3DGPB

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKNIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 19
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1220 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits TFB5-like 3dgpB00
3DOMB 3DGPB 1YDLA 2JNJA
chains in the Genus database with same CATH superfamily
2UU9F 4H4MB 3TQEA 3H5UA 4LT6A 1ZM4A 1UZDA 1FJCA 4CLPA 2UXCF 5I3QA 2HG4A 4NXNF 1SCJB 2KZMA 4QYZK 2W8LA 2JL9A 4M94A 3OJUA 4QU7A 1CS4B 2PN6A 2VKRA 4ZLJA 1XMOF 4K4YA 2CAJA 4RW9A 2QMWA 2R3VA 2CIMA 3PO4A 3CDUA 2PMZD 5LSOA 1PO6A 2I9SA 2KG0A 4ZPBA 5KG7A 4ELTA 4J7CA 4JYAJ 5E3RA 4NMXA 1SKSA 3EVOA 1K1SA 2D3OR 2NXNA 2KZZA 1HWKA 2F65A 2DIUA 1FKPB 1JLBA 3KLIA 4MIWA 4QW9A 3PG9A 5A2QU 1S99A 5CD4A 3P6YC 1RHMB 1LQ9A 1URNA 1EQMA 1VRQC 3HMJG 1HA1A 4H4MA 2AF6A 3ENWA 1FWLA 1M5OC 2BZ2A 4LREA 4KGKA 2MZ1A 4DQSA 4PCQA 2BBEA 2FZKB 1UTAA 1WKJA 2OAUA 4J9MA 4YHHJ 4B3RF 5SZTA 3MCSA 4YB1P 2EFQA 1CS4A 4K59A 3TAMB 3RR7A 4CO4A 2UU9J 5I3PA 2RILA 3PW0A 4Q5VA 1G1XA 2UXCJ 4NXNJ 1KOOA 3G82B 4DR6F 5GMKa 4MKVA 5D4PA 2MHEA 2DITA 3KJFB 3VR1A 1ZZNA 2HWIA 4DSLA 2Q6CA 3JSYA 3RRHA 4LF1A 2O01C 2C2RA 2V8GA 1XMOJ 1FKPA 1SQGA 2B9WA 4ZCLA 2LQ9A 2FB0A 3BSOA 3M6UA 1B64A 3GR0A 1YZ7A 1VBYA 1QSYA 3AY0A 4PG5A 2ZZNA 1PC4A 4A47A 3IA0A 2FZCB 2APOA 2ZEJA 3LA0A 4NX9A 5HL7Q 4X62F 4JI1J 3TAMA 1U0HB 2KYZA 1RTIB 3V2UC 4F67A 2KRBA 4QJVA 3OQ2A 2U1AA 3W5XA 4ZIVA 3O1LA 4P10A 3RAXA 1R6YA 4WYWA 4ANCA 3WX8A 3G82A 3UFCX 3KLGB 4B3RJ 2WSFC 5GADI 4KBIA 5KFOA 2BKNA 3MEEB 2LMIA 1G6BA 4LJMA 3DOMB 3F41A 2QGFB 3CO9A 3HKWA 2F3JA 4DL2A 4DR6J 3RGIA 4BWJA 2C28A 4RKUC 2FTRA 2R7TA 2Y8YA 4OYWA 2V63A 5KT5A 1PAEX 2VA3A 4XDCA 4MK9A 2R8KA 4KGXB 5F3ZA 2V2ZA 1U1LA 1U0HA 3ZZ0A 1RTIA 2RRNA 1MMNA 3OLAA 3IC1A 2V69A 4DPXA 2AYMA 1NUEA 3BF4A 3RBDA 3BDPA 2W4PA 4DX5A 4X84A 3OFHA 5IM0B 4PG4A 3KLGA 3QIPB 5LXRA 4X62J 2X51A 3PY8A 1H2VZ 3MEEA 1TKZB 1RT6B 7AT1B 2AIRB 4W98A 3MMAB 2BKOA 3G6VA 2JOQA 5KFTA 3G8QA 3DOMA 2K3KA 3UCUP 1PC5A 5KFQA 3R8YA 4PPZA 2IJRA 3L7UA 2VQFF 4O3SA 4F25A 1YJRA 2QG9B 2I6WA 5KFRA 3MD3A 1U2RA 3M8QB 3SV3A 5H9FJ 4JB8B 3TUJC 3S1TA 4LSZB 4WKRA 2HBRB 3Q89A 1QAXA 5M2PA 3AH6A 3D66A 3H2LA 1FA0A 4FNIA 1XTZA 1U1MA 3KG0A 2WBMA 4I69A 5IM0A 4WZQA 2EW9A 2M8HA 3QIPA 4DSEA 5K8MA 2KL8A 4R0EA 5E3QA 2HHUA 1TKZA 1RT6A 3P49B 3QGPA 5MLCV 1M5HA 3MMAA 4F50A 4EUVA 1PYOB 2CDQA 3OL9A 3PIPQ 5B0BA 3CNQP 3TRGA 2XWYA 1N33J 2DR8A 4M5NA 4LF9F 1R0AB 2V8DA 1N5YB 4KHRA 3LWMA 2CZ9A 1HWIA 2FHJD 4Q45A 3D1QA 3M8QA 2PI5A 1TFWA 2R7OA 5DLFA 4YR0A 3CJTA 4P71A 4DL5A 5KG0A 1T3NA 5KFGA 2NREA 2EFOA 2UVUA 3P96A 3QJLA 2HFOA 5GAHI 3I32A 2CWKA 3GSDA 1NB2A 1ZM3A 4I1TA 1H3DA 4DX8H 2LA4A 1S1UA 1REGX 4FYWB 2VBZA 4EEYA 5HP1B 3GU0A 2HLTA 1VRUB 3TZWA 3GPAA 2X7IA 3TQ1A 2XY7A 1UZHA 1R0AA 4LRDA 1N5YA 2MDAA 2J7UA 3VGVA 3QAEA 4B3OB 4BC9A 2IA0A 4QIWD 4TU7A 1RT5B 1HHTP 3PEJA 1GT8A 4EZ9A 2VA2A 3W66A 2R7VA 1S0NA 1HI0P 4LF9J 2HZAA 3CD5A 2B7CB 3FDSA 4IH7A 3R6GB 2QV6A 2FLNA 1N32F 4L3NA 1O6XA 3IR7B 1UMJA 3CPWR 4J37A 1KFSA 1WSVA 3OPKA 3DOKB 5KG4A 3GV5B 1V5IB 1QTNB 2GJIA 2AYBA 1OSCA 3SCIE 1FJ7A 5HP1A 3DLJA 2ILYA 4YB5A 1VRUA 2CQCA 4A48A 1F60B 5ETSA 1J5OB 1HQEB 1S76D 2CQIA 2XHWA 2DHXA 4B3OA 3QPIA 4ZVHA 2WVDA 1FWPA 1RT5A 4QWCA 3EJMA 1BQMB 3ULHA 1WG1A 4OI2A 3BYPA 4K4VA 5KFBA 1EJ7L 4C9DA 4GVLA 1QD1A 3LGNA 4URGA 3HO1A 1B0VA 3U1MA 3TAPA 1HI8A 2DH9A 3F56A 2G13A 3EVWA 3QWPA 3DOKA 2VPZB 4PUOB 2BJ9A 5HVGA 1LXJA 1X9WA 1N32J 1JKHB 5B08A 3BQ1A 4F4KA 1J5OA 1HQEA 5DGBA 1U6FA 4HDHA 4H4OB 4JP8A 2XGPA 3CF5Q 1HBUB 4J9RA 5H1SV 1F0XA 4RO0A 3AB2B 5D0EA 1BQMA 5HK4A 3VAGA 1NAQA 1JQGA 2HQFA 2R7RA 2MJNA 1CULB 1KNZA 1FDNA 4JOUA 2FJWA 1VC0A 2KFZA 2PEBA 3A8IA 4I2PB 2HQIA 5KT4A 3CJKB 1DQ9A 3OD2A 3N6NA 4C48A 2QYGA 3NS5A 3AOCA 1RKIA 2MKCA 2FUG9 3PO5A 4GRSA 4PUOA 3QWUA 3IG1B 1WSRA 4LBHA 4WYLA 3PYEA 1HD0A 2MKKA 2C42A 3FBFA 7FD1A 3K0JA 3DMJB 1WHWA 2Y8WA 2C1EB 4MIBA 3K5NA 1P8GA 4QU6A 1JKHA 3AFGA 2B9YA 3PYDA 1PILA 1R43A 1EB0A 1H7XA 2HZVA 3JQJA 2M0GB 4DV1F 4H4OA 1VQ9S 2BRKA 2PE8A 3D9BA 1HBUA 1KQFB 1NSAA 1NJIT 5D6GA 5AJ3F 4TLQA 3PJXA 1HQ2A 4JI8F 1BY9A 2KT5A 2OTJS 1CULA 2ZH2A 3NGSA 2AEJA 3LGMA 4OJ1A 3BZQA 5DGAA 3JYTB 3M6XA 5J1EB 4NMLA 3D0IE 4I2PA 2A2DA 2QA1A 3CJKA 2FHMA 4IYQA 4IQXA 2DR5A 4NL5A 3TJ9A 2QFIA 1TK8A 3QT8A 1EHWA 2DB1A 2A6OA 3IG1A 2ZZTA 1WNEA 4DFJA 3FUYA 2AEFA 3I87A 3HVWA 3ILLA 3KUGA 3JB9k 1B0PA 2MGZB 4DV4F 2V2KA 4D3HA 3MGJA 1WC6A 3SI8A 2HHXA 4IG3B 4IO1A 1S77D 4QIGA 3EUNA 4X4QA 2WRMA 2QLXA 1SC1B 4Q44A 3H7HB 2ZHBA 4IRDA 2W2NP 4ZIWA 2E5GA 3O44A 1NKCA 1HARA 2HQCA 4DV1J 2V5HG 2LXFA 5J1EA 3NGDA 2VFSA 4G1PA 4O4GB 2AEMA 3OTEA 3GJSB 5AJ3J 1NB7A 1K0TA 2V34A 2RT3A 2LXIA 3CJRA 2ASJA 1D9FA 2M52A 4UF4A 2BM0A 2DNNA 2XC9A 3TVKA 3IRXB 4EI2A 5KFFA 1RAEB 2JH3A 2MGZA 3EDRB 4JI6F 1YVFA 2RIJA 4QWAA 1WELA 4DI6A 1LXNA 3O2IA 2DBBA 3A8KA 2IFXA 4IG3A 4NLXA 2Z0GA 2ZH9A 1H38A 5CCLA 4ED7A 4DSIA 4WKYA 2YNIB 3R7NB 3NXZA 1C1BB 2O67A 4DV4J 2ZFHA 1HBNB 3T9ZA 2YWWA 5ITHA 1XC9A 2EVZA 2FYXA 5KOWA 2BE7D 3OL8A 3CJ0A 5E41A 4O4GA 1JIHA 4GVBA 3CD0A 2R7WA 1VQMS 1OPIA 3OSNA 4OYMA 1JMTA 2R2RA 3G86A 5J2QB 3IP0A 1X7VA 1QY7A 2OLWA 2I2YA 5DETA 3IRXA 4J9VA 2ERRA 2Q1LA 3LGHA 2C3OA 4HVZA 3WIVA 1LWXA 3RBXA 4FBTA 5BJRA 1SPBP 4RWXA 4RUCA 4C8LA 3JTNA 2HBZB 2LP4A 3EZUA 4P2MA 3DRSB 4ZCIA 5HJYA 2YNIA 3LQVA 1C1BA 3VV2B 4CLWA 4CLLA 2N4CA 4IQMA 4JI6J 4WFZA 4JI0F 1HBNA 3RG6A 1ZPWX 4HR2A 1HR0J 3MECB 3CCVS 2NR0A 5B7WA 3HHLC 3CTRA 2ZM6F 1CVJA 3G6XA 3OV7A 2IM2A 2I1RA 2QC3A 5J2QA 2C2KB 3IFEA 3HFVA 5E3AA 2EC2A 2HWHA 4F26A 2D7SA 3OR2A 1X9SA 1N54B 5ETLA 2QMUB 3UDEA 1VI7A 1S6QB 2MHNA 2VL1A 2EBEA 3IAS9 4Y0FA 4RX6A 4RW6B 2M3DA 1RYRA 2EPIA 4DDFA 2OD6A 4F2RA 2BA9A 1X8DA 1FT8A 4MK7A 3VAKA 3DRSA 4XIUA 4MIAA 2OIHA 1DBDA 5F8IA 3M8WA 2R7UA 5T41A 2KM8B 3EDQB 3THPA 1FRLA 3MECA 3GFZA 2H4WB 3GIMA 1AFJA 3I9V9 2W9CB 4HHJA 3JQKA 2MKIA 3SIPB 1F5AA 2DNQA 3KLEB 3IWXA 1VMBA 2DY1A 2CG8A 5E7OB 1U24A 3ZTSA 4DV7F 3DLEB 2DR7A 2HS0A 5EDWA 1VFJA 1NNDA 1X4EA 1SV5B 3PM9A 3EGZA 5SUHA 3L95X 4ECUA 4WK3A 1GNKA 2ZM6J 2DY9A 1OPZA 1RWVB 1W25A 3KKFA 4LFCF 4ZJQA 1REVB 1IBMF 1R8HA 4RW6A 4ECYA 1A0OB 3BN7A 1H2TZ 4Z2XA 1UA1A 2QJ3A 4ES2A 1Y4ZB 3M6VA 3DRRB 3EZOA 3Q8SB 1UFWA 3OL7A 2ZBCA 3I82A 4ZITA 1Q86T 2GX8A 2PT0A 1NDLA 3ICLA 1RACB 2HPUA 5E33A 2W9CA 2OEJA 3NEKA 2DEIA 2JEGA 3KLEA 3HJVA 2EKYA 2HHWA 4FPIA 3DLEA 2MPUA 2DD8S 4ZP9A 1HQUB 3GG1A 4LUBA 3KHGA 2GO8A 3PZPA 1SV5A 1VK8A 1B0TA 3N4WA 3HHDA 2V67A 4DV6F 3MR7A 4QOTA 4OYXA 4DUTA 1REVA 5F0WA 2XZWA 2MQLA 4DV7J 2VDIA 1U1RA 4DR1F 5IC4B 3KLFB 1YZ6A 1OQ6A 1YJ9S 3DRRA 1U47A 1RYSA 5IZHA 1F5BA 1O0PA 3HFKA 4M5MA 4CLKA 4LFCJ 2YWEA 4PWDB 1IBMJ 1X9MA 2FVSA 1U8SA 2Y3YA 3QMQA 5AXMA 3GJTB 2NXJA 3BEGB 3QT7A 3W1YC 4C97A 1WTBA 3B6BA 4DX6A 2KTQA 2GHPA 1XR6A 1Q95G 1SJFA 1SJ3P 2H54B 3PKYA 3M8RA 1HNXJ 3IM8A 4C8OA 5CA5A 3BGOP 2ROGA 1PYTA 1HQUA 3MOZA 2RRAA 2DGTA 4KRWA 3A3PB 2LQ8A 5DZ7A 4ZN1A 2YKMB 2ADBA 3G71S 3D1OA 4X64F 3RRKA 5K20B 1BUXA 4BBYA 4YY3J 4EFAC 2XEXA 2FJDB 2COLA 1MSWD 4YQWA 5C2GA 2ROPA 3KLFA 4DV6J 3MMCA 3JS9A 3CCLS 1N36F 3G2XA 2V50A 4LR8A 5LXYA 3W9HA 4PWDA 3FRYA 3TI0A 3T6JA 1RT3B 4ECSA 4I6WA 4DR1J 2XMKA 3U1LA 1KTVA 4JI3F 3PRVA 2HQGA 2VOOA 3D4JA 1B99A 5K14B 1MNEA 4OX8A 1UVNA 4N47A 3N6MA 4B9MA 3M8PB 3OBIA 1X4HA 2GCFA 4C8ZA 3HXMA 1KN6A 1NXIA 5IC6B 4TQRA 1DTTB 1SJQA 2ILZA 4AT1B 1NMEB 3SCLE 3FQLA 3RZAA 4LF4F 1M1HA 2BUNA 4KB7A 2YKMA 5EX0A 4OV1A 3H0PA 2MZJA 2CNNB 1YRXA 1RHJB 2G2OA 1YJNS 2DO4A 3CT9A 3CCSS 2P6SA 5CYJA 3WQPA 2ASLA 3Q2SC 4RNMA 1HNIB 4ZPCA 3BO2A 1FKOB 4DG1B 3HK2A 2K7KA 4HH1A 2OPQB 2UVRA 4EO6A 2BR0A 1TL4A 1RT3A 3PXGa 1J5EF 3AD7C 3PFEA 1FDAA 4WFYA 3NNAA 2ZKTA 2KG1A 3S7RA 1S10A 2DGSA 3VQTA 5K14A 3QZ8A 3KJQB 1N36J 3M8PA 1WC5A 2B0GA 2WVEA 1UVIA 4BWMA 3IR6B 2RE1A 1DTTA 4JI3J 2WSEC 4HYKA 3MR3A 2OGUA 4FXDA 2HYIB 3SYZA 3PACA 4X4TA 1FVQA 2G0IA 1T7PA 3TWZA 1SVDA 2BABA 2DHSA 3EICA 3GG0A 5L38A 4JI7F 2EI5A 9ATCB 2BEFA 1IR2A 3PX6A 4LF4J 3OXFA 4HT7A 1HNIA 3B8HA 1FKOA 3KHRA 4DG1A 3RB0A 2OPQA 2PMWA 3C15B 3OTOF 2YTCA 1KFDA 2VG5B 2YNFB 3W7BA 3NGKA 2AP6A 3MM9B 4RBVA 3T5LA 2N7CA 4LR7A 3H4BA 4LMZA 1JJHA 1JLFB 1J5EJ 3HSGA 4KPCA 3LP1B 1UP1A 5KFAA 3SZ2A 3D0GE 3W5ZA 2KVIA 4GMKA 2DNRA 1F3FA 2FHOB 3SSRA 2W9AA 4WXOA 3CCRS 2LU2A 5KT6A 3R7BB 1D8YA 3ILOA 3M8SA 2CPHA 3C15A 3HD1A 4TU8A 4CLTA 4TKTA 4NCBA 2HFVA 1Q53A 2VG5A 3THTA 1RWKB 4NYPA 2OO4A 3O3LA 2YNFA 3BBFA 4ZVPB 4JI7J 3T1HF 2GS8A 1VIXA 3MM9A 3HSDA 2R4FA 3AT1B 1JLEB 3OTOJ 1BLUA 1IVZA 1JLFA 4LSLB 2BVZA 3LP1A 3T6BA 3Q22A 1P27B 2C3YA 4MJKA 3AD9C 1NSKL 1KLNA 1JNZB 3BQ0A 1Z2ZA 4DL0C 5HLFB 5ETRA 3O8WA 2ZHOA 4OYAA 2OD4A 3I9ZA 3F0NA 3G6YA 3M2UB 2CG4A 3U7JA 4WIQA 1XWLA 2GQ2A 2VONA 4QIFA 3RB3A 4OYBA 5DLGA 4OQJA 1TKXB 4ERDA 5HATA 2KN4A 3VAJA 2WW4A 3RR8A 2B51A 4C3LA 1FNOA 1JLEA 3R9LA 1AUSL 4LSLA 2LU1A 3R1HA 4DV5F 3ILIA 1YJTA 2JEJA 2IDEA 3PCOB 3DLHA 3T1HJ 5EUHA 1UETA 1HI1A 2R8IA 3AJDA 3CDAA 1GX5A 4DPWA 5HLFA 4U96A 3QQCD 5IWAF 3PJ9A 1OQ3A 3DRXA 3W5YA 5HROB 3CCWA 3M2UA 3AOBA 1R89A 2GJFA 2PO4A 3B4DA 2IAJB 2HZCA 4DEZA 1T9VA 4X4RA 1FRHA 1TKXA 2OKQA 1K9MT 4LBPA 4F04B 3EPGA 4X4OA 2FLOA 2FZGB 1DQ8A 1JLGB 2VASA 2LYVA 3UDLA 8RUCA 4IRKA 1NPRA 3KMQA 1VC6A 2H5EA 2FY8A 2HNYA 1IN0A 5LMUF 3GWCA 4XTTA 5B0DA 3S8SA 1ZM2A 5LL6d 1T3OA 3CJSA 1RBOB 5F9LA 2CNLB 1RCOB 4DLGA 3GYXB 3PRBA 4DV5J 3P8BB 5HROA 3NBPB 3P3DA 3PV8A 3FBCA 2IAJA 3KXDA 1LWFB 1S9GB 5IWAJ 2NYHA 1CC8A 4CO5A 3DGVA 4RNNA 5CAAA 5B0GA 3OJSA 2HVDA 1JLGA 5ETQA 4DZ6A 1H7WA 3KTQA 3W61A 2FVQA 2H5IB 1U6BA 4QYZJ 2CXEA 1U0SA 1PGZA 4TYBA 1S1WB 2RDIA 1NK9A 2IJNA 1N34F 1KONA 1QAYA 4A8SA 3TR5A 2XNQA 3HT0A 1URRA 2FY1A 2RQKA 2B4UA 2SXLA 1UEVA 3L3CA 4UTGA 1QUVA 1FRJA 2J8AA 1FTRA 1GEHA 4PWWA 4J9PA 5AXKA 1FK9B 2VG6B 3NBPA 3D6MB 5LMUJ 2Z57B 2P5VA 1L5UA 5DO2A 5ETOA 1YKWA 3DU6A 1LWFA 1S9GA 3DLKB 5IXUA 4CDIA 5HMZA 4DL4A 2KXNB 3ELHA 4OZ0A 4QIVA 3OVSA 1XMQF 5HANA 2D1CA 1FF2A 3LF0A 4OI3A 2F63A 3MUTP 2FGCA 3RJMB 2IM1A 1ZH5A 3Q8QB 4NLWA 1S1WA 2IM0A 1TAUA 4XPEA 3D6TB 1S1TB 1RKJA 1RWXB 1L3KA 3WZ0A 3QFWA 2ZH1A 1RISA 1FRKA 5D4OA 3J81Y 2J9DA 2VODA 4QWDA 1RP5A 2JC0A 4WXWA 4USKA 1XBWA 1YRUA 4HEA9 3EM1A 4O3NA 1N34J 3SSQA 3G8TA 1XR5A 3V6DB 3JXOA 3A3NB 1FK9A 2VG6A 2PD1A 3CW2C 2Y9HA 4GKJJ 2AW0A 3Q2TC 1T9UA 4CO1A 4C11B 3GQCA 3K5LA 3DLKA 2L48A 3H25A 3PVXA 2WVCA 5JVHQ 2YKAA 3R5BA 4U6PA 4M5LA 2ZDOA 5FDLB 1H6KX 3A4TA 4NLGA 4QYRA 2KHDA 2PA8D 1S1TA 2HLUA 2B7BB 2XB2D 2EG2A 3E2EA 4J9OA 1XMQJ 1FXDA 1WF2A 4L72B 1S4FA 4CM0A 2DVIA 2MQOA 1CLFA 4AXIA 1Q16B 1VQNS 5KG6A 3BO4A 2OMLA 1VIOA 3V6DA 3VAHA 2LECA 3HM9A 2FJVA 1XEZA 3T1AA 2ACMA 2XQCA 4C11A 1FX4A 3PTWA 4DL3A 5K8NA 4HH0A 1YJ7A 3H2VE 5HVHA 1WHVA 5IT0A 3AXMA 3DDIA 2F4FA 2R8HA 5FDLA 1WDDA 5BXIA 2ZH5A 2ZKUA 4NA1A 4N76A 3N5BA 1RHQB 3HZEA 4Q0BB 2W2PP 3C8YA 1Y10A 1YIJS 3DNCA 4P9SA 1VBKA 5C24B 3BGUA 3A8EA 5LJ5Y 3K89A 4ZS6A 1XQIA 2HHHJ 1RUSA 3L7OA 3MAHA 3CC2S 3HVRA 5D4LA 3QT6A 2XS7A 3MHYA 1SL2A 4MKBA 1BMQB 2CPFA 1TUVA 3D54A 4FKYA 4DV3F 3A12A 2PC6A 4ANEA 2V4QA 3UR0A 2Y1IA 1TMMA 1S97A 5BYQA 5DG8A 4OYPA 1NK7A 5DDQC 2OSQA 2RS8A 3AA8A 3SFUA 4TQSA 4ID8A 2QLWA 2IHR1 4B9UA 3BH6B 4KH1B 2OEKA 1RJJA 2LQJA 1WC1A 5LSRA 4Q0BA 2XYHB 2AT1B 2V4RA 2F8HA 1ELOA 2N4DA 3IGNA 1OWXA 1R31A 4F02A 4DZDA 3IO1A 5C24A 2YWFA 4GKKF 1ACMB 2HFZA 2CQ1A 2HIQA 1OSDA 2AV5A 4RNFA 1DARA 3N6LA 1N5SA 1MWQA 3MUVP 1KWMA 3NGRA 1FFSB 3JSRA 1GK8A 1NM2A 1ULRA 4I6AA 5ETNA 4C8NA 2HFNA 1SUQB 4PXBA 1GFWB 1GXLA 3I31A 4ZOSA 4DFPA 2NS1B 2IBKA 3BSCA 4CTAB 2OI2A 5T14A 3CO0P 5IQ6A 1YI2S 3CB4A 3I0SB 4DV3J 2CZVC 2CA9A 1FXRA 5HN0A 3I5CA 1L3VA 1V9OA 1UVLA 5KFLA 1W26A 2RQCA 2XI3A 3D67A 3TW0A 1PYSB 1R6VA 3NGUA 3KDOA 1NBEB 2DPIA 4X2BA 4DF4A 2MQMA 2UV8G 1YSJA 2W2MP 3MI7X 2DH7A 1XN9A 4ILLA 3LW5C 2VH7A 4OIXA 4LF5F 3BPSP 1RE1B 1EIYB 1N0VC 1V6HA 1UL3A 3BH7B 4RUAA 4OZ5A 2RH3A 2QL7B 3ADAC 4GKKJ 2PMHA 2HRUA 1SUQA 1NDPA 1L3UA 3Q8YA 2RUSA 3J81j 4CTAA 4KGMA 4USUA 2GW8A 3PW5A 2CQ2A 1WKKA 5F8JA 5A6WA 3I0SA 1S6OA 2F4VF 1UJ5A 4LVOP 2F7VA 1OS5A 3V6KA 2EK6A 5IS2A 1Q8BA 1Q7LB 1PJ6A 3PNIA 4NXMF 3DLBA 3GJRB 1UA0A 3D0HE 3A1YG 2W7PA 5KT3A 3PW7A 2MZRA 2PDAA 4BS2A 2KH9A 4KT0C 3K17A 1NCLA 3FSIA 2C2ZB 4QIEA 4KYZA 3C6TB 2KFYA 3N01A 1RHKB 1RADB 4F4XA 3DXBA 5L9XA 2FVRA 3US5A 4DV2F 4I4BA 2BMBA 2D69A 2BW2A 4UW2A 4MMOA 2EFPA 4HTJA 2GIQA 4LF5J 3PYGA 1SC4B 2AGPA 4M5KA 2AMCB 1RT2A 3EWGA 4EGLA 5IV3A 4BHQA 2E29A 2V2VA 1NHKL 1SIWB 1NK6A 3MM5B 3S6EA 5KT2A 5DJBA 4W92B 1F5CA 1X4GA 4WZMA 1K73T 3Q23A 5CYMB 2EFGA 5CD4H 3TZYA 2MZTA 2H4YB 2ZWPA 3D5MA 5LSLA 2GQCA 1NEEA 3MTKA 4ES3A 4PAAA 2IY5B 2J9CA 5IT9Y 2IJFA 1WG5A 4TLRA 2X1GA 3C6TA 4NXMJ 2ZVSA 3CCQS 3MURP 4IOCQ 4C8MA 3WIUA 2MQNA 3MMJA 2DNMA 4KPYA 1LK7A 4P7TA 2MYFA 3KK3B 3G96A 1SH3A 4EU0A 4CH0S 1MW7A 2F40A 1WEZA 5DDPC 1C1CB 2G4BA 2CQ4A 2B9XA 2OPPB 4CI0B 4DV2J 4A8QA 3MM5A 3MAAB 2A10A 2AU0A 4YDXA 1RQ0A 2HGLA 2EBGA 4ZVFA 3UVJB 5CYMA 5D78A 4IFVB 1N6QB 1DLOB 4R25A 1KR4A 1BWVA 3KFWX 2AX1A 3TZXA 2VPXB 2W2QP 1C0UB 1RWPB 2V6AA 3N5FA 2CPIA 3NLCA 3FRZA 5F0UA 2BQ3A 1QE1B 1TTHB 4M63A 3A8JA 3GCXP 3CCJS 3IXQA 3PHTA 3TUIC 3HHLB 4IR1A 3HF5A 1C1CA 1DURA 4FXVA 3B54A 2OPPA 3C16B 2HHPA 2ZNYA 1ZZFA 5KFXA 4P75A 3MAAA 4O3RA 3KHHA 4USMA 4JYAF 2WZ1A 4ILMA 3ZXWA 2DHGA 3UVJA 5HMWA 4Q2LA 3UCGA 5L39A 4A8OA 3FFIB 3KOAA 4EBDA 5DRKA 5EX3A 2EFVA 4IFVA 1N6QA 2ZUAA 1VOMA 2HQ3A 1DLOA 4OJHA 1HNWJ 5KG2A 2WW8A 4DUZF 2X3GA 4JI5J 1S72S 1K1QA 3MR2A 3DYAB 1C0UA 3ETOA 3NY0A 3LPEA 5KG5A 3RTVA 3GFYA 1CJKB 2B43A 2E1AA 1QE1A 2IPOB 2RDJA 1KSPA 3Q8UA 3HHLA 3AAWB 2LQBA 1U1KA 3QJJA 1X31C 3C16A 4EMDA 4IR9A 4UQTA 2V8VA 2V4JB 3UNGC 5D15A 3I6PA 1PG5B 4CT8A 1GMWA 3PIOQ 1OYDA 1R8PA 4B9VA 1VQPS 2ZDPA 1G4CA 2N3OA 3VZIA 1HWJA 4X65F 3JAMY 1SH0A 2F9JA 1TV6B 4K4UA 2LEPA 2KHCA 4R0JA 3MFHA 2M5YA 2GJ2A 4LFAF 2D74B 5KFNA 4PWUA 3FFIA 3UQSA 2N3LA 2DXEA 4N8NA 4BDPA 2MSSA 1U1PA 1ZA2B 2FLLA 3CUNA 4LIWA 3OFEA 1ZS6A 4DV0F 5ETPA 4IOAQ 4J9SA 1S79A 3DYAA 2XLIA 4CCHA 4EBCA 3D6FB 4HKQA 1CJKA 1N4LA 3NCPA 2HHTA 4JI1F 3MD1A 4TNOA 2QA4G 3PX0A 2KJVA 4A8WA 2XMUA 3DI6B 4DUZJ 3MPUB 3MOJB 1MN9A 1K8AT 2V4JA 2DHHA 3MPYA 4RU9A 3AOAA 4IH6A 2ZZMA 5IV4A 5F8LA 1H73A 4OL8A 3GLJA 3ILJA 1TV6A 2YWHA 3W9IA 5CYQB 2CWXA 1EARA 4AL7A 1Y9OA 3HP6A 2WOMB 2VBYA 1QJHA 3EZ5A 3DC2A 5KTQA 4X65J 3L4BC 3I4PA 2NSBA 5L9NA 1HW8A 5E2QA 4LFAJ 1Z2LA 2DNYA 4FF2A 1RAJA 4M5GA 4IH5A 1Q5VA 1FEHA 2ABYA 1D3WA 1MMLA 4J9UE 1VCTA 4KFBB 5AE3A 3BO3A 1X4AA 3KLVA 3DI6A 4DV0J 2R2SA 3RB4A 1GXTA 4IDKB 2OSRA 3BDEA 1ZTTA 3FSYA 1B3TA 4TXSA 1YQHA 5GADU 2QYCA 3T3FA 1VK3A 4ZPDA 1ZA1B 3V6HA 1FNMA 1XMBA 4U8YA 1IKWB 4QWBA 4DOZA 3MPVA 3DRYA 4V19J 1R8CA 2WOMA 1R3NA 1XNRJ 2FJXA 4F4WA 2FJEB 2ZBQA 2GHWA 2A2CA 3NKYA 2VBXA 3MF5A 1VLYA 1CC7A 1X0FA 4LIRA 5J2NB 2K3IA 2YPYA 2DGOA 3R27A 4KFBA 2XMMA 2J0SD 2VBWA 1TUWA 2H5JB 3BQ2A 5C5JA 2VFRA 2KYXA 2RUGA 1S6UA 3KNAA 3BGFA 1ZAVA 1OY9A 1IWGA 4IDKA 2CJXB 3GIKA 1EX8A 2CPDA 4QPTA 3V6JA 3ETMA 4CLFA 2XO6A 2RHSB 1XK8A 3OTCA 2DT9A 4ATNA 5B09A 3EMTA 5CZXA 1FI4A 4B9NA 4Y2IA 3G87A 2VHGA 1IKWA 1GAOA 3HDSA 4OYIA 1VQ6S 1IBCB 4U8VA 2V8HA 1N33F 2HHQA 4FN5A 2HAFA 4DS4A 2ZH8A 2VB6A 3KJVB 3IR5B 2M7SA 2ZH3A 1HYSB 4NZ0A 2MQ8A 4KQZA 5DG9A 3BR9A 1RAIB 4WP9A 2GHVC 5GAEU 5JJBA 5J2NA 2QLBB 2CNOB 4W4MA 5KFSA 1SJ4P 2BE2B 4OI6A 4B9LA 3D2WA 1VQ5S 1YHQS 4PG6A 2VV5A 1M5KC 3BSAA 5GAEI 3QJPA 5ETKA 2MLZA 3DGPB 1T05B 2G1HA 4XAKA 3C14B 5BYSA 3EYZA 2KT3A 4EWTA 3SFGA 3L7PA 4CLUA 3CMAS 1Q82T 2CJBA 3K7RA 1JWWA 2EG1A 3SEOA 4ZLLA 2BM1A 3MM6B 3IN5A 4USHA 3CJ3A 1S12A 3M7VA 3EX7B 4NYOA 1YTYA 2R42A 2AJ0A 2VPWB 5EWEA 2X1BA 5DQIA 1LWCB 1NRKA 3KJVA 1HYSA 1PCAA 2WAQD 3MWBA 5J2MB 2VJUA 2YVSA 2BJ7A 4YUDA 5D0HA 4ZJOA 4WCEQ 1BWEA 1RAGB 2BE2A 2EK1A 1Y5IB 3H8YA 1IBKF 1FRIA 1SKRA 4QCLA 1I1GA 4JV2A 2GNKA 1FJGF 1JLQB 4KGZB 1WOPA 2NCKL 5ETMA 5HBMB 1APSA 3SCJE 2VG7B 3MDFA 5GAHU 3DGPA 1T05A 1PKUA 3C14A 2I5JB 4DUYJ 2BACA 3ZTRA 1FDBA 4QBUA 3CJ2A 1XJWB 4RW4B 2E7XA 1FD2A 4USVA 1VJQA 5HQMA 3MM6A 4FYXB 4OFZA 2GAHC 3J80Y 1WOOA 1LWCA 4QZVB 3G4SS 1GMUA 2ZH6A 2CQHA 5KAKA 2KFNA 4RUHA 5J2MA 1RLDA 1HPZB 2IA6A 1T9XA 2PIIA 4OHZA 1LWEB 1B7YB 2VF3A 2XS5A 2MTLA 3MAQA 3H5YA 2UZAA 2R7XA 2ASDA 1VQSA 1WHXA 2RVJA 3MZIA 1JLQA 5F8NA 4H54A 1KOHA 5HBMA 5M2RA 4KH0B 3MFIA 2VG7A 1G2EA 4USIA 2I5JA 1IBKJ 5B0FA 4YS2A 1UPMB 3LP2B 4RW4A 4KV8B 1FJGJ 2EWHA 3Q83A 2IYIA 1XERA 2DNZA 4DR2F 4ED8A 2O5DA 3ZO7A 4NCAA 2MZSA 2UUTA 3W2WB 3UCZP 3UNYA 1FVSA 3SDEB 1HPZA 1PSDA 2DISA 3ZNJ1 2WHOA 3EE3A 1LWEA 2HNZB 1TK5A 2JJ4D 4FF1A 4DX7A 1K44A 2KM8C 4NE9C 5KFMA 2E5LF 4NLDA 2HFSA 4FXWA 3NS7B 3NCRA 2R2TA 1V3SA 4EYIB 2J7WA 3SBMA 5AE1A 3ZZTA 1Q79A 4YN3B 3RU0A 1MWZA 4K2XA 2YQ0A 3P4UB 2OTLS 3LP2A 4KV8A 1S0MA 2WK4A 5EGYA 5A8RB 4PPDA 2ZC3A 2C2EA 3SQOP 1ZYQA 2CDRB 3CCUS 5E5NA 2R9LA 2ZHAA 3H40A 1FRXA 2HS4A 2E7VA 2ZUGA 3W2WA 4QW8A 1RT7B 1IWAA 1CJTB 3SDEA 3I0RB 3M9OB 1FE0A 2B56A 1L3TA 2HNZA 4DR2J 3KK2B 2W1BA 4F7VA 5HO4A 3HVAA 3OHAA 5AT1B 2ZJRQ 5K8OA 3DCAA 3S01A 5L1IA 1FDDA 2QTWA 3KG1A 3W3SA 2HHVA 1T9TA 1WORA 1EAYC 5HQLA 1NJXA 2RU9A 1ITPA 3TX0A 1U48A 4M95A 3M1VB 2AZ1A 2Q6BA 2CQPA 1C0TB 2R7QA 2JLGA 3BKUA 2FC8A 2X3DA 2KXFA 2CKWA 3UD4P 1VQ7S 1HFEL 2E5LJ 3AQPA 1BHNA 5A8RA 4LQ3A 2N82B 5F3TA 3N0VA 1T95A 1UW4A 2IVMA 3W60A 2E5JA 1VJWA 4GC6A 1M5PC 2Q3PA 4PXEA 3BREA 3FZ2A 3I0RA 3K5MA 6FDRA 2EEYA 2DNOA 4NLPA 3Q8VA 3KK2A 1AT1B 2QT7A 5EN1A 5F8MA 2XLKA 1AYEA 1EP4B 3J81U 4P72A 1IM6A 2QMXA 3WC0A 1U2CA 3ONQA 3H98A 2J7KA 2MLYA 3NMAA 1WKLA 1UFLA 1UJ4A 4P2SA 1NHVA 4ED1A 2XULA 3KNGA 1D9AA 1U1OA 2DH8A 4MKAA 4URSA 3M1VA 2E9ZA 1IR1A 3BGLA 1C0TA 1W2IA 4E98A 1RAHB 4M5DB 1RAAB 4ELVA 1BXNA 2B4VA 2IDLA 4J90A 4CO3A 1ZPVA 4X66F 2R8JA 2W25A 4N5SA 1AZSB 5DM7Q 2ZOMA 2HIYA 3DMJA 3VAIA 2H48B 3DFEA 3C19A 3WBZA 2Y1RI 5G0RB 1EP4A 2DXDA 1FFWB 4USTA 3DXSX 1X0PA 4HT5A 3D28A 3OR1B 1FCAA 2OPSB 2J0WA 2J9EA 2HVHA 2CJYB 4Y34A 4Y6IA 2C3MA 3JYTA 1YJWS 4U67Q 2DNLA 5A6PA 5THWA 1VQYA 4M5DA 3UI3A 4I56A 1JNRB 2C2OB 4FYDA 2KO1A 2QRRA 3MEKA 5FLXY 3RBZA 1J2VA 1AZSA 3TP2A 4OMFG 1QLNA 4EO8A 1XR7A 2ZD1B 2BANB 3OUYB 3NRBA 3OVAA 4K50A 4B3TF 3KUEA 4DFKA 5GVQA 2M9KA 3OVBA 3IMQJ 5G0RA 1TUGB 1HR0F 4F0HA 5GAGU 2KKHA 1S5ZA 4X66J 4GC7A 4Y2AA 1MN7A 2P9EA 3OR1A 2OPSA 2KJWA 3JSMB 3NWGA 2M8DB 1AB8A 2EC0A 2Z2YB 1FNXH 1YG0A 2L9DA 2VOPA 3TOQA 1H0HB 2HW3A 5HVFA 2MEWA 3QYYA 5GAGI 4IO9Q 3ITHB 2YQ3A 2B5JB 3CJ4A 3M9NB 4OX7A 2Q43A 4ZPWR 1VBXA 1DQAA 1Y3JA 5L1LA 4W90B 3L9ZA 2OH2A 1PJ5A 4UT4A 4PYAA 1KD1T 4GO7X 2L9NA 1RT1B 2HK3A 2ZD1A 1S49A 2BANA 3OUYA 3PW2A 2GGPB 4PQUB 2XMVA 1Y00A 2C2DA 2DCLA 5FJ4A 3KDNA 2MKHA 1LOUA 3TEHB 4O3QA 3DM2B 1H2UX 3P5TL 4JI4J 2Y0SD 4TYAA 4ZVTB 1LFPA 2DCUB 5A0YB 3JSMA 4RJVA 2AJ4A 2ACYA 4Y65A 1YDLA 4B3TJ 4LRCA 3BPDA 5IOLA 4ED3A 1YRTA 4K2JA 1YBAA 2OFHX 3LWLA 3QBCA 3NP5A 2BQRA 4ECXA 1PAUB 2YWKA 3ITHA 3K5PA 5LT5A 2B5JA 5K8PA 5D0RA 1T9YA 1MROB 4LBIA 5H9EK 5HI7A 4DQRA 1LW2B 1TL1B 2GMJA 1H74A 3VGSA 4O23A 1RT1A 2R2UA 4DL7A 4A8XA 2GGPA 4NLOA 4PQUA 3HLUA 3VGUA 4M5IA 4NA3A 2Z58B 2JSXA 4B3MF 9RUBA 5AE2A 3DM2A 2W9BB 3MM8B 4DL6A 5A0YA 1OMSA 4B9SA 3I4HX 2D9PA 2J8SA 2MKYA 1BGXT 1KHWA 4I0WA 1VRTB 1S57A 1U4BA 4UZCA 1N56A 2I8EA 4F0MA 3NOCA 2HGMA 3NL0A 2HK2A 4LRFA 2B8PA 1MROA 4B02A 4NPOA 1KQSR 2PFDA 1LW2A 5J2PB 1TL1A 1GH8A 2VC0A 3TVYA 2CPJA 3KHLA 1VQ4S 3FJ2A 2DYAA 4DN0A 5JMNA 4J5OA 2BJDA 1S6QA 4V19X 3HT3A 4ED6A 4H4KC 2W9BA 4LF2A 6FD1A 2GVDB 3HZGA 4FNHA 4C3KA 3MM8A 2XO7A 1EKRA 4NZ6A 2IVYA 4WFBQ 2D3O1 4KY3A 4CP5A 4ECTA 1M1GA 2BKPA 3U02A 2V0NA 1HNXF 4KGVB 1VRTA 4G3IA 2CRLA 4C4WA 3QATA 1WI6A 4WP8A 2XMJA 3O5TB 2GMHA 4B3MJ 5AXNA 1KVJA 4J9NA 3PW4A 3JSBA 1NPPA 1HBMB 3VAFA 1QSSA 1ZAXA 3DN9A 4DCOB 1O51A 2CJKA 2NZ4A 3C6UB 2FVPA 2JHEA 3CCTA 3ZTQA 4B9TA 5E0OA 5J2PA 4YY3F 4Y00A 2VQEF 4A4JA 2F1FA 2IRYA 1RTJB 3D1HA 1IQZA 5RUBA 3BSNA 4Q8EA 1AA1B 3DDNA 1DZ5A 3CDBA 1TQLA 1VYAA 2GVDA 1SJRA 2WONB 1FEEA 4CRJA 4OZ1A 5CCMA 2W4DA 4JV1A 1S7IA 4B3SF 3LPYA 2OEMA 5IT9U 3M30B 1RBLA 3PDNA 3MXHP 4BC7A 2HEKA 5IT4A 3CD7A 4C8YA 4JV5F 2PI4A 1Y0HA 4F36A 2AD9A 3HCXA 1HBMA 2CFXA 2MY7A 2LDIA 3K8WA 5GMDA 4X4VA 3C6UA 4DJBA 3D3BJ 2IC3B 2AQ4A 1KTQA 2NXEA 1NDKA 2BJ1A 1RTJA 1EZZB 1OY6A 5KFHA 5F9NA 1NLKL 1X5SA 2CPZA 2JFKA 3V4MA 1H72C 2WVFA 1Z4UA 1DTQB 1F9EB 4HI1A 5G4DA 2JFDA 2DRBA 2O3DA 4OX9F 2FC9A 2WONA 2LEBA 2K2PA 2VQEJ 3IBWA 1ZTWA 2W4CA 3GFXA 2O1PA 2UUCF 1I3OB 3J7AN 2AJ2A 4LFBF 2WCXA 1TKTB 2QL9B 3M30A 3JTPA 1Q78A 1KEKA 3KLHB 2B9EA 4L3KA 1P1TA 2JLFA 3CMQA 4AE5A 1C4AA 4UY8T 4NI2B 3CCMS 4B3SJ 3AJ2A 3IS9B 2BXJA 5I3UB 1U1QA 4NWBA 2IC3A 4AXJA 3OSPA 4JV5J 3R5DA 2CVIA 1U02A 4RPFA 4LR9A 4LQ9A 1R27B 3M8YA 5J1NA 4ED5A 1SJ1A 2ZVIA 4Z7CA 4UUWA 2ZNZA 3WHIA 5B0CA 1DTQA 3MR5A 3QSIA 4Q7AA 1NDCA 3G8SA 4ZPTR 2KB2A 3OXLA 4FBUA 1AFIA 1BC6A 5B0AA 4HDGA 1WC4A 5AXLA 4RWWA 2FVCA 1LW0B 1IBLF 2DR9A 4AUKA 3GTYX 2IYGA 1TKTA 1KVIA 1HW9A 2MKJA 2GZOA 3DDKA 1SBRA 3KLHA 4G6VB 3CWJA 3LH2S 3OFFA 4OX9J 3RW6A 5K9FA 3K5OA 3IGVA 4NI2A 2P6TA 2HNDB 3IS9A 2UUCJ 2JDJA 3CE8A 4LFBJ 2MY8A 5I3UA 5D3GB 3MPWA 4P6QA 4KSEB 1S1UB 2VJVA 5KFEA 1NZ8A 3ZZOA 2Q79A 3R97A 4MTPA 5KT7A 2BOAA 3W64A 1JXLA 3BBBA 3H42A 4U7CA 3JAMU 2HMIB 2YXLA 4IKAA 2RMLA 5BR8F 2QLJB 1T94A 1OJ4A 3DRPB 1WACA 1JX4A 1LW0A 2OELA 4DQIA 2VQFJ 4CH7A 3HVTB 3VCDA 2NUHA 1RCXB 3VVUA 1RB0A 4ZLNA 2CPYA 3CCZA 4P2XA 3MEDB 2VKZG 3BS9A 3H2UB 3SV4A 4U7UK 3FEZA 3GJQB 1VQOS 4WK1A 2RSQA 2E66A 3CSKA 2HNDA 3I5BA 2DGXA 4NLRA 1IBLJ 1TL5A 4KAIA 5D3GA 2ROEA 5CZVA 1QUPA 3MM7B 2CJAA 1UWBB 1AXQA 2J76E 1V5VA 3TX8A 4JUZA 1HWUA 3X3UA 5DQHA 5HJXA 4FDFA 2HMIA 5KFVA 4DLEA 3PR5B 2ADCA 1XNQF 3T41A 3DRPA 4CO0A 3K58A 4LF7F 3HVTA 1JLCB 4AL6A 2MQPA 1I94F 3AJ1A 3MEDA 3SXLA 1WDTA 4Y2KA 3QGIA 1UW9A 1VBZA 2J6TA 3TA1A 5BR8J 2CADA 2HSEB 4ZVGA 4E2FB 2P2CB 1IJFB 4Y2MA 3W2VB 3KYLA 1FKAF 3W65A 4OZ3A 1HNZF 3UN2A 1S59A 4FF3A 1J27A 4CYUB 3MM7A 1UWBA 1GQEA 2FIUA 2HRTA 4AD6A 2W7OA 2H3EB 1VISA 3I5AA 2FHJA 3M2RB 1JB0C 4JBCA 2R7SA 3QAUA 2ATCB 5D0GA 4F4YA 3EGVA 4DHVA 2I38A 2MKSA 4OZ2A 4CLSA 2RDDA 3VGTA 2GIFA 5KOXA 1N52B 1Q8IA 2VPYB 1FFGB 4KE5A 2V68A 1TZ0A 1JLCA 2Y1LB 4PXCA 1JXEA 5C25B 2WB1D 1N5VA 1VS3A 2DKOB 2BRLA 5HSPA 2W01A 5EHHA 2XLJA 4AQYF 2W24A 5EWGA 1XNQJ 4K7QA 3FGVA 4LF7J 1GXUA 3ZZPA 3W2VA 2D3ZA 4WU2A 1ZM9A 4CH1A 1I94J 1TKDA 4MYUA 4CYUA 1VLOA 2BYCA 3CVKA 3K57A 3TYTA 3J7Z5 4OLPA 3HFZB 1N8RT 4DR4F 3M2RA 3D6HB 3RW7A 4L76A 1HNZJ 3FNNA 4O3OA 2MXYA 5C7PA 3HI9A 4IUFA 4TN2A 2C2MB 1RU1A 2RHQB 3TNVA 5C25A 2QLFB 5DZ6A 1RHUB 3BM7A 4ZK7M 3R5JB 4PYDA 4QR0A 2XNRA 3TA0A 2XBPA 1WEYA 4DSJA 2G9OA 4N41A 2XI2A 2GFFA 1CQNA 3LOUA 3MPDA 2E5HA 4F4AA 1N48A 4K4ZA 5KFDA 2VFUA 4NRUA 2QSWA 2HGNA 3TA2A 4AQYJ 2Z4PA 2CPXA 1UVMA 4QQBA 1M1KT 2JRSA 1YK9A 1F9FA 2J0QD 1NZAA 5A76A 1VGYA 3TARA 2IRUA 1W2BR 3HULA 2A18A 2W8KA 3W62A 1D09B 4CO2A 1FO1A 3OFGA 5LJ3Y 1JJCB 2OFGX 4ZP7A 4DR4J 3FEXB 5HQ8A 4YDDB 1B7FA 1V3ZA 3CJ8A 3IWLA 1VQKS 4A8YA 7FDRA 4A8KA 1ZBTA 3LTOA 2JVOA 1K0VA 1UCNA 2KXHA 4CM2A 5FD1A 3AODA 2XTJP 1ZETA 1HIYA 3NWRA 4MAKA 1OY8A 3H59A 1T03B 2ZOGA 1UEUA 1H98A 4OJ3A 1NU4A 4J91A 2K1RB 3GR1A 2EKNA 4GKJF 5HAOA 4OYOA 2G0JA 1ZOTA 1FXLA 1NJYA 1HMVB 4UUXA 1RA6A 4WTYA 4DR7F 4P7VA 1KBRA 3HHNB 2QEXS 3J80U 3R5GA 2DGUA 4GVBB 4WF9Q 4FF4A 5U47A 2IM3A 4NLYA 4I6YA 4A46A 4MT1A 4JI8J 1KRPA 1RDRA 3UD3P 3ZZYA 2VUGA 2UVWA 3UPFA 2UUAF 2ALYB 4WTOB 3CIMA 1CPZA 2ZBPA 1KHVA 1NJWA 4DBQA 2AKWB 1Z1ZA 3BYRA 2A0FB 4ZDNA 4YMEA 3R2DJ 4Q43A 8ATCB 1T03A 3NAHA 2W2OP 2ASYA 1WOSA 4WU3A 2K1RA 2PEHA 4ECWA 1BD6A 1M5VC 1QTMA 1HMVA 1CBKA 2IVFB 1DY3A 4KR0B 3CDWA 4RLEA 2XM3A 2YKPA 4DPUA 3E01B 2I0XA 2BQUA 3EVMA 4ZVSB 4U7UD 4ID5B 3PX4A 3TJ8A 4DR7J 4DS5A 3DU5A 2AYGA 2GO9A 3ISNC 2HVEA 3OR2B 1ROFA 3UN3A 2HHSA 4QR2A 3Q8PB 1VHFA 3HX9A 1MU2B 2HHHF 1G7CB 1GX6A 3I96A 2HRYA 3HD2A 2UUAJ 2VIHA 1NSQA 4WE1B 4HI2A 1TELA 3A13A 3E8OA 4DF8A 1HL6A 3A3OB 4NZ7A 1RTDB 3POTB 2AJ1A 5B0EA 3SCKE 2DPJA 3E01A 2XYGB 4FP9A 1QVGR 2CPEA 2XSJB 4CT9A 1KP6A 2VICA 4ID5A 4XDDA 5KFJA 4XPCA 1Q5YA 3PJWA 5DQGA 1NK4A 3FKBA 1PIEA 2Z8QA 1AUDA 2H51B 5KFKA 4YR2A 3SMZA 3NCQA 4ILRA 2DNPA 2E7WA 4M8LA 3T5JA 1WI8A 4QPXA 3N9UC 1MU2A 3SQGB 4ECZA 1QAIA 2P9CA 1RAOA 3UR3C 1R8BA 3R6LB 4OZLA 2GQQA 4F2SA 2L3MA 4K4WA 1VR6A 4IOBA 2XY6A 4CWBA 4DU8A 4WE1A 2ZJQQ 4LF6F 1YGYA 2PFFB 3GSIA 3TANA 2GMLA 1WJ9A 3C2PA 1RTDA 2QO3A 3POTA 2QFJA 4I64A 3KG4A 1X5OA 3NS6A 4KHPF 3B82A 1KLMB 2XHCA 3AXKA 4RNOA 1WD6A 4QWEA 3DLLQ 4ZN3A 1NK8A 3UW1A 4ED4A 1QVFR 2XSJA 3VZHA 3SSSA 4NLSA 4WFAQ 2YPZA 1HKAA 5ETTA 3FMBA 4JI0J 4YR3A 2BV3A 4L75A 2BOPA 3PRDA 1U7LA 4ZCKA 1WWHA 4HHUA 1Q81T 4FZVA 3SQGA 2F9DA 4WP3A 1NSPA 4CNZA 1RZMA 4KO0B 2F8MA 2A1BA 2YH0A 4CLYA 3FMWA 2VD3A 4CNYA 2IIHA 1Q0NA 4ZVQB 4WBFA 4ECQA 1RBAA 3H90A 1R7IA 3Q24A 2NLWA 3UN5A 1RT4B 2AGQA 1KLMA 4E0DA 3NAIA 5H9FK 1KKHA 3PFOA 4LF6J 1LFWA 2MSTA 2RS2A 2G2ZA 3KUHA 3QRRA 3TUPA 3CEDA 4YB6A 4HHHA 3ENVA 1UEKA 2IRXA 4KHPJ 3CDEA 1C4CA 2CZ4A 1R0BG 4ZMMA 2CQGA 2XS2A 2M70A 4MKYA 2DK2A 3IRWP 2X1AA 3HJFA 3G9CA 4OHWA 1E6YB 1YBTA 2RQMA 4KO0A 2QX0A 2C22A 1SL0A 3GONA 1A7GE 4F3QA 2YBVA 4ZA1A 3IAM9 1SIZA 1A6LA 3MMCB 2FLPA 5F41A 1RT4A 5CXTA 2E44A 1M0SA 3LANA 2E1RA 4ETZA 1GMVA 4UOCA 1IM4A 3KJNB 4FVMA 3CIZA 3P5BP 5FLXU 3R7SB 1U26A 4ITSA 4DSKA 2YKOA 3TEGA 4CZCA 5L1JA 4TY9A 3ZNUA 3NMRA 3Q86A 1YJUA 2PSZA 4OHXA 3RRGA 3OT9A 4WFXA 2BDPA 1IR0A 2L08A 1DFDA 4L6V3 3F73A 2LA6A 1E6YA 5A2QY 2Y1JA 2MQQA 1RA7A 4FYYB 4MFBB 4WJBA 4KHMA 3R2CJ 3MCMA 4AL5A 4F8RA 3IBFB 1FX2A 1RTHB 2YX7A 1MG7A 2ZC4A 3GIIA 1CJUB 4FS2A 3ZFVA 4ANDA 3MMBB 1AROP 4C0BA 1SKUB 4ZPAA 1KS2A 4BCAA 3EXYA 3QZ7A 3DLGB 1QM9A 1TFYA 3H5SA 2HBYB 4RNHA 1DRZA 2YNGB 4LRAA 2Z2MA 5DDRC 4X4UA 2NPFA 1IXKA 2KRRA 2XSFA 1YITS 3T5KA 2BJ3A 2B3TB 3LP0B 3GB0A 2XCPA 3M9MB 4FYVB 1GTEA 1CQMA 4RBTA 4RUBA 4ZVUB 1FWKA 2EFNA 3ENQA 2N7YA 2Z2LA 4MFBA 2J0XA 5DS7A 3ZTOA 2DRAA 4FPRA 1F1BB 1SL1A 2WVBA 2JWNA 4R5PB 3GFHA 4F0KA 3FSXA 4MH8A 1RTHA 3UWTA 1CJUA 3ISND 4OZNA 3IBCB 1LK5A 3E51A 5F8GA 1O8BA 5IQQA 3MMBA 4DWIA 4X64J 3JQMA 1Q1KA 3NNHA 2YWGA 2WSCC 2POKA 3L09A 2GA7A 3DLGA 1CJVB 3FCVA 2P8IA 2OPRB 3J7YU 2YNGA 1MLAA 1NHUA 2XMTA 2QA2A 1JLAB 1JK9B 2VFTA 3O6QA 4G1QB 5L1KA 2QIFA 3QLHB 1N88A 3UO0A 3FZBA 5ETVA 3LP0A 4Y2CA 5C2CA 4G65A 2MLXA 3HHLD 2UXDF 3J7YI 4OI1A 4DQQA 2ZBRA 2GIRA 4CQ1A 3LUYA 2UUBF 1JXVA 4M1KA 2XY5A 1HNWF 2FPHX 4JI5F 1GMWD 4R5PA 4RR5A 2XG8A 3M2VB 2E9TA 5E3PA 5KFPA 1Q7YT 3C3LA 1X4CA 2G2YA 5JXSA 3ISZA 3EGWB 4DFMA 4AYBD 3Q0AA 1CJVA 4KC5A 2IMWP 2OPRA 2AZ3A 1UAWA 2K8GA 3H5XA 1JLAA 1N5QA 5HMXA 1DHMA 4DMZA 5KFZA 4G1QA 4USJC 3KK3A 3MUMP 4DR5F 3QLHA 2RRBA 4UZBA 3VQSA 2LEAA 3NOGA 4NLQA 2DR6A 2DEJA 3MEGB 4B08A 2CQBA 4IG0B 5KG3A 1T11A 3MCOA 1U1NA 2YH1A 2B8QA 2NPIA 2AGOA 2L9WA 2NXCA 1F3VA 2NQPA 3N28A 4OYZA 2IMOA 5KFYA 2E1MC 2UXDJ 2X1FA 2UVVA 1TK0A 2DNHA 2JX2A 3M2VA 2CVEA 2K7JA 1KQKA 2UUBJ 2DIVA 1X4DA 4C7QA 2VFVA 1NKBA 3VAMA 2DNKA 2WB4A 4USWA 3VALA 2HWTA 2RKIB 3QRQA 1NKEA 3LAMA 1L3SA 4OI4A 2HFUA 5D8HB 2OP5A 2HVZA 3T5HA 3MEGA 3UDCA 2J6UA 3HPOA 4N7TA 5LMNF 1PBAA 4TVAB 4CIOA 2U2FA 1LKZA 4M5JA 4IG0A 1SC6A 2Z2ZA 3DHXA 2GC8A 1YWXA 3OXGA 4IFYB 2UV8A 1N0UA 4A8FA 1S1VB 2CYYA 5KFUA 3UDVA 4DR5J 2ALZA 1F6TA 1SQFA 1FESA 2C3PA 3R5CA 1T02A 5J1PA 4Q8FA 3UE2A 2WTFA 1YJVA 4O4RA 3HSZA 2UUWA 2E1PA 1TMJA 2XYPB 3F44A 1F9HA 4TU9A 3BV8A 2VU5A 2HS3A 4U95A 1T8EA 1P9YA 2FJBB 3M05A 2ZH7A 1EQ0A 1V3RA 2RKIA 4LVNP 1VQ8S 2OHDA 3K59A 3T9NA 3QSYB 2LDYA 3GMGA 3BBCA 5T7LB 2G1DA 2UP1A 2PGCA 4Y28C 2J9DE 1JJ2R 2BJEA 2J5AA 5F8HA 2HNYB 2BW7A 4ZP8A 4PR6A 1UKUA 4IFYA 1S1XB 4V1Ak 3ENAA 1XNRF 3U1NA 2Z30B 4RL1A 1S1VA 2DGVA 4EK2A 4I7FB 4B17A 1U6ZA 5LMNJ 1GTHA 2RB7A 4KIAA 2NYIA 4U9RA 1SI9A 2ZOFA 2AX0A 1S6PB 4H4KA 4PXDA 3KMSA 2H9ZA 4ALZA 5M2UA 5LM7E 5DM6Q 1TU0B 2FGOA 4LF8F 3M8ZA 4UOFA 1IKVB 3OHBA 4NYZA 1ZAWA 5T7LA 4OJGA 4F3OA 3CC4S 4FS1A 1VC5A 6AT1B 1B70B 2DXFA 2XMAA 3GE9A 4ELUA 2H65B 1S1XA 3OW2R 4DQPA 4ES1A 2UXBF 3CXCR 4O3PA 4I2QB 4I7FA 1U8WA 3GIRA 1NPKA 4PRFA 1T9WA 4JI2F 3NG8A 4K5RA 2LQ5A 5CYQA 2M4MA 4DSFA 4O0IA 1QSLA 4NEYA 2KVQE 1WC3A 4DPOA 4NOHA 2RJZA 2J6SA 5H9EJ 1S6PA 4X4NA 2B6AB 2NSCA 3AD8C 2YQ1A 4DU7A 3C66A 2KDOA 4RZRA 1A9NB 2V9KA 4C6AA 2ZBIA 1U2FA 1IKXB 3RYLA 3VTIA 2BX6A 2JZ5A 2ZITA 3DHWC 1IKVA 1UFKA 2D9OA 1OO0B 4C3MA 2LLZA 1WHYA 3RAQA 3PEHA 3CGIA 1W7WA 3OLBA 3X1LB 2A3JA 4PQAA 1FE4A 5EWFA 3HHKA 1RGVA 4LF8J 3G6ES 3TAQA 4P52A 4CLZA 4A8MP 4YEAA 2GVZB 4O44B 4ECVA 1SKWA 4I2QA 5A8KB 2E1CA 2NUUG 2LFVA 3FK4A 2RF2B 1HHQA 3DOLB 4DPYA 3D3CJ 3BN4A 5A8WB 2B6AA 3MTJA 4TY8B 1S0OA 4KTQA 3CJQA 5DDOC 1NO8A 1EETB 2UXBJ 3DKDA 4HACB 1IKXA 3ZZZA 3GV8B 2LCWA 4ER8A 3Q8RB 1I5OB 4ZLPA 4JI2J 1D9DA 4NCGB 2DGWA 1E6VB 4RBUA 3BKFA 1KC8T 2KT2A 1NK0A 4EBEA 2NZCA 3QO9B 3BR8A 3PHEA 1B4SA 4DUYF 2EXUA 1F2HA 3GILA 2RD5C 3M6WA 5C42B 1S7HA 5K5MA 3PYFA 2HVIA 3EXCX 2GVZA 1BE4A 4O44A 1RK8A 1KVKA 5A8KA 3CD6S 1UVJA 2RF2A 3DOLA 1FRMA 4K5SA 4NLTA 2AJFE 2VC1A 2XWXA 3W63A 5KG1A 5A8WA 2ZH4A 4TY8A 4R8UB 1F2GA 3W9JA 4F3MA 4NASA 5KFCA 3R1LA 1EETA 2YX1A 4HACA 1P9QC 1HD1A 2JEIA 2VDHA 1VDHA 4ED0A 2DGQA 1OIAA 3THVA 4C2MA 2LXUA 1SXLA 4NCGA 1E6VA 2QN6B 4L74A 1X5TA 4EZ6A 1HNVB 3QNWB 2QL5B 2JVRA 1IKYB 1RXOB 2MJUA 4Z7YA 2OUGA 3QO9A 3FBEA 4E8UA 5CH7B 1IUJA 1N5TA 3AHPA 3GIJA 4Z37A 3KWMA 1VHIA 5C42A 2VZ9A 3FCWA 5CABA 4FKXA 1IQTA 1SQEA 4UOHA 1I51B 2Q66A 1Y3KA 5L46A 3GCWP 3LO3A 2XMWA 4ZPVR 2FJAB 1YLXA 2HQDA 4O0NA 3ZC4A 5L8RC 3R5AA 4ENOA 2BJ8A 4OHVA 1HBOB 1RAFB 4R8UA 1AW0A 1RHRB 3LALA 4DR3F 1Y7PA 2AJQA 1D8ZA 2BE9B 5DG7A 5FIIA 1RWMB 3FQKA 2ZJPQ 3OTBA 4ZVRB 5KFWA 1U49A 1I6JA 1QAJA 4P73A 1YBUA 1DAXA 1HNVA 2CQ0A 2B4PA 1IKYA 2JEFA 2XZTB 1K47A 5HMYA 2CUYA 3W8GA 2RNEA 4WWSA 4LSNB 3MR6A 1FHTA 2AHOB 2RU3A 3H4DA 1RU2A 2HKEA 2FD2A 2CQDA 3HHEA 4ZJLA 2ZE2B 4ZVEA 1HBOA 2YKNB 4OLOA 2CJQA 4ED2A 3AQOA 2L41A 3CULA 2QZ8A 3I55S 2KU7A 1QDUB 3FEYB 3AB4B 3V5RA 1TL3B 1RLCL 4OZJA 4C0HA 5JUMA 2C2NA 3RAMA 2Z56B 4D3GA 1TVRB 4ICLB 4DPTA 4DR3J 4ZHRB 3VF0B 1PBUA 3J7A1 1WC0A 4HLBA 1R0CB 4LSNA 4ZKAA 1UPPA 3MCNA 2DTJA 5I42B 1G3OA 1TAQA 2DO0A 3M4XA 3VWSA 1FJEB 3TZZA 1FERA 2LKZA 1LNQA 4DCPB 2F8EX 4OV6A 5D4NA 1WF1A 3IWNC 3UD5A 2C3UA 1IJEB 3J7ZT 2ZE2A 3FC9A 1HLWA 1WG4A 2YKNA 1Q8LA 4RU2A 1PJ7A 1P6TA 3AA9A 5E3CA 3KK1B 4WIIA 5IFMA 1Q8KA 3K2YA 3PR4A 2O66A 1S0VA 2XZDB 4XK8C 1TL3A 1NH7A 1D0EA 2AYEA 1M5SA 1NH8A 1WTFA 4IRCA 1TVRA 2F5GA 2V94A 4ICLA 2HAIA 4ZHRA 2MZQA 3W8PA 4K4TA 2Y0BB 3PKMA 1RABB 3FBBA 2YNHB 1OYEA 1TP7A 1U09A 2W7AA 4MYTA 2NXUA 5I42A 1U45A 4UOGA 3TVZA 2FQQB 1RWWB 4ZCMA 3N79A 3RB6A 2YY3A 3BGRB 2R8GA 4EYHB 2LVWA 2P9GA 1MWYA 4ZP6A 3EGNA 1R8AA 3QFHA 2MB0B 2G0CA 3U27A 2OMOA 3KK1A 1TL7B 1RWNB 1WF0A 3D68A 4PG7A 2V8PA 4N8OA 4I68A 3GYNA 4KJIA 5LOQA 3FCHA 1RT7A 3FVYA 1CJTA 1WUUA 4NRTA 2QE5A 3CJ5A 1RT2B 2HURA 3HSJA 3BKTA 3WC2A 3NNCA 1XIQA 2RQ4A 4C98A 3RBEA 4DN9A 2IBOA 2YNHA 4PZVA 3LAKA 2XCAA 3NGTA 4NEZA 4X4SA 1UJ6A 3QT5A 2HBQB 2JC1A 1NJZA 2GV1A 4I67A 4WPAA 3BGRA 4N56A 2A6MA 1O5JA 1KQGB 4P74A 3TO8A 5CQGA 4G1IA 4PKDB 4DCJB 3CMES 4PABA 4PG8A 1S9EB 2DNGA 1LV5A 2CNKB 2XGQA 3HKZD 3B78A 2JLEA 1TL7A 3TJAA 4LRBA 4HL9A 1EKSA 1SH2A 4M5HA 3V81B 4GO5X 4MK8A 2D3UA 2E9RX 2AWZA 4ECRA 3C46A 1JJ4A 2D41A 3T1YF 4OI0A 3CC7S 5BYRA 3P45B 4J9KA 3OTDA 4S0MA 3E3XA 3ZZUA 2OJ3A 3ZTPA 4ETXA 4K4XA 4URQU 5KFIA 4UY85 4YB7A 5JVGQ 4L73A 1HHSA 2B4OA 2PA3A 3GYGA 3EPIA 2KI2A 1CG2A 3QGGA 4YFUA 1U25A 4BLGA 2CJ9A 2QA4S 2F4VJ 1VQLS 1S4EA 2M2BA 4UQGA 2ZWOA 1S9EA 3H20A 3RUBL 2FHKA 4RW8B 4OHYA 1TR0A 4KKOB 2QSFA 2V9WA 3QRPA 3V81A 4N77A 4JI4F 1S48A 1C2PA 1BQNB 1X4FA 1NK5A 4YOEA 2JNJA 4C8KA 2YX4A 3V4IB 2CQ3A 2GAGC 3GP9A 3R3TA 3QGHA 2DJWA 4J9QA 4OX6A 3OL6A 4WFNQ 5D77A 1KDNA 4Y3CA 4FVCA 3BB5A 4YP3A 2MMYA 3WDOA 1ICEB 1UVKA 3B4MA 1FTCA 3T1YJ 4P2FA 1LEOA 5ADZA 4PEOA 4NA2A 2WBRA 1MMDA 1Y5NB 2FDNA 4K0KF 3TUZC 1T0TV 1Y5LB 1P1LA 1WEXA 3GZ7A 4RW7B 2K06A 1RWUA 4QR1A 4RW8A 4KKOA 1M90T 4NLVA 4C0OC 4HTIA 1SC3B 3ET6B 3GV7B 3JTOA 3M32B 1HWLA 3ZZRA 3CCES 4DXLA 1BQXA 1BQNA 4XO0A 1RI7A 4AFFA 3K8VA 3V4IA 4NLUA 3VHQA 1X5PA 3D7SB 3IM9A 1CSJA 1YX2A 4JV0A 4K4SA 4Q2MA 2YKQA 1DJ0A 4K8RA 1CEZA 4RW9B 1D1UA 1S9FA 5MAOA 3I56S 1X4BA 2RAQA 1Q4RA 4ZVOB 2E5IA 3BJYA 3T19A 4X4PA 4J9LA 2ATLA 2H1YA 4RW7A 1UWAA 1Y11A 1SB6A 5CHCB 1RWOB 1FD8A 1RTZA 1JLBB 3ET6A 3KLIB 3M32A 3QIDA 4F4ZA 2DRDA 4YHHF 3VVTA 8AT1B 1X60A 4K0KJ 5I4MA 1RSCA 2M88A 3WX4A 2V2QA 5GMEA 2DHAA
chains in the Genus database with same CATH topology
3DOMB 3DGPB 1YDLA 2JNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOM B;  3DGP B;  1YDL A;  2JNJ A; 
#chains in the Genus database with same CATH topology
 2UU9 F;  4H4M B;  3TQE A;  3H5U A;  4LT6 A;  1ZM4 A;  1UZD A;  1FJC A;  4CLP A;  2UXC F;  5I3Q A;  2HG4 A;  4NXN F;  1SCJ B;  2KZM A;  4QYZ K;  2W8L A;  2JL9 A;  4M94 A;  3OJU A;  4QU7 A;  1CS4 B;  2PN6 A;  2VKR A;  4ZLJ A;  1XMO F;  4K4Y A;  2CAJ A;  4RW9 A;  2QMW A;  2R3V A;  2CIM A;  3PO4 A;  3CDU A;  2PMZ D;  5LSO A;  1PO6 A;  2I9S A;  2KG0 A;  4ZPB A;  5KG7 A;  4ELT A;  4J7C A;  4JYA J;  5E3R A;  4NMX A;  1SKS A;  3EVO A;  1K1S A;  2D3O R;  2NXN A;  2KZZ A;  1HWK A;  2F65 A;  2DIU A;  1FKP B;  1JLB A;  3KLI A;  4MIW A;  4QW9 A;  3PG9 A;  5A2Q U;  1S99 A;  5CD4 A;  3P6Y C;  1RHM B;  1LQ9 A;  1URN A;  1EQM A;  1VRQ C;  3HMJ G;  1HA1 A;  4H4M A;  2AF6 A;  3ENW A;  1FWL A;  1M5O C;  2BZ2 A;  4LRE A;  4KGK A;  2MZ1 A;  4DQS A;  4PCQ A;  2BBE A;  2FZK B;  1UTA A;  1WKJ A;  2OAU A;  4J9M A;  4YHH J;  4B3R F;  5SZT A;  3MCS A;  4YB1 P;  2EFQ A;  1CS4 A;  4K59 A;  3TAM B;  3RR7 A;  4CO4 A;  2UU9 J;  5I3P A;  2RIL A;  3PW0 A;  4Q5V A;  1G1X A;  2UXC J;  4NXN J;  1KOO A;  3G82 B;  4DR6 F;  5GMK a;  4MKV A;  5D4P A;  2MHE A;  2DIT A;  3KJF B;  3VR1 A;  1ZZN A;  2HWI A;  4DSL A;  2Q6C A;  3JSY A;  3RRH A;  4LF1 A;  2O01 C;  2C2R A;  2V8G A;  1XMO J;  1FKP A;  1SQG A;  2B9W A;  4ZCL A;  2LQ9 A;  2FB0 A;  3BSO A;  3M6U A;  1B64 A;  3GR0 A;  1YZ7 A;  1VBY A;  1QSY A;  3AY0 A;  4PG5 A;  2ZZN A;  1PC4 A;  4A47 A;  3IA0 A;  2FZC B;  2APO A;  2ZEJ A;  3LA0 A;  4NX9 A;  5HL7 Q;  4X62 F;  4JI1 J;  3TAM A;  1U0H B;  2KYZ A;  1RTI B;  3V2U C;  4F67 A;  2KRB A;  4QJV A;  3OQ2 A;  2U1A A;  3W5X A;  4ZIV A;  3O1L A;  4P10 A;  3RAX A;  1R6Y A;  4WYW A;  4ANC A;  3WX8 A;  3G82 A;  3UFC X;  3KLG B;  4B3R J;  2WSF C;  5GAD I;  4KBI A;  5KFO A;  2BKN A;  3MEE B;  2LMI A;  1G6B A;  4LJM A;  3DOM B;  3F41 A;  2QGF B;  3CO9 A;  3HKW A;  2F3J A;  4DL2 A;  4DR6 J;  3RGI A;  4BWJ A;  2C28 A;  4RKU C;  2FTR A;  2R7T A;  2Y8Y A;  4OYW A;  2V63 A;  5KT5 A;  1PAE X;  2VA3 A;  4XDC A;  4MK9 A;  2R8K A;  4KGX B;  5F3Z A;  2V2Z A;  1U1L A;  1U0H A;  3ZZ0 A;  1RTI A;  2RRN A;  1MMN A;  3OLA A;  3IC1 A;  2V69 A;  4DPX A;  2AYM A;  1NUE A;  3BF4 A;  3RBD A;  3BDP A;  2W4P A;  4DX5 A;  4X84 A;  3OFH A;  5IM0 B;  4PG4 A;  3KLG A;  3QIP B;  5LXR A;  4X62 J;  2X51 A;  3PY8 A;  1H2V Z;  3MEE A;  1TKZ B;  1RT6 B;  7AT1 B;  2AIR B;  4W98 A;  3MMA B;  2BKO A;  3G6V A;  2JOQ A;  5KFT A;  3G8Q A;  3DOM A;  2K3K A;  3UCU P;  1PC5 A;  5KFQ A;  3R8Y A;  4PPZ A;  2IJR A;  3L7U A;  2VQF F;  4O3S A;  4F25 A;  1YJR A;  2QG9 B;  2I6W A;  5KFR A;  3MD3 A;  1U2R A;  3M8Q B;  3SV3 A;  5H9F J;  4JB8 B;  3TUJ C;  3S1T A;  4LSZ B;  4WKR A;  2HBR B;  3Q89 A;  1QAX A;  5M2P A;  3AH6 A;  3D66 A;  3H2L A;  1FA0 A;  4FNI A;  1XTZ A;  1U1M A;  3KG0 A;  2WBM A;  4I69 A;  5IM0 A;  4WZQ A;  2EW9 A;  2M8H A;  3QIP A;  4DSE A;  5K8M A;  2KL8 A;  4R0E A;  5E3Q A;  2HHU A;  1TKZ A;  1RT6 A;  3P49 B;  3QGP A;  5MLC V;  1M5H A;  3MMA A;  4F50 A;  4EUV A;  1PYO B;  2CDQ A;  3OL9 A;  3PIP Q;  5B0B A;  3CNQ P;  3TRG A;  2XWY A;  1N33 J;  2DR8 A;  4M5N A;  4LF9 F;  1R0A B;  2V8D A;  1N5Y B;  4KHR A;  3LWM A;  2CZ9 A;  1HWI A;  2FHJ D;  4Q45 A;  3D1Q A;  3M8Q A;  2PI5 A;  1TFW A;  2R7O A;  5DLF A;  4YR0 A;  3CJT A;  4P71 A;  4DL5 A;  5KG0 A;  1T3N A;  5KFG A;  2NRE A;  2EFO A;  2UVU A;  3P96 A;  3QJL A;  2HFO A;  5GAH I;  3I32 A;  2CWK A;  3GSD A;  1NB2 A;  1ZM3 A;  4I1T A;  1H3D A;  4DX8 H;  2LA4 A;  1S1U A;  1REG X;  4FYW B;  2VBZ A;  4EEY A;  5HP1 B;  3GU0 A;  2HLT A;  1VRU B;  3TZW A;  3GPA A;  2X7I A;  3TQ1 A;  2XY7 A;  1UZH A;  1R0A A;  4LRD A;  1N5Y A;  2MDA A;  2J7U A;  3VGV A;  3QAE A;  4B3O B;  4BC9 A;  2IA0 A;  4QIW D;  4TU7 A;  1RT5 B;  1HHT P;  3PEJ A;  1GT8 A;  4EZ9 A;  2VA2 A;  3W66 A;  2R7V A;  1S0N A;  1HI0 P;  4LF9 J;  2HZA A;  3CD5 A;  2B7C B;  3FDS A;  4IH7 A;  3R6G B;  2QV6 A;  2FLN A;  1N32 F;  4L3N A;  1O6X A;  3IR7 B;  1UMJ A;  3CPW R;  4J37 A;  1KFS A;  1WSV A;  3OPK A;  3DOK B;  5KG4 A;  3GV5 B;  1V5I B;  1QTN B;  2GJI A;  2AYB A;  1OSC A;  3SCI E;  1FJ7 A;  5HP1 A;  3DLJ A;  2ILY A;  4YB5 A;  1VRU A;  2CQC A;  4A48 A;  1F60 B;  5ETS A;  1J5O B;  1HQE B;  1S76 D;  2CQI A;  2XHW A;  2DHX A;  4B3O A;  3QPI A;  4ZVH A;  2WVD A;  1FWP A;  1RT5 A;  4QWC A;  3EJM A;  1BQM B;  3ULH A;  1WG1 A;  4OI2 A;  3BYP A;  4K4V A;  5KFB A;  1EJ7 L;  4C9D A;  4GVL A;  1QD1 A;  3LGN A;  4URG A;  3HO1 A;  1B0V A;  3U1M A;  3TAP A;  1HI8 A;  2DH9 A;  3F56 A;  2G13 A;  3EVW A;  3QWP A;  3DOK A;  2VPZ B;  4PUO B;  2BJ9 A;  5HVG A;  1LXJ A;  1X9W A;  1N32 J;  1JKH B;  5B08 A;  3BQ1 A;  4F4K A;  1J5O A;  1HQE A;  5DGB A;  1U6F A;  4HDH A;  4H4O B;  4JP8 A;  2XGP A;  3CF5 Q;  1HBU B;  4J9R A;  5H1S V;  1F0X A;  4RO0 A;  3AB2 B;  5D0E A;  1BQM A;  5HK4 A;  3VAG A;  1NAQ A;  1JQG A;  2HQF A;  2R7R A;  2MJN A;  1CUL B;  1KNZ A;  1FDN A;  4JOU A;  2FJW A;  1VC0 A;  2KFZ A;  2PEB A;  3A8I A;  4I2P B;  2HQI A;  5KT4 A;  3CJK B;  1DQ9 A;  3OD2 A;  3N6N A;  4C48 A;  2QYG A;  3NS5 A;  3AOC A;  1RKI A;  2MKC A;  2FUG 9;  3PO5 A;  4GRS A;  4PUO A;  3QWU A;  3IG1 B;  1WSR A;  4LBH A;  4WYL A;  3PYE A;  1HD0 A;  2MKK A;  2C42 A;  3FBF A;  7FD1 A;  3K0J A;  3DMJ B;  1WHW A;  2Y8W A;  2C1E B;  4MIB A;  3K5N A;  1P8G A;  4QU6 A;  1JKH A;  3AFG A;  2B9Y A;  3PYD A;  1PIL A;  1R43 A;  1EB0 A;  1H7X A;  2HZV A;  3JQJ A;  2M0G B;  4DV1 F;  4H4O A;  1VQ9 S;  2BRK A;  2PE8 A;  3D9B A;  1HBU A;  1KQF B;  1NSA A;  1NJI T;  5D6G A;  5AJ3 F;  4TLQ A;  3PJX A;  1HQ2 A;  4JI8 F;  1BY9 A;  2KT5 A;  2OTJ S;  1CUL A;  2ZH2 A;  3NGS A;  2AEJ A;  3LGM A;  4OJ1 A;  3BZQ A;  5DGA A;  3JYT B;  3M6X A;  5J1E B;  4NML A;  3D0I E;  4I2P A;  2A2D A;  2QA1 A;  3CJK A;  2FHM A;  4IYQ A;  4IQX A;  2DR5 A;  4NL5 A;  3TJ9 A;  2QFI A;  1TK8 A;  3QT8 A;  1EHW A;  2DB1 A;  2A6O A;  3IG1 A;  2ZZT A;  1WNE A;  4DFJ A;  3FUY A;  2AEF A;  3I87 A;  3HVW A;  3ILL A;  3KUG A;  3JB9 k;  1B0P A;  2MGZ B;  4DV4 F;  2V2K A;  4D3H A;  3MGJ A;  1WC6 A;  3SI8 A;  2HHX A;  4IG3 B;  4IO1 A;  1S77 D;  4QIG A;  3EUN A;  4X4Q A;  2WRM A;  2QLX A;  1SC1 B;  4Q44 A;  3H7H B;  2ZHB A;  4IRD A;  2W2N P;  4ZIW A;  2E5G A;  3O44 A;  1NKC A;  1HAR A;  2HQC A;  4DV1 J;  2V5H G;  2LXF A;  5J1E A;  3NGD A;  2VFS A;  4G1P A;  4O4G B;  2AEM A;  3OTE A;  3GJS B;  5AJ3 J;  1NB7 A;  1K0T A;  2V34 A;  2RT3 A;  2LXI A;  3CJR A;  2ASJ A;  1D9F A;  2M52 A;  4UF4 A;  2BM0 A;  2DNN A;  2XC9 A;  3TVK A;  3IRX B;  4EI2 A;  5KFF A;  1RAE B;  2JH3 A;  2MGZ A;  3EDR B;  4JI6 F;  1YVF A;  2RIJ A;  4QWA A;  1WEL A;  4DI6 A;  1LXN A;  3O2I A;  2DBB A;  3A8K A;  2IFX A;  4IG3 A;  4NLX A;  2Z0G A;  2ZH9 A;  1H38 A;  5CCL A;  4ED7 A;  4DSI A;  4WKY A;  2YNI B;  3R7N B;  3NXZ A;  1C1B B;  2O67 A;  4DV4 J;  2ZFH A;  1HBN B;  3T9Z A;  2YWW A;  5ITH A;  1XC9 A;  2EVZ A;  2FYX A;  5KOW A;  2BE7 D;  3OL8 A;  3CJ0 A;  5E41 A;  4O4G A;  1JIH A;  4GVB A;  3CD0 A;  2R7W A;  1VQM S;  1OPI A;  3OSN A;  4OYM A;  1JMT A;  2R2R A;  3G86 A;  5J2Q B;  3IP0 A;  1X7V A;  1QY7 A;  2OLW A;  2I2Y A;  5DET A;  3IRX A;  4J9V A;  2ERR A;  2Q1L A;  3LGH A;  2C3O A;  4HVZ A;  3WIV A;  1LWX A;  3RBX A;  4FBT A;  5BJR A;  1SPB P;  4RWX A;  4RUC A;  4C8L A;  3JTN A;  2HBZ B;  2LP4 A;  3EZU A;  4P2M A;  3DRS B;  4ZCI A;  5HJY A;  2YNI A;  3LQV A;  1C1B A;  3VV2 B;  4CLW A;  4CLL A;  2N4C A;  4IQM A;  4JI6 J;  4WFZ A;  4JI0 F;  1HBN A;  3RG6 A;  1ZPW X;  4HR2 A;  1HR0 J;  3MEC B;  3CCV S;  2NR0 A;  5B7W A;  3HHL C;  3CTR A;  2ZM6 F;  1CVJ A;  3G6X A;  3OV7 A;  2IM2 A;  2I1R A;  2QC3 A;  5J2Q A;  2C2K B;  3IFE A;  3HFV A;  5E3A A;  2EC2 A;  2HWH A;  4F26 A;  2D7S A;  3OR2 A;  1X9S A;  1N54 B;  5ETL A;  2QMU B;  3UDE A;  1VI7 A;  1S6Q B;  2MHN A;  2VL1 A;  2EBE A;  3IAS 9;  4Y0F A;  4RX6 A;  4RW6 B;  2M3D A;  1RYR A;  2EPI A;  4DDF A;  2OD6 A;  4F2R A;  2BA9 A;  1X8D A;  1FT8 A;  4MK7 A;  3VAK A;  3DRS A;  4XIU A;  4MIA A;  2OIH A;  1DBD A;  5F8I A;  3M8W A;  2R7U A;  5T41 A;  2KM8 B;  3EDQ B;  3THP A;  1FRL A;  3MEC A;  3GFZ A;  2H4W B;  3GIM A;  1AFJ A;  3I9V 9;  2W9C B;  4HHJ A;  3JQK A;  2MKI A;  3SIP B;  1F5A A;  2DNQ A;  3KLE B;  3IWX A;  1VMB A;  2DY1 A;  2CG8 A;  5E7O B;  1U24 A;  3ZTS A;  4DV7 F;  3DLE B;  2DR7 A;  2HS0 A;  5EDW A;  1VFJ A;  1NND A;  1X4E A;  1SV5 B;  3PM9 A;  3EGZ A;  5SUH A;  3L95 X;  4ECU A;  4WK3 A;  1GNK A;  2ZM6 J;  2DY9 A;  1OPZ A;  1RWV B;  1W25 A;  3KKF A;  4LFC F;  4ZJQ A;  1REV B;  1IBM F;  1R8H A;  4RW6 A;  4ECY A;  1A0O B;  3BN7 A;  1H2T Z;  4Z2X A;  1UA1 A;  2QJ3 A;  4ES2 A;  1Y4Z B;  3M6V A;  3DRR B;  3EZO A;  3Q8S B;  1UFW A;  3OL7 A;  2ZBC A;  3I82 A;  4ZIT A;  1Q86 T;  2GX8 A;  2PT0 A;  1NDL A;  3ICL A;  1RAC B;  2HPU A;  5E33 A;  2W9C A;  2OEJ A;  3NEK A;  2DEI A;  2JEG A;  3KLE A;  3HJV A;  2EKY A;  2HHW A;  4FPI A;  3DLE A;  2MPU A;  2DD8 S;  4ZP9 A;  1HQU B;  3GG1 A;  4LUB A;  3KHG A;  2GO8 A;  3PZP A;  1SV5 A;  1VK8 A;  1B0T A;  3N4W A;  3HHD A;  2V67 A;  4DV6 F;  3MR7 A;  4QOT A;  4OYX A;  4DUT A;  1REV A;  5F0W A;  2XZW A;  2MQL A;  4DV7 J;  2VDI A;  1U1R A;  4DR1 F;  5IC4 B;  3KLF B;  1YZ6 A;  1OQ6 A;  1YJ9 S;  3DRR A;  1U47 A;  1RYS A;  5IZH A;  1F5B A;  1O0P A;  3HFK A;  4M5M A;  4CLK A;  4LFC J;  2YWE A;  4PWD B;  1IBM J;  1X9M A;  2FVS A;  1U8S A;  2Y3Y A;  3QMQ A;  5AXM A;  3GJT B;  2NXJ A;  3BEG B;  3QT7 A;  3W1Y C;  4C97 A;  1WTB A;  3B6B A;  4DX6 A;  2KTQ A;  2GHP A;  1XR6 A;  1Q95 G;  1SJF A;  1SJ3 P;  2H54 B;  3PKY A;  3M8R A;  1HNX J;  3IM8 A;  4C8O A;  5CA5 A;  3BGO P;  2ROG A;  1PYT A;  1HQU A;  3MOZ A;  2RRA A;  2DGT A;  4KRW A;  3A3P B;  2LQ8 A;  5DZ7 A;  4ZN1 A;  2YKM B;  2ADB A;  3G71 S;  3D1O A;  4X64 F;  3RRK A;  5K20 B;  1BUX A;  4BBY A;  4YY3 J;  4EFA C;  2XEX A;  2FJD B;  2COL A;  1MSW D;  4YQW A;  5C2G A;  2ROP A;  3KLF A;  4DV6 J;  3MMC A;  3JS9 A;  3CCL S;  1N36 F;  3G2X A;  2V50 A;  4LR8 A;  5LXY A;  3W9H A;  4PWD A;  3FRY A;  3TI0 A;  3T6J A;  1RT3 B;  4ECS A;  4I6W A;  4DR1 J;  2XMK A;  3U1L A;  1KTV A;  4JI3 F;  3PRV A;  2HQG A;  2VOO A;  3D4J A;  1B99 A;  5K14 B;  1MNE A;  4OX8 A;  1UVN A;  4N47 A;  3N6M A;  4B9M A;  3M8P B;  3OBI A;  1X4H A;  2GCF A;  4C8Z A;  3HXM A;  1KN6 A;  1NXI A;  5IC6 B;  4TQR A;  1DTT B;  1SJQ A;  2ILZ A;  4AT1 B;  1NME B;  3SCL E;  3FQL A;  3RZA A;  4LF4 F;  1M1H A;  2BUN A;  4KB7 A;  2YKM A;  5EX0 A;  4OV1 A;  3H0P A;  2MZJ A;  2CNN B;  1YRX A;  1RHJ B;  2G2O A;  1YJN S;  2DO4 A;  3CT9 A;  3CCS S;  2P6S A;  5CYJ A;  3WQP A;  2ASL A;  3Q2S C;  4RNM A;  1HNI B;  4ZPC A;  3BO2 A;  1FKO B;  4DG1 B;  3HK2 A;  2K7K A;  4HH1 A;  2OPQ B;  2UVR A;  4EO6 A;  2BR0 A;  1TL4 A;  1RT3 A;  3PXG a;  1J5E F;  3AD7 C;  3PFE A;  1FDA A;  4WFY A;  3NNA A;  2ZKT A;  2KG1 A;  3S7R A;  1S10 A;  2DGS A;  3VQT A;  5K14 A;  3QZ8 A;  3KJQ B;  1N36 J;  3M8P A;  1WC5 A;  2B0G A;  2WVE A;  1UVI A;  4BWM A;  3IR6 B;  2RE1 A;  1DTT A;  4JI3 J;  2WSE C;  4HYK A;  3MR3 A;  2OGU A;  4FXD A;  2HYI B;  3SYZ A;  3PAC A;  4X4T A;  1FVQ A;  2G0I A;  1T7P A;  3TWZ A;  1SVD A;  2BAB A;  2DHS A;  3EIC A;  3GG0 A;  5L38 A;  4JI7 F;  2EI5 A;  9ATC B;  2BEF A;  1IR2 A;  3PX6 A;  4LF4 J;  3OXF A;  4HT7 A;  1HNI A;  3B8H A;  1FKO A;  3KHR A;  4DG1 A;  3RB0 A;  2OPQ A;  2PMW A;  3C15 B;  3OTO F;  2YTC A;  1KFD A;  2VG5 B;  2YNF B;  3W7B A;  3NGK A;  2AP6 A;  3MM9 B;  4RBV A;  3T5L A;  2N7C A;  4LR7 A;  3H4B A;  4LMZ A;  1JJH A;  1JLF B;  1J5E J;  3HSG A;  4KPC A;  3LP1 B;  1UP1 A;  5KFA A;  3SZ2 A;  3D0G E;  3W5Z A;  2KVI A;  4GMK A;  2DNR A;  1F3F A;  2FHO B;  3SSR A;  2W9A A;  4WXO A;  3CCR S;  2LU2 A;  5KT6 A;  3R7B B;  1D8Y A;  3ILO A;  3M8S A;  2CPH A;  3C15 A;  3HD1 A;  4TU8 A;  4CLT A;  4TKT A;  4NCB A;  2HFV A;  1Q53 A;  2VG5 A;  3THT A;  1RWK B;  4NYP A;  2OO4 A;  3O3L A;  2YNF A;  3BBF A;  4ZVP B;  4JI7 J;  3T1H F;  2GS8 A;  1VIX A;  3MM9 A;  3HSD A;  2R4F A;  3AT1 B;  1JLE B;  3OTO J;  1BLU A;  1IVZ A;  1JLF A;  4LSL B;  2BVZ A;  3LP1 A;  3T6B A;  3Q22 A;  1P27 B;  2C3Y A;  4MJK A;  3AD9 C;  1NSK L;  1KLN A;  1JNZ B;  3BQ0 A;  1Z2Z A;  4DL0 C;  5HLF B;  5ETR A;  3O8W A;  2ZHO A;  4OYA A;  2OD4 A;  3I9Z A;  3F0N A;  3G6Y A;  3M2U B;  2CG4 A;  3U7J A;  4WIQ A;  1XWL A;  2GQ2 A;  2VON A;  4QIF A;  3RB3 A;  4OYB A;  5DLG A;  4OQJ A;  1TKX B;  4ERD A;  5HAT A;  2KN4 A;  3VAJ A;  2WW4 A;  3RR8 A;  2B51 A;  4C3L A;  1FNO A;  1JLE A;  3R9L A;  1AUS L;  4LSL A;  2LU1 A;  3R1H A;  4DV5 F;  3ILI A;  1YJT A;  2JEJ A;  2IDE A;  3PCO B;  3DLH A;  3T1H J;  5EUH A;  1UET A;  1HI1 A;  2R8I A;  3AJD A;  3CDA A;  1GX5 A;  4DPW A;  5HLF A;  4U96 A;  3QQC D;  5IWA F;  3PJ9 A;  1OQ3 A;  3DRX A;  3W5Y A;  5HRO B;  3CCW A;  3M2U A;  3AOB A;  1R89 A;  2GJF A;  2PO4 A;  3B4D A;  2IAJ B;  2HZC A;  4DEZ A;  1T9V A;  4X4R A;  1FRH A;  1TKX A;  2OKQ A;  1K9M T;  4LBP A;  4F04 B;  3EPG A;  4X4O A;  2FLO A;  2FZG B;  1DQ8 A;  1JLG B;  2VAS A;  2LYV A;  3UDL A;  8RUC A;  4IRK A;  1NPR A;  3KMQ A;  1VC6 A;  2H5E A;  2FY8 A;  2HNY A;  1IN0 A;  5LMU F;  3GWC A;  4XTT A;  5B0D A;  3S8S A;  1ZM2 A;  5LL6 d;  1T3O A;  3CJS A;  1RBO B;  5F9L A;  2CNL B;  1RCO B;  4DLG A;  3GYX B;  3PRB A;  4DV5 J;  3P8B B;  5HRO A;  3NBP B;  3P3D A;  3PV8 A;  3FBC A;  2IAJ A;  3KXD A;  1LWF B;  1S9G B;  5IWA J;  2NYH A;  1CC8 A;  4CO5 A;  3DGV A;  4RNN A;  5CAA A;  5B0G A;  3OJS A;  2HVD A;  1JLG A;  5ETQ A;  4DZ6 A;  1H7W A;  3KTQ A;  3W61 A;  2FVQ A;  2H5I B;  1U6B A;  4QYZ J;  2CXE A;  1U0S A;  1PGZ A;  4TYB A;  1S1W B;  2RDI A;  1NK9 A;  2IJN A;  1N34 F;  1KON A;  1QAY A;  4A8S A;  3TR5 A;  2XNQ A;  3HT0 A;  1URR A;  2FY1 A;  2RQK A;  2B4U A;  2SXL A;  1UEV A;  3L3C A;  4UTG A;  1QUV A;  1FRJ A;  2J8A A;  1FTR A;  1GEH A;  4PWW A;  4J9P A;  5AXK A;  1FK9 B;  2VG6 B;  3NBP A;  3D6M B;  5LMU J;  2Z57 B;  2P5V A;  1L5U A;  5DO2 A;  5ETO A;  1YKW A;  3DU6 A;  1LWF A;  1S9G A;  3DLK B;  5IXU A;  4CDI A;  5HMZ A;  4DL4 A;  2KXN B;  3ELH A;  4OZ0 A;  4QIV A;  3OVS A;  1XMQ F;  5HAN A;  2D1C A;  1FF2 A;  3LF0 A;  4OI3 A;  2F63 A;  3MUT P;  2FGC A;  3RJM B;  2IM1 A;  1ZH5 A;  3Q8Q B;  4NLW A;  1S1W A;  2IM0 A;  1TAU A;  4XPE A;  3D6T B;  1S1T B;  1RKJ A;  1RWX B;  1L3K A;  3WZ0 A;  3QFW A;  2ZH1 A;  1RIS A;  1FRK A;  5D4O A;  3J81 Y;  2J9D A;  2VOD A;  4QWD A;  1RP5 A;  2JC0 A;  4WXW A;  4USK A;  1XBW A;  1YRU A;  4HEA 9;  3EM1 A;  4O3N A;  1N34 J;  3SSQ A;  3G8T A;  1XR5 A;  3V6D B;  3JXO A;  3A3N B;  1FK9 A;  2VG6 A;  2PD1 A;  3CW2 C;  2Y9H A;  4GKJ J;  2AW0 A;  3Q2T C;  1T9U A;  4CO1 A;  4C11 B;  3GQC A;  3K5L A;  3DLK A;  2L48 A;  3H25 A;  3PVX A;  2WVC A;  5JVH Q;  2YKA A;  3R5B A;  4U6P A;  4M5L A;  2ZDO A;  5FDL B;  1H6K X;  3A4T A;  4NLG A;  4QYR A;  2KHD A;  2PA8 D;  1S1T A;  2HLU A;  2B7B B;  2XB2 D;  2EG2 A;  3E2E A;  4J9O A;  1XMQ J;  1FXD A;  1WF2 A;  4L72 B;  1S4F A;  4CM0 A;  2DVI A;  2MQO A;  1CLF A;  4AXI A;  1Q16 B;  1VQN S;  5KG6 A;  3BO4 A;  2OML A;  1VIO A;  3V6D A;  3VAH A;  2LEC A;  3HM9 A;  2FJV A;  1XEZ A;  3T1A A;  2ACM A;  2XQC A;  4C11 A;  1FX4 A;  3PTW A;  4DL3 A;  5K8N A;  4HH0 A;  1YJ7 A;  3H2V E;  5HVH A;  1WHV A;  5IT0 A;  3AXM A;  3DDI A;  2F4F A;  2R8H A;  5FDL A;  1WDD A;  5BXI A;  2ZH5 A;  2ZKU A;  4NA1 A;  4N76 A;  3N5B A;  1RHQ B;  3HZE A;  4Q0B B;  2W2P P;  3C8Y A;  1Y10 A;  1YIJ S;  3DNC A;  4P9S A;  1VBK A;  5C24 B;  3BGU A;  3A8E A;  5LJ5 Y;  3K89 A;  4ZS6 A;  1XQI A;  2HHH J;  1RUS A;  3L7O A;  3MAH A;  3CC2 S;  3HVR A;  5D4L A;  3QT6 A;  2XS7 A;  3MHY A;  1SL2 A;  4MKB A;  1BMQ B;  2CPF A;  1TUV A;  3D54 A;  4FKY A;  4DV3 F;  3A12 A;  2PC6 A;  4ANE A;  2V4Q A;  3UR0 A;  2Y1I A;  1TMM A;  1S97 A;  5BYQ A;  5DG8 A;  4OYP A;  1NK7 A;  5DDQ C;  2OSQ A;  2RS8 A;  3AA8 A;  3SFU A;  4TQS A;  4ID8 A;  2QLW A;  2IHR 1;  4B9U A;  3BH6 B;  4KH1 B;  2OEK A;  1RJJ A;  2LQJ A;  1WC1 A;  5LSR A;  4Q0B A;  2XYH B;  2AT1 B;  2V4R A;  2F8H A;  1ELO A;  2N4D A;  3IGN A;  1OWX A;  1R31 A;  4F02 A;  4DZD A;  3IO1 A;  5C24 A;  2YWF A;  4GKK F;  1ACM B;  2HFZ A;  2CQ1 A;  2HIQ A;  1OSD A;  2AV5 A;  4RNF A;  1DAR A;  3N6L A;  1N5S A;  1MWQ A;  3MUV P;  1KWM A;  3NGR A;  1FFS B;  3JSR A;  1GK8 A;  1NM2 A;  1ULR A;  4I6A A;  5ETN A;  4C8N A;  2HFN A;  1SUQ B;  4PXB A;  1GFW B;  1GXL A;  3I31 A;  4ZOS A;  4DFP A;  2NS1 B;  2IBK A;  3BSC A;  4CTA B;  2OI2 A;  5T14 A;  3CO0 P;  5IQ6 A;  1YI2 S;  3CB4 A;  3I0S B;  4DV3 J;  2CZV C;  2CA9 A;  1FXR A;  5HN0 A;  3I5C A;  1L3V A;  1V9O A;  1UVL A;  5KFL A;  1W26 A;  2RQC A;  2XI3 A;  3D67 A;  3TW0 A;  1PYS B;  1R6V A;  3NGU A;  3KDO A;  1NBE B;  2DPI A;  4X2B A;  4DF4 A;  2MQM A;  2UV8 G;  1YSJ A;  2W2M P;  3MI7 X;  2DH7 A;  1XN9 A;  4ILL A;  3LW5 C;  2VH7 A;  4OIX A;  4LF5 F;  3BPS P;  1RE1 B;  1EIY B;  1N0V C;  1V6H A;  1UL3 A;  3BH7 B;  4RUA A;  4OZ5 A;  2RH3 A;  2QL7 B;  3ADA C;  4GKK J;  2PMH A;  2HRU A;  1SUQ A;  1NDP A;  1L3U A;  3Q8Y A;  2RUS A;  3J81 j;  4CTA A;  4KGM A;  4USU A;  2GW8 A;  3PW5 A;  2CQ2 A;  1WKK A;  5F8J A;  5A6W A;  3I0S A;  1S6O A;  2F4V F;  1UJ5 A;  4LVO P;  2F7V A;  1OS5 A;  3V6K A;  2EK6 A;  5IS2 A;  1Q8B A;  1Q7L B;  1PJ6 A;  3PNI A;  4NXM F;  3DLB A;  3GJR B;  1UA0 A;  3D0H E;  3A1Y G;  2W7P A;  5KT3 A;  3PW7 A;  2MZR A;  2PDA A;  4BS2 A;  2KH9 A;  4KT0 C;  3K17 A;  1NCL A;  3FSI A;  2C2Z B;  4QIE A;  4KYZ A;  3C6T B;  2KFY A;  3N01 A;  1RHK B;  1RAD B;  4F4X A;  3DXB A;  5L9X A;  2FVR A;  3US5 A;  4DV2 F;  4I4B A;  2BMB A;  2D69 A;  2BW2 A;  4UW2 A;  4MMO A;  2EFP A;  4HTJ A;  2GIQ A;  4LF5 J;  3PYG A;  1SC4 B;  2AGP A;  4M5K A;  2AMC B;  1RT2 A;  3EWG A;  4EGL A;  5IV3 A;  4BHQ A;  2E29 A;  2V2V A;  1NHK L;  1SIW B;  1NK6 A;  3MM5 B;  3S6E A;  5KT2 A;  5DJB A;  4W92 B;  1F5C A;  1X4G A;  4WZM A;  1K73 T;  3Q23 A;  5CYM B;  2EFG A;  5CD4 H;  3TZY A;  2MZT A;  2H4Y B;  2ZWP A;  3D5M A;  5LSL A;  2GQC A;  1NEE A;  3MTK A;  4ES3 A;  4PAA A;  2IY5 B;  2J9C A;  5IT9 Y;  2IJF A;  1WG5 A;  4TLR A;  2X1G A;  3C6T A;  4NXM J;  2ZVS A;  3CCQ S;  3MUR P;  4IOC Q;  4C8M A;  3WIU A;  2MQN A;  3MMJ A;  2DNM A;  4KPY A;  1LK7 A;  4P7T A;  2MYF A;  3KK3 B;  3G96 A;  1SH3 A;  4EU0 A;  4CH0 S;  1MW7 A;  2F40 A;  1WEZ A;  5DDP C;  1C1C B;  2G4B A;  2CQ4 A;  2B9X A;  2OPP B;  4CI0 B;  4DV2 J;  4A8Q A;  3MM5 A;  3MAA B;  2A10 A;  2AU0 A;  4YDX A;  1RQ0 A;  2HGL A;  2EBG A;  4ZVF A;  3UVJ B;  5CYM A;  5D78 A;  4IFV B;  1N6Q B;  1DLO B;  4R25 A;  1KR4 A;  1BWV A;  3KFW X;  2AX1 A;  3TZX A;  2VPX B;  2W2Q P;  1C0U B;  1RWP B;  2V6A A;  3N5F A;  2CPI A;  3NLC A;  3FRZ A;  5F0U A;  2BQ3 A;  1QE1 B;  1TTH B;  4M63 A;  3A8J A;  3GCX P;  3CCJ S;  3IXQ A;  3PHT A;  3TUI C;  3HHL B;  4IR1 A;  3HF5 A;  1C1C A;  1DUR A;  4FXV A;  3B54 A;  2OPP A;  3C16 B;  2HHP A;  2ZNY A;  1ZZF A;  5KFX A;  4P75 A;  3MAA A;  4O3R A;  3KHH A;  4USM A;  4JYA F;  2WZ1 A;  4ILM A;  3ZXW A;  2DHG A;  3UVJ A;  5HMW A;  4Q2L A;  3UCG A;  5L39 A;  4A8O A;  3FFI B;  3KOA A;  4EBD A;  5DRK A;  5EX3 A;  2EFV A;  4IFV A;  1N6Q A;  2ZUA A;  1VOM A;  2HQ3 A;  1DLO A;  4OJH A;  1HNW J;  5KG2 A;  2WW8 A;  4DUZ F;  2X3G A;  4JI5 J;  1S72 S;  1K1Q A;  3MR2 A;  3DYA B;  1C0U A;  3ETO A;  3NY0 A;  3LPE A;  5KG5 A;  3RTV A;  3GFY A;  1CJK B;  2B43 A;  2E1A A;  1QE1 A;  2IPO B;  2RDJ A;  1KSP A;  3Q8U A;  3HHL A;  3AAW B;  2LQB A;  1U1K A;  3QJJ A;  1X31 C;  3C16 A;  4EMD A;  4IR9 A;  4UQT A;  2V8V A;  2V4J B;  3UNG C;  5D15 A;  3I6P A;  1PG5 B;  4CT8 A;  1GMW A;  3PIO Q;  1OYD A;  1R8P A;  4B9V A;  1VQP S;  2ZDP A;  1G4C A;  2N3O A;  3VZI A;  1HWJ A;  4X65 F;  3JAM Y;  1SH0 A;  2F9J A;  1TV6 B;  4K4U A;  2LEP A;  2KHC A;  4R0J A;  3MFH A;  2M5Y A;  2GJ2 A;  4LFA F;  2D74 B;  5KFN A;  4PWU A;  3FFI A;  3UQS A;  2N3L A;  2DXE A;  4N8N A;  4BDP A;  2MSS A;  1U1P A;  1ZA2 B;  2FLL A;  3CUN A;  4LIW A;  3OFE A;  1ZS6 A;  4DV0 F;  5ETP A;  4IOA Q;  4J9S A;  1S79 A;  3DYA A;  2XLI A;  4CCH A;  4EBC A;  3D6F B;  4HKQ A;  1CJK A;  1N4L A;  3NCP A;  2HHT A;  4JI1 F;  3MD1 A;  4TNO A;  2QA4 G;  3PX0 A;  2KJV A;  4A8W A;  2XMU A;  3DI6 B;  4DUZ J;  3MPU B;  3MOJ B;  1MN9 A;  1K8A T;  2V4J A;  2DHH A;  3MPY A;  4RU9 A;  3AOA A;  4IH6 A;  2ZZM A;  5IV4 A;  5F8L A;  1H73 A;  4OL8 A;  3GLJ A;  3ILJ A;  1TV6 A;  2YWH A;  3W9I A;  5CYQ B;  2CWX A;  1EAR A;  4AL7 A;  1Y9O A;  3HP6 A;  2WOM B;  2VBY A;  1QJH A;  3EZ5 A;  3DC2 A;  5KTQ A;  4X65 J;  3L4B C;  3I4P A;  2NSB A;  5L9N A;  1HW8 A;  5E2Q A;  4LFA J;  1Z2L A;  2DNY A;  4FF2 A;  1RAJ A;  4M5G A;  4IH5 A;  1Q5V A;  1FEH A;  2ABY A;  1D3W A;  1MML A;  4J9U E;  1VCT A;  4KFB B;  5AE3 A;  3BO3 A;  1X4A A;  3KLV A;  3DI6 A;  4DV0 J;  2R2S A;  3RB4 A;  1GXT A;  4IDK B;  2OSR A;  3BDE A;  1ZTT A;  3FSY A;  1B3T A;  4TXS A;  1YQH A;  5GAD U;  2QYC A;  3T3F A;  1VK3 A;  4ZPD A;  1ZA1 B;  3V6H A;  1FNM A;  1XMB A;  4U8Y A;  1IKW B;  4QWB A;  4DOZ A;  3MPV A;  3DRY A;  4V19 J;  1R8C A;  2WOM A;  1R3N A;  1XNR J;  2FJX A;  4F4W A;  2FJE B;  2ZBQ A;  2GHW A;  2A2C A;  3NKY A;  2VBX A;  3MF5 A;  1VLY A;  1CC7 A;  1X0F A;  4LIR A;  5J2N B;  2K3I A;  2YPY A;  2DGO A;  3R27 A;  4KFB A;  2XMM A;  2J0S D;  2VBW A;  1TUW A;  2H5J B;  3BQ2 A;  5C5J A;  2VFR A;  2KYX A;  2RUG A;  1S6U A;  3KNA A;  3BGF A;  1ZAV A;  1OY9 A;  1IWG A;  4IDK A;  2CJX B;  3GIK A;  1EX8 A;  2CPD A;  4QPT A;  3V6J A;  3ETM A;  4CLF A;  2XO6 A;  2RHS B;  1XK8 A;  3OTC A;  2DT9 A;  4ATN A;  5B09 A;  3EMT A;  5CZX A;  1FI4 A;  4B9N A;  4Y2I A;  3G87 A;  2VHG A;  1IKW A;  1GAO A;  3HDS A;  4OYI A;  1VQ6 S;  1IBC B;  4U8V A;  2V8H A;  1N33 F;  2HHQ A;  4FN5 A;  2HAF A;  4DS4 A;  2ZH8 A;  2VB6 A;  3KJV B;  3IR5 B;  2M7S A;  2ZH3 A;  1HYS B;  4NZ0 A;  2MQ8 A;  4KQZ A;  5DG9 A;  3BR9 A;  1RAI B;  4WP9 A;  2GHV C;  5GAE U;  5JJB A;  5J2N A;  2QLB B;  2CNO B;  4W4M A;  5KFS A;  1SJ4 P;  2BE2 B;  4OI6 A;  4B9L A;  3D2W A;  1VQ5 S;  1YHQ S;  4PG6 A;  2VV5 A;  1M5K C;  3BSA A;  5GAE I;  3QJP A;  5ETK A;  2MLZ A;  3DGP B;  1T05 B;  2G1H A;  4XAK A;  3C14 B;  5BYS A;  3EYZ A;  2KT3 A;  4EWT A;  3SFG A;  3L7P A;  4CLU A;  3CMA S;  1Q82 T;  2CJB A;  3K7R A;  1JWW A;  2EG1 A;  3SEO A;  4ZLL A;  2BM1 A;  3MM6 B;  3IN5 A;  4USH A;  3CJ3 A;  1S12 A;  3M7V A;  3EX7 B;  4NYO A;  1YTY A;  2R42 A;  2AJ0 A;  2VPW B;  5EWE A;  2X1B A;  5DQI A;  1LWC B;  1NRK A;  3KJV A;  1HYS A;  1PCA A;  2WAQ D;  3MWB A;  5J2M B;  2VJU A;  2YVS A;  2BJ7 A;  4YUD A;  5D0H A;  4ZJO A;  4WCE Q;  1BWE A;  1RAG B;  2BE2 A;  2EK1 A;  1Y5I B;  3H8Y A;  1IBK F;  1FRI A;  1SKR A;  4QCL A;  1I1G A;  4JV2 A;  2GNK A;  1FJG F;  1JLQ B;  4KGZ B;  1WOP A;  2NCK L;  5ETM A;  5HBM B;  1APS A;  3SCJ E;  2VG7 B;  3MDF A;  5GAH U;  3DGP A;  1T05 A;  1PKU A;  3C14 A;  2I5J B;  4DUY J;  2BAC A;  3ZTR A;  1FDB A;  4QBU A;  3CJ2 A;  1XJW B;  4RW4 B;  2E7X A;  1FD2 A;  4USV A;  1VJQ A;  5HQM A;  3MM6 A;  4FYX B;  4OFZ A;  2GAH C;  3J80 Y;  1WOO A;  1LWC A;  4QZV B;  3G4S S;  1GMU A;  2ZH6 A;  2CQH A;  5KAK A;  2KFN A;  4RUH A;  5J2M A;  1RLD A;  1HPZ B;  2IA6 A;  1T9X A;  2PII A;  4OHZ A;  1LWE B;  1B7Y B;  2VF3 A;  2XS5 A;  2MTL A;  3MAQ A;  3H5Y A;  2UZA A;  2R7X A;  2ASD A;  1VQS A;  1WHX A;  2RVJ A;  3MZI A;  1JLQ A;  5F8N A;  4H54 A;  1KOH A;  5HBM A;  5M2R A;  4KH0 B;  3MFI A;  2VG7 A;  1G2E A;  4USI A;  2I5J A;  1IBK J;  5B0F A;  4YS2 A;  1UPM B;  3LP2 B;  4RW4 A;  4KV8 B;  1FJG J;  2EWH A;  3Q83 A;  2IYI A;  1XER A;  2DNZ A;  4DR2 F;  4ED8 A;  2O5D A;  3ZO7 A;  4NCA A;  2MZS A;  2UUT A;  3W2W B;  3UCZ P;  3UNY A;  1FVS A;  3SDE B;  1HPZ A;  1PSD A;  2DIS A;  3ZNJ 1;  2WHO A;  3EE3 A;  1LWE A;  2HNZ B;  1TK5 A;  2JJ4 D;  4FF1 A;  4DX7 A;  1K44 A;  2KM8 C;  4NE9 C;  5KFM A;  2E5L F;  4NLD A;  2HFS A;  4FXW A;  3NS7 B;  3NCR A;  2R2T A;  1V3S A;  4EYI B;  2J7W A;  3SBM A;  5AE1 A;  3ZZT A;  1Q79 A;  4YN3 B;  3RU0 A;  1MWZ A;  4K2X A;  2YQ0 A;  3P4U B;  2OTL S;  3LP2 A;  4KV8 A;  1S0M A;  2WK4 A;  5EGY A;  5A8R B;  4PPD A;  2ZC3 A;  2C2E A;  3SQO P;  1ZYQ A;  2CDR B;  3CCU S;  5E5N A;  2R9L A;  2ZHA A;  3H40 A;  1FRX A;  2HS4 A;  2E7V A;  2ZUG A;  3W2W A;  4QW8 A;  1RT7 B;  1IWA A;  1CJT B;  3SDE A;  3I0R B;  3M9O B;  1FE0 A;  2B56 A;  1L3T A;  2HNZ A;  4DR2 J;  3KK2 B;  2W1B A;  4F7V A;  5HO4 A;  3HVA A;  3OHA A;  5AT1 B;  2ZJR Q;  5K8O A;  3DCA A;  3S01 A;  5L1I A;  1FDD A;  2QTW A;  3KG1 A;  3W3S A;  2HHV A;  1T9T A;  1WOR A;  1EAY C;  5HQL A;  1NJX A;  2RU9 A;  1ITP A;  3TX0 A;  1U48 A;  4M95 A;  3M1V B;  2AZ1 A;  2Q6B A;  2CQP A;  1C0T B;  2R7Q A;  2JLG A;  3BKU A;  2FC8 A;  2X3D A;  2KXF A;  2CKW A;  3UD4 P;  1VQ7 S;  1HFE L;  2E5L J;  3AQP A;  1BHN A;  5A8R A;  4LQ3 A;  2N82 B;  5F3T A;  3N0V A;  1T95 A;  1UW4 A;  2IVM A;  3W60 A;  2E5J A;  1VJW A;  4GC6 A;  1M5P C;  2Q3P A;  4PXE A;  3BRE A;  3FZ2 A;  3I0R A;  3K5M A;  6FDR A;  2EEY A;  2DNO A;  4NLP A;  3Q8V A;  3KK2 A;  1AT1 B;  2QT7 A;  5EN1 A;  5F8M A;  2XLK A;  1AYE A;  1EP4 B;  3J81 U;  4P72 A;  1IM6 A;  2QMX A;  3WC0 A;  1U2C A;  3ONQ A;  3H98 A;  2J7K A;  2MLY A;  3NMA A;  1WKL A;  1UFL A;  1UJ4 A;  4P2S A;  1NHV A;  4ED1 A;  2XUL A;  3KNG A;  1D9A A;  1U1O A;  2DH8 A;  4MKA A;  4URS A;  3M1V A;  2E9Z A;  1IR1 A;  3BGL A;  1C0T A;  1W2I A;  4E98 A;  1RAH B;  4M5D B;  1RAA B;  4ELV A;  1BXN A;  2B4V A;  2IDL A;  4J90 A;  4CO3 A;  1ZPV A;  4X66 F;  2R8J A;  2W25 A;  4N5S A;  1AZS B;  5DM7 Q;  2ZOM A;  2HIY A;  3DMJ A;  3VAI A;  2H48 B;  3DFE A;  3C19 A;  3WBZ A;  2Y1R I;  5G0R B;  1EP4 A;  2DXD A;  1FFW B;  4UST A;  3DXS X;  1X0P A;  4HT5 A;  3D28 A;  3OR1 B;  1FCA A;  2OPS B;  2J0W A;  2J9E A;  2HVH A;  2CJY B;  4Y34 A;  4Y6I A;  2C3M A;  3JYT A;  1YJW S;  4U67 Q;  2DNL A;  5A6P A;  5THW A;  1VQY A;  4M5D A;  3UI3 A;  4I56 A;  1JNR B;  2C2O B;  4FYD A;  2KO1 A;  2QRR A;  3MEK A;  5FLX Y;  3RBZ A;  1J2V A;  1AZS A;  3TP2 A;  4OMF G;  1QLN A;  4EO8 A;  1XR7 A;  2ZD1 B;  2BAN B;  3OUY B;  3NRB A;  3OVA A;  4K50 A;  4B3T F;  3KUE A;  4DFK A;  5GVQ A;  2M9K A;  3OVB A;  3IMQ J;  5G0R A;  1TUG B;  1HR0 F;  4F0H A;  5GAG U;  2KKH A;  1S5Z A;  4X66 J;  4GC7 A;  4Y2A A;  1MN7 A;  2P9E A;  3OR1 A;  2OPS A;  2KJW A;  3JSM B;  3NWG A;  2M8D B;  1AB8 A;  2EC0 A;  2Z2Y B;  1FNX H;  1YG0 A;  2L9D A;  2VOP A;  3TOQ A;  1H0H B;  2HW3 A;  5HVF A;  2MEW A;  3QYY A;  5GAG I;  4IO9 Q;  3ITH B;  2YQ3 A;  2B5J B;  3CJ4 A;  3M9N B;  4OX7 A;  2Q43 A;  4ZPW R;  1VBX A;  1DQA A;  1Y3J A;  5L1L A;  4W90 B;  3L9Z A;  2OH2 A;  1PJ5 A;  4UT4 A;  4PYA A;  1KD1 T;  4GO7 X;  2L9N A;  1RT1 B;  2HK3 A;  2ZD1 A;  1S49 A;  2BAN A;  3OUY A;  3PW2 A;  2GGP B;  4PQU B;  2XMV A;  1Y00 A;  2C2D A;  2DCL A;  5FJ4 A;  3KDN A;  2MKH A;  1LOU A;  3TEH B;  4O3Q A;  3DM2 B;  1H2U X;  3P5T L;  4JI4 J;  2Y0S D;  4TYA A;  4ZVT B;  1LFP A;  2DCU B;  5A0Y B;  3JSM A;  4RJV A;  2AJ4 A;  2ACY A;  4Y65 A;  1YDL A;  4B3T J;  4LRC A;  3BPD A;  5IOL A;  4ED3 A;  1YRT A;  4K2J A;  1YBA A;  2OFH X;  3LWL A;  3QBC A;  3NP5 A;  2BQR A;  4ECX A;  1PAU B;  2YWK A;  3ITH A;  3K5P A;  5LT5 A;  2B5J A;  5K8P A;  5D0R A;  1T9Y A;  1MRO B;  4LBI A;  5H9E K;  5HI7 A;  4DQR A;  1LW2 B;  1TL1 B;  2GMJ A;  1H74 A;  3VGS A;  4O23 A;  1RT1 A;  2R2U A;  4DL7 A;  4A8X A;  2GGP A;  4NLO A;  4PQU A;  3HLU A;  3VGU A;  4M5I A;  4NA3 A;  2Z58 B;  2JSX A;  4B3M F;  9RUB A;  5AE2 A;  3DM2 A;  2W9B B;  3MM8 B;  4DL6 A;  5A0Y A;  1OMS A;  4B9S A;  3I4H X;  2D9P A;  2J8S A;  2MKY A;  1BGX T;  1KHW A;  4I0W A;  1VRT B;  1S57 A;  1U4B A;  4UZC A;  1N56 A;  2I8E A;  4F0M A;  3NOC A;  2HGM A;  3NL0 A;  2HK2 A;  4LRF A;  2B8P A;  1MRO A;  4B02 A;  4NPO A;  1KQS R;  2PFD A;  1LW2 A;  5J2P B;  1TL1 A;  1GH8 A;  2VC0 A;  3TVY A;  2CPJ A;  3KHL A;  1VQ4 S;  3FJ2 A;  2DYA A;  4DN0 A;  5JMN A;  4J5O A;  2BJD A;  1S6Q A;  4V19 X;  3HT3 A;  4ED6 A;  4H4K C;  2W9B A;  4LF2 A;  6FD1 A;  2GVD B;  3HZG A;  4FNH A;  4C3K A;  3MM8 A;  2XO7 A;  1EKR A;  4NZ6 A;  2IVY A;  4WFB Q;  2D3O 1;  4KY3 A;  4CP5 A;  4ECT A;  1M1G A;  2BKP A;  3U02 A;  2V0N A;  1HNX F;  4KGV B;  1VRT A;  4G3I A;  2CRL A;  4C4W A;  3QAT A;  1WI6 A;  4WP8 A;  2XMJ A;  3O5T B;  2GMH A;  4B3M J;  5AXN A;  1KVJ A;  4J9N A;  3PW4 A;  3JSB A;  1NPP A;  1HBM B;  3VAF A;  1QSS A;  1ZAX A;  3DN9 A;  4DCO B;  1O51 A;  2CJK A;  2NZ4 A;  3C6U B;  2FVP A;  2JHE A;  3CCT A;  3ZTQ A;  4B9T A;  5E0O A;  5J2P A;  4YY3 F;  4Y00 A;  2VQE F;  4A4J A;  2F1F A;  2IRY A;  1RTJ B;  3D1H A;  1IQZ A;  5RUB A;  3BSN A;  4Q8E A;  1AA1 B;  3DDN A;  1DZ5 A;  3CDB A;  1TQL A;  1VYA A;  2GVD A;  1SJR A;  2WON B;  1FEE A;  4CRJ A;  4OZ1 A;  5CCM A;  2W4D A;  4JV1 A;  1S7I A;  4B3S F;  3LPY A;  2OEM A;  5IT9 U;  3M30 B;  1RBL A;  3PDN A;  3MXH P;  4BC7 A;  2HEK A;  5IT4 A;  3CD7 A;  4C8Y A;  4JV5 F;  2PI4 A;  1Y0H A;  4F36 A;  2AD9 A;  3HCX A;  1HBM A;  2CFX A;  2MY7 A;  2LDI A;  3K8W A;  5GMD A;  4X4V A;  3C6U A;  4DJB A;  3D3B J;  2IC3 B;  2AQ4 A;  1KTQ A;  2NXE A;  1NDK A;  2BJ1 A;  1RTJ A;  1EZZ B;  1OY6 A;  5KFH A;  5F9N A;  1NLK L;  1X5S A;  2CPZ A;  2JFK A;  3V4M A;  1H72 C;  2WVF A;  1Z4U A;  1DTQ B;  1F9E B;  4HI1 A;  5G4D A;  2JFD A;  2DRB A;  2O3D A;  4OX9 F;  2FC9 A;  2WON A;  2LEB A;  2K2P A;  2VQE J;  3IBW A;  1ZTW A;  2W4C A;  3GFX A;  2O1P A;  2UUC F;  1I3O B;  3J7A N;  2AJ2 A;  4LFB F;  2WCX A;  1TKT B;  2QL9 B;  3M30 A;  3JTP A;  1Q78 A;  1KEK A;  3KLH B;  2B9E A;  4L3K A;  1P1T A;  2JLF A;  3CMQ A;  4AE5 A;  1C4A A;  4UY8 T;  4NI2 B;  3CCM S;  4B3S J;  3AJ2 A;  3IS9 B;  2BXJ A;  5I3U B;  1U1Q A;  4NWB A;  2IC3 A;  4AXJ A;  3OSP A;  4JV5 J;  3R5D A;  2CVI A;  1U02 A;  4RPF A;  4LR9 A;  4LQ9 A;  1R27 B;  3M8Y A;  5J1N A;  4ED5 A;  1SJ1 A;  2ZVI A;  4Z7C A;  4UUW A;  2ZNZ A;  3WHI A;  5B0C A;  1DTQ A;  3MR5 A;  3QSI A;  4Q7A A;  1NDC A;  3G8S A;  4ZPT R;  2KB2 A;  3OXL A;  4FBU A;  1AFI A;  1BC6 A;  5B0A A;  4HDG A;  1WC4 A;  5AXL A;  4RWW A;  2FVC A;  1LW0 B;  1IBL F;  2DR9 A;  4AUK A;  3GTY X;  2IYG A;  1TKT A;  1KVI A;  1HW9 A;  2MKJ A;  2GZO A;  3DDK A;  1SBR A;  3KLH A;  4G6V B;  3CWJ A;  3LH2 S;  3OFF A;  4OX9 J;  3RW6 A;  5K9F A;  3K5O A;  3IGV A;  4NI2 A;  2P6T A;  2HND B;  3IS9 A;  2UUC J;  2JDJ A;  3CE8 A;  4LFB J;  2MY8 A;  5I3U A;  5D3G B;  3MPW A;  4P6Q A;  4KSE B;  1S1U B;  2VJV A;  5KFE A;  1NZ8 A;  3ZZO A;  2Q79 A;  3R97 A;  4MTP A;  5KT7 A;  2BOA A;  3W64 A;  1JXL A;  3BBB A;  3H42 A;  4U7C A;  3JAM U;  2HMI B;  2YXL A;  4IKA A;  2RML A;  5BR8 F;  2QLJ B;  1T94 A;  1OJ4 A;  3DRP B;  1WAC A;  1JX4 A;  1LW0 A;  2OEL A;  4DQI A;  2VQF J;  4CH7 A;  3HVT B;  3VCD A;  2NUH A;  1RCX B;  3VVU A;  1RB0 A;  4ZLN A;  2CPY A;  3CCZ A;  4P2X A;  3MED B;  2VKZ G;  3BS9 A;  3H2U B;  3SV4 A;  4U7U K;  3FEZ A;  3GJQ B;  1VQO S;  4WK1 A;  2RSQ A;  2E66 A;  3CSK A;  2HND A;  3I5B A;  2DGX A;  4NLR A;  1IBL J;  1TL5 A;  4KAI A;  5D3G A;  2ROE A;  5CZV A;  1QUP A;  3MM7 B;  2CJA A;  1UWB B;  1AXQ A;  2J76 E;  1V5V A;  3TX8 A;  4JUZ A;  1HWU A;  3X3U A;  5DQH A;  5HJX A;  4FDF A;  2HMI A;  5KFV A;  4DLE A;  3PR5 B;  2ADC A;  1XNQ F;  3T41 A;  3DRP A;  4CO0 A;  3K58 A;  4LF7 F;  3HVT A;  1JLC B;  4AL6 A;  2MQP A;  1I94 F;  3AJ1 A;  3MED A;  3SXL A;  1WDT A;  4Y2K A;  3QGI A;  1UW9 A;  1VBZ A;  2J6T A;  3TA1 A;  5BR8 J;  2CAD A;  2HSE B;  4ZVG A;  4E2F B;  2P2C B;  1IJF B;  4Y2M A;  3W2V B;  3KYL A;  1FKA F;  3W65 A;  4OZ3 A;  1HNZ F;  3UN2 A;  1S59 A;  4FF3 A;  1J27 A;  4CYU B;  3MM7 A;  1UWB A;  1GQE A;  2FIU A;  2HRT A;  4AD6 A;  2W7O A;  2H3E B;  1VIS A;  3I5A A;  2FHJ A;  3M2R B;  1JB0 C;  4JBC A;  2R7S A;  3QAU A;  2ATC B;  5D0G A;  4F4Y A;  3EGV A;  4DHV A;  2I38 A;  2MKS A;  4OZ2 A;  4CLS A;  2RDD A;  3VGT A;  2GIF A;  5KOX A;  1N52 B;  1Q8I A;  2VPY B;  1FFG B;  4KE5 A;  2V68 A;  1TZ0 A;  1JLC A;  2Y1L B;  4PXC A;  1JXE A;  5C25 B;  2WB1 D;  1N5V A;  1VS3 A;  2DKO B;  2BRL A;  5HSP A;  2W01 A;  5EHH A;  2XLJ A;  4AQY F;  2W24 A;  5EWG A;  1XNQ J;  4K7Q A;  3FGV A;  4LF7 J;  1GXU A;  3ZZP A;  3W2V A;  2D3Z A;  4WU2 A;  1ZM9 A;  4CH1 A;  1I94 J;  1TKD A;  4MYU A;  4CYU A;  1VLO A;  2BYC A;  3CVK A;  3K57 A;  3TYT A;  3J7Z 5;  4OLP A;  3HFZ B;  1N8R T;  4DR4 F;  3M2R A;  3D6H B;  3RW7 A;  4L76 A;  1HNZ J;  3FNN A;  4O3O A;  2MXY A;  5C7P A;  3HI9 A;  4IUF A;  4TN2 A;  2C2M B;  1RU1 A;  2RHQ B;  3TNV A;  5C25 A;  2QLF B;  5DZ6 A;  1RHU B;  3BM7 A;  4ZK7 M;  3R5J B;  4PYD A;  4QR0 A;  2XNR A;  3TA0 A;  2XBP A;  1WEY A;  4DSJ A;  2G9O A;  4N41 A;  2XI2 A;  2GFF A;  1CQN A;  3LOU A;  3MPD A;  2E5H A;  4F4A A;  1N48 A;  4K4Z A;  5KFD A;  2VFU A;  4NRU A;  2QSW A;  2HGN A;  3TA2 A;  4AQY J;  2Z4P A;  2CPX A;  1UVM A;  4QQB A;  1M1K T;  2JRS A;  1YK9 A;  1F9F A;  2J0Q D;  1NZA A;  5A76 A;  1VGY A;  3TAR A;  2IRU A;  1W2B R;  3HUL A;  2A18 A;  2W8K A;  3W62 A;  1D09 B;  4CO2 A;  1FO1 A;  3OFG A;  5LJ3 Y;  1JJC B;  2OFG X;  4ZP7 A;  4DR4 J;  3FEX B;  5HQ8 A;  4YDD B;  1B7F A;  1V3Z A;  3CJ8 A;  3IWL A;  1VQK S;  4A8Y A;  7FDR A;  4A8K A;  1ZBT A;  3LTO A;  2JVO A;  1K0V A;  1UCN A;  2KXH A;  4CM2 A;  5FD1 A;  3AOD A;  2XTJ P;  1ZET A;  1HIY A;  3NWR A;  4MAK A;  1OY8 A;  3H59 A;  1T03 B;  2ZOG A;  1UEU A;  1H98 A;  4OJ3 A;  1NU4 A;  4J91 A;  2K1R B;  3GR1 A;  2EKN A;  4GKJ F;  5HAO A;  4OYO A;  2G0J A;  1ZOT A;  1FXL A;  1NJY A;  1HMV B;  4UUX A;  1RA6 A;  4WTY A;  4DR7 F;  4P7V A;  1KBR A;  3HHN B;  2QEX S;  3J80 U;  3R5G A;  2DGU A;  4GVB B;  4WF9 Q;  4FF4 A;  5U47 A;  2IM3 A;  4NLY A;  4I6Y A;  4A46 A;  4MT1 A;  4JI8 J;  1KRP A;  1RDR A;  3UD3 P;  3ZZY A;  2VUG A;  2UVW A;  3UPF A;  2UUA F;  2ALY B;  4WTO B;  3CIM A;  1CPZ A;  2ZBP A;  1KHV A;  1NJW A;  4DBQ A;  2AKW B;  1Z1Z A;  3BYR A;  2A0F B;  4ZDN A;  4YME A;  3R2D J;  4Q43 A;  8ATC B;  1T03 A;  3NAH A;  2W2O P;  2ASY A;  1WOS A;  4WU3 A;  2K1R A;  2PEH A;  4ECW A;  1BD6 A;  1M5V C;  1QTM A;  1HMV A;  1CBK A;  2IVF B;  1DY3 A;  4KR0 B;  3CDW A;  4RLE A;  2XM3 A;  2YKP A;  4DPU A;  3E01 B;  2I0X A;  2BQU A;  3EVM A;  4ZVS B;  4U7U D;  4ID5 B;  3PX4 A;  3TJ8 A;  4DR7 J;  4DS5 A;  3DU5 A;  2AYG A;  2GO9 A;  3ISN C;  2HVE A;  3OR2 B;  1ROF A;  3UN3 A;  2HHS A;  4QR2 A;  3Q8P B;  1VHF A;  3HX9 A;  1MU2 B;  2HHH F;  1G7C B;  1GX6 A;  3I96 A;  2HRY A;  3HD2 A;  2UUA J;  2VIH A;  1NSQ A;  4WE1 B;  4HI2 A;  1TEL A;  3A13 A;  3E8O A;  4DF8 A;  1HL6 A;  3A3O B;  4NZ7 A;  1RTD B;  3POT B;  2AJ1 A;  5B0E A;  3SCK E;  2DPJ A;  3E01 A;  2XYG B;  4FP9 A;  1QVG R;  2CPE A;  2XSJ B;  4CT9 A;  1KP6 A;  2VIC A;  4ID5 A;  4XDD A;  5KFJ A;  4XPC A;  1Q5Y A;  3PJW A;  5DQG A;  1NK4 A;  3FKB A;  1PIE A;  2Z8Q A;  1AUD A;  2H51 B;  5KFK A;  4YR2 A;  3SMZ A;  3NCQ A;  4ILR A;  2DNP A;  2E7W A;  4M8L A;  3T5J A;  1WI8 A;  4QPX A;  3N9U C;  1MU2 A;  3SQG B;  4ECZ A;  1QAI A;  2P9C A;  1RAO A;  3UR3 C;  1R8B A;  3R6L B;  4OZL A;  2GQQ A;  4F2S A;  2L3M A;  4K4W A;  1VR6 A;  4IOB A;  2XY6 A;  4CWB A;  4DU8 A;  4WE1 A;  2ZJQ Q;  4LF6 F;  1YGY A;  2PFF B;  3GSI A;  3TAN A;  2GML A;  1WJ9 A;  3C2P A;  1RTD A;  2QO3 A;  3POT A;  2QFJ A;  4I64 A;  3KG4 A;  1X5O A;  3NS6 A;  4KHP F;  3B82 A;  1KLM B;  2XHC A;  3AXK A;  4RNO A;  1WD6 A;  4QWE A;  3DLL Q;  4ZN3 A;  1NK8 A;  3UW1 A;  4ED4 A;  1QVF R;  2XSJ A;  3VZH A;  3SSS A;  4NLS A;  4WFA Q;  2YPZ A;  1HKA A;  5ETT A;  3FMB A;  4JI0 J;  4YR3 A;  2BV3 A;  4L75 A;  2BOP A;  3PRD A;  1U7L A;  4ZCK A;  1WWH A;  4HHU A;  1Q81 T;  4FZV A;  3SQG A;  2F9D A;  4WP3 A;  1NSP A;  4CNZ A;  1RZM A;  4KO0 B;  2F8M A;  2A1B A;  2YH0 A;  4CLY A;  3FMW A;  2VD3 A;  4CNY A;  2IIH A;  1Q0N A;  4ZVQ B;  4WBF A;  4ECQ A;  1RBA A;  3H90 A;  1R7I A;  3Q24 A;  2NLW A;  3UN5 A;  1RT4 B;  2AGQ A;  1KLM A;  4E0D A;  3NAI A;  5H9F K;  1KKH A;  3PFO A;  4LF6 J;  1LFW A;  2MST A;  2RS2 A;  2G2Z A;  3KUH A;  3QRR A;  3TUP A;  3CED A;  4YB6 A;  4HHH A;  3ENV A;  1UEK A;  2IRX A;  4KHP J;  3CDE A;  1C4C A;  2CZ4 A;  1R0B G;  4ZMM A;  2CQG A;  2XS2 A;  2M70 A;  4MKY A;  2DK2 A;  3IRW P;  2X1A A;  3HJF A;  3G9C A;  4OHW A;  1E6Y B;  1YBT A;  2RQM A;  4KO0 A;  2QX0 A;  2C22 A;  1SL0 A;  3GON A;  1A7G E;  4F3Q A;  2YBV A;  4ZA1 A;  3IAM 9;  1SIZ A;  1A6L A;  3MMC B;  2FLP A;  5F41 A;  1RT4 A;  5CXT A;  2E44 A;  1M0S A;  3LAN A;  2E1R A;  4ETZ A;  1GMV A;  4UOC A;  1IM4 A;  3KJN B;  4FVM A;  3CIZ A;  3P5B P;  5FLX U;  3R7S B;  1U26 A;  4ITS A;  4DSK A;  2YKO A;  3TEG A;  4CZC A;  5L1J A;  4TY9 A;  3ZNU A;  3NMR A;  3Q86 A;  1YJU A;  2PSZ A;  4OHX A;  3RRG A;  3OT9 A;  4WFX A;  2BDP A;  1IR0 A;  2L08 A;  1DFD A;  4L6V 3;  3F73 A;  2LA6 A;  1E6Y A;  5A2Q Y;  2Y1J A;  2MQQ A;  1RA7 A;  4FYY B;  4MFB B;  4WJB A;  4KHM A;  3R2C J;  3MCM A;  4AL5 A;  4F8R A;  3IBF B;  1FX2 A;  1RTH B;  2YX7 A;  1MG7 A;  2ZC4 A;  3GII A;  1CJU B;  4FS2 A;  3ZFV A;  4AND A;  3MMB B;  1ARO P;  4C0B A;  1SKU B;  4ZPA A;  1KS2 A;  4BCA A;  3EXY A;  3QZ7 A;  3DLG B;  1QM9 A;  1TFY A;  3H5S A;  2HBY B;  4RNH A;  1DRZ A;  2YNG B;  4LRA A;  2Z2M A;  5DDR C;  4X4U A;  2NPF A;  1IXK A;  2KRR A;  2XSF A;  1YIT S;  3T5K A;  2BJ3 A;  2B3T B;  3LP0 B;  3GB0 A;  2XCP A;  3M9M B;  4FYV B;  1GTE A;  1CQM A;  4RBT A;  4RUB A;  4ZVU B;  1FWK A;  2EFN A;  3ENQ A;  2N7Y A;  2Z2L A;  4MFB A;  2J0X A;  5DS7 A;  3ZTO A;  2DRA A;  4FPR A;  1F1B B;  1SL1 A;  2WVB A;  2JWN A;  4R5P B;  3GFH A;  4F0K A;  3FSX A;  4MH8 A;  1RTH A;  3UWT A;  1CJU A;  3ISN D;  4OZN A;  3IBC B;  1LK5 A;  3E51 A;  5F8G A;  1O8B A;  5IQQ A;  3MMB A;  4DWI A;  4X64 J;  3JQM A;  1Q1K A;  3NNH A;  2YWG A;  2WSC C;  2POK A;  3L09 A;  2GA7 A;  3DLG A;  1CJV B;  3FCV A;  2P8I A;  2OPR B;  3J7Y U;  2YNG A;  1MLA A;  1NHU A;  2XMT A;  2QA2 A;  1JLA B;  1JK9 B;  2VFT A;  3O6Q A;  4G1Q B;  5L1K A;  2QIF A;  3QLH B;  1N88 A;  3UO0 A;  3FZB A;  5ETV A;  3LP0 A;  4Y2C A;  5C2C A;  4G65 A;  2MLX A;  3HHL D;  2UXD F;  3J7Y I;  4OI1 A;  4DQQ A;  2ZBR A;  2GIR A;  4CQ1 A;  3LUY A;  2UUB F;  1JXV A;  4M1K A;  2XY5 A;  1HNW F;  2FPH X;  4JI5 F;  1GMW D;  4R5P A;  4RR5 A;  2XG8 A;  3M2V B;  2E9T A;  5E3P A;  5KFP A;  1Q7Y T;  3C3L A;  1X4C A;  2G2Y A;  5JXS A;  3ISZ A;  3EGW B;  4DFM A;  4AYB D;  3Q0A A;  1CJV A;  4KC5 A;  2IMW P;  2OPR A;  2AZ3 A;  1UAW A;  2K8G A;  3H5X A;  1JLA A;  1N5Q A;  5HMX A;  1DHM A;  4DMZ A;  5KFZ A;  4G1Q A;  4USJ C;  3KK3 A;  3MUM P;  4DR5 F;  3QLH A;  2RRB A;  4UZB A;  3VQS A;  2LEA A;  3NOG A;  4NLQ A;  2DR6 A;  2DEJ A;  3MEG B;  4B08 A;  2CQB A;  4IG0 B;  5KG3 A;  1T11 A;  3MCO A;  1U1N A;  2YH1 A;  2B8Q A;  2NPI A;  2AGO A;  2L9W A;  2NXC A;  1F3V A;  2NQP A;  3N28 A;  4OYZ A;  2IMO A;  5KFY A;  2E1M C;  2UXD J;  2X1F A;  2UVV A;  1TK0 A;  2DNH A;  2JX2 A;  3M2V A;  2CVE A;  2K7J A;  1KQK A;  2UUB J;  2DIV A;  1X4D A;  4C7Q A;  2VFV A;  1NKB A;  3VAM A;  2DNK A;  2WB4 A;  4USW A;  3VAL A;  2HWT A;  2RKI B;  3QRQ A;  1NKE A;  3LAM A;  1L3S A;  4OI4 A;  2HFU A;  5D8H B;  2OP5 A;  2HVZ A;  3T5H A;  3MEG A;  3UDC A;  2J6U A;  3HPO A;  4N7T A;  5LMN F;  1PBA A;  4TVA B;  4CIO A;  2U2F A;  1LKZ A;  4M5J A;  4IG0 A;  1SC6 A;  2Z2Z A;  3DHX A;  2GC8 A;  1YWX A;  3OXG A;  4IFY B;  2UV8 A;  1N0U A;  4A8F A;  1S1V B;  2CYY A;  5KFU A;  3UDV A;  4DR5 J;  2ALZ A;  1F6T A;  1SQF A;  1FES A;  2C3P A;  3R5C A;  1T02 A;  5J1P A;  4Q8F A;  3UE2 A;  2WTF A;  1YJV A;  4O4R A;  3HSZ A;  2UUW A;  2E1P A;  1TMJ A;  2XYP B;  3F44 A;  1F9H A;  4TU9 A;  3BV8 A;  2VU5 A;  2HS3 A;  4U95 A;  1T8E A;  1P9Y A;  2FJB B;  3M05 A;  2ZH7 A;  1EQ0 A;  1V3R A;  2RKI A;  4LVN P;  1VQ8 S;  2OHD A;  3K59 A;  3T9N A;  3QSY B;  2LDY A;  3GMG A;  3BBC A;  5T7L B;  2G1D A;  2UP1 A;  2PGC A;  4Y28 C;  2J9D E;  1JJ2 R;  2BJE A;  2J5A A;  5F8H A;  2HNY B;  2BW7 A;  4ZP8 A;  4PR6 A;  1UKU A;  4IFY A;  1S1X B;  4V1A k;  3ENA A;  1XNR F;  3U1N A;  2Z30 B;  4RL1 A;  1S1V A;  2DGV A;  4EK2 A;  4I7F B;  4B17 A;  1U6Z A;  5LMN J;  1GTH A;  2RB7 A;  4KIA A;  2NYI A;  4U9R A;  1SI9 A;  2ZOF A;  2AX0 A;  1S6P B;  4H4K A;  4PXD A;  3KMS A;  2H9Z A;  4ALZ A;  5M2U A;  5LM7 E;  5DM6 Q;  1TU0 B;  2FGO A;  4LF8 F;  3M8Z A;  4UOF A;  1IKV B;  3OHB A;  4NYZ A;  1ZAW A;  5T7L A;  4OJG A;  4F3O A;  3CC4 S;  4FS1 A;  1VC5 A;  6AT1 B;  1B70 B;  2DXF A;  2XMA A;  3GE9 A;  4ELU A;  2H65 B;  1S1X A;  3OW2 R;  4DQP A;  4ES1 A;  2UXB F;  3CXC R;  4O3P A;  4I2Q B;  4I7F A;  1U8W A;  3GIR A;  1NPK A;  4PRF A;  1T9W A;  4JI2 F;  3NG8 A;  4K5R A;  2LQ5 A;  5CYQ A;  2M4M A;  4DSF A;  4O0I A;  1QSL A;  4NEY A;  2KVQ E;  1WC3 A;  4DPO A;  4NOH A;  2RJZ A;  2J6S A;  5H9E J;  1S6P A;  4X4N A;  2B6A B;  2NSC A;  3AD8 C;  2YQ1 A;  4DU7 A;  3C66 A;  2KDO A;  4RZR A;  1A9N B;  2V9K A;  4C6A A;  2ZBI A;  1U2F A;  1IKX B;  3RYL A;  3VTI A;  2BX6 A;  2JZ5 A;  2ZIT A;  3DHW C;  1IKV A;  1UFK A;  2D9O A;  1OO0 B;  4C3M A;  2LLZ A;  1WHY A;  3RAQ A;  3PEH A;  3CGI A;  1W7W A;  3OLB A;  3X1L B;  2A3J A;  4PQA A;  1FE4 A;  5EWF A;  3HHK A;  1RGV A;  4LF8 J;  3G6E S;  3TAQ A;  4P52 A;  4CLZ A;  4A8M P;  4YEA A;  2GVZ B;  4O44 B;  4ECV A;  1SKW A;  4I2Q A;  5A8K B;  2E1C A;  2NUU G;  2LFV A;  3FK4 A;  2RF2 B;  1HHQ A;  3DOL B;  4DPY A;  3D3C J;  3BN4 A;  5A8W B;  2B6A A;  3MTJ A;  4TY8 B;  1S0O A;  4KTQ A;  3CJQ A;  5DDO C;  1NO8 A;  1EET B;  2UXB J;  3DKD A;  4HAC B;  1IKX A;  3ZZZ A;  3GV8 B;  2LCW A;  4ER8 A;  3Q8R B;  1I5O B;  4ZLP A;  4JI2 J;  1D9D A;  4NCG B;  2DGW A;  1E6V B;  4RBU A;  3BKF A;  1KC8 T;  2KT2 A;  1NK0 A;  4EBE A;  2NZC A;  3QO9 B;  3BR8 A;  3PHE A;  1B4S A;  4DUY F;  2EXU A;  1F2H A;  3GIL A;  2RD5 C;  3M6W A;  5C42 B;  1S7H A;  5K5M A;  3PYF A;  2HVI A;  3EXC X;  2GVZ A;  1BE4 A;  4O44 A;  1RK8 A;  1KVK A;  5A8K A;  3CD6 S;  1UVJ A;  2RF2 A;  3DOL A;  1FRM A;  4K5S A;  4NLT A;  2AJF E;  2VC1 A;  2XWX A;  3W63 A;  5KG1 A;  5A8W A;  2ZH4 A;  4TY8 A;  4R8U B;  1F2G A;  3W9J A;  4F3M A;  4NAS A;  5KFC A;  3R1L A;  1EET A;  2YX1 A;  4HAC A;  1P9Q C;  1HD1 A;  2JEI A;  2VDH A;  1VDH A;  4ED0 A;  2DGQ A;  1OIA A;  3THV A;  4C2M A;  2LXU A;  1SXL A;  4NCG A;  1E6V A;  2QN6 B;  4L74 A;  1X5T A;  4EZ6 A;  1HNV B;  3QNW B;  2QL5 B;  2JVR A;  1IKY B;  1RXO B;  2MJU A;  4Z7Y A;  2OUG A;  3QO9 A;  3FBE A;  4E8U A;  5CH7 B;  1IUJ A;  1N5T A;  3AHP A;  3GIJ A;  4Z37 A;  3KWM A;  1VHI A;  5C42 A;  2VZ9 A;  3FCW A;  5CAB A;  4FKX A;  1IQT A;  1SQE A;  4UOH A;  1I51 B;  2Q66 A;  1Y3K A;  5L46 A;  3GCW P;  3LO3 A;  2XMW A;  4ZPV R;  2FJA B;  1YLX A;  2HQD A;  4O0N A;  3ZC4 A;  5L8R C;  3R5A A;  4ENO A;  2BJ8 A;  4OHV A;  1HBO B;  1RAF B;  4R8U A;  1AW0 A;  1RHR B;  3LAL A;  4DR3 F;  1Y7P A;  2AJQ A;  1D8Z A;  2BE9 B;  5DG7 A;  5FII A;  1RWM B;  3FQK A;  2ZJP Q;  3OTB A;  4ZVR B;  5KFW A;  1U49 A;  1I6J A;  1QAJ A;  4P73 A;  1YBU A;  1DAX A;  1HNV A;  2CQ0 A;  2B4P A;  1IKY A;  2JEF A;  2XZT B;  1K47 A;  5HMY A;  2CUY A;  3W8G A;  2RNE A;  4WWS A;  4LSN B;  3MR6 A;  1FHT A;  2AHO B;  2RU3 A;  3H4D A;  1RU2 A;  2HKE A;  2FD2 A;  2CQD A;  3HHE A;  4ZJL A;  2ZE2 B;  4ZVE A;  1HBO A;  2YKN B;  4OLO A;  2CJQ A;  4ED2 A;  3AQO A;  2L41 A;  3CUL A;  2QZ8 A;  3I55 S;  2KU7 A;  1QDU B;  3FEY B;  3AB4 B;  3V5R A;  1TL3 B;  1RLC L;  4OZJ A;  4C0H A;  5JUM A;  2C2N A;  3RAM A;  2Z56 B;  4D3G A;  1TVR B;  4ICL B;  4DPT A;  4DR3 J;  4ZHR B;  3VF0 B;  1PBU A;  3J7A 1;  1WC0 A;  4HLB A;  1R0C B;  4LSN A;  4ZKA A;  1UPP A;  3MCN A;  2DTJ A;  5I42 B;  1G3O A;  1TAQ A;  2DO0 A;  3M4X A;  3VWS A;  1FJE B;  3TZZ A;  1FER A;  2LKZ A;  1LNQ A;  4DCP B;  2F8E X;  4OV6 A;  5D4N A;  1WF1 A;  3IWN C;  3UD5 A;  2C3U A;  1IJE B;  3J7Z T;  2ZE2 A;  3FC9 A;  1HLW A;  1WG4 A;  2YKN A;  1Q8L A;  4RU2 A;  1PJ7 A;  1P6T A;  3AA9 A;  5E3C A;  3KK1 B;  4WII A;  5IFM A;  1Q8K A;  3K2Y A;  3PR4 A;  2O66 A;  1S0V A;  2XZD B;  4XK8 C;  1TL3 A;  1NH7 A;  1D0E A;  2AYE A;  1M5S A;  1NH8 A;  1WTF A;  4IRC A;  1TVR A;  2F5G A;  2V94 A;  4ICL A;  2HAI A;  4ZHR A;  2MZQ A;  3W8P A;  4K4T A;  2Y0B B;  3PKM A;  1RAB B;  3FBB A;  2YNH B;  1OYE A;  1TP7 A;  1U09 A;  2W7A A;  4MYT A;  2NXU A;  5I42 A;  1U45 A;  4UOG A;  3TVZ A;  2FQQ B;  1RWW B;  4ZCM A;  3N79 A;  3RB6 A;  2YY3 A;  3BGR B;  2R8G A;  4EYH B;  2LVW A;  2P9G A;  1MWY A;  4ZP6 A;  3EGN A;  1R8A A;  3QFH A;  2MB0 B;  2G0C A;  3U27 A;  2OMO A;  3KK1 A;  1TL7 B;  1RWN B;  1WF0 A;  3D68 A;  4PG7 A;  2V8P A;  4N8O A;  4I68 A;  3GYN A;  4KJI A;  5LOQ A;  3FCH A;  1RT7 A;  3FVY A;  1CJT A;  1WUU A;  4NRT A;  2QE5 A;  3CJ5 A;  1RT2 B;  2HUR A;  3HSJ A;  3BKT A;  3WC2 A;  3NNC A;  1XIQ A;  2RQ4 A;  4C98 A;  3RBE A;  4DN9 A;  2IBO A;  2YNH A;  4PZV A;  3LAK A;  2XCA A;  3NGT A;  4NEZ A;  4X4S A;  1UJ6 A;  3QT5 A;  2HBQ B;  2JC1 A;  1NJZ A;  2GV1 A;  4I67 A;  4WPA A;  3BGR A;  4N56 A;  2A6M A;  1O5J A;  1KQG B;  4P74 A;  3TO8 A;  5CQG A;  4G1I A;  4PKD B;  4DCJ B;  3CME S;  4PAB A;  4PG8 A;  1S9E B;  2DNG A;  1LV5 A;  2CNK B;  2XGQ A;  3HKZ D;  3B78 A;  2JLE A;  1TL7 A;  3TJA A;  4LRB A;  4HL9 A;  1EKS A;  1SH2 A;  4M5H A;  3V81 B;  4GO5 X;  4MK8 A;  2D3U A;  2E9R X;  2AWZ A;  4ECR A;  3C46 A;  1JJ4 A;  2D41 A;  3T1Y F;  4OI0 A;  3CC7 S;  5BYR A;  3P45 B;  4J9K A;  3OTD A;  4S0M A;  3E3X A;  3ZZU A;  2OJ3 A;  3ZTP A;  4ETX A;  4K4X A;  4URQ U;  5KFI A;  4UY8 5;  4YB7 A;  5JVG Q;  4L73 A;  1HHS A;  2B4O A;  2PA3 A;  3GYG A;  3EPI A;  2KI2 A;  1CG2 A;  3QGG A;  4YFU A;  1U25 A;  4BLG A;  2CJ9 A;  2QA4 S;  2F4V J;  1VQL S;  1S4E A;  2M2B A;  4UQG A;  2ZWO A;  1S9E A;  3H20 A;  3RUB L;  2FHK A;  4RW8 B;  4OHY A;  1TR0 A;  4KKO B;  2QSF A;  2V9W A;  3QRP A;  3V81 A;  4N77 A;  4JI4 F;  1S48 A;  1C2P A;  1BQN B;  1X4F A;  1NK5 A;  4YOE A;  2JNJ A;  4C8K A;  2YX4 A;  3V4I B;  2CQ3 A;  2GAG C;  3GP9 A;  3R3T A;  3QGH A;  2DJW A;  4J9Q A;  4OX6 A;  3OL6 A;  4WFN Q;  5D77 A;  1KDN A;  4Y3C A;  4FVC A;  3BB5 A;  4YP3 A;  2MMY A;  3WDO A;  1ICE B;  1UVK A;  3B4M A;  1FTC A;  3T1Y J;  4P2F A;  1LEO A;  5ADZ A;  4PEO A;  4NA2 A;  2WBR A;  1MMD A;  1Y5N B;  2FDN A;  4K0K F;  3TUZ C;  1T0T V;  1Y5L B;  1P1L A;  1WEX A;  3GZ7 A;  4RW7 B;  2K06 A;  1RWU A;  4QR1 A;  4RW8 A;  4KKO A;  1M90 T;  4NLV A;  4C0O C;  4HTI A;  1SC3 B;  3ET6 B;  3GV7 B;  3JTO A;  3M32 B;  1HWL A;  3ZZR A;  3CCE S;  4DXL A;  1BQX A;  1BQN A;  4XO0 A;  1RI7 A;  4AFF A;  3K8V A;  3V4I A;  4NLU A;  3VHQ A;  1X5P A;  3D7S B;  3IM9 A;  1CSJ A;  1YX2 A;  4JV0 A;  4K4S A;  4Q2M A;  2YKQ A;  1DJ0 A;  4K8R A;  1CEZ A;  4RW9 B;  1D1U A;  1S9F A;  5MAO A;  3I56 S;  1X4B A;  2RAQ A;  1Q4R A;  4ZVO B;  2E5I A;  3BJY A;  3T19 A;  4X4P A;  4J9L A;  2ATL A;  2H1Y A;  4RW7 A;  1UWA A;  1Y11 A;  1SB6 A;  5CHC B;  1RWO B;  1FD8 A;  1RTZ A;  1JLB B;  3ET6 A;  3KLI B;  3M32 A;  3QID A;  4F4Z A;  2DRD A;  4YHH F;  3VVT A;  8AT1 B;  1X60 A;  4K0K J;  5I4M A;  1RSC A;  2M88 A;  3WX4 A;  2V2Q A;  5GME A;  2DHA A; 
#chains in the Genus database with same CATH homology
 3DOM B;  3DGP B;  1YDL A;  2JNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...