1GEHA

Crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
432
structure length
427
Chain Sequence
YVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMKDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE
publication title Crystal Structure of a Novel-Type Archaeal Rubisco with Pentagonal Symmetry
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
total genus 125
structure length 427
sequence length 432
chains with identical sequence B, C, D, E
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2000-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 1gehA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 1gehA01
1WDDA 1UZDA 4NASA 1RBOB 4LF1A 5RUBA 4F0MA 5HAOA 5HJYA 5HK4A 2VDHA 1IR2A 2VDIA 1RUSA 3WQPA 1RLCL 1BWVA 3FK4A 1RXOB 1RSCA 4F0KA 3NWRA 4HHHA 2OEMA 5HQMA 4MKVA 1RBAA 5HATA 2V63A 2CWXA 2OELA 3ZXWA 2D69A 1EJ7L 3KDNA 1RBLA 2V68A 2V6AA 2RUSA 8RUCA 1UPMB 1SVDA 4F0HA 2OEJA 2YBVA 1RCOB 5HANA 5C2CA 2OEKA 5HJXA 3QFWA 2CXEA 3A12A 1RLDA 2V69A 1YKWA 2QYGA 1IWAA 5HQLA 1UWAA 2ZVIA 1AUSL 1RCXB 3RG6A 3A13A 3AXMA 9RUBA 3KDOA 1IR1A 3AXKA 1GK8A 5C2GA 1AA1B 2V67A 1UZHA 4RUBA 1UW9A 3RUBL 1UPPA 4LF2A 1BXNA 1TELA 1GEHA
chains in the Genus database with same CATH superfamily
1KC7A 4KCUA 3VDCA 4UNKA 5F3ZA 3TAKA 2Y88A 4PRRA 3HDSA 5C9XA 4ZE4A 2IQ0A 5B80A 1F2GA 1B99A 3FOKA 4QRNA 1RU1A 1YSJA 4IRDA 4Z2GA 2ZD1A 4M29A 3MS8A 4PABA 3M8RA 3R5AA 1HNZF 3K4DA 4ZPBA 1RHJB 5M2RA 4YMZA 1XH2A 1VBZA 5I02A 4LQ1A 5LMNJ 3UZ5A 2TSYA 4BEQA 1IBLF 1BQCA 4WTYA 1Q95G 1C1CA 4QWDA 3PW2A 4N8NA 3E3XA 4JUZA 5GPRA 3LGNA 3DAQA 3K30A 1TWZA 1HBUA 4AT1B 3DGVA 2IVYA 3P74A 1XR6A 3LI1A 1R3NA 1R0CB 1FFWB 3EWXA 1TV2A 4MNKA 4MYXA 4X65J 4TOQA 3HFKA 4XD3A 3M43A 1IGWA 3DFHA 5L1LA 3A4JA 1RA0A 3BAXA 4F0HA 3CUXA 4UZSA 5KFYA 1EEPA 3AUOA 5AZ1A 4F0LA 2YNIA 5KFJA 1RCOB 4PMNA 3GY1A 1FA0A 3T6JA 3OXFA 3QFWA 3LZ3A 1GWJA 3RAMA 1PTDA 4FXDA 1HQUB 3RBDA 1JDAA 4RUHA 1P7TB 4I1TA 3KTQA 2XO6A 1HARA 2PI6A 2QIWA 1PC5A 3KTXA 1K0VA 4HTBA 4LBSA 2OQYA 5GJNA 4ATNA 4L1XA 3NS7B 3PB2A 3OXLA 3Q8UA 3PUGA 3GFYA 3WFLA 2UUCF 2C0HA 1NPPA 4CZCA 1F76A 1UZHA 1FRBA 1TR0A 1VQYA 2W91A 3RN6A 3J81Y 4B92A 5AYIA 1VPXA 1HMVB 1WI8A 3RW6A 3R4IA 2BGQA 4N76A 2VUYA 3PANA 1F6KA 3AXHA 3H2UB 1YXDA 4C7GA 2X05A 1DJ0A 3DBNA 3TYDA 2RRNA 4DO7A 4RLEA 2DGVA 5AVNA 3T1GA 3IFEA 1SJ4P 4LY4A 5BOFA 4Q8OA 3BGOP 4DF8A 2QLFB 3W5YA 2FY8A 5GMEA 3WLQA 4YP3A 1LF1A 2YTCA 1UETA 1N52B 4Z1YA 4M24A 1WKYA 3EDEA 4ADSA 3OJGA 1KNWA 4DR7J 1JD7A 3P3BA 3PV8A 1Q13A 1IYXA 3BR8A 2VC7A 2CPUA 1O1HA 1CQMA 2X7IA 2VFGA 4J2PA 1NK5A 2EKGA 1FFGB 1RWOB 3I5BA 4OOUA 2QA4G 3ISND 2NXJA 3P96A 7ENLA 1OS5A 3VNZA 1GX5A 3QZ7A 3FEXB 2CVIA 3GCWP 2RJHA 3F5JA 3WIJA 3PIOQ 1RAAB 2D3LA 3ARWA 4O8AA 2JGQA 3RRXA 1T03A 4RXFA 3D6NA 2H5IB 2EJAA 1OPZA 4ZCWA 2FVSA 4UFJA 3LGDA 3THQA 4U7CA 1F2HA 2ZZ5A 2ZRXA 3W01A 1D0EA 1JPKA 1JXVA 4OI4A 5AJ3F 4DSKA 3MUY1 3W0KA 3K0JA 1RADB 1UBPC 2PP3A 1QHZA 5I03A 2EI5A 3HHNB 4ERDA 3QPEA 5DMLA 2ZUVA 1WF2A 2DCUB 5JMNA 3HPFA 4FF7A 1HA1A 3B82A 3BSMA 4FF1A 2HAFA 3CT7A 2C1EB 4CU7A 1Q4RA 3GJSB 3A64A 1T9TA 1FWTA 3RGTA 3W22A 5C42A 1YXYA 4IQMA 3VCCA 1S5WA 1WZAA 1TKZB 1WOOA 5DBUA 2YVSA 1TWIA 4DI6A 4G1NA 1FH8A 1JCJA 2E9LA 2VCBA 1EB0A 1HBNA 3UJEA 2YL5A 4MT1A 4S2BA 3C0JA 1IEVA 3EGJA 3URBA 2VZ9A 3V4MA 4P71A 3HURA 1XDLA 3SZ2A 5HJLA 5GAHU 2OYMA 2J7CA 4EYHB 2WZTA 3K1GA 4P6QA 3AAWB 4Y6GA 4BA0A 4CQCA 1B0PA 2J27A 4YYCA 2WQPA 2GIQA 2PGFA 4ZN3A 5FLXU 3F41A 2VL4A 3Q86A 2J74A 4KV8B 2AJ4A 4QWAA 3KHGA 1CQNA 1GMUA 3E12A 3GXPA 3M2UA 3PTMA 3OQEA 3SCNA 4CYUA 2PF8A 1VBUA 4R33A 3GXFA 4W9TA 3NGKA 4F2BA 1IUJA 1NKEA 5I07A 3W2WB 4USIA 3FKBA 1BWVA 2CPXA 1SZRA 2DXDA 2ZOGA 2Y4SA 1QE1A 2DXFA 4DN0A 3W2VA 3S1WA 5CJMA 2HHPA 3KUEA 1JXKA 1FXLA 4AG0A 2G2YA 1JJ2R 3PBMA 1QNRA 3H53A 2D3NA 2Z0GA 4D6JA 3HVRA 2WONA 3M8PA 5I42A 5G1MA 4OBRA 3MUXA 4DAFA 3PYEA 1R9YA 3O3LA 4MJKA 4TYBA 4YS2A 3A22A 3K8MA 1CB2A 4ITSA 1UPMB 3S1XA 2CJKA 3BKUA 1R7OA 4C60A 5BJRA 1FWWA 2PZNA 4QR6A 3TVZA 3A3NB 1JXLA 1SGJA 1KTBA 2JZ5A 3SQGB 4AD6A 3FBCA 3OZOA 4Q33A 4AEOA 2QCNA 5D38A 1QK2A 3TZFA 2VFUA 3DXIA 1UYQA 1SPQA 4JN8A 3DG3A 2QUMA 3HF5A 2DHXA 3CXCR 2WSFC 2WKLA 3M4HA 4DHGA 2J5AA 4J9RA 3EWCA 4QG6A 4Z2HA 5DMNA 2KFYA 2E5DA 1J79A 1RT2A 1RAHB 3F1QA 4XUGA 1WZMA 2KT5A 1JVNA 3DC8A 3G2GA 3CVKA 2RU3A 3SSSA 4ZJQA 1QJWA 1N34J 1Z6KA 2XY5A 3LCGA 1BYCA 4IDKA 4ECVA 4H00A 4NLQA 3ICJA 1X98A 2QGHA 3KCLA 4DJEA 3Q8VA 4ZL1A 4CCCA 1HQTA 3CAQA 5FOOA 1RAEB 2VEMA 3N04A 4Q8EA 3LTYA 3EMZA 2DT3A 1KTVA 2CKSA 3UJFA 2GQ9A 3IJ9A 1RHUB 1QO5A 3EZOA 1MW3A 3ILIA 1GOMA 4X61A 2MZRA 4M5MA 1TG7A 3VZHA 1SO5A 2YLLA 1F9FA 3OTEA 2A3HA 5K9XA 1IKWB 2RD5C 1HP4A 1JCMP 3WF0A 3M0KA 3WG6A 4PUJA 1V08A 2V50A 4XAKA 1ZM9A 3AO0A 1MI3A 5D03A 1GKQA 2XGZA 3GBEA 4TMCA 2DIVA 1FESA 2HFZA 4UUWA 1SJFA 3KNGA 1SC3B 2HBVA 2GUBA 4M1KA 1QVFR 2NQ9A 3QM3A 5BXPA 4X4NA 1YNQA 5FJUA 3SN4A 2HVIA 4ZLLA 2WW5A 1XIHA 1F3FA 3FJNA 1XUZA 1VJZA 1GX6A 3DFOA 4GYFA 3D54A 5CBBA 3LP2B 1JPMA 4GYPC 3TFCA 3VQTA 2GQ3A 4GABA 4TV6A 2IW0A 3RITA 1LG2A 1EJ7L 3CIVA 5A8MA 3C6UB 5CCZA 4DV3F 1JAEA 3SN0A 1GCYA 3MP3A 5IM0B 4B9UA 1Q5VA 5AYBA 1V3LA 4IWWA 3UWUA 2PDCA 1JMTA 4DUZJ 1OBAA 3NQ2A 1GFWB 3TQVA 1HQUA 1JG9A 1J5SA 2QIFA 1P7TA 1UKTA 1RTDB 3MUCA 4PR4A 3SUWA 4GVIA 1PCKA 3HT3A 2ZH2A 1KQSR 1HNWF 4PEEA 3W1YC 4NJJA 2OXNA 3ISNC 1RYSA 1NZ8A 4W8LA 3KLGB 1NDCA 2VI0A 3QC3A 1VH7A 3BCFA 3PBVA 1OCNA 3J81U 4GYPA 4BF5A 4N7QA 4JTRA 1DPMA 3B4DA 4XZMX 3CJ8A 5AN7A 3BQ5A 5CXPA 2QE5A 5HOSA 2BGNE 4QE4A 2HZCA 3TSDA 2HLTA 1HMVA 2ACQA 4WXZA 1SCJB 4QP0A 1PKYA 2OAUA 4PUMA 2BDPA 1LKZA 3M47A 4PCTA 4NX5A 2ROEA 3ITLA 5EX0A 4TTUA 1U4BA 4ADTA 1R30A 2DH8A 3ENWA 2ALZA 4LIWA 1ZS6A 4QJVA 2XG8A 3BLEA 2MQOA 4XZHA 1UH2A 4ACZB 4W87A 4O0NA 4TXEA 3EA2A 2BRLA 4HJWA 2FJWA 2XFWA 1SI9A 1KVIA 3HMJG 4UTUA 4QCEA 5ADZA 4WPAA 3GW3A 3EXSA 4BWMA 3DFPA 2FMOA 3MHUA 1AXQA 1PWLA 4LF4J 4LAZA 2GO9A 5IOLA 2AYEA 3KBJA 1N4LA 1RB0A 1RD5A 1E0XA 4IQLA 1IGSA 1TZZA 2ZZ7A 3SUTA 2RAGA 1X6UA 2HBZB 2L5HA 2G3FA 2HG4A 3WK0A 3AIBA 2ZX6A 4WGXA 3IV8A 2VB6A 1JNRB 2AJ2A 3GM8A 4AWTA 1S1RA 1N36F 5AHNA 3GQCA 3BQ1A 5LZLA 3KOXA 3DCPA 3N0VA 5F8MA 3M0YA 5I3JA 5JQ9A 1GVRA 3PYGA 2R3VA 4WZHA 8XIMA 1N8RT 2CZFA 1XSJA 1Z42A 4EXBA 2VC1A 5KAKA 4QDMA 4YR2A 1CBKA 3TX9A 1XYFA 1JQXA 1UKUA 3NOCA 5FL0A 4CO2A 3KZSA 2V3FA 3ENQA 3WEZA 3MUTP 4DR4J 2VC5A 5G4DA 1ITCA 4M6QA 4NXMF 3DYPA 1FHDA 3GR8A 3UBPC 2CLIA 2VNCA 1TKZA 2LU1A 4XK8C 3KLIB 2D20A 4ALZA 1DWAM 4PXDA 1PJ6A 4K8RA 1W5QA 4GLEA 3LLDA 1IWAA 2E8YA 1P6WA 2D22A 4U28A 3GYNA 1UTAA 4BHYA 2FJVA 1M1GA 4L4LA 1KQGB 4M6PA 4LGXA 3GB0A 3CL7A 1RH9A 1TAQA 3L7OA 2Z26A 1M9HA 1Y5NB 5H9EJ 4WJ8A 4IHCA 5L9FA 2AGQA 5C70A 4NCGB 1N5QA 2UUAJ 3T0TA 5JIWA 3EGVA 2ZH9A 1GK8A 3SZ8A 1ALDA 1WG5A 4HL9A 4HU0A 3WBEA 4O4WA 3V36A 4MOZA 3EOLA 1EHAA 4B5XA 1CC8A 5ABEA 3SCLE 4QZVB 4KV8A 2R2SA 2XFYA 3R1LA 1LG1A 3OHIA 3IM8A 4J5NA 4OV1A 2XUCA 2FPYA 3SCUA 1V3KA 3WUEA 3KM8A 3PDNA 1KW1A 1X6LA 2TYSA 4JBRA 3W2WA 2DBBA 4A48A 2XMAA 2OVLA 1LQ2A 1PYTA 1A0EA 2KDOA 1C3FA 2X8RA 4N56A 4TUFA 4HHJA 1FTRA 2HVMA 2J6UA 1POKA 3W7GA 3N11A 3G1SA 1MO0A 2EG2A 3L2MA 3KS5A 1E6YB 4CD4A 4YOEA 4YS1A 1RUSA 2JC1A 2ZJQQ 4EU0A 3ZZ1A 1FK9B 2XSJB 1G1XA 3BLDA 4RW9B 2BW7A 1BQMB 2C3PA 2I6WA 1GQLA 3SSRA 1LJYA 2B4PA 2O4QA 5F0WA 3IWLA 4O1EA 1FWAC 2OFGX 1CC7A 1CGTA 3MTJA 3LUYA 1H7PA 3AIUA 1Z1ZA 2ERRA 3MPDA 3HCXA 1GVOA 3CYVA 2XVNA 3NO1A 1S77D 2ODOA 4ICMA 4JV5F 3S5SA 3QY8A 3PWGA 3SQGA 4P73A 4KHPJ 4LR8A 4CCEA 2CZDA 2V68A 4M5PA 3TI0A 3PY8A 3HMCA 3DHXA 3I5AA 1P48A 3PZUA 5D2TA 2DPIA 2HNHA 4E2VA 3UCUP 1FTXA 1B31A 1P43A 1U09A 2BKOA 2BQ3A 1HI8A 1ZU8A 4ZPVR 4YTRA 5FD1A 2QN6B 2XS5A 4ZOSA 2G1DA 3VZYA 3RR1A 2YGYA 5IWAJ 3V7PA 1NLKL 1XYBA 3VOGA 5K3VA 5EL1A 4Q3MA 3P8BB 3I3BA 1VRTB 3QKZA 1XGZA 4XIAA 3W8GA 1E43A 4HYRA 3UDCA 2GIRA 4JY9A 4XTTA 3GKFA 1MVYA 4MLRA 3P5YA 3W1UA 1SQFA 4I6AA 1M5PC 4W93A 1HKKA 1OFAA 5FA5A 4A21A 2XHCA 2DV0A 2NUYA 3COTA 2XZWA 2VEIA 4HNOA 3OVQA 4JKLA 3P93A 1IKWA 1WC1A 2XY7A 1KXQA 3FSXA 4WYWA 4XSLA 3RCNA 1GJWA 2OH2A 2PDMA 3DNCA 3TX0A 3DX5A 4Z2XA 1FBAA 2YR1A 3C2VA 1GORA 1C4AA 4B3OB 2HYIB 2Z00A 3MAAB 4FLQA 4ZR8A 2CQBA 4WKFA 1S79A 3GSIA 5CD4A 2UXDJ 1ZCCA 4C3KA 1G3OA 3AJXA 4CCDA 4JI7F 1BQNB 1YBQA 1DIDA 1UA3A 3TOYA 2H4YB 3LCLA 4DSLA 4DO6A 2KU7A 3N6MA 1KRCC 5CC6A 3R3TA 3NL6A 2HPIA 3IVUA 2MKHA 3QMRA 4EAMA 3UZYA 3V4IB 4GUJA 4GIRA 1JZ3A 4UR8A 4BK9A 3MFHA 3TVAA 5I79A 3VM7A 4OZLA 5U47A 3LP2A 1SFJA 1V5XA 2C15A 2FJKA 4G1PA 4ZODA 3VD7A 5KFWA 2ZWPA 2VPZB 3C6UA 2A10A 2JKEA 1DWGM 1ZA1B 4OZJA 5IM0A 2X3DA 1JKHA 3PZOA 5M2PA 4HA3A 5ABHA 3WLSA 3WK3A 9XIMA 1C0UB 1MFUA 2AEJA 3EOEA 5KFQA 4U96A 5K9CA 2RDWA 2D3ZA 1DIEA 1TQJA 1U22A 1UKPA 3VK5A 1ZBKA 3TSMA 3KLGA 4MKYA 4K38A 1WAWA 5F1UA 4MIWA 2GVGA 3PEHA 3VIMA 4F4YA 4PMQA 2GC8A 4LVOP 2E66A 2ZQ0A 1W3NA 4TU1A 5A6SA 1U6ZA 2F4VJ 1H7XA 4LWWA 2HKEA 4CO1A 3VO0A 5J1PA 2FZNA 5ETNA 3MZIA 1OC5A 5AHLA 5F9NA 3C19A 3FJ4A 2O55A 4DX8H 2UP1A 4LF5J 1SJDA 3W66A 2OPJA 2R2TA 4FXRA 5IFPA 1REGX 4NLDA 4RUCA 3GVGA 1KDNA 3A4AA 3QTPA 5ABGA 2OWCA 1JZ2A 1JFHA 5L1IA 3BZJA 2WMFA 2LLZA 2W2OP 2IS7A 2IJNA 1Q6OA 3CB3A 1YITS 3NG8A 1QVBA 4DU8A 2H8XA 2NT0A 4DQRA 1L6FA 4ACZA 1V0LA 2NXGA 2V2CA 1FKAF 3SUVA 3A47A 2UUBF 4E8UA 4JX4A 1S76D 2YKQA 2NPIA 5ETSA 1H2VZ 1VQMS 2G3MA 3G1HA 4A8KA 1S1XB 2MQPA 3FCWA 2PE4A 1J9YA 4IIDA 4ZOBA 5FIPA 3P45B 3KJFB 4AZHA 3H26A 1KWMA 4Q0BB 2LMIA 3BB5A 1ISVA 4AE5A 4GY0A 2UWFA 4GI4A 1L3UA 3TK7A 1HT6A 2FTYA 3AHPA 4HCLA 3BOXA 3GVRA 3LHZA 4LBHA 1ICEB 2CNLB 3KBWA 4ZDNA 1G01A 2PA8D 1PXGA 2PMZD 3B8DA 1XGDA 3O2LA 4F4RA 3IMQJ 1U1QA 5A2AA 3UR2A 4QG9A 2I7GA 3K8VA 1J11A 2PA3A 2QR6A 3ANUA 4ZLJA 3URAA 3TW9A 4AIOA 4HKPA 3OVPA 2XNRA 3X1LB 4QIEA 1QCWA 1QPQA 3UJ2A 3W83A 2RRBA 4IMFA 3AMDA 4A3YA 3NAHA 1K4HA 5B09A 1VC6A 3LCIA 1XCXA 1QSYA 3QO9B 4GI6A 3FYPA 4CVUA 2QIIA 1EBHA 3KLIA 4IQEA 1C8XA 2ZRVA 5F0UA 1NJXA 8RUCA 2A6LA 1T8QA 1JNEA 1S59A 4J9PA 3PZPA 4F4KA 5FI8A 1NK8A 4GBUA 2R2UA 2QCEA 2AGTA 3D0IE 4DV7F 3UU0A 3ZZZA 1MEHA 1I0BA 3GYXB 5HJXA 2EKYA 3EMTA 4DR6J 1JUBA 4NCGA 4I4BA 1EOKA 1XEZA 1WXYA 2CJAA 4HI2A 4M5DB 2W7OA 3AYRA 4E38A 2XWDA 3QQ1A 1KRBC 1RP5A 2ZKMX 1XK8A 3WNOA 1XBVA 1IF2A 1EZ2A 4MK8A 4QQ3A 5IDZA 1RY8A 9RUBA 4KQZA 1K77A 1TZ0A 2Q6CA 1ISYA 3KL3A 3TAPA 6ENLA 3E74A 3MANA 2QYCA 3FHAA 1Z41A 2B6AB 3LCXA 3EYZA 2W6RA 3WQWA 5AXKA 4POCA 4ZE5A 2X1FA 2FZGB 1KGWA 3K2GA 5BXIA 4Q7NA 2H4WB 4IO1A 1RAOA 2OO0A 5TIMA 3ITHB 2OYKA 4G9PA 4Q32A 1S5VA 3RAQA 5GNYA 5B0BA 4F9JA 3PWAA 1E6YA 3UDLA 2EBGA 4D6EA 4FYYB 1FK9A 2XSJA 1EP1A 3CULA 4JI5J 1H50A 4RW9A 2J9CA 1BQMA 4HNTA 1K8XA 4NMLA 4TX8A 3M0VA 2C71A 3GJTB 3NJ3A 1ZM3A 1TAUA 1V6HA 4ID5B 4LU0A 1S2AA 3CPWR 3AU2A 1UB3A 3LQGA 2DHAA 1GEQA 1RA6A 1FWRA 5F3TA 3HX9A 2A1YA 3IG1B 3GZ7A 2F8EX 3HHLB 1W1YA 3MP5A 1C8VA 2VBWA 5DGBA 4S38A 3UR7A 3EPOA 3PZ9A 1HJUA 2PDNA 2P0OA 2VICA 4V19X 2PI5A 4LF7F 2WWCA 4YTQA 1OMSA 1J0IA 3UA4A 3SSJA 1V3SA 3OBIA 2XTJP 1NK0A 3NGSA 4NZ1A 5LXRA 1O1ZA 3W62A 5K8OA 1RA5A 1VFJA 4OHQA 4I0WA 1ESWA 3H2OA 5A8OA 3DOLB 5L9XA 3E8OA 4FA3A 5BRQA 3MP4A 4N9DA 4NCAA 1YTYA 3R0DA 4JL1A 3HHLD 5HNNA 2DW7A 5A1AA 5CZ0A 1W5PA 4HNUA 4JHMA 3UI3A 5DLFA 2PUZA 2HHTA 3GTHA 1AJ0A 1VRTA 4TX6A 3QPZA 4HHUA 5L9NA 5LSLA 3LO3A 2RT3A 5EBAA 1QOXA 4LMZA 2P50A 3ITVA 1OX4B 1QBBA 3CIMA 5F8JA 2DR8A 4MGGA 3AHXA 3W37A 2UXBF 1Q8IA 3UD5A 2G97A 3NCQA 4JIIX 4LAMA 5B0FA 3H25A 4HZ7A 2M88A 3VZZA 3T81A 2PIIA 2EPKX 9XIAA 4XZIA 1XBXA 1LBFA 4OI3A 1IKVA 1G4SA 2YBUA 4LRBA 3V81B 3ICLA 2C2DA 3MGJA 4B3OA 2WXDM 3EBVA 3G6LA 3MAAA 4EO6A 4RNIA 3S6TA 2E28A 1R43A 4P2SA 4JI1F 3CASA 4MB1A 2IXUA 3AJ2A 4P7VA 2YFOA 2G2ZA 2D41A 3QYSA 3L5MA 1VQOS 4JYAF 4LBPA 2QJ3A 4TKTA 3TMLA 3CC4S 4LY8A 3V4IA 4O1AA 1U5VA 3WD2A 3N4FA 2W2PP 3P0XA 1SC1B 1PTAA 4DV6J 3UERA 4UOJA 1WKKA 2GSJA 4A2SA 4ZQCA 1J0YA 3IEBA 1C0UA 2KG0A 2ZXAA 3IARA 3NQ7A 4Z08A 2OQLA 3VIKA 1L5UA 2EG7A 4R5EA 2BR0A 4LT6A 1EPVA 2NW0A 3L5AA 4CO0A 1OWXA 3S5YA 4LF5F 1R3YA 2OSYA 3H4GA 1PKLA 2P6TA 4B4FA 3IBCB 2C1GA 4O8RA 4XAPA 1XLKA 5ETQA 3E0VA 4HTJA 3NPWA 4MPKA 3G96A 4XVDA 3TCEA 1CEZA 3QGHA 1FD8A 1DWHM 4GE8A 2VFFA 3APGA 2AMCB 4B3SJ 4K4ZA 3AB2B 1UD5A 4NUWA 3S6DA 2Q8LA 2A18A 1S4EA 1SZFA 2VVSA 4D2JA 2C3YA 3NGDA 3OL8A 1H7WA 2XB2D 3CE8A 3SQMA 2R7OA 1WEYA 3C6CA 3Q4DA 2ZUAA 5EHHA 1I1XA 2XG9A 3EX6A 4Z7CA 5D78A 1KCZA 2C2NA 1QSLA 2GW8A 1SW7A 2WSPA 5LOQA 1WOBA 4NWBA 5D77A 3IS9B 3MMTA 2XMWA 3M2VB 3IJLA 2DT0A 3F44A 1X8CA 3QMTA 5DQHA 4YB5A 4JV2A 1YNYA 3U6WA 3PR2A 2ILZA 3OGRA 3PX0A 4RX6A 4JCMA 2HQCA 3DGRA 5F2LA 1U83A 4CQ9A 4DIAA 4CTAB 5D32A 1S1XA 1PAEX 3BSHA 2WANA 3FEYB 3JZEA 1CXKA 5CH9A 1N8FA 1WHWA 1GT8A 1U6BA 3L67A 2BV9A 4A8IA 2IXVA 4Y9MA 2DIUA 4F25A 3ZNJ1 4L73A 4AUBA 3OG3A 3W2MA 3VGUA 4JTAA 2AQWA 3FGVA 2YYUA 4P74A 3MDUA 4QLLA 4FP9A 3WFZA 3JQKA 2AYBA 3B05A 2IYGA 4ED5A 4YXGA 3FXYA 3HQNA 2FZCB 2ZZNA 1VQTA 3REQB 3SRDA 3PYDA 4KCWA 3AC0A 3PW4A 2KRBA 4RBVA 1SZGA 4EE9A 4XSMA 4Q7BA 2JLGA 2QQ6A 2W62A 3A5FA 5IQQA 1SW0A 4ZPDA 4OTKA 1PUDA 2LQ9A 1GQNA 3G5EA 1LFPA 3EGWB 4J9UE 4AQYF 1XLEA 2H3BA 4TTGA 2IIHA 4PCPA 4DFKA 1HFBA 4BQ2A 2OB3A 1XH1A 5EPDA 2CC0A 2WZEA 4PWWA 2IPOB 3QO9A 5HMFA 1MQPA 2DGTA 3MD1A 3L12A 2ZUNA 1UP3A 4BZYA 2HWHA 1ME7A 2OEMA 2XS2A 2FHJD 2QDGA 7FD1A 5F4XA 3T2QA 1T7PA 1O94A 2DP3A 2XZTB 5FIIA 3M6XA 3W9HA 4S39A 2O67A 5KFHA 1SMAA 4ZTXA 4RCXA 3AIEA 2ASHA 1PS9A 1GHRA 3A3OB 2EKCA 3VOCA 1N5TA 4W84A 3B9EA 5KZEA 1SUXA 2F2KA 4N5SA 5HQ8A 3UP8A 3N9SA 1FEHA 3ENAA 2R1LA 4M5DA 5IT0A 1X97A 3TYCA 3WNKA 3SCPA 1FJGF 4IGNA 2FYXA 1RTJB 3B6BA 4LJMA 1FWPA 4F2TA 2A0FB 4HHPA 5A8QA 2A6MA 3NMRA 1VIOA 1A5NC 2VP8A 1PX4A 3E51A 2V69A 4LVDA 3BZGA 4QTGA 2FJXA 5A8NA 2B6AA 1FO1A 4R85A 3FDGA 1XMQJ 2ZZ3A 3GZ3A 2NX3A 3QN3A 1L6GA 4X62J 1M7JA 4DV5F 1WKEA 3NDOA 3UG5A 4CIOA 1JRCA 3BLKA 1G7VA 2DJLA 5KFSA 3HHLC 3DENA 2XWXA 7XIMA 1VCFA 4JI6F 3ITHA 4OX9J 2F63A 1MXSA 4L4MA 1DIKA 3WD0A 1PC4A 2EK1A 1QTMA 2DFAA 4USUA 5BOOA 4Y2IA 2NT1A 1NSQA 1QPOA 5HVGA 3A9IA 2W9CB 2GGPB 4S0MA 4FX8A 1NCLA 4G8TA 1VPQA 2YH0A 3VALA 4QJ3B 1PKMA 1ZBVA 3UVJB 1L6YA 4OZ3A 3LQLA 4N41A 1IT0A 1H61A 4OU1A 5FF4A 4C6EA 2F6KA 1FDDA 3G4SS 3QPYA 5CSUA 3IG1A 1XNRF 1EUAA 2YDRA 5DG7A 4DNMA 1DOSA 3IJQA 2D0GA 3FJLA 1W2PA 4GNJA 2DVTA 1XP3A 3LPFA 3RGIA 1B3TA 2XH2A 4B9MA 2WJZA 3VNKA 1ZRQA 4PTNA 2GLKA 2MZQA 3HG5A 3WH5A 2OU4A 2DGQA 1LBLA 4ZP6A 3V75A 2VFRA 3W7HA 4ECWA 2FQQB 1EDQA 1LV5A 4CLFA 3OYZA 5M1TA 1RQEA 3H59A 4UTIA 3AIQA 2UUWA 1BVNP 3DOLA 3QC0A 2CPEA 4WDXA 4KW2A 1HKAA 4HVXA 4LVFA 2XVGA 5KT4A 5DDOC 1V3RA 4FYVB 1D1UA 4LAOA 5DZ6A 4OI2A 1BWKA 4M80A 5CC7A 3TA0A 2NZLA 3C2YA 1NMEB 1CNVA 1MMFA 1VCTA 1YTEA 2L08A 4JIRA 4GKLA 4XTIA 3J7YU 1OX4A 1RWUA 5IC4B 2CLKA 3OVRA 3VXGA 1FDYA 1E0UA 2DTJA 2HBYB 1UR0A 5E3PA 2W9BB 3GILA 1DURA 3VYLA 4DPUA 2XU2A 5DM7Q 3BUVA 1UWIA 4J3WA 1XDJA 1W1B1 3TQPA 4AXNA 1KSPA 1F3EA 2CJQA 2BBFA 3QR1A 4AX7A 2GK1B 2QRRA 2AQOA 1Q8KA 1UH3A 1T9YA 4A3RA 3MEGB 5CAKA 1FRHA 4RWWA 4ZA0A 3WZ0A 4XD4A 1LOUA 3CHFA 1KRPA 3STCA 4P8UA 3WLNA 3IM9A 1RT7B 4DUTA 1OK4A 3HJEA 5DQPA 3CCQS 1NEYA 3VHQA 3VGSA 4S3EA 1JZ5A 3QPIA 5EX3A 4WKRA 4YVXA 2D3UA 2VHGA 2UXCJ 1H51A 4RUBA 5H2ZA 1G4EA 4I7FB 3LHTA 4DUOA 2NXCA 4ETZA 4RXGA 1H3DA 2MQ8A 4CNTA 5KSWA 1PKNA 3B4UA 1OX6A 1MQRA 3S8SA 5IQ6A 3RO6A 7AT1B 4Z2KA 2VFSA 2DGUA 4YR3A 2YX4A 3CDWA 3SSZA 1FWFC 4DFMA 4NZ0A 4ZO7A 2FVKA 2E9ZA 1FRLA 4HOZA 2DZXA 1P6BA 2GO8A 4KGZB 3C14A 1OIAA 1WB0A 3JUGA 4DR3F 3IAM9 4NLWA 4LS1A 4K1WA 4KYZA 3CC2S 2XLKA 5KFIA 2VDHA 5T8GA 4AY8A 3W1MA 2RKIA 4UR7A 2NLIA 2QEZA 4FB7A 3PSVA 1GZ1A 2V0TA 1H72C 4O23A 2ASLA 2A4AA 4HYVA 2KZHA 3L09A 1J2WA 4ZOEA 3TLLA 1NSAA 3I3DA 2PD9A 3Q24A 2O9OA 4DXVA 2CPDA 1IJEB 3EWYA 3WQFA 1XNQF 4F3MA 3TYAA 1H98A 4CGTA 4DUYJ 1OK6A 2VD3A 1XV8A 2HGNA 4QQBA 3CZEA 2MMYA 3M7VA 4BY3A 3O6QA 1JPIA 4JDBA 4U10A 1YE6A 3UDVA 2Z0IA 2JOQA 2Z4GA 2FPHX 3BOFA 2APOA 4JAWA 4IPJA 3C2EA 1FF2A 3BW4A 3AYSA 3IS9A 3C3LA 3M2VA 3EB3A 2JF6A 3ZT7A 2J7DA 3LBOA 4LF8J 3L4ZA 3NVDA 1CJVB 3ID7A 2NX9A 1TU0B 2GMHA 3SFKA 2ZH3A 4CTAA 2HE5A 3LS9A 5CZXA 1I2NA 2PO4A 1OC6A 4D1IA 5HR7A 3H8AA 1VB9A 3GH4A 1CG2A 3ZR4A 1EH9A 3OA5A 3KLHB 2H90A 1NK9A 1XF0A 3GFHA 3W61A 4LW7A 1IXOA 4IGMA 3QSTA 2DVIA 2Y8KA 5LNUA 2EFVA 4LFCJ 3I82A 2I0XA 4Z2IA 2POZA 2FH8A 3FFIB 2KZMA 1Y5WA 2EXOA 2DUAA 1JGIA 3C5QA 4RL3A 1MU2B 4A8QA 4DX6A 3AS1A 3TP4A 1XIGA 4HPHA 4H7VA 3REQA 3M8QB 4D9PA 3LRMA 1CVJA 1NY1A 3IA0A 2NLWA 1EX1A 1WNOA 3CD5A 4F67A 1N33F 2Y70A 1PYFA 4AEEA 1OYBA 1U2CA 3OJSA 4KT2A 1OEPA 1VYSX 2BTMA 2XZ7A 3T19A 2WLYA 5LNVA 4IFKB 2BHUA 4PAAA 3EKGA 4AC1X 2E9BA 4GA8A 1XMOF 3G1RA 1VQNS 3TO8A 2XMMA 1VIXA 1TV4A 3FYOA 1Q8LA 2AJ1A 4AWEA 2R7VA 3AHZA 2IKIA 4JICA 4JTGA 3TDFA 2C3UA 4GXPA 3TONA 3CPGA 4F0MA 4MFDA 5C71A 4WLCA 3VKAA 4C8ZA 2HK2A 1CTNA 4H01A 3AIWA 4CI0B 4ECRA 2ZEJA 1XIBA 1HO4A 4KEZA 5E6YA 2VASA 1XYMA 5KFEA 2HVHA 2RH3A 1UEKA 4JI0F 1S2CA 1XIJA 2ZA1A 2HEJA 2WOMB 3AY0A 2AQ4A 1KA9F 3TX8A 1XCFA 3GNDA 1AZSB 1XLGA 1T7LA 3H21A 4NYZA 1CJUB 3M07A 3URQA 1VGYA 1G7UA 1JJKA 3CPUA 1KLYA 4K39A 2E1RA 3RU8X 1RT4B 1RTJA 2EHHA 1DJNA 2R1MA 2ZUMA 3LRKA 3UVAA 5D2VA 3MEEB 2FGLA 4UY8T 2D9PA 3QLDA 5LXEA 1VFSA 4I6YA 4K37A 1W26A 4HDHA 2YOCA 3BREA 4WRHA 1E4MM 4F48A 4D6DA 3CCMS 4QEEA 5F8LA 3TUPA 5FACA 2OZ0A 2UUTA 2CHOA 4DY1A 1NSKL 4I5RA 4WHBA 3LYEA 3MTWA 5CPMA 5HANA 2A6OA 5I09A 4QIGA 4M3PA 4CWBA 1C9WA 1X1ZA 4NNAA 3CTRA 3MA8A 1W9DM 1JLCB 1EGMA 1RWKB 4F2UA 2GGPA 4XDCA 1RT6B 2LEAA 4OHZA 2V8VA 3D68A 5JIPA 3EKLA 1XI3A 4NJGA 3AICA 1I94J 1TL3B 2YNHB 1WO2A 1KQZA 3VTRA 1JDCA 3GV8B 1XRFA 3EDKA 5LGZA 3MSDA 2HK0A 4KAIA 3LPGA 3KVJA 1JLQB 2VUGA 3THDA 4NLSA 3B9NA 5AKQA 3LHWA 3CNQP 3WC2A 3QBCA 2YYTA 3UWWA 1JJHA 3DG7A 4IPNB 1H3GA 4BKNA 3CWJA 1MWQA 4N6FA 3W25A 1NK6A 1CDGA 3R7BB 4KHMA 4XTDA 2LA6A 3DRYA 3LLFA 1O95A 5CD4H 1XMBA 1GVIA 3SY5A 3G8SA 2BP1A 5CHCB 1XD1A 3OYXA 5BWFA 3KWXA 3H20A 1TL7B 5AYZA 2CRLA 3WLJA 3IGXA 1JDFA 4R7OA 4NZ6A 1GOIA 5CZJA 2QFIA 1B1YA 1YPXA 2MEWA 2OSQA 1Z3NA 2RDXA 4M7TA 3TIMA 4ES1A 3BGGA 1S1WB 2ZE0A 5HMWA 4A3HA 2ZADA 3BM7A 2C42A 4FDFA 2CJYB 3BSCA 3H2FA 5KG6A 5EY5A 2G0CA 3KOFA 5HQMA 3NOGA 3CZGA 5HWMA 2N7CA 5JXSA 1WD6A 4E2DA 3G9CA 3RB3A 2J6XA 2W9BA 5C24A 3WX4A 4NAFB 1PYOB 3QYQA 4UXDA 3JVAA 3EDDA 3L2LA 2MXYA 2JJ4D 2PDAA 4K7YA 3UWTA 4OMFG 1F6TA 3BE7A 3SXLA 2GK1A 3QW3A 3VOJA 5PTDA 1VQ7S 4X4VA 2X42A 3IRXB 2DRAA 4FLOA 4O19A 1QXLA 4A8RA 4QEHA 5G5IA 1BTMA 3TZNA 2D0FA 3HO8A 3QT7A 1US2A 2B56A 3S46A 4RL1A 1MN7A 1VBXA 2HK3A 4JQ3A 4FEZA 5IRPA 4A4JA 2RJGA 1AYEA 4C7DA 3TROA 4I7FA 1HR0J 1G4PA 2JE8A 4NI2B 3RAXA 2V3GA 2VJXA 4QPTA 3WF4A 1QI0A 3DI0A 2ROPA 3L95X 2PLJA 1N8IA 4A8NA 2P9CA 4HTIA 1Q65A 1ZM4A 3EX1A 4LYQA 2PLCA 2B7NA 5C2GA 2V67A 4IL0A 3W7QA 3S9ZA 2ZYFA 3FV9A 4X2PA 3ZTSA 3FBEA 3STPA 2NXNA 4IUFA 4UQAA 1Y0HA 1WDRA 3MMDA 3VAJA 3H7UA 4GC4A 4L9ZA 1K9FA 3EDFA 3NSNA 1JQGA 4WR3A 3T6CA 2E40A 4AZ7A 3ZZPA 2P8BA 3EVMA 3PO5A 1TUFA 1E4IA 2RQCA 1R47A 2OCZA 2M9KA 5E3RA 2Z2UA 1NTHA 4H6RA 3W75A 2GGHA 4ELVA 1CXIA 3RXZA 4GI9A 1U1HA 1PSDA 2YQ1A 4C6KA 4ECYA 1KFLA 1EJXC 3TYZA 4X0NA 4WEVX 3E2EA 1HNXJ 3N73A 2FD2A 3VA8A 1N54B 1BY9A 3QEZA 5IXUA 1XFBA 2AL2B 1KOOA 1S5MA 3T78A 2AQVA 2FHBA 4NLUA 3QRPA 2MLXA 2WSQA 4TV5A 1NM9A 2FQIA 2QHAA 3MYOA 3R1ZA 4JOMA 2GFTA 1XLDA 3G22A 1CJVA 4RJEA 5D4PA 2Z2MA 1LQ9A 1ELSA 1LL7A 4O3OA 4Y28C 4H9XA 2Y9HA 3PZMA 1F7BA 4EK7A 1L3VA 1SR0A 5D9MA 2PWUA 5CAHA 2CPIA 4FIQA 2FLOA 4PG7A 4GX8A 3EAUA 3I7QA 4XZLX 3T0CA 4JFVA 2E5HA 1PWMA 2ZNZA 3MR7A 3KLHA 2NQZA 1H0GA 2WYSA 3U2EA 3T09A 1DYSA 3RJMB 2G5WA 5IFTA 4DQSA 1ITXA 1TCMA 4J3SA 3K57A 2YXOA 1B5TA 4ED4A 3WO8A 4QWEA 2DY9A 1KD0A 3FFIA 3QQCD 5U4NA 2X3GA 3ZZTA 3SN1A 2F5GA 3PR5B 1M7XA 1T0OA 4N9BA 3HA1A 1MU2A 2QLJB 4J9MA 4ZZ9A 3RO8A 3BH4A 1GNKA 3JSYA 1NJIT 2ABYA 3MVTA 4Q4SA 2JFDA 1VIZA 2W1BA 5DG9A 1S6UA 1R9ZA 1UWBB 3LUTA 2QZRA 4O1BA 3B9OA 4LAUA 3W23A 2YDAA 1OFPA 1SMDA 4GVGA 4IFKA 2DVUA 3CQ0A 4V27A 5D02A 4JNYA 2AIRB 4X4TA 4HYWA 2Y63A 3K8LA 3TRGA 1NWUA 2AD9A 2IA6A 4G2DA 3MUVP 3M5XA 1ELOA 4PCNA 1UMLA 3CUHA 3G6YA 3EB4A 3RDKA 5ETKA 1SFLA 3WNMA 4ZVHA 5IBXC 3F56A 4K4WA 1GTHA 1CJKB 4WKYA 3SDEB 4JI3F 4M1BA 3W64A 1IXNA 5GAHI 4IF2A 2B9YA 4NCBA 4O14A 1B0IA 3CLMA 3KWMA 1QW8A 5AC8A 3U02A 4C6OA 2WWDA 2MKSA 3Q8QB 1RY0A 2C13A 2BY3A 1R3QA 3GIRA 4C6FA 2WOMA 2QXWA 1WZKA 3NG3A 1AZSA 4R88A 1F3XA 2D2JA 3TCSA 3Q83A 1BD0A 2B51A 1SJ3P 1CJUA 3FEZA 2GDVA 3OW1A 1QOPA 1G1YA 3HKWA 3GB6A 2ZRWA 2X30A 2GJXB 7A3HA 3NQBA 4QITA 4KE5A 2ZC3A 5G2WA 3MEEA 1DJHA 4UCGA 1IKXA 4Q4PA 4DLFA 1DVJA 2AYMA 4ED0A 2CQCA 1E6NA 1DXIA 1XKYA 1TE6A 3TC7A 1E1EA 3OLDA 5IBXA 2IA0A 4E8DA 3JS9A 3OLBA 5KFTA 5CG7A 3SMZA 1AMYA 1UQYA 3EX2A 3EMCA 1P1MA 3MKCA 4DMZA 2HWIA 3WJWA 3ETMA 3LV6A 2FLNA 2PMQA 2VPXB 4IKAA 3GIIA 1RT3B 1TRDA 3E6EA 2CLMA 4LF9J 3FC9A 1K1DA 1JLCA 3UD3P 5B0CA 1CW2A 1M5WA 1T40A 4M63A 2VF3A 3BBBA 1VMBA 2YSWA 3ABSA 1RT6A 1D9EA 1U02A 1KRMA 3L21A 4UTLA 2YZRA 5IFMA 1TL3A 2YNHA 4RNHA 2GZOA 2KVQE 5B7ZA 4H83A 2PT0A 3Q94A 5KFXA 3CHEA 5D8WA 3QAEA 2EFGA 1IWGA 1P9QC 3KOAA 3DHPA 4B9ZA 1JLQA 3AOAA 4XIUA 2EO7A 3WLHA 4EO8A 1RWMB 2JK2A 1W32A 3UZWA 4K0KJ 1G4TA 3FZ2A 2LXUA 1RWXB 1EO5A 5DJBA 2W24A 4WFAQ 2WB4A 1H49A 4Y90A 3G1FA 1UWQA 1SKUB 3BGJA 3EZ4A 4HN8A 3AH6A 3K59A 4WWSA 1W3IA 2VPYB 3DI6A 3MKVA 4OYWA 1P1XA 4AHOA 1DBTA 2F8MA 1TL7A 1IHIA 5M2UA 2BXJA 1VQ9S 3GR1A 3H4DA 2ALYB 3QQ0A 4C6PA 1D9AA 4FHAA 4QYRA 3NUKA 2G3JA 1ECEA 4XPCA 3AIRA 3CCLS 1S1WA 3MY9A 4FXSA 3CNYA 1UFLA 2FB0A 4IP5A 5CZVA 5HAOA 3GU2A 4JV0A 1HIZA 2D9OA 3GTIA 1XBWA 4JI8F 2E3ZA 2PRLA 2V9DA 3VAMA 4KTQA 3UO0A 1H1NA 3RHGA 3U27A 4N02A 4C65A 2JRSA 4NAFA 5G4WA 4NHVA 3TN6A 3SW6A 1FFRA 2XH4A 3GD6A 4C1NB 5XINA 5AC4A 5HWNA 3LTSA 3K5NA 4QBUA 5BR8F 4IIEA 1B2YA 2DUZA 4ZSUA 3IRXA 1MWYA 8A3HA 2JFKA 3I68A 3LG3A 2PC8A 4L9YA 4JN6A 2ZE2B 4PUUA 4DR1J 3MPYA 1F9CA 1V02A 1HHSA 5KG7A 1PB0A 1X96A 3MJYA 1ZENA 1FHLA 1M5KC 4F02A 2JEGA 4DSIA 1LWJA 1OADA 1UWTA 4K7VA 1TIMA 1HJSA 2H51B 1GW1A 3M1VB 4AZIA 2HVDA 3DERA 2KYXA 2YWFA 4F4ZA 4LS2A 4PPDA 4H8HA 3OHMB 2FLPA 4NI2A 3S9YA 3D3BJ 3GHSA 1A6LA 1RJPA 1NRKA 4KB7A 1WDQA 3CZLA 2HS4A 4IIGA 4QJ4B 1TTHB 4Q4OA 2J7WA 1HP5A 1QUMA 3H12A 4GQ0A 1W5MA 2Q3PA 3VQSA 3R5EA 2Y24A 3W07A 1I1GA 3OTOJ 3EA3A 1L6SA 1CZ1A 3C3NA 2HQGA 1TUWA 3AOCA 3QOMA 1VQKS 4OV4A 4ZLPA 3CJ4A 3LWMA 5XIAA 1F9HA 4ZBCA 3A8JA 4H04A 2IJFA 4DAIA 3T8QA 3DFNA 4R53A 1IEIA 3ZSTA 1RK6A 3IIXA 2WW8A 3N9UC 5H8PA 2PF0A 3QZ8A 4J7CA 1A7GE 4BLGA 5EWEA 2VRJA 3OBEA 3M6WA 5D15A 4GVFA 4RDYA 3S4TA 2KB2A 4JDYA 4ZGYA 2XYHB 2ZM6F 2VQFF 2B0GA 3N12A 3UYCA 3KLFB 3QSYB 2JFEX 4HMDA 3UGVA 3MM8B 4YTTA 4X4SA 5IZHA 5B0EA 3G6ES 1HO1A 2A7PA 5DRKA 3UXIA 1AD1A 2AV5A 3GPAA 3PO4A 3G86A 3GVQA 1GQKA 1VC0A 4RNNA 1CENA 2DNGA 3TJIA 1YE4A 1FH7A 2INEA 1GYNA 2AL2A 1T9UA 2MTLA 3PACA 1XH0A 3P7YA 2I17A 1N5SA 2W5FA 2DH3A 2DZTA 2R7TA 3RX2A 1B3XA 3GKAA 5J8LA 1R2TA 1HHQA 1S7IA 1XLIA 1N6QB 4P7LA 4CQ1A 3AALA 4D72A 4J35A 1XRTA 3OB8A 1TFWA 2GWNA 2Y1HA 2GJNA 4RW6B 4HU8A 1A5OC 3NGRA 4U2YA 1MNEA 2CEQA 2D74B 4M5GA 3T40A 3KK2B 2K7JA 2DGWA 5A2BA 4IG3B 2WMKA 2D2GA 1E15A 4HH0A 4FYWB 2IMOA 4RLIA 3VD3A 1N82A 1UASA 1UIPA 1R6VA 5LIWX 2M8DB 4JYEA 1W56A 3DZ1A 3U2OA 2RMLA 1H62A 1K70A 3R2DJ 2V6AA 4GHRA 2QAPA 2Z1WA 1PE1A 4OHYA 4GJ1A 4AUKA 4LUSB 4JNMA 4CLKA 1WXZA 2BJ1A 3AS3A 3HFZB 2XBPA 1UP1A 1JCYA 1YJVA 5KFNA 4X9SA 3BAKA 4GO9A 3UFCX 4ECXA 1JEZA 1T05B 4LCSA 3GDRA 4QFUA 4O12A 2KJWA 1KFBA 1VFMA 4HU4A 3LDVA 1UWBA 2PFDA 2E25A 4UZCA 5IDIA 1MSSA 4B9YA 3GIJA 1VFHA 2FGZA 2XTKA 3HJFA 2ZUGA 1VS1A 4PB5A 1Q6QA 4TVCA 4HH1A 1Q0NA 3G8QA 3KTSA 5IHSA 1KKRA 2TODA 3KDOA 3R10A 3R8YA 1N8WA 3K5OA 2ZVSA 1V77A 3A5VA 1CJKA 3SDEA 1VLYA 3MM5B 1TQXA 4L6HA 1WDTA 1EIYB 1W54A 1R86A 3LU2A 4ZVPB 3WENA 2LFVA 3LGHA 3N1AA 1Q4WA 4E2FB 5C5JA 6REQB 4O0ZA 3WDJA 1W1VA 1Q16B 2OT1A 1IIGA 3CTTA 3BBCA 3CUNA 3GG7A 4HBKA 2HQ3A 4J90A 3IBWA 4FS1A 1LW0B 3W1RA 4OLPA 4G1QB 2GJXA 1KNZA 1BAGA 1YZ6A 4YY3J 1BVZA 1GAOA 4NX0A 7REQB 1CWYA 1XTZA 1S2TA 3MHFA 3SAZA 3W5XA 2VKZG 2ZH4A 3RRGA 2ESCA 1YGYA 1PZ1A 3BLIA 4GMEA 4ATLA 5LNWA 5J2QB 1Q6LA 2A6NA 4PG5A 1JCLA 4RE4A 2IDEA 4OYIA 3T5HA 3NQ8A 2EFQA 4MHBA 3AZSA 3HGOA 1QSSA 1OQFA 4RBTA 5DZ7A 1G2EA 1E56A 4U4MA 1F8IA 4K68A 1Q7LB 3MTKA 1DJXA 5FF0A 2XN0A 4PXCA 2OKTA 1S49A 3GTYX 5KFBA 4DBDA 1Q5MA 1HYSB 5LYRA 4K50A 2OP5A 4F3OA 3PX6A 3QFEA 4IX0A 3KMSA 1RI7A 4KY3A 3WZ0E 2QV4A 4M0XA 3VDBA 1E70M 3B97A 2WC4A 2A3LA 4ZFCA 4PXBA 1CYGA 1TL4A 4LRDA 2I57A 2FFIA 6PTDA 2NS1B 3W71A 5A94A 4FKXA 3GDMA 1SZEA 2XPKA 3WX7A 5A3HA 5AXLA 1JFXA 3BANA 4JIEA 3UR0A 2MHNA 2B9EA 3RBXA 4F04B 2R7WA 4J37A 1IQ8A 4DSFA 1YDLA 3R79A 4MAVA 3NIYA 5HQLA 1Q53A 3AT1B 5CPLA 4CP5A 3TZYA 4WJBA 4ZB0A 4FYXB 4ZCIA 1RACB 4XK2A 4H9VA 3VAIA 3B8TA 3WF2A 5CPQA 1XHGA 2ZH8A 3W2LA 2AW0A 2BKPA 1XLCA 1AZ1A 3K1DA 1T9VA 1WUEA 3UPBA 5E0KA 2CBVA 2I5GA 2LCWA 4I7WA 1EIBA 1VBHA 2IKHA 2PDYA 2XN2A 1UPPA 3SCRA 1CXFA 1G4CA 5J2NB 1E6ZA 3HSDA 4X64F 4DJDD 3AXIA 3V1PA 2Z4PA 4B5WA 3QT6A 4FKYA 5KT3A 2WHLA 1KLNA 3TJ4A 4A8YA 2IFXA 2BM1A 4QW9A 4C1NA 5KFAA 4RW7B 4LQ9A 1CGWA 4NLYA 4X4PA 4BFAA 2XVLA 3MO4A 4I9JA 1U45A 3H98A 1HNYA 4DLGA 2Y7FA 5MF5A 2XHYA 1U1MA 2IMRA 3PHAA 2KM8B 4Z1DA 3PCOB 2P5NA 4O44B 4EBDA 3AFGA 2ZE2A 4US5D 4WUIA 4J91A 4LBUA 2Z1XA 4LCQA 2DEJA 2AAAA 4RPQA 3CJ5A 5LXYA 3PTQA 4DS5A 3NL2A 3GXIA 1PJ9A 4OQVA 4AISA 4JIQA 3ZLFA 1CLVA 3M1VA 4FXFA 1U5JA 1UR4A 3R5BA 3TJ8A 5E3QA 3F7JA 3BGRB 3VAGA 2XSXA 3AIVA 4FXWA 1MRAA 2GPTA 4TY8B 2X1AA 5KINA 5HBMB 1JIBA 1W3JA 2PFHA 3M0JA 3UJSA 4UOZA 3TW7A 5DEZA 2FGBA 3W3OA 3T9ZA 1S4FA 4JI4J 3J80Y 1TR9A 1V3IA 2NQLA 2AJFE 4NJKA 1Q66A 5GADU 1S97A 5EGRA 3M8WA 2XSBA 3IACA 3MAQA 1YDYA 4KWUA 3UN3A 3MFIA 1GYMA 2WC3A 4ZPAA 2MQNA 4H2HA 3LNMA 5FEXA 1NSPA 3FBFA 5T91A 2HZAA 2PE8A 4AWSA 1ZH5A 4OT7A 3QHNA 5JU6A 3PXGa 2D1ZA 1R8CA 3FDSA 1FUYA 1IE7C 1YEYA 2HPMA 1TYGA 1NPRA 5DF0A 1B0TA 3KLFA 3LN3A 1DQ8A 3MM8A 3OLIA 3PUEA 2XDFA 1VQ4S 3O0KA 3PN8A 3PPCA 3I0RA 4DCPB 4WOQA 4K8EA 5FJ4A 4YB6A 1Q6CA 3QATA 1YPIA 3WDHA 3VINA 4G65A 3S5ZA 2I1OA 2GSEA 4LF2A 4QIUA 1V03A 1RVGA 4X60A 1Q79A 4C6CA 4HK5A 5HI7A 1QI5A 4LF6J 2RQKA 5DXYA 1Z69A 1WKJA 5CH7B 5KFDA 1N6QA 4YCPA 3J7ZT 3I4PA 5C9RA 1BSIA 3C3UA 4E4PA 2A2CA 4B2DA 3L4UA 4RW6A 3VNIA 5HNTA 4WXWA 2ANUA 4IG3A 1AW0A 1DARA 1KM6A 2DISA 1WBJA 3L23A 2ADAA 3VZIA 4GVBA 3U2CA 4GCXA 4GWEA 3OFHA 3LAKA 3WQ5A 1IJFB 3R2GA 3HK2A 3T1HJ 4LUSA 4LRAA 2X1SA 1B3YA 1JNZB 5THWA 4TQSA 4C90A 1C8QA 3T1AA 3B8IA 3URNA 1EGVA 2CWNA 4QDPA 2J75A 4QX4A 3VM5A 2BA9A 3E5PA 4REQB 3KG1A 1KS2A 2GQ2A 2HVZA 5MAOA 3WFAA 2OG9A 3BLOA 3HGRA 2ZH5A 5DY3A 2H3EB 4XZBA 1ZAVA 4IQJA 3UT0A 1PDZA 2DRBA 2FC9A 4F3QA 4FF5A 4UWMA 1AUDA 1RA7A 2UV8A 4Q7AA 3PPFA 1JUEA 3W7NA 1P6TA 1SKWA 1Q3NA 1GH8A 4A8FA 4EF8A 5BW6A 4FYDA 2D1CA 2ZA3A 3KS6A 4IMGA 2HHHF 4DPOA 5C9UA 3LI0A 2WBRA 4W89A 2HSAA 1OY6A 3MM5A 5SUHA 2DPEA 2V5CA 2QA4S 1UD6A 4UQCA 2DO4A 2CHNA 4M5KA 1S5NA 3OTRA 4BQ5A 4F9DA 2A5HA 1XL9A 1XLAA 3H7VA 6REQA 1NFBA 1GTEA 3WBYA 2F8HA 5JBEA 1U8WA 2FVQA 1EJUC 1LW0A 3GIQA 3KLVA 5D0HA 3T07A 3ZFVA 4YMEA 4G1QA 3E1F1 2NZ4A 1KB3A 3VIJA 3MI7X 3SSQA 3OXGA 3AS2A 4GQQA 1OGGA 4AB4A 5G0RB 7REQA 2HRWA 1N32F 1YPFA 2Z6JA 4GD0A 3KUGA 1EYEA 3MT1A 5J2QA 4JTQA 3JZUA 2FYMA 5LHFA 1UC4A 3WBAA 3H5XA 3MHYA 1AL8A 2GHVC 2ZRZA 3VGGA 2YWHA 4G1IA 2FZMA 2G8ZA 2B9XA 1BG4A 2V94A 4NEYA 3H70A 4UUXA 4FLRA 3I4HX 4G5DA 3SQSA 3W53A 3WLIA 3NGTA 2DZBA 4KERA 2UY4A 1K7FA 4W92B 4PKDB 3MKKA 4RO0A 4B17A 1E51A 2VFVA 1O5RA 4WSHA 5KOXA 2HMIB 3FLUA 4PMZA 4PG4A 4DWSD 3FZBA 2CYYA 3IGVA 1EYWA 4HMEA 4DJDC 1HD0A 4DCOB 1KGXA 4DPWA 4YHHJ 2ZRYA 2C28A 3E2RA 2P10A 4QE1A 3VABA 1Q7YT 3KP1A 2HHXA 2DNOA 5FJIA 3APYA 4MJZA 3ZLHA 1DEDA 4S3GA 3ORWA 4U5IA 3N18A 1N55A 1V7AA 3UY7A 1FRJA 1KCLA 2DU2A 3KDNA 3SRHA 3PJXA 3MU7A 3GHTA 4H9TA 3BGLA 2SFPA 2XYLA 3O2IA 3U4AA 4M5HA 2RS2A 4WIWA 1BRLA 1YDVA 2SXLA 3FUYA 3BVJA 2ZUUA 2C79A 2BOAA 3TQKA 2ZBQA 1KM5A 4MUPA 4DJDA 5M3WA 3R94A 2GV1A 2Z1BA 2ZFAA 1X4EA 3W60A 1SSGA 4PC8A 1HBOB 3F5KA 2G0WA 3IWXA 3QLHB 2QEXS 1DORA 3AMLA 4N9CA 5AE1A 2KM8C 4CH1A 1ZGDA 2J6VA 2XIIA 3E0LA 2I8EA 4OZ0A 4QR0A 3RYLA 3S47A 2Y7EA 1ECQA 2ZWZA 3CIXA 1D9DA 5J2MB 3RF9A 1FNOA 4OBTA 2ZVRA 3R5CA 3T1YF 3IR5B 1WC3A 2DH2A 1OVDA 2WVTA 2FJAB 3SGZA 2Q09A 5HUOA 1HWIA 5CSRA 5ECUA 3S2MA 4RW7A 3EX4A 2XULA 4RU2A 2ZITA 2W4XA 2VVNA 3VDAA 2KX9A 2VFIA 3N9KA 2VG6B 2NUWA 2YW4A 3B78A 5EFDA 4O44A 2R7SA 3NS6A 2NXIA 3M46A 1FDAA 4EZ6A 2MDAA 1O0PA 1GPFA 1QNSA 3BDKA 2VEPA 5AY7A 2AZ1A 4KKOA 1MQQA 3SURA 1C90A 1ISXA 3WQPA 2PWGA 2OO6A 2CCRA 3A3XA 1ZPTA 2JEJA 2X7VA 1NVMA 2BFGA 3M6UA 1V3ZA 5HO4A 4M95A 1RXOB 1EARA 1MZRA 2ZZ1A 3BGRA 4HPNA 2LEPA 4H6EA 3WNPA 1S0MA 3ZJ8A 4TY8A 3J80U 2CQDA 4JFWA 4DG1B 2OSRA 1KR4A 5F4SA 4HMCA 4JQAA 4MWAB 4NILA 4QWBA 1D8CA 1R31A 1WTBA 4C8LA 1J12A 2RNEA 4UTHA 4HCDA 4OFCA 2XIQA 3D6MB 1UOKA 2P1FA 2QC3A 4A3UA 1I2QA 4OYOA 1TJ2A 2W66A 3UG8A 3ELFA 3UR5A 2X1TA 3NNAA 4KBXA 1JGMA 1HKVA 2QJIA 1OQ6A 3BN4A 2YDSA 3W76A 3PHEA 1PZ0A 1UWUA 4C11B 1QLNA 2WCGA 3S5OA 3QLLA 3RCMA 2HJPA 3PFOA 3M7WA 2CZEA 3WLRA 4A8LA 3N4WA 4ZQRA 2XZDB 4MWAD 5I00A 4GG9A 3IJ7A 3L3CA 3TWBA 4FNUA 2ZTJA 3ABOA 1HJWA 2E9RX 1FHTA 3TQEA 1BGXT 2V4JB 3AWOA 2WVVB 3NNTA 4IO9Q 1XLBA 1OINA 1ONEA 2PP1A 4LANA 2ASYA 2D23A 1J2VA 4GKKJ 1GXTA 3GAYA 2YA0A 3HT0A 3QAUA 3F2BA 1ADSA 1UJ4A 1VJWA 4F2SA 4ALDA 2AT1B 3ZJ7A 1EIXA 1S6PB 1PBUA 4M6UA 5FCZA 1VDHA 3M0ZA 4DUWA 2GVLA 4DN9A 5JUMA 3HQ1A 4OUEA 1BE4A 4X4OA 3HPXA 3C56A 4ZK7M 1VIWA 4P8VA 4B9TA 5TNVA 3VIPA 4B3TJ 2E5LF 1PTGA 4EGLA 3S1GA 3ZJKA 4Q8TA 1CJTB 1SQEA 4JI2J 2AMGA 3W7IA 1S5ZA 4P2VA 4JQ4A 2I5QA 2X1BA 2ZOMA 3MSYA 2CA9A 2YQ3A 4I56A 4NASA 4KRUA 1R7AA 3NRBA 5FSDC 3CJ0A 4AIUA 4GUFA 2VBXA 1EHWA 4DPTA 1B3OA 4J9KA 4AAJA 2OGUA 2BOGX 3AUJA 3LMZA 4DF0A 2G95A 1R2SA 3M5YA 4URSA 3NR0A 1JAKA 2GZXA 3M6YA 3ZS4A 4O15A 3MWCA 3NCPA 1U7LA 4IXHA 1E3XA 4REQA 1UG6A 1TV8A 1SW3A 1OB0A 1Q6GA 1LWIA 3JTOA 4UFLA 2R8IA 3QZEA 3UXDA 3RNDA 1PGZA 1HNZJ 4YQWA 5A8WA 4BBYA 3GVWA 1RAKA 3KK3B 3ONCA 1R3VA 3GSDA 1L3SA 3ITOA 3DU0A 1J5EF 1LWHA 2DKOB 1IBLJ 4FK9A 1MN9A 2Z27A 2POTA 5AC6A 1OIFA 3CU2A 1J93A 1E3ZA 2MZSA 2VRQA 2CQ0A 3BEGB 1GYLA 1SZNA 3BKFA 2Y8WA 3QZ6A 4NSBA 3CZ8A 3TW6A 3A1YG 3M8YA 1K1QA 2XGBA 3QYYA 1FJEB 3MO7A 3E38A 3W7PA 3W73A 1XD0A 2Q79A 2JIWA 4UC5A 3GDKA 3GS6A 4OGZA 1QW9A 4UQEA 5HVHA 4HHMA 1KFDA 1UUMA 4DYJA 1FWLA 1H09A 2YFNA 2RHQB 4KPLA 1O12A 2QO3A 4C4WA 3VV2B 3L66A 3NCRA 3NMAA 1UHVA 1YWXA 4KGVB 3H4WA 2NV2A 2PEHA 9CGTA 3IRDA 5FD0A 2YXXA 4DR2F 4C0HA 3MBDA 2NWSA 3C2PA 1RK8A 2MB0B 4LVBA 2V8ZA 2VG7A 1VKFA 2JKAA 2A2IA 3VNYA 2VGFA 3DFYA 2D2HA 5KFMA 1LRTA 2XVKA 4J3TA 4QCFA 2QX0A 1C8YA 5AT1B 3GLJA 1O5JA 1WA3A 3UGRA 3WBXA 4YB1P 1XW8A 2PU0A 4DM2A 3IRSA 1MRQA 3PFRA 2J8GA 2V4QA 1B7FA 3LSCA 3CV1A 1HZYA 4B3RF 1JLFB 1ZBCA 2WZMA 3GIKA 2NQHA 2HMIA 1V02E 4OECA 4JX5A 5D2XA 3SQOP 4QXIA 2YXGA 2GYIA 3L4WA 1VQ5S 1DJIA 1M04A 5HK4A 4KFOA 4LUIA 3VKDA 4E2BA 2VDIA 1X5SA 2B0MA 2AX1A 5EKYA 2BWGA 4F8XA 2HBRB 3E96A 5LHEA 1QTWA 4RX0A 4OV6A 2A79A 3WJSA 4I8DA 1RCQA 4XZNX 1XIIA 5MHBA 5GJPA 4ED6A 4QIFA 4XWUA 1OD0A 1EKSA 4PUEA 2CKRA 4AD2A 4ANEA 1YX1A 1Y8BA 3B3DA 4CN6A 3BAJA 2WVSA 5E5NA 2DB1A 4Q2LA 4I8YA 4D8ZA 3NA8A 1ADOA 3T44A 4BCEA 2ZH7A 1RKJA 4CNPA 1UVKA 2W9MA 5DQGA 1H11A 1HBOA 4KC5A 3KK1B 1XR5A 3PRVA 1FX2A 5T26A 2BJ3A 2OTDA 3LPEA 3QLHA 3LH2S 1UKSA 3Q2TC 3STGA 2YCKX 2Z2LA 4OYPA 5M03A 1B3WA 1NOFA 4BC7A 4J3XA 1ACMB 3J7YI 3KHJA 3WSUA 3C61A 1HW9A 5JVHQ 5CXTA 1JXEA 5AJ3J 5I3HA 4DCJB 3RW7A 5J2MA 5FESA 3L68A 4MTPA 1JUKA 1J8VA 1SQ7A 1IR0A 3UFYA 3N79A 2WMHA 5IT4A 3CC7S 3VGDA 2YNGA 5H6HA 2W8KA 1K8AT 3RPDA 3GNPA 3MD3A 3ZWSA 1XYLA 4B90A 3UJRA 3TVKA 2F61A 1FWSA 3GBDA 4IGHA 4IXXA 4Y8FA 2P0IA 1LEOA 3T2PA 4JEQA 2A3EA 2VG6A 4MWAC 1KVKA 2Y1LB 3LHYA 3ATZA 4EP8C 3HPAA 1UZ1A 2ZHOA 4D6HA 3PVFA 1DLOB 2GJFA 1EQCA 2DNHA 5A6BD 3IC1A 1Y3KA 4MH8A 3OG2A 4B9VA 4KJIA 3JSBA 2QJGA 3MUMP 2BVTA 4DN1A 3EWGA 4HSOA 3S01A 3WQEA 5EMKA 1Y0EA 1VFUA 1YLXA 4EBEA 4KF1A 4DG1A 1NOUA 3NL0A 1A9NB 4MWAA 3N5FA 4H3DA 4HNCA 1XG4A 3QFHA 5H8MA 4DV4F 1Q7ZA 3EWBX 3MI6A 3SFWA 5CLTA 3Q58A 4PTXA 1GJUA 4Y2MA 1Z89A 2Z7KA 1HIYA 3WELA 2VRKA 2GVJA 1EA0A 1EC7A 1UFWA 1IQTA 2HISA 2HCVA 5DCBA 4E6MA 3RILA 3V3WA 3ITTA 2H9AB 3BMWA 5BRPA 5FL1A 1JNDA 2V63A 3ZTPA 1TZ7A 3VKCA 2XI2A 3BICA 3W74A 3U7BA 2G3IA 3LLXA 3I5CA 1O6IA 3VE9A 2ZXBA 1DFDA 2OR2A 4Z2LA 1GMWA 4JTIA 2AAMA 5CBJA 4H9ZA 5GAGI 5D0EA 4DBUA 3N28A 1R5YA 2V4JA 4NPOA 2V5LA 3CS2A 1JDDA 2WVVA 3LQVA 3AZRA 1WEXA 2CERA 3PW0A 2B7PA 1ME9A 5CG0A 1FDBA 1G5AA 3DDNA 3NEKA 3HLUA 2FGCA 1J18A 4LSZB 5AC7A 3G1YA 1PIEA 1FY6A 3P2VA 3U1NA 3KUHA 3PM9A 3OLAA 5EGYA 2CNCA 2ALDA 4EKJA 2MLZA 4EI2A 2WNZA 1H73A 3E01B 2PRMA 4M1RA 2J9ZA 1ZP4A 1JYVA 1OY9A 3JSRA 1CJTA 1E1FA 3THTA 4P9SA 2QMKA 5AHFA 4M5NA 4TU8A 4QDWA 2B8PA 2FHCA 3NM1A 5HA7A 3QY6A 5SWUA 4E4UA 1NAQA 2O0TA 2L9DA 5ETTA 3FN9A 4HP5A 2BUNA 3BTNA 1S99A 4WX2A 4CU6A 1GQEA 4RZRA 1TK5A 4HACB 2CBIA 4U95A 2QL7B 2MZTA 2QVHA 1LT8A 1GEHA 4WD0A 4YIWA 2HEKA 2PGWA 3WCZA 1XYCA 1NDZA 5A69A 2V8PA 2J77A 4UBPC 1L6WA 3I4KA 1NDLA 4ZOAA 1ADDA 4X66F 4LR7A 3BPSP 1VEOA 3LALA 3SCOA 5I3GA 1U26A 1VEPA 3KK3A 4J27A 1S2VA 4FF2A 2DZAA 2B4GA 1PZ3A 3CB4A 4H7CA 2HS6A 5A8GA 2J13A 2ACYA 4S23A 3F4VA 4R0EA 1S6OA 4Z17A 3QNWB 1OYAA 2EEXA 3HZEA 3IXQA 3TV8A 2J4GA 2HNZB 2G0IA 1XGEA 2OFHX 2OPSB 2XMVA 4TU7A 5G4HC 2Q6ZA 4L61A 2ACSA 4FZIA 3NQMA 3S6OA 2CBUA 4HCHA 2J47A 5LSMA 1T0TV 2EGZA 2PDKA 3WF1A 3D1HA 3VIOA 3NZRA 3WDIA 2I9UA 2VCAA 4UTTC 1SIZA 3M32B 1Q78A 4PUDA 2IJRA 2YWKA 3EVOA 3SCWA 2YKMB 1PHQA 1R6WA 1T9WA 1W0MA 2YBVA 3G8RA 3M1ZA 5CJNA 2J9DE 3D1OA 3PVXA 4V1YA 2EK6A 4DV3J 2ZKTA 1PYSB 2YL9A 1FP8A 3HM7A 1B9BA 3HZ3A 4C6QA 3PAOA 2K3KA 3ATYA 4Y9NA 1I6NA 3O44A 2BYCA 2ISWA 3TA6A 3MDFA 1ME8A 1JF6A 4OJGA 1W2VA 3PW7A 4LFAF 1S12A 2O1PA 3B4MA 3NQDA 2R9LA 4NXNF 1DL3A 2E29A 3P6LA 4PL2A 4C8OA 4KGKA 3FFSA 1J27A 1QW7A 4GO7X 5ETLA 3AODA 2O7SA 3LGMA 4DJFD 2WSEC 1HNWJ 1TVLA 3CQHA 5E0FA 1UD4A 1HVXA 4ZN1A 2QA2A 3MMCB 3FDKA 2A85A 4Y9AA 4J9OA 3CCWA 3M64A 1VJSA 3GXMA 2JVOA 5CLWA 1SJ1A 1ICQA 3GC4A 2WK2A 1F3WA 3LX9A 2B5JB 4TMBA 3KBVA 1F5CA 1DJGA 2OSXA 2XIJA 1JLFA 3HPOA 1EP2A 1NB7A 4U33A 4QM1A 4UQ9A 3IJDA 1WOSA 3IP0A 1EHNA 1GHSA 4J9JA 3KKFA 4R5PB 1QU4A 5AZ0A 4MB5A 4RU9A 2GVYA 2OZ8A 2VURA 3VE7A 3S7RA 5KFLA 4CLUA 4TNOA 1UJ5A 1KO0A 2F38A 1TQLA 5CA5A 4ZVQB 3SGGA 1SIWB 2PRHA 2E1AA 4F66A 1LLWA 1M65A 4US6A 2PSNA 1FTCA 2B4OA 1J6PA 2Q66A 4ILLA 4DL2A 2UU9F 3E0WA 1TB3A 1BPLB 2MKYA 3ONQA 3B0UX 1T3OA 5KOWA 2PEVA 3E2SA 3GC2A 4ZQOA 2B4UA 4NE9C 5KITA 2QV6A 3TW0A 5I6SA 3CUIA 4QNEA 1J5OB 3KK1A 2VGGA 3HD2A 3TFXA 2RGLA 3I0SB 3OA3A 1M41A 5LIKX 1FHVA 3Q67A 2WJFA 3PFMA 4GFIA 1LZOA 1VRQC 3QKEA 3OFFA 4XBSA 1N36J 4ZQMA 3VGHA 5AVHA 1IIHA 1GOWA 2W0UA 1TWDA 3SM0A 1XIMA 1N0VC 2MJNA 4B3MJ 4MJ2A 3CGIA 1Q45A 2HSEB 4ECTA 2Z30B 2GSHA 2ZBCA 2HFSA 3MPWA 4NZFA 2OOGA 3CGTA 1FWCC 3PC0A 3HGJA 1UR8A 2Z57B 4YHGA 3OO2A 3GX9A 2CAJA 1SO3A 3L7UA 5HR6A 4FLSA 1QI4A 1MW7A 1TTIA 2WPBA 3UD4P 3G87A 3DOPA 4P2XA 2UBPC 1PAUB 3CJ3A 1EZWA 2VFEA 4MAZA 4NXMJ 3D0GE 1UWAA 1WDPA 1UCNA 2HS0A 4WK9A 3RG6A 1DQ9A 1K6AA 3UNYA 3BO2A 4MJMA 2DCLA 1DLOA 2DNZA 2Q6BA 1VHIA 4M5LA 4ANCA 4IRKA 4X4UA 2IMWP 1S5TA 1KHWA 2Y6ZA 4H8UA 3TTSA 3ADAC 4UTWC 3TWZA 1P0DA 2ZE3A 1YJNS 3OUYB 5EA9A 2FHOB 1HGWA 4HKQA 1MEIA 1H5VA 1WAUA 2A3CA 4Y2WA 3MB9A 4AZBA 2B31A 3IS4A 3FCHA 4Q8NA 5DT5A 1SQGA 4RE2A 3GDTA 4DSEA 3OVBA 4LRSA 3TN4A 3TTQA 1A3HA 5RUBA 4A8SA 4C6LA 4LH8A 3ARPA 5I3IA 4WTOB 2CJBA 3DKDA 3TN3A 4FAMA 3LA4A 4M94A 3CUZA 3H22A 3FMWA 3C0LA 4LIRA 5HXMA 4S3CA 2H9AA 1C1BB 1VJQA 1VLIA 4UTWA 1A5MC 2XLIA 2G2OA 1FP9A 4F40A 3RB0A 3F73A 4EANA 1YYAA 1SL2A 1NU5A 3AS0A 2G9OA 3IIOA 1CT5A 1F05A 3VMNA 2F40A 2CQ2A 3CCUS 3PW5A 4Z42C 1D09B 5C7VA 4MK9A 5E1QA 3GE7A 1S10A 2IM2A 2QSFA 3DHWC 4GO5X 3T8LA 4NL1A 2BDQA 4PB4A 3TP2A 1OYDA 3EX7B 5I78A 1PO6A 3ETOA 1ZALA 3WUGA 4PMYA 1O66A 2IPWA 5K8MA 2JLFA 1IVZA 2YKNB 4PG6A 2MLYA 2V3EA 4Z37A 1N88A 4JV5J 5K2ZA 4RUAA 3DOKB 1W1TA 4AHQA 4UR9A 4GBDA 3QTGA 3DIPA 3LP1B 3LGEA 3E01A 1PDYA 5T7LB 5IXEA 5BZAA 2G4BA 3K4WA 1HI1A 4UQGA 3N01A 1IEQA 3C0QA 1T41A 1VCGA 3FSUA 5G2HA 2HRTA 2YKKA 4FBTA 5EMYA 3KHRA 1V5VA 4CD6A 1LXNA 9ATCB 1TX2A 3UWVA 3W02A 1SSDA 4QE5A 3MW7A 1Z9AA 1LK5A 1JZ6A 1X31C 4HACA 2JEQA 3W7MA 4EMDA 4KH0B 1KV5A 4IMCA 4OBSA 3TA9A 4WDWA 3UZJA 3UW1A 2B7OA 4IG0B 2YIHA 3AZTA 4PWUA 1LW2B 4DV0F 1WC5A 3EJMA 1DTTB 2IBOA 1F8MA 3RM8A 2YWEA 3EKZA 4OL8A 2VT0A 1A49A 2IQTA 2B43A 1RQHA 4CEXC 4UFKA 4ZO6A 5B0AA 3ZM8A 4WP9A 4EWJA 3W63A 1YQHA 1FKPB 3S8HA 2WVBA 3WC0A 2BVZA 2HNZA 1B7YB 2QLBB 4YWIA 3CDEA 4JI7J 1YDOA 1LT7A 2OPSA 2BJ7A 1Q4NX 3VKKA 3C15B 5I3PA 4JHOA 1SC6A 1DTUA 1US3A 4WZMA 2BXYA 5A8RB 3ANVA 3KTCA 1NF0A 3M41A 2WBGA 2MNRA 1I1WA 2FY1A 1V3JA 1RHRB 2YPIA 4LVAA 3FRYA 4OQJA 2YKMA 4QGCA 1H7OA 3B40A 1UOZA 1QI2A 2FDNA 4LV4A 3WH8A 2KFZA 3BGUA 2INFA 2R94A 3WBWA 3POHA 2XM1A 3ABRA 2M5YA 1DWJM 2GGIA 4JKMA 1AT1B 1SV5B 4CM0A 4NXSA 1VHNA 4ECLA 4P2FA 1G7CB 2DR9A 2PTWA 1GOOA 4ECSA 1MLAA 2VYOA 5AHIA 1J5TA 5HP1B 1ZYQA 2KG1A 1TWSA 3NL3A 1K9MT 3MMCA 2V30A 4J5OA 4YDDB 3KYLA 4W90B 5EUHA 2XH0A 2B5JA 1YVFA 4GISA 4I2QB 3NVTA 3L4BC 3CWOX 3LRLA 4FNRA 4B02A 4UOFA 2ADCA 2AF6A 3HSZA 4NG3A 2DRDA 3H5YA 4USWA 1MWZA 1X5TA 2CJ9A 1NDYA 2W7AA 4V15A 3CMFA 3W1TA 2XSFA 3GTNA 1YQ2A 1R46A 1NU4A 4R5PA 4MKAA 4QR2A 1WUFA 4IH6A 2K1RB 5CEWA 3DUGA 4ZQPA 1K1SA 1L0PA 4JTKA 3LD5A 3O8AA 2ZJPQ 1A4LA 3QR0A 3N4EA 3T4WA 3MM9B 4UB9A 4V1XA 3STFA 2RAQA 3PBWA 4L76A 2XGIA 4M56A 2YWWA 1US0A 2UUBJ 4K4XA 1CGYA 1FWKA 1K44A 5BNKA 2J7KA 3W1AA 4CNSA 4P5UA 1WI6A 1U5HA 1NFPA 1V7YA 4X4RA 1YNPA 3WIVA 1VBJA 1FCUA 4B3MF 3NQAA 1XSIA 1J5OA 2NQPA 4RNOA 3BSOA 3I0SA 3BV8A 1W2BR 4WU2A 1E6RA 4NRRA 4CVWA 3AQPA 1FT8A 4FOKA 4DFPA 3VTIA 2EFOA 2X51A 1C91A 3THVA 4BDPA 3P8JA 3TQ1A 1SJAA 3G2XA 1F07A 1YG0A 3O15A 4K2XA 3LB0A 3GVVA 1Q8AA 1F5BA 3UXKA 4C5YA 4LFYA 1A3WA 1O60A 4RPPA 3EPNA 1RWPB 1JXJA 4W98A 4U8VA 1U1KA 1RTHB 3O7UA 3P5BP 2R1PA 4PULA 4PMOA 1SKSA 2VBYA 2E7WA 5AHEA 4AL7A 4N77A 4ZTYA 3DMJB 3QGAC 1P8GA 2D3O1 3TNOA 2PDFA 4MK7A 4O54A 3ABXA 3CB8A 1JWWA 3CPRA 4C48A 2JEIA 3AAMA 3W2KA 2HQAA 5D33A 1J0HA 3SIPB 4CNYA 3EX3A 1VHFA 2VENA 1EX5A 1OZMA 4DV7J 2J7GA 4V1Ak 1JR1A 3CCVS 1JB0C 3PEJA 2J6SA 2VX7A 3SCQA 1XPGA 5D4YA 3SR7A 3NSXA 1S48A 3GJRB 2DSUA 2X09A 2Y85A 5LA0A 3GK0A 3OUYA 5HMSA 2VQEF 1R8PA 2P8CA 2CDRB 2Y0BB 3BKTA 3MEKA 3G0SA 1SL1A 3NS5A 3E2QA 3LMYA 3RR7A 3WMBA 5A6JA 3AHTA 4IFOA 2UV8G 1LFWA 4H7ZA 2DHGA 4CO4A 1CPZA 1ZJIA 2OMAA 4KH2A 2JNJA 2GJIA 2QCDB 3VC5A 3D3FA 3NXZA 4O11A 4GYKA 4EXQA 4WZQA 4JNZA 1X6NA 2RKXA 4O52A 3RLGA 4OIFA 3H55A 2PD1A 1C1BA 4AXIA 3V2UC 3TVYA 3VX0A 1S6QB 1ZETA 2R42A 2VHLA 3TSBA 4DF2A 3H6OA 2R6OA 2O9PA 1LWFB 1IBKF 1PSCA 1X1OA 3LCFA 5BYRA 1X7FA 1UJ6A 2LECA 1K8CA 1OY8A 5ECVA 4NZ5A 2YX7A 1KTCA 3W7DA 1SFSA 4QJ1A 3RBZA 4LUYA 3V35A 4BWLC 1O7AA 2P2CB 3ARYA 5BYWA 3N34A 3CMQA 1S0OA 4QLKA 1RSCA 2ZBIA 1GJPA 4GIYA 4O4GB 2HW3A 4Q44A 3B54A 2MQMA 2ZZMA 3DRXA 5H9EK 3BQ0A 2WSRA 3MC5A 5KT5A 1MSWD 1UFKA 2YKNA 5KTLA 5TD4A 2E67A 2DVXA 1BKHA 1TRIA 2D69A 4RNJA 3SDOA 3ZXWA 4CUCA 2G13A 3KMQA 2KZZA 4XV0A 4LF7J 4OIXA 3LHUA 4KRZA 5F8IA 4KEMA 3W6MA 3LP1A 3OJUA 4ICCX 1VR6A 2E7VA 5T7LA 2R24A 1HXJA 1LK7A 1TMMA 2VG5B 2LU2A 3ERPA 4JFSA 4WFNQ 3UVIA 1Q86T 4ED7A 4OZOA 2OGYA 1YI2S 2XLJA 1PO9A 4ZCKA 1AW5A 4FNIA 5KFFA 5J2PB 4L5ZA 1TPVA 2QMWA 1TFYA 1YKWA 3A3HA 1BF6A 2BY0A 1PJ5A 4LUTB 1LWEB 3U4FA 3QIDA 3SY8A 4XAFA 2FLIA 1ZCOA 4IG0A 1X9WA 4W7UA 3AXMA 1JJCB 1LW2A 4TLQA 1ISWA 1W9UA 1KFWA 1RAGB 1KLZA 4K4UA 1W37A 2UXBJ 3BSNA 3ZVIA 4HA1A 4HPGA 2ISDA 4LX4A 1CX9A 2X0HA 4MFBB 3QHMA 4XZ9A 1TKDA 1OGBA 1XINA 3H23A 3M6VA 1UAWA 1KHVA 1L8PA 3A3WA 2DZSA 3GQYA 1HHTP 2HNYB 1VJIA 3EMQA 1H2TZ 5G4EA 3TTYA 3SEPA 4RV8A 1FKPA 1ZB5A 3P0WA 1XWLA 1OGSA 3DC0A 3OSPA 2TRSA 3WNLA 5KZMA 3MQTA 3GR4A 2HVOA 4JI1J 4JB8B 3WKZA 4HNLA 1W1PA 4AVFA 3C15A 5A2QY 3N5BA 2CETA 4EWTA 3P82A 4JYAJ 1GUVA 2HXTA 4WYLA 3BW2A 4ELTA 4CCZA 1FWGC 1RTDA 1DTNA 3KFWX 4WF7A 1SH2A 1OM0A 1TKXB 1MZHA 2QJMA 4NKCA 2ABAA 2PBGA 4WF9Q 4Q22A 2F7FA 4MNLA 2A7RA 2RQMA 2XVPA 5F2IA 3N6LA 4IG2B 2HXUA 3ZWTA 1DRZA 3EWUA 3CJKB 4V33A 1QAIA 1BF2A 2RGMA 3CL6A 3R89A 1EXPA 4U67Q 1H63A 1MW2A 1W9BM 2GMLA 1DQAA 1FNXH 3ZZOA 3JS3A 3NQ6A 4GC3A 4Y2KA 4QAWA 1SV5A 1CULB 1H60A 4NRUA 2HZGA 5HVFA 2PCEA 1WNEA 1E1CB 3CHDA 5EWFA 3OBAA 3KRBA 4AHPA 1AJZA 1QWGA 4LYRA 5HP1A 3ZC4A 3KW3A 2P3ZA 1OYCA 4UQDA 3OV7A 2C2RA 2FZKB 2RUSA 4UMBA 3WJYA 1ISZA 4GY1A 1WEZA 1BYAA 4YEAA 2P5VA 4JCLA 2F9RA 4I2QA 2E1DA 4IOCQ 2PLMA 3OFEA 3QV9A 1QNVA 4JIHA 3VGEA 3AOBA 4Y8EA 3NSMA 3LW5C 4O4VA 2C0AA 5HUPA 1VYAA 2CXEA 2C2MB 1KBKA 5E9AA 3ZOAA 2D7SA 2IM3A 1FXPA 4NRSA 1U1NA 1IXQA 1IZJA 2AL1A 3W7JA 2XC9A 4PH6A 2BASA 1RWWB 1HG3A 1S0VA 2ZVIA 1CI1A 4R8UB 2LQBA 2K1RA 3R97A 3A6OA 1UVLA 1TPUA 1V6YA 3IV3A 3PTKA 3S0CA 1A4MA 1SC4B 1R8AA 1OO0B 4C9DA 2ZUSA 3MM9A 1GGOA 2PLKA 1UD3A 5JH1A 3V0TA 4UF4A 4OV9A 3MCMA 4U3CA 3M7SA 4MWAE 4C1KA 2YNFB 3MPUB 3S5NA 1WJ9A 1PJ7A 2N3OA 3ILOA 2A3AA 4DR5F 1X8DA 2ZDPA 2UVWA 2VD9A 2A2DA 5GQBA 3QH2A 3EUNA 3QWUA 4KEVA 3FA3A 3C16B 5CYMB 3DFSA 1T95A 5FJOA 2QL5B 2DNKA 2E6YA 2QUUA 2XWEA 2YBTA 3CC1A 4WFZA 4Q8WA 5FSEC 2B9WA 3DKJA 4XBKA 2RF2B 1QAXA 4O1DA 4AD5A 1LWXA 4JY8A 3KCOA 1FOBA 4RE0A 3CIWA 4D6IA 3DLHA 3SJ3A 4GNKB 3CDBA 4WFBQ 5CPTA 1UW4A 3GCXP 2MKKA 1NJYA 1RP9A 2ZA2A 3DYMA 4CT8A 4Z0JA 3G6XA 3TE9A 1S1PA 1PV8A 1D2KA 3C52A 1EOMA 5JH2A 1RTHA 1XWYA 3FAWA 3KOWA 4NLVA 3IGNA 1VEMA 4AQYJ 3JQMA 4HGXA 1GXUA 1ZL1A 3T7VA 1UD2A 2ZX5A 4P7OA 3GYCA 2BV3A 3EOOA 4O17A 3DMJA 1Y00A