1G6BA

Crystal structure of p47s mutant of ferredoxin i
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCESECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords 7FE FERREDOXIN I
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential.
pubmed doi rcsb
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1g6bA00
2VPXB 1PC4A 6FD1A 1CLFA 3MM7A 2VPYB 1KQGB 2V2KA 3IR5B 3PNIA 5E7OB 2VKRA 1F2GA 1H7XA 1H7WA 1XERA 1JNZB 2FD2A 1FD2A 2FJEB 1FCAA 1FDBA 2GMHA 3MM8B 1BD6A 1F5CA 1FERA 3MMBB 1HFEL 1PC5A 1JNRB 1R27B 2C3UA 3MM6B 3MM5B 4KT0C 1KEKA 1RGVA 3GYXB 1FRJA 2Y0SD 3MM8A 1B0TA 1Q16B 3MMBA 1WTFA 3IR7B 1Y5LB 3MM6A 2WSEC 2C3PA 3MM5A 3OR1B 1ROFA 3C8YA 1BWEA 4CI0B 1DFDA 7FDRA 1FTCA 4YDDB 4L6V3 2FJDB 2WSCC 2PMZD 2C42A 1FRMA 5BYQA 2UZAA 1FF2A 3HKZD 3OR1A 2IVFB 1FRXA 1VJWA 1FXRA 1G3OA 1AXQA 1SIZA 2C3MA 2PDAA 5FD1A 2WAQD 1GTEA 5BYRA 3LW5C 3MM9B 4RKUC 1FDDA 1FEHA 2XSJB 1BC6A 1GAOA 2C3YA 4XDCA 1Y4ZB 3MM9A 1FRLA 1D3WA 1FRIA 2FGOA 4DHVA 2V4JB 1BLUA 2XSJA 1H0HB 1SIWB 3EUNA 3IR6B 1GT8A 1FXDA 4OMFG 5CH7B 2V4JA 2FJAB 4XDDA 3OR2B 1BQXA 1DAXA 1F5BA 3MM7B 6FDRA 1K0TA 1DURA 1KQFB 1IQZA 1B0PA 2ZVSA 3OR2A 2FDNA 1GTHA 2PA8D 2Z8QA 1A6LA 2VPWB 4OV1A 2O01C 1G6BA 7FD1A 2VPZB 4ID8A 5BYSA 1FDNA 1IR0A 1JB0C 2FJBB 2C3OA 3MMAB 1Y5NB 3MMCB 1SJ1A 4XK8C 1Y5IB 2GMJA 1FRKA 1H98A 5L8RC 1B0VA 2WSFC 1C4AA 3EXYA 5CHCB 1FRHA 3MMAA 3MMCA 1C4CA 3EGWB 4AYBD 4Y28C 1FDAA 2WB1D
chains in the Genus database with same CATH superfamily
2QT7A 1N6QA 4E2FB 4KKOB 4PCQA 3IWLA 3G6ES 1FKPB 1NMEB 1HFEL 4M5GA 5ITHA 1FJEB 2H5EA 4NYZA 4ED3A 3IR7B 1RAIB 2GAGC 3SQGB 3CCQS 4ZKAA 3O44A 1VQNS 4C3LA 3HPOA 2VV5A 3H4DA 2E5LJ 1HL6A 3WZ0A 2RRNA 3FJ2A 4RUAA 5JMNA 4Z37A 4C4WA 3PACA 2FLOA 3SIPB 4H4OA 4F4KA 1YLXA 1HBOA 4IR1A 1U1KA 1DZ5A 4C8KA 3ENAA 4PRFA 2XZDB 4YHHF 4K2JA 2JVOA 4JI1F 5ETRA 5CYQB 1LK7A 2ATLA 3LGMA 3J7ZT 3M2UB 2ZVIA 4FYWB 5KT5A 3MAAA 4MK8A 3J81U 5BYSA 4QWEA 2YBVA 3CD7A 5A8RA 1RWPB 3K5PA 3FCWA 5CHCB 1PAUB 3UNGC 2VDHA 1C4CA 3AOBA 3GYNA 1FDAA 1U1QA 4PYDA 3K57A 1KQGB 4RW4B 3NGTA 1N32F 4O3RA 2OPPB 4ZLPA 2X1GA 2IM0A 1JLQA 1M5SA 3DMJA 2LEPA 1NSQA 3HSGA 2LXIA 3M6WA 3HLUA 4JI0J 3CO9A 2L41A 1MSWD 1VLOA 1URRA 2JHEA 4IG3B 4DCOB 2DNYA 2WOMB 4B9LA 2MLYA 3CMES 3LP0A 2I9SA 3Q22A 1LWFA 1F1BB 3DLEA 3J81j 3Q86A 1LWEB 4DPTA 3HJFA 2HHTA 2IJNA 3TR5A 2CJYB 2VASA 3DRXA 1PJ7A 2MZSA 2HZAA 2BQRA 2V94A 3Q0AA 1CC8A 3SCJE 4DI6A 5DDQC 4L76A 2OEKA 2XMMA 1HR0F 2GMJA 4FS2A 1TK0A 1TKDA 5HBMB 3R7BB 4DR3F 2CXEA 4PXBA 1KSPA 2HS3A 3KFWX 4FDFA 4LF1A 3SFUA 2V4QA 1HW8A 3MTJA 3DRPB 3HD1A 5CD4H 1F2GA 4HT7A 4OZ2A 2FJEB 3BGLA 3HM9A 5LL6d 1S1XA 1SJ4P 3G82A 4X4PA 2CZ4A 2H54B 1WTBA 1HBOB 2HGLA 4Y3CA 1RTHB 1FJGF 3SCKE 2DCLA 1KVIA 1QAYA 2V5HG 1WEXA 4DWIA 2ZWPA 3DC2A 3QT6A 1LOUA 1RHKB 4LRFA 2BOAA 3MAAB 3T1YJ 2C2RA 1GXLA 2XSJB 4ED6A 3R1HA 4WP8A 3KHHA 3CJ2A 3K58A 1A7GE 3RBDA 3W64A 5A8KA 3KUEA 4IG0A 4PXDA 3D6TB 4C8MA 2DXDA 2BVZA 4A47A 3T9NA 4HL9A 4KQZA 1YRTA 3B82A 1B3TA 3I4PA 1YX2A 3SQOP 5LMNF 5HO4A 1YKWA 2E7VA 2F7VA 4FVMA 3TJAA 4C0BA 2C2NA 3M6VA 4DV4J 4DR6J 4K8RA 1H7WA 1RA7A 3NP5A 3CJQA 3KLEA 3HKWA 4ZDNA 4P71A 1N5QA 1T03A 2QA4S 1RU1A 3V4IA 4OYOA 5E33A 4OX7A 4C2MA 1U0HB 1BWEA 1S9GB 4QU7A 5BYQA 4ZITA 3V81B 4HH0A 2C3MA 2CADA 4JI2F 1U0SA 4YEAA 2NR0A 5IT9Y 3PTWA 1S1WA 2MQMA 3MEDB 4X4OA 4RO0A 2IBKA 2MDAA 3VVTA 3EGVA 5KFYA 3CJ0A 1TQLA 6FDRA 1SL1A 4A8YA 1YIJS 1M0SA 3V5RA 4OL8A 4FXWA 1S1XB 5IC6B 2EVZA 3KDNA 4NA3A 1WJ9A 3CXCR 3BQ2A 1QAIA 1S5ZA 1VRTA 3E2EA 3IO1A 1YJUA 2HVZA 4K4ZA 3FMBA 3ILJA 4QWDA 4J9QA 3OHAA 1RZMA 2FD2A 3OFGA 5A8WA 1FCAA 3CC7S 4DZDA 1IBLF 3RGIA 2Y1IA 2CDQA 4ZVHA 1FK9B 3NMRA 2WSEC 3LOUA 5A8KB 4O0IA 4YDDB 4L6V3 2R8IA 3CCTA 4OZ0A 3C6TA 4CQ1A 4EFAC 2RNEA 3IG1A 4N8NA 4DL6A 1S7HA 3CCLS 2WVBA 4DHVA 2E1MC 1C0UB 3QGPA 5HLFA 2NCKL 3SBMA 3HVAA 2NZCA 5CH7B 3IA0A 5JXSA 4DBQA 1TTHB 1WI6A 4ED0A 5AJ3F 1JLEA 4CO2A 4NLQA 3KLEB 1UZDA 1DHMA 4RUCA 5L9XA 1RT2B 4RBTA 2XC9A 3SYZA 2KL8A 3KXDA 3B8HA 1NJWA 4LVOP 2IMOA 5HSPA 1CJTB 3KNGA 1S6QB 2EFQA 3KK3B 2IY5B 5HVFA 1RLDA 3O1LA 2KHCA 2LVWA 1CC7A 1S6PA 1KEKA 3ENVA 2CQGA 2UUCJ 1X5TA 5HL7Q 5I3PA 4A4JA 2Z0GA 2BYCA 2KZMA 4Y2AA 3VZIA 2W2MP 5IT4A 1RWUA 2B9WA 1TV6A 4EGLA 2QEXS 2LYVA 4ANEA 1T9VA 2FHKA 3LALA 1VRTB 1SC4B 5B08A 4Q8FA 1SXLA 1UWBB 3BSAA 1B7FA 2ZBCA 1GT8A 4AUKA 4FS1A 1NO8A 2XI2A 4B17A 5B0AA 5M2RA 1T9XA 1RTJB 1TKXA 3V2UC 3J7A1 1SJQA 3AJ1A 1AYEA 3R7SB 2WZ1A 2ZJQQ 1RJJA 2KXNB 3MMAB 4JUZA 2OKQA 1ZA2B 4Q0BB 1JLBA 1GEHA 4DPWA 3HSDA 3C6TB 1B7YB 3BGOP 2JFDA 2A2CA 3D1OA 2QGFB 4X4NA 2XWYA 4MT1A 3U7JA 4USUA 2PD1A 3EMTA 2HFOA 2XYGB 2DPJA 1VHFA 4BCAA 1PBUA 2R8KA 3MR7A 1HMVA 2B9YA 1QDUB 4WE1A 1JLFB 3G71S 1YJRA 5KFIA 1KN6A 2QSWA 4Q45A 2UZAA 2DGSA 1VJWA 3U1LA 1IKYB 2JX2A 3CJ5A 3NRBA 4DS4A 2OPQB 4G3IA 1NJXA 3CCZA 1S1UB 2HPUA 2KVQE 3FBBA 4TYBA 2XYHB 3OVSA 3M2RA 1YRUA 1N0VC 1RISA 1PO6A 3QT5A 2ZBQA 5LJ3Y 3GV8B 1T05B 2RVJA 4DV6J 2XMUA 1S72S 4JI5F 4DPUA 1S1VA 1JWWA 2QFIA 4ZJQA 1CQNA 3I5AA 3SEOA 1L3SA 2KB2A 2G2OA 4ATNA 1KKHA 4LUBA 1FFGB 4ZVTB 3I6PA 1SC3B 1I94F 2YKMA 2E5GA 3GV7B 2KRBA 3U27A 5BXIA 3AA8A 3GB0A 5K8MA 4F4XA 4M5LA 1T7PA 2DNZA 4RZRA 2HFZA 3ZFVA 2EFOA 3VF0B 5KTQA 3B78A 3MPVA 2Y0BB 4WFBQ 3VAKA 3D7SB 2ZM6J 4OHVA 4ZPWR 4DPXA 1NSAA 3NKYA 2F5GA 2RT3A 1RT6B 4YR3A 4PEOA 1XNQF 1R0CB 4B3OA 3HZGA 3QO9A 4LR9A 2W25A 1O0PA 3HZEA 3F0NA 1KDNA 1U25A 3OUYA 5F9NA 2EI5A 3CDBA 3BBCA 4A8FA 3TX8A 1JLBB 3VQSA 3RBEA 4ZCLA 2BA9A 2HHUA 4UOGA 3AOAA 2PFDA 2ZHBA 1OS5A 1HBUB 2CQ2A 3AFGA 3LP2B 1YHQS 4PR6A 1Q8KA 3TAPA 4ZPBA 3UDLA 4G1PA 1UJ4A 3G87A 4ELVA 4KH1B 1UZHA 4KH0B 2XNQA 3MEGA 2KM8B 4CLTA 5D3GA 4Y28C 4KPCA 2A1BA 3IR5B 3HFKA 2CNNB 2JEJA 2GMHA 3C3LA 4JP8A 2PMWA 1XEZA 2HRUA 4YB6A 3OTDA 5K8PA 1Q0NA 1ZM9A 3ZTPA 3RBZA 2H4WB 2KTQA 3TRGA 3NGSA 3T5LA 1NJZA 5H1SV 2M7SA 2OJ3A 4TU7A 2F63A 2GIFA 3CD5A 4WFAQ 5ETTA 2OLWA 1CJVA 2A18A 5EX0A 2RKIA 1UVLA 2F4FA 3H40A 4WPAA 2V34A 2I5JB 3S1TA 1MW7A 2FVSA 1REGX 3E8OA 3CCMS 1U6FA 4CIOA 4RW7B 4NZ7A 2VQFJ 1VIXA 5FJ4A 2Z4PA 2D3O1 4WFZA 5KG5A 3EGWB 4PG5A 2BXJA 4B3OB 1I5OB 5C25B 4X62F 5E2QA 2GAHC 3AOCA 2IBOA 3OUYB 2ZD1B 1S9FA 4LRBA 5DO2A 4RU2A 4OYZA 4RNOA 1U2FA 3FCVA 1F5AA 5HANA 2WBMA 3US5A 3IGNA 4LFBJ 1GXTA 3K5OA 2VONA 5L1IA 1X0PA 3MEEB 1CBKA 2K8GA 4ED2A 1FXRA 2MZJA 2YWFA 2YTCA 3RB3A 1QSSA 3WX4A 3CCRS 4O0NA 5J1PA 2HNYA 2KVIA 2DEIA 2QYGA 2AF6A 4NOHA 4S0MA 4LR8A 4FN5A 4L74A 2HLUA 4LMZA 3KKFA 4C8LA 2DK2A 2MQQA 3UDVA 2OIHA 3QLHA 4X65J 3HFVA 3V6JA 2RS2A 2P6SA 2FJXA 5IV4A 2MGZB 3TA1A 3KLFA 3C14A 4CM0A 4C48A 1HYSB 3IWNC 5CYMB 9RUBA 3DYAB 1FERA 2OEMA 4EI2A 5KOXA 2HVHA 3TUJC 3DHXA 3MM5B 2IDEA 2V50A 2M5YA 2QG9B 3Q8QB 2I1RA 4EYIB 2ERRA 4DLEA 2EWHA 3UCGA 4ECVA 1MNEA 3CVKA 3AODA 5THWA 1YGYA 2AX0A 1RA6A 2JEFA 2FJVA 1KFDA 2YNFB 2XY7A 4XDCA 4KY3A 3PRBA 2ILZA 2VOPA 1YJVA 3FBEA 1EETA 2UXBJ 3D6HB 3GWCA 1RT5A 5ETSA 2BDPA 1UEUA 2FQQB 2YNGB 2CFXA 2M0GB 4ES3A 4EBCA 2JFKA 4C0HA 5DDOC 2FHJA 1M5KC 1ZYQA 4J9VA 3NLCA 4RW8A 2BE7D 5F8JA 1RBLA 3MEKA 4P7VA 1C1BA 5GAGI 4EO6A 2W9BA 4I6WA 3LGHA 1OSDA 2HZVA 4WK3A 5KAKA 2H51B 3MM8B 3PO4A 1S76D 1TUGB 2HHPA 5HP1B 2K2PA 3M6XA 3NGUA 3PR4A 4DSJA 4J9OA 4Y2CA 4FPIA 2BW2A 1IBMF 2C22A 4B3SJ 4PAAA 2ZH3A 2P9EA 4U8VA 3HHLA 4ZHRA 1S0OA 1N88A 5EX3A 3RUBL 1K73T 1HNWF 3RTVA 4P2MA 2MKSA 4GO7X 3P49B 3PX4A 4FP9A 4IKAA 5G0RB 2IM3A 2ZZMA 5C24A 1RI7A 3BH7B 3W65A 2QA2A 5EGYA 1ITPA 3DNCA 2D3UA 3BYRA 1K0TA 1RB0A 2CPZA 2XS2A 2KZZA 3F44A 3G2XA 1P1TA 4NX9A 4AL5A 2AHOB 2QYCA 4CZCA 3POTA 2F65A 4PWDA 3EXCX 3V4MA 2ZH1A 1AUDA 2FVPA 5EHHA 3OFHA 1BY9A 2OEJA 1JXEA 2HGNA 2V2VA 2OAUA 2KO1A 2YH0A 1R0BG 4URQU 1RTDB 4OZLA 3KLIB 1QAXA 3GJQB 2J0SD 5DZ6A 2VHGA 5BJRA 1KQSR 1LWCA 4ECWA 2VIHA 2COLA 4JI8F 4QIGA 4K4SA 4IUFA 5BR8F 3M4XA 4UOHA 3CD0A 4Y34A 2GC8A 3CJKA 2POKA 1RT5B 1UCNA 2WHOA 5GAHI 4K0KJ 3J7AN 3CCUS 4Y65A 1VQOS 2XZWA 4ZLJA 5HVHA 2HFUA 4H4KA 5LOQA 4DX8H 1TL7B 2B8QA 4TY9A 1NDPA 4V19X 3G96A 2N4DA 2W9BB 3GQCA 1DAXA 1N48A 1FKOA 2XMAA 3DRSA 3EDRB 3W62A 3A3PB 1QAJA 1PG5B 1VQPS 1N36J 1H98A 1APSA 2HVDA 4K7QA 2ZZNA 2VF3A 3FZBA 4K4VA 4RPFA 1BQMB 3QJJA 4TYAA 3CT9A 3CCVS 2IIHA 3MTKA 3MM6B 2CNOB 2MKCA 1Y5LB 3B6BA 2WONA 4DUZF 4LQ9A 2P8IA 4R0EA 5F0WA 2ROGA 4CTAA 4Z7CA 1Q5YA 2LEAA 4A8MP 2PI4A 1FRXA 2ZFHA 4EU0A 4I7FB 1U7LA 2QE5A 1XMQJ 2FY8A 2G0IA 4ES2A 4OI0A 1H38A 2C2ZB 1HLWA 2E7XA 3POTB 2F1FA 5J2PB 4OHZA 3EUNA 1D09B 4DR2F 2CQ3A 4LF2A 3GLJA 5HATA 3HULA 5KFWA 2P9CA 2ASJA 2KJWA 2J0XA 1T3OA 5A0YA 4ECQA 1J5OA 1NB2A 4J9NA 1M1GA 2Z2MA 3LAKA 2QX0A 4HYKA 2APOA 3IFEA 1DJ0A 2EC2A 1I3OB 3BZQA 3CIMA 4TKTA 3IP0A 1R8BA 4ECTA 3VQTA 2CVIA 3QFHA 1KLMB 2K7KA 4NLPA 2HIQA 3DOLA 1RE1B 1N5VA 1LWXA 2DYAA 1WC0A 4FVCA 1FJCA 1JLAA 2W4DA 1QJHA 1AB8A 3N6LA 2Q1LA 1U1NA 5KFQA 2Q43A 1QSYA 2UUAJ 3QGIA 2E9ZA 1S7IA 2JVRA 3NOCA 2B9XA 4XPEA 1F3FA 2ZHAA 1H74A 4B3TJ 1GMWA 2XGPA 1OY8A 1I51B 2W2OP 3HO1A 1WG5A 5B09A 4ED1A 4KV8B 3M8QB 3PW7A 1E6VB 1TU0B 4R8UB 4NLUA 2LCWA 4P2SA 2XULA 3IXQA 1BGXT 3P8BB 3EDQB 1OIAA 4I64A 1VQ7S 1XR7A 3W5ZA 2JEIA 3V6KA 4GC6A 2DCUB 1PAEX 4LF5J 3DOKB 4CTAB 2OPRA 1FRHA 1PIEA 2FC8A 2MTLA 4WKRA 3GIRA 1CLFA 1RSCA 1Z1ZA 2UXCJ 3PYGA 1PGZA 5ETOA 3PEHA 1SH0A 1WKKA 4XPCA 1B4SA 2BJDA 5LSLA 3TAMA 2FHMA 4WU3A 5A0YB 2X1AA 3FEZA 2Q3PA 2EPIA 5L1KA 1DTQA 4YB7A 4O44B 2F4VF 1C1CB 4MAKA 2OTLS 4HHHA 5KFTA 1Q5VA 3KLHA 2HQ3A 3M8SA 4WF9Q 2AJ2A 4USWA 1YDLA 2RMLA 1NKBA 1W2IA 1WC1A 2XEXA 2ZBRA 4YQWA 1UFKA 4LF9J 1OQ3A 2VUGA 5K20B 4P74A 5IFMA 3MPUB 3MZIA 4UF4A 3ZZOA 1QY7A 1FXLA 4CH7A 1WF1A 1IXKA 3BF4A 4B9MA 2J7KA 1KR4A 3AD8C 4I68A 2CQCA 1NDKA 4QR1A 4USHA 2OMLA 2XG8A 4KGKA 1CJKB 2M2BA 1BMQB 1HNXJ 5E3CA 3PY8A 2BJ1A 1SQEA 4LVNP 1OY9A 2EFVA 1WOPA 1GFWB 3T6BA 4HTJA 4C6AA 4WP9A 4C3KA 3UR0A 3FFIA 1FWLA 4CO3A 1FRJA 1WTFA 5D77A 1RK8A 1R3NA 4K4XA 4RNNA 4NXNF 3SCIE 1M90T 1OYEA 5ADZA 2CPXA 2VG5A 4Z7YA 3UVJA 1VIOA 4W92B 3DGPB 2GS8A 2FJWA 2HAIA 3TZZA 4ILRA 2JOQA 4DV1F 4FKXA 1YBUA 2B7CB 2J7UA 3EJMA 1N5YA 1WC6A 4USMA 5DLFA 3M1VB 4CT9A 2M4MA 2DVIA 4MK7A 1OSCA 4EUVA 1X5SA 1HIYA 4I2QA 1MROA 1VQ8S 2ZH6A 1IQZA 4QIEA 1VC5A 4KO0B 3OL8A 4DR7F 4UOCA 3IRXB 3ZTSA 3NCPA 4DFKA 5AXLA 3Q89A 3MMCB 5B7WA 4OI6A 3D67A 2A2DA 3BEGB 1X9MA 4LF7J 2RHSB 1TVRB 1HW9A 3BO3A 3V6HA 2F3JA 4ZOSA 5EN1A 1R43A 4MIWA 5E7OB 4CNZA 1NK9A 1SV5A 3J7YU 1JXVA 4ECSA 4NI2A 2W9CA 5F3TA 1WF2A 4DLGA 5H9EK 5J1EA 2GJFA 3MAHA 4MFBA 1BQNB 3VTIA 2LP4A 3LWMA 5DGAA 3A12A 3OLAA 1NSPA 5E3PA 2EBEA 2HZCA 1LXJA 1HBMB 5IWAF 3QZ7A 3MM9B 5KFCA 2E5LF 1PYSB 4LR7A 1F6TA 1JMTA 4L75A 4F02A 4ENOA 5FLXY 1CS4A 4URSA 2VA3A 4OYWA 3GFYA 3BGRA 2DKOB 1D1UA 3BREA 2VFVA 5KFGA 4LRCA 2BV3A 2D3ZA 3BO2A 4I67A 2BANB 1YJ7A 3VAHA 1BHNA 1IQTA 3L3CA 2XHCA 4GVBB 3OL9A 5KOWA 5I4MA 3CW2C 1X0FA 2BE2B 4WJBA 4DFPA 3CIZA 3ENQA 4QBUA 2UVWA 1T9UA 5B0BA 2BJ9A 3UW1A 3QZ8A 1NK6A 4GRSA 4J9SA 1SUQB 1YBTA 3Q8SB 3KK1A 3MMJA 2D1CA 3WQPA 3BV8A 1S57A 3ZZ0A 4JI0F 2FLPA 4KR0B 4FNIA 4G1IA 4IRKA 3LO3A 1BC6A 2H9ZA 3R5BA 5D4OA 3FRYA 1IM6A 4UY8T 2MSSA 1NCLA 1S49A 2FGOA 2FVRA 1YBAA 3CD6S 3WBZA 5KT7A 2YNHA 2BRKA 2RJZA 3UN3A 4C8NA 1WOOA 1SV5B 4NI2B 1SKRA 4ED7A 1REVA 4F0MA 5HROA 2VQEJ 1U8SA 3GONA 4JI7J 2CJ9A 3MAQA 1TK5A 2D9OA 4JI3J 4DSEA 3TW0A 3PEJA 4Y2KA 1NJIT 1CVJA 5IS2A 3R2CJ 4OV6A 5CABA 2JEGA 4AT1B 1UPMB 1U6ZA 2AJ0A 1VBKA 4I2PA 2OTJS 3T5JA 4PUOA 2QZ8A 1RTIB 1WDDA 4ZK7M 4DQRA 3R3TA 1Q95G 1EKRA 3H25A 4B08A 3MD1A 3NWRA 1UVIA 2DGQA 3JB9k 2ZZTA 2XMKA 5ETPA 2DR5A 1VBYA 1ZA1B 3ZXWA 1WSVA 3T41A 3T9ZA 5JVGQ 3T1YF 3PZPA 2HLTA 3AY0A 2DNHA 2K06A 1ZTTA 4GMKA 1ZBTA 3QIDA 4C0OC 3BGFA 4CP5A 2R42A 2YKQA 1IJFB 3PCOB 4HTIA 2XNRA 3MR6A 1UETA 4OLOA 3EVMA 3TZXA 2MMYA 3UN5A 1NHKL 1W7WA 1FHTA 5KFPA 3KHRA 3QIPB 3GG0A 4JV2A 3T19A 3UPFA 1S99A 1ELOA 4Z2XA 1Y00A 2BQ3A 2PT0A 1MMLA 3QAUA 3IM8A 4OI2A 4KHMA 4DV4F 4DR6F 5MAOA 3THTA 2M70A 1JQGA 4J9MA 1SH3A 2Y8WA 5DETA 2D74B 4QIVA 5D4LA 4DL4A 1BWVA 3I5CA 2DNKA 4AL6A 3ZZZA 5ETQA 2CIMA 4FXVA 1K1QA 3Q2TC 3H59A 2DHGA 1LV5A 2F8EX 4TU9A 4R25A 3BBBA 4OI4A 2RE1A 2KM8C 1EHWA 4DCPB 4CO1A 4PWUA 5KT6A 4WXOA 4UUXA 2HQCA 3PIPQ 2ZE2B 3R27A 1XTZA 2KFZA 3ZZYA 3ET6B 1UA1A 4A46A 3DM2A 1IJEB 4WFYA 3KJQB 4M1KA 3D6MB 3E3XA 2B3TB 2B5JA 2W2PP 2UXDJ 4USVA 2Q66A 4ZP6A 2FHJD 2M88A 3LGNA 2E5IA 3N5BA 4UW2A 4F67A 5J2MB 3QNWB 3BKFA 1H2TZ 1NPPA 1S6UA 1VJQA 3M2VA 5IOLA 1XN9A 5CZXA 4B9UA 5K14B 5F8HA 4ES1A 2KT5A 1B0TA 2AEJA 3HVTB 2YY3A 3HHLD 2Z56B 2WVFA 1HBNA 1VRUB 2U2FA 3DRRA 4G1QA 5D8HB 2BMBA 3LQVA 3LAMA 2VDIA 3CF5Q 3H42A 4CH0S 4C8ZA 1EP4B 5KFSA 3S7RA 1PYTA 2NREA 1NH7A 3P5TL 4RW6B 3JYTA 4DFMA 4K50A 1N4LA 1BQXA 3C66A 4NYOA 4OYBA 3VGUA 1RT1A 5CAAA 4OZ3A 3W8PA 1X4FA 1U45A 2VG7B 3OJUA 2V4RA 3FBCA 3EXYA 3GMGA 4DG1B 2N3LA 3PHTA 4DL5A 2VPYB 3FMWA 4P6QA 1VISA 4DV2J 2OGUA 4LSNB 1KD1T 4J5OA 2VG6A 1KHWA 4AQYJ 5KFZA 2QL5B 3NXZA 4AL7A 2KT3A 2RB7A 3R97A 3JTPA 3ILOA 3MPWA 2CG8A 3WDOA 2YWGA 3NNCA 3QRPA 4DX7A 3EICA 2ASLA 2MEWA 4NRUA 4F4YA 3M30A 4ZMMA 4X4VA 4B3MJ 4NASA 2HIYA 4ICLB 5F9LA 4HT5A 4N77A 2DNOA 3TARA 2ZH5A 2W01A 2W1BA 4U9RA 5C2GA 3B4MA 2G2YA 2N82B 1HHTP 3JAMY 1WEZA 4PXEA 2JL9A 2OO4A 2ZJPQ 4DR5J 3N5FA 1EIYB 1IR0A 4OLPA 3ICLA 1V3RA 4RW9B 2YPZA 5I3UA 1OYDA 1RAHB 1SVDA 3GZ7A 3W61A 4N8OA 3UE2A 4YR0A 2VJVA 1VQYA 3MI7X 3RW6A 4JV1A 3K59A 1FJ7A 1CSJA 3G6XA 4F2RA 3W2VA 4J9RA 2Z58B 2DO4A 2IYGA 4K59A 3TVKA 1RGVA 3A13A 4M5KA 4HKQA 2H1YA 2GV1A 3C6UA 2GVDB 4NXMJ 2HK2A 1RAFB 3BB5A 4JOUA 4UQGA 3G8SA 4IRCA 2HHVA 3NEKA 2FLNA 4DV3J 5BYRA 3MR3A 5DRKA 1RT4A 1B64A 5T7LA 2B4PA 4WKYA 3PM9A 4CLFA 3TWZA 2XLIA 4HDHA 5HN0A 5LXRA 2V4JB 2CVEA 3MHYA 5F0UA 4QYZK 1Q81T 1QTNB 3WIVA 1NLKL 4DV6F 2VG6B 1SC6A 4ETXA 7FD1A 1DTTA 4IYQA 2G1HA 1LW2B 4L73A 3RB0A 4GO5X 4F36A 2EFNA 1V5IB 1NK5A 1FFSB 3IRWP 2EFPA 2RF2A 2QO3A 4FYDA 3L7OA 1K0VA 2O3DA 3AA9A 3OW2R 1D8ZA 2ABYA 1LKZA 2CDRB 5DM7Q 1SC1B 4P10A 5KFHA 3M8RA 2J9DA 2LU2A 1IKXA 3AH6A 4ZIVA 1C0TB 4DV7J 4OYMA 1QVFR 4HACB 4UQTA 2AYMA 4NMLA 1RAGB 2NUUG 4EK2A 2ZM6F 4P73A 3ISZA 1LW0B 1NUEA 3HCXA 1MWYA 1FF2A 2QV6A 2HBQB 1GMWD 3TVZA 4J9KA 4LF8J 5G4DA 2JC1A 1RHQB 2AGPA 4NLYA 1KHVA 3BM7A 4M5DB 2GGPB 2IA6A 2XMWA 1KTVA 2Z8QA 4F26A 1NXIA 3QSIA 2O5DA 1SKWA 1Y11A 4RX6A 1CULA 2CZ9A 4XO0A 3C16B 2HBYB 1S9EB 3OLBA 2AGOA 2DR6A 2RD5C 1D9DA 2WTFA 4KKOA 2X1FA 2VBZA 4G6VB 4RNMA 4DR1F 1IUJA 1HQUB 4U6PA 1RYRA 1QD1A 2ACMA 4A8QA 2B6AB 2FC9A 3FZ2A 2DR7A 2E9TA 2V8DA 3PX0A 5GAEU 3H8YA 2WVEA 5HQMA 3KMSA 1UVKA 3NNHA 2MQ8A 2MY7A 4YY3J 1HPZB 1WHVA 4ZP7A 1RU2A 4LBHA 5CYQA 1IKXB 1TELA 1AW0A 1F2HA 4CNYA 3M2UA 2EKYA 4EWTA 1HWKA 1FRKA 2ZC4A 5LSOA 2VQFF 3TO8A 2XYPB 4IFVB 4DSIA 2IJRA 1RHUB 1ZZFA 4TXSA 2Y1LB 2LQ5A 4X66J 4N7TA 1UAWA 4QJVA 3WC2A 1PYOB 4JV0A 7AT1B 4RW4A 2DJWA 2DXEA 4IQXA 1Q82T 2OPPA 3MR2A 4BDPA 1R89A 3MXHP 1T94A 4CYUB 5D15A 2RDIA 1NZ8A 1ZH5A 4H4MB 2RUSA 3KJVB 2AV5A 4LFBF 3EPIA 2IVMA 4ZCIA 3LPEA 3PW0A 2HVEA 4IG3A 1FDDA 2H5JB 3IAM9 1RHRB 2XY6A 1ZOTA 4KGXB 2LU1A 3JSMB 2MY8A 5IXUA 2R2SA 3SSRA 4ECZA 2XCPA 1H6KX 4XTTA 2Y8YA 1LWEA 1RAJA 1VMBA 2OPSB 3PXGa 1S97A 2DO0A 2CQ4A 2EKNA 3I0RB 2AEFA 2YQ0A 1L3UA 3H5UA 4ECUA 3ZZUA 2Q6CA 1U48A 2DGTA 4ZVOB 2FHOB 2MZRA 4X65F 4F4WA 2UUBJ 1Y5NB 2KDOA 1YQHA 4J90A 3PRDA 3GP9A 2R7VA 1T9TA 3MWBA 4RJVA 3I31A 3GCWP 2GIRA 5HBMA 1T95A 2ZH2A 3FQKA 3D28A 3GE9A 5KFJA 3NAIA 2V8PA 4USTA 4QW9A 4KHPF 3OJSA 3D1HA 3DRPA 2DNGA 3H98A 2XS7A 1NU4A 2DEJA 3UQSA 1Y0HA 2X7IA 4J9LA 3LPYA 1NKCA 3UN2A 4W90B 2XHWA 1XC9A 1EB0A 2I38A 2AIRB 4J9UE 1RTHA 4BC7A 2ZC3A 2HHHJ 4FBTA 2BQUA 2L48A 2IAJB 2LXFA 2RRAA 1N8RT 5C7PA 3NBPB 3GYGA 4ZJLA 2XSJA 4RLEA 2A6OA 1H0HB 1XNQJ 1ACMB 1F0XA 3THVA 3DGVA 2H65B 3CGIA 3DLGB 2UXBF 2PIIA 1GX5A 2R2UA 4QR2A 2LEBA 1T0TV 2QRRA 2ZVSA 3JS9A 2RQ4A 4ELUA 3UO0A 4RR5A 1FDNA 2CWKA 3CSKA 1SJ1A 2A6MA 3DN9A 1U47A 2DY9A 4LF4J 4F7VA 2X3DA 3IGVA 4RBUA 1UA0A 1Y3KA 5B0CA 1RDRA 1IKVB 4O3OA 5FDLB 1CQMA 2OMOA 4P72A 2PGCA 1FTRA 1QE1B 2G2ZA 2EK1A 4O4GB 2AYGA 3M9OB 4Y6IA 4KGMA 3FKBA 4B3SF 3OL7A 3EE3A 1FO1A 1U0HA 4D3GA 2G1DA 1ZM4A 1S9GA 4ED8A 4NA1A 1RAEB 3V81A 4CO0A 1GK8A 1HNVB 1H72C 3MEDA 4ANCA 3LA0A 2P6TA 2C28A 4NEZA 5JUMA 2FYXA 1L3KA 2BJ3A 1VLYA 1FA0A 1EKSA 3E01B 3G8QA 3HK2A 4LSZB 2DGWA 3SZ2A 5HAOA 4RL1A 3IS9A 1Q78A 1X4EA 5AXNA 1WELA 3R5CA 2JWNA 2L08A 4MYTA 3I5BA 1T3NA 3H5YA 3TA2A 1Y10A 2RQMA 5DG9A 1ZETA 1Q16B 2GQ2A 1FNXH 3P5BP 5KFMA 2K3KA 1KBRA 5F41A 2RDJA 2GNKA 4O3NA 1FK9A 3PIOQ 2KN4A 4UOFA 2PEBA 1IM4A 5M2PA 4D3HA 2E1RA 4K0KF 5FLXU 4PG8A 2C3YA 1YSJA 3H2LA 3VAMA 3EZOA 4FYVB 4Y2MA 2DH8A 3VVUA 4XIUA 1RKJA 3AT1B 3MFHA 5DQHA 3N6NA 2GHVC 4DJBA 4M5HA 1C0UA 3K8VA 3RAXA 4YB5A 3DLKB 5DM6Q 1N0UA 4TY8B 3VZHA 1H2VZ 4ZPDA 2GIQA 4O3SA 4USIA 2MQPA 1Q7YT 4LIRA 4OV1A 4QIWD 3DI6B 1KOHA 3MECB 2QL7B 3ONQA 3I96A 3UD4P 1N5TA 1RT2A 1N36F 2YKNB 3V6DB 1UJ5A 3MCSA 3R5DA 4P9SA 1CJTA 3OSPA 1S6QA 3KK3A 1QUVA 4BS2A 3OPKA 2GZOA 2DD8S 3RYLA 2R7QA 5J1NA 2R7TA 1Y3JA 3DCAA 3GJRB 3MURP 3BYPA 1XMQF 3ISND 1YITS 2AKWB 2DRBA 3BDEA 3IS9B 1VFJA 1M5HA 1HQEB 1OWXA 5L38A 3N6MA 3UCUP 1OY6A 1HD0A 1UWBA 2BJ8A 4F3MA 4CLWA 3H0PA 2HBRB 4NZ0A 1IBCB 1RTJA 2PA8D 1EQMA 3PJWA 2V8GA 1MG7A 1S1TA 2WCXA 3QQCD 2HK3A 4PXCA 5CYJA 5ETLA 4C7QA 3A8KA 3MMAA 5SZTA 4Q0BA 3MCMA 3DFEA 1WG4A 4YS2A 2IFXA 2JZ5A 2LQ8A 3BR9A 4CLKA 3N4WA 1NM2A 3NCRA 2HNZB 1WD6A 3LUYA 1RP5A 4CLSA 3OR1B 3D5MA 2ALYB 2JSXA 2BR0A 3LWLA 2P5VA 1TKZB 2UUAF 1JLFA 3IM9A 1DARA 2GO8A 4DL0C 3FNNA 1IKYA 4B3TF 2HG4A 4ZCMA 3UR3C 1NAQA 2OFHX 2OPQA 5F8MA 1S1UA 2MPUA 1YTYA 1WHWA 3A4TA 2M3DA 4A8WA 3FC9A 3OR2B 4N56A 2BW7A 3GFZA 4L3NA 5KFOA 1SJ3P 1VC0A 1T05A 3HHNB 3AAWB 1BE4A 2UU9J 4HI1A 2YQ3A 4LF5F 3VAJA 1RWNB 4ZPCA 2RU3A 1XMBA 2HFSA 4B9SA 4OHWA 5D0HA 5K5MA 4KIAA 3K89A 4C3MA 3DLLQ 2UXCF 2MJNA 4DX5A 1TZ0A 5DDPC 2MKYA 3BH6B 1U1RA 3D0GE 4ID5B 2XCAA 3U1MA 1T02A 4CI0B 4OJ3A 3PX6A 2DHHA 5KFAA 3QWUA 4R5PB 5FD1A 4ELTA 1RT6A 2KRRA 3QJLA 1M1HA 2RRBA 2YKPA 5BR8J 1S1TB 1S12A 4Q7AA 2ZWOA 2LQ9A 1R8HA 2CQ1A 4B02A 2BJ7A 2UVRA 4MKVA 1HBUA 4LF9F 3LP2A 3H7HB 3CJ4A 4H54A 2FVCA 5D0GA 2BE9B 2OHDA 4BLGA 1N56A 2M9KA 1Y7PA 4DCJB 1WOSA 3ZTRA 2BZ2A 4MK9A 3WIUA 2DITA 1HNXF 3UFCX 2GW8A 2R8GA 1G7CB 3MMBB 5C42B 1UFLA 3N0VA 2BUNA 1RTZA 1VBXA 2OP5A 3D68A 1LXNA 2L9NA 2CJAA 3QFWA 1WNEA 2V9WA 1SKSA 5KFEA 3LP1B 5A2QY 2E9RX 2GQCA 3R8YA 2I8EA 5F8LA 3C15B 3GSDA 1D9AA 1ZAVA 2BX6A 2CAJA 3UD5A 5KFNA 1R8CA 1X8DA 1TL3B 2EFGA 2X51A 1DY3A 4NLVA 4IH5A 5U47A 1WEYA 3NCQA 3SSSA 1WHXA 1F5BA 1TFWA 1JJHA 1YZ7A 2NPIA 2RILA 3I0SB 3KK2B 2W2QP 2QIFA 2I5JA 2O01C 1A0OB 2LQBA 5D6GA 3U1NA 2GJIA 5HMZA 1K9MT 3JQKA 3TUPA 2KG0A 2MJUA 2PMHA 1XJWB 4BHQA 4OZ1A 4OQJA 3TYTA 4RW7A 4CLPA 4LF7F 4WBFA 4IH7A 5CZVA 4ZVRB 3RR8A 4EO8A 3GSIA 4F0HA 5C25A 1XNRJ 1WDTA 3J7Z5 1SL0A 4ILMA 2HFVA 4KGVB 3WHIA 1X4BA 3JTNA 3DXBA 1DQAA 4JYAJ 2NXJA 2ZD1A 1S48A 2XM3A 2DY1A 1NB7A 1RACB 4IRDA 2HRYA 2PI5A 3NS5A 1DQ9A 4TVAB 2PDAA 3W9IA 1WF0A 4I6YA 3MEEA 2AYEA 1K44A 2CQDA 2AEMA 3AD9C 5CCLA 3ISNC 1RCXB 3CDAA 4NZ6A 1IKWB 3JAMU 1GNKA 3SSQA 4WZQA 2V0NA 2FJAB 1U02A 4DQPA 1PJ5A 4KPYA 2IA0A 1MWQA 5IC4B 4QQBA 4DSKA 2J0WA 2G13A 2C3OA 3HVRA 3FVYA 2GVZB 1V3SA 4NLXA 2V2ZA 3W66A 3UI3A 2ZOMA 4ZCKA 2VBYA 1U1LA 1ZS6A 1X4GA 2MGZA 3PRVA 2BOPA 3GPAA 1XERA 4WTYA 1AA1B 1S4FA 1FDBA 1Q8BA 5B0GA 1ZAWA 5DQIA 1HYSA 1WSRA 5CYMA 3DYAA 3LANA 3IN5A 1JX4A 3BSNA 2WB4A 3MM5A 2HW3A 5KFLA 4IDKB 1HQ2A 2C42A 5AE1A 2YKOA 1D9FA 1T9WA 2KT2A 2HQGA 2HQIA 1B70B 3R6LB 1R31A 1RBAA 3KTQA 1FX4A 2AWZA 2YNFA 3S6EA 4UT4A 4UUWA 2DRAA 2J6TA 3A3NB 3EPGA 4I69A 1Q86T 3EVWA 2WW4A 2XY5A 3VV2B 3NGDA 2XSFA 2IRUA 2XMVA 1SQGA 1X4AA 1G6BA 1PCAA 3BSCA 4ID8A 3DXSX 2VQEF 4JI7F 4MYUA 2YNGA 3GIJA 3NS6A 1U1MA 5AE3A 1P8GA 5HMXA 4JI3F 5HK4A 3D54A 2LDYA 2EXUA 2P2CB 4OX9J 1CJUB 3MM7A 2N7YA 1N34J 1GXUA 2ZNYA 2YX4A 4LRAA 2MKIA 3W60A 3QATA 4TQRA 5F3ZA 1HHSA 2CPYA 3OTCA 4WXWA 3MM8A 1T8EA 2GQQA 5HP1A 5LM7E 5DQGA 1X5PA 1JKHA 5H9FJ 4WTOB 1XMOJ 2ZKUA 3GJTB 4O3QA 3P45B 3A3OB 2FIUA 5IM0B 2YNIA 2DH9A 1VQ4S 3OV7A 2BEFA 4M5NA 1FT8A 3M8PB 3CMAS 3DOMB 1KWMA 1Q1KA 1HWJA 3AQPA 5G0RA 1QUPA 4URGA 3NL0A 2RQKA 4DZ6A 4WYLA 3CC2S 3S01A 2J5AA 3HVWA 4MTPA 2IYIA 3AXMA 1UEKA 4OYXA 2DHSA 2UUTA 1TFYA 4NLWA 1RT7B 2YQ1A 4DR4J 3I4HX 1RWWB 2ZH9A 5GADU 2K1RB 1RWKB 2Q79A 1RTDA 3KLIA 2GX8A 2DNMA 2BACA 4K4TA 1SB6A 2R2RA 4EZ6A 2ACYA 3ITHB 2W7AA 3H5SA 2E7WA 2IPOB 1HNIB 1VK8A 2J9EA 1G3OA 3CJTA 2R8HA 1TL1B 1YJNS 2B9EA 4OJHA 2XMJA 5FIIA 4PPZA 5AE2A 3KLGB 4JV5J 1AZSB 4RUBA 1SIWB 3DDNA 5IWAJ 3OTOJ 5CA5A 4DUYJ 4BWJA 5KG3A 1TL7A 3MM7B 4MKBA 3QJPA 1JLCB 4IFYB 1F9HA 2HRTA 1VBZA 2R7SA 2UXDF 2QSFA 5J2NA 1HWIA 3DHWC 3HX9A 1Y5IB 2MKHA 3TEGA 1C4AA 2KKHA 3D3CJ 1JKHB 2YWKA 5L46A 3M32B 3M8YA 3R2DJ 1NHVA 2AJ1A 1U6BA 1P1LA 1H3DA 2YNIB 4HR2A 3T1HJ 1H7XA 1UFWA 5GMKa 2J8SA 4A8SA 3MPDA 3O5TB 2LMIA 3TA0A 1BQMA 2EK6A 5HJXA 2CQHA 2HS0A 4IQMA 3MM6A 2E5HA 4X2BA 7FDRA 2YPYA 3CUNA 2A0FB 1NZAA 4YR2A 2JLEA 4LIWA 2AW0A 4DV5J 1FD8A 4I7FA 3C46A 3RRHA 1DLOB 5AXMA 1XQIA 1U1OA 3PW5A 1BXNA 4IOBA 2E1AA 3FK4A 1JLGB 5HVGA 3UWTA 2YWWA 4KFBB 1Y9OA 1KNZA 1T11A 5CD4A 4ZVEA 5J2PA 2E5JA 1TUWA 1YVFA 2VD3A 4PQUB 2RQCA 1HNZJ 3CJ8A 3G4SS 5KG0A 3QYYA 4JI6J 4OZNA 2XLJA 3RZAA 4IR9A 2CJBA 2HMIA 1N6QB 3MUMP 2GHWA 4N47A 1HA1A 4LT6A 3ZTOA 2V2KA 2VKRA 1UVNA 1FD2A 3PJ9A 1KLMA 4DV2F 5KFDA 4X4QA 3GR1A 3TQ1A 1QM9A 2C3UA 3H4BA 1G4CA 4AQYF 1CG2A 4JB8B 2ZBIA 1ZTWA 3C8YA 1TMJA 2CZVC 3QSYB 2NYHA 5AT1B 1VCTA 2E1CA 4RU9A 4N76A 1WUUA 2YXLA 3W5XA 1SKUB 4H4OB 3FBFA 5J2NB 2IDLA 3RW7A 1UVMA 4B3MF 2I6WA 5KG2A 2ATCB 2J76E 2XWXA 2VC0A 2ZEJA 1JJCB 3TVYA 4B3RJ 4KV8A 2UVUA 3AJ2A 1O8BA 3M8QA 4A8OA 3PYDA 1GH8A 1E6VA 4CLYA 4R8UA 2MHEA 4DQQA 5A8RB 5C5JA 3PDNA 4U95A 2FJBB 4DR5F 2DISA 2CPHA 1UW4A 2LDIA 1OPZA 4AYBD 4F3QA 3DOKA 1J2VA 1MN9A 3RU0A 3TJ8A 1HWUA 1X31C 2W9AA 1JLQB 3DMJB 3BJYA 3VGSA 5LT5A 3KUGA 2KH9A 3PKMA 2FZCB 3LP0B 1Q4RA 4NXMF 5DLGA 1JXLA 4NCAA 1LWFB 2CWXA 4A48A 1TAQA 2J6SA 3DLEB 4DV3F 4XAKA 3BS9A 5CXTA 4PG7A 1O51A 4F4ZA 4O44A 1C1CA 2BKPA 1VK3A 2AJ4A 2HMIB 2B4OA 3HP6A 3L95X 3GIKA 5IQQA 2HHSA 1XWLA 3O8WA 2IVYA 4XDDA 4I56A 4FBUA 1UJ6A 1KQFB 3G8TA 3W9HA 4LRDA 1NJYA 2NUHA 4Q2MA 3A8EA 3J80Y 8AT1B 4WU2A 1V9OA 2D7SA 2J9CA 4ED4A 1S4EA 4BC9A 1R7IA 2B4VA 2R3VA 5LMUJ 4MKAA 1SCJB 5KFUA 1J5EJ 4ILLA 1CJKA 4LFCJ 3G82B 1IBKJ 4PG6A 5E3RA 2Y0SD 4DV7F 4P52A 1G1XA 2M8HA 2CPEA 4TLQA 1FFWB 4LFAJ 2WSCC 1S59A 2H3EB 3DGPA 4OYIA 4RKUC 1FE0A 2B8PA 3CTRA 4USJC 3BN7A 5KG4A 4IG0B 4LF8F 3R5AA 3K5MA 1QLNA 2FTRA 3M1VA 1W25A 3KG0A 1P27B 1YJWS 1DQ8A 3KG1A 4R0JA 3K8WA 1DURA 4NCBA 3HD2A 2NXCA 2QL9B 1X9WA 1M5OC 1VHIA 4KO0A 3BBFA 4DEZA 3IRXA 4QWCA 4RUHA 3BPSP 2G0CA 3PYFA 3MMCA 3CC4S 3MFIA 2H4YB 2C2MB 5B0FA 2R2TA 1TVRA 1T03B 4DU8A 3DLBA 3V4IB 3HHEA 3TP2A 2Z2LA 1TR0A 3K0JA 3QBCA 3JXOA 3D1QA 1GQEA 2PN6A 5E5NA 2R7WA 4FKYA 1S1WB 4KRWA 2R8JA 1BQNA 4U7UK 1X4DA 6AT1B 3EVOA 3R5GA 4KC5A 2HFNA 1UW9A 1HBMA 1IVZA 1LQ9A 3FGVA 3PJXA 3MM9A 1X4CA 2JJ4D 3Q8PB 1UEVA 2OI2A 2BBEA 3M6UA 1VQKS 2E1PA 5T14A 3MD3A 1UL3A 4YY3F 4DQSA 4QCLA 4LF6J 3FSIA 4ECYA 4ZN3A 5J2QA 2BANA 2MLZA 3RRGA 4ZN1A 2RS8A 5ETNA 4GVBA 1NEEA 5A8WB 3J7YI 2BE2A 4DL3A 3R9LA 1OO0B 3ADAC 1U24A 4X66F 3H5XA 3FSXA 1M5PC 2J9DE 2HHXA 2ASYA 1FKAF 2A3JA 1NDLA 4NLGA 1SUQA 5F8NA 1Z2LA 1S0VA 4GKKJ 4HI2A 4X64J 1M1KT 2C3PA 2OD6A 2HQFA 1HD1A 4ECXA 3HXMA 3N28A 3IG1B 4ZJOA 2B4UA 4ZP9A 5L9NA 3EWGA 3JSRA 2CRLA 2RH3A 4Q43A 2AZ1A 4OJ1A 2R9LA 3P6YC 4CLZA 1GTEA 4DUTA 4X4SA 1VC6A 2XZTB 5DS7A 4O4RA 5HLFB 4DN0A 1AROP 1EAYC 4TLRA 2ZOGA 4HDGA 1JLEB 1FI4A 3TUZC 4IOCQ 2QLXA 5EWEA 2YKAA 2Y3YA 3TNVA 3BGUA 3CDWA 3W3SA 5I42A 5F8GA 3MUTP 1TL4A 1XBWA 3NGKA 3AB4B 4QU6A 2IRYA 3OVAA 2DH7A 2UUBF 4J91A 5H9EJ 2QC3A 1TKTA 2W2NP 1TK8A 3SFGA 4V1Ak 3JSBA 5HQLA 1S6PB 2XMTA 3BN4A 2VB6A 1F5CA 2O1PA 1PC5A 2MZTA 4WYWA 4CWBA 4A8XA 3LTOA 5DGBA 2R7XA 1DFDA 2VODA 1RTIA 2PA3A 1TV6B 3BO4A 3P96A 2XQCA 2HHHF 4DV0J 4JI4J 2FUG9 4ERDA 4E98A 5J2QB 3DU6A 1R6YA 1O6XA 2KYZA 1D3WA 1EZZB 1NK8A 3W7BA 2N4CA 4Q5VA 4QWAA 2HKEA 2E66A 1TKXB 2JH3A 3T5HA 3MCNA 2JC0A 1WACA 2ROPA 2NXEA 2DGXA 4GKJJ 2LXUA 3PV8A 1OMSA 3SXLA 1Q53A 3Q8UA 3FSYA 1VQSA 4LF4F 3QIPA 2VBWA 4P7TA 2W7PA 3W1YC 1F60B 3PFOA 1SJFA 1K1SA 4F3OA 4PKDB 2DIVA 1Z4UA 1N33J 4A8KA 5HMYA 1HMVB 1Q7LB 4NL5A 4WE1B 4EMDA 3WC0A 1HI8A 2CKWA 5A2QU 3K5NA 2AJQA 4GVLA 2J8AA 2CYYA 3PHEA 2OUGA 1PJ6A 2AP6A 2VFUA 5I42B 1R0AA 2QLFB 3K5LA 3EZUA 2JDJA 4DR1J 4DN9A 3M2RB 3MDFA 2Z57B 5KT2A 1V3ZA 1TKTB 2ZE2A 4OYAA 3OL6A 2ROEA 3KG4A 1S1VB 3ET6A 4F0KA 3A1YG 3ZC4A 3E51A 2LA4A 3T6JA 4YFUA 5IQ6A 2IJFA 2YKMB 3F41A 2KG1A 3O3LA 3IWXA 1MN7A 3W63A 3ILIA 5J2MA 3OXLA 2NYIA 1JJ2R 3BPDA 2V2QA 5ETVA 3F56A 2ADCA 3Q83A 2VFSA 1NPRA 5ETMA 4MMOA 3D6FB 4KT0C 4QR0A 2PSZA 3HF5A 4ZLLA 5K14A 4F04B 3QO9B 1FTCA 3HVTA 1KLNA 2GJ2A 2FY1A 5MLCV 3ETMA 4KJIA 1O5JA 2WVDA 2ILYA 1RBOB 1VRUA 2DNRA 2D41A 2W8LA 4EYHB 1EP4A 3NY0A 2C2KB 4OIXA 2BABA 4RW6A 3DLHA 4C8OA 3RAMA 3T1AA 3S8SA 2IM2A 3QRRA 2CJXB 5L1LA 2HWTA 3EM1A 2EBGA 1A6LA 1VDHA 4IO9Q 5H9FK 3LF0A 3RB6A 1TMMA 4IH6A 5D78A 3MEGB 3O6QA 5D3GB 4ZPAA 3O2IA 3NMAA 1H73A 3OBIA 2VG7A 4J9PA 1R0AB 1FEEA 4M5IA 4DG1A 5M2UA 4PABA 3AXKA 1I1GA 2XBPA 2ADBA 1YI2S 1N54B 1NBEB 4LSNA 2B51A 4K4YA 4P2FA 4FXDA 2QJ3A 5KFRA 5SUHA 1S10A 1FVSA 1IWAA 2ASDA 4KHPJ 2CG4A 1L3VA 5CCMA 1KTQA 1HI0P 1NKEA 1CJVB 2RKIB 8ATCB 4EZ9A 4ICLA 4U96A 4YHHJ 4JI1J 3WX8A 4YN3B 1GMVA 1CPZA 2VU5A 2G0JA 1W26A 2HVIA 4NLRA 3ULHA 2FDNA 4QIFA 3NWGA 2B43A 2LECA 4XK8C 2NXNA 1HARA 5KG1A 2D3OR 2YX7A 1YJ9S 4RW9A 1Q8IA 2VOOA 2XO7A 2NSBA 1X5OA 3L7UA 1N32J 3FCHA 2KXHA 1ULRA 1BD6A 4F2SA 1EARA 1URNA 3DDIA 3R7NB 3T5KA 3GYXB 4Q2LA 1S77D 4BWMA 4OI3A 2EG1A 1TL5A 1V5VA 4YUDA 5A6PA 3VALA 1VI7A 1M5VC 2GVDA 4HHUA 4DXLA 3FDSA 4ZP8A 2HNYB 1R8PA 2NSCA 1L5UA 4L72B 4U7CA 1W2BR 3FUYA 3VGTA 3W2WA 4PPDA 4OHXA 3HI9A 3K2YA 2D69A 1SPBP 3D0IE 3KOAA 2Z2ZA 3IBCB 3I55S 4RWXA 4Y00A 1VYAA 2V4JA 3KWMA 5HMWA 1U49A 3Q2SC 4RNFA 3QLHB 5LXYA 3QWPA 3CE8A 1VR6A 3DDKA 1GTHA 4E0DA 3KUHA 4P2XA 2WVCA 1HR0J 3ZTQA 1J27A 4DR3J 2ZHOA 2FZKB 1SL2A 1B0VA 1LW2A 2UU9F 3KLFB 3C14B 3AQOA 2AX1A 5L39A 1XIQA 4ALZA 4J7CA 5GMEA 2EEYA 2DR9A 1WI8A 3RB4A 2UUCF 2HEKA 2MHNA 2X1BA 5GAGU 2PEHA 2MQLA 2XO6A 1JNRB 4QW8A 3HHDA 2WRMA 1VOMA 1FJGJ 1RQ0A 1QTMA 1C0TA 1VRQC 4M63A 2L9DA 4HACA 1LEOA 3M05A 2PMZD 3FEXB 1LW0A 4YDXA 4DF4A 3UDCA 3LW5C 3Q8VA 3TJ9A 3OTBA 3P4UB 2NXUA 5GMDA 1FWKA 1VQMS 1EETB 4KBIA 1MWZA 2AYBA 2ZOFA 2OSQA 4X84A 3B4DA 2QMXA 4Q44A 2GFFA 4ECRA 1VQ9S 1VS3A 4ZVSB 2E29A 3ENWA 4YB1P 4CLUA 2CQPA 4M5DA 4B9VA 2GGPA 2VPZB 5LMNJ 4NWBA 4RW8B 5IZHA 4USKA 4RWWA 3PG9A 1C1BB 3A8IA 1AT1B 3JQJA 3D2WA 1UWAA 2HBZB 2QLJB 5D4NA 3UNYA 3TI0A 2DXFA 1OPIA 3FRZA 4DPOA 1D0EA 2CNLB 3C16A 3Q8RB 4W98A 4E8UA 1NH8A 3W2WB 4TNOA 1S9EA 3HT0A 3CMQA 1SJRA 1RADB 4M95A 3IAS9 3HHLB 4ZHRB 1RAAB 3CJRA 2JLFA 3IMQJ 4HVZA 3GCXP 1WKLA 4JI2J 1HQUA 4QYZJ 2BM0A 1SIZA 2YVSA 1UVJA 3N01A 3BSOA 2Y1JA 4TQSA 3OQ2A 2B6AA 5AXKA 5C24B 5GAHU 3TZWA 1YWXA 4QWBA 3EZ5A 3SI8A 2BKNA 3R6GB 4C11A 4KB7A 4OHYA 5K9FA 4U7UD 3AD7C 3C2PA 2D9PA 3MPYA 3QMQA 1VQLS 4PWDB 4CH1A 2DGOA 1HPZA 2VPWB 5HJYA 1JB0C 3NS7B 1FNOA 4AXJA 3ZNUA 4ZPVR 4KAIA 4KGZB 2HHWA 4I1TA 2OD4A 1DBDA 4IFVA 1KQKA 4WIIA 2CPJA 3PNIA 3HDSA 2I2YA 3ZNJ1 2W4CA 1KVJA 1LWCB 3M9NB 1ZM2A 1IBLJ 1U2CA 4KTQA 5T41A 4NRTA 5K8NA 3SV3A 1XNRF 4ZVQB 3KYLA 3CJKB 3TANA 8RUCA 4JYAF 3SDEA 2Z30B 3M8WA 4CYUA 4X4TA 2JRSA 2GO9A 4UZCA 5RUBA 2PE8A 4H4MA 3KJVA 5GAEI 4WZMA 1FEHA 1S6OA 2DNNA 1B99A 1ICEB 1FRLA 2XGQA 2HYIB 3CEDA 4DPYA 3MOZA 5KG7A 2JNJA 2V63A 4K5SA 3JSMA 1EJ7L 1FKOB 4OYPA 2B0GA 2MZQA 2VFRA 3I87A 2YH1A 4W4MA 5AJ3J 1RT3A 3OFFA 3DRSB 1WWHA 4HH1A 2OPSA 3GIIA 2VFTA 4KE5A 3I0RA 4DL2A 3GIMA 4UTGA 4WK1A 4RNHA 1KONA 2UV8G 4UY85 5B0EA 2EW9A 2ZH8A 1EX8A 1PSDA 3TQEA 4F8RA 4WIQA 5L1JA 5HI7A 1HWLA 2FPHX 2V67A 1X7VA 2WONB 1AFJA 2MQNA 2AU0A 1JK9B 1NRKA 2OFGX 2HWHA 4NLDA 2DT9A 2ZNZA 4C11B 3H90A 4L3KA 5IT0A 1SBRA 2P9GA 2GHPA 2QFJA 4NE9C 2V9KA 1YZ6A 2RIJA 2QMWA 5IV3A 4LBPA 1FNMA 3GV5B 4ZVPB 4CO4A 1PBAA 2CPIA 2IAJA 4C8YA 1NPKA 5IT9U 3NBPA 5ETKA 3IR6B 4QPTA 1J5OB 2XLKA 3J80U 4M5MA 3KDOA 3ZZTA 3M8ZA 4DSFA 3DLGA 2LFVA 3PW4A 3A8JA 1NK7A 3PO5A 3TAQA 3D3BJ 2R7RA 4I4BA 3D0HE 5EDWA 4LSLA 3J81Y 3SDEB 3RRKA 3DOLB 2CJQA 3I82A 5D0EA 1IWGA 2WB1D 2SXLA 4OX9F 1VQ6S 2DRDA 2K3IA 1N34F 1JLAB 1RWXB 1UTAA 3EYZA 9ATCB 4FYXB 1IKVA 1P9QC 5FDLA 4AD6A 1SI9A 1UMJA 4FNHA 3X1LB 2H5IB 1QE1A 1RT3B 4O4GA 1XMOF 1WC5A 3QPIA 2V69A 3BKTA 4FYYB 3F73A 4AE5A 1GAOA 4HEA9 3BR8A 3GFHA 2V6AA 2QA1A 4DMZA 1H2UX 4WCEQ 4LQ3A 1HNVA 3Q23A 2YX1A 2CJKA 4K4UA 4O3PA 4NEYA 1XR5A 2V8VA 4JI5J 4NLSA 3PW2A 4NMXA 1YK9A 4KYZA 3E01A 4O23A 2OPRB 2DHAA 1LFWA 3I56S 1I94J 2DNPA 2DHXA 5F8IA 4DR4F 2HQDA 3MGJA 1R6VA 4NYPA 3TX0A 1RHMB 1VQ5S 2KFYA 4FF4A 2MYFA 2MKJA 2IHR1 5A76A 3W9JA 3TAMB 4CM2A 2J7WA 3K7RA 3JQMA 4DS5A 5LSRA 2PFFB 4QPXA 3I32A 2WK4A 2HURA 2FJDB 1KOOA 2GA7A 1DTQB 3UDEA 3HSJA 3NGRA 2WAQD 1F9EB 1S79A 2G9OA 3KLHB 1P6TA 1NHUA 1PILA 4OZJA 4Q8EA 4OJGA 3ELHA 4F25A 4JV5F 1D8YA 3IBFB 1LNQA 3ETOA 4LSLB 3VGVA 4X4UA 4ER8A 1FE4A 2ZJRQ 3OTOF 4DUYF 3ZO7A 2KFNA 3DLKA 3CJSA 4TY8A 2CQ0A 3GJSB 4CT8A 4WFXA 3IBWA 2ZUAA 3DI6A 3MECA 4FZVA 1XR6A 4MIAA 3VAIA 2YKNA 2CPFA 3V6DA 3D4JA 4U8YA 3FFIB 1V6HA 1JIHA 3T1HF 1RCOB 3CDEA 2V8HA 3OSNA 1LK5A 2W4PA 2VG5B 3UVJB 2IMWP 5D4PA 2GCFA 3FQLA 2CPDA 2HNDA 1GMUA 3HJVA 1SQFA 2IVFB 3GR0A 1N5YB 4FPRA 4WWSA 2C2OB 4DV5F 5KFKA 2E44A 2R4FA 2RAQA 2W8KA 4UZBA 3VAGA 3VCDA 4I2QB 1MROB 3G6YA 4DQIA 4OMFG 1FXDA 4I0WA 3TZYA 1HQEA 3VR1A 2R7OA 3PKYA 4J37A 4FF1A 5GVQA 2PC6A 1HNZF 1T9YA 1RABB 1KS2A 2XI3A 5L8RC 1UP1A 2WSFC 4JI6F 4PYAA 4ZS6A 2HAFA 4X62J 3L7PA 5DZ7A 2W9CB 3B54A 4C9DA 2MB0B 3GTYX 5J1EB 4ZVFA 1MU2A 3SMZA 3MR5A 1R27B 4MFBB 4P75A 2MKKA 3HHKA 2HNZA 4TU8A 5KT4A 3OR1A 3KHLA 4M5JA 1DRZA 2VA2A 2OSRA 1WG1A 1TKZA 2DTJA 2PO4A 1CS4B 2J6UA 3QT8A 2L9WA 3MOJB 3BGRB 4LJMA 5B0DA 1FESA 2BRLA 2MZ1A 1GX6A 2FZGB 4B3RF 4PQAA 2WW8A 2CUYA 4ZA1A 3TEHB 2HHQA 3OR2A 3K17A 5E41A 1IN0A 3CULA 2N7CA 3OT9A 2AJFE 3AJDA 3M7VA 4NA2A 1MMNA 2HNDB 2DR8A 5DG7A 4N5SA 2Q6BA 1X4HA 4HLBA 1F9FA 4OX6A 1Q8LA 4YP3A 3KK1B 3L9ZA 3OXGA 4CLLA 2J0QD 3DRYA 2MQOA 1U09A 5KFVA 2XS5A 4ID5A 1TUVA 1YRXA 3PVXA 2KJVA 4AXIA 3TOQA 3D9BA 2VZ9A 2X3GA 2WBRA 4ETZA 4R5PA 4FF2A 2ZDOA 2ZBPA 2NS1B 3DU5A 3OFEA 2C1EB 2YNHB 3SCLE 1IR2A 1FVQA 2EC0A 3RAQA 4U67Q 2ZUGA 5HQ8A 4X4RA 5JJBA 2RSQA 1REVB 5C2CA 5HROB 3QGGA 4EEYA 1NK4A 1MU2B 1ZZNA 1KC8T 1Z2ZA 3L4BC 1U4BA 1ZPVA 5A6WA 3NNAA 2RUGA 3EGZA 2M8DB 3CO0P 3L09A 2QMUB 1CEZA 1VGYA 2MXYA 4DL7A 3M9MB 3KNAA 5E3QA 3EGNA 2AGQA 5LMUF 1WC3A 3R1LA 1FX2A 2G4BA 4K2XA 1J5EF 4I2PB 4PUOB 3R5JB 1WC4A 4LFCF 2DNLA 1IBKF 3BKUA 2RDDA 2CQIA 3QGHA 4DDFA 3MMBA 1IBMJ 5C42A 3QT7A 3NG8A 4KSEB 3KMQA 4Y0FA 4LFAF 1HNWJ 5I3QA 3OD2A 1L3TA 3NOGA 3RBXA 4CRJA 4LREA 3KJFB 3AHPA 4GC7A 3LP1A 2K7JA 1N52B 2KYXA 3VWSA 1LFPA 4DX6A 3C15A 2FB0A 4G65A 3GG1A 2FLLA 4KHRA 1TL3A 3CCES 3CCSS 3RJMB 1R8AA 3H2VE 4B9NA 4MH8A 1ZPWX 4FF3A 3Q24A 1QVGR 4I6AA 2DBBA 3I0SA 3KK2A 5EWGA 4BBYA 4CCHA 2YWHA 1AUSL 4M8LA 2JLGA 4QYRA 1E6YA 4V19J 5EUHA 3EX7B 4LBIA 3C19A 4DFJA 3KJNB 1IR1A 3DLJA 2CA9A 1JNZB 2Z2YB 3NAHA 1KFSA 1NDCA 2W24A 4B9TA 4JI8J 2KI2A 2RU9A 4Y2IA 3PR5B 2VH7A 1AXQA 4OI1A 3MCOA 2F9JA 3I9ZA 4PZVA 2DGVA 2LLZA 2HS4A 3DM2B 3CJ3A 4K5RA 2Y9HA 2FVQA 2FGCA 2B5JB 2BM1A 2HWIA 2NLWA 3CB4A 1IKWA 2BKOA 4OFZA 3PYEA 2UVVA 3OTEA 4LF6F 3GU0A 4MKYA 1NNDA 4ZIWA 2UP1A 3MF5A 3H2UB 4RBVA 1NK0A 3HMJG 2GVZA 5DJBA 3M2VB 2ZKTA 4QOTA 6FD1A 2IC3A 2VBXA 2A10A 1U8WA 2NQPA 1K47A 3TUIC 3OXFA 2QTWA 1BUXA 4DOZA 1YJTA 4DUZJ 4WFNQ 3THPA 1HBNB 4C98A 3DRRB 1ROFA 1YG0A 4G1QB 4GKKF 5KG6A 4X64F 2C2EA 3W8GA 2QLWA 2LA6A 3MUVP 4IOAQ 4IDKA 1RWVB 4PWWA 3JYTB 3RR7A 1X60A 1FWPA 1Y4ZB 1FRIA 4NLTA 4DR2J 1TAUA 2HGMA 1U2RA 1E6YB 1WORA 1NSKL 1RT1B 4ZVUB 4QZVB 1HI1A 5CQGA 4EBDA 2CNKB 4DSLA 3T3FA 3I9V9 5E3AA 5KFFA 2NZ4A 2N3OA 2H48B 2UV8A 2XTJP 1UKUA 1OQ6A 4NLOA 2DB1A 1S0NA 3IC1A 1AFIA 5KFBA 2HSEB 4MJKA 1Q79A 1CJUA 4JBCA 3CCJS 3CPWR 1ZM3A 4EBEA 1UPPA 2GMLA 4C97A 1RKIA 3ZZPA 3OHBA 2DPIA 3VAFA 2AD9A 3CNQP 2L3MA 3M30B 1RUSA 4NPOA 4F4AA 5EWFA 3DKDA 3QRQA 2CQBA 4DV0F 4JI4F 5IM0A 4M94A 4N41A 1MMDA 2R7UA 2AZ3A 3SV4A 1F3VA 1RXOB 4ANDA 2O67A 3N9UC 1A9NB 2ZH7A 1G2EA 2OELA 3M8PA 3DOMA 3HT3A 4NCGA 3N79A 2IC3B 2KXFA 3G9CA 2LQJA 3G86A 2F40A 1B0PA 3PFEA 5I3UB 1RYSA 3BDPA 2MLXA 3X3UA 4GKJF 1XK8A 1KRPA 2IM1A 5KFXA 3U02A 4F50A 2C2DA 1S0MA 2F8MA 1RT7A 2RHQB 3UCZP 2F9DA 1X9SA 2VPXB 1PC4A 3W2VB 3QAEA 4DF8A 2VC1A 2LKZA 1EQ0A 1RHJB 2K1RA 3C6UB 2F8HA 2AMCB 1N33F 3HSZA 3JTOA 4AFFA 1HHQA 5KT3A 2U1AA 1U26A 2VJUA 1RT4B 5T7LB 1FRMA 1P9YA 3ZZRA 3P3DA 3FEYB 3HKZD 3ITHA 1RWMB 2F4VJ 1OJ4A 1HNIA 3KHGA 1FKPA 1TL1A 4ZPTR 2KHDA 3GILA 5LJ5Y 1BLUA 2EG2A 4ZLNA 2QN6B 3KLVA 1TP7A 3LH2S 3KLGA 3HHLC 1AZSA 1U1PA 3SQGA 3D66A 3RG6A 1DTTB 3ILLA 4YOEA 3HFZB 2QLBB 3CDUA 2VICA 3BQ1A 2UUWA 4ZVGA 1JLCA 4IFYA 3VHQA 1JJ4A 3OVBA 2BJEA 1MLAA 2DNQA 2RF2B 4OZ5A 1N5SA 2B56A 3H20A 4ITSA 5GADI 2QA4G 3CCWA 1HKAA 4OX8A 2YWEA 3M32A 2ZDPA 1RWOB 1RAOA 2DIUA 3BQ0A 4ED5A 4CO5A 4HHJA 2W7OA 1ZAXA 4NXNJ 4TN2A 5DG8A 2XB2D 3GFXA 1WKJA 2ZITA 4PG4A 2IRXA 4NCGB 1SH2A 2AT1B 3W5YA 4DV1J 5DDRC 1KP6A 4MIBA 1KVKA 3CWJA 2V68A 3Q8YA 2NPFA 5JVHQ 1RLCL 1C2PA 2ZH4A 3UD3P 1DLOA 4YMEA 2OH2A 2DGUA 1QSLA 1JLGA 4KFBA 4DU7A 4DR7J 2WOMA 4IO1A 3G6VA 2VL1A 2O66A 3JSYA 2KU7A 4PQUA 1WHYA 4H4KC 4K4WA 3AB2B 4CDIA 1CULB 5K8OA 5D0RA 5E0OA 1K8AT 2VKZG 1PKUA 2B7BB 1I6JA 2M52A 2I0XA 2Y1RI 2ALZA 2AQ4A 2MSTA 4WP3A
chains in the Genus database with same CATH topology
2NSBA 1X5OA 2QT7A 4B9SA 1SQEA 1N6QA 4OHWA 4LVNP 3FCHA 5K5MA 4KKOB 2KXHA 3IWLA 4PCQA 2EFVA 4KIAA 1ULRA 3G6ES 3T6BA 1BD6A 4C3MA 4HTJA 1FKPB 3DLLQ 4F2SA 2UXCF 1URNA 1HFEL 4C3KA 3UR0A 2MJNA 3FFIA 5ITHA 3T5KA 1FJEB 4CO3A 1TZ0A 2H5EA 3GYXB 1FRJA 4Q2LA 5DDPC 4NYZA 1WTFA 5D77A 4ED3A 3IR7B 1U1RA 1RK8A 3D0GE 4ID5B 2XCAA 1S77D 1R3NA 4K4XA 4BWMA 4RNNA 4NXNF 4OI3A 3U1MA 3SCIE 1M90T 1T02A 1TL5A 2EG1A 5ADZA 4CI0B 2CPXA 3SQGB 4OJ3A 4ZKAA 3CCQS 3O44A 2VG5A 1VQNS 1VIOA 4C3LA 3PX6A 4YUDA 5A6PA 3HPOA 1VI7A 3VALA 4W92B 5KFAA 1M5VC 2HAIA 2FJWA 4ILRA 3QWUA 2JOQA 3FDSA 4ZP8A 2VV5A 5FD1A 2HNYB 4R5PB 1R8PA 2NSCA 3H4DA 4DV1F 1L5UA 1HL6A 4ELTA 4L72B 4U7CA 3WZ0A 1RT6A 2RRNA 3FJ2A 1W2BR 2KRRA 4RUAA 2B7CB 3QJLA 2J7UA 4Z37A 1N5YA 4C4WA 3PACA 3W2WA 2RRBA 2YKPA 4PPDA 5DLFA 2FLOA 1S1TB 4OHXA 3HI9A 3M1VB 4H4OA 4F4KA 4Q7AA 4CT9A 3K2YA 1HBOA 4IR1A 1U1KA 1DZ5A 2M4MA 3D0IE 3KOAA 2DVIA 4MK7A 4C8KA 4PRFA 3I55S 4RWXA 2LQ9A 4Y00A 1OSCA 4EUVA 1R8HA 1X5SA 4YHHF 2V4JA 3KWMA 5HMWA 4I2QA 2JVOA 4JI1F 2CQ1A 5CYQB 1U49A 1MROA 1LK7A 3Q2SC 4B02A 4RNFA 1VQ8S 2ZH6A 3QLHB 1IQZA 2ATLA 4QIEA 3LGMA 2UVRA 5LXYA 1HBUA 3QWPA 3J7ZT 3LP2A 4LF9F 3CE8A 1VC5A 4KO0B 3M2UB 3OL8A 3DDKA 4DR7F 1GTHA 4E0DA 3CJ4A 5KT5A 4UOCA 3IRXB 4H54A 4MK8A 2FVCA 3NCPA 5BYSA 4QWEA 4DFKA 5AXLA 3CD7A 5A8RA 3MMCB 5B7WA 1N56A 2ZHOA 3K5PA 2M9KA 4OI6A 1SL2A 1B0VA 1Y7PA 1LW2A 2A2DA 3KLFB 3BEGB 2UU9F 1X9MA 3AQOA 5CHCB 2BZ2A 2AX1A 5L39A 3UNGC 4ALZA 1C4CA 4MK9A 1TVRB 1HW9A 3BO3A 3GYNA 1FDAA 3V6HA 1U1QA 2F3JA 2DR9A 4ZOSA 2DITA 1WI8A 1R43A 5EN1A 3K57A 1KQGB 3RB4A 1HNXF 2UUCF 4RW4B 4MIWA 5E7OB 4CNZA 2MHNA 2X1BA 3UFCX 1NK9A 4O3RA 1N32F 2GW8A 5GAGU 1SV5A 3J7YU 2PEHA 2R8GA 1G7CB 3MMBB 4ECSA 2OPPB 4ZLPA 5C42B 1UFLA 2MQLA 2X1GA 3N0VA 2W9CA 2BUNA 2IM0A 5F3TA 1JNRB 4QW8A 1WF2A 4DLGA 3HHDA 5J1EA 2WRMA 1JLQA 1M5SA 1VOMA 3DMJA 2OP5A 1VBXA 1RQ0A 2LEPA 1QTMA 3MAHA 1C0TA 4M63A 2LXIA 3M6WA 1LXNA 2L9DA 3HLUA 1BQNB 4MFBA 3VTIA 2L9NA 3LWMA 2CJAA 3CO9A 2L41A 5DGAA 1MSWD 3OLAA 3M05A 2PMZD 1URRA 1WNEA 3NMRA 2V9WA 5E3PA 3FEXB 2JHEA 4IG3B 1SKSA 2DNYA 2EBEA 1LW0A 2HZCA 4YDXA 1LXJA 5KFEA 2WOMB 4DF4A 4B9LA 3LP1B 3UDCA 5A2QY 2E9RX 1HBMB 3CMES 3LP0A 5IWAF 2GQCA 3QZ7A 2I8EA 3LW5C 5F8LA 2I9SA 3MM9B 3Q22A 1LWFA 3GSDA 5KFCA 2E5LF 1D9AA 3OTBA 1ZAVA 2NXUA 3DLEA 1JMTA 4F02A 1LWEB 1VQMS 1EETB 5KFNA 3HJFA 5FLXY 1R8CA 1X8DA 1TL3B 2HHTA 2EFGA 2X51A 4URSA 4KBIA 1MWZA 2IJNA 4IH5A 4NLVA 3TR5A 2VA3A 5U47A 3GFYA 2AYBA 2ZOFA 2OSQA 3BGRA 1D1UA 1WEYA 3NCQA 2VASA 4X84A 3BREA 3SSSA 1WHXA 2VFVA 3DRXA 1F5BA 2QMXA 3B4DA 5KFGA 1TFWA 4Q44A 1JJHA 2GFFA 2MZSA 4ECRA 1VQ9S 2NPIA 2RILA 3I0SB 2BV3A 2BQRA 1VS3A 3KK2B 2D3ZA 3BO2A 2V94A 2E29A 4I67A 3Q0AA 1CC8A 2QIFA 2I5JA 3SCJE 2BANB 3ENWA 4YB1P 2CQPA 4M5DA 2O01C 4B9VA 2GGPA 3VAHA 5DDQC 2VPZB 2LQBA 5D6GA 3U1NA 2GJIA 4NWBA 4RW8B 5IZHA 5HMZA 1K9MT 2XMMA 4RWWA 1IQTA 3L3CA 2KG0A 1HR0F 2MJUA 2PMHA 3OL9A 2GMJA 5KOWA 5I4MA 4FS2A 1TK0A 1C1BB 1TKDA 5HBMB 1X0FA 4BHQA 2BE2B 4OZ1A 4WJBA 4DR3F 4OQJA 3TYTA 3D2WA 4DFPA 4RW7A 3CIZA 3ENQA 2HS3A 4PXBA 1KSPA 4LF7F 5D4NA 4QBUA 3TI0A 2UVWA 5B0BA 3KFWX 3SFUA 4IH7A 2V4QA 3UW1A 1HW8A 1OPIA 3FRZA 3DRPB 3MTJA 3QZ8A 1NK6A 4DPOA 5CZVA 5CD4H 1D0EA 1F2GA 4HT7A 3RR8A 4EO8A 2FJEB 4J9SA 3BGLA 1SUQB 3HM9A 5LL6d 5C25A 3Q8RB 3J7Z5 1S1XA 4E8UA 3Q8SB 1NH8A 3W2WB 1SJ4P 1SL0A 4TNOA 4X4PA 4ILMA 2CZ4A 3KK1A 1S9EA 3MMJA 2D1CA 1SJRA 1X4BA 1HBOB 3DXBA 3JTNA 1WTBA 4M95A 2HGLA 3IAS9 1DQAA 3HHLB 4Y3CA 4ZHRB 1RTHB 2ZD1A 1FJGF 3SCKE 1S48A 1NB7A 2DCLA 1KVIA 2JLFA 1QAYA 4HVZA 2V5HG 3ZZ0A 1WEXA 4IRDA 2HRYA 4JI0F 2FLPA 2PI5A 4KR0B 4DWIA 3NS5A 1HQUA 4QYZJ 1DQ9A 2BM0A 1SIZA 2PDAA 4FNIA 4G1IA 2YVSA 1UVJA 1WF0A 3DC2A 3N01A 4I6YA 3MEEA 3BSOA 4IRKA 1LOUA 2Y1JA 4TQSA 3OQ2A 2B6AA 2AYEA 2C2RA 1GXLA 2CQDA 3LO3A 2XSJB 5AXKA 2H9ZA 5C24B 5GAHU 3R5BA 4ED6A 5D4OA 1BC6A 3FRYA 3R1HA 4UY8T 2MSSA 5CCLA 1YWXA 4QWBA 3EZ5A 3ISNC 3KHHA 1S49A 3SI8A 2FGOA 3CJ2A 3CDAA 2FVRA 3K58A 1YBAA 4NZ6A 1A7GE 3RBDA 1IKWB 3CD6S 3WBZA 1GNKA 4C11A 5A8KA 4KB7A 4IG0A 3SSQA 4WZQA 2V0NA 4OHYA 2FJAB 4PXDA 5KT7A 5K9FA 2YNHA 4DQPA 2BRKA 2RJZA 4C8MA 3C2PA 2BVZA 4C8NA 4A47A 3T9NA 4HL9A 2D9PA 3MPYA 4KQZA 4KPYA 3QMQA 1SV5B 1VQLS 4PWDB 1YRTA 2IA0A 4CH1A 2DGOA 3B82A 1SKRA 4ED7A 1HPZA 1REVA 3I4PA 4QQBA 5HROA 4DSKA 1U8SA 2J0WA 2VPWB 2G13A 1JB0C 2CJ9A 2C3OA 3HVRA 3MAQA 1TK5A 1FNOA 5LMNF 3FVYA 2D9OA 4AXJA 4NLXA 1V3SA 5HO4A 3UI3A 4DSEA 2ZOMA 2F7VA 4FVMA 4ZPVR 4ZCKA 3TW0A 4KAIA 2VBYA 3PEJA 4Y2KA 4C0BA 1NJIT 1U1LA 1CVJA 5IS2A 2HHWA 4I1TA 2OD4A 3M6VA 1X4GA 1DBDA 4IFVA 1KQKA 4WIIA 2CPJA 2JEGA 2MGZA 3PNIA 3HDSA 2BOPA 2I2YA 1H7WA 1XERA 2W4CA 4WTYA 1KVJA 1LWCB 1RA7A 1S4FA 1U6ZA 1FDBA 3NP5A 3M9NB 1ZM2A 2AJ0A 3KLEA 3HKWA 1Q8BA 5B0GA 4ZDNA 1ZAWA 5DQIA 4KTQA 5T41A 4NRTA 5K8NA 4I2PA 3T5JA 1HYSA 2OTJS 1N5QA 5CYMA 4PUOA 3SV3A 1T03A 1XNRF 2QA4S 3DYAA 3LANA 2QZ8A 3IN5A 1JX4A 3BSNA 3KYLA 1RTIB 3V4IA 5E33A 3CJKB 4ZK7M 3TANA 4DQRA 2WB4A 4OX7A 3R3TA 4JYAF 4C2MA 3MM5A 1BWEA 2HW3A 3H25A 5KFLA 4IDKB 3SDEA 2C42A 4B08A 1S9GB 3MD1A 5AE1A 2DGQA 1UVIA 4QU7A 2YKOA 5BYQA 1D9FA 3JB9k 2XMKA 4X4TA 3V81B 2JRSA 2KT2A 2GO9A 4HH0A 2DR5A 2C3MA 2HQIA 1VBYA 2NR0A 4JI2F 2PE8A 4YEAA 4H4MA 5IT9Y 3KJVA 1S1WA 3T9ZA 5GAEI 2MQMA 4WZMA 1FEHA 1S6OA 3MEDB 4X4OA 5JVGQ 2DNNA 1R31A 3T1YF 3PZPA 2HLTA 3AY0A 2DNHA 1FRLA 2XGQA 2IBKA 2HYIB 3KTQA 3CEDA 2MDAA 2AWZA 2YNFA 3MOZA 3S6EA 5KG7A 1ZTTA 4GMKA 4UUWA 1ZBTA 3QIDA 4C0OC 4K5SA 3JSMA 3BGFA 2DRAA 1FKOB 2J6TA 2B0GA 2MZQA 5KFYA 2VFRA 3I87A 3CJ0A 2YH1A 3EPGA 4I69A 1RT3A 3OFFA 3DRSB 2YKQA 1Q86T 1TQLA 1IJFB 6FDRA 1WWHA 1SL1A 4HTIA 2XY5A 2XNRA 4HH1A 4A8YA 2OPSA 3GIIA 1YIJS 3NGDA 3MR6A 1M0SA 3V5RA 1UETA 2VFTA 4OLOA 4OL8A 4FXWA 4KE5A 1S1XB 2XSFA 3I0RA 4DL2A 2IRUA 2EVZA 2MMYA 2XMVA 3GIMA 1X4AA 1G6BA 4NA3A 3BSCA 4ID8A 4WK1A 4RNHA 1KONA 3DXSX 2VQEF 1FHTA 5KFPA 3CXCR 3BQ2A 3KHRA 2UV8G 4MYUA 2YNGA 3GIJA 4JI7F 1QAIA 3QIPB 3GG0A 3NS6A 1U1MA 4UY85 4JV2A 3T19A 1VRTA 5B0EA 3E2EA 2EW9A 5AE3A 1P8GA 3UPFA 1S99A 5HMXA 2ZH8A 4JI3F 1ELOA 3IO1A 4Z2XA 1Y00A 1PSDA 2BQ3A 1YJUA 3D54A 2LDYA 2HVZA 4F8RA 4K4ZA 3FMBA 5L1JA 2PT0A 3MM7A 2N7YA 1MMLA 4QWDA 1GXUA 2ZNYA 2YX4A 3QAUA 4J9QA 4OI2A 4KHMA 2MKIA 4DV4F 3OHAA 4DR6F 2FD2A 5MAOA 3OFGA 5HI7A 5A8WA 3THTA 1FCAA 2M70A 4TQRA 1HWLA 2FPHX 5F3ZA 4J9MA 1SH3A 1HHSA 3CC7S 1X7VA 5DETA 2CPYA 2WONB 1AFJA 1IBLF 2D74B 2MQNA 4QIVA 5D4LA 3OTCA 4DL4A 2Y1IA 1JK9B 2AU0A 1NRKA 2CDQA 4WXWA 3I5CA 3MM8A 1T8EA 4ZVHA 2OFGX 2DNKA 2GQQA 4AL6A 3ZZZA 2HWHA 5HP1A 5DQGA 4NLDA 2DT9A 1FK9B 2CIMA 2WSEC 2ZNZA 3LOUA 4FXVA 4C11B 1K1QA 1X5PA 5A8KB 3Q2TC 3H59A 4O0IA 1JKHA 2DHGA 1LV5A 5H9FJ 5IT0A 4YDDB 4L6V3 2F8EX 4TU9A 3CCTA 2ZKUA 2R8IA 4R25A 4OZ0A 1SBRA 3C6TA 4OI4A 4CQ1A 2P9GA 2RE1A 4EFAC 2GHPA 2QFJA 2V9KA 2RIJA 2RNEA 2KM8C 2QMWA 4O3QA 3IG1A 2FIUA 5IM0B 2YNIA 2DH9A 1VQ4S 1FNMA 4N8NA 3GV5B 4CO1A 4PWUA 3OV7A 5KT6A 4CO4A 4WXOA 3CMAS 1FT8A 2CPIA 2IAJA 3M8PB 4UUXA 3PIPQ 4DL6A 2ZE2B 1S7HA 3CCLS 4C8YA 3R27A 4DHVA 2E1MC 1C0UB 1XTZA 3QGPA 2KFZA 3NBPA 1Q1KA 3ZZYA 1HWJA 5HLFA 4A46A 3IR6B 3AQPA 5G0RA 1UA1A 1QUPA 3DM2A 1IJEB 4QPTA 4URGA 1J5OB 3HVAA 4WFYA 5CH7B 3IA0A 4M1KA 2RQKA 3E3XA 5JXSA 4DBQA 2XLKA 3NL0A 1WI6A 4WYLA 3CC2S 3S01A 4ED0A 2B3TB 5AJ3F 3ZZTA 2B5JA 1JLEA 4CO2A 2J5AA 4NLQA 4DSFA 3HVWA 3DLGA 3KLEB 2Q66A 4MTPA 2IYIA 3PW4A 1NK7A 1DHMA 4ZP6A 3PO5A 2FHJD 2M88A 4RUCA 5L9XA 1RT2B 3LGNA 4RBTA 3TAQA 2E5IA 2XC9A 3SYZA 2DHSA 2UUTA 3N5BA 4UW2A 1TFYA 4F67A 3B8HA 4NLWA 1NJWA 5J2MB 1RT7B 4LVOP 2IMOA 2R7RA 4I4BA 3D0HE 5EDWA 4LSLA 3I4HX 3J81Y 3SDEB 3RRKA 3DOLB 2CJQA 3I82A 2ZH9A 3KNGA 2WB1D 5GADU 2SXLA 1H2TZ 1S6QB 2EFQA 3KK3B 4OX9F 2K1RB 1VQ6S 1S6UA 2K3IA 1N34F 3M2VA 1XN9A 1JLAB 5CZXA 4B9UA 2Q79A 1RTDA 3EYZA 3O1LA 2KHCA