1I94F

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1i94F00
5LMUF 4AQYF 2J5AA 1XNQF 2B7BB 4JI2F 2KJWA 1XNRF 4JYAF 1GH8A 4OX9F 4DV3F 1HNWF 4JI8F 4NXNF 4DV2F 2F4VF 1I94F 4JI0F 1LOUA 1XMQF 4K0KF 4DR3F 4YY3F 2E5LF 1HNZF 4LF8F 1XMOF 2UU9F 4DV0F 4LF7F 2UUCF 5IWAF 4B3SF 2BXJA 4B3RF 2RJZA 2UXDF 4JI4F 2ZM6F 2KJVA 1RISA 1N34F 4B3TF 4X66F 4JI6F 4DV4F 2BVZA 1CQMA 1HNXF 2VQEF 4DV5F 4GKKF 4B3MF 4LF9F 2UUAF 4NXMF 4DR2F 4X62F 3R3TA 1IBMF 2B7CB 1CQNA 1HR0F 4DR4F 1FKAF 5BR8F 2UXCF 5AJ3F 4LFBF 4LFAF 1J5EF 4JV5F 2UXBF 1IBLF 4DV7F 4LF5F 4DR7F 2VQFF 4DR5F 2HHHF 4DV1F 4DUYF 4JI1F 1B64A 1QJHA 3ZZPA 4DR6F 4YHHF 3T1YF 1N33F 4X64F 4DR1F 5LMNF 4DUZF 4JI5F 1IBKF 2UUBF 4JI3F 4GKJF 1N36F 4JI7F 1IJFB 2YY3A 4LF4F 1N32F 4KHPF 1F60B 1G7CB 3OTOF 3T1HF 1G1XA 4DV6F 4LF6F 4LFCF 1FJGF 1VMBA 1IJEB 4X65F
chains in the Genus database with same CATH superfamily
3DC2A 5CAAA 5LMUF 3DOMA 3WBZA 2BQRA 2AYBA 5KFBA 2JX2A 4JV1A 2ZHAA 4QIGA 4ZJLA 4S0MA 2QE5A 4OJ3A 3C19A 1KS2A 4DV0F 3HMJG 4ECXA 4WFNQ 4GKJJ 4Y2MA 4P2MA 4NA1A 2MXYA 2DR8A 2FVQA 1MMLA 1N8RT 2HBZB 1XBWA 1B70B 1R8HA 2HNZB 2VBXA 4KGKA 1WF0A 4R8UA 4RBVA 2UXBF 4C8MA 3OHBA 4AT1B 5KFAA 2UU9J 1R27B 2OPRA 5CA5A 3CJKB 2BOPA 2HS0A 1VBXA 1LW0B 1UVNA 2VKZG 3EE3A 2XM3A 2QG9B 3DDKA 3H5UA 1T02A 3KLGB 1C0TA 4JBCA 1ELOA 3DMJA 2ASLA 2FUG9 5J2PA 4O3RA 1RT7B 5DETA 2MZJA 3NOGA 3W63A 1TR0A 1JXEA 4U9RA 1Q5YA 2DBBA 4WZQA 4Y0FA 1NJYA 1SV5A 2VV5A 2F8EX 1TK8A 4NI2A 3V5RA 4ERDA 4LF7F 5G0RB 4DFKA 4OHXA 2PGCA 3UW1A 3CCTA 3D68A 4Y28C 2DR6A 3P4UB 3EXYA 4ED2A 4C3KA 2HBRB 3Q8SB 1RWMB 2RKIA 5J2MA 4NXMF 4IRKA 2ZBCA 5HBMA 1UVJA 1IKWA 1S0OA 5ETPA 5ETKA 3I9ZA 2UXCF 2BV3A 1PILA 3G71S 1M5PC 3GQCA 3W66A 3OSPA 2DNQA 4GC7A 4UZCA 2KN4A 3VVUA 1WI8A 1HNWJ 4B3TJ 5K8NA 2DGSA 3VAHA 4QU7A 2V8HA 5E7OB 4BCAA 2LFVA 5A8RB 4Q0BB 2R7WA 3FMWA 1W7WA 3W5YA 1IVZA 3FCVA 1KP6A 3SSSA 2FJXA 4K4UA 2VC0A 1UWAA 4KH0B 1N5TA 1AUDA 4F0HA 1P1LA 2ZH4A 4X2BA 2UUAJ 2R42A 4CO5A 3FMBA 1GK8A 5LMNJ 5EUHA 3FSXA 2RH3A 3POTB 2R8HA 1KFDA 2PEHA 5A8KB 1RAOA 3RB0A 4TU9A 2ZM6F 1RYSA 1CPZA 2VJVA 2Z56B 2HMIA 2VF3A 3UPFA 1X9WA 2JOQA 3GV8B 1FRJA 2B6AA 4MJKA 1KVKA 2BJ3A 2XSJB 5KFWA 3K5MA 1MMNA 3C3LA 1QAXA 1QUPA 3HDSA 3IP0A 3HPOA 4GC6A 5MLCV 4UF4A 1NUEA 1RTHA 2RQ4A 2XS2A 2WOMB 1CEZA 4CM0A 5BXIA 1DTTA 1QJHA 3PXGa 1EIYB 4XPEA 4YHHF 5E3CA 1RABB 2CQ4A 3NAHA 1VQ8S 3MUMP 3MPWA 4RUHA 2MKKA 2O01C 1X31C 1QLNA 1PYOB 2QA4G 1IR2A 1F60B 4KB7A 1NK4A 1SJ3P 3DOLA 1TKXA 1VJQA 3EGNA 1N5QA 2V69A 3HJVA 1HA1A 3QIPA 2YQ1A 1U2RA 5ITHA 5HLFA 4TQSA 2IM3A 2FJEB 2FLNA 3QAEA 3AH6A 4ZITA 3GJQB 5HN0A 3HVAA 4KRWA 1T7PA 1MU2A 2RHQB 3QT7A 2JLFA 3MTKA 4I4BA 2MQOA 2M52A 2XMVA 2Q6CA 2HFZA 1R8PA 1F5CA 3D0HE 4ES2A 3SEOA 3N28A 5HMYA 3SXLA 4I2PA 1S4FA 2W7OA 2RU9A 1IKVB 5KG4A 2C3OA 2RQMA 3CCSS 5CYQA 1T03B 1D9FA 3JS9A 2NYHA 2J9EA 2XB2D 4C8ZA 5BR8J 2YTCA 4IDKA 4LFBJ 3U02A 2WAQD 2VG7B 2N4DA 4G1QB 1R6YA 4JYAF 2RDDA 4PZVA 2IYIA 4LQ3A 3W65A 5F3TA 2QL5B 2XBPA 3DRRB 3KLEB 3ITHB 2E5IA 5KFJA 4LRCA 1OSDA 2WONB 2GJFA 2KJVA 4AYBD 4B9NA 1ZS6A 1D9DA 4CO2A 1UJ6A 4M5JA 4Y6IA 4RZRA 2HBQB 4R5PA 3BDEA 2V2VA 2R2UA 1VLYA 2OTJS 1RBLA 3GFHA 2GMLA 2E1RA 2O3DA 5IWAJ 3IG1B 4O4GB 2RVJA 3QRRA 1RKIA 1L3SA 3V6HA 4RPFA 2IC3A 3CNQP 2PMHA 2R8KA 4LF4F 3NBPB 4HHUA 4TNOA 1S0MA 4ELTA 2ZUAA 1NHVA 3EM1A 4DMZA 3BBCA 5EWFA 5B0GA 2RNEA 4J7CA 5D8HB 3PG9A 3Q86A 5I3QA 1M5VC 4USWA 3QGIA 3AXKA 4DQQA 3D67A 1NNDA 1I1GA 2Z2YB 3KUGA 3CCVS 3SCLE 3T5KA 2ZH1A 3RW6A 1KLMA 2GVZB 3DLKB 1RTJB 3UD4P 3HD1A 3UCGA 1UVKA 5D4LA 4MKAA 4ICLB 4M1KA 1X9SA 3HLUA 1N6QA 3JYTB 3N6NA 5IQQA 2J9CA 3HXMA 1IXKA 4DEZA 2JVRA 3TA1A 2F40A 2OGUA 2ROPA 2CXEA 3GFZA 1I94J 4CLFA 5B0CA 1VHIA 1WKLA 1Q95G 2JZ5A 3J81j 4W92B 3E01B 3IRXA 2ZH6A 1NDKA 4G3IA 3KUHA 3EDRB 4RNMA 4FF2A 4PWDA 1YRXA 3HI9A 2JEJA 5DDRC 2HIQA 1EZZB 5KG2A 4TKTA 4JI0F 4C11A 1S4EA 3M2UB 2XCAA 2IIHA 4PXCA 3MEDB 1N36J 3RW7A 3IC1A 2D3UA 4RW9A 3U1NA 4DV5F 4C2MA 4LF9F 4LMZA 2MPUA 4OI3A 3UN3A 2RDJA 3T6JA 1FKAF 2YX4A 2AJ4A 4CLPA 2HNYB 4ED3A 2QGFB 2FJAB 3KK3A 1IKYB 2ZZTA 2AJ1A 2UV8A 2WRMA 1L3KA 3MMBA 4I2QA 4QIWD 3W64A 3BSOA 5GMKa 2NS1B 2GIRA 1J5OA 5HK4A 3DRPA 3CPWR 4UT4A 2MY7A 1U47A 5IT9U 2AGOA 2IM2A 2HHQA 1Q86T 1A7GE 4K4YA 2LLZA 1RHQB 2XGPA 1UL3A 2CZ4A 4YDDB 3JSMB 3EZOA 1LWEA 1XR6A 3RYLA 4IO9Q 6FDRA 4ZVQB 4JI1J 3BBFA 4YUDA 4RBUA 3BB5A 4CLTA 2P2CB 1ZM3A 3M1VA 4ZIWA 1RCOB 2QL9B 4DN9A 2HWTA 2W9AA 1IN0A 3BSNA 1SC1B 4WF9Q 4ECRA 4FDFA 2XI3A 2UV8G 3MM5A 3SDEA 3L4BC 5HQLA 1CQNA 3CJQA 1GEHA 3J7AN 2IRUA 2YPZA 2Z30B 2OPQB 2V94A 2RHSB 1EHWA 2K1RB 3A3OB 2FLLA 4USKA 2UVWA 3W2WB 1N0UA 3OTDA 2OPPB 3SCIE 3TJ8A 3B8HA 3GR0A 1SC4B 3NNHA 2DNYA 1XEZA 4YOEA 4NZ0A 1QAJA 5KG5A 2YKAA 4LVNP 2C2KB 4JI7F 1LV5A 4K4WA 2ZZMA 1UJ5A 4ZVEA 4LF6F 1LWCB 1VC0A 3CE8A 2QT7A 3R5DA 3K8VA 2KJWA 2IM0A 1XNRF 2AYGA 3PIPQ 2VQEJ 1T9TA 2FJBB 3DDNA 2LDIA 1HD1A 3H25A 2DD8S 5KFFA 4ZVSB 3TW0A 1RHKB 5DM7Q 3H5XA 1MG7A 1DRZA 1HWUA 2BZ2A 3WQPA 3LAMA 1KRPA 4URSA 2PSZA 2F7VA 2XY6A 3SIPB 2FPHX 5KFGA 3TVKA 1Y9OA 2B43A 4OZ5A 2BYCA 1TUGB 3D9BA 2XNRA 5KOXA 5DQHA 1GNKA 1U45A 1Q7LB 1VRUB 4ELVA 4K4SA 2AZ3A 4DSEA 4LIRA 1GFWB 5KFEA 3PYDA 5L39A 2QN6B 3CJSA 3J81Y 2BJ8A 2YVSA 1FA0A 3FBBA 2V4JB 2CPIA 1YGYA 2BKNA 1JJ2R 1U8SA 5B0EA 4CLSA 2OLWA 2R2SA 3NS5A 2IBKA 2FVCA 1N48A 1RHMB 1U1OA 1S9FA 1Q8BA 1HNIA 4QIEA 3B82A 4A8XA 3HZGA 2JFDA 2V2QA 2GQCA 2AHOB 2MKCA 3OLBA 1DTQB 2DCLA 2DT9A 3KJVA 3AODA 1HHTP 4LFCF 3DLGB 2ZNZA 1NO8A 3C6UA 5J1EB 3KDNA 4WU2A 1HNXJ 5D0RA 2R8JA 2FJVA 4DUYJ 3QIDA 4WK1A 4AXJA 2DGXA 1U6ZA 3PHEA 3CVKA 4N47A 3MR7A 4ZPCA 3KLIA 4NLGA 4C4WA 3LTOA 1C0UB 3W1YC 2ZBPA 4LJMA 2DGTA 3LP1A 5L1IA 4F02A 3TZZA 1YBAA 2Z58B 4H4KC 2ZH9A 1BQNB 4DL2A 3MR6A 1QVGR 4M5KA 4Z37A 5FDLB 1VDHA 3NNCA 1KKHA 4DS5A 2ZH8A 3Q2TC 4IR1A 2DXDA 4FNHA 3TUIC 4F25A 4ZLPA 5KFCA 1BY9A 3ZC4A 4UOHA 3H5SA 3BBBA 2DGWA 5H9EJ 2BANB 2I5JA 2V8GA 1Y5LB 1YJNS 3HVTB 2DIVA 3RBDA 1IM6A 3OFEA 3JXOA 1SJRA 5H9FK 4F3OA 3ZTQA 4NXNF 4KQZA 2E5JA 2BR0A 2LQJA 1GXLA 1JWWA 2Q79A 3ILOA 1SBRA 3W2VB 4LF8F 5DGBA 3F44A 2EFNA 2WSCC 2R3VA 1TELA 4XK8C 2VB6A 3BN4A 2EC0A 2QJ3A 4X4UA 3H59A 4M5NA 4WZMA 2H9ZA 1VR6A 4DZ6A 4X84A 2BACA 4NLQA 4RO0A 3IS9B 2FHOB 5U47A 3ZNUA 5E41A 2E1CA 2BM1A 3GYGA 1XTZA 1W26A 2Y1RI 2NPFA 4PAAA 3TAMA 2D9OA 2YNGB 4KV8A 3K2YA 3EGWB 4QWEA 2VFTA 4OYMA 2FHMA 4F0KA 2XNQA 2XQCA 3DI6A 3HFKA 4NEZA 1GMVA 2OSRA 1SQFA 3BGFA 3MWBA 2AEMA 2DNHA 2YNFA 5C42B 3V6KA 3CJ5A 1VFJA 4B3OB 2E7WA 2ATCB 3D28A 5B08A 1SPBP 2OMLA 4QWBA 2OPSB 1IJEB 4URQU 1FDNA 4HI1A 4LF5J 3OL7A 2M8DB 4W98A 3LGMA 5D4NA 5HVFA 5I42B 3VAGA 2ERRA 4PWUA 2R8GA 1FRHA 2MQMA 1LQ9A 4NLRA 3HCXA 2RS2A 2E9TA 1RAJA 4NCGB 3QBCA 2HGNA 2MGZB 1KHVA 3IR6B 1HBMB 1HW8A 3PR4A 4CLYA 2LXUA 1OYEA 3R1HA 2XSFA 2ZOGA 4KKOA 3AA9A 2PIIA 3B4DA 1RT1A 2QMWA 1FK9A 4GVLA 2MQ8A 3NNAA 3QO9A 4DV1F 4JI2J 4ECSA 3T1YF 4FBTA 1U1RA 4ILRA 4QWDA 1GX5A 3UQSA 2KDOA 1G7CB 4FN5A 4ZPDA 2CNKB 5H1SV 2Y9HA 1EB0A 4DF4A 4CO0A 4DR5J 1X60A 2F4VF 1I6JA 1X4AA 3K5OA 3I55S 4ED8A 1YZ7A 4I68A 2F5GA 3CD6S 1PYTA 3D1HA 1FWPA 4WTOB 2BXJA 4DL7A 2B8QA 3JTNA 4QR1A 2V67A 1GMWA 1T3OA 1JLQB 4K8RA 3VR1A 1TL7B 1CC8A 3MMAB 4WCEQ 2CQBA 2MQNA 2DEJA 4GKKF 2JC1A 5HJYA 5K9FA 4HH0A 1FFSB 5HVHA 1JJHA 2C28A 2NXNA 3P96A 3UVJB 3KNAA 2CJ9A 2BQ3A 3GPAA 4X65J 3H2UB 5EGYA 2EK6A 3EVOA 4X4OA 4B9LA 4UTGA 1WOSA 1PBUA 2H5EA 1PSDA 2CADA 1JLGB 4UUWA 2X3DA 3OTOF 4GO7X 1VQ9S 2W2QP 1QSYA 1JK9B 5D6GA 4FXVA 4WIQA 3CCMS 4OHWA 3DFEA 4QWAA 3BGRA 1TQLA 3NP5A 3L7UA 3DGPA 4USJC 1AW0A 5C25A 3CJTA 3VALA 4DPOA 3BPSP 1CJTB 4MFBA 2KXFA 3MD1A 3CMAS 4D3GA 4G1PA 4OJHA 4FBUA 4K5SA 1Z4UA 1NDCA 2IAJB 3GWCA 4B17A 3JAMU 1RE1B 5LMUJ 3I5AA 3DM2A 3KKFA 2G2YA 1SJ1A 1TP7A 2GZOA 4EO8A 4UOGA 4LRAA 1NSAA 2D7SA 2MJUA 1NU4A 3RG6A 1O0PA 2DKOB 2KU7A 3M30B 4O0NA 5HP1B 2NCKL 4Q7AA 2ZOMA 3AQOA 2PT0A 3V2UC 4L76A 1NPKA 1S12A 2PA3A 4IG3B 3TO8A 1U0HB 2XMTA 2JC0A 3PTWA 3VGUA 3ZTOA 4QIVA 2ZKUA 5DG7A 3P5BP 1ZZNA 1LK7A 2IA6A 1QSLA 1DZ5A 1S97A 5JVHQ 4FKYA 3MUVP 3OR2A 1EARA 1P9QC 3F0NA 4TY9A 1RA7A 4K59A 2DHHA 1IBMJ 3HHLB 4B3SF 5K14B 4ZLJA 1Q4RA 2C2MB 4M5MA 1S49A 2M4MA 3KJNB 2IMWP 1EQMA 4I64A 5I3UB 4LR8A 1KSPA 2VBWA 3CDUA 5FIIA 3C8YA 2N82B 2H4YB 5HMZA 4PUOA 4F2RA 3MECA 3GB0A 3EVMA 3GFXA 2JHEA 1FDAA 1F6TA 2B4PA 4J5OA 2V4QA 3R5CA 3W8PA 2VPYB 1KBRA 4NLPA 3BYPA 4F4ZA 1VQKS 4LF7J 3J7ZT 1Y5IB 1VHFA 1DAXA 2CVEA 1RTDB 2C2ZB 1PCAA 1TL1A 4BBYA 3PDNA 1YQHA 2M3DA 4ETZA 1BUXA 1XMOJ 2M0GB 2B8PA 3GONA 1ZAWA 1TV6A 2GFFA 4LSLB 2E66A 3TUPA 3TI0A 4CM2A 3I82A 3IWLA 4HR2A 4ED4A 4JI6J 2Q3PA 1YJRA 1YJVA 3AD7C 1PO6A 1HNWF 2QFIA 2KRRA 1VQ7S 1S1UA 4QYZJ 2ZJRQ 3K8WA 2UUWA 1H73A 2H65B 1NHKL 2YQ0A 1ROFA 4N41A 4NRTA 1PIEA 2FJDB 4IH5A 3KLHA 3FFIB 4N56A 2UUAF 2HHVA 5KFIA 2YWFA 5FLXY 2W8KA 1WF2A 3WX8A 2DH9A 3NY0A 2QLXA 4KPCA 4KHPJ 1TKTA 4DCJB 2GV1A 4C0HA 2MKIA 3AFGA 2Y0SD 5IQ6A 3HT3A 3J7YU 2ZM6J 4ZCIA 1UETA 4QBUA 1YJUA 2JLEA 2VODA 2FZGB 2ZKTA 2DHSA 3GCWP 3GYNA 1TKZB 1E6VB 1Q8IA 3Q2SC 4Z7YA 4E2FB 5IFMA 4QR2A 2XMAA 2B7BB 3OR1B 3TWZA 3AJ1A 3Q8VA 3MI7X 2D9PA 3NS6A 2HSEB 2N7CA 2JH3A 2YWHA 1A6LA 2JDJA 3LP0B 3KUEA 3TA0A 3PY8A 5KFYA 5KFHA 4HI2A 1FJ7A 3BEGB 5LSOA 1CJUA 1JLAA 4P6QA 4CTAA 1RWVB 2W2MP 4N8OA 5E2QA 4B3MF 2HFOA 1GMWD 5CQGA 2H48B 5EWEA 3MR5A 2YWKA 1HQEA 2BW2A 2HQGA 1NZAA 3D0GE 2LECA 1RKJA 1J27A 3M8ZA 4A8SA 1FD2A 2E7VA 5D0EA 4U6PA 5A2QY 2A2CA 5GAGU 2NREA 4P73A 1P9YA 4YY3J 1DBDA 2LA6A 2AV5A 2Q66A 2MDAA 1S77D 2FYXA 3US5A 4QCLA 1TK0A 3MOZA 1UPPA 3M7VA 3NOCA 2WB4A 4ID5A 2FHKA 4AQYF 1AFIA 4B3OA 5D0HA 1F2GA 3KMQA 3QSIA 1RU2A 3V6JA 5GVQA 2K3IA 1TL3A 4QIFA 1S0VA 4LSNB 2KTQA 3R7NB 1HBUA 1NB7A 5KFLA 1QSSA 1KOOA 5EX3A 1BQMA 3VZHA 3W62A 4DS4A 3F73A 2RAQA 1KQKA 4MK9A 1ICEB 2RMLA 2GW8A 2UZAA 1V5VA 2B4VA 3OFHA 4JYAJ 4DL6A 4ZHRA 2KG0A 1ZAVA 4N8NA 4YDXA 3OVAA 1HIYA 1FRXA 1V9OA 5D0GA 2RQKA 2ZOFA 2BE9B 2Z4PA 1BLUA 1X4EA 5AE1A 3I31A 4IO1A 2H5JB 1FXDA 3FBCA 1VRTA 3O44A 4V1Ak 2GHWA 4P10A 2MZSA 4H4MA 1CULA 5FD1A 3PVXA 5C2GA 4USTA 2R7SA 4RW7B 1FDBA 1CJVA 3N01A 1B0VA 2GGPA 2EC2A 2CJYB 3SI8A 3BR8A 4TXSA 5LM7E 3HVRA 4WP9A 5AXKA 3UE2A 5ETSA 2ILZA 2HQCA 5LL6d 5CYMB 2QSFA 3BGUA 3K5NA 4LF4J 1Q0NA 2DJWA 4IRCA 1ZTWA 2M8HA 3PCOB 3C15B 4ZPAA 4NMXA 3T19A 1GTHA 4PG7A 3M9MB 2F3JA 2HFUA 5L46A 5E3AA 3TVYA 4OI1A 2V8DA 5KT6A 2C2OB 4YFUA 3SFUA 1HBNB 1YRUA 2Y8WA 4DWIA 4KHRA 1KNZA 4P2SA 3C14A 4RR5A 3LO3A 3IR7B 1LW2B 2IPOB 3G9CA 3GJTB 1FKPB 1AZSA 4A8QA 5I4MA 3OSNA 4ZA1A 3V81B 3M2RA 2W4CA 3IBWA 3BREA 2KL8A 2CWXA 3EX7B 2HHTA 3KK1B 2JVOA 4JI8F 2Z2ZA 4TYBA 1F9EB 1I94F 1HPZA 2RQCA 3I87A 1WKKA 4ER8A 4EK2A 1ZPVA 2DO0A 1HYSB 1X5TA 3JTOA 4LREA 3ET6A 3DHXA 1ZA2B 5JUMA 1S1TA 1ZM2A 2IDLA 4OI4A 3CD7A 3OUYB 2PI5A 4QPXA 4QOTA 1HWIA 4ZVRB 4YEAA 2W24A 1M1HA 2W01A 1M5OC 2AJQA 3MMCA 2QO3A 4ANCA 3KYLA 4JI5F 3PFEA 4DV5J 1HNZJ 3S8SA 4LF9J 1OS5A 3AY0A 2VUGA 4D3HA 3MURP 2HFSA 3B78A 2NR0A 1L5UA 1NPRA 3P6YC 3U27A 3VTIA 9ATCB 3IBFB 4J9VA 3VGVA 5BJRA 4H4OB 4RW6B 1X4GA 1JLCA 4DR3F 1XN9A 4ALZA 1S1XB 3Q89A 1YTYA 1RAHB 4OQJA 3EDQB 1O51A 2NXJA 2BJ7A 3I0SA 4LRDA 2BOAA 3NS7B 4J9UE 3VHQA 1KDNA 3M32B 3VAMA 3PV8A 2RUGA 5DDPC 4DSLA 2I6WA 1U2FA 4JI3J 4O3PA 2MMYA 2ZVIA 5AE2A 3DOMB 4RW4A 3BR9A 3T1HJ 2E1MC 5AE3A 2DRBA 4YP3A 4KGXB 1FKOA 4WXWA 1HARA 1U1KA 2XYGB 2DNRA 3HJFA 4FYDA 2ZDOA 3IBCB 3J7Z5 4IYQA 3TUZC 1S6QA 3QMQA 3QLHA 1V3ZA 5DG8A 3CGIA 1YK9A 2RF2A 2RRBA 2C42A 3K5LA 1F5AA 2J9DA 1SC6A 5JVGQ 1ZPWX 4KE5A 3PYEA 4A8MP 4R8UB 2G1HA 3HKWA 1WHVA 3CJ0A 3OL9A 2OPRB 3RRHA 4OYOA 4JI7J 2HK3A 3GG1A 2FGCA 2LQ5A 2DR5A 3QSYB 5HANA 5C5JA 1TVRA 4LF6J 4HKQA 1C0TB 3QJJA 2ZD1A 1RI7A 3DMJB 2VQEF 3HT0A 4WFZA 5J2PB 3A8KA 1XNRJ 3A8EA 1P6TA 5B0AA 3BO4A 4Z7CA 4HLBA 2B4OA 1HWJA 1PJ6A 3O3LA 5B0DA 3LOUA 1FWKA 2V9WA 1SV5B 3NWGA 4NI2B 1AB8A 1YKWA 4WFAQ 4USUA 4F8RA 2H51B 2VPXB 2J6TA 4G1IA 3K5PA 2HQIA 1H2VZ 1N32F 1OQ3A 1T8EA 2E9ZA 2RSQA 4G6VB 3N4WA 1GXUA 1NCLA 2LXFA 2RKIB 5J2MB 3RBXA 3HX9A 3T6BA 5HBMB 2PFDA 1IKWB 3D4JA 1TMMA 2KKHA 2J0XA 1URNA 2I8EA 4TQRA 1N5VA 5DDQC 3N5FA 1JNZB 4CO3A 4DL3A 3LQVA 2M5YA 3OW2R 1WNEA 4LFCJ 2HVZA 4ELUA 5IT0A 4DL0C 1HNXF 4HACA 1WHXA 3NXZA 2AWZA 1TK5A 1T11A 3NL0A 7FD1A 1R3NA 3W9IA 3IA0A 3NCPA 3W9HA 3K59A 3G6VA 1K1QA 3X3UA 2FGOA 2HZCA 3ZZPA 3ZZRA 1N54B 2KVQE 5D77A 3EGZA 1S9GA 4G65A 2GJ2A 1RUSA 3A8JA 3GILA 4DL4A 4OZ1A 4YB1P 2HMIB 1VGYA 2XZWA 2GVDA 2B6AB 1X4CA 3OQ2A 5CZVA 1GTEA 3TZXA 2AGPA 3LW5C 3UD5A 2UP1A 1RTHB 2ZE2A 3GSDA 4K4XA 1HNVA 4IUFA 2OAUA 3CDBA 1DTTB 3L7PA 5SUHA 3RU0A 4PEOA 5KFZA 2ZWPA 3ISNC 3V4IA 3SBMA 1RT6A 4TVAB 2B9XA 2QRRA 2VPZB 5CHCB 5L1JA 3DOLB 1TKXB 2O67A 2GC8A 2GMJA 4YR0A 1EKSA 4ZPWR 1CG2A 4NXNJ 1GXTA 5B7WA 3OBIA 1Z2ZA 2PE8A 2OD6A 4ZP9A 1J5EF 4LF8J 2G1DA 3QIPB 2VC1A 1WD6A 5HLFB 2HVDA 4IH6A 5T7LA 2V50A 2IVYA 2L41A 1N33F 4QPTA 1SL2A 1PG5B 1SJQA 3BSCA 4CQ1A 2A10A 3L7OA 1MU2B 4RLEA 1WEZA 4UQGA 4F4YA 1VQ6S 4ZPTR 2PN6A 3A12A 1RHRB 2WBMA 1LFWA 5DZ6A 1D3WA 3AT1B 1PAEX 3UCUP 3RBZA 2LDYA 5RUBA 3UI3A 3L9ZA 2HNDA 3D1QA 4OMFG 4I2PB 2MZTA 8RUCA 1RT2A 2RRNA 4I6AA 2FDNA 4UUXA 1QTMA 3NGUA 5T14A 2V2ZA 2JEFA 5CYQB 2BVZA 3PO5A 2CKWA 2VZ9A 3RJMB 4X4TA 3VF0B 3M6WA 2YPYA 1A0OB 3CJ4A 4IDKB 2KZMA 2HRYA 3DRSA 4FXDA 3WHIA 5BYRA 2HHXA 2XULA 2J6SA 2HHHF 3ZZYA 4EU0A 4Q45A 1VBKA 3NAIA 2OFHX 3I4PA 2HEKA 1FRLA 1BD6A 2PD1A 2YKNA 3U7JA 2GQQA 3FEZA 3ELHA 3QAUA 1ZOTA 2Y3YA 2R7XA 4DX6A 4Y65A 2HFNA 4A4JA 2LEPA 1D9AA 3CCUS 4JI2F 2WB1D 2WVEA 1VC6A 4DV1J 4R5PB 2X1BA 4GMKA 4M95A 3T1YJ 1TAUA 4OJGA 3SCKE 3FEXB 5K8PA 2L08A 4F7VA 4RJVA 4KAIA 4B3RF 2H5IB 3H7HB 8ATCB 2HVEA 3J80Y 2IC3B 1YSJA 2QTWA 5D3GA 2XY5A 2KG1A 4IH7A 4KGVB 1YBTA 3DLJA 3UWTA 1AROP 3ADAC 4KY3A 3NGKA 3DLLQ 2F4VJ 4CNZA 5ETRA 2EBGA 2ZZNA 1FX2A 4M5DA 3KTQA 2QLJB 2YQ3A 4L73A 2A2DA 4K5RA 1UWBA 1N56A 1U02A 1JMTA 2ALZA 3IR5B 2JFKA 4ECZA 4TN2A 5KT7A 1B99A 3ZFVA 2ZHBA 3DXSX 1NJZA 3S01A 4NLWA 1IR1A 1V6HA 3PJ9A 4RBTA 4GKKJ 2V34A 5A76A 3LP2A 4ZVTB 1KLMB 3I0RA 5K5MA 5B0BA 4X65F 5HJXA 3FZ2A 3MEGA 1OY8A 3HZEA 1KC8T 4KGMA 4QYRA 3GSIA 3BM7A 3MUTP 1N6QB 3FSIA 1TFYA 1WG1A 1R0CB 4DDFA 3OTOJ 1S6UA 4CH7A 4CYUA 4J9QA 1HKAA 3EICA 3M6VA 2I1RA 1S6PA 4Q43A 1FNOA 3VQTA 3IRXB 3K7RA 3MFIA 1SIZA 1J2VA 1BWEA 1NKCA 3I56S 4PWDB 3TX8A 3CWJA 1U6BA 3NEKA 2A6MA 2AIRB 3PX4A 3EVWA 2FY8A 4DQIA 4L3NA 4C11B 4DSJA 1HBOA 4MYTA 1X4HA 2BDPA 4YR3A 4MKVA 3M4XA 2O66A 4C97A 4IFVA 1WSRA 4Y2AA 3M9NB 4X4VA 3E3XA 2WZ1A 3NCQA 1LK5A 4AL6A 4RW9B 1VMBA 2DGQA 1K9MT 1F9HA 3MEEA 2XI2A 2W4DA 3VV2B 4AXIA 1U2CA 2GMHA 5D15A 4ZPVR 4ETXA 2DPJA 3BZQA 3MM8A 2NUHA 5GAEI 3CJ8A 3KK3B 1Y10A 4WBFA 4C6AA 3LALA 4ZKAA 3MMBB 4I2QB 3BGLA 2MKJA 1J5OB 3DRPB 2XYHB 1VQYA 1TZ0A 3R3TA 2NZ4A 4K4TA 1IBMF 2CA9A 1QAIA 1LWEB 3HFZB 4B3SJ 4DSIA 1PC5A 3RRGA 3BJYA 5L9NA 5A6PA 5E0OA 1Q7YT 3MR3A 3M1VB 4X64F 4ZN1A 4CLUA 4PG4A 5MAOA 4QW8A 2Q6BA 4QR0A 1IR0A 3MM5B 5KG0A 3SDEB 3CC7S 1S0NA 1EP4A 1X7VA 5KT3A 1TAQA 2HAIA 2V6AA 4OLPA 3Q8UA 2OIHA 2MEWA 5DG9A 1HWLA 1XMOF 1OWXA 3HHEA 3QFHA 3VGTA 1TL4A 3F41A 5F8GA 2DNMA 2EG1A 2FLPA 3FJ2A 4R0JA 2KVIA 3FGVA 1XMBA 2HAFA 4YB7A 4JI6F 3ONQA 3CJ2A 2NSCA 2NZCA 2FVRA 3D0IE 2GJIA 5A0YA 4A46A 3HSZA 2HS4A 3QGGA 4FF4A 2WW8A 4DR4F 1FJEB 1F2HA 3ETOA 2HQFA 2XLIA 3J81U 1ZTTA 5AXLA 2DHAA 3BPDA 2VICA 2DY1A 3HF5A 4ED0A 2C3YA 3L09A 2EFPA 4YR2A 1JIHA 1U6FA 2M7SA 3O6QA 5C7PA 4OX7A 4DU8A 2AF6A 2Q43A 4KHPF 2LA4A 4X4RA 3OFGA 2Y1LB 2EI5A 4J9SA 2VOOA 5L8RC 5L38A 2F9DA 1KN6A 2ILYA 4DHVA 3QRPA 4OZ0A 3UN2A 4PQAA 1E6YA 3GZ7A 3CJ3A 1RT3A 2G4BA 5CXTA 2XEXA 4MAKA 3JB9k 2P6TA 3R5BA 5H9FJ 1HNIB 3CCES 3KNGA 3AAWB 1VLOA 2EXUA 5DGAA 2X1FA 3CCRS 3G8SA 2LQ8A 2D3O1 3KJVB 3WC0A 1ZAXA 1URRA 4C8YA 2CPXA 4DG1A 1RP5A 2XZDB 4H4KA 2GO9A 3C6UB 2BJ9A 4NLOA 2B9YA 1YDLA 2A0FB 3OTBA 1NH7A 1RZMA 3A13A 4BHQA 1NSKL 4CLZA 4KH1B 3KLIB 4B3MJ 3M8QA 4ZLLA 3LP1B 4YN3B 2YNHA 4ZJOA 4DFMA 3L3CA 1ZM4A 4ZCKA 3DYAA 5J2QA 2R2RA 1U1PA 3M6XA 1N5YA 1Y00A 1DLOB 2CRLA 4TY8A 3MMJA 4I69A 5LOQA 4YY3F 4OX6A 3CMES 4MIBA 3RUBL 3DOKA 3PM9A 2FB0A 4NYZA 4HL9A 1UJ4A 3KLVA 2MQLA 2L3MA 1G6BA 3P49B 4HDGA 2I5JB 4AQYJ 2IDEA 3QRQA 3OVBA 4ZP7A 4BWMA 1HD0A 4Z2XA 4ZP8A 2VFSA 4NLYA 2AQ4A 1DQ8A 1JX4A 1RCXB 4DV2J 2QMXA 2ADBA 1WF1A 2VD3A 4K0KJ 3KLFA 3EXCX 4NZ7A 2DH7A 1IJFB 1YHQS 3RGIA 1XIQA 2YH0A 3DLEA 2C22A 5KT2A 3W8GA 3JQMA 5M2UA 1VYAA 1X0FA 2LU2A 2NXEA 3FRYA 3TAMB 4KFBA 1N88A 3OT9A 4KV8B 3QZ7A 3PYGA 2ASYA 2MQPA 1I5OB 3H4BA 2PMWA 2ZVSA 1QAYA 3DI6B 4NLVA 1NLKL 2B9EA 2K06A 2P6SA 2YNFB 9RUBA 4MT1A 3PX6A 2YKOA 3LH2S 1OY6A 2E7XA 2VA2A 4A8OA 3AHPA 1SC3B 1PGZA 3VCDA 1JQGA 2CAJA 4NX9A 4OZNA 2CPFA 2UUTA 2WTFA 2WK4A 1WC6A 6AT1B 3UD3P 1KTVA 2IFXA 3MDFA 3IN5A 3HSDA 1QE1A 3TZYA 4PCQA 1NH8A 2VA3A 2QSWA 2K7KA 4F4XA 4FYVB 1NJWA 3Q83A 5IM0A 1CJKA 2AGQA 2FJWA 5F9NA 4O0IA 1BC6A 1VQ4S 2LQBA 3H40A 2BUNA 3PKMA 4KKOB 1LOUA 2F8MA 1WTBA 1RT1B 4EZ9A 1FK9B 4WK3A 3CULA 3MGJA 2XZTB 3TAPA 1LFPA 3QO9B 1X0PA 1D8YA 4LQ9A 3G87A 2C2RA 3AJDA 1EETA 4ZVPB 2ZC3A 1FERA 5HI7A 5KOWA 2ACYA 2MZRA 4CO4A 2HHPA 2YKMA 4JI8J 1B7FA 1X5OA 3W3SA 2W2OP 4UQTA 2KXNB 3K57A 5M2RA 1VQLS 2ADCA 2F9JA 2CQPA 3IFEA 4EYHB 4UY85 4OYAA 2XO6A 4DV7F 3CC4S 4Q44A 1BHNA 3UNYA 3NRBA 2NLWA 4OV1A 1REGX 3GIIA 2XMUA 1RQ0A 2JSXA 2F4FA 2B5JA 1K44A 3QNWB 4NRUA 4OIXA 4DPTA 1RLCL 2CPZA 1KOHA 4CRJA 3QJPA 4J9NA 2VBZA 2DNPA 1RK8A 2W9BA 1FCAA 3CCLS 2XMJA 1Y5NB 3PACA 4PQUA 1HNZF 4EGLA 4JI5J 3FQLA 1SL0A 4ANDA 2AJ0A 3Q22A 2BJDA 4F2SA 2FHJA 2RJZA 5F8NA 3CUNA 2OJ3A 1S76D 3CCWA 4RWXA 3FBFA 4LR9A 1HW9A 2KT3A 1RAIB 1NRKA 4IG0A 1WI6A 1DQ9A 1FE0A 2XWXA 2YKPA 3MAAA 4DR3J 2GX8A 4WKRA 2SXLA 3W60A 3BGRB 1S1VA 1IUJA 1HWKA 4K2XA 1S5ZA 3DGPB 5D4OA 3QT5A 1EX8A 2RU3A 5C25B 1VCTA 4BDPA 3PX0A 2MY8A 1O5JA 3ENVA 4ZDNA 4MFBB 1XERA 4JI3F 1MW7A 5C24A 4C8KA 2W7AA 3H8YA 4NCAA 4C8LA 2G9OA 3T1HF 3LA0A 5K8MA 1IKXA 1IWAA 3G6YA 3DM2B 3OJSA 4NLDA 3MM9B 3ICLA 5F9LA 4JP8A 4DR2J 2LMIA 3LAKA 3OPKA 1QUVA 5B09A 4CNYA 5KFOA 1FRKA 4GVBB 3C66A 1L3TA 2KFYA 2J7WA 3W9JA 1FEEA 2L9WA 1NSPA 2OD4A 4OYZA 2GAGC 3M6UA 1IBCB 4XDDA 3ZZ0A 4LIWA 3HD2A 3GP9A 3ENWA 4FVMA 3M8PA 4BS2A 2CPEA 2DHXA 1D1UA 4F36A 1FXLA 1PJ7A 4OZLA 3OR2B 1Y3JA 5ETLA 3TUJC 2XWYA 3CDWA 1OQ6A 1REVA 3RTVA 3ZZUA 1KVIA 4YS2A 2G0IA 4PG8A 2MLZA 2XC9A 2CG4A 4M63A 4J9PA 5KFTA 2Z0GA 1SKUB 2RE1A 5DDOC 1R0AA 1CS4A 4PUOB 2XHWA 4DN0A 3MECB 3ETMA 2RD5C 2W9CA 2AEJA 4C7QA 1JLEA 1YLXA 3FNNA 5BYQA 3N5BA 4P9SA 2W2PP 2XTJP 5CABA 4ES3A 4M5IA 3GYXB 1Y7PA 2VU5A 2QA4S 2L9NA 3VAKA 1TL1B 2VG5A 1N32J 4Q5VA 1OO0B 1R0BG 2DRDA 3D54A 2FC9A 4RW8A 4CIOA 3PW4A 1U09A 1FRMA 3D66A 2AEFA 3S1TA 1TV6B 2GQ2A 3QJLA 3T41A 2EG2A 4IFYA 5FLXU 1LWXA 3KK2A 2KM8C 4DQRA 3UCZP 1HI0P 2ASJA 1OY9A 3SYZA 1S1UB 1RACB 4NA3A 1FHTA 3W7BA 1MN9A 3G4SS 3Q8QB 1YVFA 2A18A 4Y00A 3I6PA 4CH0S 4HTIA 3A4TA 1FJGF 4CZCA 3KLHB 1RWUA 5DJBA 1C4CA 2GA7A 3ENQA 1MLAA 3MM6A 1WC3A 1NAQA 4O4RA 4DV4J 4B9TA 1VK3A 4W90B 2CPYA 2YNIA 4FYXB 4OLOA 4OX8A 3EPGA 1TKTB 1CVJA 4OYBA 3BQ1A 2BEFA 2CWKA 2CQ3A 3PIOQ 4ZJQA 2L48A 4RNOA 4J9KA 2AJ2A 3PKYA 3DN9A 1DLOA 2BKOA 3PW5A 4KGZB 2BA9A 3TJAA 1LWFB 3MPVA 1GQEA 4V19J 5DRKA 4RNNA 1T05A 3KHHA 5ETMA 3RB6A 1KTQA 5JXSA 4TU8A 1MMDA 4DX8H 1SH3A 5KFMA 3CCQS 1MWQA 4KYZA 5E3RA 1K0VA 4WIIA 1FEHA 2HBYB 4DV3J 4DZDA 5A2QU 1RDRA 2DPIA 1CJUB 1JLAB 4YB5A 4CTAB 1M0SA 2J6UA 2OO4A 2HRTA 1SUQA 2G0JA 4ED5A 4C48A 1J5EJ 4TLQA 5IC4B 4DL5A 2OELA 5CH7B 3G6XA 1JKHA 1UKUA 2GHVC 2OFGX 3D1OA 1I51B 1HQEB 4WP8A 2VHGA 3P5TL 5IT4A 2G2OA 4B08A 2RB7A 4E8UA 1N33J 2M88A 2VDIA 4HT7A 3IGNA 4U67Q 1WC4A 1WJ9A 3GFYA 4DOZA 1UFKA 3DU5A 2B4UA 5KFUA 3T5LA 3AOAA 2FHJD 4WPAA 3UFCX 3PHTA 1EQ0A 2ZJQQ 4ID5B 3I5BA 1YBUA 3HHLC 1BWVA 3R2CJ 1K1SA 1OJ4A 4DXLA 2W1BA 2MKYA 1MROA 3LPEA 4DR7F 3SSRA 1TL3B 2CNOB 1HBUB 1NK0A 1RWPB 4BC7A 2KHCA 4KR0B 1BQMB 4O44A 4NOHA 3CCJS 5F3ZA 4DSKA 1NZ8A 3EWGA 2DEIA 3T9NA 8AT1B 3RBEA 1BGXT 5I3PA 4KT0C 2FIUA 5EDWA 4DLEA 2CJXB 3BS9A 1PAUB 1RADB 4ZHRB 1RHJB 1C1CA 1RTIA 4ECYA 2HHHJ 2HHSA 4K50A 1FVQA 4MKBA 4XAKA 3SV3A 3MPYA 5CCMA 1VC5A 3PYFA 1R6VA 4LVOP 2R9LA 1R43A 1K0TA 2VL1A 4ZIVA 2ZNYA 4XO0A 3M8SA 1UCNA 3AB4B 3RB4A 1RSCA 3R6LB 1RT4A 1VRTB 4ECTA 1G2EA 2DXEA 1U8WA 4H4MB 1CULB 1TUWA 2JL9A 2QFJA 2VPWB 4EMDA 3LANA 3GJSB 5BYSA 4LF1A 2VG6A 2B51A 1CJVB 2GGPB 5KTQA 3HHKA 4B3RJ 1WDTA 2MKHA 1NEEA 1V3SA 1YZ6A 1RT5A 3M05A 3RB3A 2BQUA 3H90A 3C46A 3C6TA 1DFDA 2NUUG 3OD2A 4I7FA 4NZ6A 2JJ4D 2B9WA 3G82A 2H1YA 4DPUA 1FDDA 4A48A 3BKUA 1XNQF 3CD0A 1Q82T 1JLFA 1KD1T 1QVFR 3P3DA 2G2ZA 3FSYA 3OTCA 3K17A 1XR5A 3NGSA 1FF2A 2CDRB 1KEKA 1KHWA 3C16A 1S59A 3TR5A 2ZUGA 1LKZA 3C14B 1Z2LA 1IBLJ 1MN7A 2EFQA 4JV2A 2HS3A 1X4BA 3HO1A 1RISA 4AFFA 5A8WA 1UAWA 1AZSB 3R5AA 4ZVUB 3QWUA 3M2RB 3EZ5A 3LWMA 2D1CA 3CMQA 1APSA 1IQZA 3D5MA 1D0EA 5AJ3F 4OV6A 5HROA 3HULA 3V6DA 3OHAA 5HSPA 3TX0A 4P75A 2WBRA 4AL5A 3ZZTA 3CIZA 1HPZB 2IA0A 2C2DA 1K8AT 3QPIA 3KMSA 2V4RA 2QYCA 3D6MB 3BH6B 4I6YA 4O3QA 3P45B 3TANA 5HATA 4FF1A 1F9FA 4WJBA 1AA1B 3ET6B 3WDOA 1DHMA 5L9XA 4ECQA 3JTPA 1S1TB 1T9WA 1F3FA 3OFFA 2MQQA 1WC0A 1Q53A 1XQIA 3ZNJ1 1S7HA 4OHVA 2I9SA 4F26A 2ZH2A 1B4SA 5JMNA 4O3OA 1UA1A 3SZ2A 3MM9A 3FK4A 5FJ4A 4F04B 3UDLA 3A1YG 3MMCB 4ILMA 5KT4A 2CG8A 2KZZA 3PJWA 2OH2A 2HHWA 2VH7A 1TU0B 2DXFA 2ZBRA 1WC1A 4GVBA 1QM9A 4ANEA 1O8BA 5IOLA 3CSKA 1EAYC 3GV5B 3CJRA 2DYAA 1C2PA 2DK2A 5ETNA 1JLCB 3KFWX 1FX4A 1B0PA 2J76E 4B02A 2HG4A 4M94A 4DUZF 3RRKA 2UUBF 5C2CA 4U95A 5L1LA 3ZTRA 3I0SB 1HQUA 2X1AA 1P1TA 4K2JA 2CJKA 4N5SA 1S1WA 2HQ3A 1X8DA 2COLA 3B4MA 2E9RX 3KHGA 2GAHC 7FDRA 2ZC4A 2XMMA 4RW4B 2VFUA 4X64J 2FC8A 3AD9C 1FKOB 2CJBA 1NJIT 3I9V9 3GLJA 5AT1B 2IMOA 4WE1A 3CEDA 4NCBA 2OI2A 2DR9A 3FEYB 1SB6A 4RNFA 1KWMA 2ZHOA 5IV4A 1S6QB 3BGOP 3QLHB 4IRDA 3BKTA 4LUBA 2B7CB 2RF2B 1L3VA 1YITS 5KG6A 2IM1A 1RXOB 4F4WA 2DGUA 4B9VA 3G86A 3LWLA 1UVIA 1OYDA 3IAS9 2YWGA 4DPXA 4YQWA 1SKWA 1Y0HA 1G4CA 1CLFA 4C0OC 2XYPB 3Q8YA 2K8GA 4W4MA 2VKRA 2M70A 2ROEA 3I5CA 1C1BA 3MAQA 1Y4ZB 4U8YA 5IS2A 2EPIA 1TVRB 3M8RA 2J7UA 2ZD1B 4DR4J 3MEKA 4UOCA 2E44A 4UW2A 2RUSA 1JJCB 2CNNB 3SQGA 5GADI 4PYDA 3MM7A 2UVUA 2DNZA 1NBEB 4OI0A 1WACA 2HW3A 2D41A 1Q8LA 4RUAA 4IOCQ 5AXNA 3TZWA 3O8WA 4FKXA 1Q8KA 3VQSA 5L1KA 2XMWA 1PC4A 2DNNA 2LP4A 2CJAA 2QA1A 1R8CA 1SCJB 2B56A 2J7KA 4EZ6A 1LWFA 4LFAF 2G0CA 4I56A 3QZ8A 3DU6A 4OJ1A 2JRSA 4LSZB 2ABYA 4CT9A 3QATA 2XS7A 1FNMA 1T9UA 1A9NB 4KO0A 1UVMA 1RWOB 1S9EA 3M2VA 3FBEA 3KDOA 2DNLA 2JNJA 3CIMA 5J2NA 1UW4A 1JLBA 4Q2LA 2E29A 1EJ7L 3DLHA 1X5PA 1F1BB 4HACB 1RBOB 2B3TB 2W4PA 2P8IA 5D4PA 4ZP6A 4A8WA 1V3RA 4FS1A 1B0TA 2DTJA 1Q78A 1W2IA 1FFGB 2QV6A 2I38A 2BE2A 4WYWA 1OIAA 1R7IA 1UEVA 3QFWA 2X7IA 1S9GB 1U0SA 3U1MA 1UZDA 4V19X 3A8IA 2GCFA 2GVDB 3C2PA 3WX4A 2VQFF 2OTLS 2CZ9A 2BW7A 1U48A 2ZE2B 1SXLA 1VK8A 3UNGC 1HNVB 1YWXA 1F0XA 1IBKF 2QYGA 2HYIB 2CFXA 2MHEA 1D09B 1X5SA 4DPYA 4JV0A 5KG3A 1EKRA 2BRKA 4CH1A 3V4IB 2J0WA 2HNZA 1RT6B 4FF3A 1YJWS 3M8WA 5ETOA 4MIAA 1VQSA 2FVPA 1UMJA 4OYXA 1VQOS 4DV2F 3R7BB 3CJKA 4FZVA 4K0KF 3THPA 3TOQA 1LW0A 4X62J 4ZVOB 1SQEA 4OHZA 3DCAA 5JJBA 2V8VA 4MKYA 4JV5J 3KLGA 5T7LB 3MR2A 2MSTA 3HP6A 4WXOA 4X4SA 1RT7A 2DGOA 4X66F 2E5GA 3RZAA 3EYZA 4U7UK 5GAHU 3O5TB 1VBZA 5DLFA 1JNRB 1PJ5A 1FO1A 2EVZA 5G0RA 4CO1A 3OL6A 5J1NA 2HNDB 4I1TA 4FXWA 2J0SD 3CC2S 1RT2B 3FUYA 2APOA 5CD4H 1T9YA 5ADZA 1H98A 2UUCJ 1ZM9A 2UXDJ 4USHA 5F0WA 2DHGA 2DO4A 5HVGA 2KB2A 3MFHA 2OEJA 2RT3A 2KYXA 2MSSA 4AE5A 1NK7A 2LXIA 2QA2A 1SVDA 3GG0A 3DRSB 3ZTSA 2JLGA 1NB2A 3QT6A 4IKAA 4PWWA 1FESA 3IGVA 4ZPBA 4F0MA 5A8RA 2V63A 4Q0BA 3KJQB 3MXHP 2YKNB 1S72S 4KJIA 3J80U 1OPIA 4MMOA 2RRAA 1FTCA 2H54B 1GMUA 3R5GA 5HAOA 1TUVA 5AXMA 2KFNA 2PEBA 3POTA 5A8KA 1WHWA 1RGVA 3H2VE 4DR6F 2D3OR 5KFSA 2O5DA 4EFAC 1RAGB 3RAXA 2Z57B 2QX0A 2R8IA 2JEGA 5D3GB 2XSJA 2CQ0A 4F50A 4URGA 1WORA 2MZQA 2XLJA 1DY3A 1KQSR 1N34J 3D3BJ 4DV7J 2V5HG 4PRFA 2CPDA 5CYJA 2WOMA 1S6OA 4M5DB 2W7PA 3H5YA 2R7RA 4P7TA 2V0NA 2MKSA 1YRTA 1UWBB 3BV8A 4WU3A 2FVSA 1H7XA 4LBHA 2IYGA 4EO6A 1HMVB 4DUTA 4AD6A 4MIWA 3LP2B 2DRAA 5KG1A 2DISA 3I0RB 1ZBTA 3OXFA 4TU7A 5KFXA 1RWWB 4I0WA 5KFRA 3MAHA 2E5HA 3MEGB 4HDHA 4ZVHA 3CCZA 2DIUA 4FNIA 4DV6J 3Q24A 1NK6A 2AD9A 2Z2LA 3G8QA 1RAFB 1T95A 3OL8A 2MJNA 2DNKA 2ZBQA 2VIHA 1XMQJ 2I2YA 5LSRA 4HVZA 5F41A 1UPMB 1GAOA 3TRGA 4H54A 5LXRA 4U8VA 3FDSA 4OYIA 5KAKA 4CYUB 4AL7A 2WCXA 3EZUA 1S6PB 1QTNB 2ZJPQ 1LXJA 2QZ8A 1RYRA 3N79A 2DITA 4RNHA 4C9DA 4NL5A 4L3KA 2BJEA 2YKQA 4PG6A 5GAEU 2HQDA 1RTZA 1IKVA 3UDVA 2QMUB 2VFRA 1HBOB 1T03A 4JI4F 2CQ2A 4HH1A 4NMLA 3H0PA 4U7UD 2VBYA 1QD1A 4IFVB 1M90T 3CD5A 4DR1J 4DR2F 3P8BB 2VG7A 4P2FA 4G1QA 3BF4A 3PNIA 3E2EA 1S7IA 1NDLA 3IWXA 4EUVA 3PEJA 3MEEB 3ISND 3DRRA 5F8MA 5DQGA 3KLEA 1WEYA 4M8LA 4TLRA 2HLUA 3ITHA 1UEKA 3MM8B 4OX9J 3W61A 2WONA 2MYFA 2XG8A 4CT8A 4HHHA 3THVA 2XO7A 4P74A 1OSCA 2LU1A 1YJ7A 5KT5A 4P2XA 3PRVA 3ILLA 4ED1A 1QDUB 3W5ZA 3HSJA 3KWMA 4F67A 2A1BA 4OZJA 4M5LA 3AB2B 2B0GA 1W25A 3AD8C 3IG1A 4O4GA 3TA2A 3R9LA 2OP5A 2CZVC 2FLOA 1SI9A 1AFJA 2XCPA 1GX6A 4DSFA 5KFPA 2MTLA 4L72B 1XWLA 1SKRA 2AKWB 3NBPA 3TAQA 3MCSA 1ULRA 4MK8A 1RU1A 1Q5VA 3H20A 2ASDA 3SQOP 2HGLA 1HR0F 3EUNA 4U7CA 4IR9A 4GRSA 4XIUA 1EP4B 3IAM9 1FRIA 3VWSA 3X1LB 4NASA 1U7LA 1U4BA 4P72A 1ZZFA 2RIJA 2ZH5A 1VI7A 2HZAA 2BKPA 1WOPA 2AX1A 2GVZA 1TTHB 3DLKA 2E5LJ 1RTJA 5LJ3Y 2CIMA 1XC9A 4DLGA 4X4NA 1VIOA 4ILLA 3TNVA 3E51A 3BO2A 2ZDPA 4ECVA 4ICLA 4DFPA 1G3OA 1TL5A 5A0YB 2D74B 2JEIA 4CWBA 3JYTA 5T41A 3JSBA 3JQJA 2P9EA 4N77A 2LYVA 2XY7A 2DY9A 2C3UA 4NLTA 4OYPA 5EWGA 2JWNA 4PABA 4NA2A 2ZWOA 3E01A 3KG0A 1FJGJ 4WFYA 4DV4F 4ZK7M 4EBEA 1Y3KA 2HRUA 4F4AA 2L9DA 1W2BR 1WG5A 5F8HA 2KM8B 3HHNB 5LSLA 2KO1A 3M2UA 3HHDA 4AUKA 4DPWA 3MEDA 3QGHA 1DJ0A 1E6YB 3CB4A 2DB1A 1FFWB 1RT3B 3PZPA 3BDPA 4LRBA 2FY1A 1K47A 1YG0A 2X1GA 1NJXA 3CO9A 3V4MA 3G96A 3HFVA 2HWIA 1H38A 1HHQA 4UZBA 2AT1B 2NPIA 1CSJA 1F3VA 1HI8A 3H42A 2HNYA 1HLWA 4DV3F 4DG1B 2AMCB 2J8SA 3THTA 1DURA 2DNGA 3H98A 3IMQJ 1IKYA 2U2FA 4QZVB 3NMRA 1RBAA 2DNOA 4QWCA 4JB8B 1LEOA 2XHCA 3ZO7A 3KHRA 1NDPA 4IQMA 3MZIA 3AOCA 1DARA 2IVFB 4WFXA 1FT8A 1M5SA 3RR7A 3JSYA 4PXEA 2F63A 1YIJS 3FCHA 2M9KA 2J9DE 3M8QB 4DBQA 2IJNA 3JSMA 4ITSA 2YNHB 5HQMA 5E5NA 5J2QB 3DYAB 4WWSA 3ENAA 2NXCA 1N5YB 2PDAA 1MWYA 1PKUA 1U1MA 2QC3A 1MNEA 4TY8B 1T3NA 1AT1B 1KLNA 3DOKB 1WDDA 1ITPA 1NKBA 2ZH3A 3NGRA 4FYYB 5IT9Y 3SSQA 4ZLNA 1TKDA 2CJQA 2QLWA 3MPUB 3D7SB 2W8LA 2FD2A 4O3NA 4GKJF 5D78A 4QU6A 4DV0J 2BE7D 3LF0A 2HZVA 4C3LA 2POKA 4CI0B 1ZH5A 1RHUB 5A6WA 2UVVA 3B54A 2ROGA 3KOAA 4YMEA 2OPQA 3N6MA 4DR7J 3FQKA 2K1RA 3MCMA 4PR6A 3W2WA 1U1QA 2OPPA 3PW7A 2YXLA 3PRBA 1KQGB 2UU9F 5GAHI 2UXBJ 1FTRA 1SIWB 4C8NA 3KLFB 3EJMA 1LWCA 1WHYA 4WFBQ 2WW4A 2HPUA 2RILA 3DLEB 4OYWA 2KRBA 1SKSA 4OHYA 1MWZA 4NYPA 2NSBA 2YX7A 3GJRB 3CO0P 3R2DJ 4BC9A 2KT5A 2CYYA 3TARA 4KFBB 2QLBB 3BYRA 4X4QA 1H2UX 3TEGA 1RJJA 3BN7A 1O6XA 4IOBA 2ATLA 3UR3C 4Q8EA 2NXUA 1JXLA 4A8FA 1VRUA 1U1LA 1SJ4P 1WEXA 3E8OA 1RWNB 3BO3A 1H6KX 5CZXA 3ZZZA 2EKYA 3BKFA 3VAJA 2J5AA 5KFDA 2KFZA 1R31A 1WWHA 2V4JA 3N0VA 3CW2C 1BE4A 4NXMJ 3BH7B 1FVSA 1KQFB 1N5SA 3T5HA 2R7QA 2W2NP 3IXQA 4QQBA 2UXCJ 3RAQA 3L95X 3SMZA 1QE1B 3R8YA 1DTQA 4FYWB 4B3TF 2M2BA 2D3ZA 2IRYA 3GIRA 3JQKA 3DLGA 1U24A 1T94A 1XNQJ 3K58A 3MTJA 3BQ2A 5J1EA 1Y11A 5THWA 3GU0A 5IM0B 2IHR1 5F8LA 1CJKB 4J9LA 1HMVA 2C2EA 3NLCA 1IBLF 3MPDA 4USIA 2CQHA 1P8GA 5G4DA 1X4FA 1FJCA 3EMTA 5J1PA 3HKZD 4CDIA 3PR5B 4RKUC 1C0UA 1XR7A 2BM0A 5LMNF 3MF5A 3OJUA 3IM9A 3LUYA 3R6GB 1EETB 4ATNA 2BX6A 1VBYA 3FCWA 1BQNA 4DF8A 3M9OB 4KTQA 5AJ3J 1XK8A 2PI4A 2KH9A 3FZBA 5FDLA 4NYOA 2YKMB 2IBOA 5IV3A 2IJRA 2R4FA 2QEXS 3NWRA 2PMZD 2HVIA 4UY8T 1RA6A 2O1PA 7AT1B 3H4DA 2DR7A 1LXNA 2EKNA 3DRYA 5ETVA 4OI6A 5KFKA 2AYEA 1X4DA 4GO5X 3DNCA 2BANA 1CBKA 2BBEA 3UN5A 1IWGA 1UEUA 3HVTA 3PJXA 2R7VA 2F8HA 3ZTPA 4YHHJ 1HFEL 5DM6Q 2B5JB 3QGPA 4LT6A 3W5XA 3DHWC 5E3PA 1BXNA 3KHLA 3I96A 4Y2IA 2OSQA 2UVRA 2W9BB 3W2VA 1U26A 2EEYA 3K89A 3HVWA 2CPHA 4PQUB 4Y2CA 1FD8A 4E0DA 3A3PB 2CVIA 1N4LA 1K73T 1Z1ZA 3R7SB 5HL7Q 1SH0A 3IS9A 4M5HA 1T9XA 3PFOA 2GIFA 2YNGA 4EWTA 1VOMA 2C1EB 3AA8A 1VQPS 3TYTA 4IG0B 2MHNA 3MAAB 5DZ7A 2MB0B 3KG4A 2LQ9A 2NQPA 3HK2A 1S99A 1S1VB 4R25A 4DUZJ 2YWEA 3T1AA 4EBCA 2CQDA 3N6LA 2UUBJ 4KBIA 2G13A 5C42A 1MSWD 4NWBA 1U1NA 2ZH7A 1PYSB 3ILJA 1WSVA 4ZMMA 5C24B 3CDEA 2AZ1A 2OEKA 4LBIA 2OPSA 2VDHA 1WUUA 4A8KA 3D6HB 2EFVA 2IJFA 1M5KC 2F1FA 1IKXB 5BR8F 1P27B 4LFBF 3ULHA 5I42A 5H9EK 3ZZOA 1WG4A 1R8AA 2IY5B 2P9CA 3N9UC 1TFWA 4A47A 3M8YA 4MH8A 5LJ5Y 2K7JA 4NCGA 2HWHA 3BQ0A 4FPRA 4CLKA 1H72C 2OKQA 3AJ2A 4PG5A 2MGZA 5DO2A 1HBMA 1FNXH 3IWNC 4C98A 2EK1A 4MYUA 2C2NA 3WIVA 1JB0C 3Q23A 4RWWA 4J9RA 4QJVA 4MTPA 4CLLA 4HYKA 2GO8A 4MK7A 4F3MA 3M8PB 1S48A 3VVTA 2MLXA 1RWXB 4HTJA 4Q8FA 5IWAF 4RX6A 4K4ZA 3Q8RB 2WSFC 2WVCA 2P9GA 2K3KA 1REVB 3GIKA 3BSAA 5M2PA 2MZ1A 4Q2MA 2EBEA 4L75A 1R0AB 3J7A1 1CS4B 3QQCD 3TVZA 4DJBA 1NHUA 4J37A 3UDEA 1BQXA 4OZ3A 2W9CB 2QLFB 1JLEB 4PPZA 4K4VA 1IQTA 1SL1A 1JJ4A 1WOOA 1M5HA 3R27A 1CC7A 1JLQA 4B9MA 1TL7A 3MMAA 2VG5B 4L74A 2NYIA 3KJFB 1FWLA 4RW8B 4DCOB 5IZHA 4ZCMA 1G1XA 3G2XA 4LFAJ 4K7QA 3UVJA 2CDQA 4IFYB 3D3CJ 2P5VA 1YI2S 2FZCB 3KK2B 3FRZA 2ACMA 2ZFHA 3ILIA 4P71A 2OMOA 3FC9A 2R7UA 1AYEA 2N3OA 4NLUA 1JLGA 2HFVA 4P7VA 4F3QA 3H2LA 3Q8PB 2V2KA 3GTYX 1Q79A 2CQ1A 4KC5A 2XMKA 3AOBA 3WC2A 3DGVA 2KYZA 4EEYA 2D69A 3MM6B 2X51A 4DI6A 1SH2A 2C3MA 2YNIB 2AU0A 3MCNA 4KHMA 4ZVFA 1UVLA 1CJTA 5KFNA 3ZXWA 1U25A 4JI0J 4ED7A 2OEMA 2IAJA 1N36F 4DX5A 2XLKA 1HI1A 4B9UA 2CNLB 1HL6A 4N7TA 1T0TV 3VZIA 2FTRA 2PO4A 2LEBA 1QY7A 1YJTA 2YBVA 1R8BA 5HO4A 1ZYQA 1T05B 2VQFJ 3M30A 2Y1JA 4B9SA 5HP1A 2EW9A 4NEYA 1Q81T 2CPJA 6FD1A 1IBKJ 4IG3A 3DXBA 3TP2A 1U0HA 4OFZA 3WIUA 1U49A 2ALYB 4N76A 1OMSA 2U1AA 1NK5A 3JAMY 2WVBA 4YB6A 1VQMS 5LXYA 2GNKA 4LR7A 4X62F 4KIAA 4U96A 1SUQB 5CD4A 1NM2A 5KFQA 1JKHB 4PXDA 1C4AA 1IM4A 4JV5F 2KXHA 3HHLA 4HEA9 5K14A 3IRWP 2VJUA 5SZTA 4JI1F 2V8PA 4X66J 5I3UA 1N0VC 3D6TB 5HQ8A 2A3JA 3EPIA 3OXLA 3R97A 2E1AA 3UR0A 4USMA 1VS3A 2W25A 2EFOA 4LBPA 3HSGA 2QIFA 1KFSA 4ZOSA 5CCLA 1RTDA 1H3DA 3NGTA 2VASA 1MROB 4WYLA 1SQGA 2R7OA 1B7YB 2UUCF 3SFGA 4X4PA 4LF2A 3S7RA 2UXDF 4ECWA 4OZ2A 4DU7A 3GIMA 4O44B 3SCJE 4LSLA 4HHJA 1DQAA 1CQMA 3SV4A 3R1LA 4RUBA 1HQ2A 2C3PA 3MHYA 3O2IA 2VONA 1S10A 4BWJA 3G6ES 1FXRA 1C1CB 1RTIB 4ED6A 3MOJB 1UFWA 1HHSA 4Y2KA 2Y8YA 3MD3A 3K0JA 1RWKB 2Z8QA 1TMJA 1UW9A 2WHOA 2CQGA 2XGQA 3FFIA 4IOAQ 1AUSL 3PRDA 1RT4B 4IQXA 2HHUA 1KONA 4CLWA 2Q1LA 5E33A 5E3QA 3I32A 1FE4A 2KHDA 4FS2A 1GH8A 4HT5A 3UDCA 2VG6B 1NMEB 1YJ9S 5GMDA 1M1GA 2DVIA 2BMBA 4NLSA 4DR6J 2Y1IA 3DKDA 4I6WA 1Q16B 2EFGA 3QT8A 3QYYA 1RT5B 2N4CA 4XDCA 4PYAA 1S79A 1VISA 1N34F 3LGNA 2AJFE 2GHPA 2HIYA 3OV7A 1TKZA 1E6VA 3PW0A 3C6TB 3GIJA 5KFVA 4ZS6A 5EX0A 1I3OB 1H0HB 2FZKB 3OR1A 1AXQA 4I7FB 4PKDB 4CP5A 1KR4A 5HMXA 3G82B 2QL7B 3NGDA 3KXDA 5K20B 1SJFA 3LP0A 1JLFB 1NXIA 2YWWA 4O23A 3J7YI 5F8IA 1VQNS 4FPIA 4P52A 4DUYF 3HM9A 3NKYA 2N7YA 2V68A 3CDAA 1VIXA 1FI4A 3TJ9A 3C16B 3O1LA 3B6BA 3OTEA 5EHHA 5KG7A 2HURA 4O3SA 3OXGA 5A8WB 2E1PA 3GV7B 1LNQA 2F65A 4DV6F 4RU9A 2AYMA 1RAAB 3KG1A 4QYZK 4EI2A 4Y34A 2RDIA 4WKYA 5HMWA 2R7TA 2V9KA 4WTYA 1F5BA 1XMQF 5IXUA 5HROB 3V6DB 4RU2A 4XTTA 2HGMA 3QWPA 1YX2A 3LGHA 4BLGA 2DGVA 3AQPA 1WTFA 3VAFA 2J0QD 1Q1KA 4M5GA 2HLTA 1N52B 2LCWA 2A6OA 1NPPA 2H4WB 2LKZA 4OL8A 2CQIA 1VRQC 4DCPB 3GE9A 4J9OA 1NKEA 2FQQB 4C3MA 2PA8D 2KI2A 3G8TA 2AP6A 4LSNA 4RL1A 2BRLA 1RAEB 4JI4J 3DRXA 3VGSA 1B64A 5GAGI 5EN1A 2K2PA 4DR1F 4E98A 3RAMA 4A8YA 3U1LA 4OI2A 2IRXA 5F8JA 2GIQA 4ID8A 1R89A 3CT9A 4NPOA 4C8OA 4OX9F 2VFVA 4NLXA 1UFLA 3S6EA 3CTRA 2HVHA 4C0BA 2XS5A 4EYIB 1B3TA 2WVDA 1BMQB 2DCUB 2YH1A 2Y0BB 3IO1A 1D8ZA 2H3EB 2RS8A 4ZN3A 3T3FA 1VQ5S 4CCHA 5ETQA 1OPZA 4RUCA 1RB0A 3CXCR 4ZCLA 1HQUB 4RW7A 4UOFA 1WC5A 4ES1A 1S1WB 3D6FB 5K8OA 4DQSA 4PPDA 4LF5F 2X3GA 1M1KT 5CYMA 2Z2MA 3CF5Q 3TQ1A 3WZ0A 4J90A 3NCRA 4J9MA 3C15A 1X9MA 5F0UA 3HHLD 3AXMA 1T9VA 1UP1A 3LPYA 3D2WA 2HK2A 4DX7A 4WE1B 5LT5A 2LEAA 1HR0J 4LRFA 1NK9A 4JOUA 3NMAA 4R0EA 4PXBA 2N3LA 2ZEJA 1HBNA 1NK8A 3VAIA 5GADU 4DFJA 3DLBA 2E5LF 2LVWA 2I0XA 1LW2A 1L3UA 1V5IB 3F56A 2GS8A 1FKPA 1UTAA 3PW2A 1GT8A 3IM8A 5GMEA 2OHDA 3FKBA 4I67A 3V81A 4DQPA 2ZBIA 1C1BB 3GMGA 1ZETA 3A3NB 1XJWB 4FP9A 1RLDA 3UO0A 3ISZA 3KK1A 1S57A 4NE9C 3Q0AA 2DH8A 3DDIA 3FVYA 4KSEB 1WKJA 5DLGA 1KVJA 3SQGB 1VJWA 4DR5F 3PO4A 3MM7B 2KT2A 3TQEA 4F4KA 1UZHA 2ZITA 3PEHA 3TEHB 2R2TA 4WP3A 1HYSA 5ETTA 2YX1A 2YY3A 2MLYA 2OUGA 4TYAA 4ZVGA 4USVA 2PFFB 4KPYA 3OUYA 3EGVA 2BABA 4ENOA 3MCOA 2EWHA 2AW0A 2BJ1A 4ECUA 2IVMA 2WSEC 2HKEA 3T5JA 1ACMB 2CQCA 2VOPA 4KO0B 1S9EB 2PC6A 3RR8A 1H74A 1JXVA 3M2VB 3I4HX 3R5JB 1PBAA 5J2NB 5DQIA 1JLBB 4FVCA 4JUZA 4J91A 5IC6B 4H4OA 4RW6A 3OLAA 2AX0A 4Y3CA 4L6V3 1S1XA 3T9ZA 1H7WA 2J8AA 4XPCA 3GR1A 3JSRA 1H2TZ 4EBDA 3GCXP 3OVSA 2CUYA 2WVFA 5B0FA 1WELA 4QW9A 5DS7A 3M32A 2BE2B 1UA0A 3NG8A 1ZA1B 1NSQA
chains in the Genus database with same CATH topology
3DC2A 4ED1A 5IFMA 4QR2A 5LMUF 2FJWA 3KWMA 4F67A 5F9NA 4O0IA 3DOMA 2A1BA 3WBZA 2B7BB 2BQRA 2AYBA 3OR1B 1BC6A 4OZJA 1VQ4S 3AB2B 3AJ1A 2B0GA 1W25A 3IG1A 5KFBA 2JX2A 2D9PA 2LQBA 3MI7X 4O4GA 3H40A 2BUNA 2ZHAA 4KKOB 3TA2A 4JV1A 3PKMA 4QIGA 3NS6A 1LOUA 2OP5A 2F8MA 2CZVC 2N7CA 2FLOA 1WTBA 2JH3A 1SI9A 1A6LA 2QE5A 2YWHA 2JDJA 4OJ3A 1RT1B 2XCPA 1KS2A 1AFJA 3LP0B 4EZ9A 1FK9B 1GX6A 4DV0F 4WK3A 3CULA 3MGJA 3HMJG 4ECXA 3TAPA 1LFPA 3QO9B 3TA0A 4WFNQ 3PY8A 4DSFA 5KFPA 5KFYA 1X0PA 1D8YA 4LQ9A 4Y2MA 5KFHA 4L72B 4HI2A 1FJ7A 2C2RA 1EETA 1XWLA 3BEGB 4NA1A 5LSOA 1JLAA 1SKRA 2ZC3A 4P6QA 3NBPA 4CTAA 1FERA 2MXYA 2DR8A 5HI7A 3TAQA 5KOWA 2ACYA 3MCSA 2FVQA 2MZRA 1MMLA 1ULRA 4CO4A 4MK8A 1N8RT 4N8OA 5E2QA 4B3MF 2HHPA 2HFOA 2YKMA 1XBWA 3H20A 1R8HA 2HNZB 2ASDA 5CQGA 1B7FA 1X5OA 3W3SA 2VBXA 5EWEA 2HGLA 3MR5A 1HR0F 2YWKA 4KGKA 1HQEA 4UQTA 3EUNA 1WF0A 4U7CA 5M2RA 4R8UA 2KXNB 3K57A 2ADCA 1VQLS 4IR9A 2F9JA 4RBVA 4XIUA 4C8MA 2BW2A 3OHBA 1EP4B 1NZAA 2CQPA 3IAM9 3IFEA 1FRIA 5KFAA 3VWSA 4EYHB 4UY85 3D0GE 3X1LB 1R27B 2LECA 4DV7F 1RKJA 3CC4S 1U7LA 2OPRA 1U4BA 1ZZFA 5CA5A 2RIJA 4A8SA 3CJKB 2BOPA 2ZH5A 1FD2A 2HS0A 4U6PA 4Q44A 1VBXA 1LW0B 5A2QY 1UVNA 1VI7A 2VKZG 2A2CA 3DDKA 3H5UA 5GAGU 2NREA 2AX1A 1T02A 3KLGB 1C0TA 4JBCA 3NRBA 2NLWA 1ELOA 4OV1A 1DBDA 2LA6A 3DLKA 1RTJA 3DMJA 2AV5A 3GIIA 5LJ3Y 2ASLA 2CIMA 2FUG9 2XMUA 1XC9A 2MDAA 2Q66A 1S77D 4DLGA 1RQ0A 2JSXA 5J2PA 1RT7B 4O3RA 3US5A 5DETA 2B5JA 4QCLA 4X4NA 4NRUA 4OIXA 1TK0A 1VIOA 2CPZA 3MOZA 3TNVA 4ILLA 2WB4A 3E51A 4ID5A 1KOHA 3BO2A 2ZDPA 2FHKA 2MZJA 4ECVA 3QJPA 1TR0A 4ICLA 4DFPA 1G3OA 1TL5A 5A0YB 4AQYF 4J9NA 1AFIA 1JXEA 2D74B 4B3OA 1F2GA 4U9RA 2VBZA 3KMQA 2DNPA 2JEIA 3JYTA 2DBBA 4WZQA 5T41A 1RK8A 2W9BA 3JSBA 3V6JA 4Y0FA 1FCAA 5GVQA 2K3IA 1NJYA 3CCLS 2XMJA 1Y5NB 1SV5A 1TL3A 2VV5A 2P9EA 2F8EX 4N77A 4QIFA 2LYVA 1TK8A 1S0VA 4LSNB 3PACA 2KTQA 1HBUA 3V5RA 4PQUA 2XY7A 1NB7A 5KFLA 1QSSA 1KOOA 2C3UA 1HNZF 4NLTA 4ERDA 4EGLA 4LF7F 5G0RB 5EWGA 2JWNA 3FQLA 1SL0A 5EX3A 1BQMA 3VZHA 2AJ0A 4DS4A 3Q22A 2BJDA 4F2SA 4DFKA 2FHJA 3F73A 2RJZA 5F8NA 4OHXA 2PGCA 3UW1A 3CCTA 4NA2A 3CUNA 2OJ3A 1S76D 1KQKA 4MK9A 4Y28C 3E01A 2RMLA 3CCWA 2GW8A 3KG0A 4RWXA 4WFYA 4DV4F 3EXYA 2UZAA 4ED2A 4C3KA 3Q8SB 4ZK7M 2B4VA 1HW9A 2KT3A 1Y3KA 2RKIA 3OFHA 4EBEA 5J2MA 4NXMF 2HRUA 4IRKA 2ZBCA 1NRKA 4DL6A 5HBMA 1UVJA 4ZHRA 2KG0A 1IKWA 1ZAVA 2L9DA 4IG0A 1W2BR 1WG5A 1S0OA 1DQ9A 1FE0A 1WI6A 4N8NA 4YDXA 5F8HA 2KM8B 3HHNB 2XWXA 5LSLA 2YKPA 3I9ZA 2UXCF 2BV3A 2GX8A 4WKRA 2SXLA 1PILA 2KO1A 3BGRB 3OVAA 3M2UA 3G71S 3HHDA 1M5PC 4AUKA 4PWDB 1FRXA 1V9OA 3GQCA 1S1VA 1IUJA 1HWKA 4K2XA 3MEDA 3QGHA 2RQKA 1DJ0A 1E6YB 2DNQA 5D4OA 3OSPA 4GC7A 2ZOFA 2RU3A 3CB4A 5C25B 2KN4A 4BDPA 2DB1A 2MY8A 2Z4PA 3PX0A 1WI8A 1RT3B 3PZPA 3BDPA 1O5JA 2FY1A 1BLUA 1YG0A 2X1GA 5K8NA 2DGSA 1X4EA 3CO9A 1NJXA 3ENVA 3VAHA 4ZDNA 3V4MA 5AE1A 4QU7A 2V8HA 5E7OB 4MFBB 3I31A 4BCAA 5A8RB 4IO1A 1XERA 1FXDA 3G96A 4Q0BB 2HWIA 3FMWA 1VRTA 3O44A 2R7WA 4JI3F 1MW7A 5C24A 4C8KA 2W7AA 2GHWA 3H8YA 1H38A 4NCAA 2MZSA 4H4MA 4C8LA 2G9OA 3T1HF 5FD1A 3PVXA 2NPIA 1CSJA 5K8MA 3SSSA 1IKXA 2R7SA 1HI8A 2FJXA 4K4UA 2VC0A 3DM2B 3G6YA 2HNYA 4RW7B 3OJSA 1FDBA 4NLDA 3MM9B 1N5TA 1AUDA 3N01A 4DV3F 1B0VA 2GGPA 3ICLA 4DG1B 1P1LA 2ZH4A 5F9LA 4X2BA 3THTA 1DURA 4CO5A 2LMIA 2DNGA 3H98A 3SI8A 1IKYA 2U2FA 4QZVB 3NMRA 3BR8A 3LAKA 4TXSA 2DNOA 3FMBA 3HVRA 5AXKA 3UE2A 4QWCA 2ILZA 5EUHA 5LL6d 3OPKA 5CYMB 3FSXA 2RH3A 2QSFA 3BGUA 3POTB 1KFDA 2PEHA 5A8KB 2R8HA 1QUVA 5B09A 3RB0A 3K5NA 4CNYA 5KFOA 3KHRA 1FRKA 2DJWA 4TU9A 4IRCA 2ZM6F 1ZTWA 4IQMA 2M8HA 3C66A 3MZIA 2KFYA 1L3TA 2J7WA 1RYSA 1FEEA 2L9WA 1DARA 2IVFB 4WFXA 1FT8A 1M5SA 3RR7A 3JSYA 4PXEA 4ZPAA 1YIJS 1CPZA 3FCHA 2OD4A 3T19A 2M9KA 1GTHA 2J9DE 4PG7A 3M8QB 3M9MB 2HMIA 3UPFA 4DBQA 2IJNA 3JSMA 1X9WA 2JOQA 3GV8B 2F3JA 1FRJA 2B6AA 4ITSA 3M6UA 4MJKA 2XSJB 4XDDA 2YNHB 5E3AA 5KFWA 3K5MA 3TVYA 4LIWA 5E5NA 3ZZ0A 4OI1A 1MMNA 5J2QB 3DYAB 2V8DA 3C3LA 1QAXA 1QUPA 3HDSA 5KT6A 3ENWA 4FVMA 3M8PA 3HPOA 4YFUA 4GC6A 2CPEA 2PDAA 5MLCV 1N5YB 1MWYA 4BS2A 2DHXA 3SFUA 1D1UA 1RTHA 1HBNB 1YRUA 1U1MA 1FXLA 2RQ4A 2XS2A 1MNEA 2WOMB 4TY8B 4OZLA 3OR2B 1CEZA 1Y3JA 1T3NA 4DWIA 4KHRA 1KLNA 1KNZA 1DTTA 3DOKB 4P2SA 3TUJC 1QJHA 3PXGa 4XPEA 1NKBA 4YHHF 3LO3A 3IR7B 5E3CA 1LW2B 2ZH3A 2XWYA 5IT9Y 3SSQA 3CDWA 1TKDA 2CQ4A 1OQ6A 2CJQA 2QLWA 3NAHA 3MPWA 4RUHA 3MUMP 1VQ8S 3G9CA 2MKKA 2O01C 1REVA 3RTVA 2W8LA 2FD2A 4O3NA 1FKPB 3ZZUA 4GKJF 5D78A 4A8QA 5I4MA 4QU6A 1QLNA 1KVIA 2QA4G 3OSNA 4ZA1A 4PG8A 1F60B 4KB7A 3LF0A 1NK4A 3V81B 3M2RA 1SJ3P 3DOLA 2XC9A 2CG4A 4M63A 1TKXA 4J9PA 5KFTA 4C3LA 2POKA 2Z0GA 2W4CA 3EGNA 2RE1A 3IBWA 1N5QA 4CI0B 5DDOC 1ZH5A 1R0AA 5A6WA 4PUOB 3BREA 2XHWA 2UVVA 4DN0A 2ROGA 3MECB 3KOAA 4YMEA 2OPQA 3N6MA 3EX7B 2HHTA 2RD5C 1HA1A 3KK1B 2W9CA 3FQKA 4C7QA 3QIPA 1JLEA 2JVOA 1U2RA 4JI8F 2K1RA 5ITHA 3FNNA 4TYBA 5HLFA 4PR6A 1I94F 3W2WA 4TQSA 1U1QA 1HPZA 2IM3A 2FJEB 2OPPA 5BYQA 3PW7A 2RQCA 3N5BA 2FLNA 3PRBA 1KQGB 2UU9F 4ES3A 3QAEA 3I87A 3GYXB 1Y7PA 3AH6A 5GAHI 2QA4S 2L9NA 3VAKA 1TL1B 2VG5A 4Q5VA 1OO0B 3D54A 5HN0A 2FC9A 3HVAA 4KRWA 1ZPVA 4RW8A 1T7PA 1MU2A 4CIOA 2DO0A 1FTRA 1SIWB 3PW4A 4C8NA 3KLFB 1HYSB 1U09A 1X5TA 1FRMA 3JTOA 1LWCA 1WHYA 2JLFA 4WFBQ 3MTKA 4I4BA 3DHXA 2HPUA 2MQOA 2M52A 2RILA 2XMVA 2Q6CA 3DLEB 3S1TA 2HFZA 5JUMA 1TV6B 2GQ2A 3QJLA 1S1TA 1ZM2A 1R8PA 1F5CA 2KRBA 3D0HE 1SKSA 4ES2A 4OHYA 2EG2A 1MWZA 4NYPA 2NSBA 2YX7A 3SEOA 4IFYA 4OI4A 3N28A 3CD7A 3KK2A 2KM8C 4BC9A 4DQRA 3UCZP 1HI0P 2KT5A 2CYYA 5HMYA 3OUYB 2PI5A 4QPXA 4QOTA 1HWIA 3TARA 3SXLA 4KFBB 2ASJA 4I2PA 3SYZA 4YEAA 4X4QA 1S1UB 1H2UX 2W24A 1S4FA 2W7OA 4NA3A 1M5OC 1RJJA 2RU9A 2AJQA 1FHTA 1IKVB 3MMCA 5KG4A 3BN7A 2C3OA 2RQMA 2QO3A 3KYLA 3CCSS 4JI5F 4IOBA 3W7BA 5CYQA 2ATLA 1T03B 3UR3C 3G4SS 3Q8QB 4Q8EA 3PFEA 1YVFA 1D9FA 3S8SA 1OS5A 2NXUA 3AY0A 2J9EA 2A18A 2XB2D 4Y00A 2VUGA 1JXLA 4A8FA 1VRUA 4D3HA 1U1LA 4C8ZA 3MURP 3B78A 3I6PA 1SJ4P 4CH0S 1L5UA 4HTIA 2NR0A 1WEXA 3E8OA 1FJGF 4CZCA 2YTCA 3BO3A 1H6KX 3KLHB 5CZXA 1RWUA 4IDKA 2EKYA 3ZZZA 5DJBA 3VAJA 3P6YC 3U02A 1C4CA 2GA7A 2WAQD 3ENQA 2J5AA 3MM6A 3U27A 5KFDA 2KFZA 2VG7B 1NAQA 4O4RA 2N4DA 4G1QB 3VTIA 1R6YA 4JYAF 1R31A 4B9TA 1WWHA 2V4JA 1VK3A 2CPYA 2YNIA 3N0VA 4OLOA 4OX8A 4W90B 5BJRA 2IYIA 4H4OB 1TKTB 4RW6B 3EPGA 1CVJA 1X4GA 4LQ3A 1JLCA 1FVSA 3BQ1A 4DR3F 1KQFB 1N5SA 1XN9A 3T5HA 2CQ3A 2R7QA 5F3TA 2XBPA 4ALZA 3PIOQ 3DRRB 3IXQA 2L48A 1S1XB 4RNOA 4QQBA 4J9KA 3KLEB 3PKYA 1YTYA 3DN9A 3RAQA 3L95X 1DLOA 3ITHB 3SMZA 4OQJA 1QE1B 2E5IA 1O51A 5KFJA 3PW5A 1OSDA 2WONB 1DTQA 2KJVA 3I0SA 4AYBD 4B9NA 4B3TF 2BA9A 2M2BA 2D3ZA 1LWFB 2IRYA 1D9DA 3MPVA 1GQEA 4CO2A 1UJ6A 3DLGA 1U24A 1T94A 3M32B 3VAMA 4V19J 3PV8A 2RUGA 3K58A 4Y6IA 3MTJA 3BQ2A 4RZRA 5DRKA 5J1EA 5THWA 4RNNA 5DDPC 1T05A 4DSLA 1U2FA 3KHHA 4O3PA 2MMYA 5IM0B 2IHR1 5F8LA 4J9LA 1HMVA 3RB6A 1KTQA 4R5PA 3BDEA 5JXSA 5AE2A 4TU8A 1VLYA 2R2UA 4RW4A 3BR9A 2C2EA 2OTJS 1MMDA 3GFHA 3NLCA 2GMLA 4DX8H 2E1MC 2E1RA 1SH3A 2O3DA 1IBLF 5AE3A 2DRBA 3IG1B 5KFMA 4YP3A 4USIA 2CQHA 4O4GB 3CCQS 1P8GA 5G4DA 1FKOA 2RVJA 4WXWA 1X4FA 1HARA 1FJCA 5E3RA 1RKIA 5J1PA 1L3SA 1K0VA 3V6HA 3HKZD 4WIIA 1U1KA 1FEHA 3PR5B 4RKUC 1C0UA 1XR7A 2DNRA 2BM0A 2IC3A 5LMNF 3HJFA 2PMHA 3MF5A 3OJUA 1RDRA 2R8KA 3LUYA 2DPIA 4FYDA 1EETB 2ZDOA 4LF4F 3J7Z5 1JLAB 4IYQA 3TUZC 4ATNA 1S6QA 1VBYA 3QMQA 1BQNA 3NBPB 1V3ZA 3QLHA 4YB5A 4CTAB 5DG8A 3CGIA 1M0SA 2J6UA 2OO4A 4DF8A 3M9OB 4KTQA 2UXBF 1SUQA 2RF2A 1XK8A 4TNOA 1S0MA 4ED5A 4ELTA 2PI4A 2KH9A 2RRBA 4TLQA 3FZBA 4DL5A 1NHVA 5FDLA 3G6XA 5CH7B 4NYOA 2C42A 1JKHA 2YKMB 3K5LA 1F5AA 1UKUA 2GHVC 2J9DA 1SC6A 2IBOA 5JVGQ 1ZPWX 2OFGX 2R4FA 3D1OA 2QEXS 4KE5A 2PMZD 2HVIA 4UY8T 4DMZA 1HQEB 1RA6A 4A8MP 2O1PA 3P5TL 4R8UB 5IT4A 5EWFA 5B0GA 2RNEA 4B08A 3HKWA 3H4DA 2RB7A 1WHVA 3CJ0A 4E8UA 5D8HB 3OL9A 2M88A 2DR7A 4HT7A 1LXNA 2OPRB 5I3QA 3RRHA 3DRYA 1M5VC 3IGNA 4OI6A 4U67Q 5KFKA 2AYEA 3QGIA 4DQQA 1X4DA 4GO5X 1NNDA 3GG1A 3DNCA 1I1GA 2BANA 2FGCA 2LQ5A 3GFYA 2DR5A 2BBEA 4DOZA 3CCVS 3SCLE 3T5KA 2ZH1A 5C5JA 3RW6A 1KLMA 1TVRA 3DU5A 4HKQA 2B4UA 1C0TB