1SB6A

Solution structure of a cyanobacterial copper metallochaperone, scatx1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords copper chaperone ScAtx1
publication title Solution Structures of a Cyanobacterial Metallochaperone: INSIGHT INTO AN ATYPICAL COPPER-BINDING MOTIF.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Chaperone
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sb6A00
5KAKA 1P6TA 2BJEA 3KG0A 3BF4A 2CRLA 1OQ3A 1R6YA 2RU9A 3BR8A 3HHLA 2HLUA 2OFGX 3CJKB 5B0BA 2IFXA 3BM7A 4QOTA 3GZ7A 2PGCA 2W4CA 1Q4RA 4HI1A 1LQ9A 1YRXA 2QIFA 2FHMA 1ULRA 2KYZA 2ROGA 1Y3KA 3FGVA 2BUNA 2HIQA 2XMVA 5K9FA 4A4JA 2W4PA 1N5QA 1TL4A 2FIUA 3I9ZA 4FNHA 4DPOA 2OD4A 4Q2MA 4YDXA 2N4CA 4NPOA 3KG1A 2HFNA 3LO3A 5B0CA 2LXFA 2N7YA 3HHLC 3MZIA 1CPZA 3LGNA 1Q8BA 4Y2IA 2XMWA 4EFAC 3QGPA 4HH0A 2AJ0A 2K7KA 1U7LA 4OJHA 2RSQA 2ZDPA 2ZDOA 2AJ1A 2QLWA 4OJ3A 3BGUA 4A46A 3T9NA 3CJKA 3MCSA 1YJRA 2LQBA 2EW9A 1VQYA 3HHLD 3KNGA 5IXUA 1SB6A 1FVQA 1FE0A 1SQEA 1YG0A 2GO8A 2Q3PA 1MWZA 5B0EA 1KQKA 3VTIA 3WDOA 2PD1A 3DCAA 2GGPA 2G9OA 2IYGA 3TNVA 2XMTA 5A6PA 4A47A 1JK9B 1QUPA 2ROPA 2XMKA 4DL0C 1JWWA 1Y9OA 1SI9A 1YJTA 2HLTA 2KKHA 2QLXA 1AFJA 2OD6A 1CC7A 1TUVA 2BBEA 2XMUA 4YEAA 2IYIA 4HI2A 2ROEA 1W2IA 3K7RA 2KT3A 1FE4A 1GXTA 5T7LB 2OFHX 2VH7A 1WD6A 2AW0A 3TRGA 1OSDA 2GCFA 2JDJA 1S6OA 3HF5A 2VV5A 2FB0A 3HX9A 1X0PA 2HFOA 3HDSA 1APSA 4Y2MA 3HHLB 1FESA 5B09A 1X7VA 3IWXA 4DN9A 1N5SA 1KVJA 1OPZA 3E8OA 3FRYA 3UDCA 4ZA1A 2ACYA 2OMOA 3F44A 1MWYA 2OAUA 2K2PA 4Y2KA 2GFFA 1CC8A 2LDIA 2XMJA 4U9RA 1FEEA 1FVSA 4OIXA 5B08A 2K1RB 2HQIA 4Q2LA 2W4DA 1S6UA 2XMMA 1RJJA 4HL9A 1TR0A 1VQSA 4F67A 4ZOSA 1OQ6A 3LGMA 1N5VA 2GV1A 3BDEA 1FD8A 3HFKA 2BJDA 2GA7A 2RILA 4A48A 1XBWA 1Y3JA 4NL5A 1P8GA 1V3ZA 1KVIA 1Y0HA 1TL5A 2OP5A 3DXSX 4HH1A 5B0AA 1K0VA 3QMQA 2OKQA 2GGPB 1URRA 3BN7A 2RMLA 4OJ1A 1YJUA 1IUJA 1AFIA 5B0GA 2L3MA 5A6WA 2BYCA 1N5TA 1Q8LA 2KT2A 2K1RA 1TZ0A 4FNIA 1GXUA 3TOQA 2FTRA 2N4DA 5F0WA 5B0DA 2ASYA 2QYCA 1YJVA 5B0FA 1Q53A 5F0UA 1X8DA 2LQ9A 3BB5A 3FMBA 3IWLA 4OJGA 1AW0A 5T7LA 2K7JA 3KKFA 2AP6A
chains in the Genus database with same CATH superfamily
2LLZA 3DU5A 3OXLA 4ZP7A 4CWBA 3BSCA 3M05A 2BE2A 3AB4B 4ECXA 5D4NA 2ZJRQ 1UWBA 2ZOFA 1ZPWX 4YOEA 1GT8A 2HHUA 1B4SA 1B64A 2QT7A 2HBRB 4DL0C 2OD6A 3QYYA 3O1LA 2B51A 1N36J 2XY6A 1R6VA 3HZGA 3TRGA 1F5BA 2HFOA 3HI9A 1APSA 3BGOP 1NHKL 5LSLA 3PRDA 4K4XA 2OH2A 1T05B 3OL9A 4ZCIA 4QQBA 4X2BA 2KRBA 1IBLJ 2XMMA 2FGCA 3E01B 1C1CA 4LR8A 3WHIA 5KFPA 1FD8A 3PR5B 3KK3A 4IR1A 4G1IA 4DR1F 4RUHA 1BQXA 2UXBJ 5EWGA 5M2PA 3L3CA 1S9GB 4DSFA 1NO8A 1FXRA 3K2YA 3SCJE 3QT5A 1T8EA 4JI3F 3LANA 3NBPB 1YWXA 4GVLA 4URSA 3HZEA 2R7QA 5CYQA 5J1NA 3J80Y 5EDWA 1NDPA 2HNZA 1S0MA 2B43A 2C3OA 3PM9A 2V68A 2Z0GA 2XS2A 1MNEA 4NLDA 2VOPA 3T9ZA 2A6MA 2A3JA 2CYYA 5E33A 4G3IA 2ADCA 4WTYA 1J5EF 2ZH9A 3IR5B 1PO6A 2JLEA 1UW9A 4RW7B 4ZVUB 2HQFA 2ZVIA 3KFWX 4P9SA 1G7CB 2OMOA 3TQ1A 5KTQA 3MURP 3D6HB 3HVTB 2HAIA 1M1HA 3K5MA 1WF2A 1DRZA 4IQMA 2V5HG 1E6YB 4KAIA 4JB8B 3NLCA 4NLVA 2BACA 3KLVA 4GKJJ 1JB0C 3NAHA 1ELOA 5HAOA 1JLQA 3DRYA 3CJRA 1HA1A 2VODA 4X66J 3DDIA 2MXYA 2LU2A 1P9YA 2XMVA 3DOKA 3I56S 4J9SA 4IQXA 5IWAJ 4JI5J 3MAAA 3SSRA 2AJ1A 3WDOA 4OX9F 4M5DB 1S0VA 3TJ9A 1W7WA 3MM8B 2MHEA 2XHWA 1R43A 4DF8A 5AT1B 4LREA 3KUEA 1VIXA 1HD1A 5KFMA 1IBKJ 4WU3A 5D3GB 5HATA 4OYAA 3V6KA 4OMFG 4FN5A 3TP2A 5C24B 5DDRC 3DLHA 4DZDA 2JH3A 2GGPB 2UUAJ 1S99A 4MK9A 4EO8A 1EP4B 3KLHA 4NXNF 1Q82T 2CDQA 1JLFB 4F25A 4PG8A 3K17A 4USVA 2HQCA 1CJKA 4CH0S 3P4UB 3W5XA 2DGUA 5G0RB 1VRUB 3GONA 2V4JA 1OY9A 1U2RA 4J5OA 4NPOA 3U27A 2HVEA 5MLCV 3HHLC 4PXDA 1YGYA 3MD1A 1RAFB 1LFWA 2MJNA 2XI3A 2LQBA 4DV2J 1MWZA 1UA1A 5J2NA 4IRDA 2AHOB 4RW9B 1YJTA 2OHDA 4ITSA 1U24A 4GRSA 2D3O1 2IBOA 1P1LA 5L9NA 3MR6A 4I56A 5ADZA 1FNMA 3DRRB 1YBUA 1B7FA 2V94A 1CC8A 4QJVA 1S1TB 4CO4A 2LXUA 3HHNB 2JEGA 1S4EA 1HHSA 2FVCA 4JUZA 1FF2A 4U7UD 2GS8A 3M4XA 5IT4A 4ELTA 2OP5A 4CLTA 3W2VB 2ZKTA 2ABYA 3NAIA 2UXDJ 2WCXA 3JYTB 1RHQB 4R0JA 1R0BG 2FVRA 2PGCA 4ZPDA 3PACA 2KM8B 1F9FA 2JLGA 3R1LA 5ETKA 4CLFA 2L9DA 2E5LJ 2B9XA 3Q8SB 3CSKA 1HBMA 3HSJA 3ZNJ1 1SQFA 3L7PA 1LWCB 3MM5A 1YIJS 4ZVSB 1VQ6S 1U26A 1TFYA 4DX8H 4OZ5A 3M9MB 1LXNA 4ZVFA 4MIAA 4E2FB 5A8KA 1PAEX 4FPRA 3TAMA 5HMZA 3IN5A 3AH6A 1SJFA 4JI4F 4Y6IA 2F63A 3LGMA 2H65B 1DQAA 2BJDA 3N6NA 2JNJA 1NKBA 3DRSB 1SUQB 1RTDB 1KVIA 4PQUA 2KL8A 3BGRA 1HNXJ 3QWUA 5KFEA 2DNRA 5CD4H 4OX8A 2ZBIA 3KNAA 1D8ZA 3KK1A 3PKYA 3BB5A 2WBMA 2G1HA 3KLGB 2EBGA 4YR3A 5I3UA 2OPSA 2ZFHA 2CNOB 4HHHA 1WC3A 4ED2A 1DBDA 1Y3KA 2OEMA 4GVBB 4Q2MA 1FTRA 3B82A 4ZIWA 1Y7PA 3BV8A 5IFMA 5LMNF 2X1BA 2BQUA 4ZPBA 3T9NA 4OYXA 4ZHRB 3DDKA 1FHTA 2PC6A 4M8LA 4ID5B 1XJWB 2VG7B 5IC6B 3BKFA 1CJVB 5GAGI 3M2UB 2OTLS 3DXBA 4MKVA 2JHEA 4ZK7M 2V2ZA 3BKTA 2QA4S 1I5OB 3MI7X 4ES3A 3BBCA 4Q7AA 2FHJA 1U8WA 5FD1A 3PEJA 3KG4A 4IH6A 2EVZA 2K1RB 1KP6A 3GYNA 1NK8A 4DL4A 2CQGA 1S49A 4DG1B 4FS1A 3W7BA 3LP2B 3VAKA 2MSSA 5F8MA 3HD1A 4ERDA 2FPHX 3AHPA 3FBFA 5GMEA 2VKZG 4NL5A 2VDHA 4FPIA 1FJGJ 2DNMA 4I6YA 3VR1A 1WC0A 2HS0A 4JOUA 3GCXP 4ILRA 1FFGB 3K89A 2XO7A 4NLGA 2UZAA 3VAJA 1NKCA 1FDAA 2WVDA 2L41A 3SV3A 1T05A 2VPWB 4JI0F 4AXJA 4ZVRB 3E01A 3MEGB 3CDEA 4B3TF 1PYTA 2POKA 3EWGA 4ER8A 3EXCX 3DRPB 2HZVA 4FKXA 1VK3A 2Z30B 2K06A 3DLKA 4IR9A 3CJ0A 1S9GA 1K47A 1C4CA 2NUHA 3HX9A 4DX7A 4TU9A 4R8UB 4M5GA 1XR7A 2EKNA 1SH0A 3UE2A 2H3EB 4M5NA 2OAUA 1FERA 5ETTA 2J9EA 2V4QA 2AJQA 2NSCA 4JV0A 2QE5A 1TMMA 3O8WA 4ZJOA 3IM9A 4DR6J 1YDLA 2K3KA 3UCGA 4YY3F 2KI2A 4QIWD 2O67A 2XI2A 2ZH8A 2PA3A 2ILZA 4UY8T 2C3MA 4K2JA 4RW7A 6FDRA 4QWEA 2D3OR 3P45B 2MKYA 2RHQB 3IM8A 2W24A 2J6TA 1U4BA 2HS4A 2I9SA 2X3GA 3HVTA 1HWUA 3JQJA 3K58A 1Q8IA 2QSWA 2E5JA 3C2PA 4DPTA 5EWFA 4IO9Q 1AZSB 3ISNC 3RGIA 2EFPA 1E6YA 4O3OA 2YVSA 3A13A 4ZP9A 1R8HA 4DSLA 3KLEA 4PG6A 3AQOA 4HI2A 1R3NA 4P71A 2LYVA 3RB0A 1FX2A 4R5PB 3OTCA 1RKIA 2VU5A 3ONQA 1QY7A 3R5BA 1KVJA 2OPRB 2VPYB 3GR0A 4B3RJ 4OHVA 1PYSB 3IBCB 4TYBA 2XCAA 2OGUA 3IA0A 2OSQA 3CDUA 1H98A 3BPDA 4ZLJA 1C0UB 2YKOA 2RHSB 4M5DA 1KBRA 3P8BB 3MEEB 2YX4A 1IKWB 2UVVA 3A3OB 3ZO7A 1OQ3A 2ADBA 2RNEA 2HHTA 2XYPB 3KDOA 1WSRA 1WSVA 4MMOA 2VFTA 2YXLA 5D3GA 4P52A 4GO7X 3R7NB 2MQNA 1NEEA 2DH9A 1RACB 2UUWA 2VICA 2DO0A 5C24A 3GJSB 2HEKA 2VUGA 2GGPA 4ZPCA 3S01A 3H59A 4O44B 3AFGA 2N82B 1EP4A 3RB6A 3NNHA 1FDDA 3Q8VA 1JLFA 1NZ8A 3T5HA 3CPWR 4Y2MA 3THTA 3TA0A 1KN6A 4FYVB 2MTLA 5LXYA 1FEEA 2IPOB 5G0RA 3M30B 1T9VA 1RP5A 2BM0A 1X4GA 3H2LA 3MPWA 2YNFB 2WSFC 3D0GE 4RNHA 3LH2S 4ELVA 4X4PA 1RT4A 1R7IA 3U1LA 2XY5A 1IUJA 2J6SA 4LSNA 3AY0A 1NLKL 4B3OB 4A8QA 4FBTA 3HFZB 5ETNA 1MSWD 2BABA 3BR8A 3W62A 3PTWA 3BM7A 1IWAA 4KV8B 3DRRA 2OPQA 3CJ5A 4I6AA 1S1TA 2KFYA 2A10A 2PE8A 1NPKA 3MUVP 2W2NP 2ZDOA 1X5OA 1SB6A 1HWIA 1JNZB 3W2VA 4XDDA 2XLKA 4WFXA 5D8HB 3JYTA 3R5AA 1N32F 4J90A 2XNQA 1X7VA 4XTTA 3K8WA 5C7PA 2LDIA 3G8SA 3R1HA 4Y34A 4XPEA 4DUYF 1HBOB 3J81Y 3LQVA 1HI1A 1ZYQA 2C2NA 1D1UA 1HNIB 3A12A 1GMWA 2EKYA 2RILA 2DGQA 2FLLA 1DLOA 9ATCB 2YKQA 3PFOA 4C11B 3H40A 2MLXA 1RT1A 4YB1P 4CCHA 2FC9A 3OVAA 5E41A 3W9JA 4DPUA 1NK0A 2LEBA 5KFLA 1X4FA 2BV3A 2V9WA 1D8YA 5F3TA 4I69A 4MKYA 2OI2A 2UXCF 3VVTA 3ELHA 3VZIA 5B0CA 3NWGA 3HLUA 3DOLB 2AJ0A 1U7LA 1YBAA 3DRSA 1SUQA 2LECA 2ZEJA 1BGXT 2XWYA 2HHWA 1FRKA 1BLUA 1T9XA 3KLGA 3TVYA 5HLFA 4B9SA 3CJTA 1N5YB 5BYSA 2NS1B 2CPEA 3HSZA 2YQ3A 4GVBA 3I82A 4FF2A 1T11A 2YX1A 2RVJA 1AUSL 4NCGB 2NXEA 2C2DA 4KFBB 4Y00A 2C2KB 3T1HF 4C4WA 4ZHRA 3GPAA 2YNHA 2G0IA 4QYRA 4ID5A 4DFMA 2XYGB 2VG7A 3Q8YA 3FSYA 4C6AA 1CJVA 3H20A 4C8KA 4RZRA 2ASYA 2HPUA 4CLSA 3VZHA 3MM7B 1BWEA 3JTPA 5HK4A 2MYFA 1QLNA 1FRIA 4F36A 2XM3A 3AODA 4HACA 2PN6A 2H9ZA 4Q43A 5DM7Q 2HMIB 2YQ1A 2RT3A 3LP2A 2O66A 4ELUA 2HVDA 3ADAC 4Z37A 4RBTA 1UVJA 1J5EJ 2XMTA 1MROB 1RAIB 3UQSA 4KQZA 1YSJA 3G2XA 5HQ8A 3KUGA 3C46A 2QJ3A 5K14A 3BN4A 5BXIA 5DS7A 3S1TA 2F5GA 2E66A 4UF4A 5HROB 3MOZA 1Q5VA 2PDAA 5HMYA 1RAOA 2PMHA 4GC6A 2F40A 2MB0B 4QYZJ 3B4DA 3DRPA 2DNGA 4NEYA 2W9AA 3V6HA 2WAQD 1UETA 2M8HA 2QG9B 2DVIA 1PBUA 3MMJA 1UEKA 1XK8A 3WC2A 4R8UA 3RR7A 3H90A 1G1XA 1O8BA 3R5DA 4O0NA 1TL3A 4DHVA 2XMAA 3EUNA 1K0TA 3QLHA 5KFWA 1HW9A 1BHNA 2DNZA 3ENAA 1U8SA 2PO4A 3TZYA 2AGQA 1FVQA 4OX9J 4ZP8A 1JK9B 5KFGA 4I7FB 1RU1A 2ATLA 1SKWA 2IY5B 2HBZB 4LF9J 4NA2A 2V8PA 4OHZA 2CG4A 3C6TB 4KC5A 4OHXA 1SL1A 2DHSA 3OFGA 4LIRA 5K8PA 4LT6A 1AZSA 3M2VB 4F4ZA 4K0KJ 5G4DA 4BWJA 1XIQA 4NXNJ 4LFAF 4CP5A 3CF5Q 1IM4A 1CG2A 3NMAA 1DTQA 1B7YB 1FRLA 1FNXH 2JLFA 4R5PA 4OLPA 4QIGA 5DG8A 4LQ9A 4IRKA 2OPRA 3M8QA 3GJTB 4L3NA 2CNNB 3GSIA 4QYZK 1M1GA 1N34F 3G71S 4MH8A 5AXLA 3BSOA 4OYWA 2VBWA 2XCPA 3JSBA 2B0GA 2CAJA 4O3RA 4LVOP 3I4HX 4LF2A 4J7CA 3W9HA 2VFUA 1WD6A 3SDEB 2V6AA 1S48A 4CYUB 2VASA 4X4SA 2M52A 4NXMJ 3DI6B 1IKWA 5K8MA 5K5MA 5HL7Q 4DLGA 2XHCA 1RHKB 3RW7A 2NXNA 1N52B 1AYEA 3WX4A 4C3KA 4CH7A 2QGFB 2OEKA 4O3NA 2QMUB 2CQ1A 3R5JB 1QTNB 4HH1A 3H5UA 4DL7A 1DURA 1WI8A 1PBAA 1H3DA 1WELA 4O44A 2MQOA 1YJVA 2E9ZA 1FKAF 4EU0A 1QDUB 2JL9A 2ZNYA 4RX6A 4X4QA 1RTZA 4ZN1A 2V8HA 3MUTP 2UVUA 1RYSA 3T1YF 1RT7B 3V4IB 4DV6F 2CVEA 2I5JA 2B6AA 3B6BA 5KFCA 2FJXA 3FCWA 4IKAA 4LUBA 2IJFA 2GQCA 2WK4A 1C2PA 3C14B 3UN5A 3D2WA 3HHLD 3CMQA 1ZZFA 2MQLA 5A6PA 1G3OA 2ZBQA 4F4AA 3SYZA 1PKUA 2R8JA 2D69A 2LQ8A 5HANA 4DSKA 4B3OA 2YKNB 2AJ2A 4P7VA 2CQIA 1KOHA 4LMZA 2DEIA 1E6VA 3DN9A 4DLEA 4KV8A 5I4MA 4X4NA 4UQTA 5CABA 1U2CA 4DQQA 1IXKA 2HNDA 2ZC4A 2N4DA 1WUUA 2VOOA 2RIJA 1EETA 1Z2ZA 2NCKL 2XMUA 3Q8QB 3FZBA 2UU9F 4ZITA 3ILIA 1VQMS 3D0IE 2HVIA 2N7CA 1U48A 4ECWA 4UQGA 5E3AA 4DPOA 2CPHA 1HBOA 3FKBA 2OSRA 2AV5A 2ZH2A 4OLOA 4OL8A 3U7JA 2I6WA 2YKPA 4P7TA 4L73A 3AQPA 2F8MA 2V34A 3MTKA 3G4SS 3UVJB 2ZVSA 2RB7A 1FDBA 2O5DA 4NZ0A 3MR2A 3GWCA 3QATA 4CO1A 5KFDA 1VRTB 3GQCA 4G1QB 3FSIA 4AQYF 4Y2KA 2JOQA 3BZQA 1KNZA 1M5VC 2PFDA 2EFQA 3GFYA 5DQIA 1IKYB 1PYOB 2M4MA 4DV3J 3TAQA 2FJEB 2R7XA 4A8XA 4JYAF 3DOLA 3ZTPA 2MLZA 2M0GB 4HYKA 4X4RA 3CCWA 4CLUA 4WZMA 2GMHA 5D78A 4FBUA 2VQFF 5CA5A 4XPCA 2FY8A 5MAOA 1GMUA 2M3DA 2K7JA 1WI6A 2MZJA 1YKWA 4Q45A 3GB0A 4N5SA 2WRMA 4DV4F 4PG5A 3BH7B 3FBCA 2N4CA 1JKHB 1V5VA 4FXVA 4RUAA 4M5MA 4LBPA 3KHRA 1RWPB 1J27A 4DPXA 1U1PA 4B3TJ 3SQGA 1SIZA 4DR3J 3SZ2A 2VA2A 2EG1A 5A8WB 3U02A 5A2QU 4NCGA 4MT1A 2DPIA 3DCAA 4WK3A 4A8OA 1JJCB 5T7LB 1DARA 5KFYA 4CM2A 4QIVA 2ZZTA 2BJ8A 4DL3A 2W01A 5KG5A 1NJWA 2D9PA 2G1DA 2HMIA 2Y1RI 2XBPA 2JX2A 1KFSA 3QO9A 4NI2B 3BREA 1O51A 3RUBL 4F4XA 4DQSA 1SVDA 3TX8A 1NB7A 3PHEA 1WEZA 1T02A 1WG5A 3EYZA 2E5GA 2ZH3A 4XIUA 2QIFA 4D3GA 3EVMA 1NK9A 5HROA 2LEAA 4KTQA 3KHGA 2BMBA 2QV6A 2IAJA 2DR7A 5A0YA 2C2MB 3D1QA 1H74A 4M5JA 2LP4A 3BDPA 2NPIA 1Q7YT 3R2CJ 1RHRB 3MD3A 1JLBA 2CG8A 2XULA 5HI7A 3MAQA 2KH9A 1HWJA 2VG5A 4C9DA 2ACYA 2KZZA 3PV8A 5E0OA 4ECTA 3FUYA 5L8RC 2IJNA 2R7WA 4PXBA 4OHWA 1C4AA 4HL9A 2GAHC 5FIIA 3QFHA 5CYJA 5DDOC 2DEJA 4FF1A 4OYZA 3DLLQ 3ICLA 2ZBRA 1K0VA 1RA7A 1T03B 3GIMA 1KQFB 3CMES 3FK4A 5KT7A 2CJAA 1Y11A 3SSQA 4H4OB 3TVKA 2HNYB 1NK7A 2FJWA 1FEHA 4TY8B 4ZPWR 2GQQA 2GHWA 1Z1ZA 3PHTA 1XNQF 1RWOB 3RAXA 3NGTA 4RL1A 3C6TA 4ECUA 1KS2A 3I87A 4QZVB 5ETOA 2KU7A 2F8HA 3AA9A 4J9OA 1VQ5S 4A8WA 3JSRA 1SKSA 2K8GA 1R8AA 1M5SA 3N9UC 3M2VA 4IUFA 2MHNA 1TTHB 3ITHA 3ISND 3NNAA 3RYLA 4PWDB 2UV8A 4IOAQ 3Q2TC 1F5AA 2P9EA 4DDFA 2ZBPA 1NDCA 5A2QY 4DJBA 3T5JA 4F02A 4S0MA 4BCAA 3QSYB 4O4GB 1QJHA 3V4MA 2J0QD 1S59A 2FJDB 4F2RA 2JZ5A 3PW7A 1ZPVA 4HHJA 3CULA 5KOWA 2HKEA 1M0SA 1LWEB 4X66F 2DCLA 1HQEB 5J1EA 3MMBB 3SSSA 4Q44A 2Q6BA 1H7XA 2B9EA 3SDEA 4DCPB 2CPXA 4X4OA 4CYUA 3BF4A 5KFSA 4AL7A 2CRLA 4ED8A 2GIRA 1OPIA 4WTOB 3N0VA 1OIAA 3KJVB 4ZMMA 2B9YA 2KHDA 5I42A 1ITPA 4RBUA 4NYPA 4IDKB 4NLTA 2MKJA 2ZITA 4C98A 5D4LA 2PMZD 1N6QA 2QEXS 2VZ9A 1N32J 1RXOB 4DCOB 4DSJA 3CCQS 2PA8D 5IT0A 1PILA 5KFBA 3QNWB 2JJ4D 3W66A 4MFBA 2DTJA 2XMJA 3IBFB 1YJWS 3CC2S 4I64A 1RT7A 3V4IA 4LF6F 4JV2A 3CCMS 4DX5A 4OQJA 1IKXA 3JXOA 3PO4A 3A8JA 4HTJA 5KFKA 4CO0A 3D54A 4WZQA 4TY9A 1HPZB 5L1JA 3JSMB 1TUWA 4PWWA 1AFIA 1WC1A 4KO0B 3JB9k 5LSOA 1TZ0A 1GXUA 1IQZA 1JQGA 2YKNA 3KLFA 1IQTA 1TL1B 1I1GA 4CO5A 2UXCJ 1VC6A 5ETPA 3PNIA 2R4FA 2DRAA 4P2XA 3T1AA 4F3MA 2ZZMA 4HH0A 1RCOB 1BQNB 3WIVA 3CJKA 2V8DA 4ZIVA 4C2MA 4LRDA 2YX7A 1U09A 1AFJA 3HD2A 1AXQA 1S4FA 2AW0A 3A8IA 1GFWB 3GSDA 4DL6A 4ZPAA 2QC3A 4N8OA 2FZCB 1ZOTA 2E7WA 4CH1A 3T5KA 2BVZA 3PW0A 1CQNA 2KT5A 4HDHA 2L9WA 3QT7A 4CIOA 3LP0A 1SJ4P 3QIPA 2MKKA 2V8VA 1Q0NA 3J7AN 5IT9U 4OI4A 3T1HJ 3AOBA 3DU6A 4V19J 1SJ1A 4N56A 5SZTA 4LVNP 1DZ5A 4ZLLA 3LUYA 2ASDA 3N01A 3HSDA 2WVFA 1B3TA 4C7QA 4J9NA 2MKCA 5BJRA 3Q23A 1VRTA 2Y8WA 1GTEA 2E5LF 1VC5A 1VI7A 4G1QA 4ES2A 2AYMA 1CULB 2FJVA 4CT8A 1DAXA 1O5JA 5CCLA 3CDAA 4JI1J 1IKYA 3FJ2A 4PR6A 3IS9B 1RT6A 3HO1A 2CJXB 2G13A 3DRXA 4TQRA 1X4DA 2V63A 4E0DA 5SUHA 4OX7A 4EEYA 2HHVA 4FP9A 3EJMA 3VVUA 4ENOA 3N79A 2JRSA 4Q5VA 1OS5A 1FESA 1OYEA 1RWUA 2LXIA 3QRRA 1YLXA 4DR7F 1DQ9A 4AL5A 4C0OC 2FY1A 5DG7A 3OJSA 3GCWP 1DY3A 2F9JA 1KSPA 4A48A 3MPVA 1F2HA 5A8WA 2KXHA 2OKQA 3THPA 4DS5A 2DR9A 4ZPTR 1U1NA 1VBZA 2HHXA 2E7VA 5T7LA 2W2QP 4J9VA 5GMDA 1RHMB 2EFNA 3QT6A 4Y3CA 2KYZA 1RTHB 2V8GA 3EVOA 3TAPA 1CJUB 4FYXB 2OPPB 3GU0A 3QQCD 4NRTA 3UDEA 3LGNA 4L74A 3BJYA 3V6JA 3C3LA 2R42A 4ZLNA 3GYGA 4A8SA 1M5KC 1C1BA 4TU7A 3HVAA 1UP1A 1DHMA 2DHGA 2V50A 1Y9OA 5E3PA 3QJPA 2DISA 3MDFA 1F2GA 2OFHX 5E7OB 2XZDB 2CPIA 2Z4PA 2KG0A 3AD7C 2VIHA 1EQMA 3NCQA 1MWYA 2HHQA 4J9KA 2HVZA 1F0XA 4B3SJ 3MUMP 4N47A 4TLRA 4I2QB 2QFJA 2SXLA 1U1MA 1RQ0A 1DQ8A 1NSQA 2Z58B 1L3KA 3M8ZA 1MWQA 1RTJB 1YK9A 2EWHA 3TEHB 2CZ4A 5D0GA 3TUJC 3AOCA 1WF1A 4FYYB 3M8SA 1JMTA 5H1SV 3ETOA 5GADU 5IT9Y 1P6TA 3PW4A 2DIVA 2A6OA 1V5IB 4BHQA 3JS9A 2LA6A 5DQGA 2BW7A 3M8RA 1VBXA 1N34J 2MQ8A 3F56A 3NNCA 3HT0A 1NH8A 1OYDA 2H5EA 5HMWA 3M8PB 2NXJA 4YDDB 3R2DJ 2Q3PA 2DXEA 5CXTA 4Z2XA 1T03A 5EGYA 1FRMA 4PRFA 2Y0SD 1V6HA 1R31A 3UD3P 3LP1B 4H4OA 1JJHA 3OTBA 1CJTB 2ILYA 3CVKA 4X4UA 2HNYA 4KIAA 5L39A 2IVYA 2CQ3A 4OYOA 1NZAA 4G65A 1U47A 1RWNB 1U0HA 1T95A 4G6VB 1HR0F 3ILOA 2QN6B 1FJ7A 2GAGC 4QBUA 3TA2A 4URGA 2E29A 2W1BA 4NASA 1ZAXA 5D0EA 4C8NA 1XMOJ 4WE1B 1HI8A 3G6YA 2OLWA 3HVRA 4LF1A 1A9NB 1TL7B 2H1YA 2BE7D 5U47A 1F3FA 4DV6J 5AXKA 4OI1A 2R8HA 4F3OA 3H2VE 3MR3A 2VFSA 1O0PA 2IVMA 2FLNA 4AUKA 1QAJA 4ED6A 2QX0A 1ZAVA 1RI7A 3IRXA 2AGOA 4YQWA 5KFUA 2IMOA 1LWEA 5DLFA 1HQEA 1V9OA 3D6TB 3MPDA 1T3OA 2R8KA 3K5NA 3MMBA 1WORA 3DHWC 4QWBA 3MCMA 2W7PA 4CTAB 2GFFA 5H9FJ 4NLQA 3O44A 1R89A 1X4AA 2N3LA 1G4CA 2C2RA 3HFKA 1HNVB 2B5JB 4DR5J 2F7VA 4NMLA 4IDKA 3CCZA 1T0TV 2VKRA 2BX6A 1REVB 5DDQC 1HBUA 1QD1A 1TKTB 4DN0A 1N5TA 2EFOA 3CD0A 3BBFA 2FTRA 2VC1A 4NZ6A 2P9GA 3KUHA 4OJGA 3H5YA 2W9CA 3FVYA 2RUGA 1P27B 4IOCQ 1M5OC 2WZ1A 3W1YC 5HMXA 4TQSA 4H4KC 3D5MA 3CC7S 3PIPQ 5JVHQ 3KDNA 3U1MA 2C2ZB 4HT7A 1KKHA 3BGUA 2E1AA 2CQ4A 1FDNA 5D4OA 2EFGA 1HPZA 1UEUA 3SCKE 2KXNB 1JWWA 5DGAA 2CJ9A 4NLXA 4KO0A 2EBEA 2J5AA 1RCXB 4QR1A 1S1WB 1U1KA 3DLGA 1TL1A 1KFDA 4AQYJ 2W9BB 2K2PA 1N54B 4Q8EA 5KT6A 1S6PA 2IVFB 5F8HA 2XNRA 4CLPA 4JYAJ 4EYHB 3BYRA 4P6QA 3AJ2A 2QA2A 4L75A 2Y8YA 1X4CA 4YB7A 4H4MB 3ZFVA 4YP3A 5L46A 2CPYA 3ET6B 4ED5A 2ALYB 2DXFA 3UDVA 5H9FK 4YHHF 3JAMY 1XMBA 4DV4J 2AJ4A 2CQ2A 2MEWA 4URQU 3GJQB 4TKTA 3TVZA 2DHHA 2IA6A 1KOOA 2AMCB 4F0KA 3A8EA 5DG9A 1NK5A 1NHVA 1RAHB 2G2ZA 3R6GB 3QRQA 4U9RA 4K50A 2RAQA 2BANB 3K59A 2Y9HA 2PMWA 4ETZA 1S6UA 4OZ3A 3D66A 2LQ5A 1RABB 3N28A 1XEZA 1QSLA 3SI8A 2UUTA 1XBWA 1K1QA 1Y5LB 4KHRA 1JJ2R 2I2YA 2Y0BB 2AWZA 2MGZB 4FNIA 4PG7A 3TOQA 1KLMB 2KXFA 3US5A 3ULHA 3PX6A 4N77A 2CXEA 1UMJA 3I0SB 2AZ1A 4EUVA 3G82B 1VCTA 2NSBA 1EB0A 1PC5A 5HQLA 2WW8A 3D6FB 2LKZA 4Y2IA 3TJAA 4ZCMA 4J37A 4DS4A 4DUZF 3RG6A 1YTYA 5KFOA 4OI3A 2DH7A 4C3MA 2HK2A 5KFHA 2EEYA 1EQ0A 5KFZA 4P2MA 3H25A 3LAMA 1VGYA 1TK5A 5F8LA 4ALZA 4NE9C 2P2CB 1NK4A 1KC8T 3PYFA 1SC4B 2M5YA 1HYSB 5KFIA 2GMLA 4NYOA 2X51A 2RDDA 3F44A 2RQCA 4OZLA 1GQEA 3DOMA 1RSCA 3PJWA 1U1LA 2OPPA 1UFWA 3MEDA 5E3RA 2NXCA 1LV5A 3IAS9 4WYWA 3FRZA 4KKOB 5D15A 3DLEB 3C15B 3P5TL 3POTA 1U25A 5C25A 2VL1A 1FJEB 2D74B 1SL0A 1EAYC 5KFNA 1EARA 4UOCA 1XNQJ 1TAUA 3M2RB 3JTOA 3UN2A 1UVIA 1PJ7A 4WFZA 3RRKA 3CW2C 2YTCA 3BQ0A 4ZCKA 3WIUA 4RR5A 3BR9A 1UW4A 1NSKL 3QIDA 3ZTSA 2BE9B 1GXTA 2DGWA 2VJVA 4YMEA 4ES1A 3Q8RB 2MQMA 3G6ES 2CADA 1X5TA 1JXLA 4LRBA 1V3SA 4P72A 2D3ZA 4ZS6A 1RDRA 4F0MA 2MZRA 3DGPB 3SCLE 4AE5A 4IFVA 1TKXA 3UCUP 4KJIA 3KJFB 1R0AA 4KGZB 2M7SA 3M8PA 1URRA 3W9IA 2IJRA 1W2BR 3H2UB 3HULA 4DWIA 3Q8UA 3DYAB 2F3JA 2LQ9A 1UVLA 4DBQA 2D9OA 4TN2A 4ANCA 2E7XA 2BJEA 5EWEA 5IM0A 3CMAS 3CWJA 4LSZB 3T41A 1DTTB 4ZVOB 5CZXA 2V4RA 2YWWA 2HG4A 1VRQC 2W4PA 4LRFA 2J9DE 1JLGB 3H4BA 2RU3A 4UOHA 2Y1LB 4OJHA 2RSQA 2E5IA 1SJRA 4LF9F 2A2CA 5CZVA 2BKNA 5HP1A 2DR5A 1S1UA 3VAGA 4I67A 3W60A 4WE1A 2KRRA 1TL7A 4CO3A 5K8OA 4MIWA 2KHCA 1X9MA 2VC0A 4K0KF 1NB2A 4LF6J 4LF8F 2FJBB 3MHYA 3A3PB 1LFPA 3C6UB 4OI2A 1Y3JA 4P10A 5KT5A 3R7BB 1WC5A 4ZVHA 4B17A 1H2TZ 1WHWA 2L48A 1MW7A 5C42B 3M32B 3TARA 2WBRA 5CYMB 3VGUA 4OJ1A 4OI0A 5KT4A 4M5LA 2R2SA 3UPFA 3OR1B 1BQMB 4O3QA 4CTAA 1UZHA 1FA0A 3PX0A 1XN9A 2WVCA 5A8RB 4OZJA 1HNVA 1FRHA 4NXMF 1BWVA 3OSPA 3UD4P 2AD9A 5EN1A 2C28A 5DZ6A 1REVA 1D9AA 1TKTA 4KY3A 1WEYA 2X1FA 4PEOA 1MMLA 2DGOA 1NDLA 4JI6F 1S9EB 2GVZB 2AU0A 2RS2A 2B9WA 3NOGA 4K5SA 1IVZA 1CSJA 2DNPA 3OR2B 2DBBA 3Q89A 3K5PA 3IGVA 3JQMA 3TZXA 2H4YB 2UP1A 3TA1A 3W5ZA 5CD4A 1Y0HA 2R7SA 1HNWF 2XSJB 4F0HA 1I3OB 1YJ7A 2BYCA 2DRBA 2YH1A 3Q2SC 4RUBA 4WXWA 4Q0BB 3N5BA 4OHYA 1SQGA 1S1WA 3RJMB 1KRPA 3MM6B 4PUOA 1YRUA 3WZ0A 3OL8A 3GIIA 5JUMA 1F3VA 1CS4B 4F8RA 5LJ5Y 1U49A 5E2QA 2LXFA 4WFNQ 3QJLA 1FO1A 4UY85 2AGPA 1HBNB 2PEHA 3OV7A 4F3QA 2F4VF 3R5CA 5AXMA 1R0CB 3O6QA 2DD8S 2HHSA 2GQ2A 4PYAA 2HLTA 5LSRA 3J7A1 2J0WA 4P73A 4OYIA 1FE4A 1WF0A 3ET6A 2QA4G 4K59A 4DN9A 1N5SA 4KT0C 3D3BJ 3F41A 4LBIA 4DR7J 4B3MJ 2HFSA 1S77D 6AT1B 4F50A 5GAGU 3G8TA 5HVHA 1SKRA 2XWXA 3CCRS 3QBCA 2QL5B 3NGSA 4JP8A 1WOPA 2OELA 3KOAA 1NK6A 1VJQA 1YBTA 4Y65A 1FK9B 2DNKA 3G6XA 4JV1A 4LF4J 2MKSA 3NG8A 4DEZA 3QZ7A 4E8UA 5KFFA 1R27B 3AJDA 1U45A 4USJC 1WHVA 3LPYA 3MPYA 3TNVA 3ZTQA 3CNQP 1SI9A 2AYEA 2YNGB 4QWDA 5F41A 4DV3F 1WDDA 3KK3B 1KLMA 3BH6B 2EI5A 2CWKA 1LKZA 1NDKA 3I0SA 1SC1B 1NNDA 4DV0F 1REGX 1RWVB 5B08A 3G82A 2R7VA 2DT9A 1KVKA 1N5VA 4KH1B 1S97A 3IXQA 1RLCL 4HEA9 5GAEI 2GHPA 4W98A 3CT9A 1P8GA 3QMQA 4ANDA 1IWGA 1YJUA 2HQGA 2HNZB 3CIMA 1S72S 1XMQF 3N6LA 3V2UC 1S1XB 4L76A 3GP9A 1EZZB 4DR3F 4K4SA 1WEXA 1HYSA 3OQ2A 3ZTOA 2FZGB 4G1PA 4JV5F 3BSNA 2JC1A 3KWMA 4F26A 5ETRA 3EGWB 1NJZA 4PXCA 3DLJA 3J81j 3V5RA 3NBPA 2PEBA 3I6PA 4K4WA 1WOSA 2BJ9A 4I1TA 4DR4F 2RQ4A 2MY8A 3DLEA 1VQOS 3HDSA 4NLYA 3HM9A 3HHLB 3VGVA 2XYHB 1MG7A 1IN0A 5KT3A 2J7UA 2KJWA 4AXIA 5IV4A 1VMBA 1Q5YA 4DX6A 4O3PA 1WDTA 2EPIA 3M2RA 3GYXB 2QLJB 4HHUA 2RQKA 1SL2A 3EGZA 2CFXA 3SFUA 1HR0J 2VG6B 3EVWA 3NP5A 4DQPA 1JLQB 3TZWA 1UFLA 1UKUA 2ZUGA 1PIEA 1MN9A 3DOKB 3PDNA 1RADB 4EMDA 2BRLA 4LR9A 2DR6A 3OVSA 1KEKA 2CPZA 5KFAA 5I3QA 1PSDA 2VD3A 4QOTA 1NAQA 2DYAA 5C2CA 4JI7F 4BBYA 3D3CJ 4LSLB 4WBFA 5DETA 2F4FA 3DGPA 1NJIT 1FXLA 2MY7A 3ENQA 1N56A 5LL6d 3UNYA 1JIHA 2Q79A 1UL3A 3T5LA 4JI2J 4MIBA 3W3SA 2CZVC 5DRKA 2VB6A 3K7RA 3DYAA 4UT4A 3ZTRA 2IM1A 3AAWB 2XEXA 2R2UA 1T9UA 5L1IA 3UD5A 3SQOP 2ATCB 4M5IA 1DTTA 2YPYA 2G0CA 2B8PA 3MM8A 4UOFA 4ZOSA 1JLGA 4CQ1A 1Q16B 2NZ4A 5KG2A 2O1PA 2YH0A 4USKA 1NJYA 5F0WA 1SCJB 1AW0A 3JTNA 3DDNA 1RWXB 2PIIA 1HLWA 1S6QB 2CPJA 4WP3A 4B02A 2LCWA 1ULRA 4ED3A 2ZH1A 5FJ4A 3OL6A 5EHHA 2FIUA 4K7QA 1LWXA 3NGUA 1GXLA 2N7YA 2QO3A 1Q8BA 1SH3A 2XMWA 3I4PA 3LA0A 4QU7A 3C6UA 1RTIB 1HWKA 3PW5A 1WNEA 1VRUA 2QLXA 5HBMB 5C42A 2CPFA 3GJRB 2JDJA 1HKAA 4M1KA 5KFVA 2PSZA 1HI0P 3OR1A 1D9DA 2AEJA 2FGOA 1BQMA 3QSIA 4ZDNA 3QT8A 4RW9A 3W8GA 2FZKB 3MEKA 3LPEA 1Q79A 5K20B 1HIYA 2HSEB 1WG1A 3PRVA 3MECB 1TP7A 3DXSX 1IJEB 3ILJA 3GIKA 2FC8A 1UJ6A 2VHGA 3FBBA 3R5GA 2OEJA 1NSPA 4C97A 2CPDA 2DIUA 2IRUA 3M7VA 3QAEA 1IJFB 1LK5A 1N88A 1SV5B 4YHHJ 4WPAA 3RBEA 2GVZA 1YRXA 1XNRJ 2AQ4A 2Q1LA 3OR2A 3MM5B 4DU7A 3DKDA 1HQUB 1RBOB 1VFJA 4DPYA 3OTDA 3P3DA 4WIIA 5A8KB 5HSPA 1UPPA 4X64F 2XSJA 2JEJA 2XMKA 4QR2A 2IYIA 2F9DA 3I31A 1C0TB 3I55S 2V2KA 1FFSB 2GX8A 3H5XA 1SPBP 4Q0BA 2VV5A 5JXSA 4L3KA 2H48B 2HQDA 3BGRB 1RZMA 1Q8KA 1S1VB 1MLAA 2QZ8A 3KK1B 1JXEA 2B4VA 1LWCA 3IAM9 2I0XA 3H4DA 4IYQA 2OPSB 2NXUA 1NXIA 5LM7E 2HHPA 1H2UX 3A3NB 2VPZB 4RNFA 3D6MB 3L95X 4CM0A 3EXYA 1S76D 2E44A 2OIHA 2MZQA 4JI8F 3HVWA 3FEZA 5B0FA 1BC6A 4UZBA 2HVHA 4UW2A 2QYGA 4CNZA 2BJ7A 1VR6A 3EPGA 4NZ7A 1RTDA 3QZ8A 2KVIA 3N4WA 4DR2J 1MMDA 2JSXA 3FGVA 1UA0A 2IM2A 2G0JA 1HW8A 3MAHA 1NRKA 3I0RB 2QFIA 1BY9A 1FTCA 4DUZJ 4ZPVR 3M6VA 4DUTA 1SH2A 3VTIA 3BBBA 3QGGA 3S6EA 1VOMA 1WJ9A 4O0IA 2J0XA 1FWPA 3G6VA 3Q22A 3JSYA 3CUNA 2FB0A 4DCJB 3IWNC 1FK9A 5GAHI 4UZCA 3N5FA 5LOQA 4AT1B 4WXOA 4C48A 4Q2LA 3M2UA 4YS2A 2KN4A 2LDYA 2HZCA 3NWRA 2GMJA 2KM8C 1U1RA 2ZD1B 3OLBA 4AFFA 2Q66A 3RTVA 2K1RA 2FVQA 2WB1D 3EPIA 2DHXA 2IC3B 2GC8A 4JI1F 4DG1A 2YNGA 3ZZYA 4BC7A 4ZLPA 4IFYB 4WP8A 3R9LA 2VDIA 3GG1A 1R6YA 1UJ5A 2CQCA 2BXJA 4OZ2A 5HO4A 1SIWB 4MYTA 4FF4A 4A4JA 3DLKB 3AA8A 4LFBF 2MZTA 4WFBQ 1Z4UA 3OLAA 2VPXB 3R97A 3NS7B 1ZBTA 3D7SB 4OZ1A 1OWXA 1T9YA 2IMWP 3VGTA 5A76A 3HHDA 1QAIA 3MEGA 1S1XA 4N41A 4USIA 2WTFA 1P1TA 2DGVA 5KT2A 3UR0A 2HQ3A 4I2PB 1HMVB 2E1CA 2HRTA 3RBXA 1WKJA 3NGRA 3J7Z5 4RJVA 2XB2D 4R25A 2GZOA 4TLQA 1GH8A 2G2YA 1FRXA 2RMLA 1UAWA 4XAKA 4MK7A 2C3PA 1JLEB 5BR8F 1I94F 5DO2A 5IC4B 3FMBA 3HK2A 4KH0B 1B0VA 3BO2A 1ZM9A 3R8YA 2HHHJ 2RJZA 2EXUA 3HHLA 2HLUA 2LU1A 2RRNA 4QWAA 1UEVA 3KLEB 3ZZRA 4EO6A 2NREA 2ZH4A 4RLEA 1XERA 2VG6A 2R7RA 1EIYB 1A6LA 3CJQA 2YY3A 3MCSA 1VQYA 5LMUF 1MU2B 1RBAA 2V9KA 1RB0A 2DO4A 4B3SF 4YEAA 2DGTA 1S6OA 3WQPA 3BGFA 4IG0B 3O3LA 2HRYA 1VBYA 4Q8FA 1NBEB 3SBMA 4USUA 3VWSA 4LF8J 2BQRA 1IBMF 1RAGB 4ED0A 1VQSA 4OYMA 2R2TA 2JEIA 4LSLA 1S79A 3FCHA 1VQ7S 3KJNB 4WKYA 1Y00A 1XWLA 4LRAA 3CCLS 2R8GA 5KG7A 1VJWA 2NYHA 3BN7A 1KD1T 3A4TA 2WONB 1LK7A 2RS8A 1TK8A 1QM9A 5AXNA 1QVGR 3TQEA 3EGVA 3L7OA 3D28A 5D0HA 1RWKB 4AYBD 3OHAA 1JLCB 3IGNA 1Q4RA 1ZM4A 5M2UA 4QWCA 4OV6A 1SXLA 2JEFA 1C0UA 3SXLA 1WKLA 4CNYA 3W61A 3MEEA 2QL9B 4UTGA 2BJ3A 2L9NA 4A46A 2HIYA 5I3PA 3FSXA 3TO8A 4UOGA 3AD8C 4WU2A 4NLRA 2ERRA 3FC9A 3CC4S 1FFWB 1RWWB 3K5OA 4O3SA 4JI6J 1RT4B 2J8SA 4EGLA 1S6QA 3V81B 4LSNB 2NQPA 1NH7A 2N3OA 3KMQA 3OXGA 1XMOF 1PG5B 4C0BA 1BD6A 1X9SA 4Z7CA 1HNWJ 2E1PA 1RTIA 4DPWA 3B8HA 2CIMA 1S5ZA 2OPQB 4USHA 3ZZOA 2B56A 2JFKA 3JQKA 2B7CB 4I0WA 4JBCA 1TU0B 1Q8LA 3M30A 5HBMA 3UDLA 1HL6A 2ZHOA 3LALA 1L3VA 3KLIB 2YNFA 2BA9A 1H2VZ 2RF2B 4PG4A 3N6MA 4EZ6A 3CGIA 7FDRA 4FNHA 3WX8A 2OD4A 2IRYA 1RAAB 2HFVA 1KHVA 4AL6A 2UV8G 3J7ZT 2F4VJ 3MECA 2D7SA 3J7YU 4QU6A 3EICA 5F9NA 4WK1A 2I1RA 3VHQA 3DMJB 2QTWA 5T14A 3TANA 2GNKA 1IBCB 4OZ0A 1WHXA 4DR5F 3QGHA 4M63A 1MN7A 1DLOB 1WTBA 3UDCA 1SV5A 2UUBJ 2W2PP 1RT1B 4KGMA 3ZZUA 5B7WA 1Q86T 3R6LB 2C2OB 9RUBA 4U96A 4CI0B 1HQUA 2P6SA 1RAJA 1VK8A 1LW0B 4C3LA 2EG2A 2KG1A 1FWLA 4ECSA 4NWBA 4NOHA 5AE3A 1L3UA 1VQNS 2QMWA 2DY9A 1C0TA 3H7HB 3OXFA 3LTOA 2ZJQQ 1HNIA 2BKOA 5KAKA 1X31C 1X60A 5B0BA 3PVXA 2YKAA 4CLYA 5KG6A 2PI4A 3SMZA 1S1VA 3AJ1A 5AJ3F 4BC9A 4C11A 4NCBA 2HGNA 4NX9A 4A8MP 2XY7A 4J9LA 3CTRA 3QGPA 1ZM3A 1B99A 5HLFB 3EGNA 5HQMA 3CCJS 1S12A 3P5BP 1RU2A 1ZS6A 2CDRB 5C2GA 3FDSA 4KGXB 1X0PA 2VQEF 3GIJA 3OTOF 2B4OA 2YNHB 2HS3A 4CLWA 3K57A 3H8YA 4DV0J 5LT5A 2J7WA 3KYLA 5E3QA 4DFJA 1GX5A 4M94A 3HHKA 3I0RA 1X0FA 1D9FA 1N5YA 3E51A 4HACB 5HJXA 1IR0A 1EX8A 1YQHA 5JJBA 1XMQJ 1FT8A 3QRPA 4RUCA 3UCZP 2IM0A 2CJBA 3BQ2A 2U2FA 4KFBA 4NCAA 3G8QA 4JV5J 4DL5A 4K4TA 1FWKA 5K9FA 1M1KT 1S7HA 2HYIB 2H5IB 2J76E 2KYXA 1GEHA 5K14B 3MM7A 3T6JA 3L7UA 1KQKA 4DR4J 2PFFB 2DCUB 4J9PA 2ZJPQ 2ZD1A 3GFHA 2IC3A 1OJ4A 4RW4B 4IFYA 1ACMB 5B09A 1F60B 1OPZA 4L6V3 3IR7B 1O6XA 2NPFA 1MROA 1HFEL 1R8BA 2A18A 4XDCA 3MOJB 1N0VC 2DH8A 2M70A 1RWMB 1YX2A 1FKPB 4FYWB 3PIOQ 2BQ3A 1TL3B 3RU0A 1KONA 3QLHB 5B0DA 3NGDA 2D3UA 5KFJA 2R3VA 4QPXA 2ZHAA 4ID8A 2AEMA 1WG4A 2W7OA 4O23A 4ANEA 4JI7J 2HIQA 4DV1F 4MK8A 3D9BA 1S10A 4I2PA 1HMVA 3QJJA 4LBHA 3RB4A 1B0TA 3CCVS 3D4JA 2B3TB 1M90T 3H0PA 4FXWA 2VF3A 1JLEA 4KSEB 4DV7F 2V2QA 2FYXA 4PCQA 5KG3A 1U6ZA 4ED7A 1N8RT 4D3HA 3PR4A 2R9LA 2FHKA 2P6TA 4FDFA 4P75A 1U1OA 4I7FA 4U7UK 1X4BA 3J81U 3LF0A 3X3UA 2WW4A 1DTQB 1QAXA 5ETVA 2ZBCA 4TXSA 1UVMA 3O5TB 2EK1A 3M8QB 2FHJD 1MU2A 3CCUS 2ZZNA 2XS7A 2APOA 2H51B 3KHHA 2F65A 2P5VA 5F3ZA 3CJ4A 4IG0A 2BKPA 1ZETA 1TQLA 1N5QA 4IG3B 1YJNS 2RDJA 3KG1A 5F8IA 1R8PA 2ZH5A 2DNYA 1Q1KA 5EX0A 4ZVQB 4PPZA 2MMYA 4F2SA 2H4WB 4BDPA 2MPUA 4A47A 1QAYA 2QRRA 2WONA 3E3XA 1W2IA 2GO9A 3W8PA 1FCAA 1S7IA 4HT5A 2DNHA 3X1LB 3PYGA 2LQJA 4AD6A 3FNNA 3CD6S 3HJVA 1JLCA 1ICEB 2H5JB 3LOUA 4A8FA 2MKHA 5ITHA 3MCNA 1PAUB 2BW2A 3D1HA 3DI6A 3UNGC 1A7GE 3GFXA 2DXDA 2YWKA 1Z2LA 2I5JB 5A6WA 2KTQA 1SC3B 2YKMB 2B6AB 1A0OB 4LFCF 4GKKF 2V67A 3IWLA 2BR0A 3QAUA 2J0SD 2Z2YB 2PT0A 1ZAWA 3V81A 2ROGA 1ZA1B 1FJCA 2WHOA 4C8MA 4Y2CA 2A0FB 2DR8A 3MZIA 2P8IA 1CPZA 4CO2A 8ATCB 3TZZA 1PCAA 2HW3A 2CVIA 3UN3A 1QSSA 5IXUA 1E6VB 2MDAA 4X64J 3NS5A 4ZVTB 2UUCF 1CC7A 1FX4A 4FXDA 2C42A 3ZNUA 4KHPF 1WWHA 4ZN3A 3KLIA 2HNDB 1WTFA 2ZH6A 5J2QB 3C14A 5L1LA 2RF2A 1OO0B 4RKUC 1PGZA 2B8QA 3CCES 2W4DA 3BGLA 3MMAB 4KBIA 4RWXA 4EZ9A 1EETB 3DNCA 1V3ZA 3I5BA 4NA3A 1TV6B 4WFYA 2MZ1A 3TEGA 2GJ2A 1GMVA 4B08A 3D67A 1H6KX 3CEDA 3DMJA 4JI8J 1RISA 2RRBA 2QYCA 1AROP 2ZUAA 2E9RX 1RT2B 1T7PA 2RH3A 1M5HA 1KWMA 2HGMA 4FS2A 2M2BA 3Q0AA 3HJFA 3HCXA 1X5PA 1XC9A 1OSCA 3OHBA 2LA4A 1NHUA 4FKYA 2IM3A 2W25A 3MMCB 1UTAA 2GO8A 3AXMA 1LW0A 4ZJLA 2WOMB 2ROPA 1KLNA 3S7RA 2Y3YA 4M95A 3AOAA 4OYBA 1Y4ZB 1KQSR 4UUWA 4C8OA 3HF5A 3FEXB 1WC6A 3E8OA 1JJ4A 3MF5A 3UVJA 4OIXA 4J91A 4FVCA 2VFVA 3ZZPA 3G86A 3M8YA 3BPSP 1VQPS 4ECRA 3OT9A 1TKZB 2XGPA 1VBKA 1T94A 4HLBA 4V1Ak 1H72C 4DOZA 2FLPA 2M9KA 3ZC4A 3SQGB 3PX4A 4DR1J 4U6PA 4X84A 3PYDA 4XO0A 3IP0A 1G6BA 4USTA 4LFBJ 4LIWA 1Q81T 1VS3A 2NLWA 3EZOA 2I8EA 2AIRB 4TVAB 4ETXA 2Q43A 1WC4A 3FCVA 2XLJA 4JI3J 2DB1A 3MTJA 3OUYB 4B3MF 1UCNA 3BQ1A 1KTQA 1ZA2B 2KKHA 3BEGB 1JKHA 5LXRA 2VONA 4P74A 3QO9B 1IR1A 3FMWA 3DGVA 4RWWA 1FNOA 4MTPA 3NY0A 2QSFA 3L09A 1FRJA 2KB2A 4EBCA 2KDOA 2ZM6F 3V6DB 3TYTA 2JVOA 4K4VA 2XGQA 2F8EX 5C5JA 2JVRA 3TUIC 3EDQB 1TL5A 2XO6A 4M5HA 1U6BA 3I9V9 4K4UA 4LF4F 4FF3A 1K8AT 5BR8J 1I94J 2IAJB 4ILLA 2V2VA 5A0YB 1ZH5A 1GMWD 5CH7B 1X9WA 2ACMA 3BO3A 4ECZA 4RW4A 4NI2A 4YN3B 1IM6A 2W4CA 3HHEA 4HI1A 2J8AA 1LQ9A 1FKOB 1BE4A 3UFCX 3AD9C 3U1NA 1JLBB 5L1KA 4F7VA 2IBKA 2QLWA 4U67Q 4DU8A 2C1EB 2VG5B 5LMUJ 1FKPA 1EKSA 1OMSA 2X7IA 4UUXA 1F1BB 4FVMA 4ZJQA 2ASJA 1B70B 3RAQA 2FJAB 2XS5A 7AT1B 1TUVA 3I32A 1KR4A 3T6BA 3P49B 2RE1A 3LWLA 1VYAA 4F4KA 3SEOA 4U95A 3QFWA 1VC0A 3FZ2A 4I4BA 1IBMJ 2EK6A 1JNRB 3TUZC 2AYGA 3CDBA 3DC2A 5D6GA 4WYLA 4EI2A 2JC0A 5D4PA 3R27A 5CHCB 3NXZA 3WC0A 4WWSA 1N33F 3GIRA 3PJXA 1MMNA 1URNA 2WVBA 4CZCA 4NA1A 4DV5F 4ED1A 3GG0A 2FQQB 2IFXA 1VQ4S 4W92B 3ITHB 8RUCA 2ZE2B 4WIQA 1NU4A 2VA3A 5HJYA 4HVZA 1YVFA 1I51B 4TY8A 4CLLA 2HK3A 2FVSA 2IYGA 1OY6A 2BEFA 1QUPA 5F8JA 1QTMA 1GTHA 1KQGB 2MLYA 1YZ6A 2BJ1A 3GV8B 3VQTA 2R7TA 2ASLA 4ZA1A 3UO0A 1RA6A 5J1EB 1G2EA 4PWDA 4F67A 4IG3A 2MQQA 2GVDB 4YR2A 2X1GA 4M5KA 3PJ9A 1EHWA 3H5SA 4OZNA 2YNIB 4ZVPB 4DQRA 4KRWA 3F73A 3HMJG 5I42B 1J2VA 2CWXA 4DFPA 2RQMA 4O4GA 4ICLB 2BRKA 2GIFA 5IZHA 5BYRA 1UVNA 2HFUA 1N6QB 4YR0A 4JI2F 2E5HA 2QLFB 1CEZA 4YFUA 4LF5F 4ATNA 4MFBB 2DGXA 1XTZA 3KJVA 3D1OA 4X62F 5HVFA 4FZVA 4DSIA 1IKXB 2YKMA 3RZAA 1LWFB 1WACA 1NJXA 2WB4A 5KFQA 4TU8A 2GIQA 3ENVA 3FFIB 3KHLA 4RW8B 2HQIA 1D3WA 3UW1A 3TW0A 3M1VB 3CD5A 4QR0A 4PPDA 1BUXA 3KLFB 3BYPA 2OJ3A 4DF4A 1S9FA 2VJUA 5FDLB 2RKIB 1CVJA 4OI6A 1VQ9S 1ROFA 4JI4J 3CO9A 3M6XA 4MKAA 3CJKB 1NPRA 3FBEA 5J2QA 4B9VA 2BOPA 3GZ7A 1RGVA 3JSMA 5AJ3J 4IH7A 2HFZA 2CJQA 5DLGA 5THWA 5GVQA 3J7YI 3MMAA 1HNZF 3SCIE 1TV6A 2PD1A 4HKQA 1TK0A 3IG1B 2LMIA 4XK8C 3G9CA 1GK8A 4E98A 3MM9B 3LP0B 1EJ7L 3QIPB 3VAHA 3IR6B 5LMNJ 2Z2LA 2VQEJ 2HWIA 2HBYB 1BQNA 2XSFA 5E3CA 2IRXA 3OTOJ 1RT2A 3MGJA 1RLDA 4CLZA 4KHMA 4Y0FA 1QSYA 2DPJA 3VAMA 2PI5A 5J1PA 3G96A 4P2FA 3F0NA 4RNNA 5M2RA 1Y5NB 4X65F 3C16B 1YJ9S 3MMCA 2FD2A 1XNRF 3NCPA 1IR2A 2WOMA 2FLOA 2OTJS 1RT6B 2MKIA 3M6UA 5KFTA 1QE1B 1HARA 3IBWA 3SFGA 1JLAB 4RO0A 4DL2A 3MPUB 5KFXA 1SC6A 5HN0A 1RK8A 2CUYA 6FD1A 4DXLA 2DJWA 5IOLA 5JVGQ 1FE0A 1CULA 1TKZA 2MSTA 4K8RA 3TWZA 5KG0A 2AYBA 4U8VA 4C8ZA 2CKWA 4NLWA 1H0HB 4JI0J 2AJFE 4RU9A 3I5AA 2MZSA 2XLIA 4PXEA 3IS9A 4HTIA 1DJ0A 1AB8A 2AF6A 2Z57B 4BS2A 2F1FA 1LOUA 2FDNA 2O01C 1VDHA 1RJJA 5CAAA 2CJYB 4DZ6A 3VALA 3KTQA 5RUBA 4LF7F 3OFFA 1Q95G 2K3IA 4DR2F 2KVQE 2O3DA 2HBQB 3GTYX 1NM2A 3OUYA 2W8LA 3PCOB 4LJMA 1LEOA 1Q53A 1H73A 4MJKA 1R8CA 5EX3A 1SKUB 1C1BB 3FEYB 4O4RA 3EE3A 3VQSA 1YRTA 3DLBA 4YY3J 3UWTA 1RBLA 3PXGa 4DV1J 3ENWA 1U6FA 1NPPA 3V6DA 2C3UA 4K5RA 1N48A 1T9TA 4Z7YA 3PEHA 1KHWA 3K0JA 2KFNA 3TX0A 3PYEA 2WVEA 5B0EA 2ZHBA 2Y1IA 2Z8QA 1RTHA 3CDWA 1CJUA 4ECVA 2DRDA 4DV7J 3GE9A 1N36F 2M88A 3ZZTA 4C8LA 4C8YA 4EYIB 1RT3B 1N0UA 1AA1B 2JFDA 2AX1A 1FI4A 2GW8A 3BKUA 1FKOA 3NS6A 4YUDA 1IBLF 2B4UA 2GV1A 2QMXA 2FUG9 5ETSA 1TELA 8AT1B 2RRAA 5B0AA 5IQ6A 2UXBF 3OL7A 2BM1A 3WBZA 2UVRA 2DY1A 1NMEB 4ILMA 2CNKB 1UFKA 4A8KA 2IDLA 3A1YG 1UJ4A 4I2QA 2J6UA 1X8DA 3W63A 5KFRA 5D0RA 3KKFA 2DNOA 4MKBA 1W26A 4DSEA 4W4MA 5DJBA 2B4PA 2E1MC 4RW6B 1RTJA 3MR7A 3TUPA 3NGKA 4B9TA 2Q6CA 3H98A 3PRBA 2JWNA 1LW2B 1YJRA 3M9OB 5CQGA 1QVFR 3OW2R 2IHR1 5D77A 1U2FA 3DM2B 4U8YA 2W7AA 3IO1A 4R0EA 1S0NA 5J2PB 1J5OB 2BDPA 2U1AA 2COLA 3B78A 1U0HB 5FLXU 1L3TA 1OSDA 3PY8A 3CIZA 2AKWB 4WP9A 2CA9A 4NEZA 3FRYA 3GR1A 4A8YA 4KB7A 1UPMB 4HDGA 1DFDA 2D1CA 2G2OA 3OPKA 2R2RA 2ZE2A 3QGIA 1VHIA 1PJ5A 1WHYA 1H7WA 3LP1A 4QIFA 2HHHF 1IKVB 3CJ8A 1CJTA 1TVRB 1X4HA 3BS9A 3C66A 5B0GA 4KPYA 4LFCJ 4GKKJ 2KJVA 1WOOA 4GKJF 3LAKA 1RHUB 4B9UA 3IRXB 3TI0A 3PO5A 2HGLA 3T3FA 2GHVC 3HSGA 3HKZD 3ZZZA 1K1SA 1YZ7A 2BUNA 1Q7LB 5KG4A 5HVGA 4QW9A 3Q8PB 3UI3A 2GVDA 5IWAF 2K7KA 4JI5F 1LXJA 2Y1JA 1D09B 2YNIA 3THVA 2DHAA 2UUCJ 2XC9A 4GC7A 3CCTA 2RDIA 2L08A 4KHPJ 4B9MA 4PAAA 2YWGA 5ETQA 3P96A 4ICLA 3RAMA 3IWXA 3PG9A 3QPIA 1HBUB 2OO4A 1IBKF 3PFEA 1TR0A 1XR5A 2W9CB 2I38A 4B9NA 3K8VA 2UUAF 2AT1B 4DUYJ 3W2WB 3TR5A 3D68A 4YB5A 5DDPC 1LNQA 1LWFA 2B5JA 4KPCA 3KG0A 3HXMA 3FQLA 2RU9A 2V0NA 2UVWA 2W2MP 2YPZA 1NSAA 3FQKA 3FFIA 2EC2A 1V3RA 3K5LA 3VAIA 2R7OA 1YITS 4V19X 1YHQS 4RW8A 1GNKA 3LW5C 3M1VA 1SJ3P 2HFNA 2A2DA 1ZTWA 4EFAC 3DLGB 3OD2A 2C2EA 1L5UA 2EW9A 4DV2F 5FDLA 4F4YA 4USWA 1F5CA 2RKIA 1S6PB 2Z56B 4X4TA 2KT3A 2NUUG 4NRUA 3Q83A 3I96A 1KTVA 4FYDA 2C3YA 4IH5A 2ZOGA 4OFZA 3O2IA 3C19A 2DNLA 3QWPA 1FVSA 5AE1A 4MAKA 2P9CA 3MCOA 1EKRA 4IRCA 4RBVA 2GJFA 5FLXY 1RT5B 4MYUA 2CQPA 5ETMA 1U0SA 3EM1A 2DGSA 2NYIA 1TKDA 2IDEA 1TMJA 2Z2ZA 2W9BA 2UXDF 3PW2A 3IG1A 2KT2A 3A8KA 4N8NA 3LWMA 3OBIA 4RU2A 2RUSA 1T9WA 2J9CA 3AB2B 3KK2B 4EWTA 3MM9A 2VFRA 1UVKA 5J2MB 3RRGA 3D0HE 3OSNA 2Z2MA 4W90B 3GFZA 2FHMA 4PQAA 2HAFA 4H4MA 1JXVA 2CQ0A 1TL4A 3KXDA 4GO5X 5JMNA 2HWTA 2YWHA 2KZMA 4Y28C 4CDIA 3NEKA 1QUVA 2OUGA 3HP6A 4ZCLA 2EFVA 1YG0A 2X1AA 3GLJA 3TJ8A 2UUBF 3C16A 5IQQA 5AE2A 4PABA 1UZDA 4J9QA 1XR6A 3ETMA 4EK2A 4QPTA 2VH7A 2ZKUA 3Q86A 3M9NB 3NMRA 2KFZA 2CJKA 1GX6A 1QE1A 2BE2B 1X4EA 1NUEA 1JLAA 4X4VA 3DFEA 4F04B 4B9LA 2ZM6J 1UWBB 2YWFA 3RB3A 3HPOA 1VHFA 3W65A 1RAEB 4P2SA 5ETLA 2VBZA 3H42A 2XQCA 1HNXF 1BMQB 3OJUA 3ZXWA 5KOXA 3PZPA 2BANA 1W25A 1UWAA 2E9TA 4NLPA 5CCMA 5F0UA 2H54B 2C22A 3LGHA 4ZKAA 2OFGX 3B54A 4KGKA 3M8WA 5GAEU 5K8NA 2ALZA 1C1CB 5T41A 1D0EA 2MGZA 4ECQA 3DHXA 4CLKA 5BYQA 3CO0P 2DNNA 3EZ5A 3AXKA 4ECYA 3KNGA 3L4BC 3ILLA 4KGVB 4KE5A 2HZAA 4BLGA 4BWMA 3DOMB 2FVPA 4QCLA 3IMQJ 1RYRA 3MEDB 5KG1A 3PKMA 4DFKA 2AEFA 1F9HA 4LQ3A 4EBDA 1HHQA 5CYQB 2ZWOA 2DNQA 3HT3A 1TFWA 3HKWA 3POTB 5C25B 3GMGA 1N4LA 3S8SA 2FHOB 2BOAA 2IA0A 4EBEA 1FJGF 3VCDA 5DZ7A 4CRJA 2A1BA 3R7SB 3MWBA 1N33J 1VQ8S 1NCLA 1P9QC 4L72B 2AX0A 2V69A 4DV5J 3CB4A 3B4MA 1RT3A 3GILA 1WKKA 3G87A 4ZVGA 3W5YA 1Y5IB 4KKOA 1VLYA 4LFAJ 3C15A 4YDXA 5F8GA 3W64A 3RR8A 1SBRA 1RE1B 2E1RA 5DGBA 2GJIA 3NRBA 2XTJP 4PKDB 3Q24A 3CJ2A 3M6WA 2ZH7A 4GMKA 5H9EJ 4NYZA 4J9MA 4J9RA 4PYDA 1VLOA 2ROEA 1HWLA 4F4WA 4KYZA 4IFVB 1TKXB 1YI2S 4ED4A 2AZ3A 1R0AB 1XQIA 1T3NA 7FD1A 1KDNA 3CJ3A 2R7UA 4DMZA 2CZ9A 3VAFA 2MQPA 4NMXA 4WF9Q 4K2XA 4RW6A 5GADI 3EX7B 4OX6A 1OQ6A 2G4BA 3MAAB 4RPFA 2CQHA 3C8YA 5IM0B 4H54A 2HURA 3EDRB 3R3TA 1LW2A 3EMTA 4NLSA 4DR6F 5L38A 4NLUA 3RRHA 3DM2A 3NL0A 5J2PA 1J5OA 1HQ2A 1BXNA 2HRUA 4H4KA 3IRWP 3ZZ0A 3ISZA 3RBZA 3SV4A 5HP1B 4WKRA 2J7KA 3KJQB 1S1UB 3JAMU 1I6JA 2W2OP 1K44A 2MJUA 1B0PA 4OV1A 2VBXA 2QLBB 4LF5J 3LO3A 1TAQA 4N76A 3HFVA 4YB6A 2ZDPA 2DKOB 1PC4A 4KR0B 4TNOA 3CXCR 1IKVA 5L9XA 1VQLS 2M8DB 1K9MT 2ZC3A 3RW6A 4K4ZA 2LEPA 1TVRA 3KMSA 3T1YJ 2G9OA 4X62J 3KLHB 2XZWA 4NLOA 1CBKA 2YWEA 4RNMA 2RD5C 1CJKB 1ZZNA 4HR2A 5IS2A 3OFEA 3AT1B 3OVBA 2V4JB 5LJ3Y 2LFVA 4B3RF 4C0HA 4CT9A 4Y2AA 3T19A 2GA7A 4LRCA 5H9EK 1JX4A 2KO1A 5J2NB 4WCEQ 1K73T 4DQIA 4TYAA 1FD2A 3MFIA 3NOCA 2QL7B 2IIHA 3CJSA 1TUGB 1RHJB 1L3SA 1CLFA 4N7TA 3M32A 3I9ZA 5CYMA 2EC0A 3RBDA 1ZTTA 4QIEA 1HNZJ 3GV7B 2D41A 2UU9J 1H38A 1VQKS 2ZOMA 1U1QA 4ZVEA 2QA1A 1OY8A 4U7CA 1X5SA 4PZVA 2OMLA 2WSCC 3W2WA 1F6TA 4K4YA 1NKEA 4LR7A 5A8RA 3VGSA 2CQBA 2R8IA 3NCRA 3GV5B 3I5CA 2B7BB 2CNLB 5DQHA 1S57A 3SIPB 1VIOA 3BDEA 5EUHA 4RNOA 4USMA 1AUDA 3P6YC 4WJBA 1ZM2A 1S9EA 4PUOB 4X65J 2NR0A 1HBMB 4IOBA 3J80U 2L3MA 4DI6A 3L9ZA 4J9UE 3VF0B 2AP6A 2ZNZA 1VISA 3MFHA 4IO1A 3CE8A 3BO4A 4OYPA 3TAMB 2X3DA 3UR3C 3MXHP 2VQFJ 3OFHA 1HHTP 1Y10A 2DITA 1S0OA 3EZUA 2WSEC 3IC1A 1RT5A 1Q78A 4PQUB 1M5PC 4OJ3A 5E5NA 5F9LA 3MM6A 4I6WA 4QW8A 3BSAA 1FXDA 1SQEA 4WFAQ 1RKJA 2CQDA 2BBEA 3E2EA 1CS4A 1RUSA 2GCFA 2XZTB 5I3UB 3KK2A 2NZCA 5IV3A 4PWUA 3VV2B 1HD0A 5J2MA 1HBNA 1CQMA 1SJQA 3OTEA 2YQ0A 1PJ6A 1U02A 3MR5A 5F8NA 3CCSS 1AT1B 1F9EB 3IFEA 5GMKa 2ZWPA 3CD7A 2J9DA 2LVWA 4LF7J 5DM6Q 1GAOA 2W8KA 2BZ2A 2DK2A 2VBYA 2XG8A 5GAHU 4I68A 2HWHA 4ZP6A 3NKYA 2YBVA
chains in the Genus database with same CATH topology
2MZJA 4Q45A 1NK6A 2LLZA 3DU5A 3OXLA 4ZP7A 3GB0A 4Y65A 1FK9B 4U6PA 3BSCA 3M05A 4N5SA 4X84A 2DNKA 2BE2A 2WRMA 3AB4B 4XO0A 3G6XA 4DV4F 4N76A 1G6BA 4ECXA 4PG5A 4JV1A 5D4NA 4LIWA 1Q81T 2MKSA 1VS3A 2ZJRQ 3NG8A 2NLWA 2N4CA 1UWBA 4DEZA 1JKHB 2I8EA 2ZOFA 3QZ7A 4E8UA 4FXVA 5KFFA 4RUAA 1ZPWX 4ETXA 1R27B 2Q43A 3KHRA 1U1PA 2XLJA 1U45A 3SQGA 4YOEA 1SIZA 3SZ2A 1GT8A 2VA2A 2EG1A 5A8WB 3U02A 2HHUA 4USJC 1B64A 4NCGA 1WHVA 2DB1A 3LPYA 2DPIA 2QT7A 3MPYA 3MTJA 3OUYB 3DCAA 4B3MF 3TNVA 3BQ1A 1KTQA 4WK3A 4DL0C 1SI9A 2AYEA 2KKHA 2OD6A 3QYYA 4A8OA 2YNGB 3BEGB 3O1LA 4QWDA 5F41A 2B51A 1DARA 1JKHA 5T7LB 5LXRA 4DV3F 2XY6A 3TRGA 3HZGA 3KK3B 1KLMA 2VONA 5KFYA 1F5BA 3QO9B 2HFOA 3HI9A 3FMWA 1APSA 2EI5A 4QIVA 4RWWA 5LSLA 1LKZA 3PRDA 1FNOA 4MTPA 3I0SA 1NNDA 2QSFA 4K4XA 3L09A 2OH2A 1T05B 1FRJA 3OL9A 4ZCIA 2KB2A 4DV0F 4EBCA 4DL3A 2KDOA 4QQBA 2ZM6F 3V6DB 4X2BA 5B08A 3TYTA 2KRBA 2R7VA 5KG5A 2JVOA 2XMMA 4K4VA 2FGCA 3E01B 1NJWA 1C1CA 2D9PA 2DT9A 2XGQA 5KFPA 1N5VA 2F8EX 5C5JA 1S97A 3IXQA 4HEA9 1FD8A 2G1DA 3PR5B 2JVRA 3KK3A 2Y1RI 2HMIA 2XBPA 4IR1A 2JX2A 3TUIC 5GAEI 1KFSA 4G1IA 3QO9A 2GHPA 4DR1F 3CT9A 1P8GA 4RUHA 1BQXA 1TL5A 3BREA 3QMQA 1O51A 5EWGA 1U6BA 3I9V9 4F4XA 1YJUA 4DQSA 5M2PA 3L3CA 3TX8A 4K4UA 1NB7A 4LF4F 1S9GB 4DSFA 3PHEA 2HNZB 4FF3A 1K8AT 3CIMA 1S72S 1WEZA 1XMQF 1NO8A 1FXRA 1T02A 3N6LA 1WG5A 3V2UC 3K2YA 3EYZA 2IAJB 4ILLA 1S1XB 3SCJE 5A0YB 1ZH5A 4DR3F 5CH7B 1X9WA 1T8EA 3BO3A 4ECZA 4JI3F 4RW4A 2E5GA 4K4SA 3LANA 3NBPB 1WEXA 2W4CA 1YWXA 3OQ2A 3HHEA 1HYSA 4HI1A 2J8AA 1LQ9A 2ZH3A 4XIUA 4G1PA 4JV5F 2QIFA 1FKOB 4URSA 3HZEA 4D3GA 2R7QA 5CYQA 5J1NA 3J80Y 3BSNA 3UFCX 5EDWA 2JC1A 3KWMA 4F26A 1NK9A 3EGWB 3U1NA 2HNZA 5HROA 1JLBB 2LEAA 5L1KA 1S0MA 4KTQA 3KHGA 2B43A 2C3OA 2QV6A 3PM9A 1NJZA 2Z0GA 2XS2A 4PXCA 1MNEA 4NLDA 3DLJA 2IAJA 2VOPA 3T9ZA 2IBKA 2DR7A 5A0YA 2QLWA 4U67Q 2A3JA 2CYYA 5E33A 2VG5B 4G3IA 3V5RA 3D1QA 1FKPA 3I6PA 3NBPA 4UUXA 4K4WA 2ADCA 4WTYA 4FVMA 4I1TA 4DR4F 2RQ4A 2ASJA 1J5EF 3BDPA 2MY8A 2ZH9A 2NPIA 3RAQA 2FJAB 3IR5B 1Q7YT 2XS5A 3DLEA 1TUVA 1PO6A 3MD3A 2MGZB 3I32A 2JLEA 1JLBA 1KR4A 1VQOS 4RW7B 2XULA 3T6BA 3P49B 3HDSA 4NLYA 3HM9A 2RE1A 3HHLB 5HI7A 3MAQA 3LWLA 2KH9A 1IN0A 5KT3A 4F4KA 1HWJA 3KFWX 2J7UA 2KJWA 3SEOA 2VG5A 4C9DA 2ACYA 1G7CB 2KZZA 2OMOA 4AXIA 3PV8A 1VMBA 5E0OA 4ECTA 3TQ1A 5L8RC 2IJNA 3FZ2A 4I4BA 5KTQA 1VC0A 3MURP 2R7WA 4O3PA 4PXBA 2EK6A 1JNRB 4OHWA 3HVTB 1C4AA 3TUZC 2AYGA 2EPIA 3M2RA 4HL9A 3GYXB 5FIIA 5CYJA 2RQKA 1SL2A 2HAIA 3EGZA 2CFXA 3CDBA 5DDOC 3SFUA 2VG6B 3DC2A 3NP5A 5D6GA 4DQPA 1JLQB 1UFLA 1WF2A 3K5MA 4WYLA 4IQMA 1DRZA 2V5HG 3DLLQ 4FF1A 2JC0A 3ICLA 5D4PA 1E6YB 1K0VA 1UKUA 4KAIA 2ZUGA 3R27A 1RA7A 5CHCB 1T03B 3WC0A 3DOKB 3PDNA 3NLCA 4NLVA 3GIMA 1KQFB 3CMES 2BACA 1N33F 3KLVA 5KT7A 3PJXA 2CJAA 2BRLA 1JB0C 1MMNA 3NAHA 1URNA 4CZCA 1ELOA 3SSQA 4H4OB 3OVSA 1KEKA 3TVKA 4NA1A 1JLQA 3DRYA 2CPZA 4DV5F 4ED1A 1HA1A 5KFAA 5I3QA 1PSDA 2HNYB 3GG0A 2VD3A 1NK7A 2FJWA 2IFXA 1FEHA 4QOTA 4TY8B 1VQ4S 2VODA 1NAQA 4W92B 4ZPWR 2GQQA 2GHWA 1Z1ZA 2MXYA 2LU2A 4JI7F 3ITHB 1XNQF 2XMVA 3DOKA 2ZE2B 3RAXA 4BBYA 3I56S 4J9SA 4LSLB 3C6TA 4ECUA 1KS2A 3I87A 1NU4A 2VA3A 4QZVB 4IQXA 5DETA 2KU7A 2F8HA 3DGPA 1NJIT 3SSRA 3AA9A 4J9OA 1VQ5S 4HVZA 2AJ1A 4A8WA 3JSRA 1SKSA 1FXLA 2MY7A 3ENQA 1YVFA 1N56A 2K8GA 1R8AA 1M5SA 3N9UC 4TY8A 5LL6d 2FVSA 3WDOA 1JIHA 3M2VA 2Q79A 4IUFA 2MHNA 1UL3A 2IYGA 4OX9F 3T5LA 1QUPA 4M5DB 4MIBA 1S0VA 3ITHA 3W3SA 3MM8B 2CZVC 3ISND 3NNAA 3RYLA 4PWDB 5F8JA 2UV8A 5DRKA 2VB6A 3K7RA 1GTHA 1KQGB 1QTMA 3DYAA 2MHEA 4IOAQ 2XHWA 1R43A 3Q2TC 2IM1A 1F5AA 2XEXA 3AAWB 2P9EA 3VQTA 3GV8B 2R2UA 4DF8A 4DDFA 5L1IA 5A2QY 2R7TA 2ASLA 4ZA1A 4DJBA 1VIXA 1HD1A 3T5JA 4F02A 1DTTA 1RA6A 5J1EB 5KFMA 1G2EA 4WU3A 2G0CA 5D3GB 4BCAA 3MM8A 4PWDA 4F67A 4IG3A 4ZOSA 3V6KA 4OMFG 4O4GB 2MQQA 1QJHA 3V4MA 4YR2A 2J0QD 2X1GA 1JLGA 2FJDB 4CQ1A 4F2RA 1Q16B 2JZ5A 3PW7A 4FN5A 3TP2A 3H5SA 4OZNA 2YNIB 5C24B 5DDRC 3DLHA 1ZPVA 4HHJA 2NZ4A 3CULA 2JH3A 5KOWA 2GGPB 1M0SA 1LWEB 4DQRA 4KRWA 3F73A 3HMJG 5KG2A 2O1PA 4X66F 2DCLA 4JV2A 1S99A 1HQEB 2YH0A 5J1EA 4MK9A 4EO8A 1EP4B 5I42B 3KLHA 4NXNF 1Q82T 1NJYA 5F0WA 2CDQA 1J2VA 1JLFB 4F25A 4PG8A 3MMBB 3SSSA 4Q44A 3JTNA 2RQMA 4DFPA 1AW0A 2Q6BA 4O4GA 1H7XA 4ICLB 3DDNA 2PIIA 3SDEA 2CPXA 4X4OA 3BF4A 1S6QB 2CPJA 2CRLA 5KFSA 4AL7A 2BRKA 4CH0S 5IZHA 5BYRA 4ED8A 2GIRA 1OPIA 4Q8FA 3N0VA 1OIAA 1UVNA 1N6QB 2DGUA 4B02A 3KJVB 2LCWA 5G0RB 4YR0A 1ULRA 4ZMMA 4ED3A 1VRUB 4JI2F 2ZH1A 5FJ4A 2B9YA 2KHDA 2E5HA 3OL6A 2V4JA 1U2RA 2FIUA 5EHHA 4J5OA 5I42A 4NPOA 3U27A 4RBUA 1CEZA 4NYPA 5MLCV 4YFUA 1GXLA 2N7YA 2QO3A 3HHLC 4LF5F 4PXDA 1Q8BA 1SH3A 2XMWA 3I4PA 4IDKB 1YGYA 4NLTA 3MD1A 4QU7A 3C6UA 1RTIB 1HWKA 4ATNA 1LFWA 2MJNA 2MKJA 2ZITA 2XI3A 4MFBB 4C98A 2LQBA 2DGXA 3PW5A 5D4LA 2PMZD 1WNEA 1MWZA 1N6QA 1XTZA 3KJVA 5J2NA 1UA1A 4IRDA 2QEXS 1VRUA 4RW9B 3D1OA 1YJTA 2QLXA 5HBMB 5C42A 4X62F 4FZVA 4DSIA 4ITSA 1IKXB 2CPFA 1U24A 2YKMA 3RZAA 1LWFB 1WACA 2VZ9A 2IBOA 1NJXA 1P1LA 2JDJA 2WB4A 5KFQA 3PX4A 5L9NA 4TU8A 2GIQA 4DSJA 3MR6A 3CCQS 2PA8D 4M1KA 4I56A 5KFVA 5ADZA 3ENVA 5IT0A 1PILA 2PSZA 5KFBA 1HI0P 1FNMA 2JJ4D 3FFIB 4MFBA 3DRRB 3KHLA 1B7FA 2DTJA 2V94A 3OR1A 2XMJA 1CC8A 4QJVA 1D9DA 1S1TB 1BQMA 2FGOA 4CO4A 2LXUA 4ZDNA 1YJWS 3CC2S 3HHNB 4I64A 1RT7A 4RW8B 4RW9A 3V4IA 2JEGA 2HQIA 3MEKA 1D3WA 1HHSA 3UW1A 3CCMS 2FVCA 4JUZA 1FF2A 3TW0A 4OQJA 1IKXA 3M1VB 3PO4A 1Q79A 4HTJA 5KFKA 3CD5A 4CO0A 3D54A 4QR0A 3M4XA 4PPDA 1WG1A 3KLFB 4WZQA 3MECB 2OJ3A 4DF4A 5IT4A 1TP7A 4ELTA 4TY9A 1HPZB 2OP5A 3DXSX 1S9FA 5L1JA 5FDLB 1IJEB 3W2VB 3JSMB 3GIKA 2ZKTA 2ABYA 3NAIA 2FC8A 2RKIB 1UJ6A 1AFIA 1CVJA 4OI6A 4KO0B 2WCXA 1VQ9S 3JYTB 3JB9k 5LSOA 1TZ0A 1GXUA 1ROFA 4C97A 2CPDA 2DIUA 2IRUA 4R0JA 3CO9A 1IQZA 2YKNA 3QAEA 1IJFB 3KLFA 3M6XA 1TL1B 2FVRA 1IQTA 1LK5A 1N88A 4MKAA 1I1GA 1SV5B 3CJKB 5J2QA 4B9VA 4CO5A 2BOPA 3RBEA 3GZ7A 2PGCA 1RGVA 1YRXA 3JSMA 4ZPDA 3PACA 2AQ4A 4IH7A 2KM8B 1VC6A 2HFZA 3PNIA 1F9FA 2CJQA 5DLGA 2Q1LA 3OR2A 3MM5B 2JLGA 5THWA 2R4FA 5GVQA 3J7YI 2DRAA 3R1LA 3MMAA 3T1AA 4F3MA 2ZZMA 1HQUB 4HH0A 2L9DA 1VFJA 1BQNB 1HNZF 3OTDA 3P3DA 3CJKA 2V8DA 4WIIA 4C2MA 5A8KB 3SCIE 1TV6A 2B9XA 2YX7A 3Q8SB 2PD1A 3CSKA 4HKQA 1U09A 2XSJA 4X64F 1TK0A 3IG1B 2JEJA 2XMKA 2LMIA 4XK8C 1AFJA 1HBMA 4QR2A 2IYIA 2F9DA 3I31A 3G9CA 1C0TB 1AXQA 3I55S 3L7PA 2V2KA 1LWCB 4E98A 3MM9B 1S4FA 3MM5A 2GX8A 1YIJS 3LP0B 2AW0A 3H5XA 3QIPB 3VAHA 4Q0BA 2VV5A 1VQ6S 3GSDA 4DL6A 3IR6B 1U26A 5JXSA 1TFYA 4DX8H 2Z2LA 4ZPAA 2HWIA 2XSFA 1BQNA 4OZ5A 3M9MB 5E3CA 1LXNA 2IRXA 3BGRB 4ZVFA 1RT2A 3MGJA 4MIAA 4N8OA 5A8KA 1S1VB 1ZOTA 2E7WA 4FPRA 4KHMA 3TAMA 5HMZA 4CH1A 3T5KA 2BVZA 4Y0FA 3IN5A 3PW0A 2QZ8A 1QSYA 2DPJA 1CQNA 3AH6A 2KT5A 4HDHA 3VAMA 1SJFA 2PI5A 4JI4F 2L9WA 3KK1B 5J1PA 4Y6IA 1JXEA 2B4VA 3LGMA 1LWCA 4CIOA 3IAM9 1DQAA 2I0XA 3LP0A 1SJ4P 3H4DA 2BJDA 3G96A 3QIPA 3N6NA 2MKKA 4IYQA 2V8VA 2OPSB 2NXUA 1NKBA 3DRSB 4RNNA 1SUQB 5M2RA 1Y5NB 1RTDB 1KVIA 2HHPA 4OI4A 4PQUA 1H2UX 3DU6A 3BGRA 4X65F 2VPZB 4V19J 1SJ1A 1YJ9S 4N56A 3MMCA 2FD2A 4LVNP 4RNFA 5SZTA 3L95X 3LUYA 3NCPA 3QWUA 5KFEA 2DNRA 2ASDA 1DZ5A 1XNRF 2WOMA 3EXYA 5CD4H 4OX8A 2ZBIA 1S76D 3KNAA