3DGPB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 19
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3dgpB00
3DOMB 2JNJA 3DGPB 1YDLA
chains in the Genus database with same CATH superfamily
4I0WA 2BANA 3ZTQA 3M8RA 3V81B 2GVZA 2MQOA 1U0SA 2RQKA 1SC3B 4ZVFA 3A1YG 5KG7A 4YHHJ 1VQ4S 1KTQA 2K1RB 5E3CA 1JXEA 2XWXA 2IVYA 1HQ2A 3DDIA 1F0XA 1T11A 4N76A 4RUCA 3BKTA 1XMOF 2CNNB 4RNFA 1CULB 1YBUA 4CLYA 2VONA 4ANEA 2YH0A 4OHZA 3WBZA 2JOQA 2WVBA 3EDRB 2RDDA 4USHA 4KPCA 5HJXA 3DMJA 3CDWA 3CMES 4DL3A 3PCOB 4I2PB 2BJ1A 1X4HA 1NK7A 2EPIA 5T14A 3KLGA 2W9BB 2XO6A 2JX2A 1UJ4A 1HBMA 1HWIA 3DOMB 1BXNA 4PPZA 2X1BA 1BQXA 1FTRA 1HLWA 3IAM9 4K4WA 3MCMA 1YX2A 2L9DA 4NYZA 3VAKA 2DR8A 2HAFA 2N3LA 5GAHU 4QPTA 2NSCA 2F4VJ 5HMZA 2Z2ZA 1KTVA 3LH2S 4OHWA 3MHYA 4X4TA 4J9VA 4MK9A 4TU9A 2VQFF 5FDLA 2XG8A 1NDPA 2MHNA 1UZHA 1MU2B 1S99A 1YZ6A 2R42A 4ED0A 3MM9B 4XTTA 1RWNB 2MZ1A 2XQCA 2VBYA 3DLKA 3M2RA 3GB0A 2P9GA 1WTBA 1WUUA 3OXLA 2IYIA 3POTB 2AEFA 3PYGA 2VG6B 1X9SA 1R43A 2AX0A 1S0NA 3MECB 4I7FA 3UW1A 2N4CA 1UFLA 1I94F 1IKWB 1FNMA 2Y0BB 4KTQA 1U09A 4TLRA 3OHBA 5KFDA 1EX8A 4HVZA 2GA7A 4B17A 2BUNA 4LF9J 2BQRA 2GX8A 1IUJA 3H59A 2ZVSA 4LRCA 1F3FA 4IQMA 4X66F 2VHGA 4AFFA 1TL7A 5KFXA 2UVRA 4V19J 5H9FJ 4Q0BA 3BBBA 2VQEJ 2CNLB 4RBUA 3NNCA 2KHDA 1U0HB 3MEDA 2ZZNA 2G0JA 2C2ZB 5F41A 3W9IA 1D9FA 4NYPA 2VZ9A 2YNGB 4IO1A 4QYRA 1Q78A 5KFZA 4IR1A 5ETOA 3MM7A 4JI1F 4ZVUB 5D6GA 1IKXB 5KFAA 2IVMA 2AEJA 4JUZA 3V6HA 1ACMB 1NNDA 1OYEA 3NS7B 1WC5A 3PYEA 3OHAA 4IOBA 1VBKA 1RABB 3M9MB 4Q5VA 2VJUA 3MURP 3MD3A 2MKIA 3RAQA 2VDHA 3Q22A 1YRXA 1RACB 2DR9A 4WK1A 4IQXA 1U02A 4TNOA 4H4KC 5HQ8A 1XIQA 2LMIA 4NLQA 4JB8B 4PWUA 4NI2B 2X1FA 5J2NA 1GX6A 4X4SA 4KQZA 5MAOA 2FHJD 4W98A 3Q8YA 3B78A 2WSEC 1B70B 1UFKA 2OSQA 3C16A 4DR1J 3PFEA 2PMZD 3IG1A 2CQCA 2AMCB 2ZBIA 1Y5NB 3HI9A 1U6ZA 1HHTP 3MPUB 4NASA 2HEKA 4P71A 2QLBB 1XERA 3N79A 2YPZA 4PRFA 4K50A 3IAS9 2FJVA 1Q53A 5T41A 2KT2A 4TY9A 4PQAA 4CO2A 4DR4F 5KG4A 1RHJB 3D1HA 4PUOA 3O8WA 3D6TB 3HVRA 2LXFA 2WONA 1VHFA 3TW0A 2CQ1A 2RD5C 3K5OA 3CJSA 5C24A 4RUHA 4M94A 4GVLA 3FUYA 1VHIA 3PJ9A 1SBRA 3PRDA 2KH9A 3OTDA 3NBPA 1YJRA 3HX9A 2X7IA 1JKHB 5ITHA 3FBBA 4XO0A 2R7UA 4OHXA 1CJKA 3RRHA 3H2UB 3GLJA 4A46A 1Q0NA 1LFPA 4DPWA 2HKEA 2D7SA 4KGZB 3G8QA 2HQ3A 4O4GB 4EYIB 3H4DA 3I0RA 4KO0A 1C0UB 5G0RA 3IM9A 3T1YF 1PYTA 1AUDA 2JH3A 2YKNA 1VK3A 4CH1A 2YKAA 2JZ5A 1OY8A 2F3JA 4EZ9A 4PZVA 2EC0A 2IBKA 4DU8A 4CLWA 1E6YA 3ETOA 2FZGB 1FKOB 2HS3A 5EX3A 4AXJA 2FTRA 4X64J 4Y2MA 2VG5A 1M5VC 1WDTA 4OZ0A 1T03B 3OTCA 4K59A 5CD4H 3M1VB 4UY8T 5KFTA 1SUQB 1BUXA 1K1SA 4HHUA 1RQ0A 4X4QA 4JV5J 3KUEA 3WDOA 1NZ8A 4ICLA 1N32F 5J2MA 3T9NA 5DDOC 2ASDA 2U1AA 2ZOFA 2JC0A 3I96A 5L9XA 4H4KA 3I5CA 3O1LA 1C1BB 2CAJA 1KDNA 3IS9B 4CLFA 1KP6A 2OGUA 2MMYA 3TAQA 3PO5A 3M8QB 3BN7A 4LJMA 3TVYA 4FF1A 2O67A 1XJWB 2QFJA 4F50A 1RT2B 3B8HA 5A8WA 2VA2A 4ZCMA 5BYQA 1QDUB 4OFZA 5ETVA 2VIHA 4MKBA 3BM7A 4WFAQ 5M2RA 4GVBA 1IJEB 2YXLA 2JL9A 3CJ0A 4O23A 3HVTA 2DB1A 1WSVA 2G1DA 1RTDB 3V4IA 1MN7A 2IRUA 3W7BA 3BS9A 4J9QA 1PG5B 4IRCA 1RSCA 3M30B 2IAJA 2IJNA 1UZDA 2XLIA 3EM1A 2QMUB 1ZOTA 1EAYC 4DFMA 3UD3P 4HLBA 4ECQA 1ELOA 1J5EJ 1LWCA 4OI0A 2UXBJ 2MHEA 1NJIT 1SJRA 1WWHA 2HWIA 1GXUA 1WHXA 3FKBA 5HO4A 3VHQA 4GO7X 2E1CA 3JSMB 5A8RB 1I1GA 2GCFA 5IM0B 1OSCA 3UN3A 3R6GB 4NRTA 5L38A 1JLCA 4MAKA 4FP9A 5B0GA 4QWBA 1KOHA 5J1PA 5I3UA 2LEPA 2FVRA 3GONA 1RYRA 4MKYA 2GV1A 3KMQA 3CD5A 1NKCA 5FLXY 4MIWA 3IC1A 5KT4A 2DHXA 3CO9A 3CIZA 3D1OA 3DRSA 1VMBA 1RCOB 2E7VA 1Y10A 1FD2A 4MYUA 3P4UB 4GKKJ 4TY8A 1B0VA 4USJC 4Q2LA 1R0AA 3M9NB 4A8XA 1Q1KA 1A6LA 3CT9A 4Y2KA 1N33F 1IBLF 4RNOA 4NXNJ 2FD2A 3AODA 1U26A 3D54A 2XBPA 1T05B 3NCQA 2YNHB 1R31A 4FNHA 3C8YA 3LTOA 4QJVA 4R8UB 3W9JA 4LSNB 5JMNA 5EWEA 5H9EK 5DGBA 3KJVB 1GQEA 3T9ZA 1WEYA 3UNGC 3PW7A 5E5NA 2DD8S 2OMOA 4URQU 1JXVA 3BN4A 3PX0A 1N5TA 3A3OB 3HSJA 1NKBA 3Q86A 1H2VZ 4ETZA 1RWPB 1UFWA 2XS5A 4HHHA 5IT9Y 3AT1B 1PKUA 4JI6J 1GXLA 3R1HA 4DL0C 3GMGA 1R0CB 1QUVA 5A6PA 3R5CA 3P3DA 1IBMF 4L6V3 3EGWB 1EP4A 3PXGa 1F60B 4DR6F 4KH0B 2KXFA 2NSBA 2HGLA 3D0IE 1VOMA 1T9TA 1PAEX 2LCWA 4OHVA 2VPXB 4F2RA 4LMZA 1BQNB 2V6AA 1S6QB 2EBGA 1HBUA 4X4OA 1FNOA 4G1QA 1RUSA 2DRDA 2NXJA 4FKXA 4QWEA 5AXNA 3BO3A 5EUHA 4ECUA 3NGRA 5DDRC 2GFFA 2VBXA 3NCPA 1VQKS 3KFWX 5KFHA 1EJ7L 3F41A 3UQSA 4JI7J 4XIUA 5AE1A 3GWCA 4WXOA 1HWUA 2MSTA 3AOCA 4DQSA 3GIRA 2I9SA 5DO2A 5F8LA 2FVSA 2GHVC 1AYEA 1O8BA 1X4AA 1RXOB 1NU4A 1ULRA 4ZPWR 2HK2A 2HHUA 3CULA 3OL6A 3BH7B 4U96A 3AOBA 1UMJA 2BA9A 4DR3F 2CJKA 1DURA 1D0EA 2Z2YB 3RAXA 3DI6B 4K4XA 1DHMA 4IFVA 4DPOA 4L3NA 4KFBA 2YKOA 3T5KA 4ES1A 4LF6J 2R8HA 2J7WA 2D3ZA 4DN9A 3HSZA 3FEXB 1KWMA 2X1GA 4BWJA 4PPDA 3ZTRA 4NYOA 1Q86T 2MSSA 1T0TV 4NLDA 2J8AA 2AZ3A 2M4MA 4DUZF 9ATCB 4JI8J 3MMBB 2LP4A 3AD8C 2ZM6F 2ZC3A 1U1RA 2KM8B 1SKUB 2Z8QA 1RB0A 5CA5A 4OYPA 3IGVA 1EIYB 1Q8LA 1V5VA 1JJHA 4FN5A 2V9WA 1XR7A 1FE0A 4O3NA 1HNWJ 1CC8A 4E98A 4FDFA 3T6JA 1UA1A 2Y1IA 4DR2J 1XNQJ 1BE4A 1O51A 3W9HA 2KG0A 4I67A 2QT7A 4PG5A 1X4CA 5CH7B 2CJ9A 2Q1LA 5I42A 3UFCX 2LXUA 1KN6A 4FYDA 2YVSA 5K8MA 1N8RT 2UXDF 4Q44A 3C19A 4J9SA 1V3SA 3SMZA 4ELVA 1VQ8S 4C8YA 4QW8A 1IR0A 1KR4A 3PW4A 2RSQA 4USUA 4DG1B 3S7RA 2D1CA 3NS5A 3HT3A 1CQNA 1S9GA 2E7XA 5KFWA 4JI3J 1WELA 3EGNA 3WQPA 2I6WA 1IR1A 4DZDA 2GMJA 4QIWD 1RTJA 2DGSA 2R2UA 1HNZF 1RT7B 1M0SA 5I4MA 2KDOA 4ZJOA 1FEHA 2F8HA 2MKHA 1QAYA 3NGDA 3CIMA 4C8MA 3RR7A 3ELHA 5CD4A 1U4BA 3FBFA 4UZBA 2VC1A 3FNNA 3UVJB 2VOPA 4HACB 4ED7A 2V9KA 4LSLA 5LXRA 4CO3A 4JI2F 2A2DA 2DNGA 2KVIA 2B4VA 3CGIA 3JSBA 1X4GA 2OPQB 2P6TA 4CCHA 5CZVA 1QE1B 4I4BA 2ZBPA 1U8SA 3RZAA 4HYKA 2B9EA 2JNJA 4FF3A 4C8KA 4AL7A 2K1RA 1G4CA 3TYTA 4QIFA 4NZ6A 4CYUA 1FRMA 5CXTA 1NDKA 3RBXA 2K7JA 1CULA 2OEKA 5CYMA 2F4VF 4AE5A 4ZPTR 2GO8A 4FYYB 4WFNQ 1FRHA 5MLCV 5L1LA 1S10A 3MGJA 3VVTA 2HAIA 3JSRA 2DH8A 3KLVA 1Y7PA 4M95A 3IA0A 3QSIA 5BYRA 4I2PA 3KTQA 1FK9B 2Z57B 3M32B 4LQ9A 2W9BA 3W8PA 3UD4P 4DQRA 1SJ4P 3DOMA 3DYAB 1FDNA 4LBIA 2K2PA 1K9MT 3NXZA 1LQ9A 1O0PA 2E5JA 4CRJA 3DOLB 4USMA 3QBCA 2DR7A 1U1KA 5J2QA 1UEKA 2M2BA 4LF9F 3LAKA 2HGNA 1MU2A 4TXSA 4NX9A 2WOMB 2LQ9A 2FHKA 4KE5A 3WIVA 3KJNB 4RUBA 4B3OB 1SV5B 3PYDA 4UOCA 4ZCIA 2VQEF 3MM5A 3KUGA 5E33A 1JLAB 1MROB 2P9CA 4A47A 2R9LA 4MTPA 4L76A 3MAHA 1LW0B 3POTA 4WBFA 1MN9A 2VG6A 5E3RA 1R8BA 1Q7YT 1IKWA 2E1PA 1YHQS 4KGMA 3ZZOA 3DM2B 4N41A 4FXDA 1QVGR 1FWKA 4DSLA 4KHRA 3OL8A 2WW4A 2AGQA 1UEVA 2M70A 2B0GA 2B7BB 2ZDOA 3OW2R 1T95A 1UPPA 2IJRA 4F8RA 3DDNA 4F4WA 1U49A 1FWLA 1U0HA 2QMWA 4KIAA 3KLFA 3ENWA 4ECYA 1TL1B 4P7TA 4JYAJ 2HRTA 2AP6A 2CZVC 1FE4A 2GIRA 1S4FA 2YNGA 2A6MA 4YB5A 1UA0A 2C42A 2X3GA 2MGZB 2FIUA 2R2TA 2OLWA 4G1PA 4DR1F 1IKXA 2DGQA 2Z56B 1RYSA 4LSZB 2BJ7A 1KKHA 4J5OA 2JDJA 1HD0A 2NCKL 1N5QA 1S1WB 5E3QA 3EPGA 4L74A 1WSRA 2AEMA 4ECXA 2MQ8A 3DOKB 4QIGA 4C8OA 2LQ8A 2N3OA 2XSFA 3K5MA 4Y2CA 1FHTA 5EHHA 1S0MA 2HHPA 3D5MA 3W5XA 4CNZA 4NI2A 4K5SA 2XB2D 2CPDA 3QWPA 2HG4A 1QUPA 2ZH1A 2WBMA 4OX9J 4IRKA 4DSFA 2E7WA 3MXHP 4J90A 3VAMA 3TX0A 4YP3A 2G1HA 4OI1A 1FEEA 4KYZA 2R2RA 2HQDA 3MTJA 2UUAF 4F0KA 2JLEA 2ZE2B 3H20A 2DIUA 3K8WA 1Q81T 1Q5VA 2HMIB 3MCOA 5HVGA 2HFNA 2L08A 2ASYA 5CCMA 2RE1A 3KLEB 2EK6A 2KKHA 2ACYA 1NEEA 3A3PB 4IKAA 4MT1A 2N4DA 1PO6A 1TVRB 1RAOA 3JTPA 1JKHA 2QYCA 3FCWA 4X64F 2DK2A 3K5PA 2F40A 4BHQA 4I2QB 2IC3B 4B9SA 2EFOA 2PMHA 4RNHA 1C0UA 3HMJG 5IWAJ 2FGOA 3PX4A 4JV5F 5F8NA 1S1UA 6FD1A 3VGSA 2J5AA 2V94A 3BO4A 3QMQA 3RTVA 5DDPC 1FDDA 3ONQA 4ER8A 4CLPA 4KKOB 1KD1T 3BB5A 3X1LB 1UP1A 1AB8A 2CJBA 2MLXA 2LVWA 3EGZA 5THWA 2W9AA 4B3MJ 1J2VA 2RS2A 1N5VA 3DNCA 3BGUA 3ULHA 1XR5A 2LQJA 1FKOA 1PBUA 2PEBA 2XS7A 2WK4A 1JLFB 2DPIA 3F0NA 1T03A 5HBMB 3M1VA 1LK5A 1SUQA 4KAIA 4RU9A 1T02A 2FUG9 2LDYA 2DJWA 1FJGF 4CTAB 4HI2A 2BXJA 2FVPA 2CNKB 4PXCA 3NOCA 3MR3A 3QRRA 5EN1A 2GW8A 4FNIA 1TR0A 4P2FA 1C1BA 3IS9A 2B9XA 1X4BA 1I3OB 1XBWA 1NM2A 2XLKA 4NLYA 4PR6A 3AJDA 2XMKA 3NGSA 3P49B 1HARA 1IQZA 3NRBA 2DCUB 2HS4A 3BDPA 1B4SA 5ADZA 3H25A 1RI7A 3PG9A 3VAHA 4FF4A 2W25A 1YJ7A 1RT2A 1HPZB 3T6BA 2OMLA 2QYGA 2IVFB 2B4OA 1N34F 1QAIA 4DR5J 1U6FA 1LEOA 3RBEA 4DUTA 4Z7YA 4NMLA 3TZYA 1RTDA 1VQSA 2V8VA 5KG3A 1H98A 1WF0A 3M30A 3GR1A 1AXQA 3DLEB 1TV6A 2AGPA 4QR2A 2HPUA 1FTCA 3MWBA 2V2ZA 2DNRA 2ILYA 1RBLA 2PIIA 4FXWA 1FVQA 2GVDB 1UPMB 3WC0A 3LWLA 4BC9A 2DNOA 3THPA 1LOUA 3WC2A 1TKDA 1Q82T 4ZJLA 1R6VA 1TL3B 4OYXA 3JSMA 2GGPB 4NXNF 3CJ4A 5A8RA 3S8SA 4J91A 3U27A 3US5A 3QLHA 1N0UA 2OIHA 1W7WA 1TZ0A 4PCQA 5CHCB 4ZVQB 3NY0A 4ZVRB 2KO1A 3GP9A 1VBYA 1B7FA 3FRZA 4DV6F 2PT0A 2J6TA 1OMSA 3PM9A 4FYXB 3CJ8A 3CC7S 1DQ9A 5L1IA 2XC9A 3TUJC 5GAEI 4X4NA 3CCVS 5KT3A 5IV3A 4EWTA 2V8PA 2B5JB 1TQLA 1AA1B 3W62A 1T05A 4QR1A 1RTZA 4OV1A 2AWZA 2JVOA 2YNHA 1WG5A 4RU2A 3IRXB 4R8UA 2OELA 1REVB 2KM8C 4LSNA 4NLOA 3D67A 2WSFC 4O3SA 3SV3A 4UOGA 3CJ2A 2PFDA 1Q16B 1R6YA 2DR6A 2P6SA 2H3EB 1HWJA 1HR0J 5LT5A 2CFXA 3AA8A 4P73A 2YKQA 4L72B 3GR0A 1TMMA 1F9FA 1SKRA 1NK5A 3IM8A 2GZOA 3LWMA 1ZZNA 4OZ2A 4QWCA 3BJYA 4U7CA 4DPUA 1TL4A 3TI0A 3I9V9 1PYSB 3GV7B 3B6BA 1BQNA 2F4FA 4LRFA 2DRAA 1WC1A 1S6QA 9RUBA 5KFYA 1NB7A 1H0HB 4EZ6A 1W2BR 2DNZA 4DXLA 4R25A 4J9RA 2DEIA 4NXMJ 4ZLNA 3SQOP 1DLOB 2DNMA 1JLBB 4I7FB 4XAKA 3R6LB 4OJ3A 4LF6F 1HI8A 3TQEA 3SSQA 1T9XA 3EUNA 4OI2A 2B9WA 3K0JA 2CPJA 4K5RA 1NSKL 3K5LA 3PW0A 4GO5X 3ZNUA 5DG7A 4WP8A 2E66A 2R7VA 3MOJB 2BV3A 1SL1A 4XK8C 3IBWA 3OSPA 1Y9OA 2L3MA 1FESA 3CCTA 3OL9A 3UR3C 4P75A 4ECWA 1FRIA 5F8GA 1S12A 1HNWF 4WCEQ 3OTEA 1YJUA 3OFEA 1ZYQA 4DR2F 3PIOQ 4IH5A 2DNKA 2PD1A 3I31A 1XNQF 2Z0GA 5KFPA 3QZ8A 3M8YA 3LA0A 4FBTA 2YX7A 5B0EA 1S9FA 3DXBA 1UVIA 1NH7A 2HZCA 3FMWA 1LV5A 2Y1LB 5M2UA 2XMAA 3LAMA 3MMBA 3MR5A 3MEGB 3WIUA 1U1PA 2H54B 1KHWA 4FYWB 3ZO7A 1FCAA 1XQIA 4RR5A 3QQCD 4N47A 3DLGB 3P45B 2KRRA 3EZUA 2CPFA 1WOOA 4DV1J 3TR5A 1S79A 4Z2XA 3HHLD 1UVKA 3A8EA 3D28A 2L9WA 2X51A 4DX6A 2CPHA 2MYFA 2OD6A 1FVSA 1FWPA 1NPKA 2BR0A 2DY1A 4B9LA 4DSKA 5LJ3Y 2IBOA 1P27B 5DETA 3KJQB 3M9OB 2GJIA 2P2CB 1FKAF 1JWWA 5E3PA 3NGTA 1S1TB 4PUOB 2XSJA 1SQGA 4WFYA 2LLZA 4M5HA 4DG1A 5KFJA 3DLHA 2K8GA 3CJTA 3ZTOA 1ZAVA 2BJ3A 1R8CA 3RU0A 2MY8A 1K0TA 2QLXA 2KHCA 2OH2A 1BHNA 4P52A 2PC6A 2QA4S 4TQRA 2ABYA 2FB0A 1YDLA 2FQQB 3FEZA 4EO8A 1RT7A 2DNLA 4RW7B 2MKJA 2JEGA 3HFKA 3T41A 3KOAA 3EWGA 4KO0B 1FFGB 2W2OP 2SXLA 1YKWA 3BZQA 3TJ8A 3BGRB 3MI7X 4ZIVA 2K3KA 2Q43A 5DQIA 1HBNB 4FBUA 2Q3PA 3UVJA 1RWMB 4HACA 5F9LA 2R7RA 5KOXA 5LSLA 1RTIB 4C3LA 3OLBA 2DVIA 4WWSA 3AXMA 1H72C 2EFPA 5FD1A 4DS4A 2VKZG 4HI1A 4RW8B 2H51B 4YEAA 3NNAA 4WKRA 2OPQA 1UJ5A 3KG1A 5IC6B 2I2YA 4ED5A 2BE9B 1QE1A 3GIMA 4M5DB 2B6AA 3DGPB 2IYGA 3EDQB 3ISNC 1CS4A 5FJ4A 4YFUA 2ZJRQ 4LVNP 3HKWA 1HL6A 4ERDA 4JV0A 2DNQA 3Q89A 1LKZA 2QIFA 1DBDA 4ICLB 5J2MB 3Q83A 1QLNA 2JHEA 4Q2MA 2WBRA 4C8ZA 1HIYA 2CQHA 2J9DA 4GC6A 3MOZA 2NUUG 3N5FA 5EDWA 5AT1B 2HQCA 4NMXA 3SCKE 3SFGA 1Q79A 2VICA 2AYBA 1KSPA 1IVZA 4XDDA 2VFUA 1FK9A 5I3QA 3M32A 3N4WA 4IDKB 2AX1A 1J5OB 1WNEA 3EICA 3BQ0A 5A8WB 2MJNA 5AXMA 3CD6S 4C98A 2HZAA 2V0NA 2EFVA 4OJGA 3HVTB 2FPHX 4DF4A 4YS2A 3DOLA 4QWDA 4CI0B 3C15A 2WTFA 1GAOA 2QO3A 1TP7A 2AJ0A 4HH1A 3RB4A 1RLCL 3IO1A 2IAJB 2ZDPA 3Q2TC 1CSJA 2XGPA 3MEEB 2WOMA 5LOQA 3ILJA 1M90T 4MJKA 4YQWA 1NJWA 2CQ0A 3S1TA 4HDGA 4OYBA 4B3OA 4IG0A 1SV5A 2E9ZA 2Z2MA 3N28A 1MROA 4TYBA 4JYAF 4ZVHA 4YB6A 2GAGC 1BLUA 4ZVTB 4ZLJA 4K2XA 2GHPA 2ZFHA 3RBDA 4B08A 3OSNA 3SYZA 5BYSA 4AUKA 2FJBB 1JLCB 4NLGA 2IPOB 2BE2B 2QX0A 3UN2A 2WB1D 2YWWA 3DM2A 1JNRB 1SKWA 3PR4A 4CO4A 4RPFA 4EBCA 5D4LA 2H5JB 2WVDA 2PI4A 2ZJPQ 2NYIA 3SQGA 3CJRA 3IWXA 1S57A 2HBYB 2C3MA 2CG4A 3D6MB 2O5DA 1VGYA 1Q8KA 1JLGA 4TY8B 1WEXA 2R8GA 2H48B 2CYYA 5C7PA 4DL5A 1TL1A 3CMQA 4X62J 4DCJB 5KOWA 4NLPA 1RT1B 2MGZA 3QGIA 2DH7A 2LFVA 5K5MA 2AD9A 4OX9F 1WC6A 4WTOB 3R27A 4KPYA 1VQLS 4ELTA 3PKYA 3HF5A 2J9CA 7FDRA 1BQMB 5KFVA 1S1WA 1T8EA 4C0OC 2HVZA 7FD1A 2F9JA 3LANA 5HANA 2QLJB 3CXCR 2XI2A 1PYOB 4ZPBA 2L41A 2BQ3A 1ZA2B 3E51A 1JMTA 3GV8B 1U45A 2B43A 2VBZA 1I5OB 2QFIA 1VR6A 2UUBJ 1U1QA 2KJWA 2EC2A 3OJUA 2J8SA 1V5IB 4X4RA 1ITPA 1NK4A 3OFFA 2DGUA 3I5BA 2MQQA 4M5MA 2HIYA 2V2VA 5KFOA 4DCOB 2AIRB 2NR0A 2ZE2A 2O01C 2BQUA 2HMIA 5IWAF 2OPRB 2MQNA 3BPDA 2IY5B 2CA9A 3M2UA 3TA2A 1K0VA 5H9FK 2WVCA 4WU3A 3KLEA 2NQPA 2PSZA 3M8SA 3RG6A 3RB6A 4CLKA 3K89A 3K2YA 1ZTTA 2QC3A 4UT4A 4W4MA 1FT8A 4B3MF 3BO2A 1TVRA 2QTWA 4DDFA 1K1QA 2XO7A 5KT5A 3CCES 2KT5A 5JVHQ 4ECVA 3C6TB 3RGIA 4Q43A 5L46A 1YJVA 1T3OA 3QSYB 2Z58B 4WKYA 4Q7AA 3I9ZA 4I2QA 4DFKA 3OQ2A 2IC3A 1U2CA 3KDOA 1W2IA 2R8JA 3L09A 3ENVA 5ETNA 5CABA 3EZOA 5B0CA 4IFVB 3MM8B 1AZSB 2QA4G 2W8LA 2DITA 2Y3YA 5JVGQ 1XNRJ 3H5SA 3GJQB 3TP2A 4DLGA 4JI5J 1MNEA 2BMBA 3DHXA 4KB7A 3ILOA 3RBZA 3LP2B 3DFEA 5L1KA 3KXDA 6AT1B 1S7IA 2HFZA 4TVAB 4ZPCA 5HBMA 4LIRA 1JK9B 3QATA 4B3TJ 3H4BA 1IXKA 3F44A 1H3DA 1Y0HA 4W92B 1RHUB 3GYXB 2F7VA 2Z4PA 4DR5F 4F2SA 1IBKJ 2MZJA 2YNIB 2DT9A 1WACA 4R5PA 4AQYF 3N9UC 5EWGA 4FPIA 3AXKA 3PW2A 3DRRA 4OJ1A 3BEGB 4DV3J 4DL7A 2OPSB 1N5SA 4K2JA 3FK4A 1HPZA 2W7AA 1HQEA 4HEA9 3G87A 2KU7A 1MG7A 2BKPA 3G6ES 3Q8SB 3HXMA 1FXDA 1D8ZA 3K17A 5F8JA 4MFBA 5GAEU 4BDPA 2FLOA 2YWKA 3G71S 2HZVA 2ASJA 2AJ1A 5G4DA 2PFFB 1WHYA 4ZHRB 1F5CA 3DLEA 1RTJB 3IR5B 3IR7B 1RKIA 3M6XA 4AT1B 2GVDA 1HFEL 4ILRA 2EVZA 3EGVA 5HATA 2H5EA 1D09B 1TL3A 1KC8T 4J9NA 1Z1ZA 2UXCJ 2ZHAA 3SBMA 2KZMA 3R5DA 4PG4A 3T3FA 1LFWA 1TUGB 4EU0A 4BS2A 3H5YA 4G6VB 2GS8A 3T1HF 3ILIA 4IRDA 4WPAA 4C8NA 4DQPA 5F8IA 4YR3A 3MCSA 3HCXA 3TUIC 1RT5B 5J1EB 2N7YA 4WFXA 2B3TB 4ZJQA 2EKYA 4J9LA 3OXFA 4QU7A 3WX4A 2RU9A 2Z2LA 3P6YC 4C48A 2E5GA 4E2FB 4NLWA 3MF5A 1TFYA 1FF2A 4CYUB 4IFYB 4Y3CA 2J6UA 8RUCA 2CNOB 1S76D 1N56A 5CYMB 5DQGA 4J9OA 5KFSA 3S01A 2B5JA 3R5AA 1RBAA 4DV5J 1APSA 3IBFB 4QCLA 1VQYA 2HFUA 3LGNA 4WK3A 4MK8A 1VLYA 2HHTA 2CPIA 3IRXA 1WF1A 6FDRA 5IFMA 1REVA 3ZTPA 4UTGA 3H5XA 2AF6A 2QA2A 3AQOA 3RW7A 1NJYA 3QJLA 3I4HX 3D4JA 1UVNA 3V4MA 1MMDA 3DC2A 2BDPA 4CDIA 2EXUA 3G8TA 3HK2A 2X1AA 3V6DB 4NXMF 1RHQB 1SI9A 4ZPVR 2EI5A 3N6NA 2XY5A 1HQUB 2CPZA 3M6VA 3HHDA 1SH3A 5J2QB 2V67A 3GCXP 2VU5A 1VBZA 3MMCA 4F0HA 5A8KA 2JLGA 3QAEA 3RYLA 5HVFA 1QAJA 3UCZP 3JAMY 3WX8A 3MM5B 3CCJS 4NA1A 2BJDA 2IMWP 3CMAS 2J7KA 4CWBA 2VFVA 3SFUA 5KFRA 3ZZ0A 3R2CJ 4FF2A 5IT4A 1DLOA 3KNAA 1JLBA 3KWMA 1PSDA 4NLTA 1GXTA 1Y4ZB 3BSCA 4KGXB 2DIVA 3KK2A 2FYXA 2XMTA 2M8DB 3W60A 1S1VB 3IRWP 3EYZA 1YRUA 2X3DA 2IA0A 4IOCQ 2HVDA 4F4YA 3GYNA 1C4CA 4OX6A 2DKOB 3JQMA 2DY9A 1GMWA 1D3WA 1VRTB 5KFGA 4C0BA 1RAFB 3KLFB 4X2BA 4PG7A 1PC5A 4NZ0A 3FQKA 4DV1F 5HJYA 3TVZA 4DX5A 2GQ2A 4LF1A 5LSRA 1NSPA 2CWXA 1WORA 1SIWB 1WEZA 1NSQA 3F73A 4GKJF 4U9RA 4CT9A 3A8IA 5K20B 1YZ7A 1VJQA 4RWWA 3GCWP 3DDKA 3OTOF 4OYOA 1I94J 3D9BA 2A3JA 2V2KA 3HFZB 3MEGA 1N88A 4CO5A 1P9QC 3EVWA 4NCGB 3DLGA 2CG8A 2QA1A 4RX6A 2BX6A 5KT7A 2PA8D 1LXNA 1X9MA 2JFDA 1BY9A 1S0VA 2Y1JA 2HHSA 1M1KT 2W4CA 5D0RA 1RK8A 1M1HA 3P5BP 2VOOA 3KLHB 4NRUA 3D0GE 2ZWPA 2P8IA 1NRKA 1UVMA 3CDUA 4TLQA 4C0HA 4LRAA 3VALA 2WSCC 2CDRB 3O3LA 2RVJA 4IOAQ 1S1TA 3THTA 1CQMA 3FCHA 5LMUF 3LOUA 3L7PA 3OVBA 4DHVA 3VAGA 3OT9A 1SC1B 1WHWA 3M4XA 3FGVA 4ENOA 3SV4A 2VL1A 3N6LA 5KAKA 2E9RX 3PW5A 2VFSA 2CPEA 2LEAA 2NPIA 3CE8A 4DV2J 4RW7A 4G65A 2W9CB 3AFGA 1TK5A 3HPOA 2GJ2A 1S1UB 3EZ5A 3BGRA 4B9UA 5H1SV 5KFKA 4X4VA 3J7Z5 1N0VC 3TAMA 2R3VA 1HBNA 4U7UK 4RBTA 2XCAA 1UKUA 2XMJA 1YBAA 1MSWD 4CP5A 4OZ3A 4OI4A 1FJEB 1RTIA 2VODA 1F5BA 4OZLA 1U24A 1F2GA 2W7OA 4RW8A 2J0XA 1RU1A 3IWLA 1RKJA 4K4VA 4K4UA 2IRYA 4KJIA 4M5DA 3DGPA 2BABA 4EUVA 5ETRA 4F4XA 3EE3A 3R7NB 4C6AA 1BWEA 5KTQA 1H2UX 3GYGA 1KQSR 2PDAA 2COLA 2XM3A 1REGX 2VC0A 2NZCA 2ASLA 2QSWA 3DRYA 2YX1A 1PGZA 2G2ZA 3NWRA 3VQSA 2HURA 3UWTA 4WTYA 1CC7A 4HT5A 3V6JA 5CCLA 3GFHA 4U95A 4OQJA 1RAAB 3I6PA 2UUCJ 2HHHF 2MQPA 1B99A 1U2RA 4P72A 4IDKA 1J5OA 1FDAA 1NMEB 3GG0A 4OL8A 3V6KA 3ZTSA 2CDQA 1U6BA 4YR2A 1KBRA 3BGFA 4NLRA 2DHAA 3G86A 2IJFA 4FVCA 3L3CA 4NEYA 1H2TZ 3HHKA 2VB6A 1URRA 1K44A 2OTLS 5D3GB 4HHJA 4LR7A 2XYPB 5D77A 1DAXA 2GQCA 3ZC4A 2B51A 1TV6B 1S59A 4USVA 4DSJA 4FKYA 4A8FA 3MEEA 2MZQA 3NWGA 1MW7A 2IM1A 4YY3J 3W3SA 2CADA 4ZMMA 3M8PB 1RT4B 5HP1A 3PEJA 4DWIA 5IQ6A 4X62F 4A8WA 2O66A 4ELUA 5D78A 1ZM9A 1BMQB 2J9EA 4NLSA 2EW9A 3W2VA 3BQ2A 3QLHB 3ET6A 2BE2A 2W4PA 2QEXS 3L9ZA 2JVRA 4Y65A 2OEMA 3VAFA 1T9UA 2DBBA 4ZK7M 3G96A 2RQCA 1C2PA 3GFZA 3I32A 3I5AA 2BM1A 4LREA 3BKFA 2B56A 4L3KA 5HMWA 1S1XB 3QNWB 4WP3A 1XMQJ 2RDJA 2F5GA 2UUBF 1RT1A 2ZH3A 4QYZJ 5D4NA 1ZZFA 2BM0A 3Q23A 2UV8G 4KC5A 2PN6A 1ZPVA 3KK3B 1QSLA 1G2EA 3ZNJ1 1N36J 3C2PA 1RA7A 1NK6A 3M2VB 1OY6A 1BQMA 2PO4A 5SZTA 3RUBL 2QJ3A 1VC5A 3JB9k 2D69A 5E41A 3HHNB 4PQUA 1IWAA 4QWAA 2W7PA 1PJ6A 2R7WA 2HNZB 3DCAA 4Y0FA 1QTMA 3PV8A 4CZCA 4DBQA 4RLEA 1FJCA 5DJBA 2KRBA 2QL5B 3FSYA 3PX6A 1SC4B 1KVKA 1SCJB 5HN0A 1NK9A 4DL4A 2J7UA 3EXYA 2FHOB 1N33J 5D4PA 1IBLJ 4JV1A 1AROP 2HFVA 2YY3A 5DS7A 1B0PA 1C1CB 5AXLA 3B82A 2ZH8A 3I87A 4C7QA 2F8MA 1U8WA 3TARA 4B3RJ 4G3IA 2XY6A 4U8YA 2HW3A 2H9ZA 2ZVIA 5A76A 1NUEA 1RDRA 3C46A 3MMAB 3DU6A 2OPRA 1NSAA 3HD1A 1RE1B 5B08A 2HS0A 3PNIA 4KRWA 4RUAA 4V19X 1VISA 1WC3A 3NAHA 2PI5A 3OUYB 4JI5F 2XHCA 1DZ5A 1AW0A 3G9CA 1EETB 2LECA 2VDIA 2CJXB 2DGWA 3C6TA 1RU2A 4BWMA 5HVHA 3QIPB 4AXIA 2CPXA 3CO0P 4C2MA 2W2PP 1XTZA 3MTKA 1UWBA 3KG0A 3KMSA 4PWDB 1OPIA 2JLFA 3GFXA 3MM8A 3FBEA 4ED4A 4UOHA 1AZSA 1IBKF 3MPDA 3W2WB 1DY3A 4ECZA 3E8OA 3U1NA 1IM6A 1RHMB 1A0OB 2WVEA 1N4LA 3H42A 3G6XA 3HT0A 1HI1A 1T9WA 5JXSA 1HNIA 1PIEA 2JWNA 2VJVA 3LP2A 1FDBA 4W90B 2FJAB 1HI0P 1NAQA 1JJ2R 4DV3F 2F9DA 4KY3A 4CH7A 1V9OA 3MEKA 1UJ6A 2OFHX 1DJ0A 1ZM4A 5IS2A 2CUYA 4OV6A 4EI2A 3CCQS 2J9DE 1VC6A 4HR2A 1PJ7A 2V5HG 4CM0A 4RBVA 4YDXA 2YNIA 2W01A 3MPVA 4DX7A 5K8PA 4UZCA 5ETSA 2LDIA 2MKSA 3CNQP 2F1FA 2HQIA 1HA1A 3MZIA 1HHSA 3F56A 3TOQA 3CCRS 5GMEA 2OPSA 1MLAA 4FXVA 2C2NA 2AW0A 2WHOA 1KOOA 1UTAA 2XSJB 5KG2A 2AZ1A 2UXCF 2YQ3A 2FLNA 1NB2A 2VH7A 2RKIB 3WHIA 3U1LA 2ZD1B 3Q8RB 1V6HA 2O1PA 1NJZA 2KVQE 1VQPS 3VZIA 3TX8A 4ZHRA 2KYZA 4EGLA 1S6UA 4IUFA 3FFIB 5A0YB 3TA1A 4YHHF 1VI7A 4GMKA 3JSYA 2VF3A 2BJ8A 4B02A 4NCBA 3QJJA 1O5JA 3UI3A 2ZH7A 1IM4A 2UUWA 2F65A 2IHR1 5DRKA 5J2PB 2DO4A 1FKPB 1RT5A 5J1EA 4F36A 2I38A 1EQ0A 3AQPA 2POKA 1SIZA 2D9OA 1HW8A 1LWEB 3AB4B 3BGOP 2B6AB 4U7UD 1X5SA 2ZZTA 1Q8IA 3AH6A 3RB3A 1CS4B 1TK0A 1F9HA 3SEOA 2CRLA 1CVJA 5DLFA 1HYSA 3GSDA 1HNZJ 5L1JA 2LU1A 5SUHA 5AE3A 4IYQA 4IFYA 2RF2B 3BYPA 3R7BB 1NPPA 2G9OA 3IWNC 3HJFA 5KT6A 5B09A 3NEKA 2H4YB 4OI6A 2XYGB 1ZTWA 1DTQB 2V2QA 1JLEB 3GPAA 4QW9A 3I82A 1RWOB 2EBEA 3ZZYA 2C3UA 1HKAA 3CPWR 4JI2J 1WG1A 3DU5A 1ZETA 1IBCB 1KS2A 4LVOP 2HBQB 1RT6A 4ED1A 1URNA 1IN0A 2V8GA 4HTJA 4LRDA 3CEDA 4CO0A 2XY7A 3GE9A 4LR9A 5F0WA 4C11B 5BR8J 4CT8A 4F0MA 2MKCA 2DYAA 3V6DA 3IXQA 4IR9A 4A48A 4DQIA 2XMVA 1M5OC 1TUWA 4GRSA 2B8PA 2H1YA 1HQUA 4L75A 3C15B 2RT3A 1WTFA 1ZS6A 1ZH5A 2NS1B 3QPIA 4HT7A 4YOEA 2LA4A 1TU0B 2B7CB 2HRYA 3PTWA 3G8SA 3MUMP 5LJ5Y 2AT1B 2Y8YA 4EMDA 4ECSA 1KQKA 4K4TA 1HNVA 2BJEA 2YKMB 3K8VA 2AYEA 1OO0B 4IG0B 3UDVA 1Q8BA 2XLJA 2XNRA 2DEJA 1ZA1B 3M7VA 2HLUA 3LUYA 4YMEA 2H4WB 1WJ9A 3H0PA 1G7CB 1QJHA 1RCXB 4A8MP 4LQ3A 4CM2A 4QIEA 2ZBRA 5C5JA 3TEGA 1C4AA 4ZVGA 1LW2B 2JRSA 3J7YU 1P1TA 1Y00A 4O3PA 1S1VA 4HDHA 2IFXA 1PILA 2I5JB 4U6PA 3N01A 1YJTA 2OTJS 4DX8H 3E01B 1L3UA 1GX5A 3J80U 3SQGB 4F67A 3HM9A 5KG0A 1GTHA 1VIXA 1VRTA 1HBOB 3NOGA 4DPXA 1JLGB 1EB0A 3CF5Q 2ZJQQ 4C97A 4YB1P 5GVQA 3MPWA 4ATNA 3CJKB 3MR7A 4RW9B 3QT8A 7AT1B 3FBCA 2KL8A 4ZN1A 4LF4J 4C3MA 2B9YA 3PIPQ 2RHSB 2ZH2A 4I6YA 2DXFA 1UW4A 2A0FB 2XZDB 5ETQA 3CVKA 1X5TA 2BW2A 3K57A 1DARA 3PJWA 2IM3A 2JEFA 2C2DA 2W2QP 4EYHB 4A8KA 3T5JA 4IG3A 4NCGA 2MZSA 1X4DA 1KEKA 4B9NA 3NNHA 3GIIA 3R9LA 1WKLA 4DZ6A 4ZPAA 2OPPB 2HSEB 1YVFA 1OS5A 1AT1B 4UW2A 3E3XA 3KK1B 3OTBA 3HZGA 3UN5A 4DJBA 2JFKA 4I69A 8AT1B 3OBIA 3AA9A 2P9EA 4WP9A 4K4YA 3KLHA 1V3RA 4I6WA 1CLFA 4DV2F 1VBXA 3NGKA 3L7OA 4F3OA 4OX7A 5T7LB 1SH0A 3O2IA 1RZMA 3ZXWA 3UCGA 1B0TA 4R0EA 4N5SA 4YDDB 3M2UB 1XWLA 2HGMA 5F0UA 4EFAC 1GTEA 2APOA 3PRVA 4ZCLA 1DTTB 1S97A 4EBEA 1S0OA 1DFDA 3C6UA 3VF0B 3BR9A 2XS2A 1F6TA 3CJQA 1X8DA 5K8OA 2R2SA 2UP1A 1NO8A 3IGNA 1OQ3A 5KFLA 1RAHB 3QO9B 2YWFA 2W9CA 4WZMA 2ADCA 5KG6A 4ZP6A 3DRPB 4JI4J 3GJRB 1UEUA 3OR2A 2NXNA 3N5BA 1SJ1A 4JI0J 2UUAJ 3BYRA 2E1MC 2I0XA 1CPZA 8ATCB 4Y6IA 1PJ5A 4LT6A 1NDCA 3EPIA 4N56A 1LXJA 5B0DA 4NWBA 1G3OA 1YIJS 4OZ5A 3R5BA 1SJQA 5LMNJ 1OJ4A 3D3BJ 2GAHC 3H7HB 3ITHA 5E3AA 2CWKA 2UUCF 4NA3A 4MH8A 2ZBCA 4URSA 2DGVA 1B64A 1CJUB 3SDEA 2ZH4A 3MAQA 4LFCJ 2HHVA 4WZQA 4NPOA 4D3HA 5K14A 4WE1B 1TMJA 3NG8A 4CO1A 4KH1B 1UW9A 4JP8A 1HWKA 3D2WA 2HQFA 4CLTA 1F2HA 4UQTA 4R5PB 3JYTA 4OLPA 5RUBA 3BR8A 2WW8A 4K0KJ 3GU0A 3AJ1A 3A8JA 1R8AA 2ROEA 2ADBA 4BC7A 2RHQB 2IDEA 2WRMA 4P6QA 3DRRB 2RDIA 1OY9A 4C8LA 1J5EF 4X4UA 3CDBA 4PABA 2UXBF 2VPZB 2FJDB 5KFUA 4YY3F 2YWHA 4TKTA 2VD3A 1Z4UA 1L3VA 3MFIA 1DQ8A 3EXCX 1HQEB 2FDNA 3KHHA 1U7LA 4WXWA 2I8EA 1EARA 1VRQC 3G82B 4CLSA 4G1IA 2A6OA 4DQQA 4MFBB 2DPJA 2Y0SD 1MMLA 2DHSA 3QIDA 3D66A 5D3GA 5ETPA 1FJGJ 3HSDA 1QTNB 1N54B 1VRUA 1RJJA 2R7SA 1TKZB 5D0EA 3BH6B 3KUHA 1ZPWX 3H90A 3I0SB 4CLZA 4AD6A 2MKKA 3UDLA 4A8QA 3CC4S 3HVAA 4GKKF 5KFEA 4ILMA 2E29A 1RWXB 2EFQA 2RILA 4DMZA 3M8PA 1RT4A 2ZHOA 2V8DA 5E7OB 2RS8A 2BBEA 1TELA 1XMQF 1ICEB 2KYXA 1RAEB 3BPSP 1SH2A 3FDSA 1RAIB 3R1LA 4NOHA 3LP1B 1NJXA 1NBEB 1N5YB 3NCRA 4D3GA 4DV4J 2Q79A 1N34J 1N36F 2Q6CA 4O44B 3FSXA 2VV5A 4HTIA 1JLQA 2MEWA 2ZH5A 2RMLA 1WF2A 1VQ6S 3SCJE 4CLLA 2BYCA 5HI7A 4MMOA 5HAOA 2FJXA 3L95X 3J7ZT 3LGMA 2U2FA 1HWLA 2MDAA 2CQ3A 4KT0C 3BGLA 4NLVA 2CIMA 5CAAA 2J76E 1S1XA 4K8RA 5BJRA 4NEZA 4JI6F 5HROB 3C66A 3QT7A 2HVIA 3EX7B 2VASA 1WDDA 4A8OA 4Z7CA 4M63A 4NLUA 3EVMA 1M5PC 4CLUA 3E2EA 1UCNA 2V69A 4MKAA 3KK3A 3ADAC 4M8LA 1K73T 3M2VA 2JEIA 4B3RF 3IBCB 3BSNA 2W8KA 2G2OA 4S0MA 3I55S 4DR7J 3PY8A 1IKYB 2HNZA 3SZ2A 2BKOA 4CNYA 3IN5A 2Q66A 1D9DA 4JBCA 4ZDNA 2D9PA 2J0WA 4DV6J 5GMDA 3T5HA 3AAWB 1ZM2A 1WOPA 3CCSS 1RAJA 2ROPA 2CXEA 4NZ7A 1U1MA 1WD6A 1FERA 1PAUB 3UPFA 3K7RA 3LQVA 4QIVA 1YGYA 3ISND 4JI7F 5DZ6A 2XI3A 1HHQA 4KGKA 1S6PB 5IZHA 4UUWA 3MMCB 1RTHB 2EFNA 5A8KB 1C1CA 3TZWA 4ALZA 2JJ4D 1L3TA 2QLFB 3G4SS 1PCAA 1NK8A 1GEHA 2YQ1A 1RADB 2MJUA 1TTHB 2OAUA 3MMAA 4O3QA 3D6HB 5D8HB 3CCWA 1BGXT 1GNKA 1YI2S 2G0CA 3FVYA 1NZAA 2FLLA 5DLGA 1HMVB 5IV4A 2DHHA 3KK2B 2H5IB 3HKZD 2YQ0A 5HQLA 1G6BA 3PACA 1FRJA 4MIAA 2XWYA 2CQBA 3OUYA 3UDCA 2N82B 5GADI 4C9DA 5D0GA 1EETA 3VR1A 4U8VA 4JI8F 2ZNZA 2EEYA 2HVHA 4DL6A 4PG8A 1S48A 4B9MA 2LQBA 2YWEA 3HVWA 1Y5IB 2K7KA 2IDLA 3QIPA 3FQLA 3LP0B 4LF7J 2M5YA 3HJVA 5CYQB 3Q8PB 1VQ9S 4WF9Q 4J37A 4ZKAA 4M5JA 3SSRA 1TKTB 1SVDA 3VWSA 4DV0J 4PWDA 2LKZA 3LF0A 3ISZA 1YJWS 3TRGA 3THVA 2NXUA 3W2WA 2OHDA 3FMBA 4PYAA 1QSSA 3P8BB 2FHJA 3CSKA 3U02A 1IKVB 2YPYA 3U1MA 2DH9A 5IOLA 1T9YA 1VFJA 1D1UA 1RP5A 4J9PA 1RHRB 1NHUA 2ZKUA 1L5UA 4QBUA 2MLYA 5A2QU 1UVLA 4LBHA 2JSXA 4U67Q 1X7VA 1YG0A 3PZPA 4P9SA 1YJ9S 4P2SA 2D3O1 3GILA 3TUZC 1X5PA 1YTYA 3W63A 2DXDA 4F7VA 5C25B 2XZWA 2CQIA 2V4RA 4JI3F 2CZ4A 1TKXB 2MTLA 1UL3A 2Q6BA 1UETA 2CPYA 3MM6A 3CDEA 4AL5A 4MK7A 3UD5A 4ZVEA 1FX2A 3KLIB 2HNYA 3JS9A 1TAUA 2FZKB 3BBCA 5E2QA 2XYHB 3TNVA 4KSEB 1KNZA 3TZXA 4C3KA 2RKIA 5HSPA 1M5HA 2VBWA 1P8GA 1CJVA 2ZD1A 2XTJP 1GFWB 2GIQA 5DG9A 2PMWA 3DRXA 4ES3A 1X4EA 4DUYJ 2DRBA 1NK0A 3O6QA 2AJ4A 3OLAA 2C28A 4UQGA 1FJ7A 1A9NB 2FC8A 1F5AA 4YR0A 1S77D 5GAGI 1FA0A 4ILLA 3W5YA 3FFIA 4YB7A 3CUNA 5A0YA 2QMXA 5LXYA 2YNFB 4ID5B 5KFFA 4N7TA 1VIOA 3EMTA 3TAMB 1OPZA 4O3RA 1FNXH 5KFQA 2RAQA 1IWGA 1FRLA 3S6EA 1FFSB 4N77A 3C14B 1Z2LA 3VGTA 1G1XA 2MKYA 5HLFB 3QFWA 3L4BC 1QSYA 5J2PA 3J81j 3VAIA 1FKPA 2HVEA 2GMHA 3CD0A 2OI2A 4DLEA 2W2NP 1LWEA 2Z30B 3T1AA 3GJTB 3W5ZA 1WKKA 1R7IA 1S9EA 2J6SA 3Q2SC 2CJQA 2V50A 1RHKB 5BR8F 4OZ1A 2UVWA 4DPYA 1E6VB 3V81A 2RF2A 4NA2A 2UVUA 3ILLA 4WFZA 4F3MA 1SQFA 2YKPA 3AJ2A 4DFPA 2HLTA 2DR5A 1KLMB 4PXDA 1VK8A 3NL0A 4KGVB 4TN2A 1PC4A 2NUHA 3DLJA 2R7XA 3B4MA 4I68A 5B0AA 1DTQA 4MIBA 1HD1A 1JLEA 2KI2A 1WI8A 3R7SB 1FD8A 2FZCB 2BRKA 5C42B 1JIHA 1TFWA 1IJFB 2W2MP 1B3TA 2ALYB 3SCLE 4QZVB 3QZ7A 4Q8FA 4P2XA 5DDQC 4C11A 2R7QA 2KJVA 4F4KA 1KFDA 4H4MB 2E5IA 3CDAA 1RT3B 3SXLA 2D3UA 4OMFG 4LFAJ 4O0IA 2FC9A 2M9KA 3CD7A 2W4DA 2BJ9A 3N0VA 3IR6B 2EG2A 4QR0A 3NP5A 4TYAA 3GZ7A 1X9WA 5H9EJ 3TA0A 1KONA 1CJTB 2W24A 2OSRA 2PGCA 1WOSA 2YKMA 4I1TA 4RW6B 4H4OB 1BC6A 2HFOA 1CEZA 3CJ3A 5HP1B 3CJ5A 1RAGB 1HNXJ 1VDHA 2E44A 1B7YB 1RWUA 5ETMA 4LIWA 3NKYA 3MM9A 3D7SB 4XPCA 4LF4F 4OYWA 3W2VB 3ET6B 1SL0A 1X4FA 4RW4B 3OR1B 4CH0S 4ED8A 2YBVA 2G13A 2MQMA 5DG8A 1YK9A 5DM7Q 4OYAA 3HDSA 3Q8VA 1LW2A 3MECA 4LFBJ 4ZIWA 2I5JA 4FZVA 3E01A 5IT0A 3DLLQ 4F3QA 1BD6A 2C2EA 1VQ5S 3O44A 4KHPJ 2CQ4A 5JUMA 4ED3A 3QWUA 2EK1A 3ZZZA 1EKRA 1HBOA 3QGPA 3W8GA 4PXBA 4OZJA 3ZZRA 1OWXA 2KXNB 2RIJA 3OFGA 3CJKA 3ZZTA 2CZ9A 4EO6A 1EKSA 4RW9A 3HLUA 3HFVA 4P74A 2B4UA 3KHGA 1D8YA 2V34A 1S6OA 5CQGA 3MAAB 5HMXA 4J9UE 1UAWA 1KFSA 3KDNA 1M5SA 3VV2B 4M5LA 1Q4RA 2NYHA 2XZTB 4USWA 3RAMA 5DM6Q 3QJPA 1AUSL 1AFIA 3UE2A 4PQUB 4WJBA 2CQDA 3J80Y 2KFYA 4PXEA 2VG7B 1WKJA 2DTJA 3PKMA 3Q24A 2C2RA 3EJMA 1GMWD 1MMNA 3ZZPA 3P5TL 4DPTA 1NXIA 3SI8A 2RB7A 4C4WA 3DN9A 4DSEA 1NHVA 4CIOA 4J9MA 2OPPA 2QRRA 3VCDA 2AV5A 2V4QA 5D15A 2M88A 3KK1A 3MPYA 2KTQA 3K5NA 2OJ3A 4PEOA 2BE7D 1R27B 2W1BA 4J9KA 5L8RC 3A3NB 1U48A 5F3ZA 2DISA 2WZ1A 3RB0A 5IC4B 3MCNA 2QZ8A 1U47A 4DOZA 2YWGA 5T7LA 1WG4A 3BBFA 5KFIA 2ERRA 5B0FA 3H98A 1PBAA 1KLNA 4JI4F 5AXKA 4HKQA 4X4PA 4LF2A 1I6JA 2VFTA 4JI0F 3NAIA 1OIAA 1XN9A 1SKSA 4Q45A 3TJ9A 1QM9A 3WZ0A 3A13A 4M1KA 3W1YC 3I56S 4AL6A 2E5LJ 1T3NA 1DTTA 1T9VA 2QSFA 3L7UA 3ZZUA 2C22A 5HL7Q 2ZUAA 4X65J 1RA6A 2GNKA 3ETMA 5LMNF 5U47A 2VKRA 5EX0A 3PRBA 4B3SJ 1FO1A 1Z2ZA 4ED6A 2XMWA 3QO9A 2R4FA 1TK8A 2LEBA 3R2DJ 1UVJA 2ZUGA 5LM7E 3W66A 1UWBB 1H74A 4JV2A 5AJ3J 4LFCF 3DRPA 3OD2A 3TEHB 2R8KA 2CKWA 2ACMA 4DEZA 4LF5J 3MDFA 1LWFB 2HBRB 2QN6B 4O4GA 3T5LA 1S4EA 1U2FA 4ZP7A 3HHLB 1VQOS 1F3VA 4OIXA 4K0KF 4USIA 1NPRA 4IH7A 3BV8A 1MWZA 1HNIB 5B7WA 2EWHA 4UOFA 4URGA 3HHEA 2F8EX 2OUGA 4OHYA 2KB2A 2V4JB 1VQ7S 1CJUA 2VPWB 2ATLA 2ZWOA 2IM2A 3TAPA 4FVMA 3I4PA 1IR2A 2E5HA 3AY0A 4WE1A 1SB6A 2UU9J 2VA3A 1U1OA 2HNDB 4OYZA 2BOAA 2OP5A 2BOPA 4ZITA 3CCUS 2G0IA 4KV8B 3GV5B 2DNYA 4I56A 3W61A 3KNGA 2JEJA 2YTCA 2HHWA 2FVQA 3AD7C 1EQMA 3DKDA 2AHOB 4TQSA 2XEXA 2HQGA 5IXUA 1ROFA 1OYDA 1YJNS 2OFGX 2B4PA 2Y9HA 3J81U 2ZH6A 5BXIA 3PHTA 2CJYB 3M8QA 4P2MA 2CQ2A 2AKWB 2IMOA 4WYWA 3QRPA 3G82A 4ANDA 2RJZA 1KQGB 3QT6A 4DV4F 2QE5A 1JXLA 2FVCA 1X60A 2BRLA 1SQEA 2D41A 5ETKA 1H7XA 1JJCB 2ZNYA 1TKZA 4F4AA 3OPKA 2HRUA 4LF8J 3I0SA 5C2GA 4AQYJ 1N6QB 1GMUA 1OQ6A 1EHWA 1FI4A 1HW9A 4O4RA 4X84A 4ZP9A 2J0SD 3HD2A 1JJ4A 1TL5A 4OYMA 1OSDA 2LYVA 1YWXA 2XNQA 4K4SA 3Q8QB 2PEHA 3LP1A 1X0PA 5HMYA 1L3KA 1KRPA 2RUGA 1QD1A 4DN0A 5DZ7A 2C2MB 1N5YA 4M5IA 1C0TB 1P6TA 4Q8EA 1FX4A 4KBIA 1XEZA 1N48A 4WFBQ 3M8ZA 5DQHA 3GTYX 5IM0A 1RISA 4O44A 1WI6A 4Y34A 3OVAA 3D1QA 4DV7J 3K59A 1O6XA 2R7TA 2A10A 4F04B 4DR7F 3MR6A 1R89A 3OVSA 1HYSB 3PJXA 1SJ3P 2G4BA 4ITSA 2CVIA 4ZVPB 2MPUA 1Y3JA 2BANB 4BBYA 2GVZB 1R8PA 1HR0F 5HROA 5KT2A 2RU3A 2M0GB 2CQGA 2Y1RI 2O3DA 3TUPA 2DO0A 4F02A 3BDEA 4E8UA 4OYIA 2MZTA 1RWKB 3BQ1A 4OZNA 3GG1A 4A8SA 2XMMA 1Q5YA 4ETXA 1NDLA 2E1RA 3T1HJ 2QGFB 1YRTA 1F9EB 1RT6B 2LQ5A 3DMJB 4O0NA 3SSSA 1IKYA 3KJVA 5GADU 2DNNA 3JAMU 4F25A 4ZS6A 3KLGB 2ZBQA 3VGVA 4EEYA 3A12A 3D0HE 5ETTA 4P7VA 3GIKA 1HBMB 1H38A 3R8YA 4K4ZA 1FRKA 2V68A 2V8HA 4PKDB 4Y2IA 3MR2A 1XMOJ 1S6PA 4FS2A 2QL7B 3RW6A 3KHLA 1RTHA 1H6KX 1R0BG 1I51B 4QOTA 4ID8A 4A4JA 1HNVB 5DGAA 4LF7F 2LA6A 5FDLB 4A8YA 3H8YA 2GQQA 1VLOA 1RLDA 2CQPA 4DV0F 4Z37A 1ZM3A 5L9NA 3MFHA 1VCTA 4P10A 2ZH9A 3QGGA 3ICLA 1FFWB 3FC9A 2ALZA 2C3PA 2YX4A 1S49A 3DLKB 1HMVA 3M2RB 3GQCA 3VQTA 4I64A 3HZEA 3TJAA 4M5NA 4QU6A 2XGQA 2BZ2A 4QYZK 4UUXA 3FJ2A 4ZVSB 2C3OA 2CJAA 2MLZA 4QQBA 3Q0AA 2AJ2A 4F4ZA 3HO1A 3ZFVA 3AOAA 2GJFA 1LWXA 2KN4A 1D9AA 2VQFJ 3LP0A 3KYLA 1R3NA 5CYQA 2QLWA 4NL5A 1TKTA 3QFHA 2RRNA 5GAHI 1XK8A 1TL7B 4PAAA 1V3ZA 3QGHA 2K3IA 1JX4A 4Q0BB 3D68A 4RNMA 3MEDB 5K8NA 3U7JA 5F8MA 2C3YA 3BF4A 3J7AN 2LU2A 3DI6A 1GMVA 4UY85 1IKVA 2AJQA 1SL2A 2ATCB 3MM7B 5E0OA 2EG1A 4XPEA 1X0FA 5F9NA 4NCAA 3TQ1A 1FXLA 2HHQA 4LUBA 1ZBTA 1RWWB 2FLPA 4DU7A 4IG3B 2BACA 2EKNA 2DNHA 3J7YI 3KKFA 3H40A 3R5JB 4X66J 2MQLA 4QPXA 5GAGU 3W65A 4DFJA 3RR8A 4N8NA 4TU7A 2FY8A 5C25A 2CVEA 2RRAA 1TKXA 4DUYF 3AHPA 5J2NB 4ECRA 4MKVA 5AE2A 4JI1J 2DGXA 3FZ2A 4WIIA 3C16B 4OJHA 5KG5A 3KLIA 1A7GE 4GKJJ 3IG1B 2UUTA 3R97A 5LSOA 2UZAA 2HHXA 2E1AA 2UVVA 4RKUC 4YUDA 3OTOJ 5A2QY 4USTA 3CTRA 1FXRA 5D4OA 2GIFA 2DNPA 2M3DA 2GHWA 1XR6A 4ZOSA 4ZCKA 2RNEA 1NLKL 2KT3A 2AYGA 3PEHA 3AB2B 5J1NA 3HSGA 2YH1A 3C6UB 2RQ4A 1KQFB 2WONB 3TWZA 5KFNA 3ENQA 3MUVP 3CB4A 5KFCA 2KXHA 3RJMB 3PR5B 5CYJA 5C24B 3OXGA 2P5VA 4E0DA 3NBPB 1GT8A 5KFBA 3OR2B 1CJKB 2YNFA 1VJWA 2C2KB 2HWHA 4ID5A 3PO4A 2ZC4A 1CG2A 5JJBA 3I0RB 3M6UA 1M1GA 4PG6A 5G0RB 3C14A 4FYVB 1JNZB 5IQQA 4RL1A 2IM0A 3JXOA 4DR4J 1SXLA 5HLFA 5LMUJ 2YKNB 4L73A 3ITHB 2NXCA 2AJFE 1RGVA 3BKUA 4ECTA 1YSJA 3QAUA 2KFNA 1KVJA 3X3UA 3SDEB 3CWJA 1E6YB 3LO3A 4M5GA 2KZZA 4DCPB 2ZOGA 1U1LA 2BKNA 3OFHA 3R3TA 1AFJA 5K14B 2VG5B 5A6WA 1E6VA 4HL9A 2E9TA 4UF4A 3ENAA 4LFAF 3A4TA 2MY7A 4DI6A 2HBZB 3JYTB 3SCIE 1KLMA 2HIQA 3NMAA 4Y28C 3T1YJ 3T19A 3NGUA 2NXEA 3GIJA 2FHMA 1P9YA 2RH3A 1J27A 3FCVA 4RO0A 1M5KC 2OO4A 3SIPB 5GMKa 4KHMA 5C42A 4HH0A 3PYFA 3BSOA 4EBDA 1WHVA 2HWTA 4NLXA 1HNXF 3B54A 1S5ZA 2L9NA 3FRYA 4H4MA 4ZP8A 4ANCA 2WB4A 1RT3A 5CZXA 3M6WA 3VTIA 2RUSA 2IRXA 3JQKA 5C2CA 2WVFA 4B9VA 3CCZA 3DYAA 1NCLA 2ROGA 4ZLLA 2KG1A 2K06A 2DGOA 3H5UA 2M7SA 1VRUB 4GVBB 1N32J 4LFBF 3Q8UA 2IA6A 4OLOA 2HYIB 3BREA 3PVXA 2ILZA 3V4IB 1CJTA 5K9FA 2ZITA 1YBTA 4KHPF 5FLXU 3M05A 3AD9C 2OD4A 3D6FB 1Y11A 4RW6A 4H4OA 2HK3A 4GC7A 3G6YA 3MD1A 2AYMA 5LL6d 3UNYA 1LWCB 2HHHJ 2R8IA 2M52A 1T94A 2AQ4A 1KVIA 2ZHBA 3LPYA 4DF8A 1BWVA 1JLAA 2JC1A 4LBPA 1QVFR 4RW4A 3OR1A 5ETLA 3G2XA 5KG1A 1LW0A 1SPBP 1TUVA 3DLBA 3JTNA 2FJWA 5L39A 3MUTP 2D74B 1JLQB 1JQGA 2WCXA 2C1EB 5D0HA 4DL2A 2NREA 3GJSB 5I3UB 4H54A 4ZVOB 1H73A 3FSIA 4OX8A 2DXEA 2VFRA 3DRSB 3B4DA 1NH8A 1VQMS 2NPFA 2QV6A 3HHLC 4NE9C 2MXYA 1IQTA 3K58A 3RRKA 3NMRA 4WU2A 2L48A 2XCPA 2R7OA 5IT9U 1R0AB 3KHRA 3HULA 1P1LA 3MAAA 3VVUA 3P96A 1K8AT 1YQHA 2A1BA 2VPYB 1MWYA 1UWAA 3PFOA 2DHGA 3FZBA 3CW2C 3EVOA 4LRBA 4ZPDA 3RRGA 1QAXA 1K47A 2VG7A 1SJFA 1QY7A 3R5GA 4JOUA 3TZZA 1Y5LB 4B9TA 3BSAA 4J7CA 1H7WA 2KFZA 1DQAA 3PHEA 1L3SA 2UV8A 2E5LF 3DOKA 3UO0A 4MYTA 4FPRA 3DXSX 3QT5A 1VQNS 4X65F 2VUGA 2BVZA 1X31C 2XHWA 2NLWA 2RQMA 1NHKL 2C2OB 3OJSA 4B3SF 2GO9A 3M8WA 4ZN3A 3W64A 4PWWA 4ED2A 1EP4B 2WAQD 4OI3A 3TANA 1N52B 2V63A 3V5RA 5AJ3F 1S72S 1Q7LB 2MZRA 1GK8A 3D3CJ 1T7PA 5HK4A 3O5TB 4LF5F 1HBUB 1X5OA 3VZHA 2GC8A 4XDCA 3UCUP 3FEYB 4G1QB 1VYAA 2BW7A 3V2UC 1LNQA 1XNRF 1WC0A 4LR8A 1ZAXA 2F63A 2ZOMA 4WYLA 4TU8A 4RWXA 2Y8WA 4KR0B 4N8OA 1IBMJ 1W26A 4Y2AA 2FJEB 2AGOA 5B0BA 4DR6J 4RNNA 1EZZB 1Y3KA 4Y00A 3IP0A 5M2PA 4B3TF 1XC9A 2MB0B 2QL9B 3LW5C 2UU9F 3CC2S 1VC0A 1LWFA 4IH6A 1U25A 2IIHA 2FY1A 2PE8A 2N7CA 3OL7A 4ES2A 3HHLA 2OKQA 3IFEA 4I6AA 3JTOA 3TO8A 1RBOB 3DGVA 4KFBB 3H2LA 4KKOA 3CCLS 4V1Ak 3UDEA 2M8HA 5FIIA 4DS5A 3KJFB 2RRBA 1Q95G 1MWQA 2ZZMA 4CQ1A 2V4JA 1R8HA 4O3OA 3LALA 1W25A 3H2VE 3LPEA 1JB0C 2H65B 3N6MA 2XULA 1JLFA 4USKA 1TAQA 4EK2A 3MMJA 2DGTA 2HNDA 4PYDA 4DR3J 2HFSA 3G6VA 4WIQA 2J0QD 4KV8A 3UR0A 4CTAA 5EGYA 1YITS 1WC4A 3NS6A 3VGUA 3MM6B 4LF8F 2HNYB 3PDNA 4F26A 1S7HA 1YLXA 3GSIA 4BCAA 1LK7A 1CBKA 3IMQJ 4ZA1A 5I42B 3VAJA 4DUZJ 1FRXA 2ZEJA 5F8HA 2ZM6J 4DSIA 4AYBD 1SC6A 2QG9B 4FS1A 2PA3A 4M5KA 2G2YA 1CJVB 4RZRA 3OV7A 2OEJA 1U1NA 3A8KA 4BLGA 1S9GB 1XMBA 2EFGA 2I1RA 4DV7F 1NKEA 3CCMS 1N6QA 1DRZA 2A18A 3J7A1 2A2CA 4IO9Q 3QRQA 5EWFA 3J81Y 5F3TA 2UXDJ 4YN3B 2ZKTA 2FGCA 4DV5F 5KFMA 4RJVA 2NZ4A 1RWVB 1F1BB 1GH8A 2GMLA 2AU0A 2LXIA 1C0TA 3KG4A 2XMUA 4K7QA 2GGPA 1ZAWA 3HP6A 3NLCA 4LSLB 1KHVA 3DHWC 2BEFA 5HQMA 3LGHA 3C3LA 2D3OR 3TVKA 3QYYA 1VS3A 5I3PA 3GFYA 4ZLPA 2B8QA 1S9EB 3JQJA 2DCLA 4R0JA
chains in the Genus database with same CATH topology
3DOMB 2JNJA 3DGPB 1YDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOM B;  2JNJ A;  3DGP B;  1YDL A; 
#chains in the Genus database with same CATH topology
 4I0W A;  2BAN A;  3ZTQ A;  3M8R A;  3V81 B;  2GVZ A;  2MQO A;  1U0S A;  2RQK A;  1SC3 B;  4ZVF A;  3A1Y G;  5KG7 A;  4YHH J;  1VQ4 S;  1KTQ A;  2K1R B;  5E3C A;  1JXE A;  2XWX A;  2IVY A;  1HQ2 A;  3DDI A;  1F0X A;  1T11 A;  4N76 A;  4RUC A;  3BKT A;  1XMO F;  2CNN B;  4RNF A;  1CUL B;  1YBU A;  4CLY A;  2VON A;  4ANE A;  2YH0 A;  4OHZ A;  3WBZ A;  2JOQ A;  2WVB A;  3EDR B;  2RDD A;  4USH A;  4KPC A;  5HJX A;  3DMJ A;  3CDW A;  3CME S;  4DL3 A;  3PCO B;  4I2P B;  2BJ1 A;  1X4H A;  1NK7 A;  2EPI A;  5T14 A;  3KLG A;  2W9B B;  2XO6 A;  2JX2 A;  1UJ4 A;  1HBM A;  1HWI A;  3DOM B;  1BXN A;  4PPZ A;  2X1B A;  1BQX A;  1FTR A;  1HLW A;  3IAM 9;  4K4W A;  3MCM A;  1YX2 A;  2L9D A;  4NYZ A;  3VAK A;  2DR8 A;  2HAF A;  2N3L A;  5GAH U;  4QPT A;  2NSC A;  2F4V J;  5HMZ A;  2Z2Z A;  1KTV A;  3LH2 S;  4OHW A;  3MHY A;  4X4T A;  4J9V A;  4MK9 A;  4TU9 A;  2VQF F;  5FDL A;  2XG8 A;  1NDP A;  2MHN A;  1UZH A;  1MU2 B;  1S99 A;  1YZ6 A;  2R42 A;  4ED0 A;  3MM9 B;  4XTT A;  1RWN B;  2MZ1 A;  2XQC A;  2VBY A;  3DLK A;  3M2R A;  3GB0 A;  2P9G A;  1WTB A;  1WUU A;  3OXL A;  2IYI A;  3POT B;  2AEF A;  3PYG A;  2VG6 B;  1X9S A;  1R43 A;  2AX0 A;  1S0N A;  3MEC B;  4I7F A;  3UW1 A;  2N4C A;  1UFL A;  1I94 F;  1IKW B;  1FNM A;  2Y0B B;  4KTQ A;  1U09 A;  4TLR A;  3OHB A;  5KFD A;  1EX8 A;  4HVZ A;  2GA7 A;  4B17 A;  2BUN A;  4LF9 J;  2BQR A;  2GX8 A;  1IUJ A;  3H59 A;  2ZVS A;  4LRC A;  1F3F A;  4IQM A;  4X66 F;  2VHG A;  4AFF A;  1TL7 A;  5KFX A;  2UVR A;  4V19 J;  5H9F J;  4Q0B A;  3BBB A;  2VQE J;  2CNL B;  4RBU A;  3NNC A;  2KHD A;  1U0H B;  3MED A;  2ZZN A;  2G0J A;  2C2Z B;  5F41 A;  3W9I A;  1D9F A;  4NYP A;  2VZ9 A;  2YNG B;  4IO1 A;  4QYR A;  1Q78 A;  5KFZ A;  4IR1 A;  5ETO A;  3MM7 A;  4JI1 F;  4ZVU B;  5D6G A;  1IKX B;  5KFA A;  2IVM A;  2AEJ A;  4JUZ A;  3V6H A;  1ACM B;  1NND A;  1OYE A;  3NS7 B;  1WC5 A;  3PYE A;  3OHA A;  4IOB A;  1VBK A;  1RAB B;  3M9M B;  4Q5V A;  2VJU A;  3MUR P;  3MD3 A;  2MKI A;  3RAQ A;  2VDH A;  3Q22 A;  1YRX A;  1RAC B;  2DR9 A;  4WK1 A;  4IQX A;  1U02 A;  4TNO A;  4H4K C;  5HQ8 A;  1XIQ A;  2LMI A;  4NLQ A;  4JB8 B;  4PWU A;  4NI2 B;  2X1F A;  5J2N A;  1GX6 A;  4X4S A;  4KQZ A;  5MAO A;  2FHJ D;  4W98 A;  3Q8Y A;  3B78 A;  2WSE C;  1B70 B;  1UFK A;  2OSQ A;  3C16 A;  4DR1 J;  3PFE A;  2PMZ D;  3IG1 A;  2CQC A;  2AMC B;  2ZBI A;  1Y5N B;  3HI9 A;  1U6Z A;  1HHT P;  3MPU B;  4NAS A;  2HEK A;  4P71 A;  2QLB B;  1XER A;  3N79 A;  2YPZ A;  4PRF A;  4K50 A;  3IAS 9;  2FJV A;  1Q53 A;  5T41 A;  2KT2 A;  4TY9 A;  4PQA A;  4CO2 A;  4DR4 F;  5KG4 A;  1RHJ B;  3D1H A;  4PUO A;  3O8W A;  3D6T B;  3HVR A;  2LXF A;  2WON A;  1VHF A;  3TW0 A;  2CQ1 A;  2RD5 C;  3K5O A;  3CJS A;  5C24 A;  4RUH A;  4M94 A;  4GVL A;  3FUY A;  1VHI A;  3PJ9 A;  1SBR A;  3PRD A;  2KH9 A;  3OTD A;  3NBP A;  1YJR A;  3HX9 A;  2X7I A;  1JKH B;  5ITH A;  3FBB A;  4XO0 A;  2R7U A;  4OHX A;  1CJK A;  3RRH A;  3H2U B;  3GLJ A;  4A46 A;  1Q0N A;  1LFP A;  4DPW A;  2HKE A;  2D7S A;  4KGZ B;  3G8Q A;  2HQ3 A;  4O4G B;  4EYI B;  3H4D A;  3I0R A;  4KO0 A;  1C0U B;  5G0R A;  3IM9 A;  3T1Y F;  1PYT A;  1AUD A;  2JH3 A;  2YKN A;  1VK3 A;  4CH1 A;  2YKA A;  2JZ5 A;  1OY8 A;  2F3J A;  4EZ9 A;  4PZV A;  2EC0 A;  2IBK A;  4DU8 A;  4CLW A;  1E6Y A;  3ETO A;  2FZG B;  1FKO B;  2HS3 A;  5EX3 A;  4AXJ A;  2FTR A;  4X64 J;  4Y2M A;  2VG5 A;  1M5V C;  1WDT A;  4OZ0 A;  1T03 B;  3OTC A;  4K59 A;  5CD4 H;  3M1V B;  4UY8 T;  5KFT A;  1SUQ B;  1BUX A;  1K1S A;  4HHU A;  1RQ0 A;  4X4Q A;  4JV5 J;  3KUE A;  3WDO A;  1NZ8 A;  4ICL A;  1N32 F;  5J2M A;  3T9N A;  5DDO C;  2ASD A;  2U1A A;  2ZOF A;  2JC0 A;  3I96 A;  5L9X A;  4H4K A;  3I5C A;  3O1L A;  1C1B B;  2CAJ A;  1KDN A;  3IS9 B;  4CLF A;  1KP6 A;  2OGU A;  2MMY A;  3TAQ A;  3PO5 A;  3M8Q B;  3BN7 A;  4LJM A;  3TVY A;  4FF1 A;  2O67 A;  1XJW B;  2QFJ A;  4F50 A;  1RT2 B;  3B8H A;  5A8W A;  2VA2 A;  4ZCM A;  5BYQ A;  1QDU B;  4OFZ A;  5ETV A;  2VIH A;  4MKB A;  3BM7 A;  4WFA Q;  5M2R A;  4GVB A;  1IJE B;  2YXL A;  2JL9 A;  3CJ0 A;  4O23 A;  3HVT A;  2DB1 A;  1WSV A;  2G1D A;  1RTD B;  3V4I A;  1MN7 A;  2IRU A;  3W7B A;  3BS9 A;  4J9Q A;  1PG5 B;  4IRC A;  1RSC A;  3M30 B;  2IAJ A;  2IJN A;  1UZD A;  2XLI A;  3EM1 A;  2QMU B;  1ZOT A;  1EAY C;  4DFM A;  3UD3 P;  4HLB A;  4ECQ A;  1ELO A;  1J5E J;  1LWC A;  4OI0 A;  2UXB J;  2MHE A;  1NJI T;  1SJR A;  1WWH A;  2HWI A;  1GXU A;  1WHX A;  3FKB A;  5HO4 A;  3VHQ A;  4GO7 X;  2E1C A;  3JSM B;  5A8R B;  1I1G A;  2GCF A;  5IM0 B;  1OSC A;  3UN3 A;  3R6G B;  4NRT A;  5L38 A;  1JLC A;  4MAK A;  4FP9 A;  5B0G A;  4QWB A;  1KOH A;  5J1P A;  5I3U A;  2LEP A;  2FVR A;  3GON A;  1RYR A;  4MKY A;  2GV1 A;  3KMQ A;  3CD5 A;  1NKC A;  5FLX Y;  4MIW A;  3IC1 A;  5KT4 A;  2DHX A;  3CO9 A;  3CIZ A;  3D1O A;  3DRS A;  1VMB A;  1RCO B;  2E7V A;  1Y10 A;  1FD2 A;  4MYU A;  3P4U B;  4GKK J;  4TY8 A;  1B0V A;  4USJ C;  4Q2L A;  1R0A A;  3M9N B;  4A8X A;  1Q1K A;  1A6L A;  3CT9 A;  4Y2K A;  1N33 F;  1IBL F;  4RNO A;  4NXN J;  2FD2 A;  3AOD A;  1U26 A;  3D54 A;  2XBP A;  1T05 B;  3NCQ A;  2YNH B;  1R31 A;  4FNH A;  3C8Y A;  3LTO A;  4QJV A;  4R8U B;  3W9J A;  4LSN B;  5JMN A;  5EWE A;  5H9E K;  5DGB A;  3KJV B;  1GQE A;  3T9Z A;  1WEY A;  3UNG C;  3PW7 A;  5E5N A;  2DD8 S;  2OMO A;  4URQ U;  1JXV A;  3BN4 A;  3PX0 A;  1N5T A;  3A3O B;  3HSJ A;  1NKB A;  3Q86 A;  1H2V Z;  4ETZ A;  1RWP B;  1UFW A;  2XS5 A;  4HHH A;  5IT9 Y;  3AT1 B;  1PKU A;  4JI6 J;  1GXL A;  3R1H A;  4DL0 C;  3GMG A;  1R0C B;  1QUV A;  5A6P A;  3R5C A;  3P3D A;  1IBM F;  4L6V 3;  3EGW B;  1EP4 A;  3PXG a;  1F60 B;  4DR6 F;  4KH0 B;  2KXF A;  2NSB A;  2HGL A;  3D0I E;  1VOM A;  1T9T A;  1PAE X;  2LCW A;  4OHV A;  2VPX B;  4F2R A;  4LMZ A;  1BQN B;  2V6A A;  1S6Q B;  2EBG A;  1HBU A;  4X4O A;  1FNO A;  4G1Q A;  1RUS A;  2DRD A;  2NXJ A;  4FKX A;  4QWE A;  5AXN A;  3BO3 A;  5EUH A;  4ECU A;  3NGR A;  5DDR C;  2GFF A;  2VBX A;  3NCP A;  1VQK S;  3KFW X;  5KFH A;  1EJ7 L;  3F41 A;  3UQS A;  4JI7 J;  4XIU A;  5AE1 A;  3GWC A;  4WXO A;  1HWU A;  2MST A;  3AOC A;  4DQS A;  3GIR A;  2I9S A;  5DO2 A;  5F8L A;  2FVS A;  2GHV C;  1AYE A;  1O8B A;  1X4A A;  1RXO B;  1NU4 A;  1ULR A;  4ZPW R;  2HK2 A;  2HHU A;  3CUL A;  3OL6 A;  3BH7 B;  4U96 A;  3AOB A;  1UMJ A;  2BA9 A;  4DR3 F;  2CJK A;  1DUR A;  1D0E A;  2Z2Y B;  3RAX A;  3DI6 B;  4K4X A;  1DHM A;  4IFV A;  4DPO A;  4L3N A;  4KFB A;  2YKO A;  3T5K A;  4ES1 A;  4LF6 J;  2R8H A;  2J7W A;  2D3Z A;  4DN9 A;  3HSZ A;  3FEX B;  1KWM A;  2X1G A;  4BWJ A;  4PPD A;  3ZTR A;  4NYO A;  1Q86 T;  2MSS A;  1T0T V;  4NLD A;  2J8A A;  2AZ3 A;  2M4M A;  4DUZ F;  9ATC B;  4JI8 J;  3MMB B;  2LP4 A;  3AD8 C;  2ZM6 F;  2ZC3 A;  1U1R A;  2KM8 B;  1SKU B;  2Z8Q A;  1RB0 A;  5CA5 A;  4OYP A;  3IGV A;  1EIY B;  1Q8L A;  1V5V A;  1JJH A;  4FN5 A;  2V9W A;  1XR7 A;  1FE0 A;  4O3N A;  1HNW J;  1CC8 A;  4E98 A;  4FDF A;  3T6J A;  1UA1 A;  2Y1I A;  4DR2 J;  1XNQ J;  1BE4 A;  1O51 A;  3W9H A;  2KG0 A;  4I67 A;  2QT7 A;  4PG5 A;  1X4C A;  5CH7 B;  2CJ9 A;  2Q1L A;  5I42 A;  3UFC X;  2LXU A;  1KN6 A;  4FYD A;  2YVS A;  5K8M A;  1N8R T;  2UXD F;  4Q44 A;  3C19 A;  4J9S A;  1V3S A;  3SMZ A;  4ELV A;  1VQ8 S;  4C8Y A;  4QW8 A;  1IR0 A;  1KR4 A;  3PW4 A;  2RSQ A;  4USU A;  4DG1 B;  3S7R A;  2D1C A;  3NS5 A;  3HT3 A;  1CQN A;  1S9G A;  2E7X A;  5KFW A;  4JI3 J;  1WEL A;  3EGN A;  3WQP A;  2I6W A;  1IR1 A;  4DZD A;  2GMJ A;  4QIW D;  1RTJ A;  2DGS A;  2R2U A;  1HNZ F;  1RT7 B;  1M0S A;  5I4M A;  2KDO A;  4ZJO A;  1FEH A;  2F8H A;  2MKH A;  1QAY A;  3NGD A;  3CIM A;  4C8M A;  3RR7 A;  3ELH A;  5CD4 A;  1U4B A;  3FBF A;  4UZB A;  2VC1 A;  3FNN A;  3UVJ B;  2VOP A;  4HAC B;  4ED7 A;  2V9K A;  4LSL A;  5LXR A;  4CO3 A;  4JI2 F;  2A2D A;  2DNG A;  2KVI A;  2B4V A;  3CGI A;  3JSB A;  1X4G A;  2OPQ B;  2P6T A;  4CCH A;  5CZV A;  1QE1 B;  4I4B A;  2ZBP A;  1U8S A;  3RZA A;  4HYK A;  2B9E A;  2JNJ A;  4FF3 A;  4C8K A;  4AL7 A;  2K1R A;  1G4C A;  3TYT A;  4QIF A;  4NZ6 A;  4CYU A;  1FRM A;  5CXT A;  1NDK A;  3RBX A;  2K7J A;  1CUL A;  2OEK A;  5CYM A;  2F4V F;  4AE5 A;  4ZPT R;  2GO8 A;  4FYY B;  4WFN Q;  1FRH A;  5MLC V;  5L1L A;  1S10 A;  3MGJ A;  3VVT A;  2HAI A;  3JSR A;  2DH8 A;  3KLV A;  1Y7P A;  4M95 A;  3IA0 A;  3QSI A;  5BYR A;  4I2P A;  3KTQ A;  1FK9 B;  2Z57 B;  3M32 B;  4LQ9 A;  2W9B A;  3W8P A;  3UD4 P;  4DQR A;  1SJ4 P;  3DOM A;  3DYA B;  1FDN A;  4LBI A;  2K2P A;  1K9M T;  3NXZ A;  1LQ9 A;  1O0P A;  2E5J A;  4CRJ A;  3DOL B;  4USM A;  3QBC A;  2DR7 A;  1U1K A;  5J2Q A;  1UEK A;  2M2B A;  4LF9 F;  3LAK A;  2HGN A;  1MU2 A;  4TXS A;  4NX9 A;  2WOM B;  2LQ9 A;  2FHK A;  4KE5 A;  3WIV A;  3KJN B;  4RUB A;  4B3O B;  1SV5 B;  3PYD A;  4UOC A;  4ZCI A;  2VQE F;  3MM5 A;  3KUG A;  5E33 A;  1JLA B;  1MRO B;  2P9C A;  4A47 A;  2R9L A;  4MTP A;  4L76 A;  3MAH A;  1LW0 B;  3POT A;  4WBF A;  1MN9 A;  2VG6 A;  5E3R A;  1R8B A;  1Q7Y T;  1IKW A;  2E1P A;  1YHQ S;  4KGM A;  3ZZO A;  3DM2 B;  4N41 A;  4FXD A;  1QVG R;  1FWK A;  4DSL A;  4KHR A;  3OL8 A;  2WW4 A;  2AGQ A;  1UEV A;  2M70 A;  2B0G A;  2B7B B;  2ZDO A;  3OW2 R;  1T95 A;  1UPP A;  2IJR A;  4F8R A;  3DDN A;  4F4W A;  1U49 A;  1FWL A;  1U0H A;  2QMW A;  4KIA A;  3KLF A;  3ENW A;  4ECY A;  1TL1 B;  4P7T A;  4JYA J;  2HRT A;  2AP6 A;  2CZV C;  1FE4 A;  2GIR A;  1S4F A;  2YNG A;  2A6M A;  4YB5 A;  1UA0 A;  2C42 A;  2X3G A;  2MGZ B;  2FIU A;  2R2T A;  2OLW A;  4G1P A;  4DR1 F;  1IKX A;  2DGQ A;  2Z56 B;  1RYS A;  4LSZ B;  2BJ7 A;  1KKH A;  4J5O A;  2JDJ A;  1HD0 A;  2NCK L;  1N5Q A;  1S1W B;  5E3Q A;  3EPG A;  4L74 A;  1WSR A;  2AEM A;  4ECX A;  2MQ8 A;  3DOK B;  4QIG A;  4C8O A;  2LQ8 A;  2N3O A;  2XSF A;  3K5M A;  4Y2C A;  1FHT A;  5EHH A;  1S0M A;  2HHP A;  3D5M A;  3W5X A;  4CNZ A;  4NI2 A;  4K5S A;  2XB2 D;  2CPD A;  3QWP A;  2HG4 A;  1QUP A;  2ZH1 A;  2WBM A;  4OX9 J;  4IRK A;  4DSF A;  2E7W A;  3MXH P;  4J90 A;  3VAM A;  3TX0 A;  4YP3 A;  2G1H A;  4OI1 A;  1FEE A;  4KYZ A;  2R2R A;  2HQD A;  3MTJ A;  2UUA F;  4F0K A;  2JLE A;  2ZE2 B;  3H20 A;  2DIU A;  3K8W A;  1Q81 T;  1Q5V A;  2HMI B;  3MCO A;  5HVG A;  2HFN A;  2L08 A;  2ASY A;  5CCM A;  2RE1 A;  3KLE B;  2EK6 A;  2KKH A;  2ACY A;  1NEE A;  3A3P B;  4IKA A;  4MT1 A;  2N4D A;  1PO6 A;  1TVR B;  1RAO A;  3JTP A;  1JKH A;  2QYC A;  3FCW A;  4X64 F;  2DK2 A;  3K5P A;  2F40 A;  4BHQ A;  4I2Q B;  2IC3 B;  4B9S A;  2EFO A;  2PMH A;  4RNH A;  1C0U A;  3HMJ G;  5IWA J;  2FGO A;  3PX4 A;  4JV5 F;  5F8N A;  1S1U A;  6FD1 A;  3VGS A;  2J5A A;  2V94 A;  3BO4 A;  3QMQ A;  3RTV A;  5DDP C;  1FDD A;  3ONQ A;  4ER8 A;  4CLP A;  4KKO B;  1KD1 T;  3BB5 A;  3X1L B;  1UP1 A;  1AB8 A;  2CJB A;  2MLX A;  2LVW A;  3EGZ A;  5THW A;  2W9A A;  4B3M J;  1J2V A;  2RS2 A;  1N5V A;  3DNC A;  3BGU A;  3ULH A;  1XR5 A;  2LQJ A;  1FKO A;  1PBU A;  2PEB A;  2XS7 A;  2WK4 A;  1JLF B;  2DPI A;  3F0N A;  1T03 A;  5HBM B;  3M1V A;  1LK5 A;  1SUQ A;  4KAI A;  4RU9 A;  1T02 A;  2FUG 9;  2LDY A;  2DJW A;  1FJG F;  4CTA B;  4HI2 A;  2BXJ A;  2FVP A;  2CNK B;  4PXC A;  3NOC A;  3MR3 A;  3QRR A;  5EN1 A;  2GW8 A;  4FNI A;  1TR0 A;  4P2F A;  1C1B A;  3IS9 A;  2B9X A;  1X4B A;  1I3O B;  1XBW A;  1NM2 A;  2XLK A;  4NLY A;  4PR6 A;  3AJD A;  2XMK A;  3NGS A;  3P49 B;  1HAR A;  1IQZ A;  3NRB A;  2DCU B;  2HS4 A;  3BDP A;  1B4S A;  5ADZ A;  3H25 A;  1RI7 A;  3PG9 A;  3VAH A;  4FF4 A;  2W25 A;  1YJ7 A;  1RT2 A;  1HPZ B;  3T6B A;  2OML A;  2QYG A;  2IVF B;  2B4O A;  1N34 F;  1QAI A;  4DR5 J;  1U6F A;  1LEO A;  3RBE A;  4DUT A;  4Z7Y A;  4NML A;  3TZY A;  1RTD A;  1VQS A;  2V8V A;  5KG3 A;  1H98 A;  1WF0 A;  3M30 A;  3GR1 A;  1AXQ A;  3DLE B;  1TV6 A;  2AGP A;  4QR2 A;  2HPU A;  1FTC A;  3MWB A;  2V2Z A;  2DNR A;  2ILY A;  1RBL A;  2PII A;  4FXW A;  1FVQ A;  2GVD B;  1UPM B;  3WC0 A;  3LWL A;  4BC9 A;  2DNO A;  3THP A;  1LOU A;  3WC2 A;  1TKD A;  1Q82 T;  4ZJL A;  1R6V A;  1TL3 B;  4OYX A;  3JSM A;  2GGP B;  4NXN F;  3CJ4 A;  5A8R A;  3S8S A;  4J91 A;  3U27 A;  3US5 A;  3QLH A;  1N0U A;  2OIH A;  1W7W A;  1TZ0 A;  4PCQ A;  5CHC B;  4ZVQ B;  3NY0 A;  4ZVR B;  2KO1 A;  3GP9 A;  1VBY A;  1B7F A;  3FRZ A;  4DV6 F;  2PT0 A;  2J6T A;  1OMS A;  3PM9 A;  4FYX B;  3CJ8 A;  3CC7 S;  1DQ9 A;  5L1I A;  2XC9 A;  3TUJ C;  5GAE I;  4X4N A;  3CCV S;  5KT3 A;  5IV3 A;  4EWT A;  2V8P A;  2B5J B;  1TQL A;  1AA1 B;  3W62 A;  1T05 A;  4QR1 A;  1RTZ A;  4OV1 A;  2AWZ A;  2JVO A;  2YNH A;  1WG5 A;  4RU2 A;  3IRX B;  4R8U A;  2OEL A;  1REV B;  2KM8 C;  4LSN A;  4NLO A;  3D67 A;  2WSF C;  4O3S A;  3SV3 A;  4UOG A;  3CJ2 A;  2PFD A;  1Q16 B;  1R6Y A;  2DR6 A;  2P6S A;  2H3E B;  1HWJ A;  1HR0 J;  5LT5 A;  2CFX A;  3AA8 A;  4P73 A;  2YKQ A;  4L72 B;  3GR0 A;  1TMM A;  1F9F A;  1SKR A;  1NK5 A;  3IM8 A;  2GZO A;  3LWM A;  1ZZN A;  4OZ2 A;  4QWC A;  3BJY A;  4U7C A;  4DPU A;  1TL4 A;  3TI0 A;  3I9V 9;  1PYS B;  3GV7 B;  3B6B A;  1BQN A;  2F4F A;  4LRF A;  2DRA A;  1WC1 A;  1S6Q A;  9RUB A;  5KFY A;  1NB7 A;  1H0H B;  4EZ6 A;  1W2B R;  2DNZ A;  4DXL A;  4R25 A;  4J9R A;  2DEI A;  4NXM J;  4ZLN A;  3SQO P;  1DLO B;  2DNM A;  1JLB B;  4I7F B;  4XAK A;  3R6L B;  4OJ3 A;  4LF6 F;  1HI8 A;  3TQE A;  3SSQ A;  1T9X A;  3EUN A;  4OI2 A;  2B9W A;  3K0J A;  2CPJ A;  4K5R A;  1NSK L;  3K5L A;  3PW0 A;  4GO5 X;  3ZNU A;  5DG7 A;  4WP8 A;  2E66 A;  2R7V A;  3MOJ B;  2BV3 A;  1SL1 A;  4XK8 C;  3IBW A;  3OSP A;  1Y9O A;  2L3M A;  1FES A;  3CCT A;  3OL9 A;  3UR3 C;  4P75 A;  4ECW A;  1FRI A;  5F8G A;  1S12 A;  1HNW F;  4WCE Q;  3OTE A;  1YJU A;  3OFE A;  1ZYQ A;  4DR2 F;  3PIO Q;  4IH5 A;  2DNK A;  2PD1 A;  3I31 A;  1XNQ F;  2Z0G A;  5KFP A;  3QZ8 A;  3M8Y A;  3LA0 A;  4FBT A;  2YX7 A;  5B0E A;  1S9F A;  3DXB A;  1UVI A;  1NH7 A;  2HZC A;  3FMW A;  1LV5 A;  2Y1L B;  5M2U A;  2XMA A;  3LAM A;  3MMB A;  3MR5 A;  3MEG B;  3WIU A;  1U1P A;  2H54 B;  1KHW A;  4FYW B;  3ZO7 A;  1FCA A;  1XQI A;  4RR5 A;  3QQC D;  4N47 A;  3DLG B;  3P45 B;  2KRR A;  3EZU A;  2CPF A;  1WOO A;  4DV1 J;  3TR5 A;  1S79 A;  4Z2X A;  3HHL D;  1UVK A;  3A8E A;  3D28 A;  2L9W A;  2X51 A;  4DX6 A;  2CPH A;  2MYF A;  2OD6 A;  1FVS A;  1FWP A;  1NPK A;  2BR0 A;  2DY1 A;  4B9L A;  4DSK A;  5LJ3 Y;  2IBO A;  1P27 B;  5DET A;  3KJQ B;  3M9O B;  2GJI A;  2P2C B;  1FKA F;  1JWW A;  5E3P A;  3NGT A;  1S1T B;  4PUO B;  2XSJ A;  1SQG A;  4WFY A;  2LLZ A;  4M5H A;  4DG1 A;  5KFJ A;  3DLH A;  2K8G A;  3CJT A;  3ZTO A;  1ZAV A;  2BJ3 A;  1R8C A;  3RU0 A;  2MY8 A;  1K0T A;  2QLX A;  2KHC A;  2OH2 A;  1BHN A;  4P52 A;  2PC6 A;  2QA4 S;  4TQR A;  2ABY A;  2FB0 A;  1YDL A;  2FQQ B;  3FEZ A;  4EO8 A;  1RT7 A;  2DNL A;  4RW7 B;  2MKJ A;  2JEG A;  3HFK A;  3T41 A;  3KOA A;  3EWG A;  4KO0 B;  1FFG B;  2W2O P;  2SXL A;  1YKW A;  3BZQ A;  3TJ8 A;  3BGR B;  3MI7 X;  4ZIV A;  2K3K A;  2Q43 A;  5DQI A;  1HBN B;  4FBU A;  2Q3P A;  3UVJ A;  1RWM B;  4HAC A;  5F9L A;  2R7R A;  5KOX A;  5LSL A;  1RTI B;  4C3L A;  3OLB A;  2DVI A;  4WWS A;  3AXM A;  1H72 C;  2EFP A;  5FD1 A;  4DS4 A;  2VKZ G;  4HI1 A;  4RW8 B;  2H51 B;  4YEA A;  3NNA A;  4WKR A;  2OPQ A;  1UJ5 A;  3KG1 A;  5IC6 B;  2I2Y A;  4ED5 A;  2BE9 B;  1QE1 A;  3GIM A;  4M5D B;  2B6A A;  3DGP B;  2IYG A;  3EDQ B;  3ISN C;  1CS4 A;  5FJ4 A;  4YFU A;  2ZJR Q;  4LVN P;  3HKW A;  1HL6 A;  4ERD A;  4JV0 A;  2DNQ A;  3Q89 A;  1LKZ A;  2QIF A;  1DBD A;  4ICL B;  5J2M B;  3Q83 A;  1QLN A;  2JHE A;  4Q2M A;  2WBR A;  4C8Z A;  1HIY A;  2CQH A;  2J9D A;  4GC6 A;  3MOZ A;  2NUU G;  3N5F A;  5EDW A;  5AT1 B;  2HQC A;  4NMX A;  3SCK E;  3SFG A;  1Q79 A;  2VIC A;  2AYB A;  1KSP A;  1IVZ A;  4XDD A;  2VFU A;  1FK9 A;  5I3Q A;  3M32 A;  3N4W A;  4IDK B;  2AX1 A;  1J5O B;  1WNE A;  3EIC A;  3BQ0 A;  5A8W B;  2MJN A;  5AXM A;  3CD6 S;  4C98 A;  2HZA A;  2V0N A;  2EFV A;  4OJG A;  3HVT B;  2FPH X;  4DF4 A;  4YS2 A;  3DOL A;  4QWD A;  4CI0 B;  3C15 A;  2WTF A;  1GAO A;  2QO3 A;  1TP7 A;  2AJ0 A;  4HH1 A;  3RB4 A;  1RLC L;  3IO1 A;  2IAJ B;  2ZDP A;  3Q2T C;  1CSJ A;  2XGP A;  3MEE B;  2WOM A;  5LOQ A;  3ILJ A;  1M90 T;  4MJK A;  4YQW A;  1NJW A;  2CQ0 A;  3S1T A;  4HDG A;  4OYB A;  4B3O A;  4IG0 A;  1SV5 A;  2E9Z A;  2Z2M A;  3N28 A;  1MRO A;  4TYB A;  4JYA F;  4ZVH A;  4YB6 A;  2GAG C;  1BLU A;  4ZVT B;  4ZLJ A;  4K2X A;  2GHP A;  2ZFH A;  3RBD A;  4B08 A;  3OSN A;  3SYZ A;  5BYS A;  4AUK A;  2FJB B;  1JLC B;  4NLG A;  2IPO B;  2BE2 B;  2QX0 A;  3UN2 A;  2WB1 D;  2YWW A;  3DM2 A;  1JNR B;  1SKW A;  3PR4 A;  4CO4 A;  4RPF A;  4EBC A;  5D4L A;  2H5J B;  2WVD A;  2PI4 A;  2ZJP Q;  2NYI A;  3SQG A;  3CJR A;  3IWX A;  1S57 A;  2HBY B;  2C3M A;  2CG4 A;  3D6M B;  2O5D A;  1VGY A;  1Q8K A;  1JLG A;  4TY8 B;  1WEX A;  2R8G A;  2H48 B;  2CYY A;  5C7P A;  4DL5 A;  1TL1 A;  3CMQ A;  4X62 J;  4DCJ B;  5KOW A;  4NLP A;  1RT1 B;  2MGZ A;  3QGI A;  2DH7 A;  2LFV A;  5K5M A;  2AD9 A;  4OX9 F;  1WC6 A;  4WTO B;  3R27 A;  4KPY A;  1VQL S;  4ELT A;  3PKY A;  3HF5 A;  2J9C A;  7FDR A;  1BQM B;  5KFV A;  1S1W A;  1T8E A;  4C0O C;  2HVZ A;  7FD1 A;  2F9J A;  3LAN A;  5HAN A;  2QLJ B;  3CXC R;  2XI2 A;  1PYO B;  4ZPB A;  2L41 A;  2BQ3 A;  1ZA2 B;  3E51 A;  1JMT A;  3GV8 B;  1U45 A;  2B43 A;  2VBZ A;  1I5O B;  2QFI A;  1VR6 A;  2UUB J;  1U1Q A;  2KJW A;  2EC2 A;  3OJU A;  2J8S A;  1V5I B;  4X4R A;  1ITP A;  1NK4 A;  3OFF A;  2DGU A;  3I5B A;  2MQQ A;  4M5M A;  2HIY A;  2V2V A;  5KFO A;  4DCO B;  2AIR B;  2NR0 A;  2ZE2 A;  2O01 C;  2BQU A;  2HMI A;  5IWA F;  2OPR B;  2MQN A;  3BPD A;  2IY5 B;  2CA9 A;  3M2U A;  3TA2 A;  1K0V A;  5H9F K;  2WVC A;  4WU3 A;  3KLE A;  2NQP A;  2PSZ A;  3M8S A;  3RG6 A;  3RB6 A;  4CLK A;  3K89 A;  3K2Y A;  1ZTT A;  2QC3 A;  4UT4 A;  4W4M A;  1FT8 A;  4B3M F;  3BO2 A;  1TVR A;  2QTW A;  4DDF A;  1K1Q A;  2XO7 A;  5KT5 A;  3CCE S;  2KT5 A;  5JVH Q;  4ECV A;  3C6T B;  3RGI A;  4Q43 A;  5L46 A;  1YJV A;  1T3O A;  3QSY B;  2Z58 B;  4WKY A;  4Q7A A;  3I9Z A;  4I2Q A;  4DFK A;  3OQ2 A;  2IC3 A;  1U2C A;  3KDO A;  1W2I A;  2R8J A;  3L09 A;  3ENV A;  5ETN A;  5CAB A;  3EZO A;  5B0C A;  4IFV B;  3MM8 B;  1AZS B;  2QA4 G;  2W8L A;  2DIT A;  2Y3Y A;  5JVG Q;  1XNR J;  3H5S A;  3GJQ B;  3TP2 A;  4DLG A;  4JI5 J;  1MNE A;  2BMB A;  3DHX A;  4KB7 A;  3ILO A;  3RBZ A;  3LP2 B;  3DFE A;  5L1K A;  3KXD A;  6AT1 B;  1S7I A;  2HFZ A;  4TVA B;  4ZPC A;  5HBM A;  4LIR A;  1JK9 B;  3QAT A;  4B3T J;  3H4B A;  1IXK A;  3F44 A;  1H3D A;  1Y0H A;  4W92 B;  1RHU B;  3GYX B;  2F7V A;  2Z4P A;  4DR5 F;  4F2S A;  1IBK J;  2MZJ A;  2YNI B;  2DT9 A;  1WAC A;  4R5P A;  4AQY F;  3N9U C;  5EWG A;  4FPI A;  3AXK A;  3PW2 A;  3DRR A;  4OJ1 A;  3BEG B;  4DV3 J;  4DL7 A;  2OPS B;  1N5S A;  4K2J A;  3FK4 A;  1HPZ A;  2W7A A;  1HQE A;  4HEA 9;  3G87 A;  2KU7 A;  1MG7 A;  2BKP A;  3G6E S;  3Q8S B;  3HXM A;  1FXD A;  1D8Z A;  3K17 A;  5F8J A;  4MFB A;  5GAE U;  4BDP A;  2FLO A;  2YWK A;  3G71 S;  2HZV A;  2ASJ A;  2AJ1 A;  5G4D A;  2PFF B;  1WHY A;  4ZHR B;  1F5C A;  3DLE A;  1RTJ B;  3IR5 B;  3IR7 B;  1RKI A;  3M6X A;  4AT1 B;  2GVD A;  1HFE L;  4ILR A;  2EVZ A;  3EGV A;  5HAT A;  2H5E A;  1D09 B;  1TL3 A;  1KC8 T;  4J9N A;  1Z1Z A;  2UXC J;  2ZHA A;  3SBM A;  2KZM A;  3R5D A;  4PG4 A;  3T3F A;  1LFW A;  1TUG B;  4EU0 A;  4BS2 A;  3H5Y A;  4G6V B;  2GS8 A;  3T1H F;  3ILI A;  4IRD A;  4WPA A;  4C8N A;  4DQP A;  5F8I A;  4YR3 A;  3MCS A;  3HCX A;  3TUI C;  1RT5 B;  5J1E B;  2N7Y A;  4WFX A;  2B3T B;  4ZJQ A;  2EKY A;  4J9L A;  3OXF A;  4QU7 A;  3WX4 A;  2RU9 A;  2Z2L A;  3P6Y C;  4C48 A;  2E5G A;  4E2F B;  4NLW A;  3MF5 A;  1TFY A;  1FF2 A;  4CYU B;  4IFY B;  4Y3C A;  2J6U A;  8RUC A;  2CNO B;  1S76 D;  1N56 A;  5CYM B;  5DQG A;  4J9O A;  5KFS A;  3S01 A;  2B5J A;  3R5A A;  1RBA A;  4DV5 J;  1APS A;  3IBF B;  4QCL A;  1VQY A;  2HFU A;  3LGN A;  4WK3 A;  4MK8 A;  1VLY A;  2HHT A;  2CPI A;  3IRX A;  1WF1 A;  6FDR A;  5IFM A;  1REV A;  3ZTP A;  4UTG A;  3H5X A;  2AF6 A;  2QA2 A;  3AQO A;  3RW7 A;  1NJY A;  3QJL A;  3I4H X;  3D4J A;  1UVN A;  3V4M A;  1MMD A;  3DC2 A;  2BDP A;  4CDI A;  2EXU A;  3G8T A;  3HK2 A;  2X1A A;  3V6D B;  4NXM F;  1RHQ B;  1SI9 A;  4ZPV R;  2EI5 A;  3N6N A;  2XY5 A;  1HQU B;  2CPZ A;  3M6V A;  3HHD A;  1SH3 A;  5J2Q B;  2V67 A;  3GCX P;  2VU5 A;  1VBZ A;  3MMC A;  4F0H A;  5A8K A;  2JLG A;  3QAE A;  3RYL A;  5HVF A;  1QAJ A;  3UCZ P;  3JAM Y;  3WX8 A;  3MM5 B;  3CCJ S;  4NA1 A;  2BJD A;  2IMW P;  3CMA S;  2J7K A;  4CWB A;  2VFV A;  3SFU A;  5KFR A;  3ZZ0 A;  3R2C J;  4FF2 A;  5IT4 A;  1DLO A;  3KNA A;  1JLB A;  3KWM A;  1PSD A;  4NLT A;  1GXT A;  1Y4Z B;  3BSC A;  4KGX B;  2DIV A;  3KK2 A;  2FYX A;  2XMT A;  2M8D B;  3W60 A;  1S1V B;  3IRW P;  3EYZ A;  1YRU A;  2X3D A;  2IA0 A;  4IOC Q;  2HVD A;  4F4Y A;  3GYN A;  1C4C A;  4OX6 A;  2DKO B;  3JQM A;  2DY9 A;  1GMW A;  1D3W A;  1VRT B;  5KFG A;  4C0B A;  1RAF B;  3KLF B;  4X2B A;  4PG7 A;  1PC5 A;  4NZ0 A;  3FQK A;  4DV1 F;  5HJY A;  3TVZ A;  4DX5 A;  2GQ2 A;  4LF1 A;  5LSR A;  1NSP A;  2CWX A;  1WOR A;  1SIW B;  1WEZ A;  1NSQ A;  3F73 A;  4GKJ F;  4U9R A;  4CT9 A;  3A8I A;  5K20 B;  1YZ7 A;  1VJQ A;  4RWW A;  3GCW P;  3DDK A;  3OTO F;  4OYO A;  1I94 J;  3D9B A;  2A3J A;  2V2K A;  3HFZ B;  3MEG A;  1N88 A;  4CO5 A;  1P9Q C;  3EVW A;  4NCG B;  3DLG A;  2CG8 A;  2QA1 A;  4RX6 A;  2BX6 A;  5KT7 A;  2PA8 D;  1LXN A;  1X9M A;  2JFD A;  1BY9 A;  1S0V A;  2Y1J A;  2HHS A;  1M1K T;  2W4C A;  5D0R A;  1RK8 A;  1M1H A;  3P5B P;  2VOO A;  3KLH B;  4NRU A;  3D0G E;  2ZWP A;  2P8I A;  1NRK A;  1UVM A;  3CDU A;  4TLQ A;  4C0H A;  4LRA A;  3VAL A;  2WSC C;  2CDR B;  3O3L A;  2RVJ A;  4IOA Q;  1S1T A;  3THT A;  1CQM A;  3FCH A;  5LMU F;  3LOU A;  3L7P A;  3OVB A;  4DHV A;  3VAG A;  3OT9 A;  1SC1 B;  1WHW A;  3M4X A;  3FGV A;  4ENO A;  3SV4 A;  2VL1 A;  3N6L A;  5KAK A;  2E9R X;  3PW5 A;  2VFS A;  2CPE A;  2LEA A;  2NPI A;  3CE8 A;  4DV2 J;  4RW7 A;  4G65 A;  2W9C B;  3AFG A;  1TK5 A;  3HPO A;  2GJ2 A;  1S1U B;  3EZ5 A;  3BGR A;  4B9U A;  5H1S V;  5KFK A;  4X4V A;  3J7Z 5;  1N0V C;  3TAM A;  2R3V A;  1HBN A;  4U7U K;  4RBT A;  2XCA A;  1UKU A;  2XMJ A;  1YBA A;  1MSW D;  4CP5 A;  4OZ3 A;  4OI4 A;  1FJE B;  1RTI A;  2VOD A;  1F5B A;  4OZL A;  1U24 A;  1F2G A;  2W7O A;  4RW8 A;  2J0X A;  1RU1 A;  3IWL A;  1RKJ A;  4K4V A;  4K4U A;  2IRY A;  4KJI A;  4M5D A;  3DGP A;  2BAB A;  4EUV A;  5ETR A;  4F4X A;  3EE3 A;  3R7N B;  4C6A A;  1BWE A;  5KTQ A;  1H2U X;  3GYG A;  1KQS R;  2PDA A;  2COL A;  2XM3 A;  1REG X;  2VC0 A;  2NZC A;  2ASL A;  2QSW A;  3DRY A;  2YX1 A;  1PGZ A;  2G2Z A;  3NWR A;  3VQS A;  2HUR A;  3UWT A;  4WTY A;  1CC7 A;  4HT5 A;  3V6J A;  5CCL A;  3GFH A;  4U95 A;  4OQJ A;  1RAA B;  3I6P A;  2UUC J;  2HHH F;  2MQP A;  1B99 A;  1U2R A;  4P72 A;  4IDK A;  1J5O A;  1FDA A;  1NME B;  3GG0 A;  4OL8 A;  3V6K A;  3ZTS A;  2CDQ A;  1U6B A;  4YR2 A;  1KBR A;  3BGF A;  4NLR A;  2DHA A;  3G86 A;  2IJF A;  4FVC A;  3L3C A;  4NEY A;  1H2T Z;  3HHK A;  2VB6 A;  1URR A;  1K44 A;  2OTL S;  5D3G B;  4HHJ A;  4LR7 A;  2XYP B;  5D77 A;  1DAX A;  2GQC A;  3ZC4 A;  2B51 A;  1TV6 B;  1S59 A;  4USV A;  4DSJ A;  4FKY A;  4A8F A;  3MEE A;  2MZQ A;  3NWG A;  1MW7 A;  2IM1 A;  4YY3 J;  3W3S A;  2CAD A;  4ZMM A;  3M8P B;  1RT4 B;  5HP1 A;  3PEJ A;  4DWI A;  5IQ6 A;  4X62 F;  4A8W A;  2O66 A;  4ELU A;  5D78 A;  1ZM9 A;  1BMQ B;  2J9E A;  4NLS A;  2EW9 A;  3W2V A;  3BQ2 A;  3QLH B;  3ET6 A;  2BE2 A;  2W4P A;  2QEX S;  3L9Z A;  2JVR A;  4Y65 A;  2OEM A;  3VAF A;  1T9U A;  2DBB A;  4ZK7 M;  3G96 A;  2RQC A;  1C2P A;  3GFZ A;  3I32 A;  3I5A A;  2BM1 A;  4LRE A;  3BKF A;  2B56 A;  4L3K A;  5HMW A;  1S1X B;  3QNW B;  4WP3 A;  1XMQ J;  2RDJ A;  2F5G A;  2UUB F;  1RT1 A;  2ZH3 A;  4QYZ J;  5D4N A;  1ZZF A;  2BM0 A;  3Q23 A;  2UV8 G;  4KC5 A;  2PN6 A;  1ZPV A;  3KK3 B;  1QSL A;  1G2E A;  3ZNJ 1;  1N36 J;  3C2P A;  1RA7 A;  1NK6 A;  3M2V B;  1OY6 A;  1BQM A;  2PO4 A;  5SZT A;  3RUB L;  2QJ3 A;  1VC5 A;  3JB9 k;  2D69 A;  5E41 A;  3HHN B;  4PQU A;  1IWA A;  4QWA A;  2W7P A;  1PJ6 A;  2R7W A;  2HNZ B;  3DCA A;  4Y0F A;  1QTM A;  3PV8 A;  4CZC A;  4DBQ A;  4RLE A;  1FJC A;  5DJB A;  2KRB A;  2QL5 B;  3FSY A;  3PX6 A;  1SC4 B;  1KVK A;  1SCJ B;  5HN0 A;  1NK9 A;  4DL4 A;  2J7U A;  3EXY A;  2FHO B;  1N33 J;  5D4P A;  1IBL J;  4JV1 A;  1ARO P;  2HFV A;  2YY3 A;  5DS7 A;  1B0P A;  1C1C B;  5AXL A;  3B82 A;  2ZH8 A;  3I87 A;  4C7Q A;  2F8M A;  1U8W A;  3TAR A;  4B3R J;  4G3I A;  2XY6 A;  4U8Y A;  2HW3 A;  2H9Z A;  2ZVI A;  5A76 A;  1NUE A;  1RDR A;  3C46 A;  3MMA B;  3DU6 A;  2OPR A;  1NSA A;  3HD1 A;  1RE1 B;  5B08 A;  2HS0 A;  3PNI A;  4KRW A;  4RUA A;  4V19 X;  1VIS A;  1WC3 A;  3NAH A;  2PI5 A;  3OUY B;  4JI5 F;  2XHC A;  1DZ5 A;  1AW0 A;  3G9C A;  1EET B;  2LEC A;  2VDI A;  2CJX B;  2DGW A;  3C6T A;  1RU2 A;  4BWM A;  5HVH A;  3QIP B;  4AXI A;  2CPX A;  3CO0 P;  4C2M A;  2W2P P;  1XTZ A;  3MTK A;  1UWB A;  3KG0 A;  3KMS A;  4PWD B;  1OPI A;  2JLF A;  3GFX A;  3MM8 A;  3FBE A;  4ED4 A;  4UOH A;  1AZS A;  1IBK F;  3MPD A;  3W2W B;  1DY3 A;  4ECZ A;  3E8O A;  3U1N A;  1IM6 A;  1RHM B;  1A0O B;  2WVE A;  1N4L A;  3H42 A;  3G6X A;  3HT0 A;  1HI1 A;  1T9W A;  5JXS A;  1HNI A;  1PIE A;  2JWN A;  2VJV A;  3LP2 A;  1FDB A;  4W90 B;  2FJA B;  1HI0 P;  1NAQ A;  1JJ2 R;  4DV3 F;  2F9D A;  4KY3 A;  4CH7 A;  1V9O A;  3MEK A;  1UJ6 A;  2OFH X;  1DJ0 A;  1ZM4 A;  5IS2 A;  2CUY A;  4OV6 A;  4EI2 A;  3CCQ S;  2J9D E;  1VC6 A;  4HR2 A;  1PJ7 A;  2V5H G;  4CM0 A;  4RBV A;  4YDX A;  2YNI A;  2W01 A;  3MPV A;  4DX7 A;  5K8P A;  4UZC A;  5ETS A;  2LDI A;  2MKS A;  3CNQ P;  2F1F A;  2HQI A;  1HA1 A;  3MZI A;  1HHS A;  3F56 A;  3TOQ A;  3CCR S;  5GME A;  2OPS A;  1MLA A;  4FXV A;  2C2N A;  2AW0 A;  2WHO A;  1KOO A;  1UTA A;  2XSJ B;  5KG2 A;  2AZ1 A;  2UXC F;  2YQ3 A;  2FLN A;  1NB2 A;  2VH7 A;  2RKI B;  3WHI A;  3U1L A;  2ZD1 B;  3Q8R B;  1V6H A;  2O1P A;  1NJZ A;  2KVQ E;  1VQP S;  3VZI A;  3TX8 A;  4ZHR A;  2KYZ A;  4EGL A;  1S6U A;  4IUF A;  3FFI B;  5A0Y B;  3TA1 A;  4YHH F;  1VI7 A;  4GMK A;  3JSY A;  2VF3 A;  2BJ8 A;  4B02 A;  4NCB A;  3QJJ A;  1O5J A;  3UI3 A;  2ZH7 A;  1IM4 A;  2UUW A;  2F65 A;  2IHR 1;  5DRK A;  5J2P B;  2DO4 A;  1FKP B;  1RT5 A;  5J1E A;  4F36 A;  2I38 A;  1EQ0 A;  3AQP A;  2POK A;  1SIZ A;  2D9O A;  1HW8 A;  1LWE B;  3AB4 B;  3BGO P;  2B6A B;  4U7U D;  1X5S A;  2ZZT A;  1Q8I A;  3AH6 A;  3RB3 A;  1CS4 B;  1TK0 A;  1F9H A;  3SEO A;  2CRL A;  1CVJ A;  5DLF A;  1HYS A;  3GSD A;  1HNZ J;  5L1J A;  2LU1 A;  5SUH A;  5AE3 A;  4IYQ A;  4IFY A;  2RF2 B;  3BYP A;  3R7B B;  1NPP A;  2G9O A;  3IWN C;  3HJF A;  5KT6 A;  5B09 A;  3NEK A;  2H4Y B;  4OI6 A;  2XYG B;  1ZTW A;  1DTQ B;  2V2Q A;  1JLE B;  3GPA A;  4QW9 A;  3I82 A;  1RWO B;  2EBE A;  3ZZY A;  2C3U A;  1HKA A;  3CPW R;  4JI2 J;  1WG1 A;  3DU5 A;  1ZET A;  1IBC B;  1KS2 A;  4LVO P;  2HBQ B;  1RT6 A;  4ED1 A;  1URN A;  1IN0 A;  2V8G A;  4HTJ A;  4LRD A;  3CED A;  4CO0 A;  2XY7 A;  3GE9 A;  4LR9 A;  5F0W A;  4C11 B;  5BR8 J;  4CT8 A;  4F0M A;  2MKC A;  2DYA A;  3V6D A;  3IXQ A;  4IR9 A;  4A48 A;  4DQI A;  2XMV A;  1M5O C;  1TUW A;  4GRS A;  2B8P A;  2H1Y A;  1HQU A;  4L75 A;  3C15 B;  2RT3 A;  1WTF A;  1ZS6 A;  1ZH5 A;  2NS1 B;  3QPI A;  4HT7 A;  4YOE A;  2LA4 A;  1TU0 B;  2B7C B;  2HRY A;  3PTW A;  3G8S A;  3MUM P;  5LJ5 Y;  2AT1 B;  2Y8Y A;  4EMD A;  4ECS A;  1KQK A;  4K4T A;  1HNV A;  2BJE A;  2YKM B;  3K8V A;  2AYE A;  1OO0 B;  4IG0 B;  3UDV A;  1Q8B A;  2XLJ A;  2XNR A;  2DEJ A;  1ZA1 B;  3M7V A;  2HLU A;  3LUY A;  4YME A;  2H4W B;  1WJ9 A;  3H0P A;  1G7C B;  1QJH A;  1RCX B;  4A8M P;  4LQ3 A;  4CM2 A;  4QIE A;  2ZBR A;  5C5J A;  3TEG A;  1C4A A;  4ZVG A;  1LW2 B;  2JRS A;  3J7Y U;  1P1T A;  1Y00 A;  4O3P A;  1S1V A;  4HDH A;  2IFX A;  1PIL A;  2I5J B;  4U6P A;  3N01 A;  1YJT A;  2OTJ S;  4DX8 H;  3E01 B;  1L3U A;  1GX5 A;  3J80 U;  3SQG B;  4F67 A;  3HM9 A;  5KG0 A;  1GTH A;  1VIX A;  1VRT A;  1HBO B;  3NOG A;  4DPX A;  1JLG B;  1EB0 A;  3CF5 Q;  2ZJQ Q;  4C97 A;  4YB1 P;  5GVQ A;  3MPW A;  4ATN A;  3CJK B;  3MR7 A;  4RW9 B;  3QT8 A;  7AT1 B;  3FBC A;  2KL8 A;  4ZN1 A;  4LF4 J;  4C3M A;  2B9Y A;  3PIP Q;  2RHS B;  2ZH2 A;  4I6Y A;  2DXF A;  1UW4 A;  2A0F B;  2XZD B;  5ETQ A;  3CVK A;  1X5T A;  2BW2 A;  3K57 A;  1DAR A;  3PJW A;  2IM3 A;  2JEF A;  2C2D A;  2W2Q P;  4EYH B;  4A8K A;  3T5J A;  4IG3 A;  4NCG A;  2MZS A;  1X4D A;  1KEK A;  4B9N A;  3NNH A;  3GII A;  3R9L A;  1WKL A;  4DZ6 A;  4ZPA A;  2OPP B;  2HSE B;  1YVF A;  1OS5 A;  1AT1 B;  4UW2 A;  3E3X A;  3KK1 B;  3OTB A;  3HZG A;  3UN5 A;  4DJB A;  2JFK A;  4I69 A;  8AT1 B;  3OBI A;  3AA9 A;  2P9E A;  4WP9 A;  4K4Y A;  3KLH A;  1V3R A;  4I6W A;  1CLF A;  4DV2 F;  1VBX A;  3NGK A;  3L7O A;  4F3O A;  4OX7 A;  5T7L B;  1SH0 A;  3O2I A;  1RZM A;  3ZXW A;  3UCG A;  1B0T A;  4R0E A;  4N5S A;  4YDD B;  3M2U B;  1XWL A;  2HGM A;  5F0U A;  4EFA C;  1GTE A;  2APO A;  3PRV A;  4ZCL A;  1DTT B;  1S97 A;  4EBE A;  1S0O A;  1DFD A;  3C6U A;  3VF0 B;  3BR9 A;  2XS2 A;  1F6T A;  3CJQ A;  1X8D A;  5K8O A;  2R2S A;  2UP1 A;  1NO8 A;  3IGN A;  1OQ3 A;  5KFL A;  1RAH B;  3QO9 B;  2YWF A;  2W9C A;  4WZM A;  2ADC A;  5KG6 A;  4ZP6 A;  3DRP B;  4JI4 J;  3GJR B;  1UEU A;  3OR2 A;  2NXN A;  3N5B A;  1SJ1 A;  4JI0 J;  2UUA J;  3BYR A;  2E1M C;  2I0X A;  1CPZ A;  8ATC B;  4Y6I A;  1PJ5 A;  4LT6 A;  1NDC A;  3EPI A;  4N56 A;  1LXJ A;  5B0D A;  4NWB A;  1G3O A;  1YIJ S;  4OZ5 A;  3R5B A;  1SJQ A;  5LMN J;  1OJ4 A;  3D3B J;  2GAH C;  3H7H B;  3ITH A;  5E3A A;  2CWK A;  2UUC F;  4NA3 A;  4MH8 A;  2ZBC A;  4URS A;  2DGV A;  1B64 A;  1CJU B;  3SDE A;  2ZH4 A;  3MAQ A;  4LFC J;  2HHV A;  4WZQ A;  4NPO A;  4D3H A;  5K14 A;  4WE1 B;  1TMJ A;  3NG8 A;  4CO1 A;  4KH1 B;  1UW9 A;  4JP8 A;  1HWK A;  3D2W A;  2HQF A;  4CLT A;  1F2H A;  4UQT A;  4R5P B;  3JYT A;  4OLP A;  5RUB A;  3BR8 A;  2WW8 A;  4K0K J;  3GU0 A;  3AJ1 A;  3A8J A;  1R8A A;  2ROE A;  2ADB A;  4BC7 A;  2RHQ B;  2IDE A;  2WRM A;  4P6Q A;  3DRR B;  2RDI A;  1OY9 A;  4C8L A;  1J5E F;  4X4U A;  3CDB A;  4PAB A;  2UXB F;  2VPZ B;  2FJD B;  5KFU A;  4YY3 F;  2YWH A;  4TKT A;  2VD3 A;  1Z4U A;  1L3V A;  3MFI A;  1DQ8 A;  3EXC X;  1HQE B;  2FDN A;  3KHH A;  1U7L A;  4WXW A;  2I8E A;  1EAR A;  1VRQ C;  3G82 B;  4CLS A;  4G1I A;  2A6O A;  4DQQ A;  4MFB B;  2DPJ A;  2Y0S D;  1MML A;  2DHS A;  3QID A;  3D66 A;  5D3G A;  5ETP A;  1FJG J;  3HSD A;  1QTN B;  1N54 B;  1VRU A;  1RJJ A;  2R7S A;  1TKZ B;  5D0E A;  3BH6 B;  3KUH A;  1ZPW X;  3H90 A;  3I0S B;  4CLZ A;  4AD6 A;  2MKK A;  3UDL A;  4A8Q A;  3CC4 S;  3HVA A;  4GKK F;  5KFE A;  4ILM A;  2E29 A;  1RWX B;  2EFQ A;  2RIL A;  4DMZ A;  3M8P A;  1RT4 A;  2ZHO A;  2V8D A;  5E7O B;  2RS8 A;  2BBE A;  1TEL A;  1XMQ F;  1ICE B;  2KYX A;  1RAE B;  3BPS P;  1SH2 A;  3FDS A;  1RAI B;  3R1L A;  4NOH A;  3LP1 B;  1NJX A;  1NBE B;  1N5Y B;  3NCR A;  4D3G A;  4DV4 J;  2Q79 A;  1N34 J;  1N36 F;  2Q6C A;  4O44 B;  3FSX A;  2VV5 A;  4HTI A;  1JLQ A;  2MEW A;  2ZH5 A;  2RML A;  1WF2 A;  1VQ6 S;  3SCJ E;  4CLL A;  2BYC A;  5HI7 A;  4MMO A;  5HAO A;  2FJX A;  3L95 X;  3J7Z T;  3LGM A;  2U2F A;  1HWL A;  2MDA A;  2CQ3 A;  4KT0 C;  3BGL A;  4NLV A;  2CIM A;  5CAA A;  2J76 E;  1S1X A;  4K8R A;  5BJR A;  4NEZ A;  4JI6 F;  5HRO B;  3C66 A;  3QT7 A;  2HVI A;  3EX7 B;  2VAS A;  1WDD A;  4A8O A;  4Z7C A;  4M63 A;  4NLU A;  3EVM A;  1M5P C;  4CLU A;  3E2E A;  1UCN A;  2V69 A;  4MKA A;  3KK3 A;  3ADA C;  4M8L A;  1K73 T;  3M2V A;  2JEI A;  4B3R F;  3IBC B;  3BSN A;  2W8K A;  2G2O A;  4S0M A;  3I55 S;  4DR7 J;  3PY8 A;  1IKY B;  2HNZ A;  3SZ2 A;  2BKO A;  4CNY A;  3IN5 A;  2Q66 A;  1D9D A;  4JBC A;  4ZDN A;  2D9P A;  2J0W A;  4DV6 J;  5GMD A;  3T5H A;  3AAW B;  1ZM2 A;  1WOP A;  3CCS S;  1RAJ A;  2ROP A;  2CXE A;  4NZ7 A;  1U1M A;  1WD6 A;  1FER A;  1PAU B;  3UPF A;  3K7R A;  3LQV A;  4QIV A;  1YGY A;  3ISN D;  4JI7 F;  5DZ6 A;  2XI3 A;  1HHQ A;  4KGK A;  1S6P B;  5IZH A;  4UUW A;  3MMC B;  1RTH B;  2EFN A;  5A8K B;  1C1C A;  3TZW A;  4ALZ A;  2JJ4 D;  1L3T A;  2QLF B;  3G4S S;  1PCA A;  1NK8 A;  1GEH A;  2YQ1 A;  1RAD B;  2MJU A;  1TTH B;  2OAU A;  3MMA A;  4O3Q A;  3D6H B;  5D8H B;  3CCW A;  1BGX T;  1GNK A;  1YI2 S;  2G0C A;  3FVY A;  1NZA A;  2FLL A;  5DLG A;  1HMV B;  5IV4 A;  2DHH A;  3KK2 B;  2H5I B;  3HKZ D;  2YQ0 A;  5HQL A;  1G6B A;  3PAC A;  1FRJ A;  4MIA A;  2XWY A;  2CQB A;  3OUY A;  3UDC A;  2N82 B;  5GAD I;  4C9D A;  5D0G A;  1EET A;  3VR1 A;  4U8V A;  4JI8 F;  2ZNZ A;  2EEY A;  2HVH A;  4DL6 A;  4PG8 A;  1S48 A;  4B9M A;  2LQB A;  2YWE A;  3HVW A;  1Y5I B;  2K7K A;  2IDL A;  3QIP A;  3FQL A;  3LP0 B;  4LF7 J;  2M5Y A;  3HJV A;  5CYQ B;  3Q8P B;  1VQ9 S;  4WF9 Q;  4J37 A;  4ZKA A;  4M5J A;  3SSR A;  1TKT B;  1SVD A;  3VWS A;  4DV0 J;  4PWD A;  2LKZ A;  3LF0 A;  3ISZ A;  1YJW S;  3TRG A;  3THV A;  2NXU A;  3W2W A;  2OHD A;  3FMB A;  4PYA A;  1QSS A;  3P8B B;  2FHJ A;  3CSK A;  3U02 A;  1IKV B;  2YPY A;  3U1M A;  2DH9 A;  5IOL A;  1T9Y A;  1VFJ A;  1D1U A;  1RP5 A;  4J9P A;  1RHR B;  1NHU A;  2ZKU A;  1L5U A;  4QBU A;  2MLY A;  5A2Q U;  1UVL A;  4LBH A;  2JSX A;  4U67 Q;  1X7V A;  1YG0 A;  3PZP A;  4P9S A;  1YJ9 S;  4P2S A;  2D3O 1;  3GIL A;  3TUZ C;  1X5P A;  1YTY A;  3W63 A;  2DXD A;  4F7V A;  5C25 B;  2XZW A;  2CQI A;  2V4R A;  4JI3 F;  2CZ4 A;  1TKX B;  2MTL A;  1UL3 A;  2Q6B A;  1UET A;  2CPY A;  3MM6 A;  3CDE A;  4AL5 A;  4MK7 A;  3UD5 A;  4ZVE A;  1FX2 A;  3KLI B;  2HNY A;  3JS9 A;  1TAU A;  2FZK B;  3BBC A;  5E2Q A;  2XYH B;  3TNV A;  4KSE B;  1KNZ A;  3TZX A;  4C3K A;  2RKI A;  5HSP A;  1M5H A;  2VBW A;  1P8G A;  1CJV A;  2ZD1 A;  2XTJ P;  1GFW B;  2GIQ A;  5DG9 A;  2PMW A;  3DRX A;  4ES3 A;  1X4E A;  4DUY J;  2DRB A;  1NK0 A;  3O6Q A;  2AJ4 A;  3OLA A;  2C28 A;  4UQG A;  1FJ7 A;  1A9N B;  2FC8 A;  1F5A A;  4YR0 A;  1S77 D;  5GAG I;  1FA0 A;  4ILL A;  3W5Y A;  3FFI A;  4YB7 A;  3CUN A;  5A0Y A;  2QMX A;  5LXY A;  2YNF B;  4ID5 B;  5KFF A;  4N7T A;  1VIO A;  3EMT A;  3TAM B;  1OPZ A;  4O3R A;  1FNX H;  5KFQ A;  2RAQ A;  1IWG A;  1FRL A;  3S6E A;  1FFS B;  4N77 A;  3C14 B;  1Z2L A;  3VGT A;  1G1X A;  2MKY A;  5HLF B;  3QFW A;  3L4B C;  1QSY A;  5J2P A;  3J81 j;  3VAI A;  1FKP A;  2HVE A;  2GMH A;  3CD0 A;  2OI2 A;  4DLE A;  2W2N P;  1LWE A;  2Z30 B;  3T1A A;  3GJT B;  3W5Z A;  1WKK A;  1R7I A;  1S9E A;  2J6S A;  3Q2S C;  2CJQ A;  2V50 A;  1RHK B;  5BR8 F;  4OZ1 A;  2UVW A;  4DPY A;  1E6V B;  3V81 A;  2RF2 A;  4NA2 A;  2UVU A;  3ILL A;  4WFZ A;  4F3M A;  1SQF A;  2YKP A;  3AJ2 A;  4DFP A;  2HLT A;  2DR5 A;  1KLM B;  4PXD A;  1VK8 A;  3NL0 A;  4KGV B;  4TN2 A;  1PC4 A;  2NUH A;  3DLJ A;  2R7X A;  3B4M A;  4I68 A;  5B0A A;  1DTQ A;  4MIB A;  1HD1 A;  1JLE A;  2KI2 A;  1WI8 A;  3R7S B;  1FD8 A;  2FZC B;  2BRK A;  5C42 B;  1JIH A;  1TFW A;  1IJF B;  2W2M P;  1B3T A;  2ALY B;  3SCL E;  4QZV B;  3QZ7 A;  4Q8F A;  4P2X A;  5DDQ C;  4C11 A;  2R7Q A;  2KJV A;  4F4K A;  1KFD A;  4H4M B;  2E5I A;  3CDA A;  1RT3 B;  3SXL A;  2D3U A;  4OMF G;  4LFA J;  4O0I A;  2FC9 A;  2M9K A;  3CD7 A;  2W4D A;  2BJ9 A;  3N0V A;  3IR6 B;  2EG2 A;  4QR0 A;  3NP5 A;  4TYA A;  3GZ7 A;  1X9W A;  5H9E J;  3TA0 A;  1KON A;  1CJT B;  2W24 A;  2OSR A;  2PGC A;  1WOS A;  2YKM A;  4I1T A;  4RW6 B;  4H4O B;  1BC6 A;  2HFO A;  1CEZ A;  3CJ3 A;  5HP1 B;  3CJ5 A;  1RAG B;  1HNX J;  1VDH A;  2E44 A;  1B7Y B;  1RWU A;  5ETM A;  4LIW A;  3NKY A;  3MM9 A;  3D7S B;  4XPC A;  4LF4 F;  4OYW A;  3W2V B;  3ET6 B;  1SL0 A;  1X4F A;  4RW4 B;  3OR1 B;  4CH0 S;  4ED8 A;  2YBV A;  2G13 A;  2MQM A;  5DG8 A;  1YK9 A;  5DM7 Q;  4OYA A;  3HDS A;  3Q8V A;  1LW2 A;  3MEC A;  4LFB J;  4ZIW A;  2I5J A;  4FZV A;  3E01 A;  5IT0 A;  3DLL Q;  4F3Q A;  1BD6 A;  2C2E A;  1VQ5 S;  3O44 A;  4KHP J;  2CQ4 A;  5JUM A;  4ED3 A;  3QWU A;  2EK1 A;  3ZZZ A;  1EKR A;  1HBO A;  3QGP A;  3W8G A;  4PXB A;  4OZJ A;  3ZZR A;  1OWX A;  2KXN B;  2RIJ A;  3OFG A;  3CJK A;  3ZZT A;  2CZ9 A;  4EO6 A;  1EKS A;  4RW9 A;  3HLU A;  3HFV A;  4P74 A;  2B4U A;  3KHG A;  1D8Y A;  2V34 A;  1S6O A;  5CQG A;  3MAA B;  5HMX A;  4J9U E;  1UAW A;  1KFS A;  3KDN A;  1M5S A;  3VV2 B;  4M5L A;  1Q4R A;  2NYH A;  2XZT B;  4USW A;  3RAM A;  5DM6 Q;  3QJP A;  1AUS L;  1AFI A;  3UE2 A;  4PQU B;  4WJB A;  2CQD A;  3J80 Y;  2KFY A;  4PXE A;  2VG7 B;  1WKJ A;  2DTJ A;  3PKM A;  3Q24 A;  2C2R A;  3EJM A;  1GMW D;  1MMN A;  3ZZP A;  3P5T L;  4DPT A;  1NXI A;  3SI8 A;  2RB7 A;  4C4W A;  3DN9 A;  4DSE A;  1NHV A;  4CIO A;  4J9M A;  2OPP A;  2QRR A;  3VCD A;  2AV5 A;  2V4Q A;  5D15 A;  2M88 A;  3KK1 A;  3MPY A;  2KTQ A;  3K5N A;  2OJ3 A;  4PEO A;  2BE7 D;  1R27 B;  2W1B A;  4J9K A;  5L8R C;  3A3N B;  1U48 A;  5F3Z A;  2DIS A;  2WZ1 A;  3RB0 A;  5IC4 B;  3MCN A;  2QZ8 A;  1U47 A;  4DOZ A;  2YWG A;  5T7L A;  1WG4 A;  3BBF A;  5KFI A;  2ERR A;  5B0F A;  3H98 A;  1PBA A;  1KLN A;  4JI4 F;  5AXK A;  4HKQ A;  4X4P A;  4LF2 A;  1I6J A;  2VFT A;  4JI0 F;  3NAI A;  1OIA A;  1XN9 A;  1SKS A;  4Q45 A;  3TJ9 A;  1QM9 A;  3WZ0 A;  3A13 A;  4M1K A;  3W1Y C;  3I56 S;  4AL6 A;  2E5L J;  1T3N A;  1DTT A;  1T9V A;  2QSF A;  3L7U A;  3ZZU A;  2C22 A;  5HL7 Q;  2ZUA A;  4X65 J;  1RA6 A;  2GNK A;  3ETM A;  5LMN F;  5U47 A;  2VKR A;  5EX0 A;  3PRB A;  4B3S J;  1FO1 A;  1Z2Z A;  4ED6 A;  2XMW A;  3QO9 A;  2R4F A;  1TK8 A;  2LEB A;  3R2D J;  1UVJ A;  2ZUG A;  5LM7 E;  3W66 A;  1UWB B;  1H74 A;  4JV2 A;  5AJ3 J;  4LFC F;  3DRP A;  3OD2 A;  3TEH B;  2R8K A;  2CKW A;  2ACM A;  4DEZ A;  4LF5 J;  3MDF A;  1LWF B;  2HBR B;  2QN6 B;  4O4G A;  3T5L A;  1S4E A;  1U2F A;  4ZP7 A;  3HHL B;  1VQO S;  1F3V A;  4OIX A;  4K0K F;  4USI A;  1NPR A;  4IH7 A;  3BV8 A;  1MWZ A;  1HNI B;  5B7W A;  2EWH A;  4UOF A;  4URG A;  3HHE A;  2F8E X;  2OUG A;  4OHY A;  2KB2 A;  2V4J B;  1VQ7 S;  1CJU A;  2VPW B;  2ATL A;  2ZWO A;  2IM2 A;  3TAP A;  4FVM A;  3I4P A;  1IR2 A;  2E5H A;  3AY0 A;  4WE1 A;  1SB6 A;  2UU9 J;  2VA3 A;  1U1O A;  2HND B;  4OYZ A;  2BOA A;  2OP5 A;  2BOP A;  4ZIT A;  3CCU S;  2G0I A;  4KV8 B;  3GV5 B;  2DNY A;  4I56 A;  3W61 A;  3KNG A;  2JEJ A;  2YTC A;  2HHW A;  2FVQ A;  3AD7 C;  1EQM A;  3DKD A;  2AHO B;  4TQS A;  2XEX A;  2HQG A;  5IXU A;  1ROF A;  1OYD A;  1YJN S;  2OFG X;  2B4P A;  2Y9H A;  3J81 U;  2ZH6 A;  5BXI A;  3PHT A;  2CJY B;  3M8Q A;  4P2M A;  2CQ2 A;  2AKW B;  2IMO A;  4WYW A;  3QRP A;  3G82 A;  4AND A;  2RJZ A;  1KQG B;  3QT6 A;  4DV4 F;  2QE5 A;  1JXL A;  2FVC A;  1X60 A;  2BRL A;  1SQE A;  2D41 A;  5ETK A;  1H7X A;  1JJC B;  2ZNY A;  1TKZ A;  4F4A A;  3OPK A;  2HRU A;  4LF8 J;  3I0S A;  5C2G A;  4AQY J;  1N6Q B;  1GMU A;  1OQ6 A;  1EHW A;  1FI4 A;  1HW9 A;  4O4R A;  4X84 A;  4ZP9 A;  2J0S D;  3HD2 A;  1JJ4 A;  1TL5 A;  4OYM A;  1OSD A;  2LYV A;  1YWX A;  2XNQ A;  4K4S A;  3Q8Q B;  2PEH A;  3LP1 A;  1X0P A;  5HMY A;  1L3K A;  1KRP A;  2RUG A;  1QD1 A;  4DN0 A;  5DZ7 A;  2C2M B;  1N5Y A;  4M5I A;  1C0T B;  1P6T A;  4Q8E A;  1FX4 A;  4KBI A;  1XEZ A;  1N48 A;  4WFB Q;  3M8Z A;  5DQH A;  3GTY X;  5IM0 A;  1RIS A;  4O44 A;  1WI6 A;  4Y34 A;  3OVA A;  3D1Q A;  4DV7 J;  3K59 A;  1O6X A;  2R7T A;  2A10 A;  4F04 B;  4DR7 F;  3MR6 A;  1R89 A;  3OVS A;  1HYS B;  3PJX A;  1SJ3 P;  2G4B A;  4ITS A;  2CVI A;  4ZVP B;  2MPU A;  1Y3J A;  2BAN B;  4BBY A;  2GVZ B;  1R8P A;  1HR0 F;  5HRO A;  5KT2 A;  2RU3 A;  2M0G B;  2CQG A;  2Y1R I;  2O3D A;  3TUP A;  2DO0 A;  4F02 A;  3BDE A;  4E8U A;  4OYI A;  2MZT A;  1RWK B;  3BQ1 A;  4OZN A;  3GG1 A;  4A8S A;  2XMM A;  1Q5Y A;  4ETX A;  1NDL A;  2E1R A;  3T1H J;  2QGF B;  1YRT A;  1F9E B;  1RT6 B;  2LQ5 A;  3DMJ B;  4O0N A;  3SSS A;  1IKY A;  3KJV A;  5GAD U;  2DNN A;  3JAM U;  4F25 A;  4ZS6 A;  3KLG B;  2ZBQ A;  3VGV A;  4EEY A;  3A12 A;  3D0H E;  5ETT A;  4P7V A;  3GIK A;  1HBM B;  1H38 A;  3R8Y A;  4K4Z A;  1FRK A;  2V68 A;  2V8H A;  4PKD B;  4Y2I A;  3MR2 A;  1XMO J;  1S6P A;  4FS2 A;  2QL7 B;  3RW6 A;  3KHL A;  1RTH A;  1H6K X;  1R0B G;  1I51 B;  4QOT A;  4ID8 A;  4A4J A;  1HNV B;  5DGA A;  4LF7 F;  2LA6 A;  5FDL B;  4A8Y A;  3H8Y A;  2GQQ A;  1VLO A;  1RLD A;  2CQP A;  4DV0 F;  4Z37 A;  1ZM3 A;  5L9N A;  3MFH A;  1VCT A;  4P10 A;  2ZH9 A;  3QGG A;  3ICL A;  1FFW B;  3FC9 A;  2ALZ A;  2C3P A;  2YX4 A;  1S49 A;  3DLK B;  1HMV A;  3M2R B;  3GQC A;  3VQT A;  4I64 A;  3HZE A;  3TJA A;  4M5N A;  4QU6 A;  2XGQ A;  2BZ2 A;  4QYZ K;  4UUX A;  3FJ2 A;  4ZVS B;  2C3O A;  2CJA A;  2MLZ A;  4QQB A;  3Q0A A;  2AJ2 A;  4F4Z A;  3HO1 A;  3ZFV A;  3AOA A;  2GJF A;  1LWX A;  2KN4 A;  1D9A A;  2VQF J;  3LP0 A;  3KYL A;  1R3N A;  5CYQ A;  2QLW A;  4NL5 A;  1TKT A;  3QFH A;  2RRN A;  5GAH I;  1XK8 A;  1TL7 B;  4PAA A;  1V3Z A;  3QGH A;  2K3I A;  1JX4 A;  4Q0B B;  3D68 A;  4RNM A;  3MED B;  5K8N A;  3U7J A;  5F8M A;  2C3Y A;  3BF4 A;  3J7A N;  2LU2 A;  3DI6 A;  1GMV A;  4UY8 5;  1IKV A;  2AJQ A;  1SL2 A;  2ATC B;  3MM7 B;  5E0O A;  2EG1 A;  4XPE A;  1X0F A;  5F9N A;  4NCA A;  3TQ1 A;  1FXL A;  2HHQ A;  4LUB A;  1ZBT A;  1RWW B;  2FLP A;  4DU7 A;  4IG3 B;  2BAC A;  2EKN A;  2DNH A;  3J7Y I;  3KKF A;  3H40 A;  3R5J B;  4X66 J;  2MQL A;  4QPX A;  5GAG U;  3W65 A;  4DFJ A;  3RR8 A;  4N8N A;  4TU7 A;  2FY8 A;  5C25 A;  2CVE A;  2RRA A;  1TKX A;  4DUY F;  3AHP A;  5J2N B;  4ECR A;  4MKV A;  5AE2 A;  4JI1 J;  2DGX A;  3FZ2 A;  4WII A;  3C16 B;  4OJH A;  5KG5 A;  3KLI A;  1A7G E;  4GKJ J;  3IG1 B;  2UUT A;  3R97 A;  5LSO A;  2UZA A;  2HHX A;  2E1A A;  2UVV A;  4RKU C;  4YUD A;  3OTO J;  5A2Q Y;  4UST A;  3CTR A;  1FXR A;  5D4O A;  2GIF A;  2DNP A;  2M3D A;  2GHW A;  1XR6 A;  4ZOS A;  4ZCK A;  2RNE A;  1NLK L;  2KT3 A;  2AYG A;  3PEH A;  3AB2 B;  5J1N A;  3HSG A;  2YH1 A;  3C6U B;  2RQ4 A;  1KQF B;  2WON B;  3TWZ A;  5KFN A;  3ENQ A;  3MUV P;  3CB4 A;  5KFC A;  2KXH A;  3RJM B;  3PR5 B;  5CYJ A;  5C24 B;  3OXG A;  2P5V A;  4E0D A;  3NBP B;  1GT8 A;  5KFB A;  3OR2 B;  1CJK B;  2YNF A;  1VJW A;  2C2K B;  2HWH A;  4ID5 A;  3PO4 A;  2ZC4 A;  1CG2 A;  5JJB A;  3I0R B;  3M6U A;  1M1G A;  4PG6 A;  5G0R B;  3C14 A;  4FYV B;  1JNZ B;  5IQQ A;  4RL1 A;  2IM0 A;  3JXO A;  4DR4 J;  1SXL A;  5HLF A;  5LMU J;  2YKN B;  4L73 A;  3ITH B;  2NXC A;  2AJF E;  1RGV A;  3BKU A;  4ECT A;  1YSJ A;  3QAU A;  2KFN A;  1KVJ A;  3X3U A;  3SDE B;  3CWJ A;  1E6Y B;  3LO3 A;  4M5G A;  2KZZ A;  4DCP B;  2ZOG A;  1U1L A;  2BKN A;  3OFH A;  3R3T A;  1AFJ A;  5K14 B;  2VG5 B;  5A6W A;  1E6V A;  4HL9 A;  2E9T A;  4UF4 A;  3ENA A;  4LFA F;  3A4T A;  2MY7 A;  4DI6 A;  2HBZ B;  3JYT B;  3SCI E;  1KLM A;  2HIQ A;  3NMA A;  4Y28 C;  3T1Y J;  3T19 A;  3NGU A;  2NXE A;  3GIJ A;  2FHM A;  1P9Y A;  2RH3 A;  1J27 A;  3FCV A;  4RO0 A;  1M5K C;  2OO4 A;  3SIP B;  5GMK a;  4KHM A;  5C42 A;  4HH0 A;  3PYF A;  3BSO A;  4EBD A;  1WHV A;  2HWT A;  4NLX A;  1HNX F;  3B54 A;  1S5Z A;  2L9N A;  3FRY A;  4H4M A;  4ZP8 A;  4ANC A;  2WB4 A;  1RT3 A;  5CZX A;  3M6W A;  3VTI A;  2RUS A;  2IRX A;  3JQK A;  5C2C A;  2WVF A;  4B9V A;  3CCZ A;  3DYA A;  1NCL A;  2ROG A;  4ZLL A;  2KG1 A;  2K06 A;  2DGO A;  3H5U A;  2M7S A;  1VRU B;  4GVB B;  1N32 J;  4LFB F;  3Q8U A;  2IA6 A;  4OLO A;  2HYI B;  3BRE A;  3PVX A;  2ILZ A;  3V4I B;  1CJT A;  5K9F A;  2ZIT A;  1YBT A;  4KHP F;  5FLX U;  3M05 A;  3AD9 C;  2OD4 A;  3D6F B;  1Y11 A;  4RW6 A;  4H4O A;  2HK3 A;  4GC7 A;  3G6Y A;  3MD1 A;  2AYM A;  5LL6 d;  3UNY A;  1LWC B;  2HHH J;  2R8I A;  2M52 A;  1T94 A;  2AQ4 A;  1KVI A;  2ZHB A;  3LPY A;  4DF8 A;  1BWV A;  1JLA A;  2JC1 A;  4LBP A;  1QVF R;  4RW4 A;  3OR1 A;  5ETL A;  3G2X A;  5KG1 A;  1LW0 A;  1SPB P;  1TUV A;  3DLB A;  3JTN A;  2FJW A;  5L39 A;  3MUT P;  2D74 B;  1JLQ B;  1JQG A;  2WCX A;  2C1E B;  5D0H A;  4DL2 A;  2NRE A;  3GJS B;  5I3U B;  4H54 A;  4ZVO B;  1H73 A;  3FSI A;  4OX8 A;  2DXE A;  2VFR A;  3DRS B;  3B4D A;  1NH8 A;  1VQM S;  2NPF A;  2QV6 A;  3HHL C;  4NE9 C;  2MXY A;  1IQT A;  3K58 A;  3RRK A;  3NMR A;  4WU2 A;  2L48 A;  2XCP A;  2R7O A;  5IT9 U;  1R0A B;  3KHR A;  3HUL A;  1P1L A;  3MAA A;  3VVU A;  3P96 A;  1K8A T;  1YQH A;  2A1B A;  2VPY B;  1MWY A;  1UWA A;  3PFO A;  2DHG A;  3FZB A;  3CW2 C;  3EVO A;  4LRB A;  4ZPD A;  3RRG A;  1QAX A;  1K47 A;  2VG7 A;  1SJF A;  1QY7 A;  3R5G A;  4JOU A;  3TZZ A;  1Y5L B;  4B9T A;  3BSA A;  4J7C A;  1H7W A;  2KFZ A;  1DQA A;  3PHE A;  1L3S A;  2UV8 A;  2E5L F;  3DOK A;  3UO0 A;  4MYT A;  4FPR A;  3DXS X;  3QT5 A;  1VQN S;  4X65 F;  2VUG A;  2BVZ A;  1X31 C;  2XHW A;  2NLW A;  2RQM A;  1NHK L;  2C2O B;  3OJS A;  4B3S F;  2GO9 A;  3M8W A;  4ZN3 A;  3W64 A;  4PWW A;  4ED2 A;  1EP4 B;  2WAQ D;  4OI3 A;  3TAN A;  1N52 B;  2V63 A;  3V5R A;  5AJ3 F;  1S72 S;  1Q7L B;  2MZR A;  1GK8 A;  3D3C J;  1T7P A;  5HK4 A;  3O5T B;  4LF5 F;  1HBU B;  1X5O A;  3VZH A;  2GC8 A;  4XDC A;  3UCU P;  3FEY B;  4G1Q B;  1VYA A;  2BW7 A;  3V2U C;  1LNQ A;  1XNR F;  1WC0 A;  4LR8 A;  1ZAX A;  2F63 A;  2ZOM A;  4WYL A;  4TU8 A;  4RWX A;  2Y8W A;  4KR0 B;  4N8O A;  1IBM J;  1W26 A;  4Y2A A;  2FJE B;  2AGO A;  5B0B A;  4DR6 J;  4RNN A;  1EZZ B;  1Y3K A;  4Y00 A;  3IP0 A;  5M2P A;  4B3T F;  1XC9 A;  2MB0 B;  2QL9 B;  3LW5 C;  2UU9 F;  3CC2 S;  1VC0 A;  1LWF A;  4IH6 A;  1U25 A;  2IIH A;  2FY1 A;  2PE8 A;  2N7C A;  3OL7 A;  4ES2 A;  3HHL A;  2OKQ A;  3IFE A;  4I6A A;  3JTO A;  3TO8 A;  1RBO B;  3DGV A;  4KFB B;  3H2L A;  4KKO A;  3CCL S;  4V1A k;  3UDE A;  2M8H A;  5FII A;  4DS5 A;  3KJF B;  2RRB A;  1Q95 G;  1MWQ A;  2ZZM A;  4CQ1 A;  2V4J A;  1R8H A;  4O3O A;  3LAL A;  1W25 A;  3H2V E;  3LPE A;  1JB0 C;  2H65 B;  3N6M A;  2XUL A;  1JLF A;  4USK A;  1TAQ A;  4EK2 A;  3MMJ A;  2DGT A;  2HND A;  4PYD A;  4DR3 J;  2HFS A;  3G6V A;  4WIQ A;  2J0Q D;  4KV8 A;  3UR0 A;  4CTA A;  5EGY A;  1YIT S;  1WC4 A;  3NS6 A;  3VGU A;  3MM6 B;  4LF8 F;  2HNY B;  3PDN A;  4F26 A;  1S7H A;  1YLX A;  3GSI A;  4BCA A;  1LK7 A;  1CBK A;  3IMQ J;  4ZA1 A;  5I42 B;  3VAJ A;  4DUZ J;  1FRX A;  2ZEJ A;  5F8H A;  2ZM6 J;  4DSI A;  4AYB D;  1SC6 A;  2QG9 B;  4FS1 A;  2PA3 A;  4M5K A;  2G2Y A;  1CJV B;  4RZR A;  3OV7 A;  2OEJ A;  1U1N A;  3A8K A;  4BLG A;  1S9G B;  1XMB A;  2EFG A;  2I1R A;  4DV7 F;  1NKE A;  3CCM S;  1N6Q A;  1DRZ A;  2A18 A;  3J7A 1;  2A2C A;  4IO9 Q;  3QRQ A;  5EWF A;  3J81 Y;  5F3T A;  2UXD J;  4YN3 B;  2ZKT A;  2FGC A;  4DV5 F;  5KFM A;  4RJV A;  2NZ4 A;  1RWV B;  1F1B B;  1GH8 A;  2GML A;  2AU0 A;  2LXI A;  1C0T A;  3KG4 A;  2XMU A;  4K7Q A;  2GGP A;  1ZAW A;  3HP6 A;  3NLC A;  4LSL B;  1KHV A;  3DHW C;  2BEF A;  5HQM A;  3LGH A;  3C3L A;  2D3O R;  3TVK A;  3QYY A;  1VS3 A;  5I3P A;  3GFY A;  4ZLP A;  2B8Q A;  1S9E B;  3JQJ A;  2DCL A;  4R0J A; 
#chains in the Genus database with same CATH homology
 3DOM B;  2JNJ A;  3DGP B;  1YDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...