1I94F

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i94F00
2UXBF 1XMOF 4X62F 2UUCF 1B64A 4DR3F 1XNQF 2B7CB 2BXJA 4LF6F 4JI8F 2RJZA 3T1YF 4DV4F 5LMNF 4DV2F 1F60B 1HNWF 4AQYF 1HNXF 4YY3F 2VQFF 4LFCF 1IBLF 1LOUA 4K0KF 4DR4F 2UUAF 2KJWA 2E5LF 2UUBF 2B7BB 4X65F 5LMUF 3T1HF 3ZZPA 4DR5F 4LFBF 4JI2F 4DR6F 2YY3A 4JV5F 4GKKF 2HHHF 4LF4F 4B3MF 4JI0F 2ZM6F 1IJEB 4DR1F 1HR0F 4JI5F 1QJHA 1VMBA 4LF9F 4NXMF 4DUYF 1FJGF 4OX9F 1G7CB 4LF5F 5BR8F 1N34F 2UU9F 2UXCF 1N33F 4DR2F 4JI1F 1IJFB 4LFAF 1IBKF 4JI4F 1FKAF 4DR7F 5IWAF 1N36F 2UXDF 1IBMF 4LF8F 1GH8A 3OTOF 4DV1F 2VQEF 4JYAF 1XNRF 4DV5F 1RISA 2KJVA 1J5EF 4NXNF 2J5AA 4B3TF 4JI7F 4YHHF 4KHPF 4JI3F 4X66F 2BVZA 2F4VF 1CQMA 1I94F 4B3SF 4X64F 3R3TA 1HNZF 4GKJF 4JI6F 1N32F 1CQNA 1G1XA 1XMQF 5AJ3F 4B3RF 4DV7F 4DV3F 4DV6F 4DUZF 4LF7F 4DV0F
chains in the Genus database with same CATH superfamily
1WHWA 2V63A 4I2PB 3K5MA 4F4ZA 3AOBA 1MWYA 1WOSA 4LMZA 2RS2A 1F2HA 3WX8A 1RCXB 4K8RA 4DR3F 3QO9A 1VQ9S 5GAHI 2BXJA 1S76D 4QR1A 3GFYA 1GAOA 4O3NA 2ROPA 1S9GB 2V2VA 5KG3A 3TX0A 1Y0HA 3U1MA 2E9RX 2RU3A 3WIUA 2HBZB 1V3SA 2W2QP 3V6DB 3TAQA 1S1XA 3R1HA 2ZJPQ 2X1FA 1NHKL 3G86A 4LR7A 1FNOA 4Y3CA 4ED8A 4IRKA 1KVIA 5D3GB 3OL9A 1J27A 3JTOA 4USIA 2I38A 2CNKB 5AJ3J 3LGNA 3ZTOA 1VBYA 1MU2B 2BJ3A 3D6HB 3IBWA 3JS9A 4P73A 3TUZC 4ED2A 3NLCA 4ZN3A 4DLGA 3NWRA 1TKDA 4DX7A 1XBWA 2DITA 5IT9Y 2BMBA 3M4XA 4DN9A 1VQOS 1T8EA 4A8OA 3MCSA 3I0SA 5KFAA 2HVZA 4TYBA 3POTB 2DYAA 4OI3A 4B02A 3PX6A 3EX7B 1U02A 3OLBA 4JI2F 1JIHA 1D8ZA 3MMCB 4PYDA 4R5PA 3Q8PB 2XQCA 1B3TA 1CJUA 5KFVA 4CLUA 4HEA9 1YX2A 1C0UB 3FZ2A 1XJWB 4NZ0A 4DHVA 3CMQA 1PJ5A 2EI5A 2YKAA 3DM2A 4KO0A 1N5VA 5HN0A 2RDDA 2DEJA 3QBCA 1UZHA 2G1DA 2XM3A 2ZM6F 3AD9C 2ZNZA 2W8KA 3GFXA 4YS2A 3JQMA 1ZYQA 4OHYA 5IOLA 3H20A 5D4OA 1TK5A 1NDKA 2EG1A 2QLXA 4HI2A 4Y2AA 4O0NA 1RT1A 2CJYB 2WSEC 3I5AA 4RJVA 4RNOA 1WC1A 2CA9A 3I4HX 4G1IA 2BQRA 4BS2A 3QJJA 4A47A 4CWBA 1Y3KA 4LRAA 5D0EA 1GXTA 1FD2A 2MKSA 4RWXA 2C2DA 4RW4A 4ANEA 1MU2A 4DPWA 2EFGA 2SXLA 2G2YA 1TFWA 3H25A 2HWHA 5AXNA 3SSRA 3GFHA 1NKBA 3SCJE 1WTBA 2CPZA 3H5XA 3KOAA 1OMSA 1F2GA 2GHVC 3NCPA 5G0RA 2BZ2A 4LRBA 4WU2A 3W9IA 4XPCA 2ADBA 1V5IB 2BYCA 4CTAB 4DV1F 2M8HA 1UWBB 4QR2A 5KFUA 3KYLA 2AU0A 3KTQA 3N28A 4DV5F 4F4AA 4ANCA 2B43A 4LJMA 4ZVRB 1N88A 3QGPA 5L46A 2MKKA 3J7A1 4URGA 3GE9A 2IDEA 3DKDA 4PCQA 2ZZMA 4AL5A 3MUVP 1I94F 4DG1B 1GX5A 1X5OA 4CI0B 4D3HA 5IXUA 4LF9J 2F5GA 4F50A 4KGZB 3PV8A 1GEHA 4ECXA 4M5KA 2UU9J 3VV2B 4GKJF 2UXCJ 1FJ7A 5F8HA 4CM2A 5CYQB 2MZ1A 3QGGA 2ZWOA 2DHXA 3VAGA 4A8SA 2HYIB 2BOPA 1NLKL 2DNQA 1TL4A 2AW0A 3DLKA 4EZ9A 3R5GA 1Y9OA 2OPQA 1N5YB 1F3FA 2NZ4A 1WEYA 1AZSB 2FHJD 4FDFA 3M2VA 3V4IB 4H54A 2GNKA 4NLPA 1B0VA 3M2VB 4OZ3A 4WJBA 1S1VA 3J81j 1YJNS 2CIMA 3K89A 2VFUA 3BGFA 2HMIB 5I3QA 5IQQA 3AOAA 3DYAA 3GIMA 4G1PA 5HMZA 2PEHA 1U45A 4DV0J 4C8LA 1IR2A 2KB2A 3UVJA 5LSLA 2ZJQQ 2MYFA 4YB7A 2VPZB 2VC1A 3LA0A 1KD1T 3SCKE 4ILLA 3QLHB 4DU8A 3B82A 2RQMA 1HNXJ 1A9NB 1FERA 3T9ZA 2K7KA 4DV2F 2VL1A 4F3OA 2VFVA 5D77A 3AT1B 5EWEA 3EZ5A 3QRPA 2XS7A 2X1GA 3S7RA 2ZD1B 3VR1A 1W2IA 4LFCF 2E66A 2ZC4A 1HQUA 1KS2A 5KT7A 2OEJA 4FF4A 5KFGA 1HI1A 3HSZA 2FQQB 4M8LA 2XULA 2VF3A 3NP5A 3RAMA 3K5NA 1TAUA 3UN3A 1SCJB 1SH3A 1LWFB 1P8GA 1BLUA 3GSDA 3M2RA 1LW2A 1REGX 4X4VA 4NYPA 2VPYB 1CJVA 3HVTA 3VZIA 4MK9A 1VBXA 2IIHA 4C0OC 2GAHC 1R31A 3PR4A 2M8DB 1HNWJ 2HQIA 3EPIA 3OR2A 2HMIA 2C42A 4WZMA 1KBRA 2QL7B 2DXEA 3ENVA 5ETKA 3BDPA 2Y9HA 1RAFB 3T5KA 1Q8KA 1DQ8A 3LANA 1VHFA 4LVNP 1EETB 3MMBA 3NGKA 3EM1A 1QSSA 4H4OB 3CF5Q 3R1LA 3PYEA 3QFHA 4J9UE 4DR5J 2AD9A 2Y1JA 2F65A 3FBEA 1FDDA 1UFKA 1WC3A 2XMAA 2OP5A 3T3FA 4TLQA 2E5LJ 4KV8A 3I0RB 2VQFJ 1SL0A 1RUSA 1FRKA 3MF5A 4Y2IA 1N6QA 4KV8B 2KFNA 2J8AA 3RB6A 2PI4A 4DCJB 2RILA 4K4TA 4IO9Q 1RT7B 1QDUB 2IM3A 2W4DA 4ICLB 4CH0S 2W2MP 2Z56B 5HSPA 3JYTA 1VQ4S 2IRUA 2CG4A 2V2ZA 2OPRA 3KMSA 1T9XA 1HBNA 2WTFA 1TL5A 2QX0A 3DRRB 3LP2A 3MZIA 4P75A 8AT1B 1NEEA 4IOBA 3HCXA 4YN3B 3TVKA 3NS5A 3EDRB 3PYDA 2F8HA 3G87A 4LFAJ 3FZBA 5G0RB 1RLCL 3W8PA 2HQCA 1R8HA 4KR0B 1DHMA 3TEGA 4G1QA 4WP9A 3BO2A 4F4WA 2KVQE 2M9KA 1Z2ZA 3F73A 1JXLA 1OYEA 2FPHX 3I87A 3J7Z5 2QV6A 4ED7A 4CCHA 3KHRA 4JBCA 3LALA 1BQNB 2BUNA 1RU1A 1ICEB 4Y28C 4ZK7M 1ZAWA 4H4MA 5LOQA 5GAEU 3T5HA 2DPIA 1U1MA 2PE8A 4RU9A 2YWGA 2CQ2A 2IFXA 2KYXA 2M0GB 1K8AT 2ATLA 4IRDA 4ZIWA 4HI1A 2YVSA 4RBUA 1D3WA 1MNEA 4WU3A 2ASYA 5KOXA 4KHPF 1IN0A 3CGIA 3DLEB 2IAJA 4ZLJA 1CQMA 4JI6J 4C8OA 3RBXA 3MXHP 5DDQC 2DCLA 2IAJB 5A76A 3HK2A 3HX9A 1S1WB 2ZVIA 3K5OA 4KQZA 4D3GA 1R0CB 3LAKA 2ALYB 4JV1A 3TWZA 3L7OA 4RBTA 2W9CB 3PR5B 1N5SA 3BS9A 3T5JA 2N3LA 2CJBA 2MLXA 2QLFB 4ICLA 3C16B 7AT1B 4OHWA 5AJ3F 3JYTB 4OV1A 4ETZA 3JAMY 3GCXP 5DG8A 1KVKA 2O1PA 1OPZA 1S6QA 2K06A 3C6UA 1FTCA 3HVTB 3OFFA 4OZJA 4Y2CA 1RBLA 4ELUA 4LFCJ 2CFXA 4DV6F 1C0UA 2JOQA 2P6SA 3BBFA 1SH2A 3QWUA 2AHOB 3C8YA 3PEHA 4Z37A 1RSCA 3EICA 5ETVA 5J1EB 3IAM9 1RWPB 1HWUA 1DTQB 2V4JA 1XC9A 2JLFA 1TK0A 1S5ZA 1X4DA 1KRPA 2D41A 4ECUA 2XS2A 4NX9A 4FBTA 2JH3A 4JI8F 2V4RA 3T1YF 3FRYA 1VYAA 1DTTA 1BQMA 4W90B 2XMVA 1T05B 1RHKB 3Q23A 1HNWF 5C24B 4DV4J 1RBAA 2GVDA 2DRBA 3VQSA 5KFJA 2HK2A 2VJVA 4ILRA 2DGVA 1L3TA 1IBLF 4L3NA 4K0KF 2I5JB 1HNIA 1I1GA 1Q7LB 2XY6A 2H65B 3K2YA 2DO0A 3MUMP 2BE9B 1FT8A 4GKKJ 4ZA1A 4EO6A 5B0AA 1YJRA 3TA2A 3SFUA 5L1IA 2MKHA 3O5TB 1LV5A 2VPXB 2MZSA 2B8QA 2ZC3A 2E9ZA 1X4HA 3HFZB 2NXCA 3CCVS 3MAAA 1N36J 2BV3A 4RKUC 1HBUA 4NMXA 2GQCA 4NLYA 4NLSA 3Q24A 2ASDA 4P71A 1SL2A 2E5LF 4IFVB 4A8QA 1PBAA 4X65F 1VQ5S 3NGDA 7FD1A 3J80U 1EP4A 4NLVA 3DLGA 2NSCA 2OO4A 4CIOA 2O5DA 3KUEA 4QJVA 3FRZA 2ZUAA 4R8UB 1UW4A 2FZCB 4KHRA 5T7LA 1JLGB 2KKHA 3KXDA 4NA1A 2B9EA 3PX4A 2YQ1A 2QLBB 1LEOA 3AH6A 3QIPB 1RGVA 1Q86T 4DV6J 2XMKA 5CA5A 2FJWA 4O4GA 3L3CA 3HVAA 4DX5A 2ZHAA 1NK7A 4C11A 1RT4B 4W4MA 1QAIA 2QYGA 1T9UA 3DMJA 3DDKA 2EW9A 4IG3B 5B0GA 1NO8A 2GVZB 1NJWA 1S48A 1HNVA 3Q8SB 3EGNA 3DFEA 5A8RA 2QA4G 2ZE2A 1NPKA 4UZBA 3BQ0A 2FVSA 2HW3A 3KNAA 2BJ1A 2OELA 2QIFA 3H5SA 1IJFB 3CJTA 2VBXA 3BF4A 3BBBA 3MM8A 4MYTA 3PKYA 2XCPA 4J9VA 1N52B 4OYMA 3CNQP 2YKQA 1NZAA 2AKWB 3F41A 4IO1A 3OTBA 3LO3A 1T9YA 1TMJA 3IM8A 4K59A 3TW0A 5IWAF 4RW9B 1S7IA 3DOMB 4Q45A 4AUKA 1WG1A 3DRSB 3THPA 3JSMB 1VLYA 3AFGA 3SYZA 3D54A 4MKVA 3KHGA 1A7GE 3QZ8A 1T11A 2BEFA 2YH1A 1HQEB 2J0XA 2VPWB 3WX4A 4YHHF 4JI4J 2XZDB 4ATNA 1RBOB 3M8WA 2AWZA 1HQEA 2XY5A 2F4VF 1U1QA 2ZOFA 4RNMA 4G6VB 3FQKA 2HFVA 9RUBA 3VVUA 2DH8A 3CD6S 2EC2A 3QFWA 1NSKL 2B6AA 1FD8A 4L72B 4CLWA 4CT9A 3GV5B 2ZH6A 1RT5A 2XGQA 2CPYA 2K1RB 2FVCA 5FDLB 2B6AB 2H5EA 4HH1A 1S9EA 3BKTA 3UFCX 4DV7F 1RT1B 3PY8A 4F2SA 3MR3A 2ABYA 1RHJB 2V8HA 1UVNA 4KBIA 3MEKA 2R8HA 2GIRA 1F5BA 1WC4A 3FC9A 2EKYA 4DV0F 4RUAA 1I6JA 2QSFA 4Q2LA 4TU9A 2EWHA 4YR2A 4KY3A 1QAJA 2HBQB 2NSBA 4EUVA 2ZH7A 3BSNA 3UNGC 5KFCA 3GJTB 1YITS 2RJZA 1FRMA 2CNOB 2DGSA 2PA3A 2G0IA 1TU0B 2NZCA 4J9NA 4PG8A 4PUOA 1JNRB 3IFEA 3MMAB 1S77D 4YY3F 4QW8A 2DIVA 2VQFF 3OR2B 4M5LA 2VHGA 1FRLA 3WIVA 4N76A 1G2EA 4DR3J 2ZITA 3L9ZA 1EZZB 4MK8A 5KFXA 4PWDA 1WHVA 3J7AN 4ZCLA 2DEIA 2CQ3A 3I96A 2FHMA 2J9DA 5A8RB 3DM2B 5MAOA 3J81Y 5BYQA 2HS0A 4I64A 5A0YA 3T41A 1T03A 1N0UA 2UUAF 3DRSA 4FYVB 3JSMA 2CQ4A 3UDCA 5KT3A 4QWBA 2N7YA 2VG6B 4XO0A 4X66J 3OSNA 3TRGA 3LP0B 2RQ4A 2F8EX 4RBVA 4AQYF 3Q0AA 2GMHA 1YK9A 3TJ8A 3SI8A 1MG7A 2ZD1A 2BOAA 4L6V3 2IMWP 2HKEA 1ZH5A 2EG2A 4MIWA 2A2DA 3RRHA 2HNZB 4GKKF 2Y1IA 1JX4A 3HPOA 2P9EA 4DL6A 1SJRA 3QO9B 3M9OB 4DXLA 2Z2MA 4QWCA 1U47A 1V3ZA 2WONB 4XDCA 1APSA 4KHMA 4DSKA 3BREA 5ETQA 1YI2S 4YDXA 4JI0F 3W2WB 1LWFA 3G6VA 3M6UA 1Q5YA 3D5MA 1KEKA 2OMOA 3ZNJ1 4NEYA 2BM1A 1V9OA 2AYEA 3V2UC 4F04B 1RACB 2AJ4A 3ILOA 2P6TA 5CABA 2AV5A 3AJ2A 3CT9A 1RT2A 2W4PA 3TJAA 3MWBA 1QD1A 5CD4H 4BBYA 5E3RA 4UF4A 2PMZD 3T5LA 4QYZK 1UCNA 1ZAXA 2MHNA 1K44A 5SUHA 3Q2TC 5IFMA 5RUBA 2DVIA 3AQPA 3C3LA 1HA1A 4U8YA 1S99A 4O44A 4OX8A 5KFBA 5A2QU 2PT0A 4LFAF 5DLFA 3RG6A 1ZA2B 2FLPA 4ANDA 5FD1A 4PXEA 1X31C 2VONA 2C3OA 2UZAA 4DS5A 1UA0A 3MM5A 2VASA 2GHWA 2YNHB 4K2XA 4EI2A 4CO3A 4RPFA 2W9CA 4ED0A 1P27B 5HP1B 4PUOB 1GH8A 1JLFB 1KVJA 2I2YA 4YDDB 4K2JA 2FTRA 4RW8B 3OSPA 1TMMA 1WF2A 2GS8A 3HP6A 1D09B 4YB5A 1UA1A 2XCAA 1X4CA 4C97A 2H4YB 5CYMA 4HT5A 4CLFA 1HWKA 2QA4S 4U7CA 1UAWA 2KI2A 2CJQA 3U1NA 4OI6A 4X66F 5A0YB 3OUYB 4B3SF 5I3UA 1N33J 3OHBA 3G71S 1JNZB 3KWMA 2C22A 4ED1A 2DHGA 1HNZF 1UPMB 4TY9A 1CQNA 5AXMA 2R42A 3PHTA 2FJXA 4TN2A 3ILIA 3CW2C 4WXOA 2G1HA 2IA0A 3CWJA 4M5NA 3LTOA 4PWUA 3ZTQA 4JB8B 3MD1A 2HK3A 1QY7A 4V19X 5IQ6A 2J6SA 2CVIA 3KLEB 2H54B 3EGVA 1VQYA 2R7QA 3M32B 4OHZA 4FF1A 4NLXA 4NA3A 5KFLA 2JFDA 4B08A 2MTLA 3I56S 1HI8A 2ZBCA 4RW7B 1P9QC 2DNRA 3B78A 3OTEA 1GFWB 3A13A 4WIIA 4LF7F 1LXNA 4TKTA 1PYTA 4CO2A 4F4KA 1R3NA 3OXGA 5K5MA 2PN6A 2YWEA 3ADAC 2V69A 4WFYA 1J2VA 2F63A 2I0XA 3HZEA 5D0GA 1JKHB 5JVHQ 4GC6A 3BV8A 2QFJA 1B64A 3CO9A 1XNQF 4PYAA 4LBIA 1DY3A 2B7CB 4PPZA 3ITHB 3W1YC 4ZLPA 1RZMA 1Q1KA 1TL1B 4KO0B 5ETPA 2EFOA 1X7VA 3DRYA 5THWA 2DPJA 2KVIA 4YEAA 1UVMA 2I8EA 4WWSA 4DV4F 1U6BA 2Q43A 1XIQA 4P9SA 3GQCA 5C2CA 3THVA 3DXSX 1S9EB 5HATA 2Q1LA 1RHQB 5CYMB 3HKWA 2E1AA 3W2VA 2ZH4A 1R89A 1OY8A 1QVGR 1LWXA 1GTHA 5CH7B 1RTIA 4RZRA 2OD4A 3W2VB 4A46A 1FF2A 4DEZA 3R5AA 1X0FA 1Q8LA 3P3DA 3TNVA 3CE8A 3BGRB 1T3OA 1DJ0A 3B4DA 3CMES 4HT7A 3M8RA 2OPPA 3PRVA 4KTQA 2CJXB 1VRTA 2H1YA 3JTNA 3M2UB 5D3GA 3FMBA 3P6YC 4YB1P 2G4BA 2GJIA 3V6KA 3MCMA 3HI9A 4RX6A 2K2PA 2X51A 3HMJG 4DL4A 2UUBJ 2G0JA 1CJUB 1T9VA 1VJWA 2FGOA 2MPUA 4ZOSA 3PO4A 4CP5A 1ZPWX 3OHAA 3KLIB 3HSJA 3UPFA 3QRRA 1SUQA 3ILLA 3KK1B 1JLCB 2VU5A 5B0FA 2W4CA 4B9NA 2E9TA 1FRHA 3RYLA 5H1SV 4E98A 1U4BA 3MM8B 5HQ8A 4ZVUB 5T14A 2WVFA 2NXEA 4YHHJ 3AXKA 2LVWA 5KG4A 2XB2D 3E51A 3DGPB 4ZVPB 4C3LA 2VOPA 1IKXA 1S4EA 2QC3A 2LDIA 4PWWA 3HD1A 2Y8WA 2ZZTA 3K0JA 4DUYF 1ZA1B 5K8MA 1YRUA 2Q6CA 5L9XA 1MW7A 1U24A 3GYXB 4MJKA 2FZKB 1FKOB 2YPYA 4B9MA 4F25A 3NMAA 4NEZA 2P2CB 3PKMA 1H72C 3EGWB 5I42A 1TP7A 4NLUA 3ZXWA 1AT1B 2B4OA 4ZIVA 3KK2A 2GV1A 5KT5A 1N33F 3HFKA 4JI1F 2CDQA 2ZH9A 3UCGA 2IVYA 5DQIA 2R7VA 1NCLA 4V1Ak 2EBEA 2HZAA 2E1MC 4OX7A 1RTDB 2ADCA 1PAEX 4J9SA 1VQPS 3SDEA 2RQCA 4IG0B 3PIPQ 4X4SA 5AT1B 3H40A 3QRQA 1VLOA 3NOCA 4BC7A 2WVCA 2DO4A 4FYYB 4NLWA 2MQQA 1HBOA 2CXEA 2EBGA 3R5JB 1SV5A 1KWMA 4U7UK 5LM7E 4CO4A 4LBHA 2ZH3A 4DSEA 3MR5A 4DR7J 3W5ZA 3B54A 1UETA 1CEZA 3BPDA 3GFZA 2VD3A 2MSSA 3JB9k 1SIZA 5L38A 3CEDA 4M5DA 3R3TA 5HROB 2FVPA 5F8JA 1N32F 1R8CA 2XSJB 1TKZB 3CCUS 4EK2A 4ED5A 3HDSA 1OY6A 3CXCR 1N5YA 3G4SS 3DLJA 2H5JB 1S1UA 5IT0A 5IM0B 4DSFA 4OI1A 3JQKA 2CVEA 3CDEA 5BYRA 2QYCA 3CCLS 5HAOA 1FFWB 2GVDB 1JQGA 1YJTA 4FVMA 1KP6A 1T0TV 2KO1A 3D1OA 4IH5A 2J6TA 1XNRJ 3TI0A 3MR7A 4F4XA 1QAXA 4XTTA 3NGTA 3JSYA 3BN7A 2CJKA 3CJ8A 3P5BP 3PACA 4XAKA 3VGTA 2RAQA 3R7NB 4A8FA 3R5CA 2V4JB 4P7TA 4DF4A 1WC5A 4MK7A 4CO5A 2U1AA 4FKYA 4CTAA 1PG5B 2OAUA 2OD6A 2L9DA 2KYZA 4H4MB 1D0EA 2PSZA 4OYPA 3PM9A 1NKCA 3F44A 4Z2XA 2IYGA 2MXYA 3CPWR 1FJEB 2IBKA 1F60B 4QBUA 3W8GA 2GGPA 4DL3A 3KLVA 3DN9A 5CYJA 1IM6A 3UR0A 2R8JA 1ZBTA 4F36A 4EYIB 5EUHA 4NRTA 4DV5J 4RW4B 4J9QA 5J2QA 2NYIA 3DGVA 1UJ5A 2XG8A 2A3JA 3FJ2A 4FXWA 1PCAA 5DGAA 3LOUA 4LF6J 3FBFA 2FC9A 4F67A 8ATCB 3EXCX 2F40A 1FKPA 1HBNB 3CCRS 1IKYB 5LJ3Y 1GMWA 1JLEA 3OR1B 3CCWA 3NGSA 4FS1A 1J5OB 3G96A 4TYAA 3SQGB 2CQ0A 3IRXA 3IR7B 1RHUB 4K4WA 2CPJA 1EKSA 3NNHA 2DNPA 3IP0A 3TQ1A 1FRJA 2DGUA 1KFDA 2Z57B 2YBVA 4I4BA 5D0RA 1KQFB 5SZTA 4EU0A 4PG5A 2UUWA 4ECRA 2BQ3A 2WBRA 3K17A 2E5GA 3C46A 2V2KA 2LQBA 4JP8A 4OZ5A 3OUYA 5DQGA 5KFHA 2ZFHA 2R7RA 3RRGA 2WVDA 3GCWP 4CO1A 2LQ8A 3IA0A 1CULB 1WKJA 1MN9A 2IYIA 1FDNA 2V2QA 4KGKA 3A8IA 1F9FA 1SQGA 2XMJA 4URQU 5D78A 4N47A 1CSJA 4YR3A 3ENAA 3G6YA 1HR0F 2DB1A 1VMBA 5B09A 1R0AB 2RQKA 1HWJA 4X4PA 5HP1A 3HM9A 1TVRA 5FIIA 2ZBPA 4K4XA 3A8KA 2C3PA 3N6NA 5J2QB 1K9MT 2YKMA 3FVYA 4X65J 4M95A 3I82A 2A1BA 3B6BA 5DDPC 2DRAA 3CJSA 3MEEA 3UR3C 3DMJB 2CKWA 2R2TA 2HFZA 1HKAA 1KOOA 3L09A 3RAQA 4OI4A 5KFFA 1U2CA 4TLRA 3N0VA 2ZOMA 2D3ZA 3BSCA 3LP1B 4DZDA 1X60A 4DSLA 1FKAF 3VZHA 1IWAA 2EFQA 1YDLA 3LWLA 4NLQA 2FJVA 3OD2A 4DDFA 4F3QA 4OJGA 5KFQA 2DY9A 3HSDA 4CH1A 2RB7A 2Z30B 4WTYA 2R7UA 3GJSB 4X4OA 2R2RA 3T1HJ 5KFPA 1RTHA 2FDNA 3M9MB 3AXMA 5T7LB 1SKSA 1J5EF 2DNNA 3CJKB 4NXNF 3M6WA 1IBCB 2GJ2A 2RNEA 3Q86A 1EHWA 1Q53A 4HHJA 1JB0C 1T02A 2OLWA 4HDHA 1WKLA 2PMWA 4NI2A 5IWAJ 2BVZA 2DHHA 2H48B 3G82B 3BSOA 4O3SA 2PEBA 4NLGA 2C3MA 2PFFB 3PIOQ 3NL0A 3CJ0A 2LP4A 5AXKA 4N77A 2DTJA 1UPPA 3KLHB 4CLLA 4PQUA 4DFMA 5K8PA 4QPTA 4DF8A 1VRUA 5KG1A 1AZSA 4UY8T 5IZHA 3KDNA 4OYOA 4WYLA 5B0EA 4QWAA 3D2WA 1R8BA 4F2RA 3HJFA 2KT2A 2HHSA 3K59A 1VK8A 1YJ7A 2IJFA 1HBOB 3I5CA 3MPVA 3M1VB 4RNHA 4PXDA 4AD6A 5KFWA 2ASJA 2L48A 1HR0J 2MY7A 2OEMA 4Y6IA 4P10A 2MJUA 2GVZA 5F8MA 1FWKA 1HARA 1IM4A 5F0WA 4WFNQ 2MLYA 3CCES 4UQTA 2B51A 2FZGB 3TZZA 3UVJB 1EJ7L 4OYBA 1W2BR 2XLKA 4P6QA 2MKYA 2BX6A 4Q8FA 2DHSA 5D8HB 3GMGA 5AXLA 4DX8H 1TKTA 4J9MA 1CC8A 5A6PA 2MJNA 3QIPA 1C2PA 5DZ6A 5KAKA 3BR8A 1DQAA 1FKOA 1VBKA 1CJTB 4KYZA 2JC0A 2BACA 3IWXA 4ZJLA 1CG2A 1HNIB 1PJ6A 2I5JA 5DETA 2JL9A 1WSRA 3FCWA 1AUSL 3FEYB 2BM0A 3H7HB 3KLGB 4WBFA 2IC3B 3VHQA 1PGZA 2CQGA 1X9SA 2WONA 4PZVA 5L1KA 4GO7X 2J0QD 4JYAJ 4RUHA 4C8YA 3QSYB 2KT3A 5J1PA 3IN5A 3BQ2A 4UQGA 2LQJA 3TA1A 2BQUA 4LSLB 2CDRB 2UUBF 3MAAB 3BSAA 3AJDA 3NMRA 3PW5A 4WFXA 4Y2MA 3VF0B 2K1RA 5FDLA 3HF5A 3CC7S 4ZJOA 1LWCB 1CS4B 2DNGA 4HACA 5GAGU 3RW6A 2JNJA 2OMLA 4X4RA 1NJYA 1E6YA 2R9LA 1AFJA 4X2BA 4Q5VA 1R8PA 1V5VA 1NSPA 1BD6A 2V34A 2JEJA 4YY3J 3WC2A 2RE1A 4X4NA 2DCUB 2YKPA 3MM7A 3O8WA 1B99A 3M8ZA 4ECTA 3BGRA 4OI0A 1S1TA 1NPRA 1VFJA 2Z0GA 1U1OA 4M94A 1R0AA 4ZLNA 1U1LA 2RS8A 2GO8A 3US5A 3UD4P 2FLNA 4YFUA 2KZZA 3MMAA 4ZCIA 2OHDA 4DBQA 3HHLD 4QZVB 5A6WA 3TUPA 1YRTA 3PW2A 4JOUA 3O6QA 3TAPA 1UWBA 3AODA 2N3OA 1RKIA 4J9OA 3CC2S 4LF5F 3R7BB 2HAFA 1TL3B 2C3YA 5HVGA 4X84A 1CBKA 4MT1A 3PZPA 1I5OB 1VCTA 3I4PA 4DR2F 5HANA 1N34F 2JDJA 2FJDB 4G1QB 1FO1A 2HQDA 4OI2A 4BCAA 4DR7F 3O44A 4NA2A 4NMLA 4DCOB 4ZVEA 2XWYA 3PCOB 2N7CA 1N36F 1DQ9A 2HBRB 3FKBA 5J2NB 1UJ4A 3HVWA 1C0TA 4CH7A 4ED3A 2ZZNA 1X4EA 1R6VA 3QNWB 4FPIA 2IM1A 4K4YA 3R5BA 2E5IA 4E2FB 5KFKA 4X4UA 3PEJA 3ENQA 5KFOA 3IMQJ 3TZXA 3AQOA 2M70A 2OSRA 5F8IA 3EPGA 3P96A 4DLEA 3H98A 1S12A 2DT9A 2W2PP 5E41A 2FJBB 4OYZA 2LU1A 1U0HB 1Y5IB 4C8ZA 4N5SA 5DDRC 3KJNB 2ZH5A 5I3UB 1U2FA 5F3TA 1S6PB 3TUJC 2RHQB 3FMWA 2HHWA 4OHXA 3I5BA 3M30B 2ZH1A 2RSQA 5LXRA 4NLTA 5ETTA 3LH2S 2BJ8A 4HACB 4B3RF 4WFBQ 2R7WA 1UFWA 4JI3J 3DU5A 1WSVA 3BYRA 5KG0A 3MFIA 1LFWA 5HVFA 6FD1A 4B3SJ 4RR5A 1F5CA 5BXIA 1LKZA 3GTYX 3NBPA 3QQCD 5DG7A 3FEXB 4N8OA 4AYBD 4P7VA 2HZCA 3MOZA 3HD2A 1IQZA 3ISND 1LK5A 2HNYB 2ZWPA 2XHCA 4K5SA 3X3UA 1U48A 3CD7A 4I2PA 3KK3A 4HVZA 1NH7A 5HQLA 4LF5J 2FUG9 4J91A 2R8IA 2AYBA 4JI5J 1KTVA 2M2BA 4B9VA 1U09A 5GADU 4ERDA 2O67A 4N8NA 1NRKA 1UW9A 3N4WA 2CAJA 2IBOA 1TZ0A 4ID8A 5E2QA 2KG1A 4DPXA 5KOWA 3C14B 2CADA 3IG1A 1RQ0A 3QGIA 3SCLE 2B56A 2GAGC 3FDSA 2W25A 4DCPB 5M2UA 1UMJA 3OQ2A 5IS2A 2JEIA 4KAIA 4MKYA 3CCMS 1EARA 1KHVA 3TZWA 1QM9A 4QQBA 5K14A 1VRQC 3OL8A 1H7XA 3NG8A 4I0WA 3G6ES 3VAKA 2ZHOA 3DDNA 3TANA 2VBYA 2DR8A 3MR6A 2LA6A 4B3TJ 1ITPA 2UP1A 2UV8A 2UXDJ 1SQFA 3QLHA 3GZ7A 2F4FA 5EHHA 2XZWA 4EEYA 3MPUB 2CUYA 2LU2A 5E3QA 1RTHB 1S0VA 2QO3A 3W63A 1CJTA 3NBPB 3MM6B 4Z7CA 2Z2YB 3HT0A 2V5HG 1FI4A 1X4BA 1X4FA 2DD8S 2DXFA 2DY1A 3NCQA 1R27B 1RWWB 4RNFA 4DV3J 3V4IA 3OTOJ 4M5JA 3R2DJ 4AXJA 3BKUA 4B9SA 2P9CA 3HZGA 4DL5A 2YNFA 1NDLA 1DZ5A 2F8MA 2WAQD 3R2CJ 3VAJA 5EX3A 5GMKa 1AFIA 1F1BB 1CVJA 4K50A 1IJEB 2FLOA 4PEOA 5DGBA 1TUVA 1TELA 2HQFA 3C16A 1QJHA 1IKVA 2PFDA 1C1CA 2BANB 2LLZA 3ZTRA 5I3PA 2OJ3A 1O0PA 3DGPA 5ETOA 1M5KC 2KRRA 4OLPA 2XS5A 1VDHA 4ZPAA 5MLCV 1FESA 2C2KB 1YHQS 3MOJB 3W3SA 1EB0A 3FSIA 1PBUA 1UEKA 3PJ9A 4C8MA 2FIUA 2VKZG 1X5PA 2W01A 4P2SA 4ZCMA 5I42B 2UU9F 2UXCF 1VQ8S 2A2CA 2GMLA 3A8EA 1OY9A 2C1EB 4USUA 4GRSA 2NXNA 4A8XA 4HLBA 2MZRA 4IR1A 3EZOA 3JTPA 4NLRA 2W2NP 3MPYA 2G2OA 4LF8F 3ZC4A 4A8KA 4ZP8A 4B3RJ 3G2XA 2EKNA 3ITHA 4QW9A 3K5LA 3HHLC 1R6YA 3IRXB 3F0NA 3PFEA 2OSQA 2YKMB 1GQEA 1NJXA 5DDOC 1XMQJ 4F8RA 3S8SA 2Y1LB 4HDGA 1PYSB 3GSIA 2AZ1A 3AA9A 3IO1A 4HH0A 1SJ3P 1IBLJ 3NNAA 1VQNS 1NSAA 4QIWD 4JI7F 4C98A 4JI0J 4WK1A 3ENWA 4KC5A 5C25B 4ED6A 1H7WA 1K0VA 5LMUJ 4RUCA 1PC5A 2YPZA 4LIWA 1IUJA 1HQ2A 1KC8T 1OSCA 2E29A 1KLMA 5ADZA 4HR2A 3WC0A 1KONA 1SVDA 2A18A 4USVA 2RD5C 5DQHA 5J2NA 1VISA 2VFTA 4I6YA 2NS1B 2GMJA 5E3AA 5B0CA 2R7SA 1HMVB 4Q0BA 1BQNA 1Q82T 3KHHA 1WORA 4ED4A 2AZ3A 3WHIA 3W9JA 3MECA 4B9LA 2LKZA 3CCZA 2AJ0A 4NZ7A 2P8IA 3WBZA 4FNIA 2Q79A 3THTA 4DQPA 4WKRA 3EVMA 1U1NA 1BQXA 1REVA 2IHR1 4IH6A 1KQKA 3MEGA 4PG4A 3SXLA 2XBPA 2G9OA 4A4JA 4EGLA 3W60A 4I2QA 4LBPA 3CMAS 3DLBA 2YNHA 1ZETA 2J7UA 2JC1A 2ZEJA 2RKIA 1I3OB 4DN0A 1AXQA 3GILA 4PG6A 5D15A 4EZ6A 1MMLA 3BN4A 4BWJA 4WTOB 1S72S 1CJVB 3ET6B 1TL1A 1KQGB 3Q89A 5K8OA 2CPFA 1ZAVA 2EFPA 2A6MA 1CJKA 1KN6A 4ZVTB 4CM0A 4PXCA 3N5FA 1RTJA 3OVSA 1LOUA 1VC0A 3QGHA 2DBBA 1YSJA 3UWTA 4NE9C 4L74A 1RB0A 4LIRA 4LR9A 5ITHA 5M2PA 3MMBB 1HQUB 3CJ2A 1XMBA 4DR4F 2UXBJ 1OSDA 4K4UA 3RR7A 3O2IA 1IBMF 4NXMJ 3M8YA 3NEKA 4XK8C 3I55S 1FX2A 4IRCA 4UOFA 3OVAA 2NUUG 2HHTA 3A3OB 5LMUF 2DJWA 1C4CA 4ITSA 2HQ3A 4JI2J 1UVIA 3E2EA 2HBYB 3IAS9 3L4BC 3ZZZA 2PD1A 3NS6A 4PAAA 3RB4A 1ZM2A 4LFBF 3GG0A 4R25A 2HNZA 2OKQA 4O3OA 4B17A 1DARA 4M5GA 1SBRA 4EO8A 2B3TB 2ROEA 2UUTA 1IXKA 3DCAA 3D3BJ 3M1VA 2YNFB 3OV7A 1Q81T 3GPAA 1XR6A 2YY3A 3FFIB 5JUMA 4JV5F 1S1VB 2AF6A 4FZVA 1YJWS 1NB7A 4OX9J 4K4ZA 2DH7A 3MI7X 4B3MF 2CNNB 4KPYA 2Y8YA 1NDPA 4I7FB 2CPDA 2BRKA 3C19A 1S9GA 3H4BA 2H51B 2WSCC 3V4MA 2VFRA 3M05A 4MKBA 1YQHA 1KSPA 2D9PA 1X9WA 2ZM6J 2OPSA 3DOKB 2MHEA 3IGVA 4ZPBA 4CLTA 2DISA 5JMNA 4X62J 1VQ7S 2AGQA 2FVRA 4WP3A 1B4SA 2HPUA 4DUTA 3MURP 3X1LB 4AXIA 3MM9A 3PFOA 4C3MA 2VOOA 4K4VA 2XLJA 4O23A 4I69A 3GIIA 1D9DA 4JV2A 1RT3A 2IM0A 3U02A 4JI7J 1EKRA 5IC6B 2HFOA 4ZN1A 2XO6A 1LNQA 2ZVSA 4NYOA 2VDIA 2IVMA 2NXUA 4HKQA 1SL1A 1RTZA 5U47A 3EZUA 3D6FB 2FY8A 3OVBA 5D4NA 3LWMA 2M7SA 1SXLA 3CTRA 2MB0B 1H2UX 1U6FA 3KLFB 4L3KA 4ZPWR 5AE2A 1CJKB 4FF2A 1Q8IA 4R0JA 4OQJA 1IVZA 3TQEA 2VG7A 4HTIA 5DM6Q 5EWGA 5KFZA 3CCTA 1FXDA 2YXLA 1IR0A 1YZ7A 2NLWA 4DQIA 2LXFA 1S57A 3SZ2A 3N6MA 3PJWA 1UP1A 2ZBQA 3PRDA 1HLWA 5KG5A 1MWQA 1VIXA 4LT6A 2F9DA 4X64F 1GXLA 4DFPA 3BGUA 1NU4A 1LWEB 3G8SA 4C4WA 2Q6BA 2RU9A 1FKPB 3Q8RB 2BBEA 1DLOA 3I0SB 3NY0A 3QT8A 5E5NA 2HAIA 1Y11A 3M6XA 1FJCA 1Y10A 4B3OB 1Y00A 4YP3A 2C2RA 5CHCB 2KH9A 3SCIE 4CNZA 4J9RA 2XNQA 3Q8YA 2LCWA 3D7SB 4OZNA 4H4KC 3TA0A 4Q44A 2Y3YA 4C8KA 5C2GA 2E5JA 4DUZF 4CQ1A 4OYIA 4ER8A 1U1KA 2LXUA 4KT0C 1TL3A 4ZP9A 2ROGA 2HWTA 3CVKA 3LF0A 1KLMB 1VR6A 1S7HA 3P5TL 4USJC 3MAQA 2UUCF 4FVCA 3R7SB 1QSLA 4K0KJ 1RT6A 2APOA 2VFSA 2VV5A 3QPIA 5KT4A 1NHUA 2RVJA 4PQAA 1OPIA 1RT5B 4KRWA 4DZ6A 3PG9A 4RW9A 4FYWB 3FUYA 4ZVFA 3H2LA 2U2FA 2B5JA 1S6OA 3RZAA 3KLEA 4GVLA 3A3NB 1HNXF 2M88A 2OFHX 3NAHA 1N6QB 4U67Q 2GGPB 1U0SA 4C7QA 2C2NA 1VI7A 2DRDA 3E01A 3Q8QB 3M9NB 3D3CJ 2HLTA 1NM2A 2D3UA 4I6AA 5DM7Q 2HVHA 2AP6A 4B3MJ 3SFGA 3CSKA 1X5TA 4WIQA 4N56A 2A10A 5B7WA 1DLOB 4UOHA 3SQGA 2IMOA 2XYGB 2CQPA 2JLGA 4C6AA 3GV8B 3POTA 1JLEB 4P2MA 2XGPA 3NCRA 2NUHA 1S6UA 1U8SA 3BH6B 1Y5NB 1LW0A 1UTAA 1WJ9A 2DR6A 2YKNA 3P8BB 4X64J 3PVXA 1K0TA 3FEZA 5E3CA 3HT3A 4IOAQ 3UDVA 2IVFB 2V8PA 5C42B 1SH0A 3UW1A 3HLUA 3BJYA 4CNYA 4DR6F 3VALA 4XIUA 3S1TA 2MQ8A 4IQMA 4ECQA 4ZITA 1S0OA 1D8YA 1JJ2R 1RWNB 5ETLA 4O4RA 1HNZJ 4ZPCA 1M5HA 1TKZA 1RAJA 2RUGA 2I6WA 1EIYB 1NHVA 2V94A 1RK8A 4O3QA 3UDLA 2L41A 3V6JA 1N5TA 1CLFA 5D0HA 2K3IA 2YNIB 1RABB 3GU0A 2E7VA 3Q83A 4EBEA 1F9EB 2JRSA 2POKA 2ZKUA 3CIZA 3M32A 4MIAA 1JLFA 1F6TA 3UCZP 3G8QA 4PQUB 1FJGF 4M5MA 1U2RA 2BABA 2MQMA 2OI2A 2VKRA 2YQ0A 1AYEA 3GJQB 3QMQA 3RJMB 1PILA 5DLGA 1P6TA 3C6TA 4OZ0A 5GMEA 4O3RA 1RA6A 3D6MB 5J2MB 4KSEB 1HHQA 4OJHA 2LA4A 3D0GE 3C6TB 2WVBA 3GG1A 4OYWA 3SSQA 4F7VA 4C48A 2HHHJ 3CCQS 1TL7A 4UW2A 2HHUA 1M5VC 2KFYA 4JI4F 2EFNA 1H2VZ 4NLDA 4LF8J 3DYAB 1HPZA 2AEJA 4NYZA 4CZCA 1EP4B 2JX2A 2VIHA 1RAGB 3AD7C 4DFJA 3L7PA 2OTLS 2XO7A 2VBWA 3PNIA 1RA7A 4ID5B 1AB8A 1WHXA 2V68A 4ZKAA 4ID5A 4NLOA 3S6EA 5HL7Q 2VICA 2BRLA 1RHMB 2HVEA 5HMWA 2EEYA 3LUYA 3MM6A 4RW6B 5HJXA 3BYPA 2E44A 2DK2A 1H38A 2OFGX 5AE1A 1NDCA 2BE2B 3BGLA 3EDQB 2UUCJ 3P4UB 5KT2A 5CYQA 1YGYA 4PABA 3I9V9 4ECSA 1N34J 5CCMA 3KK3B 3MAHA 1WDTA 1RTDA 1FFSB 2RKIB 1TVRB 1EQ0A 4DMZA 1S1WA 4QPXA 1HD0A 1LW0B 4HYKA 1UEVA 4BHQA 2KG0A 2KXNB 2RF2B 4EFAC 1RAIB 4DQQA 5H9FK 2RRAA 4DOZA 3ONQA 2YTCA 4ZMMA 4IQXA 1I94J 3TYTA 2DHAA 3IS9A 4ZDNA 3UO0A 3AHPA 2F7VA 3CD5A 3ZFVA 1RWVB 3MDFA 4ZLLA 5LMNJ 4YR0A 2V8DA 1YLXA 2IJNA 1RAAB 2MZQA 4HL9A 3Q8UA 4L76A 1XMOF 2J0SD 1RXOB 4F0KA 5JVGQ 3T1YJ 6FDRA 3D1HA 5K20B 2VB6A 4PXBA 3OBIA 1FRXA 2WVEA 1IKXB 5LXYA 2OPPB 2C2MB 2ILZA 4QWDA 2B5JB 1LXJA 2RDIA 3BEGB 4ELVA 9ATCB 4B3OA 3DHWC 4P74A 1NSQA 1QVFR 1V3RA 3QAUA 2HRYA 3LP0A 4CO0A 3BO3A 4WFZA 3V81B 1GMVA 2JVRA 4YMEA 2C2EA 5LL6d 3DLEA 3P45B 2OPRB 1VS3A 2HHXA 1CPZA 3R97A 1NK6A 2UVWA 4OIXA 3KLIA 2B4UA 2EXUA 4ILMA 1ZM9A 1B0TA 1ZM3A 3BR9A 3J7YU 4L75A 2LDYA 4Y65A 4AT1B 2FLLA 3PO5A 3QJLA 1S6PA 4TY8A 4DSJA 3DOLA 3ZO7A 2WRMA 3TO8A 4RL1A 3QZ7A 5L1LA 2MQOA 2YNGB 2W9AA 1SKWA 4DPTA 3TOQA 3W5XA 4UY85 4EBDA 1VQ6S 1OIAA 2FVQA 4J90A 4CYUA 1H2TZ 1IWGA 1FHTA 1TV6B 2DIUA 1U6ZA 1E6YB 2DGOA 3DRXA 3IS9B 4TNOA 2G13A 3H90A 4KB7A 4ZP6A 4V19J 2LXIA 3D4JA 1FVSA 3R9LA 1URNA 1EETA 2UXDF 1S49A 3MEDA 4LSNB 2CPEA 2R4FA 4PPDA 1UKUA 4C9DA 4Q43A 2RUSA 3W9HA 2HHHF 2V0NA 2VA3A 5FLXY 5L1JA 1NK5A 1JLGA 4I56A 2B8PA 2AJQA 3NKYA 1BGXT 2DNHA 4ZP7A 1T3NA 1M0SA 3I0RA 3FBBA 3M2RB 4IH7A 4ECVA 3K8WA 2R2UA 5IM0A 1ZOTA 1VHIA 3M6VA 3RB3A 2Z58B 3BBCA 3D0HE 5F9NA 5KFDA 1WNEA 4GVBA 5HMXA 4OYXA 1VJQA 3OXLA 1UZDA 5K14B 1G7CB 4C11B 4RW8A 5KG7A 3UD3P 4U8VA 1UJ6A 2RF2A 3WZ0A 1NMEB 1RT2B 4CLSA 5LSOA 5CAAA 4XPEA 2IDLA 1XWLA 1FXLA 4MTPA 4DL7A 3JSBA 4OZ2A 5HLFB 2PDAA 4HHHA 1QAYA 2C2ZB 3PW4A 5DRKA 2ZBIA 2BR0A 1HHTP 1IBKF 2AT1B 1JLQA 1ELOA 4ZVGA 2OUGA 4J5OA 2HIYA 1X4GA 2N4CA 3MCOA 4NRUA 4MKAA 4A8YA 2PGCA 2GIQA 1IR1A 2HNDA 1S1UB 3LGHA 2KN4A 5EWFA 2CQDA 3GP9A 2NREA 2VQEF 3CC4S 4TU8A 1DTTB 4ECYA 4DQRA 1NH8A 2BJ7A 2GHPA 4LRDA 3T9NA 2X3DA 1GX6A 4AE5A 3KK2B 1RADB 2WBMA 2GC8A 2YWWA 3RAXA 4PKDB 2RMLA 4J7CA 4USKA 4WE1B 2F4VJ 3ZZTA 1K47A 1HPZB 1NAQA 3F56A 3M8QA 3OFEA 4DUZJ 5A8KA 1G1XA 1XMQF 5KFIA 1TR0A 3OW2R 1WDDA 5KG2A 1LQ9A 2IPOB 3UN2A 5A8KB 2GJFA 2M4MA 2OGUA 2XWXA 3FK4A 4MFBB 4U7UD 3W64A 1Q7YT 1YZ6A 1FTRA 2EK6A 3VTIA 2RDJA 1YKWA 1VC6A 1LFPA 2HHQA 4LF1A 8RUCA 3QSIA 2MLZA 1U1PA 1HWIA 1OWXA 3KKFA 3LPYA 2WK4A 4LRCA 1DTQA 1VGYA 3ZZPA 3QAEA 1NXIA 3QYYA 5JJBA 3ZTSA 2XC9A 1HHSA 3FSYA 1S79A 1CC7A 1BWVA 1JMTA 1GMUA 1MROA 4KFBB 1C0TB 1GT8A 1XN9A 2LFVA 1WEXA 2QMUB 1TUGB 3EVOA 2HNDB 5T41A 3M8SA 1ZTWA 3OJUA 2LEAA 2QLJB 3TJ9A 3NOGA 3HJVA 4ZVSB 4WFAQ 3GIRA 3G6XA 4RLEA 3SDEB 1ZTTA 3OL7A 5IC4B 2HLUA 3ET6A 1RU2A 1PIEA 3WDOA 1KFSA 5C42A 1SC3B 3PW7A 2C2OB 5HLFA 1KLNA 1RLDA 3AA8A 2JEGA 1M1GA 4IR9A 1W7WA 4FXVA 5C25A 2VQEJ 2A0FB 2QA1A 2BA9A 1ZS6A 3MPWA 4FP9A 2DGQA 3K57A 2VA2A 1Y3JA 2H4WB 1Q8BA 5CQGA 1VBZA 4X4TA 1BMQB 5FJ4A 3UI3A 3ZZUA 2X1AA 5GAEI 3MTKA 3IWLA 1S9FA 4OHVA 1HWLA 1SC6A 3T1HF 1X5SA 1M1HA 3GB0A 1HMVA 5C24A 4DFKA 2HGLA 2Z4PA 4WPAA 4Y0FA 2C28A 4DR6J 3CJQA 2MGZA 1U1RA 1QSYA 1T9TA 3NAIA 1NKEA 1NUEA 2WCXA 1DBDA 2D3OR 1NK8A 1XTZA 3MMCA 4I2QB 5A8WA 4KKOA 2MQPA 3BQ1A 1YBUA 1VC5A 1NJZA 1MN7A 3PJXA 3DRRA 3LP2B 3H5UA 4K7QA 1JXVA 4LREA 3HVRA 2YX4A 2AGOA 2J7WA 1RAEB 1TKXB 3RBEA 1NK9A 2B9XA 2LQ9A 2MDAA 2EC0A 1FVQA 3W61A 4ZS6A 1H0HB 1TUWA 3RW7A 1UVKA 4OYAA 4TU7A 1RT6B 5BYSA 1RWMB 4JI5F 4CYUB 1SQEA 4NXMF 2EPIA 3FGVA 3D1QA 2IA6A 3KMQA 1VQMS 1IKVB 1IKWA 2HHVA 1HNVB 4N7TA 1H3DA 1PJ7A 2KHCA 4P2XA 1FE4A 4IDKB 5G4DA 2ZOGA 4MYUA 4WYWA 2UVUA 5E3PA 3AB2B 1QUVA 4EMDA 4DWIA 1IQTA 4F02A 1FEHA 4DV2J 4J37A 2AYGA 2DGXA 3UNYA 2D3O1 4RU2A 2LYVA 1AA1B 4LF4J 1CULA 1WOOA 4ELTA 2MSTA 3QT6A 2W1BA 3DOMA 4ZVQB 2KDOA 3FNNA 1LK7A 4OJ1A 1KNZA 4NL5A 3BZQA 2XSFA 1MLAA 1JJCB 2F9JA 5ETMA 5AE3A 4QIEA 4DX6A 3SV4A 2YKOA 1WI6A 5FLXU 2P9GA 2QTWA 2F3JA 2HFSA 3D66A 3FCHA 3D0IE 2MEWA 3OFGA 4XDDA 3OTOF 4J9LA 2L08A 2J6UA 4IG3A 4DQSA 2MZJA 2P5VA 4P72A 2DR7A 1XNRF 1SI9A 3IXQA 4DI6A 1S59A 2VG7B 3N79A 3LQVA 4U95A 1S1XB 4USWA 3C15B 3V5RA 3K7RA 2W8LA 3J81U 1DFDA 1C4AA 3A8JA 2DH9A 1EX8A 2XNRA 1L5UA 4LSLA 3CJRA 1U26A 1XR5A 1SKRA 1R0BG 5J2PB 1YVFA 4R0EA 1YJ9S 4WK3A 4NCGB 3OXFA 4CT8A 1YTYA 2Z2LA 2N82B 1DRZA 2E5HA 4E0DA 1AROP 3DC2A 4LUBA 5KFSA 5HBMB 2FHKA 2JVOA 3MHYA 4O44B 2WSFC 4JUZA 5LT5A 2Q66A 2BE2A 2CG8A 2HVDA 4GKJJ 3KLGA 4A8MP 1MROB 4KFBA 2FHJA 3TP2A 1S10A 4Q8EA 4QCLA 2HGNA 1AUDA 2VG5A 1T9WA 5HVHA 2IJRA 3Q22A 4HTJA 2H9ZA 1WI8A 4FXDA 2KZMA 3MD3A 4F0MA 2MKCA 3ILJA 4O4GB 1OQ6A 5B0BA 4LF6F 3SEOA 4H4KA 1ULRA 2R7TA 2ZDPA 3SQOP 3GIJA 2V8GA 3IG1B 1Y4ZB 2CQCA 4Q2MA 4Q7AA 2KT5A 4PRFA 1RTJB 2R3VA 4M1KA 2BJ9A 2LEPA 3LW5C 5CCLA 1O6XA 1L3KA 4DV7J 2RRNA 2UVRA 4G65A 2QG9B 1WHYA 3UD5A 4AFFA 2X1BA 2VBZA 1RKJA 1UVJA 5L9NA 2HNYA 1PAUB 2OEKA 2QMWA 1FXRA 1GK8A 2J9DE 1JLBB 1PSDA 3AAWB 3KG4A 5KG6A 3T6JA 4ES2A 5HJYA 2ZKTA 3MPDA 5HMYA 3IRWP 2HQGA 4WF9Q 2XI3A 1M5PC 1XERA 2ILYA 2KHDA 2RH3A 3BB5A 2VG6A 3ISZA 1TKTB 1H98A 3W7BA 2YNIA 1KOHA 1M90T 1XEZA 2B7BB 2QN6B 3T19A 5LSRA 4Y2KA 1Z2LA 4DV1J 4QR0A 3C14A 3IWNC 4GVBB 2A6OA 3DRPB 1Q16B 1SC1B 1S6QB 3C6UB 2HSEB 1FNMA 4LRFA 5KFRA 2QA2A 2W7OA 4E8UA 5HI7A 4QYRA 4IOCQ 3D28A 3KJQB 1M5SA 1FNXH 4UOCA 2FD2A 4CRJA 1JLAA 1RE1B 3GR0A 2NPFA 2CQHA 1HYSB 4F4YA 5M2RA 4BLGA 2WB4A 2NR0A 1HI0P 5DJBA 5L8RC 2UUAJ 3TAMB 2DNOA 4LF9F 1KDNA 3B8HA 2JJ4D 2ZUGA 4ZPDA 4JV5J 1WACA 5A2QY 2WW4A 1PYOB 2EK1A 5F8LA 4OX9F 3D68A 3SMZA 4FS2A 4B9UA 1XK8A 2HFNA 1YJUA 1DAXA 3JQJA 3PYGA 2AYMA 1RJJA 5EX0A 3VCDA 4YUDA 3E01B 1VQSA 3BGOP 4DL2A 2AQ4A 1VRTB 2AJFE 2BKNA 2MQLA 2QLWA 4EYHB 5CXTA 1WOPA 4TY8B 2DNZA 2Q3PA 4JI1J 3DI6A 2CJ9A 1FWPA 3RB0A 1KTQA 2YKNB 3DNCA 2B0GA 3TX8A 4F3MA 1N4LA 3BH7B 4ZVOB 3VQTA 3HXMA 1L3SA 2O01C 5L39A 4AQYJ 2BKPA 2KL8A 2V9KA 5H9FJ 4KGXB 1F9HA 5ETRA 2GFFA 3BPSP 3CDWA 4NOHA 2KJVA 4ZPVR 4IDKA 3CO0P 4ES1A 2DNMA 4NCBA 1HYSA 1A6LA 4C0HA 3CJ3A 2D69A 2V4QA 3CJ4A 1N32J 1H73A 2ZHBA 3VAHA 4LSZB 4MAKA 3ICLA 4OJ3A 2UV8G 3TEHB 2G2ZA 3EMTA 2L3MA 2GZOA 3HFVA 2XI2A 2Y0BB 2YWFA 3GYNA 3CUNA 3NGRA 3PXGa 1FDAA 3ISNC 3OR1A 2MKIA 2XMMA 2CPIA 3J80Y 1G6BA 5C5JA 3PX0A 2Z8QA 4OLOA 2E1RA 1SB6A 3GYGA 2L9WA 1C1BA 2XMWA 3NRBA 3QWPA 3J7ZT 4DV3F 5A8WB 2QE5A 4U96A 4WZQA 2QRRA 3SSSA 4KIAA 2ZH2A 2IC3A 1NK0A 1Q5VA 2E1PA 4UUXA 1FA0A 3ELHA 2PI5A 2X7IA 2CZVC 1XR7A 3KLFA 1Q0NA 3HO1A 2WB1D 2OPSB 3DOKA 3AJ1A 3N5BA 5BJRA 3GIKA 4DJBA 2FB0A 4WCEQ 3D6TB 1K1QA 2J9CA 4IFVA 3ZZYA 4RW6A 2HIQA 3VAFA 3RBDA 3V6DA 3FBCA 2VUGA 3W65A 2NXJA 1S0MA 1I51B 1LWCA 3BM7A 3TAMA 2R7OA 5F8GA 1U49A 1PO6A 1D9FA 4KH0B 1JLBA 3W5YA 3H2UB 1RCOB 1RT3B 3CJ5A 2BE7D 2W9BB 4NI2B 4RNNA 4U9RA 1HBMB 1O51A 1LW2B 3EUNA 4UZCA 1HBMA 2CZ4A 4BC9A 4WE1A 2MY8A 1NPPA 1BHNA 1NZ8A 3M8QB 2AEFA 1XNQJ 3HHKA 3LPEA 3DRPA 1HBUB 1VIOA 4Q0BB 1VRUB 3CDAA 4DR5F 3KUHA 3WQPA 3GONA 4UUWA 1SUQB 2CPHA 1X0PA 5LJ5Y 2J0WA 3KK1A 3UCUP 1X9MA 1WG4A 2DXDA 1EQMA 1H6KX 3H2VE 4KPCA 3MUTP 4DS4A 1P9YA 1RWXB 2QFIA 2WW8A 3OPKA 1SC4B 1SV5B 3ULHA 3OL6A 1NB2A 3NGUA 1FFGB 1RHRB 1RWUA 2YX7A 1PKUA 3I32A 3UQSA 3NNCA 1RYSA 4KHPJ 2IRYA 3RGIA 2MMYA 4IYQA 4YQWA 3M2UA 1T05A 1WC0A 1SPBP 4DG1A 1JJ4A 3DLLQ 4RUBA 1E6VB 3NXZA 4IUFA 1F5AA 4X4QA 2XSJA 3GLJA 3N6LA 1OYDA 4ZHRA 1BQMB 3H4DA 3IC1A 1K73T 3RBZA 2D9OA 1C1BB 4OFZA 4UTGA 2EVZA 1VQLS 1MSWD 1URRA 2MQNA 1WTFA 1U7LA 2J7KA 1Y7PA 2K3KA 1NK4A 4K4SA 3AB4B 3FFIA 2AX1A 1UL3A 2GQ2A 2J8SA 1G3OA 5DG9A 2EFVA 3C15A 2V6AA 2HURA 4M63A 1L3VA 5D6GA 3W2WA 3R5DA 2XY7A 3CDUA 4TVAB 1AW0A 3R8YA 4FYXB 1T03B 3TVYA 2PMHA 4IG0A 4M5HA 3KHLA 4MMOA 2W24A 2BDPA 1UFLA 2D1CA 5E0OA 3JXOA 3VGVA 4CLZA 1N56A 3HSGA 4YB6A 2PA8D 2ACMA 1D9AA 3B4MA 2UVVA 4CLPA 1FWLA 4OZ1A 4O3PA 2ZH8A 4DR4J 3MEDB 4IFYB 4LSNA 4OMFG 1WG5A 5F0UA 5KFTA 4TQSA 2KM8C 1V6HA 2LQ5A 1RTIB 4KGVB 4RW7A 4B3TF 4G3IA 3V81A 2W2OP 1L3UA 2B9WA 2FC8A 4DR1J 1REVB 4JI3F 3GR1A 2B4VA 4KKOB 2JZ5A 1RAHB 2ZNYA 4P2FA 4QIGA 4CLKA 3W62A 1RDRA 4DPYA 2LEBA 2E7XA 3G82A 2FY1A 2B4PA 3IR6B 1S1TB 5GMDA 2GX8A 4CDIA 4Y00A 4DPUA 2R8GA 5H9EK 2ERRA 2YNGA 4URSA 3AOCA 5K8NA 2KTQA 2WHOA 2J76E 2QJ3A 5ETNA 1J5OA 4LF4F 2DR9A 2AJ1A 1FJGJ 4JV0A 4R5PB 4RO0A 2MZTA 2JEFA 3HHDA 3HHLA 3W66A 1VQKS 1CS4A 2O66A 1WD6A 2DR5A 2BJEA 3EWGA 2FJAB 2HWIA 3HHLB 3L95X 3LP1A 2K7JA 2H3EB 1TTHB 1JXEA 3LGMA 2WZ1A 2ZBRA 3MTJA 1FRIA 2HFUA 2G0CA 3OTCA 5D4PA 3T1AA 4X62F 2ZJRQ 2AEMA 1HIYA 2QZ8A 4ZPTR 1D1UA 5J1NA 3QATA 4F26A 2N4DA 2V67A 2VH7A 1TFYA 1R7IA 1WF0A 1BUXA 5DZ7A 5BR8J 4P52A 1F0XA 1WKKA 2KXFA 3M8PA 3MR2A 3DU6A 2DGWA 1OQ3A 5E33A 5H9EJ 2XZTB 3EE3A 5LMNF 3ETOA 2IRXA 3BKFA 6AT1B 2XTJP 4KE5A 1RT4A 1P1TA 7FDRA 3J7YI 3VWSA 3VAMA 2JWNA 3H8YA 3IM9A 3TVZA 5EN1A 4FF3A 1A0OB 2VC0A 1VK3A 2QL5B 5IT4A 1VOMA 1IKYA 5CZVA 3PYFA 4S0MA 2AIRB 1WUUA 5KTQA 1JLAB 5KFNA 3CD0A 1N8RT 1DURA 3E8OA 4BWMA 4QIFA 5F3ZA 5IV3A 3V6HA 2LECA 3H5YA 5GVQA 3UDEA 2FHOB 2JHEA 1TL7B 2NQPA 1KQSR 1TAQA 5GAGI 1C1CB 2BANA 1S4FA 3E3XA 3MFHA 2ASLA 3G9CA 1BWEA 2JSXA 2BW7A 2V9WA 1R8AA 2IM2A 3H42A 1Q95G 3KNGA 2GQQA 4IKAA 1Q79A 3DLGB 3SBMA 3ZNUA 2B9YA 3TUIC 3TZYA 2V50A 1JWWA 2LMIA 1BE4A 5KFYA 2RT3A 2YWHA 3PHEA 4H4OA 1M5OC 3T6BA 3QJPA 1MWZA 4LQ3A 4CLYA 1YRXA 2HS3A 2ATCB 4WKYA 1XMOJ 2DNKA 3KLHA 1N5QA 1O5JA 1XQIA 1S0NA 2YWKA 1MMNA 2F1FA 2VG5B 3JSRA 2GA7A 3L7UA 4J9PA 4B9TA 3AD8C 2KFZA 3ETMA 3EXYA 3KG1A 4JYAF 1UWAA 3O3LA 3VGSA 4GC7A 4I1TA 2HS4A 4L73A 2HGMA 1ROFA 1ZPVA 2DNYA 1Z1ZA 3CIMA 4OX6A 5K9FA 2XYPB 3TARA 4A8WA 4PWDB 2FYXA 3FQLA 4QYZJ 4USTA 4ETXA 1Q78A 5B0DA 5KFEA 3BO4A 1ZZNA 2RHSB 3KJVB 3P49B 5BR8F 3KDOA 2CQBA 1YG0A 3K8VA 2KXHA 4DL0C 3OFHA 3VAIA 1RYRA 2OH2A 1T7PA 1W26A 5F9LA 1OO0B 3A1YG 2HRUA 4RWWA 1B70B 2HHPA 1SJFA 2Z2ZA 4QU6A 4I7FA 2ALZA 1BC6A 2QSWA 4DR2J 5J1EA 3OT9A 3D9BA 3K5PA 1GNKA 2X3GA 3ZZRA 3OJSA 2VJUA 4U6PA 1E6VA 4QOTA 2I9SA 2CQ1A 3DLKB 3BDEA 4I6WA 4ZJQA 2HZVA 4F0HA 3H0PA 2CRLA 3CJKA 3MM9B 3M8PB 1FEEA 1F3VA 2XHWA 4UOGA 5HQMA 1SJQA 3IGNA 5HBMA 4AL6A 3GV7B 1R43A 2Y0SD 1QLNA 2J5AA 2R8KA 1B7YB 4TXSA 4FYDA 1B7FA 2AX0A 3ZTPA 4YOEA 2QMXA 3OLAA 2XMTA 1UEUA 2D74B 3R6GB 3KJFB 1JLCA 2VODA 3MEGB 4LQ9A 1UVLA 4C3KA 2H5IB 4KH1B 4ECZA 3DLHA 3U1LA 1K1SA 4QWEA 1HW9A 2NPIA 1FCAA 3IBCB 1PC4A 4NWBA 1FDBA 4AL7A 1YIJS 1NNDA 3GWCA 1FX4A 1TV6A 2QGFB 4USHA 3PW0A 3R6LB 4NXNJ 1P1LA 1JK9B 3CB4A 1MMDA 3M30A 1RWKB 1WWHA 3CCJS 4DUYJ 1IBMJ 3C2PA 4DPOA 2GO9A 3KFWX 2GIFA 2XMUA 3QIDA 2FJEB 4NPOA 3ZZOA 3SV3A 5IT9U 1YBAA 2DGTA 4OV6A 1J5EJ 2Y1RI 2VDHA 3C66A 3I9ZA 5EDWA 1IBKJ 1FK9A 1Y5LB 1QUPA 3PRBA 2UXBF 2R2SA 2KU7A 1YJVA 2V8VA 2HRTA 4DU7A 4NASA 4BDPA 5DO2A 1G4CA 1LWEA 1YBTA 5I4MA 2CZ9A 2GCFA 2M52A 2YX1A 1X8DA 3DI6B 1QE1B 3O1LA 3OTDA 3EVWA 1M1KT 4Z7YA 4LFBJ 1TQLA 4ALZA 3A4TA 3NS7B 4ECWA 4ES3A 2CQIA 2GW8A 5GADI 5GAHU 1WC6A 2XEXA 3N9UC 4WXWA 2J9EA 3MEEB 4TQRA 1W25A 1Z4UA 4Y34A 1U0HA 3I6PA 3LAMA 1IKWB 4M5IA 2CPXA 4WP8A 5HK4A 4FPRA 3DOLB 3H59A 1QTNB 4QIVA 3VGUA 2KM8B 4DSIA 3UE2A 5F8NA 2HVIA 2L9NA 3GJRB 4GMKA 2OIHA 3SIPB 3QT7A 2BW2A 3NWGA 3IR5B 4C2MA 2WOMA 5CZXA 5KT6A 1HW8A 3A3PB 2KJWA 5F41A 2CJAA 3EYZA 2QL9B 1N0VC 2WOMB 2DNLA 4HHUA 2QEXS 1HFEL 1GTEA 1WF1A 1YWXA 4EBCA 1OS5A 4IFYA 4ZHRB 3JAMU 2MGZB 3MM5B 1QTMA 5ETSA 1FK9B 1RT7A 3KUGA 2DKOB 1U25A 3MCNA 4LR8A 3HULA 2W7PA 2D7SA 4LVOP 5D4LA 2W7AA 4UT4A 4OL8A 3D67A 2QT7A 3MM7B 1RAOA 1JKHA 4I68A 4OZLA 4N41A 3CULA 4W92B 4KJIA 2JLEA 4FNHA 1NJIT 1RP5A 2I1RA 1QE1A 1WELA 1KHWA 3I31A 3KG0A 1U8WA 5CD4A 2HG4A 2AGPA 1Q4RA 4PR6A 4C0BA 1TKXA 4DR1F 3EGZA 4K5RA 2OTJS 2NYHA 1ZM4A 2RIJA 2CNLB 3FCVA 5KFMA 3N01A 1JJHA 2JFKA 3PDNA 3TR5A 3CCSS 2NCKL 4FBUA 2COLA 3VVTA 4MFBA 2YQ3A 4R8UA 4NCAA 1N54B 3CDBA 5IV4A 1EAYC 3DDIA 1RI7A 4PG7A 2CWKA 2KRBA 3K58A 4O0IA 1FE0A 2BJDA 3IBFB 4ENOA 1X4AA 1O8BA 3G8TA 2PIIA 3ZZ0A 2HEKA 3PTWA 2W9BA 5HROA 4GO5X 2M3DA 3RUBL 4JI8J 3UN5A 1BXNA 1GXUA 1SJ1A 4FKXA 3U27A 3QT5A 1TK8A 1HD1A 3AY0A 1GMWD 3R27A 3Q8VA 4KGMA 4W98A 2M5YA 3HKZD 4FN5A 1BY9A 2CWXA 3HHEA 4LF2A 2E1CA 3MMJA 4ZVHA 1H74A 2AJ2A 3RTVA 4QU7A 2FGCA 1HL6A 1RISA 4A48A 3KJVA 3RU0A 1T94A 2PC6A 2ZE2B 4MIBA 1SKUB 1RWOB 3Q2SC 4NZ6A 5EGYA 1SIWB 2BKOA 5C7PA 5J2MA 3S01A 1SJ4P 1KKHA 4I67A 1T95A 3U7JA 4EWTA 2O3DA 1JLQB 3MGJA 4JI6F 5J2PA 2RRBA 3DXBA 2MKJA 2E7WA 4LF7J 2ACYA 2K8GA 1KR4A 2C3UA 4M5DB 4NCGA 1OJ4A 1NBEB 2XYHB 1WEZA 2AMCB 3EJMA 2VZ9A 5HO4A 2XLIA 3RR8A 2ZDOA 1ACMB 3RRKA 5B08A 4MH8A 1S97A 5E7OB 3A12A 1B0PA 2OPQB 4USMA 3FSXA 5JXSA 2IY5B 1ZZFA 2R7XA 4C8NA 3DHXA 4ZCKA 3M7VA 2CYYA 3MECB 5DS7A 4J9KA 3HHNB 1N48A 2PO4A 2YH0A
chains in the Genus database with same CATH topology
1WHWA 4I2PB 3K5MA 4F4ZA 1MWYA 4LMZA 2RS2A 4DR3F 3QO9A 1VQ9S 5GAHI 2BXJA 1S76D 4QR1A 3GFYA 1GAOA 4O3NA 2ROPA 1S9GB 5KG3A 1Y0HA 3U1MA 2E9RX 2RU3A 1V3SA 3TAQA 3V6DB 1S1XA 3R1HA 2ZJPQ 2X1FA 3G86A 1FNOA 4Y3CA 4IRKA 1KVIA 5D3GB 3OL9A 4USIA 3JTOA 2I38A 1VBYA 3LGNA 1MU2B 3TUZC 3IBWA 4ED2A 1TKDA 3NLCA 4DLGA 1XBWA 2DITA 5IT9Y 3M4XA 4DN9A 1T8EA 1VQOS 4A8OA 3MCSA 3I0SA 5KFAA 2HVZA 4TYBA 3POTB 4OI3A 4B02A 3PX6A 3EX7B 3OLBA 4JI2F 1JIHA 1D8ZA 3MMCB 4R5PA 3Q8PB 5KFVA 4HEA9 1C0UB 3FZ2A 4NZ0A 4DHVA 2YKAA 2EI5A 3DM2A 4KO0A 1N5VA 5HN0A 2G1DA 2ZM6F 2ZNZA 2W8KA 3GFXA 1ZYQA 4OHYA 3H20A 5D4OA 1TK5A 2QLXA 2EG1A 4HI2A 4Y2AA 4RNOA 3T5LA 1RT1A 3I5AA 2WSEC 1NJWA 4A8FA 4BS2A 4G1IA 3I4HX 2BQRA 3QJJA 4A47A 1Y3KA 1GXTA 1FD2A 2MKSA 4RWXA 2C2DA 4RW4A 1MU2A 2EFGA 2SXLA 1TFWA 3H25A 2HWHA 5AXNA 3SSRA 3GFHA 1NKBA 3SCJE 1WTBA 2CPZA 3H5XA 3KOAA 1F2GA 2GHVC 3NCPA 5G0RA 2BZ2A 4WU2A 4XPCA 2ADBA 2BYCA 4CTAB 4DV1F 2M8HA 1UWBB 4QR2A 5KFUA 3KYLA 2AU0A 3KTQA 3N28A 4DV5F 2B43A 4LJMA 1N88A 3QGPA 2MKKA 3J7A1 4URGA 3GE9A 4PCQA 2ZZMA 4AL5A 3MUVP 1I94F 4DG1B 1GX5A 1X5OA 4CI0B 4D3HA 5IXUA 4F50A 4GKJF 3PV8A 1FJ7A 5F8HA 5CYQB 2MZ1A 3QGGA 3VAGA 2DHXA 2HYIB 2BOPA 2DNQA 1TL4A 2AW0A 3DLKA 4EZ9A 1Y9OA 2OPQA 1N5YB 2NZ4A 1WEYA 2FHJD 3M2VA 3V4IB 4H54A 2GNKA 4NLPA 1B0VA 3M2VB 4WJBA 1S1VA 1YJNS 2CIMA 2VFUA 3BGFA 2HMIB 5I3QA 5IQQA 3DYAA 3GIMA 4G1PA 5HMZA 2PEHA 1U45A 4C8LA 2KB2A 5LSLA 2ZJQQ 2MYFA 4YB7A 2VPZB 2VC1A 1KD1T 4ILLA 3SCKE 3QLHB 3B82A 2RQMA 1A9NB 1FERA 3T9ZA 2K7KA 4DV2F 2VL1A 4F3OA 2VFVA 5D77A 5EWEA 3EZ5A 2XS7A 2X1GA 3S7RA 2ZD1B 3VR1A 1W2IA 4LFCF 2E66A 2ZC4A 1HQUA 1KS2A 5KT7A 4FF4A 5KFGA 1HI1A 4M8LA 2XULA 3NP5A 3RAMA 3K5NA 1TAUA 1SH3A 1LWFB 1P8GA 1BLUA 3GSDA 3M2RA 1LW2A 4X4VA 4NYPA 2VPYB 3VZIA 3HVTA 1VBXA 4MK9A 4C0OC 1R31A 3PR4A 2M8DB 2HQIA 3EPIA 3OR2A 2HMIA 2C42A 4WZMA 3ENVA 3BDPA 3T5KA 3LANA 1DQ8A 1VHFA 4LVNP 1EETB 3MMBA 3NGKA 1QSSA 4H4OB 3CF5Q 3R1LA 2AD9A 2Y1JA 1FDDA 2OP5A 3T3FA 4TLQA 4KV8A 3I0RB 1SL0A 1FRKA 3MF5A 4Y2IA 1N6QA 4KV8B 2KFNA 2J8AA 3RB6A 2PI4A 2RILA 4K4TA 4IO9Q 1RT7B 4ED8A 2IM3A 2W4DA 4ICLB 4CH0S 3JYTA 1VQ4S 2IRUA 2CG4A 2OPRA 3KMSA 2WTFA 1HBNA 1TL5A 3DRRB 3LP2A 3MZIA 1NEEA 4IOBA 3TVKA 3NS5A 2F8HA 3FZBA 5G0RB 2UXDF 4A8SA 1R8HA 4KR0B 1DHMA 3BO2A 4G1QA 4F4WA 2M9KA 1Z2ZA 3F73A 1JXLA 2FPHX 3J7Z5 3I87A 4ED7A 2QV6A 4CCHA 3KHRA 4JBCA 3LALA 1BQNB 2BUNA 4Y28C 5GAEU 4ZK7M 3T5HA 1ZAWA 4H4MA 2DPIA 1U1MA 2PE8A 4RU9A 2YWGA 2M0GB 2CQ2A 2IFXA 2KYXA 1K8AT 2ATLA 4IRDA 4HI1A 2YVSA 4RBUA 1D3WA 1MNEA 4WU3A 2ASYA 5KOXA 4KHPF 1IN0A 3CGIA 3DLEB 2IAJA 1CQMA 4C8OA 3MXHP 5DDQC 2DCLA 2IAJB 3HK2A 3HX9A 1S1WB 3K5OA 4KQZA 4D3GA 3LAKA 4JV1A 3L7OA 4RBTA 2W9CB 3PR5B 1N5SA 3BS9A 3T5JA 2N3LA 2CJBA 1X0FA 4ICLA 3JYTB 5AJ3F 4OHWA 4OV1A 4ETZA 3JAMY 5DG8A 2O1PA 4OZJA 1OPZA 1S6QA 3C6UA 3HVTB 1FTCA 3OFFA 4ELUA 4Y2CA 2CFXA 4DV6F 1C0UA 2JOQA 2P6SA 3QWUA 1SH2A 3C8YA 3PEHA 4Z37A 5J1EB 3IAM9 1HWUA 1DTQB 2V4JA 1XC9A 2JLFA 1TK0A 1X4DA 1KRPA 2D41A 4ECUA 2XS2A 4NX9A 4FBTA 2JH3A 4JI8F 2V4RA 3T1YF 3FRYA 1DTTA 1BQMA 4W90B 2XMVA 1T05B 3Q23A 1HNWF 5C24B 2DRBA 3VQSA 5KFJA 4ILRA 2DGVA 1L3TA 1IBLF 4L3NA 4K0KF 1HNIA 2I5JB 1I1GA 1Q7LB 2XY6A 3K2YA 2DO0A 3MUMP 1FT8A 4ZA1A 4EO6A 5B0AA 1YJRA 3TA2A 3SFUA 5L1IA 2MKHA 3O5TB 1LV5A 2VPXB 2MZSA 2ZC3A 2E9ZA 1X4HA 3CCVS 2BV3A 4RKUC 1HBUA 4NLYA 2GQCA 4NLSA 3Q24A 2ASDA 1SL2A 2E5LF 4Q0BA 4IFVB 4A8QA 4X65F 1VQ5S 3NGDA 7FD1A 1EP4A 4NLVA 3DLGA 2NSCA 2OO4A 4CIOA 2O5DA 4QJVA 3FRZA 4R8UB 1UW4A 4KHRA 5T7LA 1JLGB 2KKHA 4NA1A 3PX4A 3AH6A 3QIPB 1RGVA 1Q86T 2XMKA 5CA5A 2FJWA 4O4GA 3L3CA 3HVAA 2ZHAA 1NK7A 4C11A 1RT4B 1QAIA 3DMJA 3DDKA 2EW9A 4IG3B 5B0GA 1NO8A 1S48A 1HNVA 3Q8SB 3EGNA 3DFEA 5A8RA 2QA4G 2ZE2A 3BQ0A 2FVSA 2HW3A 3KNAA 2QIFA 3H5SA 1IJFB 4MYTA 2VBXA 3BF4A 3MM8A 3PKYA 2XCPA 1N52B 3F41A 2YKQA 1NZAA 4IO1A 3OTBA 3LO3A 4K59A 5IWAF 3TW0A 4RW9B 4Q45A 4AUKA 1WG1A 3DRSB 3THPA 3JSMB 1VLYA 3SYZA 3D54A 3KHGA 1A7GE 3QZ8A 2YH1A 1HQEB 2J0XA 2VPWB 3WX4A 4YHHF 4ATNA 2AWZA 1HQEA 2XY5A 2F4VF 1U1QA 2ZOFA 4RNMA 4G6VB 3FQKA 2DH8A 3CD6S 2B6AA 1FD8A 4L72B 4CT9A 2ZH6A 3GV5B 1RT5A 2XGQA 2CPYA 2K1RB 2FVCA 5FDLB 2B6AB 2H5EA 4HH1A 1S9EA 3UFCX 4DV7F 1RT1B 3PY8A 4F2SA 3MR3A 2ABYA 2V8HA 1UVNA 4KBIA 3MEKA 2R8HA 2GIRA 1F5BA 4DV0F 2EKYA 1I6JA 4RUAA 2QSFA 4Q2LA 4TU9A 2EWHA 4YR2A 1QAJA 2NSBA 4EUVA 2ZH7A 3BSNA 3UNGC 5KFCA 1YITS 2RJZA 1FRMA 2DGSA 2PA3A 4J9NA 4PG8A 4PUOA 1JNRB 3IFEA 3MMAB 1S77D 4YY3F 4QW8A 2DIVA 2VQFF 3OR2B 1FRLA 4N76A 1G2EA 2ZITA 5KFXA 4MK8A 4PWDA 1WHVA 4ZCLA 2CQ3A 3I96A 2FHMA 2J9DA 5A8RB 3DM2B 5MAOA 3J81Y 5BYQA 2HS0A 4I64A 5A0YA 1T03A 2UUAF 1N0UA 3DRSA 3JSMA 2CQ4A 3UDCA 5KT3A 4QWBA 2N7YA 2VG6B 4XO0A 3OSNA 3TRGA 3LP0B 2RQ4A 2F8EX 4RBVA 3Q0AA 2GMHA 3SI8A 2ZD1A 2IMWP 4L6V3 1ZH5A 2EG2A 4MIWA 2A2DA 3RRHA 2HNZB 2Y1IA 1JX4A 3HPOA 2P9EA 4DL6A 1SJRA 3QO9B 3M9OB 2Z2MA 4QWCA 1U47A 1V3ZA 2WONB 4XDCA 1APSA 4KHMA 4DSKA 3BREA 1YI2S 4YDXA 4JI0F 3W2WB 1LWFA 3G6VA 3M6UA 3D5MA 1KEKA 2OMOA 2BM1A 1V9OA 2AYEA 3V2UC 2AJ4A 2P6TA 2AV5A 3AJ2A 3CT9A 1RT2A 2W4PA 3MWBA 5CD4H 4BBYA 5E3RA 2PMZD 1ZAXA 2MHNA 5SUHA 3Q2TC 5IFMA 2DVIA 3AQPA 3C3LA 1HA1A 1S99A 4O44A 4OX8A 5KFBA 4LFAF 2PT0A 5DLFA 2FLPA 5FD1A 4PXEA 2VONA 2C3OA 2UZAA 4DS5A 3MM5A 2VASA 2GHWA 2YNHB 4K2XA 2W9CA 4CO3A 4ED0A 5HP1B 1K9MT 1P27B 4PUOB 1GH8A 1JLFB 1KVJA 2I2YA 4YDDB 2FTRA 4RW8B 3OSPA 1WF2A 3HP6A 4YB5A 1UA1A 2XCAA 1X4CA 4C97A 5CYMA 4HT5A 1HWKA 2QA4S 4U7CA 1UAWA 2KI2A 2CJQA 3U1NA 4OI6A 4X66F 5A0YB 3OUYB 4B3SF 5I3UA 3OHBA 3G71S 1JNZB 3KWMA 2C22A 4ED1A 2DHGA 1HNZF 4TY9A 5AXMA 1CQNA 2FJXA 4TN2A 4WXOA 2IA0A 3CWJA 4PWUA 3MD1A 1QY7A 4V19X 5IQ6A 2J6SA 2CVIA 3KLEB 4OHZA 1VQYA 2R7QA 3M32B 4FF1A 4NLXA 4NA3A 5KFLA 2JFDA 4B08A 3I56S 1HI8A 2ZBCA 4RW7B 1P9QC 2DNRA 3B78A 3OTEA 4WIIA 4LF7F 1LXNA 4TKTA 4CO2A 4F4KA 1R3NA 3OXGA 5K5MA 2PN6A 2YWEA 4WFYA 1UA0A 1J2VA 2I0XA 3HZEA 5JVHQ 4GC6A 1JKHB 1B64A 2QFJA 3CO9A 1XNQF 4ECXA 2B7CB 4PPZA 3ITHB 4ZLPA 4KO0B 1Q1KA 1TL1B 5THWA 2DPJA 2EFOA 1X7VA 3DRYA 1UVMA 2KVIA 4YEAA 2I8EA 4DV4F 1U6BA 2Q43A 3THVA 3GQCA 3DXSX 1S9EB 2Q1LA 5CYMB 3HKWA 2E1AA 3W2VA 2ZH4A 1R89A 1QVGR 1GTHA 5CH7B 1RTIA 4RZRA 2OD4A 3W2VB 4A46A 1FF2A 4DEZA 3R5AA 1Q8LA 3P3DA 3TNVA 3CE8A 3BGRB 1T3OA 1DJ0A 3B4DA 3CMES 4HT7A 3M8RA 2OPPA 4KTQA 5D3GA 1VRTA 3M2UB 3JTNA 3FMBA 3P6YC 4YB1P 2G4BA 2GJIA 3V6KA 3HI9A 4RX6A 2K2PA 2X51A 3HMJG 4DL4A 1VJWA 3PO4A 2FGOA 2MPUA 4ZOSA 1ZPWX 3OHAA 3KLIB 3UPFA 1SUQA 3KK1B 1JLCB 5B0FA 2E9TA 2W4CA 4B9NA 1FRHA 3RYLA 5H1SV 4E98A 1U4BA 3MM8B 5HQ8A 5T14A 2LVWA 5KG4A 2XB2D 3E51A 2VOPA 4C3LA 1IKXA 3K0JA 2LDIA 4DUYF 5K8MA 1YRUA 2Q6CA 5L9XA 1MW7A 1U24A 3GYXB 4MJKA 4B9MA 1FKOB 4F25A 3NMAA 3PKMA 3EGWB 5I42A 1TP7A 4NLUA 2B4OA 3KK2A 2GV1A 5KT5A 1N33F 3HFKA 4JI1F 2CDQA 2ZH9A 3UCGA 2IVYA 5DQIA 2R7VA 2EBEA 2E1MC 4OX7A 1RTDB 2ADCA 4J9SA 1VQPS 3SDEA 2RQCA 4IG0B 3PIPQ 4X4SA 3H40A 4BC7A 2DO4A 4NLWA 2MQQA 1HBOA 2EBGA 4U7UK 1SV5A 2ZH3A 4CO4A 4DSEA 3MR5A 1UETA 1CEZA 3GFZA 2VD3A 2MSSA 3JB9k 1SIZA 5L38A 3CEDA 4M5DA 3R3TA 5HROB 2FVPA 5F8JA 1N32F 1R8CA 2XSJB 1TKZB 3CCUS 4ED5A 3HDSA 3CXCR 1N5YA 3G4SS 3DLJA 1S1UA 5IT0A 5IM0B 4DSFA 4OI1A 2CVEA 3CDEA 5BYRA 2QYCA 3CCLS 1YJTA 4FVMA 2KO1A 3D1OA 4IH5A 2J6TA 3TI0A 4F4XA 1QAXA 3JSYA 3BN7A 2CJKA 3PACA 4XAKA 3R5CA 2V4JB 4P7TA 4DF4A 4MK7A 4CO5A 2U1AA 4CTAA 2OD6A 2OAUA 2L9DA 2KYZA 4H4MB 1D0EA 2PSZA 3PM9A 1NKCA 3F44A 4Z2XA 2IYGA 2MXYA 3CPWR 2IBKA 1F60B 4QBUA 2GGPA 4DL3A 3KLVA 3DN9A 5CYJA 3UR0A 2R8JA 1ZBTA 4EYIB 5EUHA 4NRTA 4RW4B 4J9QA 5J2QA 2NYIA 1UJ5A 2XG8A 2A3JA 3FJ2A 4FXWA 5DGAA 3LOUA 2FC9A 4F67A 3EXCX 2F40A 1FKPA 1HBNB 3CCRS 1IKYB 5LJ3Y 1JLEA 3OR1B 3CCWA 4FS1A 1J5OB 3G96A 4TYAA 3SQGB 2CQ0A 3IRXA 3IR7B 4K4WA 2CPJA 3NNHA 2DNPA 3TQ1A 1FRJA 2DGUA 1KFDA 4I4BA 1KQFB 5SZTA 4EU0A 4PG5A 2UUWA 4ECRA 2BQ3A 2WBRA 2E5GA 3C46A 2V2KA 2LQBA 3OUYA 4OZ5A 5DQGA 5KFHA 2ZFHA 2R7RA 3RRGA 4CO1A 3IA0A 2IYIA 3UW1A 1FDNA 4URQU 4KGKA 1F9FA 4N47A 2XMJA 5D78A 4YR3A 3G6YA 1CSJA 1HR0F 1AFIA 2DB1A 1VMBA 5B09A 1R0AB 2RQKA 1HWJA 4X4PA 5HP1A 3HM9A 1TVRA 5FIIA 4K4XA 2C3PA 3N6NA 5J2QB 4M95A 2YKMA