The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
125
|
sequence length |
432
|
structure length |
427
|
Chain Sequence |
YVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMKDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of a Novel-Type Archaeal Rubisco with Pentagonal Symmetry
pubmed doi rcsb |
source organism |
Thermococcus kodakarensis
|
molecule tags |
Lyase
|
molecule keywords |
RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE
|
total genus |
125
|
structure length |
427
|
sequence length |
432
|
chains with identical sequence |
B, C, D, E
|
ec nomenclature |
ec
4.1.1.39: Ribulose-bisphosphate carboxylase. |
pdb deposition date | 2000-11-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00016 | RuBisCO_large | Ribulose bisphosphate carboxylase large chain, catalytic domain |
A | PF02788 | RuBisCO_large_N | Ribulose bisphosphate carboxylase large chain, N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Ribulose bisphosphate carboxylase, large subunit, C-terminal domain | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | RuBisCO large subunit, N-terminal domain |