1GEHA

Crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
432
structure length
427
Chain Sequence
YVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMKDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE
publication title Crystal Structure of a Novel-Type Archaeal Rubisco with Pentagonal Symmetry
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 125
structure length 427
sequence length 432
chains with identical sequence B, C, D, E
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2000-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 1gehA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 1gehA01
1RLDA 1IWAA 2V69A 1RCOB 1AUSL 2V6AA 1RBAA 2CWXA 2QYGA 1UWAA 3A12A 1RBOB 1BXNA 1GK8A 3KDOA 5RUBA 2YBVA 3KDNA 3WQPA 1RXOB 1UZDA 9RUBA 1UPMB 5HJYA 3RUBL 4MKVA 4LF2A 5HAOA 1AA1B 4NASA 3A13A 3RG6A 2D69A 5HK4A 2VDHA 8RUCA 1IR2A 2OEJA 5C2GA 2V68A 1RCXB 5HQLA 1EJ7L 2OEKA 3AXKA 1RSCA 4LF1A 2V67A 2ZVIA 1BWVA 3ZXWA 4F0MA 1UW9A 3QFWA 3NWRA 2VDIA 1YKWA 1WDDA 3FK4A 5HQMA 4HHHA 1RUSA 2OEMA 2V63A 1IR1A 1GEHA 1RBLA 4RUBA 1SVDA 4F0HA 5HANA 3AXMA 1UPPA 1TELA 5C2CA 4F0KA 2RUSA 1RLCL 1UZHA 5HJXA 2CXEA 2OELA 5HATA
chains in the Genus database with same CATH superfamily
3R2CJ 2FZ9A 1WUFA 3W7CA 1TL7B 3RR4A 4IG3A 5M2UA 3I0SA 2WSRA 2OR2A 3SQMA 5CCMA 1M1BA 5BOEA 1O60A 3DHUA 4DAFA 3SZ8A 4LFYA 3S5OA 3TLQA 2W91A 2GUUA 3AZSA 3EWCA 1HUVA 3H4DA 4JTHA 1UR9A 1TV4A 5CPLA 4K8HA 1U25A 4IQXA 1TJ1A 5A2AA 2ZH8A 2W79A 1I2PA 3X1LB 3VKDA 3LDVA 1U5JA 4DLGA 3CHCA 5KFQA 1VBHA 3SCKE 4RZ4A 2PF8A 3N5BA 5B0EA 4MLJA 2KZMA 4Q4OA 4V1XA 2VZTA 3OYXA 2YKOA 1EQCA 3GDKA 1AFSA 3H21A 4GO9A 3W82A 4LYQA 3KWMA 4I68A 5IT4A 1HP5A 1N32F 4JTEA 1ZZFA 2MLXA 4JV5F 1POJA 3QATA 3W65A 4UOGA 2MEWA 3U2OA 3B9AA 3FAXA 3HZEA 1NDYA 4UOQA 1FDNA 3GXMA 5HDRA 2PDKA 1XMOJ 4XZ9A 1YJRA 4H8UA 3ORWA 2ZZ1A 1FH7A 4N7TA 5EMJA 4S3KA 4ED2A 4RWXA 4P9SA 1JJHA 4GUHA 1T5AA 1JDCA 3VKKA 3E2QA 2RB7A 3E3XA 1N8FA 4QROA 3GHRA 1RAGB 4KRTA 3S46A 1XN9A 2HCVA 1X9SA 1V4YA 1VC4A 8AT1B 1ZCCA 1IBCB 2DJXA 4HU8A 1A5OC 1RTIA 3UJRA 1UD5A 1HW6A 2JKEA 4OMFG 5AC5A 4R7WA 4PCPA 2K7KA 3G1SA 4ZP7A 4MKBA 2C3PA 1MN7A 2I14A 3K46A 4M7SA 4JHOA 1TKTA 2IKHA 1O1ZA 3PYDA 4ZB2A 5KAKA 1NZ8A 2GQQA 2GZOA 3VKJA 1RPXA 4PYSA 4B5XA 1PL9A 2XIBA 1R9ZA 4DJDD 2C1EB 4HKQA 2B51A 1VQ9S 3LLXA 1EC8A 2V2HA 4I90A 3AOBA 4AW7A 4KMQA 2Q3PA 3STEA 3HCXA 1S5TA 4AC1X 4AMAA 4XZBA 3TFXA 3HLUA 1DHKA 4ZVPB 3CCUS 2E1RA 1TTHB 3RX2A 1SJ1A 3NQ6A 2EFGA 4AY8A 3PEHA 4IWWA 4R8UA 4HPNA 3SV3A 4NZ0A 3SZ2A 1UP3A 1FKOB 1UP0A 1Q0NA 2R7QA 3HB9A 3PDNA 1SV5A 1V0NA 5DY2A 3I4PA 2GGHA 3QLDA 1T05A 3MCOA 1GZJA 4GIRA 3VGEA 4DX7A 4HPXA 3GZ7A 4Y2IA 2CQPA 2FZKB 4DV4F 5FJUA 4NCGA 4BK9A 4UOHA 3C2FA 2RDIA 3RAOA 5KG0A 4RUAA 4YHHF 3RRXA 2HPUA 1E1EA 1WOOA 5C9RA 5LZLA 3LS9A 4CQAA 1HBOB 4HHMA 1JLGA 3QV8A 1KS2A 2OX4A 4AYGA 1XIQA 4DJDA 4TMBA 3ONCA 2OTDA 3MMUA 3UYIA 1P1XA 3TUUA 3E0WA 3XIMA 1VMBA 2PDFA 4D8LA 3ZJKA 1G7VA 2J6SA 2F4VF 4Z1YA 2QLWA 1XYMA 3M8PA 1CCWB 3LUYA 4IG2B 3H5SA 3WLLA 1EO7A 1TP7A 2D0FA 4YYCA 3PYGA 2P1FA 4BHQA 3ZR4A 1NQ6A 4AY7A 2DHAA 4B3TJ 2G95A 4WY0F 1M5HA 2ZC8A 1XC6A 1RAFB 1GX6A 3PV8A 5KFXA 5L1LA 1UMLA 4QJVA 2OOFA 4LC6A 4OBSA 1TB3A 2IBOA 2QMJA 3F4NA 1JZ5A 2EPIA 3QPIA 3LPFA 2O7SA 1FJCA 1TVNA 3ADAC 1HF6A 1G1XA 1NHKL 1U33A 5SUHA 1H62A 4B16A 1CXEA 2XS2A 1MQRA 1NUEA 1UL3A 4MYTA 3KBJA 1FKPA 2GWGA 1XH1A 1DWIM 1QUPA 2GDQA 3DHFA 3BCFA 5K4ZA 1EEXA 1AFJA 1I94F 4Q0BB 4Z0JA 3H26A 4H6EA 5F7UA 1JKHB 2ZJRQ 3ANVA 4D6GA 3R3TA 1LK5A 2MQNA 3I4EA 4CVWA 1DXEA 1BY9A 4B3RJ 1NK4A 3TN5A 4J4KA 4NMXA 5AHFA 1TA3B 5GADU 1SFLA 5FJRA 1J2VA 3R7NB 5A6TC 1D9EA 2H5IB 4QW8A 1XIEA 5I42B 1Q7ZA 2W1BA 3PTQA 3H53A 3PW4A 2QCCA 3N6HA 3OIHA 3VNDA 3ARXA 4LW7A 3Q89A 3ZJ8A 3F03K 1NK7A 2YX7A 1H11A 2ALDA 2AX1A 2YNFB 4WFXA 2G0IA 3K58A 4YPJA 5IM0B 3W1XA 4INFA 3LPEA 4PPDA 4FXVA 3OUYA 2VGGA 4ID5A 5CJMA 2VC7A 4FEZA 1V3IA 4I2PA 2E9ZA 4ALZA 4R88A 5E2QA 1PKUA 4ATLA 4S0MA 4ZVEA 3LAKA 4H4KC 4I1TA 3SDEB 2KTQA 2RDJA 2DH3A 2RDUA 4GQBA 2DPEA 5F0WA 1NDKA 2QZ8A 1WKEA 1FFWB 5ADZA 2CHRA 1KKRA 2CZFA 3QSTA 2A7PA 2YKPA 3GR0A 4WHBA 2QCDB 2OSRA 3NQVA 1EA0A 2XLKA 5JUMA 2HBVA 2FB3A 3PKMA 2PLJA 2HHTA 3DMJB 3GYNA 2KG0A 1K6AA 1UW4A 1XRSA 4PA8A 4IYQA 1XHGA 2B56A 3NL3A 1DQUA 4RDVA 2G2YA 5MHBA 4WP8A 4DV1F 2GDUA 4N7QA 1TQJA 4MWAC 1H3DA 4IFKA 5F0UA 1ZBWA 3GU2A 1YGYA 4S23A 3NNHA 4IFYA 1S9EA 2P53A 1XDLA 1F3VA 3PXGa 4U7UK 4ZZ9A 4QCEA 1FNOA 3PHAA 1W6TA 1BHNA 1C0TB 1RKIA 3KHGA 2VGIA 3KNAA 3GKAA 3UO0A 2GS8A 4A8WA 3WX7A 5MF5A 1XC4A 2C8NA 2W27A 5EKYA 4WP9A 3ITOA 5AC7A 3B54A 2FJWA 3B4YA 4LUTA 2IAJA 1A3XA 3MUY1 3ZZYA 4DF8A 3NPVA 1W17A 4GYPC 1NK5A 3O8WA 1Q6RA 1FRXA 5EDWA 2VFVA 4OOZA 4P7TA 3UR8A 2YXOA 2FZCB 1RD5A 5D78A 2WONA 3W87A 3SB0A 2VKRA 2RMLA 2ZBCA 1YJWS 3ITCA 3GWCA 3JB9k 4PWDA 1JLQB 2MPUA 2UUAF 1Q7YT 1UUQA 1F5CA 4YYFA 2VUNA 3FSTA 4I4BA 3XINA 4IQDA 2NREA 4LF6F 3JSMB 4AIOA 3DC0A 4LBRA 1NJJA 4GXPA 3ISZA 1HFEL 4O4RA 3TJ4A 2DNRA 1UA0A 3W8GA 4GFIA 3E49A 2MJNA 4RUCA 3M6WA 2BY2A 2UUWA 2FLIA 2GQ9A 3GVVA 1NLKL 1REVB 1GXLA 1NSAA 1D3HA 2XM3A 3WQ8A 3SEOA 3KCOA 3EICA 4XO7A 3VM5A 5CG7A 1KR1A 1KXVA 2HRUA 3RN6A 3EDRB 2V2QA 4DPTA 4Z1CA 3MCNA 1TV3A 4J27A 2Z26A 1ICPA 1VBJA 2HXTA 4IGHA 2FGLA 5A8RB 5BOFA 5FI8A 5LNUA 4H3DA 4JI4J 1JXEA 2Y6ZA 5CPTA 3VMOA 3W88A 5I78A 4C8LA 3TMLA 3IG1B 4XKYA 4A48A 3ARWA 3PJUA 1S9GB 3DYAB 3VX1A 2QJMA 3UXDA 4AT1B 4IO9Q 3DLGA 1F6PA 2WAGA 4MM1A 2ALZA 2PRHA 4O19A 3P45B 3GZ3A 1ZY9A 3QHMA 4JI8F 2CZVA 4JX6A 2DZPA 3G96A 4ZQPA 3SCWA 5U47A 4ZO9A 4MK8A 1C29A 2P5VA 4HCDA 2NUXA 2PC6A 4I6AA 1J96A 2EG2A 1X31C 2FJEB 3ZTRA 4G3IA 3MYPA 2Y9HA 3OTDA 1S3HA 2B4VA 4IG0A 4K1WA 4UTJA 2Y3YA 1FRBA 4NZ4A 4X0VA 2P6TA 1UWUA 2R6OA 3UBPC 5HN0A 5MLCV 3R6GB 3IIOA 2CYYA 5I3QA 2FMNA 2ZFAA 3MSGA 3KJFB 1MYRA 3MT1A 1C1BB 4HHJA 2VB6A 1MNEA 2WWCA 2XIOA 3CV1A 4C48A 4NXMJ 3N34A 3BPDA 5FA5A 2F6KA 4TV6A 1M5SA 1YADA 1MLAA 2CNNB 4OGZA 3UWYA 4HL9A 1Q6FA 2ZRWA 2BG5A 2VEPA 4DV2F 1M5OC 5AYIA 1P6WA 3PBMA 3STGA 2ZX8A 1UJ5A 3M7SA 5DQGA 2ZZ4A 1O12A 2HBYB 2VODA 1PJ6A 3N2OA 2ZA3A 2X1IA 4MDOA 1WE5A 3POTA 4UQTA 4JCLA 1QD1A 4C6JA 3GSIA 4DZHA 3PN8A 3C2PA 2OJPA 1PIEA 4JN8A 1GNKA 4GBDA 4JIQA 5T91A 3UZZA 2MQLA 1HJXA 3MM7A 3TQEA 1VB9A 1ZENA 3NVDA 4I7FA 1W5MA 2PDPA 3W7NA 5EN1A 5I3DA 2D0GA 1F05A 2PBOA 3VIHA 3W2VA 1IZJA 4W87A 1LFWA 2DEIA 4FXRA 3QH2A 3NQDA 2OODA 3M64A 1QI4A 1OC7A 2HFUA 2ZHBA 4HMDA 4Q5VA 3L68A 1E72M 5AYXA 2DZUA 2V82A 5MKGA 2IKGA 2VGFA 4KCTA 1DHPA 4QQ3A 1V3LA 2P0IA 2G0JA 3DYOA 4JHMA 2QDDA 4IIDA 3G6YA 2AKMA 3RAMA 1RK5A 1D1UA 2ZRVA 2CJAA 4GY7A 5G4EA 4HOWA 2ZNYA 2POKA 3W26A 1WACA 2R9RA 3MHFA 3O3LA 1KRMA 1YZ7A 2A6MA 1JAKA 2FDNA 2XMUA 4LF1A 4A8QA 4HT5A 2QAFA 1QNOA 2YB4A 2GHVC 2G97A 3VNZA 4WE1A 4JIRA 4PB5A 2ADBA 3PG8A 1CB7B 3SECA 2ZVRA 4J90A 3UNDA 1X5OA 1S3TC 4DB7A 4I6KA 1R6VA 2WB1D 2J13A 2RQKA 1G4TA 3CZLA 4CLYA 4QPXA 1XNRF 1DFDA 4D6CA 3NGFA 2KH9A 1HD0A 4Q4SA 3A8JA 1FWPA 1J27A 5D3GB 3H4GA 7FD1A 3W4RA 1FERA 1YJTA 2CITA 2HTMA 4AZCB 3TJIA 4REQA 3GX9A 4J9LA 2BLEA 3B40A 5CBJA 5HANA 2EO7A 3QO9B 3FZBA 3NXLA 4G1IA 4H6KA 4BI6A 4DAIA 2O56A 4UOZA 3DDKA 3EYZA 2H8ZA 2BY3A 2PEVA 1MMDA 4NLWA 5IDIA 1YBTA 2YZ5A 3CB8A 3B0YA 3LCGA 1FH9A 3TAMB 2IRUA 4CO5A 4IPIA 3BJYA 1X7FA 4PUDA 4JI2J 5ABTA 1LBMA 3JAMY 4L4LA 3LWLA 4DFJA 2AQWA 3UXAA 4OJGA 4JX4A 4TMCA 4GVLA 3ES8A 2UY4A 3NZGA 5A8KA 2OKTA 3BOLA 1MW2A 3HO8A 1VPYA 3NZPA 5A2QU 3WNOA 1LXNA 2CLFA 1X8DA 2IPOB 3LGNA 1CLXA 4B5SA 4BDPA 2NXUA 2PI6A 4Y9NA 3A22A 1QLNA 1VGAA 2V8HA 1ONRA 1OS5A 1SKUB 1CS4B 1GTEA 3DH7A 4B5NA 3UJFA 3TXVA 1RHJB 1LBLA 3D6FB 3PCOB 4YOEA 1MQPA 2GGIA 5BMWA 3WH6A 2YCLA 2O67A 3PKYA 2J7UA 4IL2A 1BRLA 3MP3A 3C86A 1S0VA 1MU2B 1FFSB 1WEXA 2IM0A 1FUYA 2RF2A 1JRCA 3KZSA 1X4CA 5J1EA 4L9ZA 1CXKA 4HCLA 1N7KA 3W1NA 2ZJPQ 3M47A 5G1TA 2GMLA 2DVIA 5F8NA 1R9YA 3PZMA 3ARTA 2AJ4A 3PZPA 1UKQA 4ZLJA 2Y88A 3GYEA 3HHLB 3EOOA 4DN0A 1Z7AA 1XLKA 4OZ3A 4B9LA 4O54A 4P8UA 4Q44A 2G4FA 1OFPA 3EXCX 4LSNA 1O68A 1TPVA 3K8MA 3L4UA 1TZZA 4UFMA 2KKHA 1M53A 4JQ4A 5KZDA 1YJVA 3ME3A 3PNIA 2EC2A 4H9YA 2I5GA 2XSJA 5CGMA 1NCLA 2REQB 4US5D 1KGXA 3M05A 1K8XA 3CAWA 1KCZA 3BARA 4H4MA 5C8BB 3DFYA 1GQLA 4E4UA 2A7RA 3R79A 3L0GA 3TYUA 3EOLA 1TYGA 1VJSA 3O16A 2HS3A 3NSMA 2H9ZA 4KJIA 3TO8A 3TYDA 4O53A 3UNTA 4GIAA 1GFWB 1YBQA 2ALRA 4JYDA 2HHVA 2W4CA 2AYGA 5KITA 3WX4A 1FWCC 4DR3F 3P81A 4KQZA 4NX5A 2E67A 1YYAA 2CXEA 3BQ0A 3SUSA 5CSUA 1ESWA 1LUCB 4ZPVR 3OL8A 3E12A 3VAKA 3FEYB 4X4NA 4YN5A 3LNMA 2F7FA 3SQSA 2VC5A 4H8HA 1P5BA 2OQLA 5DT7A 3TXZA 3MUVP 2CBJA 1HBMA 2LDYA 1K1SA 2BJEA 1UWAA 5J2NB 1A4MA 2JGYA 2X2YA 2OPSB 4HCHA 4QYRA 1WKLA 2DR6A 2MLYA 3DRXA 4FF3A 1TX2A 4YB1P 4FF5A 4CNTA 5CSSA 5CZSA 5EX0A 4GD0A 2UUCJ 4A46A 4O16A 1KWMA 1RQBA 4PTDA 3BGUA 5KFIA 5I4MA 1QOXA 3BGGA 1S12A 3MW7A 3UWWA 4KWOA 3WNKA 3VUPA 1JR1A 4Z2GA 3MTJA 3OPKA 4N77A 2AJQA 1FXQA 3EWZA 3TQ0A 1TKDA 5KZMA 1HBUA 1GG0A 3WNPA 5JXSA 1AA1B 3TK7A 1XNQJ 3IRWP 1OGBA 2CPFA 3PW5A 2BDPA 4YB7A 1DJQA 5LXRA 3C3LA 2IVMA 3UGRA 1XKYA 1VEMA 3AZRA 4N8OA 3P96A 3P67A 4MB4A 3T5JA 1PV8A 1YQHA 2VNCA 1VJQA 4NJJA 4F79A 3S8SA 2WSQA 1TL7A 2VPZB 3OLGA 4FOJA 1BKHA 5CC7A 2AMXA 2DB1A 3BGLA 1N34F 1V0MA 5LMUJ 3I7SA 3MQTA 4FK9A 4N2YA 3D2WA 4H6RA 4JNZA 2O01C 4JI7J 5LXYA 3NKYA 1LG1A 4FR6A 2ZM6F 4ED1A 2XNRA 3UGVA 1J0HA 4FKYA 1XFCA 2X8RA 5JIWA 3IM8A 1EJUC 3ITTA 5H8MA 3I6TA 4WCEQ 1A5SA 1WHXA 1GEHA 2WPGA 1M5WA 3R2DJ 1O4UA 1KRBC 4WDUA 3US5A 2MANA 3GIQA 1EJWC 1KTVA 2VFDA 2E5LJ 2JOQA 1FQ0A 4K4WA 4KFNA 3UXLA 3BL3A 1RWPB 5D30A 3QGGA 2VC1A 3W38A 2YXXA 3DBPA 3FKKA 3VA8A 3HQPA 1S39A 1IWAA 1OX5A 3G6VA 2WMGA 2ZYFA 4AAJA 4ED7A 4CLUA 1N36J 3OHIA 2BOPA 1YRTA 4CLTA 2XYHB 5GMDA 1MSWD 3H23A 2LLZA 3RU0A 4FXSA 4Q7BA 3AYTA 1JUEA 4IMGA 3P80A 3V7PA 3P3BA 2X1FA 2HVEA 1I8JA 3OTEA 1UD6A 1E6NA 5IHSA 3LAMA 3UXKA 4NYOA 4F4AA 3I55S 2H4YB 3VFCA 1JQXA 4B15A 2XLJA 1DJ0A 4X66F 4L9XA 2RU9A 5BXIA 2XSBA 4WFYA 4J3WA 2Y0BB 1VK8A 3TMQA 4ID8A 3K2GA 4PTMA 3L09A 1NF0A 3RTVA 2FVPA 3TZNA 3DKDA 3KVJA 2DQXA 2YGYA 1GOXA 2BXJA 2M5YA 3DN5A 2VPYB 2NUUG 4JHZA 4AD1A 4ECSA 4XAFA 4LH8A 1WX0A 4HD5A 2F63A 3KHLA 3AYVA 3IEBA 1UZ1A 1NBEB 2ZRZA 3EWBX 3FV9A 3S2MA 2CU0A 3G5EA 1ZQ5A 3VNKA 2D73A 3MMWA 1HPZB 3G4SS 1A53A 3CLWA 3HPFA 1AMYA 4HNNA 1OT2A 1TUFA 3LHUA 4ZP8A 4L6V3 5KT2A 1OFEA 4S3AA 5BCAA 2VQEF 4KRWA 4HSNA 4A2SA 3WQGA 3FIGA 4LF7F 1PPIA 2AF6A 2XM1A 3DI0A 3WUGA 4MK7A 1FKOA 3M2UB 4CO0A 2ZH6A 1HQTA 2D7SA 3TLLA 1J0YA 1OX6A 3QV9A 3GXNA 3WQFA 5PTDA 3W6MA 4OYXA 1B90A 1LF1A 3S1VA 2XYGB 2YKNB 3JU2A 6A3HA 3FAWA 3VYLA 3IK2A 1RY8A 2WNNA 3RK8A 1ODUA 1O5KA 4ZOBA 1V5VA 4ZJQA 1YHTA 4NEZA 4LFBJ 1K7XA 2VEMA 2GV1A 7A3HA 3EXSA 1LOQA 1RLCL 2QT7A 5HJXA 1AQ0A 3BDKA 4LPCA 5CH9A 4A35A 2DDXA 2J7FA 2NV1A 5HQEA 1WG5A 4XSMA 4C6DA 3VDBA 4IG2A 4Z2IA 4HA1A 1H6KX 3FFSA 1XQLA 4Y6IA 4NPOA 4DM2A 5A94A 5T7LB 2BVDA 1NK9A 5FACA 2E5HA 5AVNA 5A0YB 1TKKA 3OA3A 2CHOA 4DF1A 1XYZA 4OVXA 2ACYA 1VQ4S 4ATNA 5FEWA 3BLLA 1X4EA 4ZQOA 1F1BB 4ASTA 3KX6A 3Q0AA 3I9V9 2ISFA 3EPMA 4CNNA 7TIMA 2Z4PA 3WQCA 4ECTA 4GVBB 3AAWB 5DGBA 1AZSB 1Z44A 2ISVA 4V1Ak 2PIIA 3M6UA 4QS5A 3MCMA 1QVGR 4Q8VA 1EJTC 1RCQA 5BRPA 1US3A 4JDYA 1U1HA 1QY7A 3H2UB 3DGRA 1E1CB 1IHIA 5FJJA 3VIJA 4NLQA 2IXUA 3UQSA 1X1ZA 2ZZ6A 4IL0A 2CNCA 3D7SB 3T5LA 1H7XA 1CXIA 2PRLA 2CQ2A 2QTWA 2W25A 2ERRA 4Q0BA 4ADUA 2J75A 3UJ2A 4GI6A 1NWRA 2Y63A 2Z00A 3D46A 4ZLPA 4FS1A 1R2RA 1VC5A 3NA8A 4GG9A 4UMBA 1S5WA 2A21A 2OSWA 4C6CA 1OFOA 3AIQA 3MUXA 4JI6J 3TE9A 2MNRA 1TA3A 3IRXA 2DV0A 3UWQA 3LENA 3GDTA 2LQ8A 2QN6B 3HO1A 3G1YA 2ZXAA 2B9WA 5I42A 3CQJA 5HO4A 3T41A 1IBLF 3EOUA 3OVAA 1CQNA 3SGGA 2V30A 2DRBA 2P2CB 2PP1A 3G18A 1RAKA 2YNFA 3ONQA 2FPYA 1I3OB 5IM0A 1OZMA 3FZ2A 1ZTVA 1U26A 3A1YG 4Z0SA 1GHSA 4C91A 1XL9A 5D6GA 1PKMA 4PG7A 3KLGB 2E68A 2IXVA 1U5VA 2J7CA 4B91A 1FCQA 4ZOEA 3MP4A 2DUZA 1DWAM 4Q7NA 4ZVFA 3SDEA 4AX6A 3ONBA 3T1HF 2ZWOA 4XKMA 3M9YA 1M9HA 3WQ5A 1S49A 2QCDA 1GZGA 3GZAA 4EE9A 3QWUA 1SZNA 4ES3A 2C28A 3QTGA 1HQEB 4J7RA 3ZZ0A 3PVFA 4DV0F 3KTCA 1N8RT 5GVQA 4KCUA 2B31A 3LLDA 5HWMA 1AZ2A 2Y7DA 1CBKA 2YFOA 3DMJA 3GONA 4Q4KA 3I7RA 4LQ3A 2H3BA 3I6RA 2GLKA 4JKKA 5HVHA 5C7VA 1JPMA 2N4CA 1ZTTA 3EXYA 4MJKA 4WZMA 1U5HA 1PEZA 3YPIA 4V19X 3KK2A 4CIOA 1FCBA 1YX1A 1HKJA 2HISA 4AWSA 2KHCA 1SZFA 3CPGA 1S1TA 5D4LA 4P5UA 4AD6A 1GYNA 3LRMA 4WWSA 1OVDA 3PPHA 1WDTA 4M8LA 2GMJA 1G4SA 3T6JA 2QF8A 1ENUA 2V4RA 1JLBB 3S7RA 2VIHA 3D47A 2YKAA 2HNDB 1UAWA 2B5JB 4DL4A 1U1UA 1RA6A 5J04A 3PPFA 4GUFA 3LO3A 3NQGA 5AOUA 2QMWA 1K1DA 3M44A 4OI1A 3NGDA 1P27B 2DYAA 3VPLA 4A3UA 1H41A 3P84A 1KGWA 4ZIWA 2DT1A 3QW3A 4USVA 1FWFC 1XRTA 1FHDA 5E7OB 2R94A 3GTIA 1G5AA 3TROA 1QNRA 3B8IA 3VCCA 3FY1A 3CL6A 2JX2A 3DDNA 1X97A 3HURA 4UUWA 2HK0A 3QTPA 2N4DA 4PUUA 3L7PA 5AE1A 2OGUA 1KN6A 2D24A 5F3TA 3L5LA 1SUXA 4FYVB 1RA7A 3BM7A 3JSMA 1DKWA 2P88A 1CXLA 3RLHA 2FVCA 3LB0A 4NNBA 1GORA 2XGBA 2OKQA 2WZTA 3GG7A 2RKXA 4HGXA 4CTAB 3W25A 3ENQA 3RNDA 3Q8SB 4NLPA 3WD0A 2ZUMA 1FWAC 5CYMB 4USJC 1REVA 1U2RA 4CN6A 4DQIA 1I1XA 3SSQA 4IQMA 2RT3A 2E1DA 3DLLQ 1TV5A 2QL7B 3PZTA 4O1CA 2MKKA 3KMSA 3GBEA 1U1PA 1RISA 1TELA 2DUAA 2COLA 5HBFA 3KBWA 3REQB 1Q85A 1C93A 3ELFA 5A8RA 4BCAA 2V9WA 2HFNA 1EQPA 1N8IA 1XBVA 3IG1A 4WSHA 3TC7A 3ZS4A 4FS9A 1S9GA 3DYAA 4CLMA 4ECUA 4GGHA 1B4EA 2F84A 1RB0A 3OJSA 3CBWA 3HFTA 3D0IE 3KLFA 3NMRA 1S72S 3LBMA 3LOUA 4PR6A 1ROFA 4LBHA 3H98A 4IMDA 1SH3A 2H54B 2XIJA 3LW5C 3M0JA 6REQA 3QYYA 5KFWA 3QSIA 3GXPA 2XYPB 4QIEA 3P6LA 4Q45A 2GFTA 3K13A 1DE6A 4OYIA 4ML9A 2INEA 1KFJA 1HQUB 5E1QA 3HQOA 4LF8F 4WLCA 3PR5B 3K0JA 4RZ6A 3K59A 3W1RA 1ZAHA 2PMZD 2J6TA 2QAPA 1WQ5A 5XIAA 2W67A 1UJ6A 1LRTA 4Z2LA 2M9KA 3OR1A 1AMKA 2AGOA 4DLMA 3EAUA 2D20A 4MB5A 1JULA 1C1BA 1QJWA 4FZIA 3CZJA 3WK0A 3WQEA 4M5NA 1HNZJ 2ON3A 1Z3NA 1E4MM 4QGCA 2Q79A 3CNYA 3VIMA 2PDNA 4ES1A 4JTIA 2ACSA 3LBCA 3C0QA 1XR6A 3SSJA 3DFSA 4WJ8A 2J9ZA 1P1LA 1R8PA 3W85A 1KHVA 4V15A 4H83A 3NG8A 1KTNA 5AB3A 4RW9A 1YNPA 4D72A 2FLLA 1JYWA 3UDCA 2AQOA 3AWNA 1JPDX 3SADA 4I69A 4O17A 1Z89A 4US6A 1O6IA 2NZLA 3C8YA 1X7IA 3K8KA 2CVEA 3QT6A 3NQ2A 4KWWA 1HNXF 3GRIA 4G5DA 2ZDOA 1I6NA 4U4MA 4ECQA 2YWFA 1R6WA 1NB2A 3O6YX 2IYGA 3TTSA 3RRKA 2RDTA 5CPMA 4UWMA 4DPYA 3V6DB 5CBBA 2QPSA 2AIRB 2Q8LA 2Z2MA 3K1DA 2BOAA 1BYDA 3GFXA 5DMNA 3OYZA 4UY85 4Q8NA 1M7PA 5D9OA 3HI9A 3E0LA 4AXIA 1NB7A 4MG4A 2HNZB 4N76A 3QGIA 2PDGA 1ZPVA 1X9MA 3ZVHB 1PC5A 2LU2A 5KFTA 1RYSA 2WVFA 4GI4A 3MHGA 3G1XA 3OQ8A 2F1FA 3AY0A 4UT4A 3ZSSA 4DBSA 3VAGA 3SFGA 3QAEA 4R0JA 4OZOA 4BWLC 4TVCA 2MZQA 1IEWA 2PU1A 4DBEA 2NZCA 4L74A 5ETQA 1PE1A 3UA3A 1QAPA 1JQVA 2VG6A 1ZA1B 1US0A 2Q3OA 4KWUA 3NXZA 3SN0A 2OD4A 2ZE2B 2PGFA 1HO1A 3LV6A 5IFTA 1NEEA 1K9EA 1PWLA 3O7UA 3ZTSA 3ZFVA 3KLVA 4B3SJ 3T44A 2OYLA 4AEEA 3PY8A 5D3GA 1QPKA 5A6AA 3CPWR 3DBNA 3RYLA 2R3VA 2OQYA 4AZCA 1KCKA 4HNLA 3AJXA 2C2NA 2DO0A 3AYRA 3SUVA 1XMOF 2WANA 1IYXA 3UF9A 1FX4A 1AODA 3QO9A 4URIA 3C66A 1AW0A 4QJ3B 1DARA 4H8NA 3TCSA 1IE7C 5FEXA 5B09A 3PBGA 4GINA 3VVGA 3RAXA 3RIKA 1V7YA 3E0FA 2CPZA 3NWGA 3ZIZA 2VG5B 3RW7A 2PLMA 5I6SA 4WF7A 5GMEA 3LMYA 3NL5A 4D3HA 5GAEI 3LGHA 4XBJA 1OJ4A 2R7OA 2AEFA 4P7NA 3QZ6A 5U4NA 1QAXA 2DORA 2DIKA 4ZQMA 3ALGA 2C3UA 3W07A 2WC7A 1G6CA 1O7AA 1WDWA 1TREA 4HH0A 2OD6A 2JHEA 4QIVA 4LV4A 1A0OB 1S97A 4NA3A 3M16A 4AEFA 1CS4A 1F5AA 4P10A 1JGMA 1IEQA 2PS2A 4NA1A 1KM6A 1ALDA 1J10A 1MUCA 3IJ8A 4H9TA 3FJ6A 1MMFA 2KFNA 4C7FA 3I68A 4P61A 1EJVC 3QLLA 1MU2A 5CZJA 2RKIB 4ILMA 1U6BA 2IKIA 1AXQA 1YK9A 4DXLA 4LSLB 3WLSA 4DUOA 1F2JA 1LWJA 1SC6A 3Q23A 2XZ7A 4CEUC 1WG4A 3ZOAA 3UFYA 2VBYA 3Q8YA 3N6MA 1OCNA 1F9EB 2WOQA 4YTQA 1RK8A 5JBEA 2LA4A 5GAGU 3LSBA 4QLLA 1WCGA 4CRJA 4O14A 2FH8A 2IUZA 1V0KA 2XIMA 1RBAA 4P2MA 1BUXA 4JQ3A 3TZFA 2DHHA 1S2AA 4EACA 2OGYA 2A1BA 5CYJA 4J40A 3CUXA 2J0SD 1VRXA 2REQA 3ABRA 3V2UC 3OIXA 4LWWA 4ZITA 1PO9A 2Y5EA 2NVCA 2E29A 4AH7A 2ZZ5A 3CUIA 4GCXA 3T2PA 1WBJA 1M1HA 1GW1A 1VQ7S 3OL9A 4WJEA 1OC5A 3IBWA 1KFLA 1E40A 1JCLA 3NEHA 2MYFA 3TA1A 3W74A 1R8CA 2HGLA 1YJ9S 4TOQA 5LXEA 4B3TF 2ZH4A 4JL1A 4ZFCA 4KCWA 3WBAA 1W5QA 2PU0A 4DF2A 5IBXC 1LUCA 3AS3A 2PRMA 2WQPA 3TJAA 4LOCA 1JYNA 3JW7A 2NYHA 1LNQA 1Q16B 1WKYA 1DBDA 3N9KA 4R85A 1ZOTA 2HS6A 3ILOA 3BOFA 4K59A 3SY8A 1NDWA 5B80A 2QEXS 3RR7A 3U5YA 1P6CA 5J2NA 3DG6A 2OPSA 1RWXB 1PSCA 4ZSTA 3U1MA 2RRAA 2R14A 3I5AA 5AHMA 5FESA 1VCVA 1H50A 3PZVA 1MXGA 4O0NA 3GDLA 3OTRA 3PANA 1DJNA 4NXSA 1VOMA 1QUMA 4CUCA 4S3FA 4S3BA 3PY2A 4MVAA 2KVIA 4NF7A 2HVMA 2PDQA 5E70A 2B7QA 4YJ5A 4YMZA 2MKCA 2WVTA 1YNQA 1KTCA 3AFGA 3IV8A 5KG3A 4A8OA 5IWAJ 2FHJD 2ANUA 3CYVA 3QBCA 1NDCA 3G6ES 4B3RF 1PBGA 3VD9A 2W2PP 5LMNJ 2A2DA 5GNXA 3ZZPA 1WXZA 2OSXA 2GNKA 2ZTJA 5K4XA 5E5NA 3HX9A 3OGSA 2ZA1A 2BVTA 1X5PA 2WWDA 4Z2HA 2XNQA 3B0VC 1ISYA 1Z2LA 1GOMA 1M90T 4AVFA 3KZPA 3N5FA 2AEJA 2ABYA 2BV3A 2FZMA 1GG1A 2IKJA 4QJ4B 3UT0A 4KKXA 3HVTB 2I9SA 1T9YA 3FRYA 3DOMB 4AZHA 4WJXA 3QZ7A 1FWEC 2HHXA 4NX0A 5L8RC 2A18A 2BACA 1TV6A 5EWEA 1FXDA 3VOIA 3WK2A 2WB5A 2FHJA 1BF6A 3M0YA 3D6HB 5D2YA 4Y2KA 2QDHA 4KH2A 2XMAA 4HBKA 3EZUA 2PE4A 4ZPTR 3MI7X 1IKXB 4AMCA 2A3BA 2D69A 3B05A 4JNYA 1JCTA 1YG0A 1YBUA 1VRTB 3HM7A 3UCZP 3TNVA 4JYFA 2K8GA 2GYIA 4A47A 5D05A 3WDQA 2MQ8A 4W88A 3EUNA 1OY6A 1VK3A 4FX7A 2AYMA 2G37A 1L3TA 4IR9A 2WYSA 4B9TA 2EG7A 3C4UA 4W8AA 2J77A 3JSRA 2J7GA 1MG7A 1RT2A 3HHEA 1S1UB 2ZKTA 3WNNA 2W0UA 3GO2A 4OWGA 4ADSA 4FLRA 5IFPA 3W7RA 1A5MC 2GOKA 1KM0A 2H6RA 3Q83A 2R7RA 3H7UA 1E43A 1IGWA 5EGRA 2FIUA 4NMLA 1QBBA 3ZQ9A 2RDWA 4I7WA 4HMEA 1XJBA 4UCGA 4USTA 1YTEA 4KEUA 1SL2A 1JJKA 1WI8A 1GQJA 4OUEA 3FVMA 3Q2SC 2Z25A 4KKOB 4R33A 3PRVA 3PRDA 4GNJA 1ITUA 3ZZ1A 1LW0B 4W92B 1EX5A 5KSWA 3T8QA 1RU1A 4EO8A 4IJBA 4D6FA 1IKVA 3CZ8A 1UG6A 4ENLA 1JGIA 1ZZMA 5BU9A 3HDSA 4GKLA 4P75A 2R2SA 2QUMA 1EB0A 2X1RA 2WSFC 4F0KA 1T8EA 1HKKA 2C2MB 4KYZA 2GSJA 4UQEA 4ZIVA 1KQYA 2ATCB 4I67A 3NCQA 5A6WA 3SMZA 3PZIA 1UJQA 3L12A 4G8TA 1JCMP 1J11A 3N6JA 4PMXA 1U6FA 2XY6A 1OYCA 3AFBA 3DAQA 3ANUA 2UVUA 4TTGA 3CTLA 1QAIA 5LA0A 4DR4J 4X2BA 4LEQA 2E5JA 5HMYA 3DLKA 4UTGA 2ZH3A 3WQDA 5A6PA 5FIPA 2Z0IA 4QE1A 5CZVA 5IRPA 5HPOA 3C14B 4OI4A 2VWTA 1DWHM 4JFTA 2HQAA 2LQJA 3PWGA 3SFKA 1TL1A 2V50A 3M2UA 2ZUGA 2VTFA 4P7QA 4RW4B 4TKTA 1K0VA 3J7YU 3O2IA 1NAL1 1XG3A 1Z2ZA 2BNJA 1UWBB 2C79A 5LIXX 5H91A 4FF1A 1GVEA 4CU6A 2YKNA 3GIPA 4IPLA 1ZJAA 2G1HA 4G56A 1I2QA 5E09A 4RPFA 4ZVJA 2CPYA 4MSSA 3TYCA 3AH6A 1JDAA 2I38A 3CMGA 3W62A 1VQPS 3SCUA 4XZNX 5C6MA 2E8YA 1OGSA 4RXGA 1M04A 1I2OA 1OFDA 5DS7A 4IT1A 2J9EA 1N55A 4U2YA 1SPBP 3BLPX 2BHYA 2X05A 2GSHA 5BNKA 5D0GA 1W0MA 1V03A 1LQAA 3R5JB 2GFFA 3GXTA 1NOFA 1FK9B 5T7LA 1GOIA 2RH3A 2OMAA 4ZQCA 4U8YA 4YFUA 3GVGA 1W9VA 4M6PA 4Q8EA 4Q4PA 4F66A 5IT0A 1NK6A 5A0YA 2V67A 3HFZB 2X30A 4F0MA 1PZ3A 2BASA 2R1PA 4J9RA 1RALA 2FTRA 3NO5A 3SAZA 4LR9A 2OFHX 2CJYB 1UJ4A 4ZB5A 5CJ5A 4F26A 2R8JA 4HHHA 4X3ZA 2J4GA 4ACZB 4GVBA 1A47A 1MRAA 4ILRA 3HN3A 1AZSA 2FYMA 4B9SA 4QE4A 1OT1A 2VO5A 4J1OA 4E8CA 3V5FA 2KZHA 2D41A 4UZBA 1L3VA 2VI0A 1HR0F 1I1GA 1L8NA 3RM9A 2AZ1A 1E1CA 1RAAB 4A8MP 4MAKA 3EX3A 1LLWA 3CQHA 4KWVA 4A3HA 1YW1A 1QT1A 2DSZA 1BMQB 5EX3A 2FDSA 3DC8A 4QHRA 4Y0FA 4C5YA 1CQMA 2BW2A 1UVLA 4PH6A 2R7VA 3U57A 3NNCA 1O1HA 4X84A 3GR1A 3MFIA 3WZ0A 4UTWC 1LFPA 4CLZA 4JI1J 1SI9A 4U95A 4LANA 5HMEA 3QZEA 4XAZA 3HMJG 3TTYA 4ZS6A 4DJFD 3DDIA 4FBUA 4PYAA 4Q7AA 1K4HA 1QMLA 3ENLA 4RLIA 1F8MA 1IGSA 4QJ5B 5LL6d 2FIQA 2HE5A 2KT5A 4BWJA 3D5HA 4NHVA 4I3GA 2HQDA 3OLEA 3IGVA 2EBGA 4X4VA 4YVXA 2J0WA 2YNGB 4XK8C 1N48A 3P6YC 3CCMS 5CBIA 1F5BA 3UNYA 3LMZA 1OWQA 2BJ3A 3S6EA 3HHKA 3D0GE 3C6CA 4ZL1A 3CUHA 1RYRA 2GAHC 4Y2MA 2BHUA 8CGTA 3H8YA 5HK4A 2KT2A 3H55A 5FJIA 1KFSA 3F4CA 1E0TA 1HQEA 4M5HA 4IRKA 1EX1A 1U6ZA 2D3OR 2XMVA 5ENLA 3MBFA 1CC7A 2A0NA 1Q63A 2XGIA 3AXIA 4UTFA 1TQLA 2E9MA 4DJFA 2JLFA 4EYIB 1QW9A 2XG8A 2JVOA 3GWQA 3GG8A 2QF7A 4AISA 4CNPA 3FJLA 4GC3A 2OKOA 3VAFA 1M3UA 4M7TA 2OHDA 2DNKA 2HV5A 4RU9A 5KFFA 4NNCA 4C1NB 4DSKA 2C16A 2BM1A 4NT0A 3GBDA 3H12A 3J7Z5 1FWJC 3BV7A 5J2QB 3BH6B 2LLEA 4PSPA 1JLBA 4WR3A 4FZVA 5AT1B 2B4OA 2QCGA 4CNUA 3A21A 1SH0A 1ELOA 2B5JA 3CM4A 5BWFA 1V02A 4UFLA 3IUIA 3VC6A 3VE9A 1WXJA 1H98A 4OL8A 2J9YA 2MZ1A 3W5YA 3U7JA 4B4HA 1K03A 1UMJA 1XBWA 4ZLLA 3IIZA 5E0KA 3VUSA 2VCBA 4F9DA 3LA4A 2DNHA 4KQNA 3WMSA 3BF4A 1C8XA 3ZR5A 4H01A 4EVZA 3F44A 1S1PA 4CQ8A 1RT4A 3R11A 1DTTB 1JLFB 3GTFA 1UP1A 3L21A 2DCUB 3O15A 4TXSA 3LCFA 2FTYA 4GJJA 4WDXA 3HVWA 2HHUA 2GAGC 3R9LA 1XV8A 3MMBB 1B9ZA 1WDRA 2UU9F 1N2VA 4HHLA 1Q7QA 5DLFA 2MHNA 2M52A 1FEHA 1Y7PA 2DBBA 1E0UA 4HDHA 2RJGA 2D0HA 5HJYA 3CJTA 3VABA 2D3LA 4LTSA 2QJNA 2HYIB 1OCBA 2ZQ0A 1M03A 2QGYA 2E9BA 1LWXA 3BO3A 4N4PA 3R5CA 1J5TA 4TX9A 1PWMA 4JI3J 3PR2A 4KB7A 1R3TA 2W3ZA 2VBWA 4X22A 2X1AA 3QHNA 4LQ1A 3CUNA 4P2FA 3UERA 3OG2A 5K8NA 1YHQS 3FJ2A 3VFLA 2YKKA 3ZR6A 3EVOA 4NZ1A 4AG0A 5A8WB 3URBA 1H7NA 3L0KA 4JCMA 3BICA 4KGMA 3REQA 5LSLA 1VBXA 4MWAB 2DSUA 3KHHA 5DM7Q 1P7TB 4E98A 4ZVTB 1UCNA 2P9GA 3FVYA 3SCLE 4NYYA 4MK9A 2QVHA 1X96A 5DT5A 4FNUA 4DL0C 1YWXA 4J2PA 4HTBA 4HVXA 1OQFA 1BWVA 1HZYA 4WTOB 3HG2A 1WC6A 2HIYA 2PLCA 4RPPA 2NLIA 3MTKA 1P6BA 5CD4H 3HXMA 2OTJS 5EMLA 4O28A 2LCWA 1PS9A 3FOKA 3LPGA 1HQUA 3E51A 3PS7A 3RGIA 1MNSA 2WHJA 1Y65A 3B3DA 1YDYA 5D8HB 5AVHA 3A4AA 4LQ9A 1RWNB 4JKLA 4DX5A 1FWIC 4C1KA 1EJXC 3AICA 1SSDA 1OYAA 3PBVA 2DXDA 4U3CA 4NAEA 1J12A 3WQOA 1NPPA 1DBTA 3BTNA 3SFUA 2GJXB 4GY0A 2F9RA 3WD1A 4RU2A 4M6UA 1BE4A 4LX4A 1DQXA 4H9VA 1K9FA 3N01A 2K1RB 3WJWA 2ZDSA 3CDAA 2UUCF 2GL5A 4FI4A 4WEVX 2E1WA 3V5RA 4AL7A 4DV4J 3OTOJ 5BRBA 4HYRA 4PRFA 3DGBA 3EVMA 3Q8PB 4FYWB 4IUOA 3KLHB 4JFWA 2PPGA 2CWNA 1T11A 1XNQF 3M30B 2BGSA 3VCDA 4MIBA 4HI1A 2CJ9A 3FSXA 1J2BA 1BHGA 3N19B 1QK0A 1D9FA 4C6MA 3MDFA 3CEUA 4G2DA 4F50A 3VR1A 1MFUA 1XYAA 4GOAA 4I5XA 3V6DA 3IA0A 3QNWB 2NXGA 3OSNA 1RWOB 4OT7A 1XR5A 1E9IA 1V77A 1K1QA 4RNJA 2HNZA 1UIPA 1G94A 3ZVHA 3H42A 4ANDA 4JI7F 4RJVA 3OHBA 2JIWA 2WTFA 3N9RA 1F61A 2YBUA 3M41A 3M8ZA 1TFWA 1JPHA 4TU7A 5IS2A 4K37A 4U5KA 3EDQB 3PR4A 1EDQA 1XM3A 4HNUA 4F36A 1X39A 2BKNA 1U2CA 2IYIA 4E8UA 4YR2A 3QZ8A 1DZ5A 1JI1A 3W7OA 2CAJA 1TUVA 2RQMA 2FGOA 3UESA 3TVYA 4LS2A 3NTYA 2ZE2A 2MQQA 2DIVA 4F7VA 4Y96A 4TY8B 3IGNA 1UVKA 2AGQA 4P52A 4LBSA 5C5YA 5KT6A 4B9VA 1L6WA 2XN0A 3LBOA 3M0KA 4I0WA 4GY1A 4AU0A 2BS9A 1LEOA 1NWSA 4EEYA 4OFZA 3SCVA 2JEJA 2B3TB 1HI8A 5GMKa 2DGTA 1GVRA 3ALFA 3UG4A 3I5CA 4R0EA 3OBAA 5E3PA 1DL3A 3IUDA 1GEQA 3SRDA 4HIBA 1BTMA 5HNRA 1JLAB 2MKSA 4G65A 2IMWP 3FEXB 3MJYA 3EXTA 5HI7A 4Q4QA 4J91A 3T9ZA 1RJJA 2F8MA 4WFAQ 1GTHA 2OQHA 3BUVA 4GVHA 1RAHB 2ZEJA 5JH2A 4S3EA 4BBYA 3OFGA 4Y3CA 1BLIA 2QE5A 1LDCA 2BW7A 2Z2YB 4G1PA 4O4VA 3SN1A 3HPZA 3DI6B 1PZ2A 3VIPA 2XVKA 4CH1A 5HP1B 3WK1A 4AWEA 4HR2A 2J6UA 3E5BA 2DW6A 4CZCA 3FCVA 4UC5A 1VRQC 4BEQA 5KMYA 2CA9A 3IBCB 3GNOA 4UOFA 4AVNA 5K9XA 1X4AA 1MI3A 1P9QC 1PIFA 1TPDA 3CIVA 1W5NA 2GJRA 3LCHA 3PX4A 2YA0A 2KJWA 1LWIA 3M7WA 4OX8A 4USIA 5E3CA 2E6YA 8A3HA 3N18A 4CQCA 3TQVA 2EK6A 2WZ1A 5E6ZA 5FSDC 4UTMA 3T78A 2GC8A 2I2YA 3R0KA 3PW2A 2VD3A 3GCWP 2VPWB 5KFHA 1F3WA 2VYOA 2EKYA 5JH1A 2M0GB 3FUYA 5KFOA 2MKIA 2HVHA 1E5NA 1CX9A 3TEGA 1LQ9A 4Y2WA 2O9RA 3FQKA 4KR0B 1VQ5S 3DHWC 3RJMB 4DU8A 2BRLA 3VKCA 4K4TA 5F3ZA 1HKWA 3PZUA 4DQQA 1J2WA 4UUIA 2QZRA 1FBAA 2UBPC 2UVWA 2VDIA 3SQGB 4UBPC 2E1MC 2NV2A 2N7YA 3RILA 1S10A 1X4DA 5HBMB 3CCRS 1IXPA 1HXJA 4KV8A 1TK8A 2Z1KA 3D1QA 4QM1A 3PM9A 2Y89A 4FBTA 2HRTA 4WTYA 2YNHB 4HLBA 1Q8JA 1T9XA 1B0PA 3MFHA 3GTXA 3HA1A 2LECA 1IM6A 4IH3A 4DBUA 1E6SM 2BABA 4PULA 3CVKA 4PL1A 3PTKA 3MD3A 4AUKA 4MY9A 5TBOA 3BW2A 4GE8A 1KM4A 5F8IA 3WZ0E 2UUAJ 4Y2CA 3GV7B 1Y5IB 3CPUA 2W62A 3QOKA 4XTIA 2XGZA 3MM9B 1MDLA 1VRUB 4LCRA 1TE6A 5DQPA 3DFEA 5E41A 3KOYA 2FLPA 5IT9U 3C8NA 2EFVA 4O50A 1SH2A 2H65B 1XCFA 2W4XA 1SIWB 2BQUA 4F0LA 2BOGX 1XIIA 1HI0P 1PBUA 1F0XA 5GAHU 3ATYA 1KOHA 3CCLS 4YHEA 3MB9A 4RDYA 3FCWA 3KCLA 1UZDA 3VKAA 4L73A 4IP7A 1YXDA 3B0PA 3NGSA 1WPCA 2QGHA 3TWBA 4LBIA 1S5ZA 4AFFA 2VBZA 4WDWA 4D6IA 4WYWA 2V5CA 1C4AA 3IAS9 3EPNA 3FSYA 4PG5A 3CDBA 4IXXA 4JI0F 4HPGA 1JD9A 3SGUA 3K7RA 1NFBA 3R6LB 2HPMA 3PHTA 4IMEA 4KPYA 1SB6A 3DUGA 4JI6F 2W4PA 1VJZA 3IRDA 4LMZA 2Z6JA 4IIGA 4TX6A 1JUKA 3TA2A 2FFCA 1R8AA 1RR2A 3S1TA 2GX8A 2JIEA 3ITLA 2V2VA 1DYSA 3DIPA 5KFEA 4GBUA 1U1RA 3FBFA 4JI8J 2XI2A 3IJLA 3AB2B 4O3PA 2EKGA 1FFRA 1VHNA 4LU0A 3K4AA 1MEHA 1OBAA 4QXIA 3AQPA 3DOMA 3M0ZA 3KRBA 3D67A 2BE2B 2HQ3A 1NRKA 4BC7A 3T08A 1QU4A 4DMZA 3AJDA 1T7LA 1RHRB 3INPA 1Q6GA 2B9XA 2CFXA 3MP5A 1IV8A 1V02E 3P14A 4D3GA 4QFUA 1S0MA 3VF0B 1NF7A 4ZKAA 3C3UA 4ED6A 1ZPTA 2PEBA 4HVZA 4OLOA 4JY9A 4CQDA 4L80A 4MFDA 3H5XA 2Z7GA 4FX6M 2NXHA 1VFJA 2MSSA 3RJYA 1I51B 1HL8A 4DV2J 5DGAA 1B3OA 1VRTA 2CJKA 3KXDA 3KK1B 1N6QB 4DSJA 1FDYA 2WOMA 6ALDA 1B0VA 4D1IA 2J74A 2C3ZA 3WEZA 1S2VA 2HWTA 2R1LA 3V6KA 1UFKA 1TL3B 2VPXB 2O9TA 4S3DA 1GMWA 1E5JA 4LC8A 1K44A 2VWSA 5C5JA 1PKLA 1BQMB 3IIPA 4JP8A 5CH7B 3T8LA 3SR7A 1FFQA 3CJ8A 1URRA 2XQCA 3GV8B 1CJTA 2BXYA 3D6NA 5CAKA 1EO5A 3HHDA 3ZJ6A 4Y9MA 2CUYA 5HULA 4GQGA 1A5NC 5B7YA 3OVBA 3SCSA 2Y61A 1BYAA 4WK9A 3I0SB 3G71S 2QVNA 4O1DA 3GC4A 3HFKA 1OINA 3OZOA 2C1IA 2DO4A 5LJ3Y 1G69A 3M0IA 2HHPA 4KKOA 4O3OA 3Q2TC 4ITSA 2E6DA 1XLGA 4LF9F 2IY5B 1XBXA 3V4IB 4RNOA 4JIEA 3CCZA 3U48A 2PDAA 2U2FA 3MZIA 1FFGB 1AVAA 4XBSA 4QIUA 3PUOA 5LSRA 5K7JA 1TV7A 2A6LA 1AQMA 1U47A 8RUCA 2R7UA 4DV3F 3TAOA 4FOUA 3WH9A 3LP2B 1RD6A 1AFIA 4ZODA 2ZIDA 5HQLA 3GQYA 2H48B 1B3VA 3ELHA 9ATCB 3W1PA 5F9NA 2R42A 4MIWA 3AU2A 2PWVA 2ZUUA 3K89A 4PUMA 2WBGA 2BYCA 3TX8A 3ZTPA 1N33J 2VFIA 1F74A 1Q8AA 1XH2A 2O55A 3MMAB 5D9MA 2LVWA 3AA9A 4L3KA 4KE5A 2XO7A 1XS2A 1HKVA 2DR9A 2P5NA 2ZXBA 1WTFA 3CGTA 3IR5B 4ZPWR 3C14A 3HKZD 3N4WA 5D03A 4N6FA 2XI3A 1E0VA 5EBAA 6AT1B 4LSZB 2OEMA 1SM9A 1XEZA 1UWBA 1EWDA 3OGRA 2RUGA 4IH6A 2CJXB 5LNRA 2XH0A 3WL1A 2EHHA 3FN9A 2ZKUA 4FYYB 1Y3JA 2Y0FA 1AB8A 4ANCA 7PTDA 2WV8A 5AXNA 4KO0B 1PTDA 1CZ1A 3MI2A 3VILA 1NSPA 2FHMA 5IFMA 1MEIA 1VP5A 4CNSA 1CJKA 3WDOA 4DQSA 4F8XA 4FLSA 1FWGC 5KFLA 5A8PA 4B3OB 1OGGA 3T9NA 3MYOA 4DCJB 1HNYA 1T9TA 4QQUA 1L6FA 3TWAA 4EWTA 4EBCA 5XINA 3AOCA 1FHTA 3F0NA 3K8VA 2OLAA 4YCPA 4KFOA 2R1KA 2DHGA 4C11B 4U7UD 1V0LA 2JKAA 2O92A 3S9IA 2BX6A 3AJ1A 2O0TA 4DO7A 1CGXA 3GD6A 1OQ6A 1W2BR 3RBZA 2FH6A 2GVEA 3BG5A 2FZNA 2HVOA 2W7PA 2HVDA 2WSYA 3BG3A 3DFHA 3R8HA 4PG6A 3W7JA 1XPYA 2F8EX 1ECEA 5KG2A 1SO6A 2Y62A 4WXOA 4ACZA 3WLJA 1HNZF 3H8AA 1FE0A 3K5OA 3VK5A 2CWKA 4ORMA 1WC4A 1RDRA 1FJGJ 1B57A 4KEMA 3VXGA 4CKQA 3ZM8A 2B4PA 4R8UB 1B30A 4EI2A 4W85A 4GGBA 2PLKA 3T0AA 1CGVA 3SO7A 4DR6F 3QPEA 4NL1A 5I07A 3ZYZA 1T05B 4IM4A 3PX6A 3GK0A 4JN7A 2R8IA 1WKKA 2BXZA 4L5ZA 4DJEC 3WBWA 2PAJA 1IBKJ 4Q4MA 2DNOA 3ARUA 2J8SA 4XIAA 2I5JB 1RU2A 4CQ1A 2P0OA 4NUWA 5DMLA 5I77A 4M80A 2XN1A 2FTWA 4YP3A 3OT9A 3ZNUA 4CLLA 3PVXA 1UB3A 4JTJA 1AJ2A 1R0MA 1NNDA 1WG1A 4NLYA 5D2XA 2WRMA 3ILIA 3UI3A 2W4DA 3PBYA 3RCYA 1K8CA 2XH2A 5EMMA 1ZRQA 5FF4A 5DQHA 2XJ7A 1M7XA 1NARA 2YNGA 4ER8A 1JCJA 4YTUA 4X4RA 1LK7A 4DR3J 2EPOA 3FYPA 1KONA 3F4VA 1EF2A 3PX0A 2Y8VA 2PDIA 1KLNA 1TFVA 2UZAA 2YX1A 5AJ3J 1WDQA 4ENOA 4QR2A 2AGPA 4M5DB 4GNKB 2K7JA 2MQPA 4M81A 3UR0A 5ETSA 3VAHA 1FCUA 1W37A 2AMGA 4FSAA 3C2YA 4DELA 2FGZA 3EB3A 3W6YA 2RUSA 1QW8A 1VYAA 3IGSA 1GJWA 2HNYB 4XISA 1SR9A 1W1VA 2WHKA 3DENA 4O1FA 5HATA 3VDAA 5CA5A 3PK7A 1V7AA 2QNEA 1SFJA 2X16A 1QSLA 1GVFA 3FGVA 5CSYA 3CCJS 4D2JA 4WVXA 2G96A 2J9CA 1IUJA 2YFNA 3M46A 3TKFA 1WOBA 4LY8A 1BXNA 3ETOA 1FJEB 1HL6A 1ZUAX 2A3AA 4C1NA 2GJ2A 3LY0A 3G6MA 4K6AA 2XFWA 3WDRA 2J7EA 2QIIA 3GY1A 4P72A 5IOLA 2DP3A 4AHPA 4DBQA 1QM9A 3BGOP 2PC4A 3GXDA 1H1YA 5J2QA 4HZMA 3E0VA 3C3NA 3SSSA 1CWYA 2Y1LB 2LEAA 4NU7A 3VO0A 3SIMA 2QCNA 4YVVA 2AWZA 3CD5A 2R2TA 1JLEA 4I64A 4NI2B 4EF8A 3H0PA 2OO0A 4LRAA 2JZ5A 4RW8B 1PCWA 3BKFA 1N34J 4ROPA 4Q8WA 4ZXLA 2MKYA 4JICA 4EPEC 2OZ0A 1NP0A 1NWTA 4DZIA 3L7OA 2UY5A 1SJRA 1DTTA 1ZPWX 1JLFA 1U1MA 1SL1A 4MHBA 1TJRA 3EX1A 3NPUA 2JE8A 3NVTA 1FXLA 3NS7B 2KM8C 3J80U 1P48A 2ROGA 4I2PB 4KHPJ 2CLOA 1XICA 5AYYA 2BVZA 3MMBA 3CQ0A 3TUPA 1RJQA 1ME7A 2DU2A 2MTLA 1J5OB 1W1PA 1BQNB 1E6ZA 3JQKA 4H4KA 4A21A 2A2CA 2XB2D 1DPMA 5D4NA 2QYCA 1B64A 1N82A 3W24A 4E6MA 2WC4A 1T6MA 3Q2DA 5HMWA 3NUKA 2POTA 1J8VA 1RQHA 2EGZA 5ABFA 4ZGYA 1SC3B 4ZO7A 2RGLA 3CUGA 1A80A 1EKOA 2CLIA 2YH1A 4IFKB 1UJPA 4Y28C 2DPIA 4J3VA 3TOPA 1CVJA 2QV6A 1V6TA 4ICMA 2MHEA 3AMDA 4AZ6A 4FNPA 5A8WA 2DR5A 1S1VB 4IX0A 1FRMA 1G7UA 2OLHA 4DZAA 1P7TA 4XVEA 3S2LA 3DLBA 3S9ZA 2PD5A 4I8DA 5HUPA 1A0CA 4NIRA 2C91A 2HURA 4K4SA 4CCHA 4IUGA 2VFRA 2QUTA 2E28A 3SXLA 1NAQA 3CD6S 4MUPA 3FQLA 2X1SA 3TVAA 4OE7A 4R27A 3W0KA 4CCCA 4AYBD 4MZYA 1XJWB 3K17A 4DV5J 2YCKX 4C2MA 2LFVA 1MW0A 1IWBA 3H54A 4ZB0A 4CN1A 4UTIA 1JD7A 4FO4A 2BZNA 3IJ9A 1K8AT 2FQQB 3CWOX 4GYPA 2VR2A 4GISA 4S3JA 4O44A 2X3GA 4PWDB 3FEZA 3ZTQA 4OYPA 2KAUC 1E0XA 4X4TA 5AE2A 4TU1A 4LVDA 1PYSB 4R7JA 3HIJA 4LUSB 4GC4A 2ILZA 3RX4A 4BWMA 3CDUA 4ETXA 2H3DA 3GU1A 2X1TA 2G50A 1TE1A 4ZK7M 3OBIA 4ERIA 1TTQA 3TONA 4JNMA 2UXCJ 2CKRA 1Q79A 1XLAA 5K9CA 1CLKA 3ICLA 2GJXA 1BGXT 2RS2A 2FZDA 1P4CA 3KBSA 1JZ4A 2IC3B 4IOCQ 1SCJB 3PZOA 2YCJA 4LF7J 3DECA 2XZTB 2VONA 3GTYX 2HQFA 5I3PA 1VRDA 3FBBA 4OJHA 4JTFA 1FWSA 4PSRA 4UZSA 4CLSA 3GMGA 1BVNP 1XCXA 4Y65A 3AHYA 4KC5A 2CPIA 3VWSA 2XMTA 4ZO8A 2VA2A 3I96A 2FYXA 4MLRA 3NL2A 1VQMS 1KRCC 1WEZA 3VD5A 4DR5J 3ZZOA 3LXAA 3U2ZA 3BSOA 3JVAA 4JTGA 4W8LA 3LPOA 4KBXA 3KLHA 3VZYA 4W8BA 4XKYB 5LMNF 3WF0A 1PIIA 1F3FA 3M30A 3ATZA 2UY3A 4XVDA 5AHEA 3Q45A 3BLFA 3HG3A 1S4EA 4CNZA 1KVKA 4RWWA 3GH5A 4N02A 2ZC4A 1K9MT 4S2BA 2ZWYA 4FNTA 3MTWA 3TN3A 3COTA 3M8QB 5F8LA 1T02A 4LS1A 4LRFA 3MANA 1LROA 4JFVA 2QLFB 4NCBA 2IM3A 4ZVHA 1QI3A 3EDKA 4P7OA 2H51B 5JVHQ 2GWNA 4IG0B 2DSWA 1OO0B 1F60B 3RCMA 4GZIA 4HK5A 3KUEA 1G67A 4C8KA 2HXUA 3IC1A 1FD2A 3W37A 2MZTA 2OPJA 1R87A 4IIBA 3L2MA 1L2QA 1AROP 3VTRA 3FNDA 3AMLA 4M56A 4YMEA 4A8LA 1UEKA 4TY8A 1U1QA 1TMHA 2FVQA 1Q8IA 2ZOFA 1YTKA 2YA2A 1R0CB 1PB0A 2PWUA 1ZBTA 2KT3A 3T55A 3O06A 4J2MA 1T8QA 5JUVA 2J7KA 3EGVA 2A3EA 5JMUA 1IIGA 1H3GA 3WH7A 1GKRA 1WZMA 2IVYA 3N79A 3Q8UA 3FA4A 3L23A 1XYLA 5C24A 2GHWA 1PAUB 1E71M 3L4YA 1JLAA 2Z30B 3GUWA 3UWVA 3BAYA 3B9OA 2XGQA 2QW5A 1RQ0A 4L6OA 1RA0A 2ZRUA 1X5TA 1U1LA 1VQKS 4CNOA 4ELVA 4OJ1A 2NS1B 5C54A 2VOOA 4XZIA 1WC5A 1TR9A 5U7SA 4AUBA 3S5SA 3CV6A 3O3RA 1YRUA 1X7VA 4RL3A 3B82A 3NAVA 2Z58B 4PBEA 3QR1A 2OZTA 5HP1A 3AI0A 4HSHA 2E6FA 4X62J 3L4TA 4O0QA 1IEVA 1JZ6A 1PGZA 4QX4A 1UD3A 1AT1B 3VZXA 4Z1AA 4P73A 3T5KA 2BQRA 5MKGB 1R0AB 4ZJLA 2HRWA 5EMYA 3WUBA 3NDOA 3VZIA 2XVPA 3GIKA 4IICA 2BBFA 4GI8A 4KEVA 5E0FA 3W29A 4R25A 3TVKA 2VR5A 3CHVA 4WBFA 1DJXA 2AOSA 2VG7B 1YDVA 2G3MA 4M5JA 3LK6A 2XTKA 5F4SA 4NLGA 2QXWA 4FIRA 4ZBCA 3CL8A 2ZNZA 3PO5A 3PC0A 5EL1A 2Y5JA 4JEJA 1FWDC 4F02A 2V2ZA 1SXLA 1SJCA 1C92A 1DV7A 2HWGA 3VOHA 1UTAA 5F4XA 4B9UA 3ZZUA 1J0JA 1UWRA 3V36A 2WKLA 3UR7A 1JMTA 4EWJA 5KG7A 2P9CA 3R97A 3BDPA 1UEUA 1U1OA 4PFMA 3MC5A 4IISA 1FWKA 2KL8A 1QWKA 4LRSA 5T9CE 3CAQA 5EMUA 1MROA 3NXFA 1QE1B 3CMFA 3EPOA 5C42B 2B7NA 1QUVA 2WLZA 4R5EA 6XIMA 2O9PA 2FD2A 4FPIA 4WKRA 2M3DA 4DS4A 3NM3A 4PCQA 4DI6A 5DG8A 3N1AA 4E0CA 2PMWA 3W9IA 5FF2A 3UWZA 1AD1A 3C0LA 3A12A 4UMAA 1RAJA 4F4KA 3VGHA 4UOJA 1R3RA 3C6UB 3G2XA 1W2VA 5KG1A 1OD0A 1F7BA 3CWNA 4NG3A 5FEZA 4Y8EA 1H74A 5HBMA 2RE1A 3H90A 2YPYA 1RWWB 3H7HB 4WOQA 1JI2A 2VBXA 3QJJA 2HDJA 2VUGA 3R2GA 3WO8A 2NQJA 3CSKA 3MECA 1ODZA 4HYKA 2YNHA 4D6HA 3GDBA 2ISSA 3DFQA 4C6OA 1U22A 3OGVA 3FEQA 2QKFA 3MM8B 4OIXA 3RB3A 3G22A 3OXLA 4C9DA 3TC3A 2MGZA 2OUGA 4GPNA 2HPIA 5I3KA 1SQEA 2J0QD 3UDEA 4PMOA 1C1CB 1PBAA 2YOCA 4FS2A 4M94A 1TV2A 2XHCA 3WH5A 1G1YA 1H2VZ 3EOSA 4DWIA 3MM9A 3OQ2A 5HVFA 1BGAA 4C3MA 1BWLA 1NJXA 3RHGA 1FKAF 3RMJA 3C0JA 3KBVA 2GW8A 1R3SA 3S1WA 4B17A 1P43A 2XG9A 4HN8A 1ZAIA 5KT5A 3J7AN 2IPWA 1J6OA 1QPRA 4ED5A 2DH8A 1EGMA 1SW7A 1KKHA 4QCLA 5LXXA 1RHMB 1QI0A 2WLYA 3UD5A 1UP2A 2D2GA 4LSNB 1TVRB 1Q5VA 1KXTA 1V3RA 3WLTA 1KDNA 4K7YA 4AZIA 3N04A 2QA1A 2BR0A 3UCUP 3EDDA 4LYKA 4RW6B 1N5TA 1CBGA 2B7PA 3P8IA 4PXBA 2DVTA 3N6QA 3QQCD 1ZALA 3MEGA 2ZCGA 4NYZA 1B3YA 3U1LA 4I6WA 3DYPA 2J79A 3ITYA 2VV5A 3ENAA 3G24A 2PD9A 4O1BA 3W2WA 4ZN3A 3KP1A 1U2FA 1XLHA 3JTNA 2QDGA 5A2QY 1L6YA 1W1YA 1YBQB 1U02A 1DWFM 4ORIA 4F2UA 2B4UA 3U02A 2Q1LA 2VM8A 5EFDA 1KP6A 5I03A 3ECQA 4FN5A 2VFHA 3K30A 1R8HA 2HLTA 3WYZA 2Z27A 1P1MA 1RBOB 4XQ6A 4L76A 4IUFA 2Y2WA 4U28A 2FJUB 2HVNA 4ZO6A 4GVGA 2OSQA 2ZZMA 2B81A 4C3KA 1RT5A 2VX4A 2D74B 1MWYA 4LFAJ 2UXDF 3CWHA 4WD0A 1VQ6S 1HHQA 2CZ9A 3V1HA 2PZNA 2QMUB 4WDTA 1V3HA 4HU0A 2FZGB 2J25A 1FE4A 3LHWA 5GJNA 4E5TA 1EC9A 4HJFA 4K8RA 4PXCA 1VIWA 2CPHA 1M5KC 1H7PA 4WFNQ 1EGVA 2G8ZA 2ALYB 2XM2A 3GDRA 1ITQA 4HYVA 2WHMA 3GR4A 3R94A 4TO8A 1CJUB 1XIFA 3PHEA 4M5GA 1GUVA 4LAKA 3KK1A 1N6QA 3UPFA 3SM0A 3AHVA 2PWDA 4A3QA 4C7DA 1CG2A 1JNEA 1QNVA 2HFVA 1FWHC 3APYA 3OVPA 3D68A 1U0HA 3ZJ7A 3DLJA 4XAGA 1AQHA 4QS6A 2ASDA 3MPVA 1BQMA 4IQLA 3P0WA 1B70B 1S5VA 4G9PA 3BZGA 2GJNA 4H1ZA 4HHUA 5K8MA 2E3ZA 3MOJB 3AIBA 2KRBA 2D2OA 5E5CA 4J28A 1S0NA 4F4ZA 3IRSA 1PO6A 4YDDB 3E6EA 3TN4A 3G6XA 1H49A 3RBDA 4G6VB 2WK2A 4BF9A 3NQEA 1H09A 3B8HA 4DYKA 1OQ3A 1EOKA 1HBNB 3T81A 1QFEA 3FSUA 1QVFR 2L9NA 3GH7A 1G4EA 4JB8B 4LJ3A 3GNPA 1MWZA 4MWAE 3KOFA 1R8BA 2PMQA 1GAOA 4P6QA 3V4IA 5H9EK 4AXKA 5H9EJ 1HIZA 3AALA 4KWSA 3LZ3A 1LWCA 2P10A 4WOZA 3CAVA 4FHAA 4KGVB 3C2VA 4PUNA 2FVRA 2C2EA 3LP2A 2EKNA 1HNIA 2GVYA 1UOKA 2D23A 4XO6A 4DU7A 3W7QA 1K7FA 4FVCA 1T0OA 2C3MA 1R7IA 3B8TA 4CCZA 3BVJA 3MMAA 2FDMA 1HKAA 2PSNA 4D6JA 2I17A 2Y4SA 4ADTA 5LKYA 3BW3A 3EWDA 4UY8T 2QJ3A 3VAVA 5C0QA 2Y24A 4JI3F 4QISA 1BXCA 3TYBA 1QRQA 3O05A 2G1DA 2YW4A 1FWNA 2EBNA 2EF9A 3AD9C 4GIYA 4X9YA 2YWKA 3BH4A 3THAA 1BXBA 2NUHA 5E93A 2FFIA 1OIMA 5KFCA 1R7AA 1MSSA 5EY5A 1OMSA 3GFHA 1S76D 3AC0A 4K50A 3ZLFA 1HL2A 1RHUB 4ZPCA 3KL5A 3WN6A 3STCA 3KEHA 2YPIA 3PJWA 4KO0A 4GABA 1JFHA 3D54A 3MAAA 4BQ3A 2MZSA 3WBZA 2IHR1 3IARA 2H4WB 4EXQA 3E2EA 4V19J 3PULA 3A5FA 2M7SA 2VCCA 1V3MA 4FNQA 4B3OA 2BKPA 1F3TA 3GJRB 1TK0A 3BREA 2LQBA 5KT4A 1TIWA 5H1SV 3F7JA 4BY3A 1V6WA 3DFPA 1T95A 3DU6A 4C11A 2LXFA 4EU0A 3L5AA 3V35A 2GO8A 3I31A 3SI9A 5F8MA 3GAYA 3POCA 4HN4A 2WVEA 4WSKA 4QLJA 2HK2A 3THQA 1C8QA 3EKGA 4Y7EA 3G82A 1A0EA 4AHOA 5EMKA 3RBEA 1DJZA 4ZCLA 3M43A 2KX9A 3VIFA 2C22A 3CC7S 5LIYX 2B43A 2Z1SA 1N56A 4FNRA 3FSIA 1CLVA 1IZCA 3EOEA 3WLQA 5IV4A 2AU0A 3PFRA 2PN6A 3L9ZA 4CD4A 4OZ2A 2C2KB 3B4DA 3DGVA 3Q86A 3WQ4A 4B5VA 4QG9A 3TYTA 4X2PA 1HFBA 4KBIA 3ZLGA 1WUUA 4DLFA 4M6VA 3W66A 3ENVA 3OTOF 2UUBF 3T5HA 3P8JA 4X4QA 1LT7A 2Y85A 3H2FA 2FMOA 1DIOA 4B9MA 3SRFA 2AL1A 1AUSL 4PCSA 2I5JA 3BXWA 3PYEA 2EXOA 1K6WA 3MMTA 3SCRA 2XYLA 2W7OA 2E7FA 2Q02A 3GB6A 4BKNA 1BWEA 3IGXA 1S1RA 1W3TA 4JKMA 2BOEX 3JQMA 3DRYA 3KVKA 4Z37A 3DLEB 1OIFA 3RBXA 1SZRA 4ZSUA 1SO3A 4NY2A 4W9TA 4G1QB 4AL6A 1U48A 3OLBA 1QCWA 3Q67A 4MKAA 1I2RA 3WDIA 3O1NA 3MHYA 1YITS 1DIDA 4KPLA 2DGVA 3SCOA 3TDFA 4O12A 1AZ1A 1O5XA 3URNA 3W7IA 4M5DA 1W9PA 3AHTA 2DXFA 2IJRA 3R58A 4FXWA 3UDLA 1BTCA 2Y7GA 2NW0A 5F1UA 1VLYA 4YTRA 2ODOA 1PHWA 1RH9A 1X0PA 1Q2SA 2HNYA 3DI1A 4V28A 4OECA 1VJIA 1ICEB 1X4BA 4PG8A 3CV7A 1QO5A 2B4GA 3P5BP 1LLZA 1UVNA 1AUDA 5CHCB 3BGJA 4JV0A 1XMQF 4LAUA 4MPQA 4S3CA 4MKYA 2M2BA 2E1AA 1MXSA 3GR8A 3NO1A 2PBGA 3OHMB 3A3XA 1DQ9A 4E2DA 1RT6B 3M2RB 3UE2A 3UY8A 1QNSA 4A8KA 5KFZA 1HX0A 1AW2A 4O3SA 3PPGA 3GNDA 3TZXA 5HL7Q 4JS3A 3CULA 2NVDA 2BP1A 1ML1A 1RUSA 1IZKA 2OPRB 1PJ9A 2XINA 3POHA 4MNKA 3IRXB 2PGEA 2ZVSA 1XI3A 5K5MA 1ADOA 2QO3A 2DZXA 1H51A 2AJ1A 1RA5A 4HYWA 2EPLX 4EUVA 4NI2A 2HNHA 4RW8A 1HJUA 3QGHA 2F38A 3CJKB 2VHGA 1OY9A 1YX2A 1TRIA 2F9DA 4WCJA 3V6JA 1O94A 2Y5SA 1B9BA 1RAEB 5G2HA 1GMVA 2VJVA 3OZPA 2FZ8A 4JTUA 4WFBQ 3MOZA 2JJ4D 4XD4A 4CEXC 3F41A 1G3OA 2NPFA 2Z2ZA 1KXHA 3KS5A 4PFHA 2AGTA 1NDZA 1A5AA 1J5OA 3GTNA 1BQNA 1ZNNA 4IJCA 1NQKA 3T9PA 5HJLA 4FNHA 3OVGA 1UPMB 1N8WA 5K2ZA 4J7CA 1E3XA 3Q4DA 3QGKC 4MYUA 3SFWA 4OYOA 4PMDA 3NLCA 2HHHJ 4LY4A 5BXPA 3TYEA 1SU5A 3KK2B 2DZVA 4NRSA 1JG9A 1W32A 1XK8A 3MWBA 3QC3A 1S1TB 5FAJA 5E9AA 2E25A 4D9PA 2KVQE 1PYTA 1S1VA 2ONEA 3NYZA 4UFIA 1FA0A 2G3JA 1FI4A 1VIZA 3MJMA 1T0TV 4GH1A 1N5YB 2X0SA 2WB4A 3NGKA 1W5OA 5G0RB 5D04C 2VRKA 2P8BA 4YVPA 3M0XA 5HPCA 3PACA 1VAHA 1LOSA 1KB3A 2EFOA 4O3NA 5KFSA 1J0IA 3T42A 2BB0A 4JGDA 2HHSA 1Q6OA 4LF5F 3EWYA 3RR8A 3L9CA 4DEZA 3O5TB 3N2CA 3L0NA 1KQFB 2ATMA 9XIAA 4ILSA 3JR2A 1MUMA 3DERA 1TWDA 3G8QA 3JTOA 2BXVA 2X7WA 4PWUA 3TX0A 1U45A 3FA5A 3R89A 4QIGA 2KZZA 2Q6ZA 4YS2A 3D6MB 2GVLA 1J5EJ 2FVKA 5FL0A 4UXDA 3MMJA 2V8GA 3K57A 2TAAA 1HNWF 4Q6JA 2JBMA 1MN9A 3BAIA 4LUSA 4LGXA 3LSCA 2VOTA 4EK7A 3UD6A 1E9ZB 2Y8KA 1K8ZA 1E1FA 2LP4A 4ZCIA 2G5WA 1TRDA 3I3DA 1JCYA 1BVWA 1LG2A 4NOHA 3NQAA 1VYRA 6PTDA 2IC3A 2XC9A 1E6QM 1W1B1 3RW6A 3I10A 5GJPA 3R5EA 3BANA 3N6LA 1I0BA 1RJPA 2NWSA 2QULA 3W60A 3I3BA 3LF0A 2BE7D 2WAQD 1IR0A 1EBGA 1ITCA 4NLUA 4ZEPA 2CLEA 2G4JA 2ZXQA 1BPLB 1EIXA 1V93A 1DQ8A 1F6TA 1RTZA 3IJIA 3LM3A 5GAGI 4KGKA 1R3QA 4UR8A 4RW7B 4DX6A 1YE6A 3K5PA 2F3JA 5KINA 2BEFA 5IC4B 1QPQA 4UOCA 4YIWA 3IWNC 3KLFB 2E1CA 5A8QA 4MKVA 2RIJA 4DUWA 2PTWA 5AC4A 3DXSX 2PZ0A 6REQB 3G8SA 4GZEA 1AL8A 3LI0A 3P5TL 2PUZA 1S9FA 5DFAA 3R43A 1M0SA 3N9SA 1KQKA 3M8QA 2IW0A 6FDRA 1KSPA 4I56A 1S5NA 4QLKA 1R46A 2FQIA 5KFJA 2D9PA 4XIMA 4WUIA 1CECA 2IIHA 3C15B 1WDPA 4IFOA 2CG8A 3DKLA 3W5ZA 3TAKA 4ZVRB 3IJ7A 1S1XB 1TSIA 4UQAA 5CXPA 3W1TA 4LV9A 3OR1B 4P7LA 1RHQB 1KBBA 3KAOA 3W1QA 1HQ2A 2PF0A 3SCTA 1C90A 4FB7A 3IBFB 4DDFA 4L9YA 1EC7A 1LM1A 1TIMA 2F5GA 2XMKA 2PA8D 1HR0J 1WDDA 3V5CA 3NY0A 4YU1A 1C0UB 3KVLA 4J37A 5FLXY 1R9XA 3P93A 4WP3A 5FIIA 3VNLA 1OFBA 3I9ZA 2PODA 1KFKA 2BGQA 2WCAA 3B06A 3VGDA 2H1YA 1BC6A 5LNSA 2R9LA 4C90A 4EBEA 1VBUA 4Z42C 1Q4WA 4HA0A 4RW9B 3F5KA 2Z2UA 1ZJHA 2A3CA 3MUAA 2W9MA 2VL4A 1WB0A 1L3KA 4IQJA 4KPCA 4GXMA 4HT7A 5LGXA 4L6DA 4PRWA 4YTSA 3RYSA 2Q71A 1OPIA 2JL9A 4CLPA 2V0NA 1J4EA 1UR3M 2FTPA 3TW7A 2KYXA 4A29A 1J79A 2WSEC 5A8GA 1MNZA 2QJGA 3N12A 5DELA 5D4YA 4Y9OA 3BLEA 1VC0A 1VPQA 2V5KA 3THDA 1JXJA 3CB4A 2A3JA 3L2LA 1NM2A 3VAJA 1KFCA 2QRRA 4LFCF 4E8GA 4J9QA 4DXKA 1NZAA 1R0AA 3SIPB 5ITHA 5A6BD 4ZOSA 4MY8A 1BD0A 3LRKA 1AQFA 3N15A 2PWEA 2C2OB 3UCQA 1GMUA 3KK3B 2LEPA 1FOBA 2VG7A 5CAAA 3TW6A 1EETA 2WJFA 3EZ4A 3PYFA 1NH7A 3G1AA 1ADDA 2KN4A 2VG6B 5KG6A 2P6SA 3WQ6A 3PW0A 3VOCA 1V3ZA 3W7GA 1GXTA 4BWLA 4YWIA 1P0KA 3DFTA 4BQ5A 4Q6XA 1N33F 2W2QP 3R13A 1OFAA 4H04A 3SEPA 3AUOA 1ZLPA 4WF9Q 4IGSA 1XW8A 4N56A 2OP5A 4BS2A 5J1PA 3IWXA 4O10A 1X5SA 3LYEA 1HWJA 2GQ3A 1PHQA 4MNMA 4PN2A 1QE1A 5C42A 3T07A 4OOUA 4YWSA 1VFLA 4GO5X 5CC5A 2J8TA 4XPCA 1GVIA 3HF5A 3PIPQ 1R0BG 3DXIA 4ECWA 2DH9A 2VL1A 3QGAC 3WD4A 4UR7A 5A6BA 4ZOAA 2QJHA 3GE7A 3R6IA 4P8VA 1NJWA 2QCEA 2DVXA 3TEVA 1G7CB 3C6UA 5KT3A 4LNYA 5DDOC 2G0CA 4A8SA 1TJPA 3CZGA 3ITHB 4LF4J 3D28A 5DXYA 2OWXA 4MF4A 4FP1A 3F2DA 3CUFA 3THUA 4RKAA 4F4YA 4DV6J 4YR3A 3IAPA 4O0KA 3AT1B 3M9MB 3VZHA 3PO4A 4D6DA 5EU9A 4F0HA 1XIMA 4QWEA 3VCNA 2A85A 4WGHA 4CO2A 4PODA 4X61A 3C16B 5DDQC 7AT1B 1NJIT 4IQEA 3MM8A 4YN3B 4EWND 3NGUA 4RBTA 1GQKA 3SUWA 4IFVB 3LCXA 1C1CA 1U49A 1KC7A 3WLHA 3QEZA 5G5IA 3CDWA 4HNVA 2UU9J 3OL7A 3HVRA 3J7ZT 2AKWB 3T2OA 4WXWA 3EM1A 4NRRA 1EFZA 2ACQA 1KWKA 4PMJA 1PUDA 3K5LA 4C5ZA 2LEBA 2OZ3A 2J8FA 1UMYA 4NSBA 1UQYA 3CEPA 2ESCA 4DR7J 1DXFA 5TD4A 4ERAA 1X8FA 1YQ2A 3OR2B 3PFEA 1YEYA 3H4BA 1XIJA 2XSXA 4PTNA 3T2QA 4J3SA 4L1XA 1LXJA 1S59A 1FJGF 4NCAA 1GVSA 2E40A 4HACA 4W4QA 2B8QA 4F4RA 2V9KA 1GQIA 2OPPA 3UVJB 1W9UA 3CJ4A 3EDFA 1NU5A 1V8EA 3KOAA 1TVRA 4OHVA 2PA6A 2MKHA 2DNNA 3TR2A 3M5YA 1WSRA 1Z42A 4DJBA 3QIPB 1XWYA 1IBKF 3C52A 4NASA 3BSMA 3DESA 3FYOA 1FESA 4RW6A 5DG9A 4DQWA 2E6AA 2QS8A 2BODX 3BCJA 4E8DA 1PCAA 5J8LA 4Y34A 4OJYA 1BQXA 2W8LA 2INFA 4FR1A 5ETOA 4A8IA 1RCXB 1M6JA 1AW1A 5FCZA 3BAJA 2Z1WA 3R1ZA 2NT1A 1D7FA 2NXCA 4RE4A 1FTXA 2J9DA 1HO4A 1N5QA 5C9WA 3N11A 3A3WA 3MEEB 3OHAA 3QMRA 2AYBA 4DSLA 2JRSA 1TPEA 1VQNS 3W23A 1HGYA 3K4WA 4F2TA 3CEDA 1GX5A 2V8VA 3TH6A 1GKQA 5A6MA 4RUHA 1VQLS 2A2IA 4OHQA 2OWWA 5AJ3F 3CXOA 3ES7A 3RRGA 4NLSA 5AHNA 2Y8UA 1EXBA 2GHPA 1XG4A 5IBXA 1BLUA 3IMQJ 2NLWA 2NXEA 4US5A 1WP6A 4XDCA 3CZEA 3UNGC 4OV1A 3ILLA 3DCPA 3KBNA 3W1YC 2ACRA 3LTPA 4MT1A 4AB4A 1CJUA 3CU2A 1KTQA 1S57A 4R3UA 2VEIA 2WNQA 3OA5A 3H2VE 4H7ZA 3DRPA 3I0RA 3MXHP 4W7UA 4AZ5A 1VLIA 3LA0A 5BYRA 4B4FA 2WCXA 1FX6A 3VHQA 4DQRA 3T1YF 4DZ6A 1RTJA 2Z56B 4F3OA 1QK2A 2FJXA 1W3IA 3SW6A 3EB2A 4M24A 4J3XA 4NILA 3BG9A 4M82A 2OO6A 3I7QA 3WKZA 2I6WA 2J7BA 2C6QA 4JBRA 1ZU8A 1TTIA 5IQ6A 1I1WA 3B8SA 4JY8A 5M3WA 4OHYA 3QY6A 1FY6A 4F0SA 4GUGA 4ES2A 2V5BA 4ECLA 3F4DA 1VCTA 3AD8C 5LM7E 4AD5A 3A24A 1HBNA 2JEPA 3L65A 2HZGA 1EQ0A 3PF3A 1RK6A 4LT6A 5FJPA 3R1HA 2B0MA 3DXBA 1Y5WA 2C13A 5C25B 5A8NA 3PJTA 4UIOA 1TV6B 3S6OA 3HTWA 3OTBA 3T40A 4KHPF 2RGMA 2VZ9A 2DTJA 2HSAA 2FJAB 5JJBA 3SCIE 1IQZA 1FNXH 2WXDM 1PJ5A 1YDOA 4QWBA 3DG3A 2H8XA 3A6OA 2QCMA 5ETLA 4TX8A 1JPKA 1H60A 1JVNA 3KFTA 4OFCA 4OU1A 2EJAA 7CGTA 1NIUA 3A64A 4LVAA 3DLHA 1S6QB 2HS4A 2PMHA 3BH7B 3C2EA 2MMYA 1UR8A 1IXOA 3MUMP 3W73A 2HLUA 2GVDB 1VS1A 3T0BA 4KT0C 3CZKA 3EEGA 3BN4A 2YL8A 3OU8A 4O4GB 1H2JA 1VYSX 1T03B 3SY1A 3G1DA 4Q8PA 1TWWA 3GVWA 2WBKA 2X2GA 4UNIA 3DGPB 5ECVA 4DN9A 3CCVS 3PTMA 2D3UA 1VLOA 5BXTA 1RT1B 4W7WA 4OI3A 1RT2B 5BYQA 3E0IA 2MQOA 3O0KA 2NT0A 1D8ZA 3KRZA 3VI2A 3HGJA 3EKZA 4IFRA 3HK2A 3NBPB 5CPQA 2B6AA 4DV5F 3H70A 1ONWA 3QT5A 3FJNA 2HHQA 2E7XA 1L6SA 4DUZJ 1UETA 3UPWA 1DVJA 3G1VA