1W2BR

Trigger factor ribosome binding domain in complex with 50s
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRIGVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 21
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1w2bR00
2AYMA 2K8GA 1CVJA 2B0GA 2KI2A 2LXIA 1OPIA 1VC0A 1FJ7A 4CH1A 1M5KC 1SJRA 2JVRA 1VQPS 3SXLA 2VONA 2NZ4A 4Z2XA 3RW6A 3CCVS 3G6ES 2XS7A 2KRBA 1K73T 2YKAA 5DDRC 2LYVA 5IFMA 1YJNS 4TLQA 1WHXA 3NNAA 1UFWA 4FXWA 3CF5Q 2MY7A 3BS9A 4C0OC 2XS5A 3MUVP 5DDOC 1OIAA 1WF1A 2N3LA 4C4WA 4TU9A 2MSSA 5EN1A 1WG1A 2L9WA 3FEXB 3UWTA 3BO2A 2M8DB 3R1HA 3UCGA 2ZJQQ 3CC2S 2DNNA 2RNEA 5LXRA 2KG1A 3CMAS 1U6FA 1IQTA 4IUFA 5DETA 4TU7A 3IWNC 5DM7Q 1YITS 1FNXH 3SDEB 1U1LA 3CCSS 4W92B 4QPTA 2GHPA 2JX2A 1DBDA 3ULHA 5DDPC 2MZJA 1YIJS 2M0GB 2SXLA 2LA4A 2DNHA 1FJCA 2DISA 1BY9A 2DNKA 3NNHA 4LIRA 3MURP 2MKJA 2L08A 2LQ5A 2ADBA 1UP1A 2KHCA 3IRWP 3OW2R 2E5GA 2XNRA 2AYEA 2RT3A 2RS2A 1WEYA 1S72S 1VQ6S 2LA6A 1OWXA 2LMIA 3TO8A 3NNCA 5D77A 3U1MA 4P6QA 4ZKAA 3FEYB 1X5PA 1VBXA 2RU3A 4ERDA 2KM8B 2AYGA 1K9MT 2DGTA 2X1AA 2F9JA 1R8PA 2HVZA 2X1GA 1U1PA 2MJUA 1YI2S 1X4HA 3J7YU 1M5VC 4UY8T 4IO9Q 2MJNA 2I2YA 1YHQS 2KXNB 5LSLA 1QM9A 2QEXS 3THTA 2N7CA 1ZZNA 2FC8A 4WCEQ 5GAGU 1VQ4S 2MQLA 2KN4A 2AYBA 2V94A 2MKKA 2CPIA 2DO4A 2HGLA 5GAEU 5ITHA 2MGZB 2UP1A 1N8RT 2J0SD 3CTRA 3SMZA 3MD3A 3UD3P 3US5A 3MUTP 2QFJA 1X4AA 3ZZYA 4TU8A 1VBZA 1SXLA 3VALA 1KQSR 2CQ4A 2LEAA 4CQ1A 1HD0A 2DGSA 2CQ3A 5GMKa 2OJ3A 1SJ3P 2M70A 4WFBQ 5CYJA 2CQ0A 3CC7S 1VQ8S 1R8HA 1XN9A 1ZZFA 3VAHA 3VAFA 2A3JA 3G8TA 2MKHA 3CULA 4WFNQ 3P6YC 1U6BA 1L3KA 2KT5A 3G96A 3K0JA 2CJKA 3CMES 2DNPA 2MQPA 1WF0A 2RQ4A 3CCUS 3B4MA 1NJIT 1VQLS 2MY8A 1Q7YT 4WFAQ 1VQ9S 3S01A 1WTBA 2JVOA 1JJHA 2N3OA 3P5TL 2MGZA 3DLLQ 3LQVA 4WF9Q 4WKRA 2KXHA 2LKZA 2M7SA 3V4MA 2DNYA 5LJ5Y 4J5OA 4CH0S 2KXFA 2MB0B 4IOCQ 4QQBA 2DK2A 1WEZA 2KYXA 3THPA 2LXUA 1VQKS 2DH7A 2YH0A 3VAMA 3UCZP 2KM8C 1M90T 3PIPQ 2XS2A 2MQMA 2OSQA 3BO3A 2XB2D 1FO1A 3CCRS 3MDFA 1UAWA 4F02A 2WBRA 5LXYA 1N52B 2RS8A 4OZ0A 1W2BR 2MYFA 2VOPA 3CCQS 2CPEA 1WI6A 1O0PA 2U2FA 5GADU 4EGLA 4RU2A 2MZQA 1HD1A 2MZSA 2CQ1A 1RKJA 1WHYA 2X1FA 3U1LA 1VQMS 3HI9A 2J76E 2DNMA 2CPFA 3R27A 2KRRA 1U1MA 2KFYA 2KG0A 2F3JA 5GVQA 4W90B 2CQCA 4PKDB 1RK8A 3D2WA 3P3DA 2CQHA 4M5DB 1WELA 2E44A 5DM6Q 1VBYA 2KH9A 3JB9k 5DDQC 2X1BA 3G9CA 1H2VZ 2KVIA 1QVFR 1Q81T 2M52A 3R1LA 1KC8T 1B7FA 1X4BA 2EK1A 1H6KX 2FC9A 1X4GA 2Q79A 2DGXA 2F9DA 1A7GE 2NLWA 1X4CA 1X4DA 2CQBA 1SJ4P 2CPDA 4C7QA 3G4SS 4A8XA 2FY1A 1A9NB 1G2EA 1DRZA 2YWKA 4QU6A 3VAIA 1U1OA 1WHVA 3LPYA 4F25A 5CA5A 2DH9A 2DNRA 2VODA 2G4BA 4YUDA 1FXLA 5LSOA 3VAJA 1JJ4A 3N9UC 3MI7X 3VF0B 2MHNA 3B4DA 5HL7Q 1WF2A 1URNA 5IQQA 5FJ4A 1PGZA 1N54B 2CPYA 3CCJS 2JRSA 2DHGA 4CIOA 1YWXA 1WHWA 2G0CA 3CC4S 1PO6A 3CUNA 1Q82T 2MKIA 2MXYA 3P49B 1VC5A 3H2VE 1NU4A 2J0QD 2BOPA 3RW7A 1YJWS 2DGOA 1P1TA 2DIUA 2VOOA 2DB1A 2MZRA 3NMRA 1P27B 5LJ3Y 4YOEA 1YJ9S 3UCUP 1U1NA 3I55S 3BEGB 4F26A 2EK6A 2D9PA 2DGQA 1DZ5A 3CCLS 2M9KA 2LEBA 2DNOA 2M8HA 2MQQA 2E5HA 1DHMA 2ZJPQ 1UW4A 4WIIA 2MKSA 4U67Q 3Q2TC 2DHXA 2AD9A 1M5OC 3MUMP 3MOJB 1U1KA 1FJEB 3G8SA 4YB1P 2U1AA 1H2TZ 1Q86T 2DO0A 2LCWA 1AUDA 2QA4S 2FHOB 2RUGA 3Q2SC 4OZ1A 1OO0B 3CXCR 2DH8A 4FXVA 4LJMA 3CCMS 1M5PC 2CQ2A 1FHTA 3VAGA 3EGNA 3BO4A 2GO9A 2I38A 1U1QA 2DIVA 2J8AA 2MQOA 1X5OA 3S8SA 1F9FA 1D8ZA 2MSTA 2MQNA 2XNQA 2M88A 2L41A 5MLCV 1KOOA 2DITA 2DNGA 2CPZA 2XSFA 3DXBA 4BS2A 3ZZZA 4QU7A 2DNLA 2RRBA 2YTCA 2OTLS 2MMYA 3UD4P 3TP2A 1VC6A 3MXHP 2DGUA 4PRFA 4V19X 2M2BA 2HYIB 4IOAQ 2E5IA 2G1DA 2M4MA 1VQNS 2EVZA 2O3DA 3J7ZT 1JMTA 4PR6A 2MZ1A 3S7RA 1FT8A 1VQ7S 1SJFA 3PIOQ 3G71S 1X5SA 1HL6A 5JVGQ 2ERRA 2HGNA 1X5TA 3EGZA 2PEHA 3CCES 1X0FA 4Y00A 4ED5A 2CQIA 3H2UB 2D3OR 2ZJRQ 2OIHA 3CPWR 2D9OA 1NO8A 1M1KT 1U1RA 1X4EA 3HHNB 1X4FA 2MPUA 2DNQA 3VAKA 1SJQA 2CPJA 2CQDA 2CQGA 3NS5A 1H2UX 5BJRA 3EX7B 1KOHA 5D78A 5GAHU 5IM0B 1YTYA 2JWNA 2CPHA 1WWHA 2ADCA 1JJ2R 2HGMA 1S79A 5H1SV 2FPHX 1HA1A 2RVJA 2BZ2A 3SDEA 2DGVA 2CQPA 2DGWA 3UE2A 2DHSA 2PE8A 1WG5A 2K3KA 2LECA 2RRAA 2DNZA 5HO4A 1K8AT 5CXTA 3NS6A 3L3CA 2CPXA 4UQTA 4Y0FA 2MZTA 1VQOS 2KU7A 1WG4A 1D9AA 1QVGR 5JVHQ 2N82B 1WI8A 4LMZA 2OSRA 2OTJS 2HZCA 3TYTA 2E5JA 3MD1A 3I56S 2DHAA 2YH1A 1WEXA 5IM0A 3CD6S 2RQCA 1VQ5S 1N88A 2MKCA 1ZH5A 3S6EA 1U2FA 1KD1T
chains in the Genus database with same CATH superfamily
4USMA 1IR1A 4QBUA 2M5YA 2CWKA 1GX5A 5E2QA 1QE1B 1AZSA 2PSZA 2VICA 2F5GA 1F2HA 2C3UA 2N3LA 2R2SA 4WWSA 5EN1A 1FJGF 1XMOJ 2V5HG 2PD1A 3FQLA 3O2IA 3O3LA 2XCPA 4QPTA 2B8QA 4C97A 4LFAF 3BGUA 2VG7A 3HHLA 1CJTA 1V6HA 1JLEA 2VQFJ 4ED0A 3MF5A 5AXMA 5HMZA 4M5NA 4OYPA 1WEYA 1M1GA 3M4XA 4NYOA 2JC1A 1RADB 3UN5A 3VQSA 3FVYA 4QW8A 1JLAB 1X5PA 4NLUA 1CLFA 4DF8A 4CLTA 2X1AA 3L7UA 3R7NB 1IJEB 2H9ZA 4JI4J 4UY8T 3DOKB 1QLNA 5F8JA 3KNGA 2EG1A 2JEFA 2FYXA 1YHQS 3B6BA 3IRXB 1IBKJ 2D74B 3K17A 1S1TB 2L3MA 1X7VA 3MMBA 4HVZA 3I4PA 1AB8A 2V8GA 4O4GA 3CTRA 3SMZA 2C3OA 2OPRA 2YX7A 3TAPA 3ISNC 2ZNYA 4PXCA 1S4FA 2Q6CA 2HZAA 3ENQA 3R5JB 5ETOA 2E1RA 4ELUA 2ZEJA 1ZZFA 3DRXA 2F63A 9RUBA 4A8YA 4IO1A 1N5TA 2CJYB 2BUNA 4DV2J 2MQPA 4PYAA 3QO9B 2MY8A 2ZWOA 1JQGA 2JVOA 1CBKA 1UVNA 4BBYA 3QLHB 2FY8A 1N34F 4P74A 1P1LA 5LJ5Y 3SFUA 3CJ2A 4UQGA 1S9FA 4QQBA 1F60B 3GR0A 3JSMA 1TUWA 2DH7A 2I1RA 3PIPQ 1NDPA 3PFOA 2ZZMA 2CZ4A 1UVKA 3SFGA 1BMQB 4JI8F 3T19A 2POKA 2BM1A 3U1LA 3HI9A 2ZBCA 3FBCA 2KRRA 3A12A 4ZOSA 1S6QB 3J7YI 3OR2B 1V5VA 4RWXA 2Y9HA 4I67A 2OEJA 3C19A 5D0GA 1QUPA 2OPPB 3HHLD 3MMAB 1RGVA 4QOTA 2P9EA 4BCAA 2F9DA 1TL4A 4AL6A 1REGX 1Q5VA 3MM8B 4DR1J 2YWKA 4QU6A 3ZTPA 2DNRA 2IHR1 2VPXB 3PR5B 1WOOA 4Y28C 2MHNA 5KFNA 4X66F 1WHWA 2MKIA 4TYBA 4DI6A 4I69A 1H7XA 2HNDB 3OTCA 2MQ8A 3DRRB 2F8HA 3LPEA 4KKOA 2EW9A 1T95A 3H5UA 2IM0A 1UCNA 2VC0A 5HMYA 3BYRA 3MUMP 3CD7A 1U1KA 3V81A 1TAUA 3GR1A 2YWHA 4OZJA 3RJMB 4IDKA 1TL7B 4KTQA 3R6GB 4YB5A 4A8QA 1B70B 3W5XA 2HHWA 1U49A 2AMCB 3BB5A 3HD1A 4UF4A 3KYLA 4WFXA 3J7A1 4DL5A 2PN6A 3BN4A 2IM3A 4KFBA 1B0PA 2H5IB 1SUQB 4PEOA 4DEZA 4DU7A 3QT8A 4PRFA 3JSRA 1CJUA 3KLFA 4FVMA 3BREA 2G1DA 2GJ2A 1GH8A 2EVZA 1IKXA 1AROP 1RAAB 1X5SA 4X4PA 3M7VA 5SUHA 5CYMA 3O8WA 3CPWR 1HBUB 2A0FB 3A3PB 4PG4A 4YMEA 2NYIA 1RT3B 3HSDA 1GK8A 2IRYA 3HX9A 1JXEA 4ES2A 1Q8KA 1S76D 5MAOA 1RTDA 5IT0A 2PDAA 2PIIA 1N5QA 3D3CJ 3CDWA 3I6PA 3AT1B 2HHSA 3TZXA 4ID8A 3RR7A 3AODA 3OLAA 2I5JB 1VQOS 3VR1A 3PW7A 1RB0A 3R7SB 3H5XA 3A3OB 3W5YA 1H38A 4CLYA 1N88A 1KD1T 2KI2A 1G3OA 3BGRB 1NAQA 2G0JA 1KLMB 4HT5A 3DLGA 2ZC3A 2HHUA 4C2MA 3GIIA 3I32A 1X8DA 4BWMA 3HVRA 2DR5A 3W61A 3GV5B 1S0MA 2RNEA 4K4VA 3NBPB 5LXRA 2R8KA 1OS5A 3J81Y 3DNCA 1TV6A 1U1LA 3ZNUA 3U7JA 2SXLA 1JLQB 4JI2J 3W2VA 4RNOA 3D1OA 2PI5A 1GXLA 3AY0A 3IRWP 4M63A 1OWXA 2XMAA 1YBUA 4HHUA 2Y1LB 4E98A 4K2JA 4P6QA 3KLIB 4M8LA 2R8IA 2VASA 1GFWB 3OPKA 3FZBA 2R7TA 3OR1A 1DLOB 4RUBA 4IFYB 4ZHRA 2KN4A 1T05B 4OHXA 3ITHB 2M3DA 4HI2A 5D8HB 5KFJA 3ZZYA 3W9IA 2CQ4A 2IDLA 3FRYA 3G86A 2DGSA 1N34J 3DI6A 3D7SB 2HMIB 2V34A 3NGDA 4MIWA 4YR0A 1U48A 4CM2A 1E6VB 2J9EA 1IKWA 2DNPA 4KGMA 4NXNF 1Q7YT 1WTBA 1HBMA 3UI3A 5AE2A 4WKRA 3GLJA 3QFWA 2LEPA 4P10A 4P73A 4Y2CA 3NS7B 2HVEA 2WONA 2QC3A 2MQMA 4URQU 5B0EA 1S99A 1TFWA 4NI2B 3HFKA 3CSKA 1WI6A 3W62A 5A0YA 2BW2A 4YP3A 4EYHB 4K2XA 4FKXA 4DS4A 2J76E 2CPFA 2OH2A 2L9NA 4WE1B 4F3QA 2IRXA 1BQMB 2RQKA 2XGPA 3HHKA 3CCWA 4MKYA 3RBEA 1Q95G 2A10A 4WJBA 3NAIA 4CNYA 4NLRA 1H2VZ 1R8BA 3R1LA 2LXFA 1KQFB 4ECZA 1UJ6A 1T03A 2DGXA 3LGHA 2E1AA 1IWGA 1NSAA 1B64A 3KJVA 5J2QA 1I51B 4KHMA 1U1OA 2QA4G 3SCLE 1UW9A 1WC1A 3ICLA 2DEJA 2VODA 5LSOA 3V6DB 3LP2A 1TL1B 3X3UA 4KC5A 5CCMA 5KFEA 2V50A 3DYAA 2ASYA 3M30B 3CCJS 3QPIA 1PO6A 2MXYA 3DHXA 3P49B 4KHPJ 1FRIA 2PA8D 1FDNA 5KFTA 2W2MP 4G65A 3WX4A 4TYAA 2HZVA 5D3GA 4DV6J 1QUVA 4JI0J 2DGQA 4CM0A 3KDOA 5FLXU 1HQUB 2M9KA 3IWLA 2UXBF 2E5HA 2FJBB 2AD9A 4R0EA 1C0UA 1M1HA 4Y2KA 4L3KA 2BANB 1LWCB 4DFPA 3SQGB 2CJAA 3T6BA 3PVXA 1U24A 5G4DA 3GILA 3LW5C 2GS8A 1MMDA 2DY9A 4LF1A 2MQOA 4L76A 4F7VA 1X5OA 3IBCB 3Q8PB 2W8LA 3WC0A 4KO0A 3UPFA 7AT1B 5HJXA 1FFWB 4YY3J 4IH7A 3EPIA 4ZVRB 1H74A 4LBPA 4UOHA 4F3OA 4LR7A 1OMSA 5IS2A 1RTHA 1H73A 3GU0A 1NEEA 3PIOQ 2HGNA 3AQOA 3EGZA 2ZH9A 4Y00A 3PRVA 3GYXB 2AGOA 3RRHA 2D3OR 4RPFA 4IRDA 3WQPA 1SQFA 2R4FA 1T9VA 1HNIB 1J27A 1RWVB 1HNZF 2H5EA 3HVTB 1RXOB 1R27B 2C3YA 4QW9A 4DLEA 4KQZA 2A6OA 5JMNA 4ZPTR 4ZLPA 5KTQA 4JUZA 2R9LA 1CPZA 1XMQJ 3PRDA 4E8UA 1YVFA 3KFWX 2G0IA 5GMDA 2R7VA 3TUPA 2DHAA 2W9BA 5IM0A 1HYSA 4RZRA 1F6TA 2ATLA 4CH1A 4HH0A 1JLFB 3MM6B 2JHEA 4Z2XA 1YJVA 5FDLB 3N5FA 4OYZA 4ZVPB 2GVDA 4YR3A 1NKEA 2N7YA 2QLFB 4B3SJ 2PFDA 3CJ8A 3CGIA 3V2UC 1L3SA 1WG1A 1HR0F 2BJ9A 3MGJA 1NK0A 2FJVA 2ZJQQ 2DNNA 3VQTA 2FVRA 4QWDA 2HNYA 3P8BB 3H98A 3CMAS 3FC9A 3SDEB 4W92B 4ILRA 3P45B 3LP0B 1VYAA 2DNHA 1BQNA 1HI1A 4M5GA 3BKUA 4B3TJ 1QE1A 1N33J 1TQLA 1N5YB 4IOBA 2OEKA 4H4MB 3FGVA 2P9CA 3KLEA 4OYIA 2H4YB 2XYGB 2LU2A 1U8WA 3QJPA 1KWMA 1RBOB 2KM8B 4DMZA 2HVZA 4LF5F 1M5VC 4IO9Q 3DRSB 4UY85 3THTA 4LFBJ 2HFSA 2VFTA 3M8SA 4DZDA 4I1TA 2UXDJ 2NPFA 3F0NA 2E7VA 1RAIB 4IFVB 3QT7A 3HJFA 2XO7A 4NXNJ 5KFYA 3MECA 3KJQB 4ECRA 1VRTB 1GXUA 3I4HX 4Y6IA 2RB7A 3LTOA 2CRLA 3RUBL 1BWEA 5I3PA 1JLAA 2M70A 2Z8QA 2VDHA 1S1WB 4A8MP 3P6YC 4DSJA 4JV5F 2IVYA 5KT3A 3CCTA 1RYSA 4MK8A 3CMES 2KYZA 2MEWA 4CO0A 2O01C 2IVFB 1I94J 1RACB 1T9YA 3EGVA 3EE3A 1FI4A 3MHYA 1Y5IB 4ICLA 3DLLQ 3MCSA 2W7AA 3GYGA 3PYEA 4J5OA 4IOCQ 4ECVA 2DK2A 4L3NA 2B56A 2Y1IA 1KVJA 4EK2A 1UJ4A 5KAKA 1N52B 2F8MA 3Q23A 2B5JA 2EXUA 3PEJA 5HVHA 1QSLA 2CPEA 2IPOB 1UL3A 4DS5A 1EIYB 1U2CA 2X1FA 2WK4A 4EEYA 3QLHA 1QAXA 1KLNA 2VG5B 3IGNA 2UZAA 1RK8A 2BE2B 1HWJA 5L38A 4M5DB 4ED8A 5BR8F 4OYMA 4ZP7A 1WOSA 1QDUB 2IDEA 2KVIA 1ZAWA 6AT1B 2EK1A 1MWYA 1WOPA 3C14B 1FTCA 4DR2F 1X4DA 2B51A 2O66A 4ATNA 5B0AA 2AJFE 1NUEA 1DRZA 1JLBA 2DH9A 3LWLA 1FXLA 1CQNA 2VPWB 3AJ1A 3JYTB 2XYHB 3KOAA 1U26A 1N54B 4N41A 3ZC4A 1GMUA 3H20A 5K8MA 3CUNA 1Q82T 2XY6A 3M2VB 3RW7A 4J7CA 3PJWA 2DB1A 1L3TA 3MMAA 1VJQA 3NCPA 1LXJA 1X31C 4MFBB 4MIBA 1FWLA 2AJ4A 3MM8A 5KT7A 3HVWA 2AHOB 1T3OA 3EVOA 3HZEA 3DLJA 3ZNJ1 2DO0A 4LIWA 1NH7A 4FXVA 5J2NA 4ECUA 1FHTA 1KVIA 4K4WA 4DUTA 4ELTA 2DIVA 1UFKA 2E7XA 3RAXA 5A8RA 2XQCA 4BS2A 4WP9A 3FSYA 2GGPB 3SV4A 1SQGA 1VQNS 4CO3A 3AJDA 1PYTA 2ZH7A 2HQCA 3L7OA 1TL7A 1FKPB 3S7RA 3IS9A 1SJFA 2H51B 1I6JA 2WB4A 1X0FA 2PC6A 3EGWB 3KMSA 5HQ8A 4W98A 2CPJA 1NHVA 4G1IA 2JWNA 1P8GA 1S79A 5H1SV 4OX8A 1MLAA 1SUQA 2ZOFA 3Q24A 3N79A 1N32J 2RRAA 4J9UE 2XO6A 2CPXA 1Q4RA 3TW0A 5L1KA 3TNVA 3RBZA 2XULA 2AEJA 4FVCA 5D4NA 2LVWA 1Q0NA 2N82B 4CZCA 3N01A 4NA2A 3OXLA 4C8LA 2JH3A 3M8RA 3UFCX 1VRUB 4H54A 4Z37A 4MH8A 4OJ1A 3CWJA 3RBDA 3PKMA 4ED7A 4EZ6A 3C6UB 2QL7B 1NCLA 4B9NA 3G87A 1LFPA 1NPKA 1N4LA 4NLXA 1WHXA 1CJKB 4LREA 1JIHA 4DSKA 1KEKA 3R5CA 4OMFG 4TU9A 2KKHA 1S77D 2IAJA 2JDJA 1KS2A 2DRBA 2NXUA 3DLHA 3GP9A 2OO4A 2WBMA 2XSJB 2DISA 3D66A 3CMQA 2K1RB 4H4OA 2AWZA 2KHCA 2H65B 1S72S 2H48B 4P75A 3OVSA 4GMKA 4KHRA 3GJTB 2ZH3A 1Y3JA 1EP4B 3D67A 3KKFA 4RNMA 1YI2S 3J7YU 4RL1A 2H4WB 2C1EB 3OQ2A 4DV1F 1ZS6A 3C46A 1JLQA 3UDCA 1WC6A 2CPIA 2RF2B 2MGZB 3AXKA 3D0IE 3MTJA 2RJZA 1KQSR 2QA1A 4N76A 3TR5A 1R0CB 3KLIA 5GMKa 5LT5A 1I3OB 3GG1A 3ADAC 5CYJA 4ECXA 1UETA 3ZTOA 2QSFA 1DLOA 1IBLF 2NXNA 2I6WA 1KP6A 3G96A 4DHVA 2EKNA 3MEKA 2UVRA 4RNHA 3C8YA 3ITHA 4JB8B 2DYAA 2AEMA 2E1CA 3KUHA 2XCAA 3THPA 2BRLA 4ED1A 3MM9A 2RDDA 2UUBF 2HMIA 3LO3A 3BO3A 5GMEA 1E6VA 1D3WA 2R7QA 3I0RB 3NLCA 5L39A 2KFNA 2FUG9 3V4IA 3T5KA 1OY6A 2Z2LA 3UD5A 4B9LA 3R27A 3RGIA 4PG7A 4WZQA 3W1YC 1RE1B 2DXDA 2KG0A 4TY9A 2DPIA 5KG3A 2R3VA 2WB1D 4XIUA 1IWAA 2YPZA 1C4CA 1Y4ZB 4F0HA 2OHDA 1PILA 1DAXA 5HLFB 4ZVUB 1DURA 2DR9A 1H6KX 1A6LA 2ZD1B 2HIYA 4LF6J 1SJ4P 4KSEB 1NB7A 2ZUAA 3KK1B 3MM5B 3DMJB 3CB4A 2VUGA 4WE1A 2G4BA 3UN2A 2UUCF 5HQLA 4TXSA 5ETKA 1MU2B 2CZ9A 1YWXA 4HLBA 2GFFA 1AXQA 4ZLJA 3PCOB 2YWGA 2CAJA 2BM0A 3Q8SB 1P27B 1LW2B 1H98A 2HQGA 2UUAJ 4F26A 3JSBA 4DSIA 3ZXWA 2J6SA 3OFEA 5C24A 4NCAA 1AA1B 3M8ZA 1FRMA 4RJVA 2CWXA 5HROA 1HKAA 2DH8A 4LJMA 2O5DA 3BO4A 3LA0A 4NXMJ 2MSTA 5B7WA 2CPZA 2XSFA 1HQUA 3A3NB 4BHQA 3ZZZA 3BJYA 2OTLS 2BKOA 1FESA 8RUCA 5A8WB 4IG0A 4ZCIA 1FT8A 1VQ7S 4LBHA 2UU9F 1LWCA 1CJVB 2E66A 3SQGA 2CQIA 2V8DA 1KQGB 2FIUA 4DN0A 4WP3A 1U1RA 4CLLA 2JLGA 4IRKA 3GE9A 5D78A 1FXRA 2HBRB 4Q8FA 2HGMA 2J6TA 2RMLA 2BZ2A 4J9NA 1IM4A 2DHSA 3KK3B 4UZBA 3L3CA 3HT0A 3NRBA 3LP1B 1VCTA 2OI2A 3MD1A 3MWBA 4DCOB 4PWDA 2FD2A 3MEDB 2RQCA 3HVTA 3Q86A 2NXCA 1OPIA 3CJKA 4ANEA 1SJRA 1EJ7L 2JVRA 3IN5A 2CNKB 1KVKA 3DRPB 5KFUA 2QE5A 3U1NA 2V6AA 3V6JA 4WKYA 1FRHA 3JAMU 5DDOC 2G13A 4NEYA 3OFFA 3FEXB 3SSSA 1M5HA 3KUGA 4CP5A 4KR0B 2PMHA 5EGYA 5EWEA 3QSIA 4X4NA 5A2QY 3IBFB 1RT7B 1NBEB 1LEOA 2V4QA 1B99A 2PGCA 5J1NA 4DDFA 3NY0A 2EEYA 3E01A 1GT8A 2XMKA 2ZHBA 2AYEA 4RUHA 4B3RF 4JI1F 4M5HA 2AGPA 1APSA 3FEYB 4JI5F 1T7PA 3DLKB 1U1PA 4PQUA 2OD6A 4F67A 2VBYA 3EUNA 5F3ZA 1FX2A 1U02A 1ZZNA 3LP0A 3Q83A 1VIOA 2HRTA 2CNOB 1R8CA 2DO4A 5ITHA 2UP1A 1N8RT 1N5YA 3D6TB 3MD3A 3QIPB 1X4AA 2DR8A 1VMBA 1X9WA 4WK1A 2ZE2B 4NYPA 2CQ3A 4CO5A 1YG0A 3EYZA 3A8IA 2B8PA 2OUGA 1UA1A 1SIWB 2Q43A 4ID5A 1TL3A 4KT0C 3DRSA 4WTYA 3CULA 2R7OA 4ZJOA 4AL5A 4FF4A 5LMNF 5SZTA 1R6VA 2YKOA 2N3OA 3W9JA 4XPEA 4NWBA 2C22A 5CABA 4FDFA 3C2PA 4I2QA 5A8KB 2QX0A 1JK9B 2ZBPA 1XR6A 3QFHA 3HCXA 2BACA 3WBZA 3CCRS 2HFOA 4NLWA 2RS8A 1W2BR 1S1WA 3IFEA 3EJMA 2RUSA 1S6UA 1VI7A 2OPQB 3WX8A 2HQFA 5J2MA 3I87A 3EWGA 2RHQB 2J7UA 1U1MA 4ED2A 2CQCA 2FVSA 5CCLA 2ZM6F 4FKYA 2X1BA 5B08A 3I31A 4M94A 2FJEB 1B7FA 2FC9A 1X4GA 2HVDA 1S49A 4L72B 4LSNB 3FQKA 2FLPA 5CA5A 4R0JA 2YWEA 2C2EA 3MI7X 2VG5A 5KOWA 1H7WA 1NJWA 2BE2A 3J80U 4M5DA 4CO4A 3AOBA 4WU2A 4C8OA 3T1HF 1UWBB 1NZ8A 3NXZA 1DTTB 3M6XA 4LF7J 1ZTTA 4OYWA 4CLUA 2VOOA 3EDQB 5F0WA 2W2QP 5L1LA 1S9EB 3C14A 4ZPBA 2VG6B 1U7LA 2GCFA 4ER8A 1S9GB 4U7UK 3AH6A 2FJXA 2MKSA 1PG5B 2CXEA 1IBMF 1FJEB 1EKRA 3EVWA 4RWWA 2XMWA 1U09A 4ES3A 2KT2A 4AQYF 3UVJA 1PSDA 3M2VA 4DQIA 2DXFA 1DFDA 2I38A 3B8HA 3PY8A 2VPYB 5KFMA 1HW8A 5HP1B 1F9FA 4DUYF 2MQNA 1CC8A 1FDDA 4MFBA 1XNRJ 1KOOA 2VJUA 1YK9A 5L9NA 4OHYA 3R3TA 2RRBA 2D3ZA 2M2BA 4I0WA 4X2BA 4PUOB 4X65F 2D69A 4X4RA 3JQMA 2KB2A 4RW4A 1JXVA 2YKMB 4QIWD 5B0FA 3AB4B 1FNMA 3UNYA 3Q0AA 2FLNA 4NLVA 4FYWB 2IFXA 1XR7A 4XO0A 2WCXA 1XMBA 4LF4J 1NSQA 1F5AA 2YX1A 3AD7C 4GVBB 3RB0A 4O3RA 2EG2A 5CXTA 3QJJA 5E3AA 3LUYA 2FLLA 2OFHX 2HZCA 1YJ7A 3CD5A 2E5JA 4P2SA 1RBAA 1WEXA 4NL5A 1HNWJ 2VKRA 4B3MJ 1Y0HA 4U9RA 2RKIB 3C16B 2R8HA 4K4SA 3CCVS 5M2RA 2YKAA 3SCKE 5C25A 1VFJA 4C0OC 4USWA 2YQ3A 4FS1A 3CJ3A 3BF4A 1SQEA 3UWTA 3E51A 2P2CB 3ZZUA 4M5KA 5F0UA 2GJIA 4B3RJ 1V3SA 2ZWPA 1SL2A 2QMXA 5L1JA 4IUFA 4NA1A 1FNXH 2HHHF 1XTZA 1F2GA 2GHPA 3A8EA 4O23A 1FE4A 2R7RA 2ZNZA 1FJCA 3RAMA 5DJBA 1U47A 5LL6d 1S6PB 4OJ3A 1CJKA 5GAHI 1C1BB 2E5GA 2XNRA 1UKUA 2NUUG 4OQJA 2HWTA 3HP6A 2W9AA 3U1MA 3MFHA 4PZVA 2JFKA 1TVRA 4BC9A 4ZVHA 3ELHA 4X62J 1LXNA 5E0OA 4HHHA 2V2QA 1G6BA 4A8OA 4DR5F 2HRUA 1FRLA 1GTEA 2XSJA 2KZMA 1EZZB 2VF3A 1QSSA 2ZH4A 1ZA2B 4FBTA 1FNOA 2IM1A 2DRAA 4LR9A 4RW7A 2ASLA 3QNWB 2D3UA 3VALA 2BW7A 2HKEA 3PJ9A 3PYGA 1RHRB 2QLJB 3DU6A 3ENAA 1EETB 4FYYB 1EP4A 4LVOP 4QR0A 3TRGA 4LRAA 2OJ3A 1YJTA 3T3FA 5K5MA 2CFXA 2YNHA 2CG4A 4PXEA 2OMOA 1LV5A 4K5RA 4UW2A 4GKKJ 3TJ9A 3GCWP 3T1YJ 3K0JA 2CJKA 2FJDB 4DR3F 3PDNA 1BWVA 2VKZG 4QJVA 2Y8YA 4OYXA 4DUZJ 1CS4A 4I2PB 1N36F 2APOA 2EI5A 2OAUA 2MGZA 1OQ6A 1WDDA 4KRWA 3DHWC 1WORA 1EQ0A 2YH0A 3R97A 3UCZP 2ZITA 4MAKA 4GKJJ 4QWCA 2WBRA 1SC4B 3T5LA 5KT5A 4IG3A 4V19J 3L7PA 5AXLA 3W63A 4QPXA 2MZQA 3B78A 3LGNA 4URGA 3TJAA 4F8RA 2KO1A 1GMWA 2Z0GA 4NLQA 3D2WA 3MMJA 4OHZA 3R6LB 5KFKA 2HSEB 4YHHJ 2AJ2A 3MAAB 3G9CA 4DL7A 4DPWA 1X4BA 4O0NA 3SBMA 1RAJA 1ULRA 4O3PA 4DL6A 4IKAA 2RH3A 4L73A 4A8KA 3OTOJ 1HBOA 4I68A 3OBIA 4ZPVR 5IC6B 4QR2A 4OJHA 2MZRA 2EWHA 4ZP9A 2ZD1A 4KV8B 3HHEA 4F3MA 4H4KC 4ZMMA 1VR6A 4M5JA 5IV4A 3PXGa 2VFUA 3UR0A 3KK1A 3MM5A 3DMJA 2HHPA 2DHXA 2MLZA 5AXNA 3WIUA 3N6NA 2BE9B 1SBRA 4DV0F 3T6JA 2AT1B 3BH6B 5EHHA 4DBQA 2RUGA 4USIA 1VGYA 4C0HA 2GV1A 1HQEA 5EX3A 3POTB 3EGNA 4C98A 3K89A 4B9VA 2QLWA 3CD0A 3M32B 4CWBA 4A48A 2B9EA 2L9DA 5ETQA 1J2VA 3QZ7A 3MXHP 5BYSA 4TNOA 2ZH1A 1U0HB 2ZBIA 5JXSA 4LBIA 4LF9J 1D0EA 1RHJB 3NWGA 4OZ5A 1FEEA 4KY3A 2DJWA 1OJ4A 2C3MA 1YKWA 2DNQA 2MPUA 2PI4A 2AP6A 4I6AA 1UA0A 2DTJA 4K59A 3K7RA 5JJBA 1RAOA 2H1YA 2VBZA 2ADCA 5F8IA 3VZIA 1GMWD 2DEIA 4NLPA 3UE2A 5I3UA 5KG2A 2B9XA 2OGUA 4MKAA 4UQTA 2GMHA 1CJVA 1WG4A 4EBDA 2W1BA 3K5MA 3UQSA 2W01A 4Y2IA 3AD8C 3QGGA 4MYTA 1Y3KA 2VBXA 3W66A 3QRRA 1RT1B 4LF8F 2PEBA 2JOQA 2FVPA 1VS3A 3UDLA 1TELA 3MEGA 5LSRA 3MAQA 4NE9C 3WZ0A 1FJ7A 3OHAA 1RDRA 3SXLA 2P8IA 2V68A 2XMVA 2DR6A 3KK3A 1K73T 5T7LB 4DCPB 1BC6A 2CYYA 3SZ2A 3LP1A 1S97A 1OIAA 2FJWA 3ILOA 2E1PA 2KFZA 2VB6A 4G3IA 4MK7A 4C48A 1MN9A 4N47A 3W2WB 1YITS 4DL3A 1VQYA 3SCJE 2CJQA 3H40A 5FLXY 2AX0A 2WW4A 1RABB 2J0XA 1DY3A 3GJRB 1BY9A 2JLFA 2DKOB 4ZVSB 1JKHA 4CLSA 1NDLA 1WUUA 4YB7A 2ADBA 3BKFA 3HSZA 3PHEA 3TAMA 1UEKA 4A8FA 5IXUA 4Y34A 1N0VC 1V9OA 2I2YA 1NK4A 4C11B 2MQLA 1OQ3A 2BJEA 4Q5VA 1K47A 3SEOA 2ILZA 3CJTA 3M8QB 2E5LF 1VBZA 3QQCD 5K9FA 2LEAA 1Z2ZA 2NREA 2G2ZA 1E6YB 1YBTA 2IC3B 4MKVA 3PEHA 4JYAJ 3VAFA 1L3KA 4DPYA 1CQMA 1REVB 4WBFA 3N6LA 4O44A 2AW0A 3D4JA 1IKYA 5B0BA 4CYUA 2HAIA 3LQVA 2GMJA 4X84A 1VHIA 1VISA 2MB0B 2Y1JA 2IMOA 1T9UA 2NPIA 4NLOA 3W8PA 1C0TB 3MDFA 3G2XA 3SV3A 3KHLA 4OI1A 3I9ZA 1FA0A 3PR4A 1Q7LB 2AU0A 3T41A 4QYZK 5FIIA 5KG1A 2MZSA 2ZFHA 3PV8A 3DGVA 2F3JA 4XAKA 3F44A 4K0KF 3FBFA 3JB9k 5ETTA 4U8VA 1G4CA 2JL9A 2LQ8A 4C8NA 1QVFR 1LW0B 1KONA 3QBCA 3E2EA 3MR5A 1RA6A 2WVCA 2OPQA 5KFRA 1A9NB 3QRPA 1TAQA 3E3XA 3A1YG 3M6VA 3VAJA 1YRUA 3OVAA 5HL7Q 4ZVQB 5G0RA 3VCDA 4CIOA 2QLXA 5EWGA 5LMUF 1FTRA 3BH7B 3NCQA 5ETRA 2B3TB 3T9ZA 1N56A 2F40A 1VQSA 2CADA 4DU8A 2VV5A 4LSNA 1HBNB 4DV4F 5I4MA 4CTAB 3PO4A 3DOLA 3DN9A 3G6XA 4A47A 4R5PA 3AOAA 2RQMA 4C3KA 1KN6A 2UVVA 4K4TA 3Q2SC 5L46A 1YRXA 1CULA 5ADZA 2KHDA 1VBKA 2DITA 1OYDA 2N4DA 4USTA 1S9GA 3EVMA 2W9CB 2XG8A 3BN7A 4KH0B 2EC0A 4V19X 4FNIA 5CYQA 4NRUA 1DQ8A 5D0RA 3TVZA 2PO4A 3Q8RB 1AYEA 4FBUA 4EU0A 2Z4PA 1KHWA 2ZJRQ 3BQ1A 3DOMA 1MROB 4K4YA 1X4EA 1IQZA 1HHTP 2HWHA 1H2UX 5HP1A 4FYXB 2BEFA 2C2OB 5E3CA 2CG8A 2CUYA 4JV0A 1HWLA 4GC7A 5K14B 4AFFA 2GQQA 1WC4A 1KBRA 1C1CA 4CLFA 2CQPA 2PE8A 4ZVGA 4PUOA 4F4ZA 1SKSA 2OEMA 5HO4A 1K8AT 4DR7F 4DPOA 2Q66A 5C42B 2OTJS 3PG9A 2CNLB 1OSCA 3TQEA 1UWAA 2BRKA 4ED4A 2GX8A 2B6AB 4Y2MA 2MKCA 4N77A 1KR4A 3EPGA 1HPZB 3V5RA 4A46A 5HMXA 5DDRC 3CNQP 2FQQB 2MLYA 4TLQA 4ELVA 1WF1A 2XLIA 3PW2A 5AJ3F 3IG1B 3R1HA 3ENWA 1R8AA 2VIHA 2XZTB 1U6FA 2NXJA 5DM7Q 3H2LA 3CCZA 5K8OA 4ED3A 1K44A 3W64A 3ULHA 3ETMA 1N6QA 4HACA 3C16A 1EX8A 2NSBA 2QT7A 4ZCMA 2LQ5A 1Y5NB 4D3GA 3OW2R 2R7XA 4ZPDA 4OX9F 5CD4A 5D77A 3NNCA 4F4YA 4ZKAA 4F50A 2P5VA 5LSLA 4X4OA 3W9HA 1QM9A 4DFJA 2BJ3A 3MPUB 1UPMB 1S6PA 4ANDA 1C1BA 5F3TA 4PQAA 4YEAA 1QD1A 3TOQA 4ZCKA 1S1VA 1RWUA 2AJ0A 4DV7J 3PYFA 2E1MC 4RLEA 1RAEB 2Y1RI 4ZJLA 5D4LA 4DPXA 2GW8A 3NKYA 4ZLNA 2VG7B 2YNFA 5A6PA 2R8GA 1RT4A 3HKWA 1RTJA 3VV2B 4A4JA 1JLEB 1KKHA 3DCAA 5E3RA 3LANA 4RW6A 1VQ9S 1ZM4A 2P9GA 3OL7A 3LAKA 4WF9Q 2LQ9A 2KXFA 1KHVA 4YR2A 4DV3J 2XS2A 2QYCA 3IAS9 3MCOA 5JUMA 2RIJA 2YNGA 4URSA 4X64J 4OZ0A 3R7BB 3QGIA 4LRBA 5F9NA 4RU2A 5KFSA 3MMBB 2G9OA 1RKIA 2CQ1A 4J9QA 4DL0C 3DKDA 1C4AA 4I2PA 2OPRB 1FEHA 4DL2A 4KIAA 4X4VA 5GVQA 4W90B 3JQKA 4D3HA 4GO5X 2E44A 1VBYA 3QYYA 3QT5A 2YKQA 5KG6A 1U6ZA 3OL6A 2VFRA 4KBIA 4J37A 2KJWA 2V69A 3OXFA 1KSPA 4UT4A 2ZHAA 4DSEA 2W2NP 4C3LA 3DM2A 1DTQB 2LU1A 4F4WA 4JI3J 3R5GA 1XNQF 2FY1A 3ILIA 3ONQA 1MG7A 3UR3C 4WU3A 4F25A 1VLYA 2ZKTA 2VFSA 3ISND 4YUDA 4JI6J 2VZ9A 3IM8A 1Q78A 3FBBA 3LAMA 1PGZA 5I42B 3JSMB 1RLDA 2ZH8A 4DSFA 2AEFA 3FFIB 1U25A 3AD9C 3WIVA 4NLTA 4OJGA 1FDAA 5EWFA 1FJGJ 3BV8A 4OI6A 3OUYA 2F4VF 3ZZPA 2LDYA 3VTIA 3TVYA 5KFWA 1LOUA 5A6WA 4F0MA 2YNIB 3MZIA 2U1AA 4LSZB 5KFGA 4LFAJ 1JX4A 3I96A 2DD8S 1OO0B 5T41A 1GEHA 3CCMS 1D1UA 5D6GA 3I9V9 2GAGC 1SV5B 4C6AA 4TY8A 4I56A 4C8MA 1D8ZA 1PCAA 4Q7AA 4FYDA 2L41A 3CT9A 2HFNA 2WAQD 2Z2ZA 2HQ3A 3MR2A 1X60A 3MPYA 3W7BA 2YBVA 1FWPA 3EMTA 1UVMA 1KTQA 3E8OA 4ZK7M 2HW3A 5ETLA 1NO8A 1M1KT 4KKOB 3M8YA 1J5EF 2WHOA 4DL4A 3HDSA 3RYLA 1IR0A 5GAHU 3M32A 4JI7F 1NXIA 3DFEA 2V2ZA 1RAGB 1S5ZA 5B0DA 4DXLA 3Q22A 3V81B 2K3KA 4KJIA 5IT4A 3ENVA 2K3IA 3NS6A 4X4UA 1FD8A 4OFZA 2HS4A 2HFVA 1WJ9A 2OSRA 2PA3A 3TX8A 4OI2A 2B7CB 3KLGB 3FCWA 2EFGA 2V4RA 3KXDA 1ZA1B 2FHJA 4KFBB 1CVJA 4XDDA 4IR1A 3KLFB 4DV5F 1R0AB 2UVWA 2ZHOA 3BSCA 4L75A 1S1XA 1S4EA 4ZVOB 1YJNS 4HDHA 4FXWA 3CF5Q 4JI8J 4PWUA 4B9UA 3BQ0A 1Z4UA 2IA6A 2ASDA 3UCGA 4Q44A 1MSWD 3CC2S 4OX9J 2ZZTA 1RTDB 1NHKL 4Q2LA 4Q45A 1YLXA 4ENOA 3LGMA 4IYQA 3K57A 1FE0A 3QIDA 3CDEA 4DX8H 3JTPA 5T7LA 4OV6A 3VGTA 3RB4A 1VQ6S 2LMIA 2XLKA 2ZZNA 4ES1A 2V8VA 1Y11A 2YPYA 1K9MT 2XMTA 1R8PA 3W2WA 4X66J 3BBFA 2ZOMA 3RAQA 2QEXS 1YSJA 2QL9B 1L5UA 2FGCA 2HPUA 1GNKA 2YWFA 1JB0C 2HNZB 5IV3A 2AYBA 4OZLA 4E0DA 2JC0A 2CZVC 1S7HA 3I82A 2XZDB 2PMWA 3JQJA 3M2UA 1WC5A 3ILLA 2VDIA 2W4DA 3PX4A 3KDNA 1R89A 3G6YA 4NRTA 3SSRA 1O51A 4C11A 3C15B 2HVIA 3VHQA 2HHTA 3H4DA 1WF0A 3RU0A 4DLGA 3EZOA 2UXCF 4NCGB 3P5TL 2N4CA 2BJ7A 2M7SA 1NHUA 1MW7A 4J9RA 3K5LA 2FHJD 2YQ0A 1TMJA 3K8VA 2R2UA 3VAMA 1M90T 3ET6A 1FRKA 2IC3A 3EZUA 3IXQA 3OR1B 3B54A 2EBGA 2QG9B 2F7VA 4OHVA 5J1EA 2QA2A 4EI2A 4K7QA 1F5CA 3KLHA 1FKOA 1Q1KA 2NZCA 1XMOF 4K4XA 4N56A 1XIQA 4FXDA 4DPTA 1I1GA 5KFVA 1FCAA 4O3SA 3T5HA 2GC8A 3JAMY 2MKYA 3DI6B 2NQPA 5GAGI 5DDQC 1C0TA 5LOQA 4U95A 1S12A 2BBEA 8AT1B 2VQFF 2VH7A 3R8YA 4Q0BB 3QAUA 2YQ1A 4F2SA 4C7QA 1HBMB 3BR8A 2WOMB 1U0SA 2MLXA 1T0TV 1NNDA 2WONB 4ECYA 3L09A 5K20B 4JI4F 1VOMA 3FCHA 1IBKF 2GVZB 2BOPA 1D09B 2CKWA 1LW0A 3GIKA 3BEGB 5A0YB 3BDEA 2HK3A 5DG7A 1SI9A 2Q6BA 3M8PA 5HN0A 4CDIA 3GFYA 3M6UA 4WIIA 4ALZA 2W7OA 8ATCB 2D1CA 4MJKA 1VK3A 2OPSB 4CO1A 1VHFA 2QA4S 2W8KA 4B02A 3OFGA 2KL8A 5DLGA 4DV2F 2EFVA 1U1QA 3G6VA 1TFYA 1T03B 4CT9A 3TANA 1HFEL 3DDIA 2ZH2A 5J2QB 1SH3A 3QZ8A 5ETPA 2G2YA 4QU7A 1HBNA 3Q8YA 2F4FA 4CTAA 2BOAA 3CJRA 4DZ6A 2HQDA 3DYAB 4O3NA 2DCLA 2BX6A 4PAAA 4P71A 2Y8WA 4BDPA 3TI0A 1ZTWA 4HR2A 4NLSA 3D1HA 4F36A 1BGXT 1IN0A 1X4FA 4P2XA 3VAKA 5BJRA 1KOHA 2CVEA 3ZFVA 4DOZA 1U2RA 3NOGA 2XI2A 2O67A 2W9CA 2QRRA 3SI8A 2DGWA 4DFKA 2XGQA 2DNZA 1RU2A 4XDCA 5JVHQ 2OMLA 1H72C 2JNJA 1MROA 2QV6A 1UEUA 2IMWP 1EARA 4P7TA 2YH1A 5K14A 1ZH5A 4OZNA 4AD6A 2B0GA 3DOKA 5F8HA 4WXOA 4UTGA 1MWQA 4ZIWA 3IRXA 3PHTA 2HURA 3BSNA 1RTHB 1S0OA 4B3OB 3H42A 3G6ES 1S1TA 3HZGA 3W3SA 3J80Y 4C4WA 5DQIA 2MSSA 3GJQB 2L9WA 1ACMB 4MIAA 2K7JA 2B6AA 1NSKL 5DETA 3FRZA 3KHRA 2X51A 1HW9A 2QFIA 3F73A 1XWLA 1WC0A 1RTIB 2Z2MA 4F4AA 5DG9A 1UTAA 3QO9A 3MURP 2MKJA 1UP1A 2BYCA 2RS2A 3HXMA 1KDNA 3IG1A 3NOCA 4ZDNA 2W9BB 3D68A 3GFXA 4OHWA 4E2FB 2FHMA 4RUCA 3M8WA 1LQ9A 1UZDA 3HHLC 1ZAXA 4U6PA 4NPOA 2UV8A 4TLRA 3TZWA 3AA8A 2GVDB 3AA9A 4N7TA 3UW1A 2HGLA 2WVEA 2UXCJ 2UXBJ 1S6QA 1TR0A 3H4BA 2V63A 3CIZA 1UZHA 4ZN1A 1O6XA 3OR2A 2HNYB 3OTEA 2AF6A 4HYKA 2VPZB 2BQRA 4LSLB 2OPPA 3HK2A 3R5AA 4WFNQ 1BQNB 2RQ4A 1Z1ZA 2FGOA 3BPSP 4YDXA 3I5AA 2AZ3A 1FXDA 1AFIA 3KLEB 1ELOA 1D8YA 2ROEA 2ZOGA 4ITSA 4DFMA 2IBKA 3KUEA 2FZCB 3V6HA 2HNDA 1QAYA 4TN2A 2IJNA 3DRRA 4F02A 3OSPA 1Q79A 1AFJA 2A6MA 2AZ1A 3AAWB 4UUWA 5F8MA 1RKJA 4P2FA 3MECB 3QGHA 1HNZJ 2H3EB 3GWCA 2OELA 3MR3A 2DHHA 4NASA 2K2PA 1F9HA 4KH1B 4JV2A 1T9TA 2C3PA 4B9TA 3LF0A 4JI2F 3TUZC 4RR5A 3D0HE 3TEGA 5GAEI 5HSPA 2JFDA 4Q8EA 1X4CA 1ZPWX 2Z56B 3MPWA 1U4BA 2J7KA 5KFFA 2HIQA 3PFEA 4ICLB 1WHVA 4HL9A 3FCVA 4EO8A 4NLGA 3J7AN 3GONA 3SSQA 2G0CA 4MMOA 4IQXA 1QTMA 2K7KA 1R7IA 2W2OP 3R5DA 4ZVFA 2DGOA 2DIUA 1HBUA 2B5JB 5C5JA 1RT3A 2WSFC 2D9PA 2VQEF 1DTQA 3IR5B 1HR0J 2BKPA 2M8HA 1W26A 3UNGC 3FNNA 1F3FA 5M2UA 5AXKA 3OD2A 1AUDA 5I42A 1O8BA 4O0IA 1HNXF 2I5JA 3LH2S 4FP9A 3CIMA 3A4TA 4QIGA 3D5MA 3V6KA 2LDIA 2BJ8A 2GO9A 3FFIA 2J8AA 2HHQA 4U8YA 1QY7A 1JLBB 1FK9B 4HDGA 2W2PP 1TKZB 1NJYA 4U7UD 3UD4P 2B7BB 3A13A 2ZH6A 1GMVA 4Q43A 3BGRA 2QMUB 2YNIA 4LF5J 1KLMA 5LM7E 1GAOA 3G71S 3NCRA 2PEHA 3Q89A 3H2UB 3BYPA 1JNRB 1ICEB 1SV5A 1NK6A 2CQDA 1SJQA 1Q8LA 1RAFB 3NBPA 2EFOA 4FZVA 2VHGA 2MTLA 5A76A 2DVIA 1HI0P 1WG5A 2LECA 1SH0A 4DJBA 4DQRA 4NEZA 1H3DA 2PT0A 4IR9A 2NXEA 3M9MB 4JV5J 2RSQA 4RU9A 1R43A 4C3MA 2C28A 1D9AA 5J2NB 1WI8A 3UN3A 5AT1B 5DLFA 2IBOA 3VVTA 1TUVA 5A8RB 3GMGA 1QSYA 1IJFB 1U2FA 4USHA 3TZZA 2EFPA 2LXIA 2OD4A 2HWIA 5IT9U 5ETMA 4DPUA 4QYZJ 4IFYA 1RWNB 4ETZA 4KHPF 3IS9B 3HULA 3C3LA 1T05A 3GPAA 1SCJB 1LKZA 2R2RA 4DV6F 4JI0F 3GFZA 4QIVA 2G1HA 5F8LA 3KLGA 4CH7A 1V5IB 3NGRA 2Z58B 5HATA 4MTPA 4P9SA 5BR8J 1R0AA 1DBDA 2GNKA 2IYGA 1GQEA 2BE7D 2QN6B 4DQPA 4MKBA 3OJUA 1OY8A 4A8WA 2O1PA 4DR2J 3W65A 1PC5A 3I5CA 4ECWA 2C2MB 3ZTRA 5ETSA 1PJ6A 5C2CA 2LA6A 3TO8A 4YY3F 2YX4A 4QIFA 3DC2A 2F9JA 4S0MA 1CC7A 4NI2A 2XHWA 5DQHA 1P9QC 2V94A 3GG0A 4ZA1A 4B08A 5DGAA 1JLGB 3TA2A 3HMJG 2IAJB 1BQMA 1Z2LA 4KGZB 4CQ1A 1Q5YA 3JTNA 3GSDA 4LR8A 1RUSA 1XEZA 3PW4A 2CQ0A 1Q53A 3OXGA 2KZZA 3UDEA 4BC7A 1U6BA 3OT9A 4DWIA 5D15A 1XMQF 2R7UA 3B4MA 2HNZA 5KFHA 4H4OB 4PG5A 2JLEA 2LKZA 1TK0A 3V4MA 1N0UA 2DNYA 3V6DA 4HT7A 4I7FB 1R0BG 1TL1A 2KJVA 5E33A 3M30A 2HBQB 3D6MB 1RWMB 2UUTA 1FO1A 1TKTB 4NLYA 5LXYA 2MYFA 5D4PA 3TEHB 3CCQS 3C15A 3D3BJ 4B3SF 2RRNA 3NL0A 4A8SA 1WHYA 4RW9B 3FKBA 4NCGA 3GIRA 4N5SA 2B9WA 1RHMB 1YJRA 2KFYA 2E29A 4I64A 2FVQA 5KG4A 5IC4B 2BANA 3MFIA 3LOUA 4ZVEA 4C8YA 3R2CJ 5HI7A 2JSXA 1WNEA 4B3TF 3HFZB 1ZBTA 1N33F 1WDTA 1SPBP 5H9FK 1SH2A 1YZ6A 2VQEJ 1RWPB 1UJ5A 2HHXA 1JJ4A 1RHKB 1WF2A 3BKTA 4CT8A 4DR4F 3MM9B 4UOGA 4RBUA 4LFBF 4X4TA 4ED6A 4FYVB 3HPOA 1YJWS 2ROGA 4KAIA 2UXDF 4RW8B 1HNXJ 4X4QA 4FF2A 2GQCA 1QJHA 1LWFB 4WTOB 4Q0BA 2ZDPA 1HNIA 1MMLA 1SL0A 3V4IB 1Y7PA 1SKWA 3CCLS 5KG7A 2LLZA 1RU1A 2WOMA 2FZKB 5DG8A 2AKWB 4DCJB 4M5IA 4FF3A 3TJ8A 3MOJB 1RWOB 2AGQA 4FNHA 4ZVTB 4QIEA 4FPRA 3MOZA 1AW0A 5GADI 2GVZA 2CQ2A 3ZZRA 4XPCA 3CDUA 1B0TA 2V2KA 1I94F 2VL1A 2LQBA 2CJ9A 1GX6A 5KFBA 4PYDA 2M88A 5HQMA 1ZPVA 3HJVA 2DNLA 2YTCA 3GV8B 2P6SA 1JLFA 3IMQJ 3MM6A 3R9LA 4UZCA 3J7ZT 2OPSA 3QATA 1RJJA 2ZVSA 5FDLA 1HL6A 2ERRA 4LF2A 1X5TA 3KG0A 4DV1J 3CCES 4ED5A 2J9CA 3W60A 4PPZA 5KFIA 2OIHA 2PMZD 2FTRA 1VIXA 4WZMA 4I4BA 1CSJA 2MDAA 4CLWA 3BM7A 3MMCB 4EZ9A 2CPHA 5C24B 3SDEA 4OI3A 1H0HB 3ETOA 2VU5A 1SC6A 3CJ0A 1IBLJ 5HROB 4DN9A 2E9ZA 1X0PA 2KU7A 1KFSA 4RNNA 4KYZA 1QTNB 4H4MA 3TYTA 4RO0A 1PYSB 2EKYA 2BMBA 1CEZA 3G82B 1PBUA 1VQ5S 2WRMA 5KFDA 1F9EB 4USVA 1SJ1A 2EBEA 2W25A 3GIMA 1M5KC 3IAM9 4RX6A 1VQPS 2UUBJ 3KK2B 3QJLA 3M9NB 2BV3A 4IG0B 1LWEB 3PZPA 2KRBA 4QWBA 4NMLA 1UFWA 2ALZA 1BQXA 4IFVA 4K8RA 3T9NA 3BS9A 4WFYA 1ZETA 1U45A 1VRTA 5E3QA 2CA9A 3DGPB 4KPCA 5IOLA 3QRQA 2F1FA 4RKUC 5KFPA 3AXMA 2KG1A 3BBCA 5F8NA 3K8WA 5CQGA 4J9OA 3CEDA 2M0GB 1BHNA 2KVQE 4B3OA 1EKSA 4QWAA 2GIFA 3D6HB 3TUJC 1MWZA 1RWXB 4OX6A 2IJFA 3BPDA 4PWDB 2DCUB 2UUCJ 2AYGA 3OSNA 2X1GA 3PACA 3CJKB 2CJXB 4CO2A 2PFFB 5GAGU 1RTIA 2GJFA 4J9KA 2MKKA 4ECSA 2HEKA 1SL1A 4ZCLA 3MUTP 3G8QA 4TU8A 2B4UA 5E3PA 3C6TB 1D9FA 2V2VA 2QMWA 4B9SA 1HLWA 4EYIB 1SJ3P 1F5BA 3BDPA 3K5OA 3OJSA 3FSIA 1N32F 3MEEB 1RT5B 4ETXA 1K1QA 1IR2A 3GIJA 3BQ2A 3TA1A 3VAHA 3T1AA 2A3JA 3OL9A 2HBZB 3CCUS 3K58A 3AQPA 1R3NA 3S01A 3E01B 1T9WA 3HKZD 1XC9A 1YX2A 2G2OA 4WXWA 2BKNA 4J9PA 1KTVA 3JYTA 1ZOTA 3IA0A 1XK8A 1WEZA 2HLTA 2LXUA 2X3DA 2J7WA 2VA3A 4PQUB 4G6VB 1HQ2A 2Z30B 2RDJA 2XB2D 3MPDA 4LSLA 2UU9J 3H7HB 5KT4A 3N4WA 2DPJA 1IKVB 3NWRA 2Z57B 2C42A 2DNMA 1D9DA 4UOFA 4P52A 4ZJQA 4PKDB 2Y0BB 5CZVA 1BUXA 2C2DA 4ID5B 1TL3B 4DR4J 2M52A 1X9SA 1RHQB 1K0TA 1M0SA 4HH1A 3N6MA 3J81j 2Q79A 3MM7B 2AX1A 1KFDA 2HBYB 2H54B 1L3VA 1N5VA 3P4UB 2GGPA 4LT6A 3N9UC 5IQQA 4I2QB 5IZHA 2DHGA 1FKPA 2ACMA 3H2VE 1NU4A 2J0QD 2FJAB 2J9DE 3N5BA 3CJQA 5LJ3Y 1YJ9S 3TZYA 1HIYA 2EK6A 3DRYA 3FMBA 3PJXA 1DZ5A 2GZOA 4U96A 2DNOA 5J2MB 2XI3A 3K59A 1M5OC 4F4XA 3R2DJ 3W5ZA 3FSXA 4PPDA 1H2TZ 3M1VB 1DQAA 1T02A 3HO1A 1NH8A 2QTWA 4J9MA 3H25A 1NJZA 4P72A 3TWZA 3DLEB 4BWJA 4ZPAA 3OHBA 2UUWA 1JWWA 3PM9A 3U02A 2XNQA 3JS9A 3HSJA 3OVBA 1VRUA 4B9MA 1QAIA 4JI1J 2XEXA 3CDBA 1VC6A 4JI5J 3O6QA 3C6UA 2HYIB 3O1LA 1F3VA 4PR6A 3UO0A 2MZ1A 3PRBA 5JVGQ 5M2PA 4KGVB 2E9TA 3OTBA 1GTHA 3GYNA 3NS5A 4GVLA 1Q8BA 3ZZTA 1WWHA 1JJ2R 1XR5A 1FK9A 4IH6A 4LFCF 1UVIA 1TKZA 2CIMA 4JOUA 1NK5A 3D9BA 2GO8A 4RUAA 2UV8G 2XC9A 2MZTA 2E7WA 3WC2A 5T14A 2K1RA 3UVJB 4OL8A 2DY1A 5BYRA 5LMNJ 4LF6F 1NKCA 1S10A 4R25A 1RA7A 1SKUB 3CD6S 3LALA 1JJCB 1TKDA 4CI0B 1L3UA 1N48A 2VONA 4GRSA 2P6TA 4RW4B 3UDVA 2W7PA 5J2PB 5IFMA 3MR7A 2CVIA 4HHJA 1TU0B 4TKTA 2RF2A 2UUAF 1S0NA 4EFAC 3BO2A 3RB3A 1X9MA 3SIPB 2GAHC 4NA3A 1ZM3A 5DDPC 4XTTA 2ZM6J 4DQQA 4CLZA 2YKNB 5DRKA 4C8KA 3L95X 1PJ5A 3AB2B 3NNHA 2ZH5A 3PW0A 4NXMF 2ACYA 4ZN3A 4R8UB 2HHVA 1PIEA 1B7YB 4USJC 4USKA 3MCNA 1VBXA 2DGTA 3THVA 2MJNA 2KXNB 3T1HJ 3WDOA 1WKLA 3I0RA 3BGFA 4WCEQ 1JXLA 4OLOA 3NMAA 5C25B 4RNFA 3GJSB 4AT1B 5GAEU 2I8EA 4K4UA 3UD3P 2ZDOA 4ZS6A 3US5A 2UVUA 4Z7CA 5KFLA 1IBMJ 3CC7S 1R8HA 3B82A 3G8TA 5HLFA 2R8JA 1LK7A 1UFLA 4AQYJ 4YB6A 2NCKL 4B17A 1VQLS 1TMMA 1SKRA 4WFAQ 4DUYJ 1VK8A 3CVKA 1JLGA 2X3GA 2OLWA 5H9EK 1NKBA 1S1UB 1K1SA 4LRFA 3DDNA 2KYXA 1WSRA 1VQKS 1MU2A 4X65J 1TVRB 4OIXA 3D28A 3SYZA 2GHVC 1PKUA 2IYIA 5RUBA 4DF4A 1FRJA 1SC1B 3PO5A 1G7CB 1HNVB 1LW2A 2U2FA 3ZZOA 4NCBA 4ZP6A 1TUGB 3C66A 3ZTSA 3CO0P 2IM2A 4MT1A 4USUA 5L9XA 5EUHA 4RW7B 3QT6A 9ATCB 5HK4A 1TKXB 4RBVA 4ILMA 1RWKB 1ZYQA 4C9DA 2R7SA 3EZ5A 2GIQA 4I7FA 1UEVA 1KQKA 2R42A 2YNHB 5D0EA 4FF1A 4Y3CA 1TKTA 1KC8T 1S6OA 2BR0A 2X7IA 2ABYA 1CS4B 2ALYB 4H4KA 3G4SS 4RW9A 2XYPB 1G2EA 5KFQA 1TK5A 6FDRA 3MAHA 1RZMA 5E41A 2C2RA 4QCLA 5ETVA 5D0HA 5A8WA 4Y65A 5FJ4A 2EFQA 4YFUA 2Q1LA 2ZBQA 2WVFA 1P1TA 1RYRA 3MPVA 3J81U 1Q8IA 4DX5A 1RTZA 4IG3B 1LK5A 3UCUP 3H5SA 1NDKA 1NDCA 5F8GA 4N8OA 2COLA 4NX9A 1SB6A 2ZC4A 4P7VA 1DHMA 1UW4A 5KG0A 4OYBA 2KTQA 2B4OA 4C0BA 1EQMA 2AJ1A 2HHHJ 1NRKA 4OYAA 1IVZA 2FHOB 1FD2A 4EUVA 4ZIVA 3VAGA 4RW8A 2VD3A 4YDDB 1SIZA 1NZAA 5D4OA 1LWFA 5HBMB 2DXEA 3ZTQA 3MEDA 1RT2B 1R6YA 3BGOP 2B4VA 2IIHA 1HBOB 2MMYA 3M2RB 3A8KA 5ETNA 2FLOA 2FZGB 3WHIA 4DSLA 4LQ3A 4LFCJ 1YGYA 1JMTA 1F1BB 3DRPA 3J7Z5 4M1KA 4PXBA 4DR5J 2V4JB 2NUHA 4NYZA 4BLGA 2D9OA 4CCHA 2B9YA 1YTYA 2AJQA 2RVJA 2VC1A 3EDRB 5DS7A 3F56A 2BDPA 1W25A 2DGVA 3CJSA 2LFVA 2BVZA 1RT7A 2E9RX 4DX6A 5DGBA 3HLUA 2ATCB 1HQEB 4DR3J 4DG1B 2RAQA 4ZPWR 2A18A 3ISZA 2HK2A 4HI1A 1N36J 2XLJA 3I56S 1PAEX 4WYWA 3MMCA 1RLCL 5J1PA 4HKQA 2K06A 4AXIA 4ECQA 3DLKA 2AV5A 3IC1A 1VC0A 2XMMA 4F04B 3OV7A 2NZ4A 2GA7A 4LF7F 2HVHA 4Z7YA 3RR8A 3KG1A 2XS5A 3BSAA 2AIRB 4EWTA 3QIPA 4DR6F 2ZE2A 3QSYB 1IXKA 2WTFA 3SCIE 3G82A 3HHDA 1YZ7A 1JLCB 2BJ1A 3IWNC 2QL5B 1DARA 3F41A 5I3UB 2EPIA 1NK7A 3KK2A 3HD2A 1XERA 2LA4A 1LWEA 3KMQA 3LWMA 1S59A 4LIRA 1FFGB 3DU5A 2L08A 1A0OB 1OY9A 1FVSA 4DQSA 4CLPA 1XNRF 3PNIA 2CDQA 2F8EX 3EXCX 2WSEC 1IUJA 2R2TA 5KT6A 1S48A 3DGPA 3MR6A 1S0VA 2RU3A 3FDSA 3MEGB 5A8KA 2V9KA 2VFVA 4NZ0A 3OLBA 3H59A 1ITPA 1X4HA 4RBTA 4EMDA 2A2DA 3IGVA 4LVNP 5B0CA 2W4CA 2XM3A 3D1QA 1MMNA 1OSDA 3GSIA 2QSWA 4Y2AA 4AE5A 4HTIA 3IO1A 2DT9A 2J0SD 4NLDA 4CLKA 5EX0A 5KG5A 3ILJA 3I5BA 2WVDA 4K5SA 3I0SB 3P5BP 4LF4F 1NB2A 2YXLA 3GZ7A 3FBEA 3HVAA 1V3RA 4DV0J 3BGLA 5C7PA 1HWIA 5THWA 4M5MA 5HVGA 1F0XA 1JKHB 2XHCA 3TAMB 4ZLLA 1NK9A 3C6TA 2Y3YA 5KFAA 5HANA 1HNWF 4B3MF 2KM8C 1FF2A 1UWBA 2RU9A 2OSQA 1RT5A 3MEEA 1DTTA 3PX0A 2RILA 1S9EA 4NZ7A 1O0PA 5GADU 2VG6A 3TQ1A 1AT1B 3QAEA 2EFNA 1RP5A 3TARA 1DQ9A 4M95A 1T9XA 4MK9A 2XY7A 1Q16B 4WPAA 2CQHA 1GXTA 2A2CA 5CH7B 2VA2A 3PX6A 3FUYA 4OYOA 1Q81T 3DLBA 1RCXB 1IKVA 5K8PA 3AHPA 4O44B 1FKAF 2CPDA 3T5JA 1IKYB 2XMUA 4CYUB 3VAIA 4AYBD 4LF8J 3VF0B 4X62F 1URNA 1WKJA 3IP0A 4LUBA 4OI0A 1PYOB 5HVFA 2YKMA 5EDWA 5DZ6A 2JEJA 1LFWA 3M6WA 3NMRA 4J9SA 3CJ5A 2Y0SD 4G1QB 3NG8A 1NPPA 4U7CA 3MM7A 1NLKL 3K5NA 4WFZA 5F9LA 2MQQA 1WKKA 2ZJPQ 3X1LB 5KFZA 2J0WA 2YWWA 4YB1P 1Q86T 2V9WA 4GVBA 3NGUA 2OKQA 1T3NA 3Q8VA 4OI4A 4FN5A 3FMWA 4GKKF 4QWEA 3OFHA 3T1YF 2ILYA 1KRPA 7FDRA 4DUZF 5HJYA 3S8SA 3EICA 2ZKUA 3O5TB 1VJWA 1YBAA 2DGUA 2RDIA 1HMVB 2RKIA 2XTJP 2NYHA 1BLUA 2W4PA 4AXJA 3M1VA 1HI8A 5G0RB 5L1IA 4GKJF 1RI7A 3R5BA 1RQ0A 3DLEA 3HT3A 1WTFA 1RT6B 3HHNB 5KOXA 3IR7B 4XK8C 4CRJA 1J5OB 2E5LJ 2IJRA 4YQWA 2CJBA 3CE8A 1HWUA 1HA1A 1XJWB 3DDKA 3DOLB 2MHEA 2YKPA 2JEGA 3D6FB 4R5PB 4YHHF 3AOCA 2JEIA 2W24A 1AZSB 1C2PA 1Y5LB 1CULB 4LMZA 1B0VA 1LNQA 4W4MA 3KLVA 1ZAVA 3ZO7A 3N0VA 3OTOF 4ZPCA 4DR6J 4JBCA 4NOHA 2D41A 4O3OA 2IRUA 5CYQB 2L48A 3HHLB 1CJTB 1M5SA 2XS7A 2LYVA 3SQOP 3NNAA 4DX7A 4OZ3A 4G1PA 3DOMB 5L8RC 4L6V3 1Y00A 2RD5C 3PKYA 3HSGA 2ZVIA 2LQJA 1EETA 1O5JA 1IQTA 2GIRA 4K0KJ 1C1CB 3AJ2A 1WC3A 2JX2A 4PG6A 3VGVA 1YIJS 3BZQA 2CNNB 5H9FJ 1V3ZA 5J2PA 1I5OB 3OTDA 4O4GB 4K4ZA 2HS3A 3D0GE 2RT3A 4OLPA 2FHKA 3QMQA 2D3O1 2YVSA 3FEZA 1KNZA 3IWXA 4PG8A 2MJUA 3H5YA 3GB0A 4LQ9A 4LF9F 2N7CA 5LMUJ 2YKNA 4OX7A 4J9VA 1U8SA 1FWKA 4UUXA 1IM6A 3VZHA 4KPYA 3BR9A 2QFJA 4R8UA 2YY3A 5I3QA 3VVUA 1S7IA 4DV4J 3H90A 1HD0A 2XWYA 1B3TA 2C2NA 4HEA9 4WFBQ 2QGFB 3MAAA 1CG2A 1XN9A 3HF5A 3VGUA 3H0PA 1N6QB 4HACB 1IBCB 3TAQA 3D54A 2XY5A 2ROPA 1NPRA 4NZ6A 4N8NA 2FVCA 4QZVB 2B43A 1EHWA 4WK3A 2C2ZB 3TA0A 2KXHA 4ZITA 3S1TA 2RE1A 2NSCA 1UAWA 1R31A 3QWPA 1PC4A 2NR0A 1FVQA 4TVAB 1HD1A 3RG6A 1PJ7A 4KV8A 3KG4A 5IT9Y 4ILLA 3K2YA 2WVBA 2R7WA 1YRTA 2V8HA 1S1VB 2J5AA 4AL7A 1NJXA 1S1UA 5IQ6A 3P3DA 1WELA 2Q3PA 1MNEA 3VGSA 5DM6Q 2KH9A 1TP7A 5B09A 3P96A 3ZZ0A 4OV1A 1YJUA 4CNZA 3POTA 4DR7J 4J90A 2YNFB 4AUKA 1RT4B 3RB6A 1YDLA 1A7GE 3Q8UA 3W8GA 1RTJB 1HNVA 2V0NA 2CQBA 4RW6B 4A8XA 4JP8A 3TX0A 2VBWA 3NEKA 4JV1A 5CHCB 1TKXA 4O4RA 4ZP8A 1RISA 4IDKB 1U0HA 2NS1B 3AFGA 4KB7A 3CC4S 1URRA 2JZ5A 2Z2YB 2V8PA 2YNGB 4ANCA 4Q2MA 4YOEA 4EBEA 1U1NA 1FRXA 1EAYC 1RBLA 1ZM2A 1TK8A 1DJ0A 5AJ3J 4U67Q 1CJUB 1FDBA 3KTQA 1IKXB 2I9SA 2QO3A 1N5SA 3KNAA 1VDHA 2OP5A 2LCWA 1SVDA 1FERA 2IA0A 5B0GA 3GQCA 4JYAF 1RCOB 2BJDA 3NAHA 3CXCR 2BXJA 3CO9A 1M5PC 5CYMB 5IWAF 5CZXA 3DM2B 4TQRA 2QYGA 5MLCV 1RT1A 2GHWA 5BXIA 3DXBA 3IR6B 4WP8A 2ZUGA 3TP2A 4ECTA 1W2IA 4WYLA 4I6YA 2M4MA 2O3DA 4MYUA 3TVKA 2DRDA 3IM9A 2HG4A 1LWXA 1T11A 1Y10A 4YN3B 4J91A 5K8NA 3FZ2A 1TZ0A 4I6WA 2J6UA 5HBMA 3QGPA 3CW2C 1VLOA 2FPHX 1RT2A 3OUYB 3Q8QB 1T94A 2XZWA 2DBBA 3M2RA 2ZBRA 3RRGA 3NGKA 3PTWA 3DLGB 2B4PA 4QR1A 2KT3A 2V4JA 1QVGR 4LRCA 4FS2A 3M05A 2QLBB 4TY8B 4KE5A 3DXSX 2C2KB 2QZ8A 1UVLA 3GV7B 3NGSA 1B4SA 2I0XA 5C2GA 4X4SA 2AYMA 1TV6B 2K8GA 2KDOA 5KFXA 3OL8A 3RW6A 1BE4A 3KHHA 3W2VB 5KFCA 4K50A 2MY7A 3M8QA 4HTJA 3MUVP 4DG1A 5BYQA 2RHSB 1UPPA 3QWUA 2M8DB 1HARA 4NMXA 4V1Ak 1E6YA 4TU7A 3MCMA 4L74A 3TUIC 3CCSS 1P6TA 1W7WA 2MZJA 2JJ4D 4IH5A 3N28A 4ZHRB 1REVA 2HAFA 3RBXA 2VJVA 4TQSA 2DNKA 3L9ZA 3L4BC 4EO6A 4IQMA 4J9LA 4GC6A 1T8EA 1QAJA 1XNQJ 2EC2A 2QIFA 4O3QA 1NM2A 3HFVA 4F0KA 5CAAA 4ERDA 1JLCA 1EB0A 1OYEA 1SC3B 1S1XB 1IKWB 4F2RA 2FC8A 4YS2A 1VRQC 1YQHA 1VQ4S 3PW5A 5AE1A 4KGKA 2BA9A 3JTOA 3BBBA 3GTYX 2FDNA 1HHSA 1OPZA 3FJ2A 3IBWA 1SXLA 4KGXB 3KJFB 3VWSA 2F4VJ 1TL5A 1NSPA 2A1BA 2HFZA 1VQ8S 2MKHA 6FD1A 4PXDA 1XBWA 2BQUA 5E5NA 2KT5A 2IY5B 1UVJA 2AQ4A 4OZ2A 1NJIT 2XBPA 1JNZB 1JJHA 4GO7X 4CH0S 2ASJA 3I0SA 1G1XA 1WACA 2BABA 5E7OB 1MN7A 1PBAA 1PAUB 3EXYA 1UMJA 5HAOA 2VOPA 4IRCA 1HWKA 4EGLA 3KJVB 1J5EJ 1K0VA 1VQMS 2FB0A 2HRYA 3PYDA 4JI7J 3LP2B 2H5JB 4PABA 3M2UB 2HFUA 3GCXP 2J8SA 4EBCA 1FFSB 3JXOA 1FX4A 2NLWA 5D3GB 5KT2A 1Y9OA 5U47A 4F4KA 2WZ1A 1AUSL 2WSCC 3CJ4A 3LPYA 1BD6A 1XQIA 5AE3A 2XMJA 3MTKA 5HMWA 1C0UB 3B4DA 5F41A 4DV5J 2CPYA 2JRSA 3ET6B 1VC5A 5J1EB 2GQ2A 3KJNB 4DR1F 4PCQA 1S57A 2BQ3A 5IWAJ 4KO0B 3I55S 2HQIA 5A2QU 2OFGX 3KLHB 3EM1A 1FKOB 4PWWA 5DO2A 2LEBA 4DV7F 1RHUB 3K5PA 5KFOA 3Q2TC 4WIQA 1RWWB 1P9YA 1ROFA 3G8SA 2LP4A 1ZM9A 1BXNA 2DR7A 4OZ1A 3A8JA 2V67A 2HLUA 5C42A 1RAHB 3NGTA 2CDRB 4QYRA 3U27A 2XWXA 2IVMA 4G1QA 1NMEB 2DNGA 3RRKA 1HHQA 5DQGA 4IOAQ 2E5IA 3H8YA 4DV3F 1HPZA 2D7SA 4X64F 4P2MA 4LRDA 4M5LA 1NK8A 3M9OB 3GFHA 3JSYA 1WD6A 2CQGA 3EX7B 5IM0B 3HM9A 3RTVA 1HYSB 3M8PB 3NP5A 3O44A 7FD1A 2GMLA 3KHGA 1RSCA 1HMVA 5CD4H 3RZAA 2J9DA 1TTHB 5FD1A 4Y0FA 3BSOA 4C8ZA 3CDAA 5H9EJ 4FPIA 2HS0A 3KWMA 4UOCA 2F65A 4JI3F 1RT6A 2QJ3A 1WSVA 3FK4A 5DZ7A 1J5OA 2WW8A 4JI6F 3S6EA
chains in the Genus database with same CATH topology
1CVJA 1TKDA 4XDDA 1OPIA 4CI0B 3CJKA 3KLFB 4IR1A 4DV5F 1R0AB 4QBUA 1SJRA 2JVRA 3IN5A 2UVWA 2ZHOA 2M5YA 3BSCA 1N48A 1L3UA 1GX5A 2VONA 1S1XA 5E2QA 3DRPB 2P6TA 4RW4B 5KFUA 2W7PA 1QE1B 5J2PB 2QE5A 3U1NA 5IFMA 1YJNS 3V6JA 4HDHA 4FXWA 2PSZA 3CF5Q 2CVIA 4WKYA 1FRHA 4HHJA 4PWUA 4TKTA 2RF2A 2UUAF 2C3UA 5DDOC 2G13A 2N3LA 1S0NA 2R2SA 5EN1A 1FJGF 4EFAC 3OFFA 3FEXB 4B9UA 3BQ0A 1Z4UA 3BO2A 3SSSA 3RB3A 2IA6A 2V5HG 2ASDA 1M5HA 3UCGA 1X9MA 4Q44A 1MSWD 3CC2S 4KR0B 2PD1A 1RTDB 2PMHA 5EGYA 5EWEA 3FQLA 3O2IA 3O3LA 4X4NA 4Q2LA 2XCPA 4Q45A 4QPTA 4NA3A 4C97A 5A2QY 4LFAF 3BGUA 3LGMA 4IYQA 3K57A 1ZM3A 2VG7A 1RT7B 5DDPC 4DQQA 3HHLA 1FE0A 2V4QA 2YKNB 5DRKA 4C8KA 3QIDA 2PGCA 3L95X 3CDEA 5J1NA 4DX8H 4DDFA 3JTPA 1V6HA 5T7LA 1JLEA 3AB2B 3NNHA 3RB4A 2ZH5A 4ED0A 3E01A 3PW0A 3MF5A 5AXMA 1GT8A 5HMZA 4NXMF 2ACYA 2XMKA 2ZHBA 2AYEA 4R8UB 1WEYA 2HHVA 4RUHA 4B3RF 1VQ6S 2LMIA 3M4XA 2XLKA 4NYOA 2JC1A 2ZZNA 4ES1A 4USJC 4JI1F 3VQSA 3FVYA 2AGPA 1APSA 4QW8A 3FEYB 4JI5F 1JLAB 1X5PA 4NLUA 1VBXA 2V8VA 1T7PA 1CLFA 3DLKB 1K9MT 4DF8A 2XMTA 2DGTA 2X1AA 1R8PA 1U1PA 4PQUA 1IJEB 2H9ZA 3THVA 4UY8T 3DOKB 3W2WA 1QLNA 5F8JA 3KNGA 2EG1A 2MJNA 2OD6A 2VBYA 4F67A 2JEFA 1YHQS 2ZOMA 2KXNB 3EUNA 5F3ZA 3RAQA 3IRXB 2QEXS 1ZZNA 1YSJA 1L5UA 3WDOA 2FGCA 3LP0A 2HPUA 1GNKA 2YWFA 3I0RA 3BGFA 4WCEQ 1VIOA 2D74B 1JXLA 1JB0C 4OLOA 1S1TB 2L3MA 3NMAA 2HNZB 5C25B 4RNFA 1X7VA 3MMBA 2AYBA 4HVZA 4OZLA 4E0DA 1R8CA 3I4PA 2JC0A 2CZVC 2DO4A 5GAEU 2V8GA 4O4GA 5ITHA 2I8EA 4K4UA 2UP1A 1N8RT 1N5YA 3CTRA 3SMZA 3MD3A 3UD3P 2ZDOA 4ZS6A 3US5A 2UVUA 2C3OA 1X4AA 3QIPB 2DR8A 1S7HA 2OPRA 2YX7A 3I82A 1VMBA 3TAPA 3ISNC 1X9WA 2ZNYA 4PXCA 4WK1A 2ZE2B 1S4FA 3M2UA 2Q6CA 2W4DA 5KFLA 3ENQA 3PX4A 4NYPA 2CQ3A 4CO5A 1YG0A 2E1RA 3EYZA 4ELUA 1R89A 1UA1A 3G6YA 4NRTA 3SSRA 3CC7S 1SIWB 2Q43A 4ID5A 1R8HA 1TL3A 3B82A 1ZZFA 4KT0C 3DRSA 3DRXA 1O51A 4WTYA 3G8TA 5HLFA 4C11A 2R8JA 3CULA 2R7OA 1LK7A 1UFLA 4A8YA 4IO1A 1N5TA 2HVIA 4AL5A 4YB6A 2BUNA 4FF4A 2HHTA 2MQPA 3H4DA 1WF0A 4B17A 3RU0A 3QO9B 4DLGA 1VQLS 2MY8A 5LMNF 5SZTA 1SKRA 4WFAQ 2UXCF 2JVOA 2YKOA 1VK8A 4NCGB 1UVNA 4BBYA 2N3OA 3P5TL 3CVKA 3QLHB 2N4CA 1JLGA 4XPEA 2X3GA 2M7SA 2OLWA 1N34F 1NHUA 4NWBA 1MW7A 1NKBA 4J9RA 1S1UB 1P1LA 5LJ5Y 3SFUA 2C22A 1K1SA 3CJ2A 4UQGA 3K5LA 3DDNA 1S9FA 2FHJD 4QQBA 2KYXA 1F60B 3K8VA 3GR0A 4I2QA 3JSMA 2R2UA 1VQKS 1MU2A 2DH7A 3C2PA 3VAMA 2I1RA 5A8KB 1M90T 1TVRB 3PIPQ 1JK9B 1XR6A 1FRKA 4OIXA 3D28A 3PFOA 2BACA 3WBZA 3SYZA 2ZZMA 2GHVC 2IC3A 2CZ4A 2IYIA 3EZUA 3IXQA 3OR1B 3CCRS 2HFOA 1UVKA 4NLWA 2EBGA 2F7VA 4OHVA 4DF4A 5J1EA 1FRJA 2QA2A 2RS8A 1W2BR 1S1WA 3SFGA 3PO5A 3IFEA 4JI8F 1G7CB 1HNVB 1LW2A 2U2FA 3T19A 3ZZOA 1S6UA 1VI7A 4NCBA 4ZP6A 2POKA 3C66A 1F5CA 2BM1A 3KLHA 2IM2A 1FKOA 2OPQB 3U1LA 5L9XA 1Q1KA 5EUHA 1XMOF 3HI9A 4K4XA 5J2MA 4RW7B 2ZBCA 4N56A 3I87A 4FXDA 2KRRA 1TKXB 4ZOSA 4RBVA 2J7UA 1S6QB 1I1GA 1U1MA 4ILMA 3J7YI 4ED2A 1ZYQA 4C9DA 2R7SA 3EZ5A 2CQCA 5KFVA 2FVSA 1FCAA 4O3SA 2GIQA 4I7FA 3OR2B 1UEVA 1KQKA 2GC8A 4RWXA 3T5HA 3JAMY 3DI6B 4I67A 2NQPA 5CCLA 5GAGI 2YNHB 2ZM6F 1QUPA 5DDQC 1C0TA 2X1BA 5B08A 2OPPB 3I31A 3HHLD 4FF1A 4M94A 3MMAB 4Y3CA 1TKTA 1RGVA 2FJEB 2BBEA 1KC8T 1B7FA 4QOTA 1S6OA 2VQFF 2VH7A 4Q0BB 2P9EA 2FC9A 4BCAA 2BR0A 1X4GA 2F9DA 1TL4A 4AL6A 2ABYA 3QAUA 1S49A 4H4KA 4L72B 4F2SA 4C7QA 3MM8B 4LSNB 3G4SS 1HBMB 4RW9A 3BR8A 1G2EA 3FQKA 5KFQA 2WOMB 2YWKA 1TK5A 4QU6A 2FLPA 5CA5A 3MAHA 6FDRA 2DNRA 5E41A 2C2RA 2IHR1 2VPXB 3PR5B 4QCLA 4R0JA 2YWEA 4Y28C 2C2EA 3MI7X 2VG5A 5KOWA 1NNDA 2WONB 2MHNA 5A8WA 4ECYA 1H7WA 3L09A 1NJWA 4JI4F 2BE2A 4Y65A 5FJ4A 5KFNA 4X66F 1VOMA 4M5DA 2EFQA 4CO4A 1WHWA 4WU2A 4YFUA 4C8OA 2Q1LA 2MKIA 3FCHA 4TYBA 3T1HF 1IBKF 1UWBB 4I69A 1DTTB 1H7XA 2HNDB 3M6XA 3OTCA 2BOPA 1ZTTA 3DRRB 1P1TA 2F8HA 1RYRA 2VOOA 3MPVA 1Q8IA 2CKWA 4IG3B 1LW0A 4KKOA 5F0WA 3GIKA 1LK5A 1S9EB 2EW9A 1T95A 5L1LA 3UCUP 3H5SA 3BEGB 4ZPBA 5A0YB 3BDEA 2VG6B 5DG7A 3H5UA 2IM0A 1U7LA 2GCFA 1SI9A 2VC0A 2Q6BA 3M8PA 5F8GA 1S9GB 5HN0A 4N8OA 2COLA 4NX9A 1SB6A 4U7UK 5HMYA 2ZC4A 3AH6A 4P7VA 3GFYA 2FJXA 1DHMA 3M6UA 1UW4A 5KG0A 4WIIA 2MKSA 2KTQA 4ALZA 2B4OA 3MUMP 2W7OA 2D1CA 4C0BA 3CD7A 1U1KA 1IBMF 1FJEB 2AJ1A 3V81A 1TAUA 3GR1A 4MJKA 1VK3A 2YWHA 4OZJA 2OPSB 4CO1A 4IDKA 4KTQA 1VHFA 1NRKA 2QA4S 2FHOB 4RWWA 1FD2A 4YB5A 2XMWA 1U09A 4ES3A 2W8KA 4A8QA 4B02A 2KT2A 3OFGA 4EUVA 4AQYF 3VAGA 2HHWA 1PSDA 5DLGA 4DV2F 3M2VA 4DQIA 2EFVA 1DFDA 2I38A 1U1QA 4RW8A 2VD3A 1U49A 4YDDB 3G6VA 1SIZA 3BB5A 3B8HA 3PY8A 1NZAA 2VPYB 1HW8A 5KFMA 5D4OA 5HP1B 1T03B 3KYLA 1LWFA 1F9FA 4CT9A 4DUYF 3TANA 1HFEL 4WFXA 2MQNA 3J7A1 5HBMB 1CC8A 1FDDA 4DL5A 4MFBA 2ZH2A 2PN6A 3BN4A 1KOOA 3MEDA 5J2QB 2IM3A 1SH3A 3QZ8A 5L9NA 1RT2B 4KFBA 4OHYA 1B0PA 1R6YA 3R3TA 4QU7A 2B4VA 1SUQB 1HBNA 2RRBA 1HBOB