1SB6A

Solution structure of a cyanobacterial copper metallochaperone, scatx1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords copper chaperone ScAtx1
publication title Solution Structures of a Cyanobacterial Metallochaperone: INSIGHT INTO AN ATYPICAL COPPER-BINDING MOTIF.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Chaperone
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sb6A00
3HHLB 3KNGA 1YJTA 4EFAC 2LXFA 2XMUA 2IYGA 2OD4A 2BJEA 2OD6A 1YJUA 3DXSX 2QYCA 2XMJA 5K9FA 5T7LB 2OFGX 2IFXA 3MZIA 3T9NA 1URRA 1N5SA 2ROEA 2W4DA 1S6UA 1TUVA 2BUNA 2FTRA 3HHLD 3K7RA 3CJKA 2BBEA 1MWYA 4A47A 1FE4A 2W4PA 1AFIA 1Q53A 3BM7A 2HFNA 1IUJA 4HH0A 2GO8A 2K1RB 1YJVA 5B0AA 1P8GA 2XMWA 2K7KA 2N7YA 2XMKA 2W4CA 3F44A 2L3MA 2Q3PA 2FIUA 2XMTA 1YJRA 1OSDA 3GZ7A 1W2IA 1TZ0A 2K2PA 2AW0A 1Y0HA 2RU9A 4ZA1A 2HQIA 1JK9B 3HDSA 4YEAA 1FESA 5B0EA 5F0WA 5T7LA 1SB6A 2XMVA 2OFHX 3BF4A 4Y2KA 3BB5A 4HI1A 4DL0C 2PGCA 1Y3KA 2PD1A 1YRXA 3HX9A 3FMBA 3VTIA 4DN9A 3BDEA 5B0DA 2ACYA 2FHMA 1X0PA 2BYCA 1JWWA 2FB0A 2IYIA 2ZDOA 3LO3A 5B0FA 5F0UA 2QIFA 2K1RA 4FNIA 1AFJA 2ROPA 1MWZA 3HHLC 4FNHA 1Y3JA 1FEEA 3LGNA 4DPOA 1AW0A 3TOQA 2GGPB 4NPOA 1TL4A 5KAKA 4OJ1A 1CPZA 2GCFA 1KVJA 2LDIA 3HHLA 5IXUA 2AP6A 1CC7A 5B08A 4A4JA 2RILA 5A6PA 2RSQA 1ULRA 1QUPA 4Q2MA 1FVQA 4NL5A 4ZOSA 2N4DA 2OKQA 3QGPA 1Q8LA 1LQ9A 3LGMA 2VV5A 2VH7A 1TR0A 1GXUA 1U7LA 1OQ6A 2KT2A 3BN7A 3IWXA 4OIXA 5A6WA 4HI2A 1KVIA 2JDJA 2QLWA 1YG0A 2HFOA 3BGUA 2GFFA 3HFKA 4OJGA 3E8OA 3TRGA 4A46A 3KKFA 3WDOA 1RJJA 2LQ9A 2LQBA 1Q4RA 1FVSA 1R6YA 3MCSA 5B0GA 1APSA 5B09A 2HIQA 1Q8BA 1K0VA 2KT3A 1X7VA 3QMQA 1XBWA 3TNVA 1GXTA 1WD6A 1VQSA 4A48A 2N4CA 2RMLA 3CJKB 1VQYA 1S6OA 1OPZA 1Y9OA 3I9ZA 1OQ3A 2BJDA 4YDXA 1FD8A 3KG0A 2GV1A 2HLTA 1KQKA 2ROGA 2K7JA 4Y2IA 1SQEA 3UDCA 2GGPA 2QLXA 1N5QA 4OJ3A 4QOTA 4Y2MA 2ZDPA 1N5TA 5B0BA 4OJHA 2CRLA 2XMMA 2KKHA 2OAUA 1FE0A 4HH1A 3IWLA 5B0CA 4F67A 1N5VA 3FRYA 2ASYA 4HL9A 2KYZA 1P6TA 2HLUA 2GA7A 3KG1A 2EW9A 1V3ZA 2AJ0A 4Q2LA 2OMOA 1SI9A 3DCAA 4U9RA 2AJ1A 2OP5A 1TL5A 3HF5A 2G9OA 1CC8A 3BR8A 1X8DA 3FGVA
chains in the Genus database with same CATH superfamily
1DQ8A 2V69A 2JVOA 4J37A 2XLJA 4GC6A 5ETKA 2YNIA 2V34A 4BC9A 4WCEQ 3DHWC 4ZVGA 3J81Y 2IAJA 4Y3CA 1JK9B 3IR6B 5DZ6A 3T3FA 1L3KA 2O01C 2LDIA 4KR0B 1TFYA 2IJNA 1LWEA 2OKQA 3LGMA 2NREA 5EN1A 4YS2A 2HS4A 1JJ2R 1JLGB 3MOZA 3QAUA 2UU9J 1XTZA 1VYAA 1DY3A 5M2RA 1DTQB 4Q8EA 3M6UA 1KLMB 1RT7A 2MZRA 5CAAA 5DS7A 3W64A 2GIQA 3EDQB 2XYHB 2QV6A 3NNCA 2NYIA 1U1RA 3DI6B 3B4MA 4RU9A 4PUOA 5L39A 1LFPA 3C14B 4DFKA 3OTOJ 2YNHA 1BQNA 1KFSA 4N56A 3M8QA 2X1GA 3KDNA 1FKOA 3WHIA 4H4KC 3TAMB 5ETQA 3AD9C 4DU8A 4IYQA 1RTHA 3ZZOA 2MKSA 3MMJA 1M5PC 1V5IB 3PIPQ 4RWWA 1JJCB 2ZOMA 3D68A 1N32F 1MROB 1RHMB 3SCLE 1I6JA 1RSCA 4O4GA 4QW9A 2VA2A 1S0MA 4B3OA 4WE1A 3M30A 1RHKB 3CGIA 3NP5A 2DR7A 2CPJA 2D3O1 1RU2A 3MF5A 2QEXS 1NK0A 4CI0B 1B7YB 2R8JA 1N0UA 4ZLLA 5CABA 4N76A 3ZNJ1 4JI5F 1HR0J 2VDIA 2V8DA 1QUVA 4Y2IA 1RQ0A 2VBZA 5J2NB 3D7SB 3PYDA 3JTPA 2HQDA 2HRTA 3P5TL 2J6SA 5C2GA 1HWLA 1LWFB 2DISA 3VAKA 1E6YA 4ED4A 2YQ3A 1TL7A 3CEDA 5HL7Q 3QPIA 3LWMA 1DJ0A 1R3NA 3F44A 2XMTA 4C48A 1JQGA 3H4DA 4HHUA 2DNGA 4HLBA 4MIBA 1SIZA 2EC2A 4M5DB 2WOMA 1S9GA 2OPRA 1L3TA 3TQEA 4MKVA 4ECVA 2FUG9 4NXNF 2HHQA 3A1YG 3PFOA 4EZ6A 4NLTA 3TA0A 2MDAA 1LK5A 2BANA 2MKKA 2L48A 4N47A 1UVNA 5T14A 4A8KA 1I94F 1GXLA 1G3OA 1YBTA 3OL6A 2DT9A 3AOAA 4C0BA 4DUYJ 3GFYA 2FLPA 2GGPA 2NR0A 1ZS6A 2XYGB 1DURA 4DG1A 3I56S 4ZHRA 3KK1A 2DKOB 1F6TA 4OI6A 3GV5B 3EXYA 2ZEJA 2JFKA 4K4YA 3VVUA 3LGHA 4Y34A 3FK4A 3MEEB 1S1UB 1EKSA 4IFYA 5ETPA 2DXDA 2OD6A 3D66A 5KG4A 1O8BA 3C8YA 3GG1A 1Q0NA 1IR1A 4Q45A 4Y65A 1RTJA 3PG9A 4DR7J 4GVLA 2W2PP 5T7LA 1NMEB 1ZM9A 3M8YA 2BVZA 1IKWB 2H3EB 1DLOA 3D0GE 2FZKB 1ICEB 5GAHU 4YP3A 4PXCA 4P10A 3MM7A 2AJFE 3GIMA 2FZCB 4RNHA 1XQIA 1RT4A 3UN5A 3PKMA 3TWZA 4JI4J 3BYRA 4KGZB 4V19J 2KT2A 1VJWA 2OMLA 2KO1A 2QZ8A 3Q23A 4PABA 2LQ8A 2OHDA 6AT1B 3IC1A 2RB7A 2MB0B 1VGYA 2C2NA 4KQZA 1UJ5A 2D3ZA 1NSAA 3QIDA 3RB0A 2R7OA 1XNQJ 4EEYA 2XMMA 3IWLA 3GJSB 2V9KA 2QFJA 4I2PB 3UCGA 5LT5A 1U45A 4RZRA 2AZ1A 3H59A 3GLJA 4F04B 2QG9B 3UR3C 3MHYA 1MU2A 5HK4A 4B3RJ 2DB1A 3VCDA 2FVQA 3POTA 4NX9A 1N48A 3UR0A 1UWBB 4B08A 2PD1A 2DHGA 1IXKA 2NUUG 3LO3A 1TL3A 4ILMA 2IRUA 1SQFA 4FP9A 2D3UA 3AD7C 2FVCA 3ZTSA 3A12A 1FDBA 1HI1A 1T02A 1ZPWX 1WHXA 1EKRA 1N5YB 2KTQA 5EWGA 1NHKL 3KJVB 2YKAA 4MK7A 4X4RA 3R5DA 1VBYA 4IFVA 5IS2A 1FERA 2G13A 4AL6A 4WFXA 3N5FA 4Q0BB 3UCZP 4NWBA 4CDIA 4N5SA 4A8QA 3Q22A 1N36F 5ETMA 3SCKE 3BBFA 2MY8A 2J76E 2NZ4A 1DTTB 1JLBB 4LSZB 3G6VA 1TL5A 2CNNB 2HS0A 3D6FB 2KRBA 4NZ7A 5L8RC 1HD1A 1YJNS 1GX6A 1YRUA 1HLWA 1WUUA 1NU4A 2VA3A 4UUWA 3W5YA 1AROP 1M0SA 2Q66A 4OI2A 2XMWA 4OZNA 4EMDA 3PEJA 2XMVA 3S01A 3KLVA 1S48A 4N7TA 2VPXB 2XNQA 2QIFA 4D3GA 3PJWA 1TKDA 3LGNA 2V4QA 5KAKA 5D6GA 3QYYA 2FHJA 1WC1A 2X3GA 2RNEA 1HNWF 4DSLA 3O5TB 4OX9F 2HQGA 4X4VA 1WNEA 2F8HA 1RWXB 2Z57B 1FXRA 2IBKA 1B4SA 2EG1A 1N56A 1H3DA 1PO6A 2DIUA 4I67A 1X7VA 3TVYA 3M8PB 3CDUA 3NEKA 1U24A 3MTJA 3VGTA 1CS4A 1KQKA 1JLFB 4NLDA 2L9DA 4RL1A 4RUCA 4PG6A 2XO7A 2W9BA 1GMWD 3JSMB 4LVNP 1EHWA 1S9EA 4UOFA 1U0HA 4DPTA 4XDDA 4KKOB 4A8FA 3KLEB 1SI9A 5L1LA 1WOOA 1RHUB 4BBYA 2HFSA 4JI6J 1BWVA 4ZVTB 3PIOQ 4TQSA 1RCXB 2KXHA 3S7RA 4WBFA 5HBMA 3LP2A 2O5DA 2K1RB 4GKKF 5F0WA 2AZ3A 2JZ5A 4O23A 3FFIA 3HXMA 4BDPA 2DR6A 2NXNA 3THTA 2YKNB 4X4PA 3NGSA 4Q2MA 2L9WA 2IRXA 3PEHA 1UKUA 3FQKA 2HGLA 2E7VA 3DLGB 3RBEA 2DGXA 4EYIB 4CTAB 1MWQA 2Z56B 3H2LA 4LR7A 4AYBD 4YY3J 3KYLA 2QL5B 3R2CJ 2KJVA 3W3SA 2JRSA 4B9SA 5A0YA 3MUMP 3KLHA 3HMJG 2HHWA 2VG5A 3CJ0A 1KOOA 3CVKA 3LAMA 2H5EA 2FLOA 1GMVA 3EVOA 2XWXA 4ENOA 5AE2A 3IGNA 5BR8F 1X31C 3I5AA 2E29A 1CQNA 1FEHA 3G8TA 1CG2A 1S6UA 2ABYA 4N41A 4X62F 4RW9B 1IUJA 4I6AA 1T03A 5L46A 1FJEB 3NCQA 2BACA 4AQYJ 3NS5A 4OYXA 4CH0S 4JI7F 1NDKA 5KFAA 4DV5F 1R8AA 3PHEA 3ILOA 1NH7A 2B4UA 2EFPA 4CYUA 4CT8A 1T3NA 4YHHF 3EVWA 5IT4A 1QSYA 3J80U 2BRLA 1LQ9A 3FSIA 4LRCA 3MM6A 3HK2A 3ZZTA 2W01A 1NK5A 4M5KA 5ADZA 4DR3J 2KZMA 3W9JA 3RW6A 2H5JB 3V5RA 3MAAB 3ISNC 2JEGA 5FLXU 2CA9A 3DLHA 4I7FB 1ZZNA 3QLHB 3PR4A 3Q0AA 3QRRA 3VGUA 1CJUA 1X60A 5KG0A 5IC6B 1RTIB 4P52A 1Y7PA 3F56A 2GIRA 3BGRB 5JVHQ 1RP5A 1FK9A 2CQ1A 4O44B 5K14B 1C0TB 2F4VJ 4DSJA 4KRWA 2XSJB 4K4SA 1R89A 4DU7A 4TU9A 2NPIA 4NCGB 2B4OA 4WF9Q 3E01A 4HH0A 4LRBA 1HW8A 1U49A 2MPUA 3TARA 1D8YA 3UD4P 1SC6A 2I6WA 4CO2A 2ACYA 4DR5F 5F8MA 2A1BA 5FIIA 4CO4A 3VZIA 2MJNA 2ZM6F 1EARA 4GO7X 2ZVSA 3SFGA 4NZ0A 1PAEX 2IJFA 3TYTA 4A46A 1IJFB 3BQ2A 1XIQA 3LQVA 4RNOA 3CJSA 7AT1B 3TI0A 4NYPA 2FPHX 5GAHI 4EWTA 3C2PA 4Q43A 1LKZA 4EBEA 1NSPA 4RKUC 1VC6A 1NDPA 4ZVPB 3B54A 3CB4A 4RNNA 2KVQE 1HI8A 4KHRA 2AJ0A 2RRNA 4DPWA 2FGCA 2LA4A 1RE1B 1FWLA 1IBMJ 2BJ8A 3RAXA 1F3FA 5J2QA 1MSWD 3HKWA 2QFIA 1RWUA 3EZUA 1F0XA 4DQSA 2W4CA 1NH8A 3KXDA 5AJ3F 3BB5A 4V19X 1T05B 2HBZB 2W2OP 4IUFA 3MM9A 4ZVEA 3RU0A 4I2QB 3TX8A 3K5MA 4IOBA 2CQ3A 2V8VA 1N52B 3Q86A 2KH9A 2B9XA 1LWXA 3SCIE 1CC7A 2DGSA 2WTFA 2QE5A 2KYXA 3FMWA 3NGRA 3KJFB 4FPIA 2FY8A 1OQ6A 2AEMA 4HYKA 1NJIT 3H4BA 2FDNA 3HHKA 3LH2S 1F3VA 1N88A 4FXWA 1WSVA 2FGOA 2PEBA 1AUSL 3DM2B 1HBMB 3QZ7A 3DC2A 3QBCA 2YNFB 3THVA 3WIUA 2QLXA 2ASDA 4NYZA 2HHTA 2V50A 2CPIA 2EK6A 1N5VA 3CULA 5KFFA 3K2YA 3DCAA 1EQ0A 5D3GB 1JLGA 4MYTA 2EFVA 2J0SD 5CD4A 4ETZA 3PW5A 5I4MA 3AOBA 3ZTRA 4OHZA 1DTQA 1Y00A 1KLMA 2NPFA 5IZHA 2LECA 4LFAF 2LQJA 2AEJA 4IOCQ 3ADAC 3BR9A 2VL1A 1HKAA 4DPOA 3HVTA 2VBXA 3DI6A 3N6MA 2DH9A 3GCWP 3C14A 2N7CA 1UZDA 1FXLA 3PVXA 2DR5A 2LP4A 2ZD1B 1PC5A 1FFSB 1IM4A 1X4DA 1XK8A 4WFZA 4O3NA 2IDLA 4I4BA 3K89A 3S8SA 3ULHA 3CJKB 3TAMA 3QJPA 4CLKA 4HEA9 5FLXY 4DSEA 3O44A 1KEKA 3LANA 3FEYB 1HNXJ 2FVPA 3IS9B 1GT8A 2VPYB 3HHNB 5IC4B 3H0PA 2ZOGA 2JVRA 2IYIA 5JMNA 4RUBA 2OFGX 1UA0A 2BW7A 1BGXT 2BX6A 5H1SV 2GZOA 3OVBA 5IM0B 1KN6A 1Y0HA 3G71S 2LVWA 5B0EA 2DHAA 1XMOF 2R8IA 4X66F 5EWEA 5J2NA 5FD1A 2UVUA 1UMJA 3QZ8A 2QA4G 2DJWA 4YB6A 3H90A 1IBLF 5IV4A 3OXGA 1FRIA 2QSWA 4MJKA 4ZCMA 2ZKUA 1SJQA 3BQ0A 3HCXA 5D0EA 3OT9A 5CQGA 1RT1B 1V3RA 1LWFA 4OZLA 4QCLA 3KUGA 2VH7A 8RUCA 1OYDA 3U1MA 5HANA 4NLSA 4F0MA 3QJJA 1SKWA 5KOWA 1S77D 4UUXA 3VVTA 4M5DA 3BYPA 2HGNA 4F3QA 2CQ0A 2YPZA 4WIIA 1N34J 1H2UX 2QMUB 4A8MP 1NNDA 1Y5IB 4KGXB 2E5GA 2FQQB 5F3ZA 4ES1A 2BOPA 2UUCJ 2UUAJ 3FBFA 3C6UB 3SQOP 2Z2YB 2W4DA 3SCJE 3DOKB 3VWSA 3Q2TC 4ZDNA 5JUMA 1HNZJ 1FDNA 3SDEB 4DV2F 2N7YA 4B9VA 3OFFA 2W2MP 4KT0C 1D9FA 2WBMA 5L1IA 5F8IA 5E7OB 2ZBCA 4ED8A 2GAHC 2DH7A 2RRBA 1ZYQA 3UE2A 2JJ4D 1Q86T 2LXUA 1N6QB 2X51A 3MEEA 1S1UA 2D41A 2ZITA 1TP7A 2VQEF 1Y5NB 2AMCB 2Z2MA 3NRBA 3KMQA 5C24B 2CQBA 3MCOA 2QLWA 2PA8D 3OV7A 4PWUA 4U96A 2D7SA 4U8YA 1QY7A 1GXTA 1IKWA 1VQSA 3LW5C 2OPPB 4NLXA 3EPIA 3ILLA 3RW7A 4LRDA 1Q5VA 2BE7D 1F5CA 4ZVSB 3DDIA 1U0SA 4Q7AA 2CVEA 2M0GB 2WHOA 2KHCA 4LIRA 3HZEA 5G4DA 1FX4A 2IFXA 2OPSB 1N0VC 3DRRB 1RZMA 1CJVB 1XMBA 5AXKA 3RB4A 2R2TA 3HX9A 4UQGA 1QVGR 1Y3JA 3K58A 4RW4B 4F0KA 4ZCKA 2XMAA 2VG7A 1SC3B 1ULRA 1VC0A 2XO6A 1G7CB 1SPBP 4ED3A 1S79A 1XEZA 2VJUA 1YG0A 4NCAA 3KKFA 2DBBA 2H48B 2HNZB 2J0XA 2XHCA 2E5LF 1APSA 1CJKB 2J7WA 1HI0P 2ADBA 2B5JB 1U1LA 4RW8B 3JAMU 2BJ7A 4QU6A 2BQUA 3MMBA 1R27B 1WG1A 2KHDA 2V63A 4DMZA 2PN6A 1SH0A 1T11A 4C0OC 1HBUB 2YKQA 4FKYA 4WYLA 2JL9A 4FYDA 1XNRF 3CO0P 3KJVA 3P45B 5H9EJ 4LF9F 1B64A 3RAQA 2XZTB 1YI2S 4Q0BA 4XK8C 2I2YA 4ECYA 5ETVA 1UZHA 1JLBA 2VG6B 3ZZ0A 4DQPA 4CH1A 1NUEA 3CCES 4QBUA 4FF2A 3VGSA 2W2QP 1PBUA 5LXRA 3AJ2A 3R5GA 3GJTB 5M2UA 4NLPA 2HHHJ 2OEKA 5D4PA 3BGUA 5KFXA 1RAJA 1S1WB 1X5TA 3G6YA 4NASA 4FS1A 3OLBA 2HAFA 1EETB 2VICA 1BD6A 4P2FA 4C4WA 1RTDA 1YSJA 1D09B 2LEBA 2HQFA 3DRPB 4MT1A 4KGVB 3M9NB 3ZZRA 4JI3J 4LUBA 4A8SA 3BBCA 2UUBJ 3I6PA 4WTYA 2DEIA 2R2SA 1J2VA 4WP9A 3L7UA 3IRWP 3M8PA 2GMLA 1OJ4A 4TYAA 1YJVA 2D69A 4JI0J 3BH7B 1JLFA 2Q3PA 3M1VB 4QPXA 3OPKA 2AW0A 2W24A 1M5SA 1T94A 3KLFB 1KD1T 1Y3KA 3JSMA 3LAKA 1KVKA 3MGJA 4KKOA 4RO0A 1KTQA 2AKWB 2RUSA 1CLFA 4A4JA 4A8XA 2ZNZA 4C8MA 1TL1B 4NL5A 1Q8LA 2YH0A 3AJDA 1GXUA 4OIXA 3HFKA 1ZM3A 4RNMA 3RBZA 5KT5A 1X5PA 2HKEA 2CWKA 4WPAA 1GTHA 2HRYA 3M6WA 1NBEB 3O1LA 5LOQA 3OXFA 3MPVA 1C2PA 3MD3A 1RACB 3TW0A 4E2FB 1U02A 2N82B 4KV8B 3T1YF 2M5YA 1F9FA 5D4LA 3DLGA 3GE9A 4ZVFA 4CTAA 4C0HA 5JJBA 5DG7A 4QIFA 1SJFA 3P96A 1URRA 2BKOA 1WI8A 5ETOA 4I64A 2CQPA 3UDLA 1YJRA 2RU9A 3EPGA 5GVQA 3ZTQA 2HNDB 3CJRA 1O51A 2LA6A 4IDKB 4EI2A 3W61A 1SH2A 3BPSP 3BBBA 1WKLA 3KFWX 2DGWA 2ZHBA 2FHOB 4DUZJ 4JOUA 2D9PA 2PFFB 5THWA 4RW9A 3E8OA 4OL8A 1W26A 1JLEB 4NI2A 1X4FA 3UD5A 2VDHA 4DX6A 1VBKA 2NLWA 4I56A 4QZVB 3G2XA 3JAMY 3UWTA 4Z2XA 1WTBA 2XS2A 1VQ4S 3BR8A 2BJ3A 1FD2A 3G87A 3MAAA 2OSQA 4ALZA 4I7FA 4USKA 1VHIA 2XNRA 3IM9A 1IKVB 4K59A 4P9SA 3B8HA 1RTIA 4C98A 2COLA 2B7CB 3NCPA 1M5HA 3QGIA 3K8VA 4OYOA 3BGRA 2DR9A 3PW7A 2Y0SD 5K8PA 5A8KB 2B9EA 5K14A 1C0TA 4ZCLA 3C15B 2XSJA 3IG1B 4LF4J 4NCGA 1H2VZ 4ZS6A 4OYAA 3PO4A 4LIWA 2HNYB 4IQMA 1S6OA 1DFDA 2IHR1 4O3PA 4GO5X 3QGHA 1WI6A 1RA7A 1NXIA 2RS8A 5E3CA 2A6MA 5H9FK 4C8KA 3A3PB 4DX8H 2QLBB 2KYZA 2G0IA 2U1AA 1CC8A 5I3UA 4BC7A 2A3JA 3JTOA 4NXNJ 1FFGB 1FWPA 3T9NA 2ROEA 5CZXA 2RHSB 2R7VA 2VONA 2ZH3A 3LP1B 2YKPA 4K50A 2XY7A 1I94J 4FNHA 2HK3A 1UVJA 4DR6F 1WJ9A 2ZBRA 2MY7A 2LU2A 2N3LA 1FVQA 5RUBA 1UCNA 1FF2A 2LQ5A 4DLGA 1KFDA 4NOHA 5B0GA 2JFDA 1U48A 2MKCA 3E2EA 5HQ8A 5GAEU 4YDXA 4DV6J 1WC4A 4HTJA 3O8WA 1M5KC 1AZSB 3FEXB 3I5BA 3IO1A 4FPRA 1N8RT 3PJ9A 1VLYA 2MEWA 2OMOA 2C22A 4J9KA 4RBUA 2A10A 3QIPB 3R7NB 3RZAA 2IC3B 2RDIA 1MMLA 5AE1A 4UY85 4J91A 3DM2A 2B0GA 1U1NA 4DSIA 1HBMA 4X64F 2AYGA 4NA3A 2PDAA 2L3MA 1YHQS 4DF8A 2YNFA 2WONB 4R0EA 1X4CA 5B0DA 2GHWA 1TMMA 2FHMA 2HWTA 2IM3A 3D3CJ 5KT4A 3Q8QB 3ISND 5D3GA 2AGQA 3NKYA 2ZJPQ 4ZP9A 5L9NA 1T9XA 1YDLA 3AB4B 2DD8S 2MKYA 4PKDB 4JI8J 3OTEA 4MH8A 3M32B 1XWLA 3A8IA 3TNVA 2CJXB 3I82A 2BV3A 1HPZB 2GHPA 2WVDA 3DRSB 3NWRA 1A7GE 4ED5A 3FCWA 2OELA 3T41A 2CPYA 4USHA 3DLLQ 3QFHA 4TYBA 1VQ7S 4CIOA 3AQOA 2KL8A 3AA8A 4ECXA 1S99A 2XGQA 1JMTA 4XPCA 1JIHA 2DNMA 4OI0A 4LF2A 1K8AT 1X4BA 3PRDA 3HHDA 3CJKA 4ZVOB 4DL6A 2W1BA 1AFIA 4QYRA 2MXYA 4ANEA 1Q79A 5E3PA 1Z2ZA 3IS9A 4CLPA 2FB0A 3AXKA 4F36A 2YTCA 2E9RX 2ZWOA 1RHJB 1VRUB 2FJWA 4NPOA 1ZAWA 4JYAJ 2CNKB 2F9JA 1SXLA 1N36J 4DDFA 4PG8A 4M63A 2QX0A 1D3WA 2NUHA 1Z4UA 5IM0A 2Z2LA 3QNWB 2BQRA 3FQLA 2MKHA 1RABB 2FYXA 3SMZA 1WEYA 1E6VB 3L4BC 4HHHA 1YBAA 2V68A 2ZC4A 3MI7X 2ZKTA 5C25B 2F40A 3RGIA 1S6PB 1R0AA 1RT1A 4X4SA 1ZM2A 2IBOA 4AE5A 4B3SF 1WC6A 1HNWJ 4ZPVR 5GADU 4U7UK 4FYWB 5KFDA 2K7KA 3HM9A 4DR4F 1HBNB 3W8GA 4ZN3A 1RTZA 3GPAA 4B3MJ 1TFWA 2MHNA 4WU3A 4PRFA 3W1YC 3JYTB 1WSRA 1QAYA 3D6TB 3UO0A 2JOQA 2Z4PA 1MMDA 4RPFA 2DY9A 3C6UA 2XS5A 1LXJA 2KFZA 4N8OA 3DOKA 3W65A 1TV6B 3SDEA 2RDJA 3L3CA 2R8GA 4B9TA 1T9TA 4LMZA 1X9WA 1VS3A 1HYSB 2ZOFA 5L38A 4O3OA 1LOUA 4KPCA 4BS2A 4NMXA 3C6TB 3NL0A 1TQLA 1RBLA 1W2BR 4GKKJ 1U1KA 3K5NA 1N6QA 1RCOB 3IAS9 3TO8A 2V4RA 1WEZA 3HULA 2GA7A 1NPRA 4P74A 2XS7A 5C24A 2YPYA 2LFVA 2IYGA 2W7AA 5CCLA 2BJEA 3RJMB 2XQCA 1N5SA 3R7BB 4QYZJ 3HI9A 3GYGA 4EGLA 5DM7Q 3S6EA 2M3DA 1BMQB 1N33J 5LMNJ 2RDDA 4U7UD 4G1IA 1RT3B 2UU9F 2ZH1A 2EBEA 3KLGA 4NMLA 1U2RA 1VBXA 2CPZA 1YWXA 1JX4A 1NPPA 4P71A 3ENQA 3TVKA 1S6QA 3GR0A 1WOPA 1WTFA 1KP6A 3HFVA 2CPXA 5J1EB 3JSYA 2OPSA 4FF1A 5BR8J 2ZH6A 4F7VA 4OX6A 4B9MA 2R8KA 2ZH8A 3R3TA 4DPYA 4X62J 3GR1A 4EK2A 5J2PB 3AH6A 3AB2B 4RW4A 2UXDJ 1FDAA 1HMVB 3QATA 2PI5A 2WBRA 1NEEA 4DR1J 4QWEA 1IQTA 3KG1A 1NK7A 4K4WA 2QA2A 4QWAA 3OD2A 3LF0A 3CD6S 2OTJS 4EFAC 3V6HA 2XMUA 3MPUB 2F65A 4YHHJ 2HNZA 2QL7B 4DFMA 4HACB 3I5CA 1HHTP 4O4RA 1CJKA 5G0RB 9ATCB 1ZH5A 1MWYA 2J9DA 3M2VB 4RNFA 1UWAA 2B43A 2B5JA 2RVJA 2WVCA 2IVMA 4RW8A 1Q16B 1P9YA 3NWGA 3BF4A 1UVKA 4FF3A 4DV0F 1GTEA 3R1HA 3MOJB 4NRUA 4TLRA 1DQAA 2ATCB 2V2ZA 2ROPA 1RWMB 1HBUA 2R7SA 2ILZA 4JV1A 4ZVRB 4RW6B 4K4ZA 3ENVA 1NLKL 2NYHA 1F2HA 4NLUA 4DSFA 4PXEA 4ECQA 5HMXA 3VALA 1OMSA 2F1FA 2J9EA 1YK9A 2CVIA 2DGQA 2GNKA 4IRDA 1V6HA 3DRYA 1QDUB 3D0IE 3MUTP 3HFZB 1NJXA 2J8AA 2RF2B 3PV8A 4ZCIA 3ETMA 2WB4A 3DOLB 3H40A 2ASYA 5KFBA 5HLFB 2E1MC 5H9EK 1TK0A 4ID5B 3W5XA 3CCMS 3DOMB 1S1WA 4K2XA 1ZOTA 2R2RA 5GAEI 4C6AA 1HNVB 5U47A 1CSJA 1S12A 1EETA 1WC3A 2DNNA 3N28A 3CIZA 2Q6BA 3DRPA 1IKXB 3T1HJ 3CJQA 3CF5Q 1DHMA 2DGUA 3GFXA 3FKBA 3D0HE 4C3LA 1KVJA 5KFJA 3MEDB 3MCMA 3PCOB 3BSAA 4DX5A 4WP8A 4CLLA 1B99A 4JB8B 3CD5A 1J5OA 3M1VA 4PG4A 3NOGA 2H65B 2MJUA 4A48A 2HHUA 1YVFA 3CPWR 4F4ZA 1X5OA 2HEKA 3DLEA 2V67A 4G6VB 1SKSA 4AD6A 4DR7F 5AJ3J 3CE8A 2BE2A 5KFYA 1TL1A 3D67A 2M52A 1P6TA 4DPUA 2K06A 4I1TA 4LBPA 1IBCB 1S97A 4C11B 2FVSA 3KNGA 1PAUB 1BE4A 1PYOB 1YZ6A 3HSDA 4AL5A 4LRAA 1H38A 2XMKA 4QIGA 3U1NA 2LMIA 4C8LA 1UPPA 1FXDA 3FMBA 3PFEA 5KFGA 4ELTA 2ZDOA 4YB7A 4KV8A 4FNIA 3EUNA 2FVRA 2G1HA 4Y2AA 4AT1B 1XMQJ 1RAAB 3DLJA 3X1LB 1ZA1B 1KBRA 2FJAB 1AYEA 3G8QA 3H5SA 1FNMA 4LR9A 1ACMB 4S0MA 4ZK7M 2H54B 1F5AA 3KJNB 2CQDA 3D6MB 1ZAVA 2HNDA 2W9CA 4KAIA 2Y0BB 2GJIA 2CPDA 4IDKA 4LSLB 1T9YA 2GIFA 3OFHA 4L3KA 5E2QA 4LFAJ 1NZ8A 2GMJA 2C2MB 3WZ0A 1MLAA 1FX2A 2DRBA 4KFBB 2CG4A 2G1DA 3RRGA 2HFVA 2V94A 2CJQA 1JLEA 4JBCA 1C0UA 3B78A 4UZCA 1IVZA 2YKMB 3W7BA 4TN2A 5HMYA 1CBKA 3GYXB 4PXDA 4QR0A 1QSLA 3MURP 3TOQA 1GMWA 3EZ5A 3ZNUA 2CPFA 2QL9B 5DETA 5GADI 3A4TA 4DBQA 3DYAB 4K4VA 1IKVA 2LYVA 3DLKB 1YX2A 4H4OB 2CPHA 1HQUB 3BGFA 1XBWA 3IAM9 1JXLA 4L73A 2YVSA 1K47A 3QWPA 5A8KA 1T9VA 4ILRA 4DCOB 4X66J 3EYZA 3W9HA 1RT5B 4QPTA 4X4UA 2JC1A 2WW8A 3IG1A 1QVFR 1L3UA 4FKXA 1FNOA 2YXLA 3BJYA 3Q8UA 1S49A 3PX4A 2UV8A 5E33A 4LF8F 1H7WA 1FWKA 2HNYA 5MLCV 2F8EX 3KK3B 1M5VC 3KG4A 4H4MB 2YKOA 1S1VB 4F02A 4B9NA 1MNEA 4JV0A 2CYYA 3IBWA 5K5MA 4QU7A 4DX7A 5CZVA 4KB7A 2E5JA 4KPYA 4G3IA 1JJHA 3I96A 2PMHA 2MQLA 3VAHA 1G6BA 1YLXA 2JHEA 4NA1A 2EK1A 2WZ1A 2GHVC 3NNHA 4F4AA 4USVA 5AE3A 4OJGA 1SCJB 2Z8QA 3WDOA 2CQ4A 1VISA 5F9LA 3LP1A 4JI6F 1JLAB 3GV7B 1Y9OA 1JNZB 3TQ1A 3TAPA 1QM9A 2XI2A 2KM8B 3L7OA 4P2MA 4DV2J 1WG5A 4FVCA 2BQ3A 3TAQA 3ZTOA 1UJ4A 2B51A 2FLLA 2EG2A 3G9CA 4PWDA 2XBPA 3R97A 5KFRA 3W2WB 3UQSA 1VDHA 1SC4B 2BKPA 3EXCX 1B3TA 1QAJA 2CNOB 1X9MA 3UFCX 1SB6A 2CQ2A 2BZ2A 3CCZA 3D5MA 3GIIA 1ZZFA 4NZ6A 2LU1A 4EU0A 4DV7F 4LBIA 1LW2B 4F4YA 3A13A 1ZM4A 3CDBA 4LF6J 3EX7B 2IC3A 2ACMA 4TQRA 4Y6IA 2E7XA 2BOAA 3MEKA 3IWXA 3DMJB 4LFBF 1BY9A 3W2VB 1C1BB 2WONA 2E1CA 2DY1A 2RRAA 1HW9A 1H2TZ 3LPEA 4OHVA 1F5BA 2JLGA 1MN7A 3KG0A 1S57A 3H42A 4WK3A 5CYMB 3QGGA 3ZFVA 4W90B 1N5TA 4DI6A 2YH1A 5B0CA 4LF1A 4AQYF 2JLFA 4FBTA 2BJ9A 2AX0A 2JLEA 3M32A 4B17A 1RISA 2R9LA 1FFWB 1HPZA 3J7ZT 3DRSA 4YDDB 5D77A 4DV3F 2QRRA 4G1QA 4DR3F 4TY8A 3VAGA 2E5LJ 2VBYA 4DN9A 4UOHA 5I3QA 2HBRB 3JSBA 5KFQA 2H9ZA 1XR6A 1VOMA 2OO4A 4M5HA 1FTCA 2FJDB 4WE1B 2C2KB 4A8WA 3NAIA 3QGPA 3OTCA 4LVOP 4DS5A 3AY0A 2P5VA 4DL5A 3CUNA 5GAGU 4QW8A 4ES3A 1K0VA 4LRFA 1YRTA 3OHAA 4ZIVA 3AJ1A 4GMKA 2LDYA 4XDCA 5HO4A 1VQMS 3BKFA 2Y8YA 1K44A 3CNQP 3CWJA 1MG7A 1SL0A 1VRUA 1FRKA 4MYUA 5KT2A 2C3UA 3QWUA 1E6YB 2BRKA 4HDHA 2V5HG 1FTRA 3RUBL 2ILYA 2E9ZA 2H1YA 2AJ4A 1VC5A 4CO1A 2NQPA 2O3DA 1IQZA 2RQ4A 3PYEA 1S0VA 2DO4A 1TELA 1E6VA 5D78A 3HO1A 1LW0B 1C4CA 2NXJA 5C25A 2NSBA 4ERDA 3OW2R 2OFHX 4CNZA 1H98A 1YRXA 3VTIA 4OZ1A 1S6PA 4DHVA 4F3OA 1FRXA 5MAOA 2F4FA 2DHXA 4HR2A 3Q8YA 3OFEA 1OYEA 3PRBA 3T5JA 4WXOA 5A6WA 3WC2A 4TLQA 3D1HA 1X9SA 1HBNA 3BN4A 1WACA 1R0CB 4DG1B 4ZHRB 2D3OR 2HFZA 1K73T 3K17A 4F2SA 3JYTA 1SUQA 1IN0A 2QJ3A 2O67A 5ETRA 4USUA 4OJ3A 1A0OB 3QT5A 4DCPB 5KTQA 3BO3A 2RUGA 2K3KA 3MUVP 1GNKA 2UXBF 2NS1B 3KHLA 1RTJB 1TV6A 4C7QA 3CDAA 5T7LB 4HTIA 4F25A 1HYSA 3W9IA 3FCHA 3TZZA 2R7XA 2YWWA 4FN5A 4WXWA 3MAQA 3C6TA 1B0PA 5KFCA 2EFNA 1REVB 2KXNB 3DXBA 4MTPA 2HFUA 3J7AN 3FCVA 4HT5A 2DCLA 3QRQA 1NKBA 3CMES 3CMAS 4ZPBA 2CZ9A 4X4OA 5KFHA 3HD1A 4LR8A 1SQGA 3R5CA 1J5EF 2N4DA 3NOCA 2DTJA 3OR2B 1YTYA 2ASLA 3JQKA 2DPJA 3AA9A 5C42A 3GFHA 3CCLS 4L6V3 1VBZA 1KSPA 3M9MB 1RT3A 2IPOB 3K5LA 1CVJA 1HNIA 4BHQA 4OI4A 3LTOA 4DL4A 4QOTA 2FC9A 3ZZYA 3OSNA 2CJBA 4QYZK 5J2MA 5KOXA 1WC5A 1PYSB 2MQNA 3QT6A 4ED7A 1YJTA 2OPQB 2VPWB 5D15A 2OD4A 3NG8A 2OIHA 4F26A 3K7RA 5GMEA 2XLIA 4CZCA 2J7KA 3C66A 3E3XA 3LWLA 1VJQA 5J2PA 5HVFA 1FCAA 4TY9A 1HMVA 1NHUA 3R2DJ 3UW1A 1NHVA 3CO9A 5GMDA 1UEVA 4JV5J 3Q24A 1ZBTA 4R8UB 2B9WA 3RRKA 5A8RB 4HACA 2DRDA 5G0RA 1HNXF 1TR0A 2GFFA 3N5BA 4IFVB 1FHTA 4J9PA 4RU2A 4Y28C 1NK6A 3VAMA 3ZTPA 1VQNS 2XEXA 2DO0A 4EBCA 1D9DA 3HJVA 3IXQA 4K4TA 4Y2CA 2MKJA 4BLGA 5KG5A 3NLCA 5HVGA 1URNA 2JH3A 3D2WA 2V8PA 5DDRC 3EGZA 1WHWA 1FRHA 4OZ2A 1UVLA 4ATNA 2RHQB 3J7YU 2XB2D 1TKTB 4IQXA 3QO9B 2RF2A 1Q82T 2P2CB 4ZLJA 2GMHA 4TNOA 2BYCA 3FZBA 3G8SA 2HHXA 5HLFA 3PO5A 4K4XA 2MLXA 4ANDA 5DRKA 1N34F 3DOMA 5BXIA 1XR7A 3J81j 2I1RA 4YN3B 2HFOA 3I4PA 5DM6Q 1HNVA 1CS4B 4JI2F 3TJ9A 5D0GA 2CZ4A 2UUCF 2OLWA 4DOZA 3M2RB 3PKYA 2HG4A 5KFTA 2DIVA 3THPA 5SZTA 1GMUA 4PCQA 3AQPA 3DFEA 1FJGJ 3CDEA 3PZPA 4XAKA 1GK8A 5JVGQ 3CC4S 1VMBA 3MEDA 4LSNB 4ECRA 1OPIA 2ZNYA 2ZWPA 2HLUA 1A6LA 2YY3A 3MM5B 3W63A 3HHLB 3UDVA 4ZIWA 3MAHA 4DR6J 1CULA 3KUHA 1U8SA 4ITSA 2VZ9A 2HWHA 3MCNA 5ETTA 3VZHA 3VAFA 2XWYA 3FBBA 1JLCB 2PO4A 4IH5A 1F2GA 3CXCR 3A3NB 2NZCA 1NCLA 1WF0A 4ZJQA 3AXMA 2CDQA 2IA0A 5E3RA 4K2JA 4IRCA 4C11A 5HMWA 1K1SA 4C8NA 3OTDA 3M05A 3I0SB 4ANCA 2N3OA 4J7CA 4LT6A 4PEOA 3QFWA 3CCRS 1VLOA 4PPDA 3KLHB 1Q4RA 2VG5B 5IFMA 5HROB 3CJTA 4FDFA 3RBXA 1MMNA 4CM2A 3BV8A 4X64J 2M9KA 5H9FJ 5KG7A 2HK2A 5L1JA 4MFBB 2RQMA 4K5SA 4PZVA 5HAOA 4IG3B 3OJUA 5GAGI 4ZP8A 4F2RA 1RT6A 1SJ1A 3DXSX 2J0WA 4DCJB 1B7FA 4YUDA 2G2OA 4R0JA 1HWKA 4A47A 2DYAA 4PG7A 3W62A 1R8PA 2HIYA 4CYUB 7FDRA 2AF6A 4LSLA 4YEAA 4ELVA 2OSRA 1UL3A 3FZ2A 4HDGA 4J9SA 1B0VA 4C3MA 2QTWA 4KFBA 2ASJA 2ZHOA 2DRAA 2IMWP 4B3TF 1ZPVA 5IWAJ 2VODA 2MZSA 1U7LA 2YKMA 2JDJA 2WK4A 5E0OA 4PPZA 2QN6B 3PYGA 4FVMA 2Z30B 2HHPA 1M90T 2LXIA 1ZAXA 3H5UA 3RG6A 4KY3A 4MKYA 4K0KJ 5HQLA 5LL6d 4E98A 2F63A 2G0CA 1BQMB 3HSJA 4WIQA 5LM7E 3NCRA 3FRYA 1OSCA 4LREA 2MGZB 1X4GA 3TR5A 2A0FB 3DYAA 1S1TA 3E01B 4FYVB 4YR0A 3DLKA 2O1PA 4R25A 2HZAA 3BGLA 4H4OA 1YJUA 4QWBA 5KG3A 1HQUA 4KHMA 2C3OA 1HL6A 2P8IA 2FJVA 1FKPB 5BYQA 2HHHF 2NXUA 1SIWB 1NKEA 4IOAQ 4OLPA 3WC0A 1YITS 3FEZA 1FEEA 1NK9A 3G6ES 3CDWA 3DU5A 1S0OA 3WX4A 4P73A 1UJ6A 4CP5A 5D0HA 1IKYB 3KK3A 4H4MA 2HZVA 5DQGA 4JI3F 1S1VA 5F8GA 4M5GA 4DFJA 3P6YC 1VQPS 4X4NA 2IVYA 4B3SJ 4UY8T 2CNLB 5D0RA 2UXCF 3KK2B 3S1TA 4UF4A 2HMIB 4OHWA 1HFEL 4DR4J 2RS2A 1RAHB 2HBYB 4JI0F 1PCAA 4OX7A 4WYWA 4Q2LA 3FBEA 4ECUA 4ED0A 4OX8A 2C2ZB 2XMJA 2W2NP 3IM8A 1AUDA 2BUNA 5FJ4A 3JB9k 4KHPJ 1JLAA 4NLWA 3V81B 5IT0A 2XULA 4DL2A 1C4AA 2QA4S 1LEOA 4NXMF 1XJWB 3KOAA 3QSIA 3MTKA 1S0NA 4OZ5A 1HARA 3W2WA 2YQ0A 2VD3A 3OL7A 4F50A 1UFWA 4OYZA 5B7WA 1RWKB 2V8GA 3OBIA 3G96A 2GQ2A 4CO0A 1MROA 2H4YB 2HSEB 4RUAA 5DO2A 3MMCB 1P1TA 2DEJA 3C3LA 1RT2B 2CWXA 2V6AA 5A2QU 2ZH9A 1T3OA 1LW2A 4TU8A 3K5PA 4I6WA 1PJ7A 1QTNB 2EC0A 3H2VE 2CADA 2PMWA 5BYRA 1K9MT 2YWGA 5HQMA 5D8HB 1UEKA 3DMJA 1U6BA 1MN9A 3PW0A 1SH3A 3PTWA 3W2VA 1C1BA 2A2CA 1IR2A 4OHYA 2PIIA 1UP1A 2GO8A 1L3VA 4DUZF 3CD0A 2DH8A 5CYMA 3AOCA 3HVTB 4YB1P 4W92B 4DV4J 2HBQB 3J7Z5 3BO4A 4KTQA 3GIKA 3Q89A 1HHQA 4X65F 3PJXA 1JNRB 4UOGA 4M5LA 1RWWB 2NXCA 3ENAA 3J7YI 1SL2A 5ETNA 1FKAF 8AT1B 2ATLA 1KDNA 2DNKA 2ERRA 3FNNA 1WKJA 1W7WA 4LQ3A 2LEAA 3Q8RB 2J0QD 4ZP7A 1WD6A 2NCKL 3M8RA 4ZVQB 2GV1A 2DR8A 4UT4A 3I87A 2C2RA 1ZTTA 4LFCJ 5A8WB 1SJ4P 3CCVS 3G6XA 3AT1B 2DK2A 2G2ZA 2CRLA 1RI7A 4RR5A 3OUYB 3TZWA 2XZDB 4DV0J 3P3DA 5HSPA 1X4EA 2VQFF 3Q8SB 2FY1A 2Y1LB 4IO9Q 3HT3A 3N79A 3OTBA 1TUVA 3V6JA 2BBEA 2R3VA 3W8PA 3T19A 4J9LA 3Q8PB 3V6DB 1NZAA 2V0NA 5DQHA 4LF4F 1S4FA 2AHOB 5FDLB 1FO1A 3IR5B 4FZVA 1JWWA 4PG5A 4IR9A 4ZITA 2PSZA 1KS2A 3RBDA 1VQ6S 2GO9A 3QT8A 2EBGA 1VQ9S 3L95X 2I8EA 5CH7B 5B08A 1QD1A 2HURA 4KH0B 2RIJA 3I0RB 1SKUB 3IGVA 4QIVA 1T0TV 1PILA 2JEIA 3MR5A 3WQPA 5KFMA 3HVRA 3MEGB 2CUYA 1RWPB 1LW0A 4FYYB 1VQOS 1JXEA 1FJCA 3ELHA 3MFIA 1YIJS 2MSTA 2LLZA 5KG2A 2J9DE 5LSOA 4B9LA 2OAUA 1U47A 2HQCA 3EGNA 4DV1J 1L5UA 3TEHB 4ZVHA 1BQXA 2HW3A 2EW9A 3DGPB 3VQSA 4WZQA 4DR2J 1BUXA 3M2UB 2RE1A 1RHRB 1U2CA 2QO3A 4I2PA 3OL9A 3FSYA 3R7SB 1W2IA 4QWDA 2HQIA 3DKDA 3IBCB 3Q2SC 1WHVA 4UQTA 2YNGB 5C7PA 5KT6A 4Y0FA 3MMAB 1U4BA 2IJRA 3UN2A 1WWHA 3U1LA 2B6AB 1G4CA 4DV6F 3EZOA 2JSXA 2R7UA 1UWBA 3BH6B 1IBKJ 4ZMMA 1M5OC 1Q95G 1W25A 3SSSA 2K8GA 2EWHA 4EBDA 4PQUB 4P6QA 3PDNA 3ZZPA 3A8EA 6FD1A 4DQRA 2UUWA 3AAWB 4G1PA 2JEFA 3MCSA 1RAGB 4U6PA 4NEYA 1REVA 3BO2A 4QR2A 1NDCA 1EQMA 3PW4A 2GS8A 2MZQA 1N5YA 1QTMA 3CCSS 4DZDA 1WC0A 1RWNB 3L7PA 4AXJA 4OV6A 5A2QY 3C19A 3OR2A 4ED1A 5LMUJ 1HWJA 4GKJJ 4TKTA 3ZXWA 1DTTA 4BCAA 3CT9A 1VCTA 5KFSA 5JXSA 4F4XA 5E41A 2A2DA 1S10A 3GSIA 2IMOA 4YB5A 3UPFA 1X5SA 4JI8F 1B70B 2MMYA 3K5OA 2O66A 2VG7B 2JEJA 2V2VA 3SV3A 2RQCA 2ALZA 2ZHAA 1TKXB 3ILIA 1BLUA 3CIMA 4CO3A 2XM3A 2OPQA 4G65A 4LF5F 2I5JB 3KMSA 3O3LA 3R27A 1M1GA 2ZUGA 4X2BA 2VUGA 2Y1RI 1S1XB 3QRPA 3MMBB 5CYQB 2K3IA 1D0EA 1L3SA 2B3TB 2R4FA 3SQGB 4KH1B 1BWEA 4NEZA 2NXEA 3T6BA 4R8UA 2CQIA 2V2QA 5E3QA 5A8RA 1M1HA 4ZJLA 4N8NA 1KR4A 2HVDA 3H8YA 4RBTA 1HHSA 4WKYA 2L08A 3M7VA 1NSQA 4QJVA 2U2FA 1RAIB 4JYAF 3N9UC 3KLEA 2R7QA 2KM8C 1PC4A 4USJC 5KFNA 2EVZA 2VF3A 2OEMA 4WP3A 2P9CA 5F0UA 2K1RA 4KGKA 1JLQB 2C3PA 4P7TA 1ZTWA 4HVZA 4EO6A 4GC7A 1XERA 5A6PA 1Q8IA 3GJQB 3KTQA 1TKTA 2YKNA 4M1KA 2LQ9A 3QO9A 2E1AA 1RTDB 1I3OB 4LF8J 2HVZA 3GIJA 5LJ5Y 2XTJP 2FJBB 2ZJRQ 2ALYB 2DCUB 2J8SA 2HVEA 2MQ8A 2G0JA 2WAQD 3R6LB 1SKRA 2XY6A 2GW8A 4B3MF 2KZZA 3GIRA 2OP5A 3RB3A 1F9EB 1NJZA 5F8LA 2EFOA 1S9FA 3KUEA 1RKJA 1X4HA 5DDQC 3HT0A 4J5OA 3PXGa 1Q7LB 3M2RA 4J9OA 2HRUA 4O3SA 1QJHA 1FESA 1N54B 3F0NA 2GJ2A 3BPDA 1U1MA 4GVBB 3EDRB 5HATA 2ZVIA 1OY6A 3KHHA 4LSNA 1AFJA 1AA1B 3LP0B 2IM0A 3TZXA 3MECB 3MM5A 3HHLA 2CQGA 2QGFB 3GQCA 1QUPA 1EIYB 2MLZA 1I1GA 2XSFA 1UA1A 4JI1F 3FSXA 4ZVUB 2P9GA 4ZLPA 1FVSA 1JLCA 1YZ7A 4WKRA 2QA1A 3KLIB 1T8EA 1Q8BA 5ETLA 2PT0A 2HPUA 3MR6A 5DG9A 3MM8B 1S5ZA 1C1CB 1EZZB 2A6OA 1N32J 3NBPB 2DITA 4OYBA 3CCWA 3QLHA 3PNIA 1N33F 4KE5A 3MR2A 5LMNF 1VQLS 3KDOA 3I0SA 2C28A 2AJ1A 1TU0B 3BKUA 4DV7J 4QR1A 1TKZB 4OV1A 2VFSA 4DJBA 5HROA 1T9WA 3JQMA 4O0IA 4JI5J 2PI4A 1WDDA 4CO5A 3K57A 2AX1A 4O44A 4CLWA 2VC0A 1TUGB 4LFBJ 3MD1A 4MIWA 4DZ6A 2WSCC 4CLTA 3V6KA 2M7SA 3HSZA 1X0PA 3W5ZA 1F1BB 1U26A 4MFBA 1P9QC 2VFRA 3EICA 2J6TA 1TVRB 1PIEA 4IG3A 2HVHA 1AXQA 3M8SA 2RSQA 1ZA2B 2R8HA 4NI2B 2CJAA 1PG5B 2UXDF 4O0NA 4ER8A 2VFVA 2BM1A 1DBDA 4HKQA 2BMBA 1O6XA 4DR1F 1RAEB 2D9OA 2R7RA 4Z7CA 3JSRA 4LF7F 1ELOA 2KG1A 3M6VA 1LV5A 1JXVA 1S7IA 4DV3J 2VASA 3NXZA 5B0BA 5AXNA 3T5KA 1I51B 3SV4A 1Y11A 4C97A 1NB2A 3ETOA 1NDLA 3MXHP 3BSNA 2KT5A 4ETXA 4CLSA 4EZ9A 4L76A 4XIUA 2VKRA 2M4MA 1QAXA 3TVZA 2Y1IA 1BQMA 2EKNA 1GFWB 3JTNA 3HLUA 2E1RA 4O3RA 1UPMB 2MGZA 4YQWA 4Q5VA 3CJ3A 2ZZNA 1T05A 1R0BG 2I9SA 2FC8A 3V4MA 1R7IA 4JP8A 3I31A 3BN7A 4I2QA 2ZZTA 1RUSA 2W7OA 2BR0A 5HP1B 2OEJA 3CC7S 4WU2A 1FKPA 3FBCA 5I42B 3IBFB 1QSSA 2CDRB 3OVSA 3VV2B 2N4CA 2RMLA 2YX1A 3GTYX 3TEGA 2AJ2A 5IT9U 2B8QA 3GMGA 3ILJA 3TZYA 3O6QA 4J9MA 5I3UB 3SEOA 2LKZA 3VAJA 2DNQA 4PWWA 5HMZA 1IKYA 2VKZG 3T1HF 3DRXA 4B9UA 2BEFA 4A8YA 2G2YA 2UVVA 3E51A 4P72A 4WFAQ 2WSFC 4OZ3A 1SV5B 3CD7A 1VQKS 2NSCA 3KK2A 2CG8A 2HMIA 3HSGA 4Y2KA 3NS6A 3D1OA 4B02A 2JNJA 2X1FA 4PXBA 2DGTA 2E7WA 1H73A 2HHVA 1HWUA 2D1CA 4H54A 1QLNA 1ZETA 2UXBJ 1HWIA 5EX3A 4K8RA 4PYDA 3V81A 2C2DA 3R9LA 2D74B 4KGMA 1EP4B 3RR8A 2ZD1A 4KBIA 3FVYA 3A3OB 4YOEA 3UNGC 1WHYA 3N0VA 1NJWA 3FC9A 1OS5A 3B4DA 4OJHA 2W8LA 4L74A 2VOOA 4C8ZA 3OR1B 4NCBA 2HHSA 2AT1B 1XMQF 2APOA 5DLFA 3ITHB 1J5EJ 3MMCA 4GRSA 4DQQA 1F9HA 4BWJA 2VFUA 1RT2A 2B4VA 1YKWA 2K2PA 2PMZD 4K4UA 3IRXB 4HI1A 5C2CA 1Q8KA 1MW7A 1HQEB 2FJXA 2YX7A 3CSKA 1M1KT 4RLEA 2DNOA 8ATCB 2HVIA 5J1PA 2GCFA 2FZGB 1H0HB 2RQKA 4V1Ak 2BW2A 3D9BA 4I6YA 3SI8A 1HBOB 4IH6A 3UVJB 2IM1A 1CJTB 1PJ5A 5HI7A 2LCWA 4Z37A 1TMJA 3O2IA 1HA1A 3DU6A 2ROGA 3I55S 2DNPA 4PYAA 1PBAA 3CJ8A 2QLJB 4OX9J 3K8WA 1H72C 3J80Y 2Z58B 2X1AA 1YQHA 2CJKA 5LSLA 3M9OB 2GVZB 4CLZA 1RLDA 2PA3A 4AFFA 1KHWA 2MZTA 4F0HA 4ED2A 5KFPA 4IO1A 3UD3P 2X3DA 1NO8A 2FHKA 2DNRA 1AT1B 5A8WA 2DNZA 3LPYA 2BDPA 4OYPA 3OUYA 3X3UA 2UZAA 3HHLC 3CTRA 5K20B 4IH7A 5L9XA 5IQ6A 1NM2A 5DLGA 3KJQB 3C16B 2EPIA 2GX8A 2CZVC 1RWOB 4FBUA 3TRGA 3V6DA 2BJ1A 1BC6A 2HIQA 3QMQA 3VHQA 4CLFA 3JXOA 5KFOA 5FDLA 3U27A 1KQFB 1Q7YT 3G82B 1OPZA 1R0AB 5AXLA 1T9UA 4NLQA 4OZ0A 1Y5LB 4NLYA 3UDCA 2MSSA 1KHVA 5LXYA 2FHJD 3PX6A 2Y8WA 5IT9Y 5C5JA 3I0RA 3KHGA 2B9YA 4OLOA 4R5PB 3RYLA 2OPPA 4DF4A 3PACA 1Q1KA 3MEGA 2KFYA 3H5XA 1D9AA 1QE1B 2ZH5A 2ZBIA 2R7TA 4WJBA 3WIVA 4EYHB 2Y9HA 3ISZA 4JI2J 2YWKA 2ZH7A 3ZO7A 3DRRA 3NMAA 2CKWA 4OI3A 2H4WB 1CJVA 2HAIA 3M8ZA 3DGPA 1JB0C 1K1QA 3M2UA 1SBRA 4I69A 2QLFB 4CH7A 1VR6A 1G1XA 3OTOF 4IKAA 5KG1A 2MZJA 2OI2A 1KVIA 2C2OB 4QIWD 3GYNA 1KONA 4JI7J 4DL3A 4M95A 4DV5J 2WVFA 2XI3A 2YWHA 2YNGA 3GP9A 3MMAA 2HLTA 4MAKA 2B6AA 2MLYA 2ZDPA 2HZCA 2M2BA 3NGDA 3HF5A 4PQUA 2CQHA 3A8JA 3R5AA 2BKNA 4L75A 4NA2A 3R6GB 4LF6F 2IRYA 3KLGB 3EVMA 4IR1A 4NE9C 3MDFA 1HR0F 3CCUS 2MYFA 2BA9A 5DDPC 1VRTB 1VQ5S 3RAMA 2VU5A 3Q83A 1S6QB 3ONQA 2AYBA 2X1BA 2ZE2B 3T5HA 1ITPA 1GX5A 2AP6A 4ZPDA 4ZOSA 1UAWA 3SYZA 4D3HA 2VG6A 2RKIB 2EXUA 1KQSR 3OLAA 2M88A 1DQ9A 2MKIA 4OMFG 1TAQA 2KT3A 4DR5J 1U09A 1KWMA 3HVWA 2ZM6J 3TUJC 2AGOA 1WF2A 1TKXA 2V8HA 5J1NA 1KQGB 3H2UB 1O0PA 1KOHA 4DXLA 2EI5A 2I5JA 4UZBA 1U6ZA 2CJ9A 4U9RA 4J9VA 3EGWB 2DNHA 4RWXA 4W98A 2LXFA 4KC5A 2L9NA 4B3TJ 4DSKA 1S1XA 2ZFHA 5CYQA 5KFWA 1FE4A 4W4MA 2F7VA 4DUYF 3QT7A 1P8GA 3SQGA 3CCTA 4ECZA 5F3TA 2GVDB 2AU0A 5B0FA 4DFPA 4URQU 3BEGB 1B0TA 4LQ9A 5CHCB 3EM1A 2C3MA 3KLFA 4I0WA 4KSEB 3I32A 5HJYA 3PX0A 3NNAA 5GMKa 5HVHA 2IIHA 4QWCA 3K0JA 4YR2A 4DEZA 4A8OA 4ZPWR 4ZPTR 1VK3A 3H98A 1R8HA 4DQIA 2XZWA 2KRRA 1HD0A 4WWSA 1IM6A 1Z2LA 1JLQA 4JI4F 1S4EA 4C3KA 5EDWA 1SVDA 2MQOA 2R7WA 1WG4A 3MFHA 4ZLNA 2V4JB 2QYCA 1G2EA 1UVMA 4RX6A 2DGOA 3FJ2A 1REGX 1XNQF 4ECTA 3N6LA 3D1QA 4USTA 4F4WA 4RBVA 3I4HX 3CJ4A 4DL0C 2VPZB 2UXCJ 4CNYA 1RGVA 1LWCB 3FRZA 4MIAA 1J5OB 2P6TA 4OYIA 5DZ7A 3PRVA 4B3RF 1D8ZA 2EFQA 3DN9A 4QQBA 4FF4A 3V2UC 2IY5B 2XG8A 3GG0A 2KXFA 1FDDA 3KNAA 1RJJA 3T9ZA 3NS7B 3UN3A 3DLEB 4WFBQ 1UETA 2YX4A 3GJRB 4URGA 3ET6B 2BE2B 4GVBA 2BJDA 3TA1A 1F60B 4MK8A 4IG0B 3LP0A 5K8OA 5CXTA 4NLVA 2MHEA 3NMRA 3MECA 5ETSA 3VR1A 3UNYA 2OUGA 4NXMJ 2YWFA 5KFZA 2DNLA 4DWIA 1S7HA 4RW7B 2I38A 1P27B 3KLIA 1Q81T 2ZH4A 2CAJA 5EUHA 5DQIA 1RBOB 3MM8A 3V4IB 1KLNA 4KJIA 4Q44A 1C1CA 1RLCL 3PW2A 2KVIA 3VAIA 3NBPA 3IFEA 3HVAA 1Q5YA 3RRHA 2JC0A 2DHSA 3EGVA 4ICLB 1NJYA 2XCPA 4HT7A 1VK8A 4WFYA 3NAHA 1UFKA 2E66A 3T6JA 1TKZA 2XC9A 2WW4A 2ZBQA 1Q78A 4CWBA 4NRTA 4DUTA 2W9CB 1XMOJ 1V3SA 2ZZMA 1FRLA 3DGVA 2YBVA 3C15A 3TX0A 1IBLJ 5CYJA 2UV8G 3MR7A 4L3NA 5LJ3Y 4JUZA 4CCHA 4XPEA 5SUHA 2AEFA 1TVRA 3OFGA 1SL1A 2VIHA 2KKHA 3R8YA 1FE0A 4KO0B 4NLGA 2Q6CA 1C0UB 1RB0A 1LNQA 4PAAA 2BABA 1I5OB 3D54A 1JKHB 2G9OA 1FT8A 1U1QA 4JV5F 4X65J 3CJ5A 4ECWA 3SXLA 5AT1B 3M4XA 1OSDA 1YGYA 5IQQA 3HDSA 2HS3A 2QT7A 2EEYA 1RK8A 1WKKA 5DG8A 1J27A 3EE3A 4USWA 1YJ7A 5IXUA 2OH2A 2RILA 2MQPA 2IM2A 4KIAA 4NYOA 5E5NA 2FD2A 3TANA 2W7PA 2VQFJ 2WCXA 2W9AA 1V9OA 2OGUA 1EJ7L 1RXOB 3R5BA 5DJBA 2YNIB 1RBAA 4MKAA 1XC9A 4NLOA 4K7QA 2IAJB 1GEHA 1SQEA 3BZQA 2VQEJ 1HQ2A 2SXLA 3OSPA 2P9EA 2XGPA 2QYGA 3J7A1 5F8JA 3GU0A 3RR7A 2IA6A 1UTAA 3KWMA 1X8DA 4YY3F 5HP1A 2ADCA 1AZSA 1LWEB 5I42A 1RHQB 5D4NA 4Y00A 3BM7A 3QIPA 2XLKA 5CD4H 1NSKL 3TJAA 2E5IA 3TUPA 1U6FA 1U1OA 1N4LA 1U1PA 4AXIA 3W66A 1S59A 4JV2A 1RT7B 1FNXH 4OHXA 3RTVA 5K8MA 1FJGF 2RH3A 5AXMA 2V9WA 1U2FA 1SV5A 2WVEA 4WK1A 2MQQA 4AL7A 4URSA 4TXSA 4PUOB 1RDRA 2YNHB 1BQNB 4LJMA 4QIEA 5KFLA 2YQ1A 1OQ3A 1PSDA 4XO0A 5HJXA 2GQCA 4BWMA 3M8QB 1VIXA 1FKOB 3NGTA 4PWDB 1TUWA 3IR7B 1T95A 2UUTA 2E5HA 4ECSA 4HL9A 3RB6A 3QJLA 1RTHB 3GV8B 2KJWA 3DNCA 3BREA 4WFNQ 2RJZA 1R31A 3L9ZA 2QMXA 4O4GB 1EP4A 2W4PA 1Q53A 4OYWA 4U7CA 1H74A 4F3MA 2XCAA 3BQ1A 4B3OB 5B0AA 3M30B 1VIOA 2KFNA 2XHWA 1RYSA 3SSRA 1KRPA 2BXJA 3OQ2A 2EKYA 1MWZA 2P6SA 2XYPB 3OR1A 4TVAB 1NK8A 1XNRJ 3AD8C 5HN0A 2F4VF 1V5VA 3BSOA 3PYFA 3SIPB 3C46A 3ITHA 2M70A 4LF9J 1BHNA 4OI1A 3VQTA 2CQCA 1R6YA 3DDNA 1OO0B 4P2XA 3CCJS 1LXNA 2IVFB 1QAIA 3IRXA 2RU3A 2YWEA 1VQYA 1GQEA 1TL7B 1RKIA 2KDOA 3I9ZA 1HQEA 1FD8A 4OZJA 1O5JA 2J5AA 2EFGA 4Y2MA 3PHTA 2L41A 2AJQA 3D28A 2AV5A 4HH1A 4F4KA 2WOMB 1S9GB 2OPRB 1HBOA 2Q79A 3F41A 3UVJA 3LA0A 1GAOA 1RAFB 4G1QB 4LF5J 3H20A 4TY8B 1WORA 1CJTA 1UFLA 5T41A 3AHPA 2RD5C 4DN0A 4UTGA 5IWAF 2BANB 1RU1A 3P5BP 4ZA1A 5IOLA 1R6VA 4ZP6A 3MR3A 3TJ8A 5EHHA 3SZ2A 4KYZA 3AODA 4ZPAA 1WF1A 1K0TA 1DAXA 4YFUA 4ZJOA 2QSFA 4F8RA 4P2SA 4K0KF 3IMQJ 2GGPB 5L1KA 2GVZA 2WRMA 1TL4A 1FJ7A 4EO8A 1DRZA 1CPZA 2F5GA 1IBMF 3KK1B 1RAOA 1Y10A 2W8KA 3PR5B 2QC3A 4RJVA 1OWXA 3JQJA 3OXLA 4IFYB 3DHXA 2E9TA 2LQBA 2AWZA 2OJ3A 4J9NA 2JWNA 3WBZA 3P4UB 2M8DB 5F41A 2Q1LA 3R1LA 2AYMA 3Q8VA 1R8BA 5DGBA 1H6KX 5KFIA 1DLOB 1FRMA 3BGOP 1KKHA 3C16A 1H7XA 3OVAA 2RAQA 4M94A 3FDSA 2H51B 3MM7B 2Z2ZA 3B6BA 2GC8A 4K5RA 1RT4B 1TK8A 4ES2A 2LEPA 3U7JA 5EX0A 2CPEA 3G82A 1OY8A 2PC6A 3WX8A 1EX8A 1TZ0A 2UVWA 3G86A 2VC1A 4ZPCA 4P7VA 3T1YJ 3ICLA 1NRKA 2J6UA 3TP2A 3LOUA 4R5PA 2UP1A 4E0DA 5E3AA 3PM9A 1TTHB 1PKUA 1T7PA 1QE1A 3NGKA 5F9NA 4L72B 4N77A 3H5YA 3CC2S 3QSYB 1PJ6A 1SUQB 3CMQA 2ZJQQ 2I0XA 1MU2B 4C8YA 2VJVA 5J1EA 4ED6A 5F8HA 3POTB 1VFJA 4E8UA 2UVRA 4KHPF 2FJEB 2WB1D 1N5QA 1CQMA 1GH8A 4J90A 3M8WA 2CJYB 1D1UA 2KU7A 1HIYA 4C8OA 2DHHA 3DDKA 3N01A 2DXEA 1WDTA 1TL3B 3NGUA 1RYRA 4ILLA 3PY8A 5F8NA 3BKTA 1LK7A 2KN4A 2WVBA 4NLRA 3UDEA 2XY5A 1VQ8S 3UI3A 4M5IA 3H7HB 2F9DA 5EWFA 3SBMA 2VFTA 2FIUA 4JI1J 1RWVB 1XN9A 4DS4A 3U02A 1TAUA 2IDEA 2ZBPA 4WZMA 3M2VA 4MKBA 3KHRA 4YR3A 3T5LA 2PEHA 2MZ1A 1VI7A 2AQ4A 3HPOA 2Q43A 4EUVA 3P49B 3EWGA 2H5IB 3TA2A 5C42B 1RADB 4J9RA 1NK4A 2DVIA 4HI2A 2E44A 4CRJA 1HNIB 4RW6A 2JX2A 4CM0A 1VRTA 1UW9A 2C42A 5M2PA 4RUHA 5J2MB 4J9UE 4OFZA 3SSQA 1U8WA 2A18A 2ZE2A 3B82A 1S72S 3ZZZA 4UW2A 5I3PA 4F67A 5KFKA 4DV4F 2GAGC 1IR0A 2G4BA 2RKIA 2J7UA 2J9CA 3FGVA 4YMEA 1KC8T 3TUZC 2Y1JA 3DOLA 3US5A 2DGVA 3HHLD 4HHJA 1EB0A 2E1PA 1R8CA 3MPYA 4ID5A 4TU7A 5KFEA 4USMA 2KG0A 4M5MA 2DXFA 1R43A 4MK9A 3BDEA 4LF7J 4O3QA 2DNYA 4H4KA 2B7BB 1NPKA 2W9BB 2UUAF 4OJ1A 4WTOB 4LFCF 5KT3A 3T1AA 1S76D 1IKXA 3M6XA 3P8BB 1S9EB 1U0HB 2CFXA 4X4TA 1Y4ZB 1HNZF 3HP6A 1P1LA 5D4OA 2M8HA 1A9NB 5BYSA 1UW4A 2MQMA 5KFVA 5DDOC 1FI4A 3MWBA 1VHFA 2VHGA 2BE9B 2GVDA 2DPIA 5HBMB 3LP2B 5KG6A 3GFZA 2FLNA 2W25A 3MPDA 1TK5A 1SC1B 3D6HB 1FA0A 3GB0A 5KT7A 3FFIB 2HQ3A 3HD2A 4DPXA 3VGVA 4CQ1A 3L09A 2B4PA 1NB7A 2QMWA 4X84A 3J81U 4Q8FA 1KNZA 2R2UA 3MZIA 2HWIA 3GONA 2HYIB 3G4SS 4ID8A 1U25A 3IWNC 3N4WA 1Z1ZA 3GZ7A 2POKA 5A76A 2GQQA 3AFGA 3F73A 2AGPA 5A0YB 3IN5A 5BJRA 3ZZUA 4OYMA 1SJRA 4ZN1A 3CCQS 1AW0A 4M5JA 2Z0GA 1NKCA 3HZGA 2F8MA 4ELUA 2V4JA 4M8LA 2VV5A 4DV1F 2R42A 2KI2A 3ENWA 4DR2F 1FRJA 5B09A 1JJ4A 4Z7YA 4AUKA 4I68A 1T03B 4CLUA 3SFUA 2F3JA 5IV3A 5ITHA 3R5JB 1WELA 4U95A 4C2MA 1LWCA 1YJ9S 1CULB 2WSEC 2KB2A 3A8KA 3D4JA 1WOSA 4FXVA 4FYXB 4J9QA 3DLBA 2V2KA 3EMTA 3JS9A 1UVIA 3I9V9 5DGAA 1NAQA 4XTTA 1XR5A 2VOPA 4X4QA 5K9FA 2CIMA 2X7IA 2BM0A 1X4AA 1IBKF 2FTRA 3MM6B 3ET6A 2HFNA 3HKZD 3OJSA 1EAYC 3CJ2A 4IG0A 2PE8A 3QQCD 2ZUAA 3K59A 5K8NA 2PGCA 5CA5A 3NY0A 6FDRA 1CJUB 4DLEA 3UCUP 2CXEA 4USIA 1AB8A 2PFDA 4RW7A 1RA6A 3LALA 3CW2C 1X0FA 2B8PA 1FK9B 3TUIC 3V4IA 3EJMA 3OHBA 1WEXA 5LMUF 3BDPA 2ZC3A 4CT9A 3QAEA 3VF0B 1VRQC 3GCXP 4GKJF 7FD1A 3BS9A 4ICLA 2AIRB 4OQJA 3LUYA 2K7JA 3BSCA 2MTLA 2B56A 1KTVA 2Y3YA 1RT6B 2C1EB 2ZH2A 4P75A 1V3ZA 3ZC4A 3GILA 5CCMA 1UEUA 3W60A 4CLYA 1RT5A 1YBUA 2RT3A 9RUBA 1CEZA 1OIAA 3MPWA 2VBWA 1ROFA 3GWCA 1OY9A 1IWAA 1IJEB 4MMOA 4PQAA 4KO0A 1PGZA 1IWGA 2UUBF 2GJFA 1JKHA 1YJWS 4IRKA 2C3YA 2HGMA 3IA0A 5EGYA 4U67Q 2AD9A 3FUYA 4UOCA 3D3BJ 2VB6A 3H25A 2OTLS 4FS2A 1LFWA 1BXNA 1DARA 4ZKAA 4PR6A 5J2QB 4C9DA 4FXDA 4LBHA 3HHEA 3IP0A 2AYEA 1PYTA 2C2EA 3GSDA 4DL7A 1SJ3P 4U8VA 3HJFA 1S1TB 3OL8A 3MM9B 5LSRA 1DZ5A 3N6NA 4M5NA 5KFUA
chains in the Genus database with same CATH topology
1DQ8A 1YJTA 2PA3A 2OPQB 2VPWB 4AFFA 4QIFA 2OD4A 2JVOA 1KHWA 4J37A 3NG8A 2XLJA 1SJFA 3P96A 2MZTA 4GC6A 2OIHA 1URRA 4F26A 2YNIA 4ED2A 5KFPA 3K7RA 2XLIA 4IO1A 4BC9A 4CZCA 2J7KA 1WI8A 3UD3P 3C66A 3E3XA 4WCEQ 4I64A 2CQPA 3DHWC 3LWLA 4ZVGA 1NO8A 3J81Y 2FHKA 3UDLA 2IAJA 1YJRA 2DNRA 4Y3CA 2RU9A 5A8WA 3EPGA 5J2PA 1JK9B 2DNZA 5GVQA 3LPYA 1FCAA 2BDPA 4TY9A 2HNDB 3OUYA 1HMVA 3X3UA 1NHUA 3IR6B 3UW1A 1NHVA 3T3FA 1O51A 2LA6A 3CO9A 1L3KA 2UZAA 3HHLC 2O01C 1UEVA 4IDKB 3CTRA 3Q24A 4IH7A 5L9XA 5IQ6A 1SH2A 2LDIA 4KR0B 1ZBTA 4R8UB 1TFYA 2B9WA 3RRKA 5DLGA 5A8RB 2IJNA 1LWEA 3KFWX 2EPIA 2GX8A 2DGWA 2OKQA 2ZHBA 5G0RA 2FHOB 3LGMA 1HNXF 2NREA 2CZVC 1TR0A 5EN1A 4JOUA 2D9PA 2PFFB 4FBUA 2GFFA 2HS4A 4RW9A 1JLGB 5THWA 3N5BA 3E8OA 4IFVB 3MOZA 3TRGA 4OL8A 3V6DA 3QAUA 1BC6A 1FHTA 1JLEB 2HIQA 1X4FA 1XTZA 4J9PA 3QMQA 5KFOA 5FDLA 4RU2A 3U27A 1KQFB 1Q7YT 5M2RA 4Y28C 1OPZA 1R0AB 5AXLA 1DTQB 4Q8EA 3M6UA 1NK6A 3VAMA 4NLQA 1VQNS 1KLMB 1RT7A 2XEXA 2MZRA 2DO0A 4OZ0A 1Y5LB 4EBCA 4NLYA 3UDCA 5DS7A 3IXQA 2MSSA 1D9DA 4K4TA 1KHVA 2NLWA 5LXYA 4Y2CA 2FHJD 3PX6A 2MKJA 4I56A 4QZVB 5IT9Y 3JAMY 5C5JA 5KG5A 2GIQA 3I0RA 3KHGA 2B9YA 3UWTA 4Z2XA 3NLCA 2QV6A 4OLOA 1WTBA 3NNCA 2NYIA 2XS2A 4R5PB 3RYLA 2OPPA 1U1RA 1VQ4S 3DI6B 3B4MA 4RU9A 3BR8A 4DF4A 1URNA 2JH3A 3PACA 1FD2A 4PUOA 1Q1KA 3MEGA 2KFYA 5L39A 1LFPA 3H5XA 3D2WA 5DDRC 3EGZA 1D9AA 1WHWA 1QE1B 1FRHA 2OSQA 4DFKA 2ZH5A 1UVLA 2ZBIA 2R7TA 4ALZA 4WJBA 4ATNA 4I7FA 3J7YU 2YNHA 2XB2D 4EYHB 1BQNA 1TKTB 2XNRA 1KFSA 4IQXA 4N56A 3ISZA 1IKVB 4K59A 3QO9B 2RF2A 3B8HA 3M8QA 2X1GA 2YWKA 1Q82T 1FKOA 1RTIA 4H4KC 4C98A 2GMHA 2ZH7A 2COLA 2B7CB 3TAMB 3NCPA 4TNOA 2BYCA 1M5HA 4IYQA 3QGIA 3DRRA 3NMAA 3K8VA 2CKWA 4OI3A 3FZBA 1RTHA 2HAIA 3ZZOA 3G8SA 2HHXA 5HLFA 3DGPA 3PO5A 1JB0C 2MKSA 1K1QA 3BGRA 4K4XA 3MMJA 2DR9A 3PW7A 2Y0SD 5K8PA 5A8KB 3PIPQ 1M5PC 3M2UA 4RWWA 1SBRA 4I69A 2ZOMA 5K14A 1N32F 1C0TA 4CH7A 1G1XA 1MROB 3SCLE 4ZCLA 3OTOF 5DRKA 1N34F 1I6JA 3DOMA 4O4GA 4IKAA 2XSJA 3IG1B 5KG1A 2MZJA 1XR7A 4QW9A 2I1RA 2VA2A 1KVIA 1S0MA 2HFOA 4NCGA 3I4PA 4QIWD 1H2VZ 4ZS6A 3GYNA 5DM6Q 4B3OA 1HNVA 1KONA 4JI2F 3PO4A 4M95A 4DL3A 4WE1A 3M30A 2CZ4A 4LIWA 2UUCF 2HNYB 3CGIA 3NP5A 2DR7A 2OLWA 4IQMA 2CPJA 3MF5A 2XI3A 2QEXS 4DOZA 1NK0A 1S6OA 2YWHA 4CI0B 1DFDA 2IHR1 2R8JA 1N0UA 3M2RB 2YNGA 4O3PA 4GO5X 4N76A 3MMAA 3PKYA 2HLTA 4MAKA 2HG4A 5KFTA 3QGHA 1WI6A 1RA7A 4JI5F 2V8DA 2DIVA 1QUVA 2B6AA 4Y2IA 3THPA 1RQ0A 2RS8A 2VBZA 4PCQA 5E3CA 3AQPA 5SZTA 2ZDPA 3DFEA 3CDEA 5J2NB 3PZPA 4XAKA 4C8KA 2HZCA 2M2BA 5JVGQ 3CC4S 3JTPA 4DX8H 1VMBA 3MEDA 4LSNB 4ECRA 2KYZA 1OPIA 2ZNYA 2HLUA 3P5TL 3NGDA 2J6SA 1A6LA 2YY3A 3HF5A 4PQUA 2CQHA 1CC8A 2U1AA 3MM5B 5I3UA 3HHLB 1HWLA 4BC7A 3R5AA 3MAHA 4NA2A 2A3JA 3JTOA 1LWFB 1U8SA 2DISA 3T9NA 4ITSA 2ROEA 2VZ9A 3VAKA 1E6YA 2IRYA 5CZXA 4LF6F 2HWHA 2R7VA 2YQ3A 2VONA 3KLGB 3CEDA 5HL7Q 3VZHA 3QPIA 3VAFA 4IR1A 3LWMA 3MDFA 1HR0F 1DJ0A 1R3NA 2XWYA 3F44A 1JLCB 2PO4A 3CCUS 4IH5A 2MYFA 2XMTA 2ZH3A 1F2GA 2BA9A 3CXCR 5DDPC 3H4DA 1VRTB 1VQ5S 3LP1B 3RAMA 1WF0A 2YKPA 1S6QB 3ONQA 2CDQA 4K50A 2DNGA 4HLBA 2XY7A 4MIBA 1SIZA 2AYBA 2IA0A 5E3RA 4IRCA 4M5DB 2WOMA 4FNHA 1S9GA 2OPRA 2X1BA 2ZE2B 1L3TA 3T5HA 4C11A 5HMWA 1UVJA 4DR6F 1K1SA 1GX5A 2AP6A 2FUG9 4C8NA 4ECVA 4ZPDA 4NXNF 2MY7A 2LU2A 2N3LA 3OTDA 1FVQA 4ZOSA 3M05A 2HHQA 3A1YG 3I0SB 2N3OA 3PFOA 4EZ6A 4NLTA 1FF2A 1UAWA 2LQ5A 4LT6A 4D3HA 4DLGA 2VG6A 2RKIB 3SYZA 1KFDA 3TA0A 3CCRS 1KQSR 3OLAA 4NOHA 2M88A 4PPDA 2MDAA 1LK5A 3KLHB 1DQ9A 2BANA 2MKIA 1Q4RA 2MKKA 4OMFG 2L48A 2VG5B 5B0GA 5IFMA 2JFDA 1TAQA 4N47A 1UVNA 5T14A 2KT3A 1U48A 2MKCA 4A8KA 5HROB 3E2EA 5HQ8A 1I94F 1U09A 1MMNA 5GAEU 1GXLA 1G3OA 4YDXA 3OL6A 2DT9A 2M9KA 4C0BA 3HVWA 3GFYA 3TUJC 5H9FJ 2AGOA 1WF2A 2FLPA 2GGPA 4HTJA 2NR0A 1TKXA 2V8HA 5J1NA 1DURA 3O8WA 4DG1A 1KQGB 3I56S 1M5KC 5KG7A 4ZHRA 3H2UB 3KK1A 1O0PA 1KOHA 4OI6A 2EI5A 3FEXB 3GV5B 5L1JA 2I5JA 3I5BA 4MFBB 3IO1A 4FPRA 2RQMA 3EXYA 1N8RT 1U6ZA 2JFKA 1VLYA 4K5SA 2CJ9A 2OMOA 2C22A 4J9KA 4U9RA 3EGWB 4K4YA 4RBUA 2DNHA 2A10A 3QIPB 4RWXA 4Y34A 4IG3B 3OJUA 5GAGI 3MEEB 2LXFA 1S1UB 4KC5A 2L9NA 4ZP8A 4IFYA 4F2RA 3RZAA 1RT6A 2IC3B 2OD6A 1SJ1A 3DXSX 4DSKA 1S1XA 2ZFHA 2J0WA 5KG4A 1O8BA 2RDIA 3C8YA 1MMLA 5AE1A 1B7FA 3GG1A 4YUDA 5CYQA 4UY85 3DM2A 5KFWA 4R0JA 2B0GA 1HWKA 1U1NA 4A47A 4DSIA 1FE4A 4Q45A 1HBMA 4X64F 2F7VA 2AYGA 4Y65A 4PG7A 1RTJA 4DUYF 1P8GA 4NA3A 2PDAA 3SQGA 2L3MA 1R8PA 3CCTA 1YHQS 4DF8A 2YNFA 2WONB 7FDRA 2AF6A 4LSLA 4YEAA 1ZM9A 5T7LA 4ELVA 2OSRA 2BVZA 1IKWB 1DLOA 4ECZA 5F3TA 4R0EA 3D0GE 1X4CA 5B0DA 2GHWA 2FHMA 2HWTA 1UL3A 2AU0A 2IM3A 3FZ2A 4HDGA 4URQU 5B0FA 4DFPA 5GAHU 4YP3A 4PXCA 4J9SA 3BEGB 1B0VA 4C3MA 5KT4A 4KFBA 1B0TA 3MM7A 4LQ9A 3Q8QB 2ASJA 2AJFE 3ISND 2ZHOA 3GIMA 5CHCB 2AGQA 5D3GA 2DRAA 2C3MA 3NKYA 3KLFA 4ZP9A 2ZJPQ 2IMWP 4RNHA 4B3TF 1RT4A 4I0WA 3PKMA 5L9NA 4KSEB 1ZPVA 2VODA 4V19J 2MZSA 1U7LA 2KT2A 1VJWA 2YKMA 3AB4B 2DD8S 2JDJA 2WK4A 5E0OA 4PPZA 4PKDB 3I32A 3PX0A 2OMLA 3OTEA 4MH8A 2KO1A 4FVMA 3M32B 3NNAA 1XWLA 2HHPA 1M90T 2QZ8A 2LXIA 5GMKa 3Q23A 1ZAXA 4QWCA 3TNVA 3H5UA 3K0JA 3I82A 4YR2A 3IC1A 2RB7A 4DEZA 2MB0B 1VGYA 4A8OA 2BV3A 1HPZB 4KQZA 4ZPWR 4ZPTR 4MKYA 1VK3A 2GHPA 3H98A 1R8HA 1UJ5A 3DRSB 5LL6d 2D3ZA 4E98A 4DQIA 2XZWA 1A7GE 2KRRA 4ED5A 3QIDA 1HD0A 3RB0A 2G0CA 2R7OA 1Z2LA 2CPYA 4USHA 1JLQA 4EEYA 3DLLQ 1BQMB 2XMMA 4TYBA 4JI4F 1VQ7S 3IWLA 4CIOA 4C3KA 5EDWA 3NCRA 3FRYA 2MQOA 1OSCA 3AQOA 2R7WA 3AA8A 2MGZB 4ECXA 1WG4A 2V9KA 1S99A 2XGQA 1JMTA 4XPCA 1X4GA 1JIHA 2QFJA 2DNMA 3TR5A 3MFHA 4OI0A 4I2PB 3DYAA 3UCGA 1S1TA 3E01B 5LT5A 4YR0A 1U45A 4RZRA 3DLKA 2O1PA 3H59A 4R25A 3BGLA 4H4OA 1YJUA 2V4JB 2QYCA 4LFCF 1K8AT 4QWBA 1X4BA 5KG3A 1HQUA 3PRDA 2C3OA 4KHMA 3UR3C 1G2EA 3MHYA 1UVMA 1HL6A 1MU2A 2DB1A 3HHDA 3CJKA 3VCDA 4DL6A 2FVQA 4RX6A 1AFIA 4QYRA 2FJVA 2DGOA 3POTA 1FKPB 3FJ2A 5BYQA 2MXYA 2HHHF 2NXUA 1SIWB 1NKEA 1XNQF 4ECTA 3N6LA 1Q79A 3D1QA 4IOAQ 4F4WA 5E3PA 4RBVA 3I4HX 4NX9A 1N48A 3CJ4A 3UR0A 1UWBB 4DL0C 4B08A 2PD1A 4OLPA 2DHGA 3WC0A 1IXKA 2VPZB 1Z2ZA 3IS9A 2NUUG 2FB0A 1YITS 3LO3A 2YTCA 3FEZA 1TL3A 4ILMA 2E9RX 1FEEA 1NK9A 1VRUB 3G6ES 4CNYA 2FJWA 4NPOA 1RGVA 2IRUA 3CDWA 1LWCB 3FRZA 4MIAA 1ZAWA 3DU5A 1S0OA 3WX4A 4FP9A 1J5OB 2D3UA 1UJ6A 2P6TA 2FVCA 2F9JA 1SXLA 4B3RF 1D8ZA 2EFQA 3DN9A 1IKYB 4DDFA 3KK3A 4PG8A 4M63A 4QQBA 4FF4A 4H4MA 3V2UC 1D3WA 2NUHA 5DQGA 2XG8A 1FDBA 1S1VA 1Z4UA 3GG0A 5F8GA 4JI3F 2KXFA 4DFJA 1FDDA 1HI1A 3KNAA 1RJJA 1T02A 5IM0A 3P6YC 2Z2LA 1ZPWX 1VQPS 3T9ZA 1WHXA 4X4NA 3DLEB 2BQRA 3FQLA 1N5YB 2IVYA 4WFBQ 1UETA 2YX4A 2KTQA 2MKHA 5EWGA 4UY8T 3KJVB 2YKAA 4MK7A 4X4RA 3SMZA 4URGA 2UXCF 3KK2B 1WEYA 2BE2B 1E6VB 3R5DA 1VBYA 2BJDA 1YBAA 4IFVA 3TA1A 3S1TA 2ZC4A 2HMIB 5IS2A 1FERA 2G13A 1F60B 4MK8A 4AL6A 4OHWA 4IG0B 3MI7X 2ZKTA 3LP0A 1HFEL 4WFXA 5C25B 3N5FA 4NLVA 5K8OA 2RS2A 5CXTA 2MHEA 3NMRA 4Q0BB 3MECA 2F40A 4JI0F 3UCZP 4NWBA 3VR1A 4N5SA 4A8QA 3Q22A 1S6PB 1R0AA 1N36F 1RT1A 3SCKE 4X4SA 1ZM2A 4OX7A 2MY8A 2J76E 2NZ4A 4WYWA 1DTTB 2IBOA 4Q2LA 1JLBB 4ECUA 3G6VA 1TL5A 2HS0A 2YWFA 5KFZA 2KRBA 2DNLA 4DWIA 4ED0A 4AE5A 4NZ7A 1S7HA 4OX8A 4RW7B 5L8RC 1HD1A 1YJNS 4B3SF 2XMJA 1GX6A 1YRUA 2I38A