1RKIA

Structure of pag5_736 from p. aerophilum with three disulphide bonds
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title The Genomics of Disulfide Bonding and Protein Stabilization in Thermophiles.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Structural genomics, unknown function
total genus 23
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11424 DUF3195 Protein of unknown function (DUF3195)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rkiA01
1RKIA
chains in the Genus database with same CATH superfamily
2AT1B 2W4CA 2FHJD 4ZCKA 5HVHA 5DGBA 1T03B 3ZZZA 1F3VA 3QAUA 5C25B 5BYSA 1WORA 3PM9A 4EZ9A 1RWNB 2N3OA 3GSIA 5KFQA 1N54B 2C3UA 2HFZA 1OIAA 1U1NA 5GAHI 3Q23A 3ET6A 5KT6A 1HL6A 3I0RB 4KYZA 3QGGA 1REVB 3DLJA 3FNNA 2RRBA 3D4JA 5CYQB 3R7SB 1VFJA 4NI2A 1N88A 2XS5A 1QSSA 4B9MA 4JYAJ 1AUDA 1DURA 4LF7F 4NLGA 4Y6IA 3PW0A 1X4CA 2EKYA 4KTQA 2KM8C 1FRLA 2ZVSA 4ZVSB 1KQGB 2MY7A 1CJKB 1SL2A 3I9ZA 4Y34A 1T8EA 2FYXA 4V19X 4ED0A 2IHR1 5E3QA 1N6QA 3I0SB 4J37A 2HVIA 4R25A 1VQ7S 3MR2A 4PG8A 2ZJRQ 1A6LA 4DUTA 3BKUA 3DGPA 5DDOC 1EETB 1IR0A 2IJRA 2OD6A 3T9NA 5E3AA 1UTAA 3LPEA 2JEIA 1PJ7A 3A8KA 1X4FA 3HSDA 2DGOA 1RDRA 4CLSA 3MUVP 1B4SA 4FXVA 3K5OA 3MFHA 1U24A 4P72A 4NOHA 4OHVA 4O0NA 4FYWB 2FJDB 5C42A 2XCAA 3OTDA 2YNFA 3JSYA 2XMMA 4KV8A 4KGKA 2P6TA 4OZ5A 1AW0A 1FRIA 2F3JA 1WHWA 2JC1A 4ZVPB 1S76D 4YHHJ 1RWKB 3RRGA 3CIMA 1FD2A 4M5MA 2VZ9A 2HS0A 3MM6A 4Y2AA 3MEDA 5DG7A 1RT3A 4B9UA 1QTMA 4JI5F 3KUEA 4GC6A 2RVJA 2IA0A 2XO7A 1VRTA 5IS2A 1IKYB 4DL2A 3GJSB 3IXQA 3DMJA 3G82B 1JLCB 3TJ8A 1Q95G 2DK2A 1Y4ZB 3PV8A 1VC0A 3IWLA 4LF6J 1Z1ZA 4J9UE 4ZVFA 3J7ZT 3P45B 4FKXA 4DUZF 2IM1A 3CDUA 3NCRA 2YWEA 1YRUA 2H4WB 3JSMA 1QAXA 3QT5A 2JLGA 5J2NB 3CF5Q 1JMTA 4MK9A 4XPCA 1DHMA 4BC7A 1RT1A 3OFEA 3D7SB 2CQCA 4QPXA 4U7UD 1XEZA 3Q83A 3D68A 3RJMB 5CYMB 4BLGA 1HW9A 1K1SA 1ZM2A 3AA8A 4DX8H 4K4WA 3FCHA 1WF0A 2PMZD 5L46A 3DU6A 1R31A 4X4UA 5KFKA 4O44B 4F0MA 4HT7A 2VG7A 1KR4A 2I2YA 4NEYA 3V4IB 5E3PA 3DOKB 1H0HB 4RZRA 2JWNA 1UW4A 4DCJB 4OJ3A 3KK2A 2GJ2A 1B99A 1JLAB 3W2VB 4A46A 2MQ8A 5F8NA 4JI3F 2B8QA 1ZM4A 1OSCA 2JLEA 4QR1A 3LUYA 5A76A 2NUUG 2ADCA 3QO9A 2VHGA 2G1DA 3H2LA 3EXCX 1Z2LA 1IWGA 4LT6A 1FXLA 4NCGB 1SCJB 1PC4A 1SXLA 5GVQA 5DLFA 1NNDA 2WONA 2FLNA 1LW2A 1T7PA 3NS7B 5ETTA 3RR7A 3GTYX 3O1LA 4ID8A 1RWWB 2QMXA 1NHVA 3NAHA 3GG1A 4HACA 3NRBA 5KAKA 1FESA 1WKJA 4BHQA 1JLBB 2J9DA 1XNRF 2GMHA 4DU8A 4JV5J 4QWDA 1K47A 3AODA 3AB4B 2VFSA 3WIUA 3PKMA 1PAUB 3T5LA 2HMIB 4AL7A 4CO4A 4CI0B 2R7XA 3OTEA 2ZITA 2DR6A 2K06A 3HHEA 3HSGA 2C42A 4AUKA 4ZHRA 4RUCA 4Q0BA 2E1RA 3BGUA 4RBUA 2B6AB 3LAMA 3EGWB 4FBUA 4IUFA 4I2QA 1X5PA 5A0YB 1SH3A 1QAJA 2W01A 1RACB 4YS2A 3IC1A 3MOJB 1S0VA 2ZBCA 2J7UA 2XMVA 3IA0A 4NEZA 1NK7A 1KQFB 1GMVA 3OXGA 1HNVA 3CJ0A 2YNGB 4UQTA 4RJVA 1DRZA 1FVSA 5K14B 4P2SA 2BM0A 4ECVA 2X1FA 4J9MA 5C2GA 3NP5A 1NJXA 3D0GE 2VU5A 1Y3JA 3TZZA 1ZYQA 3BBCA 4TNOA 4QU6A 1EJ7L 1UPPA 3KUHA 4LFCJ 4NASA 4LSLA 1U4BA 4DBQA 2VH7A 1VRUA 3CCZA 3HD1A 2HVEA 3HHLA 1MN9A 2UUCF 2DJWA 3LO3A 1S7IA 4QYZK 5KT7A 3QSYB 2ZEJA 1UPMB 3AXMA 4JV0A 5H9FK 2RIJA 4UF4A 1EKSA 3FSIA 2RKIB 5DRKA 4DJBA 1FXDA 1BHNA 2MZQA 1S0NA 2VBYA 4NCAA 4EMDA 3CCES 1RQ0A 3CO0P 4JI0J 2GV1A 1SIZA 2VPYB 2GGPA 2UV8G 4LF9J 3I4HX 1RI7A 1DTQB 1XBWA 1K1QA 3ENWA 3HF5A 4O23A 4R5PB 2QLJB 2RD5C 2KXNB 4I68A 5D78A 4ENOA 3T5HA 4RNMA 3RTVA 1HBOB 1VDHA 2LQBA 3M1VB 3OVAA 1FRXA 3LWMA 3VHQA 2N7YA 4RW4A 1RAGB 2ZOMA 4NA2A 1UP1A 5AXLA 3UD5A 3BDEA 5B0BA 1U6ZA 1EAYC 2HHPA 1KVIA 4KGXB 1TL7B 4I0WA 5CABA 2FHKA 4YB5A 4DV7J 2CKWA 1KEKA 3AY0A 2DIUA 4OZJA 4U96A 3UD4P 2CAJA 3CNQP 1U47A 5HLFB 3HVTB 1G6BA 1IBKJ 4I6AA 2YKMA 2ZJQQ 4AXIA 3MD1A 2GQ2A 3KLVA 2RDIA 4MYTA 3KWMA 4WFYA 1WOPA 4CT9A 3LPYA 2BQRA 1ROFA 4U7CA 2CQIA 1FTCA 2LYVA 2OPPB 4C11A 5B7WA 1RUSA 1S9GA 1UWBA 7FD1A 1S1VB 4NLXA 1YJUA 1X7VA 3O3LA 1RTDA 1R8AA 1HMVB 1HQEA 3AOCA 2FUG9 3VF0B 5DLGA 2HSEB 5E2QA 2AQ4A 2R2SA 1WI6A 2PMHA 1BUXA 4OHWA 3CCWA 2DNMA 1EARA 1KP6A 3Q24A 3JS9A 3CSKA 2BJ9A 2X1AA 3MD3A 1NK5A 4LSZB 4LIRA 1UVIA 3A8JA 2WW4A 3OHAA 1W2IA 5IXUA 2C2RA 4OZ0A 2IDEA 2NSBA 3TA2A 2GS8A 5CZXA 1TKZB 1N0UA 1PGZA 3SI8A 2V4RA 1Q16B 4ED7A 1JWWA 1BE4A 4L6V3 3DDNA 3S01A 2ZJPQ 3V4MA 4UOFA 2JFDA 2M8HA 1U6BA 1Y00A 5I42A 4JI6F 1UVKA 1B3TA 5ETNA 2ILZA 3DOLA 4PQAA 2K2PA 4WYWA 3R6GB 1B64A 5KT2A 4X4SA 1JLGB 3UPFA 2IAJB 4F2RA 1IKWA 3OFHA 3HCXA 4PG4A 3MAQA 1RHQB 2RH3A 4ZPDA 1YLXA 4EWTA 4CT8A 3W62A 3O6QA 3U02A 3M9MB 4DF4A 3NGTA 2XWXA 1HNIA 4G3IA 4ELVA 2XMJA 5KFAA 1FNOA 4DR1J 4CM0A 1R89A 4B3TF 4OX7A 3CB4A 3FMBA 2OHDA 2JJ4D 1HBMA 3GYXB 2OPSB 3MTKA 2XY6A 3D6TB 1R0AA 2R8IA 4LIWA 3T1HJ 3HHLD 2GFFA 3M8PA 2FDNA 3CE8A 4JBCA 2HVDA 2PO4A 3I87A 2KN4A 3RAXA 1RA7A 5JVHQ 1KONA 1Q1KA 4UOCA 4B9VA 4ZMMA 2QMUB 3IS9A 3KK1B 2RQCA 5KFXA 1EX8A 2CFXA 4PABA 1U0SA 1UA0A 4ETXA 2RAQA 3K8WA 4D3GA 3MGJA 4C8MA 2XMKA 3PX0A 3C8YA 1EP4B 5A2QU 3M8QB 3CC7S 3VAJA 2FJBB 3BKFA 3CGIA 2V9WA 2Z57B 4UTGA 4PUOA 3VQTA 1KLMB 3TANA 1HWKA 4DR3J 3EVWA 1PCAA 3GSDA 3K8VA 1VLOA 1HPZA 2YPYA 4FF3A 1BWEA 5KG5A 3B6BA 2F7VA 2K3KA 2LVWA 4YOEA 2CDQA 4ALZA 3FBCA 4NLOA 4XTTA 3CC4S 1RAFB 5H1SV 4AQYF 2RQ4A 2VODA 3EDQB 3MPDA 4Q7AA 4DR4J 4ECSA 2AGPA 4X66J 2DT9A 1RT7B 2V67A 3FFIB 2LP4A 3IAS9 2Z2YB 1F6TA 3C6UA 3EZOA 3RB3A 2VA3A 2FZGB 1RISA 4URGA 2OKQA 2F4FA 2YQ1A 3CCSS 1S1XA 3U1NA 3NBPA 1TVRB 2XLJA 1EQ0A 4USHA 3M2RA 1IKXB 2XY5A 3BSAA 2IM0A 5IT4A 4LRCA 4F3MA 2JOQA 2YPZA 4USUA 2BMBA 1N34F 3FEYB 2QGFB 3J80Y 1U0HA 1U8SA 2W4DA 3C15B 5KOWA 2YNHB 2V2QA 3J81j 1TU0B 1R0BG 3SCIE 3R2DJ 1SUQB 1Y11A 3JQJA 4PPDA 1CQMA 3R7BB 4FF1A 3OXLA 3OTOF 3TQEA 1QAIA 5AXKA 4ED8A 2AYMA 4LQ9A 3KK3A 3TI0A 3I0RA 1D9AA 1SJ3P 3BQ2A 1D8YA 4ILLA 1ZM3A 1LNQA 4QYZJ 4ZA1A 2YVSA 2QL9B 2HZAA 2HQ3A 2MJUA 2W9CA 5H9FJ 1ZPWX 4M5NA 1WHVA 3AD7C 2BQ3A 3N6LA 1TTHB 4QIFA 1UMJA 2GO8A 2M5YA 5KG1A 1U8WA 1TMMA 3T9ZA 1VISA 1OYEA 3FMWA 1I6JA 1F5BA 1FKOB 1WELA 4O3QA 1YI2S 3TZWA 2LCWA 2EWHA 2ZD1A 4F0HA 4DWIA 2UUBF 3OFFA 4NXMJ 3ULHA 3DXBA 2HHVA 2ZH5A 1DAXA 4N47A 2V69A 2VQEF 3ZTOA 2ZBQA 1RBOB 1U2FA 4M5JA 3OXFA 1HBNB 3KLFB 2C22A 3OUYB 3MCSA 4PQUA 2XYHB 2V34A 2HVZA 1Q8IA 5B0CA 4B3SF 2HWTA 2MZJA 5DDQC 2UUTA 3KG4A 1NJYA 2CQBA 3CDAA 1WKLA 1RTIB 2BX6A 4Q43A 1Z2ZA 2JX2A 1D1UA 1BWVA 3IM9A 5KFCA 3CJ4A 1VC6A 2MKYA 2VDIA 3CCMS 3I55S 4WK1A 4BBYA 4DHVA 4ED2A 2EC0A 2W2MP 3UN3A 5B0EA 3RW6A 2BA9A 3EJMA 4K0KJ 3HLUA 4NRUA 4CO3A 4RKUC 3PVXA 2E66A 3ILJA 5ETRA 3QIPB 4E8UA 4K5SA 1C1BA 5L38A 4DV3F 3GU0A 4J9RA 3VGSA 3PO5A 4OFZA 3CD5A 1QDUB 5KFFA 2J0SD 3G9CA 4LBHA 2AEMA 3EUNA 1PO6A 3EZ5A 2VFUA 1U49A 4L73A 5GAGU 1SKRA 4ICLA 2JLFA 2KRRA 2HLTA 1M90T 4YB6A 1FJGJ 2UUWA 2DEIA 2HNYA 1FRHA 3ZTRA 5E3RA 4M5DA 1RHJB 3RGIA 2OEMA 4NCBA 1MROA 3SXLA 4HDHA 1NAQA 2G9OA 1N33J 2ZZNA 1VBKA 5CYMA 3SFGA 5L9XA 4EZ6A 2VC1A 1SIWB 2ZUGA 2NYIA 3GJTB 3KMQA 5JUMA 1TMJA 4MAKA 3MMCB 4RUBA 2PN6A 4M1KA 3OR2A 5IQQA 5HMXA 4H4MB 5HROB 3FCVA 4F50A 5CHCB 2HFVA 3TZXA 3FBEA 2BKNA 2BE2B 4OV6A 4C3KA 1W7WA 3DOKA 1WI8A 4ZP7A 1F2HA 3HP6A 3RRHA 1H7WA 2YKQA 3PJ9A 3OR1B 4ECYA 1VQ8S 3G86A 4XAKA 2C3YA 4Q44A 5E0OA 3E3XA 2BKPA 1JLEA 5EGYA 3QIDA 3RRKA 1VQPS 1JX4A 3CDWA 4RW7B 2FJVA 2VKRA 5J2QA 3CD7A 4QWAA 2LXIA 2CWKA 3BSCA 2PI4A 1K8AT 2BRKA 4DV5J 2FHOB 1WD6A 4OV1A 2VJVA 1P9YA 2ZH9A 1IJFB 1QSYA 4PKDB 6FDRA 2I5JB 1VHIA 4WFBQ 1H38A 4PWDA 2HNZA 2QO3A 2CJKA 4PWUA 3EMTA 4WFZA 4LBIA 3FQKA 5F8MA 2EG1A 2HBZB 4RX6A 3B54A 2W7AA 2DNNA 1VIOA 3W64A 2DNLA 1WTFA 2GQCA 3PIPQ 4DQPA 5C5JA 3H4BA 5IT9Y 2DO0A 2Z2ZA 1SV5A 3FSYA 4ZKAA 1LWFA 5L39A 4JI2J 3TO8A 4JOUA 1CJVB 2HZVA 4FN5A 2OAUA 1HBUA 4WK3A 1L3SA 3DGVA 4P6QA 4QIWD 4IOCQ 3G96A 1I5OB 3DLKB 3TZYA 4OZ2A 3Q2TC 3PRBA 5ADZA 4QW8A 5IC4B 4P9SA 3IRXB 4Y28C 4M5LA 3ZTPA 3FBFA 4DQQA 2LQ5A 1YQHA 2CQGA 5J2MB 4FXWA 4F67A 5DG9A 3JTNA 2VBWA 3CCLS 2E1PA 3QWUA 1GFWB 2C2OB 1IBLF 4F0KA 2KFYA 3KG0A 3N4WA 2VUGA 2AX0A 3DLGA 2L9DA 1B0PA 1MMLA 2RB7A 3PW7A 2Y3YA 2YKNA 3QWPA 3CCUS 2RHQB 1OY8A 1EKRA 2Y1LB 2V2ZA 3MURP 1M0SA 2NXEA 2XM3A 2VDHA 3IMQJ 3QRQA 3TJ9A 1TL1B 4Q45A 2NSCA 3I96A 4R8UB 1LK7A 5BJRA 4Q5VA 3BQ0A 1HHTP 2BJDA 1T9UA 4ZPCA 3KG1A 4JI8J 3NGDA 5EX0A 4FP9A 1FA0A 4F3QA 4N76A 3E51A 2DH9A 2BXJA 3UNYA 3ITHA 2GIFA 4O3RA 1VQ6S 2QA2A 2D74B 2VOOA 1BLUA 2JZ5A 2W25A 1VQLS 5LXYA 3JYTA 3V6KA 2IBOA 1HI0P 3DU5A 2FVCA 3M32B 1HARA 3N5FA 4F04B 3FKBA 1UWAA 2XLIA 3VV2B 1X60A 4R5PA 2MSSA 3MMAA 5LM7E 2W7OA 2DRDA 4IRDA 2DGSA 5T41A 1C1CA 3T1AA 3H20A 3M1VA 1YJWS 2N4DA 4DUYF 3A8EA 2CPFA 4F4AA 3K17A 2C28A 3ADAC 3SBMA 3KUGA 1VQ4S 3JQMA 1U1LA 2YY3A 2G2YA 1Q7LB 1R27B 1RTJB 4YEAA 2IMWP 1UVJA 3SV3A 1VQKS 1TL3B 3I82A 2OO4A 3DLBA 3R3TA 2PI5A 4CH1A 2CPXA 3QATA 2LKZA 1NPRA 3ZTSA 5KG7A 4TQSA 3WC0A 1LW0B 4HL9A 1SL0A 4ECWA 2YWKA 3C16A 3ISZA 5KFEA 3EXYA 1TAQA 5IOLA 2XZTB 3BR8A 3W8GA 1P1LA 2ZKUA 4UOGA 2GO9A 2UXDF 2BW2A 2VG5A 1KSPA 1SKUB 2K7JA 5DDRC 3R9LA 4HI1A 2Z4PA 3PFEA 2EVZA 2MHNA 2PMWA 2KJWA 3V6HA 1KWMA 2BV3A 3AD9C 4HKQA 2YKPA 3MEKA 3RB0A 4NLPA 4OI3A 1IWAA 1KLNA 2CNOB 1MN7A 3F0NA 1RHUB 2WB4A 3W5XA 2DH8A 4IH6A 3LGMA 3KJVB 3CCJS 1APSA 3AT1B 2WVDA 3GV8B 1S1WB 4KY3A 1TFYA 2Q6CA 5KFBA 2E5JA 4UOHA 1JNRB 4CYUA 3KLEB 2CADA 3K89A 2SXLA 2D3O1 1LWEB 2BANB 3CVKA 3DYAA 3H90A 2VFRA 3UR0A 4IDKA 1CPZA 3KNAA 3CJ8A 1EIYB 2AJ4A 5T7LA 1WG4A 1S12A 1WJ9A 3SDEB 2RUGA 4ANEA 5HVFA 3R2CJ 4MMOA 4NZ0A 3IGNA 2O66A 1RCOB 2CPEA 2AIRB 4EUVA 3BBBA 1JB0C 2BJ7A 1QM9A 5JJBA 2V4JA 1VMBA 1QVGR 3AB2B 2XWYA 3MAAA 4LFCF 4B3OA 3GFZA 2APOA 3JB9k 1NM2A 4J9OA 2IFXA 2EXUA 4RBTA 3MHYA 3DLEB 3K5MA 5LJ3Y 3O44A 3RBEA 1LXNA 5C2CA 2AV5A 3SFUA 4KHMA 2OPSA 4DSFA 1RT2B 1JLFA 3MMJA 1XNRJ 1R8CA 1FERA 1S9FA 3Q8UA 4NLYA 1LV5A 4ZVHA 4ZVQB 4JI0F 5CQGA 3MR5A 3L3CA 4O4GA 1BQNB 2KL8A 3PNIA 1OPZA 1WOSA 2DNZA 4YN3B 3KLGA 5J2PB 2P9GA 1MLAA 4NX9A 1KVJA 1TV6A 2R7SA 2HRYA 3SV4A 3FEZA 2FC9A 2W8KA 2HAFA 3FQLA 2FZKB 1UW9A 1ZA1B 1WG5A 3SZ2A 4ZVGA 3E2EA 3H5XA 5KFIA 2UU9J 3HHKA 2QFIA 3NEKA 1NSAA 1PYSB 1NK8A 2A6MA 1R7IA 2IC3B 4C8ZA 4I4BA 1H3DA 1TP7A 4RW9A 2QLWA 4DPYA 1PJ5A 2GIQA 2OTJS 2IVYA 2FC8A 1YSJA 2DPJA 2R7VA 3N6MA 2N3LA 4FXDA 2DXEA 4HVZA 2M52A 2J7WA 4U7UK 2D9OA 3V6DB 2MKIA 3G6VA 2ZE2B 3VGVA 5DETA 3QJPA 3B4DA 2AJ0A 2XZDB 4DV0F 1T9YA 2RSQA 3FJ2A 3BV8A 2W2QP 1Y10A 1BMQB 2CPYA 2EEYA 4MT1A 3ONQA 5KG0A 2C3PA 4K7QA 3NKYA 2CVIA 5A8KB 5F8IA 1Y5IB 3X1LB 2ZH2A 2BUNA 2EFOA 5I3QA 1NKBA 3TA1A 2VONA 2ZHBA 1C0UB 3POTB 3GWCA 2BJ3A 4UY8T 2VG6B 3DOMB 4KJIA 4Y3CA 2JDJA 4DSKA 4OLOA 2ZFHA 2A6OA 3BH7B 1RTZA 3R7NB 4PEOA 5F9LA 1TUGB 2HGLA 1AROP 4H4KC 3UO0A 4NLTA 4RWXA 3ZZOA 3VQSA 1NKEA 2RF2A 1P9QC 1N32F 3P96A 2HK2A 3MM7B 1N36F 1X4EA 3HHLC 4WFAQ 5ETVA 2DGQA 1UZHA 5BYQA 2FTRA 2F4VF 3RB4A 4NLSA 4PG5A 3KJFB 4FYDA 2ZH8A 2E29A 4B17A 1RHMB 4KKOA 3UN5A 1FFWB 4ZK7M 2CJQA 1RADB 4OZ1A 1RYSA 3CMES 4PCQA 1UFKA 3UR3C 5HMYA 4ZITA 3NG8A 2CQ1A 3VVUA 2OTLS 3M30B 3MECA 5IWAF 3BBFA 1DLOB 2P2CB 2RMLA 5F0UA 4EBCA 2VFVA 4DR1F 3QMQA 5FDLB 2X3GA 4HHUA 1HQ2A 5ETKA 1SC1B 4PRFA 3KLFA 3OUYA 4NMXA 1TKXB 3W2WB 1MMDA 2HHSA 2YNIB 1B70B 4RNHA 1RGVA 1NH8A 1TZ0A 1WC1A 2M4MA 2XSFA 4Y2KA 1O6XA 2IM3A 3VR1A 4DSIA 2RRNA 1XJWB 2DIVA 1B7YB 2ATCB 1OS5A 5LL6d 3B4MA 1T9XA 2XS2A 3CWJA 1WWHA 4RW6B 4XDDA 3I4PA 2X51A 4DSEA 4DCOB 4JP8A 2VPZB 3BGOP 2H51B 3J80U 1TUVA 3HJFA 2DNRA 4ECZA 4GKJJ 3D2WA 4JV1A 2J5AA 4ES1A 4P74A 2KXHA 3I32A 3MR3A 3DM2B 3DI6A 3P4UB 1WKKA 2UVRA 4I56A 3MCMA 4CP5A 5IM0B 2QLFB 1XN9A 3W66A 3W65A 2BVZA 4HR2A 3HHNB 2RS2A 3N01A 2YX4A 1GQEA 4I64A 4WFXA 1VJWA 2YWGA 1AYEA 3DRSB 1T9WA 3QSIA 5B0DA 3LP0B 2J9DE 2ZWOA 3LP2A 4DLGA 3BSOA 2PA3A 2YKAA 2HQIA 3QJLA 2CPZA 4DR4F 3LQVA 5EX3A 4KGZB 1TFWA 1RT4A 3PG9A 3LF0A 1SBRA 4I6YA 1DTTA 2A2CA 3CJQA 4TLQA 1IQZA 3ICLA 4B3TJ 2GVDA 4H4OB 4M5HA 2VD3A 5K8MA 2XS7A 2XY7A 2B9WA 2DHAA 2KB2A 2BABA 3VAMA 1I1GA 1ZS6A 1NH7A 2W2OP 1N48A 4H54A 2KZZA 3GZ7A 3TYTA 4IQMA 4MJKA 1U2CA 3JTOA 3UCZP 5ETOA 2NLWA 4LRBA 1BQMB 2RDJA 3MM8B 5SUHA 3GJQB 3IGVA 2C2EA 5C7PA 4J9KA 1HD1A 4DQSA 3OBIA 4GO7X 2B43A 1NZAA 3W9HA 2P9EA 1FFSB 3OPKA 1HYSB 5IT0A 3F44A 3K5NA 1RWUA 3AJ2A 2YX7A 3A8IA 2CPIA 4IG3B 1U7LA 2FGOA 4EO6A 2K8GA 1DQAA 1RLDA 2UUAF 1ZPVA 1MMNA 1S4EA 3DRRA 2XO6A 2XTJP 2KYZA 2E9RX 3CC2S 1A0OB 3K59A 1S6QA 1NEEA 1QD1A 4AQYJ 2HRTA 2Z0GA 3NOCA 3TWZA 4DFJA 4ED3A 3J7A1 2P9CA 3C19A 4KH0B 1HLWA 5KFJA 5GADU 4ID5B 5DQHA 4LVOP 3W3SA 4X65J 2MGZB 2DY9A 5BR8F 4NXMF 4Z2XA 3PIOQ 3GLJA 5AT1B 4USMA 1YDLA 4C8OA 1X4BA 1FWLA 3R5CA 3FZ2A 4KO0A 3T1YF 4D3HA 3K7RA 4DFMA 5I3UA 2UVUA 5HAOA 1XC9A 4Q2LA 3IBFB 1N34J 1IM6A 3VGUA 3TW0A 4RW8B 2K7KA 3NL0A 2ACMA 4MKAA 4ERDA 3Q8SB 2DXFA 3RBZA 4TY8B 5K8OA 3W9IA 2EKNA 1CBKA 5L1LA 4ZLNA 4W92B 2BRLA 1N5YB 1PKUA 3L4BC 2BOAA 2EBEA 3DC2A 1N4LA 2JHEA 3OTOJ 2COLA 3IR6B 1FEHA 2HNDA 3VTIA 2ROEA 1A7GE 2YH1A 4ATNA 4RU9A 2KH9A 1M5OC 4GC7A 3GIIA 5AJ3J 1NDLA 1YWXA 3W8PA 2B5JB 4RR5A 4MKYA 3UDLA 1V3SA 4ZIWA 3VAKA 3US5A 1YRXA 4NLRA 3UNGC 2C2NA 1R0CB 1TL1A 5D4LA 1NRKA 2V9KA 3P8BB 3PXGa 3PHTA 5IC6B 1NSKL 4JI7F 4G1QA 4GVBA 4RWWA 3T5KA 1E6YA 2MMYA 2XGPA 2KTQA 4DCPB 5HJXA 4F7VA 4CLTA 4OI0A 3J81Y 4EYIB 2UUBJ 1CJTB 4BWMA 4AT1B 1Q53A 3H42A 2LU1A 4EBEA 5A8WB 3BKTA 2WSEC 3H8YA 2AYBA 2VQEJ 2CZVC 3M9NB 1JLQA 3PJXA 1FKAF 1D8ZA 4M5KA 1WACA 1FDAA 3SQGA 2MHEA 1DARA 4EGLA 2CQ2A 3GP9A 5A8RB 2QA1A 5CCMA 1F0XA 2ASLA 2LA6A 3OVSA 2O67A 4DOZA 3AFGA 5F0WA 4B3SJ 4MFBA 4DL6A 3MEGB 2R42A 2A1BA 3LGNA 2CPJA 2MXYA 5B0GA 3MPWA 2ZH6A 4TLRA 1N56A 5LSOA 2ZNYA 1U09A 4IO1A 5IT9U 5F8LA 4LSNA 2EK6A 2PEHA 3P3DA 4MH8A 5E5NA 2OEJA 4F4YA 1SJQA 2V4QA 1HQUA 1YBUA 1RTHA 1T95A 5CCLA 4U67Q 4MK8A 1RT6A 1U1QA 2QFJA 1E6VA 4Y00A 2XQCA 2DISA 3DDKA 4K59A 4URSA 2V94A 1J5OB 4AFFA 4IOAQ 1NSQA 1S99A 4UUWA 2NQPA 8RUCA 3MM5B 4DV5F 2KXFA 1HWUA 1S6PB 4F4ZA 3V81B 4USWA 4WIIA 4E0DA 5CZVA 2DD8S 2KT5A 2DH7A 2KG0A 3MPYA 4QR0A 1UAWA 3M8RA 5C24A 4C3LA 5GAHU 2F5GA 1W26A 2POKA 4LR8A 4C0HA 2GVZB 1VQ5S 1CLFA 2NXJA 3NCPA 4KFBA 3CUNA 4N8NA 2AZ3A 2QL7B 3QFWA 4DL0C 2B9XA 3MCOA 1S4FA 4W98A 1Y5NB 3EGNA 1T11A 1VQSA 3KTQA 1KHVA 2DGTA 1V5IB 5F8JA 3TUPA 2WOMA 4DL5A 4KH1B 4HTJA 2MKSA 2GC8A 3BN4A 1Q4RA 3G6ES 4C7QA 1YX2A 2OD4A 3G8SA 1N5SA 2AX1A 5GMKa 5E3CA 1LWEA 4WWSA 4F8RA 1QTNB 1DFDA 2VQFJ 2QG9B 1QUVA 4TKTA 1OYDA 4J9SA 4DR7F 3SDEA 1RXOB 1FXRA 1S1UA 1J2VA 4F36A 1G3OA 1LFWA 5HP1B 2XMUA 4WJBA 2JNJA 3TUIC 3JSRA 4G1IA 3CD0A 1NZ8A 1U26A 3MMBA 4B9TA 1TL4A 1X5OA 3EICA 4QPTA 1CJUA 4USJC 1NBEB 2VFTA 2ASDA 2ZHOA 1C0TB 3R27A 2LXUA 3SCKE 2W7PA 1GTEA 4Q2MA 4DR5F 5JVGQ 3L7PA 3GILA 3GYGA 1EHWA 1YG0A 2F63A 3H0PA 3U7JA 3RUBL 2PFDA 3QQCD 4DG1A 1S72S 2HHUA 2E5GA 3W1YC 4KHRA 2C2DA 4WTYA 4JI8F 4PXDA 1HR0F 4FS2A 3MDFA 3BZQA 2IDLA 2LA4A 4L74A 4WFNQ 2L08A 4C97A 1VYAA 4NZ7A 1MU2A 4OJHA 5DZ7A 5B09A 4PR6A 3TVKA 3ET6B 3BS9A 4FYYB 3KKFA 1B7FA 3OLBA 1SL1A 3H5YA 2HGMA 2OLWA 2E5LJ 2WVEA 4NI2B 1QE1A 1NK9A 1AZSA 3ISNC 1RABB 1VBXA 2QN6B 2DVIA 4OIXA 4FF2A 2V8GA 3D9BA 1VQOS 2ZH3A 3HKWA 1N6QB 1OQ6A 1KN6A 2XCPA 1XR7A 3IG1A 4DEZA 1F5CA 3TAQA 2DEJA 2FB0A 2HPUA 3DGPB 5K5MA 4KR0B 3R5AA 5F8HA 2ZM6J 3G8QA 4MIBA 1IBLJ 3OFGA 3IR5B 3KLHA 3PACA 1UZDA 2C2MB 5KFSA 1ZOTA 2PD1A 3ZZTA 2K1RB 5AE1A 1JJ4A 4O3PA 2MQNA 1C2PA 3TNVA 2RJZA 2ATLA 3S6EA 4USTA 3WC2A 5C42B 2MDAA 2YNFB 2KYXA 4KV8B 4M94A 2R3VA 3PX6A 1VBZA 1FKPA 1ZETA 5KG3A 4I2PA 4HHJA 2ILYA 1K44A 1TAUA 4OZNA 1U02A 2AYGA 5L1IA 4DZDA 3MM6B 3MEDB 1ZM9A 1RT3B 1T3NA 1X9MA 2Q6BA 2DR7A 1VI7A 1VRTB 2WVCA 3D1HA 4NLWA 4QWCA 4KHPF 4K2JA 2V5HG 3GCXP 4FVCA 4V19J 2KVIA 3E01B 5HVGA 2DGVA 1FRMA 5LT5A 1A9NB 1UFWA 1JIHA 4DUYJ 5GMEA 4XIUA 4WKRA 3L7OA 3JSMB 3VAIA 1TKTA 4YB1P 1SQFA 5AE2A 2DKOB 4B3RJ 4WBFA 1B0VA 3KLIA 3QJJA 1RT1B 2QX0A 2OPQA 1GXTA 5IV4A 3AJDA 1NJIT 1CQNA 3CJKA 1GH8A 5J1EA 2ZHAA 1MWZA 3RBDA 4ZLPA 5DZ6A 3DCAA 3M2VA 1S1TA 4C9DA 5D4PA 2J7KA 4WE1B 5H9EK 4TQRA 4ZVEA 1NO8A 4LJMA 4LUBA 5KT5A 2J9EA 2NR0A 2E5IA 4WZQA 2VG7B 3CD6S 3M2UA 2UXDJ 4CDIA 2FVPA 3ZZUA 4NRTA 2YX1A 3KK2B 1XR6A 4I7FA 3J7AN 2J0XA 4X4TA 3DRPB 1HIYA 3G87A 2ACYA 2H5IB 4U8VA 3FCWA 5M2UA 1TKXA 2C2KB 3PRVA 1X5TA 2YNIA 5HQ8A 2ASJA 8ATCB 3THPA 2LEPA 1PYOB 2IJFA 3QO9B 1GT8A 5DM7Q 2CPDA 1F9FA 3CO9A 2H5JB 2WONB 1PILA 3PTWA 5DM6Q 3SSQA 2LECA 1LW2B 1LWCB 3C14A 1RWMB 2BYCA 1Z4UA 1NDKA 2VA2A 2AF6A 4HACB 2UU9F 3QT6A 2N4CA 4IKAA 1OPIA 2AZ1A 1YGYA 2KFZA 4OX9F 3FVYA 3GFHA 2W9BA 4QWBA 2AEFA 1KFDA 1RLCL 4A8OA 1LQ9A 4J9PA 4Y2IA 2ZBIA 1PAEX 1LKZA 1XMOJ 2Y0SD 3K5PA 4ZCIA 1JJ2R 1SC3B 4E98A 4YP3A 3CJ3A 3KJQB 4S0MA 4ETZA 1FRKA 5HANA 1CULA 3MM9B 3GIJA 1U25A 4P10A 2WRMA 4ZHRB 2XNRA 4OHZA 1FDNA 4ZVRB 1Q81T 3CXCR 4I2QB 2PA8D 1IKVA 3M05A 4TYAA 1NSPA 3I5CA 3MPVA 4ECQA 1MWQA 2PSZA 4Z7CA 4CM2A 2UP1A 1FF2A 3MEEA 3BYPA 4P71A 2HS3A 2Z2MA 2ZBPA 1HNVB 4J5OA 2E5HA 3Q8QB 1NCLA 5U47A 1CS4A 2ZH4A 3SSSA 4IFYA 4DS5A 1UVLA 2CQ4A 1SQEA 4QU7A 2FZCB 4WXOA 1RCXB 4K4TA 2MLZA 2AEJA 4LSLB 2WVFA 1VRUB 1VS3A 3HHLB 3NGUA 3QRRA 3H2VE 4IOBA 3I6PA 1PSDA 4ED5A 3MFIA 4EYHB 3ELHA 1KC8T 2ZWPA 3H40A 3RW7A 1PBAA 1F60B 2DBBA 2E44A 1H2TZ 1PBUA 3QZ7A 4FNHA 2Y1IA 2IIHA 4J91A 3CJSA 1H98A 2L3MA 1YZ6A 1C4AA 3HULA 2GGPB 4RBVA 2AU0A 4ZPAA 1KOHA 3TAMA 4CTAA 3F56A 2MQMA 2J6TA 1Q82T 3A13A 4PG6A 1WSRA 4DV0J 4HT5A 2AP6A 2BKOA 2RRAA 1URNA 2HURA 4LFAF 5G0RA 4O3NA 4A8FA 1H74A 2B3TB 2FLPA 3R8YA 3R1LA 1R8HA 3MF5A 4RW4B 3C6TA 3GIMA 1TUWA 2I6WA 4QW9A 1U1RA 3D54A 4ZVUB 3JSBA 3OLAA 5KFOA 1RWPB 3HPOA 1UL3A 1YJVA 1Y0HA 1UFLA 2OPRA 2XSJB 4P7TA 4RW8A 1VK8A 3Q22A 4C0BA 2E1AA 2YKMB 2HHQA 1I3OB 3PHEA 3TA0A 2LXFA 2MKKA 2BQUA 2AHOB 1UVMA 2CJAA 1H73A 1WF1A 3UI3A 2B9YA 2EFNA 2GA7A 2KZMA 4C11B 1S9GB 1UWBB 2I0XA 1N32J 2XB2D 1RT5A 4GKJF 1N36J 1HQEB 4A4JA 1Q8BA 1IXKA 4NLUA 2F4VJ 1AXQA 4IFVB 1QSLA 3DLLQ 3D6FB 2HVHA 1SPBP 7AT1B 4B9SA 4KGVB 1X4AA 4M95A 1VCTA 3BYRA 2H4YB 2CVEA 2OH2A 2W8LA 5CXTA 1NK4A 5ETMA 2H65B 2DPIA 1X9WA 4XK8C 5IWAJ 5F3TA 3ZTQA 5ITHA 3CCVS 3H5SA 4KAIA 2FJEB 1IR1A 3VZIA 3CIZA 4DX5A 4ES3A 1KKHA 2XLKA 3EE3A 4P75A 4J9QA 1D0EA 2G0CA 3HVWA 2HFOA 3DOLB 3V2UC 4KPCA 3QZ8A 1Q5VA 5IQ6A 1IKWB 3MZIA 1WG1A 2FQQB 4RL1A 2AJQA 1XERA 4ED6A 1HW8A 4G1PA 3VAHA 2ROPA 2LQ8A 2R8HA 5T14A 2ZH1A 1HNIB 3I5AA 1HA1A 2VIHA 2CA9A 5H9EJ 3KMSA 4NE9C 1GXUA 1AT1B 3OVBA 2KRBA 1VC5A 1U1OA 2VB6A 3EVMA 1HBMB 3SSRA 3RYLA 2F1FA 1Y7PA 2H5EA 4B08A 3J7YU 1R0AB 4FZVA 5DG8A 4OLPA 2QIFA 1YIJS 2Z2LA 1VQNS 3MM5A 4P2FA 3M8PB 1X0PA 2BE7D 2BM1A 3MPUB 2B4UA 4CLKA 3NMAA 1HKAA 3A3PB 4GKKF 2MY8A 4HH0A 3IS9B 5F9NA 3UFCX 3C66A 3OJUA 2Y1JA 3KHLA 3R5JB 3M8ZA 5D6GA 4X65F 5FJ4A 2XULA 2ZBRA 3KOAA 2BOPA 4DPUA 2NCKL 3QLHB 5BYRA 5HO4A 2WVBA 1XMBA 3J81U 1KTVA 4Y65A 2C3OA 4QZVB 3CCQS 2V8PA 1M1HA 4DMZA 1KRPA 1HPZB 2XC9A 4DFPA 1FWKA 1FX4A 2Y8YA 3HT0A 5I4MA 2KI2A 1T03A 4YDXA 4QYRA 3J7YI 2LEAA 2NS1B 4U95A 1F5AA 1W25A 5C25A 5M2PA 4X4VA 3J7Z5 2Y9HA 4OYIA 2A0FB 3C6UB 3KDOA 4X4PA 4DSJA 3BJYA 1REVA 1S1XB 4C0OC 2ALZA 3MI7X 1RWVB 5K20B 1NHUA 2UUAJ 4LR9A 2WZ1A 3M2RB 2Z30B 5CYQA 1C0TA 5AJ3F 1CG2A 1K0TA 4ZLJA 2O1PA 2PDAA 1T9TA 2NXNA 2RQKA 2WSFC 1WF2A 4IRKA 2GAGC 1U0HB 5J1NA 1LFPA 5FLXY 3C46A 1CJKA 5K9FA 3FRZA 3P6YC 3I0SA 2Q3PA 1UA1A 5IFMA 3EYZA 5EWEA 2IY5B 3NS6A 5BR8J 1LOUA 3CJTA 2VBZA 2R7QA 2E7WA 3EWGA 3I9V9 2DNHA 3T6JA 1P6TA 4DV1F 1M5SA 1EETA 3UDEA 3HFZB 1KS2A 3T1YJ 3KK3B 2D7SA 4CWBA 4J9VA 2D3ZA 2IBKA 3BO2A 4GMKA 1EQMA 1ZA2B 4ZIVA 3OT9A 4A8KA 2QA4G 3M8SA 4HYKA 3CJ2A 4LF8F 2W9CB 3U27A 2O01C 5CAAA 4PYDA 2JSXA 2HBRB 1JJCB 4QJVA 4V1Ak 1N52B 2ZD1B 1UEVA 2GHVC 1FTRA 1T05B 1TK0A 2HKEA 2A18A 1RK8A 4ZVOB 2AJFE 2CNLB 4X62J 2ZZMA 1IKYA 2XBPA 2K1RA 3PZPA 3PEHA 9ATCB 3SCJE 1JXVA 3G82A 1JLCA 4PQUB 4PXCA 3OL7A 5HBMB 3R5GA 3GJRB 4TXSA 3RAMA 2F40A 2LMIA 4FBTA 1ELOA 4JI7J 4CO2A 5D0HA 1BQXA 1VK3A 2XMAA 2XYGB 4PAAA 3PFOA 2LDIA 2JVRA 5J2NA 1FJCA 4C6AA 3LALA 3F73A 3TJAA 4YMEA 4NLVA 1FFGB 4CQ1A 5L1JA 1L3KA 1RWOB 2W2NP 5MAOA 2XHWA 1P1TA 3GR0A 3W9JA 1RU1A 4X2BA 3QAEA 2V50A 4X64J 3KNGA 2YQ0A 3H4DA 1FI4A 1H72C 1G2EA 1NMEB 1C1BB 4O44A 4CO1A 2UXCJ 2MJNA 1M5PC 4B3MJ 2CNKB 3V4IA 1KOOA 3E01A 1RAAB 4WCEQ 3NAIA 3MCNA 4OHXA 2XI3A 3BGFA 2HWHA 2VJUA 1FNMA 1YJ9S 4ICLB 4M5GA 1L3VA 1JLAA 3W2VA 2G0IA 3UQSA 3GIKA 1LXJA 2CYYA 2HNYB 4GVLA 2MZ1A 4A8YA 4M5DB 2VQFF 4W4MA 2DR5A 1MROB 1WHYA 3PW4A 3BGRB 3BEGB 1I94F 2F8MA 1SC6A 4C8YA 2RUSA 4MKVA 1AB8A 3OTBA 2YWWA 2EG2A 3Q2SC 4NXNJ 2JC0A 1S48A 2DGWA 4DL4A 3PDNA 4LRAA 1AUSL 5DJBA 3N5BA 2IYIA 2CJBA 1IM4A 3OR2B 4OYMA 2KT3A 4NCGA 3D6HB 4WE1A 2JRSA 3D3BJ 3MOZA 5D77A 1KQSR 2HGNA 3OL9A 1MW7A 1X4GA 2YWFA 4LFBJ 3IR7B 3GONA 3P5TL 4BC9A 4CLFA 3AAWB 3OL6A 3LA0A 1TK8A 1UJ6A 4OMFG 3R5DA 3RG6A 4YUDA 3OSPA 2NPFA 2AWZA 3DRPA 4HH1A 1JLEB 2FVSA 1JLBA 2WCXA 2RQMA 3HSZA 3CCRS 1JKHB 4RU2A 5EWFA 3LP1B 4WTOB 3AH6A 2BR0A 3NWRA 4K4ZA 3TAPA 3N0VA 3R5BA 1JXLA 1FJ7A 5J2QB 1NLKL 1WTBA 4CNZA 2QA4S 2HMIA 4HHHA 2HFUA 2HQCA 2C3MA 2XYPB 1I51B 2QT7A 2ZZTA 2E5LF 4DL3A 2X3DA 2Q1LA 2OMLA 1F3FA 3FUYA 4IG0B 3EGVA 4DDFA 2CG8A 2A2DA 2HHHJ 2CQHA 1LWCA 1S79A 5LMUF 4KBIA 4WYLA 2MB0B 4LF5F 2W24A 2B6AA 1Y3KA 4J9LA 2FLLA 5A0YA 3M4XA 4PWDB 2HNZB 1TL5A 1WEZA 1AA1B 3U1LA 4JUZA 4DR7J 3SCLE 3KFWX 1U1PA 2YNGA 5GAEU 5K14A 4J9NA 2ZM6F 1X4HA 2DGXA 1NHKL 2BE9B 1RAOA 1QY7A 3H59A 2IRUA 1SV5B 3UCUP 1LWFB 1O51A 4DR5J 3DXSX 4FNIA 4F25A 2OP5A 3MM9A 1HBUB 4ECUA 3TRGA 4ZN3A 1S57A 4DFKA 3Q8RB 1H2UX 3KHHA 2VPXB 3A1YG 4P7VA 1WDDA 2G2OA 4DX6A 1S6OA 4QIVA 1HR0J 2RKIA 2J76E 1NPKA 2QZ8A 5FIIA 1VQYA 5ETSA 2NREA 4K4SA 1TKDA 5KT3A 4LQ3A 2M70A 4A48A 2J6UA 2HYIB 5KG6A 4F26A 4K4YA 4H4KA 1DTQA 2DITA 2B7CB 4X4NA 3Q8VA 3DLGB 2FY1A 2DGUA 4F3OA 2HEKA 2EW9A 2YKNB 4HTIA 3AHPA 3FK4A 1FNXH 5E41A 2D41A 2NYHA 4ZS6A 5GAEI 1SI9A 1S49A 3NGRA 4QQBA 1HBOA 1IVZA 1N5QA 2NXCA 4IR9A 2WB1D 5HL7Q 3C3LA 3CTRA 1SH2A 4L76A 3QBCA 4GO5X 1NKCA 1XTZA 3EGZA 3WHIA 1TL7A 4B3RF 1ACMB 3EX7B 3ITHB 2XEXA 4DF8A 2ZOFA 2I1RA 2E7XA 3LWLA 1B0TA 2JL9A 4IYQA 1V5VA 2CXEA 3QGHA 3JYTB 5HLFA 1D9DA 3HVTA 5HSPA 5JMNA 5K8NA 1N5VA 1L3UA 1RBAA 3LOUA 1MSWD 2WSCC 4UZBA 1MG7A 4MKBA 3BSNA 3PX4A 2VOPA 2HK3A 3MMAB 3SEOA 2CQ3A 4MK7A 3A3NB 2OPPA 4K4VA 4FDFA 1C1CB 3NWGA 2J6SA 2XMWA 1GK8A 1S1VA 5IZHA 2NXUA 2CJXB 3T3FA 1HMVA 2E1CA 2GJIA 2FJWA 2AW0A 5D4NA 4RLEA 1FRJA 4W90B 4WKYA 2HHWA 2F8EX 2QYCA 3V6JA 4QIGA 4QBUA 2VBXA 3BF4A 3CW2C 1KBRA 1NJZA 3KHRA 1XK8A 4LRDA 1M1GA 4G6VB 2XSJA 1HI1A 4YY3J 1U45A 2M88A 4M63A 1HD0A 3QGPA 4KHPJ 3WX8A 1V3RA 2HZCA 1TQLA 3C16B 2P6SA 1QAYA 4U6PA 2HG4A 1DZ5A 3HD2A 4DR2F 3DKDA 3IO1A 3CCTA 1TKZA 3IFEA 2B56A 3HKZD 4EK2A 5KFZA 4A8QA 5HMZA 3DN9A 1P27B 2MLYA 2V8VA 2VG5B 3TOQA 5HQMA 1XNQF 3SIPB 2HLUA 3R1HA 3CJ5A 3NXZA 3S8SA 4FS1A 4EFAC 3GG0A 2GMLA 2BACA 4IFVA 3RZAA 1S5ZA 5I3PA 3R6LB 3ZZYA 2QJ3A 3OQ2A 1AFIA 1TELA 1YTYA 1JLGA 4Q8EA 1CEZA 2IAJA 3BM7A 2KG1A 5EUHA 2EFGA 1X31C 4C8LA 4ZPBA 1JXEA 4UT4A 2RU9A 2YQ3A 5F3ZA 1KFSA 3NMRA 2XG8A 1Q86T 2R7OA 1XMOF 1RAIB 1XMQF 4TU7A 2KHCA 1WEXA 5L9NA 3Q86A 4I6WA 4CYUB 2QV6A 4P73A 3DYAB 2J9CA 2HS4A 4IDKB 3MR6A 5D8HB 1O0PA 4MTPA 4NYZA 5LSLA 3ZNUA 5T7LB 1XR5A 1N0VC 5KFDA 2GZOA 1DY3A 4ZPTR 2D3OR 3CDBA 4OYBA 2ASYA 4F4WA 4A8WA 4KSEB 5KFPA 1V9OA 2V4JB 1YHQS 3TX8A 2B7BB 3KK1A 3MAAB 4RNOA 2FVRA 4B3OB 4NLDA 3IRWP 2W4PA 1GNKA 3LGHA 3CULA 4MIWA 2ALYB 1UJ5A 2R2RA 4ZCMA 1UEUA 2PIIA 4ZN1A 2XGQA 3KDNA 3TP2A 1EP4A 3SYZA 2J0QD 1YKWA 3M8QA 4IQXA 1BD6A 3GYNA 3E8OA 1JLFB 1KLMA 2R2TA 3AQPA 5KFUA 4OX9J 5JXSA 2QSWA 4OYPA 3X3UA 1RHKB 2IVMA 2Q66A 3G71S 2PEBA 5CH7B 1RKJA 4O4GB 1T0TV 4QIEA 1PYTA 2GCFA 3PO4A 3KLGB 4B9LA 4B02A 1IR2A 4N8OA 5A6WA 1YVFA 4USKA 2G1HA 1TV6B 2L41A 2DNKA 3EM1A 1RT7A 3FFIA 4ED1A 1WC4A 4K8RA 4PPZA 3MR7A 2QRRA 2CQPA 3QLHA 1NDPA 4WP8A 1VQ9S 5B0AA 5D0RA 2UVVA 4ELTA 2ZVIA 2QEXS 3W60A 1TVRA 1FHTA 3P5BP 1IKXA 3NGSA 1JK9B 3H2UB 5KFWA 3CDEA 3BO4A 4WU3A 1SJ4P 4RW9B 2F9JA 1HHQA 1GAOA 3ZO7A 3DRXA 3C15A 2E9TA 2M0GB 4GRSA 2YNHA 3B8HA 4ZCLA 4C4WA 2V63A 4LF4J 4UUXA 1SUQA 2GJFA 1CVJA 1J5EJ 1VR6A 3BPSP 2P8IA 5LMNJ 1FK9B 3TVYA 4U9RA 3HX9A 3NS5A 5BXIA 1NB2A 4CLZA 3K2YA 3MUMP 2IJNA 3HVAA 4NMLA 4X4OA 5D3GB 3HK2A 3Q0AA 2CUYA 1H6KX 2V0NA 4ANDA 2MQLA 1Q7YT 3T5JA 2OIHA 3D6MB 3OL8A 2Z56B 3QFHA 1HWIA 5F41A 2B0GA 4I67A 1FKOA 3M6WA 4IO9Q 2R7UA 1VLYA 1LWXA 2CG4A 3HI9A 4LFAJ 3UVJB 4KPYA 2ZH7A 1SKSA 3WX4A 4B9NA 2DNYA 4OI2A 4RUHA 2JFKA 3TQ1A 2FJXA 3FGVA 4L72B 3IBCB 2RF2B 3GE9A 2IRXA 2W2PP 3DDIA 5ETPA 4YR2A 2B9EA 3UCGA 3AQOA 3UW1A 1HBNA 3OHBA 1N8RT 2CJYB 3GV7B 2LQ9A 2XI2A 4OI1A 1Q0NA 1RAEB 2FD2A 2MKJA 5LJ5Y 3AOAA 3BR9A 3W61A 2MPUA 3UN2A 3ZZPA 1YJRA 4ZOSA 4KKOB 1IBMF 1X5SA 1X9SA 1RTIA 2IMOA 1VQMS 3EPGA 2ZC4A 4TVAB 1M5KC 4AE5A 1S9EB 1V3ZA 2AGQA 2GNKA 3MUTP 3I5BA 2ZDPA 4TYBA 2XHCA 4WXWA 1T05A 3ZC4A 1FX2A 3DNCA 2MKHA 2DHGA 3MECB 2D69A 1YITS 2R9LA 4JI4F 2OGUA 1TR0A 1JNZB 1YJNS 4DQIA 4WPAA 3EPIA 3L95X 3S1TA 1EZZB 4JI1J 2MZTA 4WP9A 4LF1A 3DLHA 5J1PA 3QIPA 1R8PA 4J7CA 3ENQA 3O5TB 6FD1A 5HBMA 1SKWA 3HZGA 4C8KA 4DS4A 1FEEA 5F8GA 4HI2A 2PE8A 4BCAA 4YR0A 2CQ0A 4DV4F 2G4BA 2MTLA 4HEA9 1OY6A 2NPIA 3HM9A 1IQTA 1PJ6A 3D66A 2F8HA 1XWLA 2JEFA 3K0JA 2G13A 1S10A 5FLXU 4QR2A 1RWXB 5G4DA 2LEBA 4C8NA 1RE1B 2GAHC 3MMCA 2IM2A 1NDCA 3LW5C 1CC7A 2F9DA 2EPIA 2CRLA 3DI6B 2H54B 3IBWA 4H4MA 3UDVA 1UKUA 5HROA 1FO1A 1HNXJ 1CSJA 2KT2A 3IM8A 3H25A 2BE2A 2HWIA 2CQDA 5KFMA 1QJHA 1GTHA 4ZJLA 1SQGA 1U2RA 4K4XA 1HNZJ 4CLYA 3OR1A 3ZXWA 1KNZA 3VWSA 3LP2B 4JV2A 2FVQA 1R3NA 1OJ4A 1FD8A 3Q8PB 2YWHA 1ZBTA 2V6AA 2AKWB 1RT4B 1WSVA 4DV6F 4Y2MA 3BGRA 3FZBA 4RW7A 1DTTB 1VHFA 2HQDA 3PRDA 1JQGA 1YZ7A 3PYEA 3HFKA 4LBPA 2KFNA 2GVDB 1PG5B 1NU4A 2VKZG 1DJ0A 3D1QA 5KT4A 3PR5B 2RILA 2U2FA 1BGXT 1ITPA 3M7VA 3A4TA 2EFPA 3PCOB 2ADBA 1SB6A 4EI2A 5K8PA 1ZTTA 2HQGA 4DV2F 1WOOA 2V2KA 3HZEA 4KT0C 3FDSA 2IVFB 1VOMA 1HNWF 3AD8C 3ZNJ1 2DRBA 2I5JA 4KIAA 4GKKJ 1S0MA 2HBQB 2NZ4A 1D09B 3HMJG 3TUJC 1SJRA 4DR6J 3HXMA 4KRWA 1RAHB 3MTJA 3SMZA 2YXLA 4PYAA 2VL1A 4KGMA 2V2VA 3N28A 2M9KA 1JKHA 2FGCA 3LP1A 2OFGX 2OSQA 5GAGI 2ZOGA 2OMOA 2JEGA 3M9OB 1NPPA 2UXBJ 2R7RA 4RO0A 4ANCA 2KM8B 2H48B 1GMUA 1ZTWA 4OI6A 2OEKA 4MYUA 4WU2A 2FJAB 4M8LA 3DRRB 1CJVA 1YJ7A 4A8MP 4IG0A 4JYAF 3BGLA 4CO0A 3BH6B 1XQIA 1S6QB 1S7HA 5E33A 3JAMY 3DLKA 1BC6A 1WC5A 3G8TA 2RT3A 1RYRA 3UD3P 1FE0A 3RU0A 4OYZA 1XIQA 3IRXA 1U6FA 1YBTA 1ZAWA 1DBDA 1OMSA 5J2MA 3PYGA 1C4CA 1BY9A 1YBAA 5KFNA 2AYEA 2GHPA 4NWBA 2QE5A 4KO0B 3VALA 5AE3A 4X62F 4KC5A 5I3UB 4RNFA 1WEYA 4C3MA 4F02A 3TX0A 5CA5A 2N7CA 5DQIA 4F2SA 2ZC3A 3ILIA 1UJ4A 3IP0A 1G1XA 4ILMA 4Y0FA 4DXLA 5B08A 2ZDOA 2WBMA 2B4VA 2H3EB 4R8UA 4AD6A 3IWXA 3B78A 4ILRA 3O2IA 4N5SA 2DY1A 2OELA 5HK4A 4L3NA 3THTA 2HHXA 4BWJA 4IH5A 4YHHF 4DV1J 4M5IA 2LFVA 1H2VZ 2E1MC 3RBXA 3K57A 1KD1T 2HNDB 4CH0S 1T9VA 5HI7A 3M32A 4X64F 2QSFA 3LH2S 4TY9A 4EO8A 4LF7J 4LF8J 4FPRA 4ED4A 2AGOA 3HT3A 1X8DA 4NZ6A 1R43A 3O8WA 1GXLA 2UVWA 4LF6F 1HFEL 2UXCF 1T94A 4B3MF 3PYFA 2Q43A 2HFNA 2KKHA 3HSJA 1F9EB 4A8XA 4G1QB 4GVBB 4WP3A 4CLUA 1E6YB 3RB6A 3WDOA 2C2ZB 2AJ1A 4C2MA 2Y8WA 3N79A 2DR9A 2IPOB 2PT0A 1FWPA 2Z58B 2DNQA 1RTJA 2ZKTA 4OYXA 4DU7A 1TL3A 5EWGA 5KOXA 4ES2A 3D0IE 2WTFA 1JLQB 2M3DA 4AYBD 2MZSA 4NXNF 3SQGB 4PZVA 1LW0A 2KVQE 3NOGA 5KTQA 3PJWA 1Q79A 4MFBB 5DS7A 5ETLA 3T6BA 2I9SA 3NLCA 1WDTA 2B51A 2MEWA 4LFBF 5ETQA 2Y0BB 2AJ2A 2QC3A 2BEFA 5IV3A 1J27A 2WAQD 3FBBA 4LSNB 2HBYB 2DHSA 2PGCA 3GR1A 1U1KA 4L3KA 1F1BB 1HQUB 1RTHB 1RT6B 1E6VB 4JI5J 4O3OA 3HDSA 2LLZA 2X7IA 3D67A 2R7WA 1EB0A 2I8EA 5HATA 3AXKA 3KHGA 3KJVA 4U8YA 2E9ZA 3QT7A 3GV5B 2RE1A 5EN1A 3D3CJ 1S1WA 4LVNP 4WZMA 4DUZJ 3ISND 1RA6A 4UW2A 2HHHF 1R6VA 3MXHP 3KLEA 3KYLA 1ZAXA 5C24B 2CWXA 2BANA 3TEGA 1U1MA 2MSTA 4KFBB 3C2PA 4Z37A 2VASA 1I94J 1VJQA 4JV5F 1URRA 2J8SA 2FY8A 4P2MA 2P5VA 2OI2A 5EHHA 1W2BR 2WOMB 4EU0A 3LANA 1WC6A 1L5UA 4AL6A 4OYOA 5KFTA 4KE5A 4AXJA 1Q5YA 3AA9A 4UY85 3DLEA 3HJVA 2OSRA 1V6HA 4FKYA 2JVOA 1MNEA 2LU2A 7FDRA 1FVQA 4JI3J 3GMGA 5RUBA 1RT2A 5CD4H 4L75A 1S77D 1S97A 3IN5A 1M1KT 1S1UB 4OJ1A 5AXMA 4ER8A 2M2BA 4CZCA 4XPEA 1BQNA 3MMBB 4QWEA 2C1EB 1S59A 1NK0A 2KO1A 2HIQA 5A6PA 1CJUB 5J2PA 3JXOA 3M6VA 2NUHA 3UE2A 2ABYA 1K9MT 3D0HE 4ELUA 2VICA 4EBDA 1GX6A 2DR8A 5LMUJ 2R7TA 4LF5J 3D1OA 4Z7YA 2L9NA 3TVZA 4DG1B 2JH3A 2CPHA 3JTPA 4JB8B 1Q78A 4C98A 2U1AA 2QL5B 2HFSA 3VAFA 3K58A 1OQ3A 2IC3A 3RAQA 3HO1A 1MU2B 3M6XA 1RAJA 3NCQA 4QOTA 1Q8LA 3FC9A 4DX7A 3ILLA 3BREA 1D3WA 4LF9F 4USVA 4ZLLA 1UETA 2FPHX 4RPFA 1Y9OA 2L48A 4PXEA 1QE1B 2EC2A 2IYGA 3V6DA 1AZSB 2F65A 2ZE2A 2FHMA 4C48A 4OL8A 4CNYA 2W9AA 3LAKA 3HFVA 4LR7A 2KU7A 2LQJA 2AD9A 1RB0A 2GMJA 4G65A 2OFHX 3IG1B 3N6NA 2FLOA 2CZ9A 2I38A 5A8KA 2B4PA 1ICEB 2X1BA 4BS2A 2HIYA 2JEJA 2EBGA 4DV7F 2DO4A 1SVDA 4ZP9A 3KLHB 1C0UA 5D4OA 1QLNA 3POTA 1GMWA 3BQ1A 4YY3F 2VG6A 2KJVA 2WK4A 3DOMA 1FJEB 1OSDA 2RDDA 1KDNA 3WIVA 1IBKF 3DMJB 4XO0A 2E7VA 2QTWA 1GX5A 4ITSA 2AMCB 2A3JA 4P52A 3ETMA 1T02A 1IN0A 2GIRA 4NLQA 4PXBA 4CLWA 1Y5LB 2UUCJ 3GPAA 3L7UA 2YH0A 3Q8YA 2QYGA 2KDOA 3QGIA 3BB5A 1FK9A 1F2GA 1FKPB 1BXNA 3HVRA 2Y1RI 3HHDA 3R97A 4I2PB 4WIQA 3QRPA 1D9FA 2QLXA 3MM7A 1VBYA 2BW7A 3TUZC 2XMTA 2UZAA 2H1YA 3S7RA 2VPWB 4YFUA 1KVKA 2D3UA 5D3GA 4ZPWR 3B82A 4IRCA 4F4KA 3FRYA 3Q89A 3VGTA 3H7HB 1VGYA 4A47A 4YR3A 1JJHA 2MQOA 4O3SA 3UVJA 1ZZNA 3M30A 2NZCA 3PYDA 1CC8A 2O3DA 2EK1A 2EI5A 1YRTA 1DLOA 4DZ6A 3BN7A 5E7OB 3ILOA 3W5ZA 5FDLA 3U1MA 1O8BA 1IBCB 4K2XA 1TKTB 4HDGA 2IA6A 1FT8A 3CT9A 2EFVA 1RJJA 2BJEA 3KLIB 4URQU 2OPQB 3W2WA 3NNHA 3OTCA 4LF2A 2CIMA 4X4RA 1UVNA 2K3IA 2DCLA 2PFFB 4R0JA 1ULRA 3CJKB 5KFYA 5J1EB 4OYAA 2OUGA 3W5YA 3OW2R 2KHDA 3M2VB 1S1TB 2YBVA 2M7SA 1AFJA 3NGKA 4DR2J 3D28A 3KXDA 1S9EA 1NUEA 2BJ8A 4RW6A 3TARA 2MKCA 1K0VA 2DYAA 4ZDNA 3MWBA 3M2UB 1T3OA 4WF9Q 4UQGA 4P2XA 4DSLA 3T19A 2DNPA 3VAGA 1XNQJ 4TU9A 4I69A 4I7FB 1PC5A 1G7CB 3DM2A 4QCLA 4O0IA 1NXIA 2N82B 5IM0A 2CZ4A 4NL5A 2O5DA 4LRFA 3NNCA 3T1HF 3PR4A 3ENAA 3ETOA 2PC6A 2HQFA 2DB1A 1HI8A 5D0GA 3DRSA 4TU8A 4CCHA 3VCDA 3OD2A 3LP0A 1SH0A 1Q8KA 5SZTA 3CJRA 5HJYA 1XMQJ 3QYYA 3VZHA 1NK6A 3P49B 4Q8FA 2W1BA 3QNWB 2BDPA 3G6XA 1RKIA 5FD1A 5DQGA 2GX8A 3C14B 4Q0BB 3EVOA 1FE4A 1X0FA 2R8KA 4FYVB 4H4OA 4OX6A 3N9UC 1F9HA 2HAIA 6AT1B 1RP5A 4JI6J 1VRQC 2M8DB 1MWYA 2Z8QA 5KFRA 4NA3A 1RHRB 5D15A 4DR3F 3IWNC 3LTOA 1GEHA 2W9BB 2V8DA 2B8PA 1S0OA 1BQMA 4RNNA 3WBZA 5KG2A 8AT1B 3MM8A 4N7TA 3W7BA 1RZMA 4LF4F 3OSNA 2ROGA 2MYFA 5KFLA 4I1TA 2CDRB 3CMQA 4X66F 1J5EF 3OV7A 1CULB 3ZFVA 2LDYA 1HYSA 1WC0A 5LMNF 1WC3A 1GMWD 4DN0A 4N56A 3NNAA 3UDCA 4IG3A 1IKVB 1OO0B 2R4FA 3CEDA 3WZ0A 1O5JA 3MEEB 2HW3A 1SC4B 2EFQA 3GB0A 4KB7A 4OHYA 4E2FB 3ENVA 3EDRB 3F41A 4ECTA 1TK5A 1CS4B 1HWLA 2R2UA 5M2RA 2CNNB 4IFYB 2VC0A 5GMDA 4YQWA 1OWXA 1DQ9A 4HLBA 2FIUA 4NA1A 4ID5A 4DN9A 5L1KA 3DHXA 2MGZA 3D5MA 2G2ZA 2BZ2A 1RU2A 5KFHA 1REGX 2VV5A 3GCWP 4DL7A 5HN0A 4DI6A 1ZZFA 2IRYA 4DLEA 1ZH5A 4XDCA 2DRAA 4J90A 1R6YA 2DNOA 3QT8A 4CLLA 5HQLA 1HHSA 2ZNZA 2DXDA 2L9WA 2XZWA 2V68A 4TY8A 3TEHB 3TAMB 4CTAB 5EDWA 1RBLA 1UEKA 2GHWA 4OX8A 1N5YA 1QVFR 1M5HA 4Y2CA 1UCNA 1IJEB 3PW5A 5G0RB 4BDPA 3I56S 4CRJA 4N41A 2FHJA 3FEXB 1RTDB 1VIXA 3C6TB 1N5TA 3A12A 3THVA 4X84A 4JI1F 4ZP8A 4NYOA 4PG7A 2B5JA 3AJ1A 4NYPA 2X1GA 3BO3A 1FDDA 3M8WA 2OPRB 5LOQA 9RUBA 4OQJA 4K50A 3H5UA 3EZUA 5DGAA 2WBRA 3T41A 1QUPA 3GIRA 2QLBB 4MIAA 5A2QY 1FDBA 1CJTA 4CO5A 2YTCA 4ZJOA 3W63A 2XNQA 5A8WA 4ZPVR 2Q79A 3GQCA 1H7XA 2R8GA 1RSCA 2MQQA 3H98A 4OZ3A 1RT5B 2UV8A 2J0WA 3IAM9 2ZUAA 2A10A 3FSXA 4K5RA 5GADI 5I42B 4YDDB 3G4SS 3DHWC 5A8RA 4K0KF 4OI4A 5LXRA 2DHXA 2QMWA 4ZJQA 1NJWA 1G4CA 3MEGA 3I31A 1HNXF 1IBMJ 2VF3A 3SQOP 4OYWA 2GW8A 1FCAA 3BDPA 1HNZF 1LEOA 5CD4A 2BBEA 2RS8A 2RHSB 3DRYA 4A8SA 1OY9A 1LK5A 2WW8A 1FJGF 1KHWA 3KJNB 4FF4A 2DHHA 4FPIA 4JI4J 2J8AA 3G2XA 3JAMU 4R0EA 3VVTA 1N33F 1J5OA 4AL5A 2D9PA 2G0JA 4X4QA 1M5VC 4UZCA 2DTJA 2H9ZA 1YJTA 4NPOA 5AXNA 5LSRA 2D1CA 4ZVTB 2MQPA 4F4XA 1U48A 3M8YA 2CJ9A 1S6PA 3V81A 3K5LA 4O4RA 4YB7A 4DQRA 5DO2A 5HMWA 3PKYA 1DQ8A 5B0FA 3AOBA 3ZZ0A 3A3OB 1PIEA 1S6UA 5KFGA 4LREA 4DPTA 4DV4J 2DNGA 4N77A 3TR5A 3CPWR 4EEYA 3M6UA 3MAHA 3QPIA 4DR6F 2GVZA 4LMZA 3PY8A 2BJ1A 2WHOA 2HHTA 5D0EA 5CYJA 3GFXA 4FYXB 2MZRA 3V5RA 1X4DA 2HRUA 4DPWA 1WHXA 2R8JA 2RU3A 3DFEA 1KQKA 4ECXA 4RUAA 2RNEA 1NB7A 4DPXA 4ZP6A 2UXBF 1WNEA 3BPDA 4PUOB 4IR1A 4OZLA 3NY0A 2MLXA 4CH7A 1L3TA 4DV3J 4PWWA 4CLPA 3CMAS 4FVMA 3L9ZA 1R8BA 5KFVA 3G6YA 1ZAVA 2DCUB 1SJ1A 3JQKA 5DDPC 2GQQA 1HWJA 4CIOA 4DPOA 4ECRA 5MLCV 4KQZA 4USIA 2ERRA 3RR8A 5KG4A 2B4OA 3L09A 1SJFA 5THWA 2V8HA 2OJ3A 3UWTA 4DV6J 5L8RC 3OJSA 1WUUA 3GFYA 2YKOA 3ZZRA 1IUJA 5HP1A 1K73T 4OJGA 1KTQA 1P8GA 3NBPB 4IH7A 4K4UA 1YK9A 4DV2J 3WQPA 4TN2A 1HNWJ 3PW2A 4JI2F 3PEJA
chains in the Genus database with same CATH topology
4CH1A 2AGQA 2GNKA 3MUTP 2CPXA 2ZDPA 3I5BA 2LKZA 4ECQA 4TYBA 4WXWA 2W4CA 5KG7A 3ZC4A 1T05A 2PSZA 2FHJD 2UP1A 1FF2A 3DNCA 3MEEA 4TQSA 4ZCKA 3WC0A 1LW0B 5DGBA 2MKHA 2HS3A 2Z2MA 1T03B 4HL9A 1SL0A 2DHGA 3MECB 1YITS 4ECWA 2R9LA 4JI4F 3ZZZA 2YWKA 1HNVB 3ISZA 1TR0A 1JNZB 1YJNS 5KFEA 4J5OA 3EXYA 4DQIA 2E5HA 3EPIA 1TAQA 3QAUA 3L95X 3Q8QB 5C25B 5U47A 3S1TA 5BYSA 3BR8A 2MZTA 2ZH4A 2VODA 3PM9A 4EZ9A 3SSSA 4IFYA 2N3OA 4DS5A 1UVLA 5KFQA 3DLHA 1P1LA 2ZKUA 5J1PA 2GO9A 1R8PA 2CQ4A 1SQEA 3QIPA 4QU7A 4WXOA 1N54B 2UXDF 3ENQA 3O5TB 2C3UA 2BW2A 1OIAA 2HFZA 2VG5A 4K4TA 6FD1A 1KSPA 2K7JA 5HBMA 1U1NA 1SKWA 5DDRC 4LSLB 3HZGA 4C8KA 5GAHI 3Q23A 5KT6A 1HL6A 1VRUB 3I0RB 4DS4A 3QGGA 1REVB 1FEEA 5F8GA 1VS3A 4HI1A 4HI2A 3DLJA 2Z4PA 3HHLB 3FNNA 3PFEA 2RRBA 2PE8A 2EVZA 4BCAA 3H2VE 2MHNA 4IOBA 5CYQB 2KJWA 1VFJA 2CQ0A 4YR0A 3V6HA 1N88A 3I6PA 2XS5A 2BV3A 1QSSA 4DV4F 1PSDA 2G4BA 4ED5A 4HKQA 2YKPA 3MFIA 4HEA9 4EYHB 2NPIA 4B9MA 3HM9A 1AUDA 1DURA 1KC8T 4LF7F 4NLGA 3H40A 4Y6IA 3RW7A 3MEKA 1IQTA 3PW0A 3RB0A 2F8HA 1X4CA 1XWLA 4NLPA 2EKYA 4KTQA 1F60B 4OI3A 2DBBA 1KLNA 2KM8C 1FRLA 2JEFA 2E44A 2ZVSA 3K0JA 1H2TZ 2G13A 1KQGB 2MY7A 2WB4A 3QZ7A 1S10A 4FNHA 1SL2A 3I9ZA 4Y34A 2Y1IA 1T8EA 2DH8A 4IH6A 4QR2A 5G4DA 2LEBA 3LGMA 4V19X 4ED0A 2IHR1 5E3QA 1N6QA 3I0SB 3KJVB 4J37A 3CCJS 1H98A 2L3MA 4C8NA 1APSA 2HVIA 4R25A 1VQ7S 3GV8B 1C4AA 1S1WB 3MMCA 2IM2A 3MR2A 4PG8A 3LW5C 2ZJRQ 1CC7A 2F9DA 2GGPB 2EPIA 2CRLA 2Q6CA 4RBVA 1A6LA 3DI6B 2E5JA 5KFBA 1TFYA 2AU0A 4ZPAA 3DGPA 1JNRB 5DDOC 1KOHA 3KLEB 3TAMA 3IBWA 4H4MA 2SXLA 4CTAA 1UKUA 5HROA 1LWEB 1EETB 3F56A 2BANB 1IR0A 2MQMA 3CVKA 2OD6A 1FO1A 3DYAA 1CSJA 2VFRA 3T9NA 3UR0A 5E3AA 2J6TA 1Q82T 2KT2A 4IDKA 4PG6A 1CPZA 3KNAA 2JEIA 3H25A 2BE2A 2HWIA 2CQDA 5KFMA 4HT5A 1QJHA 2AP6A 1X4FA 2AJ4A 1GTHA 5T7LA 1WG4A 2RRAA 1URNA 1U2RA 4K4XA 4LFAF 5G0RA 2DGOA 4O3NA 1RDRA 3SDEB 2RUGA 4A8FA 3OR1A 3MUVP 2B3TB 4FXVA 2FLPA 3K5OA 3VWSA 3MFHA 1KNZA 4MMOA 4NZ0A 3IGNA 3R1LA 1R8HA 2O66A 3LP2B 3MF5A 4JV2A 2CPEA 1U24A 4NOHA 4RW4B 1R3NA 4OHVA 3C6TA 2FVQA 3GIMA 4QW9A 1FD8A 2FJDB 4EUVA 3Q8PB 1U1RA 2YWHA 1ZBTA 5C42A 1JB0C 2XCAA 3D54A 1RT4B 3JSBA 3OTDA 1QM9A 2YNFA 3JSYA 2XMMA 4KV8A 5JJBA 4DV6F 2V4JA 4Y2MA 1VMBA 5KFOA 3BGRA 3FZBA 3AB2B 4KGKA 3OLAA 1QVGR 2P6TA 2XWYA 1DTTB 1VHFA 4OZ5A 4RW7A 3PRDA 3HPOA 4LFCF 4B3OA 3HFKA 3GFZA 1UL3A 1YJVA 1AW0A 1Y0HA 2KFNA 1FRIA 1UFLA 2APOA 2F3JA 2OPRA 1WHWA 3JB9k 2JC1A 2XSJB 4P7TA 1S76D 4RW8A 1NU4A 3RRGA 4J9OA 2IFXA 2VKZG 1DJ0A 1VK8A 3D1QA 5KT4A 2HHXA 3CIMA 1FD2A 3Q22A 3PR5B 4RBTA 2RILA 4C0BA 2U2FA 2VZ9A 2HS0A 2E1AA 3MM6A 1BGXT 3MHYA 2YKMB 4Y2AA 3MEDA 2HHQA 3DLEB 3K5MA 2EFPA 5LJ3Y 3O44A 2ADBA 1SB6A 3PHEA 3RBEA 5DG7A 5K8PA 1ZTTA 1LXNA 1RT3A 2LXFA 3TA0A 2MKKA 4DV2F 4B9UA 1QTMA 2V2KA 2BQUA 2AV5A 4JI5F 3HZEA 3SFUA 4KT0C 3FDSA 1UVMA 2IVFB 1VOMA 4GC6A 1HNWF 4KHMA 2RVJA 2CJAA 2OPSA 1WF1A 2IA0A 3UI3A 2XO7A 4DSFA 2DRBA 1VRTA 5IS2A 1RT2B 1JLFA 1IKYB 2B9YA 3MMJA 4DL2A 1R8CA 2EFNA 3IXQA 2I5JA 4KIAA 2GA7A 2KZMA 1S0MA 1FERA 4C11B 1S9FA 3DMJA 2NZ4A 3HMJG 4NLYA 3TUJC 1JLCB 1S9GB 1SJRA 1UWBB 1LV5A 2I0XA 2XB2D 1RT5A 2DK2A 1Y4ZB 3PV8A 4ZVHA 3HXMA 4GKJF 1VC0A 4JI0F 3IWLA 4KRWA 5CQGA 3MR5A 3L3CA 1Z1ZA 3MTJA 4O4GA 1BQNB 4ZVFA 1HQEB 3SMZA 3PNIA 4A4JA 1OPZA 1Q8BA 3J7ZT 2DNZA 4DUZF 2IM1A 2VL1A 4KGMA 3CDUA 3NCRA 3KLGA 5J2PB 1IXKA 3N28A 2P9GA 2YWEA 4NX9A 4NLUA 1KVJA 2M9KA 1AXQA 1JKHA 4IFVB 1QSLA 3DLLQ 1YRUA 2FGCA 3LP1A 2HVHA 1TV6A 2R7SA 2OFGX 2OSQA 4B9SA 5GAGI 2HRYA 1X4AA 4M95A 3JSMA 2ZOGA 1QAXA 2OMOA 2JEGA 3M9OB 3SV4A 3FEZA 2JLGA 5J2NB 2FC9A 3CF5Q 2W8KA 1JMTA 4MK9A 4XPCA 2R7RA 1DHMA 2KM8B 3FQLA 2CVEA 1ZTWA 2OH2A 4OI6A 4BC7A 1RT1A 1WG5A 3OFEA 2W8LA 3SZ2A 5CXTA 2CQCA 4QPXA 4MYUA 4WU2A 4ZVGA 3E2EA 2FJAB 4M8LA 3DRRB 1XEZA 4A8MP 3H5XA 5CYMB 4IG0A 1HW9A 5KFIA 1K1SA 1NK4A 1ZM2A 3AA8A 3HHKA 4JYAF 3BGLA 4DX8H 4K4WA 2DPIA 3FCHA 4CO0A 1WF0A 1S6QB 1S7HA 1X9WA 2PMZD 4XK8C 5E33A 3JAMY 1NK8A 5F3TA 1R7IA 3DLKA 1BC6A 3DU6A 5ITHA 2IC3B 3G8TA 4C8ZA 1R31A 4I4BA 1H3DA 2RT3A 1RYRA 1TP7A 3CCVS 3H5SA 4KAIA 3UD3P 1FE0A 4RW9A 2QLWA 3RU0A 5KFKA 4X4UA 3IRXA 1U6FA 2GIQA 4O44B 2FJEB 3VZIA 1ZAWA 2OTJS 4HT7A 2IVYA 2VG7A 1KR4A 2I2YA 1DBDA 2FC8A 3CIZA 1YSJA 3V4IB 5E3PA 3DOKB 4ES3A 2DPJA 2XLKA 5J2MA 1H0HB 2R7VA 3N6MA 4RZRA 2JWNA 2N3LA 4J9QA 4FXDA 1UW4A 4HVZA 2M52A 2G0CA 1D0EA 2J7WA 4U7UK 2D9OA 4OJ3A 3HVWA 1C4CA 2HFOA 1BY9A 1YBAA 2GJ2A 3KK2A 1JLAB 3DOLB 3V2UC 5KFNA 2MKIA 3V6DB 2AYEA 3G6VA 3W2VB 2ZE2B 4A46A 3QZ8A 2GHPA 4NWBA 5DETA 5F8NA 5IQ6A 2QE5A 3QJPA 3B4DA 4JI3F 4KO0B 2AJ0A 1IKWB 1ZM4A 3VALA 3MZIA 5AE3A 1WG1A 4X62F 4KC5A 4DV0F 1OSCA 2RSQA 2JLEA 3FJ2A 5I3UB 4RNFA 1WEYA 2AJQA 1XERA 4QR1A 4ED6A 1HW8A 4G1PA 4C3MA 3LUYA 3VAHA 4F02A 5CA5A 2NUUG 2N7CA 2ROPA 5DQIA 4F2SA 2CPYA 2ZC3A 1UJ4A 2R8HA 3ONQA 1G1XA 2ADCA 4ILMA 5KG0A 2C3PA 4Y0FA 3QO9A 3NKYA 5T14A 2G1DA 2ZDOA 5B08A 2ZH1A 2WBMA 3H2LA 2B4VA 2CVIA 1HNIB 3I5AA 4R8UA 3EXCX 1Z2LA 5A8KB 5F8IA 1HA1A 4LT6A 5H9EJ 1Y5IB 3KMSA 3IWXA 1GXUA 4NCGB 3X1LB 1FXLA 1PC4A 1SXLA 3OVBA 3B78A 5GVQA 5DLFA 2ZH2A 4ILRA 2KRBA 3O2IA 4N5SA 1NNDA 2BUNA 2EFOA 2WONA 1VC5A 1U1OA 5I3QA 2VB6A 1NKBA 3TA1A 2VONA 2ZHBA 1C0UB 4L3NA 1HBMB 3POTB 2FLNA 3GWCA 1LW2A 3RYLA 2F1FA 3SSRA 4BWJA 3THTA 1Y7PA 2H5EA 4IH5A 4B08A 4YHHF 4UY8T 2VG6B 3J7YU 1R0AB 4FZVA 1T7PA 4KJIA 4Y3CA 5DG8A 4OLPA 1H2VZ 2E1MC 2QIFA 3RR7A 3O1LA 2JDJA 1YIJS 4DSKA 3K57A 1KD1T 2HNDB 2Z2LA 4ID8A 1VQNS 2QMXA 1NHVA 3NAHA 4OLOA 4CH0S 2ZFHA 3GG1A 3MM5A 3M8PB 1X0PA 2BM1A 3NRBA 2B4UA 5KAKA 1FESA 5HI7A 5F9LA 3M32A 2HGLA 1AROP 4H4KC 4X64F 3NMAA 2QSFA 4BHQA 1JLBB 2J9DA 3LH2S 1XNRF 2GMHA 4NLTA 4GKKF 4TY9A 4RWXA 4EO8A 3ZZOA 3VQSA 2MY8A 4HH0A 3IS9B 4QWDA 1NKEA 2RF2A 4FPRA 3UFCX 1P9QC 3C66A 5F9NA 2AGOA 3HT3A 3OJUA 1N32F 3P96A 3AB4B 1X8DA 2VFSA 3KHLA 4NZ6A 2Y1JA 1R43A 3O8WA 1GXLA 3PKMA 2UVWA 4LF6F 1HFEL 3MM7B 1N36F 2UXCF 1T94A 3T5LA 1X4EA 3HHLC 5D6GA 4WFAQ 4X65F 2Q43A 4B3MF 5FJ4A 2HFNA 2DGQA 2HMIB 2KKHA 4AL7A 2XULA 4CO4A 3KOAA 4A8XA 4CI0B 4G1QB 2R7XA 5BYQA 2BOPA 3OTEA 2FTRA 2F4VF 3RB4A 2ZITA 3QLHB 4NLSA 4PG5A 3HHEA 1E6YB 3RB6A 4FYDA 5BYRA 3WDOA 2ZH8A 5HO4A 2E29A 4B17A 2C42A 2AJ1A 4KKOA 4AUKA 4C2MA 1XMBA 1KTVA 4Y65A 4ZK7M 2CJQA 3N79A 4ZHRA 4RUCA 2PT0A 2DR9A 2C3OA 4Q0BA 2DNQA 4QZVB 4OZ1A 3CCQS 1RTJA 2ZKTA 2E1RA 3BGUA 4RBUA 2B6AB 3LAMA 3EGWB 1RYSA 4FBUA 4IUFA 4I2QA 3CMES 1TL3A 1X5PA 4PCQA 5A0YB 1SH3A 1QAJA 4DMZA 5EWGA 5KOXA 4ES2A 3D0IE 3UR3C 5HMYA 2WTFA 1KRPA 1JLQB 1HPZB 3IC1A 3NG8A 2CQ1A 2M3DA 4AYBD 2XC9A 4DFPA 2MZSA 3MOJB 1S0VA 2ZBCA 2J7UA 4NXNF 3SQGB 2OTLS 2XMVA 5I4MA 1LW0A 3IA0A 2KI2A 1T03A 3M30B 1NK7A 4YDXA 3MECA 4QYRA 1KQFB 3J7YI 3OXGA 5KTQA 5IWAF 1HNVA 3PJWA 1Q79A 1DLOB 2LEAA 2NS1B 3CJ0A 2YNGB 4UQTA 1DRZA 1F5AA 2RMLA 1FVSA 4MFBB 2VFVA 4P2SA 5F0UA 5K14B 2BM0A 1W25A 4DR1F 4EBCA 3QMQA 4ECVA 2X1FA 4J9MA 5C25A 5DS7A 5M2PA 5FDLB 3T6BA 2I9SA 2X3GA 3NP5A 1NJXA 3NLCA 4X4VA 2B51A 3D0GE 4LFBF 4PRFA 3J7Z5 3KLFA 1Y3JA 3C6UB 1ZYQA 3OUYA 4TNOA 4X4PA 4QU6A 4DSJA 1TKXB 3W2WB 1MMDA 4LSLA 2HHSA 2WAQD 1U4BA 2YNIB 3BJYA 4DBQA 2VH7A 4LSNB 1VRUA 2DHSA 2PGCA 4RNHA 1REVA 1RGVA 1NH8A 1S1XB 1TZ0A 4C0OC 2ALZA 3CCZA 3MI7X 3GR1A 3HHLA 2M4MA 1U1KA 2XSFA 1NHUA 4Y2KA 2IM3A 3VR1A 2UUCF 2DJWA 3LO3A 4DSIA 2RRNA 1HQUB 3M2RB 5CYQA 1RTHB 2DIVA 1C0TA 5AJ3F 1CG2A 1OS5A 1RT6B 1K0TA 5LL6d 3B4MA 1E6VB 5KT7A 4O3OA 2O1PA 2PDAA 3HDSA 2LLZA 2XS2A 3CWJA 1WWHA 2R7WA 2RQKA 4RW6B 4XDDA 4JV0A 3I4PA 2WSFC 2RIJA 2X51A 4DSEA 1WF2A 2VPZB 4IRKA 3FSIA 2RKIB 2I8EA 5J1NA 1LFPA 5DRKA 4DJBA 1FXDA 1TUVA 3HJFA 5FLXY 3C46A 2DNRA 3KHGA 5K9FA 2MZQA 1S0NA 3FRZA 2VBYA 4NCAA 3P6YC 4ECZA 3I0SA 3KJVA 2Q3PA 3D2WA 3CCES 1RQ0A 4JV1A 2J5AA 1UA1A 2E9ZA 4ES1A 5IFMA 3GV5B 3EYZA 2RE1A 5EWEA 2KXHA 3NS6A 5EN1A 4LVNP 1S1WA 4WZMA 2GV1A 1LOUA 3ISND 1RA6A 1SIZA 2VBZA 3I32A 3MR3A 2VPYB 2R7QA 2E7WA 2GGPA 3DM2B 3I4HX 2UV8G 4UW2A 3DI6A 1RI7A 1DTQB 2DNHA 3I9V9 2HHHF 3T6JA 1P6TA 3MXHP 2UVRA 4I56A 3KLEA 1XBWA 5IM0B 3KYLA 1XN9A 1M5SA 1ZAXA 4DV1F 5C24B 1EETA 2BANA 1K1QA 3ENWA 2BVZA 3HF5A 4O23A 3HHNB 4R5PB 2RS2A 1KS2A 3N01A 1U1MA 3KK3B 2D7SA 2YX4A 1GQEA 4I64A 2MSTA 2RD5C 2D3ZA 4I68A 2KXNB 5D78A 2IBKA 4WFXA 3T5HA 4KFBB 4RNMA 3C2PA 1VJWA 2YWGA 3RTVA 4Z37A 3BO2A 2VASA 3DRSB 4GMKA 1HBOB 3M1VB 2LQBA 3OVAA 1FRXA 3LWMA 5B0DA 2N7YA 3LP0B 2J9DE 4A8KA 3LP2A 4DLGA 3BSOA 4JV5F 4RW4A 2PA3A 3M8SA 2QA4G 2YKAA 3CJ2A 4HYKA 4LF8F 2ZOMA 4NA2A 2W9CB 1UP1A 1URRA 2HQIA 5AXLA 2CPZA 3QJLA 3LQVA 4DR4F 3PEJA 5EX3A 3BDEA 3U27A 5B0BA 1U6ZA 1TFWA 1RT4A 2HHPA 1KVIA 2O01C 2P5VA 3LF0A 1SBRA 5EHHA 1W2BR 4I6YA 2WOMB 4EU0A 3LANA 1DTTA 2A2CA 4I0WA 2FHKA 2JSXA 4TLQA 4YB5A 1IQZA 3ICLA 2CKWA 1KEKA 1L5UA 3AY0A 4H4OB 2DIUA 4AL6A 4OZJA 2VD3A 4KE5A 4QJVA 5KFTA 4AXJA 5K8MA 3UD4P 1U47A 5HLFB 2XS7A 1N52B 2ZD1B 3AA9A 1UEVA 2GHVC 3HVTB 1FTRA </