B;  4OZ0 A;  4N41 A;  2VKR A;  2ZKT A;  2BAN A;  3TAQ A;  3KLV A;  3EE3 A;  1ZA1 B;  4OYW A;  1RAH B;  4YB5 A;  2CA9 A;  4UUX A;  3QRP A;  1HNV B;  2E7X A;  3J7Z 5;  1LV5 A;  4WP3 A;  4DV6 J;  3AQP A;  3O44 A;  3TI0 A;  5ETR A;  3LWL A;  2VPZ B;  1HWL A;  3U27 A;  4M8L A;  2MZQ A;  4IFV B;  3BKF A;  4Y3C A;  3KOA A;  3OUY B;  1W25 A;  4U67 Q;  3TQE A;  2CRL A;  1RKI A;  3ZZU A;  2OPS A;  4UOH A;  4X64 J;  3TVY A;  3JAM U;  4G1P A;  1BY9 A;  5D0E A;  2F4V F;  1NHV A;  4O23 A;  1D8Z A;  1OIA A;  2NLW A;  1MMD A;  1UWB B;  2RIJ A;  4QBU A;  1KNZ A;  4FYD A;  1PSD A;  3MMA A;  5H9E K;  2CZV C;  1U2F A;  2YKO A;  3I0S A;  3H8Y A;  2CAJ A;  3UD4 P;  3I56 S;  3LTO A;  4DPU A;  2KFY A;  1SL2 A;  2KJV A;  2K7J A;  3VAM A;  4NRT A;  4L76 A;  3PZP A;  3EPI A;  3UDE A;  4KO0 B;  2KRB A;  1GMW A;  3EDR B;  3NCQ A;  4MFB B;  2IAJ A;  2YWK A;  4A47 A;  2OPP A;  3DLG B;  1VHF A;  1S9E B;  4HT7 A;  4XDD A;  2M88 A;  3DLK A;  2ZH3 A;  3BR8 A;  1SV5 B;  2H5I B;  2YNH A;  2GFF A;  5CYQ B;  1JLA B;  1LW2 A;  1EP4 A;  1HLW A;  4DQI A;  2OD6 A;  5D0G A;  1T9V A;  1OSD A;  2RU9 A;  1HNZ J;  5HBM B;  1UZD A;  2HQF A;  1KTQ A;  2QMU B;  1WC4 A;  3RUB L;  1N33 F;  1HNI B;  3DRX A;  4TY8 A;  2A10 A;  3BSA A;  1URN A;  2MPU A;  4A8Y A;  4JI8 F;  4K0K J;  3VWS A;  1Q81 T;  1OQ3 A;  5J2P A;  1NME B;  4ZCI A;  4F0H A;  2NR0 A;  1MWQ A;  2ZBQ A;  3C6T B;  1IR0 A;  1TKT A;  4ZLJ A;  2DIU A;  2FGC A;  4GRS A;  1X4D A;  2MDA A;  1HW9 A;  3IC1 A;  1OMS A;  1N5Y A;  2DD8 S;  3KUH A;  3RB6 A;  1FXR A;  2B7C B;  1LW0 A;  4ECS A;  5KT3 A;  2B9X A;  1N5V A;  3CB4 A;  1S5Z A;  3CED A;  4JOU A;  1S1V B;  3I32 A;  2JDJ A;  3PW2 A;  2IPO B;  4ANE A;  1W2B R;  2QG9 B;  4PXE A;  2BE7 D;  1B99 A;  3NCR A;  2GW8 A;  4DLE A;  4YDX A;  3R1L A;  1ZTT A;  2W24 A;  4C8L A;  3AHP A;  4M5H A;  4C6A A;  5L9N A;  1U6Z A;  1VQ6 S;  1SC1 B;  1FWP A;  2KI2 A;  2YX7 A;  2G2Y A;  2YKM A;  1X4E A;  1XTZ A;  2ASY A;  5D77 A;  1RBL A;  3LP0 B;  5KFX A;  1NND A;  2UUC J;  4CP5 A;  4M5G A;  3F41 A;  2EVZ A;  2MKK A;  4CLK A;  1XMQ J;  3PDN A;  3ZZY A;  1REV A;  2CYY A;  4ED8 A;  1NB2 A;  1SUQ B;  2LQB A;  4DWI A;  3ENV A;  4DV2 F;  3DOK B;  5EGY A;  4JI1 J;  3FCV A;  2LQ8 A;  8RUC A;  2E5J A;  1FE0 A;  4H4K A;  3RBZ A;  3BZQ A;  2DNG A;  4EFA C;  4HLB A;  3BDP A;  1KVK A;  2HIQ A;  1RBA A;  3NXZ A;  2OPQ B;  3D6F B;  1JJ4 A;  3BBC A;  4O0I A;  1GXT A;  1SQF A;  2FD2 A;  2MZJ A;  2K1R A;  1S4E A;  3LOU A;  2O3D A;  1JLB B;  2R2S A;  5HL7 Q;  1N0V C;  1UW9 A;  1SCJ B;  1OQ6 A;  1L3S A;  4YB1 P;  2PII A;  5BYS A;  1UVI A;  3N9U C;  4AT1 B;  2NXJ A;  1PO6 A;  4PQU B;  4F50 A;  5KFG A;  3C8Y A;  4Q2M A;  2AJ4 A;  1RWN B;  1K47 A;  4QZV B;  4RPF A;  1OJ4 A;  4F4A A;  1N8R T;  3R6L B;  4MKV A;  3VAL A;  5IOL A;  2B9Y A;  3MI7 X;  1NSA A;  1R8A A;  2E5L F;  3FGV A;  2DGT A;  2BE2 A;  3D9B A;  1KHV A;  4ED2 A;  1JQG A;  2DNQ A;  4RUA A;  2W4C A;  1U45 A;  2HNY B;  4NA3 A;  3SV3 A;  3KLF A;  1HQE B;  1SVD A;  5HLF A;  4C3M A;  1VQ7 S;  2R7R A;  4ZOS A;  2PA3 A;  3D3B J;  2HFS A;  2IVF B;  3O5T B;  3QJP A;  2Z2L A;  4XPE A;  2Y1J A;  3KHR A;  1S9G A;  3QGH A;  3FUY A;  2LQJ A;  3UI3 A;  2DNL A;  1FRM A;  3VAI A;  3CJ8 A;  2E9Z A;  1CJK A;  3DGP A;  2VA2 A;  3BQ2 A;  3KUE A;  4DX7 A;  5L39 A;  3AAW B;  4PXD A;  1GXL A;  4Y2C A;  5ETS A;  3PHT A;  1E6V B;  3EMT A;  4ED5 A;  3SDE A;  5A8K B;  4HKQ A;  2A6O A;  3L4B C;  1FRI A;  1RA6 A;  1QUP A;  2VG6 A;  4IYQ A;  3KK3 B;  2XNQ A;  2VC1 A;  3OW2 R;  3R7B B;  2V6A A;  1WOP A;  2M2B A;  3G8S A;  1TFY A;  4NLP A;  1T94 A;  2OJ3 A;  1Y5I B;  2WVC A;  4ID5 A;  1R8C A;  1X4G A;  5HSP A;  3FRY A;  4K4T A;  3OXG A;  2FZC B;  2VDI A;  1YHQ S;  1ZM9 A;  4X4Q A;  4DQS A;  2CQI A;  4A48 A;  4HT5 A;  2MJU A;  3IBC B;  1WC5 A;  3HVW A;  2KYZ A;  3D6T B;  2Q43 A;  3R2D J;  3NNA A;  4K50 A;  2DXD A;  1LWE A;  1RT7 A;  1RDR A;  3MMJ A;  2WW4 A;  2KXF A;  2BMB A;  1Q5Y A;  2NSC A;  4LBP A;  4XIU A;  2D3O R;  1AA1 B;  3SMZ A;  1UEV A;  3HFK A;  4ZP8 A;  2DR7 A;  3U1N A;  4WE1 B;  5T41 A;  1Y9O A;  1NKE A;  1N6Q A;  2EC0 A;  1ZZF A;  1JLC A;  2DY1 A;  3DYA B;  3A12 A;  4WYW A;  3DDK A;  4N8N A;  4ENO A;  4QYZ J;  1URR A;  3VVT A;  4O4G A;  3R5C A;  2QLX A;  2C2K B;  1U1L A;  1KFD A;  4C0O C;  2POK A;  1UFW A;  3DI6 A;  3VGU A;  4UQG A;  1CVJ A;  2C42 A;  2EEY A;  2F65 A;  1TAQ A;  1KVI A;  1FX4 A;  3ICL A;  4JI7 J;  3FFI A;  4F3Q A;  1RGV A;  3QRQ A;  1FNX H;  5EX3 A;  2IY5 B;  2NPI A;  3OTO F;  2C1E B;  4RW9 A;  2XGP A;  3VGS A;  3NBP B;  1IKV A;  3C46 A;  3TJ9 A;  5IT9 Y;  2CZ9 A;  2W2Q P;  2YNI B;  1TUV A;  4B02 A;  4NI2 B;  4DSE A;  2QMW A;  4EO8 A;  3A8K A;  1DBD A;  3US5 A;  3Q24 A;  2AEM A;  2YH1 A;  2MZS A;  3BN7 A;  1I94 F;  4W4M A;  2BJ9 A;  1S72 S;  2B43 A;  3IBW A;  1S10 A;  1FKA F;  1NH7 A;  2AJ0 A;  2XSJ A;  1AT1 B;  1MML A;  5BJR A;  5IM0 B;  1RAO A;  4URS A;  2GA7 A;  3OLA A;  2V8H A;  1I1G A;  4M5D B;  3ZTR A;  2IMW P;  3X1L B;  3D1Q A;  4YS2 A;  5DG9 A;  2RB7 A;  2AP6 A;  3CDE A;  2VIC A;  2V50 A;  2RE1 A;  2LEB A;  1R89 A;  3RW6 A;  2ALZ A;  2CZ4 A;  5CCL A;  1VFJ A;  4IFY A;  4QR0 A;  3E2E A;  3DU6 A;  3T3F A;  1UPP A;  2D74 B;  4WJB A;  3PEJ A;  2ATC B;  3U7J A;  2HS0 A;  4DS5 A;  1F9H A;  4ZP7 A;  4OX9 J;  1IKX B;  4Q8F A;  2VG7 A;  1V5I B;  2QIF A;  4XAK A;  1GTH A;  4ZVS B;  4BS2 A;  3KTQ A;  2M70 A;  4J9N A;  3Q8P B;  2ZBC A;  1AYE A;  3W2V A;  4C8Z A;  2HGM A;  2X1F A;  1YRT A;  2J7W A;  4G1Q B;  2DGX A;  2HFZ A;  5DG7 A;  4RWX A;  4OZ5 A;  2ZH6 A;  4ES1 A;  5DDO C;  3C15 B;  4P2F A;  5CYM B;  3E01 B;  3UCG A;  1PYS B;  4X4S A;  2RQ4 A;  4LFC F;  3RBD A;  1NSK L;  1T3O A;  2Z56 B;  2G1H A;  1M90 T;  4DUY F;  3RB0 A;  4QWB A;  5JVH Q;  4DV7 J;  3R97 A;  2GVZ A;  1FRX A;  3GON A;  3N6N A;  3KK1 B;  5JUM A;  3J81 j;  1ZAX A;  3LAN A;  1NDP A;  5DLG A;  4V19 J;  2DY9 A;  4RW8 B;  2UUB F;  2WW8 A;  1M5H A;  4HL9 A;  2ZNY A;  1D8Y A;  1VCT A;  1U25 A;  4N8O A;  3OFE A;  2MGZ A;  3PYE A;  4DR2 J;  2GMJ A;  3PRV A;  2RHS B;  4GKK J;  4IH7 A;  5LM7 E;  5F8M A;  3PYF A;  2P9C A;  2DBB A;  4ZN1 A;  3D5M A;  3V5R A;  3M9O B;  4DV4 F;  3THT A;  3PFO A;  4FP9 A;  1V3S A;  1P6T A;  5ETP A;  1UFK A;  2ZUA A;  3GV7 B;  4PKD B;  2I5J A;  4G1I A;  4IKA A;  5IWA J;  3K7R A;  2WON A;  4ZVP B;  4I1T A;  1FRL A;  1HQU A;  3HHL A;  3G82 B;  2QA2 A;  2DEJ A;  2ZE2 B;  5J1P A;  5FJ4 A;  3ILJ A;  4IDK A;  3TR5 A;  1RT4 B;  3GPA A;  4RBV A;  2QA1 A;  2BV3 A;  4DQR A;  4F4K A;  3QPI A;  5AE3 A;  5I42 B;  2PI5 A;  3Q2T C;  5EX0 A;  4E8U A;  3BH6 B;  3OSP A;  1YWX A;  5A0Y A;  4OX7 A;  1VYA A;  2XZD B;  1QE1 B;  3ET6 B;  5AJ3 F;  2AX1 A;  3GYN A;  1TL1 A;  3C66 A;  3T5L A;  1NK6 A;  2HK2 A;  5C24 B;  4NCG B;  1RT2 A;  4OYB A;  1UA1 A;  3OFF A;  2JVO A;  1VIO A;  4QU7 A;  4K59 A;  2JX2 A;  3HK2 A;  5BYQ A;  4OYI A;  4IQM A;  4PG5 A;  2RH3 A;  3DLH A;  2UVV A;  4ZIT A;  2DRD A;  3QFW A;  2CJQ A;  4GO5 X;  4FBU A;  4NX9 A;  1S59 A;  2MTL A;  3F0N A;  4OI4 A;  2YBV A;  5KG2 A;  5DQH A;  4ELU A;  4Y2M A;  3FC9 A;  4CH1 A;  3DRS A;  2HFU A;  3CCQ S;  3UR0 A;  2F1F A;  4KBI A;  3D1H A;  4A8W A;  2DH9 A;  1FES A;  1TKZ A;  4X66 J;  1ZS6 A;  3NOG A;  1IVZ A;  4MIA A;  4LF8 J;  2UXC F;  3TUP A;  3BDE A;  4ZCL A;  3C2P A;  3RW7 A;  2HMI B;  1RTI A;  1GAO A;  2YWE A;  2A2D A;  2VFR A;  2XHC A;  2RQM A;  4J9Q A;  3VAG A;  4GVB A;  5H9E J;  3CDA A;  1D9F A;  1ZBT A;  2HS3 A;  5KFP A;  4DSK A;  2DPJ A;  1RWU A;  1CJU B;  2MKH A;  5GAD U;  3GMG A;  3V4I B;  4OYP A;  5B0B A;  1NSQ A;  1ZH5 A;  1IR1 A;  2UXD J;  3WX8 A;  1NDC A;  1RTH B;  2X1G A;  5F41 A;  4I56 A;  3PW5 A;  1R6V A;  3OXF A;  4Z2X A;  3NNH A;  1WF2 A;  3MPD A;  2B4O A;  1AZS A;  2BEF A;  1J5E F;  1MU2 A;  3AOD A;  3ZFV A;  4DPW A;  1X9S A;  4DFM A;  1RHR B;  3GV5 B;  3BEG B;  3GII A;  1FK9 B;  4CYU A;  4M94 A;  4DN9 A;  4I0W A;  4ZPT R;  3V4M A;  1HWI A;  2OPR A;  4X4T A;  2HRT A;  1NPR A;  3D66 A;  5KFI A;  9ATC B;  2VPW B;  3IS9 B;  2FQQ B;  4GO7 X;  4Y2K A;  4DSF A;  2R9L A;  1NJW A;  4DQP A;  4OHZ A;  3OHB A;  4LRF A;  5IT9 U;  2B4U A;  4JV5 J;  1VQO S;  3T5K A;  2DCU B;  4LBI A;  4U8V A;  2V94 A;  2J7U A;  1VRU B;  3CCS S;  3UCZ P;  1FRJ A;  3KLI A;  3V81 B;  2W9B B;  1QD1 A;  1TKX B;  3IRX A;  2JFD A;  3L7P A;  1R8P A;  2VDH A;  2KL8 A;  4PG7 A;  5KFS A;  3THV A;  4KGX B;  1XR7 A;  4RNH A;  2XBP A;  1VHI A;  3KLH A;  1RCX B;  3G9C A;  4ECX A;  1IBK J;  3CIZ A;  3OJS A;  3NRB A;  3DGV A;  3PW0 A;  4NLV A;  5C42 A;  2HK3 A;  3W1Y C;  4QJV A;  3TA1 A;  2UP1 A;  2V63 A;  1PIE A;  4DL0 C;  2MLZ A;  3K2Y A;  5KFQ A;  2VFV A;  5HQM A;  4B9N A;  3SIP B;  1LWC A;  2HLT A;  1K9M T;  3GE9 A;  2ZOG A;  5KG0 A;  3FQL A;  4CRJ A;  3QGG A;  5KT5 A;  4CIO A;  2GVD B;  5KFA A;  1WTB A;  5IC6 B;  3A3N B;  2JZ5 A;  4OI1 A;  3HHK A;  1ZAV A;  1IKW B;  2GHP A;  3VTI A;  2VQE F;  2AV5 A;  1O6X A;  4WFN Q;  3JSM B;  2IDL A;  1RUS A;  2MSS A;  3KWM A;  4ETZ A;  1E6Y A;  3W65 A;  2OEJ A;  5DG8 A;  2AYM A;  2J8A A;  1XIQ A;  4IH6 A;  3I5A A;  2GJI A;  2QLB B;  4R8U A;  3Q23 A;  1S6P A;  3D3C J;  2L9N A;  4HI1 A;  5HK4 A;  1Z2Z A;  3CJR A;  1GTE A;  3DRP A;  3I0R A;  3RRK A;  3QSI A;  1DTT B;  2OKQ A;  1FT8 A;  3M8P B;  4I7F B;  1SBR A;  4X64 F;  4ERD A;  3SQO P;  2DNP A;  1BQN B;  1MG7 A;  4U96 A;  2VB6 A;  5T14 A;  2GHW A;  1FKP A;  4PPD A;  1FKO B;  4B3T J;  2AZ1 A;  5IC4 B;  1FDD A;  3W5Y A;  1NM2 A;  3IR5 B;  5AT1 B;  4NXM J;  2J9D E;  2ZBR A;  3OTC A;  3R6G B;  3HKZ D;  1YRX A;  1CBK A;  5CZX A;  1NSP A;  4JI0 F;  1S0V A;  4LRB A;  4ED7 A;  2JVR A;  3PYD A;  2AT1 B;  5DJB A;  1Y00 A;  4FDF A;  2XMK A;  4NYO A;  1U48 A;  1QAY A;  1LEO A;  2CNO B;  4UTG A;  3R5G A;  3T19 A;  2VOD A;  4CDI A;  2CAD A;  3DLE B;  2QA4 G;  5A8W B;  3HHD A;  1S1U A;  4YP3 A;  2DGV A;  3TX0 A;  1H2T Z;  5J1E A;  1Q8K A;  1HNZ F;  3CJK B;  1VOM A;  3R1H A;  1F9E B;  2KM8 C;  3BSN A;  4IOA Q;  3GJQ B;  2CPF A;  1CEZ A;  1FRK A;  1U1M A;  4RWW A;  4ZVH A;  3OFG A;  3EXC X;  1PCA A;  4J9S A;  3HO1 A;  3BGO P;  1RAA B;  4K0K F;  2RNE A;  2Y0B B;  3R8Y A;  4FYW B;  4A8O A;  5G0R A;  4OZ2 A;  2XS5 A;  4QR2 A;  2EC2 A;  2NUU G;  1X9M A;  1IJE B;  3VCD A;  3DM2 A;  4ZHR A;  4LR9 A;  5BXI A;  3WIV A;  1IBC B;  3GJT B;  1TL3 A;  2HZV A;  2JLF A;  4K2X A;  3GSD A;  1NEE A;  2BOA A;  5FLX U;  4I2Q A;  1BD6 A;  1B0V A;  3WC0 A;  5F8I A;  3SZ2 A;  3PEH A;  4JI6 J;  1FX2 A;  3NMA A;  4X62 J;  2MY7 A;  4NAS A;  1X4H A;  5K20 B;  4NZ6 A;  4H4O A;  3UD3 P;  3MED B;  4C97 A;  3NGS A;  3W8G A;  2J9D A;  5FDL B;  2G0C A;  4KH0 B;  1JLG B;  4KV8 B;  1S1W B;  3R5J B;  1RLC L;  4J9L A;  4DV1 F;  5D78 A;  1CPZ A;  5IXU A;  4MIB A;  2FJA B;  3VVU A;  1UVM A;  2R7Q A;  2LA4 A;  1XMQ F;  1YJW S;  4F3O A;  2YQ3 A;  3GIJ A;  2XHW A;  3ZZP A;  3MAA A;  3BH7 B;  4CH0 S;  3GFX A;  2Z30 B;  1Q95 G;  4EU0 A;  5F0W A;  3QID A;  5H9F J;  2GIQ A;  4FXW A;  3BO4 A;  3BR9 A;  1HNV A;  3UD5 A;  4DCO B;  5GME A;  5MLC V;  1B0T A;  4KY3 A;  2AKW B;  2F4V J;  4FXV A;  1HBN B;  3W9I A;  2XI3 A;  3HF5 A;  2E44 A;  1Q86 T;  1HR0 F;  1YSJ A;  2DRA A;  5GVQ A;  4YB7 A;  1UKU A;  1Z2L A;  3SFG A;  2J0W A;  3THP A;  3QIP A;  1UCN A;  1KOO A;  5KFL A;  2B7B B;  5LXR A;  1HA1 A;  2HQ3 A;  2QSF A;  2HUR A;  1PC5 A;  5F0U A;  2UV8 G;  3ETO A;  2OMO A;  2COL A;  2OSR A;  4OYM A;  3OL6 A;  1T9U A;  3LP2 B;  4YEA A;  1UWB A;  1WI8 A;  4M5J A;  3K58 A;  1KSP A;  3CUL A;  2E29 A;  1K44 A;  1M5P C;  1TUG B;  4FNH A;  4PWD B;  2RF2 A;  4C3K A;  3Q0A A;  4X65 J;  3P45 B;  3OHA A;  3PHE A;  3ZZR A;  1OY9 A;  2D9O A;  1QY7 A;  1DJ0 A;  2VHG A;  4KO0 A;  4K4W A;  3MEE A;  5KFF A;  2RML A;  3V6H A;  4C3L A;  4MFB A;  2WSC C;  3OFH A;  1X60 A;  4X4V A;  3GG0 A;  3NGU A;  4K8R A;  2JC0 A;  1QDU B;  1SC4 B;  5C2C A;  1H98 A;  4Y34 A;  1RP5 A;  3DLL Q;  4ZP6 A;  5B0E A;  4DF8 A;  2Y3Y A;  4JI8 J;  1CUL A;  4IO1 A;  1YDL A;  1APS A;  3I55 S;  2QSW A;  2DGO A;  3VR1 A;  3TVZ A;  2NQP A;  3RRG A;  2CJY B;  3T9N A;  1HBM A;  2PC6 A;  3HVT A;  2C2E A;  1HNI A;  4CH7 A;  2XEX A;  2AZ3 A;  3BB5 A;  3C6U B;  4ZCM A;  1ZPV A;  2ZD1 A;  4RNM A;  1ZTW A;  1YI2 S;  3PJW A;  2VON A;  2HFV A;  1DAX A;  2CJA A;  1A7G E;  4NYZ A;  1RJJ A;  4PAA A;  2OFH X;  4QWA A;  2E1M C;  3SCJ E;  2V4R A;  1U0H B;  3OTD A;  2ZHA A;  3ENW A;  3G6E S;  2KJW A;  2KYX A;  3NS5 A;  1RU2 A;  3K89 A;  2VAS A;  1T05 B;  5DGA A;  2FYX A;  2Y0S D;  2OP5 A;  2B56 A;  1K8A T;  3UPF A;  2HBR B;  2PMZ D;  4KKO B;  2M8D B;  4KRW A;  3GP9 A;  3H4B A;  1QM9 A;  4Y00 A;  1TP7 A;  4F4Z A;  2G4B A;  1MW7 A;  4UQT A;  4YUD A;  2EFP A;  3FEY B;  3U1L A;  4CO4 A;  4MKY A;  4ZPA A;  4FKY A;  2IYI A;  1W26 A;  4X4N A;  5IQ6 A;  2R7V A;  4RW4 B;  2V34 A;  3FRZ A;  4DV2 J;  5U47 A;  3UVJ B;  2UUT A;  3R27 A;  2CQG A;  2WCX A;  1K1Q A;  4KIA A;  2MZR A;  2IBK A;  3OD2 A;  3CD5 A;  2N7C A;  1VI7 A;  2R3V A;  1H3D A;  1QUV A;  4LF7 J;  3KUG A;  2MST A;  3K59 A;  2GJ2 A;  4GC6 A;  2XY5 A;  2YNG B;  2HS4 A;  3BGR B;  3TQ1 A;  3MUR P;  4NA2 A;  2DNY A;  1NK9 A;  1T9X A;  1R3N A;  3CF5 Q;  3T1H F;  1TR0 A;  3HZE A;  3T41 A;  3QWU A;  4K4U A;  2LDI A;  5DM7 Q;  3GFY A;  1T9Y A;  1RT1 B;  2NYI A;  4JI7 F;  4X4P A;  3KDN A;  4NZ7 A;  2RUS A;  4MIW A;  2OPQ A;  1VBZ A;  3W63 A;  5LXY A;  1KQF B;  2KG1 A;  4AYB D;  1RIS A;  1KQK A;  4OFZ A;  1O51 A;  5K8M A;  3JS9 A;  5EWE A;  2JL9 A;  4AE5 A;  1JLB A;  1S1T B;  1TMM A;  4P72 A;  1IUJ A;  3J81 Y;  4RU2 A;  1FEH A;  1FJC A;  2DHA A;  2E5L J;  3L3C A;  1WDT A;  4C8K A;  1CJV B;  1OPZ A;  4LR8 A;  4NLY A;  5CHC B;  2OD4 A;  1WKK A;  2GIR A;  3DRR B;  2F4F A;  4OV6 A;  1X5T A;  1VRT B;  3M8Q B;  4RW6 A;  2RIL A;  1M5S A;  1WEL A;  4J5O A;  1SC3 B;  3I4P A;  2HZA A;  5FD1 A;  3BGU A;  4ELT A;  1HWJ A;  2HHQ A;  3CCJ S;  2RRB A;  1D1U A;  3ZTS A;  4KAI A;  3CDB A;  4FNI A;  2XYH B;  3HT3 A;  3RG6 A;  4ED4 A;  2MKJ A;  1JLF B;  2PFD A;  2KKH A;  1JLQ B;  4ZLN A;  3LQV A;  4CLP A;  2DCL A;  5DQI A;  2FIU A;  3OVS A;  1UEU A;  3GFH A;  1HQE A;  3CCM S;  2FHK A;  3D0G E;  4RUH A;  2MHE A;  1RHM B;  1H38 A;  2WSE C;  1MN7 A;  4RW7 A;  3UNG C;  4KGK A;  3JB9 k;  1LWF B;  1FXL A;  1ARO P;  2V8P A;  3RAX A;  3BGL A;  2RVJ A;  3N6L A;  2A18 A;  4J37 A;  1T9T A;  3E3X A;  2X3G A;  2ASD A;  5E41 A;  4LF2 A;  3TW0 A;  2RS2 A;  4KE5 A;  1U4B A;  3GR0 A;  3M2R B;  1M5K C;  1F1B B;  4IG3 A;  4P2M A;  2QN6 B;  2WBM A;  4NOH A;  5KG5 A;  4OQJ A;  3FMB A;  1JJC B;  1DQ8 A;  2NPF A;  4O3N A;  4ECT A;  5CD4 A;  3TZZ A;  2R7X A;  2HVE A;  4O44 A;  4FN5 A;  2Y1R I;  4O0N A;  2FHJ D;  2FVQ A;  1U1P A;  5HAO A;  5J2N A;  1YJ9 S;  2K06 A;  3KK3 A;  4RR5 A;  3EZ5 A;  1YZ6 A;  4LFA J;  3DFE A;  2KT5 A;  4OZN A;  2VKZ G;  1RHU B;  2U1A A;  3MUM P;  3JSY A;  1SL0 A;  1NKB A;  4K7Q A;  4CT9 A;  3AD7 C;  2OHD A;  3B82 A;  1ULR A;  3ONQ A;  1QAX A;  1S7I A;  3M9M B;  2R7W A;  3ISN C;  2EKN A;  2QC3 A;  4WWS A;  3DRY A;  3H5Y A;  3QAU A;  2PN6 A;  4YDD B;  3Q89 A;  2HHT A;  3RAM A;  2VOP A;  3IR6 B;  2BVZ A;  4YQW A;  2IC3 B;  4A8M P;  3I31 A;  1OY6 A;  2R7S A;  3ZZO A;  3NS7 B;  1OPI A;  3SBM A;  5CD4 H;  2HVH A;  3QGP A;  1U8S A;  1LWX A;  4B3R J;  2RHQ B;  4DS4 A;  5L46 A;  3EJM A;  1UL3 A;  4WE1 A;  1ROF A;  5J2Q A;  1L3V A;  3K5P A;  4NWB A;  1UVJ A;  1F5B A;  1M0S A;  1I5O B;  2K8G A;  4M5K A;  1CJT B;  3QBC A;  1T0T V;  4LF9 F;  4ZJO A;  2QV6 A;  5CAB A;  1IQT A;  1N34 J;  4USV A;  2Z58 B;  2ATL A;  1HBU B;  4LIR A;  1TL7 B;  1WOO A;  1YKW A;  3IWN C;  2RQK A;  4JV1 A;  1SJ3 P;  1RWV B;  4NRU A;  1I94 J;  3MEC B;  1VR6 A;  2OFG X;  1XMO F;  1U02 A;  2QYG A;  4UST A;  3TEH B;  3JTN A;  2E7V A;  3NBP A;  3N0V A;  4N47 A;  1FE4 A;  2JH3 A;  1YBT A;  4M95 A;  2I8E A;  3IRW P;  2L41 A;  3GIL A;  2YNI A;  1HWU A;  1FTR A;  2VBY A;  4NI2 A;  4MYT A;  1NJY A;  4FF4 A;  4PG6 A;  3HM9 A;  1RSC A;  5HJX A;  2CPZ A;  3MEG A;  1KP6 A;  1R31 A;  1RWP B;  1IN0 A;  4DPY A;  4ES3 A;  3TUJ C;  2HRU A;  4NMX A;  4AND A;  4WTY A;  3GIM A;  2OSQ A;  2Z0G A;  3ETM A;  2V68 A;  1HBO A;  2BZ2 A;  1S97 A;  3LPE A;  5C5J A;  1QTM A;  3G2X A;  5IM0 A;  2MY8 A;  2UU9 F;  2PDA A;  2F9J A;  1KHW A;  2J9E A;  3CNQ P;  1NJX A;  3B78 A;  1NKC A;  4FVM A;  1Y5L B;  4KFB B;  1F2G A;  1TK0 A;  3HSZ A;  4CTA B;  2R8I A;  4M1K A;  5JJB A;  2CPE A;  3LH2 S;  3MAQ A;  2DGQ A;  3HX9 A;  3CC2 S;  4H54 A;  3DOL B;  4HHU A;  5HVH A;  2HND B;  5KG6 A;  4OYZ A;  2RDJ A;  5MAO A;  4IRC A;  3SEO A;  2MKY A;  2ZZN A;  1NK8 A;  2UVU A;  3G6Y A;  4OL8 A;  1PJ5 A;  3IN5 A;  4ETX A;  2QT7 A;  4ECQ A;  5F3Z A;  1NO8 A;  2VUG A;  4QWC A;  4IOB A;  3KMQ A;  2GGP B;  4CLL A;  4RO0 A;  2R4F A;  3OPK A;  1K0V A;  4OMF G;  1Q53 A;  2CJX B;  2OO4 A;  2BX6 A;  2DHG A;  4LFC J;  2UXD F;  4I2P B;  4X84 A;  1RTD B;  3MPV A;  2CPY A;  3DCA A;  8ATC B;  2C2Z B;  1RAF B;  1IBM F;  3N5F A;  4MK9 A;  4DUY J;  5F9N A;  2AF6 A;  4DPT A;  2UUA F;  4NLQ A;  4QWE A;  5I3U A;  2LYV A;  1I3O B;  1S6O A;  1GMU A;  3C15 A;  2IFX A;  3UDV A;  3E01 A;  2FLN A;  2B9W A;  1NAQ A;  1IBL F;  2BRL A;  2KHC A;  2OPS B;  2F8H A;  2VQF F;  2B5J B;  2UUB J;  3C14 A;  2VJU A;  4C8N A;  3Q86 A;  2RDD A;  4DJB A;  2AGQ A;  3BSC A;  1NK4 A;  2HHP A;  2X1B A;  3HFV A;  3I0S B;  1U1N A;  5B08 A;  1Q7Y T;  5IZH A;  2CVE A;  4P71 A;  3JTO A;  2B9E A;  3CDW A;  1PYT A;  4RW8 A;  4E2F B;  3L09 A;  2KU7 A;  4I6Y A;  2IAJ B;  2DVI A;  3BJY A;  2KO1 A;  4TLR A;  2C28 A;  1S1X A;  1WSV A;  1RBO B;  1VLY A;  3BQ0 A;  2MXY A;  1VK8 A;  5ITH A;  5K8O A;  3DLK B;  3TYT A;  2MKI A;  1EZZ B;  2YNH B;  4CZC A;  4NYP A;  7FDR A;  2KB2 A;  3DHW C;  2QL9 B;  1QAI A;  5SUH A;  1XN9 A;  2LP4 A;  4UY8 5;  1WG4 A;  5GAD I;  4YR3 A;  3GQC A;  3WQP A;  4ZK7 M;  3HKW A;  4I67 A;  2CVI A;  3I82 A;  5JXS A;  1UEK A;  3EGN A;  1UET A;  2IVM A;  4LF6 F;  2FVP A;  3ULH A;  1VMB A;  3HPO A;  3G82 A;  3PY8 A;  1KKH A;  2PO4 A;  2ZH9 A;  2IM2 A;  4EYH B;  3SQG B;  3OR1 B;  1TTH B;  1RT4 A;  1NK5 A;  1AW0 A;  4TU7 A;  3TEG A;  4F0K A;  2EG1 A;  4ITS A;  4NLT A;  4EEY A;  4DR7 J;  5I42 A;  3AB4 B;  3MD3 A;  4XDC A;  3JTP A;  5AXM A;  1NPK A;  1TKT B;  2WK4 A;  2ZIT A;  3QNW B;  1NH8 A;  2W2O P;  4DV0 F;  1QE1 A;  4OJ1 A;  3QJL A;  1N5Y B;  1HPZ A;  1R0C B;  2IYG A;  2XZT B;  1RYR A;  2J0S D;  3TNV A;  3ZC4 A;  3M2V B;  2ZWP A;  2AEF A;  1UJ4 A;  2AGP A;  1DTQ A;  3H7H B;  1C1C B;  2UXC J;  3CCT A;  4M5I A;  3BV8 A;  2AWZ A;  2FY8 A;  2HBZ B;  2UVR A;  3ILL A;  1FDN A;  2V2K A;  4OYO A;  3MM9 A;  5C25 B;  1VQP S;  4L75 A;  2DRB A;  4EGL A;  4EK2 A;  2FHM A;  4U8Y A;  2JNJ A;  2AIR B;  3BKU A;  3EUN A;  2DGW A;  3TZY A;  3CMQ A;  2GO8 A;  3D0I E;  2BR0 A;  1RWX B;  4KPC A;  2DHH A;  1HD1 A;  2HMI A;  2HQG A;  1NHK L;  4DR6 J;  3BRE A;  2PA8 D;  4CO2 A;  3TAN A;  1WEZ A;  3M7V A;  3PIP Q;  2ZJP Q;  1J5E J;  1T9W A;  1S48 A;  4Z37 A;  2KVI A;  1JKH B;  2DNO A;  3V4I A;  2XCA A;  5L1L A;  3IAM 9;  2VIH A;  4QIV A;  4WPA A;  4WFA Q;  2ILZ A;  2M8H A;  2MJN A;  1U6F A;  4V19 X;  3KHH A;  2M5Y A;  3LAK A;  4Z7Y A;  1ELO A;  3M8Z A;  2K1R B;  2CUY A;  1IQZ A;  4A8Q A;  3LGM A;  3HD1 A;  3DOM A;  3TA0 A;  1KQS R;  4DL4 A;  4USU A;  5DRK A;  3CD7 A;  2WVB A;  4DL3 A;  1VC6 A;  3EDQ B;  2JLG A;  1FK9 A;  4BCA A;  2VFS A;  2PT0 A;  3D68 A;  3NP5 A;  2LMI A;  1DAR A;  1Y5N B;  3H2U B;  3GYG A;  3IS9 A;  4Q7A A;  3HJF A;  4FXD A;  3KJQ B;  2XLK A;  2YTC A;  2BE9 B;  1OS5 A;  3QRR A;  2HAF A;  4WP8 A;  5DZ6 A;  2WVD A;  5CAA A;  1FFW B;  1RAJ A;  3MM8 B;  3W62 A;  5DM6 Q;  2DIS A;  2WVF A;  1DRZ A;  4P7V A;  2LXU A;  4Y0F A;  2NS1 B;  2KXN B;  1HI8 A;  1U24 A;  1R0A A;  2N3L A;  5IS2 A;  3PRD A;  2HZC A;  3D4J A;  2VC0 A;  1EAY C;  1TKX A;  3LF0 A;  1KN6 A;  2XMM A;  5HI7 A;  3ZTP A;  3Q8R B;  2CPH A;  4AQY J;  2EFV A;  1UVL A;  5DO2 A;  2Z4P A;  3HVA A;  4YY3 F;  3K57 A;  5HLF B;  1KQG B;  4FYV B;  1KEK A;  3PX6 A;  4L3N A;  4OI3 A;  3PW7 A;  3JSR A;  3NCP A;  3OV7 A;  1U26 A;  2DNZ A;  4BWM A;  3CVK A;  4OHY A;  5A8R B;  1S9G B;  4X62 F;  4Q2L A;  5A2Q Y;  3OL9 A;  3R7S B;  2GQ2 A;  1HL6 A;  4USH A;  4AFF A;  2J0Q D;  2P9E A;  2V4J B;  2ACY A;  4EYI B;  4PRF A;  2G1D A;  3HI9 A;  1DLO A;  2EXU A;  3AH6 A;  5KFR A;  3ILO A;  3HFZ B;  3CCE S;  1K0T A;  3CO9 A;  1IKW A;  2ROG A;  1B4S A;  2VFU A;  3MEK A;  2N3O A;  3CJ0 A;  2VG6 B;  4IH5 A;  3PG9 A;  4DV5 J;  3KKF A;  2QA4 S;  1HWK A;  4URG A;  4EZ9 A;  2DXF A;  4ID5 B;  4P2X A;  1SKW A;  3O6Q A;  2CQ1 A;  1GMW D;  4QW9 A;  4B17 A;  2KT3 A;  1YTY A;  2FJW A;  2HRY A;  3C16 B;  4KC5 A;  1A6L A;  3PFE A;  4KHP F;  3M8P A;  1NZ8 A;  1LNQ A;  3Q8S B;  3VQT A;  2NXN A;  3QJJ A;  4JI0 J;  3VZH A;  3QZ7 A;  2WRM A;  1BQN A;  1R27 B;  1YGY A;  3QWP A;  3TJ8 A;  3PV8 A;  3IGV A;  3I5B A;  2LCW A;  3NMR A;  2MB0 B;  2ADC A;  2H4Y B;  1RK8 A;  4DFJ A;  2Q66 A;  4X65 F;  1RQ0 A;  2OEL A;  3GG1 A;  1UAW A;  3M05 A;  1Q4R A;  4UY8 T;  5B09 A;  2Q6C A;  5B0C A;  1B0P A;  3KYL A;  3I5C A;  4O3O A;  1RWW B;  4J9V A;  1SJQ A;  3M8S A;  5B7W A;  4JI4 J;  4ED1 A;  2FJX A;  1IR2 A;  1L5U A;  2HHH F;  1HMV A;  2YNF B;  2CNN B;  4B08 A;  3DLE A;  4NZ0 A;  2VPY B;  2OEK A;  3TAR A;  1B64 A;  3LUY A;  3KJV B;  5EN1 A;  3G86 A;  2ROE A;  2I9S A;  1G2E A;  5HO4 A;  4DUZ J;  3J80 U;  4OI0 A;  3MPY A;  3CME S;  2J6S A;  2V9K A;  4ZN3 A;  2DT9 A;  2BDP A;  3FEX B;  5F3T A;  3ZTO A;  1RB0 A;  1Q16 B;  1DY3 A;  5KFN A;  4R25 A;  1X4B A;  2PE8 A;  4JI5 J;  5GAH I;  1FTC A;  4NML A;  2OH2 A;  4DR4 F;  2XSJ B;  2A3J A;  2N4D A;  3P4U B;  4H4K C;  2YVS A;  1FEE A;  8AT1 B;  2GNK A;  4FF1 A;  2P9G A;  2VOO A;  1BUX A;  2Y8W A;  2J76 E;  1FA0 A;  2HWH A;  2GO9 A;  2NYH A;  1WC6 A;  4U7C A;  1LFP A;  4J9O A;  4C98 A;  2NZC A;  2QX0 A;  2RDI A;  3OVA A;  4ED3 A;  3G6V A;  1C1B B;  1MWZ A;  4DV1 J;  4B9V A;  1RHQ B;  3PO4 A;  3OSN A;  4Q45 A;  5DS7 A;  2HIY A;  2M7S A;  4PZV A;  4ILM A;  3MED A;  4DQQ A;  4KJI A;  3B4D A;  2ALY B;  3MPW A;  5FDL A;  4DSL A;  4NCA A;  2W4P A;  4CO1 A;  1M5V C;  4ZLP A;  1S1W A;  3G96 A;  5AE2 A;  4U7U D;  2Y8Y A;  1M5O C;  2FY1 A;  4LF7 F;  4LRC A;  2PFF B;  5SZT A;  1FJE B;  2GJF A;  1RAI B;  3ZXW A;  4RNF A;  2W9C A;  4KYZ A;  1HR0 J;  4J90 A;  2XZW A;  2V5H G;  1U1K A;  4D3G A;  2R2T A;  3PTW A;  1PIL A;  3CJT A;  4ZPV R;  2VA3 A;  1GNK A;  5KTQ A;  4MTP A;  2LVW A;  1N36 F;  1VQ4 S;  2XI2 A;  1EQ0 A;  2YX1 A;  3GFZ A;  4DL5 A;  1LQ9 A;  3NWG A;  3MFI A;  3PO5 A;  1N48 A;  2K3K A;  3CCU S;  2CG4 A;  4ZJQ A;  2DR5 A;  3FSX A;  2HQC A;  5KOX A;  1U1R A;  3PJX A;  4EMD A;  3M1V B;  1J5O B;  2MKS A;  2GX8 A;  4OJ3 A;  1HAR A;  1MRO A;  3H4D A;  1KRP A;  4KTQ A;  2CKW A;  4W90 B;  4U6P A;  1N5T A;  2OTL S;  3LP2 A;  4M5N A;  1JLE A;  4RUC A;  3MM6 B;  4ANC A;  4PWD A;  2WSF C;  5CYJ A;  4WTO B;  3MM7 B;  4QCL A;  5F8J A;  3ISZ A;  4B9S A;  4LBH A;  2I5J B;  2WON B;  4K2J A;  3RBE A;  1HQU B;  4X4U A;  3TOQ A;  2B8P A;  4MJK A;  2RRN A;  7AT1 B;  1BQM A;  1N0U A;  3M30 A;  4DR1 J;  3DXS X;  1BGX T;  2H3E B;  4NLR A;  3VAJ A;  5L9X A;  2FC9 A;  4NLU A;  2QTW A;  2FDN A;  1HKA A;  4U95 A;  3BQ1 A;  3J7Z T;  4TYA A;  3M2U A;  5A2Q U;  2B4P A;  2CPX A;  4PWW A;  1VC0 A;  5A0Y B;  3AA8 A;  3WDO A;  1U0S A;  2V69 A;  1TL1 B;  4LSN A;  3HSJ A;  4QPT A;  4CO3 A;  3UN5 A;  1RT2 B;  2A2C A;  2VZ9 A;  5F8H A;  1YRU A;  1D9D A;  3HLU A;  3K17 A;  2LU2 A;  2CNK B;  4J9P A;  3M8R A;  4YR2 A;  5HMY A;  1H7W A;  5GAE U;  4ZVT B;  2DPI A;  2CIM A;  1PJ7 A;  4V1A k;  3DRS B;  4LFA F;  4DG1 B;  3QLH B;  4CM2 A;  1WTF A;  3MMC B;  3CDU A;  1XNQ F;  3BSO A;  2Y9H A;  4KKO A;  3IWX A;  4ZVG A;  3D54 A;  1TZ0 A;  3TZW A;  1XNR F;  4OYX A;  3M32 A;  1RT6 B;  1RTI B;  2YPZ A;  2UXB F;  1X8D A;  2ZNZ A;  4U9R A;  1DHM A;  1XJW B;  2EBG A;  1VQM S;  3W9J A;  2UZA A;  4I4B A;  2BBE A;  3UVJ A;  2KZZ A;  3OTE A;  5ADZ A;  2EFG A;  2DGU A;  3LP1 B;  5ETT A;  3T1H J;  4WIQ A;  4PCQ A;  2RKI A;  2X3D A;  5H9F K;  4K5R A;  3EZO A;  4B3R F;  3VHQ A;  1VC5 A;  3N5B A;  2YKQ A;  1AZS B;  3P5T L;  2HW3 A;  3K5N A;  4EZ6 A;  3BGR A;  1S57 A;  1RAD B;  2B8Q A;  5E3R A;  4NEZ A;  2RQC A;  1TQL A;  3CD0 A;  4RNN A;  3EXY A;  4OHX A;  1N34 F;  4ICL B;  4CYU B;  4IO9 Q;  2DR9 A;  1RT1 A;  2I1R A;  1MWY A;  2N7Y A;  1TL4 A;  1BLU A;  2ZJQ Q;  4R0J A;  1WEX A;  2VBW A;  3MOZ A;  5HMZ A;  4RU9 A;  1LFW A;  3TUZ C;  1MMN A;  2XWX A;  5K8N A;  4DSJ A;  2YKN B;  2DO0 A;  5RUB A;  2PEH A;  2P2C B;  3JQM A;  1KTV A;  4ZA1 A;  1Y3K A;  1T03 B;  1FFG B;  2JEG A;  3KLI B;  4Q5V A;  3A1Y G;  4HDG A;  4LT6 A;  4CI0 B;  2IRU A;  4I6W A;  4ILL A;  3DRR A;  4MT1 A;  1VRT A;  1RAG B;  5D3G A;  3M8Q A;  2C2O B;  1YJN S;  3AOA A;  2I2Y A;  4B9M A;  5L1J A;  5C42 B;  3ELH A;  3MUT P;  3VV2 B;  4CCH A;  2L9D A;  2KG0 A;  3IG1 A;  5ETL A;  2ADB A;  3H59 A;  3FSY A;  1LWC B;  2F40 A;  1EB0 A;  4CM0 A;  3FQK A;  4PYA A;  3BN4 A;  3KLE A;  2H54 B;  2BW2 A;  3VAK A;  3N4W A;  1R8H A;  5DGB A;  3ENQ A;  1T95 A;  3P5B P;  2IIH A;  3GJR B;  2XY6 A;  5CCM A;  1LWF A;  2MEW A;  1WDD A;  2CQ0 A;  5DQG A;  1VBY A;  5M2U A;  4JI2 F;  3UFC X;  1YBA A;  3KHL A;  3R5A A;  1VQS A;  2CQ4 A;  1E6Y B;  1UVK A;  1NB7 A;  5KFO A;  1U2R A;  3M2R A;  3T5H A;  2VD3 A;  4TQR A;  1A9N B;  2ZHO A;  4Q44 A;  5C2G A;  4R8U B;  2XLI A;  3OT9 A;  3N6M A;  1QSY A;  1WOS A;  1X0P A;  4CLF A;  1RU1 A;  2NXU A;  3T9Z A;  2GCF A;  3H25 A;  1RAE B;  1EKR A;  4K4Y A;  2SXL A;  3DRP B;  3CWJ A;  4Q8E A;  2CWX A;  4C11 B;  1UMJ A;  3HMJ G;  2VJV A;  4R5P A;  2FJV A;  5LT5 A;  3HHL C;  1XC9 A;  2A6M A;  1AUD A;  3FK4 A;  3RGI A;  4OV1 A;  3MM5 B;  3CD6 S;  1YQH A;  2XYP B;  2L9W A;  1W2I A;  4DX5 A;  1RHK B;  2RU3 A;  2AYG A;  3VAF A;  3D7S B;  3EGZ A;  3TAM A;  2NXE A;  2E1R A;  4IRK A;  4DN0 A;  3HHL D;  2JRS A;  2BA9 A;  1VIS A;  4TU9 A;  2BRK A;  1GT8 A;  4LQ9 A;  5HVF A;  4ILR A;  4HH1 A;  2MQO A;  3ZZT A;  3R9L A;  4LF9 J;  3MR3 A;  1W7W A;  2XNR A;  2RAQ A;  1VIX A;  3QYY A;  6FD1 A;  2P6S A;  1IWG A;  4UOF A;  1UP1 A;  1AFJ A;  1FFS B;  1RCO B;  4WBF A;  1XMO J;  4ZIV A;  3X3U A;  2W2M P;  5HMX A;  2ILY A;  4C2M A;  1U09 A;  3M6V A;  1RWM B;  4L3K A;  3FSI A;  1WOR A;  4KT0 C;  4DL2 A;  3P96 A;  4J9M A;  4P74 A;  1HBU A;  3MCS A;  1TL7 A;  4JUZ A;  1DZ5 A;  1HD0 A;  4F2R A;  3MEC A;  3QQC D;  5F8N A;  1NK7 A;  1UVN A;  1UA0 A;  3ZZZ A;  5FLX Y;  3CJQ A;  1O8B A;  4DR7 F;  1TVR B;  2UU9 J;  3DM2 B;  2W9A A;  4M63 A;  3ENA A;  4ZHR B;  5HAT A;  2DNN A;  1QJH A;  1G1X A;  2MQL A;  5I3P A;  1FER A;  3RAQ A;  4QIW D;  1VS3 A;  1OO0 B;  2DNK A;  2A0F B;  5D4O A;  3AFG A;  4I2Q B;  3CE8 A;  2BYC A;  4GMK A;  4F04 B;  4B3S F;  2XTJ P;  2FGO A;  5HN0 A;  3CC7 S;  3MR2 A;  4KB7 A;  5DZ7 A;  5D0H A;  3MAH A;  1NCL A;  4OI2 A;  2C3U A;  2KM8 B;  2BJ3 A;  4CTA A;  2CFX A;  3GCX P;  2A1B A;  3S01 A;  1S7H A;  4WCE Q;  2QL7 B;  1NHU A;  2DH7 A;  2ZEJ A;  4LIW A;  2HND A;  4IQX A;  4K4S A;  4GKJ J;  3CJS A;  1QLN A;  1MNE A;  3EGW B;  4DR6 F;  1IBM J;  2ZH4 A;  3SFU A;  1X9W A;  2RUG A;  9RUB A;  2ABY A;  2UUA J;  1ZM2 A;  3MAA B;  2D69 A;  1IKY B;  4OX6 A;  3NGD A;  3T6B A;  4FF3 A;  4LF1 A;  2GGP A;  2G13 A;  1XER A;  1T7P A;  5IT0 A;  1C0T A;  1IBL J;  4HEA 9;  1HFE L;  4OJG A;  3TA2 A;  4F26 A;  4I2P A;  2ZZT A;  1VQ9 S;  1RTD A;  2VQF J;  4OLP A;  2IM1 A;  3S6E A;  1C0U B;  4ZVU B;  3WHI A;  1WC1 A;  4AL6 A;  4ECZ A;  1TK8 A;  3UWT A;  3NWR A;  2D3Z A;  1JXV A;  1SKR A;  4P10 A;  5KFM A;  1UJ6 A;  2Z2M A;  1F2H A;  1VK3 A;  1JK9 B;  4DDF A;  1ZYQ A;  1XR6 A;  3BBF A;  3QIP B;  4I68 A;  4OYA A;  3BPS P;  5KG3 A;  3T1Y J;  4ID8 A;  3HVR A;  2B5J A;  4C8O A;  5KFJ A;  4WFX A;  3QO9 A;  2CQ2 A;  2V9W A;  4TLQ A;  2AGO A;  2ZKU A;  4RNO A;  3FBE A;  3P8B B;  1X5O A;  2RF2 B;  2AMC B;  2LQ5 A;  2ZC3 A;  2EK1 A;  3D28 A;  4WZQ A;  3BYP A;  1Q78 A;  2V2V A;  3W60 A;  3I9V 9;  4J9U E;  3KG1 A;  3MEE B;  3ZNU A;  5KFU A;  2B51 A;  2BJD A;  2DGS A;  2ROP A;  1KON A;  4JV2 A;  4LF6 J;  4F0M A;  1NDL A;  4AQY F;  4LRE A;  3A8I A;  5EHH A;  2EFN A;  2XMA A;  3V6K A;  1FNM A;  3DHX A;  5G4D A;  4IR9 A;  5THW A;  1CUL B;  4F7V A;  4KHR A;  3DDN A;  4TYB A;  1CS4 B;  3QZ8 A;  1AXQ A;  4QYR A;  4E0D A;  1HBM B;  3HUL A;  3GLJ A;  4L74 A;  2GV1 A;  1B3T A;  4PUO B;  3HVT B;  2AEJ A;  2NSB A;  4C4W A;  4BDP A;  4NLX A;  5DET A;  5T7L A;  3V6D B;  3SSQ A;  4DV0 J;  2VV5 A;  3IM9 A;  2ZD1 B;  3KJF B;  4FKX A;  3CW2 C;  5KG7 A;  3MUV P;  2IJR A;  3SQG A;  3OR1 A;  4CLW A;  1RAB B;  1SI9 A;  1VJW A;  3KK2 A;  2D3U A;  3UDL A;  3GR1 A;  4YB6 A;  3TVK A;  5HP1 B;  1S12 A;  2JOQ A;  1KLM B;  4WYL A;  3CIM A;  1K73 T;  3QSY B;  4QIE A;  3IM8 A;  3D0H E;  2Q79 A;  2E5G A;  1YJU A;  5E5N A;  1RI7 A;  4DV5 F;  4DHV A;  4JBC A;  4KGV B;  4PYD A;  3OXL A;  4WZM A;  2E5H A;  2XO7 A;  3A13 A;  1SPB P;  1IXK A;  2EI5 A;  3VZI A;  2OIH A;  3M2V A;  2VF3 A;  2AD9 A;  1HW8 A;  4HVZ A;  4XO0 A;  1C1C A;  4ZMM A;  4AD6 A;  4ZPD A;  4OZL A;  2HVD A;  3AOC A;  2KFN A;  3LPY A;  1S76 D;  3UR3 C;  4RZR A;  5C25 A;  4P52 A;  3POT B;  2ZDO A;  3GJS B;  1GK8 A;  1TU0 B;  5HRO B;  1RWK B;  3PCO B;  2QO3 A;  3JXO A;  4CLU A;  3PRB A;  3H5U A;  2YKP A;  5HJY A;  4MYU A;  1EAR A;  3JSB A;  4I69 A;  2HHV A;  1FD8 A;  1XBW A;  3MR7 A;  5ETV A;  4LVN P;  4N5S A;  2O1P A;  3DXB A;  1U2C A;  3IAS 9;  3NGR A;  3NGK A;  2B0G A;  3PM9 A;  2VG5 A;  2LXF A;  4PAB A;  4ZPW R;  3DMJ B;  2ZBP A;  3MMB B;  1EX8 A;  1JKH A;  4L72 B;  1RT5 B;  2ZM6 F;  5J2M B;  4JI4 F;  4H4M B;  3D2W A;  1Q8I A;  2YKA A;  4XPC A;  4LFB J;  5KFK A;  4GC7 A;  2HHX A;  1SC6 A;  5KFW A;  4PWU A;  2HGN A;  4NA1 A;  3HD2 A;  2D7S A;  1NJZ A;  4QU6 A;  1U1O A;  2ZH1 A;  4DUZ F;  2I6W A;  2QZ8 A;  3L7U A;  1RTJ A;  4CLZ A;  1M1H A;  2XMV A;  4F4X A;  2J5A A;  2WBR A;  4TKT A;  4A8K A;  4JI5 F;  1C4C A;  4NPO A;  1F3V A;  4RW6 B;  1VDH A;  3WC2 A;  4CT8 A;  4G3I A;  2MQ8 A;  4YY3 J;  3W5X A;  3LGN A;  3MM8 A;  1GH8 A;  2VH7 A;  3CCL S;  1EQM A;  3JQK A;  2WTF A;  2ZOM A;  1PGZ A;  4LSL A;  3B8H A;  5CQG A;  1JB0 C;  2F9D A;  4TNO A;  2JC1 A;  1BQX A;  2C3Y A;  5DDR C;  1RT3 A;  4RW7 B;  3NGT A;  1GFW B;  3AJD A;  1HNW F;  3M6U A;  4F8R A;  1T8E A;  4CO5 A;  5A8R A;  1WUU A;  5HQ8 A;  3RR7 A;  2O5D A;  4OZ1 A;  4DU8 A;  5E7O B;  2Z57 B;  1TMJ A;  2J6U A;  5KFZ A;  3G71 S;  3UW1 A;  3M8W A;  2V4J A;  4IG3 B;  5D4P A;  2QRR A;  2AHO B;  4OZ3 A;  4B3O B;  4UZC A;  1K1S A;  2P8I A;  4Q0B B;  2BXJ A;  4O44 B;  2L3M A;  5GAH U;  5E0O A;  4DL7 A;  5J2N B;  4WFY A;  3NEK A;  2KN4 A;  2LFV A;  4IFV A;  4KHP J;  2C3O A;  3TJA A;  3OUY A;  2JWN A;  2FHO B;  3W64 A;  3RJM B;  5LMU F;  4A8S A;  1HNX J;  1MSW D;  1N56 A;  4J9K A;  1Y4Z B;  3DNC A;  2B6A B;  5D4N A;  1XWL A;  2J8S A;  1IM4 A;  1YJT A;  3C16 A;  2W2N P;  4CLT A;  1BWV A;  2OGU A;  1SQE A;  4ATN A;  2VBZ A;  2W2P P;  1RYS A;  4C9D A;  1KWM A;  2J0X A;  4DLG A;  3O3L A;  5B0D A;  5CXT A;  1EJ7 L;  4QIG A;  2LEA A;  5GMD A;  4PXB A;  3H42 A;  1MLA A;  3RBX A;  1NZA A;  3CUN A;  2QYC A;  3DLG A;  4PG8 A;  1S9E A;  2HHH J;  5BR8 F;  5E3C A;  2YQ1 A;  5J2Q B;  4LF4 F;  4QQB A;  1SV5 A;  5LJ5 Y;  1NLK L;  5CYQ A;  3CCV S;  3NKY A;  1JLA A;  1VQN S;  5KT2 A;  4DPO A;  4DCJ B;  1KD1 T;  4FBT A;  1H72 C;  3IP0 A;  2J9C A;  4DR5 J;  4BWJ A;  1SB6 A;  4AXJ A;  5HBM A;  1NXI A;  4LMZ A;  1S6U A;  3PR5 B;  4DR1 F;  1HYS B;  5EUH A;  2YNF A;  3R7N B;  2HNZ B;  4WII A;  4DBQ A;  1H2U X;  1KBR A;  1EET B;  3LWM A;  4NLO A;  4XTT A;  2IM3 A;  2ZC4 A;  3KXD A;  4HHJ A;  3KJV A;  1TKD A;  3AXK A;  4DR4 J;  4GVL A;  1WC0 A;  1YX2 A;  4JYA F;  3TO8 A;  1FCA A;  3QT7 A;  2K7K A;  4IOC Q;  3MEG B;  2QLF B;  3BGF A;  3J7Y I;  3TX8 A;  3C6T A;  4ZP9 A;  3R5D A;  5KFH A;  2DIV A;  4BHQ A;  3JQJ A;  1KS2 A;  1P27 B;  4S0M A;  2HKE A;  4UZB A;  1HBO B;  3QMQ A;  4EI2 A;  4PQA A;  4DR3 J;  1QVG R;  2VBX A;  1FD2 A;  2HHU A;  2HWI A;  2OUG A;  2X1A A;  4ZJL A;  1S1V A;  4B3M F;  2CPD A;  4I6A A;  3S1T A;  4RX6 A;  2Q1L A;  3PYG A;  1OSC A;  2PEB A;  1WKL A;  4NL5 A;  2YWF A;  1JIH A;  1PBU A;  3MF5 A;  4UW2 A;  4K4Z A;  3PKY A;  2UUW A;  2J6T A;  3EVM A;  3MWB A;  2KFZ A;  1F6T A;  4WF9 Q;  4G6V B;  1SIZ A;  2BQR A;  2AW0 A;  1ZAW A;  1C1B A;  2WHO A;  3LP0 A;  3AD8 C;  5LSO A;  2G9O A;  4Y2I A;  2VU5 A;  1SJ1 A;  1LK7 A;  1RXO B;  3E8O A;  3BF4 A;  2DJW A;  4N56 A;  1SUQ A;  1S49 A;  1ZM3 A;  2CPJ A;  3DOK A;  4PR6 A;  3RTV A;  2ZH5 A;  2I38 A;  3QAT A;  3OL8 A;  4YHH F;  2W8L A;  2W7A A;  1X4A A;  4AUK A;  3H0P A;  3UCU P;  1WKJ A;  1TFW A;  3D1O A;  3MPU B;  3DKD A;  5LSL A;  4RKU C;  1ZET A;  5K14 B;  1N36 J;  4CLY A;  7FD1 A;  1BWE A;  2C3M A;  5I3U B;  2FVC A;  1JMT A;  2CG8 A;  5KG4 A;  1TV6 B;  4HAC B;  3HSD A;  4ZPC A;  1EHW A;  1N52 B;  2WOM B;  4F25 A;  3RZA A;  2P5V A;  4F36 A;  1SH2 A;  5A76 A;  3ITH B;  1WF1 A;  2HBQ B;  1FJG J;  3I4H X;  1T11 A;  1FWK A;  3C14 B;  3I6P A;  2FJE B;  3AJ2 A;  4C7Q A;  5L1I A;  3G87 A;  3MD1 A;  2GS8 A;  2CQD A;  4PPZ A;  4PQU A;  5GAE I;  3M4X A;  2QFJ A;  1H6K X;  4C0B A;  1O5J A;  3M1V A;  3W61 A;  1V5V A;  4IG0 B;  1HQ2 A;  1J5O A;  2NCK L;  2YX4 A;  1TAU A;  5D8H B;  2KVQ E;  2V67 A;  1FF2 A;  3SI8 A;  1S1X B;  2ZH7 A;  1SJ4 P;  1Y0H A;  5EWG A;  5E3P A;  3V2U C;  2P6T A;  1UW4 A;  4ZS6 A;  1ZPW X;  2K3I A;  2HNY A;  3MM6 A;  2BM1 A;  3D6M B;  3K5M A;  2PI4 A;  3MM7 A;  3FVY A;  4DOZ A;  2MQQ A;  3E51 A;  1C2P A;  3GWC A;  4JV0 A;  2HFN A;  1WAC A;  4WKY A;  2E9T A;  4RJV A;  4CO0 A;  1S9F A;  1Q8B A;  3QT5 A;  4EO6 A;  4ECV A;  3KFW X;  1BC6 A;  4K5S A;  1R8B A;  3SCL E;  4K4X A;  2KZM A;  2KHD A;  4FPR A;  4ZPB A;  2BW7 A;  4URQ U;  3JYT B;  1NUE A;  4DUT A;  3O2I A;  3CTR A;  2R8K A;  4ZVQ B;  5LJ3 Y;  2F5G A;  4WU3 A;  3OLB A;  1E6V A;  3CCR S;  5KFY A;  2Y1L B;  1VQY A;  2AJQ A;  2LKZ A;  4TQS A;  5A8K A;  3VAH A;  3SSR A;  1HPZ B;  2MLX A;  3KHG A;  4F4W A;  2V2Z A;  1TEL A;  2R8J A;  1DFD A;  1S6Q B;  2PD1 A;  3AT1 B;  4ECU A;  1XNQ J;  5I3Q A;  1DTQ B;  3CJ4 A;  2PMW A;  3WBZ A;  1XNR J;  2OTJ S;  3W9H A;  5AXL A;  1VQ5 S;  3FJ2 A;  2UXB J;  3LAM A;  3J7A 1;  3MM9 B;  2HEK A;  2ERR A;  3OR2 B;  4DG1 A;  3QLH A;  4UOC A;  3GYX B;  1Q79 A;  5GAG U;  3MMC A;  3ZNJ 1;  2FLL A;  4F02 A;  4A8X A;  2V8D A;  5IV3 A;  3RRH A;  3CGI A;  2F63 A;  2BJ8 A;  3BO2 A;  5IQQ A;  4F67 A;  1UFL A;  1RT6 A;  3HT0 A;  3CJ5 A;  2WZ1 A;  3G8Q A;  1Y11 A;  1B70 B;  2C3P A;  1L3K A;  3ISN D;  4LRA A;  2O67 A;  5KT6 A;  1X4F A;  2JHE A;  3DYA A;  3A8E A;  4M5L A;  2BAB A;  3CJ2 A;  3GTY X;  2HSE B;  2E1P A;  1LXN A;  3LP1 A;  3P49 B;  2YWH A;  1VQL S;  2FLP A;  3BS9 A;  2G2O A;  4RBU A;  4LF5 F;  1SH3 A;  1J2V A;  2V4Q A;  1Q0N A;  4FS1 A;  4PXC A;  1RLD A;  1F5A A;  3LO3 A;  4FYX B;  2HVI A;  2KXH A;  3MR6 A;  3FDS A;  5B0G A;  3DOM B;  2R7U A;  3NAH A;  5LMN F;  3IWL A;  3MDF A;  2H9Z A;  3BM7 A;  3M8Y A;  4ECY A;  5KFC A;  2EFQ A;  4ICL A;  1U1Q A;  5C7P A;  2QLW A;  1WEY A;  2DIT A;  3PVX A;  2Q3P A;  2FTR A;  4WXW A;  1Z1Z A;  2CJK A;  4NXN F;  1WC3 A;  2YKN A;  1AUS L;  4X4R A;  2D3O 1;  3KLG B;  3R2C J;  3OJU A;  4UUW A;  5EWF A;  4LUB A;  1R0A B;  4M5D A;  3W2W B;  2H1Y A;  4F4Y A;  1T03 A;  5H1S V;  3K5O A;  4Z7C A;  2E1A A;  4FF2 A;  3CO0 P;  2FUG 9;  5L38 A;  3GV8 B;  4WP9 A;  1D0E A;  2XLJ A;  1H74 A;  3OQ2 A;  2E7W A;  4X4O A;  1WHW A;  2DB1 A;  4O3S A;  1GMV A;  1U49 A;  5K5M A;  1S79 A;  3S7R A;  4DV3 J;  1R6Y A;  2YWG A;  4R0E A;  1GEH A;  4JI2 J;  5GMK a;  3AY0 A;  1N32 J;  1FNO A;  1IKX A;  4JP8 A;  1DLO B;  4HI2 A;  5AXK A;  4B9U A;  1LXJ A;  1PG5 B;  1OY8 A;  2BAN B;  3UN2 A;  2KTQ A;  1RA7 A;  4JI3 F;  2FVS A;  5KG1 A;  2IJF A;  2GIF A;  2EBE A;  4GKJ F;  4OX8 A;  2KDO A;  3M6X A;  1H2V Z;  1V3Z A;  1YIT S;  3SYZ A;  5KAK A;  4G1Q A;  3LAL A;  4O3Q A;  1L3U A;  4TXS A;  2W1B A;  4DZ6 A;  1V9O A;  3PXG a;  2FJB B;  3VQS A;  5CYM A;  4KR0 B;  4MKA A;  4X2B A;  1PC4 A;  4DV6 F;  5AE1 A;  4B9T A;  4C11 A;  2BAC A;  1F5C A;  3ZO7 A;  4JB8 B;  2CDR B;  4F2S A;  1UZH A;  1Y10 A;  5J1N A;  3MMA B;  2CQP A;  1KC8 T;  1M1G A;  4Y65 A;  3PKM A;  3KK1 A;  2G0J A;  3MM5 A;  5IT4 A;  1NK0 A;  2ZH8 A;  4O4R A;  4ZKA A;  3WZ0 A;  3T1Y F;  2CXE A;  2GMH A;  4RUB A;  2IVY A;  1KOH A;  4DFK A;  2FVR A;  3GCW P;  1L3T A;  4NEY A;  1X4C A;  1P9Q C;  1RWO B;  1JJ2 R;  1LKZ A;  3GIR A;  2IRY A;  2OPP B;  4YFU A;  3U1M A;  1OWX A;  5KT7 A;  3W3S A;  1LK5 A;  2GAG C;  2ZH2 A;  1R43 A;  1LW2 B;  1UTA A;  1T3N A;  2APO A;  2LDY A;  1EP4 B;  5HMW A;  1YJV A;  4TN2 A;  5B0A A;  2AU0 A;  1A0O B;  4L6V 3;  2W25 A;  4ER8 A;  3FKB A;  3J80 Y;  2RT3 A;  2OAU A;  1HMV B;  1FXD A;  1VLO A;  5DLF A;  4TY8 B;  2ZUG A;  5JVG Q;  3B4M A;  1SKS A;  2ZE2 A;  1FJ7 A;  4YOE A;  3A3P B;  1HI1 A;  2KRR A;  3Q8V A;  4NLW A;  1DUR A;  3IFE A;  2XQC A;  5J2P B;  4NCB A;  4UF4 A;  3KJN B;  4A4J A;  1KDN A;  1WD6 A;  3PNI A;  3ADA C;  3FNN A;  4ALZ A;  5HAN A;  2BQ3 A;  3L9Z A;  2IRX A;  4P9S A;  2XWY A;  3IO1 A;  3K5L A;  3H2L A;  4USI A;  3ET6 A;  2BJ7 A;  4P75 A;  2M52 A;  5C24 A;  1LW0 B;  2MZ1 A;  4NCG A;  2HQI A;  5KFB A;  1ITP A;  5LL6 d;  2C2R A;  3N79 A;  2C22 A;  3A8J A;  4B3S J;  2XY7 A;  1TVR A;  1YVF A;  2MMY A;  2C2N A;  1XEZ A;  3PJ9 A;  2D41 A;  3DC2 A;  1U47 A;  2GAH C;  2R2U A;  1WHV A;  2RS8 A;  4FVC A;  3VGV A;  1PKU A;  2CDQ A;  4J7C A;  3AJ1 A;  4MK8 A;  3F56 A;  4MMO A;  1GQE A;  1SL1 A;  4FPI A;  2YKM B;  4NLD A;  3FZ2 A;  3MR5 A;  1TUW A;  1ZZN A;  4PG4 A;  3W66 A;  2YPY A;  3F44 A;  1REV B;  1RTZ A;  1CLF A;  2D9P A;  1N5S A;  2BJ1 A;  3W8P A;  5KFT A;  3PIO Q;  4EBE A;  2XS2 A;  3MTJ A;  2M3D A;  1G4C A;  1CJU A;  2L48 A;  4DXL A;  5ETQ A;  3MOJ B;  2H65 B;  1YJR A;  1JWW A;  4UT4 A;  2QLJ B;  3NG8 A;  2E9R X;  2UUC F;  1RTH A;  3GSI A;  4ELV A;  3CT9 A;  4O3R A;  3EM1 A;  2ASJ A;  2W9C B;  2WB1 D;  3NLC A;  3EGV A;  1KLN A;  1F60 B;  4RBT A;  3L95 X;  4JI1 F;  1IKY A;  5ETN A;  3HZG A;  4LJM A;  5K8P A;  1X31 C;  2XS7 A;  5E3Q A;  3O1L A;  2XO6 A;  6FDR A;  3IMQ J;  1I51 B;  1C0U A;  2ZOF A;  4LFB F;  3H20 A;  3HJV A;  2XUL A;  3V6J A;  3PW4 A;  3K0J A;  1CQN A;  1Q1K A;  2ACM A;  2JEJ A;  1DQA A;  2YWW A;  5D6G A;  4KHM A;  3ZZ0 A;  5I4M A;  3VGT A;  1GXU A;  4EUV A;  3F73 A;  1MRO B;  3PR4 A;  1VRU A;  2BE2 B;  4ZVE A;  4OJH A;  2XB2 D;  2HVZ A;  3S8S A;  3DN9 A;  4DX8 H;  3V81 A;  2W9B A;  2DEI A;  4EBC A;  1JLE B;  1SIW B;  2Z2Z A;  1V3R A;  1NPP A;  4ZVF A;  3KLF B;  2ZZM A;  1VBX A;  3RYL A;  1UJ5 A;  2YH0 A;  3PX4 A;  3C3L A;  4WK3 A;  3Q8Q B;  1S0N A;  4LR7 A;  4AL5 A;  4BBY A;  2H5E A;  3AB2 B;  2FB0 A;  1N88 A;  5HQL A;  2HHW A;  1R0B G;  3HXM A;  4W92 B;  3H90 A;  1S99 A;  1FDA A;  1BQM B;  3RU0 A;  4YN3 B;  2BJE A;  3M30 B;  1N33 J;  4YR0 A;  6AT1 B;  4IR1 A;  1CJK B;  3DLJ A;  3DGP B;  2DR8 A;  2D1C A;  2MQM A;  4L73 A;  5IV4 A;  2GVD A;  4CQ1 A;  3M2U B;  3SDE B;  1VGY A;  2HQD A;  4TY9 A;  3SV4 A;  4I64 A;  4QW8 A;  1CS4 A;  2E1C A;  4KH1 B;  3B6B A;  3JSM A;  2NZ4 A;  4PUO A;  4LSN B;  1S4F A;  2BKO A;  4Y6I A;  3IR7 B;  3V6D A;  1N5Q A;  1QVF R;  1F0X A;  3SCK E;  2VL1 A;  3UE2 A;  5JMN A;  2NXC A;  2C2D A;  2QJ3 A;  1D09 B;  1JJH A;  3FBC A;  2IA6 A;  1NU4 A;  2EK6 A;  4ED0 A;  5HP1 A;  3HDS A;  2E66 A;  3Q8U A;  1KLM A;  2ZHB A;  1YK9 A;  2O66 A;  4CNY A;  3CXC R;  2H4W B;  4ZLL A;  2WVE A;  2CQB A;  2AJ1 A;  1Q82 T;  2JEI A;  5KFD A;  2K2P A;  1DTT A;  2GML A;  4KSE B;  4I7F A;  1P8G A;  4OHW A;  2VFT A;  1V6H A;  3NY0 A;  1LWE B;  4M5M A;  1RT7 B;  1HNX F;  2M0G B;  4EBD A;  3UQS A;  1TL5 A;  1XK8 A;  2DNH A;  2CQH A;  2FZK B;  3TUI C;  3M32 B;  1QSS A;  1FKO A;  3FBF A;  1ZM4 A;  3EPG A;  4P73 A;  2DHX A;  3EVO A;  1N6Q B;  4UOG A;  1B7F A;  1WG5 A;  4J91 A;  1JLC B;  1S77 D;  4YME A;  2BQU A;  4O4G B;  3MTK A;  3AXM A;  3POT A;  4LSZ B;  3MFH A;  2XM3 A;  1RE1 B;  3I87 A;  1F3F A;  5M2R A;  5HRO A;  3DI6 B;  2RKI B;  2DHS A;  4FZV A;  5E2Q A;  5KFV A;  2NRE A;  3LGH A;  2ZM6 J;  2ZFH A;  4AL7 A;  1FRH A;  3FFI B;  4KQZ A;  1WNE A;  1IWA A;  3GZ7 A;  1M1K T;  2MLY A;  3TAP A;  4NLG A;  4RW9 B;  2NUH A;  1IJF B;  3MCM A;  4C0H A;  1IKV B;  5A8W A;  3RB4 A;  4USM A;  1H73 A;  3CC4 S;  3DMJ A;  2AX0 A;  3MMB A;  2ZDP A;  1CSJ A;  1RT5 A;  4ECW A;  1G7C B;  4DR5 F;  5J2M A;  2CQC A;  3CJK A;  1RAC B;  4H4M A;  3LA0 A;  2BKN A;  1O0P A;  3QAE A;  4K4V A;  2IDE A;  4DEZ A;  1UWA A;  1HHS A;  2N82 B;  2W4D A;  1SJR A;  2HWT A;  2R7T A;  5LOQ A;  3NAI A;  3OBI A;  3H40 A;  2GHV C;  4OHV A;  3GU0 A;  3UO0 A;  1ACM B;  2E5I A;  4RLE A;  1D9A A;  1X7V A;  3WIU A;  2OEM A;  4J9R A;  2CWK A;  3FCW A;  3L7O A;  2FLO A;  1I6J A;  5D3G B;  4IFY B;  4C48 A;  3MGJ A;  3T1A A;  4DR3 F;  4P6Q A;  1YJ7 A;  3AQO A;  2R8H A;  3TWZ A;  2LEC A;  1RKJ A;  3K8W A;  1J27 A;  1HNW J;  2BOP A;  3IG1 B;  4DCP B;  1VQ8 S;  4LVO P;  3KLE B;  3NOC A;  2VG7 B;  4C8M A;  3UN3 A;  2JFK A;  3IXQ A;  2M4M A;  2BM0 A;  1S0O A;  4N77 A;  1FI4 A;  2BKP A;  5KT4 A;  2RSQ A;  1HIY A;  1JLG A;  4KV8 A;  3W5Z A;  2R2R A;  3W2V B;  3KNA A;  3NNC A;  3QT8 A;  2CJ9 A;  4TU8 A;  2ZJR Q;  2OLW A;  5LSR A;  2VPX B;  4NLS A;  1GX6 A;  2J7K A;  5E3A A;  4OX9 F;  2ZBI A;  2ZVS A;  4ZDN A;  2V8G A;  4DU7 A;  2QEX S;  3Q83 A;  2AJF E;  3WX4 A;  3J7A N;  4LRD A;  3KMS A;  2KH9 A;  4HHH A;  2QL5 B;  3M6W A;  1NJI T;  4B3O A;  1VRQ C;  2LU1 A;  3M9N B;  3TRG A;  1WHY A;  2ZVI A;  4OLO A;  5LMU J;  4BLG A;  4Q43 A;  4Q0B A;  2HAI A;  3J7Y U;  3H5X A;  2EG2 A;  1OYD A;  4EWT A;  4ZIW A;  3SCI E;  2WB4 A;  1PYO B;  4R5P B;  1N54 B;  5ETO A;  1HBN A;  2GVZ B;  4QR1 A;  4WFB Q;  5IFM A;  1FJG F;  2FZG B;  2ZWO A;  1U7L A;  3H2V E;  1B7Y B;  3CPW R;  4IRD A;  1HHQ A;  3IBF B;  4QPX A;  4DFP A;  4HTI A;  2FHJ A;  5DDQ C;  4DV7 F;  2MGZ B;  2B6A A;  3TAM B;  2MQN A;  4E98 A;  1NBE B;  2EFO A;  2HFO A;  3Q2S C;  5BR8 J;  3MXH P;  4LF4 J;  4WKR A;  2L08 A;  3I96 A;  3D6H B;  2MKC A;  5A6P A;  1FVQ A;  5KOW A;  4N76 A;  3A3O B;  3H98 A;  2V8V A;  4F3M A;  2QGF B;  1BMQ B;  1SKU B;  4DL6 A;  4PEO A;  3I9Z A;  4DR2 F;  3HHL B;  4GKK F;  4QWD A;  4C8Y A;  4IDK B;  3OTO J;  1XQI A;  4HDH A;  2V0N A;  4BC7 A;  1T02 A;  1NDK A;  3AD9 C;  3EIC A;  2XMJ A;  1HHT P;  3HHE A;  1F9F A;  4JYA J;  2PMH A;  3B54 A;  4QOT A;  1YG0 A;  2U2F A;  5IWA F;  2AJ2 A;  1BE4 A;  3EWG A;  3KG4 A;  3C19 A;  2GQC A;  1HYS A;  2HBY B;  3N01 A;  5F9L A;  4KPY A;  2F3J A;  2HNZ A;  5D4L A;  3FEZ A;  4A8F A;  3C6U A;  1EET A;  1BXN A;  2Q6B A;  1GX5 A;  2BUN A;  3T6J A;  1WJ9 A;  4LQ3 A;  4U7U K;  2HG4 A;  4OI6 A;  5CA5 A;  2XC9 A;  4B3M J;  2G0I A;  1U0H A;  2WAQ D;  1SH0 A;  2LA6 A;  4DZD A;  2DTJ A;  2XMU A;  1JXE A;  4W98 A;  2IMO A;  1EIY B;  1T05 A;  1N4L A;  3FMW A;  1Q8L A;  4WFZ A;  2GZO A;  1CC7 A;  2XG8 A;  3TP2 A;  1TKZ B;  1PAE X;  1PBA A;  3MZI A;  2DNM A;  3O8W A;  1P1L A;  1QTN B;  3A4T A;  3CCW A;  3R5B A;  4KGM A;  3D67 A;  3GIK A;  2DYA A;  2EKY A;  4GVB B;  5B0F A;  2O01 C;  1LOU A;  3ILI A;  1JXL A;  3DLB A;  5E33 A;  4RW4 A;  1CG2 A;  2UV8 A;  4MH8 A;  4DF4 A;  2F7V A;  3P3D A;  2V2Q A;  4X66 F;  3LW5 C;  2QMX A;  1WHX A;  4YHH J;  3K8V A;  1Z4U A;  2W8K A;  1BHN A;  4LF8 F;  2C2M B;  2DKO B;  1YZ7 A;  2F8E X;  4OIX A;  4O3P A;  1FVS A;  2JLE A;  5D0R A;  2YNG A;  1X5P A;  1MU2 B;  2DNR A;  2G2Z A;  2HPU A;  1C0T B;  5ETM A;  1WSR A;  2IJN A;  4CLS A;  1MN9 A;  3T5J A;  2UVW A;  1P1T A;  1SQG A;  2JJ4 D;  5A6W A;  1Q5V A;  3FZB A;  4NE9 C;  3JAM Y;  4ES2 A;  5K14 A;  4KGZ B;  3RB3 A;  2DK2 A;  2OPR B;  3OL7 A;  4HTJ A;  5ETK A;  3PAC A;  1AB8 A;  2W01 A;  1TV6 A;  2W7O A;  3OVB A;  4HAC A;  2GC8 A;  5DDP C;  2WOM A;  3KNG A;  2DH8 A;  2DR6 A;  1QAJ A;  3ITH A;  1P9Y A;  5AXN A;  1S1T A;  2B4V A;  2H5J B;  2QFI A;  1X0F A;  3NS6 A;  3VF0 B;  4HR2 A;  4ECR A;  1KFS A;  3QO9 B;  1X5S A;  3EVW A;  1AFI A;  2MHN A;  4IUF A;  4CNZ A;  1CJV A;  1ICE B;  3IRX B;  2Y1I A;  2EW9 A;  4N7T A;  1YLX A;  2EWH A;  1FO1 A;  2HYI B;  4JV5 F;  1VBK A;  3J81 U;  1G3O A;  5BYR A;  3KLH B;  4QYZ K;  3KG0 A;  3BPD A;  1RHJ B;  4IG0 A;  4DV4 J;  5CZV A;  5GAG I;  4TVA B;  1H0H B;  3SXL A;  2YY3 A;  2Z8Q A;  5F8G A;  4DPX A;  3CSK A;  5CH7 B;  3QT6 A;  3DDI A;  1KVJ A;  3IGN A;  1JNZ B;  3ZTQ A;  2LEP A;  1JLF A;  2R42 A;  1JLQ A;  2DO4 A;  4Y2A A;  3H5S A;  3FBB A;  2Z2Y B;  4WU2 A;  1DQ9 A;  1IBK F;  4OZJ A;  3P6Y C;  3KDO A;  2RRA A;  5M2P A;  4DV3 F;  4DX6 A;  2MYF A;  2FPH X;  1U6B A;  4CWB A;  3HCX A;  1N32 F;  5T7L B;  3GB0 A;  2PSZ A;  1YIJ S;  5AJ3 J;  1ZA2 B;  2IHR 1;  3UDC A;  1FHT A;  1Y3J A;  3JYT A;  4P2S A;  3KK2 B;  2R7O A;  1TK5 A;  1KR4 A;  1S6P B;  1HI0 P;  4MAK A;  2HHS A;  1G6B A;  3Q22 A;  1VJQ A;  3BKT A;  2H51 B;  2ASL A;  3I0R B;  3HP6 A;  1OYE A;  2RJZ A;  3G4S S;  2CQ3 A;  2IA0 A;  3CMA S;  2CJB A;  3BBB A;  2CPI A;  3HHN B;  2IBO A;  1CQM A;  4HYK A;  2GQQ A;  2YXL A;  2XMT A;  1JX4 A;  2PGC A;  3EX7 B;  1WG1 A;  3BO3 A;  2QE5 A;  1S6Q A;  1FKP B;  1PJ6 A;  1R7I A;  3FCH A;  3PX0 A;  4DI6 A;  2XYG B;  3G6X A;  2RD5 C;  2N4C A;  2OI2 A;  3HSG A;  4WXO A;  3W7B A; 
#chains in the Genus database with same CATH homology
 2LFV A;  1X60 A;  1UTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...