1W2BR

Trigger factor ribosome binding domain in complex with 50s
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRIGVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1w2bR00
1CVJA 2DNMA 1N52B 2ADBA 3CULA 2F3JA 3G9CA 1F9FA 3SDEB 3S8SA 2X1FA 3IWNC 2KN4A 2KI2A 5GAGU 2L41A 2KG0A 1XN9A 4TU7A 4IOCQ 2WBRA 1X4AA 1VQPS 3UE2A 2KFYA 5IM0B 3CD6S 2CPIA 3HI9A 2MXYA 3SDEA 2QEXS 2RRAA 5LXRA 1ZZFA 4QPTA 2HGLA 1X4FA 2DHXA 2XNQA 2GO9A 3EGZA 5JVGQ 2M4MA 2DNZA 3CC2S 1HL6A 1N54B 5IM0A 4C4WA 1X5OA 1WELA 1UFWA 3Q2SC 2XS7A 2AYEA 3CCQS 3BO4A 3EGNA 1G2EA 1WHWA 5H1SV 2G4BA 1VQ8S 2MQLA 3CMAS 2V94A 3S7RA 2AD9A 2X1BA 1SJ4P 3S6EA 1X5TA 1NO8A 1VQOS 1X4EA 2LA4A 4J5OA 2MHNA 2DHAA 5DDQC 5GVQA 2DISA 2MKKA 2EK6A 4FXWA 3CCLS 2AYMA 1U1QA 2MKHA 2DNYA 1P27B 2CQ0A 1QM9A 2FC9A 1OWXA 1R8PA 5HL7Q 3G6ES 2CQIA 1WWHA 4QU6A 4UQTA 2AYBA 2KRRA 3B4DA 2PEHA 4IUFA 2MB0B 1S79A 2ERRA 2CQ4A 2OSRA 1M5KC 2XB2D 2JWNA 4V19X 1DRZA 2JVRA 3CCRS 3VF0B 3K0JA 2HZCA 1X4DA 2N3LA 3FEYB 3PIOQ 2MSSA 3PIPQ 5IQQA 3VALA 1SJQA 3THPA 3R27A 2DGVA 2DNRA 1U2FA 1X5SA 3UCGA 1M90T 5CA5A 3JB9k 2DGTA 1WHYA 3UCUP 2HGMA 1VQNS 1YWXA 2MQPA 2MJUA 4LIRA 1H2VZ 1N8RT 1YJWS 2J0SD 2RU3A 1WTBA 1HD1A 2MZRA 3MD3A 1DBDA 1Q82T 2BZ2A 3VAJA 4TLQA 3MUTP 2JVOA 1L3KA 1YIJS 5IFMA 1VQ7S 2D9PA 2N7CA 3R1LA 3G8TA 2MKCA 3CCUS 2MPUA 3OW2R 3N9UC 1W2BR 1VBXA 2LQ5A 2DNNA 5HO4A 2AYGA 1B7FA 2MQMA 1YI2S 3LPYA 2MJNA 3NNCA 3ULHA 2RQCA 1O0PA 1VC0A 2CPHA 3P6YC 2RNEA 4TU8A 2MZJA 2NLWA 1M5OC 3CUNA 1RKJA 2HYIB 4A8XA 2RS2A 2QFJA 2U1AA 3UWTA 2CPZA 2RS8A 1M5PC 2LXUA 2DNHA 2E44A 2J0QD 2M52A 5BJRA 2OIHA 4PR6A 5D78A 3G8SA 1Q86T 3MOJB 2KRBA 3BO2A 2CQPA 1UW4A 1X4HA 3U1MA 1FHTA 2KHCA 1WG1A 1FJCA 1IQTA 5FJ4A 2M9KA 2RT3A 4C0OC 1UP1A 2DGUA 5CYJA 2K3KA 4F26A 1WEYA 1FJ7A 5DDRC 2DNKA 2HVZA 1UAWA 2KG1A 1M5VC 1U1OA 2KM8C 1YTYA 1WG5A 2KT5A 2RVJA 3MURP 2MQQA 1P1TA 5LJ3Y 1U1PA 3VAHA 5DDPC 2F9JA 1WI8A 3MI7X 3VAIA 2MZ1A 4Z2XA 1VQMS 2MY7A 3ZZZA 2CPFA 2E5IA 2LYVA 5GADU 2RUGA 2HGNA 2LECA 4M5DB 3MXHP 1OIAA 1K73T 4WCEQ 2L9WA 4YB1P 2OTLS 1HA1A 4WFBQ 1YJNS 3HHNB 1U1MA 2MSTA 3B4MA 4YUDA 2DGOA 3ZZYA 3D2WA 3RW6A 3Q2TC 2E5GA 1VQLS 3MDFA 1SJRA 4RU2A 1VQ6S 5GAEU 3UCZP 3TP2A 1S72S 2YH0A 2VODA 2DGSA 3BEGB 4UY8T 3I55S 3G4SS 2MZTA 1BY9A 2KVIA 4CIOA 5GAHU 1VQKS 3NNAA 2O3DA 1U6BA 1WEXA 2DHGA 4ED5A 2MGZB 1K8AT 2DHSA 2BOPA 1VBZA 1WF2A 2M0GB 2XNRA 2OTJS 2A3JA 3MUVP 2J76E 2DGQA 1SJ3P 5LXYA 2PE8A 4Y00A 2MGZA 3CCSS 5JVHQ 4BS2A 2DIUA 3CC4S 2YH1A 1VQ4S 1HD0A 2JX2A 3VAFA 5DM6Q 3BO3A 2MQNA 2KXFA 3THTA 2F9DA 1KQSR 2X1GA 2OJ3A 2U2FA 3UD3P 4W90B 1U1LA 1YJ9S 1VBYA 3CTRA 2X1AA 1VQ5S 2M2BA 2XS2A 1FT8A 2I38A 4OZ0A 1JJ4A 2MMYA 4QQBA 2LMIA 3BS9A 3VAMA 1U1KA 3SXLA 1PO6A 1NJIT 2KYXA 5EN1A 2MQOA 2KM8B 1RK8A 3J7YU 1X0FA 2CQ1A 2MZSA 3CCMS 2CPJA 5DM7Q 1KC8T 4PRFA 1KOHA 3NS6A 4W92B 2CQBA 4QU7A 3FEXB 2ADCA 4WFAQ 1WF0A 2MKIA 1OO0B 4IO9Q 5LJ5Y 3VAKA 3CF5Q 3SMZA 2ZJRQ 2CPEA 5CXTA 1FJEB 2G1DA 1VC5A 2MYFA 1QVGR 4WF9Q 2DIVA 1U1NA 4IOAQ 4C7QA 3LQVA 4TU9A 2CQ2A 4EGLA 2MKSA 5LSOA 3H2UB 1Q7YT 5D77A 2YTCA 4U67Q 5GMKa 2DB1A 2XSFA 1YITS 4ERDA 2LA6A 2LEAA 3DXBA 1KD1T 2CQDA 2FHOB 2K8GA 3P5TL 2N82B 1WEZA 3CCJS 4OZ1A 1U6FA 4CH1A 2CJKA 3NMRA 2L08A 2M88A 2KXNB 2CQCA 1URNA 2DO4A 2EVZA 3S01A 4Y0FA 5DDOC 1H6KX 4PKDB 1DZ5A 2NZ4A 2DNOA 2DO0A 3R1HA 1DHMA 3MUMP 3H2VE 1N88A 2LXIA 2CQ3A 4CH0S 3VAGA 4F25A 3CCVS 3L3CA 2J8AA 5LSLA 3TYTA 2XS5A 2MY8A 2CPXA 2Q79A 2DGXA 1H2TZ 2JRSA 1X4BA 2D3OR 2B0GA 3CMES 2DNQA 3TO8A 1WF1A 2YWKA 2RQ4A 5MLCV 2YKAA 3CXCR 1FNXH 1JJ2R 1QVFR 2M7SA 4CQ1A 3U1LA 3CC7S 1U1RA 1WHXA 2VONA 4WKRA 3IRWP 2DH7A 1WHVA 1X5PA 2KH9A 1X4CA 1D8ZA 3G71S 2UP1A 2DNLA 2MZQA 3V4MA 1Q81T 2LEBA 1K9MT 4FXVA 2DITA 1AUDA 1D9AA 1H2UX 4F02A 1KOOA 2M8DB 1X4GA 2VOPA 1YHQS 4YOEA 2LKZA 2G0CA 2KXHA 1A9NB 1ZH5A 2DH9A 4WIIA 3J7ZT 1VQ9S 2DH8A 2FPHX 3P49B 2D9OA 3I56S 2MKJA 2OSQA 2M8HA 3NNHA 2CPYA 2CPDA 2VOOA 1WI6A 2CQHA 2QA4S 4WFNQ 1ZZNA 2DK2A 2ZJQQ 1SJFA 3US5A 1M1KT 2I2YA 3CPWR 2RRBA 1OPIA 3DLLQ 5ITHA 2DNPA 2GHPA 3G96A 1WG4A 2E5HA 1JMTA 2EK1A 1FO1A 4LJMA 2FY1A 4P6QA 1JJHA 2E5JA 2FC8A 3P3DA 4LMZA 1SXLA 3UD4P 2DNGA 3MD1A 2SXLA 2N3OA 2M70A 1PGZA 4ZKAA 1A7GE 3CCES 1FXLA 2LCWA 3RW7A 5DETA 1R8HA 2KU7A 2ZJPQ 2DGWA 2CQGA 3NS5A 1VC6A 1NU4A 3EX7B
chains in the Genus database with same CATH superfamily
1CVJA 4OX9F 5BXIA 2NQPA 2A1BA 3POTA 3R5GA 5KOWA 1MU2A 1XN9A 3W64A 1DTTB 1R6YA 2QEXS 5LXRA 2DHXA 4X4QA 1T9VA 2B9XA 5IM0A 2H4WB 2RIJA 4KJIA 3EGNA 4EUVA 2FYXA 5B0EA 1XJWB 2C28A 2B8PA 4QIVA 3CMAS 4NZ6A 5KFYA 2AD9A 2IA0A 1BXNA 1RHJB 4NLXA 5H9EK 1VISA 1S0NA 3WZ0A 4C97A 3QSYB 1XMBA 2DNYA 1RQ0A 2CQIA 3DRSB 2PEHA 3OVBA 1KSPA 5AE1A 2ERRA 2VG5A 5EWGA 5KT3A 4DSIA 3R7BB 3DLEA 4H4KC 4GKJF 4AL7A 3FEZA 4LIRA 5KFWA 4F4KA 4I7FA 2DY1A 2UUAF 4NWBA 2JVOA 1I94J 2BX6A 3R5JB 1YIJS 1T03B 1FRKA 2ATLA 1PJ6A 5CYMB 2HW3A 3PJXA 5A8RA 3W63A 2GQQA 1EX8A 4LFBF 3EM1A 1VMBA 2XI3A 3IG1B 1F0XA 2JEIA 4RW9A 9RUBA 1BLUA 4HI2A 3PXGa 1F9EB 2RS2A 2J0QD 5BJRA 5L9NA 2Z2YB 5IQ6A 2BABA 3DDIA 4DQPA 2ZDOA 1YZ6A 2XWYA 4A8WA 2WW8A 1U8SA 1UEUA 2IIHA 2ZC3A 4JI2F 1CJTB 1EETB 1FJ7A 2YNFB 4IFVA 4KFBA 2CJBA 2D1CA 1CJKA 3R5AA 4NXMF 1S9GA 5JJBA 1H98A 3CJKB 2BE7D 2OMOA 4MYTA 1HA1A 2QA1A 5I42B 2R2TA 4K8RA 5EUHA 3QGPA 1TU0B 1JLEB 4NLPA 1NNDA 3DRRA 5C42A 4X4NA 1VQKS 4LF1A 3IS9B 3TUJC 2FLOA 3OR2B 1NDLA 4ZVGA 4FYXB 3BSCA 5KG3A 5LM7E 2C2MB 3KUHA 3CCSS 4KE5A 2YH1A 3TW0A 2E1MC 2VA3A 3MM6A 4OZJA 3LGHA 4JI1F 2FIUA 3FQLA 4PWUA 3E01B 1PO6A 4NCGB 4WE1A 4DUTA 5EN1A 2ZHBA 3ILLA 3TAQA 2XO6A 1RI7A 3CCMS 1NLKL 1RHRB 4F50A 3QIDA 4B17A 1AUSL 1EKSA 3ITHA 4L73A 2UZAA 2E66A 2EC2A 4O3OA 1H3DA 4KKOA 2HPUA 1ZA1B 3POTB 1MU2B 3M8WA 5D3GA 2G1DA 4LFCJ 3IR6B 1RAHB 3RRGA 4C7QA 3MECA 4F4AA 2HG4A 3MCOA 2UUWA 2PIIA 4P2FA 1HNZJ 2J7UA 2DRBA 1BQMA 4CCHA 2OPSB 1RHQB 4OV6A 2ROPA 4B9NA 3OLBA 4UUXA 1U2RA 3IAM9 1LNQA 2MQ8A 3CMES 3KK2B 3UD5A 1JJ2R 1QE1B 4CQ1A 3PW7A 3D6MB 3QIPB 4AFFA 4FVMA 3I6PA 2VG5B 1XNRF 4CYUA 2UP1A 4DL6A 3OJSA 1K9MT 2OEMA 2P9GA 3DLEB 1CULA 2GMHA 1CPZA 3PJWA 3LUYA 4OL8A 2QL7B 4D3HA 1KONA 2FPHX 2XTJP 1PCAA 2B7BB 1AZSA 3EZ5A 2HBYB 2ZKTA 2VOOA 2HQ3A 2F4FA 2QA4S 2WAQD 1Y0HA 1SJFA 4DV0J 1KEKA 5A8RB 4JV5J 2GHPA 1NHVA 4RW9B 2W4DA 2J0WA 2KL8A 4KV8A 2C3UA 2GO8A 2KU7A 2E9TA 4PWDA 4Y3CA 1TZ0A 4B9SA 4QIGA 3KLEA 4GKKJ 2YKPA 3BH6B 5KFKA 4XPCA 1UVJA 4DG1A 3ZC4A 3EJMA 2LDYA 1SCJB 2Z4PA 1CG2A 4O3RA 4WXOA 3C14A 1A0OB 5BR8J 3K17A 1X5OA 1IVZA 4B3OA 5B7WA 3Q24A 3NP5A 4PCQA 4OFZA 2D69A 5HQ8A 1XWLA 5C25A 3MM8A 1BE4A 2F63A 3CEDA 1RT5A 3IA0A 1G6BA 1QTNB 4CO5A 4X84A 3PM9A 5IC4B 3J80Y 1WDTA 5KFUA 1UJ6A 4LF7J 2E9ZA 1RT7B 2JLGA 3DRRB 2XGQA 4PXDA 4BWMA 5C42B 5GMEA 1T95A 4CP5A 2V0NA 4DUZJ 5IOLA 5IQQA 3PCOB 3M2UA 2DGVA 2J7WA 3TUIC 1BUXA 3HHLB 3DGPA 3MEDB 5K14B 4N5SA 5HROB 3MM6B 3THVA 3HD2A 2NCKL 4J9OA 5KFTA 2LEPA 4WE1B 1NH7A 4E8UA 4ELUA 4IRCA 2HZVA 2ZNYA 2BM1A 3ITHB 2YKMA 4A8XA 4UZCA 4ZP6A 4KKOB 2H9ZA 1PBAA 3M4XA 2EFOA 5D3GB 5D78A 3TZXA 1FF2A 3EVOA 3K8WA 2J8SA 3LGNA 4RU9A 4ZITA 3TZYA 4LF8J 1QSSA 4ZCKA 4CLFA 1U1OA 1B7YB 3IC1A 3DHWC 4F3OA 4TY8A 3IXQA 4BC7A 3VAHA 3Q23A 2MZ1A 5B09A 2Q3PA 4F2SA 1HKAA 1UZDA 3VGSA 1HNWF 1XR7A 1ZTWA 3MMCB 3IM8A 2ATCB 1T9YA 3R9LA 3LA0A 1JXVA 4FVCA 4ZPVR 3EUNA 4DX7A 4MIBA 1LWEA 3SV3A 3UCZP 4MJKA 1FRLA 4HKQA 3KHRA 2VODA 2DGSA 4YR0A 1JX4A 1HBOB 2Z2LA 5F3ZA 2O67A 5KG6A 4QW9A 3DI6A 3TR5A 4USTA 3QLHB 1KR4A 3EDRB 2OKQA 2IMWP 3CJ3A 3D3CJ 5AT1B 3DDNA 3R2CJ 4EO6A 2X1AA 2I38A 1GTHA 2H54B 2C3MA 2AJ0A 2ASDA 1GMWA 3GYGA 1S9EB 3J7YU 2CZVC 3I5AA 3KLGA 2BKOA 2HQGA 2WK4A 3V4IA 1UA0A 1VGYA 3LAMA 4HVZA 4KHMA 2MKSA 3GFZA 3C14B 3HSDA 1TMJA 5GMKa 1K47A 2DPIA 3DXBA 1DJ0A 1RZMA 1IBKF 3KMQA 4UOFA 4ZA1A 4K5SA 2EVZA 4Y0FA 1DZ5A 3MM8B 1R43A 2LDIA 3MUMP 1V3RA 3TYTA 1BD6A 4GO7X 1DLOA 3CCTA 2QYCA 3E2EA 3ETMA 3CB4A 3DHXA 4DCOB 5IXUA 1IKWA 2E1PA 4DV2F 4I68A 4FN5A 3VQTA 4RW7B 4JI4J 3V6DB 1HQEB 1TV6A 4X4OA 4Q0BB 2HBQB 1X4GA 3AOCA 3PHTA 3AD8C 4LUBA 1J5OA 1VQ9S 2M5YA 1YJRA 4LRFA 2UUTA 2ZNZA 4CO3A 1F9HA 2AGOA 3HVWA 1MN7A 3KLHB 1RDRA 1MROB 3SFUA 1C0TA 1NSAA 2AT1B 2AIRB 2W24A 3FJ2A 5HMWA 1JJHA 3PV8A 4USMA 4F4ZA 1MMDA 2YKMB 1TKZB 5EWEA 2R7SA 4Q8FA 1HR0F 1NK7A 1T9TA 4P72A 1RTZA 1FKOA 3P8BB 4IOCQ 4DUYF 1VQPS 3KK1A 1EJ7L 3QGGA 3SDEA 2RRAA 4H4OA 2HGLA 2J6UA 4NI2A 1FFGB 3V6HA 3AB4B 3T6JA 1UEKA 4OYWA 4TY8B 1VIOA 3C2PA 3Q8UA 5H1SV 3TUZC 1FXRA 4CLYA 4G3IA 2LA4A 2AX0A 2ZH4A 3GB0A 3D6TB 2GGPA 5IT9U 4FXWA 4RPFA 4IG0A 3AT1B 2VH7A 3SCJE 1QM9A 2W4CA 1RTHB 2I1RA 2HEKA 4NZ0A 1WWHA 1LWEB 2AYBA 1C0UB 1NDKA 3IGVA 1C1BA 4D3GA 1IJEB 3WX8A 2HHPA 4Q8EA 2FHJA 2EPIA 1GTEA 2HZCA 4NYZA 4CLSA 1FESA 2MSSA 1S6UA 3T5JA 3PEJA 2ZOFA 2ACYA 1YWXA 3J7YI 2IRUA 1C2PA 1S0OA 5EX3A 2XGPA 5FLXY 2Z57B 5IFMA 1VQ7S 3A13A 4M5MA 4IQXA 2BMBA 5HSPA 2LXFA 3G87A 2X7IA 1LWFA 3NWGA 1IJFB 1ZPVA 3H25A 4OX6A 3NAHA 2QT7A 2EFQA 3M1VB 1M0SA 4JI7J 5D4OA 2C2KB 4U7CA 3G8SA 4LR7A 3BO2A 1GXTA 4C3KA 2B6AA 2R7WA 1NH8A 1UP1A 2X3DA 5M2PA 4LF6J 3SQGA 2ZFHA 4P7TA 3HZEA 3Q8VA 1WG5A 1X7VA 3MURP 5HMZA 3B78A 2W2PP 5IS2A 2ZC4A 3NKYA 2R3VA 4KGZB 1VQMS 4K59A 2XY5A 2CPFA 4LBPA 2QL9B 5GADU 1N36F 4DQRA 4B3RJ 2FHKA 1OIAA 2PC6A 4WCEQ 2B5JB 3FBCA 2AJFE 1RWKB 1TQLA 1IKWB 4KT0C 3PX0A 2RF2A 2E5GA 2WOMA 2OPRB 1S76D 4UY8T 2OFHX 2NR0A 1GT8A 1TELA 5KFIA 4DF4A 2BOPA 2VQEF 5E3QA 4PG4A 4QBUA 1HWKA 4DR1F 2WONB 2WVDA 3D6HB 3BSAA 4QYRA 2NXUA 3BREA 3KFWX 5DM6Q 2MQNA 1AYEA 1KQSR 2CVEA 3BB5A 1HQ2A 3V2UC 3BGFA 3BS9A 3SXLA 3GV8B 5C2GA 4PAAA 3C3LA 3FBBA 2QLWA 1VDHA 2R2UA 2ZVSA 2CPEA 2VKRA 4OIXA 1S6PA 3ILIA 4WF9Q 4H4OB 3LQVA 4TU9A 1N4LA 4NI2B 1ZAXA 2Q1LA 3VZIA 1RISA 3D6FB 4J7CA 4OQJA 2XZWA 3VVUA 3MEEB 3OUYA 2L08A 4N8OA 3SFGA 3LWMA 2O1PA 3H7HB 4PKDB 5I3QA 2H51B 3R3TA 2DO0A 3P5BP 3UFCX 4IG0B 5H9FK 2B4OA 1N48A 2VB6A 1D9DA 5HQMA 2AEMA 1VK3A 3A4TA 4V19J 2P9CA 1MG7A 4FYVB 2VASA 1C1BB 1AT1B 3K2YA 1S10A 2K1RA 2VJUA 3H5SA 2KZZA 2ASYA 2RDJA 2MZQA 4P2MA 3H42A 2UUCF 3NGKA 2RHQB 3SCLE 2FJXA 1NCLA 2Y0SD 3WIVA 2D3O1 1T7PA 1A9NB 3TQ1A 3J7ZT 3I0RB 3LF0A 2LFVA 2ZE2A 4ZDNA 3G82A 2KJWA 4MKAA 2DEIA 3FMBA 3UQSA 4OI4A 2AZ1A 2IHR1 3PW0A 2SXLA 2CNLB 2VPWB 1JLQB 2GVDA 2PSZA 4DV5F 2E7VA 4NLWA 5A2QU 1TVRA 3LWLA 3KUGA 3JSMA 3PTWA 3G9CA 2EFGA 1UVMA 2ZBCA 4I2PA 5GADI 3SQGB 2Q6BA 3BQ2A 3OD2A 4A8KA 1EP4B 5G4DA 2LVWA 2AYEA 3FSYA 5T7LA 4NLQA 2HK3A 4Q43A 4YB5A 1VQOS 4DPWA 3CD5A 2W1BA 3UN2A 4LBIA 3H98A 1X9WA 4NEZA 1ZAWA 4DPYA 2ZOMA 4ECYA 2FJDB 4X4SA 3KJVB 2UU9J 2VFRA 2HVDA 1RU1A 1HWUA 1RYRA 2WB1D 1SKWA 4AXIA 3AAWB 1F1BB 2NPFA 5KAKA 5D4NA 2B7CB 2BV3A 2MJUA 3GJTB 2C3PA 4X66F 1WTBA 5IWAJ 4DS5A 3IRXB 3HX9A 1HI1A 3WC2A 1S1WB 1VBXA 2LQ5A 3HHLD 1ROFA 2CJQA 2RDIA 4OHXA 4E98A 1GMUA 2MJNA 5LMUJ 1FEEA 1U47A 4E2FB 1QAYA 3QWUA 4FZVA 5L38A 4CLTA 1N32J 2BQRA 2V2KA 4OYIA 4QYZK 3N28A 3AXMA 2CADA 4PR6A 2DR9A 3FSIA 1T9XA 3MMBB 1O6XA 2N7YA 3KJFB 3S1TA 4LRDA 2FVQA 1WG1A 3OTBA 4B9LA 1LKZA 2ZITA 4M5LA 5IZHA 2GNKA 3OUYB 2MDAA 4TVAB 1MW7A 1SUQB 2ZZNA 2LYVA 3HP6A 3CJ5A 1UZHA 3WC0A 4HR2A 2OTLS 2B3TB 3B4MA 1RTIB 5HP1B 3HVTA 2BE2A 5DG8A 3QPIA 3MHYA 3MF5A 1SJRA 5HVHA 3TP2A 1JLBA 1YG0A 1CS4A 4JI3F 2RILA 1RU2A 5F8HA 2O3DA 3ZNJ1 2AV5A 3OTCA 1WF2A 2XNRA 1Y00A 1PIEA 2K3IA 4NOHA 3HMJG 2PO4A 4Y2IA 2H5IB 2PE8A 4L75A 4KC5A 3G82B 1UVLA 4CO1A 3EPGA 4PG6A 2JX2A 3L09A 3LANA 2VIHA 2E1RA 3A8JA 2OJ3A 1AROP 3BGRA 3GR0A 1CQNA 1RBOB 2HNYA 4WZMA 3CJQA 3NCRA 2XS2A 2OP5A 2R7OA 2MMYA 3K5NA 1R8BA 1X0FA 3ETOA 2BQ3A 2GVDB 1D8YA 4KH0B 2NREA 1TVRB 3MFIA 5DQGA 1R8CA 3VAKA 3JSMB 2W2MP 1RKIA 1OYEA 2DIVA 4X62J 3RB4A 3JAMY 2CQ2A 4EGLA 2QC3A 3HHKA 2ZH9A 4K4UA 3HPOA 1ZM9A 1FNMA 2FUG9 5AE2A 1B70B 1GXLA 2OFGX 4OZ1A 4GVBA 4DL0C 4B9MA 4O44A 4OZNA 4NX9A 4DI6A 3LW5C 2KB2A 3RB6A 3GWCA 2B4UA 3JQJA 3H2VE 4DLEA 2CQ3A 1R31A 3R5DA 3W60A 2HS0A 3TAPA 1U48A 4I6YA 2VC0A 2VD3A 3SI8A 1WF1A 3CXCR 2BM0A 2VKZG 3D0IE 2UUAJ 4J9RA 4YFUA 1XMQF 2ROGA 1D8ZA 1YRXA 1XMOJ 2V8PA 5IT0A 2W2OP 3U27A 2G13A 3ENVA 1N5YB 4F4WA 3NOCA 3R7SB 3LGMA 3I56S 2Y8YA 3KLFB 4LQ3A 3CSKA 2VU5A 1T94A 3F0NA 1KLNA 3IP0A 3ENQA 2XHCA 2Z30B 3A8EA 4HACB 2ZZMA 2DT9A 3QJLA 2DNGA 2GQ2A 2N3OA 4B3TF 5G0RB 2H5JB 5DETA 1NDCA 3JQMA 2V8GA 1NU4A 3GIIA 5D4LA 1FWPA 3NOGA 4HTIA 4L76A 3CULA 3OT9A 4MK7A 1UVIA 4R0EA 2FJWA 2X1FA 2BACA 3T41A 4IG3A 3Q8PB 3BBBA 1ZZFA 2VG6B 3C6UA 4JBCA 1HL6A 3GG1A 2XS7A 3OXFA 4K2XA 3MR3A 2KJVA 4XDCA 1VQ8S 2Z2MA 1NSPA 1FRXA 1MWQA 3ISZA 3MR5A 2IM0A 4IDKA 2DISA 2Y1IA 2VQFF 3ILOA 4DV1J 4EYHB 2B43A 3MPVA 2RMLA 2KYZA 2CJ9A 2HKEA 4K4XA 3X1LB 3ZZOA 1JLBB 3RRKA 1S79A 4KY3A 5KFRA 3HZGA 2QLFB 4DDFA 4ATNA 3PIOQ 2E9RX 1KTVA 2R4FA 1X5SA 2RE1A 1M90T 3BH7B 2EWHA 1TTHB 1RT3B 2DYAA 3Q8SB 2F4VF 2RRNA 4OHZA 1BWVA 1WDDA 2HNYB 4LF5J 1KHVA 3OW2R 4OHYA 2DNNA 2RAQA 3I4HX 1E6VA 1TKTA 2NLWA 2QA2A 3GCWP 2QSWA 2FZCB 3W5ZA 2B9YA 3AB2B 3CO0P 3HSJA 2AJ4A 2KFNA 2QMXA 2F8MA 5J1NA 4B9TA 1UW4A 1K1SA 3QQCD 4DWIA 2KFZA 2JLEA 5LMNJ 3G6VA 2XWXA 1ZM3A 4TQSA 2HMIB 3QO9A 1UAWA 3WBZA 4QCLA 5CZVA 1NJWA 3RBEA 4GVBB 4YS2A 1FKPB 1RHUB 4Z2XA 4GVLA 2W7OA 2Y3YA 2K2PA 2IDEA 2CNNB 4YB1P 1RT1A 3H59A 5E3AA 1NUEA 5LT5A 2HRTA 1C4CA 4X65J 2XHWA 1RA7A 3RW6A 3NRBA 5GMDA 5HLFA 5GAEU 3NCQA 3OTOF 3BQ0A 1WKKA 1S0MA 4OI6A 5HVFA 3CT9A 2GIFA 1IR1A 2KVIA 3MFHA 2P6TA 1H38A 4ED1A 3FCWA 3GONA 2UVRA 2D7SA 1AFIA 1YZ7A 1YKWA 1CC8A 2VG7A 2YWWA 1NKCA 2DR6A 3TJAA 2OH2A 2OHDA 4W90B 2F1FA 2BEFA 4WP8A 4OZ0A 1S1XA 3D0HE 3VZHA 3T1YF 2IVMA 1HMVB 3PW2A 4RWWA 1UFLA 2E29A 4A8SA 4DPOA 5CCLA 4USIA 2XZTB 4M5HA 4IG3B 3WIUA 2VL1A 1ZAVA 2YQ3A 1F3FA 2MYFA 3BR9A 2GX8A 3MPDA 1V6HA 2IC3A 1S59A 4CT8A 2W8KA 2XSFA 1FEHA 2GS8A 1GEHA 3PR4A 4PYDA 4CH1A 2IRYA 4KIAA 5A8WB 1B64A 3CE8A 4OLPA 3CCVS 4J9VA 2FZGB 3OPKA 2V8VA 2FJAB 3EWGA 1S1VA 1RBAA 4PXBA 4F2RA 5E3RA 4A46A 4LF2A 4M8LA 2WBMA 3IRWP 1KLMA 3A3OB 4P73A 4DL3A 2ZH7A 4XIUA 2AWZA 2LEBA 4MAKA 4JI0F 1KN6A 2DPJA 4NRUA 4OZ2A 5D8HB 1E6YB 5AE3A 1FDDA 3CJ0A 2FJEB 4USWA 4C8ZA 4OHVA 1PBUA 7FDRA 2R8GA 4NLGA 4LF9J 1J5EJ 3PEHA 4IFYA 5KFFA 1PAEX 2A0FB 3I96A 4V1Ak 4DX8H 2OELA 2E5JA 1C1CA 2J5AA 4OI2A 5E5NA 2JC0A 3A3PB 1TL7A 3NS5A 4JI5F 3CDWA 2IJRA 3GTYX 1S77D 4DZ6A 2R8HA 4EZ9A 1YDLA 3L7UA 2KI2A 3CW2C 5JUMA 3HHDA 3ZFVA 3UE2A 2CPIA 2QIFA 5J1EA 3UNGC 2ZEJA 3UVJB 3M7VA 2I0XA 2VF3A 1D1UA 1WELA 1T02A 2RH3A 4NLOA 1NKBA 1X5TA 2IAJA 1WACA 2HRYA 1X4EA 5C5JA 4DBQA 2LQJA 2G9OA 2VBWA 5D6GA 2B4VA 3C66A 2V68A 1RT1B 5L39A 1JLCA 1OWXA 1PYSB 3V81A 2HNDA 5ADZA 3BR8A 3PYFA 5HLFB 1TUWA 1CQMA 4IUFA 2MB0B 5CQGA 1V3SA 3GIRA 1RT6A 1DRZA 3K0JA 3AJ2A 4KR0B 1RAAB 1WKJA 2APOA 3UN5A 2B9WA 3LO3A 1ZM4A 4FP9A 3BDPA 4MK9A 1RABB 4TLQA 3DMJA 1UWAA 5I4MA 1SKSA 2P5VA 3G8TA 2V2QA 1N34J 5T14A 2VICA 1S1XB 2AYGA 2YKQA 3LPYA 3ULHA 3MEGA 2CPHA 2DCUB 2XULA 1W7WA 3T5LA 1ZA2B 3CUNA 1Q78A 4GC7A 3A1YG 2HHHF 1S99A 2GJIA 3I9ZA 3BPDA 3DLJA 2HQCA 1U0SA 2YPYA 2Z2ZA 2GJ2A 3LP0A 3MOJB 4LR8A 2FLNA 1S48A 2JOQA 1AW0A 2XO7A 1CSJA 5KTQA 3GP9A 4C0OC 2ZVIA 3FZ2A 5DDRC 4CI0B 1M5VC 3HLUA 1YTYA 3SCKE 3VCDA 2RVJA 1QUPA 1UJ4A 3MTJA 2DHHA 3MI7X 4G1QB 1SKRA 1XNQJ 2WVBA 2MY7A 1R0AA 4TN2A 3UR0A 3VV2B 2NXEA 4I4BA 1OJ4A 5DGAA 4MKYA 5B0GA 1UL3A 4U9RA 1YJNS 1VRUA 1NM2A 3GILA 1VQLS 5AJ3J 2HHWA 1RWUA 5GAHU 4FPRA 5KFVA 2DHGA 3DOLA 2J6TA 1K8AT 2DHSA 1RWVB 3Q8YA 3MUVP 2DGQA 1SJ3P 1YBTA 3FRYA 1S57A 3RAMA 4BS2A 1KVIA 4A47A 3GPAA 2JDJA 1LK5A 3M30A 3L7OA 2UXBF 2R7RA 4P10A 4YY3J 1M5HA 1SC6A 1U1KA 2ZH8A 1U0HA 1C1CB 4NMXA 3M8SA 1O8BA 3UDCA 3FEXB 4KAIA 1JNRB 1WF0A 2AHOB 3DDKA 3H5UA 4Q7AA 4Y2MA 5CXTA 4DOZA 4I6AA 3T1HJ 4WTOB 3DOKA 4IOAQ 4C8LA 1T3NA 2YVSA 4ZVPB 2R7UA 2UXDJ 3L4BC 3PFOA 1PSDA 4AQYJ 4DN9A 2HHXA 3OHAA 1YJVA 4GO5X 4JI8J 1LFPA 5A2QY 1U45A 2IAJB 5DDOC 1H6KX 3GCXP 3NGUA 1NB7A 1N88A 5A6PA 4C98A 2VZ9A 2FGOA 2XMAA 4LBHA 3AOBA 1MMLA 3V81B 3VWSA 2HNDB 4NA1A 3TO8A 2GAHC 2YWKA 3N79A 4DR4J 2HS4A 5JXSA 1P9YA 1VRTB 4WKRA 2AEJA 1RT6B 4ZJQA 2WSCC 4DQQA 3W2WA 3CJ8A 1ZBTA 1AUDA 2Q66A 3SSRA 5F8GA 5I3UB 4DR6J 2YNGA 2OI2A 2BUNA 1SV5A 3MCNA 2OSQA 4X4PA 4ZJLA 3DMJB 1KHWA 2XBPA 4EU0A 3IBWA 1NAQA 2FD2A 3C15A 3HD1A 1LWCB 1D09B 2IMOA 1JMTA 4A8OA 1LW0A 1I94F 4C8OA 3DLBA 3EX7B 2XLJA 2XMVA 4DEZA 1WUUA 4MKBA 2CJXB 3C46A 3CO9A 3TZWA 3VGVA 5GAGU 2KG0A 3PRDA 2PFDA 2J9DA 4ID8A 3HT0A 1VIXA 2XNQA 1NJZA 5D0GA 3LP2A 2BJEA 4HI1A 4ZVEA 2FJBB 3CCQS 5CD4H 4YHHJ 5H9EJ 1TKDA 1YJTA 4EEYA 2V94A 4DX5A 1R0AB 2R7QA 1HPZB 2EI5A 3G86A 1YK9A 5GAHI 2MKHA 1U7LA 1VRUB 3PX4A 4NLYA 5B0CA 1FCAA 5CCMA 3OR1B 3J7A1 4DR5J 1VR6A 3M6XA 3B4DA 3FBFA 2CWXA 4WFXA 2Y9HA 1KVJA 2F7VA 3U1NA 2JLFA 3FFIB 3DN9A 5FLXU 1Q8BA 3M6WA 5E2QA 5M2UA 3THPA 1HW8A 5SUHA 5CA5A 3JB9k 1SBRA 2BBEA 1YJWS 4WPAA 4BHQA 1TK0A 4RNFA 4A8MP 2MZRA 3I0SA 2VV5A 1L3KA 3M30B 3N9UC 2V4JA 1LQ9A 4OZ3A 3NGDA 2FJVA 5HMYA 1Q95G 1IR0A 5CYMA 1JQGA 1SPBP 3IG1A 3M32B 2RS8A 1VS3A 2E44A 1APSA 5K8PA 4ZPBA 4P7VA 2CQPA 3AQPA 3U1MA 5FJ4A 2M9KA 3PW5A 4CLLA 2K3KA 3QFHA 3LAKA 3NBPA 2V5HG 1B0PA 3AJ1A 3FQKA 3HVAA 4J9LA 4LFCF 2YNFA 2XMKA 2I9SA 4LF4J 2XC9A 2HQFA 1Y10A 4RJVA 3LP1B 5B0BA 1HNZF 1JIHA 5B0FA 3GYNA 3CJKA 2MSTA 2AU0A 1YRUA 1JB0C 1I3OB 1U25A 3D2WA 1VLOA 2ABYA 3BQ1A 4DV6J 1QDUB 3GJRB 3BEGB 1JLEA 1BY9A 2ZH1A 1T3OA 3BN7A 1B4SA 5KFSA 1N5TA 3NWRA 2YNGB 4F0HA 2MGZB 3KOAA 1SV5B 2XYGB 4FYWB 1ZTTA 3DCAA 1F5BA 2HLTA 3N6NA 1XTZA 1UVKA 2PGCA 3ADAC 5JVHQ 3O3LA 3IR7B 1X9MA 1YVFA 2DXEA 4EBEA 1Y9OA 2L3MA 2KXFA 2CNKB 1U1LA 3AD9C 5EHHA 1N5QA 5GAGI 5E41A 4RW4B 1NJIT 3HULA 2KM8B 1SIWB 1VK8A 2CPJA 2G2ZA 4Y28C 3VQSA 4W92B 3ZO7A 4DV0F 4WFAQ 4JV5F 5F0UA 2IDLA 2UXCJ 6FD1A 1U1NA 1MWYA 4RX6A 4B3SJ 2PMWA 4HDHA 2EC0A 3LP2B 2XZDB 1ZETA 4UZBA 4R0JA 1YITS 4DV4J 4USKA 4GKKF 4B9VA 3NMRA 4N56A 4KPYA 1H0HB 5KFCA 4ZP9A 2OPSA 1RCXB 4HTJA 3AQOA 4Q2MA 3EVWA 2DXDA 3L3CA 3GLJA 2DBBA 5BR8F 4X4RA 1RT2A 3NEKA 2VBXA 4MKVA 1O51A 2RQ4A 2BANB 3HFZB 3G8QA 1NZAA 4RO0A 3UN3A 1OY8A 4DLGA 2YKNA 3KK2A 1QE1A 3MR7A 3NGRA 3QIPA 5CH7B 1ZM2A 1Q81T 5AXMA 1HHSA 3IN5A 5DRKA 3CD7A 4LF7F 1ZH5A 3I0SB 1H72C 4JYAJ 3PVXA 4DUZF 2V4JB 3W9JA 4DPXA 2RRBA 1GMVA 3OJUA 1RWXB 3RTVA 4X4UA 1SXLA 3M2VB 3UD4P 4CLZA 2AMCB 1JKHB 1Q4RA 3I31A 4A8FA 2DGWA 4ECSA 2CG4A 2ZZTA 1YRTA 4P71A 2C2DA 1WOSA 2HS3A 2L41A 1IR2A 2OPPB 5ETNA 3IFEA 1X4FA 2W9AA 3NBPB 5DLFA 5EGYA 3QZ7A 3PNIA 2AW0A 2DNZA 2XSJB 4LSNB 3K5MA 2CAJA 1MWZA 1WHWA 3I32A 3S7RA 2JC1A 4KYZA 2HRUA 4M63A 2C2ZB 4JI3J 2JEGA 4WJBA 4LF8F 1RGVA 3RGIA 3BSNA 3KYLA 3CCLS 4KHPJ 3DLGA 3KG1A 3C19A 5B08A 2DRDA 3CDUA 5HL7Q 3G6ES 1UCNA 2ZD1B 4QU6A 4UQTA 3PJ9A 2QMUB 2QLJB 6AT1B 3AJDA 2W7AA 1RT7A 3PIPQ 3R6GB 4AYBD 2XQCA 1V3ZA 1JLFB 2J0SD 1MLAA 2QJ3A 1HD1A 4F3QA 3VAJA 1GQEA 3HHLA 1NHKL 4OX7A 1S1UA 5K14A 3MEDA 1SVDA 5HROA 1WORA 3H0PA 1ZS6A 3J81Y 2GIRA 4K0KJ 1IKYB 2N4DA 4Y2CA 2HQIA 2IM3A 2P6SA 1QUVA 2G1HA 3M8PB 2QFJA 3D66A 2KZMA 3D1QA 2M52A 3OL8A 2YX7A 2NYHA 2C22A 4ANEA 1Q86T 1K44A 4EBDA 2IPOB 4Q2LA 1L3VA 1B3TA 2GJFA 4DV7J 2V34A 4ZPCA 5HJXA 5HBMB 3DC2A 2FQQB 4OYBA 1FRJA 3OXLA 3MZIA 4WZQA 3C8YA 4ES1A 4HHUA 1U1PA 3GJSB 1QJHA 3HM9A 2F9JA 1KQGB 2VC1A 3ELHA 4KGVB 2KHDA 2F65A 3KLIB 2GCFA 3DOMA 3K5OA 2B51A 3TEGA 1RT2B 2WB4A 4CLPA 2QE5A 2L9WA 4Y34A 2CJAA 4WFBQ 3SCIE 3ZTPA 2A2CA 4DSKA 4P9SA 5DQHA 3RYLA 2YKNB 2ALZA 4MYUA 1S4EA 3MMCA 4K7QA 1WC5A 3TJ9A 4RUCA 3W1YC 5F8IA 4O0IA 1EAYC 4ED8A 4DS4A 1WD6A 1U6BA 2YWGA 5FDLB 1HBOA 2VFUA 1FDNA 4O3NA 1SL2A 4NXNJ 2HFVA 3CDAA 4NL5A 4Y00A 2V4RA 1KNZA 5SZTA 4JI4F 3QLHA 1S1TB 5F9NA 3UD3P 1VBYA 1YJ9S 2HFSA 3BBCA 1HHTP 3ZNUA 5A0YA 4QQBA 3WQPA 1URRA 2VFTA 1RK8A 3JAMU 2CZ9A 3NS6A 4K50A 4CLUA 3BYPA 1S9EA 2MKIA 2RSQA 4ZVSB 2NXCA 1NJYA 4Y2AA 4I69A 2HWTA 1S6QB 4NZ7A 1Q7YT 1RAJA 1IBLJ 3OFFA 2OMLA 3N5BA 1TFWA 3Q0AA 3DFEA 5J2NB 4USUA 4CLKA 4C2MA 1NZ8A 4B9UA 2YNHB 3DGVA 2EBEA 5LSRA 1UTAA 3VAGA 1KQFB 3DLGB 2K7JA 3DYAB 3NLCA 3RG6A 2CPXA 5IV4A 5MLCV 1PC5A 1FTRA 4IKAA 1FD2A 4FDFA 4P74A 4EO8A 5A6WA 1HNVB 2KH9A 3G71S 2CFXA 3BGUA 1MN9A 1NKEA 4RW7A 2R7TA 1H2UX 4QWCA 5L1JA 3V6DA 1HQEA 4HHJA 4Q0BA 2KDOA 1RYSA 5ETOA 1DURA 2OUGA 1WI6A 3QWPA 1ZZNA 1S1UB 1GX6A 5L1IA 3MCMA 3ISND 2MKYA 2E5HA 5DZ6A 3KLHA 4MH8A 4DZDA 1T8EA 4FXDA 1AFJA 3P3DA 2Z0GA 1MROA 2BRKA 1M1GA 4ER8A 1LOUA 1R8HA 2NZCA 4B02A 1OPZA 5KFOA 3B54A 4RNMA 1N52B 2V6AA 4U8VA 1OQ3A 1TKZA 2F3JA 1EIYB 2GVZB 4KO0A 2QTWA 3GYXB 4EFAC 1FKAF 2V8DA 3MM9B 4ECZA 3CD6S 4XPEA 2FLLA 4I0WA 3IWXA 4CWBA 1FWKA 2XMJA 4OZLA 3EGZA 4DU7A 4BLGA 5C2CA 4PQUA 2CXEA 3NAIA 4JI7F 2J6SA 1UFWA 2PDAA 5CAAA 3ET6B 1D0EA 3DOMB 4USJC 4ECTA 4LF6F 1VOMA 2AYMA 3FZBA 4QIWD 1U1QA 4N7TA 3QBCA 2MLZA 4UTGA 1HBNA 3QT7A 2GMJA 1HWLA 3M8YA 1WKLA 2CZ4A 2Y1LB 1RTHA 2GV1A 4B3RF 2CQ4A 3FK4A 1C0UA 3CCRS 5K20B 1X4DA 3VALA 3FDSA 3H2LA 2BA9A 3CMQA 2CKWA 3BKTA 3D7SB 3HVRA 4X64J 4HH0A 2W2NP 5ETVA 1NRKA 2AX1A 3MD3A 1FA0A 3DRPA 4J37A 1FRIA 1HNXJ 1QSLA 1TKXA 5A0YB 4WIQA 3EICA 2D3ZA 2MQMA 1FJGJ 3TAMA 4PG7A 1O0PA 3FCVA 1VC0A 2RNEA 4TU8A 5L46A 3SSQA 4EI2A 1RKJA 2MLYA 3K5LA 1KKHA 4ANCA 2YX1A 4QR1A 5K5MA 2KT3A 2RU9A 3M1VA 1RAGB 3BM7A 4ED2A 3JTNA 4ICLB 3FC9A 1UMJA 4K5RA 4FYDA 4PPDA 3T3FA 4YN3B 3HJVA 3O6QA 5DDPC 2JHEA 3PYDA 5L1LA 3AH6A 4L74A 3H40A 3UDEA 3EZOA 2I5JB 4C8NA 3WDOA 4ELTA 3KTQA 4WFZA 2WSFC 4M95A 2DGOA 3ZZYA 3SSSA 2B5JA 4RU2A 3HDSA 3I5BA 5HK4A 5J2MA 2OPRA 3AA9A 4DQIA 3PKYA 5J1PA 2ILYA 2R2RA 4IRKA 4AD6A 3TOQA 2M3DA 2WTFA 4DFMA 4I1TA 4ZK7M 1VQ4S 1HD0A 2C2RA 2GC8A 4ZCLA 1G1XA 2U2FA 2WONA 3QZ8A 1FT8A 1RT4A 2E1AA 3W2VA 1U02A 4RW6B 2CQ1A 2YKOA 3RB3A 2V63A 4DPUA 2JNJA 1DY3A 1GAOA 3HJFA 4KO0B 1DQAA 2AZ3A 3OFGA 3EPIA 2F5GA 2Z8QA 4H4MA 1VC5A 3SEOA 1NK8A 5A8KB 4PQUB 4U67Q 2LU1A 4LRBA 4IRDA 2DB1A 2HBZB 3TA0A 1RTJA 2ZUAA 3CCWA 2M88A 5H9FJ 1Y11A 4CNZA 3MEEA 4LREA 4WU3A 5F9LA 3QRPA 2J8AA 3ZZPA 1VQYA 4OJGA 1DTQA 2C3YA 3G6XA 1HBNB 4O4GB 4DSEA 4TQRA 4WU2A 3C16B 2VONA 4ENOA 3QT6A 1WHVA 1YQHA 4C48A 1LEOA 4ZIVA 3VGTA 2OO4A 2XY6A 5KFNA 4ILLA 1T0TV 5E3CA 1D9AA 4NA2A 3BF4A 2UU9F 2V4QA 3BJYA 3M9NB 4RUAA 2OD4A 1J27A 2RKIA 3NNHA 2CPYA 3DRPB 1NHUA 4CLWA 8AT1B 2ZBRA 1GFWB 1LK7A 3SZ2A 4ELVA 1TKXB 3I0RA 2EFNA 1HFEL 3TAMB 3KDNA 5ITHA 3G96A 3GIJA 3TZZA 3NG8A 1FO1A 4OJHA 2FC8A 4FKXA 2BJ9A 3OTEA 1VJQA 3AXKA 5IWAF 3VHQA 1JXEA 4MK8A 5RUBA 1CJVA 2ZOGA 5DQIA 4O3PA 2ADBA 2GZOA 2EKYA 1JLQA 2JH3A 3QYYA 5LMUF 3JS9A 4GRSA 3WX4A 3H90A 2VPYB 1QAIA 1NDPA 4NPOA 4ED0A 3GIKA 1FX4A 5FIIA 2MXYA 1N32F 3KHLA 2HWIA 5F8JA 5JVGQ 3Q2SC 1FVQA 1VFJA 2QO3A 5CHCB 1LV5A 1EP4A 4K4ZA 4YB7A 4KRWA 3ZXWA 1KFDA 2BOAA 2W4PA 4PUOA 1BQXA 3C6TA 3TUPA 4ZVQB 2EW9A 1P27B 4PXEA 5ETLA 1RSCA 3P45B 2MTLA 3IM9A 3E3XA 5J2MB 1IKVA 3KJVA 2QYGA 4Q44A 1YBUA 1OY9A 2OSRA 3PRVA 4ZCIA 2VBZA 2QL5B 3CDEA 2NXJA 5EWFA 1N8RT 1SJ1A 1HI8A 2BDPA 1U8WA 2BZ2A 2H3EB 1RB0A 4QW8A 1RT4B 1HW9A 1W2BR 3SBMA 3IRXA 3W2VB 5KG2A 4DSLA 1HBUB 1R0CB 3BGOP 4ZVRB 4IR1A 3EGVA 1S1WA 1R89A 1YJ7A 4QYZJ 3W8PA 3HO1A 4G1PA 4XTTA 4IH5A 1LFWA 1T9WA 2VHGA 1IN0A 4ED6A 4H4MB 4IO1A 3PKMA 2IM1A 5AXLA 1I1GA 2ILZA 1IQTA 1RAFB 4LR9A 1WC4A 2RT3A 2COLA 5CYJA 5KFBA 3MMBA 2PT0A 2FVCA 1RTJB 2W25A 1Q8LA 1G3OA 1LW2B 2HAIA 4X62F 1DARA 1WI8A 4DV3J 4U7UK 1T05A 2W8LA 4I6WA 1ITPA 1P6TA 2GFFA 4PG5A 1MSWD 4OI3A 2E5IA 1DTQB 1SUQA 5KFZA 2JFKA 1V5VA 2HGNA 4DQSA 3GFHA 1N33J 1U1MA 1Z2ZA 1Y5IB 4AL6A 3JYTB 3Q2TC 2YWHA 3RUBL 2Z56B 3ZZUA 5KG5A 1RTIA 1NSQA 3HHEA 5HP1A 3NL0A 2AP6A 3G4SS 1HNIB 3HKWA 3NNAA 4CO0A 4M5GA 1XR5A 2RKIB 4QIEA 1H73A 2HIYA 1QSYA 4WKYA 3FRZA 1XMOF 2AJ1A 1FERA 4B3MJ 1U09A 1UFKA 2HFZA 4K4YA 5J2QA 2J9CA 4RWXA 1VRQC 2PA3A 4RBTA 1KC8T 1CJVB 2POKA 3CJTA 2G0IA 2UVWA 3CF5Q 2XLKA 3ZZRA 1BQNB 3CD0A 3KDOA 3H4BA 2I8EA 4X4VA 4CNYA 1HQUB 1Q8IA 3RR8A 1Q0NA 2PI5A 3TANA 4P52A 5KFMA 1B0TA 3ZTQA 2ACMA 1ZPWX 2P9EA 2J7KA 4NLRA 4ES3A 2IBKA 3QFWA 3Q86A 2CQDA 1Z4UA 4ZLJA 2N82B 2RQKA 3B6BA 1IBMF 3R5BA 4RUBA 2CDRB 1RWOB 1QTMA 2OPQB 4ETXA 4PUOB 3OFEA 2WRMA 2E5LJ 3C6TB 1U2CA 4O0NA 1CEZA 1R7IA 1UJ5A 2JRSA 1X4BA 4OV1A 4DFPA 4DR3J 3MPWA 1U1RA 1HWJA 2V2ZA 1IKVB 4FF1A 4PEOA 2UUBJ 4DR2J 4DV1F 4O3QA 3EYZA 1J2VA 1PYOB 4FXVA 1UWBB 5F3TA 4MMOA 4UOCA 2KXHA 1AB8A 2ZH5A 2H1YA 1N5YA 1HBMB 2MKJA 4DF8A 2W9CA 4F04B 2ZJQQ 2DKOB 4C8YA 2VDIA 4LQ9A 3KLFA 1WG4A 5KFDA 4RLEA 3MM7A 3KKFA 4LMZA 3MD1A 4PPZA 3KLVA 5AXKA 3CCES 4M94A 4HACA 3IBCB 1TUVA 3CJ4A 4OYOA 3ENAA 4EMDA 4LF5F 5KFQA 2DNMA 5G0RA 3T9NA 2XCAA 1RWWB 2HHSA 1FTCA 2L48A 2QN6B 4TU7A 5IM0B 2C2NA 2UVUA 4DPTA 2EBGA 1Q7LB 2EG1A 2GO9A 4WXWA 4UUWA 2M4MA 1N54B 1K0TA 1MMNA 3R2DJ 4DR7J 2VG6A 1KVKA 1T05B 1Z1ZA 1LXJA 5LMNF 2QV6A 3MR2A 3W7BA 5HAOA 4JI6J 3FBEA 2ZM6J 3GR1A 2FC9A 4LVNP 2X51A 3EVMA 1RXOB 1BGXT 4ZJOA 4C0HA 4OYXA 2IVYA 1M5KC 3UDLA 5E7OB 2QFIA 2XCPA 1IXKA 5KG4A 1UEVA 3JSYA 4I7FB 3TX0A 2UVVA 2DNRA 2FHMA 4X65F 1VQNS 3UCUP 4TLRA 1SIZA 2GW8A 3OXGA 1IKXA 3MGJA 1RT3A 5ETKA 4LRCA 3CCUS 5J2QB 4OX9J 3P4UB 1B7FA 4NLSA 1ELOA 3HSZA 2RQCA 5HQLA 5F41A 2MZJA 4J91A 1SC4B 3H8YA 3T5KA 2CYYA 1FDAA 2BVZA 5KFXA 2P2CB 2LXUA 1FE4A 3EDQB 4ZVFA 1D3WA 2KRBA 3K89A 4IFVB 4KFBB 4EYIB 2DGUA 3N6LA 4M5JA 1CJKB 4FNIA 3CDBA 1QLNA 1S9GB 2Q43A 1Q5VA 2MQQA 2HMIA 4ID5A 2GIQA 3GU0A 2WVFA 1X60A 1FKPA 1LWXA 1SQGA 1O5JA 3F73A 4KQZA 3OTDA 2LECA 2QZ8A 3I4PA 4MFBA 3BYRA 3MXHP 4GKJJ 4WFYA 3MDFA 3T9ZA 5D0RA 4LT6A 2C42A 1W26A 3QJPA 2IM2A 4LFAF 4DFKA 4ED5A 1CJUA 3PYEA 4CT9A 4N8NA 1RLCL 5I3PA 3RU0A 2R7XA 4LFBJ 5IT4A 2W9CB 3GQCA 4NASA 1D9FA 2C2OB 4K4VA 3VAFA 3BO3A 1S49A 2EEYA 1KQKA 1VQ5S 2M2BA 3MM7B 1B0VA 2CRLA 3WHIA 3SV4A 4S0MA 2MZSA 3UDVA 5DM7Q 3A8KA 1PJ5A 3Q8QB 2MLXA 4JI2J 1RUSA 4LF9F 4P2SA 1J5EF 3ISNC 4PXCA 3PHEA 1HMVA 4KGMA 4ZPTR 1SQEA 3MECB 3RJMB 3AOAA 2FVRA 2CA9A 3PYGA 2EG2A 4M1KA 2DR7A 4NXMJ 3JTOA 2HFNA 3H2UB 3W65A 3CJSA 1BQMB 1W25A 2LA6A 1FE0A 2LEAA 4URGA 2FHOB 1U6FA 2CJKA 4DL2A 1TK5A 2CQCA 4K2JA 1URNA 2DO4A 3S01A 2ZBIA 3DRYA 4K4WA 1Q16B 1FNOA 4H4KA 5A8WA 1VI7A 2DGXA 1H2TZ 2B0GA 2QA4G 1FNXH 4CYUB 3GSIA 4Y2KA 1CULB 5ETRA 1RAOA 2IYIA 3VTIA 2DITA 3GIMA 1KOOA 1VCTA 2XY7A 2M8DB 1YHQS 2LKZA 1AZSB 4OX8A 4EK2A 2E1CA 1UPPA 4JI1J 5EDWA 1CBKA 3W66A 5C24A 1YLXA 1KRPA 4KSEB 1IKXB 3ZZ0A 4OHWA 1E6YA 3IO1A 4KV8B 1VLYA 3PY8A 1EB0A 3W5XA 1UETA 2CNOB 2IA6A 4ED4A 2ZUGA 4PWDB 3JSRA 2M70A 3R7NB 3TRGA 2ZJPQ 3KLEB 4QWAA 4YMEA 1N34F 4DG1B 2HBRB 2AGPA 3EXCX 2F40A 3FGVA 2HQDA 4ZS6A 2CJYB 4IYQA 1SL1A 3R8YA 4B3OB 4DX6A 1H7XA 3CJRA 1IWAA 3QT8A 4ID5B 3UVJA 4DL7A 3EXYA 5C25B 1P1LA 3CJ2A 1RT5B 3S6EA 2YX4A 2HFUA 3BPSP 3HFVA 1N5VA 1S12A 4XO0A 2EK6A 2DVIA 1SQFA 1XNRJ 4MFBB 3RAXA 5KT7A 1RWNB 2OEJA 4IH6A 1WC6A 4PQAA 4OYPA 4ED7A 2R42A 2IRXA 1XNQF 2LP4A 1XK8A 4DXLA 3QJJA 4F67A 1Y3JA 1N0VC 1B99A 3M2UB 2QRRA 4YQWA 3D4JA 3DU5A 4HHHA 4M5NA 1CJUB 1RLDA 3RBZA 1SJQA 3DGPB 2XYHB 2RHSB 3J81U 2MQPA 1BC6A 5AJ3F 3GMGA 3E8OA 4QWBA 1WJ9A 1OSCA 1Q82T 3M9MB 4HL9A 4UF4A 1GNKA 2MKCA 2RUSA 2W01A 3QAEA 5HO4A 3LH2S 1YI2S 2HZAA 4CZCA 1VJWA 3KMSA 4MTPA 2IFXA 4U95A 3D1OA 1DAXA 4ZMMA 2G0JA 3O5TB 3Q8RB 1Y3KA 2DNHA 4XAKA 2HK2A 4YY3F 2FLPA 4NLVA 2N4CA 2F8HA 2YPZA 3DM2A 1NJXA 1JLGA 4TKTA 2WSEC 4F26A 1WEYA 2A10A 2DNKA 4KTQA 3GE9A 2KG1A 2IYGA 2KM8C 1P1TA 3T1HF 1EZZB 2V69A 1OMSA 4M5IA 1WOPA 2GHVC 4YB6A 3MPYA 4JP8A 4NRTA 2UXDF 1KFSA 2R8KA 2DY9A 4AQYF 1EARA 4G1QA 2K7KA 5T41A 4JI8F 2Y1RI 2FTRA 3RBDA 1AXQA 2VJVA 1W2IA 3W3SA 4CTAA 2P8IA 1VQ6S 2DRAA 1SI9A 2BYCA 1RWMB 3DI6B 4ETZA 2QLBB 5D0HA 2KT2A 4O4RA 4DR4F 2NSBA 5C24B 4R25A 2AJ2A 1OQ6A 4C8MA 4CDIA 2JJ4D 2UV8A 2DIUA 3ICLA 4DR6F 3M8QA 4HT7A 5HMXA 4A4JA 4Q5VA 4NLDA 3KLGB 3MWBA 4NCBA 2ZHAA 3V4IB 5KFAA 2ADCA 1QD1A 5LJ5Y 4XK8C 5THWA 3KUEA 4UQGA 3M6UA 3IMQJ 4BWJA 1JJCB 1EQMA 4N47A 2HVIA 2YTCA 3D3BJ 1HNWJ 1TL1A 4N77A 3O1LA 2W2QP 2K8GA 3BV8A 1JNZB 4ZPDA 3BKFA 2A18A 1RBLA 3MCSA 1KBRA 1DLOB 3R1HA 3DKDA 2KKHA 2VBYA 1DHMA 1Y7PA 3FKBA 1RHMB 5DG7A 5LSLA 1AA1B 4YHHF 4ILRA 4ZVUB 2Q79A 1P9QC 4QWEA 3K58A 4URSA 1TAQA 3UO0A 4FPIA 1QVFR 2Y0BB 2M7SA 4KPCA 3ONQA 3AA8A 1JLAA 1TV6B 2BE9B 2DH7A 3KJNB 3FVYA 3H4DA 1VRTA 1J5OB 5CYQA 3UR3C 3D54A 2QLXA 4ANDA 3R97A 2VOPA 4C3LA 1YGYA 1RHKB 4DR5F 5HVGA 3TA1A 2DH8A 3QT5A 1VQSA 5I3UA 4AXJA 3OSPA 2ZBPA 3PACA 4OMFG 4Q45A 1C0TB 4Z37A 2I2YA 2WVCA 4RKUC 1OPIA 4GC6A 3F56A 3X3UA 2HURA 4AUKA 4YDDB 4LJMA 3TVYA 4P6QA 4OYMA 4CM2A 1NXIA 4ECUA 1LWCA 1PGZA 3RW7A 2CVIA 3UNYA 4ZVHA 1FKOB 3KK1B 3OV7A 3CIZA 3SDEB 2RD5C 4ZOSA 1IBKJ 3IWNC 2KN4A 4H54A 3DM2B 1DQ9A 2WBRA 2ZDPA 1DFDA 1X4AA 1JLGB 1R0BG 3W8GA 1F60B 3QSIA 2DEJA 4ECWA 3PG9A 5ETSA 2W7PA 4LIWA 4C4WA 4J9UE 2MHEA 3AODA 1PILA 2G4BA 2GGPB 2NSCA 1GK8A 5ETPA 2K06A 4O3SA 4YR3A 2X1BA 4ZIWA 4DV2J 2IBOA 4FYYB 2DHAA 4TYBA 5DDQC 3PR5B 1Q1KA 2BR0A 1WTFA 1M5SA 1HPZA 4CTAB 3UW1A 4LF4F 2RJZA 2BKPA 3OR1A 3PX6A 1U6ZA 2XB2D 2JWNA 4L72B 3VF0B 3K8VA 3NXZA 4J9QA 3DRXA 3FFIA 3OL7A 3UCGA 3LOUA 1WHYA 4DV6F 5KOXA 2WHOA 3KNAA 1QAJA 4F0MA 4QIFA 1DBDA 1LWFB 3H5XA 3M8QB 1KWMA 3TI0A 2W9BA 2BRLA 1HR0J 1VBKA 1UA1A 1L5UA 1RP5A 3P6YC 1XIQA 4DUYJ 2XEXA 3MR6A 2IVFB 2OAUA 1M5PC 2KO1A 1X9SA 3LTOA 1BWEA 4F3MA 2B6AB 3M32A 3KK3A 4RL1A 3HKZD 4K4TA 3MOZA 1X4HA 4YDXA 1FJCA 2IJNA 3MPUB 3D67A 1U26A 1TL1B 5F8LA 4ZLPA 3TQEA 1X0PA 4JB8B 3EZUA 2UXCF 4FKYA 3VAIA 3CGIA 1L3SA 1X31C 4B3SF 4LRAA 1BHNA 3RZAA 3Q83A 4MIWA 1OY6A 4F36A 4JOUA 4A8QA 4DV4F 3A8IA 2RUGA 5HATA 2RF2B 2WOMB 3LP1A 3OL6A 3HHNB 3MMAA 2VDHA 4ITSA 5DGBA 1WOOA 1S9FA 1JLAB 2CIMA 2VPXB 4WBFA 2DTJA 2B4PA 4KGXB 2J9EA 4AL5A 2IJFA 3H20A 5CYQB 2HHUA 2QMWA 1TL5A 2FVSA 1TMMA 3FCHA 2M0GB 5KT5A 3AY0A 2EKNA 2J76E 5KT6A 2ZHOA 2A2DA 2MGZA 3MEKA 1QAXA 1S97A 3J81j 3EE3A 2YNIA 2V67A 2GQCA 3QNWB 4NLTA 4QZVB 5EX0A 1T9UA 3A12A 3CTRA 2NXNA 2PA8D 2L9NA 3TJ8A 1WC3A 3GSDA 3O2IA 2BXJA 4ZP8A 4JYAF 4DHVA 4RW4A 5L9XA 1CLFA 1S6PB 3SMZA 4B08A 4OLOA 3HHLC 4GMKA 2VUGA 3W9IA 3M8RA 3MMJA 1RWPB 1QVGR 1ZOTA 3U7JA 4FBTA 4DN0A 3B8HA 1K0VA 1N36J 3PW4A 2ZWOA 3FMWA 3P5TL 3CCJS 2KXNB 5K9FA 1RTDA 4MT1A 4CH0S 2WW4A 4KBIA 3KHHA 1H74A 1HYSA 3I5CA 4C11A 2D3OR 2XI2A 2OD6A 2K1RB 2VQEJ 3CC7S 3TVKA 1BMQB 2O01C 2R2SA 2BANA 5K8NA 3G2XA 4DR1J 2DNLA 4G65A 4KHPF 5B0AA 2HNZA 3NS7B 1N5SA 2ZE2B 1SH3A 4URQU 1UVNA 5A76A 2D9OA 1FWLA 1R3NA 1SH0A 1FXDA 2CQHA 1YX2A 2Z58B 3L95X 4LSLA 3US5A 3JQKA 1M1KT 4ECXA 2W9BB 4CO2A 2JZ5A 4ZVTB 5E33A 2A6MA 2LQ9A 3FUYA 1IQZA 3OLAA 2YY3A 2ZH3A 4QR0A 5IV3A 2H4YB 5D4PA 2HHQA 1PG5B 4L3NA 4OJ1A 4ZVOB 3M2VA 4CO4A 8RUCA 1JKHA 1L3UA 2YQ1A 3KK3B 4I2PB 2EFVA 4K0KF 3QMQA 2ZKUA 4BBYA 4FF4A 1XR6A 4DCPB 3JXOA 3E51A 5KG1A 3OSNA 2KFYA 2GA7A 4NYPA 2VFSA 5T7LB 1NEEA 3BZQA 4RNHA 4CRJA 2OPPA 2RQMA 3N4WA 3BO4A 4DL5A 3BBFA 2XSJA 4LSNA 7AT1B 1TAUA 1CC7A 1SH2A 5BYRA 2WZ1A 2NUHA 4DV7F 4J5OA 3O44A 4G6VB 2MKKA 4K4SA 1NSKL 2VFVA 2R8JA 2UUCJ 3MMAB 4JV1A 1FI4A 2CWKA 4KGKA 1S7IA 3P96A 3ZTRA 4U96A 3TEHB 3W9HA 4ECRA 2ZD1A 4V19X 4L3KA 2N3LA 2GHWA 2C3OA 2ZH2A 2OLWA 4X2BA 5DZ7A 5U47A 2DGTA 2V9KA 2HGMA 5IC6B 3NGSA 2HSEB 3PO4A 5K8OA 2YNIB 4ECVA 2YXLA 2YWEA 2FB0A 3CIMA 5F8MA 1JLFA 4DV5J 3R1LA 3VR1A 2MPUA 1JK9B 1T11A 1SL0A 2BJ3A 4U6PA 4NXNF 4OI1A 4N76A 2HHTA 1F2GA 3NGTA 4W4MA 1F3VA 2HYIB 1IKYA 1HIYA 1WNEA 2AQ4A 4O23A 1IBMJ 1JXLA 3D28A 2XM3A 3M8PA 5KFJA 3CNQP 2EFPA 6FDRA 2KHCA 3V6KA 1KS2A 1NK4A 2BJ8A 5CZXA 2B8QA 2HVZA 2J0XA 2HFOA 3ILJA 1FD8A 4J9NA 3L7PA 5HBMA 1RTDB 3TVZA 1ULRA 4QWDA 1IBLF 2PMZD 2XG8A 4G1IA 1HYSB 3D0GE 2OEKA 4C11B 3BSOA 4KHRA 3HVTB 2HWHA 5ETQA 2BE2B 4WWSA 1TP7A 3KLIA 2FVPA 2BJ7A 4YUDA 1CS4B 3VVTA 4Y65A 4N41A 1SC3B 4ZLNA 1MNEA 3KG4A 4X66J 3TARA 2BW7A 2YH0A 1A6LA 3HF5A 4PABA 2MZTA 4R8UA 2HNZB 4CIOA 1RAEB 5E0OA 2E7WA 5L1KA 2A3JA 4ZHRA 2JL9A 2PN6A 5F8NA 3BGRB 4EBCA 4AT1B 5FDLA 1WC0A 1PYTA 4DJBA 2FGCA 1OSDA 4LSLB 3CC4S 3W62A 1FVSA 2LQBA 2X1GA 1G4CA 2JEFA 1S1TA 3KWMA 3U02A 2HLUA 3HFKA 5F0WA 5ETTA 3TX8A 3D68A 5E3PA 1U49A 3TA2A 1GMWD 1R27B 3EGWB 1OO0B 4WYWA 1ZYQA 4TY9A 1XC9A 1XBWA 1HLWA 4I2QA 1FJEB 4FNHA 2YQ0A 1L3TA 1IUJA 1UPMB 1FK9A 3AFGA 5D77A 4C8KA 1FX2A 5J2PA 1Y5NB 4O44B 4ERDA 1FFSB 1S6QA 1KD1T 4NCAA 1WEZA 1N6QA 5BYSA 5J2NA 4PWWA 3HT3A 4ECQA 2LXIA 4HEA9 2YNHA 3T5HA 4RZRA 3GFXA 2IY5B 4M5DA 1G7CB 2DNQA 2YKAA 1XEZA 1S4FA 2ZBQA 3DYAA 4UOHA 4CM0A 5KG0A 2G2OA 3D1HA 5CABA 1NK0A 4OYZA 3V4MA 3UPFA 3SYZA 1NPKA 1HNVA 4JV2A 4RUHA 3DU6A 1EQ0A 1RADB 1UKUA 4KB7A 1TL4A 2QX0A 3P49B 1U4BA 2CPDA 1REGX 2QG9B 1NB2A 4RNOA 4P2XA 4F8RA 3PO5A 1Q79A 4J9PA 2BKNA 3T1AA 3T19A 4X64F 5LL6d 3LPEA 4ZKAA 1A7GE 1PJ7A 4JUZA 3RRHA 1I5OB 2CQGA 1HNXF 2WVEA 5HANA 4WP3A 5KFLA 1FJGF 2CDQA 1RAIB 1F9FA 1NMEB 3O8WA 1S5ZA 2YBVA 1IBCB 3C6UB 4TYAA 1NPRA 3JTPA 2GVZA 3HI9A 4JV0A 3MM9A 2NS1B 2E7XA 1G2EA 1GX5A 4R5PA 3HXMA 4IDKB 3HSGA 1HHQA 2NYIA 2DCLA 3ET6A 1XMQJ 5GVQA 4NA3A 7FD1A 4LFAJ 1GXUA 4TXSA 2EXUA 5D0EA 1R8PA 3KHGA 4C3MA 2KRRA 1HI0P 3IR5B 2B9EA 4R8UB 5IT9Y 1REVA 2JVRA 3F44A 3FEYB 3D5MA 2A6OA 3K57A 3R27A 4ZHRB 2FHJD 2XLIA 4DSFA 1FDBA 3I87A 5C7PA 1NBEB 3PZPA 4ALZA 1JWWA 2PFFB 1H2VZ 4E0DA 4FBUA 2RU3A 4F0KA 4C6AA 1WC1A 4NEYA 4HH1A 4B3TJ 3OBIA 4YP3A 2ROEA 2N7CA 4RR5A 1E6VB 3ZTOA 4ZN1A 5FD1A 1TKTB 2AF6A 2JFDA 3CCZA 3F41A 2FZKB 4RW8A 3DLKA 5DO2A 1M5OC 1WSRA 3UWTA 2CPZA 4NE9C 5DS7A 3NY0A 4IR9A 4I2QB 2BW2A 1TR0A 3QRRA 1XQIA 3W61A 2AKWB 4DL4A 1FK9B 3QO9B 9ATCB 1ICEB 5J2PB 4OJ3A 2VQFJ 3B82A 3J80U 2V50A 1N6QB 1TUGB 2KT5A 5GAEI 4ICLA 5LJ3Y 2R8IA 3DLHA 2R9LA 4DCJB 1RE1B 2NPIA 1RA6A 3Q89A 1V9OA 4F7VA 1YSJA 1EKRA 4M5DB 1K73T 1IM4A 1H7WA 1YJUA 5KT4A 2I5JA 2LQ8A 1HARA 4UW2A 3I9V9 3RAQA 1S72S 3SQOP 2F4VJ 2HVEA 4C9DA 2FY8A 3ZZTA 1WEXA 2C2EA 2DD8S 2OTJS 1YBAA 4ZCMA 2VG7B 4WK3A 3CVKA 4ILMA 3N6MA 3GZ7A 3OQ2A 4J9MA 3N01A 2F9DA 1XERA 1ACMB 1JJ4A 1V5IB 2ZH6A 3VAMA 3BDEA 2KYXA 2HAFA 2PD1A 2AGQA 2JSXA 4PRFA 1KOHA 2VPZB 1RCOB 4KH1B 3T6BA 2CQBA 4QU7A 4UOGA 4IH7A 4U8YA 4IOBA 4RW6A 2XMUA 2ZJRQ 4NYOA 2B56A 2IC3B 5LSOA 4BC9A 4PG8A 2RB7A 2CUYA 4Z7CA 4EWTA 4QJVA 3NMAA 4R5PB 5A8KA 2L9DA 3EMTA 1NK9A 2RDDA 4I64A 3M2RA 2NZ4A 2XMWA 2DNOA 3G6YA 3K59A 1S1VB 4Z7YA 3OTOJ 2PEBA 4HDGA 2MY8A 4WTYA 3GV7B 5M2RA 5ETMA 4RBUA 3PDNA 1KLMB 3AD7C 1GH8A 2QSFA 3I82A 1WHXA 4O4GA 4RNNA 5DG9A 1REVB 3UI3A 3M9OB 3C16A 4EZ6A 3OVAA 4UY85 4ZLLA 4F02A 2HIQA 4YOEA 2GMLA 2BJ1A 4USHA 3LALA 3CWJA 2FDNA 4FF3A 4QOTA 1Q53A 3MM5A 4FS2A 3BKUA 3T1YJ 2M8HA 3N5FA 1Y5LB 4IFYB 1FFWB 3Q22A 1RACB 3CPWR 3KJQB 3H5YA 3R5CA 4DSJA 3FNNA 3MAQA 2DNPA 2HVHA 4RW8B 3DLKB 1TL7B 2FY1A 2PMHA 4QPXA 4ES2A 2AEFA 1FXLA 2UV8G 1N0UA 5KFHA 1SKUB 3PFEA 1VC6A 3VGUA 2CG8A 4ZN3A 5J1EB 3S8SA 1M1HA 3IWLA 4HYKA 5KG7A 3ENWA 3HCXA 4QPTA 1F5CA 2V8HA 3M05A 3CC2S 3TNVA 2YWFA 4LVOP 4OZ5A 1TL3A 2J9DE 2MQLA 3MAAA 3J7AN 2DJWA 5K8MA 1SJ4P 1PKUA 1NO8A 4A8YA 4J9KA 2MHNA 4J9SA 2D74B 1JLCB 5AXNA 5DJBA 4Y6IA 2Q6CA 1S0VA 2CQ0A 2PI4A 4ZP7A 4DV3F 5L8RC 4JI0J 2JEJA 4OYAA 2V9WA 3KXDA 2ASLA 2XMTA 2AJQA 3KG0A 5JMNA 3QAUA 1S7HA 3FSXA 1QY7A 1I6JA 3OVSA 3A3NB 1N33F 3RR7A 2GAGC 1Z2LA 1U2FA 2O5DA 1LXNA 3QRQA 2ASJA 2KVQE 2H48B 3J7Z5 4X4TA 5HI7A 3MUTP 3OHBA 1R8AA 2D9PA 1EHWA 3MEGB 4JI5J 1U24A 3SIPB 4F4YA 5BYQA 3W5YA 3NNCA 3JSBA 1K1QA 1FRMA 3IAS9 2LLZA 1SB6A 1HBUA 3K7RA 2D41A 4B3MF 1OS5A 2U1AA 3LP0B 2MEWA 3K5PA 3D9BA 2XYPB 2OIHA 1IM6A 2ZWPA 1NK5A 1FHTA 1PAUB 1DTTA 3MAHA 2Y8WA 2DXFA 4F4XA 3NCPA 1FRHA 5KT2A 4NLUA 3M2RB 5KFGA 4IQMA 1UW9A 1TK8A 2VA2A 3GG0A 1LW2A 4FS1A 3AHPA 3ZZZA 3R6LB 4M5KA 3BGLA 4WK1A 4WP9A 1NK6A 1IWGA 2NUUG 3OFHA 4WYLA 1S6OA 2O66A 1N56A 4CH7A 3BN4A 2E5LF 4I67A 3DRSA 1KTQA 3RB0A 3DOLB 3JYTA 4I56A 3I55S 4C0BA 3M8ZA 1Q5YA 1VHIA 1HWIA 2R7VA 4TNOA 4UT4A 1F2HA 3OL9A 1VHFA 4DR3F 1VBZA 3MM5B 2WCXA 1HNIA 4YR2A 1P8GA 5LXYA 2UUBF 4DR2F 3TWZA 3THTA 4BDPA 1U0HB 2HHHJ 4BCAA 2DR8A 1T03A 3IGNA 1NPPA 4USVA 3GJQB 2LMIA 1WSVA 2G2YA 5B0DA 2MQOA 5HN0A 5MAOA 4IO9Q 1X8DA 1DQ8A 3DOKB 1Q8KA 2XMMA 4QR2A 2I6WA 3MTKA 2QGFB 4YEAA 1BQNA 4PZVA 4ZPWR 1HQUA 4ZPAA 1CJTA 1EETA 1R6VA 1F5AA 4LSZB 1VYAA 3QGIA 2BQUA 2F8EX 1TL3B 4NMLA 2V2VA 3MAAB 5KFEA 4L6V3 3IBFB 4J90A 3DNCA 2DR5A 2LU2A 3GFYA 4DMZA 4HLBA 5D15A 1F6TA 4W98A 2C1EB 4F25A 4XDDA 4HT5A 1I51B 1SC1B 4FF2A 2XS5A 2OPQA 4A48A 2D3UA 3RBXA 4PYAA 3QATA 4DR7F 3PRBA 4AE5A 1PC4A 5DLGA 2Y1JA 3U1LA 5I42A 4P75A 3W2WB 3GV5B 2KTQA 3DXSX 3QGHA 2OGUA 3ZTSA 1X5PA 1X4CA 4JI6F 2BJDA 4DU8A 2ZM6F 1RJJA 5HJYA 2ALYB 1TFYA 2UXBJ 1KDNA 2G0CA 3M6VA 1Y4ZB 4MIAA 3IS9A 1KP6A 3OR2A 2DH9A 4WIIA 4U7UD 3V6JA 2HHVA 1UWBA 3C15B 2H5EA 2H65B 5LOQA 4WFNQ 3L9ZA 2DK2A 4OI0A 2X3GA 4DFJA 1HBMA 1OYDA 4ED3A 3DLLQ 5KFPA 1C4AA 3N0VA 1LW0B 2EK1A 3HK2A 3E01A 4NCGA 5CD4A 2LCWA 8ATCB 3V5RA 3KNGA 4RBVA
chains in the Genus database with same CATH topology
4ZVHA 1CVJA 4OX9F 4RNMA 3GIIA 5D4LA 1FKOB 1N52B 4HTIA 3CULA 1OQ3A 1TKZA 2F3JA 3KK1B 4MK7A 2NQPA 3OV7A 2A1BA 3CIZA 4KO0A 3SDEB 1UVIA 4R0EA 2FJWA 2RD5C 2BACA 3GYXB 4ZOSA 2KN4A 2X1FA 3IWNC 4IG3A 3POTA 4EFAC 4H54A 5KOWA 1MU2A 1FKAF 3DM2B 1XN9A 1DQ9A 3Q8PB 1DTTB 2WBRA 2V8DA 2ZDPA 1DFDA 1X4AA 1JLGB 3MM9B 4ECZA 3CD6S 1R6YA 4XPEA 2QEXS 1F60B 2FLLA 4I0WA 3IWXA 5LXRA 1ZZFA 2DHXA 4ECWA 4X4QA 2XMJA 4OZLA 3EGZA 2VG6B 3C6UA 4JBCA 4PQUA 1HL6A 2B9XA 2W7PA 5IM0A 3NAIA 4LIWA 4JI7F 4C4WA 2J6SA 1UFWA 3GG1A 2RIJA 2XS7A 3OXFA 2PDAA 4K2XA 3MR3A 4KJIA 2MHEA 3EGNA 4EUVA 2KJVA 1PILA 5B0EA 4XDCA 2G4BA 2GGPB 1D0EA 2NSCA 1VQ8S 2C28A 2Z2MA 4QIVA 3CMAS 4NZ6A 5KFYA 2AD9A 1FRXA 4O3SA 4YR3A 2X1BA 3ISZA 2IA0A 3MR5A 4USJC 2IBOA 4NLXA 2IM0A 4ECTA 2DHAA 4TYBA 5DDQC 4IDKA 2DISA 3PR5B 4LF6F 2Y1IA 1VOMA 3WZ0A 1Q1KA 1S0NA 2VQFF 2BR0A 1WTFA 2AYMA 3FZBA 4C97A 4QIWD 1U1QA 4EYHB 2B43A 1XMBA 1M5SA 1HPZA 2DNYA 3MPVA 1HBNA 2GMJA 2RMLA 1HWLA 4CTAB 2KYZA 3UW1A 2CJ9A 1RQ0A 2CQIA 4LF4F 4K4XA 3X1LB 3DRSB 3ZZOA 2RJZA 1JLBB 2PEHA 3OVBA 1KSPA 3RRKA 2CZ4A 1S79A 1RTHA 5AE1A 2GV1A 5KFRA 3OR1A 2ERRA 4B3RF 3PX6A 1U6ZA 2CQ4A 2VG5A 3HZGA 5KT3A 5EWGA 2XB2D 2JWNA 1C0UA 4L72B 4DDFA 3CCRS 4DSIA 3VF0B 1X4DA 4ATNA 3K8VA 3PIOQ 4J9QA 3VALA 2E9RX 3DLEA 3DRXA 3FFIA 4H4KC 3FDSA 3OL7A 1KTVA 2R4FA 1X5SA 2BA9A 3H2LA 2RE1A 3UCGA 1M90T 4GKJF 4AL7A 3FEZA 3LOUA 1WHYA 2EWHA 2CKWA 4LIRA 5KFWA 3HVRA 4DV6F 5KOXA 1RT3B 2WHOA 4F4KA 4HH0A 3KNAA 3Q8SB 4I7FA 1QAJA 2UUAF 2F4VF 4NWBA 1NRKA 2AX1A 3MD3A 4QIFA 1DBDA 2RRNA 4OHZA 1FA0A 1LWFB 3DRPA 2JVOA 4J37A 3H5XA 1YIJS 1FRIA 2HNYB 3M8QB 1T03B 1FRKA 2ATLA 3TI0A 1QSLA 1TKXA 1KHVA 5CYMB 5A0YB 3OW2R 4OHYA 2W9BA 2HW3A 3PJXA 2DNNA 5A8RA 2D3ZA 2MQMA 2GQQA 2BRLA 3I4HX 3TAMA 4LFBF 1UA1A 1VMBA 2XI3A 1O0PA 1F0XA 1RP5A 3IG1B 4PG7A 1VC0A 4RW9A 1L5UA 3P6YC 1E6VA 2JEIA 2RNEA 1BLUA 1TKTA 4HI2A 4TU8A 3SSQA 2NLWA 2XEXA 2QA2A 3PXGa 3MR6A 1RKJA 2QSWA 2RS2A 2IVFB 2OAUA 3K5LA 1M5PC 2KO1A 2J0QD 1X9SA 1BWEA 2B9YA 4F3MA 2YX1A 3AB2B 5BJRA 5L9NA 2B6AB 2AJ4A 4QR1A 5IQ6A 5K5MA 3M32A 2KT3A 2KFNA 2BABA 2QMXA 2F8MA 3KK3A 5J1NA 4B9TA 2RU9A 4DQPA 2ZDOA 3HKZD 4K4TA 1UW4A 2XWYA 3M1VA 3MOZA 1K1SA 1X4HA 4A8WA 3BM7A 4ED2A 4DWIA 2WW8A 4YDXA 2KFZA 1FJCA 1U8SA 2JLEA 1UEUA 2ZC3A 2IJNA 3JTNA 3G6VA 4JI2F 2XWXA 1U26A 1ZM3A 1EETB 4TQSA 1TL1B 2HMIB 4ICLB 5F8LA 1FJ7A 4ZLPA 1UMJA 4K5RA 4FYDA 4PPDA 2YNFB 3QO9A 1UAWA 3WBZA 4QCLA 5CZVA 4IFVA 3T3FA 1NJWA 3RBEA 4KFBA 1X0PA 2CJBA 2D1CA 3EZUA 1FKPB 2UXCF 3O6QA 5DDPC 2JHEA 5L1LA 3VAIA 3R5AA 3CGIA 1L3SA 3AH6A 4Z2XA 4B3SF 3H40A 4NXMF 1S9GA 3RZAA 2W7OA 5JJBA 4MIWA 1H98A 4JOUA 3CJKB 4A8QA 2OMOA 4DV4F 2I5JB 2K2PA 2RUGA 4C8NA 2RF2B 4MYTA 2WOMB 3WDOA 4YB1P 3LP1A 3OL6A 1HA1A 4ELTA 3KTQA 2QA1A 4WFZA 1RT1A 3HHNB 3H59A 2WSFC 3MMAA 5I42B 5DGBA 4ITSA 2R2TA 5E3AA 4M95A 1S9FA 5LT5A 2DGOA 1C4CA 1JLAB 2CIMA 2XHWA 1RA7A 2VPXB 5EUHA 3ZZYA 3SSSA 3RW6A 3QGPA 1JLEB 4NLPA 2B5JA 3NRBA 1NNDA 2DTJA 5HLFA 4RU2A 3HDSA 3I5BA 5GAEU 2B4PA 3NCQA 3OTOF 3BQ0A 3DRRA 5J2MA 4OI6A 1S0MA 2J9EA 4AL5A 3CT9A 2IJFA 3H20A 5CYQB 5C42A 2KVIA 4X4NA 3MFHA 1VQKS 2OPRA 3AA9A 2HHUA 2QMWA 4DQIA 3PKYA 1TL5A 5J1PA 2P6TA 2ILYA 3IS9B 3TUJC 2FLOA 3OR2B 2FVSA 2R2RA 1H38A 4ED1A 4IRKA 3FCHA 2M0GB 5KT5A 3AY0A 2J76E 4ZVGA 5KT6A 3BSCA 5KG3A 2ZHOA 3TOQA 2A2DA 2M3DA 2WTFA 4DFMA 2UVRA 2MGZA 2D7SA 3CCSS 1AFIA 3MEKA 4I1TA 4ZK7M 4KE5A 1CC8A 1QAXA 2VG7A 1NKCA 1S97A 2YH1A 1VQ4S 3TW0A 1HD0A 2C2RA 2GC8A 2YNIA 4ZCLA 2OH2A 2E1MC 2GQCA 2VA3A 1G1XA 3MM6A 2U2FA 4NLTA 4QZVB 5EX0A 4W90B 2F1FA 3CTRA 2WONA 2PA8D 2L9NA 3QZ8A 1FT8A 4OZJA 4OZ0A 1RT4A 4JI1F 2E1AA 2FIUA 1S1XA 3FQLA 4PWUA 3E01B 3W2VA 3D0HE 4NCGB 1PO6A 4WE1A 3VZHA 5EN1A 2ZHBA 3T1YF 4RW6B 3TAQA 2IVMA 3GSDA 3O2IA 1HMVB 1RI7A 2CQ1A 2BXJA 3CCMS 4ZP8A 4JYAF 2YKOA 3RB3A 4DHVA 3PW2A 4RWWA 4RW4A 5L9XA 1UFLA 2E29A 1CLFA 4F50A 3QIDA 1S6PB 4B17A 4A8SA 3ITHA 1GAOA 2UZAA 2E66A 4DPOA 5CCLA 3HJFA 4O3OA 4KO0B 1H3DA 4KKOA 4USIA 1DQAA 2HPUA 3SMZA 4IG3B 4B08A 3POTB 4OLOA 3OFGA 1MU2B 3HHLC 4GMKA 3EPIA 2VL1A 2VUGA 2Z8QA 1ZAVA 3M8RA 5D3GA 4H4MA 2G1DA 3MMJA 1VC5A 2YQ3A 3SEOA 2MYFA 1QVGR 1ZOTA 3IR6B 1NK8A 3BR9A 2GX8A 3RRGA 4C7QA 3MECA 1V6HA 3U7JA 2IC3A 5A8KB 2HG4A 2UUWA 4FBTA 4PQUB 2PIIA 4U67Q 2LU1A 4DN0A 3B8HA 4IRDA 1K0VA 2DB1A 4CT8A 2XSFA 2W8KA 3PW4A 1FEHA 3FMWA 3TA0A 2J7UA 3P5TL 3PR4A 2DRBA 1BQMA 1RTJA 3CCJS 4CCHA 2OPSB 4CH1A 3CCWA 2KXNB 2M88A 2IRYA 5H9FJ 4KIAA 5K9FA 5A8WB 1B64A 4CNZA 3CE8A 2ROPA 3MEEA 4B9NA 1RTDA 3OLBA 4CH0S 4WU3A 4UUXA 1U2RA 4OLPA 5F9LA 3CCVS 3IAM9 2J8AA 3ZZPA 4KBIA 1VQYA 3KHHA 4OJGA 1DTQA 3OPKA 2V8VA 1HYSA 2C3YA 3G6XA 2FJAB 1HBNB 3I5CA 4C11A 4O4GB 2D3OR 1S1VA 2XI2A 3CMES 2OD6A 3KK2B 2K1RB 4DSEA 4PXBA 1JJ2R 4F2RA 1QE1B 4CQ1A 3CC7S 4TQRA 3PW7A 3QIPB