4DR3J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr3J00
2ZM6J 5LMNJ 1XNRJ 4B3RJ 2UXDJ 5IT9U 2MQ8A 4JI8J 3OTOJ 4KHPJ 1XNQJ 1XMQJ 4DV2J 4DV3J 4JI2J 4DR4J 4DV1J 5IWAJ 4B3TJ 1HNXJ 3R2DJ 4LF9J 5A2QU 1HR0J 1N36J 4DV7J 1HNZJ 1N34J 4DUYJ 2F4VJ 5FLXU 2UUAJ 1N33J 4YY3J 2VQFJ 1XMOJ 4V1Ak 2UUBJ 5BR8J 4OX9J 4JI5J 1J5EJ 4B3MJ 4JI0J 5AJ3J 2MEWA 2HHHJ 4DUZJ 4DR7J 3J81U 1IBKJ 4K0KJ 4DR2J 4LF8J 3T1HJ 4NXNJ 4DV6J 5LM7E 4JI6J 4LF7J 1I94J 4LF5J 4JYAJ 4DV4J 2UU9J 4DR5J 4JI3J 2KL8A 4LFBJ 4LF6J 4GKKJ 1HNWJ 4KYZA 2KVQE 4JI4J 4GKJJ 4RJVA 3J7AN 4X62J 4JI1J 4YHHJ 1IBMJ 4JV5J 2UUCJ 4X66J 4LFCJ 1IBLJ 4HHUA 3D3CJ 2MTLA 3W1YC 3D3BJ 1N32J 4PWWA 1FJGJ 4KY3A 3IMQJ 4JI7J 3JAMU 3J80U 4X64J 4DV5J 5LMUJ 4LF4J 4LFAJ 4DV0J 2UXBJ 4AQYJ 4DR3J 4NEZA 4DR1J 3T1YJ 2VQEJ 4NEYA 4B3SJ 4DR6J 2E5LJ 4X65J 3R2CJ 2UXCJ 4NXMJ
chains in the Genus database with same CATH superfamily
2DY1A 1IBKF 1GQEA 3BYRA 3TOQA 3UDCA 4QR1A 3ADAC 2W4CA 4JI2J 3FEYB 4BC9A 2V94A 4NYOA 2DNHA 4QJVA 5D0EA 5GMKa 3CD5A 4JV0A 5EUHA 1ROFA 1F5BA 3W65A 1HMVA 1KR4A 2VC1A 3QSYB 1VBXA 1HI0P 1F9EB 3MDFA 1LW0A 3EPIA 4B9MA 1Y0HA 4K4VA 5CYJA 4HYKA 1W25A 2YWWA 2HNYB 2VKZG 3BBCA 1NJIT 1UFLA 3KJFB 2XZTB 3QT5A 4ERDA 2VG6B 1TMMA 2ATCB 2CWKA 4ELUA 3G6XA 3J7YI 4C3MA 3PFOA 3OLBA 3CVKA 3MTJA 3QZ8A 4DQIA 3QJPA 2V4JA 3A3OB 2ZH4A 1S79A 2VDHA 1WWHA 5E3RA 3QPIA 2B9XA 2BOPA 2DNOA 5IXUA 2GFFA 2KH9A 3W2VA 1KOOA 4NA2A 4UQGA 1RK8A 2XMTA 4ZITA 1RQ0A 1VBKA 4C48A 1XMOJ 2FHJA 5KG5A 4DF8A 2LXFA 1J5EJ 4F3QA 3SQGB 3PHTA 1JKHA 1VOMA 1Q7YT 5HVHA 3V6JA 1FVSA 1H2VZ 1VRUA 2RAQA 2KFNA 2ZJRQ 2HKEA 1X9MA 3BKUA 1NK0A 3T19A 2YX4A 1GXTA 2GAHC 1FWPA 5KT6A 2X3GA 3DHWC 5KFKA 2YNIB 2PFDA 2CG8A 1JLEA 1IQTA 5KG4A 3UCZP 4QIWD 4LF4J 4YUDA 1S4EA 4CYUA 3DOKA 3I4PA 3PYEA 5A8KB 5B0BA 2DR7A 2BUNA 4ELTA 3EGZA 2MQOA 2HFSA 4FKYA 1JWWA 3QJJA 4AXJA 4G6VB 3QGPA 1UVMA 4PAAA 3OVBA 5DZ7A 5EHHA 5LXRA 4NLTA 1OY8A 4AL6A 1JLBA 3FC9A 4J9KA 2I38A 1N6QB 3N6NA 1TL7B 1U02A 2Q79A 4P7TA 4X4NA 3DNCA 3W9HA 2J6TA 3HHNB 4JI5J 3UI3A 3POTB 5HI7A 4DR7J 2DRDA 1JB0C 1SUQA 4DFPA 2IA6A 3HCXA 1EKSA 1HWLA 3S1TA 3U27A 4YB6A 4JI3J 3GV8B 2WONB 3CF5Q 2DXFA 4YDDB 1QDUB 4LUBA 2YKNA 4I7FB 2QE5A 1N5YA 4B9UA 2V8GA 1YLXA 4DR1J 3MZIA 3GB0A 1RAEB 1RT5B 2VFRA 1CJTB 2N7CA 2CQGA 2HVDA 3R5JB 4Q2MA 2LQ5A 3HZGA 4U95A 4N8NA 1FKOA 4X62F 2RUGA 3IR7B 4ZJOA 2KZZA 4RU9A 1ZETA 1ZBTA 4WF9Q 4F36A 1SH3A 2QMXA 3K5MA 4RX6A 1WF2A 4NLGA 3BN7A 3G96A 1KRPA 5LL6d 1NKBA 1V6HA 3DXBA 3G2XA 4MH8A 2GZOA 4Q5VA 2KFZA 2KDOA 2PT0A 4ZN1A 1S6QB 1FKPA 2HQGA 4JI1J 2BRLA 3V4IB 4FXDA 3OXLA 4GMKA 3ZO7A 1N34F 5IC4B 1XR7A 3FEZA 2VG7B 1I5OB 5AE2A 2CJAA 5I42A 4I6WA 1XJWB 3S8SA 2GVDA 2RMLA 3VF0B 4CT9A 2FDNA 4Q8FA 1RJJA 2AJ1A 2AU0A 3F41A 4OIXA 2UUBF 3ZZPA 1N0UA 1D9FA 4DPXA 3SFUA 3LP2A 5L46A 1VLYA 1FCAA 1CVJA 4LSLB 3BO4A 1Y5LB 4JI6F 5BYRA 1U1LA 4UUXA 3TX8A 5IOLA 1IKWA 3MCMA 2V2KA 1HNWF 4F0MA 3MR2A 1SIZA 3SCIE 2VF3A 1GXUA 3IM9A 1NCLA 4Y34A 3FNNA 2AJQA 4DR4F 4DXLA 4IH5A 3QYYA 3HHLC 2W2QP 4WBFA 1H0HB 1KSPA 1T95A 3AH6A 2W9BA 4PCQA 3ZZTA 4DS4A 1O51A 1ZH5A 1B7FA 3DHXA 2CG4A 1EQ0A 1VQMS 3I0SA 1CQNA 3M8YA 1TL3A 3VCDA 3MECA 5KT5A 1U1MA 1RDRA 1XC9A 2MKIA 3PX4A 3VAIA 4PXDA 2HQIA 3VQTA 3ET6B 1YRUA 4DPWA 5C7PA 1IKXA 2WVCA 2O1PA 2MKCA 2GMLA 1OQ6A 3C14A 4ED0A 1U8SA 3M8QA 3MCNA 2EPIA 1KLNA 5GVQA 3FRZA 4CTAB 5DG7A 3PKMA 4WK3A 5T7LA 1DZ5A 4OYBA 4ZIVA 4DL2A 1F2GA 1RHUB 1H74A 1HNIB 2KJWA 1ZPVA 4GKJJ 1JLEB 2M8DB 3ZZYA 2DHGA 4GO7X 3K0JA 2GX8A 3QATA 2F40A 3MGJA 3RRKA 7AT1B 1WTFA 4EU0A 1RB0A 3TR5A 3DM2B 1X4BA 4X64J 2P5VA 5MLCV 3KTQA 2HBQB 2WAQD 5EX0A 3T1YJ 1IJEB 2VQEJ 2XG8A 4AT1B 3CCUS 4ZVQB 5AXLA 3PW5A 2IBOA 4WKYA 4MKVA 2EFPA 3M30A 1AXQA 3NS6A 3CD7A 3JSBA 2VG5A 5K5MA 5K8PA 1UA0A 2ZOGA 2W2OP 1VQ8S 2DGOA 4NXNF 1U1RA 4RNNA 5KG7A 2DXEA 2OPSB 3C6UA 3MUVP 2MKHA 4OV6A 4K4SA 4M1KA 3KLGA 3KK3A 1VHIA 3MEEA 1PC4A 4C8LA 2E1MC 5LSLA 2V63A 1RT7A 2AKWB 2XSFA 4LQ3A 2FGOA 1LWFA 4OYAA 2RQ4A 2IRYA 2UUCJ 2J8SA 4URQU 1PKUA 4OQJA 3D3CJ 3JTNA 3ETMA 4NLYA 5J2NA 1OSDA 3IG1A 1RTJA 3H42A 4FXVA 3OHAA 1PBAA 5KFYA 2BE9B 3W61A 1JLFA 2P6TA 3JSMB 4PEOA 4NXMJ 4LR8A 2Y1IA 1AZSB 5E3AA 3T1HF 2JX2A 1JXVA 4ZLLA 2W2MP 2RQCA 4DSIA 4K4WA 4LF9J 1QAXA 3OJSA 1ZA2B 3PX6A 4HH0A 2EFVA 4FF3A 5AJ3J 3KHGA 4J9LA 1E6VB 3UPFA 4HT5A 1DTQB 1IBCB 3HHLB 1IBMF 3OR1A 5LM7E 4RW9B 1L5UA 2BR0A 1UWBB 2BKPA 1CJKB 4H4OA 5FDLA 3C19A 2JHEA 3I0RA 1EETA 3BPSP 4JI4J 3ILIA 3CT9A 2A2DA 1T05A 3KHLA 3ONQA 4O4GA 2YNHA 4ID8A 2F63A 2UUTA 4W98A 2RILA 3X1LB 3E3XA 4UY85 2IM2A 5HVGA 4L73A 5JJBA 2YKMA 2NR0A 2XLIA 4RBVA 1KVIA 2CVIA 4NA1A 3TAPA 4L74A 1EQMA 1FDNA 5K20B 4ENOA 1LWEA 4FYDA 3ZZOA 2AYBA 1BXNA 2R2TA 2FHOB 2QEXS 1HW8A 2C2MB 3HT0A 5C42A 3BGLA 2ZH9A 1KC8T 2MMYA 5CD4H 2Z2YB 3KNGA 1UVKA 3LW5C 3V6KA 3U7JA 4PWDB 5CYQA 3ILLA 4BHQA 3E51A 3ZTQA 2V8PA 4F2RA 2IYIA 3W1YC 1WG4A 2NSBA 3H25A 2DYAA 3FFIA 1MU2A 5DETA 3PFEA 4OJGA 4U67Q 3GJRB 3CWJA 4RU2A 3GONA 2R42A 1NLKL 2C2EA 2LQBA 3BSAA 3DDKA 4NEYA 2HBRB 3PM9A 2A6OA 1VIXA 2HHPA 1HBNA 1C0TB 4C97A 2IC3A 4J9QA 2IM0A 3GJTB 2DR5A 2DISA 2EG1A 3GCWP 3MEDB 1VR6A 4KT0C 2BDPA 2ZH8A 4G1QA 4DV7J 3TZWA 1C0UA 3TVYA 2D7SA 4OHWA 1WI8A 3VTIA 4UY8T 4Z37A 1FO1A 1S5ZA 4YEAA 1G7CB 1FJEB 3Q8PB 1SC4B 2OMLA 4K8RA 4DR2J 1X7VA 4A47A 5J2QB 1SC6A 4CLYA 2ROEA 3MPYA 3W7BA 2IAJB 3EGVA 2B5JA 5A8WB 3AQPA 3JQJA 4IYQA 4LT6A 3RRGA 3DDIA 2IVYA 3TVZA 4EWTA 2BRKA 3V6DA 1HBUA 3CDBA 2GVZA 2IPOB 2CPEA 4DL0C 3CJKA 1WJ9A 2FHJD 1N5SA 3PRDA 4RPFA 2DGXA 3FK4A 4G1PA 1D09B 3QRQA 3SBMA 4F67A 2FLLA 5CYMA 4DR5F 2FPHX 2Z2MA 2FVPA 1H6KX 5HMWA 1HR0J 2KZMA 5ETPA 5D4LA 1U0HB 3VGSA 3EMTA 4M5LA 1LW2A 3KLHA 3QZ7A 4I56A 4RWWA 2MQLA 1GFWB 2PMWA 2ZD1B 2W1BA 1PILA 3HKZD 4X65F 3G6ES 3I5BA 1YJRA 2L48A 2WRMA 3LF0A 3D1HA 1TVRA 4ILMA 3VWSA 2V9KA 3R1LA 2HHWA 4P75A 2BXJA 4O3SA 2F3JA 3T3FA 1PO6A 2IMOA 4KHMA 1WKJA 4XO0A 3IN5A 4DV5J 3UDEA 1U1QA 1R0AB 1K73T 1FRXA 4I2PA 1X9SA 2CPYA 4DR3J 3MFHA 4NLXA 3NNAA 2BE2B 3MPVA 2J0WA 4B3OB 1KQGB 2OIHA 2E5HA 1YBTA 4P71A 2HWIA 3QT6A 4Q7AA 2UVWA 5D6GA 3GIMA 3ENAA 3H8YA 1F3VA 4P6QA 4MT1A 4NCGB 4WYLA 3LAKA 4NL5A 2EFNA 5J2PB 2GGPA 1BGXT 2B8QA 3RG6A 2R7OA 4Y2AA 5KOWA 2AGOA 1VK3A 2X1BA 3M1VB 2QZ8A 5AE1A 5EWGA 1B70B 1WOPA 3R97A 2DKOB 2F5GA 5ETQA 1N56A 4KGKA 1CLFA 3O3LA 5I3UA 4IQXA 3OL6A 1YZ6A 1S1XB 3I4HX 2GQ2A 3RZAA 4OZJA 3EYZA 2PGCA 5LJ3Y 3HFZB 2RHSB 3DI6A 4ED8A 2YPZA 1S6PB 4ZCKA 4EZ9A 2ASYA 4YR0A 3CGIA 5GAHU 4ICLB 3D3BJ 3LWMA 2HS4A 2MZJA 1NBEB 4AE5A 2HAIA 4NRUA 3IS9A 4AQYJ 2EKNA 4M95A 3DXSX 2F8HA 2E9TA 1T3OA 2CQ0A 4IKAA 2RF2B 2ZWPA 2V67A 1EX8A 1I94F 2IM1A 5G4DA 1FNMA 1WC4A 5GADI 4NPOA 2NUUG 4JI5F 1TK0A 1RTDB 1D9DA 3MUMP 4NLSA 1Q82T 2H65B 3IXQA 1KONA 5C2CA 2K1RA 4YFUA 1B99A 2OEJA 4IDKB 3M9OB 2MJUA 4MK9A 5IT9Y 1RT6B 3DOLA 2W25A 3UD4P 2Y1LB 5HMZA 3ZTSA 2F4FA 1F9FA 1NK4A 4IUFA 3T41A 2ZH1A 2BJ8A 3M2VA 3L7OA 3E01B 3RBDA 2FJBB 3JQKA 1KKHA 2KB2A 1MU2B 4MYUA 3DLGB 3OFGA 5HLFA 2CWXA 2VFVA 3Q0AA 4WCEQ 5A8RB 4R8UB 5KTQA 4NEZA 4BWMA 3K59A 3KLEA 2MY8A 2E5LJ 3ICLA 4J9SA 1IQZA 4C8NA 2KG0A 4OLOA 4TXSA 2FUG9 4OI1A 4R5PA 3AB4B 4CLZA 1RADB 3QQCD 2HQCA 8RUCA 2KM8C 1RT1B 2C42A 5D3GB 1K0VA 3AT1B 3PEHA 3QRPA 2PN6A 1LWCA 3CE8A 5GAGI 2R7XA 2MEWA 1W7WA 2LA4A 2ADBA 4QWCA 6FDRA 2HHQA 1Y3KA 3LP1A 4JI1F 2HHTA 4RW4A 4TY8A 1NK7A 2G9OA 2B9WA 5A2QY 2YXLA 1X5TA 2I6WA 4KYZA 3KJVB 4DUTA 5CAAA 2M9KA 1FX2A 3AXKA 2ZE2A 3M8ZA 5RUBA 2R3VA 2UUAF 2QSFA 2G0IA 4IOCQ 1C1BA 3RGIA 2XBPA 4NLVA 3SXLA 1S0MA 4DR6J 4TYAA 1RT3B 1FJ7A 3OUYA 1HD0A 2R8KA 2HNZA 1U09A 2R8GA 1H7WA 1PJ6A 1ZAWA 2KRBA 3DRSA 3KHRA 1WSVA 4UQTA 4FYYB 2HRYA 2K2PA 3R2DJ 2M3DA 1PCAA 1TKZA 2JC1A 4QW8A 3WBZA 1SL0A 2GIRA 2KT5A 3SV4A 3MM9B 2DD8S 3I9ZA 1NM2A 4B17A 3HJVA 5E0OA 3UN3A 1Z4UA 2ASJA 1REVA 1CC8A 3V4MA 2U1AA 2VBZA 3S6EA 2HHHJ 1Q79A 3HF5A 4GVBA 4HDHA 2HFZA 4OX8A 1ZTWA 5H9EK 4KGXB 2KL8A 3HDSA 1VBYA 3FMWA 3I56S 2Z56B 4N7TA 2C22A 4C0HA 2K7KA 4DL3A 3MMCA 2PEHA 2Y1JA 3VAJA 2DT9A 2P8IA 4YY3F 1Z2ZA 1MG7A 1L3VA 2JWNA 4PYDA 1FRJA 3AA9A 1Y3JA 5LMNJ 2QFIA 4NI2B 1JX4A 3IGVA 3GFZA 5D0HA 2OO4A 3CCSS 5IFMA 4DJBA 1SL1A 1RHKB 1D0EA 4AFFA 5KFOA 4LSNA 4ECYA 2YNGB 4K4ZA 3SMZA 3DLJA 1S77D 3G82B 4CO2A 5F8NA 2ZHBA 3SDEB 1NK6A 3M2UB 2F9JA 1KHWA 4XDDA 4QYZJ 1CJUA 3HLUA 1P8GA 4Z7CA 2W9CA 4OLPA 4LFAF 2EK1A 5KFZA 3NS5A 3BGFA 4N5SA 1NNDA 4L3NA 3NXZA 2RDDA 3NBPA 1HYSB 4OYIA 4M5JA 3GYXB 4E8UA 5C24B 1QE1A 2Z57B 2CQ1A 4PWUA 1CULA 2SXLA 3T1YF 4RW7A 2OPRA 3NMAA 4JI7J 3ZTPA 4YR2A 3PYGA 3CIMA 3HHDA 3HK2A 4KKOA 1CS4A 1GNKA 4OYWA 1SJFA 4LRAA 2DB1A 1X4CA 3H0PA 5C25A 3OTCA 1NJZA 2H5JB 3M32B 2P9CA 4NWBA 2MSTA 1S1TB 1FRLA 4QPXA 4I0WA 4NLQA 4LBHA 3P96A 1Y5NB 2B6AA 1IM6A 3NEKA 2GO9A 2F8EX 3T9NA 2KRRA 1KTQA 1ZZNA 3R7BB 1X8DA 3QFWA 4IG3B 1RWNB 1M1HA 1HIYA 5LXYA 4I1TA 3GG0A 4FP9A 3A4TA 1NHVA 4M5HA 1ELOA 4Y6IA 1SQFA 2JEIA 1WC6A 1FDDA 2CNKB 4GO5X 2VPZB 2VICA 2MJNA 2O66A 3R6LB 4ZCLA 3TA1A 3PY8A 2ZJQQ 5H1SV 5B09A 2N3OA 3FMBA 3HULA 3PKYA 5KFIA 1UL3A 4RNHA 5FD1A 2MQNA 3SSSA 5HROB 2AZ3A 1S1VB 2ZEJA 2L41A 3M8RA 3RBZA 1CG2A 3KK2B 3M6WA 1HFEL 1KBRA 2ZUGA 2HEKA 3CTRA 1S9EA 1WHWA 5EWFA 4LF9F 2NCKL 3R7SB 2NUHA 3L9ZA 2OI2A 3Q22A 4P52A 5AJ3F 4DX8H 2IY5B 1WD6A 1TAQA 3FGVA 3C6TB 4JI4F 4QWBA 1RHQB 4B3SF 2BBEA 3M6VA 2CZ4A 2DNZA 3SYZA 1G6BA 1NK5A 1RT2B 1V5IB 4USUA 3THVA 1G3OA 3OHBA 1L3TA 4M5DA 1DAXA 1Q4RA 2MY7A 4E98A 1RWVB 4ZLJA 1VYAA 1F3FA 1U47A 1GMWA 4CLKA 4ZK7M 1XNRJ 1SC1B 2JDJA 4OJ1A 1C4AA 1HA1A 1APSA 1JLQA 3C66A 2UU9F 4NLUA 2M8HA 4C8OA 1H2TZ 5ETKA 2B4PA 4U7CA 3HFKA 1P9QC 1VFJA 3RJMB 1VC6A 2AJFE 3EVWA 3M8SA 5DLFA 1OIAA 3DLKA 3QIPB 2DNPA 3DU5A 4LF8J 1ZYQA 4CLPA 2K8GA 4DL6A 1W2IA 4CLTA 4PPDA 4LF5J 4NCAA 4PUOB 1UFKA 3K8WA 4K4UA 1HPZB 3PW4A 2WVBA 3GILA 5CZXA 2R2UA 2MSSA 1FD8A 2LDYA 3NOGA 4USKA 3HVTA 1ZA1B 4KTQA 5D78A 3ELHA 3PW0A 1MROA 4P74A 4PXBA 1WKLA 2OD6A 4J9OA 3AXMA 3DLEB 5E7OB 2BMBA 1CPZA 5I3QA 1S6OA 4KO0A 2JEFA 1GTEA 4FPRA 2HRUA 3W66A 1TL1B 3LAMA 2XS2A 2VPWB 1TP7A 5KT7A 4F4XA 1NKCA 5D4PA 3H5SA 3RW7A 4RR5A 2I5JA 5J2MA 1RWMB 3M8PA 2R7SA 1GMVA 3JAMY 2VV5A 4J9MA 4ZPWR 2JZ5A 4DZ6A 1TK5A 1RWWB 4P2SA 2DR6A 3AHPA 3FBEA 1X0PA 2RD5C 1UWAA 2JL9A 2WZ1A 1EARA 1KQFB 1YJWS 1RHRB 1QE1B 4F2SA 1B0VA 2VBXA 3MOZA 1P6TA 4ZVTB 3A3NB 1JNZB 3MEGA 3LA0A 2J8AA 1HBMB 1K1QA 3R5DA 2XEXA 2YTCA 4ZS6A 3W2WB 4L3KA 2EFGA 1R31A 1T3NA 4QR0A 1NDKA 4M5NA 4C4WA 3C16A 3HD1A 4KV8A 1YJ7A 3DOMB 4DUZF 5IQ6A 5L38A 1HI1A 4NZ7A 1VQYA 1HR0F 5HL7Q 1JLCA 3R27A 5KFSA 4OHZA 2C2NA 4MKBA 2ERRA 5I4MA 3U1NA 2CPIA 3K57A 3QO9B 1QSSA 1WHXA 1M5PC 3DRPA 2GJ2A 3CCRS 2WB1D 4YB5A 1Q86T 4ED2A 4DFKA 4N77A 1DQ9A 4TLRA 2HG4A 2XMKA 4HDGA 4DCOB 3F73A 1RISA 2VODA 2PC6A 3AODA 4NLOA 4GRSA 1U48A 2D3O1 3W63A 3H4BA 2HNDA 3CC4S 1S4FA 2CNOB 2KXFA 4FBUA 4YB1P 3KLIA 4LF6J 4RL1A 2EI5A 2NLWA 3RRHA 4B3TF 2C1EB 4ED3A 2NXNA 3WQPA 2L9DA 4ID5B 2LKZA 1HLWA 2DBBA 3LUYA 4MIAA 2D9PA 4RW8A 1U8WA 5L1KA 1TZ0A 3H40A 1NSQA 1UAWA 1WSRA 1PC5A 3JYTA 2WHOA 1U0SA 3T6JA 4JI8J 1R27B 3OTOJ 1J5OA 2BM1A 5AXNA 4RWXA 2QFJA 4LVOP 2LQJA 4K5SA 2ROPA 2M0GB 2YQ1A 3J81j 2RUSA 1WF0A 2AYEA 1T9VA 4I64A 2QRRA 1OY6A 3EGWB 4EZ6A 3FBBA 4BBYA 1PSDA 3IA0A 1IKVA 4QR2A 1S97A 1BHNA 4LFBJ 2C3MA 3NNCA 3MM8B 1WUUA 3PRVA 5DGBA 4KQZA 3QGGA 3HI9A 3NNHA 3LALA 4NYPA 5ETVA 4OZ5A 1FWLA 3IMQJ 3K5NA 4KFBB 1V3SA 2Q66A 4C8MA 1WEZA 3GLJA 2UXBJ 2MQMA 2VPYB 3H4DA 2PO4A 3MMAA 4UOFA 4HACB 4D3HA 1RWOB 2N4CA 2N7YA 4EYIB 4CP5A 1KEKA 1HWJA 4IG0A 3H5XA 3KG0A 2BOAA 1JJHA 1NU4A 1CSJA 4ZVHA 2AJ2A 2DJWA 3K17A 4OI2A 1T03B 1QJHA 4BLGA 4H4MB 5E2QA 2C3YA 4QQBA 5BR8J 1MN7A 2V8HA 4UW2A 1U2RA 4V19X 1TKXB 1U6BA 3GG1A 1N5VA 5IQQA 2G0JA 4MTPA 3ZNUA 4OYMA 1BQNB 2PD1A 3N0VA 4K4XA 1WACA 3EGNA 5HP1B 1C2PA 3EICA 1S76D 1GMUA 1RTIB 4Q45A 2R7TA 1C1CB 4C98A 4PG5A 3V81B 3U02A 1A9NB 3J7Z5 4MFBB 1VQ5S 2OP5A 4DSJA 3FSXA 2CNNB 2JRSA 2I9SA 2ZFHA 3PHEA 1QVFR 3AJ1A 2KU7A 1SJQA 3TX0A 4DV4F 2LEAA 5KFFA 4X4VA 2BEFA 2XY7A 3FEXB 3ILJA 5DQHA 3M05A 2C3UA 2WW8A 1ZM3A 1JJ4A 3MPUB 2PSZA 5HSPA 1FTRA 4LJMA 3D9BA 2G4BA 1KLMB 4H4KA 4XAKA 3CDEA 1HHTP 2PEBA 2P9EA 3D67A 2PIIA 2EEYA 2HNYA 1YITS 4E0DA 3TA0A 4QYRA 3B8HA 2ZKTA 4TY9A 1GK8A 5HVFA 4JUZA 1NZ8A 1FRHA 2PA3A 5A6WA 4LSZB 1SV5B 1RTZA 4RJVA 4EFAC 4I67A 2DNNA 3HT3A 4DR6F 2XYGB 5ETNA 4TLQA 1YI2S 2JVRA 5KFVA 3KNAA 4KJIA 1WC3A 3MEKA 2COLA 3Q2TC 4K50A 1S49A 2QJ3A 3TAMB 3KOAA 4C7QA 4KB7A 4A8OA 2HAFA 4IO1A 5IWAJ 4IFYB 5DDPC 2R7VA 2J7UA 1A0OB 3MOJB 1CC7A 4ES2A 3M2RB 3SQGA 2XY6A 4HEA9 5KG6A 1S7IA 3UD5A 3J7ZT 2H54B 3HVRA 2U2FA 1YDLA 3BKTA 4USMA 4Y0FA 4M94A 2XNRA 3LWLA 1SKUB 3ETOA 4H4KC 4IO9Q 1KQSR 2MKKA 4HL9A 2XY5A 4X4RA 5H9FJ 1QAJA 3ZZZA 3DRRB 2YNIA 2E1AA 2WSCC 3IWXA 3BGRB 3UCUP 3UNYA 2A1BA 1FFGB 2V2QA 3O8WA 3MMBB 3H20A 2DCLA 4ZPAA 5LMNF 5A8KA 1MWZA 3R8YA 1M5SA 3MR7A 1HQUB 3VVTA 2BANB 2XO6A 1TKTB 1FXLA 5DDQC 3KWMA 3GU0A 4L75A 3EUNA 4IOAQ 3BQ0A 4K7QA 3HSZA 1FXDA 1N48A 3Q24A 4DV2J 1N6QA 1TL7A 4BDPA 3NKYA 3NGSA 2Y8WA 1R7IA 3D6FB 4C8YA 3HVAA 3J80Y 1ZAXA 3CJTA 3POTA 1IBLF 4DLGA 1WDDA 3SI8A 1G4CA 4WWSA 3UO0A 2AGQA 4WJBA 1NH7A 1S9GB 1GT8A 5IM0B 4WFZA 3CB4A 2WONA 1E6YB 3CNQP 2VD3A 4OI3A 5KFCA 2ILZA 3GP9A 1RAOA 3LH2S 1SJ3P 2E1PA 4GKKJ 4I7FA 3KK1B 1QY7A 1YX2A 2R7QA 5K8NA 3OSPA 2YKPA 4HHUA 3CMES 4M5MA 4U96A 2QL7B 3OR2B 1T94A 1QUPA 1RT5A 2GIFA 2NPFA 1CJTA 2OPPB 1YRTA 3ENQA 3D66A 2R8IA 3CJ3A 4A8WA 1FVQA 1FWKA 3G86A 4Q44A 3CCZA 1XMQJ 3W9JA 4NLRA 1OPZA 1VQ9S 1BLUA 2FIUA 4DSLA 3J7A1 3CJ4A 2VU5A 4FZVA 2FC9A 4E2FB 5GAEI 3VHQA 3R9LA 3DYAB 1R8HA 3A12A 3OFHA 3O2IA 4LRFA 2R2RA 2J9EA 3OXFA 1S6QA 1GMWD 4S0MA 2BJEA 3OTEA 3V4IA 3C15B 4MKYA 2NPIA 6AT1B 2WTFA 4FYVB 5JVHQ 1H2UX 4F7VA 3CJRA 2HBZB 4WE1B 2EK6A 2VG7A 1HHSA 3IBFB 2CJBA 4I2QB 1LOUA 5D4OA 3PIOQ 3NCPA 3M6UA 3UCGA 1OQ3A 2ASDA 3M9NB 4H54A 2B9YA 2RKIB 4K59A 3KUHA 3FCVA 2KN4A 3MUTP 1G1XA 1YBAA 3W5YA 4WFYA 1MNEA 2AX0A 3EJMA 1UVLA 4DV6F 1F2HA 2UVVA 3TJ8A 4LSLA 2P9GA 3EXCX 3BR8A 3G8TA 3CMAS 1RE1B 2YNFB 4PR6A 3KJQB 1NDCA 1P1TA 4ZVOB 4OJHA 3NLCA 3H2UB 4CT8A 2J0QD 4NLDA 1JXLA 4PG6A 3U1LA 4NX9A 4P73A 1AUDA 1UPPA 4CO5A 4CDIA 1IBKJ 1F6TA 4A8YA 3EXYA 1UVIA 3ZZ0A 2VC0A 1M5KC 2ZM6F 3KDNA 5KFRA 3K8VA 4FYXB 3N5BA 1RBOB 2FVSA 1X60A 2PDAA 2VFTA 1K8AT 3IFEA 2XQCA 1QSLA 4ANCA 3DC2A 2XLKA 2R8JA 2DNRA 2F4VF 1NUEA 4D3GA 3X3UA 2XSJB 1SPBP 3CO9A 2RRNA 2WCXA 2IVFB 4ZJQA 3ET6A 1SC3B 4OJ3A 4P10A 2IA0A 1R43A 4O3PA 1NMEB 5DZ6A 3NGKA 3DGPB 1WG1A 3BDPA 3OL8A 4FF1A 2W7AA 2O5DA 2MZ1A 2ALZA 2HS0A 4EEYA 1S1UB 4CTAA 2XULA 2LYVA 3TUJC 4U7UD 1N32F 3ZFVA 1B0TA 1UMJA 2FGCA 5CCLA 4QIVA 1T9WA 2GW8A 1LK5A 4B9LA 1D8YA 2XZDB 1HNIA 4UOGA 4ZVSB 4UOCA 2ROGA 3LQVA 3VR1A 4JYAJ 1PG5B 1YJ9S 3DM2A 4QWAA 3ITHB 3PX0A 3FQLA 3FZ2A 4QIFA 2GIQA 4A48A 3P5BP 2VDIA 2VASA 3JB9k 2XMUA 4IRCA 1UKUA 1QUVA 3R2CJ 3D6HB 4FPIA 1KVKA 3BF4A 4WTYA 4CWBA 5BJRA 4Y65A 4PQUB 4W90B 4TKTA 1TTHB 2OPSA 4J9PA 3P4UB 3H5UA 4O0NA 1TUWA 4N76A 1AT1B 2NS1B 1QSYA 3OFFA 2JLEA 4QWDA 3RAMA 5CCMA 3V5RA 2B56A 2LLZA 3CJ2A 4Y28C 2BE7D 3GJSB 2GO8A 2AEFA 1X5OA 4ILLA 4OI0A 2NSCA 2VA3A 1VCTA 3FSYA 3QLHB 4DZDA 4N8OA 1N54B 1S0OA 1HL6A 1XNQF 3KHHA 1Z1ZA 2E5GA 3W9IA 4LFCJ 3JSMA 2B8PA 2V69A 4DLEA 2HZCA 3W62A 5DO2A 4NMLA 3AA8A 3MCOA 1AZSA 4B9SA 1JXEA 2CADA 1N88A 1HD1A 3ZXWA 5K8MA 1WHYA 4OHVA 2A6MA 4B3RJ 3R5BA 3KFWX 1T9XA 3TZZA 2QMUB 1IKYB 1TL4A 1NEEA 1NRKA 2E9RX 3BEGB 3MPWA 4HR2A 2FZGB 3UR0A 1E6VA 4LRDA 1DTQA 2CQIA 2BJ7A 3HHLA 1HBOB 3BM7A 3I82A 3KG4A 4DG1B 4DSKA 1NHKL 3TI0A 4RW9A 4DV0F 1Q95G 1UWBA 4M5IA 2HGLA 1CJKA 4LREA 2RB7A 5DG8A 2N3LA 4IRKA 1RWKB 3GR0A 3CDAA 2XO7A 1ICEB 4X62J 1UVNA 3QGIA 3W64A 2HS3A 3R5GA 2V6AA 1FJGJ 2QLFB 4J9NA 5E41A 4JI8F 4C9DA 3WIUA 1VRTB 3C8YA 5DRKA 3EDQB 2DNLA 2QL9B 2LXUA 1W26A 4IH7A 4ZVFA 1Q5VA 2IFXA 2EG2A 1SKWA 2DY9A 2Q43A 1DJ0A 3IM8A 2MHNA 2VL1A 2VOOA 3WIVA 3PVXA 2HURA 3CO0P 3OXGA 4EO6A 5BYSA 2YWFA 2UVRA 1T02A 2DGQA 5HAOA 4OHXA 4YP3A 1N34J 2YVSA 4ZVGA 3FVYA 2M5YA 1FHTA 3UDLA 4JI0J 1S0VA 2IM3A 3A3PB 4TU8A 1OY9A 4PXEA 3UVJB 2V2VA 4PWDA 1S1WB 5KFWA 1RGVA 3BH7B 1XMBA 5L8RC 4A8KA 4K2JA 4N41A 4NOHA 5LJ5Y 5F9LA 4NCBA 4OZ0A 2Y3YA 4J9RA 5AXKA 3NGDA 3BQ2A 4DUYF 5CXTA 1C0TA 1XIQA 3Q23A 3WX8A 4FDFA 2RSQA 2JSXA 1I51B 2RT3A 1BQXA 3LANA 4OX6A 3CSKA 2X1GA 2CQ3A 5ETMA 3MEDA 1UEVA 2C2DA 5BYQA 1U1OA 1RBLA 3DRYA 4DR4J 2MZRA 2CKWA 4PYAA 1TUGB 2O3DA 3TJ9A 4F4WA 3HO1A 4ILRA 3RBEA 2NXJA 3TO8A 3EE3A 2CQ2A 4F04B 3D6MB 4URSA 2I2YA 3NP5A 5J2QA 5KOXA 3ISNC 2IAJA 2DK2A 2QN6B 2EFQA 1KHVA 3UE2A 2PI5A 2K7JA 3IWLA 1V3RA 1CQMA 5A8WA 3GZ7A 2OLWA 2AYGA 3O6QA 2AD9A 2OGUA 4K4TA 4Q2LA 1DY3A 3BSOA 4ZCIA 4AL5A 2AP6A 3VAGA 1AUSL 2QLBB 4FF2A 2HLTA 4RBTA 4BS2A 4ES1A 4YR3A 2QO3A 3CDUA 2A18A 1DRZA 4KPYA 1DURA 2CDRB 1ZAVA 2BQ3A 2WSFC 4UT4A 5U47A 1GTHA 1SIWB 1VQKS 2CYYA 2BQUA 3K5LA 1NKEA 3V6HA 1Q8BA 3VAKA 3DCAA 2ZH7A 1U0HA 1J27A 4M8LA 2IHR1 4O3RA 3TVKA 1UTAA 4OZ1A 2DGTA 1T9TA 4A8XA 4LRBA 2DGWA 4X66F 4Q0BB 1MMDA 3LGNA 1QVGR 1D9AA 2ZD1A 2LQ8A 2E9ZA 1WC0A 4ECWA 3W5XA 5HO4A 2G0CA 4M5KA 4CCHA 1Q78A 3GFYA 3GWCA 1P1LA 3D2WA 5D8HB 3BN4A 1ULRA 2C2ZB 2V9WA 3MM5B 4NZ0A 4I6YA 3OVSA 3Q86A 4Y2MA 2MKJA 1REGX 3LP0B 2ZZNA 3UN5A 3RB6A 1R0AA 2W4DA 2CNLB 2BE2A 2GA7A 4QYZK 4B3OA 2BZ2A 1JK9B 5F0WA 5CZVA 1DTTB 5F8IA 2LMIA 3GTYX 3CCMS 4CLUA 1RCOB 2RU3A 3M6XA 1T9YA 3MURP 2CZ9A 1X4GA 3AOBA 1RAJA 2DNGA 3H98A 5J1PA 1I1GA 4U8YA 1HNVB 3TZYA 4NCGA 2DO0A 5J2PA 5B08A 3DMJB 4CNZA 2RRBA 4U9RA 3J7YU 3M1VA 4LF2A 2KO1A 2AT1B 3B54A 2OSQA 2IYGA 2FHKA 2ZC3A 4ECZA 4DCPB 3PIPQ 1CJVB 1FEEA 2Y1RI 2HGMA 1S1XA 2D9OA 4U7UK 1EP4B 5HK4A 3T1HJ 2HGNA 4TQRA 2X1AA 1S6PA 1HQEB 1N5TA 4ICLA 1IUJA 3G9CA 2E5IA 1RABB 2RS8A 4ZMMA 4B9TA 5B0EA 1WEXA 2FYXA 4WFAQ 1YBUA 1FK9B 3IP0A 2Y0BB 1X4FA 2AQ4A 2LXIA 2FJVA 4X4QA 3SSRA 1FEHA 2RF2A 1JLGB 2BJ3A 1UA1A 4B3MF 2J0SD 1YQHA 1IWAA 4WP9A 1BQMB 2OSRA 2HRTA 1RTDA 4ALZA 5KFNA 2FVQA 2OAUA 5HMXA 1U1PA 2Z58B 2RS2A 2RH3A 1TMJA 4IDKA 2XC9A 1RT6A 3QFHA 3PZPA 3CC7S 3NCQA 3UN2A 4JOUA 2W7PA 4AXIA 1LNQA 5A0YB 1YJUA 1RT4B 3E01A 3GQCA 4OYPA 1TAUA 1HI8A 1TV6B 4NMXA 1RSCA 4KH0B 2HHSA 2WBMA 2L08A 4ZHRB 1N8RT 4F25A 2GQQA 5T41A 2MYFA 4TYBA 3DLGA 2V4RA 2VZ9A 1M1KT 2BQRA 4YQWA 3J7AN 1VQ4S 3KLFB 2FTRA 5A8RA 4ZVPB 3DLHA 4R8UA 4OYOA 4FN5A 2Z2LA 3M4XA 4IFVB 4Y3CA 1FDBA 3NS7B 4X4TA 4KGZB 1KFSA 4USIA 3VGVA 2KFYA 5DM6Q 4J7CA 2FY1A 4HHHA 2HPUA 1BC6A 1RT1A 2QYGA 5D3GA 2HMIB 1BY9A 4O23A 5K14B 4O44B 3B4MA 4TVAB 2EXUA 1HNZJ 5FJ4A 2XZWA 3T5HA 1IWGA 3D0IE 1RAGB 1AFIA 2MGZB 2ZUAA 5ETOA 1ZOTA 2OEKA 3CUNA 5LSRA 2HFNA 3KJVA 5C5JA 2XI3A 4Z2XA 2WSEC 3F44A 4ED1A 4KSEB 4F4ZA 4JI2F 5SUHA 2W8LA 3HXMA 1PAUB 3VZIA 1NPKA 1N5QA 2Z0GA 3MI7X 3HKWA 4KY3A 4OZ3A 1EKRA 5DQGA 1RT3A 4OV1A 4ZVUB 4C8ZA 3IRXB 5G0RB 2XNQA 1MMLA 5DS7A 3NAHA 1R8PA 4WKRA 4L76A 4KHRA 1H72C 3MM9A 1OYDA 2GAGC 1PJ5A 5L39A 1MLAA 2CQPA 1KWMA 1RU2A 4USWA 1VGYA 2NREA 1FTCA 3CULA 3H59A 2J9DA 1B7YB 2J7WA 2IRUA 2BABA 2HIQA 1Q5YA 2ZBPA 5HN0A 3GIJA 5EGYA 3E8OA 2V34A 2XCAA 1S10A 2QA4G 3DU6A 2QL5B 3HZEA 3OTDA 4DR5J 4XK8C 5DQIA 2MZSA 2RRAA 2CXEA 1LFPA 1VQNS 4WK1A 2HFOA 1UEKA 2L9NA 2MB0B 1M5OC 3PW7A 4EK2A 5LT5A 3IC1A 1QLNA 2J7KA 1UVJA 5HBMB 1VRQC 3P3DA 4NI2A 4DL5A 1XMOF 1J5EF 1YSJA 4X65J 4FXWA 2YNGA 3BKFA 1WKKA 5L1IA 3RAXA 4UUWA 3WHIA 2BKNA 2B9EA 3G82A 3OW2R 2IDEA 3SDEA 4NYZA 3FQKA 3M2UA 3AB2B 1HNXJ 5L1LA 3A8IA 5F9NA 1WORA 3MM6B 1QTMA 1YRXA 2YWEA 2HQ3A 3W5ZA 1M90T 2WOMB 4HI2A 5DJBA 1LV5A 1Q7LB 1I6JA 2ABYA 2D3UA 4OX9J 4JYAF 3NGTA 4LF4F 1WNEA 3DFEA 4C3KA 3CCLS 1HYSA 1WTBA 5C24A 4RNOA 1LEOA 2CQDA 3TUZC 1JJCB 3OV7A 3NCRA 2DIVA 3OVAA 1V3ZA 2E29A 2HQDA 3GIIA 1RYRA 4ETZA 3M32A 1KFDA 4ETXA 3SIPB 1P27B 3D28A 4ECUA 4A46A 1S1TA 2B4OA 1LK7A 2P6SA 3IBWA 3UD3P 3HHLD 3A8KA 3CCWA 2H5EA 4DR7F 4PQAA 4QCLA 2X3DA 5DDOC 1SJRA 3T1AA 2VFUA 1KNZA 5M2UA 4IG3A 2HHXA 4DMZA 4JI3F 1LXNA 1Q81T 4R25A 3U1MA 2KYXA 4X4PA 2MDAA 2FVCA 1FRKA 1IM4A 1S99A 3DKDA 2E7XA 3F56A 2JFDA 2YQ0A 3FCWA 2M88A 4CLLA 2HSEB 1RTHB 1X4AA 3NWGA 3RYLA 4DR1F 3A1YG 4OFZA 2H3EB 2ZDOA 3K5OA 3BH6B 2DPIA 3TP2A 2LU1A 5KG2A 5DG9A 5B0DA 4ZPCA 2W2PP 2ZC4A 1I94J 4LFCF 2G2OA 5THWA 1GEHA 4XPCA 1RWXB 1KN6A 2YPYA 3MCSA 2DR9A 4I6AA 1NO8A 1IXKA 3D6TB 1VC0A 5B7WA 5HROA 3AD9C 4DQRA 2VBWA 1VQOS 3NMRA 1S1VA 3KK2A 2ATLA 2EFOA 5LSOA 4G3IA 1NPRA 2NYIA 2QLJB 2DHHA 4B3RF 1NB2A 3PR4A 1VMBA 1OPIA 3ISND 3JXOA 4C11B 2LP4A 2DGVA 4NA3A 2WW4A 4WXWA 1ACMB 3IR6B 1U7LA 2B43A 2DCUB 3MAAB 2HVHA 5HANA 4DQSA 2CPDA 1SI9A 2HK3A 4FVCA 2RNEA 3OSNA 1HHQA 3GYGA 2V8VA 4F0KA 3QJLA 3PRBA 4M63A 3QWUA 2GS8A 2G1DA 1U1NA 2IJRA 3CD0A 3GSDA 4P2MA 1FI4A 2JNJA 3C6TA 1TKDA 4TNOA 2XMVA 2K06A 1DLOB 3K89A 2RDJA 1RT2A 2JFKA 3A13A 4P72A 3MM7B 2UV8G 3H90A 1FJGF 2OPQB 5J1EB 4U6PA 3VALA 4QIEA 1S12A 3I96A 4JV5J 1JLAA 2B51A 1K9MT 2MTLA 4ZVEA 4A8SA 1BUXA 3EX7B 2AJ0A 3D7SB 2H5IB 4KC5A 4QOTA 2WB4A 3BZQA 5CH7B 2M70A 5F3ZA 2BJDA 3R5AA 2AEMA 5ETRA 4OI4A 2YY3A 4I4BA 3BB5A 2VONA 2RU9A 2RIJA 1SVDA 2JVOA 1VS3A 4PRFA 2KT3A 2ZVIA 2FZCB 3SFGA 5KFMA 4OZNA 5E5NA 4JI0F 3QIPA 3L4BC 4GC7A 4MKAA 4DS5A 2VIHA 2MQPA 2LCWA 2UUAJ 1NDLA 1V9OA 4JV1A 5F8HA 2GCFA 3BYPA 2A0FB 2ACYA 1X5PA 2ZOMA 4PUOA 2Z8QA 1HPZA 1NJWA 4ECSA 1HMVB 2LECA 3BO2A 2KXNB 1XK8A 5JVGQ 3MTKA 1LW0B 3WX4A 2K3KA 2DTJA 1F60B 1FESA 3DLEA 4ZJLA 3GMGA 4J5OA 4F26A 3H7HB 2X1FA 4MYTA 2H9ZA 1KQKA 4J90A 3AFGA 1I3OB 5CA5A 3RAQA 4RLEA 5IZHA 2OJ3A 1TL1A 1VDHA 4CO4A 4ZLPA 3QT8A 3FBCA 2B0GA 2V0NA 4V19J 2NZCA 3QMQA 1S57A 2V4JB 5B0AA 2QLWA 4F3MA 4ZP7A 4GKJF 3L7PA 4KH1B 2J6SA 2VB6A 1BWEA 1N33J 4YY3J 3HX9A 3W2VB 3R3TA 1B64A 5GAHI 4B9VA 3MMJA 4X64F 2CRLA 2ZH3A 3I31A 4WU2A 4F8RA 2QC3A 3DRXA 2VQEF 2CDQA 4YB7A 3BQ1A 1UJ6A 3CJQA 5IT0A 2J6UA 4LF7J 5KT4A 1U2FA 1QM9A 1HBMA 3W2WA 1JKHB 4F02A 1H7XA 3GFHA 2FLPA 2WVFA 1VRUB 4WFBQ 3RUBL 2QA2A 3MD3A 4MK7A 4HTIA 3G71S 1JQGA 4PWWA 3DOMA 3ZZUA 3MAQA 1ZM4A 5L9NA 4LFAJ 1X4HA 1NK8A 1PGZA 2YWKA 2ZNZA 3P8BB 1FFSB 5KFAA 3QO9A 3ZZRA 1UW9A 2MQ8A 4OL8A 5H9FK 2HW3A 4C2MA 4RW6A 4NLWA 1HQ2A 1UJ5A 4CYUB 3DOKB 2MKYA 5KAKA 1AFJA 4BC7A 4USVA 4DPUA 3EDRB 3CXCR 2UUCF 2ZH5A 5D15A 1KP6A 1D3WA 3TRGA 3QWPA 2V50A 3THPA 1M0SA 1SB6A 5EDWA 2LFVA 3MR6A 1JLBB 2QGFB 3I5AA 2W01A 2ZZMA 1YK9A 1FA0A 3QSIA 4Y2CA 4NXMF 4DN9A 2OD4A 2NXUA 3D1QA 1OWXA 4ID5A 5D0RA 3PW2A 4LVNP 1NSKL 4MIBA 1SUQB 1D1UA 1S6UA 5HQLA 1SQEA 4QPTA 1KVJA 5IS2A 4WFXA 2APOA 2DNQA 3GE9A 3GR1A 2GNKA 3HVWA 3PACA 4O3QA 5KFTA 5LMUJ 2ZKUA 3MHYA 1UFWA 2YKNB 3OBIA 4O4RA 1NHUA 4HHJA 3MR5A 2H48B 5KFDA 1N5YB 2JOQA 1UZHA 1RKIA 2VOPA 4MMOA 4KHPJ 4AD6A 2HQFA 4DQPA 3KMSA 2AX1A 4A8QA 4DV1J 2VFSA 4HKQA 1H73A 4F0HA 2FJXA 3FZBA 4ZPBA 4ED5A 4WPAA 4X4UA 2C2KB 4CO0A 2ZBRA 2FJAB 1S7HA 4CRJA 3UNGC 3NG8A 1FKOB 1L3SA 3VVUA 4PZVA 4A4JA 3W3SA 1PYOB 4W4MA 3HFVA 3RU0A 3M8WA 3MM8A 2NQPA 2AMCB 1Y5IB 1JLAB 2Y8YA 2FHMA 4KFBA 2J0XA 2IJNA 2MPUA 1J2VA 1YIJS 4Y2KA 2ASLA 1L3UA 2J76E 4XIUA 4HACA 1FKPB 1U6FA 2ZBCA 2FJEB 4TU7A 4QZVB 2Z30B 2QYCA 4B3SJ 1T9UA 2UXCJ 3OTBA 1UPMB 1HWIA 2HZVA 3MPDA 2KI2A 3TARA 5I42B 1NPPA 2YBVA 4C0BA 4DOZA 1T03A 2GVDB 3MF5A 3BSNA 4H4MA 3G87A 3LTOA 3AQOA 1XEZA 1M5VC 1TKXA 2CIMA 3SSQA 4CI0B 4C3LA 3KMQA 1QTNB 2BM0A 1AB8A 3B6BA 4O3NA 1Y11A 4RNFA 3LP2B 3IAM9 2VBYA 1XN9A 2ZHOA 4ER8A 1BQNA 2WVDA 3J81U 1N4LA 5HP1A 3IGNA 3I87A 4P2XA 1S48A 2MLYA 5GADU 1RTIA 3CPWR 4WU3A 2UU9J 4DBQA 1IKWB 4Q43A 1TELA 3QAEA 1ZTTA 3DDNA 1C1CA 3PCOB 4YDXA 2IIHA 1RLCL 3V81A 1YJTA 1AW0A 1RP5A 1WG5A 1ZZFA 4MFBA 2RVJA 4DV7F 2D3ZA 1LFWA 1R0CB 1EIYB 5KFJA 2PE8A 3C46A 3N9UC 1O0PA 5L9XA 4Z7YA 2W9BB 2GQCA 2ZOFA 2R7WA 2ZH2A 4DR2F 5IT9U 4LR9A 3Q8UA 4PG7A 2POKA 3I0SB 2GJFA 1HNZF 3FRYA 5HQ8A 6FD1A 2JLFA 2ACMA 1TL3B 4IQMA 2DH9A 5KFXA 1T7PA 1KLMA 2QV6A 3MECB 4KRWA 2I1RA 3CDWA 1U24A 2F7VA 3F0NA 2FQQB 2R7UA 4FYWB 4FS2A 1WOOA 2M7SA 2OFHX 2H4YB 5FLXU 1VLOA 2CAJA 1IKXB 3K7RA 1WELA 3C14B 1CBKA 3M8QB 2VJVA 3NL0A 4EYHB 4USJC 1SV5A 2CVEA 4L72B 1YHQS 2XCPA 3NY0A 5EWEA 1SJ4P 2HIYA 3HD2A 3HJFA 2YQ3A 4U8VA 4ZIWA 2XI2A 3VAMA 1FE0A 1H3DA 2ZITA 3BGUA 2E7WA 3PXGa 4LBPA 5KFUA 5T7LB 1NXIA 1VQPS 3G6VA 1U4BA 4UZCA 2BVZA 3SQOP 3ENVA 2AW0A 3L3CA 2IDLA 5GAGU 1RHMB 1BD6A 4ZPTR 3FDSA 3JSRA 2JLGA 3FBFA 3TAMA 2CPXA 4PKDB 4J9VA 3AJ2A 4RW6B 4IFYA 4ECRA 2R9LA 1GX5A 3M2RA 3IWNC 2ZVSA 4KGVB 1FDAA 3OLAA 2FJWA 4KE5A 2BYCA 5A2QU 4UF4A 2JH3A 1NSPA 2DNYA 3JTOA 2VQFJ 3B78A 4EI2A 1FT8A 3M30B 3TYTA 4TQSA 5KFBA 4DV5F 2DRAA 1RAFB 2VG5B 4DUZJ 2ZWOA 2VKRA 4DR3F 3DRRA 5JUMA 3BGRA 1SH2A 3C6UB 1IVZA 3LPYA 3MMBA 2Q1LA 1TU0B 4DWIA 1Y10A 1WOSA 2YKQA 3KLGB 3KK3B 3MEEB 2F65A 1HQUA 2BANA 1RT7B 5ETTA 4LF1A 3TWZA 3H2VE 5FIIA 1VJQA 1TKTA 1LWFB 2HWHA 4X4OA 2W24A 4WIIA 4QU6A 4CO1A 2ZH6A 1JIHA 5J2NB 2UZAA 3IG1B 8ATCB 1RTJB 2FY8A 1HNXF 3A8EA 2W8KA 1R6YA 1JLFB 2LVWA 4HH1A 3OD2A 2MZTA 3T6BA 2RHQB 1X0FA 5DGAA 4PG8A 3Q8SB 3VQSA 4B3TJ 2B3TB 1H98A 2OUGA 4OX9F 4K2XA 2Y0SD 3I32A 1S9GA 1PBUA 2AZ1A 5ADZA 5IM0A 3EZ5A 3TQ1A 4CQ1A 1S59A 3JS9A 1F9HA 1E6YA 3I9V9 2CPFA 2RDIA 2HK2A 1YGYA 2FLNA 4AQYF 2N82B 5F0UA 1S0NA 1KS2A 4UOHA 2AIRB 1UCNA 3HMJG 2KKHA 3KK1A 4HT7A 2UP1A 2IRXA 3NGRA 1YTYA 1U25A 3QBCA 5GMEA 3A8JA 2QMWA 3OR2A 2KVQE 1FD2A 2WVEA 2I8EA 3OR1B 1SQGA 2GJIA 1Q16B 8AT1B 2BX6A 2OPPA 1SCJB 5FDLB 4H4OB 3I0RB 1EETB 2V68A 4X2BA 3OQ2A 3IBCB 4F4YA 3L7UA 1T05B 1JNRB 5ITHA 2QSWA 2OMOA 4O4GB 1MW7A 2GC8A 4J37A 4EMDA 2YNHB 2UXDJ 4NZ6A 3EM1A 1UETA 3US5A 4FF4A 1DQAA 4XDCA 3TEGA 3PV8A 1MWYA 5B0GA 1VJWA 4WYWA 4ANDA 1IJFB 4DV3J 3J81Y 4MAKA 1RAAB 1HARA 1IN0A 2CJYB 1IR2A 2YKMB 1VQLS 3DYAA 3O44A 3UFCX 3NWRA 1U2CA 4NRTA 3CD6S 3LPEA 1NK9A 1BE4A 3R5CA 2BV3A 2YH1A 2UVUA 3C15A 4WP3A 1YVFA 3HHKA 3D0HE 4BCAA 3NGUA 1LWEB 1VISA 2E5LF 4WE1A 3T5KA 3CC2S 3ISZA 2B4UA 2MLZA 4I2QA 2MZQA 2MHEA 5C42B 4KAIA 3VZHA 4ED4A 2RKIA 1R8CA 4RUCA 2XWXA 2HZAA 5KFQA 1RAHB 1QAIA 2D3OR 1VIOA 5CYQB 2RJZA 3UDVA 5CQGA 3PDNA 1SL2A 4ZCMA 4ANEA 2ILYA 4CLSA 4IR9A 1S9FA 5KFLA 5FLXY 1TFWA 2BJ1A 3FFIB 1UP1A 4RZRA 3T5LA 2YNFA 4ZP6A 3GFXA 2NZ4A 3RR8A 4KIAA 2DH8A 3WC0A 3HSJA 3EZUA 1HBNB 2D69A 2QG9B 3IAS9 4QIGA 3CJ8A 4ZP9A 3G6YA 2IC3B 4Y2IA 1MSWD 4LR7A 1QD1A 2R4FA 3JTPA 2D41A 4V1Ak 2DHAA 3IRWP 3K5PA 4G1QB 3PJ9A 1C0UB 4JV5F 4OYZA 2AEJA 4DV4J 1ITPA 1FRIA 1SH0A 3KLVA 4PXCA 5F8JA 4YHHJ 2KVIA 2GMJA 2XSJA 1OO0B 3P6YC 3I6PA 3TUPA 4KR0B 2B5JB 2C2OB 3MXHP 3VAHA 3CCVS 2M4MA 5B0CA 1SJ1A 3T5JA 1R8AA 2OELA 1FFWB 4OYXA 3TA2A 4F4KA 3DGPA 3Q89A 3V6DB 2HHHF 5CABA 1HBUB 2XTJP 2GVZB 2G2ZA 1LWXA 4ECXA 3CJKB 2XMAA 1S1UA 3N5FA 2VA2A 4ZVRB 3N6MA 3R6GB 5A6PA 1T8EA 1EJ7L 5CYMB 1O8BA 1YG0A 3DGVA 1X9WA 4GC6A 2VPXB 4X84A 1RCXB 2QLXA 2DEIA 3RTVA 3SV3A 3TNVA 4UTGA 5KFGA 1FNOA 1ZS6A 3OJUA 4K0KJ 1YJNS 3R7NB 1LW2B 4P2FA 3UR3C 3KLHB 1URNA 3MWBA 3SCKE 3ITHA 2HHUA 4FS1A 3BBBA 2DGUA 1MMNA 1X4EA 3RW6A 2GMHA 2A2CA 3MD1A 3TW0A 3BJYA 3SZ2A 1RYSA 3H5YA 3WC2A 1TVRB 4Q8EA 2ZBIA 3HHEA 2X7IA 2PFFB 3I5CA 3HSDA 4CNYA 4GVLA 4ED7A 1Y9OA 4PQUA 3AOAA 4I2PB 4QW9A 1WHVA 4LQ9A 1TUVA 2FB0A 1N33F 3LGHA 2E1CA 3CJ0A 5ETLA 5C2GA 2BJ9A 1FERA 2ZJPQ 1YKWA 3G4SS 3Q83A 1N36J 1UZDA 2OTJS 2XHWA 3GPAA 4URGA 1WC1A 4LF7F 4JI7F 2OH2A 2YWHA 3CMQA 1YWXA 4USTA 4DU8A 1RA6A 3QLHA 2W7OA 2GGPB 5JXSA 2DEJA 1TQLA 1XWLA 1C4CA 3PG9A 3BGOP 1SBRA 2OHDA 3OL7A 2PMHA 4ECTA 4O0IA 1Y00A 4DI6A 5F41A 1RKJA 2Q6BA 2VH7A 5I3UB 1IBLJ 3TZXA 3BR9A 3JAMU 3DI6B 4WIQA 4HLBA 2L3MA 3JQMA 1IKYA 2LDIA 2AJ4A 5KFEA 4R0JA 2HFVA 2CFXA 2YKAA 3IS9B 1B3TA 2Y9HA 4MIWA 4AUKA 2DO4A 1XR5A 1HBOA 3V2UC 1HWUA 2KYZA 5D77A 4RUAA 2F9DA 2J9DE 2CQ4A 4DG1A 3IO1A 4ZKAA 3D5MA 1Q1KA 3RB4A 2RQKA 1WDTA 2EWHA 3RBXA 2KM8B 3D68A 9ATCB 2J5AA 1W2BR 4DX5A 1OSCA 1SKRA 1YJVA 2KXHA 2K1RB 1NSAA 4PG4A 4KPCA 2HVEA 3DOLB 2XHCA 5K9FA 4WZMA 2V5HG 5LMUF 1TK8A 1NH8A 3M2VB 1Z2LA 1VRTA 1VK8A 3DLLQ 4OHYA 3PJXA 3JSYA 1R8BA 4QBUA 2DRBA 3Q8QB 4NLPA 3PR5B 4KGMA 4KHPF 3D54A 5HLFB 2NXEA 1RLDA 5E3CA 4DV1F 1EHWA 3WZ0A 4ED6A 3UWTA 5KG3A 2UV8A 3D1OA 1OS5A 4C0OC 1X4DA 3KLEB 1G2EA 2MLXA 1XR6A 2FD2A 3S7RA 4X4SA 3QT7A 3ZC4A 3K2YA 1FRMA 4CO3A 4FNHA 1MWQA 3AOCA 2CJ9A 1Q8IA 2AGPA 3O1LA 2DHSA 1FJCA 4R5PB 2YH0A 4TU9A 3UVJA 1IR1A 1T11A 2EKYA 1U1KA 2WBRA 1S1WA 4EGLA 1KD1T 1UJ4A 3CCTA 3KDOA 2R2SA 1FKAF 3SCLE 5JMNA 3TUIC 4DFMA 3PO4A 1GXLA 4DN0A 4DV6J 1XNRF 2XWYA 1LWCB 4IR1A 1O5JA 2GHVC 2CJKA 2AHOB 2HVIA 4OZLA 2DNKA 3EZOA 3MAHA 3DN9A 3LP1B 4RW4B 1P9YA 4TY8B 3VAFA 3BSCA 4N47A 1F5AA 2QT7A 2UXCF 2HBYB 3QRRA 4WFNQ 3R1HA 4FKXA 5AE3A 3KJNB 2ZE2B 5MAOA 1TR0A 2ZM6J 4A8FA 3QAUA 4LF8F 5CD4A 3RB3A 1C1BB 4CLFA 1Y4ZB 4DU7A 1BWVA 2MQQA 2PI4A 2XGQA 4LF5F 2QTWA 4DL4A 2NYHA 2FLOA 3OUYB 2HNZB 3LOUA 2XM3A 1AA1B 3DRSB 3B82A 2KHCA 1GX6A 1ZPWX 1RU1A 2F4VJ 4ZPDA 3PYDA 4RUHA 4LBIA 1TKZB 2QA4S 1DBDA 3EWGA 3BBFA 4KBIA 1AYEA 1REVB 7FD1A 3VGUA 3ZNJ1 2EC0A 4GVBB 3KKFA 5I3PA 3KUGA 2CPJA 2CJXB 1KTVA 2C28A 1AROP 4P9SA 4CH0S 1N32J 1OJ4A 2CQBA 1K1SA 2OKQA 4DX6A 2JEGA 1M1GA 2YX1A 2Q6CA 4JV2A 1K47A 2V2ZA 5E33A 3WDOA 2CQHA 4ZLNA 3GV5B 3OL9A 1JJ2R 1YZ7A 3MMCB 1VHFA 4FNIA 3BO3A 3AAWB 5L1JA 2VHGA 1RHJB 4TN2A 2LA6A 4Q0BA 1PYSB 2WK4A 1WEYA 4B02A 5M2RA 2W9AA 5KT3A 2GHPA 2EBEA 3S01A 1XQIA 4JB8B 5GMDA 4C6AA 3G8SA 2CPHA 4LSNB 3KG1A 3RR7A 3MM5A 5IV4A 1IR0A 2HFUA 2Q3PA 2M52A 4WTOB 1H38A 3LP0A 1PJ7A 1CJUB 3THTA 2CPZA 5J1NA 2W9CB 1U49A 4OI6A 5F8MA 3RB0A 4AL7A 2XGPA 1HKAA 4J91A 5E3PA 2MKSA 4IRDA 2HVZA 5AXMA 2C3PA 1DTTA 2K3IA 1F5CA 5CHCB 3AD8C 1R0BG 3O5TB 5F8LA 1NB7A 3NBPB 4WP8A 1LQ9A 3NOCA 4Y00A 1GH8A 2DHXA 1CEZA 1CULB 3CIZA 4RW7B 2OPRB 1HNVA 2JJ4D 3HM9A 3DLBA 1TL5A 3KXDA 3DMJA 4KKOB 4CH1A 1CS4B 1R89A 2OEMA 5C25B 3ZTOA 3P49B 1XNQJ 3D0GE 2VQFF 1KOHA 4RNMA 1DQ8A 4LF6F 1CJVA 1NDPA 2G1HA 2H4WB 2F1FA 5F3TA 4XPEA 1X31C 3IR5B 2LU2A 4I69A 3PTWA 1EP4A 2DVIA 2B6AB 2P2CB 1N0VC 1FNXH 1X5SA 1XERA 2FZKB 2HHVA 1HQEA 2GHWA 4ZDNA 4DX7A 4YS2A 5IT4A 4DEZA 1M5HA 2DNMA 4DDFA 2DXDA 1EZZB 2YKOA 4DHVA 4ZA1A 4O3OA 2EVZA 5T14A 2CA9A 4LMZA 5K8OA 4JBCA 1FK9A 3OTOF 2MXYA 3M9MB 2XMJA 4RUBA 2RE1A 3Q8YA 1QAYA 3FUYA 2IBKA 4C8KA 1JLGA 2C3OA 1S72S 1R6VA 2FJDB 1B0PA 3PJWA 1RAIB 4ZOSA 5HMYA 2R8HA 1SXLA 1BQMA 1T0TV 1WF1A 5B0FA 4DV0J 2QX0A 7FDRA 3H2LA 4LIRA 2D1CA 2ALYB 4AYBD 2UUWA 1RA7A 1DHMA 3N6LA 3LGMA 4EBCA 2A3JA 2BKOA 1S9EB 4HTJA 2DGSA 3SCJE 4LFBF 3AD7C 2GV1A 5A0YA 4G1IA 4MJKA 3CCES 4RO0A 1RT4A 4EBDA 1TV6A 4DQQA 4ZHRA 4QU7A 1VI7A 2KHDA 2UUBJ 1EB0A 1A6LA 3AY0A 2UXBF 3N4WA 2VJUA 1R3NA 4HVZA 1PAEX 2X51A 4JI6J 3GIKA 3KLFA 3BDEA 3EVOA 2XMMA 4ECVA 4IFVA 5HATA 1HNWJ 4QWEA 4UZBA 1L3KA 2NXCA 4ZPVR 4DSEA 1WI6A 3J80U 4ELVA 2UXDF 2YWGA 2AWZA 1OYEA 4M5DB 1RI7A 3OFEA 1RWUA 5BR8F 5KT2A 4DV3F 2OTLS 2QIFA 1GAOA 2HMIA 4ITSA 5K14A 2G13A 3FJ2A 3MR3A 1A7GE 4O44A 4LRCA 3Q8VA 4NASA 1SKSA 2LQ9A 3OT9A 4CLWA 3CCJS 5M2PA 5D4NA 2M2BA 3N01A 4ZP8A 3VGTA 4CH7A 1PIEA 2EC2A 1FX4A 4F50A 3L95X 2VUGA 1XBWA 2IJFA 2XMWA 1JLQB 5KG0A 3ENWA 4DCJB 2MGZA 4DUYJ 1VBZA 4DPOA 1KDNA 1RACB 3PNIA 4HI1A 1RWPB 4DF4A 1VC5A 2E7VA 1U45A 3NRBA 4RBUA 3ZTRA 3DLKB 2CQCA 4K5RA 1Q0NA 3E2EA 3ILOA 2CJQA 1BMQB 2AV5A 3GYNA 2AYMA 1D8ZA 3W8GA 3IRXA 5G0RA 5GAEU 3KUEA 2CZVC 1U26A 4WXOA 5HQMA 1ZM9A 2FVRA 1UEUA 4M5GA 4EBEA 3HVTB 5EN1A 2B4VA 2BACA 1MROB 2ZZTA 1UW4A 2V8DA 2KTQA 4PABA 3GSIA 3GCXP 5BXIA 5E3QA 1U6ZA 2W4PA 5H9EJ 1LXJA 1K44A 4KO0B 4ATNA 4OMFG 2EBGA 2KT2A 4CM0A 3TAQA 3BREA 1VQ7S 3CJ5A 2XS7A 2BA9A 1RXOB 2HLUA 2DPJA 3FCHA 2HYIB 1JMTA 2I5JB 3EPGA 4DL7A 5J2MB 3M8PB 5F8GA 1RZMA 4NE9C 3QGHA 2JEJA 3VV2B 2BW7A 5DDRC 3HP6A 4NXNJ 4YHHF 5KG1A 5KFPA 3B4DA 2H51B 5KFHA 2YX7A 1B4SA 2E5JA 4YOEA 5HBMA 2DIUA 4A8MP 2JC0A 3UQSA 5IWAF 4X66J 3KYLA 3CEDA 2N4DA 1HW9A 2W2NP 2DH7A 1RUSA 2VG6A 3NAIA 4CM2A 2D74B 3MEGB 1NJYA 4K4YA 2V4QA 1LKZA 2B7BB 2DITA 4EUVA 4CZCA 1NZAA 3MM6A 4MK8A 4DSFA 4N56A 3C16B 4KV8B 5DM7Q 4IOBA 3LO3A 2WOMA 3BS9A 2ADCA 1VQ6S 4OX7A 3I55S 3D4JA 1Q8KA 4F4AA 3Q8RB 3FKBA 4OZ2A 1JLCB 3HPOA 4K0KF 3GV7B 3Q2SC 4USHA 5AT1B 2ZNYA 3BPDA 3CCQS 2A10A 3DRPB 2R7RA 4G65A 1OMSA 4ES3A 4DFJA 3M7VA 2AF6A 5D0GA 1ZM2A 1F0XA 5A76A 2EW9A 2I0XA 2E44A 4DV2F 2HNDB 1IBMJ 3FSIA 5IC6B 1EAYC 3KLIB 3N28A 1FF2A 4I68A 2IVMA 3PYFA 3OPKA 3TQEA 2FC8A 1MN9A 2E66A 3C2PA 2PMZD 5IV3A 2IMWP 2OFGX 3GIRA 4RW8B 3UW1A 1FE4A 1FXRA 1N36F 3N79A 2E1RA 3HSGA 5HJXA 4FBTA 1F1BB 3JYTB 1HWKA 2XLJA 1O6XA 5ETSA 3BV8A 4GKKF 2BW2A 3K58A 1NJXA 1J5OB 1VQSA 1RTHA 2O67A 2B7CB 1Q8LA 2J9CA 2C2RA 2H1YA 1N52B 9RUBA 4J9UE 4BWJA 3C3LA 3PEJA 4JP8A 4XTTA 3QNWB 4B3MJ 1Y7PA 3TANA 4YMEA 3G8QA 3CW2C 1WC5A 3TEHB 5DLGA 2L9WA 4IH6A 2KJVA 3W8PA 1DFDA 3ULHA 2CUYA 1XMQF 4C11A 1IKVB 4RKUC 4F3OA 4B9NA 4YN3B 1DARA 3P5TL 3MAAA 2Z4PA 3L09A 4ZN3A 3PO5A 2O01C 1URRA 5HJYA 2XB2D 3T9ZA 2F8MA 2RQMA 3MMAB 3MFIA 1V5VA 4L6V3 5SZTA 4WZQA 2G2YA 3TJAA 2ZHAA 1DLOA 3P45B 2XS5A 2LEPA 4IG0B 4DPYA 2XYPB 3W60A 2ZBQA 4W92B 2XYHB 4FVMA 2PA8D 3MM7A 4R0EA 2OPQA 5J1EA 2LEBA 5EX3A 1K0TA 4P7VA 2QA1A 2HWTA 4LIWA 4EO8A 3SEOA 1PYTA 3AJDA 2ZDPA 3CJSA 1TFYA 3GJQB 5LOQA 1XTZA 4B08A 1RBAA 1NAQA 2Z2ZA 4DPTA 2KG1A 4ECQA 4CIOA 1Q53A 3EVMA 4PPZA 2DR8A 3QIDA
chains in the Genus database with same CATH topology
2ZM6J 5LMNJ 1XNRJ 4B3RJ 2UXDJ 5IT9U 2MQ8A 4JI8J 3OTOJ 4KHPJ 1XNQJ 1XMQJ 4DV2J 4DV3J 4JI2J 4DR4J 4DV1J 5IWAJ 4B3TJ 1HNXJ 3R2DJ 4LF9J 5A2QU 1HR0J 1N36J 4DV7J 1HNZJ 1N34J 4DUYJ 2F4VJ 5FLXU 2UUAJ 1N33J 4YY3J 2VQFJ 1XMOJ 4V1Ak 2UUBJ 5BR8J 4OX9J 4JI5J 1J5EJ 4B3MJ 4JI0J 5AJ3J 2MEWA 2HHHJ 4DUZJ 4DR7J 3J81U 1IBKJ 4K0KJ 4DR2J 4LF8J 3T1HJ 4NXNJ 4DV6J 5LM7E 4JI6J 4LF7J 1I94J 4LF5J 4JYAJ 4DV4J 2UU9J 4DR5J 4JI3J 2KL8A 4LFBJ 4LF6J 4GKKJ 1HNWJ 4KYZA 2KVQE 4JI4J 4GKJJ 4RJVA 3J7AN 4X62J 4JI1J 4YHHJ 1IBMJ 4JV5J 2UUCJ 4X66J 4LFCJ 1IBLJ 4HHUA 3D3CJ 2MTLA 3W1YC 3D3BJ 1N32J 4PWWA 1FJGJ 4KY3A 3IMQJ 4JI7J 3JAMU 3J80U 4X64J 4DV5J 5LMUJ 4LF4J 4LFAJ 4DV0J 2UXBJ 4AQYJ 4DR3J 4NEZA 4DR1J 3T1YJ 2VQEJ 4NEYA 4B3SJ 4DR6J 2E5LJ 4X65J 3R2CJ 2UXCJ 4NXMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 J;  5LMN J;  1XNR J;  4B3R J;  2UXD J;  5IT9 U;  2MQ8 A;  4JI8 J;  3OTO J;  4KHP J;  1XNQ J;  1XMQ J;  4DV2 J;  4DV3 J;  4JI2 J;  4DR4 J;  4DV1 J;  5IWA J;  4B3T J;  1HNX J;  3R2D J;  4LF9 J;  5A2Q U;  1HR0 J;  1N36 J;  4DV7 J;  1HNZ J;  1N34 J;  4DUY J;  2F4V J;  5FLX U;  2UUA J;  1N33 J;  4YY3 J;  2VQF J;  1XMO J;  4V1A k;  2UUB J;  5BR8 J;  4OX9 J;  4JI5 J;  1J5E J;  4B3M J;  4JI0 J;  5AJ3 J;  2MEW A;  2HHH J;  4DUZ J;  4DR7 J;  3J81 U;  1IBK J;  4K0K J;  4DR2 J;  4LF8 J;  3T1H J;  4NXN J;  4DV6 J;  5LM7 E;  4JI6 J;  4LF7 J;  1I94 J;  4LF5 J;  4JYA J;  4DV4 J;  2UU9 J;  4DR5 J;  4JI3 J;  2KL8 A;  4LFB J;  4LF6 J;  4GKK J;  1HNW J;  4KYZ A;  2KVQ E;  4JI4 J;  4GKJ J;  4RJV A;  3J7A N;  4X62 J;  4JI1 J;  4YHH J;  1IBM J;  4JV5 J;  2UUC J;  4X66 J;  4LFC J;  1IBL J;  4HHU A;  3D3C J;  2MTL A;  3W1Y C;  3D3B J;  1N32 J;  4PWW A;  1FJG J;  4KY3 A;  3IMQ J;  4JI7 J;  3JAM U;  3J80 U;  4X64 J;  4DV5 J;  5LMU J;  4LF4 J;  4LFA J;  4DV0 J;  2UXB J;  4AQY J;  4DR3 J;  4NEZ A;  4DR1 J;  3T1Y J;  2VQE J;  4NEY A;  4B3S J;  4DR6 J;  2E5L J;  4X65 J;  3R2C J;  2UXC J;  4NXM J; 
#chains in the Genus database with same CATH topology
 2DY1 A;  1IBK F;  1GQE A;  3BYR A;  3TOQ A;  3UDC A;  4QR1 A;  3ADA C;  2W4C A;  4JI2 J;  3FEY B;  4BC9 A;  2V94 A;  4NYO A;  2DNH A;  4QJV A;  5D0E A;  5GMK a;  3CD5 A;  4JV0 A;  5EUH A;  1ROF A;  1F5B A;  3W65 A;  1HMV A;  1KR4 A;  2VC1 A;  3QSY B;  1VBX A;  1HI0 P;  1F9E B;  3MDF A;  1LW0 A;  3EPI A;  4B9M A;  1Y0H A;  4K4V A;  5CYJ A;  4HYK A;  1W25 A;  2YWW A;  2HNY B;  2VKZ G;  3BBC A;  1NJI T;  1UFL A;  3KJF B;  2XZT B;  3QT5 A;  4ERD A;  2VG6 B;  1TMM A;  2ATC B;  2CWK A;  4ELU A;  3G6X A;  3J7Y I;  4C3M A;  3PFO A;  3OLB A;  3CVK A;  3MTJ A;  3QZ8 A;  4DQI A;  3QJP A;  2V4J A;  3A3O B;  2ZH4 A;  1S79 A;  2VDH A;  1WWH A;  5E3R A;  3QPI A;  2B9X A;  2BOP A;  2DNO A;  5IXU A;  2GFF A;  2KH9 A;  3W2V A;  1KOO A;  4NA2 A;  4UQG A;  1RK8 A;  2XMT A;  4ZIT A;  1RQ0 A;  1VBK A;  4C48 A;  1XMO J;  2FHJ A;  5KG5 A;  4DF8 A;  2LXF A;  1J5E J;  4F3Q A;  3SQG B;  3PHT A;  1JKH A;  1VOM A;  1Q7Y T;  5HVH A;  3V6J A;  1FVS A;  1H2V Z;  1VRU A;  2RAQ A;  2KFN A;  2ZJR Q;  2HKE A;  1X9M A;  3BKU A;  1NK0 A;  3T19 A;  2YX4 A;  1GXT A;  2GAH C;  1FWP A;  5KT6 A;  2X3G A;  3DHW C;  5KFK A;  2YNI B;  2PFD A;  2CG8 A;  1JLE A;  1IQT A;  5KG4 A;  3UCZ P;  4QIW D;  4LF4 J;  4YUD A;  1S4E A;  4CYU A;  3DOK A;  3I4P A;  3PYE A;  5A8K B;  5B0B A;  2DR7 A;  2BUN A;  4ELT A;  3EGZ A;  2MQO A;  2HFS A;  4FKY A;  1JWW A;  3QJJ A;  4AXJ A;  4G6V B;  3QGP A;  1UVM A;  4PAA A;  3OVB A;  5DZ7 A;  5EHH A;  5LXR A;  4NLT A;  1OY8 A;  4AL6 A;  1JLB A;  3FC9 A;  4J9K A;  2I38 A;  1N6Q B;  3N6N A;  1TL7 B;  1U02 A;  2Q79 A;  4P7T A;  4X4N A;  3DNC A;  3W9H A;  2J6T A;  3HHN B;  4JI5 J;  3UI3 A;  3POT B;  5HI7 A;  4DR7 J;  2DRD A;  1JB0 C;  1SUQ A;  4DFP A;  2IA6 A;  3HCX A;  1EKS A;  1HWL A;  3S1T A;  3U27 A;  4YB6 A;  4JI3 J;  3GV8 B;  2WON B;  3CF5 Q;  2DXF A;  4YDD B;  1QDU B;  4LUB A;  2YKN A;  4I7F B;  2QE5 A;  1N5Y A;  4B9U A;  2V8G A;  1YLX A;  4DR1 J;  3MZI A;  3GB0 A;  1RAE B;  1RT5 B;  2VFR A;  1CJT B;  2N7C A;  2CQG A;  2HVD A;  3R5J B;  4Q2M A;  2LQ5 A;  3HZG A;  4U95 A;  4N8N A;  1FKO A;  4X62 F;  2RUG A;  3IR7 B;  4ZJO A;  2KZZ A;  4RU9 A;  1ZET A;  1ZBT A;  4WF9 Q;  4F36 A;  1SH3 A;  2QMX A;  3K5M A;  4RX6 A;  1WF2 A;  4NLG A;  3BN7 A;  3G96 A;  1KRP A;  5LL6 d;  1NKB A;  1V6H A;  3DXB A;  3G2X A;  4MH8 A;  2GZO A;  4Q5V A;  2KFZ A;  2KDO A;  2PT0 A;  4ZN1 A;  1S6Q B;  1FKP A;  2HQG A;  4JI1 J;  2BRL A;  3V4I B;  4FXD A;  3OXL A;  4GMK A;  3ZO7 A;  1N34 F;  5IC4 B;  1XR7 A;  3FEZ A;  2VG7 B;  1I5O B;  5AE2 A;  2CJA A;  5I42 A;  4I6W A;  1XJW B;  3S8S A;  2GVD A;  2RML A;  3VF0 B;  4CT9 A;  2FDN A;  4Q8F A;  1RJJ A;  2AJ1 A;  2AU0 A;  3F41 A;  4OIX A;  2UUB F;  3ZZP A;  1N0U A;  1D9F A;  4DPX A;  3SFU A;  3LP2 A;  5L46 A;  1VLY A;  1FCA A;  1CVJ A;  4LSL B;  3BO4 A;  1Y5L B;  4JI6 F;  5BYR A;  1U1L A;  4UUX A;  3TX8 A;  5IOL A;  1IKW A;  3MCM A;  2V2K A;  1HNW F;  4F0M A;  3MR2 A;  1SIZ A;  3SCI E;  2VF3 A;  1GXU A;  3IM9 A;  1NCL A;  4Y34 A;  3FNN A;  2AJQ A;  4DR4 F;  4DXL A;  4IH5 A;  3QYY A;  3HHL C;  2W2Q P;  4WBF A;  1H0H B;  1KSP A;  1T95 A;  3AH6 A;  2W9B A;  4PCQ A;  3ZZT A;  4DS4 A;  1O51 A;  1ZH5 A;  1B7F A;  3DHX A;  2CG4 A;  1EQ0 A;  1VQM S;  3I0S A;  1CQN A;  3M8Y A;  1TL3 A;  3VCD A;  3MEC A;  5KT5 A;  1U1M A;  1RDR A;  1XC9 A;  2MKI A;  3PX4 A;  3VAI A;  4PXD A;  2HQI A;  3VQT A;  3ET6 B;  1YRU A;  4DPW A;  5C7P A;  1IKX A;  2WVC A;  2O1P A;  2MKC A;  2GML A;  1OQ6 A;  3C14 A;  4ED0 A;  1U8S A;  3M8Q A;  3MCN A;  2EPI A;  1KLN A;  5GVQ A;  3FRZ A;  4CTA B;  5DG7 A;  3PKM A;  4WK3 A;  5T7L A;  1DZ5 A;  4OYB A;  4ZIV A;  4DL2 A;  1F2G A;  1RHU B;  1H74 A;  1HNI B;  2KJW A;  1ZPV A;  4GKJ J;  1JLE B;  2M8D B;  3ZZY A;  2DHG A;  4GO7 X;  3K0J A;  2GX8 A;  3QAT A;  2F40 A;  3MGJ A;  3RRK A;  7AT1 B;  1WTF A;  4EU0 A;  1RB0 A;  3TR5 A;  3DM2 B;  1X4B A;  4X64 J;  2P5V A;  5MLC V;  3KTQ A;  2HBQ B;  2WAQ D;  5EX0 A;  3T1Y J;  1IJE B;  2VQE J;  2XG8 A;  4AT1 B;  3CCU S;  4ZVQ B;  5AXL A;  3PW5 A;  2IBO A;  4WKY A;  4MKV A;  2EFP A;  3M30 A;  1AXQ A;  3NS6 A;  3CD7 A;  3JSB A;  2VG5 A;  5K5M A;  5K8P A;  1UA0 A;  2ZOG A;  2W2O P;  1VQ8 S;  2DGO A;  4NXN F;  1U1R A;  4RNN A;  5KG7 A;  2DXE A;  2OPS B;  3C6U A;  3MUV P;  2MKH A;  4OV6 A;  4K4S A;  4M1K A;  3KLG A;  3KK3 A;  1VHI A;  3MEE A;  1PC4 A;  4C8L A;  2E1M C;  5LSL A;  2V63 A;  1RT7 A;  2AKW B;  2XSF A;  4LQ3 A;  2FGO A;  1LWF A;  4OYA A;  2RQ4 A;  2IRY A;  2UUC J;  2J8S A;  4URQ U;  1PKU A;  4OQJ A;  3D3C J;  3JTN A;  3ETM A;  4NLY A;  5J2N A;  1OSD A;  3IG1 A;  1RTJ A;  3H42 A;  4FXV A;  3OHA A;  1PBA A;  5KFY A;  2BE9 B;  3W61 A;  1JLF A;  2P6T A;  3JSM B;  4PEO A;  4NXM J;  4LR8 A;  2Y1I A;  1AZS B;  5E3A A;  3T1H F;  2JX2 A;  1JXV A;  4ZLL A;  2W2M P;  2RQC A;  4DSI A;  4K4W A;  4LF9 J;  1QAX A;  3OJS A;  1ZA2 B;  3PX6 A;  4HH0 A;  2EFV A;  4FF3 A;  5AJ3 J;  3KHG A;  4J9L A;  1E6V B;  3UPF A;  4HT5 A;  1DTQ B;  1IBC B;  3HHL B;  1IBM F;  3OR1 A;  5LM7 E;  4RW9 B;  1L5U A;  2BR0 A;  1UWB B;  2BKP A;  1CJK B;  4H4O A;  5FDL A;  3C19 A;  2JHE A;  3I0R A;  1EET A;  3BPS P;  4JI4 J;  3ILI A;  3CT9 A;  2A2D A;  1T05 A;  3KHL A;  3ONQ A;  4O4G A;  2YNH A;  4ID8 A;  2F63 A;  2UUT A;  4W98 A;  2RIL A;  3X1L B;  3E3X A;  4UY8 5;  2IM2 A;  5HVG A;  4L73 A;  5JJB A;  2YKM A;  2NR0 A;  2XLI A;  4RBV A;  1KVI A;  2CVI A;  4NA1 A;  3TAP A;  4L74 A;  1EQM A;  1FDN A;  5K20 B;  4ENO A;  1LWE A;  4FYD A;  3ZZO A;  2AYB A;  1BXN A;  2R2T A;  2FHO B;  2QEX S;  1HW8 A;  2C2M B;  3HT0 A;  5C42 A;  3BGL A;  2ZH9 A;  1KC8 T;  2MMY A;  5CD4 H;  2Z2Y B;  3KNG A;  1UVK A;  3LW5 C;  3V6K A;  3U7J A;  4PWD B;  5CYQ A;  3ILL A;  4BHQ A;  3E51 A;  3ZTQ A;  2V8P A;  4F2R A;  2IYI A;  3W1Y C;  1WG4 A;  2NSB A;  3H25 A;  2DYA A;  3FFI A;  1MU2 A;  5DET A;  3PFE A;  4OJG A;  4U67 Q;  3GJR B;  3CWJ A;  4RU2 A;  3GON A;  2R42 A;  1NLK L;  2C2E A;  2LQB A;  3BSA A;  3DDK A;  4NEY A;  2HBR B;  3PM9 A;  2A6O A;  1VIX A;  2HHP A;  1HBN A;  1C0T B;  4C97 A;  2IC3 A;  4J9Q A;  2IM0 A;  3GJT B;  2DR5 A;  2DIS A;  2EG1 A;  3GCW P;  3MED B;  1VR6 A;  4KT0 C;  2BDP A;  2ZH8 A;  4G1Q A;  4DV7 J;  3TZW A;  1C0U A;  3TVY A;  2D7S A;  4OHW A;  1WI8 A;  3VTI A;  4UY8 T;  4Z37 A;  1FO1 A;  1S5Z A;  4YEA A;  1G7C B;  1FJE B;  3Q8P B;  1SC4 B;  2OML A;  4K8R A;  4DR2 J;  1X7V A;  4A47 A;  5J2Q B;  1SC6 A;  4CLY A;  2ROE A;  3MPY A;  3W7B A;  2IAJ B;  3EGV A;  2B5J A;  5A8W B;  3AQP A;  3JQJ A;  4IYQ A;  4LT6 A;  3RRG A;  3DDI A;  2IVY A;  3TVZ A;  4EWT A;  2BRK A;  3V6D A;  1HBU A;  3CDB A;  2GVZ A;  2IPO B;  2CPE A;  4DL0 C;  3CJK A;  1WJ9 A;  2FHJ D;  1N5S A;  3PRD A;  4RPF A;  2DGX A;  3FK4 A;  4G1P A;  1D09 B;  3QRQ A;  3SBM A;  4F67 A;  2FLL A;  5CYM A;  4DR5 F;  2FPH X;  2Z2M A;  2FVP A;  1H6K X;  5HMW A;  1HR0 J;  2KZM A;  5ETP A;  5D4L A;  1U0H B;  3VGS A;  3EMT A;  4M5L A;  1LW2 A;  3KLH A;  3QZ7 A;  4I56 A;  4RWW A;  2MQL A;  1GFW B;  2PMW A;  2ZD1 B;  2W1B A;  1PIL A;  3HKZ D;  4X65 F;  3G6E S;  3I5B A;  1YJR A;  2L48 A;  2WRM A;  3LF0 A;  3D1H A;  1TVR A;  4ILM A;  3VWS A;  2V9K A;  3R1L A;  2HHW A;  4P75 A;  2BXJ A;  4O3S A;  2F3J A;  3T3F A;  1PO6 A;  2IMO A;  4KHM A;  1WKJ A;  4XO0 A;  3IN5 A;  4DV5 J;  3UDE A;  1U1Q A;  1R0A B;  1K73 T;  1FRX A;  4I2P A;  1X9S A;  2CPY A;  4DR3 J;  3MFH A;  4NLX A;  3NNA A;  2BE2 B;  3MPV A;  2J0W A;  4B3O B;  1KQG B;  2OIH A;  2E5H A;  1YBT A;  4P71 A;  2HWI A;  3QT6 A;  4Q7A A;  2UVW A;  5D6G A;  3GIM A;  3ENA A;  3H8Y A;  1F3V A;  4P6Q A;  4MT1 A;  4NCG B;  4WYL A;  3LAK A;  4NL5 A;  2EFN A;  5J2P B;  2GGP A;  1BGX T;  2B8Q A;  3RG6 A;  2R7O A;  4Y2A A;  5KOW A;  2AGO A;  1VK3 A;  2X1B A;  3M1V B;  2QZ8 A;  5AE1 A;  5EWG A;  1B70 B;  1WOP A;  3R97 A;  2DKO B;  2F5G A;  5ETQ A;  1N56 A;  4KGK A;  1CLF A;  3O3L A;  5I3U A;  4IQX A;  3OL6 A;  1YZ6 A;  1S1X B;  3I4H X;  2GQ2 A;  3RZA A;  4OZJ A;  3EYZ A;  2PGC A;  5LJ3 Y;  3HFZ B;  2RHS B;  3DI6 A;  4ED8 A;  2YPZ A;  1S6P B;  4ZCK A;  4EZ9 A;  2ASY A;  4YR0 A;  3CGI A;  5GAH U;  4ICL B;  3D3B J;  3LWM A;  2HS4 A;  2MZJ A;  1NBE B;  4AE5 A;  2HAI A;  4NRU A;  3IS9 A;  4AQY J;  2EKN A;  4M95 A;  3DXS X;  2F8H A;  2E9T A;  1T3O A;  2CQ0 A;  4IKA A;  2RF2 B;  2ZWP A;  2V67 A;  1EX8 A;  1I94 F;  2IM1 A;  5G4D A;  1FNM A;  1WC4 A;  5GAD I;  4NPO A;  2NUU G;  4JI5 F;  1TK0 A;  1RTD B;  1D9D A;  3MUM P;  4NLS A;  1Q82 T;  2H65 B;  3IXQ A;  1KON A;  5C2C A;  2K1R A;  4YFU A;  1B99 A;  2OEJ A;  4IDK B;  3M9O B;  2MJU A;  4MK9 A;  5IT9 Y;  1RT6 B;  3DOL A;  2W25 A;  3UD4 P;  2Y1L B;  5HMZ A;  3ZTS A;  2F4F A;  1F9F A;  1NK4 A;  4IUF A;  3T41 A;  2ZH1 A;  2BJ8 A;  3M2V A;  3L7O A;  3E01 B;  3RBD A;  2FJB B;  3JQK A;  1KKH A;  2KB2 A;  1MU2 B;  4MYU A;  3DLG B;  3OFG A;  5HLF A;  2CWX A;  2VFV A;  3Q0A A;  4WCE Q;  5A8R B;  4R8U B;  5KTQ A;  4NEZ A;  4BWM A;  3K59 A;  3KLE A;  2MY8 A;  2E5L J;  3ICL A;  4J9S A;  1IQZ A;  4C8N A;  2KG0 A;  4OLO A;  4TXS A;  2FUG 9;  4OI1 A;  4R5P A;  3AB4 B;  4CLZ A;  1RAD B;  3QQC D;  2HQC A;  8RUC A;  2KM8 C;  1RT1 B;  2C42 A;  5D3G B;  1K0V A;  3AT1 B;  3PEH A;  3QRP A;  2PN6 A;  1LWC A;  3CE8 A;  5GAG I;  2R7X A;  2MEW A;  1W7W A;  2LA4 A;  2ADB A;  4QWC A;  6FDR A;  2HHQ A;  1Y3K A;  3LP1 A;  4JI1 F;  2HHT A;  4RW4 A;  4TY8 A;  1NK7 A;  2G9O A;  2B9W A;  5A2Q Y;  2YXL A;  1X5T A;  2I6W A;  4KYZ A;  3KJV B;  4DUT A;  5CAA A;  2M9K A;  1FX2 A;  3AXK A;  2ZE2 A;  3M8Z A;  5RUB A;  2R3V A;  2UUA F;  2QSF A;  2G0I A;  4IOC Q;  1C1B A;  3RGI A;  2XBP A;  4NLV A;  3SXL A;  1S0M A;  4DR6 J;  4TYA A;  1RT3 B;  1FJ7 A;  3OUY A;  1HD0 A;  2R8K A;  2HNZ A;  1U09 A;  2R8G A;  1H7W A;  1PJ6 A;  1ZAW A;  2KRB A;  3DRS A;  3KHR A;  1WSV A;  4UQT A;  4FYY B;  2HRY A;  2K2P A;  3R2D J;  2M3D A;  1PCA A;  1TKZ A;  2JC1 A;  4QW8 A;  3WBZ A;  1SL0 A;  2GIR A;  2KT5 A;  3SV4 A;  3MM9 B;  2DD8 S;  3I9Z A;  1NM2 A;  4B17 A;  3HJV A;  5E0O A;  3UN3 A;  1Z4U A;  2ASJ A;  1REV A;  1CC8 A;  3V4M A;  2U1A A;  2VBZ A;  3S6E A;  2HHH J;  1Q79 A;  3HF5 A;  4GVB A;  4HDH A;  2HFZ A;  4OX8 A;  1ZTW A;  5H9E K;  4KGX B;  2KL8 A;  3HDS A;  1VBY A;  3FMW A;  3I56 S;  2Z56 B;  4N7T A;  2C22 A;  4C0H A;  2K7K A;  4DL3 A;  3MMC A;  2PEH A;  2Y1J A;  3VAJ A;  2DT9 A;  2P8I A;  4YY3 F;  1Z2Z A;  1MG7 A;  1L3V A;  2JWN A;  4PYD A;  1FRJ A;  3AA9 A;  1Y3J A;  5LMN J;  2QFI A;  4NI2 B;  1JX4 A;  3IGV A;  3GFZ A;  5D0H A;  2OO4 A;  3CCS S;  5IFM A;  4DJB A;  1SL1 A;  1RHK B;  1D0E A;  4AFF A;  5KFO A;  4LSN A;  4ECY A;  2YNG B;  4K4Z A;  3SMZ A;  3DLJ A;  1S77 D;  3G82 B;  4CO2 A;  5F8N A;  2ZHB A;  3SDE B;  1NK6 A;  3M2U B;  2F9J A;  1KHW A;  4XDD A;  4QYZ J;  1CJU A;  3HLU A;  1P8G A;  4Z7C A;  2W9C A;  4OLP A;  4LFA F;  2EK1 A;  5KFZ A;  3NS5 A;  3BGF A;  4N5S A;  1NND A;  4L3N A;  3NXZ A;  2RDD A;  3NBP A;  1HYS B;  4OYI A;  4M5J A;  3GYX B;  4E8U A;  5C24 B;  1QE1 A;  2Z57 B;  2CQ1 A;  4PWU A;  1CUL A;  2SXL A;  3T1Y F;  4RW7 A;  2OPR A;  3NMA A;  4JI7 J;  3ZTP A;  4YR2 A;  3PYG A;  3CIM A;  3HHD A;  3HK2 A;  4KKO A;  1CS4 A;  1GNK A;  4OYW A;  1SJF A;  4LRA A;  2DB1 A;  1X4C A;  3H0P A;  5C25 A;  3OTC A;  1NJZ A;  2H5J B;  3M32 B;  2P9C A;  4NWB A;  2MST A;  1S1T B;  1FRL A;  4QPX A;  4I0W A;  4NLQ A;  4LBH A;  3P96 A;  1Y5N B;  2B6A A;  1IM6 A;  3NEK A;  2GO9 A;  2F8E X;  3T9N A;  2KRR A;  1KTQ A;  1ZZN A;  3R7B B;  1X8D A;  3QFW A;  4IG3 B;  1RWN B;  1M1H A;  1HIY A;  5LXY A;  4I1T A;  3GG0 A;  4FP9 A;  3A4T A;  1NHV A;  4M5H A;  1ELO A;  4Y6I A;  1SQF A;  2JEI A;  1WC6 A;  1FDD A;  2CNK B;  4GO5 X;  2VPZ B;  2VIC A;  2MJN A;  2O66 A;  3R6L B;  4ZCL A;  3TA1 A;  3PY8 A;  2ZJQ Q;  5H1S V;  5B09 A;  2N3O A;  3FMB A;  3HUL A;  3PKY A;  5KFI A;  1UL3 A;  4RNH A;  5FD1 A;  2MQN A;  3SSS A;  5HRO B;  2AZ3 A;  1S1V B;  2ZEJ A;  2L41 A;  3M8R A;  3RBZ A;  1CG2 A;  3KK2 B;  3M6W A;  1HFE L;  1KBR A;  2ZUG A;  2HEK A;  3CTR A;  1S9E A;  1WHW A;  5EWF A;  4LF9 F;  2NCK L;  3R7S B;  2NUH A;  3L9Z A;  2OI2 A;  3Q22 A;  4P52 A;  5AJ3 F;  4DX8 H;  2IY5 B;  1WD6 A;  1TAQ A;  3FGV A;  3C6T B;  4JI4 F;  4QWB A;  1RHQ B;  4B3S F;  2BBE A;  3M6V A;  2CZ4 A;  2DNZ A;  3SYZ A;  1G6B A;  1NK5 A;  1RT2 B;  1V5I B;  4USU A;  3THV A;  1G3O A;  3OHB A;  1L3T A;  4M5D A;  1DAX A;  1Q4R A;  2MY7 A;  4E98 A;  1RWV B;  4ZLJ A;  1VYA A;  1F3F A;  1U47 A;  1GMW A;  4CLK A;  4ZK7 M;  1XNR J;  1SC1 B;  2JDJ A;  4OJ1 A;  1C4A A;  1HA1 A;  1APS A;  1JLQ A;  3C66 A;  2UU9 F;  4NLU A;  2M8H A;  4C8O A;  1H2T Z;  5ETK A;  2B4P A;  4U7C A;  3HFK A;  1P9Q C;  1VFJ A;  3RJM B;  1VC6 A;  2AJF E;  3EVW A;  3M8S A;  5DLF A;  1OIA A;  3DLK A;  3QIP B;  2DNP A;  3DU5 A;  4LF8 J;  1ZYQ A;  4CLP A;  2K8G A;  4DL6 A;  1W2I A;  4CLT A;  4PPD A;  4LF5 J;  4NCA A;  4PUO B;  1UFK A;  3K8W A;  4K4U A;  1HPZ B;  3PW4 A;  2WVB A;  3GIL A;  5CZX A;  2R2U A;  2MSS A;  1FD8 A;  2LDY A;  3NOG A;  4USK A;  3HVT A;  1ZA1 B;  4KTQ A;  5D78 A;  3ELH A;  3PW0 A;  1MRO A;  4P74 A;  4PXB A;  1WKL A;  2OD6 A;  4J9O A;  3AXM A;  3DLE B;  5E7O B;  2BMB A;  1CPZ A;  5I3Q A;  1S6O A;  4KO0 A;  2JEF A;  1GTE A;  4FPR A;  2HRU A;  3W66 A;  1TL1 B;  3LAM A;  2XS2 A;  2VPW B;  1TP7 A;  5KT7 A;  4F4X A;  1NKC A;  5D4P A;  3H5S A;  3RW7 A;  4RR5 A;  2I5J A;  5J2M A;  1RWM B;  3M8P A;  2R7S A;  1GMV A;  3JAM Y;  2VV5 A;  4J9M A;  4ZPW R;  2JZ5 A;  4DZ6 A;  1TK5 A;  1RWW B;  4P2S A;  2DR6 A;  3AHP A;  3FBE A;  1X0P A;  2RD5 C;  1UWA A;  2JL9 A;  2WZ1 A;  1EAR A;  1KQF B;  1YJW S;  1RHR B;  1QE1 B;  4F2S A;  1B0V A;  2VBX A;  3MOZ A;  1P6T A;  4ZVT B;  3A3N B;  1JNZ B;  3MEG A;  3LA0 A;  2J8A A;  1HBM B;  1K1Q A;  3R5D A;  2XEX A;  2YTC A;  4ZS6 A;  3W2W B;  4L3K A;  2EFG A;  1R31 A;  1T3N A;  4QR0 A;  1NDK A;  4M5N A;  4C4W A;  3C16 A;  3HD1 A;  4KV8 A;  1YJ7 A;  3DOM B;  4DUZ F;  5IQ6 A;  5L38 A;  1HI1 A;  4NZ7 A;  1VQY A;  1HR0 F;  5HL7 Q;  1JLC A;  3R27 A;  5KFS A;  4OHZ A;  2C2N A;  4MKB A;  2ERR A;  5I4M A;  3U1N A;  2CPI A;  3K57 A;  3QO9 B;  1QSS A;  1WHX A;  1M5P C;  3DRP A;  2GJ2 A;  3CCR S;  2WB1 D;  4YB5 A;  1Q86 T;  4ED2 A;  4DFK A;  4N77 A;  1DQ9 A;  4TLR A;  2HG4 A;  2XMK A;  4HDG A;  4DCO B;  3F73 A;  1RIS A;  2VOD A;  2PC6 A;  3AOD A;  4NLO A;  4GRS A;  1U48 A;  2D3O 1;  3W63 A;  3H4B A;  2HND A;  3CC4 S;  1S4F A;  2CNO B;  2KXF A;  4FBU A;  4YB1 P;  3KLI A;  4LF6 J;  4RL1 A;  2EI5 A;  2NLW A;  3RRH A;  4B3T F;  2C1E B;  4ED3 A;  2NXN A;  3WQP A;  2L9D A;  4ID5 B;  2LKZ A;  1HLW A;  2DBB A;  3LUY A;  4MIA A;  2D9P A;  4RW8 A;  1U8W A;  5L1K A;  1TZ0 A;  3H40 A;  1NSQ A;  1UAW A;  1WSR A;  1PC5 A;  3JYT A;  2WHO A;  1U0S A;  3T6J A;  4JI8 J;  1R27 B;  3OTO J;  1J5O A;  2BM1 A;  5AXN A;  4RWX A;  2QFJ A;  4LVO P;  2LQJ A;  4K5S A;  2ROP A;  2M0G B;  2YQ1 A;  3J81 j;  2RUS A;  1WF0 A;  2AYE A;  1T9V A;  4I64 A;  2QRR A;  1OY6 A;  3EGW B;  4EZ6 A;  3FBB A;  4BBY A;  1PSD A;  3IA0 A;  1IKV A;  4QR2 A;  1S97 A;  1BHN A;  4LFB J;  2C3M A;  3NNC A;  3MM8 B;  1WUU A;  3PRV A;  5DGB A;  4KQZ A;  3QGG A;  3HI9 A;  3NNH A;  3LAL A;  4NYP A;  5ETV A;  4OZ5 A;  1FWL A;  3IMQ J;  3K5N A;  4KFB B;  1V3S A;  2Q66 A;  4C8M A;  1WEZ A;  3GLJ A;  2UXB J;  2MQM A;  2VPY B;  3H4D A;  2PO4 A;  3MMA A;  4UOF A;  4HAC B;  4D3H A;  1RWO B;  2N4C A;  2N7Y A;  4EYI B;  4CP5 A;  1KEK A;  1HWJ A;  4IG0 A;  3H5X A;  3KG0 A;  2BOA A;  1JJH A;  1NU4 A;  1CSJ A;  4ZVH A;  2AJ2 A;  2DJW A;  3K17 A;  4OI2 A;  1T03 B;  1QJH A;  4BLG A;  4H4M B;  5E2Q A;  2C3Y A;  4QQB A;  5BR8 J;  1MN7 A;  2V8H A;  4UW2 A;  1U2R A;  4V19 X;  1TKX B;  1U6B A;  3GG1 A;  1N5V A;  5IQQ A;  2G0J A;  4MTP A;  3ZNU A;  4OYM A;  1BQN B;  2PD1 A;  3N0V A;  4K4X A;  1WAC A;  3EGN A;  5HP1 B;  1C2P A;  3EIC A;  1S76 D;  1GMU A;  1RTI B;  4Q45 A;  2R7T A;  1C1C B;  4C98 A;  4PG5 A;  3V81 B;  3U02 A;  1A9N B;  3J7Z 5;  4MFB B;  1VQ5 S;  2OP5 A;  4DSJ A;  3FSX A;  2CNN B;  2JRS A;  2I9S A;  2ZFH A;  3PHE A;  1QVF R;  3AJ1 A;  2KU7 A;  1SJQ A;  3TX0 A;  4DV4 F;  2LEA A;  5KFF A;  4X4V A;  2BEF A;  2XY7 A;  3FEX B;  3ILJ A;  5DQH A;  3M05 A;  2C3U A;  2WW8 A;  1ZM3 A;  1JJ4 A;  3MPU B;  2PSZ A;  5HSP A;  1FTR A;  4LJM A;  3D9B A;  2G4B A;  1KLM B;  4H4K A;  4XAK A;  3CDE A;  1HHT P;  2PEB A;  2P9E A;  3D67 A;  2PII A;  2EEY A;  2HNY A;  1YIT S;  4E0D A;  3TA0 A;  4QYR A;  3B8H A;  2ZKT A;  4TY9 A;  1GK8 A;  5HVF A;  4JUZ A;  1NZ8 A;  1FRH A;  2PA3 A;  5A6W A;  4LSZ B;  1SV5 B;  1RTZ A;  4RJV A;  4EFA C;  4I67 A;  2DNN A;  3HT3 A;  4DR6 F;  2XYG B;  5ETN A;  4TLQ A;  1YI2 S;  2JVR A;  5KFV A;  3KNA A;  4KJI A;  1WC3 A;  3MEK A;  2COL A;  3Q2T C;  4K50 A;  1S49 A;  2QJ3 A;  3TAM B;  3KOA A;  4C7Q A;  4KB7 A;  4A8O A;  2HAF A;  4IO1 A;  5IWA J;  4IFY B;  5DDP C;  2R7V A;  2J7U A;  1A0O B;  3MOJ B;  1CC7 A;  4ES2 A;  3M2R B;  3SQG A;  2XY6 A;  4HEA 9;  5KG6 A;  1S7I A;  3UD5 A;  3J7Z T;  2H54 B;  3HVR A;  2U2F A;  1YDL A;  3BKT A;  4USM A;  4Y0F A;  4M94 A;  2XNR A;  3LWL A;  1SKU B;  3ETO A;  4H4K C;  4IO9 Q;  1KQS R;  2MKK A;  4HL9 A;  2XY5 A;  4X4R A;  5H9F J;  1QAJ A;  3ZZZ A;  3DRR B;  2YNI A;  2E1A A;  2WSC C;  3IWX A;  3BGR B;  3UCU P;  3UNY A;  2A1B A;  1FFG B;  2V2Q A;  3O8W A;  3MMB B;  3H20 A;  2DCL A;  4ZPA A;  5LMN F;  5A8K A;  1MWZ A;  3R8Y A;  1M5S A;  3MR7 A;  1HQU B;  3VVT A;  2BAN B;  2XO6 A;  1TKT B;  1FXL A;  5DDQ C;  3KWM A;  3GU0 A;  4L75 A;  3EUN A;  4IOA Q;  3BQ0 A;  4K7Q A;  3HSZ A;  1FXD A;  1N48 A;  3Q24 A;  4DV2 J;  1N6Q A;  1TL7 A;  4BDP A;  3NKY A;  3NGS A;  2Y8W A;  1R7I A;  3D6F B;  4C8Y A;  3HVA A;  3J80 Y;  1ZAX A;  3CJT A;  3POT A;  1IBL F;  4DLG A;  1WDD A;  3SI8 A;  1G4C A;  4WWS A;  3UO0 A;  2AGQ A;  4WJB A;  1NH7 A;  1S9G B;  1GT8 A;  5IM0 B;  4WFZ A;  3CB4 A;  2WON A;  1E6Y B;  3CNQ P;  2VD3 A;  4OI3 A;  5KFC A;  2ILZ A;  3GP9 A;  1RAO A;  3LH2 S;  1SJ3 P;  2E1P A;  4GKK J;  4I7F A;  3KK1 B;  1QY7 A;  1YX2 A;  2R7Q A;  5K8N A;  3OSP A;  2YKP A;  4HHU A;  3CME S;  4M5M A;  4U96 A;  2QL7 B;  3OR2 B;  1T94 A;  1QUP A;  1RT5 A;  2GIF A;  2NPF A;  1CJT A;  2OPP B;  1YRT A;  3ENQ A;  3D66 A;  2R8I A;  3CJ3 A;  4A8W A;  1FVQ A;  1FWK A;  3G86 A;  4Q44 A;  3CCZ A;  1XMQ J;  3W9J A;  4NLR A;  1OPZ A;  1VQ9 S;  1BLU A;  2FIU A;  4DSL A;  3J7A 1;  3CJ4 A;  2VU5 A;  4FZV A;  2FC9 A;  4E2F B;  5GAE I;  3VHQ A;  3R9L A;  3DYA B;  1R8H A;  3A12 A;  3OFH A;  3O2I A;  4LRF A;  2R2R A;  2J9E A;  3OXF A;  1S6Q A;  1GMW D;  4S0M A;  2BJE A;  3OTE A;  3V4I A;  3C15 B;  4MKY A;  2NPI A;  6AT1 B;  2WTF A;  4FYV B;  5JVH Q;  1H2U X;  4F7V A;  3CJR A;  2HBZ B;  4WE1 B;  2EK6 A;  2VG7 A;  1HHS A;  3IBF B;  2CJB A;  4I2Q B;  1LOU A;  5D4O A;  3PIO Q;  3NCP A;  3M6U A;  3UCG A;  1OQ3 A;  2ASD A;  3M9N B;  4H54 A;  2B9Y A;  2RKI B;  4K59 A;  3KUH A;  3FCV A;  2KN4 A;  3MUT P;  1G1X A;  1YBA A;  3W5Y A;  4WFY A;  1MNE A;  2AX0 A;  3EJM A;  1UVL A;  4DV6 F;  1F2H A;  2UVV A;  3TJ8 A;  4LSL A;  2P9G A;  3EXC X;  3BR8 A;  3G8T A;  3CMA S;  1RE1 B;  2YNF B;  4PR6 A;  3KJQ B;  1NDC A;  1P1T A;  4ZVO B;  4OJH A;  3NLC A;  3H2U B;  4CT8 A;  2J0Q D;  4NLD A;  1JXL A;  4PG6 A;  3U1L A;  4NX9 A;  4P73 A;  1AUD A;  1UPP A;  4CO5 A;  4CDI A;  1IBK J;  1F6T A;  4A8Y A;  3EXY A;  1UVI A;  3ZZ0 A;  2VC0 A;  1M5K C;  2ZM6 F;  3KDN A;  5KFR A;  3K8V A;  4FYX B;  3N5B A;  1RBO B;  2FVS A;  1X60 A;  2PDA A;  2VFT A;  1K8A T;  3IFE A;  2XQC A;  1QSL A;  4ANC A;  3DC2 A;  2XLK A;  2R8J A;  2DNR A;  2F4V F;  1NUE A;  4D3G A;  3X3U A;  2XSJ B;  1SPB P;  3CO9 A;  2RRN A;  2WCX A;  2IVF B;  4ZJQ A;  3ET6 A;  1SC3 B;  4OJ3 A;  4P10 A;  2IA0 A;  1R43 A;  4O3P A;  1NME B;  5DZ6 A;  3NGK A;  3DGP B;  1WG1 A;  3BDP A;  3OL8 A;  4FF1 A;  2W7A A;  2O5D A;  2MZ1 A;  2ALZ A;  2HS0 A;  4EEY A;  1S1U B;  4CTA A;  2XUL A;  2LYV A;  3TUJ C;  4U7U D;  1N32 F;  3ZFV A;  1B0T A;  1UMJ A;  2FGC A;  5CCL A;  4QIV A;  1T9W A;  2GW8 A;  1LK5 A;  4B9L A;  1D8Y A;  2XZD B;  1HNI A;  4UOG A;  4ZVS B;  4UOC A;  2ROG A;  3LQV A;  3VR1 A;  4JYA J;  1PG5 B;  1YJ9 S;  3DM2 A;  4QWA A;  3ITH B;  3PX0 A;  3FQL A;  3FZ2 A;  4QIF A;  2GIQ A;  4A48 A;  3P5B P;  2VDI A;  2VAS A;  3JB9 k;  2XMU A;  4IRC A;  1UKU A;  1QUV A;  3R2C J;  3D6H B;  4FPI A;  1KVK A;  3BF4 A;  4WTY A;  4CWB A;  5BJR A;  4Y65 A;  4PQU B;  4W90 B;  4TKT A;  1TTH B;  2OPS A;  4J9P A;  3P4U B;  3H5U A;  4O0N A;  1TUW A;  4N76 A;  1AT1 B;  2NS1 B;  1QSY A;  3OFF A;  2JLE A;  4QWD A;  3RAM A;  5CCM A;  3V5R A;  2B56 A;  2LLZ A;  3CJ2 A;  4Y28 C;  2BE7 D;  3GJS B;  2GO8 A;  2AEF A;  1X5O A;  4ILL A;  4OI0 A;  2NSC A;  2VA3 A;  1VCT A;  3FSY A;  3QLH B;  4DZD A;  4N8O A;  1N54 B;  1S0O A;  1HL6 A;  1XNQ F;  3KHH A;  1Z1Z A;  2E5G A;  3W9I A;  4LFC J;  3JSM A;  2B8P A;  2V69 A;  4DLE A;  2HZC A;  3W62 A;  5DO2 A;  4NML A;  3AA8 A;  3MCO A;  1AZS A;  4B9S A;  1JXE A;  2CAD A;  1N88 A;  1HD1 A;  3ZXW A;  5K8M A;  1WHY A;  4OHV A;  2A6M A;  4B3R J;  3R5B A;  3KFW X;  1T9X A;  3TZZ A;  2QMU B;  1IKY B;  1TL4 A;  1NEE A;  1NRK A;  2E9R X;  3BEG B;  3MPW A;  4HR2 A;  2FZG B;  3UR0 A;  1E6V A;  4LRD A;  1DTQ A;  2CQI A;  2BJ7 A;  3HHL A;  1HBO B;  3BM7 A;  3I82 A;  3KG4 A;  4DG1 B;  4DSK A;  1NHK L;  3TI0 A;  4RW9 A;  4DV0 F;  1Q95 G;  1UWB A;  4M5I A;  2HGL A;  1CJK A;  4LRE A;  2RB7 A;  5DG8 A;  2N3L A;  4IRK A;  1RWK B;  3GR0 A;  3CDA A;  2XO7 A;  1ICE B;  4X62 J;  1UVN A;  3QGI A;  3W64 A;  2HS3 A;  3R5G A;  2V6A A;  1FJG J;  2QLF B;  4J9N A;  5E41 A;  4JI8 F;  4C9D A;  3WIU A;  1VRT B;  3C8Y A;  5DRK A;  3EDQ B;  2DNL A;  2QL9 B;  2LXU A;  1W26 A;  4IH7 A;  4ZVF A;  1Q5V A;  2IFX A;  2EG2 A;  1SKW A;  2DY9 A;  2Q43 A;  1DJ0 A;  3IM8 A;  2MHN A;  2VL1 A;  2VOO A;  3WIV A;  3PVX A;  2HUR A;  3CO0 P;  3OXG A;  4EO6 A;  5BYS A;  2YWF A;  2UVR A;  1T02 A;  2DGQ A;  5HAO A;  4OHX A;  4YP3 A;  1N34 J;  2YVS A;  4ZVG A;  3FVY A;  2M5Y A;  1FHT A;  3UDL A;  4JI0 J;  1S0V A;  2IM3 A;  3A3P B;  4TU8 A;  1OY9 A;  4PXE A;  3UVJ B;  2V2V A;  4PWD A;  1S1W B;  5KFW A;  1RGV A;  3BH7 B;  1XMB A;  5L8R C;  4A8K A;  4K2J A;  4N41 A;  4NOH A;  5LJ5 Y;  5F9L A;  4NCB A;  4OZ0 A;  2Y3Y A;  4J9R A;  5AXK A;  3NGD A;  3BQ2 A;  4DUY F;  5CXT A;  1C0T A;  1XIQ A;  3Q23 A;  3WX8 A;  4FDF A;  2RSQ A;  2JSX A;  1I51 B;  2RT3 A;  1BQX A;  3LAN A;  4OX6 A;  3CSK A;  2X1G A;  2CQ3 A;  5ETM A;  3MED A;  1UEV A;  2C2D A;  5BYQ A;  1U1O A;  1RBL A;  3DRY A;  4DR4 J;  2MZR A;  2CKW A;  4PYA A;  1TUG B;  2O3D A;  3TJ9 A;  4F4W A;  3HO1 A;  4ILR A;  3RBE A;  2NXJ A;  3TO8 A;  3EE3 A;  2CQ2 A;  4F04 B;  3D6M B;  4URS A;  2I2Y A;  3NP5 A;  5J2Q A;  5KOX A;  3ISN C;  2IAJ A;  2DK2 A;  2QN6 B;  2EFQ A;  1KHV A;  3UE2 A;  2PI5 A;  2K7J A;  3IWL A;  1V3R A;  1CQM A;  5A8W A;  3GZ7 A;  2OLW A;  2AYG A;  3O6Q A;  2AD9 A;  2OGU A;  4K4T A;  4Q2L A;  1DY3 A;  3BSO A;  4ZCI A;  4AL5 A;  2AP6 A;  3VAG A;  1AUS L;  2QLB B;  4FF2 A;  2HLT A;  4RBT A;  4BS2 A;  4ES1 A;  4YR3 A;  2QO3 A;  3CDU A;  2A18 A;  1DRZ A;  4KPY A;  1DUR A;  2CDR B;  1ZAV A;  2BQ3 A;  2WSF C;  4UT4 A;  5U47 A;  1GTH A;  1SIW B;  1VQK S;  2CYY A;  2BQU A;  3K5L A;  1NKE A;  3V6H A;  1Q8B A;  3VAK A;  3DCA A;  2ZH7 A;  1U0H A;  1J27 A;  4M8L A;  2IHR 1;  4O3R A;  3TVK A;  1UTA A;  4OZ1 A;  2DGT A;  1T9T A;  4A8X A;  4LRB A;  2DGW A;  4X66 F;  4Q0B B;  1MMD A;  3LGN A;  1QVG R;  1D9A A;  2ZD1 A;  2LQ8 A;  2E9Z A;  1WC0 A;  4ECW A;  3W5X A;  5HO4 A;  2G0C A;  4M5K A;  4CCH A;  1Q78 A;  3GFY A;  3GWC A;  1P1L A;  3D2W A;  5D8H B;  3BN4 A;  1ULR A;  2C2Z B;  2V9W A;  3MM5 B;  4NZ0 A;  4I6Y A;  3OVS A;  3Q86 A;  4Y2M A;  2MKJ A;  1REG X;  3LP0 B;  2ZZN A;  3UN5 A;  3RB6 A;  1R0A A;  2W4D A;  2CNL B;  2BE2 A;  2GA7 A;  4QYZ K;  4B3O A;  2BZ2 A;  1JK9 B;  5F0W A;  5CZV A;  1DTT B;  5F8I A;  2LMI A;  3GTY X;  3CCM S;  4CLU A;  1RCO B;  2RU3 A;  3M6X A;  1T9Y A;  3MUR P;  2CZ9 A;  1X4G A;  3AOB A;  1RAJ A;  2DNG A;  3H98 A;  5J1P A;  1I1G A;  4U8Y A;  1HNV B;  3TZY A;  4NCG A;  2DO0 A;  5J2P A;  5B08 A;  3DMJ B;  4CNZ A;  2RRB A;  4U9R A;  3J7Y U;  3M1V A;  4LF2 A;  2KO1 A;  2AT1 B;  3B54 A;  2OSQ A;  2IYG A;  2FHK A;  2ZC3 A;  4ECZ A;  4DCP B;  3PIP Q;  1CJV B;  1FEE A;  2Y1R I;  2HGM A;  1S1X A;  2D9O A;  4U7U K;  1EP4 B;  5HK4 A;  3T1H J;  2HGN A;  4TQR A;  2X1A A;  1S6P A;  1HQE B;  1N5T A;  4ICL A;  1IUJ A;  3G9C A;  2E5I A;  1RAB B;  2RS8 A;  4ZMM A;  4B9T A;  5B0E A;  1WEX A;  2FYX A;  4WFA Q;  1YBU A;  1FK9 B;  3IP0 A;  2Y0B B;  1X4F A;  2AQ4 A;  2LXI A;  2FJV A;  4X4Q A;  3SSR A;  1FEH A;  2RF2 A;  1JLG B;  2BJ3 A;  1UA1 A;  4B3M F;  2J0S D;  1YQH A;  1IWA A;  4WP9 A;  1BQM B;  2OSR A;  2HRT A;  1RTD A;  4ALZ A;  5KFN A;  2FVQ A;  2OAU A;  5HMX A;  1U1P A;  2Z58 B;  2RS2 A;  2RH3 A;  1TMJ A;  4IDK A;  2XC9 A;  1RT6 A;  3QFH A;  3PZP A;  3CC7 S;  3NCQ A;  3UN2 A;  4JOU A;  2W7P A;  4AXI A;  1LNQ A;  5A0Y B;  1YJU A;  1RT4 B;  3E01 A;  3GQC A;  4OYP A;  1TAU A;  1HI8 A;  1TV6 B;  4NMX A;  1RSC A;  4KH0 B;  2HHS A;  2WBM A;  2L08 A;  4ZHR B;  1N8R T;  4F25 A;  2GQQ A;  5T41 A;  2MYF A;  4TYB A;  3DLG A;  2V4R A;  2VZ9 A;  1M1K T;  2BQR A;  4YQW A;  3J7A N;  1VQ4 S;  3KLF B;  2FTR A;  5A8R A;  4ZVP B;  3DLH A;  4R8U A;  4OYO A;  4FN5 A;  2Z2L A;  3M4X A;  4IFV B;  4Y3C A;  1FDB A;  3NS7 B;  4X4T A;  4KGZ B;  1KFS A;  4USI A;  3VGV A;  2KFY A;  5DM6 Q;  4J7C A;  2FY1 A;  4HHH A;  2HPU A;  1BC6 A;  1RT1 A;  2QYG A;  5D3G A;  2HMI B;  1BY9 A;  4O23 A;  5K14 B;  4O44 B;  3B4M A;  4TVA B;  2EXU A;  1HNZ J;  5FJ4 A;  2XZW A;  3T5H A;  1IWG A;  3D0I E;  1RAG B;  1AFI A;  2MGZ B;  2ZUA A;  5ETO A;  1ZOT A;  2OEK A;  3CUN A;  5LSR A;  2HFN A;  3KJV A;  5C5J A;  2XI3 A;  4Z2X A;  2WSE C;  3F44 A;  4ED1 A;  4KSE B;  4F4Z A;  4JI2 F;  5SUH A;  2W8L A;  3HXM A;  1PAU B;  3VZI A;  1NPK A;  1N5Q A;  2Z0G A;  3MI7 X;  3HKW A;  4KY3 A;  4OZ3 A;  1EKR A;  5DQG A;  1RT3 A;  4OV1 A;  4ZVU B;  4C8Z A;  3IRX B;  5G0R B;  2XNQ A;  1MML A;  5DS7 A;  3NAH A;  1R8P A;  4WKR A;  4L76 A;  4KHR A;  1H72 C;  3MM9 A;  1OYD A;  2GAG C;  1PJ5 A;  5L39 A;  1MLA A;  2CQP A;  1KWM A;  1RU2 A;  4USW A;  1VGY A;  2NRE A;  1FTC A;  3CUL A;  3H59 A;  2J9D A;  1B7Y B;  2J7W A;  2IRU A;  2BAB A;  2HIQ A;  1Q5Y A;  2ZBP A;  5HN0 A;  3GIJ A;  5EGY A;  3E8O A;  2V34 A;  2XCA A;  1S10 A;  2QA4 G;  3DU6 A;  2QL5 B;  3HZE A;  3OTD A;  4DR5 J;  4XK8 C;  5DQI A;  2MZS A;  2RRA A;  2CXE A;  1LFP A;  1VQN S;  4WK1 A;  2HFO A;  1UEK A;  2L9N A;  2MB0 B;  1M5O C;  3PW7 A;  4EK2 A;  5LT5 A;  3IC1 A;  1QLN A;  2J7K A;  1UVJ A;  5HBM B;  1VRQ C;  3P3D A;  4NI2 A;  4DL5 A;  1XMO F;  1J5E F;  1YSJ A;  4X65 J;  4FXW A;  2YNG A;  3BKF A;  1WKK A;  5L1I A;  3RAX A;  4UUW A;  3WHI A;  2BKN A;  2B9E A;  3G82 A;  3OW2 R;  2IDE A;  3SDE A;  4NYZ A;  3FQK A;  3M2U A;  3AB2 B;  1HNX J;  5L1L A;  3A8I A;  5F9N A;  1WOR A;  3MM6 B;  1QTM A;  1YRX A;  2YWE A;  2HQ3 A;  3W5Z A;  1M90 T;  2WOM B;  4HI2 A;  5DJB A;  1LV5 A;  1Q7L B;  1I6J A;  2ABY A;  2D3U A;  4OX9 J;  4JYA F;  3NGT A;  4LF4 F;  1WNE A;  3DFE A;  4C3K A;  3CCL S;  1HYS A;  1WTB A;  5C24 A;  4RNO A;  1LEO A;  2CQD A;  3TUZ C;  1JJC B;  3OV7 A;  3NCR A;  2DIV A;  3OVA A;  1V3Z A;  2E29 A;  2HQD A;  3GII A;  1RYR A;  4ETZ A;  3M32 A;  1KFD A;  4ETX A;  3SIP B;  1P27 B;  3D28 A;  4ECU A;  4A46 A;  1S1T A;  2B4O A;  1LK7 A;  2P6S A;  3IBW A;  3UD3 P;  3HHL D;  3A8K A;  3CCW A;  2H5E A;  4DR7 F;  4PQA A;  4QCL A;  2X3D A;  5DDO C;  1SJR A;  3T1A A;  2VFU A;  1KNZ A;  5M2U A;  4IG3 A;  2HHX A;  4DMZ A;  4JI3 F;  1LXN A;  1Q81 T;  4R25 A;  3U1M A;  2KYX A;  4X4P A;  2MDA A;  2FVC A;  1FRK A;  1IM4 A;  1S99 A;  3DKD A;  2E7X A;  3F56 A;  2JFD A;  2YQ0 A;  3FCW A;  2M88 A;  4CLL A;  2HSE B;  1RTH B;  1X4A A;  3NWG A;  3RYL A;  4DR1 F;  3A1Y G;  4OFZ A;  2H3E B;  2ZDO A;  3K5O A;  3BH6 B;  2DPI A;  3TP2 A;  2LU1 A;  5KG2 A;  5DG9 A;  5B0D A;  4ZPC A;  2W2P P;  2ZC4 A;  1I94 J;  4LFC F;  2G2O A;  5THW A;  1GEH A;  4XPC A;  1RWX B;  1KN6 A;  2YPY A;  3MCS A;  2DR9 A;  4I6A A;  1NO8 A;  1IXK A;  3D6T B;  1VC0 A;  5B7W A;  5HRO A;  3AD9 C;  4DQR A;  2VBW A;  1VQO S;  3NMR A;  1S1V A;  3KK2 A;  2ATL A;  2EFO A;  5LSO A;  4G3I A;  1NPR A;  2NYI A;  2QLJ B;  2DHH A;  4B3R F;  1NB2 A;  3PR4 A;  1VMB A;  1OPI A;  3ISN D;  3JXO A;  4C11 B;  2LP4 A;  2DGV A;  4NA3 A;  2WW4 A;  4WXW A;  1ACM B;  3IR6 B;  1U7L A;  2B43 A;  2DCU B;  3MAA B;  2HVH A;  5HAN A;  4DQS A;  2CPD A;  1SI9 A;  2HK3 A;  4FVC A;  2RNE A;  3OSN A;  1HHQ A;  3GYG A;  2V8V A;  4F0K A;  3QJL A;  3PRB A;  4M63 A;  3QWU A;  2GS8 A;  2G1D A;  1U1N A;  2IJR A;  3CD0 A;  3GSD A;  4P2M A;  1FI4 A;  2JNJ A;  3C6T A;  1TKD A;  4TNO A;  2XMV A;  2K06 A;  1DLO B;  3K89 A;  2RDJ A;  1RT2 A;  2JFK A;  3A13 A;  4P72 A;  3MM7 B;  2UV8 G;  3H90 A;  1FJG F;  2OPQ B;  5J1E B;  4U6P A;  3VAL A;  4QIE A;  1S12 A;  3I96 A;  4JV5 J;  1JLA A;  2B51 A;  1K9M T;  2MTL A;  4ZVE A;  4A8S A;  1BUX A;  3EX7 B;  2AJ0 A;  3D7S B;  2H5I B;  4KC5 A;  4QOT A;  2WB4 A;  3BZQ A;  5CH7 B;  2M70 A;  5F3Z A;  2BJD A;  3R5A A;  2AEM A;  5ETR A;  4OI4 A;  2YY3 A;  4I4B A;  3BB5 A;  2VON A;  2RU9 A;  2RIJ A;  1SVD A;  2JVO A;  1VS3 A;  4PRF A;  2KT3 A;  2ZVI A;  2FZC B;  3SFG A;  5KFM A;  4OZN A;  5E5N A;  4JI0 F;  3QIP A;  3L4B C;  4GC7 A;  4MKA A;  4DS5 A;  2VIH A;  2MQP A;  2LCW A;  2UUA J;  1NDL A;  1V9O A;  4JV1 A;  5F8H A;  2GCF A;  3BYP A;  2A0F B;  2ACY A;  1X5P A;  2ZOM A;  4PUO A;  2Z8Q A;  1HPZ A;  1NJW A;  4ECS A;  1HMV B;  2LEC A;  3BO2 A;  2KXN B;  1XK8 A;  5JVG Q;  3MTK A;  1LW0 B;  3WX4 A;  2K3K A;  2DTJ A;  1F60 B;  1FES A;  3DLE A;  4ZJL A;  3GMG A;  4J5O A;  4F26 A;  3H7H B;  2X1F A;  4MYT A;  2H9Z A;  1KQK A;  4J90 A;  3AFG A;  1I3O B;  5CA5 A;  3RAQ A;  4RLE A;  5IZH A;  2OJ3 A;  1TL1 A;  1VDH A;  4CO4 A;  4ZLP A;  3QT8 A;  3FBC A;  2B0G A;  2V0N A;  4V19 J;  2NZC A;  3QMQ A;  1S57 A;  2V4J B;  5B0A A;  2QLW A;  4F3M A;  4ZP7 A;  4GKJ F;  3L7P A;  4KH1 B;  2J6S A;  2VB6 A;  1BWE A;  1N33 J;  4YY3 J;  3HX9 A;  3W2V B;  3R3T A;  1B64 A;  5GAH I;  4B9V A;  3MMJ A;  4X64 F;  2CRL A;  2ZH3 A;  3I31 A;  4WU2 A;  4F8R A;  2QC3 A;  3DRX A;  2VQE F;  2CDQ A;  4YB7 A;  3BQ1 A;  1UJ6 A;  3CJQ A;  5IT0 A;  2J6U A;  4LF7 J;  5KT4 A;  1U2F A;  1QM9 A;  1HBM A;  3W2W A;  1JKH B;  4F02 A;  1H7X A;  3GFH A;  2FLP A;  2WVF A;  1VRU B;  4WFB Q;  3RUB L;  2QA2 A;  3MD3 A;  4MK7 A;  4HTI A;  3G71 S;  1JQG A;  4PWW A;  3DOM A;  3ZZU A;  3MAQ A;  1ZM4 A;  5L9N A;  4LFA J;  1X4H A;  1NK8 A;  1PGZ A;  2YWK A;  2ZNZ A;  3P8B B;  1FFS B;  5KFA A;  3QO9 A;  3ZZR A;  1UW9 A;  2MQ8 A;  4OL8 A;  5H9F K;  2HW3 A;  4C2M A;  4RW6 A;  4NLW A;  1HQ2 A;  1UJ5 A;  4CYU B;  3DOK B;  2MKY A;  5KAK A;  1AFJ A;  4BC7 A;  4USV A;  4DPU A;  3EDR B;  3CXC R;  2UUC F;  2ZH5 A;  5D15 A;  1KP6 A;  1D3W A;  3TRG A;  3QWP A;  2V50 A;  3THP A;  1M0S A;  1SB6 A;  5EDW A;  2LFV A;  3MR6 A;  1JLB B;  2QGF B;  3I5A A;  2W01 A;  2ZZM A;  1YK9 A;  1FA0 A;  3QSI A;  4Y2C A;  4NXM F;  4DN9 A;  2OD4 A;  2NXU A;  3D1Q A;  1OWX A;  4ID5 A;  5D0R A;  3PW2 A;  4LVN P;  1NSK L;  4MIB A;  1SUQ B;  1D1U A;  1S6U A;  5HQL A;  1SQE A;  4QPT A;  1KVJ A;  5IS2 A;  4WFX A;  2APO A;  2DNQ A;  3GE9 A;  3GR1 A;  2GNK A;  3HVW A;  3PAC A;  4O3Q A;  5KFT A;  5LMU J;  2ZKU A;  3MHY A;  1UFW A;  2YKN B;  3OBI A;  4O4R A;  1NHU A;  4HHJ A;  3MR5 A;  2H48 B;  5KFD A;  1N5Y B;  2JOQ A;  1UZH A;  1RKI A;  2VOP A;  4MMO A;  4KHP J;  4AD6 A;  2HQF A;  4DQP A;  3KMS A;  2AX1 A;  4A8Q A;  4DV1 J;  2VFS A;  4HKQ A;  1H73 A;  4F0H A;  2FJX A;  3FZB A;  4ZPB A;  4ED5 A;  4WPA A;  4X4U A;  2C2K B;  4CO0 A;  2ZBR A;  2FJA B;  1S7H A;  4CRJ A;  3UNG C;  3NG8 A;  1FKO B;  1L3S A;  3VVU A;  4PZV A;  4A4J A;  3W3S A;  1PYO B;  4W4M A;  3HFV A;  3RU0 A;  3M8W A;  3MM8 A;  2NQP A;  2AMC B;  1Y5I B;  1JLA B;  2Y8Y A;  2FHM A;  4KFB A;  2J0X A;  2IJN A;  2MPU A;  1J2V A;  1YIJ S;  4Y2K A;  2ASL A;  1L3U A;  2J76 E;  4XIU A;  4HAC A;  1FKP B;  1U6F A;  2ZBC A;  2FJE B;  4TU7 A;  4QZV B;  2Z30 B;  2QYC A;  4B3S J;  1T9U A;  2UXC J;  3OTB A;  1UPM B;  1HWI A;  2HZV A;  3MPD A;  2KI2 A;  3TAR A;  5I42 B;  1NPP A;  2YBV A;  4C0B A;  4DOZ A;  1T03 A;  2GVD B;  3MF5 A;  3BSN A;  4H4M A;  3G87 A;  3LTO A;  3AQO A;  1XEZ A;  1M5V C;  1TKX A;  2CIM A;  3SSQ A;  4CI0 B;  4C3L A;  3KMQ A;  1QTN B;  2BM0 A;  1AB8 A;  3B6B A;  4O3N A;  1Y11 A;  4RNF A;  3LP2 B;  3IAM 9;  2VBY A;  1XN9 A;  2ZHO A;  4ER8 A;  1BQN A;  2WVD A;  3J81 U;  1N4L A;  5HP1 A;  3IGN A;  3I87 A;  4P2X A;  1S48 A;  2MLY A;  5GAD U;  1RTI A;  3CPW R;  4WU3 A;  2UU9 J;  4DBQ A;  1IKW B;  4Q43 A;  1TEL A;  3QAE A;  1ZTT A;  3DDN A;  1C1C A;  3PCO B;  4YDX A;  2IIH A;  1RLC L;  3V81 A;  1YJT A;  1AW0 A;  1RP5 A;  1WG5 A;  1ZZF A;  4MFB A;  2RVJ A;  4DV7 F;  2D3Z A;  1LFW A;  1R0C B;  1EIY B;  5KFJ A;  2PE8 A;  3C46 A;  3N9U C;  1O0P A;  5L9X A;  4Z7Y A;  2W9B B;  2GQC A;  2ZOF A;  2R7W A;  2ZH2 A;  4DR2 F;  5IT9 U;  4LR9 A;  3Q8U A;  4PG7 A;  2POK A;  3I0S B;  2GJF A;  1HNZ F;  3FRY A;  5HQ8 A;  6FD1 A;  2JLF A;  2ACM A;  1TL3 B;  4IQM A;  2DH9 A;  5KFX A;  1T7P A;  1KLM A;  2QV6 A;  3MEC B;  4KRW A;  2I1R A;  3CDW A;  1U24 A;  2F7V A;  3F0N A;  2FQQ B;  2R7U A;  4FYW B;  4FS2 A;  1WOO A;  2M7S A;  2OFH X;  2H4Y B;  5FLX U;  1VLO A;  2CAJ A;  1IKX B;  3K7R A;  1WEL A;  3C14 B;  1CBK A;  3M8Q B;  2VJV A;  3NL0 A;  4EYH B;  4USJ C;  1SV5 A;  2CVE A;  4L72 B;  1YHQ S;  2XCP A;  3NY0 A;  5EWE A;  1SJ4 P;  2HIY A;  3HD2 A;  3HJF A;  2YQ3 A;  4U8V A;  4ZIW A;  2XI2 A;  3VAM A;  1FE0 A;  1H3D A;  2ZIT A;  3BGU A;  2E7W A;  3PXG a;  4LBP A;  5KFU A;  5T7L B;  1NXI A;  1VQP S;  3G6V A;  1U4B A;  4UZC A;  2BVZ A;  3SQO P;  3ENV A;  2AW0 A;  3L3C A;  2IDL A;  5GAG U;  1RHM B;  1BD6 A;  4ZPT R;  3FDS A;  3JSR A;  2JLG A;  3FBF A;  3TAM A;  2CPX A;  4PKD B;  4J9V A;  3AJ2 A;  4RW6 B;  4IFY A;  4ECR A;  2R9L A;  1GX5 A;  3M2R A;  3IWN C;  2ZVS A;  4KGV B;  1FDA A;  3OLA A;  2FJW A;  4KE5 A;  2BYC A;  5A2Q U;  4UF4 A;  2JH3 A;  1NSP A;  2DNY A;  3JTO A;  2VQF J;  3B78 A;  4EI2 A;  1FT8 A;  3M30 B;  3TYT A;  4TQS A;  5KFB A;  4DV5 F;  2DRA A;  1RAF B;  2VG5 B;  4DUZ J;  2ZWO A;  2VKR A;  4DR3 F;  3DRR A;  5JUM A;  3BGR A;  1SH2 A;  3C6U B;  1IVZ A;  3LPY A;  3MMB A;  2Q1L A;  1TU0 B;  4DWI A;  1Y10 A;  1WOS A;  2YKQ A;  3KLG B;  3KK3 B;  3MEE B;  2F65 A;  1HQU A;  2BAN A;  1RT7 B;  5ETT A;  4LF1 A;  3TWZ A;  3H2V E;  5FII A;  1VJQ A;  1TKT A;  1LWF B;  2HWH A;  4X4O A;  2W24 A;  4WII A;  4QU6 A;  4CO1 A;  2ZH6 A;  1JIH A;  5J2N B;  2UZA A;  3IG1 B;  8ATC B;  1RTJ B;  2FY8 A;  1HNX F;  3A8E A;  2W8K A;  1R6Y A;  1JLF B;  2LVW A;  4HH1 A;  3OD2 A;  2MZT A;  3T6B A;  2RHQ B;  1X0F A;  5DGA A;  4PG8 A;  3Q8S B;  3VQS A;  4B3T J;  2B3T B;  1H98 A;  2OUG A;  4OX9 F;  4K2X A;  2Y0S D;  3I32 A;  1S9G A;  1PBU A;  2AZ1 A;  5ADZ A;  5IM0 A;  3EZ5 A;  3TQ1 A;  4CQ1 A;  1S59 A;  3JS9 A;  1F9H A;  1E6Y A;  3I9V 9;  2CPF A;  2RDI A;  2HK2 A;  1YGY A;  2FLN A;  4AQY F;  2N82 B;  5F0U A;  1S0N A;  1KS2 A;  4UOH A;  2AIR B;  1UCN A;  3HMJ G;  2KKH A;  3KK1 A;  4HT7 A;  2UP1 A;  2IRX A;  3NGR A;  1YTY A;  1U25 A;  3QBC A;  5GME A;  3A8J A;  2QMW A;  3OR2 A;  2KVQ E;  1FD2 A;  2WVE A;  2I8E A;  3OR1 B;  1SQG A;  2GJI A;  1Q16 B;  8AT1 B;  2BX6 A;  2OPP A;  1SCJ B;  5FDL B;  4H4O B;  3I0R B;  1EET B;  2V68 A;  4X2B A;  3OQ2 A;  3IBC B;  4F4Y A;  3L7U A;  1T05 B;  1JNR B;  5ITH A;  2QSW A;  2OMO A;  4O4G B;  1MW7 A;  2GC8 A;  4J37 A;  4EMD A;  2YNH B;  2UXD J;  4NZ6 A;  3EM1 A;  1UET A;  3US5 A;  4FF4 A;  1DQA A;  4XDC A;  3TEG A;  3PV8 A;  1MWY A;  5B0G A;  1VJW A;  4WYW A;  4AND A;  1IJF B;  4DV3 J;  3J81 Y;  4MAK A;  1RAA B;  1HAR A;  1IN0 A;  2CJY B;  1IR2 A;  2YKM B;  1VQL S;  3DYA A;  3O44 A;  3UFC X;  3NWR A;  1U2C A;  4NRT A;  3CD6 S;  3LPE A;  1NK9 A;  1BE4 A;  3R5C A;  2BV3 A;  2YH1 A;  2UVU A;  3C15 A;  4WP3 A;  1YVF A;  3HHK A;  3D0H E;  4BCA A;  3NGU A;  1LWE B;  1VIS A;  2E5L F;  4WE1 A;  3T5K A;  3CC2 S;  3ISZ A;  2B4U A;  2MLZ A;  4I2Q A;  2MZQ A;  2MHE A;  5C42 B;  4KAI A;  3VZH A;  4ED4 A;  2RKI A;  1R8C A;  4RUC A;  2XWX A;  2HZA A;  5KFQ A;  1RAH B;  1QAI A;  2D3O R;  1VIO A;  5CYQ B;  2RJZ A;  3UDV A;  5CQG A;  3PDN A;  1SL2 A;  4ZCM A;  4ANE A;  2ILY A;  4CLS A;  4IR9 A;  1S9F A;  5KFL A;  5FLX Y;  1TFW A;  2BJ1 A;  3FFI B;  1UP1 A;  4RZR A;  3T5L A;  2YNF A;  4ZP6 A;  3GFX A;  2NZ4 A;  3RR8 A;  4KIA A;  2DH8 A;  3WC0 A;  3HSJ A;  3EZU A;  1HBN B;  2D69 A;  2QG9 B;  3IAS 9;  4QIG A;  3CJ8 A;  4ZP9 A;  3G6Y A;  2IC3 B;  4Y2I A;  1MSW D;  4LR7 A;  1QD1 A;  2R4F A;  3JTP A;  2D41 A;  4V1A k;  2DHA A;  3IRW P;  3K5P A;  4G1Q B;  3PJ9 A;  1C0U B;  4JV5 F;  4OYZ A;  2AEJ A;  4DV4 J;  1ITP A;  1FRI A;  1SH0 A;  3KLV A;  4PXC A;  5F8J A;  4YHH J;  2KVI A;  2GMJ A;  2XSJ A;  1OO0 B;  3P6Y C;  3I6P A;  3TUP A;  4KR0 B;  2B5J B;  2C2O B;  3MXH P;  3VAH A;  3CCV S;  2M4M A;  5B0C A;  1SJ1 A;  3T5J A;  1R8A A;  2OEL A;  1FFW B;  4OYX A;  3TA2 A;  4F4K A;  3DGP A;  3Q89 A;  3V6D B;  2HHH F;  5CAB A;  1HBU B;  2XTJ P;  2GVZ B;  2G2Z A;  1LWX A;  4ECX A;  3CJK B;  2XMA A;  1S1U A;  3N5F A;  2VA2 A;  4ZVR B;  3N6M A;  3R6G B;  5A6P A;  1T8E A;  1EJ7 L;  5CYM B;  1O8B A;  1YG0 A;  3DGV A;  1X9W A;  4GC6 A;  2VPX B;  4X84 A;  1RCX B;  2QLX A;  2DEI A;  3RTV A;  3SV3 A;  3TNV A;  4UTG A;  5KFG A;  1FNO A;  1ZS6 A;  3OJU A;  4K0K J;  1YJN S;  3R7N B;  1LW2 B;  4P2F A;  3UR3 C;  3KLH B;  1URN A;  3MWB A;  3SCK E;  3ITH A;  2HHU A;  4FS1 A;  3BBB A;  2DGU A;  1MMN A;  1X4E A;  3RW6 A;  2GMH A;  2A2C A;  3MD1 A;  3TW0 A;  3BJY A;  3SZ2 A;  1RYS A;  3H5Y A;  3WC2 A;  1TVR B;  4Q8E A;  2ZBI A;  3HHE A;  2X7I A;  2PFF B;  3I5C A;  3HSD A;  4CNY A;  4GVL A;  4ED7 A;  1Y9O A;  4PQU A;  3AOA A;  4I2P B;  4QW9 A;  1WHV A;  4LQ9 A;  1TUV A;  2FB0 A;  1N33 F;  3LGH A;  2E1C A;  3CJ0 A;  5ETL A;  5C2G A;  2BJ9 A;  1FER A;  2ZJP Q;  1YKW A;  3G4S S;  3Q83 A;  1N36 J;  1UZD A;  2OTJ S;  2XHW A;  3GPA A;  4URG A;  1WC1 A;  4LF7 F;  4JI7 F;  2OH2 A;  2YWH A;  3CMQ A;  1YWX A;  4UST A;  4DU8 A;  1RA6 A;  3QLH A;  2W7O A;  2GGP B;  5JXS A;  2DEJ A;  1TQL A;  1XWL A;  1C4C A;  3PG9 A;  3BGO P;  1SBR A;  2OHD A;  3OL7 A;  2PMH A;  4ECT A;  4O0I A;  1Y00 A;  4DI6 A;  5F41 A;  1RKJ A;  2Q6B A;  2VH7 A;  5I3U B;  1IBL J;  3TZX A;  3BR9 A;  3JAM U;  3DI6 B;  4WIQ A;  4HLB A;  2L3M A;  3JQM A;  1IKY A;  2LDI A;  2AJ4 A;  5KFE A;  4R0J A;  2HFV A;  2CFX A;  2YKA A;  3IS9 B;  1B3T A;  2Y9H A;  4MIW A;  4AUK A;  2DO4 A;  1XR5 A;  1HBO A;  3V2U C;  1HWU A;  2KYZ A;  5D77 A;  4RUA A;  2F9D A;  2J9D E;  2CQ4 A;  4DG1 A;  3IO1 A;  4ZKA A;  3D5M A;  1Q1K A;  3RB4 A;  2RQK A;  1WDT A;  2EWH A;  3RBX A;  2KM8 B;  3D68 A;  9ATC B;  2J5A A;  1W2B R;  4DX5 A;  1OSC A;  1SKR A;  1YJV A;  2KXH A;  2K1R B;  1NSA A;  4PG4 A;  4KPC A;  2HVE A;  3DOL B;  2XHC A;  5K9F A;  4WZM A;  2V5H G;  5LMU F;  1TK8 A;  1NH8 A;  3M2V B;  1Z2L A;  1VRT A;  1VK8 A;  3DLL Q;  4OHY A;  3PJX A;  3JSY A;  1R8B A;  4QBU A;  2DRB A;  3Q8Q B;  4NLP A;  3PR5 B;  4KGM A;  4KHP F;  3D54 A;  5HLF B;  2NXE A;  1RLD A;  5E3C A;  4DV1 F;  1EHW A;  3WZ0 A;  4ED6 A;  3UWT A;  5KG3 A;  2UV8 A;  3D1O A;  1OS5 A;  4C0O C;  1X4D A;  3KLE B;  1G2E A;  2MLX A;  1XR6 A;  2FD2 A;  3S7R A;  4X4S A;  3QT7 A;  3ZC4 A;  3K2Y A;  1FRM A;  4CO3 A;  4FNH A;  1MWQ A;  3AOC A;  2CJ9 A;  1Q8I A;  2AGP A;  3O1L A;  2DHS A;  1FJC A;  4R5P B;  2YH0 A;  4TU9 A;  3UVJ A;  1IR1 A;  1T11 A;  2EKY A;  1U1K A;  2WBR A;  1S1W A;  4EGL A;  1KD1 T;  1UJ4 A;  3CCT A;  3KDO A;  2R2S A;  1FKA F;  3SCL E;  5JMN A;  3TUI C;  4DFM A;  3PO4 A;  1GXL A;  4DN0 A;  4DV6 J;  1XNR F;  2XWY A;  1LWC B;  4IR1 A;  1O5J A;  2GHV C;  2CJK A;  2AHO B;  2HVI A;  4OZL A;  2DNK A;  3EZO A;  3MAH A;  3DN9 A;  3LP1 B;  4RW4 B;  1P9Y A;  4TY8 B;  3VAF A;  3BSC A;  4N47 A;  1F5A A;  2QT7 A;  2UXC F;  2HBY B;  3QRR A;  4WFN Q;  3R1H A;  4FKX A;  5AE3 A;  3KJN B;  2ZE2 B;  5MAO A;  1TR0 A;  2ZM6 J;  4A8F A;  3QAU A;  4LF8 F;  5CD4 A;  3RB3 A;  1C1B B;  4CLF A;  1Y4Z B;  4DU7 A;  1BWV A;  2MQQ A;  2PI4 A;  2XGQ A;  4LF5 F;  2QTW A;  4DL4 A;  2NYH A;  2FLO A;  3OUY B;  2HNZ B;  3LOU A;  2XM3 A;  1AA1 B;  3DRS B;  3B82 A;  2KHC A;  1GX6 A;  1ZPW X;  1RU1 A;  2F4V J;  4ZPD A;  3PYD A;  4RUH A;  4LBI A;  1TKZ B;  2QA4 S;  1DBD A;  3EWG A;  3BBF A;  4KBI A;  1AYE A;  1REV B;  7FD1 A;  3VGU A;  3ZNJ 1;  2EC0 A;  4GVB B;  3KKF A;  5I3P A;  3KUG A;  2CPJ A;  2CJX B;  1KTV A;  2C28 A;  1ARO P;  4P9S A;  4CH0 S;  1N32 J;  1OJ4 A;  2CQB A;  1K1S A;  2OKQ A;  4DX6 A;  2JEG A;  1M1G A;  2YX1 A;  2Q6C A;  4JV2 A;  1K47 A;  2V2Z A;  5E33 A;  3WDO A;  2CQH A;  4ZLN A;  3GV5 B;  3OL9 A;  1JJ2 R;  1YZ7 A;  3MMC B;  1VHF A;  4FNI A;  3BO3 A;  3AAW B;  5L1J A;  2VHG A;  1RHJ B;  4TN2 A;  2LA6 A;  4Q0B A;  1PYS B;  2WK4 A;  1WEY A;  4B02 A;  5M2R A;  2W9A A;  5KT3 A;  2GHP A;  2EBE A;  3S01 A;  1XQI A;  4JB8 B;  5GMD A;  4C6A A;  3G8S A;  2CPH A;  4LSN B;  3KG1 A;  3RR7 A;  3MM5 A;  5IV4 A;  1IR0 A;  2HFU A;  2Q3P A;  2M52 A;  4WTO B;  1H38 A;  3LP0 A;  1PJ7 A;  1CJU B;  3THT A;  2CPZ A;  5J1N A;  2W9C B;  1U49 A;  4OI6 A;  5F8M A;  3RB0 A;  4AL7 A;  2XGP A;  1HKA A;  4J91 A;  5E3P A;  2MKS A;  4IRD A;  2HVZ A;  5AXM A;  2C3P A;  1DTT A;  2K3I A;  1F5C A;  5CHC B;  3AD8 C;  1R0B G;  3O5T B;  5F8L A;  1NB7 A;  3NBP B;  4WP8 A;  1LQ9 A;  3NOC A;  4Y00 A;  1GH8 A;  2DHX A;  1CEZ A;  1CUL B;  3CIZ A;  4RW7 B;  2OPR B;  1HNV A;  2JJ4 D;  3HM9 A;  3DLB A;  1TL5 A;  3KXD A;  3DMJ A;  4KKO B;  4CH1 A;  1CS4 B;  1R89 A;  2OEM A;  5C25 B;  3ZTO A;  3P49 B;  1XNQ J;  3D0G E;  2VQF F;  1KOH A;  4RNM A;  1DQ8 A;  4LF6 F;  1CJV A;  1NDP A;  2G1H A;  2H4W B;  2F1F A;  5F3T A;  4XPE A;  1X31 C;  3IR5 B;  2LU2 A;  4I69 A;  3PTW A;  1EP4 A;  2DVI A;  2B6A B;  2P2C B;  1N0V C;  1FNX H;  1X5S A;  1XER A;  2FZK B;  2HHV A;  1HQE A;  2GHW A;  4ZDN A;  4DX7 A;  4YS2 A;  5IT4 A;  4DEZ A;  1M5H A;  2DNM A;  4DDF A;  2DXD A;  1EZZ B;  2YKO A;  4DHV A;  4ZA1 A;  4O3O A;  2EVZ A;  5T14 A;  2CA9 A;  4LMZ A;  5K8O A;  4JBC A;  1FK9 A;  3OTO F;  2MXY A;  3M9M B;  2XMJ A;  4RUB A;  2RE1 A;  3Q8Y A;  1QAY A;  3FUY A;  2IBK A;  4C8K A;  1JLG A;  2C3O A;  1S72 S;  1R6V A;  2FJD B;  1B0P A;  3PJW A;  1RAI B;  4ZOS A;  5HMY A;  2R8H A;  1SXL A;  1BQM A;  1T0T V;  1WF1 A;  5B0F A;  4DV0 J;  2QX0 A;  7FDR A;  3H2L A;  4LIR A;  2D1C A;  2ALY B;  4AYB D;  2UUW A;  1RA7 A;  1DHM A;  3N6L A;  3LGM A;  4EBC A;  2A3J A;  2BKO A;  1S9E B;  4HTJ A;  2DGS A;  3SCJ E;  4LFB F;  3AD7 C;  2GV1 A;  5A0Y A;  4G1I A;  4MJK A;  3CCE S;  4RO0 A;  1RT4 A;  4EBD A;  1TV6 A;  4DQQ A;  4ZHR A;  4QU7 A;  1VI7 A;  2KHD A;  2UUB J;  1EB0 A;  1A6L A;  3AY0 A;  2UXB F;  3N4W A;  2VJU A;  1R3N A;  4HVZ A;  1PAE X;  2X51 A;  4JI6 J;  3GIK A;  3KLF A;  3BDE A;  3EVO A;  2XMM A;  4ECV A;  4IFV A;  5HAT A;  1HNW J;  4QWE A;  4UZB A;  1L3K A;  2NXC A;  4ZPV R;  4DSE A;  1WI6 A;  3J80 U;  4ELV A;  2UXD F;  2YWG A;  2AWZ A;  1OYE A;  4M5D B;  1RI7 A;  3OFE A;  1RWU A;  5BR8 F;  5KT2 A;  4DV3 F;  2OTL S;  2QIF A;  1GAO A;  2HMI A;  4ITS A;  5K14 A;  2G13 A;  3FJ2 A;  3MR3 A;  1A7G E;  4O44 A;  4LRC A;  3Q8V A;  4NAS A;  1SKS A;  2LQ9 A;  3OT9 A;  4CLW A;  3CCJ S;  5M2P A;  5D4N A;  2M2B A;  3N01 A;  4ZP8 A;  3VGT A;  4CH7 A;  1PIE A;  2EC2 A;  1FX4 A;  4F50 A;  3L95 X;  2VUG A;  1XBW A;  2IJF A;  2XMW A;  1JLQ B;  5KG0 A;  3ENW A;  4DCJ B;  2MGZ A;  4DUY J;  1VBZ A;  4DPO A;  1KDN A;  1RAC B;  3PNI A;  4HI1 A;  1RWP B;  4DF4 A;  1VC5 A;  2E7V A;  1U45 A;  3NRB A;  4RBU A;  3ZTR A;  3DLK B;  2CQC A;  4K5R A;  1Q0N A;  3E2E A;  3ILO A;  2CJQ A;  1BMQ B;  2AV5 A;  3GYN A;  2AYM A;  1D8Z A;  3W8G A;  3IRX A;  5G0R A;  5GAE U;  3KUE A;  2CZV C;  1U26 A;  4WXO A;  5HQM A;  1ZM9 A;  2FVR A;  1UEU A;  4M5G A;  4EBE A;  3HVT B;  5EN1 A;  2B4V A;  2BAC A;  1MRO B;  2ZZT A;  1UW4 A;  2V8D A;  2KTQ A;  4PAB A;  3GSI A;  3GCX P;  5BXI A;  5E3Q A;  1U6Z A;  2W4P A;  5H9E J;  1LXJ A;  1K44 A;  4KO0 B;  4ATN A;  4OMF G;  2EBG A;  2KT2 A;  4CM0 A;  3TAQ A;  3BRE A;  1VQ7 S;  3CJ5 A;  2XS7 A;  2BA9 A;  1RXO B;  2HLU A;  2DPJ A;  3FCH A;  2HYI B;  1JMT A;  2I5J B;  3EPG A;  4DL7 A;  5J2M B;  3M8P B;  5F8G A;  1RZM A;  4NE9 C;  3QGH A;  2JEJ A;  3VV2 B;  2BW7 A;  5DDR C;  3HP6 A;  4NXN J;  4YHH F;  5KG1 A;  5KFP A;  3B4D A;  2H51 B;  5KFH A;  2YX7 A;  1B4S A;  2E5J A;  4YOE A;  5HBM A;  2DIU A;  4A8M P;  2JC0 A;  3UQS A;  5IWA F;  4X66 J;  3KYL A;  3CED A;  2N4D A;  1HW9 A;  2W2N P;  2DH7 A;  1RUS A;  2VG6 A;  3NAI A;  4CM2 A;  2D74 B;  3MEG B;  1NJY A;  4K4Y A;  2V4Q A;  1LKZ A;  2B7B B;  2DIT A;  4EUV A;  4CZC A;  1NZA A;  3MM6 A;  4MK8 A;  4DSF A;  4N56 A;  3C16 B;  4KV8 B;  5DM7 Q;  4IOB A;  3LO3 A;  2WOM A;  3BS9 A;  2ADC A;  1VQ6 S;  4OX7 A;  3I55 S;  3D4J A;  1Q8K A;  4F4A A;  3Q8R B;  3FKB A;  4OZ2 A;  1JLC B;  3HPO A;  4K0K F;  3GV7 B;  3Q2S C;  4USH A;  5AT1 B;  2ZNY A;  3BPD A;  3CCQ S;  2A10 A;  3DRP B;  2R7R A;  4G65 A;  1OMS A;  4ES3 A;  4DFJ A;  3M7V A;  2AF6 A;  5D0G A;  1ZM2 A;  1F0X A;  5A76 A;  2EW9 A;  2I0X A;  2E44 A;  4DV2 F;  2HND B;  1IBM J;  3FSI A;  5IC6 B;  1EAY C;  3KLI B;  3N28 A;  1FF2 A;  4I68 A;  2IVM A;  3PYF A;  3OPK A;  3TQE A;  2FC8 A;  1MN9 A;  2E66 A;  3C2P A;  2PMZ D;  5IV3 A;  2IMW P;  2OFG X;  3GIR A;  4RW8 B;  3UW1 A;  1FE4 A;  1FXR A;  1N36 F;  3N79 A;  2E1R A;  3HSG A;  5HJX A;  4FBT A;  1F1B B;  3JYT B;  1HWK A;  2XLJ A;  1O6X A;  5ETS A;  3BV8 A;  4GKK F;  2BW2 A;  3K58 A;  1NJX A;  1J5O B;  1VQS A;  1RTH A;  2O67 A;  2B7C B;  1Q8L A;  2J9C A;  2C2R A;  2H1Y A;  1N52 B;  9RUB A;  4J9U E;  4BWJ A;  3C3L A;  3PEJ A;  4JP8 A;  4XTT A;  3QNW B;  4B3M J;  1Y7P A;  3TAN A;  4YME A;  3G8Q A;  3CW2 C;  1WC5 A;  3TEH B;  5DLG A;  2L9W A;  4IH6 A;  2KJV A;  3W8P A;  1DFD A;  3ULH A;  2CUY A;  1XMQ F;  4C11 A;  1IKV B;  4RKU C;  4F3O A;  4B9N A;  4YN3 B;  1DAR A;  3P5T L;  3MAA A;  2Z4P A;  3L09 A;  4ZN3 A;  3PO5 A;  2O01 C;  1URR A;  5HJY A;  2XB2 D;  3T9Z A;  2F8M A;  2RQM A;  3MMA B;  3MFI A;  1V5V A;  4L6V 3;  5SZT A;  4WZQ A;  2G2Y A;  3TJA A;  2ZHA A;  1DLO A;  3P45 B;  2XS5 A;  2LEP A;  4IG0 B;  4DPY A;  2XYP B;  3W60 A;  2ZBQ A;  4W92 B;  2XYH B;  4FVM A;  2PA8 D;  3MM7 A;  4R0E A;  2OPQ A;  5J1E A;  2LEB A;  5EX3 A;  1K0T A;  4P7V A;  2QA1 A;  2HWT A;  4LIW A;  4EO8 A;  3SEO A;  1PYT A;  3AJD A;  2ZDP A;  3CJS A;  1TFY A;  3GJQ B;  5LOQ A;  1XTZ A;  4B08 A;  1RBA A;  1NAQ A;  2Z2Z A;  4DPT A;  2KG1 A;  4ECQ A;  4CIO A;  1Q53 A;  3EVM A;  4PPZ A;  2DR8 A;  3QID A; 
#chains in the Genus database with same CATH homology
 2ZM6 J;  5LMN J;  1XNR J;  4B3R J;  2UXD J;  5IT9 U;  2MQ8 A;  4JI8 J;  3OTO J;  4KHP J;  1XNQ J;  1XMQ J;  4DV2 J;  4DV3 J;  4JI2 J;  4DR4 J;  4DV1 J;  5IWA J;  4B3T J;  1HNX J;  3R2D J;  4LF9 J;  5A2Q U;  1HR0 J;  1N36 J;  4DV7 J;  1HNZ J;  1N34 J;  4DUY J;  2F4V J;  5FLX U;  2UUA J;  1N33 J;  4YY3 J;  2VQF J;  1XMO J;  4V1A k;  2UUB J;  5BR8 J;  4OX9 J;  4JI5 J;  1J5E J;  4B3M J;  4JI0 J;  5AJ3 J;  2MEW A;  2HHH J;  4DUZ J;  4DR7 J;  3J81 U;  1IBK J;  4K0K J;  4DR2 J;  4LF8 J;  3T1H J;  4NXN J;  4DV6 J;  5LM7 E;  4JI6 J;  4LF7 J;  1I94 J;  4LF5 J;  4JYA J;  4DV4 J;  2UU9 J;  4DR5 J;  4JI3 J;  2KL8 A;  4LFB J;  4LF6 J;  4GKK J;  1HNW J;  4KYZ A;  2KVQ E;  4JI4 J;  4GKJ J;  4RJV A;  3J7A N;  4X62 J;  4JI1 J;  4YHH J;  1IBM J;  4JV5 J;  2UUC J;  4X66 J;  4LFC J;  1IBL J;  4HHU A;  3D3C J;  2MTL A;  3W1Y C;  3D3B J;  1N32 J;  4PWW A;  1FJG J;  4KY3 A;  3IMQ J;  4JI7 J;  3JAM U;  3J80 U;  4X64 J;  4DV5 J;  5LMU J;  4LF4 J;  4LFA J;  4DV0 J;  2UXB J;  4AQY J;  4DR3 J;  4NEZ A;  4DR1 J;  3T1Y J;  2VQE J;  4NEY A;  4B3S J;  4DR6 J;  2E5L J;  4X65 J;  3R2C J;  2UXC J;  4NXM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...