1G6BA

Crystal structure of p47s mutant of ferredoxin i
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCESECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords 7FE FERREDOXIN I
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1g6bA00
1VJWA 2V4JA 3IR7B 3MM5B 3MM7B 4OMFG 1WTFA 1JB0C 4ID8A 1C4AA 2XSJA 1G3OA 1FRLA 3IR6B 1H0HB 2V4JB 2FJBB 7FDRA 3MM9B 1KQFB 2IVFB 2WSEC 5CHCB 4AYBD 1FXDA 1DURA 2Y0SD 3MMCB 2WSFC 4YDDB 4OV1A 1SIZA 1A6LA 1DFDA 3OR1A 2ZVSA 3PNIA 1RGVA 1H7WA 1Y5LB 1FRIA 3EUNA 3MMBA 1B0VA 1FDNA 1PC5A 2C42A 1H98A 1IQZA 2FDNA 2C3YA 4DHVA 5E7OB 3LW5C 3MMAB 3IR5B 1Y5NB 3C8YA 1FD2A 4KT0C 3MMBB 2C3PA 1B0PA 2C3MA 7FD1A 2FJEB 1FDDA 1JNZB 1FERA 1FRXA 1GTHA 5FD1A 1PC4A 2VPYB 1FTCA 3EGWB 2UZAA 1GAOA 2VPWB 4L6V3 3GYXB 1KEKA 5CH7B 1BLUA 2FJAB 1F5CA 2XSJB 2O01C 1Y4ZB 2VKRA 1K0TA 4XK8C 1BC6A 2GMJA 2PDAA 2PA8D 2GMHA 1FDAA 1FEHA 1BD6A 1AXQA 1HFEL 2V2KA 2FJDB 5BYQA 2PMZD 1FRMA 2FGOA 1GT8A 1FRHA 1FCAA 3OR2A 1F2GA 2Z8QA 1Q16B 3MM8B 1BQXA 4Y28C 2C3UA 1G6BA 3MM5A 1BWEA 3MM6B 1DAXA 2C3OA 1GTEA 3EXYA 3MM7A 3OR1B 1H7XA 6FDRA 1FRKA 5BYRA 1FDBA 1D3WA 2WAQD 1IR0A 1R27B 3MM9A 5L8RC 5BYSA 1B0TA 1XERA 2WB1D 3MMCA 3MM8A 1FF2A 1Y5IB 1CLFA 2FD2A 1JNRB 1KQGB 1FXRA 1ROFA 3MM6A 2VPXB 1SJ1A 3HKZD 1F5BA 1C4CA 2WSCC 1FRJA 3OR2B 3MMAA 4RKUC 4XDCA 2VPZB 1SIWB 4XDDA 4CI0B 6FD1A
chains in the Genus database with same CATH superfamily
2BJ9A 1IBLJ 1WKKA 3SDEB 2V4JA 3AOAA 4TN2A 4F3QA 3QJJA 2CAJA 2XSFA 3AJ2A 4L73A 2AX1A 2GO9A 3MDFA 2EEYA 1REVA 4U9RA 1FRLA 3MWBA 4RBUA 4F04B 2R8IA 5D15A 1N5YA 1WJ9A 2M8HA 3D54A 3IG1B 2J9CA 3R9LA 3VGTA 1I6JA 4B3RJ 1S97A 3QLHA 4D3HA 2JJ4D 3W5YA 1EARA 2IAJB 2MZ1A 3G6XA 3MCOA 1DURA 2B4PA 2EG1A 2YWFA 5G4DA 3TVKA 1CJTA 4HH0A 4K4TA 4RW7A 1UW9A 1FTRA 1TKTB 2XHWA 4M5NA 3JSBA 3J7YU 1UL3A 2VG5A 4HDHA 4MFBB 1S1TB 3M2VB 3GIJA 1FNMA 1WOSA 4Z37A 4Q0BB 2OPPA 1KD1T 4C4WA 2IJFA 2J7WA 2JVRA 4DV0F 2HNZB 3PX0A 5FJ4A 3LAMA 3FK4A 3LW5C 5KOWA 1NPKA 3M4XA 5KFKA 3FQLA 3D1OA 1M5OC 2C3MA 4DI6A 1GXUA 3EZUA 1PYTA 5HK4A 3QFHA 4Y00A 1UPMB 1KSPA 2BXJA 3ENVA 3I0SA 3H2LA 2VA2A 3ENQA 4ZMMA 4GRSA 5AXNA 4ZLLA 5LXRA 2D1CA 1N0UA 1X4CA 3KKFA 2WVFA 2W2MP 3K2YA 3KHRA 1HI1A 1NKBA 1FX2A 4X4NA 4DL2A 1SC4B 3UCUP 1HBMB 2LA6A 4DQSA 4JI3F 4JI8F 2EFNA 1KBRA 4NCBA 4DV2J 1ZPWX 1OS5A 3LP0B 3K0JA 1U09A 4MIBA 2GHWA 3J80U 3FVYA 2VFTA 2YNHB 1HNVA 4DPYA 2W4DA 5IQQA 5F8IA 1MG7A 4N76A 3GV7B 2DNZA 2EFQA 3IMQJ 2RE1A 3U1LA 1O8BA 3E51A 2ZH3A 2CQGA 3I32A 1RT5B 3TAQA 3J80Y 3AD9C 3NMAA 4F36A 2UUAJ 2BABA 3L9ZA 3LP2A 1IR1A 2BJ1A 2HS0A 3DGPA 2ZBRA 3U1NA 4UW2A 4K4WA 2FVSA 1AFJA 4Y3CA 1LQ9A 3L7PA 4X66J 1X60A 1N5QA 4PAAA 5F9NA 1KP6A 1RT2B 2EKNA 1U1PA 1IN0A 4WU3A 4I2QB 1UA0A 3QNWB 2KKHA 4I64A 3OV7A 4I1TA 4UY8T 4HDGA 1MLAA 4NZ6A 2YNFA 2MQOA 1TKZB 3POTB 3IC1A 4QPTA 1ZTWA 3S8SA 3BBBA 3G82A 1IQTA 2V9WA 3DRRA 3CIMA 1H7XA 2XNQA 4OHWA 3NS7B 3OXLA 3SCLE 4YY3J 2J6TA 5D4PA 3VQSA 3WZ0A 1FDBA 1RA7A 4KC5A 3HF5A 3QIPA 1MMLA 3MGJA 5C2CA 3I0SB 3OFEA 1W2BR 4ED2A 1NJYA 1JMTA 4GVBB 1FVQA 3C46A 4DV7J 1T11A 4OHXA 3GIRA 3IGVA 3TJ8A 1RHUB 2NUHA 2DKOB 3NKYA 2HLTA 1ROFA 4P75A 2W8LA 1RSCA 4E98A 2HURA 2R7QA 3N6NA 3TWZA 1J5EJ 3BGUA 2E7XA 4DZDA 2E1PA 4WWSA 2DEIA 1YWXA 4ECTA 2YKAA 1RWVB 4FF1A 2BMBA 2AD9A 5CYQA 2YNGB 4OZ5A 4PWWA 2X1GA 4BWJA 4OMFG 2HBRB 3HO1A 1IWGA 1SCJB 4CO3A 2M0GB 2I9SA 4ID8A 1IKYA 2GQQA 4QW8A 5KFVA 2CNLB 1SC1B 3FFIA 4KE5A 3GIKA 3PW4A 1MROA 5HLFB 1OWXA 2UVUA 3D0IE 2GJFA 4L3KA 5HVHA 4WKRA 3G71S 4DV1J 5M2RA 1OY9A 2H3EB 2WBMA 5LMUJ 1M0SA 2DNKA 2CQ3A 3QQCD 4U96A 4DR5F 2XNRA 1NDLA 2CZ9A 4IDKA 4O4GA 4OYBA 5A8WA 2KI2A 2APOA 3UN2A 3D4JA 4H4MA 3NMRA 4AE5A 2AJ4A 1V3SA 2DPJA 2OIHA 4X4VA 4I6AA 4Q45A 1FFGB 2WBRA 3CCMS 1BY9A 2B6AB 2XCAA 4C11B 5KFFA 4WZQA 4ZPCA 3WIUA 2YNIB 5DRKA 4F4XA 1B0PA 3G6VA 2EFGA 1M5VC 3C14A 1GQEA 2MZRA 2QV6A 3O2IA 3HPOA 2JFKA 2R8HA 2XS5A 3M8QA 1Q4RA 1Q8IA 2VONA 2OPQB 2R7VA 3Q86A 4G65A 2OJ3A 1IKVA 1AZSA 1S76D 1X7VA 2B9EA 4USUA 4CYUA 3Q24A 4DUZF 3ZTQA 4CNZA 4UUXA 2DTJA 2FZCB 3OVAA 1K44A 4EI2A 1H38A 2HHVA 3M8ZA 3G4SS 2HG4A 3RB3A 1Q82T 2XSJB 3T19A 3JB9k 3BBFA 5HROA 4MFBA 3NCQA 2FC9A 1RQ0A 2OFGX 5DQGA 1M1GA 4ZLNA 1TMMA 1NM2A 1FX4A 2ZFHA 3FBFA 2HKEA 3SV4A 2ZZTA 3IXQA 4RBTA 4PWUA 4Y34A 4NLOA 5E5NA 4H4OB 1FFWB 1HFEL 1TFWA 3HFZB 1S1XB 1NZAA 3QSIA 1LWCB 2HIQA 4RW8A 5IFMA 2KM8C 3CDWA 3RW7A 1UVLA 3VAMA 3G82B 3H7HB 5L46A 2N3OA 1CJUA 3U7JA 5KT7A 3QJLA 4OV6A 4LSNB 1SXLA 2I5JB 3R5AA 4Y2KA 3HM9A 4O23A 3GIIA 1FJ7A 5J2QA 1V6HA 2VODA 4FYWB 8RUCA 1Y00A 4HHUA 3KLHB 2OTJS 5A76A 1BQNB 3GE9A 2A6OA 1XK8A 3BR8A 4GO7X 2ZZNA 2XZWA 3LP2B 2DK2A 4KHPJ 1KLMB 1XR6A 3D28A 5CZVA 3M1VB 5KFJA 2V50A 3OL7A 4IRKA 1YQHA 1R0BG 3OJUA 3T6BA 4QYZK 2E1CA 4PABA 3L95X 4ED4A 5LSOA 2GA7A 3AHPA 3DYAB 2CPHA 3JS9A 5FIIA 4JUZA 1RWNB 2G2ZA 3A13A 4C48A 5KFOA 2VQEJ 2BYCA 4NLYA 4NRTA 5G0RA 2VQFJ 4DL3A 5KG5A 5KT2A 1VQ5S 1WG1A 2CVEA 1MROB 3CC7S 3T5JA 3KLFB 3IBCB 2UXBJ 3MR7A 5CYJA 4ZCMA 2E5GA 4ICLA 1RLDA 5IC6B 3OTDA 1VBXA 2ROPA 4WE1A 1N52B 2FVCA 1CQNA 1F6TA 3NWGA 4NI2A 1FE4A 1XN9A 3C15B 3W5XA 5C25A 1FJGF 2RSQA 1SPBP 2DNPA 3BPDA 2FJXA 2CFXA 3AT1B 3MR2A 3VAGA 5KT4A 1TK0A 1FK9B 1UFKA 3NRBA 1U2FA 3BGLA 3UCGA 4TY9A 3PW7A 2XO7A 2MKCA 1S99A 2LLZA 1VRTA 3DOMB 5D0RA 3PV8A 1YJRA 2IYGA 3RBDA 4JI1F 4H4KA 2RJZA 4QOTA 4ZN1A 4DV2F 1ZAVA 3ISND 1QM9A 1RYRA 3TNVA 4QW9A 4CT9A 1XJWB 4A8WA 2GV1A 2CXEA 2QO3A 3QT6A 4KGVB 4LT6A 4JI6F 2V2VA 1BMQB 2VG6B 5L38A 2UV8A 4X66F 2ZM6J 2VHGA 1D9FA 3CC4S 1RISA 5D4LA 1T9TA 1V3ZA 1K0VA 1SI9A 2M9KA 3WBZA 2BRKA 3NP5A 1E6VB 1O6XA 4V19X 3NNHA 1RWKB 4CYUB 4H54A 4OX6A 4R25A 1FK9A 3EJMA 1VLOA 1FDNA 1PJ5A 2DIUA 2C42A 1T0TV 2KO1A 2KN4A 2OI2A 3NOGA 4JBCA 1QD1A 1TVRA 2FHJD 2XEXA 4U8YA 5ETKA 4LFCJ 3Q83A 2NR0A 3MMAB 2WW8A 2XMJA 4RUBA 1Y5NB 3C8YA 4CLYA 2VFSA 2DH7A 1P8GA 5A6WA 4WP3A 4ZVTB 1F5AA 1YX2A 2D9OA 2MPUA 2QLBB 3QYYA 3BKFA 7FD1A 3KJVA 1KS2A 2FVPA 2G0JA 3NCRA 4I2QA 4CLKA 4DV5J 2IA6A 1ZH5A 2ZD1A 1Q8KA 4A8MP 2W9CB 3BQ1A 2QA4S 3FCVA 3PW5A 2DISA 1HL6A 2GAGC 3HDSA 3DGPB 2ATCB 4H4MB 4WU2A 2KFYA 1VQ4S 4HTJA 2LMIA 2Y9HA 2Y1RI 2NXNA 1IR2A 2EVZA 2ZNYA 1RP5A 1I51B 3CJ3A 3DOKB 3GYXB 4HEA9 4MMOA 5CH7B 5K9FA 4LF6F 2Y8YA 1I94J 1CC7A 4IFVB 3K5LA 4DDFA 2QZ8A 2C2RA 2BQ3A 1UTAA 4DOZA 1S9GB 3MEGA 4PXDA 3PJXA 3OTEA 4ZKAA 1B3TA 1K1QA 2RD5C 4M5LA 4GO5X 3FMBA 2ZH8A 3GYGA 4L72B 5FLXU 4EZ6A 4ELVA 2EC0A 5E3RA 2M5YA 4ECXA 3KLHA 4RW8B 8AT1B 5HLFA 1YZ7A 4NYZA 1U48A 2MKKA 3HJFA 2HNYB 1IM6A 2ZKUA 2BE2A 3KHHA 2N3LA 2ZC3A 2W25A 3BGFA 5F41A 2WRMA 3TW0A 4KJIA 2OFHX 4LSNA 5A2QU 2R4FA 4G3IA 2PMZD 2QG9B 3AH6A 1UJ6A 4RU2A 2HYIB 4JI1J 1DRZA 1MU2B 1HQUA 1V3RA 4DR2F 1U0HB 4ZVQB 2VASA 2VFVA 1VCTA 2YWEA 3GJRB 3I87A 4KHMA 2BQUA 2V9KA 3DCAA 6FDRA 2MLYA 3X3UA 4RLEA 4CLFA 2UU9J 1S1VB 1MSWD 2XQCA 2B9WA 1XWLA 5THWA 3CXCR 2M3DA 2XCPA 1W26A 2QA2A 4QR0A 1NSKL 4NYPA 3K7RA 4TLQA 4RW4B 5B0AA 4DU8A 1NPPA 2VBZA 2R2UA 1VR6A 1UAWA 2PC6A 3MR6A 2VBYA 2ZEJA 3DM2A 2HVHA 1QE1B 2RU3A 1ULRA 3BKTA 4ICLB 1MMNA 4M5GA 3QZ8A 3VZIA 3VWSA 2N82B 4QYZJ 2D7SA 3PTWA 1KOHA 3RG6A 4DPTA 9ATCB 3DLEB 2V4RA 1R43A 1T7PA 1WC3A 5ITHA 5I3UB 4WJBA 1HPZA 3V2UC 3TA1A 4NASA 2C22A 1VC5A 6FD1A 5DO2A 2YKNB 4XPCA 4F02A 1HARA 2EFVA 1JLQB 1NSPA 2DNGA 2ZDPA 1Q7LB 3SCIE 2L08A 3ZNJ1 4DR4F 3QWUA 1MWYA 2DBBA 5D4NA 4B3MJ 4LF9F 2FJVA 3TUJC 3ZTRA 4NEYA 3UDEA 3F0NA 1T94A 4AYBD 1RAIB 4LUBA 4XPEA 4DZ6A 2JHEA 2R7SA 4ILRA 5K14A 5LSRA 4EK2A 2PEHA 5IC4B 5J2NB 3KYLA 1WC4A 1FKOB 3DRSB 2ZH9A 1AYEA 1UKUA 2HIYA 4DXLA 4N41A 3NL0A 2FQQB 2K2PA 4DBQA 2UVVA 4JI6J 4ILMA 4N47A 5J2MB 4F2RA 3BSCA 3GFYA 1TK5A 1PJ7A 5D0EA 5A8RA 3A3OB 3G96A 2EBGA 4B9VA 1U25A 2VFRA 4HACA 2GVZB 1QTNB 4LR9A 2BW7A 3WC0A 2E7VA 3KJQB 2IM2A 2NCKL 3JSYA 2EK6A 2AJ2A 4Y65A 3O44A 3KNGA 2ZH1A 2Y1LB 4O3RA 1F0XA 1FVSA 5DDPC 2YKPA 3VGSA 3ETOA 2RQ4A 2PFDA 2BM1A 2BJ3A 2HGNA 2VC0A 3TO8A 3IRWP 3PX4A 3W8GA 4NZ7A 4JV5F 4LF6J 3BREA 1JNZB 1KOOA 4OLOA 2HMIB 2MDAA 3MTJA 1M5HA 5ETOA 1R0AB 3EZOA 3H0PA 1YDLA 2J8SA 3SBMA 2CZ4A 3CJ0A 4A8OA 4C98A 3CCQS 2ASDA 1PO6A 3KLGB 3SFGA 2H4YB 4J5OA 1QUPA 5T7LA 3R6GB 4J9VA 3I6PA 2MLZA 5J2NA 4RW7B 4EYIB 3POTA 3SZ2A 2X1AA 1GXLA 2B8PA 2O1PA 5IS2A 3GFHA 1ACMB 2MTLA 1GEHA 4BHQA 5J2MA 4K7QA 1L3SA 3TRGA 1HBOA 2PDAA 2E5LJ 4RWXA 4RW9B 1DZ5A 5LJ3Y 4KKOA 2NUUG 2OEJA 1R6YA 4NLGA 3A8EA 1T05A 4TY8A 5BYQA 2DO4A 1JLQA 5K14B 5CA5A 1N33F 3GJSB 3DKDA 3M05A 1ELOA 1GMUA 1F9FA 2OAUA 2YX1A 4IDKB 4K4SA 2B5JA 2WVDA 1HKAA 1FCAA 1N0VC 2KXHA 2CPIA 2QMWA 2YWKA 2EWHA 5I42A 3GZ7A 4BCAA 1RHRB 4DR6F 2AMCB 4CLSA 1SH2A 2JOQA 1KFDA 1JQGA 3OVSA 1SQGA 2Q6BA 2EXUA 1JLCA 1Z1ZA 2KL8A 1DAXA 1KC8T 4AXIA 1IBMJ 4FXWA 2M88A 3OR1B 4JV1A 2HHQA 3PDNA 1TV6B 3HMJG 1AB8A 3C3LA 3MCSA 2HZCA 3OFFA 2HWTA 1TKDA 3BJYA 4B9UA 4DWIA 4V19J 3W2WB 5CYQB 4ZVUB 2K3IA 1YLXA 3CJQA 3FDSA 3M6XA 4U7UK 4JI2F 1NH8A 3LANA 3MUVP 2QN6B 1M5SA 1Q79A 1HBMA 3M2UA 5C24A 5HO4A 2DR6A 2P6SA 2R3VA 3I4PA 4Y2IA 4JI4J 1KVJA 1VLYA 1CLFA 4FYYB 4KBIA 1AT1B 1QSLA 2XULA 2B8QA 1HBUA 4DV7F 4CLTA 5E2QA 3MM6A 3R5CA 2ABYA 3AOBA 3JSMA 1VK8A 1JX4A 1SB6A 2GO8A 1SJ3P 4ZJQA 4CNYA 2GVDB 3OR2B 1C2PA 2Z2YB 1P1TA 2QE5A 3HSDA 4KO0A 1KNZA 2VBWA 4LF4F 2HQCA 4MYUA 1C1BA 4OYZA 2XMMA 3I0RB 3MMJA 4ZLPA 1Y3JA 6AT1B 3ZO7A 3VAIA 3TVYA 2J6SA 4ILLA 2GCFA 1WORA 3HSZA 1WUUA 1RTJB 3TANA 4WTYA 1XNQJ 1ZAXA 4W92B 5M2PA 3AFGA 3CE8A 4PUOB 1FKOA 2OD6A 3DLGB 2HRYA 1REVB 1GMVA 2GIRA 3P45B 3W2VB 5A6PA 2PO4A 2YNFB 3BB5A 4QZVB 1KQKA 4Y2MA 2MHEA 3E3XA 2YQ0A 5E33A 2IAJA 4DX6A 3DI6A 1X31C 4OJ3A 2AJFE 3OR1A 4DR7J 4LRFA 3MHYA 4YB1P 3KJNB 3R97A 3WC2A 3MAHA 5G0RB 4DV1F 2CDRB 3CCJS 2CRLA 2VU5A 3AD7C 3THVA 2DB1A 3OLBA 1RT5A 2NZCA 1UWBB 2PFFB 3EYZA 2DVIA 3D1HA 1LKZA 4WP9A 2VZ9A 4KY3A 5B0GA 4DHVA 2FTRA 2JSXA 4B9TA 2IM1A 4DLGA 2GFFA 3NGKA 1FD2A 2LDYA 3GV8B 4MK7A 4DX7A 2AYGA 1S59A 1ZM2A 3BSNA 2DRAA 3Q2TC 3KJFB 3OHAA 4G1PA 2B51A 3UCZP 5CABA 1H2TZ 1LXJA 2D69A 1WEYA 2ZBIA 2NREA 1UEVA 1JWWA 4CO1A 1N6QA 3LWLA 4TNOA 4DPOA 1GAOA 3N6MA 2VDIA 4O0IA 2X3GA 1JXVA 2CIMA 5JXSA 4F3MA 4YS2A 4ED0A 5LOQA 4DFJA 2MSSA 1UVJA 1I1GA 4AL5A 3QRQA 2FJWA 3EVWA 3H2VE 2CPDA 2RKIA 3E01A 3LWMA 2G0CA 4J9RA 4DSLA 4YOEA 1WHXA 3TZYA 2R7XA 1TAQA 4ELUA 3Q8VA 4Q2LA 1GX6A 1VQSA 2HNZA 2DRDA 2GMHA 5EDWA 3UD3P 2EI5A 1DTTB 1AXQA 4B3TF 4IQXA 1YJ7A 2XWXA 3QO9A 1RT6B 4N5SA 5CCLA 3TAPA 3I56S 1S0NA 2HFUA 4OYOA 1FRMA 1TKTA 3GU0A 4DSIA 5B0FA 4PXBA 4DR5J 1DTQB 3GSIA 5KFNA 1OO0B 3K89A 4HT5A 1VQ9S 2LKZA 3G8SA 2KH9A 4FKXA 1RTDA 2BE9B 3CB4A 2DGOA 2DR8A 1LOUA 1QY7A 2KVQE 3D7SB 4ZP6A 3KLFA 2DNNA 5JVGQ 1WG5A 4I4BA 2OKQA 2VOPA 1UZDA 2KYXA 1FRKA 1V9OA 1DARA 2HAIA 4XIUA 2XLKA 3KOAA 3VF0B 3ZC4A 4LF7J 2BV3A 3W60A 2BQRA 2ZOFA 5DJBA 5HQLA 2A2DA 1ZA2B 3HZGA 4OZ1A 3HP6A 3K5MA 2UUCJ 3R2DJ 2K8GA 2KRRA 2RUGA 4NWBA 4XTTA 4OX7A 3TQEA 4UT4A 5E41A 5CQGA 3ET6A 5J2PB 1SV5B 2I0XA 5C2GA 1B7FA 2UXBF 3G8QA 2MQPA 3N6LA 3HLUA 4JV0A 1X4FA 1WEXA 2PN6A 2Z2ZA 4X4QA 5L1LA 2DNLA 3K8WA 4GC6A 5DQIA 4TQRA 1SH3A 2BJ7A 2YNHA 3TI0A 2J9DA 2KVIA 3QAEA 1RAOA 1KFSA 4IOBA 3CSKA 1QAYA 1RT3B 1ZOTA 2G1HA 2VPZB 1KDNA 3L7UA 1TL1A 3W9IA 4A8FA 2X3DA 5KTQA 1H72C 5BR8J 1VJWA 3R3TA 1X0PA 5J2QB 1WTFA 1S1UA 1AUSL 4J9PA 3DU5A 3HX9A 1TR0A 2A2CA 3BN7A 2NQPA 3W2VA 3I0RA 2KM8B 1EIYB 1KVKA 3CD6S 2F63A 3B82A 4DCOB 2LEPA 3HSGA 7FDRA 1HHSA 1R0CB 2CDQA 2DEJA 2B4UA 1TZ0A 3M9NB 1L3TA 1M1KT 2RVJA 4IYQA 4ALZA 4M5IA 1CQMA 3TUIC 4QU7A 2A18A 1IWAA 1RHQB 1AUDA 3KK1B 1N33J 4F4WA 1LK7A 3R8YA 4PG5A 3BR9A 2R9LA 3PX6A 2DHGA 3PHTA 2ASJA 4F4KA 4FVMA 2XBPA 4KAIA 3ZZPA 3IBFB 2ZBPA 1SUQB 1XR5A 4R0JA 4M94A 5KFPA 3PW2A 4NLUA 2M7SA 3ZTOA 4PEOA 2W9BB 1N5VA 1DLOA 1JLFB 1NJWA 4NCGA 1FWKA 1PAEX 1XR7A 4RJVA 3W5ZA 3RAQA 2HWIA 3ZZ0A 2BA9A 2CPEA 4X84A 4U8VA 2ALYB 1UJ4A 1D9AA 4JI7J 1YRXA 1K8AT 3MECB 1P6TA 4C8OA 1VBYA 2VJUA 1IKXA 3DXBA 4JI3J 3IAM9 4OI0A 3QT7A 1HBNB 1FESA 3BN4A 1RT7A 1T02A 2BKPA 2PMHA 2ZC4A 2ZITA 3L4BC 4IFVA 4L6V3 1VOMA 4FNHA 2RMLA 4ED6A 4ATNA 3MI7X 1RT1B 1TKXA 2MEWA 3M1VA 4HI1A 2Z0GA 3CCTA 1S0OA 2OPRB 1RKJA 2EW9A 1WC6A 3SCJE 3LH2S 3SSQA 3EDRB 2J0SD 1ZM3A 3M6VA 3OFGA 1GH8A 4JI7F 1RT4B 2JFDA 1RAEB 1Q8LA 3VV2B 4DN0A 4LF8J 3UO0A 4X62J 1FEHA 2CPZA 4NEZA 3GIMA 4Y0FA 2V2KA 3K5OA 3ONQA 5KFUA 2GW8A 4GVLA 4RWWA 4HYKA 1HWJA 3AA9A 3PM9A 4WIQA 3TAMA 2AGQA 1XMQJ 1NKEA 1TFYA 3VTIA 1N4LA 5CXTA 2QSWA 1TL7A 1XTZA 2MZTA 4GKJJ 3KDOA 2DNYA 2OSQA 1D0EA 1E6YB 2JLGA 3L7OA 1SJQA 4MAKA 5LM7E 3T1AA 4DR3J 4NOHA 2H9ZA 2ZH2A 4ECVA 1GMWA 2GAHC 4IH7A 1BWVA 3D67A 3EX7B 2MHNA 1FKAF 2W9AA 1RBAA 2LFVA 2HSEB 1HMVB 2WAQD 1U6ZA 1W7WA 4OI3A 2MXYA 1ITPA 2AEFA 3AOCA 3OXFA 5GAEI 1FJCA 2HLUA 1IBLF 1PCAA 2MY7A 3GR1A 2RQMA 1SJRA 3C6UA 3H42A 5HATA 5F8JA 3HD2A 2DH8A 1LWFB 1IBKF 5KFXA 4GKJF 3S7RA 1HWUA 5L9XA 4IKAA 1NJXA 2AP6A 2RF2B 3SSRA 2C2EA 2MJUA 4M95A 1OYEA 5C25B 4PQAA 3P5BP 3W65A 1FKPA 1UFWA 4OZ0A 4P2MA 5IV4A 2LP4A 2DXEA 4KV8B 3OLAA 2VFUA 3I82A 2OP5A 4J9SA 3RBEA 2C2MB 4WK1A 4XDCA 2KT3A 3CDEA 4Q7AA 4TU7A 2IIHA 3M8PB 1U1KA 2FLPA 1CS4B 4YB5A 1S1WA 4DV4J 2H65B 2JEFA 2DGTA 1F60B 2KHCA 3D0GE 3N5BA 3GTYX 3H5UA 5D8HB 2MKSA 3KDNA 3NOCA 4JP8A 3A3PB 4NLVA 3T9ZA 3DLHA 4X4UA 4K0KF 2V4JB 3DXSX 4R0EA 4RL1A 3CJKA 1JJ2R 5H9FJ 4FBUA 1FNOA 4URQU 1RT4A 4PYAA 1VRUB 5ETNA 5B09A 5LT5A 4B3SJ 2WSEC 5CHCB 2KTQA 3QGHA 2QMUB 2K1RB 3R6LB 1FXDA 3EPGA 3H98A 3JAMY 4ZVSB 2PT0A 4DR6J 1VFJA 4PYDA 3MEKA 1A6LA 1QDUB 5F8GA 2ZVSA 4ZVEA 1VQ8S 5L1KA 4NA3A 1UETA 4EEYA 1X5PA 2XLJA 1HBNA 2L9DA 1FRIA 3DLKA 1WDDA 3LPEA 2ILYA 2WVEA 3D6HB 3I31A 5ETRA 1RWXB 3DLEA 5KG1A 4DG1B 3I55S 1ZYQA 1H98A 4P52A 4PUOA 2CKWA 2AYBA 1H6KX 1MNEA 3JTPA 2M70A 1HQ2A 5A0YB 3GWCA 5KG6A 2BRLA 2HVZA 4F7VA 2HK2A 4CRJA 2Z56B 5B7WA 3H5YA 5KFBA 1QE1A 5HANA 3QWPA 1U6BA 1OJ4A 2I2YA 3KNAA 4IOAQ 1Z2ZA 3OPKA 4TVAB 4ED7A 4ZP7A 1S9FA 1N32F 2Q3PA 2EFPA 1FFSB 3ILJA 2KG0A 4NXNF 2A1BA 2PSZA 2JEJA 4ANCA 1VQKS 3K17A 1GTHA 5FD1A 2F4VF 3SQGA 1RE1B 3PR4A 1Q7YT 4KFBA 2PIIA 2VG5B 4M5MA 3CDBA 4R5PA 4CWBA 1UMJA 4LIWA 3SSSA 4OI1A 4I0WA 1UCNA 4LFAJ 2W2OP 1R8HA 5KG7A 2EG2A 3FRZA 3M8WA 4LF5J 2RRNA 2HNYA 2H5EA 1S6QB 2QL5B 2CVIA 2OELA 1VIOA 4HH1A 4YHHJ 4K0KJ 1VQ6S 3TVZA 5BR8F 1NB7A 4UOHA 3IG1A 2XMAA 1WD6A 2CJYB 1WF1A 2HHHJ 1VJQA 1C0TB 3MZIA 3SIPB 1HI8A 2WB4A 3NGSA 4HT7A 4C2MA 3CCSS 3CULA 5HSPA 4CM0A 2CPXA 2ZBCA 2YQ1A 5KFZA 3FJ2A 3EGZA 3BH7B 2Q79A 2V68A 4CH0S 5BJRA 2XS7A 1RYSA 1JLCB 2ILZA 4L75A 3R5DA 3TAMB 4FPRA 3R1HA 5DLGA 4KRWA 1H74A 3R7SB 3D0HE 4F0MA 1G6BA 3IWNC 4IR9A 2XMVA 2ADCA 4FPIA 5J1EB 3TUZC 4M63A 2I38A 3BEGB 3ITHB 5E0OA 2AU0A 3DFEA 1K47A 1RTIB 1X4GA 5KFHA 2E66A 1H3DA 2E1AA 2HRUA 1WHYA 2VICA 1HR0F 1IKWA 2OPRA 2B7BB 3FQKA 3M32B 4ZPBA 4YUDA 1S1WB 3UR3C 1B64A 2CPJA 3AB4B 2QJ3A 3M8PA 3IAS9 2QL7B 1VC0A 2X1BA 5BYSA 2OEMA 1WACA 1WG4A 1IBCB 3CCUS 3EZ5A 3PYGA 1S6UA 4RW4A 2FD2A 2GQ2A 5T7LB 3DLGA 2VQEF 3Q8QB 3TJ9A 5HMWA 2HK3A 2FLNA 1DY3A 1U4BA 4Z7YA 3Q8UA 3JQJA 3C6TB 4WXOA 3NNAA 2HFNA 1SJFA 3HT3A 2JC0A 4OIXA 3M2RB 2RT3A 5HVFA 3PR5B 2NYIA 2AT1B 2JNJA 4RKUC 1VQMS 3FZ2A 2V63A 5D3GA 5GVQA 1RAAB 1KWMA 5ETMA 3AXMA 4EWTA 1RWMB 3IFEA 3PIOQ 1QAJA 2AV5A 2L3MA 5LMNJ 3MM5B 3DHWC 2E9ZA 3OUYB 4FZVA 3UD5A 2EFOA 3I5CA 1HNXF 1KONA 4W4MA 4KTQA 5DDQC 3VALA 3U02A 3V4MA 5KFQA 1H0HB 4PZVA 4P71A 1NJZA 3KK2A 1RLCL 2P9CA 4GMKA 2QMXA 3LGHA 1HNZF 2KT2A 3IRXA 4USWA 4QU6A 1F2HA 2IY5B 2WSFC 3GB0A 4M5HA 3EE3A 4DV3F 1G4CA 1PAUB 1RUSA 5B0EA 3H2UB 1NLKL 4FS2A 1TL3A 5IM0B 3MCMA 4X65F 2HWHA 1EAYC 4NYOA 3PRDA 3DRPB 2E29A 2HQ3A 2JDJA 2YNIA 2QIFA 3ZZOA 3UD4P 1ZBTA 1EETB 4CZCA 1NSAA 5E7OB 3QAUA 3P49B 4OHYA 3IR5B 3HD1A 2IPOB 2P9GA 1KLNA 2HQFA 1GMWD 2K1RA 5E3AA 2R2SA 1VQNS 1VQ7S 3CDUA 2DGWA 1WF2A 1FJGJ 3UPFA 3HFKA 2F9DA 1CPZA 3GMGA 1MW7A 2KJWA 1RT7B 2MKHA 3B4MA 3OTOJ 1HHTP 3KJVB 3EDQB 2CQPA 3EGVA 2DR5A 4TY8B 2R7OA 3MCNA 3OTBA 5DGBA 4ECZA 1NHKL 2CADA 1EKRA 2F40A 3HCXA 2XGQA 3MECA 4AL6A 4IR1A 4X4OA 3DDKA 4F8RA 4K5SA 4WFZA 2DXDA 3N5FA 2OEKA 4PPDA 5KG2A 3PJ9A 2YH1A 2OSRA 4MIWA 4XK8C 3UE2A 4USVA 3C19A 3DOLA 5KT3A 2ZZMA 1R7IA 3KK2B 5HP1A 2XB2D 3G87A 1Q81T 4G1QA 3BGRB 1LWCA 3NY0A 5HROB 1BHNA 4W98A 3HHKA 2IVYA 5ETQA 3MFHA 1PG5B 4USMA 1B4SA 5LMUF 4K4ZA 2VUGA 3AD8C 3D1QA 3H90A 2MKYA 2MY8A 3DOMA 4USJC 1OPZA 4WFBQ 5E3PA 4CO0A 3PRBA 2BZ2A 1EZZB 2DHHA 3W61A 4A8XA 5F3ZA 1SL1A 3DMJB 3Q0AA 4WYWA 3GJTB 3BSAA 2V8HA 3I96A 1VK3A 1YBTA 4QIGA 4ZPVR 3UN3A 3RRGA 3NGRA 5E3CA 2AKWB 3VVTA 5K8PA 3OUYA 3EXYA 4Q8FA 3W62A 1VQOS 3DOLB 3TYTA 3QIPB 1HNIA 5KT6A 5JJBA 2V2ZA 2QLFB 3UN5A 2K3KA 3KUHA 3RB4A 3M6WA 4DPUA 2D41A 3HXMA 1M5KC 4Z2XA 1YRUA 2W2QP 2F8HA 1QSSA 4CIOA 3E2EA 2MGZA 5EUHA 3ICLA 2RDJA 1B0TA 2XY5A 2EK1A 1LV5A 2N4DA 4BBYA 4CO5A 2IVMA 4ZIWA 3T1YJ 2A3JA 3FSXA 3MM8A 2P9EA 1Y5IB 4OYIA 4WFYA 3VQTA 2CWXA 4K5RA 2HGLA 4ZCKA 1QAXA 3PKMA 4B17A 4R8UA 1C4CA 1LEOA 3DGVA 3PEJA 1LXNA 2R42A 3CCLS 4DUZJ 5DM6Q 2XMKA 4C8KA 2J7KA 2W01A 4DQIA 2Y1IA 1LFWA 1HI0P 2J9DE 3H5XA 3PACA 4NX9A 3I5BA 4LBIA 3WIVA 4LF4J 4B08A 2HHHF 1IVZA 1X9WA 2OGUA 3QMQA 2DRBA 4ECQA 2G4BA 2QLWA 4K50A 3DDNA 4KPCA 4AQYF 3LGNA 2IRXA 5RUBA 2ZHOA 1SKUB 3VAJA 2BR0A 2FPHX 3HVWA 4EFAC 3CMQA 3ILOA 4LFAF 2V5HG 2AJ0A 2DGQA 2WK4A 3FFIB 4Q2MA 5KFDA 2AYMA 3X1LB 1D09B 4ZVOB 2L9WA 1NK8A 4OJGA 5GMEA 2BKNA 2WVCA 1RKIA 4C0OC 3DU6A 3WX8A 1NDPA 2W2NP 4JI0F 1F9HA 1NHUA 2BJDA 2CJXB 2GZOA 4KSEB 4OI6A 8ATCB 4X4TA 5L9NA 4DS4A 1EHWA 4I69A 3BQ2A 4NXNJ 1IXKA 2HRTA 3IM8A 5L1IA 4CO4A 2B43A 4DFMA 1YITS 4AUKA 1SL2A 5K20B 1PKUA 2CPFA 2NXEA 4N8NA 1C0UB 2DY1A 3AODA 4M5KA 3RAMA 4ES3A 5A8KB 4DLEA 2FY1A 2XM3A 5HVGA 4LVOP 3AXKA 2DJWA 4LMZA 2UXDF 3M2UB 2RKIB 1N54B 3E01B 3HULA 4HVZA 1IKVB 5D77A 5C24B 2JLFA 4I2PB 2F8MA 1CSJA 4X65J 2EKYA 2D3O1 4I6YA 3PHEA 1CJKB 4V1Ak 1NEEA 5KFTA 5GAHU 2PD1A 5DDOC 1TL4A 1X4HA 3H4DA 3FGVA 3RB0A 1L3UA 1FRXA 1TP7A 1BQMA 3W9JA 5GMDA 1PJ6A 4K8RA 3HVTA 1WF0A 3LAKA 1WOOA 4ZPTR 1NU4A 5IV3A 1YJ9S 5JVHQ 3PY8A 3KLIA 1WHWA 5DS7A 4OJ1A 2W8KA 1T03B 1VGYA 1X4AA 4RUAA 3THPA 4W90B 1JKHA 4YB7A 1NO8A 2FJAB 2YX4A 3ILLA 1RTHA 4A46A 3CF5Q 4DR4J 3ZTPA 2V34A 1TKZA 2E9TA 4ES2A 2XGPA 3OSPA 1S6OA 2FY8A 3N01A 5J1EA 1HQEB 1VIXA 4G1IA 1K73T 1RAFB 3K59A 5ETLA 1IJEB 5KFYA 3H25A 2FC8A 3FEZA 2RHQB 1RAGB 3BBCA 3LOUA 3Q89A 4PG7A 2R7RA 2IMWP 4B02A 1FEEA 3CMES 4ER8A 2IA0A 3KLEA 4RW9A 2XY6A 4OZ3A 4CO2A 2FGOA 1GT8A 2DHSA 3EVMA 2J6UA 1UVNA 2QT7A 1OPIA 1CJVB 2WONA 3MTKA 1Q16B 3MR3A 2OLWA 3MM8B 5AE2A 3MPUB 1BQXA 5EGYA 1T9WA 1HNVB 2C3UA 1TTHB 3P96A 3UVJB 1M5PC 4ECWA 3W66A 5HAOA 1SBRA 4EBCA 2B4VA 1TVRB 4JI4F 4ZVRB 3A8IA 4OFZA 3CIZA 2OMOA 1J5OA 3RYLA 1VQLS 4ZP9A 2IHR1 1SKRA 1VI7A 3HSJA 2RUSA 5BYRA 4B9NA 3FCWA 3Q8RB 3C66A 2AJ1A 4EO8A 1E6VA 5CD4A 1L5UA 4NCAA 3KMQA 1NK5A 3MEDB 4FF2A 1FHTA 1RBLA 3BO3A 2AGPA 4DQRA 4FP9A 4OYPA 4YR3A 1XNRF 4AFFA 4MK8A 3MMCA 4DV3J 4DF8A 3ISNC 2C28A 3IWXA 3SFUA 3K5NA 2AHOB 4QIFA 1ZM9A 1XEZA 2DYAA 1X5TA 2ZE2A 3OW2R 3M8YA 1LW0A 3UFCX 5HBMB 2VPXB 4WFAQ 1R8BA 1SJ1A 4DUYF 3S6EA 1RWPB 1C0UA 2DXFA 3ISZA 3OTCA 5A8KA 5B08A 3NS5A 1C1CA 2J76E 2KHDA 1AZSB 2LXUA 4MKAA 2V8GA 1TL7B 5C5JA 5MLCV 3QZ7A 1RXOB 1S9EB 1UW4A 2B0GA 2H5JB 4X2BA 2P5VA 1FO1A 1U8WA 1W25A 1BUXA 1P9YA 2YH0A 3QATA 3RRKA 3TQ1A 1X5SA 4B9LA 3DLKB 2YVSA 4PCQA 3RRHA 4HACB 4PXCA 1WHVA 1PYSB 2AZ1A 1U45A 1TV6A 1NHVA 1NB2A 2E1MC 3HHNB 2MKJA 2XLIA 2FJBB 2DIVA 1FWPA 3O8WA 3D3CJ 5F8LA 2JRSA 1VQPS 1HD0A 3M32A 3LQVA 3RGIA 1H73A 2HHUA 1RBOB 1S12A 2Y8WA 1RB0A 4ED1A 1NKCA 4I67A 2DD8S 2R2RA 2HVIA 1RT1A 1TKXB 2BANA 4Y2AA 3ITHA 2FZKB 4O3PA 5DGAA 3PNIA 4DL6A 4LBPA 1HNWJ 4GKKJ 3IO1A 4ZITA 2H51B 2OO4A 5F3TA 5J1PA 3FEYB 3AB2B 2KFZA 5HQMA 1JJHA 4CLWA 2GHVC 4DR3F 2HHTA 1TMJA 3SV3A 2B56A 3NCPA 4LSZB 4LFCF 2NXJA 4ZDNA 5KAKA 1APSA 1VC6A 2HBYB 1XIQA 3PFOA 2Q66A 4FXDA 1HPZB 2KDOA 3N4WA 3DRPA 4J37A 1F3FA 3DM2B 4WXWA 4CP5A 3W9HA 4ECYA 4BC7A 2Q6CA 2RDIA 1Y11A 3U27A 4UOGA 2FJEB 2MMYA 4RR5A 4ELTA 2DT9A 1SC3B 4OYWA 4S0MA 1YJTA 3D6FB 2HPUA 3KHLA 3DLBA 2DNQA 4IOCQ 4MTPA 3EGWB 3WDOA 4IRCA 3IRXB 3HT0A 1S6PA 2ZJPQ 5H9EJ 4LFBF 1Q0NA 1HNIB 3CEDA 4DPXA 5K8OA 5IXUA 4ED8A 2LQBA 4F26A 4JYAJ 5KFMA 1R31A 3CJ8A 4IQMA 4UQTA 4DUTA 3D5MA 1SH0A 5F8HA 3P5TL 4I7FA 1RZMA 2V8DA 2WVBA 1B99A 3ZXWA 3J7YI 3BGRA 4WK3A 4LF9J 1NK4A 4ZN3A 1JJCB 4C8NA 4MKVA 1HNXJ 3CCVS 3FBCA 2QFJA 3K58A 4KIAA 2HAFA 2I8EA 2JVOA 5ADZA 2C2NA 4LR7A 1ICEB 3H59A 5CZXA 1X4DA 3JQKA 1D8YA 5ETSA 4DF4A 1EJ7L 3QPIA 4FN5A 1JLBB 4H4KC 1S0MA 1FA0A 1GFWB 4G1QB 1JJ4A 3D6TB 1DQ8A 1WKLA 2FZGB 2G1DA 3C14B 3JTOA 4YP3A 3PJWA 3Q22A 3PZPA 1TUGB 4DV5F 2Z8QA 5KFSA 2GC8A 4DX5A 4P7VA 4EO6A 5DQHA 4J9MA 4Q44A 3FBBA 1OQ6A 1RABB 3SYZA 1N36J 2DNMA 2GGPB 1BWEA 4JB8B 2NXCA 4MJKA 3CJ5A 3EICA 3H5SA 4C11A 4DMZA 4B3RF 2DGUA 4DL5A 2VBXA 3NGDA 1U1NA 2YX7A 4NLRA 3KHGA 3RAXA 1D3WA 3G2XA 3DC2A 4HR2A 3ET6B 5KG4A 3RTVA 2UUCF 1K1SA 1EP4A 1KHWA 4LF7F 3MM9A 3AAWB 2FUG9 3O3LA 4ES1A 2U1AA 4M5JA 2H48B 2UXCF 2AWZA 2NS1B 4IH6A 2ACMA 1VISA 2MJNA 2Q43A 3KUEA 5F0WA 5DETA 2V8VA 1T3NA 4QIVA 3O6QA 2V4QA 4NA1A 3AJ1A 4OJHA 3V6DB 2MGZB 2ZBQA 1JXEA 2CPYA 5IWAJ 4LRAA 4DSJA 4UZBA 2CNOB 1R6VA 3BO4A 2XMWA 2AX0A 2HNDB 4C97A 4PWDB 2OPSA 2B9XA 5HMYA 4WF9Q 3T5HA 3FRYA 2CQIA 3GILA 1VDHA 1DTQA 3ZNUA 4X62F 4AL7A 2W9BA 1TL3B 2HVDA 3NEKA 5IM0A 3G8TA 2ZOMA 5AJ3J 4USHA 1N8RT 1RJJA 2YXLA 1RT6A 2ASYA 1JB0C 3W63A 2DCLA 2MSTA 4P2XA 3IA0A 5IT4A 3C16B 2Z2MA 2YPZA 1YTYA 2Z4PA 3GPAA 4F2SA 2XC9A 4YHHF 2ZHAA 3KK3A 3OXGA 5IQ6A 4YQWA 3PFEA 3CCES 4KHRA 1RI7A 4OQJA 4CDIA 5GAHI 2NPIA 3OHBA 3ENWA 3QO9B 3RR8A 2IM0A 3MMCB 4QJVA 4QYRA 2QLXA 4OV1A 2POKA 3BF4A 2DHXA 4FF3A 3A8KA 4DQPA 4HLBA 2VOOA 1J2VA 3BDEA 5AT1B 4J9KA 2E5HA 1HWKA 2BEFA 4UOFA 5DZ6A 1CEZA 4MT1A 4FKYA 4ID5B 1R8CA 1UPPA 1N48A 3CCWA 3T3FA 2NLWA 1N32J 4USTA 2GNKA 1S10A 2C3YA 2P6TA 2FDNA 2Y0BB 4LQ3A 3HJVA 4ZVFA 2LECA 1RT3A 3BPSP 4DG1A 3W8PA 3MMBB 3C2PA 3QSYB 4U7UD 4NLXA 3R5GA 1AFIA 2BUNA 3VCDA 3A4TA 2YKMA 2BOPA 2DCUB 2MQMA 4OYAA 5CCMA 3CUNA 1S7IA 1N34F 3THTA 4J9LA 4JI5J 4EMDA 1PC4A 3GYNA 1NK6A 3OQ2A 1QTMA 3M30A 1JLAA 2DY9A 3CC2S 4ZCLA 4DU7A 2FVQA 1RACB 1NBEB 3QJPA 1JK9B 5LXYA 2ATLA 2M2BA 2MB0B 1YKWA 4IUFA 3D6MB 3AA8A 1FT8A 1Y4ZB 2RAQA 3CWJA 2LVWA 4ECRA 1ZETA 5KFRA 3QIDA 2ERRA 3LP0A 4IFYA 3HHEA 1QSYA 1XNQF 3BH6B 3TEGA 4KR0B 4RUHA 4K4XA 5H9FK 4CM2A 1FDAA 2B9YA 5LL6d 5AE1A 1BD6A 2VIHA 2ZH5A 1U47A 2V67A 1U2RA 1M1HA 1HWLA 3VVUA 1CJUB 1ZZNA 2H5IB 1YHQS 4Y2CA 2WZ1A 2RB7A 2XI3A 3J7ZT 3OR2A 3VZHA 5GADU 1JLBA 3PYFA 3TZWA 4C7QA 2A0FB 3TOQA 1W2IA 4CTAA 4DQQA 3MM5A 1RK8A 2IRYA 2VQFF 4B3TJ 3MM6B 4ITSA 4MIAA 1XBWA 1IJFB 1LW0B 1X8DA 5HBMA 4X4SA 2P2CB 4PR6A 3ULHA 1SVDA 4RW6A 1WELA 1HQUB 4JI2J 4ZJOA 2GIQA 4I7FB 1U6FA 4ZP8A 3QT8A 1G2EA 3OT9A 2R7WA 3CD0A 3FUYA 1B7YB 2GIFA 4N56A 1YG0A 1U8SA 2F8EX 2V8PA 5KFIA 3W2WA 3QBCA 1VHIA 1YBUA 3MURP 4A8YA 1U24A 2WB1D 4TLRA 4YB6A 4ZVGA 4DS5A 1E6YA 1FF2A 2W1BA 3ENAA 3CW2C 2CQ0A 5FLXY 3CO9A 4IO9Q 2G0IA 2HS4A 1A0OB 1KQGB 1FXRA 4KGKA 3UR0A 2QFIA 3T1YF 4IG0B 4CLUA 2W24A 4NE9C 1F5BA 4USKA 5D6GA 2C2DA 1Q8BA 3J7A1 1QLNA 2J0XA 4F4YA 3VAKA 4YR0A 4USIA 3N28A 1OY8A 4L76A 1CJVA 1WOPA 3WHIA 3V6KA 2HFVA 1YGYA 2LCWA 2V6AA 3A3NB 1CC8A 1CG2A 2PGCA 1RU1A 3A1YG 4RNHA 4ETZA 1QVGR 4K4VA 5AXLA 2XG8A 2HBQB 3T5LA 4NA2A 1OSDA 1T05B 2Z2LA 1G7CB 4LF8F 2KFNA 5J2PA 3PW0A 4OI2A 3D68A 1U02A 1CS4A 2NYHA 2HHPA 4P6QA 2YKNA 3GFZA 1U1QA 1N36F 1EETA 2HHWA 3VGVA 3N9UC 1CULB 4PKDB 1S57A 1LK5A 3N0VA 4TU9A 2FLOA 2N7YA 3UDLA 1T9YA 3ZZYA 4DX8H 2K7KA 2VF3A 1X4EA 4C0HA 5DG9A 4PRFA 4RNFA 2K7JA 1V5IB 3KG0A 1YVFA 2UV8G 4OX9F 3CT9A 3VR1A 4LRCA 3UNGC 1XMOF 1H7WA 5SUHA 3HHLA 1FE0A 1NAQA 3CD5A 4CLLA 1FKPB 3CVKA 3LTOA 1IQZA 2B4OA 3T9NA 2D3OR 2J8AA 2CJAA 2VV5A 4NZ0A 1S9EA 2HVEA 1SKWA 5HMXA 3M6UA 3BYPA 3SCKE 1U1RA 4O3SA 1WI8A 1FDDA 1HBUB 1EX8A 2CZVC 2JX2A 3ZZTA 4WFNQ 3J81Y 4RNMA 2WCXA 2XS2A 2CJ9A 4FNIA 4ZPAA 4X64F 2AW0A 3PO5A 3OTOF 4CLZA 2XYHB 4OYXA 3NNCA 2VKZG 1A9NB 3I9V9 2OPQA 3DHXA 3ILIA 2JH3A 2O3DA 2XHCA 2PMWA 3FZBA 4ZLJA 3PKYA 1BLUA 1DHMA 4TYBA 1K9MT 1F5CA 3JSRA 3UVJA 3HHLD 4KH0B 2DH9A 2VL1A 2KRBA 4RPFA 4HKQA 2HS3A 3IGNA 5A8RB 4OZ2A 3M9OB 1GNKA 4URSA 3ZZUA 2Z58B 1J5OB 5L39A 4YN3B 1P27B 1XMBA 2V94A 4LSLB 4BWMA 3HI9A 3CNQP 2E44A 2HGMA 3TZZA 5LMNF 4ECSA 4IFYB 1X9SA 2VA3A 1FJEB 4JI8J 5HN0A 4F4ZA 4QWBA 4C9DA 4OI4A 2KJVA 4YDXA 4O0NA 1YRTA 2XWYA 4QWCA 4IG3A 2WONB 4UY85 2BBEA 3CJKB 4NMXA 2ZOGA 4K4YA 1OYDA 3Q8YA 1S49A 3MOZA 2QA4G 1FNXH 2Q1LA 1HNZJ 1PSDA 3AQPA 3FMWA 4FYDA 1M90T 5H1SV 2CQCA 2CJKA 3NAIA 3H40A 4NLPA 1VHFA 4DR1F 2WOMB 1YBAA 2RS8A 4EYHB 4R8UB 5KFCA 2M8DB 1HBOB 1DQ9A 2DHAA 2W2PP 2LXFA 4LF1A 1QUVA 2LU2A 5EX0A 4GC7A 4DJBA 5F8NA 1IKYB 2GGPA 2YKOA 3GG0A 3NLCA 5F9LA 4CH1A 1WSVA 1RWWB 3M7VA 1TK8A 2FGCA 2FLLA 1RTHB 2C1EB 1KTVA 1R27B 2G9OA 1HR0J 2UU9F 3RW6A 3MPWA 2D74B 1Q86T 2IFXA 3R27A 4OZLA 3HHLC 4PG8A 1YIJS 1O5JA 3RU0A 1Y7PA 2J9EA 4ZJLA 3US5A 3VGUA 2OH2A 3GSDA 3SXLA 1ZAWA 1ZS6A 2CYYA 3HVAA 5GADI 1PIEA 2B3TB 2NSBA 1R8PA 2AEMA 4X4RA 1FXLA 3GQCA 3HKZD 1CJKA 3T1HJ 1TL5A 3P3DA 4WTOB 4Q0BA 1I3OB 3TUPA 3AQOA 2UUWA 4KFBB 1U7LA 1KKHA 4LF2A 4NXMJ 1UVKA 1SIWB 2O66A 3JSMB 2ZH4A 2E5LF 2JEIA 5AXMA 3HHDA 3T41A 3MEDA 2CNNB 3IR7B 5D0GA 4TXSA 1JLEB 4ETXA 3BQ0A 3M2RA 2DNHA 3F44A 3SEOA 3HHLB 4C8LA 1C4AA 3FC9A 2HW3A 3BDPA 3PEHA 4RBVA 3BSOA 3IR6B 1ZTTA 2MQLA 2XYGB 3M8QB 2CUYA 4LF5F 2NPFA 2KYZA 1U26A 4J9NA 2LXIA 4J7CA 3MOJB 1CBKA 2RIJA 5E3QA 1I94F 2K06A 2ZJQQ 5BXIA 2CA9A 4N77A 2E9RX 2KG1A 4IH5A 3PG9A 4QIWD 3JQMA 2HZVA 2BE2B 4MK9A 3CJRA 4GKKF 2W4PA 3QLHB 5KG0A 1RT2A 1KR4A 3G9CA 2KZMA 2COLA 1S48A 3V6DA 1G1XA 1IKWB 2BJEA 4OHZA 3V6HA 4P7TA 4OLPA 3L09A 3KTQA 1EQMA 2DPIA 1KRPA 4WBFA 4DV6J 2VJVA 1WWHA 2QTWA 1J27A 4O4GB 1RHMB 4ZS6A 5A8WB 4U6PA 4U67Q 3W7BA 2AQ4A 2H54B 2HHSA 4KH1B 1NDKA 1OY6A 2J5AA 2LU1A 1UWBA 2QYCA 3JTNA 2CQ4A 3CJTA 1DBDA 1R8AA 2WW4A 3P8BB 3QT5A 4ANEA 2RS2A 4EZ9A 2X1FA 3KFWX 4MH8A 3RR7A 1UA1A 1Q95G 2N7CA 4A48A 4MKYA 3CTRA 2VD3A 4Q43A 4LSLA 3MPVA 2FVRA 3KLIB 4NL5A 4ZOSA 1KQSR 4K59A 2QYGA 3MR5A 3GCWP 2IDEA 2VPYB 4ID5A 2YWGA 5CYMB 2BE7D 2UZAA 2MQ8A 3I5AA 1VMBA 4MKBA 2KXFA 1KEKA 2E5JA 3CMAS 2O5DA 2RRAA 2UXDJ 4WCEQ 2HQDA 2RF2A 1EB0A 5MAOA 4B3SF 1Y3KA 4EU0A 2VKRA 3Q8SB 2DGSA 1Q78A 2DO0A 2JLEA 2XZTB 1PBAA 4H4OA 3R7BB 4QWAA 1LW2A 4DL4A 1BC6A 2J7UA 4NLTA 2IJRA 2M52A 1VRTB 2F5GA 2M4MA 4KGZB 4XO0A 1O0PA 2KT5A 3MFIA 5IT9Y 3HZEA 2R8JA 2QSFA 4DV4F 2PE8A 1U1LA 2FJDB 3D9BA 1Q53A 3G6YA 3SQGB 1BE4A 1DTTA 3DMJA 3R5JB 1SC6A 2HBZB 2ZKTA 3F41A 2MQQA 2R7UA 1HIYA 1YK9A 5HI7A 2X51A 3RJMB 5EHHA 3LALA 2JC1A 1UEUA 4QIEA 1X9MA 2IMOA 2DNOA 2G13A 2ALZA 1KVIA 3EXCX 1VRQC 1MMDA 2BKOA 2E1RA 2VG7B 2RH3A 3P4UB 4WIIA 5GMKa 4FYVB 4P2FA 1GTEA 4Q8EA 3NGUA 1OQ3A 3I9ZA 1KHVA 5HJXA 3DRSA 2I6WA 2ZH7A 2BOAA 1N5YB 3RZAA 2AEJA 3OVBA 1LWEB 3NGTA 4U95A 4WE1B 3DYAA 1JXLA 4IO1A 1ZPVA 3IWLA 3QGGA 2OUGA 4DEZA 4Z7CA 3KUGA 4EBDA 2UVWA 3MXHP 3SDEA 1CULA 2JWNA 2X7IA 3TJAA 5B0CA 3KMSA 4KHPF 2B6AA 2MZJA 2WHOA 3TZXA 3FSIA 3T1HF 3CPWR 3CJ2A 2XYPB 1JLAB 1RWOB 4N7TA 1HW9A 2RILA 2RQKA 3HFVA 3UWTA 2FHOB 4AQYJ 1WSRA 2ZH6A 3GV5B 3FBEA 2JEGA 3A8JA 3SMZA 3TR5A 4ED5A 1N88A 2IM3A 2Z57B 1YZ6A 4E8UA 4DUYJ 4DPWA 2F65A 2SXLA 1IBKJ 3J81U 1JIHA 2WTFA 1R89A 2ZWPA 3O5TB 3SQOP 3DNCA 1IKXB 2A6MA 3B54A 3MMAA 3Q8PB 5SZTA 4XDDA 1XNRJ 1REGX 4IG0A 4KKOB 3E8OA 2FHKA 5EX3A 1PILA 3KG4A 4FF4A 4ZIVA 1S79A 4L74A 3JXOA 4P74A 1NH7A 1UP1A 2NZ4A 1I5OB 4PG4A 1UJ5A 2AZ3A 3S1TA 4F25A 1C1BB 2YNGA 2ZHBA 5DM7Q 2LQ8A 4KGXB 2UUBF 1WEZA 2VG6A 1GX5A 4LVNP 4F0HA 4M5DA 2DR7A 3KLGA 2JL9A 3J7AN 1RTJA 3IN5A 2RHSB 3BGOP 3K5PA 2BDPA 2OD4A 2Y0SD 1N5SA 4AD6A 2Y1JA 5B0BA 2HMIA 4O3NA 1DFDA 4N8OA 4OL8A 5T14A 5I3QA 4CQ1A 5D3GB 2ZE2B 1SQFA 2FHMA 2FB0A 1Y5LB 1HMVA 1F9EB 3EUNA 2C2OB 3D66A 4Q5VA 2PI4A 5KFWA 2IYIA 1PC5A 4JOUA 4WP8A 2RQCA 1MWQA 2ZVIA 4CH7A 3ADAC 4NI2B 2KXNB 2GVZA 5I4MA 3DLLQ 2HFZA 3BS9A 3CD7A 5HMZA 3TARA 2DR9A 1AROP 5B0DA 1S1UB 3OJSA 3B8HA 5A0YA 4P73A 4ZK7M 4C8ZA 3IP0A 1ZA1B 2XMTA 4A8QA 3V81B 4X64J 2UVRA 1URRA 2F1FA 4J90A 3NG8A 4QWDA 4DL0C 4MYTA 3TP2A 5FDLB 2VPWB 4AXJA 4TU8A 2B5JB 3MUTP 4UF4A 5DG7A 1SJ4P 1NK7A 2QC3A 2Y3YA 2LYVA 5C42A 2BANB 3M9MB 1RA6A 2YY3A 1EP4B 4Y6IA 2FIUA 2W7AA 1KLMA 2DNRA 1OMSA 2O01C 5IT0A 2EC2A 5K5MA 2OHDA 4F67A 2GMJA 1WTBA 1B70B 1RDRA 4A8SA 3OSNA 2GJ2A 2PA8D 1VS3A 2ZD1B 2QRRA 3QFWA 2YKMB 4HTIA 1ZZFA 2F9JA 4C3LA 2QEXS 3PVXA 3PRVA 4IG3B 1LWEA 2IDLA 1SQEA 4TQSA 3EPIA 1NPRA 4JV2A 1C0TA 2F3JA 2IJNA 2UUTA 2V69A 3BKUA 3EMTA 1HNWF 1S77D 2ADBA 1T03A 5JMNA 4RNNA 1FRHA 2BVZA 4DR1J 1NCLA 5ETTA 2D9PA 1TAUA 5KOXA 3D3BJ 1S1XA 4ED3A 1RAHB 2H4WB 3BYRA 4HHHA 3LP1A 4KB7A 4NPOA 4O44A 4Y28C 3RUBL 3DRXA 2C2ZB 2DITA 2MYFA 1Q1KA 2XTJP 4FXVA 1DLOB 1UFLA 1RU2A 2CWKA 4I2PA 3TX8A 5GAGU 3CJ4A 1OIAA 1C1CB 2GJIA 1LWFA 3B6BA 3W1YC 1S4EA 3JAMU 1WDTA 2G2YA 3MAAA 4PQUA 4QR1A 4WZMA 4LR8A 3D2WA 4J91A 1URNA 3DDIA 1XERA 4ZPWR 4O3OA 3PCOB 4LJMA 4DCPB 4P9SA 4K2JA 1MU2A 2ZM6F 4E0DA 3HK2A 4B3OB 2CQHA 3RB6A 4NLDA 3V6JA 4YR2A 3IS9A 1SL0A 5KFGA 4WKYA 2C2KB 4X4PA 1JNRB 1U1MA 1NSQA 4ECUA 2MQNA 4A8KA 1L3VA 1Z4UA 2AYEA 1D8ZA 3NBPA 1FWLA 1N5TA 2HFOA 2R8KA 2FYXA 4TYAA 3MD1A 5HJYA 5M2UA 3PXGa 2F7VA 1FRJA 2BACA 3TEHB 2CJBA 4UZCA 1N6QB 2BX6A 1H2VZ 5T41A 3FCHA 3LO3A 4CI0B 1T9UA 1HYSB 1UVMA 2DGXA 1RWUA 3B78A 1DQAA 3B4DA 2D3ZA 3KG1A 5LJ5Y 3GLJA 3OD2A 2LEBA 4C0BA 1GXTA 2AJQA 1VRUA 3G6ES 3LGMA 1U0SA 4NRUA 3RBXA 5A2QY 1X0FA 1YI2S 5KFLA 3AY0A 1HA1A 2IBOA 3NWRA 2RRBA 3MM9B 3KLVA 4LQ9A 2Z30B 2OMLA 2IVFB 1U49A 1AA1B 5JUMA 1XMOJ 2AF6A 3MPYA 4YDDB 4OYMA 3N79A 2RU9A 5K8NA 1SIZA 4OX9J 4RX6A 3V5RA 1MWZA 3MPDA 4P10A 1RGVA 2HZAA 5F8MA 3R2CJ 1RCOB 2I5JA 1WC5A 4F0KA 2YWWA 1Z2LA 3MMBA 1B0VA 2QGFB 4KGMA 5EWFA 4C3MA 4DL7A 4UUWA 2R7TA 1ZM4A 1JKHB 3GCXP 3A12A 2MKIA 2W7PA 5H9EK 4F4AA 2IBKA 2XZDB 2LQ9A 4A4JA 4KT0C 2ROEA 2C3PA 1S1VA 4LREA 3HVRA 2NXUA 2R2TA 4DV0J 4F50A 2ZWOA 2ZNZA 1R0AA 2ROGA 2XO6A 1LNQA 1JLEA 1RAJA 1T3OA 1JLFA 2BW2A 2ZUGA 3EGNA 3FSYA 2F4VJ 3NBPB 1P1LA 2ZUAA 3AJDA 3MAAB 3UW1A 4R5PB 1T8EA 4K4UA 4QCLA 1RCXB 1MN7A 1YJNS 1FTCA 4O4RA 1T95A 5I3PA 1L3KA 3FEXB 4GVBA 2J0QD 3FNNA 2CQBA 4KPYA 4B3OA 1WKJA 4RW6B 3LPYA 7AT1B 4ANDA 1QJHA 2KU7A 1HHQA 3F56A 4ZA1A 4CLPA 1N56A 2HEKA 1LW2B 4D3GA 3KK1A 3MAQA 4PQUB 4FVCA 4CTAB 1K0TA 3JYTB 3GR0A 5F0UA 2CNKB 3C6TA 5IOLA 3WX4A 1HD1A 1Q5YA 4KQZA 2OTLS 3T5KA 3WQPA 3DRRB 3R7NB 3W3SA 1HWIA 1QVFR 1F1BB 1R3NA 2CG4A 2QX0A 3EWGA 4TKTA 5KFEA 4RNOA 1UVIA 3QRPA 2H1YA 5EWEA 1YJVA 1TQLA 4C8MA 2GS8A 5CAAA 4F3OA 1VYAA 1T9VA 5CYMA 1QAIA 2GQCA 4DR7F 3EVOA 3R5BA 4O44B 4JI0J 1H2UX 2D3UA 2B7CB 4I68A 5DZ7A 1PGZA 3DOKA 2W7OA 2UP1A 3VAHA 3M8SA 3CCRS 2HHXA 4XAKA 1F2GA 1U2CA 2WOMA 3GG1A 2I1RA 4FYXB 4IRDA 4EGLA 3UDCA 3EM1A 5DG8A 4J9OA 1NXIA 1RHJB 2YKQA 4UTGA 2VH7A 1S9GA 2HQIA 3MEGB 1U1OA 1RTIA 5D0HA 2CQ1A 4LRDA 1SKSA 1EQ0A 4U7CA 1D9DA 1OSCA 2CQDA 1S7HA 3F73A 2LDIA 4QR2A 1GK8A 4NCGB 3ZZZA 1LFPA 3MUMP 2YWHA 4JV5J 3DN9A 2YTCA 3S01A 1UEKA 4ENOA 3PO4A 3OBIA 1SV5A 2GX8A 3I4HX 1IR0A 5AE3A 1D1UA 5KG3A 3CJSA 1WNEA 1HYSA 2W9CA 1P9QC 5D4OA 5L8RC 2ZDOA 2AGOA 4AT1B 1Y9OA 3MEEB 3HVTB 4FBTA 3UI3A 1BQMB 1LWXA 2BM0A 3U1MA 3H20A 2J0WA 5AXKA 1HW8A 1TUVA 1NRKA 3ZTSA 1BXNA 2YPYA 4PG6A 3VHQA 3BO2A 4C6AA 5EWGA 3OL6A 2L41A 3CCZA 3IS9B 3CGIA 1RHKB 4P2SA 5J1NA 3JYTA 4DFPA 3J81j 3V4IA 4DFKA 2F4FA 1NDCA 4B9MA 4BDPA 1PBUA 2W4CA 2A10A 4C8YA 3QRRA 3K8VA 3O1LA 5GAGI 4RO0A 3MM7B 2PA3A 1U0HA 3C16A 4HL9A 2VC1A 4KO0B 5C7PA 2CJQA 3TA0A 2GVDA 4FDFA 1SUQA 3L3CA 1S1TA 3M2VA 2QL9B 5L1JA 2XSJA 1G3OA 2JZ5A 3GJQB 4M5DB 1IBMF 1XQIA 1J5EF 5EN1A 1JLGA 1V5VA 1TUWA 3DRYA 3QGIA 2YQ3A 4OZNA 5HL7Q 2NSCA 4ZCIA 1CJTB 1KQFB 3GP9A 3PYDA 5DDRC 1YJWS 1F3VA 3OFHA 2OPSB 3T6JA 3LP1B 5GAEU 5CD4H 3MF5A 4UQGA 1RTZA 1O51A 2VDHA 3UDVA 2RNEA 2XY7A 5ETPA 2VB6A 5LSLA 5ETVA 1FI4A 4YMEA 3SI8A 1FD8A 3C15A 3GFXA 2E7WA 3Q23A 3P6YC 3HKWA 4PWDA 1WC0A 2HNDA 1X5OA 3H8YA 4LBHA 3CDAA 4NMLA 3K57A 2EBEA 4I6WA 2ASLA 2YBVA 3KWMA 3MD3A 4DV6F 4YY3F 2KZZA 2IC3A 3BZQA 4OX8A 3KLEB 1WI6A 4QQBA 3R1LA 3LF0A 4DSEA 1VBZA 1NNDA 3QGPA 2CG8A 1YSJA 1PYOB 5K8MA 2O67A 4O3QA 3PIPQ 5KT5A 3UNYA 4CCHA 2LA4A 4QBUA 3GONA 2E5IA 2QA1A 3ZFVA 2V2QA 1MN9A 2QLJB 4I56A 5HQ8A 1TU0B 1FERA 2L48A 5FDLA 1NUEA 4BLGA 5I3UA 4PPZA 9RUBA 4ZHRA 2N4CA 4G6VB 2PEBA 3W64A 3RBZA 1NJIT 1KN6A 2EPIA 4HI2A 2UUAF 4A47A 4DCJB 1S5ZA 3V81A 1BQNA 1WC1A 4ZVPB 1N34J 4KYZA 4ZPDA 4JI5F 3OL8A 4LRBA 1NK0A 3DI6B 1AW0A 3LUYA 4YFUA 2VG7A 2HFSA 3IM9A 3PYEA 3NAHA 4NLWA 3H4BA 4KV8A 4M1KA 1IUJA 1IM4A 1RTDB 1NK9A 2UUBJ 4B3MF 4C3KA 3IBWA 3TX0A 4CT8A 1DJ0A 3BV8A 1JLGB 1X4BA 4PXEA 2PI5A 4LIRA 4RU9A 3BM7A 4NLSA 4ERDA 4NXMF 4K2XA 1S6QA 4BC9A 3OL9A 5IT9U 4L3NA 1Y10A 2MZSA 3LA0A 5KFAA 2BJ8A 5U47A 4URGA 3C6UB 1XC9A 1UWAA 2CQ2A 2LQJA 3NXZA 4WPAA 1S6PB 3KK3B 4DSKA 2IRUA 5DLFA 2LQ5A 1HLWA 4WYLA 2R8GA 2OPPB 4RZRA 1EKSA 3J7Z5 1KTQA 1A7GE 2MLXA 4YEAA 2XMUA 4DSFA 2C3OA 2GMLA 2GHPA 3MM7A 2ACYA 5HP1B 1XMQF 2G2OA 4J9UE 3FKBA 1T9XA 4J9QA 3NS6A 4HHJA 2MZQA 2U2FA 2RDDA 1S0VA 1Q5VA 1RADB 4P72A 3V4IB 3MEEA 4OZJA 1Y0HA 3M8RA 1TL1B 5AJ3F 3G86A 4B9SA 1BGXT 2LEAA 4QWEA 2XI2A 4EBEA 1CVJA 4ZHRB 4RUCA 4EUVA 1NMEB 2FHJA 3KXDA 1NZ8A 2L9NA 4OHVA 4E2FB 3ELHA 5IZHA 1S4FA 4DR2J 1S72S 4JYAF 4WFXA 1UZHA 2KB2A 3ETMA 4UOCA 4LFBJ 4DN9A 2V0NA 3DLJA 5IWAF 1VBKA 1TELA 2DGVA 3Q2SC 4M8LA 2WSCC 3M30B 3VAFA 3CO0P 4ZVHA 2AIRB 1VQYA 5D78A 3ZZRA 2ZJRQ 3UQSA 4BS2A 2IC3B 3TA2A 4QPXA 1YJUA 5I42B 4FS1A 2UXCJ 2HQGA 2P8IA 4NLQA 5C42B 1HQEA
chains in the Genus database with same CATH topology
3SDEB 2V4JA 4F3QA 4TN2A 2XSFA 3AJ2A 2AX1A 2GO9A 3MDFA 4U9RA 1REVA 1N5YA 1FRLA 3MWBA 4RBUA 2R8IA 1I6JA 2M8HA 3D54A 3IG1B 2J9CA 1S97A 3QLHA 4D3HA 2JJ4D 2IAJB 2MZ1A 3G6XA 1DURA 2B4PA 2EG1A 2YWFA 5G4DA 3TVKA 4HH0A 4K4TA 4RW7A 1FTRA 1TKTB 2XHWA 3J7YU 3JSBA 1UL3A 2VG5A 4HDHA 4MFBB 1S1TB 3M2VB 3GIJA 1FNMA 4Z37A 4Q0BB 2OPPA 1KD1T 4C4WA 2IJFA 2J7WA 2JVRA 4DV0F 2HNZB 3PX0A 5FJ4A 3LAMA 3LW5C 5KOWA 3M4XA 5KFKA 3FQLA 3D1OA 1M5OC 2C3MA 1GXUA 3EZUA 4Y00A 1KSPA 2BXJA 3ENVA 3I0SA 3H2LA 2VA2A 3ENQA 4ZMMA 5AXNA 5LXRA 2D1CA 1N0UA 1X4CA 3KKFA 3KHRA 1NKBA 3K2YA 4X4NA 1HI1A 4DL2A 3UCUP 1HBMB 2LA6A 4DQSA 4JI3F 4JI8F 2EFNA 4NCBA 1ZPWX 1OS5A 3LP0B 3K0JA 1U09A 4MIBA 2GHWA 3FVYA 2VFTA 2YNHB 1HNVA 2W4DA 5IQQA 5F8IA 4N76A 3GV7B 2DNZA 2EFQA 2RE1A 3U1LA 1O8BA 3E51A 2ZH3A 2CQGA 3I32A 1RT5B 3TAQA 3J80Y 3NMAA 2BABA 3LP2A 3DGPA 4K4WA 2HS0A 3U1NA 2FVSA 4UW2A 1AFJA 4Y3CA 1LQ9A 3L7PA 5F9NA 1N5QA 1RT2B 1U1PA 1IN0A 4WU3A 4I2QB 1UA0A 2KKHA 4I64A 3OV7A 4I1TA 4UY8T 4HDGA 4NZ6A 2MQOA 2YNFA 1TKZB 3POTB 3IC1A 4QPTA 1ZTWA 3S8SA 1IQTA 2V9WA 3DRRA 3CIMA 1H7XA 2XNQA 4OHWA 3OXLA 3SCLE 2J6TA 5D4PA 3VQSA 3WZ0A 1FDBA 1RA7A 4KC5A 3HF5A 3QIPA 1MMLA 3MGJA 3I0SB 3OFEA 1W2BR 4ED2A 1NJYA 1JMTA 3C46A 1FVQA 4OHXA 3IGVA 2NUHA 3NKYA 2HLTA 1ROFA 2W8LA 4E98A 2R7QA 3N6NA 3BGUA 2E7XA 4ECTA 1YWXA 2YKAA 4FF1A 2AD9A 5CYQA 2YNGB 4OZ5A 2X1GA 4BWJA 4OMFG 3HO1A 4CO3A 2M0GB 2I9SA 4ID8A 1IKYA 2GQQA 4QW8A 5KFVA 3FFIA 4KE5A 3GIKA 3PW4A 1MROA 5HLFB 1OWXA 2UVUA 3D0IE 4WKRA 3G71S 5M2RA 2WBMA 1M0SA 2DNKA 2CQ3A 4DR5F 2XNRA 4IDKA 4O4GA 5A8WA 2KI2A 2APOA 4H4MA 3NMRA 4AE5A 2AJ4A 1V3SA 2DPJA 2OIHA 4X4VA 4I6AA 4Q45A 2WBRA 3CCMS 1BY9A 2B6AB 2XCAA 4C11B 5KFFA 4WZQA 4ZPCA 2YNIB 5DRKA 4F4XA 1B0PA 3G6VA 2EFGA 1M5VC 1GQEA 2MZRA 2QV6A 3O2IA 3HPOA 2JFKA 2XS5A 3M8QA 1Q4RA 1Q8IA 2VONA 2OPQB 2R7VA 2OJ3A 1IKVA 1S76D 1X7VA 4DUZF 3Q24A 4CNZA 4UUXA 2DTJA 3OVAA 1H38A 2HHVA 3G4SS 2HG4A 3RB3A 1Q82T 2XSJB 3T19A 3JB9k 5HROA 4MFBA 3NCQA 2FC9A 1RQ0A 2OFGX 5DQGA 2ZFHA 3SV4A 3IXQA 4RBTA 4PWUA 4Y34A 4NLOA 5E5NA 4H4OB 1HFEL 1TFWA 1S1XB 1NZAA 1LWCB 2HIQA 4RW8A 5IFMA 2KM8C 3CDWA 3RW7A 1UVLA 3VAMA 5KT7A 2N3OA 3U7JA 3QJLA 4LSNB 1SXLA 2I5JB 3R5AA 4Y2KA 3HM9A 4O23A 3GIIA 1FJ7A 5J2QA 1V6HA 2VODA 1Y00A 3KLHB 2OTJS 1BQNB 3GE9A 1XK8A 3BR8A 4GO7X 2ZZNA 2XZWA 3LP2B 2DK2A 1KLMB 1XR6A 3D28A 5CZVA 3M1VB 5KFJA 3OL7A 4IRKA 1YQHA 3OJUA 3T6BA 2E1CA 3L95X 5LSOA 2GA7A 3AHPA 3DYAB 2CPHA 5FIIA 4JUZA 3DLLQ 2BYCA 4NLYA 4NRTA 5G0RA 4DL3A 1VQ5S 5KG5A 5KT2A 1WG1A 2CVEA 1MROB 3CC7S 3T5JA 3KLFB 5CYJA 4ZCMA 2E5GA 4ICLA 3OTDA 1VBXA 2ROPA 4WE1A 1N52B 2FVCA 1CQNA 3NWGA 5C25A 1FE4A 1XN9A 1FJGF 2RSQA 2DNPA 2FJXA 2CFXA 3MR2A 3VAGA 5KT4A 1TK0A 1FK9B 3NRBA 1U2FA 3BGLA 3UCGA 4TY9A 3PW7A 2XO7A 2MKCA 1S99A 2LLZA 1VRTA 3PV8A 3RBDA 1YJRA 2IYGA 4JI1F 4H4KA 2RJZA 4QOTA 3BDPA 4DV2F 1ZAVA 3ISND 1QM9A 1RYRA 3TNVA 4QW9A 4CT9A 4A8WA 2GV1A 2QO3A 4JI6F 5L38A 4LT6A 2VG6B 4X66F 2UV8A 1D9FA 3CC4S 1RISA 5D4LA 1V3ZA 1K0VA 1SI9A 2M9KA 3WBZA 2BRKA 3NP5A 1E6VB 4V19X 3NNHA 4H54A 4OX6A 4R25A 1FK9A 1FDNA 2KO1A 2DIUA 2C42A 4JBCA 2KN4A 5IZHA 3K5NA 2ZH6A 1TVRA 2FHJD 2XEXA 2NR0A 3MMAB 2WW8A 2XMJA 3C8YA 1Y5NB 2VFSA 2DH7A 1P8GA 5A6WA 1F5AA 2D9OA 2MPUA 3KJVA 3QYYA 7FD1A 1KS2A 2FVPA 3NCRA 4I2QA 2IA6A 1ZH5A 2ZD1A 4A8MP 2W9CB 3BQ1A 2QA4S 3PW5A 2DISA 1HL6A 4WU2A 3HDSA 1VQ4S 4H4MB 3EGZA 4HTJA 2LMIA 2Y1RI 3GYXB 2EVZA 2ZNYA 1RP5A 3CJ3A 3DOKB 5CH7B 4HEA9 5K9FA 4MMOA 5F9LA 4LF6F 1CC7A 4IFVB 3K5LA 4DDFA 2QZ8A 2C2RA 2BQ3A 4DOZA 1S9GB 3MEGA 4PXDA 3PJXA 3OTEA 4ZKAA 1K1QA 2RD5C 4GO5X 3FMBA 2ZH8A 4L72B 4EZ6A 2EC0A 4ELVA 5E3RA 2M5YA 4ECXA 3KLHA 4RW8B 5HLFA 1U48A 4NYZA 3HJFA 2MKKA 2HNYB 2ZKUA 2BE2A 3KHHA 2N3LA 2ZC3A 2W25A 3BGFA 5F41A 2WRMA 3TW0A 4KJIA 2OFHX 4LSNA 2R4FA 4G3IA 2PMZD 3AH6A 1UJ6A 4RU2A 2HYIB 1DRZA 1MU2B 1HQUA 1V3RA 4DR2F 2VASA 2VFVA 2YWEA 3I87A 4KHMA 2BQUA 2V9KA 3DCAA 6FDRA 3X3UA 4RLEA 1S1VB 1MSWD 2B9WA 1XWLA 3CXCR 2M3DA 2XCPA 2QA2A 4QR0A 4TLQA 4NYPA 3K7RA 4RW4B 5B0AA 2R2UA 2VBZA 1UAWA 2PC6A 3MR6A 2VBYA 3DM2A 2HVHA 1QE1B 2RU3A 1ULRA 4ICLB 3QZ8A 1MMNA 3VZIA 3VWSA 2N82B 4QYZJ 2D7SA 1KOHA 3DLEB 2V4RA 1R43A 1T7PA 5ITHA 5I3UB 4WJBA 1HPZA 3V2UC 3TA1A 2C22A 1VC5A 6FD1A 5DO2A 2YKNB 4XPCA 4F02A 1HARA 2EFVA 1JLQB 2DNGA 2ZDPA 1Q7LB 3SCIE 2L08A 4DR4F 3QWUA 1MWYA 2DBBA 5D4NA 4LF9F 2FJVA 3TUJC 1T94A 4AYBD 4LUBA 4XPEA 2R7SA 2JHEA 4ILRA 5K14A 5LSRA 2PEHA 5J2NB 3KYLA 1FKOB 3DRSB 2ZH9A 1UKUA 4N41A 3NL0A 4DBQA 2K2PA 2UVVA 4N47A 5J2MB 4F2RA 3BSCA 3GFYA 1TK5A 5A8RA 3G96A 2EBGA 4B9VA 1U25A 2VFRA 3WC0A 2IM2A 3JSYA 2EK6A 4Y65A 2ZH1A 3O44A 3KNGA 4O3RA 1F0XA 1FVSA 5DDPC 2YKPA 3ETOA 2RQ4A 3TO8A 2BM1A 2HGNA 2VC0A 3IRWP 3PX4A 4NZ7A 3BREA 1JNZB 1KOOA 4OLOA 2HMIB 2MDAA 3MTJA 1M5HA 1R0AB 4A8OA 4C98A 2ASDA 3CCQS 2CZ4A 3CJ0A 1PO6A 3KLGB 3SFGA 4J5OA 1QUPA 5T7LA 3I6PA 5J2NA 4RW7B 4EYIB 3POTA 3SZ2A 2X1AA 1GXLA 2O1PA 5IS2A 3GFHA 5J2MA 1L3SA 4BHQA 3TRGA 1HBOA 2PDAA 4RWXA 4RW9B 1DZ5A 5LJ3Y 4KKOA 2NUUG 1R6YA 4NLGA 3A8EA 1T05A 4TY8A 5BYQA 2DO4A 1JLQA 5K14B 5CA5A 1N33F 3M05A 1ELOA 1F9FA 2OAUA 2YX1A 4IDKB 4K4SA 2B5JA 1FCAA 2QMWA 2YWKA 1N0VC 2CPIA 2KXHA 2EWHA 5I42A 3GZ7A 4BCAA 4DR6F 1FXLA 1SH2A 1KFDA 2JOQA 3OVSA 2Q6BA 1JLCA 1Z1ZA 1KC8T 1DAXA 4AXIA 4FXWA 2M88A 3OR1B 4JV1A 2HHQA 3PDNA 1TV6B 3HMJG 3C3LA 3MCSA 2HZCA 3OFFA 2HWTA 1TKDA 3BJYA 4B9UA 4DWIA 4V19J 3W2WB 5CYQB 2K3IA 4JI2F 3FDSA 3M6XA 4U7UK 1NH8A 3LANA 3MUVP 1M5SA 1Q79A 1HBMA 3M2UA 5C24A 5HO4A 2P6SA 3I4PA 1KVJA 4Y2IA 1VLYA 1CLFA 4KBIA 1QSLA 2XULA 1HBUA 4DV7F 5E2QA 3MM6A 3R5CA 2ABYA 3JSMA 1JX4A 1VK8A 1SB6A 2GO8A 1SJ3P 4CNYA 3OR2B 1C2PA 4KO0A 1P1TA 2QE5A 1KNZA 2VBWA 4LF4F 4MYUA 1C1BA 4ZLPA 2XMMA 3I0RB 3MMJA 1Y3JA 3VAIA 2J6SA 4ILLA 3TVYA 2GCFA 1RTJB 3TANA 4WTYA 1ZAXA 4W92B 5M2PA 3CE8A 4PUOB 1FKOA 2OD6A 3DLGB 2HRYA 1REVB 2GIRA 3W2VB 5A6PA 2PO4A 2YNFB 3BB5A 4QZVB 1KQKA 4Y2MA 2MHEA 3E3XA 5E33A 2IAJA 3DI6A 4OJ3A 2AJFE 3OR1A 4YB1P 3MHYA 3WC2A 3MAHA 5G0RB 4DV1F 3CCJS 2CRLA 3THVA 2DB1A 3OLBA 1RT5A 1UWBB 2PFFB 3EYZA 2DVIA 3D1HA 1LKZA 2VZ9A 5B0GA 4DHVA 2FTRA 2JSXA 4B9TA 2IM1A 4DLGA 2GFFA 3NGKA 1FD2A 2LDYA 3GV8B 4MK7A 2AYGA 2DRAA 1ZM2A 3BSNA 3Q2TC 3OHAA 4G1PA 2B51A 3UCZP 1H2TZ 1LXJA 1WEYA 2ZBIA 2NREA 1UEVA 1JWWA 4CO1A 1N6QA 3LWLA 4TNOA 4DPOA 1GAOA 3N6MA 4O0IA 2X3GA 2CIMA 5JXSA 4F3MA 4ED0A 4DFJA 2MSSA 1UVJA 1I1GA 4AL5A 2FJWA 3H2VE 2CPDA 2RKIA 3E01A 3LWMA 2G0CA 4J9RA 4DSLA 4YOEA 1WHXA 2R7XA 1TAQA 4ELUA 4Q2LA 1GX6A 1VQSA 2HNZA 2GMHA 5EDWA 3UD3P 2EI5A 1DTTB 1AXQA 4IQXA 2XWXA 3QO9A 1RT6B 4N5SA 5CCLA 3TAPA 3I56S 1S0NA 1FRMA 1TKTA 4DSIA 5B0FA 4PXBA 1DTQB 5KFNA 1OO0B 4HT5A 1VQ9S 2LKZA 3G8SA 2KH9A 1RTDA 3CB4A 2DGOA 2DR8A 1LOUA 1QY7A 3KLFA 5JVGQ 4ZP6A 2DNNA 1WG5A 4I4BA 2OKQA 2KYXA 1FRKA 1V9OA 1DARA 2HAIA 4XIUA 2XLKA 3KOAA 3VF0B 3ZC4A 2BV3A 2BQRA 2ZOFA 5DJBA 2A2DA 3HZGA 4OZ1A 3HP6A 3K5MA 2K8GA 2KRRA 2RUGA 4NWBA 5E41A 4OX7A 5CQGA 5J2PB 1SV5B 2I0XA 1B7FA 2UXBF 3G8QA 2MQPA 3N6LA 3HLUA 4JV0A 1X4FA 1WEXA 2PN6A 4X4QA 5L1LA 2DNLA 3K8WA 4GC6A 5DQIA 4TQRA 1SH3A 2YNHA 3TI0A 2J9DA 2KVIA 3QAEA 1KFSA 4IOBA 3CSKA 1QAYA 1RT3B 1ZOTA 2VPZB 1TL1A 4A8FA 5KTQA 1VJWA 3R3TA 1X0PA 5J2QB 1WTFA 1S1UA 4J9PA 3DU5A 3HX9A 1TR0A 2A2CA 3BN7A 3W2VA 3I0RA 2KM8B 3CD6S 3B82A 2LEPA 7FDRA 1HHSA 2CDQA 1L3TA 2B4UA 1TZ0A 3M9NB 1M1KT 2RVJA 4IYQA 4ALZA 4QU7A 1CQMA 3TUIC 2A18A 1AUDA 3KK1B 4F4WA 1LK7A 4PG5A 3BR9A 2R9LA 3PX6A 2DHGA 2ASJA 4F4KA 4FVMA 2XBPA 4KAIA 3ZZPA 1SUQB 1XR5A 4R0JA 4M94A 5KFPA 3PW2A 4NLUA 2M7SA 2W9BB 1N5VA 1DLOA 1JLFB 1NJWA 1XR7A 3RAQA 2HWIA 3ZZ0A 2BA9A 2CPEA 4X84A 1UJ4A 1D9AA 1YRXA 1K8AT 3MECB 1P6TA 4C8OA 1VBYA 1IKXA 3DXBA 3IAM9 4OI0A 1HBNB 1FESA 3BN4A 1RT7A 1T02A 2PMHA 4IFVA 2ZC4A 2ZITA 4L6V3 4NCGA 1VOMA 4FNHA 2RMLA 4ED6A