1RKIA

Structure of pag5_736 from p. aerophilum with three disulphide bonds
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title The Genomics of Disulfide Bonding and Protein Stabilization in Thermophiles.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 23
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11424 DUF3195 Protein of unknown function (DUF3195)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1650 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rkiA01
1RKIA
chains in the Genus database with same CATH superfamily
1O5JA 1JLBB 2WK4A 3JTOA 5KFTA 2CRLA 4W4MA 2NQPA 1X4DA 2HEKA 1E6YB 5E2QA 4YY3J 1S1TA 5E41A 2HNDB 5IC4B 2GNKA 1J5EJ 1PIEA 3GIJA 4KGZB 1UPPA 2XCAA 2MZTA 2HHQA 2J9DE 4A8YA 5DQGA 2J5AA 5J2NB 1PG5B 4AL5A 4TU7A 1T11A 4ZIWA 4RW6A 2NS1B 1ZA2B 1HW9A 1TK8A 3WC0A 1AT1B 5L39A 1XEZA 2NXNA 3MCNA 2RRNA 4C4WA 1FE0A 2DNHA 5EWFA 2FHKA 2RU9A 4YB6A 5L1LA 3B78A 5CHCB 4F67A 3EDRB 2B9XA 1CSJA 2H9ZA 4GC7A 3M8ZA 5JJBA 1VOMA 4CNZA 3JAMU 4YHHF 2DNQA 1Q0NA 5I42B 2HMIB 3AT1B 3GB0A 4PYAA 4USJC 5F8JA 1VHIA 1YZ6A 4NX9A 2HGNA 2OELA 1D0EA 3V6DA 3K7RA 4O44A 2BYCA 2Y0SD 4KHMA 5KFJA 3BBBA 2KYXA 5IT9U 3MEEB 2D69A 4DX5A 2BE2B 3K8WA 3R2CJ 2JC1A 2ROGA 1VBKA 3ENVA 2QV6A 2OP5A 2OPRA 4NXNJ 1WUUA 3N5FA 3MUMP 3TI0A 5CAAA 3QGGA 2BOPA 1XMQF 1X9MA 2VPXB 3IS9B 1TKZA 1JXVA 2FGOA 3JQKA 1HR0F 1AB8A 3A3NB 2IJNA 1RAFB 4IR9A 3BDEA 2X3DA 3H0PA 3G6ES 1GMVA 4OJGA 3O8WA 4P71A 1VFJA 3UD5A 3TEGA 2RF2B 1HWIA 1ZPVA 1LOUA 5KG4A 3R5JB 2XI3A 5K8MA 4ED0A 4FS2A 3NOCA 2ZHBA 3G96A 1WDDA 1IKWB 2W9CA 1URNA 4A8OA 2BANB 3HLUA 4H4OB 4FKXA 4O4RA 3CJ2A 1NHUA 3PHEA 4KFBA 3ICLA 4F4XA 2CQ3A 1WC5A 1BWEA 4PEOA 5T14A 2MKHA 3QFHA 4Y28C 1IBCB 4OYWA 4I1TA 2EW9A 2NXCA 4OZ5A 3MMCA 3UN2A 1OYDA 4OZ1A 3OTEA 4CYUA 1LNQA 1RTIA 2POKA 1T3NA 3AOBA 4WTYA 1K1SA 4ECUA 2XY5A 1U1LA 2HHHF 4HTIA 3M6WA 4WE1B 1H7WA 3THPA 5A8KA 5CYQA 1AFJA 1S1XB 2AV5A 4YMEA 4X4OA 1AW0A 1Q4RA 4QJVA 5FIIA 5AXLA 4IQXA 3WQPA 4LFBJ 2XEXA 3E51A 3ZNUA 4PZVA 4KTQA 1LWFB 1N5VA 3K5OA 1S9GB 3CMES 3UDVA 2IC3B 1MW7A 3LUYA 2IAJA 2XMKA 3MM9A 4NLUA 4EK2A 1VQYA 1IBLF 2AYBA 1D8ZA 2CNKB 3FVYA 3DOMA 2GHWA 4NE9C 4I6WA 2RIJA 3DDIA 4X2BA 5A2QU 2XMJA 4FF3A 3HO1A 3SI8A 3FK4A 3QJLA 5F3TA 5ETSA 4YR2A 5D77A 2W2MP 3PY8A 2DITA 2H65B 1FE4A 5HVGA 4B3TJ 1I6JA 3KYLA 3EXCX 2RJZA 1C1CB 4CO5A 4IRKA 1KKHA 2XI2A 3SFGA 1PYOB 4F7VA 1GFWB 2CUYA 2LECA 3DNCA 3M6XA 1SKSA 3HFVA 1DLOA 3B4DA 4U7CA 2BJ1A 2W1BA 3PRVA 5B0EA 2QYGA 4N56A 2W2QP 3D68A 1RKIA 3OVAA 1O8BA 2ZFHA 3TAMB 4DQQA 2LQBA 3Q86A 3Q22A 2D3O1 1RT5A 1HYSA 4JUZA 1XJWB 4DUZF 2V8VA 3W5ZA 2DTJA 5HSPA 3A8KA 3CIZA 1Q82T 1K0VA 3DMJB 4ZCKA 3PW7A 3D1HA 5C24B 4IFVA 1WF0A 3UI3A 4ZIVA 4X4QA 4H54A 1XNQF 2IVYA 2JVRA 4OI3A 4DG1A 4FVCA 4A8XA 4K7QA 2OJ3A 1ZTWA 1G6BA 1YJUA 2DGXA 1R8BA 3U1MA 2KL8A 2OFGX 4KGVB 3Q8YA 3MR6A 2WVEA 5DM6Q 1IUJA 4FYYB 2HAIA 4PG8A 3PM9A 1Q53A 4ELVA 4DR1F 2HQIA 3LALA 4YUDA 2BV3A 1TK0A 2DPIA 2FLLA 5CXTA 3Q2SC 1PBAA 2P9CA 2XZTB 3RB3A 2JLFA 3GG0A 1OQ6A 3EGZA 3HP6A 4KY3A 4C8KA 1JB0C 1RT4B 2AMCB 1AZSB 3M30A 3ITHB 3SDEA 1YJTA 3CCUS 1R0AB 1C0TB 2KJWA 2OI2A 2BJEA 2BE9B 1JXLA 2I1RA 4M5DA 1F6TA 2R7VA 2J7WA 1WHYA 4ZLPA 5LMNJ 4DLEA 3P49B 1CJTA 4JI8F 4ZPWR 2GVDA 2KXFA 1S1UA 3POTB 2F65A 1XK8A 4QIWD 4ZVHA 3PXGa 4EFAC 4CO3A 1U8SA 2OPQA 2C28A 1C1BA 1IQZA 2E1CA 4ID5B 2YH1A 1O0PA 5DG9A 3I0SB 3WBZA 2LXFA 2V6AA 1Q8IA 3LGHA 2B9WA 4DV0J 1RA6A 3GG1A 4TY8B 2VPZB 4NI2B 3MR2A 2HLTA 1JLCB 1GXUA 3FJ2A 2IBOA 1NHKL 2PMZD 1HWJA 2ZVSA 4KAIA 3FSIA 2DNZA 5FJ4A 3ISZA 2CPZA 4DFMA 3MPUB 3CMAS 1K73T 4USMA 4K5RA 2H4YB 1FEHA 2VU5A 4LREA 4G1PA 2K8GA 4GVBB 2YNIB 4F2SA 1J2VA 2FJDB 5ADZA 4FYDA 1F9HA 3SV4A 5CH7B 3I5AA 4R8UA 5HK4A 4FNHA 1X4HA 4DR5F 4WYWA 1FRMA 2IM0A 1HBOA 1OSDA 2PE8A 2ZH3A 3BKTA 4ZVOB 1V5VA 3MM5B 4DL2A 4RW4A 4N77A 5KFGA 1X8DA 4LSNB 3TQEA 4K4VA 1B0TA 3PKYA 1KS2A 2MLYA 2A1BA 4U6PA 4FF4A 2ZC4A 3PRBA 2JFKA 2EK6A 3P3DA 2XMAA 3QO9A 4USTA 4I6AA 4ELUA 2XB2D 2AYMA 1IN0A 2LA6A 5J1EA 1REVA 3CD6S 1ELOA 2H5JB 1EP4A 4DU7A 4J7CA 2BM1A 2HBYB 2E29A 2WW8A 3FEZA 3W8GA 5DQHA 4C11A 3W2VB 1K0TA 3FCVA 1LWEB 4OQJA 2I6WA 1R89A 1M5PC 1FERA 1QE1B 5KT5A 4PPZA 1NK4A 2E5GA 2E9TA 2X1FA 2LVWA 3W2WB 4X4SA 3LP2A 1IWGA 3GFZA 1UP1A 5J2QA 1X9WA 4DJBA 3PCOB 3NNHA 3AXKA 4RUBA 4RLEA 1VQKS 4NRTA 4NYPA 3CF5Q 1HD1A 2AIRB 4U96A 1JLEB 4B3SJ 2QGFB 4DR2F 2C2ZB 1SBRA 3B54A 2HQ3A 2AT1B 2RHSB 3MAAB 3KJVA 2R8GA 3EMTA 3H4BA 3M32A 4F0MA 5IT0A 1NH8A 1QUPA 2VBZA 1VRQC 2QLXA 1MROA 2WVDA 4USUA 3LGNA 4K59A 2VG6B 1Y9OA 1NO8A 5J1NA 3WX8A 1YJ9S 3DDKA 3GONA 1P9QC 3GE9A 1T95A 3HZEA 1VC0A 4RBVA 4JV1A 1BE4A 2C2DA 3JYTA 3PV8A 2OH2A 2YNGA 2GCFA 1BD6A 3T1HJ 4I68A 3KK2A 1X4GA 5BYSA 1O6XA 2IYIA 3I5BA 2FLNA 1UW9A 1FRKA 4J9SA 4QOTA 4F3QA 3EGVA 1A6LA 1XN9A 3KUGA 4HH0A 2LMIA 4ANDA 4I56A 5I3UB 1CJKA 2FZKB 4M8LA 4PG5A 3D6HB 1D09B 1GXLA 4NZ7A 3PO5A 4XK8C 5F8LA 4LF7F 3CULA 3MF5A 3MAQA 2CPIA 2BDPA 3BGRB 3H4DA 3M8PA 1Y11A 2W8LA 4QR0A 3TAPA 5A8WB 4QIGA 2MGZB 2KFZA 3RYLA 4PKDB 4OYIA 2GAGC 1T05A 2R7WA 2HHXA 4DV2F 3DLHA 1GTEA 3MCMA 1DRZA 1N32J 3H2LA 2XHWA 2YBVA 4OJ1A 5DLFA 4CLKA 2ZZTA 3UFCX 3EPIA 2BBEA 1WSVA 3O3LA 2GAHC 4KV8B 3A1YG 4OHZA 3KK3A 2PDAA 1N5SA 3S6EA 2UXDJ 3QT7A 4PPDA 4ECZA 1FRLA 5DGBA 3DM2A 1SXLA 2GW8A 1WD6A 5HQ8A 2RNEA 2N4CA 3G86A 3VAKA 1H2TZ 6AT1B 5L1KA 3PACA 2N82B 3MCOA 3DRYA 1U49A 2RD5C 2CQPA 2OSRA 3OL8A 2DGOA 3N01A 4PXCA 3PHTA 4YB7A 2YWEA 2B8PA 1U2FA 1KFSA 3MEGB 2FHOB 2K7JA 3T5HA 4J37A 2RDIA 1KQFB 1NKBA 2NPIA 3FZBA 1S48A 3HDSA 4MH8A 1S9FA 5B09A 3UDCA 1HA1A 2CVIA 3R5BA 2QX0A 1HBUA 3KHGA 5E3QA 3SCIE 3DRRB 3DYAB 4A8SA 1S79A 2LA4A 1TZ0A 3L3CA 3K8VA 2YX4A 2CIMA 1RTDB 1VQSA 4E0DA 2ZM6F 3SMZA 1Y10A 2ZBPA 1NK0A 1FJGJ 2Y1IA 1BQMB 1YRXA 3BBCA 2V8PA 1WEXA 2CPYA 2VICA 4FBUA 3ZFVA 3SCJE 1WJ9A 4J9KA 1NZAA 2VDHA 4J9PA 2W24A 2AD9A 3AY0A 4ITSA 3GWCA 2VKZG 2XM3A 3NMAA 1FWKA 4A8KA 2DHXA 3EICA 4NLOA 2M8HA 2RB7A 3TNVA 1E6YA 1L3KA 1Y7PA 2F8MA 1RWMB 2HNDA 2JX2A 2RUGA 3QT8A 1WG5A 3QQCD 3IBFB 2W2NP 4WYLA 4JOUA 1N48A 3N6NA 1T9TA 2VV5A 5CCMA 2NCKL 5E5NA 4GO7X 2MKSA 5J2NA 3NLCA 4CO4A 5D4OA 2KB2A 2V4JB 2CJKA 3NMRA 1U24A 2V2KA 3L95X 1WHWA 4ZLLA 3KDOA 3OLAA 1RTHB 4IOCQ 3J7Z5 1TFWA 2LYVA 3AQOA 1RT7B 2R7OA 5D0RA 3H90A 3HFZB 3SYZA 4S0MA 2O67A 5A6WA 2CZVC 5IV3A 1U1MA 4UW2A 4DV1F 2RUSA 5EHHA 3G4SS 2QEXS 1SIZA 4DV3F 1VQMS 5I42A 2HMIA 4C98A 3NWRA 3N6MA 1RB0A 1DQ8A 1B64A 2QA4S 2R7UA 5EUHA 4YB5A 2B7CB 1JLQA 5AE1A 3G6VA 4DV6F 4O0NA 1L3VA 3EVOA 2YVSA 3MEEA 3KHHA 4NYZA 2WOMB 3U1NA 3TA0A 4PABA 5ETLA 3CCTA 3JXOA 4RZRA 1F5AA 1FCAA 1RAOA 4IYQA 1UA0A 1WKKA 3IMQJ 4WXOA 4UUWA 1U26A 1KFDA 5K8NA 5HL7Q 4DQSA 2ZKUA 1FDDA 3IS9A 5F3ZA 2DBBA 2AU0A 5GADI 3PYEA 2OGUA 4P72A 3HHNB 4DX6A 3TRGA 3G2XA 4GC6A 2F8HA 1RE1B 1ZM2A 3NS7B 2DNOA 2BKNA 8ATCB 3SSRA 1NK8A 1KQGB 2M9KA 2RF2A 3VCDA 5ETMA 2FUG9 5HBMB 2CNOB 4P2FA 1F9EB 1IKWA 2N3LA 2BANA 1KVKA 4H4OA 3UQSA 1XR7A 4J5OA 4CH7A 5IM0B 3ZZOA 4OV1A 3WIUA 3VAGA 4BC7A 2BX6A 2ZNYA 2ZJRQ 2OD6A 3N4WA 4F4AA 2QA4G 2C3YA 3K2YA 3EZOA 4IO9Q 1EIYB 3EGWB 3CJ5A 2I9SA 3S7RA 5CD4A 4J9MA 1RZMA 1WG1A 1RP5A 4B9MA 1GT8A 1EHWA 4KQZA 2UUTA 1GAOA 2EBGA 3TZWA 2I5JB 2GQCA 3J81Y 2O1PA 4YHHJ 5C25B 4ZHRB 3K5MA 2NXEA 5KAKA 3OBIA 4HVZA 4WE1A 4P2SA 1RWWB 4ECSA 1LFWA 1S1XA 3KXDA 5FLXU 5IZHA 3LO3A 2JHEA 5D0HA 3PKMA 2KT5A 4WP8A 4OZNA 3ZZPA 2E7XA 2W2OP 1UMJA 1LWFA 2CNNB 1S9GA 1FWLA 2IC3A 1RLDA 3AA9A 1GMWA 5A0YB 2RH3A 1SJFA 2HHWA 4K2JA 3W8PA 4HI2A 2QSFA 3SSQA 3KLFB 2CJAA 1XMQJ 2VBYA 4Y65A 2YX7A 4RBUA 3BH7B 1VQ6S 3IM8A 1NHVA 3D7SB 1HR0J 3I4HX 2LEPA 1PAUB 4MJKA 2QTWA 4WFZA 1C1CA 1IM6A 2HNYB 1CJVB 2GVZB 2H51B 3T9NA 4Q45A 3RW6A 2KTQA 2Z8QA 5K9FA 4KJIA 4ERDA 4M5NA 1TL7B 4LRDA 1HHTP 3QGHA 2ILZA 2JVOA 3MM7B 4OZ3A 6FDRA 3VV2B 4YEAA 3TAMA 1AXQA 1U1RA 4EGLA 1LW2B 2DNMA 4ZJLA 5IXUA 2PEBA 3DMJA 5KFXA 4M5KA 5C24A 2MLZA 4E98A 3VVTA 1M1GA 4DHVA 2Q6BA 1F5BA 3UN5A 2Z56B 1MWYA 4RNFA 1L3SA 5D4NA 3QNWB 5KFMA 3LOUA 3MD1A 3PIOQ 3P4UB 3BGOP 2MKCA 3ENWA 2V2ZA 3X3UA 3CXCR 1U1QA 2GZOA 3QBCA 4OL8A 2HHHJ 3Q0AA 1U7LA 2GX8A 1VI7A 3BM7A 3CMQA 3FBEA 4R0EA 3PFEA 3OJUA 1TKDA 3FBFA 2V0NA 5CYMB 4OI1A 2W4PA 1H74A 4X64F 2DH9A 3RBDA 1TMMA 2CQ2A 5E3CA 2DO0A 3O5TB 3IRXB 2CQ4A 1VC6A 1U6FA 3IAS9 2N3OA 1RT4A 1AZSA 1FI4A 3ITHA 1IBLJ 2DR5A 1FEEA 1UVLA 3NAHA 4ZK7M 2A2CA 4TU9A 1VLOA 3UR3C 2M3DA 1R0AA 1GX6A 1C0TA 2F7VA 4TU8A 2MXYA 1Z1ZA 2A6MA 1FWPA 1R7IA 3C16B 1SC1B 7FDRA 2XNRA 1Q8KA 1SV5B 3W9JA 4LVOP 2AJ0A 1IR1A 2MZSA 4RR5A 3KUEA 4Z37A 3POTA 4YDDB 2HQDA 2JH3A 4ZA1A 3VF0B 3OD2A 3BO3A 3MUVP 1RT1B 3BS9A 1Q86T 4ID5A 1VRUB 3JQMA 2BM0A 1WNEA 4ZCLA 3NS6A 4LSLB 4PRFA 2CQ0A 2G0JA 4TY8A 1SH3A 4X65F 4WFBQ 2V8DA 4NI2A 3BSCA 1VQ5S 3NY0A 2VDIA 2MKYA 2AEMA 2FVCA 1YBAA 4DUZJ 1V3ZA 2PO4A 1XBWA 1XMBA 3Q24A 2DNPA 1EB0A 2E7VA 2RHQB 3WC2A 5HLFA 1CG2A 1EKSA 1T9XA 4HDHA 2HHUA 1N4LA 1VR6A 2CYYA 2VD3A 1FKOB 5AXKA 2WSFC 3VGUA 4GVBA 2UZAA 2CZ9A 2YNIA 1MMNA 1LW0B 1AUDA 1J5OB 1G4CA 2UVVA 1TTHB 4KPCA 2CDRB 3QJJA 2QIFA 3RAMA 1VBZA 3TWZA 3CO0P 2GIQA 3MM5A 4Z7YA 4DR1J 2DR7A 2HHPA 3OTOF 1LK7A 4H4KA 4LSNA 2K3IA 2R2UA 2Y3YA 3TQ1A 2Q3PA 2VBXA 3M2VB 2EBEA 6FD1A 3K58A 1HWLA 5M2RA 3MMAB 2A3JA 3DLKB 4V1Ak 2Z0GA 1GMUA 3F56A 1TKTB 2ZE2B 2W8KA 1WELA 3A8JA 4WK1A 3BSOA 4V19J 2C1EB 1N0UA 2QLWA 2GJ2A 2YPYA 3R5AA 1S1VB 3J80Y 1R43A 4JI8J 5L9NA 3T19A 3UNYA 2EWHA 2OHDA 2RVJA 3W2VA 3K17A 3BO4A 1S9EB 1LWEA 4B3OB 4WBFA 5DS7A 1IXKA 2NZ4A 1QE1A 5D4LA 1RQ0A 3F0NA 1P1LA 4OYZA 3KK1B 1RWUA 2UUBF 2X1BA 3CDBA 3M6VA 2JRSA 3C3LA 1JLEA 1UEUA 1DQ9A 2E66A 1WI8A 2IDEA 4XTTA 2IJRA 1JJHA 3MAAA 1CPZA 3NEKA 4OZJA 5HAOA 3MPWA 3B4MA 2DRBA 4J9OA 3A4TA 3NAIA 3VZHA 3EX7B 2VG6A 1KHVA 1HBMB 3NGDA 4PQUB 4L6V3 2V68A 1B4SA 4ZDNA 3DOKB 3VQSA 3KJFB 2RS2A 4DR5J 3B82A 2ZH1A 1DTQB 2WAQD 2DCUB 1YBUA 5B0FA 3ZTQA 3MUTP 3QWUA 1WF2A 1QY7A 3PIPQ 4LF8F 3SIPB 2QE5A 2EK1A 2Y1RI 3MECB 2QFIA 3M8QA 4O4GB 4DBQA 4DV4F 1MMDA 3BO2A 2AF6A 1B0PA 3FRYA 2QMXA 3BPSP 1VIXA 4CIOA 3MPYA 3OV7A 1XNRJ 3FMBA 2ROPA 2CZ4A 1TVRB 1TL3B 2IY5B 2DXFA 1B0VA 1C0UB 3US5A 3CDWA 1ZA1B 2L9NA 5IOLA 4YS2A 5F8IA 3I32A 3BGRA 1Q95G 1NB7A 2RSQA 2PIIA 3DLLQ 1RHRB 1KTQA 1RT6B 2MHNA 2AJQA 3TX8A 4NLVA 2MGZA 4WPAA 2PD1A 3MMBB 4NLXA 2RS8A 3SEOA 2HWHA 5KFCA 3ZTRA 4HACB 2LXUA 5DDOC 1FJCA 2MMYA 1RWXB 3G8TA 3VGVA 2ASYA 1Z4UA 3HMJG 3VWSA 2DHSA 5E3PA 4KV8A 3D2WA 4ECTA 2CJYB 2HZAA 4NCGB 1QAJA 4DR2J 2J9DA 2V4QA 3V4IB 4N8OA 3ISND 1UEKA 2JFDA 5D3GB 3GJQB 2PFFB 4LR8A 4K0KF 2QLJB 5DJBA 4ZVQB 4YN3B 3AJDA 3GYNA 4WU3A 3NP5A 3R6LB 4DSJA 3MEGA 4XIUA 3DFEA 3OTDA 1ZZNA 2RU3A 1FDNA 2DPJA 3H20A 4ZLNA 2JLEA 1GTHA 3ETMA 1FFWB 4I69A 2FVSA 3J7AN 2MDAA 3GR0A 3CUNA 3DRRA 1F2HA 4KO0B 3FZ2A 1S4FA 2NPFA 1H2UX 1XR6A 5KFYA 3V2UC 3VAIA 2KVIA 4I2PB 1RTDA 3H25A 2YX1A 3CJKB 3ADAC 4B9VA 4RUAA 3QZ7A 2YWGA 2YXLA 4UOGA 1BQMA 4QW9A 2GV1A 4ZLJA 4LF7J 3W1YC 4BS2A 2XC9A 3DOLB 4IG0B 2AGPA 2FVRA 3DDNA 1QJHA 1S0VA 4C8ZA 3C14B 5BJRA 1RABB 2J8SA 4OMFG 4F2RA 1ACMB 1NJYA 4FZVA 4DV2J 1XTZA 4UY85 2B4VA 2FTRA 2HVDA 2MEWA 1TAUA 1T03B 1YKWA 2QL7B 3Q83A 3CCQS 4N47A 2VKRA 3UPFA 2E5HA 2OD4A 2BRKA 4CLZA 3QPIA 2QL9B 3MHYA 3CVKA 3D54A 2XLIA 2K2PA 1KVIA 3QLHB 4MIWA 1FJ7A 3ULHA 1KNZA 2DD8S 2V4JA 3S1TA 4ZP6A 4FBTA 4EEYA 2EVZA 1RTHA 2R7QA 1RWKB 4LRBA 2VFRA 5ETQA 4UQTA 2JJ4D 2V34A 4OX9F 3GV7B 5KG2A 2XHCA 1HW8A 5E7OB 2WSCC 3HD1A 3TA1A 2CFXA 4DSEA 1ROFA 2CA9A 1YI2S 2F1FA 1WC4A 3C19A 4KGKA 1DAXA 1KWMA 2JEJA 3VHQA 4ZJOA 2WVFA 1B7YB 4W90B 1PC4A 3EXYA 2VONA 5KT7A 4DL0C 3THTA 1D9DA 4I0WA 3FSXA 3WIVA 2V69A 3MTKA 1TUVA 2VQEF 2ZM6J 2I0XA 1N52B 2H48B 5KFZA 3FC9A 4ILLA 4FXWA 2P2CB 2WOMA 3TUIC 4OLPA 3BN7A 1O51A 3VQTA 3MM6A 1KVJA 4AT1B 4WZQA 4QIEA 4I7FA 5DETA 1WDTA 1UFWA 5J2PB 2AJFE 2EKYA 1FRHA 2O66A 2FZGB 2PC6A 3OW2R 3KLEB 3I0RB 1WF1A 2HS0A 2UUWA 3IR5B 3GJRB 3QIPB 1TMJA 2B4UA 1KBRA 5JVGQ 3KMQA 3T3FA 4PG6A 4A46A 1WACA 1PYTA 5C2CA 1XC9A 2HAFA 3IFEA 4G65A 3L7UA 5IM0A 4USWA 3PYDA 4X4RA 1KRPA 4PXDA 5LSLA 4MIAA 2MJUA 1U2RA 3P6YC 3TJ9A 3CCJS 3CWJA 1ZPWX 4FP9A 4X4TA 2MQLA 2CG8A 3R1HA 4USHA 3MCSA 2HFUA 2C3OA 1HNIB 3IN5A 4DV1J 2I5JA 5KFSA 1T02A 1TV6B 4Y34A 4DV3J 2C2OB 4ZHRA 1RXOB 1A7GE 2DYAA 2EXUA 1E6VB 2B6AB 4LF2A 4P9SA 3U27A 2CPJA 1N36F 2XGQA 1UJ4A 4DV6J 3E01B 4EYIB 4QQBA 1HQEB 3CDAA 1B3TA 2C2RA 3NNAA 3EDQB 4AQYF 5LMUF 3LAKA 3I56S 4DR7F 3ZZYA 5DZ6A 1VJWA 2NLWA 1R31A 1TKXB 2V94A 3CD5A 5A0YA 4M5LA 2E1PA 2XYPB 1U48A 3TVYA 4ETZA 3KLFA 1VJQA 4J9VA 4U95A 4M63A 2FPHX 1VBYA 2CXEA 1W26A 5D0GA 3C8YA 1FXRA 4ED3A 1ZBTA 5F0WA 1HBNB 4H4KC 1XMOF 3HHEA 4NPOA 1EETB 2CPDA 2GO8A 3BB5A 1CJVA 2GVZA 1UEVA 3Q2TC 5E3RA 4DUTA 2VB6A 3WDOA 4C2MA 1U47A 3H42A 3MZIA 3D4JA 2OSQA 4ENOA 4NLPA 3JSMB 5HATA 4WIIA 2X3GA 5KFUA 1DURA 1C4AA 3MM7A 3OVBA 2Y8YA 3HT3A 4UQGA 4TQSA 4CLSA 1AFIA 3FBBA 5ETRA 4ALZA 1LW2A 2A2DA 2IFXA 2DXEA 2RT3A 2FIUA 5IQ6A 1VDHA 5EX3A 5KFOA 4IQMA 1FA0A 2C3UA 2IHR1 5IWAF 1IR2A 4RO0A 2NSBA 5LJ3Y 3H2VE 4ES2A 3RJMB 4FF2A 1ZOTA 3GCWP 2OPSB 4ICLB 2DGVA 2ZH5A 4ETXA 3U7JA 2YKOA 4DQRA 1RWVB 1WORA 1RA7A 3TARA 3DU5A 4DU8A 4RW9B 5JMNA 4NXMF 4CT9A 5HMWA 3N0VA 4LR7A 4WWSA 1KLNA 4DUYF 1U6ZA 4C3KA 1RKJA 2F9DA 4LT6A 5CYMA 1S5ZA 2NXUA 3R3TA 3W64A 2KXHA 2MHEA 4WFNQ 1IQTA 4EO8A 1A0OB 4A48A 3BYPA 3G82B 1RU2A 1JJ4A 1H6KX 3DRPB 2G2ZA 2DHGA 4K4SA 3F73A 1JX4A 1NDCA 3FSYA 4K5SA 2D7SA 4F4WA 4IO1A 4B08A 4BHQA 1HWUA 3C16A 3MDFA 4R25A 1SV5A 3IA0A 4XO0A 1KP6A 4C8MA 5C2GA 3KNAA 4KHRA 4YDXA 3D66A 4EWTA 2OEKA 3C2PA 5HJXA 2J0SD 1N54B 2ZITA 1S57A 1RT1A 4JB8B 5CA5A 5DM7Q 1VRUA 4X66F 2Q1LA 4RNOA 2UXCF 2LKZA 3U02A 4G6VB 4JI6F 3QRRA 2P6SA 5LXYA 3QGPA 3CCLS 1ZM4A 1QSSA 4QU6A 1X7VA 1PCAA 4LVNP 4MFBB 4ZPBA 1K44A 3HSZA 2AW0A 4NLDA 5EGYA 1VISA 2RKIA 4Y2IA 1U02A 2CPEA 1VHFA 2E9RX 3NL0A 1WC1A 3NRBA 2GMHA 4ES1A 3JSBA 1FKOA 3LA0A 4IFYB 2UUCF 3I82A 5B0CA 2N4DA 5MLCV 4IH7A 1LW0A 3BQ2A 1J5OA 2BVZA 1TP7A 3NGSA 1R6VA 5KG0A 2LU1A 4LF5F 5BXIA 1N56A 2PA8D 5GMKa 4NLGA 4ZPCA 2JSXA 1VIOA 4OHXA 1BQXA 1U4BA 3OUYB 4CLTA 2LP4A 4X84A 5IFMA 2Y8WA 4Q8EA 3DRSB 1YITS 4X64J 4CO1A 3EE3A 3M2VA 5B08A 3H8YA 3KTQA 4F4YA 3MMAA 1QD1A 3I9ZA 3THVA 1KC8T 2LXIA 2E44A 2NREA 3DLKA 3DLBA 4PUOB 4IR1A 2VASA 3KLGA 1Z2LA 1C4CA 1TKTA 2ZE2A 3P45B 2ADCA 1TUGB 4CCHA 1U1OA 3CC4S 1HHSA 2BJDA 3F41A 1S1VA 2Q66A 1KR4A 4P7VA 3M9NB 2EFPA 2FQQB 3JTNA 1S9EA 4B3OA 4BWJA 3P8BB 4FVMA 5JXSA 4GKJF 2HIQA 3MM8B 2MSSA 2UU9F 2LQJA 3QT6A 1WOOA 1NK6A 2HVZA 4A8MP 4AUKA 3L7PA 3B6BA 3KK1A 3IP0A 4MKBA 4PWDB 4EMDA 2OFHX 4P74A 1SPBP 4WFXA 2BQRA 4X65J 1CS4B 3NNCA 2ZWPA 3OR1B 4I64A 2FDNA 1UL3A 2Y1JA 1NH7A 1V5IB 1OIAA 1U0SA 1EX8A 3M2UB 3D9BA 3OL6A 3DGVA 3DC2A 1U1PA 2WW4A 1QTMA 4Q8FA 2KFYA 2DJWA 3M9OB 4CLYA 2ZHOA 1QLNA 2N7YA 2FJWA 1HBMA 4PQUA 4CO2A 3DOKA 1N5QA 3V6DB 3RAXA 2GQQA 2OEMA 1QAIA 1GNKA 2PFDA 1MN7A 1DTQA 4L75A 5C42B 2JC0A 1NSAA 2VHGA 2VF3A 3IR7B 5DRKA 2CQIA 3OTOJ 4Q0BB 4ID8A 1UVJA 2YKMB 4RW8B 2FC8A 3D0IE 5F0UA 1FFGB 1UFLA 3MECA 3AJ2A 3FFIB 1HI1A 4JI1F 4M5HA 2CG4A 3PX6A 2IPOB 3NBPB 1R0CB 3L4BC 1TVRA 2IIHA 2XMMA 1RHJB 3G8SA 3T1YF 2K1RB 3MAHA 1C0UA 2QFJA 4J9NA 3KHLA 4CNYA 3NCPA 2MB0B 2BA9A 4P75A 3Q8VA 4M5MA 1RT6A 2FYXA 2W9AA 1R8AA 2V63A 1B7FA 1VYAA 1NRKA 1BHNA 4U67Q 1RJJA 2BXJA 2BRLA 2KT2A 4URSA 4PWUA 2VG5B 3KDNA 4HACA 1NJWA 3GP9A 3K0JA 5GAEI 1NJZA 3RBZA 1PJ6A 2RQMA 2YWWA 4CM0A 1VRTB 3GFYA 2UUBJ 1IM4A 3NGRA 4LJMA 4G1IA 5KFNA 2XQCA 4I6YA 2J9EA 1VQ8S 4LRFA 3GFHA 3IR6B 2CQGA 1U25A 1S10A 4IH5A 5LSRA 1VGYA 4NCGA 4YR0A 1HNZF 1X4EA 3KHRA 1S99A 5IT4A 4OX7A 4CDIA 2HWIA 2WBRA 1FNMA 2UUAF 3V4IA 3NWGA 5KFQA 3V81B 4J91A 4QPTA 5D3GA 1NUEA 4WKYA 1V3RA 5HI7A 1H7XA 5H9FJ 3GIKA 1RTIB 1BGXT 3QSYB 3FNNA 3TOQA 3C15B 4OX6A 2X7IA 2MSTA 1S7IA 1VS3A 4PAAA 2IVFB 4C0BA 1OPIA 3AQPA 3D0HE 2D3UA 3CCES 4HDGA 4DCJB 1RHKB 1RHUB 1T9WA 4BBYA 4F4KA 4B3MF 2MJNA 4LF4F 2JNJA 4LF8J 3MFIA 2IAJB 4KO0A 4DV4J 5J1PA 3GSIA 1RUSA 3SXLA 4I2PA 4NZ0A 3IBCB 4LFCF 3CJKA 4G3IA 2AKWB 1ZAVA 3TZYA 4DN0A 1XR5A 3TUPA 3CEDA 2DH8A 4AYBD 3JS9A 2F63A 3FCHA 3DOLA 4IG0A 4NOHA 1YHQS 3MR7A 1NK9A 2OLWA 3BQ0A 3SV3A 3C14A 2E1RA 1X60A 1FT8A 3W62A 4U8YA 3A13A 4OX8A 2IM2A 4HYKA 1PAEX 1DTTB 4WXWA 2HZVA 3AD7C 1TL5A 1T03A 3ZTSA 3CCZA 1HNVB 1H73A 3ETOA 2HHSA 2DNGA 4JV5F 4KR0B 3BF4A 1RT5B 4CRJA 2HG4A 2BW7A 3KWMA 3VAJA 5HO4A 4WK3A 4ZPTR 1VC5A 1H98A 1UWBB 5D15A 1TK5A 1HIYA 2XY6A 3QLHA 5HMYA 4F26A 4DLGA 3RBEA 2VH7A 3SBMA 3QT5A 1N33F 5HMZA 2XSJA 5D0EA 2RILA 8RUCA 4K0KJ 2ZDOA 5KFEA 3TEHB 3PG9A 4C97A 2RRBA 2ZH4A 4TN2A 1UVIA 2HVHA 2EG2A 3GMGA 4AXJA 2R7RA 2ALYB 2CJQA 1TL4A 5E0OA 1S72S 1SL1A 1SI9A 2FLPA 2W7AA 2GS8A 5GAGI 1RTZA 1P6TA 4ED4A 2B5JB 3ONQA 4P2MA 3LAMA 2LQ9A 2J6TA 3RB4A 2K7KA 2M88A 3H5UA 3J7YI 4UUXA 2MLXA 1RT3B 1P1TA 4N7TA 5EWEA 5L1JA 1NDKA 2YKNB 3VTIA 1VQ4S 4F4ZA 4JI4F 4ZN1A 3QAUA 2HQFA 1R27B 1PJ5A 2HURA 3M7VA 1RWPB 5DG8A 4B9NA 1A9NB 5J2PA 2FHMA 5T41A 4I67A 3Q8QB 3H98A 5HMXA 2OPQB 3PR4A 2QSWA 4YB1P 3KLHB 5JUMA 2HRUA 1WWHA 2ZWOA 1L3TA 1M1KT 1RGVA 3I0RA 1NSQA 1CLFA 3PX0A 3FBCA 4DS5A 2YQ3A 4NMLA 1KQSR 3S01A 5HROB 4LUBA 1LEOA 3QIPA 4Q43A 2DISA 2Z2MA 2AQ4A 1WOSA 2XYHB 2E7WA 3LANA 4EZ9A 4DPOA 5IV4A 2F8EX 2DEJA 1RISA 4N41A 4EBEA 2DVIA 5AE2A 2OTLS 1HI8A 4U9RA 3M2RB 4YFUA 3A8IA 5ETTA 3R5DA 4BWMA 1OSCA 5KG7A 1X5TA 4OIXA 4OX9J 2YKQA 2EPIA 2KVQE 5LJ5Y 1XNRF 1Q5YA 2CQBA 4C3LA 4C0HA 2QT7A 4WP3A 2A18A 1KTVA 1SH0A 4Y0FA 1D1UA 4MKVA 4FS1A 3ZZTA 1M90T 3PW5A 5H9FK 1E6VA 2DNKA 1S12A 2NYIA 3QIDA 2J9CA 4WIQA 3OQ2A 2ERRA 3E01A 1HQEA 4RNHA 2VQEJ 1NSKL 4NLSA 1XIQA 4RPFA 3ILJA 2PA3A 2DO4A 2AP6A 3ISNC 2DY1A 1NU4A 1TKXA 2G9OA 1D9FA 2BJ7A 4ZPVR 3TZZA 3AXMA 4EZ6A 4Y3CA 3RW7A 5LOQA 5J2MB 5KFDA 4TVAB 2R4FA 5K5MA 2Y0BB 3I9V9 2QJ3A 1FXDA 1Y0HA 2Z2LA 1FTCA 3CJQA 4E2FB 5J2QB 3A3OB 2JZ5A 2QLBB 2MY8A 2DH7A 3IRWP 1HBNA 2ZUAA 2ZVIA 3R2DJ 3IWNC 3Q8SB 4DSFA 1S49A 1WOPA 2VQFF 1EETA 4DSKA 2XG8A 3OSPA 4K4XA 3DXBA 4DZ6A 4DFJA 1JQGA 1P9YA 2YQ1A 4DL5A 3T9ZA 2Z4PA 3M32B 2WRMA 3E3XA 3NCQA 3BSAA 1BXNA 8AT1B 2BUNA 4RWWA 3QFWA 2DHAA 3PR5B 3DU6A 1Q7YT 4X62F 2IDLA 1QVGR 4O23A 3MI7X 2E9ZA 2YNHB 4DX8H 4ICLA 2LCWA 2ZJPQ 4CLUA 2DGQA 3D5MA 2J6SA 2HVIA 2W7PA 2V2QA 4RW9A 3D6TB 1N36J 3M8YA 3PW4A 5U47A 5EDWA 4QIVA 1NK7A 3H7HB 4G1QB 1DY3A 5KFWA 4AQYJ 9RUBA 4MK9A 1NM2A 5LMUJ 4JYAF 4RUHA 2DRDA 2ROEA 4DR7J 2V2VA 3SQGB 2VOOA 1RCOB 3RRHA 3WHIA 3G82A 3N6LA 3G71S 3DRPA 1D3WA 2NUHA 2FLOA 3QJPA 5ITHA 4ECYA 3R5CA 4D3HA 4L74A 3DN9A 1T05B 1SC3B 5K8PA 2VG7B 1TUWA 4ZITA 2AZ3A 5GVQA 1CVJA 4CO0A 2XO7A 1WKJA 3JSRA 2L3MA 1Y3JA 4XDCA 3ZXWA 5I4MA 2R8KA 2EC0A 1RWNB 1PKUA 2ZC3A 4Y2CA 1XMOJ 3E2EA 1OY9A 3DGPB 2R2RA 1WI6A 1NKEA 3NKYA 3FDSA 4L76A 4X4UA 1RAHB 3CT9A 4E8UA 2VA2A 1TFYA 5HN0A 1U0HB 2YTCA 5E33A 2MKKA 2OEJA 4ECRA 2L41A 2HLUA 4X4NA 3NXZA 1S6UA 1FRJA 5M2UA 4BC9A 3JQJA 3OTBA 3HHDA 4UF4A 3EM1A 2D74B 3LTOA 5AJ3J 2F4VF 4DOZA 2PI5A 1BWVA 3KFWX 4TNOA 4MFBA 1Z2ZA 4OYXA 4HKQA 3IC1A 2KG1A 3GR1A 3T5LA 1RT2B 1SKWA 5IWAJ 3BEGB 5KFAA 1HNWF 5F41A 3PYGA 3SFUA 3AD9C 4B9TA 2CJBA 4TLRA 2JDJA 4IFYA 2YNFB 1F9FA 2H5IB 4DN9A 5IC6B 2F4FA 2HQGA 4UTGA 2H54B 1URRA 4ZJQA 3QYYA 3UO0A 3QRPA 5CQGA 1T0TV 1YTYA 4RBTA 2P5VA 1T9VA 4NXMJ 1U8WA 3HK2A 3C6TB 4K8RA 3BYRA 1ZAWA 2IJFA 4TKTA 5G0RB 4DUYJ 4R0JA 2HQCA 2NYHA 3GCXP 1IKYB 5CYJA 4TQRA 1S76D 1RBAA 1YDLA 4CP5A 1JLBA 3DRSA 1IJFB 2R8IA 3GSDA 2G2OA 4UT4A 2MZ1A 5EX0A 4PUOA 1JLFB 3UE2A 5L38A 2ASJA 3KOAA 2DR6A 5BYRA 1SJ1A 3RZAA 3V5RA 3CJ0A 1TELA 4C3MA 4C8LA 3IWXA 4ATNA 1X4BA 3AODA 2AWZA 2AZ1A 2F9JA 2OO4A 3WX4A 4JI3F 3VGSA 2IA6A 4WU2A 4DXLA 2R2TA 4OHVA 3MM8A 4IH6A 1DQAA 4ED2A 3D0GE 2ASDA 3FUYA 1HPZB 1X5OA 1RBOB 1NCLA 2C2KB 2BKOA 4X66J 1Q7LB 1N5YB 4PWDA 3RB6A 4I2QB 2UXCJ 2B56A 4JI6J 2VOPA 4OYPA 3DHWC 3FGVA 3OFHA 2KFNA 4QW8A 1CS4A 4QYZJ 3W5YA 3OR1A 4JI5F 3BV8A 2J0XA 5HANA 4LF6F 2B7BB 3TJ8A 4Z7CA 2V50A 3NOGA 2E5LF 1YVFA 3JB9k 3O6QA 2WZ1A 3HHLB 2G13A 3HSJA 3R5GA 4PYDA 4A4JA 3M2UA 3GIMA 3H40A 2CAJA 2NZCA 2UUCJ 3OL7A 1CBKA 2BE2A 4QPXA 3HF5A 1RAAB 1XERA 4M5IA 4P73A 3AFGA 3J81U 1JLQB 3LWLA 1GEHA 4OHWA 4KSEB 4LF5J 2FZCB 2H5EA 1PO6A 5C42A 1QVFR 3H5SA 1SCJB 3MPDA 2KZZA 4Q0BA 2W4DA 5KFHA 1W2IA 1S1WB 2HWTA 2YKMA 4RW8A 4HI1A 2CKWA 1HARA 3NG8A 1ZYQA 3FFIA 1DHMA 3KLIB 4ZVPB 5H9EJ 3LGMA 4M5JA 1YJNS 3NBPA 1FRIA 1R0BG 3O1LA 1IBKF 3PZPA 5L8RC 3AD8C 2R3VA 1N34F 1N6QB 1D9AA 2K1RA 3HVTB 2QA2A 1YJRA 1Q16B 3UN3A 4IUFA 2VJUA 2IRUA 4HT7A 2JEIA 1NAQA 4A8FA 4OYOA 1LK5A 1VMBA 3TW0A 4ZVSB 4GKJJ 2RE1A 2UU9J 2BABA 2VG5A 2DIVA 4KRWA 1HNXF 4URQU 2VODA 1JKHB 4OV6A 4KBIA 2E5JA 1K47A 1VRTA 2QYCA 1RACB 3JAMY 2MQMA 2MZRA 1UAWA 2U2FA 2MQ8A 1I94F 3OL9A 3V6KA 1FK9B 4HL9A 1KN6A 2YKPA 1Q81T 4LBIA 4CLPA 3FEYB 2R8HA 1UPMB 3CTRA 3GIIA 4DPYA 3GJTB 3CPWR 3SCKE 2BQ3A 1SKRA 2VFUA 1IR0A 2OMOA 3HD2A 5IT9Y 1BLUA 5IS2A 4OZ2A 3V81A 2HPUA 2VC1A 4QR2A 1WG4A 1FDBA 4NLTA 4GKKF 2APOA 1YSJA 2Z2YB 2PSZA 1YIJS 4FXVA 3C15A 3MGJA 1FF2A 1RWOB 3RTVA 4ELTA 3D1QA 1JNZB 5GAEU 5FDLB 5EN1A 1GQEA 4USVA 2RQCA 3EPGA 3ILOA 1R8PA 2R8JA 1U2CA 1AROP 5A8RB 2IM3A 4EO6A 3R97A 3IGNA 2D1CA 4OI4A 1VCTA 1YGYA 4WF9Q 3UDLA 2CNLB 4JI1J 3ZZ0A 1P27B 3AA8A 5GAHI 1F2GA 2QO3A 1NB2A 2M4MA 2E5IA 2FJBB 4NLQA 3BPDA 1IJEB 2FJXA 2CADA 3T1YJ 2BACA 5L46A 4ZVEA 3ZTPA 2DR8A 4Q5VA 4EUVA 4HT5A 2VZ9A 3W61A 2YPZA 2RDJA 1M5OC 1JIHA 4LIRA 1PSDA 3BREA 2HHTA 1MG7A 4RKUC 4NL5A 1XQIA 1MN9A 1SJQA 2GO9A 1S97A 1DTTA 3CCSS 1ICEB 2GC8A 2AEFA 4A8WA 3M9MB 3KJNB 1HNVA 4DFKA 2QA1A 3ZZUA 4RU2A 1F3VA 3B8HA 1SQEA 4AXIA 1SKUB 2E1AA 3PYFA 1PC5A 1UWBA 3AOAA 4ECXA 1LXJA 1F1BB 1U09A 2LQ8A 1HNZJ 1VK8A 1MU2B 3HSDA 3HHLD 2XS5A 2UUAJ 3I5CA 2NR0A 2HVEA 1R8CA 2L9WA 4NCBA 3T6BA 1OPZA 5HQLA 3X1LB 4ZP7A 4UZBA 3IWLA 2C2NA 5CABA 5CCLA 4AFFA 1JLGB 1EZZB 4QYZK 2WTFA 3GYGA 5L1IA 4TLQA 2ATLA 4IG3B 5A2QY 3P5TL 3M4XA 3UNGC 4K4YA 3FEXB 4CLFA 3Q8RB 4AL6A 1UWAA 2C22A 5KFPA 4B3MJ 4LF4J 3CJTA 3RBXA 3KUHA 2EG1A 3TZXA 4F36A 1UJ6A 1YX2A 2ACYA 4TYAA 2YWKA 2B5JA 2WCXA 1ZZFA 4ZCMA 2P8IA 2ZOMA 2EEYA 3R1LA 2KM8C 1CQNA 4F02A 1RT3A 2P6TA 4LFCJ 3MOZA 5KG6A 2YKNA 2KXNB 1OY8A 1QM9A 1S4EA 2V5HG 2ABYA 3I0SA 4DFPA 3G6YA 4N8NA 2JEGA 1V3SA 4UY8T 5C5JA 2F5GA 2MY7A 3M8RA 2BKPA 3J80U 2UXBF 4NA3A 1ZM9A 4J9QA 3O2IA 5H9EK 2HYIB 4QWCA 1MNEA 2DRAA 1JLCA 3UVJB 2HRTA 1JMTA 1SH2A 3KLHA 3NGTA 2CJXB 4M1KA 2ZZNA 2XO6A 3CJSA 4OZLA 5GAGU 9ATCB 4ED1A 1UJ5A 2OIHA 1SC6A 5HROA 1FKPB 4JV5J 2VUGA 2G1HA 3JSYA 3J7YU 3T5JA 4USIA 2J76E 4DR6F 1G1XA 2GA7A 2HZCA 1ZTTA 3ENAA 4OYMA 3VVUA 3HVAA 5HLFB 1HD0A 3OXGA 5K14B 3CO9A 1IWAA 2BE7D 4ECVA 2ZBRA 1HMVB 1N33J 4DX7A 3M2RA 2Z58B 4WTOB 2KZMA 4OJ3A 4OI6A 4ZS6A 4B02A 2XNQA 2M8DB 5T7LB 2CJ9A 3W7BA 3UCUP 1FKAF 1W25A 1LKZA 4LF9F 3NS5A 3P5BP 4ZPAA 3W66A 2HHVA 4YR3A 5F9LA 1GMWD 4C48A 2HGLA 2ZH2A 1RBLA 4RWXA 1SB6A 3N28A 2EFOA 4J90A 4ED5A 4MMOA 5K20B 1WSRA 4CTAB 3I6PA 4DR3F 3W2WA 1CJUB 1S6QB 5LL6d 7AT1B 1NNDA 4JI4J 2R9LA 1S59A 4C9DA 2M52A 3EZUA 2B9EA 2CWKA 2CDQA 3SZ2A 4ZPDA 2YQ0A 2X1AA 1HQUB 4UOCA 1FHTA 1H72C 2QG9B 4MKAA 4WFYA 5J2MA 1NPRA 1IVZA 2OUGA 2RDDA 4O3QA 1S0MA 2W01A 2HFSA 4M5GA 2KRBA 4RU9A 2G4BA 4AD6A 1NBEB 2VPYB 1JLAB 1CULB 1SJ4P 2YWFA 2CPFA 3QAEA 1FVQA 4W92B 2MZJA 3OHBA 1NSPA 3OVSA 1N8RT 4MIBA 1S6PB 1DJ0A 4USKA 4H4MB 4ZVFA 2HGMA 5L9XA 2IYGA 4NEZA 3FCWA 2J8AA 1FNXH 4I4BA 5KFIA 5DZ7A 2VFVA 4OYBA 4C8NA 3R7SB 3CC2S 3GU0A 1RLCL 2FC9A 3QMQA 3LF0A 2DY9A 1QSYA 1IBMF 2WHOA 3TO8A 2KT3A 2YNHA 3SCLE 5CZXA 3CJRA 5I3UA 4KHPF 3BH6B 2HNZB 4NEYA 2GGPB 2DKOB 4WZMA 4UOFA 2UV8G 4EYHB 1WEYA 3AOCA 3EGNA 5HP1B 4NLRA 4FKYA 3CC7S 3C46A 5CZVA 4QWDA 2Y9HA 3U1LA 3M8QB 5B0AA 1CEZA 3LP0B 4URGA 4FDFA 3VAMA 5A8WA 3ET6B 1X4FA 3LP1B 4NASA 3Q8UA 2HSEB 4JI0F 1YG0A 2DGTA 2CPHA 2GIRA 2J6UA 2DT9A 4G1QA 1U45A 4KC5A 1FESA 2HFNA 4FF1A 2AYEA 5BR8F 1X31C 2ZDPA 3SQGA 5AXNA 4RNNA 1N88A 2KRRA 1FX4A 2MPUA 2J0WA 2XMTA 1Q8LA 2WBMA 3RR7A 2OKQA 1G7CB 3NCRA 5F9NA 1WTFA 2VG7A 2I2YA 1NDPA 3ILIA 4DV7F 1SIWB 1Q8BA 1Y5LB 2W25A 2ZNZA 2EKNA 2VQFJ 3DGPA 1X9SA 3IAM9 4JP8A 5B0BA 4YOEA 1Y5NB 2WB4A 1JWWA 4B9LA 1U0HA 1VQ7S 1WC0A 2ASLA 3SSSA 2DK2A 2Q6CA 3C66A 4RUCA 5DGAA 2COLA 3PVXA 5M2PA 1SL0A 4OJHA 4ZP8A 4A47A 4J9RA 5KG1A 4RW7B 2O5DA 5AXMA 5HJYA 3DKDA 3DYAA 4BLGA 2OMLA 1REGX 4X62J 1RT2A 3BR8A 2IM1A 5DO2A 2MZQA 4DDFA 5IQQA 1SJ3P 2MTLA 3EYZA 1S0OA 1K9MT 4JI2F 2YNFA 5DDPC 4C6AA 3CDUA 5B0DA 3R8YA 1RYSA 1QAYA 3KJQB 4HHHA 4PG4A 4DQIA 2EFVA 5GMEA 1S0NA 3F44A 1UVKA 2HS4A 3C6TA 4KPYA 5I3PA 5G0RA 4ZN3A 2NSCA 1IKYA 4B3RF 3MR3A 1QTNB 1SVDA 2VFTA 3T5KA 1MLAA 1NPPA 4DR4F 3UWTA 2FB0A 4JYAJ 5A76A 1SUQB 1YQHA 5DLGA 4K50A 2JLGA 3PJWA 4P52A 2BJ8A 2JOQA 4QBUA 1IKXB 2DEIA 3OR2B 5HVHA 1JLFA 4B9UA 2BJ3A 2GMLA 1WTBA 2U1AA 3HJVA 4DF4A 2QMUB 3A8EA 5DG7A 4DV5F 1KDNA 1VQNS 4HH1A 3MEDB 3BDPA 1T9UA 3TR5A 3G9CA 2XS2A 4NZ6A 3H5XA 1UW4A 1OYEA 4Y00A 2XWYA 3QGIA 5I3QA 3N5BA 2VBWA 1NDLA 4Q44A 1HPZA 2ZH8A 3HJFA 5KFFA 4LFAF 1RK8A 2JL9A 2P9GA 1RT7A 5MAOA 2YY3A 1N5YA 3I55S 1XWLA 3PEJA 2ZBQA 4I2QA 4XDDA 3MD3A 2N7CA 1ZM3A 4ANEA 2ZD1B 2F4VJ 4P7TA 1X5PA 4K4WA 2C2EA 4C8OA 1JK9B 1NJXA 3HHLA 1HNWJ 2CPXA 1UZHA 5RUBA 2EFQA 1TL1B 1HI0P 2FVPA 4JBCA 1Q78A 4KKOB 4FN5A 2H3EB 4GVLA 3CSKA 4QWEA 4KGMA 2R42A 3FQLA 5AE3A 1LWCB 2C42A 2I38A 1WC6A 3HKWA 2QN6B 4BDPA 3GILA 4NLWA 1RADB 3BBFA 4Y2KA 2K06A 3ZO7A 1S1WA 2ZOFA 3M8SA 3MM6B 5KG5A 4HHUA 2ZKTA 3DXSX 4DQPA 3MFHA 3PTWA 4LQ3A 1I5OB 3KLIA 4O3OA 4I7FB 1CC8A 4R5PB 4IRDA 1M5VC 1YRTA 4K2XA 2MQNA 2ALZA 5HBMA 3C6UB 1N6QA 3DLGB 3HVTA 2C2MB 4P2XA 2DIUA 2ZH6A 4FYVB 4JI3J 3MEKA 4DWIA 1BQNB 3HVWA 2QMWA 3N9UC 3M6UA 2DNRA 1T8EA 2MYFA 3LH2S 1C2PA 2RQKA 1D8YA 3FQKA 1EARA 5KFKA 5GADU 3OFEA 2B9YA 1JKHA 3GFXA 4MT1A 2OTJS 1KLMB 4YP3A 3H5YA 2VJVA 4HEA9 2X51A 1ZH5A 3QWPA 4GMKA 2DNNA 4IDKB 2KKHA 1FK9A 3SQOP 1KD1T 4MYTA 2BZ2A 2GIFA 2ZEJA 5KT6A 4JI5J 1M5KC 5C25A 1FRXA 4LF6J 5BYQA 3TA2A 3W9HA 2EFGA 2E5LJ 5HVFA 1AA1B 1BUXA 5LSOA 3CJ3A 2D9PA 1BY9A 2ZOGA 3W63A 1KONA 2A6OA 4L72B 3W9IA 3GV8B 1UZDA 5F8MA 1KHWA 2EC2A 3HZGA 1NKCA 5K8OA 3UD3P 5FDLA 2W4CA 3P96A 1YJVA 2DNYA 2XBPA 3CCVS 5KG3A 4Y6IA 3LPEA 1RTJB 2F3JA 1L5UA 4QIFA 5A8RA 4HTJA 4P10A 1VQLS 2XZDB 1PGZA 3VR1A 1YK9A 2IMWP 3FRZA 3K5LA 1IKVB 1LXNA 2B4PA 1DARA 2MQOA 1YJ7A 2HNYA 4A8QA 1IBKJ 2V9KA 2FJAB 2GJFA 4WKRA 3W5XA 3PW0A 1N34J 5A6PA 4O3NA 1FJEB 2XTJP 1K1QA 4KYZA 4NRUA 4OHYA 4ZVUB 3CCRS 1P8GA 1TL7A 2L08A 2HBQB 5AJ3F 4PQAA 3PW2A 3HXMA 3PDNA 3M1VB 3TANA 1HNXJ 3OXFA 3CDEA 3DI6B 1I3OB 4Q2MA 3QRQA 2DGWA 2VIHA 2FVQA 2KN4A 4TYBA 5GAHU 1I94J 2EFNA 1SJRA 4PG7A 2AEJA 4N5SA 5D4PA 2KH9A 1FDAA 1CC7A 5FLXY 2XULA 2HIYA 4ZVRB 2R2SA 1H2VZ 4ILRA 4ZMMA 1MU2A 3VAHA 4OFZA 2H4WB 1ZETA 2HFZA 4C0OC 4NCAA 3K59A 1QDUB 4RNMA 1R6YA 4GKKJ 5KT4A 2LDIA 3OJSA 3EUNA 4AE5A 1JLGA 5KT3A 3KKFA 4JI7F 4KH1B 1JNRB 3IRXA 4ZKAA 2KHDA 3OPKA 4O0IA 3R7NB 2XCPA 2IRXA 4IG3A 2GHPA 4IOBA 2VA3A 3MPVA 3H2UB 3EVMA 3KNGA 5DDRC 3E8OA 2XMWA 1EAYC 3IBWA 1UCNA 2QL5B 1OY6A 5KTQA 3H59A 1DBDA 4CZCA 3ZTOA 2RMLA 2B43A 3TUZC 4NWBA 1F60B 5JVHQ 2A0FB 4YY3F 2FD2A 4LBHA 2AHOB 3UDEA 3GZ7A 1J5EF 4QR1A 4ER8A 3IG1B 4NLYA 1J27A 2AGOA 2G2YA 1KSPA 1X5SA 2D41A 4DL6A 4CM2A 2K3KA 4DCOB 3DCAA 4LSLA 1JXEA 2SXLA 1MWQA 3RGIA 2W9BB 3L09A 3RR8A 4ES3A 2Q43A 5KOWA 4ED6A 4DCPB 1PILA 2RQ4A 1LQ9A 2XLJA 4DPUA 3UVJA 2OPPB 2WONB 2GMJA 2BOAA 1Q79A 2WB1D 3QZ8A 2O01C 3GPAA 2G0IA 3K5PA 5FD1A 2XZWA 4F3OA 2G0CA 2DCLA 2QZ8A 1VK3A 1FKPA 4QYRA 4CQ1A 4DPTA 4PWWA 2Y1LB 2FY1A 1YWXA 5D78A 4ZP9A 1UVMA 3AB4B 3IO1A 3OXLA 3EVWA 2AJ4A 4QWAA 2ZUGA 2RKIB 3DLEB 3CCWA 4CLLA 2KJVA 3HSGA 4M94A 5K14A 1T7PA 3N79A 1F0XA 1WC3A 2HK2A 1XNQJ 5HQMA 1HMVA 3PO4A 5ETVA 2Z57B 1R3NA 1RYRA 4F25A 1FNOA 4NXNF 4IRCA 5KFBA 1YJWS 3VAFA 3RAQA 3JTPA 2PI4A 2XWXA 5T7LA 2ZJQQ 2LEBA 1H3DA 3V6HA 5LXRA 2WVCA 1RDRA 2CQ1A 1ITPA 4F8RA 1SL2A 4ECWA 1JJCB 4K4TA 3G6XA 2IA0A 1S1TB 3KLGB 3GQCA 3OT9A 2AGQA 2CQHA 2FHJD 4CTAA 4OI0A 2AJ2A 4MAKA 1CJUA 1S6QA 4Y2MA 1UETA 2F40A 1RAGB 2HFVA 4CLWA 2UP1A 3R9LA 1HQUA 3KLVA 3GJSB 4RW6B 1YRUA 2W2PP 2YH0A 2R7SA 3D67A 2UXBJ 1JJ2R 3D3CJ 3TVKA 2V9WA 4UZCA 2DB1A 2R7XA 5KT2A 3BR9A 3KG4A 1TAQA 2PMHA 1F5CA 2BQUA 4DL3A 2LU2A 4OZ0A 2DGUA 4CWBA 1JLAA 1CULA 1EQMA 3AHPA 1RCXB 3HI9A 2LFVA 1S77D 4CI0B 1NLKL 3GIRA 4DR6J 4L3NA 1UKUA 2JWNA 2KO1A 1S6PA 4H4MA 3PJXA 3R7BB 3CJ8A 4O44B 4Q7AA 4LFBF 4ED7A 1WKLA 2BJ9A 4DPXA 3LWMA 2ZHAA 4ECQA 4MKYA 2DXDA 3HM9A 3UR0A 5LT5A 2Z2ZA 4FYXB 5H1SV 2OPRB 2D3ZA 1N5TA 4O4GA 2HFOA 1PYSB 1CQMA 5F8GA 2V8GA 1Y00A 3BGLA 2PMWA 3BJYA 3HX9A 1TL3A 2HNZA 1TKZB 3HPOA 3HULA 2GGPA 1UTAA 1MWZA 2IMOA 4LF9J 4DEZA 5HP1A 4FPIA 3Q23A 2PGCA 4B3TF 3LP0A 1R8HA 3CNQP 2XMUA 2ILYA 3ET6A 5C7PA 3LP1A 1QUVA 5D8HB 3MMBA 1W2BR 4CH0S 1GH8A 3HHLC 2B8QA 4FNIA 5ETOA 4DR3J 3FMWA 2W9CB 4F0HA 2GJIA 3R27A 4KH0B 3BGUA 1FD2A 3KMSA 2ATCB 2O3DA 3HKZD 3IXQA 3J81j 3MURP 3HVRA 4NYOA 3I31A 4KFBB 1V6HA 4W98A 2GQ2A 2MKIA 1Y3KA 4U7UK 4D3GA 4CT8A 4F50A 2VPWB 4Z2XA 3MMJA 2LQ5A 2R7TA 2IVMA 3TAQA 3PJ9A 2BMBA 1B70B 4LQ9A 1S6OA 3MMCB 2J7KA 5KFLA 3VGTA 3TJAA 1RHMB 3MR5A 4U8VA 4CYUB 4NMXA 4KIAA 4L73A 2UV8A 2KDOA 1SQGA 5A8KB 5CYQB 4DF8A 2HKEA 4FYWB 2FJEB 2KI2A 1X4CA 4KGXB 1U1KA 4NA2A 3K5NA 4WFAQ 2MQPA 2A10A 4RJVA 1RSCA 5KFVA 4RW7A 3MM9B 4IOAQ 2QRRA 3LQVA 1AUSL 3DOMB 1IBMJ 1PBUA 1S7HA 1VBXA 4KHPJ 3G87A 4O3PA 2DGSA 4X4PA 1RAEB 5ETKA 3CD0A 4HLBA 2RRAA 5LMNF 3OSNA 1QSLA 3HCXA 3D6FB 2PT0A 5D6GA 1TR0A 2C3MA 4ZVTB 2DR9A 4F04B 3HHKA 1EKRA 3BGFA 3MXHP 3ILLA 2B4OA 2ADBA 3TVZA 1X0PA 1OO0B 3LPYA 4LR9A 3ENQA 2FJVA 4B9SA 4JI0J 4DSLA 4QCLA 4CH1A 3WZ0A 3D6MB 1T3OA 4DS4A 1HQ2A 5BR8J 2XS7A 1SUQA 1DLOB 5THWA 1HFEL 2D3OR 4KT0C 4DV0F 1IKXA 3OR2A 1X0FA 2VFSA 1HYSB 2HS3A 4QWBA 1B99A 5G4DA 4RX6A 2B51A 1G2EA 5SZTA 3K57A 4DL7A 4MK8A 4DV7J 4LMZA 4IFVB 3CJ4A 1I1GA 3MEDA 4EI2A 4WJBA 1T9YA 4ILMA 1PJ7A 4V19X 1DZ5A 4M95A 1WHVA 1U1NA 4DG1B 5E3AA 4MYUA 4ZOSA 3O44A 3K89A 3VALA 2V8HA 1K8AT 1OMSA 2XSJB 4TY9A 2ZD1A 3L9ZA 5GMDA 5ETPA 1NJIT 3A12A 3KG1A 3W65A 2KU7A 4HR2A 3OHAA 3CB4A 3PEHA 3AB2B 1WHXA 3D1OA 3M30B 3SDEB 2I8EA 4LF1A 1NZ8A 1FVSA 3ZNJ1 1UVNA 2FY8A 3Q89A 2YKAA 5B7WA 4JI2J 4M5DB 1TL1A 1NMEB 2FGCA 1CJTB 4KKOA 2GVDB 1ZAXA 1DFDA 1S1UB 4MK7A 4X4VA 4J9UE 4N76A 5B0GA 2M2BA 4TXSA 3NGUA 1LWCA 1OJ4A 2HK3A 4K4ZA 5F8HA 4B3RJ 4XPEA 1C1BB 4UOHA 3T6JA 2L48A 1KOHA 4BCAA 4DR4J 3GYXB 3KLEA 1H0HB 1M0SA 1H38A 4QZVB 2GHVC 4R5PA 1LFPA 1YBTA 2MKJA 3AJ1A 4OLOA 4B3SF 2ZH7A 5KOXA 4F3MA 4PXEA 1KOOA 3C6UA 4Q2LA 2E1MC 3DLGA 1FXLA 4B17A 3OFFA 1L3UA 4DZDA 3BQ1A 5DQIA 4DV5J 3HT0A 1Q1KA 3BKFA 2UVRA 3M05A 3PX4A 2ZBIA 2RAQA 3V6JA 3Q8PB 3J7ZT 1BQNA 3D3BJ 4Y2AA 1FO1A 4MTPA 1FTRA 3EZ5A 1V9OA 2CQCA 2VC0A 3QSIA 3BZQA 3FKBA 3CD7A 4KB7A 2V67A 1SC4B 4R8UB 4LFAJ 1KLMA 1VQOS 4AL7A 2EI5A 2ZH9A 3I87A 4IDKA 1HBOB 2XLKA 1HNIA 1NK5A 1Q5VA 1RAIB 4RW4B 2XY7A 2BR0A 3T1HF 4F0KA 1F3FA 4LRCA 4LRAA 1TV6A 1FD8A 1GX5A 3QO9B 3RG6A 2B6AA 1RAJA 1VQ9S 1OQ3A 3OFGA 1BMQB 1RI7A 1NEEA 4DSIA 1RU1A 5J1EB 1OS5A 1REVB 2ACMA 5CD4H 3CCMS 1EP4B 3T1AA 1HKAA 1RHQB 5LM7E 3RU0A 2AJ1A 2LLZA 2P9EA 3CIMA 2HW3A 4C11B 5SUHA 3DRXA 4LBPA 3J7A1 2UVUA 5KFRA 4XPCA 2XSFA 4P6QA 3GLJA 1AYEA 4LIWA 1RTJA 2KHCA 3RUBL 1X4AA 2M0GB 3LP2B 1N32F 1VQPS 2HRYA 1VLYA 4O3SA 2HBRB 3IM9A 4U7UD 1KEKA 2CQDA 4PXBA 1WEZA 2IBKA 4FXDA 2XGPA 1IKVA 2L9DA 5EWGA 3VZIA 2W7OA 2UXDF 1TQLA 4JV2A 4C8YA 1APSA 4EBCA 2D9OA 1GXTA 3QATA 2CVEA 2FHJA 1LV5A 3IGVA 5ETNA 2J0QD 4GRSA 4DMZA 3UD4P 3KJVB 3UCZP 3JSMA 1FX2A 1G3OA 3R6GB 4PCQA 3CGIA 2AX0A 2B3TB 4O3RA 1MROB 2LEAA 1ZS6A 1UFKA 3TX0A 3S8SA 3ZZZA 2GFFA 4OYAA 3TUJC 3M1VA 3GTYX 1M1HA 2QC3A 2WVBA 3DI6A 2DNLA 2H1YA 4EU0A 3I96A 3JYTB 2PEHA 4WCEQ 1N0VC 2YNGB 2C3PA 2OPSA 2VL1A 4OI2A 2M70A 3KK2B 2DHHA 3UW1A 2KM8B 4XAKA 4RL1A 2OAUA 2J7UA 1TU0B 1T94A 4FPRA 1M5HA 3EWGA 3V4MA 5F8NA 1NXIA 2IRYA 3EJMA 1EJ7L 3ELHA 1CJKB 1MSWD 1FJGF 2PN6A 3ZC4A 1YZ7A 3L7OA 4DL4A 1SQFA 3W3SA 2WSEC 3RRKA 3PFOA 1UA1A 1HWKA 3M8PB 4EBDA 5DDQC 4YQWA 3W60A 2M5YA 1MMLA 4J9LA 3ZZRA 3I4PA 1GK8A 2G1DA 2XMVA 3KG0A 4GO5X 1EQ0A 3DHXA 3LW5C 4K4UA 3PRDA 5AT1B 3KK3B 4WP9A 4NA1A 2HBZB 3PNIA 4JV0A 3DM2B 3GV5B 1OWXA 1Y5IB 3IG1A 3CW2C 2QLFB 4QU7A 2MQQA 4DI6A 1Y4ZB 4ED8A 4ZVGA 2V4RA 1U6BA 2LDYA 2UVWA 1I51B 2Z30B 2W9BA 3AAWB 2XYGB 2BEFA 4ANCA 4C7QA 2OPPA 2WONA 3RRGA 1QAXA 1HLWA 3BSNA 3MOJB 1BC6A 1KQKA 2M7SA 2NXJA 2Q79A 4ZCIA 4L3KA 1W7WA 4KE5A 3CE8A 3AH6A 1LWXA 3M8WA 2CWXA 3OLBA 1HBUB 3TYTA 1HHQA 2JEFA 3TP2A 2ZZMA 3HFKA 2BW2A 3DLJA 3OTCA 3DLEA 2ZBCA 1M5SA 3UCGA 2B0GA 3MWBA 1YLXA 2AYGA 4IKAA 3D28A 4PR6A 3OUYA 4DPWA 3MTJA 4HHJA 3T41A 3RB0A 4JI7J 2NUUG 3G8QA 2KG0A 2YWHA 3NGKA 1FFSB 3A3PB 1HL6A 2KYZA 4LSZB 3BKUA 2X1GA 1NPKA 3BN4A 7FD1A 1ULRA 2AX1A
chains in the Genus database with same CATH topology
3I55S 2YKNB 1XWLA 4HDHA 3VTIA 3PEJA 2HHUA 1O5JA 4I2QA 1JLBB 1N4LA 2CYYA 2VD3A 1VQ4S 4XDDA 4F4ZA 2WK4A 3MD3A 4JI4F 3QAUA 1FKOB 3JTOA 2N7CA 1R27B 5KFTA 1ZM3A 5AXKA 2WSFC 2ZD1B 2CRLA 4P7TA 2UZAA 1X5PA 4K4WA 2YNIA 5DG8A 4B9NA 1MMNA 2NQPA 1X4DA 1LW0B 1AUDA 1E6YB 5E2QA 1A9NB 1J5OB 5J2PA 2FHMA 1S1TA 2C2EA 5E41A 4C8OA 5T41A 2UVVA 3Q8QB 3H98A 4I67A 5HMXA 2HNDB 2OPQB 3PR4A 1JK9B 3QJJA 2QIFA 2GNKA 3RAMA 1VBZA 1NJXA 2QSWA 3HHLA 3GIJA 2GIQA 4YB1P 2XCAA 5JUMA 2MZTA 3KLHB 2HRUA 2CPXA 2HHQA 1WWHA 1L3TA 1M1KT 1RGVA 2J9DE 4A8YA 3I0RA 3MM5A 1CLFA 5DQGA 3PX0A 4DS5A 2J5AA 2DR7A 5J2NB 2HHPA 2YQ3A 3OTOF 4NMLA 4AL5A 1LK7A 4TU7A 2EFQA 4H4KA 4LSNA 2K3IA 1TL1B 1KQSR 3S01A 5HROB 1HI0P 2R2UA 4LUBA 2FVPA 4RW6A 3QIPA 4JBCA 3TQ1A 2Q3PA 4Q43A 1Q78A 2VBXA 2DISA 4FN5A 2NS1B 2Z2MA 4KKOB 3M2VB 1HW9A 1TK8A 3WC0A 2EBEA 5L39A 6FD1A 3CSKA 4QWEA 3K58A 1XEZA 4KGMA 1HWLA 5M2RA 2AQ4A 3MMAB 2A3JA 3FQLA 2E7WA 5AE3A 1LWCB 2C42A 2RRNA 3LANA 2I38A 3DLKB 4C4WA 4EZ9A 1FE0A 2Z0GA 4DPOA 3HKWA 2F8EX 2DNHA 5EWFA 2FHKA 1RISA 2RU9A 4YB6A 3GILA 4BDPA 3F56A 1TKTB 2ZE2B 2W8KA 1WELA 5L1LA 4NLWA 4WK1A 3BSOA 4V19J 4Y2KA 1N0UA 4N41A 3B78A 2QLWA 2GJ2A 5CHCB 4F67A 1S1WA 2B9XA 4EBEA 1CSJA 2ZOFA 3R5AA 3M8SA 2DVIA 5AE2A 1S1VB 2OTLS 3MM6B 5KG5A 2H9ZA 2ZKTA 3DXSX 4GC7A 1HI8A 3J80Y 4U9RA 4DQPA 5JJBA 1R43A 3MFHA 1VOMA 3M2RB 5L9NA 3T19A 4YFUA 4LQ3A 2EWHA 2RVJA 3KLIA 4O3OA 3W2VA 4CNZA 4YHHF 2DNQA 4I7FB 3R5DA 4BWMA 1OSCA 1CC8A 3BO4A 1S9EB 4R5PB 5I42B 5KG7A 2HMIB 1LWEA 4IRDA 4B3OB 3GB0A 4USJC 1M5VC 1X5TA 4OIXA 5F8JA 1YRTA 5DS7A 1IXKA 2YKQA 4K2XA 4NX9A 2HGNA 2MQNA 2ALZA 2EPIA 2NZ4A 1QE1A 5HBMA 1D0EA 3V6DA 3C6UB 1N6QA 5LJ5Y 1XNRF 3DLGB 2CQBA 4C3LA 4C0HA 3K7RA 4O44A 2QT7A 3HVTA 2A18A 2BYCA 5D4LA 1RQ0A 2Y0SD 4KHMA 5KFJA 1P1LA 2KYXA 1KTVA 3KK1B 3MEEB 2BE2B 3K8WA 2DIUA 1SH0A 4Y0FA 1RWUA 2UUBF 2X1BA 2ZH6A 1D1UA 3CDBA 4FS1A 2JC1A 2ROGA 3MEKA 3ZZTA 1M90T 3ENVA 3PW5A 1E6VA 4DWIA 1BQNB 3M6VA 2QV6A 3HVWA 2DNKA 2OP5A 2OPRA 2QMWA 3N9UC 2JRSA 3M6UA 2DNRA 1T8EA 2MYFA 2NYIA 3LH2S 3N5FA 1JLEA 3MUMP 3TI0A 1UEUA 3C3LA 1C2PA 3QIDA 2RQKA 1D8YA 1DQ9A 2E66A 1WI8A 3FQKA 2J9CA 3OQ2A 5KFKA 5GADU 3OFEA 3QGGA 2ERRA 2BOPA 3E01A 1XMQF 2B9YA 1JKHA 1HQEA 3GFXA 4RNHA 1X9MA 2OTJS 1JJHA 1KLMB 2VPXB 4YP3A 3H5YA 3IS9B 1CPZA 1TKZA 4HEA9 4NLSA 2X51A 1ZH5A 2PA3A 3QWPA 4GMKA 2DO4A 2FGOA 2DNNA 4IDKB 4OZJA 2AP6A 2KKHA 3ISNC 1FK9A 3B4MA 3MPWA 1HYSA 1NU4A 1HR0F 2DRBA 2IJNA 4J9OA 1TKXA 1KD1T 2G9OA 4MYTA 3BDEA 4IR9A 3G6ES 2BZ2A 3NAIA 1D9FA 4OJGA 3VZHA 3O8WA 5KT6A 1VFJA 3EX7B 2VG6A 1M5KC 4ZPVR 5C25A 4EZ6A 1FRXA 2RF2B 1HWIA 5BYQA 4Y3CA 1KHVA 3TA2A 1HBMB 3RW7A 5J2MB 3NGDA 4L6V3 4PQUB 4ZDNA 1ZPVA 1LOUA 3DOKB 3VQSA 2EFGA 5KFDA 5KG4A 2R4FA 2XI3A 5K8MA 2RS2A 3B82A 2ZH1A 5IT9Y 5K5MA 4ED0A 3I9V9 4FS2A 1FXDA 2ZHBA 1DTQB 3G96A 1Y0HA 1IKWB 2Z2LA 1FTCA 2WAQD 2DCUB 5LSOA 2W9CA 4A8OA 5J2QB 1URNA 2JZ5A 2BANB 3CJ3A 5B0FA 3HLUA 4H4OB 2D9PA 1BY9A 2ZOGA 3QWUA 1KONA 3MUTP 2MY8A 1WF2A 2DH7A 4O4RA 1QY7A 3IRWP 1HBNA 4L72B 3PIPQ 3IWNC 3Q8SB 3GV8B 3CJ2A 1NHUA 5F8MA 4LF8F 4DSFA 1KHWA 1S49A 2VQFF 1EETA 4DSKA 2QE5A 2XG8A 3HZGA 2EK1A 3OSPA 2Y1RI 3MECB 3PHEA 4KFBA 3M8QA 4O4GB 4DBQA 3ICLA 1MMDA 5K8OA 3BO2A 2AF6A 4K4XA 4DV4F 3UD3P 1B0PA 3FRYA 2QMXA 5FDLA 4F4XA 1VIXA 3DXBA 2W4CA 3P96A 1YJVA 2CQ3A 4CIOA 2DNYA 3MPYA 2XBPA 3OV7A 1BWEA 5T14A 5KG3A 3CCVS 4DFJA 3FMBA 2MKHA 2ROPA 2CZ4A 1TVRB 1TL3B 4Y6IA 4DL5A 3T9ZA 1RTJB 2Z4PA 4Y28C 2F3JA 1L5UA 4QIFA 3M32B 1B0VA 4I1TA 5A8RA 2WRMA 3E3XA 1C0UB 3US5A 3NCQA 2EW9A 3CDWA 4HTJA 2L9NA 4OZ5A 3MMCA 3BSAA 5F8IA 3I32A 1VQLS 4OZ1A 3BGRA 3OTEA 1NB7A 2RSQA 2PIIA 1PGZA 3DLLQ 1KTQA 3VR1A 1RT6B 2BUNA 4RWWA 2IMWP 1RTIA 3FRZA 3K5LA 2MHNA 2AJQA 2POKA 1IKVB 2DHAA 1T3NA 1LXNA 3TX8A 2B4PA 3PR5B 1DARA 4WTYA 4NLVA 2MQOA 1K1SA 3DU6A 2MGZA 4ECUA 2XY5A 2PD1A 1U1LA 2HHHF 2HNYA 1Q7YT 3MMBB 4X62F 4HTIA 4NLXA 1QVGR 3M6WA 4A8QA 4WE1B 2V9KA 2RS8A 3SEOA 1H7WA 4O23A 3THPA 5A8KA 5CYQA 2FJAB 3MI7X 1AFJA 1S1XB 2AV5A 4WKRA 4YMEA 2HWHA 3PW0A 5KFCA 2E9ZA 5A6PA 2YNHB 4O3NA 4X4OA 1AW0A 1Q4RA 4QJVA 2LXUA 4DX8H 5FIIA 5AXLA 5DDOC 1FJEB 1K1QA 4IQXA 1FJCA 2MMYA 4ICLA 2XEXA 2LCWA 4NRUA 4OHYA 3G8TA 3CCRS 3E51A 2ASYA 1P8GA 1Z4UA 2L08A 3HMJG 2ZJPQ 3VWSA 2DHSA 4KTQA 5E3PA 1LWFB 2DGQA 1N5VA 3K5OA 1S9GB 3CMES 4KV8A 2IC3B 3D5MA 5AJ3F 3D2WA 1MW7A 2J6SA 2HVIA 4PQAA 2W7PA 3LUYA 4ECTA 2IAJA 2XMKA 4RW9A 3MM9A 4NLUA 1VQYA 1IBLF 2AYBA 3PW2A 1D8ZA 3HXMA 3PW4A 3FVYA 5U47A 3DOMA 5EDWA 4NCGB 1QAJA 3PDNA 3M1VB 2GHWA 2J9DA 4I6WA 3TANA 2RIJA 2V4QA 4QIVA 3OXFA 3CDEA 1NK7A 3DI6B 4G1QB 4Q2MA 4X2BA 2XMJA 4FF3A 3HO1A 3V4IB 3SI8A 4N8OA 3QJLA 5KFWA 4JYAF 2DGWA 4MK9A 5F3TA 3ISND 4RUHA 4YR2A 2JFDA 2ROEA 5D77A 5D3GB 2FVQA 2KN4A 3PY8A 3SQGB 4TYBA 2DITA 5GAHU 2EFNA 2VOOA 2PFFB 3RRHA 4K0KF 1SJRA 1FE4A 5DJBA 3N6LA 3G71S 4PG7A 4N5SA 1I6JA 5D4PA 3DRPA 1D3WA 3KYLA 2NUHA 2FLOA 3QJPA 2KH9A 3EXCX 3GYNA 1FDAA 4WU3A 1CC7A 5ITHA 5FLXY 2RJZA 2XULA 1C1CB 3NP5A 4CO5A 4IRKA 4DSJA 2R2SA 4ECYA 1H2VZ 4ILRA 3R5CA 3MEGA 4D3HA 2XI2A 4XIUA 3DFEA 3DN9A 1T05B 4ZMMA 5K8PA 3OTDA 1MU2A 3VAHA 1ZZNA 4OFZA 2VG7B 3SFGA 2RU3A 1FDNA 2DPJA 1ZETA 3H20A 2LECA 5GVQA 2HFZA 3DNCA 3M6XA 4C0OC 4NCAA 3K59A 1SKSA 1CVJA 1DLOA 4CO0A 2JLEA 1GTHA 4RNMA 1R6YA 2XO7A 3JSRA 4I69A 3B4DA 4U7CA 2FVSA 2L3MA 5KT4A 2LDIA 3OJSA 1Y3JA 5B0EA 4XDCA 3EUNA 5I4MA 2R8KA 4N56A 2EC0A 4AE5A 1JLGA 5KT3A 2ZC3A 1RKIA 2MDAA 3GR0A 3KKFA 4Y2CA 3OVAA 4JI7F 1O8BA 3E2EA 1JNRB 3CUNA 2ZFHA 3TAMB 4DQQA 3DRRA 2R2RA 2LQBA 1WI6A 2KHDA 3IRXA 3OPKA 4ZKAA 3Q22A 4KO0B 1RT5A 1S4FA 3FZ2A 4JUZA 2NPFA 3NKYA 3FDSA 4O0IA 1NKEA 1H2UX 1XR6A 5KFYA 4X4UA 3V2UC 2IRXA 4IG3A 2XCPA 2GHPA 4IOBA 3VAIA 4DUZF 3CT9A 4E8UA 2VA3A 2KVIA 2VA2A 4I2PB 2V8VA 2DTJA 1TFYA 5HN0A 1RTDA 2YTCA 3CIZA 5E33A 3H25A 1Q82T 1K0VA 3MPVA 2MKKA 3DMJB 4ZCKA 4ECRA 2YX1A 3D1HA 3PW7A 2L41A 3H2UB 5C24B 2HLUA 3CJKB 4IFVA 1WF0A 3UI3A 3KNGA 4B9VA 4X4NA 4RUAA 5DDRC 3E8OA 2YWGA 3QZ7A 2XMWA 1S6UA 4X4QA 1BQMA 1FRJA 2GV1A 4H54A 3IBWA 4BC9A 5M2UA 2IVYA 4QW9A 1XNQF 2JVRA 3OTBA 4BS2A 3HHDA 5KTQA 4OI3A 3H59A 2D74B 2F4VF 2XC9A 4DOZA 1DBDA 4CZCA 2RMLA 2B43A 4DG1A 4NWBA 1F60B 3TUZC 5JVHQ 3DOLB 4FVCA 4IG0B 4A8XA 2PI5A 2AGPA 4YY3F 2OJ3A 2FD2A 3KFWX 1ZTWA 2FVRA 3DDNA 1QJHA 4MFBA 4TNOA 1G6BA 1S0VA 4C8ZA 1YJUA 1Z2ZA 4HKQA 2DGXA 3IC1A 5BJRA 2KG1A 3GR1A 1R8BA 3U1MA 3GZ7A 4OMFG 1J5EF 2OFGX 3T5LA 4F2RA 1RT2B 1SKWA 3MR6A 1NJYA 3BEGB 4FZVA 4QR1A 5KFAA 1XTZA 1HNWF 4UY85 2B4VA 3IG1B 4NLYA 2FTRA 5F41A 2AGOA 3SFUA 5DM6Q 1IUJA 1TAUA 1KSPA 2HAIA 1X5SA 4PG8A 3PM9A 1Q53A 1T03B 2CJBA 4DR1F 4B9TA 4ELVA 4TLRA 2JDJA 3CCQS 4IFYA 2D41A 2HQIA 2YNFB 3LALA 4YUDA 4N47A 1F9FA 4DN9A 4DL6A 2BV3A 1TK0A 2DPIA 2FLLA 5CXTA 1URRA 2VKRA 3QYYA 2K3KA 3Q2SC 3DCAA 4LSLA 3UPFA 5CQGA 1JXEA 2P9CA 2SXLA 2E5HA 3RB3A 2OD4A 2JLFA 3GG0A 1OQ6A 3L09A 2W9BB 3RR8A 3EGZA 4ES3A 2BRKA 2Q43A 3QPIA 3HP6A 5KOWA 4ED6A 1YTYA 4C8KA 4RBTA 1JB0C 1RT4B 2P5VA 1PILA 2RQ4A 3M30A 3ITHB 3SDEA 1LQ9A 2XLJA 3MHYA 1YJTA 3HK2A 3C6TB 2OPPB 2WONB 3CVKA 3D54A 2GMJA 2XLIA 1Q79A 2WB1D 3QZ8A 3CCUS 1ZAWA 2K2PA 2IJFA 4TKTA 5G0RB 4R0JA 1R0AB 1KVIA 2O01C 1IKYB 1C0TB 2KJWA 3QLHB 5CYJA 3K5PA 4MIWA 5FD1A 2BJEA 1FJ7A 1JXLA 4TQRA 3ULHA 2I1RA 1S76D 4M5DA 2XZWA 4F3OA 2R7VA 2G0CA 2DCLA 2J7WA 1WHYA 2QZ8A 4ZLPA 2DD8S 1KNZA 1VK3A 2V4JA 1FKPA 4QYRA 1JLBA 3DRSA 3S1TA 4DLEA 3P49B 4CQ1A 4ZP6A 4JI8F 4ZPWR 4EEYA 4FBTA 1IJFB 2EVZA 2KXFA 2FY1A 1YWXA 1RTHA 1S1UA 5D78A 2R7QA 2R8IA 3POTB 3GSDA 2VFRA 4ZP9A 1UVMA 4UQTA 3AB4B 3IO1A 2JJ4D 1XK8A 4QIWD 3OXLA 4ZVHA 4OX9F 3PXGa 4EFAC 2MZ1A 3GV7B 4CO3A 5EX0A 5KG2A 4PUOA 1JLFB 2AJ4A 4QWAA 3UE2A 5L38A 1HW8A 5E7OB 1U8SA 2WSCC 3TA1A 2ZUGA 2ASJA 2RKIB 2OPQA 3DLEB 3CCWA 3KOAA 2CFXA 4DSEA 1ROFA 2KJVA 1C1BA 2C28A 1IQZA 5BYRA 4M94A 5K14A 1T7PA 1SJ1A 2F1FA 3RZAA 3V5RA 1YI2S 3N79A 2E1CA 1F0XA 4ID5B 2YH1A 1O0PA 3CJ0A 4C3MA 4C8LA 5DG9A 3I0SB 3IWXA 4ATNA 1X4BA 1HMVA 3WBZA 3PO4A 2AWZA 2LXFA 2F9JA 2OO4A 4KGKA 3WX4A 1DAXA 1Q8IA 1R3NA 2JEJA 1RYRA 4JI3F 4F25A 2IA6A 2B9WA 1RA6A 4WU2A 1FNOA 3GG1A 4TY8B 4NXNF 2R2TA 1PC4A 2VPZB 3MR2A 3EXYA 4IRCA 4W90B 2VONA 4OHVA 5KT7A 2HLTA 1JLCB 3MM8A 4IH6A 1DQAA 4DL0C 1GXUA 3THTA 3FJ2A 5KFBA 4ED2A 1D9DA 2IBOA 3D0GE 1YJWS 3VAFA 2ASDA 2PMZD 4I0WA 1HWJA 3FSXA 2ZVSA 3RAQA 3JTPA 1HPZB 2PI4A 3MTKA 4KAIA 1TUVA 1X5OA 2VQEF 2XWXA 2I0XA 3FSIA 5T7LA 1N52B 2ZJQQ 2DNZA 2LEBA 5KFZA 5FJ4A 1Q7LB 1N5YB 1H3DA 3V6HA 4ILLA 4PWDA 5LXRA 3ISZA 2CPZA 4DFMA 4FXWA 3CMAS 1RDRA 1K73T 3RB6A 2WOMA 4I2QB 4K5RA 3TUIC 1FEHA 4OLPA 3BN7A 2B56A 2CQ1A 2VOPA 1O51A 4G1PA 3DHWC 4F8RA 3VQTA 3FGVA 3MM6A 3OFHA 1KVJA 2KFNA 4QW8A 1SL2A 2K8GA 4ECWA 4WZQA 4QYZJ 2YNIB 3OR1A 4QIEA 4JI5F 4F2SA 4K4TA 4I7FA 3G6XA 1J2VA 2J0XA 5DETA 2FJDB 5ADZA 4LF6F 3SV4A 1UFWA 2B7BB 5J2PB 2IA0A 5CH7B 4FYDA 1S1TB 3KLGB 2AJFE 3I5AA 3GQCA