3G6ES

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3g6eS00
2LYVA 1X4DA 1M5KC 1DRZA 3CCVS 5H1SV 3L3CA 5LSLA 4TLQA 1JJ4A 3CXCR 3EX7B 3VAKA 4W92B 2MJNA 5DDOC 2MKSA 1X4FA 2CPJA 3CCQS 3ZZYA 1WF1A 2FC9A 1VQNS 2VONA 2DO0A 3VAGA 5CA5A 2G0CA 2LXUA 1Q81T 1X5OA 3IWNC 1P27B 1KC8T 4FXWA 5BJRA 2M70A 3MUMP 3NNCA 3CUNA 2ADBA 3P6YC 2DNRA 1FHTA 4ZKAA 2AYMA 3CC2S 1QM9A 2EK1A 1WF2A 1OWXA 5CYJA 2N3OA 1URNA 2CQ4A 2E5IA 2MZRA 1HD1A 1X4HA 4WFBQ 4YUDA 2LMIA 5JVGQ 2FC8A 3CPWR 2QA4S 2RRAA 1VQ6S 4W90B 2M7SA 1M90T 2DNMA 2J0QD 2CPEA 3CCSS 4OZ1A 3EGNA 2CQ0A 3R1LA 2DISA 2K3KA 3J7YU 2KG0A 1FXLA 2MSTA 1ZZFA 3MI7X 1KOHA 3BO3A 3CCES 2F9DA 4WF9Q 5GAGU 2X1AA 1RK8A 2E5HA 4BS2A 1WHXA 3S6EA 2AYBA 3MURP 4WIIA 3TO8A 2FHOB 1KD1T 2DHAA 3CCRS 2NLWA 3G9CA 3S7RA 1Q82T 2KM8C 1YJWS 1U1QA 2A3JA 2HGLA 1X4AA 2U1AA 1WEZA 1U1MA 1X5SA 2L41A 3U1LA 3CF5Q 5DM6Q 1VQKS 3DXBA 1A9NB 1YHQS 4YB1P 2JWNA 3VAFA 2DGXA 2F9JA 5D78A 4PRFA 2MMYA 1X4BA 2KHCA 1D8ZA 2MJUA 1M1KT 1WI8A 4Z2XA 1DHMA 5IM0A 5GAEU 1W2BR 1M5OC 1HA1A 3TYTA 2CPHA 2MZ1A 3UCZP 4P6QA 2DGSA 3CTRA 2CPXA 2CQGA 2E5GA 2M88A 5LXYA 2LEAA 1R8HA 3MD1A 2LA6A 1CVJA 2M4MA 2M9KA 1D9AA 2D9PA 2DO4A 2LKZA 2DGOA 2KU7A 2M8HA 1VQ5S 3NS5A 1JJHA 2K8GA 2CPDA 2JRSA 2SXLA 3BO4A 1G2EA 3UD4P 1HD0A 1WEXA 5DDPC 1OIAA 2CQHA 2CQDA 2V94A 3B4MA 2JVOA 2MB0B 2AYEA 1YJNS 3HHNB 2DHSA 1PGZA 2VOOA 1H2TZ 2MXYA 3CCJS 1Q7YT 3S01A 1WG4A 3MUTP 1S72S 2DH9A 3BEGB 1DZ5A 2AYGA 4QQBA 2MY8A 2MQQA 2DK2A 2MQOA 1JJ2R 2O3DA 4QPTA 1U1NA 3PIPQ 1VC6A 2MYFA 2QEXS 2X1BA 1VQOS 2MSSA 2DGWA 2FY1A 2HZCA 2KM8B 2MZQA 2X1FA 5GMKa 3CCMS 4CQ1A 5IM0B 2XNRA 5IFMA 2MZSA 2MKKA 1VQ7S 2DITA 2E44A 2B0GA 2KXFA 3Q2SC 2OIHA 4WKRA 2CPIA 1SXLA 1WWHA 3I56S 1H6KX 3BO2A 3SDEB 2XS5A 4J5OA 4IO9Q 4A8XA 2QFJA 2G4BA 1VC5A 4QU7A 1WI6A 2MKCA 1VQ9S 2CQBA 2MZJA 2CPYA 4C7QA 2MGZA 3K0JA 1U1PA 1FJ7A 1UW4A 2DNLA 1U1KA 3US5A 2DIVA 4WCEQ 1BY9A 3MOJB 1R8PA 4Y00A 3CC4S 2M0GB 2I38A 3JB9k 2DIUA 4F25A 3D2WA 2RS8A 1QVGR 1HL6A 1N88A 2KXNB 3N9UC 2KT5A 5DDRC 1H2UX 1VQMS 3P49B 2DH8A 2PEHA 1K8AT 2HVZA 3RW7A 3VALA 3LQVA 3R1HA 2HGMA 1RKJA 2YWKA 1WHVA 1P1TA 3CC7S 3MXHP 3THPA 5ITHA 2DNQA 2CJKA 3CMAS 1NO8A 2MY7A 2CQPA 5JVHQ 2DB1A 3ULHA 1M5PC 4EGLA 3UD3P 1FO1A 1NJIT 3U1MA 2LECA 4PR6A 3NS6A 1SJQA 2KRBA 2DNNA 2X1GA 2BOPA 5HL7Q 1B7FA 2OSRA 4TU9A 3CD6S 2BZ2A 2PE8A 1WF0A 1XN9A 2DHXA 2XSFA 3NNAA 2MZTA 2E5JA 2MGZB 4ERDA 1K73T 2L08A 1F9FA 4C0OC 3BS9A 3SDEA 1UAWA 4CIOA 2LA4A 1U1LA 1X4EA 3SXLA 2LXIA 1YIJS 1UFWA 5DM7Q 2KI2A 2RQ4A 1YJ9S 2DH7A 2L9WA 2XS7A 5DDQC 3MD3A 2XB2D 3G8TA 1FJEB 4FXVA 1FJCA 2M52A 2RUGA 4LJMA 2GO9A 5FJ4A 2ZJPQ 5LSOA 3G4SS 1U2FA 2RQCA 1SJ3P 2JVRA 2CQCA 1ZH5A 2N7CA 1X4GA 2CQ2A 5GADU 4LIRA 2OJ3A 3VAIA 1WG1A 2M8DB 2CQ3A 2M2BA 2RRBA 2U2FA 1WHWA 2ZJRQ 2RU3A 4ED5A 1KOOA 3VAHA 2DHGA 2DNZA 1X0FA 3RW6A 1UP1A 2N82B 1U1RA 1YTYA 2EK6A 1O0PA 2ADCA 5IQQA 1FT8A 2CPZA 3FEYB 3VF0B 1N8RT 1X5TA 2GHPA 1X4CA 2YH0A 1OPIA 2YH1A 2N3LA 4CH0S 3CCUS 2MKIA 3SMZA 4IUFA 4OZ0A 1A7GE 2DGTA 2LEBA 4UQTA 1WHYA 3LPYA 5MLCV 1H2VZ 2MQMA 2I2YA 2MKHA 1M5VC 4IOAQ 2MPUA 3UCGA 1VQPS 1OO0B 5HO4A 1SJFA 1VBXA 1X5PA 3ZZZA 3NNHA 3CCLS 3B4DA 1VQ4S 2KH9A 4CH1A 2MQLA 1YITS 1VBZA 3VAJA 4YOEA 2RVJA 2LQ5A 4C4WA 1FNXH 2KN4A 2JX2A 2KXHA 4Y0FA 2ZJQQ 2DNYA 3J7ZT 1VQLS 4UY8T 2MQNA 2DGQA 4F26A 5GVQA 4V19X 4F02A 1WTBA 1ZZNA 1PO6A 1QVFR 1WEYA 2KG1A 1N54B 2DNHA 5DETA 2DGUA 1AUDA 2DGVA 1YI2S 3R27A 2FPHX 2UP1A 3S8SA 1WELA 5LJ5Y 4IOCQ 2Q79A 4QU6A 4TU8A 3IRWP 5EN1A 2CQ1A 2AD9A 2DNOA 1YWXA 1U6BA 3P5TL 2XS2A 5LXRA 2KVIA 2YKAA 2VODA 2LCWA 2OTJS 1N52B 2MQPA 4WFNQ 3DLLQ 1JMTA 5LJ3Y 3EGZA 3CMES 3H2VE 2RS2A 3P3DA 5D77A 3TP2A 4U67Q 4M5DB 3V4MA 2MKJA 2WBRA 3MDFA 2D3OR 2J76E 2KYXA 3CULA 3NMRA 3G6ES 3G71S 5GAHU 2CPFA 3VAMA 2OSQA 2MHNA 2CQIA 3UCUP 2OTLS 4TU7A 2ERRA 1VBYA 4WFAQ 2G1DA 1U1OA 3FEXB 3Q2TC 3THTA 2DNPA 3H2UB 2D9OA 4PKDB 1SJRA 2YTCA 2KFYA 1DBDA 2NZ4A 4RU2A 2VOPA 1NU4A 2J8AA 2DNGA 1WG5A 3OW2R 3G8SA 5CXTA 2EVZA 3MUVP 2J0SD 1VC0A 3UE2A 1SJ4P 3UWTA 2F3JA 1U6FA 3HI9A 1VQ8S 2DNKA 3I55S 2RNEA 2XNQA 3PIOQ 3G96A 1IQTA 1KQSR 1L3KA 1S79A 2KRRA 1K9MT 2RT3A 2HYIB 4LMZA 2HGNA 1Q86T
chains in the Genus database with same CATH superfamily
2OFHX 3KLGA 1JJ4A 4H4MB 4RW9B 2YWHA 3VAKA 4B02A 4UOFA 1F5AA 1S97A 2FYXA 1AB8A 3V6JA 1NPRA 5ETKA 4RL1A 3TUJC 4EO8A 3FQKA 3LTOA 3D0GE 3IWNC 5HN0A 4HT7A 2M70A 3UD5A 5BYQA 2FHMA 3M8QA 3KJNB 4N41A 3H5UA 2ZDPA 4ZLLA 1JX4A 2HHHF 2Z30B 1TV6A 1R0BG 4WTOB 2KJWA 2CNOB 1U26A 2CPEA 5I42A 4O3PA 4DV7J 3DLBA 3DRXA 1MNEA 4X62J 3KHLA 1VJWA 2HRYA 3M30A 1NZ8A 1HNVB 4C9DA 1X4BA 3H5SA 1D8ZA 3IRXB 2O01C 1T9TA 5J2QA 4AL5A 3HHLB 2H65B 1XNRJ 1RT3A 3M8ZA 3CJRA 1FKOA 4LF4J 4XAKA 4A8SA 3KNGA 4CP5A 1S6PA 2DO4A 3V2UC 4NRUA 4NE9C 4WU3A 3PZPA 4C2MA 5F9NA 2VOOA 1FERA 4QWCA 4O44B 3FFIB 2GA7A 4ZVSB 2NXNA 2OPPB 2WTFA 2CZ9A 3PR5B 3C8YA 3HHLD 1VQOS 1SL0A 1Q79A 1N32J 3IC1A 4CQ1A 1NHKL 1SJ1A 3KJVB 4GC7A 4G1IA 1U8WA 4Q44A 3MTKA 5E5NA 1DTQB 3R9LA 3MEGB 2NYIA 4NZ7A 1KKHA 5KFRA 3SDEB 3T5HA 4KGVB 3CO9A 3NGDA 3D1QA 3T6JA 3G6XA 1N34F 3K0JA 2WCXA 3GJTB 2DYAA 4NXMJ 3I31A 3V6DB 2ZEJA 1U1KA 1BY9A 1H72C 2OO4A 1BWVA 4QW9A 2YXLA 1QVGR 2YQ3A 3EUNA 1BWEA 1QLNA 3HMJG 4QR0A 5LM7E 1JK9B 2VDHA 3VZHA 3EVWA 1WHVA 4ED0A 5ITHA 1KONA 3ZZ0A 1F9HA 4I2QA 4QW8A 2HVEA 2CXEA 1FRLA 3A8JA 1U0SA 4EGLA 4DCJB 3PKYA 1QTMA 1S5ZA 3GFYA 4YDDB 6FD1A 3P96A 2OH2A 2D7SA 2X1GA 3EDQB 4NLDA 1SKSA 5GMDA 2KJVA 5AXLA 1Z1ZA 4TY9A 2W9BB 3HDSA 4LF1A 3W2VB 1UKUA 7FDRA 3D6HB 1YJ9S 5DDQC 5F8LA 4KY3A 1HNZF 5B0FA 3AAWB 1VRQC 2RUGA 1K0VA 4JI0F 1CULB 4LSZB 5THWA 1O5JA 4QPXA 1OPZA 1X4GA 1FRKA 3RYLA 3FC9A 2I5JA 2J5AA 4A47A 5T7LB 5DRKA 4LF6F 3I0SA 3BSNA 4GRSA 4JI6F 2RQMA 1S6QB 1XK8A 2N82B 1K1SA 3HXMA 1KWMA 4LF2A 4ZPTR 1U02A 3ILIA 1N33J 4ED2A 4ID5B 2B9EA 4F3QA 5MLCV 2GMHA 7AT1B 4F50A 3KG4A 4OYPA 5LOQA 3NNHA 1C0TB 2NQPA 5BXIA 3DDIA 1LV5A 1UPPA 3IP0A 1RKIA 4QWEA 1FNXH 3OL7A 4F26A 4ED3A 2XY7A 4C11A 4DFJA 2G13A 5DETA 1NM2A 2F8EX 2P2CB 4NLQA 2A0FB 3NGRA 2WOMA 3EZ5A 4FF1A 1LWFB 3NCRA 1RT6B 5D77A 3LOUA 4CLLA 5JMNA 2VC0A 2XZDB 3NMRA 3TEHB 3GILA 1U09A 2R2UA 2RKIA 3TJ9A 2HEKA 3B54A 2PN6A 2BQRA 2G1DA 1VIXA 3DM2B 1FEEA 3ADAC 4PG8A 3OW2R 4B3RJ 2YNGB 4GVLA 3N6MA 4QOTA 2MLYA 1RTIA 4U6PA 4A4JA 1U0HA 4FS2A 1Q8BA 3CCWA 1J5EJ 2GVDB 2HFZA 3DOLB 1JLCA 2FC9A 3GLJA 2OAUA 2IJFA 5CA5A 3LGHA 3HVRA 2HK3A 4DQRA 2XWXA 4B08A 4JBCA 4KGMA 2J6TA 3NNCA 4X4QA 2AX1A 1R0AB 2HHHJ 3OXFA 5CZVA 3GP9A 4K59A 2EEYA 3CMQA 2AYMA 1PYTA 1U45A 2BW7A 3O1LA 4OHZA 1YJ7A 6FDRA 4Y2KA 5JXSA 2WONB 4DZ6A 5KFNA 5BR8F 4LRDA 3KLGB 3BR8A 1RABB 4P7TA 1HI8A 1C0UA 1WHXA 1XMBA 2VZ9A 4NMLA 2FDNA 2FHOB 2IHR1 1QD1A 3FKBA 4PPZA 1RAAB 4KTQA 2KYZA 5LMNF 3VZIA 4HDHA 4X4UA 1M1KT 2MJUA 2QE5A 1IKWA 4BBYA 3M8QB 2CPHA 4G6VB 4CT9A 4KR0B 4NLVA 2QL5B 1TV6B 4KKOA 1RHMB 1M0SA 4UUXA 2M4MA 4X4SA 2M9KA 3A8KA 3Q0AA 1F0XA 5C24B 2J8SA 3CJTA 2V0NA 2CADA 5I42B 1YJNS 2HS4A 5IS2A 3CDWA 1HW8A 1Z2ZA 2AKWB 4F2RA 1WKLA 2COLA 2O3DA 3OHAA 1HPZA 1VC6A 2PIIA 3HLUA 2UXBJ 2X1BA 1TFYA 1CSJA 2RSQA 3M30B 1XTZA 3WX4A 3N0VA 1UPMB 2XNRA 5J2QB 2MKKA 4K0KJ 1IBMJ 1LNQA 1FKOB 2R7RA 2RRNA 1N34J 2E9RX 3O2IA 4IO9Q 1S6PB 2ZUGA 4FPIA 4GVBA 2P9CA 1RGVA 1YJRA 2WW8A 5DLGA 2MGZA 4LIWA 1FJ7A 1B3TA 1TKXB 3NGUA 2AJ0A 4F25A 3EYZA 1N88A 2KFZA 3N9UC 4ECZA 3M8RA 1RISA 2AGOA 4ANDA 1F60B 3D28A 5KFUA 1MU2A 3OPKA 1I94J 3Q8VA 3CMAS 4Q5VA 2MY7A 2AW0A 4USUA 3W60A 2DR7A 3FUYA 4PR6A 2HQIA 4RWWA 1J5OA 4EBCA 4MFBA 3M8PA 5KFGA 1ZOTA 1RHUB 2ZDOA 4Y2IA 2ZC3A 1FJCA 2ZJPQ 3HFKA 4I2QB 2E5LF 2N7CA 2FVQA 4JI6J 3K5NA 3MPDA 4NLWA 2YKMA 3DLGA 5K9FA 3GV8B 3RW6A 4P2FA 1YTYA 1N0UA 1GXUA 1PKUA 3RG6A 4CH0S 1HFEL 4ANCA 2GIQA 3Q23A 1M5VC 1VQPS 3LALA 4P7VA 2DXEA 3CCLS 1UMJA 2A2CA 5KT2A 4EMDA 2I5JB 3MR2A 3I0SB 4ANEA 4Q2LA 1JLAA 3UQSA 2EG2A 1ROFA 2AWZA 3FBBA 3TAQA 5C5JA 2V2ZA 2HIYA 2DNHA 3S8SA 2A2DA 2V2VA 3C14A 2G2YA 1TP7A 5LXRA 2OTJS 2MQPA 2D74B 2ZH9A 1DTTA 3P3DA 1S9FA 4B9UA 3WDOA 4M5JA 1S12A 1L3TA 3UCUP 1NSKL 3FEXB 4IYQA 1DBDA 2HW3A 3PR4A 4C11B 1PAEX 1JXLA 3I55S 3IM9A 1RADB 2AX0A 4OX9J 4CTAA 4FVMA 5LSLA 1PAUB 3L95X 2HBZB 4DSFA 5AE3A 2MKSA 3HFVA 4DQQA 2GVZA 2DO0A 3H5XA 2LXUA 3PFOA 5KFBA 2M5YA 4CRJA 2HHTA 2VHGA 1EB0A 1R6VA 5AE1A 2RKIB 4KE5A 3LP1A 4IOBA 4DV0F 1KR4A 4I64A 3H59A 1HNWF 5KT4A 2BQ3A 1S99A 5BR8J 3IG1A 3CPWR 3IWXA 1RTIB 3OL9A 1RBOB 1U0HB 4ECXA 2GX8A 1UVNA 2XMVA 2F9DA 2LXFA 1RTHB 4DXLA 5A8RA 3S6EA 4LR7A 4ZVFA 3S7RA 3TVYA 2KM8C 4NLGA 1UEVA 2A3JA 2OUGA 3HVAA 2F4VF 1WEZA 1FEHA 2HMIA 2L41A 2GZOA 4DPTA 1VQKS 4J9VA 3T1AA 1RWXB 5GAGI 1RUSA 1DJ0A 1VISA 2DR9A 4Z2XA 1FKAF 1NDCA 4FYYB 3UDEA 2RILA 3IS9A 4QIGA 2VFSA 3UCZP 2NXEA 4X4PA 3CTRA 4MKAA 5LXYA 3HJFA 4WFZA 5KFKA 2Z58B 3NBPA 2B6AA 2ALZA 2VF3A 2PDAA 3D3CJ 2CPDA 1RA6A 2V94A 2G0IA 4I6WA 3HHNB 2HZVA 1C0UB 3NCPA 4Z37A 4B3MF 1I1GA 2DK2A 2FZCB 5KG1A 2WVFA 2C1EB 2DTJA 3FZBA 2MSSA 3V81A 3HJVA 2B9WA 1IKWB 2AZ3A 5IFMA 1RWKB 2ABYA 3MM6A 1YBAA 2H54B 2JC1A 4BC9A 4Q8FA 4ZPBA 4KKOB 3MECA 2G4BA 3K57A 3F56A 1WTFA 3MOJB 4C48A 5HI7A 2QX0A 2ZD1A 3SBMA 4CYUA 2JHEA 2OPSA 4W98A 4QCLA 3PCOB 3K17A 1HPZB 3M2VA 2K3IA 3ENQA 1HQEA 3CC7S 1GT8A 3THPA 3EPIA 3C66A 2YVSA 4RUHA 3W3SA 2GC8A 4B3TF 2JL9A 4TNOA 4GO5X 1NJWA 4V19J 5SUHA 2VBZA 4TU9A 5KFHA 4GVBB 1V3ZA 4NRTA 1T9WA 3V6HA 1W26A 4A48A 2MGZB 2XCPA 2F8MA 3SCLE 1U49A 3SXLA 2R8GA 5KFQA 1N48A 4DPWA 2V4JA 4RPFA 5KG0A 4LJMA 2Y1JA 5LSOA 1MU2B 4OYMA 2AEJA 3SSRA 2HVIA 2RQCA 2JVRA 4J9OA 1B0TA 4PWWA 3TX8A 1WDTA 1C4CA 4DR7F 3PJWA 4OX7A 4JV5F 3LAMA 3FCWA 4OI1A 3C19A 3GJSB 5IWAJ 4YMEA 1J5OB 3ISNC 4A8WA 4MFBB 3M8PB 3SFUA 2XQCA 4RBUA 2AGPA 5J2NA 2N3LA 2MKIA 2HBQB 3E51A 3ILLA 3KTQA 4LVNP 1IBLF 2GQ2A 1X9WA 4R25A 5K5MA 3BKTA 1U24A 2FJWA 2W4CA 4CLSA 4C4WA 3TRGA 2YKMB 3DLGB 3CJ8A 1NAQA 3U27A 2KTQA 3BGLA 2IM1A 5F41A 2BKOA 3MFHA 3VGUA 2IMWP 5KT3A 5KG2A 2E1PA 2O66A 4TQRA 2VODA 4ZP8A 3CIZA 5LJ3Y 3OR1A 2ZH8A 1YX2A 4PXDA 4ED7A 3V4MA 1SVDA 1IKXA 4I68A 4NWBA 1VQYA 1JLAB 1XQIA 2W2OP 3MUVP 3UWTA 1U6FA 5DO2A 3UNGC 1SC3B 3GCWP 1IQTA 1KQSR 1JWWA 4PQAA 3OTDA 3C14B 1T94A 3IAS9 3NAHA 5CCMA 4ED4A 2HRUA 1V5VA 3IBWA 3PRBA 4USHA 3CCQS 1OS5A 1DTTB 2EFGA 1CLFA 3UDLA 4PG5A 2G0CA 3ETMA 3BGUA 2ZHBA 2EG1A 4ZVQB 2XBPA 4ZN1A 1WF2A 4QIVA 2CQ4A 2MZRA 2XO7A 4DCPB 4LFCF 2FC8A 4YR2A 2PA8D 3QQCD 2HQDA 3R6LB 3KMQA 1RHKB 1YDLA 1CBKA 2ACMA 3QT7A 5DZ7A 3MHYA 4PG6A 4CLZA 1AXQA 3MURP 2F4VJ 2DHAA 2GVZB 2BOAA 4ZVEA 2RB7A 1YJWS 1T9XA 2HGLA 3B8HA 3NWRA 3G6YA 5DM6Q 1A9NB 4O4RA 1R8AA 2W1BA 1RT7A 4DHVA 3QT5A 2UXDJ 3LP1B 3H40A 4ILMA 1RXOB 2ATCB 2K1RA 2ZOGA 1EQMA 4J9SA 4DJBA 3IG1B 2P6SA 2W9AA 3QGPA 4F4XA 3DRPA 2V6AA 3RAQA 5A8RB 3QZ8A 2BM1A 4ECYA 3O6QA 2ACYA 1TKZA 2RU9A 2HMIB 1FFWB 4I56A 3OTOF 3BYRA 2FY1A 3THVA 2G0JA 4M94A 4G1QA 1RAIB 3O8WA 1CJVA 2WVDA 3K7RA 3J81j 2OIHA 2LQJA 3QSIA 1F3FA 2RMLA 4C8ZA 4ZK7M 4N7TA 3NBPB 2B6AB 1CEZA 3NRBA 2QFJA 2R8KA 1VC5A 2MZJA 4OI6A 4C7QA 1IUJA 2RHSB 5F8JA 4IH5A 4OX8A 1NK5A 1R8PA 2M0GB 3DXSX 2CNLB 3BGRA 3AJDA 4ZLNA 2UV8A 4TXSA 1WC1A 3MXHP 1NO8A 2YKNA 2V9KA 4YB6A 4YN3B 3MM6B 4PWDB 2W7AA 2B4OA 5KFPA 3MECB 2HHQA 4DV2F 2XSFA 1UEKA 3AOCA 1NK0A 3DYAA 5A8WA 4GKJF 2VC1A 3W9HA 2OFGX 4ELTA 2ZD1B 3UPFA 4CYUB 3OUYA 4K4WA 2OPSB 1MWQA 4WFXA 1IBKJ 3BM7A 3M2VB 3RBDA 2HPUA 4FXVA 1HQEB 1LK5A 2M52A 4MH8A 1RWOB 2VB6A 2XZWA 1EKRA 4OI4A 2PA3A 5G4DA 1X7VA 3H42A 3VAIA 3CDBA 4CNZA 3MPWA 2M8DB 1JQGA 1L3UA 2APOA 3TX0A 4FZVA 3MPVA 4RW7A 3PW2A 4GKKF 4DWIA 5IQQA 3VF0B 5KG6A 5HROA 3ENVA 1WKJA 3CGIA 2V4JB 3CW2C 2ASYA 3K5OA 1S7HA 3Q8PB 3K59A 3UCGA 3B6BA 1NSPA 3M9MB 1S0NA 5HO4A 1I6JA 3NL0A 5KFVA 1FE4A 1VYAA 4F8RA 1RWWB 2HS0A 3CE8A 4NYPA 2FJAB 2AZ1A 3EVOA 4EZ9A 2R2RA 2B9YA 1RAFB 4ZP9A 4ZVOB 1N5QA 1QVFR 2UP1A 5LJ5Y 4MKYA 1FDAA 5J2NB 2PT0A 1KVJA 4OZ5A 4TVAB 3GJRB 1AZSA 3ZZPA 3IR5B 3CMES 1X9MA 2J0XA 1RT1A 1FJGJ 1Q0NA 1S48A 3D1OA 2CQIA 4PABA 5CQGA 2F63A 1GMWA 3G82A 5BYSA 4WFAQ 2QGFB 3THTA 2WZ1A 2DNGA 5CXTA 3HKWA 4USTA 5B0DA 3KMSA 3QRPA 3CIMA 2UZAA 4MIBA 2BEFA 8AT1B 3JSMA 1EP4A 4OI3A 1R8BA 2IM2A 2CYYA 4RW8A 2FLLA 1B7YB 4CM0A 4KQZA 4DF8A 3OR1B 1SIZA 1W2IA 2W8KA 1RAHB 2OD6A 2BMBA 2FJVA 4TKTA 5KFEA 1KC8T 3OFFA 3PNIA 2IIHA 3ENWA 1SC4B 1T9UA 2BE2A 3CC2S 5L1KA 3D6TB 4CO3A 1S6UA 3LGNA 1JKHA 4WFBQ 3RU0A 2ATLA 2EBEA 5L1JA 5M2UA 3KK3A 3RGIA 3J7YU 2Z56B 3PX0A 2E5HA 1NUEA 3VVUA 4AL7A 4ZLJA 3PX4A 1MW7A 4QR2A 4NLYA 2VKZG 3GYGA 4KHPJ 4LQ9A 2I0XA 4PYDA 4RBVA 4YDXA 3NCQA 2EFVA 2F9JA 1H3DA 3K58A 3LH2S 5DG9A 3TNVA 2LEPA 2XI2A 3KG0A 4C8KA 3HD2A 3CCZA 2O1PA 1CVJA 2GO8A 4G3IA 3ZZTA 5DJBA 3J7A1 3UD4P 4OZ2A 3TZXA 3WIVA 2JVOA 4EI2A 4WZMA 4JI2J 1KBRA 4FKXA 4BHQA 3IM8A 2AYGA 3W65A 4NXNJ 1JJ2R 2ZBCA 2IM0A 1YZ6A 1R43A 2JNJA 2QSFA 3EVMA 4TQSA 1RT7B 1FX4A 1HI0P 3W9JA 2GIFA 3U7JA 1T05A 1U8SA 2K1RB 2DITA 2E44A 1MWZA 4QR1A 4IH6A 1SXLA 2YX4A 3SI8A 4ZPVR 2LDYA 3IMQJ 4J5OA 2GHVC 1X31C 1TL5A 3GPAA 3DRPB 4DS5A 3G86A 2V68A 2QO3A 4RW4A 1AFJA 3HKZD 3L7UA 2DPIA 3ETOA 1GEHA 3KLHA 2CVEA 2RS8A 4J9MA 3H98A 4FYXB 1TKZB 1HLWA 4DV3F 1BQNA 3R1HA 1IJFB 4G1QB 4M5MA 4NZ0A 4R5PA 5I3PA 4HI1A 2CJKA 5E2QA 1CJVB 3T19A 1M5PC 4JI7J 1QAXA 3RTVA 4LSLB 1TUGB 2AJ2A 3U1MA 2KDOA 5D4LA 3R3TA 1V6HA 3OLBA 4DR4J 1RYRA 8ATCB 2I1RA 5D0RA 3QGHA 2MZTA 4ILLA 5D4PA 3T5JA 1EZZB 2KKHA 1HQUA 3BGRB 1XEZA 1HBNA 4JI4J 1U47A 5E0OA 1RCXB 1GXLA 3OFGA 4DR3J 4J9UE 2YKNB 3ZZOA 4FVCA 3AD9C 3MMCA 2HAFA 3MM7A 3C6UA 3GONA 4OJ3A 1N36J 3UN5A 5ETTA 3DU5A 3Q8RB 1UP1A 3R7BB 2JFKA 3MGJA 3DYAB 2F1FA 1CG2A 5A8WB 1ZAWA 3FEYB 1LFWA 2X51A 2GHPA 4ICLB 2R8JA 3AB4B 2YH0A 2RQKA 3OFHA 3OUYB 3BREA 3W1YC 4AT1B 3CJQA 3P45B 1FCAA 4RLEA 2IRXA 2W7OA 1TVRA 2IDEA 2J9DE 2QLXA 3FMWA 2EFPA 4AQYF 1H38A 3F0NA 1H0HB 2RVJA 3FBCA 4NI2A 4ECUA 4O4GA 2DGQA 2ZH7A 1REVA 1N5SA 1ZTWA 3JAMY 1WTBA 2Q66A 2UUCF 4RW7B 3GYNA 1YI2S 1U4BA 5HROB 2DR8A 4P52A 1U6BA 2JZ5A 2VBXA 1BC6A 1QAIA 1XJWB 4WYWA 2JEIA 5G0RA 1LK7A 2XMWA 4HTJA 4ES1A 4X65F 2QTWA 4NLUA 4QBUA 1UTAA 2LQ8A 2DR6A 2Y9HA 2W2MP 1CJUA 3GMGA 2ERRA 1TQLA 3GCXP 4LFAJ 4K8RA 2VOPA 2YWGA 1B0VA 2J0SD 3K2YA 1KP6A 2RNEA 1G4CA 1GK8A 4PG7A 3H90A 4N76A 3BGOP 4K50A 1FI4A 1Q86T 4Z7CA 1YZ7A 3L3CA 4QJVA 2H9ZA 1PYOB 4DL4A 2ZBPA 4NCGB 2PSZA 4YQWA 2ZVIA 1NBEB 1RT1B 1NSAA 3E01A 3G82B 2J9CA 3P6YC 1IKVA 4DR1J 1FHTA 4ZLPA 3HFZB 1QJHA 1VBKA 1GMUA 1URNA 2XG8A 3MZIA 3NKYA 4GC6A 2Q6BA 1VQ6S 4USMA 4FXDA 3JSMB 2D1CA 3EGNA 1EP4B 2K3KA 5I3QA 4JV1A 3HHKA 2HFVA 4RW8B 1B70B 4ED6A 1GMWD 3OBIA 5L8RC 2Z8QA 3GFZA 2VKRA 3GTYX 3KJFB 4XK8C 2A10A 5DG8A 1HMVA 3CVKA 5KT7A 3OSNA 2ZZNA 5IM0A 1Q16B 2XSJA 2BE2B 4CLUA 2DGSA 2EW9A 3OLAA 2CPXA 4DI6A 4KT0C 2ZUAA 3QJPA 3MD1A 2PEBA 2M8HA 1JJHA 2E1AA 3KK3B 5ETNA 2MB0B 2OLWA 1RAJA 3NG8A 4ECVA 2MXYA 5HJYA 2HQFA 3MUTP 3EGVA 5A6PA 2BKNA 1AT1B 2CJYB 3AOBA 2XLJA 1XWLA 2X1FA 3CCMS 3JTPA 3W2WA 3Q86A 6AT1B 1FK9A 3Q2SC 2UUAF 5HK4A 3EE3A 5J2MA 4K4ZA 5T14A 4X64J 1REGX 1K44A 4ED1A 1UW4A 1UW9A 1JNZB 3SQOP 3HULA 2XYGB 4USKA 1JJCB 1BUXA 1GXTA 3AD8C 1L5UA 3JAMU 2W24A 3DHWC 3ZTSA 2FVSA 3GWCA 3OSPA 4ZVRB 2A1BA 2DNQA 5LT5A 3JSBA 5B0CA 1T05B 2C2MB 4HI2A 2F5GA 4C3MA 2FLNA 2NPFA 1T03A 4RU9A 4RW4B 3A1YG 1Q4RA 1X4EA 3LAKA 2C2ZB 5EDWA 2C2KB 2P9GA 5J1EA 3KLHB 3QATA 4WK1A 1HBOA 4O3RA 3MD3A 1FRHA 3CDAA 2XC9A 1BQNB 1NNDA 5KG3A 4L76A 2P5VA 4R5PB 5H9EJ 5HP1B 2C28A 4CCHA 1S9EA 3ILJA 1UFLA 4J9RA 4OI0A 2RRBA 2ZJRQ 4ED5A 1Z2LA 1HBUA 3M32A 1KS2A 5ETVA 1V3SA 1T3NA 1HHQA 1SL1A 4JYAF 2YNFA 1IBCB 1X4CA 1HQUB 2CIMA 3N01A 1HBNB 4ZS6A 1Y5NB 3LPYA 2MQMA 1PIEA 3TJAA 2V8HA 2BACA 3ELHA 3OJUA 5CYMA 1S0OA 1LWEB 2V8GA 3VQTA 4EWTA 1RP5A 3MMCB 3MM7B 2HHUA 3C6UB 4JI1J 2VQFJ 5E3QA 3RB4A 1YGYA 4UY8T 4DL0C 3KLIA 3GSDA 3T1HF 3HSZA 2ZM6J 2YKOA 1A0OB 1SC1B 2GJIA 4OHWA 1BQXA 2BM0A 2CG8A 2XMAA 3RBEA 3B82A 3W5XA 4X62F 1NK6A 4X65J 2Y8WA 2RS2A 4JOUA 2R7XA 3CCTA 4WIQA 1TVRB 5IC6B 4F4YA 2MHEA 1ACMB 1VMBA 4B9MA 1CJTA 2QV6A 1VBYA 1XNRF 4FN5A 4X2BA 4C6AA 1FD2A 4PKDB 4NI2B 2AV5A 4O4GB 1REVB 4LF8J 1Q7LB 4P73A 1SJ4P 1BHNA 4C8LA 3M7VA 1RTDB 1TUWA 2BA9A 1UJ6A 2KRRA 1FRXA 4ZOSA 1IWAA 1DRZA 1FXDA 1ICEB 3CCVS 1YJTA 5MAOA 2HZAA 2JEGA 2AGQA 5G0RB 1WF1A 1UVIA 4F4ZA 2E7VA 2KL8A 1E6VA 3D1HA 3CJKB 1CJUB 1P27B 3NOGA 4KB7A 1T3OA 4YS2A 3OFEA 3PYDA 4ECQA 3MFIA 3M6WA 5L39A 1R3NA 4WP3A 2QA4S 1EARA 4NXMF 3HZEA 4MAKA 2VDIA 4OZ1A 4A8QA 5EWGA 2ZH5A 1KOHA 4Q8EA 2MLXA 4A8KA 3HF5A 5GAGU 1L3VA 1K0TA 3M8YA 2OEJA 1S10A 1YSJA 2F65A 5KT5A 4J9KA 2ALYB 1X4AA 3MEDA 1APSA 3E01B 3VAFA 3JQJA 4DPOA 2MMYA 2KHCA 2HQGA 4D3HA 2HBYB 2XLIA 1WI8A 1IKVB 4C0BA 4Q0BA 4P6QA 3R5GA 5K8MA 3I87A 3FNNA 2LA6A 2QZ8A 4OZNA 2WB4A 2V63A 1VQ5S 1M1GA 2IDLA 4F0MA 1KTVA 1B4SA 2HSEB 4LBHA 4RUBA 1RE1B 2RE1A 4FYWB 2RUSA 1TAUA 3PIPQ 2AU0A 2MYFA 1HMVB 2DHHA 1KQFB 4LVOP 3MR5A 3PACA 5IM0B 2XSJB 5D0HA 4CO2A 2JH3A 5EUHA 1H6KX 2XMTA 4MYTA 2JLEA 2WSEC 3AJ2A 4ZIVA 2PFFB 5T41A 4C97A 2YKQA 2CRLA 1QAYA 4OYBA 1RZMA 3DLKA 1S9GA 4AFFA 1K8AT 5RUBA 2PI5A 3EMTA 4NA3A 1S4EA 1LFPA 3W63A 2ZHOA 3D6FB 2VIHA 5KFLA 2ZZTA 3W2WB 3P4UB 2GQCA 3AODA 4EBEA 1FK9B 4NPOA 4ES3A 2BJ1A 2PD1A 5J2MB 1EIYB 3BB5A 2AHOB 4MKVA 5LMUJ 1V9OA 2V69A 2C22A 1FDNA 2PGCA 2PE8A 4K2JA 2HKEA 4MK8A 4FBTA 2EC0A 4ZPCA 2EKYA 2QL9B 5DQIA 4MIWA 2I8EA 2LXIA 4NA1A 3VR1A 3I4HX 1WSRA 4WKYA 2XB2D 2J7WA 2VFTA 1WOOA 2GO9A 4FBUA 2FVCA 4Q43A 4ZP7A 2HRTA 1NZAA 2C42A 4B3RF 2HHWA 4N8NA 4JI8F 1T03B 2GHWA 3DC2A 2EK6A 1RT2A 1C2PA 2CPZA 5ADZA 4MJKA 2GW8A 1C1BB 2Q1LA 5AJ3J 1J5EF 2EFNA 4EZ6A 3SMZA 5J1EB 3KKFA 2IVMA 2CG4A 3SSQA 1HBOB 4J37A 4I1TA 2QIFA 1ELOA 4NEZA 2Q6CA 1N0VC 3R5AA 2ZH1A 1S9EB 2MQLA 1MG7A 1KEKA 1JIHA 3LW5C 3T1HJ 1H7XA 2X7IA 1TL1A 1HBUB 3M32B 3TI0A 1BQMA 4M5GA 2YNFB 3L09A 2DGVA 3KK1B 2GQQA 1D3WA 1FFSB 1M5HA 2B8PA 4I7FA 3BSCA 3J7YI 1R6YA 4KIAA 3PY8A 2OHDA 3HD1A 3HP6A 5CYMB 3DRSA 2FHJA 3TP2A 4F7VA 2KYXA 3W8PA 3G71S 2CPFA 2C2RA 4Y3CA 4EK2A 3GIMA 1NDKA 4IQMA 3H2UB 1JLEA 1OJ4A 1WG5A 3G8SA 1ZS6A 2CWKA 3KLIB 3MOZA 2W8LA 4CLWA 3LUYA 1DFDA 2BABA 2WVEA 1DQ9A 5H1SV 2K2PA 2WK4A 2C2EA 3GZ7A 4W92B 4IRCA 4Y28C 5HQ8A 4O3QA 1NSQA 2UXBF 2VFUA 3D6MB 2HLTA 4BLGA 1X5OA 2WSFC 1WJ9A 1J27A 3MUMP 1CJTB 4K0KF 3CUNA 4W4MA 2ADBA 2RDIA 1IBMF 2NS1B 2VPZB 1R27B 2FZKB 3U1NA 2EK1A 1X4HA 1PYSB 1JXVA 3SCJE 4FYDA 2YQ1A 2V50A 4LF5J 2B8QA 1ZZFA 3PRVA 1SQGA 2X1AA 4E98A 4ID8A 1JLGA 2QG9B 1TUVA 5C2GA 1E6VB 3A4TA 2IYGA 1OSCA 1I94F 4DSJA 3DLEB 2B4UA 4WP8A 3RUBL 4NCBA 3HHEA 4UZCA 3EGWB 1OSDA 3E2EA 2PFDA 3KDNA 1LXJA 4HHJA 2XMJA 2LEAA 3T41A 2KU7A 2N4CA 2K8GA 3ZZUA 4ZVPB 5IV4A 2OD4A 4A46A 3HVWA 2AYEA 1PBUA 4CLPA 1VRTA 5KFDA 1DZ5A 1CC7A 2FY8A 3A8IA 1PJ7A 2IVYA 3BBBA 2RIJA 3GR0A 3MEDB 2KM8B 2J7KA 4NLSA 2FVRA 4WK3A 4Q0BB 1R31A 4NMXA 1VHIA 3RZAA 3I56S 2XS5A 3D68A 3QLHB 4FDFA 2GJFA 3JXOA 3QJJA 3ZTRA 3RAXA 4U96A 5K8PA 3TAPA 1U1PA 2DIVA 4RZRA 1MROA 2FHKA 5E3RA 4DSLA 2R7UA 4U7UK 2KXNB 2QJ3A 5DDRC 1Y11A 2PEHA 3RRGA 1QDUB 2W7PA 2VICA 1R8CA 4P72A 4CDIA 2E1RA 3C6TA 2DB1A 3DOKA 1CS4A 1SJQA 2ZZMA 1S1WA 4H54A 4HTIA 3I6PA 3MM5A 2NXCA 3VQSA 4X4NA 2FJEB 1GFWB 2YX1A 3EWGA 3MAQA 2RQ4A 1IR2A 2L3MA 3DLKB 1S9GB 3HM9A 1FDBA 3M8WA 3SCKE 2E9ZA 2YWEA 1RWMB 2WRMA 2CQCA 1TK0A 3JSRA 1IR1A 5U47A 4DFPA 2HHSA 1QSLA 4DS4A 4JI8J 4LF7J 4P10A 5KG7A 2BE9B 3DFEA 1HNIB 1Y3JA 1FT8A 3V5RA 4IKAA 4OX9F 4IH7A 2ZBIA 1HIYA 3GV5B 2GGPA 1S49A 2J7UA 4JV2A 4CH7A 1I3OB 5FLXY 4OZ0A 2RD5C 2DGTA 3W66A 4I0WA 1H2VZ 5J2PA 1FRJA 1G7CB 3DDNA 4C0HA 2KT3A 3FJ2A 4QYZJ 3PHEA 3W9IA 4M5DA 3KUHA 2L48A 4JI3J 4ZJQA 1VBZA 4RWXA 3R5DA 2KN4A 3MEEB 2BJ7A 3D66A 5HLFA 3TWZA 4J90A 3PTWA 2H48B 1RT2B 1S1XA 3H8YA 3GV7B 4C8OA 2JFDA 2E9TA 2V8DA 1D09B 1EETA 2DNOA 3N5FA 4BC7A 2QSWA 5F8NA 1JLQA 5DG7A 2IJNA 1OY9A 2AJFE 5HMZA 4DV6F 3UI3A 4I2PA 4OIXA 1VR6A 1SUQA 5IT4A 4USWA 1NPKA 1I51B 1UVKA 2DNPA 1TKDA 3ISND 1UL3A 2W4PA 2VBYA 1T95A 1Y00A 3HI9A 4KH1B 2DNKA 4CLTA 1BQMB 5ETLA 5D3GA 1K9MT 2YY3A 2LQ9A 4K7QA 3ZNUA 5C42A 4YY3J 4I7FB 3R6GB 4CNYA 2LP4A 4IDKA 5DS7A 3JTNA 2FTRA 3DRSB 5IXUA 2G9OA 2VONA 4ZHRA 1SIWB 1RT3B 4LBIA 3DLHA 3QWPA 2X3DA 2BJ8A 4Z7YA 3IO1A 4HH1A 4OV1A 2K7KA 3C16A 2JEFA 3QFWA 3T9ZA 1JLEB 1FNOA 1XMOJ 4ZKAA 2HWTA 4ZPDA 1OWXA 4KYZA 3QSYB 3OQ2A 3QZ7A 5KOWA 2RRAA 2YWWA 3RRHA 2QA4G 2DNMA 4G65A 3ITHA 2FHJD 1XMQJ 2BBEA 1FXLA 3AD7C 3MI7X 3QAUA 3MWBA 4L3NA 3WHIA 1SQEA 1S7IA 3L4BC 4KC5A 3CCRS 5KG5A 1WNEA 2NLWA 3WQPA 1U7LA 2U1AA 2BRKA 3KK2A 3JS9A 5FIIA 3TA0A 3D5MA 2DGXA 2FVPA 3M4XA 3DNCA 2BQUA 4F4KA 3FBEA 4KPCA 2LKZA 4WZQA 2ZITA 3PW4A 5KFJA 2OEKA 3VWSA 2BJEA 3B4MA 4C8YA 1H2TZ 1JLGB 1LOUA 2GMLA 1WG4A 1FFGB 1B99A 2QEXS 2D3UA 1U48A 2HZCA 3UDVA 2R3VA 2ZKTA 4USJC 5FLXU 2CJXB 4IRKA 1RLDA 2WVBA 5IWAF 5AXMA 1W7WA 1KVKA 2W4DA 4DU7A 5C7PA 2RHQB 4YR0A 2V4RA 3IXQA 2FGOA 5FDLA 4OV6A 2Y1IA 1OQ3A 1SH3A 2XTJP 3BF4A 4WCEQ 3SFGA 3CC4S 1VRTB 2RAQA 1OY8A 2KT5A 5KFAA 4TN2A 4MTPA 2VA3A 4TYBA 3LQVA 1YBUA 4DPUA 4HACA 3LP0A 1IM4A 1G3OA 2CQPA 1N6QA 4D3GA 4DLGA 1VIOA 3ZNJ1 2FGCA 2KRBA 4DX7A 2CWXA 1JLBA 4WYLA 1SI9A 3KJVA 3IGNA 4ERDA 2L08A 1HWKA 3IN5A 3SDEA 2LA4A 4UTGA 4F4WA 3QGGA 4JUZA 2C3YA 1MROB 3I5BA 2L9WA 4KO0A 5B0EA 2PI4A 4DUYF 8RUCA 1RHQB 3PHTA 4P2MA 1N5VA 3UVJA 4ZN3A 2GFFA 2IFXA 3MPYA 3C6TB 3VHQA 4ENOA 4NL5A 3DOKB 3TUZC 1WC5A 1CS4B 3PO4A 4DUTA 1GAOA 1TL7A 1VJQA 3HSDA 1S1WB 5K8NA 4DL7A 4I6YA 5J1NA 2WOMB 1Z4UA 5GADI 1SBRA 3MM5B 3G87A 2YH1A 3CCUS 1LQ9A 4DMZA 3VCDA 2LEBA 1JB0C 4UY85 2VPXB 3M6UA 2ZNYA 3BKUA 4IOAQ 3D54A 1GTEA 4DR5F 4CO1A 4LFBF 4LRCA 1CULA 4YOEA 4GMKA 4CLFA 3GG1A 3N4WA 3J7ZT 4IR1A 4OL8A 4X4VA 3MPUB 2GAGC 4ZVUB 1ZZNA 2VQEJ 1RYSA 4IG3A 4KHRA 3T3FA 2GGPB 1JLCB 1ZTTA 3AA8A 3TR5A 5EN1A 1S6QA 1YWXA 5E3CA 1UJ5A 3OR2A 1N52B 1QSYA 3BH7B 4DV6J 5J2PB 3CD0A 3AY0A 5IT0A 4NX9A 4M5DB 2HS3A 5A2QY 3OTEA 5GAHU 4P9SA 1PSDA 2UXDF 1ZBTA 2NXUA 4ZCLA 4J9QA 2D9OA 1C0TA 1G6BA 2J8AA 4RNOA 3TANA 5HLFB 2CKWA 3X1LB 1S1XB 2QLWA 1TMJA 4HKQA 1FA0A 2ZWOA 1T8EA 4RO0A 1EETB 2HYIB 2HGNA 4IG0A 2P9EA 2DRAA 3MR7A 4LR8A 1KQGB 3PV8A 1CJKA 1JLQB 5DDOC 2CPJA 3GIKA 1TTHB 3ET6A 4I2PB 4ZCIA 4DL3A 2IC3A 1SUQB 1WKKA 2C3UA 1EHWA 3IWLA 1IR0A 3MAHA 4DV1J 1VGYA 3R7NB 2GJ2A 3RR8A 3T5LA 3TEGA 1JXEA 5JVGQ 3JSYA 5D3GB 3PYGA 1GNKA 1LXNA 4G1PA 3AQPA 1D9DA 1U6ZA 3AH6A 5C42B 3WC0A 2MSTA 1H7WA 3ILOA 5CABA 4WF9Q 4M5IA 4BS2A 4IDKB 3A13A 4ZHRB 2CNKB 2QFIA 2CA9A 5B0GA 1BMQB 2YPZA 2GVDA 4PZVA 4F0KA 4NEYA 1FD8A 4ZMMA 4KFBA 1CC8A 1F1BB 5D78A 3C16B 2KVQE 2XO6A 1YBTA 1NHUA 3OL6A 4HHHA 2CJ9A 2M88A 1U2RA 2R7WA 3C46A 1R8HA 4N56A 2PMZD 2YNHA 2SXLA 3QYYA 3JYTA 4YP3A 1G2EA 1HNXF 1VDHA 1WEXA 5A0YA 3LO3A 3AFGA 1PGZA 4RR5A 1T9VA 1K1QA 2AJ4A 1Q7YT 4CI0B 1IBKF 5ETRA 1UEUA 3PW0A 2DH9A 3O5TB 1Q5YA 3LP2A 4KSEB 2MQOA 4ZVHA 4WJBA 4MT1A 3H5YA 3KK2B 5B08A 4IQXA 4MYUA 3NY0A 5F8HA 1RQ0A 5IV3A 4M5HA 1EX8A 2VL1A 5E33A 2B0GA 2KXFA 3OT9A 3I0RA 2R2TA 3L7OA 5KAKA 1TZ0A 4A8XA 3GIIA 4M5KA 4CO4A 4RNNA 4USVA 4KRWA 1VQSA 3KHHA 3G8QA 5JUMA 5KFFA 3R2DJ 1HBMA 3DOMA 1WC0A 1XERA 1VOMA 1SV5A 5C24A 5HMYA 1HL6A 3P49B 4OYOA 3PW7A 1FRIA 4UOHA 3H25A 2Y1LB 3QFHA 4HH0A 2I6WA 5JVHQ 2UVRA 4BWMA 1FO1A 1NJIT 1KQKA 3PYEA 1QUVA 1CQNA 1M5SA 5A2QU 5FDLB 2J6UA 1SKUB 2RDJA 1F9FA 4DUYJ 3LWLA 3AXMA 2UUBJ 2EKNA 2AEMA 5CD4H 3SYZA 2BRLA 2I9SA 4MK7A 2D41A 3DDKA 2WVCA 3KYLA 1TKXA 4R0EA 1SJ3P 1FJGF 1XNQJ 3DCAA 4HACB 4DR2J 1T9YA 3LP0B 1S59A 3I5CA 5F3TA 4K4XA 5KFYA 2ASJA 1N6QB 1D1UA 2C2NA 2B3TB 3MMAA 1WC3A 3PW5A 2M2BA 1TK5A 1KOOA 2JEJA 1JLBB 2DNZA 1EQ0A 4MMOA 1RHRB 4XDCA 5KFTA 2B7BB 1MLAA 2HHVA 4AXIA 1N8RT 5KFOA 1AFIA 1Q53A 4KO0B 3W5YA 2NUUG 1VFJA 2ZNZA 3LWMA 1KRPA 2MKHA 5JJBA 3UVJB 4DR5J 4HEA9 1BGXT 1SJFA 4LFBJ 2XGQA 3MCMA 2W2NP 1EJ7L 5LL6d 5ETPA 2FQQB 4QYRA 4Y2AA 1TL7B 2LQ5A 2ZJQQ 2DNYA 3ENAA 4EFAC 4CTAB 5IZHA 1ZA2B 2KG1A 1N54B 1HQ2A 3TAMA 1WELA 4PG4A 2Q79A 5HMWA 2LU2A 2HNYA 2XS2A 4OHYA 2LCWA 2OELA 4WFNQ 4KHPF 2R7QA 2XM3A 2D3OR 2J76E 1X9SA 5AXKA 3BH6B 2E66A 2NZ4A 1NU4A 2KZMA 4LQ3A 2EVZA 4USIA 3UE2A 4NLTA 4ATNA 2F3JA 2WAQD 3W8GA 4I67A 4IG3B 3PIOQ 5EWFA 1S79A 1TL3A 4LMZA 1TKTA 1QY7A 2ZC4A 4JI2F 1S57A 4TLQA 3OR2B 4NXNF 1VQNS 3SQGA 2NYHA 3G2XA 4LUBA 2V5HG 3BQ2A 3VAGA 4DV5F 1ITPA 1Q78A 3IS9B 1ZM3A 3R5JB 3V6KA 5E3PA 1OY6A 4AYBD 5B7WA 1QM9A 3Q83A 2XY5A 3WZ0A 4OZJA 3FCVA 3J7AN 5DQHA 4YUDA 3T1YJ 4W90B 2E7XA 2IA0A 1YLXA 3AHPA 1SCJB 4IG0B 3R1LA 2DISA 2KG0A 3MTJA 4E0DA 4NASA 3TA1A 1CJKB 1YG0A 2AYBA 3V81B 1X0PA 4WIIA 4PUOA 4H4KC 1ZAVA 2EPIA 3ET6B 4FF2A 3SV4A 4P71A 4O0NA 2MLZA 3CF5Q 1YJVA 2IC3B 3BQ0A 3LGMA 4ECRA 4JI7F 3FGVA 2FJDB 1R0CB 2F8HA 3NMAA 2B43A 3KLEA 3RAMA 4WE1A 4KGXB 2ILYA 2W9CA 3X3UA 4DR4F 2DEJA 5B0AA 3Q8QB 1KHWA 5D8HB 1HNXJ 1Q8LA 2PMWA 1KHVA 4A8YA 2ZHAA 1ZAXA 4B9TA 1OIAA 2BUNA 2FD2A 2AT1B 3QGIA 4AE5A 3PYFA 4JI4F 4QZVB 3S01A 4DPYA 1C1CA 3QIPA 2MY8A 4OLOA 2YX7A 4QQBA 2MQQA 1DURA 4PCQA 3MCSA 4DR3F 1RTHA 4KV8A 2B7CB 4F0HA 2OPQA 4KFBB 4V1Ak 4DL2A 3CSKA 3HT0A 4ECWA 1VQ7S 4ZDNA 4F3MA 3AA9A 4TY8A 2QRRA 1N36F 1NKEA 3H2LA 2YNHB 4FS1A 3JYTB 4JV0A 3KUGA 3QT8A 5A0YB 5K20B 4ECSA 3MM9A 1O51A 2IBKA 2OPRA 3I82A 3LP2B 5HANA 5AT1B 3AJ1A 3VALA 1YRTA 1RKJA 4HVZA 3JQMA 3F44A 2R7TA 2B4PA 3NGKA 2ASDA 2VPYB 3BN7A 5GMEA 2FLOA 3N79A 3I0RB 2LECA 3NS6A 1DLOA 1S1UA 3GFXA 1IN0A 4EUVA 3GG0A 1AUSL 3NNAA 3M2UA 1AROP 2ZOMA 3BS9A 1U1LA 1UAWA 2DRDA 3R5BA 1HBMB 3DOMB 2ZH2A 3EXCX 1SV5B 4MK9A 1KFDA 3FZ2A 3HO1A 5KTQA 5D0GA 1U2FA 3KUEA 4LFAF 5CH7B 4IR9A 3T5KA 2RU3A 4CT8A 2XULA 1WORA 1LW2A 1XR7A 3QAEA 4DN9A 3FK4A 4B3OA 2G2OA 4UQTA 4O3NA 1IKXB 4DDFA 3OD2A 3I32A 4RNMA 2VV5A 3TQEA 2VG5A 5CZXA 1X5PA 4URSA 3QT6A 4LF9F 5L9XA 1T11A 2KH9A 4DR1F 3CD7A 3MMAB 1LW0A 2J6SA 3M6XA 3N5BA 2CZ4A 2IA6A 1PJ5A 3CNQP 3MMJA 4OZ3A 2OMOA 3NWGA 1WEYA 2VPWB 4N5SA 1TU0B 3HCXA 3R27A 4P2XA 3D0IE 4XTTA 2MQ8A 2Z2ZA 3J81Y 2FJBB 3OJSA 3ZZRA 4LRFA 1MN9A 1HNZJ 1FWPA 3I9V9 1DQAA 1JNRB 4JI0J 2JJ4D 3TW0A 3G6ES 3GB0A 5CHCB 4TU7A 1UFKA 5K14A 1UWBA 4UZBA 1U1OA 2GV1A 1ZM4A 4LF6J 1NH8A 3KOAA 3N28A 3A3PB 2FUG9 3PKMA 2XNQA 1RCOB 3G96A 2H51B 3AXKA 3ISZA 5BYRA 2D69A 3TAMB 4XIUA 2UU9F 1NPPA 4DSIA 3M05A 2LYVA 4L74A 2HNYB 3UW1A 5KFSA 3BZQA 4Q2MA 1HKAA 4UT4A 4U95A 4DV5J 3FRYA 3ZZYA 2F4FA 4WXOA 2UVUA 2Q43A 4OYWA 2Z0GA 4XPCA 4ETZA 4FNIA 3HHLC 4EEYA 1VCTA 4UUWA 2HURA 2WW4A 1SPBP 3ONQA 2MTLA 4DL6A 2N3OA 3CJ5A 4X64F 3KLVA 4MKBA 1RDRA 1H98A 3GYXB 1OYDA 1TL3B 2M7SA 3PEHA 2YQ0A 1TKTB 2PMHA 4DX8H 3SV3A 3SQGB 3LANA 2KT2A 4DEZA 3CJ4A 5F8IA 4B9NA 3TARA 2QLFB 2W2PP 3E8OA 3FRZA 2VA2A 3M2RA 2YNIA 4ELVA 2JSXA 3ZTPA 4J9NA 2MZ1A 2HAIA 3J80Y 4CZCA 3PO5A 3NS5A 3RB6A 3TUIC 4K5RA 3HHDA 5H9FK 1PILA 1LKZA 2L9DA 2DHSA 3CJ3A 3D4JA 3CCJS 5F0WA 3QO9A 4PUOB 4K2XA 3RBXA 2CJAA 3UR0A 2Y1RI 1TL4A 1IXKA 3JTOA 4ZJLA 5GMKa 1SH0A 2ZVSA 5AE2A 3KLEB 2HFOA 4WE1B 4HT5A 5HQMA 4OMFG 1GH8A 2W9CB 1VLYA 4QIWD 2CPIA 1ZM2A 1PBAA 2EWHA 2YKPA 3D3BJ 2GS8A 4FF3A 2O5DA 2CQBA 2CPYA 1EKSA 3K8WA 3WBZA 1FX2A 3G6VA 1URRA 5H9FJ 4IFVA 3BPSP 4WWSA 1C1CB 3QIPB 3LPEA 3IA0A 2HVZA 2HFUA 3GE9A 4KV8B 2DCUB 1FTCA 1UA1A 2H5JB 5LMNJ 2OPQB 4JI1F 1S0VA 4OJGA 4YR3A 2VQFF 2Y0SD 3T6BA 4URGA 4IRDA 3J81U 3DRYA 4TY8B 3UD3P 3QIDA 1RACB 3CEDA 5K8OA 1W25A 5F3ZA 1UVJA 2OSRA 4ED8A 3CD6S 4OHVA 2ZM6F 3S1TA 1XN9A 2DHXA 2CFXA 2LLZA 3M9NB 4M95A 4ZJOA 3UFCX 3MM9B 2OPRB 2KI2A 3QWUA 3LF0A 1RT4A 1CQMA 2V8VA 4ITSA 2HIQA 2X3GA 5FJ4A 4KGZB 2R8IA 2RF2A 4NA2A 3K5PA 4RKUC 4B9VA 5GAHI 1SC6A 4LF8F 1DLOB 3NAIA 1WHWA 1S1UB 2BV3A 4DCOB 3HVTA 2DHGA 2VG7A 3KJQB 5ETQA 1J2VA 1KLMA 1VHFA 3M2UB 4PWDA 3ZC4A 4C3LA 4DUZF 1AZSB 3AT1B 1SL2A 1AA1B 2DJWA 1KDNA 5KFCA 1B0PA 3NS7B 3QJLA 4IUFA 1F3VA 4ER8A 2A6OA 1WHYA 3J7Z5 1VI7A 4NZ6A 1F9EB 2CNNB 2FIUA 4LF9J 3QRQA 2MPUA 4OI2A 3KWMA 5M2RA 5HVHA 4PYAA 1FVQA 2UUTA 3O44A 1XIQA 3CB4A 1BXNA 4R0JA 2XWYA 3BBFA 1DAXA 4A8FA 3P8BB 3HSGA 2JX2A 2KXHA 1LWCA 1N4LA 5D4NA 1FXRA 2CUYA 2ZE2A 3MR3A 2CDQA 3OVBA 1PO6A 5DZ6A 1LW2B 3SSSA 5KT6A 1Y5LB 3BGFA 4B3OB 4TU8A 2CQ1A 3A3NB 3R97A 4P74A 2KVIA 4AL6A 3J80U 2PC6A 4FF4A 3CWJA 4NLRA 2VG5B 4B3SF 5CCLA 3EGZA 2QMXA 2ZBQA 3MMBA 2YPYA 3L9ZA 2XCAA 1O8BA 2Y8YA 2OSQA 1C4AA 2E5LJ 1FWKA 1JKHB 1LW0B 4DSEA 1F5CA 2IM3A 2GMJA 3Q2TC 2YTCA 2P8IA 4O23A 2E1CA 2UU9J 1VQ8S 2BYCA 4Y2CA 1L3KA 5KFXA 2EXUA 2RT3A 2HFNA 5E3AA 2OI2A 3CXCR 3EX7B 2NCKL 1YK9A 4MIAA 4EU0A 2YBVA 3K89A 2BX6A 2HNZA 4KHMA 1ZPWX 2OGUA 4M63A 1RAGB 2W01A 4HL9A 1UVMA 5BJRA 5K14B 2VBWA 1UWBB 1PC5A 4LSNA 1HR0F 3HZGA 3MAAA 3MCNA 2K06A 3PEJA 2LMIA 1QSSA 2HQCA 5J1PA 3U02A 3R2CJ 3N6LA 1ZETA 1KFSA 4XPEA 1YKWA 3NLCA 3CCSS 4X4TA 2PO4A 5H9EK 1TELA 2VU5A 1XR6A 4RX6A 3IGVA 5SZTA 1IVZA 4I69A 4DG1A 4DZDA 1U1MA 1X5SA 2GNKA 2HVHA 5D0EA 4YB1P 5D15A 2JWNA 1IJEB 1IM6A 4DQIA 4RUAA 3BQ1A 1W2BR 1M5OC 9RUBA 5LMUF 2XEXA 2LDIA 4M5LA 2DY9A 5HQLA 1D9AA 1NDPA 2V8PA 3QMQA 4JB8B 1O6XA 4EYHB 3KHGA 1SH2A 4YFUA 3BO4A 2V9WA 2VH7A 3PRDA 5CYQA 3R5CA 2CQDA 3ZXWA 1BD6A 3DRRA 3ZTOA 1N5TA 4EBDA 1S72S 3K5MA 4BWJA 3QRRA 2CJBA 5HVFA 4M8LA 3PDNA 2KZZA 3UN3A 1S1VA 2EFQA 3TVZA 3OTBA 3FDSA 5F9LA 1VRUA 1RU2A 3M2RB 2YNIB 5ETMA 2MZSA 3HT3A 1RJJA 3TA2A 2HG4A 3NXZA 4DV0J 1ZPVA 2ROPA 1HNWJ 3Q89A 3W62A 2ZH6A 1NK4A 3CJ2A 3BYPA 1WI6A 2MKCA 4NCAA 4RW6A 5AJ3F 3US5A 1H73A 3QNWB 3KXDA 3QO9B 1Y0HA 4O3SA 1VQMS 3N6NA 5F8GA 4U9RA 3RW7A 2CJQA 2XYPB 1P1TA 2VUGA 1FE0A 3K8VA 3ULHA 5HAOA 1WSVA 2QMWA 1UVLA 2IY5B 4HYKA 3OL8A 2DNNA 4U7UD 5M2PA 4NYZA 3DHXA 2VJVA 2E5JA 2EC2A 1K73T 1AW0A 1SKWA 1UJ4A 1MMNA 3VGVA 2H4WB 4DFMA 2V34A 5DM7Q 4IFVB 2MKYA 3BSAA 2V2QA 4B3MJ 3BN4A 2XMUA 1HYSA 1T0TV 4F3OA 2R7VA 2HLUA 3G4SS 1OQ6A 3W5ZA 4LRAA 2CQ2A 1FNMA 5GADU 3DKDA 3NGTA 3KLFA 4DV4F 4P2SA 2J9EA 4OYXA 2O67A 1WUUA 2KB2A 2DVIA 2KFNA 4DUZJ 1NK7A 1T02A 3T9NA 4LSLA 5F0UA 5KG4A 2ADCA 1K47A 3PVXA 1FRMA 3NOCA 2V67A 1OPIA 4C3KA 3NP5A 1NXIA 1RT4B 2R4FA 4DU8A 1S1TA 1JLFA 5CAAA 5HJXA 2I2YA 2ZH4A 1QE1A 2W2QP 1FF2A 1D9FA 3AQOA 1VBXA 3GFHA 3IR6B 2GIRA 2RF2B 1DQ8A 4PPDA 1VQ4S 2DD8S 1WACA 4O0IA 4PXEA 4B3TJ 5L1LA 1RA7A 3HVTB 2VG7B 3OV7A 1KLMB 4LT6A 1VK3A 1ZYQA 1NJXA 3F41A 1AUDA 4LF5F 5IQ6A 3O3LA 5DGBA 3GQCA 1NKBA 3P5TL 1MMLA 4B3SJ 3KDOA 4N47A 2B5JA 2BJDA 2XI3A 1CPZA 3DLLQ 4ICLA 4OHXA 3DGPA 1NLKL 2WBRA 4LRBA 1RAOA 4DR7J 1LWCB 4URQU 4OJHA 4JV5J 2HWHA 1SB6A 2ZE2B 1WOPA 1S4FA 2BKPA 2HQ3A 3KHRA 2AEFA 1ZM9A 4K4TA 1T7PA 1PC4A 4B17A 4A8OA 3RR7A 3CO0P 4S0MA 1X4DA 2QC3A 4WTYA 4RUCA 1GX5A 1SQFA 1HW9A 1IBLJ 1WDDA 1U25A 3HK2A 3MMBB 1MMDA 3D9BA 4XO0A 2Z2MA 3BV8A 1HWIA 2XGPA 1FWLA 1Q81T 2AQ4A 3IAM9 1HR0J 3PM9A 2AJ1A 3BPDA 2WB1D 2BR0A 3H4DA 3DLJA 2BVZA 3HPOA 5CYJA 2DCLA 2HHPA 1M90T 1NRKA 1LEOA 2WSCC 4CLKA 1RLCL 3BO3A 2Y0BB 1HWUA 4UOCA 5KFIA 2HNZB 2AP6A 2JC0A 2JOQA 3U1LA 2B9XA 3FCHA 2ZBRA 1BLUA 4K4UA 2E7WA 4WU2A 2DKOB 4ZVGA 2OEMA 4PRFA 2H5IB 4LSNB 4NCGA 4PXBA 5GAEU 4LREA 5CD4A 2QLJB 4I4BA 3MAAB 2E5GA 3I9ZA 3KFWX 4WBFA 2HHXA 1IKYA 1X60A 2D9PA 5B0BA 2DGOA 1N5YA 2JRSA 3L7PA 4F36A 1HD0A 2IPOB 2CQHA 4ZA1A 2CAJA 1VS3A 2BW2A 2A6MA 3CDUA 4C98A 4F4AA 5DQGA 2AIRB 3BEGB 3OXLA 3PXGa 3A3OB 2D3ZA 2IJRA 4QPTA 4DG1B 1SKRA 5HATA 3GIJA 3D7SB 4ETXA 1Y5IB 2DGWA 4HDGA 2ZKUA 3IBCB 2EI5A 5C2CA 4E8UA 2IAJA 1UCNA 4NLPA 1KN6A 4LF7F 1XR5A 9ATCB 3PJ9A 1NKCA 4LFCJ 5I3UA 5CYQB 2VASA 3DRRB 2DNLA 4I6AA 2QYCA 2D3O1 5A8KA 4DLEA 4M5NA 2I38A 2DRBA 1DARA 4RNFA 1H2UX 2XHCA 5EWEA 2UVWA 4KPYA 1S1VB 4OQJA 4JI3F 1YRUA 4L3KA 1OMSA 1VRUB 3PJXA 2IYIA 3Q24A 2FJXA 4A8MP 4ZPWR 4QIFA 5L9NA 2BOPA 1B7FA 1NB2A 2NSCA 1WF0A 3CDEA 3PG9A 4RW6B 5D4OA 4DPXA 2XLKA 4CIOA 1QUPA 4BDPA 1S76D 3MF5A 2AMCB 3NGSA 4RNHA 4L75A 3FVYA 3SEOA 1FJEB 4UW2A 3UN2A 2B56A 3FMBA 3EICA 4U8VA 3GU0A 3OTOJ 1ZH5A 4DV4J 2DEIA 2EBGA 2OJ3A 4ZP6A 1TAQA 3FSXA 1S77D 4PEOA 1WG1A 2G1HA 2CQ3A 4NOHA 2XZTB 4ECTA 2DXDA 1FKPA 3CD5A 1X0FA 2ZOFA 2P6TA 1Y4ZB 4YY3F 5A76A 1M1HA 3TZWA 1HHTP 4TYAA 4DR6F 4K4YA 4OZLA 2R2SA 1GTHA 2ZFHA 5L46A 1OYEA 2HVDA 2OKQA 3FSYA 3VTIA 3TQ1A 1HYSB 3AB2B 2NZCA 1Y3KA 4GO7X 1F5BA 1YVFA 3ZZZA 4OYIA 1GQEA 3B4DA 4X66F 3KNAA 4JI5F 2GCFA 3OXGA 1R7IA 1YITS 3KLFB 3HSJA 1XMOF 3Q22A 2CZVC 5HP1A 1VQLS 5GVQA 3H20A 2UXCF 1UZDA 4U8YA 2QA2A 2FPHX 4DV2J 2L9NA 2B4VA 2R42A 1XMQF 5KFZA 1KLNA 4GKJJ 2AD9A 1Y9OA 1NB7A 1MN7A 2YKAA 1S1TB 4DX6A 1JLFB 1JMTA 1QE1B 3W7BA 5LSRA 4AD6A 3C3LA 5ETSA 3GIRA 3MDFA 2ASLA 1L3SA 1U2CA 1GMVA 2R7SA 2OTLS 4YB7A 1LWEA 4N8OA 2KFYA 1SJRA 1NDLA 3UDCA 2LQBA 1YJUA 2M3DA 3MEKA 1Y10A 2IBOA 3GJQB 4UF4A 4H4OA 1B64A 1P9QC 4GKKJ 2DBBA 1M5KC 4EYIB 2B5JB 3IR7B 1X4FA 2CDRB 4ZIWA 3DGPB 4L72B 1IQZA 3Q8YA 5ETOA 2GAHC 1RSCA 2G2ZA 1KVIA 2QT7A 1WOSA 2F7VA 3M6VA 1TMMA 4CLYA 3EZOA 1F6TA 3FSIA 1TK8A 1P8GA 1NK8A 2V2KA 2E5IA 3W61A 2YWFA 3IFEA 1E6YA 2XY6A 1RWPB 1RB0A 1F2HA 3TZYA 4QWAA 3RB0A 2IRUA 3UO0A 4PXCA 2IRYA 2UV8G 3RJMB 2LU1A 1RTDA 2RH3A 2QMUB 4HLBA 5EX3A 1KD1T 1YQHA 3GR1A 2B51A 3G9CA 4FKYA 1Q82T 1RHJB 1AYEA 3Q8UA 4H4KA 1EAYC 4YEAA 3ZTQA 1YHQS 3SCIE 2V4QA 3C15A 1HA1A 3TYTA 5KFMA 2BANA 1HWJA 3I4PA 3NEKA 3CJKA 1RTJA 3DN9A 2CQGA 7FD1A 4TLRA 2ILZA 2FB0A 4NLOA 3CJ0A 1NK9A 2H4YB 2DY1A 5E7OB 4ZITA 2BJ3A 1RT5A 3H4BA 4QYZK 4Y2MA 5DDPC 4IFYA 4DL5A 4OJ1A 1RWUA 3H7HB 3MCOA 4KGKA 2LVWA 3ZO7A 3EXYA 4N77A 2C3OA 4PWUA 5EGYA 4F67A 5EHHA 3IBFB 1V5IB 3DMJA 5C25A 1N56A 1RBLA 2MZQA 2J9DA 1KSPA 4ZVTB 3POTA 2DT9A 2Z57B 1NMEB 3Q8SB 5IT9Y 3AOAA 2NXJA 3LA0A 4X84A 4WKRA 3MM8A 1WWHA 3BO2A 1IKYB 1FDDA 1N5YB 1KTQA 5HSPA 4ELUA 4QU7A 1G1XA 3WC2A 4WP9A 1P6TA 1ULRA 1YRXA 3TJ8A 5DLFA 1V3RA 4Y00A 2VFRA 4P75A 3D2WA 1Q1KA 2VJUA 4YB5A 4XDDA 4CWBA 2E29A 3D67A 2YWKA 3WX8A 2IAJB 2QLBB 4CM2A 4ALZA 2KHDA 2HNDA 3VGTA 5D6GA 5HL7Q 1HI1A 2VQEF 3KG1A 4RJVA 3VVTA 3DU6A 5I3UB 1XC9A 1QAJA 4PAAA 5A8KB 1UFWA 1MWYA 1FESA 1PCAA 2QA1A 3BBCA 2OMLA 4Y6IA 3M8SA 3SZ2A 4ZCKA 4J91A 3I96A 2XMKA 2A18A 1TL1B 4LIRA 4B9LA 2QN6B 1RWNB 3EPGA 3GSIA 3VAHA 3BKFA 3CT9A 1XBWA 1P9YA 4WXWA 1O0PA 3M1VA 4DR6J 1X5TA 4IO1A 2VD3A 3V4IA 4AXJA 4YHHF 4NYOA 3UR3C 1A7GE 2XHWA 1D8YA 1MSWD 2MEWA 4X66J 4OYAA 4JI5J 4DV3J 4PQUA 2Z4PA 3TZZA 4OYZA 3K5LA 1F2GA 3BSOA 5KOXA 4CH1A 1P1LA 3MR6A 4DV1F 4Y0FA 1FKPB 1HHSA 2NR0A 4J9PA 2BE7D 2MQNA 2UXCJ 2CVIA 5HMXA 4V19X 4F02A 4R8UA 3DI6A 3EDRB 1GX6A 2VG6A 3IRWP 5HBMA 4DBQA 4CO0A 3H0PA 4H4MA 4RW9A 1H74A 4X4OA 2DR5A 3HX9A 3OVSA 1C1BA 1NEEA 3H2VE 4DOZA 3ICLA 2MKJA 3CULA 1Q5VA 3OHBA 3VAMA 2MHNA 2H3EB 4WPAA 1NJYA 1RWVB 4J7CA 2R8HA 3A12A 5IC4B 3B78A 3EJMA 1VC0A 1HARA 1I5OB 4LBPA 2Z2YB 2NPIA 2UVVA 4FPRA 2R7OA 4K4SA 5IT9U 1RU1A 1RBAA 2MJNA 3KK1A 4WFYA 2NSBA 2FLPA 2C2DA 3F73A 2IMOA 4FXWA 4F2SA 1HNVA 3TOQA 3IRXA 2ROEA 2DNRA 5E41A 3HHLA 4AQYJ 3W64A 5L1IA 1Q95G 4RBTA 2KO1A 1UWAA 4H4OB 4QIEA 1HD1A 4HR2A 5IOLA 3BDPA 2POKA 2UUCJ 2WBMA 1NJZA 4Y65A 5A6WA 2J0QD 3EM1A 2CQ0A 4KH0B 3CCES 1RK8A 2LFVA 4AUKA 4O44A 3FFIA 3TO8A 2AJQA 2OPPA 3ZFVA 3C2PA 1Y7PA 4K4VA 4Q7AA 4DV7F 1U1QA 3TVKA 3DXBA 4OX6A 2JDJA 4KJIA 2NREA 1DHMA 4C8MA 1D0EA 1WC6A 1DTQA 4UQGA 3WIUA 3MEGA 3I5AA 1TFWA 4DFKA 1E6YB 4F04B 4LF4F 1ZA1B 4Q45A 4X4RA 3CJSA 2C3PA 5AXNA 4QWDA 1S0MA 3V6DA 1WC4A 1LWXA 2UUBF 3M9OB 1DY3A 1Q8KA 1FVSA 3DGVA 3PFEA 1U1NA 4DF4A 1XNQF 4UOGA 4QWBA 4K5SA 2J0WA 4DR2F 4M1KA 3C15B 2F40A 3R8YA 4O3OA 2BANB 1Q8IA 3DLEA 1RTJB 1N32F 4KAIA 3RRKA 4L73A 4ZPAA 1KNZA 2BJ9A 1VQ9S 1FTRA 3UNYA 4CO5A 4FYVB 4E2FB 1RT5B 2W9BA 2FZGB 4IFYB 4ZCMA 1HWLA 3W2VA 3JB9k 1UETA 2DIUA 4DQSA 2WHOA 4LR9A 4BCAA 4DN0A 2HWIA 2DH8A 5L38A 3DMJB 5C25B 1UZHA 2HGMA 3E3XA 1TR0A 1NCLA 3POTB 2HBRB 4HHUA 2OP5A 3RBZA 5T7LA 2E1MC 4KBIA 3MM8B 1X8DA 2Z2LA 3OVAA 4J9LA 1S6OA 1RAEB 3RB3A 2BZ2A 2W25A 2NUHA 2XYHB 2N4DA 4C0OC 5F8MA 4NLXA 1UA0A 3QLHA 1YIJS 2RDDA 5I4MA 2DH7A 2XS7A 4ID5A 1NH7A 3SIPB 3G8TA 2H5EA 2JLFA 3JQKA 5DGAA 1R89A 4L6V3 2R9LA 4ILRA 2DXFA 3FBFA 5KFWA 4DX5A 4DSKA 2Q3PA 2BXJA 3PX6A 2HNDB 2U2FA 2ZWPA 1PJ6A 2UUAJ 2ROGA 1PG5B 3QBCA 1U1RA 3BJYA 2QYGA 3P5BP 1IWGA 4YHHJ 3VV2B 1WD6A 4OLPA 3BDEA 3OTCA 3VGSA 3EZUA 4DQPA 5FD1A 1LWFA 1N33F 3FQLA 2ZH3A 2N7YA 1OO0B 2BDPA 2EFOA 1RT6A 1RTZA 2DPJA 5B09A 4JP8A 4B9SA 2RJZA 2C3MA 1BE4A 2MDAA 2VFVA 3VAJA 4U7CA 1VK8A 3DM2A 1VLOA 3T1YF 2YNGA 3M1VB 2DGUA 2UUWA 2K7JA 4IOCQ 3A8EA 4C8NA 4QU6A 3V4IB 3TUPA 1A6LA 2XMMA 2JLGA 1HNIA 3BR9A 2IVFB 2AF6A 3DOLA 5EX0A 4ES2A 4Y34A 4OFZA 4U67Q 3FEZA 4PQUB 1NHVA 2QL7B 2Y3YA 4FP9A 3D0HE 3R7SB 3QPIA 2HFSA 1R0AA 1RI7A 4RU2A 4EO6A 4FNHA 3ITHB 5GAEI 5HVGA 2H1YA 4R8UB 3DI6B 2C2OB 2WONA 2VG6B 1QTNB 3MEEA 4JYAJ 5HBMB 2HK2A
chains in the Genus database with same CATH topology
2OFHX 2HFNA 1EP4A 3KLGA 4OI3A 5C42A 5E3AA 4H4MB 3CXCR 1JJ4A 4I7FB 4RW9B 3EX7B 2YWHA 1R8BA 3VAKA 4B02A 2IM2A 4CNYA 2CYYA 4MIAA 4RW8A 2FLLA 1F5AA 4IDKA 4KQZA 5DS7A 4DF8A 1S97A 4EU0A 3JTNA 3OR1B 3V6JA 2FTRA 3DRSB 3TUJC 1SIZA 2G9OA 5IXUA 1W2IA 2HNZA 1ZPWX 4KHMA 2W8KA 4EO8A 2VONA 3FQKA 4ZHRA 4M63A 2OD6A 1SIWB 2FJVA 4TKTA 5KFEA 3D0GE 1RT3B 3IWNC 3DLHA 3QWPA 4HL9A 1KC8T 1UVMA 5BJRA 5HN0A 4HT7A 3OFFA 2M70A 3IO1A 4HH1A 4OV1A 3PNIA 5K14B 2VBWA 1UWBB 2K7KA 3ENWA 1PC5A 5BYQA 2JEFA 2FHMA 3T9ZA 4LSNA 1JLEB 3M8QA 1FNOA 4N41A 2BE2A 1HR0F 3H5UA 4ZKAA 2HWTA 3HZGA 3CC2S 5L1KA 2ZDPA 4ZPDA 1OWXA 1JX4A 4CO3A 2HHHF 1TV6A 3OQ2A 1S6UA 3LGNA 1JKHA 4WFBQ 3PEJA 2LMIA 1QSSA 3QZ7A 3RU0A 5KOWA 5J1PA 2RRAA 2KJWA 3RRHA 2ATLA 3U02A 2EBEA 3N6LA 2QA4G 1ZETA 2DNMA 5L1JA 1KFSA 1U26A 3ITHA 5M2UA 4XPEA 2FHJD 2CPEA 3NLCA 4X4TA 2PO4A 3KK3A 3CCSS 3J7YU 2BBEA 1FXLA 3MI7X 5I42A 3QAUA 3MWBA 3PX0A 1XR6A 2E5HA 4O3PA 4L3NA 3DLBA 1SQEA 4RX6A 3DRXA 1MNEA 3IGVA 5SZTA 4KC5A 4AL7A 3CCRS 3PX4A 3KHLA 1MW7A 5KG5A 1WNEA 2NLWA 4QR2A 4NLYA 2VKZG 4I69A 4DG1A 1VJWA 1U7LA 2U1AA 4LQ9A 1U1MA 2BRKA 1X5SA 2GNKA 2HVHA 3KK2A 2I0XA 2HRYA 3M30A 5FIIA 4RBVA 4YDXA 3NCQA 2EFVA 4YB1P 2JWNA 3TA0A 3D5MA 1IJEB 1HNVB 2DGXA 2F9JA 1H3DA 4RUAA 4DQIA 4C9DA 1X4BA 3H5SA 1D8ZA 3IRXB 3K58A 2FVPA 3M4XA 2O01C 3BQ1A 5J2QA 1W2BR 1M5OC 3DNCA 3HHLB 2BQUA 4AL5A 4F4KA 3LH2S 5DG9A 1RT3A 2XEXA 3TNVA 2LDIA 5LMUF 2LEPA 1FKOA 2XI2A 4XAKA 3KG0A 4A8SA 4C8KA 3CCZA 3KNGA 2O1PA 1CVJA 1D9AA 1S6PA 2GO8A 3QMQA 2DO4A 2LKZA 4EYHB 3ZZTA 4G3IA 2ZITA 3PW4A 3KHGA 1SH2A 4WZQA 5KFJA 5DJBA 3VWSA 4YFUA 3J7A1 3BO4A 3UD4P 2V9WA 2VH7A 3PRDA 3V2UC 5CYQA 3R5CA 4NRUA 2BJEA 2CQDA 3B4MA 2JVOA 1BD6A 3DRRA 4WU3A 3PZPA 1N5TA 4C2MA 5F9NA 2VOOA 4C8YA 1FERA 4WZMA 1H2TZ 1JLGB 4QWCA 1LOUA 2GMLA 1WG4A 3FFIB 4O44B 2GA7A 4BHQA 4EBDA 1S72S 2OPPB 3K5MA 2AYGA 4BWJA 2WTFA 1JJ2R 2CJBA 3PR5B 3C8YA 3HHLD 2ZBCA 4M8LA 2IM0A 3PDNA 2QEXS 2KZZA 1R43A 1S1VA 1VQOS 2QSFA 4TQSA 2D3UA 1U48A 1RT7B 2EFQA 2HZCA 3TVZA 3OTBA 1HI0P 1SL0A 1Q79A 3FDSA 2ZKTA 3IC1A 4USJC 1VRUA 5F9LA 3U7JA 4CQ1A 3M2RB 2YNIB 1T05A 1SJ1A 3KJVB 1U8SA 2MZSA 4GC7A 4G1IA 3HT3A 4IRKA 2K1RB 4Q44A 2DITA 2E44A 3MTKA 1MWZA 1RJJA 4QR1A 5E5NA 1DTQB 3MEGB 4IH6A 2NYIA 3TA2A 1SXLA 2HG4A 4NZ7A 2YX4A 5IWAF 5AXMA 3SI8A 5KFRA 3SDEB 4ZPVR 3T5HA 2LDYA 1ZPVA 2ROPA 4J5OA 2GHVC 2W4DA 3CO9A 4YR0A 2V4RA 1TL5A 3IXQA 2ZH6A 2FGOA 3DRPB 3NGDA 3CJ2A 4DS5A 3G86A 3D1QA 5FDLA 1WI6A 2MKCA 3T6JA 3G6XA 1N34F 2QO3A 4NCAA 4RW6A 3K0JA 2Y1IA 2WCXA 4RW4A 3I31A 5AJ3F 3V6DB 1NK4A 1AFJA 1OQ3A 1SH3A 1U1KA 3US5A 3BF4A 4WCEQ 1BY9A 3SFGA 3HKZD 3CC4S 2OO4A 2DPIA 3QO9B 4QW9A 1Y0HA 1VRTB 3ETOA 4O3SA 3KLHA 2CVEA 2RS8A 4J9MA 3H98A 1QVGR 2KT5A 2YQ3A 3EUNA 5KFAA 1VQMS 3N6NA 1TKZB 4TN2A 1BWEA 1QLNA 3HMJG 4QR0A 5F8GA 4U9RA 3RW7A 4DV3F 2CJQA 1JK9B 4MTPA 2VA3A 3VZHA 1BQNA 4TYBA 3LQVA 3R1HA 1IJFB 1WHVA 1P1TA 4G1QB 2VUGA 4ED0A 4NZ0A 4R5PA 5I3PA 5ITHA 1KONA 3ZZ0A 4I2QA 4HI1A 2CJKA 1FE0A 4QW8A 5E2QA 3LP0A 3T19A 1IM4A 1G3OA 2CQPA 1N6QA 3K8VA 1FRLA 3ULHA 1M5PC 4D3GA 1QAXA 3RTVA 4DLGA 4EGLA 2QMWA 4LSLB 1VIOA 3PKYA 1UVLA 2FGCA 1QTMA 3U1MA 2KDOA 4HYKA 3GFYA 5D4LA 4YDDB 3OL8A 2KRBA 3R3TA 1V6HA 6FD1A 3OLBA 3P96A 2DNNA 2OH2A 2D7SA 2X1GA 1RYRA 4NLDA 1JLBA 1SKSA 4WYLA 1SI9A 3KJVA 2KJVA 5M2PA 4NYZA 5AXLA 2I1RA 3DHXA 1Z1ZA 3QGHA 3IGNA 2MZTA 2E5JA 4TY9A 5D4PA 4ILLA 2W9BB 4ERDA 1K73T 1AW0A 2L08A 3T5JA 1SKWA 3HDSA 1HWKA 3IN5A 1UJ4A 3SDEA 1MMNA 2LA4A 4F4WA 3QGGA 4JUZA 3W2VB 1UKUA 2KKHA 7FDRA 4DFMA 5DM7Q 2C3YA 1MROB 3I5BA 1HQUA 4IFVB 1YJ9S 2L9WA 3BGRB 4KO0A 1XEZA 5B0EA 5DDQC 5F8LA 1HBNA 2PI4A 4DUYF 3BSAA 1HNZF 1U47A 5B0FA 5E0OA 3AAWB 1GXLA 3BN4A 2XMUA 2RUGA 3OFGA 1N5VA 4F3OA 1HYSA 2R7VA 4JI0F 1K0VA 2HLUA 5THWA 1O5JA 3G4SS 4QPXA 2GFFA 2IFXA 1OQ6A 1OPZA 1X4GA 2CQ2A 1FNMA 3MPYA 2YKNB 3ZZOA 1FRKA 4FVCA 3C6TB 3RYLA 3MMCA 5GADU 4NL5A 3DOKB 3TUZC 3MM7A 2I5JA 2J5AA 3C6UA 4A47A 5T7LB 3PO4A 5DRKA 3KLFA 4DV4F 4LF6F 4P2SA 1GAOA 2J9EA 3I0SA 3BSNA 2O67A 4JI6F 4OJ3A 2KB2A 1S1WB 2DVIA 5K8NA 4DL7A 2KFNA 4I6YA 5J1NA 2WOMB 1NK7A 2RQMA 1T02A 3DU5A 1S6QB 1Z4UA 3Q8RB 1XK8A 1UP1A 1K1SA 2N82B 3T9NA 4LSLA 5F0UA 5GADI 5KG4A 3HXMA 2JFKA 1SBRA 3MM5B 4ZPTR 3MGJA 2ADCA 3DYAB 2F1FA 1CG2A 5A8WB 1ZAWA 3FEYB 1LFWA 2X51A 3PVXA 2GHPA 4ICLB 2R8JA 3AB4B 2YH0A 1FRMA 1OPIA 2YH1A 4C3KA 2RQKA 3NP5A 3OFHA 3OUYB 3CCUS 1LQ9A 4DMZA 3VCDA 4ED2A 4ID5B 2LEBA 3BREA 2R4FA 1RT4B 1JB0C 4UY85 1S1TA 4F3QA 2VPXB 5MLCV 1JLFA 2GMHA 3M6UA 2I2YA 2ZNYA 2ZH4A 1QE1A 4IOAQ 3D54A 1FCAA 4RLEA 2IRXA 4F50A 1FF2A 1D9FA 2W7OA 3KG4A 1GTEA 3AQOA 3GFHA 1VBXA 3IR6B 3NNHA 1C0TB 1TVRA 2GIRA 2RF2B 2NQPA 1DQ8A 2J9DE 4PPDA 2QLXA 1VQ4S 4DR5F 2DD8S 4CO1A 3FMWA 1LV5A 4LFBF 2EFPA 4AQYF 1H38A 1WACA 4O0IA 1H0HB 4YOEA 1RKIA 2RVJA