2LFVA

Solution structure of the spor domain from e. coli damx
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQVQADLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein damX
publication title Nuclear Magnetic Resonance Solution Structure of the Peptidoglycan-Binding SPOR Domain from Escherichia coli DamX: Insights into Septal Localization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05036 SPOR Sporulation related domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1070 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sporulation related repeat 2lfvA00
1UTAA 2LFVA 1X60A
chains in the Genus database with same CATH superfamily
2P9CA 2YY3A 3W5XA 3I9ZA 2OGUA 1EZZB 2FJDB 1U1OA 1XEZA 4HVZA 3C16B 4DU7A 2PI4A 1RWMB 3QJJA 1HQEA 1B4SA 3F41A 2CPDA 4RPFA 1VRTA 4F3QA 1HNWF 4PWDB 1MROB 1KLNA 4JI3F 3POTA 2E5IA 2WAQD 2UXCJ 4N77A 4MT1A 3CO0P 1A7GE 2IM2A 3MMCB 4PXDA 3CE8A 5CA5A 5D77A 2CQ4A 4C3LA 2GQQA 4PRFA 2XCAA 2W4PA 1FEEA 2V2KA 5HLFA 2CWKA 4ZIVA 5MLCV 4WXOA 3BS9A 2BDPA 2RDJA 1RHUB 2YTCA 2ALYB 2I9SA 4Y28C 2R8HA 1H2UX 4YN3B 3IM8A 4IH6A 3EMTA 2CFXA 1QD1A 3BZQA 4AE5A 2AIRB 4NOHA 2D3OR 1QE1B 3ET6A 3KDOA 3TZWA 1FNXH 1LW0B 2VFRA 1YJTA 1FDAA 3T6BA 4NCBA 2R9LA 4USHA 5AJ3F 1KFSA 5J2NA 4ETXA 3FCHA 4CO4A 3ETMA 1LWFB 3W2VA 3OVBA 4TNOA 1Z2ZA 3HVWA 4PKDB 3QRPA 1FX4A 5KFBA 2DK2A 4IG3A 4QWDA 4M8LA 8AT1B 4F25A 1ELOA 5HL7Q 3TJAA 5D3GA 3AJ2A 4KJIA 3RAXA 1HR0J 2NSBA 2O66A 5JVHQ 4KO0A 2ZH9A 3OL6A 1IJEB 4YR2A 4IOAQ 5CZVA 4DV1F 3GLJA 2ILYA 4O0NA 5F3TA 1CQMA 1LNQA 4QOTA 3O8WA 4IKAA 3KK2A 2VQEJ 4J9VA 2MKYA 4FS1A 2CPYA 1FX2A 1DLOA 3H98A 4LFCF 3BB5A 2HMIB 4JI7F 2HG4A 2HPUA 2V2QA 2EXUA 3BBBA 4G1PA 5A2QU 2HWHA 1GT8A 4OZ5A 4CT9A 3G71S 1MWYA 4ZOSA 3CMES 3UVJA 4DL0C 3CC4S 3ZC4A 2EWHA 2RRNA 2Z2LA 1CPZA 3H5XA 2ZBIA 4JI5J 2EEYA 3MECB 1F1BB 4YB7A 2FB0A 5FDLB 4B02A 4ELVA 1RCXB 1SIZA 4K4WA 1X9MA 4MIBA 5L1IA 2FC9A 5KTQA 1HBOB 2DGXA 5E2QA 3AQPA 5HO4A 2B5JA 4W4MA 2M8HA 4ED6A 1TK5A 3RG6A 1KS2A 3ULHA 3D9BA 2E1MC 4RBVA 4GVBB 3TA1A 2OPQB 4FF2A 3I5CA 3H2LA 3LGHA 1T0TV 1S0NA 2XMAA 4RJVA 5KG0A 2F3JA 4P10A 1DQAA 1SL1A 2APOA 5EWEA 2DNKA 3VZHA 4CT8A 3WHIA 1U1MA 1N88A 4K4VA 4V19J 1K0TA 2RQCA 1FJ7A 3OR2A 1P9QC 2W25A 1W2BR 4RUBA 2VASA 3ITHA 3U27A 2XLJA 1YRUA 4X62J 3KNGA 1S1TA 2HHUA 2AYBA 1JLAB 1TL4A 4HDHA 1VBZA 3HVTB 4XDCA 1K1QA 4KH0B 3H5UA 4FYVB 1BMQB 5K9FA 3K8VA 4IO9Q 1VC0A 1XNQJ 1RGVA 2RT3A 2XGPA 4C8LA 2JJ4D 3BH7B 3MGJA 1B3TA 3CJTA 4I68A 4FS2A 4C11A 3UN3A 4PXBA 3PEHA 3DKDA 2ZH1A 3WQPA 2MKSA 3OTDA 3OUYA 4UUWA 1ZZNA 3ENWA 1AZSA 2KT5A 5J1EA 2IDLA 5MAOA 4DG1B 2QLJB 3W64A 2FHMA 2XMJA 3AQOA 4QIVA 5F9NA 4U67Q 3K5PA 2DXEA 4DR4F 4O4GA 4DSEA 1TZ0A 3OW2R 3RB6A 1U8SA 1KSPA 4B3TJ 2DXFA 2IJFA 3P8BB 2DNMA 3UD3P 2ZFHA 4DL2A 1FJCA 1HW8A 2JC0A 1VLOA 3KJQB 2W9AA 2UU9F 3MF5A 3OVSA 2QFJA 1RWWB 4QWBA 3R6LB 4JUZA 2F5GA 4TU8A 1B0PA 3G6YA 2OI2A 3RBEA 1M5PC 2CQ2A 4TY8B 3DLKB 2DITA 4WTOB 1N34J 2ZBCA 1UW4A 2LXFA 3PX6A 1JLFA 2A6OA 3AA9A 1CS4B 5KFMA 4JI4F 5HK4A 2QRRA 1Q86T 2IBKA 4NI2B 2I5JA 1S1VA 2K7JA 2HNDB 3F56A 2B7CB 3H0PA 4QYZK 1QLNA 4I6AA 3SCIE 1U1LA 5AXMA 2DHGA 2YWFA 4URQU 2G1DA 5D0RA 1YTYA 4NEYA 5HROA 2BJ8A 2PC6A 1VISA 4PCQA 4DOZA 2HZAA 4MAKA 2R2SA 3L7OA 4RUAA 1P1LA 5U47A 4CTAA 2B4OA 4X66J 2JVRA 5KFEA 2ZUAA 1WELA 3GSIA 1RT3A 1FTRA 3DM2B 4KIAA 2DD8S 2V8DA 2IVMA 2HFVA 2RUGA 5K8OA 1U2FA 2DNOA 1NO8A 3NGKA 4LFAF 2E9ZA 4KPYA 3ENQA 2ZJQQ 2CAJA 2XNQA 3BQ2A 3PW7A 2W2NP 2DPJA 1VQPS 2H65B 1R3NA 5IXUA 4KQZA 2XNRA 4B9SA 2E1PA 4FN5A 2I2YA 3BQ1A 3EZUA 4F4ZA 2FLLA 4MFBB 4OJGA 2OEKA 2JFDA 3MURP 3FFIA 2GJ2A 1Q5YA 2KHDA 4EBDA 3D0HE 1X0PA 1N5SA 3BPSP 2W8KA 1XN9A 2PFFB 2DHXA 3T1HJ 1CULA 4C8OA 4PYAA 5LMNF 2DNQA 4DS5A 1VQYA 2XSJA 4NASA 3S6EA 3MAHA 2K1RA 2P6SA 5IV3A 2XS5A 4NXMJ 2XI2A 2DGWA 2Q66A 3TUPA 4CH1A 1RWKB 4OV6A 1JLEB 1SH2A 1Q81T 3TVZA 4Q2LA 1VK3A 3DOLA 1X7VA 3AB4B 3MCMA 1QY7A 4NLVA 2BMBA 1RWOB 5LJ3Y 2MZJA 3TNVA 3D2WA 2V69A 4A48A 1IJFB 3T5KA 1VQNS 1W25A 1BHNA 3QGGA 2W9BA 1LWEB 3U7JA 3G8QA 2DNHA 1S10A 4RWWA 4YB6A 3VGTA 3CO9A 5DLGA 2BXJA 5IT9U 1SJ3P 1RTJA 4PPDA 2R7UA 3NMRA 3MR7A 3GE9A 2OEMA 4U8YA 3HD1A 1M1HA 4OZ3A 1KWMA 4F3MA 4JBCA 4RLEA 2HHVA 3KLHA 1SKSA 5KFKA 2PE8A 1JLQA 1X4BA 1Q8LA 2E1RA 2ZHBA 3MCNA 5HBMB 2VG5A 2WK4A 4Y6IA 1V5IB 1QUVA 4OYWA 4ED0A 3SZ2A 4G1QB 1FXLA 4WYWA 2DR9A 1S0MA 3I31A 3V2UC 1RAOA 4DR6J 1QAXA 1FVSA 2FHOB 1AFJA 3BJYA 1SV5B 3UNGC 2G0CA 2F63A 5KG7A 2CQDA 1VQ6S 3Q2TC 2RDIA 3HHLD 5BYQA 4Q0BA 3CDEA 3O5TB 2ALZA 5C2CA 2VD3A 4CI0B 2DNPA 3ILIA 2DHAA 3RRHA 3KK1A 2JL9A 2R2RA 4X4SA 1GMUA 1OMSA 3LGNA 1HIYA 4OZJA 2RJZA 3GIJA 3RAQA 1NK8A 2OPRB 1HMVB 4HH1A 4P74A 3MMAA 4J9MA 2RAQA 1S9GA 2LDYA 4M5NA 5A8KB 3BGFA 2ZUGA 4M5JA 3KMQA 1EKRA 2XYPB 2J8AA 2CADA 5C5JA 5BJRA 3SEOA 1DY3A 1T03B 1N0VC 2C2MB 4U95A 2FDNA 3W62A 5ETNA 3IP0A 3GR0A 3C15A 5CAAA 4J5OA 1CJVB 4A4JA 3T6JA 2Z8QA 4GRSA 4ECTA 5GAHI 1FERA 4I2PB 4EBCA 2CRLA 5E0OA 1S6QB 5A8RB 3QO9B 1KR4A 1RAIB 2R8GA 2VBWA 4C2MA 4F8RA 1U0HB 1IVZA 3UE2A 1H2VZ 2KKHA 3V6DB 2W7PA 2BVZA 2VFTA 3DLEA 5D15A 1O51A 2Z4PA 2KDOA 4D3HA 2XZDB 1FRHA 2EKYA 1HNIB 2V67A 3MM7A 4IO1A 3T1YF 3EXCX 4QR2A 4LR8A 5DRKA 1YJRA 4DX8H 3QIPA 4DR5F 1PC4A 1BXNA 5D0EA 3CCES 1CJKA 1EJ7L 3CJ5A 1SL2A 5KT4A 4IRCA 5J1NA 3KG4A 1RT5A 4M5LA 1A0OB 3TQ1A 4LFBJ 5I42B 4KT0C 3EGWB 3MMBA 5IS2A 4WFNQ 2VH7A 3PTWA 1UMJA 3DRRA 3SMZA 1Y7PA 3BO3A 4ILLA 3CSKA 3HMJG 3VAHA 5C25B 4NXNJ 1YJUA 4X64F 2AU0A 3LP1B 1XIQA 4O23A 3D28A 3DGPB 1LKZA 3P96A 5ETOA 4KH1B 2JOQA 2IRXA 4KSEB 1FFGB 2DGOA 1SC4B 2NUHA 5B0DA 1VHIA 3DYAB 2A2CA 1VDHA 1X4GA 4RU2A 2O1PA 1BGXT 2AWZA 4OZ0A 3I56S 4ZKAA 4B3OB 3CCJS 5THWA 3AHPA 1WHWA 4ECRA 3IBCB 1P27B 3OT9A 4A46A 4WCEQ 1XNRF 2OSRA 1ZYQA 2Z0GA 3OJUA 3D1QA 2EW9A 4PXCA 7AT1B 4S0MA 1NEEA 1U6BA 4I6YA 3R7NB 1TL3A 2P9GA 4DUZF 4HL9A 2KVIA 1HNZJ 4DR1F 3CCLS 4LF5F 1F5BA 4YP3A 4HHUA 1PIEA 1JLCA 1F2GA 3HPOA 1DTQB 3BGOP 4DQSA 1N36F 1VRUB 4M95A 2L48A 4OI3A 1XR7A 3BN4A 5M2UA 3EZOA 3QWPA 2RSQA 2VB6A 3KUHA 2FTRA 1Q0NA 2VJUA 2QTWA 3DMJA 3PZPA 1MMLA 3EVMA 4MYUA 5KT2A 2FD2A 3JXOA 1NPPA 2LQJA 3KLFA 4NX9A 1N5VA 3MAQA 2EFPA 2XHCA 1NM2A 4CIOA 1REGX 3D67A 1S0OA 5KFJA 3DU6A 2K8GA 1HA1A 3AXMA 2F8EX 1GMWA 4G1IA 4R5PB 1W7WA 5KFFA 3NMAA 3ZNUA 1S6OA 3NWRA 2ZHAA 4RWXA 5HP1B 2FJWA 2XCPA 5HJXA 1IKYB 4ANEA 4DSKA 1RJJA 4LF7F 4CO1A 3PY8A 4ED7A 4C0HA 2M88A 1ZA1B 1Y5NB 4F0MA 2I8EA 2WOMA 2LVWA 2EK6A 2DGQA 1FEHA 2DBBA 2QO3A 2DYAA 2XY5A 1R0BG 3RB3A 3I0RB 5I3PA 1K1SA 2F4VF 2NXEA 1SJ4P 5CD4H 3SCKE 1FK9A 2QSWA 2RF2B 3CC2S 3NY0A 3Q23A 4CRJA 2HLTA 3QRQA 2FYXA 2PT0A 1GTEA 4DPTA 2DGTA 2ZH5A 2E29A 1P6TA 5LXYA 2HHHJ 1SH3A 1V3SA 3MEDA 5G0RA 3ZZUA 2B8QA 3I55S 3NNAA 2WVEA 3QGHA 2FJBB 3SBMA 2WCXA 1F6TA 2CYYA 1RTHA 3BGRB 4DLEA 3R3TA 2G2YA 3MM6B 4L3KA 2ATCB 4DV7J 2UV8A 2MHNA 3IBWA 5DDOC 1FWLA 3TUZC 4NWBA 2UXCF 5T14A 1IWGA 1AFIA 1FNOA 2N4DA 2DO0A 1HNXJ 2N7YA 5BR8J 4L73A 2JC1A 4ERDA 1VLYA 1MMNA 4N41A 2NCKL 3I82A 2ZE2A 5F9LA 4BC7A 1LWFA 2BA9A 5KT3A 2ZZNA 2RH3A 3OBIA 2VC1A 1KQKA 3I87A 2LFVA 2MKHA 2YPYA 3NEKA 2KB2A 1B0TA 1HWLA 2VG6A 1F5CA 1X4DA 3B4DA 5KFYA 3IAM9 4N76A 1H7WA 3AT1B 4USTA 3OHBA 1N5YB 2GVDA 1V3ZA 5J2QB 3SV4A 4C6AA 1UL3A 1GEHA 1ZETA 2ZD1B 1WF1A 2A3JA 4A8QA 2JSXA 4XIUA 2E9RX 5CYQA 4DN9A 3CMAS 9RUBA 3QLHB 2DHHA 3KLGB 1SKWA 1DFDA 3MR2A 3DHWC 3NGRA 5KG5A 3N0VA 3T5JA 3M1VA 2J6SA 1ZPVA 4HTIA 4Q8EA 1PC5A 5J2MB 1HR0F 2C1EB 3QT6A 4BCAA 5L8RC 2IA6A 3EJMA 3MTKA 5EWFA 3US5A 2VQEF 3T5LA 2RHQB 3IA0A 3AODA 1RB0A 3BKUA 3M8QA 2Y1IA 4IFYA 2HZVA 3B82A 5F8MA 4M5MA 2HQFA 3N4WA 2CQIA 1JLBB 3DN9A 1D9FA 2IHR1 4B3SJ 3K8WA 5DZ6A 2W2MP 3MM5B 2B4VA 1O6XA 1B7YB 1N54B 1UVIA 1F3FA 4JI5F 1JKHA 3NGSA 3NAIA 1Y11A 4HR2A 3DRSA 1HQEB 1EARA 1VRTB 2ABYA 1HI0P 1MWQA 3HD2A 4GO5X 1TL1B 3Q8PB 4ZHRA 4ZCMA 2DR5A 3BV8A 2OFGX 2GHWA 3J7Z5 1JX4A 1K73T 3BREA 2Q6CA 1N0UA 3LF0A 2OO4A 1D09B 1L5UA 3W2WA 4O3QA 5ETTA 1NBEB 3POTB 4OYXA 3MM8A 4OYIA 2MZRA 2C2OB 2HQGA 4KB7A 1M5HA 2OKQA 1RAAB 3PYFA 1N48A 4B3RJ 4PYDA 1U1RA 2B56A 1AXQA 3WX4A 1KD1T 3RUBL 3FMBA 4OI4A 3R1HA 2J9DA 3G6XA 1IKXA 4PWWA 3K17A 4K5SA 1SUQA 3MUVP 1UPMB 1VGYA 2FGCA 4ZPWR 3IN5A 4EBEA 2EC0A 2BV3A 2B3TB 4HHJA 1XMOJ 2HBZB 2I6WA 4N7TA 3WIVA 4X62F 1NSKL 1RLCL 1YZ6A 1XMBA 5IT4A 1WOOA 4CLTA 4FKXA 4Y0FA 3AAWB 2DNRA 4DG1A 2ZDOA 3VCDA 3ET6B 4JI0J 4OLPA 1NK7A 1B99A 1GMVA 3HF5A 4AXIA 1I6JA 2IM3A 9ATCB 1XNQF 4KV8A 5KG1A 3R27A 5J2NB 4K2JA 1X5OA 4QIWD 2YKNA 5DG8A 3W2VB 4ZN3A 3F0NA 3SSRA 4IG3B 1S49A 4A8SA 1LOUA 4P72A 2G9OA 5HMYA 3ILOA 1WI6A 3MFHA 5D3GB 4YB1P 2YQ3A 1RTIA 3TX8A 4P71A 4KO0B 1KHVA 1H98A 5KOXA 3BH6B 3CCSS 1HI1A 2DEJA 1GX5A 2C2DA 4JI8J 3KK2B 1IBMJ 1RA7A 4B3TF 4J9QA 2XC9A 1DLOB 4ZA1A 3QGPA 3LUYA 4NA3A 2QMWA 3D4JA 4DUYJ 1YQHA 1NH8A 3CJQA 4NE9C 4ELUA 2BZ2A 1BD6A 5IM0B 2BJ9A 2XMTA 1AUSL 1UA1A 3PG9A 2R7VA 3UVJB 2OUGA 1APSA 3OL7A 5GADU 2UP1A 4USWA 2DRDA 3L7PA 2C22A 2AJQA 4R25A 2AF6A 1JWWA 1N34F 5C42A 2BE7D 1B0VA 2UUBJ 4O3SA 1S6PA 3HHLA 1TQLA 2MKKA 1TV6A 5DQHA 2DHSA 2E44A 2MYFA 4NLGA 1OY9A 4MYTA 3NAHA 2ZVSA 2V63A 3SXLA 1YDLA 4ZVQB 2B5JB 3C46A 3C6TA 3THPA 2HS4A 3CD6S 2JZ5A 2L08A 4TLQA 4K8RA 4ED5A 4PR6A 1X5PA 3BDPA 3R5BA 2RMLA 2CDQA 1HNVA 4C8MA 1EQMA 5IC4B 1JJHA 1WUUA 2KYZA 5HMWA 4DV4J 4FZVA 3Q8SB 3IGNA 4DV3J 1SQFA 3M4XA 2FVQA 1M90T 3OHAA 2HURA 5L1KA 2C2RA 3OR2B 1R0CB 2XZWA 4FDFA 3OLAA 2EFOA 3ITHB 4X66F 2BKPA 3BBCA 3GFZA 3VQSA 1S1TB 3Q2SC 3RB4A 4Q45A 2ZJRQ 2M70A 4GKJJ 4P2MA 1JXLA 1FCAA 3BO2A 1VQOS 1Q53A 4FXVA 3K58A 1TL7A 4LRAA 2QYCA 4M63A 3SSQA 2EK1A 1R43A 1Q95G 1TL5A 5LM7E 2NPFA 4HT7A 4C8KA 2CPZA 1FKOA 4QYRA 3QRRA 2ZOGA 4C11B 4I7FA 3EZ5A 1NK6A 4OYZA 1NHKL 3M30A 3VAKA 1PBAA 2ROGA 2GW8A 3OUYB 2UVWA 1AZSB 3T3FA 5DQIA 5B08A 4Y3CA 3CVKA 3T1HF 2LU1A 3HSZA 4DL4A 3V5RA 2PFDA 4O4GB 3KLEB 1IQZA 1NUEA 2AZ1A 5ITHA 5HVHA 2UVRA 4NXMF 4ECWA 2VPWB 4DI6A 3GFXA 3G87A 5EX0A 3DLBA 1VQMS 3B8HA 2DTJA 4CLSA 2LQBA 1FD2A 4JI6J 2HHPA 5KFUA 4CWBA 3MPYA 3CPWR 1Q79A 3DOMA 4ZS6A 1NZ8A 4TU9A 5LT5A 1XR6A 3LOUA 4RNMA 4DL3A 2Z2ZA 1XBWA 2YNGA 4ZLJA 5G4DA 2PIIA 1L3SA 4ECYA 4PQAA 2LEAA 2JLGA 1JLFB 1REVA 1SJFA 2M3DA 1RISA 3IG1A 2BX6A 2VOOA 4G1QA 1YG0A 3GIKA 2E9TA 1UEUA 3KJFB 1HW9A 2XZTB 1F2HA 2I5JB 1RT4B 1S1VB 4JB8B 3GTYX 1RTZA 4RX6A 3FMWA 1QUPA 2D69A 1FFWB 4LSNA 3JSMA 3SQOP 1WTBA 1TMJA 2ZC3A 3NOGA 3FDSA 4DV0J 1FHTA 1FRXA 2WHOA 1TP7A 2HAIA 3PHTA 4OX6A 2YKAA 2IPOB 4NMXA 5HROB 3SQGA 2D1CA 2N4CA 1HQUA 3ILLA 3Q8RB 4KHPF 4YUDA 4DL5A 5DG7A 4CLUA 4CTAB 8ATCB 4J9PA 3K57A 3NS7B 5AE3A 2O3DA 3PNIA 4DWIA 4OYOA 3UW1A 4ED8A 1HD1A 1RT3B 6FD1A 4DR6F 2EFQA 3TI0A 4KGMA 4ZDNA 4F02A 4B9LA 1FWKA 5T41A 3A13A 4ATNA 1RT1A 4JP8A 2DEIA 3I96A 4TYAA 1A6LA 4ZVOB 1X4CA 3AH6A 1T03A 3O1LA 1NSQA 3M6VA 4AXJA 1DURA 4OQJA 2GJIA 5K8PA 5JMNA 3LAKA 1TTHB 4HLBA 2R3VA 3GONA 2GIFA 3W63A 2MGZA 3KOAA 2OJ3A 4KTQA 2DNYA 2A0FB 1SJ1A 4L75A 2VICA 3FFIB 4L3NA 2KM8C 3BSNA 3KFWX 3CNQP 1SXLA 1BE4A 4HEA9 4TLRA 3G9CA 3V6DA 1U09A 1CULB 2ZKTA 2QYGA 3TANA 4PG6A 2C3UA 1X8DA 2HHTA 1U2CA 2XSJB 1HNIA 3V6JA 1ZZFA 2G2ZA 2V34A 2K1RB 3OTBA 4KFBA 5ETSA 2FZGB 2KXNB 1AT1B 3PYEA 1LXJA 5D8HB 4DLGA 1Y3JA 5FLXY 2ADBA 3DRXA 2QL9B 2AZ3A 1OIAA 1JJ2R 4KGVB 2GMJA 3R5CA 2AGOA 3DOLB 2Q79A 3A12A 1Q4RA 4DQPA 4ZVEA 4K4TA 3JSBA 4UQTA 3G6ES 1KONA 4WFXA 2XWXA 5KG6A 2HNZB 2RIJA 4KGKA 4FYXB 4IOBA 2W9BB 1UCNA 1RBLA 5D0GA 3IO1A 4E0DA 2ASDA 3AD8C 3NXZA 1RYRA 3PKYA 4DV2J 8RUCA 2CUYA 4FYWB 4ZCLA 2BW2A 2W4DA 4K5RA 4W98A 1RTJB 2WZ1A 3DFEA 4H54A 1I94J 3TW0A 1XR5A 1UJ6A 2ZEJA 4CLFA 2KG1A 1U02A 5D6GA 2NS1B 3KLHB 4UTGA 1F60B 4C8ZA 3N01A 1FRMA 3K5LA 2NXJA 3JQMA 3GJTB 1JLQB 1HHQA 4NLQA 5F8IA 2VG5B 2ASYA 2V5HG 4NXNF 3GR1A 2X1GA 3HKZD 2WTFA 5KFGA 2MKCA 1YBTA 2B51A 3ILJA 4A8FA 2M5YA 2WVCA 2NXUA 2VZ9A 2QX0A 3TP2A 4G65A 5CABA 1XC9A 3KYLA 2UVUA 4CLWA 1Y3KA 1FD8A 3C19A 4LRDA 4RW7A 5LXRA 5D4NA 2QT7A 2OSQA 3SDEA 3FUYA 4ED2A 4GC7A 1GQEA 4Q0BB 2CPFA 5M2RA 4Z7CA 3M8YA 3OFGA 3HM9A 1OQ6A 3BKFA 5E33A 4J9LA 3DLHA 3H20A 4CO0A 3KK1B 3ZTRA 2L3MA 3Q8UA 3A3NB 3ZTPA 1VIXA 1HNZF 4NL5A 3MMAB 1PAEX 3H7HB 3M6UA 4C3MA 3PX0A 5BXIA 1S9GB 4OJ1A 5D0HA 1Y5LB 4KAIA 2PA8D 2IYGA 3LGMA 2O5DA 1D8YA 1IBCB 4L72B 2DH7A 5BYRA 4DPOA 1RAGB 3VF0B 2JEGA 5JJBA 2P8IA 2OMLA 1KDNA 3J81Y 1KTQA 3C15B 1S1WA 3QNWB 4D3GA 2CJBA 2R4FA 2H4YB 4TN2A 2DNNA 4X4OA 5ETRA 2GQ2A 1NB2A 2VDHA 2Y1JA 5A8WA 4AL7A 4F0HA 3OPKA 3TYTA 1RXOB 2XMMA 2ADCA 1GTHA 1PYTA 4A8XA 1FRLA 1KEKA 1T95A 2HRYA 1RADB 3UWTA 3DLEB 3IR5B 4ZN1A 4E98A 3GIMA 3M05A 3LP0A 4Y2AA 5T7LA 4G3IA 3D0IE 3MM7B 1SIWB 2KT3A 1WHVA 2H3EB 4DQIA 2M9KA 2CNLB 1S1UA 2QC3A 2YH0A 4YOEA 1CJKB 3PHEA 3TX0A 2PA3A 2BJ1A 2HFNA 1LWCA 1RT5B 4IG0A 3FQKA 2K2PA 3L4BC 5GAEU 2QG9B 4CM0A 1N32F 3MMBB 2OELA 3DRRB 2FLOA 1R7IA 1KC8T 1KKHA 2M2BA 1URNA 3N9UC 3VAIA 4Z7YA 1UVJA 2NREA 2UUCJ 3CIMA 2QL5B 1Q16B 2HHHF 2WB1D 5E3PA 2MQMA 4UY8T 3KUEA 2FUG9 2XYHB 3QWUA 4NLWA 1HI8A 1MWZA 5KFWA 4Y2MA 4DV7F 4I2QA 1VQ9S 2Y1RI 2E66A 4C97A 4PXEA 1T3NA 4I6WA 1TFYA 2GJFA 1QM9A 2CVIA 1UFWA 2J6UA 3L9ZA 4OFZA 3VTIA 3NBPA 1Q8IA 1HNXF 1TL3B 3NS5A 5BR8F 3CJ2A 2FHJA 4Y2IA 4NLRA 1UZDA 1B64A 3TWZA 1VBXA 1JLCB 2LDIA 3AB2B 2EBEA 1UFKA 4RNFA 3QZ7A 2VODA 1VC5A 3ZTOA 1UVMA 1SCJB 3VGUA 4ZVSB 4QW9A 2FC8A 3T9NA 2R8KA 1RT2A 5E3RA 4U7UK 3MDFA 4QU6A 3G96A 4UY85 2X1FA 3I4HX 3DMJB 1SQEA 2QL7B 3CJ0A 1RT7A 2I0XA 3KLFB 2H5JB 2HSEB 3D1HA 3TRGA 1T11A 3JAMU 4CM2A 2IAJA 3JB9k 1DTTA 2NXNA 3FZ2A 2D3ZA 4HTJA 2ILZA 3R5DA 4FXDA 2FVPA 1C0TB 1NKBA 4WJBA 3S01A 3PV8A 4ZPDA 2PI5A 2O01C 3K7RA 3UN2A 4LMZA 2J0WA 3IRXA 2YVSA 4FPRA 2J0SD 4NZ6A 2EG1A 1JJ4A 4FNIA 2R7TA 4DV1J 2BRLA 2NUUG 2BJ7A 4LREA 3SCLE 1FI4A 4EYIB 1PYOB 1WG1A 5LSOA 2D9OA 4Y65A 3EUNA 1VI7A 2WOMB 1T9TA 2A2DA 3KKFA 4GKKJ 1O5JA 3W9IA 2WBMA 3VAFA 3D6TB 1TL1A 4YB5A 5AE2A 3DRYA 4BWMA 2VJVA 3LW5C 3H59A 3L7UA 3MTJA 4DN0A 3IMQJ 2DGSA 1MN7A 5IT9Y 1FESA 1FK9B 1DJ0A 4FNHA 2GZOA 3TAMA 4B3SF 3GSDA 4M5DA 3C3LA 4K50A 4ZPCA 2FY8A 1W2IA 4CLZA 1CJUA 5KFNA 3MEDB 5G0RB 3MEEA 2CQCA 5CYMA 2OPPA 2W01A 5KT5A 5I4MA 1RTHB 1UA0A 4PABA 1FFSB 3CTRA 4DX5A 3H4DA 3W8PA 1YWXA 4V19X 3ZZPA 2XBPA 3LH2S 4OJHA 2A1BA 2VPZB 2OP5A 2AYEA 3PXGa 3HULA 2DGVA 2C2ZB 3GFYA 4EU0A 4QPXA 2CJ9A 1UKUA 5HMXA 4DQQA 4KRWA 2JVOA 1D3WA 1VRQC 4B3RF 4TKTA 3S1TA 3CCQS 3ELHA 1ZTTA 1RWPB 5B0AA 4PEOA 4WWSA 2F4FA 2EPIA 1NKEA 3GYNA 2ZH4A 3GJQB 4EO6A 3D6MB 4DPWA 2ZE2B 2A18A 1NDKA 3QAEA 3VZIA 3FRZA 2CNOB 2KRBA 4OYMA 1XMOF 3PJ9A 1WEZA 1S48A 2ZOFA 2LEPA 2ZH8A 4N56A 2F7VA 1KVKA 2G1HA 2NYIA 1HHTP 3AY0A 1WDDA 2VG6B 4JI0F 3BSAA 2V8HA 1GXLA 4P9SA 1Q8KA 2XM3A 2E7WA 1QDUB 4WYLA 3OTOJ 3UCUP 4ZVFA 3ZZRA 1VJQA 1FTCA 1MNEA 2GVDB 2X3DA 3MWBA 4NA2A 1NSAA 3KJVA 3J81j 4YS2A 1R8AA 2CQ1A 1VQLS 5CYQB 3GCXP 3MUMP 4Q2MA 2I38A 5IM0A 7FD1A 2BANA 1QSYA 4EUVA 3GQCA 3M1VB 4JOUA 1NK0A 2KXHA 2G13A 2CQHA 1U4BA 1ITPA 5B0FA 3W7BA 2CJKA 2QSFA 2ROEA 2HQIA 4UQGA 4JI8F 1IBMF 3P4UB 2BJ3A 1TKTA 2EFGA 4OHXA 2H48B 5ADZA 1S79A 3M8QB 4IFYB 2Z30B 4P2FA 3OVAA 4OI6A 4ECZA 1S77D 3ZZ0A 4DUYF 4RW4A 1MG7A 2NPIA 4N5SA 1WD6A 3HSJA 3DDNA 3K0JA 5CCMA 5D4PA 5D4OA 1WF2A 3DCAA 4J9OA 3ZTQA 2IM0A 1WG5A 4DV6J 3G2XA 1E6VA 3HHNB 1JKHB 2DNLA 1FKPA 2GMHA 3T9ZA 3DRSB 1MW7A 5LL6d 3M9NB 1X4FA 1FRIA 4LF1A 1DZ5A 4MK9A 5E3CA 1C1BA 1S6UA 5I3QA 2UUBF 4WBFA 2AT1B 2PEBA 4ZHRB 3V4IA 4M5HA 2AW0A 2BABA 3HHKA 2HAFA 1N5TA 3PYGA 3LPYA 1DQ9A 2CZ9A 4WP8A 1BWVA 1I5OB 3TAPA 4R0EA 4XPEA 4EZ9A 3W2WB 2MZ1A 1YRTA 2HRTA 2BM1A 4DR2J 1OYEA 4FYYB 3MM8B 4C7QA 4P75A 4PUOA 1PJ7A 4L74A 3V6KA 4FVCA 3M2RA 4A8OA 2WSCC 1S59A 3HP6A 1NRKA 1H74A 1RCOB 3SYZA 4IDKA 3N5BA 3L3CA 2QLBB 2XS2A 1IKXB 2AJ4A 2R42A 1SUQB 1Y9OA 4M94A 3PW0A 4DR3J 3OL9A 1JNZB 1PILA 2VPXB 4DV3F 1S9EB 1TKXA 2YKOA 2J76E 3BSOA 1YI2S 1LW2A 2VA3A 1NXIA 5H9EJ 2CPIA 4WF9Q 1UVKA 4GKJF 4ID8A 4LBIA 1SPBP 1A9NB 1LK5A 2W2QP 1JJCB 3TVKA 3UPFA 1EHWA 3BR8A 2C2KB 1TAUA 4MK8A 3H90A 3RJMB 4CZCA 2CPXA 7FDRA 3IBFB 3TZXA 4ES3A 1UWAA 2FIUA 3KLEA 4EO8A 4OIXA 3RW6A 4KV8B 5CZXA 1H0HB 2CKWA 3GWCA 4R8UA 3V81A 2L9WA 1R8HA 2YKNB 2VA2A 3NS6A 2AX0A 3EGZA 4Q7AA 4OX7A 3RZAA 2RQMA 5ETKA 3CCZA 3KK3A 3FEXB 2LLZA 1IBKJ 4LBPA 2CWXA 3OXLA 1D0EA 4OLOA 3HXMA 2M7SA 3PDNA 1RTIB 1S0VA 4F4KA 2V8VA 4FVMA 1IR0A 3C14A 3H4BA 3M32A 3BPDA 2Q43A 3DLGA 4ZVGA 4NLTA 2FJVA 4ZP6A 1U7LA 4NMLA 1FDBA 3QT5A 3C66A 4WK3A 1X5TA 1BQMA 2UZAA 1AYEA 4ZP8A 4JI6F 4UZBA 4QBUA 2RE1A 1RT4A 4FF4A 2DNGA 1R0AA 1KN6A 4WKYA 1LFWA 1Z2LA 1LV5A 2HS0A 3EWGA 4LSLA 4H4OA 1UFLA 2Z56B 4HACA 4X4PA 5C42B 1N33J 5L1LA 2CG8A 1NJYA 1SJRA 4DR7J 2IVFB 4DXLA 2YNFA 1KQSR 1FE0A 2HK3A 2AJFE 2V94A 1S6PB 1VQ4S 3HHLB 4OZ1A 4ED1A 2YPZA 3ZNJ1 4F36A 1NMEB 2PMHA 4WE1A 1TV6B 2DR6A 2MZTA 2GAHC 1U1PA 2HS3A 1OWXA 4XK8C 3A3PB 3QYYA 2Y0BB 2AKWB 4F4WA 1R27B 1C1CA 4F7VA 4O4RA 1X9SA 1S12A 3C6TB 2RKIA 4B9NA 3FSXA 5H9FJ 2PD1A 4B17A 4IYQA 2QA1A 4MKVA 1ZS6A 5DJBA 3UDCA 4LF4J 1HNVB 3H5YA 1UJ5A 2XY6A 4NLOA 4USJC 4BS2A 3CCRS 2KM8B 1SKUB 5F8JA 3CDUA 2J7WA 4JI1J 3GILA 4PG5A 5IZHA 3G82A 4CO5A 1TK0A 1U1KA 3UCZP 3HT0A 3J80U 1PCAA 4DSIA 1T7PA 2MY7A 2KXFA 2HQDA 5GAGI 1U1NA 3QIDA 3FK4A 1WKLA 1TL7B 1OYDA 3CJRA 3PRDA 3TUIC 2E1AA 1ACMB 3D68A 3W9HA 5DDQC 2YX7A 1U0SA 1W26A 4A47A 4CYUA 3AFGA 3PJXA 4YFUA 3EGVA 5LSLA 3HT3A 1TUGB 1FKOB 3J7YI 5DGBA 3GIRA 2HIQA 2RS2A 2NZ4A 2VDIA 4I7FB 4DF8A 4CO3A 4UF4A 2WVFA 1J5EJ 3M30B 1SC3B 4KY3A 2XS7A 4XAKA 2UUTA 4UT4A 4U9RA 1YBAA 5L39A 5GMDA 3BN7A 2Y8WA 1RTDA 2B43A 2VQFJ 1AA1B 4NLSA 3MEGA 3D54A 3UNYA 4IRDA 3AJDA 4DJBA 1G1XA 3OTCA 2HNZA 3HVRA 3IC1A 3PW5A 4OX8A 2DNZA 1R6VA 3UDEA 2HVDA 1RKIA 4ZLNA 5SZTA 4AUKA 3UCGA 1EIYB 4F4YA 4DCOB 3CIZA 3TOQA 3N79A 2M0GB 1Z1ZA 2R7WA 2BM0A 1IWAA 2JFKA 5CYJA 3CDBA 4LF6J 2QE5A 2KYXA 3DOMB 4J91A 2KO1A 2WW8A 1TELA 2IC3A 3M9MB 4IOCQ 1BC6A 2HYIB 3ENAA 3WBZA 1J5OB 4DPXA 1T05A 2YNGB 3E3XA 4O0IA 1KLMA 3GYGA 2J6TA 3VHQA 4RW8A 1HWJA 1WC1A 3ICLA 3VVTA 3M6WA 2HVIA 1O0PA 1REVB 4DV2F 2YX4A 1GH8A 5I3UA 3IG1B 4O3NA 1YKWA 3UR0A 3I6PA 2XLKA 1I94F 4EFAC 1Y0HA 4J9KA 3MR3A 2NR0A 2OH2A 4F04B 1S9FA 3K2YA 3OSPA 3QSIA 3JSMB 4LSNB 3P6YC 5F41A 2B8PA 3CCVS 5KFLA 2UUAJ 4JYAJ 4EMDA 4PQUA 1CVJA 1VQ7S 1WC6A 1NK4A 2QGFB 1QVFR 3SQGB 1NB7A 1GAOA 4EGLA 2VUGA 1HQUB 4WXWA 1TVRA 3MM9A 3FZBA 4U8VA 2BKNA 3K5OA 1GXUA 2XMVA 3KDNA 2YQ1A 2DR7A 1HBMA 2C3OA 5KFOA 2H51B 1FO1A 4PPZA 2R2TA 1TK8A 4RNOA 2OD6A 3HZGA 1R31A 4YQWA 2PDAA 2D41A 1KTVA 1P9YA 2W9CA 2GV1A 5GAHU 2WSFC 2GGPA 1RT1B 5HQLA 3DLLQ 2AEJA 3KJNB 3K59A 2F40A 3PACA 1MU2B 1WDTA 4MTPA 1NDCA 1HWIA 3CW2C 3CJKA 3MPWA 3CD0A 2YKQA 1QSSA 1EP4A 1NZAA 3MI7X 3CD5A 2MGZB 4L6V3 3MAAA 2V4JA 1YJ9S 1R8BA 3TQEA 4YHHJ 2FLNA 4IRKA 2DVIA 2J9EA 2R8JA 3IGVA 3EVWA 4FP9A 3KHRA 1HD0A 3DRPA 4HH0A 4AT1B 4IFVA 4LQ3A 1XK8A 2UV8G 4IH7A 4WK1A 2FVCA 4QR1A 1S57A 1R8CA 4DSFA 3EGNA 1WOPA 2GC8A 3ZXWA 2DISA 1UAWA 4KFBB 3RB0A 4WIQA 2J5AA 4K4YA 2VHGA 1M5VC 1C4CA 4ICLB 1NPRA 4ETZA 4HKQA 5HI7A 4AL5A 2UXBJ 1Q1KA 1UW9A 3A4TA 1HWKA 3A8IA 1N6QA 2RNEA 2GMLA 1UVLA 2GVZA 2CG4A 3E01A 1HPZA 4OHZA 4OI0A 5K8NA 4RNNA 3Q8VA 3FQLA 1WG4A 1PBUA 1UWBA 1YLXA 4ZIWA 1U8WA 1IM6A 1GK8A 2J9CA 4DV5J 3PO4A 3ZZZA 2OTJS 4OI1A 3O6QA 3JQKA 2QMXA 4YR0A 1YVFA 2HFUA 1TKZA 2MLYA 3MD3A 3QMQA 4J9NA 2GIRA 4MJKA 1RE1B 2HIYA 2GAGC 4G6VB 3PIOQ 1SBRA 4F0KA 4K4XA 4N8NA 3U1LA 1E6YA 1JNRB 4OHVA 4DCPB 4X4RA 3T1AA 1RHMB 2J0QD 2AQ4A 2QFIA 4PAAA 4TYBA 4H4MA 4K59A 4WFAQ 2NLWA 3GP9A 3M8SA 2POKA 4CDIA 4K4SA 5EDWA 2KJVA 1VJWA 2UUCF 1VHFA 3Q24A 3HO1A 4PZVA 4WU2A 1UEVA 2H54B 2YNIA 4RL1A 1FVQA 2LU2A 3FC9A 2UVVA 2AEMA 4X65J 2FJEB 5KFCA 2LXUA 1P1TA 4RW7B 4QWAA 5HANA 3ISND 4ZPBA 5AE1A 1V9OA 4UOGA 3SDEB 5HVFA 4GC6A 4QIFA 3W5YA 2HHSA 2EFVA 3DI6A 1U25A 3G6VA 3JYTA 1PG5B 4JV5J 4U96A 3N28A 2VV5A 3QT7A 5SUHA 1WSVA 3U1MA 5C7PA 2MHEA 3VAMA 4KKOA 4DFMA 5RUBA 3TZZA 4ZPVR 4NPOA 1IUJA 1C0TA 2GQCA 2KFZA 2HGMA 2CPHA 3HZEA 3D6FB 1Q5VA 2QIFA 1G2EA 1S4FA 2KL8A 3NGUA 3NG8A 2F9DA 2DT9A 2VC0A 5IOLA 3MOZA 5A0YA 1FJEB 2GX8A 1S4EA 2MDAA 4EZ6A 1MLAA 2C2EA 1S1WB 5J2PA 3C6UB 3PKMA 2KRRA 3QGIA 1IKVA 3S8SA 2N3OA 4RUCA 1C4AA 1XMQJ 1JXVA 2MLZA 1EETA 4JI2J 4AFFA 2VBXA 5A8WB 4DQRA 1WJ9A 2ZBPA 1SH0A 2W7OA 2BE2A 5DM6Q 1KBRA 3JSRA 5FLXU 3R6GB 1KHWA 2W1BA 3I32A 1I1GA 2AP6A 3LP0B 5E7OB 5T7LB 2NXCA 2BBEA 1FRJA 3KUGA 5D4LA 1S1UB 1LWCB 3M2UA 2LMIA 2LEBA 1K8AT 4IG0B 3O2IA 2VU5A 4GKKF 5LSRA 2KFNA 2HVEA 3CJ4A 3B6BA 1VIOA 4P6QA 1KVJA 1AB8A 2N82B 1GMWD 4HDGA 5K8MA 4X84A 5K5MA 1NU4A 4ECSA 2DCUB 3AD9C 3M8WA 4UZCA 1YJWS 3N6LA 2E5HA 4CNZA 2ROPA 1N8RT 4BWJA 1RK8A 3I5AA 3MPUB 1KQGB 1YHQS 3V6HA 2CJYB 2R7SA 1T3OA 5E41A 4I2QB 3P49B 3MHYA 4DF4A 3TARA 4I69A 4KPCA 1UJ4A 5A76A 1VCTA 4DU8A 3NGDA 1WNEA 1C2PA 1S7HA 2M52A 2CQGA 2OTLS 4X4TA 4Q8FA 2AJ2A 3M6XA 3NBPB 4DDFA 1XTZA 2R7RA 4NLXA 3FCVA 2LQ9A 5DQGA 2B6AA 3OL8A 2E7XA 1RDRA 3MD1A 4KYZA 2JEIA 5B0BA 4FBUA 2RVJA 4ILRA 2Y3YA 3QQCD 1RBOB 2H5IB 2OLWA 5EX3A 2LQ8A 3UN5A 1RT2B 5K20B 4IUFA 3UO0A 3NCQA 4J37A 2HNYB 4DPYA 3CMQA 3RBZA 1RT7B 2AYMA 3M8PA 4M5IA 2CVEA 3NNCA 3N6NA 2EG2A 2E7VA 2IAJB 1L3VA 1DTTB 4N47A 3OTOF 4DFJA 1NNDA 4ELTA 3FSYA 1RACB 2OD4A 1LXNA 4P7VA 4DHVA 2HZCA 2JEFA 2UUWA 4DEZA 3J81U 2XY7A 1ZAWA 5F0WA 2BR0A 2PSZA 1R6YA 2IVYA 1X4AA 3IRXB 5JXSA 3GV5B 5KFXA 2V50A 4LVNP 2VG7A 3ZO7A 2IMWP 1IKWA 2BRKA 2B9XA 3LWLA 1RHJB 1S76D 3MCSA 3SFUA 1IBLJ 1GXTA 4RW6A 3I0SB 2UXDJ 1FWPA 3HJVA 2VKRA 5AT1B 2Y0SD 2DY9A 1DQ8A 1M5SA 2V2ZA 1CJTA 3A3OB 4BBYA 3RYLA 4OX9J 4C0BA 1MMDA 2U2FA 2KN4A 2GCFA 3C8YA 4ZP9A 5IWAJ 5KFPA 4RW9A 3Q22A 3U1NA 2DPIA 3GMGA 2F8MA 3TAMB 4A8YA 1URRA 3PRBA 5LMUJ 4OYAA 4M5DB 2KT2A 3VVUA 2HW3A 4O3OA 5DGAA 2OIHA 2ZDPA 2HWTA 1CJUB 3LP2A 4DV6F 2B4PA 4O44A 3MEEB 3GYXB 2CPJA 4FKYA 3RAMA 5CYMB 5HQMA 2YKMA 2OPPB 2WRMA 4TVAB 2CIMA 5DS7A 4ZPAA 2CJQA 4B9TA 3NGTA 5KT7A 3O3LA 4USMA 1S1XA 1JIHA 1NJIT 4GVLA 1IR2A 2Z2MA 3NRBA 3KLIA 1K0VA 1S9EA 2HGLA 3P3DA 1U6ZA 1FRKA 1HYSA 2H4WB 4DR2F 2VBYA 2XB2D 2ATLA 4QZVB 3WC0A 3H25A 2M4MA 1WC0A 1I3OB 3NWGA 5LOQA 1YX2A 2RQ4A 1UP1A 1VR6A 3LANA 2VKZG 2HBQB 2MJNA 3M2VA 5B7WA 4DR3F 1WF0A 2DXDA 5FJ4A 5E3AA 2AGPA 2NZCA 2D7SA 2XQCA 2SXLA 3HKWA 1J2VA 2LQ5A 1NK5A 4IR9A 2RUSA 3R8YA 2CJAA 5B0GA 2K7KA 2HRUA 3DOKA 1JK9B 2PO4A 1RQ0A 4X4NA 5IFMA 4KHMA 1ZM9A 1F9EB 1IR1A 2P5VA 4OZLA 4Q44A 1VK8A 4NCGA 4ZVTB 5AXNA 4XPCA 1X31C 2AV5A 4B3MJ 1DBDA 1M5KC 3HCXA 3KJVB 3BEGB 3PFOA 4ED4A 4C48A 2ERRA 2QLWA 3SV3A 2V4QA 2PMZD 4F2SA 4XDDA 2LECA 3PM9A 3AOBA 5EWGA 1ZPWX 2DH9A 3D0GE 2H9ZA 2BANB 2YNHB 1IBKF 1C0UA 6AT1B 4R0JA 4ID5A 5KFTA 2FZCB 5HN0A 4C4WA 1K44A 5F8NA 2DGUA 3ETOA 5H9EK 3GZ7A 1TKTB 1SC1B 3J7AN 2FY1A 3TZYA 2W2PP 2RU9A 2YXLA 3OXGA 1YZ7A 3KHLA 4OHYA 4U7CA 2G0IA 5HMZA 2RDDA 2XG8A 5B0EA 3ZTSA 5K14A 4RW4B 3GCWP 3KHHA 4J9SA 1S7IA 5KFSA 1O8BA 2HLUA 2OPSB 1TKDA 2DRAA 3UI3A 3H2VE 5DG9A 2F9JA 3FRYA 1T9UA 2B9EA 3VGVA 1E6VB 1JLGA 4LRCA 1FKPB 2HK2A 1J27A 3QFWA 4UW2A 3R1LA 1ZM3A 1N33F 4DSJA 3PIPQ 4DR7F 2MQPA 2YBVA 3IWLA 1C1BB 3M8ZA 3V4IB 1OPIA 1MSWD 3X3UA 2XYGB 5L9NA 3MR6A 1QJHA 3UDLA 3LWMA 4PUOB 1S99A 1WC4A 5B09A 3WC2A 4LSZB 5JVGQ 2BACA 3P45B 1PO6A 3M2RB 3PR4A 3L09A 2P2CB 3R7BB 1GX6A 3R5JB 2WVDA 4IDKB 4KHPJ 1Q82T 2QLXA 3RR7A 4OYBA 4ZVHA 4LVOP 4AQYJ 4NLDA 1HLWA 2FPHX 4LF4F 2RRAA 2JNJA 2GA7A 4YY3J 3CCMS 1BY9A 3DC2A 1WACA 1PJ5A 1ZTWA 3CT9A 1TKXB 1X9WA 3A8EA 2ZBQA 3VWSA 5KFAA 2DO4A 4CLKA 1LW2B 4DUTA 4JI1F 1BUXA 2ZWOA 1Z4UA 5KT6A 3R97A 2ZVIA 1SVDA 1G3OA 4USVA 3HK2A 3PO5A 2ZH7A 4ECVA 4K2XA 3CF5Q 2WW4A 2QMUB 1V6HA 2ZBRA 2BYCA 2NYHA 2LP4A 3N6MA 2QJ3A 2RS8A 5EN1A 2B7BB 3A8JA 4R8UB 3V81B 2CZVC 4P52A 3RR8A 3LALA 2JEJA 3JAMY 2VONA 5H9FK 1J5EF 4EK2A 1OPZA 2FJAB 1PGZA 4UOFA 2EVZA 1RU2A 5C24A 3KK3B 1Y4ZB 1X4HA 4QJVA 1J5OA 2VQFF 2HQCA 3B78A 3C14B 1T9YA 3M32B 2N3LA 2Z57B 3ISZA 3DLGB 4A8MP 1HFEL 3EPIA 2W4CA 2XO7A 4BLGA 2Q3PA 3CXCR 2V9KA 1L3UA 4X4QA 1NKCA 2MXYA 1EB0A 4BC9A 2EC2A 2X3GA 3FBEA 3PW2A 1RWNB 3B54A 1BQMB 2HFZA 2HBRB 2HEKA 3R2CJ 2JH3A 4DX6A 3PCOB 3UQSA 3PR5B 4ZMMA 2VFUA 4LF6F 1R0AB 4FPIA 2VL1A 2WONA 5E5NA 2OMOA 1VFJA 4LSLB 3ENVA 4H4OB 1HHSA 4OYPA 5KG4A 4HACB 1DRZA 3R5GA 3ONQA 2XGQA 3OR1A 4WPAA 4K0KJ 1ZM4A 3GIIA 2YNFB 4J7CA 5C2GA 4F2RA 3FSIA 4A8KA 2BEFA 3BR9A 4RUHA 1SQGA 4WE1B 5KOWA 2CNNB 1ZA2B 3NKYA 2C42A 4KR0B 3MFIA 3HHLC 3IRWP 3T19A 3GU0A 4FF3A 1C1CB 4CLLA 2RKIB 2EBGA 3A1YG 4LUBA 2UUAF 4JYAF 1XJWB 1HL6A 5A6PA 2A6MA 3RGIA 2VBZA 3IS9A 2BE9B 4ZVUB 1Y5IB 2KZZA 2ZKUA 1FE4A 1MU2A 5GMEA 1RLDA 4DBQA 1L3TA 4CH7A 4ES1A 3R9LA 1PKUA 1LK7A 1FJGJ 2V8PA 1RYSA 5F0UA 2XLIA 2ZH3A 3VR1A 3G82B 2CZ4A 2GHPA 1QAYA 4DFPA 1QTMA 1RT6B 2Y1LB 4YDXA 4AD6A 1VS3A 2B0GA 3NOCA 1HBNA 2RB7A 2X51A 2JRSA 2F65A 2CNKB 1CSJA 4CYUB 1DAXA 5CD4A 3FJ2A 3PRVA 4ICLA 3I9V9 3CJSA 2FVRA 2E1CA 3N5FA 1RP5A 4PG8A 5EGYA 2O67A 2RU3A 3PEJA 4ZITA 3M7VA 3CCWA 2X1AA 2RHSB 4YHHF 1FT8A 3MOJB 3FKBA 3CEDA 1RTDB 4LBHA 1RWXB 2AMCB 4EEYA 4NCAA 2Z58B 2MKIA 1WWHA 2B9YA 3MEGB 1YJVA 2MTLA 3TVYA 4BHQA 5A2QY 2ASJA 3KLVA 3I5BA 2QV6A 1T9WA 3TEHB 3K5MA 2HHQA 5DO2A 4YMEA 1BQNA 2E5LJ 3MPDA 3QT8A 2E5GA 4C98A 3K5NA 2UXBF 3CB4A 4WFZA 3J7A1 2LXIA 1HBUA 3OXFA 1M1KT 2ZZTA 3IWNC 2IC3B 1CEZA 4LFBF 4JV2A 3BGUA 3RBXA 2QZ8A 1T05B 4TXSA 4ED3A 2XULA 3BSCA 1RHRB 1AUDA 1KLMB 1KFDA 2ZM6J 2XEXA 3C16A 4RW8B 3LA0A 3JTPA 3NL0A 4EI2A 3OFHA 2LA6A 3IR6B 3PW4A 4DV5F 3IFEA 3HLUA 5DDRC 4PWDA 4LF9J 1LFPA 4RO0A 1OSDA 3KG0A 5I3UB 3ZFVA 4DFKA 1MROA 1H3DA 2Z2YB 2ZJPQ 1N32J 1HKAA 2GFFA 2YH1A 4X4VA 2Y8YA 1U1QA 5HAOA 4OV1A 4ZP7A 1VBYA 2CQ0A 2IMOA 2PMWA 2LA4A 1N52B 3IAS9 1RUSA 1VMBA 3VGSA 2K3KA 4PQUB 3T5HA 2HBYB 1NJXA 3MMCA 1FF2A 1S97A 1YGYA 5HVGA 2ZC4A 2IRYA 2JHEA 1IQTA 3A8KA 4C8YA 3E51A 2YQ0A 2VFSA 2XWYA 4QWCA 4X4UA 2DY1A 3C2PA 1TVRB 3MM9B 2C2NA 4LQ9A 3QAUA 4HHHA 4P7TA 4B08A 1NPKA 4TQRA 1KOHA 1F0XA 3OJSA 5KFDA 3ISNC 3W8GA 1EAYC 3U02A 2FHKA 1HBMB 4Y00A 2JX2A 4DMZA 2R7OA 4GO7X 2M8DB 4X65F 3HI9A 3MZIA 4ZCKA 1OS5A 2YWWA 2W9CB 2GGPB 3PFEA 1F3VA 1QE1A 3D66A 4MKAA 3DXSX 4DL6A 1NJZA 2W24A 3ADAC 1LW0A 4MKBA 4JV0A 3CWJA 4JV5F 5F8HA 2L9DA 4CQ1A 4J90A 2AD9A 4EYHB 3CJKB 3C6UA 3PJWA 4ES2A 1EP4B 2ASLA 3K89A 2HGNA 3PYDA 2RQKA 1TMMA 3MAAB 5ETQA 5IV4A 2V4JB 2X1BA 3OD2A 1RZMA 3KG1A 2BOPA 4OZ2A 1G7CB 4LF8J 3F44A 1D1UA 5CCLA 3RRKA 3HSGA 6FDRA 3DRPB 2MQOA 4IFVB 3FVYA 3GFHA 1N4LA 2ZNZA 4NRUA 2DJWA 2JLEA 5ETMA 1M5OC 4ALZA 4H4KA 3BBFA 2GIQA 2CA9A 3FBCA 2W2OP 3BF4A 3X1LB 4ZCIA 2ZWPA 4I0WA 1XMQF 1B7FA 2HMIA 2IY5B 4MK7A 1G4CA 4JI2F 1YITS 3G4SS 5L1JA 1NDLA 4WIIA 1U24A 3W65A 4NLPA 1N6QB 3EPGA 4Y2CA 4OL8A 1U49A 3M8RA 2GVZB 3E01B 4ZJQA 2Q6BA 1HPZB 3J7ZT 4CH0S 2KH9A 3DXBA 4DX7A 3D3CJ 2PGCA 3DGVA 4ZVPB 1UWBB 3MECA 4B9UA 1WEYA 3SCJE 5FDLA 1HNWJ 3CCTA 1OO0B 2R2UA 4DPUA 1TKZB 3HHEA 1YJ7A 3EXYA 1VQ8S 4JI3J 3CCUS 2V6AA 4QPTA 1HBOA 1XERA 2LCWA 1LQ9A 1E6YB 1Q8BA 4W90B 3W9JA 4KC5A 3OLBA 3RW7A 4H4MB 5DDPC 1HARA 4GVBA 3JSYA 3V4MA 2MKJA 1FDDA 2OPQA 1EQ0A 3G8TA 2YX1A 4USUA 2V0NA 2EI5A 3PVXA 2HFOA 5CHCB 3UD4P 2YNIB 3SIPB 2NQPA 3H42A 3CUNA 1JLAA 4M1KA 3EYZA 3HVTA 4K4UA 3GJRB 5CQGA 1I51B 2B4UA 1RA6A 4I67A 2DIVA 3QBCA 3DI6B 3JYTB 2HNYA 1FKAF 4TU7A 1NCLA 3VALA 1K47A 2ZITA 3J80Y 4NZ7A 3D7SB 2R7QA 4F4AA 5AJ3J 4F50A 4WP3A 3ZZOA 5HLFB 4UOHA 1D9DA 3H40A 4KKOB 5M2PA 1FNMA 3KMSA 2HWIA 5LJ5Y 3P5TL 5EUHA 5KFRA 1UZHA 3D3BJ 2L9NA 4WP9A 1T94A 2W8LA 2HQ3A 4K7QA 4YEAA 5A0YB 2BQ3A 4Z37A 4ANDA 5ETVA 3R2DJ 4WZQA 1ZBTA 2DH8A 3QFHA 2DRBA 2XMWA 2FJXA 3HFZB 2C3MA 3TA2A 4ECQA 4NEZA 1JMTA 5J2PB 3HFKA 3I0SA 4BDPA 4QWEA 1IKVB 4IQXA 3CC7S 2KG0A 4LFCJ 3CD7A 4JI7J 1EETB 1GNKA 3AD7C 2FHJD 3KXDA 1WORA 4NYOA 3UFCX 2FZKB 2BE2B 5KFVA 1RABB 4MKYA 1RAHB 1ZAVA 2KU7A 3MPVA 3QJLA 2YWKA 2C3PA 5KAKA 3JTNA 4OMFG 2QN6B 1RHKB 3MXHP 2OFHX 4TY8A 3DLKA 3TJ8A 5GVQA 4N8OA 3Q86A 5EHHA 3HDSA 1IBLF 4FF1A 1Y00A 4OZNA 1CS4A 1WEXA 1U45A 2YWGA 4LIRA 2UXDF 1YBUA 2HVZA 1TR0A 4H4KC 5A6WA 1PJ6A 5FD1A 1AW0A 4NI2A 3M2UB 2J7KA 1XWLA 3KNAA 2R7XA 2HNDA 4OX9F 5DM7Q 2HVHA 1SL0A 4B9MA 2B9WA 4RKUC 3RRGA 3GJSB 2DB1A 2E5JA 5IWAF 2QA2A 1V3RA 1OY6A 1X0FA 1VBKA 1H2TZ 2ZH6A 5LMUF 1WOSA 1X5SA 2FLPA 4Z2XA 2MQLA 3H2UB 2FQQB 3THVA 1YJNS 3EDRB 4M5KA 3QPIA 1EX8A 1U48A 3O44A 5GADI 2HHWA 1RSCA 3OFFA 2F1FA 3IM9A 3EM1A 3RBDA 1TU0B 3AA8A 3TO8A 2JWNA 1FA0A 1RAFB 2KI2A 3DM2A 1RWUA 3EDQB 2MQQA 3GV8B 2AJ0A 5DZ7A 2MLXA 4DL7A 2V4RA 3FNNA 5J1PA 1S72S 3LAMA 1WC3A 3Q8YA 1H73A 4E8UA 2B6AB 4XO0A 2IDEA 1IM4A 4RZRA 4LF2A 4Q43A 3MR5A 5HATA 3KWMA 4MFBA 2GNKA 3SSSA 4K4ZA 3VAGA 3W5ZA 1ZH5A 2NSCA 1EKSA 4URSA 4J9UE 4WU3A 1RHQB 2MEWA 2FVSA 2VPYB 1BLUA 2JLFA 3HSDA 1CC7A 2MQNA 3CJ3A 5AXKA 4DR4J 2YNHA 4QYZJ 2ZNYA 4DZ6A 2IBOA 1IN0A 3QZ8A 5CXTA 3M8PB 4A8WA 3ZZYA 2PN6A 4QCLA 3UR3C 5HJYA 3H5SA 1QTNB 3R7SB 4LRFA 4J9RA 1YRXA 3G86A 5FIIA 1JXEA 4B3MF 3NNHA 1JLEA 2MPUA 4NLYA 2UU9J 2XI3A 4LRBA 1UVNA 1T9XA 2VFVA 1CC8A 1QSLA 5HQ8A 4C3KA 2ZZMA 3H8YA 5J1EB 2Y9HA 5KFIA 1VYAA 2VG7B 2KFYA 4JV1A 2DKOB 2LKZA 1IKWB 1KNZA 3CULA 2OPSA 3Q8QB 1LWEA 2RD5C 1TFWA 3KHGA 3NCPA 4QR0A 2GO9A 4HI1A 1FXDA 2A10A 4RW6B 3W60A 4P2SA 4ZLPA 1T02A 4JI4J 4QIGA 2V68A 2OEJA 4W92B 1CJTB 3WDOA 2CQ3A 3Q83A 1ZOTA 3BQ0A 5IC6B 2DR8A 1U47A 4M5GA 4CO2A 2BKOA 4RW9B 1RAJA 3WX8A 1WHYA 1FXRA 4QU7A 5HBMA 3ZZTA 4ECXA 2MZQA 4U7UD 1UETA 1ULRA 2COLA 3T41A 4O3RA 1BQXA 1YK9A 2BQRA 4ZPTR 3DLJA 4ECUA 2CXEA 3LP2B 2PEHA 2F8HA 2AYGA 4I1TA 2MMYA 4O44B 2DCLA 1TUVA 2YKMB 2YKPA 2IIHA 4USKA 2ZHOA 2H1YA 1PAUB 3LO3A 1M1GA 4ZK7M 1S1XB 4DV4F 1U6FA 2J8SA 1X60A 3D6HB 3KLIB 3GV7B 1RKJA 2CJXB 1HYSB 1SV5A 1SKRA 3EX7B 5KG3A 2MSTA 2W7AA 4LJMA 5DLFA 5F8LA 4LFAJ 4ILMA 3DU5A 4Y2KA 1NLKL 4QQBA 3PX4A 2V9WA 4TY9A 2KVQE 2WVBA 1Q78A 2DIUA 3I4PA 2KTQA 3IWXA 5KG2A 1IXKA 1DHMA 4AQYF 1WKJA 2OPRA 1HMVA 1SI9A 3LQVA 4TQSA 3M2VB 4YY3F 1KQFB 4CLYA 1B70B 1NSPA 1ZAXA 1T9VA 3AOAA 2G0JA 5A8KA 2OHDA 1SJQA 4PG7A 1SB6A 4F67A 3AJ1A 4PG4A 2IM1A 4MIAA 1NK9A 5F3ZA 1ZM2A 2G2OA 5LMNJ 4F3OA 2QA4G 4DSLA 3JS9A 1Q7LB 1KOOA 3DOKB 3QJPA 1UPPA 4ZJOA 4DCJB 1KRPA 1CJVA 3JTOA 2K3IA 4NCGB 4I2PA 4RBUA 2BOAA 5D78A 1S6QA 5A8RA 3QO9A 2CDRB 4YR3A 1G6BA 3VV2B 5KFZA 2MZSA 5L38A 1U0HA 1Y10A 2GHVC 2AX1A 1KVIA 5L46A 2IJRA 2VIHA 5IT0A 4C9DA 1ICEB 3W66A 1C0UB 1N56A 2CQPA 4ID5B 3HFVA 3OQ2A 1PYSB 3GG0A 5H1SV 5JUMA 4KHRA 1H7XA 4LT6A 3M9OB 2KZMA 3CGIA 4LIWA 1LWXA 2D74B 1GFWB 2EFNA 5KFHA 4KBIA 2ZOMA 2D9PA 4FXWA 2BQUA 1AROP 4IR1A 3DDKA 5I42A 1WI8A 2WBRA 3BKTA 1RAEB 5K14B 2MB0B 3DDIA 3D5MA 2IRUA 2VOPA 5C25A 3FBFA 4RR5A 1F5AA 3TA0A 3LP1A 1CG2A 3TEGA 4DV0F 3DGPA 4ITSA 1JLGB 4C0OC 3BO4A 4K0KF 1F9HA 3TAQA 4EWTA 3DYAA 3TJ9A 1FDNA 4UUXA 1S5ZA 3IR7B 1U2RA 1UTAA 4KGXB 5GAGU 2CQBA 1U26A 3CDAA 3OSNA 3CJ8A 3MEKA 4B3OA 1SC6A 1DARA 4C8NA 2I1RA 1R8PA 2J0XA 1PSDA 1JQGA 4NYZA 4LR7A 4MIWA 5BYSA 1RT6A 1XQIA 3J7YU 1X4EA 4WTYA 1KP6A 1L3KA 4CP5A 2IYIA 3HJFA 2MJUA 3TR5A 3DNCA 2HHXA 1NHUA 3GG1A 1DTQA 1WC5A 1VRUA 3B4MA 4L76A 3QSYB 5CH7B 1FJGF 2FGOA 1QAJA 1LEOA 4X2BA 3G8SA 1VQSA 3FGVA 2H5EA 3HX9A 4ZVRB 2X7IA 1TAQA 3BM7A 1OSCA 4O3PA 3IXQA 3SI8A 4RNHA 4USIA 4OI2A 2P6TA 4UOCA 3Q89A 3RU0A 2XMUA 3OTEA 3JQJA 1M0SA 2LYVA 1VOMA 2IA0A 3BDEA 5ETPA 4ENOA 4CCHA 2G4BA 1YSJA 1UEKA 3E8OA 2K06A 4OHWA 1D9AA 3EE3A 4IH5A 4R5PA 1NAQA 3FEYB 3QATA 3DHXA 2Q1LA 2ZH2A 2IFXA 5L9XA 2P9EA 2GS8A 5HP1A 2QLFB 1IKYA 4DZDA 2OAUA 1HQ2A 2V8GA 4RU9A 5C24B 4CNYA 2YWEA 2VF3A 2ACYA 1NH7A 3NLCA 4HYKA 1JB0C 1H72C 2BUNA 4NYPA 3T1YJ 3W61A 3W3SA 4OJ3A 5IQ6A 1BWEA 1MN9A 4DR5J 4HI2A 3FEZA 3MCOA 4WFBQ 2WB4A 1F9FA 2E5LF 3I0RA 3R5AA 3LPEA 2R8IA 1P8GA 1WHXA 4NRTA 3AOCA 3FCWA 5AXLA 2XMKA 1VQ5S 2HFSA 3THTA 3WIUA 2RF2A 3OV7A 3F73A 1WKKA 2RRBA 2WONB 2XO6A 1D8ZA 4X64J 4NZ0A 2C28A 1NDPA 3BYPA 4B9VA 4AL6A 2YWHA 1VQKS 2MSSA 2ZM6F 4GMKA 3OR1B 3QIPB 3GPAA 3BGRA 2QA4S 4LR9A 3MM6A 2HKEA 3KTQA 5B0CA 4LF9F 4ANCA 2GO8A 1QAIA 1V5VA 1YIJS 2AJ1A 2CPEA 4QIEA 1N5QA 1OJ4A 3AXKA 4WKRA 1XNRJ 1CBKA 1CQNA 3E2EA 4QW8A 2KJWA 4FYDA 2V2VA 1WSRA 4MMOA 3L95X 5GAEI 2AHOB 4DUZJ 3IS9B 1R89A 4AYBD 1TUWA 4DR1J 2N7CA 4NLUA 2J7UA 4LF5J 1HWUA 4Y34A 1WTFA 1RI7A 4P2XA 4P73A 4YDDB 1N36J 2AEFA 3VQTA 1RU1A 4Q5VA 3UDVA 3RTVA 1RWVB 1K9MT 5F8GA 2BW7A 2QEXS 3S7RA 2J9DE 2MQ8A 4F4XA 2AGQA 1H6KX 4WZMA 3P5BP 4V1Ak 3TUJC 5DETA 4I56A 1NHVA 3WZ0A 1HBNB 2XTJP 2BJDA 2WSEC 5HSPA 3MMJA 4PWUA 4FBTA 2MY8A 1N5YA 1Q7YT 1T8EA 2XHWA 4XTTA 4WFYA 5J2QA 4KE5A 2BJEA 1OQ3A 2IJNA 3BGLA 2ZD1A 2XSFA 3Q0AA 5ETLA 3CDWA 4KGZB 2D3UA 2L41A 4I4BA 3QLHA 3GB0A 2C3YA 4F26A 4U6PA 3KLGA 4LF7J 4NA1A 5E3QA 5KFQA 4LF8F 2ACMA 2EKNA 4ZLLA 4DS4A 3FBBA 1QVGR 5J2MA 4ZJLA 5GMKa 5IQQA 3EVOA 4MH8A 3D1OA 1RBAA 3BYRA 4E2FB 3MUTP 4HT5A 3W1YC 2JDJA 4I64A 1BQNB 2F4VJ 1ROFA 1H38A 1OY8A 2D3O1 4IQMA 3NP5A 3VAJA 4CLPA 3HVAA 3UD5A 4ER8A 1HBUB 4URGA 3EICA 3NCRA 1JLBA 2KHCA 1VC6A 3HHDA 3SFGA 2U1AA 3OFEA 4RBTA 3LTOA 1CLFA 2RILA 1NJWA 3MM5A
chains in the Genus database with same CATH topology
1UTAA 2LFVA 1X60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTA A;  2LFV A;  1X60 A; 
#chains in the Genus database with same CATH topology
 2P9C A;  2YY3 A;  3W5X A;  3I9Z A;  2OGU A;  1EZZ B;  2FJD B;  1U1O A;  1XEZ A;  4HVZ A;  3C16 B;  4DU7 A;  2PI4 A;  1RWM B;  3QJJ A;  1HQE A;  1B4S A;  3F41 A;  2CPD A;  4RPF A;  1VRT A;  4F3Q A;  1HNW F;  4PWD B;  1MRO B;  1KLN A;  4JI3 F;  3POT A;  2E5I A;  2WAQ D;  2UXC J;  4N77 A;  4MT1 A;  3CO0 P;  1A7G E;  2IM2 A;  3MMC B;  4PXD A;  3CE8 A;  5CA5 A;  5D77 A;  2CQ4 A;  4C3L A;  2GQQ A;  4PRF A;  2XCA A;  2W4P A;  1FEE A;  2V2K A;  5HLF A;  2CWK A;  4ZIV A;  5MLC V;  4WXO A;  3BS9 A;  2BDP A;  2RDJ A;  1RHU B;  2YTC A;  2ALY B;  2I9S A;  4Y28 C;  2R8H A;  1H2U X;  4YN3 B;  3IM8 A;  4IH6 A;  3EMT A;  2CFX A;  1QD1 A;  3BZQ A;  4AE5 A;  2AIR B;  4NOH A;  2D3O R;  1QE1 B;  3ET6 A;  3KDO A;  3TZW A;  1FNX H;  1LW0 B;  2VFR A;  1YJT A;  1FDA A;  3T6B A;  4NCB A;  2R9L A;  4USH A;  5AJ3 F;  1KFS A;  5J2N A;  4ETX A;  3FCH A;  4CO4 A;  3ETM A;  1LWF B;  3W2V A;  3OVB A;  4TNO A;  1Z2Z A;  3HVW A;  4PKD B;  3QRP A;  1FX4 A;  5KFB A;  2DK2 A;  4IG3 A;  4QWD A;  4M8L A;  8AT1 B;  4F25 A;  1ELO A;  5HL7 Q;  3TJA A;  5D3G A;  3AJ2 A;  4KJI A;  3RAX A;  1HR0 J;  2NSB A;  2O66 A;  5JVH Q;  4KO0 A;  2ZH9 A;  3OL6 A;  1IJE B;  4YR2 A;  4IOA Q;  5CZV A;  4DV1 F;  3GLJ A;  2ILY A;  4O0N A;  5F3T A;  1CQM A;  1LNQ A;  4QOT A;  3O8W A;  4IKA A;  3KK2 A;  2VQE J;  4J9V A;  2MKY A;  4FS1 A;  2CPY A;  1FX2 A;  1DLO A;  3H98 A;  4LFC F;  3BB5 A;  2HMI B;  4JI7 F;  2HG4 A;  2HPU A;  2V2Q A;  2EXU A;  3BBB A;  4G1P A;  5A2Q U;  2HWH A;  1GT8 A;  4OZ5 A;  4CT9 A;  3G71 S;  1MWY A;  4ZOS A;  3CME S;  3UVJ A;  4DL0 C;  3CC4 S;  3ZC4 A;  2EWH A;  2RRN A;  2Z2L A;  1CPZ A;  3H5X A;  2ZBI A;  4JI5 J;  2EEY A;  3MEC B;  1F1B B;  4YB7 A;  2FB0 A;  5FDL B;  4B02 A;  4ELV A;  1RCX B;  1SIZ A;  4K4W A;  1X9M A;  4MIB A;  5L1I A;  2FC9 A;  5KTQ A;  1HBO B;  2DGX A;  5E2Q A;  3AQP A;  5HO4 A;  2B5J A;  4W4M A;  2M8H A;  4ED6 A;  1TK5 A;  3RG6 A;  1KS2 A;  3ULH A;  3D9B A;  2E1M C;  4RBV A;  4GVB B;  3TA1 A;  2OPQ B;  4FF2 A;  3I5C A;  3H2L A;  3LGH A;  1T0T V;  1S0N A;  2XMA A;  4RJV A;  5KG0 A;  2F3J A;  4P10 A;  1DQA A;  1SL1 A;  2APO A;  5EWE A;  2DNK A;  3VZH A;  4CT8 A;  3WHI A;  1U1M A;  1N88 A;  4K4V A;  4V19 J;  1K0T A;  2RQC A;  1FJ7 A;  3OR2 A;  1P9Q C;  2W25 A;  1W2B R;  4RUB A;  2VAS A;  3ITH A;  3U27 A;  2XLJ A;  1YRU A;  4X62 J;  3KNG A;  1S1T A;  2HHU A;  2AYB A;  1JLA B;  1TL4 A;  4HDH A;  1VBZ A;  3HVT B;  4XDC A;  1K1Q A;  4KH0 B;  3H5U A;  4FYV B;  1BMQ B;  5K9F A;  3K8V A;  4IO9 Q;  1VC0 A;  1XNQ J;  1RGV A;  2RT3 A;  2XGP A;  4C8L A;  2JJ4 D;  3BH7 B;  3MGJ A;  1B3T A;  3CJT A;  4I68 A;  4FS2 A;  4C11 A;  3UN3 A;  4PXB A;  3PEH A;  3DKD A;  2ZH1 A;  3WQP A;  2MKS A;  3OTD A;  3OUY A;  4UUW A;  1ZZN A;  3ENW A;  1AZS A;  2KT5 A;  5J1E A;  2IDL A;  5MAO A;  4DG1 B;  2QLJ B;  3W64 A;  2FHM A;  2XMJ A;  3AQO A;  4QIV A;  5F9N A;  4U67 Q;  3K5P A;  2DXE A;  4DR4 F;  4O4G A;  4DSE A;  1TZ0 A;  3OW2 R;  3RB6 A;  1U8S A;  1KSP A;  4B3T J;  2DXF A;  2IJF A;  3P8B B;  2DNM A;  3UD3 P;  2ZFH A;  4DL2 A;  1FJC A;  1HW8 A;  2JC0 A;  1VLO A;  3KJQ B;  2W9A A;  2UU9 F;  3MF5 A;  3OVS A;  2QFJ A;  1RWW B;  4QWB A;  3R6L B;  4JUZ A;  2F5G A;  4TU8 A;  1B0P A;  3G6Y A;  2OI2 A;  3RBE A;  1M5P C;  2CQ2 A;  4TY8 B;  3DLK B;  2DIT A;  4WTO B;  1N34 J;  2ZBC A;  1UW4 A;  2LXF A;  3PX6 A;  1JLF A;  2A6O A;  3AA9 A;  1CS4 B;  5KFM A;  4JI4 F;  5HK4 A;  2QRR A;  1Q86 T;  2IBK A;  4NI2 B;  2I5J A;  1S1V A;  2K7J A;  2HND B;  3F56 A;  2B7C B;  3H0P A;  4QYZ K;  1QLN A;  4I6A A;  3SCI E;  1U1L A;  5AXM A;  2DHG A;  2YWF A;  4URQ U;  2G1D A;  5D0R A;  1YTY A;  4NEY A;  5HRO A;  2BJ8 A;  2PC6 A;  1VIS A;  4PCQ A;  4DOZ A;  2HZA A;  4MAK A;  2R2S A;  3L7O A;  4RUA A;  1P1L A;  5U47 A;  4CTA A;  2B4O A;  4X66 J;  2JVR A;  5KFE A;  2ZUA A;  1WEL A;  3GSI A;  1RT3 A;  1FTR A;  3DM2 B;  4KIA A;  2DD8 S;  2V8D A;  2IVM A;  2HFV A;  2RUG A;  5K8O A;  1U2F A;  2DNO A;  1NO8 A;  3NGK A;  4LFA F;  2E9Z A;  4KPY A;  3ENQ A;  2ZJQ Q;  2CAJ A;  2XNQ A;  3BQ2 A;  3PW7 A;  2W2N P;  2DPJ A;  1VQP S;  2H65 B;  1R3N A;  5IXU A;  4KQZ A;  2XNR A;  4B9S A;  2E1P A;  4FN5 A;  2I2Y A;  3BQ1 A;  3EZU A;  4F4Z A;  2FLL A;  4MFB B;  4OJG A;  2OEK A;  2JFD A;  3MUR P;  3FFI A;  2GJ2 A;  1Q5Y A;  2KHD A;  4EBD A;  3D0H E;  1X0P A;  1N5S A;  3BPS P;  2W8K A;  1XN9 A;  2PFF B;  2DHX A;  3T1H J;  1CUL A;  4C8O A;  4PYA A;  5LMN F;  2DNQ A;  4DS5 A;  1VQY A;  2XSJ A;  4NAS A;  3S6E A;  3MAH A;  2K1R A;  2P6S A;  5IV3 A;  2XS5 A;  4NXM J;  2XI2 A;  2DGW A;  2Q66 A;  3TUP A;  4CH1 A;  1RWK B;  4OV6 A;  1JLE B;  1SH2 A;  1Q81 T;  3TVZ A;  4Q2L A;  1VK3 A;  3DOL A;  1X7V A;  3AB4 B;  3MCM A;  1QY7 A;  4NLV A;  2BMB A;  1RWO B;  5LJ3 Y;  2MZJ A;  3TNV A;  3D2W A;  2V69 A;  4A48 A;  1IJF B;  3T5K A;  1VQN S;  1W25 A;  1BHN A;  3QGG A;  2W9B A;  1LWE B;  3U7J A;  3G8Q A;  2DNH A;  1S10 A;  4RWW A;  4YB6 A;  3VGT A;  3CO9 A;  5DLG A;  2BXJ A;  5IT9 U;  1SJ3 P;  1RTJ A;  4PPD A;  2R7U A;  3NMR A;  3MR7 A;  3GE9 A;  2OEM A;  4U8Y A;  3HD1 A;  1M1H A;  4OZ3 A;  1KWM A;  4F3M A;  4JBC A;  4RLE A;  2HHV A;  3KLH A;  1SKS A;  5KFK A;  2PE8 A;  1JLQ A;  1X4B A;  1Q8L A;  2E1R A;  2ZHB A;  3MCN A;  5HBM B;  2VG5 A;  2WK4 A;  4Y6I A;  1V5I B;  1QUV A;  4OYW A;  4ED0 A;  3SZ2 A;  4G1Q B;  1FXL A;  4WYW A;  2DR9 A;  1S0M A;  3I31 A;  3V2U C;  1RAO A;  4DR6 J;  1QAX A;  1FVS A;  2FHO B;  1AFJ A;  3BJY A;  1SV5 B;  3UNG C;  2G0C A;  2F63 A;  5KG7 A;  2CQD A;  1VQ6 S;  3Q2T C;  2RDI A;  3HHL D;  5BYQ A;  4Q0B A;  3CDE A;  3O5T B;  2ALZ A;  5C2C A;  2VD3 A;  4CI0 B;  2DNP A;  3ILI A;  2DHA A;  3RRH A;  3KK1 A;  2JL9 A;  2R2R A;  4X4S A;  1GMU A;  1OMS A;  3LGN A;  1HIY A;  4OZJ A;  2RJZ A;  3GIJ A;  3RAQ A;  1NK8 A;  2OPR B;  1HMV B;  4HH1 A;  4P74 A;  3MMA A;  4J9M A;  2RAQ A;  1S9G A;  2LDY A;  4M5N A;  5A8K B;  3BGF A;  2ZUG A;  4M5J A;  3KMQ A;  1EKR A;  2XYP B;  2J8A A;  2CAD A;  5C5J A;  5BJR A;  3SEO A;  1DY3 A;  1T03 B;  1N0V C;  2C2M B;  4U95 A;  2FDN A;  3W62 A;  5ETN A;  3IP0 A;  3GR0 A;  3C15 A;  5CAA A;  4J5O A;  1CJV B;  4A4J A;  3T6J A;  2Z8Q A;  4GRS A;  4ECT A;  5GAH I;  1FER A;  4I2P B;  4EBC A;  2CRL A;  5E0O A;  1S6Q B;  5A8R B;  3QO9 B;  1KR4 A;  1RAI B;  2R8G A;  2VBW A;  4C2M A;  4F8R A;  1U0H B;  1IVZ A;  3UE2 A;  1H2V Z;  2KKH A;  3V6D B;  2W7P A;  2BVZ A;  2VFT A;  3DLE A;  5D15 A;  1O51 A;  2Z4P A;  2KDO A;  4D3H A;  2XZD B;  1FRH A;  2EKY A;  1HNI B;  2V67 A;  3MM7 A;  4IO1 A;  3T1Y F;  3EXC X;  4QR2 A;  4LR8 A;  5DRK A;  1YJR A;  4DX8 H;  3QIP A;  4DR5 F;  1PC4 A;  1BXN A;  5D0E A;  3CCE S;  1CJK A;  1EJ7 L;  3CJ5 A;  1SL2 A;  5KT4 A;  4IRC A;  5J1N A;  3KG4 A;  1RT5 A;  4M5L A;  1A0O B;  3TQ1 A;  4LFB J;  5I42 B;  4KT0 C;  3EGW B;  3MMB A;  5IS2 A;  4WFN Q;  2VH7 A;  3PTW A;  1UMJ A;  3DRR A;  3SMZ A;  1Y7P A;  3BO3 A;  4ILL A;  3CSK A;  3HMJ G;  3VAH A;  5C25 B;  4NXN J;  1YJU A;  4X64 F;  2AU0 A;  3LP1 B;  1XIQ A;  4O23 A;  3D28 A;  3DGP B;  1LKZ A;  3P96 A;  5ETO A;  4KH1 B;  2JOQ A;  2IRX A;  4KSE B;  1FFG B;  2DGO A;  1SC4 B;  2NUH A;  5B0D A;  1VHI A;  3DYA B;  2A2C A;  1VDH A;  1X4G A;  4RU2 A;  2O1P A;  1BGX T;  2AWZ A;  4OZ0 A;  3I56 S;  4ZKA A;  4B3O B;  3CCJ S;  5THW A;  3AHP A;  1WHW A;  4ECR A;  3IBC B;  1P27 B;  3OT9 A;  4A46 A;  4WCE Q;  1XNR F;  2OSR A;  1ZYQ A;  2Z0G A;  3OJU A;  3D1Q A;  2EW9 A;  4PXC A;  7AT1 B;  4S0M A;  1NEE A;  1U6B A;  4I6Y A;  3R7N B;  1TL3 A;  2P9G A;  4DUZ F;  4HL9 A;  2KVI A;  1HNZ J;  4DR1 F;  3CCL S;  4LF5 F;  1F5B A;  4YP3 A;  4HHU A;  1PIE A;  1JLC A;  1F2G A;  3HPO A;  1DTQ B;  3BGO P;  4DQS A;  1N36 F;  1VRU B;  4M95 A;  2L48 A;  4OI3 A;  1XR7 A;  3BN4 A;  5M2U A;  3EZO A;  3QWP A;  2RSQ A;  2VB6 A;  3KUH A;  2FTR A;  1Q0N A;  2VJU A;  2QTW A;  3DMJ A;  3PZP A;  1MML A;  3EVM A;  4MYU A;  5KT2 A;  2FD2 A;  3JXO A;  1NPP A;  2LQJ A;  3KLF A;  4NX9 A;  1N5V A;  3MAQ A;  2EFP A;  2XHC A;  1NM2 A;  4CIO A;  1REG X;  3D67 A;  1S0O A;  5KFJ A;  3DU6 A;  2K8G A;  1HA1 A;  3AXM A;  2F8E X;  1GMW A;  4G1I A;  4R5P B;  1W7W A;  5KFF A;  3NMA A;  3ZNU A;  1S6O A;  3NWR A;  2ZHA A;  4RWX A;  5HP1 B;  2FJW A;  2XCP A;  5HJX A;  1IKY B;  4ANE A;  4DSK A;  1RJJ A;  4LF7 F;  4CO1 A;  3PY8 A;  4ED7 A;  4C0H A;  2M88 A;  1ZA1 B;  1Y5N B;  4F0M A;  2I8E A;  2WOM A;  2LVW A;  2EK6 A;  2DGQ A;  1FEH A;  2DBB A;  2QO3 A;  2DYA A;  2XY5 A;  1R0B G;  3RB3 A;  3I0R B;  5I3P A;  1K1S A;  2F4V F;  2NXE A;  1SJ4 P;  5CD4 H;  3SCK E;  1FK9 A;  2QSW A;  2RF2 B;  3CC2 S;  3NY0 A;  3Q23 A;  4CRJ A;  2HLT A;  3QRQ A;  2FYX A;  2PT0 A;  1GTE A;  4DPT A;  2DGT A;  2ZH5 A;  2E29 A;  1P6T A;  5LXY A;  2HHH J;  1SH3 A;  1V3S A;  3MED A;  5G0R A;  3ZZU A;  2B8Q A;  3I55 S;  3NNA A;  2WVE A;  3QGH A;  2FJB B;  3SBM A;  2WCX A;  1F6T A;  2CYY A;  1RTH A;  3BGR B;  4DLE A;  3R3T A;  2G2Y A;  3MM6 B;  4L3K A;  2ATC B;  4DV7 J;  2UV8 A;  2MHN A;  3IBW A;  5DDO C;  1FWL A;  3TUZ C;  4NWB A;  2UXC F;  5T14 A;  1IWG A;  1AFI A;  1FNO A;  2N4D A;  2DO0 A;  1HNX J;  2N7Y A;  5BR8 J;  4L73 A;  2JC1 A;  4ERD A;  1VLY A;  1MMN A;  4N41 A;  2NCK L;  3I82 A;  2ZE2 A;  5F9L A;  4BC7 A;  1LWF A;  2BA9 A;  5KT3 A;  2ZZN A;  2RH3 A;  3OBI A;  2VC1 A;  1KQK A;  3I87 A;  2LFV A;  2MKH A;  2YPY A;  3NEK A;  2KB2 A;  1B0T A;  1HWL A;  2VG6 A;  1F5C A;  1X4D A;  3B4D A;  5KFY A;  3IAM 9;  4N76 A;  1H7W A;  3AT1 B;  4UST A;  3OHB A;  1N5Y B;  2GVD A;  1V3Z A;  5J2Q B;  3SV4 A;  4C6A A;  1UL3 A;  1GEH A;  1ZET A;  2ZD1 B;  1WF1 A;  2A3J A;  4A8Q A;  2JSX A;  4XIU A;  2E9R X;  5CYQ A;  4DN9 A;  3CMA S;  9RUB A;  3QLH B;  2DHH A;  3KLG B;  1SKW A;  1DFD A;  3MR2 A;  3DHW C;  3NGR A;  5KG5 A;  3N0V A;  3T5J A;  3M1V A;  2J6S A;  1ZPV A;  4HTI A;  4Q8E A;  1PC5 A;  5J2M B;  1HR0 F;  2C1E B;  3QT6 A;  4BCA A;  5L8R C;  2IA6 A;  3EJM A;  3MTK A;  5EWF A;  3US5 A;  2VQE F;  3T5L A;  2RHQ B;  3IA0 A;  3AOD A;  1RB0 A;  3BKU A;  3M8Q A;  2Y1I A;  4IFY A;  2HZV A;  3B82 A;  5F8M A;  4M5M A;  2HQF A;  3N4W A;  2CQI A;  1JLB B;  3DN9 A;  1D9F A;  2IHR 1;  4B3S J;  3K8W A;  5DZ6 A;  2W2M P;  3MM5 B;  2B4V A;  1O6X A;  1B7Y B;  1N54 B;  1UVI A;  1F3F A;  4JI5 F;  1JKH A;  3NGS A;  3NAI A;  1Y11 A;  4HR2 A;  3DRS A;  1HQE B;  1EAR A;  1VRT B;  2ABY A;  1HI0 P;  1MWQ A;  3HD2 A;  4GO5 X;  1TL1 B;  3Q8P B;  4ZHR A;  4ZCM A;  2DR5 A;  3BV8 A;  2OFG X;  2GHW A;  3J7Z 5;  1JX4 A;  1K73 T;  3BRE A;  2Q6C A;  1N0U A;  3LF0 A;  2OO4 A;  1D09 B;  1L5U A;  3W2W A;  4O3Q A;  5ETT A;  1NBE B;  3POT B;  4OYX A;  3MM8 A;  4OYI A;  2MZR A;  2C2O B;  2HQG A;  4KB7 A;  1M5H A;  2OKQ A;  1RAA B;  3PYF A;  1N48 A;  4B3R J;  4PYD A;  1U1R A;  2B56 A;  1AXQ A;  3WX4 A;  1KD1 T;  3RUB L;  3FMB A;  4OI4 A;  3R1H A;  2J9D A;  3G6X A;  1IKX A;  4PWW A;  3K17 A;  4K5S A;  1SUQ A;  3MUV P;  1UPM B;  1VGY A;  2FGC A;  4ZPW R;  3IN5 A;  4EBE A;  2EC0 A;  2BV3 A;  2B3T B;  4HHJ A;  1XMO J;  2HBZ B;  2I6W A;  4N7T A;  3WIV A;  4X62 F;  1NSK L;  1RLC L;  1YZ6 A;  1XMB A;  5IT4 A;  1WOO A;  4CLT A;  4FKX A;  4Y0F A;  3AAW B;  2DNR A;  4DG1 A;  2ZDO A;  3VCD A;  3ET6 B;  4JI0 J;  4OLP A;  1NK7 A;  1B99 A;  1GMV A;  3HF5 A;  4AXI A;  1I6J A;  2IM3 A;  9ATC B;  1XNQ F;  4KV8 A;  5KG1 A;  3R27 A;  5J2N B;  4K2J A;  1X5O A;  4QIW D;  2YKN A;  5DG8 A;  3W2V B;  4ZN3 A;  3F0N A;  3SSR A;  4IG3 B;  1S49 A;  4A8S A;  1LOU A;  4P72 A;  2G9O A;  5HMY A;  3ILO A;  1WI6 A;  3MFH A;  5D3G B;  4YB1 P;  2YQ3 A;  1RTI A;  3TX8 A;  4P71 A;  4KO0 B;  1KHV A;  1H98 A;  5KOX A;  3BH6 B;  3CCS S;  1HI1 A;  2DEJ A;  1GX5 A;  2C2D A;  4JI8 J;  3KK2 B;  1IBM J;  1RA7 A;  4B3T F;  4J9Q A;  2XC9 A;  1DLO B;  4ZA1 A;  3QGP A;  3LUY A;  4NA3 A;  2QMW A;  3D4J A;  4DUY J;  1YQH A;  1NH8 A;  3CJQ A;  4NE9 C;  4ELU A;  2BZ2 A;  1BD6 A;  5IM0 B;  2BJ9 A;  2XMT A;  1AUS L;  1UA1 A;  3PG9 A;  2R7V A;  3UVJ B;  2OUG A;  1APS A;  3OL7 A;  5GAD U;  2UP1 A;  4USW A;  2DRD A;  3L7P A;  2C22 A;  2AJQ A;  4R25 A;  2AF6 A;  1JWW A;  1N34 F;  5C42 A;  2BE7 D;  1B0V A;  2UUB J;  4O3S A;  1S6P A;  3HHL A;  1TQL A;  2MKK A;  1TV6 A;  5DQH A;  2DHS A;  2E44 A;  2MYF A;  4NLG A;  1OY9 A;  4MYT A;  3NAH A;  2ZVS A;  2V63 A;  3SXL A;  1YDL A;  4ZVQ B;  2B5J B;  3C46 A;  3C6T A;  3THP A;  2HS4 A;  3CD6 S;  2JZ5 A;  2L08 A;  4TLQ A;  4K8R A;  4ED5 A;  4PR6 A;  1X5P A;  3BDP A;  3R5B A;  2RML A;  2CDQ A;  1HNV A;  4C8M A;  1EQM A;  5IC4 B;  1JJH A;  1WUU A;  2KYZ A;  5HMW A;  4DV4 J;  4FZV A;  3Q8S B;  3IGN A;  4DV3 J;  1SQF A;  3M4X A;  2FVQ A;  1M90 T;  3OHA A;  2HUR A;  5L1K A;  2C2R A;  3OR2 B;  1R0C B;  2XZW A;  4FDF A;  3OLA A;  2EFO A;  3ITH B;  4X66 F;  2BKP A;  3BBC A;  3GFZ A;  3VQS A;  1S1T B;  3Q2S C;  3RB4 A;  4Q45 A;  2ZJR Q;  2M70 A;  4GKJ J;  4P2M A;  1JXL A;  1FCA A;  3BO2 A;  1VQO S;  1Q53 A;  4FXV A;  3K58 A;  1TL7 A;  4LRA A;  2QYC A;  4M63 A;  3SSQ A;  2EK1 A;  1R43 A;  1Q95 G;  1TL5 A;  5LM7 E;  2NPF A;  4HT7 A;  4C8K A;  2CPZ A;  1FKO A;  4QYR A;  3QRR A;  2ZOG A;  4C11 B;  4I7F A;  3EZ5 A;  1NK6 A;  4OYZ A;  1NHK L;  3M30 A;  3VAK A;  1PBA A;  2ROG A;  2GW8 A;  3OUY B;  2UVW A;  1AZS B;  3T3F A;  5DQI A;  5B08 A;  4Y3C A;  3CVK A;  3T1H F;  2LU1 A;  3HSZ A;  4DL4 A;  3V5R A;  2PFD A;  4O4G B;  3KLE B;  1IQZ A;  1NUE A;  2AZ1 A;  5ITH A;  5HVH A;  2UVR A;  4NXM F;  4ECW A;  2VPW B;  4DI6 A;  3GFX A;  3G87 A;  5EX0 A;  3DLB A;  1VQM S;  3B8H A;  2DTJ A;  4CLS A;  2LQB A;  1FD2 A;  4JI6 J;  2HHP A;  5KFU A;  4CWB A;  3MPY A;  3CPW R;  1Q79 A;  3DOM A;  4ZS6 A;  1NZ8 A;  4TU9 A;  5LT5 A;  1XR6 A;  3LOU A;  4RNM A;  4DL3 A;  2Z2Z A;  1XBW A;  2YNG A;  4ZLJ A;  5G4D A;  2PII A;  1L3S A;  4ECY A;  4PQA A;  2LEA A;  2JLG A;  1JLF B;  1REV A;  1SJF A;  2M3D A;  1RIS A;  3IG1 A;  2BX6 A;  2VOO A;  4G1Q A;  1YG0 A;  3GIK A;  2E9T A;  1UEU A;  3KJF B;  1HW9 A;  2XZT B;  1F2H A;  2I5J B;  1RT4 B;  1S1V B;  4JB8 B;  3GTY X;  1RTZ A;  4RX6 A;  3FMW A;  1QUP A;  2D69 A;  1FFW B;  4LSN A;  3JSM A;  3SQO P;  1WTB A;  1TMJ A;  2ZC3 A;  3NOG A;  3FDS A;  4DV0 J;  1FHT A;  1FRX A;  2WHO A;  1TP7 A;  2HAI A;  3PHT A;  4OX6 A;  2YKA A;  2IPO B;  4NMX A;  5HRO B;  3SQG A;  2D1C A;  2N4C A;  1HQU A;  3ILL A;  3Q8R B;  4KHP F;  4YUD A;  4DL5 A;  5DG7 A;  4CLU A;  4CTA B;  8ATC B;  4J9P A;  3K57 A;  3NS7 B;  5AE3 A;  2O3D A;  3PNI A;  4DWI A;  4OYO A;  3UW1 A;  4ED8 A;  1HD1 A;  1RT3 B;  6FD1 A;  4DR6 F;  2EFQ A;  3TI0 A;  4KGM A;  4ZDN A;  4F02 A;  4B9L A;  1FWK A;  5T41 A;  3A13 A;  4ATN A;  1RT1 A;  4JP8 A;  2DEI A;  3I96 A;  4TYA A;  1A6L A;  4ZVO B;  1X4C A;  3AH6 A;  1T03 A;  3O1L A;  1NSQ A;  3M6V A;  4AXJ A;  1DUR A;  4OQJ A;  2GJI A;  5K8P A;  5JMN A;  3LAK A;  1TTH B;  4HLB A;  2R3V A;  3GON A;  2GIF A;  3W63 A;  2MGZ A;  3KOA A;  2OJ3 A;  4KTQ A;  2DNY A;  2A0F B;  1SJ1 A;  4L75 A;  2VIC A;  3FFI B;  4L3N A;  2KM8 C;  3BSN A;  3KFW X;  3CNQ P;  1SXL A;  1BE4 A;  4HEA 9;  4TLR A;  3G9C A;  3V6D A;  1U09 A;  1CUL B;  2ZKT A;  2QYG A;  3TAN A;  4PG6 A;  2C3U A;  1X8D A;  2HHT A;  1U2C A;  2XSJ B;  1HNI A;  3V6J A;  1ZZF A;  2G2Z A;  2V34 A;  2K1R B;  3OTB A;  4KFB A;  5ETS A;  2FZG B;  2KXN B;  1AT1 B;  3PYE A;  1LXJ A;  5D8H B;  4DLG A;  1Y3J A;  5FLX Y;  2ADB A;  3DRX A;  2QL9 B;  2AZ3 A;  1OIA A;  1JJ2 R;  4KGV B;  2GMJ A;  3R5C A;  2AGO A;  3DOL B;  2Q79 A;  3A12 A;  1Q4R A;  4DQP A;  4ZVE A;  4K4T A;  3JSB A;  4UQT A;  3G6E S;  1KON A;  4WFX A;  2XWX A;  5KG6 A;  2HNZ B;  2RIJ A;  4KGK A;  4FYX B;  4IOB A;  2W9B B;  1UCN A;  1RBL A;  5D0G A;  3IO1 A;  4E0D A;  2ASD A;  3AD8 C;  3NXZ A;  1RYR A;  3PKY A;  4DV2 J;  8RUC A;  2CUY A;  4FYW B;  4ZCL A;  2BW2 A;  2W4D A;  4K5R A;  4W98 A;  1RTJ B;  2WZ1 A;  3DFE A;  4H54 A;  1I94 J;  3TW0 A;  1XR5 A;  1UJ6 A;  2ZEJ A;  4CLF A;  2KG1 A;  1U02 A;  5D6G A;  2NS1 B;  3KLH B;  4UTG A;  1F60 B;  4C8Z A;  3N01 A;  1FRM A;  3K5L A;  2NXJ A;  3JQM A;  3GJT B;  1JLQ B;  1HHQ A;  4NLQ A;  5F8I A;  2VG5 B;  2ASY A;  2V5H G;  4NXN F;  3GR1 A;  2X1G A;  3HKZ D;  2WTF A;  5KFG A;  2MKC A;  1YBT A;  2B51 A;  3ILJ A;  4A8F A;  2M5Y A;  2WVC A;  2NXU A;  2VZ9 A;  2QX0 A;  3TP2 A;  4G65 A;  5CAB A;  1XC9 A;  3KYL A;  2UVU A;  4CLW A;  1Y3K A;  1FD8 A;  3C19 A;  4LRD A;  4RW7 A;  5LXR A;  5D4N A;  2QT7 A;  2OSQ A;  3SDE A;  3FUY A;  4ED2 A;  4GC7 A;  1GQE A;  4Q0B B;  2CPF A;  5M2R A;  4Z7C A;  3M8Y A;  3OFG A;  3HM9 A;  1OQ6 A;  3BKF A;  5E33 A;  4J9L A;  3DLH A;  3H20 A;  4CO0 A;  3KK1 B;  3ZTR A;  2L3M A;  3Q8U A;  3A3N B;  3ZTP A;  1VIX A;  1HNZ F;  4NL5 A;  3MMA B;  1PAE X;  3H7H B;  3M6U A;  4C3M A;  3PX0 A;  5BXI A;  1S9G B;  4OJ1 A;  5D0H A;  1Y5L B;  4KAI A;  2PA8 D;  2IYG A;  3LGM A;  2O5D A;  1D8Y A;  1IBC B;  4L72 B;  2DH7 A;  5BYR A;  4DPO A;  1RAG B;  3VF0 B;  2JEG A;  5JJB A;  2P8I A;  2OML A;  1KDN A;  3J81 Y;  1KTQ A;  3C15 B;  1S1W A;  3QNW B;  4D3G A;  2CJB A;  2R4F A;  2H4Y B;  4TN2 A;  2DNN A;  4X4O A;  5ETR A;  2GQ2 A;  1NB2 A;  2VDH A;  2Y1J A;  5A8W A;  4AL7 A;  4F0H A;  3OPK A;  3TYT A;  1RXO B;  2XMM A;  2ADC A;  1GTH A;  1PYT A;  4A8X A;  1FRL A;  1KEK A;  1T95 A;  2HRY A;  1RAD B;  3UWT A;  3DLE B;  3IR5 B;  4ZN1 A;  4E98 A;  3GIM A;  3M05 A;  3LP0 A;  4Y2A A;  5T7L A;  4G3I A;  3D0I E;  3MM7 B;  1SIW B;  2KT3 A;  1WHV A;  2H3E B;  4DQI A;  2M9K A;  2CNL B;  1S1U A;  2QC3 A;  2YH0 A;  4YOE A;  1CJK B;  3PHE A;  3TX0 A;  2PA3 A;  2BJ1 A;  2HFN A;  1LWC A;  1RT5 B;  4IG0 A;  3FQK A;  2K2P A;  3L4B C;  5GAE U;  2QG9 B;  4CM0 A;  1N32 F;  3MMB B;  2OEL A;  3DRR B;  2FLO A;  1R7I A;  1KC8 T;  1KKH A;  2M2B A;  1URN A;  3N9U C;  3VAI A;  4Z7Y A;  1UVJ A;  2NRE A;  2UUC J;  3CIM A;  2QL5 B;  1Q16 B;  2HHH F;  2WB1 D;  5E3P A;  2MQM A;  4UY8 T;  3KUE A;  2FUG 9;  2XYH B;  3QWU A;  4NLW A;  1HI8 A;  1MWZ A;  5KFW A;  4Y2M A;  4DV7 F;  4I2Q A;  1VQ9 S;  2Y1R I;  2E66 A;  4C97 A;  4PXE A;  1T3N A;  4I6W A;  1TFY A;  2GJF A;  1QM9 A;  2CVI A;  1UFW A;  2J6U A;  3L9Z A;  4OFZ A;  3VTI A;  3NBP A;  1Q8I A;  1HNX F;  1TL3 B;  3NS5 A;  5BR8 F;  3CJ2 A;  2FHJ A;  4Y2I A;  4NLR A;  1UZD A;  1B64 A;  3TWZ A;  1VBX A;  1JLC B;  2LDI A;  3AB2 B;  2EBE A;  1UFK A;  4RNF A;  3QZ7 A;  2VOD A;  1VC5 A;  3ZTO A;  1UVM A;  1SCJ B;  3VGU A;  4ZVS B;  4QW9 A;  2FC8 A;  3T9N A;  2R8K A;  1RT2 A;  5E3R A;  4U7U K;  3MDF A;  4QU6 A;  3G96 A;  4UY8 5;  2X1F A;  3I4H X;  3DMJ B;  1SQE A;  2QL7 B;  3CJ0 A;  1RT7 A;  2I0X A;  3KLF B;  2H5J B;  2HSE B;  3D1H A;  3TRG A;  1T11 A;  3JAM U;  4CM2 A;  2IAJ A;  3JB9 k;  1DTT A;  2NXN A;  3FZ2 A;  2D3Z A;  4HTJ A;  2ILZ A;  3R5D A;  4FXD A;  2FVP A;  1C0T B;  1NKB A;  4WJB A;  3S01 A;  3PV8 A;  4ZPD A;  2PI5 A;  2O01 C;  3K7R A;  3UN2 A;  4LMZ A;  2J0W A;  3IRX A;  2YVS A;  4FPR A;  2J0S D;  4NZ6 A;  2EG1 A;  1JJ4 A;  4FNI A;  2R7T A;  4DV1 J;  2BRL A;  2NUU G;  2BJ7 A;  4LRE A;  3SCL E;  1FI4 A;  4EYI B;  1PYO B;  1WG1 A;  5LSO A;  2D9O A;  4Y65 A;  3EUN A;  1VI7 A;  2WOM B;  1T9T A;  2A2D A;  3KKF A;  4GKK J;  1O5J A;  3W9I A;  2WBM A;  3VAF A;  3D6T B;  1TL1 A;  4YB5 A;  5AE2 A;  3DRY A;  4BWM A;  2VJV A;  3LW5 C;  3H59 A;  3L7U A;  3MTJ A;  4DN0 A;  3IMQ J;  2DGS A;  1MN7 A;  5IT9 Y;  1FES A;  1FK9 B;  1DJ0 A;  4FNH A;  2GZO A;  3TAM A;  4B3S F;  3GSD A;  4M5D A;  3C3L A;  4K50 A;  4ZPC A;  2FY8 A;  1W2I A;  4CLZ A;  1CJU A;  5KFN A;  3MED B;  5G0R B;  3MEE A;  2CQC A;  5CYM A;  2OPP A;  2W01 A;  5KT5 A;  5I4M A;  1RTH B;  1UA0 A;  4PAB A;  1FFS B;  3CTR A;  4DX5 A;  3H4D A;  3W8P A;  1YWX A;  4V19 X;  3ZZP A;  2XBP A;  3LH2 S;  4OJH A;  2A1B A;  2VPZ B;  2OP5 A;  2AYE A;  3PXG a;  3HUL A;  2DGV A;  2C2Z B;  3GFY A;  4EU0 A;  4QPX A;  2CJ9 A;  1UKU A;  5HMX A;  4DQQ A;  4KRW A;  2JVO A;  1D3W A;  1VRQ C;  4B3R F;  4TKT A;  3S1T A;  3CCQ S;  3ELH A;  1ZTT A;  1RWP B;  5B0A A;  4PEO A;  4WWS A;  2F4F A;  2EPI A;  1NKE A;  3GYN A;  2ZH4 A;  3GJQ B;  4EO6 A;  3D6M B;  4DPW A;  2ZE2 B;  2A18 A;  1NDK A;  3QAE A;  3VZI A;  3FRZ A;  2CNO B;  2KRB A;  4OYM A;  1XMO F;  3PJ9 A;  1WEZ A;  1S48 A;  2ZOF A;  2LEP A;  2ZH8 A;  4N56 A;  2F7V A;  1KVK A;  2G1H A;  2NYI A;  1HHT P;  3AY0 A;  1WDD A;  2VG6 B;  4JI0 F;  3BSA A;  2V8H A;  1GXL A;  4P9S A;  1Q8K A;  2XM3 A;  2E7W A;  1QDU B;  4WYL A;  3OTO J;  3UCU P;  4ZVF A;  3ZZR A;  1VJQ A;  1FTC A;  1MNE A;  2GVD B;  2X3D A;  3MWB A;  4NA2 A;  1NSA A;  3KJV A;  3J81 j;  4YS2 A;  1R8A A;  2CQ1 A;  1VQL S;  5CYQ B;  3GCX P;  3MUM P;  4Q2M A;  2I38 A;  5IM0 A;  7FD1 A;  2BAN A;  1QSY A;  4EUV A;  3GQC A;  3M1V B;  4JOU A;  1NK0 A;  2KXH A;  2G13 A;  2CQH A;  1U4B A;  1ITP A;  5B0F A;  3W7B A;  2CJK A;  2QSF A;  2ROE A;  2HQI A;  4UQG A;  4JI8 F;  1IBM F;  3P4U B;  2BJ3 A;  1TKT A;  2EFG A;  4OHX A;  2H48 B;  5ADZ A;  1S79 A;  3M8Q B;  4IFY B;  2Z30 B;  4P2F A;  3OVA A;  4OI6 A;  4ECZ A;  1S77 D;  3ZZ0 A;  4DUY F;  4RW4 A;  1MG7 A;  2NPI A;  4N5S A;  1WD6 A;  3HSJ A;  3DDN A;  3K0J A;  5CCM A;  5D4P A;  5D4O A;  1WF2 A;  3DCA A;  4J9O A;  3ZTQ A;  2IM0 A;  1WG5 A;  4DV6 J;  3G2X A;  1E6V A;  3HHN B;  1JKH B;  2DNL A;  1FKP A;  2GMH A;  3T9Z A;  3DRS B;  1MW7 A;  5LL6 d;  3M9N B;  1X4F A;  1FRI A;  4LF1 A;  1DZ5 A;  4MK9 A;  5E3C A;  1C1B A;  1S6U A;  5I3Q A;  2UUB F;  4WBF A;  2AT1 B;  2PEB A;  4ZHR B;  3V4I A;  4M5H A;  2AW0 A;  2BAB A;  3HHK A;  2HAF A;  1N5T A;  3PYG A;  3LPY A;  1DQ9 A;  2CZ9 A;  4WP8 A;  1BWV A;  1I5O B;  3TAP A;  4R0E A;  4XPE A;  4EZ9 A;  3W2W B;  2MZ1 A;  1YRT A;  2HRT A;  2BM1 A;  4DR2 J;  1OYE A;  4FYY B;  3MM8 B;  4C7Q A;  4P75 A;  4PUO A;  1PJ7 A;  4L74 A;  3V6K A;  4FVC A;  3M2R A;  4A8O A;  2WSC C;  1S59 A;  3HP6 A;  1NRK A;  1H74 A;  1RCO B;  3SYZ A;  4IDK A;  3N5B A;  3L3C A;  2QLB B;  2XS2 A;  1IKX B;  2AJ4 A;  2R42 A;  1SUQ B;  1Y9O A;  4M94 A;  3PW0 A;  4DR3 J;  3OL9 A;  1JNZ B;  1PIL A;  2VPX B;  4DV3 F;  1S9E B;  1TKX A;  2YKO A;  2J76 E;  3BSO A;  1YI2 S;  1LW2 A;  2VA3 A;  1NXI A;  5H9E J;  2CPI A;  4WF9 Q;  1UVK A;  4GKJ F;  4ID8 A;  4LBI A;  1SPB P;  1A9N B;  1LK5 A;  2W2Q P;  1JJC B;  3TVK A;  3UPF A;  1EHW A;  3BR8 A;  2C2K B;  1TAU A;  4MK8 A;  3H90 A;  3RJM B;  4CZC A;  2CPX A;  7FDR A;  3IBF B;  3TZX A;  4ES3 A;  1UWA A;  2FIU A;  3KLE A;  4EO8 A;  4OIX A;  3RW6 A;  4KV8 B;  5CZX A;  1H0H B;  2CKW A;  3GWC A;  4R8U A;  3V81 A;  2L9W A;  1R8H A;  2YKN B;  2VA2 A;  3NS6 A;  2AX0 A;  3EGZ A;  4Q7A A;  4OX7 A;  3RZA A;  2RQM A;  5ETK A;  3CCZ A;  3KK3 A;  3FEX B;  2LLZ A;  1IBK J;  4LBP A;  2CWX A;  3OXL A;  1D0E A;  4OLO A;  3HXM A;  2M7S A;  3PDN A;  1RTI B;  1S0V A;  4F4K A;  2V8V A;  4FVM A;  1IR0 A;  3C14 A;  3H4B A;  3M32 A;  3BPD A;  2Q43 A;  3DLG A;  4ZVG A;  4NLT A;  2FJV A;  4ZP6 A;  1U7L A;  4NML A;  1FDB A;  3QT5 A;  3C66 A;  4WK3 A;  1X5T A;  1BQM A;  2UZA A;  1AYE A;  4ZP8 A;  4JI6 F;  4UZB A;  4QBU A;  2RE1 A;  1RT4 A;  4FF4 A;  2DNG A;  1R0A A;  1KN6 A;  4WKY A;  1LFW A;  1Z2L A;  1LV5 A;  2HS0 A;  3EWG A;  4LSL A;  4H4O A;  1UFL A;  2Z56 B;  4HAC A;  4X4P A;  5C42 B;  1N33 J;  5L1L A;  2CG8 A;  1NJY A;  1SJR A;  4DR7 J;  2IVF B;  4DXL A;  2YNF A;  1KQS R;  1FE0 A;  2HK3 A;  2AJF E;  2V94 A;  1S6P B;  1VQ4 S;  3HHL B;  4OZ1 A;  4ED1 A;  2YPZ A;  3ZNJ 1;  4F36 A;  1NME B;  2PMH A;  4WE1 A;  1TV6 B;  2DR6 A;  2MZT A;  2GAH C;  1U1P A;  2HS3 A;  1OWX A;  4XK8 C;  3A3P B;  3QYY A;  2Y0B B;  2AKW B;  4F4W A;  1R27 B;  1C1C A;  4F7V A;  4O4R A;  1X9S A;  1S12 A;  3C6T B;  2RKI A;  4B9N A;  3FSX A;  5H9F J;  2PD1 A;  4B17 A;  4IYQ A;  2QA1 A;  4MKV A;  1ZS6 A;  5DJB A;  3UDC A;  4LF4 J;  1HNV B;  3H5Y A;  1UJ5 A;  2XY6 A;  4NLO A;  4USJ C;  4BS2 A;  3CCR S;  2KM8 B;  1SKU B;  5F8J A;  3CDU A;  2J7W A;  4JI1 J;  3GIL A;  4PG5 A;  5IZH A;  3G82 A;  4CO5 A;  1TK0 A;  1U1K A;  3UCZ P;  3HT0 A;  3J80 U;  1PCA A;  4DSI A;  1T7P A;  2MY7 A;  2KXF A;  2HQD A;  5GAG I;  1U1N A;  3QID A;  3FK4 A;  1WKL A;  1TL7 B;  1OYD A;  3CJR A;  3PRD A;  3TUI C;  2E1A A;  1ACM B;  3D68 A;  3W9H A;  5DDQ C;  2YX7 A;  1U0S A;  1W26 A;  4A47 A;  4CYU A;  3AFG A;  3PJX A;  4YFU A;  3EGV A;  5LSL A;  3HT3 A;  1TUG B;  1FKO B;  3J7Y I;  5DGB A;  3GIR A;  2HIQ A;  2RS2 A;  2NZ4 A;  2VDI A;  4I7F B;  4DF8 A;  4CO3 A;  4UF4 A;  2WVF A;  1J5E J;  3M30 B;  1SC3 B;  4KY3 A;  2XS7 A;  4XAK A;  2UUT A;  4UT4 A;  4U9R A;  1YBA A;  5L39 A;  5GMD A;  3BN7 A;  2Y8W A;  1RTD A;  2B43 A;  2VQF J;  1AA1 B;  4NLS A;  3MEG A;  3D54 A;  3UNY A;  4IRD A;  3AJD A;  4DJB A;  1G1X A;  3OTC A;  2HNZ A;  3HVR A;  3IC1 A;  3PW5 A;  4OX8 A;  2DNZ A;  1R6V A;  3UDE A;  2HVD A;  1RKI A;  4ZLN A;  5SZT A;  4AUK A;  3UCG A;  1EIY B;  4F4Y A;  4DCO B;  3CIZ A;  3TOQ A;  3N79 A;  2M0G B;  1Z1Z A;  2R7W A;  2BM0 A;  1IWA A;  2JFK A;  5CYJ A;  3CDB A;  4LF6 J;  2QE5 A;  2KYX A;  3DOM B;  4J91 A;  2KO1 A;  2WW8 A;  1TEL A;  2IC3 A;  3M9M B;  4IOC Q;  1BC6 A;  2HYI B;  3ENA A;  3WBZ A;  1J5O B;  4DPX A;  1T05 A;  2YNG B;  3E3X A;  4O0I A;  1KLM A;  3GYG A;  2J6T A;  3VHQ A;  4RW8 A;  1HWJ A;  1WC1 A;  3ICL A;  3VVT A;  3M6W A;  2HVI A;  1O0P A;  1REV B;  4DV2 F;  2YX4 A;  1GH8 A;  5I3U A;  3IG1 B;  4O3N A;  1YKW A;  3UR0 A;  3I6P A;  2XLK A;  1I94 F;  4EFA C;  1Y0H A;  4J9K A;  3MR3 A;  2NR0 A;  2OH2 A;  4F04 B;  1S9F A;  3K2Y A;  3OSP A;  3QSI A;  3JSM B;  4LSN B;  3P6Y C;  5F41 A;  2B8P A;  3CCV S;  5KFL A;  2UUA J;  4JYA J;  4EMD A;  4PQU A;  1CVJ A;  1VQ7 S;  1WC6 A;  1NK4 A;  2QGF B;  1QVF R;  3SQG B;  1NB7 A;  1GAO A;  4EGL A;  2VUG A;  1HQU B;  4WXW A;  1TVR A;  3MM9 A;  3FZB A;  4U8V A;  2BKN A;  3K5O A;  1GXU A;  2XMV A;  3KDN A;  2YQ1 A;  2DR7 A;  1HBM A;  2C3O A;  5KFO A;  2H51 B;  1FO1 A;  4PPZ A;  2R2T A;  1TK8 A;  4RNO A;  2OD6 A;  3HZG A;  1R31 A;  4YQW A;  2PDA A;  2D41 A;  1KTV A;  1P9Y A;  2W9C A;  2GV1 A;  5GAH U;  2WSF C;  2GGP A;  1RT1 B;  5HQL A;  3DLL Q;  2AEJ A;  3KJN B;  3K59 A;  2F40 A;  3PAC A;  1MU2 B;  1WDT A;  4MTP A;  1NDC A;  1HWI A;  3CW2 C;  3CJK A;  3MPW A;  3CD0 A;  2YKQ A;  1QSS A;  1EP4 A;  1NZA A;  3MI7 X;  3CD5 A;  2MGZ B;  4L6V 3;  3MAA A;  2V4J A;  1YJ9 S;  1R8B A;  3TQE A;  4YHH J;  2FLN A;  4IRK A;  2DVI A;  2J9E A;  2R8J A;  3IGV A;  3EVW A;  4FP9 A;  3KHR A;  1HD0 A;  3DRP A;  4HH0 A;  4AT1 B;  4IFV A;  4LQ3 A;  1XK8 A;  2UV8 G;  4IH7 A;  4WK1 A;  2FVC A;  4QR1 A;  1S57 A;  1R8C A;  4DSF A;  3EGN A;  1WOP A;  2GC8 A;  3ZXW A;  2DIS A;  1UAW A;  4KFB B;  3RB0 A;  4WIQ A;  2J5A A;  4K4Y A;  2VHG A;  1M5V C;  1C4C A;  4ICL B;  1NPR A;  4ETZ A;  4HKQ A;  5HI7 A;  4AL5 A;  2UXB J;  1Q1K A;  1UW9 A;  3A4T A;  1HWK A;  3A8I A;  1N6Q A;  2RNE A;  2GML A;  1UVL A;  2GVZ A;  2CG4 A;  3E01 A;  1HPZ A;  4OHZ A;  4OI0 A;  5K8N A;  4RNN A;  3Q8V A;  3FQL A;  1WG4 A;  1PBU A;  1UWB A;  1YLX A;  4ZIW A;  1U8W A;  1IM6 A;  1GK8 A;  2J9C A;  4DV5 J;  3PO4 A;  3ZZZ A;  2OTJ S;  4OI1 A;  3O6Q A;  3JQK A;  2QMX A;  4YR0 A;  1YVF A;  2HFU A;  1TKZ A;  2MLY A;  3MD3 A;  3QMQ A;  4J9N A;  2GIR A;  4MJK A;  1RE1 B;  2HIY A;  2GAG C;  4G6V B;  3PIO Q;  1SBR A;  4F0K A;  4K4X A;  4N8N A;  3U1L A;  1E6Y A;  1JNR B;  4OHV A;  4DCP B;  4X4R A;  3T1A A;  1RHM B;  2J0Q D;  2AQ4 A;  2QFI A;  4PAA A;  4TYB A;  4H4M A;  4K59 A;  4WFA Q;  2NLW A;  3GP9 A;  3M8S A;  2POK A;  4CDI A;  4K4S A;  5EDW A;  2KJV A;  1VJW A;  2UUC F;  1VHF A;  3Q24 A;  3HO1 A;  4PZV A;  4WU2 A;  1UEV A;  2H54 B;  2YNI A;  4RL1 A;  1FVQ A;  2LU2 A;  3FC9 A;  2UVV A;  2AEM A;  4X65 J;  2FJE B;  5KFC A;  2LXU A;  1P1T A;  4RW7 B;  4QWA A;  5HAN A;  3ISN D;  4ZPB A;  5AE1 A;  1V9O A;  4UOG A;  3SDE B;  5HVF A;  4GC6 A;  4QIF A;  3W5Y A;  2HHS A;  2EFV A;  3DI6 A;  1U25 A;  3G6V A;  3JYT A;  1PG5 B;  4JV5 J;  4U96 A;  3N28 A;  2VV5 A;  3QT7 A;  5SUH A;  1WSV A;  3U1M A;  5C7P A;  2MHE A;  3VAM A;  4KKO A;  4DFM A;  5RUB A;  3TZZ A;  4ZPV R;  4NPO A;  1IUJ A;  1C0T A;  2GQC A;  2KFZ A;  2HGM A;  2CPH A;  3HZE A;  3D6F B;  1Q5V A;  2QIF A;  1G2E A;  1S4F A;  2KL8 A;  3NGU A;  3NG8 A;  2F9D A;  2DT9 A;  2VC0 A;  5IOL A;  3MOZ A;  5A0Y A;  1FJE B;  2GX8 A;  1S4E A;  2MDA A;  4EZ6 A;  1MLA A;  2C2E A;  1S1W B;  5J2P A;  3C6U B;  3PKM A;  2KRR A;  3QGI A;  1IKV A;  3S8S A;  2N3O A;  4RUC A;  1C4A A;  1XMQ J;  1JXV A;  2MLZ A;  1EET A;  4JI2 J;  4AFF A;  2VBX A;  5A8W B;  4DQR A;  1WJ9 A;  2ZBP A;  1SH0 A;  2W7O A;  2BE2 A;  5DM6 Q;  1KBR A;  3JSR A;  5FLX U;  3R6G B;  1KHW A;  2W1B A;  3I32 A;  1I1G A;  2AP6 A;  3LP0 B;  5E7O B;  5T7L B;  2NXC A;  2BBE A;  1FRJ A;  3KUG A;  5D4L A;  1S1U B;  1LWC B;  3M2U A;  2LMI A;  2LEB A;  1K8A T;  4IG0 B;  3O2I A;  2VU5 A;  4GKK F;  5LSR A;  2KFN A;  2HVE A;  3CJ4 A;  3B6B A;  1VIO A;  4P6Q A;  1KVJ A;  1AB8 A;  2N82 B;  1GMW D;  4HDG A;  5K8M A;  4X84 A;  5K5M A;  1NU4 A;  4ECS A;  2DCU B;  3AD9 C;  3M8W A;  4UZC A;  1YJW S;  3N6L A;  2E5H A;  4CNZ A;  2ROP A;  1N8R T;  4BWJ A;  1RK8 A;  3I5A A;  3MPU B;  1KQG B;  1YHQ S;  3V6H A;  2CJY B;  2R7S A;  1T3O A;  5E41 A;  4I2Q B;  3P49 B;  3MHY A;  4DF4 A;  3TAR A;  4I69 A;  4KPC A;  1UJ4 A;  5A76 A;  1VCT A;  4DU8 A;  3NGD A;  1WNE A;  1C2P A;  1S7H A;  2M52 A;  2CQG A;  2OTL S;  4X4T A;  4Q8F A;  2AJ2 A;  3M6X A;  3NBP B;  4DDF A;  1XTZ A;  2R7R A;  4NLX A;  3FCV A;  2LQ9 A;  5DQG A;  2B6A A;  3OL8 A;  2E7X A;  1RDR A;  3MD1 A;  4KYZ A;  2JEI A;  5B0B A;  4FBU A;  2RVJ A;  4ILR A;  2Y3Y A;  3QQC D;  1RBO B;  2H5I B;  2OLW A;  5EX3 A;  2LQ8 A;  3UN5 A;  1RT2 B;  5K20 B;  4IUF A;  3UO0 A;  3NCQ A;  4J37 A;  2HNY B;  4DPY A;  3CMQ A;  3RBZ A;  1RT7 B;  2AYM A;  3M8P A;  4M5I A;  2CVE A;  3NNC A;  3N6N A;  2EG2 A;  2E7V A;  2IAJ B;  1L3V A;  1DTT B;  4N47 A;  3OTO F;  4DFJ A;  1NND A;  4ELT A;  3FSY A;  1RAC B;  2OD4 A;  1LXN A;  4P7V A;  4DHV A;  2HZC A;  2JEF A;  2UUW A;  4DEZ A;  3J81 U;  2XY7 A;  1ZAW A;  5F0W A;  2BR0 A;  2PSZ A;  1R6Y A;  2IVY A;  1X4A A;  3IRX B;  5JXS A;  3GV5 B;  5KFX A;  2V50 A;  4LVN P;  2VG7 A;  3ZO7 A;  2IMW P;  1IKW A;  2BRK A;  2B9X A;  3LWL A;  1RHJ B;  1S76 D;  3MCS A;  3SFU A;  1IBL J;  1GXT A;  4RW6 A;  3I0S B;  2UXD J;  1FWP A;  3HJV A;  2VKR A;  5AT1 B;  2Y0S D;  2DY9 A;  1DQ8 A;  1M5S A;  2V2Z A;  1CJT A;  3A3O B;  4BBY A;  3RYL A;  4OX9 J;  4C0B A;  1MMD A;  2U2F A;  2KN4 A;  2GCF A;  3C8Y A;  4ZP9 A;  5IWA J;  5KFP A;  4RW9 A;  3Q22 A;  3U1N A;  2DPI A;  3GMG A;  2F8M A;  3TAM B;  4A8Y A;  1URR A;  3PRB A;  5LMU J;  4OYA A;  4M5D B;  2KT2 A;  3VVU A;  2HW3 A;  4O3O A;  5DGA A;  2OIH A;  2ZDP A;  2HWT A;  1CJU B;  3LP2 A;  4DV6 F;  2B4P A;  4O44 A;  3MEE B;  3GYX B;  2CPJ A;  4FKY A;  3RAM A;  5CYM B;  5HQM A;  2YKM A;  2OPP B;  2WRM A;  4TVA B;  2CIM A;  5DS7 A;  4ZPA A;  2CJQ A;  4B9T A;  3NGT A;  5KT7 A;  3O3L A;  4USM A;  1S1X A;  1JIH A;  1NJI T;  4GVL A;  1IR2 A;  2Z2M A;  3NRB A;  3KLI A;  1K0V A;  1S9E A;  2HGL A;  3P3D A;  1U6Z A;  1FRK A;  1HYS A;  2H4W B;  4DR2 F;  2VBY A;  2XB2 D;  2ATL A;  4QZV B;  3WC0 A;  3H25 A;  2M4M A;  1WC0 A;  1I3O B;  3NWG A;  5LOQ A;  1YX2 A;  2RQ4 A;  1UP1 A;  1VR6 A;  3LAN A;  2VKZ G;  2HBQ B;  2MJN A;  3M2V A;  5B7W A;  4DR3 F;  1WF0 A;  2DXD A;  5FJ4 A;  5E3A A;  2AGP A;  2NZC A;  2D7S A;  2XQC A;  2SXL A;  3HKW A;  1J2V A;  2LQ5 A;  1NK5 A;  4IR9 A;  2RUS A;  3R8Y A;  2CJA A;  5B0G A;  2K7K A;  2HRU A;  3DOK A;  1JK9 B;  2PO4 A;  1RQ0 A;  4X4N A;  5IFM A;  4KHM A;  1ZM9 A;  1F9E B;  1IR1 A;  2P5V A;  4OZL A;  4Q44 A;  1VK8 A;  4NCG A;  4ZVT B;  5AXN A;  4XPC A;  1X31 C;  2AV5 A;  4B3M J;  1DBD A;  1M5K C;  3HCX A;  3KJV B;  3BEG B;  3PFO A;  4ED4 A;  4C48 A;  2ERR A;  2QLW A;  3SV3 A;  2V4Q A;  2PMZ D;  4F2S A;  4XDD A;  2LEC A;  3PM9 A;  3AOB A;  5EWG A;  1ZPW X;  2DH9 A;  3D0G E;  2H9Z A;  2BAN B;  2YNH B;  1IBK F;  1C0U A;  6AT1 B;  4R0J A;  4ID5 A;  5KFT A;  2FZC B;  5HN0 A;  4C4W A;  1K44 A;  5F8N A;  2DGU A;  3ETO A;  5H9E K;  3GZ7 A;  1TKT B;  1SC1 B;  3J7A N;  2FY1 A;  3TZY A;  2W2P P;  2RU9 A;  2YXL A;  3OXG A;  1YZ7 A;  3KHL A;  4OHY A;  4U7C A;  2G0I A;  5HMZ A;  2RDD A;  2XG8 A;  5B0E A;  3ZTS A;  5K14 A;  4RW4 B;  3GCW P;  3KHH A;  4J9S A;  1S7I A;  5KFS A;  1O8B A;  2HLU A;  2OPS B;  1TKD A;  2DRA A;  3UI3 A;  3H2V E;  5DG9 A;  2F9J A;  3FRY A;  1T9U A;  2B9E A;  3VGV A;  1E6V B;  1JLG A;  4LRC A;  1FKP B;  2HK2 A;  1J27 A;  3QFW A;  4UW2 A;  3R1L A;  1ZM3 A;  1N33 F;  4DSJ A;  3PIP Q;  4DR7 F;  2MQP A;  2YBV A;  3IWL A;  1C1B B;  3M8Z A;  3V4I B;  1OPI A;  1MSW D;  3X3U A;  2XYG B;  5L9N A;  3MR6 A;  1QJH A;  3UDL A;  3LWM A;  4PUO B;  1S99 A;  1WC4 A;  5B09 A;  3WC2 A;  4LSZ B;  5JVG Q;  2BAC A;  3P45 B;  1PO6 A;  3M2R B;  3PR4 A;  3L09 A;  2P2C B;  3R7B B;  1GX6 A;  3R5J B;  2WVD A;  4IDK B;  4KHP J;  1Q82 T;  2QLX A;  3RR7 A;  4OYB A;  4ZVH A;  4LVO P;  4AQY J;  4NLD A;  1HLW A;  2FPH X;  4LF4 F;  2RRA A;  2JNJ A;  2GA7 A;  4YY3 J;  3CCM S;  1BY9 A;  3DC2 A;  1WAC A;  1PJ5 A;  1ZTW A;  3CT9 A;  1TKX B;  1X9W A;  3A8E A;  2ZBQ A;  3VWS A;  5KFA A;  2DO4 A;  4CLK A;  1LW2 B;  4DUT A;  4JI1 F;  1BUX A;  2ZWO A;  1Z4U A;  5KT6 A;  3R97 A;  2ZVI A;  1SVD A;  1G3O A;  4USV A;  3HK2 A;  3PO5 A;  2ZH7 A;  4ECV A;  4K2X A;  3CF5 Q;  2WW4 A;  2QMU B;  1V6H A;  2ZBR A;  2BYC A;  2NYH A;  2LP4 A;  3N6M A;  2QJ3 A;  2RS8 A;  5EN1 A;  2B7B B;  3A8J A;  4R8U B;  3V81 B;  2CZV C;  4P52 A;  3RR8 A;  3LAL A;  2JEJ A;  3JAM Y;  2VON A;  5H9F K;  1J5E F;  4EK2 A;  1OPZ A;  2FJA B;  1PGZ A;  4UOF A;  2EVZ A;  1RU2 A;  5C24 A;  3KK3 B;  1Y4Z B;  1X4H A;  4QJV A;  1J5O A;  2VQF F;  2HQC A;  3B78 A;  3C14 B;  1T9Y A;  3M32 B;  2N3L A;  2Z57 B;  3ISZ A;  3DLG B;  4A8M P;  1HFE L;  3EPI A;  2W4C A;  2XO7 A;  4BLG A;  2Q3P A;  3CXC R;  2V9K A;  1L3U A;  4X4Q A;  1NKC A;  2MXY A;  1EB0 A;  4BC9 A;  2EC2 A;  2X3G A;  3FBE A;  3PW2 A;  1RWN B;  3B54 A;  1BQM B;  2HFZ A;  2HBR B;  2HEK A;  3R2C J;  2JH3 A;  4DX6 A;  3PCO B;  3UQS A;  3PR5 B;  4ZMM A;  2VFU A;  4LF6 F;  1R0A B;  4FPI A;  2VL1 A;  2WON A;  5E5N A;  2OMO A;  1VFJ A;  4LSL B;  3ENV A;  4H4O B;  1HHS A;  4OYP A;  5KG4 A;  4HAC B;  1DRZ A;  3R5G A;  3ONQ A;  2XGQ A;  3OR1 A;  4WPA A;  4K0K J;  1ZM4 A;  3GII A;  2YNF B;  4J7C A;  5C2G A;  4F2R A;  3FSI A;  4A8K A;  2BEF A;  3BR9 A;  4RUH A;  1SQG A;  4WE1 B;  5KOW A;  2CNN B;  1ZA2 B;  3NKY A;  2C42 A;  4KR0 B;  3MFI A;  3HHL C;  3IRW P;  3T19 A;  3GU0 A;  4FF3 A;  1C1C B;  4CLL A;  2RKI B;  2EBG A;  3A1Y G;  4LUB A;  2UUA F;  4JYA F;  1XJW B;  1HL6 A;  5A6P A;  2A6M A;  3RGI A;  2VBZ A;  3IS9 A;  2BE9 B;  4ZVU B;  1Y5I B;  2KZZ A;  2ZKU A;  1FE4 A;  1MU2 A;  5GME A;  1RLD A;  4DBQ A;  1L3T A;  4CH7 A;  4ES1 A;  3R9L A;  1PKU A;  1LK7 A;  1FJG J;  2V8P A;  1RYS A;  5F0U A;  2XLI A;  2ZH3 A;  3VR1 A;  3G82 B;  2CZ4 A;  2GHP A;  1QAY A;  4DFP A;  1QTM A;  1RT6 B;  2Y1L B;  4YDX A;  4AD6 A;  1VS3 A;  2B0G A;  3NOC A;  1HBN A;  2RB7 A;  2X51 A;  2JRS A;  2F65 A;  2CNK B;  1CSJ A;  4CYU B;  1DAX A;  5CD4 A;  3FJ2 A;  3PRV A;  4ICL A;  3I9V 9;  3CJS A;  2FVR A;  2E1C A;  3N5F A;  1RP5 A;  4PG8 A;  5EGY A;  2O67 A;  2RU3 A;  3PEJ A;  4ZIT A;  3M7V A;  3CCW A;  2X1A A;  2RHS B;  4YHH F;  1FT8 A;  3MOJ B;  3FKB A;  3CED A;  1RTD B;  4LBH A;  1RWX B;  2AMC B;  4EEY A;  4NCA A;  2Z58 B;  2MKI A;  1WWH A;  2B9Y A;  3MEG B;  1YJV A;  2MTL A;  3TVY A;  4BHQ A;  5A2Q Y;  2ASJ A;  3KLV A;  3I5B A;  2QV6 A;  1T9W A;  3TEH B;  3K5M A;  2HHQ A;  5DO2 A;  4YME A;  1BQN A;  2E5L J;  3MPD A;  3QT8 A;  2E5G A;  4C98 A;  3K5N A;  2UXB F;  3CB4 A;  4WFZ A;  3J7A 1;  2LXI A;  1HBU A;  3OXF A;  1M1K T;  2ZZT A;  3IWN C;  2IC3 B;  1CEZ A;  4LFB F;  4JV2 A;  3BGU A;  3RBX A;  2QZ8 A;  1T05 B;  4TXS A;  4ED3 A;  2XUL A;  3BSC A;  1RHR B;  1AUD A;  1KLM B;  1KFD A;  2ZM6 J;  2XEX A;  3C16 A;  4RW8 B;  3LA0 A;  3JTP A;  3NL0 A;  4EI2 A;  3OFH A;  2LA6 A;  3IR6 B;  3PW4 A;  4DV5 F;  3IFE A;  3HLU A;  5DDR C;  4PWD A;  4LF9 J;  1LFP A;  4RO0 A;  1OSD A;  3KG0 A;  5I3U B;  3ZFV A;  4DFK A;  1MRO A;  1H3D A;  2Z2Y B;  2ZJP Q;  1N32 J;  1HKA A;  2GFF A;  2YH1 A;  4X4V A;  2Y8Y A;  1U1Q A;  5HAO A;  4OV1 A;  4ZP7 A;  1VBY A;  2CQ0 A;  2IMO A;  2PMW A;  2LA4 A;  1N52 B;  3IAS 9;  1RUS A;  1VMB A;  3VGS A;  2K3K A;  4PQU B;  3T5H A;  2HBY B;  1NJX A;  3MMC A;  1FF2 A;  1S97 A;  1YGY A;  5HVG A;  2ZC4 A;  2IRY A;  2JHE A;  1IQT A;  3A8K A;  4C8Y A;  3E51 A;  2YQ0 A;  2VFS A;  2XWY A;  4QWC A;  4X4U A;  2DY1 A;  3C2P A;  1TVR B;  3MM9 B;  2C2N A;  4LQ9 A;  3QAU A;  4HHH A;  4P7T A;  4B08 A;  1NPK A;  4TQR A;  1KOH A;  1F0X A;  3OJS A;  5KFD A;  3ISN C;  3W8G A;  1EAY C;  3U02 A;  2FHK A;  1HBM B;  4Y00 A;  2JX2 A;  4DMZ A;  2R7O A;  4GO7 X;  2M8D B;  4X65 F;  3HI9 A;  3MZI A;  4ZCK A;  1OS5 A;  2YWW A;  2W9C B;  2GGP B;  3PFE A;  1F3V A;  1QE1 A;  3D66 A;  4MKA A;  3DXS X;  4DL6 A;  1NJZ A;  2W24 A;  3ADA C;  1LW0 A;  4MKB A;  4JV0 A;  3CWJ A;  4JV5 F;  5F8H A;  2L9D A;  4CQ1 A;  4J90 A;  2AD9 A;  4EYH B;  3CJK B;  3C6U A;  3PJW A;  4ES2 A;  1EP4 B;  2ASL A;  3K89 A;  2HGN A;  3PYD A;  2RQK A;  1TMM A;  3MAA B;  5ETQ A;  5IV4 A;  2V4J B;  2X1B A;  3OD2 A;  1RZM A;  3KG1 A;  2BOP A;  4OZ2 A;  1G7C B;  4LF8 J;  3F44 A;  1D1U A;  5CCL A;  3RRK A;  3HSG A;  6FDR A;  3DRP B;  2MQO A;  4IFV B;  3FVY A;  3GFH A;  1N4L A;  2ZNZ A;  4NRU A;  2DJW A;  2JLE A;  5ETM A;  1M5O C;  4ALZ A;  4H4K A;  3BBF A;  2GIQ A;  2CA9 A;  3FBC A;  2W2O P;  3BF4 A;  3X1L B;  4ZCI A;  2ZWP A;  4I0W A;  1XMQ F;  1B7F A;  2HMI A;  2IY5 B;  4MK7 A;  1G4C A;  4JI2 F;  1YIT S;  3G4S S;  5L1J A;  1NDL A;  4WII A;  1U24 A;  3W65 A;  4NLP A;  1N6Q B;  3EPG A;  4Y2C A;  4OL8 A;  1U49 A;  3M8R A;  2GVZ B;  3E01 B;  4ZJQ A;  2Q6B A;  1HPZ B;  3J7Z T;  4CH0 S;  2KH9 A;  3DXB A;  4DX7 A;  3D3C J;  2PGC A;  3DGV A;  4ZVP B;  1UWB B;  3MEC A;  4B9U A;  1WEY A;  3SCJ E;  5FDL A;  1HNW J;  3CCT A;  1OO0 B;  2R2U A;  4DPU A;  1TKZ B;  3HHE A;  1YJ7 A;  3EXY A;  1VQ8 S;  4JI3 J;  3CCU S;  2V6A A;  4QPT A;  1HBO A;  1XER A;  2LCW A;  1LQ9 A;  1E6Y B;  1Q8B A;  4W90 B;  3W9J A;  4KC5 A;  3OLB A;  3RW7 A;  4H4M B;  5DDP C;  1HAR A;  4GVB A;  3JSY A;  3V4M A;  2MKJ A;  1FDD A;  2OPQ A;  1EQ0 A;  3G8T A;  2YX1 A;  4USU A;  2V0N A;  2EI5 A;  3PVX A;  2HFO A;  5CHC B;  3UD4 P;  2YNI B;  3SIP B;  2NQP A;  3H42 A;  3CUN A;  1JLA A;  4M1K A;  3EYZ A;  3HVT A;  4K4U A;  3GJR B;  5CQG A;  1I51 B;  2B4U A;  1RA6 A;  4I67 A;  2DIV A;  3QBC A;  3DI6 B;  3JYT B;  2HNY A;  1FKA F;  4TU7 A;  1NCL A;  3VAL A;  1K47 A;  2ZIT A;  3J80 Y;  4NZ7 A;  3D7S B;  2R7Q A;  4F4A A;  5AJ3 J;  4F50 A;  4WP3 A;  3ZZO A;  5HLF B;  4UOH A;  1D9D A;  3H40 A;  4KKO B;  5M2P A;  1FNM A;  3KMS A;  2HWI A;  5LJ5 Y;  3P5T L;  5EUH A;  5KFR A;  1UZH A;  3D3B J;  2L9N A;  4WP9 A;  1T94 A;  2W8L A;  2HQ3 A;  4K7Q A;  4YEA A;  5A0Y B;  2BQ3 A;  4Z37 A;  4AND A;  5ETV A;  3R2D J;  4WZQ A;  1ZBT A;  2DH8 A;  3QFH A;  2DRB A;  2XMW A;  2FJX A;  3HFZ B;  2C3M A;  3TA2 A;  4ECQ A;  4NEZ A;  1JMT A;  5J2P B;  3HFK A;  3I0S A;  4BDP A;  4QWE A;  1IKV B;  4IQX A;  3CC7 S;  2KG0 A;  4LFC J;  3CD7 A;  4JI7 J;  1EET B;  1GNK A;  3AD7 C;  2FHJ D;  3KXD A;  1WOR A;  4NYO A;  3UFC X;  2FZK B;  2BE2 B;  5KFV A;  1RAB B;  4MKY A;  1RAH B;  1ZAV A;  2KU7 A;  3MPV A;  3QJL A;  2YWK A;  2C3P A;  5KAK A;  3JTN A;  4OMF G;  2QN6 B;  1RHK B;  3MXH P;  2OFH X;  4TY8 A;  3DLK A;  3TJ8 A;  5GVQ A;  4N8O A;  3Q86 A;  5EHH A;  3HDS A;  1IBL F;  4FF1 A;  1Y00 A;  4OZN A;  1CS4 A;  1WEX A;  1U45 A;  2YWG A;  4LIR A;  2UXD F;  1YBU A;  2HVZ A;  1TR0 A;  4H4K C;  5A6W A;  1PJ6 A;  5FD1 A;  1AW0 A;  4NI2 A;  3M2U B;  2J7K A;  1XWL A;  3KNA A;  2R7X A;  2HND A;  4OX9 F;  5DM7 Q;  2HVH A;  1SL0 A;  4B9M A;  2B9W A;  4RKU C;  3RRG A;  3GJS B;  2DB1 A;  2E5J A;  5IWA F;  2QA2 A;  1V3R A;  1OY6 A;  1X0F A;  1VBK A;  1H2T Z;  2ZH6 A;  5LMU F;  1WOS A;  1X5S A;  2FLP A;  4Z2X A;  2MQL A;  3H2U B;  2FQQ B;  3THV A;  1YJN S;  3EDR B;  4M5K A;  3QPI A;  1EX8 A;  1U48 A;  3O44 A;  5GAD I;  2HHW A;  1RSC A;  3OFF A;  2F1F A;  3IM9 A;  3EM1 A;  3RBD A;  1TU0 B;  3AA8 A;  3TO8 A;  2JWN A;  1FA0 A;  1RAF B;  2KI2 A;  3DM2 A;  1RWU A;  3EDQ B;  2MQQ A;  3GV8 B;  2AJ0 A;  5DZ7 A;  2MLX A;  4DL7 A;  2V4R A;  3FNN A;  5J1P A;  1S72 S;  3LAM A;  1WC3 A;  3Q8Y A;  1H73 A;  4E8U A;  2B6A B;  4XO0 A;  2IDE A;  1IM4 A;  4RZR A;  4LF2 A;  4Q43 A;  3MR5 A;  5HAT A;  3KWM A;  4MFB A;  2GNK A;  3SSS A;  4K4Z A;  3VAG A;  3W5Z A;  1ZH5 A;  2NSC A;  1EKS A;  4URS A;  4J9U E;  4WU3 A;  1RHQ B;  2MEW A;  2FVS A;  2VPY B;  1BLU A;  2JLF A;  3HSD A;  1CC7 A;  2MQN A;  3CJ3 A;  5AXK A;  4DR4 J;  2YNH A;  4QYZ J;  2ZNY A;  4DZ6 A;  2IBO A;  1IN0 A;  3QZ8 A;  5CXT A;  3M8P B;  4A8W A;  3ZZY A;  2PN6 A;  4QCL A;  3UR3 C;  5HJY A;  3H5S A;  1QTN B;  3R7S B;  4LRF A;  4J9R A;  1YRX A;  3G86 A;  5FII A;  1JXE A;  4B3M F;  3NNH A;  1JLE A;  2MPU A;  4NLY A;  2UU9 J;  2XI3 A;  4LRB A;  1UVN A;  1T9X A;  2VFV A;  1CC8 A;  1QSL A;  5HQ8 A;  4C3K A;  2ZZM A;  3H8Y A;  5J1E B;  2Y9H A;  5KFI A;  1VYA A;  2VG7 B;  2KFY A;  4JV1 A;  2DKO B;  2LKZ A;  1IKW B;  1KNZ A;  3CUL A;  2OPS A;  3Q8Q B;  1LWE A;  2RD5 C;  1TFW A;  3KHG A;  3NCP A;  4QR0 A;  2GO9 A;  4HI1 A;  1FXD A;  2A10 A;  4RW6 B;  3W60 A;  4P2S A;  4ZLP A;  1T02 A;  4JI4 J;  4QIG A;  2V68 A;  2OEJ A;  4W92 B;  1CJT B;  3WDO A;  2CQ3 A;  3Q83 A;  1ZOT A;  3BQ0 A;  5IC6 B;  2DR8 A;  1U47 A;  4M5G A;  4CO2 A;  2BKO A;  4RW9 B;  1RAJ A;  3WX8 A;  1WHY A;  1FXR A;  4QU7 A;  5HBM A;  3ZZT A;  4ECX A;  2MZQ A;  4U7U D;  1UET A;  1ULR A;  2COL A;  3T41 A;  4O3R A;  1BQX A;  1YK9 A;  2BQR A;  4ZPT R;  3DLJ A;  4ECU A;  2CXE A;  3LP2 B;  2PEH A;  2F8H A;  2AYG A;  4I1T A;  2MMY A;  4O44 B;  2DCL A;  1TUV A;  2YKM B;  2YKP A;  2IIH A;  4USK A;  2ZHO A;  2H1Y A;  1PAU B;  3LO3 A;  1M1G A;  4ZK7 M;  1S1X B;  4DV4 F;  1U6F A;  2J8S A;  1X60 A;  3D6H B;  3KLI B;  3GV7 B;  1RKJ A;  2CJX B;  1HYS B;  1SV5 A;  1SKR A;  3EX7 B;  5KG3 A;  2MST A;  2W7A A;  4LJM A;  5DLF A;  5F8L A;  4LFA J;  4ILM A;  3DU5 A;  4Y2K A;  1NLK L;  4QQB A;  3PX4 A;  2V9W A;  4TY9 A;  2KVQ E;  2WVB A;  1Q78 A;  2DIU A;  3I4P A;  2KTQ A;  3IWX A;  5KG2 A;  1IXK A;  1DHM A;  4AQY F;  1WKJ A;  2OPR A;  1HMV A;  1SI9 A;  3LQV A;  4TQS A;  3M2V B;  4YY3 F;  1KQF B;  4CLY A;  1B70 B;  1NSP A;  1ZAX A;  1T9V A;  3AOA A;  2G0J A;  5A8K A;  2OHD A;  1SJQ A;  4PG7 A;  1SB6 A;  4F67 A;  3AJ1 A;  4PG4 A;  2IM1 A;  4MIA A;  1NK9 A;  5F3Z A;  1ZM2 A;  2G2O A;  5LMN J;  4F3O A;  2QA4 G;  4DSL A;  3JS9 A;  1Q7L B;  1KOO A;  3DOK B;  3QJP A;  1UPP A;  4ZJO A;  4DCJ B;  1KRP A;  1CJV A;  3JTO A;  2K3I A;  4NCG B;  4I2P A;  4RBU A;  2BOA A;  5D78 A;  1S6Q A;  5A8R A;  3QO9 A;  2CDR B;  4YR3 A;  1G6B A;  3VV2 B;  5KFZ A;  2MZS A;  5L38 A;  1U0H A;  1Y10 A;  2GHV C;  2AX1 A;  1KVI A;  5L46 A;  2IJR A;  2VIH A;  5IT0 A;  4C9D A;  1ICE B;  3W66 A;  1C0U B;  1N56 A;  2CQP A;  4ID5 B;  3HFV A;  3OQ2 A;  1PYS B;  3GG0 A;  5H1S V;  5JUM A;  4KHR A;  1H7X A;  4LT6 A;  3M9O B;  2KZM A;  3CGI A;  4LIW A;  1LWX A;  2D74 B;  1GFW B;  2EFN A;  5KFH A;  4KBI A;  2ZOM A;  2D9P A;  4FXW A;  2BQU A;  1ARO P;  4IR1 A;  3DDK A;  5I42 A;  1WI8 A;  2WBR A;  3BKT A;  1RAE B;  5K14 B;  2MB0 B;  3DDI A;  3D5M A;  2IRU A;  2VOP A;  5C25 A;  3FBF A;  4RR5 A;  1F5A A;  3TA0 A;  3LP1 A;  1CG2 A;  3TEG A;  4DV0 F;  3DGP A;  4ITS A;  1JLG B;  4C0O C;  3BO4 A;  4K0K F;  1F9H A;  3TAQ A;  4EWT A;  3DYA A;  3TJ9 A;  1FDN A;  4UUX A;  1S5Z A;  3IR7 B;  1U2R A;  1UTA A;  4KGX B;  5GAG U;  2CQB A;  1U26 A;  3CDA A;  3OSN A;  3CJ8 A;  3MEK A;  4B3O A;  1SC6 A;  1DAR A;  4C8N A;  2I1R A;  1R8P A;  2J0X A;  1PSD A;  1JQG A;  4NYZ A;  4LR7 A;  4MIW A;  5BYS A;  1RT6 A;  1XQI A;  3J7Y U;  1X4E A;  4WTY A;  1KP6 A;  1L3K A;  4CP5 A;  2IYI A;  3HJF A;  2MJU A;  3TR5 A;  3DNC A;  2HHX A;  1NHU A;  3GG1 A;  1DTQ A;  1WC5 A;  1VRU A;  3B4M A;  4L76 A;  3QSY B;  5CH7 B;  1FJG F;  2FGO A;  1QAJ A;  1LEO A;  4X2B A;  3G8S A;  1VQS A;  3FGV A;  2H5E A;  3HX9 A;  4ZVR B;  2X7I A;  1TAQ A;  3BM7 A;  1OSC A;  4O3P A;  3IXQ A;  3SI8 A;  4RNH A;  4USI A;  4OI2 A;  2P6T A;  4UOC A;  3Q89 A;  3RU0 A;  2XMU A;  3OTE A;  3JQJ A;  1M0S A;  2LYV A;  1VOM A;  2IA0 A;  3BDE A;  5ETP A;  4ENO A;  4CCH A;  2G4B A;  1YSJ A;  1UEK A;  3E8O A;  2K06 A;  4OHW A;  1D9A A;  3EE3 A;  4IH5 A;  4R5P A;  1NAQ A;  3FEY B;  3QAT A;  3DHX A;  2Q1L A;  2ZH2 A;  2IFX A;  5L9X A;  2P9E A;  2GS8 A;  5HP1 A;  2QLF B;  1IKY A;  4DZD A;  2OAU A;  1HQ2 A;  2V8G A;  4RU9 A;  5C24 B;  4CNY A;  2YWE A;  2VF3 A;  2ACY A;  1NH7 A;  3NLC A;  4HYK A;  1JB0 C;  1H72 C;  2BUN A;  4NYP A;  3T1Y J;  3W61 A;  3W3S A;  4OJ3 A;  5IQ6 A;  1BWE A;  1MN9 A;  4DR5 J;  4HI2 A;  3FEZ A;  3MCO A;  4WFB Q;  2WB4 A;  1F9F A;  2E5L F;  3I0R A;  3R5A A;  3LPE A;  2R8I A;  1P8G A;  1WHX A;  4NRT A;  3AOC A;  3FCW A;  5AXL A;  2XMK A;  1VQ5 S;  2HFS A;  3THT A;  3WIU A;  2RF2 A;  3OV7 A;  3F73 A;  1WKK A;  2RRB A;  2WON B;  2XO6 A;  1D8Z A;  4X64 J;  4NZ0 A;  2C28 A;  1NDP A;  3BYP A;  4B9V A;  4AL6 A;  2YWH A;  1VQK S;  2MSS A;  2ZM6 F;  4GMK A;  3OR1 B;  3QIP B;  3GPA A;  3BGR A;  2QA4 S;  4LR9 A;  3MM6 A;  2HKE A;  3KTQ A;  5B0C A;  4LF9 F;  4ANC A;  2GO8 A;  1QAI A;  1V5V A;  1YIJ S;  2AJ1 A;  2CPE A;  4QIE A;  1N5Q A;  1OJ4 A;  3AXK A;  4WKR A;  1XNR J;  1CBK A;  1CQN A;  3E2E A;  4QW8 A;  2KJW A;  4FYD A;  2V2V A;  1WSR A;  4MMO A;  3L95 X;  5GAE I;  2AHO B;  4DUZ J;  3IS9 B;  1R89 A;  4AYB D;  1TUW A;  4DR1 J;  2N7C A;  4NLU A;  2J7U A;  4LF5 J;  1HWU A;  4Y34 A;  1WTF A;  1RI7 A;  4P2X A;  4P73 A;  4YDD B;  1N36 J;  2AEF A;  3VQT A;  1RU1 A;  4Q5V A;  3UDV A;  3RTV A;  1RWV B;  1K9M T;  5F8G A;  2BW7 A;  2QEX S;  3S7R A;  2J9D E;  2MQ8 A;  4F4X A;  2AGQ A;  1H6K X;  4WZM A;  3P5B P;  4V1A k;  3TUJ C;  5DET A;  4I56 A;  1NHV A;  3WZ0 A;  1HBN B;  2XTJ P;  2BJD A;  2WSE C;  5HSP A;  3MMJ A;  4PWU A;  4FBT A;  2MY8 A;  1N5Y A;  1Q7Y T;  1T8E A;  2XHW A;  4XTT A;  4WFY A;  5J2Q A;  4KE5 A;  2BJE A;  1OQ3 A;  2IJN A;  3BGL A;  2ZD1 A;  2XSF A;  3Q0A A;  5ETL A;  3CDW A;  4KGZ B;  2D3U A;  2L41 A;  4I4B A;  3QLH A;  3GB0 A;  2C3Y A;  4F26 A;  4U6P A;  3KLG A;  4LF7 J;  4NA1 A;  5E3Q A;  5KFQ A;  4LF8 F;  2ACM A;  2EKN A;  4ZLL A;  4DS4 A;  3FBB A;  1QVG R;  5J2M A;  4ZJL A;  5GMK a;  5IQQ A;  3EVO A;  4MH8 A;  3D1O A;  1RBA A;  3BYR A;  4E2F B;  3MUT P;  4HT5 A;  3W1Y C;  2JDJ A;  4I64 A;  1BQN B;  2F4V J;  1ROF A;  1H38 A;  1OY8 A;  2D3O 1;  4IQM A;  3NP5 A;  3VAJ A;  4CLP A;  3HVA A;  3UD5 A;  4ER8 A;  1HBU B;  4URG A;  3EIC A;  3NCR A;  1JLB A;  2KHC A;  1VC6 A;  3HHD A;  3SFG A;  2U1A A;  3OFE A;  4RBT A;  3LTO A;  1CLF A;  2RIL A;  1NJW A;  3MM5 A; 
#chains in the Genus database with same CATH homology
 1UTA A;  2LFV A;  1X60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...