1SB6A

Solution structure of a cyanobacterial copper metallochaperone, scatx1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords copper chaperone ScAtx1
publication title Solution Structures of a Cyanobacterial Metallochaperone: INSIGHT INTO AN ATYPICAL COPPER-BINDING MOTIF.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sb6A00
1P8GA 2W4DA 2QYCA 3I9ZA 1OPZA 1FE4A 2AJ1A 2BYCA 2ROGA 3MCSA 3GZ7A 2AJ0A 1Y3JA 2XMMA 2XMUA 5F0UA 1VQYA 5B0GA 2ASYA 3HHLA 4NL5A 2IYIA 2FTRA 3FRYA 5B0AA 1CC8A 4HI2A 1TR0A 2HFNA 1KVJA 2N7YA 2OMOA 2N4CA 4A47A 4ZA1A 2AW0A 2GGPB 1YJTA 2BUNA 4Q2MA 1FVQA 3HFKA 3HHLD 2PD1A 4QOTA 2HLTA 5IXUA 1CPZA 2GFFA 1TL5A 1URRA 2QLWA 4NPOA 2ZDPA 2OP5A 3T9NA 5KAKA 1Y9OA 5B0EA 4DL0C 1V3ZA 1YJVA 2RU9A 2PGCA 5B0BA 5T7LA 2LQ9A 2OFHX 4A48A 5F0WA 1N5SA 2OKQA 4EFAC 4HL9A 1AFJA 3TNVA 2FIUA 2W4CA 4Y2KA 5B08A 3BN7A 2BBEA 2RMLA 3WDOA 1AFIA 1XBWA 2OAUA 2OD4A 4U9RA 5T7LB 3LO3A 1FESA 3KG1A 2GGPA 4YDXA 2JDJA 3F44A 2XMJA 2VV5A 2LQBA 2KYZA 2OD6A 1P6TA 2FHMA 3HF5A 4HH1A 2GA7A 3LGNA 2HIQA 3HHLC 1Y3KA 1N5VA 1S6OA 3BM7A 2K2PA 2ROEA 3BDEA 2W4PA 4DN9A 3QGPA 2IYGA 1GXUA 4F67A 1FEEA 2XMTA 3FGVA 3DXSX 4Y2MA 1Q4RA 3BB5A 1X0PA 1Q8LA 1TUVA 2RILA 2KT2A 2EW9A 2ZDOA 2XMKA 1W2IA 5B0FA 3IWXA 3MZIA 2GCFA 4OJHA 1MWYA 2FB0A 1FE0A 1WD6A 3IWLA 2BJEA 3BF4A 4OJ3A 3KNGA 2L3MA 3HX9A 2IFXA 4FNIA 3TRGA 1IUJA 1X7VA 3DCAA 1AW0A 2HLUA 2K1RB 4HH0A 1OSDA 1R6YA 1QUPA 1YJUA 2LDIA 3VTIA 2HFOA 4DPOA 1JK9B 1X8DA 2HQIA 3BGUA 3BR8A 3E8OA 2XMWA 3UDCA 4OIXA 1OQ6A 2QIFA 2RSQA 4FNHA 3KG0A 1TL4A 1YG0A 1SB6A 2LXFA 3KKFA 4HI1A 1RJJA 2OFGX 3CJKB 4YEAA 1S6UA 4ZOSA 2CRLA 2VH7A 3FMBA 1FD8A 4Q2LA 1KVIA 5B0DA 2XMVA 2ROPA 2K7KA 4OJGA 1LQ9A 2K1RA 1Q8BA 1TZ0A 1N5TA 2Q3PA 3LGMA 5A6WA 5B09A 2KT3A 1APSA 2AP6A 1SQEA 2GV1A 1KQKA 2QLXA 3HHLB 2K7JA 5K9FA 1OQ3A 2BJDA 3K7RA 1FVSA 3TOQA 1N5QA 3HDSA 1CC7A 1JWWA 1K0VA 1Y0HA 1VQSA 2ACYA 2N4DA 1MWZA 1SI9A 4A4JA 3CJKA 2G9OA 2KKHA 2GO8A 1YRXA 4A46A 1U7LA 3QMQA 5A6PA 4Y2IA 1YJRA 1ULRA 4OJ1A 1GXTA 1Q53A 5B0CA
chains in the Genus database with same CATH superfamily
2HBZB 1K8AT 1CJKA 4ZLNA 5J1EA 2JH3A 4LF9F 3HHLD 2PFFB 2W2PP 1QAIA 1SQFA 3AJDA 3J81U 2XLIA 2AHOB 1AFIA 3R5DA 1U8WA 2ZJPQ 3I32A 4TY9A 4OX9J 4PQUA 1EAYC 2HK2A 3VALA 1HL6A 1FDBA 2V2ZA 4CLPA 4TLRA 4LR7A 5C2GA 2B9WA 1WKKA 1X5TA 2XWYA 5FLXU 1B64A 4JI1J 4EO8A 2Z2YB 3IMQJ 1Y4ZB 1XERA 3I31A 3W5YA 3MAAA 3DI6A 4YR3A 4K5SA 2HBYB 4KH0B 4TVAB 3KYLA 1Y0HA 2W2OP 3C2PA 2HHQA 1WF0A 2HFVA 4M5DA 1IBLJ 4PABA 3ZFVA 1N5YA 3EWGA 5FJ4A 3UCUP 2O01C 4DSLA 2Y0SD 4ZKAA 3GYXB 1IJEB 2Z2MA 4ER8A 1S1TA 5KG6A 2XM3A 1ROFA 2LLZA 2V94A 3CJ4A 3HSGA 4F3QA 4MJKA 3BO3A 1FJGJ 1M1KT 1H3DA 5DDRC 4IQMA 3QFHA 3B54A 2HIQA 2A2DA 4MKBA 2EFGA 2VICA 2CZ4A 4Z37A 4NLSA 1S9FA 2HHTA 4LF4F 4LREA 3ITHB 2V2QA 3W9HA 5E0OA 2W2NP 3BYPA 1HR0J 3CDEA 2R8IA 2LDIA 3QLHB 4IH5A 1MN9A 2HFOA 4F0MA 4LVNP 3OVAA 1T3OA 4DV5F 3GYGA 4NYZA 3TVKA 1Y10A 3HJFA 1U6ZA 3HSJA 1N5QA 1IQTA 3D3CJ 3MPVA 2LA4A 5KFFA 2DK2A 3GV8B 1W26A 3TX8A 3PJ9A 2Y1LB 1TFWA 2J6TA 2KH9A 1P9QC 1MROB 4P72A 3GJQB 4ECZA 3GLJA 2AYGA 3NNHA 5KG1A 1DJ0A 1TL5A 3V6KA 4IKAA 4OYAA 3M32B 2C2RA 2LQ9A 3CO0P 2XZWA 3KUHA 1VJQA 2QV6A 4LF5J 3M8QA 4DUZJ 2GZOA 2B5JA 1PJ7A 2MKCA 4JV0A 2XNQA 2V0NA 2MLYA 5CABA 1Y5LB 2IHR1 2HAFA 3FCWA 1R8AA 1FT8A 1HIYA 4WPAA 3T5HA 2P9EA 4Y2CA 3CW2C 5LM7E 4RUHA 2CYYA 3IFEA 1EETA 4ICLA 1SUQB 2C3UA 4JI3F 1N33J 1Y5NB 1YHQS 5LMNJ 2LECA 1X4AA 1TKDA 1K1QA 1K0VA 3EDRB 2ACYA 1U48A 3CJKA 3KTQA 3DMJA 1RADB 1CBKA 4F4XA 1YBAA 4LQ9A 1F9HA 3IO1A 1S59A 4ED6A 9ATCB 4OZ0A 4DSEA 2OSRA 2OPRA 2ZDPA 3MXHP 1Y9OA 2HQCA 4YB6A 3PRDA 3BGLA 1U1MA 5IT9U 2QFIA 3SXLA 2B8PA 3O3LA 4NEYA 2YNGB 2UUWA 1A9NB 1WNEA 2XSJA 4P6QA 2FHJA 4OJHA 3TAPA 1HNXJ 2KB2A 2ZH9A 4DU8A 2HHUA 4TQRA 2RUSA 3I87A 1TK0A 3R2CJ 1R8HA 1UFKA 2RDDA 3T6JA 3RB6A 2F65A 2ZBIA 2OPQA 1LEOA 1U2FA 2NREA 4A46A 1M5OC 3E01B 3QJPA 1LK5A 1SJFA 3I5AA 4C9DA 1DARA 5CQGA 1LWFB 1RHQB 2BKOA 3W9IA 2CUYA 5L1JA 1CC8A 1RQ0A 1S99A 3KLIA 4A8KA 4ZCIA 5D77A 1NUEA 4USTA 3PRBA 5D4PA 3ZZ0A 4ERDA 4L74A 2BE7D 3M7VA 3LWLA 3N0VA 4M5KA 2JC0A 3PTWA 3ZC4A 4UQGA 4ZMMA 3ZTOA 4TU8A 2FHMA 2GQCA 1NKCA 3QGPA 1RCXB 2JSXA 4TN2A 3LP1B 1HBUB 3SEOA 4PWDB 3ZTRA 4DXLA 2XBPA 4KPYA 1S5ZA 3EZ5A 2I9SA 2SXLA 4B3TF 2O66A 2XHWA 2HZAA 4Y2AA 8AT1B 1RAAB 2K1RA 3K5LA 4ZJOA 3U27A 4ZK7M 3BH6B 2ADCA 4ZP9A 5J1PA 3TQ1A 4YB5A 3PG9A 4L73A 1MW7A 3PKYA 4C8MA 2ZJQQ 2XHCA 1OPZA 1RWUA 4CO0A 3OD2A 4RLEA 1TR0A 1F9FA 1FFGB 2N7YA 4A47A 3K8WA 4YR0A 4H4KA 4WZQA 3M1VB 5HQLA 1WKJA 2MQQA 1V6HA 4DPTA 1N5SA 4TKTA 4NLTA 2M88A 2VHGA 3KG1A 4NA3A 2ZHOA 3QZ8A 3RG6A 1NB2A 5KFXA 4UY8T 4WFYA 4QIWD 2WZ1A 3TUJC 4CLUA 2PDAA 3PX6A 1HWUA 1JLAA 4TY8B 1VLOA 2HRUA 2CQBA 3OL8A 4QU6A 4ED7A 3ENAA 1XMBA 4F4WA 5I3PA 1K44A 3MCMA 2DB1A 4MYUA 5K8MA 3FBFA 1U1NA 3UDLA 4OJ1A 3L4BC 3KLHB 4K4VA 1PCAA 1UAWA 1S7HA 1HWJA 2OEJA 4O4GA 4XIUA 2CPIA 4QWAA 3M32A 4OL8A 5F8LA 2PI4A 2OP5A 2R7TA 4B3OB 4DDFA 5KFKA 1PAEX 2OD4A 1HQUB 2ZWPA 2YQ3A 2HNDB 1ACMB 4PYAA 3E51A 1B3TA 4QIEA 2IM0A 2LMIA 4WIQA 1JB0C 2QL5B 3P5TL 2Y9HA 1RT3B 1OYEA 1KDNA 1T9VA 2GJIA 4ECRA 3CULA 4DF8A 4O3PA 4OHXA 3FEZA 3VV2B 3EPIA 1C4AA 2OFGX 4KHPF 2BZ2A 3GJRB 3DLJA 2V34A 1W2BR 3PEJA 4L6V3 2H9ZA 3UCGA 4N7TA 5L8RC 3R7NB 2QSWA 2HK3A 2WK4A 4DV6F 1IQZA 1RZMA 1G3OA 2FTRA 2E1RA 1YBTA 4OYMA 5C24B 1UW9A 2G1HA 4K4YA 1SJ4P 3H42A 2PMZD 2DXEA 4PRFA 2JLFA 4ILMA 5ADZA 5B0BA 4EFAC 1R8PA 1NPKA 3SSQA 3J80U 3CO9A 3EZUA 4YDXA 2AV5A 1D9AA 1SL2A 2YNGA 4P71A 4FDFA 3BSAA 1UWAA 4DHVA 4J9KA 3AOCA 4DR2J 4QQBA 3BSNA 4USIA 2EW9A 3QATA 4BHQA 1EQMA 3CNQP 4OZLA 2BKNA 3FBEA 2M8DB 1YRUA 2BM0A 2CQDA 3GSDA 1TL7B 3CJTA 2X3GA 3DYAB 4QW8A 2LP4A 2M4MA 3IM9A 5B0DA 4DUYJ 2HWIA 2ROPA 3CDAA 2PI5A 4QIVA 3OFHA 4DS4A 3H2VE 3TOQA 2L41A 4FVMA 1S77D 5CYMB 4ZCKA 1HWIA 4MIWA 5F8IA 1LWFA 5GAEU 4B9TA 2QJ3A 2XO6A 2C2OB 1C1BB 2R2SA 3JTPA 2CIMA 3AQPA 1UVLA 2F4VF 2XS2A 2MQMA 2HGNA 2HAIA 1MLAA 3I5BA 2FIUA 2IMOA 3JSYA 4JV5J 3W5ZA 2ZBRA 5CAAA 3O8WA 4I68A 2GA7A 1Z1ZA 3LP1A 1HBUA 3FGVA 3R6LB 4I56A 4ZP7A 5A0YA 4PWDA 2GQQA 1WORA 3KLGB 2ALYB 1MWYA 3QBCA 5FD1A 4DSFA 3DLBA 4Y3CA 5EWGA 2I0XA 5MLCV 2YWEA 4EEYA 3JSBA 1XNRF 3VAGA 2VG6A 3MEGB 1OPIA 4ZVQB 4CYUB 2YNIB 1FVSA 3PYDA 1UW4A 5IZHA 2V68A 1JWWA 1MWZA 1U24A 1SC3B 3MM7B 3NAIA 4ZLJA 4FS1A 3M1VA 3EPGA 1Q8KA 5EWEA 2XYGB 1S4FA 4NWBA 2GIQA 2GHVC 4OZ1A 1XBWA 4RW6B 4USWA 3F44A 4MFBA 2R7XA 4FYDA 2OD6A 4KE5A 1JLCB 2AJFE 3NGDA 4JI7F 2KRBA 4RNFA 2ZH8A 3L7UA 3MZIA 4Q0BB 4DQRA 2CWKA 1GMUA 4Q5VA 1FFSB 3D0HE 1IJFB 2D41A 2MQLA 2WVBA 3UDCA 3CJ3A 4CRJA 3IAM9 3ZXWA 4EWTA 3DC2A 1T11A 3ZZOA 4X64F 2CJKA 3QO9A 5DQIA 3KLHA 2Z0GA 1UKUA 4DV0F 1QSSA 1FD2A 2VBZA 3CXCR 4DSIA 4LVOP 2UU9J 4RUAA 1S6PB 4X4SA 5I42B 1YLXA 2K06A 3SDEB 5J2NB 4ECSA 4B3OA 4Y00A 3BN4A 1HQUA 2VOOA 3NNAA 4ALZA 4NCAA 3THVA 1YI2S 2F7VA 3PCOB 2ZE2B 1OY8A 1RT3A 3THTA 2J9DA 4HDHA 2DNLA 2RF2B 4A8WA 2E29A 2HNYB 4A8OA 5CYJA 4QJVA 4OMFG 3EX7B 1RT5B 3M2VB 3EGWB 4XK8C 3TEGA 5IWAF 4WYWA 2Y8WA 1RWOB 2ZZNA 2NXEA 3T1AA 2GX8A 5ETRA 5A2QY 3SSSA 2JWNA 2AMCB 2ADBA 1F2HA 3KUGA 4NLPA 1SC6A 5C24A 1C4CA 2BVZA 3C14B 4GC6A 2YBVA 1YTYA 1NDPA 2KFYA 2EBEA 3QIDA 4EBCA 2NYHA 5KAKA 3ENWA 3DU6A 5EX3A 1T94A 3QJJA 5J2PB 1WC6A 2ASJA 1N32F 2VG7A 5KFSA 5GAHI 2ZM6F 2VBYA 4DV4J 3LP2A 1HNIB 2BJEA 3D2WA 1CSJA 4CTAB 2RNEA 3QSYB 4EGLA 1DTTA 2LA6A 1JNRB 1TL7A 2WONB 3M2UA 3RRKA 2FLLA 1UZHA 2MZSA 3CJ2A 4N77A 2RB7A 4LSZB 1WUUA 3HHLB 2VBXA 5CYMA 3BQ2A 3K7RA 1WHVA 2VBWA 5IOLA 3OTBA 3QIPB 3AOAA 1C1BA 4DPUA 2DH9A 4DI6A 3JSMB 3RUBL 3PO5A 2KG1A 3OVSA 2D3UA 3MTJA 2W1BA 2JLGA 2MKIA 2ZKUA 1L3TA 3TR5A 3N4WA 5E5NA 1FDNA 4FYVB 2X1GA 4J9UE 2QMWA 2V8VA 1VJWA 4HYKA 3JYTA 4G1QB 4ZVRB 3SCJE 2XTJP 1S1XB 2BM1A 2V4RA 2J9EA 3GP9A 5AXKA 3DOMB 5C25A 1HBNB 3CCES 4JI5F 3D5MA 5ETVA 5HK4A 5JXSA 1NCLA 1XJWB 3VAHA 2YWGA 3FSXA 4H4MB 4PPZA 4CLWA 4CO3A 2VQFF 1KQSR 3DN9A 1ZAVA 1H6KX 3KHLA 4ZP6A 3MEGA 4YEAA 3R5BA 4KB7A 4WFAQ 3NCQA 4K4TA 4ZVUB 4CYUA 2YNIA 2VFTA 4IRCA 2R7QA 2K7JA 2OPSB 3B4DA 5LSRA 3MM7A 2AT1B 3MMBB 5BJRA 2NUHA 4DS5A 1L3SA 2NR0A 4DCJB 2AKWB 2BE2B 3CWJA 4LF9J 3I55S 1TKZB 4RW6A 5E3AA 1SKSA 1UP1A 4NEZA 4OHZA 2VDIA 2VL1A 3KMQA 1RBOB 3GIMA 1N56A 3UW1A 1JLCA 4R0EA 3GIRA 3M6XA 1SJQA 2EPIA 4IO9Q 4ZVOB 2HKEA 4Q0BA 1X0PA 1DRZA 4FNIA 2RS2A 1KLMA 4LFAF 3WC0A 4H4OB 1F60B 3IWNC 2KYXA 4RBVA 3DDNA 3M4XA 3ETOA 1FX4A 5DG7A 4N76A 1K73T 4OYWA 3L95X 4Q44A 1SB6A 5L46A 4NCBA 3S8SA 5CXTA 2DRAA 2JFKA 1FDDA 2UVVA 4CH7A 2XB2D 1V9OA 4DV1F 1DBDA 2YXLA 3D6HB 1UWBB 5D0EA 2PMWA 5KFVA 2XG8A 3MPYA 1S0MA 1WG5A 4CNYA 1S6PA 2FZKB 2VFRA 5I42A 3SDEA 3WQPA 5J2NA 1Q5YA 4B3MF 1M0SA 1WI8A 1URRA 2YWHA 2V50A 4DSKA 1HBOB 4BWJA 3ZZPA 4C8NA 4A8XA 3ZZRA 2VV5A 4ZVTB 3NL0A 1RDRA 2CKWA 1P1TA 4DZDA 2RF2A 1F6TA 2DEIA 2V69A 1XNQF 2D3OR 4OX6A 2KT2A 5BYQA 2VPYB 3CD0A 1VC5A 3QWUA 4LF4J 1QM9A 2LVWA 2FHJD 1RT5A 3M2VA 5GAGU 1G4CA 1UJ6A 2J7UA 2XCPA 4C11B 3SIPB 5AE2A 2UUAF 4NI2B 1UVIA 1KP6A 1O6XA 4DV5J 2KFNA 1MWQA 4MTPA 2Q79A 2G9OA 2NQPA 1SV5A 5D4OA 4XTTA 3C14A 4NA2A 3MR3A 3TJ8A 2CJYB 2M70A 4RX6A 5B0AA 3BO2A 1FWKA 4DSJA 3LTOA 5IC6B 3HFKA 3LALA 3IM8A 5J2PA 3OBIA 4UTGA 4PUOB 2HHHF 4MMOA 1HD1A 4J9OA 1ZZFA 5KFRA 2HQGA 1TL1B 3FQLA 4WKYA 4OZ5A 1RTIB 3THPA 3HHLC 1S0VA 1WTBA 2EFNA 1FKOA 3H5UA 3C16A 4P2MA 2ZH4A 2MJUA 4N5SA 1SH2A 1IN0A 4NZ0A 3UR3C 2WONA 3R97A 2R2UA 1UMJA 1YRTA 4ZPVR 5HMXA 4GKKJ 3M8WA 2WB4A 3CCVS 4KKOB 4LF1A 2CXEA 2BJ7A 3MMAB 1NDLA 3N28A 4ZN1A 1Q7YT 6FDRA 4WKRA 3TX0A 1R0AB 3QIPA 4QR1A 4JI3J 3L7OA 2EXUA 1U0SA 3IAS9 5DGBA 1PYOB 2GJFA 1SXLA 4CCHA 2BRKA 3JSMA 3W64A 3WBZA 1GXTA 2XS5A 2W4DA 3DLEB 5KFTA 2R2RA 2YKAA 4J9VA 2RD5C 2G0JA 4JV1A 3FNNA 1U4BA 1UEKA 2RRBA 3MEEB 4QR2A 3OFFA 3PW2A 2DNNA 2HWTA 2DHSA 4A48A 4LF7F 4G1QA 2RAQA 1IKVA 3N5FA 4U9RA 1ITPA 1NNDA 3CT9A 4F4ZA 2OSQA 2D69A 2IIHA 3DOMA 5KFZA 5DQGA 2ASLA 1GXUA 1FEEA 4EU0A 1HBNA 4CNZA 3PJWA 4Y28C 3TZXA 3SMZA 4UZCA 4YY3F 3GFYA 1WD6A 3AXKA 2XZDB 3OR2B 1N34F 4H4MA 1WC4A 1NJWA 3H90A 3IRXB 4K0KF 1KSPA 1X4GA 2H4WB 2K7KA 2OEKA 2OTLS 5CCLA 1HNWF 4NXMF 3FCHA 5HJXA 3MMBA 4CLFA 3G82B 4JYAF 5A8KB 4JV2A 2ZZTA 3DRXA 3G9CA 3HLUA 1S4EA 3LAKA 3GG0A 5D8HB 4QW9A 1KTVA 5E41A 2ZHAA 4MT1A 2BE2A 4DLGA 2N4CA 3KJQB 2G4BA 5KFIA 2DGSA 3Q8UA 1U1RA 2FC8A 5KG2A 1LOUA 5G0RB 1TK5A 3T3FA 1L3KA 4P74A 3NS7B 4DFPA 2MKKA 3NXZA 1DHMA 2ALZA 3IBFB 1E6VB 3AHPA 1N0UA 5DM7Q 5IS2A 1WEXA 3W63A 5F3TA 2AZ1A 5KFAA 3MHYA 2IM1A 5KFBA 3EUNA 3FK4A 4RNHA 4NZ7A 4J9SA 1VRTB 1QE1B 2J0QD 5AJ3J 3RRGA 2ZEJA 3V2UC 2I8EA 1VMBA 4J5OA 2G2ZA 2MEWA 1E6YA 2RQCA 3CDBA 1B7YB 3NP5A 1LQ9A 2OUGA 1IKYB 2XQCA 2YWWA 1AROP 9RUBA 2UUBF 4QYZK 2DNOA 5DG9A 2FHKA 4KC5A 2NLWA 1GTHA 2RHQB 3W9JA 2ERRA 1HWKA 3J7AN 3JB9k 4OI3A 1RWNB 1HBOA 2GFFA 1QJHA 5AE3A 1EB0A 3MF5A 3T1YF 2C1EB 4BDPA 3WDOA 2BQUA 5IQ6A 2KJVA 3KDOA 2ZVSA 1FNXH 3CJRA 2WVFA 3IR5B 4Z2XA 5AXMA 3R6GB 1NKEA 2MQOA 1DQ9A 4PXDA 2AQ4A 5AE1A 2R7VA 4E98A 1S57A 2GIRA 4V19J 4ZITA 2JJ4D 4C11A 1R6VA 5DS7A 2HGLA 1ZAXA 3MWBA 4NI2A 1NH7A 4OIXA 2JNJA 2QIFA 2VASA 2QYGA 4PG8A 2M9KA 5KFYA 4QYZJ 2OHDA 1GEHA 2KM8B 3RBXA 2E9ZA 2X51A 3RW6A 4NMXA 4LBHA 1FKAF 4DR5F 2A0FB 2P6SA 5LXRA 2FLNA 4OHVA 3GJSB 2HWHA 3BQ0A 2CQGA 2UVRA 2MTLA 3TP2A 5KOWA 2RIJA 4B9UA 1PJ6A 3KHHA 1TL1A 3DRPB 1U8SA 2WVEA 1RTIA 2Z58B 2XMAA 3QT6A 2GGPA 4CLLA 3CMES 3D3BJ 3HD1A 4MYTA 3W2VB 3BDEA 3TQEA 1UA0A 2XY7A 1LW2B 3JAMY 2GCFA 1EIYB 4EYHB 4B9SA 1RE1B 1QVFR 1VHFA 1T95A 3AQOA 2NPIA 5JVGQ 3H25A 3AA8A 5E3RA 1N6QB 3MMAA 1GAOA 4B17A 1JLQB 2UVWA 2DCUB 1NM2A 1R0AA 4R0JA 4OYOA 4KHPJ 2U2FA 5SZTA 3KLFB 5DLFA 3BGFA 4C3LA 1SH3A 3QT5A 3W61A 2ZH5A 2RKIB 1W7WA 2DIUA 4W4MA 4X4TA 2VOPA 3MEEA 5KTQA 1SJRA 4DV6J 3H2UB 3R7BB 4OV6A 1NSPA 1ZETA 2VDHA 3QT7A 1T9YA 1HQEB 2V2KA 3OR1A 3HT0A 2EFQA 4QR0A 3BBFA 3K8VA 2XZTB 2B4VA 4IYQA 3OSPA 5T14A 2XY5A 2XMKA 3OR2A 3IWXA 4RW8B 3TZWA 5IC4B 1GK8A 2RU3A 2MKYA 4NZ6A 3IRXA 3GMGA 2CNNB 3CCJS 1HMVB 3FCVA 4URQU 2M2BA 3QWPA 4JP8A 2DGVA 2PA3A 2MQ8A 3G82A 4CT9A 1UPPA 2MZJA 1Q8IA 5A8KA 4EUVA 4I6AA 4HHUA 3RBEA 4LR9A 4XDDA 3DRYA 2N82B 1DZ5A 3K57A 3EVMA 5BR8F 1VQ7S 1ICEB 3P5BP 4X4RA 3CIMA 3LAMA 3Q8PB 5C2CA 3MM6B 1QD1A 2X7IA 2AF6A 3T5JA 2F4VJ 2PGCA 3CPWR 2B3TB 2MYFA 5G0RA 3HHKA 2HQFA 3U7JA 3VZHA 1ZM3A 2IRUA 2BJ8A 2EC2A 2G0IA 2KXHA 5IT4A 3AA9A 2NXUA 3MMCB 4FXDA 2J9CA 1OIAA 2PFDA 2ZVIA 4OJ3A 1VRTA 1QE1A 2IFXA 2YY3A 2FVRA 2P5VA 2U1AA 3VTIA 5K8OA 4UT4A 3HMJG 3BS9A 1LWEB 2DR5A 1IKYA 3GV5B 3CJSA 2IVYA 2HS3A 5JVHQ 4OJGA 2LCWA 4KPCA 1YIJS 4G1PA 4OYZA 4X4VA 2B4PA 2CQ3A 3IS9A 1FRLA 2XY6A 2Z2ZA 1VQYA 2JX2A 1CJTB 5EN1A 1NK0A 3I96A 2F40A 2ATCB 2HLTA 5HLFB 3UD5A 4KGKA 5F0WA 2C2DA 3PW4A 5DQHA 5E2QA 1SL1A 3CCSS 3ZZYA 3SQOP 2DHHA 1KS2A 3D9BA 2ZJRQ 2HVEA 4YR2A 1AUDA 3PX4A 5C5JA 2MY7A 3ULHA 4CIOA 2IDLA 2B51A 4N8NA 4I2QB 1KTQA 1JKHB 3QT8A 4ECWA 2KZZA 2CQIA 4P75A 4DX8H 1GT8A 4YMEA 1ZTWA 1JK9B 3OV7A 3BGRB 1T3NA 3GQCA 3TA1A 2L48A 1YG0A 5DM6Q 4C7QA 3HXMA 1SIWB 2B7BB 1TTHB 2IMWP 1B4SA 3EVOA 2EFPA 2F1FA 2YPYA 5J1EB 1M1GA 1IR2A 1F0XA 2WCXA 3PFOA 4YP3A 3MCOA 3EMTA 4X64J 1VQ6S 4LF2A 4U95A 1FCAA 5M2RA 3K5MA 4DV0J 2FYXA 4RW9B 2UXCF 2WB1D 1FXRA 1UA1A 3DRPA 2CDQA 4NLVA 4NE9C 1R0CB 4Z7YA 4HKQA 1TVRB 2H3EB 3W2VA 2IBKA 4LF8F 2DJWA 4K2JA 3PV8A 1YQHA 4Y0FA 1BQNB 4PG4A 4A8FA 2BQRA 4W90B 1N6QA 3GJTB 3QNWB 2ZH7A 1WACA 2WW4A 1KHVA 5MAOA 2BJ9A 1JLQA 3PVXA 3TAMA 2HZVA 5CD4H 4M5DB 2JLEA 3KLFA 4C0BA 4KGXB 5IWAJ 5SUHA 1QUVA 3VGUA 4CWBA 2QO3A 1XR7A 3Q86A 2GO8A 1S1TB 1YRXA 1JJ4A 1UCNA 3I9ZA 2DH8A 1VIXA 1FHTA 4OI0A 3V6HA 2MB0B 4KR0B 1AZSB 3T6BA 4LFBF 2EBGA 1HQEA 3PW5A 3X3UA 4DR7F 3V6JA 4RBUA 4A8MP 5IT0A 5I3UA 2OPPA 1SPBP 5A2QU 1OYDA 5CYQB 1PKUA 3DNCA 1WC3A 5HI7A 1N5VA 1N32J 4DU7A 1EX8A 5DZ7A 3VVUA 4C97A 1BHNA 2XGPA 2XI2A 4ZS6A 3EDQB 4P73A 3G8TA 2IY5B 2CPXA 4RW8A 2FY8A 3VAKA 1VQ5S 3KOAA 2ZM6J 2D1CA 4IO1A 2HFUA 2MDAA 1IUJA 2E7WA 1HMVA 1CJUB 3MR6A 2V9WA 1QY7A 2XMWA 4LUBA 2H5JB 5KT3A 1BQXA 2BR0A 3W8GA 3CCRS 5FDLA 2XI3A 3BREA 4ANEA 4RW7B 4IRKA 5B09A 4IFYB 4KQZA 4FS2A 3VR1A 1O0PA 3EXYA 3MM8B 3OTOJ 4K4SA 1YJRA 4D3GA 1FE4A 2EG1A 2O5DA 3C19A 2DR9A 3FUYA 2AW0A 3M8QB 4HT5A 1PC5A 3TI0A 3KXDA 3N6MA 3ONQA 3CD5A 1F3FA 1ZAWA 1T9TA 2YWFA 2NXCA 1VQNS 4ZPBA 2DNPA 4RO0A 1WG1A 2J6SA 2HMIB 3MMCA 3OL7A 1S6OA 4ZCLA 2V63A 2AGQA 4O0NA 2MKHA 4W98A 1Q0NA 1S0NA 4M8LA 2BJ1A 1X9SA 4FPRA 1S49A 5HVGA 1YJUA 1FKPB 1RHUB 4JI5J 2XEXA 3Q8VA 3PR5B 4FN5A 4LF6F 3EGZA 2CNOB 4HI1A 3CJKB 5F41A 3CCLS 1HR0F 3DMJB 1QAJA 2YQ1A 2WSEC 5ETOA 2CQ0A 2FUG9 3OFEA 2YWKA 3NCPA 3FSIA 1CJTA 2QYCA 3S7RA 4KO0A 2KO1A 1C0TA 2DISA 4PXCA 1BC6A 5HLFA 3PXGa 4F02A 2CQ2A 2YX7A 5ETPA 1EHWA 1PJ5A 4ITSA 3IGVA 3AD9C 4J9LA 1FXLA 3LO3A 2VPXB 2WW8A 2O67A 1PC4A 2ABYA 3GR1A 3G8QA 3CCTA 4I2QA 1ZZNA 5KOXA 1JKHA 1T9UA 2W2MP 2E5GA 2O1PA 1BMQB 3BGRA 3KMSA 1QUPA 4PWWA 5ETTA 1T9WA 4LFAJ 2HHVA 2CQ4A 1X8DA 2OPQB 3BR8A 2H5IB 3G2XA 2XO7A 3KG0A 1LXNA 1J5EF 1WTFA 3BO4A 5AXLA 3TYTA 4DQPA 1VC0A 3M8SA 1Q8BA 1EKSA 1U6BA 3AJ2A 1DURA 4F4KA 1UTAA 2DGOA 2IJRA 5D15A 1VQSA 2XULA 3KLIB 4DV1J 4WTOB 3CUNA 2Z57B 2XS7A 4FXWA 2MZ1A 4RW9A 3LW5C 2LQJA 5J2QB 1GQEA 4DG1B 1YITS 1H2TZ 3GYNA 4B3MJ 1YJVA 1TVRA 3DRSA 2JEGA 1FERA 1ZPWX 4HL9A 1X9MA 1NLKL 3LPEA 4Y34A 3K2YA 3MCNA 4LBPA 1Z4UA 1HKAA 4ANDA 5KG0A 1BQNA 2Q43A 3ZNUA 1TQLA 4M5GA 3T9ZA 3NWGA 3HK2A 2HEKA 5L1KA 3KDNA 4TU7A 2K1RB 2PC6A 3QQCD 2N7CA 3I9V9 1NHUA 2QL7B 1RA6A 5KG5A 3LOUA 1TL4A 3HFVA 1RJJA 2ZZMA 3MPWA 2J8SA 4LRBA 1T0TV 2ZOGA 3DGPB 5E33A 1FNOA 2FVQA 2GAHC 3ISND 3M2RB 1HNXF 5EGYA 3C15B 2UUAJ 4GKJF 3QJLA 4PYDA 4ED5A 1V3SA 2QLXA 1URNA 1HWLA 3P49B 1BUXA 1REGX 3GIKA 2W9BB 4USHA 2YPZA 1HPZB 2UXBF 2E5HA 3HP6A 1AZSA 4B3RF 2ASYA 1N36F 2X3DA 3I0RB 4USVA 1V5IB 4EK2A 4WBFA 4DV7F 2VPWB 2E7VA 3TNVA 2QN6B 2HHHJ 5CYQA 4LSNB 4ZIWA 4F4AA 3P96A 4OZNA 2EFVA 1JLAB 3W60A 4OQJA 4QU7A 2KTQA 4KGZB 4GO7X 1S6QB 5KT7A 3V4IB 1ZA2B 1BE4A 5F8JA 2L3MA 2MXYA 1CJUA 4MK8A 2QMXA 4C0HA 2DRDA 4LRCA 2HHPA 3LANA 3IR7B 3H5YA 3ZO7A 4X62F 4RW7A 2CZVC 3F41A 1RU1A 4IFYA 3AFGA 5CZXA 4NLXA 2E66A 5HJYA 4DWIA 3QGGA 2WSCC 3GR0A 3T5LA 2KT5A 2CJXB 1YJ7A 3MM8A 1I3OB 4O4GB 1WDTA 2HVZA 2J5AA 2IC3B 2FDNA 2Q6BA 3UWTA 3O1LA 4XAKA 3K58A 2BEFA 4K4UA 3GZ7A 3LWMA 1H74A 2L08A 1S9EB 4EO6A 1FRIA 1CEZA 3W62A 3QZ7A 1NK7A 4TXSA 2CQHA 2H65B 4NLQA 3OVBA 1V3ZA 5L9XA 4N47A 2EWHA 1Z2ZA 4J9MA 2HMIA 1NJIT 3OXGA 2CPYA 4LF7J 2H51B 3FEYB 1GXLA 3G71S 2J0XA 1XEZA 3MD3A 1Q82T 1U1OA 3A8EA 4KH1B 4RNNA 2C3PA 3HVTB 2DNZA 1FKPA 2UP1A 1IBCB 3RGIA 4NLOA 4YY3J 4ECYA 4OZ2A 4DPOA 1N34J 1LNQA 1YJWS 3KKFA 5ETQA 2KFZA 1NH8A 2A6OA 1S6UA 1RK8A 4DPXA 4K0KJ 5GAEI 4XO0A 3GFHA 4G3IA 3RW7A 5RUBA 4ES1A 4ZVGA 1HNWJ 4NXMJ 3NY0A 2F8HA 4JYAJ 3V5RA 1X4EA 1O8BA 3AY0A 2BKPA 4UOFA 2PA8D 1O5JA 1IBKF 2E1PA 2BUNA 3RAXA 1WSRA 1X4DA 1B0TA 1U45A 3UN2A 2RDIA 2CJAA 2RJZA 3GV7B 4QBUA 2VG5B 5EDWA 5HMWA 4WFNQ 2F8EX 4CO4A 1PSDA 3MR2A 1AA1B 2LXUA 4JUZA 2DNKA 2PT0A 4USJC 1S76D 3O5TB 3H8YA 5F8MA 3W2WB 2R7OA 2J0SD 1RLDA 1HW9A 3DLGB 3OHBA 4F50A 3TVZA 4HH0A 1TP7A 3K5OA 1BXNA 1FJEB 3BGUA 5HP1B 1YZ7A 3GIJA 1RSCA 2CZ9A 1X0FA 3CVKA 1NXIA 2WBMA 4CM0A 2QA4S 4ED3A 1JJCB 2Y1IA 2JOQA 2F8MA 2L9WA 3I56S 2JEIA 1U2RA 1GX5A 1MNEA 2FJWA 5J2QA 1FK9B 4DG1A 3OTCA 1KFSA 2UUBJ 1UJ4A 2XMUA 3FRYA 4IOBA 2F9DA 4K50A 1S0OA 2F5GA 1CPZA 2D3ZA 1KFDA 1RP5A 1F5CA 2RU9A 4U7UK 5A0YB 3MI7X 1X5PA 2JC1A 1WHYA 3AD8C 3MAQA 3T1YJ 3D0IE 4NLYA 4H4KC 4C98A 4DQQA 2QTWA 3PO4A 5G4DA 4AL7A 1JLEB 2I38A 3PM9A 3HHEA 1EZZB 1X60A 2VG6B 4DR2F 4DX6A 5D0GA 3DGPA 5KFJA 3M2RA 4WFZA 3C15A 1RAJA 4OI4A 5EWFA 2CRLA 2VH7A 3R27A 3M8PB 4B3SF 2H54B 2NYIA 2W9BA 4ED4A 3C8YA 2Z4PA 2KKHA 1HPZA 3K5NA 1TMJA 3N6LA 1U7LA 4CZCA 1KONA 1P8GA 5HO4A 2AJ4A 4DR5J 5KFMA 3I0RA 6FD1A 4CI0B 2V8HA 4MFBB 3M6UA 2CJQA 4QOTA 2EKNA 1G7CB 4OLPA 4LSNA 2MPUA 3GFZA 4DX7A 2J0WA 2IM2A 3LH2S 2FLOA 5BYSA 2RUGA 3OSNA 4DL6A 1WC1A 1S6QA 1U47A 4UY85 3D4JA 3V4IA 1IR1A 2YH0A 3PY8A 2F4FA 2MQPA 5LXYA 2CG8A 2HS4A 3TO8A 1SJ3P 3DGVA 1OO0B 4DCPB 2PN6A 5C7PA 3BSOA 1TUWA 1EJ7L 1JLFB 2PIIA 4Y65A 3QO9B 1PGZA 2JL9A 1FD8A 1TKTB 1TELA 1FRJA 3KK1A 1R27B 2KT3A 1APSA 4HLBA 1PYTA 4JI8F 2HNZB 2IC3A 2HFZA 2D7SA 4NXNF 3U1LA 3CJ0A 4D3HA 3T5KA 2R8GA 1S9EA 3JAMU 2OO4A 3HSZA 5F9LA 1NJXA 5B0GA 3Q0AA 1DAXA 4F8RA 2XLKA 4O3OA 2DNGA 1PIEA 3T1HF 3BKFA 5L1IA 1R7IA 3G6XA 1N8RT 1YGYA 2RVJA 3QGIA 2AWZA 1D0EA 2A3JA 1RYRA 2E5IA 1RTJB 2A10A 3HVTA 1VQ9S 3L3CA 1NAQA 3M8ZA 3SFUA 4F2SA 2VQEJ 3NGKA 2AJ2A 4HVZA 1RBAA 4WWSA 4F7VA 2QLBB 3BZQA 1R6YA 1NJZA 5LSLA 5DG8A 1RXOB 3OTDA 4ZVHA 4DR3F 4PXEA 1OMSA 1RA7A 1DQAA 1D9DA 3QAEA 4CH1A 4G65A 1RABB 4ED8A 1HFEL 1H98A 3NEKA 2DGQA 1WC5A 2JFDA 1Y11A 1UETA 3FEXB 3SV4A 3EZOA 5BR8J 5D6GA 2E1MC 1N88A 2VG7B 4Q2MA 3HSDA 3US5A 1HHSA 4KHRA 1RT7B 2C2ZB 2VG5A 4ZVEA 4P2XA 2B43A 1I94F 2HPUA 3U02A 3LP2B 4DX5A 1HNZF 1GMWA 2FJDB 2LQBA 4EMDA 3W8PA 4OHWA 5ETKA 3W2WA 3QGHA 2ACMA 3OXFA 1DTQA 1DTTB 2R3VA 4QPXA 2M5YA 3DLGA 3M2UB 2DNMA 1S48A 3OT9A 2IA0A 2DY9A 5HP1A 1OSDA 2CNLB 5LSOA 3SBMA 2N3OA 3H0PA 1PBAA 1RTHB 3HD2A 3AT1B 1WOPA 2RQKA 3FMWA 3W3SA 2ZH2A 2BQ3A 4DOZA 3FC9A 5ETNA 1WSVA 1Q78A 3DOLB 2CQCA 1FK9A 2ASDA 1XMOF 3FZBA 4ES3A 1QSYA 4JI4J 2HW3A 1SC4B 3S1TA 2XMMA 4KGVB 2J7WA 4HI2A 4RBTA 2LQ8A 3JYTB 1RKJA 2GMLA 2E9RX 3PIOQ 4IDKB 3MEDB 5C25B 3UR0A 4V1Ak 2FJVA 4ENOA 4NYOA 1C0UB 4X4UA 1UVKA 3CEDA 3KFWX 1G2EA 3LGNA 2HFSA 1FTCA 3AJ1A 1U1QA 4LT6A 4B9VA 1D3WA 3DXSX 1JLEA 3HJVA 1JQGA 2V4JB 3H4DA 2BDPA 2R8KA 3Q8QB 3TRGA 2MLXA 1JIHA 4FXVA 1X5OA 2HLUA 3P6YC 1RAOA 4LIRA 3M8PA 1S97A 3EGVA 7AT1B 4EI2A 3WZ0A 3D1OA 1OSCA 1N4LA 1CS4B 4DF4A 1U49A 3IBCB 5A6WA 3D6MB 2X1AA 4JBCA 2GV1A 2V8PA 1VOMA 4K4WA 3ADAC 4DQSA 1RBLA 1VISA 5A6PA 2D3O1 3FFIA 1SKRA 2J76E 4K8RA 2X1FA 1N48A 4A8YA 3UCZP 3EVWA 1RAGB 5D78A 1XR6A 4RR5A 4PCQA 1LKZA 4UUWA 3RYLA 2Z8QA 3NMAA 2UXCJ 2K8GA 3Q23A 5B08A 4IG3B 3KK2A 1SKUB 4PG6A 2CA9A 2UV8A 2V6AA 1X9WA 1KLMB 5GAGI 4BBYA 2XC9A 2W9CB 4KHMA 1J5OA 3KWMA 1TUVA 4LF8J 4RU9A 5DO2A 1JLFA 2DVIA 4C4WA 1TU0B 2QA1A 3UE2A 5I4MA 1NHVA 1TKTA 2ZBCA 2L9NA 4I2PB 2FGOA 2JEFA 4Q45A 2HSEB 2WBRA 2XGQA 2HNZA 5GADU 1F3VA 2LEPA 4OV1A 5K9FA 2IAJB 1KKHA 4PG7A 4O0IA 1C2PA 4BS2A 1RT2B 1LK7A 3UFCX 1BLUA 3CCMS 2LYVA 1Y00A 2GVDA 3H7HB 2V9KA 3MD1A 1WELA 3HZGA 4AQYF 1MU2A 4QZVB 2RDJA 4LFBJ 2YKPA 5E3PA 4DV2F 1SIZA 4DR7J 2RMLA 2BX6A 2BW2A 1IKXB 1TV6B 1RTJA 4ECTA 3BR9A 1HI0P 4DZ6A 3B8HA 3FDSA 4LFCF 1B0PA 3DU5A 3CDWA 2M7SA 3OUYA 3PHEA 4MK9A 2FVSA 3P4UB 1B70B 3FBBA 3TA2A 1G1XA 2ZH3A 1SV5B 4WIIA 4DL2A 4KY3A 3KLEB 2XMVA 3ILIA 3MGJA 1KHWA 1SQEA 1TUGB 1JLBA 5EX0A 3QPIA 4O3QA 2E1AA 1RT4A 1SI9A 1G6BA 3NGUA 1VQMS 4KAIA 1IBMF 3M9OB 3C66A 3JQKA 4X66F 2OMOA 1C1CB 4LBIA 1RT7A 3ENVA 1YJTA 4CLSA 2UUCF 4YDDB 1KR4A 2MLZA 2V4QA 4FF1A 4FPIA 2R7UA 2M52A 1FKOB 3NCRA 3C16B 4WJBA 3SCKE 2DXFA 3QYYA 3ET6B 2KL8A 1V3RA 3IR6B 1X4FA 2YKNB 2ZWOA 4JI2F 4X4NA 1WG4A 3AXMA 2B4UA 3N01A 3TUIC 3MUMP 2ZNZA 3VCDA 2ZNYA 1JJHA 4RNMA 4P7TA 3VQTA 2VU5A 4IG0B 1RTHA 3GIIA 4GRSA 5IM0B 1RYSA 1VRUA 3Q8SB 4USUA 5F8NA 1RAHB 1FF2A 4LF6J 2HHXA 3CB4A 5F8HA 1UPMB 4OX8A 3DOLA 3DXBA 4AL6A 3L09A 3JTOA 3KG4A 4LRFA 4I67A 5LMUF 5EUHA 1VBYA 3M05A 3KUEA 3R1LA 3LPYA 2VF3A 2B7CB 2V67A 4PZVA 3G6YA 1VQ8S 1IKVB 3HM9A 2FGCA 4ZA1A 3VAIA 2HHSA 1U2CA 4IDKA 3MEDA 2VFUA 3AOBA 2D9PA 2GQ2A 1AT1B 2ZITA 4BWMA 1J2VA 1FJ7A 1C0UA 2CQPA 4URGA 2JDJA 4JB8B 3PR4A 1TK8A 2V4JA 3SZ2A 1VQOS 2XMTA 1NMEB 1FRXA 3SYZA 2C3MA 2E5LF 3DRRB 5B0FA 3CC4S 3ZZZA 1ZPVA 1BWEA 2NCKL 4HDGA 3JQMA 3O6QA 4KT0C 3MM5B 4AD6A 4ES2A 2VZ9A 3IN5A 1CS4A 1RWMB 3HVAA 1JJ2R 1Q7LB 4KFBB 1B0VA 2KXNB 4DPWA 3SI8A 2NZCA 1J5EJ 4WCEQ 4M5MA 4J9PA 2Q3PA 4KJIA 3J7YU 3H20A 2FJBB 3HDSA 2FVPA 4GKKF 1GX6A 2J8AA 2I2YA 1WOOA 3PEHA 1L3VA 4O44A 4ZPCA 2FJXA 2PEBA 2FJAB 5HSPA 1XWLA 2IJFA 3PZPA 2A6MA 4FZVA 3T9NA 3F56A 3C46A 4IG3A 1Q95G 4M5JA 4QCLA 3NOGA 3A3OB 2HVDA 4N41A 1QSLA 2W9CA 3CIZA 1W25A 4RUBA 3HCXA 2ZDOA 2GNKA 5DDQC 1E6YB 4PKDB 2O3DA 5GMDA 3OW2R 1TKXB 4I2PA 3SCIE 1KNZA 3PYEA 1B7FA 2OJ3A 2LXFA 4NX9A 2DBBA 2P2CB 4QWBA 5DDOC 3NS6A 2IAJA 2FY1A 1CULB 1RT2A 4GKJJ 2CPJA 5L9NA 3BGOP 1YZ6A 4Y2IA 1RGVA 1RI7A 2GMJA 1R0BG 5HMZA 4CDIA 2ZHBA 1WHXA 3TA0A 2R8JA 3CC2S 2DCLA 4QYRA 2C2NA 2VPZB 3NOCA 2UXBJ 3AB2B 3EE3A 5KT5A 4B3RJ 1H38A 4EBDA 1N36J 4OYIA 1NPPA 4KRWA 3MOZA 4ZDNA 5HQ8A 2AU0A 5B7WA 4C3MA 2OKQA 4DFMA 5H9EK 2RS8A 1IKXA 1TV6A 3D68A 4DV7J 2OIHA 3I4HX 2XNRA 2W25A 1YDLA 2LEAA 3PW0A 2AEFA 3V4MA 2UXDF 4YN3B 4DR1F 2BABA 1UZDA 1NSAA 1M5HA 2MHEA 3R5AA 2WTFA 3IG1B 2DO0A 4RKUC 3SSRA 2VJVA 1HBMB 4QWEA 4HHHA 5HATA 3KLEA 5GMEA 2GHPA 4Q8EA 5HROB 4KYZA 1M5PC 2HRYA 2AJQA 4X62J 4A8SA 5AJ3F 3AH6A 1WEYA 3TJAA 3ICLA 4F36A 4DLEA 2CAJA 3RTVA 4WFBQ 3SCLE 2YQ0A 3HKZD 2UVUA 1JX4A 3MURP 1C1CA 2BW7A 5H9EJ 2LKZA 2GGPB 4DR4F 5LOQA 4C48A 4WP3A 4J37A 1Q79A 3QRRA 3ET6A 2M3DA 2J9DE 3TUPA 2YKNA 3AD7C 1SKWA 5HBMB 1PILA 1YVFA 4KV8B 1KQGB 4C8OA 1WI6A 2CPDA 2GAGC 3BM7A 2HVHA 1NB7A 2GMHA 2ZOMA 1SL0A 1UEUA 5KFQA 3W1YC 1EP4B 3D0GE 4IG0A 5KFPA 2HS0A 5IM0A 2KXFA 2CG4A 2DR8A 4NMLA 3KLVA 2VFVA 5IV4A 2XLJA 4MKAA 3ITHA 1VYAA 3R2DJ 2RE1A 1LFPA 1QTNB 5LT5A 4B9MA 3H59A 3QLHA 4B02A 4MK7A 2W9AA 1S1UB 3RB3A 1MSWD 2DGTA 4A4JA 1ZM4A 2R7RA 3ISNC 4ELVA 1R89A 3CMQA 2BYCA 1YX2A 1FNMA 4DPYA 3MUTP 3A8KA 3OR1B 3ZNJ1 3UDEA 3I0SB 5KFHA 2H4YB 1NBEB 4M94A 4DL0C 2ZH6A 4DL5A 1IBKJ 1WF1A 1I1GA 2B9EA 4OFZA 1MROA 2BANB 1KD1T 3OTEA 4HH1A 1DLOB 2POKA 8RUCA 4GO5X 3DRRA 4URSA 1EKRA 2JVRA 1X5SA 1JXVA 1WKLA 3MPUB 4HTIA 1NZ8A 4HHJA 3MM5A 4WE1B 3KHRA 5KFUA 3TEHB 4L3NA 1A7GE 2R2TA 4KFBA 4NLRA 4FNHA 4QIFA 4JI6F 1TAQA 4BLGA 1TL3B 2Z30B 4U7UD 4TNOA 3KK3B 4NA1A 3TWZA 2MY8A 1VBKA 4A8QA 1S1WB 3OLBA 2P6TA 2B6AB 1SUQA 1WWHA 3RR8A 3TARA 3WIVA 1VBZA 2YKOA 3MDFA 1H7XA 1U1PA 3R7SB 2IA6A 4DL3A 1XMQF 3PFEA 4C2MA 2DGUA 3LF0A 1RT6B 4ELUA 2COLA 2HQDA 2ZH1A 1KOOA 2CFXA 3UDVA 2DPJA 2NXNA 3CCWA 3P45B 3L9ZA 4DFKA 1ZM2A 4DUTA 1NK9A 4YB7A 4FKYA 4K59A 4U8VA 4O3RA 1IWGA 5A76A 1TKXA 4ZJLA 4LMZA 4B3TJ 2ZC3A 4KTQA 2C3YA 3Q8RB 3EGNA 1CG2A 3DM2B 3R5CA 1CULA 3IS9B 4M5HA 4WU3A 4CLTA 3HVRA 4EBEA 4B3SJ 3BBBA 5AXNA 5LL6d 1CC7A 1WOSA 2RRNA 3NBPB 2YNFB 1Q53A 1KBRA 4UZBA 3MM9B 8ATCB 4O23A 1F5AA 3IRWP 3E01A 3MR7A 4P7VA 1I51B 4OLOA 4X65F 2DY1A 3AB4B 3JS9A 4U67Q 4MKYA 2DNRA 5GMKa 2EEYA 1QAXA 2YNHB 2JHEA 1GNKA 4F4YA 2W7AA 4N8OA 1OY6A 1XIQA 2HBQB 4X2BA 1GMWD 2RILA 3IG1A 1RT1B 2DHXA 3MECB 1HBMA 2MZTA 2HGMA 1SBRA 5E7OB 2BA9A 4I64A 5HROA 2F63A 1FTRA 4NRTA 4JI0F 1LW0B 4GC7A 2AGOA 4ILRA 3FMBA 1KQFB 3OFGA 4QWCA 3BSCA 1TZ0A 3LGMA 2V8GA 1RWKB 2CDRB 2AEJA 2DHAA 2PSZA 3FBCA 3CD6S 5D4LA 2EKYA 5U47A 4JI8J 2D9OA 4NXNJ 3TJ9A 1N0VC 3DHXA 2DNYA 4DR6F 4Y6IA 2IRXA 1RKIA 4ZLPA 2MSTA 1T7PA 3TZYA 3M9NB 1A0OB 1JNZB 1UVMA 2PO4A 3DDKA 3SV3A 3T1HJ 5HBMA 4KBIA 5H1SV 3A3PB 3IBWA 2DTJA 4KV8A 4E2FB 5DETA 1RB0A 3BDPA 1LWXA 1QVGR 2R42A 5JMNA 4C8YA 4X4OA 2ROEA 4MIBA 2DIVA 4NRUA 5E3QA 1NK5A 1EP4A 1UFWA 2QMUB 2QSFA 3TAMB 2I1RA 2W7OA 1MG7A 4QIGA 3LP0B 5K8NA 2CADA 1FJCA 2ZBPA 3J7A1 5M2PA 2NSCA 2VIHA 2UUTA 2Z56B 3PACA 4K4ZA 3CMAS 1N52B 2C22A 1KVIA 2DYAA 3OLAA 5GVQA 2LDYA 4DR3J 1U1KA 3I4PA 1IWAA 1S1UA 2IVMA 2HIYA 2V8DA 4TY8A 4ZJQA 3GU0A 4QWDA 1UL3A 1RHMB 3GTYX 2MKJA 1R31A 2Y1RI 4W92B 2KVQE 2C42A 5K20B 3S6EA 3UPFA 3FVYA 1HNVB 2AJ1A 3OJUA 4Q8FA 1GH8A 5I3UB 3A8IA 3I0SA 4IOCQ 2OPPB 4FYYB 1U02A 1MN7A 1K1SA 2CNKB 4FVCA 2FVCA 4ZN3A 3KJNB 2BANA 3I82A 2DPIA 4PAAA 4F3OA 4C8KA 2PMHA 1I94J 1DLOA 1CQMA 3NGTA 3CCUS 3PKMA 3D28A 5HVHA 3D6FB 3IA0A 1ELOA 1HNZJ 4RWXA 1RUSA 3PW7A 1KC8T 1T05B 1ZBTA 2C2MB 4ELTA 1FE0A 4WE1A 2HNDA 4FKXA 2OH2A 5FDLB 5JUMA 2BJ3A 2VKZG 4K7QA 5BYRA 5KFNA 2C2KB 3NGRA 4L3KA 2WVCA 1NK4A 2DXDA 3DFEA 2NS1B 3W5XA 2MGZB 4WFXA 4LQ3A 1TL3A 3D54A 3KK3A 2WSFC 1RHRB 7FDRA 1S1VB 1OS5A 2Y1JA 1BGXT 3G86A 4RW4B 3HHDA 4I6YA 1S1WA 4GVBB 1WEZA 3G6VA 4ZIVA 1OQ3A 5DRKA 2B6AA 1IXKA 4C8ZA 3NMRA 3D66A 3HHNB 2XWXA 3RZAA 4RUCA 3D67A 1KEKA 2QGFB 1XMOJ 3RBZA 3EYZA 3RAQA 4JOUA 5DZ6A 2A1BA 2HQ3A 2VFSA 3QSIA 1RT6A 2L9DA 5B0EA 5ITHA 2R4FA 3R1HA 3MUVP 5J1NA 3T41A 1NDKA 2YX1A 4ZPAA 4DL4A 2CPZA 4P2FA 2QRRA 3H4BA 5IV3A 1XNRJ 3BKUA 2DNQA 5LJ3Y 1U26A 3MTKA 2QLFB 3F73A 3VHQA 3DM2A 1JMTA 2FZCB 3V6DB 1RHKB 3MAHA 1KRPA 1VCTA 1Y5IB 3KNAA 2YH1A 2FZGB 4PXBA 2RH3A 5EHHA 3NWRA 4U7CA 3CD7A 3Q2TC 3VGVA 3FRZA 3KJVB 1QAYA 4KO0B 2NPFA 4IR9A 1C0TB 4XPCA 3PIPQ 2MSSA 3NBPA 1T02A 2YNFA 2DR6A 1M5KC 3DYAA 5D0RA 3NNCA 4FP9A 2UV8G 3K59A 1IKWB 3MM9A 4O3NA 4OI6A 2ROGA 2EK1A 3TW0A 2KM8C 3PHTA 1HQ2A 1P27B 2DGWA 3NKYA 3TUZC 3P8BB 3OTOF 3EICA 2KG0A 1HARA 4J9QA 2YNHA 3A8JA 4JI7J 4X84A 2YKMB 4ZVPB 2B0GA 3VAMA 2DKOB 2YX4A 4R8UB 2VC0A 2XMJA 2KI2A 2KYZA 4EZ9A 2YKQA 3VGTA 4M5NA 3HZEA 2H48B 1RT1A 4USMA 3Q22A 3BQ1A 1KOHA 3MECA 4ANCA 3CCZA 4WZMA 1AUSL 7FD1A 2FB0A 1NK8A 2DO4A 4OZJA 1VK8A 4YHHF 5CZVA 3UD3P 3Q2SC 4ATNA 3CSKA 3G4SS 1LW0A 4F2RA 3X1LB 1U6FA 3KLGA 4FBTA 3WHIA 2AIRB 4O4RA 1ZOTA 3AAWB 1KVKA 4WXOA 3QAUA 2QT7A 1KQKA 4IFVB 4WYLA 5E3CA 1B99A 5C42B 2MKSA 4BC9A 2AEMA 3FJ2A 1JLGB 3D1QA 3J81j 1F1BB 4R5PB 3C3LA 4TU9A 2M8HA 3DRSB 2AJ0A 2B8QA 3C6UB 5CD4A 3V81B 1SQGA 4ED0A 4YS2A 3D1HA 2AYEA 4CT8A 4AQYJ 1SC1B 1S9GB 4LJMA 3BJYA 2A2CA 2GJ2A 2KVIA 4UOHA 3QRPA 4DV2J 3GE9A 2QA4G 1FX2A 4NASA 1OWXA 3NRBA 3HF5A 2K2PA 1CVJA 2EC0A 3GWCA 2OMLA 4J90A 4RL1A 3LP0A 4J9NA 4LFCJ 1X4BA 4IUFA 4M1KA 1X7VA 2BRLA 4K2XA 2GC8A 2CPHA 4DV3F 2HQIA 4J7CA 4ZCMA 4B08A 1VQLS 2GHWA 3M9MB 5J2MB 3D6TB 4ECUA 1OY9A 2WVDA 1EARA 3QFWA 2LU2A 3J81Y 1NJYA 2W24A 1FFWB 4H54A 3UO0A 2KHDA 2BJDA 2LFVA 2QE5A 3NS5A 2NUUG 2DHGA 4TYBA 3KJFB 1RWXB 3EJMA 1HNVA 4ZPTR 1H2UX 3BPDA 3OL6A 2Q1LA 1NO8A 4XPEA 3UN3A 4CLZA 3HPOA 3GG1A 4FBUA 2DRBA 1IBMJ 1AYEA 1L5UA 4P52A 3ZTSA 4AT1B 1VIOA 4HT7A 3DDIA 4X66J 4OX7A 4XDCA 5FLXY 4DL7A 1M90T 2DR7A 3MPDA 2UUCJ 4X4QA 2DGXA 4WP8A 1FWLA 3W65A 3GPAA 3ILLA 1H73A 4OX9F 1F5BA 3B82A 4WP9A 1OJ4A 4DJBA 4AL5A 4K5RA 4OZ3A 2XYPB 1YK9A 4DN9A 1FRMA 3NLCA 1T05A 2IYGA 3LUYA 4JI2J 1GMVA 3GCXP 2OTJS 3K17A 2XYHB 1MMNA 3R5JB 2KZMA 3LQVA 1LWCB 2ZE2A 1S10A 4JI1F 2MGZA 2JEJA 2C28A 4LIWA 4ETZA 1VR6A 4ZPWR 2RQ4A 4CLKA 1S1VA 1X4HA 2HNYA 4RW4A 1NEEA 2KDOA 4GVBA 4Q7AA 2QEXS 2CQ1A 3PYGA 4NLUA 1ZS6A 5HANA 3PYFA 1LFWA 2CVIA 4ZPDA 1IBLF 1ZH5A 2CWXA 3ZZTA 4DBQA 2B4OA 5ETMA 2N3LA 3NGSA 3ETMA 5B0CA 4HEA9 5LMUJ 2C2EA 5F0UA 1Y3JA 3SQGB 4E0DA 2AZ3A 5DJBA 2HFNA 2QX0A 5KFDA 1FJGF 2DITA 1KWMA 4NLGA 3N79A 2FPHX 2Q66A 2MZRA 2UZAA 1FXDA 5K5MA 2IRYA 2QZ8A 1VRQC 2BXJA 1Y3KA 5F8GA 3GONA 4F67A 2PE8A 4M5IA 3CE8A 2VQFJ 3E2EA 2B56A 4YQWA 3O44A 2E5LJ 2M0GB 3V6DA 1AW0A 3M8RA 4C3KA 2K3KA 1R8CA 3MMJA 3CJ8A 1K0TA 1S12A 1V5VA 1HNIA 1OQ6A 1NZAA 3KJVA 4CO1A 4GMKA 1TAUA 1ZA1B 4CTAA 2G0CA 5FIIA 2V5HG 4I7FB 1IKWA 2VONA 1HA1A 2OI2A 1YSJA 2BACA 4ECVA 3HHLA 2IYIA 3HULA 5ETLA 4IH7A 4C0OC 3OXLA 2W8KA 3FZ2A 3PDNA 1MMLA 4CP5A 3NAHA 2B9YA 3ZZUA 2YKMA 1BQMB 1VI7A 2WOMB 4RJVA 3HKWA 4LF5F 4V19X 4DUZF 2BBEA 4R8UA 1GFWB 1T03B 1DY3A 5CHCB 2HHWA 4OYBA 4RU2A 2BV3A 1R3NA 1RWPB 2D74B 4ED2A 4Q43A 4CQ1A 2E1CA 2MMYA 2LXIA 4HACB 3BEGB 1S7IA 2EVZA 3DLKB 1S1XA 1D1UA 5GAHU 2APOA 2BOAA 4KSEB 3UN5A 3B4MA 2IDEA 3KHGA 4L76A 5I3QA 3R3TA 2AYMA 1N33F 4AE5A 5LMNF 3SFGA 2I5JB 3U1NA 3MFHA 4ILLA 2VUGA 4IFVA 4UF4A 5IT9Y 3RB4A 5C42A 3DLHA 3BYRA 2AP6A 2YVSA 1IM4A 3I5CA 4AYBD 1JLGA 4CLYA 4R5PA 3GCWP 4WF9Q 3ILJA 2W8LA 3C6UA 1D8ZA 2JRSA 4PPDA 3V81A 1SVDA 3G8SA 5KFCA 5A8WB 2OPSA 3A12A 3DLLQ 3VGSA 1S9GA 2MHNA 2HZCA 1Q16B 4MAKA 2FJEB 2G2YA 2RQMA 1HW8A 2C3OA 1JXLA 3PRVA 1XNQJ 2OAUA 5T7LB 2GS8A 2OLWA 3FQKA 4USKA 2ZD1B 4CH0S 4G6VB 1U0HB 2VJUA 1VQPS 1X31C 1TKZA 3TAQA 2QLJB 1AB8A 5L1LA 1Y7PA 3NG8A 2KJWA 2UXDJ 2VD3A 4UOCA 4BC7A 4DR1J 3H40A 3TVYA 2I6WA 1VQKS 3A13A 2HG4A 5J2MA 2P9CA 3VZIA 5DLGA 3R5GA 2WAQD 3H2LA 4H4OA 2QC3A 3CDUA 1RACB 3CTRA 3C6TB 4QPTA 1PAUB 4LSLB 2N4DA 1SCJB 1O51A 1LV5A 1VDHA 3FSYA 2HRTA 3JSRA 1UJ5A 3MEKA 3R9LA 1UWBA 2CPEA 4DR4J 4Y2KA 2W4CA 4RNOA 3BN7A 3UVJB 3UD4P 3Q8YA 3WC2A 4I4BA 2RHSB 5D3GB 2ZFHA 2W4PA 3BB5A 2FC9A 1Q8LA 4M63A 3HT3A 5HAOA 2VA3A 2IPOB 1LWCA 4F04B 1VHIA 3KNGA 2JVOA 3DCAA 1UVJA 3RU0A 1DFDA 3KK1B 3TZZA 1PYSB 2AX1A 2GW8A 2GVZB 1NKBA 3H98A 3DOKB 4U6PA 3EM1A 3RRHA 2VB6A 4F26A 5D4NA 4IQXA 3EXCX 4AXJA 2CPFA 1YKWA 1XK8A 3UQSA 5DDPC 1ZTTA 4IRDA 3SQGA 1WJ9A 4I69A 4ID5B 1P9YA 1F9EB 2RT3A 3BKTA 1UEVA 3HFZB 3N6NA 2V2VA 5IFMA 1HD0A 4X4PA 2W7PA 3M6VA 4I6WA 1CLFA 3HO1A 2DD8S 3RB0A 2LU1A 1XN9A 2ILZA 1XQIA 4NCGB 2MQNA 3Q83A 4AUKA 1IVZA 5CH7B 3B78A 3TANA 2K3IA 3O2IA 4PUOA 3GB0A 2AYBA 5HQMA 1ZYQA 3WIUA 5K14B 3LA0A 1ZM9A 4DEZA 4S0MA 4C8LA 4TQSA 3IWLA 4MH8A 2DT9A 2DEJA 4DFJA 3J7ZT 4UOGA 4EZ6A 2MZQA 2ZUAA 3POTB 3IGNA 2P8IA 1J27A 2PEHA 4JI6J 2AD9A 1YBUA 1TFYA 4I7FA 3LGHA 3GILA 1AXQA 2JZ5A 4UQTA 2E44A 3J7Z5 5KFEA 4KKOA 5F9NA 3G96A 2A18A 5BXIA 2QA2A 1BQMA 2WOMA 1PG5B 5KG3A 2XCAA 3CJQA 1UFLA 3DLEA 1L3UA 1F2GA 5L39A 1XMQJ 1CJVB 1T03A 1DTQB 4UUXA 3FKBA 2J7KA 4FF4A 5LJ5Y 1Q1KA 4I1TA 1WF2A 4PEOA 2LQ5A 5F3ZA 4ECQA 2P9GA 3VQSA 1D8YA 1Q4RA 1Q5VA 2EG2A 4HACA 3DLKA 3DHWC 3HI9A 1HHQA 4U96A 4AFFA 4DCOB 3VVTA 4ED1A 2QFJA 2I5JA 5JJBA 3PNIA 2VQEF 4O3SA 4Z7CA 3H5XA 3A4TA 3CF5Q 3J80Y 4R25A 2R7SA 4ZP8A 1NSKL 4TLQA 3F0NA 1WHWA 3MFIA 3VAJA 5A8WA 3WX8A 1WC0A 1HI8A 4YB1P 4ZHRB 4PR6A 3OPKA 1HYSB 5IXUA 1FRHA 4WXWA 2H5EA 5T7LA 1AFJA 1BWVA 2ZD1A 1FDAA 4X65J 2B9XA 3CGIA 1U0HA 3ILOA 3GSIA 2IBOA 1U1LA 2VA2A 1RAIB 4GVLA 3VF0B 4UW2A 2FHOB 5HL7Q 2OGUA 1Z2LA 5KT4A 5IQQA 2NXJA 2ZC4A 2EK6A 1XR5A 1GTEA 1E6VA 1TMMA 3BV8A 5GADI 3ISZA 1RAEB 1EQ0A 2ZKTA 4DUYF 2EI5A 4WU2A 3HVWA 1N54B 5THWA 2CVEA 4F3MA 4JI0J 3FFIB 3C6TA 4LSLA 5D0HA 1RWWB 2J6UA 2HURA 3VAFA 5KG4A 4DN0A 4RPFA 2YTCA 3M30B 2G2OA 3P3DA 5M2UA 3D7SB 4NYPA 3AODA 3WX4A 5CCMA 1H72C 3KK2B 4J9RA 1KVJA 1RTDB 2IJNA 1NRKA 4JV5F 5A8RB 4JI4F 4DR6J 3UVJA 2G13A 3G6ES 5T41A 4N56A 1J5OB 1NPRA 2ATLA 5D3GA 2DH7A 1PBUA 4NLWA 2VKRA 2R7WA 1RISA 1SH0A 5HMYA 3A1YG 4P10A 5HVFA 1RCOB 3IXQA 3ENQA 5KG7A 1H2VZ 4LRDA 5K8PA 1S72S 2GVZA 4CM2A 4RZRA 1Q86T 4DMZA 3DOKA 3U1MA 3E8OA 1D09B 1RHJB 1NDCA 1REVB 1KLNA 3K0JA 2QG9B 1I6JA 2XSFA 1RTZA 1FA0A 1N5TA 3RJMB 4U8YA 1VS3A 4OI2A 1M5SA 1JXEA 2HBRB 2CJ9A 2E5JA 5DGAA 3BH7B 2GVDB 4ID5A 4FYWB 2HYIB 1MU2B 1VFJA 2F3JA 5ETSA 2OELA 1S79A 1MMDA 4NL5A 3OJSA 2BMBA 4OYPA 4KIAA 2Y3YA 4B9LA 2KRRA 1CJKB 1FVQA 2PD1A 4WTYA 3PX0A 4YOEA 1NK6A 4KGMA 1FEHA 4NCGA 2ILYA 4FYXB 4YUDA 2NSBA 1XTZA 4IR1A 4OI1A 1QTMA 4G1IA 4IH6A 3UI3A 3ZTQA 1HHTP 3DKDA 3PJXA 4IOAQ 3OUYB 5K14A 4DQIA 3H5SA 4PQUB 2BOPA 3A3NB 1X4CA 1RWVB 2ZOFA 4HR2A 2AX0A 1K47A 4PQAA 3POTA 3S01A 1RLCL 1JLBB 1LW2A 2RSQA 2WRMA 1YJ9S 3RR7A 1RT4B 4ZOSA 4K4XA 3MAAB 3DI6B 4NOHA 1H0HB 1BY9A 4F25A 2G1DA 2W01A 2ZBQA 1WDDA 1ULRA 1FRKA 4ZLLA 3QRQA 2FD2A 3IP0A 2UU9F 1NSQA 4CO2A 1FI4A 1N5YB 2DNHA 2MJNA 1LXJA 2RKIA 3M8YA 1CJVA 4NPOA 2E9TA 2R8HA 4LR8A 2OFHX 3ZTPA 1VLYA 4AXIA 2OEMA 1I5OB 1U25A 1QLNA 2BE9B 4L72B 2FQQB 4ZVFA 4P9SA 1P6TA 4F0HA 3CCQS 4FF2A 4E8UA 1BD6A 4HTJA 4FF3A 2H1YA 1VRUB 2KHCA 4L75A 1VK3A 3OQ2A 1VGYA 2Y8YA 4MIAA 3M6WA 2Q6CA 3T19A 2IVFB 5AT1B 3J7YI 1KN6A 3N5BA 1RAFB 5H9FK 3CJ5A 2HVIA 1PO6A 2CJBA 4LRAA 3ELHA 3OL9A 5KFOA 3JXOA 1K9MT 1IR0A 1IM6A 4ECXA 3Q24A 2NZ4A 1HI1A 4ZHRA 1XC9A 1UVNA 4PG5A 1HYSA 5KFLA 3K89A 1VQ4S 2QLWA 3BPSP 3L7PA 2RRAA 2FLPA 4P2SA 2AGPA 1HLWA 3Q89A 4F0KA 4WK1A 4BCAA 4C6AA 1P1LA 3MR5A 1FESA 4PWUA 1FWPA 3MM6A 2KN4A 4DV4F 4MKVA 1T8EA 4WK3A 3UNGC 4YFUA 2B5JB 2R9LA 2E7XA 2ZUGA 2Z2LA 2VODA 2GO9A 2QL9B 3HX9A 4ZVSB 1U09A 5H9FJ 3W66A 1R43A 4YHHJ 1YJNS 4RWWA 3JQJA 1A6LA 1M5VC 4NLDA 3JTNA 1VBXA 4Q2LA 5KFWA 4I0WA 3UNYA 4O44B 1EETB 4ICLB 4J91A 1LWEA 3M30A 5HN0A 5KT6A 1H7WA 2KU7A 3QMQA 2GIFA 3RBDA 1RU2A 4OHYA 3MCSA 2LEBA 1FO1A 1RTDA 3OHAA 3W7BA 5A8RA 3E3XA 2W2QP 4M95A 2EFOA 4EYIB 3MOJB 3G87A 2OPRB 3VWSA 6AT1B 4ETXA 1NU4A 1R8BA 3GFXA 4B9NA 2WHOA 3RAMA 2Y0BB 3K5PA 2IM3A 1SJ1A 3N9UC 4TYAA 4Y2MA 1VC6A 1DQ8A 1W2IA 1M1HA 2VC1A 2XSJB 3I6PA 5KT2A 3BF4A 5CA5A 1QDUB 3BBCA 1REVA 3CC7S 5KFGA 4M5LA 4DV3J 4OYXA 1Q81T 1T9XA 5L38A 2X1BA 1NHKL 3B6BA 1D9FA 2F9JA 3R8YA 1YWXA 1CQNA 4ID8A 4CO5A 3IC1A
chains in the Genus database with same CATH topology
1P8GA 5HO4A 2W4DA 3DLEB 5KFTA 2AJ4A 1K8AT 2R2RA 5KFMA 5J1EA 3I0RA 6FD1A 3EYZA 4JOUA 2YKAA 3RAQA 2RD5C 4CI0B 2V8HA 2JH3A 3FNNA 4JV1A 2A1BA 1U4BA 2RRBA 4LF9F 3MEEB 2HQ3A 4MFBB 3M6UA 2CJQA 3HHLD 2PFFB 2VFSA 4QOTA 4QR2A 3OFFA 3PW2A 1QAIA 2DNNA 1RT6A 2L9DA 5B0EA 2HWTA 2DHSA 1G7CB 5ITHA 4OLPA 4A48A 4LF7F 4G1QA 4LSNA 2R4FA 2MPUA 3GFZA 3R1HA 2XLIA 2J0WA 2IM2A 3LH2S 3MUVP 2FLOA 1AFIA 1IKVA 3N5FA 3R5DA 4U9RA 5J1NA 2ZJPQ 1NNDA 5BYSA 3I32A 3CT9A 4F4ZA 4TY9A 2RUGA 2OSQA 3OSNA 2YX1A 4DL6A 4PQUA 1S6QA 3DOMA 1U47A 4UY85 5KFZA 5DQGA 3VALA 2ASLA 1HL6A 1GXUA 1FDBA 1FEEA 2YH0A 3V4IA 4ZPAA 3PY8A 4EU0A 1HBNA 4CNZA 4TLRA 3PJWA 4DL4A 4Y28C 2CPZA 2QRRA 3H4BA 2MQPA 5LXYA 3SMZA 4YY3F 3GFYA 2DNQA 5LJ3Y 1WD6A 2HS4A 1U26A 3MTKA 3TO8A 1SJ3P 2B9WA 3OR2B 1N34F 3F73A 4H4MA 1OO0B 2PN6A 3DM2A 1JMTA 1X5TA 3BSOA 1JLFB 2PIIA 2XWYA 3V6DB 1NJWA 1B64A 4EO8A 3MAHA 3IRXB 4Y65A 1KRPA 1Y5IB 3QO9B 1PGZA 3KNAA 2YH1A 1Y4ZB 4K0KF 1XERA 3I31A 4PXBA 2RH3A 2JL9A 5EHHA 1KSPA 1X4GA 1FD8A 3DI6A 1TKTB 4U7CA 3CD7A 3Q2TC 2K7KA 1FRJA 3FRZA 3KK1A 3KJVB 4YR3A 1R27B 2OTLS 5CCLA 1HNWF 4NXMF 1QAYA 4KO0B 2NPFA 2KT3A 4K5SA 3FCHA 4IR9A 1APSA 4HLBA 3MMBA 1C0TB 4JI8F 4XPCA 3PIPQ 3KYLA 2HNZB 2IC3A 4JYAF 2MSSA 2HFZA 2D7SA 3NBPA 5A8KB 1Y0HA 1T02A 3C2PA 2HHQA 2YNFA 4JV2A 4NXNF 3U1LA 3CJ0A 1WF0A 1M5KC 3DYAA 3DRXA 4M5DA 4D3HA 3G9CA 3NNCA 3HLUA 4FP9A 2UV8G 3T5KA 3K59A 2R8GA 1IKWB 1S9EA 3MM9A 2OO4A 3ZFVA 1N5YA 3LAKA 4OI6A 4O3NA 2ROGA 2EK1A 5F9LA 1NJXA 5FJ4A 3GG0A 3UCUP 5D8HB 5B0GA 2O01C 3TW0A 4QW9A 1KTVA 5E41A 2KM8C 2ZHAA 1P27B 4DSLA 3Q0AA 2Y0SD 1DAXA 2DGWA 2BE2A 3NKYA 4ZKAA 4F8RA 2XLKA 4O3OA 3GYXB 1IJEB 2N4CA 3TUZC 4DLGA 2DNGA 2Z2MA 1S1TA 2G4BA 3T1HF 3OTOF 5KG6A 1ROFA 5KFIA 2LLZA 2DGSA 2KG0A 2V94A 3CJ4A 1HARA 5L1IA 4J9QA 2YNHA 4F3QA 1U1RA 4MJKA 1R7IA 3G6XA 3BO3A 1N8RT 4X84A 2FC8A 5KG2A 1M1KT 1H3DA 2YKMB 5DDRC 1LOUA 1YGYA 2B0GA 5G0RB 1TK5A 4IQMA 2RVJA 3T3FA 3VAMA 1L3KA 2YX4A 3QGIA 4R8UB 2AWZA 2VC0A 2KI2A 2XMJA 2A3JA 4DFPA 2KYZA 1D0EA 4EZ9A 1RYRA 2E5IA 2YKQA 2HIQA 2MKKA 1DHMA 2ALZA 3HZEA 2A2DA 1E6VB 4MKBA 3AHPA 1RTJB 2EFGA 2CZ4A 4Z37A 1N0UA 1RT1A 2A10A 3HVTA 4NLSA 1S9FA 1VQ9S 2HHTA 3L3CA 3Q22A 1NAQA 3BQ1A 5DM7Q 4LF4F 5IS2A 1KOHA 1WEXA 3MECA 5F3TA 3ITHB 3CCZA 3SFUA 4WZMA 7FD1A 4F2SA 2FB0A 5E0OA 3MHYA 5KFAA 3NGKA 2IM1A 1NK8A 2DO4A 4OZJA 5KFBA 3EUNA 1VK8A 4HVZA 4YHHF 4RNHA 3CDEA 5CZVA 3UD3P 4NZ7A 3Q2SC 4ATNA 2R8IA 1VRTB 1R6YA 1QE1B 3BZQA 3CSKA 5LSLA 5DG8A 2LDIA 3QLHB 4IH5A 3G4SS 1NJZA 2J0QD 2HFOA 1LW0A 3V2UC 3RRGA 4F2RA 3X1LB 3OTDA 2I8EA 1U6FA 4ZVHA 3KLGA 1VMBA 4J5OA 4FBTA 4DR3F 4LVNP 4O4RA 3OVAA 1E6YA 1ZOTA 2RQCA 1T3OA 4DV5F 3CDBA 4PXEA 3NP5A 1LQ9A 4NYZA 3AAWB 1IKYB 1RA7A 4WXOA 3TVKA 1DQAA 1D9DA 3QAUA 2QT7A 3QAEA 3HJFA 1KQKA 4CH1A 4IFVB 1U6ZA 4WYLA 5E3CA 5C42B 2MKSA 1N5QA 1IQTA 4ED8A 4BC9A 3MPVA 1HFEL 1AROP 1H98A 2DGQA 3FJ2A 2UUBF 2LA4A 5KFFA 1JLGB 2DK2A 3D1QA 2DNOA 5DG9A 3GV8B 2FHKA 2JFDA 4R5PB 3C3LA 1UETA 3TX8A 3FEXB 4TU9A 3SV4A 2M8HA 3DRSB 4KC5A 2AJ0A 3C6UB 1TFWA 2J6TA 2KH9A 1P9QC 2NLWA 1MROB 3V81B 1GTHA 5D6GA 2E1MC 4ECZA 2AYGA 1N88A 2VG7B 2ERRA 1HWKA 4Q2MA 4ED0A 3JB9k 3US5A 4OI3A 3NNHA 5KG1A 1HHSA 1DJ0A 1HBOA 1TL5A 1QJHA 2GFFA 3D1HA 4KHRA 2AYEA 3V6KA 4IKAA 5AE3A 1RT7B 3M32B 2VG5A 4ZVEA 4CT8A 2C2RA 2LQ9A 3MF5A 2B43A 3T1YF 1S9GB 1I94F 4LJMA 3BJYA 2A2CA 2GJ2A 2KVIA 2HPUA 4BDPA 3WDOA 2XZWA 3U02A 3LP2B 3GE9A 2QV6A 2BQUA 2QA4G 1HNZF 5IQ6A 1OWXA 3M8QA 2KJVA 2FJDB 2LQBA 3NRBA 3HF5A 2ZVSA 4OHWA 1FNXH 2K2PA 2B5JA 3IR5B 3W2WA 3QGHA 5AXMA 4Z2XA 1CVJA 3OXFA 1DTQA 1DTTB 2MKCA 4JV0A 2XNQA 4QPXA 2M5YA 2V0NA 3DLGA 2EC0A 3GWCA 2OMLA 3M2UB 2DNMA 1NKEA 1S48A 1DQ9A 2MQOA 4PXDA 3LP0A 4J9NA 1X4BA 2AQ4A 1Y5LB 5AE1A 2R7VA 4IUFA 2IHR1 4E98A 4M1KA 1R8AA 1X7VA 2BRLA 2IA0A 2GIRA 4K2XA 4V19J 5HP1A 2JJ4D 4C11A 1FT8A 1OSDA 5DS7A 2GC8A 3T5HA 2CPHA 2HGLA 1ZAXA 2P9EA 3MWBA 4DV3F 4Y2CA 2HQIA 5LSOA 2N3OA 4ZCMA 4B08A 1VQLS 1NH7A 4OIXA 2QIFA 2VASA 4PG8A 2GHWA 3M9MB 5J2MB 1RTHB 4RUHA 2M9KA 4ECUA 5KFYA 2CYYA 3IFEA 1EETA 4ICLA 4QYZJ 1SUQB 2RQKA 2LU2A 3FMWA 3J81Y 1NJYA 2C3UA 2W24A 4JI3F 2KM8B 4H54A 3W3SA 1Y5NB 1YHQS 2E9ZA 2KHDA 2LECA 2ZH2A 2BQ3A 4DOZA 1X4AA 2BJDA 2QE5A 1TKDA 2X51A 3NS5A 1K1QA 2NUUG 1K0VA 1Q78A 2DHGA 4TYBA 3DOLB 3RW6A 2ACYA 2CQCA 1FK9A 2ASDA 1U48A 3CJKA 1FKAF 3KTQA 1XMOF 1HNVA 3DMJA 4ZPTR 1H2UX 3OL6A 3FZBA 2Q1LA 4DR5F 4F4XA 1YBAA 4ES3A 2P6SA 1NO8A 4LQ9A 1QSYA 3IO1A 4XPEA 2HW3A 3S1TA 5LXRA 2XMMA 2FLNA 4OHVA 3HPOA 4ED6A 3GG1A 2J7WA 4FBUA 2DRBA 4HI2A 4RBTA 1L5UA 4OZ0A 2HWHA 3JYTB 3BQ0A 2CQGA 4DSEA 1RKJA 1VIOA 4HT7A 2GMLA 2OSRA 2UVRA 2OPRA 2ZDPA 4OX7A 4XDCA 3TP2A 5FLXY 4DL7A 1M90T 1Y9OA 5KOWA 3MXHP 2DR7A 4YB6A 2E9RX 2RIJA 3PIOQ 4B9UA 3PRDA 3BGLA 4IDKB 3MEDB 4X4QA 3KHHA 2DGXA 1U1MA 1TL1A 5C25B 3DRPB 3UR0A 1U8SA 1RTIA 2FJVA 4OX9F 1F5BA 3SXLA 4NYOA 3B82A 2GGPA 1C0UB 3CMES 4X4UA 4DJBA 4AL5A 1UVKA 3CEDA 3KFWX 3O3LA 1G2EA 3LGNA 4K5RA 1FTCA 4MYTA 3AJ1A 1U1QA 3W2VB 3BDEA 4DN9A 1FRMA 2YNGB 3NLCA 1T05A 4LT6A 2UUWA 2IYGA 3LUYA 1A9NB 4B9VA 1D3WA 3DXSX 1KEKA 1UA0A 1JLEA 1WNEA 2XSJA 2V4JB 4P6QA 3H4DA 2BDPA 2FHJA 2R8KA 2XY7A 2OTJS 1LW2B 3JAMY 2GCFA 4OJHA 4EYHB 4B9SA 1MMNA 3Q8QB 2KZMA 1QVFR 3LQVA 3TRGA 1VHFA 1LWCB 1T95A 2ZE2A 3AQOA 3TAPA 1S10A 1JIHA 2NPIA 4FXVA 1X5OA 2HLUA 2KB2A 4JI1F 5JVGQ 2MGZA 2JEJA 3H25A 3AA8A 2C28A 3P6YC 5E3RA 4LIWA 4ETZA 2ZH9A 4LIRA 4ZPWR 1N6QB 2RQ4A 2HHUA 1S1VA 3M8PA 1S97A 4TQRA 1X4HA 2HNYA 3I87A 3MMAA 4RW4A 1GAOA 3WZ0A 3D1OA 4B17A 1TK0A 1OSCA 1NEEA 1R8HA 1JLQB 2KDOA 1N4LA 2UVWA 2DCUB 4Q7AA 4DF4A 2QEXS 2CQ1A 1R0AA 4NLUA 1U49A 4R0JA 3T6JA 3RB6A 2U2FA 5A6WA 5SZTA 3KLFB 5DLFA 2ZBIA 1LFWA 2CVIA 2X1AA 4JBCA 3BGFA 2GV1A 4C3LA 2OPQA 1SH3A 1VOMA 4ZPDA 1U2FA 4K4WA 1IBLF 1ZH5A 2ZH5A 2NREA 4DQSA 3ZZTA 4DBQA 4A46A 2B4OA 2RKIB 1M5OC 2N3LA 5A6PA 3E01B 3QJPA 1LK5A 1SJFA 2DIUA 3FFIA 5B0CA 3I5AA 2J76E 1SKRA 4HEA9 2X1FA 4X4TA 1N48A 4C9DA 1DARA 4A8YA 3UCZP 5CQGA 2C2EA 5F0UA 2VOPA 1Y3JA 1LWFB 3MEEA 3SQGB 4E0DA 5KTQA 1SJRA 5D78A 5L1JA 1CC8A 1XR6A 3H2UB 5DJBA 2HFNA 1RQ0A 1S99A 4PCQA 3KLIA 1LKZA 4A8KA 4ZCIA 5KFDA 4UUWA 5D77A 1ZETA 1FJGF 2DITA 3PRBA 2Z8QA 5D4PA 3RYLA 3ZZ0A 3NMAA 4ERDA 2K8GA 3Q23A 4NLGA 1HQEB 2V2KA 3LWLA 3N79A 2FPHX 2Q66A 3N0VA 5B08A 2MZRA 3OR1A 4IG3B 3KK2A 2JC0A 2UZAA 3ZC4A 1FXDA 4UQGA 2EFQA 5K5MA 4PG6A 4ZMMA 4QR0A 2IRYA 2QZ8A 2UV8A 3K8VA 4TU8A 1X9WA 2FHMA 2B4VA 1KLMB 2BXJA 1Y3KA 5GAGI 2GQCA 4BBYA 1NKCA 5F8GA 3QGPA 4F67A 2PE8A 2JSXA 2XC9A 4TN2A 4IYQA 2W9CB 4KHMA 1J5OA 3KWMA 3LP1B 1HBUB 5T14A 3OSPA 1TUVA 2XY5A 2XMKA 3CE8A 3SEOA 3OR2A 3E2EA 4PWDB 3IWXA 4RW8B 2B56A 4YQWA 2XBPA 4RU9A 5DO2A 4KPYA 3O44A 2M0GB 1JLFA 3V6DA 2DVIA 2RU3A 1AW0A 3M8RA 4C4WA 4C3KA 2K3KA 4NZ6A 1R8CA 3IRXA 2QA1A 3GMGA 3MMJA 3CCJS 1K0TA 1HMVB 1HNIA 3UE2A 4URQU 1OQ6A 5I4MA 1NHVA 1TKTA 2ZBCA 2M2BA 1NZAA 2L9NA 4I2PB 3EZ5A 3KJVA 2FGOA 2JEFA 3QWPA 4CO1A 4GMKA 1TAUA 4Q45A 2DGVA 2I9SA 2SXLA 4B3TF 2WBRA 2PA3A 2O66A 2XHWA 4Y2AA 4CTAA 2XGQA 2K1RA 4CT9A 3K5LA 2HNZA 2MZJA 5GADU 1Q8IA 2LEPA 5A8KA 4OV1A 3U27A 2G0CA 4EUVA 5K9FA 4ZK7M 2IAJB 4I6AA 5FIIA 2ADCA 4ZP9A 5J1PA 3TQ1A 4PG7A 4YB5A 1C2PA 4O0IA 2V5HG 4I7FB 4BS2A