3SSSA

Ccmk1 with residues 103-113 deleted
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'AIAVGMIETLGFPAVVEAADAMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVAAGVENVKRVNGGQVLSTHIIARPHENLEYVLPIRYTEAVEQFRELEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title A CcmK2 double layer is the dominant architectural feature of the beta-carboxysomal shell facet
rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
total genus 26
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sssA00
5L38A 2A10A 4P7VA 3NGKA 4OX7A 4QIGA 3SSRA 2A1BA 4OLOA 3IA0A 3MPWA 4RBTA 3N79A 4OX8A 4QIFA 3I96A 3DNCA 3H8YA 3SSSA 3I6PA 3MPYA 4LIWA 3NWGA 5DJBA 2A18A 4DDFA 4AXJA 3SSQA 4RBUA 4RBVA 2EWHA 4P7TA 3BN4A 4OX6A 3VCDA 3PACA 3CGIA 4PPDA 4P2SA 4OLPA 3DN9A 2G13A 4QIEA 4AXIA 3CIMA 4QIVA
chains in the Genus database with same CATH superfamily
3VAJA 2HKEA 2F4FA 1QUPA 2Y9HA 1NXIA 3T1HJ 2XMWA 4M94A 5A6WA 3GSIA 3J7A1 5JJBA 1NK5A 5EUHA 3P5BP 1SKSA 1RT2A 2FHJD 4WFZA 4RPFA 4UOFA 1T9VA 4NE9C 2KVIA 3J81j 3VGUA 4X62J 4ZLLA 1YTYA 1RT1B 1IR2A 2YKPA 1N36J 5F8IA 4MTPA 2B9WA 2EPIA 3GONA 1RTZA 2YY3A 4NA1A 2W8KA 2DIUA 4B9MA 1HARA 3NWGA 2OPPB 1J27A 3W2VA 2VBWA 2CDRB 2ZH8A 1S1XB 3FC9A 4CO3A 3OHBA 1XMOF 1UAWA 2JEGA 3R5AA 4URSA 4NLWA 2V8PA 2YX7A 2NPIA 4OZ1A 3LP2B 3W7BA 5U47A 4UF4A 3KOAA 4LSLB 1RTDA 2GQQA 2QLWA 5B0AA 1LFPA 1K44A 3Q8RB 2ROGA 2W24A 2EEYA 2IDEA 4XPCA 4NMXA 5HROA 3UI3A 5AXLA 4NLYA 3CVKA 2JVOA 1VQYA 1VIXA 1VLYA 2V67A 1R6VA 4J9MA 1RT7A 2FVRA 1SC3B 5FLXY 5J2PA 1LV5A 5BR8F 1NO8A 3FZBA 3UCGA 2LP4A 1FNOA 3QGHA 4KR0B 2AJFE 4DUTA 1Y5IB 4OX8A 1WC1A 1LW2A 4FVMA 1C1CA 4NCGA 2ASLA 4ZPCA 2BABA 3KFWX 2ZD1B 5GMDA 2IFXA 3X1LB 3OSPA 2KRBA 3CCMS 4FYYB 3OJUA 1JKHA 1U47A 4GMKA 2VF3A 1FT8A 3IC1A 1FKAF 4E2FB 6FDRA 2CQ4A 3FEXB 4AUKA 1LK7A 1FDBA 5GADI 4QBUA 3FBCA 4OI0A 1HHQA 4ELTA 2KT5A 2ZVSA 1VQKS 2MY8A 5GAHI 3OJSA 3HJVA 2BXJA 2QMWA 3K5NA 3OL9A 3IWLA 3M2VA 3R3TA 3AB4B 3ZFVA 1QUVA 1L3UA 1JMTA 2DXFA 2DK2A 4OYXA 3W9JA 2LQBA 3C6UA 3RZAA 1VQOS 2A6MA 3PNIA 2VUGA 4CM0A 2W25A 1NUEA 2XHWA 2Y8WA 2L9DA 3I5CA 3IAS9 2VJUA 2IRYA 2OPRA 1SKUB 2UXDJ 1BQMA 1FRMA 2VPWB 3PRDA 4F3MA 2NYIA 3MPYA 2MHEA 2CA9A 3MM9B 2XC9A 2GMJA 2KG0A 4LF7J 1TUVA 1HWIA 2XLIA 2I5JB 3F0NA 4J7CA 3KLHA 1F60B 3PJ9A 1S1TB 3NGTA 5CYJA 1HHTP 2DJWA 4N8NA 3KJVB 3POTB 3Q0AA 4OYZA 2VA2A 2FZKB 1B0VA 2XSFA 4XDDA 5J1PA 4JV0A 1S97A 5IT4A 2VDHA 3KLFB 3CDEA 1X4CA 4L72B 1GX6A 2H4YB 3IS9B 1S76D 4LF7F 1RHJB 3MEGB 1I1GA 2UXBF 4J9SA 3MEKA 1NM2A 3DYAA 3SQGB 2FHJA 3UD5A 1TKTA 4O3PA 4A8WA 3TNVA 2VQFF 3D66A 2QL7B 3WQPA 1NJZA 1VQ7S 1B4SA 3BO4A 4F4XA 1NSPA 3LQVA 2W2NP 3U1MA 3IMQJ 1TUGB 4ZVOB 2CG8A 1KP6A 3V4IB 4ZCIA 4F0MA 2R8IA 5DS7A 3PHTA 2IYIA 2FJDB 3HMJG 4TY8B 4K2XA 4XIUA 3UDEA 3AOBA 4ZLPA 1U24A 3NWRA 3TVZA 3ENAA 5F8HA 3A3PB 4QIWD 2D9OA 5KFAA 2ASJA 2YX4A 2EFGA 2J9DA 4WYWA 3D1QA 1S99A 2DH9A 1AUDA 2ZUGA 2ROPA 4K59A 2VIHA 5AJ3J 4Q8FA 1CVJA 2DY9A 1O0PA 3UD4P 4CLSA 4DBQA 2RU3A 3BYRA 1YJ9S 2MZJA 2MMYA 1KQFB 1H2TZ 3IM9A 1U1NA 4RNFA 4QWBA 3NRBA 3CTRA 3MURP 3LTOA 5KT4A 4PUOB 1MN9A 5A2QY 3MZIA 4BBYA 3RU0A 2NREA 3I0SB 3MMBB 1B7FA 3CJRA 1TK0A 2KN4A 1HMVA 1S6QB 3ILLA 2BKPA 1R8PA 3ZTPA 5KFZA 4OZ3A 5HJXA 1M5KC 2H9ZA 3GILA 1HYSB 4WBFA 2BJ7A 4YMEA 2JH3A 5T14A 3UO0A 3MUTP 4NEZA 2XS5A 3HK2A 3M8PB 4RW4A 1UVKA 4WIQA 3CDAA 3CD5A 2GGPA 4ZPAA 1JNRB 3TYTA 4DR7F 2BVZA 1UVJA 5CYMB 1FD8A 2FJWA 1S1WB 1U6FA 3H59A 4NYPA 4B9LA 1W2BR 4LBIA 4P74A 1CJVB 2ZC3A 3MDFA 3LANA 3T6JA 3Q8QB 3L4BC 1U1LA 3A3OB 4KPCA 2P9CA 3MR2A 1ZZNA 1JB0C 1N4LA 5KT2A 1EHWA 1UVIA 5HQMA 1SJRA 4WYLA 2ZWOA 3EVMA 5MLCV 5IWAJ 1V5VA 3MPWA 2LECA 1R0AA 1D8ZA 5EWFA 4QR1A 2VC1A 1EJ7L 4J9NA 5KFVA 3U1LA 2AYMA 1SI9A 1RAGB 1WEXA 3ZZRA 4CRJA 4DL6A 3OXFA 4ED1A 2F8EX 4P75A 1IBCB 3EYZA 3OFFA 3IWNC 4ED5A 2I6WA 2G2ZA 1R31A 5KOXA 2V2VA 4M8LA 1ZTWA 2I38A 4Q5VA 3UN2A 1HQEB 4M5DB 3W2WA 1FXDA 3IGNA 1FX2A 4OX9J 4KHRA 4DZDA 1IBMJ 2PMHA 2KXHA 2DPJA 4PZVA 2IA0A 3HDSA 4RW8A 3TAPA 3SCJE 3MPVA 2Y1LB 4O3RA 4LR8A 4HI2A 4CLWA 3PW4A 2CQ0A 4RWWA 3NMAA 2JLEA 1X5TA 4ER8A 3P4UB 4DR5J 1X8DA 1HBOB 2GO8A 1YWXA 3M7VA 1CS4A 3MFIA 2X3DA 3DGVA 1HD1A 3N0VA 2XNQA 2YWEA 4PQUB 1GH8A 2W9CA 4NRTA 1IBMF 4IO9Q 1FNMA 4NCAA 2GZOA 2RDIA 4MYTA 1S4FA 3C8YA 4TKTA 3M6UA 1TELA 1FI4A 3PRVA 2XMAA 3RW7A 1X5PA 4JI0J 3W63A 4LFCF 3UDCA 3OBIA 2GS8A 3MWBA 4DR5F 1ZZFA 4DV4F 5G4DA 5IOLA 3RW6A 1QM9A 1UEUA 3VZHA 4PXDA 2XGQA 4KPYA 2EVZA 4LQ3A 4LQ9A 1HPZA 4YUDA 4NXNJ 3M1VA 4JB8B 4ECRA 2ZZMA 2XMMA 3HHLC 3CXCR 3QZ7A 1HLWA 4JI0F 2XY5A 5L9XA 1RLDA 5DETA 4NLVA 1LW0B 3AOAA 4X4OA 4PXEA 3DNCA 2ALZA 3SSSA 3AXMA 1NLKL 2HHVA 4USIA 1P1LA 1ZH5A 3IG1B 4F8RA 4C8YA 2VFUA 2BR0A 2DT9A 2U1AA 4I2QB 3OR2B 3M4XA 3BM7A 3OL6A 4IH5A 3QQCD 4KC5A 1NZ8A 4NLUA 1FTRA 2MQOA 4WXOA 3QATA 2ZH1A 2HNYA 3D5MA 4WWSA 1RT5B 4KBIA 2N3OA 3GYXB 4ED3A 3FRZA 3H2UB 1FEHA 4U8YA 5ETPA 2W7OA 2HWIA 1GT8A 2VG5A 2P2CB 2KKHA 3JQJA 5HMYA 2XQCA 4IFVB 4IG3A 3OHAA 4JI2J 1XMQJ 1TR0A 3IA0A 2GIRA 5HI7A 4J91A 4HH1A 3KLEA 1BMQB 3NOGA 2G0IA 4EU0A 3R6GB 3DN9A 3ITHB 2KRRA 2HZAA 2JEFA 4L74A 2K7JA 1R3NA 2E7WA 3U7JA 3CCES 2VFSA 2PI5A 4JI2F 2DNOA 2AU0A 3Q89A 1QE1B 4M63A 1GMUA 3J81Y 3KKFA 1M0SA 3NEKA 1CJUA 4Q2LA 1XN9A 4FPIA 3FCWA 2QEXS 4WZQA 2BQ3A 3BSNA 3HPOA 1Q95G 4WFXA 2E5GA 2WAQD 1A9NB 3E01A 4FN5A 1B99A 2FLPA 3UNGC 5F0UA 3U27A 3SQOP 2J8AA 2UXCJ 1ZPWX 3MM5B 4MKAA 1TK5A 1X4AA 3TOQA 3C16B 1AFJA 5L39A 2QT7A 4XO0A 2QJ3A 3MFHA 2CQIA 4ID5A 2CADA 4WTYA 5L1KA 3EJMA 2CJYB 1I94J 1YG0A 4OYAA 6AT1B 3KK3B 1CG2A 6FD1A 1F2GA 1KEKA 3WDOA 1NRKA 1VRUA 4X64J 1WDTA 3C14A 2UUAJ 5HSPA 1C1BB 2ZH7A 1IKYB 1OSCA 3N01A 3VAFA 4LF5J 5H9FJ 1FDNA 2ZOFA 3JTOA 5DZ6A 4U7CA 3BBCA 4MYUA 1F9EB 2B43A 5HBMA 3EDRB 1LNQA 3WZ0A 1YJVA 3FQLA 3GR1A 3AD8C 1CEZA 5D15A 5ETRA 3GP9A 2J7UA 4OQJA 1WOPA 4ZCKA 4A8OA 1UL3A 2UUAF 3A8IA 1TKXB 5J2MA 3KMQA 4PEOA 2XMUA 3K8VA 2GIQA 3NNCA 4FS1A 2W4DA 1UVLA 3J7YI 2HIQA 1VRQC 1TAUA 1UEVA 2QO3A 3ISND 4QOTA 2QA2A 2WW4A 5F8MA 2HRTA 2JNJA 2WSCC 3DRSA 3ET6A 2DNMA 4JUZA 2Y3YA 4O3SA 2B8QA 3LOUA 3MM6B 1E6YB 2R2RA 4DLEA 4I0WA 5FIIA 2QIFA 2JFKA 4L76A 1X31C 3GCWP 4XDCA 3FBFA 3BQ2A 5HP1B 2IY5B 4MFBB 2RQCA 2V2ZA 2FY1A 3M8QA 4YDDB 2VKRA 1S9FA 1SUQA 1ITPA 3P5TL 3CWJA 4QPTA 4DV1J 3F44A 5M2RA 4ZVPB 1N88A 4Y6IA 2NYHA 2KXNB 3W3SA 4B3SF 1T9XA 2XMTA 5L38A 5C24B 1PO6A 3LA0A 2JC1A 1Y3JA 1U7LA 1APSA 1S1VB 2XYHB 3CW2C 4QW9A 2XMVA 2VZ9A 2HHSA 2ATLA 5J1EA 2KT2A 4X2BA 5CCMA 1WI6A 4E0DA 4DF4A 4JI1F 2OKQA 1CJTB 1S6UA 3KTQA 2MSSA 2M8DB 3GJTB 3MMCB 3I55S 3AAWB 2YWKA 4WJBA 3D67A 4RO0A 2VA3A 2UUTA 8ATCB 3CCUS 3GCXP 1JLBB 1LWXA 1LFWA 2DNNA 2ZKTA 4OHYA 5D0GA 1PSDA 2M3DA 2JSXA 1NPKA 1X0PA 2HRUA 1WKLA 2R4FA 3QGPA 1ZBTA 2YVSA 2OD6A 2VJVA 1BUXA 2CPFA 2L41A 2ACMA 3BKTA 5DDRC 4JI4J 3J7AN 4O0NA 1WSVA 3CB4A 4NLRA 4DFKA 2YKNB 3M2UA 1AB8A 2K06A 1VCTA 3DOLB 2XMKA 2KXFA 4RZRA 4EYIB 2JZ5A 4ED0A 2YKQA 4LSZB 5KFBA 1JLEB 2FVSA 1H6KX 1T03A 4Y0FA 4DQRA 2ZOMA 4LF9F 4AYBD 4HHHA 2C3UA 3SCLE 3HHKA 4AQYF 1B64A 2J6SA 1HBMA 3NS6A 1RABB 7AT1B 4HHJA 5B0FA 3ZZTA 1F5BA 1P9YA 3VWSA 3K0JA 1JLQB 1RTJA 1C4AA 4TLRA 3M8WA 4MT1A 1SB6A 4Y2AA 1FFWB 2HHPA 4K4WA 4GKJF 3JSMA 4RNMA 4KV8A 2CJXB 3FUYA 1WF0A 2A3JA 5HMXA 4ZIWA 2IVFB 4LF2A 3CCQS 5THWA 4YOEA 1PJ6A 1RUSA 1UWBA 4USMA 4DHVA 2GVDA 5AE2A 3GFZA 3MCNA 4OMFG 4MMOA 1S5ZA 1FVQA 4NRUA 5A8KB 2D9PA 3ZZUA 1SC4B 3BGUA 1C1CB 2HNZA 1RAFB 2F65A 3GYNA 1D8YA 1FK9B 5IQQA 2P6TA 1J5EF 1YDLA 2MZSA 3PIPQ 1B0PA 4OYPA 3CCWA 3HF5A 3M32A 4ALZA 3T5JA 4F0KA 4J9RA 2MGZB 3DLEA 1Y7PA 1GXUA 4EFAC 2ZZNA 2ERRA 3NGKA 5DRKA 3UNYA 4M5GA 1S57A 1FJEB 2JWNA 1NPPA 3DOMA 4HTIA 4L73A 4BWJA 1JLCB 3HKZD 2KVQE 4C0HA 5AE3A 3M2VB 4CCHA 3R5GA 4F4ZA 2ZC4A 1S1UA 3B54A 4KGVB 3GTYX 4H4OA 2E44A 1FKPA 3JSBA 2OLWA 4E8UA 2C2NA 1JWWA 2M8HA 2HURA 4DJBA 1SJ4P 1FDDA 2QFJA 2JJ4D 3LPEA 2IHR1 1X7VA 3ENVA 5HO4A 4KE5A 4B3RJ 4ZVUB 3MPDA 3B78A 4F04B 2PMZD 2OPQA 2WONA 1VRTA 2OPSA 2V9KA 5CA5A 1YJ7A 2CZ9A 4MK8A 1NJYA 3FDSA 3JSYA 2PMWA 2A2CA 3AFGA 3CCSS 5LOQA 2AYEA 3OVSA 5E3CA 2RIJA 4PR6A 5LXRA 2VG6B 4B3RF 4FYXB 3A8EA 4DUZJ 5KAKA 1URNA 4FPRA 2XULA 5F3TA 1PBUA 4P71A 1MN7A 3KG4A 2LDIA 3PHEA 2CUYA 2LLZA 4H4MA 1NPRA 2A2DA 1NK0A 3O5TB 2AYBA 2W2OP 2AJQA 2ZBIA 4K4YA 1EARA 4DQIA 3I31A 3ZTSA 3DGPB 4PYDA 5K9FA 2GJFA 4DUZF 1WUUA 2DHSA 1MU2B 3BEGB 2APOA 4ZN1A 3WX8A 1TZ0A 4WF9Q 3UQSA 3GV7B 1IBLF 2CQ2A 5DJBA 3THPA 1W2IA 1WC5A 1SPBP 3PFEA 4S0MA 1SQGA 3MAHA 2XZTB 1B7YB 1IUJA 4I6YA 2O1PA 3V81B 1C0TA 4JV5J 3V6DA 2XZWA 1F1BB 1TL1B 2E5IA 1SV5B 4DFJA 5CABA 3Q23A 1TL3A 2B3TB 3MEEB 3JAMU 3LP0A 2Z2ZA 1ZETA 1K0TA 1KDNA 1BQNB 4AXJA 3VGVA 1IXKA 3VCDA 4CO5A 5F0WA 2CXEA 4DV0J 2E9ZA 4JV5F 1N5YA 2XSJB 1AZSA 1HBUB 2XY7A 3MI7X 4EK2A 4Z37A 3MXHP 1GTEA 3R8YA 2YQ0A 1EP4B 3EPIA 2PDAA 2C2OB 2HBRB 1T9YA 4G1QA 2AJ1A 2O66A 2WVBA 1YKWA 1X60A 4B9UA 2FY8A 4DL3A 3KK2B 1MWZA 2RS8A 2BJ8A 4XPEA 2FPHX 2XI3A 3DRYA 4DV0F 1VQPS 3DRXA 5D4NA 4DSLA 2ABYA 3KG0A 5E33A 2CJQA 1N56A 4UOGA 3KNGA 1DJ0A 1Q16B 1RBAA 1R27B 3DMJB 4X4QA 3KLGB 3HKWA 4FXWA 2V94A 3P3DA 1X0FA 2CIMA 4F36A 3M8ZA 5CCLA 1DQ9A 4GO7X 2NCKL 3B4DA 3SDEA 3TEGA 1N34J 1UW4A 3CCVS 2AJ2A 4LR9A 3M30A 5F8GA 2ZBCA 3SSRA 3UE2A 3N79A 4ZJLA 2HHHJ 4DR2F 2RUSA 2QL5B 3GV8B 2RQKA 2W2PP 3G86A 5ETTA 4FF1A 5KFDA 2W9BA 4A8XA 5KFWA 3VAKA 4LF6J 3DLKA 1T94A 3N9UC 1VR6A 3RB3A 1NJWA 2WCXA 2BBEA 3L7PA 3VAIA 2CRLA 3TAMA 3FCHA 3IBWA 1G3OA 4RW9B 4YY3J 4C8KA 4CO2A 5KTQA 4QYRA 1VBKA 4QIEA 3BBBA 3GMGA 1IWGA 3MMAA 5JXSA 2BANA 5EX0A 4LFAJ 3E3XA 3K2YA 5GVQA 1AFIA 1HWJA 4LF6F 1KR4A 2DH7A 3GFXA 2KJVA 4ICLB 2N7YA 2F40A 4K4ZA 5LSLA 2KZZA 4DPYA 2ZE2B 3BDPA 4LMZA 3B4MA 2CG4A 5ETKA 4YY3F 1KLNA 3W65A 4NX9A 1YLXA 1YGYA 1IBKF 1HHSA 3LAKA 1DLOA 2L08A 1M5PC 3TJAA 4O3QA 4LFAF 1NU4A 3QBCA 4ZP9A 2KM8B 2RF2A 1YBAA 1T95A 3HD2A 3OXLA 3IBFB 4KB7A 2Z2LA 2B9XA 1XNQF 4IG0B 2KI2A 1XNRF 4BWMA 3UPFA 1RT4A 4BC9A 1YBTA 1RYRA 3RBZA 4USUA 5HLFB 1EKSA 1IN0A 2H5JB 5B7WA 4K4XA 3AQPA 3B8HA 4N76A 1RHRB 4USHA 3BREA 2CNNB 2DVIA 3FZ2A 3TA1A 1TL5A 2HGLA 4NXMJ 1X9WA 4C11B 1RT6B 1A6LA 2HQ3A 2W9CB 3BGLA 4ETZA 3R5BA 2A6OA 2DGVA 2ADCA 2KO1A 3LGHA 2A18A 1IKWA 5KFMA 1HWUA 2XMJA 4IRDA 1U4BA 3CJ2A 4CO1A 2OI2A 5CYQB 2V34A 3RRGA 3MM7A 4ED7A 1MMDA 5M2PA 3TW0A 1SJ1A 3H8YA 1Y4ZB 3TARA 2NUUG 3KJFB 4NXMF 2DIVA 2R7VA 4BCAA 1KQSR 5KFRA 4B3TJ 1U1RA 4K50A 3I5AA 1WG4A 2IM2A 3HLUA 5KFCA 2DY1A 2GQCA 4ECYA 1TKZA 1HI8A 2NXCA 1EQ0A 1Q8LA 2AP6A 3MECB 1FCAA 2CNKB 2GVZB 1OMSA 3ZNJ1 3OR1A 2DNHA 3KMSA 2KZMA 2PI4A 2Y1RI 1FD2A 4OHWA 2DEIA 5D0EA 3M2RB 5K20B 1KLMB 5HK4A 3CF5Q 4ZPTR 4WE1B 4CO4A 2FB0A 5D0HA 1IKVA 2KFNA 3EGWB 3GIJA 1QAJA 3PZPA 5FDLB 4ECWA 1H38A 4R8UA 1JLGB 4FZVA 4CH0S 1KVJA 5EDWA 4IDKB 3QLHB 1Q78A 1LEOA 2MQNA 2OMLA 2DYAA 3W1YC 2Q6BA 2WVFA 4ZCMA 3PJWA 3W66A 4IG3B 3LWMA 4QWEA 3MD3A 3I56S 5C42A 2EFQA 1YVFA 2Y8YA 3D2WA 4ZP8A 1UPMB 1DBDA 5D4OA 4DLGA 3CJTA 3VR1A 2DISA 1H98A 3MHYA 3TZZA 2FIUA 2YNHA 2MYFA 4N5SA 1FRXA 1H3DA 3CNQP 1ZM2A 3OTDA 3M05A 4CLZA 1H0HB 4I2PA 4C7QA 1U2RA 5BYRA 2CPHA 2HEKA 2BDPA 1OSDA 1FKOA 3C66A 2DNQA 4WFYA 3L7UA 4D3HA 2M5YA 4DU8A 2KG1A 5D78A 3HHNB 4DR3J 1VK3A 4OJ1A 3CD6S 1WC3A 2KL8A 2RJZA 1K73T 3HFZB 4P73A 2C2DA 2HS0A 4D3GA 1Q53A 3RBEA 3I9V9 1XTZA 3D28A 2AV5A 2XLJA 3C6TA 3MM8A 2E5LF 1I6JA 1NSKL 2VBYA 4LF8F 3I9ZA 5K14B 4R0EA 3KLIA 1HNZJ 4DCOB 1ZA1B 3GU0A 1CJKA 2HAFA 4L75A 3HD1A 1RSCA 5D0RA 3BGFA 4TYAA 2ZBRA 1MROB 3MR3A 3HHEA 3GV5B 3K89A 4DL0C 1CC7A 4ECQA 4AL6A 5EWEA 1EAYC 2YTCA 1RZMA 3EZUA 1M5SA 2BUNA 3DDIA 1VMBA 4QIFA 2OFHX 1FE4A 4NL5A 1U25A 3D6FB 2XWYA 4RUAA 1T05A 2XI2A 3V5RA 4EYHB 2LFVA 5GMEA 4HT5A 1HNVB 2CWKA 2IM0A 2IC3A 4UOCA 1OO0B 4U6PA 3DLGA 1LXNA 1OS5A 2LMIA 4JYAF 3H0PA 2DO4A 3MEDA 5A8WA 1Y5LB 4NWBA 1SQEA 3HSJA 2BJ3A 3ZZZA 2OH2A 4LFBF 3VF0B 1D09B 2RUGA 2H65B 1RWNB 2V5HG 3ENQA 5LMNF 4LRBA 2HIYA 2NXNA 4DN0A 3R5CA 3AJDA 1MG7A 5KFSA 2R8HA 3ETMA 2Z30B 4A4JA 3RB4A 1UP1A 2M70A 1RU1A 2YX1A 1S0OA 4BHQA 3MTJA 1S9GA 4J9UE 2VC0A 4ANEA 3RYLA 1IQZA 5ETVA 2NSBA 1G4CA 1HNWF 1KVIA 1LWFA 3VHQA 5AXKA 2AQ4A 2EG1A 3CC7S 1C4CA 1HFEL 2NXUA 1NJXA 4RX6A 4W4MA 5BYQA 3QJJA 3MAAB 3W5ZA 1XERA 2MZ1A 3KK1A 3M8QB 3C46A 2HMIB 5B09A 4L3NA 1KOOA 5KG3A 1VJWA 4C3KA 4K0KF 3QIPA 2YNGB 1YJWS 4TXSA 1S9EB 1MSWD 4HL9A 2RAQA 1VQMS 1MWQA 3T5LA 4CTAB 2E29A 3HULA 4YR2A 2DR9A 2FJVA 5DLFA 1FRHA 2QZ8A 4X66J 1HA1A 1QSLA 3J7ZT 2YNIB 3CD7A 1D3WA 3CPWR 2HZCA 2VG7A 1Q8KA 3GE9A 2E7XA 2E9RX 2CQPA 4OI6A 1CC8A 2KJWA 3W5XA 1DTTA 2C2EA 4ZHRA 3RTVA 2AEFA 2Q66A 3HVTA 2G1HA 4EO8A 4A8MP 4KKOA 5ETNA 3UVJA 2PT0A 3OTCA 3UD3P 1PG5B 3HT0A 1B70B 1WHXA 5I3UA 4M5MA 2Q3PA 3AODA 3D68A 1FNXH 2HZVA 4F25A 2AD9A 3BGOP 3R6LB 5EX3A 2EG2A 1JLAB 4ZVFA 1UTAA 3BGRB 1AW0A 4DX5A 3NKYA 3DU6A 1IWAA 3W8PA 4JI5J 3VVUA 4L6V3 2ZEJA 2NS1B 4C3MA 1FTCA 4ZP6A 3GZ7A 1G2EA 3G2XA 2EFVA 1DQ8A 5A8RB 4DV7F 1GTHA 4X4PA 2BOPA 1UZDA 5I42B 2W8LA 1WORA 3CCRS 4M5LA 2YH1A 2IRXA 3HXMA 2YKMA 2CWXA 1B0TA 2F8HA 5DG7A 5A76A 2YKOA 2AEMA 4RR5A 4HACA 4LF4J 2V2QA 1XJWB 2B6AB 5K8NA 2PN6A 3F56A 4F2SA 2K1RB 2FC9A 1NHKL 1WJ9A 4YHHF 3CMES 2LA6A 3G82A 3US5A 3ZZYA 4CNYA 2QV6A 3CIMA 2DR6A 4PG8A 1P8GA 4Y00A 3PKMA 2V4QA 1F9FA 2BV3A 2XTJP 1QVFR 3K58A 4QWCA 4O44B 2C3PA 5I4MA 2FJAB 2YWGA 1D0EA 2MB0B 4LF4F 3D7SB 5D3GB 4IRCA 5A0YB 2RVJA 3LH2S 2KU7A 3QIDA 3JSMB 4FNHA 2Y1JA 1IM6A 1N5TA 3CJKB 1MMNA 3CJ4A 1V3RA 5L8RC 5B0DA 4IH6A 2IDLA 2J5AA 1Z2ZA 2PA8D 2RNEA 2JEJA 3DKDA 5D6GA 3MCMA 2QTWA 2O01C 2UUCJ 3PYEA 4LF1A 2BMBA 2DR8A 1X5OA 4RW7A 1CULB 4CQ1A 3CCLS 2LXFA 2NPFA 1YIJS 4KGMA 4HI1A 4R5PB 3O6QA 3NGDA 3R2DJ 1REVB 3RGIA 1AUSL 2ZITA 2UUBJ 4NPOA 3UCZP 4CM2A 3CCJS 1H7WA 2VFRA 1ZM4A 3EDQB 1R89A 1HBNA 4FNIA 3PW5A 4UT4A 2Y0SD 3UDLA 1YHQS 4B9VA 3TX0A 1NHUA 4JI8J 2ATCB 3OL7A 2DGSA 3OFGA 2W2MP 5CXTA 2UUBF 1NDCA 3IP0A 4IO1A 3FK4A 5H9FK 2F4VF 3QO9B 3OL8A 4ZKAA 2A0FB 1HNXF 1WEZA 2ASYA 4Y65A 5B0CA 2RKIB 4RBTA 2IMWP 4QJVA 3TZXA 3D1HA 2IIHA 2D3O1 4CLUA 1F0XA 7FDRA 3W62A 2FJBB 1M1KT 1RT3B 1K47A 3JXOA 4DR1J 4XAKA 2WB4A 2JEIA 3CULA 3MPUB 4PWUA 1KVKA 2PD1A 3DXBA 2C28A 1K1SA 5F8NA 4X4UA 3U02A 4OZ0A 2WRMA 4LREA 1LWEB 4KGZB 1Q0NA 1NK9A 3H7HB 4EUVA 2B4PA 2NXEA 5KG2A 4OV1A 2FHKA 3ADAC 4OLOA 2DHHA 2B0GA 5LJ3Y 2OPPA 5CZVA 1P9QC 3IWXA 2R8GA 1S1XA 4HR2A 3VQTA 2FDNA 2CZVC 2MY7A 4DPUA 1S0VA 4DPWA 4OYOA 4A8KA 2CNOB 1JK9B 3LP2A 2H3EB 1NK7A 2ROEA 4DSIA 2ZDPA 4LSLA 4UQTA 3LF0A 2K3KA 3M9OB 1RTHB 1U0HB 4M5HA 3QJPA 1EETB 2VDIA 3ZZPA 3CJ3A 4NA2A 3PR4A 5ETMA 1NDPA 3VGTA 3AD9C 3DRPB 4ZITA 4CI0B 1QD1A 3BBFA 4M5KA 4OZLA 1R8CA 5GAEI 2ZBQA 5B08A 4RU9A 5F9LA 4ZPWR 2HYIB 4TU9A 3P96A 2KTQA 3RUBL 3T1HF 4ATNA 1ROFA 1U1OA 2BE9B 1VJQA 1S6PB 1UWAA 3R7BB 4Q2MA 2DHAA 5HMZA 2AYGA 1Y3KA 1UKUA 2ILZA 1Q86T 2E5HA 3AB2B 4PG4A 3VZIA 3HHLB 4KHMA 4X62F 1UZHA 5E2QA 5IFMA 5F8JA 4ZA1A 3Q8UA 1N36F 4CLFA 4IOAQ 4FS2A 1L5UA 2EFOA 3P49B 1KBRA 4IYQA 4B08A 1A7GE 3KJNB 3LWLA 3TZYA 4HDHA 3P45B 4MKBA 3SDEB 3HZGA 1S79A 1HW8A 5A6PA 3K7RA 4A8QA 4MK7A 3GJQB 2J7WA 3I87A 4CH1A 3FFIB 1KC8T 2W7PA 1EQMA 3IO1A 3LP1A 2I8EA 2UVWA 1X9SA 1HIYA 2DNYA 2GC8A 4C8OA 1ULRA 5HATA 4BLGA 1RHUB 5BYSA 2OD4A 1G1XA 4KGKA 5KOWA 1QDUB 1H72C 4FBUA 4ES3A 4A8SA 2QRRA 3GFHA 3SCIE 5J2QB 4F67A 4M5IA 4WKYA 3MM9A 1CQNA 4B17A 2V9WA 3NGUA 3T3FA 1YK9A 3FSYA 3TR5A 2I5JA 2RRNA 2IVYA 1AROP 3CO9A 1L3TA 2FLOA 4OJ3A 1GX5A 3DOKB 5JVGQ 1S1TA 2HVDA 3CJ8A 3KG1A 3TVKA 3KJVA 3KYLA 3CMAS 3POTA 5KFUA 4RKUC 1UEKA 3KLFA 2LQ8A 4WPAA 4OZ2A 3IS9A 1FJGJ 4AD6A 3MEGA 5ADZA 4EBCA 1WG5A 4OJGA 3SQGA 1JJHA 1K0VA 2L9NA 3ETOA 3BV8A 3T19A 4KSEB 2BYCA 1BWEA 2VICA 1URRA 3G4SS 1TP7A 3QFHA 3W60A 4F02A 3SV3A 1SBRA 5AXNA 1JLFB 2QLJB 2X1FA 4OZJA 1WNEA 3IRXB 3V4IA 3LGMA 1S7HA 2GAGC 4TY8A 3BPSP 1WI8A 2V68A 2LXUA 1OQ3A 1U1QA 3QRPA 3T6BA 3R7SB 2CPJA 3FKBA 3V2UC 3MMJA 3PACA 2UXDF 4R25A 3G8TA 3BR8A 1TVRB 5E0OA 4C8ZA 2FVPA 3ISZA 3AD7C 1RA7A 1JJCB 3MF5A 2Y1IA 3I96A 1LXJA 3T9ZA 4NI2B 1HI0P 3OUYB 2MZTA 4EO6A 4DCPB 2GIFA 2B51A 1KNZA 2C22A 3P8BB 4ZVSB 3RAXA 4FXVA 4PUOA 3NCQA 4HDGA 5BJRA 2XHCA 5IC4B 3QGIA 3I0SA 4MJKA 4QWAA 3MMBA 3LPYA 3A13A 4N56A 3FCVA 3HSDA 4ZJOA 4O0IA 1S6QA 1NK8A 4Y34A 2B9EA 1KHWA 1HYSA 3S7RA 2G0CA 1RK8A 1M5VC 3QT8A 3H5SA 4UUXA 1RBLA 2O5DA 2HGNA 3M8PA 3AOCA 4DSKA 2EKYA 1VC6A 4PWDB 1RWOB 2AGOA 2OP5A 4I69A 1G6BA 3MD1A 4OL8A 3B82A 3H2LA 3H4BA 5CYMA 1U2FA 2M4MA 1S1WA 1SH3A 1TK8A 1U45A 3QSIA 3OVBA 1R0CB 3EICA 5B0EA 3ISNC 5KFNA 5J2NB 3M8RA 1CJVA 1S48A 2NZ4A 4JI7J 5DM6Q 4UY8T 3C15B 4Q0BB 2ZKUA 2AGQA 1WC6A 5T7LB 5AJ3F 4GKKJ 4IR1A 3ILIA 4L3KA 4NOHA 1S6OA 3PW7A 4LBHA 5G0RB 3T1YJ 3G6VA 2BQRA 3GFYA 3VGSA 4ECUA 3THTA 4R0JA 4UZBA 2K3IA 1BHNA 4PKDB 4I6AA 2C3MA 2K7KA 1VQ5S 2MKSA 3BQ0A 2X7IA 2B7CB 4QYZJ 2F1FA 3OW2R 1Y00A 2XY6A 3VAHA 3DHWC 4NYZA 3T1YF 3EZ5A 5DQHA 4JI6J 3BF4A 2X3GA 5F8LA 1HQEA 1U8SA 4M5DA 2BJDA 1Q82T 3SYZA 4I56A 4W98A 2W1BA 1NK4A 3KLIB 2UVUA 1ZYQA 2ZZTA 3TVYA 4RJVA 3TA0A 1WF2A 3UN3A 2JDJA 5LMUJ 4B3OA 1O5JA 1YRTA 3BH6B 3JYTB 1N8RT 4IOBA 2HRYA 4IQMA 2DTJA 1HBOA 8RUCA 3QJLA 3BYPA 3V4MA 1HQUA 4PQUA 1UJ4A 4NLTA 5IT9Y 3K17A 2DPIA 1K1QA 1NH8A 4MIBA 2XB2D 5LM7E 3AY0A 3WX4A 1EX8A 3ZZOA 4DV6J 4QQBA 1RADB 2DEJA 3DM2B 3PYFA 4ED4A 4WKRA 3W9HA 2DNLA 3OV7A 2RRBA 2EFPA 2BRLA 2VBZA 2F3JA 4ZVRB 1N5SA 1E6VB 2U2FA 3EUNA 5IWAF 1HL6A 2BJ1A 4LRCA 3A8JA 4YEAA 3BH7B 2BOAA 3IGVA 1OY6A 1M1HA 4WIIA 1F5AA 1Q1KA 3QSYB 2OMOA 3H42A 2AWZA 2QX0A 1KRPA 2HGMA 4DV6F 3HFVA 2OELA 4EMDA 1VYAA 4FKYA 3FVYA 3V6HA 1LW0A 2BM1A 3AHPA 3Q8YA 4IRKA 1HNIB 4LRDA 1YBUA 5GADU 2C2RA 2C3YA 2LEAA 4OHZA 3IG1A 2PFDA 2FYXA 3KDOA 5H9EJ 4I2QA 3OR2A 2CQHA 2H1YA 4OX9F 5GAHU 3TUJC 2QSFA 1Q4RA 4RWXA 1DY3A 1SQFA 3T1AA 3PW2A 1WHYA 1N6QB 2AHOB 1OPZA 2XO6A 4IQXA 1SL1A 2YQ3A 1RT5A 1IKXB 2QSWA 1J5OB 4HH0A 4J37A 5C25B 1FHTA 1GNKA 2J7KA 2WOMB 2RRAA 4A48A 2NZCA 2GAHC 2R7UA 5KFKA 1QAIA 2R7TA 2FHMA 3I32A 2XNRA 2I0XA 3PCOB 1DARA 4IFVA 4TQSA 2Q6CA 3MOZA 4ANDA 3HSGA 4HHUA 4DR4J 3KUGA 4ED2A 5LL6d 1DTQB 3H40A 3G71S 3AXKA 2MJUA 4CO0A 4LVNP 4CYUB 1XK8A 4ZVEA 1FRJA 3ITHA 2IM1A 4DPOA 2MKKA 2ZWPA 4Q8EA 9ATCB 1N0UA 3I0RB 2OSQA 2QA4G 1NH7A 5KFHA 2HSEB 4NXNF 3ILOA 2DRAA 4K5RA 2LCWA 3D4JA 1VOMA 2H54B 3BJYA 3G6YA 1WELA 2MQQA 2V8GA 4U96A 1RAEB 4IKAA 1RTIB 1YSJA 1KS2A 4K8RA 5HVHA 1JXEA 4DPTA 3QWPA 3TUIC 2HQDA 2ZM6J 2R7WA 3HVWA 4OI1A 3MM5A 2E9TA 2E1MC 2PEHA 4OIXA 3C16A 2F63A 3EPGA 5IM0B 3Q2TC 3FRYA 3ICLA 4MAKA 3IBCB 1X4EA 2Q43A 2V0NA 2ZH4A 3UR3C 4E98A 2DRBA 2GX8A 3KK3A 3N4WA 3D0GE 2QN6B 2ZM6F 5KFOA 2IAJB 2VBXA 2YPYA 1XMQF 3D9BA 4LSNB 2PIIA 1RKJA 3KUHA 3OLBA 1C1BA 2NLWA 4HACB 1IKYA 2P6SA 3DRRB 4ZS6A 1OPIA 1TMMA 1XC9A 1S0MA 1FRIA 3H98A 1U6BA 2MJNA 4WTOB 3K57A 1FXRA 3EGVA 2CQ3A 4ZK7M 3F73A 4O4GB 1PIEA 1UFWA 4PYAA 3IM8A 2E1PA 2FD2A 5CAAA 1TKXA 2RS2A 4KH0B 1R8BA 4IFYB 5IQ6A 1CBKA 2B9YA 1FDAA 1TL7B 5CH7B 3NBPB 1IJEB 4DV3J 2DGQA 1PGZA 4OYWA 1N5VA 3CDUA 2HBYB 4USVA 1YJTA 2B4VA 5DDQC 4CT8A 5C5JA 2GFFA 1Z4UA 3MM6A 2UXCF 1E6YA 2HK3A 1RGVA 1K9MT 4DX7A 3NP5A 3R97A 5KG1A 3BSAA 3D3CJ 4LBPA 5HP1A 4MFBA 2WHOA 3H90A 3PJXA 2LEBA 1I94F 4WXWA 3I5BA 3BQ1A 3QNWB 3FNNA 1VIOA 2X1GA 3FQKA 4ZPVR 3LW5C 5FLXU 4X64F 2G4BA 1RP5A 5C24A 5LXYA 2G2YA 4LR7A 4YR3A 2DHGA 4AL5A 3DI6B 2E66A 1I5OB 4F4AA 4ZLNA 2BW7A 1S1VA 5K8MA 3NOCA 4LF5F 4HTJA 2UZAA 1Y9OA 3TUZC 2BKNA 1NDLA 2QMUB 3CEDA 2W4PA 3M9MB 1SC1B 5HQLA 5DDPC 1V5IB 2UU9J 2V4JB 1CJTA 2DD8S 2HS4A 2BE2B 2JLFA 3EX7B 2CJBA 1N5QA 3MMCA 4KFBB 4WFNQ 2OO4A 5ETLA 1LWCB 5EHHA 3ULHA 2AGPA 2XM3A 3JTPA 2B5JB 4RBVA 1ZAXA 2EI5A 1ELOA 5ETQA 5DG8A 3KHGA 1JLBA 1N48A 2UU9F 2J8SA 2OSRA 3GB0A 3KNAA 2HHUA 4LJMA 2HVHA 5HVFA 2CPIA 3L95X 2DR5A 5KFGA 2GMHA 3TQ1A 2CQ1A 1XMOJ 1T9UA 4ERDA 4C8NA 2E7VA 3HT3A 4F2RA 4MK9A 2DNZA 4O3OA 4RW6B 1UPPA 3A12A 1TV6B 3BPDA 1O6XA 2YKNA 5JUMA 4DV1F 3CCZA 1RDRA 3DOLA 3R27A 2HNDB 1H74A 5KT7A 4ZOSA 2YNFA 4MKYA 2RSQA 3SIPB 2FHOB 1JLEA 4ITSA 1C0UB 3M6VA 2VPZB 2R9LA 3OXGA 2FJEB 2JFDA 5DZ7A 3FEZA 4G6VB 1R43A 2AX1A 3Q24A 1W26A 2D74B 5BR8J 5E3PA 2ZJRQ 2DCUB 1R0BG 3CJSA 4K5SA 4X4VA 4DN9A 2WSEC 1DAXA 3BS9A 5J1NA 4ZN3A 5KT6A 4QZVB 2Z57B 2MKYA 5ETOA 3HSZA 3H25A 1JLQA 1RT2B 9RUBA 4I7FA 2JX2A 1ZAVA 5EGYA 2J0SD 1OY9A 5AT1B 3RJMB 1F3FA 1XEZA 2YWFA 3ENWA 4DQSA 3TQEA 3O8WA 2LXIA 4C48A 3A8KA 4DQPA 2VV5A 4B3MJ 3SCKE 2QGFB 5A8KA 3MGJA 1MNEA 2PO4A 2HFUA 3DDKA 3W2VB 4DPXA 3TO8A 1O8BA 1U1MA 2IMOA 2MPUA 3DU5A 2BW2A 1FK9A 4XTTA 4BS2A 2AIRB 1XR5A 1OY8A 4JI4F 1VQ4S 2WB1D 4HVZA 4OHXA 3CC2S 1BE4A 2M88A 2MGZA 2JC0A 4B3MF 4DR6J 1Q5VA 1RTDB 1V6HA 3PR5B 5E3AA 1JLCA 2PC6A 3W5YA 4ILLA 1XBWA 4DG1A 4A46A 1YZ7A 5HROB 2R2SA 3WBZA 3NG8A 3A4TA 3SFGA 5A2QU 1VQ8S 2A1BA 4NZ0A 1RT7B 4DR6F 3CDWA 5J2PB 3EXYA 3IFEA 1VQ6S 1TKDA 3VAMA 2IJFA 1I3OB 3LP1B 1UETA 2RHQB 1VBZA 1FERA 2M0GB 3OTBA 1LW2B 2HQFA 4NCGB 3F41A 1NSQA 2RH3A 1WHWA 3H2VE 1GK8A 2HPUA 3M6XA 2V8VA 3PRBA 1JKHB 2UXBJ 4KIAA 1F6TA 2KYZA 2HK2A 2HFZA 3J7Z5 2R7QA 1GFWB 2KB2A 2M9KA 1VQSA 4ZJQA 4WCEQ 2C2KB 2VQFJ 2MXYA 1U1PA 2VG6A 1RAHB 3NLCA 4DXLA 2RE1A 2LQ9A 2ZBPA 2BJ9A 4DSEA 3H4DA 5FJ4A 2M7SA 4W92B 3HCXA 4DOZA 1SJQA 3O44A 1BWVA 1VQLS 2UVRA 2WBRA 3C6UB 4AL7A 1QVGR 3L9ZA 3TJ9A 4DL2A 1BGXT 1GEHA 3DGPA 2L9WA 2DO0A 2MQ8A 1FO1A 5IT9U 3KXDA 3NS5A 2I1RA 1MU2A 2HS3A 2DNPA 3D6HB 5DQIA 2OPRB 4ELUA 1BQMB 5IV4A 3QMQA 4C3LA 4IUFA 4ZMMA 5SZTA 2E1RA 2NXJA 3KUEA 1QTNB 2HFVA 1DQAA 3V81A 3KLHB 4YR0A 1RJJA 1FVSA 1Q5YA 1TL1A 4F0HA 2D3OR 1S72S 1SV5A 2IM3A 3L7OA 1HI1A 2HVIA 4G3IA 3OLAA 3MEEA 3J7YU 1K8AT 1GAOA 3GIIA 2AMCB 4NZ6A 1BQNA 2HHXA 2W2QP 3BZQA 3DYAB 2QLXA 5DDOC 2XSJA 1HBUA 1TKTB 5LSOA 2WZ1A 5KFTA 2KDOA 4ENOA 4GVBA 3GSDA 1UCNA 3OT9A 3Q8VA 1UVNA 1EP4A 3S01A 4M5JA 4DX8H 2DKOB 2JRSA 4NLXA 4YN3B 1VBXA 1Y0HA 4ELVA 3KK2A 4DR7J 1GXLA 1J2VA 4QW8A 5HJYA 4PABA 4N41A 1WC0A 4RUHA 3H20A 3C2PA 3DMJA 3KLGA 2VB6A 1ZOTA 2EK6A 1RWWB 3IN5A 1F9HA 4UW2A 4P2XA 4GVLA 2FTRA 2AJ4A 4V1Ak 3BKFA 3X3UA 3W64A 1PJ5A 3K5PA 4J9VA 1RISA 4Y2IA 4NCBA 3ZTRA 2OUGA 2J0QD 4YB5A 1D9AA 3NNAA 3W9IA 5T41A 2V63A 1RI7A 4J9LA 1VC5A 1SJFA 4K4UA 1RWXB 1RE1B 2N3LA 2RILA 1U0SA 2F7VA 4EZ9A 2C3OA 2OJ3A 1QAYA 3N6LA 4LIWA 1Y10A 1JXLA 3HVAA 4FDFA 4NLGA 1VGYA 4RW9A 5CD4H 1SVDA 2QLBB 1LOUA 2AX0A 5DG9A 1QAXA 1HMVB 2BJEA 1O51A 5K8PA 4USJC 4TQRA 4ICLA 4CIOA 3K5MA 2ZE2A 4ECSA 4U67Q 3M6WA 3EMTA 4U7UK 4RW4B 4CP5A 5DGBA 3ZTQA 4YB7A 2V50A 2GGPB 5KFIA 3KHLA 4QIGA 5DGAA 2XLKA 3BR9A 2AEJA 4LUBA 4GC7A 4JP8A 4DDFA 2MZQA 4J9QA 4IG0A 4ES2A 4V19J 3FSXA 5HLFA 2CQBA 4URQU 4O3NA 4B3OB 2OTLS 3UCUP 1N34F 3EVWA 4TNOA 3J81U 3O3LA 4LFCJ 3E51A 2V8DA 3GLJA 1VFJA 4UZCA 2HHHF 4DV4J 1HQUB 4C11A 1RT6A 1R0AB 2Z4PA 2LDYA 1TL4A 2QA4S 3GPAA 1DRZA 2R8JA 1Q7YT 1N32J 4ETXA 2K8GA 5GMKa 2MQMA 5C7PA 4ED8A 4G1IA 3S1TA 3RBXA 3TP2A 1RBOB 2WW8A 3AT1B 4EWTA 5CYQA 4PAAA 4UTGA 4TN2A 1T3NA 2HWTA 1YX2A 5HANA 2EXUA 3RRKA 1KTVA 3HFKA 4X4RA 1PYTA 2V4RA 4J9KA 4OI3A 1N32F 5IXUA 3W2WB 2Y0BB 3JAMY 3RR7A 4KT0C 2O67A 1YITS 3MAQA 1FFSB 3MECA 4RW8B 2VFVA 2MQLA 1X9MA 2GVZA 5RUBA 2YKAA 1PKUA 1YI2S 1WD6A 3TUPA 3JS9A 3PO4A 2C42A 2IJNA 2H4WB 3M2RA 1PYOB 1KLMA 5E3RA 1CS4B 4PRFA 4FP9A 4WE1A 2MHNA 4HT7A 4DS5A 4X4NA 4WK1A 2DH8A 1X4GA 4DI6A 1PYSB 2ZHAA 1PC5A 1KHVA 5HMWA 1HKAA 1SJ3P 1U02A 5FDLA 4O4RA 3UFCX 2I2YA 4C6AA 4Z7CA 1JLGA 2BA9A 3PXGa 1FX4A 4ILRA 4DMZA 4OZ5A 2DGWA 3QLHA 4IDKA 4N8OA 4Z2XA 5GAGU 1KFSA 2RD5C 3MR6A 1KD1T 3B6BA 1MW7A 3QT7A 5CHCB 2DRDA 1TQLA 4NMLA 1HPZB 3M1VB 2L48A 1CSJA 1S49A 3VTIA 1ZAWA 3UWTA 1I51B 3THVA 1L3VA 3PG9A 2EK1A 4A8YA 1UFKA 4FYVB 3NGRA 4PG5A 1TFWA 2QYGA 1WF1A 2HBZB 2P8IA 2DGUA 3FGVA 4B3TF 4URGA 2LU1A 3PY8A 1OWXA 5I3QA 4C8LA 2QL9B 1JJ4A 3RRHA 1OQ6A 2UVVA 2D41A 3GIKA 1GMVA 3NAHA 4YP3A 2V2KA 1W7WA 3N5FA 4C9DA 5KT5A 3V6JA 2OEMA 1FF2A 3V6KA 2ADBA 5B0BA 3PX0A 4IH7A 2HNYB 4ANCA 3DCAA 3TJ8A 1KKHA 1QJHA 3H5YA 4DF8A 3PKYA 2GQ2A 3QRQA 2VG5B 1MLAA 1CLFA 2ZHBA 5K14A 4C97A 1Y5NB 1CQMA 4F4KA 3TRGA 1QLNA 2J6TA 3D3BJ 1HWKA 1FWPA 3RR8A 2MLYA 2GA7A 1KQKA 2WVDA 2GJ2A 2ALYB 2LKZA 3KLEB 2SXLA 2BEFA 1FJ7A 4K4SA 1MROA 3JQKA 4WP9A 3SFUA 2XGPA 4OYIA 1U1KA 1RCXB 2H48B 3KHHA 4JBCA 2QE5A 3BB5A 5DLGA 4F3QA 4ZIVA 4KRWA 3MUVP 4YDXA 5IZHA 3CGIA 3IAM9 1HNVA 5F41A 2KHDA 3HJFA 1CJUB 2RQ4A 3IR6B 1JX4A 4DCJB 1VISA 4X65J 4U9RA 1IQTA 3E01B 3DLLQ 3LALA 3JB9k 1S59A 1IJFB 1Z1ZA 4XK8C 3BSCA 2J76E 4P7TA 3FEYB 1AXQA 4DR3F 1FRKA 3AA8A 4OLPA 1TAQA 4QPXA 4TY9A 2RQMA 3PVXA 4QYZK 3I82A 4ID5B 4ECZA 2CFXA 1PJ7A 4X65F 3PX4A 4JOUA 2J9EA 3AH6A 3PEHA 2OIHA 2ACYA 4FXDA 4DL4A 3NY0A 5MAOA 4KTQA 1VRUB 1HNZF 4B3SJ 3C14B 4QR2A 4CLTA 3UR0A 1QY7A 2UUWA 1WSRA 3O2IA 2RDDA 2D7SA 4DFPA 2FLLA 3MAAA 2VPYB 4CLKA 2EBGA 3FJ2A 2HMIA 2NSCA 4UUWA 3PO5A 2R3VA 5AXMA 4KY3A 2GHVC 5HBMB 2DGOA 2YNGA 4JI1J 1S9EA 4B9TA 3MUMP 3EE3A 1XWLA 2ZNYA 3CJ5A 2HHWA 4CTAA 2JOQA 2ZJQQ 3Q8PB 3WIVA 5J2MB 5SUHA 5LSRA 7FD1A 2O3DA 2YNIA 1NKEA 4ZDNA 1FESA 2RU9A 3SXLA 3NNHA 4CNZA 3GWCA 2HFOA 2VODA 1UMJA 2EWHA 2YWWA 5DQGA 1RWPB 4B9NA 3DRSB 3ET6B 3PFOA 3CDBA 3T5KA 1NB7A 4J90A 2MLZA 4AFFA 2BQUA 5L46A 2MZRA 3J80Y 1NK6A 1RU2A 2COLA 3QT6A 3H5UA 1X4HA 2D69A 2OAUA 2I9SA 4PCQA 4UY85 2P5VA 1JQGA 1QSYA 2B8PA 3GG1A 4W90B 3PIOQ 2MKIA 5C2GA 4USWA 4EI2A 1G7CB 1IR0A 2EKNA 3CC4S 3ZZ0A 3GR0A 1SUQB 1PAEX 4NLSA 2CPDA 1ACMB 1JLAA 4FF3A 3Q22A 2KYXA 2IVMA 1KN6A 3BGRA 4J5OA 2MKHA 2Z0GA 2PFFB 5KFXA 3SEOA 1FEEA 4KH1B 2AZ1A 1RWVB 2DNGA 5H9EK 4H4KC 1KOHA 3CUNA 4HLBA 3TA2A 2UP1A 1VQ9S 1WOSA 4LF9J 1NCLA 2BX6A 3DC2A 5A8RA 2KFYA 5J1EB 2EC0A 4AQYJ 2C2ZB 3KWMA 4IOCQ 4I4BA 2HW3A 3N28A 2YNFB 3SSQA 5I42A 2QC3A 3SMZA 4NLOA 1WTFA 1T9TA 2VOOA 2ZH5A 2CDQA 4MIAA 1N33J 4KQZA 4PXCA 4F26A 2DBBA 2B6AA 4NASA 2H5EA 4KO0A 5AE1A 4X66F 2K1RA 3R5DA 3CJ0A 1PBAA 3R9LA 4GKJJ 5HAOA 2BE7D 3GYGA 1NKCA 4RUCA 1M90T 2R2TA 5D4LA 3RB0A 2HBQB 2E5JA 4AE5A 2DB1A 3TAQA 1T8EA 2XCAA 4O44A 2FGOA 1N33F 3M8YA 5KG5A 2OHDA 5D3GA 4DX6A 4M1KA 2Q1LA 3FMWA 2WSFC 4I7FB 5A0YA 2GO9A 4DQQA 2LQJA 2PGCA 4Y2KA 4EBEA 5FD1A 1J5EJ 1PCAA 3CJKA 3ILJA 1JIHA 3AJ2A 4Y2MA 2XG8A 3M2UB 1S0NA 3HHLD 2X51A 4PG7A 5EN1A 1RWMB 4K2JA 3CO0P 4Q45A 1NSAA 3PYGA 1CULA 4JI5F 3D0HE 1NZAA 2ZH2A 1T03B 3K59A 1EIYB 4R5PA 1REVA 4WZMA 3JQMA 3R5JB 3U1NA 5KT3A 1UA1A 1ZM3A 1FXLA 4OFZA 4LT6A 3OTOJ 5KFLA 1HBMB 3T9NA 2QA1A 3RBDA 1EB0A 1N52B 4ZPDA 2LVWA 4DG1B 3P6YC 1DZ5A 1RTJB 2Z2YB 4QR0A 2G13A 4CZCA 1P6TA 1GMWD 4KV8B 4KGXB 4USTA 3OTOF 4NLPA 5HVGA 4P6QA 5GAGI 3QO9A 2WBMA 4Q7AA 3OVAA 3UN5A 4QU6A 3MR5A 3OD2A 1UWBB 2GVDB 3L3CA 1RHQB 2R42A 2RKIA 3K8WA 1L3SA 2HNZB 3IR7B 1W25A 5HQ8A 3NGSA 4BDPA 2GV1A 1RT3A 1X4FA 4A47A 3PYDA 4OI2A 1S7IA 5H1SV 2CJ9A 5LJ5Y 4NA3A 2OEJA 3RB6A 3R2CJ 2G9OA 1T0TV 4EEYA 3M32B 4DFMA 2ZVIA 5I3PA 4P2FA 3IRWP 4Y3CA 1ZA2B 3DLEB 5L1LA 2MSTA 1WC4A 2AKWB 3AQOA 3FMBA 1S12A 5KFEA 2UUCF 2MLXA 2DXDA 2DNRA 3DOMB 2KH9A 1LWEA 3EM1A 3C3LA 2IBOA 1XQIA 1T9WA 1KTQA 4FYWB 4P72A 1S1UB 3HO1A 1IBLJ 1WOOA 2FQQB 4Q43A 3SI8A 1DURA 4H4OB 4K4TA 4OYBA 1RLCL 1TU0B 4OV6A 2PA3A 4QCLA 1FKPB 4LRFA 4RNOA 2XBPA 2GJIA 2R7SA 2UV8A 3NXZA 3EGNA 4GRSA 1RWUA 1C2PA 2ZH9A 2QLFB 4HKQA 3G96A 3VVTA 4JI8F 4G1PA 2KHCA 2HQCA 1NNDA 2G0JA 3CMQA 4YS2A 1WKKA 1PILA 2V8HA 2OPQB 2YXLA 2WONB 1XR7A 1VRTB 2OPSB 2GNKA 2VL1A 3PEJA 2OTJS 4ILMA 1WACA 2G2OA 2MDAA 2VONA 2HWHA 1RQ0A 3ZTOA 1RTHA 1LQ9A 1U0HA 4ED6A 2HG4A 2R7XA 1VBYA 1NAQA 1EETA 1TMJA 1VK8A 1V3ZA 1U6ZA 1S4EA 4HYKA 2XYPB 4P2SA 5E5NA 2FVQA 3PDNA 3DDNA 1U2CA 3EZOA 3M9NB 3DRPA 2AJ0A 1NHVA 3CD0A 3RAMA 4DR1F 2J9CA 4H4MB 1RT1A 1SIZA 3MCOA 1SKWA 2GCFA 4FVCA 3DLBA 2G1DA 2AT1B 3SZ2A 3CCTA 3TI0A 4GVBB 1PC4A 5EWGA 1S6PA 4ZVTB 3WC0A 2BZ2A 2VOPA 1FA0A 1H2UX 2HHQA 4TU8A 1QSSA 5KFQA 3PX6A 2WVCA 3HHLA 4WP3A 3QYYA 2BKOA 2ILYA 4V19X 5B0GA 2ZJPQ 2DGXA 3QAEA 4OX6A 2DXEA 4DR2J 4U7UD 1C0TB 2VPXB 2A10A 1T3OA 2MEWA 2RDJA 1V9OA 3V6DB 4DWIA 3LUYA 3I6PA 1KONA 2H51B 3KJQB 2VFTA 2CYYA 2ZUAA 1TL3B 4WU2A 3S6EA 1OIAA 2DITA 3LP0B 2J9DE 1ZS6A 1SH2A 1Q8IA 2CJKA 3DLJA 4RL1A 1F5CA 4K7QA 1YRXA 3FFIA 2AW0A 1N5YB 1AZSB 2UV8G 3MCSA 1X4BA 5KG0A 4TU7A 1GMWA 2HVZA 5BXIA 1TUWA 3GJRB 3CIZA 4ZVQB 3T5HA 2XWXA 4P10A 3M8SA 1H73A 4C8MA 2ZD1A 3AA9A 4RU2A 5J2QA 4G1QB 2Z58B 5KFJA 4I1TA 3K5OA 2HAIA 1IBKJ 3E2EA 1BY9A 2JLGA 5D77A 2F9DA 3VV2B 4HEA9 1UJ6A 2XS2A 3OQ2A 2VHGA 3DOKA 1S10A 3FBEA 1Q7LB 8AT1B 1L3KA 1EKRA 1XNQJ 5ITHA 4DSFA 1FWKA 1SIWB 2GHPA 1XNRJ 4CH7A 3LGNA 2HQIA 3RAQA 1RKIA 2ASDA 4LRAA 4I68A 4USKA 5DM7Q 1HW9A 4NEYA 2LYVA 2X1BA 1RHMB 3M30B 4DSJA 4Q44A 1JNZB 2J0XA 1T11A 4DEZA 2BM0A 2VKZG 2W4CA 2NQPA 1AA1B 1AYEA 2WVEA 2MKCA 4X4TA 2W9BB 4GC6A 3D0IE 3NS7B 3DLKB 4DU7A 2EBEA 1NB2A 4ECVA 4KHPJ 3NL0A 4OI4A 2LU2A 1JLFA 1RAIB 2N4DA 3TAMB 5KFFA 1NMEB 4X4SA 3IRXA 2ZH3A 1QTMA 3MMAB 2BANB 4ECXA 2VD3A 2HLUA 1FWLA 2HQGA 4YB6A 3OTEA 2YQ1A 2J6UA 4J9PA 4J9OA 4KHPF 2HLTA 3HHDA 4U8VA 3BKUA 1TVRA 2B56A 1GQEA 3MTKA 4NI2A 1N0VC 5CD4A 1DLOB 3CE8A 3OUYA 3R7NB 3NCRA 2R8KA 1Q81T 1F3VA 1YJUA 2CQGA 2RF2B 3BN7A 1HWLA 2EC2A 2R7OA 1B3TA 2XO7A 4B02A 1H7XA 1RT4B 1ZM9A 1AT1B 3G8QA 1ZPVA 3G87A 4F4WA 1FJGF 4PXBA 1XMBA 2IPOB 3RG6A 4ZVHA 2ZOGA 4NLQA 3VALA 4OYMA 1U48A 3ZC4A 2FJXA 4DV2J 4P9SA 3T41A 1IR1A 3DXSX 3HM9A 3VAGA 2IYGA 1LKZA 5KG6A 1XIQA 2P9GA 2PSZA 4GO5X 4JV1A 1IKWB 1KSPA 3QWUA 3NAIA 4PWDA 1H2VZ 1SCJB 1U8WA 3MM7B 4DV2F 1M5OC 4F50A 2FVCA 5IV3A 4OJHA 1EZZB 1NBEB 2XCPA 4RBUA 4WFBQ 5KG7A 5D4PA 1RAOA 2HVEA 1RB0A 5J2NA 1R7IA 3C15A 1TKZB 3LAMA 1SKRA 3EGZA 4Q0BA 4JI3J 1IVZA 4DV5J 3J80U 5T7LA 3ZNUA 3LO3A 4B9SA 1DFDA 3HP6A 1RAAB 4FKXA 2L3MA 4MIWA 2CPEA 3G8SA 3C19A 5G0RA 4YB1P 3OR1B 2OGUA 2W7AA 3CT9A 2OEKA 4DZ6A 3K5LA 2IBKA 5C2CA 1BQXA 1Y11A 2E5LJ 1V3SA 2YH0A 5L1JA 4JI3F 4DV5F 4LF8J 5E3QA 4BC7A 1OYEA 2CAJA 1IKVB 4ZCLA 2RHSB 3VQSA 1P1TA 4YQWA 4Z7YA 3PTWA 4I64A 2VH7A 1FE0A 1R8AA 4R8UB 4ES1A 3D6TB 1YJRA 5LT5A 2X1AA 4ZVGA 4UQGA 1VLOA 2B7BB 2B4OA 4KAIA 2AF6A 5C42B 3Q83A 2C1EB 2YNHB 4JYAJ 3JYTA 1BXNA 4P2MA 4H4KA 1F2HA 2GHWA 2WK4A 4I2PB 4M95A 2Z2MA 2PEBA 1VDHA 2C2MB 1FKOB 1NJIT 4LFBJ 3KHRA 3GQCA 1RACB 4JV2A 4KJIA 4FF2A 4CLPA 2EW9A 3BN4A 5LMNJ 4JI7F 5D8HB 2IJRA 3GIRA 1VHIA 5KG4A 2VASA 5E41A 3GJSB 3DM2A 4GKKF 1S77D 4WK3A 4C2MA 3BO2A 5GAEU 1SC6A 2FC8A 1E6VA 3OFHA 2CPXA 2RMLA 3QZ8A 2MKJA 1MWYA 4ID8A 4QU7A 1XR6A 3C6TB 3MM8B 5L1IA 1R8HA 1HNWJ 2LQ5A 2M52A 4QWDA 4F3OA 4P52A 1RWKB 1SXLA 1OJ4A 3TEHB 1CJKB 4I67A 2QFIA 2JL9A 1HQ2A 3I4HX 3BO3A 3A1YG 1HNIA 2K2PA 5JMNA 2QMXA 4Y28C 4NZ7A 2V6AA 1D9DA 4JI6F 4K0KJ 4U95A 4M5NA 2MTLA 3SV4A 1KWMA 2HFSA 2EFNA 2D3ZA 4P7VA 2AZ3A 4PQAA 5F3ZA 3BDEA 1KQGB 1NEEA 2Z8QA 2BACA 1T05B 3O1LA 1N6QA 3WHIA 2N7CA 5LMUF 1JJ2R 3KLVA 2IC3B 4FYDA 4RLEA 1IKXA 2QG9B 3DLGB 4LIRA 4I6WA 3MEDB 3DFEA 3JSRA 1FJCA 1J5OA 5C25A 2WOMA 1U09A 3QAUA 4AT1B 2CVIA 5A8WB 4C0OC 3QPIA 1UJ5A 2CNLB 5CQGA 3GIMA 2HHTA 3Q8SB 3UW1A 2YPZA 1UA0A 4G65A 1R6YA 3I4PA 2DNKA 4ZP7A 2YWHA 4A8FA 1DTQA 2IA6A 1RAJA 2ZH6A 1M5HA 4CYUA 1CPZA 4AXIA 3G6XA 1UW9A 3DHXA 1TFYA 2W9AA 4ZLJA 1S9GB 3I0RA 3DLHA 3D6MB 4LVOP 3ELHA 2KT3A 1U26A 1UVMA 3ZO7A 4OX7A 1LWFB 2NUHA 4DUYJ 5HN0A 2CPZA 3R1HA 1RA6A 2J0WA 1BLUA 5CZXA 3KK1B 5KFPA 3MR7A 1RTIA 4N47A 5KFYA 2CQDA 1RXOB 4C4WA 2DR7A 1GXTA 1WG1A 3IR5B 3QIPB 2Z56B 4DV7J 2XS7A 2H5IB 4DUYF 1VC0A 4FBTA 4PPDA 3WC2A 1Q79A 1HR0J 1SH0A 3IXQA 5IM0A 1SL2A 4C0BA 2R2UA 2CKWA 1VQNS 3N5BA 1YZ6A 2VQEJ 4YHHJ 4N7TA 2VG7B 4TLQA 1T7PA 4DL7A 2RT3A 4WU3A 4NYOA 1HD0A 4DS4A 2IAJA 2DHXA 1DTTB 4LSNA 1HR0F 4CWBA 1QE1A 5IC6B 4ZHRB 4RUBA 3ONQA 4CLYA 2WTFA 4FF4A 4DR4F 3DRRA 3HVTB 3NMRA 4KO0B 3UDVA 3N6NA 4KKOB 5IT0A 3SBMA 3UVJB 1RHKB 1TTHB 2VQEF 2R7RA 1ICEB 5I3UB 4EBDA 2KM8C 4TYBA 1P27B 2D1CA 1IM4A 2FZGB 2JVRA 4ECTA 2HFNA 4O4GA 2GMLA 3PV8A 3Q2SC 3MOJB 5K5MA 1KFDA 2KFZA 3OPKA 1WHVA 1FRLA 2FZCB 4IFYA 3D54A 1YJNS 4ZPBA 1TL7A 3HZEA 3NCPA 1WKJA 3NBPA 3TZWA 2XZDB 1OYDA 2LA4A 3HX9A 2CZ4A 1N54B 2D3UA 5DO2A 4WFAQ 1REGX 2CJAA 4MH8A 1SL0A 1YRUA 2IRUA 3FSIA 2PE8A 3TWZA 2ZFHA 1WTBA 4OZNA 4CT9A 4CLLA 4NLDA 3QFWA 4PPZA 4CDIA 2YKMB 1DHMA 3G6ES 4F4YA 5ETSA 2F9JA 1UFLA 3HVRA 3CJQA 3TX8A 5E7OB 5IS2A 1FFGB 5HL7Q 3AJ1A 2V69A 2E1CA 3G82B 4IR9A 2ZDOA 4PG6A 2F4VJ 3G9CA 1PAUB 2FGCA 2GW8A 3L09A 3HI9A 1HNXJ 3QRRA 1D9FA 3DI6A 4N77A 1M1GA 4RNHA 4EGLA 3R1LA 2OFGX 4EZ6A 2DCLA 2XEXA 4QIVA 2JHEA 4PWWA 1WWHA 3QT5A 2CQCA 1MMLA 2V4JA 2BE2A 2N4CA 2Q79A 3E8OA 5JVHQ 2CPYA 2FLNA 4KFBA 2YBVA 4H54A 1LWCA 4K4VA 2LEPA 2M2BA 5F9NA 1RCOB 4RW7B 1U49A 1NKBA 5L9NA 2B5JA 4C98A 4DV3F 1A0OB 4UOHA 1YQHA 2DGTA 3EXCX 2W01A 3H5XA 5K8OA 2RB7A 1Q8BA 3W8GA 2P9EA 4F7VA 1ZTTA 2F5GA 2F8MA 1X4DA 1HBNB 2POKA 5M2UA 2NR0A 4MKVA 2QYCA 3PW0A 2N82B 3PM9A 3TANA 3WIUA 3D1OA 4X84A 4WP8A 3GG0A 4DL5A 1WDDA 4RW6A 2MQPA 2ZNZA 1T02A 1TV6A 2B4UA 1X5SA 1NDKA 3JTNA 3FBBA 3OSNA 3QGGA 3W61A 2HNDA 1LK5A 2VU5A 1Z2LA 2BRKA 4RNNA 3OFEA 4KYZA 3KDNA 1C0UA 1WEYA 1BD6A 3A3NB 3ZXWA 3S8SA 1RYSA 1D1UA 1VHFA 3EWGA 3Q86A 3BSOA 1VI7A 2CVEA 1JXVA 4Y2CA 2E1AA 3CSKA 2XYGB 3EVOA 2FUG9 2ZHOA 4YFUA 3N6MA 1VS3A 1BC6A 4O23A 4OHVA 4TVAB
chains in the Genus database with same CATH topology
3MUMP 1XWLA 3VAJA 2ZNYA 2JDJA 4B9UA 4DL3A 3KK2B 4B3OA 3CJ5A 2HHWA 1MWZA 4CTAA 2JOQA 2RS8A 4XPEA 1O5JA 1QUPA 2FPHX 2ZJQQ 1YRTA 2XI3A 3DRYA 3Q8PB 5J2MB 4DV0F 1VQPS 4M94A 2XMWA 5A6WA 3JYTB 3DRXA 5D4NA 4DSLA 2ABYA 3KG0A 1N8RT 3J7A1 5SUHA 5JJBA 4IOBA 5E33A 1NK5A 2HRYA 2CJQA 5LSRA 4IQMA 1N56A 5EUHA 2DTJA 3KNGA 7FD1A 1DJ0A 2O3DA 2YNIA 1SKSA 1HBOA 1Q16B 3QJLA 1NKEA 4ZDNA 1RT2A 1R27B 2FHJD 3DMJB 4WFZA 3V4MA 3HKWA 4X4QA 1HQUA 4FXWA 2V94A 3KLGB 1FESA 2RU9A 3P3DA 1X0FA 2KVIA 4PQUA 3SXLA 1UJ4A 2CIMA 4NLTA 4CNZA 3NNHA 5IT9Y 2DPIA 1K1QA 5CCLA 1DQ9A 1NH8A 4MIBA 3GWCA 2HFOA 2XB2D 4GO7X 2VODA 1UMJA 2EWHA 3B4DA 5DQGA 4B9NA 3SDEA 1YTYA 3AY0A 1RT1B 1UW4A 3DRSB 3PFOA 3CDBA 3T5KA 1NB7A 3CCVS 3WX4A 2YKPA 4AFFA 2BQUA 3ZZOA 2MZRA 4QQBA 5F8IA 4MTPA 2B9WA 3J80Y 1NK6A 3DM2B 3M30A 5F8GA 2ZBCA 3SSRA 2EPIA 2COLA 3UE2A 3N79A 4WKRA 2DNLA 3OV7A 2RRBA 2YY3A 1X4HA 3H5UA 4NA1A 2W8KA 2DIUA 4DR2F 2OAUA 4B9MA 2EFPA 1HARA 2BRLA 2I9SA 2VBZA 3GV8B 3NWGA 2F3JA 2OPPB 2RQKA 3G86A 3W2VA 4PCQA 4UY85 1N5SA 2VBWA 2ZH8A 2P5VA 1E6VB 2U2FA 3EUNA 5IWAF 1S1XB 1QSYA 4FF1A 3GG1A 1HL6A 5KFDA 2W9BA 4CO3A 3OHBA 4A8XA 1XMOF 4W90B 1UAWA 3PIOQ 4YEAA 5KFWA 3VAKA 2MKIA 3DLKA 1T94A 3N9UC 1G7CB 3IGVA 1IR0A 3RB3A 3CC4S 4WIIA 1F5AA 1Q1KA 1NJWA 3ZZ0A 3GR0A 1SUQB 2BBEA 2WCXA 2JEGA 2OMOA 4NLSA 2AWZA 3R5AA 4NLWA 4URSA 3L7PA 2CPDA 3VAIA 1JLAA 4FF3A 2CRLA 2YX7A 3TAMA 2NPIA 4OZ1A 1KRPA 2HGMA 3FCHA 3Q22A 3IBWA 4DV6F 2KYXA 1G3OA 4RW9B 3LP2B 2IVMA 4C8KA 4CO2A 3W7BA 5U47A 5KTQA 1KN6A 3KOAA 3BGRA 4QYRA 4LSLB 4QIEA 4J5OA 1RTDA 2MKHA 2GQQA 3GMGA 2Z0GA 2QLWA 5B0AA 2PFFB 1LFPA 5KFXA 3FVYA 3SEOA 1FEEA 3MMAA 5JXSA 2BANA 5EX0A 3V6HA 3Q8RB 2DNGA 1LW0A 2BM1A 3AHPA 4IRKA 2ROGA 2W24A 1HNIB 3E3XA 4H4KC 3K2YA 1KOHA 5GADU 5GVQA 1AFIA 1HWJA 2C2RA 3CUNA 4LF6F 2C3YA 2LEAA 1KR4A 4HLBA 2DH7A 3GFXA 4OHZA 4XPCA 3IG1A 3TA2A 5HROA 2KJVA 5AXLA 3UI3A 4ICLB 4NLYA 2UP1A 1VQ9S 3CVKA 2N7YA 2F40A 4K4ZA 5LSLA 5H9EJ 2KZZA 3DC2A 5A8RA 2JVOA 1VQYA 4I2QA 3OR2A 2ZE2B 1VIXA 2CQHA 4OX9F 2KFYA 3BDPA 5J1EB 5GAHU 2EC0A 4LMZA 3B4MA 2CG4A 1VLYA 3TUJC 3KWMA 4IOCQ 4I4BA 2QSFA 4YY3F 4J9MA 1RT7A 1Q4RA 4RWXA 2HW3A 3N28A 3T1AA 3PW2A 5FLXY 1KLNA 2FVRA 4NX9A 1WHYA 5J2PA 1LV5A 5BR8F 2YNFB 1N6QB 1YGYA 1IBKF 3SSQA 5I42A 1OPZA 1HHSA 3SMZA 4NLOA 1NO8A 1WTFA 3FZBA 3UCGA 4IQXA 2VOOA 2ZH5A 3LAKA 2CDQA 1FNOA 1DLOA 4MIAA 3QGHA 2L08A 1SL1A 2YQ3A 1M5PC 1RT5A 4O3QA 4LFAF 1IKXB 4KR0B 4KQZA 2AJFE 1NU4A 2QSWA 4PXCA 4F26A 2DBBA 1Y5IB 4ZP9A 2B6AA 4OX8A 2KM8B 2H5EA 4KO0A 1LW2A 1J5OB 4FVMA 4HH0A 2RF2A 4J37A 5C25B 1FHTA 1GNKA 2J7KA 5AE1A 1C1CA 2WOMB 4X66F 1YBAA 2RRAA 1T95A 2K1RA 4NCGA 4A48A 2ASLA 4ZPCA 2BABA 3KFWX 3OXLA 3R5DA 4KB7A 2Z2LA 3CJ0A 2B9XA 1XNQF 2ZD1B 2R7UA 4IG0B 2IFXA 3X1LB 2KI2A 1XNRF 4BWMA 2KRBA 5KFKA 3OSPA 3UPFA 1QAIA 2R7TA 1RT4A 2FHMA 3I32A 2I0XA 4BC9A 3CCMS 2XNRA 1DARA 3OJUA 4IFVA 1RYRA 1NKCA 4RUCA 1JKHA 4TQSA 1U47A 4GMKA 1M90T 2R2TA 1FT8A 5D4LA 2Q6CA 3IC1A 3MOZA 5HLFB 3RB0A 2E5JA 1FKAF 1IN0A 2DB1A 2CQ4A 4AE5A 6FDRA 3FEXB 5B7WA 4K4XA 3TAQA 3AQPA 4AUKA 1LK7A 1FDBA 5GADI 1T8EA 2XCAA 3B8HA 4ED2A 5LL6d 4QBUA 4O44A 1DTQB 2FGOA 4N76A 3H40A 1N33F 3G71S 2MJUA 4USHA 4CO0A 3BREA 4LVNP 5KG5A 1XK8A 4ZVEA 2DVIA 5D3GA 3FZ2A 4M1KA 4OI0A 2Q1LA 3TA1A 1TL5A 1FRJA 3FMWA 2WSFC 2HGLA 4ELTA 3ITHA 4I7FB 2IM1A 2KT5A 1RT6B 5A0YA 2ZVSA 1A6LA 2GO9A 4C11B 2LQJA 4DPOA 2MKKA 4DQQA 1VQKS 2PGCA 2MY8A 4Y2KA 5GAHI 4EBEA 4Q8EA 2HQ3A 2W9CB 3BGLA 4ETZA 3R5BA 5FD1A 3OJSA 2DGVA 2ADCA 2KO1A 1N0UA 3I0RB 2BXJA 2QMWA 3CJKA 3K5NA 2A18A 2OSQA 1IKWA 2QA4G 3IWLA 5KFMA 3M2VA 1JIHA 1HWUA 1NH7A 3R3TA 3OL9A 2XMJA 3AJ2A 3AB4B 5KFHA 3ZFVA 4IRDA 1U4BA 1QUVA 4NXNF 2DRAA 3CJ2A 4Y2MA 1L3UA 2XG8A 1JMTA 3M2UB 4CO1A 5CYQB 1S0NA 2DK2A 3RRGA 4K5RA 3HHLD 2X51A 2LCWA 2LQBA 3C6UA 3MM7A 3RZAA 4ED7A 1MMDA 4PG7A 5M2PA 3TW0A 1VQOS 5EN1A 1SJ1A 3H8YA 1VOMA 1Y4ZB 3TARA 2NUUG 3BJYA 3PNIA 3G6YA 4NXMF 4Q45A 2DIVA 1WELA 2VUGA 4JI5F 2MQQA 2R7VA 2W25A 4BCAA 3D0HE 1KQSR 1NZAA 2XHWA 2V8GA 5KFRA 2ZH2A 1T03B 2L9DA 3K59A 1U1RA 4K50A 3I5CA 3I5AA 4IKAA 3IAS9 1RTIB 1WG4A 2IM2A 3HLUA 5KFCA 4R5PA 2IRYA 2OPRA 1BQMA 1YSJA 2GQCA 1FRMA 4ECYA 2VPWB 1REVA 1TKZA 3PRDA 1KS2A 1X9WA 4WZMA 4F3MA 2NYIA 1JXEA 3MPYA 3U1NA 5KT3A 2MHEA 1HI8A 3QWPA 3TUIC 1UA1A 1ZM3A 1FXLA 3MM9B 2R7WA 2XC9A 2GMJA 2KG0A 4OFZA 4LT6A 3HVWA 1Q8LA 2AP6A 3MECB 1TUVA 4OI1A 3MM5A 1HWIA 1FCAA 2E9TA 2E1MC 5KFLA 2XLIA 1HBMB 2I5JB 2PEHA 3T9NA 4OIXA 2QA1A 3EPGA 3KLHA 1F60B 3RBDA 1N52B 3OR1A 5IM0B 2DNHA 3Q2TC 4ZPDA 1S1TB 5CYJA 2LVWA 3FRYA 3KMSA 1HHTP 2PI4A 2KZMA 2DJWA 2Y1RI 1FD2A 4N8NA 4OHWA 4DG1B 3ICLA 4MAKA 3KJVB 1X4EA 3P6YC 3POTB 2Q43A 3M2RB 3Q0AA 2V0NA 1KLMB 1RTJB 2ZH4A 1DZ5A 4QR0A 2VA2A 2G13A 1B0VA 4CZCA 3CF5Q 4ZPTR 3UR3C 1P6TA 4WE1B 4E98A 4CO4A 2FB0A 2XSFA 4XDDA 5J1PA 2DRBA 2GX8A 4JV0A 3KK3A 1S97A 5IT4A 3KLFB 3N4WA 3D0GE 2ZM6F 3CDEA 1IKVA 4KV8B 1X4CA 3EGWB 4L72B 1GX6A 2KFNA 5KFOA 2IAJB 3IS9B 1S76D 3GIJA 4LF7F 2VBXA 3OTOF 3MEGB 4NLPA 1I1GA 1XMQF 4P6QA 2UXBF 5GAGI 4J9SA 3QO9A 2WBMA 4LSNB 4Q7AA 3OVAA 3PZPA 3MEKA 2PIIA 1QAJA 3MR5A 4QU6A 5FDLB 1RKJA 1UWBB 3DYAA 3OLBA 1C1BA 2NLWA 3SQGB 3L3CA 4ECWA 1H38A 2FHJA 4R8UA 1IKYA 1JLGB 2P6SA 2RKIA 3DRRB 4FZVA 4ZS6A 1OPIA 1TKTA 4CH0S 3K8WA 1L3SA 1XC9A 4O3PA 4A8WA 1KVJA 1S0MA 2HNZB 3TNVA 1FRIA 3IR7B 2VQFF 5EDWA 3H98A 4IDKB 3QLHB 1U6BA 1Q78A 2MQNA 2MJNA 2OMLA 1NJZA 1VQ7S 1W25A 5HQ8A 2Q6BA 4ZCMA 3K57A 4BDPA 3BO4A 2GV1A 3PJWA 1FXRA 1RT3A 1X4FA 4IG3B 4A47A 2CQ3A 4OI2A 3LWMA 4F4XA 4QWEA 4ZK7M 3LQVA 3MD3A 2CJ9A 4O4GB 5H1SV 5LJ5Y 3I56S 3F73A 5C42A 2EFQA 1YVFA 4NA3A 3U1MA 3D2WA 4ZP8A 3RB6A 1UFWA 2G9OA 1DBDA 4EEYA 3M32B 4DFMA 5D4OA 4DLGA 3VR1A 2DISA 1H98A 3MHYA 2FD2A 5I3PA 3IRWP 1TKXA 3V4IB 2RS2A 4ZCIA 4Y3CA 2R8IA 3DLEB 5L1LA 5DS7A 2MSTA 2FIUA 1R8BA 2YNHA 3AQOA 4IFYB 2IYIA 2FJDB 2MYFA 5IQ6A 3HMJG 4TY8B 4K2XA 1FRXA 1H3DA 4N5SA 1ZM2A 2B9YA 3OTDA 1FDAA 4XIUA 5CH7B 3M05A 3FMBA 5KFEA 2UUCF 4ZLPA 3NBPB 1U24A 1H0HB 4I2PA 2DNRA 4C7QA 1U2RA 5BYRA 2KH9A 3TVZA 2CPHA 2BDPA 1OSDA 5F8HA 1IJEB 1LWEA 2DGQA 1PGZA 1FKOA 4QIWD 3C3LA 2D9OA 3C66A 5KFAA 1N5VA 2IBOA 3CDUA 2DNQA 2ASJA 2YX4A 2EFGA 2J9DA 4WFYA 1YJTA 1KTQA 4WYWA 2B4VA 5DDQC 4D3HA 3D1QA 1S99A 2DH9A 4CT8A 1AUDA 1S1UB 3HO1A 2ZUGA 2ROPA 4K59A 2M5YA 4Q43A 2KG1A 4Q8FA 3SI8A 5D78A 5C5JA 1DURA 4H4OB 1O0PA 1CVJA 3HHNB 2GFFA 4K4TA 3UD4P 1VK3A 1Z4UA 4OJ1A 3MM6A 3CD6S 2UXCF 1E6YA 4DBQA 1RGVA 2RU3A 1YJ9S 2MZJA 1K9MT 2PA3A 4QCLA 1FKPB 2RJZA 3NP5A 4RNOA 1K73T 2XBPA 2GJIA 2R7SA 5KG1A 2MMYA 2C2DA 2UV8A 1KQFB 3EGNA 1H2TZ 3BSAA 2HS0A 1U1NA 4RNFA 4D3GA 1RWUA 1Q53A 1C2PA 3NRBA 4QWBA 2ZH9A 5HP1A 3RBEA 3I9V9 1XTZA 2WHOA 4MFBA 3CTRA 3D28A 3MURP 3G96A 4HKQA 4JI8F 4G1PA 2AV5A 3PJXA 5KT4A 4PUOB 2XLJA 2KHCA 2LEBA 3C6TA 3MM8A 1I94F 1NNDA 4WXWA 5A2QY 2E5LF 1I6JA 3I5BA 3MZIA 3BQ1A 2VBYA 4BBYA 1PILA 2V8HA 2OPQB 3FNNA 3RU0A 2NREA 4LF8F 2WONB 1VIOA 3I9ZA 1XR7A 1VRTB 5K14B 4R0EA 3I0SB 2OPSB 2X1GA 3KLIA 3MMBB 2GNKA 2VL1A 3FQKA 3PEJA 4ZPVR 3LW5C 2OTJS 4ILMA 4X64F 1WACA 2G4BA 1RP5A 5C24A 2MDAA 5LXYA 2VONA 1B7FA 2HWHA 3BGFA 1RQ0A 4TYAA 4YR3A 1TK0A 1RTHA 2DHGA 1HMVA 2KN4A 4AL5A 3DI6B 1LQ9A 4ED6A 1MROB 1S6QB 2HG4A 3MR3A 2E66A 1NAQA 3HHEA 1VBYA 2R7XA 3GV5B 1R8PA 1S1VA 1EETA 5KFZA 5K8MA 4DL0C 1VK8A 1V3ZA 1CC7A 1M5KC 4LF5F 1U6ZA 4HTJA 4ECQA 4HYKA 4AL6A 2H9ZA 4P2SA 5EWEA 2YTCA 2UZAA 3GILA 1Y9OA 3TUZC 1HYSB 5E5NA 3EZUA 1M5SA 2FVQA 3PDNA 3DDNA 3CEDA 4YMEA 2W4PA 2BUNA 3M9MB 2JH3A 3M9NB 3DRPA 5T14A 1VMBA 2AJ0A 4QIFA 5DDPC 3MUTP 2OFHX 1FE4A 2XS5A 4NL5A 1U25A 3HK2A 1NHVA 3M8PB 2XWYA 4RUAA 3CD0A 2V4JB 4RW4A 3RAMA 1T05A 2DD8S 1UVKA 2HS4A 2J9CA 4DR1F 2XI2A 3V5RA 3CDAA 4H4MB 2BE2B 2JLFA 3EX7B 4EYHB 2CJBA 4HT5A 1N5QA 1RT1A 3CD5A 1SIZA 2GGPA 1HNVB 2IM0A 2GCFA 4ZPAA 3MMCA 1SKWA 2IC3A 1JNRB 4UOCA 4FVCA 3TYTA 1OO0B 4DR7F 2BVZA 4KFBB 3DLBA 4WFNQ 4U6PA 2OO4A 2G1DA 1UVJA 3DLGA 1LXNA 1LWCB 5EHHA 1OS5A 2LMIA 5CYMB 3ULHA 4JYAF 2AGPA 1FD8A 2FJWA 2DO4A 3MEDA 3SZ2A 3CCTA 3TI0A 1PC4A 5EWGA 5A8WA 1S1WB 1S6PA 3JTPA 2B5JB 1Y5LB 4RBVA 4NWBA 3WC0A 1U6FA 1ZAXA 2BZ2A 1SQEA 2EI5A 2VOPA 3H59A 4NYPA 4B9LA 1FA0A 1ELOA 1H2UX 2HHQA 5DG8A 1W2BR 3KHGA 4TU8A 3ZZZA 1JLBA 1QSSA 2OH2A 4LFBF 3VF0B 5KFQA 3PX6A 1N48A 2ZC3A 3MDFA 3LANA 3T6JA 2RUGA 3HHLA 2UU9F 3QYYA 2V5HG 3ENQA 3Q8QB 5LMNF 2OSRA 3GB0A 2ILYA 4DN0A 4V19X 3KNAA 1U1LA 2HHUA 4LJMA 5B0GA 3R5CA 2P9CA 2ZJPQ 5KFSA 2R8HA 2HVHA 2CPIA 3MR2A 2DGXA 3QAEA 4OX6A 3L95X 4A4JA 1ZZNA 1JB0C 1N4LA 5KT2A 3RB4A 1UP1A 1UVIA 2DR5A 1SJRA 4WYLA 5KFGA 1C0TB 2M70A 2VPXB 5MLCV 2A10A