3DGPB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3dgpB00
3DGPB 2JNJA 3DOMB 1YDLA
chains in the Genus database with same CATH superfamily
2V8DA 2KG1A 2E5HA 3GONA 3N28A 3CDUA 1JLCA 2A2DA 3GFHA 1RT4A 2E7VA 4J9QA 3BSCA 3HX9A 2BOAA 2DEJA 3PW4A 1P9YA 4C3LA 1HWIA 3BJYA 4B9TA 1RTHA 5ITHA 1A9NB 3HHKA 1ZH5A 3TVYA 2JLGA 2D41A 4LF6J 5A2QY 3T1YJ 2DXFA 4IFYA 3FVYA 5CYQB 1VQ4S 2LQBA 1VCTA 1XN9A 2MZSA 3B6BA 2E1PA 5DDOC 5CYMB 2A6OA 1Z4UA 4V19X 1XERA 2XY5A 4CO4A 1UVKA 2W8LA 3WC2A 3KMQA 3ZZYA 5C2CA 1RAIB 1WC0A 2W25A 3OVAA 2K1RA 5LSOA 2GW8A 4A8MP 1U1KA 3H5XA 3PYFA 3ETOA 1S97A 1QE1B 2BUNA 3CJKA 1UVMA 3GTYX 1RT5A 4PWDB 3TA0A 2KZMA 2HBRB 4WE1B 3AOAA 4ZPWR 2HK3A 2X7IA 1CQMA 4AL5A 1N56A 1I51B 2Q6BA 5ETNA 1C1BB 4OL8A 2XNQA 4JI1F 2UVUA 5C24B 4WFAQ 1N34J 1BD6A 5C42A 3N6LA 3NS7B 4YQWA 5H9EK 1XIQA 4AL7A 2LKZA 2WK4A 2LYVA 3AB2B 1YJWS 1S72S 2LA6A 2B4OA 2DNNA 2YNGB 5FLXY 2QLWA 1TK8A 1E6VB 1X4BA 1T03B 1L3KA 3I5BA 2KT5A 4NMXA 2FYXA 5C5JA 4LVOP 5A8RB 3M9NB 2WZ1A 3EZOA 4ZVEA 5L38A 2QA4G 5THWA 4EMDA 4X4RA 1RE1B 2V4JB 1NK8A 1NAQA 1GK8A 4NRUA 5K20B 2CUYA 1H74A 2VG5A 4IQXA 3KK3A 1WI6A 4WTOB 1IQTA 3NS6A 2XS5A 3G8TA 2CQ0A 1OPZA 2OKQA 5KFTA 1M90T 4NA1A 2RT3A 4WWSA 3RRKA 1VC5A 2UUWA 1KD1T 1F0XA 3LWMA 2OMLA 4QW9A 3LA0A 2FGOA 1UFWA 1SQGA 3BR9A 4PYDA 2VFSA 3CTRA 4DUYF 4PWWA 1RWOB 4DG1A 4DS5A 4JV5J 1IWAA 3C8YA 1IJFB 2XMTA 3R27A 4OZ1A 3BGOP 2ZOMA 1NDKA 4YFUA 4JI2F 5D0EA 3I96A 4Y0FA 3FK4A 1E6YA 2VG6B 3BM7A 1N5VA 2CPHA 1OY9A 2XBPA 2L08A 1R6YA 1KEKA 3SSRA 2YWGA 1NU4A 1EQ0A 1X4AA 2XG8A 2VKRA 4C97A 4ITSA 2LQ9A 2ASLA 2HVIA 3NY0A 4OZLA 3HPOA 3DDKA 1RA6A 1ZS6A 2QA1A 3G9CA 3QMQA 1URNA 1JNRB 3I9ZA 3EVWA 3M2VA 4O3OA 3MCMA 1SL1A 3PW2A 2VIHA 2MKSA 3D0GE 4I64A 4M5HA 2MKYA 2KG0A 5F41A 3MUVP 5CD4A 3MCNA 2CDQA 4BWJA 4ZJOA 4ED8A 3HHNB 1NKEA 2LFVA 1OYDA 4A8OA 4GMKA 1HW8A 1JLGB 2IM2A 5L1LA 3TQEA 5F3ZA 3CCES 1M1HA 1S48A 1A7GE 5H9EJ 3DNCA 1DRZA 3O8WA 5BYRA 3C14B 3ZZOA 4KHPF 2W2QP 1RB0A 2BEFA 5A0YB 2L9NA 4WP3A 1PBUA 2XY6A 3JSMA 3W2VB 3GJTB 1H6KX 4LFBF 3KK1B 5CCLA 3OSPA 4IRDA 5L1JA 2YKQA 4MYTA 1VC0A 3D1OA 4W98A 1RAJA 1G2EA 1XTZA 3I5AA 4LRFA 5GAEU 3R6GB 1TZ0A 4AQYF 1PJ6A 2I2YA 3RBDA 1TR0A 1KVIA 3F0NA 2FC9A 3TQ1A 3TX8A 1F5AA 2G4BA 1MROA 1KHVA 5J2NB 3MOJB 1K44A 1UEUA 3VV2B 4CT8A 1FDDA 2CQDA 3BQ1A 1TK0A 1RISA 1FVQA 3DN9A 3IM8A 2LXIA 1WORA 2JC0A 2RE1A 1SIWB 4JI8F 3LF0A 4A8SA 4IH5A 1SKSA 2PEHA 1TUVA 2V2VA 4HHHA 3VWSA 5A2QU 2R42A 1HBOB 2WONA 4OYPA 2FQQB 3BDEA 2DPJA 4G1IA 3AY0A 2HNDB 1TL5A 1MMDA 2XLIA 4USMA 5HQMA 3UVJB 1N88A 3OW2R 3X3UA 1U1RA 4DV3F 4U67Q 2MLXA 4CIOA 3IXQA 1BY9A 1Q5VA 3DOMA 5L1KA 4TYBA 2YPZA 1FDBA 1ZYQA 1M5SA 1UJ5A 3H2LA 1S1TA 3B78A 3LOUA 5G0RA 5IS2A 4DL0C 1TKXA 1F3VA 4N76A 1R8PA 3MTKA 4KSEB 1WG5A 4ECQA 1IKVB 4Y2CA 3MUTP 2OD4A 4WK3A 1BUXA 4ILMA 1IKYB 5G4DA 2VB6A 3F73A 4ZPTR 3QGGA 4ECYA 1WKJA 5FIIA 4NLUA 4OI6A 4ES3A 1V3RA 1UJ4A 3FUYA 4BC9A 1S77D 5C25B 1GXTA 1WUUA 5FLXU 5B0CA 2BDPA 4I2PA 3T5LA 3LP1B 4XPCA 2AQ4A 1RUSA 1EETB 2KB2A 4JI1J 1T9TA 5K8PA 4NEZA 2B7BB 5C7PA 2N7CA 2OGUA 3IWLA 3M8PA 3MDFA 1HD0A 3GYXB 3H4DA 1XEZA 4DR3F 5K8OA 5RUBA 4FPRA 3GPAA 4O3PA 1APSA 2QL5B 4DBQA 1U02A 3SSSA 2VPYB 1CEZA 3HKZD 3I0SB 4EUVA 2XCPA 2DPIA 1FEHA 4DV7F 2GZOA 5IXUA 1K8AT 2LP4A 2JLFA 1RDRA 3PDNA 1NBEB 2CVEA 4CLWA 5L9NA 1VHFA 1RU2A 4E8UA 5GMEA 4RO0A 4N8NA 4OYAA 2X1AA 3QAEA 5KFUA 3KUEA 3S01A 3IM9A 3FSXA 1N48A 3CGIA 1UEKA 4DUYJ 1TV6B 4DR7F 1FI4A 1OO0B 1HD1A 3CCQS 4L75A 4CYUB 1Q8IA 4ZVFA 2KRRA 1H38A 2GVDB 2ASYA 4DCOB 2C2EA 1SQEA 5KT3A 2XS2A 4CLSA 2V4QA 3M2RB 2EFVA 3BEGB 4JI2J 2XWXA 4FVCA 1F2HA 4ZPCA 3T5KA 4DL4A 3H7HB 4IH6A 4IG3B 2J7WA 1Q82T 4OZJA 1WWHA 2ZJQQ 5B09A 1OYEA 3DLHA 2Q6CA 3KTQA 2RRNA 1B0TA 2BJEA 3U02A 4QR1A 5LMUF 1HNXF 2YX1A 3GCWP 4FF3A 2G2ZA 5LXYA 2YKPA 3R3TA 5FJ4A 4WP9A 4IOCQ 3HVWA 3M8SA 1KVKA 1FWLA 5E3QA 4WYLA 2LA4A 4OQJA 2HNYA 2Y3YA 2ZWOA 1B4SA 2XMAA 3V5RA 2P6TA 4PZVA 1VK3A 2AMCB 4E98A 3GV7B 5L9XA 1TUGB 3KLHB 3M8QB 5D3GA 3THPA 3RJMB 3L9ZA 1U26A 3K5NA 2HFNA 1S0MA 2R2RA 1JJCB 3IRWP 4FXWA 3FQKA 4QU7A 4WKYA 2MB0B 1ZAVA 2CQ2A 1T02A 1PBAA 2AT1B 2W7OA 3BZQA 1NJXA 2PT0A 3KLIB 4L76A 1T9UA 4DDFA 3RU0A 4USTA 4ZDNA 1H98A 2FHMA 2PEBA 4O4RA 2HHTA 3K5OA 1JX4A 4P6QA 2GQ2A 4WIQA 1AROP 1HARA 5KFDA 1FA0A 3C6UB 2XO6A 5AJ3F 1SJFA 2F3JA 2X1GA 3CCTA 4C0HA 1XR5A 2DGSA 5IC4B 4ZHRB 3A8KA 3T3FA 2WBMA 1OPIA 4K0KF 4RW8B 4KHPJ 1S76D 3WC0A 2L9WA 2KYXA 5JVHQ 4Q43A 3Q86A 2QZ8A 3LO3A 2Y1IA 1V5IB 3DKDA 4ZN1A 4TNOA 4DQIA 3MXHP 1DAXA 3GJRB 4LFBJ 3NGUA 3K0JA 3CCMS 1CJUA 7FDRA 5JVGQ 3R5BA 4KC5A 1IBLF 2YH1A 4ZCMA 4DR5F 4MKBA 5DQIA 3IBCB 3EVOA 4AQYJ 1S0NA 2Y1JA 5J1EB 4OYWA 4RBVA 4LUBA 1HA1A 3Q8PB 1VBKA 1FD2A 4DSKA 5A76A 1U48A 4USJC 3EDRB 4JOUA 1WDDA 4QWEA 5DQHA 3PRVA 2H48B 4PXBA 1ZBTA 4BWMA 3DYAA 1ACMB 4GVBA 1QUPA 1VLYA 1NCLA 3CO0P 3RUBL 4U8VA 2HRTA 3GJSB 3JYTA 4EFAC 4CO0A 2VL1A 4LBIA 1U0HB 4XTTA 4JI8J 3VQSA 1OQ3A 3AA9A 1WTBA 4YP3A 2HKEA 2GO9A 1X5TA 3M6UA 5CABA 4C4WA 2X1BA 3C16B 5A8KB 2YNHB 3ICLA 1N52B 2HFSA 1HWUA 4DV3J 2GCFA 1TKZB 2GO8A 2FHKA 1UAWA 3JTPA 1IM4A 4OHVA 2IM0A 4UT4A 3PVXA 4FVMA 2UVRA 1URRA 2CPFA 4XPEA 4QPTA 5D4PA 1CC7A 1P1LA 3GZ7A 3D9BA 1I6JA 1U8SA 3LPEA 1XWLA 2IVFB 3ISZA 4ZVTB 1PSDA 1S6PB 3H4BA 2W9CB 5DDQC 4J5OA 2J5AA 3MZIA 3JQJA 5IM0A 3GR0A 2IAJA 2NUUG 3AH6A 4CLYA 3V2UC 3MR2A 4JI0F 2HBYB 2ZBQA 1QAXA 2AX0A 4KO0A 5CYJA 2IRUA 3FEZA 4OX9F 3K5LA 4LVNP 2HHHF 3UDCA 4WFBQ 5EUHA 2F65A 4ED0A 2B5JA 1NMEB 5EN1A 2E1MC 3TNVA 3OR2A 3HFZB 3RB6A 3M05A 4PQAA 2ZC3A 1VQKS 1FE4A 1CVJA 1MU2A 2DNHA 4DQQA 1KVJA 1YZ6A 4CH0S 5ETQA 2AGPA 4GVLA 1CJTB 2QG9B 2PA8D 4YMEA 1SPBP 5B0DA 1IKWB 3SQGA 2V94A 4DR3J 3LPYA 2JL9A 2QC3A 2JEGA 2D3ZA 5J2MA 1SC1B 1VQMS 1QAIA 1A6LA 1OSCA 4PUOB 3WX4A 5K8NA 2VH7A 1SIZA 2C3MA 4IKAA 3DOLB 3FFIB 1Y3JA 2WRMA 4TKTA 3FSIA 1ZA1B 1N8RT 4DV7J 2E44A 4URQU 1LWXA 1Q8KA 2WVBA 4B3OB 3M32B 1YLXA 1HBMB 1TKTB 4ID5A 3RTVA 3OJSA 2C3OA 3C15A 2NQPA 1F9HA 2VONA 2JHEA 2DITA 4IO9Q 3PIOQ 3GU0A 2VU5A 4X4TA 1EZZB 4Q0BB 4DZDA 1REGX 2AF6A 2IIHA 2MZTA 4I56A 1UVLA 3DRPA 3LUYA 4OI0A 1UWAA 4ED6A 5T7LA 4DR7J 3DLEA 4LT6A 4ED3A 4QCLA 3IWXA 4UZBA 3MR5A 1X60A 2OEKA 2BXJA 1NSQA 2D1CA 3RR8A 3MR6A 4DWIA 1HMVA 2G9OA 3M2UB 3FCWA 3ILOA 5KFBA 3ET6B 2M4MA 3ZTRA 1RT1B 1FWKA 2QIFA 1DQ8A 1P27B 1YJNS 3HVRA 3DGPB 3CNQP 2EEYA 4HI1A 2RS2A 3VCDA 3OL7A 4ILRA 3TAMA 2VDHA 5LMUJ 3L3CA 1HNXJ 2KYZA 1DHMA 3AD7C 3SI8A 2BR0A 4IG0A 2ZH5A 2FGCA 2OPSB 2WVFA 1LWFA 2HLUA 1TQLA 4ED1A 2MGZA 3QWPA 3DRXA 4A8FA 4I4BA 2WB4A 3BBFA 3J81j 2LU1A 4OYXA 1LV5A 4P7TA 4EZ6A 3K57A 5HMXA 5F8LA 1U1PA 1CULB 3JTOA 3VAMA 4K8RA 1RWNB 2EBEA 2XSFA 4HDGA 3MOZA 1C0UA 3MECB 5KT7A 2AJFE 3W63A 2FLOA 2CVIA 5BYSA 2LXUA 3A8IA 5IWAF 3IR6B 3TUIC 3OFEA 1NO8A 2L9DA 2GHVC 2XSJA 4J7CA 2IRXA 5GAGI 2CA9A 4QIFA 1VRTB 1U25A 2CXEA 3N5BA 5KFIA 2D3O1 3QZ7A 5AJ3J 1FTRA 1J5OB 4LQ9A 3KHRA 5M2UA 1PO6A 2UVVA 2XULA 1FO1A 5F8MA 1P9QC 3V81A 5E33A 3NS5A 4K0KJ 4RR5A 2MQQA 4F25A 4DEZA 4K4UA 2BJ8A 2ZOFA 2ZWPA 1PILA 5KAKA 2ZE2B 4M5DB 3THVA 3KLGB 2YTCA 4ZVGA 1RHJB 3IS9B 1RBOB 3OHBA 2EFPA 3D4JA 4W4MA 1X9MA 4F4KA 1IBLJ 1QLNA 2AW0A 5EDWA 4XDCA 4X4NA 2IRYA 4DR5J 2B0GA 2C3PA 1SC4B 4DPUA 2FVSA 2BKNA 2FJXA 1ZA2B 3FDSA 1RA7A 2BZ2A 1X5SA 1N5YA 1M5OC 1RQ0A 3KOAA 2YWEA 1RT6A 3MM8B 4I67A 3K58A 3Q8SB 2ZH1A 1JXVA 4X4PA 3P8BB 3DHXA 2ZBRA 5KFCA 1U45A 4MIWA 3MEEB 5DM7Q 1JLQA 1V9OA 4FF4A 1WEXA 2U2FA 4YDDB 4IFYB 1XNQF 2OPPB 1TL4A 4D3GA 3RYLA 4NCGA 2HVDA 1UZHA 1ZAWA 2NS1B 5BR8F 4CLZA 2NSCA 1RKIA 3MEDB 2RIJA 4ZCKA 3RG6A 4N77A 4ECTA 2K1RB 4K2JA 1IBMJ 2NPIA 3NXZA 2IJRA 1IBCB 2EG2A 3EE3A 3EGZA 3QAUA 2A6MA 3KKFA 1C0TA 1KSPA 1TP7A 1FERA 5HQ8A 1WC3A 1Y5NB 1TL1A 2WSCC 1WEZA 2PFDA 3OD2A 3NGSA 1T9YA 1YX2A 3QO9A 4UOFA 3DLKB 4I0WA 3UD4P 5IT0A 4KRWA 5C42B 4FYYB 1H2UX 4OX7A 1JLEA 2C1EB 1F3FA 4NXMF 2VPWB 2SXLA 3OVBA 3TX0A 2KVQE 3NOGA 3DRSA 4JI0J 4WFYA 1QDUB 4ECWA 5HLFA 1BQNA 1D3WA 4OX9J 2F63A 2HHHJ 4DHVA 3POTA 2B8QA 2QLJB 4WBFA 1JIHA 4Q8FA 2KXNB 2OSRA 1HIYA 3Q2TC 3CIZA 1Y0HA 3W8PA 2B6AB 4P2SA 5M2PA 1LKZA 2OHDA 2VPXB 2HGNA 3QT6A 4XO0A 1WHWA 3FCHA 8AT1B 5LL6d 1OIAA 1UETA 4AYBD 1RT2B 5E3AA 2IC3B 5EWFA 3HD1A 3RW7A 9ATCB 1RP5A 3KHLA 3QJLA 3QRRA 2R7TA 1BHNA 2AYGA 4F3MA 2QMXA 2FD2A 2DR6A 2A2CA 2J7KA 4AE5A 5IT9Y 1U2CA 2IDLA 3OTDA 3T6JA 4RNHA 7AT1B 2BQUA 3TZWA 2G0CA 3AT1B 2E1RA 2GVZA 1WKKA 1KS2A 5HROA 4DG1B 1D9AA 2YXLA 2FLPA 4KKOA 4L73A 1N54B 3UW1A 2BE2A 2E5JA 1LW0A 2UUTA 5DETA 2QSFA 4ZVUB 3QBCA 3PACA 2LEAA 2JFKA 1GEHA 3UI3A 4O3QA 2HEKA 2KJWA 2RD5C 3N0VA 3X1LB 4DS4A 3CEDA 3O1LA 2YNFB 1RAGB 3AQOA 3C46A 3RBZA 5HP1A 2PE8A 1S7IA 4DU7A 3QLHA 5LJ5Y 5B0BA 3IAS9 1SJ1A 1VQ8S 2QA2A 5DGBA 4U7CA 2VQFF 4DV4F 3OUYA 4XIUA 1U2FA 2N7YA 4JYAF 3P5TL 2H9ZA 1NK0A 3SFUA 4B9MA 4UOGA 3VTIA 4FBTA 4TY9A 4OJ3A 3I9V9 5T41A 4LREA 3ZTOA 2QYGA 3MEKA 2HHUA 2IBKA 1Q86T 4RWWA 1X0FA 4DQPA 2ADBA 2HGLA 2MSTA 1NJIT 1C4CA 4A8WA 3L7PA 5E2QA 2DO4A 2B4UA 4EYIB 2HFVA 1IR2A 3U1MA 1D9FA 4RL1A 1K73T 1YIJS 1HYSB 5KG5A 2GAGC 1IBKF 4OHZA 3MI7X 5IV4A 2LDIA 2Y1RI 1M0SA 2VG7B 3IR7B 4F4ZA 2PMZD 2FLNA 2HVZA 1VQLS 3KMSA 4MYUA 3D3BJ 3HZEA 3KLEB 2CJQA 5IWAJ 3W5XA 4JI4F 2CZVC 3NCRA 2X51A 1RGVA 3ENVA 3QIPA 2C42A 1Q81T 3CUNA 3EX7B 4DN9A 4WPAA 3B4MA 4I7FA 4ZPVR 2DNYA 3R7SB 1DARA 1NDLA 2DVIA 1AA1B 2R2SA 2D74B 3VAJA 4CI0B 2MKCA 3M6VA 1VISA 4GKKF 2V67A 2XMJA 1Q53A 4DJBA 3BGFA 4OIXA 2Z56B 3OVSA 3MM9B 4N47A 1V3SA 4URSA 2VDIA 1WKLA 2MEWA 3MR7A 1SQFA 3N6NA 1T94A 4ZP9A 3GWCA 2CPXA 4HR2A 3DLGB 4IFVA 4OX8A 3G6XA 3NL0A 3N79A 4KT0C 3CW2C 2FJEB 3PCOB 2W4PA 2QO3A 2VBYA 2D7SA 1NRKA 4I68A 4U96A 3ZO7A 1SV5B 3DOMB 4JV1A 3SSQA 1KBRA 1M1KT 4F8RA 1GMVA 1S1TB 2Y9HA 3THTA 1XNQJ 4KAIA 2IYGA 5EX3A 2L48A 2I6WA 3UDEA 1EP4A 5BR8J 3HHLB 5H1SV 1FKOB 3TO8A 1UFKA 2K3KA 4LF4F 4LIWA 1CQNA 2NXNA 2C2KB 5CHCB 4NL5A 2WBRA 3HM9A 4ZPDA 2NZ4A 1OMSA 1TL7A 4DSLA 1CJKA 3SEOA 2DBBA 4JI5F 2CJBA 5KG4A 4PAAA 2DHSA 4WXWA 3J7YU 4DV5F 1I94F 1LXJA 4DFKA 4ALZA 3SYZA 2LECA 3L95X 1HNIB 3LGMA 4P73A 1EARA 1RU1A 1PAUB 1WHVA 3KG0A 2WHOA 1TKDA 2W24A 1RCXB 3IG1A 3IMQJ 3M8PB 4NXMJ 1CSJA 5GVQA 2FVPA 2QRRA 3R2DJ 2PO4A 1AYEA 3O5TB 5FDLA 3UCUP 3M7VA 2F8HA 2RVJA 8ATCB 5J1PA 3JQMA 3M30A 4DR1F 2JDJA 4FN5A 3RRHA 3C19A 4J9SA 1D09B 1Y10A 4LRAA 1YJVA 2FZGB 2E5GA 1GAOA 3SDEA 1XR7A 4USVA 1X4FA 3FQLA 2HWIA 1B7FA 3D68A 3MM6A 3BN7A 4HH1A 2BQ3A 3SV4A 3HJFA 4RW9B 5E3RA 1P6TA 4B3RF 4RBTA 2VZ9A 4KTQA 2R3VA 4PQUB 2F1FA 1HBNA 3R7NB 2IBOA 1ZETA 3A4TA 4R25A 4B3MF 4H4OA 4B9NA 2I8EA 2DNLA 3HSGA 2CJ9A 3DHWC 3BB5A 2H5IB 4MFBA 1UVIA 5L8RC 4PG6A 3R2CJ 3QWUA 1Q0NA 1S1VB 4LR8A 2ADCA 2DGXA 3OTBA 4L6V3 4LF8F 5I42A 2F9JA 2RKIA 1VQPS 1NHKL 3AXKA 3ZC4A 3JXOA 1WDTA 2RU9A 4JUZA 2BYCA 3FZBA 1N5SA 4G65A 3IWNC 1TL3B 2AU0A 3AD8C 5IZHA 5K14A 1KQSR 2Z2MA 1U8WA 2VV5A 2I9SA 3W62A 2VQFJ 1QD1A 4DV4J 2F5GA 2MKHA 3CJTA 2ZM6F 1YDLA 3MM7B 4JYAJ 1W2BR 2ZKTA 5CZXA 3SCJE 4DR6F 4X2BA 4WU3A 2NPFA 2ALZA 1FE0A 4F3OA 2DNGA 1D8YA 2DNQA 2QFIA 4ECXA 3U7JA 3QSIA 2MJNA 2OP5A 2P9CA 2M52A 4K4YA 4IRCA 5EWGA 5I3UA 3OQ2A 3QFHA 4YY3F 4M95A 2XEXA 2JSXA 4OJGA 2RQCA 3CJ3A 5KG3A 4OZ3A 1VC6A 1VQOS 3UNYA 2Z57B 1CS4B 4IDKA 3MAQA 5J2PB 4PR6A 4C0BA 1IBKJ 2VHGA 2ZUGA 1QM9A 2EVZA 3VQTA 2IJNA 4X84A 3CJRA 5HN0A 1WF2A 4X65F 5AXNA 5SZTA 2HRYA 3BPSP 3MCOA 2PFFB 5DZ7A 1DLOA 2A3JA 2VPZB 4JI4J 1HWKA 4YB7A 2V2QA 4O0NA 5CAAA 1TK5A 4I6AA 2CG4A 5KT4A 5MAOA 4IOBA 2HRUA 3HMJG 1U49A 1FK9A 3AHPA 4F2SA 2CADA 3M4XA 2CWXA 3VGTA 3HI9A 3UN2A 2HQIA 2ZJPQ 4NI2A 3RR7A 3DCAA 2V8GA 1B0PA 5HJXA 1ICEB 1X4EA 4MMOA 2Y8WA 3DLLQ 2P9GA 2QJ3A 4R5PA 4GKKJ 4GVBB 5LT5A 3OFFA 5D8HB 1SBRA 1MN9A 4F4YA 1VRUB 4U9RA 4DN0A 3JYTB 1WSVA 2Q43A 3M9OB 2PA3A 4NWBA 2N4CA 3NCPA 3KJVB 1BQMA 1S6UA 1C1CA 1NJYA 2FLLA 4DSIA 1D9DA 1RTDB 1YGYA 4OFZA 3HHEA 1B7YB 4R8UA 1S6OA 1S7HA 4WFZA 5HK4A 2P2CB 1AFJA 2BW2A 5KT2A 2VKZG 2N4DA 2ZNZA 3UE2A 3CXCR 4ZPBA 1R8BA 2I0XA 5D4OA 4DL5A 3IAM9 1LWCB 5LXRA 2M70A 4Y2KA 5CYQA 3MPUB 3CD6S 4DV1F 2XLKA 1OJ4A 4YB6A 5CYMA 4IRKA 3WHIA 4XAKA 3AAWB 1VBZA 4ZP8A 3R8YA 3JS9A 1TFWA 4DSFA 3AA8A 1MNEA 3J81U 1AT1B 2XQCA 4ECZA 4B9VA 1FXRA 1Q78A 4P71A 2N3OA 4YN3B 4CTAB 2V0NA 3CIMA 1FXLA 1XMOF 3FJ2A 1ZM9A 4ZS6A 5H9FK 1QE1A 2IAJB 1DY3A 2W7PA 2FJBB 2ZZNA 1W2IA 4LF4J 3CE8A 4PWDA 4C3MA 1YHQS 2MPUA 2IYIA 3W5YA 4IR9A 3CD5A 5HVGA 4JI5J 1C1BA 1AW0A 4CH7A 1SL2A 3M1VB 5KG7A 4DV5J 5C24A 1I94J 1T3NA 1OY8A 1T0TV 2OFHX 2KVIA 1REVB 3Q89A 2R9LA 3ZNUA 2YPYA 1S1WB 2YNGA 2NXEA 3AJDA 1XBWA 4CLFA 4DL2A 3HJVA 2WVEA 3R5GA 2K06A 5A8RA 3WQPA 2OAUA 3I32A 2VFRA 4YUDA 3V6JA 2LQ5A 4DCPB 1NPPA 3T41A 4BS2A 3AJ1A 1RJJA 4IQMA 1RBLA 2FPHX 4DR1J 4O44A 2B4VA 4TU7A 1G7CB 5DG8A 5IQQA 2J6UA 4RU2A 4NXNF 1OQ6A 2EFOA 3PW0A 3M6XA 1O6XA 2FB0A 4LSNB 3TVKA 1RWVB 2W2PP 1PG5B 1UPMB 2CQCA 4DL7A 2DXEA 1VQ7S 2XMVA 4CO3A 2HNZB 3RZAA 3RBXA 3QT5A 4B9UA 3PYGA 4B3RJ 4OZ5A 4Q2LA 2W01A 5T7LB 3M8YA 4P72A 2B9EA 3B8HA 2VG6A 2W4DA 4DLGA 1U1LA 1T9XA 2F8MA 2XCAA 2JC1A 2LQ8A 4B3MJ 2E7WA 2ABYA 4X4UA 2OEMA 4MKVA 3VAKA 3KUHA 2R7UA 4PPZA 2GQQA 2I5JB 4ANCA 4LF8J 4OZ2A 1X5OA 4ICLB 2RJZA 3CDBA 4F02A 2JH3A 1VJWA 3TAMB 3MWBA 3ZFVA 2LEBA 4ES2A 2KJVA 2R2UA 3QJPA 3AB4B 5H9FJ 1U6FA 1UEVA 2UZAA 1M1GA 2C22A 4J90A 1KR4A 1VYAA 2ZM6J 5J2QB 1WOOA 1PIEA 1RKJA 2HVHA 3TJ8A 4ECVA 2HZVA 3CWJA 1JKHB 3D6TB 3CC7S 4DR6J 1JLGA 3L4BC 2CQ3A 9RUBA 2CYYA 3NOCA 3MM5B 4DFPA 2C2OB 1I3OB 2OSQA 3HSDA 3U27A 3ENAA 4ED5A 2DEIA 4C3KA 4H54A 5I4MA 3BQ2A 5GAGU 3C14A 3TJ9A 4NX9A 4ELUA 1DTTB 3JAMU 4ZCLA 4YHHF 2HG4A 3TUJC 2LU2A 2HHXA 5A0YA 4YY3J 2EW9A 1I1GA 3TAQA 2F9DA 2OMOA 3W2VA 2WB1D 1SCJB 1Q79A 4J9KA 1TMMA 2KKHA 1R43A 3WIUA 2VFUA 2ZDPA 2N3LA 2HIQA 3NWGA 3CF5Q 3V81B 1N6QA 3OHAA 4OHWA 1NK7A 2PMHA 2KFNA 4QIVA 1RCOB 3D28A 2ATLA 4C8MA 3UDLA 3QQCD 4FZVA 2W2OP 4X65J 3IGVA 4LR7A 4WU2A 4ECSA 3UQSA 1NDCA 5MLCV 2IHR1 4QOTA 4YOEA 2XGQA 3RW6A 5D6GA 1T3OA 5L1IA 3PEJA 3U1NA 3O3LA 1WOSA 4HACA 3D5MA 2DT9A 3J7Z5 5F3TA 1A0OB 1LK7A 2PC6A 5J2NA 3DRRB 1GT8A 5GMDA 2XI3A 3CULA 1NPKA 2FJVA 4LRDA 2FY8A 2HFUA 1JLQB 2Y8YA 2X3DA 4NZ7A 2G1HA 3NGRA 1HI8A 2HNDA 4NCGB 2V2KA 2YWHA 3Q0AA 1N5TA 1YSJA 2FJAB 1VBYA 3UVJA 1Y4ZB 3Q8RB 3NBPA 5E3CA 3LWLA 2WSEC 1LWEB 4KHRA 5HJYA 4WZQA 3GJQB 3TA1A 1GX6A 4F7VA 3FCVA 3EPIA 2CNLB 2V8VA 4CCHA 3TARA 1C0TB 3CJ4A 4OHXA 2K3IA 1SJ3P 1IWGA 3OR1B 3CJ5A 3NG8A 1J2VA 4DV1J 1IKVA 2CPDA 2CQIA 3JQKA 1IKYA 1QUVA 1RWKB 3ISNC 1RWMB 3MF5A 3KFWX 3E8OA 3V6DA 4J37A 1B3TA 4PG7A 1XMOJ 1MW7A 4RJVA 3GSIA 3GFXA 1KLNA 2BKPA 2DNZA 3OJUA 4ANEA 2DIVA 2R2TA 1L3VA 2Y0SD 4NMLA 1BQNB 2C2ZB 3N6MA 4IR1A 2EG1A 4NLVA 1RHRB 3DM2A 3ELHA 4LBPA 4M63A 5L46A 1N5QA 2ASJA 1JLFA 2DNOA 1WACA 1BMQB 4O23A 3B82A 1U6ZA 1LNQA 4ELVA 3FRYA 1WEYA 3G82B 2M8HA 4U6PA 1WG4A 2C2MB 4K59A 2GNKA 2G13A 5HANA 4KGMA 3LAKA 1L3UA 2HSEB 1KQGB 1ZTWA 2BVZA 2AJQA 2DH7A 2EFQA 1CBKA 5A6WA 4P2FA 1NB2A 3I0SA 4O3NA 1S1XB 3S8SA 4DQRA 2HS3A 2RHQB 3OFHA 5D4NA 2VC0A 3OXGA 2PGCA 1KLMB 1K9MT 5D78A 5KFGA 2DR8A 5F8GA 1WD6A 1NKCA 3O44A 3J7A1 2KI2A 4NZ6A 3RBEA 4NXNJ 2AEFA 3H5UA 2OEJA 2U1AA 4RW6B 1Q16B 1S4FA 2WOMA 2J0SD 4PXEA 3T1AA 3MFHA 4O3SA 2OLWA 1D0EA 3GP9A 2E5LF 4JV0A 5GMKa 4OJ1A 1FX4A 4K50A 4JV2A 2XO7A 4Q7AA 4RW4A 1Q95G 4P75A 2GVDA 5HP1B 5KFEA 1N36F 2UXCF 1K47A 4S0MA 3M2RA 3QLHB 1SH3A 2HQDA 4ATNA 5DGAA 4A46A 4BLGA 2HAFA 4QR2A 2VJVA 4L3KA 1NHUA 4UF4A 1GFWB 3GFZA 2QL7B 4MK9A 2O01C 1CLFA 3R97A 3D6FB 4GKJF 1GQEA 2QLBB 3SCKE 2JEIA 2QE5A 2GAHC 3OL9A 5LJ3Y 2O67A 4DCJB 1YZ7A 2GX8A 2M5YA 4URGA 1JXLA 1RI7A 3FBFA 4F50A 3US5A 3HXMA 1U7LA 3OT9A 2CZ4A 3KXDA 5DRKA 2V8HA 4LFCF 5JMNA 2WAQD 4WK1A 3GV8B 3M8QA 3TP2A 1RAHB 3LP2A 1VMBA 4V19J 2W7AA 1OSDA 1YJRA 3SFGA 2W2MP 3VZIA 4KYZA 4NLOA 1R6VA 1HPZA 3KLIA 4G6VB 2W9BA 3GIRA 4ZLJA 4LRCA 2KHCA 3C6UA 2QEXS 4CNZA 3UCZP 1VS3A 3CT9A 3MTJA 1ULRA 4B3SF 3CVKA 4HHJA 3HLUA 3L7UA 1WHXA 4YHHJ 3M8RA 1SL0A 1R8CA 1IQZA 4QW8A 4I7FB 4KFBB 1VK8A 2Q66A 4GC6A 3SZ2A 2VBWA 1Y5LB 2V8PA 4YDXA 1B70B 1NK6A 2E29A 5BXIA 2LCWA 3WZ0A 1LEOA 2X3GA 2BACA 3FC9A 4MIBA 4J9OA 4EGLA 1X9SA 3G86A 2VC1A 2BRLA 2YNIA 4H4MB 3PNIA 3TEGA 5J1EA 2MQNA 4NYPA 2RQKA 3I6PA 3K8VA 1HBUA 2IVMA 1IN0A 2BMBA 2NR0A 2QMUB 2EKNA 5CCMA 3BN4A 1ZTTA 2GGPB 1RWWB 2KDOA 4M94A 1RLCL 2MDAA 4IFVB 1PYTA 2ACMA 3BDPA 2EK1A 4KV8B 2D9OA 2H51B 4ZOSA 2AKWB 5CD4H 2J9DA 3CJ0A 3PO4A 5GAHU 2KHDA 3W64A 4OI3A 1U0HA 3H40A 5D0GA 3PRDA 2Z2ZA 3Q8QB 1D8ZA 4RKUC 2BANB 1KQKA 1QAYA 8RUCA 4NE9C 2MLZA 2WW8A 2JZ5A 4UY8T 3IO1A 4F4WA 4EYHB 2BJ7A 2WVDA 4TQRA 2V2ZA 4CP5A 3KHGA 1YKWA 4K4SA 2DD8S 5A8KA 4CLLA 5KFSA 3CMAS 2YNHA 3PXGa 3GYNA 3G96A 4N7TA 3NEKA 3ZZZA 1B64A 2BRKA 3BGRB 2V69A 2C2NA 2YWWA 1VHIA 5ETTA 1NKBA 3UR0A 1RTJA 3QT8A 1FNXH 2V9KA 5ADZA 1SUQB 2BJ1A 4K4ZA 1JLAA 3MEGB 3ULHA 5DDPC 3IBFB 2R8KA 2FUG9 3TI0A 3SXLA 3RAMA 3H8YA 2EI5A 1NSAA 2G0JA 1VQ9S 4L74A 3S7RA 2RAQA 3IG1B 2OI2A 2LEPA 4K4XA 2RDIA 5E7OB 4JI7F 3CMQA 2YQ3A 3MAAB 3I5CA 1RT3A 4PXCA 2DCLA 2AIRB 1S57A 4Z37A 3UD5A 5FDLB 1R3NA 1OWXA 3C6TA 1KTQA 3BO3A 4B9LA 2HQGA 3I0RA 1GX5A 2HZCA 1SKWA 2HVEA 3QZ8A 3CC4S 4USUA 4CLUA 2ZFHA 2LVWA 1CJTA 2IM3A 2ROPA 1X9WA 3N9UC 2DO0A 5A8WA 3DI6B 1RTIB 2AJ1A 1HI1A 1IKWA 2NCKL 1QVFR 3HD2A 1LQ9A 3MM6B 3QYYA 2ACYA 4PUOA 2KT3A 4X62F 1N0UA 2RF2B 3MMCA 4PG8A 1R8HA 3FFIA 2IA6A 2XB2D 1S59A 2E9TA 2QMWA 3L09A 1Z2LA 5T14A 1HBNB 3J80Y 1JLBB 4WP8A 1B0VA 2OTLS 1TKTA 2NZCA 3CSKA 4OX6A 1XMBA 2FHJD 4C8YA 4DR4F 3ZZPA 2RDJA 2AYBA 3T9ZA 1UP1A 1C4AA 4TU8A 1V5VA 1HHTP 1FRIA 2Z58B 4M5JA 4ZVQB 3VVTA 5I42B 2ZH9A 1XQIA 4FXDA 1T05A 2E5LJ 2H5EA 2AZ3A 1FFGB 3HSJA 2R7RA 2DIUA 4LF1A 4DPYA 2C3YA 1N36J 3DOKB 2UXCJ 4RUCA 3UNGC 2AEJA 3W2WB 1PKUA 1D1UA 2FJWA 3I55S 5K14B 3ET6A 3E3XA 3PYEA 4L72B 1CG2A 2P5VA 2DGQA 1RT1A 4M5MA 4LSLA 1NB7A 2JWNA 2IPOB 2BJ3A 4Z2XA 4BC7A 4GKJJ 1S9GB 3GIKA 2FIUA 3QRPA 5KFYA 2ZBCA 2R7XA 3BYRA 2D3OR 4FF2A 2IA0A 3G8QA 5LSRA 1UWBA 2OPSA 3SCIE 2FJDB 4OLOA 1KFDA 4C9DA 1MN7A 3TUPA 5I3UB 2PIIA 5KTQA 3M8WA 2KU7A 1YRTA 5I3PA 1NNDA 4LFCJ 1F60B 1DTQA 1DFDA 3E2EA 1V3ZA 5DDRC 2CWKA 3KHHA 1CULA 3W9JA 1ZOTA 2GMJA 3T1HF 3MPYA 3J7AN 7FD1A 2R7VA 4IDKB 4CO1A 1UKUA 1EAYC 2KXHA 3QGIA 1ZM2A 3IRXB 3LQVA 1UVNA 2E66A 3PTWA 3MHYA 3HZGA 1UCNA 2COLA 3VAIA 1IBMF 5JJBA 3G6YA 1VRTA 1SKUB 3UN3A 1Y9OA 1MMLA 2CG8A 1EX8A 1DLOB 2IVYA 4KH0B 4CNYA 4B3SJ 1NK4A 3PYDA 3EM1A 4OJHA 3OFGA 4PYAA 1HQUA 2X1FA 3TVZA 4ZVRB 5DZ6A 1HNVA 2KTQA 4C0OC 1U2RA 4LFAF 1BLUA 2HWHA 2ZE2A 3KWMA 4M5DA 4NI2B 3KLGA 1NSKL 4ZN3A 2IFXA 3MMJA 1KONA 2IY5B 2DGVA 3RB4A 1WF1A 3TEHB 2AD9A 3W60A 3MAHA 5DLFA 3ETMA 1GXUA 2DHAA 2OELA 3QPIA 3CDAA 3VZHA 4G1QA 2IJFA 1XNRJ 2JRSA 5KFLA 1H73A 5F9NA 1BQMB 2RU3A 3MM8A 1C1CB 4DV0F 2BV3A 2Q79A 4KBIA 4K4TA 1NDPA 4R8UB 3A3OB 4W92B 1KNZA 1BXNA 1NJWA 2JEJA 2J76E 3EJMA 3MEEA 3DMJA 4USIA 3BV8A 3TOQA 3QSYB 4HL9A 2OPPA 2BBEA 3V6KA 1IM6A 2PSZA 2UU9F 2DH8A 1J5EF 2MY7A 4P2MA 2OPQB 2ZBPA 1FRXA 3MEDA 5F8HA 3GV5B 2DY9A 1FRJA 3FMBA 3IBWA 1KKHA 3H98A 3KNAA 2B43A 2XHCA 4PXDA 4KPYA 5HI7A 4LSZB 3K89A 2XMUA 5ETSA 3UO0A 3ITHB 2J0QD 1S6QB 4U7UD 1P8GA 2DY1A 2HWTA 4C11A 1O5JA 2OH2A 3DLKA 5E0OA 4FYDA 1FRMA 2FZKB 4QWDA 3PHEA 2XZDB 1YJ9S 1U1QA 3EVMA 4DR2F 2F40A 4DL6A 1RZMA 5IOLA 4IUFA 2APOA 4RW7B 4CO2A 4HYKA 2XWYA 5BJRA 2XZWA 2F4FA 3MURP 1YBAA 4KGZB 3W3SA 4F67A 3NNCA 1YJTA 5HATA 1NHVA 4NCAA 2HQCA 4GC7A 4JI7J 2QT7A 1BGXT 2MJUA 3ILLA 4ZLPA 3FBCA 2B6AA 4LF7F 4HTJA 3CJSA 4XK8C 1K1SA 2AGQA 4O44B 5E3PA 2XGPA 4XDDA 4WTYA 1RT2A 3MR3A 2IC3A 3QT7A 4CLPA 1AB8A 4WCEQ 3KG1A 3J80U 3KLFB 5HVHA 5KT6A 1MSWD 1BWEA 4TU9A 1VOMA 4NOHA 3HVAA 2QA4S 4TQSA 3VF0B 3ZTPA 4X62J 3Q24A 1NH8A 1OS5A 4RUAA 4CWBA 5KFKA 2XYHB 4LQ3A 1NK9A 5LOQA 2KL8A 4MK8A 1L5UA 4CDIA 1UZDA 3K5PA 2R8HA 1VQ5S 3QRQA 2PMWA 4EO8A 1JJ2R 2YKOA 1FWPA 1RK8A 2HMIA 1Q8LA 4TXSA 3V4IA 2CAJA 2EC2A 2YKMA 3BKTA 2MQPA 1SKRA 1Y7PA 3P5BP 1TVRA 2JFDA 1YG0A 4NLSA 3H59A 4DR4J 2NREA 1GNKA 2YNFA 2Z30B 4OI2A 2DKOB 1UL3A 5KFOA 1V6HA 1U1OA 2K7KA 4R0JA 5KFXA 4OHYA 2EC0A 3WBZA 2OPRB 3LALA 4ED4A 4X4QA 1NM2A 1FJGF 5KFRA 2JX2A 4Y34A 2FVCA 3CCLS 1M5KC 1VIXA 2GC8A 1S9FA 5GADU 3OBIA 2GA7A 1VDHA 1Q7YT 4C48A 3S1TA 1WC1A 1HHSA 3DU6A 5CH7B 4H4KA 3FKBA 1QVGR 4A8KA 1KRPA 3VAHA 1QTMA 1ZZNA 3R6LB 5KFNA 2DH9A 4RNOA 2XYGB 3LGHA 2ASDA 3AQPA 2AGOA 3JSRA 1CJVB 4MK7A 3OV7A 2DJWA 3KDNA 3K8WA 4ETZA 1JLCB 2HHQA 3TAPA 3G2XA 1RT4B 2XM3A 5C2GA 2O1PA 3TA2A 2B9YA 1X0PA 5K8MA 2MQLA 3KDOA 1JB0C 1ROFA 2RILA 2W4CA 1MWZA 1YI2S 1HYSA 3ZTQA 2LQJA 4M5IA 3LW5C 3V4MA 1PC4A 1RTHB 5AXLA 3A8EA 1SI9A 1N33F 3NP5A 3W1YC 2VG7A 4EBDA 2F8EX 1UW4A 4YB5A 2XI2A 3ONQA 4FKYA 3T1HJ 3NNAA 5A6PA 3FMWA 3SQOP 3KLEA 2RSQA 1N6QB 4Q45A 3BH7B 1S9EA 1RSCA 4TYAA 4ZK7M 5IV3A 3M8ZA 3RAXA 3I4PA 5KFVA 2HK2A 4FNIA 1T9WA 5K9FA 2G0IA 3MUMP 4ED7A 3EPGA 4DFMA 2UVWA 2DTJA 1DURA 2R7SA 2CPYA 1F1BB 1AFIA 2UV8G 3CJKB 2AJ4A 1RT5B 1EQMA 4HACB 4I6WA 3PX4A 4E0DA 2J7UA 1R27B 1Z1ZA 2MZJA 3K7RA 1JWWA 2HLTA 1UMJA 1FTCA 2JLEA 5HBMA 3EXYA 3MM9A 3EZUA 3EMTA 4LFAJ 3RRGA 4KPCA 3PZPA 3T5HA 5LSLA 3RAQA 4O4GA 1RHMB 2QX0A 5B0AA 2HYIB 2DNRA 3GFYA 3IGNA 5KFHA 2QN6B 1NH7A 2CFXA 4NASA 3VALA 3NNHA 1ZM3A 4A8XA 3A8JA 3DLGA 4G3IA 3HT3A 1RYRA 4JP8A 3ZZTA 4RZRA 1UTAA 4LF5F 1YWXA 3D2WA 5HMYA 1XC9A 4DV0J 4A47A 1RWXB 3NBPB 4LIRA 2UV8A 1QAJA 5AE2A 1X8DA 2VG5B 4JBCA 3KK3B 1SV5A 2OFGX 1Y3KA 4LR9A 3ILJA 1RT7A 2RHSB 2HBQB 1SJ4P 4F4AA 2AWZA 3EXCX 3RB3A 3D0IE 2FDNA 1XK8A 2RNEA 4RNMA 4EBEA 2RRBA 2UU9J 1J5EJ 4ZVHA 1DQ9A 3HHLA 2M88A 2DGOA 4UUWA 3DRYA 1FKOA 4OV6A 2DR7A 1PYSB 1XMQF 1NZAA 4X66F 5F0WA 4CQ1A 3UN5A 1Y5IB 1H72C 1S99A 2OO4A 3V6DB 4X4OA 2YH0A 4U8YA 1TMJA 3MMAA 2AHOB 3T19A 1E6YB 4F26A 4ZITA 5D0RA 1UA0A 2VFTA 3J7YI 2BX6A 5HVFA 4C2MA 1VRQC 1HNIA 3DM2B 1NPRA 1IR0A 4D3HA 2VOOA 3GILA 1JLFB 1HQEA 4A48A 2B9WA 1EKSA 4X4SA 4DR2J 1FDNA 4RUHA 2CQ1A 3LTOA 4R0EA 3L7OA 4MIAA 3W61A 4UQGA 2NLWA 4AL6A 4NA2A 3BH6B 3M2VB 3M6WA 4KY3A 4DPOA 3FBBA 2VQEF 4A8QA 2Y1LB 3G6VA 4ZVSB 1R0AA 3SCLE 4GO7X 2H3EB 3W5ZA 3GYGA 2MHNA 4LF7J 6AT1B 3Q8UA 2HPUA 3ZZRA 3EYZA 1WNEA 1FRHA 4QIWD 5KFWA 2V68A 4B9SA 4OI1A 3KK2A 4IH7A 1Q8BA 4RW9A 3UD3P 1N0VC 4Y2IA 2NSBA 4NLGA 3OSNA 4DUTA 1WC4A 2WOMB 4FBUA 4FPIA 4UUXA 3GSDA 2D69A 2M8DB 2CPZA 3Q83A 2QYCA 4PQUA 1SB6A 4RW4B 3UDVA 5KFJA 2DNMA 3JSMB 1NEEA 2MSSA 2UUBF 3MPVA 4F0HA 1QSSA 2YKNA 1H7XA 1R7IA 1UPPA 4DPTA 1S1VA 2HBZB 4M1KA 2QV6A 2HZAA 2ZZTA 3TWZA 2C28A 5ETVA 4P7VA 4DSJA 4F2RA 3CC2S 2IDEA 1IKXA 3TW0A 4A4JA 2H54B 4FDFA 1FRKA 3D67A 3T5JA 4J91A 3G87A 3PHTA 1HI0P 2J0XA 3HHLD 1TL3A 5D77A 1R0BG 1WC5A 2YQ1A 1FJGJ 1S1UA 1VR6A 1MROB 4K5SA 3C66A 3MM7A 4CO5A 4FP9A 2ZD1A 3DDNA 1HW9A 4FKXA 5IT4A 2OD6A 4ENOA 2DHGA 3LP2B 5DJBA 3K2YA 4BHQA 3TZYA 3W8GA 1S49A 4UZCA 3FEYB 2BW7A 2J9DE 3GE9A 3LP0A 4EI2A 2W1BA 5ETKA 3D0HE 4WZMA 1HPZB 3NGKA 2HAIA 1RABB 2W9BB 1VI7A 2CQBA 2WONB 5F9LA 4DPXA 1F5BA 1OY6A 4TY8A 4HT7A 3PR4A 3MMBA 4KJIA 4KGKA 1PJ5A 5EGYA 1JJ4A 1CS4A 1TU0B 5J2PA 5DG9A 2VJUA 2CNNB 1Q5YA 1Q4RA 3A3PB 1N33J 1RHKB 2G2OA 1YK9A 1K0TA 4Q2MA 2POKA 3IC1A 2MKJA 3B54A 5G0RB 4OV1A 2ZH6A 4LJMA 1TKXB 2QSWA 2GHPA 3HP6A 1Z2ZA 6FD1A 1PYOB 3HVTA 4NRTA 2YBVA 2HW3A 3GG1A 5DLGA 3K5MA 3VGUA 2E5IA 4NPOA 2NYIA 2YNIB 1IJEB 1TAQA 1EJ7L 1DBDA 3KJFB 4HI2A 1HBUB 4ZP7A 3J81Y 2HURA 3DFEA 1H3DA 1X7VA 4DPWA 2MY8A 2F4VF 4AT1B 1FEEA 4I2PB 3F56A 2K7JA 2V4RA 4LMZA 4X4VA 3W65A 3I82A 4ILLA 1AZSA 2DNPA 2EKYA 3TJAA 1VRUA 4C6AA 2B8PA 1NJZA 1HHQA 2BM1A 4DFJA 5HSPA 4KGXB 3F44A 4DI6A 3KJVA 5ETRA 1VLOA 5KFFA 3EWGA 1IR1A 3PX0A 2W2NP 1YJ7A 5HQLA 1RTDA 4FF1A 3FBEA 2R7QA 4Y28C 4LF5J 2GJ2A 3EGVA 3JB9k 1LK5A 1FDAA 1LWCA 1FVSA 3KG4A 2HQ3A 3EZ5A 1VFJA 4YS2A 1O8BA 1RTJB 4M5LA 5F0UA 2BJDA 2MMYA 3H90A 1CPZA 2ZBIA 1VBXA 4K7QA 3QNWB 2ZZMA 3LH2S 1JLAB 3BGUA 4CTAA 2ATCB 4ZLLA 4X64F 3SMZA 4MJKA 3DU5A 2LDYA 1PCAA 1XMQJ 1LW2A 4X66J 4ES1A 2ZHBA 3OTOF 2AYMA 3D3CJ 1H0HB 2MHEA 3BYPA 2LMIA 5SUHA 1RT3B 3M1VA 2ZHAA 4UTGA 2AV5A 1NLKL 2QLXA 1FKPA 3C6TB 3BQ0A 1REVA 2GMHA 2E9RX 5KFQA 4JI6F 1WI8A 3N4WA 1S1WA 1SVDA 5CXTA 3I0RB 2Z0GA 1U47A 4QPXA 2O5DA 2ZNYA 1ZAXA 4EZ9A 1L3SA 3CCSS 3BF4A 4QR0A 4KQZA 4M8LA 5A8WB 1F6TA 5J1NA 2R8GA 4U7UK 4K4WA 1VQ6S 3VR1A 5E5NA 2HNYB 4K5RA 1TTHB 4I2QA 3KLVA 3H42A 4NLRA 2M9KA 4DXLA 2VQEJ 5HO4A 3MMCB 5D3GB 1XR6A 3Q8VA 2VASA 3UR3C 4IO1A 2WTFA 3V6HA 2PI4A 4QIEA 4LSNA 5JUMA 3NWRA 4FS2A 2XY7A 3W7BA 1U1NA 2JVRA 2KH9A 2DR5A 4CLTA 3FEXB 1S0OA 4P10A 2BE7D 1T95A 3H2UB 2XZTB 2P6SA 3QATA 2I1RA 1FKAF 2CNKB 5D15A 3G4SS 2HNZA 4N8OA 4PRFA 4I6YA 3PG9A 3E01A 3PJ9A 3TUZC 5AT1B 1H2TZ 4Q44A 1S79A 2E1AA 3VGVA 2V50A 3JSBA 5M2RA 1T05B 5LMNF 3P49B 5E41A 3MD1A 4KH1B 4OLPA 4FS1A 2UUBJ 3JAMY 1PJ7A 2OUGA 3AOCA 1F9EB 2FZCB 2ZITA 1CJUB 4JI3F 1QJHA 3IR5B 2QTWA 4QWBA 2VUGA 1VQNS 4LSLB 2I5JA 4I1TA 3PRBA 2VBXA 1KFSA 1H7WA 5ETLA 2H1YA 1JNZB 4ICLA 4QBUA 2DGUA 2XHWA 2CJXB 2MKIA 2R8IA 2C2RA 4NLPA 5IFMA 3ZZ0A 1R31A 3VHQA 3CCJS 1FNOA 1UWBB 2B51A 4NYZA 3DC2A 4ZVOB 3T6BA 2XMMA 2H5JB 5J2QA 1U6BA 4HLBA 3DYAB 3H2VE 4LRBA 4F4XA 4NEYA 3TRGA 3P45B 4CH1A 2Q3PA 1DTQB 3VGSA 2CNOB 2HFOA 2MXYA 2Z2LA 1JKHA 3HFKA 1GH8A 2CQ4A 1G4CA 1RWUA 3AD9C 5CQGA 3MM5A 5DO2A 4DUZF 4OYZA 4ZVPB 1W25A 4C8KA 2RUGA 3T9NA 3ZZUA 1EIYB 1K1QA 4LF9F 3HCXA 1HR0F 3NCQA 2JNJA 1HL6A 1DTTA 4PKDB 3KYLA 4KIAA 4B08A 3BPDA 2K8GA 3GLJA 4AUKA 2WVCA 4QYRA 4UW2A 2WW4A 2G2YA 4DX5A 1DQAA 3BSAA 4NLXA 5AE1A 4PWUA 1HNWF 4WF9Q 1JXEA 1HQUB 2ZHOA 1VQYA 4BBYA 3OLAA 1RTZA 1HNVB 3HHDA 3GIMA 4J9NA 2BABA 1WSRA 5ETOA 3BBCA 1ZPVA 3BR8A 3G71S 4RX6A 2CZ9A 5HMZA 2L41A 4UOHA 5IM0B 4NLWA 5JXSA 1U4BA 2EPIA 3CMES 3ZNJ1 3PX6A 2DB1A 1FNMA 3UCGA 4WE1A 2YWFA 2QGFB 3E51A 4KO0B 4OYOA 4F3QA 4G1QB 2ZVSA 3PO5A 4LF2A 3Q8YA 2CDRB 1HLWA 1QTNB 3DRRA 3NAHA 4NA3A 2F4VJ 3EGWB 5LM7E 2B5JB 4RU9A 2KFZA 2XMWA 5EX0A 3OR2B 1RADB 4QQBA 3DMJB 3W9HA 1MU2B 2Z4PA 3EUNA 1E6VA 1JJHA 1T03A 3TZZA 4HHUA 5D4LA 3SQGB 4ZPAA 1J27A 2BKOA 4PG4A 3P96A 5KG2A 2J6SA 2V4JA 2LXFA 5J2MB 1LWEA 1YBUA 3R7BB 1SJQA 1LFWA 1G1XA 3S6EA 2WCXA 2DYAA 4B17A 1KOOA 4QJVA 1QSYA 4C8ZA 2E9ZA 3EGNA 3DDIA 3H20A 1NUEA 4CT9A 3OR1A 1R89A 2VA2A 2YKAA 4I69A 5AE3A 4QU6A 4ID5B 3C15B 4DX7A 4H4KC 1HQ2A 4C11B 2JJ4D 2J8SA 4LBHA 5ETMA 4ECRA 4X64J 3DLJA 3DRPB 2NUHA 3IP0A 2H4WB 3IA0A 3NLCA 1WTFA 1O0PA 3DLEB 5F8JA 3LAMA 3O6QA 2MZ1A 1RXOB 1ZM4A 2QLFB 1UFLA 2CJYB 3QJJA 2VFVA 3R5JB 3OTOJ 2HHWA 3FSYA 1UJ6A 3G8SA 4AXIA 1HMVB 4ZJLA 1U0SA 4OZNA 1WF0A 5KG6A 2F7VA 2BM0A 4C8OA 2DR9A 3NGTA 5I3QA 3P4UB 2E1CA 2PD1A 1Y11A 4WYWA 4JI6J 1RBAA 2Q1LA 3G82A 2UUAF 5F8NA 1Y00A 5EHHA 2YX4A 3R5CA 2MZRA 2MQ8A 3SBMA 2J9EA 3MCSA 3CO9A 3CDEA 3GMGA 3D7SB 1AUDA 2R8JA 3OTCA 4DX8H 3HKWA 1C2PA 4MAKA 4EO6A 1PAEX 4IG0B 2H65B 1S1XA 1LWFB 3P3DA 2HS4A 2MGZB 4QZVB 2ZDOA 4ZIWA 2ZH7A 2CPIA 4Y2AA 2YY3A 3PIPQ 1KLMA 3AJ2A 3K59A 2B7CB 4HT5A 4RWXA 3KJNB 3R5AA 2V5HG 3LGNA 2CPJA 4DV6F 4KR0B 1U09A 4QWCA 2XS7A 3VAFA 1C0UB 1WC6A 4CRJA 1F9FA 2CRLA 4N41A 4B3TF 4OZ0A 1EB0A 4Y65A 4RW6A 3HULA 4ELTA 2HMIB 4WFNQ 2XSJB 3V4IB 2YKMB 1FF2A 2UXDF 1TVRB 6FDRA 4DU8A 2KM8C 4C8LA 2D3UA 1RYSA 1YRXA 3ENWA 4PCQA 1S12A 4YR2A 3MPWA 3KK1A 2FC8A 1DJ0A 5LMNJ 5B7WA 2IMWP 1RAOA 1BC6A 4Y2MA 3BKUA 3NMRA 4PG5A 4P52A 1Q7LB 2CKWA 1HKAA 2AYEA 1WHYA 4NLYA 2RDDA 4JI3J 5GAEI 4FNHA 1BWVA 3KNGA 5KFMA 4OYBA 4ER8A 4F0KA 2KZZA 2ROGA 4C98A 1MMNA 1RWPB 2B9XA 2JOQA 4MKYA 2DRDA 2A1BA 4MH8A 3BSOA 2P8IA 1WELA 2EBGA 2HFZA 1NK5A 4ANDA 1HWJA 2EK6A 2V6AA 1N5YB 1KTVA 2J0WA 2UXBF 1RT6B 2DRBA 3HHLC 1FD8A 2IMOA 3TR5A 1KOHA 1XJWB 1RAAB 2CIMA 2M0GB 2HQFA 2ZH3A 4CM0A 3GIJA 1DZ5A 2FVQA 1RACB 3BS9A 2ROEA 1SJRA 1X4GA 4KGVB 1U1MA 4RPFA 3WX8A 4DX6A 1HBOA 4DMZA 1TUWA 4DUZJ 2CJAA 2AJ0A 1P1TA 5B08A 4ZLNA 1S9EB 3MPDA 2MQOA 1RAEB 1N32F 4LF9J 4EU0A 5KG0A 1HR0J 3PKMA 2UUCF 3MGJA 1NZ8A 3AXMA 1T8EA 3RB0A 1YJUA 4KFBA 2YWKA 2UP1A 3NRBA 1KHWA 1X5PA 2HHSA 4WJBA 2MKKA 4K4VA 1TL1B 2HIYA 1HNWJ 1S4EA 2KN4A 3D66A 5HAOA 3OXLA 4NCBA 2JVOA 2RH3A 3QO9B 4DF8A 5HBMB 4BCAA 2Z8QA 1R8AA 2GMLA 1KN6A 3R9LA 4H4MA 2KM8B 1JLEB 2QFJA 2OJ3A 3C2PA 4KE5A 4O4GB 3RGIA 1FJCA 3MD3A 5C25A 2DGTA 3A12A 3DRSB 2XLJA 3CCWA 3FGVA 2GGPA 4TLQA 5HLFB 4DV2F 3LP1A 3HO1A 5IC6B 3VAGA 2BOPA 2IM1A 3EDQB 3D6HB 1RLDA 3POTB 2KT2A 1EETA 2V34A 4MTPA 4KV8A 1HNZF 2JEFA 1L3TA 3PM9A 3M9MB 2GIQA 1WJ9A 5BYQA 5GAHI 2BANA 2OIHA 1MWQA 2KO1A 4DL3A 5CZVA 1EKRA 1RT7B 2MYFA 1MG7A 3AODA 4J9MA 2V9WA 1YBTA 4J9LA 3CD0A 3ISND 2GJFA 1YTYA 1TAUA 3ADAC 3A3NB 1LOUA 4N5SA 2WSFC 4Y3CA 4IOAQ 1FT8A 3HT0A 2W8KA 3F41A 2GVZB 2KXFA 3BGRA 2P9EA 5HROB 4EK2A 4KKOB 3JSYA 2CPEA 2BE2B 4P2XA 3B4DA 1TELA 2PI5A 2ZEJA 1LW0B 2M2BA 3MMAB 3HSZA 1X4CA 3R1LA 3H0PA 1S0VA 2RB7A 4J9VA 2NXUA 3TZXA 1SUQA 2MLYA 3MEGA 2XYPB 3BBBA 2XTJP 1H2VZ 3QFWA 4YR0A 2AX1A 1BE4A 5F8IA 4O3RA 4FYVB 1IVZA 2N82B 1TV6A 4USWA 4GRSA 2ZH2A 1HQEB 4CYUA 2GIRA 1FJEB 5IQ6A 3D1HA 4DSEA 4TN2A 4WXOA 1KDNA 1NXIA 4ID8A 3CCRS 2V63A 4MT1A 3MAAA 4Y00A 2DISA 2O3DA 4GO5X 1GMWA 4WIIA 1FJ7A 3OUYB 2RRAA 3DXBA 3DGVA 1SH0A 3BO4A 4UQTA 3G6ES 2R7OA 4IG3A 4OMFG 4HH0A 3VVUA 1R0AB 4ETXA 1MLAA 2CQPA 5IT9U 1AXQA 2RMLA 2EWHA 4DF4A 3GB0A 4EEYA 2ZH4A 1GMUA 5ETPA 3W66A 2HHPA 2RUSA 3UWTA 3DI6A 1RTIA 5B0FA 2UUAJ 1ZPWX 1T7PA 3N01A 2CQHA 2PDAA 3KK2B 3OLBA 3KUGA 4B02A 2Z2YB 1FFSB 3I87A 2RF2A 3KLHA 2W9AA 2ZC4A 5AXKA 5KFZA 1GTHA 4QIGA 2L3MA 2MZQA 2VODA 4EBCA 5EWEA 3CCVS 3NMAA 2FTRA 1G3OA 4OYMA 3ENQA 1JLBA 3Q2SC 4A8YA 3IFEA 4RBUA 3A13A 1JMTA 1ZZFA 4DV6J 4YB1P 3QIDA 1W26A 1GXLA 2YKNB 4EWTA 3OL8A 2D9PA 3GCXP 3PEHA 4B3TJ 2DK2A 1EHWA 4USKA 4ZCIA 5AXMA 3QIPB 2ILZA 4ZHRA 1QSLA 1R0CB 2UXDJ 5B0GA 2E7XA 4RW8A 1Q1KA 2YX7A 2ZJRQ 1TFYA 4DQSA 1IKXB 2DGWA 4V1Ak 2LLZA 3DOKA 4F0MA 3KJQB 2VOPA 3W2WA 1LFPA 4TLRA 1S1UB 2VD3A 1SC6A 3HK2A 5DQGA 2ZD1B 2EXUA 4P9SA 1IXKA 4DLEA 4BDPA 1S9GA 4Q8EA 4N56A 4Z7CA 4ECUA 4IYQA 4J9UE 1XNRF 2A10A 1KP6A 2XMKA 3PV8A 3LP0B 4ZJQA 2AEMA 2J9CA 1PGZA 3NAIA 4PABA 1F2GA 3CCUS 2ZKUA 3CB4A 4ZP6A 5B0EA 2I38A 4CM2A 4Z7YA 2UXBJ 3MFIA 2PN6A 3O2IA 3PJWA 2K2PA 4C7QA 4TY8B 5KFPA 3MMBB 4LF6F 1GTEA 2FHJA 3T1YF 2RS8A 4W90B 1GMWD 1SC3B 4NZ0A 4ZMMA 2NXCA 3D1QA 2AZ1A 1K0VA 2ZVIA 3IRXA 3QGPA 1MWYA 3CJ2A 1HWLA 1HFEL 1KC8T 2MQMA 3BREA 2QL9B 3PW7A 2ZH8A 4USHA 4WFXA 1RAFB 2GHWA 3C16A 4FYWB 4PEOA 3DLBA 2A18A 3OL6A 2RQ4A 2DHXA 2CQGA 1EP4B 1KWMA 2EFNA 3JTNA 4J9PA 1YQHA 3HFVA 1N32J 4YEAA 1TKZA 3HVTB 2UUCJ 4HDHA 2DCUB 5KFAA 4AFFA 2VBZA 3Q23A 2C2DA 1S5ZA 3PFOA 1TL7B 1YRUA 3N5FA 1CJKB 3OXFA 4HTIA 2YVSA 3H5YA 1YITS 4M5KA 3LANA 1FCAA 1N34F 1S6PA 3R1HA 1X31C 1YVFA 2GJIA 2W9CA 4G1PA 2NXJA 1ITPA 1RHQB 4F04B 5KG1A 2R7WA 1FRLA 4M5GA 1AZSB 1SXLA 3FNNA 1IUJA 1FFWB 1SH2A 3I4HX 4HEA9 4OYIA 3D54A 4RUBA 4U95A 1QY7A 2B3TB 2VICA 1I5OB 4MKAA 3NGDA 1VQSA 4CLKA 3BO2A 3I56S 1X4DA 4DV2J 2GFFA 3M30B 2ALYB 4J9RA 3SV3A 2AJ2A 3DXSX 1UVJA 1X4HA 4K2XA 4QYZK 4OI4A 1HNZJ 2A0FB 3HDSA 4CZCA 2DHHA 5L39A 3K17A 3A1YG 2Y0BB 3BKFA 4AXJA 3SDEB 1U24A 2M3DA 4FYXB 5KOWA 2OPQA 4Q5VA 4JB8B 3GIIA 1VJQA 3NKYA 4KB7A 3PKYA 3PFEA 4JV5F 2HGMA 1LXNA 4DOZA 4NLTA 3CPWR 3DOLA 4ZKAA 4YR3A 2BJ9A 1ELOA 1WOPA 3ZTSA 4L3NA 1UA1A 4UY85 2FVRA 3Q22A 3CCZA 1LW2B 3ITHA 3AOBA 1T11A 3CD7A 3M32A 4B3OA 1HBMA 4H4OB 2KFYA 1UW9A 3FZ2A 4FXVA 4DZ6A 1S6QA 4RLEA 4MFBB 5CA5A 2ZOGA 1FESA 4Q0BA 2YQ0A 1FKPB 2B56A 3OTEA 3H25A 1M5PC 4ZA1A 4RNNA 3D6MB 2XNRA 2RKIB 2CJKA 2MTLA 4F36A 4RW7A 1RHUB 2HS0A 1NSPA 4HKQA 2ILYA 2B4PA 2HHVA 2XC9A 3M2UA 2OTJS 4C8NA 3BGLA 1T9VA 4I2QB 3WDOA 5KOXA 2BE9B 2C3UA 1PC5A 2GIFA 3ZXWA 3DGPA 5KT5A 1JK9B 2GV1A 4UOCA 3GQCA 5HL7Q 2J6TA 3ILIA 3I31A 5D0HA 2AP6A 3U1LA 3GR1A 1M5VC 3WIVA 3SIPB 3CJQA 5U47A 1AUSL 5DG7A 2NYHA 3KLFA 2BQRA 3UPFA 1N4LA 2VA3A 2GS8A 4TVAB 1G6BA 3PJXA 4WKRA 2G1DA 5HMWA 3E01B 4HVZA 3C3LA 4QWAA 2KRBA 3IN5A 3UFCX 2R4FA 3FRZA 3BSNA 2DRAA 3TYTA 4AD6A 3MECA 2ZUAA 2H4YB 4P74A 1B99A 1VIOA 4M5NA 1CC8A 1M5HA 5DS7A 1FXDA 3GG0A 2ERRA 3OPKA 1FX2A 1VGYA 3J7ZT 1F5CA 3R5DA 4QYZJ 4E2FB 1BQXA 4PPDA 3CJ8A 1J5OA 1O51A 3P6YC 3CDWA 3AFGA 3PW5A 3TANA 2O66A 2BA9A 2J8AA 4ZIVA 3QGHA 2OPRA 2VF3A 4O0IA 2M7SA 1FK9B 4ED2A 1W7WA 3PY8A 3H5SA 4NLDA 4NYOA 3PR5B 2FY1A 3W9IA 5GADI 2DNKA 4NLQA 1S10A 3IS9A 2GQCA 2EFGA 1WG1A 2DXDA 4KHMA 5FD1A 4RNFA 4R5PB 5DM6Q 1KQFB 1FHTA 3HF5A 2FHOB 5K5MA 4ERDA 1CJVA 3EICA 2RQMA 4Y6IA 1JQGA
chains in the Genus database with same CATH topology
3DGPB 2JNJA 3DOMB 1YDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGP B;  2JNJ A;  3DOM B;  1YDL A; 
#chains in the Genus database with same CATH topology
 2V8D A;  2KG1 A;  2E5H A;  3GON A;  3N28 A;  3CDU A;  1JLC A;  2A2D A;  3GFH A;  1RT4 A;  2E7V A;  4J9Q A;  3BSC A;  3HX9 A;  2BOA A;  2DEJ A;  3PW4 A;  1P9Y A;  4C3L A;  1HWI A;  3BJY A;  4B9T A;  1RTH A;  5ITH A;  1A9N B;  3HHK A;  1ZH5 A;  3TVY A;  2JLG A;  2D41 A;  4LF6 J;  5A2Q Y;  3T1Y J;  2DXF A;  4IFY A;  3FVY A;  5CYQ B;  1VQ4 S;  2LQB A;  1VCT A;  1XN9 A;  2MZS A;  3B6B A;  2E1P A;  5DDO C;  5CYM B;  2A6O A;  1Z4U A;  4V19 X;  1XER A;  2XY5 A;  4CO4 A;  1UVK A;  2W8L A;  3WC2 A;  3KMQ A;  3ZZY A;  5C2C A;  1RAI B;  1WC0 A;  2W25 A;  3OVA A;  2K1R A;  5LSO A;  2GW8 A;  4A8M P;  1U1K A;  3H5X A;  3PYF A;  3ETO A;  1S97 A;  1QE1 B;  2BUN A;  3CJK A;  1UVM A;  3GTY X;  1RT5 A;  4PWD B;  3TA0 A;  2KZM A;  2HBR B;  4WE1 B;  3AOA A;  4ZPW R;  2HK3 A;  2X7I A;  1CQM A;  4AL5 A;  1N56 A;  1I51 B;  2Q6B A;  5ETN A;  1C1B B;  4OL8 A;  2XNQ A;  4JI1 F;  2UVU A;  5C24 B;  4WFA Q;  1N34 J;  1BD6 A;  5C42 A;  3N6L A;  3NS7 B;  4YQW A;  5H9E K;  1XIQ A;  4AL7 A;  2LKZ A;  2WK4 A;  2LYV A;  3AB2 B;  1YJW S;  1S72 S;  2LA6 A;  2B4O A;  2DNN A;  2YNG B;  5FLX Y;  2QLW A;  1TK8 A;  1E6V B;  1X4B A;  1T03 B;  1L3K A;  3I5B A;  2KT5 A;  4NMX A;  2FYX A;  5C5J A;  4LVO P;  5A8R B;  3M9N B;  2WZ1 A;  3EZO A;  4ZVE A;  5L38 A;  2QA4 G;  5THW A;  4EMD A;  4X4R A;  1RE1 B;  2V4J B;  1NK8 A;  1NAQ A;  1GK8 A;  4NRU A;  5K20 B;  2CUY A;  1H74 A;  2VG5 A;  4IQX A;  3KK3 A;  1WI6 A;  4WTO B;  1IQT A;  3NS6 A;  2XS5 A;  3G8T A;  2CQ0 A;  1OPZ A;  2OKQ A;  5KFT A;  1M90 T;  4NA1 A;  2RT3 A;  4WWS A;  3RRK A;  1VC5 A;  2UUW A;  1KD1 T;  1F0X A;  3LWM A;  2OML A;  4QW9 A;  3LA0 A;  2FGO A;  1UFW A;  1SQG A;  3BR9 A;  4PYD A;  2VFS A;  3CTR A;  4DUY F;  4PWW A;  1RWO B;  4DG1 A;  4DS5 A;  4JV5 J;  1IWA A;  3C8Y A;  1IJF B;  2XMT A;  3R27 A;  4OZ1 A;  3BGO P;  2ZOM A;  1NDK A;  4YFU A;  4JI2 F;  5D0E A;  3I96 A;  4Y0F A;  3FK4 A;  1E6Y A;  2VG6 B;  3BM7 A;  1N5V A;  2CPH A;  1OY9 A;  2XBP A;  2L08 A;  1R6Y A;  1KEK A;  3SSR A;  2YWG A;  1NU4 A;  1EQ0 A;  1X4A A;  2XG8 A;  2VKR A;  4C97 A;  4ITS A;  2LQ9 A;  2ASL A;  2HVI A;  3NY0 A;  4OZL A;  3HPO A;  3DDK A;  1RA6 A;  1ZS6 A;  2QA1 A;  3G9C A;  3QMQ A;  1URN A;  1JNR B;  3I9Z A;  3EVW A;  3M2V A;  4O3O A;  3MCM A;  1SL1 A;  3PW2 A;  2VIH A;  2MKS A;  3D0G E;  4I64 A;  4M5H A;  2MKY A;  2KG0 A;  5F41 A;  3MUV P;  5CD4 A;  3MCN A;  2CDQ A;  4BWJ A;  4ZJO A;  4ED8 A;  3HHN B;  1NKE A;  2LFV A;  1OYD A;  4A8O A;  4GMK A;  1HW8 A;  1JLG B;  2IM2 A;  5L1L A;  3TQE A;  5F3Z A;  3CCE S;  1M1H A;  1S48 A;  1A7G E;  5H9E J;  3DNC A;  1DRZ A;  3O8W A;  5BYR A;  3C14 B;  3ZZO A;  4KHP F;  2W2Q P;  1RB0 A;  2BEF A;  5A0Y B;  2L9N A;  4WP3 A;  1PBU A;  2XY6 A;  3JSM A;  3W2V B;  3GJT B;  1H6K X;  4LFB F;  3KK1 B;  5CCL A;  3OSP A;  4IRD A;  5L1J A;  2YKQ A;  4MYT A;  1VC0 A;  3D1O A;  4W98 A;  1RAJ A;  1G2E A;  1XTZ A;  3I5A A;  4LRF A;  5GAE U;  3R6G B;  1TZ0 A;  4AQY F;  1PJ6 A;  2I2Y A;  3RBD A;  1TR0 A;  1KVI A;  3F0N A;  2FC9 A;  3TQ1 A;  3TX8 A;  1F5A A;  2G4B A;  1MRO A;  1KHV A;  5J2N B;  3MOJ B;  1K44 A;  1UEU A;  3VV2 B;  4CT8 A;  1FDD A;  2CQD A;  3BQ1 A;  1TK0 A;  1RIS A;  1FVQ A;  3DN9 A;  3IM8 A;  2LXI A;  1WOR A;  2JC0 A;  2RE1 A;  1SIW B;  4JI8 F;  3LF0 A;  4A8S A;  4IH5 A;  1SKS A;  2PEH A;  1TUV A;  2V2V A;  4HHH A;  3VWS A;  5A2Q U;  2R42 A;  1HBO B;  2WON A;  4OYP A;  2FQQ B;  3BDE A;  2DPJ A;  4G1I A;  3AY0 A;  2HND B;  1TL5 A;  1MMD A;  2XLI A;  4USM A;  5HQM A;  3UVJ B;  1N88 A;  3OW2 R;  3X3U A;  1U1R A;  4DV3 F;  4U67 Q;  2MLX A;  4CIO A;  3IXQ A;  1BY9 A;  1Q5V A;  3DOM A;  5L1K A;  4TYB A;  2YPZ A;  1FDB A;  1ZYQ A;  1M5S A;  1UJ5 A;  3H2L A;  1S1T A;  3B78 A;  3LOU A;  5G0R A;  5IS2 A;  4DL0 C;  1TKX A;  1F3V A;  4N76 A;  1R8P A;  3MTK A;  4KSE B;  1WG5 A;  4ECQ A;  1IKV B;  4Y2C A;  3MUT P;  2OD4 A;  4WK3 A;  1BUX A;  4ILM A;  1IKY B;  5G4D A;  2VB6 A;  3F73 A;  4ZPT R;  3QGG A;  4ECY A;  1WKJ A;  5FII A;  4NLU A;  4OI6 A;  4ES3 A;  1V3R A;  1UJ4 A;  3FUY A;  4BC9 A;  1S77 D;  5C25 B;  1GXT A;  1WUU A;  5FLX U;  5B0C A;  2BDP A;  4I2P A;  3T5L A;  3LP1 B;  4XPC A;  2AQ4 A;  1RUS A;  1EET B;  2KB2 A;  4JI1 J;  1T9T A;  5K8P A;  4NEZ A;  2B7B B;  5C7P A;  2N7C A;  2OGU A;  3IWL A;  3M8P A;  3MDF A;  1HD0 A;  3GYX B;  3H4D A;  1XEZ A;  4DR3 F;  5K8O A;  5RUB A;  4FPR A;  3GPA A;  4O3P A;  1APS A;  2QL5 B;  4DBQ A;  1U02 A;  3SSS A;  2VPY B;  1CEZ A;  3HKZ D;  3I0S B;  4EUV A;  2XCP A;  2DPI A;  1FEH A;  4DV7 F;  2GZO A;  5IXU A;  1K8A T;  2LP4 A;  2JLF A;  1RDR A;  3PDN A;  1NBE B;  2CVE A;  4CLW A;  5L9N A;  1VHF A;  1RU2 A;  4E8U A;  5GME A;  4RO0 A;  4N8N A;  4OYA A;  2X1A A;  3QAE A;  5KFU A;  3KUE A;  3S01 A;  3IM9 A;  3FSX A;  1N48 A;  3CGI A;  1UEK A;  4DUY J;  1TV6 B;  4DR7 F;  1FI4 A;  1OO0 B;  1HD1 A;  3CCQ S;  4L75 A;  4CYU B;  1Q8I A;  4ZVF A;  2KRR A;  1H38 A;  2GVD B;  2ASY A;  4DCO B;  2C2E A;  1SQE A;  5KT3 A;  2XS2 A;  4CLS A;  2V4Q A;  3M2R B;  2EFV A;  3BEG B;  4JI2 J;  2XWX A;  4FVC A;  1F2H A;  4ZPC A;  3T5K A;  4DL4 A;  3H7H B;  4IH6 A;  4IG3 B;  2J7W A;  1Q82 T;  4OZJ A;  1WWH A;  2ZJQ Q;  5B09 A;  1OYE A;  3DLH A;  2Q6C A;  3KTQ A;  2RRN A;  1B0T A;  2BJE A;  3U02 A;  4QR1 A;  5LMU F;  1HNX F;  2YX1 A;  3GCW P;  4FF3 A;  2G2Z A;  5LXY A;  2YKP A;  3R3T A;  5FJ4 A;  4WP9 A;  4IOC Q;  3HVW A;  3M8S A;  1KVK A;  1FWL A;  5E3Q A;  4WYL A;  2LA4 A;  4OQJ A;  2HNY A;  2Y3Y A;  2ZWO A;  1B4S A;  2XMA A;  3V5R A;  2P6T A;  4PZV A;  1VK3 A;  2AMC B;  4E98 A;  3GV7 B;  5L9X A;  1TUG B;  3KLH B;  3M8Q B;  5D3G A;  3THP A;  3RJM B;  3L9Z A;  1U26 A;  3K5N A;  2HFN A;  1S0M A;  2R2R A;  1JJC B;  3IRW P;  4FXW A;  3FQK A;  4QU7 A;  4WKY A;  2MB0 B;  1ZAV A;  2CQ2 A;  1T02 A;  1PBA A;  2AT1 B;  2W7O A;  3BZQ A;  1NJX A;  2PT0 A;  3KLI B;  4L76 A;  1T9U A;  4DDF A;  3RU0 A;  4UST A;  4ZDN A;  1H98 A;  2FHM A;  2PEB A;  4O4R A;  2HHT A;  3K5O A;  1JX4 A;  4P6Q A;  2GQ2 A;  4WIQ A;  1ARO P;  1HAR A;  5KFD A;  1FA0 A;  3C6U B;  2XO6 A;  5AJ3 F;  1SJF A;  2F3J A;  2X1G A;  3CCT A;  4C0H A;  1XR5 A;  2DGS A;  5IC4 B;  4ZHR B;  3A8K A;  3T3F A;  2WBM A;  1OPI A;  4K0K F;  4RW8 B;  4KHP J;  1S76 D;  3WC0 A;  2L9W A;  2KYX A;  5JVH Q;  4Q43 A;  3Q86 A;  2QZ8 A;  3LO3 A;  2Y1I A;  1V5I B;  3DKD A;  4ZN1 A;  4TNO A;  4DQI A;  3MXH P;  1DAX A;  3GJR B;  4LFB J;  3NGU A;  3K0J A;  3CCM S;  1CJU A;  7FDR A;  5JVG Q;  3R5B A;  4KC5 A;  1IBL F;  2YH1 A;  4ZCM A;  4DR5 F;  4MKB A;  5DQI A;  3IBC B;  3EVO A;  4AQY J;  1S0N A;  2Y1J A;  5J1E B;  4OYW A;  4RBV A;  4LUB A;  1HA1 A;  3Q8P B;  1VBK A;  1FD2 A;  4DSK A;  5A76 A;  1U48 A;  4USJ C;  3EDR B;  4JOU A;  1WDD A;  4QWE A;  5DQH A;  3PRV A;  2H48 B;  4PXB A;  1ZBT A;  4BWM A;  3DYA A;  1ACM B;  4GVB A;  1QUP A;  1VLY A;  1NCL A;  3CO0 P;  3RUB L;  4U8V A;  2HRT A;  3GJS B;  3JYT A;  4EFA C;  4CO0 A;  2VL1 A;  4LBI A;  1U0H B;  4XTT A;  4JI8 J;  3VQS A;  1OQ3 A;  3AA9 A;  1WTB A;  4YP3 A;  2HKE A;  2GO9 A;  1X5T A;  3M6U A;  5CAB A;  4C4W A;  2X1B A;  3C16 B;  5A8K B;  2YNH B;  3ICL A;  1N52 B;  2HFS A;  1HWU A;  4DV3 J;  2GCF A;  1TKZ B;  2GO8 A;  2FHK A;  1UAW A;  3JTP A;  1IM4 A;  4OHV A;  2IM0 A;  4UT4 A;  3PVX A;  4FVM A;  2UVR A;  1URR A;  2CPF A;  4XPE A;  4QPT A;  5D4P A;  1CC7 A;  1P1L A;  3GZ7 A;  3D9B A;  1I6J A;  1U8S A;  3LPE A;  1XWL A;  2IVF B;  3ISZ A;  4ZVT B;  1PSD A;  1S6P B;  3H4B A;  2W9C B;  5DDQ C;  4J5O A;  2J5A A;  3MZI A;  3JQJ A;  5IM0 A;  3GR0 A;  2IAJ A;  2NUU G;  3AH6 A;  4CLY A;  3V2U C;  3MR2 A;  4JI0 F;  2HBY B;  2ZBQ A;  1QAX A;  2AX0 A;  4KO0 A;  5CYJ A;  2IRU A;  3FEZ A;  4OX9 F;  3K5L A;  4LVN P;  2HHH F;  3UDC A;  4WFB Q;  5EUH A;  2F65 A;  4ED0 A;  2B5J A;  1NME B;  5EN1 A;  2E1M C;  3TNV A;  3OR2 A;  3HFZ B;  3RB6 A;  3M05 A;  4PQA A;  2ZC3 A;  1VQK S;  1FE4 A;  1CVJ A;  1MU2 A;  2DNH A;  4DQQ A;  1KVJ A;  1YZ6 A;  4CH0 S;  5ETQ A;  2AGP A;  4GVL A;  1CJT B;  2QG9 B;  2PA8 D;  4YME A;  1SPB P;  5B0D A;  1IKW B;  3SQG A;  2V94 A;  4DR3 J;  3LPY A;  2JL9 A;  2QC3 A;  2JEG A;  2D3Z A;  5J2M A;  1SC1 B;  1VQM S;  1QAI A;  1A6L A;  1OSC A;  4PUO B;  3WX4 A;  5K8N A;  2VH7 A;  1SIZ A;  2C3M A;  4IKA A;  3DOL B;  3FFI B;  1Y3J A;  2WRM A;  4TKT A;  3FSI A;  1ZA1 B;  1N8R T;  4DV7 J;  2E44 A;  4URQ U;  1LWX A;  1Q8K A;  2WVB A;  4B3O B;  3M32 B;  1YLX A;  1HBM B;  1TKT B;  4ID5 A;  3RTV A;  3OJS A;  2C3O A;  3C15 A;  2NQP A;  1F9H A;  2VON A;  2JHE A;  2DIT A;  4IO9 Q;  3PIO Q;  3GU0 A;  2VU5 A;  4X4T A;  1EZZ B;  4Q0B B;  4DZD A;  1REG X;  2AF6 A;  2IIH A;  2MZT A;  4I56 A;  1UVL A;  3DRP A;  3LUY A;  4OI0 A;  1UWA A;  4ED6 A;  5T7L A;  4DR7 J;  3DLE A;  4LT6 A;  4ED3 A;  4QCL A;  3IWX A;  4UZB A;  3MR5 A;  1X60 A;  2OEK A;  2BXJ A;  1NSQ A;  2D1C A;  3RR8 A;  3MR6 A;  4DWI A;  1HMV A;  2G9O A;  3M2U B;  3FCW A;  3ILO A;  5KFB A;  3ET6 B;  2M4M A;  3ZTR A;  1RT1 B;  1FWK A;  2QIF A;  1DQ8 A;  1P27 B;  1YJN S;  3HVR A;  3DGP B;  3CNQ P;  2EEY A;  4HI1 A;  2RS2 A;  3VCD A;  3OL7 A;  4ILR A;  3TAM A;  2VDH A;  5LMU J;  3L3C A;  1HNX J;  2KYZ A;  1DHM A;  3AD7 C;  3SI8 A;  2BR0 A;  4IG0 A;  2ZH5 A;  2FGC A;  2OPS B;  2WVF A;  1LWF A;  2HLU A;  1TQL A;  4ED1 A;  2MGZ A;  3QWP A;  3DRX A;  4A8F A;  4I4B A;  2WB4 A;  3BBF A;  3J81 j;  2LU1 A;  4OYX A;  1LV5 A;  4P7T A;  4EZ6 A;  3K57 A;  5HMX A;  5F8L A;  1U1P A;  1CUL B;  3JTO A;  3VAM A;  4K8R A;  1RWN B;  2EBE A;  2XSF A;  4HDG A;  3MOZ A;  1C0U A;  3MEC B;  5KT7 A;  2AJF E;  3W63 A;  2FLO A;  2CVI A;  5BYS A;  2LXU A;  3A8I A;  5IWA F;  3IR6 B;  3TUI C;  3OFE A;  1NO8 A;  2L9D A;  2GHV C;  2XSJ A;  4J7C A;  2IRX A;  5GAG I;  2CA9 A;  4QIF A;  1VRT B;  1U25 A;  2CXE A;  3N5B A;  5KFI A;  2D3O 1;  3QZ7 A;  5AJ3 J;  1FTR A;  1J5O B;  4LQ9 A;  3KHR A;  5M2U A;  1PO6 A;  2UVV A;  2XUL A;  1FO1 A;  5F8M A;  1P9Q C;  3V81 A;  5E33 A;  3NS5 A;  4K0K J;  4RR5 A;  2MQQ A;  4F25 A;  4DEZ A;  4K4U A;  2BJ8 A;  2ZOF A;  2ZWP A;  1PIL A;  5KAK A;  2ZE2 B;  4M5D B;  3THV A;  3KLG B;  2YTC A;  4ZVG A;  1RHJ B;  3IS9 B;  1RBO B;  3OHB A;  2EFP A;  3D4J A;  4W4M A;  1X9M A;  4F4K A;  1IBL J;  1QLN A;  2AW0 A;  5EDW A;  4XDC A;  4X4N A;  2IRY A;  4DR5 J;  2B0G A;  2C3P A;  1SC4 B;  4DPU A;  2FVS A;  2BKN A;  2FJX A;  1ZA2 B;  3FDS A;  1RA7 A;  2BZ2 A;  1X5S A;  1N5Y A;  1M5O C;  1RQ0 A;  3KOA A;  2YWE A;  1RT6 A;  3MM8 B;  4I67 A;  3K58 A;  3Q8S B;  2ZH1 A;  1JXV A;  4X4P A;  3P8B B;  3DHX A;  2ZBR A;  5KFC A;  1U45 A;  4MIW A;  3MEE B;  5DM7 Q;  1JLQ A;  1V9O A;  4FF4 A;  1WEX A;  2U2F A;  4YDD B;  4IFY B;  1XNQ F;  2OPP B;  1TL4 A;  4D3G A;  3RYL A;  4NCG A;  2HVD A;  1UZH A;  1ZAW A;  2NS1 B;  5BR8 F;  4CLZ A;  2NSC A;  1RKI A;  3MED B;  2RIJ A;  4ZCK A;  3RG6 A;  4N77 A;  4ECT A;  2K1R B;  4K2J A;  1IBM J;  2NPI A;  3NXZ A;  2IJR A;  1IBC B;  2EG2 A;  3EE3 A;  3EGZ A;  3QAU A;  2A6M A;  3KKF A;  1C0T A;  1KSP A;  1TP7 A;  1FER A;  5HQ8 A;  1WC3 A;  1Y5N B;  1TL1 A;  2WSC C;  1WEZ A;  2PFD A;  3OD2 A;  3NGS A;  1T9Y A;  1YX2 A;  3QO9 A;  4UOF A;  3DLK B;  4I0W A;  3UD4 P;  5IT0 A;  4KRW A;  5C42 B;  4FYY B;  1H2U X;  4OX7 A;  1JLE A;  2C1E B;  1F3F A;  4NXM F;  2VPW B;  2SXL A;  3OVB A;  3TX0 A;  2KVQ E;  3NOG A;  3DRS A;  4JI0 J;  4WFY A;  1QDU B;  4ECW A;  5HLF A;  1BQN A;  1D3W A;  4OX9 J;  2F63 A;  2HHH J;  4DHV A;  3POT A;  2B8Q A;  2QLJ B;  4WBF A;  1JIH A;  4Q8F A;  2KXN B;  2OSR A;  1HIY A;  3Q2T C;  3CIZ A;  1Y0H A;  3W8P A;  2B6A B;  4P2S A;  5M2P A;  1LKZ A;  2OHD A;  2VPX B;  2HGN A;  3QT6 A;  4XO0 A;  1WHW A;  3FCH A;  8AT1 B;  5LL6 d;  1OIA A;  1UET A;  4AYB D;  1RT2 B;  5E3A A;  2IC3 B;  5EWF A;  3HD1 A;  3RW7 A;  9ATC B;  1RP5 A;  3KHL A;  3QJL A;  3QRR A;  2R7T A;  1BHN A;  2AYG A;  4F3M A;  2QMX A;  2FD2 A;  2DR6 A;  2A2C A;  2J7K A;  4AE5 A;  5IT9 Y;  1U2C A;  2IDL A;  3OTD A;  3T6J A;  4RNH A;  7AT1 B;  2BQU A;  3TZW A;  2G0C A;  3AT1 B;  2E1R A;  2GVZ A;  1WKK A;  1KS2 A;  5HRO A;  4DG1 B;  1D9A A;  2YXL A;  2FLP A;  4KKO A;  4L73 A;  1N54 B;  3UW1 A;  2BE2 A;  2E5J A;  1LW0 A;  2UUT A;  5DET A;  2QSF A;  4ZVU B;  3QBC A;  3PAC A;  2LEA A;  2JFK A;  1GEH A;  3UI3 A;  4O3Q A;  2HEK A;  2KJW A;  2RD5 C;  3N0V A;  3X1L B;  4DS4 A;  3CED A;  3O1L A;  2YNF B;  1RAG B;  3AQO A;  3C46 A;  3RBZ A;  5HP1 A;  2PE8 A;  1S7I A;  4DU7 A;  3QLH A;  5LJ5 Y;  5B0B A;  3IAS 9;  1SJ1 A;  1VQ8 S;  2QA2 A;  5DGB A;  4U7C A;  2VQF F;  4DV4 F;  3OUY A;  4XIU A;  1U2F A;  2N7Y A;  4JYA F;  3P5T L;  2H9Z A;  1NK0 A;  3SFU A;  4B9M A;  4UOG A;  3VTI A;  4FBT A;  4TY9 A;  4OJ3 A;  3I9V 9;  5T41 A;  4LRE A;  3ZTO A;  2QYG A;  3MEK A;  2HHU A;  2IBK A;  1Q86 T;  4RWW A;  1X0F A;  4DQP A;  2ADB A;  2HGL A;  2MST A;  1NJI T;  1C4C A;  4A8W A;  3L7P A;  5E2Q A;  2DO4 A;  2B4U A;  4EYI B;  2HFV A;  1IR2 A;  3U1M A;  1D9F A;  4RL1 A;  1K73 T;  1YIJ S;  1HYS B;  5KG5 A;  2GAG C;  1IBK F;  4OHZ A;  3MI7 X;  5IV4 A;  2LDI A;  2Y1R I;  1M0S A;  2VG7 B;  3IR7 B;  4F4Z A;  2PMZ D;  2FLN A;  2HVZ A;  1VQL S;  3KMS A;  4MYU A;  3D3B J;  3HZE A;  3KLE B;  2CJQ A;  5IWA J;  3W5X A;  4JI4 F;  2CZV C;  3NCR A;  2X51 A;  1RGV A;  3ENV A;  3QIP A;  2C42 A;  1Q81 T;  3CUN A;  3EX7 B;  4DN9 A;  4WPA A;  3B4M A;  4I7F A;  4ZPV R;  2DNY A;  3R7S B;  1DAR A;  1NDL A;  2DVI A;  1AA1 B;  2R2S A;  2D74 B;  3VAJ A;  4CI0 B;  2MKC A;  3M6V A;  1VIS A;  4GKK F;  2V67 A;  2XMJ A;  1Q53 A;  4DJB A;  3BGF A;  4OIX A;  2Z56 B;  3OVS A;  3MM9 B;  4N47 A;  1V3S A;  4URS A;  2VDI A;  1WKL A;  2MEW A;  3MR7 A;  1SQF A;  3N6N A;  1T94 A;  4ZP9 A;  3GWC A;  2CPX A;  4HR2 A;  3DLG B;  4IFV A;  4OX8 A;  3G6X A;  3NL0 A;  3N79 A;  4KT0 C;  3CW2 C;  2FJE B;  3PCO B;  2W4P A;  2QO3 A;  2VBY A;  2D7S A;  1NRK A;  4I68 A;  4U96 A;  3ZO7 A;  1SV5 B;  3DOM B;  4JV1 A;  3SSQ A;  1KBR A;  1M1K T;  4F8R A;  1GMV A;  1S1T B;  2Y9H A;  3THT A;  1XNQ J;  4KAI A;  2IYG A;  5EX3 A;  2L48 A;  2I6W A;  3UDE A;  1EP4 A;  5BR8 J;  3HHL B;  5H1S V;  1FKO B;  3TO8 A;  1UFK A;  2K3K A;  4LF4 F;  4LIW A;  1CQN A;  2NXN A;  2C2K B;  5CHC B;  4NL5 A;  2WBR A;  3HM9 A;  4ZPD A;  2NZ4 A;  1OMS A;  1TL7 A;  4DSL A;  1CJK A;  3SEO A;  2DBB A;  4JI5 F;  2CJB A;  5KG4 A;  4PAA A;  2DHS A;  4WXW A;  3J7Y U;  4DV5 F;  1I94 F;  1LXJ A;  4DFK A;  4ALZ A;  3SYZ A;  2LEC A;  3L95 X;  1HNI B;  3LGM A;  4P73 A;  1EAR A;  1RU1 A;  1PAU B;  1WHV A;  3KG0 A;  2WHO A;  1TKD A;  2W24 A;  1RCX B;  3IG1 A;  3IMQ J;  3M8P B;  4NXM J;  1CSJ A;  5GVQ A;  2FVP A;  2QRR A;  3R2D J;  2PO4 A;  1AYE A;  3O5T B;  5FDL A;  3UCU P;  3M7V A;  2F8H A;  2RVJ A;  8ATC B;  5J1P A;  3JQM A;  3M30 A;  4DR1 F;  2JDJ A;  4FN5 A;  3RRH A;  3C19 A;  4J9S A;  1D09 B;  1Y10 A;  4LRA A;  1YJV A;  2FZG B;  2E5G A;  1GAO A;  3SDE A;  1XR7 A;  4USV A;  1X4F A;  3FQL A;  2HWI A;  1B7F A;  3D68 A;  3MM6 A;  3BN7 A;  4HH1 A;  2BQ3 A;  3SV4 A;  3HJF A;  4RW9 B;  5E3R A;  1P6T A;  4B3R F;  4RBT A;  2VZ9 A;  4KTQ A;  2R3V A;  4PQU B;  2F1F A;  1HBN A;  3R7N B;  2IBO A;  1ZET A;  3A4T A;  4R25 A;  4B3M F;  4H4O A;  4B9N A;  2I8E A;  2DNL A;  3HSG A;  2CJ9 A;  3DHW C;  3BB5 A;  2H5I B;  4MFB A;  1UVI A;  5L8R C;  4PG6 A;  3R2C J;  3QWU A;  1Q0N A;  1S1V B;  4LR8 A;  2ADC A;  2DGX A;  3OTB A;  4L6V 3;  4LF8 F;  5I42 A;  2F9J A;  2RKI A;  1VQP S;  1NHK L;  3AXK A;  3ZC4 A;  3JXO A;  1WDT A;  2RU9 A;  4JUZ A;  2BYC A;  3FZB A;  1N5S A;  4G65 A;  3IWN C;  1TL3 B;  2AU0 A;  3AD8 C;  5IZH A;  5K14 A;  1KQS R;  2Z2M A;  1U8W A;  2VV5 A;  2I9S A;  3W62 A;  2VQF J;  1QD1 A;  4DV4 J;  2F5G A;  2MKH A;  3CJT A;  2ZM6 F;  1YDL A;  3MM7 B;  4JYA J;  1W2B R;  2ZKT A;  5CZX A;  3SCJ E;  4DR6 F;  4X2B A;  4WU3 A;  2NPF A;  2ALZ A;  1FE0 A;  4F3O A;  2DNG A;  1D8Y A;  2DNQ A;  2QFI A;  4ECX A;  3U7J A;  3QSI A;  2MJN A;  2OP5 A;  2P9C A;  2M52 A;  4K4Y A;  4IRC A;  5EWG A;  5I3U A;  3OQ2 A;  3QFH A;  4YY3 F;  4M95 A;  2XEX A;  2JSX A;  4OJG A;  2RQC A;  3CJ3 A;  5KG3 A;  4OZ3 A;  1VC6 A;  1VQO S;  3UNY A;  2Z57 B;  1CS4 B;  4IDK A;  3MAQ A;  5J2P B;  4PR6 A;  4C0B A;  1IBK J;  2VHG A;  2ZUG A;  1QM9 A;  2EVZ A;  3VQT A;  2IJN A;  4X84 A;  3CJR A;  5HN0 A;  1WF2 A;  4X65 F;  5AXN A;  5SZT A;  2HRY A;  3BPS P;  3MCO A;  2PFF B;  5DZ7 A;  1DLO A;  2A3J A;  2VPZ B;  4JI4 J;  1HWK A;  4YB7 A;  2V2Q A;  4O0N A;  5CAA A;  1TK5 A;  4I6A A;  2CG4 A;  5KT4 A;  5MAO A;  4IOB A;  2HRU A;  3HMJ G;  1U49 A;  1FK9 A;  3AHP A;  4F2S A;  2CAD A;  3M4X A;  2CWX A;  3VGT A;  3HI9 A;  3UN2 A;  2HQI A;  2ZJP Q;  4NI2 A;  3RR7 A;  3DCA A;  2V8G A;  1B0P A;  5HJX A;  1ICE B;  1X4E A;  4MMO A;  2Y8W A;  3DLL Q;  2P9G A;  2QJ3 A;  4R5P A;  4GKK J;  4GVB B;  5LT5 A;  3OFF A;  5D8H B;  1SBR A;  1MN9 A;  4F4Y A;  1VRU B;  4U9R A;  4DN0 A;  3JYT B;  1WSV A;  2Q43 A;  3M9O B;  2PA3 A;  4NWB A;  2N4C A;  3NCP A;  3KJV B;  1BQM A;  1S6U A;  1C1C A;  1NJY A;  2FLL A;  4DSI A;  1D9D A;  1RTD B;  1YGY A;  4OFZ A;  3HHE A;  1B7Y B;  4R8U A;  1S6O A;  1S7H A;  4WFZ A;  5HK4 A;  2P2C B;  1AFJ A;  2BW2 A;  5KT2 A;  2VKZ G;  2N4D A;  2ZNZ A;  3UE2 A;  3CXC R;  4ZPB A;  1R8B A;  2I0X A;  5D4O A;  4DL5 A;  3IAM 9;  1LWC B;  5LXR A;  2M70 A;  4Y2K A;  5CYQ A;  3MPU B;  3CD6 S;  4DV1 F;  2XLK A;  1OJ4 A;  4YB6 A;  5CYM A;  4IRK A;  3WHI A;  4XAK A;  3AAW B;  1VBZ A;  4ZP8 A;  3R8Y A;  3JS9 A;  1TFW A;  4DSF A;  3AA8 A;  1MNE A;  3J81 U;  1AT1 B;  2XQC A;  4ECZ A;  4B9V A;  1FXR A;  1Q78 A;  4P71 A;  2N3O A;  4YN3 B;  4CTA B;  2V0N A;  3CIM A;  1FXL A;  1XMO F;  3FJ2 A;  1ZM9 A;  4ZS6 A;  5H9F K;  1QE1 A;  2IAJ B;  1DY3 A;  2W7P A;  2FJB B;  2ZZN A;  1W2I A;  4LF4 J;  3CE8 A;  4PWD A;  4C3M A;  1YHQ S;  2MPU A;  2IYI A;  3W5Y A;  4IR9 A;  3CD5 A;  5HVG A;  4JI5 J;  1C1B A;  1AW0 A;  4CH7 A;  1SL2 A;  3M1V B;  5KG7 A;  4DV5 J;  5C24 A;  1I94 J;  1T3N A;  1OY8 A;  1T0T V;  2OFH X;  2KVI A;  1REV B;  3Q89 A;  2R9L A;  3ZNU A;  2YPY A;  1S1W B;  2YNG A;  2NXE A;  3AJD A;  1XBW A;  4CLF A;  4DL2 A;  3HJV A;  2WVE A;  3R5G A;  2K06 A;  5A8R A;  3WQP A;  2OAU A;  3I32 A;  2VFR A;  4YUD A;  3V6J A;  2LQ5 A;  4DCP B;  1NPP A;  3T41 A;  4BS2 A;  3AJ1 A;  1RJJ A;  4IQM A;  1RBL A;  2FPH X;  4DR1 J;  4O44 A;  2B4V A;  4TU7 A;  1G7C B;  5DG8 A;  5IQQ A;  2J6U A;  4RU2 A;  4NXN F;  1OQ6 A;  2EFO A;  3PW0 A;  3M6X A;  1O6X A;  2FB0 A;  4LSN B;  3TVK A;  1RWV B;  2W2P P;  1PG5 B;  1UPM B;  2CQC A;  4DL7 A;  2DXE A;  1VQ7 S;  2XMV A;  4CO3 A;  2HNZ B;  3RZA A;  3RBX A;  3QT5 A;  4B9U A;  3PYG A;  4B3R J;  4OZ5 A;  4Q2L A;  2W01 A;  5T7L B;  3M8Y A;  4P72 A;  2B9E A;  3B8H A;  2VG6 A;  2W4D A;  4DLG A;  1U1L A;  1T9X A;  2F8M A;  2XCA A;  2JC1 A;  2LQ8 A;  4B3M J;  2E7W A;  2ABY A;  4X4U A;  2OEM A;  4MKV A;  3VAK A;  3KUH A;  2R7U A;  4PPZ A;  2GQQ A;  2I5J B;  4ANC A;  4LF8 J;  4OZ2 A;  1X5O A;  4ICL B;  2RJZ A;  3CDB A;  4F02 A;  2JH3 A;  1VJW A;  3TAM B;  3MWB A;  3ZFV A;  2LEB A;  4ES2 A;  2KJV A;  2R2U A;  3QJP A;  3AB4 B;  5H9F J;  1U6F A;  1UEV A;  2UZA A;  1M1G A;  2C22 A;  4J90 A;  1KR4 A;  1VYA A;  2ZM6 J;  5J2Q B;  1WOO A;  1PIE A;  1RKJ A;  2HVH A;  3TJ8 A;  4ECV A;  2HZV A;  3CWJ A;  1JKH B;  3D6T B;  3CC7 S;  4DR6 J;  1JLG A;  3L4B C;  2CQ3 A;  9RUB A;  2CYY A;  3NOC A;  3MM5 B;  4DFP A;  2C2O B;  1I3O B;  2OSQ A;  3HSD A;  3U27 A;  3ENA A;  4ED5 A;  2DEI A;  4C3K A;  4H54 A;  5I4M A;  3BQ2 A;  5GAG U;  3C14 A;  3TJ9 A;  4NX9 A;  4ELU A;  1DTT B;  3JAM U;  4ZCL A;  4YHH F;  2HG4 A;  3TUJ C;  2LU2 A;  2HHX A;  5A0Y A;  4YY3 J;  2EW9 A;  1I1G A;  3TAQ A;  2F9D A;  2OMO A;  3W2V A;  2WB1 D;  1SCJ B;  1Q79 A;  4J9K A;  1TMM A;  2KKH A;  1R43 A;  3WIU A;  2VFU A;  2ZDP A;  2N3L A;  2HIQ A;  3NWG A;  3CF5 Q;  3V81 B;  1N6Q A;  3OHA A;  4OHW A;  1NK7 A;  2PMH A;  2KFN A;  4QIV A;  1RCO B;  3D28 A;  2ATL A;  4C8M A;  3UDL A;  3QQC D;  4FZV A;  2W2O P;  4X65 J;  3IGV A;  4LR7 A;  4WU2 A;  4ECS A;  3UQS A;  1NDC A;  5MLC V;  2IHR 1;  4QOT A;  4YOE A;  2XGQ A;  3RW6 A;  5D6G A;  1T3O A;  5L1I A;  3PEJ A;  3U1N A;  3O3L A;  1WOS A;  4HAC A;  3D5M A;  2DT9 A;  3J7Z 5;  5F3T A;  1A0O B;  1LK7 A;  2PC6 A;  5J2N A;  3DRR B;  1GT8 A;  5GMD A;  2XI3 A;  3CUL A;  1NPK A;  2FJV A;  4LRD A;  2FY8 A;  2HFU A;  1JLQ B;  2Y8Y A;  2X3D A;  4NZ7 A;  2G1H A;  3NGR A;  1HI8 A;  2HND A;  4NCG B;  2V2K A;  2YWH A;  3Q0A A;  1N5T A;  1YSJ A;  2FJA B;  1VBY A;  3UVJ A;  1Y4Z B;  3Q8R B;  3NBP A;  5E3C A;  3LWL A;  2WSE C;  1LWE B;  4KHR A;  5HJY A;  4WZQ A;  3GJQ B;  3TA1 A;  1GX6 A;  4F7V A;  3FCV A;  3EPI A;  2CNL B;  2V8V A;  4CCH A;  3TAR A;  1C0T B;  3CJ4 A;  4OHX A;  2K3I A;  1SJ3 P;  1IWG A;  3OR1 B;  3CJ5 A;  3NG8 A;  1J2V A;  4DV1 J;  1IKV A;  2CPD A;  2CQI A;  3JQK A;  1IKY A;  1QUV A;  1RWK B;  3ISN C;  1RWM B;  3MF5 A;  3KFW X;  3E8O A;  3V6D A;  4J37 A;  1B3T A;  4PG7 A;  1XMO J;  1MW7 A;  4RJV A;  3GSI A;  3GFX A;  1KLN A;  2BKP A;  2DNZ A;  3OJU A;  4ANE A;  2DIV A;  2R2T A;  1L3V A;  2Y0S D;  4NML A;  1BQN B;  2C2Z B;  3N6M A;  4IR1 A;  2EG1 A;  4NLV A;  1RHR B;  3DM2 A;  3ELH A;  4LBP A;  4M63 A;  5L46 A;  1N5Q A;  2ASJ A;  1JLF A;  2DNO A;  1WAC A;  1BMQ B;  4O23 A;  3B82 A;  1U6Z A;  1LNQ A;  4ELV A;  3FRY A;  1WEY A;  3G82 B;  2M8H A;  4U6P A;  1WG4 A;  2C2M B;  4K59 A;  2GNK A;  2G13 A;  5HAN A;  4KGM A;  3LAK A;  1L3U A;  2HSE B;  1KQG B;  1ZTW A;  2BVZ A;  2AJQ A;  2DH7 A;  2EFQ A;  1CBK A;  5A6W A;  4P2F A;  1NB2 A;  3I0S A;  4O3N A;  1S1X B;  3S8S A;  4DQR A;  2HS3 A;  2RHQ B;  3OFH A;  5D4N A;  2VC0 A;  3OXG A;  2PGC A;  1KLM B;  1K9M T;  5D78 A;  5KFG A;  2DR8 A;  5F8G A;  1WD6 A;  1NKC A;  3O44 A;  3J7A 1;  2KI2 A;  4NZ6 A;  3RBE A;  4NXN J;  2AEF A;  3H5U A;  2OEJ A;  2U1A A;  4RW6 B;  1Q16 B;  1S4F A;  2WOM A;  2J0S D;  4PXE A;  3T1A A;  3MFH A;  4O3S A;  2OLW A;  1D0E A;  3GP9 A;  2E5L F;  4JV0 A;  5GMK a;  4OJ1 A;  1FX4 A;  4K50 A;  4JV2 A;  2XO7 A;  4Q7A A;  4RW4 A;  1Q95 G;  4P75 A;  2GVD A;  5HP1 B;  5KFE A;  1N36 F;  2UXC F;  1K47 A;  4S0M A;  3M2R A;  3QLH B;  1SH3 A;  2HQD A;  4ATN A;  5DGA A;  4A46 A;  4BLG A;  2HAF A;  4QR2 A;  2VJV A;  4L3K A;  1NHU A;  4UF4 A;  1GFW B;  3GFZ A;  2QL7 B;  4MK9 A;  2O01 C;  1CLF A;  3R97 A;  3D6F B;  4GKJ F;  1GQE A;  2QLB B;  3SCK E;  2JEI A;  2QE5 A;  2GAH C;  3OL9 A;  5LJ3 Y;  2O67 A;  4DCJ B;  1YZ7 A;  2GX8 A;  2M5Y A;  4URG A;  1JXL A;  1RI7 A;  3FBF A;  4F50 A;  3US5 A;  3HXM A;  1U7L A;  3OT9 A;  2CZ4 A;  3KXD A;  5DRK A;  2V8H A;  4LFC F;  5JMN A;  2WAQ D;  4WK1 A;  3GV8 B;  3M8Q A;  3TP2 A;  1RAH B;  3LP2 A;  1VMB A;  4V19 J;  2W7A A;  1OSD A;  1YJR A;  3SFG A;  2W2M P;  3VZI A;  4KYZ A;  4NLO A;  1R6V A;  1HPZ A;  3KLI A;  4G6V B;  2W9B A;  3GIR A;  4ZLJ A;  4LRC A;  2KHC A;  3C6U A;  2QEX S;  4CNZ A;  3UCZ P;  1VS3 A;  3CT9 A;  3MTJ A;  1ULR A;  4B3S F;  3CVK A;  4HHJ A;  3HLU A;  3L7U A;  1WHX A;  4YHH J;  3M8R A;  1SL0 A;  1R8C A;  1IQZ A;  4QW8 A;  4I7F B;  4KFB B;  1VK8 A;  2Q66 A;  4GC6 A;  3SZ2 A;  2VBW A;  1Y5L B;  2V8P A;  4YDX A;  1B70 B;  1NK6 A;  2E29 A;  5BXI A;  2LCW A;  3WZ0 A;  1LEO A;  2X3G A;  2BAC A;  3FC9 A;  4MIB A;  4J9O A;  4EGL A;  1X9S A;  3G86 A;  2VC1 A;  2BRL A;  2YNI A;  4H4M B;  3PNI A;  3TEG A;  5J1E A;  2MQN A;  4NYP A;  2RQK A;  3I6P A;  3K8V A;  1HBU A;  2IVM A;  1IN0 A;  2BMB A;  2NR0 A;  2QMU B;  2EKN A;  5CCM A;  3BN4 A;  1ZTT A;  2GGP B;  1RWW B;  2KDO A;  4M94 A;  1RLC L;  2MDA A;  4IFV B;  1PYT A;  2ACM A;  3BDP A;  2EK1 A;  4KV8 B;  2D9O A;  2H51 B;  4ZOS A;  2AKW B;  5CD4 H;  2J9D A;  3CJ0 A;  3PO4 A;  5GAH U;  2KHD A;  3W64 A;  4OI3 A;  1U0H A;  3H40 A;  5D0G A;  3PRD A;  2Z2Z A;  3Q8Q B;  1D8Z A;  4RKU C;  2BAN B;  1KQK A;  1QAY A;  8RUC A;  4NE9 C;  2MLZ A;  2WW8 A;  2JZ5 A;  4UY8 T;  3IO1 A;  4F4W A;  4EYH B;  2BJ7 A;  2WVD A;  4TQR A;  2V2Z A;  4CP5 A;  3KHG A;  1YKW A;  4K4S A;  2DD8 S;  5A8K A;  4CLL A;  5KFS A;  3CMA S;  2YNH A;  3PXG a;  3GYN A;  3G96 A;  4N7T A;  3NEK A;  3ZZZ A;  1B64 A;  2BRK A;  3BGR B;  2V69 A;  2C2N A;  2YWW A;  1VHI A;  5ETT A;  1NKB A;  3UR0 A;  1RTJ A;  3QT8 A;  1FNX H;  2V9K A;  5ADZ A;  1SUQ B;  2BJ1 A;  4K4Z A;  1JLA A;  3MEG B;  3ULH A;  5DDP C;  3IBF B;  2R8K A;  2FUG 9;  3TI0 A;  3SXL A;  3RAM A;  3H8Y A;  2EI5 A;  1NSA A;  2G0J A;  1VQ9 S;  4L74 A;  3S7R A;  2RAQ A;  3IG1 B;  2OI2 A;  2LEP A;  4K4X A;  2RDI A;  5E7O B;  4JI7 F;  3CMQ A;  2YQ3 A;  3MAA B;  3I5C A;  1RT3 A;  4PXC A;  2DCL A;  2AIR B;  1S57 A;  4Z37 A;  3UD5 A;  5FDL B;  1R3N A;  1OWX A;  3C6T A;  1KTQ A;  3BO3 A;  4B9L A;  2HQG A;  3I0R A;  1GX5 A;  2HZC A;  1SKW A;  2HVE A;  3QZ8 A;  3CC4 S;  4USU A;  4CLU A;  2ZFH A;  2LVW A;  1CJT A;  2IM3 A;  2ROP A;  1X9W A;  3N9U C;  2DO0 A;  5A8W A;  3DI6 B;  1RTI B;  2AJ1 A;  1HI1 A;  1IKW A;  2NCK L;  1QVF R;  3HD2 A;  1LQ9 A;  3MM6 B;  3QYY A;  2ACY A;  4PUO A;  2KT3 A;  4X62 F;  1N0U A;  2RF2 B;  3MMC A;  4PG8 A;  1R8H A;  3FFI A;  2IA6 A;  2XB2 D;  1S59 A;  2E9T A;  2QMW A;  3L09 A;  1Z2L A;  5T14 A;  1HBN B;  3J80 Y;  1JLB B;  4WP8 A;  1B0V A;  2OTL S;  1TKT A;  2NZC A;  3CSK A;  4OX6 A;  1XMB A;  2FHJ D;  4C8Y A;  4DR4 F;  3ZZP A;  2RDJ A;  2AYB A;  3T9Z A;  1UP1 A;  1C4A A;  4TU8 A;  1V5V A;  1HHT P;  1FRI A;  2Z58 B;  4M5J A;  4ZVQ B;  3VVT A;  5I42 B;  2ZH9 A;  1XQI A;  4FXD A;  1T05 A;  2E5L J;  2H5E A;  2AZ3 A;  1FFG B;  3HSJ A;  2R7R A;  2DIU A;  4LF1 A;  4DPY A;  2C3Y A;  1N36 J;  3DOK B;  2UXC J;  4RUC A;  3UNG C;  2AEJ A;  3W2W B;  1PKU A;  1D1U A;  2FJW A;  3I55 S;  5K14 B;  3ET6 A;  3E3X A;  3PYE A;  4L72 B;  1CG2 A;  2P5V A;  2DGQ A;  1RT1 A;  4M5M A;  4LSL A;  1NB7 A;  2JWN A;  2IPO B;  2BJ3 A;  4Z2X A;  4BC7 A;  4GKJ J;  1S9G B;  3GIK A;  2FIU A;  3QRP A;  5KFY A;  2ZBC A;  2R7X A;  3BYR A;  2D3O R;  4FF2 A;  2IA0 A;  3G8Q A;  5LSR A;  1UWB A;  2OPS A;  3SCI E;  2FJD B;  4OLO A;  1KFD A;  4C9D A;  1MN7 A;  3TUP A;  5I3U B;  2PII A;  5KTQ A;  3M8W A;  2KU7 A;  1YRT A;  5I3P A;  1NND A;  4LFC J;  1F60 B;  1DTQ A;  1DFD A;  3E2E A;  1V3Z A;  5DDR C;  2CWK A;  3KHH A;  1CUL A;  3W9J A;  1ZOT A;  2GMJ A;  3T1H F;  3MPY A;  3J7A N;  7FD1 A;  2R7V A;  4IDK B;  4CO1 A;  1UKU A;  1EAY C;  2KXH A;  3QGI A;  1ZM2 A;  3IRX B;  3LQV A;  1UVN A;  2E66 A;  3PTW A;  3MHY A;  3HZG A;  1UCN A;  2COL A;  3VAI A;  1IBM F;  5JJB A;  3G6Y A;  1VRT A;  1SKU B;  3UN3 A;  1Y9O A;  1MML A;  2CG8 A;  1EX8 A;  1DLO B;  2IVY A;  4KH0 B;  4CNY A;  4B3S J;  1NK4 A;  3PYD A;  3EM1 A;  4OJH A;  3OFG A;  4PYA A;  1HQU A;  2X1F A;  3TVZ A;  4ZVR B;  5DZ6 A;  1HNV A;  2KTQ A;  4C0O C;  1U2R A;  4LFA F;  1BLU A;  2HWH A;  2ZE2 A;  3KWM A;  4M5D A;  4NI2 B;  3KLG A;  1NSK L;  4ZN3 A;  2IFX A;  3MMJ A;  1KON A;  2IY5 B;  2DGV A;  3RB4 A;  1WF1 A;  3TEH B;  2AD9 A;  3W60 A;  3MAH A;  5DLF A;  3ETM A;  1GXU A;  2DHA A;  2OEL A;  3QPI A;  3CDA A;  3VZH A;  4G1Q A;  2IJF A;  1XNR J;  2JRS A;  5KFL A;  1H73 A;  5F9N A;  1BQM B;  2RU3 A;  3MM8 A;  1C1C B;  4DV0 F;  2BV3 A;  2Q79 A;  4KBI A;  4K4T A;  1NDP A;  4R8U B;  3A3O B;  4W92 B;  1KNZ A;  1BXN A;  1NJW A;  2JEJ A;  2J76 E;  3EJM A;  3MEE A;  3DMJ A;  4USI A;  3BV8 A;  3TOQ A;  3QSY B;  4HL9 A;  2OPP A;  2BBE A;  3V6K A;  1IM6 A;  2PSZ A;  2UU9 F;  2DH8 A;  1J5E F;  2MY7 A;  4P2M A;  2OPQ B;  2ZBP A;  1FRX A;  3MED A;  5F8H A;  3GV5 B;  2DY9 A;  1FRJ A;  3FMB A;  3IBW A;  1KKH A;  3H98 A;  3KNA A;  2B43 A;  2XHC A;  4PXD A;  4KPY A;  5HI7 A;  4LSZ B;  3K89 A;  2XMU A;  5ETS A;  3UO0 A;  3ITH B;  2J0Q D;  1S6Q B;  4U7U D;  1P8G A;  2DY1 A;  2HWT A;  4C11 A;  1O5J A;  2OH2 A;  3DLK A;  5E0O A;  4FYD A;  1FRM A;  2FZK B;  4QWD A;  3PHE A;  2XZD B;  1YJ9 S;  1U1Q A;  3EVM A;  4DR2 F;  2F40 A;  4DL6 A;  1RZM A;  5IOL A;  4IUF A;  2APO A;  4RW7 B;  4CO2 A;  4HYK A;  2XWY A;  5BJR A;  2XZW A;  2F4F A;  3MUR P;  1YBA A;  4KGZ B;  3W3S A;  4F67 A;  3NNC A;  1YJT A;  5HAT A;  1NHV A;  4NCA A;  2HQC A;  4GC7 A;  4JI7 J;  2QT7 A;  1BGX T;  2MJU A;  3ILL A;  4ZLP A;  3FBC A;  2B6A A;  4LF7 F;  4HTJ A;  3CJS A;  4XK8 C;  1K1S A;  2AGQ A;  4O44 B;  5E3P A;  2XGP A;  4XDD A;  4WTY A;  1RT2 A;  3MR3 A;  2IC3 A;  3QT7 A;  4CLP A;  1AB8 A;  4WCE Q;  3KG1 A;  3J80 U;  3KLF B;  5HVH A;  5KT6 A;  1MSW D;  1BWE A;  4TU9 A;  1VOM A;  4NOH A;  3HVA A;  2QA4 S;  4TQS A;  3VF0 B;  3ZTP A;  4X62 J;  3Q24 A;  1NH8 A;  1OS5 A;  4RUA A;  4CWB A;  5KFK A;  2XYH B;  4LQ3 A;  1NK9 A;  5LOQ A;  2KL8 A;  4MK8 A;  1L5U A;  4CDI A;  1UZD A;  3K5P A;  2R8H A;  1VQ5 S;  3QRQ A;  2PMW A;  4EO8 A;  1JJ2 R;  2YKO A;  1FWP A;  1RK8 A;  2HMI A;  1Q8L A;  4TXS A;  3V4I A;  2CAJ A;  2EC2 A;  2YKM A;  3BKT A;  2MQP A;  1SKR A;  1Y7P A;  3P5B P;  1TVR A;  2JFD A;  1YG0 A;  4NLS A;  3H59 A;  4DR4 J;  2NRE A;  1GNK A;  2YNF A;  2Z30 B;  4OI2 A;  2DKO B;  1UL3 A;  5KFO A;  1V6H A;  1U1O A;  2K7K A;  4R0J A;  5KFX A;  4OHY A;  2EC0 A;  3WBZ A;  2OPR B;  3LAL A;  4ED4 A;  4X4Q A;  1NM2 A;  1FJG F;  5KFR A;  2JX2 A;  4Y34 A;  2FVC A;  3CCL S;  1M5K C;  1VIX A;  2GC8 A;  1S9F A;  5GAD U;  3OBI A;  2GA7 A;  1VDH A;  1Q7Y T;  4C48 A;  3S1T A;  1WC1 A;  1HHS A;  3DU6 A;  5CH7 B;  4H4K A;  3FKB A;  1QVG R;  4A8K A;  1KRP A;  3VAH A;  1QTM A;  1ZZN A;  3R6L B;  5KFN A;  2DH9 A;  4RNO A;  2XYG B;  3LGH A;  2ASD A;  3AQP A;  2AGO A;  3JSR A;  1CJV B;  4MK7 A;  3OV7 A;  2DJW A;  3KDN A;  3K8W A;  4ETZ A;  1JLC B;  2HHQ A;  3TAP A;  3G2X A;  1RT4 B;  2XM3 A;  5C2G A;  2O1P A;  3TA2 A;  2B9Y A;  1X0P A;  5K8M A;  2MQL A;  3KDO A;  1JB0 C;  1ROF A;  2RIL A;  2W4C A;  1MWZ A;  1YI2 S;  1HYS A;  3ZTQ A;  2LQJ A;  4M5I A;  3LW5 C;  3V4M A;  1PC4 A;  1RTH B;  5AXL A;  3A8E A;  1SI9 A;  1N33 F;  3NP5 A;  3W1Y C;  2VG7 A;  4EBD A;  2F8E X;  1UW4 A;  4YB5 A;  2XI2 A;  3ONQ A;  4FKY A;  3T1H J;  3NNA A;  5A6P A;  3FMW A;  3SQO P;  3KLE A;  2RSQ A;  1N6Q B;  4Q45 A;  3BH7 B;  1S9E A;  1RSC A;  4TYA A;  4ZK7 M;  5IV3 A;  3M8Z A;  3RAX A;  3I4P A;  5KFV A;  2HK2 A;  4FNI A;  1T9W A;  5K9F A;  2G0I A;  3MUM P;  4ED7 A;  3EPG A;  4DFM A;  2UVW A;  2DTJ A;  1DUR A;  2R7S A;  2CPY A;  1F1B B;  1AFI A;  2UV8 G;  3CJK B;  2AJ4 A;  1RT5 B;  1EQM A;  4HAC B;  4I6W A;  3PX4 A;  4E0D A;  2J7U A;  1R27 B;  1Z1Z A;  2MZJ A;  3K7R A;  1JWW A;  2HLT A;  1UMJ A;  1FTC A;  2JLE A;  5HBM A;  3EXY A;  3MM9 A;  3EZU A;  3EMT A;  4LFA J;  3RRG A;  4KPC A;  3PZP A;  3T5H A;  5LSL A;  3RAQ A;  4O4G A;  1RHM B;  2QX0 A;  5B0A A;  2HYI B;  2DNR A;  3GFY A;  3IGN A;  5KFH A;  2QN6 B;  1NH7 A;  2CFX A;  4NAS A;  3VAL A;  3NNH A;  1ZM3 A;  4A8X A;  3A8J A;  3DLG A;  4G3I A;  3HT3 A;  1RYR A;  4JP8 A;  3ZZT A;  4RZR A;  1UTA A;  4LF5 F;  1YWX A;  3D2W A;  5HMY A;  1XC9 A;  4DV0 J;  4A47 A;  1RWX B;  3NBP B;  4LIR A;  2UV8 A;  1QAJ A;  5AE2 A;  1X8D A;  2VG5 B;  4JBC A;  3KK3 B;  1SV5 A;  2OFG X;  1Y3K A;  4LR9 A;  3ILJ A;  1RT7 A;  2RHS B;  2HBQ B;  1SJ4 P;  4F4A A;  2AWZ A;  3EXC X;  3RB3 A;  3D0I E;  2FDN A;  1XK8 A;  2RNE A;  4RNM A;  4EBE A;  2RRB A;  2UU9 J;  1J5E J;  4ZVH A;  1DQ9 A;  3HHL A;  2M88 A;  2DGO A;  4UUW A;  3DRY A;  1FKO A;  4OV6 A;  2DR7 A;  1PYS B;  1XMQ F;  1NZA A;  4X66 F;  5F0W A;  4CQ1 A;  3UN5 A;  1Y5I B;  1H72 C;  1S99 A;  2OO4 A;  3V6D B;  4X4O A;  2YH0 A;  4U8Y A;  1TMJ A;  3MMA A;  2AHO B;  3T19 A;  1E6Y B;  4F26 A;  4ZIT A;  5D0R A;  1UA0 A;  2VFT A;  3J7Y I;  2BX6 A;  5HVF A;  4C2M A;  1VRQ C;  1HNI A;  3DM2 B;  1NPR A;  1IR0 A;  4D3H A;  2VOO A;  3GIL A;  1JLF B;  1HQE A;  4A48 A;  2B9W A;  1EKS A;  4X4S A;  4DR2 J;  1FDN A;  4RUH A;  2CQ1 A;  3LTO A;  4R0E A;  3L7O A;  4MIA A;  3W61 A;  4UQG A;  2NLW A;  4AL6 A;  4NA2 A;  3BH6 B;  3M2V B;  3M6W A;  4KY3 A;  4DPO A;  3FBB A;  2VQE F;  4A8Q A;  2Y1L B;  3G6V A;  4ZVS B;  1R0A A;  3SCL E;  4GO7 X;  2H3E B;  3W5Z A;  3GYG A;  2MHN A;  4LF7 J;  6AT1 B;  3Q8U A;  2HPU A;  3ZZR A;  3EYZ A;  1WNE A;  1FRH A;  4QIW D;  5KFW A;  2V68 A;  4B9S A;  4OI1 A;  3KK2 A;  4IH7 A;  1Q8B A;  4RW9 A;  3UD3 P;  1N0V C;  4Y2I A;  2NSB A;  4NLG A;  3OSN A;  4DUT A;  1WC4 A;  2WOM B;  4FBU A;  4FPI A;  4UUX A;  3GSD A;  2D69 A;  2M8D B;  2CPZ A;  3Q83 A;  2QYC A;  4PQU A;  1SB6 A;  4RW4 B;  3UDV A;  5KFJ A;  2DNM A;  3JSM B;  1NEE A;  2MSS A;  2UUB F;  3MPV A;  4F0H A;  1QSS A;  2YKN A;  1H7X A;  1R7I A;  1UPP A;  4DPT A;  1S1V A;  2HBZ B;  4M1K A;  2QV6 A;  2HZA A;  2ZZT A;  3TWZ A;  2C28 A;  5ETV A;  4P7V A;  4DSJ A;  4F2R A;  3CC2 S;  2IDE A;  1IKX A;  3TW0 A;  4A4J A;  2H54 B;  4FDF A;  1FRK A;  3D67 A;  3T5J A;  4J91 A;  3G87 A;  3PHT A;  1HI0 P;  2J0X A;  3HHL D;  1TL3 A;  5D77 A;  1R0B G;  1WC5 A;  2YQ1 A;  1FJG J;  1S1U A;  1VR6 A;  1MRO B;  4K5S A;  3C66 A;  3MM7 A;  4CO5 A;  4FP9 A;  2ZD1 A;  3DDN A;  1HW9 A;  4FKX A;  5IT4 A;  2OD6 A;  4ENO A;  2DHG A;  3LP2 B;  5DJB A;  3K2Y A;  4BHQ A;  3TZY A;  3W8G A;  1S49 A;  4UZC A;  3FEY B;  2BW7 A;  2J9D E;  3GE9 A;  3LP0 A;  4EI2 A;  2W1B A;  5ETK A;  3D0H E;  4WZM A;  1HPZ B;  3NGK A;  2HAI A;  1RAB B;  2W9B B;  1VI7 A;  2CQB A;  2WON B;  5F9L A;  4DPX A;  1F5B A;  1OY6 A;  4TY8 A;  4HT7 A;  3PR4 A;  3MMB A;  4KJI A;  4KGK A;  1PJ5 A;  5EGY A;  1JJ4 A;  1CS4 A;  1TU0 B;  5J2P A;  5DG9 A;  2VJU A;  2CNN B;  1Q5Y A;  1Q4R A;  3A3P B;  1N33 J;  1RHK B;  2G2O A;  1YK9 A;  1K0T A;  4Q2M A;  2POK A;  3IC1 A;  2MKJ A;  3B54 A;  5G0R B;  4OV1 A;  2ZH6 A;  4LJM A;  1TKX B;  2QSW A;  2GHP A;  3HP6 A;  1Z2Z A;  6FD1 A;  1PYO B;  3HVT A;  4NRT A;  2YBV A;  2HW3 A;  3GG1 A;  5DLG A;  3K5M A;  3VGU A;  2E5I A;  4NPO A;  2NYI A;  2YNI B;  1IJE B;  1TAQ A;  1EJ7 L;  1DBD A;  3KJF B;  4HI2 A;  1HBU B;  4ZP7 A;  3J81 Y;  2HUR A;  3DFE A;  1H3D A;  1X7V A;  4DPW A;  2MY8 A;  2F4V F;  4AT1 B;  1FEE A;  4I2P B;  3F56 A;  2K7J A;  2V4R A;  4LMZ A;  4X4V A;  3W65 A;  3I82 A;  4ILL A;  1AZS A;  2DNP A;  2EKY A;  3TJA A;  1VRU A;  4C6A A;  2B8P A;  1NJZ A;  1HHQ A;  2BM1 A;  4DFJ A;  5HSP A;  4KGX B;  3F44 A;  4DI6 A;  3KJV A;  5ETR A;  1VLO A;  5KFF A;  3EWG A;  1IR1 A;  3PX0 A;  2W2N P;  1YJ7 A;  5HQL A;  1RTD A;  4FF1 A;  3FBE A;  2R7Q A;  4Y28 C;  4LF5 J;  2GJ2 A;  3EGV A;  3JB9 k;  1LK5 A;  1FDA A;  1LWC A;  1FVS A;  3KG4 A;  2HQ3 A;  3EZ5 A;  1VFJ A;  4YS2 A;  1O8B A;  1RTJ B;  4M5L A;  5F0U A;  2BJD A;  2MMY A;  3H90 A;  1CPZ A;  2ZBI A;  1VBX A;  4K7Q A;  3QNW B;  2ZZM A;  3LH2 S;  1JLA B;  3BGU A;  4CTA A;  2ATC B;  4ZLL A;  4X64 F;  3SMZ A;  4MJK A;  3DU5 A;  2LDY A;  1PCA A;  1XMQ J;  1LW2 A;  4X66 J;  4ES1 A;  2ZHB A;  3OTO F;  2AYM A;  3D3C J;  1H0H B;  2MHE A;  3BYP A;  2LMI A;  5SUH A;  1RT3 B;  3M1V A;  2ZHA A;  4UTG A;  2AV5 A;  1NLK L;  2QLX A;  1FKP A;  3C6T B;  3BQ0 A;  1REV A;  2GMH A;  2E9R X;  5KFQ A;  4JI6 F;  1WI8 A;  3N4W A;  1S1W A;  1SVD A;  5CXT A;  3I0R B;  2Z0G A;  1U47 A;  4QPX A;  2O5D A;  2ZNY A;  1ZAX A;  4EZ9 A;  1L3S A;  3CCS S;  3BF4 A;  4QR0 A;  4KQZ A;  4M8L A;  5A8W B;  1F6T A;  5J1N A;  2R8G A;  4U7U K;  4K4W A;  1VQ6 S;  3VR1 A;  5E5N A;  2HNY B;  4K5R A;  1TTH B;  4I2Q A;  3KLV A;  3H42 A;  4NLR A;  2M9K A;  4DXL A;  2VQE J;  5HO4 A;  3MMC B;  5D3G B;  1XR6 A;  3Q8V A;  2VAS A;  3UR3 C;  4IO1 A;  2WTF A;  3V6H A;  2PI4 A;  4QIE A;  4LSN A;  5JUM A;  3NWR A;  4FS2 A;  2XY7 A;  3W7B A;  1U1N A;  2JVR A;  2KH9 A;  2DR5 A;  4CLT A;  3FEX B;  1S0O A;  4P10 A;  2BE7 D;  1T95 A;  3H2U B;  2XZT B;  2P6S A;  3QAT A;  2I1R A;  1FKA F;  2CNK B;  5D15 A;  3G4S S;  2HNZ A;  4N8O A;  4PRF A;  4I6Y A;  3PG9 A;  3E01 A;  3PJ9 A;  3TUZ C;  5AT1 B;  1H2T Z;  4Q44 A;  1S79 A;  2E1A A;  3VGV A;  2V50 A;  3JSB A;  5M2R A;  1T05 B;  5LMN F;  3P49 B;  5E41 A;  3MD1 A;  4KH1 B;  4OLP A;  4FS1 A;  2UUB J;  3JAM Y;  1PJ7 A;  2OUG A;  3AOC A;  1F9E B;  2FZC B;  2ZIT A;  1CJU B;  4JI3 F;  1QJH A;  3IR5 B;  2QTW A;  4QWB A;  2VUG A;  1VQN S;  4LSL B;  2I5J A;  4I1T A;  3PRB A;  2VBX A;  1KFS A;  1H7W A;  5ETL A;  2H1Y A;  1JNZ B;  4ICL A;  4QBU A;  2DGU A;  2XHW A;  2CJX B;  2MKI A;  2R8I A;  2C2R A;  4NLP A;  5IFM A;  3ZZ0 A;  1R31 A;  3VHQ A;  3CCJ S;  1FNO A;  1UWB B;  2B51 A;  4NYZ A;  3DC2 A;  4ZVO B;  3T6B A;  2XMM A;  2H5J B;  5J2Q A;  1U6B A;  4HLB A;  3DYA B;  3H2V E;  4LRB A;  4F4X A;  4NEY A;  3TRG A;  3P45 B;  4CH1 A;  2Q3P A;  1DTQ B;  3VGS A;  2CNO B;  2HFO A;  2MXY A;  2Z2L A;  1JKH A;  3HFK A;  1GH8 A;  2CQ4 A;  1G4C A;  1RWU A;  3AD9 C;  5CQG A;  3MM5 A;  5DO2 A;  4DUZ F;  4OYZ A;  4ZVP B;  1W25 A;  4C8K A;  2RUG A;  3T9N A;  3ZZU A;  1EIY B;  1K1Q A;  4LF9 F;  3HCX A;  1HR0 F;  3NCQ A;  2JNJ A;  1HL6 A;  1DTT A;  4PKD B;  3KYL A;  4KIA A;  4B08 A;  3BPD A;  2K8G A;  3GLJ A;  4AUK A;  2WVC A;  4QYR A;  4UW2 A;  2WW4 A;  2G2Y A;  4DX5 A;  1DQA A;  3BSA A;  4NLX A;  5AE1 A;  4PWU A;  1HNW F;  4WF9 Q;  1JXE A;  1HQU B;  2ZHO A;  1VQY A;  4BBY A;  3OLA A;  1RTZ A;  1HNV B;  3HHD A;  3GIM A;  4J9N A;  2BAB A;  1WSR A;  5ETO A;  3BBC A;  1ZPV A;  3BR8 A;  3G71 S;  4RX6 A;  2CZ9 A;  5HMZ A;  2L41 A;  4UOH A;  5IM0 B;  4NLW A;  5JXS A;  1U4B A;  2EPI A;  3CME S;  3ZNJ 1;  3PX6 A;  2DB1 A;  1FNM A;  3UCG A;  4WE1 A;  2YWF A;  2QGF B;  3E51 A;  4KO0 B;  4OYO A;  4F3Q A;  4G1Q B;  2ZVS A;  3PO5 A;  4LF2 A;  3Q8Y A;  2CDR B;  1HLW A;  1QTN B;  3DRR A;  3NAH A;  4NA3 A;  2F4V J;  3EGW B;  5LM7 E;  2B5J B;  4RU9 A;  2KFZ A;  2XMW A;  5EX0 A;  3OR2 B;  1RAD B;  4QQB A;  3DMJ B;  3W9H A;  1MU2 B;  2Z4P A;  3EUN A;  1E6V A;  1JJH A;  1T03 A;  3TZZ A;  4HHU A;  5D4L A;  3SQG B;  4ZPA A;  1J27 A;  2BKO A;  4PG4 A;  3P96 A;  5KG2 A;  2J6S A;  2V4J A;  2LXF A;  5J2M B;  1LWE A;  1YBU A;  3R7B B;  1SJQ A;  1LFW A;  1G1X A;  3S6E A;  2WCX A;  2DYA A;  4B17 A;  1KOO A;  4QJV A;  1QSY A;  4C8Z A;  2E9Z A;  3EGN A;  3DDI A;  3H20 A;  1NUE A;  4CT9 A;  3OR1 A;  1R89 A;  2VA2 A;  2YKA A;  4I69 A;  5AE3 A;  4QU6 A;  4ID5 B;  3C15 B;  4DX7 A;  4H4K C;  1HQ2 A;  4C11 B;  2JJ4 D;  2J8S A;  4LBH A;  5ETM A;  4ECR A;  4X64 J;  3DLJ A;  3DRP B;  2NUH A;  3IP0 A;  2H4W B;  3IA0 A;  3NLC A;  1WTF A;  1O0P A;  3DLE B;  5F8J A;  3LAM A;  3O6Q A;  2MZ1 A;  1RXO B;  1ZM4 A;  2QLF B;  1UFL A;  2CJY B;  3QJJ A;  2VFV A;  3R5J B;  3OTO J;  2HHW A;  3FSY A;  1UJ6 A;  3G8S A;  4AXI A;  1HMV B;  4ZJL A;  1U0S A;  4OZN A;  1WF0 A;  5KG6 A;  2F7V A;  2BM0 A;  4C8O A;  2DR9 A;  3NGT A;  5I3Q A;  3P4U B;  2E1C A;  2PD1 A;  1Y11 A;  4WYW A;  4JI6 J;  1RBA A;  2Q1L A;  3G82 A;  2UUA F;  5F8N A;  1Y00 A;  5EHH A;  2YX4 A;  3R5C A;  2MZR A;  2MQ8 A;  3SBM A;  2J9E A;  3MCS A;  3CO9 A;  3CDE A;  3GMG A;  3D7S B;  1AUD A;  2R8J A;  3OTC A;  4DX8 H;  3HKW A;  1C2P A;  4MAK A;  4EO6 A;  1PAE X;  4IG0 B;  2H65 B;  1S1X A;  1LWF B;  3P3D A;  2HS4 A;  2MGZ B;  4QZV B;  2ZDO A;  4ZIW A;  2ZH7 A;  2CPI A;  4Y2A A;  2YY3 A;  3PIP Q;  1KLM A;  3AJ2 A;  3K59 A;  2B7C B;  4HT5 A;  4RWX A;  3KJN B;  3R5A A;  2V5H G;  3LGN A;  2CPJ A;  4DV6 F;  4KR0 B;  1U09 A;  4QWC A;  2XS7 A;  3VAF A;  1C0U B;  1WC6 A;  4CRJ A;  1F9F A;  2CRL A;  4N41 A;  4B3T F;  4OZ0 A;  1EB0 A;  4Y65 A;  4RW6 A;  3HUL A;  4ELT A;  2HMI B;  4WFN Q;  2XSJ B;  3V4I B;  2YKM B;  1FF2 A;  2UXD F;  1TVR B;  6FDR A;  4DU8 A;  2KM8 C;  4C8L A;  2D3U A;  1RYS A;  1YRX A;  3ENW A;  4PCQ A;  1S12 A;  4YR2 A;  3MPW A;  3KK1 A;  2FC8 A;  1DJ0 A;  5LMN J;  5B7W A;  2IMW P;  1RAO A;  1BC6 A;  4Y2M A;  3BKU A;  3NMR A;  4PG5 A;  4P52 A;  1Q7L B;  2CKW A;  1HKA A;  2AYE A;  1WHY A;  4NLY A;  2RDD A;  4JI3 J;  5GAE I;  4FNH A;  1BWV A;  3KNG A;  5KFM A;  4OYB A;  4ER8 A;  4F0K A;  2KZZ A;  2ROG A;  4C98 A;  1MMN A;  1RWP B;  2B9X A;  2JOQ A;  4MKY A;  2DRD A;  2A1B A;  4MH8 A;  3BSO A;  2P8I A;  1WEL A;  2EBG A;  2HFZ A;  1NK5 A;  4AND A;  1HWJ A;  2EK6 A;  2V6A A;  1N5Y B;  1KTV A;  2J0W A;  2UXB F;  1RT6 B;  2DRB A;  3HHL C;  1FD8 A;  2IMO A;  3TR5 A;  1KOH A;  1XJW B;  1RAA B;  2CIM A;  2M0G B;  2HQF A;  2ZH3 A;  4CM0 A;  3GIJ A;  1DZ5 A;  2FVQ A;  1RAC B;  3BS9 A;  2ROE A;  1SJR A;  1X4G A;  4KGV B;  1U1M A;  4RPF A;  3WX8 A;  4DX6 A;  1HBO A;  4DMZ A;  1TUW A;  4DUZ J;  2CJA A;  2AJ0 A;  1P1T A;  5B08 A;  4ZLN A;  1S9E B;  3MPD A;  2MQO A;  1RAE B;  1N32 F;  4LF9 J;  4EU0 A;  5KG0 A;  1HR0 J;  3PKM A;  2UUC F;  3MGJ A;  1NZ8 A;  3AXM A;  1T8E A;  3RB0 A;  1YJU A;  4KFB A;  2YWK A;  2UP1 A;  3NRB A;  1KHW A;  1X5P A;  2HHS A;  4WJB A;  2MKK A;  4K4V A;  1TL1 B;  2HIY A;  1HNW J;  1S4E A;  2KN4 A;  3D66 A;  5HAO A;  3OXL A;  4NCB A;  2JVO A;  2RH3 A;  3QO9 B;  4DF8 A;  5HBM B;  4BCA A;  2Z8Q A;  1R8A A;  2GML A;  1KN6 A;  3R9L A;  4H4M A;  2KM8 B;  1JLE B;  2QFJ A;  2OJ3 A;  3C2P A;  4KE5 A;  4O4G B;  3RGI A;  1FJC A;  3MD3 A;  5C25 A;  2DGT A;  3A12 A;  3DRS B;  2XLJ A;  3CCW A;  3FGV A;  2GGP A;  4TLQ A;  5HLF B;  4DV2 F;  3LP1 A;  3HO1 A;  5IC6 B;  3VAG A;  2BOP A;  2IM1 A;  3EDQ B;  3D6H B;  1RLD A;  3POT B;  2KT2 A;  1EET A;  2V34 A;  4MTP A;  4KV8 A;  1HNZ F;  2JEF A;  1L3T A;  3PM9 A;  3M9M B;  2GIQ A;  1WJ9 A;  5BYQ A;  5GAH I;  2BAN A;  2OIH A;  1MWQ A;  2KO1 A;  4DL3 A;  5CZV A;  1EKR A;  1RT7 B;  2MYF A;  1MG7 A;  3AOD A;  4J9M A;  2V9W A;  1YBT A;  4J9L A;  3CD0 A;  3ISN D;  2GJF A;  1YTY A;  1TAU A;  3ADA C;  3A3N B;  1LOU A;  4N5S A;  2WSF C;  4Y3C A;  4IOA Q;  1FT8 A;  3HT0 A;  2W8K A;  3F41 A;  2GVZ B;  2KXF A;  3BGR A;  2P9E A;  5HRO B;  4EK2 A;  4KKO B;  3JSY A;  2CPE A;  2BE2 B;  4P2X A;  3B4D A;  1TEL A;  2PI5 A;  2ZEJ A;  1LW0 B;  2M2B A;  3MMA B;  3HSZ A;  1X4C A;  3R1L A;  3H0P A;  1S0V A;  2RB7 A;  4J9V A;  2NXU A;  3TZX A;  1SUQ A;  2MLY A;  3MEG A;  2XYP B;  3BBB A;  2XTJ P;  1H2V Z;  3QFW A;  4YR0 A;  2AX1 A;  1BE4 A;  5F8I A;  4O3R A;  4FYV B;  1IVZ A;  2N82 B;  1TV6 A;  4USW A;  4GRS A;  2ZH2 A;  1HQE B;  4CYU A;  2GIR A;  1FJE B;  5IQ6 A;  3D1H A;  4DSE A;  4TN2 A;  4WXO A;  1KDN A;  1NXI A;  4ID8 A;  3CCR S;  2V63 A;  4MT1 A;  3MAA A;  4Y00 A;  2DIS A;  2O3D A;  4GO5 X;  1GMW A;  4WII A;  1FJ7 A;  3OUY B;  2RRA A;  3DXB A;  3DGV A;  1SH0 A;  3BO4 A;  4UQT A;  3G6E S;  2R7O A;  4IG3 A;  4OMF G;  4HH0 A;  3VVU A;  1R0A B;  4ETX A;  1MLA A;  2CQP A;  5IT9 U;  1AXQ A;  2RML A;  2EWH A;  4DF4 A;  3GB0 A;  4EEY A;  2ZH4 A;  1GMU A;  5ETP A;  3W66 A;  2HHP A;  2RUS A;  3UWT A;  3DI6 A;  1RTI A;  5B0F A;  2UUA J;  1ZPW X;  1T7P A;  3N01 A;  2CQH A;  2PDA A;  3KK2 B;  3OLB A;  3KUG A;  4B02 A;  2Z2Y B;  1FFS B;  3I87 A;  2RF2 A;  3KLH A;  2W9A A;  2ZC4 A;  5AXK A;  5KFZ A;  1GTH A;  4QIG A;  2L3M A;  2MZQ A;  2VOD A;  4EBC A;  5EWE A;  3CCV S;  3NMA A;  2FTR A;  1G3O A;  4OYM A;  3ENQ A;  1JLB A;  3Q2S C;  4A8Y A;  3IFE A;  4RBU A;  3A13 A;  1JMT A;  1ZZF A;  4DV6 J;  4YB1 P;  3QID A;  1W26 A;  1GXL A;  2YKN B;  4EWT A;  3OL8 A;  2D9P A;  3GCX P;  3PEH A;  4B3T J;  2DK2 A;  1EHW A;  4USK A;  4ZCI A;  5AXM A;  3QIP B;  2ILZ A;  4ZHR A;  1QSL A;  1R0C B;  2UXD J;  5B0G A;  2E7X A;  4RW8 A;  1Q1K A;  2YX7 A;  2ZJR Q;  1TFY A;  4DQS A;  1IKX B;  2DGW A;  4V1A k;  2LLZ A;  3DOK A;  4F0M A;  3KJQ B;  2VOP A;  3W2W A;  1LFP A;  4TLR A;  1S1U B;  2VD3 A;  1SC6 A;  3HK2 A;  5DQG A;  2ZD1 B;  2EXU A;  4P9S A;  1IXK A;  4DLE A;  4BDP A;  1S9G A;  4Q8E A;  4N56 A;  4Z7C A;  4ECU A;  4IYQ A;  4J9U E;  1XNR F;  2A10 A;  1KP6 A;  2XMK A;  3PV8 A;  3LP0 B;  4ZJQ A;  2AEM A;  2J9C A;  1PGZ A;  3NAI A;  4PAB A;  1F2G A;  3CCU S;  2ZKU A;  3CB4 A;  4ZP6 A;  5B0E A;  2I38 A;  4CM2 A;  4Z7Y A;  2UXB J;  3MFI A;  2PN6 A;  3O2I A;  3PJW A;  2K2P A;  4C7Q A;  4TY8 B;  5KFP A;  3MMB B;  4LF6 F;  1GTE A;  2FHJ A;  3T1Y F;  2RS8 A;  4W90 B;  1GMW D;  1SC3 B;  4NZ0 A;  4ZMM A;  2NXC A;  3D1Q A;  2AZ1 A;  1K0V A;  2ZVI A;  3IRX A;  3QGP A;  1MWY A;  3CJ2 A;  1HWL A;  1HFE L;  1KC8 T;  2MQM A;  3BRE A;  2QL9 B;  3PW7 A;  2ZH8 A;  4USH A;  4WFX A;  1RAF B;  2GHW A;  3C16 A;  4FYW B;  4PEO A;  3DLB A;  2A18 A;  3OL6 A;  2RQ4 A;  2DHX A;  2CQG A;  1EP4 B;  1KWM A;  2EFN A;  3JTN A;  4J9P A;  1YQH A;  3HFV A;  1N32 J;  4YEA A;  1TKZ A;  3HVT B;  2UUC J;  4HDH A;  2DCU B;  5KFA A;  4AFF A;  2VBZ A;  3Q23 A;  2C2D A;  1S5Z A;  3PFO A;  1TL7 B;  1YRU A;  3N5F A;  1CJK B;  3OXF A;  4HTI A;  2YVS A;  3H5Y A;  1YIT S;  4M5K A;  3LAN A;  1FCA A;  1N34 F;  1S6P A;  3R1H A;  1X31 C;  1YVF A;  2GJI A;  2W9C A;  4G1P A;  2NXJ A;  1ITP A;  1RHQ B;  4F04 B;  5KG1 A;  2R7W A;  1FRL A;  4M5G A;  1AZS B;  1SXL A;  3FNN A;  1IUJ A;  1FFW B;  1SH2 A;  3I4H X;  4HEA 9;  4OYI A;  3D54 A;  4RUB A;  4U95 A;  1QY7 A;  2B3T B;  2VIC A;  1I5O B;  4MKA A;  3NGD A;  1VQS A;  4CLK A;  3BO2 A;  3I56 S;  1X4D A;  4DV2 J;  2GFF A;  3M30 B;  2ALY B;  4J9R A;  3SV3 A;  2AJ2 A;  3DXS X;  1UVJ A;  1X4H A;  4K2X A;  4QYZ K;  4OI4 A;  1HNZ J;  2A0F B;  3HDS A;  4CZC A;  2DHH A;  5L39 A;  3K17 A;  3A1Y G;  2Y0B B;  3BKF A;  4AXJ A;  3SDE B;  1U24 A;  2M3D A;  4FYX B;  5KOW A;  2OPQ A;  4Q5V A;  4JB8 B;  3GII A;  1VJQ A;  3NKY A;  4KB7 A;  3PKY A;  3PFE A;  4JV5 F;  2HGM A;  1LXN A;  4DOZ A;  4NLT A;  3CPW R;  3DOL A;  4ZKA A;  4YR3 A;  2BJ9 A;  1ELO A;  1WOP A;  3ZTS A;  4L3N A;  1UA1 A;  4UY8 5;  2FVR A;  3Q22 A;  3CCZ A;  1LW2 B;  3ITH A;  3AOB A;  1T11 A;  3CD7 A;  3M32 A;  4B3O A;  1HBM A;  4H4O B;  2KFY A;  1UW9 A;  3FZ2 A;  4FXV A;  4DZ6 A;  1S6Q A;  4RLE A;  4MFB B;  5CA5 A;  2ZOG A;  1FES A;  4Q0B A;  2YQ0 A;  1FKP B;  2B56 A;  3OTE A;  3H25 A;  1M5P C;  4ZA1 A;  4RNN A;  3D6M B;  2XNR A;  2RKI B;  2CJK A;  2MTL A;  4F36 A;  4RW7 A;  1RHU B;  2HS0 A;  1NSP A;  4HKQ A;  2ILY A;  2B4P A;  2HHV A;  2XC9 A;  3M2U A;  2OTJ S;  4C8N A;  3BGL A;  1T9V A;  4I2Q B;  3WDO A;  5KOX A;  2BE9 B;  2C3U A;  1PC5 A;  2GIF A;  3ZXW A;  3DGP A;  5KT5 A;  1JK9 B;  2GV1 A;  4UOC A;  3GQC A;  5HL7 Q;  2J6T A;  3ILI A;  3I31 A;  5D0H A;  2AP6 A;  3U1L A;  3GR1 A;  1M5V C;  3WIV A;  3SIP B;  3CJQ A;  5U47 A;  1AUS L;  5DG7 A;  2NYH A;  3KLF A;  2BQR A;  3UPF A;  1N4L A;  2VA3 A;  2GS8 A;  4TVA B;  1G6B A;  3PJX A;  4WKR A;  2G1D A;  5HMW A;  3E01 B;  4HVZ A;  3C3L A;  4QWA A;  2KRB A;  3IN5 A;  3UFC X;  2R4F A;  3FRZ A;  3BSN A;  2DRA A;  3TYT A;  4AD6 A;  3MEC A;  2ZUA A;  2H4Y B;  4P74 A;  1B99 A;  1VIO A;  4M5N A;  1CC8 A;  1M5H A;  5DS7 A;  1FXD A;  3GG0 A;  2ERR A;  3OPK A;  1FX2 A;  1VGY A;  3J7Z T;  1F5C A;  3R5D A;  4QYZ J;  4E2F B;  1BQX A;  4PPD A;  3CJ8 A;  1J5O A;  1O51 A;  3P6Y C;  3CDW A;  3AFG A;  3PW5 A;  3TAN A;  2O66 A;  2BA9 A;  2J8A A;  4ZIV A;  3QGH A;  2OPR A;  2VF3 A;  4O0I A;  2M7S A;  1FK9 B;  4ED2 A;  1W7W A;  3PY8 A;  3H5S A;  4NLD A;  4NYO A;  3PR5 B;  2FY1 A;  3W9I A;  5GAD I;  2DNK A;  4NLQ A;  1S10 A;  3IS9 A;  2GQC A;  2EFG A;  1WG1 A;  2DXD A;  4KHM A;  5FD1 A;  4RNF A;  4R5P B;  5DM6 Q;  1KQF B;  1FHT A;  3HF5 A;  2FHO B;  5K5M A;  4ERD A;  1CJV A;  3EIC A;  2RQM A;  4Y6I A;  1JQG A; 
#chains in the Genus database with same CATH homology
 3DGP B;  2JNJ A;  3DOM B;  1YDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...