1GEHA

Crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
432
structure length
427
Chain Sequence
YVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMKDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE
publication title Crystal Structure of a Novel-Type Archaeal Rubisco with Pentagonal Symmetry
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
total genus 125
structure length 427
sequence length 432
chains with identical sequence B, C, D, E
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2000-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 1gehA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 1gehA01
4F0KA 3RG6A 5HQMA 3RUBL 2QYGA 2V68A 5HAOA 1RCXB 8RUCA 1RLDA 5RUBA 2RUSA 5HJXA 2V63A 2CXEA 2OEJA 2CWXA 5C2GA 1GEHA 1GK8A 2VDIA 1UZDA 1AA1B 1TELA 2OEMA 2OELA 1WDDA 1UPMB 1IR2A 3KDOA 1BWVA 3ZXWA 5HQLA 1RLCL 3AXKA 5HATA 1UZHA 4MKVA 1RBOB 3QFWA 1UW9A 4NASA 5HANA 1RUSA 9RUBA 3FK4A 4HHHA 3NWRA 4RUBA 1RBLA 4F0HA 1UWAA 3WQPA 1SVDA 1YKWA 2OEKA 3A12A 2VDHA 1RSCA 5HK4A 5HJYA 5C2CA 1IWAA 3A13A 2V69A 1RXOB 1BXNA 2V67A 1UPPA 1IR1A 3KDNA 4LF2A 2V6AA 3AXMA 1EJ7L 2YBVA 1AUSL 1RBAA 4LF1A 2ZVIA 4F0MA 1RCOB 2D69A
chains in the Genus database with same CATH superfamily
3UJEA 2RJGA 2WVDA 1WOPA 2JOQA 3WBAA 2KVQE 3DLBA 4JBCA 1XHGA 4FDFA 2V3EA 3IFEA 5CBBA 1FFRA 1W3KA 1S77D 4GIEA 2WMFA 2QG9B 1IEIA 2G95A 3EDFA 3W7EA 2ZKTA 2HXTA 3JVAA 2NYHA 2BACA 1XP3A 4NX0A 4S39A 4Z2KA 4LQ3A 4AIBA 1PILA 5B0FA 1BHGA 1GEHA 5EHHA 2IW0A 4S3JA 4V1XA 3IIXA 1M04A 4LAMA 4MF4A 4CD7A 1TQJA 3NSNA 2NXNA 2O5DA 5EPDA 2QL9B 1RLCL 1EX8A 5C54A 4ZHRB 3ZJ7A 3TC6A 2HJPA 1D9DA 4B9MA 3TQ0A 1XGDA 1WAWA 5KOWA 1M03A 3RW6A 3HZEA 1EEXA 1SH0A 2V9WA 1TTPA 4WF7A 4TVAB 1GVIA 3M47A 3O6DA 3KBVA 4UOQA 5M3WA 2GUUA 2NUYA 3DRSB 4J3XA 2CETA 4Q8TA 2DSUA 1YE6A 4TVDA 2J27A 3JZEA 3WNNA 3GG1A 1L3UA 4GKKJ 2VEMA 1HVQA 3UGRA 2WYSA 4C7DA 4ZLPA 1LQAA 4DF2A 2KYZA 2OGYA 1NF0A 1Q1KA 2D41A 1E4IA 4CYUA 2LEBA 3RN6A 3UWVA 1NDKA 2J6UA 3I4PA 5LNWA 3STFA 3L2MA 4LIWA 1S1RA 2C2NA 4H6EA 3WIVA 2RDTA 1HNXF 4JTGA 3TUJC 1S6PA 5C24B 3QN3A 2W7AA 3KJQB 3PX0A 2QUTA 3FCHA 5A6BA 2ZHAA 5DQIA 2JEQA 2UZ9A 3UR3C 4RR4A 1UTAA 2MQOA 1X7VA 5E3RA 2C79A 1HNVB 3P0XA 1W1YA 1EB3A 2GL5A 2ZX5A 3N29A 3R6IA 3C0JA 4I9TA 1ECEA 2D2HA 2W9AA 2ZA3A 4M51A 2Y70A 2QJIA 1ZAJA 4PTXA 2PGRA 4OI3A 1I2QA 4R5EA 1UD4A 1JUKA 3NQCA 3UI3A 3S5OA 3H54A 2FB0A 2HYIB 4ECSA 4R85A 3LTYA 4JEQA 4L74A 1F07A 1AA1B 4XZ9A 5IHRA 3F2DA 4HA4A 4V2XA 2QL7B 3OXFA 3DU0A 5E70A 2UVUA 4NLDA 3WDPP 1V02E 1DQ8A 4OI1A 4V19J 1FA2A 2MKJA 4KFBB 4MZ8A 1UP2A 1H7PA 3MHUA 3IM8A 1CCWB 1FWKA 5HQLA 4L1WA 1K8CA 1M7XA 4HKPA 3BLPX 4C90A 3MWCA 3RLVA 1CLKA 1V02A 3EDQB 4S2CA 3W23A 3O2IA 4OLOA 1D3CA 1CNVA 3RMEA 3CPRA 1KD0A 1PBGA 3GTXA 4KQNA 4CQCA 3EGJA 2HVDA 2V5JA 3EJMA 1JNEA 1L0PA 2J88A 2ERRA 5AXMA 2E67A 1U25A 2E68A 3DC2A 4NP7A 4KEUA 1F2HA 4CKQA 1SUQA 3ZT7A 1FCUA 4BK9A 4XQ6A 2CPHA 2PDNA 4LREA 4A46A 1N8IA 5HI7A 3BCFA 2G2OA 3QLHB 4PWWA 5HR6A 3A3NB 4O10A 4WDTA 3OFHA 3N9KA 1UA3A 1RQBA 5GNZA 5C9RA 4CDIA 1DTTB 1B64A 3BWWA 1WO2A 2Y0BB 5JH1A 3UNYA 1J2VA 1NJWA 3G24A 3R8RA 2I1RA 2VQEF 3KEHA 4JICA 3G1HA 2J47A 1KFWA 5B09A 1HX0A 5AE3A 2BGNE 2AGOA 4PUJA 2RQKA 2WWDA 1M90T 3LLDA 3TYCA 4GX8A 2FPHX 2HIQA 3PV8A 1OB0A 3A4XA 3RHGA 3BC9A 5KT3A 2PFDA 2DDXA 1TL1A 3XISA 1XX1A 2J7HA 3I4HX 3W02A 2C71A 3Q8SB 2PBOA 1V7YA 3NL3A 4MFDA 1MEIA 2ZE3A 4US5A 1FOBA 3GBEA 3TH6A 3C2OA 4HR2A 3WD3A 1UG6A 5KG1A 3IIZA 5D4NA 2ZJQQ 3ITHB 3O1LA 3GKFA 3OZOA 2AIRB 4ZGYA 1T9TA 2QKFA 2E9LA 2IM0A 1GOKA 4LSLA 3HFKA 1S5VA 3GDMA 2DZTA 5KFYA 3F41A 3PW7A 4FBUA 2J8FA 3C2YA 3UPFA 2K3KA 2DO4A 4ZL1A 2KN4A 4UW2A 3DKDA 3DKJA 4H7CA 2BQ3A 1L6YA 4W88A 2E7WA 3M0KA 4QYRA 2XZ7A 2J7CA 1HBNA 5KG4A 1UKQA 4AU0A 2FY8A 4PB5A 3QW3A 4F2SA 2PMZD 2NT0A 1W37A 2PTYA 4H8NA 1MW2A 4EF8A 2CPFA 4UOJA 4ZMGA 5FJRA 4UBPC 5EWGA 4ATNA 1Q6FA 4BWLC 2J7EA 4D9PA 5ETOA 3PR5B 1KOOA 2ASHA 4ICLA 2FZMA 2EWHA 1Z8AA 4JXCA 2MUCA 3O6QA 1JR1A 3FSXA 3QQWA 4GY0A 2A6OA 3M8YA 5CGMA 4AHOA 4I8DA 2BANA 2PMHA 4B3OB 1HF6A 4FXVA 4DUYJ 1OFAA 3VO0A 4IG0B 1MSWD 4O11A 3S6DA 1N36J 4OZ5A 2Z24A 2HGNA 2FJEB 1BQGA 5IXUA 2EPIA 4GCXA 3GU2A 3W27A 3NDYA 4L6DA 3TW0A 4PMOA 4GLEA 3W61A 3D3FA 3MAAB 5SZTA 2ZCGA 4YR2A 3Q8UA 4UR9A 1FK9B 3DYMA 1THFD 4J4KA 3U4AA 4LSZB 1D9AA 5DJBA 5ABEA 4M82A 5A6JA 4HD5A 2MQ8A 3VFLA 5CSSA 4CT9A 4CU7A 2JL9A 4KGKA 2V67A 2BV9A 1BVWA 2OUGA 1ZZFA 2J8AA 5EN1A 4OHQA 4ZODA 1SFTA 3W9ZA 1QUMA 3LOUA 1V93A 3VOCA 2ESCA 1A47A 1TVLA 3HOJA 3CC2S 1NP0A 2AZ1A 4JHOA 3UCQA 2W01A 2CJKA 5B0CA 2ZZ6A 4JTDA 2L41A 2OPRA 5DANA 2XQCA 2XUCA 4DL4A 3GIJA 4CQ8A 2EO7A 2J5AA 4X64F 4OIXA 3FUYA 1P6BA 1S1TA 4BEQA 5JUVA 1YJ9S 4CLTA 3NFUA 1UZ1A 1VRUA 1R9YA 3IRXA 1GHRA 1ZENA 3ENWA 1T7LA 3EWBX 5M1TA 3RCMA 1FNMA 2V8HA 1U1JA 3O3RA 4OVXA 1CS4A 2ISDA 1GNKA 3NS7B 1UMLA 1AUDA 2WSQA 3KVMA 1S2UA 5HVFA 2C91A 4A3QA 4B5UA 2IPGA 1IEVA 1BWLA 1Z3NA 3T42A 5LGXA 2OFHX 1D8YA 2MJUA 1TL5A 3PG9A 2AF6A 4WXWA 4J9QA 3H12A 3W4RA 4YPJA 3LTSA 4ED2A 2JIWA 2C1IA 2AJ0A 2WK4A 2XGZA 4X60A 4KGMA 3W73A 4MK9A 2JKEA 3OL6A 1N6QA 3B9NA 3E1F1 1KLYA 4QP0A 3OODA 3MEDA 1XNRF 3B0YA 3MTJA 2J76E 2CC0A 3GR7A 1P48A 3QC0A 1X9WA 3ZNUA 3W87A 3CC7S 3MPGA 4S3FA 1GT8A 2I7GA 1AMYA 2FJXA 4QG9A 2Z26A 1GG1A 3SCLE 2YDQA 3DGVA 3ATYA 3CB3A 5C55A 3NQVA 4EWTA 2WC7A 5FOOA 4RU9A 4FXJA 1ML1A 1W2VA 2JLFA 2AD9A 2OPQA 1ZQ5A 3ZC4A 1H50A 4P2VA 4JI0F 4HHPA 3T5LA 4J9VA 5I3UB 3OIXA 3HV9A 3EX1A 1H4PA 1NY1A 3DECA 3KMQA 3PYGA 3HP6A 4FHAA 2QSFA 2E5IA 1MI3A 4ZDNA 1RSCA 3EXCX 2PFFB 3EUNA 2E7VA 3WNOA 2ZWYA 1X38A 4ANDA 1T9XA 4DV4F 4A8SA 2R4FA 4FXWA 1NK9A 3QRPA 1JAEA 3MJMA 4YMZA 5M2FX 3DYPA 3GXDA 4XBSA 4UQAA 2D3LA 3CCVS 3ZJ6A 4P72A 4GO9A 4RPPA 5ECUA 5T26A 2XWDA 4ZA1A 5LNSA 1PTGA 1KV8A 3TANA 4UTFA 2DVIA 2VG5A 2EGZA 2ZH5A 1A5CA 2Y8UA 2FH6A 2W91A 5J2MA 3ITYA 2MKHA 4B2DD 4CM2A 3W81A 1A49A 4R27A 3VNIA 4OYMA 1RTIB 3BR8A 4OLPA 5D78A 3WFZA 3EDJA 1V6YA 4KGLA 2O7SA 2NW0A 4LWWA 2D69A 4IQEA 3W1NA 4JTLA 1PZ3A 1CJVB 1XINA 4ZPBA 1XERA 5L1IA 1M6JA 4R53A 1VCVA 4R8UB 4O19A 3NPUA 2DT9A 1DJHA 1NJZA 1V3LA 4LB3A 5HNNA 4OECA 1FRHA 5F4WA 3GK0A 2NQ9A 5TAOA 5C8BB 2V63A 2OEJA 2IRYA 5EMLA 1QU4A 4C6DA 3D9BA 2VENA 2FTYA 1XW8A 5KZDA 2MNRA 3VC5A 2Z1VA 1P27B 1QPOA 1VZWA 3NOGA 1Q8BA 3TJLA 5HP1B 9XIAA 3WEMA 1DVJA 4W84A 1F3VA 3V5RA 3IJIA 3PULA 3WDJA 4ONVA 1NIUA 1F6PA 1UWIA 1YNPA 2BOEX 1BSLA 1G1XA 1NK8A 4FF4A 5CKSA 3GIKA 2CZEA 3I65A 3THQA 1DY3A 2Q3PA 1FTRA 2X1RA 2ZADA 4A8KA 4ZVOB 2GVGA 5LHFA 2HSEB 4S1FA 2IVFB 2YA2A 4OKDA 1TUGB 1Z32X 3EB4A 2XO6A 3W2WA 2QMXA 1TWIA 1JPIA 3NNHA 4OBSA 3EYPA 4WY0F 1NO8A 2P0OA 2HNYB 4NCGB 4C0HA 2VV5A 3P7YA 5K3VA 4P8UA 3GIIA 1LWXA 4RW9A 2V3DA 1VLYA 2QE5A 2GPTA 3DYOA 4NNAA 1SV5A 4ENLA 3MDFA 3BH7B 5C7PA 2PDPA 2ZZNA 4GQQA 1WB0A 1MN7A 3M9MB 2A3EA 2BXYA 2ZC8A 5F8IA 4IIDA 5HJLA 3CO8A 4UQCA 2EKNA 4ED1A 3W0KA 4MVAA 4USJC 4JTKA 2NQPA 1QPNA 1DTQB 5JJBA 4V1Ak 2DTJA 2BE7D 4EUVA 2KXNB 5LT5A 2X7VA 1M7PA 2EXUA 2C16A 4OZ0A 3LGDA 4AY1A 1FRKA 2E3ZA 3I82A 4WFYA 4ES3A 3ZWTA 5A8QA 4LVDA 3S1GA 4RUCA 1AUSL 5BXTA 1RISA 1C7SA 2B6AA 3GLJA 4NZFA 3FBCA 3EPNA 1TK8A 4WJEA 4GUFA 3R1ZA 2EW9A 2ILYA 4MY8A 4IGNA 2CQ1A 1Y65A 4Q7NA 3CWJA 4X4NA 3D68A 4AEFA 4DX5A 3NG3A 1EL3A 3NNTA 5BZAA 1KFDA 3EX2A 1YVFA 3MWAA 4S23A 4QE5A 3HJFA 1DEDA 3K2YA 3IMQJ 2HHHJ 2CIMA 1B9ZA 4GQRA 3QY7A 4TO8A 1LV5A 2WHLA 3CO9A 4WK1A 1HKMA 1O68A 2QCMA 5IRPA 4LCQA 3ZFHA 3JU2A 1VBGA 4QBXA 5LHEA 1ONRA 3CQIA 4BI5A 3WJWA 1PYFA 3NM3A 1KHVA 3BQ6A 2PTZA 4HVZA 4C1LA 3ZNJ1 2MANA 1DARA 5HNRA 2PDGA 4CZCA 4NILA 3EMQA 1MWQA 3MEGB 1MRAA 4J3WA 3RFAA 1CJUA 2IXVA 2ZUGA 3THCA 1RB0A 4W5ZA 3J81j 3QFWA 1U4BA 1HHQA 1ZTTA 1VFJA 4H4KA 4S3KA 1LRNA 5KG5A 4NF7A 3VZIA 1NEEA 2JIEA 2FIUA 1ZALA 3SFKA 3CB4A 3TCEA 4RDZA 3DXIA 1DQXA 4KIEA 2REQB 4AL5A 3B8IA 2GK1B 2ZZ2A 1DYSA 4C60A 3O8WA 3W1PA 1WNEA 2FH8A 2QQ6A 2LKZA 2E29A 3C6TB 4CH7A 3MI3A 3ARYA 3ITVA 3LP2B 2O9OA 4PB3A 2J7WA 1JI1A 4RDWA 4M63A 5IT9U 3TJ4A 4CLKA 1R3YA 4ZO9A 3ZZTA 1RWXB 4QNWA 3CPWR 3P74A 1TA3B 3EOUA 1O0PA 2I1OA 1BXNA 4FK9A 3HVTA 4RZRA 2FYMA 4G3IA 2MB0B 1Z89A 1XPGA 4JIRA 2JHEA 3UN3A 2NX1A 4WX2A 1BLIA 2RVJA 1X1NA 2AZ3A 1UWSA 2I57A 3I32A 3WH5A 3ZTQA 1UFLA 2QCFA 2UUAJ 2RU3A 3UR2A 1NSPA 1TWDA 3T3FA 3QTGA 2OPSA 5KT4A 3LHVA 4IFKB 3KHJA 4KWSA 3U5YA 2ZHBA 1NFGA 3SCPA 1F4HA 5LOQA 2OCZA 3BLEA 3E02A 4FNQA 3C61A 1EWEA 4H54A 2UY2A 1W25A 4MJ4A 2J25A 2FLNA 2HVOA 4DR4F 3FVDA 2PDMA 2CVEA 1W3LA 4K1GA 3S01A 2XSBA 5E41A 4F4WA 4WDXA 1LQ2A 4N2YA 3CO4A 3B06A 4LANA 1UZ4A 3EZ5A 1UC5A 2JEGA 1TELA 4WFAQ 2RKIA 3TZXA 2YXLA 2OELA 4C5YA 4ZBCA 1P0DA 4MK7A 3BAYA 2KXHA 3VIJA 3L7PA 1DWGM 5GVQA 4BDPA 1RT4B 1NB7A 3DUGA 2IPOB 2FHMA 1B0TA 4LVGA 2CQBA 5K9DA 1GX5A 5J2QB 1MQRA 5HPOA 4KHPJ 4XTDA 4IUGA 2EG2A 5K8NA 4UQEA 5E2QA 4PYSA 6ALDA 2XYGB 2E8ZA 5HN0A 4I67A 3V18A 2VMFA 5GAGU 3LANA 4C3LA 1RPXA 3IP0A 4ID8A 9ATCB 1T0OA 3UR0A 3PACA 4FF5A 4JI5F 5H2ZA 1LG2A 2V2DA 4B9YA 2Q1LA 2E6YA 4O1BA 4OU1A 1MWZA 2BR0A 3VE9A 2DGSA 1U24A 3I9ZA 3NPWA 4D1JA 4KEVA 2IRXA 1LOUA 4Z2LA 3V3WA 1EZ2A 2LQJA 4G6CA 3OJGA 2BSLA 1S10A 1HHTP 3KXDA 2IRUA 2VOTA 1QJHA 1XI3A 5BXRA 2GVDB 4C6OA 3MM7B 2ZKUA 3KWXA 1BHNA 2QDEA 4LVBA 3R6LB 4E38A 4FAMA 4LF4F 1T8QA 4AH7A 5A8KB 3KDNA 3UWTA 3AD9C 3LCGA 1TPH1 3GCXP 2YDSA 3UWUA 1UMYA 4NLWA 2CJ9A 1QVBA 5FJPA 4IGHA 3GAYA 1EJ7L 4PULA 2YBVA 2ZE2B 3TZFA 2AQVA 4JAWA 1ZYQA 2RDJA 3HPAA 3G82B 2X1UA 3IAPA 4OIFA 2LQ9A 1MW0A 4ATWA 1BKHA 1S6QB 1KV5A 3U57A 1I94J 3DYAB 3I0RA 1IQTA 2PI5A 1NB2A 2C2MB 2ISVA 1E4MM 3SQGA 1N32F 1RAJA 1MDLA 3P6YC 1G4TA 3MUMP 5SWUA 1F3FA 4B3SF 1W1VA 2XO7A 4K4XA 3H5XA 3HJZA 2WCSA 2IQTA 3B9DA 4JBRA 2HAFA 2PUZA 3I6RA 5DFAA 3WQ5A 5MHBA 1YG0A 4K68A 1VRTB 3K5OA 1OVDA 4WFNQ 1KTCA 1LQ9A 3EOOA 2RAGA 4HTYA 4E8UA 2ZWOA 3GHUA 3GSDA 1NZAA 1AFJA 1OBAA 1A5UA 4AYBD 1LLWA 2HGLA 4JY8A 1W9PA 3ZZPA 2FDMA 3HXMA 2AJFE 1TPB1 5CJNA 1R3TA 4ACYA 2EKYA 2ZZTA 4L64A 1VFUA 3P5TL 4ZMMA 3RILA 3IV8A 4YTSA 4ZS6A 5G4WA 2QGYA 1OYAA 2KO1A 3N6NA 2PGFA 2Y1IA 2UVVA 1JKHB 4EI2A 2W2NP 3W00A 1R8BA 2NXIA 1TB3A 4NZ1A 5C9ZA 2D9OA 4JI1F 3SN1A 4P6QA 2FZ9A 1QK2A 2PLCA 5A8RA 5I2UA 1TKDA 3TX0A 5BW6A 1GHSA 6TIMA 2XJ7A 1P6WA 1EP1A 3K1GA 2TODA 2KL8A 3G6MA 3DOMA 3COTA 3G8SA 1JDFA 2HDJA 3TFXA 1HNWF 3FVYA 2KTQA 3QIPA 3VIHA 4C1NA 3WK1A 1WUFA 3WQWA 1ZRQA 3KBNA 4GY1A 2NUUG 3HTWA 3U02A 4US5D 1TG7A 3B0XA 2DIVA 5KZEA 2KYXA 1FWIC 5BCAA 3QO9B 1IWBA 3KLEA 3HK2A 3FY1A 1UPPA 2JLGA 4JZ5A 2MGZA 3LGGA 5IC6B 1GTHA 2WLZA 1JF6A 3GTFA 4XZLX 2OJ3A 3D3CJ 1UH2A 1JJ2R 1FKPA 1YDLA 1BY9A 3IV3A 4E4FA 1RTJB 3TZYA 1KVJA 4D6CA 1CGYA 4DN9A 2G0WA 2NV1A 2PWUA 3LY0A 5AYIA 3QWPA 3LWMA 3TOPA 3M2RA 1S97A 1O94A 5LGZA 1O8BA 5A94A 4J9KA 4ZXLA 3SQLA 2V5KA 5B08A 5EMKA 2GQQA 3U48A 4PYAA 1TTJA 1OY9A 4QZVB 3IRSA 1RJPA 3ZFVA 2PRHA 2KT5A 3GH5A 1R2RA 3WD0A 4B9UA 4U7UD 1YDYA 2ZKMX 3UW1A 4UTHA 1JXVA 3AWNA 2Y7DA 3CQJA 5CAAA 1Y0HA 2OX1A 3MMAB 3BSMA 1HI0P 3UWEA 2GAHC 1VENA 4WU3A 2Z2MA 3RGIA 3M8PB 1K0TA 1EYWA 2DNHA 1O95A 4AZCB 2RB7A 3CMQA 5CYJA 1U49A 3M0ZA 3N2BA 1UW4A 3SYZA 2IDLA 1LZOA 1DURA 1Q7ZA 2H8XA 3GKAA 1QRQA 2DZSA 5C2XA 2HQIA 1EUNA 1WD6A 4DXLA 1PKYA 2ZNZA 2O4QA 3F4CA 4X66F 5IFPA 3QV8A 3T55A 1SKWA 4JYEA 4W8BA 3WF2A 2A6MA 1KBBA 2HNDB 5A95A 3S6OA 2YZ5A 2ZXAA 1TK0A 3MHGA 1XR5A 2VP8A 1S2VA 5EA9A 1D3HA 4FNUA 3S8HA 1FDBA 2E0PA 3VILA 1ODUA 2FD2A 3LCHA 1FRJA 1NK6A 3N15A 3LQVA 1TMLA 1HL9A 1ZCOA 2WVUA 5A6KA 4LFCJ 2Z57B 4NA1A 2G13A 4DHVA 3WQPA 1UC4A 3GMGA 3GXIA 1BE4A 1V6TA 2JEPA 3VOGA 3FDSA 2F8EX 4C3MA 3P45B 5KITA 1F2GA 2BUNA 4HHUA 5EFDA 1FEEA 1R8AA 3QRQA 4QOTA 3V16A 1SJQA 3TZZA 4RW4A 3WQFA 1RP5A 4P7QA 4A6GA 2UV8A 1XGEA 3DGRA 5ABFB 2EF9A 3TN3A 4QLKA 1JG9A 2JEJA 4NLGA 2OX4A 1ZM9A 4K0KJ 2R2UA 4TXEA 3SCKE 1XLBA 1DQ9A 3R13A 4B3RJ 2QMJA 2XIIA 3G0XA 2XH7A 1CSJA 2OZTA 2UUTA 2DJWA 2PD5A 1RKJA 3T6BA 2ZOFA 3RRHA 2VR5A 4ZENA 2G0CA 2FVSA 2X1TA 4OT7A 2GZOA 3REQB 5AC8A 2R1PA 1HW9A 3C16A 1J18A 2YNFB 5HINA 1O60A 1US0A 2D1ZA 1W91A 3AOCA 2ZEJA 4J9OA 2CRLA 4FVCA 2F4FA 4JQ3A 3PBYA 5KTLA 2DSWA 1AW1A 3IPWA 4WIWA 3SUSA 1U1NA 1VCGA 1XYBA 3OBEA 4H8VA 3FBFA 1KFCA 3PIOQ 1WKJA 5C2GA 3QKEA 1SZGA 4PRRA 3GFYA 4MFEA 5HMDA 4NI2B 3VGGA 2QF7A 5AECA 1UZDA 3BV4A 4GVHA 2GVZB 3B8HA 4OZ2A 4DAFA 3B4DA 5CA5A 4Z17A 2X1FA 3BJSA 4FNRA 4I64A 4LSNB 3D1HA 2PU1A 2O9RA 4EX4A 2PC6A 5G0RA 3G22A 5LZLA 4PXEA 1YRTA 2WWCA 2RDWA 3ISNC 2XPKA 4PUWA 1GTEA 3P80A 2YW4A 3KHLA 2XI2A 4FLOA 3EMCA 3RLUA 1XMOJ 1QFEA 2BM0A 1LOSA 1HNIB 4CQDA 1S99A 3PWGA 3HURA 4DUWA 1TUWA 1EJSC 5A8GA 4DJED 4CO3A 2XTJP 3TUPA 3RM9A 3RW7A 5L9XA 3CZ8A 1ZB5A 2ACRA 1BTCA 4F8XA 3M6WA 4C7QA 2ZXBA 2WHOA 1VBUA 1GUVA 1EEPA 1BEUA 1QBAA 1VJIA 4FIRA 4YHEA 1KFKA 3M32A 5AYBA 3W74A 4CNNA 4JDYA 1YGYA 2RUGA 2X16A 2HHPA 3KFWX 4F8RA 4WZQA 1K02A 2YKNA 4PYDA 2P8IA 3AOBA 4DDFA 4GACA 4FF7A 4I5UA 1KCKA 2KFNA 3A3XA 4XKYB 2QJ3A 3N3TA 3QMSA 4Y9PA 2XLJA 4DS4A 3IVTA 5G2HA 3BDPA 4K4VA 3C8NA 3MZIA 1HJUA 4POCA 1W3IA 3I31A 1N8FA 3V75A 4HSHA 5E6ZA 4N6EA 1FHVA 1REVA 3OR1A 1ACMB 2E66A 8AT1B 4HHMA 3WY1A 1K9MT 2Z1WA 5LIKX 3ZZOA 3CMJA 4R7OA 5CABA 3AS0A 4GI9A 1EB0A 1T3NA 1TMMA 4Y0FA 1NRKA 2WM0A 5KG7A 1K8ZA 2XDFA 1ELOA 4WOQA 1WAUA 3SUUA 2QO3A 1X0PA 3P14A 1SGJA 5AT1B 2P3ZA 2ZC3A 1T02A 3GH4A 3MP4A 4DZIA 4X0NA 3HKWA 1J96A 3SRDA 4ZIWA 4D6HA 1RWUA 4OJHA 3LCXA 3W7MA 3L4UA 3LM7A 5BRQA 3UVAA 1E6VB 2VD8A 3L21A 2NUXA 4PUEA 3S2CA 2PP1A 1VIZA 3M07A 2FJWA 1X4AA 4GIAA 4HU4A 5I3JA 4CNUA 4MGGA 3FJ2A 2CUYA 4Y2AA 4LCRA 5I03A 1LWCB 5E3AA 3NYDA 4O50A 3DOKA 4N77A 3KBWA 4WU2A 2WB1D 1NK0A 2V4JA 4LF5J 3HPSA 1Q85A 4DY1A 3T1YJ 5K20B 3H2LA 1RJRA 4KF1A 1X4BA 5LSOA 1BXBA 3M43A 3DOPA 2PI6A 3CJ0A 3QLDA 4TV6A 5A76A 2XSAA 4GVFA 3ITTA 1Q16B 5GPRA 1XRTA 5KZ6A 3U7JA 1AQFA 1M7OA 1W5NA 2CPXA 3S7RA 4JOMA 4GQBA 4LYQA 4XAYA 4AAJA 5DRKA 3FGVA 2FHJA 4G8TA 4QDMA 2JDJA 1UCWA 1F8MA 4QIVA 5J1NA 3DN5A 3TYTA 5MAOA 5DM7Q 4X65F 4OI4A 2CDQA 3T4WA 1PSCA 2YY3A 4I56A 5F7UA 3N28A 4MB5A 1H62A 5FKYA 1WKDA 6A3HA 2B8PA 3MUXA 4ZQRA 4FF2A 4PEKA 2DIUA 3JTNA 4ZHRA 5M5DA 3T9NA 4FI4A 3CL6A 1XM3A 2W79A 1ZAVA 1P6TA 1GYLA 1RZMA 2C13A 4WPAA 3ILJA 5LMNF 3WQVA 2NLYA 5H1WA 4X2RA 4NKCA 4UNIA 1KC7A 1I2OA 3M1VB 3RAQA 3HF3A 3VCNA 3KOWA 3D47A 2I9EA 2IBOA 2Q3RA 4X63A 3DRSA 2AJ2A 1E3XA 4DR3J 2UY5A 4F3QA 3D2WA 3JXOA 4RCXA 1RHRB 4FB7A 2CPYA 1W9BM 2AQWA 2P76A 1ZHAA 2HBXA 4F3OA 4IH6A 3PAJA 3MO7A 3IVUA 3VDCA 3NYZA 4ML9A 1Y3JA 1RP9A 2DHAA 2PU0A 5I06A 2QULA 3FYYA 2IUZA 5HVHA 2GGIA 4JI6F 4RNJA 4W87A 3MFHA 4HU0A 3Q2TC 2VGIA 2UVWA 1VYPX 4TQTA 1R31A 1TV2A 4QE4A 1FFSB 2NQJA 3DIPA 4Q43A 1S2TA 4NNCA 1EFZA 2W5FA 5C0QA 3QMRA 4DQSA 2W66A 1LTDA 2FGCA 4IFOA 5C24A 3VFCA 3ZR4A 1PXGA 3M6YA 2J9EA 3QOMA 1TJ2A 3G86A 2HE5A 1CBGA 4HJFA 1IKXB 1YTYA 1O12A 2WVVB 2ZUTA 2N82B 3GJRB 3APGA 3S2LA 2RRAA 1HJSA 3USZA 2HZGA 2YL5A 4Y28C 1HNVA 1ZAWA 4P7OA 3FYPA 2F63A 4USIA 4KO0B 1N33J 2XYPB 4MB1A 3UE2A 5KFUA 4F4RA 1Q2RA 5D04C 3TARA 4F9DA 1O1HA 4JHMA 4HU8A 3VABA 4B4HA 1R6YA 5JIPA 3HB9A 2VUNA 3F4DA 3RB3A 4MAKA 3ITCA 2R2TA 1C29A 2YKKA 1T8EA 1VBHA 3CGIA 4A05A 3BKTA 1MW1A 4O4VA 4BY3A 2LYVA 3PP7A 4K6AA 4N8OA 3A47A 4KFBA 4W93A 5AE2A 1OY6A 5AB3A 3S9YA 1X39A 2Y1HA 1KBIA 5DMMA 3M6UA 4M8LA 4CD6A 1WHVA 1HQ2A 3SV3A 4H9VA 1JNRB 3WLJA 4PRFA 2GQ3A 3UJRA 3L9CA 1V3IA 1VRDA 3AALA 1QASA 1QPQA 3ZZZA 1K8XA 3SY5A 4EFAC 2X0SA 1RTZA 2XTKA 2V8PA 2NUWA 4LFBF 3WH6A 2F84A 3LRMA 4ED8A 4AFYA 2QV5A 4QDWA 2BVWA 1OD0A 1HJQA 4DPPA 5KSWA 1SQGA 2OPPB 2RDUA 5J2PB 3UD3P 1PGZA 3QLHA 1XNQJ 2ON3A 3K2GA 5AXLA 3GYEA 5G5IA 4CD5A 1VIXA 3VKDA 4FVMA 5HR7A 5KFDA 3KWSA 2NT1A 1JD9A 1DTTA 1PYTA 2PSZA 7PTDA 3GB0A 4MKVA 3HPXA 1QI4A 5BNKA 2UUBJ 3FW6A 3HFYA 3B9AA 4P10A 3P67A 2PA3A 2J4GA 3FX4A 1VJQA 3BTNA 1UVJA 3OQ8A 2YCJA 1NXIA 4J9SA 4DSEA 4LF8J 2YVSA 4B9LA 4DL6A 5CJMA 5F2MA 3IA0A 4WKRA 4H00A 4UTTC 3B03A 1YTEA 4GI6A 3WLKX 1QVFR 1TX2A 1TIMA 3SCTA 5K8OA 3GE9A 1SKUB 3PZTA 4QCLA 2C2EA 4QWAA 1LWFA 4GNKB 3EVWA 1NLKL 3QGVA 4RDYA 3QPZA 2V0TA 3AHTA 3AYSA 1V6UA 3ITHA 2NVAA 1G67A 5BR8J 4AT1B 1NAL1 3PZ9A 4FZVA 2W24A 3RRAA 1DXIA 1TWZA 4PH6A 4C0BA 4Z1BA 5D9PA 1FCAA 1XR2A 2RFGA 2WC3A 4JI8F 1LBMA 1LW0B 5KINA 4Q32A 2XYHB 3VGFA 2YXGA 3TA1A 3TC7A 3TW7A 4F7VA 4NAEB 2WRMA 4KRWA 3HO8A 2V30A 4X2PA 3R5EA 2ZH9A 2G4BA 4PUMA 4BQ4A 1WBHA 1VLIA 1WKLA 4O0ZA 1P0EA 3H8AA 4DUVA 2W4DA 4MMOA 5EWFA 4KMQA 1PHQA 4OYXA 2JF6A 2ZZ1A 2HVIA 2BY1A 1H2UX 5A8MA 3VDBA 3GUWA 3NM1A 2NV2A 1XXXA 1IUJA 3FEQA 5KT5A 4K4SA 3OQ2A 3G87A 1YBQB 4OOUA 5K9CA 4DX3A 4CTAB 5HJXA 4WRHA 4Z2JA 4B3OA 2R8JA 3Q8VA 2DNPA 3CIMA 1BGGA 1PKLA 4C8ZA 4IG0A 4ZB2A 1X6NA 4KE5A 4M5LA 2ACQA 2ZBQA 5TIMA 4RPQA 2NXEA 4P74A 4QEHA 2AJ1A 3C2PA 4TUFA 2MHNA 4R7WA 3PAOA 1RK8A 2GAGC 3SY1A 4HPNA 3CHVA 1I51B 1DWAM 4WK9A 3GP9A 1R46A 1S1UB 3MAAA 5LSMA 2YTCA 5I3KA 1EP3A 1ZFJA 4QTGA 1JCYA 4AVNA 1FK9A 2MY8A 4UOHA 2WAQD 3WQCA 2P10A 3WBYA 2ANUA 5AXNA 3AJDA 3M05A 3QSRA 5D05A 4C6EA 2CJXB 4JV1A 1S1WB 3KUMA 1S57A 3R5GA 5LIWX 4JFWA 1IKVB 1KFLA 4IPJA 5GJPA 3BAIA 2GVJA 3N34A 3STGA 4QJVA 1AJ0A 1IM4A 3FAWA 1QUPA 1F0XA 5KFRA 2UVRA 4KBXA 1Q7MA 3VCRA 3D5HA 3JUGA 3DDKA 4KQZA 3PB2A 4Z0JA 1ZPWX 1OPIA 1S1PA 1UP3A 3CL8A 1PSDA 4E8GA 1F6KA 2V9KA 4J2MA 1VISA 2DCLA 2EJAA 3RAMA 4Y90A 3S2JA 3LPOA 3QR3A 2INZA 2DU2A 5LNUA 4OZJA 3BCDA 3KK2B 1A50A 4KWOA 3BGRB 2WAGA 2HFSA 3V6DB 2GZXA 2CHRA 3UPBA 1TUFA 3PX4A 3T6CA 3CH9A 4E0CA 1RABB 4OYPA 4UXDA 3D46A 1CT5A 1VB9A 4JNYA 4UTLA 2JFKA 3R9LA 2PDLA 1TAUA 1CQNA 1NVMA 3NBPB 2WNQA 1IBKJ 1E0XA 3KJFB 4X4UA 1GW9A 3QGPA 3N6MA 3F4WA 3U27A 8TIMA 3CCES 1Y7VA 2BKNA 1XRVA 3IN5A 4FIQA 5CQ1A 5ENLA 2YQ0A 3F56A 2ZBPA 3BAKA 3SJNA 5M2RA 4UTWC 1C9WA 3T19A 3J7Z5 4V15A 3HZ3A 1GMVA 4WFBQ 4JPGA 2J66A 1IYXA 4EPBC 2QPSA 4AIUA 4DQIA 4YN3B 3S5NA 1SJDA 3ZVHB 3HPZA 1OC6A 2Z29A 1PB0A 2C22A 3O15A 4JTEA 3TX9A 5D4OA 3II1A 1KQGB 1URRA 1B1YA 8CGTA 1PKUA 4NPOA 3JTPA 3ZZYA 3S2NA 1FJGJ 1TJPA 3G1SA 2HHTA 3MUZ1 2R2SA 1W31A 2DZXA 4MNKA 1AW2A 4UTKA 1Q7QA 2BP1A 2RQMA 2PP0A 1R8PA 1NPPA 1K47A 2OYKA 2XS5A 3MR5A 1I2NA 1JCJA 3VINA 3L67A 8XIMA 4ZPCA 1OFEA 5C5JA 2ZM6F 3UZYA 2QGFB 3VAIA 1OFPA 1XMQF 3E96A 5LKYA 4J9UE 5GAHI 1I75A 2B56A 4CLYA 4D6GA 1R0AB 3KLKA 4O4RA 2OPJA 1P0KA 3BGGA 2JEIA 3PEJA 2DHXA 2VH7A 4K4WA 3GG7A 3WO8A 5LJ5Y 5D2VA 2Z2BA 1RTIA 2CZVC 1E1FA 3VGSA 2CNKB 4RW7B 5A8NA 1XC6A 3CASA 2R9LA 3JQKA 1CJVA 4Q8UA 2CNNB 5K8PA 1LKZA 4FS1A 2A3AA 2CPEA 4PG5A 1L6SA 1FQ0A 4R8UA 1FWHC 4M1KA 1YPFA 1Q53A 4RU2A 4GO8A 4DV3F 4DJFC 3AD8C 3ZVIA 4PL2A 2IHR1 3CUGA 3FFIB 3U9IA 4URSA 3FA5A 3VAMA 3ZTSA 3SCVA 1K6AA 6XIAA 4LR8A 1Q0NA 4JI2F 3ANVA 1RCOB 1KKRA 2BOFX 5HP1A 1YDNA 1P9QC 2VC1A 4JTRA 5L1KA 1IJFB 2JKAA 2VVNA 2K7JA 2HKEA 1AQHA 3M8ZA 3NEVA 1FE0A 3NDZA 2D74B 3T1HJ 1XBXA 1YJVA 1R85A 1E6QM 4AD6A 4LS1A 1KXVA 1HQUB 4O3OA 2VI0A 3CV7A 1SQ7A 3QZ8A 3EOEA 4AQYF 3JSRA 3T0AA 1UYQA 1O5RA 3KLGB 4CIOA 1BRLB 1JPKA 5KT2A 4DFMA 1EC8A 3MTKA 3KLLA 2MMYA 2IKJA 1JPDX 2P50A 3QY6A 2HNYA 1JZ2A 1HG3A 3WLMA 4NCGA 1QAIA 1YQ2A 1RU2A 2C15A 4DFPA 1KR1A 3T5JA 1YRUA 3AFGA 2XY5A 3A64A 1F5ZA 2GIQA 3Q22A 1SO4A 1X9SA 2V8GA 1XWYA 2EI5A 2JX2A 1NWSA 1H98A 3FCWA 4IMFA 1VQ5S 1LT7A 1S3TC 3GNXA 3DENA 4IIHA 2YL8A 4WWSA 2Q02A 1L9WA 1WACA 1NDVA 2GVYA 2Q71A 3ZLFA 3NEHA 2P6SA 2Q66A 3QQ1A 1OT2A 3J7HA 2DY9A 1DTQA 4YNGA 1FDNA 4GZEA 3NEKA 3CAKA 2YIHA 1XLGA 2B4PA 4DV5J 2GIRA 3QSYB 2ZX7A 4H2HA 1RAIB 1R30A 3LBOA 5T7LB 1IZJA 3TONA 4U96A 5H9FJ 1IQZA 3KOYA 5DMNA 4YVXA 5HMEA 2IKIA 1DTUA 1Q6LA 2YL9A 4EAMA 1YJTA 1UFWA 3EE3A 3SRHA 2WKJA 5KFEA 2CLPA 5H6HA 2BV3A 2CWKA 3RM8A 3DI1A 3CAQA 4O8RA 4EZ6A 4ZFMA 3W2LA 4CO4A 1RWPB 4DV1F 3OEXA 1TL7B 3L3CA 2BOAA 3KTXA 3DFNA 2DSVA 3SIMA 5AJ3J 1B90A 1Y3KA 2CLIA 2EPMX 4G1IA 1F76A 4E98A 4IUFA 1H51A 1RHUB 1TL3B 1HJVA 2IBKA 4DL5A 1TQXA 4ZSTA 1ISXA 1VQMS 1AFIA 4LFAJ 3NOEA 2DEPA 3VAJA 3J7ZT 2AV5A 4DR5F 2VC5A 4MY9A 2R6OA 2ILZA 2XMMA 1Z41A 3HVRA 3GH7A 1IM6A 3CJKB 2YNGB 1J0HA 3AWOA 3MEGA 5LMUF 2KVIA 4DPYA 2VKRA 2DNNA 1RGVA 1SM9A 2YFOA 2NXHA 4L6V3 2EC2A 3ILLA 4XO6A 1RTHB 3JRKA 2WSRA 2FB3A 4CQAA 1GKQA 1J2BA 2IY5B 3W29A 4P8VA 2XVPA 4V19X 3OL8A 2GA7A 1UB3A 3OLGA 3JSMB 2WZHA 2OKOA 4A48A 3PFEA 2G41A 4FOJA 1KVKA 5DGBA 3NOCA 5ETNA 4R5PB 4CU6A 1MXGA 2REQA 4HZ6A 4TQRA 4LQ1A 2GK1A 4RW5A 1H73A 1JDAA 1M1BA 4B3KA 3GU1A 2J6TA 1ADOA 2R7RA 3D6NA 2YLLA 2RAQA 1V9OA 2BA9A 1PVNA 1D9EA 3C6TA 4O57A 3MTWA 3STEA 2ZQ0A 3T0CA 1XK8A 3LP2A 1VQ9S 4NJHA 4ZVHA 3MPYA 2UBPC 1TA3A 2E5CA 1V0LA 1KONA 4W8AA 1S9FA 2DH8A 4W8LA 1OYDA 4DIAA 1HI8A 3D0IE 1FP9A 1RHKB 4ADSA 5K7JA 1M65A 4WIIA 4A8YA 3URAA 2JFEX 3WH8A 3CCUS 2LXIA 5GMDA 5C9UA 1MYRA 2NQLA 3OBAA 3QT8A 1Q63A 1DJYA 3BMXA 1VP5A 4WXZA 1XDMA 3FHAA 1T7PA 1E0WA 1U7LA 1FVQA 2DZWA 1EX5A 2WHJA 1UD3A 1YRRA 4GQGA 5IQQA 2LXUA 3LRKA 3R43A 8A3HA 4MWAD 4UTUA 4IFKA 1CXEA 2BWGA 4G7FA 3K4DA 2LA6A 1NDLA 3C8FA 4HIBA 4X4RA 2B4OA 3ZWSA 4NI8A 2XHCA 4Q45A 4F4KA 1S79A 3PZPA 2Q79A 2D20A 4UQDA 1YSJA 1ZS6A 2CA9A 3FA3A 3TSMA 3AXXA 1YX1A 4MYXA 3B4YA 4ZOAA 1RU1A 2ZZ7A 2B51A 4Q4MA 2HHWA 4NXNF 3OHBA 2HHSA 1RJJA 1LRQA 4ZQNA 2AKZA 4ILMA 1I1WA 1QNQA 5BYQA 3KFTA 3GPAA 3GM8A 3LM3A 1NJJA 1WI6A 4BS2A 3MMCB 2KH9A 4F4XA 4YTQA 2O01C 2GUBA 1CYGA 1KWMA 3HG5A 3ID7A 1OZMA 2LQ8A 1RT4A 1H7WA 4ZLJA 3QHNA 4NJGA 5H8MA 2WSKA 1F5AA 4W86A 2DO0A 4HSOA 5J2QA 1O4UA 1OQFA 4XPCA 4FYXB 3G77A 3WDHA 2FUG9 3CMES 1QOQA 4LFYA 2P6TA 5A6WA 3SECA 5IC4B 2ZNYA 2D7SA 2ACUA 1Y4ZB 3K8WA 3A5VA 2YX1A 2ZTKA 4LBIA 2K8GA 3W1QA 4CT8A 3W85A 1EHNA 1BG4A 3MBFA 4WP8A 2XVNA 3WLOA 4OX8A 4EF9A 3CTTA 3EDDA 2J24A 1UQYA 3R79A 4BQ3A 3WMBA 1SH3A 4DG1B 4UTTA 3NQFA 4TXSA 1V3SA 4WBFA 3N2XA 1DPMA 1PX8A 1L3KA 4C0OC 1Q6RA 4QQBA 3KL5A 4FS2A 5IFTA 1JRBA 1E51A 2GVDA 5DBUA 1T5AA 3JTOA 1XQKA 3TQKA 3BOFA 2BOGX 2J62A 3Q94A 2FPTA 5A8KA 5ETVA 1V3MA 4F0HA 4YXGA 2VZTA 4N8NA 1F9EB 3H6OA 2VONA 3SUVA 1G4PA 4KTQA 1UBSA 4JHZA 1E9IA 4J9LA 1Q65A 4JV5J 2ZE2A 3DGBA 3KHGA 3L4ZA 5J5RA 2ZTJA 2DNZA 1S4FA 2C1GA 3G82A 4JOUA 1Z2ZA 2VTFA 3AQUA 1GPFA 4J1OA 3TSDA 1UFKA 1Q86T 2QIWA 1HZYA 1S6QA 2I38A 4ETZA 4X4QA 1ZPTA 3DYAA 3IEBA 3TYAA 4M1RA 1K70A 3THDA 2JE8A 3D0HE 5KFVA 2C7FA 4GY7A 1DJZA 2JVRA 1L3TA 4USHA 3OSPA 4P2SA 4LT9A 1KO0A 4K4UA 3VD7A 1RT1B 4XAPA 3W76A 4ZO7A 5DY3A 3T0DA 4IG3B 1IKWB 3CD5A 4NJIA 3GWQA 4AEEA 4OJ3A 3THPA 2DNMA 3W7BA 3FA4A 3M8QB 3HIJA 4LF1A 4DBUA 1IBLJ 3CUZA 1B4SA 1VRTA 1K7EA 3G1RA 3PSVA 2CFXA 3H2VE 1UJPA 2AWZA 2ROGA 4LS0A 3PDNA 3UN2A 5DM6Q 1PUDA 2Z2UA 2QV6A 4CUCA 4AL6A 2UUCJ 1M5KC 4ERDA 3I3EA 3G6VA 4RBVA 4WSJA 5CCLA 3T8LA 1IXPA 3MPVA 4Y9MA 3ZYZA 3VKAA 4C7FA 3NCQA 3IG1B 3UZ5A 4NXMJ 1KM1A 4XKMA 4J9JA 4ATLA 1P8GA 3PBVA 1WHYA 4A35A 4MYAA 3BGLA 5ECVA 1TKTB 2E1PA 1J01A 3H2MA 2J13A 2BFGA 5T91A 4KHRA 1GKRA 2OFGX 4DLMA 1MMDA 2A3JA 4JFTA 1OFDA 2E44A 1LLOA 3KHDA 2Z28A 5FL1A 1I3OB 3O8AA 3OW2R 4FSAA 1HP5A 4IKAA 2CLHA 3EDRB 4WTOB 3QIDA 1UW9A 5IM51 4Y96A 4NT0A 1CJKB 2H48B 4F40A 4P7RA 2OMLA 1E5JA 3GZ7A 3K5XA 4XK2A 1U48A 3QO9A 3WFAA 4ZZ9A 3BAWA 3R94A 4FF3A 3PWIA 3NMAA 1X97A 3PRVA 2FGLA 5IDZA 4LBRA 4YR0A 2I17A 1RTJA 4UZCA 2C3ZA 3E5BA 4RO0A 5AZ1A 4LAUA 2ALRA 3GS6A 4G1NA 2OSWA 2MPUA 2VUYA 3B05A 4I2PB 4IJRA 4G9PA 4CLMA 4LJ3A 2VUGA 4ELVA 1B7YB 2MZQA 1TMJA 4Q3MA 1FKOB 3UCZP 1K6WA 5AVNA 1E56A 2PTXA 3BLLA 3WN6A 3M6XA 2OYMA 3AA9A 4URGA 3HZGA 4XX6A 4AYGA 1WORA 1S5NA 1YPIA 4KS0A 3ULHA 3URQA 2FLPA 2HZVA 3VCDA 1EDQA 1VBRA 2VFDA 4GX9A 2W62A 4RNIA 1S5ZA 1J0YA 3B54A 3MMAA 3VM5A 3N6QA 3W1XA 4LF9J 3OFGA 2AMXA 4UTWA 4YHGA 3NGRA 4YEAA 2NZCA 2UXDJ 3L4WA 2WZIA 4MH8A 1SJAA 5DG7A 1ITCA 4CRJA 3M8PA 3VOHA 4OFZA 4UUWA 1XH0A 2A5HA 1Y00A 4AZCA 5U47A 1XIQA 2EG7A 4K36A 3O0KA 4NOHA 3C6UA 2AYGA 4R9XA 3SCQA 1WHXA 1P43A 4UT4A 4RBTA 2CZ5A 4TTGA 2GQCA 3CIZA 5AZ0A 3BKUA 3P8BB 1KWKA 4HDGA 3V6JA 4ORMA 4LAKA 1HTIA 3BJFA 2HNDA 3GC4A 1UVMA 2QA1A 4FX6M 1FKWA 2FGOA 1ZP3A 3L66A 2X30A 3PKYA 2QR6A 1F3XA 1FKXA 4MKBA 3A8KA 4I0WA 4LUSB 3QHOA 5G1MA 3TO8A 5DZ7A 3FQKA 2X8RA 1VYAA 1YLVA 2DJXA 2FQIA 3HD1A 1H0HB 1IR0A 1RKIA 1EZZB 5KFPA 3B6BA 2A79A 1LCOA 4WF9Q 5A6SA 4F2TA 2XGIA 3BPWA 2VRKA 3CQHA 2FJKA 3RITA 2ZDSA 2GLKA 4GXMA 4L61A 4QFUA 3IWXA 1HI1A 5ABFA 4XDCA 1DTNA 3VK5A 4ECYA 3CWHA 3QRRA 4FXFA 2EFQA 2O3DA 3AHXA 2CYGA 3FSIA 5FCZA 1B3OA 2WJZA 1G5AA 2J78A 3G1YA 5BWFA 4BCAA 4ECWA 3BB5A 2FJVA 4QS6A 3BSNA 1LOLA 1FCQA 3H55A 1EDGA 4EPKA 2ZRUA 1FT8A 5KFLA 1SL1A 3NL0A 3THAA 2JH3A 4ZIVA 4MADA 4KERA 4JY9A 3CBWA 1RI7A 4DJFA 2OHDA 2YNFA 2GWNA 3SR7A 4OUEA 4JX5A 3D1QA 2QX0A 3U0HA 3PJTA 2MKSA 4O44B 1EC7A 3B8SA 3OVRA 2CHNA 4K2XA 1OEPA 4JCMA 2NQ5A 1GQNA 1DQWA 1WEZA 4DL0C 2XHYA 4HK7A 1E6PA 1E1EA 3CK5A 1FWJC 1HR0J 2K3IA 3QSTA 4NI2A 5H8PA 1YJUA 4W85A 4MPKA 3MSRA 3O16A 1JZ7A 3O63A 2BABA 2M70A 3CPUA 4QPTA 1MEWA 4LSNA 3CJRA 1A0CA 2IMRA 4EBEA 1KW1A 2KJVA 2WVCA 1U47A 2FVKA 3UG8A 4TYBA 3IS4A 4M5GA 4A3HA 5F8JA 4PBEA 2VT0A 4ZEPA 2HQDA 2PA6A 2PWFA 4QM1A 3RR4A 1RCXB 3BMWA 4DPUA 4RE0A 1ICEB 4KKOB 1UVKA 2G3IA 4H6QA 1J0IA 3HULA 1DRZA 3HJVA 1WJ9A 2QXWA 1ZJAA 2WPGA 3KUGA 2BVZA 2DIKA 1HNIA 3P4UB 3BGJA 1X6LA 5FJTA 1QDSA 3W1YC 2HEKA 5LIUX 1IKYB 1HO1A 2QPXA 3H24A 3I4KA 4DB7A 2QIIA 3MI6A 3IJ6A 4L1GA 5GNYA 4D6EA 4RE4A 1KC8T 3GUGA 4Q33A 5CAKA 2NYIA 3SUWA 4I7VA 3N6JA 4JTQA 1CGUA 4XD3A 3UT0A 4IQMA 4IR9A 4R9OA 2DPJA 4WKFA 3PC0A 4YMEA 3ABXA 2ATSA 4O1AA 1PIFA 1KQYA 5HANA 1ME7A 5E93A 3AZRA 2CWNA 1VQ8S 2YBTA 2B7CB 2R3VA 3CB8A 4XKYA 2BBEA 2DNRA 2V2KA 3QF0A 1R86A 2VZUA 1HGWA 2O1PA 2VIHA 3HM7A 2D0HA 1D8CA 3VIKA 1CBKA 5T14A 4OOZA 2PFHA 4H9MA 2J8SA 3UJSA 4Q8EA 3HDSA 4W7UA 1DHPA 3P5BP 2GIFA 3L68A 1MWOA 1QAXA 1QSSA 2Q6ZA 3SCUA 2M2BA 1J5OB 3KCLA 3R8GA 3A23A 2RH9A 2JC0A 3IAQA 4C6QA 3MMBB 1N0VC 2PE4A 4PMZA 1EARA 2Y8KA 2HWHA 3DG7A 4GD0A 3V5CA 2ZUUA 1JZ3A 3PJ9A 4LY4A 2PF8A 4ORIA 3TTEA 3D6HB 1HFEL 2GWGA 2R82A 4QAIA 1UD8A 3VDGA 2MYFA 5E0CA 3NXZA 2BE2B 4R33A 2AYMA 4QR1A 2XVGA 5CLWA 2C42A 3VIIA 3O6YX 1SC1B 4UFHA 3SQOP 5L1JA 2PLKA 2V50A 4OBRA 4DYJA 2A0NA 5JBFA 4N6FA 4DR6F 1TVNA 4HCDA 4OYWA 3PKMA 2Z6JA 3TVAA 4Q2LA 1SI9A 3M2UB 3TU9A 1E6VA 4AC1X 3UR7A 3TJAA 5DZ6A 2R2RA 3OXGA 1J5TA 3NAVA 1PZ2A 5FESA 4ZPVR 1Y5NB 2ISWA 5DEZA 1KM5A 3A8JA 1PTDA 4GE8A 4NL1A 2M52A 2ISFA 4IMGA 1RH9A 2JC1A 4LJMA 4ZLNA 1KTBA 3ENVA 4UZSA 5ABTA 1LWCA 1WG5A 2CESA 5KFNA 1UPMB 1VQ4S 3QPYA 2Z2AA 1F7BA 1M3UA 1VGAA 3WIJA 1H2JA 1Q8LA 2E1RA 4DX8H 4AZBA 4A8MP 4K7QA 2IIHA 2YNIB 5E9XA 2DR5A 5AC6A 2L9NA 1W3HA 2VFUA 3TYBA 4OV4A 4DR3F 1H7OA 2ZUVA 4L1XA 2HWTA 3QJAA 1AH3A 4OYIA 3BARA 2AMGA 4LRTA 2HVNA 4UTMA 5GAHU 4HQVA 3DLHA 2PMWA 5HPCA 4PR4A 2OSQA 2KRBA 2VRQA 4G1KA 2ABYA 5IWAJ 3U7VA 2CLFA 1XFCA 3TUIC 5DXXA 3LMZA 3V5OA 1FH9A 3L5AA 1TTHB 2C8NA 5CYMB 2GGEA 4L72B 1VEOA 3CUNA 1K1SA 2YPZA 3LBCA 2G3FA 2WZEA 3QT7A 4AWUA 1EJVC 4Y9AA 5AFDA 3DG6A 3MOZA 1C4AA 2R91A 3F2BA 2XB2D 4FPIA 1A5KC 2VVSA 2W2PP 2INEA 1FD8A 3QNWB 3F2CA 1Q8AA 2AX1A 4DJDC 3LMYA 3G71S 4I2QB 3CIWA 2NXUA 3M1VA 4MJZA 1B4KA 1LQ0A 3U5UA 2M88A 1NWRA 3LWLA 1F8IA 1G4CA 3PO4A 1LUCB 5CHCB 3GD6A 2VG6B 3TVZA 1FX2A 5CZVA 3H90A 5KFKA 2MY7A 3SCOA 1W5QA 3BW4A 3EYZA 5KFAA 2FIQA 4QE1A 4BI7A 3V6KA 3NZ1A 2CKSA 2PC4A 4H6KA 4PQAA 2ZYFA 3CUIA 4KJIA 4PTMA 3GZAA 2QA2A 3WLPA 1GQKA 5D9OA 1LP6A 4YHHJ 3EXSA 1MZRA 5BOOA 1RAEB 4EXBA 4F79A 2YSWA 1NNDA 2V3FA 3ONCA 4MJMA 1T99A 5F2IA 3I6PA 4R34A 1AMKA 4CGTA 1BD0A 1XDLA 3AH6A 3H53A 3VAVA 1RD6A 3RDKA 2YKQA 4PCQA 1WF2A 2CJYB 4M7SA 1G4EA 1IKXA 4AHQA 2WVVA 1DXFA 1B2YA 1DHKA 4I6KA 1KBRA 4CD4A 3FKKA 4MTPA 4F26A 4I1TA 2VBWA 4F4AA 2M0GB 3PCOB 2J79A 6AT1B 3MVIA 3AJXA 5DG8A 3H26A 2XMTA 2P2CB 4KO0A 3H5UA 4HN8A 2QT7A 1Q95G 3MKVA 2IC3A 2A1BA 4MNLA 4GKLA 2ZOXA 4QLJA 3GXMA 3W37A 1MUWA 4AY8A 3PPCA 1U22A 3WX8A 1WPCA 3RK8A 4Q44A 3WJXA 2J7UA 1R87A 1JLFB 3G9CA 4L4OA 2IQDA 1JMTA 3AIUA 3WF1A 1C7TA 1OD8A 4BI6A 2ZZMA 5BRPA 3B0UX 5F8MA 2H5JB 2DH2A 1L6FA 2OWXA 1IN0A 2WVBA 5CBJA 2VFIA 5DDRC 3HT3A 1HIZA 1R89A 3OYXA 3VNYA 3BS9A 1HQEB 3K4AA 1FTXA 3WBWA 3GIQA 4H9YA 1TPVA 3WLNA 4K4TA 2VHGA 3N5FA 3Q2DA 3C86A 2QDHA 3QGAC 1Y5VA 1C9DA 2MZRA 1M5WA 3RU8X 3FS2A 1EH9A 1RYRA 4DR7J 1XCWA 3G0SA 4WKHA 4ZP9A 2W67A 3LI0A 3QSIA 2CQHA 1RBAA 2DIEA 2DUAA 4FYWB 2MEWA 4CLZA 3NGDA 2VFFA 5EMMA 2BOPA 2YZRA 3M4XA 1A0EA 3VALA 3MJYA 5J2PA 2OPPA 2E7XA 3LPPA 3SQMA 3LV6A 4AF0B 3C46A 1GXUA 3M7SA 3NCRA 4LIRA 4KIAA 3OTEA 4QWEA 5HWNA 2VNCA 1QNOA 3AIVA 4ECZA 3F73A 2ZDOA 2O9PA 4TVCA 4N47A 4YB6A 3AD7C 2CXGA 3VCCA 1CGTA 2HISA 3M1ZA 1CQMA 4AW7A 1GWJA 5DQGA 1FHDA 5HQ8A 2J0WA 3K89A 1DWHM 1GVRA 4AB4A 2VDIA 1HJXA 4HPJA 3B78A 2A85A 1GJPA 5F0UA 3E8OA 3M8RA 3TAQA 2WCXA 4JKLA 1EKSA 1US2A 4NEZA 3ZXWA 4DR2J 4C8LA 1A7GE 3UFYA 1WZLA 1BC6A 4QCEA 3P0WA 2BGQA 1M01A 1JYXA 3D1OA 3C19A 3ZR5A 4DR1F 2CZFA 2YDRA 2E1DA 3CUXA 1D7KA 3LTPA 4AWSA 4HA3A 1LW0A 1XR7A 1VK3A 1EOMA 1YZ7A 6XIMA 1SW3A 3E0LA 3NQ7A 4C6IA 1HWLA 1HKJA 1O5KA 4N41A 1UEKA 4NAEA 3O5TB 1H74A 3ICJA 4H8HA 5FF2A 2E40A 3EX6A 4C48A 1EBHA 1V6WA 1B3WA 3CD6S 1H1ZA 1KRBC 3IWPA 4Y6GA 2PF0A 3HPFA 3ES7A 3KNAA 4F0LA 3CDWA 5DLCA 3W5YA 4PPDA 4QU7A 3LO3A 3OZYA 4G7EB 4TVUA 2VEKA 1FWNA 1QPKA 2BX7A 5C2CA 1TYGA 3EOLA 5F8HA 4Y2MA 5C5YA 3UN5A 3L0NA 3ARRA 1RWWB 3IR5B 4KPLA 1XPYA 1XIBA 2MQPA 3KUHA 3OGRA 1YBQA 3BQ2A 3RPMA 4K59A 4CTAA 3FEYB 4QWCA 3PR2A 2QEXS 3T5HA 3H2UB 3CTRA 1HHSA 4OX9F 1E0VA 4PZVA 2OLSA 3J80U 5EB8A 1N48A 4ZJQA 4JI3J 1VJZA 2GYIA 2FJAB 4Y65A 3R0UA 2B9EA 2HGMA 4NLUA 1ZLPA 3MDUA 2DQWA 2KG1A 1TMHA 3UDVA 4X0VA 2G3JA 5D8WA 2BXVA 2U1AA 3TJXA 3SSRA 3U8GA 3VIGA 1F6TA 1S1UA 1S7IA 1VMBA 1F74A 4DF1A 4DV7F 1BLUA 1JLEB 4RR5A 2YNHB 3L2LA 5HMSA 3QGGA 2GJXB 3FOKA 5CCZA 4UZBA 1UA7A 3V2UC 2QLWA 1H2TZ 3AYTA 5D37A 4PWDB 2GSJA 4IH3A 3D66A 4HGXA 1SXLA 1IKVA 4MNMA 4O15A 3VM7A 2ZRWA 2CQDA 5LNRA 3PW5A 4NHVA 1TE1A 3HQPA 2VFVA 2PZ0A 4ZVJA 1ISYA 5F41A 5M2PA 2LCWA 3LBMA 3D4JA 4B08A 4QBUA 4Q4KA 4D6DA 1JIBA 2Q3OA 4IG2B 4MK8A 2V8VA 2HVMA 3L4BC 4KRUA 1L6WA 2CPUA 5L38A 1WEYA 2XZWA 3KK2A 4EAYA 2ZOGA 2J6SA 3BGRA 3MUAA 5GMKa 3BSOA 3VOFA 3ARUA 3NGFA 3V6DA 3SEPA 1HWJA 3PB0A 4S2BA 3QZ6A 1KLMB 1PJ7A 1FWWA 3MHFA 4K7YA 2HIYA 3JSYA 4RWXA 4TN2A 2DIJA 2QJNA 3LW5C 4WKYA 1S1XB 4O4GB 3G0UA 2GOUA 4PTNA 3LXAA 3WQEA 2HRYA 3PR4A 3PSWA 4QGCA 3TKFA 3MSDA 4ZVFA 2G0IA 2Z1SA 4JTCA 1IWGA 1KKOA 5CZXA 3AB4B 7TAAA 3M41A 4KWWA 2OFJA 3V4BA 2CVIA 3MMUA 3OGVA 4WYWA 4OJ1A 4F2UA 3IARA 2ZX6A 2IPFA 1R3VA 3U2ZA 4B2DA 1TPC1 3AHVA 3VI2A 4S3AA 3L12A 2WK2A 4CO0A 4ZCLA 4L56A 1TPDA 3WBXA 1C0UB 2CG4A 4RKAA 3ZVHA 2BB0A 4M80A 1OFRA 3TLQA 5HL7Q 4F0MA 1VFFA 1MMLA 4H04A 1GONA 1W6TA 1G01A 1JULA 3TYEA 3NQGA 2XSFA 4KSEB 4WZHA 5KOXA 3S83A 5H9FK 1G7VA 1QI5A 2QYGA 2UXCJ 4IOAQ 3BV8A 2ASYA 4PTVA 3PWAA 3CD7A 2ZRVA 4EXAA 1PX4A 2XIJA 1OX4B 4IJBA 1ZTVA 2VWTA 3BE7A 1PS9A 3HQNA 1EIYB 4WGXA 4M5HA 4M6PA 2PE8A 2DNOA 1CWYA 2PRLA 2VEIA 2OU4A 3OSNA 3BZQA 1NJYA 3J7YI 3LSBA 4MMWA 2FHBA 2VGFA 1R0AA 4HMNA 6REQB 1S72S 1A53A 3SZ8A 4ZO8A 4RZ4A 2R8IA 4LGXA 2DZVA 3MYOA 3HU7A 3KHHA 5JXSA 5CD4A 4LTSA 3WF3A 5AXKA 3PW2A 4RW7A 3MWBA 3VAHA 2WXDM 4GVGA 3W7LA 1U5JA 1MXDA 4BWJA 4OWGA 1UWTA 3MUIA 3N0VA 5I3DA 3KZPA 3APYA 3ZT6A 3DLEB 5CG0A 4GC6A 3QM3A 1VRXA 2W4XA 3E2QA 2NSCA 1JLCB 2KAUC 2VDGA 3OLDA 1M0SA 3A8EA 4GYJA 1WX0A 1Z7AA 2QLJB 4EPEC 1FE4A 1RT2B 2R8GA 3FFIA 4YB1P 2J0SD 3KLVA 4D6JA 3CH0A 5K2ZA 4G2DA 1XG4A 2CEQA 1D7FA 1G2EA 3BN7A 2GGHA 1QI0A 2ZIDA 3WNPA 4DJEC 2FZBA 4N9EA 3QQ0A 4P2XA 1WDWA 4DYEA 1W2PA 4JIPA 1AW0A 4DV5F 4CQBA 2WCAA 3WZ0E 4CLPA 2A3LA 4X22A 4R0EA 2J75A 2OGUA 5LSRA 1S0NA 2HBVA 4E4PA 2QS8A 4NAFB 3BV7A 3GNPA 1FHUA 3CHCA 1HQUA 1QAJA 3H7VA 5A69A 4PBGA 1PJ6A 3WZ0A 1KCXA 2KX9A 3NY0A 4RV8A 4F36A 2OMOA 3CLWA 2D73A 1QHPA 2JBMA 3KLGA 3R10A 4D8AA 5I78A 1BRLA 1XLAA 3SZ2A 1JZ5A 1FFQA 4D6FA 5AJ3F 4DPOA 1PKNA 5JQ9A 5JVHQ 3PYDA 3ARSA 1H3DA 1OYCA 3G2XA 4YVVA 2OSYA 1ISZA 1V51A 2N7CA 1HN1A 1WTFA 1KD1T 3O0FA 5HQMA 5LJ3Y 3BURA 5A3HA 4XD6A 1QO2A 2FZNA 2DT3A 2POTA 3K8VA 3BGFA 3CDBA 3NP5A 4C1KA 1X5TA 4EGLA 4K5SA 1FJ7A 2QUMA 1DQAA 1WOSA 4OZOA 5T41A 2JVOA 3DLGB 3KK1B 1VD6A 3NL6A 1N5SA 4GVIA 2VC7A 5EBAA 3DMJB 5JBDA 2A3BA 1AG1O 3RJMB 1SL2A 3SFGA 2IXUA 3SUTA 1E1CB 4L76A 3FFSA 2K06A 1N34F 4M0XA 3KLIB 4P7VA 2B0MA 3BDEA 3QPEA 1KR0A 1K0VA 4IT1A 2J6XA 3R5BA 5T7LA 4J2PA 1XS2A 4RWWA 5HATA 1TTQA 1X4GA 3RLHA 3IS9B 1PV8A 2DORA 4HYVA 5G1TA 4JL1A 2WNZA 5HWMA 2ZICA 2RGMA 8ATCB 3CUHA 3QJJA 1U8WA 3B4MA 2XN0A 4A22A 1K9EA 3LD5A 2POZA 3R8HA 1IBMF 2E5LJ 4B3MJ 2GQ2A 1TL7A 1RUSA 4I6VA 4CO5A 2LVWA 4W5UA 4R0JA 3SIZA 4FNHA 4IRDA 3ALFA 4YU1A 3MF5A 3UR5A 1PO6A 1XLCA 4O0KA 3P49B 5HMZA 1IGWA 3ALGA 1TL3A 1XD1A 1XYLA 2PB1A 1EQMA 1JZ6A 4OI2A 2X1GA 2B3TB 2ZD1B 1OWXA 3NURA 3SADA 1QI2A 3CCJS 1CXIA 4O1EA 1KNZA 1DXEA 1LWIA 5LYRA 3VTIA 4HZ7A 3CJKA 1R9ZA 2P8BA 1CI1A 3MVTA 2CLKA 2YNGA 1KWGA 3I55S 3MBDA 4XBKA 3QYQA 1C8VA 1P4CA 3ME3A 3BKFA 3G6XA 1R2TA 3GW0A 3TN4A 2YKAA 4JD4A 2Z7KA 4H41A 3HHKA 3GHTA 4PPZA 2WMIB 3LERA 1RTHA 1EYEA 1NF7A 4OHWA 4E2FB 2F61A 1ONWA 1SB6A 4USKA 4GI4A 4AZHA 4H01A 2HFUA 2XSJB 3OUYB 2XCAA 4MWAB 3JSMA 4UOZA 4S3GA 1E6RA 3BVJA 2AYEA 4R5PA 2WPBA 3SMZA 1UQZA 1NFBA 2LDYA 5XIAA 5M2UA 2R8HA 2QJGA 2MLYA 3S1XA 3ITGA 1YZ6A 2R7QA 3PTKA 2H8ZA 4JN6A 2XI3A 3G8QA 2JSXA 2A10A 2EK6A 1YWXA 2HE8A 2W4CA 2FVCA 2ALZA 4DUZJ 3W24A 1NPRA 4PG4A 4DSKA 1QPRA 4FEZA 4LEQA 1EJXC 4MDPA 4PSPA 3FXGA 2AL2B 1RP8A 3KRBA 4FYYB 1GMWD 4C6LA 3ITLA 4DWSC 5B7WA 1N8RT 2QLFB 2IVYA 1VQNS 3LENA 2E1MC 1EXBA 2PDCA 3I7RA 1RVKA 1V8EA 2NUHA 2VASA 3HGJA 2I9UA 2J7BA 5REQB 1UMJA 1VDHA 2QTWA 1FWFC 4USWA 1EJUC 4E4UA 1MWYA 3NUKA 1WKFA 1UIOA 2CBVA 1ESWA 3ILIA 2FDNA 3AROA 2QJMA 3L2IA 3NGSA 2DVTA 2J7KA 4Y2IA 3PYFA 2VR4A 4F67A 4GNJA 4DL7A 4EMDA 4Q4QA 3DHUA 2Y88A 4LRAA 5D2YA 3GVQA 4C6PA 2V2QA 4LV4A 2E5HA 2HFZA 3LGHA 1HKAA 2QCHA 3GFZA 3NCPA 1QLNA 4JI4F 3NQEA 1KGWA 1ITPA 1D3GA 1FH8A 3TAMB 1RWMB 3QMTA 3MMCA 1KRAC 2J0XA 3BOLA 1TFVA 1XSKA 4EWND 5KMYA 3DX5A 2J9YA 4X4TA 4D72A 5BMXA 3S1UA 4X62J 4YN5A 4JV5F 3UA4A 3UFCX 2GMHA 3L4TA 5EUHA 2IYGA 1QJWA 4ECLA 2QPUA 5AC7A 3AU2A 3MGJA 2HLUA 3POTB 2VJVA 3NVTA 1ADDA 2WHMA 1TJ0A 4QWBA 2BHUA 3SSQA 4C4WA 3E0FA 3ZR6A 5B80A 2V82A 2F8MA 2VFTA 1FRXA 1HNXJ 3CMGA 3SFUA 4RLEA 4GHRA 3EDEA 3B40A 1GMUA 2XG9A 3WFLA 1VI7A 5AE1A 2DGOA 2HK3A 3A9IA 1BQCA 3QQCD 3ISIX 4IH7A 3DOLB 1EETB 4PXBA 1OG6A 3C3NA 2YPIA 1RVGA 2F1FA 5F3TA 4DG1A 2I16A 1XYCA 5HBMB 2MZ1A 1X5OA 1K9DA 3CD0A 4YS1A 1KB3A 2FVLA 1LL6A 2CITA 2WSYA 4XZHA 1UCNA 1R8LA 5A2CA 1QTWA 3UZJA 3AHZA 2NQZA 4WUIA 1OZQA 3OO2A 2YJQA 2BHZA 2C14A 3NTYA 4KRTA 1UWUA 1LORA 3U1LA 5A6AA 2B9YA 1DKWA 1JPHA 3QTPA 2H9AB 3STCA 1N5YB 4LVAA 1WI8A 2CZ9A 3QYSA 4KHMA 1M5PC 1XF0A 2UP1A 2JKPA 4IOBA 3IM9A 2ZFAA 1I1XA 1RHQB 2VQUA 3ARTA 3RX3A 4OZLA 1JXLA 4PUKA 1SZRA 4PG6A 1AH0A 1TE6A 1N5VA 1EZWA 2IDEA 4K38A 4EBCA 2KRRA 1JCLA 3TTSA 2MHEA 1Z2LA 1X8FA 1RT1A 2QEZA 4WE1B 2PEVA 1R6WA 4DWIA 4IG3A 1IKWA 2H51B 2JJ4D 2Y61A 3TYUA 1CLVA 4AC7C 5HMYA 1E71M 2VFSA 4DMZA 1BWEA 3M8QA 3CC1A 3AU6A 4N7TA 1PO9A 3PZNA 2GNKA 3GDTA 3DU6A 3WUFA 1K7FA 1XBVA 1W5PA 3U2EA 1RD5A 2QCCA 4IZGA 3A4TA 1VF8A 4L75A 3MMDA 5E0KA 1SJFA 1US3A 3OT9A 2I56A 5I00A 3DLLQ 1PTAA 2FDSA 1I2PA 2HK1A 4KCUA 3GR1A 4LAZA 5E3QA 4O1DA 2EG6A 2VQEJ 1SH2A 2R1MA 2KZMA 3CEPA 1QTMA 2DPEA 3A5FA 3MKKA 3FAXA 2IJFA 3W9JA 3IG1A 1D1UA 2LMIA 1FWGC 2KT3A 5D0GA 4U95A 3PJXA 4Q5VA 1SJRA 4UR8A 1VQLS 1TKTA 1VC4A 1MNZA 2D22A 4YL2A 1QHOA 2W63A 3VKKA 2HSAA 3BO9A 1GX6A 1E73M 2QZRA 4XPEA 4RX6A 4LF9F 2ZXDA 3VQTA 2BY3A 5IZHA 1WC0A 3MPDA 4LYPA 3BLIA 1Y11A 2OKQA 2QCLA 3ARVA 4PKDB 1V5VA 2BKOA 2BJ1A 1WC6A 2LEAA 4LX4A 1CJKA 1ITXA 7FD1A 5CPNA 2OO6A 4KYZA 2D3ZA 3KXQA 4KV8B 2HPUA 4B5NA 5KFBA 4HOZA 1I2RA 4C98A 2WQDA 2YA1A 4ZJLA 4ZOCA 3FV9A 3HGOA 4RNOA 3H70A 3KLHB 3UVJB 3CL7A 3FEZA 5J2NB 1BWVA 1QWGA 3UF9A 1WBJA 3AA8A 4MDOA 4RW3A 5GNXA 4I2PA 1R7AA 3N73A 1WSRA 2QGHA 2V8DA 5IBXC 4OV9A 3ZOAA 2RILA 4J3ZA 1FKOA 4XWUA 3DG3A 2ZUSA 3VKBA 2IKGA 3LPFA 4Y2KA 4LOCA 2Z2ZA 2WBGA 3MM6B 5D2XA 2RE1A 2WBMA 4Q7AA 4HMCA 4L4PA 3QLLA 1BFNA 2R1NA 4YCOA 1RTDB 1UD2A 5A6MA 1J2WA 4QSFA 1E4LA 1KNWA 2BG5A 4TLRA 4FYDA 3SRFA 1VRUB 5I3IA 4H83A 3CPGA 3MM8B 4MPQA 1HNZF 6TAAA 2QW5A 5C7HA 2NXGA 1F05A 2C6QA 1FXDA 2FJDB 2RMLA 2H9ZA 1RACB 5AHMA 3T2PA 3VGBA 1EPVA 3M7WA 4A4JA 1OCBA 3TK7A 1VBYA 2UY4A 1E9YB 2BKPA 1RA0A 2QMUB 3ZSSA 2DJLA 4UNLA 3D7SB 3T2QA 1JYNA 5G2IA 3N4AA 1W9XA 2P9EA 2G37A 1XV8A 5D4YA 4Y6IA 5LNVA 2PEHA 4UTJA 2R42A 5F9NA 9XIMA 3P96A 2PDXA 5DF0A 2OO0A 2GJRA 5DO8A 5A8WB 4KEZA 2HNEA 3NZPA 4GPNA 1ALDA 1W17A 1CEOA 2F2KA 4DO5A 1LRTA 3VX1A 4AX7A 3HQ1A 4AFFA 4LUSA 3PJWA 2TAAA 3RR1A 4CLSA 3S6EA 5C25B 3NOYA 1W56A 4DM2A 2YWFA 4XTIA 2LQ5A 1U1KA 2ZRZA 3CAVA 4CH0S 2PDWA 1QAPA 2WVEA 4X64J 3RRKA 5K14B 3W3SA 3OLAA 3MM9B 1RADB 3LPYA 3I96A 5ADZA 4MNJA 2VPXB 3L5LA 3ETOA 3FJ4A 2OSXA 3MQTA 4ILSA 1AQ0A 2QT3A 1RE1B 1RWVB 2OOGA 3IGVA 4JKMA 1EGMA 2QMKA 3B8TA 3WMLA 2B43A 1XH1A 3CC4S 1H09A 5DBTA 4W7VA 1OINA 3QOKA 3CDEA 1SPQA 2VC9A 4V1YA 4U5KA 2VBYA 5GVJA 3WK0A 4HACB 3QHMA 3FNNA 4QIUA 4UOFA 2W9CB 4JV2A 4I90A 4Q8OA 2A6LA 2XEXA 4ZPDA 1GNXA 2UXBF 3I7QA 4DJEA 4LVOP 4O44A 3T9PA 4S3CA 1T9WA 1XNRJ 1KTNA 4EBDA 4JTSA 2HZCA 5GQBA 3JR2A 3E6EA 4IOCQ 3UXLA 4HT7A 1QNPA 2BXZA 3YPIA 2R1KA 2CDRB 2D1CA 3NKYA 5FDLB 3J7AN 1RPKA 2DYAA 3K8MA 1HLWA 2AAAA 4DZHA 2B4GA 3M5YA 2EVZA 2M8HA 1ZUAX 1J5EF 2G2ZA 1WQ5A 3NQ2A 3TQVA 4N7QA 2BX6A 1X4DA 2UUWA 3I3BA 3BJYA 1S38A 1XUUA 4HA1A 4TMCA 1KM2A 4Q2MA 4JI0J 9CGTA 4C6BA 3ITOA 2FTRA 2E1CA 1YTDA 3CE8A 5EGRA 1RT5B 2PWVA 1X7FA 3ZZRA 3GONA 1E6ZA 2FTPA 1V6VA 3S8SA 1K8AT 3M8SA 4XK8C 1CJTB 4P75A 2DVXA 4EO6A 4RDVA 4DV4J 4KKOA 3W7PA 3UYIA 3GVWA 2LLZA 3V1PA 1VAHA 4I6WA 3PBWA 1E6NA 2XMKA 3IGUA 4RKUC 4ZVUB 1Z42A 1IKYA 1EIBA 2VGGA 4HTIA 2D3OR 2PGCA 3WF0A 2L48A 4RL3A 5BWAA 1H7XA 4QAWA 1R6VA 3HMJG 3V1HA 4ZA0A 4PBFA 4DAIA 2YWKA 1K4HA 1R0BG 1LWEB 1MQPA 2HMIB 4JQ4A 4RXFA 1OF8A 4TU7A 1YXDA 5DY2A 3TZNA 1HL2A 1UETA 1XUZA 4GMKA 4MIAA 2J77A 4IXHA 1I0BA 4JYFA 2VCAA 3D6MB 2GW8A 1TV6B 1MFVA 2WW8A 4QR0A 1KLZA 4Q0BB 3M5XA 2GMLA 4XIAA 4AD1A 3OHMB 4CO1A 1UIPA 2ZWPA 3W7IA 3WNKA 1K77A 3K5MA 2DGWA 4DPWA 1HO4A 4AY7A 5B0DA 1UD5A 1LXNA 1J5OA 2YCLB 3E9AA 3PZOA 3NO3A 3MMBA 2LECA 2OT0A 1V08A 3W66A 2AGQA 4HHHA 2ZDRA 2OOFA 3NWRA 4LVFA 3N9UC 3HSZA 3GTIA 3O06A 1UJ4A 5LM7E 2W2MP 2GV1A 4C6JA 4LV9A 4NZ7A 3VU2A 2E9BA 2M4MA 1W9UA 4ZVQB 4FLSA 3HGSA 3WD1A 2BE2A 1GQJA 2YGYA 2OEKA 4NZCA 3U3HA 2J9DE 2HS8A 4LW7A 1ZTWA 2PCQA 1LXJA 4DS5A 4DF4A 2YYUA 3B82A 4WKAA 1JQXA 2NLIA 4J90A 2WKLA 3TNOA 2YPYA 5A1AA 3EKGA 1EP4B 2M9KA 1M5HA 3M2UA 1NDZA 2F4VF 2IA0A 2J9DA 2DH9A 1ZM2A 2KFZA 3RJXA 2DT2A 3S5ZA 4LF2A 1K1QA 3D67A 4ZPTR 3UNGC 3L65A 4EKJA 2K1RB 1KQKA 1QVGR 1J12A 2I9SA 3C6CA 4MLJA 4NCBA 1UOZA 1XMBA 3AXMA 1UR3M 2R7TA 4HJWA 2E6DA 2J9ZA 7REQB 3LH2S 4I7FB 1V03A 2EAWA 4P9SA 5DDOC 1W54A 3ET6B 3MB9A 3EEGA 3BQ0A 1XLJA 1ZNNA 2VR2A 4DL3A 1SO3A 2YNIA 1JCMP 1EQ0A 4ASTA 1B54A 3R8YA 5HROB 1B5TA 4M5IA 5L46A 2JLEA 4IIEA 3T81A 1B0VA 1F6YA 1RJQA 1QMLA 4JTUA 5BXPA 5IXEA 3FQLA 3MR7A 3CU2A 2VD9A 3J7YU 4LH8A 4ZKAA 3AS1A 3GTHA 3PY2A 1YTKA 2EBGA 4UMAA 1CXFA 1PJ5A 4PMYA 3MR6A 4MTVA 2F5GA 5CEWA 1NHKL 2EFVA 1RWKB 5KG6A 1VFHA 3IWLA 5CYMA 4Y9OA 4LS2A 3UW6A 3UPMA 4PL1A 3B9OA 4O0NA 5MKGB 2NZ4A 1A4MA 3NPVA 4TLQA 4PUUA 5BMWA 1Q5MA 3U2CA 3WKZA 4PUOB 3U2OA 1NM9A 4CCDA 4DJDD 1JQVA 1Q4NX 1FH7A 4RUHA 2IMWP 1GVSA 1XISA 1GZ1A 3MAHA 4HT5A 2I6WA 1GAOA 1S1VB 3GHSA 1LL4A 4TNOA 4N0RA 5TNVA 3OG3A 1SJCA 4I2QA 3GVGA 2MXYA 1NOUA 4Y34A 2MZJA 1MMFA 1TWSA 3CT9A 1SW0A 3F4NA 3WQDA 3N6HA 3UEQA 4ZR8A 3LK6A 1LUCA 2ABAA 4NJKA 5CZTA 3PHTA 1CTNA 3G8RA 1WC5A 1HQTA 4N9BA 4NL5A 1BYDA 1QE1B 2HQGA 1MW7A 1T0TV 4DL2A 3PY8A 1S9EB 4DOZA 3W1RA 1ZAXA 2W7PA 4ICNA 1IWAA 1U45A 5PTDA 1XLEA 1KBKA 3W9IA 4OYZA 4MWAC 4KGXB 1R43A 2F2HA 3CV6A 2A18A 1MFUA 2Q8ZA 5FSDC 2DISA 1OCNA 3TP2A 3BO2A 3AOAA 1YJWS 3SCSA 2PODA 3IVSA 4ZN1A 3KMSA 1OSEA 3T1AA 3NG8A 1TSIA 3S6TA 2ALDA 3VNJA 3W6MA 4JNMA 2QCEA 4NZ4A 1T40A 4LC6A 4DQWA 1VBZA 3FCVA 1RWNB 1WYIA 5C9WA 1BQXA 4MIBA 1FVPA 4M5PA 3L0GA 3VR1A 2FJUB 4K2JA 2ZZ5A 4LY8A 1JLQB 2J7FA 5K5MA 2QCNA 2WVFA 3GTYX 1Q4WA 3CZGA 4YR3A 3TIMA 2ZFHA 2Y8YA 1X1OA 3ABQA 2JFDA 1UL3A 5ETSA 1OFOA 2Z30B 3C2VA 3IRDA 3OV7A 5E0OA 2DNYA 3BSHA 2MKCA 2CWXA 3MO4A 2NWRA 1EF3A 2HBRB 4RE2A 2WANA 4C6FA 3OYZA 4DR4J 2DP3A 3L4XA 2P8CA 2IFXA 4GXWA 4DNHA 3LCLA 1KXQA 1S3HA 1JLFA 2CFFA 4KEMA 1IXKA 1NKEA 2RIJA 3C2RA 1E9ZB 1WOOA 1JIHA 1XYFA 2VU5A 2GJ2A 4NG3A 2ZITA 1P9YA 1WKYA 2ACMA 3F5KA 2RDIA 5F4XA 5L6UA 2NWSA 1HJWA 5KETA 2GSHA 4F3MA 1W5OA 4P2MA 5DCDA 1HQEA 4MAZA 4DR2F 1XSIA 4ICCX 4KWUA 1JJ4A 5A2QY 2G4FA 4C9DA 3SCNA 3SFWA 2V2HA 1OGGA 4KGZB 4MM1A 4H4MB 3OTOJ 2HRWA 2WMJA 3R1LA 1WOBA 4IP4A 4RNMA 3PBMA 3D54A 4JI5J 5DDPC 1SUXA 4ZE4A 1XEZA 4QG6A 4LPCA 2CERA 1SZFA 1UKSA 2C1HA 2ZBRA 4BLGA 3FBEA 2WM1A 4AF0A 3H5SA 3CJTA 1HPZB 2RHGA 3MW7A 2IMOA 4CQ1A 5J5DA 2E9RX 4HYKA 4ZITA 5A8PA 2VL1A 4DV6F 1P1XA 2F7VA 2Y7EA 4LXFA 1BQMB 3DI6B 2HV5A 3GQCA 2FB2A 4BWLA 2EPHA 5HMWA 1NM2A 3EZOA 4B3TF 1JJKA 5F1UA 4LF4J 1VHFA 4QIFA 1RAAB 3LCFA 3OD2A 5DQHA 2DZBA 3S47A 3OTRA 4MHBA 4ES1A 3IJ7A 2EKCA 3GFXA 2ABBA 3U6WA 2BE9B 3MHYA 4GVBB 1YBTA 2HPIA 3RG6A 4GIYA 4QQUA 1ULRA 3M16A 3E2EA 3TNBA 4JI3F 2XISA 3KOAA 2FMOA 4A8LA 1V3HA 3FMWA 3R6GB 3DCAA 3CCTA 3AI0A 2DQXA 5RUBA 4NRUA 4H9UA 3M4HA 2DH7A 4YB5A 4NRRA 2FHOB 2VEFA 3H4WA 1N32J 4ECXA 2WW5A 3KP1A 4ENOA 1XLKA 3R97A 2W61A 4DI9A 5IBXA 1TX0A 4BBYA 2D3NA 4B3SJ 1L2QA 1H41A 5I79A 4B16A 2FFCA 5KAKA 4C91A 2BVDA 3CDUA 1YNYA 3RRXA 2X1BA 1VH7A 3C0SA 3QY8A 4X9SA 1RA6A 3KOFA 4G7EA 4AWTA 2R7UA 3AJ7A 2PSNA 4O1FA 1O7AA 4A2RA 2OWWA 1JAKA 4XDDA 3TR5A 4TQSA 1PYSB 1N82A 1VLWA 3AUJA 1OCJA 1Q6DA 2A7PA 4FLRA 4MKNA