1I94F

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i94F00
4JI6F 4DV5F 1FJGF 1IBKF 2B7CB 4DV6F 2KJWA 2YY3A 1N34F 1G1XA 1J5EF 4JI4F 1IJEB 4X62F 4OX9F 2HHHF 2ZM6F 1FKAF 1CQMA 4X65F 4LF6F 4LF8F 1QJHA 3OTOF 4NXMF 4KHPF 3T1YF 4LF7F 4X64F 4DV3F 4LF9F 4LF5F 1XNQF 4B3SF 4B3MF 2RJZA 2E5LF 4JI0F 5LMNF 2UU9F 4JI8F 4JV5F 4DR1F 1XMQF 4DUZF 1HNXF 4JI2F 1IBLF 2F4VF 1RISA 2UXCF 4DV1F 1LOUA 4B3RF 1GH8A 4K0KF 1B64A 4B3TF 4LF4F 3T1HF 1N33F 2UUBF 5LMUF 5BR8F 4YHHF 2BVZA 4AQYF 5IWAF 4DR5F 2VQFF 4DR6F 2UUCF 1CQNA 4DUYF 1F60B 2KJVA 1HNWF 1IJFB 4DR4F 2J5AA 4YY3F 1VMBA 2BXJA 4LFCF 4JI7F 2UXBF 4JI5F 4DR2F 1HR0F 1IBMF 4X66F 3R3TA 5AJ3F 4DV7F 4LFBF 4DV0F 3ZZPA 4NXNF 4DV2F 4DV4F 4DR7F 1XNRF 1XMOF 4LFAF 2B7BB 2VQEF 1N36F 4JI1F 4JYAF 2UXDF 1N32F 1G7CB 4JI3F 4DR3F 2UUAF 1HNZF 4GKKF 4GKJF 1I94F
chains in the Genus database with same CATH superfamily
4IG0A 3ZNUA 3M6VA 4X2BA 3CO0P 3TVYA 4UQTA 4ZA1A 2RRBA 3OBIA 5A8KA 2ZM6F 3LWMA 5J2MA 3T3FA 5JVGQ 4WZQA 2AJ1A 3TZXA 4YB7A 1PC4A 3M4XA 4F0MA 5GADU 4LRCA 3QRQA 4LREA 1FDNA 1QAYA 2VG6A 2WVFA 2ZH4A 2W7AA 1R8PA 3E8OA 2ZBCA 4PQUB 5SUHA 2GIFA 4LRFA 2OSQA 2K06A 4A8SA 3GYXB 4DR4J 3VWSA 2F5GA 1Z4UA 1UETA 3TX8A 4CO1A 1RI7A 4ZLPA 4QZVB 2YNFA 2RU3A 1XN9A 3FJ2A 4HVZA 2KO1A 1GMWD 3MI7X 5HN0A 2LEPA 4M94A 4RJVA 2R2SA 1WDTA 3ILOA 3E01B 3ZNJ1 2EI5A 2V8HA 2XWYA 4ZPAA 3V6KA 4JI6F 5EN1A 1X4FA 2SXLA 3G9CA 3FBEA 3ET6B 4NWBA 2QLWA 2Z30B 6FDRA 4ANEA 1N5VA 4DUZJ 1ZM4A 1WTBA 4ZVGA 1Q53A 2IMWP 1GFWB 2XBPA 3LUYA 4I6WA 4ECUA 3KK1A 4USKA 5DETA 4NLRA 1BC6A 1IBCB 3GJTB 3ULHA 4QCLA 2Z4PA 2E9ZA 2A2CA 4NLQA 3QLHA 2V4JB 3HD1A 4Q43A 2LEBA 1VLYA 4IQXA 2DH9A 2QMXA 3KWMA 1S9EA 2F65A 2HVZA 3MM6A 2XI3A 1TK8A 2LU2A 1NB7A 4ZVSB 4DL4A 4IRDA 1P9YA 2CDQA 3SCKE 1JXEA 1Q7LB 4DV6F 3QSIA 1TKXB 1M5KC 4C2MA 1I5OB 3HHKA 2KG1A 1VBKA 3UD5A 2IA0A 4JI8J 2AV5A 3D54A 2CPIA 1O51A 1JQGA 1TELA 2OMOA 3C16A 2PI5A 5GAEU 4K0KJ 3M2UA 2J6TA 3SSQA 2DTJA 3BSAA 2AGPA 3EGWB 1N52B 2KRRA 4RW8A 1M5OC 5HVFA 2JEFA 2XMUA 5E3QA 4FF2A 5KFGA 1FRKA 2W8KA 3CJSA 2MKCA 3D7SB 4H4MB 1PG5B 3R5GA 1B4SA 2XWXA 3LAMA 5AJ3J 3ISNC 4P2MA 2GAGC 3BEGB 5IOLA 1S6OA 2H48B 2VG5A 3VTIA 2R7SA 4OJHA 4L74A 4NI2B 2MZQA 5T41A 1JLGA 2DRAA 4PCQA 2CQCA 2D3ZA 3OPKA 4O23A 4RW6B 5EWEA 2FJBB 4ED2A 1XEZA 4DR3J 4FYVB 2MGZB 5HMWA 2F9DA 1GXTA 1SUQB 1SJFA 1RT7B 2KVQE 1XERA 5JXSA 5A8RA 2YXLA 3HSGA 2DEIA 1TL3B 5D78A 4R25A 5HMXA 2RT3A 1X9SA 2KXHA 3IRXA 2Z0GA 4QWDA 5BR8J 1V3RA 3K57A 1N5SA 4DR6J 2W9BA 1FRMA 1RABB 3P4UB 1FCAA 4R0JA 3NCQA 2GJFA 1IR1A 2HNDA 3G6ES 4WFYA 3SV3A 2CRLA 1YKWA 1VMBA 1T3OA 1X31C 4OFZA 4O3OA 3C14A 1BQMA 3DGVA 3POTB 1QAJA 2UUAJ 5GMKa 1JKHA 2MQ8A 1S6QA 3HVTB 1CC7A 3W2WA 2CFXA 4IFYA 3UDLA 3VAFA 3VVTA 4TY9A 5J1EB 3VAIA 2K3KA 2MHNA 1A7GE 1NSKL 4USJC 4J9MA 4LF5J 1S9FA 4KE5A 1X4GA 2E29A 1UVMA 2B8QA 3H20A 1TUWA 3OD2A 2VKZG 2AW0A 2HHHJ 4U7UK 2G1HA 2DR9A 2WOMB 4MK7A 1S0MA 1VJQA 1IR0A 2IRXA 3IAM9 1JLAA 4HH1A 2JEJA 4WKRA 3NWRA 3TAMB 3SCIE 3I56S 4X4NA 2RIJA 1EKSA 3IR5B 4RW7A 2UUBF 1VHIA 3AOBA 2ZH9A 3GYNA 3TUJC 1WEZA 2PN6A 4WBFA 4CLPA 4DL0C 2HBZB 4RW4A 4XAKA 2NLWA 2QFIA 1VQ5S 3J7A1 5KFDA 4P74A 2ZEJA 3KYLA 1UJ4A 1WEXA 2HRYA 4QYRA 3NAHA 1TKZB 4GKKJ 3K2YA 5GAHU 3CCQS 4IOCQ 3CNQP 3X3UA 2FLPA 1YJTA 4TYAA 4HTIA 3IAS9 3PKYA 4FYYB 1NHKL 3LH2S 2BOPA 4OYMA 3LP2B 2R7QA 5A2QU 3SYZA 3BYRA 2ZVIA 2LXIA 2W01A 4KHMA 4X64F 4FVCA 3CCRS 1IKWA 4B3SF 1FXLA 3CD7A 3CDAA 2RH3A 1HNVA 1PAEX 5K14B 5ETLA 2VPWB 4OX6A 5KT5A 3ITHA 3IRWP 1YJRA 2OFGX 1RB0A 5DJBA 4TNOA 3T1HF 2OO4A 1H98A 4URGA 1ZETA 4USTA 2BANB 1PJ6A 4X4OA 5D4NA 2BJ3A 5D0GA 2VHGA 2RILA 2ROEA 4NMXA 3J7Z5 5IXUA 3RBDA 5IV3A 4ZHRB 1F9HA 4A8KA 1QLNA 3HULA 4LIRA 1D0EA 1FA0A 2HVEA 4YQWA 3CF5Q 2OTJS 1EETA 4AXJA 1N32F 3CD5A 4TVAB 3DU6A 4TKTA 2E66A 2QA4G 3OTOJ 4IQMA 3TARA 5J2QA 2P5VA 1PCAA 1S6PB 2OPSA 5ETKA 2FJDB 2XO7A 3LP0B 2Y3YA 3BO3A 5ETRA 4KFBA 4K4UA 2G1DA 3HCXA 1GT8A 5LJ5Y 4DR1F 2DD8S 4PWWA 3K5MA 1HW8A 2F1FA 1NBEB 3GIRA 3M8QA 2HFNA 1KEKA 3R27A 4J90A 2DCLA 2Y1LB 2OKQA 4C3MA 3PEJA 1WSVA 1BUXA 4MK9A 1J5OB 4A4JA 3A3OB 1APSA 4J9SA 2UUCF 3CDEA 1TTHB 3CCTA 4JB8B 2G0IA 4Y3CA 2KJVA 2FVQA 2J5AA 3RB6A 1IBMJ 3FEXB 2NREA 5IC6B 1X4HA 3CC4S 2JDJA 4JI5F 1U0HA 3BJYA 1CJKB 1U0SA 1LV5A 2C3PA 1O0PA 2RUGA 1WOPA 1N8RT 4LFAF 2XNRA 2AGOA 4C3KA 2M2BA 3BBCA 4ECXA 4LQ3A 5DM6Q 5KFPA 3ZXWA 3PJWA 3ENAA 1PJ7A 4NXMF 1T9WA 1NDPA 5C42B 3E2EA 3IFEA 1XNQF 1SJQA 2V69A 4FS2A 3H59A 3GONA 4NA3A 1UEKA 4WK1A 3KK2B 1FK9A 4I2QA 2WBRA 3MM9B 1HBUA 1ZS6A 1T03B 2D9OA 2B9YA 4MJKA 1M5HA 2EG2A 3GR1A 1FWKA 4P2XA 1QAXA 4AQYF 3RAXA 4Y2IA 4HT7A 3EGNA 1SC4B 4MAKA 3MCMA 1B3TA 5H9EK 1BLUA 1M0SA 1HNIB 2EC2A 4P10A 3EDQB 4WU2A 4L76A 3DDKA 2J0SD 4F4ZA 2VQEJ 3LGMA 4FKYA 3CMAS 1PYOB 1Y0HA 1NAQA 4P72A 4DX6A 2YNIA 2ZH2A 3CSKA 2XM3A 2K7JA 1T9UA 3DRRA 4WFZA 2C2KB 4DUTA 1L3UA 3AD9C 2VPZB 1A0OB 3JYTB 3Q83A 3VR1A 2BKPA 4O3QA 4FBTA 4KY3A 4UZCA 2ADBA 2A18A 5HJYA 2FB0A 1JLBB 3GV8B 3QFWA 1R0BG 4W4MA 3CO9A 2OJ3A 1F3VA 4O3SA 2VDIA 4MKYA 4QWAA 4TU8A 4CO3A 2GJ2A 2V34A 1HNWJ 1RLCL 4OYIA 5CAAA 1V3ZA 1NK4A 4ERDA 3G87A 1DZ5A 2LQ9A 2EW9A 1TFWA 5I3UB 2A6OA 3KLHB 5F8LA 4RU2A 3GG1A 5E5NA 4WE1A 1UA1A 2QX0A 1VGYA 1EJ7L 1JIHA 4DQIA 3PIPQ 3D6FB 3RBEA 3HO1A 1I51B 4LJMA 1J27A 1AW0A 1JLFA 3ZTPA 1KTQA 2EFPA 2F7VA 3NLCA 1BQNA 1X7VA 1CBKA 4TQRA 1NKBA 3BKTA 4Q0BB 2C3OA 4ED7A 1VOMA 3DFEA 4OHYA 2N4CA 4CRJA 3FSIA 2M88A 2DK2A 2P6TA 4HDGA 5GADI 4M63A 4LRBA 1M1GA 2P9CA 2OP5A 3A13A 4F3QA 2UXCF 3ZZUA 3CJ0A 1HW9A 3SBMA 7FDRA 4PXBA 2KDOA 4USVA 1X8DA 5G0RA 3B82A 1PBUA 2ILYA 4JBCA 1VQMS 1HR0J 2L08A 3NXZA 3J81j 4LT6A 3QT7A 3OTCA 4CLWA 1MW7A 3OFEA 5L1KA 1H7XA 4I4BA 4ZLNA 3HLUA 1WWHA 2AEJA 5HATA 1TMJA 2BMBA 4CZCA 4ELVA 1I94F 1TQLA 4M5DA 1UTAA 3OSNA 3JTPA 2W2MP 2C2DA 4KO0B 3BSCA 3R9LA 1QD1A 1UVLA 2C3MA 1JMTA 3HI9A 1XMBA 4M5KA 2LEAA 4MTPA 2WAQD 3W5XA 3OVBA 3U1LA 5HANA 2K7KA 4CT9A 2V9WA 4PYDA 3IC1A 4L3KA 2XYPB 2HMIA 2MYFA 2COLA 2CPXA 1KFDA 2BE2B 3FCHA 4DZDA 3GV5B 4WJBA 4KB7A 3K0JA 1MWYA 1Q82T 2WVCA 4C8ZA 4JI7F 3H7HB 1XNRJ 5KFVA 2QA1A 4ETXA 4C3LA 3UR0A 3W66A 3FCVA 3NGUA 4M5LA 4DV5J 5KG1A 4ENOA 2W1BA 3MHYA 2CDRB 2GS8A 5KG4A 3B4DA 1M1HA 3BKUA 1IM6A 4J37A 4WFNQ 2DY9A 4DXLA 3SCJE 2ZJRQ 4FF4A 4LF8F 2GMHA 1UL3A 2Y0BB 3DRPA 1N5TA 4DSIA 5ETNA 2C2MB 1V3SA 2UU9F 1JB0C 5E7OB 3MM7B 4KGVB 1SC3B 4K50A 2C22A 5IZHA 2WB4A 4OHVA 5LSRA 1W2IA 3AQPA 4JV2A 1N5YA 1S9GA 1RP5A 2Q6CA 2QL9B 2ZNYA 1VQOS 3EMTA 1X5TA 1MMNA 4QYZK 2V4RA 3QQCD 5KTQA 2GFFA 1VBXA 2VQFJ 4DX7A 2DGXA 3P5TL 3D1HA 4HI1A 1KS2A 2UVRA 2VBXA 3QO9B 5B08A 4ZPTR 1AXQA 5D77A 3D68A 1PKUA 5HROB 4XTTA 2DPIA 1UEVA 2RRAA 2D74B 2XMWA 3I0RA 2V0NA 2VBWA 3PZPA 2DH8A 3CIMA 2QL5B 3CCES 5KFXA 1YDLA 2XYGB 5HBMB 1NMEB 4ECWA 5DM7Q 1ZM2A 3MAQA 2ZJPQ 2IIHA 3GFYA 3U7JA 2W2NP 1VQKS 1PYSB 5CCMA 2B5JB 4HI2A 4CP5A 1RISA 2WW8A 3KLIB 3ZTOA 2FLNA 3AODA 4CLSA 5JJBA 1RWKB 4Q44A 2HQFA 3BQ0A 1EZZB 1RAGB 4P9SA 3KHLA 3ISZA 4UY8T 4DR4F 4DSLA 2HGNA 4L72B 5ETQA 2ZC4A 1RHKB 4URQU 4DG1B 2D1CA 4JI3J 4QIWD 1JXLA 4RBVA 2GNKA 2HVIA 1KLMB 1DJ0A 2W9CB 4IFVB 3HMJG 1CJTB 4CCHA 1AUSL 2MKIA 3QWUA 4LSNB 4B17A 4ED0A 3I82A 1V5VA 1DY3A 1YJ7A 4FNHA 3DN9A 4OYZA 2Q79A 1SJ1A 1L3KA 3U02A 2BW2A 2C3YA 4HH0A 5CQGA 2K1RB 1E6VB 2OPQB 5AXKA 3OTBA 1CQMA 1UJ5A 1ZPWX 4IOBA 1DTQA 4KJIA 2PEHA 3I9V9 4FYDA 4Q45A 5KT3A 1HLWA 5EWGA 1O6XA 2DNPA 1RT3B 4TU7A 4RBUA 3NCRA 4C11A 4OV6A 2WCXA 4DUZF 1FNOA 3V6JA 3MCOA 4ID8A 1U24A 1DRZA 2P2CB 3GFXA 4LBIA 3TA1A 2X51A 6AT1B 5J1NA 1OY8A 1LW2A 2MZSA 1YJUA 3RR8A 5KFQA 3DRXA 4ZLJA 1N88A 3IBCB 2NCKL 5F8HA 3TUIC 4YMEA 3FCWA 4PR6A 1F9FA 3EXYA 5DRKA 5L38A 4DR7J 4MIWA 2QV6A 1CULB 3H4BA 2UXDJ 2YQ1A 2ZWPA 5I42B 2HNZB 1S10A 5D6GA 2MQPA 1E6YA 2N4DA 5GAHI 3IG1B 3N28A 2FJAB 3DOKA 3H2VE 3IR6B 2Z8QA 5FLXU 4ZPWR 1EKRA 2G2YA 1S12A 1FD8A 1R0AB 1U1RA 5A8WA 2D3OR 1FVQA 2J6SA 1T95A 1RT5A 2AGQA 2DNHA 4DL5A 1T7PA 3UR3C 4RUCA 5D15A 3CJ5A 3I0SB 4U9RA 4JI8F 2GV1A 4A8MP 2GQQA 2EK6A 1Q7YT 4K0KF 3NBPB 1RU1A 4OZ0A 3NWGA 2OEMA 1Y3JA 1IXKA 2ZHOA 2B9WA 2MKJA 2DH7A 3HHEA 3THPA 1YQHA 5B7WA 4C8NA 1RT1B 1T9VA 4JYAJ 3MOJB 2K2PA 5AJ3F 4GVBA 2QEXS 3D6HB 2RDIA 4U67Q 1FJGJ 3DCAA 3KXDA 2IRUA 4CYUA 5B0BA 1VRUA 2VG7B 1PYTA 2AJ4A 1P27B 1QY7A 5CXTA 4O3NA 4AFFA 1IKXA 4UOHA 3GE9A 4ECSA 1T9YA 2D9PA 2MTLA 3BGLA 4QWCA 5B0FA 4OIXA 2HHVA 1MWQA 2GMLA 5DDOC 2DB1A 3BO2A 1U02A 8RUCA 3LALA 3C19A 2V50A 1HWIA 4G1PA 3W64A 3BN7A 4RNNA 3J7AN 5ETTA 5A6PA 5BR8F 3UWTA 2DNMA 2MLYA 2XSJB 4DR6F 1MG7A 5KT4A 1U1QA 4KPCA 3BGRA 1B0VA 3BH7B 3FRYA 1QE1B 2IDEA 3BKFA 1K9MT 4OZ1A 1RWWB 2KHCA 1YBUA 3J7YU 1C2PA 2CPHA 2GX8A 4QBUA 5HJXA 1RADB 1FJ7A 2HHUA 2PGCA 2ZBRA 1WG1A 3QIPA 2W4CA 4RW9B 5K8NA 2UUAF 1C0TA 4NYPA 3DNCA 3GJQB 1VIOA 1WHXA 4WYLA 2VUGA 4DV3J 4A47A 2ZUGA 1NSPA 3W9IA 1OPZA 5E41A 2OFHX 2BJ8A 4JV5J 1A9NB 4LF5F 4RNOA 3JSMA 1WHYA 4DV1J 2WB1D 2ZOMA 1IQZA 1RHQB 3FFIB 4J9UE 1RTIA 3QJJA 5AT1B 3MPYA 4B9SA 1MWZA 4A8XA 1JJHA 4QR1A 3HSDA 1U26A 3K5OA 4DL2A 3T6BA 1SV5A 4KH0B 3NMAA 4KTQA 5FIIA 3MMAA 3MM5A 2L9NA 3SQGB 3JQJA 3LO3A 1TU0B 2K8GA 1SB6A 3A8JA 3FC9A 3LPEA 1S0NA 1VQ7S 5HK4A 3CJKA 1RBLA 3UPFA 1W26A 3MAAB 4WYWA 2HWHA 2OPRB 2ZH1A 3WHIA 1REVB 2CQIA 5HP1A 4JI4J 5J1PA 2HZCA 1X4BA 3M2VB 4GKKF 4M5NA 1K44A 3PEHA 2UVUA 4O4GA 5JVHQ 1M5PC 5ETPA 1FX4A 2VZ9A 4PEOA 3BGOP 1WG4A 1SI9A 3ZZ0A 2DO0A 4DJBA 4DS4A 4B3MJ 3Q23A 2XHWA 2Y0SD 4OZLA 4PWDB 1U2CA 2ADCA 4I6YA 5THWA 1IKYB 3I87A 5H9EJ 2IYGA 2ZZNA 4ZJOA 4FNIA 3P49B 1F5AA 2LLZA 3R6GB 3D66A 3MCNA 1FJCA 3ELHA 3R5CA 2XMTA 2V2QA 2XMAA 1S48A 3TW0A 3WX4A 4IG0B 5KOWA 5LSOA 3W9JA 1U6FA 5A8KB 5F3ZA 2BXJA 4X66J 2MZ1A 1X4AA 4AUKA 5L46A 2IM0A 2O5DA 4ZVPB 3D2WA 1HPZB 5EX0A 2PA3A 1HBNB 3QSYB 1N36J 5I3PA 4P2SA 3VAMA 2JC1A 1GEHA 1FXDA 2VG6B 1NPKA 4TLRA 4FF1A 4QW8A 1XJWB 3R8YA 4J5OA 1WC1A 1S6UA 3AJ1A 3MR7A 5DG9A 1ELOA 4KSEB 4UTGA 2GVDB 1GQEA 4ZCMA 3DLKA 1GX5A 2XY7A 3OTOF 2Q43A 2XHCA 3M05A 1TK0A 4Z7CA 2YNHA 1K8AT 1X4CA 4ED3A 4QU6A 2CQ3A 4IOAQ 1S72S 5CD4A 3J80U 4FXWA 2Z58B 4ZVFA 2KXFA 4XK8C 4DL3A 3GIKA 5CABA 4ILLA 3HFZB 3H5SA 1FKOA 3KUGA 2HG4A 1RWVB 3ILLA 3VF0B 3BQ2A 4WXOA 2WVBA 2RQKA 1NHUA 3R5AA 1VQLS 1S1VA 4Q8EA 2HZVA 3J80Y 4KKOA 2W2PP 1IBMF 4KAIA 3PR4A 4LBPA 1RTDB 3TAQA 3TA0A 5DDQC 4QWEA 2ZWOA 3N4WA 4X62J 2DO4A 2HK3A 1O8BA 2WK4A 4MIBA 2B7CB 1UVNA 1P1LA 4IG3A 4OZNA 5C24A 1T05B 4CLYA 4CNYA 4XO0A 2ZBQA 3ETOA 2YQ0A 1ZZFA 1LFPA 2B9XA 3QLHB 4X4TA 5KG3A 4E0DA 2EBEA 4O0IA 2R2UA 1VQNS 3DHXA 3TEGA 4ECVA 4FBUA 3MM6B 5H9FK 4DR5J 1Q81T 1NJXA 1K0VA 4EO8A 4A46A 4PXEA 5A6WA 1WC0A 4ICLA 2LDYA 2J9EA 2IMOA 1LXJA 1KQSR 2QGFB 5B0CA 3ONQA 2FVCA 1NM2A 3EZ5A 1HHTP 2YNGA 3MGJA 2NSBA 2G0JA 2MSTA 2VL1A 3PX6A 3C16B 2ASYA 4DOZA 3RRKA 2LQJA 2NXEA 3M2UB 1N34J 2VQEF 1RWUA 3QGPA 2AD9A 2MZTA 1HI0P 3HDSA 4RW8B 3N5BA 3WIVA 2VBYA 2AU0A 1XC9A 2M5YA 3GWCA 2E44A 4N56A 2HFUA 2MLXA 3PY8A 3PYGA 1TUGB 1ULRA 4C7QA 4ED1A 3DRSA 2Y1JA 1MN7A 2QIFA 2YWGA 4I7FA 2EEYA 2Y9HA 3PHEA 3I96A 3NRBA 4PQAA 4RO0A 1U25A 3PW2A 2EPIA 1F0XA 2QG9B 2VG5B 4ECZA 1YLXA 3KOAA 1JLGB 2IAJB 1ZYQA 3AB4B 4C8KA 2XMMA 4IUFA 1HNWF 2PFDA 1LQ9A 2IRYA 5KG7A 2RF2A 2C2EA 5A8RB 1NDKA 3QJPA 2W2QP 2FJEB 1Y5LB 3TO8A 3HHNB 2MDAA 5CD4H 2NZ4A 4N8NA 3UW1A 3ET6A 4B9TA 4Q2LA 1UKUA 2NYHA 4YEAA 1MMLA 4NLWA 9RUBA 3IRXB 2HAFA 3TP2A 4CLTA 4RKUC 3M8PB 2EFOA 4WP9A 4TN2A 1DTTA 2W9BB 5D0HA 5KFKA 3FK4A 2YKAA 3JXOA 5MAOA 2YKPA 1U47A 3C6TA 2LVWA 2PA8D 2E5LJ 1Y11A 3LQVA 3SSRA 2FHKA 3H98A 2HNDB 1AROP 3W63A 1IBLJ 4F4XA 1IQTA 3NS6A 3M32A 2X3DA 3C14B 3KKFA 4L6V3 1BQMB 1T3NA 4ZPCA 1HFEL 1JKHB 3SQOP 4P7TA 1AYEA 2HRTA 4IFYB 3W2WB 1RHMB 2GW8A 4B3TJ 2WVDA 3RW7A 2GO9A 2VV5A 2I0XA 1TKXA 2VOPA 4QWBA 4NX9A 3S01A 2VH7A 1HR0F 3OFHA 3GTYX 3BZQA 1RTZA 1D9AA 2B9EA 2BKOA 3JB9k 1KC8T 3NNAA 4WF9Q 3FNNA 1YBTA 4RWXA 3C3LA 3BF4A 3H5YA 4EI2A 4RW7B 4QIGA 4U6PA 4AL5A 3GSIA 4NPOA 2H54B 3W7BA 4UOGA 4DSFA 1KRPA 4CTAB 1HL6A 5F0UA 2F3JA 1BY9A 2CJAA 2ACMA 2VPYB 4H4MA 5F41A 2N7YA 2HGLA 3R6LB 1WKJA 4ETZA 2JL9A 1JLCA 2BX6A 3R5BA 3JSRA 1CJVA 2V2KA 4FXDA 3CC7S 2HHWA 2J9CA 4QPTA 3MD1A 4ZLLA 2FPHX 2HNYA 1N4LA 2CPEA 5CYQB 3LA0A 4RW6A 4NLDA 1RAOA 2HW3A 1FRHA 1SH3A 5K8PA 2APOA 1SKWA 1U1MA 2JZ5A 2LFVA 1SUQA 4RLEA 1HNVB 4BDPA 1OQ3A 3BYPA 4ZPVR 1XNRF 5G4DA 3CXCR 2V94A 4IRCA 1UCNA 3T41A 3EXCX 4DV5F 3RR7A 2UVWA 4KHPJ 1G1XA 3DOMA 2A1BA 4ECRA 3Q0AA 2DXEA 2IVYA 4CIOA 3UVJB 1P8GA 2ACYA 2XEXA 3GR0A 4PWUA 3LP1A 5ADZA 3DYAB 4EFAC 2VPXB 4RL1A 1RAAB 2CQ0A 3Q22A 2UUWA 3IA0A 1CC8A 3FEYB 3WC2A 3CWJA 3QT8A 1GK8A 1KDNA 2AX0A 2RDDA 5IV4A 1HQEB 4PG7A 1Y00A 1EETB 3CJ8A 2MZRA 1EARA 3POTA 4M8LA 5IT0A 5F8GA 2ZVSA 3D67A 4I69A 5J2QB 2MQQA 2B43A 2M3DA 3TAPA 4DR2J 2QJ3A 4G1IA 5J1EA 1YZ7A 4ZS6A 4KFBB 1PBAA 1KHVA 1X4EA 2VC0A 1UVKA 3MD3A 3O6QA 2E9RX 2CJBA 5J2PA 4KGXB 5CCLA 2I2YA 2BE7D 1J5EJ 3K58A 1BHNA 1KKHA 3M8QB 1HKAA 1UMJA 1YHQS 1YBAA 1RHRB 5KFRA 4C6AA 4ILRA 3KHHA 4A8OA 1WELA 2DY1A 4XDDA 3TNVA 2W24A 3WX8A 2N7CA 4USIA 4U95A 3V4MA 1Y10A 3VGTA 4DSEA 5DGAA 4O4RA 3UD3P 4U7CA 4MKAA 4P6QA 3NNCA 3W3SA 3H2UB 1OWXA 3MUVP 2F9JA 1FFSB 4OYWA 3LWLA 5IQQA 1U0HB 3D3CJ 2LYVA 3OXLA 4LSZB 6FD1A 3H5UA 4ZMMA 1HWLA 2YX1A 3R7SB 4WFXA 2UUTA 1FFWB 1TKZA 3DU5A 3IN5A 4IR9A 4KH1B 1U2FA 3DOLA 1F6TA 2D3UA 4O0NA 1ICEB 2BA9A 1AA1B 2RB7A 3WDOA 4F0KA 2XGQA 5DG8A 4KIAA 2W8LA 1HWJA 3J7YI 1X5OA 1M5VC 3LP2A 3EICA 1WOSA 4O3PA 4XDCA 3B6BA 3KFWX 1RDRA 3IWLA 4ZVRB 3KJVB 1IVZA 5KFMA 1FK9B 4JI3F 4I2QB 4EYIB 3OL9A 5K14A 1HBUB 3DLEA 1AT1B 4KQZA 1RKIA 2QE5A 4C0OC 2CJXB 3PW7A 3UE2A 2IC3A 2WONB 2KU7A 3H8YA 1ITPA 1OMSA 1T94A 2AWZA 5EX3A 2VIHA 2HEKA 1U8SA 1S49A 1ZTTA 4NL5A 3EYZA 1MROA 2PMZD 2XMJA 3DLBA 4TXSA 2F63A 1X5SA 4WCEQ 4ALZA 1OO0B 1VDHA 2OH2A 3GIIA 1RAFB 1SC1B 2H65B 1VC6A 3DRRB 4GO5X 4N8OA 3OVAA 3C15A 4LR8A 5KFZA 5HMYA 2Z2MA 1FRXA 1SJRA 4DQSA 2KYZA 2NQPA 1H6KX 1S6PA 3SI8A 1WG5A 3QGIA 1OJ4A 4EYHB 1SBRA 2KVIA 3T19A 4UT4A 4DR7F 4N5SA 1TKTA 3KJNB 3TOQA 1UVJA 2UXDF 2V8GA 3EGZA 2DHXA 2W7PA 3GCXP 1MMDA 4L3NA 2KHDA 5GVQA 4K4ZA 3M9NB 1IJEB 2HVDA 1SH2A 2O3DA 5LMNJ 2AYMA 2H4WB 1ZA1B 5T7LA 3JAMU 1S99A 1V6HA 3KG4A 3FDSA 3OFFA 3DM2A 3F73A 2IVMA 2N3LA 3F0NA 4MK8A 1HWUA 1S0VA 1EIYB 1R6VA 3R7NB 3MMJA 2NXUA 4F0HA 4GO7X 1VQ9S 1FRIA 2QTWA 1CJKA 1JLFB 2CNNB 2FZKB 5KFIA 3W65A 2B4OA 5B09A 1KHWA 2YTCA 1BQNB 3C6UA 2QA2A 3DKDA 3LF0A 4WIIA 3HSJA 3IXQA 1XBWA 3TUPA 1HBOA 3JAMY 5T14A 1VK3A 4WK3A 4ZPDA 4RUHA 2CAJA 3CCZA 4F4AA 4JV0A 5LJ3Y 2CYYA 2PD1A 3T5KA 5DO2A 4CQ1A 4JYAF 2G9OA 2OI2A 4FDFA 4X65J 1FJGF 1XIQA 2VC1A 4N41A 3Q8SB 3M9MB 2OD4A 2V8VA 2KM8C 3MM9A 1LFWA 3A3NB 1MLAA 1T03A 1U6BA 2YPYA 5G0RB 4DF8A 3M30A 3O2IA 1BD6A 3QBCA 2C2NA 3OR1A 3NAIA 4CH1A 4CM2A 5C2CA 4PRFA 4AL7A 4DQPA 5M2UA 2VD3A 3RAQA 2H1YA 4K2JA 1OS5A 2J0QD 3M1VB 2CPZA 3KDNA 3LW5C 4CM0A 4ELTA 2Q6BA 4DUYJ 4DPOA 3MR6A 3OUYA 4LIWA 3UN2A 2RD5C 1D9FA 3KDOA 4M5DB 4R5PA 2DIUA 2GZOA 5F8NA 2MHEA 5EHHA 2X1GA 1Y9OA 4TY8A 2ZE2A 4FYWB 1AB8A 1KD1T 2EFQA 3NGDA 1JNZB 2XZDB 3HFVA 1RA7A 2HQ3A 5KG5A 3T1AA 3THVA 2DJWA 3QT5A 1VHFA 3GFHA 2XGPA 3I4HX 2R2RA 2FJWA 4U7UD 1DHMA 1L3SA 2HMIB 2DEJA 3PRDA 2V67A 3CB4A 3K5LA 1DLOB 4DV3F 2FQQB 2JH3A 4URSA 2C3UA 4KBIA 4JV5F 3MWBA 2FGCA 2XS5A 3MOZA 2HBRB 2OEKA 3EUNA 4DV1F 3KLHA 3QT6A 4CI0B 5IWAJ 2BACA 1KONA 2HBYB 5ITHA 3L4BC 2HRUA 3DMJA 3CD6S 1R6YA 3FEZA 3H5XA 2QC3A 1I3OB 3FBCA 2HLUA 3UCUP 3DRPB 1LWFA 4WP3A 3MR3A 4QPXA 4IH7A 1XMOJ 2HFOA 4MMOA 3L9ZA 1NKCA 1PSDA 2FLOA 1ACMB 2XS2A 2E5GA 4BCAA 3AOAA 4YS2A 3EZOA 4DN0A 2NXNA 3AOCA 1AUDA 2BUNA 3N0VA 3CJ4A 3PCOB 4E98A 4JI4F 1HARA 4M1KA 2VICA 3DLGA 3T5HA 1N5YB 1FHTA 5B0EA 2D3O1 1UPMB 4J91A 3GG0A 1Z2ZA 5D4PA 1S9GB 2HFZA 3HJFA 1UZDA 1XMQJ 3D6TB 1I1GA 4B3MF 3NOCA 4F50A 4ANDA 1L3TA 3UO0A 2RKIA 1YJNS 2VB6A 3ICLA 4Y34A 1NHVA 4AE5A 2A2DA 2XG8A 2WSFC 4QIEA 5K8OA 4X4SA 1CEZA 1NK5A 2C2RA 3TZWA 1XR7A 3W2VA 4QJVA 2DHAA 3P6YC 4CH7A 3BM7A 3CJ3A 4Y00A 1KN6A 2RS8A 2BYCA 2VOOA 2R8KA 3Q8QB 4X66F 2Q3PA 4KO0A 4ZIVA 4FYXB 5JMNA 2VBZA 3B54A 1U1KA 2CNKB 1PO6A 1N36F 1G7CB 5FDLA 2KH9A 2JEIA 3T5LA 2JFKA 2IJRA 1RT2B 2WRMA 3PFEA 3C2PA 3NS7B 1KQKA 3JSBA 2DGVA 3OL7A 3UD4P 3Q86A 4PXDA 4J9LA 4LQ9A 2BZ2A 2CJYB 5I4MA 2BE2A 2EG1A 4YR3A 1GH8A 1MNEA 3K59A 2YH0A 4Y6IA 1D8ZA 2DCUB 3EVOA 2IJNA 3T9ZA 2CNOB 1CQNA 2KT2A 3QFHA 3T1HJ 2VA2A 1CG2A 3SZ2A 3SMZA 4TQSA 4K7QA 3LOUA 1DTQB 5L39A 2FUG9 4K4XA 2J9DA 2BQUA 3F56A 1DAXA 4W90B 4ES1A 2PI4A 4DWIA 3R3TA 3RTVA 4C11B 2YKMA 3GJSB 2QMWA 4KV8B 3KG1A 2DGUA 3CDUA 1MU2B 5F0WA 4WU3A 4R8UB 3U1MA 1SIZA 2AJFE 4Y65A 4YUDA 2LP4A 4X62F 1NPRA 2DNNA 3M8ZA 2MQMA 3NGSA 1NK9A 1FWLA 1TV6A 2VDHA 1NJYA 3AJDA 1S7HA 1HQUA 1R8HA 1Q8KA 1Q1KA 2R9LA 2V68A 3W8PA 1KP6A 3KNAA 4X4VA 1XR6A 2MXYA 3MTJA 2P9EA 2HYIB 1E6YB 2FVRA 2PC6A 4DR5F 2V9KA 1FNXH 3OW2R 2DRDA 4WTOB 2VFSA 2VFRA 3N5FA 2IM1A 2H3EB 5ETOA 3FRZA 1RT5B 1Q16B 3CC2S 2EFVA 4EU0A 2ILZA 3OHAA 1J2VA 2NSCA 1WOOA 3A4TA 3J81U 4PPZA 2QRRA 4DN9A 3KK3A 1KR4A 1GMVA 3NY0A 2B5JA 4FP9A 1N34F 2B8PA 4NE9C 3HF5A 4V1Ak 2W4PA 3N01A 1QSLA 1FKAF 4EZ9A 3K5PA 2LA6A 5D4LA 1CSJA 5I3QA 4X4PA 2OUGA 3KLIA 1DQ8A 4JOUA 4NA2A 5IM0A 2AJ2A 5A2QY 4CO4A 4DL7A 1U7LA 2V4QA 2NUHA 2JHEA 2BJ9A 1EP4A 4O3RA 2OTLS 1YX2A 1NKEA 4NLVA 1VJWA 3TEHB 4QW9A 2AF6A 4CYUB 2DBBA 2PE8A 2XI2A 1FI4A 1KLMA 5SZTA 1I6JA 4K5SA 4LSNA 1F60B 2R7OA 1QAIA 2BE9B 2J7UA 1IKXB 4V19X 1RSCA 4NLUA 3EPGA 3Q8UA 5L1IA 4MKBA 4DV4J 3D1OA 1WKKA 1TAQA 3IWXA 4EK2A 3HP6A 3RG6A 5KG6A 3RRGA 5A76A 1YITS 2H51B 4Y0FA 1RT3A 2XMKA 2WSEC 4ED5A 2KM8B 3UDEA 2E7WA 3PJXA 2Q1LA 4HL9A 1WC5A 4ZN1A 4DDFA 2EKYA 1CPZA 4OHWA 5FJ4A 4NLPA 3UQSA 2IY5B 4Y28C 3GPAA 1BE4A 3AHPA 2E5LF 1EQMA 2H5IB 3BN4A 4PG5A 5KFYA 1REGX 1GAOA 5K8MA 2BJ1A 3I55S 3I32A 1IBLF 3I4PA 1FX2A 4I1TA 3TR5A 2XB2D 3QIPB 3HJVA 4K4VA 5BJRA 1VRTB 1C0TB 4I64A 4LVOP 3FBBA 1GMUA 1RYRA 2CUYA 1Y4ZB 4PYAA 1WI6A 3IG1A 3ENWA 3H4DA 2DPJA 2H5JB 5CYMA 4NZ0A 1RCXB 5B0DA 4RPFA 2ERRA 4MFBA 3JSMB 2XC9A 1FDBA 3KMQA 4GKJJ 2EWHA 1RTIB 1D9DA 5KFCA 1T8EA 2HQDA 4G1QA 2CXEA 2IDLA 3UNGC 3QAUA 3MEGB 3DLLQ 8AT1B 4I2PA 1SQGA 3L7OA 3MMAB 3MM5B 2E5HA 4FVMA 1VQ4S 1UVIA 1VBZA 1YGYA 2OD6A 3DDNA 1RXOB 3TZYA 5HQ8A 4HT5A 3CMES 2KFZA 3MPDA 3CJKB 3TA2A 2J7KA 4DS5A 1TL5A 3A8KA 3MM8A 2HQGA 3ZZOA 2MQLA 5LMUJ 3DXBA 3GJRB 1B0PA 1N0VC 1B64A 4LVNP 2JEGA 5HP1B 3PVXA 1RT4B 5D3GA 2IM2A 1RHJB 3VHQA 4CO0A 4O4GB 4NCGA 4EZ6A 4EGLA 4KT0C 2LECA 3E3XA 2B6AB 2CQGA 4YN3B 1YIJS 4ECYA 3OTDA 2FY1A 2BOAA 4LF2A 1U49A 3V81A 1R8BA 3EPIA 2DNQA 4KHRA 3V6HA 4OLOA 4PG8A 2Y8YA 2ZUAA 4PG6A 4OI4A 2ROGA 3JQMA 1QVFR 3AAWB 2HKEA 2J6UA 2QZ8A 1RAHB 2DHHA 1RTHA 3UDVA 4KHPF 2HLTA 3GV7B 4Z7YA 2G13A 4LSLB 4YP3A 1S1WA 3OVSA 2R3VA 4ZCLA 1SPBP 4DI6A 1ZZNA 1SXLA 2NYIA 2CPDA 2XZWA 5KFSA 2DVIA 5C2GA 3EM1A 4KGKA 1UZHA 2V2ZA 2ALYB 1UWAA 2CWKA 3DDIA 4PUOB 1AZSA 4RW9A 1NUEA 2IM3A 3DLKB 2JWNA 2NS1B 1U1NA 1JLEA 4H4OB 4AD6A 2YNHB 4DR2F 3P96A 1FWPA 2M8HA 4DZ6A 1OSCA 4B9VA 3N9UC 2O1PA 1JJ4A 4DCPB 1NJIT 1Z2LA 3P5BP 3MECB 2EVZA 1S1UB 1RQ0A 3O8WA 1J5EF 4PZVA 2BJDA 2OLWA 1FKOB 2GVZB 3BV8A 1NH7A 2GHVC 2JC0A 3MTKA 2RMLA 2F8MA 1HMVA 4N77A 2E1MC 1SL1A 3IP0A 4F8RA 2J8AA 1S1VB 4DQQA 1HD0A 3GP9A 4KKOB 2QA4S 2W4DA 4B02A 5E2QA 8ATCB 3BPDA 1TAUA 2RQ4A 5C25A 3CCUS 2OPRA 2DGTA 2BJ7A 2IYIA 2R42A 1REVA 4HACA 1CS4A 4DMZA 1WDDA 1C1CB 3HSZA 4QOTA 3OQ2A 5C24B 1X0FA 3D5MA 3IMQJ 1RCOB 4EMDA 2KL8A 1UEUA 1RTJA 3I5AA 4PXCA 4F4KA 3CIZA 4UY85 5LM7E 1WI8A 4HHJA 3BDPA 3IS9A 3HD2A 3ILIA 2MPUA 2AYBA 7FD1A 4TU9A 3DLHA 1U8WA 1FNMA 2CQ4A 1FVSA 2D7SA 3T1YJ 5FD1A 4IRKA 4ICLB 3DLJA 2F8EX 3AT1B 1JLQA 1TL1A 4N47A 3CEDA 3GU0A 3PDNA 2FDNA 4JI0J 4OHZA 4EBDA 1DQ9A 2DNZA 5KFFA 2XS7A 4NLSA 2H5EA 4J9KA 2DHGA 2E1PA 2X7IA 2YNGB 4CO2A 4K2XA 5ETSA 3QYYA 4OV1A 4N7TA 2LA4A 2I5JA 3QJLA 4OJ3A 2JX2A 5L1JA 4LUBA 4DPYA 3KG0A 4DFMA 2HHTA 4X4RA 4L73A 4DQRA 1HPZA 2HS4A 3CCWA 1HBNA 3G96A 2CQBA 3VV2B 4X84A 1QVGR 1UW4A 3MURP 1WC3A 1S4FA 4LFCJ 4HHUA 1ROFA 1UFKA 4BWJA 1S1XA 2JLFA 5AE1A 4DX8H 2FIUA 4U8VA 2W2OP 2GVDA 3FKBA 4F7VA 4DV2J 3NGKA 2V8DA 1U1PA 4J9QA 3TQ1A 3DRSB 4K59A 4EBCA 1RKJA 2CQPA 5GMEA 4I7FB 1TZ0A 1S79A 2CADA 1G4CA 2EFGA 3CJ2A 3QAEA 1URNA 2FD2A 4OX7A 4KRWA 5AE2A 5LXRA 3GB0A 2N82B 5LL6d 2XSFA 2MJUA 3KUEA 4DPUA 4OYBA 2GHPA 3OHBA 3MMCA 1B0TA 5LMNF 1U6ZA 2RF2B 5KT2A 1KNZA 3MPUB 2R4FA 1SJ4P 2P6SA 2L9WA 5DLGA 1RT6B 3ZFVA 3PW5A 3R2CJ 1NDLA 2BDPA 1UA0A 5E3PA 5B0AA 1L3VA 1RTDA 4EUVA 1DTTB 3PFOA 4QU7A 2J76E 1W7WA 4I56A 2RHSB 2RNEA 1VQ8S 1NH8A 1C1BB 3M8YA 5U47A 3PYDA 4TLQA 1ZA2B 4FPIA 2OAUA 3C6TB 4YY3F 4EEYA 2C28A 1YTYA 3FBFA 3MZIA 5KG2A 1T05A 3L7PA 1RBOB 4OI6A 3M32B 3VAHA 2DISA 1FKPA 1HYSA 4BHQA 3PNIA 3KLFA 2MLZA 3R5JB 1K0TA 1R0CB 2RHQB 1VC0A 3CTRA 4OZ3A 4LF9J 3OJUA 2YKQA 4ID5B 4X65F 1SCJB 1R43A 3HHLA 5KFLA 4IYQA 2RQMA 3GSDA 1FERA 2QSWA 3CJQA 1NK0A 3B78A 4Z37A 4DCOB 2YPZA 2XQCA 3M2RB 3RZAA 1GX6A 3GQCA 4HTJA 2AZ1A 2M0GB 1K73T 4E8UA 2HHQA 4YR2A 3QZ8A 2I8EA 2D41A 2DNOA 1FDAA 4DUYF 5ETVA 2LXFA 1VISA 3HPOA 4W92B 1SIWB 2XULA 2E1AA 4GVLA 3V4IA 1X4DA 4B3OA 4WFBQ 4ITSA 2OSRA 3OXFA 5K5MA 4AL6A 2HS3A 5LXYA 2XY6A 3KUHA 4O44B 1N56A 1IBKJ 1TVRA 3RU0A 3HT0A 1NK6A 5DG7A 1OSDA 4J9PA 4P71A 2E7XA 3DRYA 5DDPC 3EDRB 4MH8A 4IO1A 2LQ8A 2YY3A 1JLCB 4FKXA 2LDIA 3ZTSA 2CNLB 1AFJA 1CJVB 2GQ2A 4DCJB 3GCWP 3RBZA 4G3IA 2J7WA 5L9XA 2ZD1B 4JI2J 1JNRB 2HNYB 1YJWS 2Z2YB 2F4VJ 1B7YB 2IAJA 1FXRA 2QSFA 3L95X 4WZMA 3OV7A 2GGPA 4ZPBA 4P7VA 1RWNB 2I9SA 3TUZC 3I5BA 3W5YA 4WIQA 2WW4A 1Y3KA 3H40A 1UW9A 3HM9A 5IWAF 1VBYA 4Q7AA 2LQBA 1HQ2A 2K3IA 4OQJA 3DOMB 3MEKA 2FVPA 4Q5VA 3M8PA 2YWFA 1GXLA 3R2DJ 3R5DA 4ZCIA 3LP1B 1BQXA 5F8JA 2A3JA 2RE1A 3C66A 1HNZJ 2YWEA 3MFIA 1UFWA 4NA1A 1XMOF 4Y2CA 2ZH8A 4F67A 1S76D 4OHXA 1VQYA 2CPYA 3V5RA 3VALA 4IDKA 3MF5A 2X1BA 3JTOA 2BEFA 2DR6A 2V6AA 1N0UA 3BB5A 5HAOA 2W25A 1YRXA 3H0PA 4CLLA 3UFCX 1HNXJ 3O5TB 5FLXY 3BQ1A 2DNYA 3NMRA 3NP5A 5LOQA 1XMQF 3EE3A 3JQKA 1P9QC 1LOUA 2UV8G 4BLGA 5J2PB 2MKHA 5HLFA 3K17A 3PTWA 1H2UX 2BABA 4J9VA 3S1TA 2YWKA 2DGOA 4ZVOB 3H42A 2ZKTA 3RRHA 1PC5A 1U09A 3MEEB 2B51A 3NKYA 2CJQA 1Q8LA 3VZIA 3KNGA 1Q78A 1RLDA 4LFBJ 1TUVA 1SL0A 1GTHA 2R7VA 4RWWA 1SJ3P 2R7UA 3EVMA 3Q89A 2CZ9A 3G71S 5B0GA 2OELA 3K7RA 3BGUA 2HFSA 4E2FB 1WD6A 3DGPA 4DR3F 4JUZA 2QYCA 1YG0A 4CTAA 4LF6J 3W1YC 3FSYA 4FPRA 2CPFA 1RWMB 3Q2TC 2DYAA 3IR7B 4ZK7M 5E3AA 2KZZA 3NEKA 3DOLB 3OT9A 2MY8A 2IJFA 2DGQA 1HBMA 2XY5A 4LF1A 1PILA 4K8RA 1XWLA 4WWSA 4CH0S 1NB2A 1UFLA 3P8BB 4P75A 2ZNZA 1RYSA 4NLXA 2HSEB 3G82A 2IBOA 3N6NA 5CYQA 3R1HA 2CJKA 2QT7A 3UCGA 4B9NA 1WSRA 4IH6A 1K1QA 1B7FA 3DLEB 4A8FA 1SC6A 2BJEA 2JLEA 5J2NB 2IC3B 1EX8A 2DNLA 2AHOB 2RUSA 1TR0A 3NGTA 1KOHA 4Y2AA 2ZH3A 4F36A 1UWBB 4RU9A 2X1FA 2XLKA 2NPIA 3MPWA 4NMLA 3UVJA 1MROB 1B70B 5A0YB 1ZTWA 2RU9A 3DYAA 1YZ6A 4B08A 5D4OA 4LR7A 3VGUA 1HWKA 3FZBA 5DS7A 1IKVA 2KN4A 3VGSA 2FJVA 2R8GA 5F8MA 3L7UA 1KSPA 2HHHF 3VVUA 1KVKA 3C15B 1JJ2R 1VQPS 1S0OA 2ZH6A 1VR6A 1HQEA 3MMBB 3CDWA 1OY6A 1VRQC 4AXIA 2QLXA 3MEDB 1LWCB 4P73A 3GYGA 3IGVA 2FLLA 1QM9A 3W5ZA 1TKTB 1VQ6S 4OI2A 3HKZD 2X3GA 1ZPVA 1U1OA 1CJUA 3PG9A 1JK9B 3MFHA 3DC2A 2NXCA 2DNKA 1GTEA 1F5CA 3PW0A 3A8IA 4P2FA 5DQHA 3NL0A 1KOOA 1WORA 3OR2A 5T7LB 1NO8A 2GIRA 3MPVA 2ZH7A 2O66A 3R1LA 3DM2B 2L41A 3BO4A 3G8SA 2DKOB 3QIDA 1NU4A 2KFNA 4NCBA 3BPSP 2AIRB 2RDJA 4OL8A 2HGMA 1L5UA 2KT3A 3TRGA 1P6TA 3IO1A 5BYQA 3V6DB 3S8SA 2GA7A 2GJIA 4USUA 3IBFB 4ES2A 2YKNB 3C6UB 3B8HA 1V5IB 3BSOA 4XIUA 1HBOB 1LW0A 1NZ8A 4USMA 4B3RJ 5GAGI 2YH1A 1DFDA 3EZUA 2IFXA 4BC9A 3HZEA 1C0UA 2GHWA 1YSJA 4ATNA 5J2MB 1H2VZ 4YHHJ 5HQMA 1T02A 4F25A 1NPPA 3WC0A 3BDEA 4M5GA 9ATCB 4DU8A 4H54A 1WACA 3KJVA 4WTYA 5C7PA 4IKAA 2FHOB 2MJNA 3KLGA 3Q8RB 1Y5IB 4S0MA 3M30B 2KXNB 2WONA 3OR1B 3U1NA 3AQOA 4ED8A 1OPIA 4NRTA 4DV4F 5KFBA 1SQFA 2YNFB 4ZCKA 5ETMA 1RGVA 1WHWA 5AXLA 3US5A 2NXJA 1N6QA 3OUYB 1OYEA 4H4KA 4R5PB 1S97A 2OPPA 2DXDA 2EBGA 3HHLD 1SVDA 3VAKA 1NSQA 4TY8B 1WJ9A 2ZE2B 3NS5A 2Y1RI 3G6VA 2RS2A 3ILJA 2Z56B 1RJJA 3PRVA 4EWTA 2JVRA 2BKNA 1LWEA 3M6XA 3NGRA 1PJ5A 5BYRA 3RGIA 3WIUA 1FRLA 3RB4A 1T9XA 3IGNA 2IA6A 4ZP7A 3J7ZT 2HPUA 2EC0A 4C8OA 1ZBTA 3CW2C 1DBDA 3B4MA 3N79A 1RAJA 3KK1B 3OL6A 4B9MA 2A6MA 1NJZA 2HFVA 4ED6A 1U45A 4JI1J 2EFNA 2HIQA 3LTOA 2VJUA 1HHQA 2UP1A 1KLNA 2LQ5A 3DI6A 2F40A 1URRA 1U2RA 4RZRA 1RAEB 1NCLA 1KVIA 2JLGA 4GKJF 2NPFA 2ZJQQ 1IN0A 1YWXA 1RHUB 3DMJB 1F9EB 4F2SA 2A10A 5KFAA 2E5JA 1EB0A 1S9EB 4DFJA 2XYHB 4N76A 1S1TA 5EUHA 1TL7A 1NJWA 4QR0A 2UV8A 3WBZA 3E51A 3SDEA 2Z2ZA 1LWFB 2MEWA 4JV1A 1VS3A 3CE8A 3KLEA 3H90A 1BXNA 3L09A 4DFKA 2WTFA 3AXKA 2PFFB 5LMUF 2OEJA 2H9ZA 3ADAC 3VGVA 1TP7A 4NASA 3PR5B 1K1SA 2HURA 5HQLA 2L48A 2AZ3A 3DLGB 1LWXA 4YB5A 4UOFA 2ATLA 2U2FA 4F04B 3JS9A 4DV0J 4RNMA 3OXGA 3Q2SC 2J9DE 4PQUA 2RKIB 2FHMA 4M5JA 1H2TZ 4OX9J 4UW2A 5KFUA 4PAAA 3EVWA 2WSCC 3EX7B 3NOGA 1Q95G 1T11A 2AYGA 3A3PB 5DGBA 4PABA 1D09B 3M1VA 2PEBA 2M52A 3W2VB 1HIYA 4OZJA 4A48A 2ZOGA 3AFGA 5L1LA 1RAIB 1YRUA 5BXIA 3OSPA 2RJZA 3OFGA 2BBEA 3E01A 4X4UA 3FGVA 4PPDA 3OTEA 3MR5A 2KKHA 2EK1A 1JX4A 1ZH5A 2EKNA 4MT1A 5FDLB 2RVJA 1O5JA 2CKWA 5F9LA 4ZITA 4YDXA 5EGYA 5EDWA 2OIHA 4GC7A 2M7SA 4EBEA 3MDFA 3A1YG 4MIAA 4LMZA 4F4WA 1ZAXA 3CT9A 1DLOA 3JSYA 5D0RA 4I0WA 2ZBPA 1V9OA 2R7TA 2OHDA 2HHSA 5HVGA 3O1LA 2V4JA 4KYZA 4QYZJ 3MAHA 1NK7A 2DHSA 5E3CA 1T0TV 1BGXT 1ZAVA 3AA8A 1S6QB 4HKQA 2VASA 2R8IA 1LK7A 4OI3A 2B0GA 1FESA 1EQ0A 3CJTA 4CT8A 3H25A 3FUYA 4GC6A 4DEZA 4DSKA 2B4PA 2I38A 1YRTA 2L9DA 2YKMB 3QMQA 2ZZMA 2HK2A 2DT9A 1RUSA 2ROPA 4CNZA 4F26A 5GAEI 2QN6B 2NZCA 3P3DA 1YJVA 3RJMB 2ZFHA 2CZVC 1U48A 1JLAB 2M4MA 3CCSS 2YKOA 4K4YA 1TV6B 1WHVA 3BBBA 3D0IE 3N6LA 3PYEA 1HQUB 2E5IA 3ZZPA 1WKLA 2RRNA 4UUWA 4KPYA 3D0GE 1WNEA 4ZDNA 1MSWD 2BRLA 2MQOA 3WQPA 4RW4B 1F5BA 2E1RA 5JUMA 2AKWB 4ZP6A 3TWZA 3AA9A 2CQ1A 1BWVA 1ZOTA 4QIVA 1GXUA 2JSXA 3RUBL 1S7IA 1FDDA 3T1YF 3GIJA 3ZTQA 4OX8A 2PMHA 4JI0F 3O3LA 3L3CA 3PO4A 2JOQA 4IR1A 4FS1A 4M5IA 4LF4J 1KFSA 2AQ4A 1N33J 5IC4B 1R8AA 3KMSA 1WTFA 4NI2A 1OYDA 2PSZA 2LMIA 3BH6B 2QO3A 2FC8A 1IKWB 3KK3B 2MGZA 3LGHA 2ZITA 3UDCA 2VODA 2VFUA 4X4QA 1RT7A 3N6MA 1W25A 2UXBJ 4YOEA 4YDDB 4ES3A 3ITHB 1TFYA 1TL3A 3D4JA 4DV7J 4LFCF 1RACB 4NXNJ 1Q5YA 4L75A 2UVVA 2VF3A 1RT2A 5IM0B 1RWOB 4DV2F 3X1LB 1Q79A 2QYGA 2Y1IA 2KZMA 3TYTA 4RR5A 1H74A 1EP4B 4NYZA 4HLBA 2HS0A 3EWGA 3GMGA 4ED4A 2AEMA 2FY8A 3QGGA 4LF7J 4LRAA 7AT1B 2HWTA 4YB1P 3G6XA 1S59A 4ZVHA 3TZZA 1OIAA 3MCSA 3M7VA 2I6WA 2V63A 2ZHBA 3PX4A 3W62A 5F8IA 2FHJA 1RE1B 1M90T 3HVTA 3UN3A 1FD2A 2QLJB 2OPSB 3M8WA 2G4BA 1KVJA 3BREA 3DXSX 3LGNA 1X9MA 2VQFF 2BM0A 2BRKA 2CPJA 4KV8A 3TJ9A 5HL7Q 2JJ4D 3TJAA 1MU2A 1M1KT 4R8UA 2KYXA 3QNWB 4IH5A 1S77D 2WOMA 4CLZA 2IBKA 2WHOA 4K4SA 3G4SS 2RAQA 3HHLC 2M70A 3D0HE 3PX0A 4OMFG 4QQBA 3TAMA 1IM4A 1S57A 1NRKA 1NSAA 3RB3A 5F9NA 3ZZRA 3RW6A 2OMLA 2B3TB 2AEFA 5K9FA 4LR9A 5H1SV 4CLFA 3PJ9A 4LF9F 2OGUA 4ZN3A 1R3NA 1C4CA 3F41A 3CVKA 3AD7C 2MKYA 5CYMB 2HWIA 2KB2A 4M5HA 4MFBB 1TL4A 3PYFA 1KBRA 3D1QA 3PRBA 3CCLS 1SKSA 4RX6A 4B9UA 5KFEA 4DPWA 4G1QB 2YX4A 1KWMA 1RBAA 3FSXA 1Q5VA 4I2PB 1BWEA 4DFPA 4DX5A 3LPYA 3G6YA 2KTQA 1IJFB 3TI0A 3TVKA 2GQCA 2AJ0A 1PAUB 5M2PA 4OZ2A 5KG0A 2AYEA 2VU5A 1RWXB 3H2LA 1NXIA 2MQNA 1EHWA 3MM8B 2ZM6J 2BANA 2KRBA 3ZZYA 1IBKF 2YWHA 5KT7A 2RQCA 2XZTB 5D3GB 4DPTA 2DR7A 1LKZA 3QZ7A 3ZZZA 4G65A 4TYBA 4C8LA 3BSNA 3CDBA 2YNIB 4NCGB 3Q8YA 2P9GA 1QSYA 3SEOA 4NRUA 3I5CA 4ZHRA 2QLBB 3W8GA 1WC6A 4JI2F 1DARA 3V81B 2F4VF 1QDUB 4NYOA 1AFIA 3LAKA 5KT6A 2KFYA 4PG4A 2G0CA 2GC8A 4ZVUB 1QUPA 3PIOQ 3LP0A 1VYAA 1QTNB 4F3MA 3G8QA 5LSLA 2PDAA 1KQGB 3T6JA 1RTHB 2YVSA 2P8IA 3CUNA 1IWAA 2XLIA 2R8HA 2W7OA 3CPWR 3RAMA 1S1WB 3BS9A 3CJRA 1YVFA 4JI6J 3EGVA 1J5OA 1HNZF 2V8PA 2HHXA 1Q8IA 2DGSA 4WE1B 2R8JA 3IM8A 4C8MA 4GRSA 1AZSB 3PO5A 4C97A 1VRTA 2CQHA 2DITA 1NEEA 1WC4A 5AE3A 5CYJA 1JLEB 1RZMA 3D6MB 3P45B 1HNXF 3HX9A 2DNGA 5C5JA 4K4WA 2BV3A 1H7WA 4KGZB 1LXNA 1F2GA 2BVZA 2B4VA 2FYXA 1G3OA 4F4YA 5KFJA 1CVJA 5CH7B 5C42A 1N48A 1R8CA 3MEGA 4D3HA 1YJ9S 4FZVA 4UZBA 2R7WA 5M2RA 1UAWA 4R0EA 3RB0A 1PGZA 1HMVB 1N5QA 3F44A 3VQSA 3KK2A 5AXNA 4YFUA 4LFBF 2WVEA 2ABYA 4DV6J 3QGHA 5K20B 1F3FA 2EXUA 4OI1A 1UPPA 2HQCA 4CLKA 1GNKA 4J9NA 3W60A 2XLJA 3WZ0A 5C25B 4AT1B 2DR8A 3VAJA 2R7XA 4HACB 4LF6F 1CS4B 1HNIA 3TVZA 1NZAA 3QATA 4C9DA 1RT4A 5CZVA 2V5HG 4MKVA 2IVFB 4HDHA 3I9ZA 3TJ8A 1Z1ZA 4I67A 3Q24A 1RTJB 1R27B 2GO8A 5E3RA 2POKA 5E0OA 2B6AA 2R7RA 5L9NA 1ZM3A 5KFTA 1QUVA 4CWBA 4F2RA 3IS9B 3R7BB 3SFGA 2D69A 3JYTA 2KG0A 4FN5A 4C0BA 3G8TA 1SKUB 1WUUA 3ETMA 3O44A 4IO9Q 1Y7PA 1D1UA 1JLQB 1TL1B 4JP8A 4ZP9A 1F1BB 1JLBA 4ZP8A 3BR9A 3C46A 3IWNC 5KFWA 1SKRA 4UUXA 1FTCA 1FF2A 3KLVA 2F4FA 1HA1A 4K5RA 2R2TA 2I5JB 2MMYA 3HVWA 3OL8A 4HHHA 4LSLA 5KFOA 3Q8VA 2YX7A 3SSSA 3FQLA 1X9WA 3GIMA 1FO1A 4ZVTB 3QRRA 1K47A 4CLUA 4ANCA 4OJGA 5I3UA 5HMZA 4DU7A 5D0EA 5KFNA 1FJEB 4DSJA 1S1XB 2HHPA 4OLPA 1HI1A 4NEZA 3K5NA 4DF4A 2JNJA 4PUOA 3HVRA 4J9OA 3MR2A 3K8VA 2VJVA 3C8YA 2GIQA 4WFAQ 2LU1A 2IHR1 4H4OA 4BS2A 3OLBA 2KI2A 1RU2A 4Q0BA 1VQSA 5CHCB 4U8YA 2O01C 3MECA 4WKYA 2NUUG 2YQ3A 1FE0A 1S1UA 5CA5A 2ZC3A 2ZBIA 1Q4RA 2CG4A 2XMVA 3Q8PB 3MMCB 2GVZA 5H9FJ 2CJ9A 1W2BR 4HYKA 3HK2A 2Z57B 3SCLE 4USWA 4C48A 5F3TA 4RNFA 4NOHA 2CZ4A 4MYTA 4DBQA 4HR2A 3G86A 5RUBA 1FFGB 2JVOA 2ATCB 3M6UA 3HVAA 4M95A 1ZAWA 4OZ5A 4RUAA 3AXMA 3PXGa 1C1CA 3HHDA 2FHJD 1TK5A 3KHRA 3I0RB 4ZOSA 1XQIA 2UUBJ 2BW7A 1NDCA 4B3RF 4AYBD 1IR2A 1FKPB 1HYSB 3KLFB 4YHHF 1IWGA 2PMWA 3THTA 2NR0A 1Q0NA 3AY0A 1LK5A 3VAGA 1G6BA 5IS2A 3T5JA 5IFMA 4F3OA 3HHLB 1RK8A 2ALZA 2O67A 2VKRA 4FF3A 3QPIA 1KQFB 4H4KC 2DR5A 4NZ6A 1HI8A 2M9KA 2CIMA 2U1AA 2KJWA 3I6PA 4HEA9 4X64J 1P1TA 2JRSA 5DZ7A 2GCFA 4B3SJ 4UF4A 3JTNA 4Q2MA 1U1LA 3FQKA 1LNQA 2VFTA 1RA6A 3V4IB 4B3OB 4Q8FA 1QTMA 1FEHA 2MZJA 4ECQA 1X60A 1TVRB 2WBMA 2UZAA 2G2OA 4Y2MA 2HZAA 1DQAA 3RBXA 4DPXA 4NEYA 3TANA 2LKZA 3V2UC 2X1AA 3CULA 1VI7A 3W61A 1SH0A 2ZHAA 2PIIA 5DLFA 3CGIA 2VA3A 5D8HB 5AXMA 2ZKUA 2Y8WA 3MM7A 1LW2B 1N32J 1DURA 2FZGB 2Z2LA 3PACA 1U4BA 1NLKL 2FJXA 4WPAA 4OYXA 2GGPB 4JI1F 2J8SA 4USHA 1BMQB 4EO6A 1H0HB 5KFHA 1RT6A 3BR8A 2FTRA 2MKKA 2QMUB 3UN5A 2V2VA 4DR1J 2AT1B 3ZZTA 4A8YA 1FTRA 3QO9A 1VFJA 3DOKB 1C1BA 2E1CA 2Q66A 5HROA 4RNHA 2FC9A 2HQIA 2UUCJ 5A8WB 4K4TA 1Q8BA 4KGMA 1N54B 3GFZA 3ZTRA 3UI3A 2YWWA 4Y2KA 3TX0A 4BBYA 3IBWA 2FZCB 5HBMA 3LANA 4IDKB 1GMWA 2KT5A 4LBHA 4JI5J 4LRDA 1JJCB 1R7IA 4YR0A 2VONA 2VFVA 4FXVA 4LFAJ 1YK9A 3K89A 4ID5A 4OYAA 1XK8A 4DV0F 2DRBA 4NLOA 5MLCV 3VQTA 1NNDA 1WEYA 4NXMJ 2BQRA 3AD8C 5HLFB 1OQ6A 2CA9A 4OX9F 1XNQJ 3PM9A 4RBTA 3J81Y 1H3DA 4B9LA 4GVBB 2AP6A 3M2RA 2ZZTA 1MN9A 2XCPA 4XPEA 1X0PA 3A8EA 4DG1A 3D9BA 1S4EA 3ENVA 3BBFA 4J7CA 2J0XA 3MXHP 1VRUB 5EWFA 5BYSA 1XTZA 3BGFA 2W9CA 4IFVA 4ZJQA 2CG8A 3UNYA 1CJTA 1UJ6A 1X5PA 3U27A 5E33A 3G2XA 4AQYJ 1JWWA 3SXLA 2K1RA 1E6VA 5HI7A 2OPQA 3DGPB 2MKSA 3ZC4A 5LT5A 4M5MA 2HVHA 4O44A 3TQEA 4OJ1A 1QSSA 3KTQA 1CLFA 2CQDA 3NG8A 4C4WA 1HBMB 1IUJA 5KOXA 4OI0A 1Y5NB 2AMCB 4CO5A 2PO4A 3KJFB 4DL6A 2ZD1A 3BGRB 3VCDA 3G82B 3T9NA 4YB6A 3M6WA 1R31A 2F8HA 3VZHA 2DXFA 1FEEA 4WP8A 3PV8A 1D8YA 1QJHA 2I1RA 1F2HA 3NCPA 1VLOA 1VK8A 1CULA 3HFKA 2L3MA 4WXWA 5I42A 2HBQB 4I6AA 2HNZA 5GMDA 5L8RC 1KTVA 3FMBA 3S7RA 2B56A 2XTJP 1C4AA 2B4UA 4B3TF 4P52A 1S5ZA 1B99A 3D28A 1M5SA 1XR5A 2RSQA 3SV4A 1R0AA 2MY7A 1IKVB 5DDRC 3AB2B 4I68A 1T9TA 2BR0A 4W98A 3I0SA 1JXVA 1SV5B 4C0HA 1EAYC 2CVEA 1G2EA 2CVIA 5DZ6A 3OLAA 2BM1A 4NCAA 3ENQA 4Z2XA 1FE4A 3NBPA 3OJSA 2B7BB 2ZDOA 2C2OB 4QIFA 3PW4A 3IM9A 1D3WA 1RWPB 3DHWC 4NLGA 2WZ1A 1A6LA 4C98A 3RYLA 4F02A 1CJUB 3ISND 4QR2A 2ASDA 5DQGA 4J9RA 1OY9A 1TKDA 1RT1A 1H38A 5IT4A 1H73A 5IQ6A 3FZ2A 2UXCJ 3W9HA 3MEEA 5HO4A 3ZO7A 2MB0B 2JFDA 3OR2B 4ILMA 4RUBA 5KAKA 2VG7A 3FVYA 4NLTA 4LF4F 2YBVA 1N33F 1HD1A 3AJ2A 3NNHA 4U96A 3KHGA 3I31A 1TMMA 5IT9U 1SL2A 2IPOB 2UXBF 4V19J 2ZH5A 2A0FB 2CQ2A 3CCMS 1LW0B 4DLGA 4DV7F 4OYOA 1I94J 4NXNF 1C0UB 2QL7B 3SFUA 3KJQB 5GAGU 1YI2S 2AX1A 5HVHA 2XCAA 2DIVA 5HSPA 2XSJA 4A8QA 4ZIWA 1WF0A 4G6VB 1QE1A 1UP1A 5IT9Y 4LF7F 5CZXA 2ZOFA 2CWXA 3GLJA 3PKMA 3KLGB 3M8SA 1WF1A 2H4YB 4CDIA 5J2NA 2C2ZB 3HKWA 2MSSA 3AH6A 4NLYA 3M9OB 1H72C 4XPCA 4DHVA 1VC5A 2LCWA 1UWBA 2FGOA 1R89A 3R97A 3HXMA 5A0YA 1HHSA 2HIYA 2DGWA 4JI7J 1N6QB 2BQ3A 3CCJS 3FFIA 2GAHC 2ASLA 2OPPB 4ZKAA 3EJMA 2E9TA 3MMBA 3D3BJ 2XNQA 3SQGA 1FT8A 4ZVEA 4A8WA 2DNRA 1LWEB 4LF8J 3MEDA 1FRJA 4BWMA 1LWCA 2J0WA 2N3OA 4KC5A 4MYUA 4ELUA 1ZM9A 5DQIA 3S6EA 2LXUA 2ZDPA 3SIPB 3MAAA 2UU9J 1VCTA 3GILA 1SQEA 1NK8A 4DLEA 3GZ7A 1Q86T 3K8WA 1PIEA 1LEOA 4BC7A 4C8YA 2QLFB 2QFJA 1VIXA 4IG3B 3A12A 3CD0A 3M2VA 3DI6B 4D3GA 4ECTA 4OYPA 4UQGA 4UOCA 2PT0A 4ER8A 3CMQA 4GMKA 4NZ7A 1WF2A 4PWDA 3MUTP 3UCZP 3M8RA 1IKYA 1S1TB 1TL7B 3CCVS 2C1EB 3PHTA 2XO6A 2GMJA 3V6DA 2FVSA 4ZVQB 4YY3J 4PKDB 2W9AA 2G2ZA 3SDEB 2AJQA 2YKNA 3HT3A 3MUMP 3QWPA 2E7VA 2HAIA 4KR0B 3HZGA 2C42A 3KLEB 3FMWA 3QRPA 4ZJLA 2M8DB 2ASJA
chains in the Genus database with same CATH topology
2HHSA 4IG0A 2B5JA 3O1LA 4FP9A 1VIOA 1N34F 1WHXA 2V4JA 3HF5A 3M6VA 4X2BA 4WYLA 2VUGA 3TVYA 4UQTA 4ZA1A 4A47A 2W4PA 3N01A 2ZUGA 1QSLA 4QYZJ 2RRBA 3OBIA 5A8KA 2ZM6F 3LWMA 5J2MA 1FKAF 3K5PA 3MAHA 4EZ9A 2LA6A 3T3FA 5D4LA 5JVGQ 1OPZA 1CSJA 5E41A 5I3QA 4X4PA 2OFHX 1NK7A 2DHSA 5E3CA 4WZQA 1A9NB 3KLIA 1BGXT 1ZAVA 2AJ1A 3AA8A 4LF5F 1S6QB 4YB7A 1PC4A 3M4XA 4HKQA 1DQ8A 4JOUA 5GADU 4NA2A 5IM0A 2VASA 4RNOA 2R8IA 1LK7A 3JSMA 1WHYA 4OI3A 2B0GA 2WB1D 2ZOMA 1IQZA 3FFIB 1FESA 4CO4A 5A2QY 4DL7A 1RTIA 3QJJA 1FDNA 1QAYA 1U7LA 2VG6A 4CT8A 3H25A 3MPYA 2V4QA 2ZH4A 4B9SA 1MWZA 2NUHA 2JHEA 2W7AA 4A8XA 1EP4A 1JJHA 4DEZA 4GC6A 1R8PA 3E8OA 4QR1A 2B4PA 2OTLS 4DSKA 2I38A 4O3RA 2ZBCA 1NKEA 5SUHA 4PQUB 1U26A 3K5OA 4DL2A 3T6BA 4NLVA 1YRTA 1SV5A 2L9DA 2YKMB 3NMAA 3QMQA 4KTQA 5FIIA 1VJWA 3MMAA 3MM5A 2L9NA 2OSQA 3SQGB 4A8SA 4QW9A 2AF6A 3GYXB 3LO3A 2ZZMA 2K8GA 2DBBA 2PE8A 2DT9A 2XI2A 3VWSA 1KLMA 1SB6A 5SZTA 2ROPA 1Z4UA 1UETA 3TX8A 4K5SA 1RI7A 4CO1A 1I6JA 4CNZA 1S0NA 4LSNA 1VQ7S 4F26A 1F60B 5GAEI 2R7OA 4ZLPA 4QZVB 2YNFA 3P3DA 1QAIA 2RU3A 2J7UA 1XN9A 1YJVA 1IKXB 2ZFHA 3FJ2A 2CZVC 3CJKA 1U48A 4V19X 3UPFA 4HVZA 2KO1A 1JLAB 4NLUA 2M4MA 4WYWA 3CCSS 3EPGA 5L1IA 4MKBA 2YKOA 2HWHA 3MI7X 5HN0A 4K4YA 2LEPA 2OPRB 4M94A 2ZH1A 1TV6B 3D1OA 1WHVA 2R2SA 1REVB 1TAQA 3IWXA 3HP6A 3D0IE 3N6LA 1HQUB 2E5IA 3ZZPA 2CQIA 2RRNA 4UUWA 4KPYA 5KG6A 3RRGA 3D0GE 5HP1A 1YITS 3E01B 4Y0FA 1RT3A 2EI5A 2V8HA 2XMKA 4ZDNA 2XWYA 5J1PA 2HZCA 1X4BA 1WNEA 1MSWD 2BRLA 2MQOA 3M2VB 4GKKF 4ZPAA 4RW4B 2WSEC 3V6KA 4JI6F 4ED5A 5EN1A 1X4FA 2KM8B 3PEHA 2UVUA 4O4GA 5JVHQ 1M5PC 2SXLA 1F5BA 2VZ9A 2E1RA 2E7WA 3PJXA 5JUMA 2Q1LA 4ZP6A 3AA9A 3G9CA 1WG4A 2CQ1A 4HL9A 1SI9A 3ZZ0A 2DO0A 1ZOTA 4DJBA 4DS4A 4QIVA 4NWBA 1GXUA 2QLWA 4DDFA 2JSXA 2EKYA 1FDDA 6FDRA 3T1YF 1CPZA 3GIJA 3Q23A 2XHWA 2Y0SD 4OHWA 5FJ4A 4OZLA 4NLPA 1N5VA 4OX8A 3UQSA 4PWDB 4Y28C 1ZM4A 2ADCA 3AHPA 4I6YA 2PMHA 1WTBA 2E5LF 5THWA 4JI0F 1IKYB 3O3LA 3I87A 4ZVGA 1Q53A 3L3CA 3BN4A 2IMWP 4PG5A 2JOQA 5KFYA 3PO4A 5H9EJ 2IYGA 1GAOA 4IR1A 4FS1A 2XBPA 5K8MA 3LUYA 1KFSA 4I6WA 3I32A 3I55S 4ECUA 4FNIA 3I4PA 2AQ4A 1IBLF 1R8AA 3KK1A 3KMSA 3P49B 1WTFA 5DETA 4I1TA 4NLRA 3TR5A 1BC6A 1F5AA 2LLZA 2XB2D 3QIPB 4K4VA 1FJCA 2PSZA 5BJRA 2LMIA 3R5CA 1VRTB 1C0TB 2FC8A 2QO3A 1IKWB 3ULHA 2XMTA 4I64A 4LVOP 3KK3B 2MGZA 1S48A 2ZITA 3UDCA 3TW0A 2VODA 3WX4A 4QCLA 4IG0B 2VFUA 2Z4PA 5KOWA 2E9ZA 2A2CA 4NLQA 4X4QA 1RT7A 3QLHA 5LSOA 3N6MA 2V4JB 1U6FA 1W25A 1RYRA 4YOEA 1Y4ZB 4YDDB 4ES3A 5A8KB 5F3ZA 1WI6A 3ITHB 3IG1A 2BXJA 1TFYA 2MZ1A 3ENWA 1TL3A 1X4AA 4AUKA 4Q43A 2IM0A 3H4DA 1VLYA 2LEBA 2O5DA 4LFCF 4IQXA 2DPJA 3D2WA 1HPZB 5EX0A 2DH9A 2PA3A 2QMXA 3KWMA 5CYMA 1HBNB 2UVVA 4NZ0A 1S9EA 1K0VA 5I3PA 5B0DA 4P2SA 2ERRA 1RT2A 5IM0B 3VAMA 4MFBA 3JSMB 2JC1A 2HVZA 3MM6A 2XC9A 1FDBA 3KMQA 4DV2F 3X1LB 2EWHA 2XI3A 1FXDA 1TK8A 1RTIB 1D9DA 2LU2A 2VG6B 5KFCA 1T8EA 1NB7A 4DL4A 4G1QA 1Q79A 4TLRA 2Y1IA 4FF1A 4QW8A 4IRDA 3TYTA 3UNGC 2KZMA 1EP4B 2CDQA 3QAUA 4J5OA 3MEGB 4HLBA 4NYZA 1S6UA 3SCKE 2HS0A 3AJ1A 1JXEA 5DG9A 3DLLQ 3GMGA 1ELOA 4I2PA 1Q7LB 4KSEB 3L7OA 3QGGA 4DV6F 1TKXB 3MMAB 3MM5B 1M5KC 4C2MA 1GQEA 2HWTA 4YB1P 3G6XA 3HHKA 4ZCMA 2E5HA 4ZVHA 3DLKA 4FVMA 1VQ4S 1GX5A 1OIAA 2KG1A 3OTOF 2XY7A 3MCSA 2Q43A 1UVIA 1VBZA 3M05A 1YGYA 2OD6A 3DDNA 2IA0A 1TK0A 2ZHBA 2AV5A 3D54A 2CPIA 1O51A 5HQ8A 3PX4A 2YNHA 4HT5A 1K8AT 3CMES 2KFZA 5F8IA 2FHJA 1X4CA 2OMOA 4ED3A 3CJKB 4QU6A 2CQ3A 4IOAQ 3TA2A 2PI5A 2J7KA 5GAEU 4DS5A 3M2UA 1TL5A 2J6TA 3SSQA 1S72S 1M90T 2DTJA 3HVTA 3BSAA 2AGPA 3MM8A 3ZZOA 1FD2A 2MQLA 4FXWA 3EGWB 1N52B 2KRRA 4RW8A 1M5OC 2JEFA 3DXBA 2XMUA 4ZVFA 2OPSB 5E3QA 1B0PA 1N0VC 1B64A 4FF2A 2KXFA 4LVNP 5KFGA 1FRKA 4XK8C 4DL3A 2W8KA 5HP1B 2JEGA 2G4BA 1KVJA 3PVXA 3BREA 3GIKA 1RT4B 5D3GA 3DXSX 4ILLA 2MKCA 2IM2A 3LGNA 1X9MA 3H5SA 1FKOA 2VQFF 2BM0A 2BRKA 2CPJA 4CO0A 4KV8A 4O4GB 5HL7Q 4NCGA 2JJ4D 4EZ6A 1MU2A 4EGLA 2HG4A 4KT0C 2LECA 4H4MB 3VF0B 1M1KT 4R8UA 3E3XA 2KYXA 3BQ2A 4IH5A 4WXOA 1S77D 2B6AB 2WOMA 2RQKA 1NHUA 2XWXA 3LAMA 3R5AA 2IBKA 2CQGA 2WHOA 1VQLS 3ISNC 1YIJS 1S1VA 4ECYA 4K4SA 3OTDA 3G4SS 2FY1A 4Q8EA 3J80Y 4KKOA 3HHLC 1U49A 3V81A 1IBMF 2M70A 3D0HE 3PX0A 4KAIA 1R8BA 3PR4A 3EPIA 2DNQA 4KHRA 4OMFG 4QQBA 3BEGB 3TAMA 1RTDB 1S6OA 1IM4A 3TAQA 3TA0A 1NRKA 5DDQC 3V6HA 4QWEA 2VG5A 3VTIA 4OLOA 2R7SA 4PG8A 3N4WA 2DO4A 4PG6A 4OJHA 4OI4A 1O8BA 2ROGA 2MZQA 2WK4A 5T41A 4MIBA 3RB3A 2B7CB 1JLGA 2DRAA 1UVNA 5F9NA 4PCQA 2CQCA 3ZZRA 1QVFR 3RW6A 2D3ZA 1P1LA 4IG3A 4OZNA 3OPKA 4O23A 4RW6B 5C24A 5EWEA 1T05B 2FJBB 2OMLA 2B3TB 4CNYA 4XO0A 4ED2A 1XEZA 3AAWB 3HK2A 3ETOA 5K9FA 2J6UA 2MGZB 5HMWA 2F9DA 1GXTA 2QZ8A 1SUQB 1LFPA 1ZZFA 1SJFA 5H1SV 2B9XA 1RTHA 4KHPF 1RT7B 2HLTA 3QLHB 1XERA 5JXSA 4X4TA 5KG3A 3GV7B 2G13A 5A8RA 2EBEA 4E0DA 4LF9F 4O0IA 2R2UA 4LSLB 1R3NA 1VQNS 4YP3A 3DHXA 1S1WA 4ECVA 1TL3B 5D78A 4R25A 1C4CA 3OVSA 5HMXA 3F41A 4FBUA 3CVKA 2RT3A 5CYMB 4ZCLA 1X9SA 2KXHA 2HWIA 2KB2A 3IRXA 1ZZNA 1SXLA 2Z0GA 4MFBB 4QWDA 1TL4A 3MM6B 3PRBA 3D1QA 3CCLS 1SKSA 1V3RA 4RX6A 4B9UA 2NYIA 1Q81T 1NJXA 2CPDA 4EO8A 2XZWA 1N5SA 4A46A 5KFEA 3K57A 4PXEA 5KFSA 2W9BA 1FRMA 5A6WA 2DVIA 4G1QB 4ICLA 2YX4A 1FCAA 2LDYA 4R0JA 2J9EA 2IMOA 4KGKA 3NCQA 3FSXA 4I2PB 1LXJA 1BWEA 4DFPA 4PUOB 3LPYA 3G6YA 2KTQA 4RW9A 1KQSR 1IJFB 2IM3A 2HNDA 3TVKA 3TI0A 5B0CA 3DLKB 2GQCA 3ONQA 2FVCA 3G6ES 4WFYA 3SV3A 2CRLA 3EZ5A 1VMBA 1HHTP 2JWNA 2NS1B 1T3OA 2AJ0A 4OFZA 2YNGA 1U1NA 3MGJA 5M2PA 4O3OA 2NSBA 1JLEA 5KG0A 4H4OB 2AYEA 1BQMA 2MSTA 2VL1A 2YNHB 4DR2F 3PX6A 3P96A 3H2LA 3POTB 2ASYA 4DOZA 1QAJA 2M8HA 1OSCA 3RRKA 5GMKa 4B9VA 1JKHA 2LQJA 2MQNA 3M2UB 3N9UC 1S6QA 2O1PA 3HVTB 2VQEF 1RWUA 1JJ4A 1CC7A 3MM8B 3W2WA 1Z2LA 2CFXA 4IFYA 1NJIT 3QGPA 2AD9A 2MZTA 3UDLA 3VAFA 3HDSA 4RW8B 1HI0P 3MECB 2BANA 3N5BA 2VBYA 4TY9A 2KRBA 3ZZYA 2EVZA 2YWHA 5J1EB 1IBKF 1S1UB 1RQ0A 3VAIA 2AU0A 3O8WA 1J5EF 5KT7A 2RQCA 1XC9A 2M5YA 2K3KA 2MHNA 2BJDA 1A7GE 2OLWA 4USJC 5D3GB 4J9MA 3GWCA 2E44A 2DR7A 4N56A 1FKOB 1LKZA 3QZ7A 1S9FA 3ZZZA 4KE5A 4TYBA 1X4GA 4C8LA 3BSNA 2E29A 1UVMA 3CDBA 2YNIB 1NH7A 4NCGB 2P9GA 1QSYA 2GHVC 2JC0A 3MTKA 3H20A 3SEOA 2VKZG 2AW0A 3PY8A 2RMLA 4NRUA 2F8MA 3I5CA 4ZHRA 1HMVA 4U7UK 2DR9A 4N77A 2WOMB 1ULRA 4C7QA 4ED1A 2E1MC 4MK7A 1SL1A 3DRSA 4F8RA 2J8AA 2Y1JA 1S0MA 1S1VB 4DQQA 1HD0A 1IR0A 2QIFA 2YWGA 4JI2F 2IRXA 4I7FA 3IAM9 4KKOB 1DARA 2W4DA 2QA4S 3V81B 4B02A 2F4VF 5E2QA 1JLAA 3I96A 3PHEA 4HH1A 2JEJA 3NRBA 1TAUA 4WKRA 4PQAA 3TAMB 3SCIE 3I56S 2RQ4A 4NYOA 1AFIA 5C25A 1U25A 3CCUS 2EPIA 3PW2A 2RIJA 4X4NA 1F0XA 2OPRA 2VG5B 3LAKA 2DGTA 5KT6A 2KFYA 3IR5B 4RW7A 4PG4A 4ECZA 2UUBF 2G0CA 2GC8A 2IYIA 1REVA 4DMZA 1QUPA 3KOAA 3PIOQ 1C1CB 1JLGB 3LP0A 4QOTA 2ZH9A 2IAJB 3GYNA 3TUJC 1ZYQA 3AB4B 1WEZA 4C8KA 2XMMA 4IUFA 2PN6A 3OQ2A 4F3MA 5C24B 1HNWF 3G8QA 4DL0C 5LSLA 1X0FA 1LQ9A 2PDAA 3D5MA 4RW4A 1KQGB 2IRYA 5KG7A 3T6JA 1RTHB 2YVSA 4XAKA 2RF2A 2NLWA 1VQ5S 1UEUA 2C2EA 1RTJA 3I5AA 3CUNA 3J7A1 5A8RB 5KFDA 3QJPA 2XLIA 4PXCA 2R8HA 2W7OA 2FJEB 1Y5LB 3TO8A 3CIZA 2MDAA 5CD4H 4F4KA 3CPWR 3HHNB 4N8NA 3UW1A 3RAMA 3KYLA 1UJ4A 1WEXA 2NZ4A 1S1WB 2HRYA 3BS9A 4QYRA 3NAHA 4UY85 1TKZB 4B9TA 4Q2LA 1WI8A 4HHJA 1UKUA 1YVFA 3K2YA 3BDPA 3IS9A 4YEAA 5GAHU 3CCQS 2MPUA 1MMLA 4IOCQ 4NLWA 3IRXB 2AYBA 3X3UA 3TP2A 7FD1A 4TU9A 1J5OA 1HNZF 2FLPA 3DLHA 1YJTA 4RKUC 3M8PB 4TYAA 4HTIA 3IAS9 2EFOA 1FNMA 3PKYA 2CQ4A 2HHXA 4TN2A 1DTTA 1FVSA 1Q8IA 2W9BB 5KFKA 2D7SA 2DGSA 4WE1B 5FD1A 2YKAA 2R8JA 4ICLB 4IRKA 3DLJA 2F8EX 5MAOA 2YKPA 1U47A 3C6TA 1JLQA 1TL1A 2LVWA 3LH2S 4N47A 4C8MA 3CEDA 2BOPA 3PDNA 2PA8D 2FDNA 3LP2B 2R7QA 3LQVA 3SSRA 4OHZA 3SYZA 4EBDA 1DQ9A 2LXIA 2DNZA 4KHMA 5KFFA 2XS7A 2FHKA 4X64F 3PO5A 4NLSA 3H98A 4FVCA 4C97A 3CCRS 1VRTA 2HNDB 2CQHA 2DITA 1IKWA 2H5EA 4B3SF 1NEEA 1AROP 1FXLA 4J9KA 3CD7A 2DHGA 4F4XA 3CDAA 2RH3A 1IQTA 1HNVA 3NS6A 3M32A 2YNGB 5K14B 2VPWB 4CO2A 4K2XA 5AE3A 5CYJA 1JLEB 3QYYA 4OV1A 4OX6A 3KKFA 2LA4A 2I5JA 1HNXF 4L6V3 1BQMB 1T3NA 3QJLA 3HX9A 5KT5A 3ITHA 4OJ3A 2JX2A 3IRWP 4ZPCA 5L1JA 1YJRA 4LUBA 2DNGA 3KG0A 5C5JA 4DFMA 2HHTA 1HFEL 4K4WA 4X4RA 1JKHB 2BV3A