5ETKA

E. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.09 angstrom resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
159
structure length
159
Chain Sequence
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 159
sequence length 159
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etkA00
1HKAA 3HSZA 2BMBA 4M5LA 4M5IA 1F9HA 5ETLA 1RTZA 1KBRA 2F65A 3ILIA 1RU2A 1TMJA 4CYUB 1IM6A 4CWBA 3UDVA 3ILJA 3MCMA 5ETRA 3KUHA 3HSGA 3HD1A 1RAOA 5ETVA 1EQMA 1RU1A 3MCNA 3KUGA 2QX0A 1TMMA 2CG8A 1DY3A 1HQ2A 3ILOA 4M5HA 3UDEA 4M5JA 4PZVA 5ETNA 4F7VA 5ETMA 1RB0A 1CBKA 5ETOA 3HSDA 4AD6A 1EQ0A 4M5MA 2F63A 5ETSA 4M5NA 1G4CA 4M5GA 1Q0NA 4M5KA 3HT0A 3QBCA 5ETTA 5ETQA 3HCXA 3HSJA 3MCOA 3HD2A 4CYUA 5ETKA 1EX8A 3IP0A 3KUEA 3UD5A 5ETPA 4CRJA 3ILLA
chains in the Genus database with same CATH superfamily
3IA0A 3D6FB 4G1IA 2J8SA 2MMYA 2LA4A 1FFWB 5KFHA 3VALA 3HHNB 4DV5J 4V1Ak 4C97A 2HZVA 4ZJOA 1C1BB 2HWTA 3MEEA 3LUYA 4OZ3A 4ICLA 3BYPA 4LF6J 3DLGA 3GJQB 4KV8B 3UCGA 5KFTA 5J1NA 1TKXB 1N33J 3NS6A 5CXTA 2C3PA 2C3MA 1VQ6S 1TL4A 3DGVA 2V9KA 1HPZB 2MHEA 3TA1A 1I94J 2EXUA 1X9SA 1Q8LA 2W8LA 4NA2A 2QG9B 2V2ZA 3CUNA 3H90A 1U1OA 4NLYA 1U6FA 1GNKA 2CNNB 2QMWA 3ILIA 4X62F 4OYZA 4Y2AA 3MM7B 2LQ5A 2N4CA 3RBDA 2CQ1A 1SQEA 4ANDA 4ANEA 1X4HA 3P96A 4D3GA 1Q7LB 2D9OA 5KOWA 1UP1A 4NLTA 3TQEA 1EAYC 1NPPA 4LF9F 1TL3A 1RK8A 4A48A 2XB2D 5D4NA 2WAQD 1SKRA 5H1SV 2BJ3A 2UXBF 2WONB 3N79A 2JC0A 3LP1B 4DG1B 3AB2B 1S97A 2DIVA 3RBEA 2RRBA 2E9ZA 1T9TA 2XULA 2U2FA 4PYDA 2F65A 5G0RA 1UTAA 4ZP8A 1JJHA 3I4HX 1S99A 1U4BA 1HBNB 2WBMA 2RAQA 2XSJB 2CJYB 2RKIA 1QSLA 2GVZA 5J2MA 4OYMA 1IR0A 4IRCA 1HIYA 1KLNA 4FDFA 3T1HJ 2K3IA 2J0QD 3IGVA 5LSLA 3POTB 1HNVB 2CZ9A 2XS5A 1WSRA 5GAHI 3HKZD 2X3DA 3NS7B 2GHWA 2GMLA 4HHUA 4DV7F 1Q86T 5F41A 1TUVA 2C3OA 2ROEA 1OPIA 3UFCX 2O5DA 2WVFA 1JJ2R 3QPIA 3I9V9 5C24B 4CLUA 5GAEU 2ZNZA 3QT8A 4EO8A 4MIBA 3VGTA 2FY8A 3IBCB 2IMWP 1HWLA 3GP9A 3M8PA 2LDIA 1TK5A 1HBUB 4K0KJ 4ATNA 5F8LA 2BM1A 4L73A 4DR1F 2B43A 1R0CB 2PMHA 4PG4A 3CO0P 3TEHB 2ABYA 3DLEA 3N4WA 5IM0B 3DNCA 5L39A 4RNNA 2O67A 2KH9A 4ED1A 2AZ3A 2YY3A 3FNNA 3WZ0A 2N7CA 3G2XA 4KFBA 5FLXU 1GX6A 5IV3A 1Z4UA 4M5IA 4PG5A 1FRLA 5J1EB 1LWCA 4DCPB 2E9RX 3NWGA 2J0SD 1CQNA 4YY3J 1JLFA 3CCSS 3I0SA 3KG0A 5KT3A 1CJVA 3NXZA 8RUCA 1BY9A 4ZLNA 2VPXB 2XMVA 1ZM9A 4H4MA 2XYHB 4DL3A 1VRUB 3JXOA 1EQ0A 2VG7B 3GIIA 1S79A 1T94A 2YNIA 2M7SA 3MCSA 3HSJA 2MLZA 2V4JA 2LECA 3JB9k 4KAIA 2D3ZA 1FRIA 2CVEA 5LXYA 3KLVA 1V3ZA 1SC1B 1YBAA 2BKOA 2DISA 1RISA 1LK7A 1VC5A 1S1WB 3OT9A 3SBMA 5GADU 1F5CA 1NJIT 3DI6A 4LBIA 1VQMS 1TFWA 3QSYB 1TL5A 2BOAA 3BS9A 3OHBA 3HPOA 4J9VA 4X64F 4CO4A 3KK3B 1W26A 2H4WB 2MXYA 3WC0A 1UWBA 2LCWA 5HVHA 4JI5J 3HT0A 4U8YA 5J1PA 3ZZRA 3FBEA 1N0UA 2D3O1 2L9DA 1SPBP 1NK8A 1A9NB 2B0GA 3KLIB 2AX0A 4KB7A 1X9WA 3NNCA 2A10A 4CIOA 2Y8YA 4WP8A 3BQ0A 1JIHA 3MCNA 3QMQA 3BH7B 1EB0A 2CQHA 1XJWB 2BRLA 1VJQA 3R9LA 3IC1A 2QLBB 2J9CA 2G9OA 1FX4A 3P49B 5GMDA 1YSJA 2UUWA 5CQGA 1FI4A 2F8MA 3U02A 1UAWA 1ZPWX 1VFJA 1WC1A 1B4SA 1O51A 2Q66A 4DFJA 3V2UC 3GIJA 3HZEA 3FBFA 3TUJC 3EXCX 3DHWC 1LWEA 5KG0A 2BM0A 5C42A 4DU8A 2ZWPA 1J5OA 2ZZNA 4B3RF 2CFXA 4WBFA 3MEDB 4FS1A 3TJAA 3W62A 3N5FA 1YJWS 3SSSA 1B3TA 4DSLA 1P9YA 4JI2J 4DL6A 2GS8A 3NCRA 1JX4A 3A4TA 3ZXWA 4HL9A 2W2PP 3J81Y 3H2UB 3EUNA 3OUYA 4Q8EA 1JNRB 2ACYA 4LSNA 4K4YA 3A3NB 3M2VB 2ZITA 1Q95G 4RW7B 2MQNA 4KJIA 3T41A 3V4IB 2FHKA 5AXNA 1D09B 1FXDA 4ED7A 3KOAA 3M6XA 5CYMA 2CUYA 2BMBA 1ZZFA 2OMOA 3M30A 3BBBA 2HHHJ 1JLGA 2HBQB 3LANA 4CH7A 4USWA 2HVDA 3EMTA 1NB2A 1VQ9S 1C0UA 3BBCA 1VYAA 2LQBA 1TVRA 2CZ4A 3GG1A 3K8VA 3CT9A 5GAGU 2FLLA 5KFYA 4K4ZA 4WYLA 4FNHA 3VGUA 4OI3A 3DCAA 3Q2TC 3AT1B 2FJXA 5IQ6A 4QU6A 1T02A 4HACA 1N56A 5D4PA 2XCAA 2B4VA 5KFRA 2FLOA 1C4AA 3CIMA 1N4LA 3GQCA 2JSXA 2IC3A 4J9LA 3MM5A 4IYQA 4A46A 3L9ZA 5KFXA 1OPZA 3PJWA 1N36J 2D1CA 2YQ1A 5CZXA 4C3KA 1H2VZ 4LFAF 3BKTA 3IWXA 3EJMA 3VZHA 3IWLA 2HQDA 2VKZG 1S6PB 2W2NP 2AYMA 5KFKA 2KB2A 4K59A 3MAAB 4NI2B 3DLHA 1QAYA 3OR1A 2K2PA 4OI2A 4O4RA 4OHYA 4KKOB 1RT5B 5AE2A 2ZVSA 3KK2B 3OL6A 3BGFA 4LVOP 3KLEB 4URSA 3PW7A 2KDOA 3A8IA 1WTBA 2N82B 3K5MA 3D68A 5KG6A 2QIFA 2ALYB 1REVA 3V6KA 3PNIA 2Y3YA 1JLCA 1MROA 3KMQA 4R5PA 1YG0A 4P2SA 4X84A 3KDOA 1KHVA 5DRKA 3LP2B 1EIYB 1KTVA 3RB4A 3CD7A 4ILLA 2CPDA 2JEGA 2GV1A 4FYWB 5ETMA 3CCMS 2R3VA 2BE7D 5DQGA 2DYAA 4OZNA 3EM1A 5DJBA 1HWIA 2JLEA 4RNOA 1TU0B 4U67Q 3Q8VA 1NZAA 1OSDA 5HP1A 4DPYA 4CNYA 4RNFA 1RT6B 3E3XA 3D2WA 3TZYA 4CLTA 1DQ8A 5KT7A 2R2RA 4DL2A 3DU5A 3NEKA 5CABA 3EWGA 1VI7A 2DNLA 1HFEL 5I42B 1KBRA 3HX9A 3TW0A 2VH7A 4A8MP 3MUMP 2VD3A 3I0RB 6FDRA 4TVAB 3LWLA 4EZ6A 5KT4A 3QGPA 1D9FA 2D41A 2KFNA 4J5OA 3OTOJ 3NMRA 1FRMA 2YNHA 5KG4A 3HHLA 2YKMA 2FVRA 5CD4A 1TV6A 3PY8A 2N3LA 1VBKA 4IOAQ 1V3RA 1NJWA 1B7FA 4YMEA 3UD3P 4X4TA 4MH8A 3DGPB 1Q1KA 3D9BA 1DURA 3PRDA 2DD8S 1Y5NB 2HVHA 2R7VA 3V5RA 2WK4A 5RUBA 1NKBA 3D5MA 1BGXT 4OHVA 2HLTA 2PA8D 2EW9A 4P7TA 1WKJA 1WSVA 1OY8A 2G2YA 1ZOTA 2BKPA 1ELOA 1TP7A 4ZVUB 2KVQE 2OO4A 4WE1B 2QGFB 4DUYJ 3LF0A 2IYGA 3CJRA 1TAUA 3IRXA 3IAM9 2PO4A 1WI8A 4C2MA 4F02A 2V5HG 1RYSA 4PXBA 4OYXA 3MMBA 1U0SA 4WFBQ 4WU3A 3ZZYA 3W5YA 4EBEA 5H9FK 1Q8IA 4OYOA 3OW2R 4PXDA 2VQFF 5I3UB 2XCPA 2J6UA 1QJHA 3WIVA 1O6XA 2FJDB 2FJAB 1KR4A 2QC3A 4TKTA 3NGRA 1FD2A 1H73A 3VWSA 5FJ4A 1OWXA 3FSIA 1C0TA 1M0SA 1TKTA 2ACMA 2JHEA 2CADA 1RAHB 2WVDA 2JOQA 3UDCA 3C6TB 2ZD1B 1VQKS 3OXFA 2VQEF 2RU3A 2KO1A 3KG4A 3OVAA 2B9YA 4URQU 5C5JA 2DGTA 3ZC4A 2Y1RI 2RQMA 2M9KA 3PW5A 2HS4A 3TJ8A 4QPXA 3ENVA 3GYGA 1JJ4A 2I5JB 4PWDA 4KH0B 4F3QA 4X4VA 5L1KA 1FNXH 3C15A 1B7YB 1HNWJ 4NLOA 1Q4RA 3DRXA 2G2ZA 4J9SA 1YJTA 4USTA 4F0HA 4OQJA 2XM3A 2J76E 4Q2MA 4NLSA 4Y0FA 5E3PA 3E8OA 3D6TB 4BC9A 2OPRB 3IM8A 4G1QA 4NZ7A 4ZOSA 4ED0A 3JYTB 2Q1LA 5ETSA 1HWKA 1YJNS 2GZOA 4UUWA 4NE9C 2FJWA 2AKWB 1YTYA 3DYAB 2ZH7A 4LF2A 3UDVA 1V5VA 2OD6A 4U95A 2VB6A 1U48A 5D6GA 3CDAA 1IKYB 4CLYA 4JI8J 5H9EK 1CULB 2E5HA 4ID5A 4ZVTB 2BJ8A 2FVPA 2LMIA 1S1TB 5KT5A 1A0OB 1C1CB 3P4UB 4RU2A 4NX9A 3QIPB 4ZDNA 4F0KA 1UETA 3CMAS 3M8SA 2MEWA 3KK1B 2UU9J 3M32B 1GMVA 2XSFA 3MUTP 3QAEA 3MWBA 1TL1A 1RCXB 5BYSA 3CGIA 2W2OP 4RPFA 2BOPA 3BM7A 4M94A 3DXBA 3P5BP 5D78A 4IUFA 2EKYA 1S1XB 5F8GA 2WONA 2NYHA 4MK8A 1VCTA 4JI0J 4WZMA 4C0HA 4DG1A 5KOXA 4AXJA 4I7FB 1HNZJ 2X3GA 2FLNA 3PO4A 3K5LA 4CWBA 2WB1D 2AD9A 3J7YI 3DRPB 3MAHA 2XZTB 1HBNA 2XSJA 3I5BA 3MPUB 5K8MA 3AXKA 2QYGA 3MR6A 3JSMB 1Q8KA 4B9UA 3SCIE 4USKA 3MM6B 4ZP6A 1FJGJ 1M5OC 1IJEB 1HNVA 3EZOA 4WIQA 4L3NA 3IBFB 2KRRA 3ILJA 1H38A 4CDIA 4LSLB 1T03B 2J0XA 3LA0A 2PIIA 2RDDA 4L3KA 4ZVEA 3VCDA 3HFVA 4X4QA 4FXVA 5KG3A 3BYRA 4OZJA 5CD4H 4B3SJ 1VRTB 4NRTA 4F2RA 3RRKA 2WOMA 2HPUA 4USMA 5IC4B 4IDKB 3EYZA 2MB0B 3KTQA 1H98A 3TX0A 2NPIA 3DM2B 2HFVA 4NLWA 1RCOB 1LW2B 3UE2A 2ZOMA 1FRHA 3W63A 1FT8A 4RWXA 1FO1A 4O4GA 1HBUA 1TR0A 1SC4B 3CJKB 2KFZA 2ROGA 2YVSA 1J27A 2HFZA 3B82A 4LREA 5J2PB 4F67A 3Q24A 3M8WA 5IM0A 1R6YA 1BXNA 4OZ0A 4I64A 4DV3J 5L9XA 3LAKA 4N41A 5EWFA 1SH2A 2DT9A 4NXNJ 3K8WA 1N54B 1F6TA 3TUPA 7AT1B 5LSOA 3PYEA 3BO4A 5HATA 3PR5B 4CTAA 1NSAA 1OYEA 3OBIA 2CJBA 2OP5A 1AA1B 4RUAA 3BPSP 4K2JA 4MIAA 2W9BA 1T3OA 2NQPA 4C0BA 3J80U 2VPWB 2Z58B 5E3RA 1NHKL 1IBMJ 3A3PB 2RIJA 3QO9B 2BE2B 3PFEA 4W4MA 4ZPVR 1YX2A 4LR9A 1ZS6A 2AZ1A 5A2QY 2BR0A 1NM2A 1Q5VA 1VRUA 4E2FB 2VG7A 3G96A 2QSWA 3DLJA 1TUWA 1YGYA 2V6AA 2DJWA 3IR5B 3T5KA 1N5VA 4ECTA 3I5CA 3UN3A 3EGNA 4E98A 4JI4J 2DNRA 2QFJA 1HBOA 4O23A 2ZZTA 1WHXA 1N32F 1UJ5A 3MFHA 4IR1A 4LF8J 3D4JA 4B9LA 5LMNF 2AYGA 2OPQB 3NMAA 4DN9A 4OYPA 3FEYB 2RT3A 3RBXA 4I6YA 1MNEA 3IBWA 3O1LA 4ZCIA 3FZBA 2IAJB 3MF5A 4DR7J 5MLCV 1XMOJ 3CJ4A 2WBRA 2IYIA 3FQKA 2UVUA 1JLEA 3LP0B 4LRAA 3U7JA 3DHXA 3M9OB 2V2VA 3N9UC 3BN4A 4UOFA 3GV5B 4BLGA 3KLIA 2M0GB 3NGKA 4WK1A 3OJUA 4ED5A 2F40A 4LRCA 3PRVA 1SQFA 2Z30B 2FJEB 3CCRS 4CH1A 4ZN3A 3UCZP 4PUOA 4U8VA 2BV3A 2EVZA 1HNIB 3EICA 3R5DA 1LQ9A 3IGNA 4CYUB 2VIHA 1UVIA 2WZ1A 4X62J 2Q3PA 2F5GA 4Y2KA 3TA2A 2XY7A 2GCFA 3RJMB 4ZP9A 3PYFA 2W7OA 1G7CB 2CIMA 1CPZA 1L3VA 2MZQA 4DV1F 5EGYA 3LTOA 3G82B 5ADZA 2M2BA 1U26A 1M5HA 1URRA 2UXBJ 1G3OA 4ED3A 2VV5A 2OIHA 3FCVA 3MURP 1Q5YA 1TL7B 3EDRB 5B0DA 1W7WA 3OFEA 4YR0A 2ZNYA 3ZO7A 3DOLA 4TNOA 2EK6A 4EZ9A 4WP9A 1K44A 2YQ0A 3C66A 3MGJA 4DL4A 3ZTOA 1XR5A 4PPZA 2CQBA 4Z7CA 2DNQA 1BQXA 4DOZA 3NAHA 4C98A 1PSDA 2XMMA 3BPDA 2J7UA 3EVWA 1TK8A 2HMIB 1V6HA 3IFEA 4NASA 3N6LA 5JVGQ 2RJZA 2IVMA 3BGLA 1F3FA 3KLFB 4DV7J 4RW7A 4A8FA 3CCES 4DL5A 4HR2A 2MGZB 3JQJA 3HHKA 3DRYA 2HFUA 3R7SB 2IFXA 3K7RA 1NDPA 1S49A 2CPZA 1RT1B 4RO0A 4UY85 2MQQA 1TMMA 3VR1A 3MMAA 4UUXA 1FF2A 2I0XA 5DG9A 3SXLA 3QWUA 5IWAF 1SJQA 4IO9Q 5DG7A 4JUZA 3WIUA 4LFBJ 2DNOA 4DR1J 4RKUC 4MAKA 4V19J 3ICLA 3HHLD 1SCJB 4W98A 1HW8A 2FLPA 1M1HA 1B70B 2E1MC 2KM8C 1SC6A 1NK5A 1WF2A 1WHYA 4DS5A 3MCMA 4NYZA 1S1UB 2OH2A 1FK9B 1MN7A 4RUHA 2IM1A 3QFWA 2I9SA 2E1AA 5E3CA 3K57A 4R8UB 4Z7YA 2VICA 3LGNA 4JI7F 4NPOA 4OI6A 2K7JA 4DWIA 3EXYA 3QRQA 3J7Z5 5KFBA 2QO3A 1JQGA 3NOCA 4A8XA 3NAIA 3D0IE 1RBLA 4KKOA 1RT5A 1H0HB 3CXCR 2MSTA 4YB1P 3KWMA 3KK2A 2DXEA 4LMZA 2LXIA 1B0TA 1H2TZ 2W7PA 3VF0B 4M8LA 4C48A 3KLEA 5E5NA 3KHLA 5F8IA 4KGXB 1NK7A 3W8GA 2HS3A 1QVFR 3ISNC 3RB3A 3PDNA 2QLWA 4C8MA 2AW0A 2X51A 3GJTB 3LP2A 1QE1A 1MU2B 1YZ7A 4ED2A 1ROFA 3IAS9 4X64J 4KHMA 4QPTA 3C8YA 2HNYB 4J9UE 1UCNA 1LW0A 4LR7A 4JI6F 4W92B 2H54B 2XMTA 5F8NA 1OYDA 2UUBF 4X2BA 4KHPF 2MKCA 1RT6A 1WEZA 2PMWA 5K8OA 2KZMA 4DPTA 4KH1B 3BGRB 2FC8A 1FXLA 4UQGA 4RUCA 5ETRA 3BJYA 2GQQA 4QZVB 5KG2A 4WWSA 3IG1B 2MKYA 3NLCA 2AGQA 4ILMA 2JVRA 5DGAA 2B5JB 2B9XA 1VQLS 3IP0A 1KOOA 4C3MA 1QY7A 3EVOA 4YDDB 3OJSA 3FBBA 3CCZA 2A3JA 4IR9A 3PW2A 2VZ9A 1FESA 1RTJB 2JWNA 1KEKA 3T6JA 3W5ZA 3HD1A 4QIVA 4NCAA 1X5TA 1NMEB 3NBPB 5KG5A 1TKDA 5LJ5Y 4GKKF 3DOMB 2FC9A 4USUA 2P5VA 1VRQC 3B8HA 5E7OB 2OFGX 2PGCA 3MZIA 1RAEB 2RILA 4FF1A 1K1QA 4MYUA 3WHIA 1TELA 4ZLJA 5I3QA 1SV5B 3MXHP 3OL7A 2N7YA 3V81B 3K2YA 4N47A 2W4DA 2KJWA 2J9EA 1PGZA 5M2PA 3SQGB 4B3RJ 3M2UA 3G6XA 1RHKB 3CCJS 3R8YA 3PHEA 2D69A 1T9VA 4J9NA 4I68A 3V4MA 5KFFA 2MQPA 2B4UA 2W1BA 1QVGR 3T6BA 4WE1A 3FFIB 4P73A 1RHUB 6AT1B 1X7VA 2ASJA 2DNZA 3TO8A 5B0GA 4ZVSB 5KFEA 4OZ5A 4TU7A 1D0EA 3QJPA 4OYBA 3K0JA 2DO0A 4H4KC 1B99A 2IRYA 4GO5X 1EARA 3SDEB 4XTTA 1SUQA 4KBIA 4PABA 1VQ4S 1P9QC 4UY8T 2B8PA 2DGSA 5B0EA 1YRXA 3OLBA 1WWHA 1SKUB 1RJJA 2FIUA 3FZ2A 1BQMB 1WNEA 1K0TA 3G6VA 4RNHA 3VGVA 2W9CB 1MSWD 1PYTA 2GHPA 3H5YA 2MDAA 3AXMA 4IOBA 4RBUA 4WTOB 4GVLA 4NLGA 3IR6B 4IQMA 5ETLA 4J9QA 4RJVA 2DNHA 1S0NA 2JH3A 4P2FA 1WHWA 4ZPBA 2CPIA 1EJ7L 4P7VA 2ROPA 4DN0A 4KY3A 1CVJA 1C2PA 3TP2A 1T05A 2V94A 4U96A 5K9FA 4NA3A 3ZTRA 2VKRA 3GFYA 2LEAA 1AZSB 2IM2A 3G6ES 1P27B 1IR2A 1YHQS 1G1XA 2GC8A 3PG9A 2KU7A 2VC1A 2L9NA 3HCXA 4LFAJ 1VQNS 3BO3A 4DF4A 4AUKA 2M3DA 5ETVA 1F2HA 2HRTA 2QLXA 3M6WA 4LFCF 2WHOA 3TYTA 5KFUA 3CJSA 2QFIA 2HGLA 5D77A 2YX4A 1D9AA 3I82A 4WFXA 3TJ9A 5A8RB 1VBXA 4NLPA 2CQDA 1Q53A 5KFGA 4CLPA 1S7IA 3GB0A 1CULA 3A3OB 2VBXA 2ZHBA 3L95X 1HI1A 2ZHAA 4FS2A 3J7A1 1S1TA 4MFBA 4LF4J 2LLZA 1FEHA 5JXSA 2AJ1A 1BQNB 1EKRA 2EC0A 1I3OB 1KSPA 3CCTA 3KJVA 4EBDA 2UV8G 3KK1A 4TU8A 2BJEA 1YJVA 2Y1IA 2VF3A 1RHRB 3S7RA 3AJ1A 1F5BA 5FDLB 1VLYA 1S9EA 2HHXA 1U49A 4Q7AA 1IBCB 5A8KB 2GAGC 3N28A 2BUNA 1S1XA 4QW8A 4F4YA 4DDFA 1HNXF 3MHYA 3EPIA 2OLWA 3KFWX 5CCLA 2DPIA 2W2MP 2ZH9A 1N48A 2E5LF 3W9HA 1S59A 1UZHA 3V6JA 2CXEA 1VMBA 5F8MA 4FPRA 1SVDA 1MG7A 1Q79A 1H3DA 4N56A 3JSMA 2DRBA 3MM9B 4WTYA 3LPEA 4QR0A 2IA0A 1U2RA 3C6UB 3I6PA 3QGIA 2GGPB 1XNRF 3DOKA 5CH7B 2H9ZA 4R25A 1FRJA 2CA9A 2J9DE 3V6HA 2CG8A 2AJ4A 3F73A 1RT7B 1QUVA 2DIUA 1S4EA 1NKCA 2PC6A 4GMKA 9RUBA 4ECWA 3GJSB 1UWAA 2MY7A 4GKJF 4IDKA 3H5SA 4DLEA 1PC4A 2ZH8A 1LW2A 1CG2A 3M4XA 5K14B 1VIXA 4URGA 3QJJA 4M5DB 2VG5B 2HK3A 3CJKA 1VLOA 2ZKTA 5HI7A 5HVFA 1E6VB 1MW7A 2UXDF 1RHQB 2L3MA 4OZ2A 3TX8A 4GO7X 5J2PA 1OY9A 4NLDA 3TEGA 4ETZA 2HIYA 1WHVA 4JI1F 1REGX 1ZA2B 1OMSA 1RZMA 2B9EA 3FMWA 1NJYA 4PKDB 2HNDB 3AD7C 4PR6A 5DQHA 5K20B 1SC3B 2LYVA 3CD6S 3SEOA 4YDXA 3ZZUA 2RHQB 3DDNA 5IT9U 3AD8C 4DSFA 1IR1A 5J2NB 1JKHA 2B8QA 2HHQA 2VQFJ 3H7HB 4OZ1A 1UJ6A 1UFKA 5LMUF 3G71S 1SBRA 2BE2A 3DRRA 2AT1B 1TMJA 2YH1A 3FCHA 4UZBA 2AJFE 4HLBA 5D8HB 2C2ZB 4BCAA 4RWWA 2RH3A 2V2KA 4AXIA 4ED4A 2I38A 3H20A 3T19A 2VQEJ 1N6QB 3M8QB 4DSIA 1T11A 3GJRB 3G87A 2XS7A 1XMQF 1J2VA 2XHWA 2QA4G 2GJIA 5KTQA 2DNKA 4ZP7A 4Y2MA 1NSQA 2I1RA 2OPQA 4QWCA 1WC4A 3ADAC 2BANB 2MYFA 3HVTA 2EFGA 2M52A 3V6DB 4MYTA 3GR0A 1I5OB 1CBKA 1EHWA 1JLAA 4OL8A 3BBFA 3KYLA 3CB4A 4PG7A 5AT1B 3IRWP 1CSJA 3HZGA 3MD3A 4DV0F 4FYXB 3M6UA 1IKXB 2KN4A 1NJZA 4DR5F 4EBCA 5DM7Q 3AA8A 2X1BA 1RWOB 2P8IA 4EWTA 2IVFB 2JEIA 4KTQA 1NU4A 2B4PA 1WORA 2B6AA 4IG3A 4RW9B 2LDYA 4DPWA 1Q8BA 5C2CA 1DFDA 1VQPS 1ZTWA 4P10A 3U1NA 3TZXA 2C22A 1HNIA 2KT5A 3PW0A 4ZPTR 4K8RA 1FKOB 4FF2A 3OTBA 4CYUA 4NEZA 1XN9A 3HSZA 5BYRA 1JXLA 1S9GA 5F0WA 1RWXB 4OMFG 4QW9A 4AL5A 3UN2A 3VAGA 4NRUA 2G1DA 3ETOA 3RTVA 2IBOA 2OAUA 1TQLA 3OD2A 4LRFA 3MDFA 5L8RC 5T14A 2W8KA 1ICEB 5F8JA 2KJVA 3UWTA 2ZH5A 1RBOB 2J6SA 4WP3A 1RE1B 2ERRA 2MKSA 3SZ2A 2VODA 2H65B 3G82A 5HANA 2XC9A 3R7BB 1F3VA 3RRHA 5F3ZA 3M7VA 1IKVB 1F1BB 1TL7A 1X0FA 4G3IA 4Q44A 5KFOA 4NZ6A 3M2RB 3KUGA 4J9RA 1VOMA 1GFWB 3FC9A 3R7NB 4TLQA 4WJBA 1W2IA 2QMXA 1U1MA 1RAIB 1K47A 4RW8A 1SB6A 2B4OA 3US5A 3H5UA 3HK2A 1CJUA 2HMIA 2B3TB 3MOJB 1RT4B 2LU1A 4ELVA 1O5JA 3OFFA 3NNAA 2MGZA 4FYVB 1RTHB 1WKKA 4M5HA 5HQ8A 3EDQB 4A8SA 4RBVA 3DRSB 3D0GE 1RT1A 1GTHA 1GAOA 3AOAA 2QYCA 2HBYB 3HM9A 2ZBRA 3L7OA 3G86A 4ZVPB 1VQSA 1XBWA 2V8DA 4YB5A 2VDHA 1J5EF 1NH7A 1WDTA 1P1LA 1M1GA 5KFWA 4ECUA 3MPYA 3H2VE 2MLXA 1NBEB 5HROB 3Q8SB 2AJ0A 1JMTA 3GSDA 4CLFA 2FHJA 2ZE2B 3W2VB 2CQCA 4XDDA 2AJ2A 5CA5A 1RDRA 1S57A 1S1UA 1UVMA 3MTJA 4IRDA 5E3QA 3FCWA 2CPXA 2E66A 3PKMA 1K0VA 4DFMA 5JMNA 3D67A 4O44A 2CJ9A 3CCWA 1H2UX 2GJFA 3CCVS 1X4BA 2KL8A 4K4SA 5HLFB 2BW7A 4R8UA 1OY6A 1MWQA 4R0EA 2DGVA 4C8ZA 2MJNA 5L9NA 2AV5A 1NK0A 2R2UA 2YKOA 2MKJA 2OPPB 4OX8A 3N5BA 2MQ8A 3TVKA 3FEZA 4RUBA 2OHDA 2HW3A 4YQWA 5A8WB 1ULRA 1R27B 5AJ3F 3CDEA 5H9FJ 1R8AA 5CAAA 3L09A 4J37A 1EZZB 1NUEA 3BKUA 1KNZA 3AQPA 3AB4B 1RADB 2VFTA 1ZM2A 1KHWA 4M5MA 2IJRA 4AL6A 1MU2A 2JL9A 4HI1A 1R3NA 2IM0A 2PN6A 3W60A 2HNYA 2F4FA 5E2QA 4ZHRB 3I32A 3CNQP 1PJ6A 2DR8A 1PC5A 3BN7A 1UW9A 3MMCB 3R1LA 2ZWOA 5K5MA 4RW4B 4OV1A 2KT2A 4EGLA 3HI9A 3K89A 4KT0C 3BGRA 1WC3A 5EDWA 1N5TA 4XAKA 2P6TA 5G4DA 2WSCC 3BV8A 1GXLA 5GMEA 4LRDA 2WVEA 3JAMU 2QA1A 5DQIA 3D3BJ 2YWFA 4JV5F 2YWEA 2UUCF 3FEXB 4DV6F 4LQ3A 2BXJA 1VC6A 1BLUA 4ALZA 3D7SB 1H6KX 1SJ1A 1IUJA 4PAAA 1R8CA 4LIRA 4OV6A 2XGQA 2LEPA 3BEGB 1CC7A 3C3LA 1RTJA 1U1LA 1ZM4A 3VQSA 1SJ3P 4YB7A 2RD5C 4DQRA 4B9VA 3C14A 1OQ3A 4Q45A 4KR0B 3R5GA 2HVZA 1OQ6A 1RAJA 3OVBA 1X0PA 3SQOP 1NPRA 5E0OA 2ADBA 3FGVA 2PEBA 1LK5A 4CLKA 5H9EJ 2ZOFA 3W66A 3DDKA 2DGUA 1SV5A 3D66A 2ZC3A 3V81A 4ZITA 3VQTA 3SFUA 2AYEA 4X4NA 3SQGA 3GE9A 2QL7B 4RNMA 1NHUA 4OFZA 2KG1A 1ZPVA 4KIAA 3LOUA 2FUG9 5G0RB 1S1VB 4XIUA 5KG7A 5KFJA 3FFIA 2HFNA 4M95A 1HD0A 2RKIB 2GVZB 5J2MB 2DPJA 2BRKA 2HHTA 1WI6A 2MHNA 1YWXA 2C2KB 3B4DA 3T5JA 1FKAF 2Q6BA 1Y9OA 4OIXA 3D6HB 4C11A 4N77A 4NCGB 1QDUB 4DFKA 1RXOB 2HAIA 2KRBA 2UUTA 1S10A 5M2RA 4ZVHA 2YNGA 1PIEA 3L7PA 4V19X 2CPEA 2G13A 4DJBA 3OFGA 4I67A 2R2TA 2YWWA 2XYPB 3Q8UA 4I2PB 4F4ZA 3UVJA 2E7WA 2RB7A 2K3KA 3EPGA 4A8KA 5HMYA 1IKWB 1YKWA 1S48A 3QLHA 2W9CA 1D8ZA 1S12A 2NXUA 1QAIA 1DHMA 2G0IA 2ADCA 4DQQA 3QAUA 3DC2A 2C28A 3DLEB 4KGVB 4FVCA 3ILOA 2HAFA 3R2CJ 3KNGA 2HQ3A 4OLOA 3NNHA 3M8YA 3EX7B 4QR2A 1RKIA 2CQ0A 4LUBA 4ZJLA 2MKHA 4TXSA 4KFBB 2N4DA 3KLGB 2EI5A 1FEEA 3W5XA 1LWCB 1N5QA 4DR3F 1IWGA 4PG8A 4A8OA 2PI5A 4JI7J 2O01C 4ELUA 1IM4A 4WPAA 1RTZA 4E0DA 3D1OA 1I6JA 1S77D 2HWHA 3I0SB 4RBTA 1Y10A 2QMUB 2H3EB 2MZTA 4Y6IA 5EX3A 5GAGI 2FVSA 1KFDA 2HQFA 1AW0A 1HQUA 4PQUB 2YNIB 2VFVA 1GXTA 1WF0A 3W7BA 2CG4A 3ET6A 2FHOB 4DSJA 2ZJRQ 4FBUA 2H5EA 1RT3A 3K5NA 4P72A 4A8QA 3OR2A 1BQNA 1TZ0A 3MEGB 1X5SA 2DR6A 3QNWB 2A2DA 1VDHA 3CVKA 1R43A 1KVJA 3DI6B 1QLNA 2YKQA 1MN9A 2ZBIA 2E7XA 2DCUB 5A8KA 2CQ3A 4JI6J 1UVJA 2OUGA 3ZZZA 4J9OA 2JX2A 5D0GA 2Z0GA 3RYLA 2UUBJ 3EZUA 3Q86A 4KHPJ 5CZVA 1WD6A 3GWCA 2BJDA 5J2QA 3MFIA 5IXUA 4O3OA 3Q8QB 3QSIA 1NK4A 1HQEA 4TYBA 3B54A 4WKYA 2F9JA 2RF2B 1I51B 3H98A 2UVVA 1HI8A 1FKPB 3MM9A 2WRMA 3CJTA 4Y2IA 3PJXA 2B51A 5F8HA 3C6UA 2RHSB 2GGPA 5B08A 4NWBA 2AF6A 1VK3A 5IOLA 4QOTA 2DHGA 2IBKA 1T9WA 2GVDA 3IWNC 2QV6A 3K5PA 1YJ7A 3OPKA 3OTOF 2L48A 3ZTPA 2CQ4A 2XYGB 2NUHA 4Y3CA 3M9MB 4C6AA 1FWLA 1KTQA 2GIRA 3PYDA 2KYZA 2CQGA 1RA7A 5D0EA 1VBYA 3BSAA 2QRRA 2W4PA 1CJKA 2CAJA 3OTDA 3C46A 3SCJE 4B02A 2ZH1A 4GKKJ 1APSA 3H40A 4J9PA 3K17A 1HYSB 4S0MA 2JFKA 2W2QP 4M5DA 3CC2S 1WELA 1JLBB 3KG1A 3GV7B 2VG5A 2HWIA 3O3LA 1GQEA 5IFMA 4RW6A 2M5YA 3GZ7A 4U9RA 1OS5A 1U6ZA 3KXDA 2JJ4D 1A7GE 1J5OB 4MTPA 4FF4A 2HQGA 3JTOA 1VQ5S 2VOOA 2BQ3A 3NGTA 4FYDA 4YHHF 2HNDA 1R7IA 2MQMA 3ZTSA 2XBPA 4IFYA 2DH9A 3MM8A 4OI1A 4NA1A 4DUYF 2ZDPA 3B78A 3NCPA 4LF7F 4XK8C 3SV3A 5HJXA 1VQOS 2PFDA 1AUDA 1QD1A 5J2NA 5LM7E 4NCBA 1IBLF 4CLWA 1WG5A 4N8OA 5C25A 2MZ1A 4FN5A 3AOCA 1RBAA 2ZC4A 4H54A 4TU9A 5HMZA 1R6VA 2R42A 1PCAA 3I5AA 4NEYA 5CYJA 1NHVA 4OYAA 3QFHA 3T1AA 2RMLA 5KG1A 1NJXA 1RTDA 1WEXA 2V67A 3M8QA 1G4CA 1YRUA 2NXNA 2LQ8A 1C0UB 4H4OA 8AT1B 1WEYA 1PJ5A 2GHVC 2CQ2A 2ZJPQ 4X65F 3H2LA 2MKKA 5GMKa 1N5YA 1PAUB 2RDIA 2OMLA 2V63A 3QWPA 1ZA1B 2BANA 5T41A 4NZ0A 3RZAA 4IH6A 3FQLA 2OEJA 4KPYA 3V6DA 2BW2A 4CNZA 2HRYA 4HACB 2ZBPA 1IN0A 2EG1A 2YKNB 1HBMB 4UF4A 2DNYA 2CJAA 3SFGA 4HHJA 5AXMA 4UOGA 2BBEA 2LFVA 1HKAA 2IC3B 1NSPA 3MM5B 1S5ZA 1UVLA 3M9NB 4ZPWR 1RUSA 1Z2ZA 2WVCA 4ETXA 4I1TA 3SV4A 2JEFA 4O3SA 3CTRA 1AXQA 4LFCJ 2FHJD 3FRYA 2AIRB 3MPVA 3R97A 2I2YA 2OJ3A 4B3OB 3OR1B 3EE3A 3AFGA 2F4VF 3O6QA 2G1HA 3B6BA 3RGIA 4RR5A 3AOBA 2IDEA 1SIZA 4CP5A 5AE1A 3JSYA 3HVWA 3W8PA 1LWFA 1Q16B 4AQYF 2VFSA 3NY0A 1GTEA 1XWLA 2JZ5A 2UXCJ 1REVB 3JS9A 3DKDA 3K59A 2HS0A 2VBZA 1MROB 4R5PB 1WDDA 2JC1A 4PPDA 2IM3A 2WW8A 2XNQA 4N7TA 5HBMA 3CC4S 3E51A 2EEYA 1PO6A 4YFUA 3KLHB 2HHUA 2YKAA 2ZFHA 4OI0A 2M88A 3MECA 4F36A 4WYWA 2WVBA 2DHSA 4KO0B 1VQ7S 3QBCA 1RT2B 2M70A 5HP1B 3UNGC 2MZSA 3OXGA 1SH3A 3CPWR 1HNZF 4ID8A 4CM2A 2LEBA 2MSSA 2V68A 4IFVB 3KNAA 2FJVA 1S6QB 2Z2YB 3SSQA 3PTWA 3IS9A 2RQKA 5DDOC 3RR7A 5T7LA 4X4SA 3FBCA 4MKBA 4RZRA 1TKZA 3QRPA 1RWNB 4LVNP 2KHCA 1DARA 4F7VA 2QLFB 1U2FA 4M63A 3FDSA 1UJ4A 1R8HA 3GYXB 1N34F 1WF1A 3I56S 2BABA 4F2SA 3TUZC 2YPZA 3ENQA 3NWRA 5THWA 2V50A 1AROP 1R8PA 1NO8A 1BWVA 2DNMA 2CRLA 4GKJJ 3NRBA 4JBCA 4B3SF 4KPCA 4O3PA 1EX8A 3IMQJ 2VDIA 1IBKJ 4EYHB 4J90A 3NL0A 4JV2A 3MMJA 4IG0A 1SIWB 1U1RA 5KFNA 4AD6A 4ZLLA 5A0YA 2UXDJ 1T7PA 3QATA 3D54A 2DR9A 5HROA 2RQ4A 4DX8H 4JI1J 1WTFA 2ZE2A 2FD2A 2XO7A 4BS2A 3G8SA 2ZDOA 2FY1A 4MK9A 2XZWA 1OSCA 4IO1A 1FWKA 3D3CJ 2C42A 2B9WA 1FTCA 2HNZA 3GFHA 3QYYA 2IY5B 2IPOB 2LXFA 1JLQB 1T95A 3UDLA 4KQZA 3EVMA 4HT5A 2BVZA 2F3JA 2Z2ZA 4OJ1A 2F8EX 3NS5A 1U8WA 1TKTB 4CO3A 3M8ZA 2I6WA 5HJYA 2RVJA 2AGOA 4ZVQB 4KGKA 4DUZJ 5A6WA 4NMLA 2G0CA 5A8WA 4OX7A 4OHZA 2RUGA 4KYZA 1FHTA 1XMQJ 2VPYB 1FJCA 3KJQB 3Q8YA 4AL7A 4ECQA 5K8NA 1VC0A 3QT5A 4G65A 3THPA 4I6AA 2FYXA 2UUAF 4B9TA 2FHMA 3RAQA 5JUMA 1U0HB 4PWDB 1X5OA 2M8DB 4LF8F 1C1BA 4B3TJ 2YX1A 5KFQA 3E2EA 3P6YC 3C15B 2L41A 1FDDA 4KV8A 5DO2A 3CC7S 3UI3A 1YI2S 3H0PA 1TKXA 4AFFA 1SQGA 1M5PC 5HSPA 3NKYA 4WFNQ 1X4EA 3BDPA 3DDIA 1HPZA 5B0CA 2RNEA 4DV0J 4EYIB 5BJRA 4PRFA 4CO0A 1QUPA 1H74A 2B56A 3DMJB 4DR5J 4G1QB 4ZCKA 2VA3A 2XS2A 3J7AN 1LEOA 4LR8A 3UD5A 3AJ2A 2PD1A 3MM7A 4CM0A 3L4BC 2BQRA 4ECSA 3M6VA 1WJ9A 1JB0C 3H4BA 4QYZJ 5C2GA 2HBZB 3PX0A 4LF5F 1V3SA 4P71A 3LP1A 1PJ7A 4ID5B 5E3AA 4XO0A 3GLJA 1GMWD 3UW1A 4FBTA 1KS2A 2RE1A 2VJUA 2Z4PA 2VOPA 5ETQA 3MR3A 5IV4A 2XHCA 3ZFVA 4FP9A 3HSGA 2E9TA 2DGQA 1IVZA 1L3KA 3GG0A 3W1YC 1TL1B 3CJ2A 2HFSA 4N5SA 4DBQA 4JV0A 3POTA 4HH1A 1UPPA 2OD4A 4IQXA 4UTGA 2GMJA 4ZKAA 1DY3A 3UR3C 1UMJA 2DCLA 2R7OA 1RTIB 2DNPA 4P6QA 3NGUA 4M5LA 5C24A 1S1VA 3TAMB 4FVMA 2GO9A 2KKHA 2KM8B 4KGZB 1RAGB 2PE8A 1XR6A 2Y1JA 2W01A 4RU9A 2H48B 4NCGA 2J9DA 1HMVB 4NXMF 3JTPA 3A8EA 4N76A 2VASA 4RL1A 4O3RA 2ATLA 2RS8A 4Y28C 1X4FA 2GX8A 1U2CA 3CIZA 4DX7A 3GCWP 1W2BR 4GVBB 4OHXA 4I2PA 3JSBA 2WOMB 1L5UA 1DJ0A 3ETMA 2ZHOA 2FZGB 5FIIA 4XDCA 2L08A 2XTJP 1IKWA 2V8GA 2AHOB 3HFZB 3MOZA 2CJXB 5J1EA 1NNDA 3MUVP 1C4CA 1J5EJ 4BDPA 4I6WA 5KFPA 4O4GB 1XNQF 2DRAA 3RB6A 1N5SA 1HD1A 1Q81T 1UEKA 4LFBF 2NSBA 3HHLC 3FSYA 2OFHX 4CRJA 3BSCA 2JLFA 2EC2A 4JI3J 4FXWA 3WBZA 3ISZA 1S4FA 2ZH4A 1HQ2A 2HHSA 4O3NA 3GSIA 4PG6A 3MCOA 2XEXA 4K7QA 3KUEA 2H4YB 4F0MA 2JNJA 3G8TA 3KLGA 1TFYA 3HHDA 4ED6A 5D4LA 3ULHA 2R7XA 3VAHA 2J5AA 2IMOA 4CTAB 2DK2A 1UFWA 1FWPA 1UA0A 3RG6A 1S1WA 1UVKA 4F04B 2YWGA 2J8AA 2W9BB 3N0VA 4ZS6A 2K06A 4IH7A 2GFFA 1KC8T 3E01B 4C0OC 4FXDA 4PQUA 3I96A 3MR5A 2PMZD 3KK3A 1X4CA 2O1PA 1T9XA 1SL1A 2NPFA 5AJ3J 2J0WA 1UL3A 4EK2A 1X8DA 2BKNA 8ATCB 5D4OA 3TAQA 4ZPCA 3IO1A 4FF3A 4QIEA 5HMWA 2C3YA 5HAOA 1HBOB 1ZH5A 1JWWA 3MEGA 3FJ2A 3PACA 3SCLE 3VHQA 4EUVA 3PR4A 2ZH3A 2EG2A 3VVTA 4ERDA 3HT3A 2V4RA 1LV5A 2G4BA 4HI2A 2PDAA 4B3MF 4DS4A 3O2IA 4F8RA 4L75A 3VAIA 1EQMA 2WSEC 4IH5A 1FFSB 1YDLA 3U1LA 3J81U 3J80Y 2E5JA 5BYQA 2IRUA 4MK7A 2QN6B 5EWGA 3AA9A 1JLEB 2W25A 3EZ5A 3GTYX 4P75A 3I9ZA 3HXMA 3P8BB 4NLXA 3G9CA 1O8BA 2RF2A 4JYAF 1FKPA 4MKAA 2C2EA 2AEFA 1RHJB 4JV5J 1FNOA 5GAHU 2UUCJ 4DR2F 3FKBA 4DV6J 1LNQA 4LF9J 3RU0A 1TAQA 2LXUA 3W65A 1YLXA 4PUOB 5LJ3Y 5B0FA 5L1JA 2P9CA 1IM6A 1RWVB 3MEDA 4PWWA 2CPFA 1VJWA 2PA3A 2QA4S 3CJ5A 4PYAA 3D1QA 1ZAWA 5CHCB 3R6LB 3H5XA 1WOSA 1FVSA 2VL1A 3PXGa 3FSXA 2HRUA 1HWJA 2RSQA 1YBTA 1HYSA 3CCLS 1JLBA 3RR8A 4CLSA 3M1VB 5IZHA 3A1YG 3UQSA 4C8LA 3M2VA 3ONQA 2MPUA 3PJ9A 1NSKL 2HHPA 2IVYA 3V4IA 1FX2A 4ZVGA 1CLFA 3W9IA 2CDRB 4O3QA 1RQ0A 3DOLB 2DH8A 1UPMB 3FK4A 2DR7A 1X4GA 1D9DA 3PO5A 1SJ4P 1QM9A 1NAQA 4LBHA 5LSRA 2GMHA 3JTNA 2MY8A 3TRGA 4M5NA 3AJDA 3PFOA 5DETA 1Y3JA 2CPYA 2XMAA 3LH2S 4DX5A 2HVEA 1NXIA 2ILYA 1K8AT 3HSDA 2O3DA 3Q89A 2O66A 3BREA 2X1FA 3TR5A 2OSRA 3GR1A 1KONA 1N0VC 1Y7PA 2P9GA 2CJKA 4PEOA 2EPIA 2V69A 3MMAB 4OX9F 2ZJQQ 5DZ6A 4DU7A 4DR6F 3VTIA 3R1HA 3SI8A 5HQMA 2DB1A 2XI2A 2ZBQA 2GIFA 3CJ8A 2D3UA 2F63A 1S6PA 4ZIVA 2CNLB 1NKEA 3MAAA 4NI2A 4EEYA 3UN5A 1F9HA 1CQMA 1D3WA 2YKNA 1HBMA 5DDRC 1NH8A 2RS2A 1E6YB 2DEJA 4NMXA 1RSCA 4DR3J 1GH8A 3QJLA 1MLAA 3CW2C 4J9KA 4X4PA 3KHGA 1XTZA 1RWPB 1FE4A 1LWXA 4UOCA 2X1GA 4DPXA 2U1AA 2RUSA 4UT4A 5L46A 4A8WA 2DO4A 3TI0A 4B3OA 2CQIA 3HJFA 3A12A 4Q43A 2WB4A 5B09A 1M5KC 1IJFB 2CNKB 1FDNA 4BHQA 6FD1A 3CJ0A 4K4WA 3RUBL 3C2PA 2K8GA 3OV7A 3HFKA 4LF4F 3T1YF 2EFOA 1X31C 1DTQB 4F4AA 3OL8A 1D8YA 2MLYA 2EBGA 1UKUA 1DTTB 3WX4A 4PCQA 4QJVA 3CDUA 4ZMMA 1QE1B 3DLLQ 3CMQA 2HKEA 3JSRA 3MPDA 1WACA 3G8QA 2XO6A 2FGCA 2LQ9A 3KLHA 2FDNA 5I42A 4C4WA 4WIIA 3NCQA 2XLKA 3GFXA 4J7CA 1LW0B 2XMJA 3I0RA 4G1PA 1ZAXA 4L76A 2H5IB 1NK6A 2FVCA 1DLOB 2MZRA 4CZCA 4KO0A 5LL6d 1RT2A 3F0NA 1U09A 1CEZA 3THVA 1KFSA 2V2QA 4IFVA 2V0NA 1S6QA 1RABB 3S01A 4WU2A 3T9ZA 2KXFA 2ZH2A 1PBAA 2D3OR 3DGPA 4X66F 1MMDA 1UA1A 3OHAA 3TNVA 3UPFA 2CYYA 4PQAA 3IM9A 3UO0A 5DG8A 4DV4F 4L72B 2Y9HA 3MD1A 1R31A 4DMZA 4Y65A 4I2QB 1AB8A 3SYZA 1P8GA 1RAOA 3T5LA 4K2XA 5DDPC 2HZAA 3S6EA 3GU0A 3K58A 2VFUA 1CJTB 4CQ1A 2XI3A 4DSEA 3F44A 3H59A 4DI6A 2GQ2A 2ASLA 5I3UA 5EWEA 3ITHB 4DR4F 3PKYA 2VG6B 5CCMA 3OVSA 2VUGA 4ZJQA 4Z37A 1QAJA 1ZAVA 5BR8F 1EP4B 1FE0A 5I4MA 4F50A 2OPSB 4ZVRB 3VAKA 5SUHA 3M2UB 4WZQA 2GNKA 3S8SA 1O0PA 2H1YA 3GIKA 4DL0C 4YHHJ 3Q2SC 5KFDA 1NB7A 3UD4P 3C6TA 1RHMB 1Y11A 2ZD1A 4IKAA 4LF7J 2VA2A 2E29A 3VAJA 4OX6A 3BR8A 1PYOB 1N88A 2W7AA 3P45B 3I87A 4DX6A 4DUTA 1R89A 1IBLJ 4Y00A 4OJGA 4C3LA 1YVFA 3GONA 1JLQA 1WKLA 3OXLA 3CMES 2I5JA 2MQLA 2ZUGA 5L1LA 4F26A 2XMWA 4DLGA 2E1RA 4K50A 1VS3A 2CKWA 1VHFA 5IT4A 1YZ6A 1IQZA 1VQYA 5IQQA 5KAKA 1VBZA 2DY1A 1Y00A 1SUQB 4KHRA 1S6OA 3PIOQ 2HGMA 3AD9C 4TY8B 2W24A 3O8WA 2BDPA 2IRXA 2EBEA 3CJQA 5B7WA 3KJFB 2F7VA 1U1KA 4X65J 2AU0A 2C2OB 4QR1A 1KQKA 2BA9A 2OPRA 1P6TA 2ZOGA 2KT3A 4E8UA 1FVQA 1U0HA 1Y4ZB 3JYTA 2VBYA 5A76A 3HF5A 3RW7A 3LWMA 3DYAA 4AE5A 1KVKA 2Q6CA 2R7TA 3PW4A 1T05B 3TWZA 2DXFA 2OSQA 1JJCB 1IKYA 2R7UA 4PZVA 5F9NA 2HQCA 2CZVC 2IJFA 1C1CA 3LAMA 4X4OA 3A8JA 3QIPA 2VHGA 4G6VB 3DMJA 2AGPA 3KHHA 2ZZMA 1DRZA 2CPJA 2V8PA 3G4SS 1XIQA 3M32A 4HHHA 2NXEA 5AE3A 2F4VJ 2HVIA 2OI2A 1QTNB 1S0VA 4I69A 1RB0A 4UQTA 1HI0P 2RU9A 4AQYJ 2QJ3A 2EFPA 1S7HA 3FVYA 4UZCA 4MFBB 4F4KA 2W4CA 4ITSA 4I7FA 2YNFB 2ZM6F 3MEKA 3DFEA 3KJVB 1Q0NA 2GAHC 3DRPA 3D1HA 5HK4A 4ECZA 3O44A 4OHWA 4AT1B 4X4RA 4WFAQ 4LT6A 4ER8A 4HT7A 2V34A 3MM6A 2R8HA 3LW5C 4K4VA 1S9EB 2DY9A 2J6TA 4LSLA 1T03A 3DN9A 1WG1A 2J7WA 2XQCA 4DEZA 1KVIA 1RTIA 1ZM3A 4DPUA 2HK2A 2F8HA 2LU2A 1RWKB 1TTHB 1VRTA 1PKUA 1OIAA 4YR3A 3TAMA 1SI9A 1HR0F 1UVNA 3DM2A 4HVZA 2OEKA 4IRKA 5A2QU 3OTEA 3FUYA 3Q0AA 2KZZA 3PYGA 4IOCQ 3H4DA 1CS4B 3ZZPA 3DOKB 1ZYQA 4A47A 2W9AA 4EO6A 1HMVA 3EGZA 1N34J 3X3UA 1SL2A 5ETOA 1X4DA 2DNGA 3JQKA 4I4BA 1BHNA 3MI7X 4GVBA 3DLKB 4GRSA 1GT8A 4ES2A 3W64A 2NSCA 2HYIB 2BJ7A 2MTLA 2CPHA 4FZVA 5KFSA 1M5SA 1U02A 4QIGA 3NP5A 2R8KA 4DCOB 1GK8A 4ECVA 3ENWA 2WW4A 3QO9A 4FKXA 3KDNA 5M2UA 1KN6A 4KRWA 4DV2F 2FQQB 1NRKA 1RYRA 3M8RA 5DLFA 3H8YA 3VGSA 1L3UA 4NYPA 4QWAA 1LFPA 2UVRA 3CCUS 2C2NA 1JKHB 1U1NA 2PSZA 2ZKUA 3LPYA 3TA0A 3W61A 5F3TA 4WK3A 2YWKA 4TYAA 3GMGA 3ZTQA 4F3MA 3DRRB 3E01A 1KLMB 3ZNJ1 3I4PA 1AFJA 3VZIA 4B17A 1T8EA 2IAJA 2RRNA 3HULA 1RAAB 2F9DA 4F4WA 3R5AA 3LP0A 1Q82T 2UUAJ 4JP8A 2FPHX 3KJNB 2R7QA 2Z57B 1OO0B 1ITPA 2IA6A 3CCQS 2UV8A 1U45A 3BF4A 4DV5F 4CH0S 3GILA 5KFLA 3BR9A 3GPAA 3HVTB 2WSFC 2NR0A 2HURA 1U24A 3EGVA 2F1FA 3RB0A 5IT9Y 4USVA 2FZKB 2K1RB 4NLVA 4LF6F 3KKFA 4R0JA 4QCLA 2ZUAA 1JLAB 4ZVFA 3FMBA 4P2MA 2XNRA 2QT7A 1N33F 1D1UA 3GV8B 3I31A 2M4MA 2QTWA 1TUGB 1RWUA 1JXEA 2QSFA 5L38A 1I94F 3RRGA 2KFYA 3DLBA 1T9UA 3J7YU 2XZDB 3Q8PB 3R5CA 3R2DJ 3WX8A 3EGWB 4BBYA 3VVUA 2R9LA 1FJEB 3HVAA 4RX6A 4DPOA 5D3GB 1F5AA 1XEZA 1KRPA 4LBPA 4TY9A 3QZ8A 1JK9B 5ETTA 2QEXS 3ENAA 2D74B 3D28A 4MMOA 4EU0A 1G6BA 3LGHA 1FDAA 1RACB 1RU2A 2EK1A 2B6AB 1K73T 4IG3B 3OFHA 4LF5J 4FNIA 5CYQB 2DVIA 2NYIA 4BC7A 3FRZA 3PX6A 1L3SA 1Z2LA 4K4XA 2JEJA 5IC6B 1JXVA 1S9GB 2X1AA 3F56A 2V4QA 4CO1A 1VHIA 4ZA1A 4H4KA 4ZPAA 2AEMA 5I3PA 2NXCA 1IWAA 3HMJG 1NZ8A 2BE9B 4CT9A 3T1HF 4USJC 2HIQA 3M1VA 3MR7A 1GX5A 4WF9Q 3HKWA 3KLFA 2EFQA 3C16B 1RLCL 4JV1A 1KP6A 2IDLA 4RLEA 1X5PA 2AMCB 4J9MA 4NLUA 4EI2A 2XLIA 3PEJA 4ZIWA 2FGOA 4ANCA 3L7UA 2QL5B 3PVXA 1BWEA 1K9MT 2Y0BB 3P3DA 1SKWA 3R5JB 1X60A 3Q8RB 4YP3A 4DQIA 4QU7A 4LRBA 1K1SA 2FZCB 4L74A 3LQVA 5DDQC 4RW8B 3QT6A 1R0AB 1AYEA 1CJUB 4JB8B 4CO2A 4C8NA 4ECRA 4M1KA 4NXMJ 1W25A 4K0KF 4FKYA 3LO3A 2V8VA 3PIPQ 2IIHA 4M5JA 1IXKA 2P2CB 4Z2XA 4QBUA 4M5GA 1RGVA 4J91A 3HO1A 1HHTP 2KI2A 1FK9A 2NS1B 3W2WB 5DGBA 3PRBA 2QL9B 3UDEA 5GAEI 1Y5LB 2AEJA 1CC8A 3BDEA 4ZCLA 1YBUA 1RI7A 1HWUA 3CF5Q 5ETKA 1XNQJ 3TZZA 1FXRA 1VQ8S 2GW8A 4YY3F 1WG4A 2A2CA 1GMUA 1PILA 2E1PA 3CWJA 2J7KA 4NOHA 4YN3B 1XC9A 1S6UA 1S76D 2ATCB 1PBUA 2IJNA 5B0BA 1DAXA 1E6YA 1VGYA 4B9SA 3BB5A 4I56A 3Q22A 4DCJB 2C1EB 2C2DA 2ILZA 4Y34A 3IXQA 2BJ1A 2XWYA 2DNNA 2E44A 4O44B 4ZCMA 1F0XA 1N32J 3NGDA 1EETB 1DQAA 2VPZB 5LMNJ 3PX4A 4OYIA 2XLJA 5GVQA 2SXLA 3X1LB 3OQ2A 4GC7A 2HQIA 1V9OA 2KHDA 1VISA 3GIMA 4WFZA 4LJMA 2PFFB 3AODA 4W90B 3BH6B 3S1TA 1XK8A 2Z2MA 2JFDA 2QA2A 3BGUA 4USHA 4CO5A 3GCXP 2GA7A 3PHTA 4Q0BB 4CCHA 1DQ9A 1KWMA 4JI5F 1DTQA 3RW6A 5ETNA 2E1CA 4MJKA 2CJQA 2VONA 3HD2A 1DTTA 3AH6A 3MEEB 3IG1A 4ICLB 5GADI 2H51B 2DRDA 4B3MJ 5D15A 3DLGB 4TN2A 4YS2A 2B5JA 2CWXA 2NZ4A 4KSEB 1HLWA 2MKIA 2KYXA 2XMKA 2DBBA 2Q79A 1DLOA 3OL9A 5EX0A 1I1GA 4OJHA 1NDCA 1XMBA 1M90T 3GYNA 2QE5A 2VU5A 3PCOB 1U8SA 3QGHA 5HMXA 9ATCB 3PM9A 4F4XA 4YUDA 2QZ8A 2WCXA 3WDOA 2EKNA 1PYSB 3NBPA 4WXWA 4HEA9 4JYAJ 4HDHA 1SJFA 2FB0A 1KQGB 4ZK7M 4ELTA 1Y5IB 2DGOA 3DOMA 4DV1J 1PAEX 4AYBD 2Y8WA 5ITHA 5HQLA 4DR2J 3BKFA 2K7KA 2YTCA 3DXSX 4K5RA 4DQSA 2MQOA 2R7SA 1TL3B 5E41A 2LVWA 5KFIA 4C8KA 3WQPA 1U1QA 2YWHA 4I2QA 1SKSA 3L3CA 2VBWA 2JVOA 5B0AA 4Y2CA 1ACMB 1Q78A 2HGNA 2GQCA 3OTCA 5F9LA 3IN5A 3C14B 2ALZA 1QAXA 1QSYA 2AP6A 2DH7A 4JI2F 1S0MA 5DM6Q 1CJTA 1NDKA 1FA0A 2LQJA 1HARA 1U7LA 3OSPA 2H5JB 1QTMA 3ITHA 2VG6A 1NCLA 1FDBA 1BC6A 2APOA 1RWWB 2UVWA 1EP4A 3ZZ0A 5F0UA 2OPSA 2KTQA 1FTRA 1U47A 4CLLA 1NDLA 4YB6A 1BE4A 4WKRA 1RP5A 3R3TA 3W3SA 1VIOA 3SDEA 5LOQA 1KQSR 3JAMY 1KD1T 1LOUA 4HH0A 2NLWA 2HHHF 4O0NA 1RLDA 2AJQA 1X4AA 1BQMA 4TLRA 5IWAJ 3ZZTA 3M8PB 5IT0A 4HYKA 5HL7Q 3F41A 4C11B 2PEHA 5AXKA 2EFNA 3ZNUA 2YNGB 2NREA 1URNA 3OLAA 1YJUA 3WC2A 3NGSA 2FJBB 2GO8A 1HW9A 4O0IA 3G6YA 1LXJA 4TY8A 3UVJB 4K4TA 1LFWA 2FVQA 4ZVOB 1F2GA 1AZSA 4MKVA 4EMDA 4OX9J 4DR6J 1AUSL 3HHEA 3QLHB 2A18A 3I55S 4LF1A 1N36F 4JOUA 1FRKA 3OSNA 1GMWA 1RA6A 1YRTA 1JLFB 3LALA 4C8YA 2NZCA 1CJVB 2HEKA 4B9NA 4C9DA 1ZTTA 2A0FB 2I8EA 4DSKA 1UEVA 2AYBA 4H4MB 1YITS 4F3OA 3CJ3A 2P6SA 2R2SA 1H72C 5A8RA 2V4JB 4KGMA 2CWKA 3CSKA 3AQOA 4QYZK 1SJRA 2EFVA 1OJ4A 3SIPB 2Q43A 4ECXA 1TK0A 3THTA 4OLPA 3AHPA 2VFRA 3KMSA 1WC0A 4YEAA 2B7CB 2M8HA 3J7ZT 3HLUA 4CT8A 3ISND 1AFIA 5BXIA 3AY0A 2ZEJA 3PV8A 1AT1B 4OZLA 5FLXY 3D0HE 4DXLA 1UW4A 1KQFB 3J81j 5FDLA 4QIWD 1HQUB 3QT7A 4K5SA 5SZTA 2BX6A 1LKZA 2POKA 3U1MA 2NUUG 2JDJA 2XY6A 1UWBB 3ET6B 1GXUA 3CULA 4M5KA 3TUIC 3ILLA 3T1YJ 4ILRA 3TQ1A 1RT3B 4U7UD 2DHHA 4HTJA 2YNFA 3TZWA 4Q2LA 3OR2B 2UXCF 4QQBA 4FPIA 5DLGA 3PEHA 3R5BA 4NLRA 4QWBA 2AWZA 2HBRB 2HZCA 1HHSA 2G0JA 4TQRA 3GIRA 4ES1A 3MR2A 2ZH6A 2CDQA 1F9EB 3QZ7A 2LP4A 5EN1A 2KXNB 1XERA 1RT7A 3R6GB 5J2QB 1U25A 2P9EA 5JJBA 3GFZA 3BQ2A 1JNZB 4P52A 1B0VA 1M5VC 1FFGB 1MMNA 4USIA 2Z8QA 4Q5VA 2LA6A 2A6OA 1U1PA 2CVIA 2CNOB 2MZJA 4A8YA 2YPYA 2ASDA 1HQEB 4MT1A 2WTFA 3TVYA 2E5IA 2YXLA 3M05A 3N6NA 3KUHA 2PI4A 2ASYA 2C2MB 2G2OA 2EWHA 5K14A 4X66J 2PT0A 1FJ7A 2DEIA 3TOQA 1H7WA 4HDGA 1CS4A 4NYOA 1S72S 1E6VA 4FYYB 4GC6A 4CLZA 3KHRA 4DV4J 1YJRA 2GVDB 2MJUA 4DZ6A 1LWEB 3LGMA 4ENOA 2QLJB 1WC5A 1NEEA 5C42B 5AXLA 2YKPA 3ELHA 3MTKA 5IS2A 2Z2LA 2Z56B 1F60B 5KT2A 4U6PA 2HHVA 3DLKA 1CJKB 4QWEA 3VV2B 4P2XA 1IBKF 5D0RA 4L6V3 3BZQA 1XR7A 2LKZA 3CE8A 2BEFA 4DR4J 2XWXA 2RQCA 3OUYB 2YBVA 2RRAA 1RU1A 4OYWA 4LSNB 3BSNA 1Q7YT 2KXHA 4RW6B 5BR8J 4ZLPA 2YH0A 1G2EA 4WCEQ 1WC6A 3HVRA 3IR7B 3SSRA 2HG4A 1MMLA 3O5TB 1N52B 2DKOB 5CYMB 2VJVA 3CD0A 2V9WA 3M30B 4DHVA 1JLGB 3C19A 4IFYB 3MM8B 3MPWA 4LIWA 1N6QA 4A4JA 2Y1LB 1T3NA 7FDRA 5K8PA 5KFZA 3N6MA 4NLQA 2YX7A 2R8JA 1TVRB 5KFAA 4F25A 2AX1A 2DGXA 5C25B 1SXLA 2L9WA 4DF8A 5U47A 4CI0B 1T0TV 3CD5A 1WUUA 2X7IA 1ZETA 1T9YA 1KLMA 2BZ2A 1HNWF 1PG5B 1RTDB 5EUHA 1L3TA 4P74A 3A8KA 1IQTA 5KFVA 2YQ3A 4DUZF 4WFYA 3CEDA 4B9MA 4N8NA 4H4OB 3VAMA 3P5TL 1S0OA 2QX0A 1ZZNA 2DITA 3RAMA 3MAQA 1IKXA 3K5OA 1N5YB 2NCKL 3A13A 1HL6A 1RWMB 1UFLA 5L1IA 2XG8A 4WXOA 1M1KT 5MAOA 2C3UA 4B3TF 4YR2A 1R8BA 1YJ9S 2DGWA 4PXCA 5FD1A 3UNYA 5KFMA 1P1TA 2K1RA 1FRXA 5LXRA 4RW9A 4EFAC 1MWZA 3HP6A 3SCKE 4KE5A 2XMUA 4JI8F 4OJ3A 4ED8A 2AQ4A 1Y3KA 2KG0A 1FKOA 3TVZA 4MKYA 1JLCB 1N8RT 4DQPA 4ECYA 4QYRA 2UP1A 4B08A 2OGUA 3N01A 5D3GA 2V8HA 4ES3A 1LXNA 3BGOP 2UU9F 2BYCA 1R0BG 3CO9A 1GEHA 3BSOA 1NLKL 2IHR1 1FCAA 2NXJA 2OTLS 1SH0A 3CDWA 2FTRA 5CYQA 1HNXJ 3HJVA 1HA1A 1LWFB 5E33A 1NPKA 1IKVA 3NOGA 3T9NA 3H42A 2JLGA 1BD6A 4PXEA 3QIDA 3RBZA 7FD1A 2E5LJ 2ZM6J 4JI0F 4TQSA 1DBDA 1HHQA 3M2RA 1BUXA 3QGGA 5DZ7A 1ZBTA 2R7RA 2D9PA 1NK9A 4HKQA 5D0HA 1H7XA 4HTIA 2E7VA 1FNMA 4D3HA 5HBMB 4X4UA 4K4UA 3ZZOA 1Y0HA 5KFCA 1BMQB 3T5HA 1FD8A 3T3FA 3PZPA 1XNRJ 1F9FA 5A6PA 4C8OA 2OELA 1FJGF 2ZBCA 3MECB 1RT4A 1RKJA 1YQHA 2N3OA 1U6BA 2OTJS 2A6MA 2HLUA 3C16A 3UCUP 1B64A 1UEUA 1RTHA 4LQ9A 2VC0A 2YNHB 3HHLB 2YKMB 3VAFA 2R8GA 4LSZB 2OEMA 5JVHQ 3NG8A 1TV6B 1QSSA 3DRSA 1HR0J 3RAXA 2XGPA 3UR0A 3Q23A 4UW2A 3D6MB 4C7QA 3IS9B 5KT6A 2UZAA 4KC5A 5T7LB 3H25A 2HFOA 1R0AA 2HSEB 2B7BB 1TKZB 1A6LA 2Y0SD 3Q83A 4DZDA 2DHXA 1XQIA 3B4MA 5ETPA 4QWDA 1YIJS 2BJ9A 3HDSA 2DR5A 1KOHA 1EKSA 5HN0A 1DZ5A 2R4FA 5EHHA 3W2VA 4ZN1A 2E5GA 5DS7A 4DV3F 1MWYA 1WOOA 2R7WA 4ZPDA 3CDBA 1X9MA 3W2WA 3DU6A 4NXNF 3IRXB 2BQUA 4Q8FA 3R27A 3MMBB 4NL5A 3TAPA 4DL7A 4IG0B 3TANA 5HLFA 3W9JA 1KKHA 2COLA 2CQPA 2JRSA 3TARA 5A0YB 5LMUJ 3JQMA 1RAFB 1V5IB 3AAWB 4XPEA 4DV2J 1SL0A 1IBMF 1FERA 2OKQA 1C0TB 4P9SA 2D7SA 4BWJA 1B0PA 2OPPA 4JI3F 2DTJA 4UOHA 4XPCA 2A1BA 2DXDA 2RDJA 2HHWA 3BQ1A 3QRRA 4U7UK 1YK9A 1VR6A 2DHAA 2GIQA 4JI4F 1Z1ZA 5HVGA 2HNZB 2GJ2A 2BACA 1EETA 3QQCD 4DFPA 1VK8A 4YOEA 2R8IA 5HO4A 1WOPA 2XY5A 3BO2A 4BWMA 2C2RA 1KDNA 4OI4A 4ZHRA 5LT5A 2KVIA 4PWUA 2ZVIA 4U7CA 3SMZA 1S9FA 3MMCA 4QIFA 4I0WA 3U27A 5C7PA 4DR7F 4Q0BA 1XMOF 1UZDA 4RW4A 4MIWA
chains in the Genus database with same CATH topology
1HKAA 3HSZA 2BMBA 4M5LA 4M5IA 1F9HA 5ETLA 1RTZA 1KBRA 2F65A 3ILIA 1RU2A 1TMJA 4CYUB 1IM6A 4CWBA 3UDVA 3ILJA 3MCMA 5ETRA 3KUHA 3HSGA 3HD1A 1RAOA 5ETVA 1EQMA 1RU1A 3MCNA 3KUGA 2QX0A 1TMMA 2CG8A 1DY3A 1HQ2A 3ILOA 4M5HA 3UDEA 4M5JA 4PZVA 5ETNA 4F7VA 5ETMA 1RB0A 1CBKA 5ETOA 3HSDA 4AD6A 1EQ0A 4M5MA 2F63A 5ETSA 4M5NA 1G4CA 4M5GA 1Q0NA 4M5KA 3HT0A 3QBCA 5ETTA 5ETQA 3HCXA 3HSJA 3MCOA 3HD2A 4CYUA 5ETKA 1EX8A 3IP0A 3KUEA 3UD5A 5ETPA 4CRJA 3ILLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKA A;  3HSZ A;  2BMB A;  4M5L A;  4M5I A;  1F9H A;  5ETL A;  1RTZ A;  1KBR A;  2F65 A;  3ILI A;  1RU2 A;  1TMJ A;  4CYU B;  1IM6 A;  4CWB A;  3UDV A;  3ILJ A;  3MCM A;  5ETR A;  3KUH A;  3HSG A;  3HD1 A;  1RAO A;  5ETV A;  1EQM A;  1RU1 A;  3MCN A;  3KUG A;  2QX0 A;  1TMM A;  2CG8 A;  1DY3 A;  1HQ2 A;  3ILO A;  4M5H A;  3UDE A;  4M5J A;  4PZV A;  5ETN A;  4F7V A;  5ETM A;  1RB0 A;  1CBK A;  5ETO A;  3HSD A;  4AD6 A;  1EQ0 A;  4M5M A;  2F63 A;  5ETS A;  4M5N A;  1G4C A;  4M5G A;  1Q0N A;  4M5K A;  3HT0 A;  3QBC A;  5ETT A;  5ETQ A;  3HCX A;  3HSJ A;  3MCO A;  3HD2 A;  4CYU A;  5ETK A;  1EX8 A;  3IP0 A;  3KUE A;  3UD5 A;  5ETP A;  4CRJ A;  3ILL A; 
#chains in the Genus database with same CATH topology
 3IA0 A;  3D6F B;  4G1I A;  2J8S A;  2MMY A;  2LA4 A;  1FFW B;  5KFH A;  3VAL A;  3HHN B;  4DV5 J;  4V1A k;  4C97 A;  2HZV A;  4ZJO A;  1C1B B;  2HWT A;  3MEE A;  3LUY A;  4OZ3 A;  4ICL A;  3BYP A;  4LF6 J;  3DLG A;  3GJQ B;  4KV8 B;  3UCG A;  5KFT A;  5J1N A;  1TKX B;  1N33 J;  3NS6 A;  5CXT A;  2C3P A;  2C3M A;  1VQ6 S;  1TL4 A;  3DGV A;  2V9K A;  1HPZ B;  2MHE A;  3TA1 A;  1I94 J;  2EXU A;  1X9S A;  1Q8L A;  2W8L A;  4NA2 A;  2QG9 B;  2V2Z A;  3CUN A;  3H90 A;  1U1O A;  4NLY A;  1U6F A;  1GNK A;  2CNN B;  2QMW A;  3ILI A;  4X62 F;  4OYZ A;  4Y2A A;  3MM7 B;  2LQ5 A;  2N4C A;  3RBD A;  2CQ1 A;  1SQE A;  4AND A;  4ANE A;  1X4H A;  3P96 A;  4D3G A;  1Q7L B;  2D9O A;  5KOW A;  1UP1 A;  4NLT A;  3TQE A;  1EAY C;  1NPP A;  4LF9 F;  1TL3 A;  1RK8 A;  4A48 A;  2XB2 D;  5D4N A;  2WAQ D;  1SKR A;  5H1S V;  2BJ3 A;  2UXB F;  2WON B;  3N79 A;  2JC0 A;  3LP1 B;  4DG1 B;  3AB2 B;  1S97 A;  2DIV A;  3RBE A;  2RRB A;  2E9Z A;  1T9T A;  2XUL A;  2U2F A;  4PYD A;  2F65 A;  5G0R A;  1UTA A;  4ZP8 A;  1JJH A;  3I4H X;  1S99 A;  1U4B A;  1HBN B;  2WBM A;  2RAQ A;  2XSJ B;  2CJY B;  2RKI A;  1QSL A;  2GVZ A;  5J2M A;  4OYM A;  1IR0 A;  4IRC A;  1HIY A;  1KLN A;  4FDF A;  3T1H J;  2K3I A;  2J0Q D;  3IGV A;  5LSL A;  3POT B;  1HNV B;  2CZ9 A;  2XS5 A;  1WSR A;  5GAH I;  3HKZ D;  2X3D A;  3NS7 B;  2GHW A;  2GML A;  4HHU A;  4DV7 F;  1Q86 T;  5F41 A;  1TUV A;  2C3O A;  2ROE A;  1OPI A;  3UFC X;  2O5D A;  2WVF A;  1JJ2 R;  3QPI A;  3I9V 9;  5C24 B;  4CLU A;  5GAE U;  2ZNZ A;  3QT8 A;  4EO8 A;  4MIB A;  3VGT A;  2FY8 A;  3IBC B;  2IMW P;  1HWL A;  3GP9 A;  3M8P A;  2LDI A;  1TK5 A;  1HBU B;  4K0K J;  4ATN A;  5F8L A;  2BM1 A;  4L73 A;  4DR1 F;  2B43 A;  1R0C B;  2PMH A;  4PG4 A;  3CO0 P;  3TEH B;  2ABY A;  3DLE A;  3N4W A;  5IM0 B;  3DNC A;  5L39 A;  4RNN A;  2O67 A;  2KH9 A;  4ED1 A;  2AZ3 A;  2YY3 A;  3FNN A;  3WZ0 A;  2N7C A;  3G2X A;  4KFB A;  5FLX U;  1GX6 A;  5IV3 A;  1Z4U A;  4M5I A;  4PG5 A;  1FRL A;  5J1E B;  1LWC A;  4DCP B;  2E9R X;  3NWG A;  2J0S D;  1CQN A;  4YY3 J;  1JLF A;  3CCS S;  3I0S A;  3KG0 A;  5KT3 A;  1CJV A;  3NXZ A;  8RUC A;  1BY9 A;  4ZLN A;  2VPX B;  2XMV A;  1ZM9 A;  4H4M A;  2XYH B;  4DL3 A;  1VRU B;  3JXO A;  1EQ0 A;  2VG7 B;  3GII A;  1S79 A;  1T94 A;  2YNI A;  2M7S A;  3MCS A;  3HSJ A;  2MLZ A;  2V4J A;  2LEC A;  3JB9 k;  4KAI A;  2D3Z A;  1FRI A;  2CVE A;  5LXY A;  3KLV A;  1V3Z A;  1SC1 B;  1YBA A;  2BKO A;  2DIS A;  1RIS A;  1LK7 A;  1VC5 A;  1S1W B;  3OT9 A;  3SBM A;  5GAD U;  1F5C A;  1NJI T;  3DI6 A;  4LBI A;  1VQM S;  1TFW A;  3QSY B;  1TL5 A;  2BOA A;  3BS9 A;  3OHB A;  3HPO A;  4J9V A;  4X64 F;  4CO4 A;  3KK3 B;  1W26 A;  2H4W B;  2MXY A;  3WC0 A;  1UWB A;  2LCW A;  5HVH A;  4JI5 J;  3HT0 A;  4U8Y A;  5J1P A;  3ZZR A;  3FBE A;  1N0U A;  2D3O 1;  2L9D A;  1SPB P;  1NK8 A;  1A9N B;  2B0G A;  3KLI B;  2AX0 A;  4KB7 A;  1X9W A;  3NNC A;  2A10 A;  4CIO A;  2Y8Y A;  4WP8 A;  3BQ0 A;  1JIH A;  3MCN A;  3QMQ A;  3BH7 B;  1EB0 A;  2CQH A;  1XJW B;  2BRL A;  1VJQ A;  3R9L A;  3IC1 A;  2QLB B;  2J9C A;  2G9O A;  1FX4 A;  3P49 B;  5GMD A;  1YSJ A;  2UUW A;  5CQG A;  1FI4 A;  2F8M A;  3U02 A;  1UAW A;  1ZPW X;  1VFJ A;  1WC1 A;  1B4S A;  1O51 A;  2Q66 A;  4DFJ A;  3V2U C;  3GIJ A;  3HZE A;  3FBF A;  3TUJ C;  3EXC X;  3DHW C;  1LWE A;  5KG0 A;  2BM0 A;  5C42 A;  4DU8 A;  2ZWP A;  1J5O A;  2ZZN A;  4B3R F;  2CFX A;  4WBF A;  3MED B;  4FS1 A;  3TJA A;  3W62 A;  3N5F A;  1YJW S;  3SSS A;  1B3T A;  4DSL A;  1P9Y A;  4JI2 J;  4DL6 A;  2GS8 A;  3NCR A;  1JX4 A;  3A4T A;  3ZXW A;  4HL9 A;  2W2P P;  3J81 Y;  3H2U B;  3EUN A;  3OUY A;  4Q8E A;  1JNR B;  2ACY A;  4LSN A;  4K4Y A;  3A3N B;  3M2V B;  2ZIT A;  1Q95 G;  4RW7 B;  2MQN A;  4KJI A;  3T41 A;  3V4I B;  2FHK A;  5AXN A;  1D09 B;  1FXD A;  4ED7 A;  3KOA A;  3M6X A;  5CYM A;  2CUY A;  2BMB A;  1ZZF A;  2OMO A;  3M30 A;  3BBB A;  2HHH J;  1JLG A;  2HBQ B;  3LAN A;  4CH7 A;  4USW A;  2HVD A;  3EMT A;  1NB2 A;  1VQ9 S;  1C0U A;  3BBC A;  1VYA A;  2LQB A;  1TVR A;  2CZ4 A;  3GG1 A;  3K8V A;  3CT9 A;  5GAG U;  2FLL A;  5KFY A;  4K4Z A;  4WYL A;  4FNH A;  3VGU A;  4OI3 A;  3DCA A;  3Q2T C;  3AT1 B;  2FJX A;  5IQ6 A;  4QU6 A;  1T02 A;  4HAC A;  1N56 A;  5D4P A;  2XCA A;  2B4V A;  5KFR A;  2FLO A;  1C4A A;  3CIM A;  1N4L A;  3GQC A;  2JSX A;  2IC3 A;  4J9L A;  3MM5 A;  4IYQ A;  4A46 A;  3L9Z A;  5KFX A;  1OPZ A;  3PJW A;  1N36 J;  2D1C A;  2YQ1 A;  5CZX A;  4C3K A;  1H2V Z;  4LFA F;  3BKT A;  3IWX A;  3EJM A;  3VZH A;  3IWL A;  2HQD A;  2VKZ G;  1S6P B;  2W2N P;  2AYM A;  5KFK A;  2KB2 A;  4K59 A;  3MAA B;  4NI2 B;  3DLH A;  1QAY A;  3OR1 A;  2K2P A;  4OI2 A;  4O4R A;  4OHY A;  4KKO B;  1RT5 B;  5AE2 A;  2ZVS A;  3KK2 B;  3OL6 A;  3BGF A;  4LVO P;  3KLE B;  4URS A;  3PW7 A;  2KDO A;  3A8I A;  1WTB A;  2N82 B;  3K5M A;  3D68 A;  5KG6 A;  2QIF A;  2ALY B;  1REV A;  3V6K A;  3PNI A;  2Y3Y A;  1JLC A;  1MRO A;  3KMQ A;  4R5P A;  1YG0 A;  4P2S A;  4X84 A;  3KDO A;  1KHV A;  5DRK A;  3LP2 B;  1EIY B;  1KTV A;  3RB4 A;  3CD7 A;  4ILL A;  2CPD A;  2JEG A;  2GV1 A;  4FYW B;  5ETM A;  3CCM S;  2R3V A;  2BE7 D;  5DQG A;  2DYA A;  4OZN A;  3EM1 A;  5DJB A;  1HWI A;  2JLE A;  4RNO A;  1TU0 B;  4U67 Q;  3Q8V A;  1NZA A;  1OSD A;  5HP1 A;  4DPY A;  4CNY A;  4RNF A;  1RT6 B;  3E3X A;  3D2W A;  3TZY A;  4CLT A;  1DQ8 A;  5KT7 A;  2R2R A;  4DL2 A;  3DU5 A;  3NEK A;  5CAB A;  3EWG A;  1VI7 A;  2DNL A;  1HFE L;  5I42 B;  1KBR A;  3HX9 A;  3TW0 A;  2VH7 A;  4A8M P;  3MUM P;  2VD3 A;  3I0R B;  6FDR A;  4TVA B;  3LWL A;  4EZ6 A;  5KT4 A;  3QGP A;  1D9F A;  2D41 A;  2KFN A;  4J5O A;  3OTO J;  3NMR A;  1FRM A;  2YNH A;  5KG4 A;  3HHL A;  2YKM A;  2FVR A;  5CD4 A;  1TV6 A;  3PY8 A;  2N3L A;  1VBK A;  4IOA Q;  1V3R A;  1NJW A;  1B7F A;  4YME A;  3UD3 P;  4X4T A;  4MH8 A;  3DGP B;  1Q1K A;  3D9B A;  1DUR A;  3PRD A;  2DD8 S;  1Y5N B;  2HVH A;  2R7V A;  3V5R A;  2WK4 A;  5RUB A;  1NKB A;  3D5M A;  1BGX T;  4OHV A;  2HLT A;  2PA8 D;  2EW9 A;  4P7T A;  1WKJ A;  1WSV A;  1OY8 A;  2G2Y A;  1ZOT A;  2BKP A;  1ELO A;  1TP7 A;  4ZVU B;  2KVQ E;  2OO4 A;  4WE1 B;  2QGF B;  4DUY J;  3LF0 A;  2IYG A;  3CJR A;  1TAU A;  3IRX A;  3IAM 9;  2PO4 A;  1WI8 A;  4C2M A;  4F02 A;  2V5H G;  1RYS A;  4PXB A;  4OYX A;  3MMB A;  1U0S A;  4WFB Q;  4WU3 A;  3ZZY A;  3W5Y A;  4EBE A;  5H9F K;  1Q8I A;  4OYO A;  3OW2 R;  4PXD A;  2VQF F;  5I3U B;  2XCP A;  2J6U A;  1QJH A;  3WIV A;  1O6X A;  2FJD B;  2FJA B;  1KR4 A;  2QC3 A;  4TKT A;  3NGR A;  1FD2 A;  1H73 A;  3VWS A;  5FJ4 A;  1OWX A;  3FSI A;  1C0T A;  1M0S A;  1TKT A;  2ACM A;  2JHE A;  2CAD A;  1RAH B;  2WVD A;  2JOQ A;  3UDC A;  3C6T B;  2ZD1 B;  1VQK S;  3OXF A;  2VQE F;  2RU3 A;  2KO1 A;  3KG4 A;  3OVA A;  2B9Y A;  4URQ U;  5C5J A;  2DGT A;  3ZC4 A;  2Y1R I;  2RQM A;  2M9K A;  3PW5 A;  2HS4 A;  3TJ8 A;  4QPX A;  3ENV A;  3GYG A;  1JJ4 A;  2I5J B;  4PWD A;  4KH0 B;  4F3Q A;  4X4V A;  5L1K A;  1FNX H;  3C15 A;  1B7Y B;  1HNW J;  4NLO A;  1Q4R A;  3DRX A;  2G2Z A;  4J9S A;  1YJT A;  4UST A;  4F0H A;  4OQJ A;  2XM3 A;  2J76 E;  4Q2M A;  4NLS A;  4Y0F A;  5E3P A;  3E8O A;  3D6T B;  4BC9 A;  2OPR B;  3IM8 A;  4G1Q A;  4NZ7 A;  4ZOS A;  4ED0 A;  3JYT B;  2Q1L A;  5ETS A;  1HWK A;  1YJN S;  2GZO A;  4UUW A;  4NE9 C;  2FJW A;  2AKW B;  1YTY A;  3DYA B;  2ZH7 A;  4LF2 A;  3UDV A;  1V5V A;  2OD6 A;  4U95 A;  2VB6 A;  1U48 A;  5D6G A;  3CDA A;  1IKY B;  4CLY A;  4JI8 J;  5H9E K;  1CUL B;  2E5H A;  4ID5 A;  4ZVT B;  2BJ8 A;  2FVP A;  2LMI A;  1S1T B;  5KT5 A;  1A0O B;  1C1C B;  3P4U B;  4RU2 A;  4NX9 A;  3QIP B;  4ZDN A;  4F0K A;  1UET A;  3CMA S;  3M8S A;  2MEW A;  3KK1 B;  2UU9 J;  3M32 B;  1GMV A;  2XSF A;  3MUT P;  3QAE A;  3MWB A;  1TL1 A;  1RCX B;  5BYS A;  3CGI A;  2W2O P;  4RPF A;  2BOP A;  3BM7 A;  4M94 A;  3DXB A;  3P5B P;  5D78 A;  4IUF A;  2EKY A;  1S1X B;  5F8G A;  2WON A;  2NYH A;  4MK8 A;  1VCT A;  4JI0 J;  4WZM A;  4C0H A;  4DG1 A;  5KOX A;  4AXJ A;  4I7F B;  1HNZ J;  2X3G A;  2FLN A;  3PO4 A;  3K5L A;  4CWB A;  2WB1 D;  2AD9 A;  3J7Y I;  3DRP B;  3MAH A;  2XZT B;  1HBN A;  2XSJ A;  3I5B A;  3MPU B;  5K8M A;  3AXK A;  2QYG A;  3MR6 A;  3JSM B;  1Q8K A;  4B9U A;  3SCI E;  4USK A;  3MM6 B;  4ZP6 A;  1FJG J;  1M5O C;  1IJE B;  1HNV A;  3EZO A;  4WIQ A;  4L3N A;  3IBF B;  2KRR A;  3ILJ A;  1H38 A;  4CDI A;  4LSL B;  1T03 B;  2J0X A;  3LA0 A;  2PII A;  2RDD A;  4L3K A;  4ZVE A;  3VCD A;  3HFV A;  4X4Q A;  4FXV A;  5KG3 A;  3BYR A;  4OZJ A;  5CD4 H;  4B3S J;  1VRT B;  4NRT A;  4F2R A;  3RRK A;  2WOM A;  2HPU A;  4USM A;  5IC4 B;  4IDK B;  3EYZ A;  2MB0 B;  3KTQ A;  1H98 A;  3TX0 A;  2NPI A;  3DM2 B;  2HFV A;  4NLW A;  1RCO B;  1LW2 B;  3UE2 A;  2ZOM A;  1FRH A;  3W63 A;  1FT8 A;  4RWX A;  1FO1 A;  4O4G A;  1HBU A;  1TR0 A;  1SC4 B;  3CJK B;  2KFZ A;  2ROG A;  2YVS A;  1J27 A;  2HFZ A;  3B82 A;  4LRE A;  5J2P B;  4F67 A;  3Q24 A;  3M8W A;  5IM0 A;  1R6Y A;  1BXN A;  4OZ0 A;  4I64 A;  4DV3 J;  5L9X A;  3LAK A;  4N41 A;  5EWF A;  1SH2 A;  2DT9 A;  4NXN J;  3K8W A;  1N54 B;  1F6T A;  3TUP A;  7AT1 B;  5LSO A;  3PYE A;  3BO4 A;  5HAT A;  3PR5 B;  4CTA A;  1NSA A;  1OYE A;  3OBI A;  2CJB A;  2OP5 A;  1AA1 B;  4RUA A;  3BPS P;  4K2J A;  4MIA A;  2W9B A;  1T3O A;  2NQP A;  4C0B A;  3J80 U;  2VPW B;  2Z58 B;  5E3R A;  1NHK L;  1IBM J;  3A3P B;  2RIJ A;  3QO9 B;  2BE2 B;  3PFE A;  4W4M A;  4ZPV R;  1YX2 A;  4LR9 A;  1ZS6 A;  2AZ1 A;  5A2Q Y;  2BR0 A;  1NM2 A;  1Q5V A;  1VRU A;  4E2F B;  2VG7 A;  3G96 A;  2QSW A;  3DLJ A;  1TUW A;  1YGY A;  2V6A A;  2DJW A;  3IR5 B;  3T5K A;  1N5V A;  4ECT A;  3I5C A;  3UN3 A;  3EGN A;  4E98 A;  4JI4 J;  2DNR A;  2QFJ A;  1HBO A;  4O23 A;  2ZZT A;  1WHX A;  1N32 F;  1UJ5 A;  3MFH A;  4IR1 A;  4LF8 J;  3D4J A;  4B9L A;  5LMN F;  2AYG A;  2OPQ B;  3NMA A;  4DN9 A;  4OYP A;  3FEY B;  2RT3 A;  3RBX A;  4I6Y A;  1MNE A;  3IBW A;  3O1L A;  4ZCI A;  3FZB A;  2IAJ B;  3MF5 A;  4DR7 J;  5MLC V;  1XMO J;  3CJ4 A;  2WBR A;  2IYI A;  3FQK A;  2UVU A;  1JLE A;  3LP0 B;  4LRA A;  3U7J A;  3DHX A;  3M9O B;  2V2V A;  3N9U C;  3BN4 A;  4UOF A;  3GV5 B;  4BLG A;  3KLI A;  2M0G B;  3NGK A;  4WK1 A;  3OJU A;  4ED5 A;  2F40 A;  4LRC A;  3PRV A;  1SQF A;  2Z30 B;  2FJE B;  3CCR S;  4CH1 A;  4ZN3 A;  3UCZ P;  4PUO A;  4U8V A;  2BV3 A;  2EVZ A;  1HNI B;  3EIC A;  3R5D A;  1LQ9 A;  3IGN A;  4CYU B;  2VIH A;  1UVI A;  2WZ1 A;  4X62 J;  2Q3P A;  2F5G A;  4Y2K A;  3TA2 A;  2XY7 A;  2GCF A;  3RJM B;  4ZP9 A;  3PYF A;  2W7O A;  1G7C B;  2CIM A;  1CPZ A;  1L3V A;  2MZQ A;  4DV1 F;  5EGY A;  3LTO A;  3G82 B;  5ADZ A;  2M2B A;  1U26 A;  1M5H A;  1URR A;  2UXB J;  1G3O A;  4ED3 A;  2VV5 A;  2OIH A;  3FCV A;  3MUR P;  1Q5Y A;  1TL7 B;  3EDR B;  5B0D A;  1W7W A;  3OFE A;  4YR0 A;  2ZNY A;  3ZO7 A;  3DOL A;  4TNO A;  2EK6 A;  4EZ9 A;  4WP9 A;  1K44 A;  2YQ0 A;  3C66 A;  3MGJ A;  4DL4 A;  3ZTO A;  1XR5 A;  4PPZ A;  2CQB A;  4Z7C A;  2DNQ A;  1BQX A;  4DOZ A;  3NAH A;  4C98 A;  1PSD A;  2XMM A;  3BPD A;  2J7U A;  3EVW A;  1TK8 A;  2HMI B;  1V6H A;  3IFE A;  4NAS A;  3N6L A;  5JVG Q;  2RJZ A;  2IVM A;  3BGL A;  1F3F A;  3KLF B;  4DV7 J;  4RW7 A;  4A8F A;  3CCE S;  4DL5 A;  4HR2 A;  2MGZ B;  3JQJ A;  3HHK A;  3DRY A;  2HFU A;  3R7S B;  2IFX A;  3K7R A;  1NDP A;  1S49 A;  2CPZ A;  1RT1 B;  4RO0 A;  4UY8 5;  2MQQ A;  1TMM A;  3VR1 A;  3MMA A;  4UUX A;  1FF2 A;  2I0X A;  5DG9 A;  3SXL A;  3QWU A;  5IWA F;  1SJQ A;  4IO9 Q;  5DG7 A;  4JUZ A;  3WIU A;  4LFB J;  2DNO A;  4DR1 J;  4RKU C;  4MAK A;  4V19 J;  3ICL A;  3HHL D;  1SCJ B;  4W98 A;  1HW8 A;  2FLP A;  1M1H A;  1B70 B;  2E1M C;  2KM8 C;  1SC6 A;  1NK5 A;  1WF2 A;  1WHY A;  4DS5 A;  3MCM A;  4NYZ A;  1S1U B;  2OH2 A;  1FK9 B;  1MN7 A;  4RUH A;  2IM1 A;  3QFW A;  2I9S A;  2E1A A;  5E3C A;  3K57 A;  4R8U B;  4Z7Y A;  2VIC A;  3LGN A;  4JI7 F;  4NPO A;  4OI6 A;  2K7J A;  4DWI A;  3EXY A;  3QRQ A;  3J7Z 5;  5KFB A;  2QO3 A;  1JQG A;  3NOC A;  4A8X A;  3NAI A;  3D0I E;  1RBL A;  4KKO A;  1RT5 A;  1H0H B;  3CXC R;  2MST A;  4YB1 P;  3KWM A;  3KK2 A;  2DXE A;  4LMZ A;  2LXI A;  1B0T A;  1H2T Z;  2W7P A;  3VF0 B;  4M8L A;  4C48 A;  3KLE A;  5E5N A;  3KHL A;  5F8I A;  4KGX B;  1NK7 A;  3W8G A;  2HS3 A;  1QVF R;  3ISN C;  3RB3 A;  3PDN A;  2QLW A;  4C8M A;  2AW0 A;  2X51 A;  3GJT B;  3LP2 A;  1QE1 A;  1MU2 B;  1YZ7 A;  4ED2 A;  1ROF A;  3IAS 9;  4X64 J;  4KHM A;  4QPT A;  3C8Y A;  2HNY B;  4J9U E;  1UCN A;  1LW0 A;  4LR7 A;  4JI6 F;  4W92 B;  2H54 B;  2XMT A;  5F8N A;  1OYD A;  2UUB F;  4X2B A;  4KHP F;  2MKC A;  1RT6 A;  1WEZ A;  2PMW A;  5K8O A;  2KZM A;  4DPT A;  4KH1 B;  3BGR B;  2FC8 A;  1FXL A;  4UQG A;  4RUC A;  5ETR A;  3BJY A;  2GQQ A;  4QZV B;  5KG2 A;  4WWS A;  3IG1 B;  2MKY A;  3NLC A;  2AGQ A;  4ILM A;  2JVR A;  5DGA A;  2B5J B;  2B9X A;  1VQL S;  3IP0 A;  1KOO A;  4C3M A;  1QY7 A;  3EVO A;  4YDD B;  3OJS A;  3FBB A;  3CCZ A;  2A3J A;  4IR9 A;  3PW2 A;  2VZ9 A;  1FES A;  1RTJ B;  2JWN A;  1KEK A;  3T6J A;  3W5Z A;  3HD1 A;  4QIV A;  4NCA A;  1X5T A;  1NME B;  3NBP B;  5KG5 A;  1TKD A;  5LJ5 Y;  4GKK F;  3DOM B;  2FC9 A;  4USU A;  2P5V A;  1VRQ C;  3B8H A;  5E7O B;  2OFG X;  2PGC A;  3MZI A;  1RAE B;  2RIL A;  4FF1 A;  1K1Q A;  4MYU A;  3WHI A;  1TEL A;  4ZLJ A;  5I3Q A;  1SV5 B;  3MXH P;  3OL7 A;  2N7Y A;  3V81 B;  3K2Y A;  4N47 A;  2W4D A;  2KJW A;  2J9E A;  1PGZ A;  5M2P A;  3SQG B;  4B3R J;  3M2U A;  3G6X A;  1RHK B;  3CCJ S;  3R8Y A;  3PHE A;  2D69 A;  1T9V A;  4J9N A;  4I68 A;  3V4M A;  5KFF A;  2MQP A;  2B4U A;  2W1B A;  1QVG R;  3T6B A;  4WE1 A;  3FFI B;  4P73 A;  1RHU B;  6AT1 B;  1X7V A;  2ASJ A;  2DNZ A;  3TO8 A;  5B0G A;  4ZVS B;  5KFE A;  4OZ5 A;  4TU7 A;  1D0E A;  3QJP A;  4OYB A;  3K0J A;  2DO0 A;  4H4K C;  1B99 A;  2IRY A;  4GO5 X;  1EAR A;  3SDE B;  4XTT A;  1SUQ A;  4KBI A;  4PAB A;  1VQ4 S;  1P9Q C;  4UY8 T;  2B8P A;  2DGS A;  5B0E A;  1YRX A;  3OLB A;  1WWH A;  1SKU B;  1RJJ A;  2FIU A;  3FZ2 A;  1BQM B;  1WNE A;  1K0T A;  3G6V A;  4RNH A;  3VGV A;  2W9C B;  1MSW D;  1PYT A;  2GHP A;  3H5Y A;  2MDA A;  3AXM A;  4IOB A;  4RBU A;  4WTO B;  4GVL A;  4NLG A;  3IR6 B;  4IQM A;  5ETL A;  4J9Q A;  4RJV A;  2DNH A;  1S0N A;  2JH3 A;  4P2F A;  1WHW A;  4ZPB A;  2CPI A;  1EJ7 L;  4P7V A;  2ROP A;  4DN0 A;  4KY3 A;  1CVJ A;  1C2P A;  3TP2 A;  1T05 A;  2V94 A;  4U96 A;  5K9F A;  4NA3 A;  3ZTR A;  2VKR A;  3GFY A;  2LEA A;  1AZS B;  2IM2 A;  3G6E S;  1P27 B;  1IR2 A;  1YHQ S;  1G1X A;  2GC8 A;  3PG9 A;  2KU7 A;  2VC1 A;  2L9N A;  3HCX A;  4LFA J;  1VQN S;  3BO3 A;  4DF4 A;  4AUK A;  2M3D A;  5ETV A;  1F2H A;  2HRT A;  2QLX A;  3M6W A;  4LFC F;  2WHO A;  3TYT A;  5KFU A;  3CJS A;  2QFI A;  2HGL A;  5D77 A;  2YX4 A;  1D9A A;  3I82 A;  4WFX A;  3TJ9 A;  5A8R B;  1VBX A;  4NLP A;  2CQD A;  1Q53 A;  5KFG A;  4CLP A;  1S7I A;  3GB0 A;  1CUL A;  3A3O B;  2VBX A;  2ZHB A;  3L95 X;  1HI1 A;  2ZHA A;  4FS2 A;  3J7A 1;  1S1T A;  4MFB A;  4LF4 J;  2LLZ A;  1FEH A;  5JXS A;  2AJ1 A;  1BQN B;  1EKR A;  2EC0 A;  1I3O B;  1KSP A;  3CCT A;  3KJV A;  4EBD A;  2UV8 G;  3KK1 A;  4TU8 A;  2BJE A;  1YJV A;  2Y1I A;  2VF3 A;  1RHR B;  3S7R A;  3AJ1 A;  1F5B A;  5FDL B;  1VLY A;  1S9E A;  2HHX A;  1U49 A;  4Q7A A;  1IBC B;  5A8K B;  2GAG C;  3N28 A;  2BUN A;  1S1X A;  4QW8 A;  4F4Y A;  4DDF A;  1HNX F;  3MHY A;  3EPI A;  2OLW A;  3KFW X;  5CCL A;  2DPI A;  2W2M P;  2ZH9 A;  1N48 A;  2E5L F;  3W9H A;  1S59 A;  1UZH A;  3V6J A;  2CXE A;  1VMB A;  5F8M A;  4FPR A;  1SVD A;  1MG7 A;  1Q79 A;  1H3D A;  4N56 A;  3JSM A;  2DRB A;  3MM9 B;  4WTY A;  3LPE A;  4QR0 A;  2IA0 A;  1U2R A;  3C6U B;  3I6P A;  3QGI A;  2GGP B;  1XNR F;  3DOK A;  5CH7 B;  2H9Z A;  4R25 A;  1FRJ A;  2CA9 A;  2J9D E;  3V6H A;  2CG8 A;  2AJ4 A;  3F73 A;  1RT7 B;  1QUV A;  2DIU A;  1S4E A;  1NKC A;  2PC6 A;  4GMK A;  9RUB A;  4ECW A;  3GJS B;  1UWA A;  2MY7 A;  4GKJ F;  4IDK A;  3H5S A;  4DLE A;  1PC4 A;  2ZH8 A;  1LW2 A;  1CG2 A;  3M4X A;  5K14 B;  1VIX A;  4URG A;  3QJJ A;  4M5D B;  2VG5 B;  2HK3 A;  3CJK A;  1VLO A;  2ZKT A;  5HI7 A;  5HVF A;  1E6V B;  1MW7 A;  2UXD F;  1RHQ B;  2L3M A;  4OZ2 A;  3TX8 A;  4GO7 X;  5J2P A;  1OY9 A;  4NLD A;  3TEG A;  4ETZ A;  2HIY A;  1WHV A;  4JI1 F;  1REG X;  1ZA2 B;  1OMS A;  1RZM A;  2B9E A;  3FMW A;  1NJY A;  4PKD B;  2HND B;  3AD7 C;  4PR6 A;  5DQH A;  5K20 B;  1SC3 B;  2LYV A;  3CD6 S;  3SEO A;  4YDX A;  3ZZU A;  2RHQ B;  3DDN A;  5IT9 U;  3AD8 C;  4DSF A;  1IR1 A;  5J2N B;  1JKH A;  2B8Q A;  2HHQ A;  2VQF J;  3H7H B;  4OZ1 A;  1UJ6 A;  1UFK A;  5LMU F;  3G71 S;  1SBR A;  2BE2 A;  3DRR A;  2AT1 B;  1TMJ A;  2YH1 A;  3FCH A;  4UZB A;  2AJF E;  4HLB A;  5D8H B;  2C2Z B;  4BCA A;  4RWW A;  2RH3 A;  2V2K A;  4AXI A;  4ED4 A;  2I38 A;  3H20 A;  3T19 A;  2VQE J;  1N6Q B;  3M8Q B;  4DSI A;  1T11 A;  3GJR B;  3G87 A;  2XS7 A;  1XMQ F;  1J2V A;  2XHW A;  2QA4 G;  2GJI A;  5KTQ A;  2DNK A;  4ZP7 A;  4Y2M A;  1NSQ A;  2I1R A;  2OPQ A;  4QWC A;  1WC4 A;  3ADA C;  2BAN B;  2MYF A;  3HVT A;  2EFG A;  2M52 A;  3V6D B;  4MYT A;  3GR0 A;  1I5O B;  1CBK A;  1EHW A;  1JLA A;  4OL8 A;  3BBF A;  3KYL A;  3CB4 A;  4PG7 A;  5AT1 B;  3IRW P;  1CSJ A;  3HZG A;  3MD3 A;  4DV0 F;  4FYX B;  3M6U A;  1IKX B;  2KN4 A;  1NJZ A;  4DR5 F;  4EBC A;  5DM7 Q;  3AA8 A;  2X1B A;  1RWO B;  2P8I A;  4EWT A;  2IVF B;  2JEI A;  4KTQ A;  1NU4 A;  2B4P A;  1WOR A;  2B6A A;  4IG3 A;  4RW9 B;  2LDY A;  4DPW A;  1Q8B A;  5C2C A;  1DFD A;  1VQP S;  1ZTW A;  4P10 A;  3U1N A;  3TZX A;  2C22 A;  1HNI A;  2KT5 A;  3PW0 A;  4ZPT R;  4K8R A;  1FKO B;  4FF2 A;  3OTB A;  4CYU A;  4NEZ A;  1XN9 A;  3HSZ A;  5BYR A;  1JXL A;  1S9G A;  5F0W A;  1RWX B;  4OMF G;  4QW9 A;  4AL5 A;  3UN2 A;  3VAG A;  4NRU A;  2G1D A;  3ETO A;  3RTV A;  2IBO A;  2OAU A;  1TQL A;  3OD2 A;  4LRF A;  3MDF A;  5L8R C;  5T14 A;  2W8K A;  1ICE B;  5F8J A;  2KJV A;  3UWT A;  2ZH5 A;  1RBO B;  2J6S A;  4WP3 A;  1RE1 B;  2ERR A;  2MKS A;  3SZ2 A;  2VOD A;  2H65 B;  3G82 A;  5HAN A;  2XC9 A;  3R7B B;  1F3V A;  3RRH A;  5F3Z A;  3M7V A;  1IKV B;  1F1B B;  1TL7 A;  1X0F A;  4G3I A;  4Q44 A;  5KFO A;  4NZ6 A;  3M2R B;  3KUG A;  4J9R A;  1VOM A;  1GFW B;  3FC9 A;  3R7N B;  4TLQ A;  4WJB A;  1W2I A;  2QMX A;  1U1M A;  1RAI B;  1K47 A;  4RW8 A;  1SB6 A;  2B4O A;  3US5 A;  3H5U A;  3HK2 A;  1CJU A;  2HMI A;  2B3T B;  3MOJ B;  1RT4 B;  2LU1 A;  4ELV A;  1O5J A;  3OFF A;  3NNA A;  2MGZ A;  4FYV B;  1RTH B;  1WKK A;  4M5H A;  5HQ8 A;  3EDQ B;  4A8S A;  4RBV A;  3DRS B;  3D0G E;  1RT1 A;  1GTH A;  1GAO A;  3AOA A;  2QYC A;  2HBY B;  3HM9 A;  2ZBR A;  3L7O A;  3G86 A;  4ZVP B;  1VQS A;  1XBW A;  2V8D A;  4YB5 A;  2VDH A;  1J5E F;  1NH7 A;  1WDT A;  1P1L A;  1M1G A;  5KFW A;  4ECU A;  3MPY A;  3H2V E;  2MLX A;  1NBE B;  5HRO B;  3Q8S B;  2AJ0 A;  1JMT A;  3GSD A;  4CLF A;  2FHJ A;  2ZE2 B;  3W2V B;  2CQC A;  4XDD A;  2AJ2 A;  5CA5 A;  1RDR A;  1S57 A;  1S1U A;  1UVM A;  3MTJ A;  4IRD A;  5E3Q A;  3FCW A;  2CPX A;  2E66 A;  3PKM A;  1K0V A;  4DFM A;  5JMN A;  3D67 A;  4O44 A;  2CJ9 A;  3CCW A;  1H2U X;  2GJF A;  3CCV S;  1X4B A;  2KL8 A;  4K4S A;  5HLF B;  2BW7 A;  4R8U A;  1OY6 A;  1MWQ A;  4R0E A;  2DGV A;  4C8Z A;  2MJN A;  5L9N A;  2AV5 A;  1NK0 A;  2R2U A;  2YKO A;  2MKJ A;  2OPP B;  4OX8 A;  3N5B A;  2MQ8 A;  3TVK A;  3FEZ A;  4RUB A;  2OHD A;  2HW3 A;  4YQW A;  5A8W B;  1ULR A;  1R27 B;  5AJ3 F;  3CDE A;  5H9F J;  1R8A A;  5CAA A;  3L09 A;  4J37 A;  1EZZ B;  1NUE A;  3BKU A;  1KNZ A;  3AQP A;  3AB4 B;  1RAD B;  2VFT A;  1ZM2 A;  1KHW A;  4M5M A;  2IJR A;  4AL6 A;  1MU2 A;  2JL9 A;  4HI1 A;  1R3N A;  2IM0 A;  2PN6 A;  3W60 A;  2HNY A;  2F4F A;  5E2Q A;  4ZHR B;  3I32 A;  3CNQ P;  1PJ6 A;  2DR8 A;  1PC5 A;  3BN7 A;  1UW9 A;  3MMC B;  3R1L A;  2ZWO A;  5K5M A;  4RW4 B;  4OV1 A;  2KT2 A;  4EGL A;  3HI9 A;  3K89 A;  4KT0 C;  3BGR A;  1WC3 A;  5EDW A;  1N5T A;  4XAK A;  2P6T A;  5G4D A;  2WSC C;  3BV8 A;  1GXL A;  5GME A;  4LRD A;  2WVE A;  3JAM U;  2QA1 A;  5DQI A;  3D3B J;  2YWF A;  4JV5 F;  2YWE A;  2UUC F;  3FEX B;  4DV6 F;  4LQ3 A;  2BXJ A;  1VC6 A;  1BLU A;  4ALZ A;  3D7S B;  1H6K X;  1SJ1 A;  1IUJ A;  4PAA A;  1R8C A;  4LIR A;  4OV6 A;  2XGQ A;  2LEP A;  3BEG B;  1CC7 A;  3C3L A;  1RTJ A;  1U1L A;  1ZM4 A;  3VQS A;  1SJ3 P;  4YB7 A;  2RD5 C;  4DQR A;  4B9V A;  3C14 A;  1OQ3 A;  4Q45 A;  4KR0 B;  3R5G A;  2HVZ A;  1OQ6 A;  1RAJ A;  3OVB A;  1X0P A;  3SQO P;  1NPR A;  5E0O A;  2ADB A;  3FGV A;  2PEB A;  1LK5 A;  4CLK A;  5H9E J;  2ZOF A;  3W66 A;  3DDK A;  2DGU A;  1SV5 A;  3D66 A;  2ZC3 A;  3V81 A;  4ZIT A;  3VQT A;  3SFU A;  2AYE A;  4X4N A;  3SQG A;  3GE9 A;  2QL7 B;  4RNM A;  1NHU A;  4OFZ A;  2KG1 A;  1ZPV A;  4KIA A;  3LOU A;  2FUG 9;  5G0R B;  1S1V B;  4XIU A;  5KG7 A;  5KFJ A;  3FFI A;  2HFN A;  4M95 A;  1HD0 A;  2RKI B;  2GVZ B;  5J2M B;  2DPJ A;  2BRK A;  2HHT A;  1WI6 A;  2MHN A;  1YWX A;  2C2K B;  3B4D A;  3T5J A;  1FKA F;  2Q6B A;  1Y9O A;  4OIX A;  3D6H B;  4C11 A;  4N77 A;  4NCG B;  1QDU B;  4DFK A;  1RXO B;  2HAI A;  2KRB A;  2UUT A;  1S10 A;  5M2R A;  4ZVH A;  2YNG A;  1PIE A;  3L7P A;  4V19 X;  2CPE A;  2G13 A;  4DJB A;  3OFG A;  4I67 A;  2R2T A;  2YWW A;  2XYP B;  3Q8U A;  4I2P B;  4F4Z A;  3UVJ A;  2E7W A;  2RB7 A;  2K3K A;  3EPG A;  4A8K A;  5HMY A;  1IKW B;  1YKW A;  1S48 A;  3QLH A;  2W9C A;  1D8Z A;  1S12 A;  2NXU A;  1QAI A;  1DHM A;  2G0I A;  2ADC A;  4DQQ A;  3QAU A;  3DC2 A;  2C28 A;  3DLE B;  4KGV B;  4FVC A;  3ILO A;  2HAF A;  3R2C J;  3KNG A;  2HQ3 A;  4OLO A;  3NNH A;  3M8Y A;  3EX7 B;  4QR2 A;  1RKI A;  2CQ0 A;  4LUB A;  4ZJL A;  2MKH A;  4TXS A;  4KFB B;  2N4D A;  3KLG B;  2EI5 A;  1FEE A;  3W5X A;  1LWC B;  1N5Q A;  4DR3 F;  1IWG A;  4PG8 A;  4A8O A;  2PI5 A;  4JI7 J;  2O01 C;  4ELU A;  1IM4 A;  4WPA A;  1RTZ A;  4E0D A;  3D1O A;  1I6J A;  1S77 D;  2HWH A;  3I0S B;  4RBT A;  1Y10 A;  2QMU B;  2H3E B;  2MZT A;  4Y6I A;  5EX3 A;  5GAG I;  2FVS A;  1KFD A;  2HQF A;  1AW0 A;  1HQU A;  4PQU B;  2YNI B;  2VFV A;  1GXT A;  1WF0 A;  3W7B A;  2CG4 A;  3ET6 A;  2FHO B;  4DSJ A;  2ZJR Q;  4FBU A;  2H5E A;  1RT3 A;  3K5N A;  4P72 A;  4A8Q A;  3OR2 A;  1BQN A;  1TZ0 A;  3MEG B;  1X5S A;  2DR6 A;  3QNW B;  2A2D A;  1VDH A;  3CVK A;  1R43 A;  1KVJ A;  3DI6 B;  1QLN A;  2YKQ A;  1MN9 A;  2ZBI A;  2E7X A;  2DCU B;  5A8K A;  2CQ3 A;  4JI6 J;  1UVJ A;  2OUG A;  3ZZZ A;  4J9O A;  2JX2 A;  5D0G A;  2Z0G A;  3RYL A;  2UUB J;  3EZU A;  3Q86 A;  4KHP J;  5CZV A;  1WD6 A;  3GWC A;  2BJD A;  5J2Q A;  3MFI A;  5IXU A;  4O3O A;  3Q8Q B;  3QSI A;  1NK4 A;  1HQE A;  4TYB A;  3B54 A;  4WKY A;  2F9J A;  2RF2 B;  1I51 B;  3H98 A;  2UVV A;  1HI8 A;  1FKP B;  3MM9 A;  2WRM A;  3CJT A;  4Y2I A;  3PJX A;  2B51 A;  5F8H A;  3C6U A;  2RHS B;  2GGP A;  5B08 A;  4NWB A;  2AF6 A;  1VK3 A;  5IOL A;  4QOT A;  2DHG A;  2IBK A;  1T9W A;  2GVD A;  3IWN C;  2QV6 A;  3K5P A;  1YJ7 A;  3OPK A;  3OTO F;  2L48 A;  3ZTP A;  2CQ4 A;  2XYG B;  2NUH A;  4Y3C A;  3M9M B;  4C6A A;  1FWL A;  1KTQ A;  2GIR A;  3PYD A;  2KYZ A;  2CQG A;  1RA7 A;  5D0E A;  1VBY A;  3BSA A;  2QRR A;  2W4P A;  1CJK A;  2CAJ A;  3OTD A;  3C46 A;  3SCJ E;  4B02 A;  2ZH1 A;  4GKK J;  1APS A;  3H40 A;  4J9P A;  3K17 A;  1HYS B;  4S0M A;  2JFK A;  2W2Q P;  4M5D A;  3CC2 S;  1WEL A;  1JLB B;  3KG1 A;  3GV7 B;  2VG5 A;  2HWI A;  3O3L A;  1GQE A;  5IFM A;  4RW6 A;  2M5Y A;  3GZ7 A;  4U9R A;  1OS5 A;  1U6Z A;  3KXD A;  2JJ4 D;  1A7G E;  1J5O B;  4MTP A;  4FF4 A;  2HQG A;  3JTO A;  1VQ5 S;  2VOO A;  2BQ3 A;  3NGT A;  4FYD A;  4YHH F;  2HND A;  1R7I A;  2MQM A;  3ZTS A;  2XBP A;  4IFY A;  2DH9 A;  3MM8 A;  4OI1 A;  4NA1 A;  4DUY F;  2ZDP A;  3B78 A;  3NCP A;  4LF7 F;  4XK8 C;  3SV3 A;  5HJX A;  1VQO S;  2PFD A;  1AUD A;  1QD1 A;  5J2N A;  5LM7 E;  4NCB A;  1IBL F;  4CLW A;  1WG5 A;  4N8O A;  5C25 A;  2MZ1 A;  4FN5 A;  3AOC A;  1RBA A;  2ZC4 A;  4H54 A;  4TU9 A;  5HMZ A;  1R6V A;  2R42 A;  1PCA A;  3I5A A;  4NEY A;  5CYJ A;  1NHV A;  4OYA A;  3QFH A;  3T1A A;  2RML A;  5KG1 A;  1NJX A;  1RTD A;  1WEX A;  2V67 A;  3M8Q A;  1G4C A;  1YRU A;  2NXN A;  2LQ8 A;  1C0U B;  4H4O A;  8AT1 B;  1WEY A;  1PJ5 A;  2GHV C;  2CQ2 A;  2ZJP Q;  4X65 F;  3H2L A;  2MKK A;  5GMK a;  1N5Y A;  1PAU B;  2RDI A;  2OML A;  2V63 A;  3QWP A;  1ZA1 B;  2BAN A;  5T41 A;  4NZ0 A;  3RZA A;  4IH6 A;  3FQL A;  2OEJ A;  4KPY A;  3V6D A;  2BW2 A;  4CNZ A;  2HRY A;  4HAC B;  2ZBP A;  1IN0 A;  2EG1 A;  2YKN B;  1HBM B;  4UF4 A;  2DNY A;  2CJA A;  3SFG A;  4HHJ A;  5AXM A;  4UOG A;  2BBE A;  2LFV A;  1HKA A;  2IC3 B;  1NSP A;  3MM5 B;  1S5Z A;  1UVL A;  3M9N B;  4ZPW R;  1RUS A;  1Z2Z A;  2WVC A;  4ETX A;  4I1T A;  3SV4 A;  2JEF A;  4O3S A;  3CTR A;  1AXQ A;  4LFC J;  2FHJ D;  3FRY A;  2AIR B;  3MPV A;  3R97 A;  2I2Y A;  2OJ3 A;  4B3O B;  3OR1 B;  3EE3 A;  3AFG A;  2F4V F;  3O6Q A;  2G1H A;  3B6B A;  3RGI A;  4RR5 A;  3AOB A;  2IDE A;  1SIZ A;  4CP5 A;  5AE1 A;  3JSY A;  3HVW A;  3W8P A;  1LWF A;  1Q16 B;  4AQY F;  2VFS A;  3NY0 A;  1GTE A;  1XWL A;  2JZ5 A;  2UXC J;  1REV B;  3JS9 A;  3DKD A;  3K59 A;  2HS0 A;  2VBZ A;  1MRO B;  4R5P B;  1WDD A;  2JC1 A;  4PPD A;  2IM3 A;  2WW8 A;  2XNQ A;  4N7T A;  5HBM A;  3CC4 S;  3E51 A;  2EEY A;  1PO6 A;  4YFU A;  3KLH B;  2HHU A;  2YKA A;  2ZFH A;  4OI0 A;  2M88 A;  3MEC A;  4F36 A;  4WYW A;  2WVB A;  2DHS A;  4KO0 B;  1VQ7 S;  3QBC A;  1RT2 B;  2M70 A;  5HP1 B;  3UNG C;  2MZS A;  3OXG A;  1SH3 A;  3CPW R;  1HNZ F;  4ID8 A;  4CM2 A;  2LEB A;  2MSS A;  2V68 A;  4IFV B;  3KNA A;  2FJV A;  1S6Q B;  2Z2Y B;  3SSQ A;  3PTW A;  3IS9 A;  2RQK A;  5DDO C;  3RR7 A;  5T7L A;  4X4S A;  3FBC A;  4MKB A;  4RZR A;  1TKZ A;  3QRP A;  1RWN B;  4LVN P;  2KHC A;  1DAR A;  4F7V A;  2QLF B;  1U2F A;  4M63 A;  3FDS A;  1UJ4 A;  1R8H A;  3GYX B;  1N34 F;  1WF1 A;  3I56 S;  2BAB A;  4F2S A;  3TUZ C;  2YPZ A;  3ENQ A;  3NWR A;  5THW A;  2V50 A;  1ARO P;  1R8P A;  1NO8 A;  1BWV A;  2DNM A;  2CRL A;  4GKJ J;  3NRB A;  4JBC A;  4B3S F;  4KPC A;  4O3P A;  1EX8 A;  3IMQ J;  2VDI A;  1IBK J;  4EYH B;  4J90 A;  3NL0 A;  4JV2 A;  3MMJ A;  4IG0 A;  1SIW B;  1U1R A;  5KFN A;  4AD6 A;  4ZLL A;  5A0Y A;  2UXD J;  1T7P A;  3QAT A;  3D54 A;  2DR9 A;  5HRO A;  2RQ4 A;  4DX8 H;  4JI1 J;  1WTF A;  2ZE2 A;  2FD2 A;  2XO7 A;  4BS2 A;  3G8S A;  2ZDO A;  2FY1 A;  4MK9 A;  2XZW A;  1OSC A;  4IO1 A;  1FWK A;  3D3C J;  2C42 A;  2B9W A;  1FTC A;  2HNZ A;  3GFH A;  3QYY A;  2IY5 B;  2IPO B;  2LXF A;  1JLQ B;  1T95 A;  3UDL A;  4KQZ A;  3EVM A;  4HT5 A;  2BVZ A;  2F3J A;  2Z2Z A;  4OJ1 A;  2F8E X;  3NS5 A;  1U8W A;  1TKT B;  4CO3 A;  3M8Z A;  2I6W A;  5HJY A;  2RVJ A;  2AGO A;  4ZVQ B;  4KGK A;  4DUZ J;  5A6W A;  4NML A;  2G0C A;  5A8W A;  4OX7 A;  4OHZ A;  2RUG A;  4KYZ A;  1FHT A;  1XMQ J;  2VPY B;  1FJC A;  3KJQ B;  3Q8Y A;  4AL7 A;  4ECQ A;  5K8N A;  1VC0 A;  3QT5 A;  4G65 A;  3THP A;  4I6A A;  2FYX A;  2UUA F;  4B9T A;  2FHM A;  3RAQ A;  5JUM A;  1U0H B;  4PWD B;  1X5O A;  2M8D B;  4LF8 F;  1C1B A;  4B3T J;  2YX1 A;  5KFQ A;  3E2E A;  3P6Y C;  3C15 B;  2L41 A;  1FDD A;  4KV8 A;  5DO2 A;  3CC7 S;  3UI3 A;  1YI2 S;  3H0P A;  1TKX A;  4AFF A;  1SQG A;  1M5P C;  5HSP A;  3NKY A;  4WFN Q;  1X4E A;  3BDP A;  3DDI A;  1HPZ A;  5B0C A;  2RNE A;  4DV0 J;  4EYI B;  5BJR A;  4PRF A;  4CO0 A;  1QUP A;  1H74 A;  2B56 A;  3DMJ B;  4DR5 J;  4G1Q B;  4ZCK A;  2VA3 A;  2XS2 A;  3J7A N;  1LEO A;  4LR8 A;  3UD5 A;  3AJ2 A;  2PD1 A;  3MM7 A;  4CM0 A;  3L4B C;  2BQR A;  4ECS A;  3M6V A;  1WJ9 A;  1JB0 C;  3H4B A;  4QYZ J;  5C2G A;  2HBZ B;  3PX0 A;  4LF5 F;  1V3S A;  4P71 A;  3LP1 A;  1PJ7 A;  4ID5 B;  5E3A A;  4XO0 A;  3GLJ A;  1GMW D;  3UW1 A;  4FBT A;  1KS2 A;  2RE1 A;  2VJU A;  2Z4P A;  2VOP A;  5ETQ A;  3MR3 A;  5IV4 A;  2XHC A;  3ZFV A;  4FP9 A;  3HSG A;  2E9T A;  2DGQ A;  1IVZ A;  1L3K A;  3GG0 A;  3W1Y C;  1TL1 B;  3CJ2 A;  2HFS A;  4N5S A;  4DBQ A;  4JV0 A;  3POT A;  4HH1 A;  1UPP A;  2OD4 A;  4IQX A;  4UTG A;  2GMJ A;  4ZKA A;  1DY3 A;  3UR3 C;  1UMJ A;  2DCL A;  2R7O A;  1RTI B;  2DNP A;  4P6Q A;  3NGU A;  4M5L A;  5C24 A;  1S1V A;  3TAM B;  4FVM A;  2GO9 A;  2KKH A;  2KM8 B;  4KGZ B;  1RAG B;  2PE8 A;  1XR6 A;  2Y1J A;  2W01 A;  4RU9 A;  2H48 B;  4NCG A;  2J9D A;  1HMV B;  4NXM F;  3JTP A;  3A8E A;  4N76 A;  2VAS A;  4RL1 A;  4O3R A;  2ATL A;  2RS8 A;  4Y28 C;  1X4F A;  2GX8 A;  1U2C A;  3CIZ A;  4DX7 A;  3GCW P;  1W2B R;  4GVB B;  4OHX A;  4I2P A;  3JSB A;  2WOM B;  1L5U A;  1DJ0 A;  3ETM A;  2ZHO A;  2FZG B;  5FII A;  4XDC A;  2L08 A;  2XTJ P;  1IKW A;  2V8G A;  2AHO B;  3HFZ B;  3MOZ A;  2CJX B;  5J1E A;  1NND A;  3MUV P;  1C4C A;  1J5E J;  4BDP A;  4I6W A;  5KFP A;  4O4G B;  1XNQ F;  2DRA A;  3RB6 A;  1N5S A;  1HD1 A;  1Q81 T;  1UEK A;  4LFB F;  2NSB A;  3HHL C;  3FSY A;  2OFH X;  4CRJ A;  3BSC A;  2JLF A;  2EC2 A;  4JI3 J;  4FXW A;  3WBZ A;  3ISZ A;  1S4F A;  2ZH4 A;  1HQ2 A;  2HHS A;  4O3N A;  3GSI A;  4PG6 A;  3MCO A;  2XEX A;  4K7Q A;  3KUE A;  2H4Y B;  4F0M A;  2JNJ A;  3G8T A;  3KLG A;  1TFY A;  3HHD A;  4ED6 A;  5D4L A;  3ULH A;  2R7X A;  3VAH A;  2J5A A;  2IMO A;  4CTA B;  2DK2 A;  1UFW A;  1FWP A;  1UA0 A;  3RG6 A;  1S1W A;  1UVK A;  4F04 B;  2YWG A;  2J8A A;  2W9B B;  3N0V A;  4ZS6 A;  2K06 A;  4IH7 A;  2GFF A;  1KC8 T;  3E01 B;  4C0O C;  4FXD A;  4PQU A;  3I96 A;  3MR5 A;  2PMZ D;  3KK3 A;  1X4C A;  2O1P A;  1T9X A;  1SL1 A;  2NPF A;  5AJ3 J;  2J0W A;  1UL3 A;  4EK2 A;  1X8D A;  2BKN A;  8ATC B;  5D4O A;  3TAQ A;  4ZPC A;  3IO1 A;  4FF3 A;  4QIE A;  5HMW A;  2C3Y A;  5HAO A;  1HBO B;  1ZH5 A;  1JWW A;  3MEG A;  3FJ2 A;  3PAC A;  3SCL E;  3VHQ A;  4EUV A;  3PR4 A;  2ZH3 A;  2EG2 A;  3VVT A;  4ERD A;  3HT3 A;  2V4R A;  1LV5 A;  2G4B A;  4HI2 A;  2PDA A;  4B3M F;  4DS4 A;  3O2I A;  4F8R A;  4L75 A;  3VAI A;  1EQM A;  2WSE C;  4IH5 A;  1FFS B;  1YDL A;  3U1L A;  3J81 U;  3J80 Y;  2E5J A;  5BYQ A;  2IRU A;  4MK7 A;  2QN6 B;  5EWG A;  3AA9 A;  1JLE B;  2W25 A;  3EZ5 A;  3GTY X;  4P75 A;  3I9Z A;  3HXM A;  3P8B B;  4NLX A;  3G9C A;  1O8B A;  2RF2 A;  4JYA F;  1FKP A;  4MKA A;  2C2E A;  2AEF A;  1RHJ B;  4JV5 J;  1FNO A;  5GAH U;  2UUC J;  4DR2 F;  3FKB A;  4DV6 J;  1LNQ A;  4LF9 J;  3RU0 A;  1TAQ A;  2LXU A;  3W65 A;  1YLX A;  4PUO B;  5LJ3 Y;  5B0F A;  5L1J A;  2P9C A;  1IM6 A;  1RWV B;  3MED A;  4PWW A;  2CPF A;  1VJW A;  2PA3 A;  2QA4 S;  3CJ5 A;  4PYA A;  3D1Q A;  1ZAW A;  5CHC B;  3R6L B;  3H5X A;  1WOS A;  1FVS A;  2VL1 A;  3PXG a;  3FSX A;  2HRU A;  1HWJ A;  2RSQ A;  1YBT A;  1HYS A;  3CCL S;  1JLB A;  3RR8 A;  4CLS A;  3M1V B;  5IZH A;  3A1Y G;  3UQS A;  4C8L A;  3M2V A;  3ONQ A;  2MPU A;  3PJ9 A;  1NSK L;  2HHP A;  2IVY A;  3V4I A;  1FX2 A;  4ZVG A;  1CLF A;  3W9I A;  2CDR B;  4O3Q A;  1RQ0 A;  3DOL B;  2DH8 A;  1UPM B;  3FK4 A;  2DR7 A;  1X4G A;  1D9D A;  3PO5 A;  1SJ4 P;  1QM9 A;  1NAQ A;  4LBH A;  5LSR A;  2GMH A;  3JTN A;  2MY8 A;  3TRG A;  4M5N A;  3AJD A;  3PFO A;  5DET A;  1Y3J A;  2CPY A;  2XMA A;  3LH2 S;  4DX5 A;  2HVE A;  1NXI A;  2ILY A;  1K8A T;  3HSD A;  2O3D A;  3Q89 A;  2O66 A;  3BRE A;  2X1F A;  3TR5 A;  2OSR A;  3GR1 A;  1KON A;  1N0V C;  1Y7P A;  2P9G A;  2CJK A;  4PEO A;  2EPI A;  2V69 A;  3MMA B;  4OX9 F;  2ZJQ Q;  5DZ6 A;  4DU7 A;  4DR6 F;  3VTI A;  3R1H A;  3SI8 A;  5HQM A;  2DB1 A;  2XI2 A;  2ZBQ A;  2GIF A;  3CJ8 A;  2D3U A;  2F63 A;  1S6P A;  4ZIV A;  2CNL B;  1NKE A;  3MAA A;  4NI2 A;  4EEY A;  3UN5 A;  1F9H A;  1CQM A;  1D3W A;  2YKN A;  1HBM A;  5DDR C;  1NH8 A;  2RS2 A;  1E6Y B;  2DEJ A;  4NMX A;  1RSC A;  4DR3 J;  1GH8 A;  3QJL A;  1MLA A;  3CW2 C;  4J9K A;  4X4P A;  3KHG A;  1XTZ A;  1RWP B;  1FE4 A;  1LWX A;  4UOC A;  2X1G A;  4DPX A;  2U1A A;  2RUS A;  4UT4 A;  5L46 A;  4A8W A;  2DO4 A;  3TI0 A;  4B3O A;  2CQI A;  3HJF A;  3A12 A;  4Q43 A;  2WB4 A;  5B09 A;  1M5K C;  1IJF B;  2CNK B;  1FDN A;  4BHQ A;  6FD1 A;  3CJ0 A;  4K4W A;  3RUB L;  3C2P A;  2K8G A;  3OV7 A;  3HFK A;  4LF4 F;  3T1Y F;  2EFO A;  1X31 C;  1DTQ B;  4F4A A;  3OL8 A;  1D8Y A;  2MLY A;  2EBG A;  1UKU A;  1DTT B;  3WX4 A;  4PCQ A;  4QJV A;  3CDU A;  4ZMM A;  1QE1 B;  3DLL Q;  3CMQ A;  2HKE A;  3JSR A;  3MPD A;  1WAC A;  3G8Q A;  2XO6 A;  2FGC A;  2LQ9 A;  3KLH A;  2FDN A;  5I42 A;  4C4W A;  4WII A;  3NCQ A;  2XLK A;  3GFX A;  4J7C A;  1LW0 B;  2XMJ A;  3I0R A;  4G1P A;  1ZAX A;  4L76 A;  2H5I B;  1NK6 A;  2FVC A;  1DLO B;  2MZR A;  4CZC A;  4KO0 A;  5LL6 d;  1RT2 A;  3F0N A;  1U09 A;  1CEZ A;  3THV A;  1KFS A;  2V2Q A;  4IFV A;  2V0N A;  1S6Q A;  1RAB B;  3S01 A;  4WU2 A;  3T9Z A;  2KXF A;  2ZH2 A;  1PBA A;  2D3O R;  3DGP A;  4X66 F;  1MMD A;  1UA1 A;  3OHA A;  3TNV A;  3UPF A;  2CYY A;  4PQA A;  3IM9 A;  3UO0 A;  5DG8 A;  4DV4 F;  4L72 B;  2Y9H A;  3MD1 A;  1R31 A;  4DMZ A;  4Y65 A;  4I2Q B;  1AB8 A;  3SYZ A;  1P8G A;  1RAO A;  3T5L A;  4K2X A;  5DDP C;  2HZA A;  3S6E A;  3GU0 A;  3K58 A;  2VFU A;  1CJT B;  4CQ1 A;  2XI3 A;  4DSE A;  3F44 A;  3H59 A;  4DI6 A;  2GQ2 A;  2ASL A;  5I3U A;  5EWE A;  3ITH B;  4DR4 F;  3PKY A;  2VG6 B;  5CCM A;  3OVS A;  2VUG A;  4ZJQ A;  4Z37 A;  1QAJ A;  1ZAV A;  5BR8 F;  1EP4 B;  1FE0 A;  5I4M A;  4F50 A;  2OPS B;  4ZVR B;  3VAK A;  5SUH A;  3M2U B;  4WZQ A;  2GNK A;  3S8S A;  1O0P A;  2H1Y A;  3GIK A;  4DL0 C;  4YHH J;  3Q2S C;  5KFD A;  1NB7 A;  3UD4 P;  3C6T A;  1RHM B;  1Y11 A;  2ZD1 A;  4IKA A;  4LF7 J;  2VA2 A;  2E29 A;  3VAJ A;  4OX6 A;  3BR8 A;  1PYO B;  1N88 A;  2W7A A;  3P45 B;  3I87 A;  4DX6 A;  4DUT A;  1R89 A;  1IBL J;  4Y00 A;  4OJG A;  4C3L A;  1YVF A;  3GON A;  1JLQ A;  1WKL A;  3OXL A;  3CME S;  2I5J A;  2MQL A;  2ZUG A;  5L1L A;  4F26 A;  2XMW A;  4DLG A;  2E1R A;  4K50 A;  1VS3 A;  2CKW A;  1VHF A;  5IT4 A;  1YZ6 A;  1IQZ A;  1VQY A;  5IQQ A;  5KAK A;  1VBZ A;  2DY1 A;  1Y00 A;  1SUQ B;  4KHR A;  1S6O A;  3PIO Q;  2HGM A;  3AD9 C;  4TY8 B;  2W24 A;  3O8W A;  2BDP A;  2IRX A;  2EBE A;  3CJQ A;  5B7W A;  3KJF B;  2F7V A;  1U1K A;  4X65 J;  2AU0 A;  2C2O B;  4QR1 A;  1KQK A;  2BA9 A;  2OPR A;  1P6T A;  2ZOG A;  2KT3 A;  4E8U A;  1FVQ A;  1U0H A;  1Y4Z B;  3JYT A;  2VBY A;  5A76 A;  3HF5 A;  3RW7 A;  3LWM A;  3DYA A;  4AE5 A;  1KVK A;  2Q6C A;  2R7T A;  3PW4 A;  1T05 B;  3TWZ A;  2DXF A;  2OSQ A;  1JJC B;  1IKY A;  2R7U A;  4PZV A;  5F9N A;  2HQC A;  2CZV C;  2IJF A;  1C1C A;  3LAM A;  4X4O A;  3A8J A;  3QIP A;  2VHG A;  4G6V B;  3DMJ A;  2AGP A;  3KHH A;  2ZZM A;  1DRZ A;  2CPJ A;  2V8P A;  3G4S S;  1XIQ A;  3M32 A;  4HHH A;  2NXE A;  5AE3 A;  2F4V J;  2HVI A;  2OI2 A;  1QTN B;  1S0V A;  4I69 A;  1RB0 A;  4UQT A;  1HI0 P;  2RU9 A;  4AQY J;  2QJ3 A;  2EFP A;  1S7H A;  3FVY A;  4UZC A;  4MFB B;  4F4K A;  2W4C A;  4ITS A;  4I7F A;  2YNF B;  2ZM6 F;  3MEK A;  3DFE A;  3KJV B;  1Q0N A;  2GAH C;  3DRP A;  3D1H A;  5HK4 A;  4ECZ A;  3O44 A;  4OHW A;  4AT1 B;  4X4R A;  4WFA Q;  4LT6 A;  4ER8 A;  4HT7 A;  2V34 A;  3MM6 A;  2R8H A;  3LW5 C;  4K4V A;  1S9E B;  2DY9 A;  2J6T A;  4LSL A;  1T03 A;  3DN9 A;  1WG1 A;  2J7W A;  2XQC A;  4DEZ A;  1KVI A;  1RTI A;  1ZM3 A;  4DPU A;  2HK2 A;  2F8H A;  2LU2 A;  1RWK B;  1TTH B;  1VRT A;  1PKU A;  1OIA A;  4YR3 A;  3TAM A;  1SI9 A;  1HR0 F;  1UVN A;  3DM2 A;  4HVZ A;  2OEK A;  4IRK A;  5A2Q U;  3OTE A;  3FUY A;  3Q0A A;  2KZZ A;  3PYG A;  4IOC Q;  3H4D A;  1CS4 B;  3ZZP A;  3DOK B;  1ZYQ A;  4A47 A;  2W9A A;  4EO6 A;  1HMV A;  3EGZ A;  1N34 J;  3X3U A;  1SL2 A;  5ETO A;  1X4D A;  2DNG A;  3JQK A;  4I4B A;  1BHN A;  3MI7 X;  4GVB A;  3DLK B;  4GRS A;  1GT8 A;  4ES2 A;  3W64 A;  2NSC A;  2HYI B;  2BJ7 A;  2MTL A;  2CPH A;  4FZV A;  5KFS A;  1M5S A;  1U02 A;  4QIG A;  3NP5 A;  2R8K A;  4DCO B;  1GK8 A;  4ECV A;  3ENW A;  2WW4 A;  3QO9 A;  4FKX A;  3KDN A;  5M2U A;  1KN6 A;  4KRW A;  4DV2 F;  2FQQ B;  1NRK A;  1RYR A;  3M8R A;  5DLF A;  3H8Y A;  3VGS A;  1L3U A;  4NYP A;  4QWA A;  1LFP A;  2UVR A;  3CCU S;  2C2N A;  1JKH B;  1U1N A;  2PSZ A;  2ZKU A;  3LPY A;  3TA0 A;  3W61 A;  5F3T A;  4WK3 A;  2YWK A;  4TYA A;  3GMG A;  3ZTQ A;  4F3M A;  3DRR B;  3E01 A;  1KLM B;  3ZNJ 1;  3I4P A;  1AFJ A;  3VZI A;  4B17 A;  1T8E A;  2IAJ A;  2RRN A;  3HUL A;  1RAA B;  2F9D A;  4F4W A;  3R5A A;  3LP0 A;  1Q82 T;  2UUA J;  4JP8 A;  2FPH X;  3KJN B;  2R7Q A;  2Z57 B;  1OO0 B;  1ITP A;  2IA6 A;  3CCQ S;  2UV8 A;  1U45 A;  3BF4 A;  4DV5 F;  4CH0 S;  3GIL A;  5KFL A;  3BR9 A;  3GPA A;  3HVT B;  2WSF C;  2NR0 A;  2HUR A;  1U24 A;  3EGV A;  2F1F A;  3RB0 A;  5IT9 Y;  4USV A;  2FZK B;  2K1R B;  4NLV A;  4LF6 F;  3KKF A;  4R0J A;  4QCL A;  2ZUA A;  1JLA B;  4ZVF A;  3FMB A;  4P2M A;  2XNR A;  2QT7 A;  1N33 F;  1D1U A;  3GV8 B;  3I31 A;  2M4M A;  2QTW A;  1TUG B;  1RWU A;  1JXE A;  2QSF A;  5L38 A;  1I94 F;  3RRG A;  2KFY A;  3DLB A;  1T9U A;  3J7Y U;  2XZD B;  3Q8P B;  3R5C A;  3R2D J;  3WX8 A;  3EGW B;  4BBY A;  3VVU A;  2R9L A;  1FJE B;  3HVA A;  4RX6 A;  4DPO A;  5D3G B;  1F5A A;  1XEZ A;  1KRP A;  4LBP A;  4TY9 A;  3QZ8 A;  1JK9 B;  5ETT A;  2QEX S;  3ENA A;  2D74 B;  3D28 A;  4MMO A;  4EU0 A;  1G6B A;  3LGH A;  1FDA A;  1RAC B;  1RU2 A;  2EK1 A;  2B6A B;  1K73 T;  4IG3 B;  3OFH A;  4LF5 J;  4FNI A;  5CYQ B;  2DVI A;  2NYI A;  4BC7 A;  3FRZ A;  3PX6 A;  1L3S A;  1Z2L A;  4K4X A;  2JEJ A;  5IC6 B;  1JXV A;  1S9G B;  2X1A A;  3F56 A;  2V4Q A;  4CO1 A;  1VHI A;  4ZA1 A;  4H4K A;  4ZPA A;  2AEM A;  5I3P A;  2NXC A;  1IWA A;  3HMJ G;  1NZ8 A;  2BE9 B;  4CT9 A;  3T1H F;  4USJ C;  2HIQ A;  3M1V A;  3MR7 A;  1GX5 A;  4WF9 Q;  3HKW A;  3KLF A;  2EFQ A;  3C16 B;  1RLC L;  4JV1 A;  1KP6 A;  2IDL A;  4RLE A;  1X5P A;  2AMC B;  4J9M A;  4NLU A;  4EI2 A;  2XLI A;  3PEJ A;  4ZIW A;  2FGO A;  4ANC A;  3L7U A;  2QL5 B;  3PVX A;  1BWE A;  1K9M T;  2Y0B B;  3P3D A;  1SKW A;  3R5J B;  1X60 A;  3Q8R B;  4YP3 A;  4DQI A;  4QU7 A;  4LRB A;  1K1S A;  2FZC B;  4L74 A;  3LQV A;  5DDQ C;  4RW8 B;  3QT6 A;  1R0A B;  1AYE A;  1CJU B;  4JB8 B;  4CO2 A;  4C8N A;  4ECR A;  4M1K A;  4NXM J;  1W25 A;  4K0K F;  4FKY A;  3LO3 A;  2V8V A;  3PIP Q;  2IIH A;  4M5J A;  1IXK A;  2P2C B;  4Z2X A;  4QBU A;  4M5G A;  1RGV A;  4J91 A;  3HO1 A;  1HHT P;  2KI2 A;  1FK9 A;  2NS1 B;  3W2W B;  5DGB A;  3PRB A;  2QL9 B;  3UDE A;  5GAE I;  1Y5L B;  2AEJ A;  1CC8 A;  3BDE A;  4ZCL A;  1YBU A;  1RI7 A;  1HWU A;  3CF5 Q;  5ETK A;  1XNQ J;  3TZZ A;  1FXR A;  1VQ8 S;  2GW8 A;  4YY3 F;  1WG4 A;  2A2C A;  1GMU A;  1PIL A;  2E1P A;  3CWJ A;  2J7K A;  4NOH A;  4YN3 B;  1XC9 A;  1S6U A;  1S76 D;  2ATC B;  1PBU A;  2IJN A;  5B0B A;  1DAX A;  1E6Y A;  1VGY A;  4B9S A;  3BB5 A;  4I56 A;  3Q22 A;  4DCJ B;  2C1E B;  2C2D A;  2ILZ A;  4Y34 A;  3IXQ A;  2BJ1 A;  2XWY A;  2DNN A;  2E44 A;  4O44 B;  4ZCM A;  1F0X A;  1N32 J;  3NGD A;  1EET B;  1DQA A;  2VPZ B;  5LMN J;  3PX4 A;  4OYI A;  2XLJ A;  5GVQ A;  2SXL A;  3X1L B;  3OQ2 A;  4GC7 A;  2HQI A;  1V9O A;  2KHD A;  1VIS A;  3GIM A;  4WFZ A;  4LJM A;  2PFF B;  3AOD A;  4W90 B;  3BH6 B;  3S1T A;  1XK8 A;  2Z2M A;  2JFD A;  2QA2 A;  3BGU A;  4USH A;  4CO5 A;  3GCX P;  2GA7 A;  3PHT A;  4Q0B B;  4CCH A;  1DQ9 A;  1KWM A;  4JI5 F;  1DTQ A;  3RW6 A;  5ETN A;  2E1C A;  4MJK A;  2CJQ A;  2VON A;  3HD2 A;  1DTT A;  3AH6 A;  3MEE B;  3IG1 A;  4ICL B;  5GAD I;  2H51 B;  2DRD A;  4B3M J;  5D15 A;  3DLG B;  4TN2 A;  4YS2 A;  2B5J A;  2CWX A;  2NZ4 A;  4KSE B;  1HLW A;  2MKI A;  2KYX A;  2XMK A;  2DBB A;  2Q79 A;  1DLO A;  3OL9 A;  5EX0 A;  1I1G A;  4OJH A;  1NDC A;  1XMB A;  1M90 T;  3GYN A;  2QE5 A;  2VU5 A;  3PCO B;  1U8S A;  3QGH A;  5HMX A;  9ATC B;  3PM9 A;  4F4X A;  4YUD A;  2QZ8 A;  2WCX A;  3WDO A;  2EKN A;  1PYS B;  3NBP A;  4WXW A;  4HEA 9;  4JYA J;  4HDH A;  1SJF A;  2FB0 A;  1KQG B;  4ZK7 M;  4ELT A;  1Y5I B;  2DGO A;  3DOM A;  4DV1 J;  1PAE X;  4AYB D;  2Y8W A;  5ITH A;  5HQL A;  4DR2 J;  3BKF A;  2K7K A;  2YTC A;  3DXS X;  4K5R A;  4DQS A;  2MQO A;  2R7S A;  1TL3 B;  5E41 A;  2LVW A;  5KFI A;  4C8K A;  3WQP A;  1U1Q A;  2YWH A;  4I2Q A;  1SKS A;  3L3C A;  2VBW A;  2JVO A;  5B0A A;  4Y2C A;  1ACM B;  1Q78 A;  2HGN A;  2GQC A;  3OTC A;  5F9L A;  3IN5 A;  3C14 B;  2ALZ A;  1QAX A;  1QSY A;  2AP6 A;  2DH7 A;  4JI2 F;  1S0M A;  5DM6 Q;  1CJT A;  1NDK A;  1FA0 A;  2LQJ A;  1HAR A;  1U7L A;  3OSP A;  2H5J B;  1QTM A;  3ITH A;  2VG6 A;  1NCL A;  1FDB A;  1BC6 A;  2APO A;  1RWW B;  2UVW A;  1EP4 A;  3ZZ0 A;  5F0U A;  2OPS A;  2KTQ A;  1FTR A;  1U47 A;  4CLL A;  1NDL A;  4YB6 A;  1BE4 A;  4WKR A;  1RP5 A;  3R3T A;  3W3S A;  1VIO A;  3SDE A;  5LOQ A;  1KQS R;  3JAM Y;  1KD1 T;  1LOU A;  4HH0 A;  2NLW A;  2HHH F;  4O0N A;  1RLD A;  2AJQ A;  1X4A A;  1BQM A;  4TLR A;  5IWA J;  3ZZT A;  3M8P B;  5IT0 A;  4HYK A;  5HL7 Q;  3F41 A;  4C11 B;  2PEH A;  5AXK A;  2EFN A;  3ZNU A;  2YNG B;  2NRE A;  1URN A;  3OLA A;  1YJU A;  3WC2 A;  3NGS A;  2FJB B;  2GO8 A;  1HW9 A;  4O0I A;  3G6Y A;  1LXJ A;  4TY8 A;  3UVJ B;  4K4T A;  1LFW A;  2FVQ A;  4ZVO B;  1F2G A;  1AZS A;  4MKV A;  4EMD A;  4OX9 J;  4DR6 J;  1AUS L;  3HHE A;  3QLH B;  2A18 A;  3I55 S;  4LF1 A;  1N36 F;  4JOU A;  1FRK A;  3OSN A;  1GMW A;  1RA6 A;  1YRT A;  1JLF B;  3LAL A;  4C8Y A;  2NZC A;  1CJV B;  2HEK A;  4B9N A;  4C9D A;  1ZTT A;  2A0F B;  2I8E A;  4DSK A;  1UEV A;  2AYB A;  4H4M B;  1YIT S;  4F3O A;  3CJ3 A;  2P6S A;  2R2S A;  1H72 C;  5A8R A;  2V4J B;  4KGM A;  2CWK A;  3CSK A;  3AQO A;  4QYZ K;  1SJR A;  2EFV A;  1OJ4 A;  3SIP B;  2Q43 A;  4ECX A;  1TK0 A;  3THT A;  4OLP A;  3AHP A;  2VFR A;  3KMS A;  1WC0 A;  4YEA A;  2B7C B;  2M8H A;  3J7Z T;  3HLU A;  4CT8 A;  3ISN D;  1AFI A;  5BXI A;  3AY0 A;  2ZEJ A;  3PV8 A;  1AT1 B;  4OZL A;  5FLX Y;  3D0H E;  4DXL A;  1UW4 A;  1KQF B;  3J81 j;  5FDL A;  4QIW D;  1HQU B;  3QT7 A;  4K5S A;  5SZT A;  2BX6 A;  1LKZ A;  2POK A;  3U1M A;  2NUU G;  2JDJ A;  2XY6 A;  1UWB B;  3ET6 B;  1GXU A;  3CUL A;  4M5K A;  3TUI C;  3ILL A;  3T1Y J;  4ILR A;  3TQ1 A;  1RT3 B;  4U7U D;  2DHH A;  4HTJ A;  2YNF A;  3TZW A;  4Q2L A;  3OR2 B;  2UXC F;  4QQB A;  4FPI A;  5DLG A;  3PEH A;  3R5B A;  4NLR A;  4QWB A;  2AWZ A;  2HBR B;  2HZC A;  1HHS A;  2G0J A;  4TQR A;  3GIR A;  4ES1 A;  3MR2 A;  2ZH6 A;  2CDQ A;  1F9E B;  3QZ7 A;  2LP4 A;  5EN1 A;  2KXN B;  1XER A;  1RT7 A;  3R6G B;  5J2Q B;  1U25 A;  2P9E A;  5JJB A;  3GFZ A;  3BQ2 A;  1JNZ B;  4P52 A;  1B0V A;  1M5V C;  1FFG B;  1MMN A;  4USI A;  2Z8Q A;  4Q5V A;  2LA6 A;  2A6O A;  1U1P A;  2CVI A;  2CNO B;  2MZJ A;  4A8Y A;  2YPY A;  2ASD A;  1HQE B;  4MT1 A;  2WTF A;  3TVY A;  2E5I A;  2YXL A;  3M05 A;  3N6N A;  3KUH A;  2PI4 A;  2ASY A;  2C2M B;  2G2O A;  2EWH A;  5K14 A;  4X66 J;  2PT0 A;  1FJ7 A;  2DEI A;  3TOQ A;  1H7W A;  4HDG A;  1CS4 A;  4NYO A;  1S72 S;  1E6V A;  4FYY B;  4GC6 A;  4CLZ A;  3KHR A;  4DV4 J;  1YJR A;  2GVD B;  2MJU A;  4DZ6 A;  1LWE B;  3LGM A;  4ENO A;  2QLJ B;  1WC5 A;  1NEE A;  5C42 B;  5AXL A;  2YKP A;  3ELH A;  3MTK A;  5IS2 A;  2Z2L A;  2Z56 B;  1F60 B;  5KT2 A;  4U6P A;  2HHV A;  3DLK A;  1CJK B;  4QWE A;  3VV2 B;  4P2X A;  1IBK F;  5D0R A;  4L6V 3;  3BZQ A;  1XR7 A;  2LKZ A;  3CE8 A;  2BEF A;  4DR4 J;  2XWX A;  2RQC A;  3OUY B;  2YBV A;  2RRA A;  1RU1 A;  4OYW A;  4LSN B;  3BSN A;  1Q7Y T;  2KXH A;  4RW6 B;  5BR8 J;  4ZLP A;  2YH0 A;  1G2E A;  4WCE Q;  1WC6 A;  3HVR A;  3IR7 B;  3SSR A;  2HG4 A;  1MML A;  3O5T B;  1N52 B;  2DKO B;  5CYM B;  2VJV A;  3CD0 A;  2V9W A;  3M30 B;  4DHV A;  1JLG B;  3C19 A;  4IFY B;  3MM8 B;  3MPW A;  4LIW A;  1N6Q A;  4A4J A;  2Y1L B;  1T3N A;  7FDR A;  5K8P A;  5KFZ A;  3N6M A;  4NLQ A;  2YX7 A;  2R8J A;  1TVR B;  5KFA A;  4F25 A;  2AX1 A;  2DGX A;  5C25 B;  1SXL A;  2L9W A;  4DF8 A;  5U47 A;  4CI0 B;  1T0T V;  3CD5 A;  1WUU A;  2X7I A;  1ZET A;  1T9Y A;  1KLM A;  2BZ2 A;  1HNW F;  1PG5 B;  1RTD B;  5EUH A;  1L3T A;  4P74 A;  3A8K A;  1IQT A;  5KFV A;  2YQ3 A;  4DUZ F;  4WFY A;  3CED A;  4B9M A;  4N8N A;  4H4O B;  3VAM A;  3P5T L;  1S0O A;  2QX0 A;  1ZZN A;  2DIT A;  3RAM A;  3MAQ A;  1IKX A;  3K5O A;  1N5Y B;  2NCK L;  3A13 A;  1HL6 A;  1RWM B;  1UFL A;  5L1I A;  2XG8 A;  4WXO A;  1M1K T;  5MAO A;  2C3U A;  4B3T F;  4YR2 A;  1R8B A;  1YJ9 S;  2DGW A;  4PXC A;  5FD1 A;  3UNY A;  5KFM A;  1P1T A;  2K1R A;  1FRX A;  5LXR A;  4RW9 A;  4EFA C;  1MWZ A;  3HP6 A;  3SCK E;  4KE5 A;  2XMU A;  4JI8 F;  4OJ3 A;  4ED8 A;  2AQ4 A;  1Y3K A;  2KG0 A;  1FKO A;  3TVZ A;  4MKY A;  1JLC B;  1N8R T;  4DQP A;  4ECY A;  4QYR A;  2UP1 A;  4B08 A;  2OGU A;  3N01 A;  5D3G A;  2V8H A;  4ES3 A;  1LXN A;  3BGO P;  2UU9 F;  2BYC A;  1R0B G;  3CO9 A;  1GEH A;  3BSO A;  1NLK L;  2IHR 1;  1FCA A;  2NXJ A;  2OTL S;  1SH0 A;  3CDW A;  2FTR A;  5CYQ A;  1HNX J;  3HJV A;  1HA1 A;  1LWF B;  5E33 A;  1NPK A;  1IKV A;  3NOG A;  3T9N A;  3H42 A;  2JLG A;  1BD6 A;  4PXE A;  3QID A;  3RBZ A;  7FD1 A;  2E5L J;  2ZM6 J;  4JI0 F;  4TQS A;  1DBD A;  1HHQ A;  3M2R A;  1BUX A;  3QGG A;  5DZ7 A;  1ZBT A;  2R7R A;  2D9P A;  1NK9 A;  4HKQ A;  5D0H A;  1H7X A;  4HTI A;  2E7V A;  1FNM A;  4D3H A;  5HBM B;  4X4U A;  4K4U A;  3ZZO A;  1Y0H A;  5KFC A;  1BMQ B;  3T5H A;  1FD8 A;  3T3F A;  3PZP A;  1XNR J;  1F9F A;  5A6P A;  4C8O A;  2OEL A;  1FJG F;  2ZBC A;  3MEC B;  1RT4 A;  1RKJ A;  1YQH A;  2N3O A;  1U6B A;  2OTJ S;  2A6M A;  2HLU A;  3C16 A;  3UCU P;  1B64 A;  1UEU A;  1RTH A;  4LQ9 A;  2VC0 A;  2YNH B;  3HHL B;  2YKM B;  3VAF A;  2R8G A;  4LSZ B;  2OEM A;  5JVH Q;  3NG8 A;  1TV6 B;  1QSS A;  3DRS A;  1HR0 J;  3RAX A;  2XGP A;  3UR0 A;  3Q23 A;  4UW2 A;  3D6M B;  4C7Q A;  3IS9 B;  5KT6 A;  2UZA A;  4KC5 A;  5T7L B;  3H25 A;  2HFO A;  1R0A A;  2HSE B;  2B7B B;  1TKZ B;  1A6L A;  2Y0S D;  3Q83 A;  4DZD A;  2DHX A;  1XQI A;  3B4M A;  5ETP A;  4QWD A;  1YIJ S;  2BJ9 A;  3HDS A;  2DR5 A;  1KOH A;  1EKS A;  5HN0 A;  1DZ5 A;  2R4F A;  5EHH A;  3W2V A;  4ZN1 A;  2E5G A;  5DS7 A;  4DV3 F;  1MWY A;  1WOO A;  2R7W A;  4ZPD A;  3CDB A;  1X9M A;  3W2W A;  3DU6 A;  4NXN F;  3IRX B;  2BQU A;  4Q8F A;  3R27 A;  3MMB B;  4NL5 A;  3TAP A;  4DL7 A;  4IG0 B;  3TAN A;  5HLF A;  3W9J A;  1KKH A;  2COL A;  2CQP A;  2JRS A;  3TAR A;  5A0Y B;  5LMU J;  3JQM A;  1RAF B;  1V5I B;  3AAW B;  4XPE A;  4DV2 J;  1SL0 A;  1IBM F;  1FER A;  2OKQ A;  1C0T B;  4P9S A;  2D7S A;  4BWJ A;  1B0P A;  2OPP A;  4JI3 F;  2DTJ A;  4UOH A;  4XPC A;  2A1B A;  2DXD A;  2RDJ A;  2HHW A;  3BQ1 A;  3QRR A;  4U7U K;  1YK9 A;  1VR6 A;  2DHA A;  2GIQ A;  4JI4 F;  1Z1Z A;  5HVG A;  2HNZ B;  2GJ2 A;  2BAC A;  1EET A;  3QQC D;  4DFP A;  1VK8 A;  4YOE A;  2R8I A;  5HO4 A;  1WOP A;  2XY5 A;  3BO2 A;  4BWM A;  2C2R A;  1KDN A;  4OI4 A;  4ZHR A;  5LT5 A;  2KVI A;  4PWU A;  2ZVI A;  4U7C A;  3SMZ A;  1S9F A;  3MMC A;  4QIF A;  4I0W A;  3U27 A;  5C7P A;  4DR7 F;  4Q0B A;  1XMO F;  1UZD A;  4RW4 A;  4MIW A; 
#chains in the Genus database with same CATH homology
 1HKA A;  3HSZ A;  2BMB A;  4M5L A;  4M5I A;  1F9H A;  5ETL A;  1RTZ A;  1KBR A;  2F65 A;  3ILI A;  1RU2 A;  1TMJ A;  4CYU B;  1IM6 A;  4CWB A;  3UDV A;  3ILJ A;  3MCM A;  5ETR A;  3KUH A;  3HSG A;  3HD1 A;  1RAO A;  5ETV A;  1EQM A;  1RU1 A;  3MCN A;  3KUG A;  2QX0 A;  1TMM A;  2CG8 A;  1DY3 A;  1HQ2 A;  3ILO A;  4M5H A;  3UDE A;  4M5J A;  4PZV A;  5ETN A;  4F7V A;  5ETM A;  1RB0 A;  1CBK A;  5ETO A;  3HSD A;  4AD6 A;  1EQ0 A;  4M5M A;  2F63 A;  5ETS A;  4M5N A;  1G4C A;  4M5G A;  1Q0N A;  4M5K A;  3HT0 A;  3QBC A;  5ETT A;  5ETQ A;  3HCX A;  3HSJ A;  3MCO A;  3HD2 A;  4CYU A;  5ETK A;  1EX8 A;  3IP0 A;  3KUE A;  3UD5 A;  5ETP A;  4CRJ A;  3ILL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...