3DKDA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with gdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3dkdA00
3ELHA 3VGSA 2HVDA 1KDNA 2NCKL 4F36A 4HR2A 1S57A 1XQIA 2DXFA 3B6BA 3PJ9A 1XIQA 4ANDA 3EM1A 1NDPA 1W7WA 1NDLA 1WKKA 1LEOA 1MN7A 1MN9A 1HHQA 2DXDA 3FBEA 4F4AA 3B54A 1NLKL 3ZTPA 3BBCA 3FBBA 1F3FA 1NCLA 3Q8VA 3ZTOA 1K44A 2HURA 3NGRA 5IOLA 3ZTRA 1NSKL 3FKBA 2B8PA 3DKDA 3Q86A 1ZS6A 3G2XA 1B99A 3FBFA 4EK2A 3EE3A 5CAAA 3R9LA 3ZTQA 2DXEA 1U8WA 4DI6A 3GPAA 4FKYA 3MPDA 2DY9A 3NGTA 4ANEA 5C7PA 3GP9A 1VYAA 3BH7B 4WBFA 1HIYA 3Q83A 1BUXA 4FKXA 1NB2A 1NSPA 4W98A 3ZTSA 1S5ZA 2ZUAA 3BBFA 3EICA 3EJMA 2AZ1A 4UOFA 3NGUA 4ENOA 1NHKL 3FCVA 1NDCA 3EMTA 3EVWA 4UOGA 1LWXA 1B4SA 1PAEX 2HVEA 1BE4A 3VGUA 3DDIA 3Q89A 4DUTA 2VU5A 1NDKA 2B8QA 3EVMA 3FCWA 2DYAA 3VVUA 1PKUA 4UOHA 3WX8A 1F6TA 1JXVA 1WKLA 3FC9A 3PRVA 3ENAA 3VGVA 2AZ3A 3EVOA 3L7UA 4C6AA 1HLWA 2CWKA 1EHWA 2BEFA 3NGSA 5BXIA 1NSQA 3VVTA 4CP5A 1BHNA 3VGTA 4ANCA 4DZ6A 2BX6A 3ETMA 3BBBA 5CABA 4O0NA 3JS9A 3Q8UA 4S0MA 1NPKA 1NUEA 1UCNA 3BH6B 3Q8YA 3FBCA 1WKJA 1S59A 4KPCA
chains in the Genus database with same CATH superfamily
2CPXA 3TOQA 5KFTA 1H7XA 1DURA 5HQ8A 4DV3F 1P9YA 5F41A 2J9DA 2P9EA 2XS5A 4Z2XA 2ZC4A 3R5DA 1Q16B 1DTQA 1SC4B 3EDRB 1IWAA 1X9WA 3FGVA 4I6YA 5MAOA 4N56A 1CJKA 4MKVA 4KPYA 4ZCIA 1WSVA 3WIUA 1NEEA 4B9TA 4HT5A 4NXNF 4OJHA 3V6KA 1F1BB 2V2ZA 1REVB 1CLFA 5CAAA 2B6AB 2VDHA 4QR1A 4LSNA 4KC5A 3M1VA 4JB8B 5A76A 4OJGA 3QWUA 3DLJA 4K4VA 4ENOA 4OX7A 2KL8A 1P9QC 5CYMA 1I94F 5F9NA 1HPZB 3W9HA 2DHHA 3B4MA 4MIAA 4RJVA 2ZBPA 2GGPA 2Z0GA 1LWCA 2BQUA 3D0IE 3GG1A 4V19J 1XR6A 1U25A 1JB0C 4ANCA 1IKYB 1NBEB 4IRKA 1DBDA 2K1RA 5KFCA 1LFPA 4QCLA 9ATCB 2QL5B 1YJ7A 2DT9A 3JTPA 4EO6A 4NCGA 5GAHU 2ADCA 3O3LA 1RZMA 1XNRF 1UETA 4QYZJ 4LIRA 1Q4RA 1IQZA 1YIJS 5F0UA 2O67A 2V8GA 1S49A 4UW2A 2W9BA 2MXYA 5IXUA 4B3MF 3QGIA 1U1LA 3NAHA 5B08A 1JLEB 4DR3J 1V9OA 5KFNA 2XGPA 2XSJA 2K2PA 4RUAA 2F8HA 4CTAA 1BUXA 4ZVUB 1VQ9S 1R0BG 1KVKA 1KLMB 3Q23A 3GV8B 2JLGA 4DV1J 1M0SA 1JJ4A 2XSFA 1S6PB 2N7YA 1EB0A 1B4SA 3F56A 2DH7A 2JC1A 4K5SA 2GAGC 1TMMA 2YPYA 2EK1A 1FNMA 2FJVA 3OUYA 2K3KA 1RBAA 4OI4A 3PKYA 5KT5A 4MK7A 3PO4A 2RF2A 4K8RA 4NA1A 1M5HA 5DGAA 1X4HA 3RW6A 4USVA 1I1GA 4R8UB 3QPIA 4R0EA 3OHBA 1KD1T 1F2GA 3I82A 5EHHA 2E7WA 4ECXA 5HQMA 3I5BA 3LQVA 5J2MB 2MKIA 5B09A 2BJEA 2VFVA 2FZGB 3P49B 3SFGA 1YG0A 2MLXA 4GO7X 1Y0HA 4K4ZA 5C25B 1Q86T 2IRYA 4B9NA 4TU8A 4EUVA 5AE2A 2JL9A 3S01A 1MROA 1XMOF 3M8SA 2R7TA 2BJDA 2HQGA 2DNRA 3MM9B 2U1AA 2I1RA 4ECQA 4N77A 5L46A 2HFUA 4HKQA 2YWGA 5DJBA 2CNKB 4RL1A 1XWLA 5F8LA 1TL4A 1TP7A 4PWDA 2FHOB 3JSMB 2IJFA 4NLDA 4M5JA 1OPZA 5CA5A 4L3NA 3W66A 3FSXA 4DPOA 3JS9A 1OWXA 2L41A 1HFEL 2G0JA 2KZZA 2HZAA 2M4MA 3THTA 4DBQA 2DXFA 4HVZA 4C8KA 1UFWA 4KH1B 4PXBA 2VF3A 1ITPA 1HBNB 2C42A 3LP2B 3MPYA 4XAKA 5IM0A 5SUHA 2OEMA 4NYPA 2ALZA 3SCKE 3BGLA 4QW9A 4XTTA 2PGCA 4ZLJA 2AW0A 2BW2A 1R8PA 2FJAB 2MGZA 2BBEA 3BEGB 4YR0A 2FLOA 3QFHA 1U6FA 1SL1A 1VRUB 2CQGA 1NPPA 5I4MA 4L74A 1AZSB 2UXBJ 2KFYA 5D8HB 2M9KA 3CCJS 1D1UA 2CFXA 3SCLE 1AUSL 5KOXA 3RBEA 5E0OA 1U2RA 1FNXH 1HYSA 4HYKA 5KOWA 2W25A 4NZ7A 3AXKA 5C24B 2V8DA 3P6YC 5A8KA 3VV2B 2ZWOA 2YKOA 4A8KA 2VPWB 4I7FA 2RMLA 3H5YA 2IRXA 2NSCA 4ED8A 3UDVA 2XWYA 3CJKA 2AYGA 1JNZB 2RAQA 2VJUA 4KJIA 2VASA 4FBTA 1T05A 2G1HA 2VOOA 5E5NA 3ILJA 2DCUB 4DN9A 4F7VA 4X4UA 2HFOA 4B9VA 3Q8PB 5DG8A 1PO6A 1N6QB 1U1KA 1YVFA 2MB0B 1WD6A 4USWA 4K50A 3BZQA 1KKHA 3TQEA 4NI2A 3A8IA 4QBUA 4YOEA 2C2DA 1V5VA 3VALA 1M5PC 5A8WB 1VQ6S 1HWKA 1NB7A 1XN9A 4MYTA 3RB3A 3N5FA 3K7RA 5GADI 4P2MA 5BJRA 5KFSA 3NRBA 3E2EA 2WBMA 4ZP6A 2R2TA 2H65B 1Q82T 1ZA1B 1B70B 1OS5A 3PFOA 3V4IA 1AROP 2YNIA 2ZH9A 1UVJA 5C42A 3DI6A 4E0DA 3PW5A 2XI3A 2HNZA 3MOZA 3UD5A 3K5MA 3IR5B 2YKNA 3CCSS 4J9OA 2ZBRA 3O8WA 4P74A 3SDEA 2N7CA 3E3XA 5CD4A 3LUYA 2XO6A 4Q8FA 1IVZA 2AGQA 2QT7A 1G6BA 4Q2LA 3TZYA 3Q8SB 4C3MA 2HVHA 1FKPB 3EE3A 3IBFB 4WK3A 1UJ5A 1QVFR 4WCEQ 1P1LA 4CO0A 2LP4A 3PW2A 3MPDA 3IGVA 3L7OA 3OFFA 4OX6A 1T11A 5ETKA 4DXLA 2ZOMA 4AYBD 3TEHB 2AD9A 2E1PA 2RB7A 2VPZB 1HWJA 3QT6A 1UWAA 2OIHA 4JI7J 1KWMA 3W2VB 2RQKA 2ROPA 1H0HB 1NK9A 1PGZA 2QZ8A 2IM3A 2H5JB 1YHQS 2HWIA 5CYQA 5C2CA 1U09A 3RB0A 2N3LA 3TYTA 2GJ2A 4G1IA 2DO0A 1VQSA 2LXIA 4LR7A 4AE5A 3I9ZA 2KI2A 4FYDA 3PEJA 3R5BA 2MQLA 3MOJB 1HI1A 4TKTA 2OPQA 3K5PA 2E5LF 4KO0B 3R5GA 1VS3A 1HHQA 1FDAA 1RT1B 2E1AA 3D9BA 4C0OC 3MTJA 1IJEB 1PJ5A 1VIOA 5ETMA 3PW0A 2A10A 4FYXB 4ZLLA 4KTQA 1FWLA 4K0KF 3HFZB 3THVA 3AB4B 4BWMA 4GC6A 4LRCA 4DR5F 3MXHP 4DV6J 4W98A 2CADA 3EJMA 1R0CB 5L1IA 1S1TA 4CLTA 4PAAA 2G1DA 3E01B 1FFSB 4NCAA 2RJZA 2HFZA 4ILRA 4ICLA 1UPMB 3U1MA 3QIPB 2UUAF 3H8YA 1X4DA 3DXSX 1QAXA 2FHMA 4JI0F 3KLFB 5J2PA 4DCJB 1RSCA 4XK8C 3UNYA 2AU0A 3HHLD 3OL6A 3J7YU 2L48A 3G71S 5CCLA 2GMLA 3G86A 3FBFA 1NO8A 4J7CA 5HMWA 3SSQA 4JV5F 2VDIA 3SBMA 3ZTQA 3I32A 4RPFA 4CO4A 4LIWA 2DGQA 2QSFA 2AKWB 2XWXA 3WX4A 2XCPA 3RGIA 2R7WA 4PXCA 2ACYA 5KG1A 3MTKA 2ZD1A 4ED5A 4F4WA 4CLLA 3WIVA 3I5AA 1FRKA 1S0OA 3PIOQ 1EKSA 2UUCF 4AQYF 3A8JA 4UOCA 4TXSA 3PO5A 1YI2S 5EN1A 2YWWA 2HLTA 3KHGA 3T6BA 1J5EF 2BDPA 3JYTA 3TAMB 3ET6A 4QOTA 1IXKA 2QMXA 3FVYA 2HQDA 4J91A 1N0VC 3OVBA 1H6KX 1IR0A 1V3SA 4DV0J 4BBYA 3QJPA 3RUBL 3QGHA 2UVUA 1VIXA 1FE4A 2BOAA 1WF1A 2HAFA 1NKEA 1K73T 1RADB 2DRBA 2GC8A 3BO2A 2JWNA 3BGRB 4Q0BB 1NSKL 4HACA 4X65J 5D4OA 1KQFB 2V8VA 4EK2A 3OQ2A 5FLXU 3CC7S 3GE9A 1FKOB 2Q6BA 3F44A 1U1MA 1NSPA 2B9YA 1RTJA 1FK9A 1RWWB 5IWAF 4JI2F 5DG7A 3NGDA 3FEXB 3CO0P 2FJBB 1NK8A 2HMIB 5LM7E 5HK4A 1RQ0A 3FCWA 6FDRA 3D3CJ 1TV6A 3HKWA 1F5CA 2H54B 2HSEB 3PRVA 4AL5A 4DV5J 4DSLA 4ECWA 3EX7B 1TKXB 3IR7B 3OL9A 1U26A 4IFVB 4QIGA 4IOBA 3RB4A 3QGGA 1ZOTA 3M2RA 3CJ5A 3H90A 5IQQA 4JI8J 2M5YA 2IBKA 3NCQA 1F3VA 2IAJB 3CUNA 1QUPA 5DM6Q 1RB0A 1RBOB 2FQQB 3QQCD 4GVBA 1FJEB 1VK8A 3FEYB 1H2VZ 3UNGC 5L8RC 3MMBB 4Y65A 1VQ8S 4X62J 2RUGA 1ZYQA 5CZXA 5KFKA 3I6PA 3N79A 3IWLA 3OL7A 1RT2B 2FHJA 4G3IA 2RVJA 2AJ1A 3P96A 3OPKA 2CPZA 4I2PA 1VBZA 2OLWA 3QRPA 4A8FA 2NXJA 1CJUA 1ZAXA 1MSWD 2YY3A 3IO1A 1DTQB 1CJKB 4WFBQ 3OFGA 4J9UE 4O4RA 3TJAA 2Z2LA 4H4OB 1EKRA 2EFPA 4AL6A 2GO8A 3BR8A 4NMLA 1NHUA 5U47A 4LSNB 2ZZMA 3M1VB 2HVDA 3MPVA 3ZZRA 2PA8D 4HR2A 2W2OP 2ILZA 3UN3A 2FPHX 2V67A 4CZCA 4F3MA 3SCIE 1TKTA 4EBEA 4F4AA 2WVEA 5AJ3J 3EGWB 5CYMB 4A47A 2LXUA 2HIQA 2XLKA 5EX3A 3RAMA 1R0AA 4WIIA 3AOCA 4ZCMA 1UEVA 2RKIA 3MCSA 2R9LA 1LWCB 5A6WA 3C6TB 1WF2A 5A2QY 1BC6A 1K8AT 2JEGA 3S7RA 1M90T 3Q83A 4NRUA 2KM8B 1NSAA 1Q53A 3JQJA 4YB5A 3EVWA 5G4DA 2K1RB 2ZH6A 1RWNB 2KVQE 2BA9A 2GHVC 3P5TL 2BQRA 5GAEU 2CJXB 2P6TA 1S9GA 1TAUA 4LBPA 1YQHA 3J80Y 3KHRA 1XBWA 1HQUA 2PT0A 2W9BB 4JI5J 3H20A 4V1Ak 1KVJA 2Y1RI 4DV2F 4DQIA 2AEFA 5C2GA 1F9FA 1S59A 3UN5A 4B3MJ 4P7TA 4OZNA 3VAFA 4L73A 4CO2A 3CCMS 5CCMA 2XSJB 4I68A 2FJXA 4CTAB 2OP5A 4CNZA 4FF3A 1S9FA 3FRZA 1N34F 2F4VF 1SH2A 3W9JA 1ZZNA 3HVWA 3W1YC 4TY8A 2CVEA 3O6QA 1K44A 3TA2A 1PIEA 4N8NA 1RTZA 3I31A 4WYLA 1FNOA 3QRRA 3OW2R 2RHQB 2E7XA 3NKYA 5ITHA 3MFIA 2EI5A 1O8BA 5KAKA 4C3KA 5EDWA 2M88A 3IG1B 4NA2A 1Z2ZA 4P52A 3WBZA 3TUPA 1T94A 3CJSA 2JVOA 3BN7A 1V3ZA 4PPDA 3IN5A 2L9NA 1J5OA 3K8WA 4DS5A 4LFCJ 4F04B 3FQLA 5IC6B 4PZVA 2QA4S 1EHWA 2QJ3A 4ECSA 2KYXA 4JV1A 4UY85 5EWEA 2BM1A 2IC3B 2Z2MA 4OMFG 3FMBA 4DMZA 3VGSA 3R5JB 3IM8A 4RUBA 1RBLA 1BQXA 2Q3PA 1IBLF 4ZIVA 4WP9A 1X5PA 1MROB 2MDAA 1NLKL 4F2SA 3ITHA 2DHGA 1C1BA 2LA4A 3CTRA 3R7SB 2K3IA 3M9NB 4HDGA 4KE5A 5DGBA 2XS7A 1CG2A 3OXLA 3RJMB 4O3QA 4J9NA 3IC1A 3DLKB 4Y2IA 3UR0A 2VICA 4H4MA 3VZHA 3P8BB 3FZ2A 2QTWA 4ID5A 4I6WA 3DC2A 3U1NA 4CT8A 3HZEA 3ZTSA 2RHSB 4MTPA 1SL0A 2EG1A 1DARA 1C0UB 3I9V9 4CRJA 1ROFA 2QX0A 2IM2A 3Q89A 4ED1A 1RE1B 2DVIA 4HI2A 2MKJA 3POTA 3M32B 2KHDA 2HNYA 2NZCA 4I56A 3G9CA 1NZAA 1SB6A 5E3RA 1WUUA 3SEOA 2Z8QA 2FVCA 4NCBA 1HNZJ 2HQIA 1JWWA 4ED6A 5IM0B 2WVFA 3HFVA 4ZA1A 1TK5A 4U8VA 1OQ6A 3Q8YA 1FWKA 3DOMA 2MGZB 4B3OB 5KFZA 4LVNP 3RBXA 1FRIA 2XMAA 2J6UA 1Z4UA 1SXLA 2BRLA 4V19X 4ZPWR 4B3SJ 5I42A 2LVWA 1E6VA 2VFUA 2F7VA 3KMSA 3G6VA 3C46A 2HHHJ 2M3DA 4G1PA 2AYBA 2PC6A 2DD8S 4I67A 1C2PA 1QAYA 1U6ZA 2P9GA 2ASDA 5A8KB 5LSLA 1JNRB 4ZIWA 1QSSA 3EICA 2CA9A 4I7FB 3MR7A 2FVRA 3MEGA 4C97A 2O01C 3NXZA 2VPXB 5IT4A 3VF0B 2CJ9A 3D7SB 3DLBA 3ZZZA 5H1SV 2ATLA 2KT5A 2UXDF 4KR0B 2WK4A 1VRTB 2H4WB 2J9CA 3EXYA 1T05B 1QY7A 3KUGA 4B3RF 1E6YA 1NNDA 4J5OA 4O4GB 3B78A 4NLQA 2X3GA 3UR3C 1VGYA 4DX6A 1FJGF 1CJTA 1NDLA 5F8IA 3BBCA 4HI1A 2C3UA 4WPAA 2ZH2A 3MMCB 2E7VA 3R6LB 1RHMB 4NLVA 1RAOA 5KFMA 1JXEA 2ZITA 3L09A 1CULA 1VQMS 4TN2A 3W3SA 5DDQC 3CSKA 1PSDA 2YNIB 3GIJA 1N32F 1GH8A 2QO3A 2A1BA 5L38A 1U47A 2DNLA 2HNZB 2IM0A 3SFUA 1D0EA 1JMTA 3P5BP 3QJLA 4UY8T 2YKNB 5HROA 2ZH4A 2MYFA 1X0FA 3SIPB 5L1JA 1HA1A 2PIIA 1FD8A 2F3JA 2CJKA 1OSDA 3C2PA 1NPKA 4Y3CA 1X5TA 2B4PA 2AV5A 2ZH7A 2YVSA 1FI4A 3C6UA 3L4BC 2YWFA 5D0RA 3QWPA 3HVTA 1SC6A 4XDDA 4OZ2A 4X66J 2DCLA 3M2VB 1F3FA 1I3OB 2DGOA 4PQUA 4ZVSB 2A2CA 2R7OA 2BYCA 2CPFA 1YRUA 4OI6A 4F0HA 2QFJA 4ZVOB 5M2RA 4LFBJ 2DNZA 3DRRA 2BJ9A 3JSYA 1M5SA 2J7UA 2HWTA 2WTFA 5J2QA 2QN6B 5DDRC 4XIUA 2VFSA 1PC5A 4YDDB 1LWEA 3RBZA 2V94A 1PBAA 4MFBB 1RK8A 1F6TA 1H3DA 4QWEA 3WDOA 5K20B 3N6LA 4OFZA 3AD8C 3FUYA 2IM1A 1UPPA 2OMOA 3TVYA 5M2UA 4C0HA 4NLWA 3ISNC 1S99A 2CKWA 3OTCA 2OAUA 1JLGA 2VB6A 3BGUA 2ZHAA 1WHXA 1IBKF 1RHJB 2KRRA 4ZJQA 4GRSA 4KHMA 3V81A 3TA0A 1S1TB 5D3GA 2ZZNA 5F8JA 3ZTOA 4X64J 2WRMA 4J9KA 7FDRA 2QRRA 4A8OA 1HR0J 3H59A 3MAAA 1VQLS 3MR2A 2OD6A 3QBCA 1BGXT 4LF6F 5J2PB 5I3UA 1VCTA 3S8SA 2MZTA 1PYSB 2HVEA 2HBQB 5K8NA 1N33F 2CUYA 2VOPA 5L1KA 1OYDA 4EZ9A 1OIAA 1KQKA 2ZOFA 4EBDA 3G6XA 4DWIA 3G6YA 2E9ZA 2CWKA 2HGMA 4CO1A 1TQLA 1WHVA 1NXIA 2YNFA 3L9ZA 1HBUA 1HNXF 4Y0FA 3H98A 1S76D 1EP4A 1GAOA 3O1LA 3DLGA 4IH6A 4JV5J 2VG6A 2NSBA 4KT0C 4J9VA 2Q43A 2XM3A 5L1LA 2BACA 3NY0A 2CNLB 4F3QA 1WI6A 4N47A 2MQMA 2ZD1B 3TO8A 2H51B 2X51A 1F9HA 2NLWA 4NWBA 4GKKF 4MAKA 1VR6A 2JRSA 4C0BA 3TEGA 1LXJA 3T5KA 1S72S 2W2QP 5HQLA 3L95X 5KFOA 4OYBA 2P2CB 3MHYA 3ET6B 2PMHA 3TJ8A 2KTQA 3RAQA 4N41A 4NLSA 4IKAA 4QIWD 3C8YA 3ENAA 3ICLA 1WSRA 4ZS6A 2AZ3A 3BKFA 2MLYA 4DQPA 4D3HA 2XEXA 5GAHI 2MZ1A 3E51A 1U0SA 4HACB 3QT7A 5H9EJ 3GJSB 4KPCA 2J6TA 3ZZ0A 1RTIB 3NS6A 2Y8WA 4QQBA 1IKYA 2YKAA 3D6MB 2CPYA 1QTMA 2OELA 4WJBA 2C3MA 3HZGA 3BREA 2MQPA 3FSYA 4ERDA 4JI2J 2RE1A 1RHRB 3FFIB 1RCOB 2D3ZA 1NKBA 2HAIA 3K58A 3T19A 1U1PA 2RIJA 2RQ4A 1IM4A 4OI1A 3NLCA 3NMRA 3IA0A 2CG8A 3D1HA 4EYIB 4WBFA 1JLEA 3ENWA 4JYAF 2H3EB 4HTJA 4DR2F 3GR1A 4OJ1A 5ETTA 1T9UA 1ZTTA 5CXTA 1RAFB 1T9YA 3ZZOA 4BDPA 4X4VA 3TNVA 2VKRA 2IIHA 2SXLA 2WHOA 2RDDA 2L9WA 2BE9B 2IBOA 1UW4A 1FFWB 1S1UB 3EGZA 4DR7F 4CLSA 4GVBB 4LRBA 3GMGA 2AGPA 2GFFA 2CXEA 2AIRB 2R7VA 3MEKA 2NXEA 3BM7A 1RWPB 4QU6A 1JLQB 4ZN1A 1VQKS 2FHJD 1FF2A 5KG4A 1N52B 5RUBA 2QA2A 4YY3J 4J37A 1L3TA 3J80U 2BE2A 3SXLA 2OEKA 4DEZA 2QYGA 5KG6A 4DR1J 4IUFA 3CMAS 1CJUB 3D3BJ 3R5AA 3K89A 1JXLA 5THWA 5J2MA 2W24A 2PSZA 2AEJA 1TKDA 2UUTA 3SCJE 1U7LA 3MUVP 4TU7A 1QE1B 4FVCA 3F41A 4C4WA 1B7YB 1RT5B 1GMUA 2V4QA 4A8XA 2CIMA 3KHHA 4DSIA 3KJFB 4LF4F 3UE2A 1WOPA 1EARA 3H2LA 2FGOA 3CNQP 5IC4B 5DZ6A 1RCXB 3N28A 1N5SA 1FTRA 2VA3A 3HSGA 1FRHA 2KG1A 3DLLQ 1R0AB 3JSMA 3LAKA 3D54A 3SQGA 2WSEC 2VA2A 3FNNA 2ZDOA 2RKIB 5HBMA 3CB4A 1YLXA 1ZTWA 2BE7D 4USKA 3CCQS 2MEWA 4RNFA 2J0WA 2VJVA 3LPYA 4DQQA 1K9MT 3GILA 2N82B 5H9FK 5HVHA 3RG6A 1RJJA 1HBNA 3O5TB 2DNGA 3LP2A 2M0GB 1HMVA 1WI8A 1TKZB 4LF8J 1S9GB 2XZWA 3M8WA 1REGX 2HQCA 1HQUB 4MIWA 2XMKA 4Y6IA 1CVJA 3U1LA 1RUSA 4ZK7M 5AXNA 2HGLA 3GR0A 4FXVA 2OFHX 4LR8A 2MTLA 4KSEB 1RAAB 4DUYJ 3M9MB 3VTIA 2DPIA 4WXWA 4IRCA 2BMBA 3R7NB 3HT3A 3CXCR 2LEBA 4TY8B 5KG2A 2O3DA 1RGVA 4DZ6A 1YKWA 1I5OB 3PYEA 4RBTA 4EWTA 2FZKB 4PUOB 2CDRB 2YPZA 1YJTA 5HMZA 4OZLA 1H7WA 1XQIA 2WAQD 2I5JA 1KNZA 4OX9F 1EIYB 1MN9A 4Q43A 2EFGA 3DHXA 1Y9OA 2FZCB 4M5NA 4ITSA 3HSZA 2BKPA 4ELUA 5BR8F 3S1TA 1GX6A 1J5OB 2XYHB 2CQPA 2AGOA 1Y00A 1TL1A 1XR5A 1FVSA 4LBIA 2PN6A 3ENQA 2CJAA 8ATCB 4RW4A 2XMMA 3NS5A 4GVLA 4ZPBA 1NJWA 4HHJA 2ZZTA 1XNQJ 1ZZFA 1H98A 1KS2A 2DITA 2PI4A 4MJKA 3DRXA 1IKWA 1PAEX 5B0AA 5F3TA 4DUTA 2C22A 1S6QB 1S10A 5KG5A 4DV4F 4CYUB 1QD1A 2LLZA 2HBZB 3H25A 4LR9A 1IBLJ 3ITHB 1C1BB 3BN4A 3PHTA 3NGSA 1L3VA 1VMBA 4C7QA 4DR4F 1NSQA 1FO1A 3ETMA 3J81U 2DR5A 4A48A 3CCRS 5F0WA 2J6SA 5ETQA 3G87A 4H4MB 1YX2A 4ID5B 2GS8A 3K2YA 4R5PB 1YJNS 3M30A 1KONA 2B5JA 4P6QA 3CD5A 4HEA9 4LFAJ 1R43A 2D3O1 3POTB 2HNYB 3GJRB 5L39A 3UDCA 1PC4A 2UXCF 3Q8RB 2YKQA 3VR1A 2CQ2A 2EXUA 4UF4A 2DGUA 4WZQA 2JFDA 2KB2A 1EQMA 4WYWA 4ZVQB 4F67A 2HRUA 3KOAA 2W7OA 3DOMB 3MECA 3UCZP 3VGUA 3UN2A 2MLZA 3NOGA 2VQEJ 4N76A 4M95A 1L3SA 2M52A 2UV8G 2HVIA 2RILA 5I42B 3TAQA 3W2VA 1E6VB 1F0XA 1DJ0A 2HS4A 2D3UA 3BSOA 5FJ4A 1AB8A 3LGMA 2RDIA 1HHSA 1M1GA 4PXDA 1B0VA 3NP5A 4P9SA 1CS4A 4IYQA 5AE1A 3AY0A 3DU6A 4F02A 3HPOA 1U0HB 2IMWP 1FERA 3N5BA 3W2WB 4CLKA 2O66A 3MEGB 3VAKA 2DR8A 1RT1A 4B17A 5D15A 1S97A 1B99A 5B0EA 4ZPVR 5JXSA 1T3OA 2AX1A 5T41A 3A3NB 3F0NA 5DDOC 2LEPA 3W63A 2NUUG 2KXHA 2AF6A 2R42A 3KTQA 2XMJA 2AYMA 2JC0A 5HN0A 2JZ5A 3ZZPA 4CNYA 3J7YI 3H5XA 1YZ6A 2MJUA 4DG1B 2UUBF 2UU9J 3DHWC 3MPWA 4C8LA 1N5QA 4CP5A 3QIPA 3TR5A 1BQMA 5LXRA 3KK3A 1NUEA 2QLXA 4B9MA 4F4XA 4WTYA 2AQ4A 3HJFA 3M8QB 2JEFA 4B9SA 1LFWA 1FT8A 1CULB 1I51B 1NH7A 2W9CB 4ZCLA 3D0GE 1T8EA 1WORA 3KKFA 4WK1A 1XMQF 2LU1A 2OSRA 3CCVS 5LXYA 1NK0A 1RT3A 3LWLA 5LOQA 2DRDA 2DXEA 1UAWA 2XYGB 5HROB 1VHIA 3ONQA 3BBFA 3DMJA 1WC0A 3OTOJ 2V2QA 3PJWA 4CDIA 4XO0A 1U02A 1X9SA 5ADZA 1MWYA 1T9WA 5AT1B 3C6UB 3IP0A 3HVTB 1ZPWX 2F63A 3VGVA 3L7UA 3J7Z5 2RU3A 3QO9A 4PQUB 2CQIA 1S7IA 2JEJA 1X4EA 2J7KA 1YGYA 5EUHA 5J2NB 3T5JA 1M1KT 3KJQB 3TAMA 1YSJA 3KK2A 3PACA 2GIRA 4KGZB 1NJXA 2B9XA 2IVFB 1W7WA 4DL6A 2ZJRQ 2VBXA 3PYFA 4OIXA 1LWFA 3V6HA 3GJQB 2WSCC 3LALA 3AAWB 3VAHA 1LWEB 4EU0A 2XMWA 5ETRA 1DZ5A 2DHSA 2Z2YB 5EWGA 1WEZA 4PEOA 2V34A 3BGRA 4Q0BA 4TNOA 3DRYA 4NYOA 1ELOA 4RNHA 2OPSA 2DGXA 4AXIA 4FKXA 3DRSB 3I87A 5GAGI 1NHKL 3GB0A 2HZCA 1YBUA 2K8GA 1FKOA 2YH1A 2Z56B 1MG7A 3W9IA 2IDEA 1P6TA 3PTWA 2R8JA 2C2MB 1C1CA 1JLGB 1C0TB 3D1QA 3WX8A 2FHKA 2HMIA 2CZ9A 2GVZA 2HS3A 1KN6A 1FDNA 3V81B 1HWIA 4YB1P 5D3GB 1NJZA 1PYOB 3EGNA 2ZBIA 1FDBA 1FJCA 1TKXA 1JLBA 4IFVA 5DO2A 2F8MA 1S4FA 2VH7A 2CVIA 4ZVRB 4BC7A 4LF9J 4ED2A 3SMZA 2U2FA 4AD6A 3FZBA 1SV5A 3MAAB 1D8ZA 1RT4B 3A4TA 2RT3A 1FXDA 4ID8A 2GVDB 1WKKA 2MKHA 3PRDA 3PZPA 3PX4A 4BCAA 3KLHA 4E98A 4KGMA 2CQ4A 2YKMB 3T9ZA 2AJQA 3V4MA 1G4CA 3UDEA 4EMDA 2Y1IA 1HNWF 2J5AA 4EYHB 4JI6J 4IG3B 3EWGA 1N56A 2IVMA 1KTVA 3D6HB 1UFLA 3CJ8A 1RT2A 3D4JA 1T9VA 3VAMA 4IR9A 2MY8A 4X4TA 3MZIA 3DLGB 3A12A 1F5BA 3AA8A 2ZFHA 1N36F 1KP6A 3PY8A 2ACMA 2J8SA 3W60A 5B7WA 3TX8A 1YJVA 4ZHRA 3L7PA 1SI9A 3OR1A 2R2SA 1Q8BA 3EVOA 3T1AA 5HJXA 2Z2ZA 2R8GA 3NS7B 5E3AA 1FX4A 3IBWA 4RX6A 4YQWA 3HHNB 4DL5A 2DO4A 1WKJA 4H4OA 1OPIA 1UTAA 4DR6F 4B3TJ 4I2QA 5E33A 5K8MA 2P8IA 4PG6A 1FTCA 3I4PA 1V6HA 3IGNA 1U1QA 2ZE2B 3GZ7A 4KFBB 4CLUA 2CNNB 1KLNA 1KSPA 1SJFA 1L3UA 1VBXA 4J9QA 5DETA 5AE3A 4GKJJ 5GAEI 4Q7AA 1LW0B 4PWWA 4GO5X 5DDPC 3C6TA 4EEYA 3OT9A 1PILA 2ALYB 2B9EA 2RRAA 5A8RA 4YHHJ 2A0FB 1GXTA 1O51A 2LDYA 3J7ZT 3OVAA 1TFWA 3M8ZA 2ZHOA 2WVDA 2DR7A 1RWMB 1MU2A 1BY9A 2H5EA 1S1WB 1ICEB 3FQKA 4YB7A 3AODA 1NM2A 5GMEA 2CG4A 2L9DA 5KG0A 3IMQJ 4ECVA 3JAMY 4F36A 1Q78A 3MFHA 5IFMA 4RW6B 2J0SD 5HO4A 2V50A 4P10A 2MQQA 2OKQA 2VQFJ 3HLUA 4DFJA 4PPZA 1FRLA 4OHYA 2YWKA 1UL3A 3R27A 4DL4A 1LK5A 1NPRA 1CC8A 2E9RX 4BC9A 3CCUS 2AT1B 1X5OA 3BDEA 3LW5C 3C19A 5KFFA 3IG1A 1D9FA 5LMUJ 2GX8A 3J7A1 1Z2LA 2QSWA 2OUGA 5BYQA 3I96A 2ZVIA 2BE2B 1RKJA 1G3OA 2XGQA 2DNYA 4QJVA 2D74B 2D69A 4DX7A 1GK8A 4DR3F 4FNIA 5F8MA 1QUVA 4ZCKA 2QL9B 1H2UX 2IC3A 3LAMA 1AFIA 2Q79A 4JI1J 3BQ2A 3B6BA 3HULA 2LYVA 2XLJA 4DV1F 3BF4A 3CDAA 2LCWA 3IR6B 2X1AA 2Q6CA 1VQNS 2ZH8A 1U1RA 4LF4J 2CQBA 1X4FA 2ZVSA 2JLEA 1ZAVA 3T1HJ 1R7IA 3OR2A 1HNVA 3DLKA 3W62A 1VQ4S 1VYAA 5A6PA 4KQZA 4NL5A 3HHEA 2HBYB 2HZVA 1R8CA 4A8QA 3SQGB 4UUXA 3MAQA 3A3OB 3CJ0A 2ZM6J 2ROEA 5HBMB 3DDIA 2YNHA 3X3UA 1C0UA 5B0CA 2XY6A 1Y7PA 4RU9A 4X84A 4QW8A 3M32A 3GONA 4K4UA 5BXIA 4PWUA 2H48B 4X4NA 2WW8A 3US5A 1HMVB 2FB0A 3IAS9 1WG5A 4FVMA 1M5KC 4OHZA 1UEUA 2BR0A 3R3TA 1X4BA 1X31C 5IT9Y 5LT5A 4B3OA 4Y2AA 1N88A 2KT2A 3H2VE 1JQGA 3TANA 3OFHA 2C3OA 2POKA 2MPUA 3C16B 4C3LA 3T41A 1KR4A 4ECTA 2ZDPA 5KFXA 3CJQA 1SKWA 2Z4PA 2NS1B 3RRHA 3PCOB 3VWSA 2XMVA 4OYMA 4PQAA 1RTHB 2EBEA 4TQRA 1BQNA 1RAEB 3ZNUA 4RUCA 1FA0A 1ZM9A 2B8QA 4FPIA 2LFVA 1DLOA 2I5JB 1CBKA 2CQHA 1S79A 4RO0A 4MMOA 4WFAQ 3G4SS 3R2CJ 5DS7A 4J9LA 4OHXA 1R8HA 1MMDA 3HT0A 1VRTA 4C8OA 4OI0A 3GIRA 3TUIC 4QIEA 1X5SA 2O5DA 1TL1B 4RW4B 5L9XA 4PRFA 4OZJA 3FCHA 4O4GA 3CDWA 2HFSA 2YQ1A 2FVSA 2UXBF 1G2EA 3HKZD 3LGNA 4ECRA 5KFIA 5KFVA 3CE8A 1IKWB 4Y2KA 3RTVA 3HK2A 4K5RA 2HQ3A 1VOMA 3QSIA 5HATA 1U8WA 3MMCA 1F5AA 3WZ0A 4F25A 1UVKA 1MW7A 3KXDA 4U6PA 2WB1D 3MM5A 1D8YA 3AJDA 1GTEA 2FD2A 4DR4J 3NWRA 5KFYA 2HFVA 3JQMA 1NJIT 2ABYA 4M8LA 2QE5A 2OPPA 2GQ2A 1N48A 5CHCB 3TP2A 3M30B 2B5JB 5GMKa 4ALZA 3PR5B 2VKZG 1WTFA 3AD9C 4GC7A 1DAXA 6AT1B 4S0MA 4DV7J 3I0SA 5GMDA 3GLJA 4LF7J 2CQDA 2NR0A 2DNQA 5D4PA 2RU9A 4HT7A 2KXFA 1LW2A 4XPCA 2NUHA 5HI7A 5LSOA 3OLAA 4ED0A 2CQ3A 4KIAA 2E9TA 2J8AA 3MECB 5D78A 2LKZA 2H9ZA 4M5KA 1NHVA 4JI3J 3M2VA 3CEDA 4DDFA 4RW8B 1Q8KA 2QMWA 4M5DB 2V5HG 3W5ZA 3T1YJ 4NRTA 3QATA 2I0XA 3UDLA 2DH8A 3E8OA 2CJYB 3BDPA 3OVSA 2ZUAA 5KFLA 4ZN3A 1D9AA 1WF0A 2A6MA 3FJ2A 1R8BA 1KOHA 4N7TA 2CWXA 4CM2A 1LOUA 3J7AN 2B3TB 2X1FA 3V5RA 4RW9A 1CS4B 2BJ7A 2E5JA 2OHDA 1VISA 4MFBA 4NLUA 4UQGA 4ZLPA 1RU1A 1XEZA 3PKMA 3DGVA 4LRFA 4OQJA 2KVIA 3BPSP 3GYGA 5HMYA 3TZWA 3ILLA 1PYTA 4RNMA 3MR3A 5KFHA 1LK7A 2GIFA 3TA1A 4NEZA 4LRAA 4NLGA 4DX8H 2P6SA 3PFEA 1NCLA 3LP1A 3T9NA 1TL5A 4JI7F 2DH9A 3QRQA 3HX9A 1R6YA 1ZS6A 3FSIA 3CPWR 1CQNA 1U6BA 5L9NA 1U4BA 1QVGR 1T95A 5FDLA 5DZ7A 5LMNF 2N4CA 1BQMB 2HYIB 2CRLA 3GFHA 2W4CA 3KK3B 3UD3P 3V6DB 2KJWA 5HJYA 2MZRA 4O3RA 2OO4A 3CJRA 1T9TA 1D9DA 3Q22A 5ETLA 4NLXA 1TK8A 3HP6A 1KOOA 3FC9A 4IDKB 2V2VA 4IQMA 2IVYA 2F9DA 2XCAA 2YQ3A 1WELA 4ILLA 3M9OB 1UA1A 2XG8A 1ACMB 1FXLA 2PEBA 1RT3B 3H7HB 4P2SA 4DV6F 1VQOS 1VLOA 1KHWA 1W26A 4G1QA 3EXCX 4URQU 5KTQA 2NREA 4Q44A 4LRDA 3MEDA 1A0OB 4Z37A 3DMJB 3EYZA 3BSNA 1R6VA 1HL6A 2B43A 4B9LA 4OV6A 3NGRA 2JFKA 2QG9B 3D0HE 1BXNA 3ZZYA 1Y11A 5K9FA 5KG7A 1FVQA 1P8GA 3KG0A 3D5MA 4Q8EA 3QO9B 1W2IA 3T6JA 2JHEA 1SPBP 2UVRA 3BGOP 3HHLA 4ZPDA 5J1EB 3H40A 4U8YA 3KK2B 1PKUA 2GIQA 3OD2A 2XY5A 1PCAA 3J81j 1SUQA 3ZFVA 4PKDB 1XJWB 3NAIA 2VG5A 3M6XA 1LWFB 3AJ2A 4RUHA 2AHOB 1S9EA 3GFYA 3K17A 1OY9A 2VBZA 2HHPA 2OTLS 2NXCA 5CD4H 1QAJA 3EDQB 4PABA 2NQPA 1RTIA 2OPSB 5J1NA 3LP0A 1UJ4A 2EC2A 1HNIB 5KFAA 3HCXA 1UMJA 2ZOGA 1R89A 2YBVA 4RZRA 3TWZA 3D67A 2MQ8A 4FYYB 1ULRA 1C1CB 4ETZA 1VRQC 3FFIA 5AXMA 1WOOA 2MQNA 3HJVA 2GVZB 3KUHA 2HHVA 3GG0A 3A13A 1YBAA 4UOFA 5GAGU 1OSCA 1DQAA 2XB2D 1JLBB 1AXQA 1IR2A 4PCQA 3QAEA 1SV5B 2ZBCA 2WB4A 4ER8A 4RNOA 2AP6A 4DSJA 5LSRA 1BD6A 4I4BA 2YXLA 2VG7B 4X65F 1JJHA 3KLHB 3ETOA 3NWGA 4TLQA 2DNMA 1S1UA 2BX6A 1IBMF 1Q0NA 2UZAA 3MUTP 2R7QA 1UCNA 4WXOA 3FBCA 3EPGA 2MKSA 2OPRB 1CEZA 2J0QD 1RAJA 4C11B 1QM9A 4F8RA 4WFYA 3WC2A 2COLA 2Y0BB 2UUWA 5KT7A 1U1OA 2J9EA 2KHCA 1JLQA 2R8HA 2WZ1A 5HLFB 3H5UA 4DL7A 3PIPQ 2W8LA 4HTIA 2RRBA 4DLGA 2G2ZA 3NCPA 2R8IA 4OYPA 1TZ0A 2V8PA 4ZHRB 4X4OA 3OR1B 3LF0A 4LF2A 2HHXA 3G82A 2OTJS 3JAMU 4DV3J 2V6AA 4K4YA 2DNOA 4U96A 1L3KA 3KJNB 4NA3A 4ILMA 2FYXA 2H1YA 3EMTA 4UOGA 4FYVB 4JI8F 1QE1A 3KNAA 4UZBA 1RT5A 1F2HA 4U7CA 2ZC3A 2DNNA 4I2QB 4NXNJ 8RUCA 1WKLA 1YJ9S 4NPOA 4BLGA 4AXJA 4ZJLA 1R27B 5CQGA 2KU7A 2DB1A 2XBPA 3G8TA 4X62F 5KT2A 4HL9A 1DFDA 3QAUA 1TUWA 3LWMA 1L5UA 1I94J 2IDLA 2GV1A 2UVVA 5CZVA 2ERRA 3C14A 2BM0A 5KFWA 2IY5B 1GXLA 1LEOA 4F4YA 1RYRA 5ETVA 1SJRA 4Z7CA 1RWKB 3RB6A 2HKEA 1P1TA 3SYZA 5A8RB 4KHRA 2KH9A 2EKNA 2V0NA 1B7FA 1EAYC 4LT6A 5D0GA 3TJ9A 1TKZA 3CO9A 3Q2TC 4KB7A 4WFXA 2E5HA 4Y2CA 3MPUB 1IKXA 4JUZA 3PX6A 1MU2B 4LMZA 4BWJA 4U7UK 4O44A 3VZIA 4AT1B 1UVLA 2ZUGA 1XNRJ 4HHHA 5G0RB 2RS2A 2N3OA 2OI2A 4X2BA 2BZ2A 2DEIA 4ECYA 1RWVB 3AT1B 4QR0A 4ZVGA 4YEAA 2CZ4A 5AJ3F 2WBRA 1SCJB 1U8SA 1TUVA 2CPIA 1FD2A 5HANA 5HVGA 5J1PA 2CZVC 2FJDB 3HF5A 3Q8UA 3EZUA 1GT8A 2QMUB 3B82A 4YS2A 2C2EA 5E3QA 1TR0A 2NCKL 2DJWA 4FF4A 4O0IA 4PUOA 5F8GA 4TQSA 4O3PA 2XYPB 5A0YB 2F4FA 4B9UA 2EK6A 4ZMMA 3OLBA 3UQSA 4WTOB 3GYXB 1M1HA 4DSFA 2YX4A 1NK6A 1IJFB 3QSYB 1XC9A 3L3CA 2QLJB 2B8PA 1YJRA 4NOHA 1DTTA 2EKYA 1WACA 4A8WA 4ZVHA 3AA9A 1NH8A 4FKYA 3G6ES 3BV8A 1HQEB 3O2IA 4JI5F 1X60A 1DRZA 2IFXA 2YTCA 2ZKTA 5IT9U 4JI4F 3BB5A 4DFKA 5KFEA 1M5VC 2KT3A 3QJJA 2BKNA 4MKAA 2O1PA 4KGVB 1K0TA 5F8HA 1RAIB 2CJQA 4QWCA 2QYCA 1HKAA 1S6QA 2B7BB 4CYUA 2NYIA 3BJYA 1GTHA 5CABA 3KLEA 4IOAQ 2XHCA 2G4BA 3CMQA 2W7PA 1XMOJ 2CPJA 1RHUB 1UZDA 2M8DB 3OR2B 1HNVB 2FLLA 2KG0A 5BYRA 2E66A 1X4CA 4YN3B 3GV7B 1MN7A 4YDXA 2DXDA 4TY9A 3KLGB 3W5XA 1CC7A 4MK8A 4WKRA 4R5PA 2E1CA 5F9LA 4PYDA 3RBDA 1VK3A 3ZTRA 2C3PA 2YNHB 2DPJA 4LFCF 4ZVEA 3H42A 3MF5A 4I64A 2IHR1 2BRKA 3R1HA 2GO9A 1JLAA 4CH0S 2VBWA 2C2KB 1DHMA 1KC8T 4A8MP 4FDFA 3WHIA 3GIIA 4ZLNA 3SI8A 5KG3A 4ED3A 2QGFB 3QIDA 2GZOA 3RYLA 1RT7A 3P3DA 4RW7A 1FKAF 4ED4A 2W2PP 1YRXA 3M6WA 4W92B 5MLCV 4OZ3A 1NK5A 3IS9A 1UVIA 3AB2B 2UV8A 4QWAA 3PEHA 4HH0A 5KFRA 1X4AA 3DGPB 1RWXB 4Z7YA 3T5HA 4OI3A 1VI7A 2IYGA 1N54B 5LL6d 4URGA 2FJEB 1UZHA 3G96A 2W2NP 4D3GA 3AHPA 3NBPA 2DGSA 1TL3A 2BXJA 2UVWA 1BQNB 5H9FJ 2Z58B 1U0HA 2FLNA 2AYEA 4K2XA 3W2WA 3J81Y 3FDSA 2E1MC 1DLOB 3NNCA 2X3DA 4ETXA 2YWHA 5CYJA 2YNGA 1HNZF 1KTQA 5KFBA 1WC6A 4C98A 2EG2A 5DRKA 2AZ1A 4NLOA 4NZ6A 4L3KA 3MUMP 4YP3A 4FBUA 1VJQA 1IR1A 5E7OB 3TQ1A 4KV8A 3IRXA 2PD1A 3HI9A 1HWLA 2QLWA 2XC9A 1T3NA 2BJ8A 2C2NA 4H4KC 4CLPA 4B3SF 2AX0A 2Y3YA 3D1OA 3GCWP 2PMWA 5D0HA 3PW4A 2G0IA 4DG1A 2HHHF 3GFZA 5D0EA 3KJVB 2P9CA 3Q2SC 3PR4A 4RWWA 3W61A 1S0MA 2GMJA 2E44A 3W64A 4UQTA 4K4TA 4KGKA 1U2CA 3HVAA 1XMBA 4L76A 2KJVA 1N8RT 1LKZA 3BGFA 2K06A 4C8YA 1RU2A 3M8QA 3VAGA 3FEZA 3MM5B 4GMKA 4CO5A 1YK9A 3ZTPA 2EFOA 2XTJP 2B9WA 2RQMA 2NPIA 5K8OA 1KRPA 2OPPB 3DDKA 2W9CA 1HW8A 3KG1A 1S4EA 3CC2S 3VAIA 4TU9A 2WW4A 4DF8A 3SZ2A 2EEYA 1RT6A 4OYWA 3N4WA 1R3NA 2OGUA 1LQ9A 3KFWX 3I0SB 2HGNA 4TVAB 1NDKA 3GJTB 1Y3KA 1LW2B 3R97A 4J9PA 1S0VA 4DUZF 4OYAA 3TVZA 4UT4A 4IG0B 1B0TA 3VGTA 1K1QA 2DR6A 2LQBA 3M6UA 1XR7A 1HBMB 2MQOA 1ZAWA 4JV0A 2R7SA 2AEMA 1VQ7S 2HFNA 3H2UB 3BYRA 3ISND 2MZSA 1U48A 3D66A 1FX2A 5T14A 5J2NA 1GEHA 5ETNA 2C2OB 1N5YA 2WVCA 2BANA 2M70A 3KUEA 3BO4A 3ZO7A 1SQGA 2EFVA 4RW9B 1IKVA 3W5YA 2FTRA 3CW2C 3CIZA 3A1YG 2H5IB 2OJ3A 3FK4A 1ZETA 2Y8YA 3KMQA 3UO0A 1R31A 2E5LJ 4NZ0A 1VBKA 1NDCA 4IR1A 3DRSA 4LSZB 1VHFA 1B3TA 3M05A 2WONB 3KHLA 3MEEB 4A46A 1SKSA 1H2TZ 2HBRB 4K0KJ 4W4MA 4X66F 2G2YA 1EJ7L 3IBCB 4DR5J 4A4JA 1C0TA 1DQ9A 4K4SA 1JLCA 2CQCA 1BMQB 3LP1B 2ILYA 4DPWA 1Q81T 5ETPA 3C66A 3FRYA 4KKOA 3PDNA 4X4SA 2A3JA 1S0NA 4P71A 4QIFA 1JKHA 4LFBF 4ANDA 2LXFA 5FDLB 4U95A 4ZDNA 1RP5A 2WCXA 1RT4A 2UUAJ 5LMNJ 3B4DA 2GVDA 4O23A 3QGPA 1WC3A 3DKDA 4DJBA 1SJ4P 4JI0J 3ILIA 2JH3A 1VQYA 3GWCA 3BYPA 2YKMA 2E5GA 2FJWA 1X4GA 4B08A 2HK2A 3QMQA 2CPHA 1ZM2A 2LECA 2W4PA 3OJSA 4IG3A 1OJ4A 1HD1A 3EPIA 3M6VA 1PJ7A 2B4VA 3KLIB 4NLTA 2WVBA 4G1QB 2APOA 2DEJA 2I2YA 3SQOP 3MEDB 4WKYA 4Y2MA 4X64F 2LQ5A 4ZJOA 1FE0A 1HR0F 4J90A 3H4BA 4R0JA 4F4KA 3DYAB 1Y5IB 2R2UA 4PR6A 2DGTA 1VC0A 5KFDA 4P73A 2UUCJ 1YZ7A 2A6OA 4AQYJ 4LSLB 2XNRA 3W7BA 1Q8LA 3HHLB 2QEXS 1CJVA 2ZNZA 5HL7Q 1J5EJ 2RUSA 2ZE2A 1YITS 3CGIA 5IV4A 1ZPVA 5KT4A 2E1RA 2H4YB 2QL7B 3GPAA 4WIQA 4KFBA 1SUQB 1TFYA 2VG5B 3NNHA 1U1NA 4DL3A 3BO3A 3P4UB 1S9EB 2FIUA 2EC0A 4E2FB 3BQ1A 1HARA 3NL0A 3OTBA 1LW0A 3MM8B 1FDDA 1WEYA 4DPUA 5DQHA 4YMEA 2HHUA 5KFUA 2D7SA 2DK2A 3LP0B 1KEKA 3U27A 4DSKA 3HHLC 3N6MA 2KDOA 5IWAJ 2ADBA 1ZBTA 2C1EB 5K14B 1S1WA 3GTYX 2MHEA 4QYZK 1VQ5S 2DRAA 3CC4S 1VC6A 4RW6A 4RBUA 4WU2A 1VDHA 1S48A 4A8YA 1PJ6A 2CYYA 4DPTA 4NMXA 4WFZA 2MMYA 3DLEA 2X1BA 3EUNA 3DCAA 3C3LA 4FYWB 3UD4P 5HP1B 4F50A 3N0VA 2MJNA 3BKUA 1IBMJ 3W8GA 2QLBB 1V3RA 4DQRA 2R4FA 1JJ2R 1VFJA 4BHQA 4MKBA 5DQIA 2D1CA 4NLPA 4UOHA 1SJ1A 2HLUA 1JXVA 4C8MA 5HSPA 3C15A 2GQQA 4PG4A 3GCXP 4C6AA 4FZVA 2B56A 2BEFA 1PAUB 3AQPA 4Y28C 1RLCL 1EETB 1Q95G 4USUA 4F26A 3DOLB 4K59A 3GU0A 3G82B 4RBVA 1JX4A 3EM1A 2JDJA 2XO7A 2HPUA 1S77D 1TVRA 3UCUP 3UVJA 2PE8A 2R3VA 3Q86A 2CDQA 3MCMA 1GQEA 4DSEA 3HM9A 4NX9A 1OMSA 1B0PA 4ECUA 1WG4A 4QPXA 2Y1LB 3BR9A 2DGVA 5EWFA 1NZ8A 3CDUA 3FCVA 4MIBA 2V4JA 2KFZA 1I6JA 4ZKAA 2B0GA 2VODA 3LA0A 4KHPF 2RDJA 2R2RA 2BOPA 3C14B 2PFFB 4KGXB 1YJWS 4YY3F 3RR7A 2DY1A 3R7BB 4NYZA 4DR1F 3DOKA 4LVOP 3NNAA 2A18A 3ZXWA 3ENVA 4CCHA 1W25A 4OYOA 3R1LA 2XZDB 4UTGA 2KO1A 4EBCA 3QYYA 2YQ0A 2MHNA 2OFGX 5DLFA 1IKXB 3MMAA 3CWJA 3PRBA 3PNIA 4QIVA 4O44B 2XS2A 1GMWA 3QZ7A 3ZZTA 3D28A 3VHQA 4IFYA 2QV6A 3NEKA 2D41A 3JSRA 2CQ1A 2MSTA 2GJFA 4P2XA 3D6FB 3R9LA 4DV2J 1TL7A 2XHWA 2BUNA 3NGTA 3AQOA 5E3PA 4ZP9A 3C16A 4DPYA 3MCNA 3O44A 2YH0A 3AH6A 2LQ9A 1X8DA 1N34J 3I0RA 2F4VJ 4YR2A 5JVGQ 2HHWA 4ES1A 4HHUA 1J27A 2AJ2A 4LREA 2GGPB 4ED7A 1RTHA 1IM6A 1VBYA 2A2DA 5JMNA 1KQSR 3KWMA 3D2WA 3RU0A 3VAJA 1KBRA 4CO3A 4ELVA 2JSXA 5I3QA 2GAHC 4ZOSA 4DQSA 4DCOB 4M5GA 4M1KA 1SVDA 4LF8F 2VUGA 4EZ6A 1DTTB 3HMJG 5E2QA 3DFEA 4ES2A 4NCGB 2FY8A 3EGVA 4CH1A 3N6NA 3PJ9A 1XIQA 4FS2A 1TTHB 4FXDA 1FRJA 1RWUA 1APSA 4MKYA 3H4DA 1WC1A 3B54A 2FVQA 2PI5A 2OD4A 4JI4J 2GQCA 4URSA 1URRA 2ZJPQ 4DUYF 5LJ3Y 3PYGA 2Q66A 3JSBA 2KM8C 1SKRA 2GMHA 4N8OA 3OL8A 4NXMF 1NB2A 1FEEA 1NKCA 3KLEB 2UP1A 4F0KA 2FC9A 3NG8A 5D4NA 2GHWA 4AUKA 4DFPA 1C4CA 1AUDA 3CJ4A 2EVZA 3R8YA 3W65A 3CCTA 3OUYB 2V2KA 4UUWA 2DISA 2RF2B 4XPEA 3M2UA 5AXKA 1UFKA 2V68A 1DY3A 2EW9A 3DNCA 3PW7A 2VBYA 1YBTA 3Q24A 3TUJC 2PFDA 2BABA 2ZHBA 3OHAA 2V8HA 1QTNB 4USTA 1XNQF 2QA1A 3F73A 3T5LA 4FPRA 1JLAB 4KRWA 4E8UA 3MWBA 1UJ6A 2F8EX 4ZPTR 3HSDA 3QZ8A 3LPEA 4I1TA 1TMJA 2F1FA 4O3NA 4XDCA 4RKUC 1RT7B 2E29A 4RW7B 4LF5F 2LEAA 1WC5A 3AXMA 5IT0A 5C7PA 2J7WA 3MM6A 4RW8A 2R7RA 4M5DA 3KDNA 3IS9B 4KBIA 3CIMA 1RKIA 2ZH1A 3D6TB 1RAHB 4PWDB 1T03A 2NYHA 3UW1A 3VVUA 3TZXA 5EGYA 1TAQA 4Y34A 3NBPB 1TL3B 1GXUA 2ZBQA 2B51A 4LFAF 3KK1A 2VONA 2NXUA 4IO9Q 2CAJA 4OYIA 3EZ5A 1AYEA 1T7PA 2YNGB 2AJ4A 3RAXA 2ZH3A 3LGHA 2F9JA 4F3OA 3MM7A 4DFMA 1K47A 2IYIA 9RUBA 1WDTA 1SQEA 2UXDJ 3FBBA 2GJIA 2Z30B 1YRTA 2HURA 5IOLA 2JVRA 4KV8B 2FY1A 3IRXB 2VQEF 4B3RJ 3QNWB 4PXEA 3NGKA 1WJ9A 1AW0A 2F65A 1KFDA 5DLGA 3PV8A 1FJGJ 4ELTA 4RNNA 3TARA 4HH1A 2VHGA 3TI0A 1BE4A 1JLFA 3IAM9 1HYSB 1MWZA 2X7IA 3OBIA 2AMCB 4DU8A 4USMA 1GNKA 3V6DA 5KT6A 1ZA2B 3BKTA 1FWPA 4IQXA 2LQJA 1ZM3A 3CCLS 2XZTB 1CPZA 2AWZA 2DIUA 2VIHA 4DN0A 4IDKA 3GV5B 4OJ3A 2KZMA 2HHTA 4O0NA 3AJ1A 4QZVB 2C28A 2EPIA 1AA1B 5GVQA 3CJKB 3PX0A 1N32J 3QT5A 1SC1B 2G2OA 3BPDA 1RT6B 3TVKA 3FBEA 3QLHA 1Q7LB 3DM2A 3IM9A 2Q1LA 2JEIA 2KKHA 1VJWA 1RTDA 2I38A 1H72C 1F60B 4RWXA 2M2BA 3UPFA 4NI2B 2UU9F 1WEXA 1J2VA 2W7AA 1IWGA 2DY9A 4IOCQ 3GP9A 1RAGB 5SZTA 1BLUA 2VC0A 4DUZJ 2QC3A 2GA7A 2HNDA 1EZZB 5KT3A 3N01A 4RLEA 1LWXA 1YTYA 4OZ1A 4FF2A 4CT9A 5J1EA 3V4IB 2BJ3A 3EZOA 5HAOA 3GSIA 4QR2A 1N5YB 3GIMA 2BANB 4LQ9A 1B64A 5AXLA 5C42B 3OTEA 3DI6B 3A8KA 1Q5VA 4J9RA 4WE1A 5GADU 2G0CA 2FLPA 3GFXA 1IKVB 2F40A 2R7UA 4WU3A 1UW9A 3SDEB 2HRYA 3ILOA 1OY8A 5LJ5Y 2WOMA 4FS1A 3OTOF 4N5SA 2HQFA 4P2FA 4JOUA 4YUDA 1HNIA 3X1LB 3ZZUA 2D9OA 4ZITA 1GFWB 3GQCA 2RQCA 4DI6A 4F0MA 3ADAC 3OSNA 4NLRA 1JLCB 5IQ6A 4YFUA 1VQPS 1IBKJ 1XERA 4U7UD 3DRPA 2I8EA 1HBOA 1XK8A 3M4XA 5M2PA 4KKOB 4USHA 4G65A 1CSJA 2ZJQQ 1JKHB 1LXNA 5CYQB 3IWXA 5HVFA 1RABB 4CLZA 1N5TA 3KG4A 2R7XA 3M8RA 2IPOB 1A9NB 1RLDA 3D68A 3B8HA 4IH5A 3W8PA 3HO1A 2VG7A 4B02A 4CH7A 4LF6J 7AT1B 2OPQB 1UWBA 3OTDA 1KFSA 3MCOA 2L08A 5EX0A 1RI7A 1N33J 4P72A 4DS4A 1RXOB 2OPRA 4C11A 2EFQA 5T7LA 2F5GA 3MD1A 4M5HA 1QSYA 3I4HX 4G6VB 5HLFA 2ZNYA 3JXOA 1HNXJ 2VV5A 2BV3A 1ZH5A 3V6JA 1TU0B 1FHTA 2V4RA 4A8SA 4QPTA 1IN0A 1H38A 2HW3A 1S5ZA 4FP9A 1DQ8A 1URNA 3CD7A 2CPDA 2J9DE 1S1XA 2KXNB 4LF9F 1U45A 3K57A 3QFWA 4ICLB 3QT8A 2P5VA 3PHEA 2MKCA 4OLOA 4MYUA 2KYZA 3DDNA 3HXMA 4LJMA 1SIWB 3WQPA 4CLFA 4GKKJ 1RACB 3CULA 1X0PA 2VPYB 4Q2MA 2DNKA 4QYRA 1CJVB 5JVHQ 1N0UA 3V2UC 5DM7Q 1SBRA 1PG5B 1NAQA 1MLAA 2W8KA 4O3OA 3OXFA 4JI6F 2OH2A 2ZWPA 5B0FA 3TRGA 3CDEA 1M5OC 1S12A 2HS0A 3OXGA 3CF5Q 2HK3A 1UP1A 3JTNA 5BYSA 3MR5A 4KAIA 2M8HA 2IA0A 3AOAA 2CQ0A 4FF1A 3M8PA 1QLNA 2DTJA 1S1VA 4L75A 2Z57B 1T0TV 1BWEA 4QWDA 4I69A 4ZVPB 1SJQA 2K7JA 2GHPA 1HHTP 1FEHA 2W9AA 4MH8A 4RU2A 4OX8A 2CPEA 2DIVA 5KFPA 1IUJA 2B7CB 3IXQA 4DPXA 1S6OA 1WHYA 3TW0A 1MMNA 2GNKA 4B3TF 4ZPCA 3S6EA 3MD3A 3CCZA 1REVA 2VFTA 5G0RA 2B6AA 3K5NA 3JYTB 2IRUA 4CLWA 3R5CA 4TYAA 4WWSA 1HW9A 2V63A 4JYAJ 2D9PA 4DR2J 1HPZA 2QA4G 3DLEB 3GSDA 4GKJF 4OYZA 2RS8A 2WSFC 3HDSA 2V69A 3RRKA 2PEHA 2HHSA 3GIKA 5DG9A 3LH2S 8AT1B 2EFNA 4C48A 2DGWA 4YHHF 1OYEA 3Q8QB 5A0YA 4DR7J 2FUG9 1C4AA 4WP8A 2PMZD 4X4PA 2VC1A 3G2XA 3RZAA 1RTJB 1FK9B 3C15B 5CH7B 3LTOA 2W2MP 1GMVA 3NOCA 1SIZA 2IJRA 1WTBA 4CQ1A 3A8EA 1HQEA 1NU4A 4JBCA 1Q7YT 3TZZA 1T9XA 1U24A 1TV6B 4DZDA 4AFFA 1O5JA 5IS2A 1V5IB 2IA6A 2MKYA 2YX1A 1XTZA 2DNPA 5KFJA 3DLHA 1UVMA 1TVRB 2HIYA 2VQFF 3UVJB 3M2RB 4MT1A 1KLMA 4OHWA 4CM0A 1RWOB 2BKOA 4PG7A 1S6PA 2BJ1A 2KRBA 3VQSA 1KDNA 5E3CA 5A2QU 1EQ0A 4H54A 2Y9HA 2VL1A 4OHVA 3H0PA 2PA3A 1U49A 4KYZA 2NPFA 2HRTA 2V4JB 4DU7A 2C3YA 2L3MA 2EWHA 1U2FA 5LMUF 3GYNA 5D6GA 2XNQA 4OL8A 3HSJA 2XI2A 3BS9A 3KLGA 2G13A 4KHPJ 4R8UA 4LBHA 2XLIA 1NK4A 3DOKB 4I2PB 3TUZC 3FMWA 4OLPA 7FD1A 3PJXA 3CCES 1ZM4A 1A6LA 1VLYA 5D77A 1QSLA 2W1BA 2PO4A 1WC4A 3ZC4A 3CJTA 4JI1F 2VU5A 4YB6A 2YKPA 3R2DJ 5C25A 3PM9A 3MMAB 4OZ0A 4LQ3A 4ZVTB 4EGLA 2C2RA 1GMWD 4IFYB 2OMLA 4HLBA 1YWXA 2HVZA 1FCAA 3BH6B 3MM9A 3T1HF 2KFNA 1TL7B 5B0BA 4IH7A 3DGPA 5F3ZA 5D4LA 1TKTB 3HFKA 1SQFA 3WC0A 2ZM6F 2DBBA 3CDBA 1UEKA 1K0VA 3I0RB 3HHKA 2FGCA 4H4KA 3CT9A 4UZCA 1JJCB 1HWUA 6FD1A 4HDHA 4PG8A 4DL2A 4MK9A 1VC5A 1FESA 2NXNA 2LU2A 1HIYA 2R8KA 5F8NA 4OX9J 4F4ZA 2W4DA 4W90B 1KHVA 3MDFA 3RW7A 5BR8J 1TELA 3AD7C 4I0WA 1D3WA 5KFQA 1H74A 2RD5C 3RR8A 1VRUA 1AZSA 3KLVA 4QU7A 2LDIA 3KJVA 4O3SA 4M5LA 1NK7A 3PXGa 2X1GA 3CMES 3NMAA 4WFNQ 3OV7A 4DV4J 3U7JA 3ULHA 5C24A 4NXMJ 1W2BR 4DX5A 2ATCB 2ASLA 3MR6A 1X7VA 1N4LA 3H5SA 3U02A 3DN9A 1S7HA 3M2UB 3RRGA 2C2ZB 1EX8A 2LQ8A 1A7GE 3JTOA 1QAIA 4TYBA 4U67Q 2AJ0A 2MZJA 4EFAC 2JJ4D 4NE9C 3K8VA 1N6QA 3CCWA 3UFCX 4NEYA 3SSRA 2GW8A 3G8SA 4ECZA 1OY6A 1JIHA 2UXCJ 3VVTA 1LNQA 1WDDA 4IO1A 3M7VA 4JV2A 5A8WA 4X4RA 4IG0A 1UVNA 1KQGB 5FIIA 3AOBA 1JK9B 1D09B 1HQ2A 1O0PA 3HD2A 4LF5J 3SSSA 1Y3JA 3MM6B 3K5LA 1HBMA 1NDPA 1Y5NB 4ES3A 5FD1A 2BVZA 3PG9A 4WZMA 1WHWA 4QWBA 2QIFA 2DHAA 1UKUA 1CQMA 1FJ7A 1T03B 4DF4A 3MI7X 1N5VA 1YJUA 4C8NA 3OFEA 4YR3A 4FNHA 4DCPB 4OZ5A 4RR5A 1MMLA 3BH7B 4F2RA 4PYAA 1LV5A 3JB9k 4DV7F 1FFGB 3UWTA 2J76E 2DR9A 1H73A 3KK1B 4LF7F 2KN4A 2EBGA 1Q79A 4IRDA 1RYSA 3UI3A 1FKPA 3CVKA 1MWQA 1WNEA 2JOQA 4DHVA 3MM7B 2HWHA 2M7SA 2WONA 3MEEA 1Y5LB 1Y10A 1Z1ZA 4M5MA 4JI3F 3BBBA 2HG4A 4Q45A 3PVXA 2QLFB 2IJNA 3T1YF 3SV3A 3BQ0A 2XY7A 3LOUA 2I6WA 4FN5A 2OEJA 3DU5A 3BSAA 1SKUB 2UUBJ 2QFIA 2RH3A 2PDAA 4JP8A 1JLFB 5B0GA 2CNOB 2JNJA 3VQTA 1QJHA 4KY3A 2YX7A 2GCFA 1QDUB 4K4WA 2VZ9A 3PYDA 4USJC 1YDLA 2D3OR 2ASYA 3KNGA 5ETOA 1T02A 1SL2A 3OJUA 4KO0A 4K7QA 3R6GB 1AFJA 1OO0B 1S6UA 3ZNJ1 2B4UA 4TLRA 5C5JA 4WF9Q 3TX0A 4DOZA 1RA6A 3MAHA 4ZP7A 2CJBA 2XULA 4FXWA 3HVRA 1XMQJ 4OYXA 4EO8A 3KLIA 2FVPA 3QLHB 3DM2B 1RDRA 5K8PA 1E6YB 1FRMA 1SH3A 1RTDB 3AFGA 4K2JA 1G1XA 3M8YA 4ATNA 5I3PA 2FDNA 3E01A 1CJTB 4L6V3 3TAPA 1S57A 2OSQA 2G9OA 2JLFA 4WP3A 3DYAA 3BSCA 1SC3B 4BS2A 2HNDB 3SV4A 4CWBA 3Q8VA 4CIOA 2YWEA 4ZVFA 4LSLA 4P7VA 3KLFA 2XQCA 2K7KA 4Y00A 4J9SA 4ANEA 1K1SA 3IRWP 2ZEJA 4ZPAA 5JJBA 2IMOA 3A3PB 3Q0AA 4WE1B 3K5OA 3NCRA 3CJ3A 1NJYA 2B4OA 2ASJA 2ROGA 2WOMB 3MM8A 4NASA 3N9UC 5B0DA 3K59A 5K5MA 1HLWA 4LUBA 1AT1B 4M94A 1PBUA 1HI8A 2MKKA 5H9EK 3IFEA 2AJFE 2NZ4A 3MGJA 3ELHA 2MSSA 1UA0A 4CI0B 1IBCB 4X4QA 2V9WA 5K14A 2DKOB 3T3FA 1Q1KA 1G7CB 3DRPB 3VCDA 3UCGA 2I9SA 1HBOB 4J9MA 3FKBA 4KH0B 2W01A 2BQ3A 4P75A 3HHDA 1NMEB 4K4XA 3DRRB 2FC8A 4DV0F 1Q5YA 4DL0C 5DQGA 5J2QB 4R25A 5E41A 5ETSA 2XMTA 4CLYA 3LANA 5IZHA 2V9KA 1R8AA 3IWNC 1KVIA 1O6XA 2J0XA 1WOSA 5HP1A 1NRKA 2HEKA 1P27B 1UWBB 2RNEA 1X9MA 3I56S 3KDOA 5HMXA 3EVMA 4AL7A 3G8QA 3ISZA 2BW7A 1OQ3A 2XMUA 1Y4ZB 1FXRA 2ZKUA 1HNWJ 1WG1A 1HD0A 1FRXA 2DNHA 2DHXA 1RHQB 4M63A 5T7LB 4EI2A 4Q5VA 1GX5A 1BHNA 3K0JA 1TUGB 3OSPA 3KYLA 3THPA 2LA6A 2MZQA 2RSQA 2VFRA 4NLYA 4PG5A 4U9RA 5IV3A 1EETA 4DLEA 5KFGA 1N36J 4LF1A 3DOLA 2LMIA 4L72B 3MMJA 4DV5F 1RHKB 1WWHA 2VD3A 1RA7A 3HD1A 1S1XB 3CJ2A 2E5IA 2Y0SD 3CD0A 3LO3A 3MURP 1HI0P 4C9DA 3P45B 1IQTA 1BWVA 3JQKA 4DR6J 2IAJA 2RRNA 5I3UB 1RISA 3I5CA 5JUMA 3NGUA 3I55S 1MNEA 2HHQA 2Y1JA 3DXBA 2N4DA 3MMBA 4M5IA 1Q8IA 2DYAA 1TK0A 4I6AA 2YNFB 1HBUB 2MY7A 4USIA 1SJ3P 4C8ZA 2JX2A 4OV1A 4ZP8A 1EP4B 3M8PB 1S1VB 2ZH5A 4OI2A 1SH0A 1F9EB 2VG6B 5FLXY 4C2MA 3CD6S
chains in the Genus database with same CATH topology
3ELHA 3VGSA 2HVDA 1KDNA 2NCKL 4F36A 4HR2A 1S57A 1XQIA 2DXFA 3B6BA 3PJ9A 1XIQA 4ANDA 3EM1A 1NDPA 1W7WA 1NDLA 1WKKA 1LEOA 1MN7A 1MN9A 1HHQA 2DXDA 3FBEA 4F4AA 3B54A 1NLKL 3ZTPA 3BBCA 3FBBA 1F3FA 1NCLA 3Q8VA 3ZTOA 1K44A 2HURA 3NGRA 5IOLA 3ZTRA 1NSKL 3FKBA 2B8PA 3DKDA 3Q86A 1ZS6A 3G2XA 1B99A 3FBFA 4EK2A 3EE3A 5CAAA 3R9LA 3ZTQA 2DXEA 1U8WA 4DI6A 3GPAA 4FKYA 3MPDA 2DY9A 3NGTA 4ANEA 5C7PA 3GP9A 1VYAA 3BH7B 4WBFA 1HIYA 3Q83A 1BUXA 4FKXA 1NB2A 1NSPA 4W98A 3ZTSA 1S5ZA 2ZUAA 3BBFA 3EICA 3EJMA 2AZ1A 4UOFA 3NGUA 4ENOA 1NHKL 3FCVA 1NDCA 3EMTA 3EVWA 4UOGA 1LWXA 1B4SA 1PAEX 2HVEA 1BE4A 3VGUA 3DDIA 3Q89A 4DUTA 2VU5A 1NDKA 2B8QA 3EVMA 3FCWA 2DYAA 3VVUA 1PKUA 4UOHA 3WX8A 1F6TA 1JXVA 1WKLA 3FC9A 3PRVA 3ENAA 3VGVA 2AZ3A 3EVOA 3L7UA 4C6AA 1HLWA 2CWKA 1EHWA 2BEFA 3NGSA 5BXIA 1NSQA 3VVTA 4CP5A 1BHNA 3VGTA 4ANCA 4DZ6A 2BX6A 3ETMA 3BBBA 5CABA 4O0NA 3JS9A 3Q8UA 4S0MA 1NPKA 1NUEA 1UCNA 3BH6B 3Q8YA 3FBCA 1WKJA 1S59A 4KPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ELH A;  3VGS A;  2HVD A;  1KDN A;  2NCK L;  4F36 A;  4HR2 A;  1S57 A;  1XQI A;  2DXF A;  3B6B A;  3PJ9 A;  1XIQ A;  4AND A;  3EM1 A;  1NDP A;  1W7W A;  1NDL A;  1WKK A;  1LEO A;  1MN7 A;  1MN9 A;  1HHQ A;  2DXD A;  3FBE A;  4F4A A;  3B54 A;  1NLK L;  3ZTP A;  3BBC A;  3FBB A;  1F3F A;  1NCL A;  3Q8V A;  3ZTO A;  1K44 A;  2HUR A;  3NGR A;  5IOL A;  3ZTR A;  1NSK L;  3FKB A;  2B8P A;  3DKD A;  3Q86 A;  1ZS6 A;  3G2X A;  1B99 A;  3FBF A;  4EK2 A;  3EE3 A;  5CAA A;  3R9L A;  3ZTQ A;  2DXE A;  1U8W A;  4DI6 A;  3GPA A;  4FKY A;  3MPD A;  2DY9 A;  3NGT A;  4ANE A;  5C7P A;  3GP9 A;  1VYA A;  3BH7 B;  4WBF A;  1HIY A;  3Q83 A;  1BUX A;  4FKX A;  1NB2 A;  1NSP A;  4W98 A;  3ZTS A;  1S5Z A;  2ZUA A;  3BBF A;  3EIC A;  3EJM A;  2AZ1 A;  4UOF A;  3NGU A;  4ENO A;  1NHK L;  3FCV A;  1NDC A;  3EMT A;  3EVW A;  4UOG A;  1LWX A;  1B4S A;  1PAE X;  2HVE A;  1BE4 A;  3VGU A;  3DDI A;  3Q89 A;  4DUT A;  2VU5 A;  1NDK A;  2B8Q A;  3EVM A;  3FCW A;  2DYA A;  3VVU A;  1PKU A;  4UOH A;  3WX8 A;  1F6T A;  1JXV A;  1WKL A;  3FC9 A;  3PRV A;  3ENA A;  3VGV A;  2AZ3 A;  3EVO A;  3L7U A;  4C6A A;  1HLW A;  2CWK A;  1EHW A;  2BEF A;  3NGS A;  5BXI A;  1NSQ A;  3VVT A;  4CP5 A;  1BHN A;  3VGT A;  4ANC A;  4DZ6 A;  2BX6 A;  3ETM A;  3BBB A;  5CAB A;  4O0N A;  3JS9 A;  3Q8U A;  4S0M A;  1NPK A;  1NUE A;  1UCN A;  3BH6 B;  3Q8Y A;  3FBC A;  1WKJ A;  1S59 A;  4KPC A; 
#chains in the Genus database with same CATH topology
 2CPX A;  3TOQ A;  5KFT A;  1H7X A;  1DUR A;  5HQ8 A;  4DV3 F;  1P9Y A;  5F41 A;  2J9D A;  2P9E A;  2XS5 A;  4Z2X A;  2ZC4 A;  3R5D A;  1Q16 B;  1DTQ A;  1SC4 B;  3EDR B;  1IWA A;  1X9W A;  3FGV A;  4I6Y A;  5MAO A;  4N56 A;  1CJK A;  4MKV A;  4KPY A;  4ZCI A;  1WSV A;  3WIU A;  1NEE A;  4B9T A;  4HT5 A;  4NXN F;  4OJH A;  3V6K A;  1F1B B;  2V2Z A;  1REV B;  1CLF A;  5CAA A;  2B6A B;  2VDH A;  4QR1 A;  4LSN A;  4KC5 A;  3M1V A;  4JB8 B;  5A76 A;  4OJG A;  3QWU A;  3DLJ A;  4K4V A;  4ENO A;  4OX7 A;  2KL8 A;  1P9Q C;  5CYM A;  1I94 F;  5F9N A;  1HPZ B;  3W9H A;  2DHH A;  3B4M A;  4MIA A;  4RJV A;  2ZBP A;  2GGP A;  2Z0G A;  1LWC A;  2BQU A;  3D0I E;  3GG1 A;  4V19 J;  1XR6 A;  1U25 A;  1JB0 C;  4ANC A;  1IKY B;  1NBE B;  4IRK A;  1DBD A;  2K1R A;  5KFC A;  1LFP A;  4QCL A;  9ATC B;  2QL5 B;  1YJ7 A;  2DT9 A;  3JTP A;  4EO6 A;  4NCG A;  5GAH U;  2ADC A;  3O3L A;  1RZM A;  1XNR F;  1UET A;  4QYZ J;  4LIR A;  1Q4R A;  1IQZ A;  1YIJ S;  5F0U A;  2O67 A;  2V8G A;  1S49 A;  4UW2 A;  2W9B A;  2MXY A;  5IXU A;  4B3M F;  3QGI A;  1U1L A;  3NAH A;  5B08 A;  1JLE B;  4DR3 J;  1V9O A;  5KFN A;  2XGP A;  2XSJ A;  2K2P A;  4RUA A;  2F8H A;  4CTA A;  1BUX A;  4ZVU B;  1VQ9 S;  1R0B G;  1KVK A;  1KLM B;  3Q23 A;  3GV8 B;  2JLG A;  4DV1 J;  1M0S A;  1JJ4 A;  2XSF A;  1S6P B;  2N7Y A;  1EB0 A;  1B4S A;  3F56 A;  2DH7 A;  2JC1 A;  4K5S A;  2GAG C;  1TMM A;  2YPY A;  2EK1 A;  1FNM A;  2FJV A;  3OUY A;  2K3K A;  1RBA A;  4OI4 A;  3PKY A;  5KT5 A;  4MK7 A;  3PO4 A;  2RF2 A;  4K8R A;  4NA1 A;  1M5H A;  5DGA A;  1X4H A;  3RW6 A;  4USV A;  1I1G A;  4R8U B;  3QPI A;  4R0E A;  3OHB A;  1KD1 T;  1F2G A;  3I82 A;  5EHH A;  2E7W A;  4ECX A;  5HQM A;  3I5B A;  3LQV A;  5J2M B;  2MKI A;  5B09 A;  2BJE A;  2VFV A;  2FZG B;  3P49 B;  3SFG A;  1YG0 A;  2MLX A;  4GO7 X;  1Y0H A;  4K4Z A;  5C25 B;  1Q86 T;  2IRY A;  4B9N A;  4TU8 A;  4EUV A;  5AE2 A;  2JL9 A;  3S01 A;  1MRO A;  1XMO F;  3M8S A;  2R7T A;  2BJD A;  2HQG A;  2DNR A;  3MM9 B;  2U1A A;  2I1R A;  4ECQ A;  4N77 A;  5L46 A;  2HFU A;  4HKQ A;  2YWG A;  5DJB A;  2CNK B;  4RL1 A;  1XWL A;  5F8L A;  1TL4 A;  1TP7 A;  4PWD A;  2FHO B;  3JSM B;  2IJF A;  4NLD A;  4M5J A;  1OPZ A;  5CA5 A;  4L3N A;  3W66 A;  3FSX A;  4DPO A;  3JS9 A;  1OWX A;  2L41 A;  1HFE L;  2G0J A;  2KZZ A;  2HZA A;  2M4M A;  3THT A;  4DBQ A;  2DXF A;  4HVZ A;  4C8K A;  1UFW A;  4KH1 B;  4PXB A;  2VF3 A;  1ITP A;  1HBN B;  2C42 A;  3LP2 B;  3MPY A;  4XAK A;  5IM0 A;  5SUH A;  2OEM A;  4NYP A;  2ALZ A;  3SCK E;  3BGL A;  4QW9 A;  4XTT A;  2PGC A;  4ZLJ A;  2AW0 A;  2BW2 A;  1R8P A;  2FJA B;  2MGZ A;  2BBE A;  3BEG B;  4YR0 A;  2FLO A;  3QFH A;  1U6F A;  1SL1 A;  1VRU B;  2CQG A;  1NPP A;  5I4M A;  4L74 A;  1AZS B;  2UXB J;  2KFY A;  5D8H B;  2M9K A;  3CCJ S;  1D1U A;  2CFX A;  3SCL E;  1AUS L;  5KOX A;  3RBE A;  5E0O A;  1U2R A;  1FNX H;  1HYS A;  4HYK A;  5KOW A;  2W25 A;  4NZ7 A;  3AXK A;  5C24 B;  2V8D A;  3P6Y C;  5A8K A;  3VV2 B;  2ZWO A;  2YKO A;  4A8K A;  2VPW B;  4I7F A;  2RML A;  3H5Y A;  2IRX A;  2NSC A;  4ED8 A;  3UDV A;  2XWY A;  3CJK A;  2AYG A;  1JNZ B;  2RAQ A;  2VJU A;  4KJI A;  2VAS A;  4FBT A;  1T05 A;  2G1H A;  2VOO A;  5E5N A;  3ILJ A;  2DCU B;  4DN9 A;  4F7V A;  4X4U A;  2HFO A;  4B9V A;  3Q8P B;  5DG8 A;  1PO6 A;  1N6Q B;  1U1K A;  1YVF A;  2MB0 B;  1WD6 A;  4USW A;  4K50 A;  3BZQ A;  1KKH A;  3TQE A;  4NI2 A;  3A8I A;  4QBU A;  4YOE A;  2C2D A;  1V5V A;  3VAL A;  1M5P C;  5A8W B;  1VQ6 S;  1HWK A;  1NB7 A;  1XN9 A;  4MYT A;  3RB3 A;  3N5F A;  3K7R A;  5GAD I;  4P2M A;  5BJR A;  5KFS A;  3NRB A;  3E2E A;  2WBM A;  4ZP6 A;  2R2T A;  2H65 B;  1Q82 T;  1ZA1 B;  1B70 B;  1OS5 A;  3PFO A;  3V4I A;  1ARO P;  2YNI A;  2ZH9 A;  1UVJ A;  5C42 A;  3DI6 A;  4E0D A;  3PW5 A;  2XI3 A;  2HNZ A;  3MOZ A;  3UD5 A;  3K5M A;  3IR5 B;  2YKN A;  3CCS S;  4J9O A;  2ZBR A;  3O8W A;  4P74 A;  3SDE A;  2N7C A;  3E3X A;  5CD4 A;  3LUY A;  2XO6 A;  4Q8F A;  1IVZ A;  2AGQ A;  2QT7 A;  1G6B A;  4Q2L A;  3TZY A;  3Q8S B;  4C3M A;  2HVH A;  1FKP B;  3EE3 A;  3IBF B;  4WK3 A;  1UJ5 A;  1QVF R;  4WCE Q;  1P1L A;  4CO0 A;  2LP4 A;  3PW2 A;  3MPD A;  3IGV A;  3L7O A;  3OFF A;  4OX6 A;  1T11 A;  5ETK A;  4DXL A;  2ZOM A;  4AYB D;  3TEH B;  2AD9 A;  2E1P A;  2RB7 A;  2VPZ B;  1HWJ A;  3QT6 A;  1UWA A;  2OIH A;  4JI7 J;  1KWM A;  3W2V B;  2RQK A;  2ROP A;  1H0H B;  1NK9 A;  1PGZ A;  2QZ8 A;  2IM3 A;  2H5J B;  1YHQ S;  2HWI A;  5CYQ A;  5C2C A;  1U09 A;  3RB0 A;  2N3L A;  3TYT A;  2GJ2 A;  4G1I A;  2DO0 A;  1VQS A;  2LXI A;  4LR7 A;  4AE5 A;  3I9Z A;  2KI2 A;  4FYD A;  3PEJ A;  3R5B A;  2MQL A;  3MOJ B;  1HI1 A;  4TKT A;  2OPQ A;  3K5P A;  2E5L F;  4KO0 B;  3R5G A;  1VS3 A;  1HHQ A;  1FDA A;  1RT1 B;  2E1A A;  3D9B A;  4C0O C;  3MTJ A;  1IJE B;  1PJ5 A;  1VIO A;  5ETM A;  3PW0 A;  2A10 A;  4FYX B;  4ZLL A;  4KTQ A;  1FWL A;  4K0K F;  3HFZ B;  3THV A;  3AB4 B;  4BWM A;  4GC6 A;  4LRC A;  4DR5 F;  3MXH P;  4DV6 J;  4W98 A;  2CAD A;  3EJM A;  1R0C B;  5L1I A;  1S1T A;  4CLT A;  4PAA A;  2G1D A;  3E01 B;  1FFS B;  4NCA A;  2RJZ A;  2HFZ A;  4ILR A;  4ICL A;  1UPM B;  3U1M A;  3QIP B;  2UUA F;  3H8Y A;  1X4D A;  3DXS X;  1QAX A;  2FHM A;  4JI0 F;  3KLF B;  5J2P A;  4DCJ B;  1RSC A;  4XK8 C;  3UNY A;  2AU0 A;  3HHL D;  3OL6 A;  3J7Y U;  2L48 A;  3G71 S;  5CCL A;  2GML A;  3G86 A;  3FBF A;  1NO8 A;  4J7C A;  5HMW A;  3SSQ A;  4JV5 F;  2VDI A;  3SBM A;  3ZTQ A;  3I32 A;  4RPF A;  4CO4 A;  4LIW A;  2DGQ A;  2QSF A;  2AKW B;  2XWX A;  3WX4 A;  2XCP A;  3RGI A;  2R7W A;  4PXC A;  2ACY A;  5KG1 A;  3MTK A;  2ZD1 A;  4ED5 A;  4F4W A;  4CLL A;  3WIV A;  3I5A A;  1FRK A;  1S0O A;  3PIO Q;  1EKS A;  2UUC F;  4AQY F;  3A8J A;  4UOC A;  4TXS A;  3PO5 A;  1YI2 S;  5EN1 A;  2YWW A;  2HLT A;  3KHG A;  3T6B A;  1J5E F;  2BDP A;  3JYT A;  3TAM B;  3ET6 A;  4QOT A;  1IXK A;  2QMX A;  3FVY A;  2HQD A;  4J91 A;  1N0V C;  3OVB A;  1H6K X;  1IR0 A;  1V3S A;  4DV0 J;  4BBY A;  3QJP A;  3RUB L;  3QGH A;  2UVU A;  1VIX A;  1FE4 A;  2BOA A;  1WF1 A;  2HAF A;  1NKE A;  1K73 T;  1RAD B;  2DRB A;  2GC8 A;  3BO2 A;  2JWN A;  3BGR B;  4Q0B B;  1NSK L;  4HAC A;  4X65 J;  5D4O A;  1KQF B;  2V8V A;  4EK2 A;  3OQ2 A;  5FLX U;  3CC7 S;  3GE9 A;  1FKO B;  2Q6B A;  3F44 A;  1U1M A;  1NSP A;  2B9Y A;  1RTJ A;  1FK9 A;  1RWW B;  5IWA F;  4JI2 F;  5DG7 A;  3NGD A;  3FEX B;  3CO0 P;  2FJB B;  1NK8 A;  2HMI B;  5LM7 E;  5HK4 A;  1RQ0 A;  3FCW A;  6FDR A;  3D3C J;  1TV6 A;  3HKW A;  1F5C A;  2H54 B;  2HSE B;  3PRV A;  4AL5 A;  4DV5 J;  4DSL A;  4ECW A;  3EX7 B;  1TKX B;  3IR7 B;  3OL9 A;  1U26 A;  4IFV B;  4QIG A;  4IOB A;  3RB4 A;  3QGG A;  1ZOT A;  3M2R A;  3CJ5 A;  3H90 A;  5IQQ A;  4JI8 J;  2M5Y A;  2IBK A;  3NCQ A;  1F3V A;  2IAJ B;  3CUN A;  1QUP A;  5DM6 Q;  1RB0 A;  1RBO B;  2FQQ B;  3QQC D;  4GVB A;  1FJE B;  1VK8 A;  3FEY B;  1H2V Z;  3UNG C;  5L8R C;  3MMB B;  4Y65 A;  1VQ8 S;  4X62 J;  2RUG A;  1ZYQ A;  5CZX A;  5KFK A;  3I6P A;  3N79 A;  3IWL A;  3OL7 A;  1RT2 B;  2FHJ A;  4G3I A;  2RVJ A;  2AJ1 A;  3P96 A;  3OPK A;  2CPZ A;  4I2P A;  1VBZ A;  2OLW A;  3QRP A;  4A8F A;  2NXJ A;  1CJU A;  1ZAX A;  1MSW D;  2YY3 A;  3IO1 A;  1DTQ B;  1CJK B;  4WFB Q;  3OFG A;  4J9U E;  4O4R A;  3TJA A;  2Z2L A;  4H4O B;  1EKR A;  2EFP A;  4AL6 A;  2GO8 A;  3BR8 A;  4NML A;  1NHU A;  5U47 A;  4LSN B;  2ZZM A;  3M1V B;  2HVD A;  3MPV A;  3ZZR A;  2PA8 D;  4HR2 A;  2W2O P;  2ILZ A;  3UN3 A;  2FPH X;  2V67 A;  4CZC A;  4F3M A;  3SCI E;  1TKT A;  4EBE A;  4F4A A;  2WVE A;  5AJ3 J;  3EGW B;  5CYM B;  4A47 A;  2LXU A;  2HIQ A;  2XLK A;  5EX3 A;  3RAM A;  1R0A A;  4WII A;  3AOC A;  4ZCM A;  1UEV A;  2RKI A;  3MCS A;  2R9L A;  1LWC B;  5A6W A;  3C6T B;  1WF2 A;  5A2Q Y;  1BC6 A;  1K8A T;  2JEG A;  3S7R A;  1M90 T;  3Q83 A;  4NRU A;  2KM8 B;  1NSA A;  1Q53 A;  3JQJ A;  4YB5 A;  3EVW A;  5G4D A;  2K1R B;  2ZH6 A;  1RWN B;  2KVQ E;  2BA9 A;  2GHV C;  3P5T L;  2BQR A;  5GAE U;  2CJX B;  2P6T A;  1S9G A;  1TAU A;  4LBP A;  1YQH A;  3J80 Y;  3KHR A;  1XBW A;  1HQU A;  2PT0 A;  2W9B B;  4JI5 J;  3H20 A;  4V1A k;  1KVJ A;  2Y1R I;  4DV2 F;  4DQI A;  2AEF A;  5C2G A;  1F9F A;  1S59 A;  3UN5 A;  4B3M J;  4P7T A;  4OZN A;  3VAF A;  4L73 A;  4CO2 A;  3CCM S;  5CCM A;  2XSJ B;  4I68 A;  2FJX A;  4CTA B;  2OP5 A;  4CNZ A;  4FF3 A;  1S9F A;  3FRZ A;  1N34 F;  2F4V F;  1SH2 A;  3W9J A;  1ZZN A;  3HVW A;  3W1Y C;  4TY8 A;  2CVE A;  3O6Q A;  1K44 A;  3TA2 A;  1PIE A;  4N8N A;  1RTZ A;  3I31 A;  4WYL A;  1FNO A;  3QRR A;  3OW2 R;  2RHQ B;  2E7X A;  3NKY A;  5ITH A;  3MFI A;  2EI5 A;  1O8B A;  5KAK A;  4C3K A;  5EDW A;  2M88 A;  3IG1 B;  4NA2 A;  1Z2Z A;  4P52 A;  3WBZ A;  3TUP A;  1T94 A;  3CJS A;  2JVO A;  3BN7 A;  1V3Z A;  4PPD A;  3IN5 A;  2L9N A;  1J5O A;  3K8W A;  4DS5 A;  4LFC J;  4F04 B;  3FQL A;  5IC6 B;  4PZV A;  2QA4 S;  1EHW A;  2QJ3 A;  4ECS A;  2KYX A;  4JV1 A;  4UY8 5;  5EWE A;  2BM1 A;  2IC3 B;  2Z2M A;  4OMF G;  3FMB A;  4DMZ A;  3VGS A;  3R5J B;  3IM8 A;  4RUB A;  1RBL A;  1BQX A;  2Q3P A;  1IBL F;  4ZIV A;  4WP9 A;  1X5P A;  1MRO B;  2MDA A;  1NLK L;  4F2S A;  3ITH A;  2DHG A;  1C1B A;  2LA4 A;  3CTR A;  3R7S B;  2K3I A;  3M9N B;  4HDG A;  4KE5 A;  5DGB A;  2XS7 A;  1CG2 A;  3OXL A;  3RJM B;  4O3Q A;  4J9N A;  3IC1 A;  3DLK B;  4Y2I A;  3UR0 A;  2VIC A;  4H4M A;  3VZH A;  3P8B B;  3FZ2 A;  2QTW A;  4ID5 A;  4I6W A;  3DC2 A;  3U1N A;  4CT8 A;  3HZE A;  3ZTS A;  2RHS B;  4MTP A;  1SL0 A;  2EG1 A;  1DAR A;  1C0U B;  3I9V 9;  4CRJ A;  1ROF A;  2QX0 A;  2IM2 A;  3Q89 A;  4ED1 A;  1RE1 B;  2DVI A;  4HI2 A;  2MKJ A;  3POT A;  3M32 B;  2KHD A;  2HNY A;  2NZC A;  4I56 A;  3G9C A;  1NZA A;  1SB6 A;  5E3R A;  1WUU A;  3SEO A;  2Z8Q A;  2FVC A;  4NCB A;  1HNZ J;  2HQI A;  1JWW A;  4ED6 A;  5IM0 B;  2WVF A;  3HFV A;  4ZA1 A;  1TK5 A;  4U8V A;  1OQ6 A;  3Q8Y A;  1FWK A;  3DOM A;  2MGZ B;  4B3O B;  5KFZ A;  4LVN P;  3RBX A;  1FRI A;  2XMA A;  2J6U A;  1Z4U A;  1SXL A;  2BRL A;  4V19 X;  4ZPW R;  4B3S J;  5I42 A;  2LVW A;  1E6V A;  2VFU A;  2F7V A;  3KMS A;  3G6V A;  3C46 A;  2HHH J;  2M3D A;  4G1P A;  2AYB A;  2PC6 A;  2DD8 S;  4I67 A;  1C2P A;  1QAY A;  1U6Z A;  2P9G A;  2ASD A;  5A8K B;  5LSL A;  1JNR B;  4ZIW A;  1QSS A;  3EIC A;  2CA9 A;  4I7F B;  3MR7 A;  2FVR A;  3MEG A;  4C97 A;  2O01 C;  3NXZ A;  2VPX B;  5IT4 A;  3VF0 B;  2CJ9 A;  3D7S B;  3DLB A;  3ZZZ A;  5H1S V;  2ATL A;  2KT5 A;  2UXD F;  4KR0 B;  2WK4 A;  1VRT B;  2H4W B;  2J9C A;  3EXY A;  1T05 B;  1QY7 A;  3KUG A;  4B3R F;  1E6Y A;  1NND A;  4J5O A;  4O4G B;  3B78 A;  4NLQ A;  2X3G A;  3UR3 C;  1VGY A;  4DX6 A;  1FJG F;  1CJT A;  1NDL A;  5F8I A;  3BBC A;  4HI1 A;  2C3U A;  4WPA A;  2ZH2 A;  3MMC B;  2E7V A;  3R6L B;  1RHM B;  4NLV A;  1RAO A;  5KFM A;  1JXE A;  2ZIT A;  3L09 A;  1CUL A;  1VQM S;  4TN2 A;  3W3S A;  5DDQ C;  3CSK A;  1PSD A;  2YNI B;  3GIJ A;  1N32 F;  1GH8 A;  2QO3 A;  2A1B A;  5L38 A;  1U47 A;  2DNL A;  2HNZ B;  2IM0 A;  3SFU A;  1D0E A;  1JMT A;  3P5B P;  3QJL A;  4UY8 T;  2YKN B;  5HRO A;  2ZH4 A;  2MYF A;  1X0F A;  3SIP B;  5L1J A;  1HA1 A;  2PII A;  1FD8 A;  2F3J A;  2CJK A;  1OSD A;  3C2P A;  1NPK A;  4Y3C A;  1X5T A;  2B4P A;  2AV5 A;  2ZH7 A;  2YVS A;  1FI4 A;  3C6U A;  3L4B C;  2YWF A;  5D0R A;  3QWP A;  3HVT A;  1SC6 A;  4XDD A;  4OZ2 A;  4X66 J;  2DCL A;  3M2V B;  1F3F A;  1I3O B;  2DGO A;  4PQU A;  4ZVS B;  2A2C A;  2R7O A;  2BYC A;  2CPF A;  1YRU A;  4OI6 A;  4F0H A;  2QFJ A;  4ZVO B;  5M2R A;  4LFB J;  2DNZ A;  3DRR A;  2BJ9 A;  3JSY A;  1M5S A;  2J7U A;  2HWT A;  2WTF A;  5J2Q A;  2QN6 B;  5DDR C;  4XIU A;  2VFS A;  1PC5 A;  4YDD B;  1LWE A;  3RBZ A;  2V94 A;  1PBA A;  4MFB B;  1RK8 A;  1F6T A;  1H3D A;  4QWE A;  3WDO A;  5K20 B;  3N6L A;  4OFZ A;  3AD8 C;  3FUY A;  2IM1 A;  1UPP A;  2OMO A;  3TVY A;  5M2U A;  4C0H A;  4NLW A;  3ISN C;  1S99 A;  2CKW A;  3OTC A;  2OAU A;  1JLG A;  2VB6 A;  3BGU A;  2ZHA A;  1WHX A;  1IBK F;  1RHJ B;  2KRR A;  4ZJQ A;  4GRS A;  4KHM A;  3V81 A;  3TA0 A;  1S1T B;  5D3G A;  2ZZN A;  5F8J A;  3ZTO A;  4X64 J;  2WRM A;  4J9K A;  7FDR A;  2QRR A;  4A8O A;  1HR0 J;  3H59 A;  3MAA A;  1VQL S;  3MR2 A;  2OD6 A;  3QBC A;  1BGX T;  4LF6 F;  5J2P B;  5I3U A;  1VCT A;  3S8S A;  2MZT A;  1PYS B;  2HVE A;  2HBQ B;  5K8N A;  1N33 F;  2CUY A;  2VOP A;  5L1K A;  1OYD A;  4EZ9 A;  1OIA A;  1KQK A;  2ZOF A;  4EBD A;  3G6X A;  4DWI A;  3G6Y A;  2E9Z A;  2CWK A;  2HGM A;  4CO1 A;  1TQL A;  1WHV A;  1NXI A;  2YNF A;  3L9Z A;  1HBU A;  1HNX F;  4Y0F A;  3H98 A;  1S76 D;  1EP4 A;  1GAO A;  3O1L A;  3DLG A;  4IH6 A;  4JV5 J;  2VG6 A;  2NSB A;  4KT0 C;  4J9V A;  2Q43 A;  2XM3 A;  5L1L A;  2BAC A;  3NY0 A;  2CNL B;  4F3Q A;  1WI6 A;  4N47 A;  2MQM A;  2ZD1 B;  3TO8 A;  2H51 B;  2X51 A;  1F9H A;  2NLW A;  4NWB A;  4GKK F;  4MAK A;  1VR6 A;  2JRS A;  4C0B A;  3TEG A;  1LXJ A;  3T5K A;  1S72 S;  2W2Q P;  5HQL A;  3L95 X;  5KFO A;  4OYB A;  2P2C B;  3MHY A;  3ET6 B;  2PMH A;  3TJ8 A;  2KTQ A;  3RAQ A;  4N41 A;  4NLS A;  4IKA A;  4QIW D;  3C8Y A;  3ENA A;  3ICL A;  1WSR A;  4ZS6 A;  2AZ3 A;  3BKF A;  2MLY A;  4DQP A;  4D3H A;  2XEX A;  5GAH I;  2MZ1 A;  3E51 A;  1U0S A;  4HAC B;  3QT7 A;  5H9E J;  3GJS B;  4KPC A;  2J6T A;  3ZZ0 A;  1RTI B;  3NS6 A;  2Y8W A;  4QQB A;  1IKY A;  2YKA A;  3D6M B;  2CPY A;  1QTM A;  2OEL A;  4WJB A;  2C3M A;  3HZG A;  3BRE A;  2MQP A;  3FSY A;  4ERD A;  4JI2 J;  2RE1 A;  1RHR B;  3FFI B;  1RCO B;  2D3Z A;  1NKB A;  2HAI A;  3K58 A;  3T19 A;  1U1P A;  2RIJ A;  2RQ4 A;  1IM4 A;  4OI1 A;  3NLC A;  3NMR A;  3IA0 A;  2CG8 A;  3D1H A;  4EYI B;  4WBF A;  1JLE A;  3ENW A;  4JYA F;  2H3E B;  4HTJ A;  4DR2 F;  3GR1 A;  4OJ1 A;  5ETT A;  1T9U A;  1ZTT A;  5CXT A;  1RAF B;  1T9Y A;  3ZZO A;  4BDP A;  4X4V A;  3TNV A;  2VKR A;  2IIH A;  2SXL A;  2WHO A;  2RDD A;  2L9W A;  2BE9 B;  2IBO A;  1UW4 A;  1FFW B;  1S1U B;  3EGZ A;  4DR7 F;  4CLS A;  4GVB B;  4LRB A;  3GMG A;  2AGP A;  2GFF A;  2CXE A;  2AIR B;  2R7V A;  3MEK A;  2NXE A;  3BM7 A;  1RWP B;  4QU6 A;  1JLQ B;  4ZN1 A;  1VQK S;  2FHJ D;  1FF2 A;  5KG4 A;  1N52 B;  5RUB A;  2QA2 A;  4YY3 J;  4J37 A;  1L3T A;  3J80 U;  2BE2 A;  3SXL A;  2OEK A;  4DEZ A;  2QYG A;  5KG6 A;  4DR1 J;  4IUF A;  3CMA S;  1CJU B;  3D3B J;  3R5A A;  3K89 A;  1JXL A;  5THW A;  5J2M A;  2W24 A;  2PSZ A;  2AEJ A;  1TKD A;  2UUT A;  3SCJ E;  1U7L A;  3MUV P;  4TU7 A;  1QE1 B;  4FVC A;  3F41 A;  4C4W A;  1B7Y B;  1RT5 B;  1GMU A;  2V4Q A;  4A8X A;  2CIM A;  3KHH A;  4DSI A;  3KJF B;  4LF4 F;  3UE2 A;  1WOP A;  1EAR A;  3H2L A;  2FGO A;  3CNQ P;  5IC4 B;  5DZ6 A;  1RCX B;  3N28 A;  1N5S A;  1FTR A;  2VA3 A;  3HSG A;  1FRH A;  2KG1 A;  3DLL Q;  1R0A B;  3JSM A;  3LAK A;  3D54 A;  3SQG A;  2WSE C;  2VA2 A;  3FNN A;  2ZDO A;  2RKI B;  5HBM A;  3CB4 A;  1YLX A;  1ZTW A;  2BE7 D;  4USK A;  3CCQ S;  2MEW A;  4RNF A;  2J0W A;  2VJV A;  3LPY A;  4DQQ A;  1K9M T;  3GIL A;  2N82 B;  5H9F K;  5HVH A;  3RG6 A;  1RJJ A;  1HBN A;  3O5T B;  2DNG A;  3LP2 A;  2M0G B;  1HMV A;  1WI8 A;  1TKZ B;  4LF8 J;  1S9G B;  2XZW A;  3M8W A;  1REG X;  2HQC A;  1HQU B;  4MIW A;  2XMK A;  4Y6I A;  1CVJ A;  3U1L A;  1RUS A;  4ZK7 M;  5AXN A;  2HGL A;  3GR0 A;  4FXV A;  2OFH X;  4LR8 A;  2MTL A;  4KSE B;  1RAA B;  4DUY J;  3M9M B;  3VTI A;  2DPI A;  4WXW A;  4IRC A;  2BMB A;  3R7N B;  3HT3 A;  3CXC R;  2LEB A;  4TY8 B;  5KG2 A;  2O3D A;  1RGV A;  4DZ6 A;  1YKW A;  1I5O B;  3PYE A;  4RBT A;  4EWT A;  2FZK B;  4PUO B;  2CDR B;  2YPZ A;  1YJT A;  5HMZ A;  4OZL A;  1H7W A;  1XQI A;  2WAQ D;  2I5J A;  1KNZ A;  4OX9 F;  1EIY B;  1MN9 A;  4Q43 A;  2EFG A;  3DHX A;  1Y9O A;  2FZC B;  4M5N A;  4ITS A;  3HSZ A;  2BKP A;  4ELU A;  5BR8 F;  3S1T A;  1GX6 A;  1J5O B;  2XYH B;  2CQP A;  2AGO A;  1Y00 A;  1TL1 A;  1XR5 A;  1FVS A;  4LBI A;  2PN6 A;  3ENQ A;  2CJA A;  8ATC B;  4RW4 A;  2XMM A;  3NS5 A;  4GVL A;  4ZPB A;  1NJW A;  4HHJ A;  2ZZT A;  1XNQ J;  1ZZF A;  1H98 A;  1KS2 A;  2DIT A;  2PI4 A;  4MJK A;  3DRX A;  1IKW A;  1PAE X;  5B0A A;  5F3T A;  4DUT A;  2C22 A;  1S6Q B;  1S10 A;  5KG5 A;  4DV4 F;  4CYU B;  1QD1 A;  2LLZ A;  2HBZ B;  3H25 A;  4LR9 A;  1IBL J;  3ITH B;  1C1B B;  3BN4 A;  3PHT A;  3NGS A;  1L3V A;  1VMB A;  4C7Q A;  4DR4 F;  1NSQ A;  1FO1 A;  3ETM A;  3J81 U;  2DR5 A;  4A48 A;  3CCR S;  5F0W A;  2J6S A;  5ETQ A;  3G87 A;  4H4M B;  1YX2 A;  4ID5 B;  2GS8 A;  3K2Y A;  4R5P B;  1YJN S;  3M30 A;  1KON A;  2B5J A;  4P6Q A;  3CD5 A;  4HEA 9;  4LFA J;  1R43 A;  2D3O 1;  3POT B;  2HNY B;  3GJR B;  5L39 A;  3UDC A;  1PC4 A;  2UXC F;  3Q8R B;  2YKQ A;  3VR1 A;  2CQ2 A;  2EXU A;  4UF4 A;  2DGU A;  4WZQ A;  2JFD A;  2KB2 A;  1EQM A;  4WYW A;  4ZVQ B;  4F67 A;  2HRU A;  3KOA A;  2W7O A;  3DOM B;  3MEC A;  3UCZ P;  3VGU A;  3UN2 A;  2MLZ A;  3NOG A;  2VQE J;  4N76 A;  4M95 A;  1L3S A;  2M52 A;  2UV8 G;  2HVI A;  2RIL A;  5I42 B;  3TAQ A;  3W2V A;  1E6V B;  1F0X A;  1DJ0 A;  2HS4 A;  2D3U A;  3BSO A;  5FJ4 A;  1AB8 A;  3LGM A;  2RDI A;  1HHS A;  1M1G A;  4PXD A;  1B0V A;  3NP5 A;  4P9S A;  1CS4 A;  4IYQ A;  5AE1 A;  3AY0 A;  3DU6 A;  4F02 A;  3HPO A;  1U0H B;  2IMW P;  1FER A;  3N5B A;  3W2W B;  4CLK A;  2O66 A;  3MEG B;  3VAK A;  2DR8 A;  1RT1 A;  4B17 A;  5D15 A;  1S97 A;  1B99 A;  5B0E A;  4ZPV R;  5JXS A;  1T3O A;  2AX1 A;  5T41 A;  3A3N B;  3F0N A;  5DDO C;  2LEP A;  3W63 A;  2NUU G;  2KXH A;  2AF6 A;  2R42 A;  3KTQ A;  2XMJ A;  2AYM A;  2JC0 A;  5HN0 A;  2JZ5 A;  3ZZP A;  4CNY A;  3J7Y I;  3H5X A;  1YZ6 A;  2MJU A;  4DG1 B;  2UUB F;  2UU9 J;  3DHW C;  3MPW A;  4C8L A;  1N5Q A;  4CP5 A;  3QIP A;  3TR5 A;  1BQM A;  5LXR A;  3KK3 A;  1NUE A;  2QLX A;  4B9M A;  4F4X A;  4WTY A;  2AQ4 A;  3HJF A;  3M8Q B;  2JEF A;  4B9S A;  1LFW A;  1FT8 A;  1CUL B;  1I51 B;  1NH7 A;  2W9C B;  4ZCL A;  3D0G E;  1T8E A;  1WOR A;  3KKF A;  4WK1 A;  1XMQ F;  2LU1 A;  2OSR A;  3CCV S;  5LXY A;  1NK0 A;  1RT3 A;  3LWL A;  5LOQ A;  2DRD A;  2DXE A;  1UAW A;  2XYG B;  5HRO B;  1VHI A;  3ONQ A;  3BBF A;  3DMJ A;  1WC0 A;  3OTO J;  2V2Q A;  3PJW A;  4CDI A;  4XO0 A;  1U02 A;  1X9S A;  5ADZ A;  1MWY A;  1T9W A;  5AT1 B;  3C6U B;  3IP0 A;  3HVT B;  1ZPW X;  2F63 A;  3VGV A;  3L7U A;  3J7Z 5;  2RU3 A;  3QO9 A;  4PQU B;  2CQI A;  1S7I A;  2JEJ A;  1X4E A;  2J7K A;  1YGY A;  5EUH A;  5J2N B;  3T5J A;  1M1K T;  3KJQ B;  3TAM A;  1YSJ A;  3KK2 A;  3PAC A;  2GIR A;  4KGZ B;  1NJX A;  2B9X A;  2IVF B;  1W7W A;  4DL6 A;  2ZJR Q;  2VBX A;  3PYF A;  4OIX A;  1LWF A;  3V6H A;  3GJQ B;  2WSC C;  3LAL A;  3AAW B;  3VAH A;  1LWE B;  4EU0 A;  2XMW A;  5ETR A;  1DZ5 A;  2DHS A;  2Z2Y B;  5EWG A;  1WEZ A;  4PEO A;  2V34 A;  3BGR A;  4Q0B A;  4TNO A;  3DRY A;  4NYO A;  1ELO A;  4RNH A;  2OPS A;  2DGX A;  4AXI A;  4FKX A;  3DRS B;  3I87 A;  5GAG I;  1NHK L;  3GB0 A;  2HZC A;  1YBU A;  2K8G A;  1FKO A;  2YH1 A;  2Z56 B;  1MG7 A;  3W9I A;  2IDE A;  1P6T A;  3PTW A;  2R8J A;  2C2M B;  1C1C A;  1JLG B;  1C0T B;  3D1Q A;  3WX8 A;  2FHK A;  2HMI A;  2CZ9 A;  2GVZ A;  2HS3 A;  1KN6 A;  1FDN A;  3V81 B;  1HWI A;  4YB1 P;  5D3G B;  1NJZ A;  1PYO B;  3EGN A;  2ZBI A;  1FDB A;  1FJC A;  1TKX A;  1JLB A;  4IFV A;  5DO2 A;  2F8M A;  1S4F A;  2VH7 A;  2CVI A;  4ZVR B;  4BC7 A;  4LF9 J;  4ED2 A;  3SMZ A;  2U2F A;  4AD6 A;  3FZB A;  1SV5 A;  3MAA B;  1D8Z A;  1RT4 B;  3A4T A;  2RT3 A;  1FXD A;  4ID8 A;  2GVD B;  1WKK A;  2MKH A;  3PRD A;  3PZP A;  3PX4 A;  4BCA A;  3KLH A;  4E98 A;  4KGM A;  2CQ4 A;  2YKM B;  3T9Z A;  2AJQ A;  3V4M A;  1G4C A;  3UDE A;  4EMD A;  2Y1I A;  1HNW F;  2J5A A;  4EYH B;  4JI6 J;  4IG3 B;  3EWG A;  1N56 A;  2IVM A;  1KTV A;  3D6H B;  1UFL A;  3CJ8 A;  1RT2 A;  3D4J A;  1T9V A;  3VAM A;  4IR9 A;  2MY8 A;  4X4T A;  3MZI A;  3DLG B;  3A12 A;  1F5B A;  3AA8 A;  2ZFH A;  1N36 F;  1KP6 A;  3PY8 A;  2ACM A;  2J8S A;  3W60 A;  5B7W A;  3TX8 A;  1YJV A;  4ZHR A;  3L7P A;  1SI9 A;  3OR1 A;  2R2S A;  1Q8B A;  3EVO A;  3T1A A;  5HJX A;  2Z2Z A;  2R8G A;  3NS7 B;  5E3A A;  1FX4 A;  3IBW A;  4RX6 A;  4YQW A;  3HHN B;  4DL5 A;  2DO4 A;  1WKJ A;  4H4O A;  1OPI A;  1UTA A;  4DR6 F;  4B3T J;  4I2Q A;  5E33 A;  5K8M A;  2P8I A;  4PG6 A;  1FTC A;  3I4P A;  1V6H A;  3IGN A;  1U1Q A;  2ZE2 B;  3GZ7 A;  4KFB B;  4CLU A;  2CNN B;  1KLN A;  1KSP A;  1SJF A;  1L3U A;  1VBX A;  4J9Q A;  5DET A;  5AE3 A;  4GKJ J;  5GAE I;  4Q7A A;  1LW0 B;  4PWW A;  4GO5 X;  5DDP C;  3C6T A;  4EEY A;  3OT9 A;  1PIL A;  2ALY B;  2B9E A;  2RRA A;  5A8R A;  4YHH J;  2A0F B;  1GXT A;  1O51 A;  2LDY A;  3J7Z T;  3OVA A;  1TFW A;  3M8Z A;  2ZHO A;  2WVD A;  2DR7 A;  1RWM B;  1MU2 A;  1BY9 A;  2H5E A;  1S1W B;  1ICE B;  3FQK A;  4YB7 A;  3AOD A;  1NM2 A;  5GME A;  2CG4 A;  2L9D A;  5KG0 A;  3IMQ J;  4ECV A;  3JAM Y;  4F36 A;  1Q78 A;  3MFH A;  5IFM A;  4RW6 B;  2J0S D;  5HO4 A;  2V50 A;  4P10 A;  2MQQ A;  2OKQ A;  2VQF J;  3HLU A;  4DFJ A;  4PPZ A;  1FRL A;  4OHY A;  2YWK A;  1UL3 A;  3R27 A;  4DL4 A;  1LK5 A;  1NPR A;  1CC8 A;  2E9R X;  4BC9 A;  3CCU S;  2AT1 B;  1X5O A;  3BDE A;  3LW5 C;  3C19 A;  5KFF A;  3IG1 A;  1D9F A;  5LMU J;  2GX8 A;  3J7A 1;  1Z2L A;  2QSW A;  2OUG A;  5BYQ A;  3I96 A;  2ZVI A;  2BE2 B;  1RKJ A;  1G3O A;  2XGQ A;  2DNY A;  4QJV A;  2D74 B;  2D69 A;  4DX7 A;  1GK8 A;  4DR3 F;  4FNI A;  5F8M A;  1QUV A;  4ZCK A;  2QL9 B;  1H2U X;  2IC3 A;  3LAM A;  1AFI A;  2Q79 A;  4JI1 J;  3BQ2 A;  3B6B A;  3HUL A;  2LYV A;  2XLJ A;  4DV1 F;  3BF4 A;  3CDA A;  2LCW A;  3IR6 B;  2X1A A;  2Q6C A;  1VQN S;  2ZH8 A;  1U1R A;  4LF4 J;  2CQB A;  1X4F A;  2ZVS A;  2JLE A;  1ZAV A;  3T1H J;  1R7I A;  3OR2 A;  1HNV A;  3DLK A;  3W62 A;  1VQ4 S;  1VYA A;  5A6P A;  4KQZ A;  4NL5 A;  3HHE A;  2HBY B;  2HZV A;  1R8C A;  4A8Q A;  3SQG B;  4UUX A;  3MAQ A;  3A3O B;  3CJ0 A;  2ZM6 J;  2ROE A;  5HBM B;  3DDI A;  2YNH A;  3X3U A;  1C0U A;  5B0C A;  2XY6 A;  1Y7P A;  4RU9 A;  4X84 A;  4QW8 A;  3M32 A;  3GON A;  4K4U A;  5BXI A;  4PWU A;  2H48 B;  4X4N A;  2WW8 A;  3US5 A;  1HMV B;  2FB0 A;  3IAS 9;  1WG5 A;  4FVM A;  1M5K C;  4OHZ A;  1UEU A;  2BR0 A;  3R3T A;  1X4B A;  1X31 C;  5IT9 Y;  5LT5 A;  4B3O A;  4Y2A A;  1N88 A;  2KT2 A;  3H2V E;  1JQG A;  3TAN A;  3OFH A;  2C3O A;  2POK A;  2MPU A;  3C16 B;  4C3L A;  3T41 A;  1KR4 A;  4ECT A;  2ZDP A;  5KFX A;  3CJQ A;  1SKW A;  2Z4P A;  2NS1 B;  3RRH A;  3PCO B;  3VWS A;  2XMV A;  4OYM A;  4PQA A;  1RTH B;  2EBE A;  4TQR A;  1BQN A;  1RAE B;  3ZNU A;  4RUC A;  1FA0 A;  1ZM9 A;  2B8Q A;  4FPI A;  2LFV A;  1DLO A;  2I5J B;  1CBK A;  2CQH A;  1S79 A;  4RO0 A;  4MMO A;  4WFA Q;  3G4S S;  3R2C J;  5DS7 A;  4J9L A;  4OHX A;  1R8H A;  1MMD A;  3HT0 A;  1VRT A;  4C8O A;  4OI0 A;  3GIR A;  3TUI C;  4QIE A;  1X5S A;  2O5D A;  1TL1 B;  4RW4 B;  5L9X A;  4PRF A;  4OZJ A;  3FCH A;  4O4G A;  3CDW A;  2HFS A;  2YQ1 A;  2FVS A;  2UXB F;  1G2E A;  3HKZ D;  3LGN A;  4ECR A;  5KFI A;  5KFV A;  3CE8 A;  1IKW B;  4Y2K A;  3RTV A;  3HK2 A;  4K5R A;  2HQ3 A;  1VOM A;  3QSI A;  5HAT A;  1U8W A;  3MMC A;  1F5A A;  3WZ0 A;  4F25 A;  1UVK A;  1MW7 A;  3KXD A;  4U6P A;  2WB1 D;  3MM5 A;  1D8Y A;  3AJD A;  1GTE A;  2FD2 A;  4DR4 J;  3NWR A;  5KFY A;  2HFV A;  3JQM A;  1NJI T;  2ABY A;  4M8L A;  2QE5 A;  2OPP A;  2GQ2 A;  1N48 A;  5CHC B;  3TP2 A;  3M30 B;  2B5J B;  5GMK a;  4ALZ A;  3PR5 B;  2VKZ G;  1WTF A;  3AD9 C;  4GC7 A;  1DAX A;  6AT1 B;  4S0M A;  4DV7 J;  3I0S A;  5GMD A;  3GLJ A;  4LF7 J;  2CQD A;  2NR0 A;  2DNQ A;  5D4P A;  2RU9 A;  4HT7 A;  2KXF A;  1LW2 A;  4XPC A;  2NUH A;  5HI7 A;  5LSO A;  3OLA A;  4ED0 A;  2CQ3 A;  4KIA A;  2E9T A;  2J8A A;  3MEC B;  5D78 A;  2LKZ A;  2H9Z A;  4M5K A;  1NHV A;  4JI3 J;  3M2V A;  3CED A;  4DDF A;  4RW8 B;  1Q8K A;  2QMW A;  4M5D B;  2V5H G;  3W5Z A;  3T1Y J;  4NRT A;  3QAT A;  2I0X A;  3UDL A;  2DH8 A;  3E8O A;  2CJY B;  3BDP A;  3OVS A;  2ZUA A;  5KFL A;  4ZN3 A;  1D9A A;  1WF0 A;  2A6M A;  3FJ2 A;  1R8B A;  1KOH A;  4N7T A;  2CWX A;  4CM2 A;  1LOU A;  3J7A N;  2B3T B;  2X1F A;  3V5R A;  4RW9 A;  1CS4 B;  2BJ7 A;  2E5J A;  2OHD A;  1VIS A;  4MFB A;  4NLU A;  4UQG A;  4ZLP A;  1RU1 A;  1XEZ A;  3PKM A;  3DGV A;  4LRF A;  4OQJ A;  2KVI A;  3BPS P;  3GYG A;  5HMY A;  3TZW A;  3ILL A;  1PYT A;  4RNM A;  3MR3 A;  5KFH A;  1LK7 A;  2GIF A;  3TA1 A;  4NEZ A;  4LRA A;  4NLG A;  4DX8 H;  2P6S A;  3PFE A;  1NCL A;  3LP1 A;  3T9N A;  1TL5 A;  4JI7 F;  2DH9 A;  3QRQ A;  3HX9 A;  1R6Y A;  1ZS6 A;  3FSI A;  3CPW R;  1CQN A;  1U6B A;  5L9N A;  1U4B A;  1QVG R;  1T95 A;  5FDL A;  5DZ7 A;  5LMN F;  2N4C A;  1BQM B;  2HYI B;  2CRL A;  3GFH A;  2W4C A;  3KK3 B;  3UD3 P;  3V6D B;  2KJW A;  5HJY A;  2MZR A;  4O3R A;  2OO4 A;  3CJR A;  1T9T A;  1D9D A;  3Q22 A;  5ETL A;  4NLX A;  1TK8 A;  3HP6 A;  1KOO A;  3FC9 A;  4IDK B;  2V2V A;  4IQM A;  2IVY A;  2F9D A;  2XCA A;  2YQ3 A;  1WEL A;  4ILL A;  3M9O B;  1UA1 A;  2XG8 A;  1ACM B;  1FXL A;  2PEB A;  1RT3 B;  3H7H B;  4P2S A;  4DV6 F;  1VQO S;  1VLO A;  1KHW A;  1W26 A;  4G1Q A;  3EXC X;  4URQ U;  5KTQ A;  2NRE A;  4Q44 A;  4LRD A;  3MED A;  1A0O B;  4Z37 A;  3DMJ B;  3EYZ A;  3BSN A;  1R6V A;  1HL6 A;  2B43 A;  4B9L A;  4OV6 A;  3NGR A;  2JFK A;  2QG9 B;  3D0H E;  1BXN A;  3ZZY A;  1Y11 A;  5K9F A;  5KG7 A;  1FVQ A;  1P8G A;  3KG0 A;  3D5M A;  4Q8E A;  3QO9 B;  1W2I A;  3T6J A;  2JHE A;  1SPB P;  2UVR A;  3BGO P;  3HHL A;  4ZPD A;  5J1E B;  3H40 A;  4U8Y A;  3KK2 B;  1PKU A;  2GIQ A;  3OD2 A;  2XY5 A;  1PCA A;  3J81 j;  1SUQ A;  3ZFV A;  4PKD B;  1XJW B;  3NAI A;  2VG5 A;  3M6X A;  1LWF B;  3AJ2 A;  4RUH A;  2AHO B;  1S9E A;  3GFY A;  3K17 A;  1OY9 A;  2VBZ A;  2HHP A;  2OTL S;  2NXC A;  5CD4 H;  1QAJ A;  3EDQ B;  4PAB A;  2NQP A;  1RTI A;  2OPS B;  5J1N A;  3LP0 A;  1UJ4 A;  2EC2 A;  1HNI B;  5KFA A;  3HCX A;  1UMJ A;  2ZOG A;  1R89 A;  2YBV A;  4RZR A;  3TWZ A;  3D67 A;  2MQ8 A;  4FYY B;  1ULR A;  1C1C B;  4ETZ A;  1VRQ C;  3FFI A;  5AXM A;  1WOO A;  2MQN A;  3HJV A;  2GVZ B;  3KUH A;  2HHV A;  3GG0 A;  3A13 A;  1YBA A;  4UOF A;  5GAG U;  1OSC A;  1DQA A;  2XB2 D;  1JLB B;  1AXQ A;  1IR2 A;  4PCQ A;  3QAE A;  1SV5 B;  2ZBC A;  2WB4 A;  4ER8 A;  4RNO A;  2AP6 A;  4DSJ A;  5LSR A;  1BD6 A;  4I4B A;  2YXL A;  2VG7 B;  4X65 F;  1JJH A;  3KLH B;  3ETO A;  3NWG A;  4TLQ A;  2DNM A;  1S1U A;  2BX6 A;  1IBM F;  1Q0N A;  2UZA A;  3MUT P;  2R7Q A;  1UCN A;  4WXO A;  3FBC A;  3EPG A;  2MKS A;  2OPR B;  1CEZ A;  2J0Q D;  1RAJ A;  4C11 B;  1QM9 A;  4F8R A;  4WFY A;  3WC2 A;  2COL A;  2Y0B B;  2UUW A;  5KT7 A;  1U1O A;  2J9E A;  2KHC A;  1JLQ A;  2R8H A;  2WZ1 A;  5HLF B;  3H5U A;  4DL7 A;  3PIP Q;  2W8L A;  4HTI A;  2RRB A;  4DLG A;  2G2Z A;  3NCP A;  2R8I A;  4OYP A;  1TZ0 A;  2V8P A;  4ZHR B;  4X4O A;  3OR1 B;  3LF0 A;  4LF2 A;  2HHX A;  3G82 A;  2OTJ S;  3JAM U;  4DV3 J;  2V6A A;  4K4Y A;  2DNO A;  4U96 A;  1L3K A;  3KJN B;  4NA3 A;  4ILM A;  2FYX A;  2H1Y A;  3EMT A;  4UOG A;  4FYV B;  4JI8 F;  1QE1 A;  3KNA A;  4UZB A;  1RT5 A;  1F2H A;  4U7C A;  2ZC3 A;  2DNN A;  4I2Q B;  4NXN J;  8RUC A;  1WKL A;  1YJ9 S;  4NPO A;  4BLG A;  4AXJ A;  4ZJL A;  1R27 B;  5CQG A;  2KU7 A;  2DB1 A;  2XBP A;  3G8T A;  4X62 F;  5KT2 A;  4HL9 A;  1DFD A;  3QAU A;  1TUW A;  3LWM A;  1L5U A;  1I94 J;  2IDL A;  2GV1 A;  2UVV A;  5CZV A;  2ERR A;  3C14 A;  2BM0 A;  5KFW A;  2IY5 B;  1GXL A;  1LEO A;  4F4Y A;  1RYR A;  5ETV A;  1SJR A;  4Z7C A;  1RWK B;  3RB6 A;  2HKE A;  1P1T A;  3SYZ A;  5A8R B;  4KHR A;  2KH9 A;  2EKN A;  2V0N A;  1B7F A;  1EAY C;  4LT6 A;  5D0G A;  3TJ9 A;  1TKZ A;  3CO9 A;  3Q2T C;  4KB7 A;  4WFX A;  2E5H A;  4Y2C A;  3MPU B;  1IKX A;  4JUZ A;  3PX6 A;  1MU2 B;  4LMZ A;  4BWJ A;  4U7U K;  4O44 A;  3VZI A;  4AT1 B;  1UVL A;  2ZUG A;  1XNR J;  4HHH A;  5G0R B;  2RS2 A;  2N3O A;  2OI2 A;  4X2B A;  2BZ2 A;  2DEI A;  4ECY A;  1RWV B;  3AT1 B;  4QR0 A;  4ZVG A;  4YEA A;  2CZ4 A;  5AJ3 F;  2WBR A;  1SCJ B;  1U8S A;  1TUV A;  2CPI A;  1FD2 A;  5HAN A;  5HVG A;  5J1P A;  2CZV C;  2FJD B;  3HF5 A;  3Q8U A;  3EZU A;  1GT8 A;  2QMU B;  3B82 A;  4YS2 A;  2C2E A;  5E3Q A;  1TR0 A;  2NCK L;  2DJW A;  4FF4 A;  4O0I A;  4PUO A;  5F8G A;  4TQS A;  4O3P A;  2XYP B;  5A0Y B;  2F4F A;  4B9U A;  2EK6 A;  4ZMM A;  3OLB A;  3UQS A;  4WTO B;  3GYX B;  1M1H A;  4DSF A;  2YX4 A;  1NK6 A;  1IJF B;  3QSY B;  1XC9 A;  3L3C A;  2QLJ B;  2B8P A;  1YJR A;  4NOH A;  1DTT A;  2EKY A;  1WAC A;  4A8W A;  4ZVH A;  3AA9 A;  1NH8 A;  4FKY A;  3G6E S;  3BV8 A;  1HQE B;  3O2I A;  4JI5 F;  1X60 A;  1DRZ A;  2IFX A;  2YTC A;  2ZKT A;  5IT9 U;  4JI4 F;  3BB5 A;  4DFK A;  5KFE A;  1M5V C;  2KT3 A;  3QJJ A;  2BKN A;  4MKA A;  2O1P A;  4KGV B;  1K0T A;  5F8H A;  1RAI B;  2CJQ A;  4QWC A;  2QYC A;  1HKA A;  1S6Q A;  2B7B B;  4CYU A;  2NYI A;  3BJY A;  1GTH A;  5CAB A;  3KLE A;  4IOA Q;  2XHC A;  2G4B A;  3CMQ A;  2W7P A;  1XMO J;  2CPJ A;  1RHU B;  1UZD A;  2M8D B;  3OR2 B;  1HNV B;  2FLL A;  2KG0 A;  5BYR A;  2E66 A;  1X4C A;  4YN3 B;  3GV7 B;  1MN7 A;  4YDX A;  2DXD A;  4TY9 A;  3KLG B;  3W5X A;  1CC7 A;  4MK8 A;  4WKR A;  4R5P A;  2E1C A;  5F9L A;  4PYD A;  3RBD A;  1VK3 A;  3ZTR A;  2C3P A;  2YNH B;  2DPJ A;  4LFC F;  4ZVE A;  3H42 A;  3MF5 A;  4I64 A;  2IHR 1;  2BRK A;  3R1H A;  2GO9 A;  1JLA A;  4CH0 S;  2VBW A;  2C2K B;  1DHM A;  1KC8 T;  4A8M P;  4FDF A;  3WHI A;  3GII A;  4ZLN A;  3SI8 A;  5KG3 A;  4ED3 A;  2QGF B;  3QID A;  2GZO A;  3RYL A;  1RT7 A;  3P3D A;  4RW7 A;  1FKA F;  4ED4 A;  2W2P P;  1YRX A;  3M6W A;  4W92 B;  5MLC V;  4OZ3 A;  1NK5 A;  3IS9 A;  1UVI A;  3AB2 B;  2UV8 A;  4QWA A;  3PEH A;  4HH0 A;  5KFR A;  1X4A A;  3DGP B;  1RWX B;  4Z7Y A;  3T5H A;  4OI3 A;  1VI7 A;  2IYG A;  1N54 B;  5LL6 d;  4URG A;  2FJE B;  1UZH A;  3G96 A;  2W2N P;  4D3G A;  3AHP A;  3NBP A;  2DGS A;  1TL3 A;  2BXJ A;  2UVW A;  1BQN B;  5H9F J;  2Z58 B;  1U0H A;  2FLN A;  2AYE A;  4K2X A;  3W2W A;  3J81 Y;  3FDS A;  2E1M C;  1DLO B;  3NNC A;  2X3D A;  4ETX A;  2YWH A;  5CYJ A;  2YNG A;  1HNZ F;  1KTQ A;  5KFB A;  1WC6 A;  4C98 A;  2EG2 A;  5DRK A;  2AZ1 A;  4NLO A;  4NZ6 A;  4L3K A;  3MUM P;  4YP3 A;  4FBU A;  1VJQ A;  1IR1 A;  5E7O B;  3TQ1 A;  4KV8 A;  3IRX A;  2PD1 A;  3HI9 A;  1HWL A;  2QLW A;  2XC9 A;  1T3N A;  2BJ8 A;  2C2N A;  4H4K C;  4CLP A;  4B3S F;  2AX0 A;  2Y3Y A;  3D1O A;  3GCW P;  2PMW A;  5D0H A;  3PW4 A;  2G0I A;  4DG1 A;  2HHH F;  3GFZ A;  5D0E A;  3KJV B;  2P9C A;  3Q2S C;  3PR4 A;  4RWW A;  3W61 A;  1S0M A;  2GMJ A;  2E44 A;  3W64 A;  4UQT A;  4K4T A;  4KGK A;  1U2C A;  3HVA A;  1XMB A;  4L76 A;  2KJV A;  1N8R T;  1LKZ A;  3BGF A;  2K06 A;  4C8Y A;  1RU2 A;  3M8Q A;  3VAG A;  3FEZ A;  3MM5 B;  4GMK A;  4CO5 A;  1YK9 A;  3ZTP A;  2EFO A;  2XTJ P;  2B9W A;  2RQM A;  2NPI A;  5K8O A;  1KRP A;  2OPP B;  3DDK A;  2W9C A;  1HW8 A;  3KG1 A;  1S4E A;  3CC2 S;  3VAI A;  4TU9 A;  2WW4 A;  4DF8 A;  3SZ2 A;  2EEY A;  1RT6 A;  4OYW A;  3N4W A;  1R3N A;  2OGU A;  1LQ9 A;  3KFW X;  3I0S B;  2HGN A;  4TVA B;  1NDK A;  3GJT B;  1Y3K A;  1LW2 B;  3R97 A;  4J9P A;  1S0V A;  4DUZ F;  4OYA A;  3TVZ A;  4UT4 A;  4IG0 B;  1B0T A;  3VGT A;  1K1Q A;  2DR6 A;  2LQB A;  3M6U A;  1XR7 A;  1HBM B;  2MQO A;  1ZAW A;  4JV0 A;  2R7S A;  2AEM A;  1VQ7 S;  2HFN A;  3H2U B;  3BYR A;  3ISN D;  2MZS A;  1U48 A;  3D66 A;  1FX2 A;  5T14 A;  5J2N A;  1GEH A;  5ETN A;  2C2O B;  1N5Y A;  2WVC A;  2BAN A;  2M70 A;  3KUE A;  3BO4 A;  3ZO7 A;  1SQG A;  2EFV A;  4RW9 B;  1IKV A;  3W5Y A;  2FTR A;  3CW2 C;  3CIZ A;  3A1Y G;  2H5I B;  2OJ3 A;  3FK4 A;  1ZET A;  2Y8Y A;  3KMQ A;  3UO0 A;  1R31 A;  2E5L J;  4NZ0 A;  1VBK A;  1NDC A;  4IR1 A;  3DRS A;  4LSZ B;  1VHF A;  1B3T A;  3M05 A;  2WON B;  3KHL A;  3MEE B;  4A46 A;  1SKS A;  1H2T Z;  2HBR B;  4K0K J;  4W4M A;  4X66 F;  2G2Y A;  1EJ7 L;  3IBC B;  4DR5 J;  4A4J A;  1C0T A;  1DQ9 A;  4K4S A;  1JLC A;  2CQC A;  1BMQ B;  3LP1 B;  2ILY A;  4DPW A;  1Q81 T;  5ETP A;  3C66 A;  3FRY A;  4KKO A;  3PDN A;  4X4S A;  2A3J A;  1S0N A;  4P71 A;  4QIF A;  1JKH A;  4LFB F;  4AND A;  2LXF A;  5FDL B;  4U95 A;  4ZDN A;  1RP5 A;  2WCX A;  1RT4 A;  2UUA J;  5LMN J;  3B4D A;  2GVD A;  4O23 A;  3QGP A;  1WC3 A;  3DKD A;  4DJB A;  1SJ4 P;  4JI0 J;  3ILI A;  2JH3 A;  1VQY A;  3GWC A;  3BYP A;  2YKM A;  2E5G A;  2FJW A;  1X4G A;  4B08 A;  2HK2 A;  3QMQ A;  2CPH A;  1ZM2 A;  2LEC A;  2W4P A;  3OJS A;  4IG3 A;  1OJ4 A;  1HD1 A;  3EPI A;  3M6V A;  1PJ7 A;  2B4V A;  3KLI B;  4NLT A;  2WVB A;  4G1Q B;  2APO A;  2DEJ A;  2I2Y A;  3SQO P;  3MED B;  4WKY A;  4Y2M A;  4X64 F;  2LQ5 A;  4ZJO A;  1FE0 A;  1HR0 F;  4J90 A;  3H4B A;  4R0J A;  4F4K A;  3DYA B;  1Y5I B;  2R2U A;  4PR6 A;  2DGT A;  1VC0 A;  5KFD A;  4P73 A;  2UUC J;  1YZ7 A;  2A6O A;  4AQY J;  4LSL B;  2XNR A;  3W7B A;  1Q8L A;  3HHL B;  2QEX S;  1CJV A;  2ZNZ A;  5HL7 Q;  1J5E J;  2RUS A;  2ZE2 A;  1YIT S;  3CGI A;  5IV4 A;  1ZPV A;  5KT4 A;  2E1R A;  2H4Y B;  2QL7 B;  3GPA A;  4WIQ A;  4KFB A;  1SUQ B;  1TFY A;  2VG5 B;  3NNH A;  1U1N A;  4DL3 A;  3BO3 A;  3P4U B;  1S9E B;  2FIU A;  2EC0 A;  4E2F B;  3BQ1 A;  1HAR A;  3NL0 A;  3OTB A;  1LW0 A;  3MM8 B;  1FDD A;  1WEY A;  4DPU A;  5DQH A;  4YME A;  2HHU A;  5KFU A;  2D7S A;  2DK2 A;  3LP0 B;  1KEK A;  3U27 A;  4DSK A;  3HHL C;  3N6M A;  2KDO A;  5IWA J;  2ADB A;  1ZBT A;  2C1E B;  5K14 B;  1S1W A;  3GTY X;  2MHE A;  4QYZ K;  1VQ5 S;  2DRA A;  3CC4 S;  1VC6 A;  4RW6 A;  4RBU A;  4WU2 A;  1VDH A;  1S48 A;  4A8Y A;  1PJ6 A;  2CYY A;  4DPT A;  4NMX A;  4WFZ A;  2MMY A;  3DLE A;  2X1B A;  3EUN A;  3DCA A;  3C3L A;  4FYW B;  3UD4 P;  5HP1 B;  4F50 A;  3N0V A;  2MJN A;  3BKU A;  1IBM J;  3W8G A;  2QLB B;  1V3R A;  4DQR A;  2R4F A;  1JJ2 R;  1VFJ A;  4BHQ A;  4MKB A;  5DQI A;  2D1C A;  4NLP A;  4UOH A;  1SJ1 A;  2HLU A;  1JXV A;  4C8M A;  5HSP A;  3C15 A;  2GQQ A;  4PG4 A;  3GCX P;  4C6A A;  4FZV A;  2B56 A;  2BEF A;  1PAU B;  3AQP A;  4Y28 C;  1RLC L;  1EET B;  1Q95 G;  4USU A;  4F26 A;  3DOL B;  4K59 A;  3GU0 A;  3G82 B;  4RBV A;  1JX4 A;  3EM1 A;  2JDJ A;  2XO7 A;  2HPU A;  1S77 D;  1TVR A;  3UCU P;  3UVJ A;  2PE8 A;  2R3V A;  3Q86 A;  2CDQ A;  3MCM A;  1GQE A;  4DSE A;  3HM9 A;  4NX9 A;  1OMS A;  1B0P A;  4ECU A;  1WG4 A;  4QPX A;  2Y1L B;  3BR9 A;  2DGV A;  5EWF A;  1NZ8 A;  3CDU A;  3FCV A;  4MIB A;  2V4J A;  2KFZ A;  1I6J A;  4ZKA A;  2B0G A;  2VOD A;  3LA0 A;  4KHP F;  2RDJ A;  2R2R A;  2BOP A;  3C14 B;  2PFF B;  4KGX B;  1YJW S;  4YY3 F;  3RR7 A;  2DY1 A;  3R7B B;  4NYZ A;  4DR1 F;  3DOK A;  4LVO P;  3NNA A;  2A18 A;  3ZXW A;  3ENV A;  4CCH A;  1W25 A;  4OYO A;  3R1L A;  2XZD B;  4UTG A;  2KO1 A;  4EBC A;  3QYY A;  2YQ0 A;  2MHN A;  2OFG X;  5DLF A;  1IKX B;  3MMA A;  3CWJ A;  3PRB A;  3PNI A;  4QIV A;  4O44 B;  2XS2 A;  1GMW A;  3QZ7 A;  3ZZT A;  3D28 A;  3VHQ A;  4IFY A;  2QV6 A;  3NEK A;  2D41 A;  3JSR A;  2CQ1 A;  2MST A;  2GJF A;  4P2X A;  3D6F B;  3R9L A;  4DV2 J;  1TL7 A;  2XHW A;  2BUN A;  3NGT A;  3AQO A;  5E3P A;  4ZP9 A;  3C16 A;  4DPY A;  3MCN A;  3O44 A;  2YH0 A;  3AH6 A;  2LQ9 A;  1X8D A;  1N34 J;  3I0R A;  2F4V J;  4YR2 A;  5JVG Q;  2HHW A;  4ES1 A;  4HHU A;  1J27 A;  2AJ2 A;  4LRE A;  2GGP B;  4ED7 A;  1RTH A;  1IM6 A;  1VBY A;  2A2D A;  5JMN A;  1KQS R;  3KWM A;  3D2W A;  3RU0 A;  3VAJ A;  1KBR A;  4CO3 A;  4ELV A;  2JSX A;  5I3Q A;  2GAH C;  4ZOS A;  4DQS A;  4DCO B;  4M5G A;  4M1K A;  1SVD A;  4LF8 F;  2VUG A;  4EZ6 A;  1DTT B;  3HMJ G;  5E2Q A;  3DFE A;  4ES2 A;  4NCG B;  2FY8 A;  3EGV A;  4CH1 A;  3N6N A;  3PJ9 A;  1XIQ A;  4FS2 A;  1TTH B;  4FXD A;  1FRJ A;  1RWU A;  1APS A;  4MKY A;  3H4D A;  1WC1 A;  3B54 A;  2FVQ A;  2PI5 A;  2OD4 A;  4JI4 J;  2GQC A;  4URS A;  1URR A;  2ZJP Q;  4DUY F;  5LJ3 Y;  3PYG A;  2Q66 A;  3JSB A;  2KM8 C;  1SKR A;  2GMH A;  4N8O A;  3OL8 A;  4NXM F;  1NB2 A;  1FEE A;  1NKC A;  3KLE B;  2UP1 A;  4F0K A;  2FC9 A;  3NG8 A;  5D4N A;  2GHW A;  4AUK A;  4DFP A;  1C4C A;  1AUD A;  3CJ4 A;  2EVZ A;  3R8Y A;  3W65 A;  3CCT A;  3OUY B;  2V2K A;  4UUW A;  2DIS A;  2RF2 B;  4XPE A;  3M2U A;  5AXK A;  1UFK A;  2V68 A;  1DY3 A;  2EW9 A;  3DNC A;  3PW7 A;  2VBY A;  1YBT A;  3Q24 A;  3TUJ C;  2PFD A;  2BAB A;  2ZHB A;  3OHA A;  2V8H A;  1QTN B;  4UST A;  1XNQ F;  2QA1 A;  3F73 A;  3T5L A;  4FPR A;  1JLA B;  4KRW A;  4E8U A;  3MWB A;  1UJ6 A;  2F8E X;  4ZPT R;  3HSD A;  3QZ8 A;  3LPE A;  4I1T A;  1TMJ A;  2F1F A;  4O3N A;  4XDC A;  4RKU C;  1RT7 B;  2E29 A;  4RW7 B;  4LF5 F;  2LEA A;  1WC5 A;  3AXM A;  5IT0 A;  5C7P A;  2J7W A;  3MM6 A;  4RW8 A;  2R7R A;  4M5D A;  3KDN A;  3IS9 B;  4KBI A;  3CIM A;  1RKI A;  2ZH1 A;  3D6T B;  1RAH B;  4PWD B;  1T03 A;  2NYH A;  3UW1 A;  3VVU A;  3TZX A;  5EGY A;  1TAQ A;  4Y34 A;  3NBP B;  1TL3 B;  1GXU A;  2ZBQ A;  2B51 A;  4LFA F;  3KK1 A;  2VON A;  2NXU A;  4IO9 Q;  2CAJ A;  4OYI A;  3EZ5 A;  1AYE A;  1T7P A;  2YNG B;  2AJ4 A;  3RAX A;  2ZH3 A;  3LGH A;  2F9J A;  4F3O A;  3MM7 A;  4DFM A;  1K47 A;  2IYI A;  9RUB A;  1WDT A;  1SQE A;  2UXD J;  3FBB A;  2GJI A;  2Z30 B;  1YRT A;  2HUR A;  5IOL A;  2JVR A;  4KV8 B;  2FY1 A;  3IRX B;  2VQE F;  4B3R J;  3QNW B;  4PXE A;  3NGK A;  1WJ9 A;  1AW0 A;  2F65 A;  1KFD A;  5DLG A;  3PV8 A;  1FJG J;  4ELT A;  4RNN A;  3TAR A;  4HH1 A;  2VHG A;  3TI0 A;  1BE4 A;  1JLF A;  3IAM 9;  1HYS B;  1MWZ A;  2X7I A;  3OBI A;  2AMC B;  4DU8 A;  4USM A;  1GNK A;  3V6D A;  5KT6 A;  1ZA2 B;  3BKT A;  1FWP A;  4IQX A;  2LQJ A;  1ZM3 A;  3CCL S;  2XZT B;  1CPZ A;  2AWZ A;  2DIU A;  2VIH A;  4DN0 A;  4IDK A;  3GV5 B;  4OJ3 A;  2KZM A;  2HHT A;  4O0N A;  3AJ1 A;  4QZV B;  2C28 A;  2EPI A;  1AA1 B;  5GVQ A;  3CJK B;  3PX0 A;  1N32 J;  3QT5 A;  1SC1 B;  2G2O A;  3BPD A;  1RT6 B;  3TVK A;  3FBE A;  3QLH A;  1Q7L B;  3DM2 A;  3IM9 A;  2Q1L A;  2JEI A;  2KKH A;  1VJW A;  1RTD A;  2I38 A;  1H72 C;  1F60 B;  4RWX A;  2M2B A;  3UPF A;  4NI2 B;  2UU9 F;  1WEX A;  1J2V A;  2W7A A;  1IWG A;  2DY9 A;  4IOC Q;  3GP9 A;  1RAG B;  5SZT A;  1BLU A;  2VC0 A;  4DUZ J;  2QC3 A;  2GA7 A;  2HND A;  1EZZ B;  5KT3 A;  3N01 A;  4RLE A;  1LWX A;  1YTY A;  4OZ1 A;  4FF2 A;  4CT9 A;  5J1E A;  3V4I B;  2BJ3 A;  3EZO A;  5HAO A;  3GSI A;  4QR2 A;  1N5Y B;  3GIM A;  2BAN B;  4LQ9 A;  1B64 A;  5AXL A;  5C42 B;  3OTE A;  3DI6 B;  3A8K A;  1Q5V A;  4J9R A;  4WE1 A;  5GAD U;  2G0C A;  2FLP A;  3GFX A;  1IKV B;  2F40 A;  2R7U A;  4WU3 A;  1UW9 A;  3SDE B;  2HRY A;  3ILO A;  1OY8 A;  5LJ5 Y;  2WOM A;  4FS1 A;  3OTO F;  4N5S A;  2HQF A;  4P2F A;  4JOU A;  4YUD A;  1HNI A;  3X1L B;  3ZZU A;  2D9O A;  4ZIT A;  1GFW B;  3GQC A;  2RQC A;  4DI6 A;  4F0M A;  3ADA C;  3OSN A;  4NLR A;  1JLC B;  5IQ6 A;  4YFU A;  1VQP S;  1IBK J;  1XER A;  4U7U D;  3DRP A;  2I8E A;  1HBO A;  1XK8 A;  3M4X A;  5M2P A;  4KKO B;  4USH A;  4G65 A;  1CSJ A;  2ZJQ Q;  1JKH B;  1LXN A;  5CYQ B;  3IWX A;  5HVF A;  1RAB B;  4CLZ A;  1N5T A;  3KG4 A;  2R7X A;  3M8R A;  2IPO B;  1A9N B;  1RLD A;  3D68 A;  3B8H A;  4IH5 A;  3W8P A;  3HO1 A;  2VG7 A;  4B02 A;  4CH7 A;  4LF6 J;  7AT1 B;  2OPQ B;  1UWB A;  3OTD A;  1KFS A;  3MCO A;  2L08 A;  5EX0 A;  1RI7 A;  1N33 J;  4P72 A;  4DS4 A;  1RXO B;  2OPR A;  4C11 A;  2EFQ A;  5T7L A;  2F5G A;  3MD1 A;  4M5H A;  1QSY A;  3I4H X;  4G6V B;  5HLF A;  2ZNY A;  3JXO A;  1HNX J;  2VV5 A;  2BV3 A;  1ZH5 A;  3V6J A;  1TU0 B;  1FHT A;  2V4R A;  4A8S A;  4QPT A;  1IN0 A;  1H38 A;  2HW3 A;  1S5Z A;  4FP9 A;  1DQ8 A;  1URN A;  3CD7 A;  2CPD A;  2J9D E;  1S1X A;  2KXN B;  4LF9 F;  1U45 A;  3K57 A;  3QFW A;  4ICL B;  3QT8 A;  2P5V A;  3PHE A;  2MKC A;  4OLO A;  4MYU A;  2KYZ A;  3DDN A;  3HXM A;  4LJM A;  1SIW B;  3WQP A;  4CLF A;  4GKK J;  1RAC B;  3CUL A;  1X0P A;  2VPY B;  4Q2M A;  2DNK A;  4QYR A;  1CJV B;  5JVH Q;  1N0U A;  3V2U C;  5DM7 Q;  1SBR A;  1PG5 B;  1NAQ A;  1MLA A;  2W8K A;  4O3O A;  3OXF A;  4JI6 F;  2OH2 A;  2ZWP A;  5B0F A;  3TRG A;  3CDE A;  1M5O C;  1S12 A;  2HS0 A;  3OXG A;  3CF5 Q;  2HK3 A;  1UP1 A;  3JTN A;  5BYS A;  3MR5 A;  4KAI A;  2M8H A;  2IA0 A;  3AOA A;  2CQ0 A;  4FF1 A;  3M8P A;  1QLN A;  2DTJ A;  1S1V A;  4L75 A;  2Z57 B;  1T0T V;  1BWE A;  4QWD A;  4I69 A;  4ZVP B;  1SJQ A;  2K7J A;  2GHP A;  1HHT P;  1FEH A;  2W9A A;  4MH8 A;  4RU2 A;  4OX8 A;  2CPE A;  2DIV A;  5KFP A;  1IUJ A;  2B7C B;  3IXQ A;  4DPX A;  1S6O A;  1WHY A;  3TW0 A;  1MMN A;  2GNK A;  4B3T F;  4ZPC A;  3S6E A;  3MD3 A;  3CCZ A;  1REV A;  2VFT A;  5G0R A;  2B6A A;  3K5N A;  3JYT B;  2IRU A;  4CLW A;  3R5C A;  4TYA A;  4WWS A;  1HW9 A;  2V63 A;  4JYA J;  2D9P A;  4DR2 J;  1HPZ A;  2QA4 G;  3DLE B;  3GSD A;  4GKJ F;  4OYZ A;  2RS8 A;  2WSF C;  3HDS A;  2V69 A;  3RRK A;  2PEH A;  2HHS A;  3GIK A;  5DG9 A;  3LH2 S;  8AT1 B;  2EFN A;  4C48 A;  2DGW A;  4YHH F;  1OYE A;  3Q8Q B;  5A0Y A;  4DR7 J;  2FUG 9;  1C4A A;  4WP8 A;  2PMZ D;  4X4P A;  2VC1 A;  3G2X A;  3RZA A;  1RTJ B;  1FK9 B;  3C15 B;  5CH7 B;  3LTO A;  2W2M P;  1GMV A;  3NOC A;  1SIZ A;  2IJR A;  1WTB A;  4CQ1 A;  3A8E A;  1HQE A;  1NU4 A;  4JBC A;  1Q7Y T;  3TZZ A;  1T9X A;  1U24 A;  1TV6 B;  4DZD A;  4AFF A;  1O5J A;  5IS2 A;  1V5I B;  2IA6 A;  2MKY A;  2YX1 A;  1XTZ A;  2DNP A;  5KFJ A;  3DLH A;  1UVM A;  1TVR B;  2HIY A;  2VQF F;  3UVJ B;  3M2R B;  4MT1 A;  1KLM A;  4OHW A;  4CM0 A;  1RWO B;  2BKO A;  4PG7 A;  1S6P A;  2BJ1 A;  2KRB A;  3VQS A;  1KDN A;  5E3C A;  5A2Q U;  1EQ0 A;  4H54 A;  2Y9H A;  2VL1 A;  4OHV A;  3H0P A;  2PA3 A;  1U49 A;  4KYZ A;  2NPF A;  2HRT A;  2V4J B;  4DU7 A;  2C3Y A;  2L3M A;  2EWH A;  1U2F A;  5LMU F;  3GYN A;  5D6G A;  2XNQ A;  4OL8 A;  3HSJ A;  2XI2 A;  3BS9 A;  3KLG A;  2G13 A;  4KHP J;  4R8U A;  4LBH A;  2XLI A;  1NK4 A;  3DOK B;  4I2P B;  3TUZ C;  3FMW A;  4OLP A;  7FD1 A;  3PJX A;  3CCE S;  1ZM4 A;  1A6L A;  1VLY A;  5D77 A;  1QSL A;  2W1B A;  2PO4 A;  1WC4 A;  3ZC4 A;  3CJT A;  4JI1 F;  2VU5 A;  4YB6 A;  2YKP A;  3R2D J;  5C25 A;  3PM9 A;  3MMA B;  4OZ0 A;  4LQ3 A;  4ZVT B;  4EGL A;  2C2R A;  1GMW D;  4IFY B;  2OML A;  4HLB A;  1YWX A;  2HVZ A;  1FCA A;  3BH6 B;  3MM9 A;  3T1H F;  2KFN A;  1TL7 B;  5B0B A;  4IH7 A;  3DGP A;  5F3Z A;  5D4L A;  1TKT B;  3HFK A;  1SQF A;  3WC0 A;  2ZM6 F;  2DBB A;  3CDB A;  1UEK A;  1K0V A;  3I0R B;  3HHK A;  2FGC A;  4H4K A;  3CT9 A;  4UZC A;  1JJC B;  1HWU A;  6FD1 A;  4HDH A;  4PG8 A;  4DL2 A;  4MK9 A;  1VC5 A;  1FES A;  2NXN A;  2LU2 A;  1HIY A;  2R8K A;  5F8N A;  4OX9 J;  4F4Z A;  2W4D A;  4W90 B;  1KHV A;  3MDF A;  3RW7 A;  5BR8 J;  1TEL A;  3AD7 C;  4I0W A;  1D3W A;  5KFQ A;  1H74 A;  2RD5 C;  3RR8 A;  1VRU A;  1AZS A;  3KLV A;  4QU7 A;  2LDI A;  3KJV A;  4O3S A;  4M5L A;  1NK7 A;  3PXG a;  2X1G A;  3CME S;  3NMA A;  4WFN Q;  3OV7 A;  4DV4 J;  3U7J A;  3ULH A;  5C24 A;  4NXM J;  1W2B R;  4DX5 A;  2ATC B;  2ASL A;  3MR6 A;  1X7V A;  1N4L A;  3H5S A;  3U02 A;  3DN9 A;  1S7H A;  3M2U B;  3RRG A;  2C2Z B;  1EX8 A;  2LQ8 A;  1A7G E;  3JTO A;  1QAI A;  4TYB A;  4U67 Q;  2AJ0 A;  2MZJ A;  4EFA C;  2JJ4 D;  4NE9 C;  3K8V A;  1N6Q A;  3CCW A;  3UFC X;  4NEY A;  3SSR A;  2GW8 A;  3G8S A;  4ECZ A;  1OY6 A;  1JIH A;  2UXC J;  3VVT A;  1LNQ A;  1WDD A;  4IO1 A;  3M7V A;  4JV2 A;  5A8W A;  4X4R A;  4IG0 A;  1UVN A;  1KQG B;  5FII A;  3AOB A;  1JK9 B;  1D09 B;  1HQ2 A;  1O0P A;  3HD2 A;  4LF5 J;  3SSS A;  1Y3J A;  3MM6 B;  3K5L A;  1HBM A;  1NDP A;  1Y5N B;  4ES3 A;  5FD1 A;  2BVZ A;  3PG9 A;  4WZM A;  1WHW A;  4QWB A;  2QIF A;  2DHA A;  1UKU A;  1CQM A;  1FJ7 A;  1T03 B;  4DF4 A;  3MI7 X;  1N5V A;  1YJU A;  4C8N A;  3OFE A;  4YR3 A;  4FNH A;  4DCP B;  4OZ5 A;  4RR5 A;  1MML A;  3BH7 B;  4F2R A;  4PYA A;  1LV5 A;  3JB9 k;  4DV7 F;  1FFG B;  3UWT A;  2J76 E;  2DR9 A;  1H73 A;  3KK1 B;  4LF7 F;  2KN4 A;  2EBG A;  1Q79 A;  4IRD A;  1RYS A;  3UI3 A;  1FKP A;  3CVK A;  1MWQ A;  1WNE A;  2JOQ A;  4DHV A;  3MM7 B;  2HWH A;  2M7S A;  2WON A;  3MEE A;  1Y5L B;  1Y10 A;  1Z1Z A;  4M5M A;  4JI3 F;  3BBB A;  2HG4 A;  4Q45 A;  3PVX A;  2QLF B;  2IJN A;  3T1Y F;  3SV3 A;  3BQ0 A;  2XY7 A;  3LOU A;  2I6W A;  4FN5 A;  2OEJ A;  3DU5 A;  3BSA A;  1SKU B;  2UUB J;  2QFI A;  2RH3 A;  2PDA A;  4JP8 A;  1JLF B;  5B0G A;  2CNO B;  2JNJ A;  3VQT A;  1QJH A;  4KY3 A;  2YX7 A;  2GCF A;  1QDU B;  4K4W A;  2VZ9 A;  3PYD A;  4USJ C;  1YDL A;  2D3O R;  2ASY A;  3KNG A;  5ETO A;  1T02 A;  1SL2 A;  3OJU A;  4KO0 A;  4K7Q A;  3R6G B;  1AFJ A;  1OO0 B;  1S6U A;  3ZNJ 1;  2B4U A;  4TLR A;  5C5J A;  4WF9 Q;  3TX0 A;  4DOZ A;  1RA6 A;  3MAH A;  4ZP7 A;  2CJB A;  2XUL A;  4FXW A;  3HVR A;  1XMQ J;  4OYX A;  4EO8 A;  3KLI A;  2FVP A;  3QLH B;  3DM2 B;  1RDR A;  5K8P A;  1E6Y B;  1FRM A;  1SH3 A;  1RTD B;  3AFG A;  4K2J A;  1G1X A;  3M8Y A;  4ATN A;  5I3P A;  2FDN A;  3E01 A;  1CJT B;  4L6V 3;  3TAP A;  1S57 A;  2OSQ A;  2G9O A;  2JLF A;  4WP3 A;  3DYA A;  3BSC A;  1SC3 B;  4BS2 A;  2HND B;  3SV4 A;  4CWB A;  3Q8V A;  4CIO A;  2YWE A;  4ZVF A;  4LSL A;  4P7V A;  3KLF A;  2XQC A;  2K7K A;  4Y00 A;  4J9S A;  4ANE A;  1K1S A;  3IRW P;  2ZEJ A;  4ZPA A;  5JJB A;  2IMO A;  3A3P B;  3Q0A A;  4WE1 B;  3K5O A;  3NCR A;  3CJ3 A;  1NJY A;  2B4O A;  2ASJ A;  2ROG A;  2WOM B;  3MM8 A;  4NAS A;  3N9U C;  5B0D A;  3K59 A;  5K5M A;  1HLW A;  4LUB A;  1AT1 B;  4M94 A;  1PBU A;  1HI8 A;  2MKK A;  5H9E K;  3IFE A;  2AJF E;  2NZ4 A;  3MGJ A;  3ELH A;  2MSS A;  1UA0 A;  4CI0 B;  1IBC B;  4X4Q A;  2V9W A;  5K14 A;  2DKO B;  3T3F A;  1Q1K A;  1G7C B;  3DRP B;  3VCD A;  3UCG A;  2I9S A;  1HBO B;  4J9M A;  3FKB A;  4KH0 B;  2W01 A;  2BQ3 A;  4P75 A;  3HHD A;  1NME B;  4K4X A;  3DRR B;  2FC8 A;  4DV0 F;  1Q5Y A;  4DL0 C;  5DQG A;  5J2Q B;  4R25 A;  5E41 A;  5ETS A;  2XMT A;  4CLY A;  3LAN A;  5IZH A;  2V9K A;  1R8A A;  3IWN C;  1KVI A;  1O6X A;  2J0X A;  1WOS A;  5HP1 A;  1NRK A;  2HEK A;  1P27 B;  1UWB B;  2RNE A;  1X9M A;  3I56 S;  3KDO A;  5HMX A;  3EVM A;  4AL7 A;  3G8Q A;  3ISZ A;  2BW7 A;  1OQ3 A;  2XMU A;  1Y4Z B;  1FXR A;  2ZKU A;  1HNW J;  1WG1 A;  1HD0 A;  1FRX A;  2DNH A;  2DHX A;  1RHQ B;  4M63 A;  5T7L B;  4EI2 A;  4Q5V A;  1GX5 A;  1BHN A;  3K0J A;  1TUG B;  3OSP A;  3KYL A;  3THP A;  2LA6 A;  2MZQ A;  2RSQ A;  2VFR A;  4NLY A;  4PG5 A;  4U9R A;  5IV3 A;  1EET A;  4DLE A;  5KFG A;  1N36 J;  4LF1 A;  3DOL A;  2LMI A;  4L72 B;  3MMJ A;  4DV5 F;  1RHK B;  1WWH A;  2VD3 A;  1RA7 A;  3HD1 A;  1S1X B;  3CJ2 A;  2E5I A;  2Y0S D;  3CD0 A;  3LO3 A;  3MUR P;  1HI0 P;  4C9D A;  3P45 B;  1IQT A;  1BWV A;  3JQK A;  4DR6 J;  2IAJ A;  2RRN A;  5I3U B;  1RIS A;  3I5C A;  5JUM A;  3NGU A;  3I55 S;  1MNE A;  2HHQ A;  2Y1J A;  3DXB A;  2N4D A;  3MMB A;  4M5I A;  1Q8I A;  2DYA A;  1TK0 A;  4I6A A;  2YNF B;  1HBU B;  2MY7 A;  4USI A;  1SJ3 P;  4C8Z A;  2JX2 A;  4OV1 A;  4ZP8 A;  1EP4 B;  3M8P B;  1S1V B;  2ZH5 A;  4OI2 A;  1SH0 A;  1F9E B;  2VG6 B;  5FLX Y;  4C2M A;  3CD6 S; 
#chains in the Genus database with same CATH homology
 3ELH A;  3VGS A;  2HVD A;  1KDN A;  2NCK L;  4F36 A;  4HR2 A;  1S57 A;  1XQI A;  2DXF A;  3B6B A;  3PJ9 A;  1XIQ A;  4AND A;  3EM1 A;  1NDP A;  1W7W A;  1NDL A;  1WKK A;  1LEO A;  1MN7 A;  1MN9 A;  1HHQ A;  2DXD A;  3FBE A;  4F4A A;  3B54 A;  1NLK L;  3ZTP A;  3BBC A;  3FBB A;  1F3F A;  1NCL A;  3Q8V A;  3ZTO A;  1K44 A;  2HUR A;  3NGR A;  5IOL A;  3ZTR A;  1NSK L;  3FKB A;  2B8P A;  3DKD A;  3Q86 A;  1ZS6 A;  3G2X A;  1B99 A;  3FBF A;  4EK2 A;  3EE3 A;  5CAA A;  3R9L A;  3ZTQ A;  2DXE A;  1U8W A;  4DI6 A;  3GPA A;  4FKY A;  3MPD A;  2DY9 A;  3NGT A;  4ANE A;  5C7P A;  3GP9 A;  1VYA A;  3BH7 B;  4WBF A;  1HIY A;  3Q83 A;  1BUX A;  4FKX A;  1NB2 A;  1NSP A;  4W98 A;  3ZTS A;  1S5Z A;  2ZUA A;  3BBF A;  3EIC A;  3EJM A;  2AZ1 A;  4UOF A;  3NGU A;  4ENO A;  1NHK L;  3FCV A;  1NDC A;  3EMT A;  3EVW A;  4UOG A;  1LWX A;  1B4S A;  1PAE X;  2HVE A;  1BE4 A;  3VGU A;  3DDI A;  3Q89 A;  4DUT A;  2VU5 A;  1NDK A;  2B8Q A;  3EVM A;  3FCW A;  2DYA A;  3VVU A;  1PKU A;  4UOH A;  3WX8 A;  1F6T A;  1JXV A;  1WKL A;  3FC9 A;  3PRV A;  3ENA A;  3VGV A;  2AZ3 A;  3EVO A;  3L7U A;  4C6A A;  1HLW A;  2CWK A;  1EHW A;  2BEF A;  3NGS A;  5BXI A;  1NSQ A;  3VVT A;  4CP5 A;  1BHN A;  3VGT A;  4ANC A;  4DZ6 A;  2BX6 A;  3ETM A;  3BBB A;  5CAB A;  4O0N A;  3JS9 A;  3Q8U A;  4S0M A;  1NPK A;  1NUE A;  1UCN A;  3BH6 B;  3Q8Y A;  3FBC A;  1WKJ A;  1S59 A;  4KPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...