3U02A

Crystal structure of the trna modifier tias from pyrococcus furiosus, northeast structural genomics consortium target pfr225
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
239
Chain Sequence
MLIHIGIDDTDSPNGMCTYIGAILYREISKIAEPLDFPRLIRLNPNVGNGAVAMSFKIDEEKIKEVKTLVIRYVRELADIDPGIVFLIGEVPKELEEFSLRALREHVTIEEAEHVARKVNAEVYKFKLGRGIIGGLAAIGYPLEKFTYELLAYRKREYWGTPRRVIKESVFYADKWSYPFTYDNVDPYKRTVLITPHGKDPVLVGIRGIDVGKILQVFEMIKIEEPIEFFQVYKTNQNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tRNA modifier TiaS from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR225
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Transcription
molecule keywords Putative transcription-associated protein TFIIS
total genus 54
structure length 239
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3u02A01
3.90.600.20 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 3u02A02
3U02A
chains in the Genus database with same CATH superfamily
4DCPB 4QIWD 5I3PA 5E33A 2MZ1A 3KK3B 3ULHA 3M8QA 3FBFA 3Q2TC 1JK9B 3CJTA 1QAIA 4FNHA 4WKRA 2CIMA 2CPXA 3ENAA 5KG3A 2ZHBA 3NS7B 3P96A 1TUWA 1N48A 2BM0A 2CQ4A 1IN0A 4CH1A 1Q5YA 4ZVEA 4ZKAA 2WVDA 3D1OA 5K8MA 3D3BJ 4I2PA 7FDRA 4FS2A 1PO6A 3H5XA 3MCMA 1WSVA 2AKWB 2KU7A 2LVWA 4GVBB 4ECZA 4ZVSB 1GNKA 3NMAA 4GKJF 2VL1A 3T5HA 4RUAA 1SH3A 2E7VA 1FCAA 3UI3A 2C2ZB 2HVHA 1VMBA 4I7FB 4ICLB 4DPXA 5SZTA 1BQXA 4LVNP 1WACA 1RT5A 4Z2XA 5IWAJ 4LF5J 2XCLA 2GC8A 2I9SA 4R8UB 3MPVA 5K9FA 4XPEA 1P8GA 1AUDA 3W9IA 2XY6A 1IWGA 4Q7AA 1JKHA 4P9SA 4OYIA 1U0SA 4IOBA 2DKOB 3HVAA 4NEZA 4PG6A 3I56S 2VB6A 3GG0A 3U02A 1N6QB 1I1GA 3J81j 3Q22A 4RKUC 2W8LA 4AQYJ 2E5LF 1TKTA 1YSJA 1A6LA 1QD1A 1TVRB 5T41A 1HQEA 1S1TA 3M32A 3MR6A 1UKUA 4QYRA 2E1RA 2ZOFA 4J9PA 1G7CB 4K50A 1JQGA 2QRRA 4M94A 1RP5A 2GO8A 5A6PA 1IBCB 1OY8A 3T9ZA 2QN6B 1SJ3P 1CC7A 1YG0A 2AJ4A 2ZOMA 3VVTA 4TQRA 4NLTA 1Q8LA 3TQEA 3VGVA 4R5PB 3GILA 5ETOA 1FX4A 2KT2A 1UVIA 2HK2A 3KKFA 1RAHB 5KT4A 1DURA 3E8OA 5RUBA 5EX0A 2VFUA 3IRXA 5E3CA 4B02A 1WC5A 3MR2A 2ZM6J 1JLCA 4ZJQA 2D7SA 1H7XA 2V8PA 4I69A 4LF8J 1QTMA 1IKWA 4TKTA 3ZTRA 2WONB 1GX6A 3H40A 3JQJA 3PV8A 3OL9A 1V3SA 4ER8A 1E6YB 1U47A 4DX6A 1XNRJ 2QT7A 3J7A1 1OYEA 1X5OA 5GMDA 2KG0A 2N3LA 1MWZA 3BH7B 1U48A 4C8OA 1WG5A 2W4CA 3BQ1A 3NRBA 2IFXA 4EMDA 1NBEB 4ZHRB 4KY3A 5F8MA 4Y0FA 3OFEA 4N41A 2JVRA 1M5SA 1U25A 4N8NA 3I0RA 1YI2S 1HNXF 1RUSA 3LO3A 3PW2A 3TZXA 5GAEU 4F3QA 4FYVB 4BC7A 2B9YA 5BJRA 5LXYA 3GIIA 4KGKA 1LW2B 2VV5A 4CCHA 2CWXA 2VD3A 3M2UB 5AE3A 4LF9F 1U6BA 1UVMA 2BJ9A 2FDNA 4ES3A 4MAKA 2V4QA 3G6YA 3T5JA 5KFWA 2WW8A 3UD5A 4NLWA 1JLQA 1TL7B 1TV6B 4WFYA 3GJRB 1APSA 4OI0A 1NXIA 4QIGA 4NCGA 4U96A 2DGWA 4FYDA 4C6AA 1FXLA 2FHOB 3D68A 2LQBA 3C16A 3VVUA 4EI2A 5HMWA 1YX2A 2UVWA 2GA7A 4IFYB 4ZP7A 4A8SA 4K0KF 4QQBA 1GH8A 4K2JA 1NCLA 1HR0J 3MPYA 2WBRA 2R8KA 1U0HA 2HZCA 3X3UA 4JYAF 1FRJA 5F8GA 3GWCA 2VA2A 4W4MA 2IYGA 1P9YA 2CQCA 1VRUB 2XMVA 4WKYA 1Q79A 2GIRA 3PR4A 4OL8A 4ZPBA 2ALZA 1CPZA 4YB1P 4P2SA 2HNDB 4RW7A 2W4DA 4DQPA 3AD8C 2HAFA 4J9UE 4M5GA 3KHGA 2GAHC 2QEXS 4JI3J 2KO1A 3I31A 1R0AB 3QGHA 4DQRA 4JI5J 2ASJA 2EG1A 4KBIA 3WX4A 1PAEX 2YKPA 2D3O1 1SPBP 2CQ3A 4HEA9 1I5OB 5E2QA 5B0BA 4X62F 4F2RA 4F02A 4HACB 2WRMA 2IM1A 4TQSA 1UPPA 3CCVS 3N28A 1FK9A 2OTLS 3MHYA 2VQEF 4DQSA 5AXLA 4DZ6A 1S1VA 2WVCA 3EVWA 4KV8B 2FJXA 1GXLA 2C3PA 2HQDA 3DXSX 2J6SA 2OPPA 1MN9A 2RT3A 2CXEA 1VIXA 3NG8A 1T05B 1X4BA 2V63A 3M32B 1DARA 2XMKA 2JX2A 1VK3A 2V2ZA 1C4AA 5B0DA 2MHNA 5KFPA 5KFYA 1RT2A 2EC2A 2BZ2A 4QIFA 3K5LA 3GG1A 3MR5A 4F3MA 1MWQA 3DI6A 2GO9A 1U49A 5DQHA 4PCQA 2XNRA 4NXNF 3DDKA 4U95A 2HWTA 4Y00A 2LQJA 2XMMA 2NXCA 4C2MA 1Y3KA 4RNFA 4WF9Q 4KGZB 3R7NB 4N8OA 3TAQA 4KFBB 3ITHA 5ETNA 3NGTA 1CULA 4EZ6A 1S9EA 2FYXA 1WF1A 5D4NA 4H4MB 2OLWA 5HBMB 3KLHA 5D3GA 1YJ7A 4LR7A 3J80U 3JYTB 3RJMB 4A8KA 1RHMB 2RUGA 2DXEA 2LLZA 1L3VA 3AB2B 3TO8A 5L39A 2ZHOA 1T9YA 1NHKL 2E1AA 2G2YA 3LTOA 1CJVB 3EDRB 4NA3A 5JMNA 3EPGA 1HNVB 2XM3A 1DTTA 2D9OA 3OLBA 3CCMS 5KTQA 4U9RA 4O23A 4N76A 4MT1A 1Q5VA 3PRBA 3W2WA 5AE2A 8RUCA 4PQUA 2KVIA 5D6GA 1HI8A 2H5EA 2YRWA 4X4TA 2HHUA 1V3RA 3G6VA 3BREA 4GC7A 3ET6A 2DGVA 3TA1A 3LOUA 3D54A 4HHJA 5MAOA 4OX8A 2ZUAA 5KFXA 5CABA 3DFEA 4Q5VA 4EGLA 4NLXA 3GZ7A 1KLMB 1S7HA 4OLPA 4C3LA 4WP9A 1R0BG 5IT4A 1HNVA 1H6KX 3DOMA 2C2EA 5FLXU 5AJ3J 4YUDA 2LA4A 1QVFR 1NB7A 2JEIA 2CFXA 1KONA 3MM7B 2DY9A 2CA9A 3NAHA 1FD2A 4IOAQ 2E1CA 2CPIA 4LR9A 1U0HB 5DJBA 5CYJA 4DX7A 4J9KA 1VQ6S 3QFWA 3CCSS 2G0IA 2NLWA 3GSIA 2IY5B 5JVHQ 3IR5B 2MSSA 3MMBB 4P6QA 1GX5A 5M2PA 1B3TA 3CF5Q 2LXIA 1UL3A 1FRKA 3D28A 2W9AA 1HBOA 2KDOA 3MMCA 3PHEA 1PJ6A 4ED7A 2HNYB 3JS9A 1GMVA 2R7QA 5HP1A 2BV3A 2GJ2A 1WEXA 1FJGJ 4GO5X 2FVQA 5K8OA 1BGXT 2MHEA 2FTRA 4CYUB 3RBDA 1IKXA 2KM8C 5FDLA 2Y0BB 3SI8A 1F60B 2PSZA 3FSYA 4A48A 4UT4A 5T7LB 1K8AT 1Y0HA 4J5OA 3PYDA 2LEAA 1SKSA 2AJ0A 2APOA 2GX8A 1Q8IA 3BSOA 2LCWA 2PGCA 2FHKA 1RISA 3UR0A 3M8PB 5CYMB 2OSRA 1KEKA 3DMJB 3G8TA 2BE9B 3D4JA 1YVFA 2KXFA 4N77A 4DX5A 2CJAA 1SCJB 2HNYA 3EGNA 1WC6A 3EVMA 3FFIA 3GV8B 3HD1A 4TNOA 3ILJA 3V6JA 2CQBA 1R3NA 1YJRA 3PEJA 4ZIVA 5L1KA 2K1RB 4GC6A 1F9EB 3C19A 1WEYA 1LNQA 1SH2A 4J90A 4QIEA 4CH7A 4A8QA 4P10A 2ATLA 5M2RA 2AGPA 4UQGA 2BR0A 1MMDA 3TZZA 3M1VA 4Q43A 5KAKA 1LW0B 1RE1B 1VRUA 3FFIB 2L9WA 4BLGA 4XDCA 1KFDA 4YHHJ 2KKHA 5HN0A 2X3DA 3OTOF 2FGOA 1RXOB 1S9EB 2GZOA 3R5DA 4LSNA 4OX6A 4USVA 4J9RA 3E01A 4C0BA 3HVWA 3OTBA 3DLEB 3FGVA 4ID8A 3I5CA 1RHJB 1FRIA 4Z37A 2KT5A 2WONA 4V19X 3TANA 3FBCA 2UUAF 1FI4A 3AD7C 1HHTP 4ILRA 3QFHA 2N7YA 4FPIA 3O44A 4P7TA 3GQCA 1LEOA 2KI2A 5H9EK 1N52B 4CWBA 1KHVA 2ZNYA 1PKUA 3KK3A 2BYCA 5HATA 2FUG9 3QT5A 3RUBL 2K7KA 3W2WB 3C46A 3O1LA 1FHTA 4RW6B 4X62J 3W8PA 3I87A 1DJ0A 1VISA 2R2RA 2LA6A 3T1YF 1SKUB 3TARA 2ZDOA 4X4OA 1HWJA 1SC4B 3QRPA 3AJDA 5EGYA 3T1HF 4LF7J 4NL5A 2UUCF 3R2CJ 2ACMA 4HH0A 4QYZK 5IQQA 1SVDA 1HMVA 1TQLA 1YJUA 3NNCA 1SQFA 5LL6d 3W1YC 4EU0A 2OEJA 2VHGA 2BBEA 4WFNQ 1KBRA 1REGX 1OY6A 1RAFB 4YS2A 2XLIA 4DSFA 5EX3A 3BH6B 2VJUA 3MAHA 3M6XA 3BV8A 3QGGA 4B9LA 1OJ4A 1M1GA 4QYZJ 1RWPB 6FD1A 2VA3A 4I6AA 3CE8A 2AT1B 2RKIA 4ED2A 2ZZNA 4CLWA 1WKKA 4PYAA 4TN2A 1VQKS 3H0PA 4OHYA 1ZAWA 4F0HA 4U8YA 3HKZD 2AZ3A 2AYBA 2W2QP 3MPUB 1DLOA 2H4WB 2VG7B 3I0SB 4LR8A 5BR8J 2HKEA 2GIQA 2H5JB 4Y2IA 1PJ7A 3AA9A 2HBZB 1FVSA 3DRSA 1HBMA 1WC1A 5BXIA 3B6BA 3GPAA 2O3DA 4JI0F 2XLJA 4DR3F 1RT6B 1MWYA 2EPIA 2G2ZA 3DOLA 3JQKA 1V6HA 1S4FA 1SQGA 3U7JA 1WF0A 5B08A 4J9OA 4I6WA 3EZ5A 1FA0A 3GJTB 2VH7A 3QWPA 5T7LA 2VBYA 3PZPA 3N5BA 1AA1B 4XK8C 3PDNA 2VONA 2BX6A 3H2LA 3Q0AA 3GSDA 4A4JA 4DXLA 3CCWA 1FRMA 3GV7B 1RHRB 1X4EA 2DITA 4X4SA 3IR7B 3SQGA 1PC5A 5AJ3F 4LFAJ 4C7QA 1YRXA 4DR2J 1ZETA 3IRWP 4JI2F 5H9FK 4DUZJ 1KWMA 1E6VB 1UWAA 2O5DA 4FNIA 4HI1A 4R8UA 3VCDA 4YFUA 3H42A 3DU6A 1VQOS 2J9EA 2K1RA 4UF4A 1EHWA 2HK3A 3NNHA 3IG1A 1F1BB 5LXRA 2UP1A 1XR6A 2M70A 2ZM6F 1UA1A 1TL3A 2KHCA 2XSJA 4OFZA 3L9ZA 4AD6A 3M9OB 2JL9A 3ZZPA 5LMNF 2Q66A 2HBRB 3CDEA 3OQ2A 4YEAA 5JUMA 1GK8A 3UDVA 3CC7S 4MMOA 3BN7A 4G1QB 2IA6A 1YZ7A 4YQWA 2AF6A 1ULRA 3TA0A 4Z7YA 2AGQA 5KT6A 1FKOB 2R3VA 3PIPQ 2JLFA 1Q81T 2XMWA 4JV5J 1NB2A 3DDNA 3MFHA 1QSLA 2JDJA 1WEZA 2K06A 1K47A 3JSMA 5I42A 1HBUB 3V6HA 1XIQA 1ZZNA 4QR0A 1D9AA 4KH1B 3CJ8A 1RACB 1Y7PA 1Z2LA 1XNQF 3CIMA 3I32A 1WC3A 1H3DA 4PXEA 4USWA 3J7YI 2CPDA 3RB6A 1FE0A 2HFOA 1S7IA 3FQLA 1M5HA 4ID5A 3CCUS 2RUSA 3GP9A 3M2UA 1VBZA 3UCGA 5I42B 2YNHB 3JSMB 4USTA 2QLXA 2VU5A 1U1RA 5F8IA 4RWWA 3M6VA 1RBLA 2ZKTA 3D1HA 4ANDA 4AXJA 2HSEB 4WU2A 3VAKA 1IKXB 5HK4A 5IC6B 5DDPC 4R0EA 2F4FA 5HQMA 2F3JA 3RTVA 1LXNA 1RTJB 2E29A 2KG1A 2A6MA 3CXCR 4UUXA 2P2CB 5IV3A 2RU3A 2C1EB 3MEEB 3KMQA 2RRAA 2Z4PA 3I4HX 2CG8A 3NNAA 1U1NA 3IC1A 3BR9A 4P52A 2Z8QA 4NLOA 3UN2A 1XBWA 2Z56B 2ZE2B 3OVAA 2EBEA 1Y10A 1IQZA 3M2RB 4FXWA 1I94F 1DQAA 2VFVA 1WUUA 2D69A 3MPWA 2DH9A 3JSBA 1IKYA 2X7IA 3FCHA 5CXTA 1GXTA 1RGVA 2LDIA 3CJ2A 5ITHA 1NJZA 3MM8B 1C0TA 2QZ8A 2MGZB 3MURP 2C3OA 5JJBA 1CEZA 2DGQA 2JEFA 3PHTA 2IVYA 3D6HB 3BQ2A 4ECXA 2NS1B 3HFKA 4ES1A 3KJNB 2CYYA 2RE1A 4OX9J 3C16B 3SV4A 2N4DA 2OPPB 5DM6Q 4J7CA 3DGVA 1RJJA 1VC0A 1QY7A 4O4GB 1N56A 1OSCA 4Y28C 2W2OP 1FNXH 1M1KT 2Y8WA 2VIHA 4U7CA 1TKXA 2OTJS 5IV4A 2EFOA 3UCUP 3DRPA 1U6FA 1GSOA 2DISA 2COLA 2HIYA 2EW9A 1FTRA 2R42A 2AJ2A 3P5BP 4NI2A 2QA4G 1UJ6A 1HR0F 4JYAJ 4OYPA 2QC3A 2PMZD 4DV6J 4TLRA 1MNEA 2MZRA 1EETB 3PR5B 2HQCA 1RTIA 5E41A 2AX0A 2GGPB 4ZA1A 4MJKA 2CQ2A 3CCQS 2ADBA 2A18A 2YKOA 1ZPVA 4P73A 2DJWA 1RYSA 2CVIA 2D9PA 3RW7A 1R6VA 2XYPB 1S1UB 8AT1B 2WSFC 1TMMA 3HHLA 5IZHA 4P72A 3RR7A 3MCSA 5ETVA 1JX4A 2G9OA 2LFVA 3H5SA 3C66A 2HURA 1D3WA 1UEUA 2B7CB 5LT5A 4CIOA 2VICA 4DQQA 2WTFA 3EYZA 1T03B 4PUOA 1PBUA 4MFBA 4JI1J 3NXZA 4K4VA 3CD7A 5DETA 1S12A 2ATCB 5CYQB 3LWLA 1RWNB 4RWXA 1CJTB 2IPOB 4KIAA 2ILZA 2VBXA 3C14A 4E2FB 3KMSA 1ZTWA 1REVA 2V2QA 4I64A 2YY3A 1U09A 3KG1A 3KUGA 2HGNA 3IO1A 5LJ3Y 2ASLA 4B9SA 1Y9OA 4UY85 3QIPB 2PMWA 1IVZA 3PJXA 5HQLA 3UD4P 1PYTA 2GHPA 4ATNA 4X64F 4LF4F 3VF0B 2R7RA 2VPWB 2R9LA 1X9WA 4PQUB 1RHQB 3OL8A 2PFDA 4PWDB 4ZLJA 1VRTB 2BQ3A 2Z57B 1JJ2R 3S6EA 3QQCD 3CJ0A 3OHBA 4HLBA 3GFHA 3JQMA 4LIWA 1TUVA 1YJVA 4I7FA 5KFVA 1F6TA 1BE4A 4DPUA 1BQMB 2F1FA 2GCFA 4RW9B 2Z2ZA 2VQFJ 2C2OB 5KG1A 2B9WA 4JI3F 2JOQA 4WP8A 3WQPA 4J9VA 1S72S 2XY5A 1W2IA 3M8SA 2J7WA 3ZXWA 4R25A 1G4CA 4HL9A 2W9CB 2CJQA 2HPUA 5KFCA 1WC0A 3MWBA 3HDSA 1VYAA 4EBDA 2VBZA 4ECWA 1RA6A 3LANA 1VS3A 3C2PA 1QTNB 2BEFA 3S01A 1Q78A 1HNZJ 3RAXA 2W4PA 3QO9B 2I2YA 1HIYA 4K8RA 2BUNA 4RJVA 1MU2B 1QUVA 4FKXA 1Q95G 3FMWA 4RW8A 5HLFA 2ZOGA 4K0KJ 2V4RA 1N5YA 3CJKA 3R5GA 5GMKa 1WOOA 3F73A 2FC8A 3UVJB 4NXMJ 2BW7A 2BRKA 3NEKA 4Y6IA 3TP2A 3JYTA 1U1QA 2Q79A 4C8KA 1S57A 5DGBA 5HAOA 3FEZA 1HQ2A 3GIRA 4XIUA 3KHLA 1AROP 3C6TB 1IM4A 2ZH2A 2WZ1A 4AFFA 3GYXB 1N5VA 2GW8A 3ZTPA 1TKXB 2OUGA 2FQQB 2HIQA 5G0RA 1JLFB 2YNIA 2YWWA 1B7FA 3TVKA 1WSRA 1FT8A 2C22A 4OYOA 3LF0A 1HYSB 1AFIA 3W61A 4BC9A 2R7SA 2A0FB 3CO9A 2IJFA 3M8YA 4KH0B 2XQCA 3OJUA 2UXDJ 4MK8A 3LPYA 3DGPA 4O3NA 1TU0B 2XO7A 3MAQA 3PFOA 2RQ4A 3R97A 1CS4A 4TY9A 4OHVA 1PG5B 2IVFB 2WAQD 4N47A 1FRLA 2ASDA 3IFEA 3WHIA 1NK5A 3CUNA 3TVYA 2EFNA 4DLEA 5GADI 1RAAB 5L38A 2RJZA 1XMOJ 2K8GA 3LWMA 3PFEA 4IDKB 1NJWA 1RAJA 2POKA 2U2FA 2A1BA 2X1FA 1DQ8A 2DCUB 2AGOA 2IVMA 2DEJA 1REVB 4DPTA 3MEDA 4F8RA 1NO8A 4I2QA 4Z7CA 4JI4F 1RU2A 4U6PA 1LWCA 3ZC4A 4DG1B 3A4TA 3BM7A 2DK2A 3HKWA 3AY0A 4TXSA 2XB2D 4QU6A 3K5PA 2X1AA 4ZVOB 2WOMA 4IO9Q 1LWEB 4KQZA 4DV1F 1JJCB 1N0VC 2GFFA 4WTOB 2CPFA 5IFMA 4LRDA 3MEDB 4TU9A 2MKIA 3OTCA 3O6QA 4O44B 1M5PC 4USHA 4CLSA 3CCJS 3F0NA 3MAAB 3V81B 2HFZA 4ECYA 4NA2A 2ILYA 2OELA 3EM1A 1NKCA 4GKJJ 1UZHA 3A3NB 2E5HA 3AJ2A 3BS9A 4Q2LA 1DAXA 1I6JA 4DR6J 4OYXA 1W2BR 2Q6CA 2V8GA 3Q8SB 4HR2A 1M5OC 4CRJA 1UAWA 4ZLLA 2W2PP 2YX1A 4OZ5A 1O51A 1T95A 3CNQP 2EKYA 2R2TA 2KTQA 2ACYA 4CNZA 3EWGA 1MROB 3D0IE 3N6MA 4EUVA 1BLUA 1XQIA 3FSXA 3G9CA 4Y65A 2EFPA 4LRFA 2AEMA 1VQLS 1UA0A 4FVCA 3G71S 2LQ5A 1PIEA 1JB0C 3PYGA 2VPXB 1X8DA 4NMLA 1N6QA 2YQ1A 2QYCA 1VHFA 3PTWA 3QLHB 4B9NA 1R8BA 3HF5A 1Y5IB 2DEIA 3UWTA 4B3OB 2CNLB 4MH8A 3LP0B 4ZITA 2DT9A 4DFMA 2JHEA 3BGLA 3KFWX 5DG7A 3DHWC 4FYWB 3CPWR 1HPZB 5DGAA 1WG1A 3CB4A 3QRQA 2HHTA 1K0TA 3AXKA 1BQNB 3BBFA 1PSDA 2IAJB 2KL8A 2V50A 3CJSA 3JTOA 4M1KA 4KPYA 4MIAA 2BKPA 2D3ZA 3ZZ0A 3BF4A 1RWVB 2Z30B 1LK5A 2GVDB 2M8HA 1JLBB 1X31C 1C2PA 5HBMA 3UR3C 4DR1J 4KO0A 4ZMMA 4DOZA 1RWOB 1VK8A 5LMUJ 4LF4J 1HPZA 3JSYA 4CZCA 1CJUA 1PJ5A 2Y1JA 1RAGB 4OX7A 2AHOB 2B56A 2M52A 2C2RA 2IMWP 4B3OA 3HD2A 1RWKB 2DB1A 1QM9A 2XWYA 3HX9A 5HROA 1WKLA 1AW0A 2MKHA 3MMAB 4LF9J 2ROEA 2WSCC 5A2QU 3V5RA 3M8QB 2QGFB 3FBEA 1VR6A 2DO0A 4ZVPB 2EVZA 2HFVA 2XNQA 2HWHA 4CM0A 4DV5J 4FYYB 2PE8A 3EGVA 4LF6F 3AHPA 4UQTA 2PEBA 2GV1A 4XPCA 2V4JB 1Q7LB 1QDUB 2H54B 3BZQA 3U1LA 4C11B 2MJNA 4PG4A 1R8CA 5LMUF 1MN7A 3A3OB 1VRQC 3I0RB 2BJ8A 1RT3B 1T9XA 2V68A 2DNHA 2V8VA 5M2UA 2H48B 3OPKA 2CPYA 5GAGU 3RRHA 4NRTA 2HHHJ 3AFGA 1A7GE 2DNOA 3GR0A 3G8SA 2DPIA 1X4HA 2G0CA 2OFGX 1GMUA 2ZFHA 1AXQA 3V4IA 1LWFB 4DSJA 1B0VA 2E7XA 4KGMA 5DRKA 5GAHI 2NREA 1Q86T 4DV2J 1SL2A 3DLLQ 1JNRB 3NKYA 5KFOA 2MJUA 3AD9C 4A8MP 3HHDA 1WWHA 1BQMA 2LEPA 1S6QA 3ZTOA 4F0KA 3QBCA 3LALA 4RW9A 5KFLA 1T11A 2E9ZA 1O6XA 2UZAA 1VDHA 2DNKA 1SXLA 1FE4A 4OYZA 1CC8A 3ZNUA 2JSXA 2OH2A 3CJ3A 4FXDA 2BM1A 4WBFA 5THWA 2CQ0A 3FQKA 5IM0A 5CZVA 4LFCF 4NLRA 4DHVA 1N33J 1XMQF 3KJFB 2HHWA 4CDIA 2F4VF 1FWKA 1L3SA 2K2PA 4KHMA 2KRRA 1VIOA 2NXJA 2HNZB 4PQAA 3DCAA 1FDDA 1H72C 1HD0A 1UJ4A 3TJ9A 3FCWA 3LP1B 4EFAC 4U7UD 3M7VA 5DDRC 1WELA 2QA1A 3M2RA 2BJEA 3KHRA 4AQYF 2EWHA 1CSJA 4QWCA 4K4YA 2XCAA 4QPXA 2JC1A 3T1HJ 3DLGA 2V9KA 1KOOA 3QGPA 4QW9A 1Y3JA 4WK3A 4BWMA 1VLOA 4URGA 3HHLB 5AE1A 4X2BA 2CJBA 3L7UA 3ONQA 4UOHA 3CCES 4CI0B 1HHQA 4K4UA 5F3ZA 4N5SA 1RTHA 3B4MA 4KGXB 4PAAA 3Q23A 2HNZA 2IDLA 2B6AB 4L3KA 2FJBB 1H7WA 3ELHA 5F0WA 3AJ1A 2P5VA 2KHDA 3SDEA 4UTGA 1TAUA 3N79A 4DCJB 4IQMA 4P75A 2MSTA 1X4CA 3DC2A 4P71A 3W9HA 1H74A 5LSRA 4PABA 1X5SA 3NBPB 2IIHA 4J91A 1NM2A 4Q45A 1YQHA 1U1PA 2AV5A 2Y8YA 2VZ9A 4L75A 4IR1A 3RGIA 3CVKA 5KT3A 1VQ9S 3X1LB 1EZZB 1YK9A 1VRTA 2XEXA 2W7OA 3BKUA 3R5BA 1CQMA 2DHGA 2LP4A 2OHDA 4KYZA 4N7TA 5KOWA 4WTYA 5A2QY 2XGQA 1UW4A 2GHVC 5ETKA 2B0GA 3VQSA 5BYSA 3KK1B 3TEGA 4IH7A 2YPYA 4DFKA 5HVGA 1R8AA 3N6NA 2CNNB 2HBQB 3A8IA 4ZOSA 3THTA 4DL4A 4DUZF 1I51B 3D67A 1KQKA 1RZMA 3HT0A 3ZTSA 2ERRA 2HMIB 3SCJE 2DHAA 3HI9A 2C3UA 1R0AA 1D0EA 1R89A 2W01A 4L72B 4OV6A 4DU8A 2PA8D 3C15A 3OV7A 3V4IB 2CNKB 2XLKA 4JI6J 1A9NB 1SJ4P 2N7CA 3PX6A 4OJGA 4CLTA 3F56A 2PMHA 3BKFA 3H90A 1NPPA 4ZK7M 4CTAA 3GIJA 2MKYA 1SBRA 4I67A 1TFWA 5IWAF 2HRYA 5C7PA 3PJ9A 2J0WA 2QJ3A 4MIBA 4LF5F 1N54B 5C24A 4NE9C 4YY3F 2AP6A 1S6PB 1H0HB 1TELA 4LUBA 3QT7A 3Q2SC 4PWDA 3NGDA 2I5JA 2P6TA 3WX8A 1AYEA 5K14B 1HW9A 4TY8A 5J2MA 3GFZA 3Q8QB 2J8AA 1RT6A 3A3PB 2C2KB 2HQIA 1S1TB 5IQ6A 3HZEA 3PVXA 1F5CA 2CPZA 3S7RA 1KTQA 2VKRA 2CKWA 4F50A 1YITS 3T41A 4ID5B 4KTQA 2FVCA 4V1Ak 5A6WA 1HWKA 1SV5B 1HWUA 1UTAA 4BCAA 3UNGC 5IOLA 4L6V3 3ZZZA 2NSBA 2VDIA 3IMQJ 2FLPA 2V8DA 4DI6A 1NU4A 2W2MP 2HZAA 1XERA 2E9TA 2C42A 3MM9B 4ZPAA 4DV6F 1RAIB 2WK4A 3HSDA 3R3TA 3D9BA 3HSGA 4NLVA 2LDYA 4CLKA 3MECA 4ECTA 1U2RA 2BQUA 2YWFA 4HHUA 1JLGA 3R5AA 2P9EA 2QMXA 1BD6A 4G1QA 2BOAA 1RABB 4LSZB 3RAMA 1TL3B 3CDWA 4ED1A 1HYSA 1B4SA 1S0VA 1J5OA 1TK0A 1R8HA 2LXUA 3A13A 4KHPF 4DR5F 3H20A 3GCXP 4H4OB 4OQJA 2H3EB 4QBUA 1NK0A 2ALYB 3KUEA 2J7KA 3MFIA 5KFSA 3FBBA 3UW1A 4CLLA 5C42B 3J7YU 1W7WA 2MZJA 2QSFA 1FNOA 2GMJA 3CULA 4DV7J 2V5HG 1WC4A 3D7SB 4RUHA 1NSQA 4CO4A 3OLAA 1Q82T 4X4UA 4JI7F 3QMQA 4ZPVR 2CJXB 3IGNA 2VQEJ 2K3IA 1SL0A 2G4BA 3UCZP 1F9FA 1KLMA 1RADB 2DXFA 1EP4A 4KC5A 5J2NB 1VLYA 2OFHX 3MGJA 2RQCA 1NDCA 1S1VB 3I5BA 1B0PA 3ISND 3PYFA 3BSCA 4GVLA 4I2QB 5F3TA 2DTJA 4G1IA 3OR2B 5L46A 4EZ9A 1N32F 3DGPB 3VALA 1VQPS 4B3TF 1S48A 4PXDA 4IRCA 1RSCA 2H65B 2D3OR 2YNGA 3HFZB 2QLWA 2BJ3A 2V8HA 2YKNA 4HDGA 3ENVA 4NZ6A 4YY3J 4B08A 4EYIB 3VQTA 3PRVA 3H4BA 5ETTA 3M8ZA 3I5AA 3F44A 1W26A 4F3OA 3FRYA 2AYMA 1ZBTA 3HJVA 4NYOA 1OWXA 2VBWA 3C6UA 4X4RA 2A6OA 1DFDA 1L3UA 5F9LA 3IR6B 1VFJA 3N0VA 4AYBD 2MLXA 2R2SA 4PRFA 1AFJA 3HVTB 3OUYA 1YIJS 3AOAA 3MOZA 4JI8J 2OPSB 4MYTA 2XCPA 5E3QA 4QU7A 2N82B 4CLUA 1S1WA 4MK9A 1VI7A 3M2VA 4OX9F 2GJFA 3K17A 4DDFA 2MY8A 2ZEJA 1J5EF 1WD6A 5F8HA 1QE1A 3D0HE 1FVQA 4A47A 2DNYA 4CLYA 2N3OA 5DDOC 3TUIC 2CJKA 3MM6A 2YS6A 2HVZA 3AQOA 2JJ4D 1EB0A 3W9JA 1U1MA 2JEJA 2ZH1A 2A2DA 4NLDA 5ETPA 3TYTA 2OP5A 3KDNA 3N9UC 1XN9A 3OXLA 3OR1B 4WFBQ 1NDPA 5AXNA 2CAJA 2RQMA 3POTA 4YR3A 4DMZA 1U6ZA 2MXYA 2RMLA 2Y1LB 1KVKA 2YNFA 5F9NA 2KM8B 5K5MA 2JC0A 2EBGA 3W63A 5F8JA 3CCZA 1UEKA 3GE9A 3I9V9 4TYAA 2GQCA 1KNZA 2YTCA 3HK2A 2F9JA 5T14A 4ECVA 3CT9A 2JFDA 4MFBB 1PGZA 4DPYA 3VAJA 4DR6F 1XMBA 2Q43A 4KV8A 3RU0A 4FF1A 1YBTA 2DH7A 2OEKA 3PYEA 4RW4A 3J7ZT 2DNZA 1DLOB 2VG7A 1ICEB 2ZVIA 1WORA 3TJ8A 3RBXA 2I0XA 2R8HA 3AOCA 2YBVA 2KXNB 2O01C 2UXBJ 4RBVA 5KFGA 4RU9A 2ZZTA 3CD5A 3TRGA 2OMLA 4ZN1A 3G96A 4K5SA 3TEHB 2BJDA 2DBBA 2OIHA 2VOOA 2AJ1A 1LXJA 3HHLD 2BA9A 4RNNA 4ILLA 1SI9A 4OZNA 2R7XA 2E66A 1CJKA 4RO0A 2OO4A 5BR8F 2F7VA 2EFVA 1UFLA 4OLOA 3M8RA 3PM9A 2R8IA 3PO5A 1JLEA 3L95X 2XI3A 2MKJA 2EEYA 3UDLA 3IAM9 3G8QA 3TWZA 1FKAF 1UPMB 1MSWD 1VQNS 2HAIA 1HWIA 1RDRA 2HVEA 3N4WA 1IWAA 2ZWPA 5K14A 4LJMA 2MMYA 3B8HA 4C11A 5HMXA 4U67Q 2FVPA 1WHXA 4ILMA 2ZBRA 4HTJA 1SUQB 2NYIA 1KKHA 2NQPA 4OHXA 1FTCA 3I9ZA 1KQGB 2F8MA 1H38A 2R7OA 4C8LA 5D0GA 2MTLA 3IA0A 5DZ7A 2IRUA 3HP6A 3B82A 3HVRA 2I1RA 2XHCA 1F9HA 1Q7YT 4ZS6A 2AYGA 1C1CB 2Z2YB 4LRCA 4ZVRB 1IKVA 3HPOA 4LF7F 3W65A 1GT8A 3OFFA 1CVJA 3DNCA 4TLQA 2E7WA 4ZJOA 3UQSA 3HHKA 1BC6A 3ILOA 3MEKA 3NGSA 3GMGA 4ICLA 1VC6A 2DNQA 2MYFA 1RI7A 4IRDA 2WW4A 4DV3J 4RU2A 1YTYA 2DNNA 2Z2MA 4F4ZA 1R31A 4IG3B 2XULA 3IM8A 3SSRA 1RTJA 2E5JA 4QW8A 2GVZB 3M8WA 3I6PA 5KFJA 2EC0A 3NY0A 2AU0A 2AEFA 2Z0GA 2MLZA 3H8YA 1WTBA 1IUJA 2LU2A 4OYWA 2LQ9A 4HTIA 6AT1B 1NSAA 4LRBA 2R8GA 2P6SA 4C48A 3DOKA 2HQ3A 3IXQA 2ZJPQ 4JI5F 5F8NA 1UETA 1NPKA 3J81Y 2CQDA 2WVFA 3KK2B 1XMQJ 4NXMF 2QMWA 3SSSA 3AAWB 1XR7A 5ETMA 1LWFA 3BO3A 2ZE2A 4C8MA 4TY8B 5J2MB 4M5HA 3HFVA 4L3NA 1DBDA 4M5JA 3OJSA 3OVBA 4IFVA 5FDLB 1FDAA 4NLPA 2VG6B 4O44A 2MQPA 3L3CA 3BGUA 2DGOA 1R6YA 1O5JA 2JRSA 3FKBA 3AH6A 1FDBA 4M5DA 4OI6A 4RNOA 4ZJLA 4NRUA 5KOXA 5EWFA 1EQ0A 3H59A 1DY3A 1HMVB 4W98A 3SCIE 5EHHA 4WIIA 4MKYA 1O8BA 1RTDA 5IT9Y 3OSNA 4LF8F 1URRA 3BGFA 2VQFF 4YB7A 2M0GB 2VFRA 2R7UA 2ZVSA 1NJYA 4OI2A 4XO0A 1FFWB 1FFSB 1RU1A 4PWUA 2YX4A 2YQ0A 2CDQA 2J8SA 4OHZA 2RQKA 4IG0A 3P3DA 3DRPB 3KJVB 3R6LB 5LMNJ 2AMCB 3WC0A 3IBCB 4KPCA 3JAMY 3KLFB 2QYGA 5HSPA 2BE7D 4CO0A 5JXSA 2DIVA 2FJEB 2MQMA 4LIRA 1YJWS 1OY9A 2Y9HA 3NMRA 2I38A 5IXUA 2XZDB 5IT0A 4WK1A 3H5UA 4KB7A 1JNZB 1NEEA 3C8YA 4CYUA 4JI2J 5CA5A 2RIJA 2IA0A 1G3OA 2Y1IA 1OS5A 2LYVA 1S0MA 1YBUA 5D4LA 2V2KA 1RYRA 2JFKA 3D1QA 1TK5A 1HNIB 3UPFA 5C5JA 1IJEB 3ITHB 2ASYA 4L73A 4ES2A 2PT0A 2BE2B 3QIDA 2YWKA 3L09A 2B6AA 2VC0A 5GMEA 2BKNA 1HNWF 1C0UB 4ZP8A 1RT5B 5D77A 3HSJA 3TR5A 3MDFA 3D2WA 4DUYF 1ZYQA 1N34J 4Y34A 4KHRA 3W60A 4JB8B 2RAQA 3ZTQA 2QFJA 3THVA 2ZBPA 1KFSA 4KJIA 3DRYA 4P2XA 1ZM2A 3AB4B 1VC5A 3CW2C 1RT2B 4H4MA 1Y5LB 4O0NA 3WIUA 4F26A 2W7AA 1X4DA 3O3LA 1LW0A 4B3RF 3EZUA 2DY1A 4IH5A 4OYBA 4YR2A 4E0DA 2B4PA 1BHNA 4WWSA 2DGUA 3M4XA 4DR4J 1LWCB 2Q6BA 2J9DE 2PIIA 2BE2A 3BKTA 4ECRA 2HS4A 3CC2S 1K1SA 5EN1A 1AT1B 3CDAA 4J9LA 1KS2A 5H1SV 1IR1A 2GQQA 4ZCKA 5KFDA 2FHJD 2MEWA 3HZGA 3CCLS 1ZOTA 5E5NA 2M7SA 2RKIB 2YWGA 4LT6A 4JI4J 1N34F 1AUSL 3MUTP 3RBEA 4ZCLA 1FKOA 4ANCA 1SUQA 3LW5C 1HI0P 2AJQA 1N5YB 5CQGA 3QATA 3HJFA 3EDQB 4PEOA 2NUUG 2XI2A 3DRSB 2RDJA 3VAGA 2XMUA 4ED4A 4DJBA 1TVRA 2B5JA 2VPZB 2P9GA 2YH0A 1I94J 2VODA 5HMZA 3W2VA 2C2MB 2IAJA 2QLFB 3R9LA 3DLKB 5KG2A 2UU9J 2FLOA 3MD3A 2H5IB 1NNDA 3VWSA 3TX8A 3BYPA 4KFBA 2ZC3A 1IKVB 2BKOA 4P2MA 4ZIWA 2LECA 1NAQA 3DM2A 1WHWA 1BMQB 3MUMP 2OPQA 4RZRA 3MR3A 3EPIA 2YYAA 3SQGB 5KFRA 1UFKA 2QMUB 5CCMA 1KHWA 1C1BB 2DO4A 3MR7A 3W7BA 4UZCA 1I3OB 4DN0A 2QA4S 2P9CA 4OZJA 1R7IA 3GB0A 2RS2A 1Q4RA 4YHHF 1N36J 1D9DA 4JV1A 4MKAA 1VQ5S 1MLAA 2KZZA 1G6BA 2B5JB 2YQ3A 3MM7A 2IM3A 1RT4A 3GFXA 2W8KA 2JLGA 4J9SA 3V6DB 2OPRB 1SC3B 2KYZA 3I4PA 4WXOA 4KGVB 5DLFA 1RT3A 4JP8A 1TKZA 3MJFA 5HMYA 2J0SD 1U1OA 5BYQA 2IC3B 1EKRA 1YJTA 3MUVP 3ENWA 1HQEB 4NCGB 2C3MA 1YLXA 1VBKA 5C2CA 2MQ8A 1NK4A 1NMEB 3RB4A 4ZHRA 1S99A 1JXVA 2G0JA 1RT4B 3UO0A 4X4VA 2RNEA 5ETQA 1C1BA 1WG4A 1Z2ZA 2KT3A 2UUTA 1OPIA 4ZPWR 3W8GA 2FJDB 1S5ZA 3AOBA 3G82A 1XMOF 4O3QA 3W5XA 3R6GB 1JJ4A 2CPJA 2M9KA 4MYUA 4QR1A 4B3SF 3CO0P 4NCBA 4H4OA 4C3KA 3RRKA 3EGWB 2D3UA 1P27B 1Z1ZA 4WIQA 3FMBA 4NI2B 4CT9A 4A8WA 1JLCB 5AT1B 2HZVA 3EVOA 1KVIA 2YKNB 3KJQB 3OSPA 1S97A 4M5DB 4NZ0A 4K4ZA 3HULA 3V4MA 5FJ4A 3PX0A 1HBNB 1L3TA 4USUA 3DMJA 2O66A 2HRUA 2XTJP 3D6TB 2UVUA 4LQ3A 3D5MA 2KN4A 4X66F 3K57A 1T05A 3MZIA 3QGIA 4JI1F 2FJVA 1EETA 1X4GA 3PX4A 5D4PA 1N33F 2V4JA 2RDDA 1GAOA 2ZNZA 4QJVA 5KT5A 4ECQA 4LF6J 1NSPA 4AUKA 3HLUA 3KLEA 3LGNA 3QZ8A 4DS5A 4DR7J 1HLWA 2B43A 4LQ9A 3MM8A 3OL7A 1U26A 2ROPA 2XYGB 3E3XA 4Y2KA 4ZVTB 5HP1B 2B9EA 2CQPA 2QIFA 1O0PA 1CJTA 3ILLA 3IS9A 2V0NA 1FXRA 3J7AN 3MXHP 4O4RA 2KB2A 1UEVA 2FD2A 5L8RC 5L9NA 1KC8T 3VGSA 4M5MA 1GQEA 2VFTA 2FVRA 1QLNA 3FUYA 2YS7A 2RHQB 1T9WA 3V2UC 4PXBA 2IM0A 1ZM9A 3ZNJ1 1U24A 1HARA 3DLJA 3OTEA 3B4DA 4RR5A 4UOFA 5A8RA 3TA2A 5A76A 2E1MC 5F8LA 2XS2A 3DYAB 5KT2A 4CO5A 1SKRA 2NR0A 4KT0C 1K73T 1T8EA 5D0RA 2QTWA 4IUFA 1RBOB 4CLZA 3BR8A 2DRBA 3C15B 3CEDA 3M1VB 1KOHA 1QAXA 1S1XB 3Q8YA 3PW0A 2VASA 1L5UA 1C0UA 4UY8T 3HM9A 3QZ7A 1XC9A 1ZPWX 3FJ2A 3VR1A 1RHUB 2HNDA 1QAYA 2BXJA 1GTHA 1Y4ZB 2YNGB 3IP0A 1KSPA 3ICLA 3ZZRA 4OZ2A 3Q24A 1JJHA 2YPZA 3T9NA 2NUHA 2WVEA 1YJ9S 1FF2A 3O2IA 3CMQA 1K9MT 1P1LA 3D3CJ 4DF4A 4FF3A 4NOHA 2UUBJ 4JOUA 3HHLC 3HMJG 4B3MF 4F4AA 2A10A 4I2PB 3DLEA 3IGVA 1X5TA 2YWHA 4F7VA 3HXMA 3T5LA 3V6DA 2FLNA 2XS7A 3R2DJ 1TKZB 4MTPA 4OMFG 5HJXA 5KFKA 3CMAS 2UV8G 4OZ0A 4RW6A 3P8BB 3QJPA 4CO1A 3DDIA 3H2VE 3QO9A 2DRAA 1J2VA 1U8SA 2X3GA 4KKOA 2UUAJ 3KLGA 1VBYA 1UFWA 2XYHB 4RNHA 4GKKJ 2I6WA 1E6YA 2AEJA 5KFNA 3QWUA 3MI7X 4BHQA 4JI6F 3TAMB 3BJYA 1FKPB 2IYIA 4KSEB 1HBOB 3MMCB 3MAAA 4YDDB 4BWJA 3V81A 2W9BA 2J6TA 2UUBF 4CNYA 2XMAA 2I5JB 1H2TZ 3JXOA 4IYQA 1NH8A 2DD8S 4DV1J 4O3SA 2ZBQA 2DR9A 2DRDA 3DLKA 3R1HA 4RLEA 2RB7A 1DZ5A 3DRXA 4DV3F 4ELUA 4DS4A 4JI7J 2HVIA 2MQOA 4JI8F 2FY8A 4MIWA 4QPTA 1WHVA 5ETLA 2KJWA 3TNVA 1IBKJ 1PCAA 3DOMB 3US5A 1CBKA 2AIRB 3IAS9 4LRAA 3PKMA 2M8DB 1OSDA 1FKPA 4B17A 2DR5A 2KYXA 3QLHA 1M1HA 2XZWA 3I0SA 2XMJA 4X65F 5LSOA 3ISZA 3ET6B 2MDAA 2NXNA 5E3PA 3EX7B 3FZBA 1TKDA 1XWLA 3RBZA 3K8VA 4X4NA 2CG4A 2J0XA 2M2BA 2OMOA 2HBYB 3FNNA 5B0AA 1N4LA 3NS6A 1VQ7S 1S77D 1RAEB 4QWBA 2GQ2A 1ROFA 3DRRB 1RAOA 2LXFA 3Q83A 3R5JB 4DV4F 3UVJA 4C9DA 1G1XA 3A8KA 3OHAA 3CWJA 1KRPA 7FD1A 3U1MA 3KHHA 4RW8B 2KXHA 4PR6A 4LSNB 5CZXA 3UNYA 4ED5A 3VHQA 3S8SA 2CQ1A 2Z2LA 2F5GA 4ED8A 1YHQS 1X7VA 4RX6A 2L41A 3PW4A 2AQ4A 1QVGR 2IBKA 1HI1A 1B0TA 3IG1B 2KJVA 1FJCA 1U4BA 1X5PA 1F3VA 3UDCA 2W7PA 3ADAC 1S59A 2JLEA 3C6UB 3S1TA 4ZCMA 3G82B 1U1LA 4K4XA 4A8YA 5DG8A 1TL1A 2FZGB 1P1TA 2IJNA 4BS2A 3W3SA 1SJ1A 2B9XA 3VV2B 4CT8A 1U8WA 4ECUA 1LW2A 3SV3A 4NA1A 4DSIA 2ZBIA 2ZJRQ 1EP4B 4F36A 3NP5A 1X9SA 3T1AA 1QE1B 1WF2A 3M30A 6FDRA 4JBCA 5KT7A 5A0YB 4Y3CA 1XEZA 2RU9A 5CD4H 3NOCA 3QT8A 1T3NA 1X9MA 1R0CB 3I55S 4IG3A 4ZP6A 3T5KA 3KDOA 3GV5B 2FVSA 1RT7B 3KLIA 2D74B 3G87A 1PYSB 5F0UA 5J1EB 3AQPA 4OV1A 1OQ6A 2D1CA 3R27A 3KLEB 5J2QA 3CJRA 5HANA 2CVEA 2ZC4A 2G2OA 5KG7A 4B3TJ 3KNGA 4IKAA 2EFQA 2OD6A 4YMEA 1J5OB 2J76E 2Y1RI 4CQ1A 1MMLA 1UMJA 2WB1D 4RNMA 1GMWD 1OMSA 4RW7B 4DN9A 1S6UA 2GHWA 1X0PA 3MEEA 2CQHA 2E5LJ 2FJWA 5L1IA 1Q53A 3BDPA 1SKWA 2EXUA 4QOTA 3EE3A 3G2XA 3H7HB 9RUBA 2XC9A 2X1BA 1Q8KA 1T0TV 1FFGB 4K2XA 3CD0A 5ETRA 2ZH3A 4X64J 5KFQA 4B3RJ 3RB3A 3B78A 1KN6A 1YRTA 2IMOA 4F2SA 1BXNA 2RDIA 2CQGA 1JLQB 1TL7A 2VKZG 2QSWA 5FIIA 5L1LA 1NK7A 4LFAF 4GKKF 2VFSA 2YVSA 5KFUA 1NLKL 4H54A 1JLEB 3J80Y 2FZKB 2KFNA 3POTB 2BACA 4R0JA 4J9MA 4OYMA 1PC4A 5KG0A 1K44A 2PD1A 1S9GB 3LPEA 1RWXB 5DLGA 3OXGA 3QAUA 1IBMJ 5HROB 2IP4A 3QJLA 2E1PA 3TZYA 2JZ5A 2ZH7A 2MY7A 3RG6A 2ZJQQ 5MLCV 3W64A 3VZHA 1HD1A 1NH7A 1PBAA 2UVVA 1NSKL 1V9OA 2CZVC 3MM5A 2V69A 3I96A 1KTVA 4CTAB 3KWMA 4M8LA 3CSKA 4IR9A 4ERDA 1HKAA 2P8IA 4DL3A 1FNMA 1Y11A 1NUEA 4WE1B 5AXKA 1TR0A 2B4OA 1ZTTA 4LFCJ 1NKEA 1NJIT 2NZCA 5J2PA 2PI5A 5FLXY 2W9BB 3LP0A 1BY9A 4FDFA 3FVYA 4GMKA 4ALZA 4DR5J 1FJ7A 3ZZTA 3EXCX 5C25A 1ZAXA 3BN4A 3GCWP 4DF8A 1WTFA 1XJWB 5HL7Q 5HJYA 3QNWB 4C0OC 2KVQE 3DYAA 4DBQA 2J5AA 1NDKA 3DI6B 3OFGA 1A0OB 2YKAA 3WZ0A 4TYBA 3M9NB 3PEHA 3QPIA 2HFSA 2CUYA 3K5OA 3CC4S 3M8PA 2H51B 4GVBA 3OVSA 3R8YA 1MW7A 4I56A 1TMJA 1TL4A 2DGXA 5D15A 3H5YA 1T02A 3CJ5A 5KFFA 1FESA 1M0SA 2YNHA 4FVMA 4EO6A 2FZCB 1HBMB 3IBFB 4WXWA 2HW3A 2J0QD 1S6OA 3R5CA 4FKYA 4ED3A 2KFYA 3ZZYA 1R8PA 3K59A 2R7TA 1VQ4S 4FP9A 1LKZA 5BYRA 5GADU 4J37A 1RKJA 5J1NA 3CJ4A 3NL0A 2DCLA 1JKHB 2OD4A 3DHXA 3K89A 4Y2MA 4F25A 3QRRA 4IQXA 2DXDA 4P2FA 1KQSR 4HH1A 2C3YA 2CJ9A 1L3KA 3HCXA 1S9FA 3H4DA 1NZAA 4K59A 1HFEL 4K5RA 3THPA 1OYDA 1URNA 3CMES 1Q16B 5KG6A 3BB5A 3HHEA 2YX7A 2DIUA 1IQTA 2UUCJ 4P7VA 3UN5A 2CJYB 3LGHA 3DLGB 4C98A 4C8YA 2LQ8A 2YRXA 3K7RA 2PC6A 4Q44A 2MZTA 2O1PA 5CHCB 4X84A 3K5NA 5J2NA 3PNIA 2KH9A 1Y5NB 4XDDA 1RT1A 2H4YB 4DPWA 2FC9A 2NXUA 2ZKUA 2ZH8A 1DRZA 4NWBA 2Q3PA 4ENOA 2W9CA 3NWRA 2CNOB 3PY8A 2KZMA 1TUGB 3BPSP 3A1YG 3IRXB 4B9TA 2BVZA 2FB0A 2PA3A 4NYZA 4OI4A 3FSIA 2YKMB 4Q0BB 5KFAA 3CCTA 1B70B 3NLCA 2XHWA 3BSAA 3D0GE 4A8FA 4JV5F 4WU3A 2XY7A 4I1TA 1NK8A 2UXCJ 5FD1A 1T94A 1WI6A 1LFWA 1VQSA 5A0YA 3GYNA 1NJXA 3CJKB 3U1NA 1DTQB 1JLAB 4M5NA 1UVLA 1S1WB 1RLDA 3E01B 4O3PA 4W90B 4DV0F 2QA2A 4OJ1A 3VGTA 3P6YC 3NGRA 3A8JA 1YWXA 4OYAA 1RWUA 3T6BA 2BJ7A 2B3TB 2YKMA 3FZ2A 4LF2A 3RAQA 4Q0BA 5GVQA 4AL6A 3P49B 2ZZMA 2F4VJ 2OGUA 5A8KB 5LOQA 2W1BA 2DGTA 3U27A 2O67A 5J1PA 5KFZA 4FBUA 3HO1A 2JEGA 2J9CA 1RTDB 3TOQA 3KYLA 4C8NA 4NX9A 1D8ZA 4PUOB 1B99A 1RTHB 4LBPA 4RUBA 4Y2CA 1X4FA 1FWLA 2E44A 2HRTA 1TFYA 1FRHA 1F5BA 3M6WA 4AXIA 1FXDA 5K8NA 2ZUGA 4EO8A 3DOKB 3TI0A 4AL7A 3NS5A 2NXEA 3MF5A 3JTPA 1HWLA 1J27A 2HLUA 3K2YA 5CYMA 4U7UK 4RUCA 4QWAA 4IFYA 1QJHA 4QWEA 3LP8A 1AB8A 2HYIB 3CDBA 3BO2A 1CLFA 2JNJA 2Y0SD 1H2VZ 2GS8A 4PG5A 1S49A 3TJAA 3NBPA 3Q89A 2Q1LA 2AYEA 4NLQA 1HBNA 4EWTA 1V5VA 2J7UA 3DKDA 3K5MA 2ZH5A 4DV2F 3BYRA 4PXCA 1YDLA 1FK9B 4ZPCA 3CD6S 4YOEA 2NYHA 3OXFA 1R27B 1VJWA 3GR1A 1KDNA 5HVHA 4XTTA 5DG9A 2XGPA 2F8HA 3MCOA 1NHUA 5CYQA 3LP2A 2OAUA 1OIAA 2VPYB 3BDEA 4NMXA 3VZIA 2I8EA 1S76D 1NZ8A 2ROGA 3KXDA 1RKIA 2JVOA 2QE5A 4X65J 1T9VA 4FYXB 2HEKA 2G13A 4LVOP 1JIHA 1NPRA 3DXBA 3NCPA 4CLFA 2XS5A 1W25A 3HVTA 4Y2AA 3OUYB 1HNWJ 1H73A 1VGYA 3MMJA 4OZLA 4PG7A 1LQ9A 1WJ9A 4DUYJ 1WDTA 3SMZA 5C25B 2XBPA 2ZITA 4PYDA 5KG5A 1TZ0A 2BDPA 3SIPB 2F40A 3SYZA 5DZ6A 3PKYA 5G4DA 4M5KA 5B0FA 2B4VA 1WI8A 2YNFB 1TKTB 5D0EA 4PKDB 4WCEQ 3P45B 2M4MA 3C6TA 4TU7A 2DVIA 3BPDA 3PW5A 2G1DA 1D9FA 4X4QA 3OR1A 4LSLA 4OZ1A 2UV8A 3NGUA 1FRXA 3EJMA 4G65A 1EARA 3FDSA 2B51A 2IJRA 2BANA 4I6YA 4MKVA 2LU1A 3EXYA 3C14B 4DR1F 5F41A 3OL6A 3TW0A 2PFFB 2GJIA 3PCOB 4KHPJ 1DTTB 2OEMA 4L74A 1OPZA 3CJQA 1NK9A 3AXMA 3FCVA 3EICA 1UVJA 1MROA 4F67A 4F4YA 3JB9k 1HNXJ 2QLJB 4YB6A 3W2VB 4KRWA 5HQ8A 3UDEA 1SIWB 2BANB 1T7PA 4I4BA 4RW4B 5A8WA 2MLYA 2RD5C 4DFPA 1ZH5A 1IJFB 2K7JA 2YWEA 4GO7X 3MMAA 4M95A 4B3SJ 3R1LA 2B7BB 4LMZA 1XR5A 4HT5A 4FPRA 2XZTB 2NSCA 2QL5B 2RILA 3BBBA 4BDPA 1GEHA 2V34A 1QSYA 1D8YA 1UVNA 3KTQA 4ANEA 1PAUB 4B9VA 5B0GA 4YR0A 1IXKA 3OW2R 1CQNA 3PACA 2L3MA 3KLGB 3KK2A 4ZP9A 3W5ZA 5DQGA 4ED6A 1QUPA 2L9DA 3OR2A 3W62A 3LUYA 2XSFA 2VG6A 2DNLA 5KFEA 3T1YJ 1M5VC 5ADZA 2PEHA 4PPDA 5U47A 3GJSB 4DL7A 2IC3A 4ZDNA 1UWBB 3V6KA 2J6UA 3EGZA 4EBCA 1SH0A 3BGRB 2DGSA 3GLJA 4DL5A 4V19J 3CIZA 1F2GA 1YKWA 5C24B 1VCTA 2OPSA 2BABA 3E51A 5D78A 4CLPA 4CM2A 4DG1A 5HLFB 2L9NA 2RVJA 5C42A 1U2FA 4DEZA 4WJBA 1RCXB 3AA8A 1RWWB 4ZVUB 1RT7A 1YJNS 5KFTA 4OHWA 2FGCA 4AE5A 3MM6B 1IKYB 3VTIA 3DLBA 3LGMA 2D41A 1Q8BA 3EUNA 1C1CA 2HS3A 2OSQA 2F9DA 2WB4A 3M2VB 5L1JA 4MK7A 4F4KA 3G6ES 2W2NP 4WFXA 1RWMB 1UWBA 3WDOA 2CWKA 4D3HA 2GVZA 3MOJB 1WHYA 5IT9U 1B64A 1ZA2B 1GFWB 4K4TA 2AX1A 4LF1A 3OT9A 3BQ0A 2BOPA 3GFYA 1F3FA 3OFHA 2HFNA 4L76A 1SIZA 4YDXA 4WYLA 4X66J 3WBZA 4ECSA 2FHMA 4QR2A 2ADCA 2YW2A 4WYWA 2GNKA 1R43A 4NPOA 5EUHA 1T9TA 1PILA 3OTOJ 1OO0B 2EK1A 1JXEA 2LKZA 2VG5B 2WOMB 2C2NA 3Q8UA 3VGUA 3KLVA 2QL9B 1U7LA 4I0WA 1F0XA 4A8XA 4DU7A 1KVJA 2RRBA 4DV0J 2W24A 3QJJA 1TTHB 3MEGB 3LP1A 2HHQA 3OD2A 3Q8PB 2ZH9A 1HA1A 2QO3A 4KE5A 1VQYA 1YGYA 2HHPA 2ZD1B 4YN3B 4E8UA 1VQMS 1S0NA 4O3RA 3A8EA 5CH7B 4J9QA 3KG0A 1KQFB 1LK7A 2F63A 3CGIA 2C2DA 4URSA 4O4GA 2ZHAA 2HGMA 1GMWA 4LREA 1S10A 3CCRS 2UXDF 2V94A 3P5TL 3PRDA 3QT6A 1RK8A 2VG5A 2R7WA 4ZN3A 3RB0A 1ITPA 2BQRA 2V67A 1KR4A 3NCQA 4G6VB 4ITSA 4DR4F 3ZFVA 2MGZA 1FEEA 4WPAA 2HQGA 4E98A 1P6TA 3ZO7A 2YH1A 2G1HA 2E9RX 1V3ZA 4OZ3A 4PPZA 3SDEB 1RB0A 3MD1A 4K4SA 3NAIA 3PG9A 4DFJA 4NXNJ 1UP1A 3RRGA 5D8HB 3VAMA 1FDNA 2KRBA 5J2PB 5HI7A 4RBUA 1JXLA 5KFHA 3G86A 3IWLA 4ZVGA 4WE1A 2DNGA 1SL1A 5SUHA 5I4MA 3IBWA 3L7OA 1MG7A 3QAEA 4JV2A 4IOCQ 4ED0A 2DR8A 2IDEA 3TX0A 5I3UA 2M3DA 4X4PA 1Y00A 3SEOA 2QG9B 3KK1A 2UU9F 4HYKA 5IC4B 4ELTA 2B8QA 4MKBA 2NCKL 1VQ8S 3FEXB 2B4UA 3GYGA 3H98A 1S6PA 2AWZA 2QX0A 1CG2A 2GAGC 4K7QA 4BBYA 4CH0S 4CO2A 1N8RT 3E2EA 2X1GA 2MKCA 4ZCIA 5AXMA 5I3UB 1ZM3A 2ZH4A 1VOMA 1G2EA 4F0MA 1D09B 3K0JA 3QYYA 2EKNA 2LMIA 3ETOA 8ATCB 2RH3A 1IBLJ 4CP5A 1SJFA 1HBUA 3ETMA 1K1QA 4EEYA 3FC9A 4JV0A 2OPQB 2DNMA 3ZZOA 1FEHA 3T19A 2HQFA 2QL7B 4H4KC 3TUZC 1NDLA 3SQOP 1SQEA 2VDHA 4DV4J 3IWXA 1CS4B 4UUWA 4O0IA 2VUGA 4RL1A 1FO1A 4PG8A 2LEBA 4RBTA 1QAJA 1N5TA 2GIFA 3PXGa 2GVDA 3LAKA 3SBMA 3TQ1A 3PW7A 3GTYX 2BJ1A 4I68A 2F65A 4NYPA 3JTNA 4EK2A 3KLHB 2UVRA 4ZVQB 2V9WA 1HNZF 2HWIA 1IR0A 1BQNA 2UUWA 1IM6A 3T6JA 5KFIA 5DDQC 3UFCX 4FF2A 2DNPA 1X60A 1AZSB 4CO3A 2HMIA 1UCNA 4ZPTR 2A2CA 3SFUA 2XWXA 2YNIB 1WDDA 4URQU 4TU8A 4DLGA 3VAFA 1ACMB 4AT1B 3SSQA 2EK6A 1MMNA 2FPHX 3N6LA 2FY1A 4B3MJ 1ZZFA 3O5TB 4M5IA 4QIVA 3K58A 3L7PA 1IBMF 2R8JA 4WZMA 2IM2A 2DR6A 1HW8A 4R5PA 1AZSA 3BGRA 4ZVHA 3NCRA 4DSKA 4M5LA 4FBTA 1F2HA 4A46A 3IM9A 3HT3A 2ZWOA 3M05A 4G3IA 3BSNA 4NZ7A 2NPFA 1HHSA 4QZVB 4QWDA 5EWEA 3DRRA 4Q2MA 5E3AA 2A3JA 1VBXA 3RR8A 1WNEA 4DV7F 1GXUA 4LSLB 4IG0B 1EAYC 1UZDA 1TL1B 3KUHA 3KJVA 2CADA 2BMBA 4J9NA 1TAQA 1WKJA 2IRXA 3HSZA 2EFGA 1FX2A 4IO1A 3MM9A 4TVAB 7AT1B 2FLLA 4C8ZA 1IKWB 5KG4A 3DM2B 1RTIB 2DHHA 5GAHU 3MMBA 2MKKA 1U45A 3TUPA 1HNIA 3MTKA 4OJHA 2BW2A 4YP3A 5CAAA 4HI2A 2MQNA 5A8WB 1U02A 2RSQA 1YBAA 3L4BC 2DYAA 3NOGA 1EIYB 1JLGB 5A8RB 2FIUA 1LWEA 2FHJA 2MQLA 1N0UA 5EDWA 3J81U 3H25A 4IFVB 2BRLA 2CPEA 3EZOA 3M6UA 4YB5A 5GAGI 5B0CA 2XMTA 3FK4A 4JUZA 4HKQA 4OI3A 2XG8A 3G4SS 1LV5A 4C3MA 4DR7F 4U8VA 3ZZUA 2XD4A 3BEGB 5G0RB 4DQIA 3LAMA 3R7SB 5B0EA 1DHMA 1QSSA 3TUJC 4HDHA 1ELOA 5J2QB 1S9GA 1C0TB 1N32J 4ELVA 3QIPA 4LFBF 1SB6A 3VAHA 3MEGA 3C3LA 4C4WA 4ZVFA 2JWNA 3TAPA 1WOPA 1C4CA 2CRLA 4LBHA 1RT1B 3ISNC 4FN5A 1H2UX 2AW0A 4KR0B 2OKQA 4XAKA 2HS0A 4C97A 4DUTA 4Q8FA 2OI2A 4ZLNA 3R7BB 3OTDA 1CJVA 5HVFA 2MQQA 1XK8A 3T3FA 1U1KA 1U2CA 3WC2A 2VOPA 4WZQA 1HQUB 3J7Z5 1EX8A 1SC6A 3TVZA 4FF4A 4EBEA 2RF2A 1KD1T 3W5YA 4USJC 4PZVA 5E3RA 4ETZA 3IWNC 5K20B 2VJVA 4HACA 1X0FA 5CCLA 2MZQA 5KFMA 2EG2A 3JAMU 2M5YA 1UW9A 3RYLA 3TAMA 2L48A 5LJ5Y 1NHVA 3GIMA 1XNRF 1N5SA 5LSLA 4NLSA 3IS9B 3JSRA 4HHHA 4JI0J 5I3QA 1VHIA 1SV5A 4P74A 1P9QC 3CDUA 2NPIA 3DU5A 4F4XA 1J5EJ 3MM5B 3KOAA 3EMTA 3MPDA 4FZVA 5CD4A 4EYHB 1KP6A 4F04B 3K8WA 3WIVA 4LFBJ 4W92B 1T03A 2B8PA 3LA0A 5DO2A 4OIXA 5HO4A 1D1UA 4LBIA 1JLBA 1MU2A 3AODA 1Z4UA 3KLFA 2UXCF 5D0HA 2IRYA 2MKSA 2VF3A 4UW2A 4B9UA 2QLBB 3I82A 5EWGA 1IR2A 4NASA 3MECB 4NLUA 2DNRA 2ZH6A 4S0MA 1WOSA 4A8OA 1N88A 3Q8RB 4DR2F 3PO4A 3NWGA 1CULB 1UJ5A 3UD3P 2CQIA 1FWPA 3UE2A 1S1XA 2U1AA 4DL6A 1CJUB 5KFBA 3A12A 2R2UA 1V5IB 4USKA 2PDAA 3N01A 5H9FJ 3KNAA 4DX8H 2YXLA 2QV6A 1ZS6A 1S79A 4WFAQ 4DV5F 3LQVA 4QCLA 2VC1A 2HHSA 2AJFE 3B54A 2UXBF 3FRZA 4ZPDA 1S4EA 2V6AA 4DR3J 4DCOB 2RHSB 1ZAVA 1JWWA 1BUXA 2N4CA 5B7WA 2DR7A 3BGOP 1EKSA 3D66A 1FJEB 3SXLA 3DOLB 2X51A 4GRSA 2H9ZA 4M63A 3P4UB 2MB0B 1LOUA 4KAIA 2OPRA 1B7YB 5D3GB 1BWEA 3G6XA 2IBOA 4NCAA 3GIKA 2IHR1 4RPFA 3BO4A 3GU0A 5E0OA 4USMA 4KKOB 3RZAA 2PI4A 1SJQA 1CJKB 2E5GA 2SXLA 4NLGA 2E5IA 2EI5A 2WCXA 9ATCB 4FS1A 4NEYA 1GTEA 2HGLA 3FEYB 5L9XA 2L08A 3SCKE 5GAEI 2R4FA 3QSIA 2RRNA 4IRKA 1M5KC 1YZ6A 1SC1B 1VJQA 2WBMA 2CDRB 4ETXA 2RS8A 3GONA 4KO0B 1HL6A 2MZSA 3NGKA 1NK6A 3M9MB 3DLHA 1RA7A 1VKZA 3H2UB 1NKBA 3MTJA 2PN6A 1S6QB 3OBIA 2XSJB 1LFPA 1X4AA 2Y3YA 4G1PA 5DQIA 1HQUA 2PO4A 1N5QA 2GGPA 2XO6A 4WFZA 3SZ2A 2Z58B 4C0HA 3HHNB 1NRKA 3PIOQ 1JLFA 2HHXA 2J9DA 2QK4A 4DPOA 4N56A 4B9MA 3ENQA 4DSEA 2AZ1A 2NZ4A 2HHHF 1RTZA 1TV6A 4HVZA 4H4KA 3UN3A 2ZD1A 1XNQJ 4WP3A 5J1EA 3RW6A 1FJGF 2GMHA 1RCOB 2GMLA 2CPHA 3F41A 1XTZA 3KLIB 1SJRA 5H9EJ 1ZA1B 1OQ3A 1EJ7L 5IM0B 3BBCA 1RBAA 1DTQA 1JLAA 3AT1B 2R7VA 1IBLF 3GJQB 2FJAB 3KG4A 2K3KA 5DM7Q 2OJ3A 2WHOA 1FD8A 2W25A 3SCLE 3PJWA 3SFGA 2DHSA 3LH2S 2CZ9A 4O3OA 1TK8A 2F8EX 3W66A 4DSLA 2V2VA 1TP7A 2M88A 1BWVA 1T3OA 2DHXA 2HVDA 1T9UA 3D6FB 5LM7E 4NLYA 4K4WA 1JMTA 4IH6A 4IDKA 1FERA 5ETSA 2HFUA 4DL2A 4DWIA 2YKQA 2DH8A 4DZDA 2C28A 3VAIA 1KLNA 4AL5A 1K0VA 5E7OB 2HG4A 5K8PA 1YRUA 4OJ3A 3N5FA 3Q86A 4OI1A 4FXVA 4DL0C 5B09A 4F4WA 4UOGA 2JH3A 2H1YA 2HHVA 5D4OA 5DS7A 5A8KA 1Q0NA 3D6MB 2KFZA 1PYOB 1RLCL 2MPUA 3CTRA 3DN9A 3ILIA 2ABYA 4D3GA 4UOCA 2RF2B 2HLTA 1F5AA 3MCNA 1UVKA 4UZBA 5JVGQ 3QSYB 1S1UA 2QFIA 1RHKB 1S0OA 2AD9A 1LWXA 1DQ9A 4HT7A 2ZDPA 5IS2A 1M90T 2WVBA 3M30B 3TZWA 1RQ0A 4ZLPA 1N36F 2ZBCA 1TL5A 1EQMA 3LP2B 4USIA 4Q8EA 3IN5A 1E6VA 1IBKF 1Q1KA 2CZ4A 2WSEC 1ZM4A 4PWWA 3O8WA 2DPJA 1H98A 5C2GA 3Q8VA
chains in the Genus database with same CATH topology
4QIWD 5I3PA 5E33A 2MZ1A 3KK3B 3ULHA 3M8QA 3Q2TC 1JK9B 1QAIA 4FNHA 2CIMA 2CPXA 5KG3A 2ZHBA 3P96A 1N48A 2BM0A 2CQ4A 1IN0A 4CH1A 4ZVEA 4ZKAA 3D1OA 5K8MA 4I2PA 4FS2A 7FDRA 1PO6A 3H5XA 2KU7A 2LVWA 4ECZA 1GNKA 3NMAA 4GKJF 2VL1A 3T5HA 4RUAA 1SH3A 1FCAA 3UI3A 2HVHA 1VMBA 4I7FB 4ICLB 5SZTA 1BQXA 4LVNP 1WACA 1RT5A 4Z2XA 2GC8A 2I9SA 4R8UB 3MPVA 5K9FA 4XPEA 1P8GA 1AUDA 2XY6A 4Q7AA 1JKHA 4IOBA 3I56S 3HVAA 4PG6A 2VB6A 3GG0A 3U02A 1N6QB 1I1GA 3Q22A 4RKUC 2W8LA 2E5LF 1TKTA 1YSJA 1A6LA 1TVRB 5T41A 1HQEA 1S1TA 3M32A 3MR6A 1UKUA 4QYRA 2E1RA 2ZOFA 4J9PA 1G7CB 2QRRA 4M94A 1RP5A 2GO8A 5A6PA 3T9ZA 1SJ3P 1CC7A 1YG0A 2AJ4A 2ZOMA 4TQRA 4NLTA 1Q8LA 4R5PB 3GILA 2KT2A 1UVIA 3KKFA 5KT4A 1DURA 3E8OA 5EX0A 2VFUA 3IRXA 5E3CA 4B02A 3MR2A 1JLCA 2D7SA 1H7XA 4I69A 1QTMA 1IKWA 4TKTA 2WONB 1GX6A 3H40A 3PV8A 3OL9A 1V3SA 1E6YB 1U47A 3J7A1 2QT7A 1X5OA 2KG0A 2N3LA 1MWZA 1U48A 4C8OA 1WG5A 2W4CA 3BQ1A 3NRBA 2IFXA 4ZHRB 5F8MA 4Y0FA 4N41A 3OFEA 2JVRA 1M5SA 1U25A 4N8NA 3I0RA 1YI2S 3LO3A 3PW2A 5GAEU 4F3QA 4BC7A 2B9YA 5BJRA 5LXYA 3GIIA 4KGKA 1LW2B 2VV5A 4CCHA 4LF9F 2VD3A 3M2UB 5AE3A 1U6BA 1UVMA 2FDNA 4ES3A 4MAKA 2V4QA 3G6YA 3T5JA 5KFWA 2WW8A 4NLWA 1JLQA 1TV6B 4WFYA 1APSA 4OI0A 4QIGA 4FYDA 4NCGA 1FXLA 2DGWA 2FHOB 2UVWA 2LQBA 5HMWA 2GA7A 4IFYB 4ZP7A 4A8SA 4K0KF 4QQBA 1GH8A 4JYAF 2R8KA 3MPYA 2WBRA 2HZCA 3X3UA 1FRJA 5F8GA 3GWCA 2VA2A 2IYGA 2CQCA 1VRUB 2XMVA 4WKYA 1Q79A 2GIRA 3PR4A 4OL8A 4ZPBA 2ALZA 1CPZA 4YB1P 4P2SA 2HNDB 4RW7A 2W4DA 4DQPA 3KHGA 2QEXS 2KO1A 3I31A 1R0AB 3QGHA 4DQRA 2ASJA 2EG1A 4KBIA 3WX4A 2YKPA 2CQ3A 4HEA9 5E2QA 5B0BA 4X62F 4F2RA 4F02A 2WRMA 2IM1A 4TQSA 3CCVS 3N28A 1FK9A 2OTLS 3MHYA 2VQEF 4DQSA 5AXLA 1S1VA 4KV8B 2FJXA 1GXLA 2C3PA 3DXSX 2J6SA 2OPPA 2RT3A 3NG8A 1VIXA 1T05B 1X4BA 3M32B 1DARA 2XMKA 2JX2A 1VK3A 1C4AA 5B0DA 2MHNA 5KFPA 5KFYA 1RT2A 2BZ2A 4QIFA 3K5LA 3GG1A 3MR5A 4F3MA 3DI6A 2GO9A 1U49A 5DQHA 4PCQA 2XNRA 4NXNF 3DDKA 2HWTA 4Y00A 2LQJA 2XMMA 4C2MA 1Y3KA 4RNFA 4WF9Q 4N8OA 3TAQA 4KFBB 3ITHA 4EZ6A 1S9EA 5HBMB 1WF1A 5D4NA 4H4MB 2OLWA 3KLHA 3JYTB 4A8KA 2RUGA 2LLZA 1L3VA 3AB2B 3TO8A 5L39A 2ZHOA 2E1AA 4NA3A 3EPGA 1HNVB 1DTTA 2D9OA 3OLBA 3CCMS 5KTQA 4U9RA 4O23A 4N76A 4PQUA 3PRBA 3W2WA 5AE2A 2KVIA 5D6GA 1HI8A 2H5EA 4X4TA 2HHUA 1V3RA 3G6VA 3BREA 4GC7A 2DGVA 3TA1A 3LOUA 3D54A 4HHJA 5MAOA 4OX8A 5KFXA 3DFEA 4Q5VA 4EGLA 4NLXA 3GZ7A 1KLMB 1S7HA 4OLPA 4C3LA 2C2EA 5IT4A 1HNVA 1H6KX 3DOMA 1QVFR 4YUDA 2LA4A 1NB7A 2JEIA 2CFXA 1KONA 3MM7B 3NAHA 1FD2A 4IOAQ 2E1CA 2CPIA 5DJBA 5CYJA 4J9KA 1VQ6S 3CCSS 2NLWA 5JVHQ 3IR5B 2MSSA 3MMBB 4P6QA 1GX5A 5M2PA 3CF5Q 2LXIA 1UL3A 1FRKA 3D28A 2W9AA 1HBOA 2KDOA 3MMCA 3PHEA 4ED7A 2HNYB 2R7QA 5HP1A 2BV3A 2GJ2A 1WEXA 4GO5X 2FVQA 5K8OA 1BGXT 2MHEA 2FTRA 3RBDA 1IKXA 2KM8C 5FDLA 3SI8A 1F60B 2PSZA 3FSYA 4A48A 1K8AT 5T7LB 1Y0HA 4J5OA 2LEAA 1SKSA 2AJ0A 2APOA 2GX8A 1Q8IA 3BSOA 2LCWA 2PGCA 2FHKA 1RISA 3UR0A 3M8PB 5CYMB 2OSRA 1KEKA 3DMJB 3G8TA 1YVFA 2KXFA 4N77A 2CJAA 3EGNA 2HNYA 3FFIA 3GV8B 4TNOA 3V6JA 2CQBA 1R3NA 1YJRA 3PEJA 5L1KA 2K1RB 4GC6A 1WEYA 1SH2A 4CH7A 4QIEA 4A8QA 2ATLA 2AGPA 2BR0A 5M2RA 4UQGA 1MMDA 3M1VA 4Q43A 5KAKA 1LW0B 3FFIB 1VRUA 2L9WA 4XDCA 1KFDA 2KKHA 5HN0A 3OTOF 2FGOA 4LSNA 1S9EB 3R5DA 4OX6A 4J9RA 3E01A 4C0BA 3HVWA 3OTBA 3DLEB 3FGVA 4ID8A 3I5CA 1FRIA 4Z37A 2KT5A 2WONA 4V19X 3TANA 2UUAF 1HHTP 4ILRA 2N7YA 3O44A 4P7TA 3GQCA 2KI2A 1N52B 1KHVA 2ZNYA 3KK3A 2BYCA 2FUG9 3W2WB 2K7KA 1FHTA 3C46A 3O1LA 4RW6B 3I87A 1DJ0A 2R2RA 2LA6A 3T1YF 3TARA 2ZDOA 4X4OA 1HWJA 5EGYA 3T1HF 4NL5A 2UUCF 4HH0A 5IQQA 1HMVA 1TQLA 1YJUA 3NNCA 4EU0A 5LL6d 2BBEA 4WFNQ 2XLIA 4DSFA 5EX3A 3MAHA 3M6XA 3QGGA 4B9LA 4QYZJ 6FD1A 2VA3A 4I6AA 3CE8A 2RKIA 4ED2A 2ZZNA 4OHYA 4TN2A 1VQKS 1ZAWA 3HKZD 2AYBA 1DLOA 2VG7B 3I0SB 2GIQA 4Y2IA 3AA9A 1FVSA 3DRSA 1HBMA 4JI0F 2XLJA 2O3DA 4DR3F 1RT6B 1MWYA 2EPIA 3DOLA 3U7JA 5B08A 1V6HA 1S4FA 4J9OA 1VQOS 1WF0A 4I6WA 3EZ5A 1FA0A 2VH7A 3QWPA 5T7LA 2VBYA 3PZPA 3N5BA 4XK8C 3PDNA 2VONA 3Q0AA 3H2LA 3GSDA 4A4JA 3CCWA 1FRMA 3GV7B 1X4EA 2DITA 4X4SA 3IR7B 3SQGA 1PC5A 5AJ3F 4C7QA 1ZETA 1YRXA 3IRWP 4JI2F 2O5DA 1E6VB 3VCDA 4R8UA 4FNIA 4HI1A 4YFUA 3DU6A 2J9EA 2K1RA 3NNHA 3IG1A 2UP1A 5LXRA 1XR6A 2M70A 2ZM6F 1UA1A 1TL3A 2KHCA 2XSJA 4OFZA 3M9OB 5LMNF 2JL9A 3ZZPA 2Q66A 4YEAA 3CDEA 3OQ2A 5JUMA 3CC7S 4MMOA 3BN7A 4G1QB 2IA6A 4YQWA 2AF6A 1ULRA 3TA0A 2AGQA 5KT6A 1FKOB 3PIPQ 1Q81T 2JLFA 2XMWA 3DDNA 3MFHA 1QSLA 1WEZA 2JDJA 3JSMA 5I42A 1HBUB 3V6HA 1ZZNA 4QR0A 1D9AA 1Y7PA 1Z2LA 3CIMA 3I32A 3RB6A 1H3DA 4PXEA 3J7YI 2CPDA 1FE0A 2HFOA 3FQLA 1M5HA 4ID5A 3CCUS 3M2UA 1VBZA 3UCGA 5I42B 2YNHB 3JSMB 2QLXA 1U1RA 5F8IA 4RWWA 3M6VA 2ZKTA 3D1HA 4AXJA 4WU2A 3VAKA 1IKXB 5DDPC 4R0EA 2F3JA 3RTVA 1LXNA 1RTJB 2E29A 2KG1A 3CXCR 4UUXA 2RU3A 3MEEB 3KMQA 2RRAA 2Z4PA 3I4HX 3NNAA 1U1NA 3IC1A 3BR9A 2Z8QA 4NLOA 1XBWA 2ZE2B 3OVAA 2EBEA 3M2RB 1IQZA 4FXWA 1I94F 1DQAA 2VFVA 3MPWA 2DH9A 3JSBA 1IKYA 5CXTA 3FCHA 1GXTA 1RGVA 3CJ2A 2LDIA 5ITHA 1NJZA 3MM8B 1C0TA 2QZ8A 2MGZB 3MURP 2C3OA 5JJBA 1CEZA 2DGQA 2JEFA 2IVYA 3BQ2A 4ECXA 2NS1B 3HFKA 4ES1A 2CYYA 2RE1A 3SV4A 2N4DA 2OPPB 5DM6Q 1RJJA 1VC0A 1QY7A 4O4GB 1N56A 1OSCA 4Y28C 1FNXH 1M1KT 4U7CA 1TKXA 2OTJS 2EFOA 3UCUP 3DRPA 1U6FA 2COLA 2DISA 2EW9A 1FTRA 1HR0F 2QA4G 1UJ6A 2PMZD 4TLRA 1MNEA 2MZRA 1EETB 3PR5B 1RTIA 5E41A 3CCQS 2AX0A 2GGPB 4ZA1A 4MJKA 2CQ2A 2ADBA 2A18A 2YKOA 1ZPVA 1RYSA 2DJWA 2CVIA 2D9PA 3RW7A 1S1UB 2WSFC 3HHLA 5IZHA 3RR7A 3MCSA 1JX4A 2G9OA 3H5SA 3C66A 1D3WA 1UEUA 2B7CB 5LT5A 4CIOA 4DQQA 2WTFA 3EYZA 1T03B 4PUOA 4MFBA 4K4VA 3CD7A 5DETA 5CYQB 3LWLA 4RWXA 4KIAA 2ILZA 2VBXA 3KMSA 1ZTWA 1REVA 4I64A 3G71S 2YY3A 1U09A 3KG1A 5LJ3Y 2HGNA 3IO1A 2ASLA 4B9SA 4UY85 1Y9OA 1XNQF 3QIPB 3PJXA 3UD4P 4LF4F 2GHPA 4ATNA 4X64F 3VF0B 2R7RA 2VPWB 2R9LA 1X9WA 4PQUB 3OL8A 4PWDB 1VRTB 2BQ3A 1JJ2R 3S6EA 3OHBA 3CJ0A 4HLBA 3GFHA 4LIWA 1TUVA 1YJVA 4I7FA 5KFVA 1BQMB 2F1FA 2GCFA 4RW9B 5KG1A 2B9WA 4JI3F 2JOQA 1S72S 2XY5A 1W2IA 3M8SA 2J7WA 4R25A 4HL9A 2W9CB 4EBDA 2CJQA 2HPUA 5KFCA 3MWBA 4ERDA 3HDSA 2VBZA 4ECWA 1RA6A 3LANA 1VS3A 3C2PA 3S01A 1Q78A 3RAXA 2W4PA 3QO9B 2I2YA 2BUNA 1MU2B 1QUVA 3FMWA 4RW8A 5HLFA 2ZOGA 2V4RA 1N5YA 3CJKA 5GMKa 3F73A 2FC8A 2BRKA 4Y6IA 3TP2A 3JYTA 1U1QA 2Q79A 4C8KA 5DGBA 3FEZA 4XIUA 3KHLA 1AROP 3C6TB 1IM4A 2ZH2A 4AFFA 3GYXB 1N5VA 2GW8A 1TKXB 2HIQA 5G0RA 1JLFB 2YNIA 1B7FA 3TVKA 1FT8A 2C22A 3LF0A 1HYSB 1AFIA 4BC9A 2R7SA 3CO9A 2IJFA 3OJUA 4MK8A 3LPYA 3DGPA 4O3NA 2XO7A 3MAQA 3PFOA 2RQ4A 4TY9A 4OHVA 2IVFB 2WAQD 4N47A 1FRLA 2ASDA 3IFEA 1NK5A 3CUNA 3TVYA 2EFNA 4DLEA 5GADI 5L38A 2RJZA 2K8GA 3LWMA 3PFEA 4IDKB 1NJWA 1RAJA 2POKA 2U2FA 2A1BA 2X1FA 1DQ8A 2DCUB 2AGOA 2IVMA 1REVB 3MEDA 4F8RA 1NO8A 4I2QA 4JI4F 4U6PA 1LWCA 3ZC4A 4DG1B 3BM7A 2DK2A 3HKWA 3AY0A 4TXSA 2XB2D 4QU6A 3K5PA 2X1AA 2WOMA 4IO9Q 1LWEB 4KQZA 4DV1F 1N0VC 2GFFA 2CPFA 5IFMA 3MEDB 4TU9A 2MKIA 3OTCA 3O6QA 4O44B 1M5PC 4USHA 3CCJS 3V81B 2HFZA 4ECYA 4NA2A 2ILYA 1NKCA 3BS9A 2E5HA 3AJ2A 4Q2LA 1DAXA 1I6JA 1W2BR 2Q6CA 2V8GA 3Q8SB 1M5OC 1UAWA 2YX1A 4OZ5A 1O51A 1T95A 2EKYA 2R2TA 2KTQA 2ACYA 4CNZA 1MROB 3D0IE 3N6MA 4EUVA 1BLUA 3FSXA 3G9CA 4Y65A 2EFPA 1VQLS 1UA0A 4FVCA 2LQ5A 1JB0C 2VPXB 1X8DA 4NMLA 1N6QA 2QYCA 1VHFA 3QLHB 4B9NA 1R8BA 3HF5A 1Y5IB 3UWTA 4B3OB 4MH8A 3LP0B 2DT9A 4DFMA 2JHEA 3BGLA 3KFWX 5DG7A 3DHWC 5DGAA 3CPWR 1HPZB 4PRFA 1WG1A 3CB4A 2HHTA 1K0TA 1BQNB 1PSDA 2IAJB 3JTOA 4M1KA 4KPYA 4MIAA 2D3ZA 3ZZ0A 3BF4A 5HBMA 1LK5A 2M8HA 1JLBB 3UR3C 1C2PA 4KO0A 4ZMMA 4DOZA 1VK8A 1HPZA 3JSYA 4CZCA 2Y1JA 4OX7A 2B56A 2M52A 2C2RA 2IMWP 4B3OA 2DB1A 1QM9A 2XWYA 3HX9A 5HROA 1AW0A 2MKHA 3MMAB 2ROEA 2WSCC 3V5RA 3M8QB 2DO0A 2EVZA 2XNQA 2HWHA 2PE8A 4LF6F 3AHPA 4UQTA 2GV1A 4XPCA 2V4JB 1Q7LB 3BZQA 3U1LA 4C11B 2MJNA 4PG4A 1R8CA 5LMUF 3I0RB 1RT3B 2V8VA 2DNHA 5M2UA 3OPKA 2CPYA 5GAGU 3RRHA 4NRTA 1A7GE 2DNOA 3GR0A 3G8SA 2DPIA 1X4HA 2G0CA 2OFGX 2ZFHA 1AXQA 3V4IA 1LWFB 4DSJA 1B0VA 2E7XA 4KGMA 5DRKA 5GAHI 2NREA 1Q86T 1SL2A 3DLLQ 1JNRB 3NKYA 5KFOA 2MJUA 4A8MP 3HHDA 1WWHA 1BQMA 2LEPA 1S6QA 5KFLA 3LALA 4RW9A 2E9ZA 2UZAA 2DNKA 1SXLA 1FE4A 1CC8A 2JSXA 2OH2A 3CJ3A 4FXDA 2BM1A 5THWA 2CQ0A 3FQKA 5IM0A 5CZVA 4LFCF 4NLRA 4DHVA 1XMQF 2HHWA 2F4VF 1L3SA 2K2PA 4KHMA 2KRRA 1VIOA 2HNZB 4PQAA 3DCAA 1FDDA 1UJ4A 1HD0A 4EFAC 3LP1B 5DDRC 1WELA 2QA1A 3M2RA 2BJEA 4AQYF 2EWHA 1CSJA 4QWCA 4K4YA 2XCAA 4QPXA 2JC1A 3DLGA 2V9KA 1KOOA 3QGPA 4QW9A 1Y3JA 4WK3A 4BWMA 4URGA 3HHLB 5AE1A 4X2BA 2CJBA 3CCES 3ONQA 4CI0B 4K4UA 5F3ZA 4N5SA 1RTHA 3B4MA 3Q23A 2HNZA 2B6AB 2FJBB 1H7WA 5F0WA 3AJ1A 2P5VA 2KHDA 3SDEA 1TAUA 3N79A 4IQMA 2MSTA 1X4CA 3DC2A 5LSRA 1X5SA 3NBPB 4Q45A 1YQHA 1U1PA 2AV5A 2VZ9A 4IR1A 1VQ9S 3CVKA 5KT3A 3X1LB 1VRTA 2XEXA 2W7OA 3R5BA 1CQMA 2DHGA 5A2QY 2XGQA 5KOWA 4WTYA 1UW4A