3SSSA

Ccmk1 with residues 103-113 deleted
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
AIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVAAGVENVKRVNGGQVLSTHIIARPHENLEYVLPIRYTEAVEQFRELEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title A CcmK2 double layer is the dominant architectural feature of the beta-carboxysomal shell facet
rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
total genus 26
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sssA00
4QIFA 4DDFA 2A1BA 4P7TA 4RBTA 3IA0A 2EWHA 4P2SA 4QIGA 4AXIA 4OX8A 4OX7A 3PACA 3BN4A 3I96A 3MPWA 2A10A 4LIWA 4QIEA 3I6PA 3H8YA 3NWGA 3VCDA 4RBVA 5L38A 3DNCA 4OLOA 3MPYA 5DJBA 4P7VA 3CIMA 4QIVA 2A18A 3CGIA 4RBUA 4OX6A 4PPDA 4AXJA 4OLPA 3SSQA 3NGKA 3N79A 3SSSA 2G13A 3DN9A 3SSRA
chains in the Genus database with same CATH superfamily
4ZJLA 4N41A 2PA3A 4ZKAA 2GO9A 1C1BB 3VVUA 5E7OB 1SUQB 2A2DA 4CYUA 1AYEA 4G65A 3OFEA 3GPAA 1CULA 2MKJA 1U26A 2ZHOA 1FJ7A 3TJ9A 1Z2ZA 3OXFA 4X64J 5GAEU 1DTQA 2KG1A 5JVHQ 3U1LA 3IAS9 3OBIA 3OPKA 1A9NB 2AZ3A 1SC3B 3C3LA 2VA3A 3TUJC 1VRTB 4U8YA 3U27A 1JWWA 3DRYA 2OD6A 1W2BR 1ZA1B 5AXMA 2BYCA 3OUYB 4O3SA 4LSZB 2HGNA 4ID5B 4KRWA 1UJ6A 2GQCA 3DU6A 2B4OA 3PDNA 1HBMB 2IM0A 2V2QA 2Q43A 4W4MA 1F0XA 1IWGA 2JDJA 2BRKA 2C3MA 4DR2J 5AE3A 1T05A 3W8GA 3MAAB 4I4BA 4I6AA 1XTZA 2R2RA 3MEEA 2PN6A 1FE4A 1ZOTA 1PCAA 4C48A 5KG4A 2XYPB 4QWEA 3ONQA 3DOLB 2WW8A 2G1HA 5B08A 4RUAA 2D69A 1XR7A 2LDYA 4O4GB 1RWNB 3HSGA 3SSSA 1WEYA 2CG8A 1U8WA 3KLFA 5BJRA 2RDJA 3TZXA 2FY1A 4QJVA 2V8GA 2R7SA 1BQMA 4RNHA 2IRXA 3M2RA 1PAEX 1VOMA 1RTZA 4WE1A 3G9CA 3ZZTA 4JOUA 4PG7A 1X5SA 2XULA 3HFKA 2UUCF 1GFWB 3IG1A 4DUZF 2K3IA 3OR2A 9RUBA 2KFZA 4RW6B 1SJ1A 2VKZG 4U7UD 2M8HA 4ANCA 2QMWA 3OR1A 1WG4A 3EWGA 3M6VA 4ZPDA 4DV5F 4OV1A 3DRPB 3RRKA 4F26A 4OYBA 5L46A 3W9JA 1OSDA 3ETMA 1FNOA 2QLBB 3QLHB 3QGIA 1N0UA 3NOCA 1M5PC 5B0BA 1TMJA 1RT4B 3J7Z5 2DNQA 2LQJA 2HWHA 1CEZA 2UU9F 2NUUG 3GR0A 3I5AA 4FYDA 1NK7A 2B9EA 2JRSA 2VG5A 1NRKA 2KL8A 4KO0A 2HG4A 4DL5A 2G0CA 3GCWP 1RLCL 1JLEB 2BQUA 3WHIA 3UDVA 5HVFA 3BDPA 1YBAA 2C2EA 3Q8UA 4K4UA 3TX8A 1VQOS 4OL8A 3Q8SB 1XMQF 4CO3A 5LMUF 2XB2D 3QATA 3HHEA 2PSZA 2XZWA 1VFJA 2OELA 4A8MP 1NDPA 2NREA 3QGHA 3D68A 1HHQA 1FKAF 2F40A 3HXMA 4IRKA 1IJFB 1NKCA 3ENQA 4YR0A 1X9SA 3FBFA 5FDLB 3LALA 1CVJA 1NM2A 4X65J 4NXNJ 2OFGX 3CJTA 2YWKA 3M8QA 3C15B 4EBDA 1RBLA 2KKHA 4RR5A 2WVBA 3C19A 2UVVA 2V68A 2QJ3A 2G1DA 3C6TA 4LRCA 2KTQA 1AZSB 1GEHA 3N6MA 3O1LA 1V9OA 4FF3A 4ZIWA 1U47A 3VZIA 2XMVA 4C2MA 4NLOA 1TL3B 4MKBA 1B4SA 2CPIA 2Z2LA 3F73A 3T9ZA 4XDDA 4RWXA 4ECUA 2W8LA 3FRZA 3NS7B 4A8SA 3N79A 4N77A 1VCTA 3CCTA 4DFKA 2RU9A 2PEHA 3DLKA 1EETB 4LSLB 2RNEA 3AQOA 1CJKB 5KT2A 3RBEA 2GA7A 2DXEA 4MKVA 2IMWP 4C8MA 2HVIA 2DNYA 3BGRA 4F4ZA 2OAUA 1XIQA 2HS4A 4USWA 5A0YA 4DFJA 1BMQB 2HVDA 2GGPB 2J8AA 1WORA 1HBUA 4U95A 1NHVA 3EGZA 3M8WA 2ADCA 1VQ5S 4KGVB 3UD5A 4LMZA 3BQ2A 2QGFB 3A4TA 3NAHA 1WWHA 2ATCB 2J9DE 3GU0A 2XCAA 3KYLA 2DYAA 3MM7B 1CPZA 2CJQA 2L9NA 3OJSA 4C8YA 2E9TA 2VG6B 5HQMA 2FHOB 4RW9B 1SKSA 5D0EA 4NLRA 2J6UA 3J7A1 4RW7B 2C3UA 1U1NA 5LJ3Y 2ZBQA 1FCAA 1UPMB 3MM6A 1HQUA 2YNHB 4I2PA 2A0FB 1LW2B 2RIJA 1WKLA 6AT1B 2KT3A 3J81U 4GC6A 5HLFB 1RHMB 2XQCA 3G6YA 1KOHA 3K5PA 2Q66A 1SJQA 2HBYB 3DGVA 3ET6B 4DV7F 5HJXA 2KT2A 1N5YB 1HNZJ 4PRFA 4UF4A 3KUEA 2RDDA 1PYSB 1KQSR 1RE1B 3MUMP 2KRBA 4PYDA 4U7CA 1OMSA 1IBCB 2IFXA 2PEBA 2H5EA 3PFOA 5C24B 1X4EA 1DZ5A 3K8VA 4NLQA 2Y9HA 4ECYA 4J9VA 4C98A 2B5JB 1VC0A 1EJ7L 3KDNA 3BEGB 3I5BA 2UVUA 1SJ4P 3T6BA 4ENOA 4FNHA 1NJXA 1CJUB 4IO9Q 3MM8A 5RUBA 4B3MJ 2FJXA 2W2OP 3HFVA 4R5PA 3MFHA 1LWFB 4ZVTB 2KZMA 3R6LB 4ZN1A 4F36A 4OX9F 2E7XA 3CB4A 3PYFA 2RRNA 2DHAA 3G82B 3RBZA 2Q6BA 5HVGA 4NLGA 5DG9A 2OEJA 3FZBA 3QFWA 1S1XA 3TP2A 5DQIA 2R7OA 9ATCB 1DAXA 2ZH7A 1H3DA 2YX1A 4WYLA 4EO6A 1WDTA 3JQMA 4DL6A 1EKRA 3CTRA 1RBOB 3QRPA 2RUGA 4KT0C 4JI5F 1OJ4A 2FQQB 2WW4A 3R7SB 3FSXA 3A1YG 1C4AA 3QT6A 3MOZA 2M88A 1J5OA 2BX6A 3BDEA 4F8RA 4UY8T 3OXLA 3TA1A 3LPYA 1Y3JA 5A8WA 1RT7A 1W7WA 2JLFA 4P10A 4ES2A 3MMCB 3V6DA 3DLEB 3EGVA 4RBVA 3P49B 5L8RC 3Q8PB 2K8GA 4A8KA 3KK3B 1KN6A 3T1HF 5B0DA 4FBTA 1PJ6A 2BJ3A 3CMAS 3EXCX 4NXMJ 1B70B 1BGXT 1QE1B 2ZOFA 2JOQA 3MTJA 2HIQA 1RT3B 2R9LA 2VD3A 3MXHP 1BXNA 5F0WA 3V6JA 2XG8A 2ZE2A 4NI2A 2E1RA 3QWPA 1W26A 2Z8QA 5A8RB 4TLRA 3BYRA 3QAEA 5I42B 2RVJA 3K5OA 1H72C 2V2ZA 3SCJE 2WK4A 3RU0A 5F3ZA 1DTTB 2UUAJ 1U2RA 2HFVA 1D9FA 1QAIA 3KLIB 2XM3A 2QT7A 1MWQA 4F0KA 3ISNC 4LF1A 2XY5A 2J7KA 2HRUA 4I0WA 4O23A 4O4RA 5DJBA 4ICLA 3MFIA 1TUVA 1LWCB 3CD5A 1QAJA 4NLWA 2NS1B 1NO8A 4OYZA 5H9FK 2DGWA 3OSNA 4LFCJ 4B9LA 4LSNB 1U0HB 3DC2A 1HIYA 3I9V9 4PWUA 3KLHB 4J9MA 3JSBA 2OTJS 3TZWA 4OX8A 5DZ7A 7FD1A 1R0BG 3RR7A 1XN9A 5KFZA 5LL6d 5EGYA 4Q7AA 2DR8A 3TAPA 3BH6B 3C6UB 5CYJA 2QV6A 5T7LA 2JEJA 2IM1A 4U9RA 2W9BA 2MZ1A 1U2FA 2N3OA 3PCOB 2AMCB 1KLNA 2F4VF 4LFBF 2B56A 3BGLA 2EXUA 4ERDA 4G6VB 3G71S 1I5OB 3V81B 3AQPA 2UP1A 5A6PA 2ZKTA 3QYYA 1F5AA 4DR6J 3T6JA 5L1KA 2YKNA 1CJTB 3OL8A 1S1WB 1HHSA 3W9IA 1VLYA 2GAHC 1C0TA 2XYHB 3DLGB 2A6OA 1GX6A 2A3JA 3EZ5A 4DV2J 1OYDA 5LT5A 2EBGA 4A8OA 1O5JA 2LU2A 2F9JA 2HBQB 2M52A 3G8TA 2UUBF 3M4XA 1SB6A 4IYQA 2HNYB 4C0OC 5I3UA 2WONB 3HKWA 1NZ8A 5F8GA 2BKOA 1UVIA 2RAQA 3LAKA 4J9QA 5HL7Q 1FHTA 1SIZA 1Y5NB 4NL5A 2OSRA 4BS2A 2YTCA 4TY8A 1KFSA 3H90A 5KFDA 2IVFB 1Z1ZA 3VGUA 4P74A 2GW8A 3D28A 1Q81T 2I2YA 1A0OB 1RA7A 4QYZK 3HM9A 4KHPJ 1JLFB 4C8KA 4IOAQ 4UOFA 2DKOB 2XHCA 1YBUA 4FYXB 4RLEA 1HYSB 2DK2A 4UQGA 4B9MA 4WCEQ 1WJ9A 3DLHA 2YKMB 1UVNA 1R8AA 1NH7A 3SSQA 2ZC4A 2UZAA 1VGYA 2HHQA 1M5OC 4KGMA 4DPTA 2Q1LA 3ELHA 1UTAA 2AEJA 1C0UB 2K2PA 5CZXA 1SIWB 3IBCB 2J7UA 4ZLPA 4WZQA 2HHSA 1NKEA 1UW9A 2PFFB 4LRBA 2MQQA 3R5DA 4DU7A 2EFVA 2CPEA 1K1QA 4ALZA 1S59A 4DX7A 1MWYA 2P8IA 3KG1A 3R5AA 4DL2A 2D3ZA 1T7PA 4OHYA 3KHLA 1SPBP 1TKXB 1YITS 1F9HA 4IDKB 2V4JA 4DSFA 1ULRA 1RAGB 1JJCB 1RT2A 4ECQA 2MKHA 1ITPA 1PKUA 2ZD1A 4K4TA 3MR2A 2J6TA 1REVB 3Q8RB 4LJMA 4NMLA 2G13A 5KT6A 3ZZOA 3RZAA 2ZZTA 4PQUA 3KK2B 3AOCA 3ZTPA 2V4RA 4WK1A 3HHNB 1OQ3A 1N56A 4NA2A 2HRTA 4KB7A 4LREA 2LFVA 3B6BA 3EE3A 2RS8A 4ED5A 2E5HA 3V4IB 3I0SB 1HQEA 4CZCA 3WIUA 1WC0A 5THWA 1HWJA 4HDGA 1UJ4A 3EGWB 4KR0B 5IT9Y 4NOHA 4OI6A 2W7OA 5DM6Q 1VJQA 4HEA9 3VHQA 4C3KA 4CYUB 1TV6A 2BJ1A 3QWUA 1N36F 3RB0A 1RABB 1IQTA 4B08A 2GVZB 2V8PA 4QPXA 1IKXA 2YKAA 2OIHA 2G9OA 2J76E 1FTCA 2HEKA 5HN0A 5CYQB 3J80U 4PCQA 4X4PA 4DCOB 4DU8A 3QIDA 2POKA 2GQQA 2X3DA 2UU9J 3US5A 5FLXY 2IVYA 2LQ8A 3NNHA 4NYZA 2GIRA 2NUHA 4EYIB 2A18A 3Q23A 4Y2KA 3KHRA 1UL3A 5KFTA 4JV0A 4NZ6A 1WC5A 2BEFA 2JVRA 3I6PA 3R7NB 3ZO7A 3JS9A 1O6XA 1IKVA 3W5ZA 5LMUJ 1T05B 3J7YI 2HHXA 5KFWA 3MEEB 4MJKA 2R4FA 1VQNS 2CJBA 2VQFJ 3VAJA 2H1YA 2BJ8A 3D54A 1FT8A 2ASDA 2GJIA 4I2QA 1D8YA 2PGCA 2BE9B 1UA0A 4X84A 1RWOB 3KLFB 2CXEA 4LIWA 4RWWA 1BQMB 4A46A 4TQRA 4AD6A 4DPXA 1NK4A 3M2RB 1MMLA 1FESA 2XS2A 1NU4A 3OT9A 4WE1B 5D6GA 4LR7A 4FYWB 5KG6A 3AY0A 4O44A 3SV3A 3N5BA 1XNRF 3RBXA 3IG1B 1AFJA 2G2OA 5L1IA 3OR2B 4LUBA 2CYYA 3CUNA 5HROB 4KKOB 4F2SA 4M5KA 1KQKA 1VI7A 1NDKA 4FXVA 5BYQA 4ELTA 3OR1B 3M1VB 3SQOP 1IQZA 1VRQC 2X3GA 4DUTA 3CCRS 1EKSA 1T02A 3BKFA 1X9WA 3H25A 1OO0B 4LF7F 2E7WA 4IO1A 3RUBL 2ILZA 2PE8A 2KFYA 3SQGB 2A10A 4O3OA 4KAIA 2JWNA 1NAQA 3IBFB 3PV8A 3OTDA 5U47A 2DO0A 5DQGA 1LW0A 2HHPA 4DV1F 5F0UA 2VG5B 4KO0B 2ZNZA 3FCHA 3K5LA 3W65A 3O8WA 4EZ9A 5AXKA 2O67A 1NSAA 3H98A 2AW0A 1EP4B 2V63A 3RRGA 2NR0A 2IM2A 2V9WA 1RWXB 4RBTA 1GNKA 3DLLQ 4FYVB 1T9UA 3QGPA 4A8QA 4Q2MA 1LXJA 1AUDA 2XBPA 4DV0J 2H54B 3CDAA 4ECZA 1DQAA 4RW8A 3K57A 3NL0A 3M8QB 1BLUA 1U49A 2J7WA 5ETKA 2VC1A 3G4SS 2P9GA 1RBAA 2M5YA 3DFEA 1H6KX 1LEOA 4DSJA 3PVXA 3HO1A 2LXFA 2DR6A 1CJVA 3QQCD 1W2IA 1PG5B 1FXDA 1JLBB 3KLGA 1VQPS 1YIJS 1KTVA 4OHVA 4ID8A 4EBEA 4OX7A 3PW0A 2X1FA 4A8WA 2J8SA 2YQ0A 5L1LA 3NY0A 1WHXA 1LWEA 2ROPA 5HMXA 2R7WA 1B0TA 2NYIA 2UXDF 1HWLA 3HFZB 3DLKB 4EYHB 1UZDA 3W64A 1RI7A 2UV8G 2D1CA 3DLBA 3BGRB 3T1YJ 2FHKA 5HAOA 2AJQA 2N4CA 2Z2ZA 5EWGA 4M5NA 1C1CA 2X7IA 5A0YB 5CZVA 3CCUS 4M5LA 1HBUB 4Y2MA 5DG8A 1GXTA 2MPUA 3ZTOA 4KH1B 2EBEA 1AUSL 2IYIA 2ABYA 2ZITA 3MM9A 1AW0A 3KJFB 2R7XA 3AH6A 4B9NA 4Q2LA 3Q89A 2VV5A 3O6QA 3AD9C 4C4WA 1FDAA 3ZZRA 3RBDA 4OYXA 3IP0A 2OI2A 4C0BA 2BW2A 3FEXB 3DYAA 2HNDA 1NDLA 2NQPA 4JI5J 1RXOB 4YY3F 1TMMA 1N5VA 1R8HA 3CMES 3RRHA 3MM6B 1HQUB 4ZPVR 1JLGA 3CIZA 1MSWD 2M2BA 3SEOA 1URRA 4WP8A 5IFMA 3L95X 2C2ZB 4ZPAA 3UI3A 1PAUB 1Q8LA 4YFUA 2VBYA 3PX4A 3ILOA 1N88A 3MWBA 5JUMA 2QYGA 2WZ1A 1K47A 3GV7B 4RUBA 1FDDA 3AXMA 4EMDA 3V5RA 3SMZA 2HGLA 2LYVA 1AA1B 4ECXA 4DR3J 2JSXA 5HBMB 2Y1JA 4NYPA 3UDLA 2R8JA 4Y00A 5GMKa 3S01A 1WI6A 4CO1A 4D3HA 2H4WB 4Q43A 4JI3F 2LU1A 3NBPA 4J9KA 2R2UA 1MROA 4DBQA 4DR5J 4YS2A 2DEJA 4OZ0A 2GVDA 4W98A 3PR5B 2DNMA 2NXUA 4Z37A 1YRUA 4R8UA 4CO2A 5KFEA 5H9FJ 1HWKA 4Y2AA 2AWZA 3H2LA 3MM8B 2X1GA 1VC6A 4WKYA 4TKTA 4R5PB 3IWLA 5KFPA 2VHGA 4JI8F 5T14A 2EFPA 2ZFHA 3MOJB 2IC3A 2CPHA 2P6TA 4R25A 2KT5A 2L48A 4I1TA 3NGDA 3FEZA 1M1KT 3M8RA 2FUG9 4PXCA 5LOQA 4DQIA 3IR7B 5EWEA 3GFYA 2DR9A 1S1XB 1UETA 3NGRA 1RWPB 5HO4A 4M63A 4TYBA 3W66A 4YB5A 2G2YA 2HFUA 3UQSA 4PG8A 3R5GA 1NEEA 5CYMA 3MCMA 3H5XA 1RACB 1X4FA 2X1AA 3A8JA 2J0XA 1RDRA 3DN9A 3BGFA 2VG7A 4PXEA 1WF2A 2LCWA 1UW4A 1J5OB 4F02A 3M9MB 3MF5A 2W9AA 3VAFA 3BBCA 2XHWA 4F67A 1OSCA 1IUJA 5A8WB 2F4VJ 4LFBJ 1RT7B 5B0AA 4NWBA 5ETSA 1ZM3A 3GIMA 3P3DA 3NGSA 5ETOA 4CLYA 4ZVOB 2RH3A 4HTIA 3M2VB 1IR2A 3HP6A 5KFKA 4WTOB 4DDFA 2MDAA 3PW4A 1RKIA 4DF8A 1SCJB 4JI1J 1P1LA 2DPJA 1SH3A 2OPSB 4B9UA 2JEGA 1R43A 2GIQA 2ZE2B 4ED7A 5F8NA 2OMLA 3IA0A 4ZCKA 2QMUB 4HH0A 3FQLA 2CZVC 1FFWB 2UUBJ 1U1PA 2P9EA 4M5MA 3L7OA 3HSDA 2YWHA 4A8FA 1VISA 2E5GA 4FS1A 4I68A 3FCWA 1OPIA 4P2SA 4CT8A 5J2NA 1T3NA 1OY9A 4QYZJ 3UFCX 3R7BB 4XTTA 2MY8A 1R89A 1H2UX 2BM0A 4ICLB 2RQMA 1OIAA 1HNWJ 4WFNQ 1NH8A 4Y34A 2VL1A 3IR6B 1HI0P 2OPRA 1ZTTA 4A4JA 5IS2A 2YX7A 2E5LF 2XMWA 4ZCLA 1KKHA 2VF3A 4ZVRB 3L9ZA 1FXRA 2ZH2A 3DMJA 1GXUA 1VDHA 4N47A 4PZVA 1SQEA 3RAMA 5T41A 2BBEA 1SL2A 4WFZA 4ED4A 1B99A 5LXRA 1I51B 5DG7A 3T9NA 4DL7A 4NCGA 4JV1A 3RR8A 4C11A 3FDSA 3ZTSA 4ZPTR 4N76A 2RU3A 2EKYA 3E01A 4B3SF 1BWVA 2YKQA 3U1NA 5J1NA 4KC5A 2W9BB 2KVIA 4I64A 1IN0A 3D3CJ 4UZBA 3IWXA 3VGTA 4OYPA 1FTRA 2IMOA 4EZ6A 2WVCA 4WU2A 4MAKA 2NSCA 1YRTA 3G96A 1IVZA 3M30A 2HK3A 2HZCA 3OTOF 2ZDOA 1RTHA 4FF2A 3NXZA 1YQHA 1C0TB 1RTJA 3H40A 3CPWR 1S1VA 1D9DA 1ZPVA 4I6YA 3E2EA 5ETVA 3SZ2A 4FF4A 3G87A 3QO9A 1TR0A 1N34J 4W92B 4QWBA 1MMNA 3OFHA 4DCJB 1KR4A 2M0GB 2R8HA 3TNVA 1UWBB 3GFZA 4X4UA 4MFBA 4PAAA 4V19X 1FD2A 3UD3P 3BSOA 1JLCA 5I3UB 7AT1B 3FQKA 4KHRA 1KLMA 5ITHA 3ILJA 1U1MA 2AD9A 4PYAA 4HT7A 2AEMA 1PYOB 2GZOA 3FK4A 2IY5B 3UCGA 4L74A 4TY8B 1XERA 4RO0A 3TR5A 1DLOA 1YJNS 4IKAA 1RWWB 3FBBA 2PC6A 3QAUA 3R1LA 3GFHA 2OEKA 2HZVA 4Q0BA 5KFQA 1WG5A 3FMWA 3L7PA 2DR7A 3UDEA 2W7PA 1IKWB 3LA0A 4NXNF 2PMZD 2VONA 2HRYA 2HHVA 2EK1A 1O51A 1N36J 1YVFA 3WC0A 3PHEA 2W2NP 2H3EB 2F7VA 1A6LA 4ZN3A 2KJVA 1ZM4A 3DCAA 4C8OA 4ZJOA 2CDRB 2OPPB 5KFLA 4MK8A 4JBCA 2Q3PA 4L3KA 2YWGA 2H65B 4D3GA 1H2VZ 1AB8A 1ZH5A 4DPWA 2CIMA 3DOKA 3K8WA 1YJ7A 3W9HA 3KJVA 4M5IA 4H4OA 3S8SA 4ZLJA 3FRYA 4P6QA 3OQ2A 3JSMA 1ACMB 1HNVA 2X1BA 1ZAWA 2V6AA 3CEDA 1RK8A 5DRKA 2VJUA 3NG8A 2V4JB 4TXSA 2Z57B 3HX9A 4BC9A 2HS3A 1RU1A 7FDRA 3RTVA 1PYTA 1RT2B 4O3RA 4IUFA 2WVFA 3PW5A 1BQNA 5F8MA 3B54A 1HL6A 3M9NB 1KDNA 2ZD1B 1UKUA 4X66F 1HA1A 4OYIA 2GJ2A 3H7HB 5C7PA 1YHQS 4DOZA 4ECSA 3HHLA 1WSRA 1WKKA 4PQUB 3IGNA 3IS9A 5D3GA 2I5JA 3Q0AA 4AYBD 3TEHB 4ZK7M 2FPHX 2ZEJA 4O3NA 3BQ1A 1WHYA 2K7KA 3GYNA 4QW9A 4OYWA 1XNRJ 3L4BC 1S97A 1U1RA 2BOAA 4Q8EA 5L9NA 3CVKA 2KXNB 3G6XA 1FJCA 3LP1B 2MB0B 3KK1B 3Q2TC 3GIKA 1TV6B 4FP9A 5KG5A 3ILLA 3PJ9A 4QCLA 2F63A 2D3O1 3TUIC 2HFNA 2OPQA 4HKQA 4CH1A 3PR4A 4LF7J 5DETA 1X5TA 3EDQB 4PKDB 2NXNA 2NZCA 1IKXB 2GQ2A 5HP1A 3HVTA 2IA6A 5A6WA 1R27B 4B3RF 1OWXA 4USIA 1RLDA 4J7CA 3VGVA 3I5CA 5I4MA 5CCMA 5I3QA 1UCNA 2UXCJ 4B9TA 4OZLA 4PXBA 2XS7A 3R2CJ 2EWHA 1FI4A 1UFLA 4DG1B 1ZETA 5KG7A 5K14A 4UOHA 1S7HA 4FYYB 4YDDB 3BJYA 3W1YC 2YX4A 1X5PA 3F0NA 1WOOA 2C2KB 4HHUA 4DUYF 3IM8A 3BGUA 4CLLA 4M5JA 4DS4A 1TL7A 2V94A 2QTWA 3CJ8A 3LGNA 3EPIA 2R7VA 2ZVIA 4OZ5A 5AT1B 1IKVB 3HHLD 1RAJA 2HQGA 4QQBA 3QJPA 3SCIE 1FFSB 1RU2A 2HZAA 4OQJA 1CLFA 4ZPCA 5ETMA 3QIPA 1UWAA 2Y3YA 3CC2S 2XMTA 3W8PA 1F5CA 1XR5A 1NMEB 2EI5A 3OXGA 3MEDA 2N7CA 2CJ9A 2DGOA 5B7WA 4I6WA 3PM9A 5KT7A 3HT0A 5HATA 4OX6A 1K9MT 3EZUA 5GAGI 2RB7A 4O44B 4UQTA 2GFFA 1NXIA 1H74A 3HHDA 3RAQA 1NUEA 2DRAA 1FXLA 2QL9B 4JI0F 1FWPA 1QVFR 5CD4H 3RW7A 3KMQA 2WCXA 4ELUA 1VR6A 1CC7A 3TOQA 2V69A 1U8SA 4FKYA 3I55S 3DGPA 1CG2A 1HW8A 1KOOA 4K4SA 3BQ0A 3GV8B 3OHAA 4K5SA 3OTEA 2FTRA 4KPYA 2FDNA 4ZVPB 2MKIA 3O44A 2C1EB 1Y4ZB 3BPDA 2UXDJ 4ZP6A 3JSYA 4DXLA 1V3SA 1KRPA 1H0HB 5KFSA 4NXMF 1HKAA 1SJ3P 2R3VA 3RB3A 3B4MA 3DLJA 2GIFA 4WKRA 4KGKA 2F8EX 2UVRA 2MJNA 1KTQA 4CH7A 1E6YB 1MNEA 4KPCA 1IR0A 3K7RA 3VF0B 4GKJJ 4FXWA 3ZNJ1 3DOMB 4F4YA 2FZCB 2KHDA 4HL9A 4O3PA 4P2FA 1DQ8A 2CDQA 2UUAF 3ULHA 3UR0A 5DGAA 3BM7A 1TFWA 4PG6A 3KG4A 1FDNA 3M6UA 4ZMMA 1APSA 3CCJS 2OMOA 3KNGA 4ZS6A 3GFXA 3ETOA 3TQEA 4RW8B 4IRDA 4M8LA 4NEYA 3CSKA 1G1XA 1KBRA 1MU2A 2N3LA 3OVSA 1HW9A 1DHMA 2VA2A 4YB6A 1YG0A 2YKPA 5E3PA 5EHHA 4UTGA 1VQ4S 1NPRA 1VHIA 1CJVB 3ICLA 4HLBA 3TX0A 3Q86A 1S9GA 4Z7CA 1MN7A 2HQ3A 2AU0A 3Q22A 2K3KA 3KLGB 3QBCA 1F9FA 4RNOA 1NK0A 3K89A 5BXIA 1X4HA 1Y0HA 2CQGA 2I8EA 1QJHA 1NB2A 2QA1A 4DCPB 2R7QA 2B3TB 4U7UK 3M8YA 2YH0A 3SBMA 1LWEB 4LBIA 2QZ8A 1U1QA 2HFZA 1AROP 3VAGA 3OLBA 1Q8KA 3C46A 3CD6S 1N5QA 3EM1A 4I69A 2HFSA 3KWMA 3GB0A 5C25B 3AJ1A 2YNGA 3UR3C 5HQ8A 4JI8J 4UOCA 5E3CA 4DV2F 3JTNA 4DSIA 5GAHI 2XI3A 1GXLA 2CPDA 5B0FA 4P73A 1NLKL 4HACA 5C2GA 4AT1B 4M94A 5F41A 4ES1A 4CIOA 4TU8A 2ROEA 3MR6A 2DGTA 2OEMA 2XZTB 2O01C 2RILA 4K5RA 1S6QA 4NE9C 3UW1A 3NGTA 3CCQS 2NCKL 3IRXA 4KH0B 4USKA 5KFBA 3SDEA 3MPDA 2MTLA 2AEFA 5B0EA 2P5VA 3C14A 2XLJA 1VQMS 2YWWA 2HNDB 3TUPA 4FPIA 4CLPA 4OI2A 5DO2A 4J9NA 1N32J 2YNFA 3DDIA 1CS4A 2YY3A 3HZEA 3G86A 2GAGC 4O0NA 1VQ6S 4OJGA 1JLGB 1V5IB 2DBBA 2QMXA 4WFBQ 1UVMA 3MMBA 2YWFA 3ENVA 1RAIB 2B9XA 3EDRB 3QZ7A 2XMKA 4DZDA 4HHJA 4K4ZA 2W7AA 5JVGQ 3W2VB 3M32A 1S77D 4K59A 1JNRB 3UN2A 4ID5A 1Y00A 1YGYA 1UZHA 4XK8C 2CWKA 2QC3A 4DLEA 5KFVA 3MPUB 5ADZA 4CM2A 2J0QD 3CO9A 3EJMA 1YLXA 3MAAA 3KLEB 2H9ZA 2VZ9A 3NBPB 1MROB 4FPRA 4FF1A 1D0EA 3DOLA 3GQCA 2GVDB 1RAHB 1ZPWX 4OLPA 2O1PA 3VWSA 1ZA2B 1NBEB 4MKAA 4R8UB 3KJNB 4NEZA 2NXEA 1LK5A 1U2CA 1UP1A 1VIXA 1OPZA 2ADBA 4ED6A 2DR5A 2CJAA 2MEWA 1N0VC 5HQLA 2IC3B 3BSAA 3HVRA 2QO3A 2QIFA 5D0RA 1NJZA 2COLA 3H5YA 5JXSA 2E5LJ 5I3PA 3UCUP 5G4DA 5E3QA 3J80Y 1L3KA 1LKZA 4WXWA 1Q16B 2DH8A 2FLLA 1QUVA 5AXLA 1VQSA 1B7YB 1IXKA 2DNHA 2IRYA 3DRPA 5CYMB 2NSBA 3ZTQA 1KHVA 3V4MA 5KFGA 5KFYA 4N8NA 3TO8A 3D1QA 4B3SJ 4YHHF 2VG7B 1RT4A 2ZH4A 4K4WA 2M3DA 1T03A 4B9VA 2ZKUA 2DNNA 2BACA 4CO5A 3FZ2A 4EI2A 2RSQA 1RTDA 1VYAA 1Q82T 2RRBA 4PABA 3TRGA 2LA6A 4LRFA 3A3PB 1WHVA 3OTOJ 1S9EB 5CABA 1P6TA 2DNOA 3VALA 3O2IA 4IG0A 3NOGA 4JB8B 4PWDB 4OZJA 4ECWA 4AL6A 1VQYA 2ACMA 3AODA 4URSA 5F8LA 2FVSA 1RKJA 3VQTA 3AJ2A 1N5SA 3BO4A 5D4PA 2RS2A 2F9DA 3D6FB 1RTIA 3RAXA 4CM0A 3D6TB 1RT5A 4I56A 3C8YA 4NLUA 2XGPA 2DITA 3W5YA 1KONA 2C2NA 4OYOA 5J2NB 5KFRA 3LO3A 3CW2C 4KHMA 3SYZA 3FC9A 1TTHB 4HH1A 5IZHA 4WZMA 2CVIA 2OPRB 8AT1B 3M6XA 2VQFF 3PACA 3P6YC 1UPPA 3RGIA 2HHHF 3B4DA 3ILIA 3CWJA 1S9FA 2MLXA 4EO8A 5IT0A 4DV6J 1QAYA 3SI8A 2DHSA 3D6MB 3BKTA 3O5TB 4RPFA 4NCGB 3W62A 4K4VA 4C11B 3AFGA 1RYSA 3W3SA 3LP0B 4RUCA 2GHPA 3E01B 4OV6A 1N5TA 1S12A 1K44A 4LSLA 4ELVA 3W63A 5HMZA 3PYDA 4FBUA 3GYXB 1HWUA 2G0JA 2VFUA 4N5SA 4J91A 3QT5A 2H5JB 2BKNA 3M2UA 4IFYB 5CA5A 4PQAA 1IBKJ 1VQKS 1RTHB 2CQ2A 3P5TL 3GIIA 4IH6A 2D9OA 3FKBA 1Q7YT 4NA1A 3M8PA 1S1VB 3TVZA 2IBKA 1D1UA 3MM7A 3QO9B 1KNZA 3UE2A 2ZH1A 4BDPA 2LXIA 2PIIA 4X66J 2VASA 4MFBB 3I9ZA 1QTNB 4CNYA 2PMWA 1JLCB 5KT3A 3E51A 5GADI 1KLMB 1SBRA 4NLSA 1TL4A 4I7FA 2VQEF 4ZVFA 2CPZA 2YNHA 2A1BA 4F04B 2FVCA 4AXIA 3L7UA 2M9KA 1SKUB 1OY8A 4IH5A 1XK8A 5CXTA 5KT5A 1LFPA 1DLOB 3BREA 3MR7A 2MGZB 3WIVA 1ZZNA 1RT6B 1OS5A 2R8IA 3MR3A 4DL4A 2BE2A 4Q0BB 4JV2A 2XNQA 3EPGA 3S6EA 4DV0F 4V19J 1XWLA 2QLXA 3KUHA 3PNIA 1VQ9S 3A12A 2BMBA 3PRDA 3NAIA 4DPOA 1YWXA 4YQWA 1MLAA 1CBKA 3HD2A 3TWZA 3PIOQ 2VUGA 2G0IA 4B3RJ 3AXKA 4LT6A 2DEIA 1JMTA 3H0PA 4GVLA 3DOKB 2IAJB 4HR2A 3KG0A 2YPYA 5A2QU 4V1Ak 2BANA 1Q5YA 4M5HA 1WSVA 4ZVEA 3KJVB 1X5OA 5ETRA 4K0KF 4GRSA 3AD8C 3BR8A 3JSMB 4JI7J 3HSZA 2EVZA 4DUYJ 1G2EA 1GK8A 1NDCA 1HNVB 4L76A 1A7GE 3LGHA 5BYSA 2KM8B 2GHVC 4C8ZA 3BO2A 4Y2CA 4EBCA 4Z7YA 1C4CA 2BZ2A 2DXFA 4FVCA 3MZIA 5JMNA 4IQMA 1WI8A 1SJRA 5K5MA 4USUA 2LQ9A 1P9YA 4KIAA 3T1YF 4WBFA 3H2UB 2KZZA 3HHLB 3PJXA 4BHQA 3POTA 2MJUA 3VR1A 3D67A 3SV4A 5D3GB 2CQ0A 3W61A 3U1MA 3CGIA 4S0MA 1B3TA 2AQ4A 1Q95G 3B8HA 2NYHA 3UVJB 3OL7A 3MMCA 3DLEA 3T5HA 4JI4F 2NLWA 2AT1B 4ZVHA 3KK3A 2W4DA 2QN6B 4JI0J 3K2YA 1R3NA 1KQFB 4URQU 4NLVA 2IJFA 2C28A 4XO0A 1NKBA 3LQVA 2HNZB 1RT3A 1YJUA 5FJ4A 2ZM6F 2KN4A 1T9VA 3EVMA 2B51A 2C2RA 2B7BB 2OPQB 4C8LA 3UO0A 1JXVA 4CI0B 3CJRA 4DSKA 4RNFA 4USJC 1EB0A 4GO7X 4NZ7A 1FKPA 1YTYA 1LQ9A 1X4GA 4N8OA 2IM3A 1JXLA 4EK2A 4ANDA 2J0SD 4DR3F 3HVWA 3MGJA 1N8RT 1W25A 5K14B 3CIMA 2EC0A 5G0RB 2EFOA 4L3NA 3DU5A 4YEAA 2Y1IA 4DR5F 5GMEA 4K4XA 2MXYA 4ZOSA 2ZH3A 2DCUB 1U0HA 3N6LA 1SL1A 3ZNUA 4CTAB 3HULA 1GTHA 3DRSA 2NZ4A 1ICEB 1FEEA 4URGA 5AXNA 1F9EB 3W2WB 4KJIA 2QLFB 3MUTP 2E9ZA 3N0VA 2EFQA 2HPUA 1G6BA 1Q53A 4ZHRA 5JJBA 2R2TA 5ETNA 1P9QC 3J7YU 1FJEB 3KHHA 2P9CA 4OIXA 1JX4A 4KQZA 5J2PB 2EPIA 3OJUA 1OYEA 5A76A 1HNXF 4J5OA 1N54B 1VQ7S 2AJ1A 5MAOA 1BHNA 1IJEB 3NNCA 4DQSA 1V5VA 4LF6F 2EEYA 1SC6A 4ZIVA 2VDIA 1TKTB 2FD2A 2FJBB 3DGPB 3FEYB 2Z30B 3PRVA 4C8NA 2QFJA 1DQ9A 4BWMA 2DTJA 2BR0A 4KTQA 4N56A 2J0WA 3MCSA 3PHTA 1RWVB 1HNIA 2GS8A 5CHCB 1X4AA 3VAHA 2BRLA 3MM5B 3CMQA 2HBZB 5EX0A 4ZCIA 2MY7A 2HNYA 2WONA 1S6PB 3CJ5A 2N7YA 3ZZPA 2MZJA 2E1PA 5KG2A 4TY9A 4UUWA 4JI1F 2E1AA 1WUUA 4OMFG 3EMTA 2U1AA 2KFNA 4MIWA 1ZAVA 1GTEA 4OJ1A 4NLDA 1Q7LB 2HW3A 2Z56B 2EG1A 4DR4F 1RAAB 2ZUAA 4EU0A 1S6OA 1NSQA 3LW5C 2R7UA 2BABA 2KB2A 2VFSA 1VRUB 3GONA 1TFYA 3CT9A 4X4OA 2AIRB 3Q8QB 2CQ1A 1HNWF 5DDOC 1UMJA 4UOGA 4DL3A 2E44A 1S72S 3N6NA 3DRRA 2WRMA 5EN1A 4P72A 4TNOA 5SUHA 2KI2A 3TVYA 1BY9A 3R5JB 2DHHA 8ATCB 5F8IA 3BN7A 1F2HA 1MU2B 1R0CB 4CLZA 4A47A 4YR3A 4BBYA 5KFCA 1T9TA 4Q5VA 2CRLA 3PRBA 5IWAF 3GJQB 3L3CA 4OI0A 1OQ6A 3BPSP 1S9GB 1R0AA 4UZCA 4B02A 4WPAA 4WYWA 2UXBF 2ALYB 3G6ES 3GYGA 1YI2S 3LP2A 2EFGA 2MSSA 1GAOA 4LBPA 1TL5A 1ROFA 5DM7Q 4QR2A 3NMAA 3HCXA 1EZZB 1S57A 1JLQB 1T9YA 2AF6A 4MK7A 5KFAA 2W2PP 2WSCC 3MAQA 1Y5IB 2DNZA 3O3LA 2FC9A 2QA4S 2MQPA 3I87A 4KSEB 2EG2A 2CZ9A 4TVAB 1JK9B 4WFYA 1KVKA 3UPFA 4CLWA 1N34F 1L3UA 5M2RA 2HYIB 3V4IA 2VPYB 3I0SA 4HACB 2OSQA 3L09A 3R6GB 4MK9A 2HMIA 4PG5A 2FJEB 4IG3A 3KTQA 6FDRA 3JYTA 4G1PA 4JI2J 3SXLA 1Y11A 3RW6A 3CDUA 4ED1A 3TQ1A 3QRRA 2CKWA 1TKDA 3HVAA 2LVWA 5BYRA 1S6QB 4QR0A 4DLGA 2QLJB 2HIYA 3IRXB 3SDEB 1NK5A 1UAWA 4LQ3A 3C14B 2FVQA 2GVZA 3FJ2A 5HI7A 2H5IB 2HAFA 2W9CA 2ZH9A 4YHHJ 3W60A 5CYQA 2YNFB 3KXDA 5BR8F 4F2RA 3THPA 5IM0A 1CS4B 4DFMA 4R0JA 2MYFA 1WNEA 4ILMA 2LDIA 5DGBA 3MMBB 4RX6A 2PA8D 3R9LA 2MSTA 5HVHA 3VCDA 1AT1B 5D0GA 3CCZA 1CULB 1T9XA 3VAIA 4J9RA 3M32B 3BKUA 2ZJRQ 1U1KA 2L9DA 5DDRC 3W7BA 5ETQA 3P5BP 1DTQB 1EQMA 2J5AA 4CLFA 1VJWA 3EX7B 4HI2A 2FHJA 3H5UA 4QU6A 1FRMA 2ASYA 1SKWA 3EGNA 2YH1A 3LPEA 1HD0A 2VB6A 4UT4A 5HMWA 2ERRA 2K7JA 1G7CB 2BJ7A 3Q8YA 2BUNA 2WB4A 1J2VA 1LK7A 1GQEA 5D78A 5KFHA 3H59A 2IJNA 3H20A 4JYAF 3I31A 1H7XA 4WP3A 4X4QA 2ROGA 4P2MA 3ISZA 3GSDA 2B7CB 5ETTA 2GO8A 4ZLNA 4WIIA 2VIHA 4P7TA 2HS0A 4OYMA 3LTOA 3WX8A 4ZPBA 1HWIA 4K4YA 2WVEA 5KOXA 1S1TA 3G2XA 5HROA 4KKOA 4PPDA 1GMUA 1WOPA 2HHHJ 3PX0A 1NB7A 4EFAC 3M1VA 2HQIA 4LRDA 1SV5A 3AD7C 1PBAA 1HR0J 4ZDNA 3V2UC 2ASLA 4CLKA 3WQPA 1JJ4A 4H4MA 2Y8YA 3HI9A 3ZFVA 2YWEA 1PC4A 4ZP9A 2DNGA 3QJLA 4L6V3 3TJAA 1FJGJ 3DKDA 3AOBA 3SQGA 4HT5A 2W4PA 4QU7A 3CDBA 3QT8A 1FK9A 1AFIA 3G8QA 1T03B 3IAM9 3D2WA 2OHDA 3R2DJ 3RJMB 1RTDB 1TKZA 4QWDA 1UA1A 3AA8A 2ZH8A 4P2XA 4ETXA 2FHJD 2HHTA 2FJAB 1YJTA 4CWBA 4Y0FA 4AXJA 3EVOA 3GJRB 3BYPA 1HHTP 4G1QA 5E3AA 3GG1A 2XC9A 2PO4A 3V6HA 3BV8A 2XNRA 4IG0B 3ZZUA 1EP4A 2UXCF 1DJ0A 1X0FA 4NZ0A 5J2MA 4ES3A 1FRXA 4J9OA 1URNA 3HKZD 5D0HA 5FIIA 1Q86T 3H42A 5A8KA 4E98A 4AL7A 2KU7A 3GV5B 4OLOA 3CJ3A 4KBIA 4TN2A 1RTIB 2ZDPA 1RT5B 1IKYA 3CCSS 2VDHA 4CLTA 2DIUA 2VQEJ 1VMBA 1NSPA 4MYUA 2VJVA 1T0TV 3KHGA 2VFRA 1R31A 4ECRA 2LLZA 3TAMA 4J9UE 2FLOA 3QT7A 4LF8J 1YDLA 1GX5A 3MMAA 2V0NA 1O8BA 2ZZMA 1EHWA 4X62J 3BBBA 3PX6A 2QLWA 4RU2A 2FZKB 1JLBA 1K73T 3BB5A 2GC8A 2YQ3A 1WF1A 3T41A 3T3FA 2L3MA 2XLIA 3H8YA 2IVMA 2I6WA 3P96A 1L5UA 2R7TA 2RT3A 1RHRB 3C6TB 1EX8A 2BE7D 5MLCV 2BV3A 4DF4A 1T9WA 5IQ6A 4IR9A 1SXLA 2HWTA 3FMBA 4K0KJ 2XZDB 3IGVA 3OFGA 2RMLA 3M2UB 4IFVA 4K7QA 4R0EA 3C66A 2ZBCA 1FO1A 3MR5A 2D74B 2Z2YB 3U02A 2I9SA 3AJDA 2ZBIA 1RHQB 1B64A 3M8PB 4WFXA 1NHKL 2CWXA 4RW4A 4WJBA 3VGSA 4NCAA 3FCVA 3X1LB 4L73A 1SQGA 4HDHA 1N4LA 1B0PA 4E2FB 1G3OA 3DHXA 2EW9A 2C42A 3OTBA 2DNKA 3LF0A 4GKJF 1JKHA 3HHKA 1TVRA 1R8CA 5GAEI 2LEAA 4RBUA 4I7FB 4DJBA 2ZHBA 2B4PA 1FRKA 3CXCR 3TI0A 3CJSA 1Y5LB 3NNAA 4ER8A 4DV4F 2WB1D 4JI4J 2CNNB 4NASA 3HK2A 2FVPA 1WTFA 2AYBA 2BE2B 1QY7A 2DD8S 1HPZA 1X4BA 2APOA 1T8EA 4JI6F 2Y0BB 4UY85 2VBZA 2ZC3A 2JLGA 2UUTA 5HBMA 4LF9J 2ZM6J 3BSNA 3SCKE 4I2PB 1UVJA 4QIFA 4LF2A 2MKCA 2KYXA 4DX5A 1N33J 2BVZA 1GH8A 1SI9A 1RCXB 2CNLB 1FX2A 2QRRA 3D7SB 3JB9k 4ZLLA 4U96A 1WC3A 3ISND 1JJ2R 1RHKB 3R8YA 2BANB 1QDUB 2MHNA 1KHWA 2P2CB 2EK6A 4M5DA 4QOTA 1NPPA 2XO6A 3GG0A 2GMLA 4DR1J 1AXQA 3CE8A 2IYGA 1RCOB 2GMHA 4OYAA 4F0MA 3M8SA 2F8HA 2MZQA 3H2VE 2F8MA 4B9SA 3CD0A 5K8MA 2WAQD 1H73A 1FERA 1QM9A 3NCPA 3JTOA 3UWTA 2PD1A 4EUVA 3A8EA 3TYTA 1BD6A 3QMQA 4K2JA 4C7QA 5CCLA 3H4DA 2HKEA 1ZM9A 2IDEA 5B0GA 3EXYA 2ZNYA 2DGVA 3POTB 1FVSA 3E8OA 2RKIA 5B0CA 3IR5B 2H4YB 3C16A 3M8ZA 2HLUA 3NWRA 4PPZA 2Q79A 3GE9A 2CQBA 5EWFA 3V6KA 5LJ5Y 2OO4A 1KS2A 3I82A 3BN4A 1YJVA 4DR7J 4USHA 1PC5A 3QNWB 1U4BA 1HNXJ 3S1TA 4NLPA 1NJIT 3M2VA 2JEIA 1V6HA 1UEKA 1MW7A 3GJTB 1P27B 3VVTA 2W8KA 4LF6J 1N32F 1T95A 3PEJA 1V3RA 4HHHA 3R27A 4QPTA 2OPSA 2MZRA 3F44A 3ZZZA 4DQQA 1KQGB 4YR2A 2XGQA 3MCOA 1Q1KA 1LFWA 3V6DB 3FBCA 1X9MA 1KVJA 2WOMA 4G1IA 1FKPB 4ED0A 1B7FA 3JTPA 2WBMA 5CD4A 1K0VA 2WVDA 1IBMF 3H5SA 4B17A 1BQXA 1FX4A 2W2MP 2HLTA 4W90B 1Q0NA 1WELA 3BS9A 2BOPA 5DDPC 2CAJA 1NK8A 3VAKA 3KJQB 3TJ8A 1RWKB 4NI2B 6FD1A 1ELOA 1PGZA 2V2KA 1X4DA 1S1UA 3CO0P 3BGOP 2G4BA 4J9LA 4DR4J 3VAMA 3CCWA 2D9PA 4FZVA 3SFGA 1K1SA 3CF5Q 4FVMA 3DRSB 5K20B 1TL1A 5KFFA 3HLUA 2QE5A 3G8SA 1S4EA 2WHOA 2F3JA 2ZOGA 2RD5C 2K1RA 4PG4A 3CULA 3SCLE 2KJWA 1HARA 4ETZA 3ENAA 1IR1A 3MUVP 5F3TA 4OJHA 3OL9A 4DMZA 2AGPA 1FRHA 4DPUA 1X7VA 2VU5A 2QSWA 4ZHRB 3PW2A 2A2CA 4FKXA 2PMHA 2CG4A 1SJFA 3PFEA 4CH0S 2MQOA 1S76D 3NEKA 2F5GA 3N4WA 3MECA 5HJYA 1WKJA 5IQQA 3IWNC 3BSCA 2B8PA 5IWAJ 1HBOA 2QSFA 1HI1A 1RHJB 2PI5A 1X0PA 2BA9A 1PO6A 4B3OA 1M5VC 5T7LB 1PSDA 2YKOA 2R42A 3M9OB 3RG6A 2FJVA 2CQ4A 2D3UA 2UXBJ 4LBHA 3CCES 2BJDA 5GAGU 4AL5A 1F1BB 1FF2A 4YMEA 4UUXA 3A8IA 1HNIB 2CZ4A 4AQYF 2V67A 1UWBA 2W2QP 2RQ4A 3VQSA 4AFFA 4DSEA 3Q8VA 1M5KC 4KV8A 2YKNB 3JAMU 4BCAA 2M8DB 2B0GA 3PO4A 4WF9Q 4DS5A 2CQDA 1FA0A 8RUCA 2JC0A 1N52B 1S0MA 1VBXA 5KFIA 3GZ7A 1MG7A 1YZ6A 4GVBA 4C6AA 1N6QA 3GILA 2IPOB 5KG3A 4GC7A 3WZ0A 3MPVA 1I94F 1HMVA 3FFIA 2B4VA 3R1HA 1DFDA 3GCXP 3LGMA 4MH8A 5M2PA 4ZA1A 2DT9A 1RISA 4FN5A 1KD1T 1IM6A 4MMOA 5LSOA 3MPYA 3H4BA 1IKWA 1GMWA 2VKRA 5E5NA 2NXJA 2B6AA 3NGKA 1QVGR 3OD2A 4MKYA 2AYMA 2JX2A 1BE4A 1H38A 3D1OA 1FRIA 2FZGB 4J90A 2OPPA 3DI6A 4LQ9A 3DRRB 5D4LA 1QSSA 3OLAA 4RKUC 4JV5F 1RB0A 4WU3A 5BR8J 3NRBA 3LAMA 2KG0A 1XC9A 5GMDA 4YB7A 4OFZA 3LWLA 3MEGA 4DL0C 1TK5A 2GV1A 4M1KA 4YDXA 3B82A 1I1GA 3M6WA 1U7LA 4RZRA 4RU9A 1FRJA 2LEPA 2RHSB 2KO1A 4DV6F 2DY1A 2XWXA 1VHFA 1YJ9S 3D3BJ 2O3DA 4N7TA 4YB1P 4QWCA 1Q5VA 1F3VA 1R0AB 3D0GE 3A3NB 4NLXA 4NRUA 4YP3A 3SFUA 1F2GA 3LP2B 4YOEA 2J9CA 2FLPA 3T5JA 3WBZA 5FD1A 1M0SA 3UCZP 1IBLF 2B9YA 2MMYA 1IWAA 3HJFA 4QIEA 2NXCA 1IBKF 4EEYA 4ZVUB 4JYAJ 1PBUA 1RAOA 3MMJA 1M1HA 3CJQA 4NX9A 4YN3B 5KFMA 4CNZA 1KP6A 2YXLA 1YRXA 3S7RA 1R6YA 2QG9B 3CCLS 2UUCJ 4NLYA 1GMWD 2DNRA 2XYGB 2OJ3A 4DUZJ 3R5CA 4IRCA 3CDWA 1U1LA 4DHVA 2HMIB 1VK8A 2ILYA 4IG3B 3GTYX 3JYTB 1JNZB 4RUHA 1ZM2A 4KFBA 1U25A 4USVA 5CH7B 3LP1A 3GJSB 5A2QY 3KK1A 3B78A 5GVQA 2LEBA 3GMGA 4DV5J 5GAHU 3D0HE 1P1TA 2LXUA 4LF5F 4QR1A 1SQFA 3D6HB 1REGX 4JUZA 1S0NA 2W9CB 1HQEB 2G2ZA 3BF4A 2MLYA 5IM0B 4TQSA 1T3OA 5KOWA 3T1AA 2MQLA 3TARA 4LFAF 1LWXA 3OV7A 4LR8A 1RHUB 4DG1A 4L75A 3ITHA 1HLWA 1YZ7A 1NSKL 1FE0A 1WD6A 4RL1A 1S0OA 1S6UA 4Q44A 2YNIA 4M95A 1QTMA 1TELA 5F9LA 4CP5A 1RYRA 3DHWC 1F3FA 1FWKA 1DURA 3QPIA 4WFAQ 3CJKA 1TK0A 1QD1A 3KLVA 3HPOA 4DQRA 1XMQJ 4Y6IA 3I0RA 3CCVS 2D7SA 3AA9A 5IT4A 3PKMA 5J1EA 3MD3A 3FUYA 1ZTWA 1UJ5A 3WDOA 5AE1A 1HQ2A 2PT0A 4JI7F 2VOOA 4OZ1A 1ZZFA 1M5SA 2JFDA 5HMYA 2JC1A 3KFWX 1N48A 3PJWA 1U24A 5IXUA 5HSPA 2DRBA 2CNKB 3Q83A 2E1CA 3EYZA 2CQPA 4FS2A 1FVQA 1VBKA 4USMA 2HVZA 3HDSA 3BZQA 4DX8H 3BH7B 4X4TA 2JJ4D 2RJZA 4O3QA 1RT1A 5D77A 5IOLA 1S1TB 5DQHA 1F60B 4I2QB 2CQCA 1YK9A 2N4DA 3TANA 2RF2A 5EUHA 1S48A 1D8ZA 1P8GA 2V2VA 2VH7A 3X3UA 2IDLA 1SV5B 5K8PA 2D41A 2CADA 1U6ZA 3MD1A 2FC8A 4OZ2A 4H4MB 4Y3CA 4DX6A 1EARA 3MURP 5C42A 2NPFA 1Y10A 1YBTA 4B3TF 2AZ1A 1H2TZ 3P45B 4WTYA 1JLAA 2CUYA 1Z4UA 4BC7A 1ZBTA 4ZJQA 1RAFB 3K17A 1FK9B 4USTA 1EIYB 3DM2A 4IH7A 1UVLA 5IC6B 4PR6A 2ZHAA 1F6TA 2HAIA 1SL0A 2ACYA 4RNNA 1TKZB 1U6FA 3FSYA 4LF4F 4J37A 2HK2A 3NMRA 5E41A 1NJYA 1J27A 1TU0B 4OJ3A 1S99A 4ZPWR 2RHQB 1K0TA 1JQGA 3MAHA 3DDNA 5EDWA 4Y65A 1E6YA 2V34A 2ZVSA 3MCNA 4FXDA 2LQ5A 2AP6A 2CA9A 4ED8A 4G1QB 1TAUA 2NPIA 1RADB 1MWZA 2XWYA 1FKOA 4PUOA 3DOMA 1RSCA 1HBNA 3PYGA 1LW0B 5J2MB 4X2BA 3SIPB 2WTFA 2LMIA 1CC8A 2KM8C 4XPEA 4F3MA 1CQMA 2YPZA 4QW8A 4AE5A 5A8KB 3QSYB 4DPYA 2VPXB 1S0VA 4Q45A 3UN5A 1IKYB 4DZ6A 4C3LA 3ZXWA 3JSRA 1X8DA 3AAWB 1BC6A 2GCFA 2ZBRA 2XMAA 2DISA 5SZTA 3HHLC 1FWLA 3TAMB 2XSJA 4DV4J 3KKFA 2W24A 1D09B 3GLJA 4QIGA 2XEXA 3MMAB 4DV7J 2AX1A 5D4OA 5H9EK 5J2QA 1HFEL 3Q2SC 4DV3F 2I38A 3OW2R 4JI6J 1WC6A 2M70A 1TZ0A 4OZNA 2FGOA 1DY3A 4X4RA 2MLZA 4CCHA 1R8BA 3NKYA 5LMNF 4MTPA 4CLUA 2DO4A 3CD7A 2B8QA 3T5KA 4P75A 1LNQA 5K9FA 2MQNA 2CQIA 2V8VA 4NYOA 1U1OA 1JIHA 4ECTA 5C25A 1WTBA 2C3YA 3BR9A 4DEZA 1B0VA 2CJXB 1YX2A 4F3OA 2DIVA 2LECA 2CQ3A 1WEZA 1KC8T 4NMXA 2BKPA 4IFVB 4OX9J 2CJYB 4P71A 1DBDA 4NA3A 1D9AA 4GKKF 3AOAA 3KOAA 2N82B 3F41A 1YJWS 3IMQJ 1SKRA 4LVNP 2VBWA 3AB2B 2Z4PA 2PFDA 3NS5A 1CSJA 4RW4B 1BUXA 3OVBA 1VC5A 2QFIA 1Y7PA 1EQ0A 1S79A 4BWJA 1X60A 4E0DA 4UW2A 1TQLA 2U2FA 2AGQA 2QA4G 1GMVA 4MIAA 1C1CB 1J5EF 2LP4A 4QIWD 2HHWA 2YBVA 1JKHB 1TVRB 1E6VA 3OSPA 3AT1B 4KYZA 1GT8A 2UVWA 3MM9B 1XMBA 4ILLA 2RQKA 2F4FA 4DI6A 1C1BA 2CPXA 1SUQA 1SH2A 1G4CA 3W2VA 1ZYQA 1FDBA 2C2MB 4Y2IA 3VZHA 5DLGA 3OTCA 4U8VA 5HK4A 3TVKA 2XLKA 3SSRA 3CC7S 4IQXA 3T1HJ 1U48A 5GADU 1M90T 4QBUA 3DYAB 2W1BA 2E9RX 1HPZB 2ZWPA 1L3TA 3I56S 2JEFA 2CVEA 4O0IA 3HJVA 5KFJA 3NS6A 3KLEA 1XNQF 3JQJA 1VRTA 2DVIA 1PILA 3UNYA 1KSPA 1DRZA 3NCRA 3EZOA 4NCBA 3OUYA 2L41A 5DDQC 3QGGA 2FB0A 2W25A 1TUGB 2VFVA 4EGLA 1H98A 4Y28C 2V9KA 1HBMA 4HYKA 1IBMJ 2ZOMA 1D3WA 4M5DB 2BJEA 5AJ3F 1U6BA 2B4UA 2GX8A 5KTQA 3TA0A 2FVRA 4F4WA 1TK8A 2AHOB 4O4GA 3BBFA 1XMOF 3N9UC 2J9EA 4NLTA 3AHPA 1Q8IA 2DGXA 3MPWA 2YQ1A 3WX4A 2RDIA 3K0JA 1CQNA 2Z0GA 4J9PA 4U6PA 1FNXH 2CPYA 2FHMA 2A6MA 2KH9A 4MIBA 4P52A 1NPKA 4GMKA 5D15A 1PJ7A 2RKIB 5KAKA 2L08A 2CJKA 4RW6A 3C16B 2F65A 3DXBA 3P8BB 3CJ0A 3IO1A 4JI2F 2QYCA 3ENWA 2AJ0A 3M05A 3LUYA 1PIEA 4KY3A 5L9XA 1WEXA 2K06A 5EX3A 2MQMA 1S9EA 2C22A 3ADAC 3QLHA 3LH2S 4X64F 4WWSA 1R8PA 2DH9A 5K8NA 4OI3A 4PWDA 3D1HA 5C2CA 1NJWA 5F8JA 5F9NA 1QAXA 4IOCQ 3PTWA 4AQYJ 3CNQP 1DARA 1JLEA 2FY8A 1F5BA 2UV8A 4WIQA 3QJJA 2WOMB 2HFOA 3G6VA 4F3QA 4H4KC 1QUPA 2EC2A 2OP5A 4WXOA 2BQ3A 2GJFA 3OL6A 4Z2XA 1LXNA 4DR2F 1XR6A 3FSIA 4X4VA 1TP7A 2F1FA 4A48A 2OUGA 3GIJA 1I94J 1TAQA 5IC4B 1NNDA 1RP5A 1TUWA 1RAEB 2ZZNA 4LVOP 4NRTA 1RQ0A 2FYXA 3MEKA 1S1UB 1XJWB 2HQFA 4ZP8A 2OH2A 2VFTA 3PG9A 1WACA 4K2XA 1QSLA 5FDLA 4TLQA 1RUSA 4EWTA 2IHR1 1TL1B 1S5ZA 2ALZA 3KDOA 4H54A 2IRUA 3C15A 1RA6A 2K1RB 2VICA 1Y3KA 2VBXA 3WC2A 2Y8WA 4QZVB 2IBOA 1T94A 2AV5A 2DNLA 2V8DA 4P7VA 4C0HA 4QIVA 2HWIA 2VPWB 3LP0A 2OKQA 4OI4A 2O66A 2DGSA 2OFHX 4ITSA 3DDKA 1M1GA 3EVWA 4JV5J 1LV5A 1AZSA 5L38A 3DNCA 3DMJB 5F8HA 2XSFA 3K59A 4OHZA 3MECB 3PYEA 3IRWP 1TL3A 3NLCA 3TUZC 3IN5A 3IC1A 1K8AT 2IA0A 1QSYA 4XIUA 2UUWA 2Y1RI 1HR0F 2AYEA 1MMDA 2AGOA 3CJ4A 1S49A 1JB0C 2B9WA 4IFYA 1HBOB 2BJ9A 2DGQA 1XBWA 4QYRA 2XS5A 2V8HA 2CPJA 1FJGF 1L3VA 1WG1A 4ZCMA 4B3OB 2QL7B 4PEOA 1EETA 4A8YA 1CJKA 3ZZYA 1VBYA 1VS3A 3FBEA 2ZH5A 2RUSA 3J7ZT 3Q24A 1RGVA 2PDAA 2AX0A 2HBRB 2BDPA 1NZAA 4G3IA 1C2PA 3M30B 4ZVQB 1IBLJ 1UVKA 4ZP7A 4KV8B 2GGPA 4FDFA 4CT9A 4KE5A 3P4UB 3NGUA 3FGVA 3NP5A 3GP9A 3IXQA 1R6VA 1RTJB 3JQKA 4F50A 3QSIA 2DJWA 2LQBA 4CQ1A 3NWGA 4GVBB 2BM1A 5KFUA 3THTA 3QZ8A 1N6QB 3TA2A 2VG6A 1RZMA 1OY6A 5KG0A 1HMVB 3FFIB 1VBZA 2MGZA 4HI1A 4OI1A 4RW9A 1RT6A 2KDOA 4CO4A 2Q6CA 3CC4S 2DHGA 2VOPA 3AB4B 4RW7A 4IR1A 4X65F 2B6AB 3A8KA 2Z58B 2E7VA 1LW2A 4RJVA 1HI8A 3DXSX 2H51B 4LF5J 3EICA 5HLFA 2HVHA 1MN9A 5L1JA 3TAQA 2YVSA 2XMUA 3DI6B 1T11A 2AKWB 4LF8F 3ET6A 2M4MA 3HSJA 2FJWA 4ILRA 1N5YA 4X62F 2DB1A 2O5DA 1WC4A 2IAJA 1VQ8S 3MEGB 4LFAJ 2OTLS 3PO5A 4X4NA 2CFXA 2V5HG 2DY9A 2XI2A 2JFKA 2VC0A 5C24A 4CDIA 1VK3A 5E33A 5IV4A 3I32A 3MI7X 1WF0A 5LXYA 2DHXA 1KFDA 5H1SV 2B5JA 3HD1A 3FVYA 3GSIA 3R97A 4TYAA 4ZVGA 3THVA 5J1PA 3N01A 1UEVA 2C2OB 5C5JA 1Q79A 1CJUA 5IT9U 2DPIA 3J81Y 2DH7A 4DN9A 1VIOA 2BQRA 1KEKA 1LWFA 2ZUGA 1YKWA 3C2PA 4H4OB 3PEHA 2HSEB 2XMJA 2ASJA 3K5NA 3G82A 3K58A 2DXDA 5E0OA 5KFXA 3TZZA 1LOUA 1RJJA 2FIUA 5FLXU 4C3MA 3UVJA 2X51A 1BQNB 1I6JA 2QEXS 3PY8A 3K5MA 2CNOB 2DCLA 4GO5X 3TW0A 5K8OA 2MKKA 3ZZ0A 2W4CA 2W01A 2D3OR 1Q8BA 3F56A 2JLEA 3UD4P 3MDFA 3IM9A 4KFBB 3CCMS 2JL9A 2LKZA 1RWUA 3IS9B 3UN3A 1UFKA 1S10A 2HNZA 1I3OB 1M5HA 1YJRA 2I5JB 3A13A 2EFNA 2KHCA 2C2DA 4K50A 4C97A 2XTJP 3VTIA 1NHUA 2FJDB 2KVQE 3D66A 1WC1A 2XY6A 4CLSA 1S4FA 4B3TJ 3J81j 1FD8A 3HMJG 4MT1A 3R3TA 1Q78A 2C3PA 1HNZF 2IIHA 2RE1A 3D0IE 2HHUA 2ZBPA 1QE1A 4DV1J 2RRAA 2DRDA 4DFPA 2KRRA 1UEUA 1FFGB 4LF4J 3ITHB 4LF9F 4ZITA 5ETPA 4DWIA 1FRLA 5G0RA 3QFHA 3IFEA 3NCQA 2HGMA 1N33F 4ECVA 2YNIB 5A8RA 1U02A 4LIRA 5HP1B 2J9DA 3HVTB 4U67Q 2MZSA 2ZJPQ 3MTKA 1S7IA 3FNNA 5E2QA 5I42A 3BO3A 4K8RA 4F4XA 3CJKB 4QWAA 2GNKA 4CTAA 2C3OA 3TZYA 3UDCA 3I0RB 1DTTA 5IV3A 3KLIA 4B3MF 5J1EB 3LWMA 4TU7A 1JJHA 1SVDA 4X4SA 3W2WA 2CPFA 4XAKA 1LWCA 4ZVSB 4DR1F 4ED3A 2VODA 3RYLA 4C9DA 2MKSA 1TL7B 3VV2B 4LSNA 5H9EJ 1QLNA 2JHEA 4L72B 4AUKA 2E66A 3KLHA 5J2PA 2I1RA 5KFNA 2ZJQQ 2LA4A 2ATLA 3TEGA 2KXFA 3QIPB 5KT4A 1RT1B 2R8GA 4DV3J 4TU9A 3C6UA 2RF2B 4OHXA 4LR9A 3OHBA 2WSFC 2R2SA 3MEDB 2GHWA 1TKTA 4I67A 3GR1A 4Q8FA 5LMNJ 4F4AA 3KUGA 1HD1A 3KMSA 2JH3A 2QX0A 2IJRA 5C42B 1SH0A 2EKNA 3UNGC 4DR7F 1KWMA 2Z2MA 5KFOA 4WP9A 3V81A 3MM5A 1JLAB 2B43A 1CJTA 3T19A 2GMJA 2P6SA 2V50A 1VLOA 1U45A 4PXDA 1S1WA 1S6PA 4F7VA 3DM2B 5DLFA 3DLGA 5LSLA 3RB4A 1FNMA 1O0PA 5B09A 5CQGA 2J6SA 3I96A 3E3XA 5D8HB 1U0SA 4HTJA 3I4PA 2OD4A 2KYZA 2Y1LB 2FLNA 4KGZB 2R7RA 2R8KA 3QRQA 2QL5B 4LRAA 2CQHA 3KNAA 2BW7A 4GKKJ 2MHEA 4DQPA 1FKOB 2DNPA 2M7SA 4PUOB 4ANEA 4MYTA 5L39A 1HBNB 1WHWA 2WBRA 2XCPA 1X31C 4XDCA 3M7VA 1JXEA 2E1MC 5DS7A 4J9SA 1VRUA 2SXLA 1WOSA 1YSJA 2QA2A 4OZ3A 1SC1B 4ED2A 4A8XA 3T5LA 2HQDA 4F4KA 4CO0A 2MQ8A 1J5EJ 2Y0SD 4PWWA 3D9BA 4YY3J 2H48B 3OVAA 4F0HA 2HURA 4IOBA 4LFCF 1JLFA 3GIRA 2DGUA 2JZ5A 3ZTRA 1HYSA 3U7JA 1V3ZA 3PKYA 2XY7A 3GWCA 4JP8A 2XO7A 2E5IA 2YKMA 2RQCA 1KVIA 2XMMA 2V4QA 2XSJB 1WDDA 5CAAA 2E5JA 1EAYC 3LANA 1NCLA 3CJ2A 4RNMA 3D5MA 5ETLA 5J2QB 1IM4A 3R5BA 3J7AN 3JAMY 4YUDA 5HANA 5DZ6A 1C0UA 5D4NA 4DN0A 2PI4A 5KG1A 3N28A 3W5XA 4F25A 3DRXA 4E8UA 1X4CA 5LSRA 2AJFE 3N5FA 2L9WA 1XNQJ 4NPOA 3HF5A 2MKYA 1XQIA 4JI3J 4H4KA 3OFFA 2OGUA 1H7WA 1UFWA 1Y9OA 4CRJA 4HVZA 2AJ4A 4KGXB 2KXHA 1JLQA 4DR6F 3PIPQ 2AJ2A 3EUNA 4OHWA 2ZH6A 1TKXA 2WSEC 4IDKA 5LM7E 3HZGA 3HT3A 4FNIA 3PW7A 4ATNA 2BXJA 1RWMB 4M5GA 3PXGa 1L3SA 2HVEA 5AJ3J 4BLGA 2FGCA 2MZTA 5M2UA 1BWEA 2AYGA 2I0XA 3PZPA 1REVA 1U09A 2E29A 3A3OB 1NK6A 1ZS6A 1NK9A 1Q4RA 1XMOJ 3KK2A 1PJ5A 1Z2LA 2VPZB 2JNJA 3IBWA 3MHYA 1R7IA 3I4HX 4XPCA 5AE2A 2ZWOA 1VQLS 1ZAXA 3JXOA 1FEHA 2YNGB 2OLWA 3D4JA 3ZC4A 5E3RA 2JVOA 1XEZA 3CDEA 4P9SA 3LOUA 1SC4B 4WK3A 1E6VB 2HQCA 3RB6A 4KHPF 4DSLA
chains in the Genus database with same CATH topology
3PX4A 1YRXA 3JSMB 3BR8A 3S7RA 1R6YA 1N88A 4N41A 2EVZA 3MWBA 2PA3A 5JUMA 3GV7B 1G2EA 3CCLS 4ZKAA 1FDDA 1HNVB 1A7GE 3V5RA 2GO9A 5BYSA 1C1BB 4NLYA 5E7OB 2DNRA 1SUQB 3SMZA 2HGLA 2OJ3A 2LYVA 2A2DA 2KM8B 4ECXA 3R5CA 2JSXA 2GHVC 4IRCA 3CDWA 3OFEA 1U1LA 5HBMB 2Y1JA 4NYPA 3UDLA 2R8JA 2MKJA 4DHVA 1U26A 2HMIB 4Y00A 4C8ZA 2ZHOA 1FJ7A 1VK8A 2ILYA 5GMKa 4IG3B 3S01A 3BO2A 1WI6A 4CO1A 3JYTB 4D3HA 1JNZB 4RUHA 4Y2CA 1Z2ZA 3OXFA 4Q43A 4JI3F 1ZM2A 4KFBA 4EBCA 1U25A 5GAEU 1C4CA 1DTQA 2BZ2A 2LU1A 2KG1A 5CH7B 3NBPA 3LP1A 4FVCA 2R2UA 4J9KA 5JVHQ 3MZIA 5A2QY 1MROA 4DBQA 3U1LA 3KK1A 3B78A 4IQMA 4OZ0A 3IAS9 1WI8A 1SJRA 5GVQA 2LEBA 3OBIA 5K5MA 3PR5B 3OPKA 1A9NB 2DNMA 2NXUA 3GMGA 3C3LA 4Z37A 2LQ9A 4KIAA 5GAHU 3T1YF 3D0HE 1P1TA 2LXUA 2VA3A 3H2UB 4LF5F 2KZZA 3TUJC 1YRUA 3HHLB 4QR1A 4R8UA 4CO2A 3PJXA 4BHQA 1VRTB 5KFEA 5H9FJ 1HWKA 4Y2AA 3POTA 3U27A 2AWZA 3H2LA 3MM8B 4JUZA 1JWWA 2X1GA 1VC6A 1S0NA 4WKYA 3DRYA 2MJUA 2OD6A 3VR1A 2W9CB 3SV4A 1HQEB 1W2BR 4TKTA 5D3GB 5AXMA 2CQ0A 4R5PB 3IWLA 3BF4A 3U1MA 2BYCA 3CGIA 3OUYB 5KFPA 4O3SA 4JI8F 5T14A 5IM0B 4TQSA 2EFPA 2ZFHA 2AQ4A 3MOJB 2HGNA 1T3OA 2IC3A 5KOWA 2CPHA 2MQLA 4ID5B 3T1AA 3B8HA 2P6TA 3TARA 4R25A 4KRWA 4LFAF 1UJ6A 2KT5A 2GQCA 2L48A 3DU6A 3OL7A 4I1TA 3NGDA 3MMCA 3OV7A 2B4OA 3DLEA 3FEZA 3T5HA 4JI4F 3PDNA 1M1KT 1HBMB 3M8RA 2IM0A 2NLWA 4DG1A 2Q43A 3ITHA 2FUG9 1F0XA 2JDJA 2BRKA 2C3MA 4PXCA 4ZVHA 3KK3A 2W4DA 5AE3A 4DQIA 1FE0A 1WD6A 3IR7B 5EWEA 1S0OA 1S6UA 3K2YA 1R3NA 1T05A 3GFYA 4I4BA 4I6AA 1XTZA 1KQFB 2R2RA 2DR9A 1S1XB 3MEEA 1UETA 2PN6A 4Q44A 4URQU 1FE4A 2YNIA 4NLVA 4M95A 1QTMA 1ZOTA 5HO4A 4M63A 2IJFA 5KG4A 5F9LA 2C28A 1RYRA 3DHWC 4TYBA 4YB5A 4XO0A 3UQSA 4PG8A 1NKBA 4QWEA 3ONQA 3DOLB 2WW8A 3LQVA 2HNZB 1DURA 1RT3A 3QPIA 4WFAQ 1YJUA 5FJ4A 1NEEA 3CJKA 5B08A 2ZM6F 1TK0A 4RUAA 5CYMA 3H5XA 2KN4A 1XR7A 3KLVA 4DQRA 3HPOA 2LDYA 4O4GB 4Y6IA 2B51A 1X4FA 2X1AA 3I0RA 2C2RA 2B7BB 2J0XA 3SSSA 2OPQB 1RDRA 1WEYA 3DN9A 3CCVS 4C8LA 2D7SA 3KLFA 3AA9A 4CI0B 5IT4A 3PKMA 5BJRA 3BGFA 2RDJA 5J1EA 2FY1A 4QJVA 2V8GA 2R7SA 1BQMA 3MD3A 2IRXA 4RNHA 2VG7A 4PXEA 1ZTWA 1UJ5A 3M2RA 4DSKA 4RNFA 1WF2A 2LCWA 4USJC 1UW4A 1VOMA 4GO7X 3WDOA 4WE1A 4NZ7A 1J5OB 1FKPA 1YTYA 4F02A 5AE1A 3M9MB 3MF5A 3ZZTA 2PT0A 2W9AA 3VAFA 3G9CA 1LQ9A 4JOUA 1X4GA 2XHWA 4PG7A 4JI7F 4F67A 1OSCA 1X5SA 2VOOA 1IUJA 4N8OA 4OZ1A 2XULA 3HFKA 5A8WB 1ZZFA 1RT7B 5B0AA 4NWBA 2UUCF 1M5SA 3IG1A 1ZM3A 2IM3A 1JXLA 2JFDA 5HMYA 2JC1A 3GIMA 3KFWX 2J0SD 4DR3F 1N48A 3HVWA 4DUZF 3PJWA 3P3DA 2K3IA 1U24A 5IXUA 3MGJA 3OR2A 1N8RT 1W25A 2RH3A 2DRBA 5K14B 2E1CA 2KFZA 4RW6B 3EYZA 2CQPA 3CIMA 4HTIA 4FS2A 2EC0A 3M2VB 5G0RB 1SJ1A 2EFOA 2VKZG 3HP6A 1FVQA 5KFKA 4L3NA 3DU5A 4YEAA 4DDFA 2HVZA 2MDAA 3HDSA 3BZQA 4DX8H 3PW4A 2M8HA 1RKIA 4X4TA 2QMWA 2Y1IA 3OR1A 4DR5F 4DF8A 2JJ4D 2RJZA 1WG4A 4O3QA 4K4XA 1RT1A 3M6VA 2MXYA 4ZOSA 5D77A 2ZH3A 2DCUB 3N6LA 4ZPDA 1SL1A 4DV5F 1S1TB 4OV1A 1P1LA 3DRPB 3RRKA 4F26A 5DQHA 4I2QB 4CTAB 2DPJA 1SH3A 1OSDA 2OPSB 4B9UA 2CQCA 2JEGA 1GTHA 3DRSA 2N4DA 2NZ4A 1FNOA 3TANA 2RF2A 1R43A 2GIQA 2ZE2B 3QLHB 3QGIA 1N0UA 5EUHA 4ED7A 5F8NA 1S48A 1FEEA 1D8ZA 2OMLA 3IA0A 1M5PC 1P8GA 2VH7A 4HH0A 4ZCKA 3FQLA 3X3UA 5B0BA 4URGA 2CZVC 1SV5B 5K8PA 5AXNA 1RT4B 2D41A 1U6ZA 1U1PA 3MD1A 2FC8A 2P9EA 3W2WB 2DNQA 3J7Z5 2LQJA 4KJIA 2HWHA 4H4MB 3L7OA 1CEZA 2YWHA 4Y3CA 3MUTP 2E9ZA 2UU9F 2NUUG 3GR0A 3I5AA 3N0VA 2E5GA 4FS1A 4A8FA 2EFQA 4FYDA 1NK7A 4I68A 2HPUA 3MURP 1OPIA 2JRSA 5C42A 2VG5A 2NPFA 4P2SA 1NRKA 4CT8A 5J2NA 1T3NA 4QYZJ 1G6BA 1Q53A 4KO0A 3UFCX 4B3TF 2HG4A 4ZHRA 5JJBA 1H2TZ 4DL5A 2MY8A 4WTYA 2R2TA 2G0CA 1R89A 1JLAA 4BC7A 1Z4UA 1H2UX 1P9QC 1ZBTA 2BM0A 1JLEB 3J7YU 2BQUA 4ICLB 1FJEB 2RQMA 1OIAA 3KHHA 4WFNQ 1FK9B 2P9CA 1NH8A 3BDPA 4Y34A 3DM2A 4OIXA 4IH7A 1YBAA 4KQZA 2VL1A 1JX4A 3IR6B 5J2PB 1HI0P 1UVLA 2OPRA 2C2EA 1ZTTA 4PR6A 2ZHAA 2EPIA 2HAIA 1SL0A 4A4JA 4K4UA 3OJUA 2ACYA 4RNNA 1TKZB 3TX8A 1U6FA 3FSYA 5IS2A 2YX7A 1VQOS 4LF4F 1HNXF 2E5LF 2XMWA 4J37A 4ZCLA 3NMRA 5E41A 4J5OA 4OL8A 3Q8SB 1XMQF 4CO3A 1FXRA 1NJYA 5LMUF 2ZH2A 4OJ3A 1N54B 1VQ7S 2XB2D 1S99A 3DMJA 3HHEA 4ZPWR 1GXUA 2PSZA 1K0TA 2XZWA 1VFJA 4N47A 4A8MP 3MAHA 3DDNA 5EDWA 1SQEA 1E6YA 4Y65A 2ZVSA 2NREA 2AJ1A 3RAMA 5MAOA 2LQ5A 2AP6A 4FXDA 4ED8A 4G1QB 1IJEB 3QGHA 5T41A 3NNCA 2BBEA 1FKAF 1TAUA 4DQSA 2NPIA 4LF6F 1SC6A 1MWZA 2XWYA 2F40A 1FKOA 1TKTB 1SL2A 4PUOA 2FD2A 3HXMA 4WFZA 2FJBB 4IRKA 5LXRA 1IJFB 3DOMA 5DG7A 3FEYB 3T9NA 1NKCA 1HBNA 4DL7A 4NCGA 4C8NA 2QFJA 3ENQA 4JV1A 1DQ9A 4BWMA 2DTJA 4YR0A 2BR0A 4KTQA 3RR8A 1LW0B 4C11A 3FDSA 1X9SA 4N56A 4ZPTR 2J0WA 3MCSA 5FDLB 5J2MB 2RU3A 4N76A 4X2BA 2WTFA 3LALA 1HNIA 2EKYA 3E01A 1CVJA 5CHCB 2LMIA 4B3SF 1CC8A 1X4AA 2OFGX 3VAHA 2KM8C 4XPEA 2YWKA 2BRLA 4F3MA 3MM5B 2YKQA 3M8QA 5J1NA 3U1NA 1CQMA 4KC5A 4QW8A 4AE5A 5A8KB 2W9BB 4EBDA 2KKHA 5EX0A 2KVIA 2VPXB 4I64A 4ZCIA 1IN0A 2MY7A 2HNYA 2WONA 3IWXA 1S6PB 3CJ5A 2N7YA 3ZZPA 2UVVA 1S0VA 2MZJA 4Q45A 1FTRA 5KG2A 1IKYB 2IMOA 4C3LA 4EZ6A 2G1DA 4TY9A 4UUWA 4WU2A 3JSRA 4MAKA 1X8DA 4JI1F 3AAWB 2NSCA 1BC6A 2GCFA 1YRTA 3G96A 3C6TA 3M30A 2KTQA 2DISA 2E1AA 2HZCA 5SZTA 3OTOF 3N6MA 3O1LA 1V9OA 2ZDOA 3HHLC 4OMFG 4FF3A 1RTHA 4FF2A 2U1AA 2KFNA 3TAMB 4MIWA 1ZAVA 1YQHA 2XSJA 1GTEA 4OJ1A 1U47A 3VZIA 2XMVA 3KKFA 4C2MA 4NLOA 1C0TB 2W24A 1TL3B 4NLDA 1RTJA 3H40A 4MKBA 1Q7LB 3CPWR 2HW3A 1S1VA 4QIGA 1D9DA 2EG1A 2XEXA 3MMAB 2AX1A 1ZPVA 5D4OA 4DR4F 4I6YA 5J2QA 3E2EA 3SZ2A 1HFEL 2CPIA 2Z2LA 4EU0A 4FF4A 1S6OA 3Q2SC 4DV3F 3QO9A 3F73A 2I38A 1TR0A 3T9ZA 4W92B 4XDDA 3OW2R 3LW5C 4QWBA 2R7UA 4RWXA 1MMNA 2BABA 2M70A 2KB2A 2VFSA 1TZ0A 1VRUB 3OFHA 2FGOA 4OZNA 2W8LA 4ECUA 3FRZA 4X4RA 1KR4A 4A8SA 3N79A 4N77A 2M0GB 2R8HA 1TFYA 4CCHA 3CT9A 3TNVA 1UWBB 3CCTA 3GFZA 4X4OA 4DFKA 2RU9A 3Q8QB 2PEHA 4MFBA 4X4UA 3DLKA 1R8BA 1EETB 2CQ1A 4LSLB 2RNEA 3AQOA 1FD2A 3NKYA 5LMNF 4V19X 3UD3P 4MTPA 3BSOA 1HNWF 5DDOC 2DO4A 1UMJA 3CD7A 5KT2A 1JLCA 5I3UB 3RBEA 4DL3A 2GA7A 3FQKA 2E44A 4KHRA 3T5KA 1S72S 1KLMA 5ITHA 3N6NA 3DRRA 2WRMA 5EN1A 5K9FA 2IMWP 1U1MA 2AD9A 4HT7A 4TNOA 2MQNA 4C8MA 2HVIA 5SUHA 2KI2A 2DNYA 3BGRA 3TVYA 4F4ZA 2OAUA 1BY9A 2CQIA 2HS4A 2V8VA 3UCGA 4TY8B 5F8IA 1XERA 3BN7A 5A0YA 4DFJA 1MU2B 4NYOA 4A47A 2GGPB 4YR3A 2J8AA 1U1OA 1JIHA 1HBUA 3TR5A 4ECTA 1DLOA 4BBYA 1YJNS 4IKAA 1NHVA 2C3YA 5C25A 1WTBA 3BR9A 4DEZA 1B0VA 3EGZA 5KFCA 2PC6A 3QAUA 2ADCA 3R1LA 3GFHA 1VQ5S 4F3OA 2DIVA 2LECA 4Q5VA 2CQ3A 2CRLA 3PRBA 4LMZA 1WEZA 3BQ2A 4Q0BA 5IWAF 1KC8T 3L3CA 3NAHA 1WWHA 2J9DE 4OI0A 5KFQA 1WG5A 2XCAA 1OQ6A 3KYLA 3FMWA 4IFVB 3L7PA 3MM7B 1CPZA 2CJQA 2L9NA 2DR7A 3OJSA 2W7PA 4C8YA 1IKWB 2E9TA 1DBDA 1S9GB 2VG6B 4NXNF 1R0AA 4NA3A 1D9AA 4GKKF 2PMZD 2VONA 2FHOB 2HRYA 3KOAA 4B02A 2N82B 4RW9B 2HHVA 2EK1A 3F41A 1YJWS 4WYWA 1SKSA 2UXBF 1O51A 1YVFA 3WC0A 3PHEA 1SKRA 3G6ES 4LVNP 2VBWA 3AB2B 3LP2A 2Z4PA 1YI2S 2F7VA 1A6LA 2EFGA 3NS5A 2MSSA 4NLRA 2J6UA 1CSJA 2KJVA 1ZM4A 3DCAA 4C8OA 3J7A1 1GAOA 4RW4B 2OPPB 4RW7B 2C3UA 1TL5A 1U1NA 5KFLA 5LJ3Y 1FCAA 3OVBA 1VC5A 1ROFA 4MK8A 3MM6A 4JBCA 1Y7PA 1HQUA 2Q3PA 4QR2A 5DM7Q 2YNHB 3NMAA 2YWGA 4I2PA 4D3GA 1JLQB 1LW2B 1S79A 2RIJA 1H2VZ 4BWJA 4E0DA 1ZH5A 2AF6A 2KT3A 4UW2A 2CIMA 4MK7A 5KFAA 3DOKA 3K8WA 4GC6A 1TQLA 2WSCC 1Y5IB 2DNZA 2U2FA 3MAQA 5HLFB 3O3LA 2FC9A 2AGQA 2QA4S 2MQPA 2QA4G 4MIAA 1C1CB 1J5EF 3G6YA 1KOHA 3I87A 3K5PA 3KJVA 4QIWD 2Q66A 1SJQA 2HHWA 1JKHB 1TVRB 1E6VA 3OSPA 4KSEB 2EG2A 1GT8A 4H4OA 3S8SA 1JK9B 4DV7F 3FRYA 4P6QA 4WFYA 2KT2A 1N5YB 3OQ2A 3JSMA 2UVWA 4PRFA 3UPFA 3MM9B 1XMBA 1HNVA 4ILLA 2RQKA 1N34F 1L3UA 1C1BA 2CPXA 2X1BA 5M2RA 1ZAWA 1SUQA 1SH2A 2HYIB 3V4IA 2VPYB 3I0SA 1KQSR 2OSQA 3W2VA 1ZYQA 1FDBA 3L09A 3MUMP 3CEDA 4Y2IA 4MK9A 3VZHA 3OTCA 5DLGA 1RK8A 5DRKA 2KRBA 3TVKA 2HMIA 2XLKA 3NG8A 2V4JB 4PG5A 4U7CA 4TXSA 2FJEB 2IFXA 4IG3A 3HX9A 3SSRA 3CC7S 2H5EA 3PFOA 3KTQA 4BC9A 6FDRA 5C24B 2HS3A 4G1PA 3JYTA 4IQXA 1U48A 1X4EA 7FDRA 1DZ5A 3RTVA 3SXLA 5GADU 1RT2B 3K8VA 4NLQA 3PW5A 4QBUA 1BQNA 1M90T 4IUFA 4O3RA 3DYAB 5F8MA 3RW6A 3CDUA 4ED1A 1HL6A 3TQ1A 1HPZB 2E9RX 2CKWA 1TKDA 4ECYA 3HVAA 4C98A 2LVWA 2B5JB 3M9NB 2ZD1B 1VC0A 1L3TA 1UKUA 5BYRA 1S6QB 4X66F 4QR0A 1HA1A 3I56S 4DLGA 2GJ2A 3BEGB 3I5BA 1YHQS 2UVUA 4DOZA 3IRXB 1SJ4P 2JEFA 3SDEB 1NK5A 2CVEA 4O0IA 4ECSA 3T6BA 5KFJA 3KLEA 3NS6A 1XNQF 1UAWA 3HHLA 4LQ3A 4FNHA 1VRTA 2DVIA 1PILA 1NJXA 2FVQA 3FJ2A 5HI7A 4IO9Q 1KSPA 3MM8A 4PQUB 3IGNA 2W9CA 1DRZA 3IS9A 3NCRA 2ZH9A 2FJXA 5D3GA 4R5PA 3MFHA 1LWFB 2I5JA 4NCBA 5CYQA 2KZMA 2YNFB 3OUYA 4AYBD 2L41A 3Q0AA 5BR8F 4F2RA 3THPA 5DDQC 5IM0A 4DFMA 4ZK7M 2FPHX