1GEHA

Crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
432
structure length
427
Chain Sequence
YVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMKDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Novel-Type Archaeal Rubisco with Pentagonal Symmetry
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
molecule keywords RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE
total genus 125
structure length 427
sequence length 432
chains with identical sequence B, C, D, E
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2000-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 1gehA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 1gehA01
1RLCL 2YBVA 2OEMA 1UW9A 3AXKA 5HK4A 2CWXA 1SVDA 3RG6A 3KDOA 3RUBL 4F0KA 1BWVA 1WDDA 5HANA 4RUBA 1AUSL 1RSCA 1UPMB 4F0MA 9RUBA 5RUBA 2VDIA 1YKWA 1RLDA 3FK4A 2CXEA 1RUSA 2QYGA 5HQLA 1RXOB 1GEHA 4LF2A 1EJ7L 4NASA 1UZDA 2OEKA 2V68A 3WQPA 3A13A 2OEJA 1AA1B 1IWAA 4HHHA 2VDHA 5HQMA 1RCOB 2V69A 1BXNA 8RUCA 1IR1A 3NWRA 1UPPA 2V6AA 5C2GA 3AXMA 2OELA 1UWAA 2V63A 3ZXWA 5C2CA 2ZVIA 1UZHA 1IR2A 5HJYA 2V67A 1RBLA 1RCXB 3A12A 1GK8A 2RUSA 3KDNA 4MKVA 5HJXA 1TELA 3QFWA 4LF1A 5HAOA 5HATA 1RBAA 2D69A 1RBOB 4F0HA
chains in the Genus database with same CATH superfamily
4N76A 2QTWA 1YPFA 4K8GA 4EMDA 3TH6A 3VA8A 5DDPC 3CJ3A 2ADCA 2XMMA 2IPFA 3ITGA 1JCLA 4QIUA 3ILJA 3K8WA 3NDZA 2E9BA 2XIQA 4ZXLA 2XNQA 3RU6A 5AE2A 4UOCA 1Q6RA 2QZ8A 3V16A 1I60A 4CTAB 1J0ZA 1TTQA 1M41A 1XKJA 2MGZB 4LNYA 3S6OA 2DR9A 3PM6A 2UVUA 4HVXA 4D71A 3CAVA 1U6ZA 1QSYA 3QT8A 4V33A 4Y3CA 4EO8A 3BAJA 1NU5A 3DOKA 3W66A 1EARA 1XISA 2DIVA 3HZEA 3NXFA 3CQ0A 1UA7A 4AD6A 2XMJA 4W8LA 2QL7B 5HMWA 2R7XA 2J6VA 8XIMA 1Z1ZA 1ZM3A 2R8GA 3QLLA 1XR2A 1VLWA 3MBFA 2RHGA 2HVDA 4PMYA 1O66A 2R8IA 3L0GA 4YB1P 1CTNA 1GQIA 4MAZA 3TONA 1YPXA 2WK2A 2J8FA 4DMZA 4UUXA 4F0HA 3TI0A 1BPLB 2O5DA 3DLJA 4A8XA 5A6MA 3H20A 1KHWA 1JPDX 5B7ZA 5HI7A 4NASA 1B3XA 5KFRA 4YDDB 1A49A 1QR7A 1WKLA 2OQLA 3NQ8A 1D3WA 3V4IB 1T03A 2J6UA 5GJPA 1Y5XA 3QN3A 4CNPA 3STFA 1AH4A 1S39A 1V3RA 1ME9A 1VYPX 1F3VA 1JLFA 3HQOA 2IKJA 4LEQA 3ZT6A 2O4MA 1K9EA 3B9DA 1E9YB 3H2LA 3N01A 4RLIA 1ACMB 1KGWA 1F8MA 2UY4A 1TL5A 3OUYB 1EJSC 4KR0B 4JTUA 1FCUA 4HKPA 5DCBA 1MMDA 1WC0A 2R8JA 1VB9A 3BXWA 3SRFA 3X1LB 5TBOA 2F7FA 1LWEB 2M88A 4Y6GA 2VC5A 3GNRA 5E3PA 3UNTA 4E6MA 3WQGA 1H2UX 1RCQA 5F2GA 1X5OA 1UL3A 1YJ9S 4AD3A 3MMAA 1F74A 4DRSA 1SFSA 3HHLC 2XI2A 1EGZA 3RX4A 3U7JA 1K8XA 1A4MA 1XL9A 3E6EA 2J7HA 2WMHA 3GCWP 4Y2IA 1VQLS 4AVOA 1JLBB 3NVTA 1PJ6A 3SCUA 3T09A 3IVUA 3EBVA 4LVGA 3GV5B 3EZ4A 1RA6A 4ANDA 3COTA 3CD0A 2X2GA 4X0VA 2MLYA 3U1LA 4L65A 4DELA 4LFCF 2DT1A 1O12A 2VEIA 2X1TA 2TPSA 2V9WA 1H98A 3HGJA 2VV5A 3WQ8A 2PUZA 3JAMU 4IOCQ 1FWJC 3L4ZA 2OZTA 4Q7NA 5CSUA 4A8SA 2YKKA 4HYVA 2FIQA 4RDYA 4A22A 2OMOA 1SSDA 5U47A 3PFMA 2DR7A 1RLCL 1HFBA 2ZWYA 1MQQA 1AJ2A 2QCHA 2JE8A 3U8GA 4MJ2A 3UGRA 3A4JA 3DOMB 2XFRA 2VXNA 4KO0B 3Q37A 4NZ6A 2XH2A 4XD5A 4RW4A 4IIFA 1XBWA 4IX0A 4WY0A 1WNOA 1KVKA 2NYIA 4USWA 3UVJB 2XN2A 4FS9A 3LCWA 3TC3A 2POZA 2QUTA 5IBXA 1WZLA 2VQTA 1HWKA 3EYZA 1VFFA 1LUCA 4ZIVA 1MRQA 3N6LA 2FMNA 1MUMA 3UW1A 1LKZA 1WORA 2MY7A 1H7PA 1WB0A 4IRKA 4DL5A 2NVDA 2PD5A 5I06A 1VS3A 3AUOA 3C66A 2CJKA 4GZ7A 1H7NA 2ZE0A 1GQJA 4A6GA 3T5KA 3IJ9A 1YJNS 3PFOA 5AHNA 1VBRA 3BV7A 4AMAA 3PK7A 2PN6A 1A5SA 6XIMA 5AFDA 1P1XA 2XN1A 5D9PA 3SCTA 4UT4A 3KM8A 1WC1A 4PXBA 3R5CA 3RNDA 1P7TB 1YK9A 1DJ0A 2POKA 5TIMA 1M7XA 5LNWA 2EKNA 4ZOEA 3ZR5A 5ETTA 2YH1A 2RDIA 1YTKA 1DTQA 1FXPA 3LPPA 4LFBF 1UVLA 3WUGA 1FFRA 1O1HA 3OVQA 1O5KA 4RUHA 1H41A 3HM9A 1J5EF 5F8NA 3W02A 1SQ7A 4TVCA 3NPXA 1JDCA 3C0QA 1PDYA 4O4VA 5CPQA 4KGVB 3BN4A 2PS2A 3P61A 3TJIA 5GAEI 3WBWA 3A4WA 2C2EA 1Q5MA 5HINA 3PZQA 2I5JA 3GU0A 5KT5A 3E02A 5DFAA 2XSJB 2WJZA 2XSJA 3AS3A 4IQLA 3W86A 5IS2A 4JI7F 2VQFJ 4AUBA 1ZJAA 3GQYA 3VZIA 4LF8F 3HMJG 4CCEA 2YNHB 4TVDA 1FNXH 3VKCA 3MCSA 3O8WA 4HNCA 2HMCA 4NZCA 1AQHA 1S6PB 2HNDA 4H4OB 3H5SA 3CC7S 3H25A 2BY1A 2QDHA 1W1ZA 3ARXA 4W4QA 2NV1A 1X4GA 1ZLPA 1S1TB 4HOXA 5FF0A 1Z2ZA 4CNOA 1JPIA 4YTRA 2WHMA 4HN8A 1AL7A 2FQIA 3EPGA 2OKTA 3TEVA 4ZHRA 1UKPA 4MAKA 1H2VZ 4GO8A 4PYDA 3NZQA 2PDJA 1NFGA 2HEKA 2EKGA 4GYPA 2HISA 3TCSA 1OGGA 5ETVA 2HURA 1SYTA 3WQPA 4Q44A 4XKMA 3ARWA 2MZRA 3NZPA 1CPUA 4NA3A 4ENLA 3FKBA 3P67A 1PAEX 4H7ZA 3W1RA 2VG5B 4OWGA 5IDIA 1DHMA 4QNEA 1U1RA 3SSQA 1YNYA 3GTFA 4YR0A 3H8AA 2XVGA 4KIRA 2BQ3A 4Z0JA 4CQCA 3CZ8A 4IG3B 1WOOA 4EK2A 2QG9B 4GK8A 1XYFA 3IBFB 1S2WA 2FPHX 2YA0A 5BRBA 1J96A 1TPC1 4B08A 4UUIA 2OB3A 3UG8A 3H2NA 3QJJA 5K9DA 4O16A 4CVWA 3DLBA 1CLVA 1JZ6A 4CCCA 4INFA 4OHQA 2ATSA 3L4BC 2VM8A 3DEQA 3LUTA 2B7OA 2HPIA 5IFMA 1JJCB 3T07A 3GIPA 3O7UA 1B99A 4AZHA 1OQ6A 1L0PA 4K8RA 2WW8A 1SMAA 1XYZA 3CZKA 4F79A 1MNZA 3M6DA 4O54A 3WCZA 4OZJA 1K1DA 3SURA 2UXDF 3NMAA 2AJQA 1NAQA 2X3DA 2C42A 3FY1A 4FPSA 3MHYA 3FC9A 5REQA 5C2CA 3BKUA 3Q8PB 3C61A 5CBJA 4JI6J 3ZJKA 3TJ4A 2GW8A 3DRPB 5D78A 2C2DA 1EXBA 2CZDA 3P5ZA 4UQCA 3UR7A 2I9SA 2Y5EA 4H9XA 3W38A 2ASDA 2XIBA 1XRTA 3CZJA 4NSBA 9RUBA 3I56S 2ZM6F 2Y1RI 2DNZA 1RXOB 3I7QA 1F73A 2KB2A 4GWEA 1HNVB 3TW9A 1R5YA 4ERDA 2RDDA 2C3OA 3FFIB 4AZ6A 1WTFA 4ZSUA 3P14A 3PZVA 4YHGA 1SO4A 4RCXA 3G6ES 4QBXA 2BY0A 1NZ8A 4DJEA 2HGMA 3UJSA 1NXIA 3R5GA 1H2TZ 2FGOA 3NQEA 4TX9A 1OK6A 3I4HX 3QSYB 1MNSA 2WSCC 2QYGA 2XWEA 6AT1B 3E2EA 1HWLA 1U33A 3M6VA 3I4EA 4HP5A 2AOSA 1XR5A 2ZA3A 3W1TA 3WN6A 3T4WA 5KZ6A 2OSQA 1DWIM 2C0HA 1JNZB 3N6MA 2XZTB 2V5LA 3IC1A 1FHUA 1TIWA 1IJEB 2H5JB 4C8LA 4X4SA 2Y7DA 3DU6A 2EG1A 4IPPA 4JTJA 1R27B 2HLTA 3QZ7A 2NXIA 1OT1A 2MXYA 3L4XA 1WEXA 2I14A 4AD1A 1IVZA 3SADA 4LFCJ 4IP5A 2W7PA 2DCUB 2DT2A 2YCEA 2HROA 1XQLA 4PG5A 5D02A 3GKFA 1THFD 2H4YB 3FXGA 1VJZA 3HG5A 2OZ8A 1JZ7A 2CNKB 2QL9B 1RKIA 3OYXA 1K1SA 4KRWA 5GJNA 3VGGA 2WCGA 3EDEA 4N2YA 2DHGA 3ENWA 1NF0A 5JXSA 4IMDA 3AOCA 4FYYB 9ATCB 4JL1A 1BQXA 3MPWA 1YLXA 4XSLA 3UD4P 5CSRA 1S0MA 1H5VA 1S4FA 1JXJA 1IGSA 1W5MA 1BQMA 3TAPA 1MG7A 5EMLA 2YDQA 3M43A 3W07A 1EX5A 4KESA 5F2MA 1NJXA 3FJ6A 1JNRB 2WNZA 4WWSA 3NBPB 2VPZB 3NNTA 3BGRA 4CWBA 4A8NA 2KKHA 4UZCA 3KWMA 4S3CA 2BJEA 5C5YA 3C86A 1DKWA 2VFVA 4B9SA 4CM2A 1S5ZA 2HHSA 1IKVB 1PEZA 2DO0A 3BYRA 4ACYA 5FF3A 2YB4A 4IDKA 4WGXA 2Q3OA 2XMTA 2FJKA 1Y7VA 3G3DA 4N47A 1R30A 3LZ3A 3AICA 2Z1BA 2CPUA 2GYIA 3HPZA 5DEZA 1IGWA 1KTNA 1TWWA 4CLMA 3L12A 2ICSA 2NQ5A 3T9ZA 4PMXA 2CZ5A 1FDYA 2WMKA 1QNOA 4EXBA 3UN5A 1AZ1A 1P0EA 2C28A 3M8YA 4D6GA 4EF8A 1J10A 2IBOA 3VMNA 3NCRA 4C8MA 5A8PA 1RHRB 1NFBA 1Q7MA 4OX7A 3Q8YA 1CBGA 5HO4A 4RW3A 1JDAA 2V3FA 3W7KA 2HYIB 3LOTA 4NZFA 1A5KC 3LLDA 3LTPA 1OFBA 1VRXA 2VJXA 5HUOA 3W5XA 2ZHOA 3G2XA 3KK2B 3SZ8A 3V5RA 1VYAA 3TN4A 3VIFA 2G3JA 2XMAA 4FYDA 1UWIA 1LOUA 4FLRA 3AMKA 1WDWA 4Z2LA 4DF4A 4ELUA 3OLIA 5LMUJ 4QP0A 4ECQA 3AC0A 1ITCA 1TE6A 3ARUA 3LB0A 3DUGA 1HBOB 1AUSL 3H4DA 4PTMA 4W87A 4G1PA 3G9CA 2AYEA 2PCEA 1R87A 2XWXA 3PW4A 1RTDA 1FCQA 1U1NA 1YJVA 4H9TA 1IR1A 2NYHA 2QT3A 2PA3A 3WSUA 5GVQA 1RWXB 1UZ1A 3G3MA 3OQ8A 1VQPS 3WLRA 3S5ZA 3CT9A 4M5KA 2AKWB 2JHEA 2FVRA 4F3OA 4FS1A 2J9ZA 1GVSA 2PAJA 3B04A 4ZDNA 1U1LA 1XNQJ 4Q7IA 4O0KA 2FVQA 4ZO7A 3HLUA 3IJ6A 5H9EK 2PI6A 3KLEB 1UASA 3HK2A 4OIXA 4J4KA 1RZMA 2ABBA 3WNOA 1J6PA 1UCNA 3Q2SC 2PURA 4NP7A 1K9FA 4FOJA 2EPMX 3W9ZA 1WHVA 4WYWA 1OT2A 1VEPA 3QSTA 3BSHA 2HHVA 3CCZA 1DXFA 2H5IB 4ID8A 4LFBJ 4RNMA 3V2UC 3QC3A 3MEGA 3MS8A 4K36A 4MIMA 3GJSB 1I94F 1QFEA 1OJ4A 1POJA 3ONBA 2FDMA 2G9OA 1HJUA 3CIMA 4GUHA 1J01A 1U1OA 5CCMA 3EDDA 1UPMB 2V5KA 1ADDA 2CLOA 2ZH8A 1P6TA 2I57A 4CD4A 4ED8A 5CSYA 2M4MA 3K4AA 5HPCA 3VKDA 4AD2A 3W61A 1RWVB 5BYQA 1F2GA 3V6DA 3KFWX 5G5IA 4MJMA 2RAGA 2CZVC 4YY3F 4IO9Q 3HSGA 2AQOA 4RE2A 3AQPA 3H4GA 3BICA 4DO6A 3WBYA 4FIRA 1K70A 2WNWA 5A0YB 2ZBQA 1DPMA 3TUUA 3KTSA 4JHMA 2D22A 3HFTA 5K5MA 5CC7A 1JF6A 2VICA 4ADSA 3THQA 3MEDB 4CI0B 2R9LA 2VL1A 2FGZA 4GH3A 4R5EA 3E12A 2Y2WA 3CD6S 4K7QA 5K8MA 4G1QA 1GX6A 4URSA 2DU2A 1OX5A 2B8QA 3GXPA 2H9AA 4BWLA 1FKXA 4NQ1A 2BE2B 2MSSA 3M8RA 2DJXA 2HE8A 4PL2A 4JV5F 2OSXA 1BD0A 4JX6A 1E6YA 3C6TA 3KLFA 4DWIA 1YXDA 3VGHA 2NSXA 2ZCGA 5EX3A 1WUEA 4LBSA 2QCFA 5D32A 2E44A 2VBYA 4ONVA 1OGSA 4K4SA 4IUGA 1SIWB 1YDLA 4ZN3A 2Z2AA 3CM4A 5BXPA 2JLGA 2QMKA 3AHZA 4TTGA 2GK1A 3BK0A 1F3XA 3CUJA 1X8CA 2YB1A 4C7FA 2QUNA 4XZNX 3GIMA 3U2ZA 1UJQA 3M2UB 4A35A 2XS2A 3KBJA 1SBRA 3BV4A 1JYXA 3LZ5A 4OE7A 1NPKA 3ZS4A 3ILIA 3JZEA 4ACZB 4J9UE 2UXBF 4L7ZA 3HZ3A 3MJMA 3UNDA 3OLEA 1BXCA 4DPUA 5T91A 4OV4A 3DGVA 1NK9A 2H6RA 1TO3A 3D0CA 3ANYA 2VL4A 4GABA 2Y9HA 1NKEA 4WHBA 1SQGA 2QLBB 2WMIB 1XLCA 2VA3A 2QGHA 5JXQA 1WBJA 2AL1A 1MW2A 3GC2A 4PMOA 2EVZA 3DRPA 4KETA 4NPOA 2ZE2B 1AMKA 4PMJA 2Y0BB 2RDXA 3KMQA 3ITOA 3QMSA 3A13A 2ZUTA 1SW3A 2ZVSA 3OO2A 4N42A 3MEEB 4LJMA 3NGTA 4GKKF 1CXIA 4ZPTR 2ZUWA 1OWQA 3EM1A 1N8FA 4EPDC 1DTTB 2C6QA 3R7BB 2RQCA 3BM7A 4EI2A 2VONA 3EWCA 4R7OA 2EPOA 3RX3A 4ENOA 3EEGA 5I0DA 4HT5A 5K9FA 5J1EB 4QWEA 2GZOA 3ADAC 3W82A 5L9XA 1Q79A 3VDBA 2HS4A 1EC8A 1W1YA 4FVCA 1EBGA 5H1SV 3LTOA 4C90A 5U7SA 1HPZA 2E1MC 4RLEA 4UTFA 3DKDA 5GNZA 1XJBA 2FZCB 2FJVA 1RDRA 1EP2A 2OO6A 4MY8A 3QIPA 5J2QA 4PZVA 3D3CJ 3GIYA 3DHPA 5LM7E 4DL2A 1TPDA 3OD2A 4LBPA 4IGSA 1F6YA 3RLGA 1HD1A 1A6LA 2QULA 4O50A 4WJXA 4BY3A 1G7CB 4DR6F 4ILSA 5A6PA 2AYGA 1LG1A 1ITUA 3ZMRA 1RT5A 1HR0J 1VHIA 1V03A 5DBTA 4FF1A 3LD5A 1SXLA 5KFYA 2ZM6J 2XYHB 2ROPA 1MW3A 3CVKA 4NLRA 3TZWA 7FD1A 1G9HA 2QJNA 3BOLA 5XIAA 4IMGA 5F4XA 5C42B 4M6VA 3JW7A 5I3GA 1Y0EA 2WV8A 1IF2A 1RALA 3CTRA 3O0FA 1LOQA 4QXIA 2OCZA 3SQGA 4URGA 2NUXA 1QTWA 3B6BA 4IRDA 3PX0A 3UZXA 2J0XA 2HMIA 3R7MA 2HMIB 1HO1A 3G82A 1U8SA 4D1JA 3DLHA 4LY4A 3G82B 2NUYA 1C1BB 3AHPA 3AH6A 4FKXA 2X7VA 1WD6A 4AF0B 4WPAA 3BR9A 5C55A 1SZEA 3HHNB 4NA1A 3U5YA 3BW3A 2JLEA 2XS5A 1RVGA 1WHWA 1KR0A 3GSMA 1VQKS 2GVEA 3MM7A 4RE3A 2R7WA 4BC9A 3HG2A 3UEQA 2DZVA 4YR3A 1S0NA 2RQMA 3VX0A 1XNQF 1XLBA 5A69A 4M5HA 2QCNA 2V4JB 1RWKB 2IMRA 4Y8FA 4XISA 4FF2A 1R89A 1Q66A 3R79A 1PVNA 2QIWA 4LH8A 3UD3P 2F8EX 3CH0A 2X1FA 4DPOA 2KRBA 2XVNA 3QIPB 1JGIA 3TSDA 2Q3PA 3SIMA 4QLKA 3NXLA 4IKAA 2IBKA 1FEEA 5FAGA 3MO4A 2ZXQA 1W9PA 2PSZA 4O14A 1EAYC 3EPOA 1J18A 3O05A 4EP8C 3PW5A 4UC5A 2CJ9A 5HP1A 3HOJA 1BWKA 4WGHA 1XICA 1KQFB 3PWGA 2K7KA 3QQ0A 4MNLA 1L2QA 5ABEA 2RQ4A 3SY8A 1CGXA 1AQMA 2O56A 3LQLA 4DZHA 1JLFB 2EXUA 3V0SA 3L7PA 4BDPA 4XVEA 2OWXA 4CD5A 4GVGA 3I5BA 3QRPA 4LOCA 1QPNA 3ZWTA 1RTHB 1YPIA 1EF3A 1T8QA 3RGIA 3W85A 1OD8A 3KBWA 3E3HA 4LF2A 1FVQA 3H4BA 4I90A 4JYAF 1RT3B 1PKNA 4DR7F 2AX1A 4O3OA 3WHIA 1HBOA 4W7VA 1S1XA 3MSDA 3VAIA 3HJVA 3QJPA 1QE1B 3OFHA 2A79A 2MJNA 4CYUA 1EHWA 3VZYA 2O66A 4WYLA 2NSCA 1GOIA 1JMTA 3IGSA 1I4NA 4O3QA 4J9PA 3MUTP 3DC2A 2AJFE 4HACB 5CZJA 1W25A 1RAAB 3ONCA 3TJLA 2CXEA 1J12A 1YX1A 2HBRB 1W1TA 5FF7A 5DS7A 4Y9AA 1U25A 1G6CA 1H60A 2DV0A 4ZVPB 1ZS6A 3TVKA 4ZMGA 3MR3A 1SJ4P 3MMBB 1AZ2A 2DZWA 4OI4A 2WVUA 4IJRA 3FEQA 2Z7KA 1WKEA 1SH3A 2QFIA 1X5SA 2VR2A 2RDJA 5CYMA 4K4TA 4FS2A 4OBTA 3VINA 2ZICA 1IKXB 1BC6A 1XD0A 3BLLA 3WDQA 1HMVA 5EMKA 5K8OA 2HBQB 2JFKA 4MVAA 4CM0A 2RT3A 3UZZA 4EX4A 1YJRA 2PGCA 1X60A 5DM7Q 2VWSA 2WKLA 3SYZA 4F0SA 4PUKA 4OUIA 1R8BA 3N2TA 2OQYA 5DLGA 1K8AT 4DUTA 1I2RA 4ALZA 2GJNA 3HURA 1JULA 4B3LA 1NK7A 2DSVA 4F26A 4B16A 3V6HA 2E5GA 3LBMA 4PQUA 5JMUA 1X9MA 5KG5A 3P8JA 2GQ9A 3K1DA 5T14A 1Z3NA 2DPIA 4C65A 1E15A 1R7OA 3IUDA 1T7LA 2VZVA 3G1HA 4GZEA 1UH4A 3U48A 4AIUA 1PG5B 2LA4A 2CJQA 3OVPA 3CIWA 1XYBA 3N3TA 1BF6A 3NRBA 3IN5A 1LWCA 4JNMA 4DJDA 3TTOA 2V2VA 2V4RA 4XIAA 1S72S 2W8LA 4IR9A 5JQ9A 3C2RA 5C9WA 5AYZA 1IWPA 3B4YA 1X98A 4DF8A 4DUYF 1BFNA 4J3TA 5F9NA 3LY0A 2TYSA 1SB6A 7TIMA 5DG7A 1VHCA 1J2VA 1FA0A 4CRJA 4QWCA 4K68A 3PW0A 1FWCC 1BVNP 1T7PA 1BRLA 4PRRA 4NLUA 1EKRA 5KINA 2MLZA 3NQ2A 1LWIA 2TSYA 3FX4A 2VU5A 2PTDA 3EPMA 2Q1LA 2D69A 4GVIA 3LALA 4Q4KA 3LW5C 1HMVB 2HPUA 2OODA 5E9AA 4M81A 4NJIA 5GNXA 2DZUA 4CU6A 1FDNA 5LXRA 1TMQA 3B06A 4PUEA 2FDNA 2EPNA 4WU2A 1ZJHA 2NSBA 1AK5A 3QPIA 2NZ4A 2EFQA 2IPOB 3SECA 3TDFA 7FDRA 1E0XA 5A3HA 2E1CA 1RD6A 3FKRA 3EJMA 2CQDA 4ED4A 3I10A 2C1IA 2AMCB 2NWSA 1JLAB 3C2FA 4ZIWA 4XZLX 4JI6F 4WX2A 4M1RA 2SXLA 4QNWA 5DQGA 3AFGA 3FEZA 1W2IA 1E4MM 3K8KA 2WZ1A 2YA2A 5DY2A 3UY7A 1PX8A 4ZPBA 2I0XA 1VDHA 2WM1A 2X0SA 3OLDA 2WPGA 3UCQA 4DZ5A 1FDBA 1NP0A 3B8WA 1E6SM 3G8TA 3DIPA 4C91A 2PT0A 2R7TA 2MTLA 3NMRA 3GIRA 2XGBA 1FRJA 3NUKA 2ZRYA 4DO7A 3UCCA 3WENA 5ECVA 1AFIA 3U2OA 4ID5B 1EZZB 3BR8A 2PC8A 3M2RA 2YDRA 3W2LA 1TJPA 5A8MA 2FVLA 3Q23A 3M64A 4ORIA 3TUZC 1S10A 4URQU 4CNNA 2IQDA 3PJ9A 3CO8A 3SUSA 4MWAA 4BWMA 3ITCA 3N17A 2VDHA 2IUZA 1ZPWX 4P74A 4Q8FA 4DR5F 1WEYA 1OPIA 1VEMA 3NURA 2FD2A 3A47A 3MAAB 2F9RA 3IG1A 3MM9A 1ZALA 4MB3A 1TTPA 3V18A 4ATNA 3UPBA 3JSYA 1EX1A 2OUGA 1YEYA 4UNLA 4U6PA 2G4FA 4WF7A 3BSCA 2AHOB 4I6YA 3W5YA 2HFUA 3STCA 3H5UA 4NAFA 2HNZA 3C0JA 5CPLA 3CCUS 3EWDA 2KH9A 4AQYJ 2A85A 3ARQA 2FH8A 1ZRQA 2NW0A 4DWSC 2B31A 4ZB0A 1OF8A 3W70A 2W2NP 3VGUA 1V0KA 2ZH1A 4LSLA 4EBCA 4U7UK 3CGTA 2O3DA 3GXNA 4D1IA 2IKHA 4MZYA 4Q8PA 1FEHA 1QNPA 2D20A 5CG0A 4TUFA 4ILLA 1M3UA 2KZZA 1N5YA 4O3RA 1G3OA 3OYZA 2QXWA 1ESWA 3RXZA 1T95A 2CHRA 4Y6IA 2XMWA 2WZHA 3PTDA 2NX9A 1VGYA 4C1KA 1L3TA 3U3HA 1KV5A 2ZH5A 1NVMA 4A3UA 1RTDB 4OYBA 3HD1A 3ZVHA 1QNQA 4ZITA 2J7FA 1JJKA 3M5VA 4JP8A 3GR8A 4BCEA 2K7JA 4KWWA 1X9SA 1RBLA 3ELFA 4NT0A 4X65J 2MMYA 1N34F 3KS6A 4CQDA 5K14A 4Q4SA 3RAOA 2MQLA 2HFVA 3CWOX 3VAFA 2NXEA 1EL3A 3U27A 2PDXA 4NZ0A 4C8NA 1YDYA 2HGLA 3H42A 3NY0A 1GAOA 1KKHA 1DVJA 2FZGB 5KT7A 3W27A 1TL7B 3CASA 5LJ5Y 4DEZA 1YLVA 3R43A 3GXTA 1CULB 4H9UA 5JH2A 1Q78A 5EBAA 3ZZZA 2HNHA 1WXYA 1C0UB 3R2CJ 5BXRA 1FX6A 1HP5A 4DS5A 4H6RA 5C9RA 4W4MA 4K37A 2QSFA 1S6QA 4ETXA 1FWBC 2IS7A 4DSFA 2YX7A 2MYFA 3W9HA 4KGJA 1MZHA 4NAFB 4GLEA 1R8CA 1PCKA 2HNZB 3H5YA 3POTB 1JI1A 3IVTA 3PPCA 1VFLA 2JKAA 1S9GA 3W5ZA 2P6TA 4M29A 4TQRA 4GIRA 4KHPJ 2DHXA 4CQ1A 4AH7A 3PS7A 3NNAA 1VRQC 2VGIA 4S3DA 2ZRZA 1K6AA 2E9RX 2GQAA 1Q45A 3DHXA 2XLJA 5TD4A 1B3VA 4B4FA 2YFOA 2LXFA 3VIMA 4BS0A 4QE5A 2DNMA 4DV0J 1DP0A 2GOKA 1S9EA 1FXRA 1H09A 5GNYA 1FBAA 1XMQF 4XAGA 3APGA 4HNTA 4U7UD 4CZCA 3AISA 2VZ9A 4G9PA 1U2FA 2C2NA 2LXIA 4JIEA 3QW4B 3WQ5A 1UEVA 3T0AA 1BTCA 4KRTA 3NCPA 2QMJA 3K5NA 3MUIA 3AJDA 2QCLA 3WLPA 2QN6B 3A3OB 1GQNA 1HW8A 4A8RA 1ZAIA 2YYUA 2PB1A 2HVIA 2ZKTA 1F2JA 5KT4A 2J9DA 1C8VA 3BAYA 3R0DA 1MNEA 5HPOA 1XH1A 2M0GB 3HHLA 1NDLA 3TUPA 3B0PA 6CGTA 4GVHA 1LW2A 2ASLA 2DO4A 3OB8A 1QW7A 4PB5A 3BO3A 3AS0A 2BBFA 1R3VA 3WK2A 4KGKA 2KM8C 4Q8EA 3CMGA 3PBUA 3MEGB 4LY8A 4ZZ9A 3CDEA 5KFOA 4RX0A 4GKJF 4F4AA 3JR2A 3D4JA 3TIMA 4LANA 3MM6A 2R2UA 1H2JA 1NB2A 5JIPA 1RJPA 1R46A 2J62A 5I3IA 4LYPA 4GC7A 3CIVA 1W3KA 1X7VA 3EKGA 1XR6A 2YKMA 4OQJA 2PDKA 4JN8A 2DYAA 1IBLF 3H7VA 4JI0J 2GVZB 4FP1A 1IQZA 1S12A 4M51A 3H90A 3W73A 1VKFA 5AZ1A 3VZHA 5EMUA 3M0XA 1B9BA 3FVYA 4PQAA 2GX8A 4Q8TA 2YLLA 4MJZA 1W0MA 2AL2B 4KW2A 1GOOA 3AOAA 3MR2A 1Q6QA 4DQRA 3T5HA 3GC4A 3MB9A 1QI5A 1Q6DA 1MDLA 3TW6A 1JK9B 1TP7A 1FTRA 2J9YA 4J91A 4B9TA 2IM3A 3VOIA 1WKJA 1ICPA 5CYQA 1T9WA 4PBEA 1HNZJ 4PUMA 3R89A 3W7MA 4UNKA 4IJBA 3RAQA 1HKJA 4XUGA 1E5JA 3C4UA 4EXAA 1E0UA 3JAMY 1WC5A 2WOMA 1RCOB 2OAUA 3UWYA 3BGJA 3UA4A 4QYZJ 5B08A 2N7YA 5A8WB 3PB0A 4ZJQA 1XM3A 3ATZA 1I1GA 2GK1B 3QY6A 1KWMA 4N41A 2P9GA 2WOQA 1IBKF 2LVWA 2NPFA 2ATLA 2XGZA 3KL5A 3KBVA 4P2VA 1RVKA 1V3KA 4DIAA 3EGNA 3URNA 5LZLA 1FD8A 4L75A 4A2RA 3C15A 4KJIA 2LEPA 3ZTRA 4J9OA 1WOBA 2A2DA 3VZZA 2ASHA 1ZJBA 3DGPA 3ANVA 1MMLA 3N3MA 2UU9J 4YVPA 2WM0A 2QCGA 3V5OA 3DHWC 3SUTA 1CGTA 3BOFA 1HGYA 3VYLA 3NPWA 2W1BA 3E9AA 3SR7A 3WDRA 2Y5SA 5FLXY 2HS3A 3T8LA 2XHWA 3N6NA 3ZTPA 3TQ1A 1TK0A 5K4ZA 1RY0A 2EEXA 4CT8A 2V2KA 5I4MA 4WP3A 3VWSA 2J8SA 3NGJA 3PJWA 4EAYA 3OPKA 4JYDA 4Q8WA 5A8RA 2A3LA 3V5FA 3VAKA 3GS6A 1WCGA 1W3IA 1M68A 3R7SB 2KT2A 3EICA 5AYYA 3FSIA 3AHVA 3VNDA 4D6IA 1U24A 3PRDA 4RW9B 7XIMA 2ZJQQ 3NGSA 3MPDA 2Y8WA 1UW4A 2J7WA 2DGSA 2AMGA 5H8MA 1KD1T 1D9EA 3A5VA 4AT1B 3LX9A 5LA2A 1EQPA 4MTVA 1IT0A 2R91A 1TR9A 4HPGA 4UQBA 3DOLA 4AEOA 3Q22A 2GGEA 4MIBA 5HWMA 2HCVA 2QCDA 1XCXA 3TAOA 3VIHA 2OP5A 2HFNA 3KRBA 1KKOA 3F2CA 1R7AA 1HL9A 2C91A 3WLHA 4X64J 2PTYA 5B09A 3CTLA 1CJTB 5LHFA 1ONRA 2EPIA 4N9EA 1CJTA 3CPWR 4JTEA 2R2TA 3I4PA 3MI3A 5AC8A 1SV5A 4HU4A 3SUUA 5KT6A 2V5CA 3RCMA 3CB3A 3MMDA 3TZFA 4XK8C 1EETB 1M1KT 4L4OA 4DV4F 2W62A 3IUIA 3W37A 2IDLA 4JTKA 2Y88A 4N9BA 4AWSA 3HHKA 5JJBA 5D9NA 2FZNA 1XS2A 4ZB5A 4DHVA 2VKRA 4EYIB 1FFSB 3II1A 1RBAA 3GU2A 1X4EA 4TYAA 2QV5A 4Z2KA 1C7TA 2YL9A 3WLJA 1VMBA 3S01A 2XY6A 2V3EA 3QLDA 1E70M 1XSIA 3LCFA 1B1YA 3V7PA 1Z32X 3DDKA 2YZRA 4DZIA 2DITA 5FOOA 2VFGA 3AD7C 2C1GA 1NWRA 3CHFA 4KFNA 3WBAA 1Z8AA 5A8RB 4H9YA 3GUWA 2ZA1A 3A4AA 2E7XA 3M8WA 1VLIA 4IQDA 1R3SA 2P3EA 2KRRA 2BASA 3OEXA 4L73A 4UQ9A 2JWNA 1FH8A 2X1AA 3KTQA 1I2NA 4IH6A 4TNOA 3RCNA 3FBEA 3NGUA 3GZ3A 3S8HA 4PXEA 4JIIX 3EX4A 3IAM9 2UUCF 4E4PA 5AZ0A 2HS8A 3RJYA 2WHKA 3UGVA 1AZSB 5KTQA 4KCUA 2FLIA 1DQWA 1JUKA 1ICEB 1WDTA 3CMQA 4KFPA 4Q32A 4UWMA 4C5ZA 2CPHA 3KLGA 2VYOA 2DNRA 3M5ZA 1U7LA 5AN7A 1LV5A 4NJKA 1MQPA 3P5YA 4JQAA 1SUQB 1HNWJ 2C1EB 1EDQA 3NPVA 4ETZA 2I38A 3H21A 2V5DA 2EC2A 1S76D 4LF4F 4C6NA 1ZPTA 1BVZA 3UG3A 1DRZA 1BSLA 1FXDA 4X66F 4HPJA 2JK2A 2UUAJ 3TTEA 2XBPA 1WC3A 1TE1A 1S6QB 4RX6A 1HBNB 1YMYA 3K89A 2MKKA 2B7NA 4BI5A 3BPWA 1VF8A 1VYSX 5KFQA 3QXBA 2G2YA 4D6CA 5SWUA 3EUNA 1OVDA 3GW0A 3QGKC 4C48A 2OPQB 3SUVA 1A5AA 4DB7A 2HXUA 1PSDA 4DPYA 4DJBA 2O9RA 3QFWA 1N5VA 1TKDA 3USBA 4BWJA 3LSBA 1X4DA 5CPSA 4YHHF 5H9FK 2PBOA 4GMEA 2RMLA 3P81A 4R9OA 2WSQA 1QNSA 2BLEA 1AB8A 3WL0A 2EFNA 4USKA 1ZA2B 1C93A 4DLGA 4HHHA 4NJJA 4AX7A 4US5D 1US0A 4JV1A 2J7CA 4UIOA 1WSVA 3C14B 3U57A 5L9FA 4I6AA 3TOYA 4B5XA 1XIBA 2DY3A 1JIHA 5H9FJ 4R9XA 3SI8A 4HN4A 4C6MA 4J2PA 4G2DA 1OYEA 1O8BA 3EGZA 2ISDA 1R2SA 3KVJA 3ARTA 4JI2J 4PTVA 2OHDA 5CCZA 1OWXA 2LDIA 3H2MA 4ES4A 3OVGA 4C0HA 1NNDA 3NS7B 4DWSD 3SCVA 2VC6A 1AW5A 1A0DA 1RHKB 4ZR8A 4C0OC 2FB2A 5KFFA 1UA3A 4QLJA 4DHGA 1QHZA 1HI0P 3MCMA 3WIVA 2XSBA 4WRHA 1EJVC 2PWEA 3MV11 1HQEA 1NH6A 2V30A 2KVIA 3V0TA 1W31A 2WVTA 4CNSA 1V6TA 4QIEA 1R0AB 1LLOA 2EI5A 3GYNA 3HA1A 1S7HA 1IKXA 1DBDA 2VGFA 1R3RA 3JS3A 4PRTA 1R9XA 2JFEX 5L39A 3NAVA 3UR0A 2B9YA 4AYSA 1UZDA 1OYCA 1JCTA 1VFMA 4HVZA 3MM6B 3P4UB 1TJRA 1TX2A 4MNJA 5HVHA 1WHXA 3CS2A 2QLYA 3PW7A 3OR1B 4GFSA 1Q4NX 4B9VA 4H6EA 3JB9k 3B3DA 5LSRA 1S1UB 1E1CA 2R94A 1VQSA 4YB5A 4DR2J 4JHZA 4R53A 1XLMA 5K20B 2XM3A 1G69A 1DLOA 2ZOFA 4F4ZA 1TL4A 1YKWA 3FK4A 3OIHA 4FLQA 1NK8A 2HFSA 2BM0A 3UWUA 3GH5A 3JYTA 4X4VA 1R9ZA 2XM2A 2AL2A 4ZQMA 3WZ0E 5F3TA 3K13A 3B0VC 2ZBTA 3ME3A 3OLGA 2AAAA 1NAL1 2AJ0A 1U1UA 1J0JA 2KX9A 3W53A 4NYOA 4GY0A 3R10A 4RNIA 1BHNA 4O57A 4PH6A 2FC9A 3ITHB 4C1LA 1IXQA 3VGBA 2ZIDA 2AGOA 1HBMA 4XG1A 2WLZA 4MK8A 2WRMA 4OOUA 4HA3A 2ZH7A 2QE5A 3KUHA 2QF7A 4E5TA 1NDCA 5KZDA 2QJGA 2Q01A 4H7CA 4ZP8A 2KFZA 3WFZA 5I3JA 3DRSB 1UWSA 1XX1A 1K8ZA 1YZ6A 3J80U 1VQYA 1RT2B 2PEHA 1X9WA 4U5IA 4ASTA 1H0HB 3CV1A 3BDPA 4LBUA 2E5LJ 1ZNNA 2DDXA 3KMSA 1F3TA 2V5JA 3Q8VA 4S3FA 4HEA9 3P5BP 1VBXA 2UVVA 4JEJA 3GHRA 3QO9B 4DL7A 4LF6J 3N9UC 3QQ1A 1KBIA 1EJ7L 1R38A 2VVSA 3KCJA 3P84A 4X4RA 3BG3A 1VPQA 1WDSA 1FWAC 5LKYA 5E1QA 3OTEA 3ZWSA 1GZGA 2WVSA 1WF1A 3CCRS 4FZIA 3S2MA 1OG0A 4GIEA 2F6XA 2CIPA 2NXUA 1KVIA 1WKDA 1Q2RA 2HHQA 2XCPA 3A3XA 2DFAA 1Q2SA 3E96A 4IXXA 5LMNJ 3DLLQ 3BWWA 4YVXA 3TQ0A 4NAEB 3VC5A 1QTMA 2FKPA 1XLFA 2P0IA 3FDKA 1QO2A 3K5MA 2B7QA 1V6WA 4H9MA 4YN3B 3OL9A 3I87A 3H12A 5IT9U 1H63A 3TNVA 4YUDA 2FMOA 5IT0A 3QV9A 3WD2A 2PBGA 3T78A 1NPRA 1I75A 1RQHA 1OB0A 4GO7X 2DIJA 3LTYA 1WWHA 4C11A 3OIXA 4LRAA 2BY3A 1D8YA 1HNVA 4DM1A 3NXZA 2J9EA 4QDWA 1I51B 4IFRA 4DPQA 1V3JA 4FX8A 3XIMA 3L68A 1KM5A 3A9IA 3M0JA 2JEPA 4CLTA 4DYJA 2LDYA 1A0EA 3Q45A 4QGCA 1AW2A 3R8RA 4NYPA 1XR7A 2DNNA 1SC1B 1FKPA 4DI8A 2AP6A 1L6GA 2PMHA 4JI5F 2PDBA 1GZJA 3D0HE 1DOSA 3EWGA 1HQ2A 2HRUA 1J6OA 2YCIX 4N6EA 4ZODA 1J5SA 3GHSA 3GU1A 1T05B 3ZFHA 3T1GA 4XBSA 1R8LA 4I68A 2F9JA 1YJWS 1SW0A 1Y5VA 4J9JA 4P52A 2C3YA 1P0DA 3ZJ6A 1W1PA 2BHYA 3CCVS 4PULA 4DV1J 4W84A 4J3UA 1MYRA 1TWDA 2XN0A 4GCXA 1B0VA 2GMJA 1B3ZA 3L66A 4DYKA 3M2VB 3HKWA 1AT1B 2RF2A 4DPPA 1BF2A 2XI3A 5FEPA 3SQGB 1PBAA 3SCNA 3TA1A 4W90B 4XD4A 1K3UA 2ZZ3A 3BGAA 4DUWA 3HIJA 1SPQA 2BE9B 5C42A 2RILA 2CDRB 3M0HA 1UD2A 2FTYA 3EWBX 1F3FA 1LK7A 4RUCA 1NIUA 1ZAHA 3F7JA 4XO0A 4WEVX 4BI6A 5KFMA 1DXIA 2VX5A 2DNQA 2R82A 4C2MA 3MMAB 2AKMA 5B0GA 4DF0A 5A8NA 3KL3A 3BGRB 4FX6M 3VMOA 2CYGA 5FJOA 4P7LA 1SU5A 4PMQA 3W7PA 5DZ7A 1UVKA 1SKWA 3ZNJ1 3NKYA 3WQCA 4M5MA 4AF0A 1GX5A 2VNCA 2ZH4A 2HSAA 2UWFA 1K8CA 3CUHA 5HROA 3RO8A 3OR2B 3GTXA 3J7ZT 5FJIA 2ISFA 3N4WA 1D09B 3QIDA 1A7GE 3M7SA 3QLHB 5CQ1A 1WDRA 4I56A 2XYLA 3DFPA 4L56A 2VRQA 3VDCA 2ZDPA 5DQIA 1XKYA 1UH3A 5HBMB 3AJ7A 3WELA 3G6MA 2WSKA 4GQBA 1JJHA 3QJAA 3PC0A 2RFGA 5KFLA 4M94A 4CEUC 3BDEA 3HF5A 2PI4A 4NLOA 1WE5A 4E98A 4WCJA 1RH9A 1WKKA 6XIAA 1TRDA 3A8EA 2VDGA 3E01B 3LHVA 3O1LA 1JJ4A 3FXYA 3UFCX 3T5JA 1I1XA 4JZ5A 3S1UA 4YIWA 2B5JB 3PBWA 1OABA 2J9XA 4O4GA 4E0DA 2XLKA 4FF4A 1EC9A 2AAMA 3G8RA 2WXDM 1TVRA 1KXHA 4S1FA 4HT3A 3MM8B 3RMJA 2W01A 3NWGA 1YI2S 5DJBA 3K17A 2PE4A 3GHTA 3SI9A 3T0BA 2HS0A 4A8OA 1XLJA 3EA3A 1AFSA 3RJXA 4USIA 1QXLA 1GW1A 5AC4A 3PM9A 1U1HA 4ICLA 1RISA 2BDPA 4O15A 1PAMA 4B5WA 4CCDA 1JWWA 4UW2A 1NDPA 3THCA 3S6TA 3DM2A 1DIOA 5A8OA 4J35A 3L9ZA 3V4MA 1P48A 1EEPA 2V2ZA 4JIRA 5E3RA 4DN0A 4MY9A 1LRQA 5DMLA 2OG9A 5FL1A 4RNOA 1SKSA 1IWAA 1U8WA 4XK2A 5I3HA 4A46A 3VUSA 1XMOF 4RBVA 2FJWA 1KBKA 1DQUA 1UHVA 3EDKA 1JX4A 1XYCA 1OY8A 2BOEX 3QOKA 7ENLA 3QF0A 1W5NA 1YQHA 3G1RA 1CQMA 2LQ9A 4DQSA 4LFAF 1XLLA 3DECA 1Q3NA 3RITA 3H2CA 3SY1A 5C9XA 4NUWA 2VEGA 5K7JA 4GI9A 3W63A 1NHUA 3PYGA 5M2RA 2FB3A 2Y1IA 4S2CA 4HZ8A 3R8GA 3T41A 2OJPA 3O2IA 3M1VA 1G4EA 1HA1A 2MKYA 3HFYA 3T19A 2V6AA 3CL6A 3T6CA 3WBZA 2MKIA 4CN1A 1S6OA 2HNDB 1PKLA 2OX1A 3QVQA 4CD7A 4K0KJ 2D2OA 1SPBP 1ZM4A 2WQPA 1EOMA 3BAIA 3RR1A 3R2GA 2M70A 2W0UA 3PTMA 3OJUA 2RHQB 5AT1B 5TQLA 2O4QA 3N14A 5HVFA 1YYAA 5D37A 5A6TC 1U1QA 2INFA 1OIFA 1C29A 4KV8B 3ZJ7A 4WIQA 2BR0A 3D28A 1W26A 2AYMA 3PYFA 3T5LA 5A95A 2NQZA 4QSFA 1TV7A 2DVTA 5C8BB 2ISVA 2DT0A 2WB1D 5J2NA 4OBSA 1B3OA 3W7NA 1D1UA 3WK1A 4DWSA 2RUSA 4XBJA 2F61A 2H8ZA 3T2PA 3KJVA 4Y7EA 1QE1A 4UUWA 3OL6A 5BW6A 4JTHA 3W4RA 2FHFA 1EIXA 4GVLA 4B3TF 4PMVA 1VGAA 3C2VA 3VOJA 4ERGA 1KD0A 4J9QA 2JGYA 2JC0A 2GHVC 1NELA 1FWIC 4NL1A 1FF2A 1EZWA 3CQKA 4US5A 3IIXA 4PB4A 4NX5A 3LCIA 3M44A 4LYKA 3VNZA 2V2HA 4H9ZA 3OOQA 3B8UA 1POKA 2FGBA 5EFDA 1KEKA 4MZ8A 1AFJA 1NSJA 5I03A 3SMZA 2HVHA 3OZYA 4Z1DA 2ZXBA 3MP3A 4RBUA 4ZCLA 4PMDA 3U0HA 1RWMB 4JI5J 3PX4A 3PZUA 1E9IA 4O3SA 1K77A 3C2PA 4P61A 2DNPA 4HA4A 4C3LA 3SFUA 4HYWA 3VD9A 4C6QA 2VOTA 4H41A 1L8PA 3T2OA 7TAAA 5B0FA 2GDVA 2IXVA 4AIOA 4DUZJ 3PTQA 1ZCCA 2PDHA 3PP7A 3IANA 3W1MA 1AVAA 2DEJA 4LUSA 3C0LA 2GVLA 5L1KA 1LXNA 3WNMA 2A6MA 4KBIA 5ABFB 3K8MA 4WD0A 4QHRA 3OUYA 5HQLA 3AMLA 4X4NA 4GYFA 2J0WA 1MRAA 3GR4A 3TLLA 3BCFA 5LIXX 4UTTC 4JOUA 1L9WA 4E2DA 2PPGA 5BYSA 4C8YA 2FHKA 4H01A 1KFLA 2QA4G 1MEHA 4EVZA 1N33J 3M41A 4M8LA 1E55A 4H83A 3KP1A 3MU7A 2P9EA 4P2XA 1YHTA 2HQGA 1T96A 1CCWB 3OTOF 3SXLA 4CN6A 1KWGA 1MXDA 4HHUA 2UUWA 3CJTA 2W4XA 2BGSA 1FJGF 1J2WA 4X2RA 2J7UA 3CUGA 2NZCA 4C9DA 4I7UA 2BQRA 4D6EA 1LTDA 4LIWA 4X62J 2R24A 2W2OP 4JUZA 4MIWA 3TX8A 4GXPA 1CJVA 2HNYA 3T0DA 2WB5A 3WDPP 4NWBA 1DHPA 3NM1A 1E0TA 1S1WA 2E7WA 3E49A 3IIOA 2W63A 4ES3A 4XAPA 3NG8A 3SB0A 3GNXA 1J0HA 1M5SA 3Q89A 5DZ6A 5J5RA 5CD4A 5A6WA 1D3HA 5AC5A 3L65A 2CFFA 3AXMA 3QPEA 1JCMP 2CPZA 3O1NA 3HI9A 4M5GA 5KFCA 2YKAA 1TSIA 1BUXA 1P1LA 2RDWA 2QAFA 1E40A 3SN0A 3I65A 2V9DA 2VZOA 5E0CA 5FIPA 3FZ2A 4F8RA 1RYRA 4DJED 1NH8A 3TJ8A 4I67A 3EOLA 3C8YA 3I55S 4FI4A 3MM5A 1X38A 1KCXA 1IIGA 4HHPA 1HTIA 5G1MA 2BVTA 4FNPA 3RAXA 2VUGA 3HX9A 1BXNA 2HHWA 3PSWA 3PZTA 2QEZA 4QJ5B 1SIZA 4DJFC 1NKBA 1HJVA 5CC3A 1E4LA 4B5NA 1KFCA 1C1CB 2KYXA 5FEXA 4ZPWR 4DN9A 1XUUA 3RB4A 3S47A 3TXVA 1E6ZA 4PUWA 3MUZ1 5AKQA 1A0OB 4F0RA 1G67A 4P8XA 2Z30B 3RW7A 5F3ZA 2XY5A 2D41A 2VIHA 4U67Q 4IPIA 3KVLA 4KHPF 1JLEB 1KV8A 2YW3A 4A3YA 4P75A 2R2RA 4LCSA 1QJWA 3DU0A 3KWXA 5CC5A 3H23A 1A0CA 5DELA 1XQIA 4ZJLA 2W3ZA 3PDNA 1ISWA 4Y2WA 1NF7A 2V67A 3MR6A 1HIZA 4ED1A 3S5NA 1LWFB 2WC7A 4C6AA 2PD1A 1OC5A 3QOMA 4L61A 2JFDA 3M6UA 3KLVA 1AW0A 2BOPA 4JBRA 2NREA 2CKSA 3QT6A 4D72A 2BDQA 2CQ2A 3VD4A 1QI2A 2IMOA 5FA5A 3W3SA 3GH4A 5KFSA 3AYTA 5HQEA 2F9DA 3W2WB 2ZC8A 3NL5A 1Z7AA 4XDCA 1KFSA 4UY8T 1XCWA 4BQ4A 1F9HA 1X1NA 5GAHI 1N5SA 2DQXA 1GXLA 4LWWA 1APSA 2R8HA 3M0IA 1KFWA 4WZQA 2IRXA 1KRAC 2QW5A 3ZLHA 2HSEB 4G65A 4L76A 3E0IA 2XIMA 1RPXA 3QBUA 3KNGA 1HNIA 1OFPA 4J40A 1RHUB 3N4AA 1IT7A 2X1GA 3UVIA 1LK5A 3UZJA 1UMYA 1LWEA 1AUDA 3QH2A 3E5PA 1S1XB 4EWTA 8AT1B 1V9OA 3BL3A 3R6LB 4OOZA 3IR5B 3EPIA 3AHTA 1KXTA 4QJ1A 3A8KA 3F41A 5KFBA 1GGOA 1PHWA 1KBRA 2H48B 3THPA 2UXCJ 3HGOA 3BN7A 3UXKA 3HSDA 1YJUA 1DIKA 4U2YA 4LB4A 4EPEC 5IZHA 2RJZA 2P88A 2ZYFA 3URQA 4LR9A 4J3VA 2XSFA 2IJNA 3DYAA 1FI4A 1JPHA 4QISA 1W3HA 1BSIA 2DBBA 3W7LA 2AJ4A 1Y10A 4ZO6A 3M32B 3P3DA 1CC8A 3EB3A 5DXXA 5KMYA 2WC4A 3HULA 4G6CA 4FXDA 3GYEA 1Z6KA 3CTTA 4LXFA 2DEIA 1EB3A 2BODX 1URRA 3DMJB 1RA7A 4JFWA 1HD0A 3FIGA 3L2IA 3WKZA 3HVTA 3I4KA 2PDNA 3G5EA 4MG4A 4PE8A 3PZIA 2MY8A 3PPFA 2INZA 3F1QA 2Q8ZA 1W5QA 5D4LA 3VOHA 1GTHA 1DXEA 3ENVA 2C13A 4CCHA 1QW9A 3AXIA 1S59A 2VBWA 1WAWA 1FXQA 1RU1A 1XLEA 1QWGA 2HPMA 1GCYA 3DZ1A 4YMZA 1AYEA 2FFIA 4Q7BA 1XH0A 3V75A 5SUHA 1T9YA 1NSAA 2PA8D 3UR8A 1NEYA 4ZPDA 3VFCA 1U48A 3WD4A 2UV8A 3DKJA 3GNDA 2ZTJA 1RWUA 4HCHA 2DGVA 3EOOA 2AGTA 4PN2A 1ZP4A 2B7BB 1NY1A 1PIFA 2E9LA 4ZPCA 3SQOP 5C25B 2XMKA 5F1UA 1CEOA 3AIRA 3MR7A 5CYQB 2VG5A 3J7A1 1TUWA 3HHLD 3IS9A 4JI0F 2CG8A 4M19A 1T9XA 2IAJB 5KETA 2H9ZA 1FJEB 4X63A 4IOBA 1EWEA 3A4TA 1N54B 1WC6A 4HPXA 4WZHA 4M5IA 3T1AA 1N82A 1I45A 1W9XA 2BJ8A 4CO0A 4EPBC 2LU2A 4E8UA 2I17A 2X0YA 3WK3A 3PFRA 2PI5A 3GYGA 4C1NB 4MYTA 3M32A 4QSHA 2E1WA 2I9EA 1E3XA 2DB1A 3GQCA 2A7NA 3DG7A 3ES7A 5C2XA 4P9SA 3HQPA 4PB3A 4OZ2A 3ARZA 3TQVA 5HMYA 4OI6A 3FAXA 4H04A 5T9CE 3WJXA 4JN6A 3HP6A 3BO9A 3GYCA 1EJXC 3NIYA 3TTQA 3CULA 3DYMA 4GFIA 4JV5J 2WVEA 4BHYA 3N4FA 4WP8A 1RWWB 1EEXA 1HKAA 2V69A 2AEFA 4TN2A 1U4BA 3M5YA 3KUEA 3VIGA 3DI1A 5K4XA 3NO3A 2YPZA 2DR6A 2VCAA 3BLPX 3DAQA 1S1VB 1Y00A 2D74B 4F40A 4WJEA 1ADOA 4KHMA 1IXKA 3KHLA 3UESA 3SDEA 2IVFB 1EQCA 4R7JA 7CGTA 5FD0A 4OZ3A 4IFYB 3GR0A 3GNPA 5C54A 1W3LA 1GVRA 4QZVB 4B17A 4GX8A 2BOFX 3PTWA 3I5AA 4USMA 1EJRC 1N6QA 3GZAA 5I6SA 3K8VA 5DCDA 3FA5A 2VZTA 3DFOA 3GSDA 4LF9J 3DBNA 4AZCA 1S46A 2R7UA 1P6CA 2NZLA 3NQ7A 3I0RA 4XZHA 4K2SA 3NQCA 2MKCA 3LEPA 4K1WA 1NJZA 2R1NA 5TNVA 3CDBA 3RRAA 4USVA 3OL8A 3W7QA 3VNYA 1N32F 1QCWA 4Q8UA 3TVAA 2BFGA 5B0AA 2YH0A 3VCDA 1R85A 1S2AA 5IV3A 1BEUA 2CQBA 3SQMA 1L8NA 2ZHAA 1J5OB 2YR1A 1FP8A 3EDJA 4R0JA 3S3GA 1Z41A 2MNRA 1YDOA 3N9KA 3QMQA 1N36J 2F4FA 2Y3YA 1EQ0A 1EJTC 2IKIA 2B6AA 5ADZA 3GFXA 2NV2A 4B5VA 5KG1A 4WLCA 4GQ0A 1ZB5A 1QASA 2VB6A 4HI2A 2Y7FA 2M2BA 2GAGC 1S9GB 1LXJA 3BJYA 2QIFA 1EOKA 2J47A 4DU7A 2DY9A 3E3XA 1EDTA 4R85A 4M8UA 3WMCA 1BGXT 2A0NA 3IJIA 2IRUA 1IBMJ 4WSKA 4HPNA 2VFHA 3VTRA 1RWPB 2AV5A 1SO3A 1W3JA 2BOGX 3RM4A 2ZA2A 3CEDA 5EGYA 3MECA 1K7FA 1JPMA 2INEA 1ONEA 1J5TA 1FCVA 3CWHA 2BANA 2BXVA 2JEGA 1ZGDA 4ZS6A 4ZL1A 3HPOA 4MYAA 1FH7A 1CJUA 1XMBA 3LQGA 4CVUA 3FQLA 3FFIA 3H7UA 1E1FA 1Q6GA 2OYKA 5GADU 1K44A 5D2XA 2YW4A 4OHWA 1EBHA 1JR1A 4MWAD 1RT6A 3M8ZA 2OZ3A 3OL7A 6ENLA 3LPFA 5HAOA 5EWGA 4F3QA 1KONA 3UDCA 2OLSA 4DCPB 3UR3C 1F3EA 1KRPA 4ZXOA 1EQMA 3B9AA 4WBFA 1DTTA 4L9ZA 5D09A 1J0IA 2J8GA 2UY5A 1TVLA 4DV5F 2J0QD 4OZOA 1TWIA 3M6WA 1EGMA 2PDMA 4ZVHA 3NFUA 3TSMA 1FWHC 5A2QU 1QPKA 1K9MT 3D68A 1NMEB 1A80A 2B81A 1EUNA 4NLXA 3TUJC 5D0GA 4MIAA 3Q0AA 4OLPA 4IH7A 4I7FA 1SC6A 1V7AA 1HBNA 1KVJA 1HHSA 1RT7A 2EFPA 3SDOA 2CAJA 3SFGA 1T5AA 4O1CA 2W4DA 5G2WA 5HSPA 3T1HJ 1FWWA 3FAWA 2CBJA 3UVAA 2WONB 5CAHA 3MA8A 1R3YA 1GMWD 1KBJA 4AEFA 3LCHA 2YDAA 5AXNA 4P73A 4C8OA 2G0JA 4L6V3 3SCKE 2PDYA 4AAJA 2RU3A 4B9ZA 3W7DA 2E5JA 1WZAA 3KTCA 1FWLA 5IM51 3LGHA 3E2VA 4GIYA 1ZU8A 4GVBA 4HDGA 2EFGA 2PTXA 1DTNA 3WBXA 1R3NA 1U5JA 1AG1O 4OQVA 1XC6A 3KK1A 1IZJA 1PV8A 2R1LA 3OBEA 1WOSA 5D15A 3ULHA 3UPFA 8RUCA 2IHR1 4I69A 2QPXA 1PZ2A 4UOQA 1XNRJ 3PZPA 2BJ9A 3MHFA 1LORA 1B0IA 2MZJA 2HWGA 1EO7A 2WBGA 5A6JA 1F2HA 3CCQS 2DNGA 1HR0F 3GXDA 1ZCOA 1V5VA 5ABGA 2G2OA 4O1BA 2C8NA 3CE8A 5MLCV 3ETOA 1VBGA 2K3IA 1FO1A 1RTJB 2BE2A 2G37A 1DARA 4GHRA 1AW1A 3IJ7A 1PKUA 3N4EA 2Q6CA 3MMTA 3NOEA 4AZ5A 2PEVA 3ARRA 1WAUA 1HKVA 3KLEA 1K0TA 2ZUAA 4REQA 4DJDD 5ETOA 5HUPA 2GCFA 3KOAA 4EBEA 3CAKA 5DMNA 3FNNA 4P7OA 4JI2F 3TN5A 5KG4A 1JD7A 1ZZFA 1UZ4A 2CLLA 4K6AA 4B9NA 3WFAA 1YW1A 3O16A 1JKHB 1GOKA 1ZAVA 4LVAA 3LDVA 3UXDA 1VC5A 2HQ3A 3SCQA 4URIA 5F2IA 1X6LA 4DBQA 1HL8A 3MUXA 3PF3A 4DR3J 4V19J 4S2BA 2PC6A 1YJTA 2XZ9A 2G13A 1DJHA 4FP9A 4O19A 3RB0A 3EX7B 2ZVIA 3W6YA 2J9CA 5J2MA 4F7VA 1HKKA 4WK1A 2AGPA 1BQCA 1M03A 4W86A 5CLTA 1X4HA 1U0HA 1WQ5A 3WLIA 3UY8A 2U1AA 1XLKA 3BPSP 3NGFA 4N77A 3S5YA 1WI8A 3M8QB 4MGGA 1HQUB 1E1CB 4JICA 3EXYA 3NGDA 4H00A 1UIOA 5KFIA 1YBUA 5AE3A 4FIQA 2R8KA 3CEPA 4ZTYA 2ZJPQ 2KI2A 3LHWA 4FXRA 3K1GA 4IUFA 3BCJA 4MKYA 1JLQA 5DXYA 2W2MP 1S2TA 1PWLA 3A12A 1GQEA 1RWOB 2Y8YA 3LO3A 1UC5A 2YVSA 1CC7A 3O44A 1C91A 2HVMA 5GADI 1S0OA 1OEPA 5J1PA 3RF9A 4MY1A 1ITXA 3ZZPA 1TQLA 2X1UA 3T05A 1KLMA 1ZM9A 3ALGA 4FXWA 5D0RA 1ZS2A 3TAMA 3PZMA 3HPAA 1HVQA 4Y9OA 5DLCA 2OEJA 2FJBB 3HT3A 3KLLA 1OFQA 1JCXA 4XWUA 1WKYA 3URAA 2V82A 4YL2A 3Q2TC 2IMWP 2HBXA 3CCLS 3L3CA 1VQOS 1HWIA 4ZPAA 1ELOA 3GFYA 1JZ2A 4ZQRA 1FWDC 4MDPA 3AB2B 2CW6A 1BKHA 1S57A 1TL1A 3LU2A 3IS4A 4QS5A 4IIBA 3BLKA 3W87A 2QA2A 2ZITA 1CZ1A 2F2HA 2BJ1A 3CPUA 2Z1WA 2ZWPA 3S83A 2XDFA 4ROPA 3M2UA 1HZYA 3SFWA 5GQBA 1ZBCA 3LRKA 3TFCA 2DUXA 4KPCA 2EJ1A 4GUFA 4J7RA 3TZZA 2AEMA 2DPEA 5LSMA 2OKOA 1KOHA 3C15B 3SCOA 5F8LA 2Z7GA 4WK9A 1MW0A 2XVKA 4WDUA 2QO3A 1N8IA 1F5ZA 4U8VA 3LLXA 3DRRB 4AZGA 4OJ1A 5C7VA 1RK5A 2GWNA 4LUJA 3GVVA 2IY5B 1O94A 4B4HA 5FSEC 1PCWA 5BOOA 3S4TA 1KCLA 4HMEA 6ALDA 2YKNB 3KUGA 1OADA 4TQTA 4IYQA 1I1WA 5A6AA 3LK6A 3A3NB 3N2XA 3PJTA 3H53A 4HSOA 1WV2A 3PXGa 2UU9F 3QZAA 4C11B 3TAMB 2FJXA 2E6AA 3MAAA 2WVBA 1PTAA 4NXMF 1HBMB 4XAKA 4GC3A 3F03K 3PYDA 2BVDA 3F4CA 3CV6A 4Q45A 4Y9MA 1WXZA 2QGFB 1BXBA 3MPYA 1C8YA 1DV7A 3GONA 7PTDA 2DGQA 2FLLA 4BQ3A 4LFYA 4S39A 5T7LB 5HLFB 4G5DA 1HQTA 3L2MA 4GUIA 2D7SA 1XIHA 4DJFD 3TR9A 5BXTA 3OTBA 4CO5A 4DV6J 1M7JA 3P6LA 4KY3A 3AS2A 3FJ4A 1DURA 3A64A 1LCOA 1FNMA 2YCKX 2ZDRA 3NOGA 3T81A 1Y5NB 1NDKA 3NSNA 4MNKA 1EKSA 5LNUA 1UP0A 1UB3A 1TZZA 4DR5J 4QITA 3V81A 1XIIA 3CZGA 3IWPA 4DPXA 1JJ2R 1Q63A 4L6OA 1MW1A 3MSGA 1Q86T 1JZ8A 1UC4A 4JS3A 4ZFMA 1G2EA 1AJZA 2G0IA 5HMSA 4RUAA 3WQ6A 4ZEPA 1P27B 3U1NA 1VQ4S 3HJEA 3DNCA 2OH2A 2HVZA 3P45B 3NQBA 4FBTA 4PSPA 1X8DA 3WX8A 3BS9A 3G1FA 2P5VA 5K14B 1UYQA 1XQKA 2AJ1A 3K57A 4K4UA 1O1ZA 3MTKA 1C8QA 4ERIA 1BVWA 1MWYA 4RDWA 3BSOA 1NZAA 1L3UA 4OHXA 3WF1A 1XDJA 1UTAA 5HMFA 1JAEA 4OHVA 5I79A 3UR5A 1QAYA 4ZQOA 2QHAA 1C0UA 2VT0A 5A6LA 1J93A 1H62A 2EKYA 3QRRA 3OJGA 2HK0A 3WLMA 1SJCA 1BD6A 1SO6A 4C6LA 2LQ8A 2JKEA 3PVFA 5G2IA 1Y3JA 2CDQA 2CYYA 2Q3RA 1RHCA 1JNEA 5J2QB 1Q8AA 3F73A 4NU7A 2RH9A 1IBCB 1OSCA 3EZOA 4NLGA 4UFJA 2V3GA 5LGXA 3QZ6A 4K5SA 3WF4A 2IRYA 4H4MB 1OINA 4LAMA 3NGKA 2GO8A 3EX3A 1S5MA 3S9YA 4U31A 3GPAA 4A48A 3IIZA 1KQYA 2EPKX 1Q6LA 3CC2S 2XSAA 1NARA 2Y0SD 3VDGA 1UD3A 4XIUA 1AXQA 4JDBA 3M30A 3UXLA 2KXNB 1Q8IA 3D0IE 1PWMA 4AW7A 2YXOA 2AQVA 4E38A 3DFHA 3D3BJ 1TKZA 2VQEJ 1UR2A 4XO7A 3M0VA 5M5DA 1CXHA 2NLWA 4JIHA 4U28A 1GYLA 4H4IA 2B56A 3J7YU 3CAQA 3FGCB 5KFGA 2C1HA 2BHZA 4QG8A 1NJYA 2ZEJA 3GG7A 1WF0A 1WHYA 4EYHB 1MUWA 1A5MC 4KWUA 4U9RA 1IQ8A 5E5NA 2A2IA 1J0YA 3TAQA 1EIYB 2DH3A 3N12A 2W92A 2NCKL 3IM9A 5D8ZA 1X6NA 3BANA 4OZ1A 5E0FA 1CVJA 1P0NA 2FHCA 3W1PA 4DSIA 2NQHA 4R33A 1IKYB 1SH0A 4MK7A 2PLCA 1CNVA 5K9XA 2WW5A 2ALZA 3W23A 4CLSA 3ES8A 5DGAA 2QCEA 3G86A 4DFKA 4GGHA 3N5BA 1C2PA 5HNTA 2E7VA 3TYDA 3RJMB 4KFBA 3S5OA 4C6EA 3NSMA 1U83A 2PFHA 1B31A 3QW3A 3CMJA 4AVFA 3NLCA 3GV7B 2VH7A 1I2OA 2VC1A 1QI0A 4RW5A 2J6TA 4PRWA 1HKMA 1I9CB 3CJ8A 1E6PA 4PWWA 2NXGA 1N5QA 4YP3A 1V8EA 4C6IA 2CLIA 3ABZA 3WLSA 4YTSA 4X4QA 1RT1B 1OO0B 2BB0A 5EFFA 3ISIX 1FERA 2GIFA 4WKAA 4LSBA 2J13A 3AY0A 3NDOA 2WCAA 4ATDA 4JTIA 1AL8A 2J79A 1C0TA 3TARA 3T0TA 4O12A 1JDFA 4NRTA 5FJTA 3W2VA 1DY3A 1VZWA 4U5KA 1V5IB 1TKTB 2A6OA 1Y5IB 3ITXA 7ODCA 5HNRA 3NS5A 4OX6A 3VM7A 1G4SA 1VRTB 3KYLA 2QQ6A 4OL8A 1MZRA 1Q6OA 3ICLA 3IPWA 3D9BA 1KLMB 4F4WA 2F4VF 3H55A 5EB8A 1O6IA 2ZX9A 3I9V9 3LPYA 1EP4B 4NLPA 2ZX5A 1FDAA 3TVZA 2MZSA 5E41A 1RJRA 1UUOA 1SJDA 3Q24A 3MYPA 3UXAA 1XERA 1XFCA 4GJ1A 3HT0A 4C1NA 1J2BA 1J79A 5E0OA 1XRFA 4FNTA 4NYZA 3N19B 3GW3A 5F0WA 3I6RA 4K4YA 1I0DA 3S1WA 1RAEB 2GS8A 2ZXAA 1JI2A 2B4GA 4C6DA 2QGYA 3F4DA 4MPKA 3GP9A 5HNNA 1U0SA 5DQHA 2JEJA 1HJWA 4OBRA 2VF3A 3OHIA 2JEIA 1XDMA 4GNKB 3M8PA 1TCDA 2ZX6A 2GVJA 4AYGA 1FTXA 4E0CA 1TPB1 4ICCX 2VZUA 2WAGA 4L3NA 2Y63A 1Q8KA 4FPIA 4H7VA 1S1VA 4CKQA 5CZ0A 3TC6A 2GJIA 1S0VA 4NKCA 3P0WA 3VNIA 4ZE5A 1G4PA 4FXSA 1K02A 1F9FA 1C92A 4JX4A 4EK7A 3W62A 2VJVA 2O9TA 5GAHU 2ALDA 4C5YA 3O6QA 3SV3A 4USTA 2FHMA 4B92A 3QWPA 2F3JA 3E51A 3DH7A 1NK5A 2XO7A 3LTSA 3MUAA 3KZSA 3MUCA 3OGVA 1JXEA 1HG3A 1LWCB 2OFGX 3KHRA 1PIEA 3OGSA 3SGUA 2JJ4D 4WF9Q 4UMBA 1UUQA 3ZIZA 3IJDA 1FRKA 2PGWA 3HFZB 3GD6A 4I5UA 3STEA 1AD1A 4KMQA 3HMCA 1KBBA 2YX0A 1NJIT 4GD0A 2W91A 2BVZA 4K4WA 4AWEA 4B5TA 4O52A 4JL2A 4DLFA 3TMLA 2QLFB 3DFEA 3QYSA 4OX8A 3KRZA 2JH3A 3PG9A 1XIMA 3GG1A 5LXEA 4KKXA 3AQOA 4Z08A 3Q4DA 1TK5A 4WSJA 1SR9A 6A3HA 3ZQ9A 5DMYA 1B70B 1W54A 5FJRA 3CV2A 1RT2A 3DERA 2ZX8A 4FK9A 4JTQA 3H8YA 2B9XA 4OV1A 4PBGA 1U09A 1DBTA 1P9QC 2CIMA 3FHAA 2J8AA 2CZ9A 4I7FB 1JLGA 2MQQA 1R3TA 5DGBA 1QAIA 3OODA 4Q0BB 3AU2A 4OV6A 3CCMS 4QR0A 4O1DA 4LBIA 1QO5A 2D3LA 5EMMA 1IIHA 1KB3A 2RH3A 4JTRA 4B5SA 2YWKA 4DZDA 2XCAA 1CGYA 3V1HA 4PMRA 3J81U 3CCSS 3WX7A 2DEPA 3SEOA 3W71A 3PIPQ 1QUVA 1P5BA 1CBKA 1ZTTA 3MUY1 1PBGA 1H1YA 3E01A 4RPPA 1V3SA 4S3GA 4XPCA 4J2MA 2RJHA 5CAAA 2D23A 1VRUB 2CQ4A 3E38A 4LRBA 4R5PB 2EG2A 2GFTA 3NL6A 4ECRA 2DZSA 2FH6A 3IMQJ 3PUOA 3CDWA 2AEJA 3MEKA 4Z42C 2KO1A 3CB4A 1REGX 3HPSA 4Q3MA 1CJUB 3TNBA 2UUCJ 2I16A 1NM2A 2Z8QA 1O5RA 2G96A 3CJQA 1TA3A 3MHUA 4QOTA 1FWEC 4LT6A 1W17A 4X3ZA 2DNLA 2JDJA 1JPKA 3GLJA 3H59A 1V7YA 1NQ6A 1M1GA 4J9LA 3BV8A 1C1BA 1F60B 1Q53A 4WTYA 4Z2IA 4B3SF 1KNZA 1WKFA 4AC7C 5I3DA 4ECWA 4TQSA 1RHMB 2QLWA 4CCZA 1SJAA 1IEIA 2YWHA 4LF4J 4FYVB 1NDYA 4A3RA 1OJXA 3F2DA 4X66J 3N6QA 4F50A 1X31C 3MEEA 1QAXA 3OV7A 4AXKA 4PUUA 2GFFA 4LIRA 3QLHA 3T6JA 3PHTA 3PKYA 4L9XA 2OELA 3FBCA 4N4QA 1UZHA 4J28A 1DJZA 1Q8LA 1S3HA 3MTWA 2BBEA 4ZVOB 1L3VA 4DO5A 2UUBF 1N48A 3IV3A 1KWKA 1SL0A 1KQKA 5KFWA 3I5CA 3NM3A 2VPWB 2VC9A 3R1HA 4ZFCA 3VDHA 2WSFC 4GJIA 3M05A 2E9TA 3D5HA 4K7VA 3MUMP 1TCMA 3A9BA 2FZBA 4YXGA 1FCBA 2IJRA 1B7FA 3PZ9A 2U2FA 2HBZB 1VFUA 4Y2MA 3AMDA 1K73T 4LF7F 1NHVA 1B4KA 3PAJA 3WIJA 4J3WA 1E6QM 1UD4A 4OZ5A 3CT2A 4G1NA 1IZKA 1HJSA 3LRLA 4UB9A 3C3NA 4GC4A 4O18A 2OTDA 3TJXA 4F2BA 2RF2B 3V4IA 1VLYA 2V50A 2GA7A 4DU8A 3FLUA 3A21A 4J27A 3PN8A 2J7GA 1LQ2A 5CPTA 5KZEA 5FESA 1VAHA 3M46A 2OFJA 3CDAA 3OPSA 4NZ4A 1AROP 1KDNA 5FJJA 3TANA 3LH2S 3V6JA 1YBAA 3G1YA 1UR4A 4W5UA 1N0VC 3R3TA 5D05A 4DXLA 2Y0FA 1X4AA 2XHCA 3HVAA 3HN3A 4A8MP 4B9MA 2QRRA 2QPSA 4CEXC 5HMDA 3JXOA 3NSXA 4PBFA 3CSKA 2BNJA 1UJ4A 3UD6A 4R8UA 4FF5A 3TE9A 4BCAA 1K03A 4KT2A 3O5TB 1BQGA 3J7YI 2JX2A 4B3MF 5A2QY 3M4XA 3HZGA 2G0WA 1RTJA 5EMYA 1E1EA 4C98A 4S23A 5F2LA 5BCAA 2DY1A 2I8EA 3KVMA 5JMNA 5FIIA 1JB0C 3I6TA 2R42A 2WJEA 1O4UA 3WNNA 3AJ2A 3WLNA 1KM0A 3B4MA 2VPYB 1WP6A 2XH0A 4XZBA 3R6GB 1YTYA 3K4DA 5AHEA 1NK4A 3NR0A 4AC1X 3ABXA 2QJIA 2FVPA 2BTMA 3TVYA 4CNUA 3BH7B 4RXGA 4HLBA 3W2UA 1FE4A 2O67A 5G4DA 2PDLA 2Z28A 4FR6A 1T9UA 2CPFA 5FJ4A 4GYKA 2OYLA 2XB2D 3QPZA 4IGHA 2A3HA 2D1CA 1A3HA 4YYCA 4D6JA 3IWXA 4HR2A 3LGDA 3FBBA 4OJYA 5C24B 1D7KA 1PAUB 3TWBA 4QW9A 4KO0A 4V2XA 4KEMA 2TAAA 4H4OA 4QIWD 3VR1A 2CLFA 3RBEA 1QMLA 2CQ3A 1EZ2A 3N28A 2ACMA 4JFVA 3KTXA 4QIGA 4RU2A 5KOWA 3VAMA 4M6PA 2ZH6A 4O4GB 5CCLA 4ECTA 3JYTB 2JF7A 4TV5A 1WDDA 3SJ3A 3UDVA 2HRYA 4TYBA 1RT1A 2PE8A 3PKMA 3V35A 3CUNA 1F1BB 3F44A 5HVGA 3LGEA 2ZOGA 2GVZA 1XBYA 2ZFHA 3CW2C 3VQTA 1TAQA 1FOBA 1T94A 2VEPA 2BXJA 3ZTSA 1TZ0A 2V8PA 2PEBA 5DO2A 4LCRA 4K7YA 5DMMA 2H3EB 2Q09A 4LF1A 1RAJA 2YYTA 1KXVA 5G4EA 1IT8A 3EA2A 3GG8A 2C0AA 1JRCA 3H2AA 1VJIA 3CUFA 2EKCA 4CQ9A 5D04C 3DI6A 1P7TA 4L4LA 4MUPA 1KSPA 2ZOXA 4HZ6A 4JI7J 4MUZA 3EYPA 3HCXA 5D2TA 5GAGU 4HACA 4G1QB 4MT1A 4AY1A 1Y5LB 5GAEU 3ZJ8A 4GQQA 5CXPA 4A8QA 3TQEA 2ZUNA 3TA0A 3OJSA 1T6MA 3IA0A 4CYUB 5HJYA 3N2CA 3STPA 1CLKA 3JU2A 3REQA 1DFDA 1ITQA 2OJ3A 4BI7A 3VHQA 2EHHA 2E25A 2FVCA 5KSWA 2WVCA 1M5HA 4FF3A 3MKVA 1SVDA 2PDQA 4MMWA 4F0KA 5LJ3Y 3DMJA 4W7UA 1KM1A 1B9ZA 3E2QA 4JI3J 3UD5A 2GDQA 2CNCA 3VX1A 4WDXA 2YCLA 4LFAJ 2BS9A 4P7QA 3G1XA 1F6KA 2EK6A 2Q6ZA 1DIDA 3HJZA 3RYSA 2GQ8A 2VBXA 2VGGA 3S2LA 2OZ0A 3G77A 2QV4A 3EB4A 1ISYA 2DGOA 2JOQA 2DZBA 4N9CA 1C4CA 3BREA 1T11A 4KGXB 1JG9A 3MURP 4YLWA 2DR5A 2HJPA 3OR1A 2R7RA 4H8NA 4BLGA 4M80A 1O5QA 1PE1A 1J11A 2CLHA 3GR7A 4D6HA 4DZAA 4HU8A 2OD4A 2QL5B 4H54A 1X39A 4OYPA 1XK8A 8CGTA 3RRXA 1K47A 1FK9B 1YE4A 3NEKA 4WFYA 3YPIA 1WZMA 3A1YG 1XLGA 4Q8MA 3QRHA 3QY8A 2GMHA 3CCES 4NI2B 1GVQA 4PEKA 1FY6A 5F8IA 4W8AA 5KFJA 5D9MA 5AXLA 2VFFA 3IARA 1VQ9S 4PYAA 1H7WA 3UZYA 1WELA 1IJFB 1KXQA 3DLKA 3PBGA 1FKPB 3HD2A 4MKBA 2XO6A 4XV0A 1QUMA 2VUNA 5CSSA 2DH9A 3QGAC 3QMRA 3BLDA 3N6JA 5AYBA 3GMGA 1A5NC 1N8RT 2MSTA 1V3LA 2HK1A 1S5NA 5HMEA 4NEZA 1B3TA 2R6OA 3S9ZA 5KFHA 2Y7EA 3BGUA 4CH1A 4TU9A 2VFIA 1H5YA 3EOSA 3ISNC 4M5LA 4OYMA 4QLLA 1M0SA 4CNYA 3ATYA 1OY6A 2J76E 1OQ3A 3VFLA 2QEXS 1GMUA 2B0GA 1VCTA 4D3HA 2GQ2A 4PEOA 4C8ZA 2DT9A 3W2WA 3DX5A 1Q8BA 1LNQA 3E0LA 1Y9OA 2VQUA 1XLIA 3HPFA 3GDBA 1SZNA 1FJGJ 3AALA 3RPDA 3W81A 5EWEA 4RUBA 2ZADA 4LVNP 1P6WA 2N7CA 2RHSB 5FJUA 4HQVA 1FRHA 4KQZA 4DL3A 2DW7A 2EPHA 3PBYA 4IPJA 1GTEA 4NJHA 3RM8A 3VGVA 1YTDA 2E77A 1SQEA 1IQTA 3O6DA 2Z26A 2XPKA 4HCLA 4Z7YA 1ZYQA 1FKOB 3MFHA 3DLEA 5D0EA 2DNOA 4DV1F 1CS4B 4ECXA 3H6OA 4M56A 2KYZA 4C7GA 5HATA 3QGPA 4K2JA 2GVDB 2WVDA 4F0LA 4J5OA 3NL0A 2Z1SA 1TTIA 1M6JA 4M24A 4TY8A 1VBUA 4RR4A 4J37A 3RM9A 3SN1A 1MU2B 4FN5A 4TLRA 3RR4A 2Z57B 3AJ1A 3DG6A 3THUA 4GINA 3W7HA 2BGQA 3W9IA 2CERA 3DYAB 2G4JA 4HNNA 5ABHA 3UERA 1TKXB 4ZVUB 2AYBA 4OX9J 5IV4A 4CLUA 4O1AA 5BMWA 1P0BA 1CG2A 2HG4A 4HU0A 3DGBA 3VF0B 1OYBA 1WF2A 5D2VA 2YNIB 5LNSA 3CQJA 3M2RB 4DL6A 4TX8A 4XPEA 1T0TV 3KCOA 2DSUA 4FYXB 3WNLA 2E8ZA 1LQAA 2ZZMA 5I78A 3ISZA 2QF8A 1FA2A 1FE0A 4M5DA 2TODA 3MPGA 2ON3A 4BWLC 5LOQA 1QPQA 4H6QA 1BYBA 5J8LA 3O07A 1HVXA 1T3OA 3J7AN 1YWXA 1JQXA 1OX4B 4RKAA 2B7PA 3KG1A 2FJAB 3T1HF 3S8SA 3T3FA 1CQNA 2ZBIA 3CJ5A 2ROEA 2XTJP 3G6XA 2PGRA 1OIMA 1IE7C 5H1WA 3W2JA 4IF2A 5ETNA 1KLNA 3PNUA 2VFRA 4EE9A 1Z89A 1E43A 4LF5F 4LUTA 1UWBB 2HQDA 3WEMA 1QK0A 1Q6EA 5LMUF 1PJ5A 3JQJA 3NO5A 4Y96A 4LRFA 2KHDA 3IEBA 3IR7B 3KLKA 5IC4B 4BBYA 3L4UA 1BWEA 3MDUA 1KRMA 3Q2DA 3SQSA 4YWIA 3AIEA 3D6FB 1XGZA 1UBSA 2N4DA 1OGBA 5T8GA 1XIGA 4GI4A 5DDRC 1K9DA 4DFJA 1R31A 2KJWA 2CPJA 3ITLA 4BKNA 5HROB 2HRTA 4K0KF 1X7IA 4QW8A 1NK6A 2PCQA 4XX6A 3IWLA 2QT7A 4KHRA 4X2PA 1KC8T 1VIOA 2XS7A 5I77A 4XUYA 4O3PA 1DTQB 1HWJA 3L67A 3LYEA 3QR1A 4ELVA 2D3ZA 2WZIA 4FNIA 5LSOA 4J5NA 1E6NA 1MXGA 3LMYA 1PYTA 2YKOA 5I3UA 5H6HA 2L9DA 4R27A 1R86A 3HXMA 2NQPA 4S0MA 2YNHA 1JKHA 3EZUA 1XFBA 3K7RA 2C2MB 3H4WA 4GBDA 3UDLA 5I23A 4JAWA 3TEHB 3GSIA 1EHAA 3MC5A 4PTNA 1I94J 2DGAA 8TIMA 3CZLA 1K4HA 1ICQA 1GONA 3O9NA 1S4EA 4KKOB 3GTIA 3N0VA 3THTA 4DV7F 2OD6A 3HG3A 3OHAA 4UZBA 1XBVA 3V6DB 1H7RA 3NS6A 1SKRA 3R5BA 2ZC4A 5ETRA 1XIQA 3BMXA 3ZLFA 1HP4A 2DW6A 2O9PA 1RY8A 4GO9A 3DHUA 3FQKA 4IFYA 3W2VB 5H8UA 5DBUA 2HK3A 4L1WA 2R9RA 2WK4A 1FX2A 4Q4RA 5EU9A 1TVRB 4Q2MA 2XTKA 4JI4F 3K5PA 5A6BA 1EYEA 4I5RA 3ZT5A 3CJRA 5KFNA 1ZQ5A 4HA0A 5ETMA 3THDA 2VR5A 1RB0A 2WWCA 1DIEA 3HFVA 1IEQA 4LB3A 1PB0A 2BX7A 2R1MA 1KC7A 3F4VA 4LV9A 2V5BA 1RKJA 2CQIA 4NNCA 4DFPA 3AZRA 3JTNA 3QAUA 3R94A 3G87A 5LYRA 2AWZA 3GTNA 3ZYZA 2ZRVA 1PYMA 4HSHA 3GR1A 3KJVB 4L64A 4G7FA 3J7Z5 4FBUA 4PWUA 4IL0A 1TUGB 5G1TA 4LV4A 3R58A 1GPWA 2J88A 4RE4A 3C2OA 2CQHA 2RKXA 3H5XA 4XTDA 1C7SA 1LLZA 5D3GA 2DH2A 3Q94A 4IG3A 2EQDA 4Q4QA 4NX0A 4UTLA 2PMZD 3G1DA 1GORA 1H38A 2B43A 3VK5A 1B7YB 2ZOMA 1XDLA 2YCLB 3G0XA 3QMTA 4IMFA 1XBXA 4KWSA 3HHLB 3MPUB 1RI7A 1M53A 2BY2A 2QFJA 4IH3A 3AU6A 1P1TA 5B0EA 4Z2JA 1HO4A 1OY0A 4ACZA 4YCPA 4QYZK 3PSVA 1GXTA 2E40A 1OYDA 1R8HA 4NILA 1TV6B 2QJMA 4NRRA 2B8PA 3NQFA 3USZA 2UXBJ 4U3AA 1LJYA 1P0KA 1XRSA 3VAHA 5J2MB 1K9TA 2E6FA 1YADA 2Y8VA 3GXFA 3TA6A 4O44A 3K2GA 4IMAA 4B02A 4BS2A 1NJJA 1OFEA 2V38A 4HMCA 2G3NA 4O28A 2J75A 1M01A 1TAUA 3A3PB 3XINA 2Q8XA 1JLAA 4FO4A 1KTBA 4B90A 1ML1A 5A76A 4Q33A 2G8ZA 1LLWA 3FRYA 3RK8A 2HBYB 4AQLA 5JH1A 3F4NA 5T9BG 1SJFA 5KT3A 1IBLJ 3VKKA 3W22A 2ZUUA 3CUXA 3CT7A 4B91A 2L3MA 3H0PA 4IG0A 3RX2A 4Z2GA 3DI0A 2CFXA 2X1BA 3P6YC 4QIFA 1YJ7A 4RK8A 2BQUA 3E0WA 1JXVA 2BV3A 4C8KA 1W9DM 1XWYA 2FTPA 1S77D 4I2QB 5BOFA 1U1MA 3FHQA 3R11A 1RLDA 4NG3A 2I56A 3A23A 3IUHA 3GYXB 3WZ0A 4J9MA 4LQ3A 2YQ0A 1R47A 2BW2A 4EZ6A 4XD3A 4DYEA 2BKPA 4DDFA 2B51A 3AIQA 2PP0A 4DBDA 2NXJA 1CT5A 3FEMA 1U6BA 3NO1A 3MFIA 1QNVA 4AZIA 3TSBA 1Q6FA