3DGPB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
total genus 19
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3dgpB00
1YDLA 3DGPB 2JNJA 3DOMB
chains in the Genus database with same CATH superfamily
1C1BA 4X84A 4KIAA 2KTQA 3RRKA 4FYXB 5HI7A 5J2QB 4DQRA 2Y1IA 1PG5B 1YRUA 1R43A 3NGRA 2L08A 3PW2A 5HMYA 2LMIA 1B0VA 4RW9B 4CDIA 4EYIB 3P5BP 2FJAB 4P7TA 2GQ2A 2V69A 3MXHP 1SKUB 5CYMB 4C97A 1VQ8S 4KSEB 3FBEA 4N8NA 2K1RB 1N0VC 2BX6A 1N5VA 3FFIA 3GR1A 1VLYA 4L73A 3ZZRA 1SL0A 1CC7A 2MKSA 4QZVB 3MFHA 5H9EK 2RVJA 4F8RA 2M7SA 4M8LA 2CZ4A 2MKHA 5JJBA 1OY8A 1RT7B 2CA9A 3CD5A 4Y2KA 3R5JB 5D0HA 3RRGA 1E6YB 5A8RA 1D1UA 2WVBA 4HLBA 4K0KJ 2C2ZB 4XK8C 1HQ2A 2RMLA 2B4VA 1Q5YA 4AD6A 1SKWA 4RUCA 2V4RA 3GPAA 2FVRA 4ICLB 3TUZC 2W9BA 1HNIB 1Z2LA 2YXLA 2V8DA 3DHWC 4P2SA 4URSA 3ENWA 4C8NA 4DR5J 3ZFVA 1S59A 4PEOA 2JC0A 3DYAA 4JOUA 1PCAA 1X4AA 2HWHA 3FSYA 5E3QA 1SQGA 2LQ5A 4DUYF 5HP1A 4K0KF 5IC6B 4D3GA 5HQMA 1TUGB 1W7WA 2ALYB 3DRSB 3J7ZT 1S6UA 3PO5A 1RT3A 3NKYA 4RL1A 4DQQA 1VBKA 3GU0A 1O51A 1AUSL 4GO5X 5B0GA 1KC8T 3QJJA 3BO4A 2FTRA 2BMBA 4ZK7M 2F65A 3Q8SB 2W2MP 4FKXA 1M0SA 5LSOA 2PFDA 3VAHA 2VOOA 2ROPA 4EU0A 4CLSA 3R5DA 1FE4A 3DLEB 3LPYA 4OIXA 4AQYJ 4HR2A 3OUYA 3CUNA 5KFHA 1RDRA 2NR0A 2ZE2B 3NOCA 4J9QA 4M5IA 1N32J 1SBRA 3DCAA 3AQOA 4OZ2A 4RZRA 4WU2A 2Q6BA 1PAUB 1RAOA 1C4AA 2VU5A 1MMNA 5IT4A 3K5NA 2HRYA 2Z56B 4QOTA 4KKOB 3NAHA 3KYLA 1FHTA 2V2KA 3M2UA 1ZTWA 2DRAA 3SXLA 2EWHA 4IDKB 4XPCA 4DSEA 4ZIVA 5CABA 3OTOF 2QFJA 2RDIA 1N34J 2QJ3A 2XGQA 2OIHA 1FXLA 3G9CA 1LWFA 3BBCA 4TN2A 5IOLA 5KFMA 1V3RA 2HS4A 4ZPCA 2NPFA 6AT1B 2AGOA 4ID8A 2X3DA 4XPEA 1TL5A 4A47A 1MU2B 3BPSP 4DL0C 2HBQB 1S6QA 4F3MA 2K2PA 2BQ3A 4OHYA 4B3MJ 2FYXA 2V63A 3LP0B 2LDIA 3MR3A 3KK3B 4K4XA 2DH7A 2FZCB 3AOAA 3FRZA 3V4MA 3BO2A 2KDOA 2UUBJ 3W64A 2E5LJ 2G2YA 1U4BA 3KLVA 3SCIE 4NX9A 1KLMA 2ZITA 1U1MA 2WK4A 1XMOJ 1NH7A 1FF2A 2EKNA 2HYIB 3OVBA 5A8KA 2RHSB 3PHTA 3QFWA 4NRTA 4DUZF 4P73A 3IXQA 2VBZA 3M8ZA 3V6DA 4ED1A 4MIAA 4M5MA 4OJGA 7FDRA 3CMQA 5J2PB 1G1XA 5GAGU 4FPRA 4HTJA 1I94J 4QIVA 1R3NA 2B9XA 2CKWA 3H2VE 1NSQA 3HT3A 3R2CJ 1SI9A 1X4GA 5M2UA 5HSPA 5DO2A 2A1BA 2VQFF 5EX0A 2EBGA 5GAEU 1U0HA 4OI0A 4GO7X 3EX7B 3QRQA 4JYAF 1TL3B 3UI3A 3HP6A 2GMHA 2ZHBA 4ZLPA 4HACA 3CCMS 1JWWA 5JVHQ 1AA1B 5T7LB 4PR6A 2XMAA 3OL6A 2I8EA 2YKNB 1WOOA 4LF8J 1RT2B 4OMFG 2WSEC 6FDRA 2XY7A 2UVUA 1RT7A 3E2EA 3TUPA 2A18A 3M6WA 3LWMA 4B3SF 4CT8A 1NPPA 4EMDA 3CCJS 2AJ4A 3M30A 3SCJE 2E7WA 2ZNZA 5IM0A 1NZAA 1GT8A 2J8SA 3D6FB 2QO3A 3DKDA 1YVFA 4KO0A 5CH7B 3OVAA 4ERDA 2HSEB 1WSRA 2DY9A 2RS8A 2XMMA 2E1PA 3KXDA 2DHHA 2NS1B 5KFSA 1HLWA 4O4RA 2CUYA 2V50A 2MLYA 2DITA 2ZWPA 3UO0A 1YG0A 3I0RB 3THTA 1T3NA 1S48A 1IWAA 3CXCR 3IP0A 1WKJA 1Y4ZB 3FBFA 3FGVA 3L7PA 4MJKA 3NMRA 4ZS6A 5KFPA 1N48A 1MROA 4DUTA 2CJKA 1ZA1B 4CLZA 1ZOTA 1N36F 2OEMA 2LQ9A 4OYWA 4FDFA 2K06A 3CCTA 4AXJA 3RUBL 3PXGa 1VQPS 1NH8A 4K4UA 5LXRA 3CJ0A 2HQIA 3KUGA 1P8GA 5MAOA 5A2QY 2AU0A 2N3OA 2EVZA 3WIUA 2V4QA 1B0PA 3H2UB 4F50A 2G9OA 3QJLA 4GKKJ 1R7IA 4ZP9A 1U6BA 1VFJA 2HVDA 5D3GA 3M2VA 2HNZB 1IBLF 1S77D 3IRXB 1JLCA 1D8YA 2QG9B 5AXMA 1WI6A 2ZD1A 2B4OA 2DGXA 2WVFA 3JTPA 4KFBA 4F4YA 2CZVC 3LANA 3Q83A 1G2EA 3D9BA 1RWWB 3GQCA 3C14B 1M90T 2KO1A 4FVMA 4FBUA 4U7CA 3CTRA 3EZOA 2DNMA 2KXHA 4ECXA 4LIWA 2Q66A 2XMWA 4EO8A 1IBMJ 3UN2A 1S6OA 3K5OA 4QCLA 2J7UA 3QZ8A 5A8RB 3IGNA 2HHHF 4DV6F 2IBKA 2K8GA 4F2SA 4F67A 1HD0A 3DOMB 3X1LB 1VR6A 3T1YF 1H3DA 1WEZA 3DLJA 2CYYA 4WPAA 2O67A 1NK0A 2AYMA 5L39A 4CT9A 1EB0A 4PYDA 4WKYA 5K8MA 3PEJA 4JI8J 1WWHA 1YK9A 4QIWD 3QSYB 2HGLA 1I6JA 5E33A 3ISZA 4O4GA 2IMWP 4R5PB 2GIQA 5D0GA 3KHHA 1KD1T 2JSXA 1D9AA 4G1QA 3FMBA 4DV6J 3MM9A 2GVZA 2VBXA 1ZM4A 3ET6A 2EI5A 1FKAF 5F8IA 1H73A 2FVSA 1Q81T 5JXSA 1CJKB 2Z30B 5T14A 4Q0BB 4ZPAA 2AJ0A 5HQ8A 3H5YA 5F9NA 2RIJA 4PABA 3GJRB 3MM5B 3R5CA 4UOCA 2OGUA 4WP8A 3TVYA 1VS3A 1Q8LA 1HL6A 4ED0A 1UA1A 1R27B 4V19X 4K5SA 2J8AA 5AJ3J 3FSXA 4JI5J 2IY5B 1V5VA 3B82A 1C2PA 2FJDB 1LWXA 3VV2B 3MM7A 1E6VA 3G96A 1T11A 3RR8A 1U7LA 2PA3A 3ZZPA 1JNRB 1OWXA 2HIYA 2ZE2A 2HZCA 4DOZA 3KLGB 2K7JA 4KH0B 3MEDB 4GC6A 4I6YA 4KY3A 4DPWA 3K17A 4MMOA 4ECZA 5GMEA 1V5IB 3OL9A 2XI2A 1UZDA 2WCXA 3P5TL 3OQ2A 4OYXA 3UN3A 4AFFA 3PX0A 4GVBA 4YR2A 4ECRA 1HBMB 1WEXA 3AHPA 2GO9A 2YKNA 4DMZA 2EXUA 3GSDA 3HDSA 2YNFA 5DRKA 4F4AA 2GJ2A 2CPJA 4O44B 3TZZA 2MKIA 4C8ZA 3QO9A 1IKXB 2QMUB 4DSKA 5I3QA 3BQ0A 5GVQA 1JMTA 1M5SA 2YQ3A 5H9EJ 3BGUA 1HWLA 3HHDA 3KUEA 2R2SA 2HFVA 3I4PA 3EYZA 2LQBA 1UJ6A 2Z58B 1LEOA 4CO5A 2B7CB 1FRJA 2XZDB 1WC1A 2W7AA 2XG8A 2ILZA 4K4VA 2R7QA 3B78A 1HWKA 3LGNA 2DPIA 1NDLA 5I3PA 3B54A 5B09A 2UXCF 2IM2A 2GVDB 4O0NA 4OZ5A 1L3VA 5CQGA 2RF2A 1TMMA 2W25A 5D4PA 4KGZB 2MQLA 4IG0A 4Q8FA 2JFKA 3K2YA 1VQNS 2Y3YA 4ZLLA 4LF2A 5J2NA 4I7FB 2QA4G 1L3SA 1HIYA 2DGQA 3HD1A 4CM2A 1N5YA 5HBMB 1UVJA 3SSRA 4DR1F 3CGIA 3MTJA 2M3DA 2VQEJ 1CPZA 2HHTA 4IR9A 5J2MB 3SZ2A 2W7OA 2PA8D 4FYYB 4LJMA 3THPA 3GYNA 1XEZA 3BYPA 1RAEB 5B08A 3KJFB 1ULRA 3Q86A 4NLQA 2HHXA 4DV2J 5FDLA 2P2CB 4QR0A 1N36J 1S1XA 1KBRA 3NLCA 2BDPA 3BBBA 2UV8A 1HNIA 4ECVA 1XWLA 2M9KA 2ZFHA 4JI5F 2VODA 1JLAA 2E7VA 4DLEA 2IRUA 3HI9A 2DXEA 2J7KA 3MAAB 4ZVHA 4I0WA 1F60B 4GKJJ 4YB5A 2BANA 2LDYA 2MGZA 3K8VA 2OI2A 3GZ7A 3O5TB 4WWSA 4F0HA 4BBYA 4LFCJ 2VFVA 2JZ5A 4P72A 1NM2A 1YI2S 4B9VA 2HPUA 2XTJP 2CPFA 2Z57B 4K5RA 5IV3A 3L09A 4TU9A 4WP9A 5C42A 1VIOA 3BSOA 4J9PA 4LF7F 4OLPA 3K5PA 4K50A 3CDWA 3EGNA 1FTRA 3JQKA 4YUDA 1DTTA 1IKYB 2KJVA 4MT1A 1JXEA 2DHAA 2GMJA 3PM9A 3E51A 4X65F 4TQRA 3Q0AA 1Y5NB 4FS2A 1HHSA 2CZ9A 5I3UA 4GKJF 1KKHA 3OXGA 2D69A 4OZ0A 2HZAA 1VQOS 1NUEA 1TFYA 3KHLA 2UU9F 2R7SA 1JNZB 2AEFA 2JVRA 2DT9A 2HBZB 2HK2A 2ZUGA 3NNAA 4CH1A 5E2QA 2BE2A 5F8GA 4QU6A 3SSQA 1HPZB 3MTKA 4LQ9A 2OAUA 1RA7A 2DGWA 2ZOMA 2QYGA 2BJ3A 1HHTP 4MIWA 1IUJA 5DLGA 1A0OB 3IRXA 3CJ4A 3GG0A 5AE1A 3C6TA 4IYQA 3TWZA 2IRYA 4CO0A 2XWYA 4B3SJ 2VDHA 1X9WA 4AQYF 1EARA 2L9DA 3HVTB 4X64F 2Y1JA 4MKBA 4P7VA 3MR7A 2VB6A 4WK1A 1H74A 2WB4A 1FD2A 5I4MA 5F9LA 1CVJA 1SV5A 2KM8C 2DIUA 1TZ0A 4I2QA 2N3LA 3PW4A 3PYEA 1HBMA 4IQMA 2VG5A 4DPUA 2E29A 1S79A 1RACB 1IKWB 3DMJB 4H4MA 4DN0A 4EZ6A 1RHJB 1UP1A 2HS0A 2JJ4D 2ZNYA 2VFUA 4B3OB 5CYQB 7AT1B 5EDWA 4HHUA 1H7WA 1WI8A 4ZP7A 1FNXH 2JEGA 3CC7S 1WORA 2LQ8A 5J1PA 3BN4A 3MR5A 4F7VA 3T9NA 4DWIA 4TXSA 3BF4A 1Y9OA 2UXDJ 1V6HA 4WBFA 4YR3A 4WXWA 2N4DA 3UD4P 1VQYA 4LRFA 1BWVA 3MEGA 4Q2MA 5KFDA 1SL1A 2MQMA 4Z7CA 4ZPTR 1FNMA 4J90A 3GWCA 2DO0A 5ETNA 2W2QP 3OTOJ 2AF6A 2CPYA 2IVFB 1D9FA 3TW0A 4ZMMA 4R5PA 2LEBA 4IUFA 3QT7A 1GTHA 2CPIA 2BKNA 3FEYB 2GVZB 1ACMB 1UWAA 4NI2B 1YIJS 2E5LF 2L41A 1YWXA 2GO8A 2OLWA 3I4HX 4J9VA 2YX7A 4TY8B 1S5ZA 2YBVA 3UN5A 2FHKA 3ZZTA 4NCGB 2B4UA 1TAUA 2HQDA 3GJQB 4ELVA 5KFZA 2BV3A 4B3MF 4C2MA 4RW6A 2FHMA 4PPDA 1KP6A 3SDEA 5KFOA 2PEHA 4DZDA 3KHGA 3GILA 1XTZA 1K47A 1WC5A 1IBCB 1RHKB 2FDNA 3IBWA 3NGKA 2B9EA 2ZVSA 1M1KT 2R7OA 3RU0A 3FMWA 2ZJQQ 1WHVA 3I6PA 4DJBA 4ZLJA 2R2UA 4O3RA 2KVIA 3QSIA 1C1CA 4OZLA 2ZDOA 4LSNA 2ABYA 5ETKA 1FDBA 1FXRA 3L3CA 2YNHA 4ECUA 1VRUB 5EX3A 4ZITA 1JK9B 5C25B 2ATLA 1F9EB 2OJ3A 3FBCA 3BH6B 3DI6B 1NNDA 3V6HA 1KQFB 4TLQA 2YH0A 1JLAB 2V0NA 3NS7B 3BPDA 3AJ1A 4OYMA 4I2PB 2YNFB 4JI0F 4X62J 4DR3J 3RB4A 3JTOA 3S8SA 3DN9A 2BM1A 3W8GA 1NJIT 1P27B 1GXLA 3MPDA 1NAQA 3VQSA 2EFGA 1YBTA 1X4BA 4J9KA 1GX6A 1KLNA 5THWA 2A6OA 4RW4A 1DTQA 3LW5C 5K20B 4UUXA 4EWTA 1D3WA 1WC4A 4A8QA 1N0UA 3K89A 2E66A 3DLKB 2W9CB 1Q7YT 3MUTP 1SJ3P 3U27A 4CYUA 1RQ0A 2DRDA 2NYHA 2CAJA 4UF4A 1XK8A 2H1YA 2E44A 5DZ7A 4CH0S 5K14B 3BQ2A 3AA9A 2FPHX 4MTPA 3QGIA 1NKCA 3VGUA 3IBCB 1VBYA 4X66F 2PO4A 2O3DA 3MUVP 9RUBA 4CLFA 1NJZA 2WZ1A 3TO8A 4KFBB 4M1KA 3PX4A 1T9YA 2QZ8A 4WFNQ 5E5NA 3R27A 3VGTA 2HBRB 5KFWA 1NHVA 4X4OA 4QJVA 3HHLD 3I9ZA 5LXYA 4DR6F 4DL6A 3PCOB 1GX5A 4NA2A 2CQ3A 3VQTA 1R8HA 3SQGB 3BGRB 3T9ZA 2FY1A 1FWKA 1OY6A 1VCTA 3HVWA 2ADBA 4IRCA 3GE9A 3HD2A 3MPYA 1JLQA 1N5TA 1K44A 4R8UA 1RAFB 4U95A 1H2UX 4DSFA 2BR0A 4OX9F 2ZOGA 1PYTA 3LO3A 1OY9A 3Q22A 4DV1J 2F1FA 4PWWA 3G6YA 1TV6A 1H7XA 2YNGA 2WTFA 5GADU 3CB4A 3G8SA 4IRDA 4I2QB 3OSPA 2C2NA 4CH7A 1V3ZA 4DV1F 4OX9J 3DRYA 4YEAA 5LSRA 3MCNA 2ZH1A 4ZA1A 3FKBA 4NLVA 5B0CA 1T05A 4E0DA 4J5OA 3AJ2A 3ZZ0A 3DOLB 1RBLA 2RB7A 3PKMA 1RWXB 5DZ6A 4GMKA 1VISA 3PW5A 1TKDA 3KHRA 4LF6J 1UFLA 2H54B 2HURA 4O3SA 1FJGF 4GRSA 2LA4A 2RD5C 4NPOA 2GIFA 4J9RA 2B8QA 3PTWA 2F7VA 2UUAF 1O6XA 2EK1A 2B0GA 2V34A 2W4DA 4I6AA 2Y1RI 1X0FA 2FC9A 4NLWA 2DGOA 2AGQA 2DNQA 1PC4A 2DR9A 2EFOA 1AFJA 1ZETA 2MQPA 1WF0A 2LLZA 3F56A 5MLCV 3MMAA 1KFDA 2GQCA 1L3TA 2ROGA 1S6PA 4OYAA 1HMVB 2CJBA 2IIHA 2VIHA 4YY3J 3W3SA 3H8YA 1AT1B 5J1EB 2XQCA 1KOOA 3IA0A 1QUPA 5HVFA 5I3UB 4NYZA 1J5OB 3MZIA 5CZXA 4EK2A 2D3ZA 2OPPA 3KLFB 4NMLA 4OYOA 1BQMA 3EDQB 1X4FA 3MGJA 4JI6F 1TL7B 4YN3B 3IGVA 2AHOB 1UEUA 2ZUAA 3DM2B 3DOKB 1VK8A 2CQ0A 3CJSA 3JTNA 3SDEB 4ZCMA 4TQSA 1U45A 2A2CA 5IZHA 2KHCA 3SV4A 1GFWB 2ASLA 4NLPA 4PG7A 4M95A 1UFKA 1Y11A 5CYMA 4J9LA 5KG2A 1IR1A 2RKIB 2BJ8A 1HI0P 2P9CA 2HAIA 1BMQB 1FDNA 4C8KA 2I5JA 1NDCA 2DEIA 3I87A 2CG4A 5C25A 1KVIA 3LUYA 1HNZJ 1RTIB 2QFIA 2RILA 3C6UB 2QLBB 2C42A 3DI6A 3TJAA 3CCSS 4FN5A 5KG0A 1RKJA 2FGCA 4NCBA 1F3FA 3CSKA 3UDEA 1JKHB 2D3O1 2ZKTA 3IAM9 3DMJA 3PHEA 4ENOA 3OFEA 1R8AA 1KSPA 3L7UA 3MM8A 4QR1A 1EP4A 2NXEA 4OI3A 1ZZNA 4B3OA 2O66A 2MB0B 1F0XA 4DBQA 3MURP 1JJCB 3Q24A 4J9SA 1D9DA 5CYJA 2UUBF 4ZPVR 3DLGB 4EZ9A 1QUVA 1S9GA 2V5HG 3A3OB 1B64A 4I7FA 2HRUA 3W62A 2IBOA 3J80Y 4DCJB 4KPCA 2KG1A 3M8SA 4DQSA 3PW7A 1HYSA 4BWMA 5AXKA 2I0XA 2LECA 5E3AA 1CC8A 2IJFA 3D6TB 3PRVA 4PG5A 2D3OR 2JOQA 3M8PB 2LKZA 3MMJA 5EWGA 1Q16B 3BDEA 3J80U 1F9HA 2CWKA 2IPOB 4DV3J 4P6QA 3BYRA 4FF4A 2GHWA 3CD0A 2BZ2A 3HSZA 4L3KA 2XLJA 3GIRA 5G0RB 4LR9A 2Y0BB 1RCOB 4X4QA 1T8EA 2J9DA 4FYWB 1PJ5A 5KG6A 4OV1A 5IT0A 2VFTA 5HANA 2MLXA 2XS5A 3E8OA 3C15B 1LWCA 1SH3A 4RW8B 2MZ1A 4B9UA 4B02A 1VQKS 3NXZA 1R6VA 1RWKB 4U9RA 2HVEA 2MGZB 1N32F 2C2RA 5JUMA 1U0SA 4USTA 1REGX 2MQOA 1RUSA 5HROB 1FJ7A 2C2MB 1BXNA 3CF5Q 1WSVA 4DSIA 1FKPB 2RQKA 1R0AA 1HBUB 2KYZA 3LA0A 5KFTA 3ZZYA 2C3YA 2WRMA 5C42B 5L1JA 2W8KA 4J9OA 3TEHB 4LSLA 2XZWA 3FNNA 1EAYC 2WOMA 2JC1A 3R9LA 3T3FA 4CTAA 2AYEA 2HHPA 1URRA 2V2QA 3GONA 5K8PA 4NLXA 3QPIA 5KFVA 3M8WA 4NEYA 2HWTA 5IWAJ 2APOA 3OD2A 3OT9A 3AODA 3BREA 2QSFA 4DR7F 4P2XA 3PX6A 2V8GA 3F73A 1T3OA 2FGOA 1WD6A 3CNQP 3V2UC 5IWAF 4CP5A 3MEEB 1N4LA 3R1LA 4EEYA 1MN9A 1WACA 2CQ2A 2GHPA 2KJWA 1URNA 3ILIA 3CCQS 2JLGA 3TZXA 3VGVA 3QZ7A 3HHKA 4DR4F 5KT6A 3J7AN 2FZKB 3D2WA 2FJEB 5A0YB 1JJ4A 3I0SA 2HEKA 3DLEA 2FJVA 2JEIA 3GCXP 1QSSA 4ETXA 4NXMF 3QT8A 4LMZA 1A7GE 1TKZB 2NUHA 2J0QD 3G71S 3G2XA 3J81U 3CIMA 1UFWA 3IRWP 3FCWA 4YR0A 1ZBTA 3HFKA 4ANEA 3AY0A 1TMJA 4OL8A 1Z1ZA 4OI2A 1F9FA 3SFUA 3N28A 1DBDA 1KR4A 1FJCA 4KT0C 4OYBA 3PY8A 1LWFB 2OPQB 3OLAA 1Q82T 2A10A 3D6HB 2BACA 3HKZD 3LP2B 5DDOC 2IYIA 5L1KA 3B4DA 1XR7A 2OEKA 3ISND 1TK8A 3MMBA 1K8AT 3HHEA 2KI2A 3CIZA 3IMQJ 4USVA 3JYTA 1APSA 1KRPA 3X3UA 3W63A 5DGBA 1PSDA 1ICEB 4IQXA 2LXUA 2R7XA 3VAJA 1WJ9A 1UEVA 2KHDA 5EHHA 1T9UA 3K5LA 2FJBB 2ZM6F 3VZHA 4M5DA 4TNOA 2F63A 1MMLA 1U1QA 1NHKL 1SC4B 2B5JB 2DYAA 1T05B 3BGOP 2BQRA 4LRCA 4HHJA 3WBZA 1F3VA 3BEGB 3ZZUA 2FLLA 4F02A 1JLGA 2HFNA 5HATA 2G1DA 3DLGA 3Q23A 4LFCF 2B6AB 1LNQA 1UW4A 4P10A 3U7JA 4DR4J 3H5UA 3HFVA 3NP5A 2CADA 3M8RA 4K4TA 2H48B 5IQQA 3SCKE 4X64J 5U47A 3R7SB 3OJSA 5J2PA 1ZTTA 2HHQA 1Y10A 4DS5A 1HBOB 3W1YC 3A3PB 4C11A 3MMAB 2UVVA 1TTHB 3MOJB 3RW7A 2ILYA 3EMTA 4DR6J 2MDAA 1C1CB 2BW7A 3M1VA 4KQZA 4EUVA 2DHSA 4USMA 2BQUA 2NLWA 3NG8A 4CNYA 3QAEA 3HZGA 1CS4B 5KFRA 3D7SB 2E1AA 2GJFA 3NNHA 1TL7A 3VAIA 2UU9J 4PXEA 3MD3A 3CJQA 1GMWD 1ZM9A 3T5LA 1RWNB 4QYZJ 4UT4A 4LRAA 1SJFA 1U8WA 2C22A 5G4DA 4CRJA 1LK5A 2CPDA 2VHGA 1IVZA 2RRAA 2XBPA 1FT8A 6FD1A 1UVIA 2MKKA 4QPXA 1FRXA 4BCAA 1DTQB 1FESA 2YQ0A 3KLHB 1UAWA 1MU2A 3K7RA 1BC6A 5DETA 1S6QB 1X4DA 2IJNA 2KRRA 1HBNB 3AD9C 1S1VA 2C2DA 4JI4J 1MG7A 1RWOB 2DR8A 3G8TA 2HMIB 2VL1A 1JXVA 4JI7J 4JI2F 4C3LA 3I31A 5B7WA 2MY8A 2HG4A 1NEEA 5KFBA 2OO4A 1X4HA 1TUVA 2OP5A 2BOPA 3RZAA 4B08A 3ADAC 4TYBA 3QT5A 2FLNA 3PEHA 3GV5B 1X7VA 3TA2A 4F26A 4F3OA 2B8PA 4B9SA 4ATNA 4OZJA 1KOHA 3VZIA 4B9MA 4RNHA 5RUBA 1YJ7A 3MM9B 2Q1LA 3SEOA 4WXOA 2CNKB 4K4ZA 4MFBB 3SCLE 5D3GB 3SQGA 4FS1A 3M2VB 4FBTA 1QSYA 2F9DA 2VZ9A 1JLCB 3LGHA 1JLQB 2DXDA 3G82B 2VQEF 4ID5A 2D3UA 3OR1B 4DR1J 4JI0J 1QLNA 4QYZK 4A8XA 1RYRA 5HMZA 4HH0A 5HAOA 1TV6B 2L48A 2YNGB 1MWZA 1HARA 1YBUA 3MM7B 4M5GA 1OIAA 2CQ4A 3DFEA 5IT9Y 3QGGA 4E98A 2AT1B 3E01A 3ZXWA 1LKZA 2C3MA 3JXOA 4J9UE 4ZLNA 3VAKA 1JJ2R 1SKSA 1NPRA 3CW2C 1FNOA 4NLYA 3ILLA 4USWA 4QIGA 5A8WA 5DG9A 1VBZA 3UNGC 1AUDA 4ZJLA 3WZ0A 5HP1B 1VQMS 1EIYB 1HI8A 3FRYA 3KK2B 1BY9A 2OPQA 1FKOB 3JQJA 1RT3B 1AB8A 2UXDF 1Y3KA 4JI4F 3QIPB 1SC3B 3D4JA 1YHQS 4KO0B 4O44A 3HHLC 4PWUA 4F2RA 2PMZD 4U96A 1Q1KA 4FYVB 2HLTA 3RG6A 1G6BA 3DHXA 4CLPA 2IMOA 3D1OA 3IWLA 2ZHOA 2AD9A 2FJXA 2LU1A 4K4WA 4UQTA 2YH1A 2DPJA 2LU2A 4ED3A 5F0UA 4Y0FA 3M7VA 5FLXY 4FNHA 4F04B 1U2RA 4DXLA 4NEZA 1FI4A 2HLUA 1J5OA 1F5BA 4PG6A 3D0IE 3GFZA 2R7UA 2DNRA 3UW1A 3RAMA 5D6GA 2R7WA 4YHHJ 1RLCL 2VJUA 1NK5A 1QD1A 1TL4A 2DH8A 2QGFB 1HNVA 2AZ3A 3I5AA 3M6UA 1QTNB 3MEEA 3O6QA 4HVZA 3O3LA 3U1LA 4CCHA 1S4FA 3MM5A 4NZ6A 4C3MA 4YDDB 3Q8UA 2J9DE 3AFGA 1FRKA 3D5MA 4IDKA 4DV7J 3T6JA 1HBOA 1DFDA 4KH1B 5DM6Q 1NSAA 2F4FA 2RKIA 4NASA 2OPRA 4A8KA 4PWDA 4DUZJ 3M8QB 4YHHF 3MCOA 4ZVQB 3G4SS 2KYXA 4DV4F 3AXKA 4NWBA 1XERA 2WHOA 2CQ1A 2BA9A 3BR9A 1VQSA 4RW7A 3SBMA 4LF4J 4X65J 4GVBB 1GNKA 2ASYA 4YOEA 5GADI 3OFHA 4ZVFA 2HVIA 3EPGA 3KFWX 1EP4B 2W01A 3A8KA 4RWXA 4DV0J 1X5OA 4H4OB 2EFPA 1HFEL 2XCAA 5BYRA 1ZM3A 1WF1A 1Q79A 4LF8F 3MPWA 3HHLB 2ASJA 5E3CA 3Q8PB 1ZS6A 4N41A 1PC5A 1YJRA 3MCSA 2MZJA 4X4RA 5KT5A 3T1YJ 1T94A 1Q86T 4ZVOB 2AEMA 2GS8A 2NPIA 3EXYA 4M5DB 2NCKL 4AT1B 1M5KC 3KG0A 3NRBA 4WE1A 4RUAA 4X2BA 5KFNA 1I51B 4DSJA 1IKVB 2NYIA 3K58A 1WC0A 1OQ6A 2RQ4A 2QA2A 1XNRJ 2VD3A 1AW0A 3D0GE 1KNZA 3W2WB 3GYGA 4P71A 5A76A 4IOAQ 2O1PA 2LEPA 1GQEA 2MZRA 1N5YB 2QLWA 3KKFA 4IG3A 4DF8A 4NLDA 3TA1A 2HHUA 1NJXA 1RB0A 4MFBA 4NXMJ 5FD1A 2P6TA 5J2MA 1R0AB 2BE7D 4NZ7A 5ETMA 2W9AA 1E6VB 4F0MA 2GHVC 2VG6B 3ETMA 3PO4A 2MY7A 3DRXA 3CCUS 2K3IA 5EWEA 4YQWA 1DHMA 2YTCA 4IFYB 3ILOA 2C3OA 3HCXA 4WYWA 5K9FA 1I94F 3PYGA 2RU3A 1TKTB 3I0RA 3BN7A 4ELUA 2R7TA 1R8PA 2FB0A 2QIFA 3T5JA 2FVCA 3ZZOA 2H5EA 4OLOA 2W2OP 2GFFA 2XCPA 3CD6S 1VRTB 4NOHA 3SMZA 1WOSA 2NZ4A 3KLHA 4RKUC 3OVSA 2H4WB 2HQGA 1N52B 2BABA 4QR2A 1TL1B 4WFZA 4DX8H 1NK8A 1JX4A 4ILRA 3HSDA 1XQIA 4DHVA 3BQ1A 1AYEA 2EPIA 2CQBA 4QWBA 3GB0A 4DX6A 2AEJA 4USJC 4DV0F 2GW8A 1UETA 4PQUA 5KT7A 4OHXA 2DNPA 4GC7A 4UZBA 4XTTA 1NK4A 1RABB 2OH2A 4YY3F 1NMEB 4RLEA 5LMNF 5L1IA 1QSLA 1MN7A 1U1PA 2BVZA 4E2FB 1DJ0A 2RF2B 4F36A 1U47A 2X1AA 1KVKA 2OUGA 4IG0B 1YGYA 1B4SA 4MKAA 4FVCA 3WHIA 4NI2A 3I9V9 4Y2AA 3J7YU 1B7FA 4CNZA 2R2RA 3SFGA 2SXLA 5L8RC 4QWEA 4C48A 4PKDB 1REVA 4XAKA 2L9NA 1VC5A 1G4CA 2OPRB 2VC1A 4QWCA 4PWDB 1SH0A 4R25A 3OR1A 4NE9C 2YNIA 4DR2F 4O0IA 1FRMA 4Y2IA 2Y8WA 4GKKF 1XR5A 2EG2A 3NY0A 5C24B 4UOHA 1HWUA 4ECWA 4Q8EA 3THVA 3BKFA 2RUGA 1EX8A 5FIIA 4O4GB 5B0DA 4ZDNA 2B5JA 1Y7PA 5HO4A 4WCEQ 1Y3JA 3VAMA 2CJ9A 4JV5F 1K1SA 3QFHA 3EVWA 3EGZA 4RUHA 1M5HA 4L3NA 2EFVA 3JSBA 5ITHA 2RT3A 1KDNA 5C2GA 4A8OA 4JI1F 2VBYA 4DEZA 4QU7A 4B3TF 3SSSA 5A8WB 1ROFA 4WK3A 4FP9A 1DQ8A 2G1HA 3DC2A 4LF1A 4ZHRA 2P5VA 4Y6IA 4BS2A 1W25A 3J7Z5 3MEGB 1WG4A 2GC8A 1UCNA 2VKZG 1RCXB 2WVEA 3Q89A 4LFBF 4WF9Q 1NPKA 4HT5A 5DGAA 3UVJA 4WE1B 3HF5A 3DLKA 2W9CA 4W90B 4K59A 2PD1A 1UMJA 5L1LA 4Y34A 4EO6A 2BUNA 1CJTB 3D3CJ 2IVMA 3CCWA 2HIQA 4N7TA 4U8YA 2HVHA 4XO0A 3FZ2A 3Q2SC 2FUG9 3N5BA 1F6TA 2BJEA 2JLEA 4RJVA 4N5SA 2HWIA 2IA0A 1TVRA 2WONB 2Y1LB 3HPOA 2DNKA 4PYAA 2DIVA 4OV6A 2OPSB 3HFZB 4C8OA 3A8EA 3AD7C 2AX1A 4RR5A 3KLEA 4X4VA 3QO9B 4FPIA 1OO0B 1OSCA 3MMCB 3UNYA 4B17A 5H1SV 4YB6A 3AD8C 3SIPB 3HXMA 3ITHB 4DR2J 2KB2A 1PGZA 3R5GA 4PG8A 1Q8KA 3K57A 3M8QA 4ED5A 2VG7A 3ZNJ1 4OJ1A 1SIZA 1VRUA 3M4XA 1U2FA 3VVTA 3OJUA 1HWJA 1BQNA 3BGRA 2DNOA 1RHRB 1YLXA 3HT0A 4ZKAA 1EJ7L 4DL3A 4Q7AA 4AUKA 3QGHA 3HVRA 2MKCA 4U7UD 2O5DA 4HI1A 3RW6A 3FEZA 5IT9U 1UTAA 2KRBA 4KHPF 2VV5A 2W24A 3BM7A 4C98A 1UWBA 4LIRA 4K2XA 1C0TB 3GV7B 2R9LA 1IBLJ 3IWNC 1NO8A 3BR8A 1LOUA 4H4KC 1BQXA 4BC7A 4DL5A 2BJ9A 1Q4RA 3KJVB 4NLSA 3UQSA 5HBMA 2P6SA 3VVUA 1C0UA 1YJNS 4CYUB 5KT4A 1NB7A 3BH7B 3GG1A 5DS7A 3PKYA 2XS7A 4PQUB 2HK3A 3C2PA 3OBIA 2BE9B 4ZPBA 1D8ZA 2GIRA 2KT5A 5LL6d 4ES3A 4DPYA 2MQ8A 2QN6B 3W2WA 2PGCA 5FDLB 4TY8A 1Q0NA 2K3KA 1RGVA 2CQIA 1AZSB 1LXNA 3MAHA 4LVOP 4MK8A 3VR1A 2QLJB 3I82A 1O8BA 3M6VA 5KG7A 4DV3F 2P9GA 3QGPA 1TU0B 3U1MA 4UTGA 2RRNA 5KFQA 4WTOB 1I3OB 4B9LA 3VWSA 1TP7A 2HBYB 3TAQA 2JX2A 2W2PP 2XSJB 2QRRA 1N56A 1U02A 2NSCA 1G3OA 2DNHA 1FTCA 1RHQB 1U1KA 4BWJA 2XMJA 1FVQA 2E1MC 2RNEA 3A13A 3M2UB 1QDUB 4TU7A 4JV1A 2OMOA 4IFYA 1H2VZ 2C2OB 2QMWA 2WSFC 3L7OA 2AJ2A 3W8PA 2EC0A 1WDDA 3M32B 3PNIA 3PDNA 5KAKA 5LMNJ 1FEEA 1L5UA 4ELTA 3P96A 4M5JA 1UJ5A 1FD8A 4USHA 1SJQA 1DQ9A 1R6YA 1SKRA 3RB0A 3G86A 2R2TA 3U1NA 3PV8A 1RU2A 4KGXB 3H5XA 3IM9A 4C0HA 3OW2R 2NUUG 1L3KA 1YRXA 5DLFA 1QVGR 2WVCA 1XNRF 3NBPB 5KG3A 3PYDA 1EETB 1CG2A 4PG4A 1IR2A 5AXNA 4IKAA 4NXNF 2I1RA 3TEGA 3W9JA 2QX0A 1Q7LB 3C46A 3TANA 1T9VA 1TKXA 4EBDA 2CNNB 4Q43A 3KJNB 5A6PA 5CZVA 1FX2A 1U8SA 3TVKA 3FCVA 5K14A 1LW0A 3OR2B 4ECQA 3OTDA 2DR6A 3KLIB 5KT3A 3V6JA 2ZH9A 3PACA 2ROEA 4M5LA 5F8NA 2AJQA 3P6YC 1K9MT 4X66J 4QBUA 2AZ1A 2BJ1A 2XO6A 4DS4A 3KLFA 3KK1A 2YPZA 3NGDA 4DFJA 4JI1J 4RW7B 1TVRB 2WONA 3D67A 1FFSB 4RU9A 2IFXA 5ETSA 3EJMA 4B9TA 1VQ6S 2F40A 2JLFA 3QIDA 2YKOA 1NDKA 2KU7A 4C8YA 3H59A 3EGWB 4ER8A 2AGPA 3RBZA 4M5NA 2KT2A 3MR6A 1QY7A 2POKA 3KG4A 4DG1B 2V2ZA 3C15A 5SZTA 1UW9A 2IYGA 2F3JA 1RT1A 2OFGX 4W98A 8ATCB 2F8HA 3TI0A 4G3IA 2ALZA 3ELHA 2MZSA 3C6UA 5ETOA 1HD1A 2DRBA 2FZGB 1WUUA 2RHQB 2GV1A 2MMYA 5KG1A 4F3QA 1T03A 3BSNA 1DY3A 3AB4B 3LTOA 3D66A 3AA8A 4Q45A 5KG4A 4GVLA 1FKPA 2OSQA 4WKRA 2QMXA 1YQHA 1TAQA 1WEYA 3EVOA 5F3TA 2HNDA 1SUQB 5GMDA 1KLMB 3IR6B 4FZVA 3A4TA 4ES2A 3V6KA 4CTAB 2VF3A 3VF0B 1UKUA 3DU6A 1SC1B 4RW6B 2XYPB 2IAJA 3CCRS 3O1LA 1LQ9A 4A8SA 1HQEA 4IG3B 2VPWB 3RR7A 1UJ4A 2GJIA 2ZBPA 1PYSB 5DM7Q 1B99A 4Z37A 1CLFA 3J81j 1KONA 2AV5A 1A6LA 1HMVA 1X5PA 1Z4UA 2JNJA 5ETRA 2R8KA 2MKYA 1MMDA 2XULA 5KFAA 2PC6A 3QWUA 4PXBA 4ZP8A 3G6ES 1SJ4P 2VONA 4ED4A 1OPZA 2FC8A 5LMUJ 1U0HB 4C9DA 5J1NA 4IO9Q 5G0RA 2PIIA 1J5EF 2BRLA 1HR0F 3OTEA 1AZSA 1R0CB 1X9SA 3UPFA 3JSMA 1NJWA 1LW2B 1T95A 5CCMA 3DGPB 3M2RB 2XHWA 2QL9B 4LF5J 3QNWB 1RT5B 4H4KA 4CLYA 1FCAA 1R8BA 1M5OC 3G8QA 2RQCA 3US5A 2DVIA 4OHWA 5ETQA 2EKYA 5L46A 4OQJA 1XC9A 5AXLA 1VMBA 4RW4B 4OYPA 1GXUA 3TJ9A 5HROA 3SV3A 3MWBA 4HDGA 2BEFA 3VHQA 4O3PA 1EQMA 3M32A 1YBAA 5F8LA 2W1BA 2MLZA 2M5YA 2XEXA 2UXBF 1W26A 1FRLA 3NWRA 4L74A 4WIIA 3ZC4A 1NSKL 3MM8B 4CLWA 4ETZA 3Q8VA 4UW2A 3T5KA 2DGSA 2X51A 4I56A 2XMTA 4F4XA 1RJJA 3PFEA 3E3XA 2YKQA 4KBIA 1VQ5S 2PI5A 2GAGC 2Q3PA 4OYIA 3TP2A 4CLLA 4DL4A 1NZ8A 1Q5VA 1N54B 2GGPB 1WNEA 4G1PA 1NK6A 2R8HA 3LOUA 1U6ZA 1RTDB 1HWIA 2BOAA 1LXJA 3MPUB 4G1QB 3T41A 1ZM2A 3UDLA 1YZ6A 3D6MB 4FYDA 3ZO7A 1RKIA 1RTHB 1G7CB 3GLJA 3N6NA 4LR8A 1QM9A 1UL3A 3EICA 3H40A 2H3EB 2B6AA 2NREA 3TAPA 3J7A1 5A6WA 2ZBIA 3LF0A 3NOGA 3EE3A 3WX4A 2JEFA 1CEZA 4DFMA 2WBMA 2ZZNA 3HK2A 1TKZA 1UZHA 1RSCA 1WG5A 2CRLA 3DDKA 3R97A 1YJTA 1LV5A 4HHHA 3RTVA 4M94A 4JBCA 4LFAF 1HW9A 1UVKA 4IR1A 4I4BA 3RAQA 2KFYA 1LWCB 2J76E 4RW8A 4ZJOA 5KFYA 3CMES 2XC9A 3L4BC 3T1AA 3ENQA 1X9MA 4QW9A 4DG1A 4WFBQ 2Z2ZA 1U24A 3DOMA 4KHPJ 3L9ZA 1S4EA 2E5GA 2ZH4A 1F2GA 3IS9B 3R6GB 1HQUA 1KHWA 4ZVEA 2PE8A 3BGFA 4OX8A 5I42B 1X4CA 2W7PA 4KV8A 4J9NA 1S1UB 4KB7A 1DAXA 1Q78A 1R0BG 2NZCA 3QWPA 2QA4S 4RPFA 3KDOA 4EYHB 3AJDA 3KNGA 3TNVA 5DDPC 5F0WA 1U1NA 3CJ8A 2WVDA 3OLBA 3I56S 2E1CA 4B3RJ 3BV8A 3LP1B 3LWLA 4ECTA 1JLGB 4YMEA 1AFIA 3NBPA 4PAAA 3EGVA 4XIUA 1YJVA 4HEA9 1PBAA 4NYPA 2MQNA 3H98A 2OFHX 2ZH2A 1VC6A 2GVDA 2XZTB 1CULA 3H2LA 4M5KA 2BXJA 1RAIB 2VASA 2VICA 1EQ0A 1TKXB 2OMLA 4FXWA 3W66A 3KLEB 2LVWA 2IM3A 5KFGA 4ZJQA 4I6WA 1QJHA 3DXSX 3H7HB 5KFIA 2C2KB 3R5AA 1VQ9S 3ZTSA 1FERA 4JI3F 5H9FJ 2Q43A 5LJ5Y 4X4NA 2JHEA 2Z4PA 1EZZB 1S0OA 2V68A 1HW8A 3RGIA 2I5JB 5LT5A 3BZQA 4DCOB 3D54A 1OPIA 1JB0C 3N0VA 4ZP6A 4KE5A 4P2FA 3HMJG 3C16B 2KXNB 1RHUB 3DLBA 2PEBA 1T9WA 3OFGA 4OI1A 5HMWA 2I38A 2QYCA 3KWMA 2M4MA 1LW2A 5HK4A 3HM9A 2RS2A 1NXIA 3O8WA 3MPVA 2CJXB 4PPZA 4J9MA 2M2BA 2OEJA 4DQIA 2OTLS 1S1WA 2X7IA 5LM7E 2YWGA 4AXIA 1N6QB 1IKXA 1KFSA 2X1FA 2V8VA 1FDAA 2PFFB 5BYSA 4XDCA 3FEXB 3N6MA 2JH3A 2DBBA 3E01B 1HNXJ 1VHIA 2DH9A 2QLXA 2PI4A 4PUOB 2IJRA 2GNKA 4K4YA 1GEHA 4IOBA 2DHGA 2UZAA 4NZ0A 3KJVA 3R1HA 4B3RF 1N5SA 3FC9A 2BANB 3NGUA 4Y28C 3D28A 1M5VC 4USUA 3AAWB 3DLHA 4JYAJ 3OXFA 4TU8A 3VTIA 1H6KX 3TA0A 1MLAA 3QIPA 2VQFJ 4ECSA 1SVDA 2W2NP 4AL7A 2HFZA 3TX8A 4QQBA 1Q8BA 2GQQA 3IO1A 3R6LB 4A8WA 1S97A 1HHQA 2CPEA 3ZZZA 5C2CA 3DYAB 5JMNA 2KH9A 1GH8A 2MJUA 4CI0B 2ZEJA 2YWKA 3CJKB 3ZTOA 1ZZFA 1N5QA 5GAHU 3LH2S 1VC0A 3LAKA 1SQEA 4F25A 4OX7A 3D0HE 3B4MA 4JI2J 4ZCLA 2B7BB 2EEYA 2HQFA 1L3UA 3K8WA 3MDFA 4U6PA 2XB2D 4N56A 3EZ5A 1MW7A 3WX8A 4ZVSB 3BSCA 2A2DA 4RUBA 1X60A 1IQTA 3TARA 1HBUA 4WZQA 1FFWB 1CS4A 5KG5A 4DZ6A 5E3RA 2HFSA 3CMAS 2V67A 1FO1A 2ASDA 2G0IA 4KGKA 2LP4A 4BLGA 3DXBA 5AT1B 2AX0A 2GMLA 3W60A 2CPZA 2V8PA 4B9NA 3BJYA 1VRQC 1XNQF 4ZN3A 2BKOA 3LAMA 3F44A 1PO6A 4YS2A 1XR6A 3KK2A 2W8LA 3IC1A 4CQ1A 3HJFA 4ZVUB 1FKOA 1P9QC 2XGPA 1GTEA 3KJQB 3EDRB 2AW0A 3NCPA 1EETA 2IVYA 2YWWA 2YQ1A 1CQMA 3BSAA 3NCQA 4HI2A 4JI3J 2ZZMA 5HN0A 2JEJA 5ETPA 5CYQA 4J37A 2E5IA 5E7OB 4ILMA 4LT6A 3DRRB 5GAGI 1ZH5A 2V94A 4A8YA 4KPYA 2D74B 1XMQJ 3O44A 2HGMA 4R0EA 1KQSR 1IKYA 3RRHA 1RT6B 2YKMB 3PG9A 4K2JA 3G6XA 2VH7A 2NSBA 2UUCF 2JWNA 4DL2A 1YX2A 3IWXA 1NLKL 3LP1A 4S0MA 2CJYB 1MSWD 5EN1A 2HS3A 3PR5B 5LJ3Y 1S9EA 1BE4A 1YDLA 1S7HA 4ZCIA 1OYEA 4XDDA 5SUHA 3TX0A 2UVWA 1WTBA 2VFRA 4OI6A 2X1GA 3T1HJ 4PRFA 2JVOA 3QMQA 5L9NA 1HPZA 4RX6A 5L38A 3TVZA 3SYZA 1XMQF 2JFDA 2PMHA 2V8HA 4IO1A 3M9OB 4HYKA 1X5TA 4DU8A 2DR7A 5GAEI 2AP6A 5GMKa 1SJ1A 2DNYA 1FWLA 4DV2F 4KTQA 1RWPB 3C6TB 5EWFA 4ZCKA 4DR7J 1R89A 5KFCA 3MMBB 1S1TA 1MNEA 2A3JA 2XMUA 2ZJRQ 4LF5F 3I5CA 5F3ZA 1B7YB 3PVXA 2E9ZA 4DF4A 3C8YA 3H4DA 1TR0A 3KUHA 2MYFA 4RBVA 4D3HA 3H5SA 3PIOQ 4AL6A 1T03B 2UP1A 4LSNB 4UUWA 3BGLA 4DPOA 1N33F 3EWGA 5CHCB 1FXDA 1UPPA 2CQCA 2OELA 4H4MB 1U6FA 1T9TA 4PXCA 4CO4A 1RTZA 3K5MA 2UXCJ 2YKAA 3D1QA 2F8MA 5ETVA 2BJDA 1TFWA 4HACB 4ICLA 1JLEB 3I32A 1RWVB 1SUQA 3LGMA 1RU1A 1FEHA 4NLTA 1S9FA 3R3TA 4CO3A 2ADCA 3NS5A 4NA3A 3GV8B 5L9XA 1ELOA 4KHRA 2LFVA 4V1Ak 2V6AA 3GTYX 4AYBD 3IS9A 3FSIA 4N76A 2H9ZA 3RAXA 3NCRA 2XYGB 1GMVA 2BW2A 3A12A 3ENAA 3H0PA 3H42A 3K59A 1FRIA 5KFFA 1S1UA 3NGSA 1IBKF 3OFFA 1TL1A 1IKVA 3CVKA 2ZHAA 3OHAA 3FDSA 3MHYA 1R8CA 3KOAA 1ZAXA 1H2TZ 2VPZB 1B70B 3M1VB 1MWYA 2PT0A 3QRPA 3CT9A 5D4LA 4LF6F 3UDCA 2DGUA 4KGVB 3NNCA 2OTJS 2D7SA 3FUYA 3P3DA 4N8OA 5HLFB 3R5BA 4RO0A 2FLPA 1Y5LB 2IRXA 1GMUA 1CJUB 2XMKA 1CULB 3GYXB 2AMCB 4P52A 5HMXA 4ED8A 3UCUP 1PILA 4AL5A 3FCHA 4FXVA 1Y00A 3GCWP 4FNIA 3D3BJ 3LALA 3C3LA 3HHNB 5DDRC 1NRKA 4UZCA 3UD5A 4MAKA 1RT4B 2HNYA 3CO0P 2OD6A 4JI8F 2V9KA 4JI6J 2KZMA 4Q5VA 1GXTA 1RAGB 3AXMA 2LCWA 4YB7A 4DCPB 1SCJB 2H5JB 3C16A 3TYTA 4JV2A 1NBEB 2DK2A 2VFSA 4ZVRB 4R8UB 1SH2A 2DNZA 3M9MB 3R8YA 2KT3A 3JB9k 1RXOB 2W4PA 3FBBA 1XMBA 4RNFA 4L76A 2CNLB 2M0GB 1N6QA 1RWMB 2J0SD 3C14A 4ZOSA 5AE3A 1S10A 1SL2A 2GGPA 2AJFE 2DHXA 3HHLA 4ED2A 3QRRA 1WHYA 1QTMA 1FX4A 1RTDA 1X8DA 3DOLA 2NXUA 4P2MA 2AWZA 4Q44A 2NXNA 4HTIA 1LWEA 4BHQA 3PRDA 1QAYA 2BRKA 2M8DB 4KYZA 3T6BA 3M9NB 4U8VA 1S99A 2VPXB 4ZHRB 2XS2A 3OV7A 2KZZA 2HVZA 1IXKA 1FK9B 4ID5B 1UVMA 2Q6CA 2HGNA 3CJ5A 4I64A 4Y65A 2Z2LA 2MHEA 4ILLA 3HSJA 5B0FA 1ZPVA 2B9YA 4URGA 2KL8A 2KVQE 4WFAQ 1HKAA 2AJ1A 1K0TA 1Q8IA 2PN6A 2N7YA 3FQLA 4TY9A 5ETLA 3OXLA 1KQKA 1TL3A 2UVRA 2XLKA 1YTYA 1VJQA 4BDPA 2UUAJ 3NS6A 1OSDA 4DFKA 4Q0BA 2GAHC 1REVB 4Y2MA 4KKOA 2HW3A 2RSQA 3DOKA 2DKOB 1RP5A 4U7UK 2UXBJ 2QT7A 2R7VA 4P9SA 1HQUB 2M52A 5HL7Q 3ONQA 5LOQA 5H9FK 3ITHA 9ATCB 3MOZA 2W9BB 4IOCQ 3M30B 1BUXA 1F2HA 5IM0B 4Z2XA 2VG7B 3B6BA 1SQFA 3C19A 3QLHA 2XLIA 2FVPA 3TR5A 1HNWJ 2DY1A 4LFAJ 1BQNB 1KTQA 4CO2A 1TUWA 2CFXA 4ANCA 2IC3A 4IRKA 1JLEA 1X0PA 3DU5A 3H25A 3LP0A 3WC2A 3MM6A 1JXLA 4I67A 1QAIA 2A0FB 2DNLA 2J6TA 4F4ZA 3FQKA 4KGMA 2CPHA 1UWBB 1HNWF 3IG1A 3WC0A 2D9OA 1N34F 1CSJA 1I1GA 4I69A 3U02A 2Z8QA 3UDVA 4A4JA 5IQ6A 2MKJA 2ZC3A 3UVJB 1S6PB 5A8KB 2KM8B 5LMUF 3SQOP 3GIKA 1FE0A 2G2OA 1VYAA 3MCMA 2CQDA 2XWXA 1RLDA 2ACYA 2EFQA 3CJ2A 3CC2S 2GA7A 2Y9HA 2WSCC 4B3TJ 2HNZA 3GJTB 2CQHA 1WTFA 3M8PA 4AE5A 1JLFB 4R0JA 1ZYQA 3QJPA 2D9PA 4RBTA 3RBDA 2F4VJ 2D1CA 1AROP 2ZD1B 2OPSA 1Q53A 1WELA 4WTYA 2RRBA 1TK0A 2E9RX 2HHSA 1T9XA 4NL5A 4QPTA 4C7QA 4LSZB 3MMCA 3H90A 4H4OA 4MYTA 2H4YB 4ZPWR 4IFVB 3IR7B 4QW8A 5J2NB 4CLTA 4DLGA 4USIA 5DQHA 4LUBA 1VK3A 1ZPWX 4LVNP 1YJ9S 3GFHA 4TYAA 5FJ4A 5KFUA 2DTJA 1ZAWA 3S6EA 2J6SA 2XSJA 1YJUA 5D0RA 1RTIA 4NMXA 4NLRA 5K8NA 4OHZA 4TKTA 1IM6A 4UOFA 3TJ8A 5KT2A 4DR5F 1JKHA 3DGVA 4NLUA 2WBRA 2CQGA 4C8LA 4O3OA 4ITSA 1NKBA 4FKYA 1CJVB 1WKKA 2HQCA 4FXDA 2FJWA 2G2ZA 4KRWA 4KR0B 4MH8A 3ULHA 2D41A 3M8YA 1XMOF 4MKYA 4OZNA 2RDJA 1O0PA 2RQMA 4PUOA 2KN4A 2LXIA 2LXFA 1JLBA 4LBHA 1RADB 2QL7B 5LSLA 3WIVA 1YSJA 4ES1A 1HYSB 3QYYA 1C0UB 1HI1A 2XHCA 4MIBA 1BGXT 3NL0A 1CJKA 2CG8A 2F5GA 3TAMA 3PW0A 2BYCA 1KHVA 2ZWOA 5D4OA 5IFMA 3OSNA 3AQPA 2GX8A 2Y0SD 3MECB 3NGTA 4RBUA 2VG6A 2WW4A 2QA1A 2QV6A 2B51A 5CD4H 4O23A 1FK9A 1RAJA 2J0WA 1WC3A 2PMWA 1S0MA 4ZIWA 3ISNC 4UQGA 1CJTA 3PFOA 3S01A 2R7RA 1A9NB 2IA6A 4RNMA 1LW0B 1GK8A 2FHOB 3OR2A 3GFXA 3HJVA 2XY5A 2GZOA 5A0YA 2CJQA 3MAQA 3KLIA 4L6V3 3TRGA 1KTVA 4CIOA 5AE2A 3Q8QB 1P6TA 1VOMA 5T7LA 3TQ1A 2XM3A 1TKTA 1KWMA 2HFOA 2V2VA 1RTJA 3KG1A 2ZZTA 3ICLA 3NWGA 1EHWA 3UR3C 3W9IA 3OPKA 4X4SA 1UVLA 1KS2A 3OTCA 3Q8YA 4X4TA 2FY8A 4J91A 2M70A 4CLUA 1TK5A 3EZUA 4DU7A 1T7PA 2YX1A 2HRTA 1BHNA 1NJYA 5K8OA 1PIEA 3N6LA 1W2BR 2Q79A 5C5JA 2B4PA 4ECYA 2R8JA 5KOWA 4JB8B 4F4WA 4LSLB 1N8RT 4V19J 1XNQJ 4UY8T 3G6VA 3HVTA 2VUGA 1DLOA 1X4EA 1DZ5A 2OHDA 4JP8A 3NAIA 5HQLA 4RNOA 4WFXA 1IQZA 1SV5B 2YX4A 1MROB 1U25A 4HH1A 3W5XA 1C0TA 4L72B 4LBPA 3CWJA 5KFXA 4EFAC 1FRHA 5FLXU 1HNZF 2ZOFA 3O2IA 3MI7X 3W9HA 3D1HA 4M5HA 4DN9A 5HVHA 5CD4A 3PR4A 2B9WA 4OFZA 4DUYJ 3M05A 3RBXA 4U67Q 4LF4F 3DRPA 2XYHB 2B43A 4NA1A 3UFCX 4QYRA 1U1OA 2YVSA 3W7BA 3QT6A 3JSYA 1PBUA 2N82B 1EKRA 3GIMA 3BBFA 4MYUA 3DLLQ 2LYVA 1PJ6A 2CPXA 1FJGJ 4P74A 4DV5J 2MSTA 2X3GA 3PJ9A 4A48A 3N79A 1S57A 1BWEA 4C11B 3HKWA 1NK9A 1NDPA 3PYFA 3V4IA 5D8HB 4DV7F 1X5SA 1RAAB 2I6WA 4DL7A 5B0BA 4W4MA 1CBKA 1FFGB 3K0JA 5DQGA 2DNGA 3JS9A 5M2PA 3KLGA 2VBWA 3AB2B 3MD1A 3T1HF 3MEDA 3DNCA 1WC6A 4X4UA 2IM0A 2NXCA 4C6AA 1SJRA 3CJRA 4DR3F 4IFVA 1RWUA 2QEXS 1RHMB 2EW9A 2ZH8A 2QE5A 4A8MP 3MAAA 1P1LA 3CCZA 1RT5A 1S12A 2DCLA 3JYTB 2UUCJ 3ETOA 2CQPA 3RB3A 1OYDA 1U48A 1B0TA 3W5ZA 5KFKA 1UVNA 1OQ3A 2CXEA 3H20A 3DDNA 3A1YG 2COLA 2JDJA 2KFZA 1Q95G 1S76D 8RUCA 2QL5B 5E41A 4WFYA 2RJZA 5IXUA 1NB2A 1S1VB 5KOXA 5F41A 3MR2A 1QAJA 3ET6B 2E1RA 2FD2A 5CA5A 3W61A 2HMIA 3MM6B 2RH3A 3N01A 2R42A 2E9TA 1DTTB 3R7BB 4NYOA 4Y2CA 4ZN1A 2DXFA 5F8MA 4EBCA 2MJNA 1QVFR 4Y3CA 1PYOB 5EGYA 2IAJB 3BKUA 3D68A 2XO7A 1U1RA 1HQEB 4PCQA 1SXLA 1WF2A 2H65B 3V81B 1AXQA 2DGVA 5F8JA 4HDHA 1QE1A 3H4BA 3QQCD 1LFPA 1H38A 1CQNA 3V4IB 1TELA 3MECA 4RU2A 2U1AA 3QBCA 4W92B 4WZMA 1RT4A 2HNYB 1SB6A 2A6MA 3GMGA 3VAGA 4LBIA 2CJAA 3TZYA 2H5IB 4KJIA 2G0CA 5HJYA 3CC4S 1C1BB 4LF9F 3Q2TC 2RU9A 4M63A 1JLFA 1RI7A 4RWWA 4ZVGA 2P9EA 4C3KA 2EC2A 3DGPA 1DARA 1OS5A 1UEKA 1NU4A 2J7WA 3M2RA 1RTJB 5CCLA 1ITPA 2ZH3A 4YP3A 1KEKA 2LEAA 2MZTA 2YPYA 2QLFB 4RW9A 5HJXA 2J6UA 4NCAA 2VA2A 3GP9A 1FA0A 1S1XB 2GCFA 1KQGB 1DURA 3LPEA 4MK9A 5B0EA 2FVQA 2CWXA 3UE2A 3PJWA 4PXDA 3JAMU 4ED7A 2VG5B 1NKEA 5F8HA 4JV5J 1IKWA 1S0NA 1DRZA 4FF2A 2IM1A 1RT1B 3BKTA 3KMQA 2R8IA 3A8JA 5CXTA 4LF9J 3F0NA 1HBNA 2R8GA 1LWEB 4C4WA 3S1TA 4K7QA 2CDRB 1YZ7A 3QATA 1PKUA 2ZH7A 1KN6A 2V9WA 2OD4A 1EKSA 4KHMA 1NK7A 4LQ3A 3ZTPA 3KTQA 1RA6A 2UUWA 2HNDB 3LQVA 1SIWB 1IR0A 2YY3A 2R3VA 1XN9A 1PJ7A 2VC0A 5B0AA 4N47A 5BR8F 3QAUA 3C66A 1JLBB 2QSWA 3IR5B 2Y8YA 2HHVA 1H72C 1NHUA 4MKVA 3DRPB 4IH7A 3PZPA 3DRSA 5DDQC 1LK7A 4UOGA 2J9EA 1S0VA 5D0EA 1W2IA 2V4JA 1QAXA 1HNVB 3UCGA 4DSLA 2H51B 2IDLA 2BE2B 3I55S 2L3MA 3G82A 4L75A 1IM4A 1RE1B 4LF7J 4J7CA 2ZJPQ 1FWPA 1TQLA 4JUZA 5BR8J 1IWGA 4LRDA 2MXYA 2ATCB 3I96A 2HFUA 2CIMA 3J81Y 3CDAA 3OUYB 2VJVA 1ZA2B 1H98A 2BJ7A 2DD8S 1RBOB 3AT1B 3QLHB 1N33J 4YB1P 4G1IA 2IC3B 3V5RA 7FD1A 4EBEA 1VJWA 2YWEA 2OSRA 1FJEB 4FF1A 2EFNA 2BM0A 1GAOA 2VKRA 1SPBP 3NEKA 4DX7A 4DFPA 2PSZA 2G0JA 1S1WB 4E8UA 4X62F 4QWDA 3ILJA 3GIIA 2IHR1 3N9UC 5IV4A 2ZM6J 3T19A 2CDQA 5DG7A 3CCLS 3IG1B 4NRUA 1B3TA 2BKPA 4A46A 2LQJA 2E5JA 1T0TV 3MF5A 4KV8B 1GMWA 3IAS9 4O3NA 4CZCA 3GIJA 1K0VA 3POTB 4NLOA 5D4NA 4ZPDA 1IBKJ 4C8MA 2AYBA 3ENVA 5BJRA 2AYGA 4YFUA 2FIUA 1VI7A 1HR0J 2HKEA 4WIQA 1VQ7S 1NCLA 2MEWA 2QTWA 2UV8G 4URQU 3AH6A 5ETTA 3FK4A 3KMSA 8AT1B 3KK1B 2RAQA 4K4SA 3UR0A 2OKQA 1RISA 2C28A 4IH5A 3TQEA 3CULA 4PQAA 2ZBRA 3V81A 4DQPA 1V3SA 2L9WA 1LFWA 5D77A 2VOPA 3CJTA 1OMSA 2UUTA 2MTLA 1QE1B 2JL9A 4NCGA 5DQIA 3IFEA 5K5MA 3CCES 1Y0HA 2RDDA 3OHBA 2K1RA 1VHFA 3FFIB 3CJKA 3JQMA 4HT7A 3ZTQA 3EPIA 1IJFB 3OTBA 1J27A 4TVAB 4P75A 3HO1A 4K8RA 3OL8A 3RYLA 3AOCA 4LREA 2BBEA 4OJHA 4Z7YA 2ZH6A 4ED6A 1YRTA 2EG1A 2WW8A 3F41A 4WYLA 2ERRA 1VIXA 2XNRA 3PJXA 2IDEA 2DCUB 4I1TA 2DJWA 4KC5A 3EVMA 4PZVA 4X4PA 1J5EJ 5KFEA 4MK7A 1S7IA 1I5OB 3WDOA 3P49B 2WB1D 1CJVA 2MPUA 1P9YA 2C2EA 1F5CA 2E5HA 2RE1A 1R31A 4H54A 4OYZA 2XY6A 2G4BA 3MFIA 3HLUA 2FLOA 1K1QA 1RZMA 1WG1A 4WJBA 4G6VB 3P4UB 2EK6A 3IN5A 4QIEA 1D09B 2CVIA 2Z0GA 1FVSA 1RT2A 5IC4B 1YITS 1VQ4S 3TUJC 1YJWS 5IS2A 4RNNA 3CE8A 2ZKUA 2VA3A 1JIHA 5ADZA 3W2VA 5C7PA 1XBWA 3TAMB 1SC6A 3CDUA 1IJEB 4DI6A 3UCZP 5BYQA 3CEDA 4HL9A 2ACMA 3FJ2A 5AJ3F 3DRRA 2C1EB 3L95X 2MHNA 3Q8RB 4DPTA 1WDTA 1JJHA 4I68A 1NSPA 3BDPA 2DEJA 3P8BB 1RT6A 2YKMA 2X1BA 3JSMB 5JVGQ 3EM1A 2XSFA 2Z2YB 3ZNUA 5J2QA 1HA1A 1M5PC 3P45B 4DV5F 2EBEA 2RUSA 2P8IA 3HVAA 3KDNA 3BO3A 2DISA 4OZ1A 2FHJA 4OZ3A 2I2YA 1C4CA 2DR5A 1BQMB 2XI3A 3DDIA 1YKWA 3CCVS 2KFNA 2ZDPA 2M8HA 4KAIA 5D78A 3DM2A 2N7CA 4CWBA 3R2DJ 1VGYA 2YNHB 5KFLA 2VPYB 1VDHA 2F9JA 3GR0A 2E7XA 4OHVA 1HNXF 1OJ4A 2AIRB 4F0KA 2CNOB 1RAHB 5D15A 1S72S 1E6YA 3MUMP 2G13A 3CDBA 3I0SB 3A8IA 3PRBA 4NLGA 1FDDA 3G87A 1WHXA 3RB6A 1DLOB 1P1TA 2FHJD 2C3PA 2MSSA 1RBAA 2AKWB 2B56A 2U2FA 2YNIB 4I2PA 3RJMB 1IBMF 3PIPQ 2HZVA 4FF3A 4DDFA 5C24A 1O5JA 1XIQA 2HAFA 3W5YA 3VAFA 3KK3A 4UY85 4DV4J 3TOQA 5KFJA 1S49A 1VRTA 4WU3A 3RBEA 4LR7A 1M1HA 2CVEA 2PDAA 3IBFB 4ANDA 3VALA 1N88A 2O01C 1T02A 2KXFA 2Z2MA 1U49A 2DGTA 1RTHA 2QC3A 3KNAA 3NMAA 3LP2A 4BC9A 4EI2A 3CO9A 3CPWR 2AQ4A 2B3TB 5A2QU 3HX9A 4QIFA 4EGLA 3MEKA 3V6DB 1WHWA 2DB1A 3BS9A 4YDXA 5T41A 3CD7A 2KG0A 2YWHA 1S9EB 2DNNA 3JSRA 3W65A 1IN0A 5J1EA 4ZVTB 1F5AA 3FZBA 2ZVIA 4ALZA 3GJSB 4Q2LA 1M1GA 3A3NB 2F4VF 1VBXA 1X31C 2OPPB 1WKLA 3I5BA 3TUIC 2MZQA 4USKA 1Z2ZA 1BLUA 1VLOA 2F8EX 5KTQA 5HLFA 2V4JB 1RYSA 2ZBCA 1XJWB 2J5AA 4DPXA 4TLRA 1VQLS 1CJUA 4A8FA 2NQPA 2HQ3A 3OL7A 4CM0A 1S1TB 5EUHA 3SI8A 3EXCX 1U09A 1ZAVA 5DG8A 1DQAA 4JI7F 5M2RA 1UPMB 3BB5A 4F4KA 2ZH5A 2XNQA 4CLKA 4C0BA 4LFBJ 2J9CA 5I42A 1RK8A 2YKPA 4IH6A 2NXJA 2WAQD 3GSIA 3HSGA 4OX6A 4DX5A 1K73T 1D0EA 4N77A 2ZBQA 2M88A 3GFYA 3WQPA 5E0OA 2J0XA 1Y5IB 1MWQA 4ZVPB 3R7NB 5BXIA 4O3QA 2KKHA 2MQQA 5CAAA 3TZWA 1F1BB 3HULA 4NXNJ 4JV0A 2XMVA 3N5FA 2ZC4A 4G65A 2WOMB 4C0OC 2K7KA 1JQGA 2JRSA 2C3UA 3CJ3A 5HVGA 5GAHI 3ZTRA 1UA0A 1H0HB 4LRBA 1U26A 3CDEA 3UD3P 2W4CA 3JAMY 3AOBA 1J2VA 3HZEA 1BD6A 4WP3A 2VDIA 5DJBA 2YWFA 3M6XA 1U2CA 1V9OA 2R4FA 3B8HA 4QWAA 2HHHJ 2HHWA 3W2VB 2FQQB 3VGSA 3T5HA 1S9GB 4Y00A 2LA6A 2N4CA 3VCDA 3UWTA 1WOPA 3EUNA 3POTA 3S7RA 3J7YI 1PAEX 2I9SA 4CO1A 1U1LA 4OI4A 4HKQA 1KVJA 2DO4A 3IM8A 3N4WA 4OJ3A 5E3PA 3FVYA
chains in the Genus database with same CATH topology
1YDLA 3DGPB 2JNJA 3DOMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDL A;  3DGP B;  2JNJ A;  3DOM B; 
#chains in the Genus database with same CATH topology
 1C1B A;  4X84 A;  4KIA A;  2KTQ A;  3RRK A;  4FYX B;  5HI7 A;  5J2Q B;  4DQR A;  2Y1I A;  1PG5 B;  1YRU A;  1R43 A;  3NGR A;  2L08 A;  3PW2 A;  5HMY A;  2LMI A;  1B0V A;  4RW9 B;  4CDI A;  4EYI B;  3P5B P;  2FJA B;  4P7T A;  2GQ2 A;  2V69 A;  3MXH P;  1SKU B;  5CYM B;  4C97 A;  1VQ8 S;  4KSE B;  3FBE A;  4N8N A;  2K1R B;  1N0V C;  2BX6 A;  1N5V A;  3FFI A;  3GR1 A;  1VLY A;  4L73 A;  3ZZR A;  1SL0 A;  1CC7 A;  2MKS A;  4QZV B;  3MFH A;  5H9E K;  2RVJ A;  4F8R A;  2M7S A;  4M8L A;  2CZ4 A;  2MKH A;  5JJB A;  1OY8 A;  1RT7 B;  2CA9 A;  3CD5 A;  4Y2K A;  3R5J B;  5D0H A;  3RRG A;  1E6Y B;  5A8R A;  1D1U A;  2WVB A;  4HLB A;  4K0K J;  2C2Z B;  4XK8 C;  1HQ2 A;  2RML A;  2B4V A;  1Q5Y A;  4AD6 A;  1SKW A;  4RUC A;  2V4R A;  3GPA A;  2FVR A;  4ICL B;  3TUZ C;  2W9B A;  1HNI B;  1Z2L A;  2YXL A;  2V8D A;  3DHW C;  4P2S A;  4URS A;  3ENW A;  4C8N A;  4DR5 J;  3ZFV A;  1S59 A;  4PEO A;  2JC0 A;  3DYA A;  4JOU A;  1PCA A;  1X4A A;  2HWH A;  3FSY A;  5E3Q A;  1SQG A;  2LQ5 A;  4DUY F;  5HP1 A;  4K0K F;  5IC6 B;  4D3G A;  5HQM A;  1TUG B;  1W7W A;  2ALY B;  3DRS B;  3J7Z T;  1S6U A;  3PO5 A;  1RT3 A;  3NKY A;  4RL1 A;  4DQQ A;  1VBK A;  3GU0 A;  1O51 A;  1AUS L;  4GO5 X;  5B0G A;  1KC8 T;  3QJJ A;  3BO4 A;  2FTR A;  2BMB A;  4ZK7 M;  2F65 A;  3Q8S B;  2W2M P;  4FKX A;  1M0S A;  5LSO A;  2PFD A;  3VAH A;  2VOO A;  2ROP A;  4EU0 A;  4CLS A;  3R5D A;  1FE4 A;  3DLE B;  3LPY A;  4OIX A;  4AQY J;  4HR2 A;  3OUY A;  3CUN A;  5KFH A;  1RDR A;  2NR0 A;  2ZE2 B;  3NOC A;  4J9Q A;  4M5I A;  1N32 J;  1SBR A;  3DCA A;  3AQO A;  4OZ2 A;  4RZR A;  4WU2 A;  2Q6B A;  1PAU B;  1RAO A;  1C4A A;  2VU5 A;  1MMN A;  5IT4 A;  3K5N A;  2HRY A;  2Z56 B;  4QOT A;  4KKO B;  3NAH A;  3KYL A;  1FHT A;  2V2K A;  3M2U A;  1ZTW A;  2DRA A;  3SXL A;  2EWH A;  4IDK B;  4XPC A;  4DSE A;  4ZIV A;  5CAB A;  3OTO F;  2QFJ A;  2RDI A;  1N34 J;  2QJ3 A;  2XGQ A;  2OIH A;  1FXL A;  3G9C A;  1LWF A;  3BBC A;  4TN2 A;  5IOL A;  5KFM A;  1V3R A;  2HS4 A;  4ZPC A;  2NPF A;  6AT1 B;  2AGO A;  4ID8 A;  2X3D A;  4XPE A;  1TL5 A;  4A47 A;  1MU2 B;  3BPS P;  4DL0 C;  2HBQ B;  1S6Q A;  4F3M A;  2K2P A;  2BQ3 A;  4OHY A;  4B3M J;  2FYX A;  2V63 A;  3LP0 B;  2LDI A;  3MR3 A;  3KK3 B;  4K4X A;  2DH7 A;  2FZC B;  3AOA A;  3FRZ A;  3V4M A;  3BO2 A;  2KDO A;  2UUB J;  3W64 A;  2E5L J;  2G2Y A;  1U4B A;  3KLV A;  3SCI E;  4NX9 A;  1KLM A;  2ZIT A;  1U1M A;  2WK4 A;  1XMO J;  1NH7 A;  1FF2 A;  2EKN A;  2HYI B;  3OVB A;  5A8K A;  2RHS B;  3PHT A;  3QFW A;  4NRT A;  4DUZ F;  4P73 A;  3IXQ A;  2VBZ A;  3M8Z A;  3V6D A;  4ED1 A;  4MIA A;  4M5M A;  4OJG A;  7FDR A;  3CMQ A;  5J2P B;  1G1X A;  5GAG U;  4FPR A;  4HTJ A;  1I94 J;  4QIV A;  1R3N A;  2B9X A;  2CKW A;  3H2V E;  1NSQ A;  3HT3 A;  3R2C J;  1SI9 A;  1X4G A;  5M2U A;  5HSP A;  5DO2 A;  2A1B A;  2VQF F;  5EX0 A;  2EBG A;  5GAE U;  1U0H A;  4OI0 A;  4GO7 X;  3EX7 B;  3QRQ A;  4JYA F;  1TL3 B;  3UI3 A;  3HP6 A;  2GMH A;  2ZHB A;  4ZLP A;  4HAC A;  3CCM S;  1JWW A;  5JVH Q;  1AA1 B;  5T7L B;  4PR6 A;  2XMA A;  3OL6 A;  2I8E A;  2YKN B;  1WOO A;  4LF8 J;  1RT2 B;  4OMF G;  2WSE C;  6FDR A;  2XY7 A;  2UVU A;  1RT7 A;  3E2E A;  3TUP A;  2A18 A;  3M6W A;  3LWM A;  4B3S F;  4CT8 A;  1NPP A;  4EMD A;  3CCJ S;  2AJ4 A;  3M30 A;  3SCJ E;  2E7W A;  2ZNZ A;  5IM0 A;  1NZA A;  1GT8 A;  2J8S A;  3D6F B;  2QO3 A;  3DKD A;  1YVF A;  4KO0 A;  5CH7 B;  3OVA A;  4ERD A;  2HSE B;  1WSR A;  2DY9 A;  2RS8 A;  2XMM A;  2E1P A;  3KXD A;  2DHH A;  2NS1 B;  5KFS A;  1HLW A;  4O4R A;  2CUY A;  2V50 A;  2MLY A;  2DIT A;  2ZWP A;  3UO0 A;  1YG0 A;  3I0R B;  3THT A;  1T3N A;  1S48 A;  1IWA A;  3CXC R;  3IP0 A;  1WKJ A;  1Y4Z B;  3FBF A;  3FGV A;  3L7P A;  4MJK A;  3NMR A;  4ZS6 A;  5KFP A;  1N48 A;  1MRO A;  4DUT A;  2CJK A;  1ZA1 B;  4CLZ A;  1ZOT A;  1N36 F;  2OEM A;  2LQ9 A;  4OYW A;  4FDF A;  2K06 A;  3CCT A;  4AXJ A;  3RUB L;  3PXG a;  1VQP S;  1NH8 A;  4K4U A;  5LXR A;  3CJ0 A;  2HQI A;  3KUG A;  1P8G A;  5MAO A;  5A2Q Y;  2AU0 A;  2N3O A;  2EVZ A;  3WIU A;  2V4Q A;  1B0P A;  3H2U B;  4F50 A;  2G9O A;  3QJL A;  4GKK J;  1R7I A;  4ZP9 A;  1U6B A;  1VFJ A;  2HVD A;  5D3G A;  3M2V A;  2HNZ B;  1IBL F;  1S77 D;  3IRX B;  1JLC A;  1D8Y A;  2QG9 B;  5AXM A;  1WI6 A;  2ZD1 A;  2B4O A;  2DGX A;  2WVF A;  3JTP A;  4KFB A;  4F4Y A;  2CZV C;  3LAN A;  3Q83 A;  1G2E A;  3D9B A;  1RWW B;  3GQC A;  3C14 B;  1M90 T;  2KO1 A;  4FVM A;  4FBU A;  4U7C A;  3CTR A;  3EZO A;  2DNM A;  2KXH A;  4ECX A;  4LIW A;  2Q66 A;  2XMW A;  4EO8 A;  1IBM J;  3UN2 A;  1S6O A;  3K5O A;  4QCL A;  2J7U A;  3QZ8 A;  5A8R B;  3IGN A;  2HHH F;  4DV6 F;  2IBK A;  2K8G A;  4F2S A;  4F67 A;  1HD0 A;  3DOM B;  3X1L B;  1VR6 A;  3T1Y F;  1H3D A;  1WEZ A;  3DLJ A;  2CYY A;  4WPA A;  2O67 A;  1NK0 A;  2AYM A;  5L39 A;  4CT9 A;  1EB0 A;  4PYD A;  4WKY A;  5K8M A;  3PEJ A;  4JI8 J;  1WWH A;  1YK9 A;  4QIW D;  3QSY B;  2HGL A;  1I6J A;  5E33 A;  3ISZ A;  4O4G A;  2IMW P;  4R5P B;  2GIQ A;  5D0G A;  3KHH A;  1KD1 T;  2JSX A;  1D9A A;  4G1Q A;  3FMB A;  4DV6 J;  3MM9 A;  2GVZ A;  2VBX A;  1ZM4 A;  3ET6 A;  2EI5 A;  1FKA F;  5F8I A;  1H73 A;  2FVS A;  1Q81 T;  5JXS A;  1CJK B;  2Z30 B;  5T14 A;  4Q0B B;  4ZPA A;  2AJ0 A;  5HQ8 A;  3H5Y A;  5F9N A;  2RIJ A;  4PAB A;  3GJR B;  3MM5 B;  3R5C A;  4UOC A;  2OGU A;  4WP8 A;  3TVY A;  1VS3 A;  1Q8L A;  1HL6 A;  4ED0 A;  1UA1 A;  1R27 B;  4V19 X;  4K5S A;  2J8A A;  5AJ3 J;  3FSX A;  4JI5 J;  2IY5 B;  1V5V A;  3B82 A;  1C2P A;  2FJD B;  1LWX A;  3VV2 B;  3MM7 A;  1E6V A;  3G96 A;  1T11 A;  3RR8 A;  1U7L A;  2PA3 A;  3ZZP A;  1JNR B;  1OWX A;  2HIY A;  2ZE2 A;  2HZC A;  4DOZ A;  3KLG B;  2K7J A;  4KH0 B;  3MED B;  4GC6 A;  4I6Y A;  4KY3 A;  4DPW A;  3K17 A;  4MMO A;  4ECZ A;  5GME A;  1V5I B;  3OL9 A;  2XI2 A;  1UZD A;  2WCX A;  3P5T L;  3OQ2 A;  4OYX A;  3UN3 A;  4AFF A;  3PX0 A;  4GVB A;  4YR2 A;  4ECR A;  1HBM B;  1WEX A;  3AHP A;  2GO9 A;  2YKN A;  4DMZ A;  2EXU A;  3GSD A;  3HDS A;  2YNF A;  5DRK A;  4F4A A;  2GJ2 A;  2CPJ A;  4O44 B;  3TZZ A;  2MKI A;  4C8Z A;  3QO9 A;  1IKX B;  2QMU B;  4DSK A;  5I3Q A;  3BQ0 A;  5GVQ A;  1JMT A;  1M5S A;  2YQ3 A;  5H9E J;  3BGU A;  1HWL A;  3HHD A;  3KUE A;  2R2S A;  2HFV A;  3I4P A;  3EYZ A;  2LQB A;  1UJ6 A;  2Z58 B;  1LEO A;  4CO5 A;  2B7C B;  1FRJ A;  2XZD B;  1WC1 A;  2W7A A;  2XG8 A;  2ILZ A;  4K4V A;  2R7Q A;  3B78 A;  1HWK A;  3LGN A;  2DPI A;  1NDL A;  5I3P A;  3B54 A;  5B09 A;  2UXC F;  2IM2 A;  2GVD B;  4O0N A;  4OZ5 A;  1L3V A;  5CQG A;  2RF2 A;  1TMM A;  2W25 A;  5D4P A;  4KGZ B;  2MQL A;  4IG0 A;  4Q8F A;  2JFK A;  3K2Y A;  1VQN S;  2Y3Y A;  4ZLL A;  4LF2 A;  5J2N A;  4I7F B;  2QA4 G;  1L3S A;  1HIY A;  2DGQ A;  3HD1 A;  4CM2 A;  1N5Y A;  5HBM B;  1UVJ A;  3SSR A;  4DR1 F;  3CGI A;  3MTJ A;  2M3D A;  2VQE J;  1CPZ A;  2HHT A;  4IR9 A;  5J2M B;  3SZ2 A;  2W7O A;  2PA8 D;  4FYY B;  4LJM A;  3THP A;  3GYN A;  1XEZ A;  3BYP A;  1RAE B;  5B08 A;  3KJF B;  1ULR A;  3Q86 A;  4NLQ A;  2HHX A;  4DV2 J;  5FDL A;  2P2C B;  4QR0 A;  1N36 J;  1S1X A;  1KBR A;  3NLC A;  2BDP A;  3BBB A;  2UV8 A;  1HNI A;  4ECV A;  1XWL A;  2M9K A;  2ZFH A;  4JI5 F;  2VOD A;  1JLA A;  2E7V A;  4DLE A;  2IRU A;  3HI9 A;  2DXE A;  2J7K A;  3MAA B;  4ZVH A;  4I0W A;  1F60 B;  4GKJ J;  4YB5 A;  2BAN A;  2LDY A;  2MGZ A;  3K8V A;  2OI2 A;  3GZ7 A;  3O5T B;  4WWS A;  4F0H A;  4BBY A;  4LFC J;  2VFV A;  2JZ5 A;  4P72 A;  1NM2 A;  1YI2 S;  4B9V A;  2HPU A;  2XTJ P;  2CPF A;  2Z57 B;  4K5R A;  5IV3 A;  3L09 A;  4TU9 A;  4WP9 A;  5C42 A;  1VIO A;  3BSO A;  4J9P A;  4LF7 F;  4OLP A;  3K5P A;  4K50 A;  3CDW A;  3EGN A;  1FTR A;  3JQK A;  4YUD A;  1DTT A;  1IKY B;  2KJV A;  4MT1 A;  1JXE A;  2DHA A;  2GMJ A;  3PM9 A;  3E51 A;  4X65 F;  4TQR A;  3Q0A A;  1Y5N B;  4FS2 A;  1HHS A;  2CZ9 A;  5I3U A;  4GKJ F;  1KKH A;  3OXG A;  2D69 A;  4OZ0 A;  2HZA A;  1VQO S;  1NUE A;  1TFY A;  3KHL A;  2UU9 F;  2R7S A;  1JNZ B;  2AEF A;  2JVR A;  2DT9 A;  2HBZ B;  2HK2 A;  2ZUG A;  3NNA A;  4CH1 A;  5E2Q A;  2BE2 A;  5F8G A;  4QU6 A;  3SSQ A;  1HPZ B;  3MTK A;  4LQ9 A;  2OAU A;  1RA7 A;  2DGW A;  2ZOM A;  2QYG A;  2BJ3 A;  1HHT P;  4MIW A;  1IUJ A;  5DLG A;  1A0O B;  3IRX A;  3CJ4 A;  3GG0 A;  5AE1 A;  3C6T A;  4IYQ A;  3TWZ A;  2IRY A;  4CO0 A;  2XWY A;  4B3S J;  2VDH A;  1X9W A;  4AQY F;  1EAR A;  2L9D A;  3HVT B;  4X64 F;  2Y1J A;  4MKB A;  4P7V A;  3MR7 A;  2VB6 A;  4WK1 A;  1H74 A;  2WB4 A;  1FD2 A;  5I4M A;  5F9L A;  1CVJ A;  1SV5 A;  2KM8 C;  2DIU A;  1TZ0 A;  4I2Q A;  2N3L A;  3PW4 A;  3PYE A;  1HBM A;  4IQM A;  2VG5 A;  4DPU A;  2E29 A;  1S79 A;  1RAC B;  1IKW B;  3DMJ B;  4H4M A;  4DN0 A;  4EZ6 A;  1RHJ B;  1UP1 A;  2HS0 A;  2JJ4 D;  2ZNY A;  2VFU A;  4B3O B;  5CYQ B;  7AT1 B;  5EDW A;  4HHU A;  1H7W A;  1WI8 A;  4ZP7 A;  1FNX H;  2JEG A;  3CC7 S;  1WOR A;  2LQ8 A;  5J1P A;  3BN4 A;  3MR5 A;  4F7V A;  3T9N A;  4DWI A;  4TXS A;  3BF4 A;  1Y9O A;  2UXD J;  1V6H A;  4WBF A;  4YR3 A;  4WXW A;  2N4D A;  3UD4 P;  1VQY A;  4LRF A;  1BWV A;  3MEG A;  4Q2M A;  5KFD A;  1SL1 A;  2MQM A;  4Z7C A;  4ZPT R;  1FNM A;  4J90 A;  3GWC A;  2DO0 A;  5ETN A;  2W2Q P;  3OTO J;  2AF6 A;  2CPY A;  2IVF B;  1D9F A;  3TW0 A;  4ZMM A;  4R5P A;  2LEB A;  4IUF A;  3QT7 A;  1GTH A;  2CPI A;  2BKN A;  3FEY B;  2GVZ B;  1ACM B;  1UWA A;  4NI2 B;  1YIJ S;  2E5L F;  2L41 A;  1YWX A;  2GO8 A;  2OLW A;  3I4H X;  4J9V A;  2YX7 A;  4TY8 B;  1S5Z A;  2YBV A;  3UN5 A;  2FHK A;  3ZZT A;  4NCG B;  2B4U A;  1TAU A;  2HQD A;  3GJQ B;  4ELV A;  5KFZ A;  2BV3 A;  4B3M F;  4C2M A;  4RW6 A;  2FHM A;  4PPD A;  1KP6 A;  3SDE A;  5KFO A;  2PEH A;  4DZD A;  3KHG A;  3GIL A;  1XTZ A;  1K47 A;  1WC5 A;  1IBC B;  1RHK B;  2FDN A;  3IBW A;  3NGK A;  2B9E A;  2ZVS A;  1M1K T;  2R7O A;  3RU0 A;  3FMW A;  2ZJQ Q;  1WHV A;  3I6P A;  4DJB A;  4ZLJ A;  2R2U A;  4O3R A;  2KVI A;  3QSI A;  1C1C A;  4OZL A;  2ZDO A;  4LSN A;  2ABY A;  5ETK A;  1FDB A;  1FXR A;  3L3C A;  2YNH A;  4ECU A;  1VRU B;  5EX3 A;  4ZIT A;  1JK9 B;  5C25 B;  2ATL A;  1F9E B;  2OJ3 A;  3FBC A;  3BH6 B;  3DI6 B;  1NND A;  3V6H A;  1KQF B;  4TLQ A;  2YH0 A;  1JLA B;  2V0N A;  3NS7 B;  3BPD A;  3AJ1 A;  4OYM A;  4I2P B;  2YNF B;  4JI0 F;  4X62 J;  4DR3 J;  3RB4 A;  3JTO A;  3S8S A;  3DN9 A;  2BM1 A;  3W8G A;  1NJI T;  1P27 B;  1GXL A;  3MPD A;  1NAQ A;  3VQS A;  2EFG A;  1YBT A;  1X4B A;  4J9K A;  1GX6 A;  1KLN A;  5THW A;  2A6O A;  4RW4 A;  1DTQ A;  3LW5 C;  5K20 B;  4UUX A;  4EWT A;  1D3W A;  1WC4 A;  4A8Q A;  1N0U A;  3K89 A;  2E66 A;  3DLK B;  2W9C B;  1Q7Y T;  3MUT P;  1SJ3 P;  3U27 A;  4CYU A;  1RQ0 A;  2DRD A;  2NYH A;  2CAJ A;  4UF4 A;  1XK8 A;  2H1Y A;  2E44 A;  5DZ7 A;  4CH0 S;  5K14 B;  3BQ2 A;  3AA9 A;  2FPH X;  4MTP A;  3QGI A;  1NKC A;  3VGU A;  3IBC B;  1VBY A;  4X66 F;  2PO4 A;  2O3D A;  3MUV P;  9RUB A;  4CLF A;  1NJZ A;  2WZ1 A;  3TO8 A;  4KFB B;  4M1K A;  3PX4 A;  1T9Y A;  2QZ8 A;  4WFN Q;  5E5N A;  3R27 A;  3VGT A;  2HBR B;  5KFW A;  1NHV A;  4X4O A;  4QJV A;  3HHL D;  3I9Z A;  5LXY A;  4DR6 F;  4DL6 A;  3PCO B;  1GX5 A;  4NA2 A;  2CQ3 A;  3VQT A;  1R8H A;  3SQG B;  3BGR B;  3T9Z A;  2FY1 A;  1FWK A;  1OY6 A;  1VCT A;  3HVW A;  2ADB A;  4IRC A;  3GE9 A;  3HD2 A;  3MPY A;  1JLQ A;  1N5T A;  1K44 A;  4R8U A;  1RAF B;  4U95 A;  1H2U X;  4DSF A;  2BR0 A;  4OX9 F;  2ZOG A;  1PYT A;  3LO3 A;  1OY9 A;  3Q22 A;  4DV1 J;  2F1F A;  4PWW A;  3G6Y A;  1TV6 A;  1H7X A;  2YNG A;  2WTF A;  5GAD U;  3CB4 A;  3G8S A;  4IRD A;  4I2Q B;  3OSP A;  2C2N A;  4CH7 A;  1V3Z A;  4DV1 F;  4OX9 J;  3DRY A;  4YEA A;  5LSR A;  3MCN A;  2ZH1 A;  4ZA1 A;  3FKB A;  4NLV A;  5B0C A;  1T05 A;  4E0D A;  4J5O A;  3AJ2 A;  3ZZ0 A;  3DOL B;  1RBL A;  2RB7 A;  3PKM A;  1RWX B;  5DZ6 A;  4GMK A;  1VIS A;  3PW5 A;  1TKD A;  3KHR A;  4LF6 J;  1UFL A;  2H54 B;  2HUR A;  4O3S A;  1FJG F;  4GRS A;  2LA4 A;  2RD5 C;  4NPO A;  2GIF A;  4J9R A;  2B8Q A;  3PTW A;  2F7V A;  2UUA F;  1O6X A;  2EK1 A;  2B0G A;  2V34 A;  2W4D A;  4I6A A;  2Y1R I;  1X0F A;  2FC9 A;  4NLW A;  2DGO A;  2AGQ A;  2DNQ A;  1PC4 A;  2DR9 A;  2EFO A;  1AFJ A;  1ZET A;  2MQP A;  1WF0 A;  2LLZ A;  3F56 A;  5MLC V;  3MMA A;  1KFD A;  2GQC A;  1L3T A;  2ROG A;  1S6P A;  4OYA A;  1HMV B;  2CJB A;  2IIH A;  2VIH A;  4YY3 J;  3W3S A;  3H8Y A;  1AT1 B;  5J1E B;  2XQC A;  1KOO A;  3IA0 A;  1QUP A;  5HVF A;  5I3U B;  4NYZ A;  1J5O B;  3MZI A;  5CZX A;  4EK2 A;  2D3Z A;  2OPP A;  3KLF B;  4NML A;  4OYO A;  1BQM A;  3EDQ B;  1X4F A;  3MGJ A;  4JI6 F;  1TL7 B;  4YN3 B;  3IGV A;  2AHO B;  1UEU A;  2ZUA A;  3DM2 B;  3DOK B;  1VK8 A;  2CQ0 A;  3CJS A;  3JTN A;  3SDE B;  4ZCM A;  4TQS A;  1U45 A;  2A2C A;  5IZH A;  2KHC A;  3SV4 A;  1GFW B;  2ASL A;  4NLP A;  4PG7 A;  4M95 A;  1UFK A;  1Y11 A;  5CYM A;  4J9L A;  5KG2 A;  1IR1 A;  2RKI B;  2BJ8 A;  1HI0 P;  2P9C A;  2HAI A;  1BMQ B;  1FDN A;  4C8K A;  2I5J A;  1NDC A;  2DEI A;  3I87 A;  2CG4 A;  5C25 A;  1KVI A;  3LUY A;  1HNZ J;  1RTI B;  2QFI A;  2RIL A;  3C6U B;  2QLB B;  2C42 A;  3DI6 A;  3TJA A;  3CCS S;  4FN5 A;  5KG0 A;  1RKJ A;  2FGC A;  4NCB A;  1F3F A;  3CSK A;  3UDE A;  1JKH B;  2D3O 1;  2ZKT A;  3IAM 9;  3DMJ A;  3PHE A;  4ENO A;  3OFE A;  1R8A A;  1KSP A;  3L7U A;  3MM8 A;  4QR1 A;  1EP4 A;  2NXE A;  4OI3 A;  1ZZN A;  4B3O A;  2O66 A;  2MB0 B;  1F0X A;  4DBQ A;  3MUR P;  1JJC B;  3Q24 A;  4J9S A;  1D9D A;  5CYJ A;  2UUB F;  4ZPV R;  3DLG B;  4EZ9 A;  1QUV A;  1S9G A;  2V5H G;  3A3O B;  1B64 A;  4I7F A;  2HRU A;  3W62 A;  2IBO A;  3J80 Y;  4DCJ B;  4KPC A;  2KG1 A;  3M8S A;  4DQS A;  3PW7 A;  1HYS A;  4BWM A;  5AXK A;  2I0X A;  2LEC A;  5E3A A;  1CC8 A;  2IJF A;  3D6T B;  3PRV A;  4PG5 A;  2D3O R;  2JOQ A;  3M8P B;  2LKZ A;  3MMJ A;  5EWG A;  1Q16 B;  3BDE A;  3J80 U;  1F9H A;  2CWK A;  2IPO B;  4DV3 J;  4P6Q A;  3BYR A;  4FF4 A;  2GHW A;  3CD0 A;  2BZ2 A;  3HSZ A;  4L3K A;  2XLJ A;  3GIR A;  5G0R B;  4LR9 A;  2Y0B B;  1RCO B;  4X4Q A;  1T8E A;  2J9D A;  4FYW B;  1PJ5 A;  5KG6 A;  4OV1 A;  5IT0 A;  2VFT A;  5HAN A;  2MLX A;  2XS5 A;  3E8O A;  3C15 B;  1LWC A;  1SH3 A;  4RW8 B;  2MZ1 A;  4B9U A;  4B02 A;  1VQK S;  3NXZ A;  1R6V A;  1RWK B;  4U9R A;  2HVE A;  2MGZ B;  1N32 F;  2C2R A;  5JUM A;  1U0S A;  4UST A;  1REG X;  2MQO A;  1RUS A;  5HRO B;  1FJ7 A;  2C2M B;  1BXN A;  3CF5 Q;  1WSV A;  4DSI A;  1FKP B;  2RQK A;  1R0A A;  1HBU B;  2KYZ A;  3LA0 A;  5KFT A;  3ZZY A;  2C3Y A;  2WRM A;  5C42 B;  5L1J A;  2W8K A;  4J9O A;  3TEH B;  4LSL A;  2XZW A;  3FNN A;  1EAY C;  2WOM A;  2JC1 A;  3R9L A;  3T3F A;  4CTA A;  2AYE A;  2HHP A;  1URR A;  2V2Q A;  3GON A;  5K8P A;  4NLX A;  3QPI A;  5KFV A;  3M8W A;  4NEY A;  2HWT A;  5IWA J;  2APO A;  3OD2 A;  3OT9 A;  3AOD A;  3BRE A;  2QSF A;  4DR7 F;  4P2X A;  3PX6 A;  2V8G A;  3F73 A;  1T3O A;  2FGO A;  1WD6 A;  3CNQ P;  3V2U C;  5IWA F;  4CP5 A;  3MEE B;  1N4L A;  3R1L A;  4EEY A;  1MN9 A;  1WAC A;  2CQ2 A;  2GHP A;  2KJW A;  1URN A;  3ILI A;  3CCQ S;  2JLG A;  3TZX A;  3VGV A;  3QZ7 A;  3HHK A;  4DR4 F;  5KT6 A;  3J7A N;  2FZK B;  3D2W A;  2FJE B;  5A0Y B;  1JJ4 A;  3I0S A;  2HEK A;  3DLE A;  2FJV A;  2JEI A;  3GCX P;  1QSS A;  4ETX A;  4NXM F;  3QT8 A;  4LMZ A;  1A7G E;  1TKZ B;  2NUH A;  2J0Q D;  3G71 S;  3G2X A;  3J81 U;  3CIM A;  1UFW A;  3IRW P;  3FCW A;  4YR0 A;  1ZBT A;  3HFK A;  4ANE A;  3AY0 A;  1TMJ A;  4OL8 A;  1Z1Z A;  4OI2 A;  1F9F A;  3SFU A;  3N28 A;  1DBD A;  1KR4 A;  1FJC A;  4KT0 C;  4OYB A;  3PY8 A;  1LWF B;  2OPQ B;  3OLA A;  1Q82 T;  2A10 A;  3D6H B;  2BAC A;  3HKZ D;  3LP2 B;  5DDO C;  2IYI A;  5L1K A;  3B4D A;  1XR7 A;  2OEK A;  3ISN D;  1TK8 A;  3MMB A;  1K8A T;  3HHE A;  2KI2 A;  3CIZ A;  3IMQ J;  4USV A;  3JYT A;  1APS A;  1KRP A;  3X3U A;  3W63 A;  5DGB A;  1PSD A;  1ICE B;  4IQX A;  2LXU A;  2R7X A;  3VAJ A;  1WJ9 A;  1UEV A;  2KHD A;  5EHH A;  1T9U A;  3K5L A;  2FJB B;  2ZM6 F;  3VZH A;  4M5D A;  4TNO A;  2F63 A;  1MML A;  1U1Q A;  1NHK L;  1SC4 B;  2B5J B;  2DYA A;  1T05 B;  3BGO P;  2BQR A;  4LRC A;  4HHJ A;  3WBZ A;  1F3V A;  3BEG B;  3ZZU A;  2FLL A;  4F02 A;  1JLG A;  2HFN A;  5HAT A;  2G1D A;  3DLG A;  3Q23 A;  4LFC F;  2B6A B;  1LNQ A;  1UW4 A;  4P10 A;  3U7J A;  4DR4 J;  3H5U A;  3HFV A;  3NP5 A;  2CAD A;  3M8R A;  4K4T A;  2H48 B;  5IQQ A;  3SCK E;  4X64 J;  5U47 A;  3R7S B;  3OJS A;  5J2P A;  1ZTT A;  2HHQ A;  1Y10 A;  4DS5 A;  1HBO B;  3W1Y C;  3A3P B;  4C11 A;  3MMA B;  2UVV A;  1TTH B;  3MOJ B;  3RW7 A;  2ILY A;  3EMT A;  4DR6 J;  2MDA A;  1C1C B;  2BW7 A;  3M1V A;  4KQZ A;  4EUV A;  2DHS A;  4USM A;  2BQU A;  2NLW A;  3NG8 A;  4CNY A;  3QAE A;  3HZG A;  1CS4 B;  5KFR A;  3D7S B;  2E1A A;  2GJF A;  3NNH A;  1TL7 A;  3VAI A;  2UU9 J;  4PXE A;  3MD3 A;  3CJQ A;  1GMW D;  1ZM9 A;  3T5L A;  1RWN B;  4QYZ J;  4UT4 A;  4LRA A;  1SJF A;  1U8W A;  2C22 A;  5G4D A;  4CRJ A;  1LK5 A;  2CPD A;  2VHG A;  1IVZ A;  2RRA A;  2XBP A;  1FT8 A;  6FD1 A;  1UVI A;  2MKK A;  4QPX A;  1FRX A;  4BCA A;  1DTQ B;  1FES A;  2YQ0 A;  3KLH B;  1UAW A;  1MU2 A;  3K7R A;  1BC6 A;  5DET A;  1S6Q B;  1X4D A;  2IJN A;  2KRR A;  1HBN B;  3AD9 C;  1S1V A;  2C2D A;  4JI4 J;  1MG7 A;  1RWO B;  2DR8 A;  3G8T A;  2HMI B;  2VL1 A;  1JXV A;  4JI7 J;  4JI2 F;  4C3L A;  3I31 A;  5B7W A;  2MY8 A;  2HG4 A;  1NEE A;  5KFB A;  2OO4 A;  1X4H A;  1TUV A;  2OP5 A;  2BOP A;  3RZA A;  4B08 A;  3ADA C;  4TYB A;  3QT5 A;  2FLN A;  3PEH A;  3GV5 B;  1X7V A;  3TA2 A;  4F26 A;  4F3O A;  2B8P A;  4B9S A;  4ATN A;  4OZJ A;  1KOH A;  3VZI A;  4B9M A;  4RNH A;  5RUB A;  1YJ7 A;  3MM9 B;  2Q1L A;  3SEO A;  4WXO A;  2CNK B;  4K4Z A;  4MFB B;  3SCL E;  5D3G B;  3SQG A;  4FS1 A;  3M2V B;  4FBT A;  1QSY A;  2F9D A;  2VZ9 A;  1JLC B;  3LGH A;  1JLQ B;  2DXD A;  3G82 B;  2VQE F;  4ID5 A;  2D3U A;  3OR1 B;  4DR1 J;  4JI0 J;  1QLN A;  4QYZ K;  4A8X A;  1RYR A;  5HMZ A;  4HH0 A;  5HAO A;  1TV6 B;  2L48 A;  2YNG B;  1MWZ A;  1HAR A;  1YBU A;  3MM7 B;  4M5G A;  1OIA A;  2CQ4 A;  3DFE A;  5IT9 Y;  3QGG A;  4E98 A;  2AT1 B;  3E01 A;  3ZXW A;  1LKZ A;  2C3M A;  3JXO A;  4J9U E;  4ZLN A;  3VAK A;  1JJ2 R;  1SKS A;  1NPR A;  3CW2 C;  1FNO A;  4NLY A;  3ILL A;  4USW A;  4QIG A;  5A8W A;  5DG9 A;  1VBZ A;  3UNG C;  1AUD A;  4ZJL A;  3WZ0 A;  5HP1 B;  1VQM S;  1EIY B;  1HI8 A;  3FRY A;  3KK2 B;  1BY9 A;  2OPQ A;  1FKO B;  3JQJ A;  1RT3 B;  1AB8 A;  2UXD F;  1Y3K A;  4JI4 F;  3QIP B;  1SC3 B;  3D4J A;  1YHQ S;  4KO0 B;  4O44 A;  3HHL C;  4PWU A;  4F2R A;  2PMZ D;  4U96 A;  1Q1K A;  4FYV B;  2HLT A;  3RG6 A;  1G6B A;  3DHX A;  4CLP A;  2IMO A;  3D1O A;  3IWL A;  2ZHO A;  2AD9 A;  2FJX A;  2LU1 A;  4K4W A;  4UQT A;  2YH1 A;  2DPJ A;  2LU2 A;  4ED3 A;  5F0U A;  4Y0F A;  3M7V A;  5FLX Y;  4FNH A;  4F04 B;  1U2R A;  4DXL A;  4NEZ A;  1FI4 A;  2HLU A;  1J5O A;  1F5B A;  4PG6 A;  3D0I E;  3GFZ A;  2R7U A;  2DNR A;  3UW1 A;  3RAM A;  5D6G A;  2R7W A;  4YHH J;  1RLC L;  2VJU A;  1NK5 A;  1QD1 A;  1TL4 A;  2DH8 A;  2QGF B;  1HNV A;  2AZ3 A;  3I5A A;  3M6U A;  1QTN B;  3MEE A;  3O6Q A;  4HVZ A;  3O3L A;  3U1L A;  4CCH A;  1S4F A;  3MM5 A;  4NZ6 A;  4C3M A;  4YDD B;  3Q8U A;  2J9D E;  3AFG A;  1FRK A;  3D5M A;  4IDK A;  4DV7 J;  3T6J A;  1HBO A;  1DFD A;  4KH1 B;  5DM6 Q;  1NSA A;  2F4F A;  2RKI A;  4NAS A;  2OPR A;  4A8K A;  4PWD A;  4DUZ J;  3M8Q B;  4YHH F;  3MCO A;  4ZVQ B;  3G4S S;  2KYX A;  4DV4 F;  3AXK A;  4NWB A;  1XER A;  2WHO A;  2CQ1 A;  2BA9 A;  3BR9 A;  1VQS A;  4RW7 A;  3SBM A;  4LF4 J;  4X65 J;  4GVB B;  1GNK A;  2ASY A;  4YOE A;  5GAD I;  3OFH A;  4ZVF A;  2HVI A;  3EPG A;  3KFW X;  1EP4 B;  2W01 A;  3A8K A;  4RWX A;  4DV0 J;  1X5O A;  4H4O B;  2EFP A;  1HFE L;  2XCA A;  5BYR A;  1ZM3 A;  1WF1 A;  1Q79 A;  4LF8 F;  3MPW A;  3HHL B;  2ASJ A;  5E3C A;  3Q8P B;  1ZS6 A;  4N41 A;  1PC5 A;  1YJR A;  3MCS A;  2MZJ A;  4X4R A;  5KT5 A;  3T1Y J;  1T94 A;  1Q86 T;  4ZVO B;  2AEM A;  2GS8 A;  2NPI A;  3EXY A;  4M5D B;  2NCK L;  4AT1 B;  1M5K C;  3KG0 A;  3NRB A;  4WE1 A;  4RUA A;  4X2B A;  5KFN A;  1I51 B;  4DSJ A;  1IKV B;  2NYI A;  3K58 A;  1WC0 A;  1OQ6 A;  2RQ4 A;  2QA2 A;  1XNR J;  2VD3 A;  1AW0 A;  3D0G E;  1KNZ A;  3W2W B;  3GYG A;  4P71 A;  5A76 A;  4IOA Q;  2O1P A;  2LEP A;  1GQE A;  2MZR A;  1N5Y B;  2QLW A;  3KKF A;  4IG3 A;  4DF8 A;  4NLD A;  3TA1 A;  2HHU A;  1NJX A;  1RB0 A;  4MFB A;  4NXM J;  5FD1 A;  2P6T A;  5J2M A;  1R0A B;  2BE7 D;  4NZ7 A;  5ETM A;  2W9A A;  1E6V B;  4F0M A;  2GHV C;  2VG6 B;  3ETM A;  3PO4 A;  2MY7 A;  3DRX A;  3CCU S;  2K3I A;  5EWE A;  4YQW A;  1DHM A;  2YTC A;  4IFY B;  3ILO A;  2C3O A;  3HCX A;  4WYW A;  5K9F A;  1I94 F;  3PYG A;  2RU3 A;  1TKT B;  3I0R A;  3BN7 A;  4ELU A;  2R7T A;  1R8P A;  2FB0 A;  2QIF A;  3T5J A;  2FVC A;  3ZZO A;  2H5E A;  4OLO A;  2W2O P;  2GFF A;  2XCP A;  3CD6 S;  1VRT B;  4NOH A;  3SMZ A;  1WOS A;  2NZ4 A;  3KLH A;  4RKU C;  3OVS A;  2H4W B;  2HQG A;  1N52 B;  2BAB A;  4QR2 A;  1TL1 B;  4WFZ A;  4DX8 H;  1NK8 A;  1JX4 A;  4ILR A;  3HSD A;  1XQI A;  4DHV A;  3BQ1 A;  1AYE A;  2EPI A;  2CQB A;  4QWB A;  3GB0 A;  4DX6 A;  2AEJ A;  4USJ C;  4DV0 F;  2GW8 A;  1UET A;  4PQU A;  5KT7 A;  4OHX A;  2DNP A;  4GC7 A;  4UZB A;  4XTT A;  1NK4 A;  1RAB B;  2OH2 A;  4YY3 F;  1NME B;  4RLE A;  5LMN F;  5L1I A;  1QSL A;  1MN7 A;  1U1P A;  2BVZ A;  4E2F B;  1DJ0 A;  2RF2 B;  4F36 A;  1U47 A;  2X1A A;  1KVK A;  2OUG A;  4IG0 B;  1YGY A;  1B4S A;  4MKA A;  4FVC A;  3WHI A;  4NI2 A;  3I9V 9;  4Y2A A;  3J7Y U;  1B7F A;  4CNZ A;  2R2R A;  3SFG A;  2SXL A;  5L8R C;  4QWE A;  4C48 A;  4PKD B;  1REV A;  4XAK A;  2L9N A;  1VC5 A;  1G4C A;  2OPR B;  2VC1 A;  4QWC A;  4PWD B;  1SH0 A;  4R25 A;  3OR1 A;  4NE9 C;  2YNI A;  4DR2 F;  4O0I A;  1FRM A;  4Y2I A;  2Y8W A;  4GKK F;  1XR5 A;  2EG2 A;  3NY0 A;  5C24 B;  4UOH A;  1HWU A;  4ECW A;  4Q8E A;  3THV A;  3BKF A;  2RUG A;  1EX8 A;  5FII A;  4O4G B;  5B0D A;  4ZDN A;  2B5J A;  1Y7P A;  5HO4 A;  4WCE Q;  1Y3J A;  3VAM A;  2CJ9 A;  4JV5 F;  1K1S A;  3QFH A;  3EVW A;  3EGZ A;  4RUH A;  1M5H A;  4L3N A;  2EFV A;  3JSB A;  5ITH A;  2RT3 A;  1KDN A;  5C2G A;  4A8O A;  4JI1 F;  2VBY A;  4DEZ A;  4QU7 A;  4B3T F;  3SSS A;  5A8W B;  1ROF A;  4WK3 A;  4FP9 A;  1DQ8 A;  2G1H A;  3DC2 A;  4LF1 A;  4ZHR A;  2P5V A;  4Y6I A;  4BS2 A;  1W25 A;  3J7Z 5;  3MEG B;  1WG4 A;  2GC8 A;  1UCN A;  2VKZ G;  1RCX B;  2WVE A;  3Q89 A;  4LFB F;  4WF9 Q;  1NPK A;  4HT5 A;  5DGA A;  3UVJ A;  4WE1 B;  3HF5 A;  3DLK A;  2W9C A;  4W90 B;  4K59 A;  2PD1 A;  1UMJ A;  5L1L A;  4Y34 A;  4EO6 A;  2BUN A;  1CJT B;  3D3C J;  2IVM A;  3CCW A;  2HIQ A;  4N7T A;  4U8Y A;  2HVH A;  4XO0 A;  3FZ2 A;  3Q2S C;  2FUG 9;  3N5B A;  1F6T A;  2BJE A;  2JLE A;  4RJV A;  4N5S A;  2HWI A;  2IA0 A;  1TVR A;  2WON B;  2Y1L B;  3HPO A;  2DNK A;  4PYA A;  2DIV A;  4OV6 A;  2OPS B;  3HFZ B;  4C8O A;  3A8E A;  3AD7 C;  2AX1 A;  4RR5 A;  3KLE A;  4X4V A;  3QO9 B;  4FPI A;  1OO0 B;  1OSC A;  3MMC B;  3UNY A;  4B17 A;  5H1S V;  4YB6 A;  3AD8 C;  3SIP B;  3HXM A;  3ITH B;  4DR2 J;  2KB2 A;  1PGZ A;  3R5G A;  4PG8 A;  1Q8K A;  3K57 A;  3M8Q A;  4ED5 A;  2VG7 A;  3ZNJ 1;  4OJ1 A;  1SIZ A;  1VRU A;  3M4X A;  1U2F A;  3VVT A;  3OJU A;  1HWJ A;  1BQN A;  3BGR A;  2DNO A;  1RHR B;  1YLX A;  3HT0 A;  4ZKA A;  1EJ7 L;  4DL3 A;  4Q7A A;  4AUK A;  3QGH A;  3HVR A;  2MKC A;  4U7U D;  2O5D A;  4HI1 A;  3RW6 A;  3FEZ A;  5IT9 U;  1UTA A;  2KRB A;  4KHP F;  2VV5 A;  2W24 A;  3BM7 A;  4C98 A;  1UWB A;  4LIR A;  4K2X A;  1C0T B;  3GV7 B;  2R9L A;  1IBL J;  3IWN C;  1NO8 A;  3BR8 A;  1LOU A;  4H4K C;  1BQX A;  4BC7 A;  4DL5 A;  2BJ9 A;  1Q4R A;  3KJV B;  4NLS A;  3UQS A;  5HBM A;  2P6S A;  3VVU A;  1C0U A;  1YJN S;  4CYU B;  5KT4 A;  1NB7 A;  3BH7 B;  3GG1 A;  5DS7 A;  3PKY A;  2XS7 A;  4PQU B;  2HK3 A;  3C2P A;  3OBI A;  2BE9 B;  4ZPB A;  1D8Z A;  2GIR A;  2KT5 A;  5LL6 d;  4ES3 A;  4DPY A;  2MQ8 A;  2QN6 B;  3W2W A;  2PGC A;  5FDL B;  4TY8 A;  1Q0N A;  2K3K A;  1RGV A;  2CQI A;  1AZS B;  1LXN A;  3MAH A;  4LVO P;  4MK8 A;  3VR1 A;  2QLJ B;  3I82 A;  1O8B A;  3M6V A;  5KG7 A;  4DV3 F;  2P9G A;  3QGP A;  1TU0 B;  3U1M A;  4UTG A;  2RRN A;  5KFQ A;  4WTO B;  1I3O B;  4B9L A;  3VWS A;  1TP7 A;  2HBY B;  3TAQ A;  2JX2 A;  2W2P P;  2XSJ B;  2QRR A;  1N56 A;  1U02 A;  2NSC A;  1G3O A;  2DNH A;  1FTC A;  1RHQ B;  1U1K A;  4BWJ A;  2XMJ A;  1FVQ A;  2E1M C;  2RNE A;  3A13 A;  3M2U B;  1QDU B;  4TU7 A;  4JV1 A;  2OMO A;  4IFY A;  1H2V Z;  2C2O B;  2QMW A;  2WSF C;  3L7O A;  2AJ2 A;  3W8P A;  2EC0 A;  1WDD A;  3M32 B;  3PNI A;  3PDN A;  5KAK A;  5LMN J;  1FEE A;  1L5U A;  4ELT A;  3P96 A;  4M5J A;  1UJ5 A;  1FD8 A;  4USH A;  1SJQ A;  1DQ9 A;  1R6Y A;  1SKR A;  3RB0 A;  3G86 A;  2R2T A;  3U1N A;  3PV8 A;  1RU2 A;  4KGX B;  3H5X A;  3IM9 A;  4C0H A;  3OW2 R;  2NUU G;  1L3K A;  1YRX A;  5DLF A;  1QVG R;  2WVC A;  1XNR F;  3NBP B;  5KG3 A;  3PYD A;  1EET B;  1CG2 A;  4PG4 A;  1IR2 A;  5AXN A;  4IKA A;  4NXN F;  2I1R A;  3TEG A;  3W9J A;  2QX0 A;  1Q7L B;  3C46 A;  3TAN A;  1T9V A;  1TKX A;  4EBD A;  2CNN B;  4Q43 A;  3KJN B;  5A6P A;  5CZV A;  1FX2 A;  1U8S A;  3TVK A;  3FCV A;  5K14 A;  1LW0 A;  3OR2 B;  4ECQ A;  3OTD A;  2DR6 A;  3KLI B;  5KT3 A;  3V6J A;  2ZH9 A;  3PAC A;  2ROE A;  4M5L A;  5F8N A;  2AJQ A;  3P6Y C;  1K9M T;  4X66 J;  4QBU A;  2AZ1 A;  2BJ1 A;  2XO6 A;  4DS4 A;  3KLF A;  3KK1 A;  2YPZ A;  3NGD A;  4DFJ A;  4JI1 J;  4RW7 B;  1TVR B;  2WON A;  3D67 A;  1FFS B;  4RU9 A;  2IFX A;  5ETS A;  3EJM A;  4B9T A;  1VQ6 S;  2F40 A;  2JLF A;  3QID A;  2YKO A;  1NDK A;  2KU7 A;  4C8Y A;  3H59 A;  3EGW B;  4ER8 A;  2AGP A;  3RBZ A;  4M5N A;  2KT2 A;  3MR6 A;  1QY7 A;  2POK A;  3KG4 A;  4DG1 B;  2V2Z A;  3C15 A;  5SZT A;  1UW9 A;  2IYG A;  2F3J A;  1RT1 A;  2OFG X;  4W98 A;  8ATC B;  2F8H A;  3TI0 A;  4G3I A;  2ALZ A;  3ELH A;  2MZS A;  3C6U A;  5ETO A;  1HD1 A;  2DRB A;  2FZG B;  1WUU A;  2RHQ B;  2GV1 A;  2MMY A;  5KG1 A;  4F3Q A;  1T03 A;  3BSN A;  1DY3 A;  3AB4 B;  3LTO A;  3D66 A;  3AA8 A;  4Q45 A;  5KG4 A;  4GVL A;  1FKP A;  2OSQ A;  4WKR A;  2QMX A;  1YQH A;  1TAQ A;  1WEY A;  3EVO A;  5F3T A;  2HND A;  1SUQ B;  5GMD A;  1KLM B;  3IR6 B;  4FZV A;  3A4T A;  4ES2 A;  3V6K A;  4CTA B;  2VF3 A;  3VF0 B;  1UKU A;  3DU6 A;  1SC1 B;  4RW6 B;  2XYP B;  2IAJ A;  3CCR S;  3O1L A;  1LQ9 A;  4A8S A;  1HQE A;  4IG3 B;  2VPW B;  3RR7 A;  1UJ4 A;  2GJI A;  2ZBP A;  1PYS B;  5DM7 Q;  1B99 A;  4Z37 A;  1CLF A;  3J81 j;  1KON A;  2AV5 A;  1A6L A;  1HMV A;  1X5P A;  1Z4U A;  2JNJ A;  5ETR A;  2R8K A;  2MKY A;  1MMD A;  2XUL A;  5KFA A;  2PC6 A;  3QWU A;  4PXB A;  4ZP8 A;  3G6E S;  1SJ4 P;  2VON A;  4ED4 A;  1OPZ A;  2FC8 A;  5LMU J;  1U0H B;  4C9D A;  5J1N A;  4IO9 Q;  5G0R A;  2PII A;  1J5E F;  2BRL A;  1HR0 F;  3OTE A;  1AZS A;  1R0C B;  1X9S A;  3UPF A;  3JSM A;  1NJW A;  1LW2 B;  1T95 A;  5CCM A;  3DGP B;  3M2R B;  2XHW A;  2QL9 B;  4LF5 J;  3QNW B;  1RT5 B;  4H4K A;  4CLY A;  1FCA A;  1R8B A;  1M5O C;  3G8Q A;  2RQC A;  3US5 A;  2DVI A;  4OHW A;  5ETQ A;  2EKY A;  5L46 A;  4OQJ A;  1XC9 A;  5AXL A;  1VMB A;  4RW4 B;  4OYP A;  1GXU A;  3TJ9 A;  5HRO A;  3SV3 A;  3MWB A;  4HDG A;  2BEF A;  3VHQ A;  4O3P A;  1EQM A;  3M32 A;  1YBA A;  5F8L A;  2W1B A;  2MLZ A;  2M5Y A;  2XEX A;  2UXB F;  1W26 A;  1FRL A;  3NWR A;  4L74 A;  4WII A;  3ZC4 A;  1NSK L;  3MM8 B;  4CLW A;  4ETZ A;  3Q8V A;  4UW2 A;  3T5K A;  2DGS A;  2X51 A;  4I56 A;  2XMT A;  4F4X A;  1RJJ A;  3PFE A;  3E3X A;  2YKQ A;  4KBI A;  1VQ5 S;  2PI5 A;  2GAG C;  2Q3P A;  4OYI A;  3TP2 A;  4CLL A;  4DL4 A;  1NZ8 A;  1Q5V A;  1N54 B;  2GGP B;  1WNE A;  4G1P A;  1NK6 A;  2R8H A;  3LOU A;  1U6Z A;  1RTD B;  1HWI A;  2BOA A;  1LXJ A;  3MPU B;  4G1Q B;  3T41 A;  1ZM2 A;  3UDL A;  1YZ6 A;  3D6M B;  4FYD A;  3ZO7 A;  1RKI A;  1RTH B;  1G7C B;  3GLJ A;  3N6N A;  4LR8 A;  1QM9 A;  1UL3 A;  3EIC A;  3H40 A;  2H3E B;  2B6A A;  2NRE A;  3TAP A;  3J7A 1;  5A6W A;  2ZBI A;  3LF0 A;  3NOG A;  3EE3 A;  3WX4 A;  2JEF A;  1CEZ A;  4DFM A;  2WBM A;  2ZZN A;  3HK2 A;  1TKZ A;  1UZH A;  1RSC A;  1WG5 A;  2CRL A;  3DDK A;  3R97 A;  1YJT A;  1LV5 A;  4HHH A;  3RTV A;  4M94 A;  4JBC A;  4LFA F;  1HW9 A;  1UVK A;  4IR1 A;  4I4B A;  3RAQ A;  2KFY A;  1LWC B;  2J76 E;  4RW8 A;  4ZJO A;  5KFY A;  3CME S;  2XC9 A;  3L4B C;  3T1A A;  3ENQ A;  1X9M A;  4QW9 A;  4DG1 A;  4WFB Q;  2Z2Z A;  1U24 A;  3DOM A;  4KHP J;  3L9Z A;  1S4E A;  2E5G A;  2ZH4 A;  1F2G A;  3IS9 B;  3R6G B;  1HQU A;  1KHW A;  4ZVE A;  2PE8 A;  3BGF A;  4OX8 A;  5I42 B;  1X4C A;  2W7P A;  4KV8 A;  4J9N A;  1S1U B;  4KB7 A;  1DAX A;  1Q78 A;  1R0B G;  2NZC A;  3QWP A;  2QA4 S;  4RPF A;  3KDO A;  4EYH B;  3AJD A;  3KNG A;  3TNV A;  5DDP C;  5F0W A;  1U1N A;  3CJ8 A;  2WVD A;  3OLB A;  3I56 S;  2E1C A;  4B3R J;  3BV8 A;  3LP1 B;  3LWL A;  4ECT A;  1JLG B;  4YME A;  1AFI A;  3NBP A;  4PAA A;  3EGV A;  4XIU A;  1YJV A;  4HEA 9;  1PBA A;  4NYP A;  2MQN A;  3H98 A;  2OFH X;  2ZH2 A;  1VC6 A;  2GVD A;  2XZT B;  1CUL A;  3H2L A;  4M5K A;  2BXJ A;  1RAI B;  2VAS A;  2VIC A;  1EQ0 A;  1TKX B;  2OML A;  4FXW A;  3W66 A;  3KLE B;  2LVW A;  2IM3 A;  5KFG A;  4ZJQ A;  4I6W A;  1QJH A;  3DXS X;  3H7H B;  5KFI A;  2C2K B;  3R5A A;  1VQ9 S;  3ZTS A;  1FER A;  4JI3 F;  5H9F J;  2Q43 A;  5LJ5 Y;  4X4N A;  2JHE A;  2Z4P A;  1EZZ B;  1S0O A;  2V68 A;  1HW8 A;  3RGI A;  2I5J B;  5LT5 A;  3BZQ A;  4DCO B;  3D54 A;  1OPI A;  1JB0 C;  3N0V A;  4ZP6 A;  4KE5 A;  4P2F A;  3HMJ G;  3C16 B;  2KXN B;  1RHU B;  3DLB A;  2PEB A;  1T9W A;  3OFG A;  4OI1 A;  5HMW A;  2I38 A;  2QYC A;  3KWM A;  2M4M A;  1LW2 A;  5HK4 A;  3HM9 A;  2RS2 A;  1NXI A;  3O8W A;  3MPV A;  2CJX B;  4PPZ A;  4J9M A;  2M2B A;  2OEJ A;  4DQI A;  2OTL S;  1S1W A;  2X7I A;  5LM7 E;  2YWG A;  4AXI A;  1N6Q B;  1IKX A;  1KFS A;  2X1F A;  2V8V A;  1FDA A;  2PFF B;  5BYS A;  4XDC A;  3FEX B;  3N6M A;  2JH3 A;  2DBB A;  3E01 B;  1HNX J;  1VHI A;  2DH9 A;  2QLX A;  2PI4 A;  4PUO B;  2IJR A;  2GNK A;  4K4Y A;  1GEH A;  4IOB A;  2DHG A;  2UZA A;  4NZ0 A;  3KJV A;  3R1H A;  4B3R F;  1N5S A;  3FC9 A;  2BAN B;  3NGU A;  4Y28 C;  3D28 A;  1M5V C;  4USU A;  3AAW B;  3DLH A;  4JYA J;  3OXF A;  4TU8 A;  3VTI A;  1H6K X;  3TA0 A;  1MLA A;  3QIP A;  2VQF J;  4ECS A;  1SVD A;  2W2N P;  4AL7 A;  2HFZ A;  3TX8 A;  4QQB A;  1Q8B A;  2GQQ A;  3IO1 A;  3R6L B;  4A8W A;  1S97 A;  1HHQ A;  2CPE A;  3ZZZ A;  5C2C A;  3DYA B;  5JMN A;  2KH9 A;  1GH8 A;  2MJU A;  4CI0 B;  2ZEJ A;  2YWK A;  3CJK B;  3ZTO A;  1ZZF A;  1N5Q A;  5GAH U;  3LH2 S;  1VC0 A;  3LAK A;  1SQE A;  4F25 A;  4OX7 A;  3D0H E;  3B4M A;  4JI2 J;  4ZCL A;  2B7B B;  2EEY A;  2HQF A;  1L3U A;  3K8W A;  3MDF A;  4U6P A;  2XB2 D;  4N56 A;  3EZ5 A;  1MW7 A;  3WX8 A;  4ZVS B;  3BSC A;  2A2D A;  4RUB A;  1X60 A;  1IQT A;  3TAR A;  1HBU A;  4WZQ A;  1FFW B;  1CS4 A;  5KG5 A;  4DZ6 A;  5E3R A;  2HFS A;  3CMA S;  2V67 A;  1FO1 A;  2ASD A;  2G0I A;  4KGK A;  2LP4 A;  4BLG A;  3DXB A;  5AT1 B;  2AX0 A;  2GML A;  3W60 A;  2CPZ A;  2V8P A;  4B9N A;  3BJY A;  1VRQ C;  1XNQ F;  4ZN3 A;  2BKO A;  3LAM A;  3F44 A;  1PO6 A;  4YS2 A;  1XR6 A;  3KK2 A;  2W8L A;  3IC1 A;  4CQ1 A;  3HJF A;  4ZVU B;  1FKO A;  1P9Q C;  2XGP A;  1GTE A;  3KJQ B;  3EDR B;  2AW0 A;  3NCP A;  1EET A;  2IVY A;  2YWW A;  2YQ1 A;  1CQM A;  3BSA A;  3NCQ A;  4HI2 A;  4JI3 J;  2ZZM A;  5HN0 A;  2JEJ A;  5ETP A;  5CYQ A;  4J37 A;  2E5I A;  5E7O B;  4ILM A;  4LT6 A;  3DRR B;  5GAG I;  1ZH5 A;  2V94 A;  4A8Y A;  4KPY A;  2D74 B;  1XMQ J;  3O44 A;  2HGM A;  4R0E A;  1KQS R;  1IKY A;  3RRH A;  1RT6 B;  2YKM B;  3PG9 A;  4K2J A;  3G6X A;  2VH7 A;  2NSB A;  2UUC F;  2JWN A;  4DL2 A;  1YX2 A;  3IWX A;  1NLK L;  3LP1 A;  4S0M A;  2CJY B;  1MSW D;  5EN1 A;  2HS3 A;  3PR5 B;  5LJ3 Y;  1S9E A;  1BE4 A;  1YDL A;  1S7H A;  4ZCI A;  1OYE A;  4XDD A;  5SUH A;  3TX0 A;  2UVW A;  1WTB A;  2VFR A;  4OI6 A;  2X1G A;  3T1H J;  4PRF A;  2JVO A;  3QMQ A;  5L9N A;  1HPZ A;  4RX6 A;  5L38 A;  3TVZ A;  3SYZ A;  1XMQ F;  2JFD A;  2PMH A;  2V8H A;  4IO1 A;  3M9O B;  4HYK A;  1X5T A;  4DU8 A;  2DR7 A;  5GAE I;  2AP6 A;  5GMK a;  1SJ1 A;  2DNY A;  1FWL A;  4DV2 F;  4KTQ A;  1RWP B;  3C6T B;  5EWF A;  4ZCK A;  4DR7 J;  1R89 A;  5KFC A;  3MMB B;  1S1T A;  1MNE A;  2A3J A;  2XMU A;  2ZJR Q;  4LF5 F;  3I5C A;  5F3Z A;  1B7Y B;  3PVX A;  2E9Z A;  4DF4 A;  3C8Y A;  3H4D A;  1TR0 A;  3KUH A;  2MYF A;  4RBV A;  4D3H A;  3H5S A;  3PIO Q;  4AL6 A;  1T03 B;  2UP1 A;  4LSN B;  4UUW A;  3BGL A;  4DPO A;  1N33 F;  3EWG A;  5CHC B;  1FXD A;  1UPP A;  2CQC A;  2OEL A;  4H4M B;  1U6F A;  1T9T A;  4PXC A;  4CO4 A;  1RTZ A;  3K5M A;  2UXC J;  2YKA A;  3D1Q A;  2F8M A;  5ETV A;  2BJD A;  1TFW A;  4HAC B;  4ICL A;  1JLE B;  3I32 A;  1RWV B;  1SUQ A;  3LGM A;  1RU1 A;  1FEH A;  4NLT A;  1S9F A;  3R3T A;  4CO3 A;  2ADC A;  3NS5 A;  4NA3 A;  3GV8 B;  5L9X A;  1ELO A;  4KHR A;  2LFV A;  4V1A k;  2V6A A;  3GTY X;  4AYB D;  3IS9 A;  3FSI A;  4N76 A;  2H9Z A;  3RAX A;  3NCR A;  2XYG B;  1GMV A;  2BW2 A;  3A12 A;  3ENA A;  3H0P A;  3H42 A;  3K59 A;  1FRI A;  5KFF A;  1S1U A;  3NGS A;  1IBK F;  3OFF A;  1TL1 A;  1IKV A;  3CVK A;  2ZHA A;  3OHA A;  3FDS A;  3MHY A;  1R8C A;  3KOA A;  1ZAX A;  1H2T Z;  2VPZ B;  1B70 B;  3M1V B;  1MWY A;  2PT0 A;  3QRP A;  3CT9 A;  5D4L A;  4LF6 F;  3UDC A;  2DGU A;  4KGV B;  3NNC A;  2OTJ S;  2D7S A;  3FUY A;  3P3D A;  4N8O A;  5HLF B;  3R5B A;  4RO0 A;  2FLP A;  1Y5L B;  2IRX A;  1GMU A;  1CJU B;  2XMK A;  1CUL B;  3GYX B;  2AMC B;  4P52 A;  5HMX A;  4ED8 A;  3UCU P;  1PIL A;  4AL5 A;  3FCH A;  4FXV A;  1Y00 A;  3GCW P;  4FNI A;  3D3B J;  3LAL A;  3C3L A;  3HHN B;  5DDR C;  1NRK A;  4UZC A;  3UD5 A;  4MAK A;  1RT4 B;  2HNY A;  3CO0 P;  2OD6 A;  4JI8 F;  2V9K A;  4JI6 J;  2KZM A;  4Q5V A;  1GXT A;  1RAG B;  3AXM A;  2LCW A;  4YB7 A;  4DCP B;  1SCJ B;  2H5J B;  3C16 A;  3TYT A;  4JV2 A;  1NBE B;  2DK2 A;  2VFS A;  4ZVR B;  4R8U B;  1SH2 A;  2DNZ A;  3M9M B;  3R8Y A;  2KT3 A;  3JB9 k;  1RXO B;  2W4P A;  3FBB A;  1XMB A;  4RNF A;  4L76 A;  2CNL B;  2M0G B;  1N6Q A;  1RWM B;  2J0S D;  3C14 A;  4ZOS A;  5AE3 A;  1S10 A;  1SL2 A;  2GGP A;  2AJF E;  2DHX A;  3HHL A;  4ED2 A;  3QRR A;  1WHY A;  1QTM A;  1FX4 A;  1RTD A;  1X8D A;  3DOL A;  2NXU A;  4P2M A;  2AWZ A;  4Q44 A;  2NXN A;  4HTI A;  1LWE A;  4BHQ A;  3PRD A;  1QAY A;  2BRK A;  2M8D B;  4KYZ A;  3T6B A;  3M9N B;  4U8V A;  1S99 A;  2VPX B;  4ZHR B;  2XS2 A;  3OV7 A;  2KZZ A;  2HVZ A;  1IXK A;  1FK9 B;  4ID5 B;  1UVM A;  2Q6C A;  2HGN A;  3CJ5 A;  4I64 A;  4Y65 A;  2Z2L A;  2MHE A;  4ILL A;  3HSJ A;  5B0F A;  1ZPV A;  2B9Y A;  4URG A;  2KL8 A;  2KVQ E;  4WFA Q;  1HKA A;  2AJ1 A;  1K0T A;  1Q8I A;  2PN6 A;  2N7Y A;  3FQL A;  4TY9 A;  5ETL A;  3OXL A;  1KQK A;  1TL3 A;  2UVR A;  2XLK A;  1YTY A;  1VJQ A;  4BDP A;  2UUA J;  3NS6 A;  1OSD A;  4DFK A;  4Q0B A;  2GAH C;  1REV B;  4Y2M A;  4KKO A;  2HW3 A;  2RSQ A;  3DOK A;  2DKO B;  1RP5 A;  4U7U K;  2UXB J;  2QT7 A;  2R7V A;  4P9S A;  1HQU B;  2M52 A;  5HL7 Q;  3ONQ A;  5LOQ A;  5H9F K;  3ITH A;  9ATC B;  3MOZ A;  2W9B B;  4IOC Q;  3M30 B;  1BUX A;  1F2H A;  5IM0 B;  4Z2X A;  2VG7 B;  3B6B A;  1SQF A;  3C19 A;  3QLH A;  2XLI A;  2FVP A;  3TR5 A;  1HNW J;  2DY1 A;  4LFA J;  1BQN B;  1KTQ A;  4CO2 A;  1TUW A;  2CFX A;  4ANC A;  2IC3 A;  4IRK A;  1JLE A;  1X0P A;  3DU5 A;  3H25 A;  3LP0 A;  3WC2 A;  3MM6 A;  1JXL A;  4I67 A;  1QAI A;  2A0F B;  2DNL A;  2J6T A;  4F4Z A;  3FQK A;  4KGM A;  2CPH A;  1UWB B;  1HNW F;  3IG1 A;  3WC0 A;  2D9O A;  1N34 F;  1CSJ A;  1I1G A;  4I69 A;  3U02 A;  2Z8Q A;  3UDV A;  4A4J A;  5IQ6 A;  2MKJ A;  2ZC3 A;  3UVJ B;  1S6P B;  5A8K B;  2KM8 B;  5LMU F;  3SQO P;  3GIK A;  1FE0 A;  2G2O A;  1VYA A;  3MCM A;  2CQD A;  2XWX A;  1RLD A;  2ACY A;  2EFQ A;  3CJ2 A;  3CC2 S;  2GA7 A;  2Y9H A;  2WSC C;  4B3T J;  2HNZ A;  3GJT B;  2CQH A;  1WTF A;  3M8P A;  4AE5 A;  1JLF B;  4R0J A;  1ZYQ A;  3QJP A;  2D9P A;  4RBT A;  3RBD A;  2F4V J;  2D1C A;  1ARO P;  2ZD1 B;  2OPS A;  1Q53 A;  1WEL A;  4WTY A;  2RRB A;  1TK0 A;  2E9R X;  2HHS A;  1T9X A;  4NL5 A;  4QPT A;  4C7Q A;  4LSZ B;  3MMC A;  3H90 A;  4H4O A;  4MYT A;  2H4Y B;  4ZPW R;  4IFV B;  3IR7 B;  4QW8 A;  5J2N B;  4CLT A;  4DLG A;  4USI A;  5DQH A;  4LUB A;  1VK3 A;  1ZPW X;  4LVN P;  1YJ9 S;  3GFH A;  4TYA A;  5FJ4 A;  5KFU A;  2DTJ A;  1ZAW A;  3S6E A;  2J6S A;  2XSJ A;  1YJU A;  5D0R A;  1RTI A;  4NMX A;  4NLR A;  5K8N A;  4OHZ A;  4TKT A;  1IM6 A;  4UOF A;  3TJ8 A;  5KT2 A;  4DR5 F;  1JKH A;  3DGV A;  4NLU A;  2WBR A;  2CQG A;  4C8L A;  4O3O A;  4ITS A;  1NKB A;  4FKY A;  1CJV B;  1WKK A;  2HQC A;  4FXD A;  2FJW A;  2G2Z A;  4KRW A;  4KR0 B;  4MH8 A;  3ULH A;  2D41 A;  3M8Y A;  1XMO F;  4MKY A;  4OZN A;  2RDJ A;  1O0P A;  2RQM A;  4PUO A;  2KN4 A;  2LXI A;  2LXF A;  1JLB A;  4LBH A;  1RAD B;  2QL7 B;  5LSL A;  3WIV A;  1YSJ A;  4ES1 A;  1HYS B;  3QYY A;  1C0U B;  1HI1 A;  2XHC A;  4MIB A;  1BGX T;  3NL0 A;  1CJK A;  2CG8 A;  2F5G A;  3TAM A;  3PW0 A;  2BYC A;  1KHV A;  2ZWO A;  5D4O A;  5IFM A;  3OSN A;  3AQP A;  2GX8 A;  2Y0S D;  3MEC B;  3NGT A;  4RBU A;  2VG6 A;  2WW4 A;  2QA1 A;  2QV6 A;  2B51 A;  5CD4 H;  4O23 A;  1FK9 A;  1RAJ A;  2J0W A;  1WC3 A;  2PMW A;  1S0M A;  4ZIW A;  3ISN C;  4UQG A;  1CJT A;  3PFO A;  3S01 A;  2R7R A;  1A9N B;  2IA6 A;  4RNM A;  1LW0 B;  1GK8 A;  2FHO B;  3OR2 A;  3GFX A;  3HJV A;  2XY5 A;  2GZO A;  5A0Y A;  2CJQ A;  3MAQ A;  3KLI A;  4L6V 3;  3TRG A;  1KTV A;  4CIO A;  5AE2 A;  3Q8Q B;  1P6T A;  1VOM A;  5T7L A;  3TQ1 A;  2XM3 A;  1TKT A;  1KWM A;  2HFO A;  2V2V A;  1RTJ A;  3KG1 A;  2ZZT A;  3ICL A;  3NWG A;  1EHW A;  3UR3 C;  3W9I A;  3OPK A;  4X4S A;  1UVL A;  1KS2 A;  3OTC A;  3Q8Y A;  4X4T A;  2FY8 A;  4J91 A;  2M70 A;  4CLU A;  1TK5 A;  3EZU A;  4DU7 A;  1T7P A;  2YX1 A;  2HRT A;  1BHN A;  1NJY A;  5K8O A;  1PIE A;  3N6L A;  1W2B R;  2Q79 A;  5C5J A;  2B4P A;  4ECY A;  2R8J A;  5KOW A;  4JB8 B;  4F4W A;  4LSL B;  1N8R T;  4V19 J;  1XNQ J;  4UY8 T;  3G6V A;  3HVT A;  2VUG A;  1DLO A;  1X4E A;  1DZ5 A;  2OHD A;  4JP8 A;  3NAI A;  5HQL A;  4RNO A;  4WFX A;  1IQZ A;  1SV5 B;  2YX4 A;  1MRO B;  1U25 A;  4HH1 A;  3W5X A;  1C0T A;  4L72 B;  4LBP A;  3CWJ A;  5KFX A;  4EFA C;  1FRH A;  5FLX U;  1HNZ F;  2ZOF A;  3O2I A;  3MI7 X;  3W9H A;  3D1H A;  4M5H A;  4DN9 A;  5HVH A;  5CD4 A;  3PR4 A;  2B9W A;  4OFZ A;  4DUY J;  3M05 A;  3RBX A;  4U67 Q;  4LF4 F;  3DRP A;  2XYH B;  2B43 A;  4NA1 A;  3UFC X;  4QYR A;  1U1O A;  2YVS A;  3W7B A;  3QT6 A;  3JSY A;  1PBU A;  2N82 B;  1EKR A;  3GIM A;  3BBF A;  4MYU A;  3DLL Q;  2LYV A;  1PJ6 A;  2CPX A;  1FJG J;  4P74 A;  4DV5 J;  2MST A;  2X3G A;  3PJ9 A;  4A48 A;  3N79 A;  1S57 A;  1BWE A;  4C11 B;  3HKW A;  1NK9 A;  1NDP A;  3PYF A;  3V4I A;  5D8H B;  4DV7 F;  1X5S A;  1RAA B;  2I6W A;  4DL7 A;  5B0B A;  4W4M A;  1CBK A;  1FFG B;  3K0J A;  5DQG A;  2DNG A;  3JS9 A;  5M2P A;  3KLG A;  2VBW A;  3AB2 B;  3MD1 A;  3T1H F;  3MED A;  3DNC A;  1WC6 A;  4X4U A;  2IM0 A;  2NXC A;  4C6A A;  1SJR A;  3CJR A;  4DR3 F;  4IFV A;  1RWU A;  2QEX S;  1RHM B;  2EW9 A;  2ZH8 A;  2QE5 A;  4A8M P;  3MAA A;  1P1L A;  3CCZ A;  1RT5 A;  1S12 A;  2DCL A;  3JYT B;  2UUC J;  3ETO A;  2CQP A;  3RB3 A;  1OYD A;  1U48 A;  1B0T A;  3W5Z A;  5KFK A;  1UVN A;  1OQ3 A;  2CXE A;  3H20 A;  3DDN A;  3A1Y G;  2COL A;  2JDJ A;  2KFZ A;  1Q95 G;  1S76 D;  8RUC A;  2QL5 B;  5E41 A;  4WFY A;  2RJZ A;  5IXU A;  1NB2 A;  1S1V B;  5KOX A;  5F41 A;  3MR2 A;  1QAJ A;  3ET6 B;  2E1R A;  2FD2 A;  5CA5 A;  3W61 A;  2HMI A;  3MM6 B;  2RH3 A;  3N01 A;  2R42 A;  2E9T A;  1DTT B;  3R7B B;  4NYO A;  4Y2C A;  4ZN1 A;  2DXF A;  5F8M A;  4EBC A;  2MJN A;  1QVF R;  4Y3C A;  1PYO B;  5EGY A;  2IAJ B;  3BKU A;  3D68 A;  2XO7 A;  1U1R A;  1HQE B;  4PCQ A;  1SXL A;  1WF2 A;  2H65 B;  3V81 B;  1AXQ A;  2DGV A;  5F8J A;  4HDH A;  1QE1 A;  3H4B A;  3QQC D;  1LFP A;  1H38 A;  1CQN A;  3V4I B;  1TEL A;  3MEC A;  4RU2 A;  2U1A A;  3QBC A;  4W92 B;  4WZM A;  1RT4 A;  2HNY B;  1SB6 A;  2A6M A;  3GMG A;  3VAG A;  4LBI A;  2CJA A;  3TZY A;  2H5I B;  4KJI A;  2G0C A;  5HJY A;  3CC4 S;  1C1B B;  4LF9 F;  3Q2T C;  2RU9 A;  4M63 A;  1JLF A;  1RI7 A;  4RWW A;  4ZVG A;  2P9E A;  4C3K A;  2EC2 A;  3DGP A;  1DAR A;  1OS5 A;  1UEK A;  1NU4 A;  2J7W A;  3M2R A;  1RTJ B;  5CCL A;  1ITP A;  2ZH3 A;  4YP3 A;  1KEK A;  2LEA A;  2MZT A;  2YPY A;  2QLF B;  4RW9 A;  5HJX A;  2J6U A;  4NCA A;  2VA2 A;  3GP9 A;  1FA0 A;  1S1X B;  2GCF A;  1KQG B;  1DUR A;  3LPE A;  4MK9 A;  5B0E A;  2FVQ A;  2CWX A;  3UE2 A;  3PJW A;  4PXD A;  3JAM U;  4ED7 A;  2VG5 B;  1NKE A;  5F8H A;  4JV5 J;  1IKW A;  1S0N A;  1DRZ A;  4FF2 A;  2IM1 A;  1RT1 B;  3BKT A;  3KMQ A;  2R8I A;  3A8J A;  5CXT A;  4LF9 J;  3F0N A;  1HBN A;  2R8G A;  1LWE B;  4C4W A;  3S1T A;  4K7Q A;  2CDR B;  1YZ7 A;  3QAT A;  1PKU A;  2ZH7 A;  1KN6 A;  2V9W A;  2OD4 A;  1EKS A;  4KHM A;  1NK7 A;  4LQ3 A;  3ZTP A;  3KTQ A;  1RA6 A;  2UUW A;  2HND B;  3LQV A;  1SIW B;  1IR0 A;  2YY3 A;  2R3V A;  1XN9 A;  1PJ7 A;  2VC0 A;  5B0A A;  4N47 A;  5BR8 F;  3QAU A;  3C66 A;  1JLB B;  2QSW A;  3IR5 B;  2Y8Y A;  2HHV A;  1H72 C;  1NHU A;  4MKV A;  3DRP B;  4IH7 A;  3PZP A;  3DRS A;  5DDQ C;  1LK7 A;  4UOG A;  2J9E A;  1S0V A;  5D0E A;  1W2I A;  2V4J A;  1QAX A;  1HNV B;  3UCG A;  4DSL A;  2H51 B;  2IDL A;  2BE2 B;  3I55 S;  2L3M A;  3G82 A;  4L75 A;  1IM4 A;  1RE1 B;  4LF7 J;  4J7C A;  2ZJP Q;  1FWP A;  1TQL A;  4JUZ A;  5BR8 J;  1IWG A;  4LRD A;  2MXY A;  2ATC B;  3I96 A;  2HFU A;  2CIM A;  3J81 Y;  3CDA A;  3OUY B;  2VJV A;  1ZA2 B;  1H98 A;  2BJ7 A;  2DD8 S;  1RBO B;  3AT1 B;  3QLH B;  1N33 J;  4YB1 P;  4G1I A;  2IC3 B;  3V5R A;  7FD1 A;  4EBE A;  1VJW A;  2YWE A;  2OSR A;  1FJE B;  4FF1 A;  2EFN A;  2BM0 A;  1GAO A;  2VKR A;  1SPB P;  3NEK A;  4DX7 A;  4DFP A;  2PSZ A;  2G0J A;  1S1W B;  4E8U A;  4X62 F;  4QWD A;  3ILJ A;  3GII A;  2IHR 1;  3N9U C;  5IV4 A;  2ZM6 J;  3T19 A;  2CDQ A;  5DG7 A;  3CCL S;  3IG1 B;  4NRU A;  1B3T A;  2BKP A;  4A46 A;  2LQJ A;  2E5J A;  1T0T V;  3MF5 A;  4KV8 B;  1GMW A;  3IAS 9;  4O3N A;  4CZC A;  3GIJ A;  1K0V A;  3POT B;  4NLO A;  5D4N A;  4ZPD A;  1IBK J;  4C8M A;  2AYB A;  3ENV A;  5BJR A;  2AYG A;  4YFU A;  2FIU A;  1VI7 A;  1HR0 J;  2HKE A;  4WIQ A;  1VQ7 S;  1NCL A;  2MEW A;  2QTW A;  2UV8 G;  4URQ U;  3AH6 A;  5ETT A;  3FK4 A;  3KMS A;  8AT1 B;  3KK1 B;  2RAQ A;  4K4S A;  3UR0 A;  2OKQ A;  1RIS A;  2C28 A;  4IH5 A;  3TQE A;  3CUL A;  4PQA A;  2ZBR A;  3V81 A;  4DQP A;  1V3S A;  2L9W A;  1LFW A;  5D77 A;  2VOP A;  3CJT A;  1OMS A;  2UUT A;  2MTL A;  1QE1 B;  2JL9 A;  4NCG A;  5DQI A;  3IFE A;  5K5M A;  3CCE S;  1Y0H A;  2RDD A;  3OHB A;  2K1R A;  1VHF A;  3FFI B;  3CJK A;  3JQM A;  4HT7 A;  3ZTQ A;  3EPI A;  1IJF B;  3OTB A;  1J27 A;  4TVA B;  4P75 A;  3HO1 A;  4K8R A;  3OL8 A;  3RYL A;  3AOC A;  4LRE A;  2BBE A;  4OJH A;  4Z7Y A;  2ZH6 A;  4ED6 A;  1YRT A;  2EG1 A;  2WW8 A;  3F41 A;  4WYL A;  2ERR A;  1VIX A;  2XNR A;  3PJX A;  2IDE A;  2DCU B;  4I1T A;  2DJW A;  4KC5 A;  3EVM A;  4PZV A;  4X4P A;  1J5E J;  5KFE A;  4MK7 A;  1S7I A;  1I5O B;  3WDO A;  3P49 B;  2WB1 D;  1CJV A;  2MPU A;  1P9Y A;  2C2E A;  1F5C A;  2E5H A;  2RE1 A;  1R31 A;  4H54 A;  4OYZ A;  2XY6 A;  2G4B A;  3MFI A;  3HLU A;  2FLO A;  1K1Q A;  1RZM A;  1WG1 A;  4WJB A;  4G6V B;  3P4U B;  2EK6 A;  3IN5 A;  4QIE A;  1D09 B;  2CVI A;  2Z0G A;  1FVS A;  1RT2 A;  5IC4 B;  1YIT S;  1VQ4 S;  3TUJ C;  1YJW S;  5IS2 A;  4RNN A;  3CE8 A;  2ZKU A;  2VA3 A;  1JIH A;  5ADZ A;  3W2V A;  5C7P A;  1XBW A;  3TAM B;  1SC6 A;  3CDU A;  1IJE B;  4DI6 A;  3UCZ P;  5BYQ A;  3CED A;  4HL9 A;  2ACM A;  3FJ2 A;  5AJ3 F;  3DRR A;  2C1E B;  3L95 X;  2MHN A;  3Q8R B;  4DPT A;  1WDT A;  1JJH A;  4I68 A;  1NSP A;  3BDP A;  2DEJ A;  3P8B B;  1RT6 A;  2YKM A;  2X1B A;  3JSM B;  5JVG Q;  3EM1 A;  2XSF A;  2Z2Y B;  3ZNU A;  5J2Q A;  1HA1 A;  1M5P C;  3P45 B;  4DV5 F;  2EBE A;  2RUS A;  2P8I A;  3HVA A;  3KDN A;  3BO3 A;  2DIS A;  4OZ1 A;  2FHJ A;  4OZ3 A;  2I2Y A;  1C4C A;  2DR5 A;  1BQM B;  2XI3 A;  3DDI A;  1YKW A;  3CCV S;  2KFN A;  2ZDP A;  2M8H A;  4KAI A;  5D78 A;  3DM2 A;  2N7C A;  4CWB A;  3R2D J;  1VGY A;  2YNH B;  5KFL A;  2VPY B;  1VDH A;  2F9J A;  3GR0 A;  2E7X A;  4OHV A;  1HNX F;  1OJ4 A;  2AIR B;  4F0K A;  2CNO B;  1RAH B;  5D15 A;  1S72 S;  1E6Y A;  3MUM P;  2G13 A;  3CDB A;  3I0S B;  3A8I A;  3PRB A;  4NLG A;  1FDD A;  3G87 A;  1WHX A;  3RB6 A;  1DLO B;  1P1T A;  2FHJ D;  2C3P A;  2MSS A;  1RBA A;  2AKW B;  2B56 A;  2U2F A;  2YNI B;  4I2P A;  3RJM B;  1IBM F;  3PIP Q;  2HZV A;  4FF3 A;  4DDF A;  5C24 A;  1O5J A;  1XIQ A;  2HAF A;  3W5Y A;  3VAF A;  3KK3 A;  4UY8 5;  4DV4 J;  3TOQ A;  5KFJ A;  1S49 A;  1VRT A;  4WU3 A;  3RBE A;  4LR7 A;  1M1H A;  2CVE A;  2PDA A;  3IBF B;  4AND A;  3VAL A;  1N88 A;  2O01 C;  1T02 A;  2KXF A;  2Z2M A;  1U49 A;  2DGT A;  1RTH A;  2QC3 A;  3KNA A;  3NMA A;  3LP2 A;  4BC9 A;  4EI2 A;  3CO9 A;  3CPW R;  2AQ4 A;  2B3T B;  5A2Q U;  3HX9 A;  4QIF A;  4EGL A;  3MEK A;  3V6D B;  1WHW A;  2DB1 A;  3BS9 A;  4YDX A;  5T41 A;  3CD7 A;  2KG0 A;  2YWH A;  1S9E B;  2DNN A;  3JSR A;  3W65 A;  1IN0 A;  5J1E A;  4ZVT B;  1F5A A;  3FZB A;  2ZVI A;  4ALZ A;  3GJS B;  4Q2L A;  1M1G A;  3A3N B;  2F4V F;  1VBX A;  1X31 C;  2OPP B;  1WKL A;  3I5B A;  3TUI C;  2MZQ A;  4USK A;  1Z2Z A;  1BLU A;  1VLO A;  2F8E X;  5KTQ A;  5HLF A;  2V4J B;  1RYS A;  2ZBC A;  1XJW B;  2J5A A;  4DPX A;  4TLR A;  1VQL S;  1CJU A;  4A8F A;  2NQP A;  2HQ3 A;  3OL7 A;  4CM0 A;  1S1T B;  5EUH A;  3SI8 A;  3EXC X;  1U09 A;  1ZAV A;  5DG8 A;  1DQA A;  4JI7 F;  5M2R A;  1UPM B;  3BB5 A;  4F4K A;  2ZH5 A;  2XNQ A;  4CLK A;  4C0B A;  4LFB J;  2J9C A;  5I42 A;  1RK8 A;  2YKP A;  4IH6 A;  2NXJ A;  2WAQ D;  3GSI A;  3HSG A;  4OX6 A;  4DX5 A;  1K73 T;  1D0E A;  4N77 A;  2ZBQ A;  2M88 A;  3GFY A;  3WQP A;  5E0O A;  2J0X A;  1Y5I B;  1MWQ A;  4ZVP B;  3R7N B;  5BXI A;  4O3Q A;  2KKH A;  2MQQ A;  5CAA A;  3TZW A;  1F1B B;  3HUL A;  4NXN J;  4JV0 A;  2XMV A;  3N5F A;  2ZC4 A;  4G65 A;  2WOM B;  4C0O C;  2K7K A;  1JQG A;  2JRS A;  2C3U A;  3CJ3 A;  5HVG A;  5GAH I;  3ZTR A;  1UA0 A;  1H0H B;  4LRB A;  1U26 A;  3CDE A;  3UD3 P;  2W4C A;  3JAM Y;  3AOB A;  1J2V A;  3HZE A;  1BD6 A;  4WP3 A;  2VDI A;  5DJB A;  2YWF A;  3M6X A;  1U2C A;  1V9O A;  2R4F A;  3B8H A;  4QWA A;  2HHH J;  2HHW A;  3W2V B;  2FQQ B;  3VGS A;  3T5H A;  1S9G B;  4Y00 A;  2LA6 A;  2N4C A;  3VCD A;  3UWT A;  1WOP A;  3EUN A;  3POT A;  3S7R A;  3J7Y I;  1PAE X;  2I9S A;  4CO1 A;  1U1L A;  4OI4 A;  4HKQ A;  1KVJ A;  2DO4 A;  3IM8 A;  3N4W A;  4OJ3 A;  5E3P A;  3FVY A; 
#chains in the Genus database with same CATH homology
 1YDL A;  3DGP B;  2JNJ A;  3DOM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...