3U02A

Crystal structure of the trna modifier tias from pyrococcus furiosus, northeast structural genomics consortium target pfr225
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
239
Chain Sequence
b'MLIHIGIDDTDSPNGMCTYIGAILYREISKIAEPLDFPRLIRLNPNVGNGAVAMSFKIDEEKIKEVKTLVIRYVRELADIDPGIVFLIGEVPKELEEFSLRALREHVTIEEAEHVARKVNAEVYKFKLGRGIIGGLAAIGYPLEKFTYELLAYRKREYWGTPRRVIKESVFYADKWSYPFTYDNVDPYKRTVLITPHGKDPVLVGIRGIDVGKILQVFEMIKIEEPIEFFQVYKTNQNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcription-associated protein TFIIS
publication title Crystal Structure of the tRNA modifier TiaS from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR225
rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Transcription
total genus 54
structure length 239
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3u02A01
3.90.600.20 Alpha Beta Alpha-Beta Complex Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 Glycinamide Ribonucleotide Synthetase; Chain A, domain 4 3u02A02
3U02A
chains in the Genus database with same CATH superfamily
1RP5A 1DHMA 4NCGA 1M90T 1R0BG 4H4MB 1UTAA 3VVTA 5A76A 4RUBA 1JLFA 4M5LA 1RHJB 4E98A 5H9FK 3O2IA 1TK8A 3ENAA 2GIQA 1Q53A 1HPZA 1YTYA 2CQ1A 1B0TA 3OTOJ 2OI2A 1K9MT 4YUDA 4TY8A 3V4MA 2JVOA 2DO4A 1YKWA 4X4TA 5BJRA 4K4TA 1RAIB 5M2PA 1IJEB 5KFHA 1RA6A 3LP0A 5KFCA 1EARA 3IAS9 3EVMA 3MUTP 1T0TV 5A2QU 1DFDA 2DHHA 4ANDA 1JMTA 3FGVA 2HBYB 1WEYA 1EETA 2IVMA 3NGRA 2XY7A 1IM4A 2PEHA 2B4OA 3I96A 1UL3A 3D3BJ 2ZZTA 4F3OA 2KH9A 4DPWA 3MAQA 4LREA 2GIRA 2DNNA 5KFFA 4O3SA 2RSQA 5KFPA 4C7QA 4OHZA 5GADU 4Y2KA 2JEGA 4OZ2A 4M5KA 2W8LA 1T05A 4I2PB 3BEGB 2IAJA 2YY3A 1K8AT 3FVYA 3RRGA 1MWQA 3EWGA 2BX6A 1VBYA 5HVHA 2V68A 3QO9B 3H7HB 1CC7A 4F4WA 3T19A 4IFYB 2I2YA 3UDEA 5DDPC 1K0VA 1ZAVA 1SUQA 1ZOTA 1B70B 4CYUA 3R97A 2GHVC 4R0JA 2XHWA 3KK1A 3IWXA 3CCVS 4R8UA 3GB0A 5KFWA 3BH7B 2FJBB 2YNHB 3KK3B 3MM8A 5SZTA 4Q45A 2KVIA 3FK4A 3DMJB 2R7UA 5EX3A 1UA0A 5HI7A 2PN6A 2HHXA 5EDWA 3ZTQA 1NJIT 3FRZA 4LF5J 1HNWJ 1S6PB 4I7FA 2ZBQA 4L3KA 3DLGB 4X62J 2Y1JA 1ZZNA 2J6SA 1EHWA 4RO0A 2X3DA 3GV7B 4P2SA 4LF7J 1SIWB 5E3QA 1HQ2A 3GIKA 2XZDB 3IP0A 1HBMA 4DDFA 1JLGA 4LRAA 3UN2A 3Q2SC 3OJSA 4WWSA 2ZKUA 1CJUA 2XC9A 3LP1B 2CFXA 4ZVUB 3PYEA 3HVWA 2FVSA 3HM9A 1JX4A 4JI6J 1VQ5S 1HYSA 1H3DA 4UZCA 5HBMB 5KFDA 3AFGA 1NPKA 4FS1A 1N36J 3SXLA 4DSJA 1N56A 1SQFA 5CA5A 3TVZA 4MFBB 3C15B 4DBQA 1LWFA 2VFUA 2WVCA 2PE8A 4WFYA 2XI2A 4DL2A 2OPQA 1EAYC 3PO5A 5G4DA 2CQ2A 7FD1A 1DY3A 2UXDJ 4OIXA 1YI2S 2ZH8A 2XYPB 3M30A 2AZ1A 2HZCA 3UN3A 2UUBF 3KLHA 3BH6B 2I1RA 4ES3A 4CLWA 2H5EA 3IAM9 3N4WA 2HRTA 2HHTA 4G1PA 2KTQA 3GR0A 1S57A 4LF4F 4F8RA 4CH7A 4HI2A 2UV8G 1N34F 3JB9k 2ZBCA 3NS6A 4ZVRB 2QSWA 1I51B 3BGOP 5HMYA 2WK4A 3DLKA 2CJQA 1RBLA 2J0QD 5E41A 3GG1A 2OPRA 3D9BA 1RWPB 1HBNA 1RZMA 2Z4PA 3PG9A 2AYBA 4AL7A 2IJRA 4RW7A 2NCKL 3MMCA 4J9PA 1UJ5A 3GSIA 3OTCA 4KKOA 4PXEA 4ZLPA 2V9WA 2ZZNA 3M2RA 1HI0P 3GV5B 4JI5F 3I32A 2E7WA 3KLVA 3C16B 2GJ2A 3NMAA 1GMWD 3DRYA 4BC7A 3OLBA 4IKAA 5B0FA 5A2QY 3A3NB 3KUHA 2WOMB 1SC4B 1E6YB 3QNWB 2KYXA 5FDLB 3KG1A 4KJIA 1HR0J 1YBAA 3M8QA 2IVFB 1HI8A 3OHBA 3BREA 2OTJS 1OO0B 3WDOA 5A6PA 2L41A 1G1XA 4RW6A 1VQ6S 3T5LA 3R8YA 2WZ1A 2JC0A 2PMWA 3R5DA 2UXBF 2DNRA 2NUUG 3ITHB 3W2VB 4F4YA 2BJEA 2W2PP 1Y5LB 4USWA 2D69A 4ED2A 5GAGU 2L3MA 3FZBA 2RHSB 3I5AA 4OZLA 2KFZA 1I94F 2QRRA 1RLCL 2VG6A 3P6YC 5KG1A 4J9SA 3KUEA 4RUCA 5DLGA 1B3TA 1NEEA 2CDQA 4CO3A 1WG5A 2LEAA 4A47A 1SBRA 4DL0C 4P7VA 1NJZA 2ZBPA 4I6WA 1KQSR 2RS8A 4J9QA 4FS2A 4QJVA 1S12A 2UVRA 2ZH4A 2AKWB 4ES2A 4ZJOA 2NPFA 2V2QA 2YX4A 4TU7A 4DUTA 2AJ0A 4RNOA 1L5UA 2EG1A 4QWCA 5DZ7A 5B0AA 1FF2A 5JJBA 1RACB 2HLUA 2ZDPA 1O0PA 2ZH9A 4ES1A 4LSZB 1X5OA 1Y9OA 4QWDA 3DU5A 2P2CB 5LMUJ 2VICA 3AJ2A 1C2PA 3TO8A 3F0NA 5E33A 1Y4ZB 3EZUA 3NCPA 5EHHA 3TZWA 1D9DA 3GJTB 2ALYB 5HK4A 3LO3A 3PHTA 1SV5A 3VHQA 4C8KA 1V3ZA 3TZYA 3TP2A 5D15A 2VKZG 4PG8A 2P6TA 2AHOB 1PC4A 2O01C 1WJ9A 3FEXB 2DHAA 2Z30B 1NJWA 3U27A 4RW9A 4DN0A 5E3CA 1S4EA 4O3RA 4FPIA 3CJ3A 3HZEA 5LL6d 1S1WB 2MQQA 3GR1A 2JJ4D 3OR1B 3TUPA 2ZEJA 3P49B 2HBRB 4LFAJ 1P9YA 4LF1A 3MHYA 2Q1LA 2VU5A 1Z2LA 4CLLA 2IJNA 2YBVA 1YRUA 1S97A 1VQ7S 3GIJA 3I4HX 1TL1B 4WZMA 1X9WA 3MOJB 1NXIA 2WVBA 1SH0A 1FEEA 2HK2A 4QOTA 2ZHBA 1GX6A 1D0EA 4UW2A 3GYGA 4NRUA 3HLUA 2E5LJ 3CCWA 1N6QA 3HSJA 3BZQA 4CP5A 1N8RT 5M2UA 3H4BA 4ED0A 2YNFA 2OKQA 2HWHA 4PWDB 1ZPVA 1HW8A 4C8OA 3IFEA 2B8QA 4N8OA 1Y11A 1XTZA 3Q8PB 2YS7A 4OJHA 4AQYJ 1Q82T 2HAIA 4ECZA 1V6HA 4X66J 1NZAA 5L1JA 2GV1A 2LVWA 2IM0A 4JI2F 2BKNA 3ZZTA 3AOCA 3H59A 5EWFA 2A18A 1X4HA 2BE2A 1M1GA 3MEGB 4GKKF 2DNGA 1VBXA 4J91A 1T3NA 1LWCA 4ZITA 1VIXA 3TR5A 3AQOA 1KQFB 4XTTA 2EFOA 1SQGA 2RVJA 2ZD1A 2IIHA 3MM7A 3W8GA 4Q44A 1H7XA 2VZ9A 3P96A 1U1QA 9ATCB 3M1VB 4DG1B 2ZHAA 4DLEA 4F4ZA 4NLWA 2KJWA 4P7TA 3CCSS 2BEFA 1WELA 2CWXA 1B99A 4B08A 4NYOA 1UZHA 3DI6A 3ILOA 3QMQA 1C1CA 2F4VJ 1U6BA 2M3DA 2DH9A 3D0GE 3MMBB 3LQVA 2B7BB 4NA2A 4NX9A 2DTJA 3B4DA 2RU3A 3MECA 2C2ZB 2V5HG 2HZVA 1TL7B 1VBKA 3HKZD 3Q0AA 4WE1A 3G2XA 4C0OC 4WKYA 3D54A 3C6UB 3HJVA 2HSEB 1C0TB 4MKVA 3I9V9 2M9KA 3Q8UA 2EG2A 2RE1A 2LECA 1S9EB 3S1TA 1RK8A 4ENOA 1JLCB 2H9ZA 2HNZB 3SMZA 4LIWA 2NXCA 1WC3A 3NWGA 2M8DB 4UY85 2ZH7A 3UCZP 2HVZA 4QCLA 1RHMB 5GAGI 2PDAA 3ZTOA 4J9KA 4ED3A 2PMZD 5C25A 2QIFA 4DV1F 3QWPA 4WP9A 3LF0A 2M88A 3FSIA 4OZ1A 2KZMA 5C42B 3RAQA 4A8KA 1P1TA 1LWXA 4DUYF 3KXDA 2W2MP 2MPUA 4B3MF 1BD6A 3BGRB 3NAIA 2MEWA 4X4PA 4TU8A 1IBKJ 4Y2MA 5D4LA 1OPZA 3ZC4A 4FZVA 1ZBTA 2IRYA 2NLWA 4HT7A 1G3OA 2IRXA 5DQIA 4DFPA 2Z0GA 1QAJA 2FLOA 3TZZA 3M4XA 1TKXB 2PFDA 2VPXB 1D09B 3GFZA 2H48B 2GX8A 3LPYA 1RTHA 1SJRA 5LM7E 4OX9J 2QSFA 1RABB 3O6QA 2YTCA 3T1HF 4Y34A 4OYWA 3EMTA 2E5GA 4DL3A 3CO0P 2R8HA 2B6AA 2FVCA 1R0AA 3MCMA 4WJBA 4U7CA 4ECUA 1JK9B 3JXOA 4R25A 3IA0A 3GJSB 2KDOA 4YB7A 3K7RA 3UCUP 2HVHA 2HRYA 4DR1J 2CPEA 3D0HE 4OFZA 3N5BA 5F41A 1RT7A 3KHLA 2FJXA 1X4EA 4U67Q 1YITS 1JJHA 3CVKA 3PX0A 3DLBA 1KR4A 3JSMA 2WAQD 2LEPA 4F0HA 3NY0A 3FEYB 2NZ4A 4CH1A 4DV6J 2RJZA 1ZM9A 4TLRA 3F44A 5E3AA 1IKVB 3PFEA 3D7SB 2GJIA 2ZWOA 1QTMA 3L4BC 1NPRA 4R5PB 1ZETA 4C8MA 5J2PA 2VBZA 4DV7J 2DGVA 4DX7A 1CULA 2CJAA 3D3CJ 1XR7A 3DOLB 3CJTA 1A9NB 3R5BA 5JVGQ 1XNRJ 1NUEA 3D67A 1LW0B 2D1CA 3KLIA 4ITSA 3QFHA 2AT1B 2HQGA 3DOMB 3G86A 2XWYA 3SCKE 1N48A 1CQMA 2E9TA 5E2QA 4AT1B 2W9BB 2R2TA 3WQPA 4BHQA 4MIBA 4ZN1A 5KFRA 2NYIA 3HMJG 2IP4A 4FYVB 3GJRB 3LP2B 3TNVA 4YY3F 4UZBA 2OELA 4KGMA 2NREA 1KQKA 3KMSA 4GVBA 3B82A 1I5OB 2HMIA 3M8PA 3T1YF 1RISA 3LANA 1FI4A 3DKDA 5GVQA 1HPZB 4QPXA 2EFNA 2R8GA 3T1AA 5KG7A 2VFVA 5C24A 1WF1A 2Y9HA 1F5AA 4HYKA 3KHHA 2B0GA 2CWKA 3QSIA 3UNGC 4DV0J 5B0GA 1PJ7A 4M5IA 2QFIA 1UJ6A 1S77D 1SI9A 1FRHA 3K57A 2Q3PA 1IBMF 1OIAA 1F2GA 4FXDA 1BUXA 3NS7B 4ED4A 3BDPA 2CQHA 2OHDA 3PRDA 1TKTB 3DLEA 2W9CA 4MKAA 3MUVP 2ZVIA 3TVYA 4KQZA 4NLXA 3I5BA 2VQFJ 1IWAA 3HFZB 4CLFA 1GX5A 2ILZA 4X64J 2KRRA 2OD4A 1WF0A 3OHAA 2MKJA 2YYAA 4ZS6A 2XS7A 4CO2A 4IOBA 1FT8A 4A8YA 1R3NA 3KK2A 2LQ9A 3DRXA 2IHR1 1KQGB 2U2FA 4PG7A 1NJXA 5U47A 3PW2A 2CQ3A 2OPSB 4J9UE 5DM6Q 2XCAA 4PWWA 4LUBA 4TY9A 2YWEA 1RDRA 5CXTA 1DTTA 4DCJB 2APOA 3SQGA 4CYUB 2WONA 3MM6A 4F7VA 1XIQA 3NGDA 2W8KA 1WI8A 4YN3B 2H65B 3DRPA 3OR2A 2D74B 1VJQA 4KGKA 1S9GB 3M9OB 1S7HA 4IG3B 2VONA 2DRAA 4YMEA 5I3UB 2RDIA 2LCWA 2YKMB 5LSOA 4I7FB 1FJCA 3EDQB 4WZQA 3BSAA 4LFBF 3OVBA 1ZH5A 2R7QA 2MHEA 4YHHJ 2BKOA 2NQPA 1RHKB 2E5LF 1FD8A 4Y3CA 2R2SA 2CNOB 5L1LA 4QPTA 1HHSA 3G82B 4PUOA 2R4FA 2JHEA 4M94A 3L7PA 4ZMMA 4ZDNA 3JTPA 1CJUB 1GTEA 2CJKA 1HWKA 2ZE2A 2GFFA 3V4IA 4PXCA 4PCQA 2W2NP 3OBIA 1PSDA 2HS3A 2UVUA 1HYSB 1YQHA 1EQMA 1NKCA 4A8WA 1WKJA 3GFXA 3Q22A 4N7TA 2Z2YB 2LA4A 3MPDA 3RG6A 4DV5J 4A8MP 4NASA 3ZNJ1 3EE3A 3D6HB 4HH0A 2AGOA 2HFOA 3K0JA 1RTIA 1F1BB 2B4VA 2KT2A 4U96A 1RGVA 4PRFA 4HACA 3KLHB 3C46A 1O8BA 4QR2A 3OTEA 5IC4B 4AE5A 1RAGB 1YBTA 2MKSA 5F0WA 1RTJA 2R8KA 4FKYA 4JI4J 2DVIA 4O23A 4FDFA 2AF6A 3HHLA 4LRBA 1N5TA 3FCVA 4ILMA 4FYDA 1IWGA 4F26A 3QGHA 4GKJF 4C6AA 2B9EA 4LQ9A 3SCIE 1Q78A 2DNZA 3DGPA 5HO4A 3HHKA 2KO1A 2JNJA 5CYQB 1CSJA 3HCXA 4ETXA 1J5EJ 3ONQA 1VLYA 4WYLA 5EWEA 1NRKA 3MMCB 4P10A 2MTLA 3I0SA 1R27B 2YRWA 1UVIA 1T9VA 3L7OA 1H74A 4J7CA 3CJQA 4Q2MA 1Q7YT 1RWWB 2I8EA 3KG0A 3P3DA 4CLUA 7FDRA 2DXEA 3I0RA 4E0DA 1ZZFA 2FHJA 1YBUA 3H20A 4ZVFA 3MAAB 5AXLA 1FRJA 3PRBA 4NI2A 1PO6A 2J0SD 4NYZA 2W9AA 5D3GA 1XMBA 2HHUA 1RCOB 2BXJA 2UV8A 4X4UA 5JXSA 4I6AA 4RW6B 2CKWA 2N82B 3N79A 2FGOA 2O5DA 2XWXA 1Z4UA 3FCWA 1S59A 2XHCA 4EO6A 1BQNB 2YNGB 4IFVA 2W2QP 3VAJA 3FBFA 3I9ZA 1IR1A 5D6GA 2ZHOA 3BSOA 5CCLA 4KAIA 3I31A 3KJFB 3ZZRA 3BBCA 4EU0A 4V19J 2ZM6F 1GAOA 3PXGa 3Q8SB 1IQTA 1XR6A 5T7LB 3U1MA 3M8WA 1IKYA 3A8EA 3TJ8A 3RBXA 2DITA 4I69A 4PWUA 2WVFA 3RUBL 3C6TA 1T94A 2M2BA 1X31C 4KYZA 4RW8A 2IYIA 2QEXS 4CLTA 1RT4A 2YPYA 1FXDA 1HD0A 4WFAQ 3S6EA 4CTAB 5HP1A 3VCDA 4GVLA 2FJEB 1V3SA 4OX9F 4CO0A 1Y00A 4KTQA 4QIFA 4YDDB 3BGUA 1RYRA 3CCRS 3HKWA 2PA8D 2SXLA 1RHQB 3JSBA 3MCOA 3GJQB 1XNQJ 2JEIA 3W63A 4ZPBA 2E1AA 2W01A 2EXUA 1VQ8S 3V6JA 5KTQA 4Q0BB 4DQQA 4ZPAA 1VQKS 2LQBA 5FIIA 5DDOC 3J7YU 4I1TA 2EC2A 4ICLA 3O44A 4QU7A 1KVIA 3EZOA 1U6FA 3KLGA 4LFCJ 4G1QA 3AB4B 2HW3A 1W2BR 3KKFA 1RTDA 4NLGA 5B0DA 5HLFB 2F4FA 3OXFA 4F4XA 1WF2A 1LK7A 1NDCA 1L3TA 4RNHA 4HVZA 3EX7B 1WNEA 1UWBB 1AUDA 1VDHA 2M8HA 1WDDA 2M7SA 1U1RA 4N77A 3TEGA 3D1OA 4OI3A 1FDNA 2YNIB 2PT0A 2JEJA 4WU3A 1JJ4A 2UU9F 2E66A 1F3FA 1S1VA 2J8SA 1FWKA 4U6PA 2UUTA 4LF8J 3SSSA 1F2HA 1U0HB 2K8GA 2WB1D 4RW4B 5J2MB 1TKDA 3PHEA 5HANA 4TVAB 2FYXA 4KHRA 2YXLA 4P72A 3NBPB 4JI1J 4Y28C 1KBRA 2M52A 4DR2F 2J6TA 4USKA 4CNZA 1V5VA 1S6QB 4QWAA 1U8WA 4IYQA 4LVOP 3F56A 5KFQA 2XMKA 3H5UA 1MN9A 2N7YA 3W3SA 3CCES 1N6QB 1U02A 3ZXWA 4HT5A 2HS0A 4WFXA 3GFHA 5KG5A 1RT2A 4USTA 3A4TA 5MLCV 2WBMA 4LSNB 3QGGA 2MLXA 1FCAA 2HBZB 1F5BA 1S79A 2MKIA 4MK8A 1WD6A 1RTZA 5I42A 4RKUC 4RUAA 4YOEA 3PX4A 3VALA 2F5GA 4NYPA 4UUXA 2XD4A 5D0GA 3V6DA 3OSNA 2G13A 1VJWA 3R9LA 1HNZF 2QG9B 2XMAA 1LWCB 4OYBA 4HR2A 1REVB 3HDSA 2DGOA 3CCMS 2Y1RI 3MWBA 1NH8A 2ZBRA 4Q8FA 3X3UA 3SV4A 3DM2B 1RA7A 1G2EA 2B5JB 3J81j 1PBAA 6FDRA 3HVRA 4ZPWR 1XK8A 4E8UA 2FVQA 4C11B 4B3OB 3J81Y 1V5IB 2FJVA 4O44A 4NLDA 2HHHJ 4WP8A 4PPZA 3PDNA 3VF0B 4IH6A 1C1CB 3JSRA 3PY8A 3ZO7A 2OSQA 3UDLA 4CNYA 3I82A 1ZTTA 3HHNB 2D9OA 1FRKA 5HVGA 3QJPA 2GQQA 3CJKB 2G9OA 1MLAA 4IUFA 2ZWPA 1PJ5A 2QMUB 3MECB 4DUZF 1CJVB 1YJTA 2D9PA 2GS8A 1DZ5A 3CF5Q 4RU2A 4DR3F 3KLEB 5HATA 1JLBA 4AUKA 2EVZA 2K2PA 3VAHA 4WIQA 1NU4A 1CG2A 4RBVA 4ZA1A 2QA4G 2F9DA 2DGUA 2PSZA 1RWUA 5HJYA 1LW2B 3CW2C 1WC1A 4B9UA 2VPZB 1S1UB 3MTJA 2AW0A 2J9DE 2AJ1A 3ZTSA 2HGNA 3CJ5A 1KLNA 4PG5A 2J0XA 2I6WA 2VA2A 3VGUA 4DR6F 3K17A 2CZVC 3MR2A 4CO5A 4PKDB 2MYFA 2IYGA 3HVTA 2HHSA 3N0VA 2NR0A 2IDEA 2VG5B 2WRMA 2PA3A 1WHYA 2IPOB 4EZ6A 1UVJA 3MEEB 3DOKA 3I5CA 2W7OA 4A46A 4IH5A 4M1KA 5A8RB 4ILLA 3WIUA 3MF5A 2XNRA 3FDSA 1RT3B 3KHGA 3MGJA 3CC2S 1QAIA 3BO2A 1VK8A 3RAMA 2IC3B 4RL1A 2AJ2A 2XGPA 1JJ2R 3PVXA 2CVEA 2HGLA 4ZCMA 4DL5A 1HBOA 1MU2A 3GONA 3U1LA 3K58A 1YX2A 1CS4A 4OJ3A 1YSJA 4OZJA 4R0EA 1FTCA 5DG7A 1TAUA 3A13A 4X4NA 1D8YA 1SL1A 1FFWB 1UWAA 4QU6A 2C2DA 1UKUA 1UVLA 1HL6A 2MKKA 5J1EB 3FRYA 2DGXA 1W25A 3HVAA 5CYMB 3QYYA 1FKOB 3CCJS 4W92B 2B6AB 2FQQB 3B54A 3ZZ0A 2CUYA 1PAUB 3CSKA 1GXLA 1TP7A 3NKYA 2G1HA 1TKZA 1X5TA 2BR0A 4TYBA 1RWVB 3W62A 1M5VC 3JQMA 3J7YI 4WK1A 1UW9A 1UPMB 2JLGA 2E9ZA 1N0VC 3D1HA 1DQAA 4L75A 1JLEA 2CQ4A 1S7IA 1YJNS 1JLAA 2K7JA 5ETLA 1SCJB 2XMUA 4KGZB 4N47A 4WTOB 4GRSA 2OP5A 2DK2A 2R7TA 3TA0A 3MZIA 2YX7A 3AJ1A 2FC8A 1VQ4S 3RRKA 2LXIA 3UNYA 1B4SA 4XDDA 2AP6A 4HLBA 1Y0HA 2EFVA 2FZCB 3UPFA 2MQPA 3JTOA 3DGVA 2ZH6A 1YIJS 3EXCX 4JI8F 1DARA 2JLFA 3M32A 1DJ0A 2YQ0A 3PW7A 3KLIB 2YWKA 2VOOA 2I9SA 2JEFA 1TVRA 2B9YA 4WFBQ 4IO9Q 3T6JA 4JI0F 5IZHA 2V34A 4UOCA 3NS5A 1OY6A 1FRIA 4O4GA 2E7VA 4I64A 2RH3A 1HWIA 3QFWA 4EYHB 1Q4RA 1IKWB 3BJYA 2OPPB 5KFVA 4WIIA 4QW8A 1U24A 3BQ2A 2PO4A 2VA3A 1YG0A 5B0EA 3E8OA 4YP3A 3CCTA 3CUNA 2GAGC 2ZH5A 2PGCA 2VDHA 2DO0A 3R7NB 2MZ1A 3LAKA 2DB1A 3IRXA 2IVYA 2J7UA 2QO3A 2C2MB 3AB2B 3NRBA 2ROPA 4OL8A 3MEDA 4AXJA 2GVZB 1AFJA 4M63A 4MT1A 2R7VA 4C2MA 2Z56B 3HO1A 3TQEA 3R7SB 1C0UA 2Z57B 2WW4A 4PQAA 3PIOQ 4YR0A 2AX0A 1RAJA 3BO3A 5DQHA 4U8VA 1BQMB 1WKLA 2CA9A 3TARA 3FCHA 4TKTA 5A6WA 5KFGA 2UUBJ 3V5RA 2CPDA 2PD1A 5HMXA 3DLEB 3NP5A 3UFCX 1GTHA 2CQ0A 2UXCF 2VL1A 2W1BA 1LWEB 2ZVSA 3KLFB 2DR9A 1TELA 4ZVHA 1N34J 4L73A 2VHGA 3AODA 5DDQC 4F04B 3WC2A 5LSLA 3QRQA 3CD0A 2ZNZA 1IM6A 3HX9A 5DO2A 2BJDA 4DV4F 4KO0A 2F8HA 5DQGA 3TANA 1U0SA 2IRUA 2ASLA 2ERRA 2UP1A 3D1QA 3C14A 4HDHA 1HNXF 4U8YA 2F63A 3TJAA 4X4RA 3ETOA 5IT9U 4OX7A 2W4CA 2AGPA 3HI9A 3R1LA 4ED6A 1DTTB 1FK9A 4JI5J 2DH8A 1GT8A 5DRKA 2WONB 3MM6B 3M8RA 5IT0A 1WHWA 4ECVA 5CZXA 1SQEA 1H38A 2FIUA 4XO0A 3MR3A 3TVKA 4HL9A 3LAMA 2DRDA 4L6V3 5FJ4A 3DN9A 3IBWA 1TK5A 1BC6A 3HSZA 3TUJC 4H4OA 1JLQB 3R5AA 1AW0A 1DAXA 1PC5A 4QYZK 1FDDA 3WX8A 5J2QB 4F4KA 1FJ7A 2X51A 2PI4A 2RS2A 3J80Y 2R7XA 2CNKB 4ED5A 2UXBJ 2K7KA 1RWOB 2RILA 5HN0A 3N9UC 2V4JB 2KXNB 2F7VA 4LSLA 3RAXA 2IA0A 2DD8S 4PUOB 4W4MA 1VI7A 2GHWA 4ECRA 1I94J 3U02A 1ZYQA 1MW7A 3DC2A 4K59A 3E3XA 4LIRA 3V2UC 4IG0A 2OEKA 2EBEA 1JB0C 4DU7A 4NA3A 4B02A 2J0WA 5D0HA 4I0WA 1UJ4A 2HQFA 2C2KB 2NXUA 3RB4A 4DPTA 1JXEA 3NOGA 2WW8A 3PIPQ 1ZAWA 3BSNA 1NSAA 4GC7A 2FJDB 2MKCA 2R42A 4WBFA 1ULRA 5G0RA 3EVOA 2XI3A 3GFYA 1LKZA 1FNMA 3MMAB 2XO7A 3DLJA 3D2WA 3VTIA 4GO5X 5IXUA 4DU8A 3DHWC 4OYPA 2QA4S 1UEVA 2Y1IA 2WSFC 5BR8F 3QIPB 4BBYA 1EB0A 4LF2A 1MNEA 1RHUB 2ZC4A 3QJJA 2R9LA 2V4RA 2GMJA 4YB5A 4USJC 3FFIB 3B6BA 2C3YA 3CD7A 3NL0A 2L9WA 3HHLB 4YDXA 4K4VA 4J9OA 1R8HA 3NWRA 2QL5B 3CO9A 2MGZA 2DEJA 2MSSA 4CLPA 5C2CA 2Z58B 3O3LA 4P6QA 4ANEA 1MMDA 2BACA 3DGPB 3VAMA 4CH0S 1MMLA 2E1CA 3SI8A 2Y8WA 1QSYA 1DLOA 4OHVA 5H9EK 2XGQA 3THPA 3TUIC 3LA0A 2XSJB 1SJ4P 1KOHA 1KONA 4RU9A 1KFSA 2CXEA 4URQU 4CM2A 4K5SA 2FC9A 1TR0A 3OJUA 4H4MA 2AYMA 2FB0A 4ZHRB 3M2UB 4O3QA 2CG4A 3JAMY 1MWZA 2GA7A 3W9JA 1MROB 2D7SA 2JL9A 2FY8A 3ISZA 3BQ1A 3MXHP 3G9CA 4I2QB 4AL5A 2BJ1A 5FLXU 4TXSA 3POTB 3VVUA 2ILYA 4PPDA 2FJWA 2CQIA 5B08A 1DTQB 1FFGB 2A10A 1BHNA 5LJ5Y 2C2EA 3CGIA 1CJTB 2WTFA 1FJEB 1VQMS 3IBCB 4EBCA 1T9WA 1FDBA 2WBRA 5KT3A 4C8YA 4NXNF 1IKYB 4J9LA 1XQIA 1PAEX 4UT4A 2VODA 1U1NA 3FNNA 3AD9C 4FKXA 2BANB 3C6TB 4RWXA 1OWXA 1NHKL 1RT6B 4C0BA 2XLJA 1KKHA 1QDUB 1RAEB 3AD8C 1U6ZA 1AA1B 4DHVA 4JI2J 1QJHA 1LNQA 4F67A 4OYIA 3QO9A 2C3UA 3K8VA 3H42A 3DFEA 2RDJA 4IFYA 5LMNF 4GKKJ 1U2CA 3TX0A 3M2VB 5AJ3F 1X9SA 3SIPB 3HHLD 4KV8B 4DR4F 3BR8A 2RHQB 2ZDOA 3A3PB 4K0KF 1K1QA 1Q81T 2XQCA 4DX8H 1BGXT 3AAWB 2E5JA 2YNHA 1Z2ZA 3KK3A 3R6LB 3F73A 3NGTA 1R8AA 1X7VA 2D41A 1X4BA 3R1HA 2K3KA 3CDBA 2A2DA 1ITPA 3GIIA 1GMWA 3DMJA 3PKYA 3KOAA 3JYTB 1NAQA 3TOQA 1RJJA 3NNAA 1S6PA 3ULHA 3IM8A 3C8YA 3HFKA 4EBEA 5IFMA 4FVMA 3DLGA 4NCBA 4Y6IA 2ZZMA 2RF2B 2GZOA 2HHPA 2X1FA 2FHOB 4C0HA 5HROB 4TLQA 1RT5A 4M5MA 1NDLA 3EYZA 1HW9A 2FHJD 1IKXB 3B4MA 4PG6A 1FKAF 3IG1B 3LP1A 2ACMA 4X4OA 3ETMA 3NCQA 2H4WB 3KDOA 3W5YA 4ED1A 1Q5VA 1P9QC 3HJFA 5KFNA 1F9EB 2HQCA 5EGYA 4QWBA 3ZNUA 2J8AA 5E7OB 2MZJA 3SSQA 3L3CA 5LXRA 4QR1A 4A48A 4KGVB 4B9TA 4ZJLA 3CJRA 2V6AA 4MFBA 1HQEB 3C15A 3ENVA 3H25A 5ETNA 1SKSA 4MKBA 5CQGA 2O1PA 4ZVPB 3TZXA 2DNMA 4DN9A 2KG0A 1KWMA 5KFEA 3LP8A 3R2CJ 2VFSA 4P2XA 1UVNA 3IBFB 1M0SA 2DNOA 5HSPA 3UI3A 5FD1A 2KXFA 2C1EB 3QAEA 4CT8A 4F0MA 4FXWA 1HBUB 2KT3A 4JI3F 1FJGF 2PMHA 2OGUA 2VH7A 4DV1J 3T41A 2AEFA 1HIYA 1IVZA 3K5MA 1OQ6A 1IBLF 4C4WA 3Q8QB 5F9NA 5KOXA 4FYWB 4NA1A 1YWXA 2F8MA 1OSDA 4ELVA 4DUYJ 5KFBA 3MPUB 1YJWS 1NZ8A 4P75A 1KDNA 3PNIA 5MAOA 5KG6A 4B3MJ 1B7FA 1S1XB 5I42B 1E6VB 1I3OB 2RQCA 1VQNS 2RKIA 3SSRA 2P8IA 4OX6A 2BE7D 1VRUA 4K2JA 3OL7A 4UY8T 1C1BA 3KWMA 1KTVA 2AYGA 2YQ3A 4NLUA 4DPOA 1H6KX 1OPIA 4ECTA 2W7AA 3T1HJ 3HFVA 2H5JB 2J5AA 4RNFA 2VD3A 2WOMA 4NLYA 2LQ5A 3RBZA 5FDLA 3CULA 3W8PA 5F0UA 2XCLA 3HK2A 4PQUB 3AA9A 4J9VA 2G2YA 1X4FA 1UAWA 1OY8A 3GU0A 2XY5A 1GXUA 1ZM4A 2XMJA 2XEXA 3W2VA 3OUYB 4FF3A 3HHEA 1L3UA 3KMQA 1NM2A 1N5VA 1W2IA 4HI1A 3K5LA 1XMOF 3EGVA 2R8JA 1JLBB 3PRVA 3CMQA 3RB0A 2L9NA 2HBQB 4RBTA 4PEOA 4K8RA 5A8WB 5I4MA 3GP9A 1M1HA 3LTOA 5AE1A 3ILJA 2XULA 3I6PA 1HNVB 4DPYA 2HNDB 4DV2F 3FJ2A 3SEOA 5A0YB 2OFGX 2U1AA 3AA8A 2UUAF 4E2FB 4DMZA 1HMVB 4ZVEA 3HVTB 1T9TA 2UVVA 4A4JA 4DF8A 4HTJA 5D0RA 1X8DA 2VDIA 2OTLS 3E01B 5L38A 4L76A 1HFEL 5A8KB 3TAMB 3BR9A 1QVGR 2CADA 4YY3J 1YRXA 4ZLLA 4URSA 4DV3F 5AXMA 2XYHB 3OL8A 2Q79A 5J2NB 2QLWA 3KNGA 2MQMA 1OJ4A 1TTHB 1Z1ZA 2XLKA 3T1YJ 2ADCA 1FWPA 1QLNA 4RZRA 2H54B 1KS2A 1UEKA 3PYGA 1YGYA 2HLTA 2CIMA 4L3NA 2BJ8A 2XY6A 4M5DB 3DLLQ 2J76E 1Y5NB 2J7KA 1M5PC 3J7Z5 3VGVA 3BPSP 5KFAA 1JWWA 2V4QA 1W7WA 5ETQA 2NPIA 2NSCA 4Z2XA 1KEKA 3JTNA 1IBMJ 3G4SS 2BRKA 1VQSA 3KHRA 1GQEA 1NK5A 1R8BA 2KFYA 3MAHA 3CJSA 1PYOB 3H98A 3HT0A 4IOCQ 1SKRA 1WACA 1U8SA 3OTDA 4D3HA 2W4PA 2WHOA 1TKZB 2XZWA 2X1BA 1S1WA 1KLMB 4B3TF 4DQIA 1QE1B 2YWHA 3MD3A 5IC6B 2LP4A 2A6OA 3OR1A 4URGA 1WTFA 2ASJA 2JVRA 4QIVA 2MDAA 1YJ7A 2IM1A 2DHSA 1JLAB 4Y65A 2GNKA 1TL1A 4MIAA 1N5YB 2DGQA 3PX6A 2DT9A 1J2VA 2HVDA 1VC5A 2I0XA 1AFIA 2DGTA 2M5YA 1OMSA 1PBUA 2ZH3A 2IJFA 2HFZA 3W2WB 4RWWA 4YR2A 4TN2A 4RJVA 2BW7A 1PILA 4USIA 2RRNA 1GNKA 1UFKA 1A0OB 3L09A 5KT5A 4MK7A 4PWDA 2HGMA 5IS2A 2CPHA 3GIMA 3TJ9A 1KN6A 4F25A 1J5OA 3KDNA 1CPZA 1GEHA 2GQ2A 2JFDA 5ETRA 1WEXA 4IDKB 5D8HB 4LFBJ 4F2RA 3AD7C 4NLVA 2R7WA 1H98A 2MZSA 3EGZA 3MM5B 3MEGA 3PM9A 3A1YG 3MURP 3G6XA 2HWIA 1Q8LA 3HSGA 5GMDA 1L3KA 3TA1A 3NGSA 3BYRA 3FKBA 3Q8VA 3CMAS 3FSYA 1YZ7A 2AZ3A 3RYLA 5DETA 2I5JB 4FN5A 2X1GA 1O6XA 3UW1A 5KT7A 3ENQA 2K1RB 2FLNA 3GCXP 1UETA 2F1FA 5B0CA 2F65A 4ELUA 3N6LA 3NLCA 5KT2A 4QQBA 3SYZA 2C3PA 3BYPA 4B9LA 1UVMA 4KPCA 1XR5A 4ZN3A 5C5JA 4TQRA 4EEYA 2OAUA 3MMBA 1N33F 3M6XA 1S1TA 1KSPA 1SH3A 4CZCA 1VHFA 3AHPA 9RUBA 4U9RA 1O51A 4NXMF 4LJMA 1T03B 1KP6A 1TL7A 4YFUA 1K73T 3QIDA 3MFHA 1KFDA 3EDRB 3GV8B 3C6UA 4WKRA 5E3PA 4ID5B 1M5SA 3T6BA 3AJDA 1OSCA 3LOUA 2ZKTA 2J9CA 4V1Ak 4XIUA 3L95X 5GAHI 3TUZC 1S9EA 1Y10A 1EX8A 2HQIA 2QLBB 3MR6A 3CCQS 4GKJJ 5K14B 3FMWA 2P9GA 4KO0B 3LH2S 2WB4A 2DNYA 2FZKB 4KIAA 4UOFA 3A3OB 4WPAA 4WP3A 2VG7A 3V6KA 5ETVA 1JKHB 1T9UA 1BQXA 4CIOA 1SIZA 1S0MA 1AB8A 2VB6A 3MEKA 2KFNA 1FKPB 3ILLA 1DRZA 2ZITA 5IM0B 4ED7A 3UQSA 1GMUA 2G4BA 2VQEF 4G3IA 2VJVA 2DEIA 5C42A 1F60B 2QLXA 3O8WA 3QLHA 2KHCA 3NGKA 3PKMA 2KM8B 1HWJA 5K9FA 1IN0A 4KGXB 4P9SA 2HEKA 3BGRA 4DX5A 1BMQB 4H4OB 1S72S 2IBOA 2VKRA 1R6YA 5F8JA 2CAJA 1VRTB 2MQLA 2WVEA 1SKUB 2VFTA 2V8HA 2HHWA 1VYAA 1ROFA 1HQUB 1N32F 4OV6A 4MYUA 4P2MA 5CH7B 3K8WA 4LR9A 3V81B 2HKEA 3K5NA 4M5JA 3OVSA 2AX1A 3DCAA 1RT1B 2Y8YA 2NYHA 3QPIA 4KE5A 5DS7A 5F8LA 2ZC3A 3CDEA 4NMXA 5KG4A 3G8QA 1TK0A 3S8SA 2GGPB 2ZM6J 1CC8A 2M4MA 1ZA2B 3N01A 1FTRA 3GLJA 2W4DA 4C8LA 4Y0FA 3OL6A 1TV6B 2E5HA 4UQGA 1UW4A 2MHNA 4OZ3A 5HVFA 4LF9F 3QRRA 5KT4A 1Q8BA 2B4UA 1PIEA 1BWVA 2IDLA 1UFLA 1H2TZ 2AWZA 2OD6A 3MM9B 2VC0A 4O3NA 2AJFE 5F3ZA 2CJXB 4X65F 5K20B 1APSA 4LF6F 2XLIA 1R7IA 1RSCA 4DQSA 4FXVA 4K5RA 2VPWB 3BSCA 1AUSL 1TFWA 1IKVA 1GK8A 2ZOMA 1TUVA 3UO0A 3QBCA 2MQNA 2FGCA 4CQ1A 2JDJA 4L74A 4NLPA 3R5GA 5L46A 3DOLA 3IRWP 2Y1LB 1N4LA 2KYZA 4MTPA 1LW0A 4F4AA 1RE1B 3OT9A 1WORA 1REGX 2NXJA 3UVJB 1U2RA 1WHXA 1CJKB 3DOMA 3D0IE 1RKJA 1R6VA 3DYAA 5KFTA 1FE0A 3VAGA 2MZTA 2W9BA 4YR3A 3T5KA 1PGZA 3GYXB 2EFGA 2N4CA 5F3TA 3LP2A 1X60A 2V8PA 5E0OA 4LBHA 3HPOA 2BKPA 2CPFA 4JI7F 4C8NA 5BXIA 1U7LA 3EPGA 3DDNA 3MPVA 1S48A 2LYVA 1TUGB 4JP8A 2DIUA 2UU9J 4ZIVA 3THTA 2YH1A 4JYAJ 2DJWA 2P9EA 3H2VE 3Q83A 1D9FA 2HQDA 3W1YC 1FESA 1OY9A 2Z2LA 4ZVGA 4G6VB 4DOZA 3AT1B 3ET6A 1LOUA 3WC0A 2X1AA 5LOQA 1T8EA 4DR2J 5IWAF 4KY3A 4NCGB 5IQ6A 1X5PA 1IJFB 3S01A 4FBUA 1JLFB 1TKTA 4NLRA 4DWIA 1NK4A 4DR5F 1U47A 3K5OA 5F8GA 1WG4A 1AXQA 3GYNA 2N3LA 3QT7A 1TAQA 3UCGA 2XMVA 5I3PA 4TY8B 3H5SA 5LJ3Y 2DKOB 3OW2R 3KJVA 4ED8A 3GMGA 1WSRA 4KFBA 3BPDA 2HVIA 1TL5A 2BM0A 2MY7A 3CJ8A 3LP0B 5KFLA 1P6TA 2RT3A 2J9DA 4DL4A 2OPSA 4K2XA 4GMKA 1SJFA 1WC4A 1EETB 3A8KA 1HNZJ 3HP6A 3OXLA 4ANCA 3MPWA 5HQMA 1RWXB 3Q8YA 3D6FB 1Q7LB 3DDIA 4EMDA 4CLSA 1U4BA 1RCXB 1N0UA 2J6UA 4NMLA 3BM7A 1FXLA 1S9GA 4NWBA 2QLFB 4K7QA 4IG3A 2QK4A 2EBGA 2QN6B 2WSCC 3MUMP 2AJ4A 1T05B 3M8SA 2YW2A 3M05A 4LQ3A 1LK5A 4OZNA 2IAJB 4RNNA 4ECQA 2RRBA 1RAFB 5I3UA 2BJ7A 4EUVA 1P27B 2YKMA 4NLTA 4LRFA 2FPHX 1FRLA 1Q16B 5T14A 5DM7Q 1RWNB 2XO6A 1FEHA 5JUMA 3OTBA 1KVKA 3TW0A 2KM8C 4MIWA 1SUQB 4ECYA 2CG8A 1FFSB 4EYIB 1RT5B 4DUZJ 3G82A 3KK1B 4R8UB 5L9NA 4HHJA 1Y7PA 4WTYA 4DR3J 4CT9A 4MYTA 5KFIA 3MM8B 3P45B 3VAFA 2NZCA 2GW8A 6FD1A 5BYRA 2CZ4A 4JV5F 2ACYA 4P71A 4IRCA 4ATNA 1VBZA 3AY0A 2WSEC 4ECXA 4DEZA 3LPEA 4OJ1A 1G4CA 2AIRB 3LWLA 1M5OC 4DR6J 2RIJA 3SFGA 2PC6A 3D68A 3ZZUA 5AXNA 4LRDA 2QA1A 2V8GA 4DQRA 1HBMB 1JLGB 4LR7A 2CPZA 2C28A 3UDCA 4KHPF 2B9WA 3W66A 2V2KA 1EIYB 5E3RA 1NJYA 1NPPA 4ZK7M 2CPJA 2ZH1A 3BO4A 2V67A 3TX8A 3TEHB 4NRTA 2XSFA 3ISND 3CPWR 5D0EA 5M2RA 1FRXA 1LWFB 3FZ2A 2OPQB 2V2ZA 2VIHA 3F41A 2P6SA 3N5FA 5GAEU 5CYQA 4HDGA 4Q2LA 4U7UD 4HEA9 4OYXA 3P5TL 4Y2CA 2RKIB 4FPRA 4FVCA 1SL0A 3M30B 4OV1A 1VRUB 1GXTA 5KT6A 1C1BB 1CVJA 1VCTA 1EQ0A 2BVZA 3AXKA 2BZ2A 3FBBA 5CD4H 2VC1A 4B3RJ 2PFFB 4DSKA 1Q8KA 2RMLA 3W5XA 4WK3A 1M5HA 2KL8A 5EUHA 2W7PA 1FVQA 1MMNA 1H7WA 1U1OA 3MAAA 1WDTA 3DLKB 5BYQA 1IBCB 2OPRB 2QZ8A 3NXZA 2XCPA 3T9ZA 4FYXB 4F36A 4IQXA 1HBNB 3G6YA 4ZP9A 1UA1A 3BGFA 2NXNA 4NEYA 1N5SA 4RW7B 1A6LA 1RYSA 2VBYA 4CLYA 2JX2A 5KFYA 2RB7A 3BKUA 4KKOB 4RPFA 3VGTA 1HWLA 3M2RB 4QIEA 1OQ3A 4KHMA 5L9XA 1B64A 1BQNA 2V63A 2YNGA 2E44A 3HSDA 1O5JA 4MKYA 2HK3A 4OX8A 3WX4A 1RUSA 1NB2A 3QZ7A 2VPYB 1RAOA 3H40A 2V94A 1S0NA 3M9MB 1J27A 5T7LA 2Q66A 3M8QB 4H4KC 4P73A 4W90B 2DPJA 3BF4A 1VLOA 4DL7A 3D4JA 3MMJA 1YJRA 3FQLA 2HFNA 2QV6A 2XYGB 4TYAA 4JI8J 5KFZA 3QSYB 3BGLA 4QBUA 1DBDA 4WFZA 2HZAA 5RUBA 4CTAA 4WCEQ 2CQDA 2Q6BA 3R7BB 1AROP 3BS9A 4JI0J 2A1BA 3SCJE 4OLPA 3CXCR 2C2OB 2VG6B 3A12A 1NBEB 2H1YA 1WWHA 2DNPA 3C19A 2Y0SD 5KFXA 4RR5A 2EKNA 3ISNC 1RBAA 3P4UB 4DR7F 3NOCA 4IRDA 2DCLA 3RB6A 3LUYA 3CJ2A 4LBPA 5GADI 2D3UA 4Z7CA 4Q0BA 4CLKA 1TL4A 4BWMA 2RDDA 1AZSA 1IR0A 3RW7A 4ZP7A 4OYMA 2OIHA 1XMQF 3PW0A 4XDCA 3H0PA 3PO4A 3BB5A 1VFJA 5CABA 3R5JB 4RX6A 2YWFA 3HZGA 2V8DA 5HLFA 2HNYA 2Z2MA 4C98A 1SC6A 5C7PA 2UVWA 1S0VA 1UWBA 2IM3A 2BBEA 4OI1A 2MB0B 3WIVA 1ACMB 2H5IB 1NKEA 3UE2A 5LXYA 2UXCJ 1QUVA 1YJ9S 4B3SF 1SC1B 1U25A 2BQ3A 2YNIA 3SBMA 2QMXA 2CDRB 4DFJA 4DCPB 2DISA 3LGHA 2CQGA 5HAOA 3MCNA 4G1IA 5I3QA 1U0HA 4DV4J 3I56S 4RW4A 5J2MA 1SV5B 3NBPA 1YK9A 2DNKA 1HNXJ 2XZTB 3SV3A 1S6QA 3RTVA 4ZKAA 4XPEA 3TA2A 4Z37A 3LWMA 3OXGA 5JMNA 2FTRA 2G2ZA 4RW9B 1F9HA 2QGFB 2GMLA 4RLEA 3FBEA 2CPIA 1VQLS 3CJ4A 3AH6A 2ZNYA 3OTOF 3W65A 2GAHC 5ETPA 3NMRA 1HLWA 4GO7X 2FVRA 4JYAF 3D6TB 1VK3A 2ZJPQ 1VGYA 1SJ1A 4UQTA 5K8PA 3W60A 4WFNQ 4LSNA 1JQGA 3FBCA 4OHYA 4OI4A 1Q1KA 4NZ7A 1B0PA 2HIQA 1J5OB 3H2UB 5CAAA 2B43A 2PEBA 4C8ZA 3LGNA 2XMTA 2EWHA 2VJUA 1Y5IB 2XS5A 2R7OA 3CE8A 2KJVA 3T5JA 4PAAA 4LVNP 1WI6A 5B7WA 3WZ0A 1REVA 3EJMA 2YNFB 5HJXA 4USMA 2LFVA 2RAQA 2E5IA 1NB7A 4ID8A 5CZVA 4ZJQA 3DM2A 2B5JA 1SKWA 5B0BA 3CWJA 4KH1B 2YWWA 1CBKA 1MN7A 1NSQA 4HH1A 4C11A 5KG0A 3DRSA 2LQJA 4B3OA 4NL5A 2HHQA 2M0GB 3UD5A 4YEAA 1H72C 2L9DA 4Z7YA 2O66A 2HAFA 5GAEI 3PR5B 4OI0A 2G1DA 3IR5B 1FX4A 3ICLA 3GPAA 3DRRA 2C2NA 4C9DA 4P52A 3SZ2A 2BE2B 5KOWA 2LDYA 2NXEA 1TFYA 3ELHA 1FWLA 1S1TB 3MFIA 1VR6A 1NK0A 2FHKA 3HT3A 3CJKA 1UCNA 3H5YA 2OMOA 3QAUA 1CJVA 2AU0A 4CLZA 4NLSA 1P8GA 4OZ5A 3GILA 2ZD1B 3MM7B 1W26A 3KLEA 1NK6A 4NZ6A 1U1MA 5KFOA 2YKNA 1YDLA 5BR8J 4O0IA 1RWMB 4OJGA 2RU9A 3LALA 3DU6A 1TUWA 2QA2A 1DQ8A 1LW2A 1S1UA 3PEJA 4LF5F 1HNWF 3UD3P 2EK1A 3DI6B 4FP9A 4UOHA 5BYSA 2CYYA 1QUPA 4USUA 4DQPA 4X62F 5HMWA 3P8BB 3U1NA 1SB6A 4EWTA 1FDAA 4LF7F 2VG7B 2CJYB 4GC6A 3FQKA 3DDKA 1S76D 5HQLA 2VG5A 3PTWA 1RI7A 4WE1B 2F3JA 2GQCA 3QT6A 3VWSA 3TAQA 2LU2A 5AE2A 2VBWA 3MEEA 4V19X 4QIGA 4JI6F 1BXNA 5J1PA 2PIIA 5EWGA 2MY8A 4HTIA 4ALZA 3ZTRA 1N36F 1HWUA 3KNAA 1CEZA 5A8RA 3QLHB 1RXOB 2FLPA 5B09A 1BY9A 4AD6A 2DXFA 1RADB 1RT3A 3NEKA 4NLOA 2C3MA 5F8NA 4ZVSB 2MJNA 2IC3A 2UXDF 4Q43A 1IUJA 2GVDA 3UR0A 2Y0BB 5K8MA 4NE9C 2R8IA 1FA0A 4JUZA 3IC1A 2CPYA 1Q5YA 3MDFA 2LXFA 4ILRA 5KG2A 1G6BA 2QL7B 5C25B 4CO4A 1NDKA 1VQPS 1LV5A 1KD1T 2AQ4A 5J1EA 4UUWA 1NCLA 3EGWB 3KFWX 5CYMA 1FKOA 2B7CB 3BN4A 1XEZA 4PZVA 1N54B 1XWLA 3EUNA 4NXNJ 2JWNA 2B51A 3HULA 3RRHA 1R8PA 1VS3A 2UUCJ 3VZIA 1NHUA 4MAKA 2XG8A 2KZZA 3OLAA 4W98A 3H8YA 2N4DA 1XBWA 2FD2A 3I4PA 1S49A 1RTHB 2BJ3A 4B3RF 4N5SA 1VHIA 5LMNJ 3T5HA 3R6GB 1B7YB 3M6WA 2HIYA 4X2BA 4IQMA 5AJ3J 1R0AB 2XNQA 4DR4J 1FVSA 5KG3A 4K0KJ 1BWEA 1HR0F 1JXLA 2ZJRQ 1JNRB 3GWCA 2ADBA 2A0FB 1R89A 3EPIA 4F3QA 2MKHA 4CI0B 4M5GA 1H2UX 5D78A 5ETKA 4CO1A 3SQOP 2BOAA 3CIMA 1RT7B 4C3LA 2GIFA 4K4YA 1F0XA 4O0NA 4PYDA 2OMLA 2YVSA 4ZLJA 4FBTA 3JSMB 4DS5A 2XTJP 2N7CA 3AOAA 1TL3A 5ITHA 3JQKA 4ZPTR 3GSDA 2JSXA 1MWYA 1RAAB 4Y2IA 1UZDA 4WU2A 3OFEA 4I6YA 4PXDA 1RAHB 3DYAB 4C48A 4ZOSA 2YKPA 2YKQA 2KG1A 3BBBA 3S7RA 5DGBA 2BABA 3RBEA 4DSEA 1Q86T 1IKWA 3R3TA 4EBDA 2IY5B 2OPPA 5J2PB 4OI2A 2KN4A 2XB2D 1WSVA 1CULB 2ASDA 1ZTWA 2V9KA 2F40A 4B9VA 1I6JA 1U26A 3N28A 1NLKL 1S5ZA 5EX0A 2HVEA 1KRPA 1U1KA 4USHA 4KT0C 3MOZA 2MQ8A 4WXWA 1S99A 4QYZJ 2GVZA 1U09A 4M5NA 2UUWA 3H4DA 3PR4A 1EP4A 4JV2A 3ET6B 3PZPA 4K50A 3SCLE 3MR7A 8AT1B 4KBIA 3JSYA 2LU1A 1BQMA 3G71S 2IFXA 4JB8B 4B9SA 3AXMA 3QT5A 3RZAA 1K1SA 1OS5A 4GVBB 2LXUA 4JI3J 5LMUF 1FJGJ 3GE9A 4NPOA 3M8PB 2HMIB 5THWA 1HNIA 4KH0B 1LWEA 3IO1A 3KLFA 4YB6A 1IBLJ 1X0PA 2QYCA 1RB0A 1B0VA 5HQ8A 2W2OP 2KVQE 3PYFA 2HFSA 1TU0B 2BV3A 5C24B 3KJVB 4AFFA 3QGPA 4YQWA 2XM3A 2BM1A 2LLZA 2DR7A 2G0CA 4KFBB 3RR7A 1VQYA 3VZHA 2VFRA 2WCXA 2RD5C 2IM2A 2AYEA 3N6NA 4DSLA 5KFSA 2A2CA 4QIWD 2VASA 2BJ9A 5DG8A 2GJFA 3OFFA 2C2RA 4FNIA 4OZ0A 2W9CB 2CZ9A 5DGAA 1UP1A 4M8LA 5ETMA 1YVFA 3AOBA 2Y3YA 3VQTA 3QATA 4DPUA 2HS4A 3V6HA 1MSWD 4X4QA 1F6TA 4FF4A 2RQ4A 4KSEB 4LFAF 1NSKL 1LEOA 1X4GA 1X4AA 3KK2B 1JLQA 4K4WA 1ZA1B 4U7UK 1X4DA 3HD1A 2YWGA 5J2QA 3VAIA 2QMWA 2QX0A 1U1LA 3QT8A 1NHVA 2HRUA 5H9EJ 3FMBA 1VC6A 2V4JA 7AT1B 4DI6A 1FD2A 3SQGB 3W7BA 1X5SA 1RU1A 3DRPB 3OR2B 1XMOJ 3D6MB 1PYTA 4EGLA 1S6UA 3CC7S 3X1LB 2J9EA 2QLJB 4JV1A 4A8OA 4A8XA 5EN1A 1LFPA 2QJ3A 2HHVA 3J7A1 1KHVA 4DS4A 2J7WA 5ETOA 4AQYF 1NKBA 4Q7AA 4DSIA 3W64A 4X66F 3KYLA 2VV5A 3C3LA 2G0IA 3RJMB 4DV2J 3D66A 1KNZA 3E2EA 1UEUA 2DNLA 2VBXA 1SPBP 2DYAA 1NDPA 1IQZA 2FDNA 1KHWA 2UUAJ 4CM0A 2HPUA 2DNHA 1XERA 3LW5C 3OVAA 1T3OA 5K8OA 1L3VA 3MMAA 3RU0A 4LRCA 3VV2B 4ZPCA 3I87A 2EKYA 3OQ2A 1VQ9S 4MMOA 2ZE2B 3V4IB 3IR7B 1S9FA 4M95A 2EEYA 3R27A 3IS9A 3QIPA 5H9FJ 4NOHA 2GO8A 1UVKA 4S0MA 2C3OA 5GMKa 2EW9A 4ZP6A 4DV3J 3FFIA 1Q95G 3NAHA 4JBCA 4O3OA 3OPKA 3EXYA 5KFMA 3Q24A 3H5XA 4ZIWA 1NO8A 2R7SA 1XJWB 3DHXA 2IA6A 4ZP8A 5AE3A 3MD1A 4AXIA 2F4VF 3ENWA 5DZ6A 1BLUA 4F50A 8ATCB 1D1UA 2YH0A 4C97A 2HYIB 1RTIB 1X0FA 2HQ3A 5ETTA 4IH7A 4HACB 3OSPA 4H54A 2XSJA 4ZLNA 4X84A 1EKRA 2JFKA 3QZ8A 2ZOFA 1RTJB 2ZOGA 1F9FA 4ZHRA 3M2UA 3NG8A 1JXVA 5L39A 5GMEA 4DFMA 2V2VA 1VMBA 3OFGA 1MROA 5DG9A 1C4CA 1RQ0A 2LQ8A 2DHGA 3CEDA 4KR0B 4WYWA 4I2QA 1S6OA 2H51B 1R0CB 2UZAA 1NK9A 4B3TJ 2R3VA 4EK2A 4BC9A 3POTA 3M7VA 1HD1A 1DTQA 3PYDA 3SDEA 3PFOA 1T7PA 3UD4P 3I0SB 4O4RA 1Q0NA 5D4OA 3KJQB 4KB7A 3PJ9A 2CRLA 4FNHA 4Q5VA 3C2PA 4DXLA 1TMMA 1UPPA 1TMJA 1BE4A 2B8PA 4J37A 3PJXA 2QT7A 3J7ZT 1CJTA 2YX1A 3QRPA 1VOMA 3DNCA 1ELOA 4NCAA 6AT1B 1QTNB 1PG5B 3R2DJ 3Q86A 3I0RB 2C22A 5AXKA 1LXJA 3J81U 2QE5A 2L48A 2BE9B 4OYOA 3SFUA 4NI2B 1IBKF 4U95A 2Q6CA 5D3GB 1VC0A 4OHXA 4DZ6A 1XN9A 2BANA 3MI7X 2BDPA 3BN7A 1KOOA 1TZ0A 1HHQA 4I68A 1RT6A 4ZVOB 4QZVB 3O5TB 4UOGA 2D3O1 2ZUAA 1K47A 2MLZA 2I38A 2DIVA 4PYAA 2QC3A 5DDRC 4TQSA 2LEBA 2YQ1A 5CHCB 1PCAA 1VQOS 2OEJA 4IFVB 3CD5A 5AT1B 4UTGA 1DQ9A 1VKZA 1HA1A 3DXBA 3Q89A 5IT9Y 3M2VA 1IXKA 2RUGA 4KV8A 4F3MA 1SXLA 3EICA 2DNQA 4OYAA 3ZFVA 2FVPA 4KC5A 1GSOA 3EGNA 3L7UA 3PW5A 1HHTP 2E1MC 1X4CA 4DR1F 4PG4A 3VAKA 2DCUB 2B9XA 2UUCF 4DL6A 2BUNA 4RW8B 3RGIA 3JYTA 4I2PA 1AZSB 1SC3B 1RT4B 4M5HA 2M70A 2AV5A 2NUHA 5HP1B 1U49A 1RWKB 3M8YA 1PJ6A 2CQCA 4DV6F 2HWTA 1AYEA 1N33J 4NZ0A 2RF2A 4DPXA 3PW4A 5KFKA 2HNYB 5HROA 2FUG9 3J7AN 1QM9A 1WKKA 4NXMJ 1IKXA 4DV7F 2EPIA 2RRAA 3IG1A 2DBBA 2N3OA 4EI2A 1NK8A 4QW9A 4P2FA 2BQUA 5IT4A 3JS9A 4B9MA 4J9MA 1XNRF 3IGNA 2EI5A 2E9RX 2E7XA 4ICLB 2A6MA 2KRBA 1T95A 4O3PA 5CYJA 1HQEA 3KLGB 1F3VA 4G1QB 2YRXA 1SL2A 3WBZA 4D3GA 5F9LA 2JRSA 4IO1A 1V9OA 5KFUA 3U7JA 1RTDB 3OL9A 2NSBA 2DXDA 2DY9A 3PACA 2BA9A 1WOOA 4HHUA 5IV3A 5DJBA 1I1GA 4CCHA 2AGQA 4JOUA 3MR5A 2MQOA 3NCRA 4DJBA 1HBUA 4CDIA 1MG7A 2KHDA 2MKYA 3CCZA 3GZ7A 2HURA 2RNEA 4B9NA 3W9HA 2VQEJ 5HBMA 4F0KA 2E29A 4MJKA 4NEZA 3G87A 1GH8A 3IM9A 2JOQA 1ZAXA 5F8IA 2AD9A 4K4XA 3N6MA 5D4NA 3M6UA 3CD6S 1S1VB 1K0TA 1LQ9A 3CC4S 4DV0F 3THVA 3HD2A 1S1XA 3BV8A 1E6VA 2ASYA 4WXOA 2W24A 1PYSB 1H73A 1YJUA 1HARA 2IMOA 1F5CA 3K89A 3PJWA 2GC8A 1N32J 2DY1A 4J9NA 3RBDA 3K59A 4K4UA 1YLXA 2FZGB 3FC9A 3G6ES 1FO1A 2VQFF 1M1KT 2EFPA 2HG4A 4PXBA 4X64F 2FLLA 3NNHA 1RT2B 5F8MA 3IXQA 3IGVA 1LXNA 3DRSB 4I67A 5H1SV 2DR5A 4LF9J 4PQUA 3US5A 1FNOA 1YRTA 2X3GA 2CNLB 2DR6A 5DLFA 5FLXY 2X7IA 1P1LA 3DRRB 2MZQA 4RBUA 3HHLC 2XS2A 4KPYA 4X65J 3V6DB 4Y2AA 4WF9Q 4LF6J 4OLOA 3OUYA 4N76A 2LA6A 1WEZA 2DRBA 2G2OA 1X9MA 3C16A 2B4PA 1URNA 3BQ0A 2EFQA 2DH7A 3DXSX 4K4SA 2E1RA 2YKNB 4N8NA 1E6YA 2MZRA 3W9IA 1WC6A 3HF5A 3IWNC 5L8RC 2CQBA 5A8WA 5GAHU 2ZBIA 4O44B 3VR1A 2OFHX 4TU9A 2AMCB 3EM1A 1H0HB 1Y3JA 1URRA 1HNVA 1L3SA 1D8ZA 5F8HA 2BOPA 2HNDA 1QAYA 4XPCA 1NH7A 2KT5A 3CCLS 4ECSA 4YHHF 2VOPA 5A0YA 4X4VA 5ETSA 3TQ1A 1GMVA 2ALZA 3ITHA 2CQPA 1QSLA 4OI6A 3CDWA 2F8EX 4XAKA 3Q2TC 1HMVA 2JZ5A 2DR8A 4LT6A 8RUCA 2D3ZA 3T9NA 1WUUA 2JC1A 1FERA 1CQNA 1Q79A 3CB4A 3E01A 1QVFR 2OSRA 4F2SA 2B3TB 3G8SA 3VQSA 2CVIA 5A8KA 1DURA 3TAMA 4RUHA 2BMBA 4ZCIA 1RBOB 3Q8RB 4RNMA 3G96A 4A8SA 4ZCLA 4UF4A 2AJQA 5J2NA 4JI7J 2FY1A 2DGWA 4DLGA 2POKA 1WOPA 1HI1A 2HFUA 5L1KA 4DV5F 2LKZA 4X4SA 3KJNB 3EVWA 4M5DA 2GVDB 2LMIA 2YKOA 3FSXA 3FUYA 1LFWA 1YJVA 5J1NA 4DX6A 3OFHA 3FEZA 3T3FA 1M5KC 2ROEA 1SJ3P 2RUSA 3RR8A 3BKFA 5IWAJ 2F9JA 5L1IA 2FHMA 3DOKB 3ZZYA 4FF1A 4JI4F 2PI5A 1JJCB 4YB1P 2OLWA 5D77A 4USVA 4EZ9A 2H4YB 1Y3KA 4DR5J 1ICEB 2KB2A 4I56A 3B8HA 4DZDA 2V8VA 5D4PA 1KLMA 1QE1A 1FX2A 2IBKA 4J90A 4DF4A 3NNCA 3J80U 1J5EF 2YPZA 5E5NA 4AL6A 2P9CA 3UDVA 3CIZA 3ZZZA 2RQMA 3Q23A 1HBOB 1MU2B 4ERDA 2CJBA 1CS4B 3CCUS 4AYBD 1AT1B 1RLDA 1N5YA 5JVHQ 5CCMA 1RHRB 1YHQS 3TRGA 3IR6B 4HKQA 2L08A 3W2WA 1D9AA 1UMJA 3A8IA 2MXYA 1A7GE 1VRQC 3KG4A 4ZVTB 5T41A 2OH2A 2Z8QA 1U48A 1H2VZ 4CRJA 4QWEA 1U1PA 4LR8A 2ATCB 1WHVA 1FRMA 3IN5A 3GQCA 4OHWA 3G8TA 2XMWA 4LBIA 3GTYX 1JLEB 2HFVA 2LDIA 5SUHA 5LT5A 4IDKA 1TL3B 5IQQA 2GHPA 1T9YA 4IRKA 4JV0A 4QR0A 2P5VA 2GMHA 3MM5A 2A3JA 4L72B 3ILIA 3UN5A 1NK7A 1N52B 2CPXA 2CNNB 4BS2A 2V69A 2KXHA 3PCOB 1K44A 2MLYA 3MJFA 2QL9B 2QTWA 1QAXA 2I5JA 1KVJA 2K1RA 4IOAQ 4JV5J 1U45A 2BQRA 4XK8C 2EK6A 2G0JA 3M32B 1OYDA 4ZPDA 3L9ZA 1G7CB 1TVRB 2DHXA 2VF3A 3E51A 2DGSA 2V50A 2BRLA 3W5ZA 3K2YA 4BLGA 1R8CA 3D28A 3QQCD 1EP4B 3RW6A 3PV8A 4MH8A 4O4GB 2FJAB 2NS1B 4A8QA 2OO4A 1EJ7L 1T03A 2ROGA 4A8FA 4KHPJ 1XNQF 3JAMU 3CDUA 2YKAA 4ZPVR 5K8NA 3GIRA 4PABA 1T11A 1FE4A 3DLHA 3M1VA 4DG1A 1T02A 5LSRA 4J9RA 1N88A 2C42A 1HNIB 4ID5A 2WVDA 4ECWA 2R2RA 3H2LA 4LF4J 3MPYA 2QFJA 3IWLA 1EZZB 1QY7A 1PKUA 1WG1A 3IRXB 1RU2A 1OYEA 2ATLA 4IR9A 3NGUA 1R43A 4LFCF 4ZVQB 3MEDB 1TQLA 3H90A 1S4FA 5K14A 2EC0A 1ZS6A 1FHTA 3D5MA 3TYTA 1C0UB 1NNDA 2COLA 2BW2A 1WC5A 3MTKA 1JKHA 2IMWP 5IOLA 2GO9A 3TAPA 1NMEB 3I55S 3JQJA 1FKPA 1FNXH 3HHDA 4ZCKA 3CJ0A 5IM0A 3GCWP 3ZZPA 4EFAC 1N5QA 4PR6A 1C0TA 2XBPA 4FF2A 3LGMA 2GCFA 2BYCA 4EO8A 5ADZA 3BBFA 2VUGA 1JLCA 4BWJA 4LF8F 2HNZA 1CLFA 3B78A 3OD2A 3PEHA 3KUGA 2DPIA 2R2UA 3TI0A 4OMFG 4JI1F 3ADAC 3C14B 1VRTA 1SJQA 4QYRA 4YS2A 4MK9A 4CWBA 1HQUA 4BDPA 1C4AA 1R31A 3V81A 1FK9B 2Q43A 3OV7A 2KU7A 1RT1A 4LMZA 1HKAA 4B17A 1EKSA 2D3OR 1ZM3A 2GGPA 1KC8T 4Y00A 3MCSA 4FYYB 4OQJA 5CD4A 4N56A 1SH2A 5K5MA 3M8ZA 1TV6A 1V3RA 3CNQP 2MSTA 3G6VA 3QWUA 5KAKA 2R7RA 2RQKA 4F02A 1WC0A 2ZH2A 3MM9A 2H3EB 3CMES 3KTQA 2K06A 2JH3A 3AQPA 3QJLA 2O67A 1TKXA 3P5BP 3ZTPA 4TNOA 4DSFA 4N41A 4LSLB 1GFWB 4HHHA 2MMYA 2OUGA 2K3IA 3ZZOA 1VIOA 2AEMA 2KKHA 1SVDA 2ZUGA 3WHIA 2E1PA 4G65A 2O3DA 4OYZA 4DCOB 4Q8EA 1ZPWX 4IG0B 2ABYA 3IS9B 3IMQJ 4I4BA 4DFKA 3UWTA 1QSSA 4DR7J 4K4ZA 3GG0A 4ETZA 2HHHF 3EZ5A 3M9NB 2OJ3A 3O1LA 1XC9A 2ZFHA 4NLQA 3A8JA 1VISA 4ELTA 1UFWA 5G0RB 3UVJA 1XMQJ 3QGIA 4C3MA 4BCAA 2ZJQQ 2AEJA 1CJKA 3CTRA 2MJUA 2KI2A 2OEMA 3C66A 1YZ6A 3W61A 4C3KA 4IR1A 1WTBA 4KRWA 2W25A 2CJ9A 3RB3A 1D3WA 4ER8A 4R5PA 1NSPA 3UR3C 3M6VA 2YS6A 3BKTA 3HXMA 1T9XA 5HL7Q 1Q8IA 2B56A 2JLEA 4P74A 3K5PA 3CT9A 2MGZB 4B3SJ 5IV4A 1RKIA 1JIHA 1JNZB 3TWZA 2QYGA 1U2FA 5KFJA 1IR2A 3CDAA 5HMZA 4J5OA 1WOSA 1KTQA 1S0OA 2V0NA 1DLOB 3SDEB 3R5CA 1ZM2A 1QD1A 3VGSA 4H4KA 3BDEA 1FXRA 1S10A 2XMMA 2Z2ZA 5C2GA
chains in the Genus database with same CATH topology
3G4SS 2M2BA 3CIMA 1RT7B 1RP5A 4RW8A 2IYIA 1DHMA 4NCGA 1M90T 2QEXS 4C3LA 2BRKA 1VQSA 4H4MB 4K4YA 1F0XA 3KHRA 1RT4A 1GQEA 1NK5A 1FXDA 1R8BA 2OMLA 1HD0A 2YVSA 4WFAQ 2KFYA 1JLFA 3S6EA 4CTAB 3MAHA 5HP1A 4FBTA 3JSMB 3VCDA 4DS5A 2N7CA 4E98A 1TL3A 3H98A 3O2IA 5ITHA 4IOCQ 1SKRA 1WACA 4ZPTR 1U8SA 2JSXA 3GSDA 2W4PA 1MWYA 3OTDA 4D3HA 1TK8A 2FJEB 4Y2IA 2GIQA 1Q53A 1V3SA 4WU2A 4OX9F 4CO0A 2WHOA 3OFEA 1HPZA 1TKZB 4I6YA 4PXDA 3DYAB 1YTYA 2CQ1A 2XZWA 2X1BA 1Y00A 1B0TA 1S1WA 1K9MT 1KLMB 4KTQA 4QIFA 4YDDB 4B3TF 4ZOSA 4YUDA 4TY8A 3V4MA 1QE1B 4DQIA 2YKPA 2JVOA 2YKQA 2DO4A 2YWHA 3BGUA 3MD3A 1RYRA 4X4TA 5BJRA 4K4TA 2KG1A 5M2PA 3CCRS 3OR1A 3HKWA 4URGA 2PA8D 1WTFA 2SXLA 2ASJA 3S7RA 5DGBA 2JVRA 4QIVA 1IJEB 5KFHA 2BABA 3RBEA 3JSBA 2MDAA 4DSEA 1Q86T 1RA6A 1IKWA 3R3TA 4EBDA 2OPPA 5J2PB 2IM1A 3LP0A 4OI2A 2DHSA 2KN4A 2XB2D 2JEIA 1JLAB 4Y65A 2GNKA 1TL1A 4MIAA 5KFCA 2ASDA 1ZTWA 2V9KA 3IAS9 4ZPBA 3MUTP 2E1AA 2F40A 4B9VA 1I6JA 1VQ8S 3V6JA 1N5YB 1U26A 3N28A 2DGQA 3PX6A 2DT9A 5KTQA 4Q0BB 1J2VA 4DQQA 1DFDA 1JMTA 5EX0A 3FGVA 1VC5A 4ZPAA 1VQKS 1WEYA 2I0XA 1AFIA 2LQBA 5FIIA 2DGTA 2M5YA 5DDOC 3J7YU 4I1TA 1KRPA 4ICLA 3O44A 1EETA 4QU7A 1KVIA 1U1KA 4USHA 2IVMA 4KT0C 3MOZA 2ZH3A 2XY7A 1IM4A 2IJFA 2HFZA 2PEHA 2B4OA 1U6FA 3I96A 3W2WB 3KLGA 4RWWA 4WXWA 1UL3A 1S99A 4G1QA 4YR2A 4QYZJ 4TN2A 4F3OA 2KH9A 3MAQA 1PILA 4USIA 2RRNA 1GNKA 3AB4B 2GIRA 1U09A 2DNNA 3L09A 2HW3A 2UUWA 5KT5A 1W2BR 3H4DA 3KKFA 3PR4A 5KFFA 4O3SA 1EP4A 2RSQA 4MK7A 4JV2A 4PWDA 2HGMA 1RTDA 5KFPA 4NLGA 5B0DA 5HLFB 5IS2A 3OXFA 4C7QA 3PZPA 4K50A 4OHZA 3SCLE 4F4XA 5GADU 1WF2A 1LK7A 4Y2KA 1L3TA 2CPHA 4KBIA 4RNHA 3JSYA 2JEGA 2LU1A 4HVZA 3GIMA 1BQMA 3G71S 3EX7B 1KN6A 2IFXA 4F25A 4B9SA 1WNEA 1UWBB 2W8LA 1AUDA 1T05A 1J5OA 3RZAA 2M8HA 1CPZA 1K1SA 4I2PB 2M7SA 1U1RA 3BEGB 2IAJA 4N77A 2YY3A 1OS5A 1K8AT 3FVYA 3RRGA 2GQ2A 2JFDA 2LXUA 1VBYA 1WEXA 5LMUF 4IDKB 3GE9A 5D8HB 4NPOA 3M8PB 2HMIB 3D1OA 4F2RA 5THWA 1HNIA 4NLVA 2R7WA 1H98A 1LWEA 2MZSA 3QO9B 3EGZA 3IO1A 3KLFA 4OI3A 4YB6A 1CC7A 3MM5B 1X0PA 2QYCA 5HQ8A 1B0VA 4F4WA 3T19A 4IFYB 3MEGA 1FDNA 2YNIB 2PT0A 2I2YA 5DDPC 3PM9A 3A1YG 1K0VA 1ZAVA 2JEJA 1SUQA 4WU3A 1ZOTA 3MURP 1JJ4A 2UU9F 3G6XA 2BV3A 2E66A 1Q8LA 2HWIA 5C24B 3KJVB 4AFFA 2GHVC 3QGPA 1S1VA 4YQWA 1L3KA 2BM1A 4R0JA 4U6PA 2UUTA 2XHWA 3SSSA 2LLZA 3IWXA 3KK1A 3TA1A 3CCVS 2DR7A 2K8GA 2G0CA 4KFBB 4R8UA 2WB1D 4RW4B 5J2MB 1TKDA 3PHEA 3CMAS 3RR7A 3GB0A 5KFWA 4KHRA 1VQYA 2FJBB 3FSYA 2VFRA 3VZHA 2YNHB 3KK3B 3MM8A 3NBPB 3RYLA 5DETA 2WCXA 5SZTA 2RD5C 2I5JB 2IM2A 4FN5A 2AYEA 2X1GA 4Y28C 4Q45A 3UW1A 5KT7A 2KVIA 2K1RB 2M52A 3ENQA 3N6NA 2A2CA 5KFSA 4DR2F 2FLNA 2J6TA 4DSLA 4CNZA 1UETA 3DMJB 4QIWD 1S6QB 2F1FA 2VASA 5B0CA 4QWAA 4IYQA 4LVOP 5DG8A 4ELUA 2R7UA 5EX3A 1UA0A 3F56A 5KFQA 5HI7A 3OFFA 2XMKA 3N6LA 3NLCA 3H5UA 2PN6A 2C2RA 2HHXA 5EDWA 2N7YA 4FNIA 4OZ0A 1NJIT 3FRZA 5KT2A 2W9CB 3W3SA 3CCES 1S6PB 1N6QB 4I7FA 4QQBA 3SYZA 5DGAA 2C3PA 1UP1A 4M8LA 4B9LA 1UVMA 4HT5A 1YVFA 1XR5A 2HS0A 3DLGB 2Y1JA 1ZZNA 5C5JA 4WFXA 4TQRA 4EEYA 3VQTA 2J6SA 2OAUA 3MMBA 1N33F 3GFHA 2HS4A 3GV7B 3M6XA 1S1TA 1KSPA 1SH3A 4P2SA 5KG5A 4CZCA 1VHFA 3V6HA 1SIWB 4X4QA 1MSWD 1RT2A 5E3QA 5MLCV 3GIKA 3AHPA 4FF4A 2RQ4A 2WBMA 4KSEB 4LFAF 1HBMA 4LSNB 4U9RA 4DDFA 1JLGA 1O51A 3QGGA 4NXMF 4LJMA 1T03B 1X4GA 3Q2SC 1X4AA 4YFUA 3OJSA 1K73T 1FCAA 3KK2B 1JLQA 4K4WA 2ZKUA 3QIDA 1F5BA 2XC9A 3LP1B 3MFHA 1KFDA 1S79A 2CFXA 4MK8A 2MKIA 1WD6A 5I42A 4U7UK 1X4DA 3HVWA 2FVSA 4RKUC 4RUAA 3GV8B 4YOEA 2YWGA 3HM9A 3PX4A 3C6UA 1JX4A 4WKRA 5J2QA 5E3PA 3VALA 3VAIA 2QMWA 4NYPA 4UUXA 1VQ5S 1HYSA 1U1LA 4ID5B 1H3DA 1M5SA 3T6BA 5HBMB 5KFDA 1NHVA 1OSCA 4FS1A 2HRUA 3SXLA 3LOUA 3V6DA 4DSJA 5H9EJ 1N56A 2ZKTA 2J9CA 3OSNA 2G13A 1VJWA 3FMBA 3TVZA 5CA5A 1VC6A 2V4JA 1HNZF 4XIUA 3L95X 5GAHI 1FD2A 3TUZC 3SQGB 1LWCB 1S9EA 3W7BA 1REVB 3HDSA 4MFBB 4DBQA 2DGOA 1LWFA 2HQIA 2VFUA 3CCMS 2PE8A 1X5SA 2Y1RI 3MR6A 3CCQS 3MWBA 1NH8A 4WFYA 2XI2A 4DL2A 2OPQA 3DRPB 3OR2B 4Q8FA 3PO5A 5K14B 3FMWA 3X3UA 5G4DA 2P9GA 4KO0B 2CQ2A 3LH2S 3SV4A 2WB4A 2DNYA 4EGLA 1S6UA 7FD1A 3DM2B 3CC7S 3X1LB 4KIAA 1RA7A 1G2EA 2J9EA 2B5JB 4OIXA 2VG7A 6FDRA 3V6KA 3HVRA 4A8OA 4JV1A 1JKHB 1YI2S 4A8XA 2ZH8A 1BQXA 4ZPWR 5EN1A 1LFPA 4CIOA 1XK8A 1SIZA 1S0MA 4E8UA 3M30A 2HHVA 2FVQA 4C11B 2HZCA 3J7A1 2VB6A 1KHVA 3MEKA 2KFNA 1FKPB 4DS4A 4B3OB 2J7WA 3J81Y 2UUBF 3KLHA 4AQYF 2FJVA 1NKBA 4O44A 4Q7AA 2I1RA 4DSIA 4ES3A 4NLDA 4X66F 1DRZA 2H5EA 2ZITA 5IM0B 3KYLA 4ED7A 2VV5A 3IAM9 3N4WA 4PPZA 2HHTA 3C3LA 4G1PA 3PDNA 2KTQA 3VF0B 3UQSA 4IH6A 1C1CB 3JSRA 2VQEF 3PY8A 2G4BA 1KNZA 3GR0A 4G3IA 2OSQA 3UDLA 3E2EA 1UEUA 4LF4F 2DNLA 4CNYA 2VBXA 3I82A 1ZTTA 4F8RA 3HHNB 5C42A 4CH7A 1IQZA 2FDNA 1F60B 2QLXA 2UV8G 3O8WA 3QLHA 4HI2A 2KHCA 1KHWA 1N34F 2D9OA 1FRKA 2HPUA 3NGKA 2DNHA 3JB9k 1XERA 3QJPA 2GQQA 2ZBCA 3CJKB 3PKMA 3LW5C 3NS6A 2QSWA 2G9OA 3OVAA 1T3OA 4IUFA 2KM8B 5HMYA 1HWJA 3MECB 5K9FA 5K8OA 1IN0A 2WK4A 3MMAA 3RU0A 3DLKA 4DUZF 1L3VA 1YJTA 2D9PA 2CJQA 4ZPCA 3I87A 2J0QD 3BGRA 1DZ5A 5E41A 3CF5Q 2EKYA 4H4OB 4RU2A 3GG1A 3OQ2A 1S72S 2IBOA 2OPRA 4DR3F 1VQ9S 3KLEB 2VKRA 1R6YA 4MMOA 2ZE2B 5F8JA 1JLBA 4AUKA 3V4IB 2EVZA 3IR7B 1S9FA 1HBNA 2Z4PA 2K2PA 4M95A 3R27A 3IS9A 3VAHA 2AYBA 3QIPA 1VRTB 4AL7A 5H9FJ 4NOHA 2GO8A 1NU4A 4RW7A 1CG2A 4RBVA 2MQLA 4ZA1A 1UVKA 2C3OA 5GMKa 2EW9A 2QA4G 2F9DA 2DGUA 4ZP6A 2PSZA 3MMCA 2VFTA 1RWUA 2V8HA 1LW2B 4J9PA 2VPZB 3FFIA 4B9UA 1UJ5A 2HHWA 3NAHA 1ROFA 3OTCA 4JBCA 4KKOA 4PXEA 1HQUB 1S1UB 4ZLPA 4O3OA 1N32F 3OPKA 3EXYA 3MTJA 2AW0A 4MYUA 2J9DE 5KFMA 2V9WA 2ZZNA 3Q24A 5CH7B 3K8WA 3M2RA 3H5XA 2AJ1A 3V81B 1HI0P 3GV5B 4JI5F 2HGNA 1NO8A 3I32A 3CJ5A 3K5NA 2E7WA 3OVSA 3KLVA 2AX1A 3DCAA 1KLNA 2R7SA 2GJ2A 4PG5A 3DHXA 2IA6A 1RT1B 4ZP8A 3NMAA 2J0XA 5AE3A 3MD1A 3QPIA 4AXIA 4KE5A 2F4VF 5DS7A 5F8LA 3ENWA 2VA2A 3DRYA 4BC7A 2ZC3A 3OLBA 3CDEA 4DR6F 4IKAA 5B0FA 5A2QY 5KG4A 3G8QA 1BLUA 2CZVC 1TK0A 2WOMB 3MR2A 4F50A 3S8SA 4CO5A 4PKDB 1D1UA 2GGPB 2MYFA 2YH0A 1CC8A 4C97A 2HYIB 2IYGA 1RTIB 3HVTA 2M4MA 1X0FA 2HHSA 2HQ3A 1E6YB 2KYXA 1FTRA 3N01A 5FDLB 3KG1A 2W4DA 4KJIA 3N0VA 1YBAA 4C8LA 4Y0FA 3M8QA 3OL6A 2IVFB 1HI8A 1TV6B 4IH7A 2NR0A 3OHBA 3BREA 3OSPA 2E5HA 2VG5B 2WRMA 4H54A 4UQGA 2PA3A 1UW4A 2MHNA 2XSJA 2OTJS 1WHYA 4X84A 4LF9F 5KT4A 1Q8BA 2B4UA 1OO0B 3WDOA 5A6PA 2L41A 4EZ6A 1G1XA 1UVJA 2JFKA 3MEEB 4RW6A 3QZ8A 2ZOFA 1VQ6S 1UFLA 1H2TZ 1RTJB 2AWZA 3DOKA 3T5LA 2OD6A 3MM9B 2VC0A 4O3NA 2AJFE 3I5CA 5F3ZA 2ZOGA 2JC0A 2W7OA 1F9FA 4ZHRA 4A46A 4X65F 3M2UA 3NG8A 3R5DA 4IH5A 4M1KA 2UXBF 1APSA 5L39A 4LF6F 5A8RB 2XLIA 4DFMA 4ILLA 2DNRA 2NUUG 3ITHB 3W2VB 4F4YA 1R7IA 2BJEA 3MF5A 4DQSA 2XNRA 1VMBA 3FDSA 1Y5LB 4FXVA 3OFGA 1MROA 1RT3B 5DG9A 4K5RA 3KHGA 2VPWB 4ED2A 1C4CA 1RQ0A 3BSCA 5GAGU 2L3MA 3MGJA 3CC2S 3FZBA 2DHGA 1TFWA 3CEDA 3I5AA 4OZLA 4KR0B 2KFZA 4WYWA 1IKVA 4I2QA 1S6OA 3BO2A 1QAIA 1I94F 1VK8A 2QRRA 2UZAA 3RAMA 1NK9A 2ZOMA 1TUVA 2IC3B 4BC9A 2VG6A 3P6YC 5KG1A 4J9SA 2MQNA 3POTA 2FGCA 1HD1A 4RUCA 5DLGA 2XGPA 1JJ2R 3PVXA 4CQ1A 1NEEA 2CDQA 1DTQA 2CVEA 2JDJA 2HGLA 4ZCMA 4DL5A 3SDEA 3PFOA 1HBOA 1MU2A 1T7PA 3UD4P 4NLPA 4CO3A 3U1LA 1WG5A 2LEAA 3I0SB 4O4RA 3K58A 5D4OA 4KB7A 4A47A 1SBRA 3DOLA 4DL0C 4OJ3A 1YSJA 2CRLA 4OZJA 4FNHA 4P7VA 4R0EA 1FTCA 4Q5VA 5DG7A 1NJZA 3IRWP 3C2PA 4I6WA 1KQSR 1TAUA 2RS8A 4J9QA 4X4NA 4J37A 3PJXA 2QT7A 2KYZA 3J7ZT 1N4LA 2YX1A 4FS2A 1D8YA 1VOMA 1SL1A 3DNCA 4MTPA 4QU6A 1ELOA 1LW0A 4NCAA 2C2DA 1UKUA 1UVLA 1HL6A 4QJVA 2MKKA 5J1EB 3FRYA 2DGXA 1W25A 3HVAA 5CYMB 3QYYA 1FKOB 3CCJS 4W92B 2UVRA 2B6AB 3I0RB 1U2RA 2ZH4A 2C22A 1WHXA 3ZZ0A 5AXKA 3CSKA 4ES2A 1GXLA 3DOMA 3D0IE 1LXJA 1TP7A 3NKYA 2QE5A 2L48A 1RKJA 1TKZA 3DYAA 5KFTA 3SFUA 1FE0A 2NPFA 3VAGA 2MZTA 1X5TA 2BR0A 4TYBA 2W9BA 2YX4A 1M5VC 4TU7A 1IBKF 2Q6CA 3J7YI 2AJ0A 4RNOA 1L5UA 4YR3A 4WK1A 5D3GB 2EG1A 4QWCA 1VC0A 5B0AA 4OHXA 3T5KA 1FF2A 1PGZA 5JJBA 1XN9A 3GYXB 2BANA 3MI7X 2BDPA 2HLUA 3BN7A 2JLGA 2E9ZA 1KOOA 2ZDPA 1O0PA 2EFGA 1TZ0A 2N4CA 2ZH9A 1N0VC 5F3TA 3LP2A 4ES1A 4I68A 3D1HA 1RT6A 1DQAA 5E0OA 1JLEA 2CQ4A 1YJNS 1X5OA 1JLAA 1Y9OA 4QZVB 4QWDA 2K7JA 3O5TB 3HPOA 2XMUA 2I38A 3DU5A 2CPFA 2DIVA 4N47A 4JI7F 4C8NA 5DDRC 3AJ2A 1U7LA 1C2PA 4TQSA 2LEBA 3TO8A 3EPGA 3DDNA 2OP5A 5CHCB 3MPVA 5E33A 2DK2A 1VQOS 2R7TA 4IFVB 3CD5A 1Y4ZB 3TA0A 3EZUA 3NCPA 1S48A 2LYVA 3MZIA 1DQ9A 2YX7A 5EHHA 3AJ1A 2FC8A 1D9DA 1HA1A 3DXBA 2DIUA 5IT9Y 1VQ4S 3THTA 2YH1A 3M2VA 2DJWA 2P9EA 3H2VE 1IXKA 2RUGA 1D9FA 4KV8A 3LO3A 3RRKA 4F3MA 1SXLA 2LXIA 1FESA 2Z2LA 4ZVGA 4XDDA 2AP6A 2DNQA 3ZFVA 2FVPA 4KC5A 4G6VB 1SV5A 3EGNA 4DOZA 4HLBA 1LOUA 1Y0HA 4C8KA 1V3ZA 3WC0A 3PW5A 1HHTP 2E1MC 1X4CA 2X1AA 3TP2A 4DR1F 4PG4A 1T8EA 2EFVA 3VAKA 2VKZG 2DCUB 4PG8A 2B9XA 3UPFA 2MQPA 2P6TA 3JTOA 2ZH6A 5IWAF 2UUCF