3ZZYA

Crystal structure of a raver1 pri3 peptide in complex with polypyrimidine tract binding protein rrm2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
QSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic Analysis of Polypyrimidine Tract-Binding Protein-Raver1 Interactions Involved in Regulation of Alternative Splicing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
total genus 27
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zzyA00
1B7FA 4V19X 2MMYA 5CXTA 2DH8A 5DETA 1QVFR 4WFBQ 1Q7YT 2MZJA 3BS9A 3R1HA 3EX7B 3VF0B 2X1GA 2KM8C 5CYJA 5MLCV 2CQ3A 1M5VC 1X5OA 3MD3A 5LXYA 2JVOA 2DGVA 3NNAA 1ZZNA 5LXRA 2RUGA 3IRWP 1M5KC 3RW7A 3FEXB 1R8HA 1UP1A 3HHNB 2OIHA 3DLLQ 2LKZA 1SJQA 2QFJA 1OIAA 2HYIB 2VONA 1A7GE 2LA4A 1FXLA 2L9WA 2E5HA 2EK6A 2L41A 5BJRA 3SXLA 5LSLA 2KVIA 2KN4A 2ADBA 2CPHA 1K8AT 1WHWA 2CPDA 2MGZB 1FJEB 1VBXA 1VQ7S 2KT5A 1NU4A 5LJ3Y 1F9FA 2DH9A 2E5GA 3R27A 2L08A 2XSFA 2CQHA 3CMAS 4LJMA 2CPFA 3S8SA 4Y00A 2CQDA 1WEYA 2D9PA 2FPHX 3JB9k 2LEBA 2FY1A 2DGOA 3CCSS 5GAHU 2MKSA 2M7SA 3VAGA 2DNQA 4M5DB 2U2FA 4A8XA 2CQIA 3UWTA 3B4DA 3ZZZA 2DHSA 2M70A 3UE2A 4IUFA 2DNLA 2JVRA 3G6ES 2BOPA 2KFYA 2NLWA 3H2VE 5HL7Q 2GO9A 3S01A 1DHMA 4F02A 2I2YA 3CCVS 1D8ZA 1M5PC 3S6EA 4U67Q 5LSOA 1UFWA 4TU7A 3VAHA 4QU6A 3TP2A 3CCUS 1VC6A 5H1SV 4F25A 1WF0A 3MDFA 3NNCA 2D9OA 2DGWA 2DHGA 1X4FA 2MKKA 1VQ4S 4IOCQ 2A3JA 2RNEA 1U1MA 1P1TA 2MSSA 3UCZP 3N9UC 2FC8A 1QVGR 2DK2A 1H2UX 1X5SA 2U1AA 2ZJQQ 2DNKA 2AYMA 4WF9Q 3V4MA 3P5TL 2MKJA 2YH0A 2UP1A 1U1LA 3G8TA 2MQPA 2MGZA 4QU7A 1WEXA 2CQ2A 3LQVA 3NNHA 1FJ7A 1VBZA 2N3OA 4F26A 3D2WA 2I38A 2M88A 1VC5A 2XNRA 3BEGB 3MUTP 2DGQA 2PEHA 2F9DA 1OO0B 1VQNS 1D9AA 2XS2A 5DDOC 2E44A 3G96A 1OWXA 5GAGU 3EGZA 3P6YC 1XN9A 5GMKa 2FC9A 4PKDB 1JJHA 2RS8A 2N82B 2DH7A 3PIPQ 4FXWA 1X4DA 3VAIA 3DXBA 2ZJRQ 2DNNA 1U1PA 2LQ5A 2MSTA 1QM9A 2MZRA 1WELA 4QPTA 5DM7Q 1YTYA 3Q2TC 2MQQA 3VAJA 2AYEA 2MJUA 3TYTA 1N54B 2N7CA 4CQ1A 4IOAQ 3CCMS 2YH1A 3CCRS 3THTA 5IFMA 2OTJS 1X4EA 1DRZA 2LEAA 2ZJPQ 4W90B 3BO2A 1YI2S 1VBYA 2JRSA 5DDQC 3MUVP 2MY8A 2MQMA 2G0CA 1X5PA 4PR6A 1YJWS 1VQMS 1X4BA 1IQTA 3CC2S 3CXCR 5CA5A 5DM6Q 2NZ4A 1HD1A 2MKHA 2CQPA 5LJ5Y 1VC0A 2CPZA 4WKRA 1YHQS 1U1NA 1X4AA 2KI2A 4TU9A 1U2FA 3Q2SC 2DNYA 1X4GA 2HGNA 3IWNC 1NO8A 3UD3P 2XS7A 1WWHA 4YB1P 1H2TZ 4WIIA 3FEYB 1U1OA 3ULHA 1KD1T 2M4MA 4ERDA 1UW4A 2CQ4A 2DNZA 3BO3A 1VQLS 2DNRA 1FHTA 1M1KT 2VODA 1S79A 2MZ1A 1HD0A 2J76E 1SJ4P 3MI7X 3L3CA 4ZKAA 1JJ2R 2DIUA 2KXHA 1OPIA 3VAFA 4W92B 2DO0A 2F9JA 1JMTA 4P6QA 4YUDA 1UAWA 3CCES 1VQPS 2HGLA 2RQCA 1YJ9S 1FT8A 1VQ9S 3BO4A 2CPEA 1KOOA 2DNMA 2MZSA 3MURP 3R1LA 2CPXA 2Q79A 1WF1A 3CCLS 2DGXA 3S7RA 5JVHQ 4IO9Q 2K8GA 5IM0B 3G9CA 2E5IA 2KYXA 1U1KA 1K9MT 3J7ZT 5DDPC 2LXUA 2AYGA 2M9KA 1YITS 2MB0B 1O0PA 3K0JA 1VQOS 4CH0S 2DNGA 2KM8B 1WHYA 1VQ6S 1N52B 3US5A 1WTBA 4FXVA 3OW2R 1G2EA 1WI8A 1KQSR 3G71S 2MY7A 3SDEB 1U1QA 2KXFA 2X1BA 1VQKS 2M52A 1Q86T 1S72S 1PO6A 2XNQA 2CQBA 2CPYA 3CUNA 1X0FA 3NMRA 3PIOQ 4WFAQ 4RU2A 1H6KX 1SJFA 1BY9A 1HL6A 1KC8T 5HO4A 2G1DA 2O3DA 5JVGQ 3UD4P 3ZZYA 2DNHA 1YIJS 2XB2D 2MQLA 3P49B 4BS2A 3NS6A 2KH9A 1WG1A 2YWKA 1L3KA 4QQBA 2B0GA 3P3DA 4EGLA 3CCJS 1M5OC 1A9NB 2CPJA 1WHVA 2RT3A 2OJ3A 1WHXA 2CQ0A 4J5OA 1HA1A 2KHCA 2DNPA 1RK8A 1WEZA 2MZQA 1RKJA 1H2VZ 2QA4S 2K3KA 2MQNA 2LMIA 4WCEQ 2X1AA 1KOHA 1SJ3P 1WI6A 2CPIA 2DISA 1URNA 5D77A 2KG0A 1SXLA 2CQGA 2F3JA 1X5TA 2OSQA 2EVZA 2HVZA 3G8SA 5GADU 2DGTA 1FO1A 1U6FA 3I55S 3VAMA 2KG1A 2N3LA 4TU8A 2RQ4A 1AUDA 2MYFA 3G4SS 1U6BA 4UY8T 2G4BA 2VOOA 4PRFA 2MXYA 2LCWA 4UQTA 1N8RT 1WF2A 2D3OR 3EGNA 2DO4A 3J7YU 5IM0A 2KRRA 2LA6A 1W2BR 4Y0FA 3UCUP 2ERRA 4OZ1A 2RRBA 2CJKA 3MUMP 2MPUA 4Z2XA 3I56S 1FNXH 2LYVA 1Q81T 1CVJA 4OZ0A 4ED5A 2V94A 3HI9A 3UCGA 5D78A 2MKIA 2DHAA 1R8PA 2M2BA 3H2UB 2KRBA 3MOJB 2BZ2A 2X1FA 3MXHP 2XS5A 2LECA 5GAEU 3CCQS 5DDRC 2SXLA 1FJCA 2DB1A 1M90T 1N88A 1DZ5A 2FHOB 2DGUA 2MHNA 2J8AA 2RS2A 3CC7S 1ZH5A 2E5JA 2DNOA 2RVJA 2HZCA 1DBDA 4C7QA 1NJIT 2CQ1A 2ADCA 1K73T 3CTRA 3B4MA 5FJ4A 5GVQA 1U1RA 2RRAA 2MJNA 1ZZFA 3TO8A 2DGSA 2DHXA 2OSRA 2YKAA 1X4HA 3SMZA 3VALA 5IQQA 4LMZA 3U1MA 2DITA 1WG4A 2PE8A 2HGMA 2MZTA 2AD9A 4C4WA 2JWNA 2LXIA 2M8DB 4TLQA 4C0OC 5ITHA 1Q82T 3MD1A 4WFNQ 1X4CA 2KXNB 2J0SD 1JJ4A 2CQCA 3CC4S 1PGZA 3U1LA 1SJRA 2DIVA 2MKCA 3SDEA 2GHPA 3LPYA 2RU3A 2OTLS 3CMES 3CF5Q 3THPA 2M0GB 3RW6A 4CIOA 3CD6S 4CH1A 3CULA 2JX2A 3VAKA 2MQOA 2QEXS 4LIRA 2WBRA 1WG5A 2KU7A 1VQ8S 1YWXA 3NS5A 2VOPA 2YTCA 3CPWR 2J0QD 4YOEA 5EN1A 2EK1A 1P27B 1VQ5S 2M8HA 2AYBA 1YJNS
chains in the Genus database with same CATH superfamily
1NKBA 4V19X 4B08A 3E51A 5CXTA 4B3MF 3HJVA 1IM4A 3U02A 5DETA 4ZLPA 3DOLB 4DZ6A 4ZLLA 4RW8A 3H7HB 1RBLA 3ZXWA 3K5NA 3DRRA 1U02A 2Q6CA 3GIRA 3ZC4A 3R1HA 3EX7B 3RB0A 1HMVA 3NL0A 2IJRA 4P2FA 2WONA 2ZWPA 3VF0B 1RHUB 2OPPA 3HDSA 2HNZB 4XTTA 3SCIE 4JI5F 5MLCV 2H5IB 2J7KA 3QGPA 4Y28C 5LMUF 4LFCF 1NKCA 1XMOF 4C8OA 4J90A 3ZTQA 4ZVSB 2A18A 4P7TA 3IFEA 5HJXA 4Y65A 3MD3A 4QIWD 2WVCA 5DQGA 2HHSA 1SBRA 1FWKA 1ACMB 1RKIA 1JX4A 3QIPA 4LF6J 1M5KC 1UPMB 2A1BA 3UNGC 2ZNYA 2FHKA 1EKRA 3H42A 1PBUA 4F3QA 3VGSA 4ZMMA 2ILYA 3G82B 3HFKA 3G6YA 4J9OA 3T3FA 4B3RF 2V2VA 2LKZA 5T41A 1SJQA 2G2ZA 1ELOA 2QFJA 3W2VA 2VONA 1YRUA 2LA4A 2XHWA 2W2MP 2N4DA 2L9WA 2CDQA 2W2NP 1FNOA 3HULA 2EK6A 1R3NA 3NOCA 1H3DA 4DCOB 5G4DA 4DU7A 1FRJA 1RAHB 1X31C 4Q0BA 4WZQA 1JNZB 2Z4PA 5LT5A 4DS5A 4XK8C 4X4QA 3Q83A 2CPDA 2QL9B 1S12A 1W2IA 3Q8PB 3FVYA 2EFPA 1VQ7S 2KT5A 2YKNB 1JK9B 2Z0GA 4CWBA 4R0JA 3O6QA 1Q79A 3JSMB 2HAIA 2OFGX 4TVAB 1EARA 1RISA 3DRPB 4YR0A 2IMWP 2E5GA 4Y34A 3E01A 1RHQB 3K5OA 3R27A 5L1JA 3HZGA 4P72A 4LJMA 2I5JB 3J80Y 3VR1A 2AZ3A 4KV8B 4NL5A 1KFSA 3VQSA 3F41A 3PRDA 4ECUA 4Q8EA 4ANEA 1U47A 2FPHX 2VPWB 2H5EA 2IVYA 2W2OP 4PQAA 4QR2A 4H4KA 1RT7A 2H3EB 1VQMS 2R8GA 2OMOA 2PT0A 4OI4A 3T9ZA 4CLWA 1IBKF 4BLGA 1QAJA 2DNQA 2O1PA 2EFGA 2MLZA 3HHDA 1YX2A 4LR7A 3AFGA 3DRPA 2M70A 4OYPA 3LWLA 2DNLA 2ZNZA 4QR1A 4YMEA 1W26A 5L8RC 4GRSA 2JLEA 2V34A 3MM7A 4ZP9A 4CO4A 5EWFA 2YKOA 2XLJA 4O23A 1ZM2A 2KFYA 1HWIA 2OFHX 2RILA 3DRSB 2GO9A 4KGXB 4QR0A 3GFYA 3CJQA 2IM1A 2ASDA 1FTRA 1FF2A 3HD2A 4F02A 3CCVS 1D8ZA 1RAEB 4ZA1A 1IBMF 2YNIA 4U67Q 4TU7A 1UFWA 4QWCA 3GJTB 2Y0SD 3ELHA 3G6VA 3VAHA 3V6JA 3TP2A 4ECTA 2ZZNA 1FEHA 1TV6B 2V2QA 4AXJA 2ZE2A 5H1SV 4C11A 5F8GA 1RYRA 1KQGB 4ECVA 3W61A 4DG1A 5IXUA 1KONA 1KTQA 4BC7A 1FFWB 3CVKA 2L48A 4NXNF 1Z1ZA 3KK1A 4IOCQ 1OYDA 3H2LA 2A3JA 2DD8S 4KHPJ 3AH6A 1EETA 2P9EA 3M2RB 4RW7B 1QUPA 1B7FA 1FKPA 3MWBA 3UCZP 2RJZA 2PDAA 2A0FB 5A0YB 3KHLA 2R2UA 1QVGR 3M8ZA 4IKAA 5E5NA 4R8UB 4RW9A 4DL0C 3GMGA 3UDEA 3RBZA 3QSYB 3QJJA 1S5ZA 3G8TA 4K4YA 2YNGA 2CQ2A 3OVBA 4QU7A 2LEPA 2KZMA 3DU5A 4DV4F 1C2PA 2N3OA 3DHXA 1FDAA 3CJSA 5KFWA 3O44A 2UVRA 2I38A 4L76A 2M88A 3PXGa 2XWYA 2E9RX 3DCAA 4B3TF 4DSLA 3MEDB 2DGQA 4W98A 4DMZA 1FRKA 4DN0A 4C3KA 1Y4ZB 2DCLA 4MAKA 4C6AA 2ZM6J 2A6OA 2FJXA 4RR5A 2Z58B 2OPSB 2K7JA 5I3PA 3CGIA 3MM5B 3PYEA 2CKWA 4KBIA 9RUBA 1SQGA 2VQEJ 1SIWB 3PVXA 1IKXA 2R7SA 4NCBA 3FC9A 4RW4A 4U96A 1RAJA 3G96A 4PXBA 1WTFA 3RB3A 3EGZA 4GMKA 3H20A 3VVTA 2HNDA 4K5RA 5K8OA 4PKDB 1JJHA 3A8EA 4LVOP 4H54A 2HHWA 2MLYA 4C2MA 3K7RA 4AQYJ 5CYMA 1TV6A 4CRJA 1UVMA 2R4FA 3IA0A 4K7QA 4G6VB 2LU2A 5K9FA 1Q16B 4NLXA 3MTJA 2B4PA 5ETLA 5KFZA 2GW8A 2ZH9A 4CTAA 1FXRA 4H4OB 2MZRA 1WELA 1YTYA 1KLMA 4NI2B 5M2RA 1C0UB 4A8YA 2H9ZA 1WOPA 1HHQA 4K4WA 3PHTA 1Y10A 2QLXA 1K0VA 3TYTA 2MJUA 2JOQA 3DYAA 2QN6B 3OFGA 4OZNA 2RDDA 3WX8A 2UUBF 2LLZA 4ED3A 1RBAA 3TX0A 4ZVRB 5EWGA 4FS1A 1TKDA 4JV5J 4O4RA 3J7YI 4DLEA 4MJKA 4F4KA 3H5XA 5F8HA 5H9EK 1GT8A 4PXDA 1KLMB 4HL9A 3MUVP 2MY8A 2ASLA 1TL7B 2GIRA 1B7YB 3FGVA 2VBXA 2G9OA 4QIVA 4PR6A 1EX8A 1X4BA 2FJBB 2HLUA 3WC0A 3Q22A 5LMNF 3CC2S 4RNNA 4JI8J 1UWAA 4AYBD 4DOZA 2F8MA 2IM3A 3BR8A 5CA5A 3SV4A 4HACB 5B7WA 3TA1A 1HD1A 3FBBA 1N48A 4RKUC 2NQPA 3G86A 4TNOA 4WXOA 4MIWA 5GAHI 4G3IA 2HLTA 1T0TV 4TY8A 1LKZA 1AT1B 3OR1A 3TVKA 1VC0A 3K5PA 2CPZA 2NUUG 4LF7J 4WKRA 2YY3A 2W8KA 3LP1A 2E66A 4CLLA 1U2FA 4N8NA 1FDDA 3KWMA 2H65B 2NCKL 2DNYA 1J2VA 2FJAB 2HGNA 1U6ZA 4ZVTB 3IWNC 5BXIA 3G82A 1NO8A 1QAXA 4IG0A 4WYWA 5K8PA 4M94A 1LW2B 1YJRA 3R7NB 1RTJB 3A3OB 3GILA 3AODA 1H2TZ 4TKTA 3DKDA 4H4OA 1U49A 2J0WA 2M4MA 3MGJA 2BYCA 3RRKA 4ERDA 2HFOA 2CQ4A 3BYPA 1KHWA 1RLDA 2QFIA 1A0OB 1CJKA 2JFKA 3H5UA 5BR8F 5AJ3J 4NASA 1QE1A 3MAQA 3CJ8A 2HVEA 2J76E 1S6UA 2DCUB 4CP5A 4LF6F 3I87A 3BSNA 4KGKA 3MMBA 3JSMA 5IV4A 1NEEA 2EFQA 5IT9Y 3NBPB 3Q0AA 2B9XA 1WC1A 4P73A 4USHA 2F9JA 3HFVA 3A8KA 1JMTA 2ZD1A 3A13A 4LRFA 4DX5A 1WJ9A 5JMNA 2J7UA 2HZVA 4PYDA 4U9RA 3CCES 3MMCB 1VQPS 2FJDB 2VF3A 1CJKB 2HBYB 3TA0A 1LK7A 2DJWA 2VKRA 1KOOA 4DCJB 1EJ7L 2DNMA 4EK2A 4O0IA 3KYLA 2MZSA 4HHUA 2DR8A 2Q79A 4JOUA 3GYGA 4USUA 3OLBA 3CCLS 4OLPA 1DQAA 2VL1A 2DPIA 2BANA 4FF2A 2V2ZA 2DRAA 1QY7A 4FP9A 1U1KA 1H0HB 1RAGB 5HANA 2WOMA 3OXGA 4AT1B 4DR2F 4K8RA 4ZHRB 1HNXF 1D8YA 1VQOS 4LSLA 2DNGA 1HNVB 2AGQA 3DLKA 4WFZA 5K14A 3D1QA 2DXEA 1WTBA 2EFNA 2QGFB 3H5YA 4FXVA 1IN0A 4QIFA 4Q2MA 2N7YA 3UD5A 4F4XA 1Y7PA 4TLRA 2XLKA 3P45B 3HZEA 1MMDA 1WI8A 4IFVB 1KQSR 4DLGA 2M3DA 3H0PA 4DPUA 3V6DA 1I94F 5A8RA 1EIYB 1UETA 4X66J 5KG6A 4BCAA 5HMXA 2XZTB 3UDLA 2XM3A 2KXFA 2X1BA 4L3KA 3K59A 1GMVA 3QMQA 1RT6B 3M2VB 3QATA 2D3ZA 4DL3A 1AB8A 1S72S 4AL5A 3JYTA 2C22A 1LWCB 2YWWA 2CPYA 4N5SA 1IJFB 5J2QA 1VGYA 5F8MA 3BBCA 3MAAA 4PG4A 1S0OA 4B3MJ 2ACYA 4V1Ak 4CLYA 2CJXB 3W62A 2KO1A 1CPZA 2E1AA 1FKPB 1AXQA 4M5DA 1HL6A 4NLYA 5BYSA 1HNWJ 1KC8T 1CQNA 1GFWB 4WU3A 4TXSA 3M9MB 1RT3A 1IKVA 1KSPA 3UD4P 5F8IA 1KHVA 2FHJA 3RJMB 1YIJS 3V2UC 2QA2A 3P49B 4BDPA 1VI7A 4BS2A 1H72C 4FVMA 2HRYA 1ZM3A 4NZ7A 2KH9A 3DM2B 4LFCJ 4UZCA 1ROFA 4JI3J 4DV2J 2YWKA 2GQ2A 1L3KA 3G8QA 4P75A 2OELA 2PO4A 3QZ8A 3I5BA 3M8QB 3TEHB 5JUMA 2OGUA 2WVEA 1V9OA 3P3DA 4EGLA 2ATCB 3DGPB 2PSZA 3NGKA 4RBVA 3PX4A 1FDNA 1M5OC 4CNZA 2B51A 2AT1B 4ZS6A 1H7XA 1JB0C 2R2TA 5KFHA 1FKOA 2IBOA 3M32A 4FN5A 2NS1B 2ZM6F 3Q8RB 3HKWA 2E7WA 4USWA 2VQEF 5DQIA 4YR3A 4LF8J 2BM0A 5SZTA 1KVJA 2MQ8A 3KG0A 1XNRJ 2AX1A 4QCLA 4ANCA 1HWJA 2LDIA 1HA1A 2I8EA 2KHCA 4ECXA 2R8KA 4KH1B 1FX2A 1GMWA 1NXIA 3A4TA 4F0HA 2CVIA 3BH7B 2KB2A 2ZH3A 3KG1A 1UKUA 4WXWA 2GMLA 2X1AA 4M5IA 3GB0A 3D4JA 3M4XA 4DR3F 4X4NA 1SQEA 2IM2A 3VWSA 3CDAA 5D77A 2POKA 3N0VA 4PQUB 3TAPA 1WC0A 5GADI 3LANA 2J6UA 4C8MA 3TAQA 4NEZA 4NA2A 4N7TA 2BQUA 3NEKA 1ZA2B 4DQSA 2HVZA 4ILMA 3F56A 1FO1A 1WOOA 3R97A 1RTDB 3OTOF 1R6YA 8AT1B 3V81A 1U6FA 4ZPTR 3VAMA 5LOQA 3MHYA 2DKOB 3SCLE 1V3SA 1V3ZA 3BQ1A 2H48B 3D6MB 2RQ4A 2Q6BA 3FRZA 3K8WA 1N34J 2I5JA 3VV2B 3IR6B 4B3SJ 1TTHB 4UY8T 1Q0NA 4ECQA 2VOOA 2FGCA 5KFOA 2Y9HA 5B08A 2RE1A 5EWEA 3MEGA 2H5JB 2MXYA 4O3SA 3W9JA 2WCXA 4HH0A 4NLRA 4YB7A 1S1TA 3DOMA 3FNNA 3LP2B 2HHUA 4O4GA 1KP6A 1WD6A 4UOFA 1AFIA 4B9MA 2IYIA 1PYOB 3J7YU 4IH6A 3OR1B 4B9UA 1U8WA 1W2BR 2RKIB 3CO9A 3JSYA 3MM5A 2KHDA 3JTOA 4I64A 3MM9B 4B9LA 1NH7A 3B78A 2VBYA 2NXEA 1U48A 3TOQA 3BPDA 1Q81T 5C2GA 3MEGB 4ZN3A 2RIJA 4AD6A 4LF7F 3HI9A 1RP5A 3CE8A 3GR1A 3KKFA 2Y0BB 4P9SA 2DHAA 3D67A 4CO3A 4N41A 2GX8A 2D7SA 5T7LA 3RBXA 2E9TA 1FK9B 3SYZA 2BZ2A 2GHVC 2VFSA 1Y3KA 4K4VA 4QBUA 2CJAA 3QIDA 2QIFA 4CLSA 3MECA 5KFEA 3CCQS 4NXMJ 2NYIA 3NBPA 1TL1B 2C3PA 2SXLA 1XC9A 1FJCA 4UOCA 1Y5NB 4F04B 5KG4A 1N88A 3HHLD 1ZH5A 2MHNA 4EBCA 1G4CA 3N5FA 3C19A 3IBCB 4MFBA 1CQMA 2RD5C 4ED7A 2BJEA 2H54B 3T5JA 4HDGA 2YWFA 4J9MA 2RQMA 3PFEA 3TQ1A 2VPZB 4ZK7M 4IDKA 5AT1B 5C5JA 2AJ1A 3JTPA 5D0HA 5FJ4A 1FD2A 5THWA 2B6AA 3OXFA 2EFOA 4Q8FA 1E6YB 1S1XA 1CSJA 3OTBA 2AIRB 1TK8A 2R7XA 1FXDA 1SKUB 2JSXA 2R2SA 2VG6B 3FSYA 5BYRA 2OPRB 2YKAA 2LQJA 2YKNA 4FPRA 2CZ9A 5IQQA 4DV6J 4GKKF 5E2QA 1FRIA 3AOAA 2DRDA 4WBFA 3PTWA 4OYXA 3JAMU 2Z2ZA 4OX7A 3K57A 4ILLA 2QL7B 4NLPA 1UFKA 4DCPB 5KFLA 3FMWA 1RBOB 2MZTA 2IMOA 1NRKA 1FFSB 1SH3A 2HWHA 4RW4B 3W63A 3T1YF 3LP0B 3CJRA 5ITHA 2I1RA 5B0GA 1S4EA 2IRUA 3QWUA 2WW8A 4A4JA 3SCKE 4F4AA 4ECSA 2JEJA 5HQ8A 4K4XA 2BQRA 4YY3J 3HVAA 1GQEA 4LFBJ 4RL1A 5DZ6A 5IWAJ 1ZTTA 1NK0A 1Q4RA 2V0NA 1GEHA 2V68A 1U8SA 2EWHA 3CD5A 3D1HA 1HLWA 1SJRA 2QL5B 3QYYA 4L3NA 1C0TB 2CVEA 1XMQF 3CD7A 2HHXA 3M1VB 2FZKB 3SDEA 4IFVA 4ATNA 1QSLA 3TJ8A 3MEKA 2H4WB 2GJIA 1RTJA 2V8HA 3LPYA 2H51B 3PYGA 2VODA 4ETZA 3VGTA 3QQCD 4JI0J 4CIOA 1H38A 1X0PA 3RW6A 1O51A 2RU9A 2CNOB 3LP0A 1RQ0A 4OLOA 4ZPAA 3IGVA 4D3GA 4DBQA 4J9LA 2B7BB 3ZZRA 1XERA 2WZ1A 4OJGA 3K58A 2JX2A 1DAXA 1MW7A 1IXKA 2EEYA 2HWTA 3GP9A 2WBRA 1WG5A 4LBPA 3RBEA 3MMBB 4YOEA 1KVKA 2EBGA 1RT4A 4HDHA 3FZ2A 2V5HG 2IA0A 2ZUGA 3POTA 2HRTA 4BBYA 1RHMB 1Q5VA 2WB1D 4ZCKA 5J2MB 1YJNS 1AROP 4DR6F 4MYUA 1RT7B 4O3NA 2Y1LB 4A48A 1QVFR 1Q7YT 3HXMA 2QC3A 2HIQA 2VG5A 1C1CB 1KTVA 1LNQA 1GX5A 1MLAA 3I0SA 3KK2A 3EPIA 3I82A 4I4BA 2V4RA 5D0EA 1S9GB 3W2WB 4J9NA 1MG7A 2VG7A 4IO1A 2AX0A 2R42A 2YNGB 2X1GA 2NR0A 2RSQA 3RAQA 1HQ2A 4EBDA 3LPEA 4C0BA 3F0NA 3VQTA 5CYJA 1S0VA 3BREA 4QOTA 2CQ3A 2I6WA 1RT1A 2F8EX 1QDUB 1V3RA 1GXLA 4F7VA 2YQ3A 2JVOA 3DU6A 5AJ3F 3VCDA 1RAAB 1ZZNA 4NCGB 2BR0A 1C0TA 2DBBA 2RUGA 3P4UB 1XEZA 5LXRA 3IRWP 2UUCJ 1KWMA 1DLOA 1NPKA 2BE9B 3FEXB 3FSXA 4MT1A 5E7OB 4QWAA 1UP1A 3SEOA 3HHNB 3DLLQ 1RT2A 2J9DA 4ZDNA 1YGYA 1NB2A 3HSJA 3NS7B 5CZVA 1S1UA 4EWTA 5LSRA 4EMDA 2HYIB 4DS4A 2E5HA 2W4CA 4NLTA 3IG1B 2VIHA 2AJ2A 4ZVQB 4QYRA 2BW2A 3MR3A 1CEZA 2GV1A 2RB7A 2ZZTA 4LRCA 3QFHA 1K8AT 2GGPB 1WHWA 3M30A 5HMYA 2E1PA 2F1FA 2ZOMA 1HI0P 2DYAA 2KFZA 1HQEA 2JEIA 2RMLA 3R6LB 4CLPA 1OY6A 2DH9A 2QV6A 2XMWA 4USVA 3UPFA 4Q43A 3X3UA 1VRTB 2G13A 2BJ7A 2L08A 2XSFA 1RWXB 1RWMB 3CMAS 3EUNA 4RW8B 5DGAA 1L5UA 4AUKA 3S8SA 1IWGA 1J5EJ 2AMCB 1WEYA 4JI5J 3Q86A 1OY9A 2ILZA 3UQSA 1JLBA 2HURA 1SQFA 1S48A 1DURA 3CCSS 5GAHU 3H4DA 3NG8A 2M7SA 3VAGA 3M9NB 2GHWA 5C25B 2LVWA 3E3XA 4C8LA 3A12A 3FFIB 2CQIA 3UWTA 3R5AA 4HT5A 2D41A 3UE2A 2OUGA 2WOMB 1N34F 2JVRA 3MM9A 5HI7A 1Q8LA 2EKNA 2C2MB 1YBUA 2NLWA 3H2VE 4KO0B 1SPBP 1GXUA 3ZNUA 4CO0A 4UZBA 3KK3B 4K2XA 3C3LA 3M9OB 2QLBB 4DI6A 4ZVFA 3GIIA 1M5PC 1CJTA 3S6EA 1LV5A 2BBEA 3DLEB 2BRLA 2OPQA 4QU6A 5C25A 1PC4A 1ZAVA 4W4MA 2Z57B 4IR9A 3ISZA 4HEA9 3W8PA 4DPOA 3BQ2A 4F25A 4PEOA 1RA7A 3FK4A 3MDFA 5KFQA 1NK6A 4CLUA 2D1CA 4EBEA 4DL5A 2R7TA 2BJDA 3QRPA 2IY5B 3ZZUA 2DHGA 2DGWA 1O6XA 4OL8A 3NOGA 2JC1A 5T7LB 3UNYA 2ALZA 1VQ4S 2JC0A 3OLAA 2UXBJ 2FY8A 2RNEA 5EX3A 2QZ8A 1P1TA 2LP4A 2MSSA 3CJ4A 1UL3A 3N9UC 3M7VA 2FC8A 1HW8A 2G2YA 4NLWA 5KG0A 3JYTB 3AT1B 1H2UX 2DY9A 2U1AA 1JLAA 4F2RA 4O44A 1J5OA 2IJNA 2W4PA 2ZHAA 2YH0A 2L3MA 1OY8A 5DS7A 3HHLA 2MQPA 2VC0A 3LQVA 1VRQC 1XBWA 3GFHA 3WIVA 4UOGA 2MGZA 3GIMA 4DV2F 3ITHB 4I2PB 3MPUB 4F26A 3D2WA 1S77D 2VG6A 5DG9A 3QWPA 2XNRA 1F1BB 4WP3A 4YQWA 2QMUB 5H9EJ 2PEHA 2V67A 2ZDPA 1E6YA 1S1XB 2F9DA 3JSRA 5CHCB 1EP4B 4UUWA 3KHHA 2GQCA 1Q7LB 3CJ5A 1VIOA 3IM8A 1BQNA 5A6PA 3W66A 3VTIA 1IBMJ 3CCTA 4MIAA 3R5CA 5KG5A 5J2NB 1XNRF 1Z2ZA 4R25A 3UI3A 5DDOC 2IC3A 2E44A 2Z30B 1SH2A 3EXCX 5DG8A 4AE5A 3W5XA 2HS3A 3U27A 3RAXA 3C46A 1XN9A 5GMKa 2J0QD 4NZ0A 4JV2A 3P6YC 4B3OB 4FYWB 1GH8A 2RS8A 2YNHB 5F3TA 2LQ9A 4LVNP 4M5NA 2MLXA 4FXWA 5KG2A 3T5KA 2E1CA 3FQKA 2YKMA 2UVVA 5CABA 4M95A 2DVIA 1DFDA 1BUXA 4C11B 1M5HA 3DXBA 4I68A 5HK4A 2ZJRQ 3OVSA 4CO2A 2AV5A 3PX6A 1RWWB 2HBRB 4PXCA 2HAFA 3KOAA 3GE9A 1UZDA 1N0VC 4IH7A 3V6KA 5DM7Q 3Q2TC 2AWZA 3L7PA 4NLOA 5CCLA 4OI6A 3PZPA 1TQLA 2B3TB 3DI6B 3HSDA 1QAIA 1NZAA 1N54B 3CJTA 3P5BP 5E41A 2N7CA 3OPKA 5JJBA 4BWMA 4RW9B 2DXDA 4O44B 1J5OB 2BJ8A 2DHHA 2DPJA 4CI0B 1S1VB 1IKWB 1HWKA 2VQFF 2HNYA 6AT1B 4DV3F 4B3TJ 1TL1A 1DRZA 1S0MA 3FBFA 2B43A 2LEAA 3IWLA 4PABA 2V8GA 1YI2S 1AZSB 1Q8IA 5DDQC 2FGOA 1ZPWX 3DGPA 2XGPA 4ZCLA 5KFAA 3CJ3A 2MQMA 1QTMA 1X5PA 2EG1A 2JLFA 1FA0A 5KT7A 2XC9A 1YJWS 1IQTA 2PMZD 4IR1A 1VCTA 3J7Z5 3CXCR 3POTB 3D3BJ 3NCRA 4U8VA 5J1NA 2EFVA 2XSJA 2XMVA 3MPDA 3PV8A 4DUZJ 5J2MA 1G3OA 1HBOB 4RLEA 3PR4A 4E0DA 5KG7A 3GQCA 3FUYA 1NKEA 5KFRA 1NDLA 5LJ5Y 4DSEA 3SBMA 1BXNA 3R5GA 3QGHA 5F8NA 3IS9A 1NDPA 2IVMA 1LXJA 3ETOA 3HT3A 1YHQS 2FVQA 4LF5F 1JIHA 3SI8A 2KI2A 2QE5A 1ZBTA 4TU9A 1Q8BA 1SI9A 3GTYX 4X4OA 2J9DE 2C2OB 2XG8A 3OFEA 1TFWA 3LA0A 1YJVA 4A8SA 4KGMA 2Z2LA 3KDNA 2XSJB 2RAQA 4IG3B 3UD3P 1VDHA 4M5HA 1WDTA 3HJFA 4FF3A 4DHVA 1WNEA 4WIIA 3EVWA 3FEYB 2IPOB 3ULHA 2XMAA 2IRXA 1KD1T 4B9VA 3PYFA 1RTDA 3CT9A 4FKXA 1GXTA 1UW4A 2B9YA 2DNZA 3BO3A 3BKFA 2DNRA 3QT6A 4ITSA 3V81B 4JI7F 3BGRB 3FKBA 4O3RA 4X65F 1M1KT 3GSIA 3BB5A 1NLKL 2OD4A 2EW9A 1JXEA 1K1QA 5CZXA 1HD0A 2F40A 3GCWP 2UVUA 4R8UA 4ZJQA 1IKWA 3S1TA 5KFGA 1SJ4P 3MI7X 1U24A 4YP3A 1NHUA 1JJ2R 2WW4A 2IBKA 2GIQA 3DXSX 4WK1A 3LH2S 4ED6A 3SSQA 3PCOB 4JI8F 5KTQA 4W92B 4CDIA 2QA1A 3G2XA 4KSEB 4P6QA 1D1UA 3ET6B 4GO5X 4C8YA 5H9FJ 2YWGA 4UOHA 3PKYA 1D0EA 3GV7B 1VQ9S 1TAUA 1XIQA 1T9XA 3D0GE 2ZH1A 2Q43A 4CH7A 2NPFA 2BKPA 2CPEA 1SUQB 1FD8A 4OHZA 1FDBA 2RF2B 3HVTB 3PJXA 3C14A 4OJHA 1L3VA 2CPXA 4HHJA 4F4YA 2MEWA 3N6LA 3H4BA 1HKAA 1WF1A 2BKNA 2IHR1 2DGXA 2V69A 3JQKA 4L6V3 4WP8A 5ETPA 4JI2J 2A10A 1LWFB 4ELVA 4TQRA 3G9CA 2VOPA 5K8MA 2BJ9A 1T94A 2E5IA 2E7XA 5DDPC 2LXUA 2VV5A 2MB0B 4KO0A 5DLGA 1VISA 2VICA 4Q5VA 5IWAF 3T5HA 3K0JA 1S97A 2XY6A 3CCZA 5H9FK 4KAIA 5CYMB 4LSNB 1MU2A 4I6WA 2F7VA 3THVA 2CG8A 5F8LA 2GS8A 4I6AA 4ZPDA 3OW2R 1IKXB 3QAUA 1X60A 1RXOB 3EM1A 3CJKB 3LGMA 4IRKA 1B3TA 4ZN1A 1PYTA 3K5MA 2MY7A 2ZH7A 4RBUA 2OEMA 3MMJA 2Y1IA 1HQUB 3PO5A 5AXMA 3OTDA 3PYDA 2OEKA 2HQ3A 1Y3JA 2ASYA 2OPQB 3D7SB 2RRNA 3I0RB 1MU2B 3DDNA 4O0NA 5AE2A 3BJYA 3E2EA 2RKIA 2C2RA 3J81Y 3D6TB 5F41A 1PO6A 4YS2A 4J91A 2XNQA 4LF9J 4PZVA 4ZP7A 1X0FA 1P6TA 3OT9A 1VJQA 4EUVA 4MH8A 1NPPA 3RUBL 1OJ4A 4DR6J 1DJ0A 2V9KA 2PD1A 3A3NB 1FE4A 5HVFA 3M8SA 2HFVA 2GNKA 3GIKA 1SJFA 4ID8A 1Q78A 1S6PA 4ICLB 2NPIA 1JLQB 3JS9A 2UXCJ 3SZ2A 2RF2A 2G1DA 3M6WA 3MECB 1QTNB 2HFZA 1Y11A 2MQLA 2Y8YA 1ULRA 2ZBQA 4HYKA 4A8MP 4GC7A 1Y5IB 4LF1A 1WG1A 2WVFA 3Q8QB 3PR5B 2J8SA 4I2QA 2WSCC 2MHEA 5D4LA 2BJ1A 5C24A 1NK5A 3R5BA 4NOHA 1NSKL 3EVOA 4F8RA 2VH7A 3KLFA 1L3UA 3TUIC 3JTNA 4OYOA 2YNHA 1BWVA 1MROB 2O66A 1WHVA 1KDNA 2GAGC 2ZZMA 2A2CA 2JJ4D 1SJ1A 2CQ0A 3IWXA 1ITPA 1GMUA 3GJRB 2HK2A 4QIEA 1HBNA 2DNPA 1WEZA 2YKMB 3MCOA 3KLGB 3EPGA 1RKJA 4DR4F 1H2VZ 1DLOB 3EDQB 4X4UA 1G6BA 2K3KA 4HI1A 4EYHB 4I1TA 3UVJB 4WE1B 2XCAA 1F9HA 2CDRB 2GJ2A 1XJWB 2PA3A 1MROA 2HVIA 2OH2A 2NUHA 2CJ9A 4F2SA 1NHKL 1URNA 3I96A 2YX7A 4Y6IA 2CRLA 5KFXA 2GJFA 4MFBB 2J5AA 3X1LB 3B82A 2BX6A 1SXLA 3IAM9 2KG0A 3EZ5A 2AGOA 3QZ7A 2F3JA 5B0FA 4CNYA 5HROB 2GGPA 2HFSA 3M30B 3PACA 2DGTA 4ZVGA 3TX8A 5GADU 4YFUA 4J9SA 1WSVA 3KFWX 4QW8A 1S59A 1YRTA 3I55S 3FCHA 5DG7A 4Z7YA 3HD1A 1FJGJ 2KG1A 2N3LA 4QWDA 4K50A 3I6PA 3LALA 4TU8A 5B0DA 3U7JA 3G4SS 4MKBA 3B54A 4LQ9A 1U6BA 4B9SA 2G4BA 2QRRA 5A8KA 1SL0A 4NMXA 1HBUB 2XGQA 4Y2KA 2XEXA 3GG0A 5KFKA 2PI4A 1M0SA 1S6OA 2Y1RI 4WK3A 3SSSA 4I7FA 5EUHA 3OJSA 3OHBA 2L9NA 2XMUA 2C2KB 3MPYA 1WC5A 4EO8A 2BQ3A 2GMJA 7AT1B 2W2PP 3EGNA 1SKRA 2LA6A 2KM8B 2CZVC 2FHJD 4OHWA 5K8NA 4OV6A 3UCUP 3NGSA 1AYEA 3IG1A 3OL7A 5E3RA 1EQMA 4OI2A 3EGVA 3M8YA 4V19J 3UFCX 1F0XA 4P2MA 5KFYA 2MPUA 3T41A 1HBNB 3MUMP 1FNXH 4DSJA 1HI1A 2LYVA 3GYNA 4JBCA 2UV8A 2V94A 4KIAA 1VBKA 4Y2AA 5HMWA 2UXBF 1U09A 2MKIA 3O1LA 1T7PA 4K4UA 4DPWA 1UEKA 2ZBIA 3DLEA 4WE1A 1F6TA 2M2BA 3H2UB 2KRBA 3IP0A 3KXDA 1MWZA 2D3O1 3MOJB 1DQ8A 5D3GB 2Y1JA 2ZOGA 3ZZTA 5J1EA 5CQGA 2XS5A 4ZP8A 4H4MB 2XO6A 1NBEB 3OTOJ 5HQLA 3PRBA 1NJZA 4F36A 4IQXA 3NGDA 1M90T 3NLCA 1DZ5A 1KFDA 1RSCA 2FHOB 1IUJA 1YK9A 2KT2A 3UN5A 2RS2A 3CC7S 1JLCA 4TQSA 4PCQA 5D8HB 3DI6A 2D74B 4UF4A 2NYHA 1DBDA 1JKHA 1NM2A 4C7QA 4EO6A 1NJIT 4JI4F 3IMQJ 1I51B 3NXZA 4NCAA 2ADCA 3NMAA 3CTRA 4CTAB 3B4MA 1S1VA 1GK8A 3DOLA 1U1RA 2UXCF 2P2CB 4PG5A 3GCXP 3ITHA 4OZ3A 1S4FA 4NE9C 3UR0A 4PWWA 1ZZFA 4USKA 3UR3C 4OI1A 2UUTA 1T02A 4FYXB 5HBMA 1CJTB 1R0AB 1X4HA 2CNNB 3RAMA 3AJ1A 3SMZA 2UVWA 1S57A 2RHSB 2VASA 3RU0A 2XZDB 4LRBA 2FJVA 1FKOB 1TU0B 3EE3A 3NGUA 5ETMA 2AU0A 4UY85 3EICA 3JXOA 2YNFB 1L3SA 1HI8A 3TUPA 4FKYA 1HR0F 2DR6A 2VFRA 2PE8A 1N33J 3K8VA 4DX7A 3R3TA 1S0NA 4C4WA 3OR2A 1VMBA 2LXIA 3MR7A 3R5DA 4KPCA 4TLQA 1D09B 4WPAA 3TZZA 1B70B 2DXFA 1NHVA 2UUWA 2XMJA 3W8GA 5HVHA 4WFNQ 2KXNB 1FCAA 4DUYJ 2HBQB 1JJ4A 2AP6A 4NXMF 5IQ6A 1WOSA 5IC4B 3CC4S 4S0MA 3PFOA 3U1LA 1IJEB 1LFPA 1UZHA 3I0RA 3Q8YA 4NLSA 1XMOJ 2DIVA 1V6HA 2MKCA 4ELTA 4RNFA 1FKAF 2B9EA 3HSGA 4G1QB 2GHPA 4I56A 2OTLS 4I0WA 1HQUA 3CF5Q 3SQOP 3HM9A 2R7OA 3W64A 1D9FA 2B8QA 4JI1J 1HNZF 2V8DA 1F2GA 1RHRB 4DDFA 4IRCA 1JWWA 1NDCA 2UXDJ 4B3RJ 2BA9A 4KFBA 4CLFA 2JDJA 2YPZA 1PIEA 1C1BB 5KT3A 2YBVA 1N4LA 1C4AA 3AB2B 3D9BA 4OZJA 1UVJA 1JLGB 1VQ8S 3CNQP 2GC8A 4ZVEA 1PSDA 2UU9F 4BHQA 4IFYA 4UW2A 1T9VA 3BPSP 3CPWR 1YZ7A 4NLDA 2DR9A 1VK8A 1QSYA 3ETMA 3RRGA 3N01A 1PC5A 3HX9A 5HSPA 3U1NA 4XDDA 1RAIB 1JLBB 3GPAA 4L75A 2AYBA 1KRPA 4LF5J 2MMYA 2FLNA 3HK2A 1HMVB 4ZPWR 4NA1A 3PW0A 3RBDA 3P96A 1WUUA 4X4TA 3TRGA 3TZWA 3IN5A 3HLUA 1TMMA 2MZJA 2B4VA 4TYBA 4WFBQ 3BYRA 1UJ5A 3BS9A 4RWWA 1I6JA 3QRRA 2IJFA 4B17A 4ZIVA 1R31A 3LOUA 4YY3F 2R8JA 2ACMA 3N6NA 1BGXT 3OR2B 1RGVA 3T5LA 2KM8C 1VIXA 5C24B 5E33A 1NMEB 4ZVPB 5HP1B 2VFUA 3CDUA 4KR0B 3WIUA 1M5VC 3ZTSA 4KYZA 1SV5B 3AQPA 1UW9A 4X65J 4JI6F 2AEFA 3QFWA 4OYBA 2PMWA 3CW2C 3KUGA 2BANB 1ZTWA 1PAUB 4JYAJ 1YBAA 1VJWA 4DG1B 4IG3A 1B99A 1CJUA 2KYZA 3OL8A 4K4TA 2OIHA 2YX4A 4GKJF 1N5YB 3OVAA 1OIAA 4OJ3A 5IT0A 1PCAA 1VOMA 1BQXA 5HP1A 4OI0A 2PIIA 3W5ZA 2L41A 5LL6d 3HCXA 4BC9A 4RBTA 5LSLA 4WJBA 4F67A 2KVIA 7FDRA 4IQMA 2XLIA 1R0CB 4E8UA 2K2PA 3LTOA 1TELA 3E01B 3ISNC 3R7SB 3KDOA 4U7CA 1FWLA 1T11A 1WDDA 3O5TB 3HSZA 2GVDA 4DPTA 1WSRA 2XI2A 3BF4A 5F3ZA 2AF6A 3SFUA 4ANDA 4KHPF 1RT6A 3M8WA 1TK5A 2NZCA 2CQHA 3WX4A 2AW0A 2COLA 3BGUA 5GAEI 3C2PA 4G1IA 4K4SA 1X7VA 3KJVB 3DDIA 4ELUA 2ZBPA 3BSCA 4JUZA 4DV7F 3HVTA 3QAEA 2DGOA 4P7VA 2LEBA 2ZHOA 4OQJA 1KN6A 3L7OA 3DOKB 3KUHA 3MM7B 1R7IA 1S7HA 1M1GA 3TAMB 5G0RA 4DV4J 3ISND 4M5DB 5K5MA 2X7IA 1HIYA 3B4DA 1IR1A 1PJ7A 4GVBB 2LQBA 3UO0A 2KL8A 4IUFA 1NUEA 3D66A 4LRAA 2BOPA 4K4ZA 2AEMA 3BGLA 3N79A 1DTTB 3JSBA 3S01A 3KJVA 2V6AA 4DSFA 1ZPVA 2JFDA 1PYSB 3R7BB 2B5JA 5LSOA 3MPWA 1LXNA 3TAMA 3HVRA 1S1UB 3ZFVA 5MAOA 3KHGA 4LBIA 2EC0A 1VC6A 1LWXA 3ET6A 2QYCA 1WF0A 2IIHA 2QO3A 2O5DA 2AQ4A 3NKYA 3ONQA 3O2IA 3W3SA 2BE2A 3VHQA 2XMKA 3SIPB 3T1HF 3NNCA 1F5CA 4B9NA 1X4FA 4ES1A 2QMXA 1VK3A 3MAAB 3QNWB 2KJWA 2YXLA 3I5CA 3PRVA 3TEGA 2B7CB 4MMOA 1A6LA 3QGGA 5ETTA 3TW0A 1U1MA 3GZ7A 5J2PB 1NK4A 1OQ3A 4FS2A 1J5EF 3R6GB 1RACB 1X5SA 3IRXA 3M8PA 4NX9A 3V5RA 4DXLA 2DNKA 2AYMA 4DR7J 1SVDA 2MKJA 3VZHA 4EU0A 2KT3A 2UP1A 4WF9Q 4IYQA 1WEXA 4CT8A 4DX6A 3NNHA 2V4QA 3C8YA 4C97A 2RDJA 1VBZA 3BDEA 2G0IA 4F50A 3DLGB 1OPZA 2A2DA 3FJ2A 1C1CA 3FSIA 4Q7AA 4J9PA 3QSIA 3ZO7A 3PW5A 1RLCL 2BABA 1CC7A 2ZH5A 2UUBJ 4LQ3A 3BDPA 3MUTP 1RABB 1URRA 2YVSA 2CZ4A 1DTQA 3V4IA 2ASJA 3B6BA 5KFFA 3DRXA 3M8PB 2WVDA 1RE1B 1OO0B 1T03A 2MKYA 3JQMA 1UVNA 3VGUA 1N32F 1K47A 1D9AA 1L3TA 3T19A 1CBKA 2XS2A 5LMNJ 2ZEJA 5DRKA 4ECYA 5CYQA 3M32B 5GAGU 1TKXA 1UEVA 2V4JB 1KQKA 4EEYA 1EB0A 4DR4J 1JQGA 4F3MA 3SV3A 5C42A 3KLHB 5HMZA 3PIPQ 3OSNA 1QSSA 1RT2B 1IQZA 1UVLA 5KFNA 1JLFB 3LGHA 3PO4A 2PA8D 4NXNJ 3WHIA 3ILLA 4FZVA 5AXNA 3VAIA 1GMWD 3QJPA 2KZZA 1OS5A 3OTEA 4I69A 2ZBRA 2BE2B 1VRUB 1T95A 4CLZA 1SC1B 1SC4B 3HPOA 2UUAJ 4A8FA 1RTHB 1F5AA 4QPTA 1HHSA 1ICEB 4J7CA 4RW6B 4CLKA 2EPIA 2MQQA 3GV5B 4ECWA 1RADB 3KLGA 2Q66A 3VAJA 1S76D 3HVWA 4QWBA 5KOXA 4DFJA 4IOAQ 1IVZA 3OSPA 3DLJA 3KLHA 3CCMS 1O8BA 1FJGF 4Z7CA 3CCRS 2IYGA 5IOLA 1JLFA 1Z2LA 2GA7A 2R3VA 2X3DA 4OYIA 1X4EA 2UZAA 3GJQB 3THTA 5IFMA 4DL7A 4RW7A 3MTKA 3MR5A 4W90B 4DSKA 5AE1A 1VBYA 1C1BA 2QLWA 1FVSA 2YWEA 4EI2A 2PEBA 4JI1F 4M5JA 4HACA 2UXDF 3CDWA 3AA9A 5E3QA 1KR4A 7FD1A 3BSOA 4NRTA 4KE5A 4DR1F 2ZUAA 3EWGA 4P2XA 1U1QA 4LUBA 2UU9J 3QO9B 1VRTA 5I3QA 5DM6Q 2E29A 2NZ4A 2E9ZA 1TL7A 1MWQA 4PPDA 2BACA 5U47A 5KFSA 1KEKA 2IC3B 4OYMA 4J9KA 3GSDA 1BLUA 1FFGB 5IC6B 4MIBA 1X4AA 3MM6B 4Z37A 1N5VA 4DL4A 3PW7A 2XHCA 4IG0B 1XR7A 2JEGA 1TL3B 3PY8A 1B0PA 1TK0A 2EKYA 4Y2MA 4ZIWA 1RTZA 3HT0A 3OV7A 5I3UB 2HHVA 2AJFE 3PHEA 4DR2J 2FYXA 2XS7A 1TUGB 1WWHA 1FESA 1SKWA 3KMQA 3AJDA 4YB1P 3MCNA 1RTHA 4JP8A 3RB6A 4RUBA 5JXSA 4HTJA 4YDDB 1U1OA 4DUTA 3RR7A 5HLFB 1XTZA 1NK9A 2VDIA 4A8QA 1VQLS 4DV3J 3IGNA 1LW2A 1FHTA 2HBZB 4JV5F 1BD6A 4LF4F 1S79A 2MZ1A 5KFIA 4AXIA 5B0CA 2QX0A 3LO3A 5I3UA 2HNYB 2OP5A 4KHMA 3LAMA 2HQFA 4UT4A 4HH1A 2VBWA 4ZKAA 3L3CA 3MZIA 1I94J 2HMIA 4ZVOB 3D1OA 4DQRA 1HYSB 1S1WB 4DPXA 3RZAA 1R89A 4NLVA 1OPIA 2JHEA 3DRRB 4GKJJ 3VZIA 3W9HA 4RPFA 1JLCB 4DR1J 4YUDA 1S6QB 3IXQA 4BWJA 4E2FB 1D3WA 2HGLA 4R5PA 2RQCA 1YJ9S 4PG6A 5HJYA 3MEEA 1XR5A 3BO4A 1EP4A 2O67A 2FZCB 2OKQA 3DM2A 4RU9A 1T3NA 4ED4A 5AE3A 3T9NA 5L46A 3MURP 2C28A 1CS4B 1EAYC 2Z2MA 1D9DA 4C9DA 3D5MA 2HFUA 1NZ8A 3Q89A 1REGX 4PG7A 2K8GA 2IAJB 2XBPA 3S7RA 3TJAA 5IM0B 4DUYF 1HNWF 4O3PA 1K9MT 3EZUA 2VJVA 4DQPA 1T9TA 3J7ZT 3NGTA 2AYGA 2M9KA 2FZGB 3SCJE 2VUGA 3H59A 3KMSA 1YITS 3D0IE 1RT4B 4MKYA 5L38A 3BQ0A 2C3OA 3AAWB 3MEEB 5G0RB 8RUCA 1U25A 1VQ6S 2FJEB 1T3OA 1N52B 2Q3PA 3I9ZA 5IV3A 3PM9A 1FWPA 4J9RA 1YJUA 4FNIA 2OEJA 4JI3F 4U8YA 5BR8J 5J2NA 1YJTA 1H73A 9ATCB 4KKOA 1RT5B 3Q8UA 4JI0F 2W9CB 1ZAWA 4N8OA 2XYPB 3A3PB 4NMLA 2VG5B 3I0SB 3M2VA 1CC8A 3KK2B 3M1VA 3SDEB 3CJ0A 5SUHA 3AHPA 1OSCA 1VQYA 1VHIA 3G6XA 2AGPA 3M6XA 4NLGA 2DTJA 2GZOA 4U7UD 2Z2YB 3A1YG 1YG0A 1VQKS 4WZMA 5I42B 2M52A 5A8RB 5F8JA 3DC2A 1CJUB 2BXJA 3NCQA 5HN0A 3ADAC 5KFBA 2C1EB 4UQGA 3IBWA 2CQBA 2P6TA 2R2RA 2XI3A 3ILOA 3CUNA 2FVPA 2VU5A 3NMRA 3PIOQ 4NRUA 4GVLA 4DF8A 3CDEA 3IR7B 4RU2A 1ZS6A 4KFBB 2C2DA 4XPCA 3T1HJ 4ZITA 4DR3J 1FTCA 4CM2A 2YNFA 2Z8QA 3C14B 3EXYA 5E3AA 4ENOA 1S49A 3H8YA 3EYZA 2O3DA 5JVGQ 4F4WA 2EG2A 4H4MA 2X51A 2DNHA 1WC4A 5I4MA 2XB2D 1JLEA 3C6TB 1FX4A 5K20B 3OD2A 5J1PA 4K0KF 1U26A 1P9YA 4X62J 3PG9A 1IBLJ 1M1HA 4M5LA 3ENWA 2BEFA 4ZP6A 4DR7F 1JXVA 2OMLA 1NSAA 2HKEA 5A76A 2VBZA 2AJ4A 3PDNA 4K2JA 3TANA 2WVBA 1Y5LB 2CFXA 1XQIA 4YN3B 4DQQA 2D3UA 3TZYA 4JI6J 4LSNA 4FNHA 1ZM9A 4QQBA 6FDRA 2FB0A 3K5LA 1W7WA 2OLWA 3CCJS 1BMQB 1ZAXA 5C42B 1WKKA 3NAIA 3O3LA 2ALYB 2GIFA 2CPJA 2XYGB 3EGWB 3J7A1 4G65A 1TMJA 4QYZJ 4MTPA 4GVBA 5CYQB 3TUJC 1LEOA 1N32J 3DLKB 3FEZA 1CG2A 1VRUA 2YQ1A 5E3PA 1KQFB 4TN2A 4YHHF 1R0AA 1T8EA 2DEJA 5A8WB 4A8KA 1EHWA 4OYAA 4LF9F 4X2BA 1VS3A 4ZVUB 2QG9B 1RK8A 2RHQB 5J1EB 4U7UK 5L9NA 4KJIA 2MZQA 3ILJA 4ED1A 2QA4S 2GAHC 5DGBA 4DV5J 2LMIA 4WCEQ 1B4SA 5HVGA 2W4DA 1ZM4A 3J81j 1MSWD 4OYZA 4Q2LA 3WDOA 3P8BB 1WI6A 2QMWA 2WHOA 5EX0A 5FDLA 1SJ3P 3TWZA 1KVIA 4F4ZA 2DISA 4ED2A 1MMNA 3DDKA 1SL1A 1IBCB 2P5VA 2JZ5A 4UUXA 1B0VA 2V50A 4M5MA 2OSQA 3GU0A 3OJUA 2ZBCA 1ZETA 1HNIB 1SB6A 2FIUA 3KG4A 1VQSA 2W9BA 1T05B 4PWDA 4P52A 2CNKB 4C8NA 4PAAA 4G1QA 3TI0A 1NPRA 2HQGA 4ZPCA 2XMMA 4N56A 3QO9A 1LWFA 4ZJLA 3TUZC 4X4PA 1QUVA 2MDAA 5HBMB 1WC3A 2B9WA 3C16B 3G71S 1AUDA 1RT3B 3WZ0A 2KFNA 1HWLA 4LT6A 1GTEA 3TNVA 3AOBA 5DLFA 3PJ9A 1HPZB 1J27A 1NSPA 1SUQA 2HWIA 2LCWA 4LFAJ 1RHJB 2GQQA 4KC5A 5HATA 4DEZA 4DX8H 8ATCB 4UQTA 1TL3A 3ZNJ1 4IFYB 4N77A 1WF2A 4PYAA 1N8RT 2VZ9A 2I0XA 5M2UA 2CG4A 3LUYA 4C3LA 1JJCB 2WK4A 3D6FB 4FDFA 3MFHA 3AA8A 2HQCA 1BC6A 2G1HA 4ZPVR 2ERRA 4OZ1A 1X9WA 2RRBA 4O4GB 3DYAB 2V2KA 1Y9OA 4ES3A 2YKQA 4ID5B 4GKKJ 2W9AA 4DU8A 2VJUA 4DV6F 1XNQJ 3IAS9 1T9UA 3W2VB 3UN2A 4OZ0A 1CVJA 1OMSA 3GFZA 2LQ8A 1MWYA 2B5JB 1R8PA 3KUEA 1S9EA 3C66A 3PKMA 2ZDOA 1RU2A 2R7QA 3K17A 5EDWA 1CJVB 4Q45A 2X1FA 2NSCA 1Y00A 2LECA 4RNMA 2OI2A 5DDRC 4ILRA 4EZ6A 3DMJB 1R0BG 2W8LA 4LFBF 2DB1A 1Q95G 4OMFG 4P2SA 5K14B 5HROA 2P8IA 5ETOA 2DGUA 2QTWA 2J8AA 3R5JB 2ROPA 1S6QA 4JB8B 2E5JA 4CO1A 2DNOA 2XY7A 5KFMA 2RVJA 2QYGA 3BM7A 5A2QU 2K7KA 1KKHA 4OFZA 5C2CA 4B3SF 3TVZA 4LF4J 3KJNB 2IA6A 3I31A 4URQU 1RCOB 4Y3CA 3VGVA 5L1LA 1N36F 2OPRA 5GVQA 4GC6A 5ETQA 3MCSA 4EFAC 3DRYA 2PC6A 5AXLA 5A8KB 2AHOB 1F5BA 2Z56B 3TO8A 1P1LA 2APOA 5B0AA 2DGSA 2FLLA 1TUWA 1UEUA 3C6UB 4L74A 3RB4A 2BOAA 4NZ6A 4USIA 3PW2A 4MK9A 1S10A 5KFPA 4LMZA 4NA3A 3U1MA 4XDCA 3AXKA 4K5SA 2NXUA 3QGIA 5L1KA 4KPYA 1AZSA 2DITA 3TVYA 4QPXA 5KT2A 1F3FA 1AFJA 5B0BA 4M5KA 2VC1A 1TP7A 1S1TB 1TL4A 2GO8A 2P9GA 1SV5A 3DOMB 2HGMA 1SL2A 4NLUA 2JH3A 2JWNA 3UW1A 2M8DB 2OPPB 4LSLB 5ETKA 2E7VA 4OX9J 2J9CA 1YLXA 2HIYA 3NP5A 4QZVB 1U0HA 2V4JA 3MD1A 1Q82T 1NJWA 2J0SD 1PAEX 3IO1A 5FLXY 4ECZA 3T1AA 1WKJA 4MYTA 3H5SA 5DO2A 2CQCA 3OHAA 2F4VF 1SC3B 2VB6A 2VFVA 3HFZB 3MFIA 4WYLA 1IWAA 3T6BA 4X4SA 4C48A 2QSWA 5I42A 1AW0A 4IH5A 5L9XA 2BW7A 4XAKA 2J6SA 3CWJA 1H7WA 4ALZA 4JI4J 3CMES 4HLBA 3THPA 4U95A 1YVFA 4AL7A 2FUG9 3G87A 3J81U 4RNOA 1N6QB 1DTTA 2W25A 4CH1A 1UCNA 3Q8SB 3CULA 1F2HA 1VLOA 3VAKA 2MQOA 4U6PA 2UV8G 4PPZA 2E5LJ 2QEXS 3L9ZA 2H4YB 5LM7E 4LIRA 5IZHA 3D68A 1RB0A 3GYXB 3KK1B 2W2QP 2J7WA 4JV1A 1V5VA 3IC1A 3FDSA 2YTCA 3C15B 3EDRB 3NS5A 3ENVA 3N5BA 3OFHA 4X84A 5D15A 1C4CA 1EKSA 5ETSA 4X64J 4F0KA 4WP9A 1P27B 4KRWA 1NH8A 2M0GB 2M8HA 2W1BA 1UJ4A 4OZLA 5KAKA 3T6JA 4LBHA 4DFKA 1LWEB 1F3VA 2KDOA 3KJQB 1N6QA 1S9GA 2DH8A 2KTQA 4R5PB 3K89A 3ZTOA 1ZOTA 1RTIA 2B6AB 3MM8A 3GLJA 2ZHBA 3TARA 4QIGA 1QJHA 2LU1A 1JLEB 2C3YA 2YWHA 1XMBA 3C6TA 4FVCA 2ZITA 3TJ9A 5KT6A 4DL2A 4IRDA 2HRUA 4DZDA 3I5AA 4LR9A 1RT1B 4OZ2A 1G1XA 4H4KC 3KK3A 1IBLF 1GX6A 4WTOB 1Q1KA 5E3CA 4RUCA 3M8QA 1XMQJ 2HFNA 1CLFA 3KHRA 2CIMA 3N4WA 1X5OA 2BV3A 4NYPA 2HSEB 3NAHA 5KT5A 3J7AN 3BBFA 1U0SA 2IM0A 4GO7X 1LWCA 4FYYB 5LXYA 5M2PA 2DGVA 3NNAA 1R8BA 1YKWA 5J2QB 3BKUA 5KG3A 1C0UA 4I67A 1T9YA 3RW7A 5D6GA 5KFCA 1E6VB 2EI5A 4MKAA 1RWKB 1R8HA 3MAHA 1LW0A 4RO0A 3BGRA 1I1GA 3BR9A 3M8RA 1NK7A 2WSEC 1PILA 5A8WA 1UWBA 2XO7A 5IT9U 1A7GE 1TAQA 5HLFA 1FXLA 4KT0C 2A6MA 2HPUA 3QPIA 2M5YA 1YZ6A 2VDHA 4A47A 4P74A 5BJRA 5J2PA 1N56A 3SXLA 1RCXB 2VPXB 5EGYA 2KN4A 2ADBA 2FVSA 1HNIA 2CPHA 4PUOB 3HHLB 2MGZB 1FI4A 4D3HA 1VBXA 5FDLB 1FJEB 1LQ9A 3CD0A 1OYEA 2HMIB 2RDIA 3KJFB 1NU4A 1NSQA 1BHNA 5LJ3Y 1F9FA 3D0HE 3VVUA 1NDKA 1LWEA 2QSFA 3L4BC 3N28A 1YQHA 1RTIB 2CPFA 1DTQB 3MM8B 3V4IB 5D0RA 4Y00A 1Q53A 2CQDA 1XR6A 4DQIA 1R43A 2D9PA 4OHXA 3JB9k 4YB6A 3NRBA 2FY1A 1TVRB 1K0TA 2LXFA 2MKSA 1TUVA 4L73A 1TKTB 2K1RA 3MR6A 4DV1J 2QT7A 4XO0A 1S6PB 4ICLA 2U2FA 3EJMA 4A8XA 5KOWA 1SC6A 2WAQD 3ZZZA 2DHSA 2XYHB 2YQ0A 4F0MA 1FEEA 3G6ES 3H98A 2WONB 4KB7A 2VG7B 5CCMA 4IOBA 4YEAA 4CYUA 3D28A 2R7WA 1IR0A 3PEJA 5HL7Q 4LFAF 1YSJA 2V63A 1DHMA 2RQKA 3WC2A 4QWEA 2I2YA 2HHPA 3MF5A 2IDEA 2FLPA 2HHHF 4CCHA 4FBTA 1HYSA 2DEIA 4DF4A 1TKTA 2K1RB 2ZFHA 4OV1A 1UWBB 1W25A 3CCUS 2VA2A 3BBBA 3DN9A 1YBTA 1VHFA 3IBFB 4MK7A 1REVB 3I32A 2B8PA 3BV8A 4C8KA 1R8AA 3A8JA 3QT7A 2D9OA 1BQMB 2CJQA 1KLNA 1S9EB 2PN6A 4RJVA 2MKKA 1F9EB 2CJBA 3HHKA 2CXEA 2ZH8A 2ZD1B 5L1IA 1X9MA 2FVRA 2W01A 1OSDA 3AY0A 2V9WA 4WTYA 2BUNA 1NNDA 3TA2A 4Q0BB 3CCWA 1KBRA 2ROGA 3DHWC 1QE1B 2DK2A 3HMJG 1KNZA 1JLQA 4KHRA 1WORA 4L72B 2ZJQQ 1QLNA 3V4MA 3P5TL 1V5IB 3M2UA 3UDCA 4DV7J 1U1LA 2PFFB 2K3IA 4OX6A 4RX6A 1FNMA 4HKQA 1FJ7A 4RUAA 1M5SA 3Q24A 2X3GA 3QRQA 2BE7D 5BYQA 2ZC3A 3UVJA 2HW3A 5GAGI 4PXEA 3C6UA 3GG1A 5F9NA 3R2DJ 4K59A 3TQEA 1VC5A 4LR8A 3BEGB 1TFYA 5IS2A 4FYDA 1K44A 3AD8C 1BE4A 1VFJA 3KNGA 4KV8A 4I2PA 5D0GA 1EZZB 4CLTA 1GNKA 1YDLA 1H98A 2E1RA 2N4CA 2D69A 3C16A 2FVCA 3I9V9 3JQJA 3M2UB 2PFDA 2CYYA 2F63A 3MM6A 1NK8A 4YHHJ 1VQNS 4B3OA 3L95X 4TY8B 5D4PA 2B56A 3WQPA 2R9LA 1OWXA 3AB4B 3FZBA 4DUZF 3HHEA 4C98A 2GVZB 3GWCA 2FC9A 1NB7A 2N82B 2DH7A 3FQLA 1CS4A 3GV8B 4KTQA 3RTVA 1K1SA 5A6WA 3AD9C 1IKYA 3ENQA 2EC2A 1X4DA 1REVA 2IAJA 2WBMA 5RUBA 2DNNA 5D4OA 2JLGA 2OAUA 3OTCA 1U1PA 2LQ5A 2MSTA 3CMQA 4IDKB 1QM9A 2F5GA 4KGZB 1VLYA 1WACA 5CD4A 4MKVA 5ETRA 2JL9A 1NJYA 2AEJA 2AYEA 4CQ1A 1G7CB 1UFLA 2G2OA 3HF5A 4WIQA 3R2CJ 2GVDB 2F4VJ 2DR5A 3RRHA 3DLBA 3SFGA 2W7PA 3HHLC 2OTJS 2ABYA 4LIWA 3NCPA 4HVZA 3R9LA 3B8HA 2ZJPQ 1PJ5A 3BO2A 4HHHA 1RJJA 2B4UA 3TZXA 2JRSA 5KFJA 2L9DA 2R7RA 3FBCA 3OFFA 4A8WA 1HBOA 2G0CA 2C3MA 4DFMA 2BMBA 3CIZA 5C7PA 3NWGA 3QJLA 4USTA 4ED0A 2HEKA 2EBEA 4ETXA 1T03B 3FRYA 4C8ZA 2AJQA 4DR5F 2MKHA 2CADA 5GMDA 1AUSL 1RUSA 2CQPA 2GFFA 4FXDA 1Q8KA 1S99A 1TZ0A 2J9EA 1XNQF 4M8LA 4O3QA 2LDYA 1RYSA 3KLVA 4CO5A 3BN7A 1U1NA 1SCJB 2OPSA 2YKPA 2CWKA 2CNLB 3CDBA 4JI2F 3DFEA 3KLIA 2UUAF 1OQ6A 3H40A 1HBMB 3Q2SC 1X4GA 1HNVA 4FYVB 1EETB 3M2RA 3O8WA 4N76A 2HVHA 4XPEA 1YRXA 4M63A 4YB5A 4LRDA 2CJYB 5D4NA 2YPYA 2W7OA 2ZH4A 2ZH2A 4RW6A 2HHQA 1O5JA 2PMHA 3Q8VA 5D3GA 5B09A 5LMUJ 4AFFA 5AXKA 1FRHA 1RWNB 2I9SA 2VQFJ 3PNIA 1EQ0A 4I6YA 4LREA 1U2RA 4HI2A 1T9WA 4FPIA 3R8YA 5CD4H 2FLOA 3SQGA 1S9FA 4DL6A 5FLXU 1RZMA 2CUYA 4KH0B 3OUYA 2AZ1A 4EZ9A 4DV0J 4HTIA 3FCWA 2KVQE 3ILIA 4WFXA 4ZCIA 1N36J 2DIUA 2KXHA 2O01C 4X66F 3DMJA 2YNIB 1S7IA 2BRKA 2HHTA 5CH7B 3KLEB 3BKTA 4A8OA 3VAFA 2DO0A 5DZ7A 2OD6A 5L39A 6FD1A 1HHTP 1JNRB 1UAWA 2R7VA 3MR2A 2IDLA 1PKUA 1FT8A 3CIMA 1JXLA 1XWLA 5B0EA 3SQGB 4NWBA 4QJVA 5EHHA 1CULB 3MMAB 5FD1A 1TVRA 2DR7A 4ZCMA 3R1LA 3EMTA 3GR0A 1ZA1B 3M05A 4OIXA 4ID5A 1U45A 1LK5A 1UMJA 2NXNA 3N6MA 5KG1A 1HARA 4WKYA 3DLGA 4DN9A 5JVHQ 4IO9Q 2JNJA 3IM9A 4OX9F 4DPYA 5T14A 3D54A 2KYXA 3LF0A 3QT8A 4J9QA 4FBUA 1VYAA 4CYUB 1O0PA 2P9CA 2W9BB 1T05A 1Z4UA 1NAQA 3KLIB 4PWDB 1DY3A 4OYWA 4URSA 4WWSA 2W7AA 2ZKUA 4CH0S 2HK3A 1RAOA 1WHYA 1HBMA 2C42A 2KJVA 2XWXA 3AD7C 3DNCA 3RG6A 3US5A 3W7BA 3Q23A 4KGVB 3OBIA 4O3OA 3LP1B 4JI7J 2ATLA 1G2EA 4M5GA 1B64A 1FK9A 4OHYA 3TR5A 4USMA 1X9SA 3HO1A 3F73A 2AKWB 2DT9A 2WB4A 3OUYB 3FCVA 4M1KA 2E5LF 4R0EA 2F8HA 5A2QY 4B02A 2HHHJ 1HNXJ 1Q86T 1LW0B 2XULA 4LF2A 4X64F 5ADZA 5A0YA 3OL9A 4ZOSA 3KLEA 1SIZA 1RWUA 1JLGA 3BH6B 4YDXA 4WFAQ 4DJBA 2XTJP 5E0OA 1TL5A 1PGZA 4CT9A 1GAOA 1H6KX 4ZJOA 3FFIA 1BY9A 1HFEL 1N5QA 2DRBA 2V8PA 2FD2A 5HO4A 1DARA 4P71A 1UJ6A 3CSKA 3ZZYA 2ZKTA 1MN7A 3MEDA 4I2QB 1U4BA 4DSIA 1RWVB 2BJ3A 4JV0A 3GIJA 5IT4A 3ICLA 3GONA 3NS6A 1GTHA 1UA1A 1I3OB 3NWRA 4PWUA 4X4RA 4QYZK 1B0TA 1KS2A 1N5TA 5KT4A 2ZH6A 4AL6A 2E1MC 2VHGA 2NSBA 2R8HA 2MTLA 2GVZA 4P10A 5HQMA 2B0GA 2Y8WA 4JYAF 1PBAA 3W1YC 4ZLNA 3HP6A 4FF4A 3GJSB 3UN3A 4ZHRA 3MPVA 3PJWA 1RT5A 3ZTPA 2GMHA 5DJBA 1A9NB 2VA3A 1RWPB 2Y3YA 2RT3A 2OJ3A 1NCLA 5FIIA 4MK8A 5F0UA 3UDVA 1WHXA 3PX0A 4F3OA 3H25A 2R7UA 1MMLA 3CJ2A 1UTAA 4C0HA 4C3MA 1VR6A 2OO4A 4J5OA 4RWXA 3DOKA 1NJXA 1UVKA 3A8IA 4Q44A 1N5YA 3PEHA 2IRYA 4FF1A 2XMTA 3RYLA 2FJWA 3K2YA 2HVDA 5F9LA 4EYIB 4CM0A 2OHDA 1E6VA 1RDRA 1P8GA 2VFTA 2MQNA 3D3CJ 2YX1A 2C2EA 3NY0A 2AJ0A 2B4OA 1KOHA 4NPOA 4E98A 4AQYF 3L09A 3DGVA 3W65A 2CPIA 3FBEA 3KNAA 5HAOA 1U0HB 3H90A 1JKHB 3PW4A 1LFWA 2ZC4A 1AA1B 4DWIA 2V8VA 2CQGA 1UVIA 3QT5A 1PG5B 4K0KJ 2VKZG 5F0WA 3ZZOA 4X62F 4HR2A 4ER8A 1X5TA 1BQNB 2EVZA 2J0XA 2QA4G 4PUOA 3G8SA 3BGOP 3DLHA 3HKZD 1IBKJ 1S1WA 3E8OA 4YR2A 4DV1F 4Y2IA 2F4FA 2C3UA 1RHKB 1WKLA 1HBUA 4QW9A 2NXJA 2P6SA 3AJ2A 2RH3A 1IKVB 1SH0A 2MYFA 5GMEA 2LFVA 4OHVA 4PRFA 1FRLA 1TKZB 2GCFA 4J9UE 4LSZB 2QJ3A 3CEDA 4DFPA 3V6DB 1TR0A 3ENAA 2K06A 1R6VA 3C15A 2D3OR 2HG4A 3MMCA 2BVZA 3DRSA 1PJ6A 2DY1A 3J80U 3MCMA 4KKOB 2H1YA 3EZOA 3BN4A 2DO4A 4N47A 4NEYA 2KRRA 2ZVIA 3CO0P 3IR5B 5IM0A 3W2WA 3L7UA 4Y0FA 4NYZA 3BGFA 4I7FB 3M6VA 4ZPBA 3KLFB 4DV5F 1Q5YA 3QLHA 5KFUA 2CA9A 2R8IA 1YJ7A 2CJKA 2CWXA 2HQDA 3LAKA 4Z2XA 3I56S 3RR8A 2HZAA 3LGNA 1TKZA 4NI2A 4KQZA 4ED5A 2WRMA 3UCGA 5D78A 1HR0J 2IVFB 1N33F 3I4PA 5CAAA 1RA6A 1R27B 4CZCA 2RUSA 2ZOFA 2J6TA 2PGCA 3T1YJ 3CB4A 2JEFA 4OZ5A 2W9CA 2C2NA 4NCGA 1RAFB 1F60B 1XK8A 1IKYB 2ZWOA 4NYOA 3ZTRA 3W9IA 2PI5A 3MXHP 1TKXB 5GAEU 2FTRA 2ZE2B 2BM1A 3NGRA 2XZWA 4KY3A 1FRXA 3AOCA 5KFVA 4USJC 1HQEB 3QLHB 3IRXB 3WBZA 3SSRA 2FQQB 1FVQA 5KFTA 2XQCA 1MN9A 4RZRA 2FDNA 2IFXA 2HZCA 4PQUA 1R8CA 4OI3A 2WSFC 3MOZA 4OJ1A 2CQ1A 3W5YA 4URGA 1QAYA 3IS9B 1K73T 2NREA 4DV0F 2ROEA 5KFDA 1FE0A 1HNZJ 2W24A 3FMBA 2XY5A 4J37A 3V6HA 2RRAA 4J9VA 1U7LA 3ZZPA 4PG8A 2MJNA 2CAJA 2F65A 1I5OB 4ED8A 1HW9A 4X4VA 3JAMY 2KKHA 4LF8F 2DHXA 2OSRA 3AQOA 1N0UA 1CULA 3MMAA 4ZVHA 1X8DA 4A46A 1HWUA 1Y0HA 2HQIA 4OX8A 4ES2A 1APSA 3OQ2A 3VALA 1FRMA 2ZVSA 4RUHA 2WTFA 3OL6A 2HNDB 2EXUA 3GFXA 1WC6A 3AXMA 1ZYQA 2BDPA 1WG4A 4XIUA 1H74A 1BQMA 2AD9A 3BSAA 1UPPA 2HNZA 3LWMA 1UA0A 4C0OC 2HS4A 4WU2A 1U2CA 1X4CA 3RGIA 2YH1A 1IM6A 2BKOA 2QLJB 3I4HX 4RNHA 1CJVA 1QD1A 4G1PA 1LOUA 1MNEA 3F44A 3CJKA 3QIPB 2C2ZB 4WFYA 3M6UA 5ETNA 3ZZ0A 1P9QC 3EVMA 2QLFB 5DQHA 2RU3A 1SKSA 3KTQA 3BZQA 2FHMA 4TYAA 3OXLA 1JLAB 3CD6S 4UTGA 2G0JA 4ZLJA 2UUCF 1RWOB 2NXCA 4TY9A 1FERA 1RU1A 5ETVA 3LW5C 3QBCA 4ECRA 1BWEA 2KU7A 1RI7A 2Q1LA 1YWXA 4DR5J 3LP2A 2VPYB 3D6HB 2XCPA 1N5SA 1DQ9A 4NLQA 5EN1A 2EK1A 2VD3A 3W60A 4B9TA 1VQ5S 4HT7A 1HPZA 1IR2A 2HS0A 4Y2CA
chains in the Genus database with same CATH topology
1NKBA 4V19X 4B08A 3E51A 5CXTA 4B3MF 3U02A 1IM4A 5DETA 4ZLPA 3DOLB 4RW8A 3K5NA 3DRRA 2Q6CA 3ZC4A 3R1HA 3RB0A 3EX7B 1HMVA 3NL0A 2WONA 3VF0B 2OPPA 3HDSA 2HNZB 3SCIE 4JI5F 5MLCV 3QGPA 2J7KA 4Y28C 5LMUF 4LFCF 1NKCA 1XMOF 4C8OA 2A18A 4P7TA 3IFEA 2HHSA 4Y65A 3MD3A 4QIWD 5DQGA 1SBRA 1RKIA 1JX4A 3QIPA 1M5KC 2A1BA 3UNGC 2ZNYA 2FHKA 4ZMMA 4F3QA 3G6YA 3T3FA 4B3RF 2ILYA 3HFKA 4J9OA 2LKZA 5T41A 1SJQA 1ELOA 2QFJA 3W2VA 2VONA 1YRUA 2LA4A 2XHWA 2N4DA 2L9WA 2CDQA 1FNOA 2EK6A 1R3NA 1H3DA 5G4DA 4Q0BA 1FRJA 4WZQA 1JNZB 2Z4PA 5LT5A 4DS5A 4XK8C 4X4QA 2CPDA 1W2IA 3Q8PB 3FVYA 2EFPA 1VQ7S 2KT5A 2YKNB 1JK9B 2Z0GA 3JSMB 4R0JA 3O6QA 1Q79A 2HAIA 2OFGX 1RISA 3DRPB 4YR0A 2IMWP 2E5GA 4Y34A 3E01A 3K5OA 3R27A 5L1JA 3HZGA 4LJMA 2I5JB 3J80Y 3VR1A 4KV8B 4NL5A 1KFSA 4Q8EA 3VQSA 3F41A 3PRDA 4ECUA 1U47A 2FPHX 2VPWB 2H5EA 2IVYA 4PQAA 4QR2A 4H4KA 1RT7A 2R8GA 2OMOA 2PT0A 4OI4A 3T9ZA 1IBKF 1QAJA 2DNQA 2O1PA 2EFGA 3HHDA 3DRPA 2M70A 3LWLA 2DNLA 2ZNZA 4QR1A 4YMEA 5L8RC 3HVRA 4ZP9A 2JLEA 3MM7A 4CO4A 5EWFA 2KFYA 2XLJA 2YKOA 4O23A 1ZM2A 1HWIA 2OFHX 2RILA 3DRSB 2GO9A 4QR0A 3GFYA 2ASDA 2IM1A 1FTRA 1FF2A 4F02A 3CCVS 1D8ZA 4ZA1A 1IBMF 2YNIA 4U67Q 4TU7A 1UFWA 4QWCA 2Y0SD 3G6VA 3VAHA 3V6JA 3TP2A 4ECTA 2ZZNA 1FEHA 1TV6B 4AXJA 2ZE2A 5H1SV 4C11A 5F8GA 1RYRA 1KQGB 4ECVA 4DG1A 5IXUA 1KONA 1KTQA 4BC7A 3CVKA 2L48A 4NXNF 1Z1ZA 3KK1A 4IOCQ 3H2LA 2A3JA 2DD8S 3AH6A 1EETA 2P9EA 3M2RB 4RW7B 1QUPA 1FKPA 3MWBA 3UCZP 2RJZA 2PDAA 5A0YB 3KHLA 2R2UA 1QVGR 4IKAA 5E5NA 4R8UB 4RW9A 4DL0C 3GMGA 3QJJA 3OVBA 3G8TA 4K4YA 2YNGA 2CQ2A 4QU7A 2LEPA 2KZMA 3DU5A 4DV4F 1C2PA 2N3OA 3DHXA 1FDAA 5KFWA 2UVRA 3O44A 2I38A 2M88A 3PXGa 2XWYA 2E9RX 3DCAA 4B3TF 4DSLA 3MEDB 2DGQA 4DMZA 1FRKA 4DN0A 4C3KA 1Y4ZB 2DCLA 4MAKA 2FJXA 2OPSB 2K7JA 5I3PA 3CGIA 3MM5B 3PVXA 2CKWA 4KBIA 4LF8F 2R7SA 1SIWB 1IKXA 4NCBA 4RW4A 1RAJA 3G96A 4PXBA 1WTFA 3RB3A 3EGZA 4GMKA 3H20A 2HNDA 4K5RA 5K8OA 4PKDB 1JJHA 3A8EA 4LVOP 4H54A 2HHWA 4C2MA 3K7RA 5CYMA 1TV6A 1UVMA 2R4FA 3IA0A 4G6VB 2LU2A 5K9FA 1Q16B 4NLXA 3MTJA 2B4PA 5KFZA 2GW8A 2ZH9A 4CTAA 1FXRA 4H4OB 2MZRA 1WELA 1YTYA 1KLMA 5M2RA 4A8YA 1C0UB 2H9ZA 4K4WA 2QLXA 1K0VA 3TYTA 2MJUA 2JOQA 3DYAA 3OFGA 4OZNA 2UUBF 2LLZA 4ED3A 5EWGA 4FS1A 1TKDA 4O4RA 3J7YI 4DLEA 4MJKA 4F4KA 3H5XA 5F8HA 1GT8A 4PXDA 1KLMB 4HL9A 3MUVP 2MY8A 2ASLA 2GIRA 3FGVA 4QIVA 2VBXA 2G9OA 4PR6A 3WC0A 1X4BA 2FJBB 2HLUA 3Q22A 5LMNF 1VQMS 3CC2S 4RNNA 4AYBD 4DOZA 2F8MA 2IM3A 3BR8A 5CA5A 3SV4A 5B7WA 3TA1A 1HD1A 1N48A 4RKUC 2NQPA 3G86A 4TNOA 4WXOA 4MIWA 5GAHI 4G3IA 2HLTA 4TY8A 1LKZA 3TVKA 3OR1A 1VC0A 3K5PA 2CPZA 2NUUG 4WKRA 2YY3A 2W8KA 3LP1A 2E66A 1U2FA 4N8NA 1FDDA 3KWMA 2DNYA 1J2VA 2FJAB 2HGNA 1U6ZA 3IWNC 5K8PA 4M94A 1NO8A 1QAXA 4IG0A 4WYWA 1LW2B 1YJRA 1RTJB 3GILA 1H2TZ 4TKTA 4H4OA 1U49A 2J0WA 2M4MA 3MGJA 2BYCA 3RRKA 4ERDA 2HFOA 2CQ4A 5BR8F 1KHWA 3H5UA 2JFKA 1QE1A 3MAQA 4LF6F 2J76E 1S6UA 2DCUB 3I87A 3BSNA 4KGKA 3MMBA 3JSMA 1NEEA 2EFQA 5IT9Y 3NBPB 3Q0AA 2B9XA 4USHA 2F9JA 1JMTA 2ZD1A 2J7UA 4U9RA 3CCES 3MMCB 1VQPS 2FJDB 3TA0A 1LK7A 2DJWA 2VKRA 1KOOA 4O0IA 3KYLA 2DNMA 2MZSA 2DR8A 2Q79A 4JOUA 3OLBA 3CCLS 4OLPA 1DQAA 2VL1A 2DPIA 2BANA 4FF2A 1QY7A 4FP9A 1U1KA 1H0HB 4DR2F 2WOMA 3OXGA 4ZHRB 1D8YA 1VQOS 4LSLA 2DNGA 1HNVB 2AGQA 3DLKA 4WFZA 5K14A 3D1QA 1WTBA 2EFNA 3H5YA 4FXVA 1IN0A 4QIFA 4Q2MA 2N7YA 4F4XA 1Y7PA 4TLRA 3HZEA 1MMDA 1WI8A 4IFVB 1KQSR 4DLGA 2M3DA 3V6DA 1I94F 5A8RA 1UETA 5KG6A 4BCAA 5HMXA 3UDLA 3K59A 2KXFA 2X1BA 3QMQA 1RT6B 3M2VB 2D3ZA 4DL3A 1S72S 4AL5A 3JYTA 2C22A 1LWCB 2CPYA 4N5SA 1IJFB 5J2QA 1VGYA 5F8MA 4PG4A 1S0OA 2ACYA 1CPZA 2KO1A 2E1AA 1FKPB 1AXQA 4M5DA 1HL6A 4NLYA 5BYSA 1KC8T 1CQNA 4WU3A 4TXSA 3M9MB 1RT3A 1IKVA 1KSPA 3UD4P 5F8IA 1KHVA 2FHJA 1YIJS 3V2UC 2QA2A 3P49B 4BDPA 1VI7A 4BS2A 4FVMA 2HRYA 1ZM3A 4NZ7A 2KH9A 3DM2B 1ROFA 2YWKA 2GQ2A 1L3KA 3G8QA 3QZ8A 2PO4A 3I5BA 3M8QB 5JUMA 1V9OA 3P3DA 4EGLA 3NGKA 3PX4A 2PSZA 4RBVA 1FDNA 1M5OC 4CNZA 2B51A 4ZS6A 1H7XA 1JB0C 2R2TA 5KFHA 1FKOA 2IBOA 3M32A 4FN5A 2NS1B 2ZM6F 3Q8RB 3HKWA 2E7WA 2VQEF 5DQIA 4YR3A 2BM0A 5SZTA 1KVJA 3KG0A 2AX1A 4QCLA 1HWJA 2LDIA 1HA1A 2I8EA 2KHCA 4ECXA 2R8KA 2CVIA 2KB2A 2ZH3A 3KG1A 1UKUA 4WXWA 2GMLA 2X1AA 3GB0A 4DR3F 3M4XA 4X4NA 1SQEA 2IM2A 3VWSA 3CDAA 5D77A 2POKA 3N0VA 4PQUB 3TAPA 5GADI 3LANA 2J6UA 4C8MA 3TAQA 4NA2A 2BQUA 4DQSA 2HVZA 4ILMA 3F56A 1FO1A 3OTOF 1R6YA 3V81A 1U6FA 4ZPTR 3VAMA 3MHYA 3SCLE 1V3SA 1V3ZA 3BQ1A 2RQ4A 2Q6BA 3FRZA 3K8WA 2I5JA 3IR6B 4UY8T 2VOOA 4ECQA 2FGCA 5KFOA 5B08A 2RE1A 3MEGA 2MXYA 4O3SA 2WCXA 4HH0A 4NLRA 4YB7A 1S1TA 3DOMA 3FNNA 3LP2B 2HHUA 4O4GA 1WD6A 1AFIA 4B9MA 2IYIA 3J7YU 4B9UA 4IH6A 3OR1B 1W2BR 2RKIB 3CO9A 3JSYA 3MM5A 2KHDA 3JTOA 4I64A 3MM9B 4B9LA 1NH7A 3B78A 2VBYA 1U48A 3TOQA 4LF7F 1Q81T 3MEGB 2RIJA 3HI9A 1RP5A 3CE8A 3GR1A 3KKFA 4CO3A 2ALZA 2DHAA 4N41A