1I94F

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i94F00
4DV2F 4LF8F 4DR3F 2B7CB 4JI7F 4LFBF 4AQYF 1CQNA 4JI5F 4DR1F 2UXCF 4DR5F 1IBMF 1FJGF 4DR6F 2UUBF 1N34F 4GKKF 2KJWA 1B64A 1I94F 3R3TA 2VQEF 4KHPF 4B3MF 4LF9F 4DUYF 4JI8F 4DR4F 1HNXF 1QJHA 3ZZPA 2UUAF 4JI6F 1N32F 4OX9F 4NXNF 4DR2F 4GKJF 3OTOF 1F60B 1IJEB 4DV5F 4DV7F 1J5EF 1FKAF 1HR0F 4YHHF 4LF6F 2J5AA 1N36F 4X66F 1IJFB 2RJZA 4JYAF 4DV0F 2ZM6F 1HNZF 5LMNF 2E5LF 1XMQF 1G7CB 2F4VF 4JI1F 4X65F 1IBKF 3T1YF 4DV4F 4LF5F 5BR8F 1RISA 2HHHF 4B3RF 2VQFF 1N33F 4LF4F 2BXJA 2YY3A 4LF7F 1CQMA 4JI2F 2UU9F 1VMBA 2UXDF 1LOUA 4X62F 4YY3F 1XNQF 4JI0F 1HNWF 4JV5F 5LMUF 1XMOF 5AJ3F 1IBLF 4JI4F 4K0KF 3T1HF 4X64F 4LFAF 2UXBF 4DV1F 2B7BB 5IWAF 2BVZA 1XNRF 4NXMF 1GH8A 2KJVA 1G1XA 4DV6F 2UUCF 4B3SF 4JI3F 4DUZF 4DV3F 4LFCF 4B3TF 4DR7F
chains in the Genus database with same CATH superfamily
2F4FA 1NSQA 4DX7A 2VFSA 3Q8RB 5DQIA 3GTYX 4O44B 5E3RA 1KHWA 5CCLA 5GAGU 3MAAA 4Y2IA 4ZITA 4A8SA 2GCFA 2Z8QA 2DKOB 1TV6B 4KPYA 2G0IA 3W2VB 4RBVA 2CJYB 5CAAA 2FLOA 4UOCA 4IG3B 3VZIA 4QYZJ 3FJ2A 4RW8A 4I56A 1L3KA 3BO2A 2LXIA 3DOKA 4YHHF 3H98A 3B78A 3UWTA 1P6TA 3FEZA 3JAMY 1JB0C 4ZPWR 2F4VF 3PW5A 1AXQA 2JDJA 3DXBA 2WOMA 1T9VA 5IT4A 2NXJA 1SIWB 1A9NB 4LF5F 2IFXA 2JC1A 4YB1P 1H3DA 4YR2A 1RKIA 2W2MP 4QWEA 2YBVA 2B6AB 5H9FK 2RIJA 5B08A 4PAAA 1NXIA 2RQCA 2HG4A 3S7RA 4C11B 2HWHA 3HVTB 5KFSA 4Y00A 5KG4A 3BV8A 4DR3F 3BZQA 1VQ5S 3QT7A 4OYXA 1E6YA 2R7TA 4DR6F 2PFFB 3CC2S 2LMIA 2B4OA 2QA4S 2G2YA 1YIJS 1FX4A 2W2OP 3OXLA 1H7WA 3CCJS 2HHSA 2XMVA 2CWKA 1P1LA 3NS5A 4RU9A 2RT3A 1PKUA 4LT6A 3DN9A 4FN5A 2ASYA 2YKNB 3TI0A 2B43A 3A8EA 2E5HA 3U02A 1D8YA 3AOBA 3EDQB 2ZKUA 3DOMA 5IC6B 3V6KA 4JBCA 1BQMA 3RGIA 3AD8C 3UI3A 5L1IA 3A8JA 2XMJA 1S7HA 4M5MA 3IC1A 4KV8A 1YVFA 2K7KA 2MKHA 1LFPA 3KFWX 3UVJB 1KLNA 1DY3A 3PFOA 1WG1A 4LQ3A 2CPZA 1KLMA 5KFOA 2CQ4A 1AA1B 1PGZA 4X65J 4WK1A 2LDIA 2B56A 2ZBIA 2W9CB 2HBYB 1VBXA 1SB6A 2KTQA 1N34F 3S8SA 4PYAA 2MZ1A 3OFEA 5M2PA 4UW2A 3KK2B 3N6LA 3Q86A 5HN0A 2HQFA 1EAYC 1TMMA 4CLFA 1G6BA 4XAKA 2I2YA 5D0HA 4X4TA 3QO9B 3QGIA 3HSZA 2NUUG 3CCES 1NU4A 2LA4A 4QIGA 3TA2A 1CULA 2RHSB 3KLEB 1ULRA 3B8HA 1L5UA 3T1YF 3TUIC 4RL1A 2V69A 3EICA 3HDSA 5IM0B 4DR4J 4FF1A 3QAEA 2E5LJ 4DN9A 1FTRA 2QTWA 2BE9B 2PMWA 2GGPB 3NCRA 4EO8A 5FIIA 4NXMF 2BX6A 2FLPA 2HHXA 1URRA 2P5VA 3LPYA 4NASA 3HT0A 2KVQE 4Q44A 1SJQA 4X4VA 5GAHI 1N5VA 4NRUA 1Q86T 2ZUGA 4LBIA 4ECWA 5BR8J 3AB4B 3SV4A 1NK8A 4RW6B 3R3TA 3EYZA 1FDNA 3NMAA 4USMA 2LEBA 2JEIA 3KOAA 5HSPA 3Q22A 2FVRA 4QW8A 2R2TA 4J9MA 4ED1A 3UNYA 3N4WA 5JUMA 1IBKF 4KAIA 2YWHA 4U67Q 3N0VA 3DLJA 1LQ9A 1RACB 1LKZA 1LXNA 4F3QA 2YNHB 3C16A 5GAGI 3SDEB 3ENQA 5AJ3F 2J6UA 5CZXA 1RADB 2WVDA 1SL2A 4F26A 1JXEA 2OPSA 3Q2SC 4MIWA 2BRLA 3CTRA 2CZ4A 2HSEB 4OX6A 4B3TF 4A8MP 2JL9A 2BANA 4HTJA 1RTJB 1HI8A 1ZTTA 2UXCF 4LR8A 2QL9B 2FHJD 3BO3A 5G4DA 4C6AA 2ZBQA 3R5BA 4L6V3 3W63A 8AT1B 3K8VA 2HRUA 5K5MA 4CLTA 5F3ZA 4IFYA 4P75A 3NLCA 4U9RA 3MAAB 5H9FJ 5EN1A 2XM3A 1HMVB 1QLNA 2WW4A 2BYCA 2HNDA 1Y3KA 2J5AA 1QUVA 4MMOA 2UUAJ 3GJRB 4NEZA 3AHPA 5F3TA 5H1SV 4DFJA 2DGOA 2YX7A 4YFUA 2ZH8A 2ERRA 1FRLA 1KD1T 2PA8D 2K1RA 3US5A 4LMZA 1PC4A 1KRPA 3O5TB 4IR1A 3CMAS 3F44A 1RTIA 3QYYA 2OP5A 1DQ9A 3M2VA 2Z57B 4DFKA 1GXLA 4KFBA 2I1RA 1CS4B 3VGVA 3UR0A 4M94A 4BC7A 3JB9k 4RUAA 1XN9A 4LSZB 4BC9A 4DJBA 5K20B 4CLLA 2ZWPA 2DTJA 1LWXA 2WVBA 2DNMA 2XSFA 3W8PA 1Y9OA 1VC6A 1R8BA 3HM9A 4K5SA 2JEGA 3HULA 3BO4A 3SBMA 3BQ2A 4OV1A 2QZ8A 4FYYB 2NR0A 3R5JB 1HWKA 4ZHRA 2W1BA 3MTJA 1H38A 5BJRA 1KVIA 2B9YA 1GAOA 2QN6B 3V4IB 1FHTA 2R7XA 2VPXB 3I0RA 3BN7A 2HIQA 3TANA 4YR3A 2ZOMA 3Q8SB 2EKNA 1LXJA 2RQMA 4Y6IA 4L76A 1VCTA 2AJQA 3IGNA 3AXMA 1H2UX 4QJVA 1VMBA 2U2FA 4K8RA 5HJXA 6FD1A 1U6BA 3DOMB 2AV5A 1FRKA 3RRKA 1HNWJ 2BQRA 3AOAA 1KQSR 4UF4A 3TX8A 3I5BA 5KG3A 2HHWA 3DYAA 3AA9A 3ET6A 3PYEA 3L4BC 3PJWA 3CCUS 3JQJA 4OFZA 4WJBA 2DJWA 2P2CB 1R43A 2MTLA 1JLEA 2DRBA 5MLCV 2KRRA 3A8IA 4OJGA 1KLMB 2GQ2A 3DRSA 3NBPA 2LEPA 3K59A 2B9WA 2H4YB 2VG6B 2ADCA 2VBZA 3CGIA 4DV5F 2RH3A 2OPRA 5K8MA 3POTA 5C25A 2DNPA 3LALA 1WSVA 2GHPA 5D3GA 2VOPA 2VG5B 2B9XA 4X65F 3EGWB 4ED3A 2U1AA 4DQRA 7FD1A 2RVJA 1ZPWX 4F4WA 3K5LA 2Z2LA 4PXDA 1AZSA 2X7IA 4N77A 4OZ5A 3MCSA 1CULB 2XSJB 4ECTA 1PYSB 3PW7A 4NX9A 2GVZA 4OZNA 2GHVC 1YJWS 4KPCA 4YDXA 1HW9A 3HVWA 3D67A 4ZJOA 4WP9A 1TELA 3KLFB 3RB3A 2BM1A 2O5DA 1ZM9A 4F02A 4WIQA 1HBMA 4U96A 4CNYA 1S9FA 1RP5A 1ACMB 4ED4A 1VRUA 2P9CA 4DR4F 2A2DA 1TL1B 4WFBQ 3JQKA 5C42A 3NRBA 2C2ZB 5DZ6A 3C6UB 2IJRA 4B9VA 4ZVOB 2E66A 2RRNA 1VQOS 1WELA 3MUMP 2V8HA 4LF6F 2VD3A 4DV2J 2KFYA 4IDKA 4D3GA 3MPUB 4QIEA 4OIXA 4ZA1A 4URQU 5KFFA 4YR0A 5ADZA 1MWZA 1LK5A 1TKZA 2AP6A 2P8IA 1TFYA 1NK4A 5BR8F 2HLUA 2KFZA 2XG8A 3TVZA 3W5XA 2NPIA 1RT1B 4TU9A 3MM6A 3G82A 3FKBA 1MLAA 1HBNA 4RBTA 1TL7A 1LWCB 1OSDA 3C16B 2E9TA 3KG4A 4A8FA 1EETB 1HL6A 1OMSA 4M5DB 2L41A 4M5JA 1SJRA 1RCOB 2FJEB 1HLWA 2CQHA 1SI9A 1VR6A 4NLUA 1A7GE 2WBMA 1OPIA 4ATNA 4Z7CA 1IBLJ 3M8WA 2HVHA 2K3IA 2F8HA 4F8RA 1EX8A 3VZHA 3MTKA 2Y8YA 3QLHA 4K59A 2ACYA 4U8VA 3HX9A 1FI4A 2QFJA 3WHIA 2A0FB 1RHKB 5KT2A 3MZIA 4LF1A 2OTLS 4ED0A 4HL9A 2KG0A 3PZPA 2AZ3A 4OLOA 3CXCR 2F7VA 4WFAQ 3UCGA 4USIA 3FGVA 1UVKA 2Q3PA 1I5OB 1MROB 4EWTA 4ZKAA 1U1NA 3TUJC 4UQGA 4LSNB 3UN3A 1S6QA 3J80U 4ES3A 2XS5A 3GG0A 2XHCA 2W24A 2CQ3A 4KFBB 1PBAA 5EWFA 1NBEB 2GC8A 3CCZA 4N56A 3I5AA 4GVBB 3OV7A 5DDPC 4DFPA 1N88A 5KFHA 3C2PA 4DG1B 1FD2A 2XGPA 1YJVA 1P8GA 1F0XA 1RWMB 1AB8A 2XLIA 4KHMA 3G6VA 3OXGA 2VDHA 3R2DJ 2CJKA 5EX0A 4IRDA 4DU7A 5KFBA 2K3KA 5L39A 5M2RA 3G71S 1WI6A 3M2RA 1B7YB 1QY7A 5ETVA 1RU2A 1IQTA 3HZGA 1SJ4P 4WBFA 2OGUA 1PO6A 3BH6B 1RU1A 3RUBL 4ZHRB 1S4EA 4L3KA 1HKAA 4BWJA 1B4SA 2JC0A 3BGFA 1RWPB 4X62F 5EHHA 1EP4A 6AT1B 3I0RB 3VVUA 2V5HG 1RT7A 3OUYB 3GCWP 2FVCA 3IWLA 3KG1A 5I42A 5F8NA 3FDSA 1Q0NA 1VC5A 5HL7Q 3LGMA 4ED2A 3I55S 1T7PA 2BR0A 2F40A 2ZE2B 3R9LA 1KHVA 3RU0A 3ILOA 2HHQA 3RAMA 3BR8A 2FDNA 1N33J 2YNGB 4JI2J 3NAIA 1HWJA 2FD2A 2QMUB 3MR2A 3PY8A 2FZCB 5KFVA 5DG9A 2DGSA 1XWLA 3FBCA 2MQQA 4B3OB 2D1CA 5K14A 1WI8A 2JFKA 1Y00A 1FE0A 1IVZA 4XIUA 2RDJA 4OHVA 3DRSB 1U4BA 2BRKA 2J8SA 3VGUA 3J7ZT 2IAJB 5FJ4A 3HT3A 2OPRB 1U6FA 3POTB 3NG8A 4I64A 4MFBA 4M5GA 4MK9A 2I0XA 2DIUA 3CJKB 2KXNB 4OYWA 5E2QA 2MZSA 2B7BB 5D4LA 3TZWA 3UDLA 3H5UA 4RNOA 1UVNA 3M1VA 1Z2ZA 3EX7B 4ILLA 5GVQA 4JI1J 3UD5A 1Q8KA 2GVZB 4EYIB 2IC3A 2IVYA 2XWYA 3V4MA 1SPBP 5CCMA 1YSJA 4FF4A 4CLZA 2QRRA 3QAUA 1FESA 4QBUA 2Q43A 2OD4A 1M0SA 2FC9A 3PR5B 5CA5A 3LGHA 1JJHA 4RW9A 5DS7A 2J7WA 3QRQA 5D0GA 3NKYA 1NHVA 5C42B 2UVUA 1NK9A 2XLJA 2KM8B 4IO1A 4F4KA 3DU5A 2CG4A 1FD8A 4O4GA 1I94J 3V81A 3J7YU 2XI2A 4CQ1A 2K2PA 2B4PA 4V1Ak 3A4TA 4Q2LA 3UNGC 3N01A 1M1GA 4J9NA 3IBFB 3FRZA 1KWMA 3MR7A 4FNHA 2KI2A 4DPYA 4DV4J 2E9RX 2F65A 2BVZA 3KUHA 4KE5A 4OHXA 3GV5B 4NLGA 2RS8A 4GC6A 3D0GE 1VQ6S 4IH6A 2LQBA 1KEKA 4LIWA 2OO4A 3G82B 5IZHA 2B5JB 1C0UA 1XR6A 3L09A 1RAFB 4DV2F 3BSAA 1RHRB 3GIRA 4P2FA 3SZ2A 1VGYA 4KHRA 1YBUA 4FF3A 2OUGA 5B09A 2VFVA 4AQYJ 1VS3A 2WVCA 4DR5J 1I51B 1F2GA 2YKAA 2JRSA 3C8YA 1N5TA 3RB6A 2XMUA 4EU0A 4LFCJ 4B9NA 4DS4A 2OIHA 2DXEA 3KNAA 1MN9A 3TNVA 3T9NA 2J7KA 4OX9J 1PC5A 5EWEA 1C0TA 5F8IA 2NXCA 4X4QA 1KTVA 1FRJA 2M88A 4MH8A 2N4DA 2MHEA 3AODA 3U1NA 2FGOA 4RU2A 1U7LA 1IBLF 1RBAA 1GNKA 1CBKA 4LFAF 3MM7A 1PJ6A 2BQ3A 1TKXA 2V34A 2PN6A 4GC7A 4CRJA 2W4CA 3TOQA 3OL9A 4ELTA 4DHVA 1RLDA 1C4CA 3QSIA 2IBOA 4C8KA 3HHLA 4MJKA 1TR0A 2VQFJ 1S6QB 4BCAA 2HHTA 1FRHA 3UN2A 4KTQA 5F8GA 1JLGB 3E3XA 4CO4A 1QJHA 2C28A 2M8DB 5ETOA 3MD1A 4WTOB 3K58A 3UDEA 1NRKA 4O3PA 2HZAA 4O3NA 1OYEA 1KS2A 4C7QA 3M9MB 1RYSA 1NEEA 5HLFB 3OXFA 3HHDA 3OFHA 3M2RB 4BDPA 2OEJA 3HPOA 5LT5A 1JLCA 4KR0B 1HBUB 2AEJA 1CQMA 1XJWB 3S6EA 2N82B 3B4MA 2JEFA 3LP0B 3GQCA 1ZA1B 3SCKE 4DSEA 1D9FA 3HHKA 4ED5A 2VG7A 4A8XA 2X3GA 3TVYA 3MCOA 4BWMA 1YG0A 1EP4B 1WKLA 4ICLB 2GVDB 4DR7F 5B0CA 1RT3A 2IMOA 4XDDA 5I42B 3TWZA 3W9IA 1CJVA 2CPIA 4CLYA 3N5FA 4NZ6A 4DQQA 4ER8A 4QIWD 1ZS6A 4WU2A 1RWXB 4OZ1A 3HK2A 3JYTA 4PEOA 4KGMA 2GMHA 3I87A 1FKPA 1PAUB 4K4SA 2ZH5A 2V4RA 4FYDA 3SIPB 3OT9A 5I3UA 4DPOA 1U8WA 4OYIA 1JXLA 4WFYA 2NYHA 4OZ0A 2HS0A 4D3HA 2J7UA 3MPYA 1WDDA 4LUBA 3DGPB 3HHNB 1OIAA 3BN4A 3QPIA 1RAJA 2W2NP 4KY3A 3R7SB 1T02A 3FVYA 3MEDA 1N33F 1H6KX 4WE1B 1QDUB 1GT8A 4JI2F 1LW2B 3A13A 4MIAA 2BUNA 3TP2A 3PVXA 2HMIA 3TZZA 1RHUB 1YITS 4MFBB 2DPIA 4DV6F 4CDIA 3FRYA 4USHA 1FJ7A 3U7JA 4OLPA 4JV5J 1RWVB 3QZ8A 2EKYA 3GG1A 1FWLA 3BQ1A 3VAJA 3MFHA 2HWIA 3OTEA 3UW1A 4EUVA 3BGRA 3TAQA 3ZTOA 3M1VB 5GAEI 1UTAA 3GIJA 5H9EK 2XBPA 2XMAA 3J7YI 4K0KJ 1YRUA 5C24B 5DJBA 2UXBJ 2R7SA 5BYSA 2DO0A 1VQKS 3IM9A 1R0AA 1N5SA 3AOCA 4NE9C 2UV8G 2OFHX 3D0IE 2FVQA 3C3LA 2N7YA 4HYKA 1T05A 1JXVA 3AJDA 4JI1F 2XYPB 2IA0A 1U02A 1GXTA 3QATA 4DX6A 2DR8A 2DHSA 2KL8A 4F25A 4O4GB 3BYRA 3V81B 1UWBA 2LXFA 2UV8A 4XDCA 1WC5A 5KT7A 5HMWA 5F8LA 4RNNA 2HFUA 5J2NB 4WP8A 4ED7A 1QD1A 3SI8A 2NQPA 3LTOA 2MPUA 2IDEA 1JLBA 5GMDA 1I94F 3UO0A 2ROPA 1FA0A 4O3SA 1HARA 1PYOB 1VFJA 5D77A 3ILIA 1ZTWA 1PBUA 1LW0A 3KLIB 2MY7A 4OYPA 3OSPA 1BMQB 3R5AA 5DG8A 4LF9J 3JTPA 2DY9A 4NLPA 4M8LA 3KHGA 1T03A 1ZBTA 1RAAB 2DVIA 2HWTA 3MFIA 5A2QU 1IWAA 4G1IA 4U95A 1D9AA 3THPA 4WPAA 4FPIA 3LH2S 1HNZJ 1X9SA 4PUOA 1RYRA 1WHYA 3RBEA 5F0UA 3OSNA 1PG5B 1RA7A 3QJLA 4RUHA 1DBDA 2QJ3A 2JLGA 1KSPA 4M5LA 1S48A 3GFZA 4DV1F 1EHWA 1GH8A 2ZBCA 3Q8YA 4FKXA 2IYIA 4LFCF 2F3JA 1FO1A 3OFFA 2DITA 2PFDA 5T7LA 3ISZA 2LQ8A 4ZVGA 4XPCA 2AYMA 2KXFA 4C4WA 1XNRJ 4J9LA 2CPXA 1RE1B 1H98A 5KOWA 1KONA 3J81Y 2AW0A 2XB2D 2G1DA 3GJQB 1WWHA 2ROGA 3BPSP 2VZ9A 4OJ3A 3Q8QB 5DM6Q 3TARA 3H59A 4B9SA 3V2UC 8RUCA 2QE5A 1G4CA 3HHLC 4PG4A 3IN5A 4HHJA 3UCUP 2ZNYA 3MMAA 2NCKL 3K89A 2XQCA 2C3UA 4U7CA 2NXUA 2MGZB 4RUBA 2F1FA 2Y1LB 3GMGA 4OI2A 5FDLB 2E7WA 3FUYA 2KYZA 2VQFF 4OI4A 1X4EA 2KU7A 3LP2A 3TA1A 4HHHA 2AYEA 4K5RA 4H4OB 4RLEA 2P9GA 2JOQA 3KUEA 1FXDA 3DXSX 1QM9A 3LAMA 2M2BA 4YDDB 3HKZD 4W90B 2W2PP 4ZJQA 4B08A 4ETXA 4WFNQ 3PRVA 4IKAA 2VG7B 2JHEA 5E3PA 1WF1A 1J27A 4HVZA 1KFDA 1RT3B 2IM3A 1KP6A 3R6LB 4IFVA 3H5SA 3FSIA 2BJ7A 3PIOQ 5G0RA 2PMHA 2DB1A 1NKEA 2X1FA 2EW9A 1FKAF 4USVA 2AT1B 3ELHA 4LR7A 3JYTB 1FKPB 3OTOJ 2EBGA 4YB5A 1K0VA 4ZPVR 1FK9A 1DQAA 3AA8A 1NLKL 3BBFA 2V2ZA 1C1BA 1QAXA 2ZDPA 5H9EJ 4AE5A 3CE8A 1ELOA 3OR1A 2KZZA 3VALA 3CJ5A 2V2QA 4PG7A 3G96A 4PWDA 1FWKA 2D3OR 2HMIB 2G0CA 1GMUA 4ERDA 5CXTA 2BACA 4P2SA 3PW0A 3VAIA 1MMDA 1NPPA 4R5PA 1Q5YA 4JI8F 1YI2S 4DL2A 1RWKB 3BGRB 3JTNA 2W01A 4L3NA 4B17A 2RE1A 2FHJA 2MJUA 2MKKA 3MMCA 5AXNA 3PYDA 1TUWA 4ECQA 3IG1A 2V2VA 1X8DA 4XK8C 3FCHA 1BUXA 2JLEA 1WDTA 5KTQA 1D8ZA 3HD1A 3DGVA 3GYNA 5ETQA 3I9ZA 3ONQA 1OY9A 1PCAA 1JKHB 2MQMA 2IMWP 1REVA 2WK4A 4F2SA 4K0KF 2UXBF 2UVRA 4ZPTR 2ABYA 4G1QA 1Q7LB 1N0VC 4URGA 3IR5B 2DBBA 3ZC4A 3D1OA 1QE1B 4WYWA 2G4BA 1UWBB 5J1PA 1U1PA 1NJYA 3LAKA 1V3ZA 1HA1A 1TK0A 5CYJA 3RBZA 4ECVA 1HNVA 2YKOA 3G6ES 2FZGB 4DI6A 4PWWA 2CQCA 3MEKA 3T6BA 4NZ0A 3EPIA 3G87A 4DX8H 5T14A 4KIAA 1C1CA 3U1MA 2RF2B 3DM2B 1N48A 4B9UA 1N6QA 3M2UB 3SV3A 3DOLB 2QEXS 1WC4A 1FWPA 3HFKA 3G8SA 1LW0B 3EGVA 2E1CA 4QZVB 4X4RA 4HDGA 5DDRC 4KKOA 2QO3A 1Q81T 3DLKA 1TK8A 5KFNA 2HK2A 3DI6A 1F5AA 2V6AA 1HQEA 1TMJA 2GX8A 4FNIA 2CDRB 1RBLA 4C0OC 2DNOA 3QIPB 1PSDA 1TK5A 1Y5NB 2B8PA 3BGUA 4AT1B 4B3RJ 1VOMA 3UD4P 3IFEA 1HR0J 4E2FB 1NZ8A 4HEA9 5M2UA 1UJ5A 1PJ7A 3KK1B 2OPQB 3M8SA 3CSKA 3RBXA 1S1TA 2O67A 2E44A 2EEYA 2XS7A 4HACA 3G8QA 1MN7A 2N4CA 3KHLA 4ZVHA 3M30B 3FFIA 4J91A 1X4GA 5BYQA 2PI5A 3R8YA 2LYVA 2ZVIA 2Q6CA 4TVAB 2HNZB 5L8RC 1MG7A 4AL5A 3VV2B 2PEBA 4JYAF 2QL7B 2A3JA 4AL6A 1NDPA 4ZIVA 4CWBA 4ZP8A 3RJMB 2WAQD 4G65A 4WCEQ 1U49A 3NWRA 2M70A 3DC2A 1RWNB 4K4YA 4C98A 3K17A 1IKWB 4S0MA 4CH0S 3VAHA 1TKTB 2R7RA 3CIMA 4RNFA 3IS9B 1FRXA 4GKJJ 5HP1A 1FXRA 1F1BB 2YNIA 3ISND 3VCDA 1S1VA 1HI0P 3LP2B 1SUQA 5ETKA 4ECUA 3CCMS 4O23A 2PSZA 4IUFA 4RWXA 4NYOA 2CXEA 2CNNB 2L08A 3ZFVA 2AJ1A 3SQGA 2BA9A 3I6PA 1XQIA 1Q53A 4NCAA 5A8WB 1KN6A 2ZHBA 1SKWA 1DTTB 9ATCB 3L7OA 2AHOB 2AD9A 2DRAA 1UVIA 2QLJB 2JNJA 4O3QA 3J7Z5 2EK6A 3LGNA 4IFVB 3R5CA 2YXLA 4DQIA 5G0RB 1XMQF 1IM4A 2XNRA 3K57A 4MIBA 2CVIA 1S9EB 1NK6A 4YHHJ 1UVJA 3IBCB 5E33A 5KFTA 3NNAA 2MLZA 2AJ2A 2B3TB 2HVDA 2CDQA 4ZVFA 5LJ3Y 3TJ8A 3M8QB 2E5GA 4FXDA 1N5QA 2HGLA 3BR9A 4LF5J 1OQ6A 4DV7J 4P2XA 3HSGA 3JS9A 3S1TA 4PXCA 1HD0A 3MM8A 1TL3A 4M63A 3OW2R 9RUBA 5KFGA 4NZ7A 1GXUA 3BH7B 2DRDA 4I2PA 1LNQA 1HQ2A 1WOPA 1R89A 2X3DA 1RTHB 1FNOA 3EVOA 3LPEA 5HAOA 4DR6J 1M5VC 4EK2A 4J9SA 4YP3A 3MMJA 4ZP6A 1LWEA 1Y0HA 2VA2A 4RX6A 2AF6A 5K8OA 4Q0BA 4LF8J 2DEIA 3BB5A 3MOJB 5LMNF 1NPRA 4CM0A 5KT6A 2UVVA 1JLQA 3AY0A 4FBTA 2CQ0A 4C8ZA 4ANDA 1IBCB 1FRMA 5AXKA 3IG1B 4PCQA 2ZHAA 4QWCA 5BXIA 3DLEA 4V19J 2CJAA 2KH9A 5CHCB 1V3SA 2EPIA 3T1HF 4ZMMA 1Q8LA 1JX4A 5B7WA 4K50A 4NLWA 4QCLA 3BDPA 1NJIT 4QPXA 4DPXA 3IRXB 1DURA 4M95A 4HLBA 4LFBF 2V67A 4EBEA 1A0OB 1IKXA 4G1QB 2UUBF 2HFOA 5J2PB 1NJXA 2QIFA 3OTBA 2JLFA 2H54B 4KH1B 4LR9A 5GMKa 4P73A 2HQCA 3CJ4A 1N34J 4LRFA 1IUJA 2P6TA 2RRBA 2F9JA 3CULA 1RT2A 2RDIA 3MUTP 4GMKA 4CLWA 2HRYA 3PDNA 4ZJLA 4NCBA 2OAUA 1M5HA 3D5MA 3PM9A 3EM1A 4H4MB 1N8RT 4Y2CA 4QWBA 3ICLA 5HROA 4Z2XA 4UT4A 3CB4A 3JSYA 4F0KA 2VL1A 3D68A 1VQ9S 3DLKB 3DI6B 2ZZMA 3BM7A 4FS2A 3RTVA 1HQEB 2V4JB 4DOZA 3QFHA 3BGLA 4NCGB 3FC9A 2YVSA 3L9ZA 1T94A 1RABB 2OSRA 1IBMF 2MB0B 3GR1A 2EI5A 5J1EA 3DKDA 3CWJA 2MKCA 2ROEA 1X0PA 3MCNA 3FK4A 2VKRA 1S1TB 4UOGA 1M5KC 3V6DB 1M1KT 3EPGA 4J9RA 1LK7A 1EZZB 3VTIA 4KSEB 2V8DA 2MYFA 5KFRA 1HR0F 1NPKA 4PYDA 5ETPA 2R2UA 1FFSB 3NGTA 1D3WA 4R8UB 3GYXB 1S5ZA 3D4JA 2YKMB 4LF4F 4B9MA 2MKJA 4UTGA 3PW4A 2I8EA 1ZAXA 1CJTA 3EUNA 4A46A 4NI2B 3PNIA 5L1JA 3E2EA 3I0SA 4NLVA 3M9OB 3TRGA 3M8PB 5L46A 1FKOA 1S0MA 3FSXA 1RBOB 2LQ9A 3O3LA 2N3LA 2EXUA 1JWWA 2CPEA 3B54A 1BQNB 2XO7A 1YZ6A 2ZH7A 2LP4A 5D78A 1EARA 2YNIB 3ZZOA 1FDBA 1S1VB 4LF7J 1NSKL 2VC0A 5E3QA 3RAQA 5LMUJ 3D0HE 1RTDB 2UXCJ 4FVMA 2ZD1B 4BBYA 2RUGA 1X5TA 2AX1A 2W9BA 4GKJF 4TYAA 4HH0A 3MR6A 3SQGB 2HAFA 8ATCB 2CQ1A 3L95X 2DGVA 4CLPA 5KFAA 3DHXA 4ZVSB 2AJ0A 1WHVA 4HDHA 2LA6A 4CTAA 2W9AA 1RT5B 2BXJA 2C2RA 2EFNA 4UZBA 2MQNA 1F2HA 1CJUA 5KAKA 2XEXA 3FZBA 5HQMA 4USTA 4F04B 3DCAA 5KG6A 1DLOB 2RQ4A 4JI3F 2KXHA 4Y3CA 4CZCA 4JOUA 1DTQB 2XZTB 2HLTA 4E8UA 1SV5B 2KT3A 2EFOA 5B0BA 3HP6A 2HBRB 3MM8B 4KJIA 1TL3B 5HQ8A 4I2PB 2CQ2A 1S9GB 5CYQA 2M5YA 2EC2A 3ADAC 4RW7B 4DV7F 2XO6A 3G4SS 4QR2A 5HATA 2OPPB 5A8RB 1UW4A 2HVEA 1R0BG 2VASA 4GO5X 5IV4A 2WW8A 1F5BA 3E01A 5GADU 3BKFA 3R7BB 1RSCA 1FJCA 3ENWA 2DH8A 4Q0BB 1RISA 2N3OA 1VIXA 2MEWA 1T11A 4OI3A 1F9EB 3HJFA 2DISA 2QLXA 1BGXT 3A12A 3OR2A 1JLQB 1G2EA 1S57A 4P2MA 4ELVA 3FNNA 5I3QA 3TR5A 2H3EB 5D8HB 3DLEB 2BABA 5KFYA 4LF8F 3OL8A 4NA1A 4C8MA 4CO3A 4C3KA 2CQPA 3TO8A 2AJFE 3DLGB 1JMTA 1PILA 4WWSA 4LRCA 4C8YA 2EG2A 1UKUA 4DEZA 3JSBA 3CMES 4KGKA 1N52B 2IIHA 4I7FB 1N4LA 3T9ZA 1S1WA 5IT9Y 1IKYB 2B8QA 1CLFA 2E29A 2MKSA 3JSMA 1J5EF 4K2XA 5LXYA 2XZDB 1K73T 1T9TA 1N5YB 1XR7A 4DSLA 5KFEA 4KGVB 4A47A 3CEDA 3HKWA 4DV5J 2ZH4A 4ID5B 3FEYB 5AT1B 4WYLA 1FT8A 2EFGA 4UQTA 2MSTA 1LOUA 1KQFB 4CT8A 2JH3A 2DGWA 2G2OA 2H5JB 4W98A 2GMLA 2QV6A 5HROB 1QAIA 2HEKA 2PD1A 4P52A 4B3SF 1VQ8S 1KVKA 2QC3A 3GIKA 4NYZA 3SYZA 2F9DA 2VICA 1WUUA 1VLOA 3QSYB 3N28A 2FHKA 1Z2LA 1UPPA 1ZETA 4NMXA 1UJ6A 4A8KA 4Q45A 4Q7AA 3CJ8A 4DL0C 2YNFB 2D9OA 5D0RA 4HT7A 5HI7A 1FNXH 2GMJA 2ZNZA 3RBDA 5J1EB 1S1XA 1HNIA 4KB7A 1UP1A 1WG4A 2BMBA 1NKCA 3V5RA 1RT4A 3WC0A 2OHDA 4MKVA 4N47A 2KKHA 3KK3A 1EIYB 3C15A 4FYXB 2CJQA 3ILLA 3C14B 1YK9A 4LF6J 1V3RA 1D1UA 4DUYJ 2CQDA 3D7SB 3W65A 1GMWD 1JIHA 2VPWB 1GTEA 2D3UA 3M7VA 5CYMB 2W2QP 4JI4F 1MMNA 2QT7A 3QQCD 4O3OA 2OH2A 3MECB 1RT6A 4WU3A 1WOSA 4LIRA 2XCPA 4Y65A 1B99A 1T0TV 3N79A 2DCLA 2NSCA 4KGXB 1NUEA 1J5OB 4ZLJA 1RAIB 2FJDB 4UUWA 3ZXWA 4YY3J 2QLWA 3WBZA 5KFLA 3W5ZA 2G0JA 2DGQA 3BDEA 4NXNF 3TAMA 4PXBA 1X9MA 2CWXA 2DNHA 2LU2A 3KHHA 3QBCA 3T3FA 3AXKA 1BQXA 3FBEA 4QU6A 2DT9A 4OI6A 2W9BB 2Y0BB 2DO4A 4KGZB 4RJVA 2YQ3A 4DL5A 4M5KA 4K4XA 3FCWA 1HBOB 4LF7F 2H1YA 2YWEA 4DR2J 5LMUF 2HNYA 1WD6A 4QIFA 4I6YA 1S0OA 3SQOP 1TL5A 3GSIA 2BE2A 1ITPA 3CD7A 3IXQA 1MSWD 1X4FA 3ZZTA 4ZVEA 5DQHA 2XY5A 1MU2A 4TY8A 1GQEA 4W4MA 2VFTA 4NLSA 4JUZA 3F0NA 3TEGA 1UFKA 3T5LA 1XMOJ 1D9DA 2XNQA 3G6XA 1S49A 4K4WA 4OYAA 2L9DA 4RW8B 3C6TA 3P4UB 4TU7A 3DOKB 4EYHB 2RAQA 1K47A 4YB6A 2HBZB 3SFGA 4IG0A 2QA2A 4AXJA 1X60A 4QW9A 3KYLA 3DMJA 3CPWR 1EQ0A 4K7QA 3P6YC 4X4SA 2WOMB 4EEYA 4LVNP 2VQEJ 1SQFA 1YJRA 5HVHA 4OV6A 5AXMA 5I3PA 3E01B 5J2QA 2J6SA 2ZDOA 1X5PA 3LQVA 2VIHA 3N9UC 2C2NA 3AH6A 4X62J 1YRTA 3SMZA 1U1LA 1EKRA 3UE2A 4DSIA 3CCVS 1WHWA 1XMBA 3FCVA 4URSA 5HMXA 1E6YB 1S6PA 1N56A 1Y4ZB 4NA3A 2RD5C 1AT1B 2ASJA 3KLGA 3MXHP 3H90A 4MT1A 2FVPA 2MQ8A 2HURA 5D15A 4KC5A 3GIMA 2EG1A 3RR7A 3W2WA 2VF3A 2ZJRQ 2CNLB 4ES1A 3KMQA 1TTHB 2R8IA 1WJ9A 5KFQA 2CADA 4OZJA 2CA9A 4PPZA 4K4UA 1DJ0A 3PRDA 4IYQA 2Z2MA 4GRSA 1QSSA 4QQBA 2NSBA 4E0DA 1BQMB 3PIPQ 1DRZA 3CD5A 5L9NA 3D1QA 3FMBA 4ENOA 4ZLPA 1N32J 4KV8B 4DXLA 2BKOA 3BQ0A 1X7VA 1WEYA 2C2EA 1TU0B 5C5JA 2DYAA 4DF8A 5HO4A 1ROFA 1ZM3A 2WB1D 3GCXP 4I6AA 1FTCA 3GR0A 3W60A 4DQSA 1B64A 4GKKF 2KJWA 2JVRA 1NM2A 3TEHB 1AUSL 3THTA 1NZAA 4KYZA 3W2VA 1I3OB 1TUGB 3PR4A 2AEMA 3RB0A 4IG3A 2N7CA 3L7PA 1SKRA 5DM7Q 2A6MA 4F0MA 1OY6A 1RZMA 3GE9A 5DLFA 1SKSA 3GFYA 4CO0A 3GYGA 2GA7A 3NXZA 1S1XB 1HNIB 2OMOA 5IC4B 3DDKA 3T5HA 3NWGA 3FQKA 2HQGA 4KHPJ 1RT4B 2ZJQQ 3SXLA 3G9CA 3C15B 2UU9F 4IQXA 5E41A 1MWQA 2OTJS 3CVKA 4DZ6A 2M0GB 2CNKB 2B6AA 4NEYA 5AE1A 3TVKA 1QSYA 4RPFA 2FC8A 2UUCF 1VQMS 2R7WA 4LRDA 2B9EA 2CPFA 1N54B 1S1UA 4EFAC 2AYBA 3HVTA 2GW8A 2QGFB 2ZBRA 2UUTA 2BOAA 2GV1A 3R1HA 2VFUA 3RYLA 1FXLA 4DUYF 1Q78A 4R0EA 4WFZA 4IR9A 3BJYA 1OS5A 1RA6A 1WEXA 4TLRA 7AT1B 3DLBA 5EDWA 4LRAA 4DDFA 2R2SA 2GJ2A 2IA6A 4PZVA 4FYWB 4ALZA 3BF4A 2QA1A 5LL6d 1UZHA 3KLVA 2GAHC 2YKNA 2MQOA 3P5TL 4RW4A 2NZCA 3BEGB 2AJ4A 4F7VA 2Z58B 3NGUA 4C0HA 3MI7X 2ALZA 4MYUA 4YY3F 2D41A 3HLUA 1FFGB 2RQKA 1QSLA 4DCOB 1OPZA 1V6HA 2OPSB 3OJUA 2R2RA 2K06A 3RZAA 5D4OA 1RXOB 3UVJA 1YX2A 3KG0A 2BANB 5MAOA 4DQPA 4TU8A 4LFAJ 2XI3A 3QRRA 3QWUA 4OX8A 3RB4A 3LA0A 3PACA 2W9CA 5CABA 2HRTA 1BE4A 2RDDA 2GAGC 2BE2B 3AD9C 3DFEA 4IFYB 1VYAA 2C2KB 4FBUA 5K8PA 1I6JA 1F3VA 4DR2F 3KK2A 4CLKA 2DHHA 2PE8A 4WF9Q 2HNDB 2IJFA 3AD7C 3VGTA 3QO9A 4J90A 2HGNA 2K1RB 1DFDA 4NL5A 3JTOA 3KLEA 2CRLA 3PW2A 1VBKA 1RTIB 4CM2A 1YJUA 4IG0B 3D3BJ 1CJKA 3JSRA 3M2VB 2DNLA 4IOCQ 5IM0A 1MWYA 3DMJB 4DPUA 3EJMA 1XMOF 2V9KA 1KR4A 3AQOA 1S59A 2GGPA 1GX6A 4O0NA 3B6BA 4PG5A 4MKYA 4ZS6A 2DD8S 5HBMA 3VHQA 2JFDA 5B0FA 4JI7F 1FJGF 4PQUA 3L3CA 2EWHA 1KNZA 2Z56B 5KG5A 5CD4A 1KKHA 5FLXU 2VQEF 4DR7J 4QWDA 1AW0A 4RW6A 2XMMA 3ZTRA 1U2RA 2ACMA 1Q16B 1RB0A 2RKIA 1Q7YT 5AXLA 4USJC 4L75A 1UL3A 1F60B 3RRHA 3JQMA 1KC8T 4YB7A 2ZM6F 1JNRB 2YPYA 2FJXA 3MPVA 4IO9Q 2C2DA 2VV5A 2BJ9A 1U1QA 2BW7A 5KT4A 2BV3A 1NMEB 4FKYA 1K1SA 3NGDA 4B9LA 3J80Y 3JAMU 1TZ0A 1E6VA 2YNHA 3P3DA 2E7VA 3SDEA 2VBXA 5KFMA 1X9WA 1AYEA 3DYAB 1W25A 4AD6A 2R7VA 4NLRA 1M5OC 3ET6B 1TP7A 1H74A 1VQLS 3HHEA 3J7A1 4DV6J 1JLEB 4G6VB 4I4BA 4W92B 3NBPB 1Q5VA 3LANA 5IQQA 2M3DA 1N32F 2E9ZA 2CJ9A 4DUZJ 5C25B 2BJ8A 3GILA 3UCZP 4I0WA 2Y3YA 2R8HA 1HMVA 5D3GB 5E3AA 4FXVA 1BC6A 3K5MA 2RUSA 1G7CB 3CD6S 4TN2A 3ETMA 3U27A 5IOLA 2VDIA 3FBFA 1VQNS 1M90T 3PXGa 2ZUAA 2NS1B 1AZSB 1X4BA 1NJWA 4RWWA 3QJJA 4TYBA 1JQGA 4RZRA 3BGOP 4Q2MA 5IT9U 4ZCMA 2VHGA 1ZAVA 1RCXB 4HI1A 4L73A 4WFXA 2LLZA 4ZPBA 4EZ6A 4PKDB 4OMFG 3BS9A 3NOGA 4MK8A 1CS4A 1G1XA 3VR1A 4Q8EA 2BEFA 3MPDA 4X4NA 4NWBA 3H42A 4YQWA 3WQPA 1GK8A 1HBMB 5HVFA 4BS2A 1VQ4S 4LBPA 5THWA 4C3MA 1UVLA 1VRUB 1WHXA 2XY7A 1ZPVA 4PXEA 4KHPF 2D74B 5DG7A 1S1UB 1VLYA 2MZQA 2UZAA 1VISA 5IV3A 2MKYA 3M9NB 1WTFA 3ZZUA 4CLSA 2R3VA 3ENVA 2HBQB 5JJBA 1U1MA 2XULA 2XS2A 4IDKB 3X1LB 3BKTA 4IOAQ 2D69A 4N8OA 3K5PA 2GNKA 1TKZB 2DNQA 3V4IA 2M8HA 5DETA 3T5KA 2OSQA 3OL6A 4A8OA 3NOCA 2LU1A 1NO8A 2XYHB 1UAWA 3MM6B 4TKTA 1L3TA 1X5OA 1KQKA 1Q79A 3OVBA 4EGLA 2R42A 4ID8A 2WZ1A 1OJ4A 1ZA2B 4RW4B 5L38A 1HBNB 3GSDA 1TL7B 2XMWA 1YBAA 3BBCA 3MUVP 4XTTA 4Z7YA 4UY8T 4DV1J 1IQZA 4JI5F 4FPRA 4DR1F 1FEEA 3KXDA 2CJBA 2R8JA 2OJ3A 2J0XA 2EFPA 5HJYA 2BKNA 2CQIA 5DRKA 1PIEA 3T41A 4PR6A 2ZITA 2YWKA 3QGGA 1F5CA 1FRIA 3QLHB 4NOHA 2VG6A 1LEOA 1SJ1A 1F3FA 2O3DA 2FTRA 2RJZA 2EFQA 4DL6A 1YDLA 4USUA 4A4JA 3OBIA 2VODA 3EGZA 1R8PA 2GQCA 4U8YA 2B4VA 2VG5A 4X2BA 3ZZ0A 1ZOTA 4N8NA 2MQLA 1NCLA 5A8KA 1DQ8A 2BW2A 4C48A 1HD1A 1XNQF 3PJXA 4JI0F 3C46A 1CPZA 2XSJA 5KFXA 2QLBB 2AZ1A 1UETA 1CJKB 3KJFB 2JVOA 4DL4A 2L48A 3GJSB 4ZLLA 3P49B 1R7IA 3KLFA 2HHHJ 2NUHA 1WF2A 3D6TB 1M5PC 3AQPA 3H2UB 5HBMB 2XHWA 3CJRA 1IR1A 4ZPDA 1VJQA 3ZZPA 1HHTP 1SL0A 1TL1A 4PQUB 1RHQB 3LOUA 4DWIA 2RB7A 3HO1A 3C6UA 2YQ0A 4ITSA 3WIUA 4DV3J 3H40A 2K7JA 3PV8A 4A8WA 2RKIB 4DSJA 1K1QA 2QG9B 2ZWOA 3Q0AA 1YHQS 3LW5C 3CC7S 1U09A 5ETSA 2XGQA 2PMZD 2GFFA 4K4TA 1TAQA 2C3MA 4QPTA 4YN3B 3RAXA 1RT7B 1RT1A 1SVDA 3AB2B 2AKWB 1O0PA 4YOEA 2DNGA 1W7WA 5IQ6A 2HFNA 1FVSA 1PAEX 1LWCA 1E6VB 3T5JA 2CZ9A 4EBDA 2F8MA 1FJEB 1EETA 1S77D 4M5DA 3OPKA 1Y3JA 1K0TA 2DNYA 3MURP 4J9OA 2FJAB 1WORA 1Y7PA 2ASLA 3I82A 1Z4UA 1WOOA 3OFGA 3Q8VA 3G6YA 2CQGA 5K14B 4OI1A 3Q8UA 4ZP9A 3P96A 1QUPA 1ZZNA 3CDBA 2FZKB 4I2QA 3ISNC 2DIVA 3R97A 4JI8J 3QFWA 4NLDA 3GLJA 1L3VA 3DRPA 4O0IA 2PGCA 3CMQA 3GPAA 3E8OA 4C3LA 4KT0C 2C2MB 1U26A 3LWMA 1WC3A 1VRTA 4YS2A 3PFEA 2KDOA 1U1KA 3SFUA 3PX0A 4XO0A 1FF2A 2MMYA 3FEXB 2C1EB 3LWLA 2Z4PA 1R6YA 1SBRA 4G3IA 1VQSA 4DSFA 2CG8A 4X84A 1MROA 2VPYB 2QFIA 2HW3A 1UW9A 4DUZF 4EI2A 1SQEA 4LSNA 2IC3B 3F41A 1U1OA 4IH7A 2KHDA 2VPZB 2MDAA 2PC6A 5D4NA 4PQAA 2J9CA 1SQGA 2BJEA 2P9EA 4GVBA 1NB7A 3K5OA 5DO2A 1HWIA 4ZPAA 4DG1A 4RW9B 2A1BA 2AIRB 5IWAJ 2QL5B 4ZOSA 1B7FA 1VK8A 3HZEA 2PT0A 3OD2A 4J9KA 2ZZTA 1URNA 3HFZB 2ZOGA 1SL1A 5DGAA 1LWFA 3CJ3A 3UQSA 1R31A 3CCWA 4H4KA 5HMYA 4F3MA 5EX3A 2W7PA 4FZVA 2MLYA 3VAFA 1Y10A 2HZVA 3OLBA 4WKRA 3DLHA 4X4UA 1U6ZA 2X1GA 4F0HA 4F36A 3EWGA 2JEJA 3OUYA 4X66J 3SSQA 5CZVA 3W66A 1C0UB 2MZTA 3KJVA 5GMEA 4RBUA 1DARA 4HHUA 3TZXA 5DGBA 2ZE2A 4LF2A 5D4PA 4GO7X 2DXFA 5F0WA 3EVWA 2YNGA 2C3PA 1TFWA 4DUTA 3GB0A 5JXSA 5AE3A 4MYTA 5EUHA 2WBRA 1HFEL 1VK3A 2KO1A 3CNQP 3WIVA 4B3OA 3AFGA 1APSA 4V19X 1R0CB 2IBKA 3KKFA 1C0TB 3M32A 2VH7A 4AXIA 2BJ1A 2LDYA 4RO0A 3J7AN 3O2IA 3KDOA 4TQRA 2IAJA 3NEKA 5HQLA 1G3OA 4UUXA 4JYAJ 2FHMA 1HNXJ 3MAHA 3FMWA 4HT5A 1AROP 3IAM9 4ZK7M 4J37A 3EZ5A 5KOXA 3MM7B 4X4PA 3CJKA 5B0EA 1TKXB 1VBYA 2YWGA 2DCUB 5A8KB 4DPTA 4LSLA 3KNGA 1ZZFA 4CI0B 4OYBA 1YJ9S 3HHLB 3BBBA 3P8BB 1P9QC 2A18A 2XZWA 3D9BA 4R25A 2FJBB 2Z30B 2E5IA 1BY9A 2ZH1A 2UXDJ 2IDLA 3WC2A 5ETMA 2W8LA 3ENAA 4L72B 5A2QY 1X4CA 2LECA 1NB2A 5LSOA 2HHPA 3KJQB 3LUYA 4B9TA 3VAKA 3ZZZA 3NCPA 2E5LF 2RHQB 4ECSA 4ZCKA 1OO0B 2RS2A 4OJHA 3SCJE 1JLCB 2HHHF 4DPWA 3R2CJ 2LXUA 2VC1A 4TXSA 1XMQJ 3Q83A 4OHYA 4Q43A 1Y5LB 3CIZA 4WZQA 3GONA 4HI2A 3M8ZA 5U47A 3TQEA 3DNCA 1GMWA 2HFVA 4YUDA 3DLLQ 4QU7A 4DV3F 3EXCX 1U47A 4C97A 4CIOA 5HANA 3UD3P 2MLXA 5E5NA 2B5JA 2COLA 2CIMA 2FIUA 1CJVB 1T9UA 2F5GA 4L74A 4TY9A 5B0GA 1F6TA 2O1PA 1FX2A 5B0AA 2JWNA 2V68A 5KG2A 1U8SA 3OVSA 1U24A 1H7XA 3EE3A 4Y0FA 3I96A 2FVSA 5I3UB 2FPHX 2DEJA 2GS8A 4P10A 2X51A 4ILMA 2WB4A 4AUKA 4DBQA 4A48A 3T6JA 1YJNS 2G2ZA 2WVFA 2YX4A 2I5JA 2A6OA 3AAWB 3HVRA 4PABA 2DGTA 1R27B 3IRWP 3PKMA 4I2QB 3Q2TC 3MEDB 1Q8BA 1U2FA 1HYSA 3DRPB 4B3MJ 3MHYA 2R7QA 2AGPA 5LMNJ 4ZN1A 1WC6A 3WDOA 4M5HA 1VRTB 2RRAA 1CC8A 1B0PA 2CKWA 3T19A 1QTMA 3IR7B 5C2CA 1SH2A 3DU6A 2JJ4D 3O44A 1IM6A 4DV0J 3MOZA 2H5IB 4IRCA 1KOOA 3T1HJ 1OYDA 3K0JA 3B4DA 2PO4A 2B51A 3ZTSA 4Y34A 3ZTQA 2J6TA 1Q1KA 2VBWA 4KRWA 1YLXA 3D54A 3D2WA 6FDRA 3E51A 4LFBJ 2MZJA 2CFXA 1JLGA 2UUAF 1UFWA 2UUBJ 1R0AB 2FLNA 1OY8A 7FDRA 4AYBD 2XYGB 2IRYA 2YTCA 1Y5IB 3R5DA 3UN5A 1S4FA 3GZ7A 1T05B 2Y8WA 3BYPA 3IWXA 3N6NA 1B0VA 2HVZA 5KFCA 3TW0A 5F8HA 1S6UA 5HLFA 2ZC4A 2H5EA 1C2PA 3UFCX 2Y0SD 4J9PA 2Q6BA 1LWFB 1K44A 1HBUA 2NXEA 1X4AA 1S72S 3WX4A 3LP0A 5F8MA 2PA3A 4Q5VA 2WTFA 5IWAF 3NMRA 2B0GA 3IA0A 1VC0A 1N36J 2XCAA 3GFXA 2CAJA 1IN0A 3V6HA 1L3SA 4H4KC 3ULHA 1NKBA 5JVGQ 4ZDNA 2AQ4A 4ICLA 2GVDA 1SC6A 1JLBB 3KJNB 4QIVA 1S0VA 2SXLA 3H25A 2BE7D 1U48A 1RHMB 3R6GB 3KJVB 2H51B 4ETZA 2Y9HA 2Q1LA 2K8GA 1IBMJ 4P72A 2HVIA 1TKDA 2OEMA 1CG2A 3IBWA 2EFVA 3H5XA 2J9DE 3GFHA 5SUHA 4FXWA 1X5SA 1T03B 3CDUA 4X66F 3V6JA 3MPWA 3T1AA 1DHMA 3A3PB 2LKZA 1HQUA 3HXMA 3I4HX 3DRYA 5HVGA 1YBTA 3DGPA 4PUOB 3RW6A 5ETTA 3MEGA 4N5SA 3M32B 2QYGA 3D6MB 3C66A 3X3UA 4WE1A 1SJ3P 1HNWF 4M5NA 3PO5A 1LW2A 4CYUA 1K8AT 2C22A 4LF4J 3W5YA 2KJVA 2YQ1A 2WSEC 2J9EA 3NAHA 5T7LB 1NSPA 4ZLNA 4JV1A 2Y1IA 5KG0A 3I4PA 2W7AA 2X1BA 1YGYA 2WCXA 2E5JA 3PYGA 4B02A 2DH7A 1S12A 4LBHA 2R4FA 3CJSA 4LSLB 3G2XA 3P45B 3M4XA 1YQHA 1HNXF 4PG8A 5KG1A 4ZVTB 3TJ9A 1S6OA 1KQGB 5C24A 3MCMA 1HWLA 1RAOA 2G1HA 4NMLA 1S97A 1SXLA 2Z0GA 3MMAB 3ZNUA 3MMBA 4OX7A 4KO0A 1JJCB 1VHFA 3C19A 4F3OA 1HHSA 1JLFA 1RWOB 2MKIA 2ILYA 1RKJA 2GO9A 2DY1A 2KN4A 3ETOA 3A3OB 3N6MA 4OL8A 3GV7B 1CEZA 2ZKTA 2UXDF 2MY8A 1NDKA 3H4BA 5GAEU 3TJAA 2Y1JA 4MKBA 1H72C 3NGSA 1XIQA 2KM8C 2BZ2A 3GV8B 2L3MA 4XPEA 4A8YA 3IR6B 3TX0A 3TUZC 3TZYA 2VJUA 2CPHA 2V9WA 2OELA 4MTPA 5J2NA 4QR0A 2Q79A 4OHZA 4JI3J 3GIIA 4EZ9A 1RTZA 1WKKA 4OJ1A 3W61A 1IR2A 4K2JA 2J76E 5E3CA 2VA3A 2NZ4A 4NA2A 1F9FA 2GHWA 2D3O1 4G1PA 2FB0A 3OTDA 3MM9A 3KLIA 2DNZA 1HI1A 4K4VA 2EBEA 2LFVA 2DNKA 2RILA 4RNHA 1RWUA 2LCWA 2A10A 4ECZA 1FK9B 1NAQA 1ICEB 4X4OA 2ZH2A 1C1BB 1AFJA 2I5JB 4AFFA 1GTHA 2IRXA 5DDQC 3HSJA 1O51A 4USKA 3QIDA 2HAIA 2ILZA 1HYSB 5F41A 2W4DA 3UDVA 3OR1B 2D3ZA 3CF5Q 4PWDB 3AJ2A 2YWWA 1IKVA 5I4MA 2QA4G 2GQQA 3OJSA 4NLXA 2FJVA 1XC9A 4Y2AA 1VI7A 3THVA 4O3RA 3NCQA 3QT8A 5ITHA 1NK5A 2QSFA 4R5PB 4CO5A 2V8PA 4B3MF 4IOBA 2YKPA 1HW8A 3EVMA 1FCAA 2G13A 4MKAA 3RG6A 3MMCB 2ZH3A 3IWNC 4J9QA 1NNDA 1CC7A 1SIZA 2VKZG 4DV0F 3H7HB 1WEZA 4JP8A 4GVLA 1U1RA 2UP1A 3EZUA 1J5EJ 2ZH9A 2MGZA 2V0NA 2KVIA 3ZNJ1 2M52A 1WACA 5FDLA 1X4DA 3I32A 2BOPA 1REVB 2OI2A 3PYFA 2XY6A 1U0SA 2M9KA 1N0UA 1RJJA 3R27A 4P6QA 2CJXB 3O8WA 4H4OA 1JJ2R 4MAKA 3OLAA 3W9HA 3ZZRA 3GJTB 3QZ7A 4UY85 1B3TA 1H0HB 3MAQA 3W7BA 1UVMA 2C42A 4ED8A 3IAS9 3IM8A 4B3SJ 3QT6A 1HNVB 3H0PA 3CCQS 1EKSA 1R8HA 5HK4A 3SSSA 1C1CB 5F9NA 1GMVA 4PRFA 2VONA 4O4RA 3ZZYA 1UA0A 3NNHA 1BD6A 3LP1A 1N6QB 1BXNA 4LREA 1FDDA 1N36F 2DXDA 3A1YG 1IWGA 4ES2A 1P9YA 2MQPA 3KWMA 4KKOB 3EZOA 3OHAA 1UEKA 4IH5A 2ADBA 5CH7B 2DGXA 4OQJA 4P74A 5ETRA 2AGOA 4JV0A 2OMLA 2RNEA 1HQUB 4F50A 3CDWA 2F63A 4EBCA 5LOQA 2EVZA 3MM5A 2FHOB 4CLUA 4ECRA 5T41A 3MEGB 4F4ZA 2DGUA 5E0OA 4CH7A 4DS5A 1KDNA 1FERA 4JI4J 4BHQA 4CYUB 4HACB 2IJNA 3HD2A 1Y11A 1MNEA 2CYYA 2BQUA 5B0DA 3UR3C 3FFIB 3TAPA 2I9SA 1GX5A 1EB0A 4ZPCA 1NSAA 4CH1A 4OYOA 3PEJA 2V4QA 2J8AA 4RKUC 1L3UA 5JMNA 5LSLA 3FBBA 3DHWC 3PHEA 1NDCA 2IHR1 2AU0A 1Q82T 3HFVA 1WTBA 4UOFA 2LVWA 5BYRA 3RR8A 2CUYA 3VAMA 4NXNJ 2PI4A 2YPZA 4ZP7A 3EDRB 2H9ZA 2XMKA 3M6UA 2A2CA 1FNMA 4J5OA 5EGYA 3MMBB 1ZM2A 1TVRA 4KO0B 3OTCA 2HHVA 1JLFB 3CJTA 2CPYA 2MJNA 4OZ2A 1JKHA 5HP1B 3IO1A 1H73A 4I67A 3H2LA 3CO0P 1SUQB 3RW7A 3N5BA 4FS1A 2VOOA 2WRMA 1YJTA 3PG9A 2DR6A 3I9V9 3QT5A 3HVAA 3CDEA 2KB2A 2NLWA 1QE1A 4Z37A 4FDFA 4Y28C 1T9WA 2FUG9 3EXYA 3PJ9A 3CJQA 1SJFA 2AMCB 1UA1A 1K9MT 1QVGR 4NYPA 1PYTA 4YMEA 5C7PA 2FJWA 2RU9A 2H48B 3M6VA 4P7VA 4F4AA 2G9OA 1YZ7A 4ANEA 2V63A 3J81U 3QJPA 1DAXA 2KT5A 3DDIA 2RF2A 3DM2A 1TAUA 3TUPA 3IGVA 2IPOB 2ZZNA 3M2UA 3DOLA 4C2MA 3HMJG 5IS2A 3MM9B 1RAEB 4DV4F 1XTZA 1S99A 3BSOA 2HFZA 3HSDA 2AEFA 2DNNA 3D3CJ 1JLAA 4CT9A 3QIPA 2P6SA 1OWXA 2OLWA 1OQ3A 1UFLA 2KZMA 2Z2ZA 3H2VE 3S01A 1X31C 2OFGX 4TNOA 3KK1A 2OPQA 1DZ5A 2D7SA 4AQYF 1CQNA 4DR5F 2DHGA 4EO6A 3J81j 4I6WA 3M30A 3A8KA 1IKVB 2HS4A 4QR1A 2GIFA 5ETNA 3D1HA 2KFNA 1LWEB 2R8KA 3GP9A 4OX9F 2KYXA 2DH9A 3K5NA 2HNZA 4FYVB 2I6WA 2R7OA 4ZIWA 2YH1A 2I38A 2DNRA 1VIOA 3NNCA 4JB8B 4RNMA 1SKUB 2LQ5A 1R6VA 2E1MC 3PHTA 2ZJPQ 2L9WA 1XERA 4IRKA 3W62A 3KLHA 2WONA 5K9FA 2O01C 1NHUA 5L9XA 3WX8A 3Q8PB 2CPDA 1IKWA 4ECYA 1TKTA 2AGQA 1VQYA 4ELUA 3IS9A 1H2VZ 1A6LA 1IR0A 4FVCA 2E1RA 1UEVA 1KVJA 2HIYA 1KBRA 3W1YC 2BBEA 2O66A 2IVFB 1XEZA 3CT9A 2R8GA 3I5CA 3ILJA 1S10A 1U0HA 1IKXB 3AJ1A 4KBIA 2BM0A 2NPFA 5DQGA 1UJ4A 4LJMA 1RDRA 1FFWB 3AT1B 4OZ3A 4X64J 2WSCC 2DK2A 2HZCA 4JV2A 4GKKJ 4PG6A 5A8WA 1RT2B 4C8OA 3FZ2A 1DTTA 1J2VA 2LQJA 5IFMA 2DR5A 3ITHA 4OI0A 3R7NB 4DL7A 3EGNA 1O5JA 2FGCA 4EMDA 3RRGA 1KTQA 2XLKA 1NDLA 3D6HB 3Q24A 5KFZA 3LP1B 2DR9A 5DZ7A 5JVHQ 1UZDA 1S9EA 1HPZA 1NHKL 2NYIA 3ZTPA 1P1TA 1V5VA 5FD1A 3LF0A 1YTYA 1BWEA 4PWUA 3M8QA 4P71A 2FLLA 4KQZA 3W3SA 2BJDA 1I1GA 5KFJA 2UU9J 3BSCA 1R3NA 4ZN3A 3D66A 3F56A 2QSWA 1D09B 2GIQA 3CCLS 3G86A 2ZVSA 2V8VA 3MM5B 5A6PA 2J9DA 1QTNB 2XWXA 3PX6A 2UUCJ 4R0JA 1WF0A 3QRPA 2CNOB 4WTYA 5KFIA 3U1LA 3QNWB 1RTHA 1RGVA 1Q8IA 5IXUA 4UOHA 3DRRA 4USWA 2HYIB 4QYRA 5KFKA 2QX0A 3L7UA 3F73A 3MEEA 4NLOA 4HTIA 2V50A 3QGPA 1T9YA 2POKA 2MSSA 3CO9A 2H65B 3OVAA 4DSKA 1RI7A 2R9LA 5AE2A 3M8YA 2DR7A 3HCXA 4MK7A 1GFWB 4LQ9A 1CJTB 1NH8A 3HJVA 4JV5F 4F2RA 3O6QA 5KFWA 3I0SB 3M6WA 4M5IA 2UVWA 1TVRB 2QMXA 2GZOA 1FKOB 1HWUA 2NREA 4RUCA 3BSNA 3UDCA 4J9VA 3VGSA 4WIIA 2V94A 1S76D 1WC0A 4I68A 2CQBA 2DHXA 3IRXA 4C8NA 3CUNA 2ASDA 3B82A 2D9PA 2IYGA 3UPFA 5J2PA 5C2GA 3BPDA 2ATCB 3CJ2A 4PPDA 1C4AA 1VDHA 4ECXA 1CVJA 2MXYA 3G8TA 1IJEB 4HH1A 2Q66A 2HFSA 3VWSA 3VVTA 2ZHOA 2M4MA 2X1AA 2ALYB 3PX4A 1S79A 3D6FB 4IQMA 4Q8FA 2HQDA 3HI9A 3MWBA 4WKYA 1UWAA 4N7TA 4CTAB 5E7OB 1ZH5A 4H4MA 3ZO7A 1FDAA 2YY3A 2HQIA 1CJUB 4ILRA 2ZH6A 4JI6J 3VAGA 2IM2A 2RU3A 2FY8A 5KFDA 2QYCA 1W2BR 1CSJA 4DLGA 5GADI 1FEHA 2J0WA 3MGJA 2CZVC 1HHQA 1VBZA 2V4JA 1W2IA 2RMLA 4NCGA 3SCIE 1JLAB 2XMTA 3PO4A 3KTQA 3QGHA 3CC4S 2ZC3A 3OHBA 1QVFR 2E7XA 4P9SA 4JI7J 4LF9F 1BLUA 3Q23A 1FJGJ 5A0YA 1SH0A 5CYQB 3V6DA 1RHJB 4F4XA 5LSRA 1M1HA 2HHUA 5KFUA 4BLGA 4ZCIA 3KMSA 3R1LA 2W7OA 5F8JA 2H4WB 3PTWA 2V2KA 3OL7A 1S7IA 1HNZF 4WZMA 2GJIA 1U2CA 5J2MA 4OYZA 3O1LA 4U7UD 5A6WA 1S0NA 4R8UA 2IY5B 1NJZA 3CCSS 3SSRA 2ZM6J 2HK3A 2YKMA 3IP0A 1VJWA 3GU0A 1VQPS 3DRXA 3OR2B 1RUSA 4NLQA 5DDOC 2OD6A 1FVQA 3KLHB 2WONB 4NI2A 2BDPA 1XNRF 1NK7A 1ZM4A 2RSQA 2YKQA 2PEHA 1UEUA 1UMJA 4NLTA 3QMQA 3M8PA 3H8YA 2IVMA 5LM7E 4E98A 2ZFHA 1TUVA 4LVOP 1BQNA 1MW7A 3A3NB 1TL4A 4I1TA 5IT0A 1WG5A 2FY1A 2BJ3A 2VFRA 4CO2A 4DCJB 1UPMB 1U0HB 1S1WB 1XR5A 2GJFA 1AFIA 3CJ0A 5SZTA 1RTDA 2ZD1A 2ZOFA 1V5IB 2AX0A 4CP5A 3JSMB 1JK9B 1HIYA 5RUBA 2KT2A 2JSXA 3D28A 1X4HA 2KHCA 2XTJP 4U7UK 4N76A 2IM1A 1Q4RA 4LRBA 3CW2C 3ITHB 1B70B 4TQSA 2WVEA 4H54A 2GIRA 3HF5A 1UCNA 4K4ZA 3PKYA 2HS3A 4M1KA 1RT5A 3H4DA 1YKWA 2OKQA 1LFWA 2DPJA 4WXWA 3KHRA 2E1AA 4X64F 1AUDA 1HPZB 2VU5A 4O44A 4ZVQB 4RR5A 2C3YA 1DLOA 4J7CA 4OZLA 2F4VJ 3MD3A 3P5BP 1T95A 2B7CB 1DTQA 1TV6A 3NS6A 3M8RA 1SV5A 2EC0A 2EK1A 4C8LA 1KFSA 1OSCA 5KFPA 4A8QA 1SC4B 2WHOA 2QLFB 4AL7A 1RK8A 3H20A 1TQLA 3NGRA 4NLYA 5CQGA 3W9JA 3MF5A 1S9GA 3OTOF 2PIIA 3KDNA 4F67A 5KT3A 4RW7A 3KK3B 1IJFB 4P7TA 4DR3J 3DRRB 2AWZA 4J9UE 4C0BA 1REGX 2OPPA 5A8RA 5LJ5Y 1WKJA 3MEEB 4Y2KA 2W4PA 3NP5A 4DCPB 3DDNA 4C11A 5J1NA 1QAJA 2Y1RI 3K8WA 4QYZK 3MDFA 3Q89A 1RT6B 2W8KA 2YWFA 3NY0A 1PJ5A 1T8EA 4QWAA 1SH3A 4QOTA 1WNEA 4DMZA 2C3OA 2HGMA 2FQQB 5CD4H 2XC9A 3DLGA 5LXRA 4DLEA 2GO8A 3I56S 1EJ7L 4DF4A 3MR3A 4JI5J 2R7UA 4DR1J 3TAMB 4I7FA 2B4UA 2KG1A 2VB6A 5DLGA 1IKYA 1F9HA 2LEAA 3PCOB 1O6XA 2MZRA 2C2OB 3WZ0A 2J0QD 2VJVA 1IXKA 1BWVA 1XBWA 1RAGB 1N5YA 4C9DA 1D0EA 4ZCLA 3CCTA 4ID5A 3CD0A 1U45A 3NS7B 5KG7A 1RLCL 3TYTA 2DHAA 4OYMA 3TA0A 1RQ0A 2HNYB 2UUWA 5F9LA 1Q95G 1NK0A 2YH0A 3MR5A 5L1LA 2Z2YB 3M6XA 4CNZA 5ETLA 1T3NA 3HHLD 1XK8A 2ZEJA 5KT5A 4ZVPB 3M05A 1XNQJ 4JI0J 2W25A 2PDAA 3R5GA 2J0SD 1MU2B 3VF0B 3T1YJ 4TY8B 1VRQC 4I69A 1B0TA 5EWGA 1H2TZ 1GEHA 3I31A 3CCRS 3BKUA 4UZCA 1U25A 1LV5A 5D6GA 2HKEA 3FQLA 1SCJB 4CCHA 4DFMA 4NPOA 3C6TB 1EQMA 4JI6F 2YNFA 4NXMJ 1Z1ZA 4F4YA 2BKPA 4DN0A 3OQ2A 3K2YA 3CDAA 4N41A 4ANCA 3NGKA 5A0YB 1V9OA 4Y2MA 2E1PA 3FSYA 3IMQJ 4YEAA 3QWPA 2MHNA 4DX5A 1M5SA 4U6PA 1WSRA 3C14A 3TQ1A 4B3RF 3JXOA 1W26A 4TLQA 4FP9A 2AYGA 4WXOA 5J2QB 5J2MB 3H5YA 2VUGA 4ED6A 3SCLE 2IRUA 5HMZA 5A76A 4DU8A 5CYMA 4WK3A 2L9NA 1ZAWA 2KRBA 4DL3A 1MMLA 3MECA 2CPJA 1YRXA 4OHWA 1SC3B 1S6PB 3SEOA 3PEHA 1IBKJ 2APOA 4ZVUB 1FE4A 1ZYQA 1RAHB 3KLGB 1O8BA 1R8AA 1BHNA 2F8EX 1J5OA 1YJ7A 1R8CA 1NH7A 2IM0A 1WC1A 4FF2A 2QMWA 5AJ3J 1QAYA 3W2WB 2WSFC 3W8GA 2JX2A 4ZVRB 1JJ4A 2V8GA 2ZBPA 2OEKA 4NRTA 3KUGA 2ATLA 3BREA 4B3TJ 4KH0B 5GAHU 1P27B 3EMTA 4CO1A 1RWWB 4WP3A 3LO3A 3PRBA 4HR2A 1X0FA 1T9XA 3VQTA 2YX1A 4HKQA 1YWXA 2M7SA 3NL0A 4DZDA 1KOHA 2JZ5A 5K8NA 1HBOA 2NXNA 3K7RA 5D0EA 1VQ7S 2HQ3A 2VBYA 1RTJA 1SC1B 5L1KA 3VQSA 2CVEA 2FYXA 1VHIA 2HPUA 3W64A 1T3OA 1JNZB 5FLXY 3GWCA
chains in the Genus database with same CATH topology
3I4PA 1WHWA 1XMBA 2W7AA 5J2NB 2X1BA 4URSA 5HMXA 4ED7A 1E6YB 3SI8A 1S6PA 2NQPA 1YGYA 2WCXA 1N56A 2E5JA 2VFSA 3Q8RB 5DQIA 4B02A 4O44B 5E3RA 1Y4ZB 2MPUA 2RD5C 4NA3A 2DH7A 1KHWA 1JLBA 5CCLA 2R4FA 5GAGU 2ASJA 4LSLB 4Y2IA 3KLGA 1I94F 3MXHP 4A8SA 2ROPA 3M4XA 1FA0A 1YQHA 4O3SA 2GCFA 1HARA 2FVPA 1HNXF 2Z8QA 4PG8A 1VFJA 5D77A 1TV6B 4KPYA 5KG1A 4KC5A 3W2VB 4RBVA 3GIMA 1ZTWA 1LW0A 2EG1A 1S6OA 1KQGB 3RR7A 3KLIB 5C24A 2FLOA 2MY7A 4UOCA 1HWLA 4IG3B 3W2WA 3VZIA 2ZJRQ 3R5AA 3OSPA 4QYZJ 4NMLA 4ES1A 1SXLA 1S97A 3KMQA 2R8IA 3FJ2A 2Z0GA 4RW8A 5DG8A 5KFQA 3JTPA 1L3KA 3MMAB 3MMBA 4I56A 2LXIA 4OX7A 3BO2A 3DOKA 4OZJA 4YHHF 4NLPA 4KO0A 3H98A 1VHFA 4F3OA 4PPZA 4K4UA 1HHSA 1JLFA 4M8LA 1DJ0A 3KHGA 1T03A 3PRDA 3B78A 3UWTA 1P6TA 1ZBTA 4IYQA 2Z2MA 2MKIA 2HWTA 2ILYA 3MFIA 3FEZA 2DVIA 4G1IA 3JAMY 1RKJA 2GO9A 1JB0C 2KN4A 4ZPWR 2F4VF 1D9AA 1QSSA 4QQBA 3THPA 3PW5A 1AXQA 2JDJA 2NSBA 3DXBA 2WOMA 5IT4A 3ETOA 3N6MA 1SIWB 4E0DA 1A9NB 4LF5F 4OL8A 2IFXA 3LH2S 2JC1A 1BQMB 4YB1P 3PIPQ 3GV7B 1DRZA 3CD5A 1X9SA 5L9NA 1H3DA 4PUOA 1CEZA 2ZKTA 1RYRA 1WHYA 3D1QA 3RBEA 5F0UA 4YR2A 3FMBA 2UXDF 3OSNA 2MY8A 4ZLPA 1RKIA 4QWEA 1RA7A 3QJLA 4KV8B 4RUHA 1DBDA 2JLGA 3H4BA 2B6AB 5GAEU 1KSPA 1S48A 3GFZA 2RIJA 5B08A 4DV1F 2Y1JA 4MKBA 1GH8A 3BQ0A 2ZBCA 2KM8C 1X7VA 1WEYA 2RQCA 2BZ2A 2HG4A 2C2EA 3S7RA 5C5JA 4C11B 2HWHA 2IYIA 2L3MA 4XPEA 3HVTB 3GV8B 4DF8A 4LFCF 2F3JA 5KFSA 1FO1A 4A8YA 3IR6B 4Y00A 3TUZC 3OFFA 5HO4A 1ROFA 2DITA 1ZM3A 5T7LA 5KG4A 3ISZA 4DR3F 2WB1D 3BZQA 2CPHA 4ZVGA 4XPCA 2AYMA 2KXFA 2V9WA 1VQ5S 4C4WA 4J9LA 4MTPA 4I6AA 5J2NA 1FTCA 3GR0A 1E6YA 4QR0A 2R7TA 2Q79A 2CPXA 4OHZA 4DR6F 1H98A 3GIIA 2PFFB 4DQSA 5KOWA 4GKKF 1KONA 2KJWA 3CC2S 4EZ9A 1B64A 4OJ1A 3J81Y 2AW0A 2JVRA 2J76E 2XB2D 5E3CA 2G1DA 2VA3A 2NZ4A 1WWHA 2ROGA 4NA2A 2LMIA 2B4OA 2VZ9A 1F9FA 2QA4S 2GHWA 1YIJS 4OJ3A 3THTA 4G1PA 3Q8QB 1NZAA 5DM6Q 2FB0A 3H59A 3TARA 3W2VA 3OXLA 4B9SA 1H7WA 3CCJS 3V2UC 3OTDA 3MM9A 3KLIA 2QE5A 3PR4A 2HHSA 3RB0A 3HHLC 4IG3A 2DNZA 4PG4A 2N7CA 1HI1A 3L7PA 2XMVA 1SKRA 5DM7Q 3IN5A 4HHJA 3UCUP 4K4VA 2ZNYA 2EBEA 2DNKA 1P1LA 2RILA 3NS5A 3MMAA 4RU9A 3GE9A 2RT3A 5DLFA 4RNHA 1SKSA 1RWUA 2LCWA 2C3UA 3GFYA 4CO0A 4LT6A 2A10A 4U7CA 4ECZA 3DN9A 4FN5A 2ASYA 2YKNB 3TI0A 2B43A 2GA7A 3A8EA 2E5HA 2NXUA 1S1XB 1HNIB 2MGZB 1FK9B 3U02A 1NAQA 2OMOA 1D8YA 2F1FA 4OI2A 3GMGA 3DDKA 3T5HA 3NWGA 2ZKUA 3FQKA 5FDLB 4X4OA 1RT4B 2ZH2A 3DOMA 2ZJQQ 2E7WA 2KYZA 3SXLA 1C1BB 2VQFF 4OI4A 1AFJA 1X4EA 2I5JB 2KU7A 3LP2A 3TA1A 3G9CA 3V6KA 4AFFA 4JBCA 1BQMA 1GTHA 2UU9F 4IQXA 2IRXA 5DDQC 5E41A 3UI3A 2OTJS 1O51A 3QIDA 2AYEA 3CVKA 5L1IA 2M0GB 2XMJA 1S7HA 2HAIA 4K5RA 4H4OB 2ILZA 3IC1A 4KV8A 1HYSB 5F41A 1YVFA 2K7KA 4RLEA 2P9GA 2MKHA 2W4DA 2B6AA 3OR1B 1LFPA 3KFWX 5AE1A 3TVKA 2D3ZA 1KLNA 1QSYA 3PFOA 2JOQA 3CF5Q 1WG1A 2FC8A 2UUCF 1VQMS 2R7WA 4LQ3A 2CPZA 4PWDB 3AJ2A 1KLMA 5KFOA 1FXDA 2CQ4A 3DXSX 1QM9A 1N54B 1S1UA 2CPFA 2M2BA 3HKZD 3HVTA 3LAMA 4EFAC 4YDDB 1PGZA 1IKVA 2GW8A 4WK1A 5I4MA 2QA4G 4W90B 2GQQA 2LDIA 3OJSA 4NLXA 2FJVA 2B56A 2UUTA 2ZBIA 2W9CB 1XC9A 4Y2AA 1VI7A 4B08A 4ETXA 4WFNQ 3THVA 4O3RA 1VBXA 1SB6A 3NCQA 2KTQA 1N34F 5ITHA 4IKAA 2GV1A 2QSFA 2VG7B 2VFUA 2JHEA 4CO5A 5E3PA 4R5PB 1WF1A 3RYLA 3S8SA 1FXLA 4HVZA 2MZ1A 1KFDA 1RT3B 2IM3A 4B3MF 4DUYF 3OFEA 4IOBA 2YKPA 1HW8A 5M2PA 4UW2A 1Q78A 3KK2B 4IFVA 3H5SA 4R0EA 1FCAA 3N6LA 2G13A 3FSIA 4MKAA 5HN0A 3PIOQ 4WFZA 5G0RA 3MMCB 2PMHA 2DB1A 2ZH3A 4IR9A 3BJYA 1OS5A 1RA6A 3IWNC 1WEXA 1G6BA 4TLRA 4XAKA 4J9QA 1NNDA 2I2YA 1NKEA 2X1FA 2EW9A 1CC7A 3DLBA 4X4TA 5EDWA 3QO9B 1FKAF 3QGIA 4DDFA 2NUUG 1SIZA 2R2SA 3CCES 2GJ2A 1NU4A 2LA4A 4QIGA 3TA2A 2VKZG 2IA6A 4DV0F 3JYTB 4ALZA 1WEZA 3KLEB 1ULRA 3BF4A 2QA1A 5LL6d 1U1RA 1FKPB 2UP1A 3B8HA 3EZUA 1L5UA 3KLVA 2EBGA 2YKNA 2MQOA 3T1YF 3P5TL 4RW4A 4YB5A 1K0VA 2ZH9A 2MGZA 4ZPVR 1FK9A 2V0NA 1DQAA 2KVIA 3BEGB 3TUIC 2AJ4A 2M52A 1WACA 3HDSA 5IM0B 5FDLA 4FF1A 3AA8A 1X4DA 3QAEA 3MI7X 4C0HA 2ALZA 3I32A 2BOPA 1C1BA 1REVB 1QAXA 4DN9A 4MYUA 1FTRA 4YY3F 2ZDPA 2D41A 3HLUA 5H9EJ 2RQKA 1QSLA 2XY6A 2M9KA 1N0UA 1OPZA 1RJJA 1V6HA 3R27A 2GGPB 2OPSB 4P6QA 3NCRA 4AE5A 3OJUA 3CE8A 4EO8A 2R2RA 3O8WA 4H4OA 5FIIA 1ELOA 4NXMF 1JJ2R 3RZAA 4MAKA 5D4OA 2FLPA 3OLAA 2HHXA 1URRA 3OR1A 3ZZRA 2P5VA 3LPYA 3KG0A 2KZZA 3QZ7A 2BANB 4UY85 3VALA 3CJ5A 4PG7A 5MAOA 4Q44A 3G96A 4DQPA 4PWDA 1SJQA 1H0HB 4TU8A 2D3OR 2HMIB 4X4VA 5GAHI 3MAQA 3W7BA 1UVMA 2C42A 2G0CA 1N5VA 2XI3A 4NRUA 3QWUA 4ED8A 1Q86T 2ZUGA 4OX8A 3IAS9 4ERDA 4ECWA 5CXTA 3RB4A 3AB4B 2BACA 3SV4A 1NK8A 1HNVB 3PACA 2W9CA 4RW6B 3CCQS 4P2SA 3PW0A 3VAIA 3R3TA 1MMDA 1R8HA 2BE2B 3EYZA 1FDNA 4R5PA 4JI8F 3DFEA 1YI2S 4DL2A 3SSSA 1C1CB 4IFYB 5F9NA 3NMAA 4FBUA 3BGRB 5K8PA 3JTNA 1I6JA 4PRFA 4L3NA 4B17A 2RE1A 2VONA 2FHJA 4DR2F 4O4RA 3KK2A 2MJUA 3ZZYA 2MKKA 1UA0A 2PE8A 3NNHA 2LEBA 4WF9Q 1BD6A 3LP1A 2HNDB 1N6QB 3MMCA 5AXNA 2JEIA 3KOAA 2IJFA 1FDDA 3Q22A 2FVRA 4QW8A 2R2TA 1N36F 3A1YG 4J9MA 3QO9A 4ECQA 4ED1A 3IG1A 2HGNA 1X8DA 4XK8C 4ES2A 2K1RB 1DFDA 3FCHA 2JLEA 5KTQA 2MQPA 3N4WA 3KWMA 4NL5A 3JTOA 5JUMA 3KLEA 4KKOB 2CRLA 1IBKF 4KAIA 1D8ZA 3PW2A 2YWHA 3OHAA 4U67Q 1RTIB 3GYNA 4IH5A 3I9ZA 1YJUA 2ADBA 3ONQA 3N0VA 3DLJA 1LQ9A 4IG0B 5CH7B 1LKZA 2DGXA 4OQJA 1JKHB 2MQMA 1LXNA 3JSRA 3M2VB 2DNLA 4IOCQ 4F3QA 5IM0A 1MWYA 2YNHB 2AGOA 4JV0A 3DMJB 2OMLA 2RNEA 1HQUB 5GAGI 4F50A 3CDWA 3SDEB 2IMWP 1REVA 4EBCA 3ENQA 2WK4A 4F2SA 1XMOF 5AJ3F 2EVZA 2J6UA 4K0KF 5CZXA 3MM5A 2FHOB 2V9KA 1KR4A 2UXBF 2UVRA 3AQOA 4ZPTR 1SL2A 2ABYA 4ECRA 5T41A 4F26A 2GGPA 1JXEA 2OPSA 3Q2SC 1GX6A 4G1QA 3MEGB 1Q7LB 4MIWA 1N0VC 2BRLA 2DGUA 4F4ZA 5E0OA 3CTRA 4CH7A 2CZ4A 4URGA 4DS5A 3IR5B 2DBBA 3ZC4A 4OX6A 4PG5A 3D1OA 4B3TF 1FERA 4MKYA 4ZS6A 2DD8S 5HBMA 1QE1B 4A8MP 2JFDA 4WYWA 5B0FA 2JL9A 4BHQA 2BANA 2G4BA 4HTJA 4JI7F 2IJNA 1RTJB 1HI8A 1UWBB 5J1PA 1ZTTA 1MNEA 1U1PA 2UXCF 1FJGF 2CYYA 2BQUA 1NJYA 3LAKA 4PQUA 5B0DA 3L3CA 1V3ZA 2EWHA 1HA1A 3UR3C 1TK0A 2FHJD 3FFIB 3BO3A 1KNZA 5CYJA 5G4DA 3TAPA 2I9SA 5KG5A 1GX5A 4ZPCA 2VQEF 4ECVA 1HNVA 2YKOA 3R5BA 4L6V3 4QWDA 3G6ES 4CH1A 4RW6A 1AW0A 1MSWD 2XMMA 3PEJA 1U2RA 2CQCA 1Q16B 3MEKA 3T6BA 2V4QA 3K8VA 2RKIA 2HRUA 1Q7YT 5K5MA 2J8AA 5AXLA 4NZ0A 4RKUC 4USJC 4DX8H 3EPIA 5T14A 4KIAA 5F3ZA 1C1CA 4IFYA 1L3UA 5LSLA 3NLCA 3DHWC 4U9RA 3PHEA 5H9FJ 1UL3A 3U1MA 5EN1A 2RF2B 3DM2B 1F60B 3RRHA 1HMVB 1QLNA 2IHR1 1N48A 2AU0A 1Q82T 2BYCA 2HNDA 4B9UA 1WTBA 1N6QA 1Y3KA 2J5AA 1QUVA 1KC8T 3M2UB 4MMOA 3DOLB 3SV3A 2QEXS 3AHPA 4YB7A 2LVWA 3HFKA 5BYRA 3G8SA 2ZM6F 5F3TA 3VAMA 5H1SV 1LW0B 4DFJA 2DGOA 3RR8A 2PI4A 1JNRB 2YX7A 2FJXA 4ZP7A 3MPVA 4YFUA 2ZH8A 2H9ZA 2XMKA 2ERRA 2E1CA 1FRLA 4IO9Q 1KD1T 3M6UA 2PA8D 2C2DA 2K1RA 3US5A 2A2CA 4LMZA 1FNMA 4QZVB 4X4RA 1PC4A 2VV5A 1KRPA 4HDGA 4J5OA 5EGYA 5DDRC 3O5TB 3MMBB 1ZM2A 4IR1A 1U1QA 4KKOA 1TVRA 3CMAS 2QO3A 3F44A 4KO0B 1Q81T 5KT4A 2BV3A 3DLKA 3OTCA 2HHVA 1TK8A 1RTIA 1JLFB 5KFNA 1K1SA 3DI6A 2CPYA 3NGDA 2MJNA 4B9LA 1F5AA 3QYYA 1HQEA 3J80Y 2OP5A 1JKHA 5HP1B 1DQ9A 2GX8A 3IO1A 3M2VA 1TZ0A 1E6VA 4FNIA 2YNHA 4C0OC 4DFKA 1GXLA 3P3DA 2DNOA 3QIPB 3SDEA 4KFBA 2I1RA 4I67A 1PSDA 1Y5NB 3H2LA 3BGUA 1TK5A 2VBXA 3UR0A 1SUQB 5KFMA 1VOMA 3UD4P 1X9WA 3IFEA 4M94A 4BC7A 3RW7A 3N5BA 4FS1A 3JB9k 4RUAA 4HEA9 5M2UA 2WRMA 2VOOA 1UJ5A 1XN9A 1YJTA 3KK1B 2OPQB 3M8SA 3CSKA 3I9V9 3DYAB 3HVAA 1W25A 3CDEA 2R7VA 4NLRA 2KB2A 2NLWA 4BC9A 1S1TA 4DJBA 2O67A 1M5OC 1TP7A 2E44A 1QE1A 2DTJA 4Z37A 1VQLS 4Y28C 2FUG9 3EXYA 2XS7A 3HHEA 3J7A1 3G8QA 2DNMA 2XSFA 2N4CA 1JLEB 3KHLA 1SJFA 4G6VB 4I4BA 1UA1A 4ZVHA 4W92B 3M30B 3NBPB 1K9MT 1QVGR 4NYPA 3FFIA 4YMEA 3LANA 5IQQA 1Y9OA 1VC6A 1R8BA 1X4GA 2M3DA 5BYQA 3HM9A 2FJWA 2PI5A 2RU9A 2LYVA 4K5SA 2JEGA 2Q6CA 3M6VA 2HNZB 3BO4A 4P7VA 1N32F 2E9ZA 2G9OA 2CJ9A 3BQ2A 5L8RC 3QJPA 4OV1A 1DAXA 2QZ8A 5C25B 2KT5A 4AL5A 2NR0A 4ZHRA 1HWKA 3GILA 2RF2A 3DM2A 4I0WA 3MTJA 3UCZP 1TAUA 2R8HA 1HMVA 2Y1IA 5D3GB 1H38A 5BJRA 1KVIA 3IGVA 4JYAF 5E3AA 2B9YA 2ZZNA 1GAOA 4FXVA 3M2UA 3DOLA 1BC6A 3V4IB 1FHTA 4C2MA 3K5MA 2R7XA 3HMJG 1G7CB 2A3JA 4AL6A 3CD6S 2VPXB 5IS2A 4TN2A 3MM9B 3U27A 4ZP8A 3I0RA 3BN7A 2HIQA 2WAQD 1VQNS