4PQUB

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and datp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
425
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna
total genus 120
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pquB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquB03
3KLIA 4I7FA 1IKWA 3E01B 2BE2B 2OPPA 2WONB 2IM1A 1SUQA 1JXLA 3QZ7A 4HYKA 2I5JB 3LP1A 1N5YB 1W25A 2FJVA 2YNGA 3G86A 4H4OA 5KG4A 3CJ5A 4MK8A 2ZD1A 1HPZA 3DLKB 4ECUA 4R8UB 3MEEA 2W9CB 1TKXB 2D7SA 3M9NB 2BQRA 4J9KA 2RKIA 2BR0A 2UVVA 4NLGA 3BGRB 5J2NA 4WFZA 4URGA 3ITHA 4RW8B 3N6NA 3QIDA 1R0AB 3OLBA 2W8KA 5KFIA 3NKYA 2DPIA 2R8JA 2ZKUA 2ILZA 1FKOB 3UR0A 4KV8A 4F4ZA 4O44A 5L1LA 1JLAA 2XWYA 3BQ2A 4NZ0A 4X2BA 1TV6B 3DM2A 3PW2A 2R2UA 4EBDA 4URQU 1VRTA 3LAMA 1QE1A 1RTHA 4ZVFA 3IG1A 1IKYA 3RAXA 2FLLA 5C24A 1LW2A 1S6QA 4NLYA 1TVRB 4KHMA 3DRRB 3HVAA 5F8MA 3KHLA 4IG3A 2OPSA 4MKAA 3GILA 3DOLA 2R2SA 4G1QB 4WFXA 5D3GB 1KLMA 5KFKA 3E51A 3PR4A 4IRKA 4ED0A 5DQHA 1BQNA 3V81B 1TL1A 4KKOB 5HP1A 4PWDA 1TKTA 2ZE2A 1FKPB 1RT3B 1UWBB 5CYMB 2ALZA 1JLCB 1ZTWA 3FQKA 1JKHB 1IKVA 3T1AA 4LQ9A 3C6TA 4FBUA 1MU2A 2HNYB 3SFGA 3Q8PB 2OPQA 3T5JA 1HNIB 2YNHB 3KLEA 2E9RX 1T94A 1TL3B 1HQEB 3M8PB 4DG1B 4O4GA 2AGPA 2BQUA 1C0TA 3IS9A 1WNEA 2YNFA 3GV5B 5F8GA 4ZP8A 4QWCA 3HVTB 3H5SA 5KG2A 1JIHA 5HBMA 4I2PB 3LALA 5KFQA 3N6MA 3QLHA 1S9GA 2V4RA 3I5BA 3GIMA 3I0RB 1LW0A 4IG0A 2B6AB 5FDLA 5J1EB 4RUAA 3BQ1A 3BREA 4ECVA 3OSPA 5KG7A 2VG5B 4QW9A 4PQUA 4ZMMA 4ED2A 2AGOA 3KK2A 3DRSB 4O3SA 1RT7A 3NL0A 2W7OA 3GV8B 2IJFA 3UDLA 4K4SA 2IMWP 2IJNA 2IC3A 1K1SA 4NLTA 3DLEB 4TY8B 1SH0A 4Y2CA 1HMVB 4MK7A 4MKBA 2AGQA 1S6PA 4QWDA 2JEJA 4H4MA 2FVSA 3QZ8A 3QGIA 3PHEA 1S1UA 5KFGA 4FS1A 3RBEA 2V9WA 1RT2A 3QO9B 4RW9A 4H54A 3H5XA 1RT5B 5KG6A 5KT7A 1LWEB 4FS2A 4YR3A 2R8IA 1S1XB 4WE1A 2FVRA 4NLWA 5J2MA 1IKXA 1T05A 1I6JA 4DEZA 3IN5A 2IM0A 2IBKA 1RTIA 1T03A 1YVFA 3EPIA 1S9EB 3HVWA 4PUOB 4J9SA 3KJVB 1RTDB 1C1CB 4OL8A 1RAJA 5KFRA 4F4YA 3FFIA 4WZQA 5DGBA 2WB4A 1S1VB 1EP4B 2YKNA 3JYTA 1S97A 4IKAA 5J2QB 3D5MA 5F8IA 4Q45A 3G6XA 4NCGA 5I3UA 3PW5A 4QWBA 2XI3A 5KFTA 1IM4A 2W9BB 2YKMA 4R5PA 1REVA 3RB3A 1S1WA 5I42B 3PVXA 1RT6B 5HROA 2I1RA 4IDKA 4KO0B 2B43A 5KFPA 4NYZA 3IGNA 3DLGB 4MFBA 1SH2A 3EZUA 4IH7A 4GC6A 1JLGB 3MEGB 5JXSA 4ECWA 3MFHA 3NAIA 3C6UB 2FJXA 2HMIA 3MTKA 4M95A 1SH3A 4B3OA 4NLSA 5EDWA 2HWHA 3LP2B 5KFMA 2WONA 3H4BA 3KLHB 5EWEA 2I5JA 3SI8A 2BRLA 5DLFA 5C25A 3CWJA 4F4XA 2ATLA 2C2RA 3KMQA 4R8UA 2W9CA 3HHKA 2IM2A 3QYYA 5KFZA 4J9MA 2R8GA 3MECA 1RT1A 3T19A 2RDIA 5EWGA 4Q0BA 5L1JA 4LQ3A 4ZVEA 2FLNA 3PJWA 2FLPA 1NNDA 5KFYA 3BGRA 2VA2A 4URSA 3DDKA 4RZRA 2VA3A 1JLBA 5KFJA 5K14B 4RW8A 3CDUA 3OL7A 4RNHA 3KLGA 1R0AA 3UPFA 4DL4A 4YQWA 3H59A 3MF5A 4ZVHA 3TAMA 4J9PA 5KG3A 1K1QA 4IFVB 5CYQA 3DMJB 1TKZB 2W9AA 3CJ0A 3RB6A 1FK9B 3NMAA 2JEIA 4RW7B 1TVRA 3OL6A 3NGDA 4DL2A 1BQMA 4ECSA 4F50A 2HNZB 4KE5A 1S10A 1DLOA 3CDWA 3GIIA 2ILYA 4ID5B 2YNIB 4RW4B 1GX5A 4O3RA 2WTFA 3M9OB 5EWFA 4G1QA 4ED8A 3KLIB 4I7FB 1NHVA 4RUCA 4J9LA 2C2DA 4O3QA 3FDSA 3DOKA 5F9LA 4RNOA 3NBPA 1T3NA 1SUQB 3M8QA 1D0EA 1JLQA 5C5JA 3V81A 5KT6A 1QAIA 1KHVA 2YNGB 1C0UA 5KFAA 4H4OB 4ZPAA 4J9NA 1HQUB 1RT3A 4QW8A 1S0OA 5CYMA 5JUMA 3MEEB 1TQLA 1S0MA 1JKHA 3V6HA 3Q8SB 1ZETA 2VG6A 4ECXA 1JLFA 1RT4A 2HNYA 3FQLA 5DG7A 3DI6A 1HNIA 3ITHB 4DG1A 4ICLA 3D28A 4U7CA 4ECRA 4I2QB 4IQXA 4XPEA 3HVTA 4ZPDA 4NLQA 4I2PA 2EC0A 3NAHA 5DQGA 3BR9A 4KV8B 4YR2A 4ZHRA 4O44B 1OS5A 2B6AA 2FVPA 4ZP6A 1HARA 1U09A 1VRTB 4EYHB 2VG5A 1QE1B 2R8KA 3IG1B 1IKYB 1JLEB 3DRSA 1LWCB 1LW2B 5C24B 3KK1A 3PW7A 4ZP9A 4ECTA 1MMLA 3KK3B 2HAIA 1RTJA 2F8EX 4YMEA 2IA6A 2J6SA 4MK9A 5KG5A 2W7PA 3LANA 4LSLA 3H5UA 2V4QA 5L9XA 3KHRA 4XO0A 2OPSB 3DOLB 1RA6A 1S1TA 4JV0A 4MIBA 1KLMB 2C2EA 4LSNA 3BSNA 1LWEA 3G6YA 4Y34A 3DRPA 1S1XA 3T5KA 3LP0A 4GC7A 4KSEB 2VG7A 1KHWA 3OHAA 1VRUA 1TL1B 2WCXA 1GX6A 2UVWA 2C22A 5HP1B 4PWDB 2AX1A 2ZE2B 5KT5A 1SV5A 2E9ZA 1C1BA 2HNDB 5KG1A 2WOMB 4ZVGA 4U6PA 1C1CA 1QAJA 5HLFB 2O5DA 1MU2B 2AQ4A 4ZPCA 1S1VA 1EP4A 5C42B 2UUTA 2BANA 5J2QA 2OPQB 4QWEA 5DQIA 1N6QB 5KFHA 3I0SB 3V6DA 1S9FA 3CJ3A 3OL9A 4TYBA 4ECQA 4DL6A 1C0TB 1TP7A 2YNFB 5DG9A 3DYAA 1RT6A 4RW6A 3LAKA 4KO0A 2OPRA 4R0EA 5HBMB 3TVKA 2IAJA 3Q8RB 3GIKA 4KFBA 3JSMB 4JV1A 3V4IB 4RNMA 1LW0B 4IG0B 4WYWA 3C6UA 5FDLB 1J5OB 3RB0A 3RAQA 3FRZA 5KFSA 4Q8EA 3LP2A 5KFBA 1DTTB 3KK2B 3SFUA 3IRXA 3KLFA 1RT7B 4ED3A 1N48A 3KLHA 3QIPB 3HKWA 2IC3B 2J6TA 2RF2B 5KFEA 3H98A 3ISND 4EBEA 4IRDA 3MEDB 4K4ZA 3CDEA 1DTQA 4H4MB 4IH5A 1S1UB 2FVCA 4TYAA 1RT2B 3E01A 4RW9B 2BE2A 1XR6A 4KB7A 5KFXA 1S49A 2ASDA 2C28A 2BQ3A 4FBTA 3TQ1A 1N5YA 4XPCA 4TN2A 4WZMA 4IFYB 1RTIB 1T03B 3DLKA 2R2RA 5J2PB 4ZP7A 1TKXA 1HNVB 3BSAA 5F8NA 3MR6A 2XCPA 4K4VA 2AWZA 4KBIA 4TY9A 5F8LA 3FFIB 3JYTB 3IGVA 5T14A 1EETB 4WXWA 3KOAA 1XR7A 5KFCA 5EUHA 1TKZA 4NCGB 3BQ0A 2OH2A 5I3UB 4G3IA 4IOBA 2JC1A 3CO9A 2YKMB 1HYSB 4O4RA 4RNNA 1S1WB 3MFIA 3PW0A 5HROB 1FKOA 4IDKB 2HNZA 4MFBB 4DL3A 3OHBA 1TV6A 4MIAA 5KG0A 3BSOA 4ECYA 2W8LA 2B5JB 4EO8A 4MH8A 5L1IA 4B3OB 1S48A 3UQSA 1XR5A 3KHGA 2BRKA 3Q8QB 3QGGA 4KAIA 1LWFB 3DRRA 4EEYA 3ISNC 4M94A 4K4UA 5C25B 4DL5A 1HQUA 4NLPA 4QPXA 5D3GA 1D1UA 1IKWB 3T5LA 4NLOA 4TQRA 3PZPA 4Q44A 2QV6A 2OPPB 2GIQA 4Y3CA 3MECB 1RT1B 2AX0A 2WRMA 4ED6A 4Q0BB 3LP1B 4KKOA 2XGPA 3RBDA 1JLBB 1FKPA 1HPZB 1UWBA 2ZD1B 4HKQA 3VQSA 1JLCA 5DLGA 4I2QA 3KLGB 5KFNA 5KT2A 2FVQA 2UVRA 4O3NA 5KFOA 4NRUA 5KFFA 2RKIB 3TAMB 2GC8A 2QE5A 2R8HA 4NLXA 5F8JA 5J2NB 2YNHA 4TQSA 1TL3A 1HQEA 3M8PA 3N6LA 5CYQB 3H40A 5KFVA 3PR5B 1JLEA 3GV7B 1LWCA 5KFUA 3CIZA 4K4YA 3KK3A 1QUVA 1BQMB 3GQCA 1DLOB 1JLAB 3ICLA 3I0RA 4NLUA 3DM2B 5J1EA 1ZTTA 4IR1A 4NRTA 3M9MB 2R2TA 3KMSA 1RTHB 4J9RA 5DG8A 3PW4A 3DOKB 1S6QB 3KNAA 3NBPB 3M8QB 2HWIA 1JLQB 3DLEA 4TY8A 1HMVA 4K4XA 4NLDA 1C0UB 2D3ZA 1S0NA 4EBCA 4IG3B 4YR0A 1C2PA 3H2LA 2HNDA 2RDJA 2WOMA 3QO9A 5DGAA 1RT5A 4JUZA 4WYLA 5HLFA 5KFDA 2VG6B 1JLFB 1RYRA 4J9QA 4F4WA 1RT4B 2GIRA 3BJYA 2XCAA 5C42A 3DI6B 1BQNB 1RDRA 1N56A 1TKTB 1N6QA 3I0SA 1S9EA 4TLRA 4RU9A 4ICLB 3CJ4A 4PUOA 2UVUA 5KT4A 4Q8FA 3KJVA 1RTDA 1IKVB 1RA7A 2D3UA 4NLVA 4O3OA 3OLAA 3C6TB 3OSNA 3JSMA 4ZHRB 2WK4A 3V6KA 3V4IA 3KLVA 2JLEA 3KLEB 1J5OA 3GIJA 4EYIB 4O4GB 2W9BA 3IS9B 5KFWA 4K50A 2AU0A 4EO6A 3I5AA 1DTTA 5I42A 3KK1B 2CKWA 2XI2A 3V6JA 3QIPA 2D41A 4ED7A 3T5HA 1RTJB 3DLGA 2RF2A 3QLHB 1JLGA 3MEGA 1S9GB 3I5CA 4WXOA 3MEDA 4LSLB 3H4DA 1CSJA 1JX4A 3BSCA 2FJWA 3MR5A 4ED1A 1RYSA 4Y2AA 4TXSA 1S1TB 3FSIA 4PQUB 4LSNB 3EPGA 3DRPB 3LP0B 3PJXA 2VG7B 1VRUB 2ASJA 4IRCA 1S6PB 4K4WA 4IFYA 3MR2A 2V0NA 4JV2A 2ASLA 1SV5B 4O3PA 5J2PA 3RB4A 3CJ2A 2E9TA 1HNVA 1C1BB 3G6VA 4DL7A 1Z4UA 4Q43A 4WE1B 1N4LA 5J2MB 1IKXB 1T05B 2WHOA 1EETA 2BANB 3KHHA 2JEFA 2XC9A 3V6DB 5K14A 2JEGA 5L1KA 4YP3A 2DPJA 2XGQA 1HYSA 2CJQA 2IM3A 2UUWA 5KFLA 3DYAB 4RW6B 5KT3A 4K4TA 2OPRB 2IAJB 1S4FA 4KFBB 4IH6A 2YKNB 4RNFA 4IFVA 4J9OA 4IR9A 2B5JA 4ECZA 1NHUA 3DMJA 4KHRA 4QWAA 3H5YA 2J6UA 5F8HA 4R5PB 1REVB 4WFYA 1FK9A 3IRXB 3KLFB 1LWFA 4RW7A 2JC0A 3GYNA 4NLRA 3QGHA 3MR3A 5F9NA 3OL8A 4ZPBA 4ID5A 2YNIA 4RW4A 1DTQB 3CVKA 2HMIB
chains in the Genus database with same CATH superfamily
2POKA 5DDOC 1HA1A 3QZ7A 4I6WA 2VBXA 4UF4A 3RW7A 1WI6A 1HPZA 5D15A 4JI1F 1TKXB 3KG1A 1UVLA 2ALYB 5GMKa 1TFWA 1H98A 2L08A 2UVVA 1VCTA 4EGLA 2YWGA 2YWFA 4B9UA 5D6GA 2UUAF 2H5JB 3OLBA 2ILZA 4KV8A 5CQGA 2W2PP 3ZO7A 1IR2A 1RUSA 2CADA 3BB5A 5CD4A 3D6MB 3DU6A 1R0CB 5HO4A 4M5LA 3MM7B 1VI7A 4HTIA 1TKTA 2W24A 1N5TA 3MMCB 2ALZA 3RUBL 1OPIA 5B0FA 1IKVA 4M5NA 2RQMA 4AL5A 2HQDA 2V67A 2GJFA 4DG1B 3CPWR 1LEOA 1WKKA 3ILIA 4LR9A 4OJ1A 1X4FA 3OSPA 5KG7A 4U7UK 3SSRA 2JEJA 1IWGA 3PHEA 3CNQP 3R5JB 5A8KB 2FIUA 2CQ1A 4PR6A 1S9EB 4GVBB 4JI8F 3D6FB 3MUMP 3BN7A 2AP6A 3D67A 4Q45A 2W9BB 3AQOA 4CWBA 4IDKA 3OW2R 3MEGB 3E2EA 2GHPA 4M95A 2DH9A 1M0SA 3LP2B 3M2VB 4LBIA 4FVMA 3M6XA 2XM3A 5CCMA 3M1VA 2VC1A 3NS5A 4P71A 3ZNJ1 2CNLB 4D3GA 5IT4A 4RZRA 1M1HA 2XY7A 3GSIA 2P9EA 4CYUB 4DV6F 1Q8LA 3R7BB 4UQTA 4NXMJ 4I7FB 4DPWA 2M8HA 3NBPA 3BV8A 4B08A 2BOAA 5HVHA 1RT3A 3HSZA 3OFGA 4JI6J 4DR2F 2HNYA 4DQRA 3DI6A 4PYAA 4OZ0A 4KRWA 2X1GA 4NLQA 1U1OA 3ZZTA 3VAKA 3T3FA 2B6AA 3C14B 3W61A 2Y9HA 3PO5A 3BSNA 1KSPA 3DRPA 1MROA 4GC7A 2VG7A 3ZTOA 1VC6A 4OI4A 1XC9A 2ZE2B 2FTRA 3FUYA 3OR1B 4DU8A 5D4OA 2H4WB 2DNZA 1RT6A 5HBMB 3RZAA 2MQNA 2RJZA 4LF4J 4L3NA 4OYAA 2VQFJ 2G0JA 4E2FB 4JI2J 4HVZA 3RGIA 1U0HB 2HEKA 1N48A 2HHQA 2ROPA 3D0IE 3DFEA 3L7PA 7FDRA 4ILMA 2VBZA 2CPFA 1CBKA 3C16A 4NASA 1RWOB 4GMKA 4ZN3A 2CZVC 2XCPA 2MLXA 3AHPA 2GO9A 1XR7A 1VLYA 3RRGA 1NO8A 4DDFA 3L7UA 3J7YI 3PYDA 1TV6A 3C2PA 1RZMA 2DGXA 2IHR1 5SUHA 3V4MA 3VAGA 2K7JA 3T5LA 2C3PA 1VS3A 1C4AA 1YJRA 2V9KA 2VFTA 2EI5A 3WBZA 2ZD1B 3VQSA 4DUYJ 5KFNA 3MPUB 5DO2A 4WP9A 5EGYA 3JXOA 3GSDA 4TQSA 1HQEA 3FSXA 5GADU 3PR5B 1JLEA 1RWNB 1X4DA 1X4GA 3L09A 3DGPB 2X1AA 1W7WA 2KO1A 4FN5A 2HHTA 1R8PA 1R7IA 1FWLA 2BDPA 4RBUA 1RT4B 5GMDA 4J90A 5IM0B 3OR2A 4PUOA 5KT4A 2OUGA 1E6VB 4DQIA 3GYGA 1YI2S 3TZYA 3N79A 4EO6A 3V6JA 4PPDA 2B56A 1NU4A 4LSNB 2ZH5A 3EPGA 3M32B 4NXNF 3PJXA 3QRQA 4QR2A 4W4MA 2N7CA 4JV2A 1HNVA 1HD1A 1ULRA 1WEZA 3ENAA 3N01A 1K9MT 2QJ3A 5J2MB 2DRDA 2V8DA 7FD1A 2GQQA 3VAJA 2MKIA 3FMWA 5D77A 2R3VA 4IH6A 4LFAF 3W2WA 2A6OA 1NHUA 3PG9A 2HSEB 3CD5A 3EMTA 2UUCF 4RW7A 2PGCA 1HBMB 1Y5IB 3BBBA 3LTOA 1S6UA 4YB5A 2DXFA 2FJVA 4UOGA 4LBPA 3M2UA 3BKFA 3G6ES 2DCLA 4C11B 4NLGA 2HHWA 4MYUA 4DHVA 3QIDA 1NRKA 1U2FA 2YX4A 2DPIA 4N41A 2IY5B 3PRVA 5HQMA 1S4EA 3B82A 2XWYA 4URQU 3W3SA 3JSRA 4LVOP 1WC1A 4NEYA 4K8RA 1NDCA 5KFKA 1VDHA 1HFEL 3V81B 5E3QA 1H72C 3WDOA 3A8IA 4OMFG 3VAHA 5CYMB 4W92B 3FQKA 3JQKA 1RHJB 1DRZA 3IAM9 4O4GA 3IS9A 4OI3A 2X1FA 1U1RA 3QT7A 2B4VA 3I5BA 4IG0A 4R25A 4N77A 2YKQA 3GV8B 4FS2A 4B3RF 4DEZA 1AUSL 1WSRA 2AYEA 2CWKA 5F8IA 3MAQA 1S5ZA 4FYXB 3PEHA 3A12A 2CJYB 5DZ7A 1K0VA 3I4HX 2BE7D 3HSDA 4NXMF 3QFWA 1JLGB 5JXSA 1JJ4A 4DX5A 2DTJA 2F4FA 3EZOA 2NXCA 4JI6F 1BE4A 2WW8A 4IQMA 2CNKB 4RLEA 1PYTA 5EHHA 5KFYA 4DL4A 1RAHB 4RNHA 3TO8A 1WC3A 1FWKA 4ZCKA 2HYIB 1WF2A 1KWMA 2JHEA 5AT1B 1VQ8S 1DQ8A 1KC8T 2MKSA 3ZTSA 1VRQC 3GZ7A 4CLTA 1JQGA 2ZOGA 2KZMA 1F9EB 1O0PA 3FJ2A 3OUYA 5JJBA 5M2RA 4ECRA 4I2QB 3NS7B 4HT7A 4USTA 2ZBQA 3NAHA 3TW0A 4KV8B 4JI2F 1OPZA 2EFQA 4Z7CA 2KM8C 3MR7A 2HAIA 3JSYA 1FFWB 3W63A 4DUTA 2VC0A 1T3OA 5DDQC 4DCJB 4CCHA 1VGYA 1SQFA 1GX6A 4LRCA 5KT5A 1CLFA 2FHJA 1QAJA 2ZH6A 3BF4A 5IZHA 3V6DA 1RABB 5GAHU 4OZ1A 2OFGX 2A2CA 3UW1A 4LFBF 2DGTA 3EICA 3TEGA 2ZH1A 4PG5A 1VIOA 2Y8WA 1OJ4A 3W5XA 1XR6A 3MCSA 1WC4A 4KGXB 3W5YA 4DUYF 2EK1A 2HHVA 4OHVA 3DLJA 2FHKA 2HVEA 4DZDA 4O23A 3IWXA 2DB1A 4JI7F 3ZTQA 1EETB 3H42A 1TKZA 4IDKB 4KHPJ 2CQCA 2B4OA 1P1LA 3CUNA 1CEZA 2W8LA 4DU7A 5L1IA 3K58A 4WPAA 3QGGA 4EEYA 2RSQA 5LXRA 3M1VB 4Q44A 2QA1A 1B70B 1DQ9A 1OQ3A 3A3NB 2CJ9A 2BVZA 5F8JA 5KFVA 1QSYA 1YJ7A 3PFEA 3MM9B 4O0NA 3PRDA 2JOQA 3NBPB 1N54B 2PMZD 1M1KT 1RHQB 2CDQA 1S0NA 1FTRA 2W4PA 2GFFA 4ES1A 5DGAA 4HHUA 5C42A 3DI6B 4N76A 2BBEA 5DDRC 3KDNA 2WK4A 2XYHB 4DPYA 1DTTA 2CKWA 5ETKA 4WWSA 3N4WA 2P9GA 4USUA 3DRPB 2VG7B 3M8WA 3W1YC 2D9OA 3BN4A 4KC5A 2ROEA 3MPVA 1N4LA 3NGSA 2WHOA 4TVAB 4NI2A 4KQZA 4FZVA 3W66A 2HHHJ 3M05A 3A8JA 4LF5F 4WFYA 1WHVA 1REGX 1ZM2A 4ID5A 2FUG9 3C16B 1O51A 1UP1A 2K8GA 4B9NA 1N33J 1JXEA 1JWWA 1F5AA 1OWXA 3IP0A 4M5IA 1SL0A 3QSYB 4URGA 4QR1A 1I51B 2R8JA 3VAFA 4O44A 1TV6B 2H54B 1I1GA 2DR8A 2GNKA 4ID8A 3AJ2A 4G1PA 3ADAC 6FDRA 3HVAA 4P52A 4X4TA 4EZ9A 3M8ZA 2O3DA 2DHSA 3M4XA 4OZ5A 5HL7Q 2MSSA 4YB6A 1FX4A 1RBAA 1UWAA 1HQEB 5FD1A 2VF3A 2P5VA 4CO5A 5FDLA 2C2KB 4QW9A 3DRSB 2ZNYA 3EGNA 2IC3A 1SH0A 3UDVA 1S6PA 1J5EJ 4F7VA 3QZ8A 1YDLA 5KG6A 4ELVA 4WE1A 3A3PB 1YK9A 1T05A 3OR2B 2EFOA 2V4JB 4PUOB 4USWA 3WC0A 1N52B 5KFRA 2CQ0A 2YKNA 2VU5A 1CQNA 2WBRA 2HVDA 2F63A 1REVA 4GC6A 4YB1P 1JXVA 1LQ9A 3GLJA 3VCDA 2I5JA 1FD2A 4OI0A 2XS5A 2OD4A 2HRTA 4CLLA 4G6VB 1VQ5S 5SZTA 4OYBA 1YBTA 2ZM6F 4ATNA 5KFJA 4RW8A 4DQSA 5KG3A 2ZHAA 2E5IA 3W2WB 3M30A 1D09B 4QIFA 4C2MA 4RW7B 3JQMA 4O3RA 1EQMA 2DO0A 2R7UA 3G82A 3DOKA 5KT6A 2W2NP 5GADI 5E5NA 1WHYA 1JKHA 3M2UB 2DR9A 1SBRA 1FNXH 1OSCA 4FNHA 4F3QA 2H5EA 3OJSA 4C98A 5ETMA 3BH7B 3RR8A 5B0DA 4DF4A 4ZPDA 2B8QA 4TU8A 3DRXA 5A8RB 2UXCF 5A8WA 3FEXB 3VTIA 1G6BA 4ZP6A 2I2YA 5IT0A 3KK1A 4WKRA 1IXKA 1SJ4P 2CQIA 4UOCA 2IYIA 1VIXA 4MK9A 3EDRB 3EVMA 2CPJA 1LWEA 4YUDA 1BY9A 3AA9A 1YZ6A 2WCXA 3HDSA 1UEVA 2O5DA 1KLNA 2XNRA 4J5OA 2V5HG 3HHEA 3Q8RB 5D0HA 1EJ7L 3R6GB 1XTZA 4IG0B 1J5OB 3SFUA 2OO4A 3O3LA 1X5TA 3VVUA 3FC9A 3G96A 3UNGC 3W2VA 1R8HA 1Q78A 1Q79A 4WZMA 3ZFVA 3TP2A 1FF2A 3BSAA 2PD1A 1I94J 4NYPA 3IGVA 3T6JA 3DHWC 3MFIA 1SC1B 3RRKA 3FCWA 1N5QA 4BLGA 4ILLA 4EO8A 2NXJA 3QMQA 4U8YA 2DGVA 5DRKA 1NAQA 3GWCA 3PFOA 4NLPA 3SCLE 3THVA 1PBUA 1YRXA 3QRRA 3LP1B 5U47A 1VQ6S 1H74A 1P1TA 2HLTA 5KFOA 2CPHA 2KT2A 4N56A 3M8PA 1RLDA 2LQ8A 5KFUA 2IMOA 2Z2YB 1PAUB 2KKHA 3ICLA 3DM2B 3TZWA 3PKMA 2HWIA 4YEAA 1TKDA 3HJVA 2GIRA 4OFZA 3OUYB 2XMJA 4WF9Q 1WDTA 1NDKA 1PO6A 3VV2B 2JLEA 1HNZJ 3Q8VA 3GIJA 3KJFB 2AU0A 4ES2A 3N28A 2CPZA 2QSFA 1N33F 4X64J 1N0VC 2ZWPA 1Q82T 2E9TA 4RWWA 4DL7A 1HBNA 3VALA 3V6DB 2NZCA 3CD7A 5K5MA 5DJBA 4ES3A 3HK2A 5E7OB 4JB8B 3Q22A 4YY3J 5F9NA 2CPIA 1E6YA 1XMQJ 4UT4A 1SKSA 3F73A 1HWJA 3GMGA 4L74A 3LUYA 3PIPQ 2VJUA 2DNLA 2KXFA 2B9WA 2H1YA 3TWZA 5EN1A 3VZIA 1RB0A 1VQYA 3CCUS 3NKYA 3CULA 2ZKUA 2P6SA 1NDLA 4P74A 1QE1A 3IG1A 1IKYA 3B78A 1J5EF 1S6QA 2R9LA 4DR1F 3K17A 1TVRB 2CVIA 1TELA 2AJ4A 1X9SA 4MKAA 1SI9A 2VKRA 4W98A 1H7XA 4PG6A 3AOCA 4PPZA 2GVZA 3EXYA 1T94A 4JYAJ 2AGPA 4AD6A 4GVLA 4AUKA 4ZP8A 1RAIB 1WC0A 4ELUA 1X9MA 3GU0A 2QA4G 4FYWB 2VG5B 2CZ4A 4MKBA 4N8OA 5ITHA 4X62J 1RT2A 3L4BC 4ZJOA 4YR3A 1RTIA 1TTHB 3IR7B 3JAMY 3O6QA 1P9YA 3I82A 1UVMA 5HANA 2YH0A 2KT3A 3NEKA 5I3UA 4QWBA 2KVQE 4UZCA 3DDNA 3EZUA 4X66J 3C6UB 2HMIA 4DUZJ 5ETRA 5EDWA 3ELHA 4ALZA 5LT5A 3D0HE 4QOTA 2X51A 3QYYA 3T19A 2RDIA 2VOOA 3OL7A 3A8KA 2ZH8A 3CD0A 3H59A 1IR0A 3IBWA 1F0XA 4LRAA 3Q8YA 4DR4J 4ID5B 5J1PA 2QL9B 1Q5VA 4O3QA 4CM0A 3ILOA 1KEKA 1IR1A 2MXYA 2IRXA 1NPPA 4U7CA 3CJKB 2DNNA 3MAAB 2FZKB 1UJ6A 2PE8A 1NPRA 4O44B 2MTLA 3NOCA 2EKNA 1IWAA 4H4KC 5ETNA 1JNRB 2ZHOA 3BZQA 1WTFA 4TLQA 1OYEA 4JV0A 3NY0A 4CO1A 4E98A 3UVJA 1I94F 4PXEA 2UU9J 5KG1A 2XNQA 2AQ4A 3I55S 2WVCA 2BANA 5J2QA 5H1SV 2H51B 3KYLA 5KFHA 2DY9A 3V4IB 3RAQA 5FDLB 2ZWOA 5H9FK 5HN0A 2GMJA 5HVFA 2QFJA 3QIPB 2IC3B 1KBRA 2J6TA 2CPXA 4HTJA 3CDEA 2B51A 5EX3A 4WTYA 4XPCA 1IBCB 2CQDA 3H2VE 1I5OB 1PJ6A 2HW3A 4IOBA 4NA2A 2C1EB 4KR0B 1S48A 2GW8A 3HM9A 1IBKF 4DL5A 4Y3CA 4ED6A 4KKOA 2VFRA 8ATCB 3NRBA 1FKPA 5JVHQ 4X65F 1OY6A 3R9LA 5D78A 2YNHA 5F0WA 2CG4A 4KGVB 2BJ3A 1DQAA 4K4YA 1F2HA 4R0JA 1P6TA 4X64F 2MLZA 3N5BA 1VMBA 3DOKB 3KNAA 2HVIA 4LVNP 3DLEA 5IWAJ 2FZCB 4P2SA 1C2PA 5HAOA 1HNWF 2WOMA 1RT5A 2ZDPA 4DV4J 2ZH2A 2AYMA 2LEPA 4Q8FA 3C6TB 2Y1LB 3TR5A 4CH0S 4ELTA 3KK1B 4ED7A 1XMQF 4IOCQ 3OXFA 4Y65A 4OX8A 1RP5A 3AXMA 1HQ2A 2V0NA 4B9SA 4O3PA 3RB4A 1RHMB 2R7QA 2HQCA 1EAYC 5H9FJ 2XC9A 1XQIA 4RBVA 2VPZB 2J7WA 3HFZB 2B0GA 4GO7X 1FK9A 2V63A 4NEZA 4NLRA 3G4SS 2N7YA 4CTAA 3N5FA 1OSDA 2OPPA 2G2YA 5AE1A 2PA8D 3W2VB 2WONB 4HYKA 2CPEA 3G86A 4I0WA 3D1HA 2UUBJ 3F44A 3IRWP 4N8NA 5J2NA 1LOUA 2RQKA 3AB2B 3OV7A 1X5PA 3WIUA 1N36J 1YRTA 1RTHA 2NS1B 3RJMB 3LO3A 1FVQA 2DT9A 4X62F 1VQLS 3GILA 3TZZA 4C3KA 3PR4A 4UW2A 5A0YA 1FFGB 5FIIA 4FBUA 2O1PA 2XS2A 2ZJQQ 3KLEA 2E9RX 3M8PB 3GV5B 5F8GA 4X66F 1JIHA 4CT8A 4DUZF 3SV4A 3LALA 2OKQA 3N6MA 1CG2A 3GIMA 2KXHA 2KVIA 1D8YA 3OTOJ 2Q43A 3VR1A 3BO4A 1TK8A 2LXIA 4F3OA 1X4CA 1RE1B 2VL1A 4H54A 4QBUA 2J0XA 3O5TB 2M2BA 3IN5A 3R1LA 4DLGA 4J9SA 3AA8A 3TJAA 3FFIA 4UOHA 4DR4F 3D5MA 8RUCA 5CA5A 4JI4F 5KFTA 5HROA 3KKFA 3GFZA 1TK0A 2PT0A 1TL5A 2FJXA 3MTKA 1O8BA 5IT9U 4QIVA 3SI8A 4PWWA 3ZNUA 1F60B 4JI5F 5L1JA 1V9OA 4Q0BA 1H38A 2FLPA 2MQLA 1ZAWA 7AT1B 4DV5J 2VA3A 4XDCA 8AT1B 4J9PA 2JFKA 4USMA 3CJ0A 3OVAA 5HATA 1H3DA 3MPDA 4C6AA 5K8PA 2HRUA 2ACYA 1S0OA 1ZETA 2VG6A 4PABA 1HNIA 4ZHRA 1PBAA 1UCNA 2H5IB 4C48A 1NSPA 2OEKA 3L95X 1QE1B 3IG1B 1IKYB 1RTJA 1PSDA 3FKBA 4QCLA 1FRIA 5L9XA 4MIBA 1L3UA 2GMHA 4K0KJ 1VRUA 4ANEA 2VV5A 4LJMA 5ETPA 3THTA 2ZH9A 4ZVGA 2GVZB 2DNOA 2MKYA 1SC3B 1S1VA 2UUTA 2AD9A 1S7IA 4Q5VA 2VPYB 2JVRA 4MTPA 3TVKA 3BEGB 5F0UA 4HLBA 2R7OA 2KG0A 3D3BJ 5KFBA 3HFVA 3CJSA 3HKWA 3ISND 4USVA 1HWUA 2K1RB 5F41A 1RT2B 1MWYA 4KB7A 5KFXA 1BGXT 4FBTA 1RTIB 2B7BB 3D3CJ 2MHEA 2K06A 4V1Ak 4WJBA 4DV3J 2J8SA 1OYDA 2E7WA 1R6VA 3OXGA 5I3UB 2HFVA 3SQOP 3PACA 4LSZB 2IVYA 3TA1A 4PRFA 4FXWA 2H48B 3HCXA 3RBXA 4CLKA 1SXLA 5IWAF 2PIIA 1LWFB 3HZGA 2HBZB 3ISNC 2MY7A 4DV4F 4TQRA 1G3OA 2WRMA 4FXDA 3GJQB 1UWBA 3FZ2A 3OQ2A 1WHWA 1W2BR 4A4JA 2QE5A 1TL3A 2E5HA 1BUXA 3H40A 2DNYA 1LWCA 4IYQA 2DR7A 1QUVA 1ZZFA 1JLAB 3JS9A 3PW4A 3ZZZA 4N7TA 2HFSA 1EARA 3JTOA 3J81Y 5LXYA 4OYWA 3Q24A 4DSKA 1AFIA 5KFDA 2Z4PA 3DHXA 2XCAA 1N6QA 2Q6BA 1U1PA 3KJVA 2D3UA 3TJ8A 3V6KA 3KLVA 1EZZB 1S12A 2YKOA 2J5AA 3HF5A 3QLHB 2B9EA 1CVJA 1JX4A 4ED1A 4Y2AA 4CLWA 3UCUP 1BHNA 4IRCA 4K4WA 2UUBF 3UVJB 2H3EB 1SB6A 2JNJA 1FEHA 2YQ0A 5DETA 2BANB 1N36F 3CCLS 5A2QU 5KFLA 1RISA 2W2QP 3LOUA 1Z1ZA 4KHRA 5BJRA 5F8HA 1HR0J 3PTWA 3OTBA 2AZ1A 3CVKA 1IBLJ 3K0JA 2YXLA 2LECA 4H4OA 1FFSB 5KG4A 3BDEA 2RUSA 3I56S 2F65A 3M9NB 4BWMA 2KU7A 2CAJA 4YDXA 2LXFA 3BGRB 4ETXA 1R0AB 3QJJA 2RU3A 4HT5A 3BQ2A 1X4BA 4EBDA 3D7SB 1M1GA 1N8RT 2V8HA 4C3LA 4ILRA 1PYSB 4WFXA 1KLMA 3SYZA 2MKKA 1N32J 4KKOB 1CC7A 3GP9A 4DR3J 1FKPB 6FD1A 3OJUA 5DM6Q 3T1AA 4LQ9A 3AD8C 2FJEB 1RHRB 3A1YG 1KS2A 2OPQA 2YNHB 1WOSA 2VZ9A 4QZVB 3M8RA 3MWBA 1W26A 4X4UA 1M5HA 4ZLLA 3UDLA 3DLEB 1YJNS 2HS0A 3HHLA 3LGNA 4CH7A 1LWXA 1F3VA 2MQPA 3RBEA 4F0HA 2ROGA 1RT5B 1S1XB 1SJ1A 3R27A 3AODA 1Q53A 1SVDA 2VFUA 1C1CB 4F4YA 2EVZA 4WFNQ 3G6XA 4OZ2A 4IH7A 2HWHA 3KLHB 5EWEA 1R6YA 2BRLA 1QD1A 5DLFA 3M6VA 3KMQA 4GKJF 2V8PA 2V69A 2R8GA 2PEBA 2VA2A 1RHKB 4FYDA 2AV5A 4B3TJ 1XIQA 4LF9F 4YQWA 3ONQA 1K1QA 2G13A 2KYZA 2FJBB 1FK9B 5MAOA 3NGDA 3HVRA 5AXMA 4CTAB 3PNIA 3BGLA 3BGOP 4K0KF 2OH2A 3MD3A 1KD1T 1WACA 3Q8SB 3CCVS 5ETLA 4BC7A 4DG1A 4DR5J 4X4PA 1LXNA 4XPEA 4ZPVR 1YJUA 2LVWA 4YN3B 1AT1B 5GAEU 2AW0A 2R8KA 3PW7A 3H7HB 2ZVIA 5T41A 3J7Z5 4W90B 2W7PA 2R7SA 3H5UA 3KHRA 1RWWB 4CH1A 2ZZTA 4GO5X 5A8KA 2NSCA 3IBCB 2W01A 4GVBA 1KVKA 5HLFB 4OV6A 5KAKA 3LGHA 2RHQB 2YTCA 4FNIA 3I0SB 1S9FA 4DCOB 4A47A 4KFBA 2XSFA 2X3GA 5FJ4A 2HG4A 4DBQA 3LP2A 2HQIA 2RF2B 4K4ZA 1GXLA 2XLJA 2OHDA 3FNNA 3NLCA 4IO9Q 3NCPA 3BPSP 2KJVA 1L3KA 4TN2A 4IFYB 3CSKA 3TAQA 5J2PB 1A7GE 3VWSA 4KBIA 4TY9A 2HZVA 3FFIB 5T14A 2AIRB 4ZIVA 4Y28C 5HROB 1Q95G 2DIUA 1ZPWX 4FKXA 5KG0A 2K7KA 3K89A 1S59A 3C15B 3Q8QB 2PO4A 4K2JA 2DNGA 1S7HA 3IA0A 2R7WA 2Q6CA 2F3JA 2J9EA 4Q0BB 5HMWA 3POTA 5KT2A 2UVRA 2RKIB 3CT9A 2MLYA 4DXLA 2OEMA 4DFMA 3L9ZA 2GJIA 1S72S 3CIZA 4DPXA 4AQYJ 1VJQA 3MMJA 2RAQA 4KYZA 3I0RA 4RX6A 2HK3A 3HI9A 3LQVA 1ZTTA 3W7BA 5G4DA 1JK9B 3GJSB 3CD6S 3FBCA 4NLDA 4C0HA 2XO6A 4IG3B 4YR0A 2H9ZA 2DH8A 2RDJA 4F0KA 1WOPA 2VG6B 4J9QA 2CQGA 1S6OA 1SIZA 3MUVP 3DLLQ 4PQAA 5F3ZA 4S0MA 3TQEA 4NLVA 3J80U 4ZHRB 1M5KC 5RUBA 3F56A 2ZH7A 1NJYA 5I42A 1U24A 4OZ3A 3ZXWA 2RDDA 2XYGB 1RTJB 1XNQF 1H2UX 2BKNA 1RADB 4E8UA 1HLWA 2DBBA 1XBWA 5GAGU 1VRUB 2EWHA 2ASJA 3CE8A 1GTEA 2RE1A 4Q43A 1B0TA 3CCTA 4LRFA 5L1KA 3FEZA 2XGQA 2V6AA 1R8CA 1QLNA 4QWAA 4UUXA 4R5PB 2IDEA 4CO0A 1R89A 4XK8C 3MR3A 2LU1A 3UWTA 1K73T 1M5PC 5IC6B 1Y11A 4ED5A 1Y3JA 3AH6A 2WW4A 2VPXB 2ZD1A 4R8UB 3MEEA 2W9CB 3ZZPA 2KXNB 3AB4B 4WFZA 4ENOA 1WEXA 5KFIA 3K8WA 4ZVTB 2B9XA 1B0VA 1VRTA 4CLSA 4HDHA 2F7VA 3R5GA 3P5BP 2CNNB 1IQTA 2NXUA 1RLCL 4OHZA 2F9JA 4BHQA 2K3IA 1Y3KA 1CS4B 1UWBB 2C42A 2KFYA 1E6VA 3HZEA 3W62A 5C2CA 1BXNA 1TL3B 1RCXB 2Q1LA 3QSIA 2NUUG 2MQOA 3P3DA 4ZMMA 3KNGA 2MZTA 1RT7A 3UE2A 4K7QA 1KOHA 4QYRA 3M7VA 2YWWA 5J2MA 4Y6IA 4LT6A 3KJVB 2FGOA 2ZC4A 3JYTA 4P2XA 4IKAA 2IVFB 3PEJA 3TUJC 1Y10A 3SQGB 1S1WA 1SL1A 3PVXA 2I1RA 1VQ4S 2WB1D 3EWGA 2CIMA 3BO2A 1QSSA 3H4BA 5CHCB 1SJ3P 4B3SJ 4F4XA 2M4MA 2JX2A 4NCBA 2N4DA 4ZLNA 3PKYA 4DR5F 4AT1B 4DI6A 2JJ4D 2MQ8A 2RD5C 4X4SA 1QUPA 3K5OA 3VGVA 2W9AA 3CJ8A 4I56A 1S10A 5HI7A 5EWFA 1Q5YA 2HRYA 1ACMB 2K3KA 4J9LA 3FDSA 4MT1A 3V81A 3D1QA 5KFAA 4H4OB 5CYMA 4U7UD 1S0MA 2UXDJ 3V6HA 3DXBA 1JLFA 1MN9A 2VICA 4UQGA 2M88A 1KOOA 1D9AA 2RVJA 1VQKS 5DQGA 2OSRA 3ENWA 4EYHB 2BV3A 2J6SA 3H20A 4LF6F 3H25A 1KLMB 2DGQA 2BJDA 2VASA 3M2RA 3UD4P 2HNDB 2I9SA 1FNOA 2OPQB 4QWEA 3PCOB 3LW5C 1D9FA 3RU0A 3OL9A 3D1OA 3BBFA 5C2GA 1T11A 3UN3A 1X31C 2L41A 2HQGA 3TJ9A 3H98A 3HHLB 4L6V3 1Y7PA 3W9IA 4ZKAA 2CJBA 2BJEA 3E01A 1HNXF 1TZ0A 1K0TA 1RU1A 3TQ1A 2R7VA 2MKCA 4P7VA 1ZA1B 1GAOA 2QA4S 3MR6A 3GFHA 3O8WA 1YZ7A 5EUHA 1RHUB 2JC1A 1OO0B 3PW0A 2HBYB 5E2QA 3F41A 2B5JB 1SJFA 1XR5A 4P72A 1T0TV 2V68A 3UNYA 5D3GA 1IKWB 3D66A 2PA3A 1XERA 3WHIA 5T7LA 3RBDA 4I2QA 2MMYA 1A9NB 3GJTB 3ZZOA 2FVQA 2KFNA 3MM6B 2R8HA 3U1MA 3P6YC 1HBOB 1UZDA 3JQJA 3I32A 4RO0A 1TFYA 1K47A 2R2TA 4ZJQA 3CCMS 2RU9A 2MGZA 3MUTP 1OY9A 4WK3A 2XMKA 3QAUA 2AMCB 2ABYA 2QMUB 1RA7A 4O3OA 2FQQB 2J9CA 2I0XA 3TNVA 1FXDA 3JAMU 1Q1KA 2BJ9A 1CSJA 1CQMA 3BGUA 3BSCA 3R5CA 3CW2C 3QT5A 1Q81T 2FY8A 2QGFB 3HX9A 5LSLA 1LK7A 4GKKJ 1EETA 3U27A 2OP5A 1ZM4A 4K4TA 5KTQA 4CO2A 1S4FA 1QJHA 3N9UC 4KFBB 3R97A 4ZVRB 3LF0A 2RQ4A 2BXJA 4NMLA 2GV1A 5FLXU 3MAHA 2WSEC 4JP8A 1EQ0A 1AA1B 1VBYA 4V19J 3ITHA 3TARA 1KONA 3N6NA 2ZNZA 2MHNA 1FKAF 3UR0A 4L73A 3MM9A 4ZVFA 4ZOSA 3UN2A 1RGVA 3OT9A 2ZC3A 2OTJS 1V6HA 1HHSA 2Q66A 4F8RA 3US5A 1EKRA 1T9TA 2D3O1 3POTB 4QPTA 1VQ9S 5ETTA 3Q8PB 4EWTA 1Q7LB 4J91A 2DGUA 2QIFA 4AL7A 3HVTB 3LH2S 3E8OA 5LMNJ 3I0RB 4RUAA 3PY8A 1JJCB 4MK7A 4H4MA 3QGIA 2V9WA 5IQ6A 3QT6A 4DCPB 3RR7A 2WZ1A 1FRKA 4M5HA 2IBKA 4JI3F 4RUHA 5LSOA 1HHTP 4CIOA 4PKDB 4A8QA 4LMZA 3S7RA 1PC5A 1IM4A 5I42B 2QT7A 2VQEF 4KO0B 2D74B 2LDIA 2OLWA 4ZPTR 1BQXA 4DR7J 1SH3A 2LDYA 1LK5A 2M5YA 4D3HA 5HQLA 4ZVEA 3PJWA 1NNDA 5AXKA 1JLBA 3MI7X 2APOA 2CPDA 1XK8A 2GHVC 4OLPA 1U02A 5D0GA 5CYQA 2E1MC 4PXCA 2HNZB 1DLOA 1QVGR 4RUCA 2AJQA 3PM9A 1U1MA 1NLKL 1VHFA 3MEEB 4C9DA 1ZZNA 4M1KA 3IR6B 3D2WA 3KWMA 3WQPA 4DN9A 3SMZA 3I4PA 1OS5A 2E44A 2HHPA 1VRTB 3R5BA 2Q3PA 1B99A 1VOMA 2LQBA 4DX8H 3DRSA 2VHGA 4G65A 2LQ5A 2A1BA 2V4QA 2DNMA 1KHWA 2V4JA 2E9ZA 3GIRA 3RAMA 2E5LJ 1ZBTA 3JSMB 1FERA 1L3VA 4WK1A 3IM9A 4P10A 1PILA 1RT7B 1VR6A 4K5SA 1DTQA 2JL9A 2FGCA 3G71S 1GNKA 1X0PA 4ZCIA 2ZJPQ 3FVYA 3HT0A 1QAXA 3P96A 3JYTB 2W7AA 3KOAA 5KFCA 1BMQB 2QG9B 3CO9A 1FJGJ 2YPYA 1S1WB 3IWNC 2C3YA 2O67A 5L39A 4RJVA 1AUDA 2BZ2A 1JJHA 3NP5A 4MYTA 3IBFB 1FJEB 4KT0C 3PZPA 3FBFA 1FTCA 4HKQA 2OFHX 3AY0A 1ZS6A 5A8RA 1NZ8A 3GV7B 1D8ZA 3FEYB 2EPIA 1SKRA 4Q7AA 4KH1B 1HMVA 2QL5B 4F04B 4WCEQ 4GKKF 3S01A 2RIJA 1JLFB 1HD0A 1RDRA 2HGLA 1GMWD 2J9DA 1GH8A 4ZCLA 1ZYQA 1MW7A 1J5OA 4EU0A 4RBTA 5GMEA 2FPHX 3GONA 1S9GB 3FSIA 4PQUB 4IUFA 2D69A 1VK3A 1YTYA 3M2RB 1ITPA 3CJ2A 2Q79A 3Q23A 4CLYA 1AB8A 2DYAA 4K59A 1IKXB 3FCHA 4XIUA 2IPOB 3M8SA 1RAAB 1SPBP 2Z8QA 1FVSA 3TUZC 3O2IA 2QLWA 3L7OA 3E01B 3MHYA 2R7RA 4BWJA 1FD8A 3LP1A 2V8GA 5J1NA 3ZTRA 1FRJA 2LP4A 3HULA 1ZPVA 2YY3A 1NMEB 3AXKA 1FRXA 4JBCA 1WEYA 4NZ7A 2PMHA 5L1LA 1P9QC 1NK6A 3KUHA 3DM2A 3OVSA 3GTYX 1F6TA 5C24A 4RKUC 2N3LA 4KHMA 2NR0A 3ZZ0A 5F8MA 3JB9k 5E0OA 2R2SA 4OJGA 5D3GB 3E51A 5DQHA 2ZJRQ 1WG4A 5T7LB 2I8EA 5KOWA 4OYMA 1RBOB 4LF4F 2VQFF 3SFGA 4XDDA 2BQUA 1C0TA 3H5SA 1AZSB 4I2PB 2MKHA 4DR7F 5JMNA 2ZUGA 3FZBA 2KI2A 4EFAC 2MGZB 9RUBA 3NL0A 1TUWA 4K4SA 1K1SA 2FVSA 3D68A 5B7WA 4KY3A 1KFDA 4F67A 2YX7A 2IM0A 2XQCA 3JTNA 4P75A 1T9XA 2GIFA 4MKYA 1Z2ZA 2G2ZA 2WB4A 3RB3A 3BYRA 1NJWA 3MZIA 2IYGA 3W60A 3CJRA 5HMZA 1RAFB 1RBLA 4KPCA 3EGVA 2IRUA 4BDPA 4LREA 1VK8A 2YKAA 4JI0J 2CA9A 5CCLA 3ILJA 4Y2KA 4O0IA 1FWPA 3KLGA 3AJ1A 2DR6A 5E3AA 3PO4A 3ET6A 1ICEB 3K5NA 5M2UA 2JEIA 1TVRA 1NBEB 4ZN1A 2WTFA 3R2CJ 3C19A 3ZZRA 3VGUA 5K8MA 3K5MA 1M5VC 1D0EA 2OSQA 2EK6A 1HQUB 3DDIA 4ECXA 4MKVA 3DNCA 2E5LF 3CF5Q 2QRRA 3ITHB 3J81U 3SSQA 4IQXA 3ZZUA 2XSJB 2K2PA 3BR9A 3HFKA 2VG5A 3P49B 3OBIA 2FJAB 3IMQJ 4ER8A 2IA6A 2UUAJ 4XO0A 1MSWD 2E5JA 4Y34A 1VFJA 3MCOA 2HIYA 4HEA9 4CM2A 3T5KA 1UVJA 2C22A 2AX1A 1UTAA 3T1YJ 3N0VA 4UY8T 2HZCA 1U2RA 1D9DA 4A8KA 2PFFB 4DJBA 3GE9A 3A8EA 4DL6A 1TP7A 2IAJA 3GIKA 4JV1A 4UY85 4RNMA 1PGZA 3C6UA 1RXOB 1IJEB 2VJVA 1VQMS 3CMES 3KLFA 2E7XA 4YHHJ 3DLBA 5D0EA 5D4LA 4H4MB 2GQCA 4PXBA 2ASDA 3JTPA 1FDDA 2AEMA 3NMRA 3J7AN 5D4NA 3DU5A 3HXMA 3QQCD 4G3IA 3HD1A 1QAYA 3D9BA 3QAEA 1FKOA 2W25A 3ZZYA 4DF8A 1T9VA 4OYIA 1ZM3A 4C8KA 1UJ4A 4CZCA 1G7CB 2KHDA 2F8MA 2I6WA 2MYFA 1Y9OA 2P2CB 1JLBB 3CJKA 1TUGB 1HW9A 1YIJS 3MAAA 4F02A 4DMZA 3ZTPA 2H65B 2QL7B 2LKZA 4ZIWA 1KQKA 3N6LA 5CYQB 2OD6A 2JVOA 2PSZA 3MM8B 2R4FA 2KJWA 1GK8A 1DLOB 1RWUA 4M5JA 2BOPA 1X5OA 1UFLA 2WVFA 2JFDA 2DY1A 2ZZNA 1NCLA 3HHLD 1I3OB 2GO8A 3IR5B 1BQNB 3KFWX 4TLRA 3SSSA 1FJ7A 1IUJA 3TVZA 1EX8A 4ZVSB 3V4IA 4EYIB 5KFWA 3R6LB 1UZHA 3NCQA 3QIPA 4EZ6A 2XG8A 4OHWA 1CULA 3MR2A 3HHLC 2ASLA 2ZOMA 1Z4UA 1G1XA 2DXDA 5K14A 2IM3A 2YH1A 3UN5A 2QLFB 1UVIA 3WC2A 4UTGA 1YSJA 5A76A 2J6UA 1JMTA 1P8GA 2G0CA 4Z37A 1DTQB 3NS6A 3VQTA 1S0VA 1U48A 4J9KA 4DPUA 2BR0A 2KTQA 4DX7A 3UO0A 4JV5J 4EI2A 1UW9A 5AXLA 3CC4S 1YJTA 3KJQB 4DFPA 4HDGA 1NB7A 1WI8A 4NLYA 3TX0A 3R5DA 4CT9A 1GXTA 2DCUB 2OPSA 4G1QB 1PJ5A 3T6BA 3GR1A 4LBHA 4ED0A 1FE0A 1KN6A 3HJFA 3AD7C 1Y4ZB 4ZVPB 4PXDA 3C6TA 1LNQA 2KT5A 2YNFA 2COLA 5HK4A 2ZBRA 3BQ1A 3RBZA 3UD3P 2QO3A 2W7OA 1LXJA 2IJNA 2DISA 1HMVB 1NJIT 3OPKA 4KPYA 4FS1A 4OZLA 3KUEA 2A3JA 5CH7B 4KJIA 2ERRA 3GG1A 1I6JA 3EPIA 4KHPF 3PV8A 3FK4A 2YBVA 3Q8UA 3CCJS 5DZ6A 2CDRB 1EP4B 1S97A 2CQBA 4NCGA 3PW5A 5KFPA 2LQ9A 4DZ6A 1FJCA 2BA9A 4B3OA 4NLSA 5KFMA 2DHAA 2WONA 1NK9A 2XMAA 5C25A 2OJ3A 2BMBA 5KFZA 3CMQA 3KG4A 1M5SA 4URSA 4NXNJ 2YX1A 2IVMA 2L9WA 2ZITA 4CLZA 4DX6A 2Z30B 4AXIA 1HW8A 1U2CA 1F9FA 4F50A 5K8OA 4ED8A 3CC7S 2FYXA 4LFAJ 3QJPA 1T3NA 2ZUAA 3T1YF 4NMXA 1MMDA 2V2KA 1QAIA 2UUCJ 4J9NA 3SDEB 1U1NA 5BYQA 2R7XA 2MKJA 2WSFC 2C2MB 2LA4A 3MMBA 4YR2A 4YHHF 2Y1IA 2B3TB 2E1PA 2B4PA 3W5ZA 5C24B 4Y0FA 4ZP9A 1MMLA 3KK3B 3MEKA 3LANA 1WC6A 1R27B 4ETZA 2HHHF 2PC6A 1WD6A 2VFVA 1C1BA 2OAUA 3R1HA 2J0QD 2XZDB 3GR0A 1C0TB 2RT3A 2XMUA 2WSCC 3A3OB 2UXBJ 3LPYA 2J0SD 4ED3A 2BKOA 2VD3A 1FA0A 4USHA 3EX7B 4DSFA 2BE2A 2SXLA 5B0EA 2DHXA 1NB2A 4IO1A 4ANDA 3W8PA 4NZ6A 5F8NA 1ZAXA 5AJ3J 4K4VA 2AWZA 2F4VJ 4DPOA 2GA7A 3K57A 4B3RJ 2UZAA 2BW7A 2NXNA 3CC2S 4NWBA 2KB2A 3CDBA 3OTDA 1KQFB 2ZBIA 2QC3A 2DNQA 3SCIE 2WAQD 1VQOS 1M90T 2MQQA 3KLGB 4OHXA 2XY6A 5HJYA 4NLXA 3ET6B 3SCKE 3T9NA 2M52A 2ADBA 4ZVQB 2PDAA 5J1EA 4RR5A 1NK4A 5DG8A 2M70A 2WBMA 3V2UC 2NPFA 2XLKA 2D3ZA 3QPIA 2AEFA 2CFXA 3MDFA 2BJ7A 3NGTA 4F36A 2RS2A 1B64A 1NDPA 2L3MA 3R8YA 3SEOA 3FBBA 4J7CA 2FJDB 5B0BA 1GXUA 4ZCMA 3I5AA 2XI2A 3T5HA 3D6HB 3DLGA 5GAHI 4OI6A 3H4DA 4FKYA 2K1RA 1RKIA 2H4YB 1U8WA 1UVNA 4N47A 2F40A 3HKZD 4Z7YA 1L5UA 5LMUJ 4JV5F 2MJNA 4TNOA 2BJ1A 2DPJA 3TA0A 2AJ0A 2IAJB 1F2GA 4IFVA 4IR9A 3BO3A 4CP5A 5IT9Y 3KLFB 1LWFA 2FDNA 4OLOA 2E5GA 1BWVA 1HIYA 4LFBJ 2VB6A 1YWXA 1U47A 4OX9J 2QFIA 3EVOA 2V34A 3B4MA 3P45B 5IV3A 2YNGA 4DV7J 5DS7A 4NYOA 1FKOB 1EIYB 1JLAA 3TA2A 2OMOA 4JI7J 1LW2A 4WKYA 2DIVA 4U96A 5L38A 2EKYA 2HAFA 3H90A 3TVYA 4P2FA 4ITSA 2I38A 1TL1A 1V5VA 4PWDA 2DHHA 3A4TA 4DN0A 1GTHA 5AE3A 1QTMA 5M2PA 1YX2A 1GEHA 3QLHA 3A13A 2VPWB 4DV0J 2E1RA 3K7RA 4OJHA 1TK5A 3CEDA 2W2OP 4O3SA 3GFXA 4MMOA 4A8FA 2IJFA 2IMWP 4HH0A 1RWPB 2BEFA 3BKTA 2AZ3A 2AF6A 3HVWA 1NZAA 3ENQA 1RAJA 2NCKL 4DLEA 1S77D 2ZFHA 3EXCX 2HQFA 2P6TA 2YKMA 1FI4A 3NGUA 2B43A 3UI3A 2L9DA 1ZA2B 5K9FA 1CULB 2VBWA 2ATLA 2RQCA 2HPUA 4BBYA 4EMDA 4BS2A 2FLNA 3BGRA 1R3NA 5K14B 1R0AA 1HL6A 2MZSA 2HBRB 4ZVHA 3RW6A 1AW0A 1TU0B 4KGMA 1U1KA 2VFSA 3OFHA 2D9PA 2HFOA 2V50A 4PCQA 3WX4A 3CJTA 4LF5J 1KHVA 2KZZA 1FT8A 1TL4A 1TQLA 1HNZF 1WORA 1ZM9A 4YB7A 3TUIC 2IRYA 2UXBF 1X9WA 2VONA 2Y1JA 3THPA 2Z2MA 4LF8J 1NJXA 2VH7A 5KG5A 1YJ9S 2OPSB 3SXLA 1S1TA 2C2EA 2V2QA 1DARA 2YWKA 1S1XA 3LP0A 2J9DE 5AJ3F 4A46A 1SV5A 2F4VF 1C1CA 2XYPB 5ETVA 3ZC4A 3HO1A 1YQHA 3KTQA 4YY3F 2HK2A 4ECQA 2P9CA 4AE5A 2YNFB 4RW6A 2JWNA 2KRBA 2Y3YA 1XNRJ 2CQ3A 3C8YA 3QRPA 4WYWA 3RB0A 1FCAA 4Q8EA 2QYCA 3H2UB 4FDFA 3KLHA 1NM2A 3MEDB 4QYZK 3DCAA 4OX6A 3PDNA 2QSWA 3HHNB 1SQEA 3JSBA 2R42A 5A2QY 4I6AA 1OIAA 1NKCA 4C97A 3MD1A 3BQ0A 4NCGB 2DR5A 1HYSB 1X8DA 1VBXA 4X4QA 4DL3A 2HBQB 3OHBA 4MH8A 4B3OB 3LPEA 2F1FA 4KAIA 2EEYA 1CPZA 4M94A 3GCWP 1A6LA 5C25B 1S76D 3NXZA 4C4WA 4CLPA 1A0OB 5BR8J 4JYAF 1N34J 1RU2A 1HPZB 2P8IA 3GG0A 4O3NA 5KFFA 5GVQA 2W1BA 4M8LA 1YHQS 1XN9A 1RK8A 2N4CA 4QIGA 2XMTA 2RRAA 2ZM6J 2JSXA 3G87A 5D8HB 1PAEX 3AQPA 3OVBA 3DN9A 3KMSA 1YG0A 2E1AA 4OYOA 1SIWB 5LMUF 4F3MA 4JUZA 5HLFA 1N56A 1TKTB 3I0SA 4RU9A 2UVUA 4G1IA 1IKVB 3OLAA 2DO4A 3MMBB 5HVGA 4NCAA 3U7JA 2F8HA 2HGNA 1MWQA 4OX9F 2RF2A 3I5CA 4WXOA 1U6BA 2L9NA 1VBZA 1SL2A 2UXCJ 4LF7J 3CMAS 2LU2A 4DV7F 1GMWA 4FPRA 3PX4A 4IFYA 1B7YB 5J2PA 3G6VA 1C1BB 1SJQA 5CZXA 1CJUA 4YP3A 1KFSA 2ATCB 4C8LA 4QYZJ 4K5RA 3H5YA 3C15A 1B0PA 3ILLA 2U1AA 4KIAA 4WU3A 2BYCA 2ZBPA 1RYRA 3CDUA 3NGRA 3BDPA 4XTTA 2BE2B 4OHYA 3QGPA 1SUQA 1UPMB 1W25A 2AYGA 4ECUA 4RPFA 2RKIA 4PWUA 2CVEA 4CNYA 3VVTA 4DV0F 2GVDA 1ZH5A 3PX6A 4F4ZA 1UW4A 3PW2A 1XEZA 3LAMA 2MZ1A 4RU2A 2GMLA 3HD2A 3G9CA 3FSYA 2UU9F 1W2IA 1URRA 4IG3A 2Z57B 4TU7A 5K8NA 2MZQA 3B54A 1RT3B 4YS2A 2IA0A 1S99A 1ZTWA 1NHKL 1KQGB 2HNYB 4J9UE 1CC8A 1WNEA 4WP3A 2YPZA 4FYYB 4F0MA 2B6AB 5J1EB 5HSPA 2RB7A 4ZS6A 1CJVA 3RYLA 4NLTA 5ETQA 1TAUA 5KFGA 4A8OA 3QT8A 1IM6A 1MROB 1N0UA 3HSGA 3OXLA 5IQQA 2LA6A 1U45A 2AJ1A 5CABA 4R5PA 1D3WA 1RT6B 3DLGB 2JZ5A 1LV5A 3MFHA 3NAIA 1IN0A 3Q89A 4OYZA 1WWHA 3BS9A 2CQ2A 4R8UA 2W9CA 4NPOA 3TZXA 5EWGA 2FB0A 2OGUA 1KP6A 2HS3A 2GAGC 3MF5A 2ZOFA 2CRLA 1GFWB 3OTEA 4LF8F 4IFVB 3E3XA 3RB6A 2HFUA 2RMLA 4DL2A 3OL6A 2E1CA 1BQMA 2EG1A 4M63A 3I6PA 2BM1A 3CCES 2GS8A 4M5MA 4JOUA 2YNGB 1C0UA 1CS4A 4ZPAA 2V8VA 1HI8A 3MOZA 4DQPA 4CI0B 2DRBA 1XNRF 1FRHA 2EFGA 1NSAA 3FBEA 2DGWA 3D6TB 2CUYA 5CXTA 1HWLA 2RHSB 1JLEB 3Q86A 1LW2B 1KTVA 5THWA 1R8AA 1J2VA 1RA6A 2YVSA 2O01C 1TL1B 2UVWA 1Z2LA 4PWDB 4DR1J 5E41A 1RTZA 2NSBA 3J80Y 4NL5A 4ZPCA 5H9EK 4DV1J 3SQGA 4C8ZA 2V2ZA 4ED4A 3OD2A 4R0EA 3B6BA 1R43A 5IFMA 2MPUA 1Q8BA 4B9LA 4A8YA 1LKZA 3U1LA 1VJWA 5BR8F 4LRBA 1N34F 1S49A 5K20B 3P5TL 1NUEA 5E3PA 2R2RA 2JH3A 3BPDA 4ZP7A 1HNVB 1WF1A 5F8LA 1NK0A 2ZH3A 1Y00A 2YKMB 4ZLJA 4C8MA 3EYZA 3AFGA 4WFAQ 3MGJA 3AT1B 3J7A1 2Y1RI 1B4SA 5L8RC 4DWIA 1WKLA 1TMMA 3K2YA 3NG8A 1FXRA 1U4BA 2OMLA 4LIWA 3LWMA 4I67A 1QDUB 4NRUA 2EG2A 2NQPA 4UUWA 4ZPWR 3OTOF 2QN6B 3PX0A 2C2OB 4CDIA 2IIHA 3G8SA 2MSTA 4FXVA 1F5CA 3TYTA 1X4HA 3B4DA 4I1TA 4LF7F 2MEWA 2Y8YA 4IR1A 3KXDA 4K4XA 1UPPA 4HI2A 2HNDA 2DH7A 3MMAA 2FZGB 5B0AA 2LYVA 2G4BA 2EFPA 3CCZA 3CJ4A 3GPAA 2DJWA 3UDEA 4FVCA 3ETOA 4O4GB 3IS9B 2PI5A 2XMVA 3MR5A 1RYSA 1S1TB 2QLXA 4DV5F 5B08A 3LP0B 5H9EJ 4YFUA 1SV5B 1YJWS 5ETOA 2KHCA 4DFJA 4QQBA 3K5PA 1F9HA 1QY7A 5LOQA 2KL8A 4RW6B 2CZ9A 2CXEA 3BM7A 4J9OA 2B5JA 1F5BA 3EGWB 3SIPB 1UJ5A 4ZPBA 1IKWA 5I3QA 2BACA 1N88A 3BGFA 3KG0A 5LSRA 2N3OA 4I6YA 1KNZA 2PMWA 3MM6A 1U6FA 1HBOA 1YRUA 2AHOB 3R3TA 3TRGA 3H8YA 4B02A 2FLLA 2DD8S 3RAXA 1WDDA 1VQSA 2CQHA 2OTLS 5IV4A 3KHLA 3UFCX 1Y5LB 2X3DA 2GAHC 4IRKA 3ENVA 2CG8A 1UETA 5HP1A 4ZVUB 1KKHA 2W4CA 1IBKJ 4TKTA 1RAOA 3J7ZT 4FF4A 1Q8IA 3FMBA 5B0GA 3IWLA 4PG4A 1AFJA 2AEJA 3AOAA 3RTVA 1PC4A 1EHWA 2B9YA 3NWRA 5G0RA 2V4RA 4X65J 3BREA 1J27A 3KK2A 1OY8A 4A8XA 4DV3F 3I9ZA 1S1UA 3U02A 2R8IA 4Y2MA 4YDDB 1YVFA 4NX9A 1HI0P 1V5IB 4FF3A 1SC4B 4OL8A 1IVZA 1HNWJ 2B4UA 3SZ2A 3VF0B 5B0CA 2XI3A 2OI2A 3S1TA 4B3MJ 3IGNA 4ECWA 2V94A 2NPIA 5I4MA 1YGYA 3HHDA 2E66A 4F25A 3H0PA 2HIQA 2C2RA 1DHMA 2IM2A 2PFDA 3EVWA 4HHJA 3M6UA 1RT1A 2E7VA 1JB0C 3AD9C 3ULHA 1CJUB 2BX6A 2DEJA 2R7TA 2G1DA 3D54A 1TKZB 4ZLPA 3QATA 4LFCJ 3NMAA 2EBEA 4HH1A 4ZVOB 3CDWA 1GX5A 3M9OB 4WP8A 2CJKA 1JNZB 1SUQB 3M8QA 4J9VA 1TR0A 5MLCV 1R8BA 2B7CB 2NLWA 4DV1F 3FQLA 4L76A 3OTCA 5CAAA 1HWKA 1PCAA 3D28A 2GVDB 3HVTA 1RAGB 1H2VZ 1NEEA 2FVPA 1LFPA 1GQEA 2PEHA 1ZOTA 1SKWA 2DVIA 1KVJA 5BYRA 1OMSA 4YMEA 1GMUA 2YQ3A 5ADZA 3DOMA 4M5DA 4U95A 1RSCA 5AE2A 1URNA 3OHAA 1ZAVA 2HS4A 3GFYA 4U6PA 5IS2A 1U8SA 3I96A 5C42B 1HR0F 1KVIA 2OIHA 2XULA 3DYAA 4DV2J 4KO0A 1IBLF 4PYDA 3AAWB 3FRZA 3CGIA 1DTTB 1CJVB 2LEBA 2CPYA 3PYFA 2BJ8A 4IH5A 2FC8A 3NCRA 1FRMA 1AXQA 3DKDA 2BQ3A 2QLJB 1N5YA 3HPOA 1MNEA 1H6KX 3HLUA 4PEOA 1UL3A 1VYAA 4WTOB 2F9DA 2NXEA 4NI2B 1V3ZA 3HT3A 1XWLA 4NA3A 3F0NA 3Q83A 2HNZA 4OYXA 4ZITA 5FLXY 1NJZA 5CYJA 2XHWA 2UV8G 1U6ZA 1N32F 4UOFA 2OEJA 4DR3F 3T41A 3DRRA 4JI4J 4F26A 1S57A 2Z58B 2QV6A 1WUUA 5IXUA 4DS5A 2BUNA 2QEXS 3TUPA 4KTQA 2GC8A 1ROFA 4JI5J 1UMJA 1L3TA 1YBAA 2J8AA 4UZBA 1BQMB 1NK5A 3NOGA 2MZJA 4NLUA 1F3FA 2DGSA 4NRTA 2G0IA 3TAPA 4J9RA 1H2TZ 1TMJA 3S6EA 2HVHA 1C0UB 3C66A 1T02A 1CJKA 2XMWA 1WG1A 2W2MP 1QSLA 3H2LA 3B8HA 3QO9A 4WYLA 4F4WA 4L3KA 3BJYA 4LF2A 4B9TA 4PAAA 4Q2MA 2QZ8A 4P2MA 3OSNA 3JSMA 5IOLA 1UVKA 2DXEA 2QMXA 1UA0A 3UD5A 1O5JA 2XBPA 3C46A 2O66A 3LWLA 2L48A 3PHTA 1G2EA 2PN6A 3KJNB 1CJTA 4B3TF 1S6PB 2XZTB 4FYVB 2ACMA 4WE1B 1T05B 1H73A 2HHSA 2JEGA 4HL9A 4L72B 4WIIA 2G1HA 4AYBD 3CCWA 2YKNB 4RNFA 4USKA 3DMJA 4USJC 1RWKB 1REVB 2JC0A 3GYNA 1H7WA 1NK8A 3KLIA 2EC2A 2IM1A 3QWPA 3W65A 2I5JB 4MK8A 1U1LA 3BKUA 3EE3A 4LUBA 5CZVA 1U0SA 2AT1B 4U8VA 2NREA 2ZVSA 4BC9A 2DGOA 4HHHA 4RW8B 1NK7A 1HKAA 3QNWB 2IFXA 3M6WA 4FP9A 2VODA 3M30B 2F5GA 1BD6A 4WFBQ 1SKUB 2HHUA 2C3OA 4Y00A 2DNHA 2HURA 3DOLA 1M5OC 4RL1A 3G82B 2KDOA 2WVDA 1HWIA 1SQGA 1JKHB 3O44A 1MU2A 4USIA 4OI1A 1C4CA 4B3MF 4WBFA 2DRAA 2ZKTA 2JLFA 5A8WB 5BXIA 1S9GA 2QTWA 2HFNA 2C2NA 4ED2A 4PQUA 2EW9A 5F9LA 4OYPA 4QWDA 3Q2TC 1X5SA 3K5LA 2XZWA 4ZJLA 3MMAB 1LWEB 2FVRA 2DNPA 1IKXA 3NWGA 3QWUA 4NE9C 4HR2A 3TX8A 3IC1A 1DBDA 3TI0A 4ERDA 3RRHA 1F1BB 4LFCF 4WU2A 2C3MA 2UP1A 2M9KA 3CCRS 2NUHA 3PRBA 5CD4H 4MFBA 2VBYA 1LFWA 4OI2A 2ZZMA 2E29A 1QM9A 3I9V9 5LJ3Y 2HKEA 1FO1A 3CWJA 1UFKA 3CIMA 3HHKA 4J9MA 3MECA 4LQ3A 4AQYF 3UPFA 3EM1A 4CO3A 4C3MA 2J7KA 1XJWB 2DNKA 2EFVA 1L3SA 3TAMA 2HLUA 1N5SA 3MM5A 1IJFB 5JVGQ 5HMYA 1WTBA 3VHQA 1FHTA 3GIIA 2KRRA 2LMIA 1IBMJ 1SCJB 4RWXA 1X4AA 4KH0B 5C5JA 4A48A 4QW8A 1APSA 1XMBA 5DG7A 1WSVA 4DV2F 2CYYA 1AZSA 4I2PA 2EC0A 2HHXA 1NXIA 4X4OA 4X4RA 1TL7A 2DKOB 1QTNB 3G6YA 4U67Q 4C0BA 5HP1B 2VKZG 2MQMA 4OZJA 2NYHA 2RH3A 5DQIA 4ZK7M 2CQ4A 4J37A 2XLIA 2VUGA 1MWZA 4AFFA 2OPRA 2AJFE 4LR7A 1OQ6A 5G0RB 2ZBCA 2FD2A 3KK2B 1FDNA 2M7SA 4BCAA 2KG1A 1O6XA 1VLOA 1S1UB 1TUVA 3X1LB 3KDOA 1WHXA 2BKPA 2YWEA 3I87A 3DLKA 3MXHP 2QX0A 1YJVA 1JJ2R 1HBNB 5AXNA 2NZ4A 4X84A 4RNNA 4KGKA 1YKWA 4Y2IA 4OZNA 4I4BA 4WIQA 1K8AT 4XAKA 3KHGA 3NNAA 2LEAA 5D4PA 2QMWA 2AYBA 1HQUA 1E6YB 2YQ1A 1D1UA 2GIQA 1RT1B 2AX0A 3W64A 2XGPA 3X3UA 1JLCA 5DLGA 2GGPA 2XSJA 3T1HJ 1KR4A 4GKJJ 2FLOA 2Z0GA 2Y0SD 2X1BA 3GQCA 1HBUA 4B9MA 4LF9J 1BLUA 4NOHA 2BABA 1S6QB 3M8QB 1X7VA 4TY8A 5GAEI 1T95A 2WVEA 2FHOB 2AKWB 4DSJA 4DOZA 5HQ8A 2J0WA 2KYXA 2BM0A 3FRYA 1RTDA 1U1QA 5A6WA 2D1CA 4B9VA 4B3SF 5E3RA 2BW2A 3IAS9 3CCSS 2D41A 3Q2SC 1WG5A 1WJ9A 5DM7Q 3WZ0A 3DOMB 1DFDA 1VISA 4M5DB 1RJJA 1NKBA 3LGMA 2A2DA 2RRNA 3BBCA 4DL0C 1FESA 2JEFA 1Q0NA 2CJXB 3AJDA 2CJQA 2GQ2A 3DYAB 3G8TA 4ECZA 1TAQA 3EGZA 2AJ2A 4DR6J 2CJAA 2UXDF 3MOJB 4RW4A 2YNIA 5JUMA 2HMIB 2PI4A 3VAIA 3G8QA 3WX8A 1JXLA 3CDAA 1N5YB 3CJ5A 3OFFA 2D7SA 2BQRA 4AXJA 4LIRA 5ETSA 4QR0A 1RWXB 3MM8A 5D0RA 4LF1A 4X2BA 3DRRB 4ANCA 1XMOJ 2C2ZB 1BQNA 1FX2A 1Q16B 3K59A 2DK2A 3TEHB 1RI7A 3EDQB 3CCQS 2MB0B 3R5AA 5KG2A 5KFQA 1WC5A 3DGVA 1LW0A 3EJMA 4ECVA 4DSLA 2AGQA 4PG8A 3OFEA 2LXUA 4A8MP 4C8OA 1CJKB 3QO9B 4RW9A 2HVZA 5KT7A 3VGTA 2ZH4A 2A10A 1RAEB 1T9YA 1T03A 5BYSA 1U7LA 4M5GA 5GAGI 4DSIA 1K44A 5L9NA 5DGBA 4ZA1A 1YITS 4L75A 5J2QB 2C3UA 4NYZA 1IBMF 2CNOB 4IOAQ 3R7NB 1PJ7A 4FF1A 1CJTB 3R2DJ 5HJXA 1XNQJ 1VHIA 1R0BG 4FPIA 2CWXA 3DDKA 3CB4A 2JRSA 2ASYA 2ZDOA 1T9UA 3DMJB 4K2XA 4CLFA 3C3LA 1PYOB 2NYIA 1AYEA 4ECSA 4A8WA 5I3PA 4G1QA 3BR8A 3GB0A 3KLIB 4CNZA 2C2DA 3BH6B 3NNHA 1JLQA 2HZAA 1FEEA 2A18A 1RWMB 2MDAA 4ICLA 1DY3A 2FHJD 1S79A 4M5KA 5EX0A 1U09A 4X4VA 4DFKA 4ECTA 2F8EX 3DXSX 3G2XA 4LSLA 1NKEA 4C8NA 3DOLB 4KSEB 3SV3A 2XMMA 2KN4A 4V19X 4CLUA 2WOMB 2HQ3A 1MU2B 2RUGA 3Q0AA 1EP4A 3RG6A 3AOBA 4TYBA 1DAXA 1T9WA 4CQ1A 3D4JA 4OJ3A 4QIEA 4HACA 2V2VA 3NGKA 5KFSA 3IRXA 1KDNA 3WIVA 2GHWA 2RNEA 1GMVA 5E3CA 9ATCB 2EBGA 3T1HF 1PG5B 1TKXA 1YLXA 4WXWA 1UEUA 3MTJA 4O4RA 2W4DA 4MFBB 1PKUA 3IXQA 4MIAA 3BSOA 4ECYA 1FDBA 2BRKA 1EB0A 3SDEA 2OPPB 2EXUA 3MM7A 3MECB 4X4NA 1VC5A 2KH9A 2A6MA 1Y5NB 1MMNA 3MMCA 5LMNF 1BWEA 1RACB 2IBOA 3TAMB 3P4UB 3MM5B 3U1NA 5J2NB 4QJVA 3CTRA 2XWXA 5LL6d 3KK3A 3M9MB 1H0HB 2FC9A 1RTHB 3CJQA 4CO4A 1BC6A 1UEKA 2MZRA 4MJKA 4F2SA 3GCXP 2RRBA 1V3RA 2G2OA 4ZDNA 1MN7A 5A0YB 1U25A 1R31A 1DZ5A 2GCFA 1S9EA 4AL6A 2U2FA 1SC6A 3MPWA 4DS4A 1Q86T 1WOOA 4DR6F 3KLEB 1UAWA 2W9BA 3IM8A 1TL7B 3MEGA 3O1LA 2YWHA 5L46A 4I69A 2FJWA 4TXSA 3I31A 3M2VA 1GT8A 4C7QA 1Q4RA 4LF6J 4OIXA 3CXCR 2D3OR 5KT3A 1FDAA 2OPRB 3DLHA 3UDCA 3LA0A 2JLGA 4CYUA 2XY5A 2ADCA 3OL8A 1QVFR 1XMOF 3K8VA 1G4CA 3UCGA 4I7FA 1YBUA 1UA1A 3R7SB 4P9SA 1X0FA 3DLKB 3J7YU 3T9ZA 3SCJE 3NNCA 4RUBA 1HNXJ 2XS7A 3M8YA 2W8KA 2DITA 2GX8A 1Y0HA 4NZ0A 2R2UA 2J76E 3C14A 2GJ2A 4C8YA 4B17A 4CRJA 4EUVA 2Z56B 3PIOQ 1P27B 4E0DA 2A0FB 2ZE2A 1JLCB 1T7PA 2GGPB 2CQPA 1VBKA 3OR1A 4JI1J 3T5JA 1HNIB 4GRSA 2N82B 3MCNA 2VDIA 4C0OC 3UCZP 2KM8B 3EUNA 3VAMA 3W8GA 4QWCA 2G9OA 5HBMA 3FCVA 1HBUB 1HHQA 1U49A 4OV1A 2AGOA 1U0HA 2Z2ZA 1IQZA 4TY8B 4Y2CA 3W9JA 4DSEA 4F4AA 3P8BB 4I68A 2LLZA 1KTQA 3H5XA 4EK2A 1ELOA 1NH8A 4NLWA 1FJGF 1N5VA 4PZVA 2UV8A 1Q8KA 1RTDB 4WZQA 2LQJA 1S1VB 2GZOA 2LCWA 4F2RA 1B7FA 1SH2A 1VQ7S 3TOQA 4TU9A 4LR8A 2QLBB 2M8DB 2ZHBA 2XB2D 2FY1A 4P7TA 1PIEA 1UFWA 2X7IA 2MY8A 3V5RA 1KRPA 2XHCA 3D0GE 3DC2A 1FXLA 4JI8J 4N5SA 3FGVA 3S8SA 4KE5A 3PXGa 2ILYA 4RW4B 2YNIB 1DJ0A 1NH7A 4F4KA 4Q2LA 2WVBA 3DGPA 1NHVA 4RNOA 4QU7A 4U9RA 5E33A 3MPYA 2VOPA 1SJRA 4MIWA 2FHMA 3W9HA 2MJUA 1RT4A 5IM0A 1X4EA 4NA1A 4PG7A 2XEXA 1HARA 1VC0A 1RKJA 1LWCB 2HFZA 4I64A 3J81j 5B09A 4DV6J 1Q7YT 2DNRA 3IO1A 4LSNA 3M32A 2HWTA 3L3CA 1V3SA 4DQQA 3UR3C 4QU6A 3TANA 1N6QB 4DR2J 3CJ3A 1DURA 2Z2LA 2VIHA 5DG9A 3KUGA 2DHGA 3LAKA 1WF0A 1KQSR 1LW0B 2IJRA 5F3TA 3QBCA 3PJ9A 3MCMA 1EKSA 1HBMA 5KFEA 4EBEA 4IRDA 3HSJA 2FVCA 4TYAA 4RW9B 1NPKA 2C28A 2BE9B 2QA2A 1T03B 3VGSA 3DRYA 4QIWD 2Y0BB 2LFVA 4DPTA 3ISZA 4C11A 3ETMA 4YOEA 1AROP 1VQNS 1RQ0A 3QFHA 4Z2XA 4JI3J 2B8PA 2DEIA 4FF2A 3UQSA 1B3TA 4LRDA 4K4UA 2VQEJ 4QPXA 2VDHA 1FRLA 4NLOA 1NSKL 3IFEA 3VZHA 1NSQA 3SBMA 1U26A 2RS8A 3HMJG 4H4KA 4P73A 5DDPC 2M3DA 4KGZB 2KFZA 5C7PA 3HP6A 2OELA 5LJ5Y 1WKJA 1WELA 5IC4B 1JLQB 2RILA 4P6QA 4EBCA 5LM7E 3PYGA 1MG7A 2YKPA 3EZ5A 2IDLA 1FNMA 4HI1A 4OQJA 4ICLB 1VQPS 4A8SA 5KOXA 3BYPA 3CO0P 3QJLA 2M0GB 4K50A 1RCOB 2QYGA 1JLGA 4JI0F 3MEDA 4LSLB 1X60A 2XO7A 3GJRB 2HGMA 2EFNA 1FE4A 1MLAA 6AT1B 3KHHA 1UKUA 1HYSA 2UUWA 2J7UA 2JDJA 1HI1A 3GYXB 3PYEA 1T8EA 2XTJP 5HMXA 4HACB 4OX7A 3IRXB 1RWVB 3QGHA 3MURP 5A6PA 4MAKA 2ZEJA
chains in the Genus database with same CATH topology
3L7OA 1IKWA 3N5FA 3E01B 1OSDA 3MHYA 5I3QA 2OPPA 4BWJA 5AE1A 2PA8D 1FD8A 2POKA 2WONB 2BACA 3W2VB 5DDOC 1HA1A 3QZ7A 4HYKA 2CPEA 4I6WA 3LP1A 3G86A 4I0WA 2VBXA 1N88A 3RW7A 1WI6A 1HPZA 2V8GA 3BGFA 3D1HA 4JI1F 3KG0A 5LSRA 1TKXB 3KG1A 5J1NA 2N3OA 4I6YA 5GMKa 1TFWA 1H98A 1UVLA 1KNZA 3F44A 3IRWP 2L08A 3MM6A 2UVVA 1FRJA 4N8NA 5J2NA 1U6FA 1LOUA 4EGLA 2RQKA 2YWGA 1ZPVA 1HBOA 2YWFA 4B9UA 2YY3A 3AB2B 3OV7A 1YRUA 5D6GA 2UUAF 3R3TA 3OLBA 1FRXA 4JBCA 1WEYA 1X5PA 4NZ7A 3TRGA 2ILZA 2PMHA 1YRTA 4KV8A 5CQGA 1P9QC 5L1LA 3H8YA 1NK6A 3OVSA 3DM2A 4B02A 1RTHA 2NS1B 3LO3A 2DD8S 3RAXA 2FLLA 5C24A 1FVQA 2N3LA 4RKUC 1VQSA 3BB5A 2CQHA 2DT9A 4KHMA 2NR0A 3ZZ0A 2OTLS 4X62F 3DU6A 5F8MA 1VQLS 3KHLA 3UFCX 3JB9k 3GILA 5HO4A 5E0OA 2R2SA 1Y5LB 4OJGA 5D3GB 4C3KA 3E51A 3PR4A 3MM7B 4UW2A 4IRKA 3ENVA 1VI7A 5DQHA 5A0YA 2ZJRQ 1WG4A 1UETA 5HP1A 4HTIA 1TKTA 5FIIA 5T7LB 2I8EA 2W24A 1N5TA 2W4CA 5KOWA 3MMCB 2ALZA 1OPIA 5B0FA 1IKVA 4TKTA 4LF4F 3J7ZT 4FBUA 2RQMA 4AL5A 2VQFF 2O1PA 3SFGA 2XS2A 2ZJQQ 4FF4A 1Q8IA 3FMBA 5B0GA 3KLEA 3IWLA 2E9RX 3M8PB 4DG1B 4PG4A 4XDDA 3CPWR 1C0TA 2BQUA 1AFJA 3GV5B 5F8GA 4X66F 3H5SA 1JIHA 4CT8A 4I2PB 1PC4A 2MKHA 4DUZF 3RTVA 3LALA 2B9YA 2OKQA 3SV4A 4DR7F 3N6MA 2ZUGA 5G0RA 4OJ1A 2V4RA 1CG2A 3GIMA 1X4FA 3OSPA 3BREA 5KG7A 3FZBA 2KI2A 2KXHA 2KVIA 4U7UK 4EFAC 3KK2A 2MGZB 1D8YA 2Q43A 3SSRA 3VR1A 3NL0A 4K4SA 3BO4A 1K1SA 4A8XA 2JEJA 1TK8A 2FVSA 2LXIA 4DV3F 3PHEA 4F3OA 3I9ZA 1S1UA 1X4CA 2VL1A 4H54A 3U02A 5B7WA 4QBUA 5A8KB 2J0XA 2R8IA 4Y2MA 1KFDA 4F67A 4YDDB 2YX7A 3O5TB 2FIUA 2M2BA 3IN5A 2IM0A 3R1LA 1YVFA 2CQ1A 3JTNA 4PR6A 1S9EB 4NX9A 1HI0P 4DLGA 4MKYA 4FF3A 4J9SA 3AA8A 4OL8A 4JI8F 1Z2ZA 3MUMP 3FFIA 2WB4A 3BN7A 4DR4F 2AP6A 3D5MA 4Q45A 2B4UA 3SZ2A 3VF0B 5B0CA 5CA5A 4JI4F 5KFTA 2XI3A 3AQOA 2W9BB 3RB3A 3S1TA 5HROA 4IDKA 3KKFA 3GFZA 3OW2R 3IGNA 1NJWA 4ECWA 2V94A 2NPIA