3G6ES

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g6eS00
3UCZP 3EGZA 3G6ES 4PRFA 1M5PC 2QFJA 2XSFA 3VAIA 4CH1A 1U1KA 2ZJQQ 2LXIA 2DNLA 5IFMA 3K0JA 2AYGA 1O0PA 1U1MA 4IOAQ 5IQQA 2E5JA 2MQLA 5HL7Q 1RK8A 1X4BA 3HHNB 1KD1T 2DGVA 1YHQS 3VAGA 1A9NB 1UP1A 2MJUA 4Y0FA 4QU6A 2HGMA 3G8TA 2GO9A 2KXNB 1URNA 2KHCA 2M0GB 5GADU 2N3LA 2KRBA 2DGQA 2DNHA 2DNRA 2E5HA 2NZ4A 2FPHX 3CCQS 1S72S 5GVQA 2D9PA 4F25A 3CTRA 3VAJA 2ADBA 1OIAA 2XS5A 2KRRA 3ZZYA 3L3CA 2MKSA 4WKRA 2KVIA 4TU9A 1CVJA 1PGZA 3ULHA 1U1LA 4IO9Q 1X4DA 2KH9A 2XS7A 1VQKS 3MURP 2CQDA 3MDFA 2YH0A 1DZ5A 4IOCQ 5CXTA 1WHVA 3H2VE 5CA5A 3G9CA 5GAHU 3NS6A 2DNKA 1WF2A 2KYXA 2SXLA 3PIPQ 1WEXA 2DH8A 2OJ3A 4LJMA 5JVGQ 2EVZA 4ED5A 4W92B 2KI2A 1WG5A 2RU3A 2OSRA 1KC8T 1WI6A 2MZRA 1WHYA 4C0OC 3NNHA 4CIOA 1L3KA 3MI7X 2DNZA 5BJRA 5HO4A 1FJ7A 1WEYA 3B4DA 4CH0S 3MOJB 3S01A 1BY9A 2VODA 4LMZA 3I56S 2CQ0A 1WHWA 3J7ZT 2NLWA 2I38A 2L08A 2O3DA 2LECA 1ZH5A 1X4CA 2GHPA 2M8HA 2CPIA 3G8SA 3CCMS 2M7SA 1FJCA 3THTA 3CUNA 1F9FA 2CPEA 1WTBA 3B4MA 2G4BA 3SMZA 5LXRA 1A7GE 1YITS 5IM0B 1NJIT 1VQLS 1VQ6S 2F9JA 5LXYA 3MXHP 3VAMA 1B7FA 2MKJA 3UD3P 2CQPA 3UCGA 1M5VC 2I2YA 2Q79A 2KG1A 3CPWR 3S8SA 4WIIA 1G2EA 1ZZFA 2MHNA 3LQVA 2DNMA 5GAGU 2DNGA 2M2BA 1SJRA 3U1MA 2DNQA 1VQMS 3BEGB 4WFAQ 2CPHA 4WF9Q 2CPDA 2QEXS 2DITA 5JVHQ 3R1LA 2DGSA 2CQIA 2KT5A 1FXLA 5DDQC 3NNAA 3P3DA 3EX7B 1OO0B 2XB2D 2DNOA 4F02A 1OPIA 3VF0B 3CCJS 1NU4A 2M88A 2U2FA 2DHAA 1U6BA 2KFYA 2DB1A 2OTLS 3FEYB 2LA6A 1SXLA 1WF1A 2DNYA 3RW7A 3CCUS 1VQNS 4A8XA 3CULA 4TU8A 5MLCV 5DDRC 2MKKA 4PR6A 2MKIA 1X5SA 4OZ0A 2ZJPQ 3SDEA 2JWNA 1AUDA 5IM0A 2MSSA 2DHSA 1NO8A 2CQ3A 3D2WA 1VQPS 1Q86T 2AYEA 1PO6A 2DH9A 1P27B 2CPZA 2DGWA 2JVRA 1KOHA 2JVOA 3CCRS 4QU7A 4UQTA 2RRAA 2J8AA 2MZSA 1YJNS 2F3JA 2DISA 3ZZZA 3CC4S 3P49B 2XS2A 1X4HA 1VQ8S 2CPFA 2M9KA 2B0GA 3R1HA 2JRSA 2CQBA 2K8GA 2KM8B 2YH1A 1JMTA 1QM9A 2OIHA 1YTYA 2MJNA 3BS9A 2KXFA 3MD1A 3BO3A 3CC7S 2VONA 3CMAS 2HGLA 3N9UC 3I55S 1VQ5S 5FJ4A 2N82B 1U1NA 1YJ9S 1UW4A 2RQ4A 2MZQA 5DDOC 3IRWP 2MY8A 3Q2TC 1WG1A 2MPUA 3UWTA 2MQOA 1X5TA 5ITHA 1SJ4P 2MQPA 2HYIB 3THPA 1D8ZA 4LIRA 3VAFA 1JJ4A 1JJ2R 1X4FA 2BZ2A 1WF0A 2KU7A 4PKDB 1VBZA 2E5IA 3G71S 1K73T 3TYTA 4TU7A 4V19X 5DM6Q 3MUTP 2UP1A 1D9AA 1HA1A 2MYFA 1VQOS 3UD4P 3VAHA 2N7CA 2MSTA 2F9DA 1YJWS 3PIOQ 2MQMA 2DO0A 3Q2SC 4P6QA 3CCSS 3V4MA 3SDEB 2VOOA 2A3JA 2FC9A 1VBXA 2PEHA 1U6FA 4FXVA 4YB1P 1VC0A 3J7YU 1Q7YT 4W90B 1X5OA 1S79A 4WFNQ 1VBYA 4OZ1A 4IUFA 1H2TZ 2ZJRQ 2X1AA 3G96A 2M70A 2MY7A 2YKAA 2CQ1A 3S6EA 1K8AT 2HZCA 3P5TL 2MGZA 5D78A 3NS5A 3G4SS 2ADCA 1ZZNA 2CQ2A 1FO1A 4F26A 5DETA 4C4WA 2DO4A 2CQCA 2FY1A 3BO4A 1SJQA 2LYVA 1DHMA 1M1KT 2N3OA 2LMIA 1HD1A 1DRZA 5D77A 2OSQA 3FEXB 2L9WA 4QQBA 2DHXA 1Q82T 1P1TA 2LEAA 2DGXA 1N88A 2HGNA 2CQHA 1HL6A 1VQ9S 3CC2S 1N54B 1U2FA 3SXLA 5EN1A 1X4AA 2EK1A 4C7QA 2DGOA 2D9OA 5H1SV 2MZJA 1KQSR 2RS8A 3HI9A 4Y00A 2DGUA 3US5A 2KN4A 3H2UB 2FC8A 1VC6A 1U1RA 1UAWA 3MUVP 4J5OA 3EGNA 2EK6A 3VALA 2DIUA 3CCLS 4UY8T 2V94A 2K3KA 2RUGA 2PE8A 2LQ5A 3MUMP 1IQTA 2X1FA 1HD0A 1N52B 1YWXA 2MKHA 2RQCA 2M4MA 3NMRA 3CCES 4QPTA 2MQQA 2DK2A 3RW6A 4FXWA 2E44A 3U1LA 3CMES 3CF5Q 5LJ5Y 3CCVS 3VAKA 3TP2A 2QA4S 1SJ3P 2X1BA 1M5KC 2L41A 1WEZA 3OW2R 2RNEA 2DNPA 5LSOA 2MXYA 2BOPA 3UCUP 5GAEU 2CPJA 3MD3A 3P6YC 2MGZB 3CD6S 2LCWA 2DH7A 1U1PA 1WHXA 2MKCA 5DDPC 1WG4A 1FHTA 4YOEA 3JB9k 1R8PA 1R8HA 2X1GA 2LKZA 1U1OA 4BS2A 4ERDA 4TLQA 2MB0B 2MZ1A 4M5DB 1H6KX 5DM7Q 1VC5A 1W2BR 1VQ4S 4Z2XA 2KM8C 2RRBA 1FJEB 4CQ1A 2AD9A 1FT8A 2VOPA 3R27A 1VQ7S 4U67Q 2HVZA 1XN9A 2DNNA 3CXCR 1YI2S 1DBDA 2XNRA 4EGLA 1SJFA 2KXHA 2CQ4A 2J0SD 5CYJA 1Q81T 1X0FA 5LSLA 3UE2A 2MZTA 3BO2A 2LA4A 3S7RA 2G0CA 1QVFR 3TO8A 2J76E 2KG0A 2OTJS 3DLLQ 2DGTA 2YWKA 2G1DA 1H2VZ 1WI8A 2LEBA 2DIVA 1N8RT 2U1AA 1UFWA 3LPYA 1H2UX 1U1QA 2JX2A 2MQNA 1WWHA 1QVGR 2LXUA 2AYBA 2DHGA 5GMKa 2RT3A 2CQGA 1RKJA 4WCEQ 2AYMA 1WELA 3DXBA 2FHOB 4RU2A 1JJHA 2MMYA 2WBRA 1M5OC 1YIJS 2CPXA 4ZKAA 2M52A 2E5GA 1K9MT 2XNQA 1X4EA 2RS2A 2J0QD 2ERRA 1X5PA 5LJ3Y 1X4GA 1OWXA 1KOOA 2CPYA 2YTCA 1FNXH 2M8DB 3IWNC 2CJKA 1M90T 2D3OR 4WFBQ 4YUDA 3NNCA 2RVJA
chains in the Genus database with same CATH superfamily
1JLFB 4KGKA 3LUYA 1ZM9A 3MPYA 3L9ZA 4I67A 5KFGA 3K0JA 3MEDA 2AYGA 3ZC4A 2LU2A 2K7JA 1J2VA 1RK8A 4DG1A 2EFPA 2ILYA 2VICA 5IT4A 3QQCD 3HVTB 2HNDB 2FHJA 1FD2A 4F3QA 3DLEA 2XMMA 4ZVTB 1OIAA 3NRBA 1NK7A 3MPWA 4NZ6A 4HDGA 3ULHA 1U1LA 2ZDOA 3H5UA 4DL7A 4A8OA 2DHHA 3PY8A 1GMWA 2CKWA 2SXLA 1WEXA 5EX3A 1KRPA 5FIIA 4ZPBA 2KI2A 2RHQB 5B0BA 3BN7A 2OSRA 4DI6A 4AL5A 1OSDA 4QCLA 3MM8B 4DR1J 5KFJA 2D3O1 3ENVA 1BD6A 4FNIA 2C42A 2J6UA 4FYVB 3MAQA 3EXYA 2VODA 2VC1A 3M2RA 4L74A 4LR9A 1U7LA 1TL4A 4OYZA 1X4CA 2AEMA 3TQ1A 2CPIA 3MPVA 2AJ1A 1JKHA 2UUAJ 4OZNA 2NXUA 1NK5A 1IBKJ 4B3TF 2IAJA 4E0DA 2ZH2A 4YY3F 4L3KA 1OMSA 5IM0B 2QV6A 1VQLS 1LXJA 3MAHA 4DUTA 3UD3P 4O44A 3KXDA 3S8SA 3TZWA 5M2PA 3UN2A 2P9CA 3ISND 3TZXA 3UDEA 2R42A 4FBUA 2E1PA 1WOOA 2HFSA 4FF1A 4A8YA 3TA1A 4CI0B 2WVCA 4FKYA 1KSPA 3P8BB 2YXLA 4DF4A 3Q8VA 4K4SA 3OVSA 4PR6A 2MKIA 3SZ2A 3H8YA 3EMTA 1SV5B 4AXIA 4ZCKA 1S57A 3DI6B 5ETOA 2J8AA 2AJ4A 2GVZB 1BLUA 2RH3A 1B0TA 2G2OA 5KFNA 3FFIA 1CJTB 1D8YA 2RQ4A 2FJBB 3QPIA 3K5MA 2YX1A 3OD2A 4LF4F 2V4QA 2E7XA 3MEGA 1HBMB 1FE0A 1JLCA 4NXMF 5IQ6A 1U25A 4LF5F 1FWLA 1TV6A 4NYPA 2QT7A 2MSTA 4U8VA 2PIIA 4O0NA 5J2MA 1S9GA 3Q2SC 1UEUA 5DLGA 4TQRA 3Q8UA 2PEHA 4UUWA 4DUZF 2HFZA 1X5OA 4JI7F 4FN5A 3DKDA 2DRDA 2YKAA 2AU0A 1IKYB 3TAMB 2P9GA 2CJ9A 5CD4A 4U7UK 1UVJA 1FO1A 1WC5A 2CDRB 4U9RA 5FLXU 1NM2A 5F3ZA 2BJ9A 2LYVA 2LMIA 3JAMY 3IA0A 4DV4F 3TUJC 3SSRA 2AZ3A 4B17A 2HZVA 2VA3A 4NLRA 1R6YA 4Y65A 5U47A 4OZ3A 1TR0A 4RW4B 3GV7B 4OX9F 3OHAA 1Y5IB 4Y2MA 2K3KA 4K2XA 2RUGA 4I2PA 2AJ0A 2V8HA 1JLQB 3M9MB 2WZ1A 3RBXA 2BE9B 2ZFHA 3H7HB 1JX4A 5FDLB 5A76A 4JYAJ 1Y0HA 3P6YC 1D0EA 2BM1A 3ZTRA 3N0VA 3RB0A 1Y4ZB 4ECZA 2KKHA 3QJLA 1FHTA 3I4PA 3ET6A 4L3NA 3T9NA 1UZHA 4OHZA 4ZLNA 4TLQA 3OL7A 2MZ1A 3KJVB 3E2EA 4IKAA 4EZ6A 2CJXB 4DV3F 1D9FA 2YY3A 2F8EX 5K8MA 4WE1A 3LWLA 1X7VA 2XY5A 3GIIA 2YWHA 1S1UB 1X0FA 2DRBA 2AGPA 2FJEB 2ZVSA 2YWKA 3UDLA 3R8YA 3CO9A 3KK1B 2F5GA 2MQNA 3GJTB 3ENQA 1CC7A 1YRXA 3PYEA 2HAIA 4RW7A 3A8EA 1PBAA 2V67A 2ZM6F 4NCGB 3J7AN 4NI2B 2RJZA 3TEHB 1Y9OA 1UVIA 2OPRB 2FY8A 4ZOSA 4M5IA 3OVBA 3KLFA 1U1KA 3ZXWA 1YBTA 5ETSA 4LRFA 2HBZB 3R97A 2YKMA 2MQLA 1TKTA 4UZCA 2HGMA 5KAKA 3G8TA 2C3PA 4C3KA 1R0BG 1N34J 1TKZB 2DGQA 2E5HA 1ZTTA 3QO9B 5GVQA 3G6YA 4BLGA 3BR8A 2FJDB 4OJ1A 2KRRA 2MKSA 3I0SB 4TU9A 2LVWA 5A8RB 1U24A 1X4DA 4H54A 1RTDA 3NWRA 1RHKB 5CYQB 4ZPCA 2DYAA 1WF2A 1FKAF 1BQMA 4USUA 3T3FA 1NH8A 1FEEA 4DFMA 4KBIA 1CJUB 3J80U 3VZHA 5K8PA 3MHYA 4ICLB 3MI7X 2DNZA 3PO5A 4USWA 3BDPA 3O6QA 3FCHA 4BBYA 1IVZA 2OPSA 2LECA 2XO6A 2VD3A 4KGMA 4ZP9A 3TWZA 1H72C 1NHKL 3OFEA 3EDQB 3HT3A 3M8QB 4ITSA 5I3QA 4GO5X 3VGUA 3NGSA 2XHWA 2Q79A 2F7VA 4NRTA 1G2EA 2L3MA 4OYPA 5GAGU 4R5PA 4ZS6A 5ETLA 2RUSA 1YZ7A 3PEHA 3GU0A 5F9LA 3QLHA 3W5YA 3AJ1A 1U6BA 4K0KF 3GCXP 2LA6A 1RTIB 1UVLA 2PA3A 4WTYA 3NWGA 4CO3A 4MTPA 4TY8A 5KTQA 3D2WA 1VQPS 3CIZA 3CO0P 3K59A 3QRPA 1P27B 2ZH1A 2YQ0A 4C97A 1FFGB 1ZPVA 3P49B 1VQ8S 1RT4A 2BXJA 4GKJF 1GFWB 1B64A 3HDSA 1KVJA 3QMQA 1K0VA 1YJ9S 3EM1A 1UW4A 2MZQA 2FB0A 4DR3F 1NAQA 1ZM4A 2E5IA 3KKFA 3FBEA 4UTGA 3EJMA 1Q8LA 4WP3A 1HI1A 3F73A 2R3VA 3HLUA 2V4JB 5JXSA 2JC1A 4IQMA 3D6FB 3CJKA 2B6AA 5L1KA 4FXVA 5IC4B 1O5JA 1RSCA 3K8WA 4OLOA 2CJYB 4BWJA 1DLOB 1N32F 3SI8A 5EWGA 5EUHA 2XCPA 5KT3A 3IGNA 3QRRA 2CQCA 2Z8QA 1HNXJ 3T5LA 1M1KT 4DZ6A 2VV5A 2EG2A 3W2VB 1NUEA 1FRXA 3DMJA 3TI0A 1LW2A 1S12A 1EETB 4RNOA 2A2DA 3HJVA 4Y6IA 2OFGX 5LMNF 4Y00A 4NLPA 1KQSR 1REGX 2KN4A 4C8KA 1N0VC 2XYHB 2NUUG 3HVAA 2VBXA 3LP1A 2GMHA 3MFHA 4CTAB 1TQLA 6AT1B 1JLAB 3MMBA 4ATNA 2V8VA 4NMXA 3BB5A 3A8KA 4YOEA 2IM3A 2PT0A 3F0NA 2MB0B 2AX1A 1RHUB 4K50A 1VC5A 3CDEA 1VQ4S 4CQ1A 2AD9A 1UVKA 3SSQA 2VQEJ 1N5YA 2ZBPA 1YI2S 4DMZA 5E33A 2YKQA 3M8PA 5B0DA 3PJWA 4DPWA 5E0OA 2G0CA 1B7YB 1PJ5A 4NOHA 3V5RA 4ZP7A 4DL6A 3GFYA 1Y3JA 1KDNA 3CD0A 5L8RC 3UQSA 4JI2J 2CPXA 2M52A 3KDNA 4OJHA 3QATA 3W7BA 5KFPA 3T19A 2KT2A 1MU2B 4NL5A 4DV7J 1X4GA 3PRBA 2QJ3A 3D66A 2FTRA 1QUVA 2NXJA 4DSEA 2NYHA 3ENWA 1VRUA 2V2QA 4KHPJ 3CJTA 2ZE2A 3CW2C 3CT9A 2DNLA 4ENOA 2YKNA 3DRRB 5HL7Q 3HHNB 5IV4A 1KD1T 2WVEA 1HI0P 2D3UA 2COLA 4AXJA 1VMBA 4MFBB 5BXIA 4DR4J 5A0YB 3SCLE 4P2FA 2UUTA 3HHLA 1PGZA 2KH9A 1VQKS 3T6BA 3ADAC 1XC9A 4G1PA 1WHVA 2XI3A 4O3QA 3R7SB 3A4TA 4R8UA 1T94A 1ZPWX 1FRMA 4RR5A 3KLGB 3OTOF 1KC8T 1MMLA 3ISZA 4QJVA 2WCXA 2ZITA 3AXKA 1GEHA 3M1VB 2ZC3A 1IJEB 3CJQA 2B4OA 2B43A 3G6VA 4Y2IA 2CQ0A 1Q8IA 2IM1A 3SQGB 3MR6A 3HXMA 5KFHA 2KB2A 3MTJA 3IG1A 3DRSB 1NEEA 1ZTWA 2XMJA 3MMAA 4USJC 4NLUA 4DSIA 1T05A 4RO0A 3R5JB 2LU1A 3VAMA 5LOQA 4X4UA 1AZSB 4WIIA 1T11A 2X51A 4OV6A 2XLIA 4B3MF 1S10A 2HRTA 4ECSA 3C6TB 2GMLA 4FYYB 2W9BA 2QL5B 2OI2A 3CCJS 3KLHA 3AQOA 5K5MA 2HIYA 3H98A 2HNZB 3MGJA 3BKTA 1NDLA 4WWSA 3EPGA 4IFYB 3ILIA 4QBUA 2CPZA 4MKVA 2WVDA 2BJ1A 3ZZZA 1TAUA 3MR7A 3HSZA 1YJUA 4DV6F 1QM9A 3A12A 2LQBA 2AF6A 1FVSA 1RHMB 3ZTOA 1FKOB 2IVFB 1B99A 1VR6A 1WG1A 2VBZA 3PCOB 3OLBA 5H9EJ 2MQPA 5AT1B 1D1UA 2GGPA 3NKYA 2ZOMA 3OR1B 1WORA 4G1QB 3GLJA 3ETMA 3BGRB 1DQ8A 4GMKA 1WF0A 2JEIA 1AUSL 2RDDA 1UWBA 2ZOGA 3A1YG 2K06A 5J2NA 3NP5A 4OHWA 2OD4A 3DOLA 3HSJA 4OLPA 2DR6A 4B3TJ 4YY3J 1VC0A 1X9SA 1C1CA 3WHIA 1HMVA 3W8GA 4K4UA 3Q8PB 1HD1A 3QSIA 4QQBA 1F6TA 1Q8BA 1U0HA 3BJYA 2NR0A 3VHQA 2EWHA 3MAAA 1B4SA 3CC2S 5C24B 4JI0J 3BREA 4C7QA 2W8LA 3W9HA 4L72B 3KNGA 2RS8A 2YNFA 2X3GA 5L38A 4P72A 3CSKA 4M5JA 1C4AA 1LW0B 3GSIA 3G86A 2EG1A 4ZVEA 2E1MC 2GA7A 5HI7A 1RXOB 1FNOA 1KKHA 2BKOA 3MR3A 1T9UA 2EFOA 5L9XA 4EI2A 1SJ3P 2X1BA 2I5JA 4DL2A 4RX6A 1GQEA 1WJ9A 5A2QU 2HNYB 4A48A 4O4GB 3D3CJ 1WG4A 2AZ1A 5MAOA 2HRYA 1JLFA 4WP9A 4NXMJ 2R7OA 1EB0A 4RLEA 4MJKA 4N56A 2RILA 2ASYA 1FT8A 4FF4A 3KLEA 2IVYA 2P6TA 2IM2A 3EYZA 2Y8YA 3HVTA 2HNDA 4DQRA 1FDBA 3AHPA 2VFVA 1TTHB 3KG0A 2HW3A 2PFDA 1GX5A 4P75A 1RKJA 3BSNA 1JJHA 2VZ9A 2UVWA 2R2UA 4TYBA 4IG0B 4M5MA 3G2XA 3BYPA 3MECB 1RT3A 5CCMA 4DV4J 5A8KB 2QMWA 4OV1A 1OWXA 2M8DB 1ZBTA 3MM8A 2UUWA 3EVMA 3PTWA 1Q53A 1Y5NB 4B3RJ 3GV5B 1F3FA 1RT7B 3LP2B 4OX9J 3Q23A 5SZTA 4ZPWR 2D69A 1HARA 2E5JA 3M30A 1A9NB 1DFDA 1T95A 2M0GB 2DNHA 2NZ4A 2FPHX 4DV0F 3F44A 4F25A 1NCLA 1PSDA 3CCZA 4J9KA 3C46A 4C11B 3OTBA 2HVIA 2UUCF 4Q2MA 1S97A 2EC2A 3EZOA 3G9CA 1W26A 1OSCA 4LJMA 1SVDA 1RDRA 3OSNA 2RU3A 1PJ6A 3IWLA 4DV3J 2PMHA 4CIOA 2UU9F 4RW8B 1FWKA 4NA1A 3MOJB 4WTOB 1NPPA 3CJ3A 4M63A 4LMZA 2FLOA 1SV5A 1S0OA 4PXCA 2HURA 3DI6A 4B9NA 1NB7A 1WTBA 2GVZA 2D74B 3B4MA 1FJGF 3AOCA 2UXDF 1NHVA 1RAGB 3MXHP 1CJTA 1JLEB 3UCGA 3L95X 1SC1B 5HSPA 2ZM6J 4WFAQ 4KGZB 3R1LA 2ROGA 3KHRA 2DNOA 1RUSA 1N48A 3VF0B 2IA6A 4JV2A 2OPQB 1QE1B 1MROB 1XNRF 2ZWOA 1CBKA 2KFYA 1GTHA 1RLCL 1NH7A 3K2YA 3TR5A 3GYNA 3CULA 3K89A 1RADB 5DDRC 3GWCA 1T9VA 2PFFB 3B6BA 1TK5A 2AYEA 2YNIB 4YP3A 1AYEA 3PW5A 2AJ2A 1IKYA 3TAMA 1EKRA 2C22A 2GIRA 2BW2A 4ETXA 1RE1B 3G82B 3N9UC 4F4YA 1HYSB 2R7UA 4DFJA 1XERA 1FF2A 2W9CB 2AEFA 5E41A 3L4BC 1U2CA 2KTQA 2H4WB 2PSZA 3G87A 3THPA 3GTYX 4M5NA 2QFIA 1H0HB 2VPXB 2FZGB 5D4NA 4LSNB 1UZDA 4RW4A 5DM6Q 2UP1A 2EEYA 1EHWA 4IR9A 1BWVA 2XY6A 4CWBA 5F8NA 3EZUA 1WC6A 2CZVC 2MQMA 5G0RB 4J91A 3SDEB 2R8GA 3MCNA 2CG8A 2A3JA 3JSBA 2WTFA 1VBXA 3J7YU 3PEJA 2AW0A 5B08A 5EX0A 2Q3PA 5FDLA 1H2TZ 2AV5A 1R27B 2CQ1A 2HZCA 4DFKA 2E1RA 3G4SS 2EBGA 3FK4A 4D3GA 2C2RA 4GVLA 4ECTA 3QWPA 4DL3A 3KJVA 3OUYB 2CFXA 3DLBA 3MEKA 2E1AA 4USMA 3D68A 3SXLA 1X4AA 2R2RA 1LOUA 4WK3A 3HHLC 4WU3A 5H9FJ 1S1UA 2WB1D 3ELHA 3FJ2A 1VOMA 3U02A 4PUOB 2ZZTA 2HHHJ 3MUVP 2EK6A 3KK1A 2PE8A 5EWEA 4GKJJ 4ZP8A 3NMRA 1B0PA 3C16A 4X84A 2XY7A 2E9RX 1WSVA 3FQKA 4AFFA 1UJ4A 3V6HA 1LK5A 3QIPA 2DY9A 3T5HA 3AD7C 4NCGA 4ILMA 4F3MA 2OPRA 1F60B 2J0XA 4I7FB 1ELOA 3TQEA 1S1TB 3RAQA 3TX0A 4KH1B 2CWXA 2XNRA 4Y2CA 3Q8SB 5E3PA 1TKZA 3FRYA 2Y1RI 1SI9A 2J76E 3QO9A 4DSFA 3DLLQ 3MEDB 1UFWA 3I0SA 1QAXA 5A8RA 4URSA 5ETNA 4DG1B 5GMKa 4WCEQ 1WELA 1RJJA 4DL5A 4RBUA 4RU2A 4M5KA 2ROEA 2J6TA 1LWFB 3NMAA 2JJ4D 3DLEB 4F50A 4C8YA 1SL2A 3H20A 3GFXA 1XMQF 4A8QA 1FDNA 3KUGA 1CJUA 1FRJA 1RU1A 2CPYA 1WC1A 4PG8A 3R5DA 1U09A 5LMNJ 4DS5A 2GQ2A 4ED7A 3LTOA 3K57A 4X66J 4CLZA 2ACYA 1UP1A 4NEZA 5J1EA 1M5HA 1URNA 4Z7YA 4OMFG 3J81j 2W7OA 2KJWA 3M8QA 1Y00A 2IMOA 4FF2A 2JC0A 3ETOA 1EARA 3UI3A 2GAGC 3LGNA 3WIUA 4OX8A 3PM9A 4IO9Q 1FESA 2YNHB 1K44A 3FEZA 3PKMA 1DZ5A 2RMLA 5HATA 2K2PA 1TMJA 2CNKB 4Q0BB 1IBCB 4O44B 5KFRA 3AXMA 4W92B 4QZVB 1JNZB 5DLFA 1RTIA 5IZHA 4B9VA 5C25B 4NLYA 5DZ7A 3DU5A 3UR0A 4LRBA 2VJVA 3EVWA 4JI8F 4DSLA 1UETA 2NXEA 3KJQB 4ZPVR 4FP9A 2L08A 2WB4A 4RNNA 3NOCA 2GHPA 3CB4A 1D09B 1FJCA 1VLYA 5AJ3F 4RWWA 1TP7A 3AB2B 4X62F 2VB6A 2DPJA 2CQPA 4NCAA 2MHNA 4PWUA 3LANA 1Q1KA 5KG2A 4LF9F 5A6PA 4MIWA 2JFDA 5DZ6A 3SCKE 2D1CA 3Q8RB 2XB2D 4A46A 3D4JA 4I6AA 4KPCA 4LRCA 4LBHA 2V4JA 2HPUA 2C2KB 2ZEJA 3R2CJ 2DNYA 3RW7A 4CO2A 1VQNS 4A8XA 2BM0A 2AMCB 2LDIA 2GQQA 4JOUA 4BC9A 3ZZTA 1JLCB 4MKYA 1HI8A 2DXEA 2OMOA 1HWUA 1EP4B 1T3OA 4DV2F 3AOAA 1YJNS 1DLOA 4FS2A 1N0UA 1HBNB 1U0SA 2CQBA 1FNMA 3BO3A 4PXBA 1VQ5S 3Q2TC 3OTOJ 2HG4A 2VFSA 3QT5A 3W2VA 1JXLA 1VIXA 3PR5B 4LIRA 1RWWB 1EETA 3G71S 4BC7A 4ELVA 3C3LA 3NCRA 1HA1A 2FZKB 4B9UA 1WTFA 4JI4F 2J5AA 3OTEA 4HH0A 1NKEA 3B78A 4X4OA 4EWTA 4CTAA 3GR0A 4W90B 4P7VA 1VBYA 2ATCB 1EJ7L 4KV8A 4RUHA 1JLAA 1LFPA 2PEBA 4KTQA 5T14A 4HTIA 1IR2A 4I2PB 2LQ9A 4C4WA 2ASLA 4DR6F 3K5PA 5D4OA 5I3PA 5J2QB 1B0VA 4P52A 3OQ2A 1FA0A 4QYZJ 3M05A 3TJ8A 2P5VA 2JNJA 1RBLA 2V2VA 1X9MA 4K7QA 3H90A 3M6VA 4QR0A 1U1RA 4DXLA 2RF2B 8RUCA 2GW8A 4WZMA 3K5LA 4OQJA 1RCXB 2X1FA 3I5AA 3B82A 2MKHA 3IS9B 2Y1LB 4DV6J 3C14B 1TK8A 1VDHA 4QPXA 2NCKL 2HQIA 4DPYA 4MK7A 4USVA 1MU2A 3MD3A 1CJVB 4USIA 2BRLA 2ZOFA 1U8SA 5K20B 2X3DA 3DN9A 3MFIA 4ZJOA 4C0BA 1FDDA 2BV3A 3OXLA 3SIPB 5E3CA 3DRRA 3CXCR 1WACA 4XPCA 2FJXA 4ILLA 1Q5VA 3VGTA 1PC5A 4ED8A 2B9XA 3GZ7A 5IOLA 5A0YA 2ZUGA 1N8RT 2HRUA 3D28A 2ZWPA 1U1QA 1Y10A 4RUCA 2FLPA 3DLGB 3CJ0A 1M5OC 1AT1B 2KZZA 2C3OA 3MWBA 4DN9A 3KLGA 3I0RB 1X5PA 2BKPA 3M6UA 3M9OB 1FNXH 3IWNC 3BKFA 2CJKA 3TARA 2KJVA 2B4VA 2O5DA 3B54A 3JAMU 3EGZA 1M5PC 4ZIVA 2C1EB 1VJQA 5F41A 4PYAA 1RISA 2RU9A 3DRSA 3FKBA 4C8NA 3OHBA 4NA3A 2KXNB 5GADU 4CLFA 4TYAA 3CTRA 3VAJA 2ADBA 2XS5A 2DY1A 3RTVA 1LKZA 4L73A 1KVIA 3IBFB 1OY9A 2VG6A 3C6TA 5DRKA 2J7UA 2W4PA 3KUEA 3J81Y 3VVUA 1MMDA 3GFZA 1R43A 4NA2A 1KNZA 3EICA 1FRKA 3FDSA 1HNVA 2RD5C 4YB5A 4CLKA 4C0OC 2E9TA 3RYLA 3RJMB 4DQQA 2HNZA 1CS4A 4EYIB 2CZ9A 3I56S 4IFYA 1HBOA 5LL6d 2PMWA 1UWAA 5L46A 3CCMS 1T3NA 4TY8B 3ILLA 2K1RB 3J7Z5 1YITS 4WZQA 2POKA 5KG6A 4DZDA 5E3RA 3M8YA 3UR3C 3M7VA 3CMQA 4ZLPA 1FKOA 1SJRA 1J5EJ 4OZ5A 3BH6B 2E5LJ 3DYAB 4CO5A 2DGSA 3OR1A 3D0GE 4G1QA 4Q45A 3BGRA 3CDAA 3CJRA 2ZZMA 2LFVA 4RJVA 4OZ2A 4G3IA 4ZHRB 2BACA 2BX6A 2DHAA 1U8WA 1Q78A 3R2DJ 2Z2MA 4IG3B 1JXVA 1NPKA 1S1XA 5MLCV 3GIJA 2VU5A 5F9NA 2CVIA 4OJGA 3TUZC 2F63A 3E01A 2UUCJ 3I6PA 2IRUA 2GJFA 2M9KA 4F4AA 2Z58B 4DQSA 4ZN1A 4ECVA 1R7IA 4C3MA 3BS9A 3CC7S 2N82B 2XI2A 4ED0A 1LWEB 4QOTA 2G2YA 3IRWP 1UA1A 4OYOA 3DRPA 3ILJA 2HYIB 5C24A 4U96A 2V9KA 3IMQJ 1OJ4A 2DR7A 2GZOA 1LW0A 4F0KA 5AXNA 3SSSA 1BXNA 3TRGA 1R8CA 3NGDA 3DMJB 3FNNA 1FJGJ 4L6V3 2UXDJ 2PGCA 1QJHA 3GIMA 5FLXY 5J1PA 4O4RA 3GR1A 3QRQA 3NS5A 2HNYA 1G7CB 4O4GA 3J7YI 3QZ7A 4NLSA 2H48B 1RT2B 2RE1A 4J9NA 4QIGA 4QIEA 1XNRJ 1RI7A 3LGMA 4LVNP 3OXFA 1VQ9S 2ZBIA 3EPIA 1MLAA 2DEJA 4DWIA 4ZPTR 4OI3A 3BGLA 1HWJA 1N5YB 4UY8T 2LLZA 3GCWP 2R7SA 2MQQA 3RW6A 3L7OA 4IG0A 3U1LA 4FVCA 2VBYA 3MECA 4KR0B 3WX4A 1S99A 2XWYA 5A8KA 4AE5A 3UCUP 1R0CB 1UVNA 2MGZB 4HL9A 4E8UA 2WHOA 5THWA 1XWLA 3BM7A 2LKZA 2LQJA 1H6KX 1W2BR 2VDIA 1RT7A 3LP2A 2A1BA 1RAHB 2C2ZB 2F8MA 2IJNA 5B7WA 4ECRA 4K4XA 1VRUB 2O66A 2IPOB 2AJQA 2YKNB 2W25A 2XMTA 4C11A 3KNAA 5E5NA 5ETVA 4EO8A 3SFUA 5KFVA 2R2SA 1ZM2A 2X7IA 4LF2A 1VLOA 2WONB 2ZHBA 4PAAA 4GRSA 2DEIA 1GMUA 1RB0A 5KFOA 2HLTA 2BANB 4X4NA 1RBOB 2YX4A 5B0GA 5LM7E 2H5IB 4IDKA 2R8JA 1EQ0A 3NNCA 2F40A 4RW8A 1HNXF 3TA2A 3I5BA 3GE9A 2BQUA 4RPFA 2QLWA 2ZJQQ 1E6YB 1U1MA 4LF8F 1RQ0A 5IQQA 3UW1A 5F0UA 1Q0NA 2WOMB 2YKOA 4ILRA 5AXKA 2RDIA 2FVPA 5IWAF 3DRYA 5CYMB 1B70B 2N3LA 4JB8B 2C2DA 2RKIA 2HQGA 1JLEA 4FVMA 3L3CA 4WKRA 3MURP 1FRHA 3OXGA 3RG6A 2HS4A 2IY5B 3LP0B 2HBRB 4BHQA 3L09A 2EVZA 2OPQA 1QE1A 1UW9A 2WSEC 1QSLA 2CYYA 3IR5B 1SQFA 3NGUA 3FQLA 1N4LA 1RU2A 5D4PA 1RAAB 2W1BA 1G4CA 4UQGA 4C3LA 3KLHB 4IH6A 3TA0A 4LR7A 2VQEF 3PYGA 3IR7B 3THTA 5C42B 2OEMA 5KOWA 3UVJB 2JL9A 4KAIA 9RUBA 3O1LA 2QMXA 3GYXB 3IO1A 2JEJA 3MM7B 2V50A 2Z57B 1XJWB 3G82A 4DLEA 1HYSA 3LQVA 1XMQJ 4I56A 4E98A 1VQSA 5HP1B 4Q5VA 2W9CA 1FI4A 1MMNA 2DJWA 4JI2F 1HQ2A 3HVRA 5KFKA 5K9FA 4JI5F 3GJQB 4ZVHA 3EX7B 2AGOA 4LSNA 3MEEB 1H38A 1RHJB 2OTLS 3FEYB 1WF1A 3O2IA 2VBWA 2B9WA 4LRAA 2MKKA 1U45A 5G0RA 4DQPA 3SDEA 2JWNA 5C7PA 3UO0A 1U2RA 4BWMA 5HBMA 3KG1A 4HVZA 1GXTA 2DGWA 4OYBA 1WKJA 2RRAA 1TL1B 1Q8KA 2DISA 4ANCA 5F8GA 2EKNA 3PRVA 3R1HA 3K17A 3OL6A 4ALZA 1K0TA 1JMTA 2FLNA 1W25A 3NL0A 2HGLA 5FJ4A 3OUYA 1FCAA 2CG4A 2UV8A 2EW9A 2XMKA 2CRLA 4I1TA 4CLTA 1JJ2R 5KFWA 1K73T 4JI8J 4KFBB 3UNGC 2HQCA 2HVDA 3UD4P 4PUOA 3MAAB 2KYZA 3VTIA 3OJSA 4RNHA 5AJ3J 5BYSA 1KLMB 4P6QA 1C2PA 1X31C 2DR9A 4PQUB 2XGQA 2RQMA 2HQ3A 3CNQP 4I6WA 1K8AT 2IHR1 4LF9J 2EC0A 5DETA 1IKXB 1KBRA 2DO4A 1FERA 4TY9A 2CAJA 4GKKF 4DSKA 3QWUA 2WW4A 3W5ZA 2BQRA 1S1TA 4URQU 2QG9B 4PPDA 2GJIA 1APSA 3RR7A 2NSCA 4P73A 2GMJA 3ZTPA 4B3SJ 1HQEB 4DV2J 3DXSX 2FGCA 1J27A 3OVAA 3KLEB 2V94A 2BE7D 4UOCA 3R7BB 1HWLA 1N52B 2HHQA 1LWFA 4Y34A 2YNGB 1O8BA 3CF5Q 3RB3A 1BHNA 1S49A 2QA4S 5HAOA 2ZD1A 2V68A 3VCDA 4KKOB 3FSIA 1H7WA 1Q7LB 1TL7B 2GHWA 4O3NA 3R5GA 5ETKA 1U1OA 1UFKA 1RT3B 4F8RA 5J2PB 4N77A 1SC6A 1ULRA 1UFLA 1FJEB 4JI4J 3QSYB 4RUAA 4WP8A 1FXDA 2VFTA 1H7XA 2OEJA 1YRTA 3ZTSA 2GCFA 4EBDA 1G3OA 2Y8WA 3M30B 4HT5A 2YNHA 4AYBD 4NZ7A 1S6PB 1BC6A 2VC0A 3D6MB 4Q0BA 1EKSA 4DR6J 3NCQA 4U7CA 1WSRA 2QLFB 1HFEL 2ZH4A 1UPMB 3M2VA 5BYRA 1RABB 1BGXT 2Z4PA 2OPPA 1JLGB 1TVRA 3DOMB 5C25A 4IOBA 4WXOA 4WFBQ 3LALA 1WKKA 3ZTQA 3R5BA 3R6LB 3BQ0A 1XR5A 4CO1A 3K5NA 4JI0F 5C5JA 4LBPA 5KFLA 3OV7A 3N6NA 2UUBJ 2UVVA 2DNRA 4C8MA 4NPOA 3DLKB 3AJDA 3W2WB 4YQWA 2W24A 4ED2A 1RT6B 3FUYA 4DU7A 5GADI 2NS1B 1I6JA 5CA5A 3K8VA 2GVDB 1Q95G 3TX8A 1ZA2B 1WD6A 3LF0A 3T5JA 3D7SB 3IC1A 1S9FA 2QL9B 1FKPB 4K4VA 2G2ZA 2BRKA 3DDKA 5HO4A 3AD9C 5A8WA 1YBUA 3UPFA 1FRLA 4YHHF 3Q8YA 1MW7A 2H3EB 4LFAF 1NXIA 1EP4A 1RTZA 2VG5A 1G1XA 2M7SA 5JMNA 2BJEA 2CPEA 3QT6A 1GTEA 1HBNA 1IM4A 2IA0A 4I6YA 3RGIA 4WYLA 2GHVC 4WF9Q 2QEXS 4QWBA 4BCAA 2F4VJ 5DDQC 2CZ4A 4DHVA 2ZH8A 3VQTA 1TUWA 3BQ1A 5KFFA 5HVGA 2G0IA 3PHEA 3CCUS 2B3TB 1MWZA 4I2QB 3JTOA 2JZ5A 3ITHA 4QR1A 2BDPA 4TVAB 4B3RF 3KOAA 5KG7A 2C3YA 4DL4A 1EZZB 4QU7A 1IXKA 5E2QA 2XZDB 2QLXA 2JRSA 3P45B 3CDUA 3MD1A 4LFCF 1MWQA 3FRZA 4WYWA 4CLUA 2OFHX 5J2QA 1PYTA 1KFSA 1RAIB 1KFDA 1I51B 4UOGA 1XEZA 1D8ZA 1R8AA 1RYRA 2KT3A 5HMYA 4V19X 5GAEI 2CJAA 4J9MA 5KOXA 2HHUA 1X9WA 1IR0A 5D0HA 3RRHA 2RF2A 3IN5A 4DPTA 3OL8A 3IS9A 3C14A 1U6FA 5KFQA 4X4PA 4ANEA 1S4EA 4J7CA 3S6EA 4HYKA 1CJVA 3MM5A 4EUVA 1RWPB 1B3TA 3TW0A 1K1QA 3C16B 1L3TA 3D6HB 2W7AA 2HWHA 4A8MP 2NUHA 2O01C 2HVHA 2ZKUA 1JLBB 2DGXA 2WK4A 3QIPB 2XYPB 5D8HB 1F9EB 3DCAA 4CYUB 5ETMA 2HS3A 5D0RA 2EK1A 1FX4A 2H54B 2E7WA 3CJSA 6FD1A 1AFIA 1CQMA 3CJ4A 1BUXA 3CDWA 3ISNC 2ZH5A 4IFVB 4KQZA 4ZJQA 4ECWA 2JLGA 2DBBA 1IQTA 1Z2LA 1Q4RA 1HPZB 2NZCA 1YWXA 4H4KA 3DLGA 2Z30B 2BE2B 2QSFA 1RACB 4G1IA 4K4YA 5LJ5Y 1HW8A 5FD1A 3I0RA 3EGWB 2IBKA 4ZK7M 3PYDA 2ZNZA 2NXNA 2BW7A 3PX0A 5L9NA 3Q86A 2Z0GA 1T9YA 4BS2A 2JSXA 3A8IA 5D15A 1R0AB 4X4RA 5KFTA 4Z2XA 2CWKA 3NEKA 3GG1A 5HANA 2MLYA 1ZAVA 4EGLA 3MOZA 5LSLA 2FGOA 4U8YA 4DQIA 3V6DB 2I6WA 3DRXA 1JIHA 3T1HF 5J1EB 3BR9A 3UN3A 1V3SA 4PXEA 3JSMB 4IR1A 3IXQA 4OI1A 1D3WA 3EUNA 2RS2A 3TANA 3N5BA 2ASDA 4DOZA 3PV8A 1T0TV 2DVIA 2FVQA 3UFCX 2PI4A 2YTCA 3WC2A 4AT1B 1M90T 2W4CA 3TVZA 2KFNA 4RBTA 1QTNB 2B7BB 4DR7J 7AT1B 1CLFA 5KG5A 3GB0A 5IFMA 3PXGa 2WW8A 2ZZNA 1X4BA 5HJYA 2K1RA 5HJXA 1EIYB 2PD1A 4B9LA 4EZ9A 3I4HX 1CJKB 3JQKA 2D9PA 4H4MB 4OIXA 1SL1A 2HHHF 1TKXB 4DX5A 3RRGA 2P2CB 4FPIA 3DYAA 3PW0A 1PJ7A 4IOCQ 1P9YA 3H2VE 2J8SA 2N4DA 5GAHU 1C1BB 2MTLA 2B56A 3EGVA 1FE4A 2XM3A 2BYCA 4ZHRA 4YEAA 1KEKA 1XMOF 5KFDA 2MZRA 4IG3A 1RCOB 1ROFA 1VGYA 1PKUA 1YJ7A 4CO0A 5F8MA 5F8JA 2JDJA 3V4IB 3X3UA 3O44A 3PVXA 2IJRA 3KLIB 5D6GA 4MKBA 3W5XA 4F4ZA 4DSJA 2B5JA 4Q44A 4K4WA 1LWEA 2DNGA 1ZA1B 3FC9A 2GJ2A 2HHWA 2CPHA 2NYIA 5C2GA 3MCOA 4CP5A 3RBDA 2EFNA 1DARA 1S1VB 4PXDA 1V9OA 1JQGA 3I31A 4YMEA 1IR1A 4RBVA 3TNVA 3HKWA 4OI4A 4LF8J 2WVFA 4PG4A 5D0GA 2KFZA 1JNRB 3O8WA 5IWAJ 4K5SA 3EVOA 4LIWA 2Y0SD 2XMVA 2Q6BA 2DHSA 2BVZA 2IDEA 2DH9A 3MPUB 3Q83A 2HWTA 4X66F 1REVB 2XS2A 1S9EB 3KDOA 1RLDA 2YX7A 1RT2A 2YQ3A 3AODA 3H5YA 2KXFA 2ABYA 4KV8B 1NK4A 2IYIA 2MY8A 4DR2F 3NLCA 4QIFA 3ZFVA 5KFAA 1K1SA 4HR2A 1N33J 3AA9A 5HQ8A 4ZP6A 4JI1F 3HSGA 3T1AA 2V5HG 4JV0A 3NBPB 1FFSB 2OUGA 4L76A 2DCUB 4NYOA 3JTPA 4WFZA 2HHPA 2R9LA 4CH7A 4PABA 4J9SA 4NLDA 5CH7B 4IUFA 2R4FA 1LQ9A 1YJTA 4TLRA 2MGZA 1L5UA 3BSOA 3UDVA 3C6UA 4JI5J 1GX6A 1RKIA 1UKUA 3IBWA 4UZBA 1IKWB 1VRTB 1DRZA 5D77A 2L9WA 5F3TA 3N4WA 1OYEA 1HL6A 2UZAA 4ZA1A 1SBRA 1XNQF 4XAKA 2G9OA 4J9UE 1S0NA 1HW9A 2DIUA 3PHTA 1TFWA 3W61A 4LREA 2Q1LA 1N6QA 2M4MA 1OPZA 4MK9A 2WONA 2GIQA 2XC9A 1F2GA 3DLJA 2ZDPA 1WEZA 3RRKA 2RNEA 2BANA 3T5KA 3W65A 3DOKB 5LSOA 3BDEA 1O51A 2AIRB 3ZZRA 1R8PA 3D0IE 1X8DA 2VF3A 2QX0A 1SCJB 5IT0A 2V4RA 1E6YA 1F3VA 2VOPA 2OGUA 2XSJB 1VQ7S 2XULA 4AL6A 3BBCA 3BZQA 1J5OB 2FHMA 3WX8A 4AUKA 3H59A 2WOMA 1BWEA 2B9EA 3GP9A 2CQ4A 5CYMA 4W4MA 4UT4A 2QSWA 2DR5A 5CABA 1C0UB 3O5TB 5AE2A 4CM0A 4UF4A 3GILA 1H2UX 2JX2A 2AYBA 2LXUA 1PYOB 2RT3A 3MCSA 3DXBA 3NAHA 3TZZA 1I1GA 1SKUB 3OBIA 2MLXA 1RT1B 1YIJS 4PCQA 4GKKJ 3LP0A 1QAJA 5F8HA 1TFYA 2L9NA 4O3OA 4KPYA 4PG5A 4ZVOB 2VG6B 2EFVA 4I69A 2DXFA 5KFMA 2NXCA 3Q24A 3MM9B 2QFJA 2EBEA 4J9VA 3QGIA 1SH3A 3UNYA 1HNVB 4RL1A 3JQJA 4ZPDA 5C42A 1CS4B 3UVJA 2QLBB 2BKNA 1HBOB 3CCQS 3I82A 3R9LA 3MM7A 2NQPA 4HI2A 1UL3A 3W63A 5HP1A 1PAUB 2F1FA 3T6JA 5KFEA 1Z4UA 3D1QA 3NS6A 3MZIA 5IT9Y 3MEEA 4RW9B 3TVKA 5HMWA 1RP5A 4MMOA 1FJ7A 5DGAA 3AY0A 5ETPA 4OYWA 2L48A 3D5MA 4TXSA 4OJ3A 3J7ZT 1WHWA 2I8EA 1T9TA 4B3OB 3MPDA 1ICEB 3KG4A 1TL1A 3AH6A 1S1XB 3ILOA 2VKZG 3C8YA 5DS7A 5LXRA 3F56A 8AT1B 4CCHA 1NSKL 2F9JA 4TKTA 4KC5A 4F2SA 3CPWR 4U7UD 1SC3B 4JUZA 2C3MA 2DNMA 3W3SA 2HQFA 1AROP 3E01B 1DY3A 1UMJA 1OQ3A 2DITA 5JVHQ 3MR5A 4HACB 2OO4A 3ZNJ1 3EWGA 4KFBA 1L3VA 4USKA 1NU4A 2M88A 1NJYA 4HDHA 4H4KC 3DRPB 3R6GB 5LMUJ 3AD8C 4ED6A 2IBOA 4ZVQB 2RSQA 3QGPA 1KLMA 7FD1A 1X5SA 4URGA 3JYTB 4RNFA 5HROB 3QGHA 1KOHA 4PQUA 4UQTA 3DM2B 1YK9A 2J9CA 2FJVA 3CC4S 4I4BA 1VFJA 4JBCA 3I9ZA 1NSPA 1VISA 1IKXA 3N6MA 3JQMA 1IWAA 1YTYA 1TAQA 1V5IB 4YFUA 1T02A 1F0XA 1GK8A 2QGFB 5DDOC 1H73A 1SJ4P 4MK8A 2RIJA 5K8OA 4DCOB 2FJWA 1UEVA 3J81U 3OPKA 2V0NA 4O3PA 5F8LA 3FMBA 1H74A 3IBCB 3HD1A 2QZ8A 2B4PA 4YHHJ 3MUTP 1JK9B 4OI2A 1T9WA 4LFAJ 1HQEA 4KO0B 3MM6B 2XEXA 1VQOS 3HD2A 3V4MA 1QLNA 2YNGA 1S79A 1KTQA 2PMZD 1F5CA 1U4BA 2ZJRQ 4QR2A 5E3QA 1RWXB 1F2HA 5D78A 4KKOA 4AQYF 1SKRA 3DNCA 2CQ2A 4JI6F 1NB2A 1TL7A 4IRDA 2ZH6A 1HNZJ 3KYLA 1VI7A 4A8WA 2APOA 5J2PA 2QN6B 2DHXA 1J5EF 2JFKA 1GXUA 1TU0B 4HKQA 5KFYA 2E5LF 2HGNA 2CQHA 1V3ZA 1RAFB 3VZIA 3HM9A 4DFPA 3LA0A 1U48A 5IV3A 4DL0C 3US5A 2XHCA 4FDFA 1S6QA 2FC8A 1NZ8A 1UAWA 3VGVA 1RTHB 4J5OA 2DPIA 3EGNA 2CVEA 3VALA 5DQIA 2R7RA 1ZAXA 5E7OB 3HT0A 4OL8A 3IRXB 1S6PA 2HSEB 3HKZD 4LFCJ 3RBZA 1TMMA 2L41A 3OW2R 2Z2ZA 4DN0A 4PWWA 2JLFA 2YWWA 2Q6CA 1JLGA 2MKCA 3DOMA 1N5VA 2HLUA 1R8HA 2M5YA 5I42B 1OY6A 4QIVA 2R7XA 5L1JA 2DTJA 4IDKB 4U67Q 5HMXA 4CNZA 5HN0A 5DG7A 5CYJA 2Y1JA 2IYGA 3UE2A 3EXCX 2VJUA 1NJZA 3VR1A 3MMJA 2HMIA 5I4MA 1TL3B 2U1AA 3DLKA 4HT7A 3W2WA 3UDCA 1RT6A 1YRUA 1N5TA 1M5SA 2GVDA 2RKIB 3QBCA 1MN9A 1NJWA 2Q43A 1FKPA 4P71A 3N01A 3BSCA 2FVRA 4YUDA 4TNOA 5GAGI 4Y3CA 3VAIA 4CH1A 1SJ1A 2P8IA 2Z56B 3M32B 3POTA 3C66A 3M8SA 2DGVA 1YHQS 4Y0FA 2C3UA 2GO9A 2YWGA 4F2RA 5B0CA 1LEOA 2CJBA 1DTQB 3GSDA 3H2LA 3IAS9 2XS7A 3TAPA 2YH0A 2W2QP 1T8EA 2KYXA 3OFHA 2GS8A 1E6VB 3CD5A 2OJ3A 3DHWC 4EU0A 4EMDA 3AAWB 1WG5A 3QAEA 1VK3A 5GAHI 3W9IA 4DCPB 4LBIA 4PG6A 1KQKA 2RB7A 4I2QA 1WEYA 2WSFC 3B4DA 3QAUA 3U7JA 2R7TA 5EWFA 4LRDA 1EX8A 1T9XA 2M8HA 2PN6A 2C28A 4ELUA 3LO3A 2EI5A 3SCIE 3T1HJ 3SMZA 2FHJD 3QFWA 3ZNUA 5HBMB 3TJ9A 3CJ8A 1I3OB 1ZZFA 2M2BA 2QA2A 1GT8A 2C2MB 1HHTP 1S6UA 1KHWA 2B9YA 2RHSB 1NBEB 1GMWD 2AEJA 3P3DA 2VA2A 1SPBP 1ZOTA 1LWCB 4CLSA 2CJQA 2EPIA 2HIQA 3TAQA 3HF5A 4OZ0A 1YJRA 1NO8A 1MWYA 1RA6A 2BABA 2R7VA 2R8HA 2GX8A 3GFHA 3ZZOA 2VASA 3HZGA 2VUGA 4IRCA 3V81A 2H51B 2KM8B 2MJNA 4M5HA 4C8LA 3KUHA 8ATCB 3PJ9A 3B8HA 4BDPA 1XMOJ 4MIBA 1JLBA 5HQMA 4FYXB 4CYUA 4M8LA 2FVSA 2IJFA 3VAFA 4CO4A 2BZ2A 2VFUA 5IS2A 4CLLA 2MYFA 4WXWA 5KG1A 4IFVA 4MYUA 3VWSA 4PQAA 3R7NB 3UN5A 1HPZA 2G13A 4X64F 2FC9A 2BE2A 3RU0A 1NJXA 4YB1P 2JOQA 4WFNQ 1H3DA 3G6XA 5L1IA 2J6SA 2JHEA 2OD6A 1ITPA 5AXLA 4J9RA 3P5TL 4WJBA 4UOFA 2XLKA 1RBAA 1W2IA 1V3RA 2A0FB 1HQUB 2ZD1B 1R0AA 4ZLJA 1Q82T 2K7KA 1P1TA 4MH8A 4IH7A 5CZVA 1S1WB 3K5OA 4ZVFA 1XMBA 1IN0A 1RHRB 2D9OA 4ID5B 3HI9A 2XMAA 1FX2A 1VC6A 2VL1A 4EBEA 5AE3A 2HFUA 3V6DA 2UXBF 4LVOP 3ONQA 1FTCA 4DF8A 4PWDA 2XZWA 4FF3A 1LXNA 5IXUA 4CZCA 4YB7A 2Z2YB 3CVKA 2W7PA 3JSMA 4ZVSB 4EK2A 3TP2A 1TKDA 2RAQA 3VQSA 2ZC4A 3OFGA 4I64A 5KFBA 4DR2J 2LCWA 3OLAA 2ZHOA 1IKVB 4HHHA 4FPRA 4C0HA 3KK3B 4ER8A 1T03B 3SYZA 3H5XA 1U26A 1RWKB 4U95A 1TL5A 2XZTB 2VQFF 1YBAA 4JI1J 1RGVA 4LR8A 3M2VB 1WDDA 3R27A 1LK7A 3DFEA 2OPPB 1TVRB 4D3HA 2QTWA 1R3NA 2XGPA 4F3OA 4ECUA 4J90A 2HZAA 4B9SA 1SJFA 1HHQA 2LA4A 5H9EK 1QVFR 1CJKA 1P9QC 4H4MA 2LEBA 2DIVA 1TKXA 2FD2A 3LPYA 4YR3A 4RNMA 3D6TB 3RAXA 4XK8C 3PDNA 1BQNA 1KQFB 2A2CA 1C1BA 2PO4A 1KS2A 1UTAA 2HBQB 2WVBA 1C4CA 4XDDA 3PW7A 4YDDB 4DPUA 4LF6F 4XIUA 1XK8A 5L39A 2ZBCA 2D3OR 3BBFA 4TN2A 5EHHA 1U47A 1XNQJ 2YQ1A 4OYAA 3V4IA 2LXIA 4JI3F 2OH2A 1OY8A 1O0PA 3KLIA 4XO0A 3AOBA 4B9TA 1YGYA 4JV1A 4Z7CA 1Z1ZA 3OR2B 4YS2A 5A8WB 4C6AA 2CNLB 4K4ZA 1RWMB 4B3SF 3R5CA 4KYZA 4UY85 3DGPB 2J9DA 2VG5B 4QWDA 5ADZA 2LDYA 2HHSA 2KZMA 1F5AA 4ZVRB 1S1VA 1ACMB 3KTQA 4DX6A 3EDRB 3C15A 4P2XA 3BGOP 1VK8A 2F65A 4RZRA 1AW0A 4J9QA 2O3DA 1CQNA 4ZITA 1REVA 1EAYC 1S9EA 4J37A 3ITHB 4NMLA 1NJIT 4P74A 3DHXA 2I2YA 2KG1A 2D7SA 2HWIA 4DLGA 3AB4B 3BEGB 2DT9A 5CAAA 2CPDA 3FCWA 3CGIA 4HH1A 3OTCA 2CQIA 4KY3A 1UJ5A 1ZM3A 5HLFA 4F0HA 3MMCB 3M2UB 1WOSA 2ROPA 3A3NB 1RAJA 1PYSB 3PG9A 2CADA 1SXLA 3U27A 3NBPA 2H1YA 3HSDA 3OSPA 2IMWP 2CNNB 5LT5A 3H42A 2HFVA 4N5SA 4GC6A 6FDRA 3W8PA 2CQ3A 3FVYA 3SBMA 2ALZA 2PDAA 1SIZA 1ZS6A 2B0GA 3QFHA 4K5RA 3H4BA 2UUBF 1HKAA 2OIHA 1IBLF 1IKWA 1YSJA 1VRTA 1FDAA 1DQ9A 3I55S 1FD8A 5CCLA 4R0EA 2MPUA 4NLQA 3HHKA 3MM5B 3L7PA 4CLYA 3HULA 2KU7A 2XMWA 2IVMA 3PR4A 3TYTA 3Q0AA 4OHVA 3T41A 5D3GB 2N7CA 4HTJA 4ZLLA 4YR0A 2A18A 4LSLB 3PIOQ 2R7QA 4C8OA 3H0PA 2UVUA 2VOOA 4NEYA 2LXFA 1TUVA 4OZ1A 2XBPA 4FZVA 4LQ9A 3BN4A 3DOKA 3RZAA 2ZKTA 2A6OA 1CG2A 2HBYB 1DQAA 3M6WA 1SJQA 2CXEA 4KH0B 2VFRA 5D0EA 2XSJA 4DPXA 1WNEA 1WKLA 1J5OA 1MNEA 5EN1A 3EZ5A 4AD6A 4TQSA 2F4VF 3LOUA 2HK2A 4NASA 3OFFA 1C0UA 1C0TA 3V6KA 2BJ8A 3F41A 3LAMA 1HD0A 4GVBB 1RWOB 5CQGA 1RT1A 4F7VA 4MYTA 1RWUA 1KQGB 2E66A 4OYIA 3ZZPA 1WC0A 3MTKA 1PC4A 3T9ZA 1NPRA 3TJAA 4NXNF 1AA1B 2GV1A 3J7A1 2BMBA 1U1PA 1WHXA 4DS4A 4ZMMA 1DTTB 3JS9A 4PYDA 3MM9A 3OTDA 2HAFA 4M5DB 1PIEA 2H9ZA 5IC6B 3D1HA 2RRBA 4P10A 1YG0A 2CA9A 3AJ2A 2HVZA 4ED4A 4ECQA 3N5FA 4OZJA 3S7RA 2F4FA 4ZVUB 3SFGA 3PNIA 4R25A 4X4QA 3QT7A 4JP8A 4PZVA 4AQYJ 5HVHA 5F8IA 2FHOB 5KFUA 1NSAA 4JI6J 4PG7A 4XTTA 4F04B 4QW8A 2WBRA 2WBMA 4YN3B 3HHEA 5KG0A 1S76D 2QYGA 2J9EA 4RW9A 4NZ0A 2HK3A 2GAHC 2ALYB 1FK9B 1YJVA 4B02A 2ZH9A 3HP6A 4DJBA 1PILA 1JJCB 4X65F 2RVJA 4DUYF 2E7VA 4DCJB 1NMEB 1SUQB 3KFWX 2XLJA 4CM2A 4B3OA 3WC0A 4L75A 1SL0A 2W2NP 4OI6A 1MG7A 7FDRA 2MJUA 2IRXA 1P6TA 4ID8A 3KHHA 2CUYA 3HK2A 4KSEB 1S4FA 2IRYA 2BUNA 1QY7A 3L7UA 2WRMA 4EO6A 5H9FK 1CVJA 4ZDNA 1S59A 2YWEA 4ZCIA 4A47A 5E3AA 2B8PA 1VJWA 1KHVA 4OI0A 1LWXA 4LF4J 1FEHA 4HACA 4FBTA 1HBUA 2MKYA 2B5JB 1HWIA 2QE5A 2YVSA 1NK9A 4LF5J 1P8GA 2NREA 3IAM9 2XG8A 3CJ5A 1WHYA 3NNHA 4OYMA 5BJRA 2K3IA 2BJ7A 1VHIA 3JYTA 4DUZJ 4JI7J 2IIHA 5HROA 1F9HA 2W2PP 3DM2A 3G8SA 2IC3B 2GC8A 4CLPA 1SH0A 3LH2S 4FYDA 3NGTA 1VQ6S 3HHLD 4DX8H 3VVTA 2DNQA 1VQMS 2ZVIA 2N4CA 4ECXA 2AWZA 4F0MA 3KJFB 2CIMA 3KMSA 3TUIC 4C2MA 2QYCA 4IYQA 2VPYB 5BR8F 1Z2ZA 3RAMA 3I5CA 4KGVB 1SQGA 4KO0A 3MM6A 1YZ6A 5LSRA 2Q66A 1HNWF 4LF7F 1GMVA 2AKWB 4X4SA 4P2MA 2ZJPQ 1AUDA 5IM0A 4DR7F 1IJFB 1PO6A 1DJ0A 4Y28C 3MR2A 1NK8A 2ZBRA 4N47A 1RT5B 2YH1A 2QL7B 4M95A 2DRAA 2ZHAA 3CMAS 4KIAA 4F36A 1HNIB 3KJNB 3LW5C 4LSZB 4UOHA 3C6UB 3BH7B 1VBZA 3P5BP 4NLOA 4TU7A 2UVRA 4I0WA 4AL7A 5KFIA 1D9AA 3KHLA 4J9PA 1GH8A 2BA9A 2QA4G 5JJBA 4P2SA 3CJ2A 3HFZB 1RTHA 3Q8QB 1N36F 5KFSA 3GV8B 1Q5YA 5B0FA 2H65B 4N76A 2NPFA 3IRXA 3KK2B 3CIMA 2BBEA 2GFFA 1FXRA 2HQDA 2LEPA 3IWXA 3PRDA 1N6QB 1F1BB 4ES2A 3HO1A 1HBMA 5I42A 2N3OA 1VBKA 1XTZA 4RW6B 2ZUAA 5HMZA 3SV3A 1N88A 3M6XA 4NCBA 1N54B 4NX9A 4ANDA 1F5BA 1CULB 5HVFA 5H1SV 1R89A 4CNYA 2DGUA 3X1LB 4PPZA 1D9DA 2A6MA 3CCWA 3H2UB 3HJFA 1TL3A 2V9WA 4FNHA 1DURA 3CCLS 1N56A 2H5EA 5KT2A 5T7LB 2UV8G 3IFEA 1IQZA 1VYAA 4QPTA 2E44A 3GIKA 3JSYA 4K8RA 2V34A 3KMQA 3D54A 3LPEA 2DNPA 5K14B 2R2TA 2BR0A 2DH7A 4YB6A 5DO2A 3S1TA 3J80Y 2QLJB 2VPZB 4H4OB 1RZMA 4ERDA 2BJ3A 4FXDA 2IFXA 2V6AA 3C2PA 3M32A 3TOQA 4LFBF 1DBDA 2HS0A 4X64J 2KXHA 2J0SD 1JLQA 1Q81T 2HHXA 2J7KA 3FCVA 4LUBA 1N33F 1M1GA 3NGKA 2KG0A 2OTJS 2XMUA 2QO3A 1UPPA 3C19A 1DTQA 4HEA9 4ZVGA 2AYMA 2GQCA 3OT9A 2G0JA 1JB0C 4IQXA 3PW4A 2V8GA 1WC3A 3W9JA 1KLNA 4WIQA 3PACA 1E6VA 1K9MT 5I3UB 2FYXA 2ERRA 5EGYA 4DR5F 4K0KJ 4N8OA 3A3PB 3VGSA 3NCPA 3M8ZA 3G6ES 3H4DA 5M2UA 2XSFA 1YDLA 2W9AA 2UXBJ 1Y5LB 1HR0F 1RTJB 2D3ZA 4O23A 3DU6A 4IO1A 2FIUA 2VG7B 3PFEA 4OHYA 5T41A 1S72S 4Q43A 4QYZK 4S0MA 1S48A 3IM9A 2KVIA 2HVEA 2Z2LA 2QMUB 2XTJP 1IBMF 1RA7A 4NI2A 4DR3J 1RWVB 2DNKA 2W2MP 1L3SA 1HHSA 2DH8A 3SV4A 2VQFJ 2OKQA 3KWMA 1LWCA 4QWCA 5KFXA 1WI6A 2OHDA 3QGGA 2H5JB 4Z37A 1YKWA 4EBCA 2E1CA 1A0OB 5KFCA 3N6LA 1BY9A 3AQPA 1NSQA 4Q7AA 2UXCF 2NLWA 2D41A 1QSSA 1MSWD 4FKXA 5KT4A 4X4TA 3U1NA 3D3BJ 1N32J 2FLLA 1S77D 3CUNA 2AGQA 4QW9A 1F9FA 1UJ6A 2G4BA 4JV5F 3AA8A 2B4UA 1RWNB 5CYQA 4KE5A 5LXYA 3R3TA 2MKJA 2B8QA 4DDFA 5C2CA 3U1MA 1S7IA 4LF6J 4ICLA 2EFGA 2KT5A 5KFZA 5B09A 2F8HA 2O1PA 1OO0B 4OFZA 2ASJA 1SKWA 2H4YB 4YDXA 4FYWB 4N7TA 1WDTA 4V19J 4JI3J 5F0WA 1R6VA 2W4DA 3WBZA 3I32A 5KT7A 5GMEA 1NNDA 1GNKA 3M2RB 2HHTA 2MSSA 3EE3A 4WFYA 2AX0A 1Q86T 3KLVA 2MQ8A 3W60A 2JVOA 4Y2KA 1JKHB 3SQOP 1X4HA 2IAJB 2AHOB 2K8GA 5EDWA 2Y9HA 2M3DA 1HQUA 1FRIA 4NLVA 1UEKA 2J7WA 2N7YA 4C8ZA 4K4TA 3I9V9 1Q16B 4LQ3A 4RWXA 1X5TA 1S1WA 2NSBA 5IT9U 3PYFA 2OAUA 2DCLA 4K59A 3FZ2A 4DV5F 4ID5A 3T1YF 5G4DA 2JEGA 4DV1F 2WSCC 3BYRA 1QAIA 4CT8A 2DO0A 5HK4A 1XBWA 5BYQA 3PKYA 1S6QB 2OP5A 4YR2A 1KVKA 2GO8A 3G96A 2JH3A 2I1RA 1IKVA 2VKRA 2HHVA 3FGVA 1QTMA 3OL9A 3KK3A 4G65A 1T03A 3FFIB 3BO4A 3M8WA 1DHMA 5ETQA 3DC2A 1SB6A 2OSQA 3ICLA 2PI5A 3QZ8A 4N8NA 4ED1A 4G6VB 1I94F 2KL8A 3FBFA 3GG0A 3MEGB 1M0SA 2DGOA 2MEWA 1ZETA 1U02A 3K7RA 4W98A 4V1Ak 1TV6B 1V6HA 5LMUF 2RRNA 2V69A 5J2MB 1S9GB 4EFAC 2RQCA 1JXEA 2W8KA 3HHDA 3CCES 2VHGA 1IBLJ 4FXWA 3LWMA 3CCVS 2HMIB 3GMGA 5D4LA 3LGHA 4P7TA 2YPZA 2MXYA 3BGUA 2CPJA 3CD6S 4J9LA 3IP0A 4USTA 4X4VA 5DDPC 5ETTA 3WQPA 4ED3A 3PZPA 4P9SA 1HIYA 3WZ0A 4KT0C 1TK0A 4ES1A 4C98A 4DU8A 4CRJA 3BGFA 5DG8A 1Q79A 2DXDA 3BV8A 1P1LA 1NZAA 1FTRA 3AFGA 3Q22A 3GQCA 3IR6B 4DR1F 3OR2A 2MZTA 3TO8A 2DGTA 3I87A 2G1DA 4UUXA 1H2VZ 3POTB 3DGPA 5JUMA 2DHGA 4B3MJ 2UUAF 2CQGA 4GO7X 1IBKF 1NLKL 4C48A 1OS5A 3DLHA 2BOAA 4A8KA 3GJSB 1IUJA 4ZKAA 1X0PA 2KDOA 3TEGA 4I68A 3D1OA 2IM0A 3BSAA 5LJ3Y 2Y0BB 4XPEA 5L1LA 3PX4A 3ET6B 4N41A 2RQKA 3W64A 1HNZF 2A10A 3H25A 4IOAQ 3LAKA 1PG5B 3THVA 4WE1B 4ELTA 2LQ8A 1AB8A 4QU6A 4QYRA 3IM8A 3BBBA 4MAKA 1UCNA 2KRBA 2PC6A 2KO1A 2HEKA 1OYDA 4R0JA 2XWXA 3PJXA 2MLZA 4NXNJ 3H5SA 3N28A 1SQEA 2XO7A 1QD1A 4ECYA 1MN7A 4MKAA 1BQXA 3CCTA 4HI1A 1SIWB 4RW7B 1PCAA 2B7CB 4NRUA 1ZYQA 3MMCA 3M2UA 3RB6A 4F67A 2J9DE 2QRRA 1S7HA 2E9ZA 3FSXA 4CH0S 2KVQE 3S01A 3HX9A 3UD5A 3KLFB 1PAEX 4MFBA 2I38A 2ATLA 3QT8A 2J0WA 2YKMB 1X60A 2R7WA 1TKTB 1HLWA 3E51A 4O3SA 5SUHA 4OX6A 1B7FA 2V2KA 1M5VC 3ZZ0A 3QJPA 4HHUA 1S0VA 3QNWB 1RTDB 1A6LA 3V81B 3HFVA 1QAYA 3D9BA 3P4UB 1HWKA 3M1VA 1DAXA 4X65J 1XIQA 4LT6A 4M1KA 4DUYJ 2XYGB 1BQMB 1RYSA 4F02A 3CWJA 1NDKA 2LP4A 5D3GA 3SQGA 2DB1A 4NLXA 1SC4B 4WBFA 4KJIA 3G8QA 2FVCA 4RU9A 4LSLA 4TU8A 4DPOA 4ZCMA 1NK0A 1N5QA 3E3XA 4A8SA 2DKOB 2KHDA 2OPSB 2FHKA 1LV5A 3VV2B 1AZSA 4KRWA 3CE8A 1CSJA 3BQ2A 2C2OB 2YKPA 2R8IA 2W2OP 2CPFA 1WC4A 5A2QY 4Q2LA 3N79A 3W1YC 2VONA 3SCJE 3HFKA 2EFQA 1S0MA 1SH2A 1U1NA 4J9OA 4R5PB 4CT9A 5A6WA 4JYAF 1NK6A 1KP6A 3DGVA 1XQIA 2B51A 4RUBA 1NKBA 1X4FA 4PKDB 4KHMA 3TZYA 3QLHB 4B08A 5DJBA 2FQQB 2E29A 2VDHA 1JWWA 3P96A 3VAHA 4A4JA 2XCAA 3M4XA 3RR8A 1TUGB 4GVBA 2P6SA 2HKEA 4OHXA 4ZIWA 2M70A 2MY7A 4PWDB 2YBVA 3HZEA 2AJFE 3PFOA 1RT4B 2ADCA 1ZZNA 1CEZA 4LF1A 5BR8J 1CC8A 4RKUC 1CPZA 1DTTA 2I0XA 4M5DA 3FEXB 2AQ4A 3PO4A 1U2FA 1HNWJ 1V5VA 4LF7J 2AT1B 4NWBA 1VQYA 1I5OB 4K2JA 4DV0J 1KTVA 2NPIA 1IM6A 2BJDA 2HFOA 5KG4A 3CJKB 1GXLA 2B6AB 2DK2A 5DQGA 1N34F 3CMES 1AFJA 4O0IA 2QA1A 5KG3A 3KHGA 1M5KC 4ZPAA 5DGBA 4DX7A 5GAEU 3MF5A 5B0EA 5DG9A 4F4WA 1FK9A 2ZH3A 1Y3KA 4XDCA 3QYYA 2UU9J 2DR8A 4ZN3A 1BQNB 1ZAWA 1G6BA 1SUQA 3CDBA 2YPYA 5DM7Q 4QIWD 2EKYA 1YQHA 3FSYA 2KM8C 3QJJA 1XN9A 2DNNA 1N36J 1LW2B 2FUG9 1L3UA 3HMJG 1NRKA 1FWPA 3ZO7A 5M2RA 1WWHA 3NG8A 3LP1B 4Q8FA 4M5GA 2BQ3A 5CHCB 2MMYA 1FFWB 2RDJA 5CD4H 3MMBB 4NYZA 2XNQA 1X4EA 2YWFA 2J0QD 1KR4A 1KOOA 2WAQD 1WUUA 4X2BA 2FJAB 3RBEA 3UCZP 5CZXA 4PRFA 3C15B 3ENAA 2JLEA 2HFNA 3CEDA 4M5LA 2Y3YA 2IC3A 3VAGA 5K8NA 4Q8EA 2GNKA 2KHCA 3M8PB 4EEYA 2C2NA 2G1HA 3NY0A 3ZZYA 1NDPA 3GONA 4NE9C 5GMDA 3TVYA 2O67A 4Y2AA 1N5SA 1KWMA 2CQDA 3MDFA 1K47A 2OELA 5CXTA 1WOPA 3PIPQ 5KT5A 2MDAA 5JVGQ 3A3OB 4ED5A 1VRQC 4ZJLA 3NXZA 9ATCB 1Y11A 4LFBJ 1L3KA 4A8FA 4UW2A 5HLFB 2XQCA 1VS3A 1VHFA 4WFXA 2ZE2B 3HPOA 1S6OA 1NKCA 4MIAA 1YVFA 1ZH5A 2DD8S 2V2ZA 3A8JA 1PBUA 3NGRA 3PW2A 2ZNYA 3FBBA 2Y1IA 1URRA 1A7GE 3GIRA 5HQLA 2QC3A 1RT5A 1YX2A 3I96A 4IRKA 3W62A 3GJRB 2CDQA 3HHLB 4DR5J 3IGVA 1SKSA 1NHUA 4M94A 1HNIA 1VIOA 3FMWA 2OMLA 2QIFA 1FXLA 4R8UB 3NNAA 1XR7A 4ZCLA 1LFWA 4B9MA 1T7PA 1OPIA 3NS7B 2U2FA 3R5AA 2W01A 3SEOA 3RUBL 2PA8D 1HR0J 4WU2A 2C2EA 2ZBQA 1IWGA 4QWEA 4DEZA 1U49A 3KK2A 1KN6A 2V8PA 3ZZUA 4KB7A 1QUPA 2JVRA 2OLWA 3CCRS 2VPWB 1UA0A 3IG1B 1EQMA 2MZSA 5AE1A 2F3JA 3H40A 4GC7A 5AXMA 4ES3A 3MMAB 1YLXA 1IBMJ 2VIHA 1T05B 1RHQB 1S5ZA 3D0HE 4RW6A 2R8KA 4HHJA 1MROA 3UWTA 4CDIA 2MQOA 2P9EA 5ITHA 1TZ0A 1BMQB 1NDCA 4DBQA 4NLGA 1U6ZA 3NOGA 4O3RA 2CNOB 1CULA 1JJ4A 4PEOA 2W9BB 2UXCJ 3OJUA 3E8OA 2YNIA 3JSRA 2F9DA 1YJWS 3A13A 4JV5J 2EXUA 3CCSS 5T7LA 2IDLA 3GYGA 1O6XA 4U6PA 1Q7YT 3BKUA 4NLTA 3MCMA 1C0TB 2BEFA 3O3LA 2X1AA 3Q89A 5K14A 3NAIA 2ILZA 4OYXA 3AT1B 3BF4A 3JXOA 4F26A 3W66A 4QWAA 2FY1A 1VCTA 2AP6A 4FS1A 4H4OA 4F4KA 4IH5A 1AXQA 3CD7A 2LEAA 4DV7F 2JEFA 2GGPB 4OX7A 4NLWA 3M8RA 3PX6A 3DDNA 2MZJA 4WK1A 2I9SA 4KHPF 3K58A 1UWBB 1M1HA 1UVMA 4CLWA 1H98A 5B0AA 3FZBA 3QIDA 5J2NB 3DOLB 1LNQA 2LQ5A 3MUMP 2V63A 3HVWA 4WKYA 2OEKA 3JTNA 3WIVA 5ETRA 1Y7PA 1C1CB 3VAKA 1R31A 3D67A 4DR4F 1HMVB 5KT6A 5I3UA 1QSYA 3GPAA 2ACMA 2BOPA 4ETZA 1BE4A 3WDOA 3JB9k 2ZH7A 2L9DA 4HLBA 1OQ6A 3RB4A 1R8BA 2X1GA 4DV5J 3T1YJ 4KGXB 2FDNA 1U0HB 1FVQA 3FBCA 4DV1J 3V6JA 4EYHB 3DDIA 1RTJA 4F4XA 1GAOA 1KONA 2VG7A 2VH7A 4X62J 2YNFB 4MT1A 3BO2A 3V2UC 4ZVPB 5J1NA 1XR6A 3M9NB 2MHEA 1WI8A 5RUBA 3BPDA 1QVGR 2FZCB 2GIFA 1W7WA 3HCXA 4E2FB 4KHRA 4OZLA 4USHA 1TELA 4C9DA 2I5JB 5DQHA 1RAOA 2E5GA 4I7FA 4WPAA 1QDUB 2V8DA 1I94J 3BPSP 3TUPA 1RAEB 1HBUB
chains in the Genus database with same CATH topology
1JLFB 4KGKA 1SUQB 4DS5A 3LUYA 2GQ2A 2B7BB 4ED7A 3KFWX 1ZM9A 3MPYA 1CLFA 2XLJA 4I67A 5KG5A 4B3OA 3GB0A 5KFGA 5IFMA 3WC0A 3K0JA 3MEDA 2AYGA 3ZC4A 2LU2A 2K7JA 3PXGa 1J2VA 3K57A 2WW8A 2ZZNA 1RK8A 1X4BA 1SL0A 4OI6A 4DG1A 2ACYA 2EFPA 7FDRA 1UP1A 2MJUA 2ILYA 2IRXA 1P6TA 4ID8A 5J1EA 1M5HA 1URNA 2K1RA 4OMFG 5IT4A 2W7OA 3KHHA 2PD1A 2HNDB 3HVTB 2KJWA 3M8QA 3HK2A 2FHJA 1FD2A 4F3QA 4B9LA 1Y00A 2IMOA 4KSEB 1S4FA 3I4HX 2IRYA 4EZ9A 3DLEA 2D9PA 2XMMA 2BUNA 2JC0A 3ETOA 1QY7A 4H4MB 4OIXA 1SL1A 2WRMA 1OIAA 3UI3A 3LGNA 4EO6A 3NRBA 1TKXB 1NK7A 2HHHF 3MPWA 4NZ6A 4HDGA 4OX8A 4ZDNA 3RRGA 1CVJA 2YWEA 3PM9A 3ULHA 4A47A 1FESA 5E3AA 2YNHB 1VJWA 1KHVA 4ZCIA 4IO9Q 1U1LA 4OI0A 3FEZA 3DYAA 2ZDOA 3PKMA 1DZ5A 3H5UA 3PW0A 2RMLA 1FEHA 4IOCQ 3H2VE 4DL7A 4A8OA 4FBTA 2K2PA 2N4DA 5GAHU 1HBUA 3PY8A 4Q0BB 2B5JB 2CKWA 4O44B 1C1BB 2SXLA 1WEXA 2B56A 1HWIA 5EX3A 5KFRA 2QE5A 1KRPA 2YVSA 1NK9A 1FE4A 1P8GA 2BYCA 5FIIA 4ZPBA 2NREA 4ZHRA 4W92B 4YEAA 2KI2A 1KEKA 3IAM9 1XMOF 5B0BA 3BN7A 2OSRA 4QZVB 5KFDA 1JNZB 5DLFA 2MZRA 1RTIA 2XG8A 3CJ5A 5IZHA 4B9VA 1WHYA 4IG3A 4AL5A 1OSDA 1ROFA 3NNHA 4QCLA 3MM8B 5C25B 4NLYA 3DU5A 1VGYA 5KFJA 3ENVA 5BJRA 3UR0A 1BD6A 4FNIA 4CO0A 2C42A 2K3IA 2J6UA 4JI8F 3MAQA 3EXYA 2VODA 2VC1A 3M2RA 4DSLA 5F8MA 3JYTA 2JDJA 5F8JA 1UETA 3V4IB 3X3UA 1U7LA 3O44A 4ZPVR 3PVXA 5HROA 1TL4A 4FP9A 2L08A 2WB4A 4RNNA 3KLIB 3DM2A 1X4CA 3TQ1A 2GHPA 3CB4A 2CPIA 3MPVA 3G8SA 2AJ1A 1JKHA 5D6GA 4MKBA 1FJCA 4OZNA 2IC3B 2GC8A 2NXUA 1VLYA 5AJ3F 1NK5A 4RWWA 1TP7A 4B3TF 1SH0A 4F4ZA 2IAJA 3AB2B 3LH2S 4E0DA 4FYDA 2ZH2A 4YY3F 4X62F 5IM0B 2QV6A 4DSJA 1VQLS 1VQ6S 1LXJA 2VB6A 2DPJA 3MAHA 3UD3P 2B5JA 2CQPA 4O44A 4Q44A 4NCAA 3S8SA 3HHLD 4K4WA 2MHNA 4DX8H 1LWEA 2DNGA 2DNQA 1VQMS 2GJ2A 2HHWA 2CPHA 5M2PA 2NYIA 4PWUA 2N4CA 4ECXA 2AWZA 2P9CA 3LANA 3ISND 2CIMA 3KMSA 1Q1KA 5KG2A 4LF9F 3TUIC 5A6PA 3RBDA 2EFNA 1DARA 4MIWA 4C2MA 2JFDA 2QYCA 4FBUA 1S1VB 4IYQA 2VPYB 3SCKE 5BR8F 4PXDA 1Z2ZA 2D1CA 3RAMA 4A8YA 1V9OA 3I5CA 4FF1A 3Q8RB 2XB2D 3TA1A 4CI0B 3I31A 1KSPA 4A46A 4YMEA 4RBVA 4I6AA 4KO0A 3MM6A 3TNVA 3HKWA 4OI4A 2V4JA 2HPUA 5LSRA 4DF4A 4PG4A 2DNYA 3RW7A 4CO2A 1VQNS 4K4SA 4A8XA 2KFZA 1JNRB 3O8WA 2Q66A 1HNWF 2BM0A 2LDIA 2GQQA 3OVSA 4X4SA 4JOUA 4LF7F 4BC9A 4PR6A 2MKIA 4K5SA 4LIWA 3ZZTA 1JLCB 4MKYA 2Y0SD 2ZJPQ 2XMVA 1HI8A 2Q6BA 1AUDA 3SZ2A 5IM0A 4DR7F 2DHSA 3H8YA 2BVZA 1IJFB 1SV5B 2OMOA 1HWUA 2DH9A 1EP4B 4AXIA 1T3OA 4DV2F 4ZCKA 1PO6A 3DI6B 2J8AA 1YJNS 1DLOA 2AJ4A 1DJ0A 2HWTA 4X66F 4FS2A 1REVB 4Y28C 2XS2A 1S9EB 3MR2A 1NK8A 1N0UA 1BLUA 1HBNB 4N47A 2CQBA 2YX7A 1RT5B 2RH3A 1B0TA 2YH1A 1RT2A 2YQ3A 5KFNA 3H5YA 3FFIA 1D8YA 4M95A 2KXFA 1FNMA 3BO3A 4PXBA 2ABYA 2DRAA 2ZHAA 3CMAS 4KV8B 4KIAA 1VQ5S 1NK4A 2IYIA 2RQ4A 2FJBB 2MY8A 3QPIA 3Q2TC 2HG4A 2VFSA 3W2VA 3K5MA 4DR2F 1JXLA 3NLCA 2YX1A 4LF4F 1HNIB 1VIXA 4QIFA 3LW5C 2V4QA 3C6UB 3PR5B 2E7XA 4LIRA 3ZFVA 3MEGA 5KFAA 1K1SA 1EETA 1VBZA 1HBMB 1FE0A 3G71S 1JLCA 4BC7A 4NLOA 4TU7A 2UVRA 5IQ6A 4ELVA 4I0WA 3C3LA 1U25A 3AA9A 4NXMF 4LF5F 5HQ8A 4AL7A 5KFIA 1D9AA 3NCRA 1HA1A 4ZP6A 3KHLA 4J9PA 4JI1F 1GH8A 2BA9A 2QA4G 5JJBA 4P2SA 3T1AA 3CJ2A 2V5HG 1TV6A 4B9UA 1RTHA 4NYPA 4JV0A 1WTFA 2QT7A 2MSTA 3NBPB 3Q8QB 4JI4F 2J5AA 3OTEA 4HH0A 1N36F 2PIIA 1NKEA 5KFSA 3B78A 3GV8B 2DCUB 5B0FA 5J2MA 1S9GA 4NYOA 3Q2SC 3JTPA 4WFZA 2HHPA 4N76A 2NPFA 3IRXA 4X4OA 1UEUA 4EWTA 2R9LA 5DLGA 3KK2B 4TQRA 2PEHA 3CIMA 4UUWA 4CH7A 3GR0A 4CTAA 4DUZF 4J9SA 2HFZA 4NLDA 5CH7B 4W90B 1X5OA 4P7VA 2BBEA 1VBYA 4JI7F 4FN5A 4IUFA 4KV8A 4RUHA 2R4FA 1JLAA 1LFPA 2GFFA 4KTQA 1LQ9A 2YKAA 5T14A 2AU0A 1FXRA 1IKYB 1YJTA 4HTIA 3TAMB 2LEPA 3IWXA 4TLRA 2P9GA 4I2PB 2MGZA 2CJ9A 1L5UA 3PRDA 3BSOA 4U7UK 1N6QB 1UVJA 1FO1A 2LQ9A 4C4WA 4ES2A 3C6UA 4U9RA 1GX6A 1RKIA 5F3ZA 3HO1A 1UKUA 3IBWA 2ASLA 2LYVA 1IKWB 1HBMA 5I42A 2N3OA 4DR6F 2LMIA 1VRTB 3K5PA 5D77A 1DRZA 1XTZA 5D4OA 3JAMY 2L9WA 4RW6B 3IA0A 5F3TA 3N4WA 5I3PA 5HMZA 4DV4F 5J2QB 1B0VA 3SV3A 3TUJC 3SSRA 1N88A 3OQ2A 1HL6A 2UZAA 4B17A 3M6XA 2VA3A 4NLRA 1FA0A 4NCBA 4QYZJ 1N54B 4NX9A 1R6YA 4Y65A 4LFBF 3M05A 4ZA1A 1F5BA 1SBRA 2P5VA 5U47A 5H1SV 1R89A 1XNQF 1TR0A 4RW4B 4CNYA 1X9MA 3GV7B 2DGUA 4XAKA 2G9OA 3X1LB 3M6VA 4PPZA 1D9DA 4QR0A 3CCWA 3H2UB 1U1RA 3HJFA 4OX9F 1S0NA 3OHAA 1Y5IB 1HW9A 1TL3A 2V9WA 4FNHA 4Y2MA 1DURA 2DIUA 3CCLS 2RF2B 1TFWA 2K3KA 1N56A 2GW8A 4K2XA 2RUGA 4WZMA 2H5EA 3K5LA 4I2PA 4OQJA 2AJ0A 2V8HA 2X1FA 3I5AA 2Q1LA 5KT2A 3B82A 5T7LB 2MKHA 2UV8G 3IFEA 1IQZA 2M4MA 1N6QA 1JLQB 3IS9B 3M9MB 4QPTA 1OPZA 4MK9A 1TK8A 2WONA 2E44A 2GIQA 2XC9A 3GIKA 2ZFHA 3JSYA 4QPXA 1F2GA 1JX4A 3KMQA 3DLJA 3D54A 5FDLB 2ZDPA 1WEZA 3RRKA 2RNEA 2HQIA 2BANA 3T5KA 2DNPA 3DOKB 5LSOA 5K14B 2R2TA 3BDEA 4MK7A 1MU2A 3MD3A 1Y0HA 1O51A 2BR0A 3P6YC 1D0EA 2BM1A 3N0VA 2DH7A 3RB0A 1Y4ZB 4USIA