1RKIA

Structure of pag5_736 from p. aerophilum with three disulphide bonds
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
b'MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title The Genomics of Disulfide Bonding and Protein Stabilization in Thermophiles.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Structural genomics, unknown function
total genus 23
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11424 DUF3195 Protein of unknown function (DUF3195)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rkiA01
1RKIA
chains in the Genus database with same CATH superfamily
4P2MA 3QFHA 1YJNS 5ETLA 3K5MA 1TVRA 3UDEA 4IO1A 3FEXB 3W64A 1N0VC 3PW2A 1OO0B 3JQKA 3MEDA 5DM6Q 5SUHA 2RQ4A 6FDRA 4LR9A 2BX6A 3GTYX 1V5VA 2HFUA 4CLTA 3DNCA 3AQPA 3NXZA 3I87A 3MM9B 3GILA 2RQCA 3DGVA 2AEFA 3GIMA 3K8VA 2VOPA 1YZ7A 5IWAJ 3M30A 2Y1JA 3W5YA 4N7TA 2FY8A 2CVEA 5GAHU 1YBTA 3GIRA 5HVFA 3EGZA 4EYHB 2F7VA 4RNOA 3C6UA 1I3OB 4J9KA 3GYXB 2FQQB 2XYPB 1IUJA 1UW9A 3G86A 1JLEB 2XMKA 4DV3J 4QIGA 2R8KA 2DNLA 2YKPA 4B9VA 4LF4J 1PCAA 1HMVB 2PMWA 1UCNA 4DWIA 2YPYA 2QL5B 2XZWA 2U1AA 3GV7B 2V2QA 4WBFA 3ENVA 3HT3A 3R1HA 4F26A 2V2VA 4DV2F 2X1BA 1IM6A 2B6AA 3D5MA 5DGBA 4DEZA 3DDIA 4ZLLA 5IM0B 3MEGA 3GLJA 3Q86A 4DFMA 5D8HB 2R8GA 3MAHA 4FF1A 4ER8A 2HHHJ 3VAKA 3BGLA 5HQLA 3DM2B 1HLWA 2WONA 1MMLA 1RUSA 4OX7A 3MMCA 3JSRA 4Y2AA 4ED2A 3PEHA 3H7HB 3RR7A 4UT4A 3L3CA 2UV8A 4A47A 1WDDA 2GO8A 2XY7A 3ZZYA 4HLBA 2U2FA 4C11A 1AW0A 2YNIB 2V94A 1UFLA 2H3EB 1NBEB 4YB1P 4WFYA 3V6DA 2RNEA 4DHVA 3LUYA 3FBCA 5GAEU 1C1BA 3TJ9A 1FRJA 2ZBIA 3W62A 4X66J 2MQLA 4LF5J 4DV4F 1RXOB 4KH0B 3VAGA 3V6HA 4LF7F 1DQ9A 3BEGB 4EMDA 4ECRA 4JI7J 2QZ8A 5HMXA 2XSJB 1WHWA 1E6VB 2KDOA 3BH7B 4F7VA 1U6ZA 1S7HA 5F0WA 1RTIA 3ZC4A 1RAEB 4OL8A 1PGZA 4DL0C 1S9FA 4U8YA 3VWSA 1D8ZA 3P49B 2MZTA 3FSXA 1NHVA 4YB7A 2M7SA 2IM1A 2OSRA 2AGOA 5BYRA 2NR0A 4C0OC 2E9RX 1X31C 1TKXB 4HTIA 1RTJA 3TEGA 2AKWB 2NLWA 2XLJA 1MU2A 5KFDA 4RX6A 2DJWA 2MKCA 3LQVA 1Q5VA 1WELA 1UZDA 2C2ZB 3GG0A 4DPOA 3BKTA 4NLSA 2GAHC 2V8GA 3J7AN 1LW2A 1DQ8A 3TX0A 3PYFA 2FGOA 1QAIA 2X1AA 1WG1A 3S6EA 5HP1A 3IBFB 1RKIA 3VAFA 1WC3A 5JXSA 1SQEA 3MAAB 4L76A 4WP3A 1U0HA 5KFOA 2C22A 4KQZA 3GFXA 2YKMA 4J9PA 3MMBB 2B4UA 1N34F 3IC1A 2Z56B 1AZSA 4HEA9 1LFWA 4GO7X 1DARA 3W5ZA 3BM7A 3BO2A 5IQQA 1F60B 3UD5A 4KYZA 1XMQJ 3G6XA 2P5VA 1LXNA 2KXNB 2DNKA 3PVXA 4MKVA 2VA3A 4DL7A 2A2DA 3E3XA 4CM0A 4JBCA 3R97A 2N3OA 1TL7A 4TN2A 3EM1A 3DGPA 4ZDNA 1HPZB 4F4AA 2QV6A 3JAMU 3SMZA 1HQUA 4OZ0A 3R5GA 2GC8A 3CD5A 1FWLA 2OFHX 2BKNA 4GMKA 4C48A 4ED0A 2XMJA 4UZCA 3HHNB 2ZKTA 1IBKJ 1PSDA 1PJ7A 4K4WA 3RAXA 3SXLA 1OQ6A 5KT5A 3US5A 5LL6d 4F4ZA 3PW4A 1Y3KA 1LWCA 3OT9A 2VPWB 5AJ3J 3S01A 2PIIA 5KFSA 2OO4A 2HGMA 2CQCA 1SH3A 2HNZA 2V67A 3LF0A 2HHWA 2VONA 4L74A 4DPXA 1QVGR 3GR1A 4DUZF 3JS9A 2F9JA 3QT6A 1K0TA 4Y00A 2CQDA 3JTNA 4DSLA 3UVJA 3ZFVA 4QU6A 1HHSA 1TTHB 2FZCB 4DR2J 2R4FA 2HWHA 3AA9A 2MQNA 1UETA 1CC7A 4JV1A 5EN1A 5F41A 2W8LA 1V9OA 4N56A 3C3LA 4PG8A 2G1DA 5A76A 3T6BA 4YN3B 4JI6J 2ASJA 1MMDA 2BR0A 3MGJA 3WZ0A 5DDRC 2HBRB 1UMJA 1WUUA 5CD4A 4E8UA 5KFWA 4ECTA 1HNZJ 4AQYF 2CIMA 3O8WA 2AYMA 2MKJA 5H9EJ 3U02A 2NZ4A 2BM0A 4OYOA 3D1QA 4ZP9A 1SQGA 2HHQA 4PWUA 3NWGA 1Q81T 2Z0GA 2YNFA 4IR9A 3CULA 2IYIA 3DDNA 1CJUA 4JV0A 4JI8J 1REVB 2CVIA 2V4QA 2VKZG 5J2NA 3Q8VA 2VASA 1XMOJ 1OSDA 4DF8A 2QLWA 1VQPS 3K7RA 3J80Y 5DG7A 4OHWA 2KB2A 3KJNB 2J7WA 3T1YF 2AJ2A 4NEYA 2I8EA 3K58A 4F2SA 3TUPA 3RUBL 1RBOB 2OPPA 1G4CA 4DS5A 3CDUA 5CYMA 1N36F 3CCQS 1FJGJ 2RKIA 1TELA 2EFOA 1Y9OA 4C8KA 2OHDA 3P3DA 1YWXA 1UW4A 2I6WA 4JUZA 3GCXP 1CS4B 2BJ1A 1S0OA 1MROB 2YPZA 3IM9A 4PG4A 5GMEA 2OI2A 1H7XA 4JYAJ 4DL3A 1JNZB 2E5HA 3I55S 2WW8A 1PILA 4N8NA 4DX6A 5ETPA 3L7UA 3T9NA 2R8JA 4R5PA 2Z57B 3IWXA 2DT9A 3MUTP 1KQFB 2CZ4A 4N41A 2AYBA 2FJVA 2OLWA 3ONQA 1NH8A 5GAGI 4URGA 3FBEA 1AFIA 3H5XA 1GMWD 3SYZA 4YDDB 3BSCA 4FZVA 5I3UA 3D0GE 2XLIA 4M5IA 4RNHA 5FLXY 2JH3A 1SI9A 3CCLS 1DHMA 1GTHA 1VQ4S 3J7YI 1QUPA 4USIA 4KTQA 4FDFA 2C2NA 7FD1A 4A4JA 4Z2XA 2JVOA 5E3CA 4DSKA 3QAUA 2CXEA 2I2YA 1H3DA 4ANDA 2K1RA 1VIOA 2UZAA 2R9LA 1YQHA 3A3NB 2J6SA 2GJFA 4LFCJ 1Q78A 2WOMA 2IY5B 3G87A 2GHPA 4I64A 3LWMA 2X3GA 5KT4A 3MEEA 3O3LA 1X9WA 4JI5J 1UA1A 5J1PA 1S1UA 2HVIA 1HR0F 4IYQA 1I6JA 2ZWPA 3OVAA 4KHRA 4NOHA 2QLFB 1NK7A 4NLXA 2MQQA 2VC0A 1U45A 3UDLA 2E7WA 4EUVA 1RTZA 4X4QA 4WXOA 1NO8A 4YHHJ 3PACA 3U1LA 4YR2A 4QZVB 2J8SA 3DMJB 4M5DA 3BQ0A 1BY9A 2HVDA 1WSVA 2RAQA 3TX8A 1X9MA 4Q2LA 1IM4A 1O8BA 3KKFA 2LMIA 1WF2A 1X5TA 5KFLA 3M8YA 5L39A 3D4JA 1PKUA 1FDDA 5A6PA 2XMUA 1RB0A 1NK6A 1OYEA 4N77A 3M8QA 3DCAA 1F3VA 2R2TA 2D3O1 3EDRB 2CQGA 1RT5A 3KLFA 3GJQB 4HI1A 2DGQA 4ECXA 2DY1A 1GXTA 1OY8A 2VBWA 2ZNZA 3JQMA 1RT3A 1RZMA 1UFWA 1DRZA 4JOUA 4O4GA 4DDFA 5D77A 5J2QA 1NLKL 4C8LA 2GJIA 5BJRA 1PC5A 4KV8A 2VFRA 1U24A 1WI8A 2H48B 4C2MA 4NYOA 2IC3A 3UW1A 4F0MA 4RW4A 4ELTA 3ENAA 2OTJS 4P7VA 4DX8H 4DMZA 5JMNA 4N5SA 5B0GA 1CJKA 4QPXA 3OL9A 1IKXB 3BDEA 2CQ4A 2M52A 2A6OA 4DSIA 1VC5A 1WG5A 3DRRB 3KK3B 3R5BA 4R0EA 4CCHA 1WF1A 2C2OB 4USTA 1GTEA 3OSNA 4M5NA 1KOOA 1IBMF 1HBNA 5HMWA 3OW2R 4B9LA 2QYCA 3MPWA 2CUYA 3QRRA 3I0SA 3I82A 2PMZD 5JUMA 2ZOMA 2V68A 3R6LB 2PI5A 2B51A 4J9MA 2DYAA 4ELUA 3IR6B 1EZZB 1KR4A 2GS8A 3HVRA 2K7JA 2GHVC 3CB4A 3L7PA 4K4TA 4DG1A 2CWXA 4P6QA 3NGDA 4N47A 3VV2B 2P9CA 4X4OA 3EMTA 3IR7B 4Q44A 2YVSA 1WKJA 2VG7B 4CO0A 4ED5A 2C2EA 4JI2F 3FRZA 4LRFA 1N6QA 2HPUA 5LM7E 3FCVA 1PG5B 3UFCX 1WWHA 3BBFA 2ATCB 1S76D 1YK9A 4ZCLA 3ZZTA 4FKYA 2MKHA 1NSQA 3MM5A 4ANEA 1LOUA 4DV4J 2UVVA 3WHIA 2KFNA 3EGVA 2PGCA 2QGFB 3KNAA 2V8VA 4MTPA 1EKRA 2DH8A 4LFAJ 2V4RA 3A4TA 3FGVA 4DV7F 3CO9A 4C98A 4XO0A 3GB0A 2R7WA 3CCZA 3IM8A 3SCIE 2CPDA 1NJWA 1U2RA 2RU3A 2BZ2A 3TOQA 5HLFA 1LV5A 1YJ9S 2ZOFA 1VBKA 2EBGA 1FTRA 5KFCA 3PKYA 2MY7A 2DRBA 2VJUA 3Q8RB 1NK9A 4OYMA 1VRTB 3AJ1A 3J81Y 2KFYA 1NB2A 2UXDF 1C0UB 2ROEA 1MN9A 2WCXA 2BJ7A 1NB7A 1EKSA 4NCBA 3L95X 2ACYA 4P71A 1RHQB 5AXMA 4V19J 3K59A 4EGLA 3DLHA 3LGMA 1NJIT 2DXFA 4ZJLA 2B4PA 3K5PA 2HAIA 1UVIA 2BKPA 4I56A 3MR3A 1N88A 1VBXA 2DGOA 3JSMA 1AT1B 2CKWA 2ZD1A 5IS2A 5DQIA 2YKNA 4TY8B 4OV1A 1YRXA 1SJQA 4RWXA 3LPEA 3EX7B 3MPVA 4DX5A 2KXHA 4M5LA 5DJBA 4OIXA 4L75A 1JB0C 5K9FA 2FYXA 4DR4F 1TMJA 1V5IB 2WVDA 3HZGA 3ET6A 4Z7CA 2Z58B 2B8PA 1HBOA 2IHR1 3HVWA 1C4CA 3KLGB 1TU0B 4OYIA 4CYUA 4PXDA 2VQFJ 1XEZA 4OX6A 2C3YA 4TYAA 5A8KB 3AH6A 4X65F 5D4LA 3C8YA 3OL7A 2H5JB 3ZZZA 3GFHA 1XTZA 3N5BA 2HVEA 3SFUA 2HS0A 2AJQA 3OR1B 2OGUA 3M32B 4PQAA 1JQGA 2KO1A 2VQEJ 4HH0A 1EX8A 4RW8A 4OYZA 2IRUA 1J2VA 2JRSA 4F02A 4ZIVA 3HHEA 3IG1A 2MZJA 5HBMB 4OYPA 5HI7A 3HSJA 2Y8WA 3A8EA 2MKIA 3VCDA 5T41A 4B3TF 4IDKB 2VDHA 4MK9A 1S1WA 4NLYA 4IUFA 2F8MA 4K4ZA 5FLXU 3PIOQ 1X4DA 2HFOA 2ZHOA 1B0VA 2NS1B 1HNWF 3G6YA 3VZIA 3HKWA 1YBAA 1KBRA 2A1BA 2CQIA 1EETB 2DTJA 1RI7A 3K5NA 5DZ6A 1D9AA 2ZH9A 4YQWA 4BBYA 3POTA 1JLQA 4A8KA 4CZCA 3MMAA 5KFEA 1QTNB 4UOFA 3MF5A 2P8IA 3DC2A 4RW9B 4LRBA 2C3MA 3TA0A 1CQNA 4Q45A 2IVMA 3GMGA 1ROFA 2MY8A 3OR2A 4ZVTB 3OPKA 2H4WB 2W2QP 2ZC4A 4TQSA 5H9EK 1NK5A 1UVKA 2GIFA 2Y3YA 5KFPA 3JB9k 2COLA 2V5HG 3JTPA 1HQEB 2PC6A 3S1TA 4OHZA 3I31A 3DLGA 1YDLA 4A8XA 1WC6A 4ZLJA 4MYUA 3TP2A 2A0FB 2DGWA 1YVFA 2V8HA 2H65B 3Q2SC 2APOA 2KT3A 3R27A 3QO9B 4WFAQ 5CD4H 3HX9A 2C3PA 3BQ2A 4ZPAA 2ZH2A 2VV5A 2BQRA 2CQ3A 1NDPA 5J2MA 4AE5A 4C8OA 3VZHA 4PZVA 3HFZB 4H4MB 1CVJA 4DPTA 3CIZA 1S77D 4OHYA 5L1KA 2CJXB 3C19A 3KUHA 1S97A 1VRUB 2Q1LA 1DTTB 3CTRA 4KPYA 3UN5A 1APSA 3KK2A 2A3JA 2VUGA 2VG5B 1IKWA 4YEAA 2MHNA 2CNLB 4B17A 4NLUA 5K14A 1YZ6A 1TV6A 2NXJA 1F5AA 1RT7A 1WHVA 2J9DE 4IRCA 1F0XA 5B09A 2ZUGA 4WZMA 1W7WA 1OYDA 2VFTA 3R2DJ 1OIAA 1L3SA 1IBLF 3NMRA 1ELOA 2FHMA 2J0QD 1PJ6A 3ITHA 3TANA 1CULA 1U1LA 3AXMA 1IN0A 2R7OA 4IOBA 4C3MA 3BR8A 2E66A 5CABA 3B8HA 1HFEL 3FK4A 3N9UC 4NA2A 1YHQS 1RDRA 3CC4S 1SIZA 3NNCA 2JDJA 4B08A 2DB1A 1VK3A 2CJ9A 2W2OP 1ZETA 2LXUA 2ATLA 3UN2A 3KJVA 5M2UA 3DI6A 4JP8A 3KHGA 2CZ9A 5L9NA 2NXNA 2V69A 2OFGX 3MI7X 1SKWA 1I94F 5SZTA 2LECA 4FPRA 4DR1J 1S0VA 2MYFA 2OIHA 4GVBA 3F73A 4LSNA 1WOPA 4B3SJ 4F2RA 1U1OA 2GQ2A 4C3LA 2CQ2A 4I68A 2FDNA 1HWJA 3AJDA 5EWEA 1QTMA 4U7UK 1R8CA 2HNDA 1FESA 2YX1A 2HZVA 1KN6A 5GMDA 2NYIA 3EYZA 3H4DA 3GSDA 2AJ0A 3ENWA 3QT7A 2R2UA 4IQXA 1GT8A 4DFJA 1VHFA 2VFVA 2ACMA 1VBZA 1LW0A 4ZN1A 2H51B 2IFXA 2J9DA 4ICLA 1X0PA 2QJ3A 2QTWA 3GCWP 4DXLA 4KO0B 4WP8A 1X0FA 2DNNA 4U9RA 1DTQB 7AT1B 4QU7A 3T6JA 3J81U 1H2TZ 3CJSA 5A8RB 2P2CB 1M5KC 4YB6A 2XYGB 4M63A 1RAGB 3PG9A 2LDYA 5M2PA 2UVRA 4Y65A 2PD1A 1T7PA 1BC6A 1U6FA 1YRUA 4DLGA 3PX6A 3MTJA 3Q2TC 1HWLA 4UF4A 2FJDB 1IQTA 3BYRA 3I0RA 2EK1A 4F3MA 3PO4A 1S10A 4HDHA 1SJRA 4DLEA 3PO5A 3GG1A 1WI6A 4DR6J 3EXYA 2WAQD 3MEDB 2BJDA 3KLEB 2OJ3A 3Q23A 5CYQB 3HM9A 2HHUA 4EBDA 2GIQA 3KLIB 3BH6B 3O44A 5F8IA 5K8PA 1K73T 1R89A 4JB8B 2UUCJ 2CYYA 3TZWA 3WX4A 1NHKL 2NUUG 3M8PA 3P8BB 1JJCB 3SQOP 1HKAA 1N52B 3LGHA 5AE2A 4RNFA 3OTDA 3CJQA 3VAMA 2AJ4A 2HQ3A 3DXSX 3CJ5A 4QIFA 3C6UB 4K5SA 4C0HA 1TL5A 1LXJA 2UU9J 3MR2A 4QWEA 1BQNA 1LWEB 3BYPA 3DOMA 5AXNA 2PEHA 4HH1A 2Q66A 1LWFA 2F5GA 4ZP6A 4HACB 2QG9B 2X1FA 2OPRB 2DD8S 2IM3A 1HA1A 2MZSA 4MKYA 3RJMB 4ZLPA 1LWXA 2XMMA 4XPEA 2HQCA 2VFSA 3SIPB 2HHPA 4L3NA 2YTCA 1QAJA 1K8AT 2B6AB 1CPZA 3BO4A 3LW5C 1JXEA 2UVUA 2NXEA 1UVMA 3SQGB 3NWRA 4OZ2A 1YIJS 3QT8A 2W01A 4C4WA 2UUAF 3A1YG 4MH8A 1WOOA 3EVOA 5HANA 4EK2A 2W9CA 2HGNA 1NEEA 3MMCB 4HVZA 3W3SA 1K9MT 1YG0A 1FJ7A 3H90A 4LFBF 3EVMA 3Q83A 1S4EA 3LP0A 3FMWA 2LQBA 1V3RA 2CJBA 4G1QA 1PO6A 1N5QA 1BUXA 3CJ8A 2EVZA 2DNGA 4RZRA 1HW9A 2CQBA 2YWHA 4DFKA 1C1BB 4ZPVR 1X8DA 2BXJA 2YWGA 4FBUA 1WOSA 4G6VB 4ECZA 4ZPTR 3NCQA 1N33F 3VHQA 2LKZA 2HW3A 4OZ1A 2KM8C 4W90B 4JI3F 3W9HA 4KHMA 5G4DA 1H38A 4LBPA 4FYYB 3OUYB 4DL2A 4DN9A 3F0NA 1N5YA 3L7OA 3BN7A 4Q2MA 8ATCB 4KGXB 2FLOA 4MFBA 4RWWA 3HSDA 3UDVA 2GVDA 1HWUA 1JJ4A 4XDCA 2WZ1A 3BZQA 1ZAXA 2E9TA 2PI4A 4PQUA 1HBMB 1Y4ZB 3N4WA 2YX7A 5J1EA 5D0GA 3FSYA 1RTJB 2AZ1A 3KLHA 4MKAA 1ZOTA 1MU2B 1VDHA 1VYAA 2RRAA 5D4OA 3O2IA 5HQMA 4ZK7M 2OELA 4DBQA 2BQUA 4DV1J 3LH2S 1X9SA 4WFZA 3G4SS 3CW2C 3BDPA 2BJEA 3CCUS 4ED6A 3QZ7A 1LW2B 4K0KJ 5ADZA 2HRYA 2KYZA 1IVZA 4CLYA 1XJWB 3BR9A 3UCUP 3T19A 1S57A 5K20B 3IWNC 2MSSA 2BW7A 4UUWA 1VQ8S 3IA0A 2YKMB 3M05A 5IWAF 3HK2A 1RWXB 5HROA 2HQFA 4ILRA 2HQDA 2E9ZA 3FDSA 4E2FB 4DN0A 1ZS6A 4X65J 5I42A 1NKBA 4ES3A 5C7PA 3GE9A 4ED1A 3D28A 1JLCB 1TL3B 2HS4A 4J9QA 1WJ9A 3KHRA 1J5EF 1TZ0A 1FTCA 4J7CA 4WKRA 5A0YA 1S9GA 1RT2A 3OHAA 5CAAA 2FD2A 3KLVA 4H4OB 2HBQB 4B3OA 1WD6A 1VJQA 3KXDA 1RTDA 3BREA 5FDLA 1PAEX 1OS5A 1SVDA 1QUVA 3QRQA 2HWIA 3TRGA 1VOMA 1GAOA 3VR1A 4AUKA 3UN3A 1A0OB 3H5SA 3D54A 5KG1A 4ETXA 3FMBA 4OZJA 3GSIA 2HHHF 1JK9B 2IPOB 2FZGB 3TYTA 1P1LA 3AOAA 1URNA 2ILZA 4KY3A 1SL1A 2OPSA 2WVEA 1EIYB 4DX7A 2HVHA 2WB1D 1XN9A 1JLBA 4HKQA 4AXIA 2HNZB 2YKAA 3DKDA 4XIUA 4WU3A 2AT1B 2DNZA 2FGCA 2IJFA 1FWKA 2ZNYA 3JTOA 1WORA 2CG8A 3SEOA 3UO0A 4NZ7A 1WC5A 1FNXH 4UUXA 1KRPA 4CT9A 2ASYA 4X66F 4LF5F 5KG6A 2IJNA 3NKYA 2FLLA 2FPHX 4QIWD 3PYEA 3CCVS 3T5KA 4KH1B 1D3WA 4OYBA 5DZ7A 4O3SA 4JI7F 3EZ5A 1OSCA 4AT1B 2HMIB 2NREA 1YJ7A 3I6PA 1FF2A 4I1TA 1JIHA 1F5BA 2JHEA 3CCMS 1HHQA 1A7GE 1IJEB 4KGVB 1TUGB 3EJMA 3MUVP 2DK2A 3BJYA 3EUNA 2H5EA 2BJ3A 2M2BA 3LA0A 2YNFB 3DU5A 2ZH5A 1F6TA 4NRTA 2BRKA 2F8EX 1O0PA 4RUCA 3ADAC 4ID5B 1IXKA 4YY3J 3CD6S 3F56A 2FUG9 2D9PA 3GR0A 3P5TL 2HFZA 2WHOA 4X64J 4NXMJ 1X4EA 2OPPB 3N28A 1T9UA 2B9YA 1VQLS 5F8LA 1SC4B 4LSZB 1S6QB 2M5YA 3NMAA 1KTVA 4C0BA 5F8JA 4X4VA 2XS5A 3EWGA 5CYMB 3VQTA 4PPZA 3T1AA 2EKNA 2CPZA 1SC1B 2LEBA 2C3UA 1W25A 2DR7A 3R5CA 4DU8A 2R42A 2HFNA 5ETRA 2DEJA 4ES1A 5D6GA 2AJ1A 4WYLA 3PYGA 4A46A 3NGKA 1U26A 1WG4A 1XMQF 3MFIA 2IM2A 1RQ0A 3QATA 3RTVA 1OJ4A 4BS2A 2KI2A 4C97A 1F5CA 2E5IA 1EQMA 2VHGA 2FZKB 1ZZNA 1RT6A 4R5PB 2QC3A 1FD8A 1HNVA 2DNOA 5MLCV 2ZBQA 1TR0A 2KYXA 2NXCA 1DY3A 3PDNA 2RIJA 3PCOB 4TLRA 4ZPDA 4L72B 2K3IA 2W4PA 4KGKA 2EBEA 4Y0FA 4F4KA 2F63A 3FQLA 1T11A 1LNQA 3IS9A 1X7VA 5H9FJ 3HFKA 2BE2B 1IBKF 3D1OA 2O5DA 2FHOB 4PRFA 1OY6A 4YB5A 2OKQA 1D9FA 4EO8A 2B56A 2YNIA 2UUTA 3A13A 1VQSA 1FDNA 4ZMMA 1K47A 2DCUB 3LGNA 4NRUA 4O3NA 3RW6A 1Q0NA 4MAKA 2AJFE 1JXVA 1N56A 2BJ9A 1NDCA 2EG1A 1KSPA 3V4MA 4ILMA 1M1HA 2RS8A 4KFBA 2ADCA 1G7CB 1S59A 2MXYA 5M2RA 1WTFA 1KOHA 2K1RB 1S1TA 1ITPA 4WWSA 1RAAB 2YXLA 1JX4A 4USJC 2PEBA 4X4UA 1FD2A 4Y28C 4DR2F 3HKZD 5HMZA 2WOMB 2KVQE 4YUDA 1FDBA 5KFHA 2AWZA 3B4DA 3K57A 4DR7J 3TJAA 3MEEB 2NCKL 1S1UB 4ZP8A 4EU0A 4JI6F 4PABA 1U0SA 1SJ1A 1TKXA 3DLKB 2L41A 2LU2A 3ZZUA 1SJ3P 5KOXA 3W66A 1HNZF 1Q7LB 1Y5LB 3OQ2A 4W98A 5D4NA 3HO1A 4Y2CA 1U09A 5GAGU 2LEPA 5D15A 2GMJA 2VBXA 3CVKA 1D0EA 1S79A 3SCKE 3IGNA 5I4MA 2QL9B 2O66A 1RBLA 3DYAA 3G82B 3LAMA 1D8YA 3TEHB 4X4PA 2YNGA 1RT5B 1XMOF 5IOLA 3KLFB 1QAXA 2KL8A 2HRTA 3RYLA 3J7YU 3CT9A 3MMBA 3B78A 2RU9A 3FNNA 1FKAF 4FF3A 2XMVA 3LP2B 4B9MA 2RHQB 5D0EA 1U48A 5GADI 4OLOA 5KFRA 3QJPA 1S48A 2J0WA 1FJGF 2RSQA 2IC3B 3CCWA 2RT3A 1S0NA 4RW4B 2D3ZA 4DPYA 1VQOS 2MMYA 1MLAA 1VQYA 4TQRA 2JLFA 1U8SA 4DPUA 4U67Q 4NCAA 5HL7Q 2J9CA 4O3RA 4UQTA 5KFXA 2W7OA 1BQMA 3BSOA 4JYAF 3U7JA 2GNKA 3CJKA 3L4BC 5ETTA 2JVRA 1IQZA 4WK1A 4LVNP 2E7XA 1R31A 4CLPA 1HBNB 2YWEA 2Q43A 1S0MA 1XWLA 1FX4A 3I0SB 1Q8IA 4IH7A 3CMES 1RHKB 4FKXA 2C42A 2JLEA 4IRKA 3KMQA 2YWWA 1TKZA 5LMUJ 2MQMA 3DOLB 9RUBA 4DG1B 3ZTRA 1DURA 2BV3A 5HQ8A 2FJBB 4Q8FA 3I96A 2I1RA 3IRWP 1N5SA 3G8TA 4OYXA 1VK8A 1SJ4P 1NDKA 1H98A 3MUMP 4F67A 5KT3A 2W9BA 2GIRA 2LA6A 2KG1A 1M1KT 4P7TA 4HT7A 1UP1A 3MM5B 4LF9J 1EAYC 3NRBA 2CQ0A 4ZCMA 3K8WA 2Q6BA 5KFMA 4K59A 3M6UA 3ILLA 5E33A 3M9MB 1KONA 4JI3J 4O3PA 3P5BP 1FXRA 2CQPA 4WU2A 4LFCF 2A6MA 2OD4A 3CDEA 1HHTP 1PIEA 2LP4A 4DQQA 3MM7B 1F2HA 3U1MA 3NNAA 2WSEC 2F1FA 2LXFA 3FBFA 2VBYA 3TUZC 3ICLA 2AHOB 3ZZRA 3QPIA 3GIIA 3N01A 4DCOB 3QRPA 4D3HA 1FCAA 2XC9A 3IRXB 4FN5A 3DRSB 5IV3A 3CJ3A 4YHHF 1LQ9A 3Q8YA 1S1XA 2MZ1A 3D0IE 5DO2A 4QWCA 1HARA 2RRBA 2WW4A 1IWAA 3VAJA 2NUHA 5HN0A 2B4VA 4DV0J 4LRDA 4X4NA 1X4BA 4O23A 4HR2A 5GMKa 1IWGA 5ETMA 3H8YA 2G2OA 1M5VC 2XO7A 3MPYA 4I2QB 1U1RA 1ZAVA 3BV8A 2ZD1B 4PXEA 4C8YA 4JI1J 3OVSA 2YBVA 2KTQA 1BWVA 2VFUA 4J9VA 2IIHA 4QOTA 3BGOP 2RJZA 3A3PB 3OVBA 1CS4A 2FHJA 2R7TA 4F8RA 1MROA 4NWBA 1U6BA 1WC1A 3QLHA 2L08A 3CDWA 3ET6B 3M9NB 5JVHQ 1HBOB 4X4SA 2P6TA 4M5MA 4HT5A 3DDKA 2VODA 1NRKA 4P73A 3J7ZT 1R8PA 1ZA1B 1J5EJ 2HSEB 4ZVPB 3TQEA 1TL4A 2CDQA 2OTLS 2R2SA 2CQHA 4KC5A 1MSWD 1DQAA 2XM3A 4ZPCA 1NXIA 4LMZA 3QJLA 3TO8A 2DR9A 4A8OA 4WJBA 3MTKA 4NLTA 3AD7C 2D3OR 1UVJA 1FXDA 4WTYA 5IZHA 3PNIA 1U25A 4NLGA 2C2KB 2JL9A 3FCWA 1CC8A 5RUBA 3MHYA 3D0HE 4O3OA 3S8SA 3KJQB 1SKUB 1YJTA 1AFJA 2ZUAA 2P9EA 1RU2A 2AYGA 2DH9A 3DHXA 4QPTA 4CLLA 1C1CB 2FHJD 3E01B 3PRDA 8AT1B 3HHLB 2MQPA 1S1WB 1NK0A 1U2FA 3ZTOA 2RQMA 2DH7A 1WEZA 1VQ6S 4K2JA 3UCGA 2UUBJ 2JFDA 2MGZB 2V9WA 2MZQA 2FC8A 1RBAA 3AY0A 1VC6A 3ILOA 1K1QA 1FT8A 5KG4A 3POTB 4C8MA 1Y5NB 2J7UA 3EDQB 3PIPQ 3NLCA 2M9KA 2CA9A 3MMAB 4IG0A 2VICA 1CQMA 1RTHA 3DRPA 4PXCA 4LT6A 4J91A 2Y1LB 3W7BA 4ZHRB 3KK1A 3MWBA 4RW7B 5DLFA 3B6BA 3GQCA 3OTBA 4CQ1A 2VPXB 2FJEB 1X5SA 4LFAF 4ID8A 1KQSR 1HYSB 4K2XA 3NBPB 1VQMS 4LR8A 5IV4A 1FKPB 4F3QA 4ED4A 4FNIA 4QBUA 4ECSA 4LF8F 4ALZA 2HYIB 4NLPA 2VL1A 4EI2A 5EWFA 3RBEA 3N0VA 2X7IA 2CWKA 4Z37A 4EO6A 1IR2A 4Y2IA 1R7IA 2YKOA 4FYVB 3ILJA 1T03A 2FVQA 4FBTA 2FB0A 1CEZA 4BHQA 3C16A 2MTLA 1YJVA 3M8WA 3W8PA 1X4AA 3DRXA 5J2MB 1SKRA 3KFWX 4ZCIA 3H5YA 4DUYJ 4LJMA 2EC2A 2RS2A 4UY8T 2ILYA 4KT0C 2ZVSA 4O0NA 2DHSA 3SDEA 1GXLA 3HXMA 1IKXA 2B7CB 2F3JA 2BOAA 3AB4B 2M8HA 3V81B 1P27B 3VGTA 1Q8LA 4A48A 4USHA 1UVLA 4NMXA 3A8JA 4CDIA 1RWKB 4EFAC 2MLXA 1S1VA 5K14B 2VQFF 1TV6B 2EFVA 3ZZ0A 3LALA 2CPHA 1M5SA 1OPZA 5AXLA 4EZ9A 3ZZPA 3QGGA 1N4LA 3ISND 4CRJA 4K4SA 1WC0A 5LOQA 2E1RA 2DVIA 1NNDA 1TK5A 4NASA 1T9YA 4DZ6A 5H9FK 3LP1B 3MM6B 3HVAA 1R0AB 3ITHB 3W9JA 1RISA 1IKYA 4GC7A 1ZPWX 2VQEF 1B70B 3SSSA 5H1SV 4TYBA 4IG3B 2KU7A 4ERDA 1Y7PA 2VG7A 1Q8KA 4IFYB 5KFAA 2X3DA 3HD1A 1UJ4A 1B7FA 2QE5A 3MDFA 3TVKA 1M1GA 3PM9A 2Y8YA 1BLUA 4NXNJ 3GPAA 4IFVB 3W65A 4QIVA 3G6VA 1SC6A 4OZ5A 2ZITA 3KJVB 4CH1A 2MEWA 4LRAA 4NLWA 1FNOA 3TWZA 4LSLB 1Z1ZA 1N48A 1S5ZA 4I7FB 5F3ZA 2FVRA 4LSNB 4UTGA 4O0IA 1QE1A 2KN4A 4CM2A 2HNDB 5EX0A 2RQKA 3M2RA 3LAKA 2V50A 3CCES 4USWA 1MWZA 2ZFHA 1AUSL 1FNMA 1QM9A 4KRWA 2F4FA 2P6SA 2QA4S 3OLBA 2K06A 1MWYA 2FY1A 1SXLA 3M2UB 2KFZA 3Q22A 1LW0B 2KHCA 2G13A 4QW8A 4ICLB 2EK6A 4USUA 3UDCA 1VQKS 3BBBA 3ULHA 1D9DA 2YQ3A 2B9WA 1VHIA 2W9AA 3OFGA 4C9DA 2QRRA 1T9WA 4X84A 2MB0B 3HP6A 5HJYA 4ES2A 3AA8A 3HJVA 1KQGB 3W2WB 3VVUA 2EEYA 3I0RB 4GO5X 3TZXA 3TR5A 1HI0P 3FZBA 1WKLA 3PJWA 3CCJS 5HSPA 3MAQA 1GMWA 3E2EA 9ATCB 2OUGA 3CNQP 4L6V3 4AD6A 5K8OA 1U4BA 1PYTA 4H54A 1B99A 2F9DA 4Q0BB 4FYXB 2VZ9A 2XY5A 2D1CA 5D0RA 2ZKUA 1GFWB 4G3IA 3UE2A 2RUGA 4DS4A 3M8PB 4X4RA 3GU0A 3CCRS 1T94A 2ZDPA 1JLGB 5LXYA 3BGUA 2ROGA 1B3TA 2CAJA 3D3BJ 2ZH7A 3M6XA 3OV7A 1S6OA 2Y0BB 1F9FA 4I69A 3DOMB 1UZHA 4WKYA 1SL2A 3D3CJ 1HBUB 4PYDA 1LWFB 2C1EB 3WC2A 2XS2A 2LDIA 5L46A 3TQ1A 3W1YC 1WKKA 3UCZP 5KFIA 4KE5A 5HBMA 3HJFA 2CRLA 1FRLA 2CJYB 3QT5A 1NHUA 2X1GA 4IDKA 3KJFB 1HWIA 2B0GA 3H4BA 2HQIA 3MR7A 4QW9A 1NMEB 5KFBA 2N4CA 4TY9A 4ZIWA 4ZLNA 1R27B 4HDGA 1RHMB 4B3MJ 4RKUC 3VVTA 3CC2S 1BGXT 2UXCJ 2CDRB 1EETA 4R8UA 4OX9J 5C24A 5CYJA 3QZ8A 3CWJA 1TL1A 3CE8A 1Y5IB 4RW9A 3LP0B 2G0IA 2AF6A 2QA1A 4AXJA 4JV2A 4G1QB 4DR1F 3H0PA 2CQ1A 2DO4A 4LR7A 2W2PP 1RAHB 1KFDA 1Q95G 4B3SF 4WP9A 1M0SA 3NGSA 3NCRA 3SV4A 3QBCA 3I5BA 1XMBA 3R6GB 1HQEA 4KIAA 4J90A 4I6WA 2GX8A 2W4DA 1JJHA 1S9EB 5MAOA 1SJFA 3MR5A 3PHEA 4H4KA 5I3QA 3OD2A 2HURA 4OI6A 3TI0A 3W2VB 1AXQA 4JV5J 1N5YB 3QO9A 1UEUA 4V19X 2DEIA 3AXKA 4JI4F 2F65A 4P52A 1DBDA 4MFBB 3FRYA 2GVDB 5CZVA 3WC0A 2JX2A 1XBWA 4FXDA 5L1LA 1NJYA 3T9ZA 2AD9A 4PQUB 3PXGa 2BW2A 3G8QA 3PYDA 1QAYA 4QR2A 3VF0B 2RRNA 5CCLA 1JJ2R 4IOAQ 1KS2A 3IR5B 4MT1A 3ILIA 4LQ9A 5DRKA 2ZH4A 3CEDA 3DLEA 4D3GA 4K5RA 3PW7A 1U1MA 2VG5A 4A8SA 4MK7A 5HATA 3A8IA 4DR6F 1VS3A 1S12A 5B7WA 2DNQA 2R2RA 1BD6A 3MCOA 2H9ZA 3GV8B 5E2QA 2DGVA 2RD5C 2XMWA 3V5RA 2ZWOA 1JLFA 1WHYA 2HS3A 2JFKA 2ADBA 1RWOB 2GVZB 2UUCF 3M1VA 1P8GA 1ZM2A 2QA2A 1UAWA 4WFBQ 4AL7A 2XNRA 1XERA 4AL6A 5K5MA 1WACA 1DFDA 2ZJRQ 2XZTB 2EG2A 2CPIA 1AUDA 1NSPA 3GIJA 5A8WA 1ULRA 2H1YA 5I42B 3NGTA 4EZ6A 4USMA 3IAS9 2C2MB 1QSYA 1R0CB 3R8YA 1UFKA 3BPDA 4F4XA 2UU9F 5EHHA 2JLGA 2B9EA 1HNIB 1H0HB 5A0YB 1S9GB 2BANB 3BGRA 4ED3A 1REGX 4HHJA 2ZE2A 3FBBA 2IBOA 4ZA1A 4LRCA 4M94A 3AB2B 4DQIA 4KSEB 2JWNA 4Q8EA 2YNHA 1C0TB 2MHEA 3EPGA 2FLPA 2PE8A 3ZXWA 5BXIA 4DPWA 1RTDB 4FXVA 2OP5A 5EUHA 4WFXA 4NYZA 1FWPA 5E5NA 2FLNA 2KKHA 1F3FA 4ENOA 4QWAA 4OFZA 1CJTA 3BGFA 2VC1A 4URQU 1X4HA 2D3UA 4ZPBA 4TU9A 1OPIA 4ECWA 4WF9Q 5BR8F 3P45B 2LQ9A 4RUBA 1FRMA 2OPSB 2R7VA 5KFNA 2GV1A 2UXBF 1JLBB 1WEXA 1QSLA 4NI2A 3OSPA 1N8RT 4YR0A 4XAKA 5LSOA 5B08A 3T1HJ 4ZS6A 2EPIA 2J76E 3AFGA 3RAMA 1RGVA 1TQLA 3BF4A 1RAFB 4JI0F 2RVJA 3FSIA 4K4XA 3TVZA 4G65A 4KO0A 2JC0A 3HFVA 1R3NA 2V8DA 1Y0HA 2OEJA 3FCHA 3JXOA 2DGUA 1H73A 3PHTA 4Q43A 2HKEA 1NKCA 4LF8J 3ISNC 3T5HA 2GGPB 1ZM9A 3LO3A 1HWKA 4X62F 4DL5A 2IVFB 4J9SA 1NJZA 2I5JA 4WE1A 2W7PA 1U1QA 3QSIA 4CH7A 4KB7A 4CTAB 2V8PA 2WK4A 2A10A 3HVTA 2VA2A 3H42A 2KRRA 3TA1A 1RKJA 2I0XA 2W2NP 3RRHA 2I38A 2XGQA 3LANA 1LFPA 1N32J 5C42B 2CPYA 5EDWA 4BWMA 2J6TA 2PSZA 3KLEA 2K8GA 3CJ0A 1JNRB 3RB3A 2J6UA 1IJFB 5CYQA 3MMJA 3J80U 4OZNA 4NE9C 4ZN3A 5KFJA 1QVFR 3JSYA 1KNZA 3E8OA 4F3OA 3KLIA 1ZTWA 3TUIC 1KHVA 4BDPA 2E5JA 2SXLA 2C28A 1Q8BA 2M70A 4DV1F 5T14A 1PJ5A 1R6VA 2G0CA 2HVZA 1RACB 4K0KF 1L3VA 3H20A 1T02A 2K7KA 3VGUA 3OBIA 2Z2YB 1VCTA 2AGQA 2NSBA 2IRXA 5KFZA 1RT4A 1P6TA 3TAMB 2YQ0A 4WFNQ 3ZZOA 3KUGA 3DXBA 2PDAA 1N0UA 3N5FA 5KFVA 2BE9B 4OJ1A 2IDEA 3AOBA 1UWAA 3SI8A 2XMAA 1LWEA 1Q86T 4FYDA 2UP1A 4YDXA 4NCGB 1MW7A 4HACA 4IRDA 1HQ2A 4Q5VA 2D69A 2OPRA 4GC6A 2JC1A 3BSAA 4L3KA 4LBIA 1KD1T 1RWNB 3DOKB 2ROPA 3OJUA 2Y9HA 2BUNA 2HIYA 1SUQA 3V4IA 4UZBA 3SCJE 3G2XA 2EXUA 1ZPVA 3LWLA 2LEAA 1NAQA 2HNYA 2HZCA 3H2VE 3C15A 2HK3A 1TP7A 1JKHB 3SQGA 3CCSS 1RT6B 1HNVB 1JLAB 4NMLA 5DGAA 1FRHA 2OMOA 2C2DA 2R7XA 1WDTA 4PUOB 4DV5J 3B4MA 2A18A 3FC9A 3I9ZA 4NLQA 1FK9B 4DFPA 1H74A 2ZHBA 4J9OA 4QQBA 2AMCB 3IS9B 4LUBA 2UVWA 1VGYA 3LTOA 4KKOA 1KFSA 2XNQA 1KVIA 4EBEA 3RB0A 2OAUA 2B5JA 4UOHA 3T41A 2VD3A 4PG6A 5F8HA 1GH8A 3IBCB 2M8DB 1RT1B 4HHUA 3UR0A 2IM0A 3MCSA 1XR6A 2WSCC 4O4RA 1Q79A 4KFBB 5IT0A 2AYEA 4YOEA 2E1PA 3QIPB 4M5HA 1S1TB 1XNQJ 2N82B 3OUYA 3MM8A 4LQ3A 3PR4A 3MCMA 1SV5A 3I9V9 4RW6A 2GMHA 3NEKA 8RUCA 1FRKA 2V0NA 2BBEA 4RLEA 4I0WA 2V34A 3D6MB 2WVBA 4MYTA 1U02A 3HMJG 3HPOA 3UPFA 1HBMA 2RMLA 3KHLA 2DNMA 2XO6A 1KVJA 2Z30B 2DGTA 3EZUA 2Z4PA 3QMQA 3D67A 2RDJA 1YJUA 4TU8A 1U47A 5JVGQ 2RF2A 1HW8A 4G1IA 3TA2A 4B3RJ 1QJHA 4J9UE 4Y3CA 4GKJF 4OJHA 4DL4A 1DAXA 5CH7B 2QL7B 3DYAB 2FC9A 4CO5A 1J5OB 5EX3A 2YNGB 2N3LA 3T3FA 2VG6B 4YY3F 2FJXA 2DGXA 2QSWA 5B0FA 5ETSA 3MECA 4F25A 3NG8A 1XNRF 2B9XA 1Q4RA 3CGIA 3MOJB 1UWBA 4X64F 3EGNA 4NXMF 2ZJPQ 2EKYA 4PKDB 4XDDA 2QX0A 1NZ8A 3QGHA 3KOAA 5FD1A 4HL9A 2PMHA 3HSZA 2BVZA 1JLCA 1TL3A 4DU7A 5C5JA 1RA7A 3GONA 2ZZMA 4H4OA 4DR5J 3RU0A 4OZ3A 4K4YA 4NZ6A 2V2ZA 1BQMB 2ALZA 3H59A 3CJKB 4ZVGA 3RBZA 2BQ3A 5AT1B 4ECUA 3EXCX 3FFIB 5C2GA 3W9IA 1PC4A 2EFPA 3KG4A 1XIQA 2DR8A 5T7LB 1FKOB 1YBUA 1BMQB 4ZOSA 5ETOA 3CF5Q 1L3KA 4B9UA 2YKQA 1QDUB 5BYSA 2AZ3A 2EW9A 1TKZB 2AX0A 2A2CA 4P9SA 3TAQA 4KJIA 3GV5B 4PWDB 5B0CA 3CJ4A 1RHRB 2IDLA 2QO3A 4LF2A 3SFGA 4ZVEA 1ZM3A 2KXFA 2V4JB 2ZDOA 3KG1A 3P4UB 1N54B 4OJGA 2W9BB 2KZZA 3BKFA 2RB7A 5E3AA 4WTOB 3PFEA 2MPUA 5GADU 3VALA 3KG0A 4H4KC 1RLDA 3JYTB 5JJBA 2VKRA 3RG6A 1Q1KA 3D9BA 3OFHA 2ALYB 4DV6F 6FD1A 2HMIA 4ANCA 2Y0SD 4BCAA 1RWPB 4FS1A 1OMSA 3HI9A 5KFTA 5G0RB 5CHCB 1RU1A 1VBYA 4P72A 3NY0A 3NS5A 2MKSA 2KJVA 4DR7F 3M2VA 4JI4J 4R25A 2ZHAA 4URSA 1FA0A 1EP4B 3HDSA 2XG8A 3I5AA 3CJRA 3K17A 4ZITA 4KR0B 4HI2A 1NPPA 1S1XB 4ID5A 1ZZFA 3J81j 3RRGA 4Y2MA 3M6VA 4U7CA 3R1LA 2B4OA 5FJ4A 1TUVA 2DXEA 2VU5A 2R7QA 1BXNA 3QFWA 4GRSA 4B9SA 1G1XA 1K44A 4PR6A 1Z4UA 1TVRB 1YJWS 3BN4A 1XR7A 3SV3A 3D6FB 1FO1A 2YQ1A 3FJ2A 1S6QA 3JSBA 5KTQA 2V6AA 1IBCB 3RB4A 3DFEA 3L9ZA 4ZVOB 2JEJA 2AIRB 3PZPA 3H5UA 4K7QA 1T9TA 2DHHA 1QY7A 2HIQA 1FJEB 3DHWC 2PN6A 1PBUA 3DRYA 2ZVIA 4DUTA 2CPFA 4PEOA 3OL6A 3M30B 4CLKA 1RADB 4P75A 2D74B 3QLHB 4IOCQ 2FTRA 3CJ2A 1KTQA 4ZJOA 1T9XA 4I6AA 4BWJA 2HEKA 5EWGA 1FFGB 3RBXA 4N76A 2MJUA 3W63A 4P2XA 2HGLA 3GYNA 5KG0A 3ENQA 2RILA 2CJQA 4BC7A 2H4YB 2AP6A 2BRLA 2G9OA 2BYCA 2XLKA 2LQ8A 1VJWA 1RSCA 3M8ZA 2MQ8A 5LMNJ 2BE2A 5KOWA 3V6KA 1Y00A 2UUWA 3MEGB 4KGMA 3NAIA 4CP5A 3R9LA 1T05A 3GZ7A 1SH2A 3NCPA 1EHWA 3W5XA 5KG7A 4M5JA 3HULA 5LMUF 1HNXJ 5BR8J 3QGIA 2WONB 3AT1B 2FVSA 3E51A 4O44A 2KH9A 1FE4A 1VIXA 2E5GA 1S6PA 3PEJA 2UXBJ 2RUSA 3IXQA 4WZQA 4UOGA 2JEFA 1B64A 4QR0A 2R7UA 3OTEA 4C11B 1NH7A 1S4FA 2R7SA 1IR0A 4PXBA 4USVA 4IQMA 3PJXA 4CO1A 1T9VA 3V6DB 4P10A 4RJVA 4JI0J 2OH2A 4WCEQ 2LYVA 1NK4A 1S72S 1XR5A 2QLBB 3B54A 1HIYA 1RAOA 2O67A 3LOUA 3QWPA 1NK8A 3R7NB 4LF9F 2M4MA 4IG0B 1V3ZA 3DRPB 1RTHB 3U27A 1TKTA 1EB0A 5D0HA 4E98A 1Q53A 2W25A 3KK1B 2L9WA 3DLKA 1ZH5A 1I1GA 4X62J 4WIQA 2KRBA 1DLOA 2POKA 4ECYA 1ZAWA 2VOOA 4LF6J 3IMQJ 4YFUA 3RR8A 1RTIB 5AE3A 1LK5A 4OI1A 1CJVA 4WIIA 2ZH8A 3OXGA 4F0KA 1N5VA 1T3NA 3G71S 2DRDA 4IR1A 3PY8A 4MJKA 4NLDA 3K5LA 5ETVA 4UQGA 1VI7A 3G82A 1RJJA 3W61A 5IC4B 5L9XA 2O3DA 4ZVUB 2G2ZA 3AOCA 2B7BB 5J1NA 5BYQA 1T03B 2B3TB 2BE7D 3C16B 1Z2ZA 4DV0F 1W2BR 2ZEJA 3LP2A 2FVPA 3TVYA 2IYGA 5D3GA 3C14A 1FJCA 3ZTSA 2G4BA 4LF1A 3WIUA 5HP1B 3GP9A 2UV8G 3AD9C 2AEJA 4JI1F 3SSQA 2XSFA 2E5LF 1U0HB 1E6YA 3SDEB 2QIFA 3R7SB 2J7KA 4U7UD 2MLZA 4C8NA 1ZM4A 2BACA 3P6YC 1RYRA 5C25A 3EVWA 1AZSB 1Q82T 3CPWR 1OWXA 2I9SA 1VQ5S 3HF5A 3X1LB 4DSFA 3FKBA 3QWUA 2W4CA 5CCMA 5IT4A 2AU0A 4RUHA 2BEFA 4DV2J 3QAEA 4NL5A 1S1VB 3TZYA 3N6MA 4MIWA 1VLYA 4ETZA 2MZRA 1R6YA 1YGYA 2DCLA 4F4YA 4ZKAA 1TL7B 1RK8A 2VB6A 1LKZA 3DGPB 3TAPA 4DR3F 5LT5A 3DOLA 1HQUB 2EFNA 2YWFA 2E1AA 2VDIA 4DQPA 1IKYB 2GO9A 3O1LA 4ZP7A 1X4FA 2OPQA 3TUJC 3N6NA 2F8HA 3R3TA 1GXUA 4RNNA 3G96A 1GNKA 2ZM6F 5KFGA 1LWCB 1N5TA 2DNYA 1SC3B 3J7A1 2K3KA 3I56S 3IBWA 1NJXA 4TU7A 3K5OA 4I2PA 3L09A 3CO0P 5GAHI 4OQJA 2EC0A 4EWTA 1UKUA 4LF7J 2UUBF 3VTIA 2KJWA 1RAJA 3KYLA 4NZ0A 1UPPA 3T5JA 2QT7A 2RE1A 3UVJB 1QE1B 4LBHA 5LXRA 2L9DA 4CLWA 3W60A 3MM7A 1IKVA 1XQIA 1WTBA 4CO4A 2O01C 1T3OA 3M2RB 4TKTA 2KZMA 4K8RA 4NX9A 4M95A 3THTA 5J2PA 2ZZTA 2OSQA 3PRBA 3THPA 1KLMA 1P1TA 4N8OA 3IRXA 4LIWA 3J7Z5 3DRSA 4EYIB 2CPXA 2YY3A 3G8SA 1QLNA 2IAJA 2C2RA 2XCPA 2F40A 2AEMA 5IT9Y 4A8FA 1KC8T 1AB8A 1NUEA 3BBCA 2ZBRA 1UEVA 3NGRA 2RH3A 2ZZNA 3C6TA 3ZNJ1 3ZO7A 2ASDA 2JOQA 1RAIB 5KG3A 2XI3A 3MR6A 4GKJJ 1RA6A 5AE1A 3I4PA 4I2QA 1CJUB 1HL6A 2XZDB 3S7RA 5J2NB 1WC4A 1RWWB 3MM9A 1GX5A 3VGSA 1VQ7S 3PJ9A 1XNRJ 2GHWA 1N34J 2VH7A 1PAUB 2PA8D 2J8AA 4DUYF 3AAWB 5GAEI 3KDOA 3DLJA 2CZVC 4CWBA 3MPUB 2V63A 2PA3A 4ECQA 1JLEA 2KT5A 2RKIB 4DQRA 3RZAA 4GKKF 3MD3A 3CC7S 4PYAA 4RU9A 1HMVA 2GCFA 1QSSA 2BABA 1B7YB 1UL3A 2HHSA 2CNOB 5E3RA 3DLLQ 2WRMA 2DBBA 4C6AA 3U1NA 5IM0A 1A6LA 2Z2LA 4MMOA 2Q79A 3UD4P 4CI0B 2CNNB 2MKKA 4HTJA 2XWXA 3A8KA 2N7CA 4CLUA 3GWCA 2BMBA 3DM2A 4Y6IA 2WBMA 5F9NA 4CO2A 1X4CA 1C1CA 1YJRA 3E01A 1UPMB 2LCWA 3HHLA 4B02A 4ZVRB 2XMTA 3PRVA 3CIMA 3CD7A 3JQJA 1KWMA 2FJWA 2HLUA 1ZBTA 5KT7A 4DUZJ 2FHKA 4L73A 5I3UB 2MGZA 4RO0A 3FEZA 2ZBCA 3SSRA 2R7RA 4NXNF 1SL0A 4R8UB 1TFWA 4TLQA 3V2UC 4AL5A 5C24B 4M5GA 5E3PA 1KHWA 1KP6A 1CSJA 4UY85 1TL1B 4F4WA 1AA1B 4LVOP 2DNRA 4ZHRA 4RW7A 1VLOA 1NU4A 2R8HA 7FDRA 5ITHA 3NNHA 2XEXA 2O1PA 1HYSA 2XSJA 3NBPA 4DV6J 2J0XA 1E6VA 1FKPA 4NLRA 5IQ6A 1UEKA 3OHBA 4AQYJ 2B43A 1PYOB 3D7SB 2J5AA 4K4UA 4C8ZA 4QYZJ 1TKDA 2KVIA 1VC0A 4DJBA 3C66A 3HLUA 1FEHA 3HHLD 3CDAA 3HD2A 2AW0A 2HK2A 1W26A 1GK8A 5E3QA 3OLAA 5I3PA 1NZAA 4KAIA 4M5DB 3P96A 2XS7A 4TNOA 1YI2S 4AYBD 4U6PA 5KFFA 3QJJA 4RNMA 1CG2A 2GW8A 3IWLA 3T1YJ 5AXKA 4IH5A 3RGIA 1NSKL 1G2EA 1NSAA 3I32A 4FVMA 3HSGA 4ZJQA 3M8QB 5B0EA 2F4VF 3MAAA 4ILLA 1S49A 3Q0AA 1N36J 1KLNA 4YR3A 3FZ2A 3IP0A 2M3DA 4FP9A 3DLEB 1RT3B 2HBYB 4O4GB 5DM7Q 3PW0A 5J2QB 3V81A 2L48A 4FXWA 4DSJA 4XPCA 4OI2A 5HMYA 1I5OB 4KV8B 3ZTPA 2V2KA 4DQSA 4V1Ak 2DNHA 4A8QA 1VFJA 3R5JB 1JLFB 3F41A 2ZH3A 5CA5A 3M1VB 5C2CA 3A3OB 3OJSA 2ZOGA 4EEYA 1R8BA 2HLTA 2PT0A 1CJKB 2QSFA 3OFEA 1V3SA 5DS7A 1HPZA 3QGPA 5A8WB 4RBUA 3LP1A 3MM6A 3NOGA 1R0AA 1SIWB 3ZNUA 4J37A 1T8EA 4OI4A 3EICA 4I67A 4DCPB 4IG3A 3BGRB 1RABB 2ZE2B 1CBKA 2QYGA 4IFYA 2NQPA 4LIRA 3CJTA 5DDQC 3CMAS 1PYSB 4OI3A 2YNHB 3KHHA 1F1BB 2XGPA 3Q24A 1VR6A 4IFVA 5HO4A 2HHXA 4YMEA 4CNYA 2MKYA 1CJTB 4M1KA 2AQ4A 3IAM9 2BA9A 3V6JA 1DJ0A 4LSLA 4A8MP 4KHPF 3BB5A 3QNWB 3FVYA 4B3MF 4I7FA 2WBRA 2QEXS 2UXCF 1WHXA 4PPDA 1ZYQA 4CT8A 1N6QB 1H72C 4OX9F 5B0BA 5L1JA 2YH1A 4ZPWR 3NAHA 1DZ5A 3K2YA 4EBCA 3Q89A 3KWMA 1RWVB 2XBPA 1K1SA 2IMWP 1NCLA 2W8KA 4NI2B 1A9NB 4QWDA 2VPYB 1H6KX 1HI1A 1HR0J 1BE4A 3M2UA 4ELVA 3MOZA 2QLXA 4PG7A 3BS9A 4GVLA 5DG8A 2KG0A 2IMOA 1UA0A 5U47A 4S0MA 3WX8A 1FE0A 3EE3A 1T0TV 4FPIA 3T5LA 2DXDA 1M90T 5DDPC 1KKHA 5HLFB 2ZBPA 5IT9U 1U1KA 2CPJA 2CNKB 3IFEA 4PWWA 1NDLA 2MSTA 1R8HA 1REVA 3W2WA 3GFZA 3F44A 4JV5F 3C46A 2I5JB 4WE1B 5HVHA 3CXCR 4OJ3A 1U1PA 3BSNA 1FHTA 2KM8B 3RBDA 3HVTB 3UQSA 1KDNA 2WSFC 5F3TA 2BKOA 2JNJA 1ACMB 3GJTB 2HG4A 5DLGA 4B9TA 3BKUA 3KTQA 1TUWA 5K8MA 2QN6B 2XULA 5THWA 2MLYA 2DISA 1TFYA 1VMBA 4Q0BA 3JSMB 2XY6A 3PX4A 4J9LA 3GJRB 1NPKA 2Z8QA 1X5OA 2YKNB 3AJ2A 3G6ES 1P9YA 4UW2A 1B0PA 3BPSP 2E5LJ 2JSXA 1B0TA 2AX1A 2ABYA 1JLGA 2QLJB 5CZXA 5DG9A 2YH0A 3AODA 3WIVA 1RT4B 4W4MA 5KT2A 5DQGA 2W2MP 5B0DA 3Q8PB 4CYUB 1IBMJ 1HBUA 2XTJP 1SH0A 3M8RA 1Z2LA 1FFWB 5LSLA 4F0HA 2JJ4D 1RCXB 4OZLA 4ZVFA 2H5IB 1F9EB 3N79A 5L38A 2HFVA 4RU2A 1SUQB 4YP3A 4RPFA 2VJVA 3V4IB 3CCTA 4QCLA 3ZTQA 2ZJQQ 4DR3J 5HK4A 2E7VA 2CJKA 4RUAA 2HNYB 4OYWA 3C15B 2Y1IA 2DNPA 2DHGA 4BLGA 5F8GA 5E7OB 4C7QA 3X3UA 1X4GA 4O3QA 2HAFA 1IR1A 3D68A 3TJ8A 3B82A 4RW8B 4QWBA 2LXIA 4E0DA 4JI2J 4NA1A 2GQQA 2DR5A 3I4HX 3IG1B 2NYHA 3NL0A 4QJVA 3PV8A 4FF2A 2V9KA 4XK8C 2R3VA 1M5HA 4ED7A 2CFXA 2ZM6J 3FEYB 1SB6A 1EQ0A 3K89A 2DO0A 2XHWA 3SZ2A 4KKOB 1FVSA 3NP5A 2GMLA 2R8IA 3R7BB 3OTOF 2GAGC 3PTWA 3H2UB 1CLFA 2B5JB 2M0GB 3C2PA 4PCQA 4HHHA 4B9NA 2H54B 1M5PC 4DV7J 4DSEA 2OEMA 3IO1A 4Y2KA 3VAHA 1LK7A 1FX2A 1JLQB 3TZZA 1NPRA 2D9OA 1S9EA 2B8QA 1VQ9S 1FERA 2GZOA 3T1HF 2VBZA 3MM8B 2G2YA 4Z7YA 5CQGA 5F8MA 3W2VA 3OR2B 1XK8A 2BM1A 1SV5B 2UXDJ 4Q7AA 4RW6B 3DMJA 1U49A 4MK8A 4ZCKA 4J5OA 3HCXA 4NYPA 3FUYA 1FI4A 2RDDA 3SBMA 4IO9Q 3DLGB 3M7VA 4MIBA 4ATNA 3QYYA 3M4XA 3PX0A 3BQ1A 6AT1B 1FDAA 2IRYA 2LFVA 3D66A 2QMWA 5DDOC 2DITA 3MCNA 1HI8A 1D1UA 2RF2B 4OX8A 1Y3JA 3OXFA 1L3TA 1N32F 4P2FA 2VIHA 2WTFA 4DR4J 3KDNA 3WDOA 4CNZA 5B0AA 1GEHA 2IVYA 4A8WA 2DPIA 2HWTA 5CXTA 3UWTA 2NPIA 3HHDA 2GVZA 2LA4A 2Z2ZA 3MECB 1O5JA 2HBZB 4G1PA 2LU1A 1UWBB 4GKKJ 2HHVA 3KK2B 4ITSA 3RB6A 1BQXA 5LJ5Y 3M6WA 4CIOA 1M5OC 1IKWB 3DRRA 3KK3A 1RHUB 4FNHA 1RWMB 3CSKA 2XB2D 1KEKA 1EJ7L 4DV3F 2CJAA 4MKBA 1HNIA 3M9OB 4X2BA 2Q3PA 2BANA 4LF4F 1PBAA 2KT2A 3R5DA 5IFMA 1BWEA 1RT7B 3Q8SB 3H40A 3TNVA 5KFQA 1C0TA 1GMVA 4CLZA 3HHLC 4ED8A 3WQPA 2EI5A 1W2IA 1JWWA 1SQFA 3EPIA 1T95A 3AD8C 3MXHP 1SPBP 2EWHA 4U95A 5KFUA 3HZEA 2DR6A 4J9NA 4QR1A 1UTAA 4M5KA 1K0VA 4B3TJ 5HJXA 1JXLA 1CULB 2RDIA 3G9CA 3I5CA 5A2QY 2N7YA 3WBZA 4DOZA 2HQGA 5ETNA 1RE1B 4A8YA 2IA6A 1HNWJ 2XYHB 3RRKA 4DV5F 2PO4A 3MURP 2AV5A 1L3UA 2XCAA 2E1CA 4UOCA 1U7LA 2IA0A 1G3OA 2ZC3A 4K4VA 1VRQC 3ISZA 2DIVA 1FRIA 1S6UA 3UD3P 3DI6B 3D2WA 3IN5A 5F9LA 1FFSB 4R0JA 1J27A 1P9QC 2DKOB 4IH6A 2ZH1A 3CUNA 2DIUA 2DRAA 1RHJB 3OTCA 3CDBA 4ECVA 5KAKA 3KNGA 4GVBB 2LQJA 2LQ5A 4DZDA 2NSCA 3CMQA 1UVNA 3KUEA 4F36A 4QYZK 2OD6A 4NPOA 4YS2A 4WPAA 1SBRA 2GGPA 3VAIA 1FXLA 1XNQF 5HVGA 3NS6A 2YWKA 2MQOA 1VRTA 1O6XA 5E0OA 2IJRA 1C0UA 3NGUA 4CTAA 2L3MA 2FJAB 3OFFA 4IKAA 4WXWA 3UI3A 1TMMA 2Z2MA 2QMXA 3M2VB 1HD0A 1TAQA 2XHCA 3O6QA 2D7SA 5C42A 4DL6A 2PFFB 1MWQA 2HHTA 3RAQA 5IXUA 2W24A 4Y34A 1B4SA 2FIUA 4TY8A 4KPCA 2F4VJ 4RBVA 2K2PA 1H2UX 5ETQA 4B3RF 3MZIA 4WYWA 1R8AA 3AHPA 3THVA 2JEIA 1GX6A 3TAMA 3KLGA 3IGVA 1R43A 2ASLA 4AFFA 1F2GA 4NCGA 4TXSA 4DF4A 5EGYA 4K50A 4TVAB 2DHXA 3VQSA 3DOKA 5A8KA 1RLCL 2J0SD 4BC9A 3AQOA 4OHXA 3H25A 1V6HA 1OQ3A 1IBLJ 2QMUB 3M8SA 1WEYA 1U2CA 1YITS 3OR1A 1JKHA 2HZAA 3M32A 1KQKA 2GA7A 1BQNB 1JLAA 2DHAA 2DY9A 3RW7A 4ZVQB 4DR5F 1D09B 3GJSB 4F04B 4PUOA 2HFSA 1UJ6A 5E41A 1FK9A 3MD1A 3MPDA 1VISA 2M88A 2WB4A 2E1MC 4NLVA 2XQCA 1T05B 2G1HA 1H7WA 4CO3A 2OMLA 2NPFA 3QQCD 1I94J 4KHPJ 1Q5YA 2AGPA 1RCOB 4C3KA 2MDAA 2CG4A 1RT1A 5AJ3F 1MG7A 2BDPA 3W8GA 4LREA 1VQNS 3ELHA 4O44B 2W9CB 1FVQA 1S6PB 1TK0A 4QYRA 3QIPA 3H98A 1Q7YT 1MN7A 1RP5A 4OMFG 3QSYB 3GYGA 2XWYA 4OHVA 2J9EA 4I4BA 2EFQA 1TK8A 4KBIA 3MEKA 1ZTTA 4U96A 2D41A 3DLBA 5IC6B 3GIKA 5KFKA 3TW0A 1H2VZ 1KVKA 4CLFA 5D78A 2VF3A 3TARA 1TKTB 3D6HB 3QIDA 1SKSA 3UR3C 1ZA2B 3KMSA 3NS7B 2N4DA 1YTYA 1DLOB 1NKEA 2E44A 2HRUA 3HHKA 2DGSA 1U1NA 1Q16B 1Y10A 5GVQA 5D4PA 2W1BA 1CJVB 3LPYA 5A6WA 3BO3A 1X5PA 2IBKA 3DU6A 4USKA 5L1IA 3EZOA 4JI8F 4H4MA 1J5OA 4FVCA 3NOCA 2C3OA 4ZVSB 2VG6A 5J1EB 5LJ3Y 3KLHB 3DN9A 4CLSA 4X4TA 1VRUA 3ETMA 1DTTA 4ZVHA 1C4AA 5L8RC 4NLOA 1R0BG 1NM2A 4FYWB 5D3GB 4PAAA 4NEZA 3UNYA 4U8VA 3C14B 2QFJA 4RBTA 4M8LA 4KGZB 3PFOA 4P74A 1L5UA 2W7AA 2LLZA 1JMTA 2QA4G 2XI2A 4XTTA 1E6YB 1O51A 4WK3A 1Y11A 2NXUA 1RWUA 5FIIA 4DCJB 2QFIA 2LVWA 5KG5A 3PW5A 4P2SA 2JZ5A 1F9HA 5HROB 4OI0A 2WVFA 5DETA 5C25B 4OYAA 1G6BA 2PFDA 1XC9A 3FFIA 3SCLE 2OEKA 1BHNA 3Q8QB 5KG2A 2CPEA 1HD1A 4DI6A 2ERRA 5KFYA 3JAMY 1WSRA 5T7LA 1FKOA 2GFFA 3MFHA 2G0JA 2L9NA 2KHDA 2FVCA 3N6LA 1ICEB 1LEOA 4MIAA 2ZH6A 1RT2B 3O5TB 2WVCA 1WF0A 3A12A 2YX4A 4B3OB 2UUAJ 5A2QU 2CADA 1GMUA 4PWDA 1MNEA 4OV6A 5FDLB 1S99A 1I51B 3ETOA 2BOPA 5LMNF 1FRXA 3GFYA 4RR5A 5KT6A 2Y1RI 1YX2A 4LFBJ 2OPQB 2GQCA 2V4JA 2E29A 5DQHA 3OL8A 2EFGA 2BJ8A 1C2PA 1FEEA 3OTOJ 1YLXA 2NZCA 3D1HA 1AROP 1URRA 1YRTA 1HNXF 4PG5A 2X51A 1GQEA 1RYSA 5ETKA 1AYEA 1TAUA 1U8WA 3JYTA 4I2PB 4FS2A 4I6YA 2VPZB 3Q8UA 3VGVA 1OY9A 1N33J 1QD1A 4QIEA 1YKWA 4OLPA 4CH0S 3UNGC 5F0UA 4NA3A 4F50A 3D6TB 5G0RA 1S7IA 3K0JA 2DPJA 1EARA 4HYKA 2GJ2A 3R5AA 3PR5B 4J9RA 1IKVB 2Q6CA 2P9GA 4JI5F 3R2CJ 1DTQA 3FQKA 2MJNA 2RHSB 5J2PB 3HT0A 3CD0A 5A8RA 5HAOA 1EP4A 1SCJB 1MMNA 1KLMB 2JEGA 1X60A 3H2LA 4W92B 5F8NA 2IAJB 1UJ5A 4LF6F 4FF4A 3EGWB 1WNEA 3C6TB 4RL1A 3PKMA 3OXLA 5LSRA 5K8NA 1YSJA
chains in the Genus database with same CATH topology
2XI3A 3Q2TC 1HWLA 2FJDB 1IQTA 3I0RA 3MR6A 1YJNS 3AA8A 3K5MA 1RA6A 1TVRA 1KQGB 2EK1A 5AE1A 3I4PA 4I2QA 3W2WB 4IO1A 3FEXB 4F3MA 3PO4A 3I0RB 1S10A 1HL6A 1N0VC 4HDHA 1SJRA 3PW2A 1OO0B 4GO5X 3MEDA 5DM6Q 3S7RA 4DLEA 5J2NB 3PO5A 3GG1A 3TR5A 1HI0P 3MM9A 3FZBA 5SUHA 2RQ4A 6FDRA 1WI6A 1GX5A 3EXYA 3PJWA 2WAQD 3MEDB 3CCJS 2BJDA 3AQPA 3DNCA 1VQ7S 3KLEB 3MAQA 3I87A 2OJ3A 3Q23A 5CYQB 3MM9B 3HM9A 3E2EA 3GILA 2RQCA 2GHWA 2HHUA 2VH7A 3GIMA 4L6V3 5K8OA 3K8VA 2PA8D 1U4BA 4EBDA 2VOPA 2GIQA 3M30A 4H54A 3KLIB 2J8AA 3O44A 5F8IA 2Y1JA 5K8PA 1K73T 4DUYF 1R89A 3AAWB 2CVEA 2F9DA 5GAHU 5GAEI 4Q0BB 2CYYA 3DLJA 2VZ9A 2XY5A 2CZVC 3EGZA 2D1CA 3WX4A 4EYHB 2ZKUA 2NUUG 2F7VA 3M8PA 4G3IA 3UE2A 2RUGA 2PA3A 4ECQA 1JLEA 4DS4A 1N52B 2KT5A 2RKIB 3M8PB 4RNOA 4X4RA 3C6UA 4J9KA 4DQRA 3RZAA 3GYXB 5AE2A 4PRFA 4GKKF 3CCRS 4RNFA 3MD3A 3CC7S 1IUJA 3OTDA 1T94A 2ZDPA 3G86A 1JLEB 2AJ4A 2XMKA 1JLGB 2HQ3A 3DXSX 3CJ5A 4RU9A 5LXYA 4QIFA 4QIGA 2R8KA 1HMVA 3C6UB 4K5SA 2DNLA 2YKPA 3BGUA 4C0HA 2ROGA 4B9VA 1TL5A 2GCFA 2ZH7A 1LXJA 3M6XA 3MR2A 4QWEA 3OV7A 1QSSA 1BQNA 1S6OA 1LWEB 1HMVB 3DOMA 5AXNA 4DWIA 2PEHA 2XZWA 1F9FA 2BABA 4HH1A 2U1AA 1LWFA 2Q66A 4ZP6A 3GV7B 1UL3A 2HHSA 2X1FA 2OPRB 4I69A 2DD8S 5E3RA 2IM3A 3ENVA 4WKYA 3HT3A 1SL2A 3R1HA 1HBUB 3DLLQ 1LWFB 1HA1A 2MZSA 4MKYA 4F26A 2WRMA 3WC2A 2DBBA 2XS2A 2LDIA 4ZLPA 3U1NA 5IM0A 2XMMA 4DV2F 2X1BA 4XPEA 1A6LA 3TQ1A 2VFSA 2Z2LA 2B6AA 4MMOA 3D5MA 2HHPA 3UCZP 5DGBA 2Q79A 5KFIA 3UD4P 4KE5A 4DEZA 4CI0B 5IM0B 3MEGA 5HBMA 3HJFA 4L3NA 2YTCA 1QAJA 2CRLA 1K8AT 2B6AB 1FRLA 2MKKA 1CPZA 3BO4A 4HTJA 4DFMA 3LW5C 1JXEA 1NHUA 2X1GA 2XWXA 5D8HB 4IDKA 2R8GA 2N7CA 2UVUA 3MAHA 1HWIA 3GWCA 2B0GA 3H4BA 4FF1A 1UVMA 2HQIA 3DM2A 4Y6IA 3SQGB 4QW9A 3VAKA 2WBMA 1YIJS 5F9NA 4CO2A 1X4CA 3BGLA 1C1CA 1YJRA 3E01A 5KFBA 3DM2B 2N4CA 2LCWA 2WONA 3HHLA 1MMLA 4TY9A 4B02A 1R27B 4HDGA 4OX7A 2XMTA 4C4WA 3MMCA 2UUAF 3A1YG 3JSRA 4Y2AA 3PEHA 4ED2A 4MH8A 3CIMA 4RKUC 3CD7A 3CC2S 3RR7A 1BGXT 1EETA 2W9CA 3L3CA 2UV8A 2HGNA 1NEEA 2HLUA 1ZBTA 3MMCB 4HVZA 4A47A 5KT7A 2FJWA 3W3SA 4R8UA 2GO8A 2FHKA 1K9MT 2MGZA 5I3UB 2XY7A 3ZZYA 4HLBA 1YG0A 2U2FA 3FEZA 1FJ7A 4C11A 4LFBF 2ZBCA 3SSRA 2R7RA 4NXNF 1AW0A 1SL0A 4R8UB 2YNIB 1TFWA 5C24A 3LP0A 5CYJA 3QZ8A 3FMWA 2V94A 1UFLA 2LQBA 3CWJA 1TL1A 4TLQA 3V2UC 1V3RA 2CJBA 3CE8A 1Y5IB 4YB1P 4G1QA 4WFYA 1N5QA 4RW9A 3V6DA 1PO6A 4AL5A 5C24B 3LP0B 5E3PA 2RNEA 1KHWA 1CSJA 2EVZA 2AF6A 4DHVA 4UY85 2QA1A 3LUYA 1TL1B 4F4WA 5GAEU 1C1BA 4LVOP 4AXJA 2DNGA 1FRJA 2ZBIA 4G1QB 4DR1F 4RZRA 2DNRA 2MQLA 4JV2A 1HW9A 2CQ1A 4DV4F 2DO4A 4ZHRA 4RW7A 2CQBA 1NU4A 2R8HA 2YWHA 7FDRA 3VAGA 4DFKA 1C1BB 5ITHA 3NNHA 1KFDA 2XEXA 4ZPVR 1X8DA 4B3SF 2BXJA 2O1PA 1M0SA 3V6HA 4LF7F 2YWGA 4FBUA 1DQ9A 3NCRA 1HYSA 3SV4A 2XSJA 3NBPA 2J0XA 3BEGB 1E6VA 4G6VB 4ECZA 4ECRA 3I5BA 1XMBA 4ZPTR 1HQEA 2QZ8A 3NCQA 4KIAA 1N33F 5HMXA 1FKPA 4NLRA 2LKZA 2HW3A 2XSJB 1WHWA 5IQ6A 4OZ1A 1E6VB 2KM8C 4W90B 4I6WA 2KDOA 4JI3F 2GX8A 3OHBA 2W4DA 1U6ZA 4KHMA 2B43A 1JJHA 5G4DA 1H38A 1S7HA 5F0WA 1S9EB 1RTIA 3ZC4A 5MAOA 3OUYB 4DL2A 1SJFA 3MR5A 4DN9A 3PHEA 4OL8A 4H4KA 5I3QA 1PGZA 4DL0C 1S9FA 2J5AA 4K4UA 1N5YA 3VWSA 3L7OA 4OI6A 3TI0A 4C8ZA 4QYZJ 3BN7A 4Q2MA 2KVIA 1TKDA 1D8ZA 3W2VB 1VC0A 1AXQA 3P49B 2MZTA 3FSXA 4DJBA 3C66A 1NHVA 4YB7A 3HLUA 2M7SA 2FLOA 1FEHA 1N5YB 4MFBA 2IM1A 2OSRA 3HHLD 2AGOA 4RWWA 3CDAA 3QO9A 1UEUA 5BYRA 4V19X 1HWUA 1JJ4A 2AW0A 4XDCA 2NR0A 4C0OC 2E9RX 4JI4F 3BZQA 5E3QA 1DBDA 3OLAA 4MFBB 5I3PA 3FRYA 1NZAA 1TKXB 4HTIA 4KAIA 1ZAXA 4M5DB 5CZVA 3WC0A 3P96A 1RTJA 2JX2A 2E9TA 2PI4A 4PQUA 1HBMB 1Y4ZB 2NLWA 3N4WA 2XS7A 4TNOA 1YI2S 1XBWA 2XLJA 1MU2A 5KFDA 4FXDA 4AYBD 2YX7A 4U6PA 5KFFA 3QJJA 4RX6A 5J1EA 4RNMA 1CG2A 3FSYA 1RTJB 2DJWA 2MKCA 5L1LA 1NJYA 2GW8A 3IWLA 3LQVA 4MKAA 3PXGa 3T9ZA 3KLHA 2AD9A 4PQUB 1WELA 1ZOTA 2BW2A 5AXKA 4IH5A 3G8QA 3GG0A 4DPOA 1MU2B 1QAYA 4NLSA 4QR2A 2RRAA 3VF0B 2RRNA 5D4OA 3O2IA 5CCLA 1G2EA 1JJ2R 4IOAQ 4ZK7M 1KS2A 2V8GA 3I32A 4FVMA 1LW2A 1DQ8A 4DBQA 2BQUA 3IR5B 2FGOA 3M8QB 5B0EA 3LH2S 4LQ9A 1QAIA 1X9SA 4WFZA 5DRKA 3G4SS 3CEDA 2ZH4A 2F4VF 3BDPA 4ILLA 2BJEA 2X1AA 1S49A 3CCUS 4ED6A 1WG1A 3QZ7A 3S6EA 3DLEA 3Q0AA 5HP1A 1LW2B 1RKIA 4D3GA 4K5RA 1KLNA 4YR3A 3VAFA 5JXSA 3PW7A 4M95A 1U1MA 5ADZA 2VG5A 1SQEA 3FZ2A 2HRYA 2M3DA 4A8SA 4FP9A 3DLEB 4MK7A 2KYZA 5KFOA 2C22A 1RT3B 4DR6F 1VS3A 3BR9A 4O4GB 3UCUP 5DM7Q 4KQZA 3GFXA 5B7WA 2DNQA 3T19A 3PW0A 2R2RA 2YKMA 5J2QB 3V81A 1BD6A 2L48A 4J9PA 3MMBB 3IWNC 2B4UA 4FXWA 4XPCA 1N34F 2MSSA 4DSJA 2H9ZA 3IC1A 4OI2A 4UUWA 5E2QA 3GV8B 2DGVA 2RD5C 1VQ8S 3IA0A 4HEA9 2XMWA 5HMYA 2YKMB 3M05A 1LFWA 4GO7X 1DARA 4KV8B 3V5RA 5IWAF 3HK2A 1JLFA 1WHYA 2V2KA 2HS3A 4DQSA 3BM7A 2JFKA 2DNHA 2ADBA 5HROA 3BO2A 4ILRA 5IQQA 4A8QA 1F60B 2UUCF 3M1VA 1VFJA 1P8GA 1ZM2A 2E9ZA 2QA2A 1JLFB 1UAWA 4WFBQ 4AL7A 2XNRA 3FDSA 1XERA 3F41A 3G6XA 2ZH3A 2P5VA 4DN0A 4AL6A 5K5MA 3M1VB 5CA5A 1WACA 5I42A 1DFDA 1LXNA 2ZJRQ 1NKBA 3OJSA 2KXNB 2ZOGA 4ES3A 4EEYA 2DNKA 3PVXA 2EG2A 2CPIA 3GE9A 4ED1A 1R8BA 1AUDA 3GIJA 3D28A 2VA3A 2HLTA 5A8WA 1ULRA 4DL7A 5I42B 2A2DA 3E3XA 1JLCB 2PT0A 1TL3B 2QSFA 4EZ6A 3IAS9 4JBCA 2HS4A 3OFEA 4J9QA 1V3SA 5DS7A 1QSYA 1HPZA 2N3OA 4TN2A 3QGPA 3KHRA 1J5EF 1TZ0A 1FTCA 5A8WB 3DGPA 4F4XA 4WKRA 4ZDNA 5A0YA 1S9GA 2UU9F 5EHHA 4RBUA 1HPZB 2QV6A 1RT2A 3LP1A 3MM6A 3OHAA 1R0AA 2JLGA 1SIWB 1HNIB 1H0HB 2FD2A 3KLVA 4H4OB 3SMZA 4J37A 5A0YB 1S9GB 2BANB 1HQUA 3BGRA 4OZ0A 4ED3A 1T8EA 4HHJA 2ZE2A 4OI4A 4B3OA 2GC8A 2IBOA 4ZA1A 3CD5A 1WD6A 4I67A 2OFHX 4IG3A 3BGRB 1RTDA 2ZE2B 4M94A 3BREA 3AB2B 4GMKA 5FDLA 4KSEB 2JWNA 4ED0A 2YNHA 1C0TB 4DQIA 4Q8EA 4IFYA 2XMJA 2NQPA 1OS5A 2MHEA 2ZKTA 4LIRA 3EPGA 2FLPA 2PE8A 3HHNB 5DDQC 1PSDA 1QUVA 3CMAS 1RTDB 2HWIA 4FXVA 4OI3A 4K4WA 3RAXA 3TRGA 1VOMA 2YNHB 2OP5A 3KHHA 5EUHA 4WFXA 3SXLA 1GAOA 2XGPA 3Q24A 3VR1A 4AUKA 1OQ6A 4NYZA 4IFVA 5E5NA 5KT5A 2FLNA 2KKHA 3US5A 5HO4A 5LL6d 4QWAA 2HHXA 4F4ZA 4OFZA 3PW4A 3H5SA 3D54A 3BGFA 5KG1A 2VC1A 4ETXA 3FMBA 1X4HA 4URQU 4YMEA 1Y3KA 4OZJA 2HHHF 1JK9B 2D3UA 4ZPBA 4CNYA 4TU9A 1LWCA 1OPIA 4M1KA 2AQ4A 2VPWB 3IAM9 2BA9A 3V6JA 3S01A 1DJ0A 2PIIA 4LSLA 3TYTA 5KFSA 2OO4A 2HGMA 2CQCA 4A8MP 4ECWA 1P1LA 1URNA 2ILZA 1SL1A 2OPSA 4KHPF 1SH3A 2HNZA 2HVHA 4WF9Q 3BB5A 3LF0A 5BR8F 2HHWA 3FVYA 4B3MF 2LQ9A 2WB1D 2WBRA 4I7FA 1XN9A 2QEXS 2VONA 2UXCF 1JLBA 4HKQA 1WHXA 4AXIA 4PPDA 1FRMA 2OPSB 2R7VA 1ZYQA 1QVGR 3GR1A 2HNZB 2YKAA 4DUZF 5KFNA 4XIUA 4CT8A 1N6QB 4OX9F 4DLGA 2GV1A 4WU3A 2F9JA 5B0BA 4ZPWR 5L1JA 2YH1A 3NAHA 2UXBF 1JLBB 1WEXA 1K0TA 4Y00A 2DNZA 2CQDA 2FGCA 2IJFA 3JTNA 1DZ5A 1QSLA 4DSLA 3ZFVA 3OSPA 4QU6A 3K2YA 4EBCA 1HHSA 3KWMA 1N8RT 4YR0A 4XAKA 2R4FA 2ZNYA 3JTOA 5LSOA 2XBPA 1K1SA 2HWHA 2IMWP 2W8KA 5B08A 3AA9A 1A9NB 3SEOA 2MQNA 4QWDA 1UETA 1CC7A 4JV1A 5EN1A 2VPYB 5F41A 4ZS6A 2W8LA 1V9OA 1H6KX 2EPIA 4NZ7A 2J76E 4N56A 3RAMA 1FNXH 4UUXA 1KRPA 1RGVA 1HI1A 1TQLA 3M2UA 4CT9A 3C3LA 4PG8A 3BF4A 2ASYA 4X66F 4ELVA 4LF5F 4JI0F 2RVJA 3FSIA 5KG6A 2IJNA 2G1DA 3MOZA 3NKYA 4K4XA 2QLXA 4PG7A 3T6BA 3TVZA 3BS9A 4KO0A 2JC0A 1R3NA 2ASJA 2V8DA 5DG8A 2KG0A 2FLLA 1MMDA 2BR0A 3MGJA 1Y0HA 2IMOA 2FPHX 3WZ0A 3FCHA 4QIWD 5DDRC 1UA0A 3CCVS 5U47A 3T5KA 2DGUA 1D3WA 1UMJA 4O3SA 1FE0A 4JI7F 4Q43A 3EZ5A 1NKCA 1OSCA 4E8UA 3ISNC 3T5HA 2HMIB 2NREA 5KFWA 2GGPB 3I6PA 4ECTA 3T5LA 1M90T 1ZM9A 5DDPC 3LO3A 1FF2A 1HWKA 4X62F 2CIMA 4AQYF 5HLFB 3O8WA 4I1TA 2AYMA 4DL5A 1JIHA 2MKJA 1F5BA 5H9EJ 2JHEA 2IVFB 3CCMS 4J9SA 3U02A 2CPJA 3IFEA 1U1KA 1A7GE 1IJEB 2NZ4A 2BM0A 3D1QA 3MUVP 4ZP9A 1NJZA 2DK2A 2I5JA 4WE1A 3BJYA 2W7PA 1U1QA 3EUNA 4CH7A 2MSTA 4KB7A 4CTAB 2HHQA 2WK4A 4PWUA 1R8HA 2A10A 1REVA 3NWGA 2H5EA 3GFZA 3W2WA 2Z0GA 3HVTA 3F44A 2YNFA 1Q81T 4IR9A 3CULA 2VA2A 4JV5F 2IYIA 3DDNA 2I5JB 3C46A 4WE1B 3CXCR 2M2BA 4OJ3A 2KRRA 1U1PA 3BSNA 1FHTA 4JV0A 2KM8B 3RBDA 1REVB 3TA1A 3HVTB 2CVIA 2YNFB 3DU5A 3UQSA 2I0XA 2V4QA 3RRHA 2I38A 2VKZG 2XGQA 5J2NA 3LANA 1LFPA 2VASA 4NRTA 2WSFC 2CPYA 5C42B 2ZH5A 5EDWA 1OSDA 5F3TA 4DF8A 2BRKA 2F8EX 2QLWA 1VQPS 3K7RA 1O0PA 4BWMA 4RUCA 2J6TA 3J80Y 2PSZA 5DG7A 3KLEA 2K8GA 3CJ0A 1JNRB 2HG4A 3RB3A 4ID5B 5DLGA 2J6UA 4OHWA 1IJFB 5CYQA 3KTQA 4B9TA 1IXKA 3MMJA 5K8MA 2KB2A 2XULA 4OZNA 5THWA 3CD6S 5KFJA 2J7WA 1QVFR 3T1YF 3F56A 2I8EA 3K58A 3JSYA 2FUG9 4F2SA 1KNZA 2D9PA 3E8OA 4F3OA 3KLIA 1ZTWA 3TUIC 1KHVA 3GR0A 2OPPA 3P5TL 4BDPA 2DISA 2HFZA 1TFYA 1VMBA 4Q0BA 2WHOA 3JSMB 2XY6A 3PX4A 2E5JA 2SXLA 1X4EA 4J9LA 2C28A 1Q8BA 2Z8QA 2M70A 1X5OA 2YKNB 4DV1F 3AJ2A 3G6ES 5T14A 2OPPB 4DS5A 3N28A 2G0CA 3CDUA 4UW2A 1B0PA 2HVZA 4K0KF 5CYMA 2B9YA 2JSXA 3CCQS 5F8LA 1L3VA 1N36F 1VQLS 1S6QB 3H20A 1T02A 2K7KA 2M5YA 3OBIA 2RKIA 1B0TA 3NMAA 1KTVA 2EFOA 2AX1A 4C0BA 5F8JA 4X4VA 2XS5A 2AGQA 1Y9OA 2ABYA 4C8KA 2NSBA 5CYMB 2IRXA 1JLGA 1RT4A 1P6TA 5KFZA 3TAMB 3VQTA 3P3DA 1YWXA 1UW4A 5CZXA 3ZZOA 4JUZA