3ZZYA

Crystal structure of a raver1 pri3 peptide in complex with polypyrimidine tract binding protein rrm2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
QSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
publication title Crystallographic Analysis of Polypyrimidine Tract-Binding Protein-Raver1 Interactions Involved in Regulation of Alternative Splicing.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3zzyA00
1VQ6S 1VQOS 3UE2A 2X1FA 1VQ5S 2KG1A 1FJCA 2MJNA 3H2UB 1HA1A 1WG5A 5DDQC 2DB1A 1X4CA 1VQLS 1B7FA 2DNPA 3R1HA 2AYEA 4QQBA 2VOOA 1UFWA 3R27A 5GMKa 3L3CA 5ITHA 1PO6A 3CC4S 2RNEA 1U6BA 4V19X 2CPZA 2JWNA 1JJ4A 3TP2A 2M4MA 1ZZFA 2CQPA 1H6KX 4FXVA 2EK1A 1X4AA 3VALA 1U1PA 2ADCA 1BY9A 2MXYA 4EGLA 1WHWA 1M5PC 5GAEU 1WEYA 3P49B 1HD0A 1R8PA 5CYJA 2KXFA 3TO8A 2M2BA 3VF0B 2MSSA 2CQBA 2CPYA 5LXRA 5IM0B 1DZ5A 2MSTA 2LXIA 2XNQA 2RVJA 3RW7A 3SXLA 2F9JA 1PGZA 2HGLA 4CH1A 3CUNA 4WFAQ 2KXHA 3G96A 1YI2S 2CPHA 1VQMS 2MKIA 2HGMA 2DH9A 1SJ3P 2OIHA 3CD6S 2DISA 1WG1A 2QEXS 3K0JA 1SJFA 1X5PA 2KM8B 1P27B 2MQPA 3CTRA 1O0PA 4TU7A 2GO9A 2MZRA 3S01A 1YIJS 2KM8C 1A7GE 2DH8A 1U1OA 3NNCA 5DDRC 5LXYA 1QM9A 2RS2A 1Q7YT 1Q82T 3UD3P 2M8DB 4TU8A 3P6YC 2HYIB 3NS5A 1VQKS 2HGNA 4IO9Q 3CC2S 5CA5A 4CH0S 2PE8A 2DNYA 4PKDB 1XN9A 2MKSA 1U1NA 2DGWA 2O3DA 2XS7A 2DGSA 3CCUS 4WKRA 5GVQA 2KYXA 5DM6Q 3UD4P 2LMIA 2D9PA 4W90B 4PRFA 2K3KA 3CCES 2XS2A 3HHNB 1HD1A 5GADU 2LEAA 2B0GA 2KN4A 3B4MA 3G6ES 4J5OA 2MQOA 4WFBQ 2V94A 2JX2A 2LCWA 3N9UC 1ZH5A 2XNRA 2A3JA 1M5VC 4M5DB 3PIPQ 3I56S 2CPXA 4CQ1A 1QVFR 1WF2A 2MJUA 1FHTA 2DGTA 2CQ0A 4F26A 3FEXB 2J0QD 3D2WA 2DIVA 3EGZA 2MKKA 2AYBA 5H1SV 1U6FA 2N3OA 3VAJA 3IWNC 2KXNB 1VQPS 1WEXA 3OW2R 4P6QA 4YUDA 4QPTA 1K73T 3CC7S 4WCEQ 1U1MA 3SDEB 1U2FA 1WI8A 2M52A 2Q79A 5DETA 2F9DA 3BO2A 5GAHU 2KU7A 2M8HA 1M5KC 1R8HA 1WEZA 3CCMS 3CMES 2MY8A 2KFYA 5FJ4A 3H2VE 2FPHX 3VAMA 1U1KA 3FEYB 3THTA 1JMTA 1OPIA 1SJRA 1X4DA 3B4DA 1DRZA 1NJIT 2LKZA 4BS2A 2RRAA 3S7RA 5IQQA 5D77A 2KG0A 2LECA 3NNAA 4PR6A 2YKAA 2UP1A 2EK6A 3DLLQ 3US5A 2MYFA 4OZ0A 2MMYA 1YJWS 2MY7A 3MDFA 2VONA 2SXLA 1D8ZA 2OJ3A 3THPA 2YH1A 2RT3A 1F9FA 2MQNA 2DNKA 1AUDA 2HZCA 2LA6A 2MPUA 4LJMA 2DNGA 2DO4A 2PEHA 1H2VZ 5LSOA 2FY1A 5BJRA 2OTJS 3MURP 2I2YA 5EN1A 3J7ZT 3IRWP 3BO4A 1KD1T 2JVRA 4IOCQ 2DHSA 2NLWA 3U1LA 2CQIA 2DHAA 2XSFA 2ERRA 1H2TZ 2FHOB 1VQ8S 1FNXH 1L3KA 2DGVA 2YTCA 2X1BA 2E5JA 2ZJRQ 1S79A 2KH9A 1H2UX 4C0OC 5HO4A 2CQ1A 2WBRA 4Y0FA 1YWXA 3EX7B 1YJ9S 2BZ2A 1FXLA 2YH0A 2U1AA 4C4WA 1WELA 3BO3A 4QU6A 4CIOA 1JJHA 3CXCR 2X1AA 3MD1A 2DGOA 1URNA 1U1RA 1JJ2R 2CPJA 2CPIA 1VQ7S 2GHPA 2M0GB 2CQHA 3U1MA 2L9WA 4ED5A 1WF1A 4UY8T 4IOAQ 1WHVA 2DNRA 1DBDA 5DDOC 2N7CA 2RRBA 3CCSS 4YOEA 2DNHA 4OZ1A 2MZQA 5LSLA 1X5OA 2FC9A 3MXHP 3UCUP 1RK8A 3BEGB 1KC8T 5MLCV 1VC5A 2MHNA 1YTYA 1KOHA 2MZJA 1K9MT 2CJKA 3VAFA 1SJ4P 2J0SD 5IFMA 3UWTA 2MGZA 1VQ9S 2EVZA 1VBZA 1OIAA 2K8GA 2CQ3A 5IM0A 2AYMA 3VAGA 1FJEB 2DNOA 3ZZYA 5CXTA 3UCGA 1SJQA 1VBYA 3J7YU 2ZJQQ 2RUGA 5D78A 3VAHA 3VAKA 2LYVA 1S72S 1WHYA 1N52B 3PIOQ 1ZZNA 1WTBA 1NU4A 2JVOA 2M88A 3P5TL 1X4BA 2QFJA 1U1LA 2MQQA 1WWHA 4F02A 4LIRA 2CQCA 3JB9k 1WHXA 2G0CA 1WG4A 1VQNS 2J8AA 2CPEA 3Q2SC 4A8XA 5DDPC 4FXWA 1RKJA 1X5TA 1X4GA 2RQCA 2BOPA 1G2EA 3UCZP 3G4SS 1QVGR 1N8RT 1X4EA 2JRSA 2MKCA 2D9OA 4LMZA 2OTLS 3G8SA 4QU7A 3G8TA 1FO1A 5LJ3Y 2DNMA 1YITS 1M5OC 1X4HA 3EGNA 1W2BR 2MQMA 2N3LA 2E5GA 2U2FA 4UQTA 5GAGU 3CPWR 2ZJPQ 3P3DA 1Q86T 2KHCA 2M9KA 1P1TA 2DO0A 3MUTP 3S6EA 1YJNS 2NZ4A 2DNQA 1X0FA 1OWXA 4Z2XA 2N82B 3CULA 4WFNQ 3CCQS 2D3OR 1CVJA 2KRBA 3MUVP 2MKJA 1M90T 2M7SA 2G1DA 2X1GA 3LQVA 2MGZB 3DXBA 1IQTA 2E5IA 1U1QA 2CQDA 4Y00A 2MZTA 3RW6A 2MB0B 1UW4A 2MQLA 2CPFA 2M70A 4RU2A 2YWKA 2VODA 2XS5A 3NNHA 3NS6A 2XB2D 3G9CA 1HL6A 2QA4S 2E44A 2DHXA 3SMZA 1FJ7A 1WI6A 4WF9Q 4IUFA 1UP1A 3SDEA 1OO0B 1VC6A 1UAWA 1VC0A 1KQSR 2G4BA 2KT5A 3MI7X 2CPDA 5JVHQ 3CCVS 2KI2A 3CF5Q 2LEBA 2DIUA 5JVGQ 4TU9A 1K8AT 4ZKAA 2F3JA 2L08A 2DITA 2LA4A 2DH7A 2MKHA 4U67Q 2L41A 1VBXA 4WIIA 3TYTA 1KOOA 2OSRA 4ERDA 2AYGA 2MZSA 3BS9A 3MD3A 2RQ4A 3S8SA 1YHQS 4W92B 3R1LA 4YB1P 2DHGA 3MUMP 2VOPA 2CQ2A 3LPYA 3NMRA 3CMAS 2DNZA 3VAIA 3CCRS 1Q81T 1NO8A 2CQGA 2DGQA 1DHMA 1N88A 3V4MA 2DK2A 1VQ4S 3G71S 1X5SA 2LQ5A 2AD9A 2RU3A 1A9NB 1D9AA 2DGUA 5DM7Q 3Q2TC 4F25A 2DGXA 1SXLA 2DNLA 2KVIA 3HI9A 3MOJB 5HL7Q 2I38A 2LXUA 3ULHA 1WF0A 5LJ5Y 2E5HA 2HVZA 2J76E 1M1KT 2ADBA 3I55S 2MZ1A 2RS8A 3CCLS 2OSQA 2KRRA 2CQ4A 3CCJS 2FC8A 2DNNA 1X4FA 4TLQA 1FT8A 4C7QA 1N54B 3ZZZA
chains in the Genus database with same CATH superfamily
1QTNB 2HHTA 3PKYA 1JQGA 1NK5A 3CDWA 5F3ZA 1AFJA 2DNPA 5A6WA 1LXNA 1N48A 1P6TA 3QT7A 2V9KA 1T11A 2VOOA 3L3CA 5ITHA 1JLCB 4WYLA 3V4IA 2CQPA 1XQIA 3UR3C 3CD7A 1ACMB 3DOMA 4ANCA 1WEYA 3QT5A 4XDCA 2HS3A 3WHIA 1VRQC 5LXRA 2QC3A 2HWIA 2Y1RI 4BCAA 1U0HA 1NB2A 4CH1A 2V4QA 2Z2YB 3MTJA 1RWMB 1WG1A 1TAQA 2KM8B 1T0TV 4QR2A 4U8VA 1NK7A 1K1SA 1SQGA 4JI5F 4K4XA 3QJPA 2XO6A 2RS2A 3VWSA 3PCOB 1C1CB 1EAYC 4N76A 3IFEA 3CO0P 5C7PA 3IM9A 5K8MA 4RUHA 3POTB 4FF3A 1VHIA 3DRXA 1EHWA 2ZM6J 1R3NA 2LEAA 3KYLA 4DMZA 3OL6A 4R25A 5HQ8A 1RT1A 2A3JA 1HI8A 4UQGA 3M9OB 3LW5C 2CQ0A 3TVYA 1FFWB 2J0XA 1ZPVA 3ENAA 3VGTA 3R5DA 3SDEB 3PW5A 3BO2A 4CLTA 1CLFA 1SKRA 2LVWA 3M4XA 5J2QA 4B9SA 3FZ2A 2GJIA 3EICA 2RDIA 2GAGC 3THTA 4XO0A 2BR0A 3RAMA 1ZAXA 2ZE2B 3L7OA 4QIWD 3HDSA 2VUGA 3AOAA 1XERA 1NPPA 2CJQA 3P4UB 2G2YA 3R5GA 1UZHA 4B3TF 3I32A 2DO4A 5LSOA 4Q5VA 3J7ZT 2DPJA 2CQIA 2ERRA 1VQ8S 1P8GA 2EWHA 5KOXA 1JKHA 2DCUB 4A48A 4NLRA 2BZ2A 2U1AA 3LAKA 2VU5A 3HHLB 1MNEA 1HNIB 2HLTA 3BH7B 4CLZA 2AZ3A 1TK0A 4OYAA 1U8SA 4LT6A 4K50A 2DNHA 5B0CA 2FC9A 2RE1A 4DV6F 5GAGI 4JP8A 2OPQA 4KPYA 2CJKA 2LQJA 3OUYA 2IMOA 3NLCA 2IJNA 2RDDA 2UXDF 3CEDA 4M5LA 1RHRB 2HRTA 3EE3A 3UCGA 2ZJQQ 2VDHA 4ELVA 1QAIA 3VAHA 2M88A 4ALZA 1SBRA 3VQSA 3V6DA 5KAKA 1RWPB 4FXWA 2V4JA 4CWBA 1RTIA 1JNZB 1QE1B 2MKYA 2MQMA 2JEGA 2G2OA 2ZJPQ 5KFOA 2KHCA 3K2YA 1X0FA 3F44A 3FBEA 1RE1B 2MKJA 1TUWA 4NL5A 2EG2A 5HQLA 2GV1A 2YKOA 2DY1A 1T9TA 4B3RF 1URRA 2M70A 4PABA 1GMWA 1J27A 1MROB 5DG7A 3OL7A 1J2VA 2KT3A 3T6BA 5J1EA 1HHTP 3NGRA 1WOSA 3CNQP 3PYEA 3U7JA 2L41A 2RU9A 4RW4B 3VVTA 3GSIA 5CD4H 1IXKA 2IM2A 3BS9A 4N8OA 4M5IA 2IIHA 4X4NA 1MMDA 4DL0C 1CJTB 2CQ2A 1HARA 4IOBA 4KV8B 2GAHC 1CJVB 4B08A 1M1KT 1LEOA 4X4TA 1HNVB 2MQ8A 3R7SB 4ETXA 2OPSB 1YJ7A 4DV3F 3BR8A 1E6VB 5D0GA 1U2RA 1K0VA 3RAXA 4OX6A 2F1FA 2BJ3A 3J81Y 1RHQB 2YQ0A 4N47A 2JL9A 2IRUA 4H54A 1N36F 2AEFA 1M5SA 2W9CA 3CC4S 1HPZA 4DR4F 1VIOA 5H9EJ 3M7VA 1ZS6A 3CDEA 2VIHA 1ZTTA 4I1TA 2FVCA 2AJFE 4EU0A 3HVAA 1ITPA 1UPPA 4NLPA 5CYJA 3EVMA 1NK8A 3MR3A 2GIRA 3OLBA 2ASLA 2JZ5A 3G6YA 5HROA 3BDPA 5D0RA 3SXLA 2JLGA 4P2XA 1HMVB 2C2MB 3D3CJ 2NCKL 1SJ3P 1RA7A 1KSPA 2PEBA 3G86A 2ASJA 1SH2A 3IGNA 3RR8A 4C0BA 4R8UB 3TVKA 1CULB 1G3OA 1YK9A 3CJKA 4WK3A 3W7BA 1TV6A 4FYDA 3KLHA 4ZN3A 3EVWA 4GKKJ 5KG0A 3BN4A 4PCQA 5F0UA 3KLIA 2YX4A 1KDNA 3CCES 1UZDA 2ROGA 3ILOA 2BDPA 4TVAB 3QSYB 5ETMA 2EFOA 3A8IA 1ICEB 2CG4A 1FNOA 1MW7A 3EGZA 4NCAA 1WACA 3DU6A 2NSBA 3MAAA 3BYPA 4OX7A 3D28A 3VCDA 2FVRA 4KYZA 3DRSB 2VFRA 4DU8A 1B0VA 3FEYB 2CJYB 2W1BA 3CDBA 4BS2A 2R9LA 1Y11A 3BB5A 4S0MA 4FF4A 4KGVB 3NAIA 1TKDA 4ZJOA 1BHNA 5KG7A 2MY7A 4LR7A 1D9DA 2Z8QA 4H4OA 2AHOB 3LP2B 2PEHA 1IKXB 2FY1A 1JJCB 1KD1T 2GIQA 1F5BA 4DFMA 4KQZA 2LXFA 2F7VA 4QBUA 4X4UA 2Q43A 5HO4A 1G1XA 3W2VB 2YH0A 2B9WA 3GQCA 3CXCR 5A8RB 2BOAA 1U1RA 3DKDA 2FZCB 4KHRA 3KLGA 1I1GA 1FNMA 1UFKA 2FTRA 2RRBA 4JYAJ 1RWVB 1RCOB 1NJXA 1VC5A 5FDLB 2MHNA 1S0MA 4F4AA 4DI6A 1KRPA 2ROPA 2AYMA 4HHHA 3M32A 1VBYA 2E5LF 3PY8A 3HM9A 4LIWA 3BH6B 2MQQA 1NH8A 2CQCA 3KLEB 5F41A 1VQNS 5KFBA 4Q8FA 2J8AA 4C8KA 3GV8B 1CG2A 1BC6A 2C42A 1HBOA 5F3TA 3RU0A 3G8SA 4ID5A 5CCMA 4A8OA 3RB6A 2N3LA 2GHVC 2FLLA 3MR7A 3A13A 3P3DA 2UUAJ 2PFDA 2NZ4A 2VBWA 3CCQS 5F8NA 2F8EX 3JSYA 5BYQA 1WTFA 1F5CA 3K8VA 3OLAA 1MWZA 2HNYA 2A1BA 1YZ6A 2P9EA 3I96A 4CYUB 3I0RB 2MB0B 4AXJA 1TL1A 4KHPJ 2C2RA 4Z7CA 1EP4B 1FD8A 3SDEA 3O44A 4I6YA 1F1BB 2G0IA 3MMAB 3NAHA 1JLAB 2W2PP 1OY9A 3EPGA 1FKAF 4RKUC 2Z58B 5EWGA 3OBIA 2ZE2A 2E7WA 2B51A 1YKWA 4U7UK 4LQ9A 4NMXA 2FD2A 1YHQS 4FYWB 4USHA 3CCRS 1Q81T 4J9QA 1QLNA 2ZNZA 1V3RA 4F4YA 2DGXA 3MOJB 2E5HA 4DR4J 3CCLS 3TA1A 3QRRA 2IFXA 4GC6A 2AWZA 4GKJJ 4LF8J 1RABB 3W9IA 2ZH4A 5E3AA 1GMWD 3TX0A 2HFSA 4GMKA 4HTJA 2V0NA 1X4CA 3KUHA 1S9GA 1B70B 1Y4ZB 4Y28C 1HNIA 4RWWA 4DL7A 3NMAA 3NWGA 1PO6A 1IJEB 1LV5A 4DS4A 3KJVB 2XZTB 4NXNJ 2M4MA 4C11B 5LMUJ 1WSVA 1S59A 5LMNF 4ED8A 3TUPA 3N5FA 4JI2F 5CYQB 2GGPA 1NLKL 4OJ3A 4KKOA 4OYWA 1VMBA 3DOLB 1ELOA 3BGUA 3DLEB 3VF0B 2OPPB 4I7FB 2FJDB 2XNQA 2RVJA 2LDYA 1NSPA 2FGOA 3NGDA 4P75A 1PGZA 3VVUA 1NK6A 3B6BA 3TRGA 5ETLA 1GNKA 4F4ZA 3RB3A 1CQNA 1GX6A 2EW9A 1C0TB 2J7KA 4ZA1A 5IWAF 1FXRA 4J9VA 3NNCA 1RT6B 4J9KA 3D0HE 3PO5A 5CZXA 3O3LA 4HHJA 4MKAA 3G82B 3DRPB 5K9FA 3C19A 4IO9Q 4OYBA 1DAXA 3TR5A 4JI6F 4FS2A 2LMIA 1IBCB 3HHNB 2QYGA 5GADU 1XNQF 2B0GA 1S77D 4G65A 4OYXA 4GO5X 2R7QA 3H5SA 4FP9A 3FSXA 1TQLA 3N5BA 4NYZA 3SSQA 2J5AA 5CAAA 3I56S 4N8NA 2DGTA 3FDSA 3UNYA 3M1VA 4WWSA 4JBCA 3C16B 2VASA 4YUDA 4LFCF 1CSJA 1K73T 2E9RX 2B56A 2YKMA 1RTHB 3TA0A 5HJYA 4KO0A 4RNOA 2WVCA 2ZZNA 5FJ4A 2XY5A 1KQFB 8ATCB 1NHUA 3DU5A 4RW4A 1JLGB 4A8YA 3B4DA 4K7QA 1DARA 4IG3B 2PFFB 1FRMA 1UWBB 2QFIA 1CJTA 1REGX 4OI1A 1Q5YA 2V34A 5ADZA 3DMJB 3RRKA 3A1YG 1F9FA 1XMOJ 1LKZA 2MQNA 2EBGA 2YBVA 4YDDB 1RAJA 3BPSP 3L4BC 3BN7A 1I94F 1RTJB 5K20B 4RUBA 3KFWX 2GJFA 5F8IA 2YQ1A 2IMWP 2Q66A 1YJ9S 4OV6A 1BQNA 2WB1D 3UDVA 1K47A 3I87A 2IYIA 4OZ5A 2CPJA 4FF1A 2YKPA 1F6TA 3U1MA 2VG5B 3H59A 3VGSA 3MXHP 4CO3A 4IYQA 1VBZA 2GIFA 4PG6A 1SC3B 3WQPA 4ECWA 3ILIA 5HANA 3PIOQ 1Z2LA 4X64J 4K59A 3P5TL 3NG8A 3Q24A 5F8GA 2YKNB 4F02A 2B5JB 1HWLA 5C24B 3R5AA 1M1GA 2CPEA 5M2UA 2D3O1 2AW0A 4R8UA 2KL8A 1CULA 2D9OA 4P74A 4CM0A 1PC5A 1YITS 4IRKA 2YWWA 1LXJA 2IA0A 3RBEA 3NOCA 4XIUA 3UN2A 1XR5A 4DEZA 1OWXA 4Y2CA 4ZOSA 4DR7J 1CVJA 1S1TB 1IBMJ 3PW7A 2IM3A 2WSEC 1HR0F 3TEGA 4WP9A 1WDTA 3JS9A 1TU0B 2YXLA 5T7LA 1G7CB 2F4VF 5I4MA 1HWKA 3KK1A 3ZZOA 4LSNB 3VZIA 2ZHOA 1U4BA 3LWMA 3DRSA 1I5OB 2GC8A 1S7HA 2KI2A 3NY0A 1KVJA 2J9DA 2OD6A 3PYDA 3MM7B 2ATCB 3N0VA 2QA1A 1RT4A 3MGJA 3PW0A 4F2SA 4DUZF 2VC0A 3OD2A 1N32F 2DNZA 3KNGA 3IBCB 1A9NB 3H8YA 4CLLA 3HI9A 5E41A 2XY6A 3ULHA 2FZGB 2OSQA 2VBXA 4X65F 4AFFA 3BBBA 3IRXA 3GFXA 4ES2A 2GMLA 2HHUA 1MN9A 4I2PB 1VQLS 4DV4J 5A8RA 3AD7C 4JI4F 1RAAB 4CZCA 1ZZFA 4B9UA 4ITSA 3I5CA 5AXNA 3W5ZA 5HP1B 3CD5A 3JSRA 2FZKB 4K2JA 3KLFB 4ECRA 2KXFA 5D8HB 2DY9A 2CQBA 4P2MA 5IM0B 4NI2A 2Y1LB 2ZUAA 1HBMB 3CUNA 4WFAQ 3ZZ0A 2FVSA 2BXJA 2OIHA 4JV5F 1CJUB 3UO0A 3KLEA 4JI6J 1REVB 3JXOA 4OMFG 5KTQA 1S1UA 1NKBA 2V8GA 2BM0A 4EFAC 4TU7A 4OI3A 3ZZTA 2KM8C 2IC3A 1U47A 1U1OA 5DDRC 2M8DB 4TU8A 2CWXA 4IR1A 3ZZRA 4QW9A 4AE5A 4KRWA 3HHLD 3LUYA 3MECA 4QIFA 2KYXA 4NYPA 5DM6Q 1S6UA 2YWGA 4DV1J 4CT9A 3O2IA 1YRUA 3MF5A 4J5OA 2VG6A 4A8WA 4NLSA 2GHWA 3ETMA 1FI4A 2EFNA 4ED2A 3DHWC 1RAGB 3W3SA 4CQ1A 4F26A 3FEXB 3HVWA 2XMTA 4CLSA 4FVCA 4G1QB 4LF7J 1WI8A 3A12A 5F9NA 1IKWB 1LK5A 4P7TA 3RAQA 1FX4A 3EPIA 1XMQJ 2W4CA 5A8WB 1JMTA 1OPIA 4ZPAA 2YY3A 4A8SA 5LM7E 3MEGB 3MEEA 5H9FJ 3GJTB 3JYTB 3HSGA 3R7BB 2CKWA 4ICLA 1NDKA 2YH1A 2XMWA 2QE5A 3QGHA 1FERA 4YHHF 3ENQA 1RAOA 2AJ0A 3MURP 2ZVIA 5EN1A 2JVRA 1L5UA 2OEJA 4DQRA 2B7CB 4DR6F 4F4WA 2B9EA 1RT2B 2AU0A 4DWIA 1WELA 1Q0NA 2BJDA 5DGBA 3TJAA 4NX9A 5ETVA 1F2HA 2WSFC 4CLKA 4JOUA 3HHLC 3CJ3A 3T5KA 2C2KB 1M1HA 5HLFB 3PFEA 2ZBCA 1FKPB 1RK8A 4ZVOB 2W8KA 4N41A 3C6TB 2VJVA 4I7FA 2YNFB 3ZZUA 4W98A 4YP3A 2DNOA 2QLBB 4FF2A 1SJQA 1U02A 2NZCA 3JTNA 1RQ0A 1C4CA 1LK7A 5DO2A 1VRTB 2QTWA 2QFJA 1MWYA 2GVZA 2YVSA 2I9SA 4J9NA 1X31C 2CADA 3GR1A 3N79A 2OUGA 4OI6A 5A0YA 3FRZA 3BGRB 3M8QA 3OL9A 3G82A 2DNMA 3FC9A 1NJWA 1H74A 4DLEA 4NYOA 3GV7B 5KFHA 3ADAC 4C3KA 3QIDA 4U8YA 3HVRA 3D66A 2D3OR 2W2NP 5AXMA 3PEJA 3C2PA 3GFHA 4DF4A 3I82A 1OYDA 4FZVA 2CQDA 3PTWA 1HFEL 1R8AA 1N33F 2XS5A 3D6HB 2AZ1A 3UD5A 2QA4S 5J2PB 4DFJA 2VQEJ 2KDOA 2HFUA 1TELA 4FKYA 1S0VA 3MI7X 2UXBF 4Q0BB 3GB0A 3KJQB 2FHMA 2Q6CA 1JLGA 7AT1B 4PWWA 4P9SA 2XZDB 3D67A 1VRUB 3MAHA 1X0PA 5DS7A 4DG1A 4X65J 3M8ZA 4ZVUB 2RQ4A 1YJRA 1Y3JA 2IHR1 2FJVA 3SEOA 2VOPA 4LBPA 1D09B 3GP9A 5FD1A 4EZ6A 2FJAB 3BQ0A 2BJ8A 2DNLA 1KP6A 1K44A 3A3PB 2AF6A 2ADBA 4ENOA 3OTDA 1PILA 2YPYA 3RB4A 1Q53A 1V5IB 4LRAA 3SCKE 1ULRA 3CJ4A 3ISND 3PNIA 1FDDA 1U6ZA 1FKOB 1CS4A 3LPEA 1H73A 5GMKa 3BQ1A 4R5PB 3QJJA 1RZMA 2VG5A 3GLJA 3TWZA 4FXVA 5DG8A 1X4AA 3VALA 2HG4A 5JUMA 2MXYA 4FVMA 4C3MA 4EGLA 1WHWA 3IM8A 1M5PC 3TARA 1B0TA 4M5DA 4L3KA 3P49B 3NL0A 1HD0A 3TQ1A 3HVTB 4DV7J 3E2EA 5F8LA 2HW3A 1RISA 5KFRA 4TYAA 3GSDA 1UVMA 4DL6A 3PJWA 2CNKB 3BJYA 1R27B 5IT0A 3G96A 4KFBB 4C8YA 3J7A1 1JK9B 4AQYF 1SJFA 4LSLB 4CO2A 2ROEA 1PBUA 5K14B 1XR7A 4TQSA 1TKXB 3AY0A 1Q82T 3UD3P 4JI8J 3P6YC 3LAMA 4A8KA 2RF2A 4ECSA 5J2NA 5BYRA 4EI2A 2BE7D 1R8BA 4NZ0A 5G0RB 2FJWA 8AT1B 2PI4A 3WBZA 2K3KA 1YDLA 3OFEA 4CO4A 2J9CA 4UF4A 3UN5A 3HHEA 1M5VC 3W9HA 3B54A 1HW9A 2LQ9A 4O3OA 2F63A 3AOBA 4CLUA 3DN9A 4DCJB 1UEKA 1FVSA 4USMA 2MKKA 1U6FA 3HFZB 2X3DA 1HIYA 3MEDB 3ISNC 5HBMB 2EC2A 4YB7A 3Q8RB 3M9MB 3SV3A 2KFYA 3H2VE 3MM7A 1RYSA 3MEKA 5KT6A 3JQMA 2XCPA 3W61A 3AXMA 1MLAA 5DG9A 1QSSA 5IQQA 5D77A 3BPDA 2VL1A 2WTFA 2IJRA 3M8SA 5A6PA 4DR6J 2VONA 4LR8A 3FNNA 5KFNA 2KZZA 3AODA 4DV0J 4DUTA 4EBDA 2AJ1A 1UL3A 3PRVA 5BJRA 3MM9B 4OLOA 2XSFA 3CCZA 3M2RB 2QRRA 1E6YB 3DOKB 2X1BA 3HHKA 5C25B 3D6FB 4Y0FA 1JLFA 1TKZA 4C4WA 2QLWA 2AT1B 2DGOA 1URNA 4X62J 2Z2MA 1FA0A 2YNGB 3OHAA 1DQ8A 2E66A 2GHPA 2J6UA 1DURA 4WBFA 2JJ4D 3VV2B 4NEYA 3Q86A 1PBAA 3KLFA 3UWTA 2UXCF 4LFAF 3KK3A 5IM0A 1Q4RA 1HBMA 5IC6B 2MLYA 3DFEA 1HQEB 3T1HJ 2CWKA 2UUWA 4NXMJ 1REVA 5GMEA 5D4OA 3MR2A 4KC5A 4DUYF 4CO5A 1Q8BA 1VJWA 1N8RT 1FESA 4NCBA 3DM2B 4DFPA 4O3NA 2DXFA 2GW8A 1R0BG 1FE0A 4UQTA 3PXGa 5GAGU 2DO0A 3S6EA 2W8LA 4Z2XA 3J81j 4USTA 5HVGA 2H4WB 2HK2A 1RTDA 5KG4A 2UXBJ 1N6QB 3KJNB 2WW4A 5GADI 1F2GA 2EEYA 1AZSB 2JH3A 4MT1A 1H7XA 1NZAA 3R3TA 5D0HA 3KG4A 2BM1A 2QMWA 2RQMA 3OTOJ 2H3EB 3K5MA 4F4XA 1IBLJ 4ZKAA 3IMQJ 2GVDB 2HBYB 2DH7A 1RWNB 4LF5J 2OSRA 3MEGA 4ZCLA 2VHGA 2AYGA 2Y0BB 1JLQB 3JYTA 3S8SA 3IN5A 2VFSA 3NP5A 4CTAB 4PG8A 1NO8A 1VYAA 2PC6A 1NSAA 1IBKJ 3OVSA 2XM3A 3R6GB 3TUJC 1QSLA 5KFCA 3EVOA 1PCAA 1WDDA 2KHDA 3AHPA 2DNNA 4NMLA 4H4MB 1R31A 2QL9B 2WONA 5LL6d 1Q8KA 2IA6A 4FBUA 3UFCX 3UE2A 2KG1A 2MJNA 2NS1B 1WG5A 1RT2A 3OR2A 2OEKA 4NA2A 3QBCA 3QIPB 1U6BA 4LF6F 3BBFA 4RW7B 2YNIB 5HN0A 2X7IA 1ZM9A 1SV5B 2YNFA 1CPZA 2V2KA 3PRBA 3FEZA 4FBTA 1RT7B 4PWDB 3BZQA 2D69A 2PDAA 5KFQA 3IWLA 1GT8A 1TVRA 4DXLA 5E2QA 3G6XA 1UJ6A 1O0PA 4MK7A 4XK8C 1T05B 4ZIVA 2O01C 1T02A 1X9SA 4J9SA 4DR3J 4Q45A 2XI3A 4ZN1A 5CA5A 2YWFA 1WKLA 4GVBA 4YB6A 1O51A 1JLEA 5GVQA 3GIMA 2GZOA 3SIPB 3V4IB 4I67A 2W7PA 5KFPA 5A76A 3B4MA 4LF4J 2A10A 4WFBQ 3MFIA 2FHJA 2LCWA 3N9UC 3DOMB 1GTHA 4J9UE 3QMQA 3KTQA 1IM6A 1RAFB 1NB7A 1EB0A 4DQQA 4ID8A 4IFVA 4P6QA 1J5OA 4IRDA 1RJJA 2YQ3A 1U1MA 1S99A 2A18A 1SL2A 1HNZF 4ZPBA 2DR8A 2O67A 2K3IA 3R5JB 4OI4A 5B0FA 4LSZB 3NXZA 2QYCA 1FRLA 1VRUA 3C3LA 3QZ8A 4V1Ak 2RRAA 3PX0A 3QT8A 1S1WA 4PR6A 1JXLA 2MMYA 2ZH8A 4URQU 4A47A 2FQQB 3VGUA 1XNRF 4EWTA 4P73A 3AD9C 1H2VZ 2ACYA 1RT1B 4LBIA 4A8QA 4OX9F 4FPRA 1RBAA 2NXNA 1HLWA 3KMSA 1R0AA 3OT9A 5KFJA 2V8VA 4CIOA 1JJHA 3J80U 1OJ4A 3P8BB 5KFAA 5AE1A 4R0EA 2KVQE 1VQ7S 4ED7A 5J2QB 4A46A 2B4UA 2VA2A 3T6JA 3CCSS 1GX5A 4HACA 5J1NA 5LSLA 1SQFA 1S6PA 2ZH5A 4RW6A 5MLCV 1RADB 1SJ4P 1RWKB 4OHYA 2MGZA 2EVZA 4WZMA 2GMHA 4MYUA 2BANA 1NZ8A 3VAKA 1S72S 4XDDA 1VCTA 2Z2ZA 1IKVA 4YR3A 1Q8IA 3IGVA 1GH8A 3PR4A 3JB9k 1WHXA 5F0WA 2CZVC 4AL5A 3Q2SC 4DSLA 4WE1A 2ZKUA 3OVBA 1TKXA 2P6SA 4QJVA 1C0UA 4CO0A 1JKHB 3QO9A 1FO1A 3VHQA 3D68A 3VR1A 1HW8A 3HKWA 2QMXA 3I5AA 1X60A 1P1LA 4DHVA 3V6JA 2UUCF 3W2WB 2G1DA 2BACA 5L39A 5CQGA 3EXYA 2OPQB 3OUYB 2ZFHA 3ZXWA 1UPMB 5KG1A 2C2NA 3AB4B 1RU1A 4IH7A 4RU2A 4KPCA 4LRFA 4M5MA 1NJZA 1O5JA 4LF2A 3E01A 1WI6A 4WF9Q 2M5YA 3BSOA 3UPFA 3V6DB 4MKYA 3H20A 3SYZA 4QYZK 2NYHA 3AQPA 2V4JB 5G4DA 2ZUGA 3BGOP 1YJUA 2AEJA 4JI3F 4J91A 1IWGA 1RTIB 4NLTA 3ZNJ1 1R89A 4ER8A 1EKRA 4NRUA 3UR0A 3MWBA 4F8RA 2R7UA 4CLWA 2QLFB 2PI5A 3HO1A 4WYWA 2NXJA 4JUZA 2PT0A 2VPYB 4ZLNA 3D0IE 1IN0A 4K0KJ 3AT1B 4OHVA 3M2RA 3A8EA 3CCJS 3RBDA 2VH7A 2DR7A 5C25A 2R2RA 2X1FA 2CDRB 5J1EB 1SPBP 5ETRA 2EFPA 4QQBA 3R27A 4DQPA 3UDCA 2DJWA 2LLZA 2B6AA 2R2SA 3MR5A 4C6AA 3RYLA 1SH3A 4OZ3A 4BWMA 2B4PA 4OHWA 2HFZA 2KJWA 2CNNB 4U95A 2CIMA 4UUWA 2P6TA 3FCHA 3L95X 4RX6A 2CPYA 3BGLA 3PACA 1WC4A 1DZ5A 3DLBA 2R7RA 4E2FB 1Q5VA 3GG1A 1TL7A 3ZO7A 1P27B 2VD3A 2GO9A 3S01A 2Y1JA 1PG5B 1W26A 3KKFA 4X66J 2V8HA 1XWLA 4CH7A 5GAHI 2DTJA 2DR5A 3GYXB 3LWLA 3OJSA 2RRNA 4PG7A 1W2IA 4RZRA 1XN9A 2XS7A 2W9CB 1HPZB 2OO4A 4ZIWA 2JLEA 3Q8VA 3T5HA 1M0SA 5KFXA 3G6ES 1FDNA 2OELA 4LRBA 4LVOP 3ELHA 3P45B 1QVFR 3HFKA 1FRJA 2FHKA 1X9MA 2NXEA 2VJUA 4WCEQ 1KEKA 3OFFA 4DPOA 2M8HA 1WEZA 3Q8SB 2GVDA 2FPHX 1FJGF 4J9LA 3CE8A 1GQEA 1S9EA 3ETOA 2Y9HA 3CJKB 3IS9A 4C2MA 1TV6B 2AGOA 2FJEB 4YN3B 4P7VA 4CTAA 4ZPDA 2A0FB 4RBVA 3K59A 3KHGA 2V63A 1V5VA 3KLIB 3GYNA 1AUDA 2MPUA 2DNGA 2HHQA 2YNHA 3OV7A 2HKEA 3JQKA 2HVEA 4MFBA 4NLXA 5KFUA 1G6BA 2W9BB 3D0GE 3MAAB 3J80Y 3DYAA 2HHPA 3OXFA 1P9YA 2X1AA 4L73A 1J5EJ 4ZP8A 2CFXA 1LW0A 1IQZA 4B3OB 5EGYA 2ILYA 2M0GB 2V9WA 4F50A 4ED5A 1WF1A 5BYSA 4YR2A 2N7CA 3Q89A 3M6UA 1SH0A 4EO6A 1FVQA 3BSCA 3QYYA 1IR2A 4ETZA 1L3VA 1U7LA 1AFIA 1S6QB 3MFHA 3PX6A 2HFOA 2HQFA 1RT7A 4PWDA 2NUHA 4DR5F 4EYHB 1RU2A 2FIUA 3GONA 4H4OB 3ZNUA 2GS8A 2VPWB 2XHWA 4XAKA 3NWRA 1WTBA 2OPRA 1S48A 4MIAA 3ZTSA 1MWQA 1RB0A 3T41A 4QR1A 3KDNA 4KH1B 1HWUA 3DGPA 1U45A 2ILZA 1XTZA 3G8TA 1D9FA 5KG5A 5KFWA 3J81U 4DSIA 3KLGB 2HK3A 4LF9F 1YJNS 4FYYB 2BEFA 4NOHA 4FXDA 3CULA 1NK0A 4HR2A 2C3PA 1GMUA 4ZP9A 2HHHJ 1FEEA 1U1QA 1NXIA 7FD1A 2MZTA 2ZH1A 4JI3J 3ZZPA 3RJMB 3V6KA 3M32B 4EBCA 3F41A 2NXCA 1LWCA 3NS6A 3IAM9 2J7WA 3QZ7A 1AUSL 4MJKA 1N56A 5B7WA 1H0HB 1UFLA 2XGQA 1K8AT 2F3JA 5I3UA 1HBOB 4IG0B 2WW8A 4ERDA 5RUBA 4ID5B 3FKBA 2V8DA 2NPIA 4KGXB 9RUBA 4ECYA 4JI7J 2X3GA 4UTGA 5IQ6A 1XK8A 6FDRA 1X5SA 3R97A 2RU3A 2XWXA 4IH6A 2D3UA 5AXLA 5GAEI 4F36A 2HVZA 3DLKA 2MZ1A 4H4KC 2HNYB 1ZOTA 1JIHA 2KRRA 4M5HA 3LP0A 2UU9J 1PC4A 1S49A 1TL1B 4X84A 5HATA 1VQ5S 2WVBA 3H2UB 2IVYA 4Y34A 4RO0A 2AYEA 2VZ9A 1UFWA 3RB0A 3MM8A 4I68A 2JWNA 3TP2A 3PKMA 5I42A 4ANDA 2B9YA 4XPEA 1VGYA 4WK1A 3FMWA 4N5SA 1BY9A 1FDBA 1V3ZA 4NZ6A 1RBLA 3M30A 4K4ZA 1UEVA 4A8MP 1WC0A 3MPYA 3C8YA 1GTEA 2R8IA 4DLGA 4P10A 2WAQD 3QPIA 4HLBA 2QEXS 3K0JA 4MMOA 1DQAA 3CTRA 2BV3A 3GR0A 4MK9A 2VQFJ 2HVHA 2HRYA 4HH0A 1KLNA 2C3UA 4X4OA 2IVFB 4NLVA 2AP6A 1S9GB 4DV5F 2E1AA 3MM6B 1QTMA 1PKUA 1WUUA 4E8UA 4ECZA 4KH0B 2XYPB 3MMCA 3TAMA 4DR2F 4W90B 4PRFA 3W2WA 4J90A 2C28A 4B3MF 3L7UA 5J2MA 4DSFA 3IA0A 4AT1B 2GGPB 2JX2A 1Q78A 1VI7A 4KKOB 4F3MA 1PYTA 4M5NA 1UTAA 2DEJA 5AJ3J 2LEPA 3PHEA 3MMBA 2UVUA 2UUBJ 1BLUA 3TA2A 1CC7A 1RT5B 1IJFB 3IWNC 1SUQA 1WEXA 1LWXA 3L9ZA 2PSZA 3CD0A 1UVNA 4M95A 3MPWA 3H42A 3H0PA 2CG8A 2CVEA 2M3DA 3D1OA 2ZD1B 5F8HA 4EZ9A 3TZZA 4RWXA 3RBXA 1DRZA 2H54B 2CXEA 4K4UA 1HNWF 1T95A 2E1PA 2HNDA 3OXLA 1S4FA 1SQEA 3SI8A 3SFGA 1PYSB 1TL3A 3PG9A 4ILMA 2HZCA 4JV0A 4K4WA 2RILA 4DV2J 2CA9A 5KFEA 2OTJS 5D15A 3U1LA 3EM1A 4PQAA 5A2QU 1YBTA 2R7TA 3UI3A 4USWA 3M1VB 1TZ0A 2YKMB 4QU6A 4C98A 4ZLPA 4KO0B 5KOWA 4MIWA 4CO1A 1WSRA 2O1PA 3Q83A 1OSDA 4IOAQ 4Q44A 4OV1A 5BR8J 3ZFVA 2BYCA 4F0KA 5KT7A 1I51B 3R6LB 1BD6A 4CNYA 4F3OA 2NXUA 1WHYA 1HYSA 3OTBA 3EUNA 2XMAA 2EFGA 1RT3B 3QLHA 3HP6A 1KTQA 2VA3A 3FBBA 4Q7AA 2KKHA 3M6VA 1RI7A 3TUIC 3FSIA 3TEHB 2R7WA 4YB5A 2B4VA 1BQNB 3TUZC 2BJEA 4Y3CA 1HHSA 2HURA 3U1NA 2CRLA 3LP1A 5L1KA 1UVKA 1APSA 1WOPA 2YWHA 2H5EA 1M90T 4ZHRB 5KFSA 2X1GA 4PXBA 5KG3A 1DQ9A 1ZYQA 1V3SA 5CH7B 3LQVA 1N34F 4JI5J 3ISZA 5AT1B 2Q1LA 3NNHA 2Z57B 4JB8B 2J9DE 4F04B 5C2GA 1D1UA 5B0DA 3I9ZA 2VPXB 1HBUB 2BVZA 3OSNA 2IPOB 1UVJA 1KOOA 4DN9A 4IDKA 4J37A 4BBYA 4WIQA 1XEZA 5CCLA 1DJ0A 3VAIA 2GX8A 3V81A 4PXCA 1N88A 3V4MA 5CHCB 2MLXA 1NK9A 1UMJA 2GJ2A 2DGUA 3SV4A 2L9DA 1BE4A 3HMJG 2P9GA 2I38A 5L1LA 3M8RA 1GAOA 2V2VA 1RYRA 2R2UA 3CCTA 3Q0AA 4UOGA 1KHWA 3NBPA 5T7LB 4KTQA 2W9BA 3KK1B 4KR0B 2I5JA 5DDQC 3IG1A 1NKEA 3R5BA 2IDEA 4O23A 3T9ZA 4B3OA 4ECUA 2Z4PA 4B3TJ 3PV8A 3D9BA 2HFVA 2VV5A 5H9EK 4B3SF 1RT4B 3V6HA 2Z0GA 2ADCA 1S6QA 3LO3A 3TX8A 6AT1B 3BBCA 4DX5A 4HHUA 2ASDA 1SKWA 2CDQA 4DV5J 2NUUG 2F9JA 2HGLA 1BMQB 1QD1A 4WFYA 3UQSA 3W5YA 1S12A 6FD1A 5ETSA 4AXIA 1AW0A 3AXKA 2GQCA 2MZRA 2MHEA 1YIJS 4DV6J 2DEIA 3CWJA 1TP7A 3IRXB 2Z2LA 2UXDJ 4NA3A 1RTZA 3AJ2A 2XG8A 5IC4B 2EBEA 2F8MA 3BSAA 2V69A 4KGKA 3W63A 1CBKA 2IAJA 2XS2A 4FNHA 2IDLA 3D4JA 1SB6A 5A8KA 2XNRA 5ETPA 1PAUB 1KWMA 1ZBTA 2OGUA 4NI2B 2BJ1A 2VFTA 2IY5B 2DT9A 3CT9A 2DIVA 2AYBA 5H1SV 1DLOA 4RNMA 3FCVA 1Q16B 2XYGB 4F67A 2DR6A 4PZVA 1N5YB 2E7XA 4QWBA 1S1UB 3ZTOA 3AJ1A 3HSDA 1T8EA 3CCMS 2EC0A 3NKYA 4F0MA 3VAMA 1U1KA 4JI1F 3DLHA 2F4FA 2IC3B 3V5RA 4ZITA 1TAUA 4IG0A 4DDFA 3S7RA 4B3RJ 3I9V9 2V67A 3MECB 1YJWS 1MSWD 1YX2A 4C8MA 2SXLA 1D8ZA 2XI2A 2OJ3A 2XY7A 4PQUA 3C6UB 2LA6A 4M5KA 2VG6B 4WXOA 4RNHA 2XLIA 5KFKA 4DJBA 3IRWP 4X4VA 5A2QY 1H2TZ 2HQCA 1BQMB 4Y2KA 3U27A 2CQ1A 1HQ2A 3C66A 1RWXB 1X8DA 1YGYA 3X3UA 4UOHA 1VQYA 3QAUA 1OPZA 2KFNA 2GQ2A 5DLFA 4FKXA 3H2LA 1S1XA 1Y5NB 3GFZA 1RACB 1X5OA 4OYPA 3UCUP 3PYGA 3MEEB 1YJVA 1F3VA 5IFMA 2ZBIA 4DV3J 3UN3A 2HS4A 3AJDA 3ZZYA 3Q22A 2OKQA 4ICLB 3ZTRA 2HFNA 1N36J 5E5NA 5KFGA 5HSPA 2JVOA 1X4BA 1UA1A 3WC2A 4ZLJA 2ZM6F 3NGSA 2C3YA 3PVXA 1S1VB 2H65B 5DLGA 2FLPA 1XC9A 1EJ7L 3CMQA 4M1KA 2JRSA 5IT9U 2WOMA 3CDAA 4QU7A 5F8MA 5I3QA 1X4HA 4K2XA 3QQCD 1PJ7A 1VLOA 3MM6A 1SCJB 1Q86T 1H3DA 2YX1A 1O8BA 1ZM3A 3KUEA 2COLA 4WFNQ 3MUVP 4YY3F 3W1YC 4A8FA 1JB0C 3EDQB 3OL8A 5KFMA 4Y00A 2WVEA 1QJHA 1UW4A 1RT5A 1NNDA 4USIA 2VICA 3UDEA 3KDOA 2XB2D 4IFYA 2V8PA 2BABA 2JFDA 4JV1A 1OO0B 4CT8A 2GVZB 2CUYA 1WORA 3PZPA 3CCVS 5A0YB 2ZD1A 4DOZA 1KKHA 5M2PA 4L6V3 3CJ2A 2DITA 2QSWA 1VBXA 3M8QB 4WIIA 1YZ7A 3WC0A 2HHSA 5L46A 2W01A 2C2ZB 2JEJA 3B82A 3QJLA 2KO1A 4ECTA 2HRUA 2VG7A 4AL6A 2DGQA 1TL4A 4OJHA 2DK2A 3G71S 2W25A 2KVIA 3JSMA 1HWJA 2QG9B 4OFZA 5L1IA 3I55S 4RW9A 2BRKA 5J1PA 4LRCA 3O1LA 4B3SJ 3DRYA 4OX8A 2FDNA 1FJCA 5JXSA 4YDXA 4MKBA 1ZAWA 1RHMB 5U47A 3DLGA 4PYAA 2V6AA 5AE2A 3LTOA 1R0CB 2GA7A 4CLYA 3GCWP 1JJ4A 2R4FA 1FCAA 3Q8UA 1VOMA 3P96A 2GO8A 1S10A 4O4GB 3JTPA 4DG1B 3J7AN 2FVPA 2V50A 4DPXA 1FWPA 1RXOB 4DCPB 3SCLE 2MSTA 2EG1A 4I0WA 3K5NA 3UW1A 1YLXA 3ONQA 1UWAA 5ETTA 2HGMA 1Y9OA 1RT3A 1FFSB 4FDFA 4HYKA 4OQJA 4QIEA 2PN6A 4FNIA 2Q3PA 1WNEA 3PM9A 4TYBA 3H5YA 1A7GE 2DH8A 3Q8QB 5B0EA 4Y2AA 3RRHA 1LWFB 2XSJA 2E5LJ 1CS4B 2I8EA 5DZ7A 4RUCA 2DGSA 1N5VA 5HAOA 3F56A 1FTRA 1S0OA 4ZHRA 2POKA 4G1IA 1EETA 4M5DB 4DFKA 2C2EA 2K06A 2P8IA 1WF2A 2H1YA 2MJUA 4KB7A 2YKQA 4AUKA 3I0SA 5B0GA 2J0QD 1GEHA 3IBFB 3D2WA 1B99A 1FE4A 3C15A 2WVFA 1T9UA 1HBUA 5HMXA 2ZC3A 1LFPA 5ETKA 3HD2A 4FN5A 4PUOB 1FDAA 1UJ5A 1T9XA 2QZ8A 2K7JA 2LECA 3VQTA 3NNAA 1EKSA 2EFQA 2RF2B 2F40A 4KBIA 2EK6A 3US5A 5J2NB 4OZ0A 4DPTA 1CJKA 1S9FA 1YBAA 2ZKTA 4IR9A 3OR1A 3OJUA 2CYYA 3C14B 3J7YI 2XTJP 3ZTQA 2ZVSA 5LT5A 2ZOFA 1TUGB 4OZ2A 4PXDA 2J8SA 4X4PA 1C1BA 2OEMA 4DN0A 4I64A 3G6VA 2WBRA 1HHQA 2FVQA 2QA4G 4Y6IA 3H90A 1IR0A 4OI0A 3GTYX 3FVYA 1DBDA 3PEHA 4YOEA 1YJTA 4ZVGA 2BA9A 4W4MA 5B08A 4EEYA 3DI6A 1YTYA 2MZJA 4O44A 2J0SD 2VKRA 3W60A 4DU7A 3IWXA 1FJEB 3KG0A 1F60B 2BQ3A 1EQ0A 1NJYA 3SFUA 5D3GA 4GKKF 1NU4A 3LOUA 1WC5A 4LIRA 3GJRB 4M5JA 4WPAA 3KLVA 2IYGA 2FJBB 5LMNJ 1N4LA 1Q7LB 1KQGB 4X4QA 4JI2J 4YY3J 1X4GA 5IT9Y 3GIIA 2MKCA 1QAYA 3LA0A 2AQ4A 1JLFB 1M5OC 4BLGA 4PPDA 1TKZB 3T5JA 2HVIA 3K58A 4G1PA 4TY8B 4UZBA 1A0OB 4USKA 2DNQA 1QAXA 3OSPA 1F3FA 4ZMMA 2V5HG 1VR6A 5KG2A 1N5SA 3NCQA 5IWAJ 1IQTA 3HD1A 3KK3B 3RW6A 4IKAA 2CAJA 2DXDA 3HCXA 2NYIA 1Y7PA 4V19J 1JXVA 1FFGB 2L3MA 4IUFA 1R6YA 1S5ZA 1N5YA 1F0XA 2G13A 1KQSR 2G4BA 1RKIA 2LU1A 4DZ6A 4DPYA 1XNQJ 2KJVA 5C42A 1SC6A 3FQKA 5JMNA 3CO9A 2KFZA 3BREA 3DXSX 2ZOMA 4LQ3A 3H4BA 2NPFA 3HK2A 4P52A 2B4OA 3WZ0A 3ILJA 4FS1A 3MM5A 4LFCJ 5E3QA 5ETOA 1VQ4S 3C6UA 3Q2TC 2ZOGA 2VFVA 2J76E 1RTDB 4JYAF 2WHOA 4E0DA 1FTCA 2ZDPA 1BQMA 2FYXA 4PG4A 1KONA 3AD8C 4P2FA 2C22A 2QL7B 1MU2A 1YVFA 1VQ6S 3Q23A 3SBMA 2RUSA 2DB1A 4HI1A 2Y3YA 1B7FA 3I31A 3TZYA 2PMWA 1VIXA 2XZWA 4C8ZA 1N0VC 2AJQA 1U49A 3CJTA 3D6MB 3CIMA 3M6XA 4HL9A 3SQOP 1I94J 4QPXA 4KJIA 1NPRA 2Q6BA 1WC6A 4WXWA 3TO8A 1VQSA 1UETA 1U26A 4ILLA 1FK9B 3RW7A 2JFKA 3DDIA 2ZH9A 2UUAF 3DC2A 4ELTA 5IOLA 2DH9A 1U09A 3CJ5A 1TR0A 5CD4A 4UOFA 1S1VA 1X5PA 4KIAA 3DGVA 2MQPA 2XULA 5DZ6A 2HNZA 4ZCIA 4GO7X 2WONB 3OQ2A 2HZVA 4KHPF 1PJ5A 3QFHA 4J9RA 3OR2B 4PG5A 3DCAA 3FFIA 1TL5A 4QIVA 2W4PA 4QR0A 1CEZA 3BQ2A 1S0NA 2ZH3A 5HMZA 3DHXA 4OZLA 2E7VA 1F9HA 3K5LA 4CI0B 1ZM4A 3HX9A 3GFYA 2DKOB 3EDRB 3S1TA 4OZNA 1B3TA 3CIZA 3VAJA 3OW2R 2BMBA 1TVRB 2FJXA 1SL0A 1U2FA 5DETA 3CSKA 5GAHU 1TK8A 5EX0A 2V68A 3MPVA 2DBBA 4RBUA 3EZ5A 2RKIA 3LALA 1QY7A 4GKJF 3L09A 4LF8F 3QAEA 2LDIA 1HR0J 4URGA 2ZC4A 3M6WA 4F4KA 1DY3A 3DLLQ 2F4VJ 4GVBB 5H9FK 1JLEB 1LW2A 2W2QP 2NSCA 3T3FA 2DNKA 4NXNF 5LMUF 4M8LA 3KK2A 1FRKA 3QFWA 1GXUA 4XTTA 2J6TA 1B64A 2J9EA 4QWCA 3B8HA 3DRRA 2DGVA 4DUZJ 1H2UX 4ZCMA 4IFVB 1J5OB 1KHVA 3ITHA 1N32J 3SSRA 3BO3A 4A4JA 4YR0A 2P9CA 1JJ2R 2A2DA 4NCGB 2WB4A 1BXNA 1K0TA 3D1HA 4P2SA 4QWAA 2CQHA 3KXDA 3EWGA 4O4GA 4DX6A 4IQXA 1WD6A 4K4VA 2YX7A 5C5JA 1VFJA 1V6HA 3FUYA 3MCNA 1KOHA 3VAFA 1B0PA 1VQ9S 1S1WB 2K8GA 2RB7A 1C4AA 3GU0A 1LQ9A 4K4SA 1CC8A 5D78A 1JX4A 4O0IA 1Y5IB 4JI4J 3CDUA 4NASA 4D3GA 2VF3A 4PXEA 1SJ1A 2G0CA 3CJRA 3TJ8A 2QT7A 1RHJB 5L1JA 4B02A 2W7OA 4ZJQA 1SC4B 3D6TB 1SIZA 1NUEA 1IUJA 4ES3A 1R0AB 1LWFA 3UVJA 3CGIA 2HWTA 3EMTA 1TTHB 4Y65A 2O5DA 3NEKA 3IO1A 2XMKA 4ZPVR 2A6MA 4JV5J 5EWEA 1FRIA 3PW4A 4ZPTR 2EXUA 2IM1A 2UUTA 4HACB 2R7SA 1S6PB 4RW6B 2MGZB 3MZIA 2OMOA 3FZBA 2YWKA 3FBFA 2BANB 3HSJA 2CZ9A 1D3WA 1UP1A 1IKVB 1KLMB 4RPFA 1XMOF 3EYZA 2OP5A 2HIQA 2KT5A 1IM4A 4N77A 1T03B 4ZVFA 1AB8A 1JLCA 4USJC 4TU9A 4WE1B 4KT0C 4PUOA 2MKHA 2HHVA 1C0UB 1RLDA 5HMWA 3QO9B 3HULA 2MZSA 2MTLA 5E33A 4EMDA 2LQBA 4X4RA 2N4CA 3KWMA 2CQGA 4PAAA 3AB2B 3P5BP 1D9AA 1Y00A 3QATA 2XCAA 3M9NB 3D7SB 2VBZA 4B9VA 2LXUA 3OPKA 3C14A 3D54A 2QX0A 2ABYA 1FEHA 2XLJA 1H38A 4C9DA 1FT8A 7FDRA 1VC0A 3ZZZA 4I6WA 1S4EA 3MCMA 1HA1A 4WU2A 3E01B 3DLJA 1Q79A 1C1CA 5F8JA 1SKSA 3BGFA 3PDNA 4X64F 3G87A 1B4SA 4J7CA 2RNEA 3QGIA 2LQ8A 4YHHJ 2YWEA 3POTA 5D6GA 1H6KX 2BQRA 2EK1A 2ZWPA 3HHDA 4Q8EA 3NGTA 1TFWA 1DTQB 3CVKA 5GAEU 3GCXP 4USVA 1DFDA 1MG7A 4ES1A 1RHKB 2DR9A 3FSYA 3PYFA 1SI9A 1PYOB 3IP0A 4E98A 5KFDA 3PHTA 2KXHA 4O0NA 1VQMS 3PO4A 3X1LB 3JTOA 2E1CA 4NLUA 4DR7F 1IBMF 2CJ9A 4ATNA 3RRGA 2QMUB 3JAMU 3TOQA 1R43A 4HKQA 4QIGA 1QM9A 4C8NA 3LGNA 2IRXA 2VKZG 4DF8A 3D5MA 4MKVA 1WC1A 4YS2A 4M94A 1VQKS 2HGNA 2ZBQA 8RUCA 2MKSA 3A3NB 4TY8A 2DGWA 2O3DA 4ZVPB 4Z37A 3HFVA 4P72A 2B6AB 1IWAA 3UD4P 3HJFA 2BE9B 3W8PA 4URSA 3TVZA 1HD1A 3VZHA 4DSEA 2MQOA 4RNFA 1RDRA 1NH7A 4B17A 2B7BB 1U24A 1OY8A 5HVHA 3O8WA 3H5XA 2G0JA 3G2XA 1ZM2A 3CC7S 3NGKA 2M52A 1TL7B 2HQ3A 3OFHA 3HHLA 3GE9A 5EUHA 1UJ4A 1FRXA 1RWUA 4G6VB 4KGMA 3WDOA 5D4PA 5CABA 2HWHA 4WP8A 1N33J 2UP1A 3CB4A 3AA9A 4HT7A 4DV4F 1LWEB 2X51A 1RBOB 2R7OA 2OFHX 2O66A 2GMJA 1IKYB 1BGXT 2BW7A 3OFGA 2HBRB 4O3QA 5BXIA 2Z56B 1D0EA 5KFLA 3B78A 4QZVB 1QE1A 2OD4A 1FD2A 3EX7B 2V4RA 1FXLA 1XBWA 3MD1A 1FWLA 2KTQA 3H5UA 2W2MP 4M63A 1ZA2B 3GWCA 1L3SA 4CCHA 2MZQA 1S9EB 1RHUB 3IS9B 1TUVA 3QWPA 3R7NB 1ZA1B 5CXTA 3TNVA 4JI0F 1FK9A 1AT1B 3FMBA 1XJWB 2ZH6A 2B9XA 1MROA 2BX6A 4DV1F 1WWHA 3GV5B 4O3SA 2YNHB 2VDIA 4MFBB 3SCIE 1Z1ZA 1X4EA 1SC1B 2KT2A 3K5PA 3DYAB 3QGGA 1LW0B 4LF7F 2AIRB 1QDUB 5IS2A 1AXQA 3K89A 4N7TA 3M05A 4KV8A 3KHHA 4DBQA 4RU9A 4AQYJ 1CJVA 4UY85 1NHVA 4Q2MA 1XMQF 1HNVA 1AA1B 1NM2A 3R5CA 5GMDA 1EQMA 2WSCC 3IR7B 2OPSA 2DRAA 1YQHA 2VODA 1E6VA 2E44A 1VLYA 2OPRB 2D74B 1NCLA 1VC6A 2QA2A 5HMYA 5JVGQ 3DGPB 2LA4A 4U67Q 4DR1F 1AYEA 2F5GA 1KFDA 4LUBA 2QLXA 3MD3A 2R8JA 1HKAA 3SCJE 2HHXA 5EX3A 3LPYA 3CMAS 4HVZA 4EYIB 2BRLA 1WKJA 5HL7Q 1HMVA 1S7IA 1VDHA 2RJZA 1KN6A 4C48A 3VGVA 3QRPA 1U2CA 5E3RA 1LWCB 1VQOS 2P2CB 5EHHA 4EBEA 4NCGA 2HIYA 2ZH7A 5L8RC 2R8KA 5C2CA 4YMEA 4DX8H 3BR9A 5I3UB 2H5IB 1YRTA 2D7SA 1NSKL 5HI7A 5KFYA 3WX8A 1FRHA 1R6VA 3SZ2A 4CLPA 2H9ZA 4ZVEA 2Y0SD 3MPUB 5L9XA 2RHSB 4HTIA 5K8OA 3JAMY 3DLKB 4WFXA 3LP0B 3M2UB 2C3OA 1NEEA 3AFGA 4DL3A 3GPAA 5LXYA 2RSQA 4KSEB 4LR9A 1MN7A 4LFAJ 2UXCJ 2HYIB 2HS0A 3A3OB 2QGFB 2CVIA 2PE8A 1PIEA 2JDJA 2AKWB 1RAEB 2VQEF 3I4PA 1GK8A 5DQIA 3MM8B 1U25A 4ZS6A 3CJ0A 1A6LA 4YEAA 5I42B 3C46A 4F0HA 3LP2A 2KN4A 1IKXA 4DUYJ 1NDCA 2RHQB 1RGVA 3GZ7A 4GRSA 3PIPQ 3HLUA 1GFWB 4RW8B 4TQRA 5E0OA 3M30B 4UW2A 4L76A 4C8OA 5CZVA 4CM2A 3OVAA 2Y1IA 2DYAA 3HF5A 1QSYA 4ECQA 3W2VA 1KLMA 4UZCA 2Q79A 4RL1A 1JLBB 1TFYA 4AL7A 1T03A 1R8HA 3GG0A 2NQPA 1SJRA 3N4WA 1X4DA 3HKZD 2PD1A 5FDLA 2XLKA 3I5BA 3NCPA 4DSJA 3BKFA 2G9OA 2R7XA 2EKYA 2ZBRA 3MDFA 2E9TA 3MMCB 3TAMB 2VFUA 3TJ9A 3E3XA 4ZK7M 2KB2A 3MR6A 2PIIA 5J2MB 4AD6A 4D3HA 5DRKA 4IOCQ 2DHSA 4KGZB 2HEKA 4NEZA 2FHOB 4K5SA 4NPOA 2HBQB 1Z4UA 3MMBB 4DV7F 2XHCA 1SUQB 2H5JB 4C3LA 2H51B 3GMGA 1RWWB 4JI0J 4KHMA 3LGHA 2E1MC 2V2ZA 2K1RB 2FLOA 4NLWA 4U9RA 4CRJA 1XR6A 1WHVA 2R2TA 3PJXA 5SZTA 1DTQA 4QOTA 3QNWB 2B8QA 1KC8T 3D1QA 1EX8A 4CNZA 2HNDB 2QV6A 4JI8F 4CYUA 2R7VA 3I0RA 4O3PA 3VAGA 3V2UC 5HJXA 2FUG9 2HAFA 3TANA 2RUGA 1TL3B 1EP4A 4GVLA 1PSDA 4LF6J 2WVDA 4IQMA 4WU3A 4LFBF 1WG4A 1WJ9A 3MMAA 4MH8A 3LGMA 3OHBA 3ET6B 1JLAA 5DDPC 3F73A 2DRBA 3MCOA 1K1QA 2GCFA 5DGAA 2LU2A 5KFVA 2E5GA 2UV8G 1P1TA 1RWOB 3WIUA 3AA8A 4HDGA 4BDPA 5KT5A 1HNXF 4AYBD 3T5LA 1ZAVA 4RNNA 4ED0A 1OQ6A 5FLXU 3GILA 4ZVRB 1EARA 4DR1J 2FLNA 2ZZMA 1HL6A 1SL1A 1HYSB 3ENWA 1FJ7A 3FCWA 3RG6A 4DV0F 1PJ6A 1N0UA 3QLHB 1V9OA 2N4DA 4TY9A 3KJVA 2LEBA 4C11A 1VJQA 2L08A 2ZEJA 5ETQA 5KFTA 5CYQA 4X2BA 2PMHA 3DOLA 3I4HX 2XGPA 2RH3A 2C2OB 3DLEA 4HI2A 1OQ3A 2OPPA 2W2OP 3PJ9A 2HHWA 1LWEA 3K5OA 3LP1B 2AD9A 1OSCA 4X62F 3QWUA 2HMIB 1HNZJ 5LJ5Y 1IKYA 2RS8A 1Q8LA 3GJSB 1C0TA 1NKCA 1KVKA 1RT6A 4ZJLA 3W66A 3DRPA 4IRCA 1TKTB 3ILLA 3M2VB 2BW2A 3R1HA 4DPUA 3T1HF 2BUNA 4NXMF 2ALZA 4V19X 3KNAA 2CPZA 2BKPA 4TXSA 1XNRJ 4HDHA 4OJ1A 4CLFA 5HQMA 1U1PA 4IDKB 4OX9J 2C3MA 3HZEA 2ALYB 1F9EB 3FJ2A 2BJ9A 3D3BJ 5KG6A 1KQKA 3EJMA 2M2BA 3V81B 4QWEA 3T1AA 3C16A 5E7OB 2HLUA 2QLJB 1YI2S 2FHJD 4BC9A 2MKIA 4K4TA 2LFVA 3CD6S 2DISA 1RTHA 2QJ3A 1HQUB 4DQSA 1BWEA 3NBPB 2HQDA 4OJGA 4MK8A 1YRXA 3L7PA 2I5JB 4IG3A 5JJBA 3IG1B 3NS5A 5MAOA 3PX4A 3I6PA 1UWBA 4EK2A 3CC2S 1TMJA 3MHYA 3R2CJ 3CCUS 5CYMB 3OTOF 1PAEX 2GFFA 4J9OA 3DMJA 4WTYA 5M2RA 4NRTA 4GC7A 1IBLF 4OIXA 1NRKA 1L3UA 1S97A 4LF5F 4JV2A 1RTJA 2CPXA 4FYVB 1IR1A 3NOGA 3T19A 5B09A 2CNLB 1AROP 3W8GA 2KXNB 2XMUA 1RLCL 5KFZA 3GIRA 3OTEA 1IBKF 3RBZA 4Y2IA 2F9DA 3E8OA 1Y10A 2UUCJ 2I6WA 3CMES 1NAQA 1RSCA 2AX1A 2RQKA 4PYDA 1HBNB 2R3VA 2IBKA 3M8WA 1Y5LB 3K57A 4OI2A 4TKTA 2KG0A 1TMMA 5KFFA 3BV8A 2QN6B 2IAJB 5IT4A 2WZ1A 4LJMA 4ANEA 2UVRA 2YKNA 5IV3A 3TI0A 2B5JA 5A8KB 3T1YF 2I2YA 1VISA 3BO4A 2NLWA 5C24A 1W25A 2H4YB 2HQIA 4U6PA 2JC1A 4C97A 1DLOB 5KT4A 5T14A 4K4YA 4L74A 4OYIA 4DL2A 1JNRB 2CPIA 4LF1A 4WFZA 1T9YA 2ATLA 2UVWA 1FWKA 2VB6A 1GXLA 4UY8T 2OLWA 1S1TA 4OZ1A 4LFBJ 1FX2A 2PMZD 4MYTA 5K5MA 1NDLA 3AAWB 4DR3F 2MDAA 1F5AA 1OIAA 4U96A 4NA1A 2ZBPA 3J7YU 2QO3A 3O5TB 3W65A 1RUSA 4LSNA 3IAS9 4PQUB 1ROFA 3R9LA 5B0BA 1QAJA 2UV8A 4ZLLA 4LF4F 2Z30B 3M2UA 4OL8A 1HNXJ 4A8XA 4MAKA 1RKJA 1G2EA 2B3TB 1NPKA 3G4SS 2OI2A 2FGCA 4LMZA 1UW9A 2VBYA 4C0HA 4U7CA 1N5QA 1VHFA 2F65A 4KY3A 3CPWR 2F8HA 4L72B 1C2PA 2RMLA 5FIIA 3W64A 2CJAA 3W9JA 1S1XB 2AV5A 3O6QA 1N5TA 2A2CA 5FLXY 4Q43A 2M7SA 1DTTB 3W5XA 2PO4A 2EFVA 2Y8WA 4YQWA 3HSZA 4RW8A 4I4BA 3SSSA 2J7UA 3NGUA 2RIJA 5EWFA 1Y3KA 2DCLA 3CJSA 2MQLA 3G9CA 4WJBA 2I1RA 4B9NA 3WX4A 4L75A 4I2PA 3IBWA 4FPIA 1JLBA 2K2PA 3DDKA 3FBCA 3EZOA 4ZPWR 2CPDA 4ZP7A 2JNJA 2JHEA 3EGVA 4DX7A 4N56A 5HP1A 4LRDA 2WOMB 1T7PA 4LVNP 2ACMA 1VK8A 2JEFA 2I0XA 4I2QB 1H98A 4F3QA 3NMRA 2LQ5A 5KFIA 4QYRA 3M8PB 1SXLA 3UDLA 4I69A 1CJUA 5AE3A 2PA8D 1FJGJ 2CQ4A 4CP5A 4WKYA 2FC8A 2PGCA 4WP3A 4K8RA 2ASYA 2HAIA 4ZP6A 2MEWA 2XQCA 3OXGA 4KE5A 1LFWA 4IFYB 1FF2A 4DL4A 2DXEA 2KYZA 4IO1A 5HVFA 4O3RA 2K1RA 2HQGA 5T41A 3NS7B 5LOQA 1RCXB 1R8PA 4NLOA 4NLDA 2CJBA 1UVIA 1S6OA 3BYRA 2EPIA 2V2QA 2LXIA 4B9TA 2VG7B 4DL5A 2GQQA 2W24A 4PWUA 3AOCA 4ZCKA 3RTVA 1QUVA 3JSMB 2CPHA 4G1QA 1UEUA 4RW9B 1IKWA 3ET6A 2AEMA 4BWJA 4NE9C 5A8WA 2HPUA 3N28A 1Q7YT 2B43A 2IRYA 2NR0A 2RD5C 4CH0S 4DR5J 1U1NA 4PKDB 2ZHBA 3KG1A 3DLGB 2HVDA 2XC9A 4WKRA 3A8KA 3QGPA 2XBPA 3TAQA 3BDEA 2RDJA 2RAQA 1JWWA 2V94A 2ZITA 1ZH5A 4CDIA 1B7YB 3KHLA 3MMJA 2VC1A 5E3CA 2IM0A 3GYGA 1U0SA 3ENVA 1FHTA 4B9MA 3SQGB 1KBRA 2G2ZA 2ZNYA 2N3OA 4MTPA 4UOCA 3HJVA 1BQXA 4ED1A 2XMVA 4QPTA 4LF9J 2KU7A 1YBUA 5DQGA 3AQOA 4K0KF 4NLQA 3N01A 1X7VA 4I6AA 3T1YJ 4UUXA 5HLFA 2LKZA 4ZVQB 2BE2B 1FKPA 2DPIA 3THVA 1KFSA 4WZQA 2XEXA 2IJFA 1P9QC 2E9ZA 5THWA 3C6TA 2XSJB 3HXMA 2VPZB 5K8NA 3IR5B 3A8JA 2W4DA 2HMIA 2W9AA 4I56A 1VRTA 1S76D 1EETB 1NBEB 1KTVA 2D1CA 2DHAA 1KS2A 2OAUA 3ICLA 2DHHA 4ZVHA 1L3KA 3I0SB 2YTCA 3BGRA 2ZJRQ 1S79A 2MLZA 1TKTA 2AJ2A 3C15B 4LREA 4MIBA 3M2VA 2PA3A 1T9VA 4EO8A 4ZVTB 3JQJA 2J6SA 2ZZTA 5I3PA 2Y8YA 3RZAA 3EZUA 2L9WA 1GXTA 5DDOC 3GJQB 2DRDA 1R7IA 2CZ4A 4X66F 1K9MT 5DQHA 1HI1A 1VK3A 4ECXA 3MAQA 1UCNA 3GIKA 2CQ3A 2APOA 1W7WA 1CJKB 1MMNA 4KAIA 4QCLA 2CNOB 4OYOA 2LYVA 5J2PA 4OHXA 3DNCA 4K5RA 1ZZNA 1YSJA 1U0HB 2W7AA 3H7HB 3OR1B 1VBKA 2BJ7A 1Q95G 1Z2ZA 1HQUA 3LF0A 4PEOA 3J7Z5 4Q0BA 1C1BB 5SUHA 3QT6A 4NZ7A 2OTLS 2HZAA 1RP5A 5LJ3Y 4ED6A 3M8YA 1W2BR 3WIVA 3HT0A 3IC1A 4OYMA 5CYMA 4Y2MA 2M9KA 1IVZA 4J9MA 3FGVA 2D3ZA 3W62A 2AMCB 5IV4A 4TLRA 4H4KA 1NMEB 2E1RA 3DI6B 4O44B 1SIWB 3DXBA 1KVIA 2CPFA 5D3GB 2JLFA 4B9LA 5L38A 3KOAA 3SMZA 3ZTPA 1OMSA 4ECVA 1FKOA 2WK4A 1UAWA 4QYZJ 4DR2J 4R5PA 3CF5Q 2N7YA 4B3MJ 2DIUA 4L3NA 4Q2LA 1HBNA 2G1HA 4PPZA 1BUXA 4P71A 4ZVSB 2BKNA 4Z7YA 3F0NA 5F9LA 3VTIA 3HVTA 4W92B 2C2DA 3R1LA 4YB1P 2DHGA 2IVMA 5DJBA 4QW8A 3MUMP 4DQIA 2R8HA 3NCRA 3ZC4A 1J5EF 3IR6B 2FB0A 4DZDA 4F25A 1SKUB 4ED3A 4KFBA 1OY6A 3N6LA 5EDWA 4TNOA 3TZWA 3TQEA 4LSLA 2BBEA 1MMLA 5K14A 1X4FA 1HNWJ 2GNKA 4C7QA 4DCOB 1UVLA 2KZMA 1EIYB 1VS3A 1WC3A 3R8YA 2ZH2A 5L9NA 1L3TA 5G0RA 5K8PA 5C42B 1D8YA 4U7UD 5D4NA 2L48A 1LOUA 3BSNA 4BC7A 2E29A 4HH1A 3AH6A 1YG0A 3BF4A 2D41A 1I3OB 2K7KA 5LSRA 3MTKA 5E3PA 4F7VA 2MSSA 5KT3A 2R42A 3MM5B 3HZGA 2UZAA 3KHRA 4USUA 3H25A 4QWDA 3R2DJ 1T3NA 1KNZA 3MEDA 1Q1KA 5HBMA 1RAHB 4ELUA 1O6XA 3DDNA 5D0EA 3GIJA 4WTOB 2HHHF 2NREA 1MU2B 2DD8S 5D4LA 3LANA 3MCSA 3UNGC 2FY8A 1T94A 4NLYA 4HT5A 4UT4A 2DNYA 5IZHA 3BKUA 3QRQA 1CQMA 3MPDA 4ZDNA 1NHKL 2AX0A 3TW0A 1Y0HA 2D9PA 3CCWA 2JEIA 3PR5B 5B0AA 1U8WA 1DTTA 4M5GA 3EGWB 2QIFA 3MM9A 3Q8PB 2JOQA 4YFUA 3KMQA 4LBHA 2AGPA 1E6YA 3DOKA 3CJQA 4JI7F 3KUGA 4ILRA 1VQPS 1R8CA 3HPOA 4EUVA 3PFOA 1M5KC 1GMVA 2CJXB 1H7WA 2YNGA 4ED4A 1HWIA 2MY8A 4XPCA 2HNZB 2XWYA 1S57A 2UU9F 2AGQA 1NJIT 1N34J 2J0WA 5IXUA 3E51A 2YKAA 4I2QA 1T9WA 3Q8YA 2MYFA 3FFIB 1RA6A 2XMMA 2ZDOA 3K17A 1BWVA 3TAPA 2EI5A 5HK4A 3THPA 3CW2C 2RT3A 3M8PA 1HQEA 3KJFB 3RR7A 1X9WA 2YPZA 1EZZB 2L9NA 1OYEA 4FYXB 5KT2A 1FNXH 9ATCB 1NSQA 1HI0P 2E5JA 2OFGX 2ZHAA 4C8LA 1U48A 2KH9A 4C0OC 3DM2A 2XYHB 1YWXA 3EXCX 3A4TA 1XMBA 2A6OA 4RBTA 1SVDA 2QSFA 2JSXA 4ZPCA 2RKIB 4DS5A 2HSEB 2DNRA 3K8WA 3FK4A 3RUBL 3PRDA 3BEGB 2VQFF 2JC0A 3H98A 1N6QA 4J9PA 4HEA9 4OLPA 4RUAA 5AXKA 1AZSA 1LW2B 3N6NA 1JXEA 1N52B 5HROB 4DPWA 3FQLA 4RR5A 1UKUA 1U1LA 1LNQA 3KK2B 2BKOA 3U02A 1M5HA 3K7RA 2WBMA 1UA0A 1X5TA 2RQCA 2BOPA 1WKKA 3PW2A 2HBZB 3DRRB 3UCZP 1WOOA 5AJ3F 1QVGR 2UUBF 4O4RA 2LP4A 1JLQA 3ITHB 3EGNA 4OHZA 1NDPA 2U2FA 3KLHB 2OH2A 3MUTP 2BQUA 4NWBA 2QL5B 2OMLA 2N82B 3LH2S 1RAIB 2KRBA 2DVIA 2XO7A 1NK4A 4BHQA 5ETNA 2P5VA 3H40A 1G4CA 2B8PA 2E5IA 3JSBA 1ZETA 4DSKA 2H48B 3MOZA 1ZPWX 3SQGA 4H4MA 1FXDA 4G3IA 2AJ4A 2XMJA 2DHXA 3HT3A 3FRYA 1I6JA 3QIPA 4DV2F 5JVHQ 2OHDA 3TZXA 2WCXA 1KR4A 3RGIA 4X4SA 2UVVA 3BM7A 3H4DA 3CJ8A 4RW7A 2YNIA 3TYTA 2BE2A 3G8QA 1XIQA 4NLGA 1SV5A 4IH5A 1ZTWA 4OZJA 3UVJB 4F2RA 2R8GA 3N6MA 1QUPA 1H72C 3T9NA 4OYZA 3IXQA 1OS5A 1T3OA 4RLEA 4RJVA 2C1EB 2IBOA 3NRBA 1DHMA 3QSIA 5DM7Q 4R0JA 1WF0A 5BR8F 3OTCA 4JI1J 2EKNA 2WRMA 4TN2A 3BKTA 2ZWOA 1T05A 4TLQA 1TK5A 1N54B
chains in the Genus database with same CATH topology
1LWCB 3KK1B 1VQOS 3CJ4A 2HHTA 3PKYA 4KR0B 2I5JA 3ISND 1NK5A 5DDQC 3CDWA 3IG1A 3PNIA 5F3ZA 1AFJA 1NKEA 1FDDA 2DNPA 1U6ZA 1LXNA 5A6WA 5EHHA 4EBEA 1P6TA 1N48A 1FKOB 2V9KA 3R5BA 2VOOA 4NCGA 4O23A 3T9ZA 4B3OA 5GMKa 3L3CA 3BQ1A 2ZH7A 5ITHA 5L8RC 4ECUA 2R8KA 2Z4PA 4R5PB 3QJJA 1JLCB 4WYLA 2VG5A 3PV8A 4YMEA 3V4IA 2CQPA 4DX8H 3BR9A 4FXVA 5DG8A 5I3UB 1X4AA 3VALA 2VV5A 3UR3C 4B3SF 2HG4A 3CD7A 1RT4B 3V6HA 1YRTA 2Z0GA 2ADCA 5JUMA 2MXYA 4FVMA 4C3MA 4EGLA 1WHWA 1M5PC 3DOMA 3TARA 2D7SA 1B0TA 1WEYA 4M5DA 5HI7A 4XDCA 3P49B 3NL0A 1S6QA 1HD0A 5KFYA 3TQ1A 3HVTB 2HS3A 3E2EA 3LO3A 1FRHA 5F8LA 2HW3A 3TX8A 3SZ2A 1RISA 5LXRA 5KFRA 2H9ZA 2ASDA 4ZVEA 2HWIA 2Y0SD 2Y1RI 4TYAA 5L9XA 3GSDA 4BCAA 1SKWA 1UVMA 2CDQA 2NUUG 4DL6A 2F9JA 3PJWA 2HGLA 4CH1A 2V4QA 3BJYA 1R27B 4HTIA 5K8OA 5IT0A 3G96A 4WFYA 3UQSA 4KFBB 3JAMY 3DLKB 3MTJA 6FD1A 4AXIA 3J7A1 1WG1A 1TAQA 4C8YA 1AW0A 4WFXA 1JK9B 2GQCA 4AQYF 1SJFA 3LP0B 2KM8B 3M2UB 4QR2A 4LSLB 2C3OA 1NK7A 2MZRA 1K1SA 4CO2A 2ROEA 2MHEA 1YIJS 5K14B 1XR7A 1NEEA 4DL3A 3CWJA 1TP7A 5LXYA 2RSQA 4TQSA 4K4XA 1TKXB 3IRXB 4JI5F 3QJPA 2RS2A 3AY0A 4KSEB 2Z2LA 1Q82T 3UD3P 3VWSA 3P6YC 2HYIB 2HS0A 1C1CB 3LAMA 4NA3A 4A8KA 2RF2A 4ECSA 2CVIA 4N76A 3IFEA 2PE8A 2JDJA 3AJ2A 5J2NA 2XG8A 5BYRA 2VQEF 3I4PA 1R8BA 2EBEA 5DQIA 3MM8B 4NZ0A 2F8MA 1U25A 3BSAA 5G0RB 4ZS6A 5K8MA 4RUHA 3CJ0A 3POTB 1A6LA 2FJWA 4KGKA 4FF3A 3DRXA 2PI4A 3WBZA 4YEAA 5I42B 2K3KA 2XS2A 2IAJA 3C46A 1R3NA 4FNHA 3LP2A 2LEAA 3OFEA 4CO4A 3KYLA 2KN4A 4DMZA 2J9CA 3OL6A 4R25A 1IKXA 1SB6A 3HHEA 5A8KA 5HQ8A 1RT1A 2XNRA 2A3JA 1M5VC 1RGVA 3GZ7A 3PIPQ 3HLUA 1HI8A 4RW8B 1HW9A 5E0OA 4TQRA 4UQGA 3M30B 3M9OB 2LQ9A 4O3OA 4UW2A 1ZBTA 3LW5C 2CQ0A 4C8OA 2VFTA 3TVYA 2J0XA 3DN9A 2DT9A 1FVSA 2DIVA 3CT9A 2MKKA 2AYBA 5CZVA 5H1SV 1U6FA 1ZPVA 3OVAA 1DLOA 4RNMA 2Y1IA 1Q16B 3HF5A 1QSYA 4ECQA 4F67A 3W2VA 1KLMA 3MEDB 3ISNC 5HBMB 3R5DA 3SDEB 2Q79A 4YB7A 3Q8RB 3PW5A 2E7XA 1N5YB 1JLBB 3M9MB 3BO2A 1CLFA 1TFYA 4QWBA 3SV3A 4AL7A 1T03A 1S1UB 1SKRA 2LVWA 3AJ1A 1T8EA 1R8HA 3CCMS 3M4XA 3GG0A 2EC0A 2KFYA 3NKYA 3H2VE 3MM7A 5J2QA 4B9SA 3FZ2A 3VAMA 1U1KA 2GJIA 3MEKA 1RYSA 5KT6A 4JI1F 3DLHA 2RDIA 2IC3B 3THTA 3V5RA 2NQPA 1TAUA 4XO0A 4IG0A 2XCPA 1SJRA 2BR0A 3N4WA 3RAMA 1X4DA 1ZAXA 3HKZD 4DDFA 2ZE2B 3L7OA 5DG9A 3S7RA 2PD1A 5IQQA 1QSSA 5FDLA 5D77A 2XLKA 4QIWD 3HDSA 3I5BA 3NCPA 2VL1A 2WTFA 2VUGA 4DSJA 3I9V9 3MECB 2G9OA 1YJWS 1XERA 3M8SA 2R7XA 2EKYA 5A6PA 2CJQA 1MSWD 3MDFA 2VONA 2E9TA 4C8MA 3MMCB 3FNNA 2SXLA 5KFNA 3TAMB 1D8ZA 2XI2A 2OJ3A 2KZZA 2VFUA 2XY7A 3E3XA 4PQUA 4ZK7M 3C6UB 2LA6A 2KB2A 3MR6A 2PIIA 4B3TF 5J2MB 4EBDA 3I32A 2AJ1A 2VG6B 2DO4A 4WXOA 1UL3A 4D3HA 4RNHA 5LSOA 5DRKA 5BJRA 2XLIA 3MM9B 5KFKA 4Q5VA 3J7ZT 4DJBA 3IRWP 2DPJA 4IOCQ 2DHSA 4X4VA 5A2QY 2CQIA 4OLOA 2XSFA 2ERRA 1H2TZ 2FHOB 3CCZA 4K5SA 1VQ8S 4NPOA 3M2RB 3MMBB 1P8GA 1Z4UA 1BQMB 2QRRA 1E6YB 2EWHA 4Y2KA 3U27A 3DOKB 2X1BA 4DV7F 5KOXA 3HHKA 1JKHA 5C25B 2CQ1A 4Y0FA 1SUQB 2DCUB 4A48A 3C66A 4NLRA 1JLFA 2BZ2A 4C3LA 1X8DA 1YGYA 1TKZA 3X3UA 2U1AA 4C4WA 3LAKA 2QLWA 3GMGA 1VQYA 3QAUA 1OPZA 2KFNA 2DGOA 2GQ2A 1URNA 3HHLB 1MNEA 4KHMA 1HNIB 2HLTA 5DLFA 2Z2MA 2E1MC 1FA0A 2YNGB 3OHAA 2K1RB 1DQ8A 2E66A 2GHPA 2J6UA 2FLOA 3H2LA 1S1XA 1TK0A 1Y5NB 3GFZA 4NLWA 4U9RA 1XR6A 1WHVA 2R2TA 1DURA 1U8SA 3PJXA 2JJ4D 4LT6A 4K50A 2DNHA 5SZTA 1DTQA 1X5OA 5B0CA 2FC9A 2RE1A 4QOTA 4DV6F 5GAGI 3UCUP 2OPQA 1KC8T 3D1QA 3MEEB 4KPYA 1YJVA 4CNZA 2CJKA 2HNDB 2LQJA 3OUYA 2IMOA 5IFMA 3KLFA 2QV6A 2IJNA 3NLCA 4JI8F 2ZBIA 3UWTA 2UXCF 4LFAF 3KK3A 2HS4A 2UXDF 2R7VA 3I0RA 4O3PA 5IM0A 3CEDA 3V2UC 3VAGA 1Q4RA 3ZZYA 3Q22A 3UCGA 2FUG9 3TANA 2OKQA 2ZJQQ 4ICLB 1HBMA 4ELVA 2RUGA 2HFNA 1QAIA 3VAHA 1TL3B 1EP4A 5E5NA 3DFEA 1HQEB 5KFGA 2JVOA 2M88A 4ALZA 2UUWA 1SBRA 1X4BA 3VQSA 1UA1A 1REVA 1PSDA 3WC2A 3V6DA 2ZM6F 4IQMA 4WU3A 4LFBF 1WG4A 3MMAA 2C3YA 5D4OA 4MH8A 3MR2A 3PVXA 3LGMA 3OHBA 4KC5A 4DUYF 5KAKA 1JLAA 1S1VB 5DDPC 3F73A 4FXWA 5DLGA 4CO5A 2FLPA 2V4JA 1XC9A 2DRBA 1Q8BA 1VJWA 4M1KA 1N8RT 1FESA 2JRSA 1K1QA 4NCBA 1RTIA 1JNZB 3DM2B 2GCFA 1QE1B 2WOMA 3CDAA 5DGAA 4QU7A 4DFPA 4O3NA 5F8MA 2GW8A 5I3QA 1X4HA 4K2XA 2MQMA 2LU2A 5KFVA 1FE0A 3MM6A 2JEGA 2E5GA 4UQTA 3PXGa 5GAGU 2UV8G 2ZJPQ 5KFOA 1Q86T 2KHCA 1P1TA 2DO0A 1H3DA 2YX1A 3S6EA 1O8BA 3K2YA 2W8LA 3AA8A 4HDGA 4BDPA 1ZM3A 5KT5A 1X0FA 4Z2XA 1HNXF 2COLA 4WFNQ 4AYBD 3F44A 1ZAVA 3T5LA 3MUVP 4YY3F 4RNNA 2MKJA 4ED0A 4A8FA 1OQ6A 1JB0C 4NL5A 2EG2A 3GILA 1RTDA 3OL8A 5KG4A 1N6QB 2GV1A 2YKOA 5KFMA 4Y00A 2FLNA 5GADI 2ZZMA 4B3RF 1F2GA 1QJHA 1URRA 1UW4A 1RT5A 2M70A 1NNDA 2JH3A 4USIA 1H7XA 1NZAA 3R3TA 2XB2D 1HL6A 3KG4A 1SL1A 1HYSB 4IFYA 3ENWA 1FJ7A 1MROB 5DG7A 3OL7A 2BM1A 2BABA 2JFDA 4JV1A 1J2VA 2KT3A 2QMWA 3T6BA 1OO0B 2RQMA 4CT8A 5J1EA 4DV0F 1HHTP 1N0UA 3QLHB 1V9OA 2N4DA 3K5MA 4TY9A 3PZPA 3CCVS 3U7JA 3KJVA