3DKDA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with gdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3dkdA00
3NGUA 1NDKA 1WKLA 1NUEA 1U8WA 1NHKL 1WKKA 1HHQA 3DDIA 4DZ6A 1KDNA 4S0MA 5CABA 1NSPA 3EMTA 3ETMA 3FC9A 2DY9A 3FBFA 4ANCA 1XIQA 3ZTPA 1JXVA 3Q8YA 3VGUA 4DI6A 1NDCA 1VYAA 2DXEA 1MN9A 1W7WA 3NGRA 4FKYA 3NGTA 3VVUA 4ANEA 1LWXA 1NSQA 2DYAA 3DKDA 3FCWA 3BH6B 2AZ1A 1NB2A 2HVDA 3VGVA 3GPAA 1B99A 3NGSA 3ZTSA 4DUTA 1F6TA 3ZTQA 3R9LA 1ZS6A 5BXIA 4O0NA 1NPKA 1EHWA 3EJMA 3FBCA 3BBCA 1PKUA 2BEFA 3Q89A 1K44A 1NCLA 4C6AA 1NDLA 3FKBA 3BH7B 4F4AA 3ZTOA 3ELHA 4WBFA 3EVOA 3Q83A 3BBFA 2HURA 3EVWA 1HIYA 1S5ZA 3ENAA 3Q8UA 1S59A 3VGSA 3EM1A 4F36A 5IOLA 1XQIA 1NSKL 1LEOA 3MPDA 1UCNA 2VU5A 2BX6A 3B6BA 1B4SA 4HR2A 4ENOA 2ZUAA 2CWKA 3EVMA 3VGTA 1BE4A 2DXDA 5CAAA 3FBEA 1BHNA 3GP9A 2B8PA 3EE3A 4UOGA 3ZTRA 1BUXA 3JS9A 3WX8A 2B8QA 2NCKL 2HVEA 3BBBA 3FCVA 5C7PA 2AZ3A 3VVTA 1MN7A 1S57A 3Q8VA 1HLWA 4UOFA 3EICA 1NDPA 3L7UA 1F3FA 3FBBA 1PAEX 3PRVA 1NLKL 1WKJA 4FKXA 4UOHA 4CP5A 4ANDA 3Q86A 3PJ9A 4EK2A 4KPCA 3B54A 2DXFA 4W98A 3G2XA
chains in the Genus database with same CATH superfamily
1EKSA 2M88A 1PO6A 2XBPA 1HI8A 4X62J 2VHGA 3I82A 2FQQB 4L72B 1BXNA 2DK2A 3Q8YA 3OL8A 3QRPA 2CVEA 1E6YA 4OX6A 1U0SA 3NGRA 4B9UA 1M0SA 4LFBF 1RTZA 7AT1B 4EO8A 2DCLA 1Q86T 3CC2S 4Q7AA 2L9NA 1JNRB 5KFZA 3E2EA 3BH7B 1VQ5S 1PJ7A 5KG5A 2OFGX 3J81Y 5ETKA 3CNQP 4HTIA 1S6OA 3B4MA 2XO6A 3THVA 4QYZK 3P3DA 1LWCB 1EETB 2O5DA 5EWGA 1KQKA 1RADB 3M1VB 2FDNA 3HVTB 2ALZA 2RHQB 2NSCA 3IBCB 1CG2A 1KHWA 2JVOA 3Q2SC 2B8PA 4U8VA 2GX8A 4YR3A 2YKPA 1PSDA 2X3GA 3MWBA 4G65A 3G87A 4JI5J 3KLHB 2FGOA 1S1UA 1UA0A 2MZJA 2LYVA 3DNCA 1LFWA 3L95X 4WP3A 3DRYA 4GMKA 2XCPA 4RW8A 2UZAA 4WU3A 1LWFB 2JC0A 2XY7A 3DLKB 2VZ9A 1UVJA 3SQGA 3PM9A 4Y65A 2YNHB 4IQMA 4ZCIA 2HMIB 1FFGB 2QLFB 4EWTA 4CWBA 1RWMB 3LP1B 4R25A 5C24A 1KNZA 1OYEA 3GIJA 2PMHA 2JFKA 1RWUA 2VQEF 3UN5A 1DARA 1EP4B 3TO8A 3J7A1 1TUVA 2R2SA 4CM2A 2E1MC 4G1QB 3QGPA 5MAOA 3WZ0A 1N5SA 3T1HF 3DRPB 4B3OA 5ITHA 1FD2A 1F9HA 1NH8A 3CJ8A 4DL3A 4ID8A 1JWWA 2LEPA 1C0TA 3AJDA 1N48A 4IRDA 2IM3A 3ZZ0A 4OV6A 1T02A 2DHAA 2LA6A 5DO2A 4GC7A 3TR5A 1ZPWX 4ECSA 2QL9B 4DQSA 1SI9A 4M5DA 3I0SB 4ITSA 1HW9A 1IKVB 2PEBA 4FF1A 4DV1F 1FDBA 2JRSA 3IM8A 3NCPA 2Q1LA 1Q82T 4J9LA 3PJXA 2HNYB 3NGKA 4LBPA 5SUHA 3MEKA 2A6MA 1M5OC 3RG6A 4CM0A 1UL3A 2OHDA 2VC1A 4JI1F 2DVIA 2IM1A 4DU7A 1YITS 1JK9B 3MPYA 2YNGB 2W24A 2HVZA 5HVHA 4BWMA 4OI0A 3CJ0A 3ZTOA 3TUPA 3KK3B 2KT5A 1FRLA 1HQUA 1FJGJ 3H5SA 1NJWA 3FCHA 4ZJQA 4RPFA 3ZNUA 2AF6A 1X60A 2ZJQQ 1NNDA 4U7UK 2XI2A 4QWEA 2PDAA 2BA9A 3KOAA 1E6VA 4NOHA 3MPWA 2GVZA 4H54A 4IH6A 4QIVA 3VVTA 1WC1A 3FMWA 5BJRA 2PT0A 1X8DA 3Q8PB 5KFNA 1FCAA 4DV6F 3JQKA 2IC3B 4I68A 3PR5B 2KXHA 2CPIA 3P6YC 2DR5A 5HBMB 4HI1A 1S0MA 4K2JA 3TA1A 2P5VA 2ZVIA 4NLWA 2DRDA 1RAGB 2QG9B 4H4OB 3ZZYA 3PR4A 2ADCA 2IFXA 1FWPA 1ZS6A 1Y11A 5IFMA 1Q4RA 4B9SA 4KKOB 4X4QA 2RVJA 4YB7A 4ZP6A 3NNCA 3R5AA 3J81U 2R7QA 2HFOA 2CNLB 3R5GA 2RKIB 4QW8A 2KRRA 3US5A 1IM4A 3HHLB 2BMBA 4IO1A 4UTGA 3JB9k 3QO9A 4CLFA 2UUCF 2WOMA 1VGYA 3KDOA 2GW8A 2YQ0A 2HWTA 2GS8A 4K4TA 4DR5J 3UE2A 3FSIA 1U2FA 2VFSA 4OJHA 2AU0A 1TP7A 1KEKA 2FLOA 3MF5A 5L9XA 1U4BA 1REVA 4NLXA 1T8EA 2GCFA 4LVNP 5CYQA 1VHFA 1HD1A 1SQEA 3KLEA 1UVNA 3BGOP 4NLDA 5HANA 2ZH5A 4YB1P 2VJUA 1LXJA 1Z2LA 3W9JA 2CG4A 3GZ7A 1SQGA 5ETNA 1VC6A 1B7FA 1TK8A 2H65B 2I6WA 4IFYA 2NLWA 4FZVA 1WDDA 3TAQA 3W61A 2R4FA 3F41A 1H38A 4X2BA 4PYDA 4ZVFA 2W2PP 2B3TB 3G6XA 5HK4A 1AZSA 4DR3J 3GJTB 1QY7A 1S99A 1DTQA 3TA2A 2IBKA 3TAMB 3UR3C 1OSCA 4C8KA 1HBUA 4QPTA 1Y0HA 4U95A 2OI2A 4NEZA 2R3VA 2GO9A 5LJ5Y 4WFZA 3OHAA 5CYMB 1PAEX 2CQCA 3U1NA 2P9GA 3V6DA 4CH0S 2IHR1 1RT6B 4O4RA 1CBKA 2LQ8A 2C28A 1FO1A 5ETOA 4F2SA 1I51B 3PRBA 2EFOA 3H90A 2D9PA 2E5GA 1V3ZA 4MK8A 3MAAB 5J1PA 5L1KA 3M2VB 1S0OA 3P45B 2ASJA 5F8NA 4DUZF 2DNGA 1A0OB 3I55S 4WBFA 3HZGA 3JYTA 3DXBA 5C25B 2OPPA 2GVDA 2YWFA 1I6JA 1AT1B 2DD8S 1FD8A 4YDXA 3ITHA 2B7CB 2HRUA 2UV8A 1IQZA 3N28A 1NJIT 5KFJA 1TKZA 1FRHA 4CI0B 2IVYA 4YS2A 1QJHA 2DTJA 3H4DA 4ZA1A 2I9SA 4UOFA 3E01B 5KG3A 2BRLA 1ZM4A 3ISND 3Q8SB 4JI8J 1UEVA 1ZTTA 5GADI 2Z56B 1HKAA 5DG9A 2HHTA 2W9BB 3KJNB 2RF2B 2Y1LB 1Q8LA 4F26A 4S0MA 4X66F 3ZTPA 1WC6A 5LXRA 3HJFA 1ZAWA 2HQGA 4PQUA 3HD1A 2YWWA 1JLAB 4USHA 4DV4F 4UOCA 3LO3A 1D9AA 4EZ9A 3FJ2A 1IQTA 3OTBA 1YK9A 3NCQA 3Q24A 5DZ6A 2OPRB 4WU2A 3VALA 4K5SA 1EARA 3HD2A 4RUBA 5J2PA 1DQ9A 2F5GA 5C42A 3CC4S 2W25A 3I5CA 3O2IA 3BGFA 3NS5A 4I56A 4TN2A 5K14A 1TMJA 5J2NA 3MURP 4ES3A 1FRIA 3ILOA 3G8QA 3PRVA 4HACB 4N77A 2FVCA 1EX8A 3QWPA 5A8WB 4LBIA 1RTIA 2JLEA 1HNIA 3EMTA 2HGLA 2GJFA 2GGPA 1M1KT 1GXUA 2QA4G 3CTRA 3M05A 3VTIA 4XPEA 2HLUA 4DCPB 1UWBB 1RTHB 2RRAA 2AYMA 2UVUA 1MWQA 3PJWA 1CULA 2KVQE 4CT9A 4KHPF 1N34J 3FKBA 3DOMB 2E1CA 2R7TA 1OY6A 3Q83A 4DQPA 3V6JA 1SL2A 2VPWB 1V5IB 3SDEA 3LH2S 2WVFA 1FT8A 4RX6A 2MY8A 2XB2D 5IS2A 2NPIA 3ZTRA 2AEMA 4J9QA 4I64A 2HVEA 4YDDB 3CULA 4ECTA 5LSRA 3GG1A 3HF5A 4N7TA 4ECZA 3E3XA 2Z2YB 2OPQA 3M8QB 3K0JA 1VHIA 3KFWX 1TU0B 1U09A 1GT8A 3OR1B 4M5GA 3FBFA 2DGXA 1JQGA 1BD6A 3HVWA 4OZJA 1FFWB 3CCWA 4NA1A 3IG1A 3QLHA 4QU7A 1KONA 4NCGB 3PG9A 1J5EF 5H9EK 2EXUA 1N5YA 3VAMA 4ZITA 4HVZA 5D4LA 3U1MA 1XNRJ 3H2UB 2OGUA 4IDKB 3UDLA 3QAUA 2ZKTA 2FJWA 3N9UC 2ZHAA 1ZYQA 1FI4A 4NYZA 1BWVA 5D0RA 1FDAA 1Y5IB 1LFPA 4WK3A 5HQMA 1G2EA 4ILLA 5DJBA 2KXFA 2NSBA 4KIAA 1VIOA 1DHMA 2XYGB 3L7UA 5K8OA 2XZWA 1RAHB 1R8HA 1ZAXA 2GIQA 4J9OA 3LP0B 2CJYB 2DR7A 1HA1A 3QFHA 1IUJA 1NHKL 4OI4A 1RT7A 4NLVA 1BQNB 3KLIB 4OX8A 2N7YA 3CSKA 1TAUA 4KV8A 2QA4S 1UFKA 2OTLS 3CDWA 4DV3F 4RW6B 1NSQA 2ROGA 2AZ1A 4UUXA 1AXQA 1IBMF 3I9ZA 1WORA 4TXSA 2KO1A 2YKNA 4OLOA 4OLPA 3C15A 4FNIA 2V6AA 3JQMA 2HRTA 1VIXA 3CIZA 4LF2A 4PXCA 5B0CA 3N6NA 1HPZA 5KFFA 3GTYX 3ZNJ1 2CJBA 2DGQA 3OR2B 2OEMA 4X4PA 4CT8A 3ZZPA 2HQ3A 4OJ1A 1TELA 3V6HA 2F8HA 4B3MF 4PG4A 1TK5A 1AYEA 3RRKA 3M9MB 3BSNA 1WF1A 4R0EA 4OZ3A 5A0YA 1L3UA 1WTFA 1SJFA 3IO1A 1R6VA 2KT2A 3BSCA 3R5BA 3MMCA 1XC9A 3HSJA 2PE8A 3BPSP 1G7CB 5A8RA 4LF9J 2BXJA 2CRLA 3FC9A 3WDOA 5D3GB 2QFJA 1S72S 2Z8QA 2LXFA 4OHZA 5AXNA 5I3UA 1F9EB 2RIJA 1VLOA 1W2BR 1T05A 3KHLA 2V94A 5DLGA 2BRKA 2F8MA 4DSEA 5AXKA 4NZ0A 5EN1A 2WVCA 3AQOA 2IPOB 4JBCA 2KJVA 2VG7B 3QATA 4HL9A 4O3OA 3MR6A 2BJEA 1YZ6A 1LEOA 2DNRA 1FRJA 2EK6A 1TKTA 1JB0C 2MY7A 4X62F 5E41A 4WYLA 3CJ2A 2BABA 4ZVQB 3UDEA 4ERDA 4X4TA 1BQMB 1MN7A 4YN3B 2RS8A 4MKYA 2MKYA 5D0EA 4DSFA 5HN0A 2LXIA 4JI3J 4AQYF 2Y8YA 1MLAA 5B09A 1H3DA 3NNAA 1R0BG 2AJ4A 3MFIA 3K5MA 3H5UA 3POTA 5KFYA 5KFDA 2PA8D 1VRTB 1QE1B 5C5JA 2BE9B 2MQ8A 4C8OA 2VG6B 3T5LA 4JV0A 4DSIA 1VYAA 1TL1A 2AWZA 3RB6A 1HW8A 3C46A 4P2XA 3OXLA 2H4YB 1QSYA 1LKZA 1XR7A 4EBEA 5B0EA 2XSJB 1SJ4P 3IP0A 3MHYA 3WQPA 3HX9A 4ZMMA 3JXOA 4Z2XA 3CW2C 2I8EA 4C11B 1SUQA 3U02A 2U2FA 2FHKA 4KGMA 2V8DA 1FKOA 2C22A 1TKDA 4O3SA 1FE0A 2ZUGA 3BGRA 4WYWA 4TY8B 3LWLA 3KLGB 4UUWA 2YX7A 3PFOA 3HPOA 4Q8EA 5KT7A 2EPIA 5BYSA 1VQPS 5CD4A 4DXLA 4OIXA 2ILZA 1QM9A 3SXLA 2K1RA 3JS9A 1NAQA 4OX9J 1NJZA 3DMJA 2YKQA 2KXNB 3AD9C 2EVZA 2C2DA 2R2TA 2V4QA 3HM9A 3AB4B 3OVAA 3CJ3A 2NUUG 3VAFA 2KKHA 4IFVA 2EKNA 4TU7A 4AD6A 3IBFB 5ADZA 3DOLA 1XMQJ 5LSLA 1NJYA 2ASDA 3LW5C 4GVBB 1NDCA 4L74A 3VHQA 4ANEA 3T1AA 1NB2A 3KTQA 2AEJA 1X31C 4O3NA 1W25A 4WFBQ 4P71A 1ELOA 4CH1A 1Y3KA 4GC6A 4OHWA 1DZ5A 5H1SV 1TVRB 4F0MA 5DDPC 2XGQA 3G8SA 2RUSA 4ZOSA 2XZTB 4Y2KA 3CCQS 4FYVB 4ID5A 3NAHA 4OYZA 4HT5A 3NBPB 4MJKA 3MECB 5GADU 1RISA 5IT9Y 1Q53A 2LLZA 2WAQD 3CGIA 4B9VA 2X7IA 3G71S 4JI2J 1FTRA 1L3TA 3IBWA 2JEIA 3BKFA 3HHKA 5ETQA 1FJEB 3KLFA 2RDDA 4CH7A 3DRXA 1KQFB 2CQDA 4IG3B 3HFZB 4LRBA 1NDKA 2IA0A 1U8WA 1NB7A 2HK3A 3CCUS 4MYTA 4DPTA 4J37A 3I4PA 1MU2A 1RYSA 1IJEB 4NI2B 1RWNB 2CPFA 4M5MA 1KTQA 4RW9B 1CJUB 4CO3A 1WWHA 4C7QA 4CYUA 3EGWB 4JUZA 4J9PA 2QJ3A 3QZ7A 3J7AN 3I5AA 2VH7A 3QYYA 1GX5A 1Q16B 3IAM9 3GU0A 3H5XA 2B6AB 1FXLA 4OX7A 1DTTA 1RLCL 3JSMB 1FERA 1RABB 2VC0A 1S12A 2YVSA 2V69A 2DNNA 4AUKA 2WVBA 3GWCA 3GYNA 1X5SA 5IV4A 3R5CA 2D3OR 4ZPDA 3IFEA 5KFMA 2QMWA 2QLJB 2GIRA 1V6HA 1JJCB 1JLGA 3A8EA 1NDPA 2R8IA 2B9WA 3IGVA 1YTYA 3Q86A 5L1IA 3EYZA 4MYUA 4V19X 1IWGA 3G86A 4DL6A 2FJEB 1NSPA 4TY9A 4DWIA 4NWBA 1WACA 3S01A 2VA2A 4WFXA 3H2VE 2C2RA 2ZFHA 4X4UA 1FK9B 2HHUA 2VA3A 4DR5F 2G1DA 1G6BA 1NPKA 4WE1A 4KHMA 2HNDB 3CCVS 3ELHA 3RBZA 1ZBTA 1S5ZA 4M5IA 5LMNJ 3AJ1A 5B08A 2B4VA 5DQHA 1KSPA 4LF4J 4RZRA 2OEKA 1PCAA 3HHLC 3NNHA 2V50A 1R0AB 5GMKa 4LF1A 3H20A 4C9DA 1CC8A 4TLQA 2FHMA 3W9HA 1T0TV 4BDPA 3R3TA 2EBEA 4P2SA 4EU0A 3K5LA 3GB0A 2KT3A 1F60B 1NZ8A 2CPDA 2JEFA 2UXBJ 4K2XA 1SPBP 2Z2ZA 3LP2B 3VAIA 5F8GA 2V68A 1QAXA 4HTJA 2G0CA 4UT4A 5E5NA 2LCWA 4RW4A 2RDIA 2MZ1A 1PYSB 5D4NA 4DR3F 1HNZJ 2HFUA 2KHCA 1DLOB 3PV8A 5F8JA 4PRFA 3FFIB 3WC0A 2OUGA 4KFBB 2ZD1A 3W2VA 3LGHA 3AA9A 3EVOA 1S79A 5KT3A 1A9NB 3JSBA 4ZHRB 3OFGA 3MPDA 5EWFA 2MKIA 1Q78A 3EPGA 5I42B 3M8RA 3ETOA 2VKRA 2DO0A 1FVQA 2C3MA 1CJKA 4DQIA 2H51B 2MKSA 1KFDA 2W9CA 1NBEB 3TWZA 5IQ6A 2KYZA 2WZ1A 4K50A 1S76D 1IKXA 5FDLA 1QUPA 3MM5A 4ER8A 3DCAA 1TKXA 2LA4A 1MROB 4OYIA 1S1WA 4IOAQ 5F41A 4NRUA 1U25A 3A3NB 2Z30B 2XNQA 1JJ2R 1WF2A 4LIWA 2DIUA 4CLPA 3NWRA 3BO3A 1UMJA 3EGVA 1YJTA 1HBOB 4U7CA 2W7OA 3EZOA 1N56A 2MQPA 1KVIA 3DU6A 2ZNYA 2LVWA 3UDVA 5GMDA 4WF9Q 2BZ2A 4JI8F 3F44A 3DI6B 4PUOB 1RCOB 3OD2A 1HIYA 4LFBJ 3GYXB 2JVRA 1MMDA 2AJ2A 2YKMB 1NSKL 1M1HA 4DL7A 1YGYA 1XBWA 5A8KA 2HFVA 2VV5A 1UPPA 4EGLA 3SCLE 4IRCA 2A2DA 3BBBA 4OZNA 2DNQA 4CLUA 4B3RJ 2HNZA 4WKYA 1WKJA 1WC4A 2HBZB 5MLCV 3IGNA 3KNGA 4MIAA 1N33J 2RHSB 2E1RA 3RB0A 4LQ3A 3JTNA 3HT3A 4H4KA 2DH9A 3J80U 1D3WA 3BSAA 3M2UB 5F8MA 2XNRA 2DNHA 5IC6B 4NCBA 3W2WB 3IWNC 2QV6A 3BZQA 4NZ6A 4WPAA 3QT7A 1UJ6A 2D3UA 1FRKA 3UN3A 3X3UA 2ZNZA 4OV1A 3CUNA 1AB8A 2C2ZB 3NLCA 5AXMA 3MEEA 1AFIA 4DN9A 4NLGA 1VJWA 1SH2A 2FJVA 4GO7X 5KFQA 2QL5B 2BANA 2IM0A 2V9KA 1P27B 3KUEA 2XLJA 3HKZD 1NK8A 1Q0NA 1DBDA 4LREA 1S6UA 4NL5A 4LSNB 3BB5A 4NASA 1O5JA 5KFGA 3RBEA 1SKWA 3C6TA 1T9XA 2B4UA 5FJ4A 4ED4A 1S1TB 2V34A 1YJRA 3SEOA 2NXUA 3T1YJ 1I1GA 1EETA 3PVXA 3M1VA 5F3TA 3QJPA 2W7PA 4J5OA 1YZ7A 4DV1J 2VONA 3M32A 1T9UA 4FYXB 2ADBA 2CZ4A 1X9WA 3LTOA 1L5UA 2H5IB 2LQBA 2OD6A 5THWA 4ZLJA 4I2QA 1XNQF 1QTNB 1HNWJ 2VOPA 4CLZA 4DEZA 1YI2S 2XS5A 2QA2A 5KFIA 2WB4A 2CDQA 4LR8A 2E5HA 2J8AA 5EWEA 2QTWA 2M3DA 3RGIA 3GIRA 3ULHA 2JEJA 2HMIA 3CJKA 1RWXB 3J7YI 5T14A 1ACMB 2RU3A 3MDFA 1FTCA 5IM0B 1QLNA 2EWHA 3PW7A 2Y3YA 3CDEA 4F8RA 1UEKA 5KOWA 2RE1A 2C2OB 1NJXA 2M4MA 1T11A 1XNRF 4IH5A 2WB1D 1Y4ZB 2D7SA 1Q8KA 1HWIA 5HMXA 3I0RB 2B0GA 3DRRA 3OLAA 2J7UA 4K59A 3R2DJ 1NXIA 4QW9A 3KKFA 4BS2A 3OFEA 3MCMA 2DGOA 1D9DA 2D74B 4USKA 1BMQB 3ADAC 3AAWB 3GMGA 4YEAA 4R5PA 4KB7A 4LMZA 2RT3A 1TZ0A 2HURA 1N6QB 2J9EA 3VAKA 1URNA 1CEZA 2C3OA 4KE5A 4DJBA 4QIEA 4X4RA 2QLXA 2W1BA 1BE4A 3PRDA 1APSA 2ZH1A 2Z57B 1VK3A 5HI7A 3OVSA 5KFOA 1CPZA 4J9UE 4MTPA 2ZZMA 5FIIA 3GV8B 1N32J 2HNYA 1GMUA 3Q0AA 1SXLA 1G4CA 4ZVEA 4F3QA 5CA5A 4DS5A 1WHYA 2OMOA 4WCEQ 4QWAA 4RNFA 2K3IA 4F2RA 2ATCB 2EI5A 3L7PA 1RTJB 4ZPWR 3DLHA 5DRKA 1X4GA 1MG7A 2HLTA 4DG1B 2VG5A 3FQLA 2PD1A 4ZP7A 4QR1A 2W7AA 2CNOB 4J9MA 5DM6Q 5HP1B 2VD3A 3GE9A 4D3GA 3IWLA 5LXYA 3R1HA 4DUTA 3V2UC 4FDFA 4YQWA 1X4FA 5F0WA 2DHHA 4WK1A 3SCKE 4DF8A 1S1UB 4MIBA 2HBRB 1MW7A 4ZPCA 4RW8B 2CZ9A 4OYAA 4HHHA 4LF9F 4N41A 4LF7F 3NRBA 3H42A 2R8GA 1KN6A 4DMZA 2ZBPA 4DV5J 2CUYA 3K8VA 1S57A 2COLA 2YNFA 4E8UA 3PIPQ 4H4OA 4LF5J 1LXNA 2BE7D 5JVHQ 5C24B 2J7KA 4H4KC 4YHHJ 4IG0A 4DL5A 4IH7A 4W98A 1HQ2A 3W65A 4NZ7A 5IT0A 2IM2A 3TZWA 1RHMB 4K0KJ 1YBTA 4P74A 3JQJA 1NKBA 1S6PA 2W01A 4M5JA 8RUCA 4XDCA 4KGKA 2ZBIA 3HHNB 3CXCR 4B3OB 2AYEA 1TUWA 2KI2A 3L3CA 3ZXWA 4Y0FA 5SZTA 3MTJA 4DFPA 2F3JA 1K0VA 3Q89A 1C0TB 3C3LA 4JI3F 3AOAA 3BBFA 4CLSA 4O0IA 1U1KA 2XMUA 3BPDA 2AEFA 3OL6A 2V8HA 3QFWA 1S9EB 4DUZJ 4ENOA 4OJ3A 1OS5A 4LFCJ 4ZLNA 4A47A 1KR4A 1RHUB 1DURA 1HBMA 3UW1A 1EQMA 2UUAJ 1R27B 3CPWR 4WZQA 1JX4A 3MCOA 2DRBA 4U7UD 4HKQA 1WF0A 4QIGA 1RT3B 4FKXA 1V3RA 3UPFA 4XO0A 1UETA 3ZC4A 3BJYA 4JI0J 3BO4A 4F04B 4ZDNA 1KDNA 1HQUB 1UA1A 1D0EA 4NLOA 4QOTA 4X4SA 1HR0J 2L48A 4YR2A 5RUBA 3CJQA 3BKUA 3KYLA 4FVCA 4EEYA 2HIQA 4OX9F 1VJQA 3THTA 4IRKA 2HHHJ 1M5SA 3MOJB 3RB3A 1E6VB 5ETMA 4KO0A 1SBRA 2ZE2A 2GVZB 3CMQA 3OJUA 2ZWOA 3PYDA 5J1EA 2IBOA 2F4FA 2XLIA 1RT4A 1JKHB 2WSCC 3PCOB 1RTDA 3KHRA 4DR4J 1XMQF 2O01C 3Q23A 2LXUA 1LWEA 4RNOA 3EE3A 2F1FA 1SKUB 4LF6J 2HYIB 2BBEA 2AZ3A 4KQZA 3B4DA 3KG0A 3JSYA 1OY9A 3MR2A 4P75A 3KUHA 2WW8A 4O44A 3VZIA 3M2VA 3PJ9A 1V5VA 3BQ2A 3BN4A 4EI2A 1Q81T 2B5JB 3CB4A 4RBUA 4PKDB 3O8WA 3T9ZA 4WP9A 3D9BA 3HVAA 2HHSA 3R2CJ 3OT9A 1KBRA 1MN9A 1UVMA 1X0PA 4WFAQ 3OFFA 2XSFA 4A8WA 3B8HA 5E3CA 4TQSA 3VGVA 3QO9B 2PMZD 2CQHA 2DPJA 2B51A 2M8HA 1AW0A 4JI2F 3IS9B 1NDLA 3DGPB 2M2BA 4DCJB 1M90T 2AJ0A 1U1LA 5M2UA 4PG7A 1O8BA 1YBAA 5K8PA 2GV1A 2M52A 1F3VA 1IBCB 2J0XA 2WHOA 2MEWA 2W4PA 2FB0A 2IJNA 1K8AT 2BV3A 1TFYA 3N0VA 4L73A 3M2RA 2W9BA 7FD1A 5EGYA 2H1YA 3PZPA 1REVB 4J9NA 1S4EA 3T6BA 5KOXA 5DM7Q 5K20B 3B82A 4RWWA 1U2CA 2NYIA 1GH8A 2R8HA 4ATNA 3O1LA 1JLAA 4PEOA 3KLEB 3AB2B 2RU9A 3IR7B 1YJVA 2V63A 3NY0A 1UP1A 3VV2B 3D6MB 4DZ6A 2MZRA 1S7IA 4IFYB 5HSPA 4J9SA 3TZYA 2G4BA 1J5OA 3OSNA 2HEKA 3MEGA 5FLXY 3VQTA 4I4BA 1FF2A 3O5TB 3P8BB 3PW2A 3QAEA 3TQEA 1AZSB 1CQMA 1CS4A 1S9GA 3R9LA 1KRPA 1I5OB 1DTQB 1N4LA 2DISA 1HBUB 1AUSL 3MM7A 2ZC3A 1PJ5A 2BQRA 3AD8C 4ZN1A 5E3AA 3V6DB 1YJWS 3KG1A 2VFRA 4NLTA 2ZUAA 4RKUC 3CJ5A 1J5EJ 2XEXA 2DPIA 1GQEA 3DRSA 4WIQA 3O44A 2V2QA 1KS2A 2FY8A 1NKEA 3M9NB 1MSWD 1S1XB 1F3FA 2Q43A 1RTHA 3QIPA 1S97A 3FK4A 1TQLA 1HD0A 3G82B 2R7OA 5LMNF 3DLGB 4ED1A 2FGCA 1RWPB 2E5IA 4MFBB 3JYTB 5I4MA 4LF4F 3D67A 5KG4A 5K8MA 2GVDB 4DI6A 1C1BA 2EC0A 1HNVA 1YBUA 1XMOJ 3KXDA 3ITHB 5KG2A 3D6HB 1TKZB 2OAUA 1HI0P 4PYAA 4YP3A 1B0VA 1WUUA 4ZIVA 5K5MA 1JLEA 5B0GA 1T03B 3R8YA 4HT7A 2UXBF 3DOKA 3KK2A 2PFFB 6FDRA 1HWLA 1VI7A 3J7YU 1CQNA 1Y7PA 3WBZA 4L6V3 3HI9A 4JB8B 4ZVUB 4TYBA 1NKCA 3OR1A 2VBXA 5AXLA 2F9JA 1HNZF 2B4OA 3CMAS 4PQUB 2KDOA 2E5JA 3CIMA 3MD3A 2DEIA 4Y00A 4CP5A 3C66A 4WTOB 3CT9A 3SQOP 4NCGA 3BF4A 4MIWA 3MI7X 3PX4A 2QSFA 4A4JA 1SB6A 1RA6A 2Q79A 3JTOA 2ASLA 5J2PB 3N5FA 2ZOFA 4YMEA 2RRNA 5T7LA 3I9V9 5KAKA 3D0HE 5C42B 3M8PB 2QX0A 4K4SA 1HNXJ 3JAMY 2AYBA 1H2UX 4RBTA 1KVKA 3FBCA 4DX6A 2ZDPA 4TKTA 3HULA 5IT4A 3CCMS 5J2NB 2DH7A 1YKWA 1T9VA 3IC1A 1FJ7A 2HFSA 1LW0A 3RJMB 4NLPA 2MGZA 2BX6A 4K7QA 1RTIB 3K2YA 2P2CB 3EGNA 1HNIB 3QWUA 1B0TA 4IQXA 4P10A 1KTVA 2X3DA 3O3LA 2GGPB 2C3YA 4QYZJ 2C1EB 5F9NA 1RU1A 5G4DA 2CAJA 3I31A 3Q2TC 2CJKA 4K4YA 4NLYA 4GRSA 4W92B 5BYRA 1WKKA 1HHQA 5E2QA 3ETMA 1K0TA 3UN2A 2VF3A 5HATA 2ZH9A 4AQYJ 1C0UB 3SDEB 3NP5A 1VLYA 4OZLA 2M7SA 3DHWC 2DXEA 3CCSS 1EKRA 2XYPB 4H4MB 1U1NA 2A1BA 1R8BA 3UFCX 4QJVA 3G96A 1P1TA 4NYPA 3EZUA 4JI6J 1XMBA 3PIOQ 2FIUA 3C14A 2RJZA 5FLXU 2VBWA 1RWWB 3KMQA 2CIMA 3T3FA 1B64A 4B3RF 1X5OA 1U47A 1HWJA 1UKUA 4MKAA 1RHJB 1N33F 3RRGA 2M70A 3QIDA 2FY1A 2XMVA 3F73A 2OPQB 2QSWA 3UD3P 4DDFA 1Q8IA 1BQXA 4HYKA 4UY85 2LU1A 3SMZA 5CXTA 3TAPA 1NPPA 4ZCKA 4IUFA 1WI8A 5D3GA 3AQPA 4PXEA 4U9RA 2J76E 4NEYA 4DR1J 1U2RA 2Y1IA 1F1BB 2GZOA 5LL6d 4DV2J 2ZITA 3KMSA 2Y1RI 3IG1B 2VUGA 3QLHB 3CWJA 3AY0A 4E98A 1XN9A 4C3MA 2FTRA 7FDRA 1YJ7A 4ED3A 1RCXB 1N5YB 3W9IA 2F8EX 2VFUA 2HIYA 4NX9A 4WZMA 2MQNA 2DIVA 2DNZA 2UU9J 3CO0P 2HVHA 2UXCF 3PY8A 3UVJA 2HVDA 3GPAA 3TZZA 3RRHA 1ZM3A 3W1YC 2PGCA 2POKA 1CJVA 2VFTA 3MMAA 3D1HA 2WSEC 2JEGA 3MUMP 1PAUB 3MM8B 4OYMA 1LK7A 4L76A 5L1JA 1HWUA 2ASYA 1BHNA 4B17A 3D1QA 3T1YF 1RT7B 3K5PA 3EZ5A 2OTJS 2VG6A 5KFKA 3MUVP 1F5BA 1RAFB 1JLQA 3R7NB 2WCXA 3R97A 5M2RA 4RWXA 3VR1A 1WOOA 3PYGA 1YRUA 5KFXA 4ZIWA 3I5BA 2NZCA 4NXMF 2XSJA 4ICLA 3HDSA 3PHEA 3U7JA 3NMRA 1U24A 3ZZRA 4OHYA 1GX6A 2YKNB 2D9OA 3C15B 1MMLA 2ZOGA 1HNWF 2YNIA 1M5HA 3D66A 3GR1A 3GJRB 2HQCA 1XK8A 3WIVA 1HPZB 2DR9A 1HBNA 2AJFE 2Q6CA 3GILA 4OI1A 4J7CA 8AT1B 1CJTA 3JAMU 4LF8J 3EJMA 2MKCA 4W4MA 2P8IA 3FNNA 1PBAA 3HSZA 4I0WA 2H48B 1N88A 5E7OB 4KJIA 4ELUA 5A0YB 4PQAA 4KPYA 3MGJA 4F0HA 4NE9C 2Q6BA 3P5BP 3W8GA 2VODA 3W60A 3MMCB 5A8RB 3PO4A 1VQOS 2FLNA 1L3SA 4RUCA 4GVBA 4OI6A 3B78A 2OLWA 2MQLA 5I3UB 3CD6S 1RLDA 4OI2A 4PWDA 1T05B 3PW4A 2J7WA 2WK4A 3Q8RB 2KN4A 4WJBA 5HMZA 3KUGA 2YWEA 5L8RC 1WHXA 2N82B 4YUDA 4LR9A 5DGAA 5KFAA 4M5KA 5D15A 2V0NA 1H7XA 3ILIA 2FC9A 1SIZA 2ZC4A 3TRGA 5GAEI 2H9ZA 1RYRA 1TKTB 3VAJA 1BC6A 1PIEA 4C0BA 1LWXA 3ILLA 3SIPB 3F56A 2XMJA 4TU8A 5A6WA 1QAIA 4JP8A 1N32F 4DV0J 1Y5NB 3MECA 3OTEA 2FLLA 2ZVSA 5D6GA 4F4AA 2DHGA 4HEA9 3SFUA 2XM3A 2FZKB 2PO4A 2G2ZA 2HHXA 1H73A 3POTB 1IWAA 2ZH6A 3IRXB 2HZAA 1NU4A 4LFAJ 1TL1B 1T3NA 4RW9A 2BJ9A 2F4VJ 2GJIA 1CJUA 1WHVA 1NO8A 2CG8A 3M6UA 2A3JA 2UUBJ 4RU9A 2GMJA 1HI1A 2YX1A 1IBKJ 1SUQB 1FDNA 1X9SA 2CQ3A 1FKOB 5HLFA 3LA0A 4IYQA 4P73A 2AV5A 3NGDA 3BV8A 2JWNA 4DPUA 2LMIA 4OYPA 4NLSA 2R8JA 1X5PA 4ECXA 2C2NA 4DV5F 3UCGA 2YKAA 5BXIA 2OSRA 2K1RB 2E66A 4LF5F 3PEJA 2NUHA 3DMJB 2BEFA 3NEKA 1ICEB 1S49A 5D4OA 2PA3A 3R6GB 5BR8J 1GK8A 5K8NA 4YHHF 2KVIA 1U48A 2HSEB 3PTWA 2FVPA 1VS3A 1Y3JA 3HLUA 2MDAA 4Q44A 4K0KF 4IFVB 1WDTA 3TZXA 1VQ6S 2ZBQA 3GYGA 4USTA 2YPYA 1L3KA 3M6VA 1RT1A 3DOLB 3M6WA 1S0VA 2V2ZA 1Z4UA 4XK8C 2MXYA 2W8LA 4ETXA 4C0HA 1PC4A 1TMMA 3IR5B 2Y0BB 4B08A 2JH3A 3OBIA 4BCAA 1T3OA 2ZH4A 4LRCA 1C4AA 4K4UA 2MLYA 1NMEB 1OPZA 2D1CA 3H0PA 1IXKA 4G1PA 2HNDA 4M5NA 2DNKA 3W64A 4YFUA 4EYHB 3FZBA 3FMBA 4LFCF 1NEEA 3O6QA 3DFEA 4FNHA 2DR6A 4EZ6A 4O3RA 4HI2A 4ID5B 5DZ7A 1R0AA 4RU2A 2RH3A 5KFCA 3ICLA 2UUAF 1S9FA 2J6TA 4M5LA 3H98A 5KFVA 3TQ1A 1FE4A 3CCJS 2DKOB 2YQ1A 4Y2AA 3TJ9A 2V2KA 3I56S 3LP2A 4JI0F 3KLFB 4JYAJ 1OYDA 1U49A 2RILA 1H72C 3HSGA 5CQGA 2DH8A 3QQCD 2RDJA 4XIUA 1WNEA 2YWKA 1HR0F 3MMBA 2CJQA 1T94A 3QT5A 1HLWA 1FHTA 4K4XA 2HHHF 5CZVA 2V4JB 2VFVA 4I2PA 1OO0B 2DGUA 4FBTA 2Q66A 6AT1B 1DLOA 1OJ4A 3FFIA 5J2QB 3UWTA 2BDPA 4KSEB 4CYUB 4LUBA 3KJVA 2CPXA 5KFTA 3K5NA 2VIHA 1SL0A 3M8WA 2ALYB 4FVMA 4RBVA 4AE5A 4N76A 2E5LJ 4DR4F 1DTTB 2NXEA 4P6QA 2NYHA 3D3BJ 2EK1A 3ZO7A 5HO4A 4WXWA 1SC1B 3HCXA 1TV6A 2HHVA 3K17A 4KTQA 1ZPVA 4I67A 2KFZA 4LF6F 2D69A 3KNAA 4X4VA 1HWKA 3ET6A 1F6TA 2IMWP 2WTFA 2QT7A 1K73T 5D0GA 1RDRA 1VK8A 2VBZA 3MTKA 4B3TJ 1PYOB 4Y34A 1JLGB 3NS6A 1MWZA 3QSIA 1X4EA 3FVYA 3EXYA 1OQ3A 1S77D 2HQFA 5ETTA 3K57A 3W5XA 3QGGA 2V67A 1N0VC 4WFNQ 4OQJA 5KTQA 2QFIA 3HXMA 3SV4A 3EXCX 1VDHA 3HFKA 1H7WA 3CMES 1K1QA 1HBOA 3M7VA 2GIFA 1R7IA 2HWHA 1ZOTA 4DV7J 4WXOA 1WOSA 4OZ5A 2UVWA 2ZH8A 2R7RA 4DBQA 4C0OC 1DQ8A 4AL7A 2HGNA 1RSCA 2CQ0A 2DITA 4M5HA 1HQEB 3SCJE 2ROPA 4G3IA 3RW7A 4B9MA 3QGIA 2ZJRQ 1NCLA 2ATLA 4DZDA 3DYAB 3UNGC 2Y9HA 2ACYA 3TVKA 4U96A 5D0HA 2QMXA 2FLPA 3A12A 1PG5B 3LPEA 2EC2A 3MM6B 3A1YG 4ZPAA 2ERRA 2FUG9 3KK1A 1Q79A 1M5VC 2ZZTA 5IV3A 3SV3A 2MJNA 1REGX 2UP1A 1BUXA 1XNQJ 4P7TA 5H9EJ 4C8ZA 4RW4B 3M2UA 5KT4A 4EBDA 4R8UB 2HS3A 2FVRA 1JXLA 3L4BC 2UVRA 2P6SA 1C4CA 4OI3A 1QVFR 3Q22A 2PC6A 4K8RA 4ANDA 4ILMA 2R42A 2AGPA 3NGUA 3IMQJ 4PPDA 2QN6B 1S1VA 2ZD1B 1VC0A 3ISNC 4DLEA 2AT1B 2FZCB 3W2VB 3OXFA 1U0HA 3CCLS 2MB0B 1WC0A 5IQQA 4ECWA 5GAGI 2W9CB 4V1Ak 1I94J 2B7BB 5E3RA 3D68A 4QWCA 1WC3A 3FEZA 1RHQB 1IKXB 5FDLB 3MM5B 1H74A 2FJXA 3HHEA 2CPYA 3T41A 1XQIA 1S1WB 1LV5A 1D8YA 3G8TA 4O23A 2V8PA 4J9RA 3TW0A 2GFFA 4DF4A 3GSIA 1P9QC 1XMOF 2P9EA 5C2GA 1IKYA 3FSXA 2V8GA 3VCDA 5AE3A 4KHRA 2DCUB 2QYGA 4WWSA 2IRXA 3PYFA 1FNMA 3C16B 1RHRB 2GJ2A 5L39A 3H2LA 2XC9A 3G2XA 1SH0A 3KHGA 5KFHA 2XLKA 3D4JA 3BGUA 3WHIA 4FPIA 3QRRA 1PILA 3QZ8A 3G6YA 4RW7A 2XO7A 3OV7A 4LVOP 3JTPA 1UTAA 1IJFB 2C42A 3H40A 2RRBA 1T7PA 2JL9A 1W2IA 3MEDA 4F7VA 3NG8A 2ZH7A 1PKUA 1RI7A 4IR1A 1F2GA 2WBRA 5IM0A 3CO9A 5DDQC 5K9FA 4ZP8A 1FWKA 2E1AA 2HNZB 1UWAA 2XMMA 1B70B 3AXKA 3TYTA 3V4IA 5A2QY 3KWMA 2DGWA 3WX8A 3TA0A 5IXUA 1HNXF 4FYWB 3R1LA 1FKPA 3GG0A 4LF7J 1FWLA 4OYWA 3GJSB 3FUYA 4PXDA 4URGA 5GAEU 2B43A 1AUDA 4UF4A 2CXEA 4NLQA 4PWUA 1IM6A 4N5SA 2YWGA 2IIHA 1N6QA 2C3UA 2GQQA 1ZM2A 3MEEB 3IA0A 1JXVA 2CADA 1S10A 2CQ2A 3BR9A 3J7ZT 2CNKB 3OTDA 3QRQA 4Z37A 1BGXT 1C1CA 5KT5A 3W8PA 2BOPA 2BANB 3BS9A 4LRDA 4HDGA 2CA9A 2RQKA 2IJRA 3EDRB 2UUTA 3BM7A 1UCNA 2BOAA 3M30B 3U27A 2LECA 2IYIA 3DXSX 3QNWB 3V81A 2ZDOA 3W3SA 2BE2B 1RTJA 2VB6A 3C6TB 1CLFA 1EB0A 3W5ZA 4DG1A 3DLEA 2B8QA 2NCKL 3IN5A 5LT5A 3Q8VA 1U7LA 4JI6F 3AA8A 1HHTP 1MWYA 2DJWA 5HP1A 1N36J 2R7SA 1R8AA 5EUHA 1RE1B 3QPIA 4LSLA 1ITPA 2HG4A 1H6KX 2VPYB 2Z0GA 3IAS9 3M32B 2ZWPA 1VC5A 3H4BA 1NUEA 3W63A 1DFDA 3TX8A 1X4BA 2DY1A 4NYOA 5KT6A 4AXJA 2W9AA 5KG1A 4I2QB 4MT1A 4ALZA 1U1RA 1K1SA 2O1PA 3UDCA 3H8YA 2E29A 2P9CA 2QA1A 4OYOA 4QR2A 2BM0A 3ZTSA 1WEYA 1SC3B 4DHVA 2V8VA 3CJKB 3OPKA 4DR1F 5FD1A 1VRQC 2MHNA 4DV2F 1MMNA 3CE8A 3GV7B 5CHCB 4QQBA 4Q2MA 3EM1A 4Y6IA 2C3PA 4HR2A 3ZZOA 2PMWA 4LRAA 2UXDJ 3OLBA 4DR7J 1F5AA 5ETSA 2QE5A 4P7VA 5HROB 1UW9A 2BW7A 1TAQA 2GA7A 1T9TA 3KJFB 2UU9F 3MAQA 3WIUA 3RYLA 4USVA 3DRRB 2GO8A 3AFGA 2BVZA 1Z2ZA 2CQIA 5KG6A 4R5PB 4ECYA 1WKLA 2ZKUA 3T5JA 1JIHA 4OZ0A 3DHXA 2A18A 3HK2A 3W62A 1S9EA 3D5MA 1JLBA 2X1BA 4W90B 3X1LB 3IR6B 1KKHA 4X64J 4CO1A 1B99A 3ZTQA 2AMCB 2R9LA 4DLGA 1VMBA 5F3ZA 1FKAF 5LOQA 1H2TZ 3FEXB 3PFEA 2OO4A 3IM9A 3OVBA 4GKKJ 2I2YA 2X1GA 4U67Q 1W26A 2QMUB 3GFHA 3OTOJ 3CJSA 1RT3A 4P9SA 1H0HB 1YJUA 3BKTA 2AJQA 1HMVB 2OPSA 2V2VA 4JI4J 2QL7B 1YHQS 2HVIA 4MH8A 5A2QU 3ENQA 2VG5B 1GTEA 2A6OA 2HZVA 2HW3A 1F0XA 2DHXA 3PHTA 4HHUA 1SH3A 3TVZA 4F4KA 5CD4H 3A3OB 4LF8F 1TTHB 2BQUA 2HBQB 1SJ3P 5CZXA 3UNYA 2HBYB 2EBGA 4DL2A 2L9DA 3AXMA 1U6FA 4ES1A 3CCTA 1VCTA 2OKQA 3D54A 3SI8A 4QCLA 1JKHA 2W2MP 1KWMA 1DRZA 5T41A 4BBYA 2BUNA 4LR7A 4FYYB 1FRXA 1IBLJ 1KQSR 1U45A 4DN0A 1EZZB 4ETZA 2D3O1 1K44A 2EFPA 4DSJA 2CQ1A 3MPVA 2YNFB 2JLFA 4PPZA 4YB5A 3M8ZA 2YPZA 3H25A 4NXNF 2VBYA 5H9FJ 1Q95G 4F36A 4ZN3A 4PR6A 1Z1ZA 4L3KA 2WSFC 4RNHA 4IG0B 2B5JA 1C2PA 3OQ2A 4I7FA 2DNLA 1SC6A 2PI5A 4MK7A 4EMDA 2WVEA 3J80Y 2GAGC 1IR2A 1S6PB 3A8KA 3HZEA 2PI4A 4DV0F 1VRUB 1RWKB 2FJAB 2W8KA 4A8MP 2CYYA 4KH0B 5CH7B 5H9FK 2Z2MA 1N54B 4QWDA 1SVDA 2DXFA 1QSSA 1A6LA 2HGMA 2XHWA 3AHPA 2QIFA 3IS9A 3CCES 3DGPA 1SV5A 1ROFA 2ZEJA 3R27A 4DPWA 2KRBA 2XGPA 3U1LA 1UFWA 2LDIA 1X7VA 3LF0A 3CD5A 4QBUA 4A8OA 4RUAA 3VAHA 4ES2A 1U6BA 3D6TB 3TEHB 5J1NA 4LFAF 2OD4A 1WD6A 5JXSA 4ED6A 1HBMB 4CDIA 2F4VF 4IR9A 3VZHA 3A8IA 2UUBF 1WEZA 9RUBA 4J9KA 4FPRA 2E44A 1IBKF 4R0JA 4USWA 2VOOA 2GMLA 2CJXB 1RGVA 2WONA 1RBAA 3B6BA 1PBUA 2BYCA 3D28A 1LW2A 5L38A 4PAAA 2MMYA 5G0RA 2B9XA 5EDWA 4ELVA 1AFJA 2VPZB 4NA3A 1JLFA 3I6PA 4FS1A 3NOGA 1P1LA 4ELTA 5BR8F 4YR0A 1AROP 1TL3B 4KO0B 1T95A 2ZE2B 2HQDA 4CO5A 3N79A 1FJCA 5GAGU 5J1EB 1RT2B 2WRMA 4CO4A 1RT4B 1IR0A 2DGVA 1RTDB 3MCSA 3S7RA 4ZLPA 3GIIA 2VQFF 1LWEB 1EJ7L 2I0XA 3A8JA 4CO2A 3CD0A 3JSRA 4P72A 1S1XA 2ZM6J 4O44B 3OHBA 4DR2J 1F2HA 4Y2MA 2KU7A 5EHHA 2CWKA 3G82A 2OFHX 3DLGA 4C98A 5B0DA 4CTAA 3J81j 1S0NA 1YIJS 4MFBA 1IKWB 2N4DA 3MZIA 1N52B 3DLBA 1UZHA 9ATCB 2VKZG 3OFHA 1S6QA 2IAJB 2LQ5A 1PGZA 2DR8A 3T5KA 1ZZFA 4C48A 1D9FA 2NZ4A 1X4CA 4Q0BB 1LOUA 3A3PB 3T5HA 1T03A 2ZZNA 5LM7E 4JYAF 1FNOA 3UR0A 2Z58B 4O3QA 3L09A 2HHQA 2J5AA 3NCRA 5D77A 2AIRB 4V19J 1UJ4A 3M2RB 2LQ9A 5DQIA 4USIA 4KAIA 3QJJA 3CC7S 4OL8A 2YY3A 3MM9A 3K8WA 1QAJA 4F4ZA 2XMTA 3D0GE 4ZKAA 3G9CA 4P52A 1N5TA 3A13A 3RBDA 4UZBA 2HFZA 1B4SA 4O4GA 4QWBA 2I5JB 2E5LF 4I1TA 2HPUA 4PXBA 4QIWD 1VQKS 3AOBA 2G1HA 1HYSA 3OL9A 3C6UA 4KC5A 3CEDA 3OUYA 1J5OB 2ZHOA 1UVKA 1PC5A 4FP9A 1BY9A 3MEGB 5J2MA 2HHWA 3M8PA 3BN7A 1R8PA 3OTCA 4B3TF 4KPCA 1CS4B 4F50A 1S9GB 2IVMA 4LIRA 3EGZA 1RT5A 2UVVA 4C2MA 5HVFA 3MM7B 3UCZP 1RKJA 2MSSA 3TUZC 4BHQA 1KLMA 1WHWA 1ZZNA 4DSKA 4KY3A 2IJFA 3RBXA 1TL7A 3OL7A 5KFWA 3DRSB 2R7WA 1CC7A 4LJMA 3A4TA 3G4SS 3ILJA 4O0NA 3VQSA 2DBBA 2FVSA 4LT6A 5C2CA 2BJ3A 5KFUA 4CRJA 1HARA 2UXCJ 3ENAA 4DV7F 3Q8UA 1XWLA 3NWGA 3QIPB 3OSPA 2V9WA 2KL8A 1X4AA 1T9YA 4DFMA 4UY8T 3NKYA 2GNKA 1R89A 1BWEA 1RZMA 5A76A 1C0UA 2L9WA 1NK0A 4LRFA 3DM2B 3EPIA 1C1BB 3R5DA 4H4MA 1OWXA 1RU2A 1FNXH 1HNVB 4HHJA 5F8HA 4ZPTR 2VICA 3T6JA 1LWCA 3LALA 1SCJB 3HVTA 2C2KB 2W2OP 2BR0A 5JVGQ 1JLEB 4ZLLA 4F4XA 4NXMJ 3DOKB 3KK2B 3TX0A 1N5QA 2MKHA 4URSA 3KLHA 2EG1A 3QGHA 4BWJA 2UUWA 1NK7A 2MZSA 4CQ1A 3D1OA 3R7SB 2FJDB 1LWFA 1URRA 3DLKA 3EDQB 2KFNA 4PABA 8ATCB 2MLXA 2YNHA 4DOZA 4ZK7M 3VGSA 3V6KA 3GV5B 4I6AA 2HS0A 5F8IA 2P6TA 3LP1A 2ZHBA 4QU6A 2BACA 3WC2A 3S6EA 4KGXB 3LGMA 4C8MA 4FXVA 1EP4A 4CNYA 2MQOA 2G13A 5KG7A 2ZH3A 2FD2A 3PACA 4Q8FA 5T7LB 1I94F 4A48A 4G1QA 4F67A 2B9EA 2W4DA 3KJQB 2LQJA 1VQNS 3B54A 3DRPA 2J6SA 1JLCB 1P8GA 4CLKA 3NMAA 3LGNA 1HHSA 2MKJA 5KFBA 3SYZA 2YX4A 4K4ZA 1WG5A 4ANCA 3V4MA 3KDNA 2CQ4A 2R8KA 1LW0B 4JV2A 3PO5A 3MM8A 2YTCA 4DU8A 2MGZB 5CCMA 2AGQA 1YRTA 1KVJA 2HQIA 2L08A 3I0SA 2Z2LA 1FA0A 5GAHI 1YG0A 1U1PA 3BREA 1IKVA 4JOUA 2D41A 4IKAA 4KGVB 2W2NP 3OW2R 5DDOC 2MSTA 3GR0A 3MAHA 3NL0A 3OJSA 4NMLA 1E6YB 5EX0A 3EVMA 1LQ9A 2DXDA 4E0DA 1ZA1B 3LANA 5AJ3J 1XERA 3TJ8A 1JJ4A 2YNGA 2XY6A 4FXWA 4GKJJ 1RB0A 3GJQB 2KM8B 3KK3A 1FEEA 4DCOB 1YJ9S 2QYCA 3M8YA 3SSSA 1S48A 3PEHA 1L3VA 3R6LB 2JC1A 1YSJA 1EAYC 4DX8H 1DY3A 2H54B 4ZVHA 3N6MA 3C14B 3J7Z5 4B3SJ 4CLYA 3NXZA 5AE2A 4C8YA 3QMQA 2KTQA 5JUMA 4XDDA 4C3LA 4FYDA 1Y5LB 4RO0A 5I3QA 2DY9A 2DNMA 4WIIA 1SJQA 2OMLA 1NPRA 2GHPA 4QR0A 3DKDA 2IC3A 3RW6A 3RR7A 2HHPA 2NXNA 2K3KA 4HDHA 4A8SA 3CDUA 3IRWP 3SQGB 4C6AA 2IRUA 5HBMA 2JFDA 1XEZA 3UD5A 4ED2A 2KB2A 4M95A 4ZJOA 2D3ZA 4ZCLA 1U02A 1ZM9A 2O66A 3T19A 2WBMA 2DEJA 2NR0A 4B9TA 4X65F 4Y3CA 1VQMS 3SFGA 4KKOA 3K7RA 2C2MB 2IY5B 4FF4A 3ZZTA 3MXHP 3FEYB 3MUTP 2L3MA 4ILRA 3UVJB 2Z4PA 2RKIA 5KFRA 4XPCA 3ENVA 3HHLA 1NH7A 1CJVB 3VF0B 3DN9A 1U1MA 3MMAB 2YKOA 3FSYA 4NCAA 3E51A 1VQ9S 2AYGA 1RAIB 1YJNS 2I38A 2JNJA 4UQTA 1XTZA 1DQAA 3IRXA 2R2RA 4M5DB 4J9VA 4M94A 4ZCMA 1N36F 3AODA 3C8YA 3S8SA 1JLQB 2APOA 1FVSA 3QJLA 4ICLB 3GCWP 5IC4B 2V4RA 4JI5F 1YVFA 3I32A 2RAQA 1LK5A 3UO0A 5GMEA 4IOBA 2E7XA 2YNIB 1N0UA 4Q5VA 5I3PA 1X0FA 2ZBCA 2G2OA 4DR6J 2YH1A 2JX2A 3KHHA 4KYZA 1M5PC 3S1TA 3HT0A 4YY3J 3RAXA 4RL1A 4UOHA 2O67A 5LSOA 1HBNB 1CJTB 3BR8A 2OP5A 2Y1JA 3W7BA 4CCHA 4ZVTB 3CDAA 1UW4A 1X4HA 3E8OA 4U6PA 3TAMA 2LU2A 3FZ2A 4TNOA 2NS1B 2UXDF 1VBKA 4DR7F 2CWXA 1B0PA 1W7WA 1WEXA 2PIIA 1NSAA 3P49B 5CYMA 3H7HB 4F4WA 4FN5A 1UZDA 1GMVA 1YX2A 1RT6A 5LMUJ 4LQ9A 2ZBRA 1TUGB 3FRYA 3HHLD 1U8SA 1OIAA 5CYJA 2KZMA 1FXRA 2N3LA 4JV1A 3TARA 2J9CA 4PWDB 2XHCA 3MAAA 2MZQA 4HH0A 2BQ3A 1RAJA 1DAXA 1Q7YT 2F63A 1R3NA 1RAEB 1WELA 4TVAB 2EFVA 1NK5A 4X64F 1D09B 4QZVB 5C25A 2NQPA 4ZP9A 1GFWB 2RD5C 1YLXA 4GKKF 3RZAA 3GQCA 4NA2A 2ZH2A 4OYBA 4F02A 4BC9A 1U1OA 3OTOF 2WOMB 1B7YB 2MYFA 2IRYA 2IDLA 5IWAJ 4JI4F 3E01A 2KG0A 1ULRA 3RR8A 3GCXP 5DETA 1RAOA 3L9ZA 1WG1A 3UI3A 3C2PA 3CJRA 3BQ0A 1FJGF 3NGSA 4ZVOB 1AA1B 2RF2A 3SSRA 2CFXA 1O0PA 5KFSA 4IO9Q 2G0JA 5CYQB 3NS7B 2V4JA 4N8OA 1CSJA 1RWOB 2IA6A 2VU5A 5J2QA 1VBZA 2JDJA 4FS2A 3HMJG 1UAWA 2A2CA 5CCLA 2YQ3A 2MTLA 2YH0A 3LAMA 5JMNA 5E3QA 2LEAA 2QEXS 5HLFB 5BYQA 1IBLF 2OPRA 4AXIA 2EFNA 4RNMA 3MCNA 2XI3A 2YWHA 3MOZA 4CLWA 3SBMA 4TU9A 1CVJA 5A6PA 2F7VA 1WG4A 2XMAA 1BLUA 3D3CJ 4DL0C 5CABA 1R6YA 2E1PA 3NAIA 2XMWA 1VQ8S 4XAKA 5B0AA 2CZVC 1Q8BA 4A8FA 2CNNB 3D6FB 4PG5A 2JOQA 4OZ2A 1I3OB 3DDKA 2LDYA 2DYAA 1YDLA 2J6UA 4HACA 1U26A 2G9OA 4JI7J 2MZTA 3HHDA 4AT1B 1RBOB 5A8WA 1RT1B 4F25A 4ED8A 4DPOA 4DQRA 1Q7LB 3EX7B 4DUYJ 1KQGB 1RUSA 2CPHA 2X1AA 2ZOMA 5IZHA 1UWBA 4UZCA 2M0GB 1Y00A 5DQGA 4ECUA 2RQCA 5LJ3Y 1NK4A 1FESA 4G6VB 2V5HG 3DOMA 3GSDA 2IMOA 4DPXA 4XTTA 3PKMA 2OPPB 4EUVA 1UVIA 1HQEA 2J9DE 3EUNA 1JNZB 2JJ4D 2A0FB 4A46A 5E3PA 3TANA 1IN0A 3TJAA 2MHEA 3BSOA 3G6ES 3DYAA 3VWSA 2VPXB 2EEYA 3BYPA 3F0NA 2BKOA 3MM6A 2RUGA 2F65A 4JV5J 3TOQA 3L7OA 2RNEA 3M8QA 1UPMB 5DG8A 4R8UA 1XR6A 1U6ZA 4DX5A 1RQ0A 1KOHA 3MMBB 4DS4A 1V3SA 2DHSA 4B9LA 3EVWA 2GHVC 2PEHA 3ONQA 4I2PB 3RTVA 2AP6A 3DDNA 2KYXA 2K8GA 2M9KA 2NXCA 5B0FA 1FEHA 3HFVA 1J2VA 1B3TA 2XY5A 3KJVB 5HL7Q 4FBUA 3C19A 2RB7A 3QBCA 1YWXA 1Q5YA 4ZVRB 4L3NA 1RACB 1TV6B 2A10A 2EG2A 2OIHA 4O3PA 4CNZA 2OSQA 5HJXA 4IDKA 3ET6B 4CLLA 2OEJA 3FGVA 1QSLA 4CIOA 2F9DA 2RQMA 2ZM6F 1WSVA 1R43A 5ETRA 5IT9U 3N5BA 4Q2LA 4PCQA 4DR2F 1GXLA 3M9OB 1YRXA 5K14B 5GAHU 2U1AA 5ETPA 3LQVA 3DU5A 3BGLA 4DSLA 2XYHB 2YXLA 3I4HX 1KOOA 3LP0A 1OPIA 4MMOA 1EHWA 2FJBB 3AH6A 1VBYA 1BQNA 3KLIA 3SZ2A 2X1FA 4C8LA 3FDSA 1M1GA 5L46A 5KG0A 4RW6A 3C16A 1ZETA 1H98A 1EIYB 5CAAA 4ZJLA 2MKKA 3R7BB 3GP9A 1TL4A 4ECRA 2J8SA 2SXLA 2J0QD 1CULB 3PYEA 4C4WA 3FCVA 4N47A 4KR0B 4F4YA 2AGOA 2I1RA 2K7JA 2CKWA 3HO1A 4P2FA 3V5RA 4CZCA 4QPXA 1U1QA 4QYRA 2HWIA 2KH9A 4KGZB 3OR2A 3DDIA 4LSZB 5ETLA 3I87A 4M63A 2E9TA 1FFSB 5DS7A 2RS2A 1NHUA 1DJ0A 2OELA 2IYGA 3PNIA 3KK1B 2ABYA 4LBHA 3M8SA 1OY8A 3BQ1A 3CCRS 2KHDA 2O3DA 3MFHA 3CJTA 3M4XA 4ZPBA 4M1KA 5HQLA 2CVIA 3RUBL 1S59A 2DRAA 2EKYA 3RAMA 2FZGB 2J9DA 3N01A 1R31A 1S1VB 4C8NA 5KFEA 1FDDA 4KRWA 2AD9A 1QD1A 4D3HA 3LWMA 2ZJPQ 3QSYB 5HMYA 4CO0A 4NPOA 1OQ6A 4I69A 2VQEJ 4QIFA 1VQ4S 2R7UA 2VG7A 1UVLA 1QUVA 3FBBA 1U0HB 2EFQA 2PSZA 2KFYA 4A8YA 5AE1A 1P6TA 3T1HJ 2K06A 4DPYA 1G3OA 2H3EB 1BQMA 3MR3A 1N34F 1VQ7S 3N4WA 3M30A 3KLVA 4UW2A 1SJ1A 2BE2A 2YBVA 1VQYA 1K47A 1SKRA 4ECQA 2K7KA 4Y2CA 3FQKA 1KP6A 2HAFA 1NRKA 3BDEA 1IKYB 1QE1A 1VRTA 1RA7A 2OH2A 5E33A 5M2PA 1N5VA 4KV8B 5D8HB 4IOCQ 3ISZA 2NXJA 4OHVA 4C11A 2XULA 3GFZA 1T9WA 4JI1J 4RW7B 2H5JB 2GQ2A 2MQMA 1KFSA 1M5KC 5E0OA 3VAGA 2Y8WA 2GMHA 4TY8A 3K59A 3KLGA 2BJ7A 1MNEA 4AL6A 1WTBA 2QLBB 2XWYA 4A8XA 3MEDB 3BO2A 2HRYA 2ILYA 4TLRA 3SCIE 1Q5VA 3CF5Q 2NREA 1OMSA 3DC2A 3V4IB 1K9MT 2ROEA 3BH6B 1GEHA 5HROA 1TK0A 4Y2IA 1ZTWA 3BBCA 1RWVB 1NK6A 4DV6J 2LEBA 4F0KA 1IR1A 2DNOA 3I96A 4ECVA 3FRZA 1FKPB 3KG4A 3IWXA 2RQ4A 3LAKA 5GVQA 4NRTA 2JSXA 3EWGA 2BJDA 3AT1B 3H59A 2VL1A 1X4DA 4NXNJ 2R7XA 5F0UA 2DB1A 4J91A 2B4PA 2E9RX 3GLJA 1TVRA 3EICA 1WC5A 4NMXA 4J90A 3TUJC 3TI0A 2X51A 2NPFA 1SJRA 3K89A 1C1CB 1JXEA 2LKZA 5HJYA 3NBPA 4DX7A 4EYIB 3TP2A 1NHVA 1VR6A 4K5RA 1XIQA 2UUCJ 3PKYA 1FX4A 2C2EA 5L1LA 1HMVA 3NGTA 5AJ3F 3THPA 3V81B 2KZZA 4GKJF 1PJ6A 3Q8QB 2EW9A 3DLEB 4IG3A 3LUYA 4L75A 3BDPA 1VBXA 3UD4P 1QVGR 1HFEL 1GMWA 1WOPA 4B3SF 4LSLB 2VASA 4NI2A 2XG8A 3RB4A 1Y10A 2AX0A 4Q45A 2XWXA 1ZA2B 3SSQA 1GXTA 3D2WA 2FC8A 2HAIA 2KM8C 3R5JB 4WTYA 4M8LA 3BYRA 4P2MA 2B6AA 2QLWA 2XQCA 3BGRB 4X4OA 3JSMA 4FXDA 2HS4A 1Q1KA 3HP6A 3P96A 4DFJA 1N8RT 5DLFA 3MD1A 3TUIC 2FVQA 3W5YA 2XS2A 2RSQA 2AHOB 2G0IA 3GIKA 5DG7A 4KT0C 1WSRA 4U8YA 4AFFA 2GHWA 1GTHA 4TQRA 1TR0A 4NLUA 3UQSA 4N56A 5DGBA 1S4FA 2VQFJ 4MKBA 3GONA 1SQFA 4YOEA 1VRUA 2E9ZA 5F8LA 4USUA 2M5YA 4URQU 3CDBA 1O6XA 4MK9A 1PYTA 1FK9A 4OMFG 2F40A 3MMJA 2XZDB 1D1UA 4F3OA 2R7VA 3TVYA 3CJ4A 4FF2A 1JLBB 1WI6A 1SL1A 4B02A 3RAQA 3K5OA 2HFNA 1GMWD 4PG8A 3DLLQ 3GIMA 3DLJA 3W66A 1LNQA 2HKEA 1EQ0A 2JHEA 4RR5A 3VGUA 4KBIA 1RJJA 2CPZA 2DGSA 1ZH5A 3ENWA 3VVUA 5HQ8A 1NZAA 3TEGA 2OPSB 5JJBA 2CPEA 4C3KA 5B7WA 1R0CB 2CDRB 4DR6F 2CQPA 4BC7A 5ETVA 4YY3F 2QZ8A 4YB6A 2RMLA 2OJ3A 2DT9A 4WP8A 1TFWA 3LPYA 3ZZUA 1MU2B 2UV8G 4BLGA 4PWWA 2AW0A 4A8KA 4X66J 4I6WA 4DFKA 4ZVPB 1TL3A 2E7WA 4G1IA 4ED0A 4DV4J 3MPUB 4KFBA 2AQ4A 1RT2A 4PZVA 3AOCA 1OSDA 1X5TA 2LP4A 2N4CA 4ED7A 1X9MA 5LMUF 4ZHRA 1F5CA 3GFXA 3CCZA 5D78A 4DQQA 4GO5X 1FX2A 1JJHA 4RLEA 5I42A 1J27A 3N6LA 2JLGA 1WJ9A 1VISA 4PG6A 1D8ZA 1VFJA 2CJAA 3WX4A 2B9YA 1IVZA 4Y28C 4OFZA 3PXGa 4AYBD 2XTJP 4OYXA 6FD1A 1RXOB 4WKRA 4OJGA 4Z7YA 1MROA 3FCWA 2VJVA 4ZS6A 2VDIA 4I7FB 3PW0A 1UEUA 5HMWA 2FPHX 1IKWA 2KJWA 2GAHC 2B56A 1HL6A 2FHOB 5DDRC 3MR5A 2IAJA 4X84A 2R2UA 5U47A 4ZVSB 5IOLA 1RHKB 3HJVA 4Q0BA 2BJ8A 3AD7C 1GAOA 3FBEA 1SV5B 1KLNA 5IWAF 3DGVA 3LOUA 4UOGA 2K2PA 4OHXA 2KG1A 4WE1B 1P9YA 1SC4B 4EFAC 3DI6A 4PUOA 4ED5A 4KHPJ 1O51A 1A7GE 2YKMA 3NOCA 1ZAVA 1V9OA 2H5EA 1TL5A 3D0IE 3T9NA 5F9LA 3CD7A 3OXGA 1SIWB 2HZCA 3D7SB 3PX0A 3HKWA 1NK9A 2QC3A 1UFLA 3P4UB 4CLTA 2WONB 4MKVA 1FXDA 2H4WB 2Y0SD 1G1XA 1KHVA 2I5JA 5HAOA 2PN6A 2CQBA 2DNPA 3RU0A 2GQCA 1RK8A 2E7VA 3PDNA 4GVLA 5HVGA 1LW2B 5AT1B 2DO4A 5G0RB 4AL5A 3ZZZA 3IXQA 1RAAB 2CPJA 1JLFB 4ZPVR 3W2WA 3VGTA 3G6VA 4Q43A 2IDEA 1KC8T 2HK2A 2XCAA 1H2VZ 2QGFB 5C7PA 2LFVA 5B0BA 4JI7F 1QAYA 4RUHA 1QDUB 3H5YA 1JMTA 4USJC 5EX3A 4EK2A 4HH1A 2DGTA 2BM1A 4K4VA 3CVKA 4A8QA 1SKSA 1CJKB 2WVDA 4RJVA 4EO6A 3MR7A 1XJWB 2N3OA 4DUYF 2FHJA 2MPUA 3GFYA 3HSDA 4Z7CA 3K58A 4NLRA 4WFYA 4F3MA 1Y9OA 4FKYA 4EBCA 2MQQA 1TKXB 4K4WA 4LSNA 2L41A 4CTAB 2BW2A 4I6YA 2ACMA 2WW4A 1RP5A 2MJUA 1R8CA 2Q3PA 3DM2A 1S1TA 4DL4A 2J0SD 5KT2A 1S6QB 4OZ1A 1YQHA 1VQSA 3PX6A 1UJ5A 4USMA 2VDHA 2QO3A 1QTMA 3P5TL 4FF3A 4DV3J 2EFGA 4JV5F 3M6XA 3PW5A 4HLBA 5KFLA 4UQGA 4KH1B 1IBMJ 2AX1A 4C97A 5D4PA 1XR5A 1NLKL 2PFDA 4RNNA 2N7CA 3MM9B 5A8KB 2MLZA 2BJ1A 3UCUP 2W2QP 1RKIA 1FRMA 3ZFVA 2G2YA 4TYAA 2JZ5A 4O4GB 2J0WA 5L9NA 2AJ1A 1VQLS 3QT6A 5KFPA 4B3MJ 1S7HA 2W4CA 1F9FA 1RBLA 4ZVGA 1HYSB 2CQGA 2IVFB 4X4NA 3C6UB 4N8NA 3OUYB 1NM2A 2BKNA 3HVRA 3I0RA 2DNYA 2BKPA 5J2MB 4MAKA 2CJ9A 2FHJD 3BEGB 2XS7A 4B9NA 1JLCA 2QRRA 1RT5B 2GC8A 3QT8A 1GNKA 2XMKA 3TNVA 1KLMB 4E2FB 1KD1T 3AJ2A 1VOMA 2AKWB 1TL7B 4X65J 2FYXA 2M8DB
chains in the Genus database with same CATH topology
3NGUA 1NDKA 1WKLA 1NUEA 1U8WA 1NHKL 1WKKA 1HHQA 3DDIA 4DZ6A 1KDNA 4S0MA 5CABA 1NSPA 3EMTA 3ETMA 3FC9A 2DY9A 3FBFA 4ANCA 1XIQA 3ZTPA 1JXVA 3Q8YA 3VGUA 4DI6A 1NDCA 1VYAA 2DXEA 1MN9A 1W7WA 3NGRA 4FKYA 3NGTA 3VVUA 4ANEA 1LWXA 1NSQA 2DYAA 3DKDA 3FCWA 3BH6B 2AZ1A 1NB2A 2HVDA 3VGVA 3GPAA 1B99A 3NGSA 3ZTSA 4DUTA 1F6TA 3ZTQA 3R9LA 1ZS6A 5BXIA 4O0NA 1NPKA 1EHWA 3EJMA 3FBCA 3BBCA 1PKUA 2BEFA 3Q89A 1K44A 1NCLA 4C6AA 1NDLA 3FKBA 3BH7B 4F4AA 3ZTOA 3ELHA 4WBFA 3EVOA 3Q83A 3BBFA 2HURA 3EVWA 1HIYA 1S5ZA 3ENAA 3Q8UA 1S59A 3VGSA 3EM1A 4F36A 5IOLA 1XQIA 1NSKL 1LEOA 3MPDA 1UCNA 2VU5A 2BX6A 3B6BA 1B4SA 4HR2A 4ENOA 2ZUAA 2CWKA 3EVMA 3VGTA 1BE4A 2DXDA 5CAAA 3FBEA 1BHNA 3GP9A 2B8PA 3EE3A 4UOGA 3ZTRA 1BUXA 3JS9A 3WX8A 2B8QA 2NCKL 2HVEA 3BBBA 3FCVA 5C7PA 2AZ3A 3VVTA 1MN7A 1S57A 3Q8VA 1HLWA 4UOFA 3EICA 1NDPA 3L7UA 1F3FA 3FBBA 1PAEX 3PRVA 1NLKL 1WKJA 4FKXA 4UOHA 4CP5A 4ANDA 3Q86A 3PJ9A 4EK2A 4KPCA 3B54A 2DXFA 4W98A 3G2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGU A;  1NDK A;  1WKL A;  1NUE A;  1U8W A;  1NHK L;  1WKK A;  1HHQ A;  3DDI A;  4DZ6 A;  1KDN A;  4S0M A;  5CAB A;  1NSP A;  3EMT A;  3ETM A;  3FC9 A;  2DY9 A;  3FBF A;  4ANC A;  1XIQ A;  3ZTP A;  1JXV A;  3Q8Y A;  3VGU A;  4DI6 A;  1NDC A;  1VYA A;  2DXE A;  1MN9 A;  1W7W A;  3NGR A;  4FKY A;  3NGT A;  3VVU A;  4ANE A;  1LWX A;  1NSQ A;  2DYA A;  3DKD A;  3FCW A;  3BH6 B;  2AZ1 A;  1NB2 A;  2HVD A;  3VGV A;  3GPA A;  1B99 A;  3NGS A;  3ZTS A;  4DUT A;  1F6T A;  3ZTQ A;  3R9L A;  1ZS6 A;  5BXI A;  4O0N A;  1NPK A;  1EHW A;  3EJM A;  3FBC A;  3BBC A;  1PKU A;  2BEF A;  3Q89 A;  1K44 A;  1NCL A;  4C6A A;  1NDL A;  3FKB A;  3BH7 B;  4F4A A;  3ZTO A;  3ELH A;  4WBF A;  3EVO A;  3Q83 A;  3BBF A;  2HUR A;  3EVW A;  1HIY A;  1S5Z A;  3ENA A;  3Q8U A;  1S59 A;  3VGS A;  3EM1 A;  4F36 A;  5IOL A;  1XQI A;  1NSK L;  1LEO A;  3MPD A;  1UCN A;  2VU5 A;  2BX6 A;  3B6B A;  1B4S A;  4HR2 A;  4ENO A;  2ZUA A;  2CWK A;  3EVM A;  3VGT A;  1BE4 A;  2DXD A;  5CAA A;  3FBE A;  1BHN A;  3GP9 A;  2B8P A;  3EE3 A;  4UOG A;  3ZTR A;  1BUX A;  3JS9 A;  3WX8 A;  2B8Q A;  2NCK L;  2HVE A;  3BBB A;  3FCV A;  5C7P A;  2AZ3 A;  3VVT A;  1MN7 A;  1S57 A;  3Q8V A;  1HLW A;  4UOF A;  3EIC A;  1NDP A;  3L7U A;  1F3F A;  3FBB A;  1PAE X;  3PRV A;  1NLK L;  1WKJ A;  4FKX A;  4UOH A;  4CP5 A;  4AND A;  3Q86 A;  3PJ9 A;  4EK2 A;  4KPC A;  3B54 A;  2DXF A;  4W98 A;  3G2X A; 
#chains in the Genus database with same CATH topology
 1EKS A;  2M88 A;  1PO6 A;  2XBP A;  1HI8 A;  4X62 J;  2VHG A;  3I82 A;  2FQQ B;  4L72 B;  1BXN A;  2DK2 A;  3Q8Y A;  3OL8 A;  3QRP A;  2CVE A;  1E6Y A;  4OX6 A;  1U0S A;  3NGR A;  4B9U A;  1M0S A;  4LFB F;  1RTZ A;  7AT1 B;  4EO8 A;  2DCL A;  1Q86 T;  3CC2 S;  4Q7A A;  2L9N A;  1JNR B;  5KFZ A;  3E2E A;  3BH7 B;  1VQ5 S;  1PJ7 A;  5KG5 A;  2OFG X;  3J81 Y;  5ETK A;  3CNQ P;  4HTI A;  1S6O A;  3B4M A;  2XO6 A;  3THV A;  4QYZ K;  3P3D A;  1LWC B;  1EET B;  2O5D A;  5EWG A;  1KQK A;  1RAD B;  3M1V B;  2FDN A;  3HVT B;  2ALZ A;  2RHQ B;  2NSC A;  3IBC B;  1CG2 A;  1KHW A;  2JVO A;  3Q2S C;  2B8P A;  4U8V A;  2GX8 A;  4YR3 A;  2YKP A;  1PSD A;  2X3G A;  3MWB A;  4G65 A;  3G87 A;  4JI5 J;  3KLH B;  2FGO A;  1S1U A;  1UA0 A;  2MZJ A;  2LYV A;  3DNC A;  1LFW A;  3L95 X;  4WP3 A;  3DRY A;  4GMK A;  2XCP A;  4RW8 A;  2UZA A;  4WU3 A;  1LWF B;  2JC0 A;  2XY7 A;  3DLK B;  2VZ9 A;  1UVJ A;  3SQG A;  3PM9 A;  4Y65 A;  2YNH B;  4IQM A;  4ZCI A;  2HMI B;  1FFG B;  2QLF B;  4EWT A;  4CWB A;  1RWM B;  3LP1 B;  4R25 A;  5C24 A;  1KNZ A;  1OYE A;  3GIJ A;  2PMH A;  2JFK A;  1RWU A;  2VQE F;  3UN5 A;  1DAR A;  1EP4 B;  3TO8 A;  3J7A 1;  1TUV A;  2R2S A;  4CM2 A;  2E1M C;  4G1Q B;  3QGP A;  5MAO A;  3WZ0 A;  1N5S A;  3T1H F;  3DRP B;  4B3O A;  5ITH A;  1FD2 A;  1F9H A;  1NH8 A;  3CJ8 A;  4DL3 A;  4ID8 A;  1JWW A;  2LEP A;  1C0T A;  3AJD A;  1N48 A;  4IRD A;  2IM3 A;  3ZZ0 A;  4OV6 A;  1T02 A;  2DHA A;  2LA6 A;  5DO2 A;  4GC7 A;  3TR5 A;  1ZPW X;  4ECS A;  2QL9 B;  4DQS A;  1SI9 A;  4M5D A;  3I0S B;  4ITS A;  1HW9 A;  1IKV B;  2PEB A;  4FF1 A;  4DV1 F;  1FDB A;  2JRS A;  3IM8 A;  3NCP A;  2Q1L A;  1Q82 T;  4J9L A;  3PJX A;  2HNY B;  3NGK A;  4LBP A;  5SUH A;  3MEK A;  2A6M A;  1M5O C;  3RG6 A;  4CM0 A;  1UL3 A;  2OHD A;  2VC1 A;  4JI1 F;  2DVI A;  2IM1 A;  4DU7 A;  1YIT S;  1JK9 B;  3MPY A;  2YNG B;  2W24 A;  2HVZ A;  5HVH A;  4BWM A;  4OI0 A;  3CJ0 A;  3ZTO A;  3TUP A;  3KK3 B;  2KT5 A;  1FRL A;  1HQU A;  1FJG J;  3H5S A;  1NJW A;  3FCH A;  4ZJQ A;  4RPF A;  3ZNU A;  2AF6 A;  1X60 A;  2ZJQ Q;  1NND A;  4U7U K;  2XI2 A;  4QWE A;  2PDA A;  2BA9 A;  3KOA A;  1E6V A;  4NOH A;  3MPW A;  2GVZ A;  4H54 A;  4IH6 A;  4QIV A;  3VVT A;  1WC1 A;  3FMW A;  5BJR A;  2PT0 A;  1X8D A;  3Q8P B;  5KFN A;  1FCA A;  4DV6 F;  3JQK A;  2IC3 B;  4I68 A;  3PR5 B;  2KXH A;  2CPI A;  3P6Y C;  2DR5 A;  5HBM B;  4HI1 A;  1S0M A;  4K2J A;  3TA1 A;  2P5V A;  2ZVI A;  4NLW A;  2DRD A;  1RAG B;  2QG9 B;  4H4O B;  3ZZY A;  3PR4 A;  2ADC A;  2IFX A;  1FWP A;  1ZS6 A;  1Y11 A;  5IFM A;  1Q4R A;  4B9S A;  4KKO B;  4X4Q A;  2RVJ A;  4YB7 A;  4ZP6 A;  3NNC A;  3R5A A;  3J81 U;  2R7Q A;  2HFO A;  2CNL B;  3R5G A;  2RKI B;  4QW8 A;  2KRR A;  3US5 A;  1IM4 A;  3HHL B;  2BMB A;  4IO1 A;  4UTG A;  3JB9 k;  3QO9 A;  4CLF A;  2UUC F;  2WOM A;  1VGY A;  3KDO A;  2GW8 A;  2YQ0 A;  2HWT A;  2GS8 A;  4K4T A;  4DR5 J;  3UE2 A;  3FSI A;  1U2F A;  2VFS A;  4OJH A;  2AU0 A;  1TP7 A;  1KEK A;  2FLO A;  3MF5 A;  5L9X A;  1U4B A;  1REV A;  4NLX A;  1T8E A;  2GCF A;  4LVN P;  5CYQ A;  1VHF A;  1HD1 A;  1SQE A;  3KLE A;  1UVN A;  3BGO P;  4NLD A;  5HAN A;  2ZH5 A;  4YB1 P;  2VJU A;  1LXJ A;  1Z2L A;  3W9J A;  2CG4 A;  3GZ7 A;  1SQG A;  5ETN A;  1VC6 A;  1B7F A;  1TK8 A;  2H65 B;  2I6W A;  4IFY A;  2NLW A;  4FZV A;  1WDD A;  3TAQ A;  3W61 A;  2R4F A;  3F41 A;  1H38 A;  4X2B A;  4PYD A;  4ZVF A;  2W2P P;  2B3T B;  3G6X A;  5HK4 A;  1AZS A;  4DR3 J;  3GJT B;  1QY7 A;  1S99 A;  1DTQ A;  3TA2 A;  2IBK A;  3TAM B;  3UR3 C;  1OSC A;  4C8K A;  1HBU A;  4QPT A;  1Y0H A;  4U95 A;  2OI2 A;  4NEZ A;  2R3V A;  2GO9 A;  5LJ5 Y;  4WFZ A;  3OHA A;  5CYM B;  1PAE X;  2CQC A;  3U1N A;  2P9G A;  3V6D A;  4CH0 S;  2IHR 1;  1RT6 B;  4O4R A;  1CBK A;  2LQ8 A;  2C28 A;  1FO1 A;  5ETO A;  4F2S A;  1I51 B;  3PRB A;  2EFO A;  3H90 A;  2D9P A;  2E5G A;  1V3Z A;  4MK8 A;  3MAA B;  5J1P A;  5L1K A;  3M2V B;  1S0O A;  3P45 B;  2ASJ A;  5F8N A;  4DUZ F;  2DNG A;  1A0O B;  3I55 S;  4WBF A;  3HZG A;  3JYT A;  3DXB A;  5C25 B;  2OPP A;  2GVD A;  2YWF A;  1I6J A;  1AT1 B;  2DD8 S;  1FD8 A;  4YDX A;  3ITH A;  2B7C B;  2HRU A;  2UV8 A;  1IQZ A;  3N28 A;  1NJI T;  5KFJ A;  1TKZ A;  1FRH A;  4CI0 B;  2IVY A;  4YS2 A;  1QJH A;  2DTJ A;  3H4D A;  4ZA1 A;  2I9S A;  4UOF A;  3E01 B;  5KG3 A;  2BRL A;  1ZM4 A;  3ISN D;  3Q8S B;  4JI8 J;  1UEV A;  1ZTT A;  5GAD I;  2Z56 B;  1HKA A;  5DG9 A;  2HHT A;  2W9B B;  3KJN B;  2RF2 B;  2Y1L B;  1Q8L A;  4F26 A;  4S0M A;  4X66 F;  3ZTP A;  1WC6 A;  5LXR A;  3HJF A;  1ZAW A;  2HQG A;  4PQU A;  3HD1 A;  2YWW A;  1JLA B;  4USH A;  4DV4 F;  4UOC A;  3LO3 A;  1D9A A;  4EZ9 A;  3FJ2 A;  1IQT A;  3OTB A;  1YK9 A;  3NCQ A;  3Q24 A;  5DZ6 A;  2OPR B;  4WU2 A;  3VAL A;  4K5S A;  1EAR A;  3HD2 A;  4RUB A;  5J2P A;  1DQ9 A;  2F5G A;  5C42 A;  3CC4 S;  2W25 A;  3I5C A;  3O2I A;  3BGF A;  3NS5 A;  4I56 A;  4TN2 A;  5K14 A;  1TMJ A;  5J2N A;  3MUR P;  4ES3 A;  1FRI A;  3ILO A;  3G8Q A;  3PRV A;  4HAC B;  4N77 A;  2FVC A;  1EX8 A;  3QWP A;  5A8W B;  4LBI A;  1RTI A;  2JLE A;  1HNI A;  3EMT A;  2HGL A;  2GJF A;  2GGP A;  1M1K T;  1GXU A;  2QA4 G;  3CTR A;  3M05 A;  3VTI A;  4XPE A;  2HLU A;  4DCP B;  1UWB B;  1RTH B;  2RRA A;  2AYM A;  2UVU A;  1MWQ A;  3PJW A;  1CUL A;  2KVQ E;  4CT9 A;  4KHP F;  1N34 J;  3FKB A;  3DOM B;  2E1C A;  2R7T A;  1OY6 A;  3Q83 A;  4DQP A;  3V6J A;  1SL2 A;  2VPW B;  1V5I B;  3SDE A;  3LH2 S;  2WVF A;  1FT8 A;  4RX6 A;  2MY8 A;  2XB2 D;  5IS2 A;  2NPI A;  3ZTR A;  2AEM A;  4J9Q A;  4I64 A;  2HVE A;  4YDD B;  3CUL A;  4ECT A;  5LSR A;  3GG1 A;  3HF5 A;  4N7T A;  4ECZ A;  3E3X A;  2Z2Y B;  2OPQ A;  3M8Q B;  3K0J A;  1VHI A;  3KFW X;  1TU0 B;  1U09 A;  1GT8 A;  3OR1 B;  4M5G A;  3FBF A;  2DGX A;  1JQG A;  1BD6 A;  3HVW A;  4OZJ A;  1FFW B;  3CCW A;  4NA1 A;  3IG1 A;  3QLH A;  4QU7 A;  1KON A;  4NCG B;  3PG9 A;  1J5E F;  5H9E K;  2EXU A;  1N5Y A;  3VAM A;  4ZIT A;  4HVZ A;  5D4L A;  3U1M A;  1XNR J;  3H2U B;  2OGU A;  4IDK B;  3UDL A;  3QAU A;  2ZKT A;  2FJW A;  3N9U C;  2ZHA A;  1ZYQ A;  1FI4 A;  4NYZ A;  1BWV A;  5D0R A;  1FDA A;  1Y5I B;  1LFP A;  4WK3 A;  5HQM A;  1G2E A;  4ILL A;  5DJB A;  2KXF A;  2NSB A;  4KIA A;  1VIO A;  1DHM A;  2XYG B;  3L7U A;  5K8O A;  2XZW A;  1RAH B;  1R8H A;  1ZAX A;  2GIQ A;  4J9O A;  3LP0 B;  2CJY B;  2DR7 A;  1HA1 A;  3QFH A;  1IUJ A;  1NHK L;  4OI4 A;  1RT7 A;  4NLV A;  1BQN B;  3KLI B;  4OX8 A;  2N7Y A;  3CSK A;  1TAU A;  4KV8 A;  2QA4 S;  1UFK A;  2OTL S;  3CDW A;  4DV3 F;  4RW6 B;  1NSQ A;  2ROG A;  2AZ1 A;  4UUX A;  1AXQ A;  1IBM F;  3I9Z A;  1WOR A;  4TXS A;  2KO1 A;  2YKN A;  4OLO A;  4OLP A;  3C15 A;  4FNI A;  2V6A A;  3JQM A;  2HRT A;  1VIX A;  3CIZ A;  4LF2 A;  4PXC A;  5B0C A;  3N6N A;  1HPZ A;  5KFF A;  3GTY X;  3ZNJ 1;  2CJB A;  2DGQ A;  3OR2 B;  2OEM A;  4X4P A;  4CT8 A;  3ZZP A;  2HQ3 A;  4OJ1 A;  1TEL A;  3V6H A;  2F8H A;  4B3M F;  4PG4 A;  1TK5 A;  1AYE A;  3RRK A;  3M9M B;  3BSN A;  1WF1 A;  4R0E A;  4OZ3 A;  5A0Y A;  1L3U A;  1WTF A;  1SJF A;  3IO1 A;  1R6V A;  2KT2 A;  3BSC A;  3R5B A;  3MMC A;  1XC9 A;  3HSJ A;  2PE8 A;  3BPS P;  1G7C B;  5A8R A;  4LF9 J;  2BXJ A;  2CRL A;  3FC9 A;  3WDO A;  5D3G B;  2QFJ A;  1S72 S;  2Z8Q A;  2LXF A;  4OHZ A;  5AXN A;  5I3U A;  1F9E B;  2RIJ A;  1VLO A;  1W2B R;  1T05 A;  3KHL A;  2V94 A;  5DLG A;  2BRK A;  2F8M A;  4DSE A;  5AXK A;  4NZ0 A;  5EN1 A;  2WVC A;  3AQO A;  2IPO B;  4JBC A;  2KJV A;  2VG7 B;  3QAT A;  4HL9 A;  4O3O A;  3MR6 A;  2BJE A;  1YZ6 A;  1LEO A;  2DNR A;  1FRJ A;  2EK6 A;  1TKT A;  1JB0 C;  2MY7 A;  4X62 F;  5E41 A;  4WYL A;  3CJ2 A;  2BAB A;  4ZVQ B;  3UDE A;  4ERD A;  4X4T A;  1BQM B;  1MN7 A;  4YN3 B;  2RS8 A;  4MKY A;  2MKY A;  5D0E A;  4DSF A;  5HN0 A;  2LXI A;  4JI3 J;  4AQY F;  2Y8Y A;  1MLA A;  5B09 A;  1H3D A;  3NNA A;  1R0B G;  2AJ4 A;  3MFI A;  3K5M A;  3H5U A;  3POT A;  5KFY A;  5KFD A;  2PA8 D;  1VRT B;  1QE1 B;  5C5J A;  2BE9 B;  2MQ8 A;  4C8O A;  2VG6 B;  3T5L A;  4JV0 A;  4DSI A;  1VYA A;  1TL1 A;  2AWZ A;  3RB6 A;  1HW8 A;  3C46 A;  4P2X A;  3OXL A;  2H4Y B;  1QSY A;  1LKZ A;  1XR7 A;  4EBE A;  5B0E A;  2XSJ B;  1SJ4 P;  3IP0 A;  3MHY A;  3WQP A;  3HX9 A;  4ZMM A;  3JXO A;  4Z2X A;  3CW2 C;  2I8E A;  4C11 B;  1SUQ A;  3U02 A;  2U2F A;  2FHK A;  4KGM A;  2V8D A;  1FKO A;  2C22 A;  1TKD A;  4O3S A;  1FE0 A;  2ZUG A;  3BGR A;  4WYW A;  4TY8 B;  3LWL A;  3KLG B;  4UUW A;  2YX7 A;  3PFO A;  3HPO A;  4Q8E A;  5KT7 A;  2EPI A;  5BYS A;  1VQP S;  5CD4 A;  4DXL A;  4OIX A;  2ILZ A;  1QM9 A;  3SXL A;  2K1R A;  3JS9 A;  1NAQ A;  4OX9 J;  1NJZ A;  3DMJ A;  2YKQ A;  2KXN B;  3AD9 C;  2EVZ A;  2C2D A;  2R2T A;  2V4Q A;  3HM9 A;  3AB4 B;  3OVA A;  3CJ3 A;  2NUU G;  3VAF A;  2KKH A;  4IFV A;  2EKN A;  4TU7 A;  4AD6 A;  3IBF B;  5ADZ A;  3DOL A;  1XMQ J;  5LSL A;  1NJY A;  2ASD A;  3LW5 C;  4GVB B;  1NDC A;  4L74 A;  3VHQ A;  4ANE A;  3T1A A;  1NB2 A;  3KTQ A;  2AEJ A;  1X31 C;  4O3N A;  1W25 A;  4WFB Q;  4P71 A;  1ELO A;  4CH1 A;  1Y3K A;  4GC6 A;  4OHW A;  1DZ5 A;  5H1S V;  1TVR B;  4F0M A;  5DDP C;  2XGQ A;  3G8S A;  2RUS A;  4ZOS A;  2XZT B;  4Y2K A;  3CCQ S;  4FYV B;  4ID5 A;  3NAH A;  4OYZ A;  4HT5 A;  3NBP B;  4MJK A;  3MEC B;  5GAD U;  1RIS A;  5IT9 Y;  1Q53 A;  2LLZ A;  2WAQ D;  3CGI A;  4B9V A;  2X7I A;  3G71 S;  4JI2 J;  1FTR A;  1L3T A;  3IBW A;  2JEI A;  3BKF A;  3HHK A;  5ETQ A;  1FJE B;  3KLF A;  2RDD A;  4CH7 A;  3DRX A;  1KQF B;  2CQD A;  4IG3 B;  3HFZ B;  4LRB A;  1NDK A;  2IA0 A;  1U8W A;  1NB7 A;  2HK3 A;  3CCU S;  4MYT A;  4DPT A;  4J37 A;  3I4P A;  1MU2 A;  1RYS A;  1IJE B;  4NI2 B;  1RWN B;  2CPF A;  4M5M A;  1KTQ A;  4RW9 B;  1CJU B;  4CO3 A;  1WWH A;  4C7Q A;  4CYU A;  3EGW B;  4JUZ A;  4J9P A;  2QJ3 A;  3QZ7 A;  3J7A N;  3I5A A;  2VH7 A;  3QYY A;  1GX5 A;  1Q16 B;  3IAM 9;  3GU0 A;  3H5X A;  2B6A B;  1FXL A;  4OX7 A;  1DTT A;  1RLC L;  3JSM B;  1FER A;  1RAB B;  2VC0 A;  1S12 A;  2YVS A;  2V69 A;  2DNN A;  4AUK A;  2WVB A;  3GWC A;  3GYN A;  1X5S A;  5IV4 A;  3R5C A;  2D3O R;  4ZPD A;  3IFE A;  5KFM A;  2QMW A;  2QLJ B;  2GIR A;  1V6H A;  1JJC B;  1JLG A;  3A8E A;  1NDP A;  2R8I A;  2B9W A;  3IGV A;  1YTY A;  3Q86 A;  5L1I A;  3EYZ A;  4MYU A;  4V19 X;  1IWG A;  3G86 A;  4DL6 A;  2FJE B;  1NSP A;  4TY9 A;  4DWI A;  4NWB A;  1WAC A;  3S01 A;  2VA2 A;  4WFX A;  3H2V E;  2C2R A;  2ZFH A;  4X4U A;  1FK9 B;  2HHU A;  2VA3 A;  4DR5 F;  2G1D A;  1G6B A;  1NPK A;  4WE1 A;  4KHM A;  2HND B;  3CCV S;  3ELH A;  3RBZ A;  1ZBT A;  1S5Z A;  4M5I A;  5LMN J;  3AJ1 A;  5B08 A;  2B4V A;  5DQH A;  1KSP A;  4LF4 J;  4RZR A;  2OEK A;  1PCA A;  3HHL C;  3NNH A;  2V50 A;  1R0A B;  5GMK a;  4LF1 A;  3H20 A;  4C9D A;  1CC8 A;  4TLQ A;  2FHM A;  3W9H A;  1T0T V;  4BDP A;  3R3T A;  2EBE A;  4P2S A;  4EU0 A;  3K5L A;  3GB0 A;  2KT3 A;  1F60 B;  1NZ8 A;  2CPD A;  2JEF A;  2UXB J;  4K2X A;  1SPB P;  2Z2Z A;  3LP2 B;  3VAI A;  5F8G A;  2V68 A;  1QAX A;  4HTJ A;  2G0C A;  4UT4 A;  5E5N A;  2LCW A;  4RW4 A;  2RDI A;  2MZ1 A;  1PYS B;  5D4N A;  4DR3 F;  1HNZ J;  2HFU A;  2KHC A;  1DLO B;  3PV8 A;  5F8J A;  4PRF A;  3FFI B;  3WC0 A;  2OUG A;  4KFB B;  2ZD1 A;  3W2V A;  3LGH A;  3AA9 A;  3EVO A;  1S79 A;  5KT3 A;  1A9N B;  3JSB A;  4ZHR B;  3OFG A;  3MPD A;  5EWF A;  2MKI A;  1Q78 A;  3EPG A;  5I42 B;  3M8R A;  3ETO A;  2VKR A;  2DO0 A;  1FVQ A;  2C3M A;  1CJK A;  4DQI A;  2H51 B;  2MKS A;  1KFD A;  2W9C A;  1NBE B;  3TWZ A;  5IQ6 A;  2KYZ A;  2WZ1 A;  4K50 A;  1S76 D;  1IKX A;  5FDL A;  1QUP A;  3MM5 A;  4ER8 A;  3DCA A;  1TKX A;  2LA4 A;  1MRO B;  4OYI A;  1S1W A;  4IOA Q;  5F41 A;  4NRU A;  1U25 A;  3A3N B;  2Z30 B;  2XNQ A;  1JJ2 R;  1WF2 A;  4LIW A;  2DIU A;  4CLP A;  3NWR A;  3BO3 A;  1UMJ A;  3EGV A;  1YJT A;  1HBO B;  4U7C A;  2W7O A;  3EZO A;  1N56 A;  2MQP A;  1KVI A;  3DU6 A;  2ZNY A;  2LVW A;  3UDV A;  5GMD A;  4WF9 Q;  2BZ2 A;  4JI8 F;  3F44 A;  3DI6 B;  4PUO B;  1RCO B;  3OD2 A;  1HIY A;  4LFB J;  3GYX B;  2JVR A;  1MMD A;  2AJ2 A;  2YKM B;  1NSK L;  1M1H A;  4DL7 A;  1YGY A;  1XBW A;  5A8K A;  2HFV A;  2VV5 A;  1UPP A;  4EGL A;  3SCL E;  4IRC A;  2A2D A;  3BBB A;  4OZN A;  2DNQ A;  4CLU A;  4B3R J;  2HNZ A;  4WKY A;  1WKJ A;  1WC4 A;  2HBZ B;  5MLC V;  3IGN A;  3KNG A;  4MIA A;  1N33 J;  2RHS B;  2E1R A;  3RB0 A;  4LQ3 A;  3JTN A;  3HT3 A;  4H4K A;  2DH9 A;  3J80 U;  1D3W A;  3BSA A;  3M2U B;  5F8M A;  2XNR A;  2DNH A;  5IC6 B;  4NCB A;  3W2W B;  3IWN C;  2QV6 A;  3BZQ A;  4NZ6 A;  4WPA A;  3QT7 A;  1UJ6 A;  2D3U A;  1FRK A;  3UN3 A;  3X3U A;  2ZNZ A;  4OV1 A;  3CUN A;  1AB8 A;  2C2Z B;  3NLC A;  5AXM A;  3MEE A;  1AFI A;  4DN9 A;  4NLG A;  1VJW A;  1SH2 A;  2FJV A;  4GO7 X;  5KFQ A;  2QL5 B;  2BAN A;  2IM0 A;  2V9K A;  1P27 B;  3KUE A;  2XLJ A;  3HKZ D;  1NK8 A;  1Q0N A;  1DBD A;  4LRE A;  1S6U A;  4NL5 A;  4LSN B;  3BB5 A;  4NAS A;  1O5J A;  5KFG A;  3RBE A;  1SKW A;  3C6T A;  1T9X A;  2B4U A;  5FJ4 A;  4ED4 A;  1S1T B;  2V34 A;  1YJR A;  3SEO A;  2NXU A;  3T1Y J;  1I1G A;  1EET A;  3PVX A;  3M1V A;  5F3T A;  3QJP A;  2W7P A;  4J5O A;  1YZ7 A;  4DV1 J;  2VON A;  3M32 A;  1T9U A;  4FYX B;  2ADB A;  2CZ4 A;  1X9W A;  3LTO A;  1L5U A;  2H5I B;  2LQB A;  2OD6 A;  5THW A;  4ZLJ A;  4I2Q A;  1XNQ F;  1QTN B;  1HNW J;  2VOP A;  4CLZ A;  4DEZ A;  1YI2 S;  2XS5 A;  2QA2 A;  5KFI A;  2WB4 A;  2CDQ A;  4LR8 A;  2E5H A;  2J8A A;  5EWE A;  2QTW A;  2M3D A;  3RGI A;  3GIR A;  3ULH A;  2JEJ A;  2HMI A;  3CJK A;  1RWX B;  3J7Y I;  5T14 A;  1ACM B;  2RU3 A;  3MDF A;  1FTC A;  5IM0 B;  1QLN A;  2EWH A;  3PW7 A;  2Y3Y A;  3CDE A;  4F8R A;  1UEK A;  5KOW A;  2RE1 A;  2C2O B;  1NJX A;  2M4M A;  1T11 A;  1XNR F;  4IH5 A;  2WB1 D;  1Y4Z B;  2D7S A;  1Q8K A;  1HWI A;  5HMX A;  3I0R B;  2B0G A;  3DRR A;  3OLA A;  2J7U A;  4K59 A;  3R2D J;  1NXI A;  4QW9 A;  3KKF A;  4BS2 A;  3OFE A;  3MCM A;  2DGO A;  1D9D A;  2D74 B;  4USK A;  1BMQ B;  3ADA C;  3AAW B;  3GMG A;  4YEA A;  4R5P A;  4KB7 A;  4LMZ A;  2RT3 A;  1TZ0 A;  2HUR A;  1N6Q B;  2J9E A;  3VAK A;  1URN A;  1CEZ A;  2C3O A;  4KE5 A;  4DJB A;  4QIE A;  4X4R A;  2QLX A;  2W1B A;  1BE4 A;  3PRD A;  1APS A;  2ZH1 A;  2Z57 B;  1VK3 A;  5HI7 A;  3OVS A;  5KFO A;  1CPZ A;  4J9U E;  4MTP A;  2ZZM A;  5FII A;  3GV8 B;  1N32 J;  2HNY A;  1GMU A;  3Q0A A;  1SXL A;  1G4C A;  4ZVE A;  4F3Q A;  5CA5 A;  4DS5 A;  1WHY A;  2OMO A;  4WCE Q;  4QWA A;  4RNF A;  2K3I A;  4F2R A;  2ATC B;  2EI5 A;  3L7P A;  1RTJ B;  4ZPW R;  3DLH A;  5DRK A;  1X4G A;  1MG7 A;  2HLT A;  4DG1 B;  2VG5 A;  3FQL A;  2PD1 A;  4ZP7 A;  4QR1 A;  2W7A A;  2CNO B;  4J9M A;  5DM6 Q;  5HP1 B;  2VD3 A;  3GE9 A;  4D3G A;  3IWL A;  5LXY A;  3R1H A;  4DUT A;  3V2U C;  4FDF A;  4YQW A;  1X4F A;  5F0W A;  2DHH A;  4WK1 A;  3SCK E;  4DF8 A;  1S1U B;  4MIB A;  2HBR B;  1MW7 A;  4ZPC A;  4RW8 B;  2CZ9 A;  4OYA A;  4HHH A;  4LF9 F;  4N41 A;  4LF7 F;  3NRB A;  3H42 A;  2R8G A;  1KN6 A;  4DMZ A;  2ZBP A;  4DV5 J;  2CUY A;  3K8V A;  1S57 A;  2COL A;  2YNF A;  4E8U A;  3PIP Q;  4H4O A;  4LF5 J;  1LXN A;  2BE7 D;  5JVH Q;  5C24 B;  2J7K A;  4H4K C;  4YHH J;  4IG0 A;  4DL5 A;  4IH7 A;  4W98 A;  1HQ2 A;  3W65 A;  4NZ7 A;  5IT0 A;  2IM2 A;  3TZW A;  1RHM B;  4K0K J;  1YBT A;  4P74 A;  3JQJ A;  1NKB A;  1S6P A;  2W01 A;  4M5J A;  8RUC A;  4XDC A;  4KGK A;  2ZBI A;  3HHN B;  3CXC R;  4B3O B;  2AYE A;  1TUW A;  2KI2 A;  3L3C A;  3ZXW A;  4Y0F A;  5SZT A;  3MTJ A;  4DFP A;  2F3J A;  1K0V A;  3Q89 A;  1C0T B;  3C3L A;  4JI3 F;  3AOA A;  3BBF A;  4CLS A;  4O0I A;  1U1K A;  2XMU A;  3BPD A;  2AEF A;  3OL6 A;  2V8H A;  3QFW A;  1S9E B;  4DUZ J;  4ENO A;  4OJ3 A;  1OS5 A;  4LFC J;  4ZLN A;  4A47 A;  1KR4 A;  1RHU B;  1DUR A;  1HBM A;  3UW1 A;  1EQM A;  2UUA J;  1R27 B;  3CPW R;  4WZQ A;  1JX4 A;  3MCO A;  2DRB A;  4U7U D;  4HKQ A;  1WF0 A;  4QIG A;  1RT3 B;  4FKX A;  1V3R A;  3UPF A;  4XO0 A;  1UET A;  3ZC4 A;  3BJY A;  4JI0 J;  3BO4 A;  4F04 B;  4ZDN A;  1KDN A;  1HQU B;  1UA1 A;  1D0E A;  4NLO A;  4QOT A;  4X4S A;  1HR0 J;  2L48 A;  4YR2 A;  5RUB A;  3CJQ A;  3BKU A;  3KYL A;  4FVC A;  4EEY A;  2HIQ A;  4OX9 F;  1VJQ A;  3THT A;  4IRK A;  2HHH J;  1M5S A;  3MOJ B;  3RB3 A;  1E6V B;  5ETM A;  4KO0 A;  1SBR A;  2ZE2 A;  2GVZ B;  3CMQ A;  3OJU A;  2ZWO A;  3PYD A;  5J1E A;  2IBO A;  2F4F A;  2XLI A;  1RT4 A;  1JKH B;  2WSC C;  3PCO B;  1RTD A;  3KHR A;  4DR4 J;  1XMQ F;  2O01 C;  3Q23 A;  2LXU A;  1LWE A;  4RNO A;  3EE3 A;  2F1F A;  1SKU B;  4LF6 J;  2HYI B;  2BBE A;  2AZ3 A;  4KQZ A;  3B4D A;  3KG0 A;  3JSY A;  1OY9 A;  3MR2 A;  4P75 A;  3KUH A;  2WW8 A;  4O44 A;  3VZI A;  3M2V A;  3PJ9 A;  1V5V A;  3BQ2 A;  3BN4 A;  4EI2 A;  1Q81 T;  2B5J B;  3CB4 A;  4RBU A;  4PKD B;  3O8W A;  3T9Z A;  4WP9 A;  3D9B A;  3HVA A;  2HHS A;  3R2C J;  3OT9 A;  1KBR A;  1MN9 A;  1UVM A;  1X0P A;  4WFA Q;  3OFF A;  2XSF A;  4A8W A;  3B8H A;  5E3C A;  4TQS A;  3VGV A;  3QO9 B;  2PMZ D;  2CQH A;  2DPJ A;  2B51 A;  2M8H A;  1AW0 A;  4JI2 F;  3IS9 B;  1NDL A;  3DGP B;  2M2B A;  4DCJ B;  1M90 T;  2AJ0 A;  1U1L A;  5M2U A;  4PG7 A;  1O8B A;  1YBA A;  5K8P A;  2GV1 A;  2M52 A;  1F3V A;  1IBC B;  2J0X A;  2WHO A;  2MEW A;  2W4P A;  2FB0 A;  2IJN A;  1K8A T;  2BV3 A;  1TFY A;  3N0V A;  4L73 A;  3M2R A;  2W9B A;  7FD1 A;  5EGY A;  2H1Y A;  3PZP A;  1REV B;  4J9N A;  1S4E A;  3T6B A;  5KOX A;  5DM7 Q;  5K20 B;  3B82 A;  4RWW A;  1U2C A;  2NYI A;  1GH8 A;  2R8H A;  4ATN A;  3O1L A;  1JLA A;  4PEO A;  3KLE B;  3AB2 B;  2RU9 A;  3IR7 B;  1YJV A;  2V63 A;  3NY0 A;  1UP1 A;  3VV2 B;  3D6M B;  4DZ6 A;  2MZR A;  1S7I A;  4IFY B;  5HSP A;  4J9S A;  3TZY A;  2G4B A;  1J5O A;  3OSN A;  2HEK A;  3MEG A;  5FLX Y;  3VQT A;  4I4B A;  1FF2 A;  3O5T B;  3P8B B;  3PW2 A;  3QAE A;  3TQE A;  1AZS B;  1CQM A;  1CS4 A;  1S9G A;  3R9L A;  1KRP A;  1I5O B;  1DTQ B;  1N4L A;  2DIS A;  1HBU B;  1AUS L;  3MM7 A;  2ZC3 A;  1PJ5 A;  2BQR A;  3AD8 C;  4ZN1 A;  5E3A A;  3V6D B;  1YJW S;  3KG1 A;  2VFR A;  4NLT A;  2ZUA A;  4RKU C;  3CJ5 A;  1J5E J;  2XEX A;  2DPI A;  1GQE A;  3DRS A;  4WIQ A;  3O44 A;  2V2Q A;  1KS2 A;  2FY8 A;  1NKE A;  3M9N B;  1MSW D;  1S1X B;  1F3F A;  2Q43 A;  1RTH A;  3QIP A;  1S97 A;  3FK4 A;  1TQL A;  1HD0 A;  3G82 B;  2R7O A;  5LMN F;  3DLG B;  4ED1 A;  2FGC A;  1RWP B;  2E5I A;  4MFB B;  3JYT B;  5I4M A;  4LF4 F;  3D67 A;  5KG4 A;  5K8M A;  2GVD B;  4DI6 A;  1C1B A;  2EC0 A;  1HNV A;  1YBU A;  1XMO J;  3KXD A;  3ITH B;  5KG2 A;  3D6H B;  1TKZ B;  2OAU A;  1HI0 P;  4PYA A;  4YP3 A;  1B0V A;  1WUU A;  4ZIV A;  5K5M A;  1JLE A;  5B0G A;  1T03 B;  3R8Y A;  4HT7 A;  2UXB F;  3DOK A;  3KK2 A;  2PFF B;  6FDR A;  1HWL A;  1VI7 A;  3J7Y U;  1CQN A;  1Y7P A;  3WBZ A;  4L6V 3;  3HI9 A;  4JB8 B;  4ZVU B;  4TYB A;  1NKC A;  3OR1 A;  2VBX A;  5AXL A;  2F9J A;  1HNZ F;  2B4O A;  3CMA S;  4PQU B;  2KDO A;  2E5J A;  3CIM A;  3MD3 A;  2DEI A;  4Y00 A;  4CP5 A;  3C66 A;  4WTO B;  3CT9 A;  3SQO P;  4NCG A;  3BF4 A;  4MIW A;  3MI7 X;  3PX4 A;  2QSF A;  4A4J A;  1SB6 A;  1RA6 A;  2Q79 A;  3JTO A;  2ASL A;  5J2P B;  3N5F A;  2ZOF A;  4YME A;  2RRN A;  5T7L A;  3I9V 9;  5KAK A;  3D0H E;  5C42 B;  3M8P B;  2QX0 A;  4K4S A;  1HNX J;  3JAM Y;  2AYB A;  1H2U X;  4RBT A;  1KVK A;  3FBC A;  4DX6 A;  2ZDP A;  4TKT A;  3HUL A;  5IT4 A;  3CCM S;  5J2N B;  2DH7 A;  1YKW A;  1T9V A;  3IC1 A;  1FJ7 A;  2HFS A;  1LW0 A;  3RJM B;  4NLP A;  2MGZ A;  2BX6 A;  4K7Q A;  1RTI B;  3K2Y A;  2P2C B;  3EGN A;  1HNI B;  3QWU A;  1B0T A;  4IQX A;  4P10 A;  1KTV A;  2X3D A;  3O3L A;  2GGP B;  2C3Y A;  4QYZ J;  2C1E B;  5F9N A;  1RU1 A;  5G4D A;  2CAJ A;  3I31 A;  3Q2T C;  2CJK A;  4K4Y A;  4NLY A;  4GRS A;  4W92 B;  5BYR A;  1WKK A;  1HHQ A;  5E2Q A;  3ETM A;  1K0T A;  3UN2 A;  2VF3 A;  5HAT A;  2ZH9 A;  4AQY J;  1C0U B;  3SDE B;  3NP5 A;  1VLY A;  4OZL A;  2M7S A;  3DHW C;  2DXE A;  3CCS S;  1EKR A;  2XYP B;  4H4M B;  1U1N A;  2A1B A;  1R8B A;  3UFC X;  4QJV A;  3G96 A;  1P1T A;  4NYP A;  3EZU A;  4JI6 J;  1XMB A;  3PIO Q;  2FIU A;  3C14 A;  2RJZ A;  5FLX U;  2VBW A;  1RWW B;  3KMQ A;  2CIM A;  3T3F A;  1B64 A;  4B3R F;  1X5O A;  1U47 A;  1HWJ A;  1UKU A;  4MKA A;  1RHJ B;  1N33 F;  3RRG A;  2M70 A;  3QID A;  2FY1 A;  2XMV A;  3F73 A;  2OPQ B;  2QSW A;  3UD3 P;  4DDF A;  1Q8I A;  1BQX A;  4HYK A;  4UY8 5;  2LU1 A;  3SMZ A;  5CXT A;  3TAP A;  1NPP A;  4ZCK A;  4IUF A;  1WI8 A;  5D3G A;  3AQP A;  4PXE A;  4U9R A;  2J76 E;  4NEY A;  4DR1 J;  1U2R A;  2Y1I A;  1F1B B;  2GZO A;  5LL6 d;  4DV2 J;  2ZIT A;  3KMS A;  2Y1R I;  3IG1 B;  2VUG A;  3QLH B;  3CWJ A;  3AY0 A;  4E98 A;  1XN9 A;  4C3M A;  2FTR A;  7FDR A;  1YJ7 A;  4ED3 A;  1RCX B;  1N5Y B;  3W9I A;  2F8E X;  2VFU A;  2HIY A;  4NX9 A;  4WZM A;  2MQN A;  2DIV A;  2DNZ A;  2UU9 J;  3CO0 P;  2HVH A;  2UXC F;  3PY8 A;  3UVJ A;  2HVD A;  3GPA A;  3TZZ A;  3RRH A;  1ZM3 A;  3W1Y C;  2PGC A;  2POK A;  1CJV A;  2VFT A;  3MMA A;  3D1H A;  2WSE C;  2JEG A;  3MUM P;  1PAU B;  3MM8 B;  4OYM A;  1LK7 A;  4L76 A;  5L1J A;  1HWU A;  2ASY A;  1BHN A;  4B17 A;  3D1Q A;  3T1Y F;  1RT7 B;  3K5P A;  3EZ5 A;  2OTJ S;  2VG6 A;  5KFK A;  3MUV P;  1F5B A;  1RAF B;  1JLQ A;  3R7N B;  2WCX A;  3R97 A;  5M2R A;  4RWX A;  3VR1 A;  1WOO A;  3PYG A;  1YRU A;  5KFX A;  4ZIW A;  3I5B A;  2NZC A;  4NXM F;  2XSJ A;  4ICL A;  3HDS A;  3PHE A;  3U7J A;  3NMR A;  1U24 A;  3ZZR A;  4OHY A;  1GX6 A;  2YKN B;  2D9O A;  3C15 B;  1MML A;  2ZOG A;  1HNW F;  2YNI A;  1M5H A;  3D66 A;  3GR1 A;  3GJR B;  2HQC A;  1XK8 A;  3WIV A;  1HPZ B;  2DR9 A;  1HBN A;  2AJF E;  2Q6C A;  3GIL A;  4OI1 A;  4J7C A;  8AT1 B;  1CJT A;  3JAM U;  4LF8 J;  3EJM A;  2MKC A;  4W4M A;  2P8I A;  3FNN A;  1PBA A;  3HSZ A;  4I0W A;  2H48 B;  1N88 A;  5E7O B;  4KJI A;  4ELU A;  5A0Y B;  4PQA A;  4KPY A;  3MGJ A;  4F0H A;  4NE9 C;  2Q6B A;  3P5B P;  3W8G A;  2VOD A;  3W60 A;  3MMC B;  5A8R B;  3PO4 A;  1VQO S;  2FLN A;  1L3S A;  4RUC A;  4GVB A;  4OI6 A;  3B78 A;  2OLW A;  2MQL A;  5I3U B;  3CD6 S;  1RLD A;  4OI2 A;  4PWD A;  1T05 B;  3PW4 A;  2J7W A;  2WK4 A;  3Q8R B;  2KN4 A;  4WJB A;  5HMZ A;  3KUG A;  2YWE A;  5L8R C;  1WHX A;  2N82 B;  4YUD A;  4LR9 A;  5DGA A;  5KFA A;  4M5K A;  5D15 A;  2V0N A;  1H7X A;  3ILI A;  2FC9 A;  1SIZ A;  2ZC4 A;  3TRG A;  5GAE I;  2H9Z A;  1RYR A;  1TKT B;  3VAJ A;  1BC6 A;  1PIE A;  4C0B A;  1LWX A;  3ILL A;  3SIP B;  3F56 A;  2XMJ A;  4TU8 A;  5A6W A;  1QAI A;  4JP8 A;  1N32 F;  4DV0 J;  1Y5N B;  3MEC A;  3OTE A;  2FLL A;  2ZVS A;  5D6G A;  4F4A A;  2DHG A;  4HEA 9;  3SFU A;  2XM3 A;  2FZK B;  2PO4 A;  2G2Z A;  2HHX A;  1H73 A;  3POT B;  1IWA A;  2ZH6 A;  3IRX B;  2HZA A;  1NU4 A;  4LFA J;  1TL1 B;  1T3N A;  4RW9 A;  2BJ9 A;  2F4V J;  2GJI A;  1CJU A;  1WHV A;  1NO8 A;  2CG8 A;  3M6U A;  2A3J A;  2UUB J;  4RU9 A;  2GMJ A;  1HI1 A;  2YX1 A;  1IBK J;  1SUQ B;  1FDN A;  1X9S A;  2CQ3 A;  1FKO B;  5HLF A;  3LA0 A;  4IYQ A;  4P73 A;  2AV5 A;  3NGD A;  3BV8 A;  2JWN A;  4DPU A;  2LMI A;  4OYP A;  4NLS A;  2R8J A;  1X5P A;  4ECX A;  2C2N A;  4DV5 F;  3UCG A;  2YKA A;  5BXI A;  2OSR A;  2K1R B;  2E66 A;  4LF5 F;  3PEJ A;  2NUH A;  3DMJ B;  2BEF A;  3NEK A;  1ICE B;  1S49 A;  5D4O A;  2PA3 A;  3R6G B;  5BR8 J;  1GK8 A;  5K8N A;  4YHH F;  2KVI A;  1U48 A;  2HSE B;  3PTW A;  2FVP A;  1VS3 A;  1Y3J A;  3HLU A;  2MDA A;  4Q44 A;  4K0K F;  4IFV B;  1WDT A;  3TZX A;  1VQ6 S;  2ZBQ A;  3GYG A;  4UST A;  2YPY A;  1L3K A;  3M6V A;  1RT1 A;  3DOL B;  3M6W A;  1S0V A;  2V2Z A;  1Z4U A;  4XK8 C;  2MXY A;  2W8L A;  4ETX A;  4C0H A;  1PC4 A;  1TMM A;  3IR5 B;  2Y0B B;  4B08 A;  2JH3 A;  3OBI A;  4BCA A;  1T3O A;  2ZH4 A;  4LRC A;  1C4A A;  4K4U A;  2MLY A;  1NME B;  1OPZ A;  2D1C A;  3H0P A;  1IXK A;  4G1P A;  2HND A;  4M5N A;  2DNK A;  3W64 A;  4YFU A;  4EYH B;  3FZB A;  3FMB A;  4LFC F;  1NEE A;  3O6Q A;  3DFE A;  4FNH A;  2DR6 A;  4EZ6 A;  4O3R A;  4HI2 A;  4ID5 B;  5DZ7 A;  1R0A A;  4RU2 A;  2RH3 A;  5KFC A;  3ICL A;  2UUA F;  1S9F A;  2J6T A;  4M5L A;  3H98 A;  5KFV A;  3TQ1 A;  1FE4 A;  3CCJ S;  2DKO B;  2YQ1 A;  4Y2A A;  3TJ9 A;  2V2K A;  3I56 S;  3LP2 A;  4JI0 F;  3KLF B;  4JYA J;  1OYD A;  1U49 A;  2RIL A;  1H72 C;  3HSG A;  5CQG A;  2DH8 A;  3QQC D;  2RDJ A;  4XIU A;  1WNE A;  2YWK A;  1HR0 F;  3MMB A;  2CJQ A;  1T94 A;  3QT5 A;  1HLW A;  1FHT A;  4K4X A;  2HHH F;  5CZV A;  2V4J B;  2VFV A;  4I2P A;  1OO0 B;  2DGU A;  4FBT A;  2Q66 A;  6AT1 B;  1DLO A;  1OJ4 A;  3FFI A;  5J2Q B;  3UWT A;  2BDP A;  4KSE B;  4CYU B;  4LUB A;  3KJV A;  2CPX A;  5KFT A;  3K5N A;  2VIH A;  1SL0 A;  3M8W A;  2ALY B;  4FVM A;  4RBV A;  4AE5 A;  4N76 A;  2E5L J;  4DR4 F;  1DTT B;  2NXE A;  4P6Q A;  2NYH A;  3D3B J;  2EK1 A;  3ZO7 A;  5HO4 A;  4WXW A;  1SC1 B;  3HCX A;  1TV6 A;  2HHV A;  3K17 A;  4KTQ A;  1ZPV A;  4I67 A;  2KFZ A;  4LF6 F;  2D69 A;  3KNA A;  4X4V A;  1HWK A;  3ET6 A;  1F6T A;  2IMW P;  2WTF A;  2QT7 A;  1K73 T;  5D0G A;  1RDR A;  1VK8 A;  2VBZ A;  3MTK A;  4B3T J;  1PYO B;  4Y34 A;  1JLG B;  3NS6 A;  1MWZ A;  3QSI A;  1X4E A;  3FVY A;  3EXY A;  1OQ3 A;  1S77 D;  2HQF A;  5ETT A;  3K57 A;  3W5X A;  3QGG A;  2V67 A;  1N0V C;  4WFN Q;  4OQJ A;  5KTQ A;  2QFI A;  3HXM A;  3SV4 A;  3EXC X;  1VDH A;  3HFK A;  1H7W A;  3CME S;  1K1Q A;  1HBO A;  3M7V A;  2GIF A;  1R7I A;  2HWH A;  1ZOT A;  4DV7 J;  4WXO A;  1WOS A;  4OZ5 A;  2UVW A;  2ZH8 A;  2R7R A;  4DBQ A;  4C0O C;  1DQ8 A;  4AL7 A;  2HGN A;  1RSC A;  2CQ0 A;  2DIT A;  4M5H A;  1HQE B;  3SCJ E;  2ROP A;  4G3I A;  3RW7 A;  4B9M A;  3QGI A;  2ZJR Q;  1NCL A;  2ATL A;  4DZD A;  3DYA B;  3UNG C;  2Y9H A;  2ACY A;  3TVK A;  4U96 A;  5D0H A;  2QMX A;  2FLP A;  3A12 A;  1PG5 B;  3LPE A;  2EC2 A;  3MM6 B;  3A1Y G;  4ZPA A;  2ERR A;  2FUG 9;  3KK1 A;  1Q79 A;  1M5V C;  2ZZT A;  5IV3 A;  3SV3 A;  2MJN A;  1REG X;  2UP1 A;  1BUX A;  1XNQ J;  4P7T A;  5H9E J;  4C8Z A;  4RW4 B;  3M2U A;  5KT4 A;  4EBD A;  4R8U B;  2HS3 A;  2FVR A;  1JXL A;  3L4B C;  2UVR A;  2P6S A;  1C4C A;  4OI3 A;  1QVF R;  3Q22 A;  2PC6 A;  4K8R A;  4AND A;  4ILM A;  2R42 A;  2AGP A;  3NGU A;  3IMQ J;  4PPD A;  2QN6 B;  1S1V A;  2ZD1 B;  1VC0 A;  3ISN C;  4DLE A;  2AT1 B;  2FZC B;  3W2V B;  3OXF A;  1U0H A;  3CCL S;  2MB0 B;  1WC0 A;  5IQQ A;  4ECW A;  5GAG I;  2W9C B;  4V1A k;  1I94 J;  2B7B B;  5E3R A;  3D68 A;  4QWC A;  1WC3 A;  3FEZ A;  1RHQ B;  1IKX B;  5FDL B;  3MM5 B;  1H74 A;  2FJX A;  3HHE A;  2CPY A;  3T41 A;  1XQI A;  1S1W B;  1LV5 A;  1D8Y A;  3G8T A;  4O23 A;  2V8P A;  4J9R A;  3TW0 A;  2GFF A;  4DF4 A;  3GSI A;  1P9Q C;  1XMO F;  2P9E A;  5C2G A;  1IKY A;  3FSX A;  2V8G A;  3VCD A;  5AE3 A;  4KHR A;  2DCU B;  2QYG A;  4WWS A;  2IRX A;  3PYF A;  1FNM A;  3C16 B;  1RHR B;  2GJ2 A;  5L39 A;  3H2L A;  2XC9 A;  3G2X A;  1SH0 A;  3KHG A;  5KFH A;  2XLK A;  3D4J A;  3BGU A;  3WHI A;  4FPI A;  3QRR A;  1PIL A;  3QZ8 A;  3G6Y A;  4RW7 A;  2XO7 A;  3OV7 A;  4LVO P;  3JTP A;  1UTA A;  1IJF B;  2C42 A;  3H40 A;  2RRB A;  1T7P A;  2JL9 A;  1W2I A;  3MED A;  4F7V A;  3NG8 A;  2ZH7 A;  1PKU A;  1RI7 A;  4IR1 A;  1F2G A;  2WBR A;  5IM0 A;  3CO9 A;  5DDQ C;  5K9F A;  4ZP8 A;  1FWK A;  2E1A A;  2HNZ B;  1UWA A;  2XMM A;  1B70 B;  3AXK A;  3TYT A;  3V4I A;  5A2Q Y;  3KWM A;  2DGW A;  3WX8 A;  3TA0 A;  5IXU A;  1HNX F;  4FYW B;  3R1L A;  1FKP A;  3GG0 A;  4LF7 J;  1FWL A;  4OYW A;  3GJS B;  3FUY A;  4PXD A;  4URG A;  5GAE U;  2B43 A;  1AUD A;  4UF4 A;  2CXE A;  4NLQ A;  4PWU A;  1IM6 A;  4N5S A;  2YWG A;  2IIH A;  1N6Q A;  2C3U A;  2GQQ A;  1ZM2 A;  3MEE B;  3IA0 A;  1JXV A;  2CAD A;  1S10 A;  2CQ2 A;  3BR9 A;  3J7Z T;  2CNK B;  3OTD A;  3QRQ A;  4Z37 A;  1BGX T;  1C1C A;  5KT5 A;  3W8P A;  2BOP A;  2BAN B;  3BS9 A;  4LRD A;  4HDG A;  2CA9 A;  2RQK A;  2IJR A;  3EDR B;  2UUT A;  3BM7 A;  1UCN A;  2BOA A;  3M30 B;  3U27 A;  2LEC A;  2IYI A;  3DXS X;  3QNW B;  3V81 A;  2ZDO A;  3W3S A;  2BE2 B;  1RTJ A;  2VB6 A;  3C6T B;  1CLF A;  1EB0 A;  3W5Z A;  4DG1 A;  3DLE A;  2B8Q A;  2NCK L;  3IN5 A;  5LT5 A;  3Q8V A;  1U7L A;  4JI6 F;  3AA8 A;  1HHT P;  1MWY A;  2DJW A;  5HP1 A;  1N36 J;  2R7S A;  1R8A A;  5EUH A;  1RE1 B;  3QPI A;  4LSL A;  1ITP A;  2HG4 A;  1H6K X;  2VPY B;  2Z0G A;  3IAS 9;  3M32 B;  2ZWP A;  1VC5 A;  3H4B A;  1NUE A;  3W63 A;  1DFD A;  3TX8 A;  1X4B A;  2DY1 A;  4NYO A;  5KT6 A;  4AXJ A;  2W9A A;  5KG1 A;  4I2Q B;  4MT1 A;  4ALZ A;  1U1R A;  1K1S A;  2O1P A;  3UDC A;  3H8Y A;  2E29 A;  2P9C A;  2QA1 A;  4OYO A;  4QR2 A;  2BM0 A;  3ZTS A;  1WEY A;  1SC3 B;  4DHV A;  2V8V A;  3CJK B;  3OPK A;  4DR1 F;  5FD1 A;  1VRQ C;  2MHN A;  4DV2 F;  1MMN A;  3CE8 A;  3GV7 B;  5CHC B;  4QQB A;  4Q2M A;  3EM1 A;  4Y6I A;  2C3P A;  4HR2 A;  3ZZO A;  2PMW A;  4LRA A;  2UXD J;  3OLB A;  4DR7 J;  1F5A A;  5ETS A;  2QE5 A;  4P7V A;  5HRO B;  1UW9 A;  2BW7 A;  1TAQ A;  2GA7 A;  1T9T A;  3KJF B;  2UU9 F;  3MAQ A;  3WIU A;  3RYL A;  4USV A;  3DRR B;  2GO8 A;  3AFG A;  2BVZ A;  1Z2Z A;  2CQI A;  5KG6 A;  4R5P B;  4ECY A;  1WKL A;  2ZKU A;  3T5J A;  1JIH A;  4OZ0 A;  3DHX A;  2A18 A;  3HK2 A;  3W62 A;  1S9E A;  3D5M A;  1JLB A;  2X1B A;  4W90 B;  3X1L B;  3IR6 B;  1KKH A;  4X64 J;  4CO1 A;  1B99 A;  3ZTQ A;  2AMC B;  2R9L A;  4DLG A;  1VMB A;  5F3Z A;  1FKA F;  5LOQ A;  1H2T Z;  3FEX B;  3PFE A;  2OO4 A;  3IM9 A;  3OVB A;  4GKK J;  2I2Y A;  2X1G A;  4U67 Q;  1W26 A;  2QMU B;  3GFH A;  3OTO J;  3CJS A;  1RT3 A;  4P9S A;  1H0H B;  1YJU A;  3BKT A;  2AJQ A;  1HMV B;  2OPS A;  2V2V A;  4JI4 J;  2QL7 B;  1YHQ S;  2HVI A;  4MH8 A;  5A2Q U;  3ENQ A;  2VG5 B;  1GTE A;  2A6O A;  2HZV A;  2HW3 A;  1F0X A;  2DHX A;  3PHT A;  4HHU A;  1SH3 A;  3TVZ A;  4F4K A;  5CD4 H;  3A3O B;  4LF8 F;  1TTH B;  2BQU A;  2HBQ B;  1SJ3 P;  5CZX A;  3UNY A;  2HBY B;  2EBG A;  4DL2 A;  2L9D A;  3AXM A;  1U6F A;  4ES1 A;  3CCT A;  1VCT A;  2OKQ A;  3D54 A;  3SI8 A;  4QCL A;  1JKH A;  2W2M P;  1KWM A;  1DRZ A;  5T41 A;  4BBY A;  2BUN A;  4LR7 A;  4FYY B;  1FRX A;  1IBL J;  1KQS R;  1U45 A;  4DN0 A;  1EZZ B;  4ETZ A;  2D3O 1;  1K44 A;  2EFP A;  4DSJ A;  2CQ1 A;  3MPV A;  2YNF B;  2JLF A;  4PPZ A;  4YB5 A;  3M8Z A;  2YPZ A;  3H25 A;  4NXN F;  2VBY A;  5H9F J;  1Q95 G;  4F36 A;  4ZN3 A;  4PR6 A;  1Z1Z A;  4L3K A;  2WSF C;  4RNH A;  4IG0 B;  2B5J A;  1C2P A;  3OQ2 A;  4I7F A;  2DNL A;  1SC6 A;  2PI5 A;  4MK7 A;  4EMD A;  2WVE A;  3J80 Y;  2GAG C;  1IR2 A;  1S6P B;  3A8K A;  3HZE A;  2PI4 A;  4DV0 F;  1VRU B;  1RWK B;  2FJA B;  2W8K A;  4A8M P;  2CYY A;  4KH0 B;  5CH7 B;  5H9F K;  2Z2M A;  1N54 B;  4QWD A;  1SVD A;  2DXF A;  1QSS A;  1A6L A;  2HGM A;  2XHW A;  3AHP A;  2QIF A;  3IS9 A;  3CCE S;  3DGP A;  1SV5 A;  1ROF A;  2ZEJ A;  3R27 A;  4DPW A;  2KRB A;  2XGP A;  3U1L A;  1UFW A;  2LDI A;  1X7V A;  3LF0 A;  3CD5 A;  4QBU A;  4A8O A;  4RUA A;  3VAH A;  4ES2 A;  1U6B A;  3D6T B;  3TEH B;  5J1N A;  4LFA F;  2OD4 A;  1WD6 A;  5JXS A;  4ED6 A;  1HBM B;  4CDI A;  2F4V F;  4IR9 A;  3VZH A;  3A8I A;  2UUB F;  1WEZ A;  9RUB A;  4J9K A;  4FPR A;  2E44 A;  1IBK F;  4R0J A;  4USW A;  2VOO A;  2GML A;  2CJX B;  1RGV A;  2WON A;  1RBA A;  3B6B A;  1PBU A;  2BYC A;  3D28 A;  1LW2 A;  5L38 A;  4PAA A;  2MMY A;  5G0R A;  2B9X A;  5EDW A;  4ELV A;  1AFJ A;  2VPZ B;  4NA3 A;  1JLF A;  3I6P A;  4FS1 A;  3NOG A;  1P1L A;  4ELT A;  5BR8 F;  4YR0 A;  1ARO P;  1TL3 B;  4KO0 B;  1T95 A;  2ZE2 B;  2HQD A;  4CO5 A;  3N79 A;  1FJC A;  5GAG U;  5J1E B;  1RT2 B;  2WRM A;  4CO4 A;  1RT4 B;  1IR0 A;  2DGV A;  1RTD B;  3MCS A;  3S7R A;  4ZLP A;  3GII A;  2VQF F;  1LWE B;  1EJ7 L;  2I0X A;  3A8J A;  4CO2 A;  3CD0 A;  3JSR A;  4P72 A;  1S1X A;  2ZM6 J;  4O44 B;  3OHB A;  4DR2 J;  1F2H A;  4Y2M A;  2KU7 A;  5EHH A;  2CWK A;  3G82 A;  2OFH X;  3DLG A;  4C98 A;  5B0D A;  4CTA A;  3J81 j;  1S0N A;  1YIJ S;  4MFB A;  1IKW B;  2N4D A;  3MZI A;  1N52 B;  3DLB A;  1UZH A;  9ATC B;  2VKZ G;  3OFH A;  1S6Q A;  2IAJ B;  2LQ5 A;  1PGZ A;  2DR8 A;  3T5K A;  1ZZF A;  4C48 A;  1D9F A;  2NZ4 A;  1X4C A;  4Q0B B;  1LOU A;  3A3P B;  3T5H A;  1T03 A;  2ZZN A;  5LM7 E;  4JYA F;  1FNO A;  3UR0 A;  2Z58 B;  4O3Q A;  3L09 A;  2HHQ A;  2J5A A;  3NCR A;  5D77 A;  2AIR B;  4V19 J;  1UJ4 A;  3M2R B;  2LQ9 A;  5DQI A;  4USI A;  4KAI A;  3QJJ A;  3CC7 S;  4OL8 A;  2YY3 A;  3MM9 A;  3K8W A;  1QAJ A;  4F4Z A;  2XMT A;  3D0G E;  4ZKA A;  3G9C A;  4P52 A;  1N5T A;  3A13 A;  3RBD A;  4UZB A;  2HFZ A;  1B4S A;  4O4G A;  4QWB A;  2I5J B;  2E5L F;  4I1T A;  2HPU A;  4PXB A;  4QIW D;  1VQK S;  3AOB A;  2G1H A;  1HYS A;  3OL9 A;  3C6U A;  4KC5 A;  3CED A;  3OUY A;  1J5O B;  2ZHO A;  1UVK A;  1PC5 A;  4FP9 A;  1BY9 A;  3MEG B;  5J2M A;  2HHW A;  3M8P A;  3BN7 A;  1R8P A;  3OTC A;  4B3T F;  4KPC A;  1CS4 B;  4F50 A;  1S9G B;  2IVM A;  4LIR A;  3EGZ A;  1RT5 A;  2UVV A;  4C2M A;  5HVF A;  3MM7 B;  3UCZ P;  1RKJ A;  2MSS A;  3TUZ C;  4BHQ A;  1KLM A;  1WHW A;  1ZZN A;  4DSK A;  4KY3 A;  2IJF A;  3RBX A;  1TL7 A;  3OL7 A;  5KFW A;  3DRS B;  2R7W A;  1CC7 A;  4LJM A;  3A4T A;  3G4S S;  3ILJ A;  4O0N A;  3VQS A;  2DBB A;  2FVS A;  4LT6 A;  5C2C A;  2BJ3 A;  5KFU A;  4CRJ A;  1HAR A;  2UXC J;  3ENA A;  4DV7 F;  3Q8U A;  1XWL A;  3NWG A;  3QIP B;  3OSP A;  2V9W A;  2KL8 A;  1X4A A;  1T9Y A;  4DFM A;  4UY8 T;  3NKY A;  2GNK A;  1R89 A;  1BWE A;  1RZM A;  5A76 A;  1C0U A;  2L9W A;  1NK0 A;  4LRF A;  3DM2 B;  3EPI A;  1C1B B;  3R5D A;  4H4M A;  1OWX A;  1RU2 A;  1FNX H;  1HNV B;  4HHJ A;  5F8H A;  4ZPT R;  2VIC A;  3T6J A;  1LWC A;  3LAL A;  1SCJ B;  3HVT A;  2C2K B;  2W2O P;  2BR0 A;  5JVG Q;  1JLE B;  4ZLL A;  4F4X A;  4NXM J;  3DOK B;  3KK2 B;  3TX0 A;  1N5Q A;  2MKH A;  4URS A;  3KLH A;  2EG1 A;  3QGH A;  4BWJ A;  2UUW A;  1NK7 A;  2MZS A;  4CQ1 A;  3D1O A;  3R7S B;  2FJD B;  1LWF A;  1URR A;  3DLK A;  3EDQ B;  2KFN A;  4PAB A;  8ATC B;  2MLX A;  2YNH A;  4DOZ A;  4ZK7 M;  3VGS A;  3V6K A;  3GV5 B;  4I6A A;  2HS0 A;  5F8I A;  2P6T A;  3LP1 A;  2ZHB A;  4QU6 A;  2BAC A;  3WC2 A;  3S6E A;  4KGX B;  3LGM A;  4C8M A;  4FXV A;  1EP4 A;  4CNY A;  2MQO A;  2G13 A;  5KG7 A;  2ZH3 A;  2FD2 A;  3PAC A;  4Q8F A;  5T7L B;  1I94 F;  4A48 A;  4G1Q A;  4F67 A;  2B9E A;  2W4D A;  3KJQ B;  2LQJ A;  1VQN S;  3B54 A;  3DRP A;  2J6S A;  1JLC B;  1P8G A;  4CLK A;  3NMA A;  3LGN A;  1HHS A;  2MKJ A;  5KFB A;  3SYZ A;  2YX4 A;  4K4Z A;  1WG5 A;  4ANC A;  3V4M A;  3KDN A;  2CQ4 A;  2R8K A;  1LW0 B;  4JV2 A;  3PO5 A;  3MM8 A;  2YTC A;  4DU8 A;  2MGZ B;  5CCM A;  2AGQ A;  1YRT A;  1KVJ A;  2HQI A;  2L08 A;  3I0S A;  2Z2L A;  1FA0 A;  5GAH I;  1YG0 A;  1U1P A;  3BRE A;  1IKV A;  4JOU A;  2D41 A;  4IKA A;  4KGV B;  2W2N P;  3OW2 R;  5DDO C;  2MST A;  3GR0 A;  3MAH A;  3NL0 A;  3OJS A;  4NML A;  1E6Y B;  5EX0 A;  3EVM A;  1LQ9 A;  2DXD A;  4E0D A;  1ZA1 B;  3LAN A;  5AJ3 J;  1XER A;  3TJ8 A;  1JJ4 A;  2YNG A;  2XY6 A;  4FXW A;  4GKJ J;  1RB0 A;  3GJQ B;  2KM8 B;  3KK3 A;  1FEE A;  4DCO B;  1YJ9 S;  2QYC A;  3M8Y A;  3SSS A;  1S48 A;  3PEH A;  1L3V A;  3R6L B;  2JC1 A;  1YSJ A;  1EAY C;  4DX8 H;  1DY3 A;  2H54 B;  4ZVH A;  3N6M A;  3C14 B;  3J7Z 5;  4B3S J;  4CLY A;  3NXZ A;  5AE2 A;  4C8Y A;  3QMQ A;  2KTQ A;  5JUM A;  4XDD A;  4C3L A;  4FYD A;  1Y5L B;  4RO0 A;  5I3Q A;  2DY9 A;  2DNM A;  4WII A;  1SJQ A;  2OML A;  1NPR A;  2GHP A;  4QR0 A;  3DKD A;  2IC3 A;  3RW6 A;  3RR7 A;  2HHP A;  2NXN A;  2K3K A;  4HDH A;  4A8S A;  3CDU A;  3IRW P;  3SQG B;  4C6A A;  2IRU A;  5HBM A;  2JFD A;  1XEZ A;  3UD5 A;  4ED2 A;  2KB2 A;  4M95 A;  4ZJO A;  2D3Z A;  4ZCL A;  1U02 A;  1ZM9 A;  2O66 A;  3T19 A;  2WBM A;  2DEJ A;  2NR0 A;  4B9T A;  4X65 F;  4Y3C A;  1VQM S;  3SFG A;  4KKO A;  3K7R A;  2C2M B;  2IY5 B;  4FF4 A;  3ZZT A;  3MXH P;  3FEY B;  3MUT P;  2L3M A;  4ILR A;  3UVJ B;  2Z4P A;  2RKI A;  5KFR A;  4XPC A;  3ENV A;  3HHL A;  1NH7 A;  1CJV B;  3VF0 B;  3DN9 A;  1U1M A;  3MMA B;  2YKO A;  3FSY A;  4NCA A;  3E51 A;  1VQ9 S;  2AYG A;  1RAI B;  1YJN S;  2I38 A;  2JNJ A;  4UQT A;  1XTZ A;  1DQA A;  3IRX A;  2R2R A;  4M5D B;  4J9V A;  4M94 A;  4ZCM A;  1N36 F;  3AOD A;  3C8Y A;  3S8S A;  1JLQ B;  2APO A;  1FVS A;  3QJL A;  4ICL B;  3GCW P;  5IC4 B;  2V4R A;  4JI5 F;  1YVF A;  3I32 A;  2RAQ A;  1LK5 A;  3UO0 A;  5GME A;  4IOB A;  2E7X A;  2YNI B;  1N0U A;  4Q5V A;  5I3P A;  1X0F A;  2ZBC A;  2G2O A;  4DR6 J;  2YH1 A;  2JX2 A;  3KHH A;  4KYZ A;  1M5P C;  3S1T A;  3HT0 A;  4YY3 J;  3RAX A;  4RL1 A;  4UOH A;  2O67 A;  5LSO A;  1HBN B;  1CJT B;  3BR8 A;  2OP5 A;  2Y1J A;  3W7B A;  4CCH A;  4ZVT B;  3CDA A;  1UW4 A;  1X4H A;  3E8O A;  4U6P A;  3TAM A;  2LU2 A;  3FZ2 A;  4TNO A;  2NS1 B;  2UXD F;  1VBK A;  4DR7 F;  2CWX A;  1B0P A;  1W7W A;  1WEX A;  2PII A;  1NSA A;  3P49 B;  5CYM A;  3H7H B;  4F4W A;  4FN5 A;  1UZD A;  1GMV A;  1YX2 A;  1RT6 A;  5LMU J;  4LQ9 A;  2ZBR A;  1TUG B;  3FRY A;  3HHL D;  1U8S A;  1OIA A;  5CYJ A;  2KZM A;  1FXR A;  2N3L A;  4JV1 A;  3TAR A;  2J9C A;  4PWD B;  2XHC A;  3MAA A;  2MZQ A;  4HH0 A;  2BQ3 A;  1RAJ A;  1DAX A;  1Q7Y T;  2F63 A;  1R3N A;  1RAE B;  1WEL A;  4TVA B;  2EFV A;  1NK5 A;  4X64 F;  1D09 B;  4QZV B;  5C25 A;  2NQP A;  4ZP9 A;  1GFW B;  2RD5 C;  1YLX A;  4GKK F;  3RZA A;  3GQC A;  4NA2 A;  2ZH2 A;  4OYB A;  4F02 A;  4BC9 A;  1U1O A;  3OTO F;  2WOM B;  1B7Y B;  2MYF A;  2IRY A;  2IDL A;  5IWA J;  4JI4 F;  3E01 A;  2KG0 A;  1ULR A;  3RR8 A;  3GCX P;  5DET A;  1RAO A;  3L9Z A;  1WG1 A;  3UI3 A;  3C2P A;  3CJR A;  3BQ0 A;  1FJG F;  3NGS A;  4ZVO B;  1AA1 B;  2RF2 A;  3SSR A;  2CFX A;  1O0P A;  5KFS A;  4IO9 Q;  2G0J A;  5CYQ B;  3NS7 B;  2V4J A;  4N8O A;  1CSJ A;  1RWO B;  2IA6 A;  2VU5 A;  5J2Q A;  1VBZ A;  2JDJ A;  4FS2 A;  3HMJ G;  1UAW A;  2A2C A;  5CCL A;  2YQ3 A;  2MTL A;  2YH0 A;  3LAM A;  5JMN A;  5E3Q A;  2LEA A;  2QEX S;  5HLF B;  5BYQ A;  1IBL F;  2OPR A;  4AXI A;  2EFN A;  4RNM A;  3MCN A;  2XI3 A;  2YWH A;  3MOZ A;  4CLW A;  3SBM A;  4TU9 A;  1CVJ A;  5A6P A;  2F7V A;  1WG4 A;  2XMA A;  1BLU A;  3D3C J;  4DL0 C;  5CAB A;  1R6Y A;  2E1P A;  3NAI A;  2XMW A;  1VQ8 S;  4XAK A;  5B0A A;  2CZV C;  1Q8B A;  4A8F A;  2CNN B;  3D6F B;  4PG5 A;  2JOQ A;  4OZ2 A;  1I3O B;  3DDK A;  2LDY A;  2DYA A;  1YDL A;  2J6U A;  4HAC A;  1U26 A;  2G9O A;  4JI7 J;  2MZT A;  3HHD A;  4AT1 B;  1RBO B;  5A8W A;  1RT1 B;  4F25 A;  4ED8 A;  4DPO A;  4DQR A;  1Q7L B;  3EX7 B;  4DUY J;  1KQG B;  1RUS A;  2CPH A;  2X1A A;  2ZOM A;  5IZH A;  1UWB A;  4UZC A;  2M0G B;  1Y00 A;  5DQG A;  4ECU A;  2RQC A;  5LJ3 Y;  1NK4 A;  1FES A;  4G6V B;  2V5H G;  3DOM A;  3GSD A;  2IMO A;  4DPX A;  4XTT A;  3PKM A;  2OPP B;  4EUV A;  1UVI A;  1HQE A;  2J9D E;  3EUN A;  1JNZ B;  2JJ4 D;  2A0F B;  4A46 A;  5E3P A;  3TAN A;  1IN0 A;  3TJA A;  2MHE A;  3BSO A;  3G6E S;  3DYA A;  3VWS A;  2VPX B;  2EEY A;  3BYP A;  3F0N A;  2BKO A;  3MM6 A;  2RUG A;  2F65 A;  4JV5 J;  3TOQ A;  3L7O A;  2RNE A;  3M8Q A;  1UPM B;  5DG8 A;  4R8U A;  1XR6 A;  1U6Z A;  4DX5 A;  1RQ0 A;  1KOH A;  3MMB B;  4DS4 A;  1V3S A;  2DHS A;  4B9L A;  3EVW A;  2GHV C;  2PEH A;  3ONQ A;  4I2P B;  3RTV A;  2AP6 A;  3DDN A;  2KYX A;  2K8G A;  2M9K A;  2NXC A;  5B0F A;  1FEH A;  3HFV A;  1J2V A;  1B3T A;  2XY5 A;  3KJV B;  5HL7 Q;  4FBU A;  3C19 A;  2RB7 A;  3QBC A;  1YWX A;  1Q5Y A;  4ZVR B;  4L3N A;  1RAC B;  1TV6 B;  2A10 A;  2EG2 A;  2OIH A;  4O3P A;  4CNZ A;  2OSQ A;  5HJX A;  4IDK A;  3ET6 B;  4CLL A;  2OEJ A;  3FGV A;  1QSL A;  4CIO A;  2F9D A;  2RQM A;  2ZM6 F;  1WSV A;  1R43 A;  5ETR A;  5IT9 U;  3N5B A;  4Q2L A;  4PCQ A;  4DR2 F;  1GXL A;  3M9O B;  1YRX A;  5K14 B;  5GAH U;  2U1A A;  5ETP A;  3LQV A;  3DU5 A;  3BGL A;  4DSL A;  2XYH B;  2YXL A;  3I4H X;  1KOO A;  3LP0 A;  1OPI A;  4MMO A;  1EHW A;  2FJB B;  3AH6 A;  1VBY A;  1BQN A;  3KLI A;  3SZ2 A;  2X1F A;  4C8L A;  3FDS A;  1M1G A;  5L46 A;  5KG0 A;  4RW6 A;  3C16 A;  1ZET A;  1H98 A;  1EIY B;  5CAA A;  4ZJL A;  2MKK A;  3R7B B;  3GP9 A;  1TL4 A;  4ECR A;  2J8S A;  2SXL A;  2J0Q D;  1CUL B;  3PYE A;  4C4W A;  3FCV A;  4N47 A;  4KR0 B;  4F4Y A;  2AGO A;  2I1R A;  2K7J A;  2CKW A;  3HO1 A;  4P2F A;  3V5R A;  4CZC A;  4QPX A;  1U1Q A;  4QYR A;  2HWI A;  2KH9 A;  4KGZ B;  3OR2 A;  3DDI A;  4LSZ B;  5ETL A;  3I87 A;  4M63 A;  2E9T A;  1FFS B;  5DS7 A;  2RS2 A;  1NHU A;  1DJ0 A;  2OEL A;  2IYG A;  3PNI A;  3KK1 B;  2ABY A;  4LBH A;  3M8S A;  1OY8 A;  3BQ1 A;  3CCR S;  2KHD A;  2O3D A;  3MFH A;  3CJT A;  3M4X A;  4ZPB A;  4M1K A;  5HQL A;  2CVI A;  3RUB L;  1S59 A;  2DRA A;  2EKY A;  3RAM A;  2FZG B;  2J9D A;  3N01 A;  1R31 A;  1S1V B;  4C8N A;  5KFE A;  1FDD A;  4KRW A;  2AD9 A;  1QD1 A;  4D3H A;  3LWM A;  2ZJP Q;  3QSY B;  5HMY A;  4CO0 A;  4NPO A;  1OQ6 A;  4I69 A;  2VQE J;  4QIF A;  1VQ4 S;  2R7U A;  2VG7 A;  1UVL A;  1QUV A;  3FBB A;  1U0H B;  2EFQ A;  2PSZ A;  2KFY A;  4A8Y A;  5AE1 A;  1P6T A;  3T1H J;  2K06 A;  4DPY A;  1G3O A;  2H3E B;  1BQM A;  3MR3 A;  1N34 F;  1VQ7 S;  3N4W A;  3M30 A;  3KLV A;  4UW2 A;  1SJ1 A;  2BE2 A;  2YBV A;  1VQY A;  1K47 A;  1SKR A;  4ECQ A;  2K7K A;  4Y2C A;  3FQK A;  1KP6 A;  2HAF A;  1NRK A;  3BDE A;  1IKY B;  1QE1 A;  1VRT A;  1RA7 A;  2OH2 A;  5E33 A;  5M2P A;  1N5V A;  4KV8 B;  5D8H B;  4IOC Q;  3ISZ A;  2NXJ A;  4OHV A;  4C11 A;  2XUL A;  3GFZ A;  1T9W A;  4JI1 J;  4RW7 B;  2H5J B;  2GQ2 A;  2MQM A;  1KFS A;  1M5K C;  5E0O A;  3VAG A;  2Y8W A;  2GMH A;  4TY8 A;  3K59 A;  3KLG A;  2BJ7 A;  1MNE A;  4AL6 A;  1WTB A;  2QLB B;  2XWY A;  4A8X A;  3MED B;  3BO2 A;  2HRY A;  2ILY A;  4TLR A;  3SCI E;  1Q5V A;  3CF5 Q;  2NRE A;  1OMS A;  3DC2 A;  3V4I B;  1K9M T;  2ROE A;  3BH6 B;  1GEH A;  5HRO A;  1TK0 A;  4Y2I A;  1ZTW A;  3BBC A;  1RWV B;  1NK6 A;  4DV6 J;  2LEB A;  4F0K A;  1IR1 A;  2DNO A;  3I96 A;  4ECV A;  3FRZ A;  1FKP B;  3KG4 A;  3IWX A;  2RQ4 A;  3LAK A;  5GVQ A;  4NRT A;  2JSX A;  3EWG A;  2BJD A;  3AT1 B;  3H59 A;  2VL1 A;  1X4D A;  4NXN J;  2R7X A;  5F0U A;  2DB1 A;  4J91 A;  2B4P A;  2E9R X;  3GLJ A;  1TVR A;  3EIC A;  1WC5 A;  4NMX A;  4J90 A;  3TUJ C;  3TI0 A;  2X51 A;  2NPF A;  1SJR A;  3K89 A;  1C1C B;  1JXE A;  2LKZ A;  5HJY A;  3NBP A;  4DX7 A;  4EYI B;  3TP2 A;  1NHV A;  1VR6 A;  4K5R A;  1XIQ A;  2UUC J;  3PKY A;  1FX4 A;  2C2E A;  5L1L A;  1HMV A;  3NGT A;  5AJ3 F;  3THP A;  3V81 B;  2KZZ A;  4GKJ F;  1PJ6 A;  3Q8Q B;  2EW9 A;  3DLE B;  4IG3 A;  3LUY A;  4L75 A;  3BDP A;  1VBX A;  3UD4 P;  1QVG R;  1HFE L;  1GMW A;  1WOP A;  4B3S F;  4LSL B;  2VAS A;  4NI2 A;  2XG8 A;  3RB4 A;  1Y10 A;  2AX0 A;  4Q45 A;  2XWX A;  1ZA2 B;  3SSQ A;  1GXT A;  3D2W A;  2FC8 A;  2HAI A;  2KM8 C;  3R5J B;  4WTY A;  4M8L A;  3BYR A;  4P2M A;  2B6A A;  2QLW A;  2XQC A;  3BGR B;  4X4O A;  3JSM A;  4FXD A;  2HS4 A;  1Q1K A;  3HP6 A;  3P96 A;  4DFJ A;  1N8R T;  5DLF A;  3MD1 A;  3TUI C;  2FVQ A;  3W5Y A;  2XS2 A;  2RSQ A;  2AHO B;  2G0I A;  3GIK A;  5DG7 A;  4KT0 C;  1WSR A;  4U8Y A;  4AFF A;  2GHW A;  1GTH A;  4TQR A;  1TR0 A;  4NLU A;  3UQS A;  4N56 A;  5DGB A;  1S4F A;  2VQF J;  4MKB A;  3GON A;  1SQF A;  4YOE A;  1VRU A;  2E9Z A;  5F8L A;  4USU A;  2M5Y A;  4URQ U;  3CDB A;  1O6X A;  4MK9 A;  1PYT A;  1FK9 A;  4OMF G;  2F40 A;  3MMJ A;  2XZD B;  1D1U A;  4F3O A;  2R7V A;  3TVY A;  3CJ4 A;  4FF2 A;  1JLB B;  1WI6 A;  1SL1 A;  4B02 A;  3RAQ A;  3K5O A;  2HFN A;  1GMW D;  4PG8 A;  3DLL Q;  3GIM A;  3DLJ A;  3W66 A;  1LNQ A;  2HKE A;  1EQ0 A;  2JHE A;  4RR5 A;  3VGU A;  4KBI A;  1RJJ A;  2CPZ A;  2DGS A;  1ZH5 A;  3ENW A;  3VVU A;  5HQ8 A;  1NZA A;  3TEG A;  2OPS B;  5JJB A;  2CPE A;  4C3K A;  5B7W A;  1R0C B;  2CDR B;  4DR6 F;  2CQP A;  4BC7 A;  5ETV A;  4YY3 F;  2QZ8 A;  4YB6 A;  2RML A;  2OJ3 A;  2DT9 A;  4WP8 A;  1TFW A;  3LPY A;  3ZZU A;  1MU2 B;  2UV8 G;  4BLG A;  4PWW A;  2AW0 A;  4A8K A;  4X66 J;  4I6W A;  4DFK A;  4ZVP B;  1TL3 A;  2E7W A;  4G1I A;  4ED0 A;  4DV4 J;  3MPU B;  4KFB A;  2AQ4 A;  1RT2 A;  4PZV A;  3AOC A;  1OSD A;  1X5T A;  2LP4 A;  2N4C A;  4ED7 A;  1X9M A;  5LMU F;  4ZHR A;  1F5C A;  3GFX A;  3CCZ A;  5D78 A;  4DQQ A;  4GO5 X;  1FX2 A;  1JJH A;  4RLE A;  5I42 A;  1J27 A;  3N6L A;  2JLG A;  1WJ9 A;  1VIS A;  4PG6 A;  1D8Z A;  1VFJ A;  2CJA A;  3WX4 A;  2B9Y A;  1IVZ A;  4Y28 C;  4OFZ A;  3PXG a;  4AYB D;  2XTJ P;  4OYX A;  6FD1 A;  1RXO B;  4WKR A;  4OJG A;  4Z7Y A;  1MRO A;  3FCW A;  2VJV A;  4ZS6 A;  2VDI A;  4I7F B;  3PW0 A;  1UEU A;  5HMW A;  2FPH X;  1IKW A;  2KJW A;  2GAH C;  2B56 A;  1HL6 A;  2FHO B;  5DDR C;  3MR5 A;  2IAJ A;  4X84 A;  2R2U A;  5U47 A;  4ZVS B;  5IOL A;  1RHK B;  3HJV A;  4Q0B A;  2BJ8 A;  3AD7 C;  1GAO A;  3FBE A;  1SV5 B;  1KLN A;  5IWA F;  3DGV A;  3LOU A;  4UOG A;  2K2P A;  4OHX A;  2KG1 A;  4WE1 B;  1P9Y A;  1SC4 B;  4EFA C;  3DI6 A;  4PUO A;  4ED5 A;  4KHP J;  1O51 A;  1A7G E;  2YKM A;  3NOC A;  1ZAV A;  1V9O A;  2H5E A;  1TL5 A;  3D0I E;  3T9N A;  5F9L A;  3CD7 A;  3OXG A;  1SIW B;  2HZC A;  3D7S B;  3PX0 A;  3HKW A;  1NK9 A;  2QC3 A;  1UFL A;  3P4U B;  4CLT A;  2WON B;  4MKV A;  1FXD A;  2H4W B;  2Y0S D;  1G1X A;  1KHV A;  2I5J A;  5HAO A;  2PN6 A;  2CQB A;  2DNP A;  3RU0 A;  2GQC A;  1RK8 A;  2E7V A;  3PDN A;  4GVL A;  5HVG A;  1LW2 B;  5AT1 B;  2DO4 A;  5G0R B;  4AL5 A;  3ZZZ A;  3IXQ A;  1RAA B;  2CPJ A;  1JLF B;  4ZPV R;  3W2W A;  3VGT A;  3G6V A;  4Q43 A;  2IDE A;  1KC8 T;  2HK2 A;  2XCA A;  1H2V Z;  2QGF B;  5C7P A;  2LFV A;  5B0B A;  4JI7 F;  1QAY A;  4RUH A;  1QDU B;  3H5Y A;  1JMT A;  4USJ C;  5EX3 A;  4EK2 A;  4HH1 A;  2DGT A;  2BM1 A;  4K4V A;  3CVK A;  4A8Q A;  1SKS A;  1CJK B;  2WVD A;  4RJV A;  4EO6 A;  3MR7 A;  1XJW B;  2N3O A;  4DUY F;  2FHJ A;  2MPU A;  3GFY A;  3HSD A;  4Z7C A;  3K58 A;  4NLR A;  4WFY A;  4F3M A;  1Y9O A;  4FKY A;  4EBC A;  2MQQ A;  1TKX B;  4K4W A;  4LSN A;  2L41 A;  4CTA B;  2BW2 A;  4I6Y A;  2ACM A;  2WW4 A;  1RP5 A;  2MJU A;  1R8C A;  2Q3P A;  3DM2 A;  1S1T A;  4DL4 A;  2J0S D;  5KT2 A;  1S6Q B;  4OZ1 A;  1YQH A;  1VQS A;  3PX6 A;  1UJ5 A;  4USM A;  2VDH A;  2QO3 A;  1QTM A;  3P5T L;  4FF3 A;  4DV3 J;  2EFG A;  4JV5 F;  3M6X A;  3PW5 A;  4HLB A;  5KFL A;  4UQG A;  4KH1 B;  1IBM J;  2AX1 A;  4C97 A;  5D4P A;  1XR5 A;  1NLK L;  2PFD A;  4RNN A;  2N7C A;  3MM9 B;  5A8K B;  2MLZ A;  2BJ1 A;  3UCU P;  2W2Q P;  1RKI A;  1FRM A;  3ZFV A;  2G2Y A;  4TYA A;  2JZ5 A;  4O4G B;  2J0W A;  5L9N A;  2AJ1 A;  1VQL S;  3QT6 A;  5KFP A;  4B3M J;  1S7H A;  2W4C A;  1F9F A;  1RBL A;  4ZVG A;  1HYS B;  2CQG A;  2IVF B;  4X4N A;  3C6U B;  4N8N A;  3OUY B;  1NM2 A;  2BKN A;  3HVR A;  3I0R A;  2DNY A;  2BKP A;  5J2M B;  4MAK A;  2CJ9 A;  2FHJ D;  3BEG B;  2XS7 A;  4B9N A;  1JLC A;  2QRR A;  1RT5 B;  2GC8 A;  3QT8 A;  1GNK A;  2XMK A;  3TNV A;  1KLM B;  4E2F B;  1KD1 T;  3AJ2 A;  1VOM A;  2AKW B;  1TL7 B;  4X65 J;  2FYX A;  2M8D B; 
#chains in the Genus database with same CATH homology
 3NGU A;  1NDK A;  1WKL A;  1NUE A;  1U8W A;  1NHK L;  1WKK A;  1HHQ A;  3DDI A;  4DZ6 A;  1KDN A;  4S0M A;  5CAB A;  1NSP A;  3EMT A;  3ETM A;  3FC9 A;  2DY9 A;  3FBF A;  4ANC A;  1XIQ A;  3ZTP A;  1JXV A;  3Q8Y A;  3VGU A;  4DI6 A;  1NDC A;  1VYA A;  2DXE A;  1MN9 A;  1W7W A;  3NGR A;  4FKY A;  3NGT A;  3VVU A;  4ANE A;  1LWX A;  1NSQ A;  2DYA A;  3DKD A;  3FCW A;  3BH6 B;  2AZ1 A;  1NB2 A;  2HVD A;  3VGV A;  3GPA A;  1B99 A;  3NGS A;  3ZTS A;  4DUT A;  1F6T A;  3ZTQ A;  3R9L A;  1ZS6 A;  5BXI A;  4O0N A;  1NPK A;  1EHW A;  3EJM A;  3FBC A;  3BBC A;  1PKU A;  2BEF A;  3Q89 A;  1K44 A;  1NCL A;  4C6A A;  1NDL A;  3FKB A;  3BH7 B;  4F4A A;  3ZTO A;  3ELH A;  4WBF A;  3EVO A;  3Q83 A;  3BBF A;  2HUR A;  3EVW A;  1HIY A;  1S5Z A;  3ENA A;  3Q8U A;  1S59 A;  3VGS A;  3EM1 A;  4F36 A;  5IOL A;  1XQI A;  1NSK L;  1LEO A;  3MPD A;  1UCN A;  2VU5 A;  2BX6 A;  3B6B A;  1B4S A;  4HR2 A;  4ENO A;  2ZUA A;  2CWK A;  3EVM A;  3VGT A;  1BE4 A;  2DXD A;  5CAA A;  3FBE A;  1BHN A;  3GP9 A;  2B8P A;  3EE3 A;  4UOG A;  3ZTR A;  1BUX A;  3JS9 A;  3WX8 A;  2B8Q A;  2NCK L;  2HVE A;  3BBB A;  3FCV A;  5C7P A;  2AZ3 A;  3VVT A;  1MN7 A;  1S57 A;  3Q8V A;  1HLW A;  4UOF A;  3EIC A;  1NDP A;  3L7U A;  1F3F A;  3FBB A;  1PAE X;  3PRV A;  1NLK L;  1WKJ A;  4FKX A;  4UOH A;  4CP5 A;  4AND A;  3Q86 A;  3PJ9 A;  4EK2 A;  4KPC A;  3B54 A;  2DXF A;  4W98 A;  3G2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...