1I94F

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i94F00
5BR8F 1LOUA 1XMQF 1IBMF 4DV5F 1N32F 1IBKF 1HNXF 1N36F 4DUYF 1HNWF 4JI1F 1G7CB 4X65F 5IWAF 1XNQF 3ZZPA 4DR2F 3OTOF 2HHHF 4B3RF 4B3MF 4LFBF 4X64F 1J5EF 1RISA 1F60B 4AQYF 1HNZF 4JI5F 2B7BB 1HR0F 4OX9F 4JI2F 3R3TA 4YY3F 4X62F 5AJ3F 4DV1F 1G1XA 4DV3F 4DV6F 4LF5F 4JI0F 1VMBA 3T1HF 1IJEB 2KJWA 3T1YF 2B7CB 2VQFF 4K0KF 4DV4F 1IJFB 4YHHF 4JI7F 4KHPF 2KJVA 2UXBF 4GKKF 4DV2F 2ZM6F 4JI3F 4LF4F 1FJGF 4LF6F 2VQEF 4B3TF 1B64A 2UU9F 4DR3F 2UUCF 4DR7F 4DR6F 2F4VF 2E5LF 4B3SF 4DR4F 4X66F 4JI8F 1XNRF 4DUZF 5LMNF 4DR1F 4LF8F 1CQNA 2RJZA 5LMUF 4JI4F 4LFAF 2UXCF 1XMOF 4LF9F 1FKAF 1N33F 4NXMF 4JV5F 1I94F 2J5AA 1IBLF 2UUAF 4DV0F 4JI6F 1GH8A 2UUBF 4GKJF 4DV7F 2BXJA 4JYAF 1N34F 2YY3A 1CQMA 2UXDF 4LFCF 4DR5F 4LF7F 4NXNF 1QJHA 2BVZA
chains in the Genus database with same CATH superfamily
3VAMA 2XHCA 3MECA 1Y3KA 1R8CA 4UTGA 5F8NA 2BDPA 4KFBA 3NGRA 1HI1A 4B3SJ 2VBXA 5HMXA 1SKUB 4GC6A 1Q53A 2B9EA 4A46A 2B4PA 1VS3A 1AYEA 1NKEA 5CABA 2NPIA 3UD3P 5HP1A 1FJCA 2YNHA 2DJWA 5K8PA 5F8HA 1KFDA 4I67A 3QIDA 3AODA 3VGUA 2AYEA 4F4KA 2O1PA 1X4CA 1LWEB 2PN6A 3HDSA 1FF2A 2XMMA 1QDUB 4OV6A 4G65A 4CNYA 3A8JA 1HNVA 3Q8VA 2BABA 1IBKJ 3KWMA 3UDEA 4QIEA 2G9OA 1S72S 4DDFA 3KHLA 4F0MA 1ZTTA 4WE1B 4F4ZA 2CNLB 1YJUA 1APSA 3OBIA 3C8YA 2IPOB 4N41A 4UOFA 2BANA 1JLGA 4A8FA 1EARA 2XZWA 4Y2MA 3TA0A 4ILLA 3RRKA 5CCLA 3UPFA 1NH8A 3DM2B 3MUMP 2KN4A 3AA9A 4YP3A 5LSRA 2W9CA 4H4OA 5IC4B 2NSBA 4ZP8A 2NCKL 2CPJA 1MLAA 4RO0A 1J27A 3EICA 1FK9A 4KGVB 1WG1A 3KK3A 3CCQS 2QG9B 1EKRA 1ICEB 3BR9A 2HS4A 3VAIA 2HHVA 5B0AA 2ZOFA 1RT2A 4B3MJ 5AE3A 2PDAA 4DWIA 2Q66A 2WHOA 1S6OA 5KFOA 2BJ3A 2JDJA 3H4BA 4OYZA 2AYGA 1TTHB 1HNWF 8AT1B 4ED4A 2J6TA 4CTAB 2K7KA 4B9NA 5B08A 3ILLA 2DISA 2HW3A 1IKYB 2J6SA 2DRBA 4ER8A 3ENQA 4ZLLA 4KO0A 2A18A 2QFJA 3MPUB 2B7CB 4QCLA 4PXEA 1Q0NA 3VVTA 3GR1A 4DPOA 2W4PA 1R43A 4UZBA 3BF4A 1Q81T 4OZLA 4QWDA 4RZRA 4DLGA 1W2BR 2DNKA 2O67A 1WC5A 2KI2A 1PBUA 2VICA 3AAWB 1WKLA 4D3GA 2HVHA 4YN3B 1NJXA 1WUUA 4CTAA 4LJMA 1F5BA 4DV7F 4UZCA 1U45A 3JYTB 2HEKA 2HIYA 2C2ZB 1OYEA 4NLUA 1XMQF 4CLSA 2IMWP 3KG1A 4DV4J 2ZM6J 1RKJA 1RGVA 3NGSA 5CYQB 5B0FA 4Y2KA 4Q43A 3OR2B 3IP0A 3DRRB 3LP1B 4B9TA 1UJ5A 1XK8A 2AZ1A 2MZ1A 3HSJA 3HHLC 2MKKA 2GMJA 1WHVA 2B5JB 1OY8A 2EBGA 2QJ3A 3IC1A 4M5LA 2KZMA 4K4YA 3CD5A 2Z57B 4G1PA 1XJWB 2BOPA 4XPEA 3JYTA 5DGAA 4NZ6A 5CD4H 3GIIA 5E7OB 4LF9F 2GVDA 2MKHA 3OTEA 2VD3A 2YWFA 2CJAA 4J7CA 2UUBF 1LWFA 2D9PA 1T9VA 3N6MA 4DV3J 3H42A 2VIHA 3WC0A 2PSZA 5ITHA 3UR0A 1YDLA 3KJVB 3G86A 2ZBPA 5JMNA 3Q8PB 1LWCA 1XWLA 1HMVB 4DR3J 1QAJA 3ELHA 1FWPA 3MM7B 2KH9A 1PC5A 2IYIA 4C4WA 2NUHA 1EZZB 2EEYA 3QLHB 2XY6A 1U0HA 2AGPA 3M2RA 4FYDA 1OSCA 4U95A 4QYZK 3AD9C 3RAMA 3ZZ0A 3KLHB 1X7VA 2XS5A 3ICLA 3EM1A 2VFVA 3CJRA 5L1IA 1T3OA 3DLEB 1TK5A 4F02A 5I42A 5DJBA 3QNWB 1NK8A 4USWA 4IFVB 4ANEA 5T41A 4JUZA 5DS7A 4IOAQ 1RBOB 5IWAJ 2VBYA 4OX6A 1CG2A 4NX9A 2IC3B 5HSPA 4DV0F 4DPTA 3V5RA 5LJ3Y 5DLFA 1Q7YT 1K44A 3BQ1A 3KK2A 3M1VA 3IBWA 2DO4A 5HO4A 1XNQJ 2GHWA 4X84A 4IG0B 4USKA 3A3PB 1NPPA 1PYOB 4PWDA 4U67Q 3VTIA 4DX8H 1RDRA 3KLHA 4DR4J 1HNZF 1TAUA 1HBUA 3Q2SC 2W9BA 2IAJB 4DEZA 1WTBA 3D67A 4UQGA 4CO4A 4KAIA 4DG1A 1NK9A 2AGQA 3TZXA 3EPIA 3ETMA 4EZ9A 2VQEF 2GQCA 1FWLA 4XAKA 2OPRA 5CCMA 3RB6A 4NI2B 3ILIA 3CGIA 3HKZD 2HRYA 4OZ2A 1FVQA 5K8OA 1RTJA 3P49B 5KFMA 2NXNA 3MEDB 4M8LA 1N33F 4B9MA 2Z2LA 3SSSA 2EFNA 2G1HA 2HGNA 5T14A 4ECQA 4CI0B 3HT3A 1QY7A 2XI2A 4C8YA 2IBKA 4NEZA 3P45B 2E7XA 1XC9A 2Y8WA 2VG6A 1I51B 2AZ3A 3VGSA 1HBNA 5C24B 1YBUA 2RQCA 4ZVRB 3RBEA 3Q0AA 1OJ4A 3ISZA 1AUSL 3QFWA 1LK5A 4OJ1A 2IJFA 3GG1A 3HLUA 2LQ8A 1QUVA 3SFUA 2RAQA 3AJDA 4DQIA 4K7QA 2U1AA 4ES2A 2XY7A 2FJBB 4FF2A 4OLPA 3PDNA 3R7BB 2P9CA 2QN6B 2YKNA 2OJ3A 1NRKA 1Z4UA 2M70A 2A1BA 1P9YA 2QA4S 2YH0A 4Y0FA 3LO3A 5IT4A 2QIFA 3BGUA 4MYTA 3BGLA 3MDFA 1G3OA 3QATA 3VHQA 3CCVS 2DNYA 2DNHA 1KLMA 5D8HB 2GAHC 3DHXA 1AZSA 3VAKA 3CCES 2DH8A 3RAXA 1FRKA 3ZNUA 1HQ2A 1XR6A 1QJHA 1NSAA 2BW2A 3ZXWA 1Y5LB 3KNAA 2ZOMA 4R5PA 3LAKA 4FBTA 2OPSA 4QBUA 4ZPBA 3IG1A 1X31C 4IG3A 1JXEA 1RABB 1S99A 1NZ8A 4IUFA 5LMNJ 5HANA 2H5JB 3BKTA 2DGTA 2W4CA 2GVZB 2Y3YA 3KK1A 4PCQA 1TK0A 3DXBA 2V4JB 3PKMA 3KUEA 4ZJQA 3IR5B 1P1LA 1FE4A 5A6PA 1IVZA 3H20A 3KMQA 4B3SF 1WI6A 3CJ2A 5HVHA 1VQPS 3MZIA 2E1AA 4Q7AA 1I5OB 3C2PA 4KSEB 2A3JA 4XO0A 4OYXA 2G2ZA 1JQGA 3H2UB 3A1YG 1GT8A 4HI2A 1NK7A 2QV6A 2IJNA 2P6SA 3C6UB 1NSPA 4PXBA 5KFAA 4JI0J 1X5OA 3TW0A 5GAGU 2ZBCA 4IDKA 1B7FA 4EO6A 3M8PB 3FMBA 4ZVSB 1FKOB 3UCUP 4MKYA 2KVQE 4ANDA 2RUSA 2NYHA 3W9JA 8ATCB 2XULA 5KFBA 2MMYA 2CG4A 2YQ1A 1TV6B 2KG0A 3TEGA 1XNRJ 2H48B 2BKNA 4OHXA 4ZK7M 3FZBA 3PFOA 2AMCB 1RHMB 5H9FK 3VGTA 1IJFB 2PE8A 1V5IB 4WP8A 3HZGA 4W90B 3G4SS 3IWLA 4K4WA 5HQLA 2EVZA 4E98A 4EBCA 1RWWB 1YI2S 4DU8A 2IM3A 1RHUB 2O66A 3AQPA 3LF0A 4M5KA 4JI1J 3SEOA 2GMLA 4J9KA 5HAOA 1FKOA 4H4KA 2HHTA 3PEHA 2CYYA 3AD7C 2JX2A 4LVOP 2CZ4A 4WF9Q 1H74A 3MPYA 4DV1J 1H73A 2RMLA 3AQOA 2BVZA 2IHR1 1KTQA 2I5JB 1FERA 1K73T 3BH6B 3N9UC 3R5CA 3I5CA 4GVBB 1PIEA 4QR1A 4O4RA 1J2VA 2VU5A 3V6JA 1SV5B 1E6YB 1FDBA 2CFXA 4LF4J 4UOGA 4B3MF 4BWMA 3R9LA 2EKYA 4A8KA 2DY9A 4FPRA 3TA2A 3CJKA 3NMRA 2XZDB 3ADAC 4F36A 4QWBA 4ZITA 1NJYA 4XPCA 4MJKA 5KFNA 1VQYA 4TY8A 3BO3A 1CJKA 4ILMA 4KR0B 2HWTA 4C11B 4KE5A 2J0WA 4UQTA 1VQLS 2PMHA 2EK6A 5KFDA 2HGLA 2OSRA 4DFPA 2DNQA 2E66A 2CQPA 2DGSA 2AKWB 4DOZA 2JWNA 3THTA 4K5SA 2DKOB 4DX7A 2MQLA 1T9YA 3QWUA 1SV5A 4ECSA 5J2MA 3GFHA 3OJSA 3J7AN 1JKHA 1C1BB 4QJVA 2F40A 1S59A 3R1LA 4PG6A 1NDLA 1S77D 2R7TA 4ED0A 4P73A 2UXBJ 2XMUA 3EZUA 4DV2J 2CUYA 1YSJA 3FC9A 4NLWA 4NCAA 3D3CJ 4P74A 3U1MA 3RBXA 3G6YA 1VC6A 3PYDA 4QIGA 3SSRA 1RYSA 3IBCB 4DV4F 1MROB 3T9NA 4C8ZA 2E9RX 2ZM6F 1UWAA 4MKAA 4NLPA 4WZQA 1NKBA 2ACMA 2RNEA 3M7VA 4KJIA 4RBTA 4IR1A 3M8QA 3TX8A 2E9ZA 5J1NA 1S1UA 2B8QA 1VQSA 4OYWA 5K14A 2ZBQA 5F0WA 5KFWA 3AD8C 2GIFA 3RB0A 4RNHA 3EJMA 3NNHA 2GA7A 3Q83A 4L72B 5J2QA 1OS5A 2XEXA 5KFUA 2NLWA 3BGOP 3NCPA 3FNNA 4OX9J 1OY9A 5HK4A 2YX7A 2J9DA 4X4UA 1CJVA 1M5VC 2KU7A 3JS9A 2BM0A 1LNQA 2GW8A 2LEAA 3D6TB 3UDLA 2XC9A 3FKBA 2HSEB 4ZA1A 1WHWA 3I9ZA 1P27B 2ZH6A 2PC6A 4O3OA 4DV3F 2IA6A 1NK6A 4WYLA 4MKBA 1SJQA 4B9VA 1M5PC 5B0BA 4M5HA 5JXSA 2XWXA 4OQJA 4LF1A 5E5NA 2FPHX 1P9QC 4Q8EA 1FFWB 2FHMA 5ETKA 4DR3F 3GFXA 2CJBA 4MMOA 3MAHA 5A8KA 3W9IA 1F1BB 4IOBA 4QIFA 1PC4A 4AL6A 5K8MA 1YQHA 1YZ7A 2XO6A 4ZN3A 3LA0A 2DGXA 1NU4A 4F4WA 3J7Z5 4HVZA 2DGQA 2APOA 4Y28C 3EVWA 4DZ6A 1REVA 1SIWB 4TY9A 5H9EK 2EWHA 2RD5C 2DXFA 4B02A 4B3OB 2B6AB 3RTVA 3E51A 2CPIA 2OPPB 2HVZA 1HHSA 4CM0A 2DR9A 2BBEA 3BZQA 5A8RB 1RAJA 1NK0A 5KFZA 3HHLA 5IWAF 2E9TA 2UU9J 1F3FA 3MCNA 3Q86A 4N8OA 3OL9A 2CADA 2ZJQQ 4QIVA 4RJVA 3TJAA 2FVQA 4NLXA 2IM0A 1QSLA 4MT1A 3C6TA 1HW8A 5E3CA 1I94J 4MTPA 4UOCA 1V5VA 2O5DA 4AYBD 5LL6d 3CWJA 4F0KA 4YR0A 1FXDA 2G2OA 4DR4F 1R0CB 2PA8D 4HHJA 3MCOA 1NH7A 3MMJA 2OPPA 2DXEA 2ASLA 2DGVA 3OSNA 1JLBB 1JMTA 4ZMMA 5IOLA 3V6DA 3KJQB 3MCSA 5MLCV 3NGTA 4WFXA 1TMJA 2VG5A 1S10A 1RWOB 3L3CA 4I6AA 1QSYA 2AJ1A 4LRBA 2VPYB 2YWEA 2CNKB 2LEPA 2A2CA 4ZCIA 1ZPWX 2F4VJ 2GO9A 3P5BP 1GMUA 5ADZA 2OSQA 1PAEX 3D1QA 2QSFA 3G8SA 5AXMA 2V9WA 1SQGA 1VRQC 1DLOB 2C3YA 6FD1A 5GAGI 1R3NA 1FWKA 2KFYA 1V3SA 5A8WB 2MLZA 2OUGA 4JI6J 2ZUAA 3TQEA 1T0TV 4AUKA 5D3GB 2CQDA 2GS8A 3N4WA 5J2PA 2WSFC 1CS4B 3R5GA 1VQKS 3DMJA 1RLCL 2XZTB 4I1TA 2JVRA 1KKHA 4NL5A 5D78A 4J9UE 1DURA 3G8QA 3QZ8A 3TJ9A 4LIRA 2ROEA 2ILYA 2KRBA 1U1PA 2PEHA 1DLOA 5DG9A 1TL7A 4DLEA 2BV3A 5KG4A 2RSQA 1NPRA 4TLRA 2EC0A 4LQ3A 2HURA 1NK5A 5D3GA 3F41A 3DRPB 2V69A 3D5MA 2R7XA 3ISNC 1YJTA 4ZIVA 2ZH1A 4G1IA 3L9ZA 3W2WA 4YB1P 4I64A 2XM3A 1Q8BA 4FYXB 1TL4A 2HNYB 2OGUA 4Q2LA 4M94A 3HCXA 3B8HA 4FNHA 5EN1A 1T95A 3NBPB 3MMCA 1CPZA 2KDOA 5LMNF 4TU8A 1VQ9S 1AFJA 3DFEA 1HQEB 1FKAF 1R0BG 3CCRS 2VC0A 1HNIB 3HVTA 2OHDA 3O8WA 4FYWB 3PR5B 1VHIA 3DNCA 1NAQA 3NGDA 2RU9A 1WEYA 1KHWA 1VBKA 3MHYA 1RAOA 2WSCC 4ALZA 1UFLA 1N5TA 1NPKA 1ZS6A 3ETOA 2VONA 5KT7A 3IO1A 3HD1A 4O4GB 3PIOQ 3NMAA 4DR7J 2HNYA 2HRTA 3KOAA 4ILRA 2Z2YB 4HLBA 3TQ1A 1RUSA 3POTB 4N47A 1WOSA 2Z4PA 4HACB 3IBFB 4YHHJ 4JI0F 3ENWA 3JTPA 2BM1A 4OJHA 3LALA 3G8TA 3P8BB 2ZNYA 1UKUA 1HNIA 2EFQA 1YBTA 2CA9A 3PG9A 2XLJA 4PWUA 2J8AA 2C2NA 1F0XA 3MCMA 4U8VA 1XNRF 1NK4A 4J9SA 3FFIB 4DV5J 2YKMA 5KOWA 2VA2A 3U7JA 3WX4A 3IS9B 3NG8A 2LKZA 1SC4B 4N56A 2AYMA 4WFNQ 2DR7A 3QZ7A 1SKRA 4UUXA 5C7PA 4EI2A 2ZHAA 3VQTA 4FKYA 2DHAA 4FKXA 1XEZA 4C0BA 3LANA 2B9XA 2YNGB 1NHVA 2BJEA 2MSSA 4F67A 3ZTPA 2PA3A 5DG8A 3U02A 1ZM3A 2ZBRA 4JI1F 2HRUA 2V34A 2MQNA 1CULA 1D1UA 1U02A 1VFJA 3V2UC 1UVNA 1VR6A 5K8NA 4DV1F 3VALA 2YX4A 4Y2CA 2XLIA 3DC2A 2DNPA 2OPQB 2VFSA 2ZHBA 3RW6A 3IS9A 4ZKAA 4LF4F 3QO9B 2A0FB 1KTVA 1J5OA 1TELA 3QPIA 2AQ4A 5CZVA 2C42A 2Y1IA 2Z8QA 2CNOB 3TI0A 3G82B 2XMAA 3EGNA 2YNFA 4ELVA 1RT5B 2HHHJ 4ED8A 3J80Y 4F26A 2GFFA 1Y0HA 3HKWA 4OHYA 3ENAA 3MMBA 4P2FA 1SH0A 2YY3A 4L6V3 4R0EA 2LQJA 4O3PA 4LRFA 3PJXA 3X3UA 1KDNA 1WD6A 2OAUA 1U0SA 1KD1T 3GP9A 2DYAA 2GMHA 4WIQA 3QO9A 1TVRB 2QLBB 2J9DE 2XSJA 1HWLA 4RW4A 2VUGA 1GFWB 1JLQB 1Y4ZB 2ADBA 3TNVA 4JI4J 1PCAA 1DJ0A 5IFMA 1U1LA 2UXBF 4DV2F 2HFVA 2UZAA 5HJXA 1Q1KA 4Q45A 2GNKA 4RW6A 1NO8A 1IQTA 1KS2A 5FDLB 2IFXA 1D8ZA 1LXNA 3OUYA 2KZZA 5HQ8A 1XMOJ 2BR0A 1Z1ZA 1RA7A 5E3AA 3PO5A 3OSPA 1ZA2B 2VOPA 4IFYA 2QTWA 3NGKA 1RA6A 4FF4A 3TA1A 1VBYA 5B0DA 1DQAA 4DSFA 3OFHA 4P71A 1RTHB 2OEMA 2K8GA 1I6JA 3NNCA 1RK8A 4C3MA 1UVKA 3EVMA 4MK8A 1NEEA 2D1CA 1H6KX 2DO0A 2RKIA 2D3ZA 2L9NA 1FJGJ 3MI7X 5FJ4A 2HS0A 4DCJB 5HATA 4OX9F 5LSOA 3J7YU 1U09A 2BJDA 4K4UA 2B4UA 4OHWA 4NCBA 4DSEA 1S1TA 2L3MA 4HH1A 4QR0A 4WP9A 2ZD1B 1GQEA 1SKWA 2R8JA 3TOQA 5DG7A 4M63A 1A0OB 1LKZA 1SC1B 3W1YC 1H2TZ 3AH6A 3H8YA 1WC4A 1N32J 4U8YA 2J9CA 4FDFA 3NKYA 1VISA 5IT0A 1L3VA 1CEZA 2C3MA 4MK9A 2M9KA 5D0GA 4TU7A 4NMLA 3N79A 3OTBA 1YRUA 1WHYA 3I96A 2V8PA 2JRSA 2GHPA 2I6WA 4I68A 2MTLA 3SCKE 4OYOA 2RF2A 3WHIA 2HKEA 3GIMA 3M6WA 3VF0B 1PSDA 5A2QY 3M8YA 5HJYA 1TL5A 3KNGA 3CUNA 1KC8T 2YWWA 3MAAB 1YIJS 1G7CB 1Y3JA 4AL5A 3IRXB 3C14B 1NDPA 1LV5A 4GMKA 2C22A 3DLKB 4UUWA 2GGPA 3I0RA 2J6UA 2MY8A 5KG3A 3RB4A 4DS5A 1VRUB 1S1WA 3DRSA 5ETRA 1QTMA 4Y2AA 3I5BA 1XERA 2Q6CA 2UU9F 3KJFB 2QYCA 3L95X 1U6FA 1IQZA 2EFGA 2VPWB 5LOQA 1UCNA 4ZHRB 2FLOA 4Y34A 3MM8A 5LT5A 1U47A 1HWUA 3HK2A 5IM0A 1I94F 3KXDA 3MM6B 2AJQA 3OXLA 1SH2A 4LFBJ 5C42B 3C16A 4MIWA 4EBEA 4FBUA 2ZE2A 4J9MA 3MOZA 3PYFA 2V2ZA 4BDPA 1U1KA 3MURP 1NCLA 1WG5A 5AJ3J 3HJVA 3CC7S 4RW7B 1RT3A 1R8HA 1GMVA 2FHOB 2BKPA 1C4AA 1HIYA 1JLAA 4O0NA 5HMWA 4OHVA 1L3SA 2C2DA 4JV5J 4ECTA 3MMAA 1WORA 1GAOA 2BJ8A 2JHEA 5C25A 4DSKA 2F4VF 2XB2D 4LMZA 2V6AA 3NWRA 2RE1A 4HEA9 4RU2A 1JWWA 4JV2A 3K5LA 4DI6A 2QE5A 1W2IA 2JFDA 4NLRA 5F8JA 3ZZRA 1RCOB 3GJTB 1QSSA 1NB2A 1ZYQA 4JI6F 4USJC 3BN7A 2AW0A 2V50A 3NXZA 3CJTA 2YVSA 2R42A 3M32B 2KXNB 3Q2TC 2HVEA 3QJLA 2M0GB 2GQQA 3R27A 2UVVA 1T3NA 2PO4A 3VGVA 3PACA 3MR7A 1X4GA 1PKUA 1J5EF 3W2VB 4ZJLA 2X1GA 4JI8J 1NB7A 2QO3A 4ZVGA 1ZH5A 4Q0BA 2GCFA 2KT2A 3GFYA 1UPPA 3I82A 4NASA 2DHHA 4DR6J 1RT7B 1HBMA 2L9WA 1BWEA 1MMLA 3EDQB 2F9JA 1W26A 5JVGQ 2W2MP 2KHDA 4IO9Q 3KLFA 2OIHA 2HMIB 2Y1LB 4KPCA 3GPAA 2E1MC 4A8WA 2AX0A 1Q5VA 3LH2S 1OPIA 4AQYJ 1RT6B 2VF3A 1FEEA 5THWA 1CC7A 1YGYA 2DRAA 2WONB 1U1QA 5GAHU 5CYMA 4LF5J 2FZCB 2YWGA 3IXQA 2JNJA 3H5XA 3QRQA 2ACYA 3V81B 3V6HA 5AE1A 4V1Ak 1EIYB 4FVMA 2QL7B 2FJEB 3KLGA 4CH1A 3GV5B 1HHQA 1M90T 5IT9U 4OJ3A 2Y0SD 5HROB 2FY8A 1HKAA 2CDQA 1C1CA 1RHQB 2B56A 1N0VC 1SXLA 4Y2IA 3QT5A 4J9PA 4DHVA 1UVMA 1UW4A 3CD7A 3V4IB 3PX0A 2Y0BB 1EJ7L 3CD6S 2LCWA 3PZPA 2ROPA 2DGWA 2J8SA 3A3NB 1S9GA 4DR7F 2COLA 1FHTA 3QFHA 4YEAA 4MFBA 4ZVQB 4KGXB 3FUYA 2C2MB 1SCJB 2CQBA 4EZ6A 4OV1A 3CW2C 2NREA 3CE8A 3LP2B 4X2BA 4R8UA 3NWGA 4AE5A 4X65J 3I0SA 3I6PA 3DLGA 3BKUA 1JLEB 1UJ6A 5A0YB 4GC7A 2XMJA 4KH1B 2WVEA 1RHKB 3MEGB 2JLEA 2YWKA 4DV5F 2OFGX 4AL7A 2E5IA 1IR1A 2QLXA 2LMIA 4P10A 4W98A 5I4MA 1L3KA 2BACA 5J1PA 2CRLA 2OO4A 4JV1A 4P75A 2MQPA 2XGQA 3DLHA 4PG7A 2VODA 3RRGA 4NZ7A 3MM9A 1IKWA 3PCOB 3LP2A 3GMGA 2JEGA 2LXIA 3NS5A 2NQPA 5DDRC 5KFCA 5HN0A 1JLEA 4C97A 4XIUA 3N5BA 4K4XA 3W7BA 1F3VA 4KGKA 2DD8S 3M2VB 3DI6B 5L1LA 3J7YI 3MEGA 4LR7A 2HBYB 2YPYA 3LW5C 1YRXA 2C3PA 1WF1A 4A8QA 3BEGB 4DQPA 1TKZB 2IM2A 4LRCA 4DL6A 1WWHA 4DV6J 1IBCB 4KH0B 1S1XA 2AHOB 3BGRB 4OZ0A 2DT9A 1H0HB 4DMZA 4B3RJ 2H3EB 2X1AA 4TXSA 2UVWA 4JI3J 4ZPTR 4X4TA 3GR0A 2JEIA 2HHHF 2P9GA 4JI5F 3PRVA 3OVBA 2BE7D 1VIOA 4K4ZA 3C46A 3CC2S 1SJFA 3ITHB 1S6QA 3CJQA 2R7VA 1B0PA 4BC9A 1BE4A 1M0SA 2CQ1A 4PPDA 3R5AA 1BLUA 2RDIA 1C0TB 5KFTA 1X5SA 3F0NA 4H4MA 2YKQA 2RRAA 4FYYB 4HT7A 2MZSA 4BCAA 2I38A 3QT7A 5A76A 4N7TA 4P2MA 4JI4F 2XI3A 2A6OA 5G4DA 1PBAA 1B3TA 4OL8A 2WOMB 1X4DA 3W65A 3FZ2A 3ULHA 2DNOA 2L08A 3BKFA 3J81j 3R6LB 4LSNA 2JEJA 3H0PA 3SQGA 1Q78A 1SVDA 3SBMA 2VKZG 3QMQA 1KOHA 1VQ5S 2LECA 2VKRA 3NP5A 4O0IA 2X1FA 2P6TA 4QW9A 2HHSA 2R7RA 4RW8B 3LGHA 3EUNA 5I3PA 1GMWA 4B9SA 3R2CJ 2V0NA 5KFJA 3FBCA 3MUTP 3LP0A 5GMDA 3R1HA 1KP6A 1SUQA 5BXIA 5LMUJ 5J1EA 1UJ4A 3JTNA 1NXIA 4DL2A 1RT4B 5G0RA 1Q16B 5KT3A 4J9RA 4PQUA 2V2QA 1FJGF 1R89A 1WELA 5DO2A 1U2FA 1TAQA 2IRUA 1LW2A 2M8HA 1N34J 3ET6A 2CXEA 3T19A 1ZAWA 3DRYA 1TKDA 2X1BA 4RUCA 4MIAA 4K50A 4C8MA 2FGOA 3CMQA 5J2NB 3P5TL 1NLKL 5KT2A 1Y5IB 3QIPB 4KGZB 1GH8A 2L9DA 1RCXB 1TKTB 2AJ0A 4EBDA 4P7VA 4F3QA 1UFKA 3B82A 2W8LA 1N32F 1Y10A 2B8PA 1N88A 3OT9A 1L3TA 4DCPB 5K5MA 1O8BA 4S0MA 3MECB 2YPZA 3SYZA 4ZLJA 1T11A 1F60B 4KFBB 2XQCA 2W2OP 2XS2A 1HR0F 2R7SA 1Z2LA 1N5SA 1GNKA 3ISND 3QJPA 2EG1A 1RACB 2GX8A 3OVAA 4K4TA 4DL0C 3BSOA 3GIRA 3HFZB 5HP1B 3DCAA 2CZVC 3CIMA 4JOUA 5HLFA 2YNHB 2R8GA 4F50A 1EB0A 1SC3B 4ITSA 2IA0A 2BW7A 3H5SA 3UDCA 3EGVA 3QSYB 1QE1A 1H72C 2D7SA 1IXKA 3O3LA 3Q89A 1S7IA 4LREA 4YFUA 1Q86T 3GG0A 1HNVB 2FQQB 1Q5YA 4DR5F 1GX5A 3LWLA 1X5PA 3GZ7A 1VQ6S 2DRDA 2MKSA 1HWIA 3CJ3A 2DGOA 4RNMA 2RB7A 1U8WA 4LFBF 3VAGA 4E8UA 3PJ9A 2BANB 1JLGB 5M2PA 4X66J 1RT1B 4HT5A 5D4PA 2J7WA 4WBFA 4A8SA 3FBEA 4OI3A 4RKUC 3T1HF 3VR1A 5GAHI 2E44A 2W9CB 4H4OB 3UN5A 4P6QA 4ZPCA 1Q8KA 4HH0A 4DCOB 3TZYA 5FLXU 4BWJA 3MEEA 1B7YB 1C2PA 5AT1B 3W60A 4KKOA 2HYIB 1FK9B 2NYIA 1M5OC 3B54A 3DOKA 3KK3B 5C5JA 2ALZA 3TX0A 3CO9A 1N36J 3AJ1A 5KFIA 5FD1A 2MSTA 1I3OB 4JV5F 3MPDA 4X4SA 1RU2A 3W61A 4DSIA 3G6VA 3DYAA 3U1NA 2O3DA 1RT2B 2M4MA 1YJVA 2I1RA 5HL7Q 1RT1A 3P96A 3SCLE 2CNNB 4QOTA 1R8PA 5BR8F 1MU2A 3K57A 4ZJOA 3Q8SB 4GKKJ 4RNFA 2QL5B 3K5PA 4Y00A 3GSDA 2HNZA 2HVIA 2MXYA 1RSCA 4RU9A 4J9QA 2N4DA 3QSIA 2HHQA 3PHTA 1U4BA 2BQRA 5IQ6A 3CDUA 2JH3A 3KLVA 2KXFA 2ZNZA 4F3OA 2HNDB 3VVUA 4KO0B 2M88A 1L3UA 4X4VA 2H54B 2BX6A 2IVFB 3GV8B 4V19J 1TL1A 3UW1A 4LFCJ 4JI8F 2N3OA 2E5HA 2J7KA 3RGIA 4CP5A 3D66A 3EE3A 1HBOB 2AV5A 3K59A 3CDWA 2VFUA 4DU7A 1U26A 1N6QB 3O2IA 4OZ1A 5K20B 2QA4G 3MGJA 2N82B 4PZVA 4YY3J 4MAKA 4NYOA 2FDNA 3M8WA 4HTIA 4B17A 3KHGA 1RXOB 2Z2MA 1ITPA 2HNDA 2XGPA 4KYZA 3NNAA 2B43A 1KVIA 1OY6A 2VBZA 4DXLA 4AQYF 2E5LJ 4KBIA 1S6PA 4OJGA 3I87A 3MFIA 1QVFR 3QQCD 4DR1J 3GB0A 4HDHA 4LF5F 1SQFA 2RRBA 2WVFA 2MQOA 1HBOA 3B6BA 4G6VB 1YZ6A 4DFJA 1TU0B 1R0AA 3ZO7A 2W2QP 1N6QA 3BV8A 1MG7A 2PFDA 2ZDPA 2V94A 5A6WA 2KB2A 3HF5A 3A8IA 3CPWR 4WZMA 1JJHA 4DN0A 5CD4A 2F3JA 3GJRB 3NCRA 2V8GA 2HGMA 4ZN1A 1PO6A 3AXMA 3CJ5A 1F2GA 4BBYA 2GVDB 4GRSA 3P3DA 2LDIA 1V3RA 4QU6A 4C7QA 3BBFA 4V19X 2P8IA 4DFKA 4CNZA 1LWFB 3GV7B 1LOUA 4TNOA 3KLIA 4DPXA 1ROFA 5EX3A 4IRKA 4X65F 4C0HA 1K47A 1HQUA 3BJYA 2VDIA 2RUGA 3UN2A 2RQ4A 1LWCB 3HSZA 1BQNA 3EX7B 5BYSA 2MKIA 3WZ0A 2N7CA 2YNIA 1FDAA 1RE1B 2LFVA 3EGZA 5F9NA 2C2RA 3DLJA 2DIVA 1VC0A 1U0HB 1T03A 3BQ2A 3M2RB 5HBMA 4DF8A 3PYGA 4EO8A 4ZCKA 3PX4A 4EYIB 2CPHA 3GILA 4FF1A 3UD5A 1VQ8S 4Q2MA 3N5FA 2PD1A 4ICLA 3C19A 3R97A 1S57A 2BJ7A 1LW0A 3R2DJ 4ETXA 5I42B 1HNXJ 2PMWA 3HZEA 2ZUGA 1X60A 1F5CA 2KFZA 3K0JA 1U49A 1SL1A 1W25A 2X51A 2V63A 1K1QA 1UEUA 3CD0A 2VV5A 3KK2B 3M1VB 2WB4A 3C15A 4BLGA 3SI8A 2MZRA 4CCHA 2HHXA 4H54A 1RTIA 3SIPB 4PWDB 3A13A 5I3UA 5KFRA 1HBUB 4OMFG 2W9BB 2JSXA 4NPOA 4DV6F 1FDNA 5HQMA 1P8GA 3CCLS 3CCTA 1NHKL 3AXKA 3MM5A 2B9WA 4NA1A 4DG1B 2DGUA 5KG5A 4KTQA 1IM6A 2HZCA 3KYLA 2XY5A 4JI3F 1UWBA 2YKOA 1FRMA 3GONA 5L8RC 4N5SA 1NSQA 1R6YA 1RTZA 4C2MA 4KHRA 2HHUA 3H7HB 2OPRB 5KG6A 1AFIA 4HYKA 4NXNJ 3IWXA 4F4AA 2CDRB 4O3RA 2XMWA 5DRKA 3D9BA 2XWYA 1RTJB 2MLXA 4C8LA 4OFZA 3OFFA 1IKXB 1DTTA 2RIJA 3H59A 5MAOA 3DDIA 2CIMA 3QWPA 4NLOA 2FZKB 4ZLNA 1NMEB 3EXYA 3KUHA 5F3ZA 1JJ2R 1RHRB 4FS2A 2VG6B 4NCGB 2ASJA 3PYEA 1DZ5A 1GX6A 3X1LB 1HBNB 2PI4A 2EFVA 2W24A 5KFEA 1YLXA 3CJ4A 5IS2A 1ULRA 7FD1A 3K2YA 3MOJB 1OYDA 2YTCA 4IH7A 3PW2A 2YXLA 4J90A 1IKXA 5D0RA 3GU0A 2YKNB 3SXLA 2W1BA 5EX0A 1DQ8A 1AA1B 2K7JA 1TK8A 3HVRA 5LMUF 4DUYJ 4MK7A 4NA3A 2D3UA 2BZ2A 2GV1A 3U27A 4NCGA 4OZNA 1EQ0A 3QBCA 4Q44A 4I2QA 5F8IA 4DV7J 2OEJA 1C4CA 3O44A 1S9EA 2QRRA 1KLMB 1VHFA 2R2SA 1AZSB 1TQLA 1N34F 1XMQJ 3NS7B 4LUBA 3Q8UA 2F8MA 4DPUA 4L3NA 3NY0A 3IAM9 1VRTA 4QYRA 2RT3A 2QL9B 3IR6B 3OXGA 3ZTSA 3GE9A 4F0HA 4R5PB 3M6VA 2OPSB 3PW0A 3IG1B 5ETSA 1Q8LA 4IG3B 1G2EA 2MJUA 3I9V9 2ZDOA 3M8SA 4NLYA 4DQSA 3FBBA 1RADB 3HX9A 3KLEA 2BQ3A 4P7TA 4NXMJ 1AW0A 3AB2B 1IUJA 3ZNJ1 3KK1B 1RAAB 5RUBA 3FSIA 3ZC4A 4BC7A 3AOCA 1T05A 5CYJA 4AXIA 2FJAB 2JC1A 2O01C 2BEFA 3E8OA 5M2RA 3CJ8A 3FRZA 1IBMJ 1WOOA 1PJ7A 1ZETA 3A3OB 1LFPA 3NLCA 1FRXA 4ZVHA 3N0VA 1RTDA 3LOUA 4M5NA 4R25A 2BXJA 2MKYA 2PFFB 1TZ0A 2ZHOA 2WB1D 3FMWA 2HZVA 2CQGA 1B70B 1CVJA 1WSRA 4IDKB 1VQOS 2OLWA 2N7YA 1EETA 3FGVA 1GK8A 2MQMA 4NZ0A 4DSLA 4CLLA 4DZDA 2Z0GA 2QT7A 3D0IE 3IMQJ 4N77A 4K2XA 4NOHA 5C2CA 4X4QA 4LFAJ 2AJFE 3EYZA 4M5MA 1FKPB 2VG7A 1TL3A 4YDDB 2AYBA 4RBVA 1PJ5A 3LGNA 2MZJA 2WVBA 2UUAJ 3N6NA 3I4HX 4X4OA 1JNZB 1VLYA 3O5TB 3BYRA 4FZVA 1RAEB 4X66F 3IM8A 1Q95G 3W64A 4NLVA 1NJIT 1JLFA 4IR9A 4QIWD 2MHEA 4PYDA 4NLDA 2ABYA 5E41A 2HFNA 3EGWB 4OYIA 1GEHA 1OQ3A 5EWGA 1S6UA 1NM2A 4I6YA 1IBKF 1N36F 2FVCA 4M5JA 2HFSA 4WJBA 2ZVSA 1FKPA 2OTJS 3MR2A 3R5DA 2AF6A 1XBWA 1BC6A 2R8HA 2FJDB 3U1LA 1T94A 3GTYX 2JVOA 2XNRA 1CJUA 2HBQB 5B7WA 3CJKB 1ZM4A 1Y7PA 1QTNB 3VAJA 4Y6IA 4RUHA 1U1OA 3MR5A 2PMZD 2HFUA 1S4EA 4TY8B 2VQEJ 3HJFA 3T5JA 1CJKB 2NZCA 4GKKF 4K8RA 3DGPA 4G1QA 3MD3A 3HHKA 5CA5A 1S1VA 4QU7A 4M5GA 3M4XA 3TUIC 1KVJA 1VJQA 3GWCA 1HD1A 3SZ2A 3TR5A 4CO1A 4PABA 3J7A1 2DB1A 4Y65A 5GMEA 4CRJA 1RAGB 4B08A 3UR3C 1S0MA 4NLSA 1BQMA 4LQ9A 5J2MB 3TRGA 1JNRB 3D6FB 2KKHA 4LFCF 3VWSA 4C98A 1FE0A 3SQOP 1JKHB 2RHQB 5L38A 3PX6A 1D09B 1RWVB 1VBXA 1Q79A 4J9OA 3GYXB 3D6MB 4I0WA 2K3IA 1KBRA 3BREA 2LDYA 3NL0A 4CO3A 1FEHA 2V8VA 5ETVA 2EFPA 4I56A 4YY3F 3L4BC 1WKJA 3E01A 3G9CA 4K4VA 4CYUA 2D74B 4F4YA 3OW2R 1VK3A 1S0OA 3I55S 2CPEA 3EVOA 5B0GA 4W4MA 1UZHA 2FUG9 3M6UA 3UVJA 1VBZA 2E5LF 4KGMA 4XK8C 3TYTA 3H90A 3OHAA 4EWTA 2R3VA 3M8QB 4DR1F 1WDTA 4XTTA 3W66A 3QAEA 1S1UB 1S49A 2BRLA 2CQIA 2QFIA 1SQEA 5K14B 1FTCA 4TVAB 3N28A 4KPYA 4CWBA 2CQ0A 2DNZA 3L7UA 2VJUA 1HFEL 1H98A 3PEJA 3OFGA 3D28A 5J2QB 2OFHX 2XBPA 1RWXB 5IZHA 3UNGC 5KG2A 2AJ2A 3NRBA 2MJNA 2MB0B 1NUEA 1HYSA 1YHQS 2K1RA 3OL8A 2W2NP 4FS1A 3M8RA 1CJVB 2ZH4A 2LA6A 1F2HA 2VH7A 2POKA 2XLKA 4WKRA 1IR0A 4F2SA 3HHEA 4ED6A 3K8VA 2DH9A 5KFKA 3TVZA 2BE2B 4A47A 4ATNA 3H98A 5ETLA 2UP1A 2ZZNA 3NS6A 4ELUA 7FDRA 4LRAA 3TUZC 4GO5X 4I7FB 2VASA 3PTWA 1QD1A 3R6GB 3MPWA 5DDOC 3FRYA 1HI0P 2QA2A 3MEKA 4OI1A 2FGCA 1RWPB 2FD2A 3I56S 5D4NA 1RLDA 1CJTA 2LQBA 4LF7J 1VGYA 3M2UA 5A8KB 2QLFB 4U9RA 1I1GA 3SDEB 4ZPVR 2AIRB 1YRTA 4GVLA 4Q5VA 1D9DA 1HPZA 1K0TA 1KRPA 4DJBA 2BE2A 3FDSA 3RR7A 3A8KA 1FJ7A 1Q82T 2PT0A 3D6HB 1REVB 1Y9OA 2RU3A 2Z30B 2FIUA 4ZVFA 1IWGA 1HNXF 1S0VA 3JSRA 4I7FA 1Q8IA 1K8AT 3M9MB 2IRXA 5C2GA 3OTCA 2KTQA 1YKWA 2V2KA 3HHLB 4UF4A 4UW2A 1JXVA 5B09A 3BO4A 2HAFA 2XHWA 3BS9A 3T5LA 2F8HA 1Q7LB 5L1KA 2NXEA 4N8NA 3QGIA 3D54A 3SDEA 4ENOA 3TARA 3FEXB 3NOGA 3C6TB 2W8KA 4KT0C 1TKXB 3GYNA 4MKVA 2WBRA 2QA1A 1ZA1B 1PYTA 4L75A 2RS8A 1NJWA 1SL2A 2ZH8A 4RW9B 3O6QA 3R7SB 1LWEA 2R7QA 2PIIA 3DU6A 4DSJA 4KQZA 3HVAA 2XSFA 2G0JA 3D3BJ 1XR7A 4DL4A 1MSWD 1BWVA 5HVGA 3V6DB 3MTKA 4IKAA 2BRKA 4NXNF 4DL5A 1N5YB 5CH7B 1R6VA 1OQ6A 4CLTA 4WE1A 2VG5B 4PYAA 2FJVA 4HDGA 1LEOA 1XNQF 3IGVA 3FCVA 1TKXA 4F25A 2HBZB 1X4AA 3DM2A 2JOQA 2FLNA 4F2RA 4RW9A 3W5YA 1RWKB 2DHGA 2UXCJ 2YQ3A 4DX5A 3RR8A 3AA8A 1ACMB 3Q23A 4A8XA 5KTQA 2HFZA 2KVIA 2WSEC 1RB0A 2HHWA 1RWMB 4RUAA 3MR3A 3ZTOA 4NYZA 1FX2A 2HLUA 2IM1A 3R8YA 1FO1A 3VZHA 2MKJA 1MWZA 3MFHA 2OMLA 3TJ8A 1N5YA 2LP4A 3QYYA 1YWXA 5J2PB 4ECVA 5CAAA 1LXJA 3DMJB 2KL8A 1CBKA 2SXLA 2OTLS 2QZ8A 2CAJA 3PRBA 5F41A 3Q24A 4OLOA 2YBVA 1UVJA 4UY85 4IQXA 1SPBP 5L9XA 3BGFA 4WKYA 2OKQA 3CJSA 2M52A 3JAMY 4DUYF 2JLGA 2NSCA 3K58A 2XS7A 1ZM9A 5JUMA 1S12A 1TL7B 4USVA 1X4BA 3AJ2A 1IKYA 1UMJA 1FRLA 3HP6A 4LF8J 5IXUA 4FXWA 2W9AA 3FJ2A 2HBRB 1U6BA 4CZCA 1XMBA 4WK3A 3W2WB 3CB4A 2BQUA 4DPYA 3GJQB 2C2EA 2Y1JA 1DY3A 4EEYA 4B9LA 5AXLA 4L73A 6AT1B 3S01A 5AXKA 3MMCB 1WSVA 3US5A 4PXDA 2IIHA 4NXMF 4DQQA 2QMWA 4I6WA 4EUVA 1DAXA 1L5UA 2A2DA 5HI7A 2G0IA 1FDDA 3HVTB 2DEJA 4J91A 2MKCA 3BSAA 3WIUA 1IBMF 1ZBTA 2CQ3A 3V6KA 4CDIA 5CYQA 1QLNA 4JP8A 3OR2A 5BYRA 1D0EA 3DRRA 3LP1A 4ES1A 1KN6A 2AEJA 2V9KA 3GFZA 5KAKA 2J76E 5EHHA 2LQ5A 2B5JA 1TR0A 1Y00A 1K1SA 1G4CA 3NGUA 1TUWA 3FEZA 3GLJA 2DR6A 1URRA 5KFQA 1GXLA 2CPFA 1SC6A 4CO0A 4C9DA 3HSDA 2L48A 2ZZMA 1YG0A 3OR1B 2WVCA 5KFYA 3I31A 4LFAF 2YKMB 5EDWA 4AXJA 3LPYA 3NCQA 2UUAF 1LK7A 4IOCQ 4PQAA 2GIRA 1EP4B 5E3QA 3IAS9 1WC6A 4YB6A 3DDNA 5F3TA 3KJVA 1VK8A 3HHLD 1WOPA 2W4DA 4OI6A 1BQXA 4DN9A 1HMVA 2ZWPA 4X4RA 4LF6J 1ZPVA 3A8EA 4USHA 3KG4A 3MM7A 1VOMA 3GJSB 2GIQA 4F04B 1CULB 1SIZA 2EKNA 1SI9A 3SMZA 3K89A 1RHJB 3QLHA 3OR1A 2G4BA 1WJ9A 2XO7A 1TMMA 1N54B 1VDHA 4WCEQ 3UWTA 4ZCMA 3I5AA 3D0HE 3HPOA 4DPWA 2BJ1A 3DLEA 3PR4A 2F63A 1J5OB 1UFWA 2CJXB 1EP4A 4QWAA 1Y11A 4IFVA 2GQ2A 2V68A 2I0XA 4CT8A 2CWXA 2FC9A 3ZZZA 2F7VA 2C3OA 1VQNS 2WW8A 2IC3A 1UPMB 4J9LA 4X64J 2YNFB 2H5IB 5DM6Q 1FNXH 3IRWP 2UVUA 5D0HA 3I32A 3L7PA 1IWAA 3MMBB 2XNQA 5T7LB 3HFVA 5F8LA 4KIAA 4DF4A 4CLPA 2H4WB 1H7WA 4RLEA 4O23A 3FSXA 4IG0A 3DXSX 5F8GA 4ZP7A 3ZFVA 3S6EA 1ZM2A 2E1PA 2WRMA 4QQBA 2DEIA 2IAJA 2GO8A 4ECXA 4OYBA 2XSJB 3JB9k 1YJWS 2W7OA 5AE2A 4RW4B 4AT1B 1GTEA 2KM8C 1H3DA 3UE2A 3OTDA 1JLCB 1E6VB 1RBLA 3J81Y 4GO7X 1P6TA 2Z56B 7AT1B 2MZQA 3VAFA 1WG4A 3PY8A 5B0CA 4ZVOB 3G2XA 4NI2A 4RW6B 2PEBA 2DK2A 5T7LA 1S5ZA 3MAQA 3OUYB 4DQRA 4CO2A 3MEDA 1HARA 1T9UA 4IFYB 4WFAQ 1XIQA 4YB7A 4RWWA 4USIA 4OYMA 4C6AA 3UI3A 5JJBA 4RL1A 1KFSA 5M2UA 1RZMA 5C24A 2OP5A 4DL3A 1JLCA 3T6JA 3H2VE 5IT9Y 2MLYA 2L41A 3L09A 3A12A 1E6VA 1HWJA 2XMKA 2RKIB 3OFEA 4B3TJ 1R27B 1M5KC 3V4MA 1GTHA 4LF2A 1RQ0A 4YDXA 3N6LA 1T02A 1PILA 2HK2A 5L9NA 2FLPA 4NLTA 5DGBA 2HQ3A 3HULA 4HHHA 1VCTA 1F6TA 3TUJC 1S1TB 3H4DA 3F56A 1YJ9S 2R7OA 5KFXA 1SJ1A 4PAAA 5GMKa 5U47A 3EDRB 1VIXA 3HMJG 5K9FA 4E2FB 2PGCA 4YR3A 3CVKA 3QT8A 3ENVA 1R8AA 1WF0A 4U7UK 3RBDA 1S9FA 4P2SA 4DR2J 2Y9HA 3LQVA 3CMAS 2GAGC 1YTYA 3JAMU 2WK4A 3CCMS 2N3LA 4LF7F 2RF2B 3T6BA 2YKAA 3PNIA 4K0KJ 1NBEB 2QX0A 1WC0A 1M1KT 2HK3A 4BS2A 1P1TA 2HVDA 4HTJA 1XR5A 3BR8A 4HHUA 1X5TA 4ECWA 2GVZA 2NZ4A 4YMEA 3WDOA 3HXMA 2GGPB 1UVIA 2M8DB 3I0RB 9RUBA 1NDCA 3IA0A 1CLFA 3H5YA 2V4JA 3S7RA 2UVRA 1RKIA 4R0JA 1BUXA 1S1WB 3DRSB 2FLLA 1DRZA 2B51A 2HWHA 4RUBA 3WC2A 4WFBQ 3JQKA 1LFWA 1TP7A 4LT6A 2FHKA 2R2UA 3LPEA 2X7IA 3MM8B 4KV8B 3ZZUA 5DETA 4DX6A 5IM0B 2CJYB 1FT8A 1M1GA 1WI8A 1D9FA 2A10A 3C6UA 1OMSA 3C16B 3DOMB 6FDRA 2UUWA 1YJRA 3M8PA 2FVSA 1U1RA 2ZE2B 2ZWOA 3W3SA 3C66A 4IRDA 3M9NB 1TV6A 3WQPA 2LYVA 1S7HA 2RHSB 2HG4A 1KQKA 1D3WA 3M8ZA 5SUHA 3WX8A 5EUHA 1MN9A 1RT3B 2K2PA 3BM7A 3P6YC 1OO0B 4ZVEA 3E3XA 1FRIA 1JLAB 3TEHB 4KRWA 4KV8A 2ZFHA 4PG8A 4FP9A 3MMAB 3O1LA 5LXYA 5C25B 2ZKUA 2BMBA 3PKYA 1B99A 3W63A 2K06A 5F8MA 2WVDA 4CQ1A 3DOMA 2KRRA 5GADU 3CMES 4URQU 2XMTA 4ZDNA 2G0CA 2UXCF 2E7WA 5CZXA 1H2VZ 1R8BA 2AJ4A 3HM9A 2HQDA 2IJRA 2NXJA 8RUCA 1KQFB 1H2UX 2DTJA 4A8YA 4NLQA 2I5JA 2MPUA 4QYZJ 1WHXA 4L3KA 4ZCLA 4GVBA 2WZ1A 2F4FA 4X4PA 2ZC4A 1E6YA 4ZPWR 1CSJA 4EFAC 3Q8RB 4ERDA 2BE9B 3HSGA 1IN0A 5KG0A 2UUCJ 3BO2A 4EYHB 1XN9A 2DIUA 1HA1A 4DUZJ 1PJ6A 2LVWA 2DCLA 4WU3A 2EPIA 3VV2B 4Q0BB 3RU0A 2YH1A 4C11A 1TFWA 1F5AA 1KONA 5CQGA 1IR2A 5KFGA 2MQQA 5EWEA 4O3QA 5E2QA 1HBMB 4ECRA 3RB3A 2NXCA 2R2RA 2HWIA 4ANCA 4J37A 4LF8F 4NMXA 5DZ7A 3KG0A 1U2RA 1AXQA 2DITA 1ZOTA 2IY5B 3Q8QB 3KLFB 1FA0A 4JV0A 4TQRA 2HQIA 5FIIA 3D68A 2IMOA 1C1BA 2DPIA 4J9NA 5ETMA 4C48A 5CXTA 2RRNA 4UOHA 2AEMA 3VQSA 5CYMB 4A8OA 4Z37A 2LLZA 1UL3A 3T41A 3LGMA 5GAEU 4YQWA 1R31A 3KLGB 2LEBA 4WTYA 3G6XA 4OX7A 5LSLA 4EU0A 4TYAA 2ZH9A 1C1CB 3J81U 1HHTP 1UA0A 1XTZA 3EXCX 1O51A 1IM4A 2GC8A 1MROA 2FVPA 1TUVA 3KTQA 2RILA 1IBLJ 5F9LA 1HWKA 3CT9A 1YK9A 1FFGB 3PW4A 4DS4A 1S9GB 4HR2A 2JC0A 4MFBB 3UD4P 3VCDA 4ED2A 1ELOA 3B4MA 3A4TA 3CC4S 3OTOJ 4R8UB 1FCAA 3I0SB 3DLGB 5F0UA 4W92B 3UN3A 1KSPA 4CM2A 2CQCA 2HHPA 3KHRA 3TVKA 2AD9A 2QMXA 4KHMA 2BJ9A 3AFGA 4PUOB 1SB6A 2CJQA 2BA9A 2DR5A 2Q3PA 4YS2A 2KYXA 2FVRA 2ATCB 1FESA 3DKDA 1JXLA 2JEFA 2I2YA 3UDVA 1V3ZA 3SCIE 1B0TA 5KOXA 3W8PA 3DHWC 4ZVTB 2HPUA 5FLXY 2J0XA 2XMVA 2MGZB 2CQ2A 3MM9B 4YHHF 1IKWB 1QAYA 2V2VA 1QAIA 3PW7A 1NKCA 4LF6F 1S79A 2F1FA 3RAQA 4ZP9A 2F9DA 3QT6A 2ZEJA 2MHNA 5E33A 1SJ3P 1S76D 2VL1A 3TWZA 3VZIA 5HMZA 4K2JA 1UAWA 4PUOA 3OHBA 3CCSS 1XQIA 1A9NB 2J0QD 2R7UA 3M6XA 4XDCA 2LU2A 2KYZA 3R5BA 3OPKA 2EG2A 2V4RA 4LBHA 3GCXP 3B78A 3LAMA 1FX4A 4OHZA 1JB0C 4NA2A 4B3OA 2B6AA 2Y1RI 3KUGA 3NAHA 5A8RA 4CH0S 4KB7A 1S1XB 5KFFA 2OMOA 2IVMA 2MGZA 2ZBIA 2VHGA 1HL6A 3KHHA 2H1YA 4P2XA 3W5ZA 2C1EB 4X64F 4ES3A 2D3OR 2KG1A 3PVXA 4CT9A 2FJWA 2Q79A 3RUBL 1VLOA 1Z2ZA 1S6QB 3ZTRA 1RWUA 4ZOSA 3HO1A 4A4JA 3ILJA 3EMTA 2Q43A 1UA1A 2VJVA 4WU2A 2DHSA 4H4MB 4XDDA 4ED1A 1FRJA 2MQ8A 1Y5NB 3SSQA 1JLBA 3MXHP 2GZOA 3LWMA 2E5GA 4PR6A 4RBUA 3PO4A 1RJJA 1UW9A 1X0FA 2KFNA 2LA4A 4LSNB 5H9FJ 2ATLA 3RRHA 4C3KA 4IH6A 3SQGB 1K0VA 2D9OA 3MD1A 3RG6A 1G6BA 2HLTA 5DLGA 4IO1A 1UVLA 1J5EJ 2R9LA 2J7UA 4LVNP 3TZWA 3RW7A 3QGPA 3EWGA 3JXOA 2P2CB 3IFEA 5KFSA 1X9MA 1W7WA 2JZ5A 3LP0B 4C8OA 3S8SA 1SUQB 3K17A 5J1EB 2KM8B 2GJFA 3TAPA 5A8WA 2QMUB 2FC8A 5D6GA 2MYFA 5G0RB 1U2CA 5DQHA 4B3TF 2FZGB 4PQUB 2H9ZA 3AB4B 4O44B 1FFSB 2UXDJ 3GQCA 1LW2B 5BJRA 4JBCA 4LSLB 1CS4A 2KO1A 1ZTWA 5ETQA 2H65B 1KNZA 4O3SA 3ET6B 4O3NA 3UO0A 3UQSA 1N5VA 1VYAA 1T8EA 5DQIA 1BGXT 1XMOF 1HW9A 2VBWA 2ZJRQ 4PXCA 1UEVA 3R7NB 2Y8YA 1B0VA 2KT3A 4G3IA 1REGX 4ID8A 2WAQD 1KQGB 4NRTA 1DFDA 3TAMB 1FJEB 2MDAA 4OIXA 4TU9A 2QC3A 4K5RA 1V9OA 2VQFJ 5GADI 5SZTA 3PJWA 1PGZA 2QEXS 4QWEA 1MMDA 3ZZPA 1UP1A 4DR2F 2Z58B 2W7AA 2LXUA 1YBAA 3B4DA 2EFOA 1IKVB 3DRPA 4O44A 5D0EA 3BDEA 3DDKA 4WIIA 1WKKA 3N01A 3D0GE 2ZH2A 4LSLA 2G2YA 2QLWA 3KKFA 4K0KF 3BN4A 1QM9A 2ZITA 3MTJA 5ETPA 4HKQA 5E0OA 2R8KA 5DQGA 3FCHA 1U24A 3NBPA 3PM9A 5HLFB 1MWQA 2M2BA 3FK4A 5DZ6A 3TUPA 4ZLPA 3EPGA 3TAMA 1HQEA 2V8HA 1TFYA 5E3PA 1Q4RA 3UNYA 1DBDA 4EMDA 1A6LA 4TQSA 1QE1B 1AUDA 3K5OA 4NYPA 2B9YA 2CJKA 1IKVA 1B4SA 3OL6A 5KFLA 2ZKTA 2ASDA 4JI7J 4M95A 2VDHA 1S0NA 3T1AA 1YJNS 3QGGA 1V6HA 4O4GA 1K9MT 2BYCA 2RH3A 5KG7A 4OYAA 2B7BB 3POTA 1JX4A 4M1KA 5B0EA 1F9HA 4HACA 3CNQP 3BPDA 3BQ0A 1RU1A 4WP3A 3IR7B 2WW4A 3T3FA 2GJ2A 1WF2A 4OX8A 4P52A 5GAEI 3DRXA 1U48A 3MEEB 3BYPA 4OZ5A 2FYXA 3FFIA 3M9OB 4NWBA 4KKOB 3BPSP 2V4QA 3G96A 1FNMA 3HT0A 2RDJA 2LU1A 2HQCA 4TYBA 3DOKB 2UV8G 3SV4A 2ZH5A 4OI4A 3UCGA 4PG5A 4U7CA 4FNIA 2WBMA 2FY1A 4I4BA 1D9AA 2QYGA 5ETTA 2VA3A 3DYAB 4AD6A 4P9SA 1YJ7A 4OZJA 3M05A 5LM7E 2YNGA 2MEWA 2GJIA 4FVCA 4RPFA 1SJRA 5I3QA 1S97A 4ZP6A 1MU2B 4JI5J 1KWMA 1X4FA 4LSZB 2P9EA 3TVYA 2YQ0A 4ZIWA 2AU0A 2KHCA 2HNZB 4LR8A 9ATCB 3HI9A 3UCZP 1U6ZA 4TN2A 5AJ3F 3G6ES 3OXFA 3CDEA 1N0UA 2OPQA 3PV8A 3T9ZA 2YWHA 2IDLA 2OD4A 4WWSA 2KJVA 4LRDA 3MR6A 4I2PB 1NDKA 2QGFB 3F44A 5H9EJ 2HFOA 1B64A 4FN5A 4USMA 3D4JA 4LIWA 2UUCF 4LBIA 4C0OC 1TL1B 4JYAJ 1ZZNA 2DNLA 5L46A 4DUZF 2NPFA 3MUVP 3CF5Q 2RJZA 2EI5A 3G82A 2ALYB 1O0PA 1ZZFA 1RT5A 2NXUA 3K5MA 3BSNA 5ETOA 2OH2A 2CPDA 4L74A 1MN7A 4DBQA 3JQMA 3BSCA 1WC1A 2VC1A 2IDEA 3IN5A 4LR9A 3H25A 3FEYB 3T1YJ 3D2WA 3CIZA 1GMWD 3FVYA 1RAHB 2ASYA 4KHPJ 4MYUA 2DNRA 1TVRA 3KJNB 4IQMA 2D69A 4I2PA 1FI4A 2EW9A 2DHXA 3JTOA 4FYVB 4ECYA 1JLQA 5IQQA 1HD0A 1S6PB 5ETNA 2KJWA 2OELA 4FXDA 4ECUA 2CPYA 1F9FA 2RVJA 3ZTQA 2V5HG 4ED5A 4USTA 2U2FA 2HQFA 4RR5A 1R0AB 2JFKA 3DLLQ 5FDLA 3EZ5A 2IYGA 4DR6F 3C3LA 2JLFA 5L1JA 2DBBA 1N4LA 2CG8A 2HAIA 1HLWA 3AOBA 4K59A 2J0SD 2IVYA 2B4OA 3GCWP 1IBLF 3RYLA 2E29A 4C3LA 1KR4A 4CH7A 1RTHA 2DY1A 4P72A 3HVWA 1FVSA 4JI2J 4X62J 3UFCX 2H51B 1CQMA 3NOCA 4Z7CA 2KT5A 4C8NA 5KFHA 1JIHA 3MF5A 4M5IA 1AROP 3R5JB 1S48A 2YKPA 4A8MP 2C2KB 1VJWA 3D1OA 1U25A 4CLZA 3KLIB 2C3UA 2XYPB 4NE9C 3T5HA 3AT1B 2D41A 3E2EA 3OTOF 1HR0J 3S1TA 5E3RA 1HQUB 1X9WA 3OJUA 5BYQA 3BDPA 4ED7A 2I9SA 1BQNB 4L76A 3R3TA 2F5GA 2VPXB 1LWXA 2YNIB 1N56A 2OI2A 3OQ2A 4QPTA 3PHEA 3GIKA 1NHUA 2ZD1A 2C2OB 1FNOA 3KMSA 4URSA 1T03B 5HBMB 2VFTA 4ZVUB 4J5OA 1X4HA 3TO8A 4GKJJ 1OIAA 1UTAA 2WTFA 4WTOB 4ICLB 1VQ7S 1O6XA 1LW0B 1T9WA 4JB8B 4IYQA 3IWNC 1FXLA 2AEFA 2AT1B 2R7WA 2ADCA 3CEDA 2B4VA 3ONQA 3T5KA 5KT4A 4CLKA 1NNDA 3H40A 4DR5J 3HHDA 3PW5A 5IV4A 3TZZA 2ROGA 3F73A 3QJJA 3PFEA 1SL0A 3Q8YA 4Y3CA 4U7UD 3K7RA 3MAAA 3PRDA 5D4OA 4PPZA 3IRXA 1URNA 1M5SA 3C15B 3C14A 3FCWA 1KOOA 4M5DB 3JQJA 3DLKA 2EK1A 5HMYA 1RTIB 2A6MA 2EBEA 3T1HJ 5D4LA 4OI2A 5I3UB 1QAXA 2V8DA 2VB6A 1VRUA 3M30B 5AXNA 1IJEB 1RAFB 3LTOA 1X0PA 2EXUA 3MM5B 1KVKA 2HZAA 4NEYA 3DU5A 5D77A 1UWBB 3KDOA 5KFVA 2W25A 1UETA 4YR2A 1EKSA 1U1NA 1NJZA 4FF3A 4ZHRA 4ZS6A 1VQ4S 2ZH7A 4E0DA 1M1HA 1BXNA 3DOLB 2ZJPQ 3K5NA 3MM6A 2E5JA 1ZAXA 5C42A 4WXOA 1QVGR 3K8WA 4M5DA 3TAQA 2H4YB 4OZ3A 1PYSB 1DTTB 4U96A 1FTRA 5BR8J 3CULA 1MWYA 3BBBA 3MWBA 3DLBA 2XCPA 1X9SA 2ILZA 4ECZA 3M30A 5H1SV 1UEKA 1X8DA 4QW8A 1O5JA 1FD2A 3FQLA 2XYGB 1DTQB 3D7SB 4QWCA 4B3RF 4RW7A 5JVHQ 4F7VA 2UV8A 2E1RA 2C28A 1PG5B 2IRYA 1H7XA 3FSYA 3SV3A 2DXDA 3JSMB 4CLWA 3VAHA 3DOLA 3NAIA 5LXRA 1WACA 3W8GA 1YX2A 1DARA 4RWXA 1N5QA 2P5VA 1X4EA 1KQSR 3ZZOA 4ED3A 4C8KA 5DDPC 2CPZA 1DHMA 2R8IA 4ETZA 1HNWJ 4KC5A 3SFGA 1DTQA 1VC5A 4I2QB 2HIQA 1ZAVA 1LQ9A 2QSWA 2FTRA 1S9EB 3M32A 2UXDF 4IRCA 3J80U 3FBFA 4B9UA 5IV3A 4HI1A 2OEKA 4I69A 4QR2A 1QUPA 3JSMA 2V67A 3RJMB 3CO0P 1MW7A 3CCUS 2CZ9A 2I8EA 1VRTB 4ID5B 1WEXA 3W2VA 4OI0A 1U7LA 5EWFA 2CJ9A 2FB0A 2NUUG 1RISA 4DFMA 4PEOA 4WYWA 2ZZTA 4YUDA 2R4FA 4RNOA 3TANA 1VMBA 2VZ9A 2CPXA 1SKSA 1JJCB 2AGOA 2M7SA 2CVIA 2G1DA 2GHVC 3RBZA 2VQFF 4URGA 3KLEB 4FPIA 1RT7A 3NEKA 3IM9A 4PKDB 2NS1B 1WC3A 2G13A 3LUYA 1T05B 4IH5A 5D15A 3WIVA 3BB5A 4PWWA 5KT6A 3THPA 5GVQA 1EQMA 3QAUA 1WDDA 4ZPDA 1T9XA 2HMIA 1OSDA 1AB8A 1S4FA 1M5HA 1HI8A 1RT6A 4ID5A 1N8RT 2J5AA 1U8SA 4YOEA 3CJ0A 2WONA 1WEZA 1RTDB 3JSBA 3J7ZT 5KT5A 3V81A 2Q1LA 3ZZTA 3TP2A 3OD2A 3JSYA 4LBPA 5HROA 3CCZA 3KDNA 1EETB 4ELTA 2ZVIA 4CO5A 2B3TB 3CCJS 3HHNB 2DNGA 2VPZB 2K3KA 2LXFA 2DH7A 2DVIA 2F8EX 4A48A 2B0GA 4USUA 2WCXA 3V4IA 1BHNA 4PRFA 3BBCA 1KEKA 4LF9J 3DN9A 4JI7F 2X3GA 3CCWA 5HVFA 2VG7B 2ZOGA 4QPXA 4NRUA 4N76A 2RDDA 1BY9A 1TL3B 3CTRA 1MMNA 2UUBJ 2ERRA 3RZAA 3AOAA 2CQHA 1EHWA 1KHVA 3THVA 2XTJP 1YVFA 4Z2XA 3G87A 4TKTA 2XCAA 3OLBA 2J9EA 1JLFB 1U1MA 2AP6A 2PI5A 3CXCR 2M3DA 4RNNA 1NZAA 2DR8A 3OVSA 2CVEA 2FHJA 2ZC3A 4WFYA 1RYRA 4EGLA 5KG1A 4PG4A 2DNNA 4CLFA 4CIOA 2UUTA 1C0UB 1EX8A 5A0YA 4WK1A 4DUTA 2IBOA 1PAUB 3QRRA 4RX6A 5A2QU 1YITS 4Z7YA 4MIBA 2M5YA 1FXRA 1CJUB 4UY8T 3HFKA 3CDBA 3BH7B 2CKWA 4D3HA 2H5EA 3AHPA 1N52B 1EAYC 1SH3A 3PIPQ 3SCJE 2KXHA 5EGYA 4DV0J 3DGPB 4G1QB 3CSKA 1C0UA 3M2VA 1S1VB 2DPJA 3DI6A 2HQGA 3WBZA 1RBAA 1JK9B 3GSIA 2JJ4D 2JL9A 1VQMS 4YB5A 2ZH3A 4KY3A 5IC6B 2F65A 2YX1A 3ZZYA 3OV7A 2AX1A 2HS3A 3GIJA 1D8YA 1TKZA 2W2PP 1R7IA 1OWXA 2QLJB 1HNZJ 4EK2A 4JYAF 1BQMB 2E1CA 3I4PA 3BGRA 2RS2A 5DDQC 2AWZA 2BUNA 2Z2ZA 4OYPA 5L39A 1BD6A 1KLNA 2RQMA 2E7VA 3OLAA 3OL7A 2CWKA 2EC2A 2Q6BA 3ITHA 5CHCB 1G1XA 3ILOA 2D3O1 4K4SA 1T7PA 4CLYA 2N4CA 4DL7A 3T1YF 1GXTA 1C0TA 4ZPAA 1N33J 3E01B 4CLUA 3QRPA 3HD2A 4CYUB 4KHPF 1RI7A 1BMQB 4J9VA 1N48A 3D1HA 1WTFA 2RQKA 4HL9A 1DQ9A 1AT1B 2VOOA 2W01A 4AFFA 4UT4A 1RP5A 1VI7A 3UVJB 1CQNA 2OD6A 3W5XA 1T9TA 1MNEA 2WOMA 5LJ5Y 4U6PA 2VFRA 1JJ4A 3QGHA 4FXVA 1H38A 1FD8A 3PXGa 2MZTA 2XG8A 2DNMA 1WNEA 1NSKL 4Q8FA 2W7PA 3W62A 1SBRA 3H2LA 1HYSB 4RW8A 2K1RB 5DM7Q 3CDAA 4F3MA 1CC8A 4NLGA 4BHQA 4JI2F 4X62F 3GYGA 2BKOA 2NR0A 2LQ9A 3H5UA 4F8RA 1GXUA 4MH8A 2MY7A 1RT4A 3Q22A 4WXWA 1A7GE 3KFWX 2BOAA 3G71S 3W9HA 1OPZA 2R2TA 3L7OA 1RWNB 2X3DA 1CJTB 3FQKA 1SJ4P 3M2UB 4WPAA 3DGVA 3MPVA 3P4UB 2XYHB 1F9EB 4QZVB 1UZDA 4TLQA 1RAIB 5J2NA 1FRHA 2FJXA 1TUGB 2DCUB 4WFZA 3QIPA 5KFPA 3IGNA 1TKTA 1HPZB 4GKJF 4X4NA 2CQ4A 2FHJD 3EZOA 4ZVPB 3AY0A 4F4XA 4H4KC
chains in the Genus database with same CATH topology
1XEZA 4C0BA 4FS2A 3LANA 2B9XA 3VQSA 5CYMB 2YNGB 1NHVA 4A8OA 2BJEA 2MSSA 4Z37A 2LLZA 2VG6B 4NCGB 2ASJA 1UL3A 4F67A 3VAMA 2PA3A 5DG8A 1DZ5A 3U02A 3MECA 1GX6A 1ZM3A 4JI1F 1Y3KA 2HRUA 3X1LB 1HBNB 1R8CA 3LGMA 5GAEU 2PI4A 2EFVA 5F8NA 2BDPA 2MQNA 4YQWA 4KFBA 1R31A 3KLGB 2LEBA 1D1UA 4WTYA 1HI1A 3G6XA 4OX7A 5LSLA 4EU0A 2W24A 2VBXA 5HMXA 1VFJA 5KFEA 4TYAA 2ZH9A 3V2UC 1UVNA 3CJ4A 5IS2A 5K8NA 1ULRA 3VALA 4DV1F 4GC6A 7FD1A 1Q53A 3K2YA 1C1CB 3MOJB 2YX4A 1HHTP 4Y2CA 4A46A 2B4PA 1XTZA 2XLIA 1VS3A 1UA0A 3DC2A 2HHSA 3EXCX 1O51A 1NKEA 2DNPA 2OPQB 1IM4A 2GC8A 2YTCA 2NPIA 1MROA 4IH7A 2VFSA 3UD3P 2ZHBA 3RW6A 5HP1A 3IS9A 3PW2A 4ZKAA 2FVPA 1TUVA 1FJCA 3KTQA 2RILA 2YNHA 2DJWA 5F9LA 1HWKA 3CT9A 4LF4F 3QO9B 1IKXA 3PW4A 5K8PA 1KTVA 5F8HA 4DS4A 1KFDA 1J5OA 2YKNB 3QPIA 4I67A 3QIDA 3SXLA 2AQ4A 1S9GB 5CZVA 5EX0A 2JC0A 2C42A 1DQ8A 2Y1IA 4MFBB 3UD4P 2AYEA 2K7JA 1TK8A 2Z8QA 4F4KA 2O1PA 1X4CA 1LWEB 2PN6A 3HVRA 3VCDA 5LMUF 4ED2A 4MK7A 1ELOA 4NA3A 3B4MA 3HDSA 1FF2A 2D3UA 2BZ2A 2GV1A 2XMMA 3TI0A 3U27A 4NCGA 4OZNA 3CC4S 4Q44A 3EGNA 4CNYA 4I2QA 2YNFA 4R8UB 5F8IA 1RT5B 4ELVA 4ED8A 1FCAA 1C4CA 3J80Y 4F26A 3I0SB 3O44A 1S9EA 2GFFA 1Y0HA 3DLGB 2QRRA 1KLMB 3HKWA 4OHYA 5F0UA 1HNVA 4W92B 1VHFA 2BABA 3MMBA 2R2SA 1KSPA 1TQLA 1N34F 2CQCA 2HHPA 1SH0A 2YY3A 3KWMA 4LUBA 3KHRA 4L6V3 4R0EA 2F8MA 3TVKA 2LQJA 4QIEA 4O3PA 2AD9A 2G9OA 2QMXA 4KHMA 1S72S 4DDFA 3KHLA 3PJXA 3X3UA 4PUOB 1SB6A 2CJQA 4L3NA 1WD6A 3IAM9 1VRTA 2BA9A 1ZTTA 4WE1B 4F4ZA 4QYRA 2RT3A 3IR6B 1YJUA 1APSA 2DR5A 2OAUA 1KD1T 2Q3PA 3OXGA 2KYXA 3OBIA 3C8YA 3GE9A 2FVRA 4R5PB 1FESA 3M6VA 1JXLA 2OPSB 2JEFA 4N41A 2GMHA 2BANA 2I2YA 1JLGA 1TVRB 3QO9A 3PW0A 4A8FA 3IG1B 2XZWA 2J9DE 1Q8LA 4IG3B 1V3ZA 2XSJA 4Y2MA 3TA0A 1HWLA 1G2EA 4RW4A 2MJUA 2VUGA 4ILLA 3I9V9 2ZDOA 3M8SA 3SCIE 1B0TA 5KOXA 3RRKA 3DHWC 4NLYA 5CCLA 1JLQB 3UPFA 1NH8A 3DM2B 3MUMP 1Y4ZB 2KN4A 3AA9A 4DQSA 2ADBA 3TNVA 4YP3A 5LSRA 2HPUA 5FLXY 2W9CA 4H4OA 3HX9A 3KLEA 2J0XA 2XMVA 1DJ0A 2MGZB 2CQ2A 3MM9B 4P7TA 2BQ3A 2NSBA 4ZP8A 1AW0A 3AB2B 1IUJA 4YHHF 5IFMA 1U1LA 1IKWB 3KK1B 1QAYA 2UXBF 4DV2F 1QAIA 3FSIA 2UZAA 2CPJA 3PW7A 1Q1KA 3ZC4A 4BC7A 1NKCA 4LF6F 1T05A 4Q45A 1S79A 2GNKA 5CYJA 2F1FA 3RAQA 1FK9A 4ZP9A 4RW6A 1NO8A 2F9DA 1IQTA 1KS2A 1WG1A 5FDLB 2IFXA 4AXIA 2FJAB 2JC1A 1D8ZA 3KK3A 2MHNA 2O01C 3CCQS 1LXNA 3OUYA 3E8OA 5M2RA 5E33A 1SJ3P 5HQ8A 2BR0A 2KZZA 1Z1ZA 3FRZA 2VL1A 3VZIA 1RA7A 1S76D 5E3AA 5HMZA 3BR9A 1ZETA 3PO5A 3OSPA 2HS4A 1LFPA 1UAWA 4PUOA 2VOPA 3OHBA 3CCSS 4IFYA 3VAIA 2HHVA 3NLCA 1FRXA 3NGKA 1RA6A 5B0AA 4ZVHA 4FF4A 2ZOFA 3TA1A 1VBYA 3N0VA 5B0DA 1A9NB 1RT2A 5AE3A 1DQAA 2J0QD 2R7UA 3M6XA 3LOUA 4XDCA 4DSFA 2PDAA 1RTDA 3OFHA 4DWIA 2Q66A 2LU2A 2WHOA 2KYZA 3R5BA 4R25A 3OPKA 2BXJA 1S6OA 2EG2A 5KFOA 2V4RA 1RTHB 3B78A 3LAMA 2K8GA 2PFFB 2JDJA 4OHZA 3H4BA 1TZ0A 2ZHOA 1JB0C 4NA2A 1I6JA 4B3OA 2B6AA 2WB1D 2Y1RI 3NNCA 3FMWA 1RK8A 4C3MA 1UVKA 4MK8A 3NAHA 2CQGA 1NEEA 5A8RA 2D1CA 1H6KX 4CH0S 4KB7A 2DO0A 2AYGA 1S1XB 5KFFA 2OMOA 1CVJA 2IVMA 2RKIA 4IDKB 2D3ZA 2MGZA 1HNWF 2ZBIA 1VQOS 2OLWA 2N7YA 1HL6A 1EETA 3KHHA 2L9NA 3FGVA 3MI7X 2J6TA 5FJ4A 2MQMA 4CTAB 4X64F 2K7KA 4NZ0A 4DSLA 4ES3A 2HS0A 2D3OR 4B9NA 2KG1A 2Z0GA 5B08A 2DISA 4OX9F 2QT7A 5LSOA 3PVXA 2HW3A 1IKYB 4CT9A 3D0IE 3J7YU 2J6SA 2FJWA 2Q79A 2DRBA 3ENQA 4N77A 4K2XA 4KO0A 1U09A 2A18A 4NOHA 1Z2ZA 4X4QA 2BJDA 4K4UA 1S6QB 2AJFE 2QFJA 3EYZA 1RWUA 2B4UA 4OHWA 4NCBA 4DSEA 4ZOSA 1S1TA 2B7CB 3HO1A 4QCLA 1FKPB 4PXEA 4A4JA 2VG7A 2L3MA 4HH1A 1TL3A 3GR1A 4QR0A 4DPOA 4YDDB 2AYBA 2ZD1B 4RBVA 3LGNA 2Q43A 2W4PA 1R43A 2MZJA 1GQEA 3N6NA 1SKWA 3BF4A 3I4HX 2R8JA 3TOQA 5DG7A 1UA1A 4X4OA 1JNZB 2DHSA 1VLYA 4WU2A 4H4MB 4XDDA 4M63A 1LKZA 3O5TB 4ED1A 1Q81T 4FZVA 1FRJA 4X66F 4OZLA 1H2TZ 1Y5NB 3AH6A 3H8YA 4NLVA 4QWDA 4RZRA 3SSQA 4DLGA 1W2BR 1NJIT 1JLFA 4IR9A 4QIWD 2J9CA 2DNKA 2MHEA 2O67A 3NKYA 1JLBA 3MXHP 2KI2A 4NLDA 5IT0A 3AAWB 1L3VA 2ABYA 1CEZA 3LWMA 2E5GA 2C3MA 4MK9A 4D3GA 5E41A 4PR6A 2M9KA 4TU7A 2HVHA 4NMLA 4RBUA 3N79A 1RJJA 3OTBA 3PO4A 2HFNA 1YRUA 1X0FA 2KFNA 1NJXA 2LA4A 1WHYA 3I96A 3EGWB 4CTAA 4LJMA 1F5BA 2JRSA 2GHPA 4I68A 4DV7F 3SCKE 2RF2A 1U45A 1OQ3A 3GIMA 4LSNB 5H9FJ 3JYTB 2ATLA 3M6WA 3VF0B 5EWGA 3RRHA 4C3KA 4IH6A 3SQGB 1PSDA 1S6UA 2D9OA 5A2QY 1K0VA 4NLUA 1XMQF 4I6YA 1TL5A 1IBKF 3MD1A 1N36F 2IMWP 2FVCA 1G6BA 2HLTA 3KNGA 3KG1A 4WJBA 3CUNA 5DLGA 1KC8T 2ZVSA 1FKPA 1YIJS 4IO1A 1UVLA 2OTJS 1G7CB 1Y3JA 1RKJA 4AL5A 3MR2A 3R5DA 1RGVA 2R9LA 2J7UA 2AF6A 3IRXB 1XBWA 5CYQB 5B0FA 4LVNP 4Y2KA 4Q43A 3RW7A 3OR2B 1BC6A 3QGPA 2R8HA 3DRRB 3LP1B 2FJDB 3U1LA 1T94A 1LV5A 4B9TA 2JVOA 1UJ5A 4GMKA 1XK8A 2XNRA 2C22A 3DLKB 3IFEA 5KFSA 2MZ1A 1X9MA 5B7WA 4UUWA 3CJKB 1ZM4A 1Y7PA 2GGPA 2JZ5A 3I0RA 3VAJA 3LP0B 2J6UA 4C8OA 3HHLC 2MY8A 4Y6IA 4RUHA 3S8SA 1U1OA 2MKKA 5KG3A 3MR5A 2GMJA 1SUQB 2PMZD 1WHVA 3RB4A 4DS5A 2B5JB 1VRUB 5J1EB 1S1WA 3DRSA 2EBGA 4TY8B 3IC1A 3HJFA 2KM8B 3T5JA 1QTMA 3TAPA 5A8WA 4GKKF 2FC8A 5D6GA 2MYFA 4Y2AA 5G0RB 3I5BA 5DQHA 1XERA 3DGPA 4G1QA 2KZMA 3MD3A 4K4YA 4B3TF 3HHKA 5CA5A 2H9ZA 2Q6CA 1S1VA 3AB4B 3CD5A 2UU9F 4PQUB 4QU7A 4O44B 3M4XA 4G1PA 3TUIC 1KVJA 2BOPA 3GQCA 1LW2B 2QYCA 3L95X 4JBCA 3GWCA 5BJRA 4XPEA 3JYTA 1HD1A 1U6FA 1IQZA 4LSLB 2EFGA 2VPWB 3TR5A 2KO1A 3SZ2A 1ZTWA 4CO1A 5DGAA 4NZ6A 1KNZA 4ZHRB 4O3SA 3J7A1 2FLOA 4O3NA 5CD4H 4Y34A 3MM8A 2DB1A 3UQSA 5LT5A 1U47A 1N5VA 4Y65A 1T8EA 5DQIA 3GIIA 1BGXT 5E7OB 1XMOF 4LF9F 1HW9A 2VBWA 2ZJRQ 1HWUA 2MKHA 4PXCA 1UEVA 3OTEA 3HK2A 4B08A 5IM0A 1B0VA 3UR3C 2VD3A 1I94F 2YWFA 2KT3A 3MM6B 2AJQA 3OXLA 1SH2A 1S0MA 5C42B 2CJAA 4G3IA 4ID8A 4NLSA 2WAQD 1BQMA 4LQ9A 2UUBF 1KQGB 5J2MB 1LWFA 2D9PA 4NRTA 3TRGA 1DFDA 1JNRB 4MIWA 2KKHA 4LFCF 3N6MA 3VWSA 3TAMB 4EBEA 4C98A 1FJEB 4FBUA 2ZE2A 2MDAA 1FE0A 4OIXA 4TU9A 4K5RA 1JKHB 4J9MA 3WC0A 2PSZA 3MOZA 5ITHA 3UR0A 5L38A 3PX6A 3KJVB 1V9OA 3G86A 5GADI 5SZTA 3PJWA 4BDPA 1U1KA 1PGZA 2QEXS 1VBXA 4QWEA 3MURP 1Q79A 1MMDA 3Q8PB 1LWCA 3ZZPA 1UP1A 4J9OA 1XWLA 4DR2F 3GYXB 4I0WA 1HMVB 2K3IA 1WG5A 3BREA 2LDYA 3NL0A 1QAJA 4CO3A 1FEHA 2W7AA 2LXUA 1YBAA 3B4DA 2V8VA 2EFOA 1IKVB 3MM7B 3DRPA 4O44A 3CC7S 2KH9A 3BDEA 4RW7B 3DDKA 4WIIA 2EFPA 4I56A 4YY3F 1RT3A 1R8HA 3N01A 1PC5A 2IYIA 2FHOB 3D0GE 2NUHA 4C4WA 2ZH2A 4LSLA 2QLWA 3QLHB 2XY6A 1C4AA 2AGPA 3M2RA 1JLAA 3E01A 3G9CA 4K4VA 4FYDA 3KKFA 1OSCA 5HMWA 4OHVA 1L3SA 4K0KF 2D74B 4F4YA 2C2DA 3BN4A 3OW2R 1VK3A 4ECTA 1QM9A 3MMAA 3RAMA 1S0OA 1GAOA 2ZITA 3MTJA 3I55S 2JHEA 3ZZ0A 2CPEA 5C25A 4HKQA 3KLHB 5E0OA 2R8KA 5B0GA 5DQGA 1X7VA 3FCHA 3ICLA 4DSKA 1U24A 2XS5A 3NBPA 3PM9A 2VFVA 2FUG9 3M6UA 1VBZA 2E5LF 5HLFB 5L1IA 4KGMA 2F4VF 2XB2D 1T3OA 4LMZA 4XK8C 3TYTA 2M2BA 3OHAA 3DLEB 2RE1A 4HEA9 1TK5A 4EWTA 4ZLPA 5I42A 4RU2A 5DJBA 3M8QB 4F02A 3EPGA 4DR1F 1NK8A 1JWWA 3TAMA 1HQEA 4JV2A 3QAEA 2V8HA 3K5LA 4IFVB 1S1UB 2QE5A 1S49A 1W2IA 2BRLA 1TFYA 5T41A 5E3PA 2JFDA 2CQIA 1Q4RA 4NLRA 1SQEA 5K14B 4JUZA 1FTCA 5F8JA 3N28A 5DS7A 4KPYA 1DBDA 3ZZRA 2CQ0A 4IOAQ 2DNZA 2VBYA 4OX6A 1QSSA 1A6LA 4TQSA 1CG2A 1HFEL 1H98A 1ZYQA 1QE1B 3PEJA 4NX9A 2IC3B 3OFGA 3D28A 4JI6F 4DV0F 3K5OA 2OFHX 5J2QB 4NYPA 1AUDA 4USJC 3V5RA 2B9YA 2XBPA 2CJKA 3BN7A 1IKVA 2AW0A 5LJ3Y 5IZHA 3UNGC 5DLFA 5KG2A 3OL6A 2YVSA 1Q7YT 3NRBA 3M32B 3BQ1A 2MJNA 2KXNB 3KK2A 2MB0B 3Q2TC 1HYSA 3M1VA 3QJLA 2M0GB 3IBWA 2GQQA 2DO4A 2K1RA 3R27A 3OL8A 5HO4A 1YHQS 5KFLA 2ZKTA 4FS1A 3M8RA 2ZH4A 2UVVA 2LA6A 2GHWA 2ASDA 1T3NA 4M95A 2PO4A 2VH7A 1S0NA 2POKA 3T1AA 2XLKA 1YJNS 3QGGA 4IG0B 4X84A 4WKRA 1V6HA 1IR0A 4O4GA 1K9MT 4F2SA 4PWDA 4U67Q 2BYCA 2RH3A 3VTIA 4DX8H 3HHEA 5KG7A 4ED6A 1RDRA 3K8VA 3PACA 3KLHA 2DH9A 1X4GA 1J5EF 5KFKA 3W2VB 2X1GA 3TVZA 1HNZF 2BE2B 1HBUA 3Q2SC 4A47A 1TAUA 2B7BB 3POTA 2W9BA 2IAJB 4ATNA 4DEZA 1NB7A 1JX4A 4M1KA 5B0EA 3H98A 1WTBA 2UP1A 2ZZNA 2QO3A 4ZVGA 4UQGA 1ZH5A 4CO4A 4KAIA 3NS6A 4Q0BA 4ELUA 7FDRA 2GCFA 2KT2A 4DG1A 1NK9A 2AGQA 3GFYA 4GO5X 3TUZC 3BQ0A 4I7FB 2VASA 3I82A 3MPWA 3IR7B 3T3FA 5DDOC 3FRYA 2GJ2A 1HI0P 3EPIA 1RT7B 1WF2A 4EZ9A 2QA2A 1HBMA 3MEKA 2GQCA 4OI1A 4XAKA 4OX8A 2FGCA 2VQEF 2L9WA 5GAEI 2OPRA 1BWEA 5CCMA 3DRXA 1U48A 2FD2A 3RB6A <