3ZZYA

Crystal structure of a raver1 pri3 peptide in complex with polypyrimidine tract binding protein rrm2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
QSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
publication title Crystallographic Analysis of Polypyrimidine Tract-Binding Protein-Raver1 Interactions Involved in Regulation of Alternative Splicing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 27
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zzyA00
1U6FA 5JVGQ 2G1DA 2F9JA 2FC9A 1Q81T 2L08A 2MHNA 1QM9A 3VAFA 1X4BA 2MZSA 1WF0A 1X0FA 2F3JA 2CQPA 2DITA 5IM0B 3I55S 1IQTA 1FNXH 4C0OC 1Q86T 1A9NB 2DGOA 2AD9A 1Q7YT 2MYFA 5DM6Q 3VAHA 1VQ6S 1AUDA 2MPUA 5HL7Q 1S79A 2M8HA 4IOAQ 2MY8A 2CQ1A 2LYVA 4IOCQ 5BJRA 5ITHA 2M2BA 1U1KA 5LJ5Y 1VQ9S 4C4WA 5H1SV 3R1LA 2MJUA 3CD6S 2MXYA 1M5PC 2LMIA 3CCRS 4ED5A 2VODA 2LEBA 4QU6A 2KM8B 3CCLS 4TLQA 2VONA 2MKIA 2AYGA 2RS2A 1HA1A 1WG1A 1X4EA 5IFMA 2UP1A 3G8TA 5GVQA 3U1MA 3S7RA 1WWHA 3CMES 2LECA 3L3CA 3MD1A 1QVGR 1U1RA 1P27B 2JVRA 2MSSA 4EGLA 2DNZA 2MZTA 4QPTA 1S72S 1ZZFA 3US5A 3MURP 2VOOA 3PIOQ 4ERDA 1H6KX 2MKSA 2CQ3A 2XS2A 1U1OA 3RW6A 1N8RT 2U1AA 1U1PA 2LXUA 4ZKAA 5LSOA 1WG4A 2D9PA 3Q2SC 2JVOA 1UP1A 2M8DB 5LJ3Y 4J5OA 2DNLA 4TU9A 2OSRA 3VAIA 2KYXA 1H2VZ 1WHVA 2DK2A 2DNKA 4YUDA 5GMKa 3CCSS 1D8ZA 3TP2A 2FPHX 3J7ZT 1WTBA 1D9AA 1WEXA 3CF5Q 1SJ3P 1U2FA 5LXYA 1HD1A 1VQKS 4OZ0A 3CC4S 2G4BA 1X4DA 2HGLA 1WHWA 2LEAA 2Q79A 1NO8A 2CPYA 4Z2XA 2MY7A 3G8SA 5MLCV 3N9UC 2KXNB 5EN1A 3MI7X 1OIAA 5GAHU 2J0QD 3G71S 3K0JA 1WI8A 4Y00A 2N7CA 3NMRA 2MQMA 2KH9A 1VQ8S 3V4MA 2DNYA 3B4DA 2DB1A 2DNNA 3THTA 1WHYA 4TU7A 2KVIA 3THPA 2LXIA 3MDFA 3P49B 2YWKA 2MKKA 1OWXA 3CXCR 1BY9A 2MQNA 4M5DB 2DISA 2HZCA 3NS6A 2N82B 3UD4P 1WF1A 2DNPA 1PGZA 3S6EA 3UCGA 2MKJA 1DZ5A 1KC8T 1B7FA 1VQLS 2AYMA 5IQQA 2N3OA 2DHAA 2OTLS 2CPIA 2YH0A 3BO3A 2MKHA 2DHSA 3G9CA 3BEGB 2M9KA 3CCJS 1SXLA 2DGTA 2J8AA 3G96A 3CMAS 2CQCA 4U67Q 1L3KA 2QA4S 2E5HA 2DGQA 3ULHA 3P5TL 5CA5A 2MQPA 1P1TA 1X4AA 4LMZA 2EVZA 1WI6A 1N54B 4WFBQ 1M1KT 2OIHA 5DDQC 1FJEB 1DBDA 1KD1T 2DGSA 2KN4A 2MGZA 1F9FA 4IUFA 1UAWA 2DHGA 1X4GA 4A8XA 2X1AA 1U1MA 3I56S 2KRBA 1X5SA 3VF0B 4F02A 2MB0B 4OZ1A 3MUTP 5CXTA 3CTRA 1WEYA 2DNQA 5DDRC 2KFYA 1VQNS 4WFAQ 1U1LA 2HYIB 1WEZA 3G6ES 1HL6A 1H2UX 2MMYA 2L9WA 2MZQA 2M70A 3VALA 2D3OR 1VQMS 1O0PA 1KQSR 3UWTA 2CPEA 2DGUA 3FEXB 2A3JA 2AYBA 2LA6A 1NJIT 3MXHP 3JB9k 3LQVA 2D9OA 2DGWA 2LKZA 2J76E 2B0GA 2HVZA 5DDOC 2L41A 3IWNC 3TYTA 4PR6A 2MSTA 2N3LA 1JJ4A 2J0SD 1JJ2R 3NNHA 3FEYB 3LPYA 1Q82T 4CQ1A 3BO4A 4FXWA 5DETA 1H2TZ 3ZZZA 5DDPC 3VAKA 4V19X 2FY1A 1URNA 1XN9A 2XNQA 2CPJA 2CQ4A 3R1HA 3EGZA 2RUGA 2RRBA 2K8GA 1X4FA 2X1GA 1YIJS 2LQ5A 3CCUS 4Y0FA 3EX7B 1PO6A 5GAEU 2KI2A 4QU7A 5LSLA 2OSQA 2U2FA 2BOPA 3BO2A 2EK1A 1YITS 2RU3A 3MUMP 1UW4A 4YOEA 2NZ4A 2KG1A 1VBZA 5D78A 3TO8A 2AYEA 2GHPA 2KT5A 3CCQS 4C7QA 1VC0A 2PE8A 1KOOA 1WHXA 2G0CA 2M0GB 2RT3A 5HO4A 3BS9A 3R27A 2BZ2A 1X4HA 4PKDB 3CCES 1VQ7S 1VQPS 2RRAA 1SJ4P 2FHOB 2NLWA 2DIUA 3RW7A 1YJWS 3VAGA 1DHMA 1U1NA 4CH1A 4RU2A 2RS8A 2O3DA 3P3DA 1R8PA 1WG5A 5LXRA 3CULA 2CQGA 5GADU 2GO9A 4WFNQ 4YB1P 1X4CA 2CQIA 4LJMA 3VAMA 2WBRA 4W92B 1VBXA 3J7YU 1N88A 2JX2A 1M5KC 1YTYA 3UE2A 1YI2S 2K3KA 2MGZB 1OO0B 2QFJA 3NNCA 2DH8A 2E5IA 5IM0A 4WKRA 2KG0A 2KM8C 1NU4A 2CQHA 3CUNA 2DNHA 3HI9A 2DO4A 2X1FA 4CH0S 2OJ3A 3PIPQ 3NNAA 2MZRA 1U1QA 2M52A 1JMTA 2CPZA 1YJNS 5CYJA 2I2YA 1R8HA 2XSFA 2X1BA 1A7GE 2JRSA 1VQOS 2LA4A 1U6BA 4PRFA 2V94A 1M90T 2ZJRQ 3OW2R 2I38A 1KOHA 2KXHA 2RNEA 4WF9Q 2ADCA 2HGMA 3ZZYA 3MOJB 1CVJA 4QQBA 1X5TA 4FXVA 2DNOA 3SDEB 2DGVA 2DH9A 3SDEA 1FHTA 3CCMS 3HHNB 1FT8A 2MZJA 2CQ0A 5JVHQ 2VOPA 1SJQA 2M7SA 2SXLA 2RQCA 4IO9Q 2QEXS 3UD3P 3H2VE 4UY8T 3DLLQ 2LCWA 2CQ2A 2HGNA 3P6YC 1FJCA 2MQOA 2ZJPQ 2E5GA 3U1LA 2KU7A 1M5OC 1N52B 3UCUP 4UQTA 1WELA 2CQBA 2DO0A 3D2WA 2YH1A 3SXLA 3CC7S 2CPFA 2KRRA 1FXLA 2M88A 1RKJA 1VQ5S 2DH7A 4WCEQ 3CC2S 3CPWR 2CJKA 3VAJA 1RK8A 1VQ4S 1OPIA 2CPHA 3S8SA 2MQQA 2OTJS 1YWXA 2YKAA 2KXFA 5DM7Q 3CCVS 4CIOA 1HD0A 2F9DA 1FO1A 4F26A 2XS7A 1X5OA 2XS5A 1X5PA 1QVFR 2DNMA 2RQ4A 1VC6A 2EK6A 1SJFA 2DNRA 3DXBA 2ZJQQ 2DIVA 1FJ7A 3G4SS 1JJHA 2MQLA 4W90B 3SMZA 1K9MT 3Q2TC 2E5JA 4BS2A 2M4MA 2MZ1A 4TU8A 5FJ4A 1UFWA 1WF2A 3EGNA 3MUVP 2DHXA 4F25A 2PEHA 3H2UB 2CPXA 2YTCA 2DGXA 4P6QA 1ZH5A 2XNRA 1W2BR 1YHQS 2ADBA 2DNGA 2FC8A 2ERRA 1YJ9S 2CPDA 2JWNA 1ZZNA 1G2EA 5D77A 1M5VC 3MD3A 2RVJA 1VC5A 1K73T 1VBYA 1K8AT 4WIIA 2MJNA 3B4MA 1SJRA 5GAGU 3IRWP 2CQDA 2MKCA 2E44A 1DRZA 2KHCA 3S01A 3UCZP 2XB2D 3NS5A 4LIRA
chains in the Genus database with same CATH superfamily
1HHSA 3RJMB 4Q8EA 3VAFA 3KUEA 2EWHA 1RBLA 2IA6A 3I32A 2HVEA 4C9DA 4OHZA 2ZWPA 4J90A 1LV5A 1IBKF 2H4WB 2O5DA 1Q7YT 3M9OB 5DM6Q 3A8IA 5HVFA 3TAPA 5KTQA 2E7VA 4ZP7A 2HNZB 5BJRA 4JV5J 1FXRA 3NGKA 4S0MA 2AZ3A 1XQIA 1YG0A 5LMUJ 3I87A 1NLKL 4PXDA 4ZN3A 4DV6F 4A8QA 2G1HA 1HQ2A 5IFMA 2C2DA 2WVFA 3M8WA 4DPXA 5HANA 1VISA 2BR0A 3BGRB 2WK4A 3E01B 4D3HA 2WSFC 2UV8G 4TQSA 1ZZFA 3CT9A 4K4ZA 3ZTSA 1S0VA 5SUHA 3GIRA 5C25B 3NBPA 2FVQA 3MWBA 4F4ZA 4DFPA 3K8VA 1FRJA 1PAUB 4U9RA 3DFEA 2DR9A 1QSSA 3RBEA 4IFVB 3CJ3A 2GVDB 2QMXA 1SJ3P 4ZJQA 4USUA 5IC6B 2V68A 5EWEA 3K5OA 3DU5A 2VA2A 9RUBA 2IFXA 1BLUA 4USJC 2N7CA 4K4XA 3NMRA 3GZ7A 1VQ8S 2QZ8A 4E98A 1FKOB 4WJBA 3IN5A 4Q2LA 3PX6A 2WONB 4J9MA 3NS6A 1WJ9A 1L3SA 4ED7A 3VWSA 3TAMB 2N3OA 1S9EB 1QAXA 4DV1F 2DHAA 2W01A 1RYRA 1LW0A 3EPIA 4OYMA 4HHUA 2VDIA 2IRXA 2N7YA 4O0NA 1KD1T 3KG0A 4CLYA 3R6LB 1XNRF 2GQ2A 3CTRA 3PEHA 4JI1J 2L9WA 2J6UA 1HNIB 4MK9A 1F2GA 2V8HA 5D3GB 4PCQA 1X9MA 5KFKA 1REVA 4DG1B 2BOAA 3Q89A 2N3LA 3PX4A 1RXOB 5D4NA 1PC4A 1T05A 1TAQA 4A8MP 4PWDB 3HP6A 4RNNA 3EZOA 1HW9A 2BE9B 4WP3A 4ANDA 1RT3A 1UWBA 4X84A 3N6NA 3JS9A 2RRNA 4ZPCA 1ZETA 4DF4A 3CCUS 3VR1A 1VIXA 2HW3A 1GX6A 5KFFA 1KVJA 1AYEA 1QAYA 4DZ6A 2IDEA 3MOZA 5KFOA 3HPOA 2RT3A 4RBTA 2BJ3A 3BS9A 5L46A 2WVEA 1TL3A 3W2WA 3FMBA 2XBPA 2N4CA 2LQ8A 3TZXA 1WG5A 1KTVA 4GKJJ 3MGJA 4CLLA 1C0UB 2CJQA 1VBXA 4KE5A 4O4GA 5F8IA 3CB4A 4A48A 2MGZB 1Q5YA 1RHUB 3I31A 3BPSP 3C2PA 2KG0A 3TAQA 4I1TA 3CUNA 1KFSA 4QIEA 4ILRA 2QMWA 3DLKB 2UUAF 1XBWA 3MAAB 2XLIA 4CDIA 3A3PB 1VBKA 2L9DA 2MHEA 4QIGA 3BQ0A 2W2NP 2W2PP 3PM9A 1D9FA 3SI8A 3BGOP 2VOPA 2ZEJA 2MDAA 4MAKA 5BYQA 3DLLQ 2LCWA 2ZZNA 1RU2A 4P74A 1YLXA 3BQ2A 2RQMA 2FY8A 2MLXA 1V3ZA 2M88A 3JQMA 3WZ0A 4OL8A 1M0SA 2J6SA 2KYZA 3LANA 4L3KA 4DZDA 3PY8A 4K0KJ 3R7BB 1BQXA 4YB5A 4TN2A 2R2SA 1Y00A 3KLEA 2BKOA 4CLSA 4DN9A 1RP5A 4USWA 1S97A 3ONQA 2G13A 4P71A 1DY3A 3R5JB 2C3YA 4DHVA 3L09A 2Y1JA 4R8UA 4PPZA 1TU0B 4RUCA 4ER8A 1YBAA 3OVSA 4I2QB 2MJNA 3KK2B 1VQYA 4NLRA 3UCZP 4LIRA 3HKZD 5JVGQ 1UTAA 4B3MF 2JL9A 2PA8D 2BM1A 2HVHA 3NGUA 3KJVB 3ITHB 1LQ9A 3K8WA 5IXUA 3NKYA 3D66A 4ZCIA 2DJWA 4FYWB 5B08A 4LSZB 4UF4A 4NLDA 1H38A 2E9TA 3HF5A 2L3MA 3X1LB 1AW0A 1X4EA 2IDLA 3HCXA 3HLUA 3S7RA 3F73A 3KOAA 4I0WA 3PKYA 4QPTA 3HHLA 3O44A 1QE1A 4DUYJ 2KZZA 5LSOA 1TFWA 2D9PA 3Q2SC 4AL6A 1L3UA 4LF6F 2CIMA 3Q8QB 4JYAF 1H2VZ 3EXYA 1W2IA 2V2KA 1RT6A 3QBCA 4C0BA 1PCAA 2WHOA 1VJWA 2KXNB 3FCVA 1U48A 2BDPA 4LFBJ 4C8MA 1RT7B 2PT0A 2CJBA 5LMNJ 1WHYA 5AE3A 1UJ4A 3QSYB 1APSA 1LK5A 2R8GA 4USHA 4CRJA 2AYMA 3JAMU 4RW9A 4U96A 2WTFA 2B9EA 1NDPA 4NCAA 1D0EA 2CPIA 3VTIA 2OPQA 2GGPB 1NJYA 1OPZA 1TFYA 1Z4UA 3BN4A 3SSRA 4C11A 2XHWA 5D0RA 2YVSA 3MMCB 3J80Y 1UETA 1TVRB 1E6VB 3MEEA 4O3NA 2DHGA 2FJDB 2MZQA 3G87A 1VQMS 3D1OA 4O23A 3UDLA 4CZCA 3JB9k 2FJWA 1TELA 2EG2A 5G0RB 3NS7B 3L4BC 1FE4A 4DSLA 3T9ZA 3C16A 4ZS6A 2RILA 3N28A 3QMQA 3PEJA 4RWWA 3D0HE 4R5PA 2QL9B 3ILLA 3FEYB 1S10A 1Q82T 1RAAB 2VF3A 3AOCA 3B82A 1F5CA 3R5BA 2RUGA 2RRBA 3IM8A 1IR1A 1P9YA 2RU3A 4OX8A 1ZS6A 2IY5B 4IOBA 3V6JA 3ENWA 5DQIA 2AYEA 4CM0A 3D68A 4Y34A 2OPSA 4NI2A 1RAHB 4QWEA 2VBZA 4OLPA 4ED4A 5I3UA 3A1YG 4I6WA 2O3DA 4ZCMA 2BRLA 5HQ8A 3ZTOA 1U26A 4UOGA 1OY6A 3C46A 1RWVB 1U47A 2R8JA 1XMOF 2X1FA 3FEZA 3IBWA 1IJFB 3TI0A 5IV3A 3GJRB 3NAIA 1U25A 1TL4A 4JI6F 2A2CA 1A7GE 5EWGA 2MLYA 4QIFA 1VRTA 4CTAB 3KWMA 1KOHA 3M9MB 2GJIA 4LF8F 3GYXB 3SDEB 1NK0A 2B6AA 2L48A 4C3LA 5J1EB 1NKBA 1QY7A 2W9CA 3M6XA 1IKXB 2XYHB 4M1KA 4H4MB 3SCKE 1IVZA 4N41A 1DLOB 3JSMA 4PYAA 3CJ8A 3GSDA 4JB8B 3CIMA 2VASA 3MMAA 2YH1A 3SXLA 2KRRA 1VQ5S 2DH7A 3CPWR 5CYQB 3A4TA 1S0NA 4K50A 4ZHRA 1RE1B 1CJVA 2HS4A 4F26A 2RF2B 3BDEA 4BWJA 2DNRA 1K44A 2F40A 3M1VB 3SSSA 4BS2A 5FLXU 1WF2A 2XO6A 1PBAA 3H2UB 1UVMA 3GLJA 3MCSA 3K17A 4XAKA 3FBFA 2F5GA 4LRDA 4JI8J 1CULA 3VVUA 1VOMA 3DOLB 2K06A 5ETMA 3RG6A 2XGPA 2OD6A 3QATA 4CNYA 4TQRA 4DX7A 2XB2D 3MMBA 3H59A 2RSQA 5L9XA 1KDNA 3EE3A 1O6XA 4KV8A 5RUBA 2J9DE 2AD9A 3M8YA 4G1PA 2CKWA 2AWZA 5AXKA 3UN3A 2VPZB 3OR2B 2VQFF 5LJ5Y 1VQ9S 2I0XA 4ELVA 1GX5A 5KFZA 4WU2A 1RDRA 3DYAA 3CJKA 5I42A 2B56A 2PEBA 5HK4A 2HURA 4U8YA 4ETZA 2E9RX 2H4YB 1VCTA 5GAGI 3MEDA 3POTA 4C8KA 3U1MA 3WBZA 2CAJA 2G2OA 2CNKB 1QVGR 2YKNA 1RCOB 3LP0A 4EGLA 2Z4PA 1SKUB 3B6BA 2P9CA 1Q8IA 1GQEA 1FWLA 5D0HA 6FDRA 2XC9A 2P6TA 3O3LA 2YKOA 5L39A 1NRKA 2DNLA 2W2OP 4K7QA 2HHHJ 3W66A 1MN9A 1WTBA 1WEXA 1U0SA 1N0UA 3CC4S 4K4WA 1FRIA 1JNRB 4DOZA 2MY7A 5JJBA 3D0GE 5GAHU 1Q53A 2HBQB 3Q83A 4Z7CA 4DL3A 1SBRA 2VG5A 1Q0NA 3K5LA 2W7AA 3ZZRA 3H0PA 1YBUA 3HVAA 4FPRA 3LPEA 2ZHAA 1E6YA 1LW0B 4USVA 2XI3A 4KBIA 3CVKA 5KT4A 3EM1A 1R0AA 2EVZA 3MMJA 3C66A 2P9GA 2V9KA 4ZN1A 1UAWA 4DL5A 3O1LA 3I56S 5IC4B 3U27A 4KHMA 3LH2S 1B99A 5T7LA 2UUCJ 4MMOA 5E41A 1Q8LA 2DXEA 4OI1A 2RDJA 2A3JA 4NEYA 1NJIT 5DQHA 3NOCA 5FDLA 3KJFB 3D6FB 1MROB 1JLAA 1S77D 3SFGA 3DC2A 3CD7A 2OPPB 4CQ1A 4KH0B 1R89A 4NA3A 3MPUB 1F5BA 4FXWA 3NP5A 2RUSA 4ZIWA 3KJNB 3E2EA 1DTTA 2K1RB 1NSQA 3Q22A 4ZK7M 3K7RA 2KI2A 4KHRA 3N6LA 5A2QY 1PJ5A 1FXDA 2R7XA 4NLQA 1FRKA 1N5YA 2I5JA 1RT2B 3K5MA 3HM9A 3QT5A 5HATA 1S1UA 2LQBA 2RRAA 1SJ4P 3GCWP 1M1GA 5KFQA 3J81j 4PABA 2CQGA 4J9PA 1NAQA 2GNKA 3T5KA 2IBOA 4MYTA 2XWYA 1HWLA 4G1QA 2HHSA 2FJXA 2Z57B 1SB6A 1BXNA 5F41A 5KFDA 4UOHA 3HI9A 4O3OA 4PZVA 2UUBF 1ITPA 3P8BB 3T5JA 5L8RC 1FEHA 2ZC4A 4ETXA 1HNWF 2HIYA 4C3KA 3QGGA 1VQOS 3QT6A 5D0EA 5HAOA 3Q8RB 1T0TV 2O01C 2QYCA 3E3XA 4YN3B 2HHTA 4ILMA 2PMZD 3H2VE 1FJCA 4JV5F 1UA1A 3RB3A 4QYRA 1NK6A 2C1EB 3N79A 4L73A 5LMUF 3IWLA 3BSAA 4DQSA 3CC2S 1JLBA 1GMUA 3BPDA 1RT5A 1XEZA 1GMWD 3PNIA 1YWXA 3H20A 3IA0A 3CCVS 2FTRA 1EZZB 2QSWA 3KHRA 2DNMA 1EKSA 3KLEB 5HROA 3R97A 2IAJA 2MZ1A 3MR2A 3D5MA 4PWWA 2IIHA 5K14A 2WBMA 4JI0J 1H7WA 4R8UB 1W2BR 1FX4A 3ET6A 2DCUB 1RADB 1U4BA 2CADA 4GVBA 1SJRA 2JDJA 4OZLA 4E8UA 1X9WA 3PO5A 3LP1A 3PHEA 3CIZA 1B0VA 4FPIA 3OR1B 1FNXH 2XSJA 1LK7A 4ZLPA 4B9UA 4YB7A 2W25A 2M8HA 2KKHA 5LOQA 4PG7A 3AQOA 1T8EA 2O67A 1JLCA 5CYMB 4IOCQ 2YQ3A 1NK5A 3GSIA 1U1KA 3GYNA 4QWCA 2WVBA 1UJ6A 1FVQA 2JZ5A 1R0CB 2OAUA 2RS2A 4Q43A 2WRMA 3G82B 1WWHA 2J9DA 2HHUA 1JLFA 1OY8A 7FDRA 4FF3A 2DNZA 4RW7B 2ATLA 5C2GA 3US5A 1AFJA 1EX8A 3SQGB 2MKSA 2EFPA 2Q43A 4JI1F 4B08A 3AOBA 4TY8A 4I68A 2VV5A 3R7NB 2B4UA 4PUOA 1WHVA 2DNKA 1CQMA 1R6YA 2HZVA 1M5SA 1RT6B 4EZ9A 5IOLA 1FK9A 4DV2J 4UUWA 2JEGA 2LEAA 4V19J 4DPWA 4PQAA 4LVOP 2CPYA 3UPFA 1SVDA 3L7OA 2AP6A 1BHNA 1GXLA 2HBYB 4OYOA 4TU7A 1DURA 3QQCD 4QR0A 1BQMA 3GPAA 4OV6A 3CCZA 4RW9B 1NB2A 1ZM2A 2GVZA 3FGVA 4NZ7A 3DI6A 4P2FA 2XQCA 4RO0A 3OXGA 5ETOA 3CCJS 4YDDB 1SXLA 1LOUA 2Y8YA 3P5TL 1NBEB 3OLAA 3HHKA 1DBDA 4ICLB 5KAKA 3BYRA 1HI1A 4IUFA 3TUJC 4HTJA 4C3MA 4M5LA 5DDRC 3LP2A 2HYIB 1U1LA 2XO7A 1S9GB 1H72C 2JEJA 2HQDA 2ZUGA 4MYUA 4GKJF 2Z2MA 3P4UB 1LEOA 5ADZA 4DCOB 1Y5LB 5BR8J 1JXLA 1EQMA 2YKMA 3I5BA 3L9ZA 4ES1A 3C16B 2HLUA 2AV5A 2HBRB 1ROFA 5K5MA 4IRDA 1RTDA 3GJTB 4CO0A 2VJVA 2ZZMA 2IM3A 2V34A 3GIKA 5DETA 2UXDJ 1KHWA 1NJXA 1I5OB 2CPJA 3QGHA 4TYAA 4IG0A 1UEKA 1PO6A 1VHIA 5E0OA 5KG3A 2OPSB 4KC5A 4NI2B 3M2RA 1WC3A 5E3QA 1NPPA 1SC1B 2UVUA 4DQQA 1TL1B 3E8OA 2R42A 4X4VA 4TVAB 5SZTA 2FHOB 2KFZA 5KT7A 4K0KF 5GADU 2FB0A 2QG9B 4WFNQ 1X4CA 3UFCX 4IR1A 1AUSL 4TNOA 1TUWA 3J7YU 5CAAA 7FD1A 2ZDPA 4F2SA 5H9EJ 1M5HA 3NNCA 1C0TA 4DFJA 2J7UA 2QIFA 4RJVA 4FBTA 2JRSA 3TANA 1HBUB 1CQNA 4N5SA 4CO3A 4KYZA 4ENOA 3GIIA 3GR1A 4Q45A 1MNEA 2V63A 2FLNA 4D3GA 4FKYA 2B6AB 4KFBB 3RBXA 5HMXA 1FHTA 3MM6A 3PDNA 1HBOA 3MTKA 1WUUA 2RQCA 2VG7A 1N5VA 1GNKA 4YR2A 4LSNA 1NHKL 3JSMB 1FDBA 3OXLA 4IO1A 3IG1B 4KTQA 3W2VA 1RAJA 4NEZA 3DLGB 4X64J 3KLGB 1Q78A 1RKJA 5EDWA 1Q8KA 4EYIB 4ZHRB 1OPIA 2MQQA 1HR0J 3P5BP 4CIOA 1I94J 4ED3A 1CJKB 1EETA 1TKTA 3LGNA 2XYPB 1SQFA 1HBNA 4WU3A 3FSXA 5B09A 5FJ4A 3R5DA 3FNNA 2RJZA 1HWUA 4DUYF 2F8HA 4OJGA 3JYTA 1VC5A 1KLNA 1NSPA 2OPRA 1N36J 4RUBA 3KHLA 4M5MA 3TEHB 1G6BA 1Q1KA 3HFZB 4DR3J 2C2KB 3NS5A 4HEA9 2NUUG 3TVYA 4AFFA 1KVIA 3NMAA 3ISZA 3RGIA 2W9AA 5DGAA 4G65A 4EU0A 1KWMA 4LFBF 4OFZA 1XR7A 1LWCB 1R8BA 3BB5A 5LMNF 1X0PA 2UUWA 2J9EA 2DR7A 4LBPA 3MFHA 3I0SA 4CO2A 2C3PA 1UVKA 2B7CB 4CP5A 4I56A 5BYRA 4DU7A 4EYHB 3MEDB 3POTB 2UP1A 4B9LA 4RPFA 4ELTA 3LP0B 2MSSA 4NMXA 3CJ5A 4HH1A 3MR6A 2V69A 3R5AA 2EI5A 3FMWA 3ZZPA 4ZKAA 2W1BA 2JVOA 4J5OA 3NG8A 3SFUA 3VAIA 5DGBA 5GMKa 3TP2A 2CVEA 2GFFA 1U2FA 2HFSA 4RW6A 2Y0BB 2VFTA 2VKZG 2ZH1A 5ETQA 3WC2A 2FGCA 5EN1A 3W61A 5C7PA 4QW8A 1YQHA 2DNYA 2DB1A 4GO5X 5KOWA 4LIWA 4U6PA 4IH6A 3DU6A 1T95A 3DGPA 2HMIB 3N5FA 2ILYA 3J7Z5 1SH3A 4KO0B 2EKYA 1RWMB 3LTOA 4IG3A 3V2UC 2W7OA 2E5LJ 3I5CA 3FFIA 2J5AA 2ASYA 3IWXA 1OSCA 2LDIA 3HHLC 4LF2A 5GAHI 4OZ1A 1WEYA 2DNQA 3T6BA 4OJHA 1WEZA 1Q95G 5T7LB 3ZXWA 4LFAJ 2GJFA 4F7VA 1B70B 2LA6A 5FDLB 4A47A 2F4FA 2ZHBA 4ZJLA 1WD6A 3TYTA 2YWEA 1SCJB 3V6DA 4Y3CA 1SC4B 2EPIA 1SL2A 2FGOA 4RKUC 3TW0A 3D28A 3MAHA 1DTTB 1LWEA 1JB0C 2OEMA 4KKOA 1IBMJ 4PQUB 1XN9A 3J7AN 2K8GA 3CDUA 4NLSA 1VJQA 2OSQA 2W4CA 2FJEB 2WSCC 1QAIA 3MUMP 2AW0A 1KONA 1RTJB 2DYAA 4EZ6A 2BMBA 5D15A 3IBFB 1N33J 2KT5A 4C7QA 4DV5J 4DMZA 1NHVA 2NXNA 3VGSA 4R0JA 3IGVA 1KQGB 1N5SA 1R8PA 1O8BA 3FKBA 4FS2A 4MFBA 4AE5A 1S6PB 1RTIA 2V5HG 1V5IB 1R43A 2HHQA 1QTNB 4ID5B 3JTPA 4KSEB 3PTWA 4LREA 5J2NB 2HRUA 2QFJA 5AXMA 3CJ4A 4OI4A 2CQHA 4JI8F 2NXUA 2CDRB 2FLPA 3NNAA 4NE9C 4ZVPB 2VC1A 4KR0B 2PGCA 4F3QA 4Q7AA 1FDNA 4ELUA 2HNZA 1M90T 2RNEA 1CVJA 2B51A 1V5VA 3AA9A 3NGDA 4OZ2A 1CSJA 4CT9A 4CLZA 2GIRA 1B7YB 2XULA 3BGRA 3E01A 3VZIA 1N52B 3FRYA 4DSEA 2HQ3A 3I9V9 4KAIA 2PI5A 1R3NA 5JUMA 3OSPA 2KB2A 5C25A 5HMWA 3DOMB 2OFGX 3DDIA 4QWBA 1OQ3A 4YHHJ 2Y9HA 3RAXA 3GV7B 1WACA 2FZCB 4CLUA 1DQ9A 3DXBA 3GG0A 5HROB 2DT9A 2B9WA 2VL1A 4IFVA 3Q2TC 2GVDA 2PEHA 3RBDA 3WIUA 3NEKA 3EGVA 3LGMA 2ERRA 4LBIA 1J5EJ 3OVBA 3MHYA 4GVBB 3C15B 3BBFA 4OIXA 3GMGA 3IRWP 2HHHF 1FKOA 3EPGA 2VZ9A 2WONA 2JHEA 1IM6A 1U8WA 4M63A 4CLPA 2RHSB 5C42A 3TAMA 1X0FA 3AODA 3RU0A 1IQTA 4DR4J 4K8RA 5KFTA 1V6HA 4KPCA 2AF6A 3VAHA 2GQCA 5KFJA 1AUDA 4A8SA 1U49A 4IRKA 4HDGA 2OUGA 1TL7B 5F3TA 3D3BJ 1R6VA 3BKTA 2NXCA 3FCWA 3CCRS 2ABYA 4LRCA 1ZTTA 5F8NA 2Y1IA 2BVZA 2YWGA 5AE1A 5GVQA 4HHJA 5D3GA 1Q7LB 2V8PA 1S72S 1H98A 2CZVC 3JTOA 4DG1A 2QLBB 1IKWB 1RGVA 4ERDA 1H6KX 2GAGC 1U1OA 2U1AA 2LXUA 2UUCF 1XK8A 1DQAA 2RH3A 4PWDA 2ZD1A 2R7VA 2JSXA 3ZFVA 1TKZB 3SQOP 3ISNC 2EXUA 3FK4A 4FYDA 4Q0BA 2DR5A 3PR4A 1QLNA 3CWJA 2WOMB 5H9FK 1ZAWA 2E1MC 2ZHOA 4NCGA 2AZ1A 4FYXB 4X4OA 4G3IA 5K8NA 1AROP 3CJSA 4HHHA 2E9ZA 3MDFA 2YWKA 4J9SA 1BQMB 2XMUA 5HBMB 2VIHA 4K2JA 1RAOA 2DNPA 5AE2A 1Q79A 3T5LA 4P73A 3K57A 1N32J 3DI6B 1M1HA 1DJ0A 1TP7A 1Q16B 2JC0A 3K5NA 5A8RB 1RABB 2M9KA 3TUZC 1S6UA 3M2UA 1Y7PA 4WXWA 3AJ1A 1PYSB 2OIHA 4BLGA 1GT8A 3DHXA 2MGZA 3SV3A 5E7OB 4OYPA 1J5OA 1X5SA 1CBKA 5FD1A 4PG6A 1YGYA 1L3TA 3DLKA 1YSJA 4ZVRB 3ZNUA 2YNHB 2RAQA 3O6QA 3ISND 2R8IA 1B64A 3BF4A 3MAAA 4ZA1A 3SCIE 5DZ6A 2WB4A 2VBYA 2F63A 4EO6A 3B54A 1RTDB 2BQUA 4J91A 1RA6A 5F8JA 3NNHA 2GZOA 3BO4A 1KKHA 3A13A 4WKYA 5LM7E 2QLWA 1FI4A 3CDAA 3H8YA 2HRYA 1A6LA 2VPWB 2NPIA 1RWKB 1LFPA 2IM0A 3KHHA 1AZSB 2R2RA 3TO8A 4ZITA 2BJ8A 3H5UA 3M4XA 1WKLA 3MR5A 1MU2B 1T9XA 2XY5A 1Q8BA 4ZPWR 2KJVA 1YZ6A 2Y3YA 1X8DA 4FF1A 3SSQA 3QNWB 4OZNA 1U1NA 4M5KA 4X62J 2VPYB 4I2QA 2ROPA 3KK2A 3QAUA 2CQIA 3TUPA 1QTMA 4ZCLA 3CMQA 1HQUB 2J6TA 4JI0F 3HJFA 1WSVA 3KJVA 3ITHA 2RIJA 3R7SB 1ZBTA 3IGNA 2DO4A 4ILLA 2RMLA 1FTCA 2M52A 2ZH7A 2I2YA 4ED1A 2KXHA 3BREA 2HGMA 3EVWA 3RYLA 2KFNA 2ZNZA 1V3SA 2LLZA 4NXNJ 5GADI 4ZVEA 4F4YA 1L5UA 3OLBA 2VG7B 1KRPA 4LSNB 1TQLA 5KFHA 1TZ0A 2ALZA 4LF7J 2B7BB 4LT6A 4JBCA 3TJAA 1P6TA 2FYXA 3NWGA 1I1GA 2GHVC 2UXCJ 5KG7A 2ZFHA 1S7HA 1CPZA 1RT1B 1FXLA 4Y2CA 1UEUA 2FJAB 2CYYA 4RW8B 1S6QA 4BWMA 4PG5A 3MR3A 3ZTQA 5T41A 4L76A 3EXCX 1FO1A 1ZA2B 1P8GA 4DCPB 3O5TB 2E1PA 1JJHA 4LRBA 1R0BG 1JQGA 2V8DA 3KLVA 1ULRA 1SUQB 2BJ7A 1IBLJ 3RRHA 3D3CJ 4NOHA 1MMDA 4M5IA 1HFEL 3H42A 3PW0A 3JYTB 5HMZA 1G2EA 1WDTA 1RT7A 3HD1A 4WIIA 5AJ3J 2DBBA 3QJPA 4X4UA 4OI3A 3M7VA 2GV1A 4DV2F 1EP4B 2MZSA 2ASDA 1XR6A 2GGPA 2HQGA 2DGOA 3MPDA 3P45B 2HHWA 3V6KA 2B8QA 2R2UA 3CDWA 2DPIA 2BEFA 1GEHA 3MMCA 2A6MA 2EFQA 1E6VA 1MWYA 3G86A 3OL8A 3CD6S 2HAFA 4LR7A 2P5VA 3MECB 3CCLS 1OJ4A 1G4CA 4ECWA 1K0VA 1OSDA 2QN6B 3G8TA 1NKEA 1VMBA 3K2YA 4ECQA 3OUYB 1U1RA 4L3NA 2H3EB 1T94A 2BRKA 1N4LA 3EVMA 1NK8A 3AFGA 4B9VA 3RW6A 2GC8A 4NYPA 1URRA 1GK8A 3T1YJ 1WG4A 3SIPB 2XMAA 3V81A 5E3CA 5E3AA 5EX0A 4QYZJ 4WXOA 2YX1A 5BXIA 5BR8F 3DRPB 2FPHX 5B0CA 3CF5Q 1U45A 3QSIA 1JIHA 1NO8A 2YX7A 3AJDA 4L75A 1Y5IB 1RZMA 3AD9C 4PXCA 3KHGA 4V1Ak 4B3SJ 3DKDA 1IUJA 3B4DA 2UXDF 1NHUA 7AT1B 2XTJP 2F1FA 2DRAA 1F9EB 2C42A 2IM2A 1PBUA 1CG2A 5E33A 3PW2A 1WOSA 1GXTA 4JI5J 2JLFA 3FFIB 2CXEA 3ZZUA 2V8VA 2E5HA 5HSPA 3ULHA 2CWXA 1CC7A 1WI6A 3GCXP 4C8OA 2LP4A 1VQSA 2P2CB 2LQJA 4AQYJ 2NCKL 3LO3A 2AGPA 3C3LA 3G6ES 2UU9J 2ACMA 2MMYA 3PRBA 3TOQA 3NGTA 1NUEA 3EICA 3IR5B 2CPEA 1U6ZA 4CTAA 4YQWA 4M95A 2AX1A 3W8GA 1RQ0A 4ECTA 3EZUA 1JKHB 5J1EA 4LR9A 3T19A 1RHMB 2HNYB 4W98A 4H4MA 3LPYA 3RUBL 4URQU 1D9DA 3NGRA 1DLOA 1UEVA 4ZPAA 1FE0A 2H1YA 1LWEB 3D4JA 2FY1A 1URNA 3RR7A 1U02A 2YXLA 2Y8WA 2BW7A 3KYLA 3MPYA 3RB0A 2U2FA 4F4KA 1FERA 3GB0A 4DDFA 4LRAA 4C8LA 2KG1A 2RF2A 1G3OA 4P7VA 5D78A 4NLTA 1D1UA 4JV2A 1VC0A 3QRRA 3M1VA 1TL5A 4OV1A 2IRYA 1VQPS 1WC0A 4X65J 2ACYA 2AEMA 2AMCB 2E66A 2HEKA 4QOTA 1TK8A 1HR0F 1I94F 4J9UE 3DOLA 2V4RA 1AT1B 1M5KC 2VFRA 2ATCB 1RUSA 3PX0A 3HVRA 2DNHA 2I6WA 5KG4A 4R25A 5KFAA 4O0IA 4HKQA 1N36F 3PRVA 5HLFB 5HMYA 4DR3F 1C1BB 4FP9A 3C14B 3OR2A 2I38A 2VQEJ 4OHXA 4WYLA 4YMEA 2DGVA 3AA8A 3BSCA 4OI2A 3CCMS 4FYVB 1R27B 4LF5J 3RAMA 1SI9A 1NH8A 2R3VA 4RU9A 4WPAA 4YB6A 1M5OC 1EQ0A 4MKAA 4M94A 3CC7S 4O3RA 4ZVQB 3CGIA 4ED6A 1RK8A 3HSDA 3OBIA 5L1JA 1XNQJ 3S8SA 2OTJS 2KXFA 1UL3A 1I51B 4DUTA 2EFGA 3P96A 1X5PA 2B43A 1SJFA 4ZDNA 3TNVA 3UD5A 1U8SA 4Z7YA 3W5ZA 1XJWB 1NNDA 2E5JA 3AD7C 2QYGA 2K2PA 1RKIA 3MFIA 3R6GB 4EWTA 4RNOA 1R31A 3W5XA 1VBYA 4ZVSB 2PI4A 2IVFB 2CQDA 4EMDA 5KFIA 5L1LA 4EK2A 2G1DA 1AFIA 5C42B 3TJ8A 3MCOA 4JP8A 5HP1B 5IM0B 3V6HA 2I8EA 1SKSA 3BH6B 2VFSA 1KR4A 1LXNA 3KFWX 2C2ZB 4N56A 3VGUA 1XWLA 5KFXA 3M8QB 3DMJA 2DPJA 1YDLA 2FHJD 3M8SA 4RUAA 1NJZA 2VODA 3OL7A 4ECZA 2MKIA 4JI2J 1WG1A 1CJTB 4AD6A 2E5LF 4KY3A 2D3ZA 4Y2IA 2QFIA 5A8WA 2IYGA 4QIVA 4F0MA 5ETSA 3DDKA 2CUYA 2LDYA 1MROA 4A8YA 4M5GA 2I9SA 4GMKA 2OPPA 2R2TA 2ZD1B 4K4UA 2HFNA 4LFAF 2QJ3A 3GIJA 2YNGB 4Q0BB 4NYZA 3C6UA 3I4PA 4Z37A 2K1RA 4JV0A 4NX9A 1PKUA 1X4DA 4O4RA 2ZBPA 4NCGB 4ECRA 3UN5A 3I0RA 2D3UA 3QLHB 1FDAA 4OI0A 2NXEA 1S7IA 2FZGB 5EGYA 3BV8A 1ZA1B 3V4MA 3SCJE 1HMVA 4ZCKA 1BY9A 3PJXA 1RT2A 2BA9A 1IBMF 1U2CA 4M5DA 3QGIA 1WF1A 1PGZA 3UCGA 1B7FA 2FLOA 3UN2A 4M5JA 2YY3A 3QT8A 2HQFA 3DLEB 1N33F 3M2UB 3PXGa 3CMAS 2AIRB 5IZHA 4HT5A 2QA4S 2F65A 3GILA 4DV5F 3HSZA 1UMJA 1N54B 2JH3A 4ZP6A 2X3DA 2D7SA 2KN4A 1J5OB 4LBHA 4DSJA 2CA9A 4WFAQ 1I3OB 4YFUA 5AT1B 4F4AA 2NXJA 5EX3A 2WB1D 1PILA 2H54B 3QT7A 4HR2A 3LQVA 1ZM9A 2BX6A 1G7CB 4DFMA 4FZVA 2ZH5A 2JNJA 3PW7A 1VIOA 1U09A 1JJ2R 5C2CA 2ROGA 2W24A 3IMQJ 2MKYA 2BQ3A 1IWAA 4V19X 4DPTA 2XGQA 2YKQA 3T9NA 3ZC4A 1X4FA 2X1GA 1UFKA 4Y0FA 5LSLA 3DRRB 1HI8A 3BO2A 1FKPB 2F8EX 5U47A 3WX4A 4EBCA 5LSRA 3OT9A 2M0GB 5F9NA 4MK7A 4FN5A 1Y3JA 3V4IA 2V50A 3GV8B 1TV6A 3H2LA 4GRSA 1HWIA 3IO1A 3I96A 2DVIA 4YHHF 4GKKJ 2LXFA 2QLFB 2GHWA 5GMDA 2QA4G 2GO9A 2XCPA 5ETPA 4MIBA 3T1AA 2AKWB 4AL5A 3BZQA 3CJTA 4WYWA 1XMQJ 4I6YA 2K3IA 4QW9A 3OR1A 2KM8C 1LWFB 1NU4A 1J5EF 1JMTA 5D0GA 2V8GA 3UQSA 1D3WA 1NZ8A 4C8NA 5CYMA 3PYGA 2XWXA 2VD3A 2E1AA 3MM7B 5KG0A 3H4DA 3KNGA 4FXVA 3D6HB 1WC6A 2BJ9A 2LQ9A 4DR4F 1PJ7A 5KFBA 5CD4A 5E3RA 1FT8A 3GIMA 1PSDA 3ENQA 2DTJA 3UD3P 2VFVA 3G82A 4LF9J 2JLEA 4DR5J 1VRUB 2KU7A 3UCUP 4RW7A 1WC4A 2C2OB 1S6QB 3SQGA 4WCEQ 3PHTA 2W9BB 5DM7Q 5ETKA 4UY85 2QV6A 2ZJQQ 1RACB 3G4SS 4ZJOA 2VUGA 1S99A 1HARA 2PD1A 3AAWB 4P6QA 1LWXA 2VDHA 2HVIA 1ZZNA 5D77A 2YBVA 2OH2A 3CCWA 2UVVA 3B4MA 5AXLA 2ZE2B 3PR5B 4DR2J 3CD0A 1RWXB 1DRZA 2E44A 1UPPA 3OFGA 2JJ4D 2VA3A 1Y0HA 4CM2A 2XZWA 1LFWA 2NYHA 4OJ3A 2AJQA 4OZJA 3ZTPA 1S0MA 5HJYA 3NL0A 2ZC3A 4ECXA 1YJRA 1FF2A 1BE4A 2H48B 3MR7A 4CLFA 4WK3A 1K1SA 4ICLA 1N32F 4Q44A 4IFYB 4UW2A 3ZZ0A 2LEBA 1WSRA 1S9GA 1K1QA 5JMNA 1YRUA 1SV5A 1NDLA 2UXBJ 4BC9A 4URSA 3W63A 3KTQA 3J7A1 3R8YA 2E1RA 5KT2A 2Q66A 1S1TB 2RE1A 8AT1B 3V81B 3IRXA 2RU9A 3D54A 3HVTB 4HI1A 3QFWA 3AT1B 1HD1A 1VQKS 4OZ0A 4FXDA 4USKA 8RUCA 4WFZA 1SKWA 3MM9B 3N5BA 5BYSA 1IQZA 1OYEA 1ELOA 5A0YB 4NASA 2DISA 2HZCA 2Y0SD 1FX2A 2LVWA 4GC6A 1TL1A 2V6AA 5IT9U 1VQLS 2OEKA 2OTLS 2FDNA 2DHSA 2W7PA 1L3KA 5KOXA 3M9NB 4WFBQ 1N34J 2R9LA 4PXEA 5D8HB 5E3PA 4J9KA 3FVYA 4F02A 2V67A 5CXTA 3IS9A 2HFUA 4F50A 4X62F 4F2RA 1K47A 2ZKTA 3OJUA 2ZBCA 2M70A 2D3OR 4TLRA 1HBUA 3FEXB 2DGUA 4J9OA 1J27A 5FLXY 4X66J 2HVZA 4PPDA 3BH7B 4KFBA 3BYPA 2ZZTA 2J0SD 2BQRA 2POKA 4AYBD 5D4PA 4X4RA 3IG1A 4FDFA 2OELA 3DLGA 3M2VB 1C4AA 3KLGA 1EAYC 4NXNF 5A8KA 2QE5A 4M5HA 2Z30B 4B3TJ 5CHCB 1CJKA 4LF7F 1TR0A 3MPVA 3F41A 1I6JA 2CWKA 3NCQA 2UXCF 3PFEA 1UWAA 2IRUA 4WP8A 3C19A 5MAOA 1DHMA 3PJWA 4OQJA 3W3SA 2MLZA 3QFHA 4DV0J 5HN0A 4B17A 4FVCA 3ZO7A 2XYGB 1IBLF 2VC0A 1NK9A 2K3KA 3HSGA 3GFXA 2E5IA 2W4PA 5B0AA 1NK4A 4WKRA 4L74A 2YNFB 3J81U 3KMQA 2IBKA 2NYIA 1GMWA 1LWCA 3DOKB 2CNLB 5CYJA 5AJ3F 1S12A 5IS2A 1Y5NB 1CS4B 4WF9Q 2ADCA 2VG6A 1TKXB 2DH9A 2BACA 3C8YA 4CWBA 3HK2A 2V4JB 3HHNB 2CQ0A 4LQ3A 2WCXA 4HDHA 3RAQA 2F4VJ 2BKPA 3VGVA 3A8JA 4KHPJ 4I4BA 4MKBA 2ZJPQ 3Q8PB 3QGPA 2PN6A 4OMFG 4C48A 4UQTA 2XY7A 4A8OA 2Z2YB 3VAJA 5A6WA 4I7FA 2XS7A 4DCJB 1VC6A 4RL1A 3F0NA 3LAMA 4QJVA 4DQPA 2D1CA 2ZH3A 1F6TA 3EGNA 3MUVP 3IAM9 1RSCA 4QWAA 1IJEB 2B4VA 3R5CA 4HI2A 1ZH5A 4WBFA 3M32B 2XNRA 3T1YF 2BANA 2AJFE 4HH0A 4ZP8A 2VBWA 3G2XA 2RVJA 4LF1A 1K8AT 4NLYA 3DLHA 2HZAA 5KFWA 1GTEA 2QX0A 2OHDA 2HMIA 1WF0A 2F3JA 4RR5A 1S1VB 4KO0A 3W62A 4U8VA 1FNOA 4B3SF 2C2NA 5KFVA 2WW4A 3TVZA 2MYFA 4NL5A 1R7IA 1T03A 2CQ1A 3BR9A 2M2BA 2H5EA 1U24A 3DMJB 1S57A 1M5PC 3LGHA 4X4QA 2HBZB 2KO1A 2KM8B 3BQ1A 2DHHA 2J0WA 4JI5F 2IVYA 2V2ZA 1JLQB 1NPRA 4H4OB 4RNFA 1UVIA 2MQ8A 2LECA 5A8WB 3GJSB 2ZDOA 3M8RA 1R8CA 1ZOTA 2FVSA 4F3MA 1U0HB 3M6VA 1DQ8A 2UU9F 4OZ3A 5B0FA 1UP1A 5DG7A 1Y10A 1RWNB 5EUHA 4NCBA 1SIWB 2IM1A 5L9NA 3C6UB 2BJ1A 4WP9A 4KJIA 1D8ZA 4ZPTR 1YRXA 2HS3A 4PQUA 1LKZA 3BM7A 4IQMA 5M2UA 4DV7J 2HGLA 1WHWA 1FRHA 5GMEA 2QSFA 3GWCA 4IH5A 3I0RB 1S1WB 2J0QD 2XLKA 4UOCA 1RTJA 4YP3A 1HMVB 1T9WA 4B9MA 4PXBA 3OJSA 2DEJA 4C97A 2C28A 3P49B 2MKKA 1OWXA 4M5DB 1OYDA 1GMVA 2UZAA 3D1HA 5HQMA 4LVNP 1NDKA 3X3UA 3DRSB 3FRZA 2AGOA 1S6PA 4WIQA 3D9BA 3IP0A 2CJXB 2KL8A 2DGQA 1S4EA 1ZAXA 3KXDA 4ID5A 5CA5A 3AQPA 2PA3A 2YNIA 3I4HX 4FS1A 2VU5A 4ATNA 4X65F 5J2NA 5J2QB 1RB0A 2X1AA 1S1XA 2VH7A 3TX8A 1HL6A 1FVSA 1S6OA 3MM5B 3MCMA 5LT5A 1O51A 3EDRB 5IT4A 3RRGA 2J76E 4NZ6A 3DRXA 4H4KA 2HQCA 4USIA 1PAEX 2HAIA 3K89A 3T5HA 1S48A 2LU1A 2BYCA 2VQEF 1H2TZ 1O5JA 4EO8A 3KUHA 2QL5B 4KGZB 1KS2A 4QU7A 1IKVA 3DOMA 1B3TA 1CLFA 4LF5F 2XMKA 1GFWB 4NRTA 4DUZJ 3R3TA 3HMJG 2BZ2A 2HFZA 2IJNA 4F36A 5DQGA 3GQCA 3V4IB 1TV6B 4DV4J 4DQRA 1XNQF 4NA1A 2FD2A 4F4WA 2IJFA 2C2EA 3C15A 4YB1P 3WDOA 4I69A 2HSEB 2M3DA 1FJGJ 2ILZA 4EUVA 3CO0P 3PIPQ 3VHQA 5CZVA 1T02A 1IWGA 3UVJB 5L1IA 2V94A 2QLJB 1TL7A 1ZYQA 3MOJB 2QO3A 4QQBA 5KFEA 5KFLA 2BE2A 3LOUA 3MEKA 4P75A 4C6AA 5CABA 4YR3A 3C6TA 4QIWD 3ZZOA 2ALYB 1SJQA 1HNZJ 2QEXS 3WX8A 2DXDA 3P6YC 5F9LA 2EC2A 3DN9A 1T9YA 4OX9J 3D2WA 1QUVA 4IDKB 1RHKB 3DNCA 1IKWA 2BABA 2CJKA 3IFEA 1VQ4S 4JI2F 3OTDA 5B0GA 2F9DA 4G6VB 3A8KA 4ECVA 4WK1A 1N5QA 3GFHA 2RQ4A 1TKZA 3K58A 2MQLA 2NPFA 2WOMA 3TRGA 4PAAA 4YEAA 2ZH2A 1KNZA 2YQ1A 1MN7A 4OJ1A 2OFHX 2FC8A 4A46A 4CYUB 4B3OA 3BKUA 1XERA 1MMNA 4B3RJ 5HBMA 2FC9A 3LWLA 2MHNA 5KT3A 2JOQA 4P2SA 2EFNA 1QJHA 3TQ1A 1VLOA 4R0EA 2J7WA 3N0VA 5A8RA 4NMLA 4ECYA 1L3VA 4IKAA 3AY0A 4KGXB 5H1SV 1KLMB 2XEXA 4RNMA 3OD2A 5IWAJ 3PZPA 4DR6J 2B9XA 4DR1J 2ZWOA 1NDCA 2YNHA 1U7LA 3TA1A 1SV5B 3L3CA 1VHFA 4J9QA 3AXKA 1S76D 3E51A 2C2MB 2C22A 4B9NA 1NKCA 4DV3J 3PIOQ 2UVWA 2HNDA 1YBTA 1VYAA 3IRXB 2A2DA 5KFMA 4Q5VA 4NLGA 3MF5A 1AA1B 1C2PA 4WE1B 3K59A 3FJ2A 2F8MA 5C24B 1S9FA 2R8KA 3T1HJ 2CVIA 3AH6A 2G4BA 1QSYA 1DTQB 1JLEB 2R4FA 2NSBA 5H9EK 4DL0C 5DLFA 5KG6A 1C1CB 3K0JA 1AZSA 3DM2B 2DNNA 3EZ5A 3QIPB 1RHJB 3OQ2A 1MU2A 2N82B 4O44B 3PACA 4O3QA 4DSIA 4WTOB 5ETVA 3LW5C 2MTLA 2YH0A 3BO3A 3M8ZA 2IC3A 2IHR1 3NGSA 4ZVFA 4RW4B 2MQPA 4LMZA 2WZ1A 1HQUA 3M30B 2CJ9A 3GP9A 4WTYA 4RX6A 3N01A 4M5NA 3IS9B 4GKKF 2JEFA 3AJ2A 2PFDA 2CG4A 1LW2B 2XZTB 4CH7A 1O0PA 3LUYA 5THWA 5EHHA 2DKOB 1PIEA 1RAFB 1XMQF 4BC7A 1YJVA 4ECSA 4NZ0A 2FLLA 4ZLLA 2E1CA 1F9HA 4DWIA 5DG8A 4LFCJ 5M2RA 1BMQB 3TWZA 4PEOA 1FTRA 3GJQB 1RAEB 2KZMA 1T9VA 2ASLA 3U1NA 2N4DA 2Q3PA 3B8HA 4ANCA 1RT1A 2UV8A 3M8PA 3EGZA 3A3OB 3KDOA 5A8KB 3AB4B 4RW8A 2LQ5A 5J2MB 2PIIA 5DO2A 2EK1A 2NZ4A 1VBZA 4LF9F 2YWFA 2GHPA 2AGQA 4DR5F 2NS1B 2EKNA 1WHXA 2VJUA 1TAUA 1GXUA 5HO4A 3GE9A 1SUQA 2Z56B 3UR3C 2NUHA 3EWGA 2G2YA 2ZH6A 2KJWA 4ED8A 3AD8C 2HRTA 2RKIB 5M2PA 1IR2A 1ZAVA 4LSLB 2KT3A 4XPCA 1HIYA 1BD6A 1EP4A 3SV4A 1OO0B 4ZIVA 3PKMA 2XMTA 2ZBIA 3RB4A 3CW2C 2OP5A 3TA0A 2MZRA 2HWTA 3N4WA 4OX7A 4XPEA 2BW2A 4DR2F 3OTEA 2B8PA 4OLOA 1R8HA 4OI6A 4YY3J 2LA4A 3NCRA 2BKNA 3ZZYA 3M6UA 1N48A 1X5TA 3PYEA 2VG6B 2XLJA 3R2CJ 1JLGB 4LF4J 3MECA 1P9QC 4DL2A 2EW9A 2MZJA 2COLA 5AXNA 2M7SA 4N76A 2HGNA 3LA0A 4BDPA 3R9LA 4HTIA 1MSWD 3OUYA 4BBYA 3SZ2A 3J80U 2AJ0A 1KN6A 5C5JA 4I7FB 2YKAA 5ETLA 1PYOB 3HZGA 5DJBA 1SJ1A 1HBMB 1QVFR 2DIVA 3DRPA 2UXBF 1FJ7A 3BJYA 1YJ7A 1K9MT 3QYYA 2CZ9A 3CEDA 4L6V3 4K4TA 3QWUA 3B78A 2BANB 1JX4A 4ZPDA 2EFVA 2ZNYA 3L7PA 3MD3A 2G2ZA 1K73T 3TR5A 2FZKB 1C4CA 3QO9B 3UO0A 3JQKA 1Y3KA 2GA7A 1T03B 1UVNA 4UT4A 3D67A 3OTOJ 2NZCA 2Y1RI 4P9SA 4E0DA 4C4WA 1EARA 2HQIA 3NRBA 1RA7A 1UJ5A 3PV8A 2H65B 3OFFA 4LQ9A 2ASJA 2DR8A 1N0VC 4QU6A 2VB6A 3H7HB 3KJQB 1QD1A 1XIQA 2QL7B 4ZMMA 4HVZA 3HFVA 2V0NA 3F44A 1SL0A 1D09B 2XCAA 1P27B 1N34F 4DJBA 5I4MA 1FRMA 4ZVHA 1PYTA 1JKHA 4EBDA 1DAXA 1SH2A 3RTVA 3HX9A 2HNYA 2RD5C 1S4FA 4NXMJ 3MTJA 4F4XA 2OSRA 5K8PA 3CCSS 1TKDA 4X66F 3J7ZT 1V3RA 4UOFA 5ETNA 3S1TA 2J9CA 3BDPA 3DLJA 1VS3A 2D41A 2ZH8A 3DCAA 2EC0A 3ZZTA 3IM9A 2C3UA 1NZAA 4J37A 4F0KA 4Y00A 3OFEA 2Z2LA 1VR6A 1OY9A 3THPA 3CXCR 2VPXB 2Z58B 4PG8A 3HHLD 1HPZA 1DZ5A 4IYQA 1H73A 1N6QA 4DL7A 3LAKA 3OVAA 4DX6A 1SPBP 4DEZA 4B3TF 4GC7A 3GYGA 5FIIA 4Q8FA 3I82A 4NWBA 3G96A 4CLKA 4ZVTB 2WSEC 2YNIB 2P8IA 1X4AA 3W7BA 1T9UA 3U7JA 1VI7A 1RISA 1S1XB 2RQKA 4NLPA 3F56A 3SCLE 2HKEA 4GVLA 5CQGA 4ZLNA 3CNQP 3EDQB 4ZPBA 2D74B 2VKRA 2HVDA 5HLFA 3N6MA 3VALA 4DV0F 1C1BA 1WOOA 4OHVA 3C14A 3HZEA 3UWTA 4TYBA 3JSYA 2WVDA 5L38A 1RHQB 4F0HA 1S49A 1RWUA 5JXSA 3NBPB 1Y11A 2H5IB 1FCAA 2GMJA 1RJJA 2JFKA 2B5JA 2CJYB 3AHPA 4X4PA 3R1HA 3D6TB 4PG4A 3OHBA 1IKVB 5EWFA 1GTHA 4IRCA 2D69A 4RBUA 2F4VF 3LWMA 4KHPF 4FF2A 1SKRA 2A6OA 2G0CA 2AT1B 3R27A 1NB7A 5HI7A 1RTZA 4JV1A 1TTHB 5IV4A 3IR7B 2NLWA 1F5AA 3HJVA 2BJEA 1HQEA 1NSAA 4ANEA 1RU1A 2ZH9A 1KHVA 3H5SA 4A4JA 4K4VA 1FNMA 2JX2A 3LALA 4AL7A 5KFRA 3UDEA 3G8QA 3HVWA 5HP1A 3H5YA 5IM0A 2R7UA 3TA2A 1VFJA 4ZOSA 2J0XA 2NREA 2JC1A 1WTFA 3HT0A 4ZLJA 3PRDA 3HO1A 2BE2B 1WKJA 2YPYA 4K4SA 3M8QA 5F3ZA 1REVB 4FF4A 5D4LA 3C6TB 2X7IA 2V2QA 2HG4A 1F0XA 4QBUA 1FKAF 2ZM6J 1CJTA 1T05B 1S59A 3QPIA 2ZOMA 1KSPA 3W9JA 4JI7J 1X7VA 1KVKA 4HLBA 1RT3B 1UWBB 1F3VA 4U95A 5E5NA 1MWQA 4J9RA 4U7CA 1U2RA 2QRRA 4JI4J 3CSKA 1HD0A 1X5OA 4K2XA 2CJAA 5E2QA 2YNGA 3QRPA 1K0TA 3FC9A 3Q86A 2GMLA 2R7SA 1TL3B 4EFAC 5B7WA 3W2WB 1XR5A 2GCFA 3KLHA 2B9YA 4WFXA 1YHQS 3IR6B 2ADBA 1Q4RA 1YJ9S 3QLHA 3KK3A 3TVKA 2HK3A 1RCXB 3OFHA 4B3OB 1VLYA 2EEYA 2MKCA 3S01A 4N8NA 4N77A 4QZVB 1U6FA 5D4OA 4O4GB 2L08A 3KG1A 1QM9A 4DV7F 2Q6CA 4N7TA 4BHQA 1RLCL 2CQPA 1HW8A 4NLWA 2QTWA 4DR7J 3TARA 1Q86T 3DLEA 1ACMB 3Q8UA 5A2QU 5ETTA 4UTGA 5F8LA 2MY8A 2LYVA 1HKAA 2X3GA 1LXJA 2PDAA 3HD2A 3MPWA 4HL9A 1YRTA 2FVCA 3ILIA 1Z2LA 4KGVB 3MD1A 4RLEA 1SH0A 2VOOA 1KEKA 3FQKA 1RBOB 2CQ3A 1AB8A 2HNDB 5K20B 1U1PA 1YKWA 4U7UK 3W8PA 3SYZA 2PC6A 2DK2A 4YUDA 3FZ2A 2P6SA 2HHVA 3H40A 4GO7X 1CEZA 4HT7A 4E2FB 4A8WA 3DRRA 4Z2XA 3G8SA 1FKPA 3G71S 1NH7A 1DFDA 4MK8A 3DXSX 2YPZA 3DGVA 3W65A 1KC8T 2FJBB 3IBCB 5IQQA 1QSLA 1S5ZA 2VHGA 4JI3J 2R7QA 3PFOA 3KNAA 2IC3B 2MKHA 4J7CA 1IBCB 4DUZF 2CNNB 2J8AA 4KQZA 2CQCA 3UW1A 2QA2A 5F0UA 1S0OA 3QJLA 4I67A 5DDQC 1FJEB 4DV4F 4ZVGA 4A8XA 4TKTA 1U1MA 2KRBA 3VF0B 1LWFA 2ZBQA 2GS8A 2GW8A 2FHMA 3BKFA 4Y2KA 1QUPA 1WC1A 4FNHA 3D1QA 3UR0A 2XMJA 3ICLA 2BV3A 1FJGF 3MM7A 1HYSA 2D9OA 2LKZA 4Y65A 3DHWC 2RDIA 3HHLB 4WZMA 1KP6A 4USTA 3G6XA 1QE1B 3KLIA 1VK8A 1JXVA 4MKVA 3J7YI 3ELHA 4MH8A 2FQQB 1VRUA 2HWHA 1NXIA 4DSFA 2DY1A 3M8PB 2XNQA 2CQ4A 1PC5A 4J9LA 1PG5B 2WW8A 4ZPVR 2XHCA 1HNZF 2W9BA 1UW4A 4YOEA 4DSKA 3L95X 4DL6A 3O2IA 1RBAA 4NYOA 4YS2A 4OX9F 4UZBA 3RB6A 1FD8A 2DD8S 3EUNA 1SL1A 3OV7A 3MCNA 4JOUA 2DIUA 1YJWS 3VAGA 3AXMA 1UFLA 2OPQB 5CCLA 5LXRA 1FESA 1CJUA 2PO4A 3D7SB 2ZE2A 4C11B 2BM0A 2APOA 4LJMA 2A1BA 1YK9A 1F3FA 1HNXJ 1NM2A 2E29A 1N88A 3KKFA 3UE2A 3JSBA 3MEEB 2Z0GA 3BN7A 2WVCA 4K59A 2QA1A 3KK1A 4H4KC 2GAHC 1KFDA 1U1QA 3H90A 5KFGA 1UVJA 2G9OA 2OD4A 1U6BA 4B3RF 2DY9A 4HACA 2JFDA 3NCPA 4QYZK 1TK5A 4RUHA 4DBQA 4IFYA 1T9TA 2AHOB 1BGXT 4LRFA 4IQXA 4R5PB 2SXLA 2IA0A 1CC8A 1RWOB 4P72A 4KB7A 2IJRA 2CZ4A 1YJUA 4WWSA 1F2HA 5IWAF 4DL4A 4CO4A 2KHDA 1ZPVA 4DR6F 3BGUA 1LNQA 1S1TA 4DR1F 4NLVA 3KUGA 2YWHA 2DEIA 4DFKA 2OKQA 3RZAA 3HVTA 1IM4A 2UVRA 2M4MA 2CDQA 1OMSA 4DV3F 2DHXA 5I3UB 1X60A 4MKYA 2FHJA 3MM9A 2ZKUA 2JWNA 1EHWA 3U02A 2HFOA 3HXMA 3FCHA 5A0YA 4I2PA 3CD5A 3T1HF 3W9IA 3KMSA 5LL6d 3NAHA 5CH7B 3T3FA 3I55S 4C0OC 4DF8A 5F8HA 2KTQA 2LU2A 1VQ6S 2CNOB 1VRTB 2IPOB 3R1LA 3QZ8A 3H98A 1FFSB 1ZM4A 2W9CB 1IXKA 2R7WA 4OHYA 3MM8A 5KG2A 3CMES 2QC3A 2HWIA 3T41A 3VVTA 4O3PA 3MMAB 4NLOA 4G1IA 3RRKA 1T3NA 3WHIA 5IT0A 3MEGA 3W9HA 1WDDA 1SQEA 1CJVB 5F8MA 4A8FA 4MTPA 2KYXA 3M2VA 4ECUA 2H51B 4OYIA 4RWXA 4Y6IA 2YQ0A 3H25A 2OEJA 4TY9A 2JLGA 4ED2A 4XDCA 3W64A 3M05A 3D6MB 4LFCF 1Q5VA 5MLCV 2W4DA 5J2PA 1IBKJ 2AQ4A 1F1BB 1YX2A 1CULB 1TUVA 4X64F 2E7XA 2XMMA 1BQNA 3FBEA 2BXJA 3BGLA 4JUZA 1HPZB 3DLBA 3MMBB 3S6EA 3IAS9 2HIQA 1N6QB 3Q8YA 1HWJA 1FRXA 4DV6J 4KV8B 4OZ5A 5I3PA 1J2VA 3BEGB 1KQKA 4U67Q 4DX5A 4KGKA 4DQIA 2HFVA 4KH1B 2EFOA 1P1TA 1B0TA 1F9FA 3DYAB 4KPYA 3CJKB 5I42B 2YNFA 3NXZA 3DRYA 3MUTP 3G6VA 3DOKA 1H2UX 1KQSR 4QR2A 2O1PA 4N8OA 5K9FA 1CS4A 1Y9OA 3KLFA 1HHTP 2YKNB 3MXHP 1NEEA 3VCDA 5HQLA 3THVA 2B0GA 3PYDA 1TKXA 1BUXA 4PR6A 2AJ4A 2V4JA 2FVRA 4ES3A 4FKXA 2R7RA 4KT0C 4OHWA 4DLGA 3HHEA 4YY3F 2B5JB 1NMEB 3VAKA 2G0JA 5L1KA 3OTBA 3I6PA 3IC1A 2DRDA 4ZVUB 4LF4F 5CZXA 1SIZA 5GAEU 3L7UA 4DV1J 3OHAA 3W1YC 1YITS 3QAEA 4I64A 1H74A 3TZZA 3H5XA 4DLEA 1KOOA 2VG5B 3EJMA 3PVXA 4PKDB 1VQ7S 2H5JB 1ZPWX 4AXJA 3KDNA 1E6YB 1XNRJ 3M32A 1HQEB 3HFKA 3RW7A 1UKUA 1RTHA 3HDSA 4USMA 1X31C 3CCTA 4DPYA 3CULA 4CNZA 2ZVSA 4EBEA 1RT4A 1NPKA 3EYZA 1R0AB 3ENAA 2RB7A 1NJWA 4OYZA 3MAQA 1S1VA 2YX4A 2O66A 3AOAA 2GIFA 4P2MA 4W4MA 1YJNS 1BC6A 2R7OA 5A76A 1H0HB 2Y1LB 1MG7A 1RHRB 2X1BA 1G1XA 3JTNA 1RLDA 4FVMA 2RDDA 4KRWA 5F0WA 2ZVIA 1RWWB 1JLAB 1H3DA 1HNVA 2Z2ZA 1FA0A 3BSNA 5JVHQ 3DDNA 1JLQA 1FEEA 4H4OA 3EMTA 1UZHA 2CQ2A 3OTOF 2PMWA 3G6YA 3U1LA 1T7PA 2XZDB 1IR0A 2ZOGA 2EG1A 4N47A 1NK7A 1TK0A 2ZITA 2CPFA 4OYBA 1U0HA 2H9ZA 1MW7A 9ATCB 4X4TA 2YWWA 1REGX 2CFXA 4RZRA 4LR8A 5DZ7A 5KT6A 4C2MA 3FSYA 1N5YB 2I5JB 1FWKA 4P52A 4ES2A 4TU8A 2FJVA 4F25A 3KLHB 1S1UB 2A0FB 2CPXA 2GMHA 1S1WA 3VQTA 3KK3B 4A8KA 1IKYA 2W8KA 4NXMF 3FQLA 2UUAJ 3OL9A 4NLXA 2KHCA 3R5GA 2W8LA 3LF0A 1VRQC 1Q81T 4G1QB 3FDSA 1ZM3A 4ID8A 1D8YA 3SEOA 2DITA 1AXQA 1MWZA 4P7TA 3UDCA 3DRSA 3MZIA 4J9NA 1H7XA 1B0PA 4UZCA 1P1LA 2MPUA 5HL7Q 1S79A 4IOAQ 1JNZB 4O3SA 1F60B 4XO0A 4K5SA 3OL6A 3TUIC 2HS0A 2MJUA 3ADAC 1XTZA 1HWKA 5J2QA 2MXYA 2PFFB 4ED5A 2DXFA 2VONA 4B9TA 3HHDA 4QWDA 1HA1A 2HHPA 1VDHA 3MM5A 4NLUA 4XDDA 3D0IE 4X2BA 2AX0A 4YR0A 3M6WA 2JVRA 1RWPB 2PMHA 1XC9A 2MZTA 1A0OB 3GFYA 3MURP 5F8GA 4XK8C 4F67A 1JLBB 1RT5B 2XS2A 2Z8QA 3VQSA 2YKPA 4F04B 3TEGA 1JXEA 4K4YA 1W25A 1WOPA 2M8DB 1UCNA 5LJ3Y 2Q1LA 4TU9A 3WIVA 3Q0AA 3HSJA 2HK2A 3T6JA 2IAJB 4AXIA 2DCLA 3UDVA 5DG9A 1EIYB 1GAOA 4B3MJ 4XIUA 5K14B 3FBCA 3Q8SB 3OSNA 4QPXA 2QMUB 5D6GA 3ET6B 3MI7X 1UZDA 2V2VA 1QDUB 1V9OA 2ZUAA 3CJRA 4M8LA 3OPKA 2MQNA 2NQPA 1ZTWA 5IQ6A 3BBCA 1UPMB 3LP1B 8ATCB 4C8ZA 1UW9A 3GFZA 2K7KA 3FBBA 2A18A 1S9EA 4X4SA 6FD1A 1KQFB 2XSJB 1VGYA 5K8OA 4YDXA 2DGTA 2OGUA 2BE7D 3BGFA 3NY0A 3O8WA 1JLCB 1HLWA 4NA2A 2AU0A 3PW4A 1M1KT 2LFVA 1R8AA 3EGWB 2CG8A 1X4GA 3BBBA 2MB0B 3GTYX 3NOGA 4URGA 3FZBA 4AT1B 4RBVA 2F7VA 4LF6J 2GO8A 3UVJA 1JLFB 3ETMA 2EBGA 1HNIA 2MEWA 3VGTA 4JYAJ 1HYSB 3H4BA 2DGWA 4U7UD 5DDOC 2L41A 3IWNC 3JQJA 3CO9A 4OYAA 3ILOA 4OX6A 3KLIB 4NRUA 3GONA 4TY8B 2AJ2A 4ITSA 1ICEB 4PUOB 2OO4A 3ZZZA 2GJ2A 1X9SA 3JAMY 2R7TA 4IDKA 2R8HA 2QLXA 1FK9B 1N56A 3WQPA 4X4NA 2ZM6F 1JJCB 3WC0A 2ROEA 3RBZA 1NCLA 3CCQS 4JI7F 3ZNJ1 5B0EA 1FWPA 3ETOA 1X4HA 2NR0A 2GVZB 1EJ7L 2V4QA 4JI4F 1EKRA 4CH1A 4RU2A 2RS8A 2W2QP 4PYDA 3P3DA 1CJUB 1Y4ZB 3GV5B 1YZ7A 2QGFB 4CYUA 1BWEA 5H9FJ 1C0UA 1EB0A 2XMVA 3I5AA 4UUXA 1YTYA 1YI2S 2VBXA 3KK1B 2DH8A 5HJXA 5KFNA 2FIUA 3ZTRA 2WAQD 5KFPA 3QWPA 4K5RA 4CLWA 4CH0S 3LP2B 3NLCA 2CPZA 3QIDA 4C0HA 1WNEA 2VFUA 2XSFA 4PRFA 4HACB 2ZJRQ 3W5YA 1YJTA 4DN0A 1KLMA 4EI2A 2YKMB 2Q6BA 4HYKA 2KDOA 4IR9A 4DR7F 3Q24A 4CO1A 1OS5A 4UY8T 3K5PA 1W7WA 5KFSA 4ED0A 5A6PA 1WELA 2CQBA 5IT9Y 2M5YA 5KFCA 4C98A 4IG0B 1PJ6A 2CPHA 2J8SA 3PG9A 4Y2MA 3HULA 4WE1A 5C24A 2AEFA 3M2RB 5KFYA 1UFWA 4LUBA 1DTQA 2YTCA 4PWUA 2DGXA 2B4OA 1JLEA 4WFYA 2DNGA 1C1CA 2CPDA 1XMOJ 2OMLA 1IN0A 3DM2A 3NWRA 4Q2MA 4ZP9A 1HI0P 4JI6J 4I2PB 3QIPA 2ZBRA 3PW5A 1WC5A 2F9JA 1B4SA 4O44A 1MMLA 1SC6A 1X4BA 3CJQA 3ENVA 3PCOB 4KGMA 4LF8J 1W26A 1C0TB 1VK3A 3QJJA 1A9NB 3HKWA 2IYIA 2P9EA 3CDBA 5B0DA 4IH7A 4P2XA 2IMOA 4DPUA 4RW4A 5ITHA 1OQ6A 2XM3A 3M30A 1T3OA 2E7WA 4JI3F 2LMIA 4P10A 2G0IA 5DRKA 2XY6A 4NPOA 4TLQA 3MM6B 1HBOB 2AYGA 5KT5A 2BJDA 1LW2A 3QRQA 3MM8B 2GIQA 1MLAA 3TZYA 3W2VB 2PSZA 3CJ0A 4CO5A 2B4PA 1JWWA 1SC3B 3RR8A 4L72B 3SBMA 3VZHA 3A3NB 2XI2A 3MEGB 1N8RT 2DRBA 2W2MP 2NSCA 3JXOA 1EETB 1TKTB 3EVOA 2GQQA 4CT8A 1YVFA 3BR8A 1HBNB 4DI6A 2UUTA 1D9AA 5KG5A 5J1PA 1GH8A 5LXYA 2Q79A 4DXLA 5J2MA 3J81Y 1QAJA 5J2PB 3UI3A 4XTTA 3UNYA 4MJKA 5DLGA 3N9UC 2LEPA 1OIAA 1WI8A 1FDDA 2MQMA 2BUNA 2KH9A 2BBEA 3FUYA 2OPRB 3THTA 2KVIA 1BQNB 2LXIA 4BCAA 1FFWB 4MT1A 1RI7A 1Z1ZA 2VQFJ 3UD4P 3Q8VA 2MKJA 3FSIA 4F3OA 4F8RA 1WKKA 2C3MA 3A8EA 4H54A 2QT7A 4QR1A 3G9CA 2I1RA 5J1NA 2V9WA 2RKIA 3TZWA 4LSLA 3BSOA 3JSRA 3HT3A 3R2DJ 1KTQA 1NSKL 4CLTA 2DGSA 3I0SB 1TVRA 2CRLA 1WORA 1VQNS 2KFYA 4I6AA 4B9SA 4FBUA 4DS5A 1RAGB 4MIAA 1N5TA 4C8YA 3KLFB 3GG1A 1HNXF 4B02A 2AYBA 2IVMA 3V5RA 2KT2A 1RYSA 5G0RA 1JLGA 2MSTA 3CJ2A 2A10A 1JJ4A 3UNGC 2EBEA 1SQGA 3PYFA 5DDPC 1TMJA 2XMWA 4RW6B 2DR6A 2J7KA 1UA0A 1YIJS 3EX7B 2FUG9 2ZOFA 2C2RA 2BOPA 2AJ1A 3TJ9A 1JK9B 2GX8A 5G4DA 2OLWA 5CD4H 4CI0B 1HBMA 2FHKA 1KBRA 2X51A 4WZQA 2PE8A 3TQEA 5I3QA 2HHXA 1XMBA 3DGPB 3CCES 1T11A 2FVPA 2JEIA 5B0BA 2HLTA 1RTHB 2HPUA 3KG4A 5T14A 3Q23A 5HVGA 4IG3B 4UQGA 2OI2A 3OTCA 1RT4B 3PO4A 3VAMA 2WBRA 3QO9A 4W92B 4DX8H 2L9NA 3CE8A 5GAEI 4QCLA 1BWVA 2C3OA 3VV2B 4DU8A 1FFGB 2OJ3A 4TXSA 2XG8A 3AB2B 2IMWP 3OXFA 4KIAA 5K8MA 3OW2R 3I9ZA 3PJ9A 3TX0A 1UVLA 2KVQE 4FNIA 3A12A 2AEJA 2B3TB 4ALZA 2DNOA 1HNVB 2D3O1 3SDEA 3V6DB 1IKXA 4IO9Q 1HHQA 1DARA 1FD2A 5CCMA 2MQOA 2E5GA 4CCHA 4ZVOB 1TUGB 1Z2ZA 3ILJA 2VICA 2DO0A 4DPOA 4KKOB 4AQYF 3QZ7A 4OYWA 4DS4A 2K7JA 5CYQA 4J9VA 5ETRA 1RAIB 5KFUA 4AUKA 5HVHA 4OYXA 2XS5A 3GR0A 2EK6A 4FYYB 3GU0A 4W90B 3SMZA 4Y28C 2ZH4A 4MIWA 3W60A 4RNHA 4EEYA 4Y2AA 5DS7A 3IXQA 1FRLA 1IKYB 6AT1B 1M5VC 2UUBJ 4MFBB 2OMOA 5KG1A 1HNWJ 1RTIB 2RHQB 3CDEA 1TMMA 5GAGU
chains in the Genus database with same CATH topology
1U6FA 5D4OA 4HEA9 4O4GB 2L08A 2NUUG 3KG1A 1LFWA 1HHSA 3TVYA 4AFFA 4Q8EA 1QM9A 3VAFA 4DV7F 1KVIA 2EWHA 3ISZA 2Q6CA 3NMAA 4BHQA 4OJ3A 2CQPA 1HW8A 4NLWA 2IA6A 2AJQA 3I32A 4OZJA 2W9AA 4C9DA 5DGAA 4EU0A 4OHZA 3TARA 1Q86T 1LV5A 3DLEA 1IBKF 4LFBF 4OFZA 1XR7A 1S0MA 2O5DA 1LWCB 1Q7YT 3NL0A 3M9OB 1R8BA 2ZC3A 5DM6Q 4ECXA 3BB5A 1YJRA 5LMNF 1FF2A 5F8LA 3TAPA 1X0PA 5KTQA 2MY8A 4ZP7A 2LYVA 2HNZB 5BJRA 2UUWA 2X3GA 2J9EA 1LXJA 4WK3A 1FXRA 2DR7A 2PDAA 3MFHA 1K1SA 3NGKA 4ICLA 3I0SA 3MPWA 4CO2A 1N32F 2C3PA 4HL9A 1UVKA 1YG0A 2B7CB 3I87A 1YRTA 4Q44A 4PXDA 4I56A 4IFYB 2FVCA 4UW2A 4DV6F 4A8QA 5BYRA 3ZZ0A 2LEBA 4EYHB 1S9GA 3MEDB 3POTB 1Z2LA 5IFMA 2C2DA 2UP1A 1K1QA 4B9LA 1YRUA 1SV5A 3MD1A 2BR0A 3BGRB 2WK4A 4ELTA 3E01B 3LP0B 4D3HA 2MSSA 4BC9A 4RLEA 2WSFC 2UV8G 4TQSA 1ZZFA 4URSA 3KTQA 3CT9A 1SH0A 2VOOA 4K4ZA 1KEKA 3CJ5A 4HH1A 3J7A1 3FQKA 1S0VA 2E1RA 3MR6A 3R5AA 5SUHA 5KT2A 2CQ3A 2HNDB 2Q66A 2EI5A 1S1TB 3FMWA 3NBPA 3ZZPA 5C25B 4ZKAA 1U1PA 2FVQA 2RE1A 3V81B 3MWBA 4F4ZA 4DFPA 3K8VA 1FRJA 4U9RA 3IRXA 2JVOA 4U7UK 3SYZA 4J5OA 3DFEA 3NG8A 3SFUA 2PC6A 2DR9A 3VAIA 2RU9A 2DK2A 4YUDA 3D54A 3FZ2A 5GMKa 2P6SA 5DGBA 1QSSA 2HHVA 3RBEA 4IFVB 3HVTB 3CJ3A 3TP2A 2CVEA 2QMXA 2GFFA 3H40A 1SJ3P 4HI1A 1U2FA 4GO7X 4RW6A 1CEZA 1HD1A 1VQKS 4HT7A 4OZ0A 4FXDA 2VFTA 4A8WA 5EWEA 3K5OA 3DRRA 2VKZG 2ZH1A 3DU5A 4Z2XA 2VA2A 3G8SA 3WC2A 1FKPA 4WFZA 3MM9B 3N5BA 2FGCA 2IFXA 5BYSA 1SKWA 5EN1A 1IQZA 3G71S 1BLUA 4QW8A 4USJC 2N7CA 4K4XA 3NMRA 3GZ7A 1ELOA 1YQHA 1VQ8S 1NH7A 2QZ8A 2DNYA 1DFDA 2DB1A 4MK8A 4E98A 3DXSX 5A0YB 1FKOB 4WJBA 4GO5X 5KOWA 4LIWA 4Q2LA 3IN5A 3PX6A 2WONB 2DISA 4U6PA 4IH6A 4J9MA 2HZCA 3DU6A 3NS6A 1T95A 2Y0SD 3DGPA 2HMIB 1L3SA 2LVWA 3N5FA 4GC6A 4ED7A 2ILYA 1TL1A 3J7Z5 3VWSA 1KC8T 2FJBB 1VQLS 5IQQA 3TAMB 2N3OA 1QSLA 1S9EB 1QAXA 4DV1F 1SH3A 2DHAA 2R7QA 1RYRA 4KO0B 2EKYA 1LW0A 2OTLS 3PFOA 2FDNA 3KNAA 4IG3A 2IC3B 2MKHA 2DHSA 3EPIA 3V2UC 2W7OA 4DUZF 4KQZA 2J8AA 2W7PA 2CQCA 3I5CA 3FFIA 1L3KA 2J5AA 3UW1A 5KOXA 2QA2A 2IRXA 2N7YA 5F0UA 2ASYA 3IWXA 3M9NB 1S0OA 3QJLA 4WFBQ 4I67A 5DDQC 1FJEB 1KD1T 3KG0A 2R9LA 4PXEA 4DV4F 1OSCA 2LDIA 5D8HB 5E3PA 4J9KA 3HHLC 1XNRF 4ZVGA 4A8XA 4TKTA 5GAHI 3FVYA 2KRBA 1U1MA 3VF0B 4F02A 1LWFA 4OZ1A 2GQ2A 5CXTA 3IS9A 3CTRA 1WEYA 2DNQA 3PEHA 3T6BA 4F50A 4X62F 4OJHA 1WEZA 2GW8A 5T7LB 4F2RA 2L9WA 2ZKTA 3OJUA 2FHMA 2ZBCA 2M70A 2J6UA 4Y2KA 2D3OR 1HNIB 4TLRA 1QUPA 4MK9A 1F2GA 2V8HA 1HBUA 3FEXB 2DGUA 4FNHA 5D3GB 3D1QA 3UR0A 4PCQA 2LA6A 2XMJA 4J9OA 3ICLA 5FDLB 2BV3A 1FJGF 3MM7A 5FLXY 1HYSA 2D9OA 2LKZA 4Y65A 3DHWC 4A47A 1X9MA 5KFKA 2ZHBA 2HVZA 2RDIA 1REVA 3HHLB 4DG1B 4WZMA 4PPDA 1WD6A 4KFBA 3TYTA 2YWEA 3G6XA 1QE1B 2N3LA 3V6DA 3PX4A 3KLIA 4Y3CA 1VK8A 2J0SD 5D4NA 2BQRA 1PC4A 2EPIA 1SL2A 1T05A 2POKA 1TAQA 4A8MP 3J7YI 2FGOA 4RKUC 4AYBD 4MH8A 4PWDB 5D4PA 4X4RA 3TW0A 3HP6A 3D28A 4RNNA 3IG1A 1HW9A 1VRUA 2HWHA 3DLGA 3M2VB 1C4AA 3MAHA 4DSFA 1DTTB 1LWEA 3KLGA 3M8PB 1JB0C 1RT3A 4KKOA 4PQUB 1XN9A 2XNQA 1UWBA 2CQ4A 1PC5A 4X84A 3N6NA 2RRNA 2K8GA 4ZPCA 4J9LA 4DF4A 1ZETA 3CDUA 4NLSA 3CCUS 4NXNF 3VR1A 5A8KA 2QE5A 1VIXA 2OSQA 2HW3A 2WW8A 1GX6A 2W4CA 4ZPVR 2FJEB 1HNZF 5CHCB 2W9BA 2WSCC 1QAIA 3MUMP 1UW4A 5KFFA 2AW0A 4YOEA 4DSKA 3L95X 1KONA 1RTJB 4DL6A 1TR0A 4EZ6A 4LF7F 1KVJA 3O2IA 2KT5A 3MPVA 1QAYA 4C7QA 3F41A 4NYOA 1I6JA 3MOZA 5KFOA 3HPOA 2RT3A 3NCQA 2UXCF 4RBTA 4OX9F 3BS9A 3RB6A 1FD8A 3PFEA 2DD8S 1TL3A 4DMZA 2IRUA 3EUNA 3W2WA 3OV7A 1SL1A 1NHVA 3FMBA 2XBPA 2N4CA 4JOUA 5MAOA 2DIUA 1YJWS 4R0JA 3VAGA 1DHMA 3IGVA 1UFLA 1KQGB 1N5SA 2OPQB 3PJWA 1R8PA 1O8BA 1KTVA 1WG5A 5CCLA 4FS2A 5LXRA 1FESA 4MFBA 4OQJA 2PO4A 4AE5A 2ZE2A 4C11B 1S6PB 1RTIA 2BM0A 3MGJA 3W3SA 2APOA 2V5HG 1C0UB 1R43A 4LJMA 2HHQA 2A1BA 2CJQA 4ID5B 5HN0A 4B17A 4FVCA 1VBXA 4KE5A 3JTPA 2E29A 4O4GA 1N88A 3KKFA 5F8IA 3CB4A 3UE2A 1IBLF 2VC0A 4KSEB 3JSBA 3MEEB 2Z0GA 2K3KA 3BN7A 4A48A 2MGZB 1NK9A 5J2NB 2HRUA 4K59A 5AXMA 3CJ4A 3GFXA 3I31A 2QFJA 2QA1A 2E5IA 2W4PA 3KK1A 5B0AA 1NK4A 4H4KC 4OI4A 4WKRA 3C2PA 2KG0A 2YNFB 4I1TA 3TAQA 2CQHA 3CUNA 1KFSA 4QIEA 4JI8F 3KMQA 2IBKA 2NXUA 1KFDA 2NYIA 4ILRA 2FLPA 3NNAA 1U1QA 1LWCA 2QMWA 3DOKB 2VC1A 5KFGA 3DLKB 4KR0B 1XBWA 5CYJA 2UUAF 5AJ3F 1UVJA 2G9OA 2PGCA 4F3QA 4Q7AA 5IS2A 1FDNA 1Y5NB 4ELUA 2HNZA 2OD4A 1U6BA 4B3RF 2XLIA 1M90T 2RNEA 4WF9Q 2JFDA 3NCPA 2ADCA 2L9DA 1TK5A 1CVJA 2B51A 4RUHA 2MHEA 4DBQA 3AA9A 4QIGA 3NGDA 4IFYA 2VG6A 1TKXB 2DH9A 2BACA 3BQ0A 3C8YA 3PM9A 3HK2A 1BGXT 2V4JB 1D9FA 3HHNB 4IQXA 3SI8A 4R5PB 2CQ0A 4LQ3A 2WCXA 2VOPA 1CSJA 2SXLA 2MDAA 4MAKA 4CT9A 2IA0A 4HDHA 5BYQA 1CC8A 3RAQA 2GIRA 2LCWA 3DLLQ 2ZZNA 2XULA 4I4BA 4MKBA 2ZJPQ 4KB7A 3Q8PB 3BGRA 3E01A 3VZIA 3QGPA 2PN6A 4OMFG 2CZ4A 3BQ2A 1N52B 1YJUA 3FRYA 4DSEA 2HQ3A 3I9V9 4UQTA 2XY7A 5IWAF 4DL4A 2RQMA 4A8OA 4KAIA 1V3ZA 2M88A 4CO4A 3WZ0A 2PI5A 4OL8A