3U02A

Crystal structure of the trna modifier tias from pyrococcus furiosus, northeast structural genomics consortium target pfr225
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
239
Chain Sequence
MLIHIGIDDTDSPNGMCTYIGAILYREISKIAEPLDFPRLIRLNPNVGNGAVAMSFKIDEEKIKEVKTLVIRYVRELADIDPGIVFLIGEVPKELEEFSLRALREHVTIEEAEHVARKVNAEVYKFKLGRGIIGGLAAIGYPLEKFTYELLAYRKREYWGTPRRVIKESVFYADKWSYPFTYDNVDPYKRTVLITPHGKDPVLVGIRGIDVGKILQVFEMIKIEEPIEFFQVYKTNQNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tRNA modifier TiaS from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR225
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Transcription
molecule keywords Putative transcription-associated protein TFIIS
total genus 54
structure length 239
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3u02A01
3.90.600.20 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 3u02A02
3U02A
chains in the Genus database with same CATH superfamily
5D0GA 5CHCB 3M9OB 4JYAJ 3R8YA 3C6TA 5F3ZA 3SQOP 4DFMA 4HTIA 1H74A 2UV8A 4HVZA 3IC1A 1LWCA 4QIFA 1I3OB 3BH7B 2X1AA 3GU0A 1BHNA 3HFVA 8AT1B 1WTBA 1Y11A 4XPCA 2XCPA 3UCUP 1TK8A 2D69A 2OPRB 4RU9A 3N9UC 5I4MA 3PTWA 4MK7A 4OYMA 1N5YA 3PG9A 1SJQA 1RAIB 1OPIA 2M7SA 4KO0A 1RCXB 2HQIA 2MGZA 3VAJA 2B9XA 1KVKA 1VYAA 2Y1JA 2W9CA 4DQIA 3DYAB 4DR6J 2R7OA 3CO0P 5DLGA 1WDDA 3OFHA 1W2IA 1O0PA 2MMYA 1MMNA 2DNHA 4RW8A 4CNZA 2MZJA 5KT7A 4ECUA 4H4OA 1O51A 2AX0A 2F65A 2QLWA 1U1PA 5D3GA 5KFDA 4WIIA 1HYSA 3CW2C 4CLSA 1WORA 2A1BA 4DSIA 2LMIA 2QFIA 4P9SA 1JJ2R 4DV7J 1XMOJ 1U6BA 5HLFB 3UQSA 1FVSA 2M3DA 2LYVA 2DR5A 1FNMA 1C0TA 1DLOA 3I4PA 2UVRA 3KJVA 2RU3A 3W2WA 2ZH7A 2YY3A 3MMJA 1YKWA 2VPYB 4HHUA 4WU3A 3Q2TC 2XNQA 1GAOA 2HNYA 2W9AA 4ICLB 4JI3F 1S10A 4LSLB 4CLLA 4DSJA 3BDPA 1S1VB 5KFLA 3IBFB 1RAAB 4DN0A 3I5CA 4LJMA 4KAIA 4L73A 2GJFA 4RLEA 3D6FB 5IC4B 1U1LA 4JI4F 4FXDA 3DM2A 2MLZA 5KT2A 1JB0C 1FDDA 1EX8A 3QLHA 4MMOA 2WTFA 4KR0B 3CULA 1PC4A 1J5EF 3HJVA 3GB0A 3PXGa 1FO1A 2M8DB 4I67A 4OI2A 2KDOA 2B8QA 1S77D 2CNNB 3H42A 1RT2A 5HI7A 3SCIE 4OZ3A 3NAHA 3SFGA 4UOHA 1K73T 3UDCA 2HK2A 3IR5B 4PEOA 4TXSA 5GAHI 1K9MT 3B54A 2M2BA 3DLGA 3ITHB 4P72A 2HHSA 5IS2A 2K7JA 3QRQA 4MK9A 2H9ZA 2N3LA 1QD1A 1WF2A 3TUJC 4M94A 4P73A 5A0YB 1SH2A 1U4BA 1RA6A 2E1AA 4J9RA 2V2ZA 2HZVA 2DBBA 3N5BA 3UD4P 3MI7X 3TJAA 3DGPB 1JLQA 1IBCB 4Q7AA 2LFVA 3CMAS 3J7A1 1JJHA 1VIXA 3FDSA 1TK5A 2OEMA 3TJ9A 4AD6A 2DIUA 1CJVA 2DO0A 2SXLA 3WC2A 2ZH5A 1MWQA 1WACA 1O8BA 4L72B 1YIJS 4B3SJ 1VRTB 2H1YA 2LDYA 3GYXB 3VGUA 2KFYA 5G0RA 4ECWA 2UVUA 4JI2J 1KHWA 1XBWA 3U7JA 3TAQA 2CDQA 4RNNA 2W2MP 4K4YA 1TZ0A 4P52A 4ZVFA 4RBUA 2HLUA 4EYIB 3HSDA 5LSRA 1CJUB 1ZTWA 2XY6A 3PACA 1T03A 3T1HF 1VQ7S 2WSCC 3KHGA 4USVA 3KLEB 2A0FB 2DHHA 3WDOA 1DJ0A 2ZOMA 4B3OA 2B7BB 1SUQA 2EW9A 4FDFA 4PRFA 3RB3A 4QU7A 2HHQA 1Q95G 2ZDOA 4G1PA 1AB8A 2MPUA 3HVRA 2PMWA 5C42B 5IT4A 3MUMP 4QPXA 4JI5J 5T7LA 4OV1A 1FFSB 4D3HA 3KWMA 4OHZA 1NHVA 2A6OA 1ZM3A 3V6DB 2V94A 1WC5A 3MD3A 4KTQA 2UUAF 1AZSB 1R8AA 1UP1A 4Y2CA 4LIWA 3HSJA 4B9TA 2DHAA 2NXJA 4WP9A 1H7WA 5LT5A 4NA2A 4X4PA 4YUDA 5GAEU 2OD6A 2RKIB 2XMKA 3MMBA 3OR2B 4M8LA 3MR2A 4KGKA 3FC9A 2HZAA 4IFVA 4DEZA 1RTIB 2OO4A 5IWAF 2I5JA 3TQ1A 4ZJOA 2CWXA 3Q86A 4PABA 2O01C 4WTOB 4NLVA 4OX6A 3KDOA 3M32B 3O3LA 1KDNA 4JI1J 3BV8A 5A8WA 3MM5A 3MPWA 1OIAA 4C8MA 2UXCJ 1SCJB 4OYWA 4C8NA 1S0OA 1TUWA 3D6MB 4W90B 2MZRA 1T95A 4PQUB 2FQQB 3I56S 4C8LA 2EWHA 8RUCA 3OHBA 5CH7B 4F3MA 1CJTA 3P8BB 4ZPVR 4A46A 1V3RA 5CYQB 4F3QA 2CAJA 4LR9A 2MB0B 1U8WA 1Z2ZA 2DT9A 2V2VA 2YKNB 3AY0A 3CGIA 3DLKA 3GP9A 3SXLA 2HNDA 2DPJA 1IVZA 2QZ8A 5IQQA 5AXMA 2AGPA 2YWEA 1IR0A 4ZPCA 2LEPA 1IQTA 2CJKA 4TLQA 2CZVC 2B4VA 4PQAA 4P71A 1RISA 2L3MA 2MKYA 1BC6A 2FHMA 2KVQE 5D6GA 3KTQA 2MZSA 2ZUAA 4A8WA 2BJDA 1HNIB 1UEUA 3PX4A 3T1HJ 2V8VA 3MECA 4OX9F 1R0CB 2YS6A 1S0NA 3L7UA 3DCAA 5FDLA 5J2PA 2CJ9A 2C3YA 4H4MA 5CYMB 4LF9F 2EC2A 1SJRA 2WRMA 2LA6A 2MHEA 4MAKA 4B17A 1K8AT 3R27A 4YQWA 4C0BA 1SJ1A 4FXWA 1K1SA 1VHIA 2C42A 3D68A 2XCAA 3HP6A 2YX1A 3H4DA 3HMJG 2D3OR 2RVJA 1PBAA 2RJZA 4FNHA 4RWWA 5L1KA 2R8JA 3H5UA 2HGMA 3PJWA 4NCGA 3JQMA 1WHVA 1ZPWX 2LQ8A 4DCOB 1GXUA 2GGPB 4ZVTB 2V9WA 4OZ0A 1YJWS 4I69A 4J7CA 5DZ7A 4RW6B 3KLHB 1NSKL 1Z1ZA 2ZOFA 4EO8A 2YH1A 1FFGB 4RW9B 1NSPA 1R6YA 2IMOA 4MKAA 2ZWOA 2FC8A 4NLSA 3OVSA 3QPIA 1RT2B 4ED1A 1FXLA 4IH7A 4LIRA 4C9DA 4DUZF 1UVNA 3N5FA 3PYDA 1HD0A 4BBYA 4NYPA 1NXIA 3G86A 4ZCLA 2AJFE 4DL3A 1OYEA 2DPIA 3FZBA 2VG5B 4CH1A 1IKYA 3N4WA 3KDNA 4U7UK 2K1RA 4DOZA 1X4HA 2CYYA 3GV8B 1M5VC 4FF2A 1N32J 2GIRA 1LWFB 5HAOA 4WK1A 5SZTA 3EGVA 2R7WA 1Q16B 2JEGA 4X66F 1RT7B 1C0TB 2DGXA 1NKCA 5E3QA 4ECRA 3W9JA 1H3DA 2AZ3A 1MN9A 3MM8A 4ZVRB 1TAUA 4DWIA 3FBFA 3HT0A 3T5KA 2AGOA 3EZOA 3QATA 1IJFB 1FFWB 3G87A 4N56A 3QFWA 3FBEA 2CPEA 4RPFA 1VQ8S 4JI7J 2IDLA 1I6JA 2XTJP 3QIDA 5K5MA 4IQXA 3DFEA 3RB0A 5EWEA 1OJ4A 2F4FA 1L5UA 1NNDA 2GHVC 2RHSB 2F8MA 3OTEA 2CPJA 4IQMA 3H40A 4FBTA 1I1GA 4LFAJ 2ZJPQ 4IR9A 3MWBA 3PDNA 3T6JA 3ZZZA 1IR2A 3ZFVA 3RRKA 1RYSA 3KXDA 3Q8PB 3MM9A 3MEDB 3MR7A 4ZPDA 5IZHA 1KR4A 1QAXA 2LA4A 3HXMA 4K4XA 2GAGC 2IPOB 3JTOA 4QR0A 5IOLA 2RRBA 4DPYA 1YJ9S 2IJRA 4P2FA 4CLYA 2ZHAA 4IR1A 3JAMU 4MH8A 3P5BP 4DR5J 3PYEA 1GNKA 4OHWA 1LWEB 3SCLE 3N28A 1SQGA 2H54B 2Z56B 3ZZOA 5T7LB 2NYHA 5H9EK 2KL8A 2LXIA 3OL9A 1VKZA 4W4MA 3A13A 2BW2A 2E7VA 5KFQA 1F5CA 1ZAVA 2RH3A 3B6BA 1CQMA 1KONA 1MLAA 1ZOTA 3V6DA 3THVA 4LVOP 2HQDA 2E7WA 5KFFA 2OPRA 1FK9B 1N52B 4DV7F 1S1TA 1XMOF 2W9BA 1X9SA 4URQU 3BS9A 4OJGA 1BMQB 4P7VA 1U8SA 4J9OA 2M9KA 2YNIB 2YWHA 3D6TB 3WIVA 1FRLA 2MKJA 4DX5A 3K89A 4AQYJ 2XO6A 2F8EX 1RP5A 3BYRA 4G3IA 4YHHJ 3I5BA 2ZKTA 5FIIA 4RUCA 1HA1A 3SYZA 2HS4A 2KVIA 3DC2A 3TQEA 1IBKJ 3MOZA 5HJYA 1RLCL 1VCTA 3IGNA 4DUZJ 1VLOA 2BACA 4LBHA 4Q44A 3MEGA 1EKRA 2WZ1A 2XZDB 1TR0A 1HBNA 4IDKA 2N7YA 1HNVB 4YDDB 4OI4A 2IA6A 3NCRA 2LQJA 4JI4J 1RE1B 1ZM4A 4C11B 4PUOA 5B0DA 3DLBA 1RT7A 3RUBL 4QR1A 3H0PA 4ZLLA 3H25A 1QM9A 3M30B 4C0OC 4EK2A 1DTTA 9RUBA 4DSLA 4FKYA 4RUHA 1ITPA 3A8IA 3LWMA 4QYRA 3UVJB 4RNHA 4PR6A 5J2QA 1VC5A 1FA0A 2XS2A 1O6XA 4USHA 2DH8A 4HDHA 3UFCX 1Q82T 3I32A 4ZP6A 2WVCA 1OMSA 5KFWA 1FKPB 1CJVB 4C7QA 2BANB 2J5AA 4BWMA 3T6BA 3O6QA 1SVDA 2FZCB 1RQ0A 1IQZA 3PRDA 1NPRA 1HR0J 4X4UA 3FMBA 1IUJA 2A2CA 4ZHRB 4J9UE 2YNHB 4OFZA 2AEFA 2O3DA 2VC1A 3R7BB 1JXLA 3HHLD 2J6TA 3QRRA 2HVZA 2V8PA 3IMQJ 1C4AA 1R8HA 1RABB 3RU0A 1FJCA 4LF6F 1YZ6A 4QCLA 3FBBA 4HT7A 3W5XA 3MCMA 2XMAA 3VAFA 5CD4A 5AJ3J 5IC6B 5DGAA 1YVFA 3KMSA 4LSNB 2UU9J 2PO4A 3ZXWA 4X62J 2GNKA 1HPZB 5DGBA 5KT5A 1TL1A 3FRYA 2QG9B 2GMLA 5GAEI 3J80Y 1HI1A 3US5A 3HD2A 1YJRA 4USTA 1IWAA 5MLCV 1S1VA 2LU2A 3JSMB 1CJTB 4KT0C 3M8PB 2P6SA 4UUWA 1Y00A 3SSRA 3OTOF 3QGGA 2VQEF 2XNRA 4UY85 2B4UA 3DM2B 1QUVA 1WDTA 1XWLA 2WONB 1G1XA 5E33A 2RDIA 4LREA 3HX9A 3I0SA 3W7BA 3A4TA 2UUBF 2E9RX 3FK4A 3CDBA 4F36A 2HS3A 4LBIA 4ALZA 4DPUA 1Q81T 3M8RA 4LF8F 1IKXA 3DDNA 1X5SA 2FPHX 3J7ZT 1B64A 1RKIA 1TU0B 2O67A 2QN6B 3IS9A 3WBZA 5FLXU 1SL0A 5ETNA 3CVKA 2HQFA 4DJBA 4DMZA 2JLEA 2VA2A 1FJEB 2VA3A 1PGZA 3MM5B 4FF3A 2DCLA 3J80U 1RHMB 2NXCA 4R5PA 1B70B 4OV6A 5D4LA 4ED6A 2HHVA 3GSDA 2FHJA 1ZM2A 1PKUA 2RT3A 3M6UA 5EUHA 4D3GA 2JLFA 4DUTA 5JMNA 1HQUA 3IWNC 4M5DB 2BDPA 4JI6F 1JLEA 5J2NA 2HMIA 3T5LA 2AWZA 2YKNA 1UEVA 3LA0A 1NHKL 2QTWA 3D3CJ 3LOUA 2YKAA 4XK8C 3KJVB 4K2JA 3CCJS 1Q79A 3W5YA 2YS7A 1BWEA 1LXJA 1P1TA 1V3SA 4A8XA 3MFHA 2YBVA 2KT2A 3TX8A 3BN7A 1KTQA 4NLTA 2B56A 1G4CA 1FE4A 4DFKA 2CPYA 1OQ3A 3CE8A 3IG1B 4KHMA 2VFSA 3J81U 1UA1A 5CXTA 2VONA 2CADA 1IKWB 1N48A 1YX2A 2KO1A 4GVLA 2DO4A 3P96A 3WX8A 3BQ2A 1VQMS 2DRAA 3VQSA 4LF6J 1TVRB 2KHDA 4OYPA 1TL7A 3G6XA 2PA3A 1X5PA 1G2EA 2MKSA 4RBTA 2AZ1A 2ZKUA 3NWGA 4MYTA 2DTJA 3C6UB 2VKZG 5J1NA 7FD1A 4M1KA 5HP1B 1HNWF 3EE3A 4NLXA 3PM9A 1VHFA 2XS5A 4DR2J 5B0BA 5L1JA 4W92B 1RHRB 3AA9A 1ZZFA 3GTYX 4Y28C 3Q8SB 2VFUA 3HHEA 2R7XA 3EUNA 5EWGA 5J1EA 1XTZA 1S1UB 3Q83A 5HO4A 4V19X 2QMWA 1MSWD 1GXLA 1JLFA 3TZXA 1FX4A 1AZSA 1G3OA 2R7SA 7FDRA 5D77A 1YK9A 2ZE2A 1SV5A 3LO3A 1SC3B 2XBPA 3DGPA 1B7FA 1AA1B 4JV5J 2RKIA 3IN5A 3PW0A 3NL0A 2YPZA 3AFGA 1BQXA 3CJRA 4CYUA 3B78A 2E1PA 3MM6A 5GAGU 3VGSA 3V4MA 4OZ1A 2X1FA 2HURA 1ELOA 2O66A 1VC0A 5D8HB 4CRJA 2CUYA 3G96A 2ZITA 5IT9U 2QLJB 3HVWA 4A48A 2UXBJ 1WOOA 4HHJA 4YN3B 5K20B 1RKJA 3WIUA 1U09A 2AV5A 3LAKA 3NS7B 4KV8B 3LPYA 1F6TA 3LP0B 4DL0C 1M1GA 1R0BG 1RBLA 3MJFA 3OLAA 2W8LA 3TAMB 2AF6A 2OSQA 4ID5A 3PEHA 3MZIA 1RU1A 3N6NA 4OYAA 4XDDA 2H4YB 4JV0A 2BE2B 2QK4A 3GMGA 1PCAA 1TKTB 5DO2A 4DV6F 3GIRA 1S4FA 2V8HA 2X7IA 5JJBA 4IH6A 4ENOA 4O44A 1HMVA 2VU5A 3KJQB 5KT4A 1ACMB 1NZ8A 1FNXH 4DV5J 2WBMA 4DV0J 4RKUC 3N79A 4WZQA 4UQGA 2UZAA 3JYTA 4LF1A 8ATCB 3TOQA 4K5RA 5HP1A 4ZP8A 1HNWJ 4F0KA 2N4CA 3GJRB 3ZZUA 2ROGA 4A8MP 4DQSA 1Y5LB 1T9YA 1SPBP 4IRKA 1UJ6A 3PRVA 2FJXA 1N5TA 4DR1J 3OTDA 4OI6A 1RWVB 4PG8A 1WKLA 2AW0A 5HVFA 2VC0A 1T3NA 1URNA 1TL1B 1QVGR 3GYNA 1HWIA 5HQ8A 2HVIA 1KLMB 3EM1A 3X1LB 1WI8A 4L3NA 2EG1A 3BR9A 1RAEB 2IMWP 3ULHA 2J9EA 2R7RA 1LQ9A 2HNZA 1YRTA 1MROB 1QTNB 2ZJQQ 5H9EJ 2KJWA 4USUA 4CO3A 1OYDA 2XSJA 2JEFA 1RWUA 2C2NA 3HHKA 5ETKA 1J2VA 3I0SB 5KFCA 4DR5F 1NKEA 4OZ5A 5KOWA 1FWKA 1SKRA 1M5PC 4M5KA 3TVKA 2YKQA 2ZJRQ 1KSPA 3GIIA 4NI2A 1R89A 3ISND 4EEYA 2CJQA 2N3OA 1RLDA 2RQMA 5GADU 4JI0F 5EWFA 1KVIA 2XEXA 2CNKB 4ELTA 4E0DA 5HANA 2BR0A 2G0JA 2V4JB 1TFYA 2EXUA 2KRBA 3DXBA 4K59A 4DBQA 7AT1B 1BQNB 4KYZA 4B9VA 1X4BA 3Q8UA 3SV4A 4HH1A 2DEJA 4IKAA 4KV8A 3CJKA 3L9ZA 4AQYF 3LP0A 4LF5J 5HK4A 4CO0A 4P6QA 4QYZK 3M30A 1Q8LA 2W2OP 5CA5A 3RAQA 1CPZA 2VUGA 1RTJB 4PAAA 1FDBA 2A10A 2OFHX 4ZLNA 3H5YA 3NBPB 3JSYA 4P2SA 3HHNB 1X0PA 2HFOA 1WHXA 3JXOA 4MTPA 3CJ4A 3OD2A 4Z37A 1KQKA 3R5BA 2V5HG 2VBXA 4OLOA 1IBLJ 1FF2A 3HVTA 3M4XA 1EP4B 5EHHA 3UDLA 1FK9A 2R8KA 2YNHA 1KFDA 4RW4A 2B6AA 2D3ZA 3H20A 4YR0A 3BM7A 3VQTA 1N0UA 3CEDA 1N6QB 4PXBA 3M8QA 3CJSA 2VB6A 2AYEA 1YSJA 1IBKF 5F9NA 2NSCA 1GMWD 4RO0A 1X5OA 4CNYA 4GRSA 4QW8A 1FX2A 2M4MA 2YQ0A 1PJ6A 2OEKA 2HVEA 4K5SA 4O23A 4X64F 4XPEA 1EIYB 1UVLA 4NPOA 2QX0A 4EBCA 4J9LA 3FBCA 1NBEB 3HZEA 1TL5A 4GMKA 2YH0A 5GMEA 3UE2A 3BO4A 2FLOA 5DM7Q 3M32A 1B0PA 3NNHA 4ED0A 3HM9A 4HKQA 5A8RB 5DZ6A 3PYFA 4PUOB 2HHUA 4R8UB 4LF7F 2I6WA 3UI3A 4TU7A 2PSZA 3H59A 3LALA 4L74A 4M5NA 1RTHB 2OD4A 4C6AA 1JXVA 4QBUA 4P2MA 4DPXA 2ZM6J 2XB2D 3MMAB 1NK7A 1IN0A 2POKA 5BJRA 1NJYA 2ZNZA 3D7SB 2UU9F 2RF2A 1UVMA 4PWDA 5F8NA 1GXTA 3PW7A 1Y3JA 5H1SV 4CYUB 3EPGA 3TI0A 1DQ9A 3SCJE 2BX6A 4N7TA 3WX4A 3KHHA 2NLWA 1APSA 1YJ7A 2OFGX 2ZEJA 1NEEA 3V6JA 4I7FB 1KOHA 1LFPA 1AUDA 2BM0A 1YRXA 4B3SF 4ETZA 2NR0A 1IKWA 2KYZA 2ZD1A 3GJQB 4L75A 1R0AA 4WFNQ 4N76A 3P4UB 2MY7A 3HT3A 2NYIA 1RDRA 1SI9A 2OMLA 2PD1A 1T9XA 3AT1B 4PPDA 2AYMA 2JZ5A 4YS2A 1H2UX 1HQUB 3MEDA 2KG1A 4P10A 4RNOA 1F5BA 4Q0BA 3M9NB 4O4GB 3KLGA 2BUNA 1JLBB 1CSJA 2DYAA 1C4CA 2KHCA 3GJTB 2HFUA 3IRXA 4ZCIA 2ZFHA 5KFPA 3PVXA 1U0HB 1J27A 2QO3A 2Z2YB 3VVUA 5KG6A 2EFOA 2EFQA 5KG1A 3VF0B 1N34F 4J9VA 2H3EB 4X4TA 2PIIA 4DV4J 1J5OA 1XNRF 5A2QY 2XMMA 3JB9k 3IG1A 3MPUB 3HZGA 4C3MA 1U1RA 3G8QA 3ET6A 1DZ5A 2GGPA 1FRIA 4IO1A 4YFUA 3MPDA 4OHVA 2C2ZB 4QIWD 3VHQA 1EARA 1MWZA 2HIYA 1X7VA 3DMJB 2N4DA 2MQ8A 4J37A 1NB7A 2XI3A 4YY3F 3PX0A 4CWBA 3HCXA 3LQVA 1RT4B 4KGZB 2HYIB 1LWXA 2E9ZA 5B0EA 4WE1B 1NAQA 3G82B 4MFBA 4IOBA 2VDIA 1C1BA 2LQ5A 1GQEA 4TU9A 3DLLQ 3I0RB 5D15A 2B9EA 4WF9Q 1JQGA 2LDIA 2HKEA 2RNEA 3LP1A 3OPKA 4ZVQB 2D41A 4O3PA 1P9YA 3ZC4A 5LMUF 1D9DA 4J9PA 4W98A 4IG3B 4XDCA 3KK2B 2NUUG 4A8SA 4U7UD 3V4IB 4OHYA 4NLRA 3SEOA 4EU0A 1TV6B 3HVAA 3ZTQA 3LAMA 2VG7A 4QWBA 5JVHQ 2J6SA 4KO0B 3K58A 2E5LF 4F3OA 5AXKA 4LR7A 1URRA 5F8GA 2ASLA 1U1KA 3Q23A 4OYOA 2COLA 2Y9HA 3NKYA 3ELHA 2UUCJ 3VZHA 3RB4A 1TKXB 1T9WA 1T9TA 3ZO7A 1NJXA 3M9MB 3BN4A 2QFJA 2Y8WA 4HR2A 2KJVA 5DLFA 2XY7A 3W2VB 2HFNA 4P7TA 1HMVB 1VBZA 2FHJD 2GMJA 3TANA 1WD6A 2HBYB 2ADBA 5L39A 3AXMA 2RSQA 3CWJA 3FFIA 5GMDA 2EFVA 4M5LA 4U67Q 1M5KC 4Y00A 1UW9A 4C0HA 5CABA 4DQPA 3BGFA 2DD8S 1C0UA 1LEOA 3M2RA 4IH5A 1Y10A 3NGSA 2ZH9A 2ZC3A 3DOMA 3PJXA 5KG0A 1UETA 4X4QA 1UAWA 1HNXJ 2V68A 1YBAA 3CO9A 3NGKA 4HLBA 4KH0B 4O3QA 1KWMA 2IYGA 2RHQB 3ZZ0A 2XI2A 2IVMA 3U27A 5LJ5Y 4ED2A 3JSRA 2D9OA 4WU2A 4LSNA 2B4OA 3NOGA 4BC9A 1QAIA 2PA8D 3S01A 4FPRA 1FJ7A 4KC5A 3OQ2A 4DPOA 3PKYA 4F0MA 2A18A 1WOSA 2APOA 3OLBA 1UPMB 2CQHA 2NXNA 2GVDA 1JLGB 3OJSA 3LP2B 2HG4A 5KFBA 3FKBA 2KZMA 3A8EA 3ZZPA 2E5IA 3M6WA 3M8SA 3OBIA 3UN2A 2W9BB 4LFBJ 3JS9A 4GKKF 2B9YA 3TEHB 3EZUA 3BKFA 4ZLPA 2J0WA 1NPPA 3QIPB 4DV1J 2C1EB 3AJ2A 4AL6A 4RU2A 1DY3A 1WNEA 4ANCA 2V8DA 3OXGA 3GV7B 2AKWB 2VQFJ 4UQTA 2BKOA 3K8WA 3GR0A 2GS8A 4OYIA 2ZH1A 2DNNA 4Q45A 2CNLB 4CLZA 2YNGA 4FYDA 4C48A 1YTYA 3DU5A 2XG8A 3IFEA 1XR5A 3TVZA 5EGYA 2JNJA 2MQMA 3DHWC 3R7NB 5L1LA 2VD3A 5J1EB 1B99A 4A8QA 1KOOA 4LRCA 4ZVGA 2V9KA 2WAQD 3HHLC 3PY8A 2V4QA 1RWKB 2MJNA 2VPWB 5HQLA 1T02A 1HW8A 4KSEB 1B0TA 3NAIA 5ETOA 5C25B 3KHLA 1M1KT 4WYWA 1KFSA 4UTGA 3ZTSA 4CLFA 3BGRB 3TAMA 3BQ0A 3M8WA 2EKNA 1HBUA 1RWOB 4ECYA 2RILA 1QY7A 1RAGB 2XYGB 1S6PA 4A4JA 4DV3J 1F2GA 1BE4A 1VDHA 4M5MA 1WTFA 2JH3A 4IFYB 3CCVS 1IM4A 2YWGA 5DQGA 3TAPA 4F7VA 2OJ3A 2JX2A 1ZH5A 3I6PA 3PKMA 5H9FK 3ILJA 1VQ9S 4B9SA 5THWA 2HHTA 5AXLA 1SQFA 1RWWB 2B6AB 1FERA 5F8IA 4HACA 3UD5A 2YTCA 1MMDA 1WWHA 2J7UA 2FVQA 3V81A 4DL2A 5B7WA 2ASDA 3R2CJ 2RUGA 3QLHB 4LQ9A 2QT7A 3N0VA 3OTOJ 2VQEJ 5B0CA 4CIOA 2QYCA 3AAWB 2LEBA 3C6UA 1QVFR 2ZBQA 2XHCA 4NLGA 2HQGA 2LCWA 2OPPB 2DITA 2UUBJ 1K0VA 2VL1A 4J9SA 3M6VA 4JI0J 1WG5A 3DLGB 3ITHA 5E3AA 4QPTA 2D9PA 1JMTA 2V0NA 3O2IA 1NSAA 5KTQA 4ECXA 2BV3A 1CQNA 3HVTB 4EZ9A 4USIA 1S1UA 2WVDA 1B0VA 3JAMY 4KBIA 2DNZA 3UR3C 2BRKA 2EI5A 2JFKA 3KLIB 4HI1A 4RW4B 3GQCA 3ZNUA 1VQ5S 1FD2A 1ZAWA 3M8PA 2XMVA 3MF5A 3NS5A 2ILYA 3HFKA 1UTAA 2HAIA 2P6TA 2WONA 4HYKA 3BBBA 2K2PA 5KFSA 5CYJA 5IM0B 5BR8J 2MDAA 3JTPA 5GAGI 2LLZA 1HWKA 1XMBA 2J8SA 4I6WA 3SDEA 1FXDA 2C2OB 3TP2A 4CQ1A 4NI2B 3CCRS 2DNQA 1KEKA 4B9LA 2VG5A 1IBLF 4ERDA 3S7RA 3LP1B 2MQOA 3CSKA 3R6GB 4N8OA 2CQ1A 4KHRA 2VH7A 1LWFA 9ATCB 4G1IA 2JLGA 2C3OA 1GX6A 1HYSB 1CC8A 3V4IA 2RS2A 2CPIA 3QBCA 1OS5A 1K47A 1N88A 2CQPA 2OPSB 2QGFB 3HDSA 3I96A 4FXVA 3OV7A 3PW4A 4JV2A 2W4PA 3JTNA 2CVEA 5I3UB 3NBPA 1FT8A 5T14A 3R1LA 5U47A 4CO5A 1X4EA 2CPZA 3E01B 3KUHA 4DZDA 4X4OA 3D0GE 2K7KA 4V19J 2DNGA 1LK7A 3VAMA 6FD1A 1U6FA 3DYAA 4DUYJ 2BOPA 2CJBA 1UVJA 3QJJA 2HWTA 1UFWA 4NX9A 5K14B 3TRGA 5LMNJ 1P8GA 2G0IA 2J0QD 4NLUA 3RBZA 3FCWA 4ES2A 4DL6A 1YI2S 1CULB 3OJUA 4B3TF 3PFOA 3O44A 4TLRA 2XLIA 2BE7D 1JIHA 3M2VA 4OLPA 2UUWA 4S0MA 1WC0A 2R7VA 3D1QA 3ILLA 5D3GB 1VK3A 3T1YF 2KRRA 1LV5A 4DX8H 2HVHA 3QT5A 3OHAA 2F4VJ 2QLFB 1LXNA 4PCQA 2FVSA 2B7CB 3BREA 4AXJA 1U1NA 2NREA 2HBZB 1V5VA 5K8MA 4IFVB 1V6HA 3C14B 2JOQA 1R8PA 4QOTA 3C3LA 4B3MF 4WFZA 3KLGB 2VFTA 4DR4J 3IRXB 1W7WA 4RUBA 4WTYA 4ED4A 1HNZJ 4A47A 3GG0A 1NSQA 3FCHA 3G2XA 3RBEA 2B0GA 2W2NP 2W7AA 1NRKA 1P27B 3L7OA 4AT1B 5D4OA 1D8YA 4F4AA 3E51A 3NMRA 4ZPTR 3CC4S 3A3OB 4LRBA 4LMZA 3M2UB 2OIHA 2YNIA 2YXLA 2Z57B 5HVGA 2CQIA 1WC1A 4MJKA 1H73A 5CYQA 3U1LA 4XIUA 1VC6A 2G4BA 2NZ4A 2HHWA 2FZKB 3DNCA 2GO8A 2Q1LA 3IM8A 3KHRA 3H4BA 1GH8A 3KLFA 5BR8F 4LRAA 5EX0A 3W1YC 4AXIA 2QSFA 4CLTA 2AJ1A 2NQPA 3I4HX 2UXDJ 3H8YA 2XM3A 2XMWA 1SJFA 4CTAA 4QIEA 3KMQA 4ZJLA 3NLCA 1EQ0A 2XGPA 4F04B 5F0UA 2CQ2A 1Y7PA 4DN9A 5I42A 3W65A 4WKYA 3DRRA 1UCNA 4YB6A 4DS5A 4C11A 3A3PB 4PG4A 3GE9A 4E2FB 4PQUA 1WG4A 3BBCA 1D9AA 3RYLA 2F9DA 3NEKA 3UCZP 4ZPBA 2D7SA 2FJAB 3MGJA 5C25A 4K4SA 4FP9A 3CPWR 4F4YA 4AL7A 1HD1A 4J9QA 2OELA 1HBUB 5F0WA 1FRMA 3R9LA 5LSOA 4B02A 2MSTA 1C1CA 1M0SA 1EQMA 3OW2R 2K8GA 1AW0A 3H98A 2NS1B 3DKDA 1UMJA 4DFPA 3AB4B 2QL7B 3S6EA 1XNRJ 2D1CA 1JLGA 2CQ4A 3GIJA 1DAXA 4LRDA 2IFXA 2YVSA 5C24A 3W66A 4EO6A 2E29A 3M1VB 4U7CA 4FBUA 2XWXA 4B9NA 5L46A 1X60A 2O5DA 3BGLA 4AE5A 2V2QA 3PNIA 1CJUA 4A8OA 1KBRA 4YY3J 3RG6A 1J5EJ 2IC3B 1S9GA 3LGMA 2DEIA 3NWRA 4QIGA 4ZK7M 4ILLA 3ILOA 4CO1A 1FD8A 2F7VA 4P2XA 3SFUA 2ZOGA 4HH0A 2DVIA 3JSBA 1WEYA 5J2MB 1CEZA 4I2QA 3TA0A 1TQLA 2IP4A 1IM6A 1ZA1B 2EFGA 2YNGB 2XGQA 4PZVA 2DY9A 1TMMA 2K1RB 4EI2A 4Q43A 5HATA 4B9UA 5IV3A 1KN6A 3BR8A 3WC0A 1T9VA 3D5MA 2GVDB 2J7KA 2FJDB 2DR6A 3C16B 1VK8A 1KQGB 2GQCA 4R8UA 1Q1KA 1UJ5A 3DI6B 3EMTA 1FKAF 4LR8A 1L3KA 2HHHF 1DARA 2E1RA 2VG7B 4ID8A 4TY9A 5I3PA 1CLFA 4OZNA 1RT1B 2A2DA 3PYGA 3QIPA 3DN9A 1QLNA 5AXNA 1T11A 2L9DA 4KGVB 3EVWA 2F5GA 3L09A 3CJ2A 5HBMB 1D09B 5K8OA 3CJ5A 3LTOA 3TZWA 3C2PA 3SI8A 1WELA 1MN7A 2K06A 4JI2F 2DH9A 3Q2SC 4IUFA 3BSNA 1FTRA 1UW4A 4OZLA 5HMYA 2MTLA 3G9CA 2NPFA 3GLJA 2FHKA 2OH2A 4GKKJ 2G2YA 2QMXA 1Q0NA 1UFKA 3DOMB 2BJ1A 5F8HA 2RQ4A 1SIWB 4X4NA 3FCVA 4IRDA 2BKNA 3T1AA 4ER8A 1S57A 3DLKB 2QL5B 3MM8B 3QGIA 3HKZD 2DISA 3AA8A 3CCUS 3TO8A 4JI5F 4DL5A 5K14A 3IO1A 4DX6A 4DV2F 3KFWX 3TA1A 3CC7S 4ICLA 2DCUB 4ZPAA 1BLUA 2HGNA 3CCZA 4NCGB 2XY5A 2KXFA 2XWYA 2Z30B 1M90T 4NLOA 4Q2LA 2MQNA 4NL5A 1U48A 3A1YG 2NCKL 5H9FJ 4RW6A 1PYTA 3T9NA 3KKFA 3KLHA 2VBYA 2IM3A 5B09A 1RAJA 2FVCA 3FSYA 3GZ7A 2UVWA 5IM0A 4ZVPB 3TUZC 1RBAA 2CA9A 3W3SA 2MYFA 3CDUA 2VDHA 3OR2A 1ROFA 4JOUA 3CD5A 4K7QA 4G1QA 3QJLA 5HMXA 1HPZA 4XAKA 1WEZA 1QSLA 4R0EA 1XIQA 1PAUB 1U1MA 4IDKB 3HF5A 3PHEA 5CCLA 3RBDA 1S72S 4WXOA 1P9QC 2F8HA 1SXLA 3AOBA 4N47A 1R27B 5A8WB 1DFDA 2LU1A 4OX7A 4TQRA 3O1LA 3HJFA 4GC7A 3R5AA 2HRYA 1VMBA 1S1TB 1IXKA 2AIRB 1AT1B 1X4GA 3D1OA 4ATNA 1QE1B 5EDWA 3CJTA 2QLBB 4CH0S 5EX3A 3UVJA 2ASYA 5ETTA 3SZ2A 5LJ3Y 2W7PA 1Q78A 4FYYB 4DQQA 4JYAF 1H2VZ 1SL2A 3Q8RB 2YKMB 3CD6S 4YR2A 4KGXB 2HNDB 2ZH6A 4DL4A 4PWDB 2FJVA 1FHTA 3IAM9 3K17A 2GC8A 4IFYA 3CCSS 2IY5B 1R3NA 4I6YA 3BSAA 4Y2MA 3FUYA 3GR1A 4DX7A 5D0RA 1AFIA 1RWNB 2LQ9A 3W64A 4FS2A 1HBNB 4KFBB 1YJUA 3DRPA 1VRTA 1E6VA 2K3IA 3IBWA 2R7TA 1WOPA 2FY1A 2D74B 1VRQC 2FC9A 1LW0B 3MM7A 5CD4H 1N5SA 2ADCA 1WF1A 3UN3A 2R2UA 3KUGA 3EX7B 4DR6F 3MXHP 2FZGB 1RHJB 1UZHA 1DTQB 1LW2A 3CCQS 2GHWA 2P2CB 1YWXA 1N5VA 3DGVA 4MYUA 4FS1A 1VLYA 4WBFA 2VBWA 2G2OA 3P3DA 4RJVA 3TYTA 2C28A 3BEGB 1YZ7A 4WP8A 1N56A 1Y0HA 3MPYA 5L9NA 5C42A 4A8YA 2QA4S 4IOAQ 1LK5A 5AT1B 1S12A 4USWA 2CJAA 3RBXA 3PW2A 2GW8A 2YYAA 1JLCA 3QAUA 1WC6A 4TYAA 2N82B 1AROP 2R8HA 3GJSB 1VGYA 2JVOA 3MMCB 3QT8A 2AYGA 2QMUB 1VRUA 2WCXA 2V69A 3CJ8A 5CCMA 4X66J 2AEMA 2F63A 4CO2A 2N7CA 3MEEA 5KFZA 5I3QA 3KLFB 2VKRA 2E1CA 4DSKA 4QR2A 1GK8A 1TL3A 1WKKA 3ZTPA 2ALYB 4TKTA 4FYVB 1K0TA 4DI6A 2C2EA 2XQCA 3DRXA 4X64J 2UUCF 2IRYA 1OY6A 1RTZA 2DGUA 3E8OA 3FRZA 3BQ1A 5L8RC 4CM2A 3PCOB 3RAMA 3GIMA 2Q6CA 1D8ZA 1S99A 2BQ3A 2UP1A 2DB1A 3JSMA 5DDOC 3TWZA 3M2UA 3TVYA 3PR4A 1S9EA 1WJ9A 4LF7J 2HGLA 5ETLA 5SUHA 1KLNA 1A9NB 1KS2A 3TUPA 4F67A 1HNXF 4IG0A 1E6YB 3VR1A 5D78A 4A8KA 2RE1A 1F9FA 4OQJA 3W9HA 1RHKB 3SMZA 1IKXB 1Q53A 3MCNA 2GQQA 3A8KA 4J5OA 3V6KA 2UUAJ 2HBQB 1NDPA 2PEBA 5CQGA 5ETQA 4K4ZA 1F5AA 1CULA 3NGUA 3SQGB 3T1YJ 2YKOA 2F4VF 3FEZA 4PKDB 2QSWA 3DRSA 4ZCKA 4H54A 2B5JA 2XYPB 4I2PA 4KKOA 4OYXA 3UW1A 3UWTA 4DPWA 5IQ6A 1RADB 3MTJA 2EFPA 5J2NB 4YHHF 1R6VA 3UDVA 5FDLB 4DV1F 3OXFA 1NPKA 2X3GA 3BPDA 5I3UA 1HNZF 1X4FA 2BABA 2FVRA 4DLEA 3NXZA 1RU2A 3VGVA 4KE5A 1SC6A 2BKPA 2GHPA 1BUXA 1DBDA 4Z2XA 2FIUA 1PJ5A 2YWFA 3DRYA 4G6VB 3AD7C 3HSZA 3OSPA 1L3SA 3K5PA 2R2SA 2OPQA 3IWXA 3G6YA 4YOEA 3KJNB 4JI1F 1EETA 3GFHA 2DRDA 1H6KX 3BGOP 2CDRB 2W8KA 4DU7A 3E2EA 1PILA 2GVZA 2G0CA 3HO1A 2YRWA 3PZPA 1YRUA 3BBFA 3VTIA 2IRUA 2YNFB 4DCJB 2UXDF 2C2DA 4RW9A 4ZP9A 4J9MA 3EGNA 3BYPA 4O4RA 5HBMA 1VQKS 2QC3A 2ZBCA 4ZITA 3KLVA 3GFZA 1FJGJ 5GMKa 1RGVA 2AJ2A 1M5HA 1MNEA 1PC5A 5LL6d 3GCWP 2C3MA 1BXNA 1S7IA 5F41A 1FEHA 1RXOB 1FESA 1VISA 5A76A 4K4WA 3HHLB 4F02A 1SIZA 3POTB 2DRBA 4Y2AA 1RTDA 3BDEA 4P75A 4WZMA 3T19A 2IIHA 3OR1A 4PXCA 2XLJA 4Q8FA 1Q7LB 3MTKA 4Y6IA 5RUBA 4JI8F 1TKDA 2OPSA 2FLNA 2DNKA 2KXHA 2IRXA 3OT9A 4KHPJ 1LOUA 1DTTB 1N0VC 2CQBA 4CI0B 1SC1B 1HHSA 4KY3A 3CUNA 1AYEA 5JXSA 2OMOA 3OL6A 2E5JA 1X5TA 1NK8A 2HHXA 3ETOA 5LXRA 4Y34A 4DZ6A 1H98A 4R0JA 4ZVOB 2QA4G 2DXEA 3CJ0A 4C98A 4DPTA 2CG8A 3DOKB 4ZVEA 2Z2MA 2WK4A 4ZIVA 2NZCA 1RHUB 2WHOA 1Q8BA 2VV5A 1QUPA 1A7GE 1FI4A 2HZCA 3QFHA 3AH6A 2PI4A 3HHDA 2C2MB 2MLYA 1RWXB 4K8RA 1VIOA 3C19A 2AP6A 3DRSB 4WYLA 4CH7A 3PIPQ 2HHHJ 2VF3A 1U49A 3NP5A 3D9BA 1RB0A 3BPSP 1VQYA 2E9TA 1XNQJ 1S9GB 2KI2A 4QW9A 1M5OC 1LFWA 3RZAA 2BQRA 2EK1A 2YWWA 4RNMA 3J7YI 4RWXA 1NDKA 3AQPA 4I2QB 3GONA 2WW8A 2MZTA 1SKWA 4EMDA 3NGRA 3KOAA 1RHQB 2DXDA 2G9OA 2PFDA 4PXDA 5E0OA 1T05B 1KD1T 3GIKA 2QJ3A 1G7CB 2DGSA 2UVVA 5J1PA 3C46A 1EP4A 3QT6A 5E3PA 1GTEA 4KIAA 2VJVA 2ASJA 1CC7A 5A6PA 1NDLA 4NLYA 2GO9A 1RSCA 2CPFA 4M5GA 5KG2A 2NXUA 3N6LA 1OWXA 2LKZA 2CIMA 2L08A 2QV6A 3NCQA 3UDEA 3UCGA 3HULA 5M2UA 4YP3A 1A0OB 1NB2A 5D4NA 3Q8QB 1N6QA 1UVIA 2JEIA 1SV5B 1TVRA 4V1Ak 4ZKAA 2ZH2A 1NKBA 2XLKA 1ZAXA 1D3WA 4GVBA 1ZPVA 3K59A 2ZH4A 1UEKA 1UVKA 4JUZA 2FLPA 2AJQA 5A2QU 2LXFA 5DQHA 4F4WA 3CT9A 2ZZNA 1VJWA 3ENQA 4HDGA 1NCLA 1I5OB 1U02A 4DSEA 2J0XA 2ZHOA 1ZETA 1F9EB 1KC8T 3DRRB 5DG9A 2I0XA 4LQ3A 1RK8A 5KFTA 2CJXB 2XO7A 3I55S 2HEKA 4KH1B 4B3TJ 1EZZB 3HFZB 5DJBA 3EICA 4CLUA 3ZZTA 3EPIA 2XS7A 2OAUA 4M5DA 1TUGB 2M0GB 5JVGQ 2HMIB 2MKCA 1PO6A 1RWMB 5BYRA 2KZZA 1HLWA 1FDNA 4RBVA 4DR2F 3TR5A 3CB4A 1VQPS 1UA0A 5HMWA 4B3MJ 3NNCA 4K0KJ 5DDRC 3MDFA 3S1TA 1N32F 2ZNYA 4Y3CA 1IKVA 1HQEB 3AHPA 3EGWB 5HVHA 1KTVA 5G0RB 2DHGA 1HWLA 4I64A 2FVPA 1EAYC 1VFJA 1SB6A 3M2RB 5E2QA 2BEFA 1JWWA 4ECQA 3M8QB 4N77A 2IAJB 1XJWB 1BD6A 2EK6A 2DKOB 4JBCA 4DR7J 2BW7A 1DLOB 1L3UA 1SKSA 4L6V3 3Q24A 1FWPA 2Y1LB 3DDIA 2IVYA 2L9WA 2J6UA 5BXIA 2FD2A 4MKYA 1PJ7A 2ZDPA 3CCTA 3HKWA 2M88A 3VV2B 3FSXA 2XMUA 1GFWB 2Y0SD 3IRWP 3TW0A 1FDAA 2EBEA 2QL9B 4LSLA 1J5OB 2CG4A 2OHDA 3RGIA 1EETB 3DXSX 3KJFB 1HL6A 1Q8IA 4FYWB 4DHVA 3CF5Q 4ZN1A 1IBMF 3NNAA 2GVZB 4KB7A 2WB4A 3M7VA 3LPEA 2V8GA 1JK9B 1RT6A 2HFZA 2RB7A 3KK1B 4DR3F 1HI0P 4M95A 4ZLJA 2JEJA 3F41A 3G82A 3ILIA 3RW7A 4PG7A 2ZZMA 1C1BB 1ZM9A 4X84A 4ES1A 5IWAJ 5KFNA 4OZ2A 5ETPA 5KFOA 4QWDA 3C15B 2JHEA 3BSCA 1B3TA 1YJTA 3KNAA 1U6ZA 4JP8A 2PC6A 1BWVA 4HTJA 4ZMMA 2ATLA 1SJ4P 1S97A 2IM1A 1MU2A 2UV8G 1HR0F 2YX7A 4C8ZA 2MJUA 2OTLS 5HLFA 1IJEB 1XN9A 1S9EB 1F60B 1H2TZ 2XSJB 2VIHA 2FJWA 4HHHA 4ZVUB 1WKJA 2XZTB 2VOPA 1W26A 3K5MA 3Q89A 4NA3A 4RL1A 3U02A 4NE9C 1WI6A 4TN2A 2F9JA 1WC3A 4ZA1A 3K8VA 3TJ8A 5AJ3F 3BZQA 1IKVB 1HQEA 2BE2A 3OTCA 2W7OA 3Q8YA 3GV5B 1TKTA 4X62F 1GMUA 3CJ3A 2CJYB 5B0GA 3BSOA 2HWHA 1JLCB 4PYAA 3CD0A 1N36J 2E7XA 5KFKA 4H4OB 4ETXA 3MUVP 3PO4A 2QRRA 1KNZA 3G6VA 1XMQJ 1Z4UA 2B9WA 3V81B 1HNIA 3L3CA 5C24B 2IDEA 4QQBA 1UL3A 2CWKA 3VGTA 4Y2KA 3OFGA 1NO8A 3WHIA 3MEEB 3V6HA 3MM7B 3MMBB 3KLEA 1AFJA 2DGVA 3THTA 5KT6A 3OL8A 2QYGA 1VOMA 4O4GA 4OYZA 1P1LA 3P45B 2CFXA 4ED5A 1ULRA 5ETRA 1FRKA 2GA7A 1U0HA 3WQPA 1TKZA 4FVMA 5BYQA 3H7HB 5L1IA 1SJ3P 2ZVSA 3VVTA 2R2RA 3RAXA 4OI0A 2YKPA 4M63A 1WHYA 2CQCA 5M2PA 1OY9A 1TTHB 5A0YA 1NJZA 2ZHBA 4B08A 1IBMJ 1KP6A 4TY8B 3PIOQ 1RTHA 1T7PA 4NRUA 2J9DA 4ECSA 2DJWA 1Z2LA 2J8AA 2OSRA 2Y1RI 2RS8A 2HHPA 2ZZTA 1M5SA 1ZZNA 1OSCA 2YKMA 1EB0A 4ANEA 3R6LB 2R2TA 1S1XA 1W25A 2I5JB 3BH6B 2GAHC 3DOKA 1V9OA 4UF4A 3U1NA 1N33J 1S6QA 3CMQA 3W2VA 3EXCX 4OJ3A 1NH7A 3D54A 2J76E 4DV2J 2LQBA 1KQSR 3HHLA 3J7AN 3K5NA 1U2FA 2DY1A 3DRPB 1MU2B 3R1HA 5ETSA 1Q4RA 3C66A 2BRLA 1YDLA 2R4FA 4BCAA 1BGXT 5CZXA 3CJKB 3F73A 4ECZA 2CZ4A 1VBYA 4ZVHA 1Y3KA 3UD3P 4NXNJ 4NLQA 3PFEA 1RTJA 2EC0A 1HHTP 2GV1A 4B3RF 4PPZA 3UNYA 3VALA 3EVMA 1NK0A 1T05A 2W25A 3QMQA 5IXUA 3IA0A 3TZZA 2IYIA 5C7PA 1WC4A 2PE8A 5A8KB 3J7Z5 2V6AA 1X9MA 5HJXA 2AQ4A 1F3FA 2C3UA 3A12A 5L9XA 1IWGA 2X1BA 3A3NB 2W24A 5ADZA 4ELUA 3I9V9 3WZ0A 1GMWA 4JI6J 1HKAA 1WHWA 2HSEB 4LFAF 1HW9A 1RACB 4LF4F 1D9FA 2CQ3A 2A3JA 2R42A 3QT7A 2ROPA 2ALZA 2CQDA 4YEAA 4YMEA 3FQLA 1RT3B 3AODA 3D28A 1S48A 2RU9A 3ISZA 3M8ZA 4WE1A 3K5LA 2XMTA 1MMLA 4U8YA 3P6YC 1X31C 5EN1A 2MQLA 3B82A 4PG5A 1AXQA 1X8DA 3Q8VA 2U2FA 1IKYB 4LRFA 1PIEA 4B3RJ 1XR7A 2MZQA 4M5JA 3MR5A 2OUGA 2LVWA 2BBEA 3T5JA 3ZNJ1 4UOFA 5LM7E 2EG2A 2MY8A 3KK2A 4WPAA 2K3KA 3BJYA 2CNOB 4RNFA 3N01A 2DNLA 3PO5A 1GT8A 2IBOA 1MROA 3GWCA 2KH9A 4QJVA 3BGUA 4USJC 3H2LA 3HPOA 2BQUA 1RT6B 3KK1A 1FKOA 2LEAA 3DMJA 2CPHA 4AFFA 2HQCA 1JXEA 3R5JB 4PWWA 1ZTTA 3DDKA 1RT4A 4HI2A 3TZYA 2A6MA 5ITHA 2C2KB 3IBCB 1JNZB 4JB8B 2HBRB 2FYXA 5KFUA 3MOJB 2EFNA 3MHYA 2MKIA 2ACMA 1QJHA 2WOMA 3CC2S 1TK0A 1S76D 2DNMA 3X3UA 5KFEA 4NXMJ 4NCAA 1HFEL 1MW7A 2I8EA 2VPZB 3M8YA 4XTTA 5D0EA 3D0HE 1V5IB 2V34A 4IG3A 2Z2ZA 1FRJA 2I38A 1R43A 4DF8A 3NGTA 2AHOB 3D1HA 3KNGA 4KKOB 4I56A 4WK3A 3VCDA 3W5ZA 4RUAA 3LGNA 4H4MB 4JV5F 3UNGC 4K50A 3PEJA 1V3ZA 1RUSA 1LNQA 4KRWA 4LF8J 4DDFA 4FF1A 2KG0A 4EBDA 1JLBA 3TARA 3H2UB 4BDPA 1VQOS 3GG1A 1M1HA 1XEZA 4MK8A 3W2WB 1RZMA 1B7YB 2BANA 5A8KA 1N34J 1YJVA 1W2BR 1JKHA 1S5ZA 1CS4B 4PYDA 4F4XA 3E3XA 2UXBF 2HPUA 2WW4A 1R8BA 3KLIA 2YWKA 3OVAA 3PV8A 2KU7A 2LXUA 1X4CA 3ET6B 2NXEA 4NLDA 4C3LA 4C2MA 3QQCD 3W8PA 3KYLA 2AX1A 1NMEB 5A6WA 3L95X 1UWBA 1Q5YA 5J2MA 1TL3B 2DXFA 2WVBA 3QGPA 1CBKA 1TFWA 1RTIA 3AD9C 3T9ZA 3CCMS 2ZH3A 2CQGA 1QAYA 3J81j 4KPYA 4J9KA 1XR6A 1SBRA 2JWNA 1N4LA 4QIVA 3T3FA 1FWLA 2U1AA 3HI9A 2OKQA 4F0HA 2V2KA 5E41A 2IA0A 3MPVA 4E98A 2D3UA 1JX4A 2RRAA 4DV0F 2JC0A 4NZ6A 4K4VA 1HBMB 3G8TA 1F0XA 3M05A 1JLFB 5HQMA 5A8RA 1N5QA 1S6OA 2XZWA 5F8LA 4ITSA 2DNYA 2R7QA 3J81Y 4K4UA 3P5TL 1FNOA 3W8GA 3QSIA 2KXNB 1U1QA 5ETVA 3W60A 1Q86T 3ENWA 3IR7B 2DIVA 5LSLA 1FXRA 3W9IA 3Q22A 4DR1F 2IM0A 4BS2A 5E7OB 3OFFA 1C2PA 4F8RA 3I31A 3MM6B 2AYBA 2KN4A 3GFXA 5M2RA 4WJBA 2IM2A 4WWSA 2YRXA 1JJCB 2EEYA 3AOAA 2R3VA 4M5HA 3VAKA 3M2VB 2H5EA 2RAQA 2ZBPA 4FNIA 4MKBA 4O0IA 2FUG9 3FGVA 5DG8A 2RQCA 2KYXA 4HACB 4IRCA 2RQKA 3KK3A 4H4KC 4F4KA 4DR7F 4B9MA 1U24A 3DHXA 4TU8A 3RTVA 2DGOA 4Q2MA 1FEEA 1T03B 2B3TB 1REVB 1WEXA 2DGTA 1TL4A 2VG6B 5FLXY 3CDAA 3H5XA 2Z2LA 2FGCA 3RB6A 1WG1A 2I1RA 3ISNC 1RAOA 4Z7CA 5AE2A 2Y8YA 2IJFA 3V2UC 2Y3YA 4C4WA 5FD1A 1JKHB 3SIPB 1SC4B 1NM2A 1OPZA 4OI1A 3MURP 1EJ7L 2X3DA 4LF5F 3LP2A 1YBUA 2R9LA 6AT1B 3R5GA 3SV3A 2JSXA 2M5YA 4UOGA 5F8JA 2QA2A 4ED8A 3I87A 1WSVA 2PDAA 1HBOB 3TX0A 1OSDA 3W62A 3RW6A 1GEHA 4CT8A 4DF4A 2L41A 2AT1B 1BY9A 1RT3A 3C14A 4KPCA 3OUYB 1NK4A 3UPFA 1RWPB 3K5OA 3ENAA 1PSDA 2FTRA 3IS9B 3QO9A 1RAHB 5KFYA 5IT0A 2C22A 1S0VA 1KLMA 1R8CA 2JFDA 2PGCA 1N36F 2W2PP 4NCBA 2QEXS 5B0AA 3NS6A 2OEJA 3D6HB 3EDQB 1T8EA 3IM9A 1RCOB 1NK6A 3OFEA 1VQ6S 1LKZA 3K2YA 3OR1B 1Q5VA 4F4ZA 4F26A 1TV6A 3HD1A 4ZS6A 4CT9A 3DU6A 5J2QB 1XNQF 2D3O1 2MEWA 4KGMA 4X2BA 2XD4A 2V4RA 2NPIA 2BJEA 1RBOB 5E5NA 1X9WA 1HHQA 4X65F 4X4VA 2VJUA 2KM8B 5KG5A 1Y9OA 2HWIA 4QWEA 1H0HB 1VS3A 1ZA2B 2DNPA 2IVFB 1G6BA 4DXLA 3EGZA 2V4JA 1PAEX 2Z58B 4C8YA 4EGLA 3M6XA 5HN0A 2PFFB 3I9ZA 1VQLS 2CXEA 3D66A 2BJ3A 4TYBA 4ED7A 4DS4A 1PBUA 4BC7A 3MR3A 2Z0GA 3FFIB 5HMZA 4Q8EA 1VI7A 2UUTA 1GTHA 2V50A 4LBPA 1NJWA 2J0SD 2EBGA 2HFSA 3B4MA 3EJMA 3MECB 4M5IA 5ETMA 4EFAC 3D3BJ 3QJPA 5KFGA 3GSIA 4I1TA 4RR5A 5DM6Q 3L7PA 2DR8A 3E01A 3KG0A 5L38A 2OI2A 3IGVA 3S8SA 2MXYA 1YITS 1VQ4S 3DLHA 1O5JA 2MSSA 5JUMA 5C2CA 2DR7A 5IT9Y 1JLAA 2J7WA 1DQAA 3ETMA 4NYOA 5AE3A 1U25A 5B0FA 3CDWA 4DV6J 1CJKA 5KFIA 3QAEA 5D0HA 1DURA 1VRUB 2XC9A 2C2RA 1U2RA 2WVFA 4LUBA 5AE1A 4QU6A 2BA9A 2BMBA 2VPXB 3IWLA 3M1VA 3QZ7A 2BYCA 3MUTP 1RI7A 4U9RA 4F2RA 1MG7A 2ZE2B 5DS7A 3K57A 2KKHA 3CIMA 4EBEA 3CCES 1TL7B 3KG1A 1DQ8A 4O0NA 2ACYA 4C8KA 1RJJA 2G1HA 4DUYF 3G8SA 1FCAA 1BQMB 4Q5VA 4CTAB 2QIFA 2ZBRA 5HL7Q 4NZ7A 3RRHA 3MEGB 4DV4F 1HWJA 5GVQA 5DDPC 4QWAA 1FJGF 1HARA 1TKZB 4K0KF 3QWUA 4ZOSA 4C3KA 1GMVA 3OTBA 1QSYA 1HNVA 3LF0A 4AUKA 3H5SA 3QSYB 3G71S 2KTQA 2ILZA 4NXNF 2B8PA 4C97A 2HVDA 2YPYA 1JNRB 4A8FA 3MMAA 3K0JA 3Q0AA 5GADI 4DLGA 4OX8A 4KHPF 4Z7YA 2HLTA 1R31A 1SH0A 1T3OA 2H48B 3H90A 3NOCA 2BXJA 2CPXA 2L9NA 2AJ4A 2NSBA 3FVYA 3NCPA 4U96A 5DG7A 3PX6A 4B3OB 4O3OA 1RAFB 2FY8A 4K2XA 5D4PA 4X4RA 2YW2A 5LMUJ 3A8JA 1S1WB 2H5JB 4MIBA 3ZTRA 1CG2A 4I7FA 2ATCB 4DU8A 4LSZB 1S7HA 1YBTA 3EZ5A 2VFRA 3UN5A 4KFBA 2C3PA 5KFRA 2FB0A 4RW7B 4OYBA 4FVCA 1B4SA 1ZS6A 2J9CA 1ZYQA 4LF4J 4R5PB 2G2ZA 1LW0A 5IFMA 2Z4PA 3RJMB 5C2GA 2H4WB 3MR6A 2DHSA 4NLWA 3MD1A 2NUHA 1JLEB 3OL7A 3DOLA 3HK2A 1DRZA 2JJ4D 4DR3J 2KT3A 3KUEA 1JLAB 2BM1A 4MT1A 2GJIA 2MQQA 4DQRA 1HI8A 4WXWA 3QNWB 4OI3A 4Y65A 1QDUB 4OZJA 4F2SA 2RDJA 1CJKB 5KFAA 2MQPA 3LH2S 1UKUA 1HBMA 3R5DA 2EPIA 2FDNA 4LVNP 3PHTA 1OO0B 5DQIA 2AMCB 5MAOA 3NMAA 3QWPA 3GPAA 5GAHU 2DR9A 2ZVIA 1DHMA 2FHOB 5KG3A 3CMES 2JL9A 4WFBQ 2PMZD 3P49B 2AGQA 1H7XA 2BJ9A 4UT4A 5KFJA 1NH8A 1I94F 2Q3PA 4R25A 3EVOA 4FF4A 1UWBB 4URSA 1T0TV 1HWUA 3CD7A 2EKYA 4MIWA 2VODA 1SKUB 5HROA 3I0RA 4ELVA 3SDEB 4F25A 3IP0A 1RA7A 2BJ8A 3POTA 4ILRA 4LT6A 3SSQA 2X51A 4AYBD 4NZ0A 1XK8A 1KHVA 2F3JA 4YB7A 2ROEA 1T94A 1Y5IB 4ZJQA 2MKHA 4LFBF 2HNZB 4NWBA 4UZBA 2Y1IA 2BZ2A 2W01A 3DLJA 1NU4A 3D0IE 2WBRA 2KT5A 3R5CA 4OHXA 4F50A 4WKRA 3PJ9A 3O8WA 4BLGA 4CZCA 4XO0A 2ZM6F 1PG5B 1U7LA 3N6MA 1RT1A 2Q43A 1FKOB 1OY8A 3HSGA 3MAAA 3V5RA 2E44A 4PXEA 4J9NA 2I2YA 2WVEA 3NRBA 4WCEQ 4NEZA 3H2VE 3CCLS 3UO0A 3F56A 2VICA 3VAGA 1NK5A 1RYRA 5DETA 1GX5A 4OL8A 1K44A 2G13A 2HFVA 3MEKA 1FKPA 3R3TA 4UUXA 2Q79A 5G4DA 4CLPA 1XC9A 2UXCF 3C8YA 4BWJA 2XMJA 3ADAC 3AJ1A 3B8HA 5BYSA 3AD8C 3NY0A 2GQ2A 5LXYA 4N5SA 2VQFF 1N8RT 2PEHA 4ZHRA 3EWGA 1KVJA 3LANA 3BF4A 5KFVA 3KK3B 1S49A 3QYYA 1XQIA 3NG8A 4I6AA 2H5IB 4NYZA 2IC3A 3ZZRA 1REVA 2HAFA 2WSFC 1PYOB 1VJQA 2KB2A 2FJBB 2AEJA 2XULA 3GCXP 2Q66A 3T5HA 3C6TB 5CZVA 4FPIA 4I68A 1VBXA 1TMJA 2GJ2A 2Y0BB 3UR0A 2HNYB 4N8NA 4DSFA 4TNOA 2E5HA 4GO5X 1QAJA 4O3SA 4KJIA 2OP5A 2H51B 2PI5A 2H65B 3D67A 1QTMA 3EYZA 4LFCF 3DLEB 2XHWA 2CQ0A 2JDJA 2B51A 3MMCA 4O44B 4WFYA 1KKHA 3C16A 4J90A 2BOAA 3ZZYA 4CLKA 4WFAQ 4ECTA 1UWAA 3DI6A 4U8VA 2LECA 1XERA 2M70A 3LGHA 4P74A 4TY8A 3FMWA 4UZCA 1N5YB 2PMHA 2E5GA 4IG0B 2IBKA 1Y4ZB 4IO9Q 2RF2B 2BVZA 2RRNA 1H72C 2HRUA 2HRTA 3D4JA 3MCSA 3ONQA 4NOHA 4RX6A 2W9CB 5FJ4A 1NHUA 5HROB 1MWYA 4EWTA 2FGOA 3R97A 4G65A 4RZRA 1U1OA 1S1XB 2ABYA 4RW8B 1YHQS 3RR7A 1R7IA 3BKTA 3SQGA 4YDXA 3OSNA 3MCOA 4IOCQ 3I82A 4DL7A 4JI3J 3MAHA 2B4PA 2W1BA 2M8HA 2P9EA 1AUSL 4AL5A 1UPPA 1K1QA 2HK3A 2RIJA 2E1MC 5F3TA 5K8PA 2HW3A 1HQ2A 3O5TB 1FE0A 1Y5NB 2DGQA 2AD9A 2MKKA 3OXLA 2Q6BA 1QE1A 3BGRA 4WP3A 2VG6A 1EKSA 1YG0A 1S6UA 4GO7X 4Y2IA 3BO3A 2ERRA 4ILMA 4NMLA 4ZIWA 3FEXB 4ID5B 3AXKA 1EHWA 1NK9A 4UW2A 5E3CA 1NLKL 1C1CB 2JVRA 1PYSB 1Q7YT 1D0EA 4DR4F 2AU0A 1S4EA 2M52A 4ED3A 5K9FA 3R2DJ 2DNRA 1CS4A 2XYHB 4ZVSB 3W63A 1L3VA 2GCFA 2ZD1B 4DCPB 3LWLA 1R0AB 3SSSA 1E6VB 1VBKA 3JQJA 4L76A 3IXQA 1XMQF 5DDQC 2WB1D 5K8NA 4OMFG 3TUIC 1N54B 3ICLA 3D2WA 1GSOA 3J7YU 1TUVA 4LF2A 2E5LJ 3RR8A 2PN6A 1A6LA 4URGA 4X65J 1S59A 1SUQB 1WSRA 4OJ1A 5LMNF 4JI7F 4G1QB 2DNOA 1UZDA 2CRLA 3CIZA 3TEGA 4DG1A 3AQOA 1KQFB 1X0FA 3VAHA 2CKWA 2YQ1A 4KQZA 4YR3A 4QWCA 4FYXB 4LFCJ 3G4SS 2CVIA 2R7UA 2OLWA 1I51B 1X4AA 2OPQB 3AOCA 4QZVB 3GFYA 1RT5A 4FZVA 1FRHA 1REGX 2DH7A 4NXMF 1UFLA 4PWUA 4FN5A 2JRSA 4ZCMA 4PG6A 4BHQA 1VQNS 3FQKA 1TAQA 2PT0A 3CTRA 4C8OA 4ES3A 3FJ2A 4NEYA 1KRPA 6FDRA 1JLQB 1ZBTA 3LP8A 2CPDA 3T41A 3LUYA 4J91A 3HLUA 3W61A 2P8IA 1S0MA 3QZ8A 1NJIT 5DRKA 3OUYA 3EDRB 1BQMA 4UY8T 3C15A 2ZC4A 4I4BA 1QSSA 1N33F 1FVQA 3CCWA 3MFIA 2OTJS 4QYZJ 1F9HA 1L3TA 1WF0A 4YB5A 2WOMB 4K4TA 3TA2A 2RD5C 1RTDB 5T41A 1BQNA 2J9DE 2BE9B 4ANDA 2JC1A 1YGYA 2HS0A 2B5JB 4I2PB 2IHR1 4ZN3A 4ECVA 5J2PB 3U1MA 1T9UA 2RDDA 2P9CA 3LW5C 1VR6A 1D1UA 1NDCA 1H38A 1TP7A 2R8IA 3BKUA 2F1FA 4UOCA 2IJNA 4EUVA 2VBZA 3MAAB 4MIAA 4FKXA 1YQHA 1E6YA 4HT5A 5HSPA 3PR5B 3EXYA 1TKXA 4NRTA 4EYHB 4NMXA 1SL1A 4JV1A 2I9SA 4GKJF 1NUEA 3QGHA 3ZTOA 2KM8C 4HL9A 3PW5A 2YX4A 2GFFA 2R8GA 2ZUGA 2GIQA 3FZ2A 3GYGA 4CDIA 4U95A 4HEA9 2KFNA 2IAJA 1C0UB 2XCLA 1YLXA 4TVAB 2MHNA 5KAKA 1HBOA 3JYTB 1U2CA 1OQ6A 2VASA 1FTCA 3CJQA 1P6TA 4NLPA 5CYMA 2B43A 3DOLB 4OX9J 2RUSA 2ZWPA 4CM0A 2OPPA 2VZ9A 1S79A 1NZAA 4DG1B 4DV3F 3QRPA 3I5AA 3QO9B 5IV4A 2ZBIA 2P9GA 3B4DA 2WSEC 1JJ4A 3AB2B 1UJ4A 3F44A 2LP4A 4USMA 4N41A 2ZH8A 2VFVA 1S9FA 4DFJA 3RRGA 1LWCB 3FNNA 3OVBA 1RT5B 4WIQA 1U47A 4ZPWR 2P5VA 1IR1A 5KG4A 3IR6B 4TQSA 5KG7A 5CAAA 2DGWA 2W4DA 4E8UA 4NASA 4OJHA 4O3RA 2VOOA 2MLXA 2Z8QA 3VWSA 1FRXA 3ENVA 3VAIA 2MGZB 4GVBB 1F2HA 4GC6A 2V63A 1WUUA 1S6QB 1SH3A 1VQSA 5KFMA 5I42B 4MFBB 4NA1A 2FLLA 3GILA 5F8MA 5KFXA 4X4SA 3BB5A 2QLXA 2X1GA 3FEYB 3VZIA 5KT3A 2AJ0A 4CP5A 2L48A 2QA1A 3AJDA 4RW7A 4H4KA 2YQ3A 4IYQA 4USKA 3MAQA 4EZ6A 3R7SB 2W2QP 3K7RA 1HIYA 3TNVA 4CO4A 1SQEA 1U26A 2F40A 2MZ1A 1CVJA 1I94J 3IAS9 3CNQP 3SCKE 3F0NA 5C5JA 2G1DA 2GX8A 4Q0BB 3G6ES 4CCHA 1LWEA 4I0WA 3FSIA 2E66A 4ZP7A 2W4CA 1DTQA 1LW2B 1Q8KA 1S6PB 2BJ7A 5KOXA 4CLWA 5LOQA 4YB1P 1U45A 4GKJJ 4MKVA 2HIQA 3CDEA 2VHGA 5F9LA 1YJNS 3THPA 1S1WA 4U6PA 1F3VA 3PRBA 4OIXA 5E3RA 2EVZA 2O1PA 3DLEA 2DHXA 3CXCR 1F1BB 2XSFA 3KG4A 3NGDA 1TELA 1U0SA 4DV5F 3JQKA 2CZ9A 2GZOA 4WFXA 4LF9J 2DK2A 4Y0FA 3BO2A 3SBMA 5KFHA 4JI8J 2V67A 5B08A 3L4BC 4ZDNA 4L3KA 4O3NA 3MM9B 2FJEB 2OGUA 1X4DA 2QE5A 2YNFA 1ICEB 2KFZA 2HQ3A 2GMHA 2RMLA 2GIFA
chains in the Genus database with same CATH topology
5CHCB 3M9OB 3C6TA 5F3ZA 4DFMA 4HTIA 2UV8A 4HVZA 3IC1A 1LWCA 4QIFA 2X1AA 1WTBA 4XPCA 2XCPA 3UCUP 1TK8A 2OPRB 4RU9A 3N9UC 5I4MA 4MK7A 1N5YA 1SJQA 1OPIA 2M7SA 4KO0A 2MGZA 2HQIA 3VAJA 2B9XA 2Y1JA 2W9CA 4DQIA 3DYAB 2R7OA 5DLGA 3OFHA 1W2IA 1O0PA 2MMYA 1MMNA 2DNHA 4RW8A 4CNZA 2MZJA 5KT7A 4ECUA 4H4OA 1O51A 2AX0A 2QLWA 1U1PA 5D3GA 5KFDA 4WIIA 1HYSA 4DSIA 2A1BA 2LMIA 1JJ2R 1U6BA 5HLFB 3UQSA 1FVSA 2M3DA 2LYVA 2DR5A 1FNMA 1C0TA 1DLOA 3I4PA 2UVRA 3KJVA 2RU3A 3W2WA 2ZH7A 2YY3A 3MMJA 2VPYB 4WU3A 3Q2TC 2XNQA 1GAOA 2HNYA 2W9AA 4ICLB 4JI3F 1S10A 4LSLB 4DSJA 3BDPA 1S1VB 5KFLA 4DN0A 3I5CA 4LJMA 4KAIA 4RLEA 1U1LA 4JI4F 4FXDA 3DM2A 5KT2A 1JB0C 1FDDA 3QLHA 4MMOA 2WTFA 3CULA 4KR0B 4WZMA 1PC4A 1J5EF 3PXGa 3GB0A 4I67A 1FO1A 2M8DB 4OI2A 2KDOA 1RT2A 5HI7A 3SCIE 3NAHA 3SFGA 1K73T 3UDCA 4TXSA 3IR5B 5GAHI 1K9MT 2M2BA 3DLGA 3ITHB 5IS2A 2K7JA 4MK9A 2H9ZA 2N3LA 1WF2A 3TUJC 4M94A 5A0YB 1SH2A 1U4BA 1RA6A 2E1AA 4J9RA 2DBBA 3N5BA 3UD4P 3MI7X 1JLQA 4Q7AA 3CMAS 3J7A1 1JJHA 1VIXA 3FDSA 1TK5A 2DIUA 2DO0A 2SXLA 3WC2A 2ZH5A 1WACA 1O8BA 4L72B 1YIJS 1VRTB 2LDYA 3GYXB 2UVUA 2KFYA 5G0RA 4ECWA 1KHWA 1XBWA 3U7JA 3TAQA 2CDQA 4RNNA 1TZ0A 4ZVFA 4RBUA 2HLUA 4EYIB 1ZTWA 2XY6A 3PACA 1T03A 3T1HF 1VQ7S 2WSCC 3KHGA 3KLEB 3WDOA 1DJ0A 2ZOMA 4B3OA 2B7BB 1SUQA 2EW9A 4PRFA 3RB3A 4QU7A 2HHQA 2ZDOA 4G1PA 2MPUA 3HVRA 3MUMP 5C42B 5IT4A 4QPXA 5T7LA 4OV1A 4D3HA 3KWMA 4OHZA 1NHVA 1ZM3A 3V6DB 2V94A 3MD3A 4KTQA 1R8AA 4Y2CA 1UP1A 4LIWA 4B9TA 2DHAA 1H7WA 5LT5A 4NA2A 4X4PA 4YUDA 5GAEU 2OD6A 2RKIB 2XMKA 3MMBA 3OR2B 4M8LA 3MR2A 4KGKA 4DEZA 4IFVA 1RTIB 2OO4A 5IWAF 2I5JA 3TQ1A 2O01C 4NLVA 4OX6A 3M32B 3O3LA 5A8WA 3MM5A 3MPWA 1OIAA 4C8MA 4C8NA 1S0OA 2MZRA 1T95A 4PQUB 4C8LA 3I56S 2EWHA 3OHBA 5CH7B 4F3MA 4ZPVR 4A46A 1V3RA 5CYQB 4F3QA 2MB0B 3AY0A 1Z2ZA 2DT9A 2YKNB 3CGIA 3DLKA 3SXLA 1X9SA 2HNDA 2DPJA 2QZ8A 5IQQA 5AXMA 2AGPA 2YWEA 1IR0A 4ZPCA 2LEPA 1IQTA 2CJKA 4TLQA 2CZVC 2B4VA 4PQAA 1RISA 2L3MA 1BC6A 2FHMA 5D6GA 3KTQA 2MZSA 4A8WA 2BJDA 1HNIB 1UEUA 3PX4A 2V8VA 3MECA 4OX9F 1S0NA 3DCAA 5FDLA 5J2PA 2CJ9A 2C3YA 4H4MA 5CYMB 4LF9F 1SJRA 2WRMA 2LA6A 2MHEA 4MAKA 4B17A 1K8AT 3R27A 4YQWA 4C0BA 1SJ1A 4FXWA 1K1SA 3HP6A 2C42A 2XCAA 2YX1A 3H4DA 3HMJG 2D3OR 2RVJA 5L1KA 2RJZA 4FNHA 4RWWA 2R8JA 3H5UA 2HGMA 3PJWA 4NCGA 1WHVA 1ZPWX 1GXUA 2GGPB 2V9WA 4OZ0A 1YJWS 4I69A 4RW6B 3KLHB 1Z1ZA 2ZOFA 4EO8A 2YH1A 4RW9B 1R6YA 2IMOA 4MKAA 2FC8A 4NLSA 3OVSA 3QPIA 1RT2B 4ED1A 1FXLA 4IH7A 4LIRA 4C9DA 4DUZF 1UVNA 3N5FA 4BBYA 1HD0A 4NYPA 3G86A 4ZCLA 2AJFE 4DL3A 2DPIA 3FZBA 2VG5B 4CH1A 1IKYA 3N4WA 4U7UK 4DOZA 2K1RA 3GV8B 1X4HA 2CYYA 1M5VC 4FF2A 2GIRA 1LWFB 4WK1A 5SZTA 2R7WA 1Q16B 2JEGA 4X66F 1RT7B 1C0TB 2DGXA 1NKCA 5E3QA 4ECRA 1H3DA 1TAUA 3MM8A 4DWIA 3T5KA 2AGOA 1IJFB 4N56A 2CPEA 1VQ8S 1KNZA 1I6JA 3QIDA 5K5MA 4IQXA 3DFEA 3RB0A 5EWEA 1L5UA 1NNDA 2GHVC 3OTEA 2F8MA 4IQMA 2CPJA 3H40A 4FBTA 1I1GA 2ZJPQ 4IR9A 3MWBA 3PDNA 3T6JA 3ZZZA 3ZFVA 3RRKA 1RYSA 3Q8PB 3MM9A 3MEDB 4K4XA 4ZPDA 5IZHA 1KR4A 1QAXA 2LA4A 3HXMA 3JTOA 4QR0A 1YJ9S 4IR1A 2RRBA 4B3OB 2ZHAA 4MH8A 1GNKA 4OHWA 1LWEB 3SCLE 3N28A 3ZZOA 5T7LB 3OL9A 2LXIA 2BW2A 5KFQA 1F5CA 1ZAVA 2RH3A 3V6DA 1CQMA 1KONA 1ZOTA 3THVA 4LVOP 5KFFA 2E7WA 2OPRA 1FK9B 1N52B 4DV7F 1S1TA 1XMOF 2W9BA 4URQU 3BS9A 4OJGA 4P7VA 4J9OA 1U8SA 2M9KA 2YWHA 2YNIB 2FVSA 1FRLA 2MKJA 2F8EX 1RP5A 4G3IA 3I5BA 2ZKTA 5FIIA 4RUCA 1HA1A 2HS4A 2KVIA 3DC2A 3MOZA 3IGNA 2BACA 4Q44A 3MEGA 1TR0A 1HBNA 4IDKA 2N7YA 1HNVB 4YDDB 4OI4A 2IA6A 3NCRA 2LQJA 1ZM4A 4C11B 4PUOA 5B0DA 3DLBA 1RT7A 4QR1A 3H25A 1QM9A 3M30B 4C0OC 4DSLA 1DTTA 4RUHA 3LWMA 4QYRA 5J2QA 4RNHA 4PR6A 1VC5A 1FA0A 2XS2A 3UFCX 4USHA 2DH8A 4HDHA 1Q82T 3I32A 4ZP6A 5KFWA 1FKPB 4C7QA 2BANB 2J5AA 4BWMA 3T6BA 3O6QA 1RQ0A 1IQZA 3PRDA 4X4UA 3FMBA 1IUJA 2A2CA 4ZHRB 4OFZA 2YNHB 2O3DA 2VC1A 1JXLA 2J6TA 3HHLD 2HVZA 1C4AA 1R8HA 3RU0A 1FJCA 4LF6F 4QCLA 4HT7A 3VAFA 5DGAA 1YVFA 3KMSA 4LSNB 2PO4A 2GNKA 1HPZB 5DGBA 5KT5A 1TL1A 3FRYA 2GMLA 5GAEI 3J80Y 1HI1A 3US5A 1YJRA 5MLCV 1S1VA 2LU2A 3JSMB 4KT0C 3M8PB 2P6SA 4UUWA 1Y00A 3SSRA 3OTOF 3QGGA 2VQEF 2XNRA 4UY85 2B4UA 3DM2B 1QUVA 1XWLA 2WONB 1G1XA 5E33A 2RDIA 3HX9A 3I0SA 3W7BA 2UUBF 2E9RX 3CDBA 2HS3A 4ALZA 1Q81T 3M8RA 1IKXA 3DDNA 1X5SA 2FPHX 3J7ZT 1B64A 1RKIA 2O67A 3WBZA 3IS9A 3CVKA 4DJBA 4DMZA 2JLEA 2VA2A 1FJEB 2VA3A 1PGZA 3MM5B 4FF3A 2DCLA 4R5PA 5D4LA 4ED6A 2HHVA 3GSDA 1ZM2A 2FHJA 3M6UA 2RT3A 5EUHA 3BSNA 4D3GA 2JLFA 1HQUA 3IWNC 4M5DB 2BDPA 4JI6F 1JLEA 5J2NA 2HMIA 3T5LA 2AWZA 2YKNA 1UEVA 3LOUA 2YKAA 4XK8C 3KJVB 3CCJS 1Q79A 1BWEA 1LXJA 1P1TA 1V3SA 4A8XA 3MFHA 2KT2A 3TX8A 3BN7A 1KTQA 4NLTA 2B56A 1FE4A 4DFKA 2CPYA 1OQ3A 3CE8A 3IG1B 4KHMA 2VFSA 1UA1A 5CXTA 2VONA 1IKWB 1N48A 2KO1A 2DO4A 3P96A 3BQ2A 1VQMS 2DRAA 3VQSA 1TVRB 2KHDA 3G6XA 2PA3A 1X5PA 1G2EA 2MKSA 4RBTA 2ZKUA 3NWGA 4MYTA 5J1NA 2DTJA 3C6UB 2VKZG 7FD1A 4K4YA 4M1KA 5HP1B 1HNWF 4NLXA 3PM9A 1VHFA 2XS5A 5B0BA 5L1JA 4W92B 3AA9A 1ZZFA 4Y28C 3Q8SB 2R7XA 2VFUA 3HHEA 3EUNA 5EWGA 5J1EA 1XTZA 1S1UB 5HO4A 4V19X 2QMWA 1MSWD 1GXLA 1JLFA 1G3OA 2R7SA 7FDRA 5D77A 2ZE2A 1SV5A 3LO3A 2XBPA 3DGPA 1B7FA 2RKIA 3IN5A 3PW0A 3NL0A 1BQXA 3B78A 5GAGU 3MM6A 3V4MA 4OZ1A 2X1FA 1ELOA 2O66A 1VC0A 5D8HB 3G96A 2ZITA 3HVWA 4A48A 4HHJA 1RKJA 1U09A 2AV5A 3LAKA 4KV8B 3LPYA 3LP0B 4DL0C 3OLAA 2W8LA 3TAMB 2AF6A 2OSQA 4ID5A 3PEHA 3MZIA 3N6NA 4XDDA 4JV0A 2BE2B 3GMGA 1TKTB 5DO2A 4DV6F 1S4FA 2V8HA 5JJBA 4IH6A 4O44A 1HMVA 5KT4A 1FNXH 4WZQA 2WBMA 4RKUC 3N79A 4UQGA 2UZAA 3JYTA 3TOQA 4K5RA 5HP1A 4ZP8A 2N4CA 3ZZUA 4A8MP 2ROGA 4DQSA 1Y5LB 4IRKA 1UJ6A 2FJXA 1N5TA 3OTDA 4OI6A 4PG8A 1T3NA 2AW0A 1URNA 2VC0A 1TL1B 1QVGR 3GYNA 1HWIA 5HQ8A 2HVIA 1KLMB 3X1LB 1WI8A 4L3NA 2EG1A 3BR9A 2IMWP 3ULHA 2J9EA 2R7RA 1LQ9A 2HNZA 1YRTA 1MROB 2ZJQQ 5H9EJ 2KJWA 4CO3A 2XSJA 2JEFA 1RWUA 3HHKA 1J2VA 3I0SB 5KFCA 4DR5F 1NKEA 4OZ5A 5KOWA 1SKRA 1M5PC 3TVKA 2YKQA 2ZJRQ 1KSPA 3GIIA 1R89A 3ISND 4EEYA 2CJQA 2N3OA 2RQMA 5GADU 1KVIA 4JI0F 5EWFA 2XEXA 4ELTA 4E0DA 2BR0A 2V4JB 1TFYA 2KRBA 3DXBA 4K59A 4DBQA 4B9VA 1BQNB 1X4BA 3SV4A 4HH1A 4IKAA 4KV8A 3CJKA 4AQYF 3LP0A 4CO0A 4P6QA 1CPZA 3M30A 1Q8LA 5CA5A 3RAQA 2VUGA 1RTJB 1FDBA 2A10A 2OFHX 3H5YA 3HHNB 3NBPB 3JSYA 4P2SA 1X0PA 2HFOA 1WHXA 4MTPA 3CJ4A 4Z37A 1KQKA 3R5BA 2V5HG 2VBXA 4OLOA 1FF2A 3HVTA 3M4XA 1EP4B 5EHHA 3UDLA 1FK9A 2R8KA 2YNHA 1KFDA 4RW4A 2B6AA 2D3ZA 3H20A 4YR0A 3BM7A 3VQTA 1N0UA 3CEDA 1N6QB 4PXBA 3M8QA 2VB6A 2AYEA 1YSJA 1IBKF 5F9NA 2NSCA 1X5OA 4CNYA 4QW8A 1S77D 2M4MA 4K5SA 4O23A 4X64F 4XPEA 1UVLA 4NPOA 4EBCA 4J9LA 3HZEA 1TL5A 4GMKA 2YH0A 3UE2A 3BO4A 5DM7Q 2FLOA 3M32A 1B0PA 3NNHA 4ED0A 3HM9A 4HKQA 5A8RB 4PUOB 2HHUA 4R8UB 4LF7F 3UI3A 4TU7A 2PSZA 3H59A 3LALA 4QBUA 1RTHB 2OD4A 2XB2D 3MMAB 1NK7A 1IN0A 2POKA 5BJRA 1NJYA 2ZNZA 2UU9F 2RF2A 1UVMA 4PWDA 5F8NA 1GXTA 3PW7A 1Y3JA 5H1SV 3TI0A 3EPGA 1DQ9A 3SCJE 3WX4A 3KHHA 2NLWA 1APSA 2OFGX 1NEEA 3V6JA 4I7FB 1KOHA 1LFPA 1AUDA 2BM0A 1YRXA 4B3SF 4ETZA 1IKWA 2KYZA 2ZD1A 1R0AA 4N76A 4WFNQ 2MY7A 3HT3A 2NYIA 1RDRA 1SI9A 2OMLA 2PD1A 4PPDA 2AYMA 2JZ5A 1H2UX 1HQUB 3MEDA 2KG1A 4RNOA 1F5BA 4Q0BA 3M9NB 4O4GB 3KLGA 2BUNA 1JLBB 1CSJA 2KHCA 1C4CA 3IRXA 4ZCIA 5KFPA 2ZFHA 3PVXA 2QO3A 5KG6A 2EFOA 2EFQA 5KG1A 3VF0B 1N34F 1J5OA 4X4TA 2PIIA 1XNRF 5A2QY 2XMMA 3JB9k 3IG1A 4C3MA 3HZGA 1U1RA 3G8QA 1DZ5A 2GGPA 1FRIA 4IO1A 4YFUA 4OHVA 4QIWD 1MWZA 1X7VA 3DMJB 2N4DA 4J37A 1NB7A 2XI3A 4YY3F 3PX0A 3LQVA 1RT4B 2HYIB 5B0EA 4WE1B 1NAQA 4MFBA 4IOBA 4TU9A 1C1BA 2LQ5A 1GQEA 3DLLQ 3I0RB 4WF9Q 5LSRA 2LDIA 3LP1A 2RNEA 3OPKA 5LMUF 1D9DA 2D41A 4O3PA 3ZC4A 3RR7A 4J9PA 4IG3B 4XDCA 3KK2B 2NUUG 4A8SA 3V4IB 4OHYA 4NLRA 3SEOA 4EU0A 1TV6B 3HVAA 3LAMA 2VG7A 4QWBA 5JVHQ 2J6SA 4KO0B 3K58A 2E5LF 4F3OA 5AXKA 1URRA 5F8GA 2ASLA 1U1KA 3Q23A 2COLA 3NKYA 3VZHA 3RB4A 1TKXB 1NJXA 3M9MB 3BN4A 2QFJA 5DLFA 2KJVA 2XY7A 3W2VB 2HFNA 4P7TA 1HMVB 1VBZA 2FHJD 2GMJA 3TANA 1WD6A 2ADBA 5L39A 3FFIA 2RSQA 3CWJA 2EFVA 4U67Q 1M5KC 2E9ZA 4Y00A 4DQPA 4C0HA 3BGFA 2DD8S 1C0UA 3M2RA 4IH5A 2ZH9A 2ZC3A 3DOMA 3PJXA 5KG0A 1UETA 4X4QA 1UAWA 1YBAA 3CO9A 3NGKA 4HLBA 4O3QA 3ZZ0A 5LJ5Y 2IYGA 3OV7A 3MR6A 2XI2A 2IVMA 3U27A 2UUAF 4ED2A 3JSRA 2D9OA 4WU2A 4LSNA 2B4OA 4BC9A 1QAIA 2PA8D 3S01A 4FPRA 1FJ7A 4KC5A 3OQ2A 4DPOA 3PKYA 2A18A 2APOA 3OLBA 2CQHA 1JLGB 3OJSA 3LP2B 2HG4A 5KFBA 2KZMA 3A8EA 3ZZPA 2E5IA 3M6WA 3M8SA 3OBIA 2W9BB 4GKKF 2B9YA 4ZLPA 3EZUA 4AL6A 2J0WA 3QIPB 3AJ2A 4RU2A 1WNEA 2V8DA 3OXGA 3GV7B 4UQTA 3K8WA 3GR0A 2ZH1A 2DNNA 4Q45A 4FYDA 2YNGA 1YTYA 3DU5A 2XG8A 3IFEA 1XR5A 3TVZA 5EGYA 2MQMA 3DHWC 5L1LA 2VD3A 5J1EB 4A8QA 1KOOA 4ZVGA 3PY8A 2V9KA 2WAQD 3HHLC 2V4QA 2VPWB 2MJNA 1T02A 1HW8A 4KSEB 1B0TA 3NAIA 5C25B 3KHLA 4WYWA 1KFSA 3BGRB 3TAMA 3BQ0A 1HBUA 4ECYA 2RILA 1QY7A 4A4JA 1F2GA 1S6PA