3SSSA

Ccmk1 with residues 103-113 deleted
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
AIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVAAGVENVKRVNGGQVLSTHIIARPHENLEYVLPIRYTEAVEQFRELEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Carbon dioxide concentrating mechanism protein
publication title A CcmK2 double layer is the dominant architectural feature of the beta-carboxysomal shell facet
rcsb
source organism Thermosynechococcus elongatus
total genus 26
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sssA00
3SSQA 4QIVA 4OX8A 2EWHA 3PACA 4RBUA 3VCDA 4QIFA 4P7VA 4RBTA 3NGKA 4PPDA 5L38A 2G13A 3CGIA 4OX7A 4OLOA 3H8YA 2A10A 4AXJA 3IA0A 3I6PA 4QIEA 3MPYA 4LIWA 3SSRA 3NWGA 2A1BA 3DNCA 3DN9A 4OLPA 4P2SA 4AXIA 3BN4A 3SSSA 4QIGA 4OX6A 4DDFA 4RBVA 3CIMA 3I96A 3N79A 2A18A 4P7TA 3MPWA 5DJBA
chains in the Genus database with same CATH superfamily
2KO1A 1DHMA 1WC5A 1RAOA 4MK9A 4I69A 3R6LB 3PG9A 1S9GB 2ZJPQ 2ZOFA 3SCJE 4IO9Q 1JLFB 2VPWB 4FXVA 3I0SB 3RYLA 1UZDA 1BLUA 1AZSA 3CULA 4X64J 3MTKA 3C15A 5CQGA 5KG7A 2VUGA 4CDIA 3WBZA 1N48A 2NCKL 3K58A 4TY9A 4KV8B 2X7IA 3G9CA 2H5EA 1S1XA 2FDNA 1FDDA 2EWHA 2XMTA 5IXUA 3TJAA 2MKJA 2V2ZA 2BV3A 1X4GA 3HM9A 1YRXA 3BS9A 1B99A 5ETKA 5L46A 5IT9Y 2K1RB 1SJQA 2FQQB 3BBCA 1OY9A 3OTOF 2DGWA 4HTJA 2OSRA 2DKOB 2OAUA 2AQ4A 2X51A 3MM8B 4AT1B 2ZE2B 4AD6A 3VAFA 2R8GA 3JSYA 3S01A 2D3O1 1FKPA 3ZZRA 1ULRA 3QATA 2VASA 3IC1A 2PSZA 4N77A 3KG0A 1HNWJ 1U24A 4NRUA 3MM7A 1Z2ZA 3ZTRA 3R7NB 2JEJA 3L7OA 1Y7PA 3NCQA 3OXFA 4DR7F 1IQTA 1VRTB 1XMQJ 5FIIA 3KHHA 2DR9A 2EK1A 1N32F 4DPOA 4LFBF 1TKXB 3UN5A 2ZBIA 3CMES 4Z37A 1HA1A 2BKNA 3T1HJ 1DY3A 1R8AA 1SXLA 2W9BA 3SZ2A 2CJQA 2UUWA 1RWNB 4NLDA 5I3UA 2PA3A 3S1TA 1FFGB 3QO9B 2MHNA 4ZLJA 3DDNA 2DNMA 3DU6A 1SC1B 2RRNA 4MFBB 4U8YA 2HG4A 1HBMA 2AX0A 4A8XA 2WK4A 5IS2A 5A8KB 1TAUA 1TP7A 1RACB 1ZAXA 2B7CB 1RBLA 4Q2LA 2R7VA 1QJHA 2MQNA 2RNEA 2MKCA 5KT4A 4NLSA 3HT0A 2Y1JA 2IVYA 4GO7X 5HLFB 2OHDA 1V5IB 2MDAA 4F3MA 4IR9A 4ICLB 4QPTA 3PW2A 1J5EJ 1XNQF 4MIWA 4G1QB 2QFJA 3BBBA 2XGPA 4ES3A 2YNGA 1FEEA 1CJKB 3PY8A 2RB7A 4EBEA 1VMBA 3Q2TC 2CIMA 4JI3F 3BZQA 3PYEA 4KR0B 2EC2A 4A8KA 2PMWA 3BYRA 3KHGA 5KFGA 2RU3A 1TKTA 3NLCA 2XSJA 4IKAA 3D7SB 3CD0A 2NYIA 3QIPA 4ZVFA 4HT7A 3EGWB 3AQOA 2HGLA 3UDVA 4MKBA 4I2QA 1TL1A 1FE4A 1WORA 3HPOA 1BMQB 3K7RA 3H5UA 2HAIA 3MMBA 1UA1A 1O51A 4ED4A 4OI1A 4A47A 1S4FA 1P8GA 4ED8A 1DTTB 3KK3A 4OMFG 3Q8UA 3IWLA 2A6MA 2GW8A 5E5NA 3W62A 4QWBA 2O67A 4YDDB 1FRJA 1U49A 2HFSA 3BM7A 5HMXA 2D7SA 4NLQA 2J9CA 1VLOA 3LP0A 3VF0B 3V4IB 4B9NA 4DR3F 3DOLB 4LRCA 1EB0A 2J6UA 1HBUB 1VQKS 3WHIA 2UUAF 4NXNF 1FRLA 5E3CA 4CLKA 5C2GA 3NS7B 2HHHF 5M2UA 3LOUA 1FXDA 3M05A 4JI5F 4O0IA 3IG1B 3TZZA 1CJTB 2VG6A 1Q5VA 4YY3J 1RZMA 3E3XA 4X2BA 5F8MA 4JI0F 4PG7A 1RT2B 3GLJA 1N5SA 1WSVA 3PYFA 1SKSA 1VBXA 1LKZA 2ZBRA 4LSLB 3JTPA 4NI2B 1IBCB 4QQBA 3KJNB 2D1CA 4LF1A 2E1CA 1TVRA 5DGAA 2RJZA 4DMZA 3NS6A 2XWXA 2KT2A 2VQEF 3TP2A 1GH8A 2XLIA 2JDJA 1BQMB 2ZUGA 2MSSA 2ZH7A 3DM2A 3CVKA 1FRIA 3DYAA 3R7SB 3OV7A 1R3NA 1XIQA 2KM8B 3T3FA 4RW6B 4OX7A 1NHKL 2DR8A 5GAHI 1IR2A 1NHVA 3TAMA 8ATCB 3BR8A 1REVA 2HBZB 1RTZA 2V8VA 4WKRA 5KFBA 3AA9A 3FCVA 2ZH4A 2CWKA 4CYUB 4ZJOA 3UW1A 4FF4A 2D9OA 2ZC4A 4F0HA 1VYAA 4Y2IA 2FHMA 1RTJA 4K4VA 5LMUF 4ZJLA 3J81U 4Q7AA 3PKYA 1LW0B 4OHVA 4USVA 2IM0A 3SXLA 2BW2A 4DUZF 3JSBA 4DV0J 4HDGA 2KI2A 5EHHA 3CCUS 2EFNA 4J9RA 4EBDA 3MUVP 1N36J 1EIYB 4DV7J 2APOA 5B0GA 3MAAA 1FO1A 2RIJA 3VGSA 3MR6A 1HIYA 5M2RA 2HS3A 1RADB 4YS2A 1ZBTA 2BYCA 3HSZA 4IFYB 2Z30B 1VQNS 4OZ0A 2CADA 1U0HB 2DGSA 2YNHA 4ZVOB 2K2PA 2JLEA 3HCXA 2L41A 2WVFA 2Z2MA 4A48A 1IQZA 3OTBA 1MWZA 2IAJB 1CQNA 3UE2A 2IA0A 1TR0A 2X3GA 4DV3F 2HHTA 1WNEA 1Y5LB 1KLNA 4B9UA 2KU7A 3H42A 1N54B 2CPFA 2XYPB 5BJRA 1C2PA 2AKWB 1SL2A 4C8YA 4ED2A 2HZCA 1H2UX 2K3KA 3KLIB 4RW4A 1HLWA 2EXUA 3NKYA 1SUQB 3UCUP 1ZH5A 1RT6B 4ZVRB 2QA4S 3ILLA 5CHCB 1DTQA 2WONA 2P5VA 2C42A 5KFFA 2IVFB 1WTFA 1XR7A 2FY1A 2QRRA 1UWAA 4DS5A 4N47A 4X4QA 4BWMA 2UUTA 2B9XA 1HHSA 4G3IA 4QU6A 2W8KA 3CB4A 1NH7A 1TV6B 1VS3A 3LW5C 5ETVA 4OJGA 1S79A 1FK9B 4U67Q 4N8OA 2BQUA 4NXMF 2GQCA 2ZM6J 1U2RA 5HK4A 2Z57B 4I0WA 1UA0A 2XI2A 3PJWA 1FJGJ 1UMJA 1V9OA 4NCGB 2UU9F 1RAAB 3PR4A 4OQJA 3SEOA 1FRHA 3CCTA 1QLNA 1JLCB 2AEMA 1Y11A 3BSAA 3OR1A 4CQ1A 3DLLQ 4ZVHA 5CYJA 3FQKA 4X62F 4F4WA 3D6MB 4ETZA 2OPRB 4IRCA 3CDEA 3GCXP 4ZVSB 5IV3A 4UTGA 4HHUA 1TL3A 4WTYA 3GV5B 1SPBP 4J9UE 2HLUA 4QR0A 2MYFA 3MEDA 4YN3B 4WP9A 5G0RB 1EARA 4YB6A 3M9MB 1T94A 2Y0SD 4CLWA 2CQCA 4ANEA 2CQHA 2J7KA 3HF5A 1RK8A 1YHQS 3AFGA 1WACA 1HKAA 1WF2A 3SI8A 4I7FA 1SC6A 2OIHA 2QA1A 3KXDA 4ZLNA 4EUVA 4PYDA 2M70A 3DN9A 2MKIA 1CJUA 3CIMA 1MWYA 3PIOQ 5DQGA 4WFBQ 3QJJA 2X3DA 2HLTA 3IBWA 4O4GB 9ATCB 1OYDA 4U7UD 2V2VA 4ZN3A 1HHTP 1TL7A 3IGNA 4DCOB 3TANA 3MR5A 3SSRA 3V81B 1U02A 1Q86T 1IXKA 5EWFA 4WTOB 4C8LA 3QPIA 2YX7A 3CJSA 4IG0A 3CJKB 5BYQA 2IRYA 3MUTP 1VOMA 4PWWA 1HNIA 4ZP9A 1VRQC 4KO0B 3EPGA 5HVHA 2EFGA 4P7VA 2XWYA 2IJNA 1REGX 2OEKA 2GFFA 5HP1B 3DRYA 4P6QA 4M1KA 4TY8B 3AXMA 1NDKA 3MPWA 2ZBQA 1U6ZA 2VONA 4DU7A 4Q43A 1NH8A 2M9KA 3AOBA 3CGIA 4RW8A 2VF3A 5E3PA 3O44A 1BY9A 4DR6J 2DEJA 5JXSA 4LFCF 2GAHC 3P4UB 2EFPA 2NSBA 1QVGR 2FVRA 3T5JA 2QSWA 2X1BA 3PW0A 3GFYA 4HL9A 3MHYA 3EZUA 3GYGA 4D3HA 2NZ4A 2DNQA 3UPFA 4K50A 2R42A 3R1LA 2XTJP 4OZJA 4ECSA 5L1IA 1FVSA 1YQHA 2MJUA 3BN4A 4F0MA 2OSQA 3M9NB 3KHLA 1WKKA 1OPZA 4F3OA 4P74A 2AJ2A 4DR5J 4ZPVR 1FRMA 4A8MP 3IM9A 4IH7A 3CCRS 1UETA 2RDIA 1VQ9S 5IWAF 1SC3B 1BUXA 4KKOA 4J9NA 2F4FA 1T3NA 3BO4A 1S6PA 2HQFA 4X4UA 1QTMA 2F4VF 3EDRB 4DSJA 2GHWA 3J7Z5 1QSSA 1EQMA 1W26A 1H74A 4RNNA 3EVWA 4DCPB 3KJVB 2VFSA 2J5AA 2UXCF 4TLRA 2FJAB 1Y3KA 4NASA 5KT2A 3BPSP 2PI5A 1S1UA 5JVHQ 4ILLA 2GJIA 1A6LA 4CH1A 3SQOP 1AXQA 1FT8A 1YWXA 1OSCA 2MZTA 2NXUA 2MKKA 2VH7A 4O3SA 2JLFA 5A6WA 4NYOA 3SDEA 4F04B 3N6MA 2BRKA 5B7WA 4K0KJ 1S6QB 2C2ZB 3W2VB 3HVTA 5GAGI 1QUPA 3Q86A 3Q8PB 4RU2A 1UKUA 3VZIA 3TAQA 2DO4A 2EVZA 1IBMJ 2J0QD 2EFVA 1KTVA 4LF8F 3LWMA 5J2MA 4GMKA 5H9FK 3TOQA 4DZ6A 4O44A 1I6JA 2UV8A 4LF7F 3A3NB 4OYWA 4DDFA 4F4YA 3R1HA 4URQU 2BJ9A 1HBOA 1Q7YT 1F3VA 2BUNA 1FEHA 3EXCX 4EO8A 5D3GB 3QNWB 3MCOA 3BH6B 1VQLS 1T9YA 4EFAC 1C1CB 3PYDA 3MM5B 2KXFA 3OVAA 2KFZA 3O3LA 4HYKA 3MEEA 2R8HA 3LPYA 2FD2A 2Y8YA 3V6DA 2XMMA 4R8UB 4M5MA 2YKNB 3GR1A 1B70B 3TUIC 3JSMB 3CCZA 4J9SA 4K4ZA 1DLOA 2RILA 3W8PA 1M5KC 1PAEX 1S1VB 1UVKA 2LA6A 2LMIA 3G6YA 2D3ZA 1FKAF 5ETSA 3G4SS 1PKUA 5IM0B 3IR7B 4WK1A 2XY7A 4LSZB 5U47A 1WD6A 1OQ3A 4XAKA 3SCLE 5F9LA 4E2FB 2B9EA 3IRXB 3POTA 4DZDA 1Q95G 3H5XA 4X65F 5EDWA 3QYYA 4NPOA 4RR5A 3CF5Q 3J81j 1YJVA 2QZ8A 1UVLA 4ATNA 3CCJS 3Q89A 5LSRA 5FJ4A 3CTRA 4PG4A 3MXHP 2CJAA 2ZC3A 2XBPA 4K7QA 2A18A 2WW4A 2LEAA 3D66A 2EG2A 3Q24A 4URSA 2LCWA 1KEKA 4KHPJ 4JI4J 1TTHB 3K8WA 4LSNB 1D8ZA 2DD8S 1Q7LB 3IAM9 1NNDA 1DQAA 4K4TA 4ZVEA 2E5LJ 4NZ6A 2CQ1A 4WE1B 2E1AA 1Y0HA 4LF4F 2YNFA 5K14A 2MZJA 1UVMA 3W61A 2BJ7A 1EKSA 1FX2A 3AAWB 1TAQA 4X66J 1UFWA 3PZPA 5KFCA 3C6TB 1CLFA 3DLGB 2YWKA 3LA0A 2CVEA 4GVBB 3G71S 4ZDNA 2GX8A 4CM0A 2R7WA 2V5HG 1EKRA 4Y3CA 3M2UA 4CWBA 1IN0A 5HVFA 2AZ3A 2I6WA 2HFUA 2MY8A 4RW9B 2PFFB 1HNVA 2GC8A 3TQEA 2R7RA 4YOEA 2UUBJ 1T8EA 2NXCA 3BREA 1KN6A 1Q8IA 1Q5YA 4DL6A 1U6BA 3L4BC 1SH3A 4LRBA 2V9KA 3DRRA 4Y2CA 2BQRA 2JC0A 4DV6F 1NKCA 1LFWA 1BQNB 3ICLA 5A0YA 2HFVA 1KD1T 4B3SJ 2XQCA 4FYDA 4LFAJ 2WBMA 1R31A 3HHLC 3KLEB 2HSEB 1WTBA 2UVWA 4QYZJ 2H51B 2KYZA 4LF2A 2DNPA 3JTOA 2GIRA 4X4OA 3BGLA 5CYMB 1RT4B 1CQMA 1NJYA 2V9WA 4AE5A 4ERDA 4U7UK 1YRUA 4B08A 1S48A 1RT5B 4DUYF 3M6XA 1DARA 1ACMB 4JB8B 2ASLA 5HQ8A 1LXNA 3Q23A 4MAKA 1XJWB 3PFOA 3KLHA 2G2YA 2HMIB 3US5A 3UD5A 3NXZA 1UEKA 5AJ3F 4Q0BB 5GADU 1LWCB 3AA8A 2ZH3A 1NMEB 3T1AA 1K47A 1K0TA 2DNNA 2VQFJ 4ELUA 2B9WA 4FYWB 2UP1A 3NGUA 1VFJA 2H3EB 4DN9A 2RU9A 3IBCB 4RLEA 2RSQA 1IKWA 4N76A 3DLEB 2LQ8A 4FYVB 1PYTA 5HANA 1GX5A 1WOPA 2C3MA 4ZCLA 3PXGa 4DR1F 5B09A 3ZZUA 2RHSB 1CULA 4JI8F 3VAKA 1YJ7A 3FBCA 3O5TB 1VC0A 2NUUG 4FVMA 2LP4A 1HW9A 4HH0A 1UTAA 3W1YC 3HHKA 1H73A 4R25A 1VQYA 3SBMA 2RUGA 3HDSA 4F8RA 4ZP7A 3RB6A 3MAHA 2KG0A 2QGFB 2R7SA 2B51A 1RAHB 1YTYA 2EFQA 2NUHA 1JNRB 1VIXA 1R0AA 4RUBA 4DR4J 2MQMA 2IBOA 2ZH2A 2ZBPA 3M1VB 2W8LA 1N4LA 3FSXA 5D0GA 6FDRA 4UZBA 4KGKA 3QFHA 3AOCA 3M2RA 1F5AA 2V63A 1FNXH 2ACMA 1NSPA 2X1GA 3OTOJ 1F5BA 2AIRB 4I64A 2W2MP 4MK8A 2HHPA 2KRRA 3JAMU 3SSSA 1U0SA 1C1BA 1SV5B 3ZTQA 2MQOA 1TFWA 1JLGA 3T9ZA 2HIQA 2OMLA 3TR5A 1PIEA 1HD0A 2G0IA 5JUMA 1U45A 1M1KT 4KAIA 1S49A 1MMNA 3I0RB 4Y2MA 1CSJA 2JEIA 5KFYA 1RLDA 2QLJB 3CEDA 3HD1A 1GTHA 1RT7A 4AXIA 1SQEA 3U1NA 1JJCB 1EETA 2YTCA 4P73A 1Z4UA 1HQEB 3ZZYA 2V4JB 3ZO7A 2FLNA 5KFAA 2F9JA 3CMQA 1IVZA 3JQKA 1M1GA 2D9PA 3Q0AA 1TK0A 4C0OC 3UR3C 4RNOA 5EX3A 2C3YA 1L3TA 2F7VA 3T5KA 1IKXA 2YX1A 2KTQA 4YUDA 4KH0B 3VAIA 4HHJA 1SJ1A 4CLUA 3SQGB 3HT3A 1O5JA 2GAGC 3OSPA 1RWKB 2Y1IA 3CDWA 4NA1A 3RZAA 2ASJA 2BE9B 3PYGA 2WTFA 1N5QA 3M9OB 2AU0A 4USMA 3DNCA 2K7KA 3CDAA 2DISA 3KYLA 4IQXA 2VV5A 3BSCA 2QIFA 3EWGA 1H2TZ 3RTVA 2XO7A 2CG8A 5AE2A 3BGOP 1UJ6A 2VJUA 2AHOB 2IYGA 1P9YA 4J9PA 4UT4A 1TKZB 3MDFA 4WXWA 2CNKB 2P8IA 4KGXB 2E44A 3CDBA 5FDLB 2FJDB 4KC5A 1D9DA 5I42B 3E8OA 4F36A 4IDKB 5F8JA 4F67A 5F3TA 3ZZOA 1KOOA 5HMZA 4KGZB 2BEFA 1SH2A 4XPCA 2XI3A 1SJ4P 2GZOA 5SZTA 3V6JA 2LQBA 4OHYA 3ZZPA 1E6YA 2C2OB 3MCNA 1VC6A 2HK2A 2MXYA 3T1YF 4IR1A 4I2PA 4OZNA 4X84A 2FHJD 4KQZA 1OY6A 3N0VA 2GGPA 1S72S 3OLBA 2RDJA 3ZTSA 1WC0A 1IKYB 1QAJA 2ZZTA 2G2ZA 3DI6A 2RF2A 3FEYB 2PEBA 3MM9B 4OX6A 1HPZA 3C19A 4B3TF 4EI2A 1J27A 1KONA 2I5JB 3ET6A 3GFHA 2HEKA 1F1BB 2W9CB 3IGVA 1FESA 4EU0A 3R27A 4RPFA 4JI6F 5J2QB 3KMSA 1R0BG 4CLTA 1W7WA 2B4OA 1SKRA 1HR0F 5J2NA 3CJQA 4ID8A 3M8PB 4QBUA 1EP4B 1U1QA 1HL6A 5AXLA 3TEGA 2XNQA 1XBWA 3MTJA 2WVDA 1XMBA 4KBIA 1S10A 3U27A 4CLYA 3GV8B 2AMCB 3M6WA 4ILMA 1GK8A 4LQ3A 3B82A 2JOQA 4XPEA 3ADAC 1F9FA 1K44A 3GG0A 1KQSR 5DG9A 1RT1A 4V1Ak 4WFXA 4NX9A 2GQQA 2ROPA 3GWCA 2XS7A 2IYIA 4ETXA 1WF0A 3L95X 3M8QB 2B4VA 4M5JA 3NY0A 3PRVA 2ZITA 1RABB 2I8EA 5MAOA 4B3MJ 2HQ3A 2GCFA 4MTPA 1AZSB 2RQCA 4XIUA 2Z56B 4YB7A 1NK7A 4U96A 4ZVTB 5LL6d 3C15B 2XZTB 3WQPA 1XERA 2Z4PA 3MF5A 4NZ0A 2AZ1A 1NJIT 3RG6A 2E29A 1U2CA 3HI9A 1VQOS 4PG5A 1WEZA 1SBRA 4K4SA 1FERA 1XWLA 5H9EJ 5I4MA 3H5SA 5HSPA 4TU9A 1TL5A 4H4KC 2VPZB 2EC0A 4N5SA 3IR6B 3VAGA 5C25A 2QN6B 3PHEA 1FKPB 3JS9A 4XK8C 4TQRA 3TYTA 2IDEA 3GILA 2LLZA 3UDCA 2GVDA 3MM7B 2DNOA 2PFDA 4Y28C 5HATA 2CQ4A 3CJ0A 2HNYA 3M7VA 4P2XA 2G2OA 5SUHA 3N9UC 1R8BA 4O3OA 4AUKA 2H4YB 3KUEA 3DLJA 3D6TB 3V6HA 2W9BB 4DF8A 5I3UB 3EX7B 5E3AA 3I5CA 5HJXA 2PGCA 3U1MA 1RHKB 4DN0A 1X4CA 2ZVIA 1HBMB 1FHTA 2B5JA 2E1PA 5D8HB 4DEZA 5EN1A 3PIPQ 4UY85 2V8PA 1RYSA 4V19J 1RP5A 3HP6A 4UQGA 1X5PA 3BKTA 4ZCMA 4CO1A 3K57A 4JI1J 1P6TA 4BDPA 4DLEA 4WFZA 1FNMA 3L09A 4J90A 1Q78A 3RR7A 4JV0A 5FD1A 2JRSA 2YNGB 4ECXA 4PWUA 3FDSA 2VB6A 2WSCC 3G8TA 3TX8A 4DI6A 2OFGX 5KT5A 1T3OA 4OLOA 4S0MA 1VCTA 2XSJB 4DLGA 2WVEA 4XDCA 2K1RA 3QIPB 2LDYA 3KJQB 2GQ2A 2VKRA 3VVUA 3EPIA 3FK4A 5GAEI 2ZE2A 2N4CA 3JSRA 3G8QA 3MPDA 2BR0A 4JYAF 2DCLA 3MWBA 2V4QA 2BBEA 4JV2A 2R8IA 2PN6A 3MMBB 5HAOA 1SL1A 4P7TA 3OXLA 2FLPA 3KK3B 4RO0A 5L1LA 5K5MA 2O1PA 2Q6BA 2MZQA 5A8WA 3OFHA 2XY6A 3FQLA 2WOMA 2WRMA 4LBHA 4MH8A 4IH5A 2KFNA 2VBYA 1TKXA 3EGVA 2FPHX 2KVIA 1BD6A 2F3JA 2XYHB 1UWBA 1U26A 1WG5A 4IG3A 3LP0B 4X4VA 3Q22A 3R2CJ 1PG5B 1MN9A 3B78A 1XQIA 4KHMA 1RGVA 3C6UA 5DRKA 1BWEA 2L3MA 3D1QA 1T0TV 4MFBA 2GIFA 2GMLA 2QLFB 3HFKA 2HHUA 3PKMA 1WHWA 2MJNA 2VG6B 3UD3P 3JTNA 1L5UA 2YKPA 1GAOA 4NZ7A 2B4UA 5ETPA 5B0DA 1SC4B 4G6VB 4LR8A 5L39A 1OWXA 1LWFB 4DFKA 5EWGA 4BBYA 1NK6A 4JI2J 3FMBA 1TVRB 5I3PA 5C24B 1MMLA 3PACA 4A8SA 4G1PA 1U1PA 2YBVA 2BXJA 4C8MA 3E01A 2IVMA 3M32A 4W92B 1UP1A 3MR2A 3DM2B 3DYAB 1K8AT 1LW2A 2VFTA 1RHRB 5AXKA 2LDIA 2LEPA 1KVIA 3PW4A 2JX2A 2OPPA 2CNLB 3TAMB 2C2EA 1V6HA 3IBFB 1KWMA 3CD7A 2J8AA 3EJMA 4C8OA 4ZCKA 2UZAA 1WUUA 4C97A 1GXTA 2DH9A 3Q83A 2OP5A 1SKUB 4FF3A 2ZVSA 3UI3A 1RJJA 3CC2S 4YQWA 2DH7A 3HVRA 4F25A 1DTTA 1RTJB 2V0NA 3F56A 2LQJA 1K9MT 2P9CA 3I5BA 2VD3A 2AEFA 4IQMA 5BR8F 3D3CJ 1PJ5A 1VIOA 3EGNA 5CD4H 4ES1A 4Y34A 3FNNA 2ZNZA 3MAAB 4DV5J 1FTRA 2HNDA 3DOKA 3LO3A 1VQPS 3M2VA 5ETOA 2AV5A 3DLKA 3GYNA 1PGZA 2HWHA 2XYGB 5KT3A 1Y5IB 1BHNA 2A6OA 2AF6A 4W90B 3K8VA 5H9EK 3VAJA 4CTAA 1CJTA 2J7UA 1U1MA 3TVKA 1RAIB 1RT2A 5HJYA 1OIAA 3MCSA 1X0PA 1SCJB 2V50A 4EEYA 4NI2A 3NNCA 1GMUA 3WDOA 1R8CA 2WW8A 1FXRA 1NLKL 4LR7A 5LXYA 3O8WA 2DVIA 1WDTA 2VFRA 4LRDA 4MT1A 1HNZJ 1CVJA 3FBEA 1ELOA 3R2DJ 4JV1A 4K4UA 1Y9OA 2YWGA 3TUPA 3SCIE 1JXEA 2N3LA 3MM6A 4Z7CA 1DTQB 1KOHA 4RW7B 2MHEA 1YITS 4LF7J 1HMVA 1C0TA 4O4RA 2R7QA 5DG7A 1NKEA 1XNRJ 1WC4A 2RKIB 2MLXA 3MPVA 2E1RA 4DQSA 1JLAB 1RWXB 1RAGB 5DJBA 3I4HX 3MMAA 4KTQA 1W25A 1OYEA 2VC0A 4DQRA 5EUHA 4OI0A 3H40A 1PYSB 1GQEA 4K4YA 3PEHA 3LAKA 4X64F 3T5HA 1UVNA 4CNYA 2HS0A 1KHWA 3I9ZA 3TO8A 1LW0A 3ZNJ1 1SVDA 4I6YA 3NNHA 1L3SA 3CNQP 3J7AN 1ZYQA 3OR1B 2R7OA 4ZMMA 1CS4A 2PDAA 5E3RA 2DRBA 4A8YA 2KFYA 5E7OB 2XS2A 1JWWA 1YIJS 4NYZA 2OD4A 1UFKA 1J2VA 4IFYA 2QLWA 4JV5J 1TL3B 2Z0GA 2P9GA 1JLEB 2XGQA 1U0HA 4U6PA 4OV1A 1IUJA 4DCJB 3MEDB 4ECQA 1HNWF 2AJFE 1JXVA 5KFWA 1OQ6A 3PRBA 4DSIA 1XMQF 3EZOA 1YBTA 1U47A 4I7FB 3PJ9A 2AT1B 2KXHA 1JLBA 2OD6A 1RHJB 4OLPA 1CJUB 1VISA 1XMOJ 3MCMA 3T1HF 2ATLA 2W7PA 4ECZA 1K73T 3BGRA 2YKAA 3DU5A 1TFYA 2VZ9A 3A3PB 2K8GA 3AD7C 5AXNA 1O6XA 1RT6A 3J80U 1TL7B 3THPA 4B3RJ 1ZM4A 4MK7A 3B4MA 4RL1A 4MJKA 3ZTPA 4E98A 4IG0B 4H4OA 1WEXA 2BMBA 4URGA 3CW2C 1HNIB 4C0BA 3EUNA 4FNHA 1TV6A 1JLQA 4DL0C 2M7SA 2CQGA 4DV4J 2MSTA 4OZ5A 5KFTA 2ZDPA 4M95A 5CZVA 4USUA 3UVJA 1DQ9A 1RAJA 2WAQD 3QSIA 1UCNA 3W5YA 3UN3A 2VODA 1YLXA 4RW8B 2POKA 1N5YA 1R8HA 4P72A 2MZRA 1URRA 3Q8SB 5B0FA 1V3SA 2KXNB 1MROA 4TU8A 3W63A 1RHUB 3ZZTA 2CNOB 2SXLA 1VQ6S 2D3UA 4LF6J 1N33J 2E1MC 3CDUA 5F8HA 4LQ9A 4ED5A 5KFHA 2AYMA 4QWCA 3O2IA 1M1HA 1YGYA 2BJ8A 3DOMB 5B0BA 4FXWA 4RWXA 2YWEA 2V6AA 1B0PA 2VBZA 1I94J 2VDIA 5DLGA 1EQ0A 3THTA 2HVZA 4EK2A 3LAMA 4KKOB 4OJ3A 4Q8EA 4LVNP 3NGDA 1S6PB 4O23A 5F3ZA 3OL7A 3RB0A 2CPDA 2IA6A 3KKFA 3HHEA 3SFUA 1I51B 3IXQA 2YPZA 3G86A 1WDDA 3DXSX 3BDEA 1IKVA 3D1OA 2AJ4A 4RBTA 1M5HA 4X4TA 4U8VA 4OYXA 2UXDJ 1SB6A 3H7HB 3KOAA 2MQ8A 3K5NA 3MD1A 3RUBL 1S1UB 3W65A 2MQPA 3U02A 5A6PA 2DTJA 2M88A 1HYSA 1EJ7L 5D4LA 2DHAA 1GFWB 4NLTA 1RTDA 1AUSL 4YY3F 2KH9A 2FYXA 3W8GA 3QJPA 1GXUA 3HVTB 2UUCJ 5JJBA 1PC5A 3D0IE 3OHAA 2FJWA 2W01A 3AD9C 2UVVA 2J0WA 4HDHA 3N79A 4TY8A 4RWWA 5B0EA 3KTQA 5J2MB 2HYIB 1TMMA 1F3FA 3W9HA 5IZHA 1G1XA 4CM2A 2VA2A 1SJRA 3MZIA 2Q66A 1YJTA 4O44B 1MMDA 4O3RA 1WWHA 4WP8A 1M0SA 2LXIA 1FWLA 2ABYA 1D3WA 1S9EA 1HBOB 1KQGB 1NSAA 1TQLA 4ZVPB 2ZD1B 1X7VA 2L9NA 1IJFB 1KS2A 4ZHRA 1RQ0A 2B0GA 2XCAA 1WI6A 2BW7A 2BANA 4Q45A 4QWEA 4BLGA 5CA5A 2FJXA 2HBYB 3F73A 2LU2A 3KLGA 3V6DB 3FZBA 4DFPA 2OGUA 2DHSA 1N88A 2FHJA 2YKMA 3CD5A 4QWAA 5DO2A 2GVZA 1DLOB 4NLOA 3J7A1 3OLAA 4EO6A 1YSJA 1FJ7A 4DV0F 1B0TA 1N36F 1OJ4A 4DV7F 3OXGA 3NWGA 5C2CA 2JFKA 5D78A 3ZZ0A 1RB0A 5J1EB 4IFVA 4YDXA 5F8IA 3GR0A 2JNJA 3POTB 4QW9A 4O3NA 2MKYA 3J7YI 3HFZB 2F8MA 2AGQA 5J1PA 5KG1A 2LKZA 3NOGA 2RRAA 3VGTA 2LYVA 3T19A 4N41A 2Z2LA 3H4DA 2F8HA 3RBXA 2W7AA 2I38A 1OO0B 4YHHJ 1RAFB 2HVIA 1SQFA 1J5OB 3B4DA 2JZ5A 1GMWD 2CRLA 4DR2J 1KQFB 3MOZA 5F41A 4NLRA 4ZN1A 1CC8A 2NQPA 1E6VA 4DV1J 3UR0A 4DL7A 2VIHA 3AY0A 1RLCL 3W64A 3KNAA 3N5BA 1AUDA 2E7WA 2ZWPA 2WB4A 2LXFA 1HARA 5K14B 4DV2J 2C2NA 3D54A 2W2OP 1S4EA 2J9EA 2HQIA 3TQ1A 2B8PA 2V94A 1T9TA 2QL7B 4PYAA 3IWXA 3HKWA 2OPSA 3WC2A 1ZA2B 1ZETA 3I9V9 4IOCQ 1NB2A 2JVOA 3M2UB 1FDNA 3MM5A 3KK1A 2LQ5A 2IM1A 2H1YA 2PT0A 1TZ0A 3VAMA 2ZM6F 4ECVA 3D67A 4WYLA 1YJNS 2L48A 4OX9J 1XR5A 5D4OA 5CABA 4J9LA 2OPQA 3K5OA 3DRRB 1BE4A 4I68A 1VJQA 4DX8H 4Y00A 4ENOA 1PJ7A 4NCAA 5A0YB 2F9DA 2ATCB 1SJFA 2DH8A 1TK8A 3BQ0A 3PX4A 1S1WA 1ZM3A 3KG1A 1UEVA 2CJ9A 5DQHA 4B17A 1VRUA 1MN7A 3SCKE 3IRXA 3I56S 1U4BA 4F3QA 4OHWA 1UJ5A 4OI4A 3BPDA 1RBOB 2AWZA 4M63A 4B3TJ 3WZ0A 1UAWA 2QSFA 2YWHA 5K8NA 3PW7A 4J5OA 4M5KA 3H8YA 2F65A 2DGVA 1PCAA 3QAEA 3MPUB 4RKUC 4JI6J 3ITHA 3KLHB 3RAXA 4W98A 1BC6A 4QR2A 7FD1A 3G6XA 1FXLA 2HURA 1HR0J 3F41A 2ALZA 5KAKA 2DIVA 4G65A 2DPIA 2E5GA 4OHXA 1PO6A 4DPWA 3DGPA 1C0UA 3GQCA 1TELA 1IKWB 1VQSA 2MQQA 2LFVA 1VK3A 3PCOB 2O3DA 5E0OA 4WKYA 1CULB 3NGRA 1SIZA 3P5BP 2MPUA 4USKA 3JQJA 4USHA 3VZHA 2JHEA 4FXDA 4FDFA 2HS4A 4GVBA 2F40A 4F02A 2B7BB 4DWIA 2Y9HA 2FTRA 4ZVQB 4DPXA 2FJEB 1VHFA 3THVA 5A76A 4K5SA 4KGVB 2LQ9A 3ZFVA 5ETQA 3SSQA 5F9NA 4ZPTR 4DR6F 2BJEA 2C3PA 2FVQA 3BJYA 1S0MA 1AT1B 1HWLA 1WOSA 4DX5A 1QAYA 4I1TA 3M2RB 5KT6A 4DS4A 5B0AA 2E66A 4AFFA 4FKYA 5H9FJ 2DGOA 5K8PA 5A8RB 2YX4A 1VQ5S 2HHQA 3D68A 1UFLA 4L75A 1F2HA 1HNXJ 3QJLA 2QLXA 2XMJA 1URNA 3BN7A 1C1BB 1U6FA 3HO1A 4DR5F 1T7PA 3PO5A 3MEKA 4CNZA 4DSFA 2UVRA 4J9OA 1P1LA 1Y3JA 1RSCA 2EPIA 2LXUA 1JLGB 3OJSA 5IQQA 2LA4A 2V4RA 1R8PA 1VBKA 2BX6A 3JQMA 1TK5A 1DRZA 4DG1B 3MR3A 2HMIA 1NSKL 4UOGA 4FF1A 4Q0BA 3FCHA 4L72B 5KG0A 4QR1A 3QT5A 4OYAA 4B02A 1H38A 1R27B 1RT7B 3I32A 2DR7A 4Y0FA 3N4WA 1EETB 2M52A 4UOCA 4ZP6A 3TZWA 1QAXA 2CPEA 3DKDA 2FUG9 4KFBA 4C7QA 2N82B 4DQQA 2U1AA 3ISND 3UNYA 2Y1RI 5EGYA 2XMKA 5C42A 1IKXB 4XDDA 4C98A 5IQ6A 3OHBA 4FKXA 3IMQJ 4K0KF 3BH7B 2ROGA 5D4NA 1X9WA 4I56A 2N3OA 2YWFA 4EBCA 3NP5A 3LGMA 2W7OA 4TVAB 1T9VA 1IBMF 5AE1A 4ZOSA 2JSXA 4J9QA 4JBCA 2UVUA 2IDLA 3DFEA 4UZCA 3GTYX 2RHQB 3D0GE 4TN2A 2YH1A 4M5HA 4JUZA 3KFWX 2DHGA 3R5AA 4LMZA 3OQ2A 1HI8A 2C2KB 2K06A 4K8RA 3V2UC 1LWEA 1JKHA 2DGTA 4DQPA 1EZZB 1NUEA 2NXNA 4OJ1A 3NCPA 4JI7J 2VOPA 2Y3YA 1Y5NB 4KGMA 1R89A 3IP0A 3BO2A 1UVJA 1FDBA 3UDLA 2IRUA 2DHHA 3DXBA 2JWNA 1FKOA 3B6BA 1UVIA 2CFXA 3FUYA 1RI7A 2ZHBA 1H72C 3HJVA 2FB0A 3BBFA 4OYMA 2XLKA 2YQ3A 5IT9U 3DLHA 2FVSA 4GKKJ 2CDQA 3MECA 4OI6A 1ICEB 3K2YA 2Z2ZA 3TAPA 3H0PA 4ZVGA 4FN5A 2FC8A 5EWEA 3EZ5A 2BM1A 1WSRA 3IFEA 3I55S 2Q43A 3CCWA 1WHYA 1S1TA 1FX4A 1LNQA 4DPYA 5J2PA 3AT1B 3C2PA 1RU2A 4TLQA 4Q5VA 1NHUA 2ZH1A 3MAQA 3TARA 2BKPA 2GGPB 1X0FA 4ZPWR 1HQEA 5LXRA 2DXEA 3IS9A 3TA1A 2Y1LB 4CZCA 5HROA 2A10A 5FLXY 3DI6B 2RF2B 3A8EA 4UW2A 2CQ2A 2DITA 1U09A 2ADCA 2M4MA 1HWJA 4X4PA 3OVSA 2CVIA 1YBUA 3ET6B 1ROFA 3AODA 3LP1B 2DNZA 3CC4S 3LWLA 2R7TA 1VI7A 4NWBA 4WZQA 1WC3A 2PMHA 4KHPF 2X1AA 4JI4F 2HNZA 4FP9A 1S6UA 2R7XA 4FBTA 3DRSB 2H9ZA 1RTHA 1MG7A 5KT7A 7AT1B 1HBNA 3FRYA 1U8SA 4X66F 3QAUA 5GMEA 4OI3A 2MEWA 4LT6A 1I1GA 1FDAA 1RHMB 4ES2A 1RT3A 3VQTA 2R2TA 5JVGQ 3ZNUA 1RT1B 4AQYJ 2AP6A 2P6SA 3D0HE 4ZLPA 4O3QA 1VC5A 1X4AA 3DLBA 2M3DA 1U1LA 6AT1B 4PQUA 1TUGB 2Q1LA 1S57A 3FC9A 2UUBF 1K1SA 3I4PA 4FBUA 2B43A 3E2EA 3AHPA 3SV4A 3KK2A 3FEXB 4HACA 4BC7A 2WVBA 2DB1A 1GXLA 3RW6A 1N5VA 5BR8J 2H48B 2KHCA 2B4PA 2QFIA 4B3SF 3QGPA 3CIZA 3ZC4A 2H5IB 3GJTB 3T6BA 2HHWA 3KUHA 2HVDA 1NJZA 3LP2A 4C3LA 3MFIA 1EAYC 5T7LA 1N0VC 5KFPA 4ER8A 2HGNA 4ED3A 5L1JA 3GIKA 4WYWA 3W7BA 1JMTA 3G87A 1N0UA 1G6BA 1HI0P 3FVYA 4CO2A 5C25B 2WZ1A 1HI1A 1JQGA 1NRKA 1YRTA 3PX6A 3A8KA 1X4FA 3F44A 3HHLB 4DL4A 2GVDB 3GMGA 1RDRA 1IBKJ 4TYBA 1CEZA 2I9SA 2HNYB 2QC3A 4P2SA 3R3TA 2CNNB 4NLPA 1KLMB 2VQFF 1AB8A 3T9NA 3M8PA 5E3QA 4ELTA 4Y2KA 5HQLA 1OS5A 1YVFA 5D15A 2G1DA 2UV8G 1T9WA 1N34J 3OFGA 4U95A 3OPKA 1U1RA 3BDPA 4FYYB 4H54A 5F8NA 2B5JB 1MSWD 1IBLF 4GC6A 4DQIA 2KN4A 4QIVA 1SH0A 4Q44A 3M8QA 1KVJA 2ZBCA 2JL9A 3NEKA 2W2NP 4Y6IA 3D5MA 3NAHA 3BO3A 1IWGA 5LMNF 2CJKA 2Z2YB 2IMWP 4HI1A 4ECUA 1K0VA 3PO4A 2VJVA 2EG1A 2PC6A 1V3RA 1DZ5A 4KJIA 4DR4F 1FVQA 2CQBA 2QJ3A 2CAJA 5B08A 4WBFA 4K4WA 4OFZA 2OTLS 2J0SD 4OJHA 1SQGA 2QA4G 2DXFA 2HRYA 4NCBA 4J9KA 2OFHX 4I4BA 2BOAA 1C4CA 2RMLA 3QLHA 4USJC 2HVHA 5ETRA 3M8YA 4ELVA 1JX4A 3ISNC 3KHRA 5GAHU 4LJMA 2YNIA 1KR4A 2BJ3A 3D6HB 1XC9A 5CYQA 2XHCA 3KLFA 4RBUA 5C7PA 2KYXA 4DXLA 4M8LA 3BYPA 4TKTA 1I3OB 5A8WB 4GO5X 3DMJA 2WOMB 3P6YC 4PUOB 4KY3A 4TYAA 1NJWA 2RUSA 2FHKA 2FIUA 1WF1A 1GMVA 2W2PP 3QRQA 1M5SA 4KHRA 2FLOA 1EX8A 4WFYA 1LEOA 3GFZA 3FSIA 3G96A 4PXEA 1UWBB 4KPYA 4IG3B 4RX6A 5L8RC 5BYSA 1YJ9S 2VG5A 5L9NA 4C8NA 2DEIA 1QE1A 3C6UB 3BF4A 3BR9A 4DL5A 1F9EB 2CPXA 1UPPA 2DR5A 2DCUB 2MZ1A 2AJ1A 3T6JA 2DHXA 4QWDA 5RUBA 4ZPCA 2CZ9A 5L38A 2IMOA 2XS5A 1T03A 2R2SA 2XMWA 2VG7A 1VHIA 1N5TA 2QYGA 1A7GE 3VVTA 4UF4A 3GJSB 2DY9A 3MR7A 3E01B 3FCWA 3M32B 1N52B 1WI8A 1Y00A 4MYUA 1LOUA 2IJRA 1LW2B 1AA1B 2MGZA 4LBPA 2AJ0A 2OPPB 1QD1A 5F0WA 3MMCB 5B0CA 3QQCD 2HK3A 3W9JA 3KDOA 3GPAA 2XCPA 4IO1A 3CXCR 3OUYA 3UD4P 4B9VA 4QIEA 3IWNC 2CYYA 4BWJA 5JMNA 3RB4A 5LT5A 5T41A 1WKJA 3RBEA 4OI2A 2A3JA 4CO0A 5IV4A 3OT9A 1MWQA 2P9EA 3EM1A 4L76A 2ZH8A 4B3OA 2DPJA 4YR2A 4BHQA 3HHDA 3TA2A 4NEYA 5E33A 1Q8BA 4ED1A 1AYEA 2HNDB 3DOKB 2XMVA 1HQUA 2DJWA 2XNRA 2B6AA 2YKQA 2Q79A 3M2VB 3M30B 5K20B 4ID5A 4ZIWA 4PZVA 2HVEA 3DLKB 2PD1A 2XB2D 1FJEB 2R3VA 1RTIA 3WX4A 2LECA 1KSPA 1CJVB 1ZAWA 1GMWA 2KJWA 2BJ1A 1U2FA 1X4BA 3NOCA 4CO5A 4MKAA 2C22A 1Z1ZA 3G82A 4CTAB 5T14A 3GIMA 3IN5A 4PAAA 3VQSA 2AEJA 1MW7A 5THWA 3VCDA 2KKHA 3QBCA 1Q16B 4DFMA 4O0NA 3M4XA 1LWFA 4PWDA 3OL9A 4K5RA 5MLCV 1P27B 1Q81T 3HSJA 3HZEA 5C5JA 2VICA 5C24A 1YBAA 2CA9A 4CI0B 5K8OA 2CQIA 2IM2A 2CWXA 1T9XA 3N6NA 3W9IA 1GEHA 2OEJA 3W5ZA 3ISZA 2LU1A 4QOTA 4ALZA 3AB4B 1DURA 3MM6B 1HMVB 1C0TB 2O5DA 2BABA 1R6VA 2JC1A 5IC4B 2I1RA 1Q79A 2FZKB 5KFJA 5FLXU 5LSOA 3R9LA 4DR7J 1T95A 1T9UA 1U25A 2J7WA 3MMAB 1N32J 4IRDA 2M2BA 2ZZMA 3EVMA 1FFSB 1S9FA 4LFBJ 3L9ZA 1YJRA 2XHWA 3QMQA 3MEGB 1NSQA 4B3MF 4YR3A 2OLWA 1Y4ZB 3CCLS 5HL7Q 3QZ7A 1DFDA 2DNHA 2W24A 1S7IA 4CLPA 4M5IA 4YP3A 2WSFC 3GCWP 3QWPA 4WXOA 1IR0A 1KFDA 3MI7X 4HT5A 2HHXA 2CQ0A 5KG3A 1CS4B 1YDLA 2IBKA 2AGOA 4KIAA 3DHXA 1MLAA 3G2XA 4QU7A 1JB0C 3W5XA 4CT8A 5AXMA 4EWTA 4HTIA 1KNZA 2XLJA 4LRAA 2ZKTA 5IT4A 2WB1D 3FBBA 5CCMA 2WSEC 3OTDA 2AW0A 3EICA 2GMHA 2BE7D 1XNQJ 2HGMA 2YQ0A 3JYTA 4C11A 2MMYA 5KTQA 2UXBF 4FNIA 3HX9A 4ZLLA 4JI3J 4BCAA 3QT6A 3QRPA 2PI4A 2GMJA 1S76D 2ZKUA 2CPYA 1JLBB 4H4MA 3R7BB 8RUCA 4GKJF 4ZVUB 4PG8A 2DT9A 2NYHA 3GB0A 4V19X 3OW2R 1MU2A 3FBFA 4X4RA 4R5PA 2AJQA 4DUTA 3BGRB 3MFHA 3GSDA 3L7UA 5DETA 4X4NA 5DDOC 3M8RA 3TUJC 4JP8A 5GADI 1ZS6A 3CWJA 4PXBA 4RW7A 2FY8A 1G3OA 2YWWA 3NMRA 2CZVC 2FZCB 4OYIA 2C2DA 3J7ZT 2WBRA 1BWVA 4DFJA 2GHPA 4H4OB 5IC6B 2RKIA 3ILOA 3BSNA 2C2RA 5HMYA 2ILYA 1JLAA 1B3TA 4I6WA 3FEZA 2VPYB 4USIA 4JI1F 1JJHA 2HKEA 4KYZA 1JLQB 2RVJA 2M8HA 1M90T 3UCGA 1YJUA 2V68A 4XTTA 2CZ4A 3H2VE 4K2XA 1FD2A 3M8WA 3UVJB 1B7YB 5HVGA 4DR3J 3NBPA 3PR5B 5GAGU 5GVQA 2QV6A 4C8ZA 4NXNJ 4X4SA 5IFMA 2UUAJ 2ILZA 1N5YB 4NRTA 5HBMA 1V5VA 2HHHJ 2EBGA 3FGVA 4JI5J 3SIPB 1RWWB 1MROB 3D6FB 3K5LA 1QSYA 1VDHA 1NU4A 2CQDA 4GRSA 4JI0J 1F9HA 1N6QB 3CJ8A 4QJVA 3ETOA 2KM8C 2IJFA 2RT3A 2VU5A 3VR1A 5D6GA 3CPWR 3C46A 7FDRA 3FFIA 1JLEA 2R8KA 4DPTA 3X1LB 3D9BA 5CD4A 1ITPA 2RS8A 2ERRA 1PJ6A 2HFOA 1ZA1B 4M5DA 3VAHA 2VQEJ 4AL7A 4P52A 5KG4A 2V2QA 2E9ZA 2DNGA 2MY7A 1VQ8S 3GZ7A 2VBWA 3RAMA 1APSA 4NLYA 4AXJA 1FJCA 4UOHA 2NREA 9RUBA 3NGSA 1TUWA 4DL3A 3Q2SC 1IKVB 3L7PA 2BE2A 3HHLD 4CLZA 3M6UA 3FZ2A 2KHDA 1TL4A 3LGNA 3TA0A 1CG2A 1LV5A 2LEBA 3N6LA 4DJBA 3UO0A 1IM6A 1RUSA 1WHVA 4OHZA 3HZGA 3RR8A 2QEXS 8AT1B 2XMAA 2QX0A 2N7YA 1OPIA 1HYSB 3RU0A 2Q3PA 2A2DA 2O66A 5DS7A 1FRXA 1X5OA 3WIVA 2VFUA 3NGTA 1RTDB 5LMUJ 2D69A 1RCXB 4L74A 3JAMY 3CJRA 4DUZJ 3VALA 1T05A 2J8SA 1S1XB 1X31C 1O8BA 1XTZA 1S6OA 2V2KA 3AOAA 2PE8A 3ENWA 2D3OR 4JI2F 2D41A 3P8BB 1XEZA 2RQKA 4TU7A 3W2WA 1R43A 2CPIA 3OR2A 3KMQA 3H98A 1F6TA 1AFJA 1P1TA 3CJ2A 2J9DE 4OZ3A 2HBQB 4NLVA 2C1EB 3M8SA 3TW0A 2ROEA 3H90A 2E5IA 3CE8A 3DRPA 5CH7B 1S9EB 3HVAA 5L1KA 2QMUB 4PR6A 4QW8A 3HXMA 3RAQA 4RJVA 4HLBA 4D3GA 2AYEA 3KUGA 2Y0BB 4ZHRB 4DV3J 2BANB 1RA6A 2MB0B 2ASDA 4AL6A 3B54A 3C14A 5K9FA 3DOMA 4EYIB 5KFZA 1SKWA 3KLGB 3PW5A 4CH0S 1D09B 4NEZA 4YMEA 3QT8A 4NL5A 2YKMB 4CP5A 2GVZB 2IC3A 4LVOP 4A8WA 4P10A 2RRBA 4OIXA 5KFXA 2K3IA 2CPHA 3C16A 5CAAA 3MPYA 1CC7A 1L3KA 4J9MA 1NDPA 3R6GB 3LGHA 3AD8C 4DV5F 4WWSA 2BA9A 4IFVB 2IFXA 1S9GA 3CCSS 4CLFA 3SV3A 2IRXA 1JLFA 2RD5C 3I0SA 3TJ8A 2ACYA 4KT0C 3R5GA 5HN0A 4NXMJ 5HQMA 4NLXA 2XM3A 2HRTA 2E9RX 1TU0B 1NXIA 1KVKA 2N4DA 3NAIA 4KV8A 5E2QA 3ZXWA 2UU9J 2QO3A 4C0HA 1V3ZA 3EVOA 1UW4A 4ED0A 1TKTB 4MIBA 3CCVS 4PRFA 2OELA 4DX6A 4X62J 1GT8A 1E6VB 4ILRA 3QT7A 2ZUAA 4L3NA 1S5ZA 4PEOA 1HNZF 2U2FA 3D1HA 3MM8A 4I2QB 5KFOA 2JH3A 3QGGA 4WIIA 1TL1B 5BXIA 2OKQA 2V34A 2GJFA 1ZOTA 1NZ8A 1WELA 1XNRF 1SI9A 3D28A 2CDRB 2OPSB 3X3UA 1UPMB 2MTLA 1VRTA 2XMUA 2ZD1A 1U48A 3I87A 1TMJA 3GIJA 3DRXA 4J9VA 2JVRA 3KK1B 2GA7A 1RE1B 2PIIA 2EK6A 1FTCA 4MYTA 2M5YA 1S0VA 2IHR1 3SFGA 2B8QA 4OL8A 3A8IA 2WVCA 2OPQB 5K8MA 2RH3A 3QO9A 1PILA 1LXJA 1WJ9A 4NLGA 4IH6A 5A8KA 3M8ZA 1IWAA 1S1WB 2FVPA 3VGVA 1RWOB 1A9NB 3Q8YA 5J1EA 1VRUB 3GV7B 2BACA 3WX8A 1L3VA 4F2RA 2DYAA 3NWRA 3RBZA 1VBYA 1HFEL 4M5NA 1FWKA 3R97A 4JV5F 5HLFA 3CO9A 2VC1A 4AYBD 2CJBA 4ICLA 2J6SA 4PPZA 1CBKA 2WHOA 1X4EA 3K5MA 4G1QA 3NS5A 1CJKA 4WU2A 4KRWA 2GNKA 5G4DA 4LFCJ 3VTIA 1C4AA 5BYRA 3ITHB 3C3LA 1ZM2A 3AJ2A 2XY5A 2LVWA 1J5OA 2AD9A 3CC7S 1T11A 1PAUB 3EMTA 4LIRA 2DNKA 1XMOF 4LF5F 2HHVA 2IY5B 1REVB 2ADBA 3KLVA 3DGPB 1C0UB 5IOLA 3PV8A 1O0PA 3RJMB 2OJ3A 1B7FA 4TQSA 2BKOA 3BEGB 2AYBA 4B3RF 4LF9F 4FZVA 5I3QA 2HWIA 4NMLA 3ZTOA 5IWAJ 5D77A 3ILJA 2V8DA 4R0EA 3CUNA 1OMSA 1XR6A 2F4VJ 2C3OA 2ZDOA 1QM9A 1X9SA 1I5OB 2XULA 1QUVA 4DV4F 2ASYA 3I31A 4B9LA 4P71A 2ZNYA 3V4IA 3DOLA 1HWKA 4F26A 2YH0A 2UXCJ 4LR9A 3GSIA 2OMOA 2DBBA 2A2CA 2KB2A 1HBUA 2HZVA 2YNHB 4ANDA 1QDUB 2PMZD 3CJ5A 3Q8QB 1Q8LA 2BDPA 2FGOA 1FD8A 4HKQA 3IG1A 4L3KA 1AW0A 1Q8KA 3UFCX 5KFRA 2B3TB 2FVCA 1WOOA 4LF6F 3GU0A 4DHVA 1N33F 4LSLA 1NCLA 2MQLA 1KRPA 2L9DA 2GJ2A 1GTEA 4ZCIA 2E7XA 1IJEB 3GYXB 2OO4A 5CZXA 4P2MA 1KDNA 3WIUA 4YB5A 1I94F 2JEFA 4LF8J 3PJXA 1YK9A 2KT3A 3GONA 4RW4B 1BQMA 4ANCA 1PYOB 3A1YG 3TRGA 4KE5A 2WONB 4ED6A 1LWXA 2QL5B 2GO9A 2NPIA 4RW6A 2NR0A 2K7JA 3NMAA 4C3KA 1U7LA 5HO4A 3KWMA 4QPXA 2VKZG 2UXDF 4UOFA 3R5JB 4EGLA 3NNAA 2DIUA 4WPAA 3KNGA 4KFBB 4CYUA 3IM8A 1XK8A 1QSLA 1KBRA 4E8UA 5E41A 5DG8A 4N7TA 5LM7E 1SL0A 3W60A 2BJDA 2DK2A 2RE1A 5C42B 1IBLJ 2YKOA 4HH1A 1W2BR 2UUCF 1LK7A 1NAQA 3H2LA 3N5FA 4OZLA 1NK8A 2WCXA 3N01A 4DX7A 3I5AA 1HWIA 3A8JA 2W4PA 5LMNJ 4PPDA 2E5HA 3MGJA 1FF2A 5DM6Q 2R2RA 2QE5A 2RAQA 2D74B 1FFWB 2QG9B 2X1FA 4X65J 2V69A 2VFVA 1LWEB 4K59A 4A8QA 1JKHB 2DR6A 3RRHA 1KHVA 1S77D 2KL8A 2L9WA 3DHWC 2HIYA 4IOAQ 5KOXA 2VHGA 1XN9A 4ZS6A 2G1HA 4IYQA 4F7VA 2IAJA 1QAIA 1Z2LA 4I6AA 5A8RA 2C28A 1X4HA 4ZA1A 3FSYA 3Q8RB 1RWPB 2H4WB 3GP9A 1FKOB 5LOQA 4BS2A 1UJ4A 1SJ3P 1EHWA 4OYOA 5LJ3Y 4RUHA 1UL3A 3NRBA 4LF4J 3KLIA 3U7JA 3BV8A 4J91A 1SUQA 3MECB 3PM9A 4QIGA 3HSDA 2HW3A 1D9AA 2E9TA 4DG1A 2M8DB 2IIHA 1S1TB 2DY1A 1S97A 4A4JA 5J2PB 4CLLA 3QGIA 3PEJA 3OL6A 4K2JA 2Z8QA 1NPKA 5KFLA 3FMWA 3LQVA 1U1KA 2AGPA 1ZAVA 3W3SA 4GC7A 2Y8WA 3IS9B 5KG6A 4U7CA 5HROB 2MKSA 4YFUA 1FK9A 3H59A 1J5EF 2QA2A 5D0RA 1NPRA 5CCLA 2VBXA 3MUMP 3LTOA 2ZJRQ 2BRLA 5KFVA 2I0XA 1RISA 3HULA 4Q8FA 4DV6J 4YHHF 2DO0A 1VGYA 4RUCA 4NCGA 4DSEA 2BZ2A 2G0CA 3QRRA 4WF9Q 3U1LA 5AT1B 2JLGA 1JLCA 3D2WA 4DR2F 3VV2B 2C2MB 1DQ8A 2HNZB 5ETTA 1ZPWX 2OPRA 4DV1F 3GIIA 1K1QA 3C66A 3RW7A 4LIWA 5DDQC 3S8SA 1RTHB 4ECTA 1OSDA 3R8YA 1H6KX 3UQSA 4DV2F 3P49B 1HBNB 2RS2A 4C2MA 3CCMS 3AJDA 1KC8T 1RT3B 3RRKA 5G0RA 4DUYJ 5HMWA 4GVLA 5F8GA 3PFEA 4L6V3 1RAEB 4QIFA 3K89A 5F8LA 2DNLA 3LF0A 4FS1A 3AQPA 3BKFA 5AJ3J 4YR0A 2HBRB 3KJFB 4OZ2A 2AX1A 2G9OA 4RNMA 3H20A 3EGZA 4PQUB 2V8HA 1Q4RA 4AL5A 4USWA 4O4GA 4OZ1A 4UY8T 4NMXA 4OX9F 3BSOA 1S12A 2HAFA 3KK2B 4HACB 3KG4A 5KFNA 3QZ8A 2HHSA 4LREA 2QT7A 1LQ9A 4DR1J 3V81A 4DU8A 2M0GB 3MMJA 3NGKA 1LFPA 4JI8J 1RKJA 4RUAA 1H0HB 2CKWA 5H1SV 4LBIA 3SDEB 3CJKA 3LP2B 3PDNA 5T7LB 2VA3A 1JNZB 3R5DA 4TXSA 1WG4A 2EW9A 4KO0A 4DOZA 4HEA9 3BGFA 4B9SA 5D4PA 2XZWA 2F8EX 3HHNB 2CQPA 4HR2A 4USTA 2NPFA 1RWMB 5HP1A 3NCRA 3T41A 1YZ6A 5KFSA 3ENAA 1PC4A 4CLSA 4OV6A 4C48A 4QYZK 3LP1A 2DNYA 5GAEU 1JJ4A 4WU3A 3VHQA 4CRJA 5KFMA 2GHVC 5KFKA 4I67A 1Y10A 2YQ1A 1U1OA 3TWZA 2JJ4D 1S7HA 2QMXA 3FJ2A 5KFDA 1GX6A 3TUZC 4P9SA 2HFNA 4WFAQ 2N7CA 3V4MA 2JEGA 4ZKAA 4IUFA 3DRSA 1B64A 2B56A 4HI2A 4K4XA 4WK3A 2OI2A 1KTQA 2ZHOA 3MEEB 2KDOA 4J7CA 1FNOA 2ZZNA 3CCES 3IA0A 4A8FA 4QCLA 2ZFHA 1M5OC 1R7IA 1NKBA 2HQDA 2KZZA 3P5TL 4F4ZA 4B9TA 3UNGC 2R4FA 4W4MA 2MZSA 4NA3A 3K0JA 3GE9A 4IRKA 2Z58B 1VR6A 3BQ1A 3IO1A 1BQXA 3H4BA 3OJUA 4EYHB 1WC1A 3KJVA 4ECYA 4ITSA 4ZJQA 3UWTA 4F4AA 4RNHA 4EMDA 1RWUA 4ZP8A 2QTWA 3M6VA 1QY7A 3EYZA 1NK4A 2J9DA 3ELHA 5KFUA 4A46A 2W25A 2CG4A 1RWVB 1RHQB 1TKDA 3L3CA 3TEHB 4PQAA 3EE3A 3J80Y 3HFVA 4ECWA 1S6QA 3W2VA 4C3MA 2NLWA 1NDLA 3QLHB 3HD2A 4CO3A 1FWPA 2OH2A 4FPRA 3OTCA 1FE0A 1HNXF 2ZHAA 4ZIVA 3K5PA 3RRGA 4F4XA 3AB2B 1S0NA 5LSLA 5DDPC 1ZM9A 2YNIB 2HQGA 3EXYA 3TVYA 3HHLA 3HVWA 5CYQB 3KLFB 2YNFB 1NBEB 2UXBJ 3AH6A 2PA8D 4RNFA 1YKWA 2H65B 3TVZA 1R0CB 3DMJB 3C8YA 2FJVA 2XEXA 1YX2A 2KG1A 4IOBA 1FA0A 4NOHA 1KLMA 4GKJJ 4JOUA 4HHHA 1ZPVA 4ZPDA 1VLYA 2ALYB 3NL0A 4TNOA 5D3GA 4DBQA 2VG5B 1WEYA 1NK0A 1Q53A 1QE1B 1C1CA 2ZEJA 4FPIA 1HNVB 3HKZD 3PRDA 4R8UA 1YJWS 4WCEQ 2YKNA 3QSYB 1MNEA 3PHTA 3JSMA 2V67A 4F2SA 5HI7A 1JXLA 2QYCA 3TNVA 1FJGF 1S1VA 1X8DA 3OFEA 2GIQA 2CUYA 1T03B 3HMJG 3VWSA 2IM3A 2VG7B 5IM0A 3HLUA 3T1YJ 1NK9A 2J6TA 3R5BA 4U9RA 1JIHA 2ZH9A 1NO8A 2NS1B 2CPZA 4NYPA 4UUXA 5A2QY 2DXDA 1YG0A 3F0NA 4A8OA 2DNRA 2MGZB 1HHQA 3O1LA 1BGXT 1H2VZ 1RKIA 1N8RT 2PO4A 4FS2A 3OSNA 4B9MA 1ZTTA 3H2UB 1ZZNA 4JI7F 2E5JA 3WC0A 2ZWOA 5KFQA 4QYRA 4RZRA 5ITHA 4BC9A 3OUYB 4WJBA 4DF4A 2H54B 1L3UA 3CCQS 1RYRA 4LSNA 1H7WA 5EX0A 1FCAA 3OBIA 4M94A 3T5LA 2JFDA 4WE1A 1HQ2A 1M5PC 1F5CA 3Q8VA 4NLUA 2CPJA 3QIDA 1NDCA 4GKKF 4ZK7M 4L73A 1VQ7S 1D0EA 3W66A 4LRFA 1NEEA 2G4BA 4PUOA 2IPOB 1VJWA 4B3OB 2GV1A 3C6TA 4E0DA 1NK5A 3DLGA 3LALA 1UEUA 2F63A 5DQIA 3ZZZA 1HQUB 4CCHA 2B6AB 1A0OB 3CT9A 2FZGB 4ID5B 3ILIA 2P2CB 3FKBA 1Q0NA 3CD6S 2RDDA 4F0KA 3TJ9A 1RTIB 4N8NA 4RW9A 3HK2A 3JXOA 3DGVA 2BVZA 1KQKA 4F4KA 1CPZA 1D9FA 1D8YA 4Q2MA 5ETNA 1VQMS 4ZPBA 5KG5A 3H25A 3E51A 4Y2AA 3TZXA 1R0AB 3G82B 3TX0A 4DSKA 4YEAA 4OYZA 1X5SA 2CJXB 3HSGA 2XO6A 4C9DA 3V6KA 3G6ES 3MURP 1WHXA 2RQMA 2ZH5A 1BQNA 4PKDB 1WC6A 3UCZP 3A13A 4PWDB 1F60B 3BB5A 4PG6A 4ED7A 1M5VC 4N56A 2VDHA 3DC2A 3KLEA 4RU9A 3CO0P 3S7RA 3G8SA 4CIOA 1NPPA 2QL9B 2QLBB 1ZZFA 2CJYB 2XG8A 3MD3A 1HW8A 5IT0A 4MKYA 1NZAA 4XO0A 4DSLA 1KP6A 3BKUA 5CXTA 5CYMA 1SIWB 1RT4A 2DGQA 3I96A 3ONQA 4PXDA 4DPUA 4C4WA 2YY3A 2I2YA 3GFXA 3PTWA 2HFZA 1RT5A 3MMCA 5GMKa 1VK8A 2F1FA 4AQYF 1WG1A 3LPEA 4M5GA 1PSDA 2DRDA 2OUGA 2VPXB 3BQ2A 2FC9A 2NSCA 1AFIA 3A4TA 1LWCA 1P9QC 4OYPA 4QIWD 3A12A 2A0FB 4O3PA 3IRWP 4MMOA 4PXCA 3SMZA 3P3DA 2BQ3A 2J0XA 3DLEA 2W2QP 4OX8A 4NA2A 4OYBA 2YPYA 3N28A 3H5YA 5KFIA 2EKNA 1JJ2R 3CSKA 1DJ0A 1X4DA 2FJBB 3P96A 2W1BA 2XZDB 3QFWA 1U1NA 2HQCA 3QWUA 1H7XA 3PX0A 2L08A 1U8WA 4MIAA 2YXLA 3M30A 2KJVA 3LH2S 2DGUA 1CJVA 3A3OB 1JK9B 3ETMA 4FVCA 2G0JA 3MOJB 3OFFA 4MKVA 5F0UA 4KH1B 3JYTB 4C11B 2AYGA 5DZ7A 4Y65A 1FI4A 1IBKF 5M2PA 3M1VA 2OTJS 5KOWA 2G13A 2EKYA 4CT9A 4KSEB 4PABA 1B4SA 3ENVA 5ETLA 4H4MB 3EDQB 3R5CA 3JB9k 5KG2A 4KB7A 1D1UA 1MU2B 4P2FA 1ZTWA 4G1IA 1IM4A 4R5PB 1T02A 5ETMA 2YVSA 2KZMA 1Q82T 1X60A 1N34F 2R8JA 4JYAJ 3IAS9 3K59A 2E7VA 2R2UA 4R0JA 4NE9C 1SV5A 5DM7Q 2KRBA 2DRAA 3CJTA 3CMAS 4J37A 2NXJA 1UW9A 1KFSA 1RA7A 3GIRA 2V8GA 2EFOA 2C3UA 5LJ5Y 3I0RA 3IR5B 1E6YB 3S6EA 2FLLA 4Z2XA 4C6AA 4F50A 3GJRB 4I2PB 3MEGA 2KVQE 1S59A 1H3DA 3QGHA 1VQ4S 2OEMA 2XC9A 1HWUA 3NBPB 4WIQA 4Z7YA 2V4JA 2HWTA 4UUWA 4CO4A 5D0HA 3NG8A 5HBMB 2EBEA 3KDNA 4KPCA 4EZ6A 4QZVB 1QTNB 2XSFA 3OL8A 2KT5A 5DDRC 1HPZB 3OTEA 1NB7A 1YZ7A 2J76E 2R9LA 5AE3A 3SYZA 5ADZA 3SQGA 2P6TA 2Q6CA 4WP3A 3PVXA 5J2NB 3TZYA 2GO8A 5GMDA 3FFIB 2HZAA 3V5RA 2H5JB 1H98A 3LUYA 3J81Y 4M5LA 2ZOGA 1DAXA 4M5DB 1R6YA 2E5LF 3FRZA 2NZCA 1BXNA 2FHOB 4CH7A 4UQTA 4H4KA 5DZ6A 1RU1A 2CQ3A 1F2GA 4EZ9A 2COLA 1F0XA 5D0EA 3D4JA 4FF2A 2BM0A 4C8KA 4HVZA 1G4CA 1LK5A 2O01C 4YB1P 1X9MA 4LF5J 3CJ4A 2BE2B 4ZPAA 1TKZA 2FGCA 3CJ3A 1W2IA 6FD1A 1GNKA 2BOPA 1FRKA 4ECRA 2ZJQQ 1KKHA 5FDLA 3GJQB 2EI5A 3VGUA 3GG1A 4RBVA 5I42A 4LF9J 5DLFA 4IDKA 2GS8A 3UDEA 1RCOB 1NM2A 2HRUA 4ZITA 2ZH6A 1NJXA 2MLZA 4FYXB 3J7YU 5KFEA 3O6QA 1PBAA 1T05B 2W4DA 2W4CA 4WFNQ 1VBZA 1TUVA 4LFAF 1N56A 3D3BJ 1YI2S 3P45B 1Q1KA 3DDIA 2QMWA 3OVBA 3DDKA 1RXOB 3W2WB 3I82A 2PEHA 4LUBA 3HJFA 3LANA 2RQ4A 3OR2B 3AXKA 1QVFR 2F5GA 1OY8A 3AJ1A 1G7CB 1RBAA 1IKYA 2NXEA 2MLYA 1G2EA 2HPUA 4PCQA 4P75A 3RBDA 3RB3A 5J1NA 3MM9A 5L9XA 1AROP 3DRPB 1S99A 3RGIA 2I5JA 4DL2A 3ULHA 2VOOA 2W9CA 3TI0A 1S0OA 4WZMA 1B0VA 1PBUA 1HD1A 3I6PA 1X5TA 1N6QA 5J2QA 3OD2A 2B9YA 3UN2A 1EP4A 3C14B 3BGUA 3PNIA 1DBDA 1IR1A 2ZOMA 3G6VA 2MKHA 2EEYA 2VL1A 2CXEA 2W9AA 3ENQA 2IC3B 1UZHA 3K17A 2DGXA 3B8HA 3C16B 5DGBA 1WKLA 5A2QU 2A1BA 2R7UA 4NLWA 3DCAA
chains in the Genus database with same CATH topology
2KO1A 1DHMA 5B0AA 1A9NB 1TKZB 2E66A 4AFFA 5J1EA 1VRUB 4MK9A 3GV7B 5H9FJ 4I69A 2BACA 2DGOA 5K8PA 3MDFA 5A8RB 1L3VA 4F2RA 4WXWA 1S9GB 2YX4A 1VQ5S 2HHQA 2ZJPQ 1VBYA 1HFEL 1UFLA 2ZOFA 3SCJE 2E44A 4JV5F 5HLFA 3CO9A 3CDBA 2VC1A 3QJLA 2QLXA 2XMJA 5FDLB 4IO9Q 1JLFB 2VPWB 1URNA 2FJDB 4FXVA 3BN7A 4AYBD 4KC5A 2CJBA 1D9DA 1C1BB 3I0SB 4ICLA 3RYLA 5I42B 2J6SA 4PPZA 3E8OA 1BLUA 1U6FA 2WHOA 3HO1A 4DR5F 1T7PA 3PO5A 3CULA 4IDKB 1X4EA 3MTKA 3MEKA 3K5MA 4G1QA 4CNZA 5F8JA 4DSFA 2UVRA 4F67A 1P1LA 4J9OA 5CQGA 3NS5A 5KG7A 2VUGA 5F3TA 3ZZOA 1Y3JA 2EPIA 1KOOA 2LXUA 1JLGB 3WBZA 5HMZA 1N48A 3OJSA 5IQQA 4WU2A 2LA4A 2V4RA 1R8PA 1SH2A 3K58A 4TY9A 4KRWA 2GNKA 4KV8B 4XPCA 2XI3A 5G4DA 1SJ4P 3VTIA 1C4AA 3G9CA 5BYRA 3ITHB 3C3LA 1TK5A 1DRZA 1ZM2A 3AJ2A 2H5EA 4DG1B 5SZTA 3MR3A 2XY5A 1S1XA 2EWHA 1FDDA 2FDNA 2XMTA 2HMIA 3V6JA 2LQBA 5IXUA 2LVWA 4FF1A 1J5OA 4OHYA 2MKJA 3ZZPA 2AD9A 3CC7S 4Q0BA 3FCHA 1E6YA 4L72B 2BV3A 1X4GA 5KG0A 3HM9A 4LIRA 1YRXA 1VC6A 4QR1A 3BS9A 2DNKA 2MXYA 3T1YF 1XMOF 4B02A 4IR1A 4LF5F 2HHVA 5IT9Y 1REVB 1SJQA 2K1RB 2ADBA 4I2PA 1H38A 4OZNA 3KLVA 1R27B 4X84A 1RT7B 3I32A 2DR7A 4Y0FA 1C0UB 3N4WA 2FHJD 4KQZA 1EETB 2M52A 3OTOF 2DGWA 3N0VA 4UOCA 4HTJA 2GGPA 2OSRA 3PV8A 1O0PA 2OAUA 2AQ4A 4ZP6A 2X51A 3MM8B 2OJ3A 1S72S 3OLBA 2ZE2B 2RDJA 1B7FA 1IKYB 1QAXA 2CPEA 4TQSA 2FUG9 3BEGB 1QAJA 2AYBA 3VAFA 2R8GA 4KFBA 4B3RF 3JSYA 3DI6A 2RF2A 4C7QA 4FZVA 4LF9F 3FEYB 5I3QA 3S01A 1FKPA 3ZZRA 1ULRA 2N82B 4DQQA 2VASA 2U1AA 3IC1A 2HWIA 3MM9B 3ISND 2PSZA 4OX6A 1HPZA 2Y1RI 5EGYA 4NMLA 4N77A 2XMKA 3KG0A 4B3TF 1KONA 1U24A 2I5JB 5C42A 1IKXB 4NRUA 3GFHA 3MM7A 4XDDA 5D77A 4C98A 5IQ6A 1Z2ZA 3OHBA 2V8DA 2W9CB 3IGVA 1FESA 4EU0A 3R27A 2JEJA 3L7OA 1Y7PA 3NCQA 3OXFA 4R0EA 3CUNA 4DR7F 1IQTA 4JI6F 4K0KF 5D4NA 2ROGA 1VRTB 5J2QB 3KMSA 1XR6A 1X9WA 5FIIA 4I56A 3KHHA 2DR9A 2EK1A 1N32F 4DPOA 2C3OA 2ZDOA 2N3OA 2YWFA 4EBCA 1QM9A 3NP5A 1X9SA 4LFBF 1TKXB 3LGMA 2B4OA 2W7OA 1SKRA 1HR0F 5J2NA 1IBMF 5AE1A 4ZOSA 4ID8A 2XULA 3M8PB 2JSXA 4QBUA 1QUVA 4J9QA 4DV4F 1EP4B 2ZBIA 4JBCA 1U1QA 2UVUA 2ASYA 3CMES 1HL6A 3I31A 4B9LA 3DFEA 4Z37A 3D0GE 1HA1A 5AXLA 1R8AA 2XNQA 1XBWA 1SXLA 2W9BA 2ZNYA 3SZ2A 3V4IA 2CJQA 3MTJA 4TN2A 2YH1A 3DOLA 1HWKA 4F26A 2YH0A 1XMBA 4JUZA 2UUWA 4KBIA 2OMOA 2DBBA 4NLDA 5I3UA 3U27A 1S10A 2A2CA 2KB2A 3KFWX 2DHGA 2PA3A 3S1TA 3GV8B 3R5AA 1HBUA 3QO9B 3M6WA 3OQ2A 4LMZA 4ILMA 4LQ3A 2MHNA 3B82A 1HI8A 2JOQA 4XPEA 3V2UC 1F9FA 1LWEA 2YNHB 3DDNA 1JKHA 2DNMA 2DGTA 3DU6A 2RRNA 4MFBB 4DQPA 2PMZD 3GG0A 3CJ5A 2HG4A 1HBMA 2AX0A 4A8XA 3Q8QB 2WK4A 4OJ1A 5A8KB 1Q8LA 3NCPA 5IS2A 1TP7A 2FGOA 2BDPA 1FD8A 4HKQA 1TAUA 1KQSR 5DG9A 1RT1A 3IG1A 1AW0A 2VOPA 4WFXA 1ZAXA 2B7CB 2R7VA 4Q2LA 4NX9A 3UFCX 2GQQA 5KFRA 1QJHA 1Y5NB 2B3TB 4KGMA 2MQNA 2RNEA 2FVCA 2MKCA 5KT4A 2ROPA 3GWCA 1R89A 4NLSA 2XS7A 3BO2A 2IYIA 4ETXA 2Y1JA 1WF0A 1UVJA 3L95X 4LF6F 3M8QB 4DHVA 1N33F 2B4VA 4LSLA 1FDBA 2IVYA 2MQLA 3UDLA 1KRPA 2L9DA 2IRUA 4GO7X 3DXBA 2JWNA 5HLFB 2ZITA 1FKOA 2GJ2A 1UVIA 2MDAA 2CFXA 4F3MA 4ICLB 4QPTA 4IR9A 2I8EA 1GTEA 1RI7A 4ZCIA 5MAOA 2E7XA 2ZHBA 1IJEB 2GCFA 2HQ3A 3GYXB 4MTPA 2RQCA 4XIUA 2OO4A 4YB7A 3PW2A 1XNQF 1NK7A 4MIWA 4G1QB 5CZXA 5LL6d 2FB0A 2QFJA 4YB5A 1I94F 2XGPA 2JEFA 4ES3A 3PJXA 2YNGA 2XLKA 1XERA 2YQ3A 1FEEA 2KT3A 2Z4PA 3MF5A 3PY8A 2RB7A 4RW4B 3DLHA 4EBEA 2FVSA 1BQMA 1VMBA 2CDQA 3MECA 4OI6A 3Q2TC 3K2YA 2CIMA 3A1YG 4NZ0A 4JI3F 3TRGA 3TAPA 4ZVGA 3BZQA 4FN5A 2FC8A 4KE5A 5EWEA 4KR0B 3EZ5A 1NJIT 2WONB 4ED6A 2E29A 3HI9A 2BM1A 4A8KA 3IFEA 2GO9A 2NPIA 3KHGA 4PG5A 5KFGA 1WEZA 1SBRA 3I55S 4RW6A 2Q43A 2RU3A 2NR0A 2K7JA 3CCWA 4K4SA 1FERA 3NMAA 1WHYA 1XWLA 4C3KA 1S1TA 1TKTA 5H9EJ 5J2PA 3NLCA 3C2PA 1U7LA 5I4MA 3H5SA 2XSJA 4IKAA 4TLQA 4TU9A 4Q5VA 1NHUA 1TL5A 5HO4A 3CD0A 3KWMA 2NYIA 3QIPA 4ZVFA 4QPXA 4HT7A 2ZH1A 4H4KC 2VPZB 3MAQA 3TARA 3EGWB 2VKZG 3AQOA 2GGPB 1X0FA 2UXDF 4ZPWR 1HQEA 5LXRA 2HGLA 4EGLA 2EC0A 3IS9A 3NNAA 2DIUA 4MKBA 3TA1A 4I2QA 4N5SA 3KNGA 3IR6B 4CZCA 3VAGA 5HROA 2A10A 1TL1A 4KFBB 1FE4A 3HPOA 5FLXY 3DI6B 2RF2B 5C25A 3A8EA 4UW2A 2CQ2A 2DITA 3K7RA 3H5UA 3PHEA 1FKPB 1U09A 1XK8A 2HAIA 4XK8C 1QSLA 3MMBA 2ADCA 1UA1A 4E8UA 5E41A 1O51A 2M4MA 4TQRA 5DG8A 3TYTA 4OI1A 4A47A 1HWJA 4X4PA 1SL0A 1S4FA 3OVSA 2CVIA 1P8GA 2BJDA 2DK2A 3GILA 4ED8A 2RE1A 5C42B 1DTTB 2LLZA 3UDCA 3MM7B 2YKOA 1ROFA 3KK3A 4OMFG 4HH1A 2DNOA 4Y28C 3LP1B 2CQ4A 2DNZA 2HNYA 3CJ0A 3CC4S 3IWLA 3LWLA 1W2BR 2R7TA 2GW8A 1VI7A 5SUHA 2UUCF 5E5NA 4NWBA 1LK7A 1NAQA 3N9UC 1R8BA 4O3OA 3H2LA 4WZQA 3N5FA 4OZLA 4QWBA 2O67A 2WCXA 3N01A 1NK8A 4AUKA 4YDDB 3I5AA 1HWIA 1FRJA 4KHPF 2PMHA 1U49A 2X1AA 4JI4F 2W4PA 3BM7A 3DLJA 4PPDA 5HMXA 2D7SA 2HNZA 2E5HA 3MGJA 4FP9A 1FF2A 1S6UA 5DM6Q 2R2RA 2R7XA 2QE5A 4NLQA 2J9CA 4FBTA 3LP0A 3VF0B 3V6HA 2W9BB 3V4IB 2D74B 4B9NA 4DR3F 4DF8A 3DRSB 3DOLB 2H9ZA 1RTHA 5I3UB 2X1FA 3EX7B 5E3AA 5KT7A 2J6UA 1HBNA 3FRYA 1U8SA 1HBUB 1VQKS 2UUAF 4NXNF 3I5CA 1FRLA 5E3CA 2VFVA 2HHHF 4X66F 5M2UA 1LWEB 4K59A 3LOUA 4A8QA 2PGCA 1JKHB 3QAUA 4OI3A 3U1MA 1FXDA 4LT6A 1I1GA 4DN0A 3M05A 1FDAA 1X4CA 1KHVA 3RRHA 4JI5F 1HBMB 1FHTA 4ES2A 1S77D 2B5JA 1RT3A 2L9WA 3DHWC 4IOAQ 3VQTA 2R2TA 5D8HB 4O0IA 5JVGQ 1RT1B 4DEZA 3IG1B 5EN1A 5KOXA 2VG6A 2AP6A 2P6SA 3PIPQ 4UY85 3D0HE 1XN9A 3E3XA 4X2BA 4ZLPA 5F8MA 4JI0F 4ZS6A 1RYSA 4V19J 4O3QA 4IYQA 2IAJA 1RP5A 1RT2B 4PG7A 1QAIA 1N5SA 1SKSA 1VC5A 1VBXA 1LKZA 1Z2LA 3HP6A 4UQGA 1X4AA 1X5PA 3DLBA 4LSLB 4I6AA 3JTPA 4ZCMA 5A8RA 2C28A 4CO1A 2M3DA 1X4HA 4ZA1A 3FSYA 3K57A 3Q8RB 4QQBA 2D1CA 1P6TA 1FKOB 4BS2A 4BDPA 1U1LA 4DLEA 4WFZA 2E1CA 1UJ4A 1SJ3P 1TVRA 4PQUA 1FNMA 3L09A 2Q1LA 5DGAA 2UUBF 5LJ3Y 2RJZA 4RUHA 1K1SA 1UL3A 3NS6A 4DMZA 2XWXA 3I4PA 2KT2A 2VQEF 1Q78A 4FBUA 2B43A 4JV0A 3RR7A 5FD1A 3E2EA 2JRSA 2YNGB 3AHPA 3NRBA 3TP2A 1GH8A 3SV4A 3KLIA 2XLIA 3KK2A 2JDJA 3FEXB 3U7JA 4ECXA 4BC7A 1SUQA 1BQMB 2ZUGA 4PWUA 2MSSA 3FDSA 3MECB 3PM9A 2DB1A 2ZH7A 3DM2A 3CVKA 4QIGA 2HW3A 1FRIA 3DYAA 1GXLA 1D9AA 2VB6A 3OV7A 1N5VA 2WSCC 3RW6A 1R3NA 2E9TA 3G8TA 4DG1A 3TX8A 2KHCA 2B4PA 2KM8B 2M8DB 4B3SF 3T3FA 3QGPA 2OFGX 5KT5A 3CIZA 4RW6B 1T3OA 4OX7A 3ZC4A 2DR8A 5GAHI 4OLOA 3T6BA 2HHWA 1S1TB 1NHVA 3TAMA 4A4JA 1S97A 5J2PB 2XSJB 4DLGA 1NJZA 3LP2A 3QGIA 3BR8A 4C3LA 4XDCA 1REVA 2K1RA 3MFIA 3PEJA 5T7LA 3OL6A 3QIPB 2Z8QA 1N0VC 5KFLA 5KFPA 3FMWA 3LQVA 2V8VA 4WKRA 2LDYA 2GQ2A 2VKRA 2HGNA 1U1KA 4ED3A 3EPIA 2AGPA 5KFBA 3AA9A 3GIKA 1ZAVA 5L1JA 5GAEI 2ZE2A 2N4CA 4GC7A 3W3SA 3JSRA 3IS9B 4WYWA 5KG6A 3G8QA 3W7BA 2BR0A 1JMTA 4JYAF 4U7CA 1N0UA 2DCLA 2ZH4A 1G6BA 5HROB 1HI0P 2MKSA 3FVYA 3MWBA 4YFUA 2V4QA 4CO2A 5C25B 1FK9A 2BBEA 4JV2A 2R8IA 3H59A 1J5EF 1HI1A 2QA2A 3UW1A 1NRKA 2PN6A 3MMBB 1YRTA 1SL1A 4FF4A 4P7TA 5CCLA 3PX6A 3F44A 1X4FA 3HHLB 2D9OA 3OXLA 2ZC4A 2VBXA 3MUMP 4DL4A 4Y2IA 3KK3B 2FLPA 2FHMA 3GMGA 2ZJRQ 2BRLA 5L1LA 1RDRA 5KFVA 1RTJA 4K4VA 5LMUF 4TYBA 1CEZA 2I0XA 1RISA 2I9SA 4Q7AA 2HNYB 3PKYA 1LW0B 5K5MA 4OHVA 2O1PA 2Q6BA 2IM0A 4Q8FA 2MZQA 5A8WA 3SXLA 3OFHA 4YHHF 2XY6A 2BW2A 4DUZF 2DO0A 3FQLA 3JSBA 1VGYA 2WOMA 2WRMA 4RUCA 4MH8A 4NCGA 4DSEA 4HDGA 2KI2A 5EHHA 2BZ2A 4P2SA 3CCUS 2G0CA 4IH5A 2EFNA 4WF9Q 3U1LA 4J9RA 4EBDA 2KFNA 3MUVP 2JLGA 1JLCA 3R3TA 3D2WA 2VBYA 4DR2F 4NLPA 1TKXA 1KLMB 2VQFF 2APOA 2FPHX 3T9NA 3M8PA 5B0GA 5E3QA 4ELTA 2KVIA 1BD6A 1FO1A 2F3JA 1DQ8A 4Y2KA 2HNZB 2RIJA 3MR6A 2OPRA 1UWBA 1ZPWX 1U26A 1OS5A 5M2RA 4DV1F 1WG5A 2HS3A 3GIIA 1K1QA 4IG3A 3LP0B 3C66A 4X4VA 1YVFA 3Q22A 3RW7A 4LIWA 5DDQC 3S8SA 2G1DA 2UV8G 1RTHB 4ECTA 1ZBTA 1OSDA 2BYCA 3B78A 1H6KX 4IFYB 3UQSA 4DV2F 3P49B 1HBNB 4KHMA 2RS2A 1RGVA 3C6UA 3OFGA 4C2MA 3OPKA 1U1RA 3CCMS 3BDPA 5DRKA 1VQNS 4OZ0A 4H54A 1BWEA 2L3MA 1KC8T 2DGSA 2YNHA 3D1QA 5F8NA 2K2PA 4MFBA 2JLEA 2L41A 2B5JB 2GMLA 1RT3B 1MSWD 3HFKA 2HHUA 3RRKA 5G0RA 1IBLF 3PKMA 5HMWA 4GC6A 1WHWA 2MJNA 2VG6B 2Z2MA 3JTNA 5F8GA 3UD3P 4DQIA 1L5UA 2YKPA 2KN4A 3PFEA 4L6V3 1GAOA 4NZ7A 2B4UA 4QIVA 1SH0A 4A48A 1IQZA 5B0DA 3OTBA 4QIFA 4Q44A 5F8LA 1MWZA 2IAJB 2DNLA 3LF0A 1CQNA 3UE2A 2IA0A 4G6VB 4FS1A 3AQPA 5L39A 3M8QA 1OWXA 1TR0A 2X3GA 1KVJA 2ZBCA 1LWFB 4DV3F 2HHTA 4YR0A 1WNEA 2JL9A 1Y5LB 4DFKA 1KLNA 5EWGA 4BBYA 4B9UA 2KU7A 1NK6A 2AX1A 2G9OA 4Y6IA 1N54B 3D5MA 3FMBA 3NAHA 4RNMA 1TVRB 3BO3A 5LMNF 2CJKA 3H20A 2CPFA 2IMWP 5BJRA 3EGZA 5I3PA 4PQUB 1C2PA 2V8HA 1Q4RA 1SL2A 4AL5A 4C8YA 5C24B 1MMLA 4ED2A 3PACA 4HI1A 4A8SA 2HZCA 4ECUA 4G1PA 1U1PA 2BXJA 1K0VA 4C8MA 1H2UX 4O4GA 3PO4A 4OZ1A 4UY8T 2EG1A 4OX9F 2PC6A 3BSOA 3E01A 2K3KA 3KLIB 3KK2B 2IVMA 3KG4A 3M32A 1V3RA 4RW4A 1DZ5A 4KJIA 3UCUP 3NKYA 1SUQB 5KFNA 1ZH5A