1SB6A

Solution structure of a cyanobacterial copper metallochaperone, scatx1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords copper chaperone ScAtx1
publication title Solution Structures of a Cyanobacterial Metallochaperone: INSIGHT INTO AN ATYPICAL COPPER-BINDING MOTIF.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Chaperone
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sb6A00
1VQYA 4FNHA 4NPOA 3TOQA 2ACYA 2OFGX 4A4JA 1AW0A 2FHMA 1JWWA 1YJUA 2OMOA 2FIUA 5B0DA 3IWXA 4OJHA 1CC8A 1Q4RA 3KNGA 2PGCA 1RJJA 1QUPA 1S6UA 1OSDA 4NL5A 3BM7A 1N5QA 5B0FA 4U9RA 4OJ1A 2N4DA 2K7KA 1TR0A 1Y9OA 3BR8A 1FE4A 1XBWA 1YRXA 2KT2A 3FMBA 2FB0A 4Y2KA 3E8OA 4ZOSA 2QYCA 3HHLC 1GXUA 2AP6A 2KKHA 2XMKA 3K7RA 1FD8A 3CJKA 3DCAA 3FRYA 4Y2MA 3IWLA 2W4PA 3MZIA 2HLUA 2ASYA 1TL5A 1X7VA 2LXFA 3KG0A 1IUJA 1Y3JA 5K9FA 4DL0C 1KVJA 2IFXA 4A46A 3KKFA 2W4CA 2AJ1A 1N5SA 2OD4A 5A6WA 1YJRA 2K1RA 4F67A 2RMLA 4HH0A 4HI2A 4DN9A 2QLXA 1SB6A 1FVQA 1Q8BA 1X8DA 2CRLA 4HI1A 3BGUA 1P8GA 1MWYA 4A47A 2N7YA 2KYZA 5F0UA 1ULRA 2GA7A 1V3ZA 1WD6A 4Q2LA 2GGPA 3CJKB 5F0WA 5A6PA 3HX9A 3GZ7A 3LO3A 1S6OA 2FTRA 1OQ6A 1SI9A 2OFHX 1U7LA 1YJTA 2HFOA 1JK9B 2GO8A 1Q8LA 2HLTA 2BUNA 2L3MA 3LGNA 2GCFA 3QGPA 4OJGA 2N4CA 1SQEA 2OKQA 2RSQA 4Q2MA 2OAUA 1KQKA 2LQ9A 2JDJA 2LQBA 1TL4A 2BJEA 2XMJA 3BB5A 1OPZA 2W4DA 3BDEA 4QOTA 2K1RB 2VV5A 2ROGA 2XMUA 2HIQA 3BF4A 1W2IA 2XMWA 2K2PA 1K0VA 2IYGA 3VTIA 2BJDA 4A48A 3UDCA 2BYCA 2HFNA 2BBEA 2RILA 2GGPB 2ROPA 1YG0A 2OD6A 1URRA 2ZDPA 5IXUA 2EW9A 5T7LA 2Q3PA 1FEEA 1CPZA 1OQ3A 3HHLB 3WDOA 1FESA 2XMTA 5B0GA 2XMMA 1GXTA 3I9ZA 2AJ0A 3HHLA 3LGMA 1AFIA 1P6TA 2QIFA 4OJ3A 4YDXA 3TRGA 1KVIA 1R6YA 2GFFA 4HL9A 3F44A 5B0BA 4OIXA 1AFJA 3BN7A 4ZA1A 3HDSA 2K7JA 3TNVA 4DPOA 2PD1A 3FGVA 2ZDOA 1N5VA 2HQIA 1TUVA 3HHLD 2G9OA 4Y2IA 1X0PA 3KG1A 5KAKA 1VQSA 2IYIA 2KT3A 5B09A 3T9NA 5B08A 1Y3KA 1MWZA 2QLWA 2RU9A 2LDIA 1FVSA 5T7LB 1Y0HA 1Q53A 2ROEA 4HH1A 3HFKA 1YJVA 4YEAA 4EFAC 2AW0A 1CC7A 1TZ0A 2GV1A 3MCSA 4FNIA 5B0CA 5B0EA 5B0AA 2OP5A 3HF5A 2VH7A 1N5TA 1APSA 3QMQA 1FE0A 2XMVA 3DXSX 1LQ9A
chains in the Genus database with same CATH superfamily
2DHAA 1N36J 4OFZA 1DTTA 1QUPA 3BPDA 2XBPA 4WU2A 1D9FA 2VPXB 2ZFHA 5KT6A 3G8TA 1CQNA 1E6VA 4DFMA 1C1BA 3J81Y 4ETZA 1RGVA 4B3RF 4Q8EA 5D0EA 4ZVPB 1X4BA 1FDBA 2I2YA 2XWXA 4TU7A 1HI8A 2HURA 3GV8B 1SB6A 4MK9A 3GILA 3KDOA 1P8GA 1S1XB 1JIHA 3H40A 1NDKA 1NZ8A 1N52B 1UEVA 2JOQA 2GVDB 3MAAB 4DQQA 1FXLA 2XY6A 2MY7A 1RHJB 4BWMA 3QATA 4TQRA 3FSIA 3HK2A 4EBEA 3L09A 1WF2A 1U2RA 3LUYA 4NLSA 5DDPC 1T95A 1A0OB 3NWRA 1OPIA 2ZHAA 5HVGA 2CJXB 3ZZRA 2LDIA 1LWCB 5I42A 4HH1A 3DU6A 1S59A 1TMMA 2V8DA 1BQXA 5H9FK 3S1TA 3QZ8A 1QSLA 2W9CB 1WEYA 1KP6A 2DNNA 3I4HX 1RU1A 2OO4A 5IV4A 3G2XA 1VIXA 2VG5B 4PPZA 3MEGA 2AF6A 4OYPA 5GAGU 4M8LA 2PMWA 3RR7A 5D3GA 2LLZA 2X1BA 3SSSA 3QRRA 3G96A 1FTRA 1GTEA 3QZ7A 4JI7F 2HSEB 3DFEA 2ERRA 3M8PB 4Z7CA 3NLCA 2H48B 1FNOA 1YX2A 2P9CA 1YQHA 4V19X 3MUVP 5ETKA 3D54A 3DKDA 3H25A 4EYHB 2BJ1A 4O23A 1GAOA 1S1WB 4Y28C 1U02A 1M5VC 2JSXA 1NDPA 1FESA 1M1HA 4EO6A 4RW8B 4DFJA 5HBMB 3TAMA 2K7JA 4IO9Q 4Q0BA 2G13A 4ZP9A 3KK1A 2KT3A 4FP9A 1K1QA 4YQWA 2W2NP 3VR1A 4KO0A 4FVCA 1Z1ZA 3SZ2A 2C22A 1KC8T 3P49B 5EDWA 4ZIWA 1RTHA 4X64F 1BWEA 5FIIA 5CCMA 2Z57B 2ATCB 2G0CA 1IKXA 2ZZTA 5F0UA 3J7Z5 1H3DA 5FDLB 4CO1A 1TL7A 1Q78A 3OFEA 2YH0A 2XHWA 3GCWP 1FNMA 2FGCA 1FXRA 1U1MA 2NPIA 1SL2A 5D4PA 2ZH7A 5BYQA 1CS4A 1I94F 4PYAA 2ILYA 4OJ3A 4J9SA 5D0RA 2GW8A 2NSBA 1REVB 1NKBA 3M30A 3ZO7A 3G82A 1Y3KA 1C2PA 2L9DA 1FDAA 2CJQA 3GG0A 2ILZA 2F7VA 2RS8A 4U7UK 3B4DA 1N5TA 3N0VA 1NAQA 2BVZA 3HT3A 4LVNP 3HT0A 5E33A 5AT1B 5CA5A 2ZH1A 2B6AB 2MZTA 3GQCA 4DDFA 4EBCA 2A1BA 4P72A 3KLHB 1JKHA 3GIRA 2G0JA 3A8KA 1UPPA 5CYJA 2KFZA 3K8VA 2GIFA 4DX5A 1GX5A 4ELUA 4RUBA 3KK3B 3H0PA 3H8YA 5KG2A 2OPSB 4F4AA 5DG8A 3TP2A 3KYLA 2Z58B 2Z2ZA 1E6YB 2QJ3A 1D9DA 4OZ0A 4GO5X 4FBUA 1SCJB 4TY8A 2QT7A 3I87A 3T1YJ 2FHKA 1SKRA 5IQQA 1R43A 3ILJA 3WDOA 2XMTA 2IMWP 1DBDA 1SIZA 4F2SA 4WE1B 4CNYA 5B7WA 2WK4A 2G1DA 4DUYF 3A3NB 2EG1A 4IQMA 5J1NA 4ZVRB 3NOGA 3B82A 3DHXA 4M5DB 1DHMA 3TVZA 3QIPB 2VFSA 4Y65A 1KTQA 2ZC4A 1H98A 4X4VA 2COLA 4PQAA 2PGCA 3EDRB 3NMRA 1FF2A 4OI0A 5HJXA 2G2OA 5DM6Q 3K5PA 1RT3B 1IUJA 2CKWA 1PC5A 2QL5B 4RO0A 3QNWB 3V6JA 1NKEA 4K4ZA 2V2QA 1JB0C 3CWJA 1OWXA 4QIGA 1NK6A 2KN4A 1S9GB 1VBXA 1SC3B 4OYBA 4X84A 1BLUA 2GO8A 3T5JA 3PYEA 3A12A 1RT7B 3UD4P 3F0NA 4UOFA 1WF0A 5D77A 4LT6A 3BYRA 3PKYA 2ZKTA 1JJCB 1NXIA 2CQGA 4H4OB 3MOZA 5GADI 2WTFA 2CPXA 5HMXA 4RNHA 2ZOMA 1RYSA 2RE1A 3V4MA 3SI8A 2UZAA 5L39A 2CQHA 5KFEA 2DPJA 2D7SA 3QIDA 1R0AA 2OP5A 5HP1A 3SSRA 5EGYA 2LU1A 5EWEA 4OL8A 3A4TA 3TOQA 3EE3A 2FZKB 2D41A 4O4RA 2FVQA 5G0RB 1FJGJ 3M2UA 3DDKA 1TL5A 2LDYA 3C16B 3OR1A 1VQ9S 3D68A 1R0CB 4LFCF 3RTVA 5KG3A 4DV3J 4KIAA 3P3DA 1AUSL 1SI9A 1XWLA 3LP2B 2DTJA 4OJGA 3I5AA 2YKMA 1CJTB 4Y34A 4WFBQ 3WC0A 1IR2A 5IT4A 4IR9A 1XNRJ 3P96A 1F0XA 5KFGA 2AYEA 3R97A 1T9WA 4ZVHA 2UV8A 3CDUA 1F9HA 4LSLA 3TEHB 3MM5A 5L1KA 2IY5B 1Q8KA 3KMSA 4PWDB 4NLVA 2MZJA 5ETRA 5KAKA 3GLJA 2HZAA 4CQ1A 1XJWB 4CLLA 3HFKA 4CM0A 1QAXA 1CG2A 1UVNA 3MMAA 3H5XA 1RAEB 4JI2F 2N82B 2XY7A 2B5JA 2MJUA 2RVJA 1T3OA 1F5AA 5SUHA 2FLLA 3AHPA 1B7YB 4ZP7A 3OQ2A 3J81j 2FZCB 1HNVB 3W66A 3ZTOA 4F2RA 3V2UC 3VHQA 2K1RA 1VLOA 3Q8UA 2GA7A 1ZYQA 3NNAA 4B08A 2MKIA 4Y00A 3BKFA 4KRWA 3I96A 3BYPA 3RAMA 3P8BB 3FBFA 4OYAA 4DV4J 1YG0A 3N6LA 3HHLB 4JV2A 5HJYA 2QE5A 3M8YA 3NGTA 1VBZA 3OLAA 2GQCA 3BS9A 2DPIA 1ZS6A 2VUGA 3RYLA 1Q95G 2BABA 1GXLA 1YJUA 3G6ES 4F8RA 1RWWB 2N4DA 2OTJS 1K8AT 2AYGA 4B17A 4NMLA 4WZQA 1U1OA 4F02A 3UNYA 5C2CA 3GMGA 3LWMA 1AZSA 3DYAA 1VQ5S 3A3PB 2WHOA 1PSDA 1KHVA 1NPKA 1R8HA 1HBMA 3BBFA 1SQEA 2OKQA 4O44B 4F3OA 2XG8A 3TVYA 3DLKB 3AOCA 1NJZA 1RTIA 5GMEA 1AB8A 1T0TV 2X7IA 2AEMA 4WK3A 3B78A 1U8SA 1V5IB 3TRGA 5LSLA 2QGFB 4WJBA 1Q1KA 4OZ3A 3CJ3A 1RXOB 3MPWA 1FHTA 4OHVA 1MMLA 2DGQA 1N32F 2HVDA 1TZ0A 3CJ4A 4WP9A 3TX8A 4FDFA 1RWPB 4MKBA 3D0IE 4P10A 2UUCF 2MEWA 2QLBB 3OTOJ 3UN3A 3OJUA 2E9RX 4JI3J 4OJHA 1RT5A 3NBPB 5IWAJ 3IRXB 1FFGB 2DGSA 2XS5A 2J6TA 4S0MA 4C98A 2QYCA 3DRSA 1WELA 1YIJS 1PC4A 1IBLJ 1EQ0A 1SC4B 1CLFA 3I32A 2K3KA 4JI6F 2B9WA 2UVWA 4USTA 3DC2A 1NCLA 2EBEA 1S97A 3BDPA 2EBGA 2GJIA 2WBMA 1ZZFA 1U7LA 1YJTA 2ZM6J 4LIWA 4WFAQ 4FS1A 5J2QB 3DLEB 1WUUA 5FLXY 4PQUB 3BB5A 1XR5A 4RR5A 3VTIA 2CQ0A 3FBCA 4WYWA 1I6JA 2Q3PA 2F1FA 1YGYA 4ER8A 1TUWA 1U2FA 4DPOA 3V4IA 4DV6F 3FUYA 1TKXB 1DJ0A 3MMBA 3BSCA 3EGWB 4P52A 1VHFA 4LSZB 3QQCD 5B0EA 3SXLA 3DRRB 2GHVC 4ZHRB 2BE7D 1UZDA 2DR7A 1NK0A 3C6TA 4LF2A 4L3NA 2HGNA 1HLWA 2K06A 2DCLA 4XDDA 2MZ1A 1JNRB 4ECTA 2WSCC 2QN6B 1UFWA 1ELOA 1KVJA 8RUCA 1R8CA 4JV5F 1FVQA 1F5CA 4IO1A 1W7WA 4M5GA 4KGMA 2E5HA 1XMQJ 4TYBA 4RKUC 3GYXB 4QU7A 1NHKL 4DMZA 4PWWA 2RNEA 1TVRB 1JJHA 5C25A 5F9LA 5DG7A 2HVEA 3JQJA 5DQIA 2C2KB 2R4FA 4DEZA 1ZH5A 2NSCA 3KLIB 3D9BA 1Q5YA 5ETNA 2WOMB 2HEKA 4QWCA 3BBBA 1GMUA 3C14B 4Q43A 2AYBA 1DQAA 4DXLA 4K59A 1X4DA 3EX7B 2AW0A 5CYMB 1VMBA 4MK7A 3TX0A 5ETMA 2OFGX 2UXDJ 4Y2CA 2NLWA 2XI3A 4ICLA 1H0HB 4DUZF 2KT2A 2KJWA 2V2ZA 1R89A 1FRMA 1EB0A 3EVWA 2ZBIA 3BO3A 4KH1B 5E3CA 2QFIA 3ITHB 2YKNA 2EFOA 3HI9A 4X65F 3W8GA 2JFKA 1RISA 4K4TA 1O5JA 2PA3A 1WD6A 3SDEA 3QWPA 1KTVA 3MM8B 4MFBB 2HLTA 2VDIA 4YUDA 4PYDA 2KJVA 2F3JA 5HK4A 2EI5A 2RKIA 2DKOB 3OVAA 4IG0B 3W63A 4PG6A 2IIHA 1NJYA 2DGTA 4USVA 3AD9C 2EKYA 2JEIA 1HD1A 4J37A 1GX6A 2YTCA 2IYIA 2CAJA 4YP3A 1A6LA 1GMVA 3JTPA 3MR2A 3CEDA 2PEBA 2BANA 2DCUB 4EU0A 3Q2TC 2VF3A 1G6BA 5F8LA 3E3XA 4ZCMA 2HRYA 1NB7A 4UQGA 2ZVIA 3R6LB 1FE4A 1T9UA 4HHHA 3PRBA 4BHQA 1X9SA 3JYTA 3FRYA 2HHVA 2JLEA 5IZHA 2DGUA 3UPFA 1NDCA 2J5AA 4X4UA 2VIHA 3AOAA 3VVUA 2DT9A 2VKRA 5KFHA 2WAQD 2HNYB 3HSGA 3QGGA 2BUNA 2ADBA 4ZPWR 4N56A 1ZOTA 1HQEB 1W2IA 3OVBA 2XI2A 3BREA 2OPRA 2BJ7A 1VOMA 3G6VA 2BM0A 2B7CB 2XC9A 5HQ8A 1YZ7A 1U24A 4KTQA 4DR1J 2R8JA 4PG8A 1AFJA 1ZAXA 4DG1A 3GFHA 5C2GA 3QAEA 3PR4A 3W9JA 4NI2A 3H20A 2Z0GA 2D3UA 3MCNA 1A7GE 2B0GA 2ZHOA 3I55S 1T94A 3KWMA 1Y5LB 1S1XA 1Y11A 3HZGA 2IMOA 4AQYF 3TEGA 2UXCF 3GIKA 4K7QA 2GVDA 3MAAA 4LRAA 4Z37A 2IA0A 4E0DA 2VQEF 1RU2A 3CNQP 1F2GA 3SMZA 1F3VA 3A13A 4NZ7A 2K3IA 4ZS6A 2V8PA 2QYGA 1NSAA 2FC8A 3PW5A 1U6FA 3KG4A 4KHPJ 3W65A 5A76A 2UVUA 5HROA 3I56S 5KG6A 3IR6B 3CULA 3W64A 1LWCA 1B0TA 3B6BA 1IBMF 4DL4A 2BRKA 2AJ0A 4F36A 4AXJA 4DLGA 2I0XA 3A8JA 2W9CA 5A8RB 1QTNB 4X66F 4WFNQ 5B08A 2ROEA 2VG5A 1RLCL 1GK8A 4HLBA 1IBKJ 1LEOA 2W24A 3GV7B 1S76D 2PFFB 2GHWA 2VOOA 3ICLA 1JWWA 3JAMU 4LF6F 1RJJA 1S6UA 3FQLA 1N5QA 4YMEA 5E3PA 2LQJA 2ZUGA 3E01B 1X5SA 3M8PA 3PHTA 3HLUA 4DL6A 3IFEA 1ZTWA 4PXEA 2XGPA 2OD4A 4Q44A 1WOOA 1KLNA 1RA6A 1S1WA 1UCNA 4MKAA 5L38A 4TN2A 2WSFC 4DV0F 4RW8A 4JP8A 2ZH5A 4ED1A 1VQ4S 5HBMA 2DH8A 1TL3B 4HTIA 2QRRA 4KKOA 3J7AN 1WI6A 3CJ2A 2ROPA 1Q79A 2KHCA 5AJ3F 4HDHA 3RAXA 3TUZC 2D9PA 4KFBB 5MAOA 3BKTA 3RB4A 3FGVA 3GJSB 1T8EA 5L1IA 5HMWA 2CJYB 2E1CA 4IUFA 3M8ZA 1GQEA 4JI8J 4IKAA 3D28A 5CD4A 1RSCA 3MURP 1Y5IB 2FZGB 3NAIA 3IGVA 5AXMA 4AUKA 1KEKA 1FDDA 3I6PA 2CPHA 3OW2R 3MPDA 2DHXA 3GWCA 2OH2A 4G65A 5FDLA 3THPA 2BACA 3FDSA 4HH0A 4HI2A 3FFIB 4LR9A 3NGUA 5LMNF 4G1PA 2WZ1A 4F4XA 1S6PA 5E5NA 1ZM2A 4J7CA 4F0KA 3KK2B 5LL6d 3KXDA 2L3MA 5M2PA 1LXJA 5DDOC 1Q7LB 3D1OA 2MKYA 5D8HB 1REVA 1R6VA 2X1AA 4NXMF 1Q82T 2IVMA 1H2TZ 2HPUA 2HHWA 5CCLA 1N5VA 3D6HB 3GIMA 2MSTA 3AB2B 3KHLA 2DR6A 2BJ3A 3KLHA 5B0CA 3DOKB 2VH7A 3BPSP 1U1LA 3I5BA 4A8WA 4B9SA 1DTTB 4IH6A 4JYAJ 2OMOA 1IR1A 2RRBA 5CYQB 3IAM9 4OJ1A 3CD0A 4BDPA 1HKAA 2OPSA 3EM1A 1C1BB 3PACA 4LF5F 2MLXA 4ATNA 3RRHA 1E6YA 2J9DA 3VF0B 3NXZA 5HATA 3S7RA 4J9MA 3OFFA 4DF4A 4U7UD 1HNWF 2BJ8A 2VICA 4IOCQ 2Q6BA 2DIVA 4ECZA 3T1HJ 3IWNC 4ECWA 2EVZA 4MK8A 2MKKA 3M7VA 4UF4A 4LBIA 3NG8A 1QSYA 3R5AA 2R2SA 4K4UA 3OFHA 2IBKA 2IPOB 1X9MA 4M5DA 3HFVA 3QIPA 4YDXA 3EZ5A 4X4NA 3AH6A 2GVZB 2EFPA 1NJWA 3PIOQ 4ILLA 2I5JB 4WBFA 4DX8H 5K20B 3QSYB 2DGOA 2Z8QA 2HS4A 1UMJA 2XMVA 3SCIE 3SFGA 3KLEB 2OGUA 2CDRB 1WEZA 2GMLA 5K8NA 3MEGB 1LK5A 1PJ6A 2X51A 2ZE2A 3BV8A 4Q45A 2A3JA 4BC9A 1S9GA 1MROA 1VK8A 1Y3JA 1RT7A 1SH2A 4PAAA 4IRDA 4I67A 4PG7A 1S0OA 4LSNA 3T6JA 1IWGA 4PXDA 2VQFJ 2CPDA 4H4OA 3K2YA 1P1LA 1HA1A 3WIVA 1OPZA 3PYGA 3MPYA 2FLOA 4CLWA 4HKQA 1IQTA 3PR5B 3FRZA 2UUBF 2AJQA 1D9AA 4I6WA 1KSPA 4ECSA 2LXUA 1FD2A 4M94A 3TAMB 4Q0BB 2RF2A 5J1PA 1BMQB 7AT1B 1KS2A 2IVFB 1QD1A 5EWGA 2MQMA 3N79A 3P45B 1MU2B 2QA4G 2J7KA 2NZCA 1UVMA 4LF9F 1LW2B 2C2ZB 4KO0B 5G0RA 2G2ZA 2C3YA 3GPAA 4GO7X 4DF8A 3DM2B 3O1LA 3Q23A 4FKYA 1TL1A 2ZJPQ 2JWNA 1SJ3P 3C16A 1BWVA 5KT5A 5CZXA 1SJQA 1OSDA 4O4GB 4RU2A 1FA0A 4BC7A 2DNMA 2GO9A 3LP2A 3QT7A 1ZM3A 2HQ3A 1RAHB 2JNJA 4QJVA 2B9XA 3KKFA 1IKXB 2DO0A 2RQKA 4ZPDA 3BN4A 3JQMA 5JMNA 4DJBA 1MSWD 3FK4A 5LSRA 1B7FA 1TL7B 1VRTB 4LIRA 2AX0A 5D6GA 4PWDA 4KV8A 4EMDA 3Q8VA 1NH8A 2Y9HA 1M5OC 1JXVA 2PT0A 3LAMA 2YNHA 1X5PA 1AFIA 1MN7A 5M2UA 4LFAJ 3M30B 3G82B 1T05B 4E98A 1Q0NA 2JEGA 3SBMA 3Q24A 1WDDA 2JC1A 1UL3A 3PTWA 1U1NA 2LEPA 3U1MA 8AT1B 1UAWA 5FD1A 4L6V3 4KH0B 1HNZJ 4OHXA 3GU0A 1VR6A 2HFVA 4NL5A 2CQ4A 1JKHB 4ECRA 4J9UE 2APOA 2R2RA 3JB9k 3BO2A 1ZTTA 2DVIA 3DCAA 4DV5F 3M9MB 2ZNYA 4M5KA 3GCXP 4BLGA 4H4KC 4KB7A 1G7CB 2XSFA 3IR5B 5KOWA 1VRUA 1RE1B 3S01A 2AX1A 4OI4A 3UN2A 2EFQA 4DBQA 2ZITA 4PABA 2LQ9A 5SZTA 2Z2LA 4Q5VA 4ED6A 3KFWX 4K4XA 3J7YI 3DGPA 4R5PA 3PVXA 1HBNB 2YPZA 1R6YA 3CJRA 3BN7A 2W7PA 1HI0P 3AA8A 3CJTA 1IKVB 4R0JA 4KBIA 1UVIA 3D0GE 4ILRA 1VI7A 4F0MA 1TTHB 3AQPA 4LFCJ 1MN9A 1NH7A 1URNA 4UTGA 3R5DA 2B4VA 2DJWA 4YHHJ 4DV2F 3NKYA 5F41A 5CQGA 6FD1A 1RB0A 2W8LA 1XBWA 3Q8QB 2IRUA 2J6SA 4N76A 4O44A 4LR7A 5M2RA 4OI6A 3UD5A 2FYXA 5IFMA 2M4MA 3FCHA 4PEOA 3DLBA 3ZTPA 4ANDA 2AV5A 2BJ9A 1HNXJ 1XEZA 4E8UA 3MPUB 4CO0A 4HT7A 3MD3A 3PRVA 5LXYA 2RUGA 2RD5C 3PO5A 2DK2A 1WJ9A 4DR6F 2KU7A 2FPHX 1RHUB 4CO5A 4YY3J 4FPRA 1I1GA 1FRKA 5CABA 4B9NA 2Q66A 3PW2A 3NBPA 4HDGA 1Q53A 1R0AB 1XMOF 2B4PA 5HP1B 2B3TB 3RB3A 2CPZA 2HQFA 2MSSA 2DNPA 3THTA 5DJBA 1RKJA 1NSPA 1IKYA 1K47A 2DNGA 1HBOA 4C8ZA 2BDPA 4KHRA 2VDHA 3VALA 2J0SD 1JLEA 2NYHA 2RRNA 4ES1A 3LAKA 1C0UB 5J2QA 2DR8A 1JLGB 3FNNA 3N01A 4PRFA 2WSEC 3H2VE 4M63A 3W9IA 5L1LA 4LF4F 4B3SJ 4KJIA 3SCLE 1P9YA 2YKMB 5BR8F 2WVCA 3QGPA 2CJAA 2A6OA 3PW7A 1WF1A 3PY8A 2IM2A 2VKZG 4IOAQ 1X4CA 1TKXA 1RWVB 4ZDNA 3WX8A 3HJFA 1DARA 3AB4B 1AXQA 1VQ6S 3EPIA 3DRRA 4ZHRA 4MJKA 1TV6B 3OD2A 4YEAA 1LK7A 1QAJA 4RBUA 3H5SA 3HHKA 3HJVA 3J7A1 3QGHA 3LQVA 3ISND 3EXYA 3R2CJ 1NBEB 3VAFA 3FZBA 1R8BA 3R5JB 1RHKB 3DMJA 3GR0A 3PX6A 3VAMA 1FEHA 3O3LA 4FN5A 4PUOB 1TVRA 4P73A 1YITS 3ZNUA 5T41A 4AL6A 3CJKB 2DH9A 4CP5A 1UW9A 2HMIB 4EZ9A 1N32J 4H4MA 3KLIA 2BMBA 4V1Ak 3T1AA 2BE2B 3WC2A 2UUCJ 2E5LJ 1HR0F 2HHUA 1SKWA 3FKBA 1SUQB 2EW9A 5KFJA 1T03A 3LGHA 2ZOGA 5CYMA 2ZJRQ 1J5EF 4NMXA 4CO3A 4G6VB 3AFGA 2EKNA 2W2QP 1XTZA 2N3OA 2P2CB 4DQIA 1NK8A 3DRXA 1Y7PA 5H9EJ 4E2FB 2BKPA 1LQ9A 4R0EA 2DR9A 4B9TA 2V6AA 4OHYA 1VBYA 3CCJS 3ITHA 1Y9OA 4X4TA 1XIQA 1H7XA 1BGXT 1U8WA 3RBEA 3HHLC 2R3VA 3TYTA 3MM8A 2YNIB 4OX9F 4MFBA 3DYAB 3AJ1A 2LECA 4NLRA 3UE2A 4UOGA 4IG0A 1HBMB 2O1PA 4ZVQB 1X5TA 3HX9A 3GZ7A 3ONQA 4DV6J 2NXNA 1YZ6A 3ETOA 3AXKA 5LXRA 3OTDA 2HHHJ 4NYOA 2RJZA 1RTIB 1VC5A 1RWUA 1URRA 1YLXA 2NUHA 3EDQB 2YXLA 4B02A 2W1BA 1NPRA 1RTJB 4HL9A 3MEKA 2OI2A 1WKJA 3WHIA 1YI2S 2FJXA 1N33J 2EXUA 2IM0A 2PIIA 1NDLA 1UEUA 1AYEA 1BD6A 4JUZA 3SCJE 4M5NA 1RWNB 4OZ5A 4CLKA 4LJMA 2JZ5A 3DLLQ 4LF7F 2W9AA 4NPOA 2UU9J 1GEHA 1WHXA 2F4VJ 3PKMA 3KNGA 4N77A 1TFYA 4NLOA 3OHAA 2KFYA 4GKJF 1JXLA 1JJ4A 2HNYA 4GKKF 5CHCB 3VGTA 2R8IA 3LOUA 2ASJA 5E41A 1NZAA 4U8VA 1R3NA 1NHUA 3KHRA 2UUAJ 3OJSA 4FVMA 1TP7A 2F9JA 2ZZNA 2N4CA 3D6FB 4QW8A 3LWLA 1X5OA 4MAKA 3CDWA 1UTAA 4AT1B 4X4RA 2OD6A 1N36F 4ZKAA 3MFIA 2CQDA 3V4IB 4CCHA 5H9FJ 4USJC 1WHYA 2CNKB 4DI6A 4CDIA 2M88A 3VQSA 3N4WA 4DSLA 1K44A 5DM7Q 1WG5A 1RHRB 2V8GA 3C8YA 2O66A 1SV5B 1Z2ZA 1UVKA 3RUBL 3I82A 4H54A 4CLTA 3H42A 5HSPA 3JTNA 5KTQA 2BX6A 4LRFA 4JOUA 3JAMY 1XN9A 4EO8A 5K14A 1Q7YT 3CPWR 3OTCA 1H72C 2ZD1A 1NM2A 2RDIA 1YJRA 4TNOA 3KJVB 1CVJA 2FUG9 4DN9A 4CLPA 1SBRA 2RIJA 3GYNA 2R7VA 2VBYA 1ULRA 4RBTA 4IFYA 1OJ4A 4HACB 2V5HG 2R7WA 3PFEA 4UZCA 4NRTA 4A47A 2RQMA 2VV5A 2KL8A 5GAEI 2IYGA 1FFWB 3NEKA 3UR3C 2MZSA 2XSJB 5GAHI 4WFYA 1NSQA 2IRXA 1ZA1B 5E0OA 2GFFA 3Q0AA 3TA0A 4ID5B 5K8PA 1RAFB 4LFBF 4NEZA 2YNFA 2IRYA 2R8GA 1YJWS 1PCAA 4WP8A 2ZOFA 5KFMA 4U8YA 3CTRA 3QWUA 5DG9A 3D3CJ 1FE0A 2J76E 4NX9A 1PGZA 4OMFG 4Y6IA 3K5LA 1YKWA 2HQGA 5EWFA 1WC1A 1TR0A 3NWGA 1CJUA 3UW1A 3CE8A 4IRKA 4DLEA 4F04B 4A8QA 1U26A 4WIQA 2GIRA 4DL0C 1NJIT 2XB2D 1TL3A 2LU2A 1MWYA 1HWLA 3SDEB 1VQOS 4P2XA 3C6UB 2XLIA 3CD5A 2V4JA 1CJVB 5D78A 5HLFB 4KFBA 1SC6A 4XPEA 2H65B 4B3OB 1FJ7A 1FEEA 2AJFE 1NUEA 1FRLA 4O0NA 4Q7AA 3M2VA 1OY8A 2KZMA 1NKCA 4N7TA 3TANA 4QR2A 3FJ2A 1I5OB 1YRUA 2VPYB 3T5KA 2H54B 2L08A 2XGQA 4GVBA 4UQTA 2C2MB 4CYUA 4JBCA 1NU4A 3QMQA 3QJJA 1SJRA 4Y2AA 1EJ7L 2VB6A 4CT8A 3ENAA 1FK9B 4YR3A 3FFIA 4ZVSB 4DR7J 4ID8A 3ZZTA 3AOBA 4ZPCA 4GC7A 2FJWA 3KK2A 2LXFA 4I68A 5LSOA 1R7IA 4X4QA 3MAQA 1N34F 3IA0A 4R25A 2DHSA 5IQ6A 1X8DA 3IRWP 4X2BA 4HI1A 5DETA 4CH0S 2QL7B 2IDEA 4FF3A 1Q8LA 3QT5A 4GRSA 2V67A 4DL5A 4C2MA 3C19A 2HHTA 4OZLA 4IR1A 2E29A 1OQ3A 2ZBPA 4LF6J 3EZOA 1TKTB 4ZPTR 3I9ZA 5J2MA 3ILLA 2F40A 5I3UA 4PXBA 1KFDA 4EZ6A 3DLGB 3DNCA 2J0WA 2YY3A 5KG4A 3OSNA 5CYQA 3PX4A 2MB0B 2XM3A 4FYVB 1FWLA 4FNIA 2W2PP 4NI2B 2G4BA 2YX7A 4RW6B 2MY8A 2JVOA 3M1VA 3MCMA 3BGRA 4P9SA 2CXEA 3MM9B 1VQ8S 2J6UA 2VODA 1TFWA 4U95A 4F4KA 4DV1F 2LQ8A 5HMYA 4ENOA 3OXFA 3T1YF 3GJQB 5AJ3J 5DS7A 4DZDA 4QYZK 1Q8BA 5KFYA 3IBFB 3W9HA 3KDNA 2U2FA 2OSRA 2ACMA 2V2KA 2YVSA 2BV3A 5HROB 4OYOA 2VBXA 3L95X 2GVZA 3TI0A 2Y3YA 1Y5NB 4ZLNA 2HYIB 1NB2A 2I5JA 1BC6A 2EC0A 1ZPWX 1WWHA 2MHNA 4YB6A 4ZP6A 3ZNJ1 3V81B 3ZC4A 5C7PA 3KLEA 1VQSA 2H5IB 5HI7A 5HAOA 2QMXA 4F7VA 3VAGA 3JS9A 2E66A 1ZAWA 3PCOB 5LMNJ 1EX8A 1M1KT 2N7CA 3I9V9 4F3MA 4G1QA 4DCJB 4KPCA 2M7SA 1WG1A 2C3UA 2CJKA 4CI0B 1IJEB 1SQFA 2D9OA 2BQUA 4K8RA 2IHR1 4XIUA 4F4YA 2CA9A 4ZPVR 4YN3B 3K89A 2MQ8A 1QUVA 2A10A 4NA2A 4NXMJ 1RUSA 4KGKA 2N7YA 4M5HA 5ETSA 4CLFA 3TJ9A 4RPFA 1FKPB 4ZVFA 1X0FA 3AA9A 5JVHQ 2JDJA 2BJEA 4KKOB 3DLJA 4BWJA 4QIEA 3MECA 2CZVC 3W5YA 4RBVA 2HFZA 3TZYA 2YWKA 1MU2A 4QWDA 3NS6A 4WCEQ 1N0UA 2YX4A 1BXNA 1LW2A 2DNKA 3DM2A 3R7BB 1PIEA 1FJGF 3E51A 1RT2B 1X4GA 3B54A 3CIMA 4R8UB 4PXCA 5ETPA 4J9OA 1YJVA 2KM8C 4O4GA 2FGOA 5B0AA 1JLFB 5IOLA 2DB1A 1REGX 3KJQB 4OX6A 1ITPA 4DV3F 2NXCA 3BJYA 1WC0A 3ET6A 4NCGB 2R7UA 1G1XA 1UKUA 3CIZA 3HULA 1XC9A 1RHQB 3DRPB 4DFKA 2ZWOA 2MQOA 1XNRF 4WF9Q 3BZQA 4J9KA 3V6KA 5E3QA 2MKCA 2ZBQA 2GQ2A 1VRTA 1GH8A 1XK8A 4Y3CA 4OHWA 2R7QA 4C4WA 3PRDA 3ADAC 1S6PB 4LQ9A 3MD1A 2OSQA 3R6GB 1GMWD 1LOUA 3H5UA 1L3KA 1WEXA 4D3GA 4HVZA 4ECUA 1Y00A 1T05A 2WB4A 1HARA 5CH7B 2NUUG 5F8JA 3MF5A 1NO8A 3D4JA 4X62J 1DQ8A 1TAQA 1U25A 3U7JA 1FX4A 4KR0B 3IS9A 4FF1A 3A8IA 2EC2A 2FJBB 4MKVA 4PR6A 2VASA 4XDCA 4RNNA 3QPIA 2ZBRA 1UJ5A 1HW8A 5DQHA 1LFPA 2M2BA 2YKOA 3IWXA 3BM7A 4B9UA 2QEXS 4QIVA 3BR8A 4KGZB 2DNQA 3K7RA 2KXNB 3JSMB 3IWLA 2W4PA 2HNDB 4MIAA 1AUDA 4DV4F 3LW5C 2AJ1A 4DWIA 2KRRA 4F67A 4JB8B 3AD7C 3P4UB 1K0TA 4DZ6A 3W2WA 2YQ0A 3K58A 1HBNA 1KBRA 3DRYA 1S12A 5A0YB 4DR4J 4Q8FA 3C2PA 2Z2YB 1IKVA 2ALZA 4KGVB 1LWXA 4ZLPA 2ZNZA 2ZHBA 1M5SA 1JJ2R 2X3GA 2CWXA 4F25A 4OLOA 4I7FA 3F73A 2ZWPA 3CJSA 3F44A 5B0BA 3EGZA 5KOXA 3CCWA 2NXEA 2FJEB 3OUYA 3KLGB 4AL5A 2CADA 4KHMA 3VCDA 4XTTA 5HVHA 2ATLA 1SXLA 4DPTA 3LPYA 2J7WA 1S0VA 1S99A 2A18A 5L9XA 1JXEA 3O2IA 4I2QB 4C48A 2CPFA 2ZE2B 2HIYA 4DCOB 4C8NA 3QSIA 1MROB 3A3OB 2OEKA 3IR7B 1UWBB 1CULB 2IFXA 5U47A 2Y8YA 2ALYB 3H2LA 4LSNB 4M1KA 5KFWA 2UUTA 2B43A 4DR2J 3GSDA 1FRXA 3CCZA 1LW0A 3OTBA 3N5BA 3I5CA 3KJNB 1WTBA 1LV5A 2UUWA 3TR5A 3Q22A 5J2NA 3H4BA 4RW7A 3PJ9A 3OTOF 3ZZPA 3FSYA 4UUWA 4KGXB 4ZJLA 3FCVA 2OPQA 5IWAF 2RF2B 2DXFA 2CQCA 2GIQA 2RH3A 1F3FA 1UJ4A 3HVWA 3QYYA 5IM0A 3HMJG 4QPXA 1IBLF 2CPIA 1VLYA 1RQ0A 4U96A 3MCSA 3W8PA 3EXCX 4C8YA 1TL1B 1C0UA 1JLGA 5C42A 4M5IA 2UVVA 2ZM6F 3IM8A 5KFLA 1QAIA 3GONA 3M6UA 1DAXA 3CDEA 3U27A 1SH0A 1DFDA 1S6QA 2Y8WA 3POTB 3QT6A 2DGWA 4NLPA 2JL9A 2LCWA 3O44A 1F1BB 5DRKA 1R8PA 1S6OA 3LH2S 4F4ZA 1GMWA 2I8EA 2XZTB 3DGVA 2VA2A 3CW2C 4UOHA 8ATCB 3EVMA 4KV8B 3O8WA 2HIQA 4I4BA 1TV6A 2CPJA 1L3TA 1FDNA 4K4WA 3Q86A 4RZRA 1B99A 3G71S 2YNHB 3CD6S 3LGMA 4DSFA 5LT5A 2HK2A 1S7HA 3W5ZA 2OEJA 4C8KA 3IBCB 1TELA 3OVSA 1RWMB 1WSRA 1B64A 2XZWA 4EFAC 2ASDA 4GVLA 4NYPA 1FI4A 2VBWA 1U6ZA 3BH6B 4URSA 1GNKA 3OL8A 3RRKA 1CQMA 1OY9A 4AYBD 4PUOA 1HMVA 4IFVB 5K8OA 2YQ1A 3CMQA 1NNDA 3HHDA 4ZOSA 3CJKA 2KT5A 1WG4A 2EFGA 2HMIA 4IDKB 2JEJA 2YWGA 3ETMA 1OYDA 1VRUB 2BE2A 4FPIA 1N5YB 1SL0A 2IC3B 3TUIC 1PJ5A 1T9YA 5KFFA 1WORA 1SUQA 1RWKB 4LF1A 3GJRB 4CTAB 1F2HA 2ZKUA 1VFJA 2QG9B 4YDDB 3M32B 1JLAA 2RSQA 4J9QA 1XMOJ 2KRBA 2LQBA 2ROGA 2XULA 4ECVA 3DGPB 4DR5J 4R5PB 4K4SA 2E44A 5IT0A 2UXDF 4OYIA 2KG1A 2W8KA 1UFKA 2V8VA 1U1KA 3CVKA 1IWAA 2MMYA 2FHJD 1OYEA 4FYYB 4I69A 3SV3A 2CWKA 2DRDA 1T7PA 4QCLA 1Q5VA 2MYFA 2JC0A 3MMCB 2GNKA 4C0BA 2XQCA 3OBIA 4YB5A 2DGVA 4ZMMA 1Z4UA 3BKUA 2ADCA 3HCXA 1RT6A 1MWQA 2RDJA 4JI5F 4A4JA 2YNIA 5HQLA 1ZM9A 2J7UA 2B9EA 3R1LA 2GAGC 2C3MA 2V4RA 2PMHA 3JXOA 4PG4A 2NPFA 2JJ4D 5IT9U 1U0HB 3CCLS 1X9WA 3UDEA 1Q16B 5DDRC 1U4BA 2A0FB 3CF5Q 1HBUB 4DV7J 1BUXA 1WKLA 5GVQA 5GAHU 3TAPA 3FBEA 4J9NA 2F8EX 1NHVA 4UY85 1KQKA 1RTJA 3MHYA 5EN1A 1F9EB 2VU5A 4RW9A 1IKWA 3O6QA 3R5BA 2WONA 2FVSA 1EARA 4B3MF 2DNLA 5DDQC 2Z56B 4TKTA 1S4EA 4C8OA 4YR0A 2RB7A 2E7WA 3UR0A 1F5BA 2YBVA 2ZDOA 2HQIA 2DNHA 2G9OA 3R9LA 4CLZA 3B8HA 2HHXA 1MWZA 5ETVA 5C5JA 3BGLA 4LQ3A 1IKYB 2BOPA 3CMAS 1F60B 1HBOB 4KYZA 1N6QA 3UCUP 4DSJA 1JLEB 3VAIA 2DYAA 3W7BA 3FMBA 5THWA 3TQEA 2E1MC 5I3PA 4A8KA 4CLYA 4QU6A 1J5EJ 2QLXA 5L8RC 3SFUA 2A2DA 5E2QA 4DR1F 1HD0A 5DZ6A 3QFHA 3RAQA 3LO3A 4NLQA 3ELHA 2XO7A 2MZRA 1S9EB 3G8SA 4Q2MA 3ZXWA 4RUCA 1KONA 4QOTA 2F8MA 2IA6A 3UDCA 2E1RA 2R8HA 5F8GA 3P5BP 4URQU 3PXGa 1SV5A 3H7HB 3R5CA 3NNCA 5A8WA 3GFXA 4ZK7M 1B0VA 1HFEL 1FTCA 2D69A 3EWGA 3W5XA 4LF8F 2I6WA 3RU0A 4NASA 1X4HA 2Z30B 2L9WA 4FBTA 2OPPB 3WBZA 4EI2A 2R2UA 1S5ZA 4FYDA 3DMJB 3KJVA 1EKRA 2NYIA 1CJKB 1SPBP 2YNGA 4J9LA 2H9ZA 4DHVA 1SL1A 4CLSA 1FD8A 3JQKA 4KHPF 3CGIA 4HACA 3MR5A 3THVA 1T11A 1YBTA 2IVYA 3BGUA 2HNZA 3C15B 3FEZA 3VQTA 2XSJA 4J9RA 1HPZA 4H4MB 3M4XA 3UCGA 3DDNA 4QQBA 2B4OA 3MEEA 1OMSA 4ALZA 1IBKF 5C24B 4ID5A 5CD4H 1U2CA 2D3ZA 1T03B 1N48A 1RK8A 1NPPA 2JHEA 1XNQJ 3QJLA 3T19A 1TQLA 5KFQA 3CCTA 4QIWD 2M70A 3VWSA 4B9VA 4P2FA 2J9CA 3TNVA 2HBYB 3KG1A 3RB0A 2CG4A 1Y0HA 2AJ4A 1PYTA 4MH8A 5DZ7A 1FKAF 2H4WB 4J5OA 3T9ZA 1X60A 2Y0SD 2QMUB 3KNAA 3HD2A 4K5SA 1MLAA 3KUGA 3N9UC 4ECYA 2A6MA 1V9OA 4CNZA 1DLOA 3DI6B 2MTLA 2XMKA 3C6UA 4UW2A 1WSVA 1KLMA 1CJVA 1TMJA 1YDLA 3OPKA 5HLFA 2YWEA 3ISZA 4K2XA 3AJDA 3TJ8A 3SQOP 1JLBB 4NLYA 1PBAA 3QJPA 4B3OA 3Q8RB 1G3OA 4CZCA 1DQ9A 2OLWA 1HHTP 4IYQA 2UP1A 2WRMA 2CG8A 4TQSA 2GQQA 4JI8F 3LPEA 1YBAA 1QDUB 3T6BA 4RWXA 1RT1B 3G4SS 1YBUA 4OZ1A 3Q2SC 1QVFR 2V68A 4IRCA 3HDSA 1VIOA 4N8OA 1VQMS 2CYYA 1S1UA 4NOHA 3CJ8A 5AE1A 1KD1T 3LA0A 1FK9A 5DGBA 4OX7A 2BW2A 3J80U 1B3TA 4W98A 3TUJC 3W62A 1C4AA 2XS7A 4LVOP 3HD1A 4B3TJ 2CQBA 2CQ2A 3JSRA 5AXNA 3IGNA 2QA1A 3EUNA 2FB0A 1GXUA 2CVIA 4NLGA 4RLEA 5LMUF 1QY7A 4P75A 1EAYC 3NCQA 1MW7A 4MIWA 4ELTA 2AGPA 3O5TB 2BW7A 2KYXA 4HEA9 3PG9A 4LFBJ 1TKTA 5L46A 2HHQA 4DU7A 1YJ7A 4ES3A 1K0VA 5D15A 3HHEA 3DLGA 2YKQA 3OLBA 4X4PA 4JYAF 3BSNA 3DXBA 3K5OA 2IJNA 1U0SA 4G1IA 3GG1A 2Z2MA 4RW6A 3HXMA 2YKPA 2P9EA 2Y1LB 3MM9A 3TAQA 2OIHA 1APSA 5KFCA 4JI4F 1WC4A 2G1HA 3T1HF 2VA3A 4FS2A 1HQUA 1U49A 5B0FA 2ZH3A 2QFJA 3G9CA 3EMTA 4NZ6A 5K14B 3NY0A 4RW4A 3N5FA 3PFOA 3SYZA 1IN0A 3EGNA 1PKUA 2KKHA 2HLUA 2XWYA 1B70B 2ZD1B 5K9FA 3MR3A 3H90A 3LP0A 2F4FA 3GTYX 1V3SA 2RMLA 3RBZA 2LMIA 2CJBA 4IFYB 4USIA 5KFSA 1S72S 4DX6A 1H38A 3H2UB 3HZEA 4MMOA 4P2MA 3BQ2A 2HFOA 2LKZA 3V81A 2R9LA 2QLJB 1PAEX 3C66A 4I2PB 1U1RA 1TK5A 1C0TB 1HQ2A 2W7AA 3HVTB 2VONA 5HO4A 3C3LA 2YNFB 1JLQB 2ZEJA 4NLUA 3R1HA 3UDLA 5KFIA 1OIAA 1N34J 4QR0A 2AWZA 3MPVA 2EG2A 2HBRB 3K59A 3MFHA 3PIPQ 2BOAA 1FWPA 1Q4RA 3HM9A 2L9NA 4C97A 1CJUB 1QTMA 2VQFF 3Q8PB 1UETA 4LBPA 5A2QY 3E8OA 1D3WA 1VRQC 4JI0J 5D0HA 1H6KX 1P1TA 3ENVA 4DPWA 1KOHA 2VG6B 4FZVA 1FKPA 1O8BA 1ZBTA 5KG5A 2W4CA 1N5SA 3CT9A 2BZ2A 3NL0A 3M6XA 1JMTA 3UNGC 2J8SA 4CWBA 4DPUA 2V4JB 1GT8A 1SQGA 2BXJA 4QWBA 2DRAA 1MG7A 1QAYA 2LP4A 4K2JA 1UPMB 2KTQA 2I1RA 3ZFVA 1KNZA 4PPDA 4O3OA 1RT2A 4R8UA 4B3RJ 2FD2A 2POKA 2HFNA 3WIUA 4RJVA 3UWTA 2RT3A 3M2VB 4EK2A 2C2OB 1AA1B 4LREA 1JLFA 4ED5A 1JNZB 2WVBA 4OIXA 4RUAA 1TUVA 4ERDA 1YWXA 4GVBB 4TVAB 4NCGA 2YWWA 4DV1J 4CYUB 2V8HA 2IAJA 3DRPA 3LF0A 1YHQS 2MDAA 1VBKA 2E7VA 2V4QA 5F8IA 4U9RA 3D6MB 2OEMA 2P6TA 4FXWA 2DH7A 3GSIA 1VQKS 4JI1F 5GADU 5KFRA 4NZ0A 2PI4A 2E5IA 2X1FA 1VCTA 3U1NA 1S1TA 5F3TA 2CJ9A 1KQFB 1G4CA 3GE9A 2IJRA 2RDDA 3AXMA 4LFAF 3M8QB 4OYZA 2DGXA 2GS8A 3PM9A 2XMJA 2EFNA 3UQSA 2VJUA 3BQ0A 1NK9A 3RZAA 2BBEA 2RILA 1RBLA 3SV4A 3UVJB 1HNZF 4C9DA 1RAJA 3ULHA 2CQIA 4C8LA 5J2MB 4JI7J 4AXIA 2J9DE 4TY9A 1M0SA 3V6DA 1DURA 5I3UB 4FYWB 2NCKL 1FERA 4USUA 1EQMA 1DTQB 2MQPA 1VYAA 3IBWA 3DLHA 3SEOA 2J8AA 4Y0FA 3DOLA 3T5HA 4FF2A 4LMZA 3M1VB 2VL1A 3BBCA 3JSMA 1LNQA 3BGRB 2HNDA 3IAS9 4DPYA 4F4WA 2UVRA 3D3BJ 1HNIB 3GP9A 2H51B 1YRTA 1EP4A 4I64A 2M3DA 3ZZOA 3OTEA 2VOPA 2MKSA 4O3PA 3JSYA 5A0YA 5KT7A 3W60A 5A6PA 4PZVA 2DBBA 1BQNB 4ETXA 2ZH4A 1KFSA 5ETOA 2HS3A 2BJDA 3NGRA 3CB4A 1ZPVA 3KLGA 4X64J 3TA2A 4A8SA 3KHHA 4J90A 1RKIA 4YHHF 2Q43A 4PG5A 3OXGA 1VQPS 4W4MA 4MIBA 2PD1A 4Z2XA 1F6TA 2MKJA 4I2QA 1CC7A 3PX0A 2NQPA 1ZETA 1VJQA 4IOBA 2W2MP 1I94J 1UWBA 1CULA 4G1QB 2Y1JA 3J7ZT 5HANA 3TZWA 1S48A 2XO6A 5KFZA 4ZN3A 2AGQA 1HNXF 4F50A 1I51B 4MTPA 4TYAA 2ASLA 4DUTA 1UW4A 2HW3A 5KG0A 3NS7B 4WP3A 1Q81T 4DQPA 5A8KB 5DQGA 2AZ3A 3Q8SB 1UZHA 4YY3F 2WVFA 2HZVA 2M8HA 1OQ6A 4BBYA 3OSPA 4NA3A 2IM3A 3BEGB 2V2VA 1UVLA 3CSKA 2OAUA 3MECB 4Z7YA 3S8SA 2JLGA 3PEJA 2LQ5A 2HVHA 1T9TA 4O3RA 2VBZA 5KT3A 5J1EB 1JX4A 2AJ2A 2M0GB 2H1YA 2LFVA 3NCRA 3M6VA 1VQ7S 3GFYA 2O67A 4ED8A 1XR6A 1W26A 1R8AA 1BHNA 3NAHA 3Q89A 1R27B 3PJWA 1KWMA 3RW7A 3ET6B 3IC1A 2QO3A 2X3DA 4B3SF 1T02A 1N4LA 3POTA 5HN0A 3OR2B 4IQXA 2WBRA 4OLPA 4ZCLA 4DUYJ 4Y2MA 1FKOB 2YPYA 2OHDA 1U48A 2C2DA 2F9DA 1MMDA 2HZCA 3RRGA 2DEIA 2M8DB 1RAGB 4QW9A 5D0GA 3R3TA 4KT0C 4NCAA 4C0OC 2Q1LA 3V5RA 1M90T 1EETA 2QX0A 4U7CA 4ED7A 3D6TB 1WOPA 1HWUA 2D1CA 4NXNF 2PN6A 3VGSA 2SXLA 2KG0A 2QSFA 1N88A 3MEDA 1RTDB 3HKZD 5IS2A 5IV3A 4WTOB 3IS9B 4FKXA 3MWBA 5KT4A 2NZ4A 4IFVA 3CUNA 2N3LA 4OYMA 1TKZB 4DS4A 1J2VA 2ZH6A 3ZZUA 2C2EA 2J0XA 3BR9A 4IDKA 5D4NA 1SKUB 1N8RT 3HVRA 1EZZB 1ZAVA 1N5YA 2IC3A 4P2SA 4WKRA 1FCAA 2HWHA 2E5LF 2MXYA 2NR0A 4CTAA 5DLFA 3LP1A 4CH7A 3M32A 3MM7A 3M9OB 2H4YB 4WZMA 5LM7E 1YJ9S 4OI1A 4KSEB 3GIIA 5FJ4A 5IT9Y 2C2RA 3W2WB 5ITHA 4ZITA 3E2EA 1IJFB 4ECXA 4WU3A 2WVEA 1IM4A 4P7TA 3W2VB 4MYUA 3MMCA 3MR7A 4KC5A 2FJVA 3NCPA 3UD3P 1NMEB 3KHGA 4I7FB 1Y10A 5B0GA 3M2RB 5IC4B 2QIFA 1KQSR 3IG1A 3OUYB 2KHDA 1VS3A 4WTYA 4N8NA 2D3O1 1NK4A 3KUEA 2VZ9A 1L5UA 1TUGB 3JTOA 1M5HA 1U0HA 2AGOA 2Q79A 1SJFA 1FT8A 1T9VA 2O01C 1HBUA 3DU5A 3T3FA 2HHHF 1RDRA 1QE1B 5I3QA 2EFVA 2GX8A 4JI2J 3ZTQA 4DOZA 1FXDA 2HGMA 2WB1D 1RCOB 5CZVA 4AD6A 1N33F 2CPYA 1LW0B 5HMZA 1RWXB 4XK8C 2R7RA 4K0KF 4OQJA 5J2NB 1L3SA 4RW7B 5E3AA 2OPQB 2UU9F 5AXLA 4WFZA 4A8FA 2F4VF 3IP0A 4RNMA 3VZIA 1FFSB 2RHSB 3PW4A 1TU0B 1SJ1A 5IM0B 2PSZA 2PFDA 1WNEA 2PMZD 1D8ZA 2AYMA 3FC9A 2BM1A 3F56A 3D1QA 3DXSX 2P9GA 5C42B 2V69A 3NMAA 2UUAF 2PDAA 4ZLLA 4L74A 2EK1A 4YR2A 3QO9B 4C11B 2DHGA 1RI7A 4DQRA 2LXIA 1JLCB 2AU0A 4ZJQA 1S6QB 3RW6A 1J27A 3GIJA 4WWSA 1S9EA 3HSDA 2MGZB 2Q6CA 1K1SA 2JEFA 4DPXA 3OV7A 4DX7A 4EUVA 5F8MA 1SIWB 4ANCA 2W9BB 2NREA 2UXBF 3R5GA 2CNNB 1U47A 3M8WA 4QWAA 1UVJA 1TL4A 3BDEA 1FX2A 4ANEA 4FXDA 1VISA 3ZZZA 7FD1A 4JI5J 1XQIA 3HVAA 3IXQA 1YSJA 1ZM4A 1P6TA 4JV0A 2OPPA 3R7SB 2WVDA 4M5JA 4LRCA 3VGUA 2FDNA 2YKAA 3AT1B 1V3RA 3CJ0A 3EICA 1CJKA 4ZPAA 3VAHA 3I0SA 4FNHA 1HMVB 3BSAA 1YK9A 2PO4A 2F65A 4EYIB 5K5MA 1S1VB 2VFVA 2Y0BB 3SSQA 1YRXA 3C15A 3SCKE 2AQ4A 3MM6B 2CZ4A 2IDLA 4J9PA 4MYTA 4DSEA 4B3MJ 4EGLA 1NRKA 3L7PA 5C24A 3UFCX 3GB0A 3QBCA 1VQNS 4W92B 2R7SA 4UY8T 2XLJA 1KKHA 1JLAB 2V34A 5IC6B 2C3PA 1BQMB 1NJXA 2DNOA 1WHVA 2W4DA 1EKSA 2XMUA 3BF4A 2QC3A 4P74A 1S0NA 1O0PA 3K17A 4JI6J 4ZVOB 1RT4A 2DXEA 3D7SB 1QSSA 4OV1A 1C1CB 3RJMB 3OL6A 1AROP 1IM6A 2MKHA 3KUHA 2HWTA 1P27B 2R8KA 3N6MA 3L3CA 5KFDA 1RT6B 3CXCR 3IN5A 3DI6A 4QBUA 3WZ0A 5ETLA 1SC1B 3PHEA 2FLNA 2W2OP 3J80Y 2MJNA 2B7BB 1HYSB 1FJCA 1JLBA 4MKYA 2FHOB 3SQGB 5KFKA 2HBQB 4AL7A 3FVYA 2QA4S 1FJEB 1X7VA 1T3NA 4HHJA 2J9EA 4X4OA 1NEEA 1PJ7A 3ZTRA 4A8XA 3CCQS 1V3ZA 3BO4A 2CVEA 3QFWA 1RT1A 4C8MA 1JK9B 4ELVA 4NEYA 4LF8J 3DOMB 4RW9B 4U6PA 1IKWB 1VQLS 2GJ2A 2WONB 2V63A 1YTYA 3R7NB 3RBXA 2GGPB 4QIFA 1QLNA 3TJAA 1DY3A 5KG7A 4J9VA 4JV5J 1HHSA 2M9KA 3PDNA 3W61A 3MUMP 2GJFA 1C4CA 3W1YC 3AD8C 4DR7F 3QLHB 3D66A 1OS5A 2C2NA 1PG5B 1X31C 3GR1A 2DO4A 2HGLA 3HF5A 4ZCKA 1RYRA 2PC6A 1N6QB 4KY3A 2AMCB 3NP5A 3A1YG 3OHBA 4G3IA 2ZH9A 4HTJA 2CIMA 2M52A 3MMJA 2F8HA 4QYZJ 4DR3F 3TARA 5RUBA 4OX8A 3HKWA 5K8MA 1ICEB 3VAJA 2R7TA 3LGNA 1H7WA 4DUZJ 1PYSB 4IG3B 1S57A 4NE9C 1V5VA 3LTOA 4XAKA 5GMDA 2KM8B 4I6AA 4OV6A 3CC7S 2GAHC 4X65J 5KG1A 1GXTA 4NCBA 3KLFB 5A8WB 2FQQB 3F41A 1L3VA 1CSJA 3I0RB 4V19J 3T9NA 1LWEB 1FVSA 5J2PB 2CQ3A 1VDHA 3OL9A 2KI2A 1KDNA 3W3SA 2PEHA 3WQPA 2CUYA 2GC8A 3TZZA 5T14A 5I4MA 4A8OA 1RAIB 3K5NA 1BE4A 5DGAA 1PAUB 2YNGB 4ECQA 2YWFA 4WIIA 2FC9A 4OI2A 5D4OA 2FY1A 4UUXA 4YFUA 5KFBA 2B4UA 3A8EA 3UI3A 2DR5A 2M5YA 1U45A 3IO1A 2D74B 2HNZB 2KZZA 1VGYA 2H3EB 4IH5A 2IM1A 3RG6A 1HPZB 4I2PA 1DZ5A 1LWFB 3NGSA 1C0TA 2ZJQQ 1IQZA 3MEEB 1UJ6A 3HVTA 2XCAA 4A8MP 1X4AA 1JLQA 4CM2A 1F9FA 3FZ2A 2VC0A 2HRTA 3VZHA 1J5OB 1RHMB 5AXKA 1KRPA 4NLXA 4RNFA 5L9NA 3TQ1A 4H4KA 1QVGR 1SVDA 5T7LB 4F3QA 5LMUJ 1FO1A 5ETTA 3V6HA 5KFOA 3ZZYA 5G4DA 3HSJA 2VG6A 2B6AA 4JV1A 9ATCB 3PZPA 1ZZNA 1DLOB 1W25A 2GMHA 2R2TA 1H2VZ 5HL7Q 2VG7B 2HAFA 1KLMB 2WCXA 4UOCA 2MLYA 1B4SA 1T9XA 4I1TA 1N54B 3KK3A 2KYZA 1E6VB 5AE3A 1XERA 1AT1B 2XYGB 2VFTA 1LFWA 3BSOA 5CXTA 4GMKA 1FWKA 4AQYJ 2K2PA 2K8GA 1A9NB 2UXCJ 2FVRA 2QV6A 1KOOA 3K8WA 4L3KA 5F3ZA 4JI4J 2RU3A 3TUPA 2VQEJ 2AHOB 1UWAA 1S1UB 3OFGA 4C3KA 4HYKA 3HHLD 4WE1A 1U1QA 1YVFA 4ED4A 2MZQA 1GTHA 2ZUAA 4LRDA 1UA0A 2E7XA 2LEBA 2F5GA 3TVKA 4NLWA 4ED0A 3BGOP 1N0VC 2MHEA 2F63A 2Y1IA 2PA8D 2BQRA 3G8QA 4P7VA 1NLKL 2JH3A 2QSWA 3OT9A 1NK7A 4ZVGA 1IBMJ 4A8YA 3VVTA 5I42B 3J81U 2EWHA 2CNOB 4X66J 4URGA 1X4FA 2P5VA 4K50A 3M8QA 2XYPB 3L7UA 3Q8YA 2BEFA 2KXHA 4ZVEA 1RT3A 4UZBA 1RABB 2U1AA 4USKA 3BQ1A 4DSIA 4X62F 1KHWA 2AZ1A 2DY9A 5D3GB 3UVJA 4L73A 1HW9A 4PWUA 2AKWB 3CDAA 3MTJA 3FSXA 2XYHB 1R0BG 2DXDA 1DTQA 5IXUA 2AEJA 3AODA 1WTFA 2VFUA 2XMMA 3EYZA 3K5MA 1X4EA 5KFPA 1WI8A 4B9LA 3UN5A 1X0PA 4WK1A 1PO6A 4DV0J 2KO1A 1UA1A 1D8YA 1HNIA 2DHHA 1S49A 4KQZA 4TU9A 2HKEA 3CJQA 1TAUA 4A48A 3PW0A 3KOAA 3D5MA 1HQUB 3KK1B 1H74A 2H5EA 1ACMB 4O0IA 3CMES 4RW4B 3OXLA 2HG4A 3QT8A 5H1SV 4Y2KA 2AP6A 2DRBA 2RUSA 4DR4F 4NLDA 1RA7A 3LP0B 2BKNA 1BQNA 4XPCA 4YB7A 2QZ8A 1P9QC 2LEAA 1K73T 2E1PA 4L75A 3ISNC 5D4LA 5KFXA 1RTHB 4ES2A 2HFSA 1GFWB 5A6WA 1CJTA 5F9NA 1ZA2B 3M6WA 3C46A 4USHA 4ZP8A 3M05A 3QGIA 5JVGQ 1ROFA 2RQ4A 4C3MA 3MTKA 5EX3A 3H4DA 4K4VA 4WKYA 1DRZA 4OZJA 4JI1J 2VD3A 3LALA 3CC4S 1CS4B 2O5DA 1FRIA 2GHPA 2W01A 2FJDB 3EZUA 3GYGA 1Z2LA 1UFLA 1VQYA 1S77D 3CCMS 1RZMA 5B0DA 2FIUA 3J7YU 3FEYB 4DR2F 5A8KA 4EWTA 3GJTB 5DLGA 1OY6A 3G6YA 1WHWA 1O6XA 2AEFA 2MLZA 2RQCA 3CCUS 1HNVA 2O3DA 5BYRA 2DY1A 3KLVA 2B9YA 3L4BC 4BS2A 3M8SA 2W7OA 4P6QA 1G2EA 3D0HE 1U1PA 2MQQA 2I9SA 5GAGI 5J1EA 5EHHA 4LF5J 2RHQB 3K57A 4TU8A 3GFZA 3FQKA 4CH1A 1KR4A 3U02A 1HNWJ 4OI3A 2ZVSA 3MI7X 3D1HA 4M5LA 3HHLA 4N41A 3PNIA 3TA1A 4L72B 4TY8B 1HWIA 5A2QU 2IAJB 4PCQA 4ZCIA 3OR2A 2QMWA 4QWEA 4HT5A 3MUTP 3I31A 1FKOA 2ACYA 1O51A 1S9FA 2QTWA 3L7OA 2E1AA 4RNOA 3ILOA 2CQ1A 4EBDA 5JJBA 2UV8G 4PKDB 2XNQA 1WDTA 3AQOA 1S1TB 1WC5A 4C6AA 5KFVA 4ZN1A 4RL1A 4WXOA 3QRPA 2RAQA 2L41A 3IM9A 3VV2B 2Y1RI 4FF4A 3HHNB 2KVQE 1RTDA 3M8RA 5LJ3Y 1RBOB 2LA6A 5KFUA 3H98A 2VFRA 2R7OA 1IBCB 4RUHA 4CO4A 3DLKA 1Q86T 2A2CA 4ZLJA 4O3NA 3CCES 3US5A 3V6DB 5KFAA 3HP6A 3PYDA 2IBOA 2HVIA 1TKZA 2KXFA 3D67A 2E9ZA 4ZA1A 4QYRA 2CPEA 1S0MA 4RWWA 5EX0A 3X3UA 2QLWA 1LXNA 2H5JB 2C28A 2LA4A 2OMLA 3DOLB 2JFDA 4QZVB 2UUBJ 2OTLS 4TLQA 4FXVA 5F8HA 5BXIA 2NXJA 1R31A 2WW8A 1D09B 1EP4B 4I56A 2DNYA 2GZOA 3IRXA 1EIYB 1XR7A 1SJ4P 1M1GA 4DR5F 2YH1A 3KG0A 2PE8A 6FDRA 4LF9J 1RAOA 4AE5A 3W2VA 2KFNA 1Y4ZB 3M2UB 2JX2A 2FTRA 5F8NA 2VHGA 3OR1B 3M2RA 4B9MA 2JRSA 2X1GA 3DLEA 4USWA 2FVPA 4PQUA 2XEXA 2NXUA 3FCWA 1RLDA 3NGDA 4WXWA 1KVIA 2C1EB 2EK6A 4DU8A 4I0WA 3ZZ0A 2KDOA 4Y2IA 2RS2A 2CFXA 3EJMA 2XLKA 2RU9A 4M95A 3NS5A 5KT2A 2XHCA 3G87A 3FBBA 4O3QA 4LSLB 3PV8A 3R27A 3MM5B 3RR8A 1RTZA 2FVCA 3UCZP 3PYFA 4DV7F 2YQ3A 3DN9A 1QE1A 2MQNA 2C42A 1WOSA 4F0HA 1EHWA 3UO0A 2FY8A 4C0HA 2E5JA 3HO1A 4CT9A 1HL6A 1UEKA 4TXSA 3MMAB 4NA1A 3CCSS 2B8PA 3M9NB 2L48A 4NXNJ 2B5JB 3I4PA 4WFXA 5L1JA 2FLPA 3G6XA 4YOEA 3N6NA 2R7XA 4JI3F 2HFUA 5HVFA 3ZTSA 4DN0A 1CBKA 2HAIA 2ZZMA 4WPAA 3MR6A 4ZIVA 2K1RB 3RBDA 2KVIA 3FEXB 4DV5J 1H73A 1TK8A 3N28A 4L76A 5EUHA 2BYCA 3JSBA 1S79A 1UP1A 3X1LB 4DCPB 2HHPA 1S10A 4DL7A 3VGVA 3T41A 2XZDB 4AFFA 2DIUA 3NNHA 2CNLB 2WOMA 2MPUA 2OELA 3MCOA 3C14A 3CCVS 2MQLA 3PEHA 2GV1A 2P8IA 3QO9A 2XMAA 4C11A 1KN6A 1IR0A 4EEYA 4LR8A 1JLCA 2FHMA 2MGZA 1RWOB 2DISA 1H2UX 1S4FA 9RUBA 2W9BA 1XMBA 3Q83A 2B56A 2DNZA 2D3OR 1HWKA 2CRLA 2HK3A 1HIYA 2QLFB 1IVZA 3WX4A 3NRBA 3S6EA 1MMNA 4DV2J 3R2DJ 7FDRA 2AIRB 2IJFA 1EETB 1AZSB 3CDBA 4CIOA 1V6HA 1PILA 2DITA 4LBHA 1VC6A 1OO0B 2ZC3A 3MEDB 5HQMA 1M5PC 1HHQA 2ZBCA 1YJNS 4NWBA 5CAAA 4ZPBA 4OZNA 1XMQF 1B0PA 1HI1A 2E9TA 4K5RA 4CO2A 4KAIA 1S1VA 3H5YA 2KH9A 3MM6A 2HHSA 4DSKA 2GMJA 4NRUA 2ZH2A 2YX1A 4DR6J 2HQDA 3CC2S 2K7KA 1TK0A 2V9WA 4K0KJ 1W2BR 4HR2A 2YWHA 3LP1B 2XCPA 3MM7B 1BQMA 1RT5B 1XNQF 3H59A 5MLCV 1D1UA 1M5KC 3TZXA 2B51A 3ILIA 1FNXH 1PYOB 3DRSB 4N47A 5F0WA 1K9MT 3MAHA 6AT1B 1KVKA 4A46A 2OUGA 5JXSA 4X4SA 1WC6A 1I3OB 1C1CA 4ZVUB 1HQEA 2BRLA 3MOJB 5JUMA 4KE5A 4DQSA 1OSCA 2BA9A 1WC3A 5DO2A 2CDQA 4RU9A 3IG1B 2LYVA 5LJ5Y 1WACA 3P5TL 4RX6A 4W90B 3EGVA 3AAWB 4LF4J 3QAUA 1SKSA 5BR8J 1RADB 3B4MA 4XO0A 2XTJP 1HYSA 3RGIA 5LOQA 3QRQA 3SQGA 3KTQA 2BKOA 2NS1B 4K4YA 1N56A 2UXBJ 5GAEU 2B8QA 1NK5A 5BJRA 3MMBB 1CEZA 3HFZB 2CZ9A 2KB2A 4ZVTB 4FYXB 2AD9A 3PJXA 2XS2A 4OYXA 4U67Q 3C6TB 4MT1A 1MNEA 3NOCA 1BY9A 3DOMA 2VJVA 3EPGA 4DL3A 3TWZA 3ENWA 1HWJA 4J91A 2GGPA 5FLXU 5E7OB 2I38A 5GMKa 3OL7A 1NSKL 4N5SA 2JVRA 2VPWB 1RCXB 3FMWA 1QM9A 3QLHA 2QA2A 2ZDPA 2QL9B 4LUBA 4C3LA 4C7QA 4I6YA 1CPZA 4NLTA 4B3TF 2HRUA 3CJ5A 4OYWA 2ZH8A 3MGJA 2LVWA 1VHIA 2AT1B 5C25B 1VJWA 3UDVA 3LANA 5A8RA 5B09A 3VAKA 2XY5A 2V50A 2BR0A 1Q8IA 4DS5A 2WW4A 3HPOA 1HR0J 3RB6A 2HQCA 1RBAA 2DNRA 3TO8A 4O3SA 3DHWC 2HS0A 1D0EA 2P6SA 4IH7A 1VC0A 2VPZB 4M5MA 2G2YA 3E01A 3MZIA 3CO9A 4DFPA 3TW0A 4HHUA 2ABYA 3AJ2A 2PI5A 2E5GA 4ZJOA 4ICLB 3T5LA 4IG3A 3U1LA 3K0JA 1VK3A 3R8YA 3DDIA 2EPIA 4BCAA 4USMA 3EVOA 1LKZA 4GC6A 3BH7B 5AE2A 3KLFA 3NGKA 1U09A 2R42A 2YKNB 2XMWA 4P71A 4YS2A 1U6BA 3I0RA 4OX9J 1LWEA 5BYSA 5J2PA 3MXHP 4ED2A 1S7IA 1KQGB 5KFTA 4CLUA 1RAAB 2RKIB 2Z4PA 3KJFB 4OZ2A 1IXKA 1FRJA 4KPYA 1FRHA 4WYLA 2RRAA 3I0SB 3ENQA 4NYZA 1PBUA 1AW0A 3SIPB 5KFNA 1CC8A 2DD8S 5H9EK 2OJ3A 2FJAB 1JQGA 2BANB 3AY0A 1WKKA 3GV5B 3G86A 1QJHA 2ASYA 1LWFA 4YB1P 1RP5A 1SH3A 2DEJA 1RACB 3BGFA 3CCRS 3MDFA 2EEYA 4ITSA 4LF7J 4CRJA 4Q2LA 3IMQJ 3JYTB 2HVZA 2FHJA 2OFHX 2VC1A 4D3HA 4F26A 3CD7A 4LRBA 5E3RA 2CQPA 1J5OA 4ILMA 2W25A 2GCFA 4GKJJ 2C3OA 4TLRA 2BQ3A 3CO0P 3HSZA 4GKKJ 1TKDA 1L3UA 5T7LA 1RT4B 2V0NA 3KMQA 4DL2A 2BE9B 2HWIA 4QR1A 2HBZB 2V94A 3P6YC 2G0IA 4QPTA 4DR3J 2OPRB 3D2WA 4JI0F 2JLFA 3L9ZA 4OHZA 2V9KA 5ADZA 3PO4A 2XNRA 2J0QD 4UT4A 2VG7A 3DOKA 5ETQA 4DG1B 4ED3A
chains in the Genus database with same CATH topology
3SCIE 2DHAA 4FNHA 1HMVB 3BSAA 3SFGA 3KLEB 4OFZA 1C0UA 1DTTA 1JLGA 5C42A 2PO4A 1QUPA 4WU2A 2XBPA 4EYIB 2UVVA 5K5MA 1WEZA 1S1VB 2GMLA 2ZM6F 2VFVA 3MEGB 5K8NA 1D9FA 3SSQA 1LK5A 2VPXB 2ZFHA 1YRXA 5KT6A 2X51A 2ZE2A 3G8TA 1CQNA 1E6VA 4DFMA 3SCKE 2AQ4A 1C1BA 5KFLA 4Q45A 1QAIA 3MM6B 2CZ4A 3J81Y 2A3JA 4BC9A 4ETZA 1S9GA 3M6UA 1DAXA 1RGVA 1MROA 3CDEA 3U27A 4B3RF 1VK8A 4MYTA 4J9PA 4Q8EA 1SH0A 1DFDA 4DSEA 1S6QA 1Y3JA 1X4BA 4EGLA 1FDBA 2I2YA 1RT7A 2XWXA 4TU7A 3POTB 1HI8A 2DGWA 1SH2A 1NRKA 3L7PA 5C24A 3UFCX 3GB0A 1SB6A 4MK9A 3GILA 4NLPA 3GV8B 4IRDA 2JL9A 1P8GA 1VQNS 4I67A 4PG7A 1S1XB 1JIHA 2LCWA 3O44A 4W92B 2R7SA 1S0OA 4LSNA 5DRKA 1R8PA 4UY8T 3T6JA 1S6OA 3LH2S 4F4ZA 2XLJA 3H40A 2I8EA 1JLAB 1N52B 1UEVA 2C3PA 2JOQA 2VA2A 4PXDA 2CPDA 1BQMB 4H4OA 4DQQA 3K2YA 1NJXA 1P1LA 2DNOA 1FXLA 1HA1A 1WHVA 4KV8B 1OPZA 2W4DA 2MY7A 3MPYA 3O8WA 2XY6A 2FLOA 4BWMA 2XMUA 2HIQA 3BF4A 4I4BA 1TV6A 4HKQA 4TQRA 2CPJA 1IQTA 3PR5B 1L3TA 1S0NA 3FRZA 2UUBF 3FSIA 3HK2A 2AJQA 4EBEA 1D9AA 1O0PA 1FDNA 4I6WA 4K4WA 1KSPA 4RZRA 3L09A 4ECSA 1WF2A 1U2RA 3G71S 2LXUA 2YNHB 1RT4A 1FD2A 3CD6S 3LUYA 4M94A 3TAMB 3LGMA 1QSSA 4DSFA 4NLSA 4OV1A 1C1CB 4Q0BB 3OL6A 2RF2A 5LT5A 1AROP 5J1PA 5DDPC 1T95A 1S7HA 1KS2A 2MKHA 1OPIA 2ZHAA 2IVFB 5EWGA 2MQMA 3N79A 4C8KA 2HWTA 1P27B 1MU2B 3ZZRA 3OVSA 2LDIA 1LWCB 5I42A 2QA4G 4HH1A 2J7KA 2R8KA 1B64A 2XZWA 3N6MA 4EFAC 3L3CA 2ASDA 5KFDA 3DU6A 1RT6B 4NYPA 2VBWA 1U6ZA 3CXCR 1UVMA 4LF9F 2V8DA 1BQXA 1LW2B 4KO0B 5G0RA 3IN5A 4URSA 1GNKA 3DI6A 3S1TA 3OL8A 2C3YA 3RRKA 4QBUA 3QZ8A 4GO7X 3WZ0A 2W9CB 1QSLA 4DF8A 1CQMA 3DM2B 3O1LA 3Q23A 1TL1A 2ZJPQ 1WEYA 3PHEA 2DNNA 2JWNA 2FLNA 3I4HX 4AYBD 1SJ3P 4PUOA 2OO4A 1HMVA 5KT5A 3J80Y 5CZXA 4IFVB 1SJQA 1OSDA 2MJNA 1VIXA 5K8OA 2VG5B 2B7BB 1HYSB 4O4GB 1NNDA 1FJCA 1JLBA 4RU2A 4PPZA 4MKYA 3HHDA 2FHOB 3SQGB 5KFKA 3MEGA 2AF6A 4ZOSA 5GAGU 1FA0A 4M8LA 4AL7A 3CJKA 3RR7A 4BC7A 2DNMA 2KT5A 5D3GA 2GO9A 3FVYA 1WG4A 2LLZA 2QA4S 1FJEB 3LP2A 2EFGA 2X1BA 3SSSA 1ZM3A 1X7VA 1T3NA 2HQ3A 4HHJA 2HMIA 4IDKB 4QJVA 2B9XA 3KKFA 1FTRA 3G96A 2JEJA 1IKXB 1GTEA 2DO0A 2J9EA 2YWGA 3QZ7A 4JI7F 2RQKA 4X4OA 1VRUB 2BE2A 4ZPDA 1SL0A 1N5YB 1NEEA 2IC3B 3BN4A 3TUIC 3DFEA 4A8XA 3CCQS 2ERRA 1V3ZA 3M8PB 3BO4A 2CVEA 4DJBA 1MSWD 5KFFA 1RT1A 1SUQA 4C8MA 5LSRA 1B7FA 3NLCA 4CTAB 1JK9B 2ZKUA 1VFJA 1FNOA 1VRTB 4YDDB 4ELVA 2P9CA 1JLAA 2RSQA 1YQHA 3M32B 4LIRA 4J9QA 4V19X 2AX0A 2KRBA 3MUVP 2LQBA 3D54A 3H25A 5D6GA 4EYHB 4RW9B 4U6PA 1IKWB 2ROGA 2GJ2A 4O23A 1VQLS 4PWDA 2WONB 4KV8A 1GAOA 1S1WB 2XULA 4ECVA 1NH8A 1YTYA 4R5PB 4Y28C 4K4SA 2GGPB 4QIFA 1M5OC 2E44A 1M5VC 2JSXA 1QLNA 2PT0A 5IT0A 2UXDF 3LAMA 2KG1A 5KG7A 2W8KA 1FESA 1HHSA 2M9KA 4EO6A 4RW8B 2V8VA 3PDNA 3CVKA 4DFJA 1U1KA 2YNHA 1X5PA 3MUMP 1AFIA 1C4CA 5HBMB 5M2UA 2MMYA 2FHJD 3TAMA 2K7JA 4I69A 3M30B 3SV3A 4IO9Q 4DR7F 3QLHB 4Q0BA 1T05B 2G13A 4ZP9A 3KK1A 2KT3A 4E98A 1T7PA 4QCLA 4FP9A 2JEGA 2MYFA 1OS5A 2JC0A 3MMCB 3Q24A 2GNKA 1K1QA 3GR1A 2JC1A 4C0BA 1UL3A 2DO4A 3OBIA 4YB5A 4YQWA 2DGVA 2HGLA 4ZMMA 1Z4UA 3HF5A 4ZCKA 1U1NA 2LEPA 3U1MA 2ADCA 1RYRA 1RT6A 3VR1A 2PC6A 1N6QB 1UAWA 4KO0A 5FD1A 4L6V3 4FVCA 1Z1ZA 2RDJA 4JI5F 4OHXA 3NP5A 2YNIA 3A1YG 4A4JA 3SZ2A 3OHBA 4G3IA 1ZM9A 2ZH9A 4HTJA 2C22A 2CIMA 1KC8T 4NL5A 2M52A 2CQ4A 2J7UA 3MMJA 1JKHB 4ECRA 3P49B 2APOA 2R2RA 2F8HA 3R1LA 4QYZJ 3JB9k 5EDWA 3BO2A 4DR3F 1ZTTA 2C3MA 2DVIA 3TARA 2V4RA 3DCAA 4DV5F 2PMHA 4PG4A 3M9MB 4OX8A 2ZNYA 2NPFA 1RTHA 4X64F 2JJ4D 3CCLS 4H4KC 4KB7A 1X9WA 1BWEA 5FIIA 1Q16B 1G7CB 5DDRC 1U4BA 3CF5Q 2XSFA 3HKWA 5CCMA 2G0CA 1IKXA 1HBUB 5K8MA 3IR5B 5KOWA 5F0UA 1VRUA 3J7Z5 3S01A 5GVQA 5GAHU 3TAPA 1H3DA 2AX1A 3VAJA 4OI4A 4J9NA 2EFQA 5FDLB 4CO1A 4DBQA 2R7TA 3LGNA 2ZITA 2F8EX 1Q78A 1NHVA 4UY85 1H7WA 3OFEA 2YH0A 1KQKA 2LQ9A 2XHWA 5SZTA 1FNMA 2FGCA 1RTJA 2Z2LA 4Q5VA 1FXRA 4ED6A 1U1MA 2NPIA 4IG3B 3MHYA 3KFWX 5D4PA 1SL2A 5EN1A 4K4XA 4RW9A 1IKWA 3J7YI 3O6QA 3R5BA 2WONA 2ZH7A 2FVSA 5BYQA 3DGPA 4XAKA 4B3MF 2DNLA 4R5PA 5DDQC 2KM8B 1I94F 4I6AA 4TKTA 3PVXA 3CC7S 4C8OA 1HBNB 5KG1A 1GXTA 4NCBA 2ILYA 4YR0A 3KLFB 4OJ3A 5A8WB 2RB7A 4J9SA 1R6YA 2E7WA 3UR0A 3BN7A 3F41A 2W7PA 1HI0P 2GW8A 1F5BA 1L3VA 2ZDOA 1CSJA 2HQIA 2DNHA 2G9OA 3AA8A 2NSBA 3I0RB 4V19J 3B8HA 1REVB 1NKBA 3M30A 2HHXA 3T9NA 1IKVB 1LWEB 4R0JA 1Y3KA 1MWZA 1C2PA 4KBIA 2L9DA 1FVSA 1FDAA 3D0GE 2CQ3A 5J2PB 1UVIA 4ILRA 2CJQA 1VI7A 3OL9A 3GG0A 2ILZA 5C5JA 2KI2A 3AQPA 2F7VA 2RS8A 4U7UK 3BGLA 4LQ3A 3W3SA 1NH7A 3B4DA 1N5TA 1URNA 2PEHA 1IKYB 1NAQA 2BVZA 3N0VA 2BOPA 3HT3A 4LVNP 3CMAS 1F60B 5E33A 2GC8A 1HBOB 3R5DA 1N6QA 5CA5A 2B4VA 2B6AB 2ZH1A 2MZTA 3UCUP 2DJWA 3GQCA 4DDFA 5T14A 4DV2F 5I4MA 2A1BA 4EBCA 3NKYA 5F41A 5CQGA 4A8OA 6FD1A 4DSJA 3K5NA 5DGAA 2YNGB 1JLEB 2W8LA 3KLHB 3VAIA 1XBWA 4ECQA 1JKHA 3W7BA 3FMBA 2YWFA 5THWA 2E1MC 4WIIA 5I3PA 3Q8QB 2FC9A 2IRUA 5CYJA 4OI2A 2KFZA 2J6SA 4A8KA 3K8VA 5D4OA 2FY1A 4UUXA 4YFUA 5KFBA 2B4UA 4QU6A 3A8EA 3UI3A 2DR5A 2M5YA 1GX5A 4ELUA 1U45A 4N76A 3KK3B 4O44A 3IO1A 3H8YA 2D74B 2HNZB 5KG2A 2KZZA 5M2RA 2QLXA 2OPSB 1VGYA 5L8RC 3SFUA 2A2DA 5DG8A 4OI6A 3TP2A 3KYLA 4IH5A 5E2QA 4DR1F 1HD0A 5IFMA 1E6YB 2IM1A 2M4MA 3FCHA 1HPZB 3RAQA 3LO3A 4I2PA 3DLBA 4NLQA 1DZ5A 1LWFB 2ZJQQ 1C0TA 2MZRA 2XO7A 1S9EB 2AV5A 3G8SA 4Q2MA 1IQZA 3MEEB 4RUCA 1KONA 1XEZA 4E8UA 1UJ6A 4QOTA 4CO0A 2F8MA 4OZ0A 1D9DA 4GO5X 4HT7A 2IA6A 4FBUA 3HVTA 2XCAA 3MD3A 4A8MP 1X4AA 4TY8A 5LXYA 2RUGA 2QT7A 1JLQA 3I87A 1F9FA 2RD5C 2E1RA 3UDCA 3PO5A 3FZ2A 2FHKA 2R8HA 2VC0A 2DK2A 5F8GA 4URQU 1SKRA 3PXGa 5IQQA 3VZHA 4DR6F 1R43A 2KU7A 1J5OB 1SV5A 3WDOA 2XMTA 2FPHX 5AXKA 2IMWP 1KRPA 4NLXA 1DBDA 1SIZA 4RNFA 3R5CA 4CO5A 4F2SA 3NNCA 4FPRA 1I1GA 4WE1B 5L9NA 4CNYA 1FRKA 5A8WA 5B7WA 4B9NA 3GFXA 3TQ1A 2Q66A 2WK4A 4ZK7M 1B0VA 1HFEL 2G1DA 4H4KA 4DUYF 3PW2A 2EG1A 3NBPA 4IQMA 5J1NA 1QVGR 4HDGA 1FTCA 3B82A 5T7LB 4F3QA 1Q53A 1R0AB 1XMOF 3DHXA 1FO1A 2B4PA 5HP1B 4LF8F 3V6HA 2B3TB 4M5DB 1DHMA 5KFOA 3RB3A 3TVZA 2CPZA 3RU0A 2MSSA 3QIPB 2VFSA 4Y65A 1X4HA 2L9WA 3ZZYA 2OPPB 2DNPA 3THTA 4FBTA 5DJBA 1RKJA 5G4DA 3WBZA 1IKYA 1KTQA 2ZC4A 2DNGA 1H98A 4X4VA 2COLA 2VG6A 2R2UA 4PQAA 1HBOA 4C8ZA 2BDPA 2PGCA 4FYDA 2B6AA 4JV1A 3NMRA 4KHRA 3PZPA 1ZZNA 3DMJB 3KJVA 1FF2A 4OI0A 2NYIA 1DLOB 1W25A 2GMHA 2R2TA 3VALA 2J0SD 1H2VZ 2YNGA 4J9LA 5HL7Q 1JLEA 2H9ZA 2VG7B 4DHVA 5DM6Q 1SL1A 1FD8A 4KHPF 2RRNA 4ES1A 3K5PA 1KLMB 3CGIA 2WCXA 1RT3B 3MR5A 3LAKA 1IUJA 3THVA 1C0UB 5J2QA 2DR8A 1JLGB 2CKWA 1PC5A 4UOCA 3V6JA 3FNNA 4I1TA 1N54B 3N01A 4PRFA 1NKEA 3KK3A 4K4ZA 2WSEC 3H2VE 2IVYA 4M63A 3BGUA 2HNZA 2KYZA 1JB0C 1E6VB 3FEZA 5AE3A 3CWJA 1OWXA 5L1LA 1XERA 4QIGA 1NK6A 4LF4F 2KN4A 2XSJA 3VQTA 1S9GB 1VBXA 4KJIA 4J9RA 3SCLE 4X84A 1BLUA 1HPZA 4H4MB 2YKMB 5BR8F 2GO8A 2CJAA 2VFTA 3QGPA 1LFWA 3T5JA 3PW7A 3M4XA 3UCGA 3BSOA 3DDNA 4QQBA 1RT7B 5CXTA 2B4OA 3UD4P 1WF1A 3MEEA 4ALZA 1IBKF 4GMKA 2IM2A 5C24B 3PY8A 4ID5A 5CD4H 2D3ZA 2VKZG 2K2PA 4IOAQ 1WF0A 2K8GA 1A9NB 1T03B 1X4CA 1TKXA 3HJFA 4ZDNA 2QV6A 2FVRA 1KOOA 3K8WA 1N48A 1DARA 1RK8A 3AB4B 5F3ZA 5D77A 1AXQA 2JHEA 4LT6A 2RU3A 3QJLA 3T19A 1TQLA 3PKYA 2ZKTA 2CQGA 5KFQA 3CCTA 4QIWD 4H4OB 2M70A 3VWSA 1VQ6S 3MOZA 3EPIA 5GADI 4B9VA 1S1UB 2CPXA