1GEHA

Crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
432
structure length
427
Chain Sequence
b'YVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMKDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE
publication title Crystal Structure of a Novel-Type Archaeal Rubisco with Pentagonal Symmetry
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Lyase
total genus 125
structure length 427
sequence length 432
chains with identical sequence B, C, D, E
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2000-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 1gehA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 1gehA01
3RG6A 1RUSA 1BWVA 1RBOB 2VDIA 5HANA 8RUCA 1IR1A 1RSCA 4LF2A 2OELA 2CWXA 3ZXWA 4LF1A 1YKWA 3RUBL 3KDOA 1RLDA 1SVDA 2OEKA 5HATA 1EJ7L 2V69A 2VDHA 4NASA 3AXMA 1AUSL 1UZDA 1GEHA 2OEMA 3A12A 1IWAA 1RCOB 1UWAA 1UPPA 5HK4A 5HJXA 2QYGA 1RBLA 2V68A 1GK8A 5C2CA 5HQLA 1WDDA 5C2GA 2OEJA 4RUBA 1UPMB 3QFWA 4F0KA 4F0MA 2CXEA 3A13A 1RXOB 3NWRA 2YBVA 1BXNA 1RBAA 2V6AA 4HHHA 1TELA 5HAOA 4MKVA 3WQPA 9RUBA 5HQMA 1UW9A 3AXKA 3KDNA 4F0HA 2ZVIA 1IR2A 2V67A 5RUBA 2RUSA 1AA1B 1UZHA 2V63A 5HJYA 1RLCL 3FK4A 2D69A 1RCXB
chains in the Genus database with same CATH superfamily
3HPAA 5D4OA 2X7IA 5I3IA 2CVEA 4GI6A 1FWAC 3FJLA 3M0VA 2JEGA 1X9MA 3D0IE 3UPWA 1FDDA 4NCGA 1O1ZA 1GMWA 4GO8A 4W85A 1IR1A 2Y1LB 2VEKA 3FHAA 1CGUA 2R1LA 2J0QD 2E9BA 4AIEA 5XIAA 1H3DA 2J78A 2Y7DA 4IG2A 4FAMA 1LBMA 3SCVA 4AEFA 4UZBA 1TQJA 2FHMA 3OG2A 1N8WA 4K68A 3IRDA 1OFAA 1XNRJ 3E74A 1C4CA 4Q7NA 1W3KA 3VKDA 5EBUA 4LS2A 5KMYA 4MJZA 5H9FJ 4JTLA 5DDOC 2FHBA 1NK7A 3OODA 2C71A 3SFKA 3NQ7A 1RA0A 1JFHA 4Q4PA 6A3HA 4U6PA 3EB3A 4JQ4A 1GJPA 3T5JA 1TPEA 1K8XA 2H54B 2RE1A 2XMUA 1KFSA 3QR3A 4NZ1A 1V77A 2O67A 5IRPA 2UVRA 3LV6A 3CT7A 1SB6A 2E77A 2H90A 5C9XA 2Z1WA 3FXGA 3KBNA 1VB9A 2E68A 4PTVA 4P9SA 1K0VA 2D2HA 2HEJA 4PG8A 4URQU 4S3GA 1L3UA 3KUHA 3VIGA 2DR6A 4HVZA 1J5EF 2P50A 3LPOA 1A7GE 4HMDA 3THUA 1HD0A 3AISA 2RRAA 1ICEB 4V33A 1NK0A 4F48A 4IG2B 2EBNA 3SQGA 4P7LA 3O1LA 2D0GA 3G82B 1UAWA 1JLEA 4R3UA 1WOSA 3DMJB 2FGBA 3QMRA 2QUVA 2GQ8A 2A1BA 1Q8KA 1R6WA 2PDWA 3W8PA 1DHKA 3WFLA 2MXYA 3HPSA 1SGJA 4XO7A 3V0TA 2O55A 4LUTA 1F74A 1TR1A 4KFPA 1QBBA 3FCVA 1Q86T 4ZBCA 4CM0A 2VV5A 3MUAA 2KJWA 2V8DA 3SSQA 1DYSA 5L38A 5DZ6A 2CPIA 4WY0F 2Z25A 3ENVA 3GJSB 1KR1A 4C6FA 3OFEA 1OX5A 4S39A 2ACQA 4LF5J 2ZH3A 4CKQA 1P6CA 1OY0A 3EDJA 1RT5A 5FJ4A 3BGGA 2J88A 3U2OA 3PRDA 4JV2A 4UBPC 2WB5A 1QW9A 3I56S 2YKQA 4O3PA 3C2PA 2OU4A 3QGHA 3CPGA 4I5XA 1O12A 4Y8FA 5GAGI 3HP6A 2XZTB 1IT0A 4LREA 2NZLA 1KLYA 2BE9B 3BXWA 4PRRA 1WAWA 3MYPA 1B3OA 1LZOA 3IANA 2A3HA 3MCOA 3DLBA 3BSHA 3WQ4A 3A3HA 1X8DA 4IMGA 3SQGB 1VK3A 1LWHA 2ZX6A 3WQOA 1EHWA 1WG5A 1TKZB 4RNIA 1JLEB 2RRBA 4DBQA 1V5VA 5CZSA 3UZ5A 3LALA 4GI4A 4H8UA 1REQB 3KUMA 1H98A 4DR7J 1JCNA 1WKFA 2CETA 5J2MB 2FB0A 1YJUA 4LUTB 4N6FA 3QHNA 4R5PA 1GYNA 4ID5A 4ETZA 4LW7A 4RKAA 1I1GA 4D1IA 2J0XA 2PN6A 4WK1A 1MW7A 4U67Q 4CNTA 5D37A 2MQMA 3FJ2A 1J6OA 1G7UA 2XYLA 3MAQA 1RAOA 2CZVC 4IPNB 4NVTA 4RUBA 2ASHA 1DTNA 3KP1A 1RT5B 1XIDA 3TWBA 3NLCA 3K5LA 4RZ5A 3FV9A 2ZKTA 3RRGA 3M1VA 1HW6A 4DPQA 3B03A 4HPJA 5CPQA 1VLWA 3OBAA 3ME3A 1NU5A 2GJIA 3POTA 2YNHA 2VONA 2Y5SA 2VDGA 4DEZA 2XMKA 3W28A 2DNKA 1DJIA 3BANA 3MAAA 2FVQA 4LCQA 2YL6A 4PR4A 1U02A 3DGPA 1TL5A 1XFCA 4RBUA 4CLKA 1ZAXA 1DWJM 3LQVA 5DLGA 3ZJ7A 4FXFA 2WBRA 2R7RA 3EX7B 2AGQA 5B0EA 3PRBA 2CNLB 5D2YA 2IFXA 4X4OA 2DXFA 2Y7EA 4R5PB 4GIRA 2V2KA 2QMJA 3EEZA 4ID5B 2VFFA 2B9XA 3LGEA 4LBUA 1J79A 4S3JA 1CULA 2IVYA 1KM6A 4AZBA 2K2PA 2AL2B 1KM5A 2XUCA 3EMZA 3CJ0A 3DGBA 1HJWA 2ZWOA 4M6QA 2C2RA 3NL2A 1RTIB 3H12A 3OXFA 7PTDA 1DARA 4C48A 4LNYA 3MUY1 2F8HA 1EF3A 2WVCA 2E6YA 1M5VC 4PMOA 2BW7A 1ROFA 1N5SA 2XMTA 5AC6A 3T4CA 3D6FB 2JZ5A 5KFEA 2CLHA 1F9CA 3I4KA 1PKUA 4IRDA 2KRRA 3POTB 4W87A 2YNHB 4ALZA 3V81A 1N5YB 2I9SA 2HK0A 2OMLA 1NUEA 3CTRA 3ES7A 2VC9A 3MAAB 2ESCA 4ZOCA 2MTLA 2UVUA 2J7KA 3NGUA 3MHYA 2PTZA 3B9AA 2AYEA 3DGPB 1S7HA 3KLIA 4MPKA 4PABA 4DR4F 1ME8A 3EA2A 2UUWA 4NLTA 3L5MA 1B30A 5CG0A 1XYCA 2Z58B 4AF0A 2DSKA 4EPDC 5CBBA 1UMJA 1QK0A 1Q16B 5DRCA 4A35A 4FPIA 4GKTA 4B4HA 3GSDA 1VC4A 4FNSA 2DXEA 2MKHA 2BS9A 2VICA 1CULB 2P1FA 4DRSA 2VT0A 1SC6A 1A49A 3NWRA 2CPZA 3ARXA 2Q1LA 1Z2ZA 4KQZA 2R7VA 1TAUA 4KCUA 2DCLA 1VHCA 1PKYA 4LALA 1NK5A 2FVRA 3LLDA 3GVVA 3T9PA 3F4NA 2FTYA 3A3WA 4CQ9A 3GHUA 2NV1A 2HPIA 3NQAA 4DUZJ 4L1XA 3WQEA 2HS3A 3LANA 2CQPA 2EFQA 4W89A 1IKWA 4CD4A 3ITXA 3PZUA 1VFSA 3HHLA 8XIAA 2IHR1 5J1PA 4MNMA 4H9ZA 4F02A 3OVQA 2ZTKA 2BX7A 3LQGA 2PMZD 4L1GA 1UHVA 5D32A 3EOUA 3KLIB 2Z4PA 4QM1A 1XM3A 1EC7A 5GAEI 3CUFA 1ALDA 4AF0B 3NZGA 4LUIA 1WO2A 1L0PA 4H6RA 3TMQA 3EWWA 2BJDA 5BW6A 5AXMA 5E41A 4H7VA 1W3NA 2LP4A 2AYBA 4P71A 5AECA 1CG2A 2VFEA 4DR5F 3MSGA 4OV9A 2VI0A 4ILRA 2DHGA 1W3JA 3M8RA 1NB2A 3H6OA 3NVDA 1G4SA 3GJRB 2QIIA 5FF0A 3EA1A 3P6YC 1OBAA 5LGXA 3MUXA 2Z4GA 5J1EA 3OSNA 1HJVA 4FNPA 1H2TZ 5KFRA 3CHEA 3ATZA 5KFJA 3G6LA 3DN5A 1OX4A 3QIPA 2QNEA 2OR2A 2W4CA 4ELTA 4G8TA 1FNOA 3GM8A 1IKWB 2HXUA 3HHLB 1U49A 3CTLA 1ZPTA 4EX4A 3BH6B 2D2GA 4F2RA 4R34A 1KWKA 1X60A 1KM3A 4R85A 1PAEX 3E2SA 4DF4A 1QRQA 2QCCA 1E9YB 4D71A 3F03K 2JOQA 2RMLA 2HRWA 4KERA 1MUWA 3N3TA 1BG4A 1TUXA 3UCDA 5B0GA 5HMFA 5K4ZA 3WQVA 4WLCA 4BHQA 1IYXA 4Q8OA 3CUHA 4CLWA 4TVDA 2PWHA 1NJWA 1Q85A 3NBPA 5IS2A 4Y0FA 1S5VA 2D3NA 3BDEA 1G94A 1R3RA 2DGAA 1WBJA 3W24A 4DSEA 2A10A 3K8VA 5ETQA 2ZE3A 4H9UA 1EXPA 3KMSA 4NE9C 4N02A 4J4KA 1WDRA 3OSPA 1XNRF 4DSFA 3CGTA 1EJTC 2I56A 4KFBA 2EC2A 4Y8EA 1IJFB 2V50A 1Q7QA 2Z2BA 3DX5A 1PAUB 1J2BA 4IP4A 1IZKA 3RBDA 2B4PA 3I5BA 1H7OA 5HBFA 5F1UA 2QLWA 3PUEA 1RVKA 2VFIA 2E9ZA 4AEEA 1LM1A 3F4DA 2N3LA 3UVJA 2R7UA 1X4FA 2A3LA 4P8VA 3KS5A 3C0SA 4YYFA 1C93A 2AJQA 2JKEA 4CM2A 4BI7A 2HVNA 2W66A 4J9SA 3BE7A 3AMCA 4H7CA 5L1KA 3QZEA 4TKTA 2RB7A 2VFSA 1YITS 1C7TA 3WUFA 4JQAA 1RSCA 4O15A 4Q4QA 3WF4A 1F2HA 1K6AA 4CCHA 3WQGA 2JX2A 3FW6A 4TY8B 4Q4SA 4BWMA 3E0LA 3NBPB 3S1UA 4LV9A 3D47A 1EKSA 4DL7A 1THFD 3A3PB 4K2JA 3M7WA 5KFSA 1Y00A 3B9EA 4ELVA 4PXBA 1FWKA 3HHDA 1P0KA 1XDJA 2PEHA 3BPDA 3W2VA 4QS6A 1S1PA 1PSDA 4KFBB 3IIXA 3VD3A 1KLMA 4LMZA 2DORA 1S59A 2IPJA 1OQ3A 3IM8A 3O1NA 4YHHJ 2KO1A 2R24A 3ZYZA 1O5XA 2D3ZA 4BCEA 2EK1A 1H7WA 4F4XA 1B3YA 3ALFA 3UCUP 3P96A 3TJ9A 3W01A 2XO6A 4NNBA 4LF5F 2K3KA 4XDCA 4B9ZA 4KRUA 2NQZA 1ISVA 2L9DA 3SW6A 3L66A 4ROPA 1VHNA 2PC6A 4HYKA 2XS2A 4C1LA 4MLRA 3G5EA 2XTKA 4YXGA 1PDYA 3VZYA 2XLJA 2AAMA 1KP6A 3PJWA 2AX0A 1AZ1A 2CDQA 5FKYA 3SEPA 1GVEA 3H98A 3LW5C 4USIA 1PSCA 4JTIA 4IICA 1BQNB 4KGZB 3F4VA 1XLMA 2K1RB 2INZA 2ZITA 4A8KA 1SQ7A 3DENA 1HTIA 2Z0GA 4F4WA 2GSHA 4QX4A 3GG8A 4WXZA 2FHKA 3LRMA 1G9HA 4DR7F 1U33A 4GC3A 2HHHJ 2D1ZA 4AY8A 2NT0A 3KK3A 1AQFA 1KLMB 4BDPA 3GU2A 2V3DA 4GABA 1PXGA 2EGZA 4FF2A 1WC1A 4USHA 2QDEA 2YA0A 3DFPA 3H5XA 4F4YA 2RDDA 3DCAA 1AMYA 5IM51 2MQNA 5L46A 4REQA 1TL7A 1TPUA 4H00A 3IWXA 4MY9A 4DZ6A 2WMKA 1DWIM 1QSLA 2GS8A 3P60A 5C0QA 2XFWA 4ICCX 6PTDA 3LN3A 2WMFA 1VHFA 4RW9B 3ZXWA 1X8FA 2MMYA 2VJVA 1XPGA 3D3AA 2EBEA 2FB3A 4YTTA 3C86A 3HF3A 1ADOA 4CIOA 1RJPA 2XG9A 5LHEA 3W7EA 3CUJA 3IJ7A 4O1FA 4IXXA 4IIBA 2OHDA 4DN0A 3PPGA 1Q53A 3VGBA 3D1QA 1EGMA 4AIBA 3EM1A 3CWOX 5FCZA 4LF4J 1S5WA 5HQ8A 3TA1A 3ES8A 3AZRA 2E1MC 1F5ZA 4W4QA 1VMBA 4NA3A 1NTHA 3FVDA 1UPPA 1T0OA 4FXVA 3QMTA 1V3RA 4PKDB 1AD1A 1V7AA 3KK3B 3D2WA 1ECEA 3BKTA 1NSKL 1C8VA 1K9TA 4RR5A 4AY1A 1D0EA 4O0QA 3EPGA 1IBMJ 1UVNA 5ABHA 1CS4B 1WKLA 1V6VA 4XSMA 3T07A 5CEWA 2NXEA 3E38A 2WC3A 3PTDA 4U3AA 1JYNA 2WWDA 3ITTA 2QA2A 3CMFA 2VD8A 4DCPB 4TR9A 5E9AA 3OVPA 3E2QA 1S4FA 4RDWA 1OGSA 4OFCA 4O4GA 3BLDA 4F3QA 3QT7A 3CXCR 4KSEB 4NLUA 1XIHA 5AE2A 4TQSA 3DHWC 4A8YA 1N6QA 3VFCA 3I6EA 3NS7B 4M1KA 2RH3A 3W73A 4G5DA 1RT7A 4ED3A 3I0RA 1KFLA 4HKPA 4XKYA 4Z1DA 5HBMA 3EGNA 5A8RA 1S10A 1ZJAA 3WDJA 5KFGA 1KTQA 5TNVA 4F26A 3C52A 4Q2LA 4XD5A 3TP2A 3M6YA 3NSNA 3E8OA 4A48A 1I6JA 2OMAA 4ELUA 1T3NA 4I5RA 5CLTA 2DO4A 4YDDB 1MWQA 3GK0A 3C0QA 5IWAJ 5FJPA 1KQSR 1FCUA 3L4XA 1NU4A 1U09A 1WP6A 1YBQA 2OT0A 3TA6A 4FZVA 2B43A 1NDZA 3SCIE 3UWWA 4EAMA 4RNOA 2P76A 1JZ8A 4UNLA 2I38A 4NLQA 1FVQA 4MF4A 4DN1A 4AYGA 1MW0A 3GNNA 3PBYA 1CNVA 2JK2A 5G1TA 1D7KA 3AIUA 1ZBVA 3UBPC 4X62J 3TTOA 1FCQA 2XVNA 3DKDA 5IHSA 4DUZF 2BJEA 1R3VA 1PTGA 1C2PA 3OFHA 2PGEA 2EKGA 2WZ1A 4DPWA 1C8QA 2ZWYA 6ALDA 4I9TA 1YEYA 2Z29A 1N6QB 3CZGA 5IHRA 1H2JA 1AL7A 3N6MA 4A8RA 1WDTA 1RT7B 2OIHA 3I0RB 2Z7GA 5C54A 3ZSTA 4AZCA 5THWA 3CCWA 3T3FA 1TR0A 4NEZA 1JCYA 2PDGA 4NRSA 1QAJA 3BMWA 2VPZB 3W75A 5DDQC 2P5VA 3FLUA 4WVXA 1RT3B 2VGIA 3W9ZA 1V6HA 4KGLA 3K30A 2MGZB 1LUCA 5F3TA 4JX6A 5DY2A 1YBQB 4CP5A 3ERPA 3DYMA 4F9DA 2ZUTA 2LVWA 3SAZA 4JTJA 2LDYA 4JB8B 3CU2A 1OPZA 4HACA 2LU2A 1NIUA 5D4LA 3PFMA 1T6MA 4GMKA 3HK2A 1OFDA 1M1HA 5D33A 3TCSA 2Z1KA 3MM6B 2HSEB 1J2WA 3AXKA 4W7VA 4AD2A 2OB3A 2ZVIA 4YVVA 5KFBA 3TXZA 1KLZA 4LS0A 4LYPA 5HWJA 5BU9A 4C5YA 3QFHA 4UTGA 1VYAA 3PHAA 4GGBA 2XIQA 4C11A 2VOTA 2BQRA 3PN8A 4PRWA 5LSLA 3JTNA 2HIQA 1OQFA 5LSOA 1ZU8A 1TPB1 1XDLA 3JSMA 1B90A 4EK7A 2WVSA 3M0IA 1HN1A 4BQ2A 1Y5IB 1S2UA 3EKZA 1G0CA 4AZCB 2FHJD 3BKUA 3H2CA 5L6UA 3AJ1A 3CV1A 3FGCA 3W2JA 3TTEA 3TEHB 3K8KA 3N2XA 4JEQA 3URBA 4NI8A 4YYCA 2BJ9A 3SSRA 1VR6A 4YP3A 4WJXA 2YKNB 1HA1A 3MY9A 1SKWA 1KCLA 1LUCB 3RUBL 1BTMA 3AFBA 2DGXA 3KLVA 3LCXA 2DPJA 3GB0A 1UBSA 4U5IA 1QK2A 3WF2A 4C6QA 1WDWA 3MHGA 3ITHB 3IJ6A 3LHVA 1P0DA 5U4NA 3MO7A 2EFVA 3IRSA 4JY9A 4HACB 4DJEC 3C2FA 2FZGB 4K4VA 2JLEA 3HGSA 4YY3J 1FHTA 5FJOA 1ICSA 2E1RA 4USTA 1HKIA 4C6EA 2H65B 1P8GA 4ASTA 1RTHA 2XU2A 5LA0A 3NGFA 1KQKA 1S1VA 4HSHA 4WFAQ 2C1GA 4HMEA 2DJLA 2ILZA 5LGZA 3DFEA 4C11B 1Q5VA 3VHQA 3WX8A 8XIMA 2VG5B 1FJ7A 3K46A 4DJFD 1EJVC 2IQ0A 2PO4A 1XQLA 4FXDA 1XISA 1KFEA 4HJWA 2QJGA 2BXVA 3JSMB 4MTVA 1YIXA 4HK7A 4KEZA 4P5UA 4YMZA 5L8RC 4K4TA 1IQTA 1K9MT 3JYTA 4LQ1A 2QA4G 2CLMA 2VELA 4JTQA 3KTQA 2IRUA 5A3HA 1Y5NB 2PDPA 5HL7Q 2X41A 3R43A 3PZ9A 3M8QB 3OLEA 5E0FA 4GH3A 4Y9OA 3FOKA 4KMQA 1NHUA 5JH2A 2OG9A 4I9MA 4W86A 1DIEA 2VD3A 3R27A 2N7YA 2DJXA 1QCWA 3NEVA 1FJGJ 3UN5A 4HA3A 3VU2A 1ZZFA 4G1PA 1UVKA 4S3DA 7REQA 3DRXA 3C14A 1TCDA 1H1YA 3GC4A 1S1TB 2O01C 5BRPA 4EO8A 3F44A 3W74A 2X2YA 4K2SA 3EAUA 3EXSA 3QPEA 1JUBA 4YHHF 1QOXA 2BQUA 6REQB 1TPC1 5GJPA 5TIMA 4EZ6A 1TE1A 3B0XA 5HJYA 4HHLA 4JDBA 3P84A 2BXJA 1GOKA 1S1VB 3G8QA 3OTCA 4L64A 4UFKA 1RT1A 3K1GA 3RJXA 2YIHA 1NM9A 1XUZA 4RW7A 3AD9C 4IH7A 1C29A 1U0HA 4PYDA 3PPHA 4JPGA 1FEHA 1I8JA 2C1IA 1HGYA 2BRLA 2PP3A 3K8MA 4JICA 4UFLA 2R8HA 2A0NA 2V0TA 3SI9A 1GVRA 3TZWA 5F8JA 4U96A 4HVXA 2ZH1A 1E6YA 2WAQD 2ZD1A 1W1A1 2Y62A 4G56A 1S79A 4AE5A 4D8ZA 1EJSC 4EF9A 4NT0A 2GVLA 3GX9A 5T8GA 1DE6A 3HZEA 1ZA2B 2OZ8A 1PHWA 2OMOA 1PKLA 3FSTA 1P4CA 3HZ3A 4LIWA 1CEOA 5E3RA 4L9XA 3LTOA 2NQ9A 4M51A 4N47A 2HHHF 5FA5A 3CT2A 4HA1A 1O5RA 1HLWA 2ONEA 7REQB 3C14B 4O4WA 4A3YA 3N6HA 2ZCGA 2ZC3A 2P9EA 4TU8A 3CC2S 3BZGA 1UA3A 3W2KA 4M8LA 3IAM9 5KFAA 2QL9B 3THPA 2PI6A 2HHXA 3P8BB 5IOLA 3B78A 3B8HA 3MUZ1 1ZTVA 4TOQA 4KKOB 1RT1B 1EBHA 2PODA 4M80A 3FSXA 2OTJS 1D8YA 1VRUA 2X1UA 3SN0A 4TU9A 2HWIA 1U0HB 2Y8UA 4GQ0A 1HKJA 2DD8S 4K8RA 2QCNA 4JIPA 1JPMA 4OFZA 1L5UA 2NUUG 4LB3A 2ZZ3A 3G9CA 5D04C 3S1GA 3THCA 3U7VA 1BFNA 5BCAA 3M2RA 1LOSA 5I42A 3K59A 4GO9A 2ZD1B 2VFTA 4M6VA 3WD3A 4XVDA 4J9PA 4NOHA 4CD5A 4QBXA 3H55A 3TVKA 4OWGA 1Q63A 4LF4F 3GHSA 1JRBA 4O8RA 5K2ZA 1E0UA 5AC4A 5D2WA 1F3XA 1S9GA 4DUYF 2W3ZA 4HGXA 2HFVA 3ZO7A 1V3JA 3G6VA 3ZJKA 1P6TA 1TPVA 1QJHA 3VGDA 1A3HA 1D8WA 3RCNA 1KFCA 1BPLB 3QO9A 2H8XA 4HBKA 2AJ1A 1GMWD 1HWJA 2A3BA 3CJ4A 2PWGA 1GGOA 1RK8A 4DL4A 3LZ3A 3T55A 1IBMF 3NDYA 4DZDA 3UVAA 1HNWJ 3R1HA 3MWCA 2XGIA 1ME7A 1VLOA 1ELOA 2HJPA 4ZLNA 1VRUB 1R2TA 1SKUB 2DEPA 1YPFA 3TSDA 3WD1A 4DJDA 3KLKA 4JQ2A 3VOHA 2W2MP 2Q8XA 1LOUA 1TWSA 1HARA 3GYCA 4OGZA 3U7BA 1ONXA 3N6LA 4LSNA 3BVJA 2ASDA 1S5MA 4DR1J 1GPWA 1X4CA 2C22A 2Z0IA 3RB6A 3TZFA 1CJUA 4I2QA 4DV2J 2Y4SA 4G1NA 3T1YJ 1RP9A 3CEUA 4EEYA 1KR0A 5K7JA 2X0SA 2HRUA 4DQIA 4JI2J 1E5JA 2GWGA 4WSKA 1QAIA 1S9GB 4IDKB 3K13A 3T44A 4HN4A 2M8DB 2QMUB 2HFNA 3I7SA 4AY7A 4BQ3A 1BGXT 2ISDA 1XTZA 3SFGA 3W1NA 5HK4A 1TPWA 2GZOA 1CXIA 3SZ8A 3T42A 3KNGA 1BXCA 4PCTA 3LI0A 1JUKA 1ICQA 2O4QA 3V16A 3UVIA 5A8OA 3UN2A 5I3DA 1O94A 1KA9F 5IWAF 1YK9A 3E2EA 2G4BA 3Q8QB 3GXFA 5C2GA 3BGUA 1T41A 3SFUA 1E0VA 2CLEA 2E1CA 5U7SA 3M32B 5I23A 1E6RA 3LV5A 2P6TA 3ZQ9A 4WP3A 3O06A 1RT6A 3GFHA 2DT2A 2CPEA 2AOSA 4X62F 4KGXB 3WLHA 1RJJA 1R86A 5E0KA 3CDEA 4JI3J 4HP5A 2WZTA 1A5LC 2YDSA 1PX4A 3PZMA 2VZSA 3NO3A 4QZVB 4WKYA 2Y1JA 4D6GA 4LSNB 3TAMA 4U4MA 1IWPA 1SW0A 1C1CB 1S2WA 2BABA 4B5VA 3W9HA 1JLCA 4YN3B 4ZTYA 4YR2A 2LQBA 1A6LA 4HYVA 4R25A 1BSLA 2D41A 3AHPA 2CLIA 3BOFA 5HR7A 4NPOA 4D9PA 1XMQF 1Q13A 3S01A 5AYZA 2FVMA 3HSZA 4X2PA 5CJNA 3W1TA 1TZZA 4N7QA 1QATA 3IGXA 3W7KA 2HBZB 4O8AA 4PCNA 4ES2A 4F79A 1K8ZA 2UP1A 1L2QA 4JKKA 4ECUA 1S12A 4PQAA 3TXVA 2FC9A 1E6NA 5TF0A 2K7KA 1W5QA 3VCRA 2IM1A 4C9DA 4RX6A 3STEA 1PHQA 3MI7X 2OXNA 4IMDA 4JXCA 1RLDA 1RT6B 1GVQA 2W9MA 2WNNA 2LXFA 2QGYA 5KG6A 2B8QA 3PW7A 3R8YA 1VQ7S 5D2XA 1I0DA 1TV3A 1K73T 4ZPTR 4N9DA 4ZLPA 4TV6A 1JXJA 3TAMB 3HBLA 1HWUA 4KRTA 3FMBA 3NG3A 4OECA 2BM0A 3UGRA 6FD1A 2BSLA 2A2DA 1CJTA 2KG1A 1RAFB 3C2YA 5K8NA 3PZQA 2AF6A 1TKTB 2D22A 4F4KA 2W4PA 2V68A 4CLUA 1J0JA 2PDFA 5BMXA 2WVUA 2WYSA 3HOJA 3S1VA 4DUWA 4IPJA 4FBUA 3W2WA 1C8YA 5CKSA 4D6CA 1L3SA 3DI1A 4NAFB 3KE0A 2KVIA 1A5KC 3K5MA 3N17A 2DR9A 5XINA 2FTPA 5A6SA 1KBBA 1VJWA 4ZQNA 5HNTA 1APSA 1NJJA 3MA8A 5CZJA 2CQHA 1Z3NA 4Y3CA 1NARA 1ZBWA 3PO5A 4JR5A 5CJ5A 5H9EJ 4LOCA 5KOWA 1DJWA 3MB9A 1AXQA 1G2EA 3QKZA 2J47A 4YY3F 4QJVA 2EEXA 4JFVA 4MZ8A 1W5PA 5DT7A 4MWAA 2Q79A 2QJMA 2DHHA 1N33F 3S3GA 3L7PA 1R7IA 5BJRA 2E9MA 4CZCA 3WNMA 2IPWA 2FJVA 1QJWA 1Y3JA 3P5TL 2C2EA 3KLEA 5J04A 2ZA1A 4ADTA 2RQKA 3MMBB 4EZ9A 3PZTA 2VPXB 4LVGA 4O57A 1QXLA 2Y0BB 4GVBB 3ISIX 1NZ8A 3GHRA 1SV5A 3ABRA 1E6XM 3WLMA 2DGVA 5IQ6A 3RPMA 4DAIA 1CJTB 1AD4A 1JRCA 2IVMA 3MR3A 4WDXA 1SUQA 2E8ZA 2E5IA 2KL8A 1F76A 2HQCA 4NLVA 1H2UX 3LHYA 4MVAA 2P9GA 2W92A 1R2SA 1URRA 7FD1A 1QD1A 1LEOA 4A8WA 5I77A 3LBMA 5F8NA 4OBRA 3AU2A 3W2WB 3C6TA 1N5QA 2QLFB 3GXNA 1OX6A 3MD1A 4NYOA 5D0GA 4PQUA 3N11A 5CPTA 2B4VA 3W1MA 4CLYA 2ZH6A 2ZDSA 2ZICA 4KCTA 2C2OB 4WY0A 5AC5A 3ZWSA 4H9TA 1EP3A 3QLLA 1FJGF 3RLVA 2B7BB 2HNHA 5E0CA 4QLKA 1GTEA 2ZIDA 4GWEA 5EWEA 3FEMA 4CNOA 4MWAB 4J3UA 2WQPA 1O95A 1XC4A 3GLCA 4Y00A 4YTQA 3WQWA 3OXGA 2YH1A 1OSEA 4IIEA 1SU5A 3ARTA 2OQHA 3W6YA 4ZCKA 1UWAA 4QIEA 3BYRA 2B9EA 4B15A 3GV8B 1PO9A 1Y5WA 3HG5A 2XWDA 1C7SA 3FYPA 1PBUA 3M7SA 4FIRA 4YFUA 1AB8A 3NL6A 5C2XA 1SV5B 2CKSA 1LOLA 3AXXA 3FNNA 1S39A 3OJUA 1W9BM 3E9AA 4MM1A 2B5JB 2ROGA 4MH8A 3CCLS 4P2MA 5KFPA 1F73A 3IN5A 3SCLE 3LCFA 2MQ8A 3UD4P 4HI2A 1FWFC 2V5BA 2L9WA 2C0HA 3ZTRA 4F4AA 1Q6CA 3WMBA 4CU6A 2QSWA 3W66A 4FYDA 1XXXA 2VKZG 1WI8A 3GILA 5LZLA 1OZMA 1P9YA 4PQUB 3VVGA 5TQLA 4ZJLA 1CC7A 3ENWA 3PFEA 3RN6A 3CIVA 1T5AA 3JVAA 3I3EA 5I4MA 4LUSA 4S3FA 4JN7A 3HHLD 3IWNC 3QGAC 3WLOA 1NHKL 4TVCA 5CPOA 3WH7A 1OC7A 1KM0A 3IVSA 3DLJA 1D2KA 4LRSA 3VIFA 4E3VA 3RYSA 2XNQA 2R91A 4Z7CA 4PWWA 1V3KA 4GD0A 2DGOA 3LOUA 4ZVFA 2GVZB 2H9ZA 2BV9A 3HQ1A 5C24A 3OVBA 2A6OA 4FS1A 5I78A 4ECZA 1NSQA 3CTTA 4GE8A 4XQ6A 3SB0A 4UQBA 3P3DA 3AXHA 4C7DA 3TC7A 3W7MA 2DNQA 2V8GA 4GA8A 1XEZA 4Z2KA 2F1FA 4LVOP 1WHYA 3WUEA 1NAL1 5G4HC 2EG1A 2HVIA 4CLZA 1X7FA 1DQ8A 1V9OA 5HWMA 2X1RA 1BQMB 3LGMA 4RPPA 2KYXA 2H5EA 2YCEA 5A8MA 3J81U 3C0LA 4Q8PA 3UXIA 3YPIA 3IGNA 5HI7A 1XN9A 4CLLA 2FZ8A 4EPKA 1UKUA 2HMIA 1AUSL 4TMBA 4LUSB 1KBLA 3GTXA 2GJRA 1VI7A 2JNJA 1HKWA 3GXTA 3HT0A 1H0GA 1U6ZA 3CCRS 1ME9A 4MDOA 1NO8A 1U7LA 3HTWA 3AZTA 4M3PA 2BNJA 4GX8A 4ZOEA 1T95A 3H4XA 3MHFA 4GFSA 1GEQA 3IUIA 3V35A 2BBFA 2OCZA 5KFTA 4YS1A 5C24B 3M0KA 4PGLA 1H7RA 1LRQA 4LAUA 4QW8A 2R9LA 4E0DA 1HNZJ 4IP7A 2BW2A 3NNTA 5HVGA 2I2YA 3H2MA 5M2FX 1S77D 1TAQA 2F8QA 2FHCA 4PSRA 4UWMA 3VGEA 5DT5A 1O4UA 5A2AA 1P43A 2FLIA 3OU8A 4DR1F 3NP5A 1M7XA 4LNCA 1M0SA 4DV2F 5I2UA 1NWTA 3T1YF 2I16A 1KBIA 3PTKA 4IHCA 4EYIB 3B8WA 4JI2F 2YJQA 5HQMA 2G3FA 3D6NA 3WQCA 1XR6A 2B0MA 1XWLA 2B0GA 2HZAA 3RAXA 1OFEA 1JJHA 4ECTA 3SCQA 2IUZA 3T1HJ 3CO8A 4I8YA 4H9XA 4IF2A 2HMIB 1IEVA 4UTUA 1Z7AA 1W1VA 3WDOA 5D3GB 3MUCA 1RWXB 4IMAA 2B7PA 1M5OC 3TYBA 3K89A 1A5SA 4NQ1A 1MWYA 2GK1A 4H4IA 2DH3A 2I17A 3K5PA 3DI6B 3CQHA 5K20B 3R6IA 2BOFX 3ORWA 4B3KA 1RJRA 4QIWD 2QC3A 3MV11 4M5HA 4YB1P 2RKXA 1C4AA 4LRCA 1XINA 4LRFA 3A8IA 1X4DA 1Y5LB 4OYAA 4JI3F 1R8AA 1NB7A 5CSUA 3L5LA 2PA6A 4ES1A 1QI5A 1JCLA 3KOXA 3HD2A 4C0BA 4FLOA 4DWSA 2VHGA 3W7CA 3I0SB 1TTJA 3BWWA 1SH3A 5DG9A 3H5SA 1LLOA 1KKOA 3G3DA 5D9OA 3QMSA 3NGSA 1RV8A 1TQLA 4OE7A 3L4UA 3PFOA 3TFXA 4X64J 4IUGA 3WNOA 4OJ3A 1J18A 3PZOA 1B9BA 4O3QA 2ISSA 2YCLA 1CLXA 2ZBQA 3PIPQ 4IG3B 4UQTA 3VZHA 3DEQA 1YHTA 1M04A 2OJ3A 2MZJA 2EQDA 2A85A 3SCOA 1VQKS 1F6TA 4ZSTA 3A4XA 1HKMA 1EJRC 3OZPA 1R8LA 3AS1A 3VIJA 3LBCA 4C65A 4IH5A 5JXQA 3MI2A 2BY0A 4L7ZA 1T9WA 3ARSA 4O28A 4QLLA 2GK1B 2X42A 3VE7A 2B6AA 2ROEA 4QU6A 3BMVA 4C6LA 5A8QA 3DXSX 3LM3A 2WLYA 3FQKA 2HXTA 2WANA 3CH0A 3ONBA 4YLWA 2RDXA 2EXUA 4Q4RA 1OCJA 2C0AA 4Q4MA 1ADDA 3O9NA 3GY1A 4JFUA 4XD6A 3NL3A 2CQ1A 1V0NA 1NY1A 3WLRA 2DH9A 1S2TA 2I1OA 4JI4J 2VZTA 1MROA 2ZRXA 4GRSA 1OIAA 2CFXA 4ZCIA 4P7TA 2WB4A 3WHIA 4R9OA 1Q82T 4AD1A 2ROPA 2VPYB 1YLVA 1CQMA 4IFYB 3UZYA 3ENAA 1DFDA 4QDMA 2OVLA 3K4WA 1GH8A 2PD1A 3F41A 5CBJA 2PDUA 5FF4A 5CAHA 4IR1A 3WYZA 4WWSA 4WKRA 1AROP 3T8LA 2OQYA 3EGJA 4O17A 1AQMA 3S9YA 1K03A 2YCLB 3KBWA 4B3MJ 1SJ3P 1W1B1 5D15A 4HT7A 2FPVA 5ETNA 4RXGA 5B7WA 3IJDA 2MKIA 3GG7A 5IT4A 4Q0BA 3S6TA 3J81Y 4WK3A 2BHUA 4P74A 3GFXA 2CKRA 2HYIB 1RBOB 5LA1A 1RAJA 1KTCA 3E02A 3EGWB 4WPAA 2B6AB 5LSRA 1GQJA 3VYLA 1PJ6A 3FY1A 2V8VA 4CNUA 1QTMA 2EJ1A 3MZ2A 5GAGU 5A8GA 3GBDA 3AU6A 4WGHA 3HJFA 4J37A 3FIGA 2PPGA 2HBXA 5CH9A 2XTJP 1X97A 3O3RA 1QPQA 2J8AA 3M0HA 4Z0JA 3OHAA 1FDAA 4UR9A 1HWIA 1P9QC 1FH9A 1MROB 3KHJA 3NSXA 1FWSA 4O23A 1T9UA 3UF9A 1ZQ5A 4DNHA 1JI2A 4YHEA 2FZNA 4NL1A 3RM8A 5I0DA 3A3XA 4IMEA 1JZ3A 4GC4A 5ABFB 1UWSA 3IJIA 4IIHA 3AMGA 4I7FA 1POJA 1ZBKA 5KT5A 1VQOS 2CESA 1H50A 3EKGA 3RAOA 1A3XA 1XJBA 3W3SA 1GQNA 3BGOP 5GMEA 2X1AA 3CO9A 1KQGB 2H51B 1MMLA 2NX3A 4PMDA 3CDWA 4ICNA 1N34J 4XISA 5FF7A 5GQBA 2Q09A 2BFGA 2PMWA 3OUYA 1VOMA 3G1HA 3IK2A 3STPA 4TMCA 2WVVA 2V4RA 2EKNA 3MMDA 4Q0BB 3P61A 3ILLA 3BJFA 4CCZA 5HROA 3TVYA 2Z2YB 2GVEA 3S2CA 1IEXA 2A6LA 5A6WA 4WSJA 5AYIA 4K4ZA 3V6HA 1FDJA 3W8GA 2ILYA 1YJWS 3NQGA 3V5RA 3QZAA 1OYDA 1CDGA 1PCAA 2TAAA 1JJCB 4HMCA 3FKBA 1S9EA 4M5JA 4IJBA 4Z08A 3NFUA 2OLSA 5G1MA 1W26A 3IVTA 3PW4A 1BG9A 1E0TA 1C1BB 3ONQA 1K9FA 2IJRA 3SSZA 4JIQA 2YZRA 2IKGA 3GUGA 2YWGA 3CPWR 1PUDA 5HMYA 1Q45A 3UEQA 1UH2A 3DBPA 4LYKA 3D0GE 1TRDA 1TL3B 1BYAA 1X4BA 3VVTA 2VX4A 5CPMA 4ZENA 2BHZA 1VFJA 4LY8A 1CLVA 4ZGYA 4I7FB 2QCEA 3F5LA 4ZVGA 4CLSA 3SV3A 5KFIA 4CO4A 4IX2A 5LT5A 1YJRA 1UR0A 3CJRA 3R1LA 1BYDA 2H3DA 2GGPB 4O11A 5T14A 2R4FA 2CZFA 1QE1A 1U5JA 3HQPA 1VBHA 2ZA2A 5FJUA 3V6DA 3OUYB 5FD0A 2OPRA 2VC7A 1HJSA 5EMLA 3W83A 2RDWA 2WVVB 5GADI 4PMZA 5FJTA 5HROB 1FTRA 1MW3A 3DOLB 3COTA 3M9YA 2WNQA 4OJGA 3WELA 3QH2A 4BQ5A 2NR0A 1S97A 2KYZA 1YADA 3PAJA 5XIMA 5DQPA 2QJHA 4ALDA 3M0LA 5KFHA 1QHPA 1UP0A 3D3BJ 1VFMA 3ZZZA 2CNOB 4WCJA 1TJ1A 4OUIA 1A5NC 3RMJA 3S47A 2WOMA 1WF1A 5E0OA 2IKHA 4A4JA 4NZ0A 3POHA 4LR7A 1K9EA 1RPKA 3BICA 4C8LA 3DGVA 4UFMA 2GQAA 5F1VA 2Z00A 2PB1A 1M9HA 4V2XA 1E0WA 1DJQA 1Z4UA 4X66J 4FS2A 2O4MA 2UV8G 1T05A 3TX0A 1R30A 4M81A 1VK8A 1OM0A 2QYCA 2O3DA 1TKDA 4L74A 1T8QA 1VS1A 3VOJA 4O54A 3SDOA 3HSDA 4OYZA 1WUFA 1JWWA 3BEGB 1ZL1A 1DY3A 1DJHA 2A6MA 4ICLA 5LL6d 3MKCA 2OPRB 3K5XA 4NXKA 5LM7E 4PG4A 5DGAA 4ED7A 2RU9A 4IP5A 5EWGA 3GW0A 1ZAHA 4LYRA 2RQMA 4XWUA 2BOGX 2ATLA 4UOFA 2F61A 3KTSA 4X9SA 2GIFA 2WHOA 3IC1A 5DEZA 4BA0A 1IXOA 2JEPA 4ZLLA 1X98A 4UFIA 2NLYA 4DL0C 5AHNA 1UW9A 1BQCA 3QKEA 4R53A 4I6KA 1FHUA 3QYSA 2DNNA 4PEOA 2WOMB 1D3GA 1ONEA 1UMLA 2YL9A 5IM0A 2Q66A 1TWZA 1Q8IA 3WLLA 4GCAA 3LXAA 2RHQB 4PWDB 2PDHA 3NVTA 3MTJA 4PAAA 1BMQB 1NVMA 2PEVA 4O14A 4H54A 2D3UA 3R1ZA 4WEVX 1HF6A 4UTFA 2E4TA 2YZ5A 4B08A 1NK9A 4RW5A 3URQA 2C3OA 2HZGA 3UR0A 1HNZF 5C9ZA 3KJVA 2EHHA 1V6UA 3AYSA 4DG1B 5I3PA 3SADA 4NA1A 1R87A 5JU6A 1M5WA 1X4AA 4BQ4A 2IPFA 1Z41A 3TN5A 3CLMA 3LTPA 3QRHA 3NRBA 5IT9U 1ZALA 2DRBA 3UR3C 4K59A 4N9CA 4HH0A 1QR7A 2YXOA 1Z2LA 3L7UA 3FFIA 3SQOP 1U6FA 1MUMA 3R13A 3EGVA 1FWEC 5G0RB 5KFOA 3WQ5A 3T1HF 1AQ0A 4NXSA 3R5EA 1B3ZA 4I2PB 4AL6A 1QOPA 4S0MA 1IWAA 3BAXA 1UKOA 4Q4KA 3OL7A 4ZXOA 3TONA 5A8NA 3TUZC 5E33A 1XLDA 5IM0B 5J5DA 1EP4B 3LUYA 5EGYA 4P2SA 4ZP9A 4XTDA 2AV5A 3MVIA 2O9RA 2QJ3A 1FD2A 2J27A 2V2VA 2QAFA 4D3GA 5B08A 5CZKA 1ZYQA 3K2GA 2PI4A 4XPCA 3VIMA 4UMAA 2PGCA 2QXWA 3OVRA 1N0VC 1D1UA 5K4XA 3G18A 2HWTA 4DFKA 2JH3A 3GD6A 1DIKA 3FYOA 4O19A 5CC7A 3KCJA 4X0NA 2WSEC 2O9PA 1RAIB 2PTYA 1H11A 1XLCA 4IISA 2CG4A 2HFUA 1QVFR 5A1AA 4UMBA 4UOHA 3SO7A 2BV3A 4K7QA 1W1PA 1SO6A 2NUWA 2OGUA 2IMRA 5E7OB 3QV7A 4B17A 3RBEA 3CPRA 3M0XA 2FDMA 3LHZA 2HROA 3FKRA 3WLSA 1XCXA 2FTRA 1R0AB 2YQ0A 2ODOA 3EXRA 3FSUA 2NVAA 1U1OA 3DM2A 1JB0C 1XGDA 4JZ5A 3NA8A 3VXGA 5AVNA 2ZDPA 4USVA 3CUZA 4DSKA 4MDPA 1CGVA 3B9NA 1BWVA 2V38A 3RU0A 1Y4ZB 4ERAA 5FAJA 2FFCA 1X4EA 4BBYA 3OP2A 3Q58A 3CVKA 3STFA 3MECB 2PDLA 1FWHC 3PCOB 1RWVB 3LP0A 2DIKA 4XVEA 1VC6A 4JQ3A 3PYGA 4JI4F 1H7NA 1RABB 4B5UA 2Y24A 1WE5A 3W25A 4XD3A 2BBEA 4P73A 3C5QA 1XRTA 1RJQA 2DVIA 3WDRA 1Q4WA 4LSLA 2YQ1A 3W87A 3GVRA 3N9SA 1N4LA 5ABGA 3SIPB 4MT1A 4JP8A 3MWAA 5HXMA 3FDKA 3ALGA 1IR0A 3ZTQA 5A69A 1WKKA 5E5CA 4YWIA 4CN6A 4ED0A 3A12A 2HAIA 4R33A 3WZ0A 1RD5A 2XGZA 3TFCA 2QJIA 2WM0A 1VEMA 2IQTA 3ONCA 1KQZA 1O5JA 4JTGA 4W93A 2G4FA 4H4KC 4ZVTB 4B3MF 2IBKA 3JS3A 4ZITA 2NYIA 3BOLA 2BZNA 2WCAA 3A5FA 2XIOA 1V3HA 3TN3A 5JUVA 3I4EA 3CC4S 1DPMA 1XL9A 2BVTA 2GVGA 3DM2B 1SC4B 1NKCA 4RNNA 1FFWB 5EFDA 4WHBA 2AKMA 1XLBA 1UR1A 3VMOA 3Q8SB 2YXXA 2KXFA 3L5AA 2X8RA 4O12A 2XPKA 1HPZB 2ZXDA 4DPUA 1KCXA 4U3CA 3H2UB 4AWEA 3DBNA 3TO8A 2YQ3A 3IARA 1FHDA 3LP0B 3KWMA 4GISA 4RE4A 1P7TA 3GU0A 4F2TA 2GJ2A 2GC8A 1WSRA 4GVHA 2DNGA 2Z26A 1X5OA 3RRHA 4KFNA 1F7BA 3VGHA 4J9NA 2A6NA 3IGVA 3UCCA 3KDNA 4NLOA 2B9WA 1CC8A 4N5SA 3D46A 1M1KT 1FOBA 1QNPA 3G8SA 3SCJE 3O3LA 4IGHA 2DGSA 2JSXA 3CJSA 3EYZA 4PUWA 1TJPA 3CD6S 3QW4B 4WOQA 1E1FA 3GH4A 3TWZA 3SY1A 4F04B 1XSIA 2ZDRA 2ANUA 3QSIA 2I14A 3NL5A 2C2ZB 1K1DA 4UTWA 1N34F 3VIIA 3S5SA 2PDCA 1FRKA 4PB4A 4NIRA 3EDFA 1TV6A 1CZ1A 4HDGA 4HT3A 4YN5A 1Q66A 1NF0A 5AZ1A 1KTVA 4PC8A 1LV5A 4QYZJ 4DJDD 2YWEA 5BYWA 1GPFA 3ZT5A 1MEHA 4LF2A 2RS2A 1ELSA 2ZC8A 3WK3A 3SGZA 4KYZA 3QT6A 2CJQA 2PDMA 4GC6A 3NOYA 4KJIA 4Y7EA 2Q71A 3GC2A 4NXNJ 5EL1A 2QCFA 4W5UA 4C6IA 3EWCA 2PDJA 2Y3YA 5KINA 1P7TB 5IC6B 1FWWA 3CUIA 1QWGA 3SZ2A 4O4VA 5IOBA 4NLSA 3S6EA 2C3YA 5D8ZA 5KEZA 2JIWA 3BZJA 3O8WA 3WQFA 1U1KA 1UBPC 3S6DA 1HUVA 1R38A 3TYAA 2GHPA 4MHBA 3R89A 1VBUA 3RX3A 5KZMA 1MRAA 4RBTA 1RK5A 1EWEA 4OJ1A 4W8LA 3QPIA 1EX1A 1JYVA 3DHUA 2R3VA 2AMCB 1E72M 4LJMA 3I96A 1NOWA 1RBLA 4WKHA 5DDPC 2KFNA 5B0BA 4ETXA 3A9IA 3THAA 4AIUA 1QOQA 3CMJA 1TV6B 3I6TA 3HULA 4GH1A 3LERA 1FY6A 4KEUA 1GQEA 4JD4A 4F0LA 1XICA 4XBJA 1BQGA 3Q2DA 2ZRVA 4PUMA 2DR5A 5HAOA 3HVAA 4ES3A 4NNAA 3HKWA 4WQ6A 1S4EA 4RWWA 2FJWA 2GHVC 1IT8A 4GVGA 4D6EA 1XPYA 1B99A 3AYTA 9RUBA 4KIRA 4BS0A 2Z2MA 4CQ1A 5DM6Q 2GW8A 3TVZA 1W37A 3ISND 2VOPA 2J6TA 4ES4A 4P7QA 4ATWA 2RUSA 4KGKA 1L3KA 1AA1B 1DKWA 1G6BA 4X66F 3AIQA 3R25A 3CAKA 3BN7A 4ZPWR 3SM0A 3J7ZT 3H8AA 3M47A 1RDRA 1DQ9A 5AYBA 4QISA 2GFTA 3G0XA 3QPZA 4J9UE 4ENOA 3AO0A 3F4WA 2LQ9A 1FCAA 2MZSA 1DVJA 3AC0A 4ZP6A 1Q1KA 3SBMA 1ECQA 3LF0A 1H62A 1ZZMA 2NWSA 4CNNA 3MOJB 2OELA 1W9DM 4EI2A 5AT1B 3WBZA 4PFHA 2NCKL 4QBUA 1ISXA 1Y3KA 1Y11A 1RU2A 2KT2A 4YL2A 4QCEA 3H40A 3MAHA 5CSRA 3T0CA 1XH0A 3GZ3A 2PA8D 2UZ9A 1KM4A 1KM1A 3WENA 4NAEB 2TMDA 4QWCA 4NZ6A 1P0EA 2GO8A 2K7JA 2E9LA 1CGTA 3UYIA 4O1BA 1EX8A 1RACB 1FDNA 2ZQ0A 3R2GA 2UY2A 1XLFA 1UFKA 2K8GA 5FEPA 3GU9A 3KJFB 3FVYA 1FP8A 3PC0A 1KRBC 2ZRZA 4XO6A 2EFNA 3OA3A 4ZVPB 1VRXA 3C2RA 4GI8A 4I67A 3AS2A 1OFQA 2ALDA 2XYPB 3FBCA 5BYQA 2F8EX 3JUGA 1HGWA 3RPDA 3UWYA 1BGAA 5HJLA 4C6JA 3M5VA 1MW2A 1IQ8A 1KXTA 2QL7B 3CE8A 3BO4A 3JSBA 3BJSA 1TO3A 4CH1A 2EPNA 3CGIA 1JGIA 4DM2A 3CCUS 4IUFA 3EZ5A 3UJEA 5TD4A 4G9PA 4F8RA 4AISA 1IKXB 4MWAD 6XIMA 3GPAA 1R3SA 3DU6A 2DU2A 4HSNA 3Q8VA 1NXIA 3PBWA 3N34A 3P93A 3EMTA 3P8IA 2LECA 3QSRA 4H04A 3US5A 1M01A 1RAHB 1JDDA 3I5CA 3WK2A 2CLOA 3KK1A 1OYBA 3G1VA 1UJ4A 3U57A 4K50A 1Z6KA 2RGLA 3CQIA 1LW0B 2ZJRQ 4LAOA 1IWBA 4C3LA 4UQGA 2ADBA 5FL1A 4RNHA 1FE4A 3FJ4A 4HNCA 3FRYA 3KRSA 3O15A 3A23A 3NYZA 2ZZTA 4JKMA 3QM3A 2X0HA 3VD7A 3VGGA 3LA0A 5D9NA 3O2LA 2HFSA 3RG6A 1E4NA 4BEQA 3IS9A 1G01A 3NOEA 3TROA 1JAKA 1LWJA 4WRHA 1G5AA 4L80A 3BLEA 3WQDA 5T7LB 2G3NA 1LDCA 3B9DA 1XYMA 5DELA 3CJKA 2CNNB 4A22A 4H4MA 4KY3A 1WDPA 1QI2A 4XZ9A 2V82A 3I87A 3CCQS 4IGMA 2ZM6J 2WZMA 3ITLA 3UZXA 1VCGA 3WNNA 4MMWA 1Q6QA 2FJKA 1AODA 4GY1A 2QLXA 3V0SA 4GG9A 1I51B 1DHPA 1O7AA 4MB1A 5SUHA 1Q3NA 2YR1A 1P6WA 3B0UX 5F4XA 5HATA 3WBAA 2E1WA 3TW0A 5CD4A 1TB3A 3A21A 4O4RA 2IXUA 1KTNA 1UP3A 1LLZA 3B4YA 1IGWA 1GNKA 5E2QA 1A0OB 3WIJA 2IA0A 2J62A 2POTA 3IUHA 3EPIA 2HS0A 4LXFA 3I7RA 4GI9A 2VFGA 2FUG9 4LF7J 1RU1A 4A8OA 3GXDA 2L9NA 1ITQA 1JMTA 3RLGA 4GFIA 2X1IA 4X65J 5K9FA 4MYAA 1H0HB 5L39A 2QVNA 4ZEPA 1WELA 4DU8A 1DQXA 1LRNA 2V9KA 2OQLA 2DZSA 2QIWA 2QLYA 1CEZA 1U2FA 2FVKA 3PVFA 1QPOA 4MB3A 4LRDA 3C19A 1JKHB 4DUOA 3OV7A 2ZBTA 5FEZA 5H8MA 2G0IA 1VRDA 2Q6ZA 3IJ8A 4IR9A 3U7JA 1FVSA 4H1ZA 3CSKA 3EX4A 2PZ0A 1B7YB 3Q45A 1TPFA 4PG6A 4XAKA 2HURA 2BVDA 4F8XA 4QWAA 2UY4A 3PTQA 1FWJC 2V67A 2KX9A 3MV01 4LEQA 1JX4A 3HKZD 4USMA 3B54A 4O18A 4PRTA 3C15A 4N8NA 1DJGA 3BGRB 3BSCA 4FNTA 4CN1A 1PIEA 3BDKA 1KS2A 2CC0A 3PAOA 1MYRA 1V6YA 4L72B 3H5YA 1M41A 3OYXA 4RL3A 5E6YA 1R3WA 1KFWA 2N3OA 5E5NA 2AJFE 3GC5A 5T9CE 2BX6A 4ZJOA 4JTHA 1B31A 2Z27A 3OGRA 5D38A 4ZOAA 3VCDA 3EXCX 2DH2A 1YPXA 1G3OA 2B81A 4U9RA 3BAIA 4RPFA 4CTAA 4CT8A 5EGRA 2OSQA 3BG5A 2CYYA 3PYEA 3CHDA 3BR8A 3DLHA 1X5TA 3VNDA 1XX1A 1SIZA 3BO3A 3NKYA 2F38A 1YDVA 2MDAA 1JNEA 3T0DA 3T0BA 4B3TJ 2E1PA 3IACA 1SFLA 2OLWA 4FYYB 1Z1ZA 3QIDA 3BLPX 2MUCA 4DQWA 4G2DA 4D72A 2IA6A 4H4KA 2YA2A 3KKFA 3KVKA 4OV4A 2IPGA 2GA7A 2HS6A 3UW6A 4HU0A 2OKOA 5GJMA 3AIBA 3L0NA 1QASA 3SCRA 4DJFC 1NJXA 1YQHA 2A3EA 3PZIA 3C15B 1MN7A 3G87A 4S1FA 4IUOA 1WNEA 2XIIA 2ZZ6A 1ZBTA 1F4AA 2DZTA 2QVHA 2COLA 3GBEA 1WDQA 2CFFA 2FJXA 5D02A 1EQMA 5KOXA 3AAWB 3FSYA 1DEDA 3VNLA 3L9CA 3QSYB 3WEOA 4QG8A 3BG9A 5G4WA 1CBKA 2XB2D 3N9RA 1LW2B 5AE1A 3CCMS 5F7UA 5ETPA 1TREA 3DI0A 4NXNF 4QCLA 4RZ4A 2DQWA 1GZJA 1IEWA 2W0UA 3TW6A 1AH4A 3TYTA 4C1KA 2ADAA 4BWLC 3UNGC 1VFLA 2CJXB 2PA3A 5CC5A 4JN8A 1TKXB 1XR5A 3R10A 3CYVA 5REQB 3T2QA 4ZHRA 1GTHA 4Y34A 3OLDA 4FO4A 3N4FA 2BHYA 3N12A 3GTYX 1H1NA 4GQBA 2XGPA 4JIRA 2HHSA 4XAYA 1JXLA 4UNIA 2J0SD 3O16A 1RWMB 1Y0HA 4FYWB 4PMNA 2YL5A 3TEVA 2U1AA 2F4VJ 2VFVA 1RAKA 3LYEA 2C7FA 3VNIA 4YTRA 2I5JA 3NAVA 1AH0A 1CBGA 3RU8X 4C8NA 4QWEA 1SKRA 5CLWA 2RF2A 1QLNA 5FJRA 2OAUA 3CZKA 3DRPB 5C6MA 3VKAA 4OKDA 1NP2A 2FYXA 2HNYA 2HZCA 1XLIA 4UOJA 4RDYA 3KRUA 3W86A 4J9VA 2YA1A 4F2SA 4Q22A 3ILJA 2GMHA 4DWSD 2QV6A 3HIJA 3MEGA 3PM6A 1X1OA 3D67A 3WDPP 1FD8A 3NURA 3FKKA 3U48A 2EC0A 4Q32A 2VCBA 2GOKA 5FDLA 2XIJA 5E3QA 1MU2B 4K37A 5FJIA 1KFBA 5AOUA 4U7UK 3R0KA 5J5RA 4A47A 3W27A 3LP2A 5KZDA 4ZHRB 2RQCA 1V3MA 1KD1T 3BUVA 2WAGA 4JL2A 3TU9A 4Y2MA 3UDCA 1XMBA 3RDKA 5DCEA 5DLCA 1QVGR 3FA3A 2JFKA 1KD0A 2IAJA 5DF0A 5EMKA 1FEEA 2CQ0A 3GR8A 2I5JB 2ATMA 4DL3A 1SMAA 2LXIA 1XYBA 4OMFG 4DBEA 1I0BA 1F3VA 4FA3A 2G13A 3LWLA 3EMCA 2HNYB 4IOCQ 4WR3A 3FEQA 5C42B 3MUIA 3MGJA 1GXLA 3DFSA 1R0CB 1B0IA 1F3WA 2DJWA 4QP0A 3VMNA 4Q8TA 3HVWA 1GVYA 5E3CA 1UQZA 2ON3A 3HQOA 4GLEA 3MEGB 2KFYA 3Q86A 2OGJA 3B8UA 1RYSA 1VBGA 4WDWA 5DQGA 4S3KA 4BLGA 4DPPA 1GX6A 1K0TA 5EMMA 3TNBA 4ED8A 5CJMA 3WLQA 1KV5A 1Z9AA 4CDIA 4F0HA 2M8HA 3UW1A 1FKAF 2Z8QA 2J24A 4DI9A 2HWHA 1EP2A 4IJRA 1AJ0A 4H8NA 4USJC 3WLIA 3P7YA 4ERIA 5CPLA 2A3CA 4OHYA 5LXEA 3G1AA 2KU7A 3PB0A 3KX6A 2Y8KA 1X7VA 2TYSA 3HVTA 1OZQA 3UWVA 1C90A 3SCWA 2LMIA 1EZWA 1AL8A 2C1EB 4K0KJ 3GIQA 4C1NA 1FUYA 1W8SA 2EXOA 3I6RA 5LNSA 2VDIA 5A2BA 4Q43A 1HQEA 3VQTA 4PCPA 1TA3B 4AD4A 4KKXA 1U1LA 4S3EA 2KHCA 1CGYA 1UP1A 4HSOA 2GJXA 4PB3A 1NH7A 1E15A 3EGZA 3FC9A 3RGTA 2ZUAA 4IL2A 3JTPA 1QHZA 2XH0A 1VYRA 3HB9A 2GMLA 2AKWB 2LA4A 5LKYA 4OZ0A 2BVZA 2ZE2B 5AXLA 4WXOA 5C71A 5CCLA 3S42A 1EARA 1RCQA 4JTTA 3RX4A 4ZPCA 4J2PA 3E1F1 3PPFA 3TI0A 4LAMA 4AUBA 1KDNA 3VIOA 3MR2A 1L2UA 3R6LB 1SI9A 4H19A 5CQGA 1V5XA 1YG0A 5HMWA 4E4PA 2JKAA 3UR5A 1YMYA 2V3EA 2VQUA 2MSSA 5A8WA 4DUTA 3EB4A 4MJ4A 4RV3A 1J0HA 4JX5A 2WO5A 1PX3A 4K8HA 2J7GA 3HVTB 3D9BA 2Q02A 3T05A 5F8HA 1B4EA 4E8GA 1RHKB 2H9AA 3UY7A 1J8VA 2MKJA 1T94A 1N54B 4WKAA 1HQEB 2YW4A 2KT5A 1ZSXA 3P0XA 3BLIA 1WA3A 3GNRA 2WSCC 1TVLA 2PDQA 2RGMA 3AHYA 3TTSA 3T0TA 2DW6A 4OI4A 4O0ZA 3HFKA 1E9IA 4UTTA 4PUNA 1LP6A 2GJXB 3OB8A 1VFHA 4DBWA 3L4ZA 3E0WA 5MLCV 3LA4A 5DDRC 1XIBA 1SFJA 2M3DA 5CYMB 1DL3A 4IFKA 3WN6A 2H4WB 1VH7A 3NO5A 3FCPA 4PCFA 3BSNA 1CJVA 2XSBA 3RXZA 3T2PA 4IIGA 3AQOA 4E8UA 3BKFA 1YDOA 4OIXA 5D6GA 4LF7F 4RO0A 3R8GA 2D74B 2VQTA 3EYPA 1OY8A 4DWDA 4X65F 4I6VA 3TSMA 4JN6A 4C6NA 3BQ6A 2J6VA 3BQ1A 1UWRA 3AJDA 1ZB5A 1MWZA 2MKCA 2JDJA 3BSOA 2B7CB 3QLHA 2GJPA 1VCFA 3GP9A 4DBSA 4B9TA 1FWLA 2F9RA 3DKLA 3DC2A 2DZAA 3DXIA 2FZMA 4Z1BA 4GVFA 4DV5J 2I9UA 2VRKA 3SDEB 1KXQA 3A5VA 3PK7A 1V3LA 2DEIA 3TYEA 4QJ4B 4OVXA 4LT6A 3LXCA 3GAYA 5L9NA 4NASA 1N36F 2DVXA 3IP0A 2BY2A 1DLOA 4R0JA 3W9JA 1TP7A 3MPVA 1ML1A 1JXVA 4Q2MA 3U2ZA 1JDAA 3WH9A 1NJZA 2WSQA 4GMEA 4LBRA 5BROA 2NSBA 4L9ZA 2I5GA 1EKRA 3PM9A 5FF3A 3WJSA 3R94A 1CJVB 3PV8A 4H9YA 2ABYA 3ZLHA 1UVJA 2GVDA 3GR7A 3G6ES 5CBIA 1HP5A 1ADSA 3DC0A 3VTRA 5I07A 1N32J 1VCVA 5D09A 2VVSA 2H48B 1XRSA 3BH4A 3PUDA 2JFEX 5EBAA 3U0HA 3WCZA 1OSCA 3W23A 1UJPA 3DAQA 2XZWA 1IXKA 6XIAA 1TMHA 3GYXB 4XD4A 3EX3A 5U47A 1WHVA 4O50A 4P2FA 5G2HA 1Q7ZA 3HV8A 4B3TF 3UCQA 5HVFA 2PEBA 1C91A 3UYCA 2UY3A 1L8PA 1LWCA 2XCAA 1RZMA 2TRSA 3CB8A 4M0XA 3W7JA 1QNRA 1SSGA 3I9ZA 5KZEA 1Q8JA 1R0MA 3FA5A 5A5WA 1ZAWA 4IKAA 4RUHA 2RKIB 3ZTSA 1C9DA 4US6A 2VG7B 3CCJS 3OXLA 3TZXA 4DZHA 3MR5A 3W4RA 1EQCA 1DLOB 3D5HA 3MKKA 3ARVA 3HG4A 4D8AA 3GW3A 4F3OA 3GKAA 1CXEA 3JZEA 2L48A 3FDSA 4JHOA 4Q4OA 3PYDA 2Q43A 2GVDB 5HPCA 2E44A 5LIXX 1XGEA 4RW8A 3BLKA 1K7EA 4J7CA 2AP6A 2RAQA 3NIYA 2AMXA 3VCCA 1QBAA 4EMDA 1MUCA 3H2LA 3RU6A 3TN4A 4DV0J 3VGSA 5CGQA 3FDGA 2WW8A 4TXSA 3GRIA 1FWTA 4HA4A 1CJKA 3AT1B 1GYLA 1U1HA 3SRKA 2DZBA 5DFAA 4XG1A 1XH1A 1RHCA 4W7WA 1YBTA 4UXDA 5LYRA 3NXLA 4FOUA 3RCMA 3AICA 1SL0A 4PA8A 4BS2A 4RW6A 2GDUA 3CV6A 3HPOA 3RITA 4DIAA 5EMYA 1OS5A 2VUGA 3MO4A 3UNTA 1S1WA 3W1LA 2F4VF 1GYMA 4Q8MA 5GMDA 3HG2A 3R2DJ 4XAZA 3UI3A 4UOGA 4WFZA 3DIPA 2DK2A 4DX7A 1RT4B 4OX6A 1JXKA 2V4QA 2EW9A 3BK0A 2LLZA 1YTEA 3N4AA 1BQXA 1EPXA 2PD5A 2EJAA 3G71S 1CW2A 1SFTA 1DZ5A 4ZOSA 2QDDA 2YKMB 4E2VA 3AYVA 3APTA 3DHDA 1Q6DA 1V8EA 2C91A 1UKPA 1ZNNA 2DSWA 3QFWA 3NWGA 4LU0A 2AL1A 2XSXA 1HG3A 1E1CA 3UETA 3DYAA 3WQ6A 4RW8B 1S76D 3TC6A 1UUOA 5K8PA 4DSJA 1P5BA 3UXLA 5AYXA 1H0IA 4W4MA 3DLLQ 2OSRA 3H42A 3MR7A 4CLTA 3UD5A 3G22A 3HHLC 2R8JA 3DGRA 2IIHA 4QCFA 1VQ6S 1VLYA 1VBRA 1UL3A 4XK8C 8AT1B 1SQGA 1WPCA 1ICPA 3T5LA 2PWVA 3QOKA 1S2CA 3UPBA 5C25B 4GINA 4L6V3 2DNPA 3DXBA 1JCXA 4ZO9A 3LOTA 3CD7A 1CB7B 2GQCA 4Y2WA 1MW1A 2WNZA 3TQPA 1S1WB 3W3OA 5A6KA 4M6PA 4MKNA 2E5LJ 2DRAA 4Y90A 3I6PA 1LT8A 2WBMA 3GTFA 2DHSA 3W5YA 3B40A 2E1DA 2BXYA 5G2IA 2C8NA 3RJMB 4J3TA 5C7HA 5C5YA 2XVPA 4HPGA 3PZPA 3U2CA 1PC4A 2RRNA 4HTIA 4B91A 6TAAA 3WBEA 1EUAA 1VQTA 1C92A 3J7AN 1Q8LA 5F4WA 2A3JA 4LBPA 2Z28A 3IBCB 2W61A 3BTNA 5FLXU 2DT1A 4DZIA 2ICSA 2WJDA 1R5YA 2OWXA 2WSKA 3QT8A 2PBOA 2MY8A 4JV1A 9CGTA 2M4MA 3U02A 3BZQA 3G8RA 3MW7A 3DYAB 2ASLA 3CMES 4DV3J 1US2A 5LSMA 1NSJA 4DF8A 3Q2TC 3N3MA 2FH8A 2V69A 2D0HA 3CIMA 2EG2A 1GKRA 4MYTA 2HFOA 4DYJA 3QVQA 3KP0A 2UXCJ 3QGVA 1SCJB 1EC9A 3WNKA 1JQGA 4LEFA 3L7RA 3KG4A 2ZH9A 1NDYA 3C8FA 4PUDA 3PNZA 3PG9A 4XAPA 5EHHA 3MP5A 2N7CA 2CPXA 2R1MA 3H24A 4S3AA 1H51A 3M44A 1AG1O 2YNGA 2DHAA 5LJ5Y 4K0KF 1SM9A 4WOZA 4MKBA 3QY7A 4PMQA 4LVBA 5KTLA 2BUNA 5HNUA 1GG1A 4LV4A 3G1DA 5DBUA 4E3TA 1B0TA 1M1GA 3AB4B 3WKZA 2ZKMX 1EZZB 2XYHB 2G2OA 3OZMA 2HRTA 1JYXA 2XHYA 1FJCA 4MFBB 3QBUA 1EDQA 3L4BC 3PZNA 3FUYA 3CJ3A 4PSPA 2BJ1A 3MCMA 2HW3A 1UKQA 3SMZA 2WONA 2ZUGA 2XFRA 2MQOA 4GBDA 3V0UA 1YZ7A 1LL6A 4QW9A 1N88A 4IGSA 3KJQB 3S8HA 3KWXA 5DX7A 1B3WA 2KM8B 3AMKA 1PAMA 4AHPA 3UXAA 2HK1A 4ZR8A 1YTKA 2TPSA 2W24A 5DZ7A 2RD5C 4IH6A 3FVMA 3O63A 5C9WA 4EBDA 2ACMA 4JYAJ 4O3SA 3ZC4A 4FR1A 4GYKA 4Z1YA 4AXJA 5J2QB 1UW4A 2NSOA 4ML9A 1W1ZA 2DUZA 4GK8A 3K7RA 2HS8A 1XLGA 3A4AA 1KRCC 4GUIA 1XLAA 2H4YB 4W92B 2HGNA 5GNYA 1W1YA 1S1RA 3S5ZA 3Q8UA 2X09A 2DH7A 1NDPA 4DQSA 1ZBCA 4RPQA 1MFUA 1D8ZA 4DL6A 2C16A 3M07A 3JR2A 5G4DA 4OOUA 3RFAA 1AZSA 1V03A 1WCGA 1UZ4A 4GVLA 5A8KA 3UERA 2PRHA 4HHJA 1OT1A 2J9ZA 1F9EB 3ENQA 1HYSA 3KVMA 3NGDA 2WZEA 4XZHA 1ZA1B 5A6LA 1O5QA 1GX5A 1R8BA 1R8HA 2VCCA 3CO0P 4CYUA 4C8MA 2R94A 3N2CA 4IQLA 4JTKA 3OR1A 1A50A 4ILMA 4H8VA 3EOEA 2L5HA 4RKUC 1AH3A 2QLBB 5EX0A 4NCGB 3UG3A 3LRKA 3VOFA 2XS7A 3BQ5A 5M2PA 3VKKA 3HSJA 3R5JB 3BBFA 3V4IA 4Q7IA 4MGGA 3R7NB 4PUOA 5DMYA 3Q94A 1NK6A 1HIZA 2KXHA 3RR8A 1JNDA 3NSMA 3BGAA 3OL9A 5FF2A 1EHAA 1PO6A 3VDAA 1CXFA 3POCA 1NWRA 4HPHA 2XJ7A 4UFHA 4G65A 4HMNA 1W5MA 1U1NA 5D4NA 1FWDC 2FLPA 1X39A 2UVVA 3TX9A 4FXSA 4GUHA 3LRLA 2HVOA 1HHSA 2R8WA 2XY7A 3NR0A 5LIUX 1WC4A 3PY8A 1W6TA 4LR8A 4DV5F 1AJZA 2YDQA 1AZSB 3FBFA 3H2AA 3NGTA 3W71A 4OJHA 1J0ZA 1ZS2A 4HQVA 2HQ3A 5I3UA 5ECVA 1BLUA 2ZWPA 4MG4A 3LCWA 2WKLA 5D0HA 5B0CA 4CYUB 4I7VA 2GGHA 4MTPA 3B0PA 4B2DA 3OIHA 4GKLA 2F65A 3USBA 4ILLA 2G2ZA 1IR2A 4IOTA 2G0WA 3MPUB 3E49A 3UY8A 3WZ0E 3SY8A 4TTUA 3W82A 4EWJA 1S48A 4MNKA 4YDXA 4FSAA 3CB4A 1FDBA 3KTXA 3IGUA 3R7MA 2GSJA 4BK9A 3FAWA 5DO8A 3QC0A 1WG4A 1YDNA 4OQVA 3TJLA 4PUOB 4CEXC 3OTBA 2C79A 4ZVEA 2OTDA 2HMCA 1Q4RA 2UU9J 4R7OA 5HLFA 2DIUA 1Y5XA 4M7TA 4NNCA 4CD8A 2V81A 3L7OA 1TZ9A 4EWTA 5GADU 2CWXA 3E3XA 4PCQA 2CJBA 1BKHA 2C18A 5GVJA 1E6SM 4KCVA 2MPUA 2GUBA 1ZJBA 5JJBA 3MP4A 2NXGA 5DBTA 2CQ3A 1WF0A 2CBVA 4W88A 4LRAA 3LHWA 2BANA 2F8MA 4ED1A 1LBFA 2V5JA 2M5YA 3FZ2A 4A8XA 1PV8A 2IQDA 5I3UB 4D8LA 3PSWA 3TQVA 5KFUA 2ADCA 3DESA 2ALYB 3SQLA 3OZYA 3HPFA 1RP5A 3T5KA 3MM8A 1S49A 4IX0A 3PBUA 2FIQA 2OSWA 3FQLA 4N7TA 4QIUA 3AQPA 2OUGA 3JAMU 2IRYA 4NL5A 3I10A 3UFCX 2OX4A 3CK5A 1TU0B 1VRTA 3GR0A 3BSAA 9ATCB 4ZP7A 5A94A 2G1HA 1QI4A 2YW3A 1SJRA 2A21A 4ECQA 1F60B 2GAHC 3HCXA 4AUKA 3K4AA 3LMZA 2QEZA 5C9UA 3EB2A 1H7XA 1EOKA 4AL7A 4OX7A 3QF0A 3NPWA 3PJTA 2DNMA 1SJ4P 1PYMA 4FNRA 1OC5A 3IJ9A 4I5UA 4RE2A 4CO1A 1NKEA 3P4UB 2JC0A 2CJYB 1X9WA 2G41A 5HLFB 4LAKA 4DV0F 1CXLA 3LTYA 1TUGB 3VZIA 1W31A 4DCOB 4A8QA 1WOBA 1IM6A 4AL5A 4K7YA 1LL4A 4S3CA 2Q6CA 4QR2A 1OK4A 3MM5A 3PB2A 1GMVA 4JNZA 3KLLA 5AYYA 1NH6A 3HHKA 3SN4A 3ILOA 1QAXA 5F0UA 3N04A 3NOGA 2HRYA 4YR0A 1F3TA 1XWYA 4J9RA 4AMCA 4PR6A 2CNCA 1UC5A 3JQMA 2R8GA 2C15A 2RDUA 4DO4A 3LO3A 1T40A 2GIRA 2J75A 3E96A 3NGJA 2CHOA 4LFCJ 2INEA 3QMQA 5PTDA 3MM8B 2B8PA 4DV1J 2ZWZA 3L65A 4C0OC 5LNUA 3PTWA 4BCAA 5CC3A 1JZ6A 2XN0A 3RNDA 3M6UA 4DDFA 2Y89A 3FK4A 1K1SA 2D69A 3K58A 4MADA 3M1VB 2J7HA 4FLSA 5CGTA 3M0JA 2FHOB 2BKNA 1PIGA 2PDIA 3CCES 5GAHI 1V7YA 1IWGA 3P62A 5IFPA 1NJIT 4EKJA 2YOCA 5LIYX 5L9FA 5I3HA 2AJ2A 1HVQA 5K8OA 3PANA 3NPUA 3UJRA 4CLMA 3C6CA 2Q8ZA 1X8CA 1WJ9A 5A2QU 2VA2A 4OTKA 3KUEA 1KEKA 4ZE5A 4F9JA 2VVNA 1WEXA 2PLJA 4UOQA 1PJ7A 2DPEA 2XLKA 3E0VA 4D6DA 4HLBA 3MM5B 1O51A 4DLEA 3WQ8A 1DV7A 5HMEA 3GE9A 1S0MA 3A22A 3F2DA 2V2CA 1BVZA 2JE8A 3LMYA 3ZZTA 5KITA 4J28A 2U2FA 1XHGA 4FB7A 2GMJA 1X4GA 2WQDA 3P5BP 3GIRA 3WFZA 2E5LF 2RJGA 2QUUA 3RR4A 5IV3A 4YOEA 4D2JA 1JZ7A 3W00A 3WD0A 3RMEA 3Q24A 3LP1A 2FLLA 3G1YA 1FO1A 4OZOA 2O66A 5AE3A 3DH7A 1VZWA 5MAOA 4EF8A 3T8QA 1FRMA 4P2XA 1FRLA 1Y8BA 2JFDA 4J9KA 2J7CA 1BXBA 4N0RA 5HUOA 3PKYA 4B5NA 1BWEA 2ZUWA 1R46A 4F0RA 5KAKA 1EFZA 1T9TA 4YS2A 3V81B 5TBOA 2E67A 1E9LA 2Y61A 2GGJA 4DV3F 3LGNA 4USWA 4KRZA 3AFGA 1XYZA 4IQEA 4FI4A 1H41A 2E29A 2QCLA 3IS4A 4NYZA 5BXSA 4I7UA 3VILA 4FHAA 4QDWA 4RUCA 5C8BB 5ETTA 2UXCF 5KFWA 1JF6A 3RAQA 4O0KA 3KRBA 3MUTP 4DFMA 2WW5A 3CLWA 2ZVRA 2EPOA 2BMBA 2GV1A 2H6RA 3MZIA 2G5WA 4B9SA 5CZXA 3BGFA 1NNDA 2R1PA 1W25A 4MFDA 1DIDA 4NI3A 3AIRA 4TIMA 2HHWA 2J66A 4H6KA 4XBKA 3TA9A 3LAKA 4KV8A 2NVCA 3W1XA 3MQTA 1U8WA 1F05A 3NQFA 5FJJA 3KBVA 2V9DA 2WBKA 1IBLJ 4WZHA 2HHQA 2JL9A 1JVNA 2ZTJA 2XDFA 1S99A 1I4NA 2LEBA 2Y0SD 2QT7A 3AJ7A 1B0PA 2DY9A 3M2VA 1X9SA 4NJHA 1MEWA 2F40A 1H72C 1VQ8S 3LPGA 4EUVA 3DRYA 4PPZA 4TX8A 3SSSA 4N8OA 1EEPA 4EPEC 1ZM2A 4G1KA 2ZH7A 2D20A 2QF7A 2VDHA 1RAGB 3N6QA 1T9VA 3VDBA 3WMCA 4JYAF 3GAKA 4M1BA 3N01A 3FNDA 1RWUA 1K9DA 1LXNA 2ZH5A 3AHXA 4BY3A 3N1AA 1FCBA 2Z1BA 1ZRQA 5A6MA 3T4WA 2UZAA 1LWIA 1JLQA 1SR0A 2PDAA 5C9RA 3E12A 5A6BD 3PZVA 1I75A 4M5DA 4AWSA 5LXYA 5J2NA 2CA9A 5MKGA 2DFAA 2BP1A 4JFSA 4MYXA 2OPSA 3SXLA 2R14A 4NYUA 2WC4A 3HX9A 1BVWA 3QAUA 3PO4A 5J1EB 4DEFA 1B3XA 4DJED 3LK6A 5HWNA 3MSRA 2YBUA 4J1OA 4Q45A 4JYFA 5DMNA 3ITOA 4A6GA 4GY0A 1OX4B 1UD5A 2ZBIA 3QIPB 4MLJA 1RTJA 1WZLA 5D2VA 4MUPA 3CZEA 2YKOA 1V4YA 3KXQA 2ZFAA 4E0CA 3NDOA 1VF8A 2WBGA 4HTYA 2IMWP 2VB6A 2EKCA 1J6PA 2DZWA 1UOKA 2R2RA 1IEIA 3W85A 5CD4H 4C5ZA 4J3SA 2JRSA 1K4HA 2AEFA 1MQPA 3AODA 2F6UA 2QUNA 2W9BA 4CRJA 4TX9A 2V3GA 2R2SA 1F61A 5F8LA 1ZY9A 1I2RA 3MUVP 5L1IA 4YUDA 1JD7A 1DJ0A 4MAVA 4QAWA 1OJXA 3O6CA 7TAAA 3RRXA 4YHGA 2I8EA 2J9XA 4IFVA 4RZ6A 2B7OA 3QSTA 3N29A 5H2ZA 1XH2A 3P67A 3FEXB 4EGLA 4M5DB 3BG3A 2DSUA 2W6RA 3VI2A 2NW0A 1CYGA 5GVQA 5DY3A 4CNSA 5J2NB 3PACA 5HA7A 2PP1A 2ZZ4A 1UVLA 1S72S 1EGVA 1GHRA 3B3DA 4HNOA 3MPDA 1EX5A 3NCOA 3WJWA 2JEQA 2KTQA 4CO5A 2BRKA 3A4JA 2R42A 5AHEA 3TVAA 1JGMA 4HNLA 5KFFA 2PCEA 4XBSA 4UTHA 3UVJB 2A5HA 1SPQA 3NM1A 5B0FA 1O1HA 3ITVA 3DZ1A 1JLAA 3R7SB 2FZDA 3KZPA 1C3FA 2CPJA 2ZHBA 1RHQB 3VOIA 4CQBA 1CI1A 1RALA 3MMJA 4CCEA 1V5IB 2XM2A 3R5GA 4ZVOB 4KF1A 4NMXA 4ZK7M 5A8PA 5G2WA 4HTJA 4DELA 2AAAA 2V5LA 3FGVA 3QYYA 3PZGA 1E4IA 4PODA 1U45A 2O9TA 2WMHA 2D3OR 3R8HA 2VGFA 2UU9F 4IFVB 3VDCA 1EA9C 4MIBA 2JWNA 1GK8A 5JMNA 3C66A 1PVNA 2NXCA 5HMZA 1B5TA 1N0UA 3D3FA 1E5NA 3W2VB 4QU7A 4L75A 4UT4A 2CRLA 1KB3A 5D78A 4PN2A 2PUZA 4ZO8A 3SFWA 1W91A 2YNFA 2GAGC 2BE2A 4C3MA 3C6UA 2GDQA 2M9KA 3LH2S 2M7SA 4HHHA 1OEPA 2C3MA 4DV7J 3I31A 1RWPB 5ETLA 3G1SA 1GZ1A 2HKEA 1T11A 2AGPA 4HJFA 4ED4A 4DR6J 4ZQCA 4QJ3B 4CVWA 3QHOA 3Q8PB 3H26A 3M5YA 1PYSB 1HJUA 4K2XA 2YL8A 3APGA 1H49A 2DIJA 3BLLA 3L12A 5ECUA 3HD1A 1RVGA 4RWXA 1DJZA 1QI3A 3RBZA 1UUQA 4IOAQ 3CL6A 4V1YA 4OJYA 4KEVA 3W7GA 1OF8A 4PZVA 3LENA 5FD1A 1RCXB 4S38A 4LBIA 1TL1A 4AVNA 2VEIA 2DGTA 2IY5B 3ZM8A 4DJDC 5F2IA 4HI1A 2WC7A 3CAWA 1HP4A 2P88A 2WOQA 4MY1A 4ZJQA 3W65A 1MO0A 1RQ0A 1AMKA 2BJ8A 4JNMA 4WSHA 3A4WA 1PTAA 4L3KA 1XYAA 4B9YA 1KNWA 2GQ2A 2YNFB 4C7GA 3EVOA 2BE2B 2FZBA 3VPLA 4EWND 2N4DA 3C6UB 2HQAA 3W2LA 3CS2A 3WH6A 3XINA 1LQ9A 1HI0P 2QW5A 3EE3A 5L1LA 1L3TA 4AC7C 4O3NA 1WKDA 5A6PA 2O9OA 2BB0A 2GJLA 1S6OA 1G67A 4LFCF 3IA0A 3TJIA 4KWUA 3M6XA 4DV1F 3EWUA 2ZZNA 2FMNA 1WTBA 4GACA 4GUFA 4REQB 3VNYA 1B4SA 1TL7B 4ZS6A 4W9TA 4I9JA 5BYRA 1FRJA 2NX9A 1L6SA 3WBXA 2IYGA 4IFRA 3BO2A 3QTPA 2YTCA 2E9TA 1MMNA 2K06A 2E3ZA 4WJBA 2VR5A 2V2HA 3GZ7A 4FIQA 1RHUB 4UR8A 3N18A 3NPVA 3TV8A 2R7WA 2I9EA 2M88A 2VUNA 2QF8A 2HG4A 1N2VA 3WL0A 3DFTA 4E8DA 5AC7A 1TL1B 3BJTA 4R8UA 3NQ8A 4C7QA 4IO1A 3PJUA 4ACZA 3AZSA 5CZ0A 4F36A 2FQIA 3RILA 1YPIA 3GV7B 3G3MA 2DY1A 1YZ6A 3W1QA 2GQQA 1UWBA 4X61A 3DOMA 5HVHA 1NWSA 3KOZA 3TQEA 2YDAA 1H63A 3CPUA 5LNVA 3PULA 3QRQA 3TYCA 4KPYA 2YLLA 1IEQA 4GZEA 3ISNC 3EPOA 5F3ZA 1A47A 1SL1A 1QSSA 3L4YA 2J8SA 3OPKA 3CNYA 4ZPDA 3B8VA 4HNTA 3OJSA 4PPDA 3PX0A 3I32A 4IRCA 3VAJA 1XP3A 1SFSA 1J93A 5AHLA 3WJZA 4JIIX 4RE0A 3OW2R 3V6JA 1A5BA 3CJ5A 3T2OA 2HHTA 3TA0A 4QYZK 1WORA 1IQZA 4DXXA 1OYEA 4B9NA 4DS5A 4ECRA 1NSAA 1IM4A 2V5KA 1TRIA 3N2MA 4KESA 4ITSA 4O4GB 2BODX 1QTNB 4HZMA 3MI6A 3TLLA 2Q3RA 1HVXA 1JZ5A 3CDAA 3RM9A 4A8LA 1B3VA 3QJLA 1VBKA 1FDZA 4KC5A 3PFRA 2BJ7A 5LNRA 4ACZB 2J4GA 3IFEA 4XKYB 5HBMB 5A8RB 3UQNA 4DLFA 4JV0A 4QJ1A 4GYJA 1TFWA 1Z69A 1O68A 1UWBB 4J9JA 5JBDA 2ATSA 5I3GA 6ENLA 3MF5A 4M7SA 3G2GA 3K57A 4HCHA 1UB3A 1UH4A 4MUZA 3VNJA 1W9PA 2GWNA 2VX6A 4DR3J 3M8PA 4NCAA 1T0TV 1ITXA 2IKIA 4LFYA 3AHVA 3OYZA 3TYUA 2AHOB 1M65A 5CQ1A 1AQHA 1S5NA 1SW7A 2VBYA 3CDUA 3ZR5A 3HJEA 1FP9A 2CUYA 1WI6A 4X4RA 2PTXA 3OGVA 3RRKA 4URIA 2EBGA 1XW8A 2CZDA 3FN9A 1QSYA 3NQDA 2WRMA 2HHPA 3N0VA 4OZ1A 4HYRA 3WD4A 2XMVA 2MZTA 1IBLF 1VYSX 4QWBA 1KC8T 2JVRA 2CQIA 1BUXA 1YVFA 1LQ2A 4H8HA 3V18A 1TVRA 1UR9A 2PLCA 3DFOA 4MWAC 4Q8NA 3VX0A 3IG1A 3H59A 2VF3A 4AD5A 1UWQA 2FPYA 1WDSA 2J8GA 3LSCA 1RKJA 2HBRB 1PB0A 1FRIA 3DLGA 3UD6A 2AT1B 2ATCB 8CGTA 1K1QA 4GKJJ 3O44A 2FPTA 5DQIA 1AUDA 3PP7A 3OW1A 4BF5A 1YNYA 3KW3A 5T26A 3BPWA 4AHOA 5B7YA 3M8PB 1EJUC 1E43A 2OZ0A 3QY6A 3IWLA 2AQWA 1XI3A 3FRZA 5E3AA 1PC5A 3JQKA 4X4NA 1HZYA 4P8WA 4LFBJ 1YLXA 4U95A 3J80U 2F9JA 3OA5A 5LOQA 2VJUA 1FWRA 3EA3A 5F41A 2GVYA 1S6PA 1BEUA 1FQ0A 4FXWA 4O52A 4C8KA 1KVKA 4DF2A 4XDDA 1XV8A 1OINA 5GMKa 4ILSA 4LF1A 5KFZA 3MR6A 3PBVA 3LPFA 3VO0A