3DGPB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
total genus 19
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3dgpB00
2JNJA 3DGPB 3DOMB 1YDLA
chains in the Genus database with same CATH superfamily
4RU9A 3M30A 1Q8BA 4EK2A 3Q22A 3V6JA 2RSQA 1GMWD 2BABA 2PMWA 3IP0A 3CSKA 1TUVA 4IFYA 2VD3A 4ID5B 1VQ8S 2ZWPA 1B70B 1KOOA 2F4FA 2FHKA 2ZUGA 3MM6B 3TW0A 4X66J 2ZWOA 4ID5A 4OMFG 2XC9A 1XNRF 1B7YB 4F4KA 5F41A 1U1PA 2HPUA 5BYRA 2MKKA 5ETLA 2NXUA 2DR5A 5L9XA 3CEDA 1OJ4A 1X0FA 1BLUA 2MY8A 3NG8A 2D7SA 4V1Ak 3JAMU 4KHPF 1H73A 4NA1A 1JLQA 5IS2A 2DB1A 5EN1A 1SB6A 1WHYA 2KYZA 2PMHA 3QATA 4ED6A 1H72C 2HFNA 4RUAA 4ZVPB 1TKDA 1FKPB 2EFVA 4CYUB 3Q23A 4TNOA 1RTDA 5D4OA 4RW4B 3QRRA 2NPIA 2YX7A 2OP5A 1NJYA 1U7LA 1DY3A 3CCWA 3L7PA 5HAOA 1KEKA 3MMBB 3AQPA 2ASDA 4YDXA 1FFSB 1N0VC 2BACA 4EU0A 1M1KT 4DQSA 3C66A 4JI8F 2V9WA 4I67A 2MJUA 3D1QA 5FD1A 3W2WA 1CJKA 3MHYA 4USMA 2IDLA 3POTA 4G1QA 5E2QA 2A3JA 3BN4A 3KK2A 3D2WA 1N48A 1NKBA 1FEEA 2ZVSA 3PFEA 2DNRA 4MIAA 1VR6A 4U8VA 1DQ9A 3RJMB 4BC7A 5C2GA 2XEXA 1TL3A 1RWXB 3SCKE 2DD8S 2HFVA 4HHJA 1DBDA 3OL8A 2DNPA 3JYTA 3ZZPA 1FESA 1S1VB 2R7WA 1NB2A 2KDOA 1DLOB 2HHHF 5LMUJ 2QGFB 4EI2A 4U95A 2AEMA 4C3KA 3W5XA 2HHSA 4DPTA 4ERDA 4UOCA 4KKOA 1FK9A 1R8PA 2KM8C 4FBTA 3LAKA 4LMZA 1HMVB 3F0NA 4HI1A 1LNQA 1X7VA 1HBOB 3OTCA 4IFVA 4KGMA 4PXEA 3TVYA 1N52B 1UEVA 4DX6A 4K4WA 4PUOB 1FE4A 2KVIA 1GTHA 2PDAA 2AHOB 4F4YA 1NZAA 1N5YA 2AIRB 2YNGB 3CDEA 5DM7Q 2ZJPQ 3ITHA 5H1SV 2HAFA 3THTA 1HHSA 1T3OA 2GO9A 5F8IA 1SV5A 1FRKA 2YH0A 3V6DB 3IBFB 4K4TA 2EBGA 4LF9F 4LF5J 3UCZP 2KL8A 4DL7A 3K5LA 1U6BA 3ZTQA 3QGGA 3UD3P 3TAPA 4ZLPA 1SJ1A 2VU5A 2F8EX 1M5VC 1YRXA 3N5BA 3H5UA 2QLJB 1SL1A 4OZ1A 4ES3A 5J1EA 2BOAA 2R8KA 3BQ2A 2LXIA 4FBUA 3KLEA 2HHXA 3MGJA 2VF3A 3FEZA 4O44B 5A6WA 1IWGA 4B3OB 1WG5A 2MZQA 2R3VA 5GAGU 1LKZA 4DEZA 3GONA 3D3BJ 2I5JA 3EVMA 3OR2B 2J6SA 2CQ0A 2FJVA 1KVJA 1RCXB 1FX4A 1RWKB 4QU6A 5GADU 4A8SA 2MZRA 4OFZA 1S12A 4NZ0A 3RGIA 1NJWA 5IT9U 2CVIA 4YR3A 3I96A 4J5OA 4RNOA 2ILYA 1T7PA 3N0VA 2COLA 1KOHA 2BE7D 4Q7AA 5K8PA 5A2QY 2UUCJ 4A48A 2AW0A 5A8WA 4DLEA 2NSCA 5IT0A 1QAYA 2H9ZA 5B0FA 1N5TA 2B43A 3TANA 1X9SA 4DU7A 1J5EJ 2RQMA 5ETOA 4K2JA 1TV6B 3CJSA 1MMLA 4NLXA 4F2RA 2JLEA 4TYAA 4WFAQ 3MAQA 4MMOA 1VFJA 2ADCA 5DLFA 2DNLA 2E1RA 3W3SA 1Y11A 2V2QA 3LAMA 4X4PA 5KT6A 1NM2A 4PWUA 1M1HA 4F02A 1UEUA 1KRPA 1PYSB 3OL9A 4B08A 2XLKA 1ZZFA 1D9DA 1RWMB 2OPPB 3IO1A 2EW9A 1KDNA 4QWEA 4DV1F 2FIUA 1MWYA 3Q24A 1J2VA 4P2SA 4WU3A 3V6DA 2QLBB 5KAKA 1RT3A 2D3O1 3C8YA 4CP5A 1N54B 2V6AA 3TEGA 2QX0A 4DFJA 2VHGA 3CB4A 4U96A 5IM0B 4BLGA 3TZYA 1B3TA 1S77D 3RUBL 2MQNA 3QQCD 2JX2A 2W2QP 2M5YA 3QGHA 4PG5A 4J9KA 4DUZF 2Y8WA 1RACB 1RWUA 4X64F 2XMKA 2EI5A 3BS9A 3EGVA 5D15A 8RUCA 2ZBRA 3IFEA 3PYEA 3SCJE 4OLPA 3DN9A 2L9NA 3CDAA 4FF3A 3W9IA 2BJ1A 1D8YA 1E6VA 3GJRB 2MGZA 1HQUA 1KFSA 1FDAA 2UV8A 2HW3A 1RT4B 1GT8A 4ZLLA 1LW2B 2IPOB 2MSSA 1VQ7S 5KFWA 3SIPB 3BPDA 3EVWA 4Q43A 4Q44A 1TKZB 3EDQB 1IJEB 3T19A 1Y7PA 4NMLA 5B0DA 1AXQA 2FHOB 2M8DB 4B17A 3I5BA 4XPEA 3E2EA 1S79A 3IM9A 3TA1A 3HVTB 3RBZA 1KQKA 4C3MA 1OPZA 1RZMA 3BYPA 4WTOB 3QLHA 3KJFB 4LSLA 1QE1B 1P6TA 2BM0A 4FYXB 2ZE2A 3D0GE 3PJWA 4OHXA 1TK5A 3CJKB 5H9FJ 2XQCA 3PNIA 1N32F 2NXCA 5C24B 1JB0C 3EMTA 1WOPA 5LMNF 1ZAWA 4E0DA 2DH8A 1UVKA 4LRCA 1BE4A 2CQ2A 4K0KJ 3OQ2A 2KFNA 1F5AA 3HSDA 3TJ8A 2WONA 2J5AA 4OZ5A 3QFHA 3FDSA 5J2MA 1RK8A 2FHJA 4M5HA 2B3TB 4PPDA 1RTIB 3NL0A 5D78A 1FNMA 2CPZA 2K2PA 4U6PA 1S0VA 4KY3A 4V19X 1T94A 4RW6A 3J81Y 2DNZA 3JQMA 5BYSA 3CMAS 2VQFJ 3W64A 2GGPA 3TQ1A 2VFVA 4OI6A 4UZCA 3GTYX 4WP3A 5J2NB 1YDLA 5I42A 1RI7A 2VODA 3FNNA 5KT4A 4NI2B 2HBZB 4AE5A 3R1LA 2ZUAA 2XI3A 1GQEA 3BBBA 1Q16B 4GVLA 4ILMA 4OX9J 1RYSA 3MECB 3C16B 2HWIA 1RWPB 3ET6B 4FF2A 1QVFR 2FC9A 3T9NA 1T3NA 5AE2A 1X5PA 3FRYA 3MECA 4NCGB 2XLIA 3ZZ0A 4WXWA 4K4YA 4OYWA 5KFYA 3KLVA 2RS2A 3LP1B 2CQBA 4X84A 3CC4S 4HTIA 2IVYA 3FMWA 3M2RA 1RKJA 3CCZA 4EO6A 4P74A 1FKAF 2UXDF 4L3KA 2OFGX 2W7OA 4EZ9A 2D9PA 4KAIA 2C3MA 1BC6A 3BJYA 1GX5A 1RJJA 2RAQA 4KHRA 1TU0B 2CIMA 4EBDA 2B8QA 3CCES 4FYVB 3MM9A 4JI8J 4J91A 1QAJA 1RT2B 1NK9A 1F0XA 2VZ9A 1X9MA 3M05A 2I9SA 2NCKL 3K57A 1UKUA 2BDPA 1D9AA 5J2PA 4JI5J 2IJFA 1LFWA 2XO6A 1GMUA 1FFGB 4DR6J 4PG4A 4QWCA 4CLKA 1PG5B 1C0UA 1RT1B 2CYYA 3KUHA 4YQWA 2FVQA 4B3MJ 2EEYA 2V8VA 3JSMB 1Y10A 4ES2A 4TY9A 2BQUA 1IVZA 4USIA 1PIEA 1NJXA 3OXGA 1U0SA 1JLAA 1R31A 3Q8PB 3IRWP 3BSNA 3EX7B 4U7UK 2DGSA 1REVB 2CQGA 3VWSA 5LSOA 4F04B 2JHEA 3GIRA 3MMBA 4DV0J 2KFZA 1YX2A 3PYDA 1RA6A 4UOFA 5CYMB 1NSQA 3T9ZA 3ULHA 4DUYJ 3S1TA 5ETSA 5U47A 2DR9A 4M5DB 3THVA 3R2CJ 1X60A 4DR4F 1NDPA 2HNDB 1FK9B 2BW7A 2C3YA 2JLGA 1FCAA 1I94J 2YKQA 2DJWA 5DZ6A 4DPYA 2MY7A 2I6WA 2J7KA 5F3TA 2ZBQA 3EZUA 3DLGA 4WE1B 4I6AA 1XWLA 2ZM6J 1KS2A 1DAXA 1KQGB 4R5PB 1HWIA 1DTQA 3LP1A 2IY5B 4U8YA 4HHUA 4ZVQB 5BXIA 3U1MA 1VBKA 5DM6Q 4F0KA 1XMOF 3HHLA 3W8PA 3J7AN 1NCLA 2CJ9A 2KKHA 2QLXA 4IFYB 1SJ3P 2HZAA 4WKRA 3CJ4A 3UDCA 1HBOA 4IFVB 1SH3A 4Y3CA 3TOQA 2BQRA 4F8RA 3M30B 4QBUA 1GH8A 1T05B 4RR5A 2DHXA 5EUHA 2LLZA 2HIQA 2C2ZB 2XYHB 2ZOFA 2W7PA 3U1LA 2ASJA 2U2FA 4BHQA 2QO3A 2PSZA 3MWBA 1I94F 3QT7A 2QA1A 5D3GA 1FXLA 1JWWA 4USWA 2B4UA 3DLKA 2KVQE 4F25A 2XGQA 5E3AA 1VMBA 3MAAA 1YIJS 4DR2J 1TL1A 2AP6A 2JL9A 1JJ2R 2GJFA 2LVWA 3LQVA 4NCAA 1UVMA 3G6YA 2A10A 2LQ5A 2FZCB 2QFIA 2VPZB 3DRSB 2GW8A 4USJC 5KFTA 1VQPS 1T05A 1J5EF 1EIYB 4G3IA 3C3LA 3DLJA 4DQPA 1YBTA 2GHVC 1UTAA 3DRSA 3M2UB 3R3TA 2F3JA 4WK3A 5HMWA 4LRAA 3PR5B 3UDLA 2J6UA 2QEXS 1UW9A 2RF2A 5ETVA 2ZZNA 4MYUA 1H2UX 2W01A 2PA8D 4M5LA 1RISA 2HS0A 2DK2A 2F7VA 5HQ8A 3HT0A 1Q82T 2KZZA 2VASA 4AT1B 1S72S 1BMQB 2ZEJA 3P45B 4N5SA 1R7IA 1NMEB 1X4EA 5B0GA 2UUTA 4ZJQA 4MKAA 4XO0A 4DSJA 2AZ3A 4PQUB 3J7YI 1WOOA 1LQ9A 1W7WA 2GV1A 7FDRA 4FPIA 5LSRA 1QSYA 3PO4A 1HNIA 1GXLA 1RTJA 2BV3A 2GIFA 4C97A 4D3HA 4DSKA 2B4VA 1DLOA 1HIYA 1Z4UA 3ENAA 4NZ7A 3NCRA 4ZCMA 3KFWX 3GMGA 1UJ6A 1I5OB 3JYTB 3RZAA 5KFLA 3GV8B 4NRTA 3PJ9A 1KSPA 4B3TF 3AD7C 1SI9A 2LCWA 2MKHA 1IN0A 4CO4A 4YR2A 3T3FA 3A1YG 2ROPA 4ILRA 1VQMS 1T0TV 5I4MA 1GEHA 3JTNA 2G4BA 4EWTA 2UV8G 1IKXA 4HTJA 2GO8A 3ONQA 2AJ4A 2DKOB 2GS8A 2KT5A 4X64J 4C0BA 2XWXA 4DV3J 1N5YB 1Q95G 2JOQA 2DH7A 3D4JA 1LFPA 2QL7B 3KDNA 4OYAA 2EFPA 5EWGA 1TVRB 1ZTWA 1TAQA 5CHCB 3M32B 5C25B 2DR7A 1UVJA 1RB0A 2ALZA 1NHKL 5K5MA 2ZBPA 4DR3J 1SKWA 3BKFA 2C1EB 3CVKA 4IQMA 3HHDA 4LREA 3R5JB 4O4RA 2CJKA 2E1MC 1JLGA 2ZFHA 2XG8A 4ZN3A 4TQSA 3VAHA 3CO9A 3THPA 2BVZA 2DGVA 3VAJA 3KHRA 1FDNA 5ETQA 3KOAA 4L75A 3MPYA 4FZVA 3K17A 1Y5IB 1XC9A 4FF1A 4LFBJ 1IXKA 1U25A 4Z2XA 3G82B 3QAUA 4U9RA 1KTQA 5KFUA 5G0RB 4FNIA 2PA3A 3B54A 3PXGa 1RBAA 2CUYA 3BDPA 1S6QA 4WIIA 3CTRA 2JRSA 2ZH6A 2AJ2A 2L08A 3W2VB 2X3DA 5EDWA 1HR0J 2HHUA 2ZJQQ 5D0EA 2V0NA 4JI7F 1CJKB 4MK8A 2LDIA 3GILA 1QSSA 5KT2A 3ZZOA 3F44A 3IAM9 4HYKA 1KLMB 4GVBA 5E3QA 1SQFA 2GAGC 2J0SD 2KTQA 2E44A 1UCNA 2VJUA 3CDUA 1N56A 1VRUB 4CZCA 1HNWF 2H51B 1JMTA 4LR7A 4J9RA 4CT9A 3J7A1 1S1TA 3DOKA 3ENQA 3NKYA 1RA7A 1YLXA 4MK7A 4ED0A 4LFBF 2ZH5A 1MU2B 1RT5A 4PQAA 3NGSA 4WPAA 1ZAXA 1R43A 1H98A 2G0JA 1JJ4A 2HVHA 4H4OB 1FE0A 5C2CA 4U7UD 3QLHB 4ZPDA 4ZCKA 2YNFA 4J9UE 2FLLA 4KPYA 1WTFA 2ZKTA 1TMMA 2JFKA 1K1SA 2Q6CA 3B8HA 4RWXA 1Q5VA 1HL6A 2UZAA 2GZOA 3BO3A 4NOHA 2GVZA 5IWAJ 3CJ2A 4PWDA 2QL5B 3MXHP 2R7RA 2BE2B 4DSLA 2VQEF 1KHWA 2M2BA 3KLIA 5EWEA 3H59A 2J9DE 2WB1D 4AXJA 4DX5A 4YB5A 4O3OA 1FDBA 5HP1A 2YNIA 3OSNA 5GADI 2WOMB 5EWFA 1AW0A 1PAUB 4L76A 4N8OA 3HM9A 3AFGA 1I6JA 2FZKB 3V6HA 2XZTB 2Z2YB 3A8IA 2DCLA 3LGMA 4DR7F 3J80Y 5G4DA 4MFBB 1S6OA 2XZWA 3DYAB 4PZVA 1CS4B 2IM3A 2VOOA 1UFWA 1V5IB 1Y3JA 4LJMA 3DYAA 1T11A 2CPFA 3Q86A 4LQ9A 1WDTA 2XLJA 3KNGA 3PM9A 4Y0FA 3OJUA 3EYZA 1H3DA 4LT6A 5CCLA 3CC2S 4GKJJ 1S49A 1DARA 2DGUA 2YKMA 3RB0A 1H7XA 3BH6B 1A7GE 1FRJA 4H54A 2W9AA 2V63A 2HLUA 2MGZB 5K8OA 2BKOA 4PEOA 2XB2D 2XSFA 3K5OA 3R9LA 2J6TA 3HHLC 3N4WA 3QGIA 3FEYB 3AJDA 1H6KX 3AJ2A 1KLMA 3G96A 3KMQA 2XBPA 2ATCB 2DNMA 2JC0A 2QLFB 3HCXA 2BR0A 2R8JA 4AL5A 5L1IA 2VFSA 1FJEB 1TR0A 4LR9A 1H7WA 2QRRA 3NAIA 1CJVB 4Y34A 1RE1B 1UPMB 3GIJA 3SXLA 2E9RX 2X1FA 4TY8B 1PKUA 4KIAA 4PKDB 4YDDB 1S5ZA 3N9UC 2N4CA 3MMJA 1JLEA 2CG4A 5ETNA 3VTIA 1T8EA 1JLEB 4L72B 4LIWA 2RHQB 4IDKB 2PI4A 3KHHA 1X5OA 2RDIA 4ZMMA 4J9MA 3MD1A 4I2QB 5F3ZA 2DNYA 3KLIB 3IM8A 1N33J 2ACYA 4CIOA 2F8HA 5D77A 3AODA 3NBPB 2X1GA 1NPRA 3ILJA 4ETZA 3KK2B 3IXQA 1RAFB 4IH5A 4RW9B 2IBOA 2YPZA 5KFGA 5KFVA 1HNVB 1WG4A 3TUIC 4KHPJ 3J81j 5GAEI 3MR5A 4J37A 1UZDA 2N82B 2R7SA 1QD1A 2DCUB 3ZZRA 5IM0A 1VK8A 3OL7A 4RW6B 1N0UA 4OI1A 1S7HA 3SQOP 5BR8J 4B3RJ 1A0OB 4C11B 3W1YC 2HRYA 1KQSR 3C19A 2YWHA 4X66F 2HHPA 4CLFA 2W9BB 4LFAF 3QIPB 3EGWB 5LMNJ 4B3SF 4DL5A 4DCJB 4ECSA 1NDLA 4A8MP 3W5ZA 4P10A 1AFIA 2ZH8A 1FD2A 4ZCIA 2H4WB 1HMVA 3FBCA 2XM3A 1HD1A 3OD2A 4RJVA 2XHWA 4N76A 1N4LA 2HZVA 2BANA 1IKYA 2C3OA 2J0XA 3PR4A 2YKPA 1XR5A 2CNKB 1OY9A 5HQMA 4RNMA 2VQFF 1WF1A 2WW8A 2QV6A 4PR6A 4EMDA 3M9OB 2BM1A 4J9VA 4KTQA 3CCSS 3IRXA 2L9WA 3AA9A 5BR8F 1FJCA 4NA3A 4NWBA 3EXYA 2MQOA 1R0AA 4HH0A 3ENWA 1AZSB 5M2RA 4DV7J 2WW4A 2RS8A 2YKNA 1VHIA 1UWAA 3EGNA 4FKXA 3HVTA 4RUBA 3LP0A 3TVZA 4DSEA 1RAOA 4LF9J 4PCQA 3VR1A 3G87A 2FD2A 3C6TA 4WXOA 4F3OA 3QFWA 3D6HB 1FHTA 1X4FA 5HSPA 3BR9A 5A6PA 2MQLA 2R7TA 3RW7A 3NNAA 2NR0A 3I0RB 2KFYA 2ZVIA 4NLQA 4CO3A 1I1GA 1WKLA 3MPVA 5ADZA 5GAHU 3J7ZT 2DBBA 4DR5F 1AFJA 2QYCA 2DT9A 3EXCX 2V8PA 3RRHA 1WTBA 3GSDA 4L6V3 4P2XA 1EETA 2Q6BA 4LIRA 3QZ7A 3DFEA 5KFBA 5J2MB 5DGBA 4OLOA 5IC4B 3QO9B 4IG3B 2BBEA 1HWJA 1U1KA 2QYGA 4OX9F 4X4TA 1QDUB 3DU6A 4HH1A 4DL3A 3W9JA 2MZ1A 2R7OA 2W25A 4LSZB 2DRAA 3MM7B 2HQGA 3QYYA 2CAJA 4DL6A 1SQEA 3BSCA 3M8WA 2XO7A 4ED5A 1U6ZA 3MM7A 1MROA 3L7UA 2DIUA 4QIFA 5KFIA 5HLFB 2AJQA 2HRUA 5ETTA 2ZH7A 1FVQA 4CT8A 4DR5J 3PO5A 1C4AA 2YWWA 3SEOA 3OHAA 2DEIA 4UY8T 3JSBA 4DR3F 2HK3A 1S9GA 2YKAA 2XCPA 4JI4F 1IKXB 3I56S 4C4WA 3TX0A 1R6YA 5EGYA 4ECXA 3BQ1A 2P9CA 4Q8FA 5B7WA 1P1TA 5C5JA 5EX3A 4DQQA 2MXYA 2OTLS 1G4CA 4UQGA 1XMBA 2J8SA 2VG5A 2YNGA 3MTJA 2MLZA 2AGPA 5CQGA 1FEHA 2YQ3A 3DNCA 2V4RA 2VBYA 4ZPCA 3UCGA 4DUYF 2HQDA 3BKTA 3HF5A 2EPIA 2KG1A 4TLRA 1NSKL 1WEYA 4Y6IA 1RU1A 4DR4J 3S7RA 2P2CB 1RT2A 3TUPA 1L3UA 2OHDA 1WNEA 4KFBB 2CZVC 2H5EA 2HG4A 1F60B 2IYIA 3UN3A 2O1PA 2FJBB 3DMJA 3GV7B 2P5VA 1DZ5A 4NLUA 3ZNJ1 3I0RA 2BJ7A 2RQ4A 3UR3C 5JUMA 2FVSA 1HBNB 2RH3A 2ZBIA 1WI6A 3CCTA 3S8SA 5KT3A 1HHQA 1NBEB 4P6QA 4JYAF 1EHWA 1KWMA 4PWWA 3D66A 2FUG9 4RW7B 1U02A 2HURA 3A8EA 3VZIA 3HHKA 3ZZZA 1ZA1B 2CJAA 2J9CA 4O3NA 3G8TA 1VQNS 1VRTB 2MQ8A 3MOZA 2NSBA 3R6GB 2OIHA 1APSA 1FWKA 5LJ5Y 1MWZA 4TU7A 3NXZA 3S01A 3CO0P 4ZITA 3FCHA 4RUCA 5KFCA 3FQKA 5CYMA 4RNFA 5HMZA 1F2GA 4NRUA 4F4WA 3QJLA 1IR2A 3H0PA 1K8AT 1RTJB 1WC4A 1CJUB 1WACA 2G0CA 4DHVA 1R8AA 5DQIA 2YWEA 1QAIA 5GMKa 3OVBA 5GAGI 4DL2A 2OELA 4O4GA 1WSRA 4W98A 5KFPA 3X1LB 2PMZD 3PZPA 3SFUA 3TVKA 3ZFVA 4DU8A 1MSWD 3K2YA 1RT7B 2W8KA 1TKTA 4G65A 4YY3F 4YB1P 2GVDB 3O8WA 3OTDA 4KH1B 4ZVHA 2DEJA 3CCVS 4FKYA 3CUNA 5J2QA 3ZTPA 2H4YB 5FIIA 1RBLA 4JUZA 2OKQA 1PYTA 4USTA 2HS3A 1X8DA 4ZJOA 1K0TA 4ELVA 5AXLA 2DIVA 3I9V9 2QSWA 3D5MA 2W2OP 3R27A 1VQ9S 4GKJF 3KK1A 2GVZB 4PWDB 4ZVRB 1T9XA 4L74A 2GJIA 4OV1A 1ITPA 1RTIA 2UXCF 4DPOA 1F3FA 3QPIA 2HEKA 2H5IB 4ZPTR 4X4SA 2FY1A 5KT5A 4DV3F 2DNOA 2OPQB 2UU9F 4RKUC 2XNRA 2G1HA 2IJNA 2WOMA 2VL1A 1GFWB 4RX6A 3V81B 2FJEB 4C98A 4U67Q 2ERRA 3FUYA 4B3TJ 5BJRA 2CQDA 1GK8A 4P2MA 5D4NA 1VOMA 5DJBA 4EBEA 1PC5A 5JXSA 4WFNQ 4IO1A 2V2VA 2CXEA 4RW4A 2W4DA 1EQMA 4JI0J 1B7FA 3GJTB 5IQQA 4JI2F 4PYAA 4FS2A 3GP9A 1QJHA 2ILZA 3KWMA 4KBIA 1VQYA 2FVRA 3MMAB 2RHSB 4I7FB 1SH2A 3NGUA 4ZOSA 3VGSA 3W61A 1UVNA 1PGZA 1S0OA 2YH1A 4KJIA 4ZK7M 4LUBA 1L3TA 1QTMA 1U1QA 2B9XA 4X62F 1WOSA 4RLEA 4DX8H 1OS5A 2ABYA 2ROEA 2CQ4A 3JTPA 3HD2A 2GMLA 1FRHA 1YJ7A 2I8EA 4ZPBA 4DI6A 3MM5B 2QA4G 3M6XA 4CM0A 3A8KA 2KM8B 3NGRA 4I6YA 4IOCQ 3HZGA 4DCPB 1S6PA 4CNYA 2PGCA 5ETKA 5A8WB 1RLDA 2Z2LA 4PG7A 5ETMA 2B51A 2C28A 4M5JA 4C8OA 5J1PA 1RHJB 2AYEA 4LR8A 1ZM9A 3OW2R 1SKRA 4EYHB 4JI7J 4DF4A 1V3ZA 3CCUS 2IMWP 2HBRB 3B4DA 4CH7A 3G9CA 1FT8A 4IR1A 1ZPVA 1RT3B 2LKZA 5HROB 3NGDA 4QYRA 4DQRA 1M5PC 4AXIA 2VG7B 3HLUA 5H9EJ 2OD6A 4J90A 3SYZA 2VFTA 4LF8J 4NLWA 3HFKA 2JZ5A 1DTTB 2Q1LA 1K47A 5CH7B 4A8OA 1WELA 3BSOA 2IFXA 4ITSA 3HHNB 2E5HA 4PG6A 5F8JA 3C15B 5AT1B 3GPAA 4DSIA 4UUXA 2Q3PA 3MCNA 3NCPA 2LDYA 4Q8EA 1VC6A 1HBUB 1Q81T 3DC2A 2W8LA 1G2EA 2F1FA 4OJGA 5GAHI 4J9PA 4H4KA 4QIGA 2WBRA 2G1DA 2WK4A 3O6QA 4WYLA 1FFWB 4GKKF 2Z30B 3IWNC 4Y2AA 1S99A 3M2RB 1YZ7A 1HI1A 2K7KA 3MM8A 4YUDA 3CF5Q 4HKQA 2GX8A 1RWNB 2EKNA 2XTJP 2DXDA 4WKYA 2HVDA 1NRKA 2OMOA 5DLGA 1VQOS 2E1AA 1M5KC 1XK8A 4PG8A 1FRXA 3NGKA 1R8HA 2DISA 4P52A 2XS5A 3MM9B 5A8RA 2CZ4A 1VS3A 2M0GB 4G1IA 4A4JA 4C0OC 1NSPA 3L3CA 1VYAA 2RU9A 3AXKA 4KHMA 2JJ4D 3PEJA 3FQLA 3UE2A 2BJ3A 4CLUA 3CMQA 2ZD1A 5I3UB 5AJ3J 1SL0A 1URNA 1FKOA 4QIWD 4MIBA 2W2PP 4QIEA 1TKZA 1HA1A 4CWBA 3BO2A 2WVFA 4OHWA 4C0HA 3N6MA 3PW0A 3QRPA 3OTBA 1O51A 4DV0F 2VOPA 2AWZA 2FLOA 3MAAB 2JSXA 1VBZA 2Z58B 3CJ0A 2DNQA 4RUHA 1KR4A 3M2VB 2VBZA 3KG0A 1E6YB 1AT1B 2YNFB 3MEGA 1D1UA 2EWHA 2HIYA 1CC7A 4E2FB 3KJVA 3Q0AA 3DRRB 2HWTA 4PXDA 4DS4A 3H2LA 2NREA 3DM2B 2X51A 2ZOGA 3LO3A 1O0PA 3M8ZA 3BREA 4LRDA 4X4UA 1RWWB 2QMWA 3SV3A 1RTHA 3PYFA 1LW0A 4WFZA 2DY1A 3R97A 1TKXB 1TL7B 2HNZA 2FLPA 1WG1A 3IWLA 4OZ3A 2R9LA 5HATA 1C2PA 1NNDA 3SFGA 4JP8A 2IHR1 2MHEA 2LQBA 3MTKA 2KN4A 1SXLA 4UOGA 1TP7A 2VDIA 1YTYA 1HNZF 1SIZA 3Q8SB 4Z7YA 1HNIB 2C2EA 2HZCA 3C16A 4DR1J 4ER8A 3IS9B 1NH8A 2CFXA 3MPUB 3R5CA 2GQ2A 1NXIA 4BWMA 4NI2A 5MAOA 3GWCA 4KC5A 4WWSA 2APOA 2HNYA 4N56A 5HN0A 3DLHA 4OL8A 2WSCC 1B0VA 3TR5A 5K14B 3IGVA 4Y2KA 2IC3A 1AYEA 2HMIB 3MZIA 2EK1A 3HVRA 1T9UA 1YJRA 4B9LA 3FFIA 4GMKA 1IKWB 4OI2A 3RB4A 2EFOA 4PUOA 1K1QA 3DDIA 3EPGA 1JNZB 1VC5A 3KHLA 4BCAA 3TRGA 3M6WA 1TVRA 2NPFA 4TN2A 5B09A 2OAUA 2O01C 4H4KC 1CJVA 1IKVB 1LWFA 3VV2B 4CO2A 3V6KA 2ALYB 5M2UA 2R7QA 3GFZA 3PRBA 4K7QA 4WYWA 5KFQA 1NDKA 2MZSA 3AHPA 3HFVA 4CLZA 3FJ2A 2G2ZA 4LF4J 3UI3A 4IQXA 5L9NA 2CQHA 2LMIA 3ZC4A 4K4SA 3BGFA 2KT3A 2UUAF 2HYIB 5HANA 2BA9A 2D74B 2FHMA 1MW7A 2RF2B 2BYCA 2RVJA 4KO0A 1AB8A 5C42B 4I6WA 3HMJG 3MR6A 2FTRA 1FRLA 1RAJA 2JWNA 3AD9C 2E9TA 1YZ6A 4NXNF 1VLOA 2OLWA 2WSFC 4DZDA 5HQLA 5KT7A 1JK9B 1S6QB 1TMJA 4ECTA 3RBEA 1YBUA 3Q8QB 4ZS6A 2LU2A 2UUBJ 5E3PA 3OR2A 1VQ5S 1FERA 3U7JA 3RB3A 1T9YA 1YSJA 1NKCA 4PQUA 2J0WA 1NK5A 1NK4A 4DG1B 5CA5A 4LF4F 4WZQA 3GJSB 2K8GA 3MR7A 3DLLQ 2XWYA 1F9FA 4OYZA 4ANDA 2YY3A 4DG1A 3HJFA 5FLXU 4DSFA 5HMXA 2ZH4A 2DGQA 5DQHA 2Y1JA 2WVCA 1XBWA 2RIJA 2ZC3A 4E98A 2LQJA 1CJUA 2V68A 3D3CJ 2JVRA 5M2PA 3GV5B 2MJNA 4DQIA 4JI1F 1S57A 3LP2B 4MJKA 1S1WA 2F65A 3EJMA 2ZH9A 2UXDJ 1FVSA 1IM4A 2VC0A 2Z2ZA 5CD4A 3AY0A 4DMZA 2IRXA 5DDOC 3UNYA 2NZ4A 3KXDA 1MMDA 4ZVSB 1VBYA 1NK7A 3IR6B 2GHWA 1S9EB 1YGYA 1FWLA 2AKWB 2RUGA 1VBXA 3NS6A 4LF1A 4NLOA 3I87A 2CDQA 3IRXB 4P7TA 2CJQA 2HFUA 1G7CB 2FY8A 4MIWA 1W25A 2AX1A 3KG1A 3LGNA 5HP1B 1TK8A 1OSDA 4DPWA 2Y9HA 3EWGA 3W63A 3PX4A 4C8MA 2QE5A 4P72A 1HW8A 2BUNA 5AE3A 1HNWJ 4NLVA 1RAHB 2B4OA 3LP0B 4MTPA 3UVJB 2RB7A 4USVA 4X62J 3EDRB 3R7BB 2CPYA 3PHTA 4B02A 5KG5A 2XMUA 3TO8A 2NZCA 2KZMA 2MDAA 3R5DA 3L95X 4LFCJ 2XMMA 4ED4A 5F0UA 1PJ5A 5CAAA 5DDQC 1MN9A 2X3GA 4QIVA 5CZVA 2EBEA 2OD4A 5LJ3Y 1A9NB 6FDRA 1S10A 4MT1A 1FJ7A 1REVA 5CZXA 1LK7A 4URQU 3O5TB 3OSPA 2W4CA 2LXUA 3DOMA 3GYXB 5HMYA 1IBCB 3HO1A 2FJXA 1JKHB 5IQ6A 3DOMB 3X3UA 3E8OA 4K4XA 1FDDA 4GC6A 3C14A 5IV3A 2VA2A 4RBTA 3CD5A 1V6HA 3E51A 3HULA 4CNZA 8ATCB 3BV8A 4FDFA 3M9MB 2EG1A 1U1LA 2DO4A 3KLFA 4DL4A 2UP1A 3JSRA 2WZ1A 4U7CA 2KG0A 2LEBA 2R2RA 2E1PA 3KLFB 3J7YU 2J9EA 2BJ8A 2IJRA 2F5GA 4GO7X 4D3GA 3RRGA 1HPZB 2ADBA 3SI8A 4JYAJ 3BH7B 3Q8UA 4ZVEA 2W24A 5KG1A 2XMAA 2JEFA 2ZE2B 3I0SA 1CC8A 1PBUA 3H2UB 2HQCA 2VC1A 2QC3A 3D68A 4IDKA 4PYDA 2N7CA 1ELOA 4XK8C 4K4UA 5H9FK 2AU0A 1RUSA 4UF4A 3NOGA 3HP6A 2RT3A 4L3NA 3Q8RB 3VAKA 4EYIB 3DLEB 1UAWA 4AQYJ 2B56A 3BGOP 3FBFA 1FWPA 2NXJA 5CABA 4EUVA 4PRFA 2K06A 4DR2F 3NRBA 1F2HA 1U0HA 3W60A 5KG6A 2HFOA 4RW9A 4I68A 4ZIWA 2Y8YA 2VUGA 2JEIA 2D9OA 4DOZA 2X1AA 1U0HB 1O5JA 3OFGA 2BQ3A 1FNXH 1X4GA 2DNHA 2P9EA 3MEKA 3CJ5A 3UPFA 2MZJA 2C2RA 1FTRA 2QN6B 1KONA 4F3QA 4ED2A 4BDPA 1XNQF 3FGVA 3KUGA 5GAEU 2VH7A 2UUWA 4P9SA 3TJAA 1ACMB 4R25A 1IBMJ 2W9BA 2Y1IA 4QWAA 2H1YA 4OJHA 3AA8A 4F50A 3G2XA 1U09A 2EC0A 1S1XA 4FNHA 6FD1A 3WZ0A 2RNEA 3ET6A 3JQKA 2E5LJ 2DGOA 2F4VJ 4B3SJ 2YQ1A 3VGTA 1NPPA 2BZ2A 2YXLA 1XR6A 3R1HA 3W65A 2GFFA 1WF2A 4I64A 2IVMA 2J8AA 3FBBA 4K5SA 3CULA 4JV5F 4ELUA 2ZKUA 1UFLA 4KGZB 5HVFA 3M6VA 4HEA9 4O3PA 4OYBA 3KG4A 2MHNA 2HGMA 3H90A 4CDIA 1ZYQA 1FXDA 3DRPA 4O3SA 4HACA 3UNGC 4Z7CA 4WCEQ 4YP3A 1N36F 4CLTA 3DI6B 4NLPA 4ANCA 1R8BA 4OJ1A 4IRDA 1U6FA 1EX8A 2OSQA 2KYXA 4NYPA 4NX9A 5IZHA 3SZ2A 1S0NA 3CJKA 1U49A 2F4VF 3AOAA 1R3NA 2VG6B 3DM2A 1P9YA 3BDEA 3MEDA 3US5A 4DL0C 4R8UA 3QRQA 3MAHA 1ROFA 4LSLB 3VAFA 4ELTA 4ECVA 2OH2A 2QG9B 3GG1A 4M5IA 5D0HA 1YWXA 3HDSA 1HWUA 1RYRA 1RHQB 4M5KA 4C8YA 3AT1B 5C24A 1QUPA 3P96A 3TUJC 4F4XA 2AEFA 3PW7A 4ZP7A 4QR2A 5HJXA 2N3OA 5CYQB 5T7LA 3QJJA 3SQGB 3VALA 2PD1A 4LF5F 1WHXA 2QIFA 3KLHB 3KHGA 3I4HX 4UTGA 3FZ2A 3H20A 5E5NA 3IWXA 3MURP 4ANEA 2E5IA 3L7OA 1S97A 1SL2A 4OHYA 3BZQA 4LF2A 2P6SA 5I3PA 2IMOA 2YVSA 1B4SA 3U27A 1Z2LA 3HVWA 2CJYB 1HWKA 5E33A 3C6UB 5J2NA 3J81U 1XNRJ 5SUHA 3CW2C 3CJQA 5KG7A 1YJTA 2QMXA 4KQZA 2YWGA 2IC3B 4LF6J 1K44A 1QM9A 3QWPA 3MM8B 1S9GB 1X4CA 2VFUA 2WB4A 3MF5A 4R0EA 3D6FB 3NEKA 2RMLA 2XY5A 5JVGQ 1N34F 1CEZA 4ZIVA 3DOLA 5E41A 4MYTA 4DFKA 1VQLS 4C6AA 3GE9A 2HHHJ 1CPZA 2G13A 2ZM6F 2R8IA 2UUAJ 1K0VA 3KK3A 1B99A 3G6XA 1TELA 1JLBB 4CH1A 3KNAA 1C4CA 3JB9k 3LWLA 4LF7J 1IKVA 1LWFB 2VV5A 3D0IE 3DXBA 4P2FA 5KTQA 1AZSA 3EUNA 4WTYA 1UA0A 4FXWA 4YR0A 2GMJA 3LGHA 5F8MA 4HACB 2IRUA 2C2MB 1IQTA 2EVZA 2IA0A 3ZTSA 5F9LA 2I0XA 1Q4RA 1PO6A 3MDFA 1LEOA 4C8KA 1IR1A 2CDRB 2XHCA 4RW8B 1NPKA 1UW4A 2N3LA 5J1NA 1CSJA 2XNQA 2MKIA 3QGPA 3EICA 1FKOB 1NAQA 2FPHX 1HLWA 3DLKB 3E01A 4GO5X 1X31C 5GVQA 3MR3A 3ENVA 1N34J 2RILA 2IBKA 3MEGB 1WUUA 2V8HA 4ZJLA 3IGNA 3VAMA 2YNHA 4CO0A 4F4AA 1RT6B 3HX9A 4Q5VA 1Q1KA 3M2UA 1C1BA 4OX8A 2HSEB 3NWGA 3RAXA 3P49B 2Z56B 4QPTA 3DRRA 1VISA 3MCSA 4TYBA 1N5QA 2JVOA 3QBCA 4CO5A 2RU3A 4OI0A 5AJ3F 2C2OB 3B82A 1YQHA 3OTOF 5HJYA 1D9FA 2F40A 3D0HE 2B9YA 2DGWA 2XI2A 1BQNA 3QT5A 3POTB 2HQFA 1Z1ZA 2OEKA 1U1MA 2R42A 1WSVA 4BWJA 4UW2A 2OPRA 3GG0A 2GQCA 2QLWA 3PCOB 4M1KA 3D1HA 2Y0BB 1TL3B 4B9UA 3QT8A 5FLXY 3Q8VA 3OHBA 4KT0C 1F5BA 2GQQA 1VIXA 3A3NB 2HNYB 4ATNA 4MAKA 2E7VA 4ETXA 1GX6A 3AD8C 1B0PA 4DV4J 4HLBA 1XEZA 5IT4A 3KK3B 1KKHA 2ZOMA 4ECWA 4OZ0A 2MZTA 1SC1B 1TZ0A 4FP9A 4ZVFA 2RRNA 2HBYB 2PEHA 1YK9A 1JJHA 1GXTA 1Y4ZB 4LFCF 1CULA 3EZOA 3HHLB 4NCBA 1VK3A 3LOUA 1SVDA 3GJQB 2AYMA 2RE1A 5A8KB 2BANB 2GNKA 3M8QA 3TZWA 5DDRC 3M9NB 2VPWB 4ZHRB 3FSXA 2FHJD 1HNZJ 2CADA 3IAS9 5IXUA 3GIIA 2RUSA 3DDKA 3SDEA 3PKYA 3OUYA 2LEPA 1NDCA 1SV5B 4OI4A 3VAGA 2XULA 3DRYA 3MUTP 3A4TA 4DPUA 3IR7B 1WDDA 1V3SA 2CPDA 2W2NP 3P6YC 4A8YA 1NJZA 1RTDB 5IT9Y 1OY8A 1RTZA 2MLYA 4OZJA 2HAIA 2HGLA 4ECUA 1CVJA 4QR1A 1N33F 2AMCB 3T41A 4WIQA 5DQGA 1SC3B 1RHMB 3QNWB 4NA2A 3CCLS 1DFDA 3IMQJ 2Y1LB 4N47A 4DX7A 1UVLA 1BQMA 2WRMA 5ITHA 4JI2J 3EPIA 5BYQA 4URGA 1X9WA 2XMJA 1AA1B 1M5SA 5ETRA 4I69A 1BWVA 4HL9A 3W66A 2LQ8A 4YS2A 5KFOA 4GRSA 1GNKA 2GA7A 1NK0A 4EZ6A 2AX0A 1HQEA 3VCDA 2B8PA 2AT1B 2MB0B 1MROB 2FDNA 2U1AA 5K20B 4G1QB 3MPDA 1T9VA 2WCXA 1ZA2B 3MM5A 4RNNA 4P7VA 4C3LA 2OMLA 2O5DA 3WBZA 3JSYA 3WHIA 2DPIA 2G2YA 4F0MA 1UMJA 1PJ6A 4KGXB 4Y00A 2BW2A 2XCAA 1NU4A 1S1VA 1U24A 1HNXJ 1VI7A 5DS7A 3K5NA 4DFPA 4ED8A 1VIOA 2XZDB 2CVEA 3DLEA 2MSTA 2ZDOA 4H4OA 5K14A 1HYSA 1RAEB 2XYGB 3LPYA 3PHEA 4FYYB 2I2YA 2AEJA 4KV8B 3BGUA 1L3KA 3H5YA 4N77A 4DV2J 2DY9A 4KGKA 2BEFA 1WEXA 2QTWA 1TFYA 4P73A 4P71A 1N32J 4ZVUB 2HHQA 2B0GA 1ZTTA 4I2PA 5B0BA 7FD1A 1WJ9A 2M8HA 3MI7X 4NXMJ 1RQ0A 3OFEA 4USHA 4J9NA 4K0KF 1R0AB 2VQEJ 1EJ7L 2EFNA 2PT0A 1XR7A 1TL1B 5HVGA 2VONA 9ATCB 1YJUA 1S1XB 3NP5A 1RWVB 3BSAA 2NXNA 4NMXA 5KFAA 3QSYB 1YI2S 3UVJA 2DPJA 4IH7A 1EKSA 3G4SS 4LBHA 5DO2A 2Q79A 4A8QA 5G0RA 2L3MA 4DV2F 5D4LA 3CJRA 4QYZJ 3H7HB 3FSIA 3OBIA 3G86A 5L1LA 3DU5A 5DETA 1U8SA 1VRTA 2XMVA 2UVWA 1RKIA 1DQAA 2GAHC 2VBWA 4M8LA 2K1RB 4ECYA 1ZM3A 3VF0B 1XQIA 1LK5A 1PBAA 2O3DA 3IR5B 4CM2A 1S9FA 3BKUA 5E0OA 2NLWA 3UO0A 4QZVB 2CPHA 3C14B 2HBQB 3DXSX 2G9OA 4NYZA 1Q0NA 2NUHA 3CDBA 2BOPA 4C9DA 2YWKA 5JVHQ 1N36J 1U47A 2Y3YA 4KRWA 1LWXA 4GVBB 2A0FB 2HRTA 1M5OC 1MU2A 1LXJA 4PABA 4LBPA 3OLAA 2W7AA 2PN6A 4WFXA 2XSJA 5RUBA 3Q89A 1HPZA 2ZBCA 1U4BA 5FJ4A 3I31A 2XS2A 2O66A 3OFHA 3O3LA 1RT5B 1NK8A 1YJNS 3LPEA 3SMZA 1Y5LB 2ZH1A 4A8XA 4JI5F 4FYDA 4ZVGA 5KFNA 5KFEA 3B4MA 4QWDA 2ACMA 5J2QB 2FLNA 4DR6F 1HBMB 1V5VA 3IG1A 1SKUB 1BD6A 2CNLB 2E66A 4BBYA 5D6GA 1L3VA 2MKSA 4NEZA 4UZBA 4J9QA 1EQ0A 3MPWA 2BE2A 1FRMA 1RSCA 1ZS6A 3TUZC 2YQ0A 1CQMA 1XTZA 4H4MB 1IBLJ 3NMAA 1Y00A 2QMUB 4ZP8A 3QSIA 3KK1B 2HHWA 3ETOA 1OMSA 4H4MA 4MFBA 2B7CB 2DITA 2NXEA 4LF7F 4WF9Q 1YRUA 1ZPWX 2VKRA 1WEZA 1RAAB 3MFHA 3GR0A 4F67A 3HK2A 1TUGB 4ECQA 3AQOA 1S0MA 2HQ3A 1NK6A 2FQQB 3IS9A 3TNVA 1WKKA 1UWBB 2ZZTA 3DHXA 3I9ZA 2LECA 2CA9A 3SSSA 1U8WA 1IM6A 3NCQA 2FYXA 1M90T 4B3OA 5F8NA 4NLRA 5HK4A 3W2VA 3BF4A 4X65F 3M1VB 4DN0A 3CPWR 4K4ZA 1E6VB 3S6EA 4ZP9A 3T6BA 1FF2A 2LP4A 3PEHA 3LWMA 2R2UA 2V9KA 1HWLA 1RT4A 4XIUA 1T9TA 2P8IA 3N01A 2ASYA 3V2UC 3HHEA 1IKWA 1FRIA 2KXNB 3M8RA 4DFMA 3UD4P 2CPIA 4O0NA 4V19J 1XMOJ 4S0MA 2QT7A 4EEYA 3A8JA 2EKYA 2XMWA 4HR2A 3A3PB 1LWCA 1U2CA 4QR0A 3BGLA 3W8GA 5KFXA 3T1AA 4KPCA 4OYOA 5DRKA 5LT5A 2XMTA 1S1UB 2D41A 3ZXWA 3PV8A 1YHQS 1P8GA 4DV7F 4ZA1A 3QAEA 3NNHA 3ZTOA 2AV5A 2AGOA 4QOTA 1QVGR 2E5LF 3HT3A 3C46A 3K5MA 1IJFB 2CQPA 4RL1A 2H3EB 3ELHA 4KO0B 2H54B 5IOLA 3F41A 3SBMA 4LVOP 2LEAA 1R0CB 1HARA 1SC4B 2FGCA 2MKJA 3GCWP 4OI3A 1FD8A 3JS9A 3I55S 3SQGA 4NXNJ 2UU9J 1RT6A 3TZXA 4YEAA 2CNNB 4DV5F 2EFGA 3K5PA 3ISZA 3W62A 5KFKA 4DWIA 4DPXA 4ZVTB 1WC1A 5T7LB 1RAIB 3RB6A 1SIWB 3G8SA 2ZITA 1UPPA 3F73A 1H74A 2GMHA 4UQTA 3NS7B 4IOBA 1RGVA 4KB7A 2G0IA 1OWXA 3P3DA 4M5MA 3RBXA 3MR2A 2QA4S 1KLNA 1V3RA 2HFSA 2PEBA 2RKIA 1O6XA 4DBQA 4YOEA 3BEGB 1RBOB 1Y0HA 3D9BA 1HBUA 1S59A 2Y0SD 3M1VA 4JOUA 2RKIB 3DGVA 4A46A 3FFIB 5DDPC 4DV5J 2AJ1A 2CPEA 3VAIA 4DF8A 2L48A 2YX4A 3QJPA 1OY6A 1JLBA 2DGTA 1HW9A 2DXEA 2OGUA 2DGXA 3LA0A 4DCOB 2ZHAA 3T5HA 1QSLA 2G2OA 2C3PA 1CQNA 1IKYB 1Z2ZA 3WC2A 3NLCA 3PDNA 1B0TA 2ZD1B 3GSIA 4FF4A 1UL3A 2CZ9A 1LWCB 2RQKA 2YBVA 1F9EB 3PW5A 2XS7A 4R0JA 3HKZD 1Q79A 3NGTA 3DI6A 3K8VA 4TY8A 4ZPWR 1GXUA 4M63A 4ZCLA 5KFDA 1KBRA 2X7IA 1BHNA 3N79A 3QWUA 4J9OA 2B9EA 2LQ9A 3M2VA 4W92B 3M4XA 2JEJA 1EKRA 2CRLA 4FPRA 1Q78A 2IVFB 1BQMB 1X4AA 4NE9C 2DO0A 3N5FA 2XGPA 3PKMA 1XJWB 3CDWA 4C2MA 3SCLE 2RDJA 3LALA 1C1BB 5A2QU 4XDDA 3R2DJ 2UXBJ 1RHRB 5LL6d 2Z8QA 4XTTA 4LSNA 4IYQA 1U2RA 1HD0A 2H65B 3FEXB 3T1HJ 5L38A 1JLAB 4F4ZA 1FJGJ 3E3XA 4OJ3A 2W4PA 4ZLNA 1W2IA 2OEJA 1LW0B 2ZC4A 4HT5A 3UW1A 4ES1A 1HR0F 2QJ3A 4M94A 4DR7J 1ZM4A 4NEYA 2J76E 5D0GA 3L09A 3D6MB 4YB6A 1P9QC 2B6AA 2F9DA 3TA0A 4DV6F 1KHVA 2PO4A 1D8ZA 3ISNC 2RRBA 3KDOA 1QAXA 3O2IA 4QW9A 1UP1A 3CNQP 1S1WB 2E7XA 3U1NA 5HLFA 4NXMF 2KJVA 1UVIA 4FN5A 2ATLA 4WP9A 1WWHA 1R8CA 2WSEC 5IFMA 2BKNA 2LU1A 1OO0B 4Z37A 4AYBD 4FVCA 3WQPA 1Q53A 1RU2A 5JJBA 3DLGB 2I1RA 2RDDA 3T1HF 4YY3J 4USKA 1RADB 1TQLA 1IBKJ 1TAUA 3HFZB 1H0HB 2DYAA 2MKCA 3I6PA 4I1TA 3TX8A 4DV6J 4NYOA 1PC4A 4OZNA 4AQYF 1QTNB 1S6UA 4J9SA 5F0WA 2MLXA 1H2VZ 3FZBA 3LW5C 3QT6A 1PILA 3OR1A 4A47A 3GIMA 1UA1A 1DURA 3C6TB 3FKBA 2DRBA 4IR9A 4Y2IA 2C42A 4QYZK 2AD9A 2AZ1A 3UD5A 5C42A 5KOWA 2NYIA 2BXJA 2CNOB 3ZTRA 1HI8A 2NQPA 4O3RA 4CLLA 4YN3B 1E6YA 3A13A 3AOCA 5T41A 1ZH5A 1IBMF 4EFAC 3RYLA 3K59A 2YNHB 1Q8IA 4W90B 1ZBTA 3AH6A 4ZPVR 1EZZB 2QFJA 1U1OA 2RQCA 2MQQA 3HKWA 1HI0P 1X4BA 3KJNB 3HSZA 7AT1B 4QU7A 2HWHA 1UJ5A 4IG0B 1JKHA 2HNZB 4WBFA 5KFSA 1CBKA 2IIHA 2LFVA 2MYFA 4DUZJ 4OX6A 1LV5A 2D1CA 2WBMA 4IG0A 1YRTA 1M5HA 2P6TA 2POKA 3NOCA 4B3RF 1SJQA 1RCOB 1UEKA 3TP2A 1HFEL 4DR1F 3DRXA 4LFAJ 2K7JA 2DXFA 4OV6A 1LOUA 5F8LA 3VGVA 2WTFA 3ILLA 2VICA 2QSFA 3UQSA 4YB7A 3BQ0A 4P75A 1EB0A 1OYDA 4IKAA 3PFOA 3I0SB 4IH6A 4F0HA 2OFHX 3J80U 2E9ZA 3H42A 2GIRA 4CH0S 1KNZA 2WVBA 5AE1A 3CD0A 3NAHA 2OSRA 3UN5A 1HYSB 1ICEB 1RT7A 2QZ8A 4RU2A 1HBMA 2KO1A 2CJXB 3IG1B 1YJWS 2LA6A 4KV8A 2AYBA 1VJWA 4O23A 1Y5NB 3JXOA 2AJ0A 3LP2A 2C2DA 2FJWA 2R8GA 5KFMA 1VQSA 2CG8A 1NJIT 1EARA 3R5AA 2AJFE 3FCWA 2V34A 4WFYA 5T14A 3G6VA 5HI7A 1VRQC 3WX8A 3FRZA 4Y2CA 2KB2A 3O44A 4ZKAA 4X65J 2KJWA 2DR8A 3V4MA 2B5JB 4JB8B 4KSEB 3HJVA 2ZNYA 4AD6A 4TXSA 1MNEA 1XMQJ 1RWOB 4IOAQ 5KG0A 3H25A 3BYRA 4NLYA 1U1RA 1K9MT 3PX0A 1TL4A 1O8BA 1YJ9S 2A2DA 5FDLA 4I56A 4RZRA 2IM0A 2B7BB 2MKYA 3EM1A 3GYGA 1D09B 1JLGB 2Q43A 5LOQA 1HBNA 1S4EA 2EXUA 3M6UA 4K5RA 4FS1A 3EZ5A 5CCMA 3MCMA 3V5RA 4E8UA 3VGUA 1U2FA 1W26A 2JC1A 2V50A 2PE8A 3IC1A 2WVEA 2K1RA 2RJZA 4OZ2A 4M5NA 1U1NA 3DKDA 2ROGA 1J5OA 1NZ8A 2DNGA 1G3OA 1OIAA 2IAJB 4OYMA 5LXYA 2ZNZA 4HVZA 2RRAA 2OJ3A 1KTVA 2I5JB 2ZHOA 2L9DA 2OTJS 3MOJB 1BXNA 4F7VA 1OYEA 4RBUA 6AT1B 5K8NA 1T03A 2NUUG 3UWTA 3MCOA 4JI1J 2LYVA 4ECZA 2VKZG 3K0JA 4ILLA 3M8PB 2B9WA 2IM1A 4X2BA 1HQ2A 4USUA 5CYJA 1T03B 1K73T 1NSAA 4RW8A 1RABB 1JJCB 2PC6A 2DNKA 3T1YF 4OYXA 3NNCA 1TKTB 1U26A 1UETA 1N5SA 2BKPA 2FJDB 1N88A 2DHGA 3E01B 4X4NA 3RW6A 3D1OA 4Y2MA 1SBRA 4ED1A 2A6MA 1B64A 3NS5A 1F9HA 3CCMS 3NWRA 2V4QA 4KH0B 1PAEX 2HS4A 3P8BB 2W1BA 1AUSL 3KJVB 5KG3A 3CGIA 2JH3A 5KG2A 1RHUB 2BRLA 2YTCA 2OI2A 3VQTA 3FCVA 1SH0A 1LWEA 2KI2A 1S9EA 2VB6A 5SZTA 4B9SA 2M52A 4DUTA 4LF6F 4CI0B 4B3MF 5EX0A 2HHTA 2IRYA 1NLKL 4AFFA 3CXCR 3M32A 4HT7A 3VQSA 3F56A 3BBCA 3MMCB 1GMWA 2MTLA 1S7IA 3TARA 2UVVA 4C8ZA 2HLTA 1NUEA 2NS1B 3GFHA 5L39A 1Q86T 4JI3J 2PFFB 2CQ3A 2YNIB 1BY9A 3CJ3A 2JNJA 1QUVA 4LRBA 3SSQA 4CLYA 5DG9A 4YHHF 2A6OA 4QCLA 2V8GA 3C15A 2MQMA 1WC6A 2M88A 3LF0A 5I3QA 4ECRA 1QY7A 4Q0BA 1S48A 1UWBA 2W2MP 3QIDA 4ICLB 2KHDA 4RO0A 5D4PA 4ZPAA 3Q2SC 1VQKS 3RR8A 1P27B 4WE1A 3OXFA 2Z57B 4HDGA 4DV1J 4QQBA 2R2SA 3GU0A 2V8DA 2OEMA 4HHHA 3H4DA 5HO4A 2EFQA 3G71S 4DV4F 4WJBA 4JV1A 3H98A 3BN7A 4MKYA 1JXLA 2HMIA 2YKMB 3RRKA 1RLCL 1N8RT 1UJ4A 2ASLA 3C2PA 3TQEA 4NASA 4CCHA 3T6JA 3CC7S 2F63A 1XN9A 3DCAA 3DRPB 3H2VE 1ULRA 3D54A 3GB0A 2M3DA 2ZZMA 3Q83A 3IN5A 1YJVA 4LVNP 1HQUB 3OJSA 3CCQS 4ID8A 2ZDPA 3I82A 4K59A 4F26A 4X4RA 2OUGA 3CJ8A 5D3GB 1S6PB 2EK6A 1OQ6A 4ZVOB 3AB4B 3SDEB 1QLNA 3A12A 3OTOJ 3HHLD 5HBMA 4X4QA 4ZP6A 4R8UB 4BC9A 2R2TA 1KN6A 2WHOA 4KYZA 3AAWB 5THWA 1JLQB 1S1UA 2KT2A 3L9ZA 3GFYA 2IYGA 1UFKA 4PXCA 5KFJA 1AUDA 5IWAF 1F6TA 2Z0GA 3AXMA 3T5KA 3RAQA 1BUXA 3B78A 1LXNA 5B0AA 3HSJA 1NHVA 2D3UA 3W7BA 4TQRA 1WI8A 3JSMA 5HROA 1X4DA 2EC2A 4G6VB 3R6LB 2UXCJ 3BO4A 4DDFA 2E5GA 3BPSP 5GMDA 1TL7A 1TKXA 3GFXA 3M7VA 4WFBQ 5D8HB 1S76D 1I3OB 3OPKA 3KLGA 2H5JB 5B08A 1V9OA 4OYIA 3OVAA 1PCAA 2FJAB 3KLHA 3KLGB 1KVIA 1T02A 2GIQA 2V94A 4WZMA 4HI2A 1GTEA 2GGPB 1BQXA 4OZLA 2EG2A 3P5BP 2DR6A 4QPXA 3ETMA 2HNDA 2WVDA 3OT9A 1SJ4P 4K2XA 1WC3A 2YKOA 1EAYC 2VBXA 4DS5A 5L8RC 4FXVA 1R27B 3TEHB 4KE5A 1TUWA 1HNXF 5ETPA 3Q2TC 2F8MA 4C7QA 3OL6A 2J0QD 4M95A 1NH7A 5A8RB 4UOHA 5DG8A 1FJGF 1EP4A 3KYLA 4NPOA 2VIHA 1LW2A 2VG5B 3IBWA 1M0SA 4HDHA 3KMSA 4GC7A 2FC8A 3VVUA 4DLGA 1GAOA 2KXHA 3FMBA 1ZAVA 1IBLF 3D28A 3TZZA 1VCTA 3GIKA 4Q45A 1JLCA 2HHVA 1SUQA 2BMBA 4C48A 1WHWA 3EVOA 4K8RA 1C1CA 2GHPA 3ILOA 3P4UB 3PRDA 4O0IA 1JLFA 1PJ7A 3PACA 4RWWA 3CIMA 3ZZUA 1C1CB 5F9NA 2R4FA 2HVZA 2PIIA 3AB2B 1Q7LB 5A76A 1WHVA 2JEGA 5J1EB 2M7SA 2DHSA 3LH2S 5CD4H 2R7UA 4J7CA 3TAMA 4A8KA 1WD6A 3G82A 2D3OR 5J2PB 2YX1A 1KP6A 3D7SB 4LSNB 1S4FA 4F36A 2AQ4A 2B4PA 4IRKA 3R7SB 5L46A 3M8YA 3RBDA 3GLJA 4CTAB 3MUMP 2XY7A 3DHWC 4IG3A 4NLDA 5H9EK 1VQ6S 4RW7A 3R5GA 1FA0A 5CYQA 1URRA 4CTAA 3RR7A 2N4DA 2E29A 1KD1T 2K3KA 4L73A 4LBIA 5A0YA 3NMRA 2WAQD 3UDEA 3CT9A 2OPRB 1YBAA 2OPSB 1R89A 2BJ9A 2V4JA 4FVMA 5I42B 1VDHA 2A18A 4TU8A 1DRZA 4FYWB 4CQ1A 4NLGA 3SV4A 3U02A 3M8SA 2CKWA 3HSGA 3IA0A 1Q8KA 2UVUA 2C2NA 5F8HA 1CLFA 1SCJB 3KJQB 1CJTA 5F8GA 4ED7A 4KKOB 2R7VA 1NEEA 3VZHA 4O4GB 4IO9Q 1TV6A 2VPXB 1L3SA 4RPFA 4MKVA 1H38A 2HVEA 5HVHA 5KG4A 3HPOA 3OXLA 4F3MA 5DZ7A 3CE8A 4EBCA 1EP4B 5A8KA 4I2PB 4A8WA 4QWBA 3T5LA 4X4OA 1F1BB 4B9VA 5C25A 2V2ZA 2ZH3A 3I4PA 4ZHRA 1VQ4S 3GR1A 2MPUA 3CWJA 1HKAA 4PPZA 4PAAA 4CLSA 4ZN1A 2M70A 2E7WA 2CQ1A 2BRKA 2Y1RI 2Z2MA 2Q66A 2DTJA 1CULB 3D6TB 2IA6A 4KFBA 1MWQA 1SUQB 3B6BA 3ITHB 3H4BA 5E7OB 3TAQA 3TWZA 1F3VA 2X1BA 2B5JA 3OFFA 1JLFB 4OQJA 1WF0A 1XNQJ 3K8WA 1RHKB 4I0WA 5LXRA 3KLEB 4C8NA 4LF8F 5D0RA 2UUCF 1FKPA 1FI4A 1PSDA 1YVFA 3ZO7A 3OUYB 1CS4A 3ZZYA 5KFHA 2C22A 3V81A 1Y9OA 1TL5A 3AJ1A 5IV4A 2DHHA 4EGLA 1IBKF 2GJ2A 3N6NA 5JMNA 2MQPA 1P1LA 4JV2A 3SSRA 1NO8A 1VHFA 2QA2A 3K89A 1KVKA 1R6VA 4UUWA 5AXMA 2FVPA 1Q5YA 2IM2A 1FO1A 3MD3A 5E3CA 2KHCA 4BS2A 4GKKJ 4LRFA 2JFDA 5CXTA 3MMAA 4I7FA 3TJ9A 1JXVA 3OTEA 4OYPA 2CJBA 2JLFA 2VPYB 3BM7A 4A8FA 2C2KB 2FZGB 1WC5A 1X4HA 3OV7A 2KRBA 4Y65A 3BBFA 1S1TB 2B6AB 2CWKA 1VLYA 3W2WB 2HKEA 4NL5A 2DVIA 1UZHA 1WKJA 4G1PA 3EGZA 1XERA 4JI4J 1MG7A 2LA4A 1SPBP 2GCFA 2M9KA 3GQCA 3CMES 4XDCA 2GVDA 4KGVB 4ENOA 2QL9B 1QE1A 3V4IB 1Q8LA 3DOKB 3RAMA 2J9DA 1IWAA 1DTQB 2OPPA 4YHHJ 3RTVA 4IUFA 3PIOQ 3V4IA 3PW4A 3K7RA 4WK1A 1U45A 5GMEA 3PW2A 5IC6B 3TYTA 2BJEA 1SJRA 2YWFA 3MEEB 3ICLA 3H5SA 5MLCV 1OQ3A 1JIHA 2HGNA 2CPJA 2N7YA 3M8QB 4DXLA 1X0PA 3UFCX 3CCJS 3J7Z5 1KC8T 1CG2A 1SC6A 2PI5A 4B9NA 2HVIA 3Q8YA 4CLWA 3WC0A 5LMUF 4CO1A 2BX6A 4ICLA 3R7NB 1ZETA 3DMJB 3MMCA 2CQCA 1TFWA 1N6QB 1NHUA 4TU9A 3VHQA 3A3OB 4K50A 4ALZA 2ZH2A 3C6UA 2R7XA 1N6QA 2VFRA 2MEWA 1D0EA 3G6ES 4O44A 5FDLB 3HD1A 1ZZNA 5KFZA 4XPCA 1VC0A 4B9TA 2DRDA 2O67A 3GCXP 1JX4A 1ZM2A 4K4VA 2UUBF 3HI9A 5KFFA 4M5GA 4I4BA 1SJFA 3BGRB 2SXLA 4N41A 2P9GA 1IUJA 2ZHBA 1TK0A 1ZOTA 4CRJA 4N7TA 2BE9B 2KRRA 3I5AA 3W9HA 2L41A 1XMQF 5L1JA 1Q7YT 4KR0B 4O3QA 2V69A 1NKEA 2FVCA 2VDHA 1JXEA 2V5HG 1M1GA 3MUVP 3M8PA 4URSA 3FK4A 2XY6A 1BGXT 5EHHA 5I3UA 3RU0A 1WORA 3BB5A 4ZLJA 2VG6A 2DNNA 3QMQA 3CJTA 3D67A 3G8QA 4RNHA 1AROP 3WDOA 2V67A 5C7PA 3HXMA 1YITS 3H5XA 4DN9A 3R8YA 3AOBA 1REGX 2CPXA 3TA2A 3ZNUA 1VRUA 3H8YA 2E5JA 3LTOA 2LXFA 2Z4PA 3CD7A 4WP8A 1OSCA 3N6LA 5AXKA 2KH9A 3KTQA 4Q2LA 1R0BG 4QW8A 3R5BA 2KU7A 4YMEA 3MFIA 3K58A 4TLQA 1KQFB 3PX6A 1EETB 3MEEA 1FTCA 2DH9A 2I38A 2UXBF 3I5CA 2VA3A 1YKWA 3ILIA 4N8NA 5B0EA 4W4MA 3QO9A 4I2QA 3GZ7A 1X5TA 2NYHA 4MKBA 3TI0A 1DTTA 2E1CA 2AF6A 1SKSA 4Q0BB 4NLTA 4TVAB 2C3UA 2OPQA 1BQNB 2D3ZA 3T1YJ 5LM7E 1I51B 3NBPA 4YFUA 1BWEA 4JV0A 1D3WA 1OPIA 4TKTA 3PY8A 4X4VA 2M4MA 2H48B 3OLBA 3EE3A 1HHTP 1HNVA 2AYGA 3ADAC 3DGPA 1FX2A 1H2TZ 1SQGA 2W9CB 4AL6A 4PXBA 4JI0F 5L1KA 5E3RA 4NLSA 1XIQA 4EO8A 4C11A 4J9LA 2A1BA 5K9FA 3BGRA 3WX4A 3JTOA 2DHAA 3QIPA 1C0TB 2IDEA 3OVSA 1J5OB 2FGOA 1TTHB 4IRCA 3UN2A 3DOLB 3BR8A 2K3IA 3H40A 3VVTA 1FNOA 2IAJA 5K8MA 1WC0A 1J27A 8AT1B 2AGQA 2HQIA 2J7WA 1JLCB 1VGYA 3PIPQ 4JI3F 2YKNB 2V2KA 1A6LA 1FXRA 5AXNA 3UCUP 2XYPB 1RXOB 3MM6A 5DGAA 4UY85 4Q2MA 3ISND 4MK9A 2BJDA 4OIXA 5KFRA 2F9JA 3FSYA 3HVAA 5KOXA 4C8LA 1YG0A 1F5CA 1T9WA 3DDNA 3OR1B 3PG9A 4JI6J 1DQ8A 1MN7A 3CD6S 3CIZA 3MEDB 1GMVA 1RDRA 2XSJB 3L4BC 3HZEA 3N28A 3WIUA 5B0CA 4AL7A 2YPYA 3KKFA 1KFDA 3JAMY 1L5UA 4LQ3A 4OX7A 4JV5J 1IQZA 5HBMB 3UR0A 3KUEA 1U48A 3GYNA 2HK2A 4AUKA 3CCRS 1C0UB 1DJ0A 1RT1A 3DLBA 1RP5A 4XAKA 3ZZTA 3LANA 3IBCB 4RBVA 4CYUA 1VJQA 2WONB 1N5VA 3TAMB 5A0YB 1LWEB 2CWXA 2GC8A 1RAGB 4DZ6A 9RUBA 4ED3A 4CLPA 3T5JA 3PRVA 4ZDNA 4UT4A 3QZ8A 2V4JB 2VJVA 4FXDA 1T95A 2VG7A 1DHMA 4QJVA 1RTHB 4Y28C 2FB0A 5HL7Q 3PYGA 1Y3KA 3SCIE 3LUYA 4MH8A 1MMNA 2J7UA 2RD5C 4JI6F 4B9MA 3PVXA 4M5DA 1W2BR 1JNRB 1HQEB 2D69A 4JBCA 4NZ6A 3FBEA 3P5TL 2MMYA 2KXFA 4DJBA 3DGPB 5LSLA 2W9CA 3FVYA 3JQJA 3NY0A 2A2CA 1IR0A 2JDJA 2OPSA 1MLAA 4OHZA 1JQGA 3W5YA 4F2SA 2UVRA 4WU2A 1NB7A 3O1LA 3PJXA 4R5PA 2ZJRQ 5DG7A 3I32A 4NCGA 1CJTB 1X5SA 2HFZA 1C0TA 2PFDA 1PYOB 3UDVA 2CQIA 3PTWA 3FC9A 1G6BA 2OO4A 3RG6A 2R8HA 4OHVA 1G1XA 3WIVA
chains in the Genus database with same CATH topology
2JNJA 3DGPB 3DOMB 1YDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNJ A;  3DGP B;  3DOM B;  1YDL A; 
#chains in the Genus database with same CATH topology
 4RU9 A;  3M30 A;  1Q8B A;  4EK2 A;  3Q22 A;  3V6J A;  2RSQ A;  1GMW D;  2BAB A;  2PMW A;  3IP0 A;  3CSK A;  1TUV A;  4IFY A;  2VD3 A;  4ID5 B;  1VQ8 S;  2ZWP A;  1B70 B;  1KOO A;  2F4F A;  2FHK A;  2ZUG A;  3MM6 B;  3TW0 A;  4X66 J;  2ZWO A;  4ID5 A;  4OMF G;  2XC9 A;  1XNR F;  1B7Y B;  4F4K A;  5F41 A;  1U1P A;  2HPU A;  5BYR A;  2MKK A;  5ETL A;  2NXU A;  2DR5 A;  5L9X A;  3CED A;  1OJ4 A;  1X0F A;  1BLU A;  2MY8 A;  3NG8 A;  2D7S A;  4V1A k;  3JAM U;  4KHP F;  1H73 A;  4NA1 A;  1JLQ A;  5IS2 A;  2DB1 A;  5EN1 A;  1SB6 A;  1WHY A;  2KYZ A;  2PMH A;  3QAT A;  4ED6 A;  1H72 C;  2HFN A;  4RUA A;  4ZVP B;  1TKD A;  1FKP B;  2EFV A;  4CYU B;  3Q23 A;  4TNO A;  1RTD A;  5D4O A;  4RW4 B;  3QRR A;  2NPI A;  2YX7 A;  2OP5 A;  1NJY A;  1U7L A;  1DY3 A;  3CCW A;  3L7P A;  5HAO A;  1KEK A;  3MMB B;  3AQP A;  2ASD A;  4YDX A;  1FFS B;  1N0V C;  2BAC A;  4EU0 A;  1M1K T;  4DQS A;  3C66 A;  4JI8 F;  2V9W A;  4I67 A;  2MJU A;  3D1Q A;  5FD1 A;  3W2W A;  1CJK A;  3MHY A;  4USM A;  2IDL A;  3POT A;  4G1Q A;  5E2Q A;  2A3J A;  3BN4 A;  3KK2 A;  3D2W A;  1N48 A;  1NKB A;  1FEE A;  2ZVS A;  3PFE A;  2DNR A;  4MIA A;  1VR6 A;  4U8V A;  1DQ9 A;  3RJM B;  4BC7 A;  5C2G A;  2XEX A;  1TL3 A;  1RWX B;  3SCK E;  2DD8 S;  2HFV A;  4HHJ A;  1DBD A;  3OL8 A;  2DNP A;  3JYT A;  3ZZP A;  1FES A;  1S1V B;  2R7W A;  1NB2 A;  2KDO A;  1DLO B;  2HHH F;  5LMU J;  2QGF B;  4EI2 A;  4U95 A;  2AEM A;  4C3K A;  3W5X A;  2HHS A;  4DPT A;  4ERD A;  4UOC A;  4KKO A;  1FK9 A;  1R8P A;  2KM8 C;  4FBT A;  3LAK A;  4LMZ A;  1HMV B;  3F0N A;  4HI1 A;  1LNQ A;  1X7V A;  1HBO B;  3OTC A;  4IFV A;  4KGM A;  4PXE A;  3TVY A;  1N52 B;  1UEV A;  4DX6 A;  4K4W A;  4PUO B;  1FE4 A;  2KVI A;  1GTH A;  2PDA A;  2AHO B;  4F4Y A;  1NZA A;  1N5Y A;  2AIR B;  2YNG B;  3CDE A;  5DM7 Q;  2ZJP Q;  3ITH A;  5H1S V;  2HAF A;  3THT A;  1HHS A;  1T3O A;  2GO9 A;  5F8I A;  1SV5 A;  1FRK A;  2YH0 A;  3V6D B;  3IBF B;  4K4T A;  2EBG A;  4LF9 F;  4LF5 J;  3UCZ P;  2KL8 A;  4DL7 A;  3K5L A;  1U6B A;  3ZTQ A;  3QGG A;  3UD3 P;  3TAP A;  4ZLP A;  1SJ1 A;  2VU5 A;  2F8E X;  1M5V C;  1YRX A;  3N5B A;  3H5U A;  2QLJ B;  1SL1 A;  4OZ1 A;  4ES3 A;  5J1E A;  2BOA A;  2R8K A;  3BQ2 A;  2LXI A;  4FBU A;  3KLE A;  2HHX A;  3MGJ A;  2VF3 A;  3FEZ A;  4O44 B;  5A6W A;  1IWG A;  4B3O B;  1WG5 A;  2MZQ A;  2R3V A;  5GAG U;  1LKZ A;  4DEZ A;  3GON A;  3D3B J;  2I5J A;  3EVM A;  3OR2 B;  2J6S A;  2CQ0 A;  2FJV A;  1KVJ A;  1RCX B;  1FX4 A;  1RWK B;  4QU6 A;  5GAD U;  4A8S A;  2MZR A;  4OFZ A;  1S12 A;  4NZ0 A;  3RGI A;  1NJW A;  5IT9 U;  2CVI A;  4YR3 A;  3I96 A;  4J5O A;  4RNO A;  2ILY A;  1T7P A;  3N0V A;  2COL A;  1KOH A;  2BE7 D;  4Q7A A;  5K8P A;  5A2Q Y;  2UUC J;  4A48 A;  2AW0 A;  5A8W A;  4DLE A;  2NSC A;  5IT0 A;  1QAY A;  2H9Z A;  5B0F A;  1N5T A;  2B43 A;  3TAN A;  1X9S A;  4DU7 A;  1J5E J;  2RQM A;  5ETO A;  4K2J A;  1TV6 B;  3CJS A;  1MML A;  4NLX A;  4F2R A;  2JLE A;  4TYA A;  4WFA Q;  3MAQ A;  4MMO A;  1VFJ A;  2ADC A;  5DLF A;  2DNL A;  2E1R A;  3W3S A;  1Y11 A;  2V2Q A;  3LAM A;  4X4P A;  5KT6 A;  1NM2 A;  4PWU A;  1M1H A;  4F02 A;  1UEU A;  1KRP A;  1PYS B;  3OL9 A;  4B08 A;  2XLK A;  1ZZF A;  1D9D A;  1RWM B;  2OPP B;  3IO1 A;  2EW9 A;  1KDN A;  4QWE A;  4DV1 F;  2FIU A;  1MWY A;  3Q24 A;  1J2V A;  4P2S A;  4WU3 A;  3V6D A;  2QLB B;  5KAK A;  1RT3 A;  2D3O 1;  3C8Y A;  4CP5 A;  1N54 B;  2V6A A;  3TEG A;  2QX0 A;  4DFJ A;  2VHG A;  3CB4 A;  4U96 A;  5IM0 B;  4BLG A;  3TZY A;  1B3T A;  1S77 D;  3RUB L;  2MQN A;  3QQC D;  2JX2 A;  2W2Q P;  2M5Y A;  3QGH A;  4PG5 A;  4J9K A;  4DUZ F;  2Y8W A;  1RAC B;  1RWU A;  4X64 F;  2XMK A;  2EI5 A;  3BS9 A;  3EGV A;  5D15 A;  8RUC A;  2ZBR A;  3IFE A;  3PYE A;  3SCJ E;  4OLP A;  3DN9 A;  2L9N A;  3CDA A;  4FF3 A;  3W9I A;  2BJ1 A;  1D8Y A;  1E6V A;  3GJR B;  2MGZ A;  1HQU A;  1KFS A;  1FDA A;  2UV8 A;  2HW3 A;  1RT4 B;  1GT8 A;  4ZLL A;  1LW2 B;  2IPO B;  2MSS A;  1VQ7 S;  5KFW A;  3SIP B;  3BPD A;  3EVW A;  4Q43 A;  4Q44 A;  1TKZ B;  3EDQ B;  1IJE B;  3T19 A;  1Y7P A;  4NML A;  5B0D A;  1AXQ A;  2FHO B;  2M8D B;  4B17 A;  3I5B A;  4XPE A;  3E2E A;  1S79 A;  3IM9 A;  3TA1 A;  3HVT B;  3RBZ A;  1KQK A;  4C3M A;  1OPZ A;  1RZM A;  3BYP A;  4WTO B;  3QLH A;  3KJF B;  4LSL A;  1QE1 B;  1P6T A;  2BM0 A;  4FYX B;  2ZE2 A;  3D0G E;  3PJW A;  4OHX A;  1TK5 A;  3CJK B;  5H9F J;  2XQC A;  3PNI A;  1N32 F;  2NXC A;  5C24 B;  1JB0 C;  3EMT A;  1WOP A;  5LMN F;  1ZAW A;  4E0D A;  2DH8 A;  1UVK A;  4LRC A;  1BE4 A;  2CQ2 A;  4K0K J;  3OQ2 A;  2KFN A;  1F5A A;  3HSD A;  3TJ8 A;  2WON A;  2J5A A;  4OZ5 A;  3QFH A;  3FDS A;  5J2M A;  1RK8 A;  2FHJ A;  4M5H A;  2B3T B;  4PPD A;  1RTI B;  3NL0 A;  5D78 A;  1FNM A;  2CPZ A;  2K2P A;  4U6P A;  1S0V A;  4KY3 A;  4V19 X;  1T94 A;  4RW6 A;  3J81 Y;  2DNZ A;  3JQM A;  5BYS A;  3CMA S;  2VQF J;  3W64 A;  2GGP A;  3TQ1 A;  2VFV A;  4OI6 A;  4UZC A;  3GTY X;  4WP3 A;  5J2N B;  1YDL A;  5I42 A;  1RI7 A;  2VOD A;  3FNN A;  5KT4 A;  4NI2 B;  2HBZ B;  4AE5 A;  3R1L A;  2ZUA A;  2XI3 A;  1GQE A;  3BBB A;  1Q16 B;  4GVL A;  4ILM A;  4OX9 J;  1RYS A;  3MEC B;  3C16 B;  2HWI A;  1RWP B;  3ET6 B;  4FF2 A;  1QVF R;  2FC9 A;  3T9N A;  1T3N A;  5AE2 A;  1X5P A;  3FRY A;  3MEC A;  4NCG B;  2XLI A;  3ZZ0 A;  4WXW A;  4K4Y A;  4OYW A;  5KFY A;  3KLV A;  2RS2 A;  3LP1 B;  2CQB A;  4X84 A;  3CC4 S;  4HTI A;  2IVY A;  3FMW A;  3M2R A;  1RKJ A;  3CCZ A;  4EO6 A;  4P74 A;  1FKA F;  2UXD F;  4L3K A;  2OFG X;  2W7O A;  4EZ9 A;  2D9P A;  4KAI A;  2C3M A;  1BC6 A;  3BJY A;  1GX5 A;  1RJJ A;  2RAQ A;  4KHR A;  1TU0 B;  2CIM A;  4EBD A;  2B8Q A;  3CCE S;  4FYV B;  3MM9 A;  4JI8 J;  4J91 A;  1QAJ A;  1RT2 B;  1NK9 A;  1F0X A;  2VZ9 A;  1X9M A;  3M05 A;  2I9S A;  2NCK L;  3K57 A;  1UKU A;  2BDP A;  1D9A A;  5J2P A;  4JI5 J;  2IJF A;  1LFW A;  2XO6 A;  1GMU A;  1FFG B;  4DR6 J;  4PG4 A;  4QWC A;  4CLK A;  1PG5 B;  1C0U A;  1RT1 B;  2CYY A;  3KUH A;  4YQW A;  2FVQ A;  4B3M J;  2EEY A;  2V8V A;  3JSM B;  1Y10 A;  4ES2 A;  4TY9 A;  2BQU A;  1IVZ A;  4USI A;  1PIE A;  1NJX A;  3OXG A;  1U0S A;  1JLA A;  1R31 A;  3Q8P B;  3IRW P;  3BSN A;  3EX7 B;  4U7U K;  2DGS A;  1REV B;  2CQG A;  3VWS A;  5LSO A;  4F04 B;  2JHE A;  3GIR A;  3MMB A;  4DV0 J;  2KFZ A;  1YX2 A;  3PYD A;  1RA6 A;  4UOF A;  5CYM B;  1NSQ A;  3T9Z A;  3ULH A;  4DUY J;  3S1T A;  5ETS A;  5U47 A;  2DR9 A;  4M5D B;  3THV A;  3R2C J;  1X60 A;  4DR4 F;  1NDP A;  2HND B;  1FK9 B;  2BW7 A;  2C3Y A;  2JLG A;  1FCA A;  1I94 J;  2YKQ A;  2DJW A;  5DZ6 A;  4DPY A;  2MY7 A;  2I6W A;  2J7K A;  5F3T A;  2ZBQ A;  3EZU A;  3DLG A;  4WE1 B;  4I6A A;  1XWL A;  2ZM6 J;  1KS2 A;  1DAX A;  1KQG B;  4R5P B;  1HWI A;  1DTQ A;  3LP1 A;  2IY5 B;  4U8Y A;  4HHU A;  4ZVQ B;  5BXI A;  3U1M A;  1VBK A;  5DM6 Q;  4F0K A;  1XMO F;  3HHL A;  3W8P A;  3J7A N;  1NCL A;  2CJ9 A;  2KKH A;  2QLX A;  4IFY B;  1SJ3 P;  2HZA A;  4WKR A;  3CJ4 A;  3UDC A;  1HBO A;  4IFV B;  1SH3 A;  4Y3C A;  3TOQ A;  2BQR A;  4F8R A;  3M30 B;  4QBU A;  1GH8 A;  1T05 B;  4RR5 A;  2DHX A;  5EUH A;  2LLZ A;  2HIQ A;  2C2Z B;  2XYH B;  2ZOF A;  2W7P A;  3U1L A;  2ASJ A;  2U2F A;  4BHQ A;  2QO3 A;  2PSZ A;  3MWB A;  1I94 F;  3QT7 A;  2QA1 A;  5D3G A;  1FXL A;  1JWW A;  4USW A;  2B4U A;  3DLK A;  2KVQ E;  4F25 A;  2XGQ A;  5E3A A;  1VMB A;  3MAA A;  1YIJ S;  4DR2 J;  1TL1 A;  2AP6 A;  2JL9 A;  1JJ2 R;  2GJF A;  2LVW A;  3LQV A;  4NCA A;  1UVM A;  3G6Y A;  2A10 A;  2LQ5 A;  2FZC B;  2QFI A;  2VPZ B;  3DRS B;  2GW8 A;  4USJ C;  5KFT A;  1VQP S;  1T05 A;  1J5E F;  1EIY B;  4G3I A;  3C3L A;  3DLJ A;  4DQP A;  1YBT A;  2GHV C;  1UTA A;  3DRS A;  3M2U B;  3R3T A;  2F3J A;  4WK3 A;  5HMW A;  4LRA A;  3PR5 B;  3UDL A;  2J6U A;  2QEX S;  1UW9 A;  2RF2 A;  5ETV A;  2ZZN A;  4MYU A;  1H2U X;  2W01 A;  2PA8 D;  4M5L A;  1RIS A;  2HS0 A;  2DK2 A;  2F7V A;  5HQ8 A;  3HT0 A;  1Q82 T;  2KZZ A;  2VAS A;  4AT1 B;  1S72 S;  1BMQ B;  2ZEJ A;  3P45 B;  4N5S A;  1R7I A;  1NME B;  1X4E A;  5B0G A;  2UUT A;  4ZJQ A;  4MKA A;  4XO0 A;  4DSJ A;  2AZ3 A;  4PQU B;  3J7Y I;  1WOO A;  1LQ9 A;  1W7W A;  2GV1 A;  7FDR A;  4FPI A;  5LSR A;  1QSY A;  3PO4 A;  1HNI A;  1GXL A;  1RTJ A;  2BV3 A;  2GIF A;  4C97 A;  4D3H A;  4DSK A;  2B4V A;  1DLO A;  1HIY A;  1Z4U A;  3ENA A;  4NZ7 A;  3NCR A;  4ZCM A;  3KFW X;  3GMG A;  1UJ6 A;  1I5O B;  3JYT B;  3RZA A;  5KFL A;  3GV8 B;  4NRT A;  3PJ9 A;  1KSP A;  4B3T F;  3AD7 C;  1SI9 A;  2LCW A;  2MKH A;  1IN0 A;  4CO4 A;  4YR2 A;  3T3F A;  3A1Y G;  2ROP A;  4ILR A;  1VQM S;  1T0T V;  5I4M A;  1GEH A;  3JTN A;  2G4B A;  4EWT A;  2UV8 G;  1IKX A;  4HTJ A;  2GO8 A;  3ONQ A;  2AJ4 A;  2DKO B;  2GS8 A;  2KT5 A;  4X64 J;  4C0B A;  2XWX A;  4DV3 J;  1N5Y B;  1Q95 G;  2JOQ A;  2DH7 A;  3D4J A;  1LFP A;  2QL7 B;  3KDN A;  4OYA A;  2EFP A;  5EWG A;  1TVR B;  1ZTW A;  1TAQ A;  5CHC B;  3M32 B;  5C25 B;  2DR7 A;  1UVJ A;  1RB0 A;  2ALZ A;  1NHK L;  5K5M A;  2ZBP A;  4DR3 J;  1SKW A;  3BKF A;  2C1E B;  3CVK A;  4IQM A;  3HHD A;  4LRE A;  3R5J B;  4O4R A;  2CJK A;  2E1M C;  1JLG A;  2ZFH A;  2XG8 A;  4ZN3 A;  4TQS A;  3VAH A;  3CO9 A;  3THP A;  2BVZ A;  2DGV A;  3VAJ A;  3KHR A;  1FDN A;  5ETQ A;  3KOA A;  4L75 A;  3MPY A;  4FZV A;  3K17 A;  1Y5I B;  1XC9 A;  4FF1 A;  4LFB J;  1IXK A;  1U25 A;  4Z2X A;  3G82 B;  3QAU A;  4U9R A;  1KTQ A;  5KFU A;  5G0R B;  4FNI A;  2PA3 A;  3B54 A;  3PXG a;  1RBA A;  2CUY A;  3BDP A;  1S6Q A;  4WII A;  3CTR A;  2JRS A;  2ZH6 A;  2AJ2 A;  2L08 A;  3W2V B;  2X3D A;  5EDW A;  1HR0 J;  2HHU A;  2ZJQ Q;  5D0E A;  2V0N A;  4JI7 F;  1CJK B;  4MK8 A;  2LDI A;  3GIL A;  1QSS A;  5KT2 A;  3ZZO A;  3F44 A;  3IAM 9;  4HYK A;  1KLM B;  4GVB A;  5E3Q A;  1SQF A;  2GAG C;  2J0S D;  2KTQ A;  2E44 A;  1UCN A;  2VJU A;  3CDU A;  1N56 A;  1VRU B;  4CZC A;  1HNW F;  2H51 B;  1JMT A;  4LR7 A;  4J9R A;  4CT9 A;  3J7A 1;  1S1T A;  3DOK A;  3ENQ A;  3NKY A;  1RA7 A;  1YLX A;  4MK7 A;  4ED0 A;  4LFB F;  2ZH5 A;  1MU2 B;  1RT5 A;  4PQA A;  3NGS A;  4WPA A;  1ZAX A;  1R43 A;  1H98 A;  2G0J A;  1JJ4 A;  2HVH A;  4H4O B;  1FE0 A;  5C2C A;  4U7U D;  3QLH B;  4ZPD A;  4ZCK A;  2YNF A;  4J9U E;  2FLL A;  4KPY A;  1WTF A;  2ZKT A;  1TMM A;  2JFK A;  1K1S A;  2Q6C A;  3B8H A;  4RWX A;  1Q5V A;  1HL6 A;  2UZA A;  2GZO A;  3BO3 A;  4NOH A;  2GVZ A;  5IWA J;  3CJ2 A;  4PWD A;  2QL5 B;  3MXH P;  2R7R A;  2BE2 B;  4DSL A;  2VQE F;  1KHW A;  2M2B A;  3KLI A;  5EWE A;  3H59 A;  2J9D E;  2WB1 D;  4AXJ A;  4DX5 A;  4YB5 A;  4O3O A;  1FDB A;  5HP1 A;  2YNI A;  3OSN A;  5GAD I;  2WOM B;  5EWF A;  1AW0 A;  1PAU B;  4L76 A;  4N8O A;  3HM9 A;  3AFG A;  1I6J A;  2FZK B;  3V6H A;  2XZT B;  2Z2Y B;  3A8I A;  2DCL A;  3LGM A;  4DR7 F;  3J80 Y;  5G4D A;  4MFB B;  1S6O A;  2XZW A;  3DYA B;  4PZV A;  1CS4 B;  2IM3 A;  2VOO A;  1UFW A;  1V5I B;  1Y3J A;  4LJM A;  3DYA A;  1T11 A;  2CPF A;  3Q86 A;  4LQ9 A;  1WDT A;  2XLJ A;  3KNG A;  3PM9 A;  4Y0F A;  3OJU A;  3EYZ A;  1H3D A;  4LT6 A;  5CCL A;  3CC2 S;  4GKJ J;  1S49 A;  1DAR A;  2DGU A;  2YKM A;  3RB0 A;  1H7X A;  3BH6 B;  1A7G E;  1FRJ A;  4H54 A;  2W9A A;  2V63 A;  2HLU A;  2MGZ B;  5K8O A;  2BKO A;  4PEO A;  2XB2 D;  2XSF A;  3K5O A;  3R9L A;  2J6T A;  3HHL C;  3N4W A;  3QGI A;  3FEY B;  3AJD A;  1H6K X;  3AJ2 A;  1KLM A;  3G96 A;  3KMQ A;  2XBP A;  2ATC B;  2DNM A;  2JC0 A;  2QLF B;  3HCX A;  2BR0 A;  2R8J A;  4AL5 A;  5L1I A;  2VFS A;  1FJE B;  1TR0 A;  4LR9 A;  1H7W A;  2QRR A;  3NAI A;  1CJV B;  4Y34 A;  1RE1 B;  1UPM B;  3GIJ A;  3SXL A;  2E9R X;  2X1F A;  4TY8 B;  1PKU A;  4KIA A;  4PKD B;  4YDD B;  1S5Z A;  3N9U C;  2N4C A;  3MMJ A;  1JLE A;  2CG4 A;  5ETN A;  3VTI A;  1T8E A;  1JLE B;  4L72 B;  4LIW A;  2RHQ B;  4IDK B;  2PI4 A;  3KHH A;  1X5O A;  2RDI A;  4ZMM A;  4J9M A;  3MD1 A;  4I2Q B;  5F3Z A;  2DNY A;  3KLI B;  3IM8 A;  1N33 J;  2ACY A;  4CIO A;  2F8H A;  5D77 A;  3AOD A;  3NBP B;  2X1G A;  1NPR A;  3ILJ A;  4ETZ A;  3KK2 B;  3IXQ A;  1RAF B;  4IH5 A;  4RW9 B;  2IBO A;  2YPZ A;  5KFG A;  5KFV A;  1HNV B;  1WG4 A;  3TUI C;  4KHP J;  3J81 j;  5GAE I;  3MR5 A;  4J37 A;  1UZD A;  2N82 B;  2R7S A;  1QD1 A;  2DCU B;  3ZZR A;  5IM0 A;  1VK8 A;  3OL7 A;  4RW6 B;  1N0U A;  4OI1 A;  1S7H A;  3SQO P;  5BR8 J;  4B3R J;  1A0O B;  4C11 B;  3W1Y C;  2HRY A;  1KQS R;  3C19 A;  2YWH A;  4X66 F;  2HHP A;  4CLF A;  2W9B B;  4LFA F;  3QIP B;  3EGW B;  5LMN J;  4B3S F;  4DL5 A;  4DCJ B;  4ECS A;  1NDL A;  4A8M P;  3W5Z A;  4P10 A;  1AFI A;  2ZH8 A;  1FD2 A;  4ZCI A;  2H4W B;  1HMV A;  3FBC A;  2XM3 A;  1HD1 A;  3OD2 A;  4RJV A;  2XHW A;  4N76 A;  1N4L A;  2HZV A;  2BAN A;  1IKY A;  2C3O A;  2J0X A;  3PR4 A;  2YKP A;  1XR5 A;  2CNK B;  1OY9 A;  5HQM A;  4RNM A;  2VQF F;  1WF1 A;  2WW8 A;  2QV6 A;  4PR6 A;  4EMD A;  3M9O B;  2BM1 A;  4J9V A;  4KTQ A;  3CCS S;  3IRX A;  2L9W A;  3AA9 A;  5BR8 F;  1FJC A;  4NA3 A;  4NWB A;  3EXY A;  2MQO A;  1R0A A;  4HH0 A;  3ENW A;  1AZS B;  5M2R A;  4DV7 J;  2WW4 A;  2RS8 A;  2YKN A;  1VHI A;  1UWA A;  3EGN A;  4FKX A;  3HVT A;  4RUB A;  3LP0 A;  3TVZ A;  4DSE A;  1RAO A;  4LF9 J;  4PCQ A;  3VR1 A;  3G87 A;  2FD2 A;  3C6T A;  4WXO A;  4F3O A;  3QFW A;  3D6H B;  1FHT A;  1X4F A;  5HSP A;  3BR9 A;  5A6P A;  2MQL A;  2R7T A;  3RW7 A;  3NNA A;  2NR0 A;  3I0R B;  2KFY A;  2ZVI A;  4NLQ A;  4CO3 A;  1I1G A;  1WKL A;  3MPV A;  5ADZ A;  5GAH U;  3J7Z T;  2DBB A;  4DR5 F;  1AFJ A;  2QYC A;  2DT9 A;  3EXC X;  2V8P A;  3RRH A;  1WTB A;  3GSD A;  4L6V 3;  4P2X A;  1EET A;  2Q6B A;  4LIR A;  3QZ7 A;  3DFE A;  5KFB A;  5J2M B;  5DGB A;  4OLO A;  5IC4 B;  3QO9 B;  4IG3 B;  2BBE A;  1HWJ A;  1U1K A;  2QYG A;  4OX9 F;  4X4T A;  1QDU B;  3DU6 A;  4HH1 A;  4DL3 A;  3W9J A;  2MZ1 A;  2R7O A;  2W25 A;  4LSZ B;  2DRA A;  3MM7 B;  2HQG A;  3QYY A;  2CAJ A;  4DL6 A;  1SQE A;  3BSC A;  3M8W A;  2XO7 A;  4ED5 A;  1U6Z A;  3MM7 A;  1MRO A;  3L7U A;  2DIU A;  4QIF A;  5KFI A;  5HLF B;  2AJQ A;  2HRU A;  5ETT A;  2ZH7 A;  1FVQ A;  4CT8 A;  4DR5 J;  3PO5 A;  1C4A A;  2YWW A;  3SEO A;  3OHA A;  2DEI A;  4UY8 T;  3JSB A;  4DR3 F;  2HK3 A;  1S9G A;  2YKA A;  2XCP A;  4JI4 F;  1IKX B;  3I56 S;  4C4W A;  3TX0 A;  1R6Y A;  5EGY A;  4ECX A;  3BQ1 A;  2P9C A;  4Q8F A;  5B7W A;  1P1T A;  5C5J A;  5EX3 A;  4DQQ A;  2MXY A;  2OTL S;  1G4C A;  4UQG A;  1XMB A;  2J8S A;  2VG5 A;  2YNG A;  3MTJ A;  2MLZ A;  2AGP A;  5CQG A;  1FEH A;  2YQ3 A;  3DNC A;  2V4R A;  2VBY A;  4ZPC A;  3UCG A;  4DUY F;  2HQD A;  3BKT A;  3HF5 A;  2EPI A;  2KG1 A;  4TLR A;  1NSK L;  1WEY A;  4Y6I A;  1RU1 A;  4DR4 J;  3S7R A;  2P2C B;  1RT2 A;  3TUP A;  1L3U A;  2OHD A;  1WNE A;  4KFB B;  2CZV C;  2H5E A;  2HG4 A;  1F60 B;  2IYI A;  3UN3 A;  2O1P A;  2FJB B;  3DMJ A;  3GV7 B;  2P5V A;  1DZ5 A;  4NLU A;  3ZNJ 1;  3I0R A;  2BJ7 A;  2RQ4 A;  3UR3 C;  5JUM A;  2FVS A;  1HBN B;  2RH3 A;  2ZBI A;  1WI6 A;  3CCT A;  3S8S A;  5KT3 A;  1HHQ A;  1NBE B;  4P6Q A;  4JYA F;  1EHW A;  1KWM A;  4PWW A;  3D66 A;  2FUG 9;  4RW7 B;  1U02 A;  2HUR A;  3A8E A;  3VZI A;  3HHK A;  3ZZZ A;  1ZA1 B;  2CJA A;  2J9C A;  4O3N A;  3G8T A;  1VQN S;  1VRT B;  2MQ8 A;  3MOZ A;  2NSB A;  3R6G B;  2OIH A;  1APS A;  1FWK A;  5LJ5 Y;  1MWZ A;  4TU7 A;  3NXZ A;  3S01 A;  3CO0 P;  4ZIT A;  3FCH A;  4RUC A;  5KFC A;  3FQK A;  5CYM A;  4RNF A;  5HMZ A;  1F2G A;  4NRU A;  4F4W A;  3QJL A;  1IR2 A;  3H0P A;  1K8A T;  1RTJ B;  1WC4 A;  1CJU B;  1WAC A;  2G0C A;  4DHV A;  1R8A A;  5DQI A;  2YWE A;  1QAI A;  5GMK a;  3OVB A;  5GAG I;  4DL2 A;  2OEL A;  4O4G A;  1WSR A;  4W98 A;  5KFP A;  3X1L B;  2PMZ D;  3PZP A;  3SFU A;  3TVK A;  3ZFV A;  4DU8 A;  1MSW D;  3K2Y A;  1RT7 B;  2W8K A;  1TKT A;  4G65 A;  4YY3 F;  4YB1 P;  2GVD B;  3O8W A;  3OTD A;  4KH1 B;  4ZVH A;  2DEJ A;  3CCV S;  4FKY A;  3CUN A;  5J2Q A;  3ZTP A;  2H4Y B;  5FII A;  1RBL A;  4JUZ A;  2OKQ A;  1PYT A;  4UST A;  2HS3 A;  1X8D A;  4ZJO A;  1K0T A;  4ELV A;  5AXL A;  2DIV A;  3I9V 9;  2QSW A;  3D5M A;  2W2O P;  3R27 A;  1VQ9 S;  4GKJ F;  3KK1 A;  2GVZ B;  4PWD B;  4ZVR B;  1T9X A;  4L74 A;  2GJI A;  4OV1 A;  1ITP A;  1RTI A;  2UXC F;  4DPO A;  1F3F A;  3QPI A;  2HEK A;  2H5I B;  4ZPT R;  4X4S A;  2FY1 A;  5KT5 A;  4DV3 F;  2DNO A;  2OPQ B;  2UU9 F;  4RKU C;  2XNR A;  2G1H A;  2IJN A;  2WOM A;  2VL1 A;  1GFW B;  4RX6 A;  3V81 B;  2FJE B;  4C98 A;  4U67 Q;  2ERR A;  3FUY A;  4B3T J;  5BJR A;  2CQD A;  1GK8 A;  4P2M A;  5D4N A;  1VOM A;  5DJB A;  4EBE A;  1PC5 A;  5JXS A;  4WFN Q;  4IO1 A;  2V2V A;  2CXE A;  4RW4 A;  2W4D A;  1EQM A;  4JI0 J;  1B7F A;  3GJT B;  5IQQ A;  4JI2 F;  4PYA A;  4FS2 A;  3GP9 A;  1QJH A;  2ILZ A;  3KWM A;  4KBI A;  1VQY A;  2FVR A;  3MMA B;  2RHS B;  4I7F B;  1SH2 A;  3NGU A;  4ZOS A;  3VGS A;  3W61 A;  1UVN A;  1PGZ A;  1S0O A;  2YH1 A;  4KJI A;  4ZK7 M;  4LUB A;  1L3T A;  1QTM A;  1U1Q A;  2B9X A;  4X62 F;  1WOS A;  4RLE A;  4DX8 H;  1OS5 A;  2ABY A;  2ROE A;  2CQ4 A;  3JTP A;  3HD2 A;  2GML A;  1FRH A;  1YJ7 A;  2I8E A;  4ZPB A;  4DI6 A;  3MM5 B;  2QA4 G;  3M6X A;  4CM0 A;  3A8K A;  2KM8 B;  3NGR A;  4I6Y A;  4IOC Q;  3HZG A;  4DCP B;  1S6P A;  4CNY A;  2PGC A;  5ETK A;  5A8W B;  1RLD A;  2Z2L A;  4PG7 A;  5ETM A;  2B51 A;  2C28 A;  4M5J A;  4C8O A;  5J1P A;  1RHJ B;  2AYE A;  4LR8 A;  1ZM9 A;  3OW2 R;  1SKR A;  4EYH B;  4JI7 J;  4DF4 A;  1V3Z A;  3CCU S;  2IMW P;  2HBR B;  3B4D A;  4CH7 A;  3G9C A;  1FT8 A;  4IR1 A;  1ZPV A;  1RT3 B;  2LKZ A;  5HRO B;  3NGD A;  4QYR A;  4DQR A;  1M5P C;  4AXI A;  2VG7 B;  3HLU A;  5H9E J;  2OD6 A;  4J90 A;  3SYZ A;  2VFT A;  4LF8 J;  4NLW A;  3HFK A;  2JZ5 A;  1DTT B;  2Q1L A;  1K47 A;  5CH7 B;  4A8O A;  1WEL A;  3BSO A;  2IFX A;  4ITS A;  3HHN B;  2E5H A;  4PG6 A;  5F8J A;  3C15 B;  5AT1 B;  3GPA A;  4DSI A;  4UUX A;  2Q3P A;  3MCN A;  3NCP A;  2LDY A;  4Q8E A;  1VC6 A;  1HBU B;  1Q81 T;  3DC2 A;  2W8L A;  1G2E A;  2F1F A;  4OJG A;  5GAH I;  4J9P A;  4H4K A;  4QIG A;  2WBR A;  2G1D A;  2WK4 A;  3O6Q A;  4WYL A;  1FFW B;  4GKK F;  2Z30 B;  3IWN C;  4Y2A A;  1S99 A;  3M2R B;  1YZ7 A;  1HI1 A;  2K7K A;  3MM8 A;  4YUD A;  3CF5 Q;  4HKQ A;  2GX8 A;  1RWN B;  2EKN A;  2XTJ P;  2DXD A;  4WKY A;  2HVD A;  1NRK A;  2OMO A;  5DLG A;  1VQO S;  2E1A A;  1M5K C;  1XK8 A;  4PG8 A;  1FRX A;  3NGK A;  1R8H A;  2DIS A;  4P52 A;  2XS5 A;  3MM9 B;  5A8R A;  2CZ4 A;  1VS3 A;  2M0G B;  4G1I A;  4A4J A;  4C0O C;  1NSP A;  3L3C A;  1VYA A;  2RU9 A;  3AXK A;  4KHM A;  2JJ4 D;  3PEJ A;  3FQL A;  3UE2 A;  2BJ3 A;  4CLU A;  3CMQ A;  2ZD1 A;  5I3U B;  5AJ3 J;  1SL0 A;  1URN A;  1FKO A;  4QIW D;  4MIB A;  2W2P P;  4QIE A;  1TKZ A;  1HA1 A;  4CWB A;  3BO2 A;  2WVF A;  4OHW A;  4C0H A;  3N6M A;  3PW0 A;  3QRP A;  3OTB A;  1O51 A;  4DV0 F;  2VOP A;  2AWZ A;  2FLO A;  3MAA B;  2JSX A;  1VBZ A;  2Z58 B;  3CJ0 A;  2DNQ A;  4RUH A;  1KR4 A;  3M2V B;  2VBZ A;  3KG0 A;  1E6Y B;  1AT1 B;  2YNF B;  3MEG A;  1D1U A;  2EWH A;  2HIY A;  1CC7 A;  4E2F B;  3KJV A;  3Q0A A;  3DRR B;  2HWT A;  4PXD A;  4DS4 A;  3H2L A;  2NRE A;  3DM2 B;  2X51 A;  2ZOG A;  3LO3 A;  1O0P A;  3M8Z A;  3BRE A;  4LRD A;  4X4U A;  1RWW B;  2QMW A;  3SV3 A;  1RTH A;  3PYF A;  1LW0 A;  4WFZ A;  2DY1 A;  3R97 A;  1TKX B;  1TL7 B;  2HNZ A;  2FLP A;  1WG1 A;  3IWL A;  4OZ3 A;  2R9L A;  5HAT A;  1C2P A;  1NND A;  3SFG A;  4JP8 A;  2IHR 1;  2MHE A;  2LQB A;  3MTK A;  2KN4 A;  1SXL A;  4UOG A;  1TP7 A;  2VDI A;  1YTY A;  1HNZ F;  1SIZ A;  3Q8S B;  4Z7Y A;  1HNI B;  2C2E A;  2HZC A;  3C16 A;  4DR1 J;  4ER8 A;  3IS9 B;  1NH8 A;  2CFX A;  3MPU B;  3R5C A;  2GQ2 A;  1NXI A;  4BWM A;  4NI2 A;  5MAO A;  3GWC A;  4KC5 A;  4WWS A;  2APO A;  2HNY A;  4N56 A;  5HN0 A;  3DLH A;  4OL8 A;  2WSC C;  1B0V A;  3TR5 A;  5K14 B;  3IGV A;  4Y2K A;  2IC3 A;  1AYE A;  2HMI B;  3MZI A;  2EK1 A;  3HVR A;  1T9U A;  1YJR A;  4B9L A;  3FFI A;  4GMK A;  1IKW B;  4OI2 A;  3RB4 A;  2EFO A;  4PUO A;  1K1Q A;  3DDI A;  3EPG A;  1JNZ B;  1VC5 A;  3KHL A;  4BCA A;  3TRG A;  3M6W A;  1TVR A;  2NPF A;  4TN2 A;  5B09 A;  2OAU A;  2O01 C;  4H4K C;  1CJV A;  1IKV B;  1LWF A;  3VV2 B;  4CO2 A;  3V6K A;  2ALY B;  5M2U A;  2R7Q A;  3GFZ A;  3PRB A;  4K7Q A;  4WYW A;  5KFQ A;  1NDK A;  2MZS A;  3AHP A;  3HFV A;  4CLZ A;  3FJ2 A;  2G2Z A;  4LF4 J;  3UI3 A;  4IQX A;  5L9N A;  2CQH A;  2LMI A;  3ZC4 A;  4K4S A;  3BGF A;  2KT3 A;  2UUA F;  2HYI B;  5HAN A;  2BA9 A;  2D74 B;  2FHM A;  1MW7 A;  2RF2 B;  2BYC A;  2RVJ A;  4KO0 A;  1AB8 A;  5C42 B;  4I6W A;  3HMJ G;  3MR6 A;  2FTR A;  1FRL A;  1RAJ A;  2JWN A;  3AD9 C;  2E9T A;  1YZ6 A;  4NXN F;  1VLO A;  2OLW A;  2WSF C;  4DZD A;  5HQL A;  5KT7 A;  1JK9 B;  1S6Q B;  1TMJ A;  4ECT A;  3RBE A;  1YBU A;  3Q8Q B;  4ZS6 A;  2LU2 A;  2UUB J;  5E3P A;  3OR2 A;  1VQ5 S;  1FER A;  3U7J A;  3RB3 A;  1T9Y A;  1YSJ A;  1NKC A;  4PQU A;  2J0W A;  1NK5 A;  1NK4 A;  4DG1 B;  5CA5 A;  4LF4 F;  4WZQ A;  3GJS B;  2K8G A;  3MR7 A;  3DLL Q;  2XWY A;  1F9F A;  4OYZ A;  4AND A;  2YY3 A;  4DG1 A;  3HJF A;  5FLX U;  4DSF A;  5HMX A;  2ZH4 A;  2DGQ A;  5DQH A;  2Y1J A;  2WVC A;  1XBW A;  2RIJ A;  2ZC3 A;  4E98 A;  2LQJ A;  1CJU A;  2V68 A;  3D3C J;  2JVR A;  5M2P A;  3GV5 B;  2MJN A;  4DQI A;  4JI1 F;  1S57 A;  3LP2 B;  4MJK A;  1S1W A;  2F65 A;  3EJM A;  2ZH9 A;  2UXD J;  1FVS A;  1IM4 A;  2VC0 A;  2Z2Z A;  5CD4 A;  3AY0 A;  4DMZ A;  2IRX A;  5DDO C;  3UNY A;  2NZ4 A;  3KXD A;  1MMD A;  4ZVS B;  1VBY A;  1NK7 A;  3IR6 B;  2GHW A;  1S9E B;  1YGY A;  1FWL A;  2AKW B;  2RUG A;  1VBX A;  3NS6 A;  4LF1 A;  4NLO A;  3I87 A;  2CDQ A;  3IRX B;  4P7T A;  2CJQ A;  2HFU A;  1G7C B;  2FY8 A;  4MIW A;  1W25 A;  2AX1 A;  3KG1 A;  3LGN A;  5HP1 B;  1TK8 A;  1OSD A;  4DPW A;  2Y9H A;  3EWG A;  3W63 A;  3PX4 A;  4C8M A;  2QE5 A;  4P72 A;  1HW8 A;  2BUN A;  5AE3 A;  1HNW J;  4NLV A;  1RAH B;  2B4O A;  3LP0 B;  4MTP A;  3UVJ B;  2RB7 A;  4USV A;  4X62 J;  3EDR B;  3R7B B;  2CPY A;  3PHT A;  4B02 A;  5KG5 A;  2XMU A;  3TO8 A;  2NZC A;  2KZM A;  2MDA A;  3R5D A;  3L95 X;  4LFC J;  2XMM A;  4ED4 A;  5F0U A;  1PJ5 A;  5CAA A;  5DDQ C;  1MN9 A;  2X3G A;  4QIV A;  5CZV A;  2EBE A;  2OD4 A;  5LJ3 Y;  1A9N B;  6FDR A;  1S10 A;  4MT1 A;  1FJ7 A;  1REV A;  5CZX A;  1LK7 A;  4URQ U;  3O5T B;  3OSP A;  2W4C A;  2LXU A;  3DOM A;  3GYX B;  5HMY A;  1IBC B;  3HO1 A;  2FJX A;  1JKH B;  5IQ6 A;  3DOM B;  3X3U A;  3E8O A;  4K4X A;  1FDD A;  4GC6 A;  3C14 A;  5IV3 A;  2VA2 A;  4RBT A;  3CD5 A;  1V6H A;  3E51 A;  3HUL A;  4CNZ A;  8ATC B;  3BV8 A;  4FDF A;  3M9M B;  2EG1 A;  1U1L A;  2DO4 A;  3KLF A;  4DL4 A;  2UP1 A;  3JSR A;  2WZ1 A;  4U7C A;  2KG0 A;  2LEB A;  2R2R A;  2E1P A;  3KLF B;  3J7Y U;  2J9E A;  2BJ8 A;  2IJR A;  2F5G A;  4GO7 X;  4D3G A;  3RRG A;  1HPZ B;  2ADB A;  3SI8 A;  4JYA J;  3BH7 B;  3Q8U A;  4ZVE A;  2W24 A;  5KG1 A;  2XMA A;  2JEF A;  2ZE2 B;  3I0S A;  1CC8 A;  1PBU A;  3H2U B;  2HQC A;  2VC1 A;  2QC3 A;  3D68 A;  4IDK A;  4PYD A;  2N7C A;  1ELO A;  4XK8 C;  4K4U A;  5H9F K;  2AU0 A;  1RUS A;  4UF4 A;  3NOG A;  3HP6 A;  2RT3 A;  4L3N A;  3Q8R B;  3VAK A;  4EYI B;  3DLE B;  1UAW A;  4AQY J;  2B56 A;  3BGO P;  3FBF A;  1FWP A;  2NXJ A;  5CAB A;  4EUV A;  4PRF A;  2K06 A;  4DR2 F;  3NRB A;  1F2H A;  1U0H A;  3W60 A;  5KG6 A;  2HFO A;  4RW9 A;  4I68 A;  4ZIW A;  2Y8Y A;  2VUG A;  2JEI A;  2D9O A;  4DOZ A;  2X1A A;  1U0H B;  1O5J A;  3OFG A;  2BQ3 A;  1FNX H;  1X4G A;  2DNH A;  2P9E A;  3MEK A;  3CJ5 A;  3UPF A;  2MZJ A;  2C2R A;  1FTR A;  2QN6 B;  1KON A;  4F3Q A;  4ED2 A;  4BDP A;  1XNQ F;  3FGV A;  3KUG A;  5GAE U;  2VH7 A;  2UUW A;  4P9S A;  3TJA A;  1ACM B;  4R25 A;  1IBM J;  2W9B A;  2Y1I A;  4QWA A;  2H1Y A;  4OJH A;  3AA8 A;  4F50 A;  3G2X A;  1U09 A;  2EC0 A;  1S1X A;  4FNH A;  6FD1 A;  3WZ0 A;  2RNE A;  3ET6 A;  3JQK A;  2E5L J;  2DGO A;  2F4V J;  4B3S J;  2YQ1 A;  3VGT A;  1NPP A;  2BZ2 A;  2YXL A;  1XR6 A;  3R1H A;  3W65 A;  2GFF A;  1WF2 A;  4I64 A;  2IVM A;  2J8A A;  3FBB A;  4K5S A;  3CUL A;  4JV5 F;  4ELU A;  2ZKU A;  1UFL A;  4KGZ B;  5HVF A;  3M6V A;  4HEA 9;  4O3P A;  4OYB A;  3KG4 A;  2MHN A;  2HGM A;  3H90 A;  4CDI A;  1ZYQ A;  1FXD A;  3DRP A;  4O3S A;  4HAC A;  3UNG C;  4Z7C A;  4WCE Q;  4YP3 A;  1N36 F;  4CLT A;  3DI6 B;  4NLP A;  4ANC A;  1R8B A;  4OJ1 A;  4IRD A;  1U6F A;  1EX8 A;  2OSQ A;  2KYX A;  4NYP A;  4NX9 A;  5IZH A;  3SZ2 A;  1S0N A;  3CJK A;  1U49 A;  2F4V F;  3AOA A;  1R3N A;  2VG6 B;  3DM2 A;  1P9Y A;  3BDE A;  3MED A;  3US5 A;  4DL0 C;  4R8U A;  3QRQ A;  3MAH A;  1ROF A;  4LSL B;  3VAF A;  4ELT A;  4ECV A;  2OH2 A;  2QG9 B;  3GG1 A;  4M5I A;  5D0H A;  1YWX A;  3HDS A;  1HWU A;  1RYR A;  1RHQ B;  4M5K A;  4C8Y A;  3AT1 B;  5C24 A;  1QUP A;  3P96 A;  3TUJ C;  4F4X A;  2AEF A;  3PW7 A;  4ZP7 A;  4QR2 A;  5HJX A;  2N3O A;  5CYQ B;  5T7L A;  3QJJ A;  3SQG B;  3VAL A;  2PD1 A;  4LF5 F;  1WHX A;  2QIF A;  3KLH B;  3KHG A;  3I4H X;  4UTG A;  3FZ2 A;  3H20 A;  5E5N A;  3IWX A;  3MUR P;  4ANE A;  2E5I A;  3L7O A;  1S97 A;  1SL2 A;  4OHY A;  3BZQ A;  4LF2 A;  2P6S A;  5I3P A;  2IMO A;  2YVS A;  1B4S A;  3U27 A;  1Z2L A;  3HVW A;  2CJY B;  1HWK A;  5E33 A;  3C6U B;  5J2N A;  3J81 U;  1XNR J;  5SUH A;  3CW2 C;  3CJQ A;  5KG7 A;  1YJT A;  2QMX A;  4KQZ A;  2YWG A;  2IC3 B;  4LF6 J;  1K44 A;  1QM9 A;  3QWP A;  3MM8 B;  1S9G B;  1X4C A;  2VFU A;  2WB4 A;  3MF5 A;  4R0E A;  3D6F B;  3NEK A;  2RML A;  2XY5 A;  5JVG Q;  1N34 F;  1CEZ A;  4ZIV A;  3DOL A;  5E41 A;  4MYT A;  4DFK A;  1VQL S;  4C6A A;  3GE9 A;  2HHH J;  1CPZ A;  2G13 A;  2ZM6 F;  2R8I A;  2UUA J;  1K0V A;  3KK3 A;  1B99 A;  3G6X A;  1TEL A;  1JLB B;  4CH1 A;  3KNA A;  1C4C A;  3JB9 k;  3LWL A;  4LF7 J;  1IKV A;  1LWF B;  2VV5 A;  3D0I E;  3DXB A;  4P2F A;  5KTQ A;  1AZS A;  3EUN A;  4WTY A;  1UA0 A;  4FXW A;  4YR0 A;  2GMJ A;  3LGH A;  5F8M A;  4HAC B;  2IRU A;  2C2M B;  1IQT A;  2EVZ A;  2IA0 A;  3ZTS A;  5F9L A;  2I0X A;  1Q4R A;  1PO6 A;  3MDF A;  1LEO A;  4C8K A;  1IR1 A;  2CDR B;  2XHC A;  4RW8 B;  1NPK A;  1UW4 A;  2N3L A;  5J1N A;  1CSJ A;  2XNQ A;  2MKI A;  3QGP A;  3EIC A;  1FKO B;  1NAQ A;  2FPH X;  1HLW A;  3DLK B;  3E01 A;  4GO5 X;  1X31 C;  5GVQ A;  3MR3 A;  3ENV A;  1N34 J;  2RIL A;  2IBK A;  3MEG B;  1WUU A;  2V8H A;  4ZJL A;  3IGN A;  3VAM A;  2YNH A;  4CO0 A;  4F4A A;  1RT6 B;  3HX9 A;  4Q5V A;  1Q1K A;  3M2U A;  1C1B A;  4OX8 A;  2HSE B;  3NWG A;  3RAX A;  3P49 B;  2Z56 B;  4QPT A;  3DRR A;  1VIS A;  3MCS A;  4TYB A;  1N5Q A;  2JVO A;  3QBC A;  4CO5 A;  2RU3 A;  4OI0 A;  5AJ3 F;  2C2O B;  3B82 A;  1YQH A;  3OTO F;  5HJY A;  1D9F A;  2F40 A;  3D0H E;  2B9Y A;  2DGW A;  2XI2 A;  1BQN A;  3QT5 A;  3POT B;  2HQF A;  1Z1Z A;  2OEK A;  1U1M A;  2R42 A;  1WSV A;  4BWJ A;  4UW2 A;  2OPR A;  3GG0 A;  2GQC A;  2QLW A;  3PCO B;  4M1K A;  3D1H A;  2Y0B B;  1TL3 B;  4B9U A;  3QT8 A;  5FLX Y;  3Q8V A;  3OHB A;  4KT0 C;  1F5B A;  2GQQ A;  1VIX A;  3A3N B;  2HNY B;  4ATN A;  4MAK A;  2E7V A;  4ETX A;  1GX6 A;  3AD8 C;  1B0P A;  4DV4 J;  4HLB A;  1XEZ A;  5IT4 A;  3KK3 B;  1KKH A;  2ZOM A;  4ECW A;  4OZ0 A;  2MZT A;  1SC1 B;  1TZ0 A;  4FP9 A;  4ZVF A;  2RRN A;  2HBY B;  2PEH A;  1YK9 A;  1JJH A;  1GXT A;  1Y4Z B;  4LFC F;  1CUL A;  3EZO A;  3HHL B;  4NCB A;  1VK3 A;  3LOU A;  1SVD A;  3GJQ B;  2AYM A;  2RE1 A;  5A8K B;  2BAN B;  2GNK A;  3M8Q A;  3TZW A;  5DDR C;  3M9N B;  2VPW B;  4ZHR B;  3FSX A;  2FHJ D;  1HNZ J;  2CAD A;  3IAS 9;  5IXU A;  3GII A;  2RUS A;  3DDK A;  3SDE A;  3PKY A;  3OUY A;  2LEP A;  1NDC A;  1SV5 B;  4OI4 A;  3VAG A;  2XUL A;  3DRY A;  3MUT P;  3A4T A;  4DPU A;  3IR7 B;  1WDD A;  1V3S A;  2CPD A;  2W2N P;  3P6Y C;  4A8Y A;  1NJZ A;  1RTD B;  5IT9 Y;  1OY8 A;  1RTZ A;  2MLY A;  4OZJ A;  2HAI A;  2HGL A;  4ECU A;  1CVJ A;  4QR1 A;  1N33 F;  2AMC B;  3T41 A;  4WIQ A;  5DQG A;  1SC3 B;  1RHM B;  3QNW B;  4NA2 A;  3CCL S;  1DFD A;  3IMQ J;  2Y1L B;  4N47 A;  4DX7 A;  1UVL A;  1BQM A;  2WRM A;  5ITH A;  4JI2 J;  3EPI A;  5BYQ A;  4URG A;  1X9W A;  2XMJ A;  1AA1 B;  1M5S A;  5ETR A;  4I69 A;  1BWV A;  4HL9 A;  3W66 A;  2LQ8 A;  4YS2 A;  5KFO A;  4GRS A;  1GNK A;  2GA7 A;  1NK0 A;  4EZ6 A;  2AX0 A;  1HQE A;  3VCD A;  2B8P A;  2AT1 B;  2MB0 B;  1MRO B;  2FDN A;  2U1A A;  5K20 B;  4G1Q B;  3MPD A;  1T9V A;  2WCX A;  1ZA2 B;  3MM5 A;  4RNN A;  4P7V A;  4C3L A;  2OML A;  2O5D A;  3WBZ A;  3JSY A;  3WHI A;  2DPI A;  2G2Y A;  4F0M A;  1UMJ A;  1PJ6 A;  4KGX B;  4Y00 A;  2BW2 A;  2XCA A;  1NU4 A;  1S1V A;  1U24 A;  1HNX J;  1VI7 A;  5DS7 A;  3K5N A;  4DFP A;  4ED8 A;  1VIO A;  2XZD B;  2CVE A;  3DLE A;  2MST A;  2ZDO A;  4H4O A;  5K14 A;  1HYS A;  1RAE B;  2XYG B;  3LPY A;  3PHE A;  4FYY B;  2I2Y A;  2AEJ A;  4KV8 B;  3BGU A;  1L3K A;  3H5Y A;  4N77 A;  4DV2 J;  2DY9 A;  4KGK A;  2BEF A;  1WEX A;  2QTW A;  1TFY A;  4P73 A;  4P71 A;  1N32 J;  4ZVU B;  2HHQ A;  2B0G A;  1ZTT A;  4I2P A;  5B0B A;  7FD1 A;  1WJ9 A;  2M8H A;  3MI7 X;  4NXM J;  1RQ0 A;  3OFE A;  4USH A;  4J9N A;  4K0K F;  1R0A B;  2VQE J;  1EJ7 L;  2EFN A;  2PT0 A;  1XR7 A;  1TL1 B;  5HVG A;  2VON A;  9ATC B;  1YJU A;  1S1X B;  3NP5 A;  1RWV B;  3BSA A;  2NXN A;  4NMX A;  5KFA A;  3QSY B;  1YI2 S;  3UVJ A;  2DPJ A;  4IH7 A;  1EKS A;  3G4S S;  4LBH A;  5DO2 A;  2Q79 A;  4A8Q A;  5G0R A;  2L3M A;  4DV2 F;  5D4L A;  3CJR A;  4QYZ J;  3H7H B;  3FSI A;  3OBI A;  3G86 A;  5L1L A;  3DU5 A;  5DET A;  1U8S A;  1VRT A;  2XMV A;  2UVW A;  1RKI A;  1DQA A;  2GAH C;  2VBW A;  4M8L A;  2K1R B;  4ECY A;  1ZM3 A;  3VF0 B;  1XQI A;  1LK5 A;  1PBA A;  2O3D A;  3IR5 B;  4CM2 A;  1S9F A;  3BKU A;  5E0O A;  2NLW A;  3UO0 A;  4QZV B;  2CPH A;  3C14 B;  2HBQ B;  3DXS X;  2G9O A;  4NYZ A;  1Q0N A;  2NUH A;  3CDB A;  2BOP A;  4C9D A;  2YWK A;  5JVH Q;  1N36 J;  1U47 A;  2Y3Y A;  4KRW A;  1LWX A;  4GVB B;  2A0F B;  2HRT A;  1M5O C;  1MU2 A;  1LXJ A;  4PAB A;  4LBP A;  3OLA A;  2W7A A;  2PN6 A;  4WFX A;  2XSJ A;  5RUB A;  3Q89 A;  1HPZ A;  2ZBC A;  1U4B A;  5FJ4 A;  3I31 A;  2XS2 A;  2O66 A;  3OFH A;  3O3L A;  1RT5 B;  1NK8 A;  1YJN S;  3LPE A;  3SMZ A;  1Y5L B;  2ZH1 A;  4A8X A;  4JI5 F;  4FYD A;  4ZVG A;  5KFN A;  5KFE A;  3B4M A;  4QWD A;  2ACM A;  5J2Q B;  2FLN A;  4DR6 F;  1HBM B;  1V5V A;  3IG1 A;  1SKU B;  1BD6 A;  2CNL B;  2E66 A;  4BBY A;  5D6G A;  1L3V A;  2MKS A;  4NEZ A;  4UZB A;  4J9Q A;  1EQ0 A;  3MPW A;  2BE2 A;  1FRM A;  1RSC A;  1ZS6 A;  3TUZ C;  2YQ0 A;  1CQM A;  1XTZ A;  4H4M B;  1IBL J;  3NMA A;  1Y00 A;  2QMU B;  4ZP8 A;  3QSI A;  3KK1 B;  2HHW A;  3ETO A;  1OMS A;  4H4M A;  4MFB A;  2B7C B;  2DIT A;  2NXE A;  4LF7 F;  4WF9 Q;  1YRU A;  1ZPW X;  2VKR A;  1WEZ A;  1RAA B;  3MFH A;  3GR0 A;  4F67 A;  3HK2 A;  1TUG B;  4ECQ A;  3AQO A;  1S0M A;  2HQ3 A;  1NK6 A;  2FQQ B;  3IS9 A;  3TNV A;  1WKK A;  1UWB B;  2ZZT A;  3DHX A;  3I9Z A;  2LEC A;  2CA9 A;  3SSS A;  1U8W A;  1IM6 A;  3NCQ A;  2FYX A;  1M90 T;  4B3O A;  5F8N A;  4NLR A;  5HK4 A;  3W2V A;  3BF4 A;  4X65 F;  3M1V B;  4DN0 A;  3CPW R;  4K4Z A;  1E6V B;  3S6E A;  4ZP9 A;  3T6B A;  1FF2 A;  2LP4 A;  3PEH A;  3LWM A;  2R2U A;  2V9K A;  1HWL A;  1RT4 A;  4XIU A;  1T9T A;  2P8I A;  3N01 A;  2ASY A;  3V2U C;  3HHE A;  1IKW A;  1FRI A;  2KXN B;  3M8R A;  4DFM A;  3UD4 P;  2CPI A;  4O0N A;  4V19 J;  1XMO J;  4S0M A;  2QT7 A;  4EEY A;  3A8J A;  2EKY A;  2XMW A;  4HR2 A;  3A3P B;  1LWC A;  1U2C A;  4QR0 A;  3BGL A;  3W8G A;  5KFX A;  3T1A A;  4KPC A;  4OYO A;  5DRK A;  5LT5 A;  2XMT A;  1S1U B;  2D41 A;  3ZXW A;  3PV8 A;  1YHQ S;  1P8G A;  4DV7 F;  4ZA1 A;  3QAE A;  3NNH A;  3ZTO A;  2AV5 A;  2AGO A;  4QOT A;  1QVG R;  2E5L F;  3HT3 A;  3C46 A;  3K5M A;  1IJF B;  2CQP A;  4RL1 A;  2H3E B;  3ELH A;  4KO0 B;  2H54 B;  5IOL A;  3F41 A;  3SBM A;  4LVO P;  2LEA A;  1R0C B;  1HAR A;  1SC4 B;  2FGC A;  2MKJ A;  3GCW P;  4OI3 A;  1FD8 A;  3JS9 A;  3I55 S;  3SQG A;  4NXN J;  2UU9 J;  1RT6 A;  3TZX A;  4YEA A;  2CNN B;  4DV5 F;  2EFG A;  3K5P A;  3ISZ A;  3W62 A;  5KFK A;  4DWI A;  4DPX A;  4ZVT B;  1WC1 A;  5T7L B;  1RAI B;  3RB6 A;  1SIW B;  3G8S A;  2ZIT A;  1UPP A;  3F73 A;  1H74 A;  2GMH A;  4UQT A;  3NS7 B;  4IOB A;  1RGV A;  4KB7 A;  2G0I A;  1OWX A;  3P3D A;  4M5M A;  3RBX A;  3MR2 A;  2QA4 S;  1KLN A;  1V3R A;  2HFS A;  2PEB A;  2RKI A;  1O6X A;  4DBQ A;  4YOE A;  3BEG B;  1RBO B;  1Y0H A;  3D9B A;  1HBU A;  1S59 A;  2Y0S D;  3M1V A;  4JOU A;  2RKI B;  3DGV A;  4A46 A;  3FFI B;  5DDP C;  4DV5 J;  2AJ1 A;  2CPE A;  3VAI A;  4DF8 A;  2L48 A;  2YX4 A;  3QJP A;  1OY6 A;  1JLB A;  2DGT A;  1HW9 A;  2DXE A;  2OGU A;  2DGX A;  3LA0 A;  4DCO B;  2ZHA A;  3T5H A;  1QSL A;  2G2O A;  2C3P A;  1CQN A;  1IKY B;  1Z2Z A;  3WC2 A;  3NLC A;  3PDN A;  1B0T A;  2ZD1 B;  3GSI A;  4FF4 A;  1UL3 A;  2CZ9 A;  1LWC B;  2RQK A;  2YBV A;  1F9E B;  3PW5 A;  2XS7 A;  4R0J A;  3HKZ D;  1Q79 A;  3NGT A;  3DI6 A;  3K8V A;  4TY8 A;  4ZPW R;  1GXU A;  4M63 A;  4ZCL A;  5KFD A;  1KBR A;  2X7I A;  1BHN A;  3N79 A;  3QWU A;  4J9O A;  2B9E A;  2LQ9 A;  3M2V A;  4W92 B;  3M4X A;  2JEJ A;  1EKR A;  2CRL A;  4FPR A;  1Q78 A;  2IVF B;  1BQM B;  1X4A A;  4NE9 C;  2DO0 A;  3N5F A;  2XGP A;  3PKM A;  1XJW B;  3CDW A;  4C2M A;  3SCL E;  2RDJ A;  3LAL A;  1C1B B;  5A2Q U;  4XDD A;  3R2D J;  2UXB J;  1RHR B;  5LL6 d;  2Z8Q A;  4XTT A;  4LSN A;  4IYQ A;  1U2R A;  1HD0 A;  2H65 B;  3FEX B;  3T1H J;  5L38 A;  1JLA B;  4F4Z A;  1FJG J;  3E3X A;  4OJ3 A;  2W4P A;  4ZLN A;  1W2I A;  2OEJ A;  1LW0 B;  2ZC4 A;  4HT5 A;  3UW1 A;  4ES1 A;  1HR0 F;  2QJ3 A;  4M94 A;  4DR7 J;  1ZM4 A;  4NEY A;  2J76 E;  5D0G A;  3L09 A;  3D6M B;  4YB6 A;  1P9Q C;  2B6A A;  2F9D A;  3TA0 A;  4DV6 F;  1KHV A;  2PO4 A;  1D8Z A;  3ISN C;  2RRB A;  3KDO A;  1QAX A;  3O2I A;  4QW9 A;  1UP1 A;  3CNQ P;  1S1W B;  2E7X A;  3U1N A;  5HLF A;  4NXM F;  2KJV A;  1UVI A;  4FN5 A;  2ATL A;  4WP9 A;  1WWH A;  1R8C A;  2WSE C;  5IFM A;  2BKN A;  2LU1 A;  1OO0 B;  4Z37 A;  4AYB D;  4FVC A;  3WQP A;  1Q53 A;  1RU2 A;  5JJB A;  3DLG B;  2I1R A;  2RDD A;  3T1H F;  4YY3 J;  4USK A;  1RAD B;  1TQL A;  1IBK J;  1TAU A;  3HFZ B;  1H0H B;  2DYA A;  2MKC A;  3I6P A;  4I1T A;  3TX8 A;  4DV6 J;  4NYO A;  1PC4 A;  4OZN A;  4AQY F;  1QTN B;  1S6U A;  4J9S A;  5F0W A;  2MLX A;  1H2V Z;  3FZB A;  3LW5 C;  3QT6 A;  1PIL A;  3OR1 A;  4A47 A;  3GIM A;  1UA1 A;  1DUR A;  3C6T B;  3FKB A;  2DRB A;  4IR9 A;  4Y2I A;  2C42 A;  4QYZ K;  2AD9 A;  2AZ1 A;  3UD5 A;  5C42 A;  5KOW A;  2NYI A;  2BXJ A;  2CNO B;  3ZTR A;  1HI8 A;  2NQP A;  4O3R A;  4CLL A;  4YN3 B;  1E6Y A;  3A13 A;  3AOC A;  5T41 A;  1ZH5 A;  1IBM F;  4EFA C;  3RYL A;  3K59 A;  2YNH B;  1Q8I A;  4W90 B;  1ZBT A;  3AH6 A;  4ZPV R;  1EZZ B;  2QFJ A;  1U1O A;  2RQC A;  2MQQ A;  3HKW A;  1HI0 P;  1X4B A;  3KJN B;  3HSZ A;  7AT1 B;  4QU7 A;  2HWH A;  1UJ5 A;  4IG0 B;  1JKH A;  2HNZ B;  4WBF A;  5KFS A;  1CBK A;  2IIH A;  2LFV A;  2MYF A;  4DUZ J;  4OX6 A;  1LV5 A;  2D1C A;  2WBM A;  4IG0 A;  1YRT A;  1M5H A;  2P6T A;  2POK A;  3NOC A;  4B3R F;  1SJQ A;  1RCO B;  1UEK A;  3TP2 A;  1HFE L;  4DR1 F;  3DRX A;  4LFA J;  2K7J A;  2DXF A;  4OV6 A;  1LOU A;  5F8L A;  3VGV A;  2WTF A;  3ILL A;  2VIC A;  2QSF A;  3UQS A;  4YB7 A;  3BQ0 A;  4P75 A;  1EB0 A;  1OYD A;  4IKA A;  3PFO A;  3I0S B;  4IH6 A;  4F0H A;  2OFH X;  3J80 U;  2E9Z A;  3H42 A;  2GIR A;  4CH0 S;  1KNZ A;  2WVB A;  5AE1 A;  3CD0 A;  3NAH A;  2OSR A;  3UN5 A;  1HYS B;  1ICE B;  1RT7 A;  2QZ8 A;  4RU2 A;  1HBM A;  2KO1 A;  2CJX B;  3IG1 B;  1YJW S;  2LA6 A;  4KV8 A;  2AYB A;  1VJW A;  4O23 A;  1Y5N B;  3JXO A;  2AJ0 A;  3LP2 A;  2C2D A;  2FJW A;  2R8G A;  5KFM A;  1VQS A;  2CG8 A;  1NJI T;  1EAR A;  3R5A A;  2AJF E;  3FCW A;  2V34 A;  4WFY A;  5T14 A;  3G6V A;  5HI7 A;  1VRQ C;  3WX8 A;  3FRZ A;  4Y2C A;  2KB2 A;  3O44 A;  4ZKA A;  4X65 J;  2KJW A;  2DR8 A;  3V4M A;  2B5J B;  4JB8 B;  4KSE B;  3HJV A;  2ZNY A;  4AD6 A;  4TXS A;  1MNE A;  1XMQ J;  1RWO B;  4IOA Q;  5KG0 A;  3H25 A;  3BYR A;  4NLY A;  1U1R A;  1K9M T;  3PX0 A;  1TL4 A;  1O8B A;  1YJ9 S;  2A2D A;  5FDL A;  4I56 A;  4RZR A;  2IM0 A;  2B7B B;  2MKY A;  3EM1 A;  3GYG A;  1D09 B;  1JLG B;  2Q43 A;  5LOQ A;  1HBN A;  1S4E A;  2EXU A;  3M6U A;  4K5R A;  4FS1 A;  3EZ5 A;  5CCM A;  3MCM A;  3V5R A;  4E8U A;  3VGU A;  1U2F A;  1W26 A;  2JC1 A;  2V50 A;  2PE8 A;  3IC1 A;  2WVE A;  2K1R A;  2RJZ A;  4OZ2 A;  4M5N A;  1U1N A;  3DKD A;  2ROG A;  1J5O A;  1NZ8 A;  2DNG A;  1G3O A;  1OIA A;  2IAJ B;  4OYM A;  5LXY A;  2ZNZ A;  4HVZ A;  2RRA A;  2OJ3 A;  1KTV A;  2I5J B;  2ZHO A;  2L9D A;  2OTJ S;  3MOJ B;  1BXN A;  4F7V A;  1OYE A;  4RBU A;  6AT1 B;  5K8N A;  1T03 A;  2NUU G;  3UWT A;  3MCO A;  4JI1 J;  2LYV A;  4ECZ A;  2VKZ G;  3K0J A;  4ILL A;  3M8P B;  2B9W A;  2IM1 A;  4X2B A;  1HQ2 A;  4USU A;  5CYJ A;  1T03 B;  1K73 T;  1NSA A;  4RW8 A;  1RAB B;  1JJC B;  2PC6 A;  2DNK A;  3T1Y F;  4OYX A;  3NNC A;  1TKT B;  1U26 A;  1UET A;  1N5S A;  2BKP A;  2FJD B;  1N88 A;  2DHG A;  3E01 B;  4X4N A;  3RW6 A;  3D1O A;  4Y2M A;  1SBR A;  4ED1 A;  2A6M A;  1B64 A;  3NS5 A;  1F9H A;  3CCM S;  3NWR A;  2V4Q A;  4KH0 B;  1PAE X;  2HS4 A;  3P8B B;  2W1B A;  1AUS L;  3KJV B;  5KG3 A;  3CGI A;  2JH3 A;  5KG2 A;  1RHU B;  2BRL A;  2YTC A;  2OI2 A;  3VQT A;  3FCV A;  1SH0 A;  1LWE A;  2KI2 A;  1S9E A;  2VB6 A;  5SZT A;  4B9S A;  2M52 A;  4DUT A;  4LF6 F;  4CI0 B;  4B3M F;  5EX0 A;  2HHT A;  2IRY A;  1NLK L;  4AFF A;  3CXC R;  3M32 A;  4HT7 A;  3VQS A;  3F56 A;  3BBC A;  3MMC B;  1GMW A;  2MTL A;  1S7I A;  3TAR A;  2UVV A;  4C8Z A;  2HLT A;  1NUE A;  2NS1 B;  3GFH A;  5L39 A;  1Q86 T;  4JI3 J;  2PFF B;  2CQ3 A;  2YNI B;  1BY9 A;  3CJ3 A;  2JNJ A;  1QUV A;  4LRB A;  3SSQ A;  4CLY A;  5DG9 A;  4YHH F;  2A6O A;  4QCL A;  2V8G A;  3C15 A;  2MQM A;  1WC6 A;  2M88 A;  3LF0 A;  5I3Q A;  4ECR A;  1QY7 A;  4Q0B A;  1S48 A;  1UWB A;  2W2M P;  3QID A;  4ICL B;  2KHD A;  4RO0 A;  5D4P A;  4ZPA A;  3Q2S C;  1VQK S;  3RR8 A;  1P27 B;  4WE1 A;  3OXF A;  2Z57 B;  4HDG A;  4DV1 J;  4QQB A;  2R2S A;  3GU0 A;  2V8D A;  2OEM A;  4HHH A;  3H4D A;  5HO4 A;  2EFQ A;  3G71 S;  4DV4 F;  4WJB A;  4JV1 A;  3H98 A;  3BN7 A;  4MKY A;  1JXL A;  2HMI A;  2YKM B;  3RRK A;  1RLC L;  1N8R T;  1UJ4 A;  2ASL A;  3C2P A;  3TQE A;  4NAS A;  4CCH A;  3T6J A;  3CC7 S;  2F63 A;  1XN9 A;  3DCA A;  3DRP B;  3H2V E;  1ULR A;  3D54 A;  3GB0 A;  2M3D A;  2ZZM A;  3Q83 A;  3IN5 A;  1YJV A;  4LVN P;  1HQU B;  3OJS A;  3CCQ S;  4ID8 A;  2ZDP A;  3I82 A;  4K59 A;  4F26 A;  4X4R A;  2OUG A;  3CJ8 A;  5D3G B;  1S6P B;  2EK6 A;  1OQ6 A;  4ZVO B;  3AB4 B;  3SDE B;  1QLN A;  3A12 A;  3OTO J;  3HHL D;  5HBM A;  4X4Q A;  4ZP6 A;  4R8U B;  4BC9 A;  2R2T A;  1KN6 A;  2WHO A;  4KYZ A;  3AAW B;  5THW A;  1JLQ B;  1S1U A;  2KT2 A;  3L9Z A;  3GFY A;  2IYG A;  1UFK A;  4PXC A;  5KFJ A;  1AUD A;  5IWA F;  1F6T A;  2Z0G A;  3AXM A;  3T5K A;  3RAQ A;  1BUX A;  3B78 A;  1LXN A;  5B0A A;  3HSJ A;  1NHV A;  2D3U A;  3W7B A;  4TQR A;  1WI8 A;  3JSM A;  5HRO A;  1X4D A;  2EC2 A;  4G6V B;  3R6L B;  2UXC J;  3BO4 A;  4DDF A;  2E5G A;  3BPS P;  5GMD A;  1TL7 A;  1TKX A;  3GFX A;  3M7V A;  4WFB Q;  5D8H B;  1S76 D;  1I3O B;  3OPK A;  3KLG A;  2H5J B;  5B08 A;  1V9O A;  4OYI A;  3OVA A;  1PCA A;  2FJA B;  3KLH A;  3KLG B;  1KVI A;  1T02 A;  2GIQ A;  2V94 A;  4WZM A;  4HI2 A;  1GTE A;  2GGP B;  1BQX A;  4OZL A;  2EG2 A;  3P5B P;  2DR6 A;  4QPX A;  3ETM A;  2HND A;  2WVD A;  3OT9 A;  1SJ4 P;  4K2X A;  1WC3 A;  2YKO A;  1EAY C;  2VBX A;  4DS5 A;  5L8R C;  4FXV A;  1R27 B;  3TEH B;  4KE5 A;  1TUW A;  1HNX F;  5ETP A;  3Q2T C;  2F8M A;  4C7Q A;  3OL6 A;  2J0Q D;  4M95 A;  1NH7 A;  5A8R B;  4UOH A;  5DG8 A;  1FJG F;  1EP4 A;  3KYL A;  4NPO A;  2VIH A;  1LW2 A;  2VG5 B;  3IBW A;  1M0S A;  4HDH A;  3KMS A;  4GC7 A;  2FC8 A;  3VVU A;  4DLG A;  1GAO A;  2KXH A;  3FMB A;  1ZAV A;  1IBL F;  3D28 A;  3TZZ A;  1VCT A;  3GIK A;  4Q45 A;  1JLC A;  2HHV A;  1SUQ A;  2BMB A;  4C48 A;  1WHW A;  3EVO A;  4K8R A;  1C1C A;  2GHP A;  3ILO A;  3P4U B;  3PRD A;  4O0I A;  1JLF A;  1PJ7 A;  3PAC A;  4RWW A;  3CIM A;  3ZZU A;  1C1C B;  5F9N A;  2R4F A;  2HVZ A;  2PII A;  3AB2 B;  1Q7L B;  5A76 A;  1WHV A;  2JEG A;  5J1E B;  2M7S A;  2DHS A;  3LH2 S;  5CD4 H;  2R7U A;  4J7C A;  3TAM A;  4A8K A;  1WD6 A;  3G82 A;  2D3O R;  5J2P B;  2YX1 A;  1KP6 A;  3D7S B;  4LSN B;  1S4F A;  4F36 A;  2AQ4 A;  2B4P A;  4IRK A;  3R7S B;  5L46 A;  3M8Y A;  3RBD A;  3GLJ A;  4CTA B;  3MUM P;  2XY7 A;  3DHW C;  4IG3 A;  4NLD A;  5H9E K;  1VQ6 S;  4RW7 A;  3R5G A;  1FA0 A;  5CYQ A;  1URR A;  4CTA A;  3RR7 A;  2N4D A;  2E29 A;  1KD1 T;  2K3K A;  4L73 A;  4LBI A;  5A0Y A;  3NMR A;  2WAQ D;  3UDE A;  3CT9 A;  2OPR B;  1YBA A;  2OPS B;  1R89 A;  2BJ9 A;  2V4J A;  4FVM A;  5I42 B;  1VDH A;  2A18 A;  4TU8 A;  1DRZ A;  4FYW B;  4CQ1 A;  4NLG A;  3SV4 A;  3U02 A;  3M8S A;  2CKW A;  3HSG A;  3IA0 A;  1Q8K A;  2UVU A;  2C2N A;  5F8H A;  1CLF A;  1SCJ B;  3KJQ B;  1CJT A;  5F8G A;  4ED7 A;  4KKO B;  2R7V A;  1NEE A;  3VZH A;  4O4G B;  4IO9 Q;  1TV6 A;  2VPX B;  1L3S A;  4RPF A;  4MKV A;  1H38 A;  2HVE A;  5HVH A;  5KG4 A;  3HPO A;  3OXL A;  4F3M A;  5DZ7 A;  3CE8 A;  4EBC A;  1EP4 B;  5A8K A;  4I2P B;  4A8W A;  4QWB A;  3T5L A;  4X4O A;  1F1B B;  4B9V A;  5C25 A;  2V2Z A;  2ZH3 A;  3I4P A;  4ZHR A;  1VQ4 S;  3GR1 A;  2MPU A;  3CWJ A;  1HKA A;  4PPZ A;  4PAA A;  4CLS A;  4ZN1 A;  2M70 A;  2E7W A;  2CQ1 A;  2BRK A;  2Y1R I;  2Z2M A;  2Q66 A;  2DTJ A;  1CUL B;  3D6T B;  2IA6 A;  4KFB A;  1MWQ A;  1SUQ B;  3B6B A;  3ITH B;  3H4B A;  5E7O B;  3TAQ A;  3TWZ A;  1F3V A;  2X1B A;  2B5J A;  3OFF A;  1JLF B;  4OQJ A;  1WF0 A;  1XNQ J;  3K8W A;  1RHK B;  4I0W A;  5LXR A;  3KLE B;  4C8N A;  4LF8 F;  5D0R A;  2UUC F;  1FKP A;  1FI4 A;  1PSD A;  1YVF A;  3ZO7 A;  3OUY B;  1CS4 A;  3ZZY A;  5KFH A;  2C22 A;  3V81 A;  1Y9O A;  1TL5 A;  3AJ1 A;  5IV4 A;  2DHH A;  4EGL A;  1IBK F;  2GJ2 A;  3N6N A;  5JMN A;  2MQP A;  1P1L A;  4JV2 A;  3SSR A;  1NO8 A;  1VHF A;  2QA2 A;  3K89 A;  1KVK A;  1R6V A;  4UUW A;  5AXM A;  2FVP A;  1Q5Y A;  2IM2 A;  1FO1 A;  3MD3 A;  5E3C A;  2KHC A;  4BS2 A;  4GKK J;  4LRF A;  2JFD A;  5CXT A;  3MMA A;  4I7F A;  3TJ9 A;  1JXV A;  3OTE A;  4OYP A;  2CJB A;  2JLF A;  2VPY B;  3BM7 A;  4A8F A;  2C2K B;  2FZG B;  1WC5 A;  1X4H A;  3OV7 A;  2KRB A;  4Y65 A;  3BBF A;  1S1T B;  2B6A B;  2CWK A;  1VLY A;  3W2W B;  2HKE A;  4NL5 A;  2DVI A;  1UZH A;  1WKJ A;  4G1P A;  3EGZ A;  1XER A;  4JI4 J;  1MG7 A;  2LA4 A;  1SPB P;  2GCF A;  2M9K A;  3GQC A;  3CME S;  4XDC A;  2GVD A;  4KGV B;  4ENO A;  2QL9 B;  1QE1 A;  3V4I B;  1Q8L A;  3DOK B;  3RAM A;  2J9D A;  1IWA A;  1DTQ B;  2OPP A;  4YHH J;  3RTV A;  4IUF A;  3PIO Q;  3V4I A;  3PW4 A;  3K7R A;  4WK1 A;  1U45 A;  5GME A;  3PW2 A;  5IC6 B;  3TYT A;  2BJE A;  1SJR A;  2YWF A;  3MEE B;  3ICL A;  3H5S A;  5MLC V;  1OQ3 A;  1JIH A;  2HGN A;  2CPJ A;  2N7Y A;  3M8Q B;  4DXL A;  1X0P A;  3UFC X;  3CCJ S;  3J7Z 5;  1KC8 T;  1CG2 A;  1SC6 A;  2PI5 A;  4B9N A;  2HVI A;  3Q8Y A;  4CLW A;  3WC0 A;  5LMU F;  4CO1 A;  2BX6 A;  4ICL A;  3R7N B;  1ZET A;  3DMJ B;  3MMC A;  2CQC A;  1TFW A;  1N6Q B;  1NHU A;  4TU9 A;  3VHQ A;  3A3O B;  4K50 A;  4ALZ A;  2ZH2 A;  3C6U A;  2R7X A;  1N6Q A;  2VFR A;  2MEW A;  1D0E A;  3G6E S;  4O44 A;  5FDL B;  3HD1 A;  1ZZN A;  5KFZ A;  4XPC A;  1VC0 A;  4B9T A;  2DRD A;  2O67 A;  3GCX P;  1JX4 A;  1ZM2 A;  4K4V A;  2UUB F;  3HI9 A;  5KFF A;  4M5G A;  4I4B A;  1SJF A;  3BGR B;  2SXL A;  4N41 A;  2P9G A;  1IUJ A;  2ZHB A;  1TK0 A;  1ZOT A;  4CRJ A;  4N7T A;  2BE9 B;  2KRR A;  3I5A A;  3W9H A;  2L41 A;  1XMQ F;  5L1J A;  1Q7Y T;  4KR0 B;  4O3Q A;  2V69 A;  1NKE A;  2FVC A;  2VDH A;  1JXE A;  2V5H G;  1M1G A;  3MUV P;  3M8P A;  4URS A;  3FK4 A;  2XY6 A;  1BGX T;  5EHH A;  5I3U A;  3RU0 A;  1WOR A;  3BB5 A;  4ZLJ A;  2VG6 A;  2DNN A;  3QMQ A;  3CJT A;  3D67 A;  3G8Q A;  4RNH A;  1ARO P;  3WDO A;  2V67 A;  5C7P A;  3HXM A;  1YIT S;  3H5X A;  4DN9 A;  3R8Y A;  3AOB A;  1REG X;  2CPX A;  3TA2 A;  3ZNU A;  1VRU A;  3H8Y A;  2E5J A;  3LTO A;  2LXF A;  2Z4P A;  3CD7 A;  4WP8 A;  1OSC A;  3N6L A;  5AXK A;  2KH9 A;  3KTQ A;  4Q2L A;  1R0B G;  4QW8 A;  3R5B A;  2KU7 A;  4YME A;  3MFI A;  3K58 A;  4TLQ A;  1KQF B;  3PX6 A;  1EET B;  3MEE A;  1FTC A;  2DH9 A;  2I38 A;  2UXB F;  3I5C A;  2VA3 A;  1YKW A;  3ILI A;  4N8N A;  5B0E A;  4W4M A;  3QO9 A;  4I2Q A;  3GZ7 A;  1X5T A;  2NYH A;  4MKB A;  3TI0 A;  1DTT A;  2E1C A;  2AF6 A;  1SKS A;  4Q0B B;  4NLT A;  4TVA B;  2C3U A;  2OPQ A;  1BQN B;  2D3Z A;  3T1Y J;  5LM7 E;  1I51 B;  3NBP A;  4YFU A;  1BWE A;  4JV0 A;  1D3W A;  1OPI A;  4TKT A;  3PY8 A;  4X4V A;  2M4M A;  2H48 B;  3OLB A;  3EE3 A;  1HHT P;  1HNV A;  2AYG A;  3ADA C;  3DGP A;  1FX2 A;  1H2T Z;  1SQG A;  2W9C B;  4AL6 A;  4PXB A;  4JI0 F;  5L1K A;  5E3R A;  4NLS A;  1XIQ A;  4EO8 A;  4C11 A;  4J9L A;  2A1B A;  5K9F A;  3BGR A;  3WX4 A;  3JTO A;  2DHA A;  3QIP A;  1C0T B;  2IDE A;  3OVS A;  1J5O B;  2FGO A;  1TTH B;  4IRC A;  3UN2 A;  3DOL B;  3BR8 A;  2K3I A;  3H40 A;  3VVT A;  1FNO A;  2IAJ A;  5K8M A;  1WC0 A;  1J27 A;  8AT1 B;  2AGQ A;  2HQI A;  2J7W A;  1JLC B;  1VGY A;  3PIP Q;  4JI3 F;  2YKN B;  2V2K A;  1A6L A;  1FXR A;  5AXN A;  3UCU P;  2XYP B;  1RXO B;  3MM6 A;  5DGA A;  4UY8 5;  4Q2M A;  3ISN D;  4MK9 A;  2BJD A;  4OIX A;  5KFR A;  2F9J A;  3FSY A;  3HVA A;  5KOX A;  4C8L A;  1YG0 A;  1F5C A;  1T9W A;  3DDN A;  3OR1 B;  3PG9 A;  4JI6 J;  1DQ8 A;  1MN7 A;  3CD6 S;  3CIZ A;  3MED B;  1GMV A;  1RDR A;  2XSJ B;  3L4B C;  3HZE A;  3N28 A;  3WIU A;  5B0C A;  4AL7 A;  2YPY A;  3KKF A;  1KFD A;  3JAM Y;  1L5U A;  4LQ3 A;  4OX7 A;  4JV5 J;  1IQZ A;  5HBM B;  3UR0 A;  3KUE A;  1U48 A;  3GYN A;  2HK2 A;  4AUK A;  3CCR S;  1C0U B;  1DJ0 A;  1RT1 A;  3DLB A;  1RP5 A;  4XAK A;  3ZZT A;  3LAN A;  3IBC B;  4RBV A;  4CYU A;  1VJQ A;  2WON B;  1N5V A;  3TAM B;  5A0Y B;  1LWE B;  2CWX A;  2GC8 A;  1RAG B;  4DZ6 A;  9RUB A;  4ED3 A;  4CLP A;  3T5J A;  3PRV A;  4ZDN A;  4UT4 A;  3QZ8 A;  2V4J B;  2VJV A;  4FXD A;  1T95 A;  2VG7 A;  1DHM A;  4QJV A;  1RTH B;  4Y28 C;  2FB0 A;  5HL7 Q;  3PYG A;  1Y3K A;  3SCI E;  3LUY A;  4MH8 A;  1MMN A;  2J7U A;  2RD5 C;  4JI6 F;  4B9M A;  3PVX A;  4M5D A;  1W2B R;  1JNR B;  1HQE B;  2D69 A;  4JBC A;  4NZ6 A;  3FBE A;  3P5T L;  2MMY A;  2KXF A;  4DJB A;  3DGP B;  5LSL A;  2W9C A;  3FVY A;  3JQJ A;  3NY0 A;  2A2C A;  1IR0 A;  2JDJ A;  2OPS A;  1MLA A;  4OHZ A;  1JQG A;  3W5Y A;  4F2S A;  2UVR A;  4WU2 A;  1NB7 A;  3O1L A;  3PJX A;  4R5P A;  2ZJR Q;  5DG7 A;  3I32 A;  4NCG A;  1CJT B;  1X5S A;  2HFZ A;  1C0T A;  2PFD A;  1PYO B;  3UDV A;  2CQI A;  3PTW A;  3FC9 A;  1G6B A;  2OO4 A;  3RG6 A;  2R8H A;  4OHV A;  1G1X A;  3WIV A; 
#chains in the Genus database with same CATH homology
 2JNJ A;  3DGP B;  3DOM B;  1YDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...