3EVOA

Crystal structure of the mimivirus ndk +kpn mutant complexed with dtdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3evoA00
1F3FA 3L7UA 4F4AA 1HHQA 5C7PA 4FKYA 4ANEA 4DI6A 2HVDA 5BXIA 1XQIA 1ZS6A 1PAEX 1NLKL 3FBFA 1NCLA 3GPAA 1NDCA 1U8WA 4C6AA 2B8QA 2HURA 2DXEA 4UOGA 1PKUA 3BBFA 3GP9A 3ZTRA 4O0NA 2BEFA 1B4SA 1EHWA 2DYAA 1NDPA 1NSQA 1HLWA 3VVUA 1NUEA 4CP5A 4ENOA 4F36A 1NSPA 3B54A 4ANDA 1UCNA 4EK2A 3Q86A 1NPKA 3DKDA 2VU5A 1MN7A 4KPCA 3EM1A 3WX8A 2ZUAA 1KDNA 1B99A 1JXVA 3FBCA 2AZ1A 2B8PA 3R9LA 1BUXA 2DXFA 3EE3A 1W7WA 3BH6B 3EVOA 4W98A 2NCKL 3FBEA 1MN9A 3FBBA 3Q89A 3ZTQA 3FCVA 3G2XA 1NDKA 3BBBA 3FC9A 1BE4A 1NSKL 1XIQA 3ZTPA 4ANCA 3VGUA 3PRVA 3EICA 4HR2A 1NHKL 3EVMA 3MPDA 3DDIA 5IOLA 3NGSA 4UOHA 4FKXA 3NGUA 4DZ6A 5CAAA 3FKBA 1S5ZA 1VYAA 1S57A 1WKJA 1WKKA 3Q83A 2HVEA 3BH7B 1F6TA 1K44A 2BX6A 4WBFA 3JS9A 3NGRA 3EJMA 2AZ3A 3VGVA 3ZTSA 3VGTA 3ENAA 3ELHA 3Q8UA 3Q8VA 3FCWA 3B6BA 3VVTA 2DXDA 1S59A 1NB2A 1NDLA 3PJ9A 5CABA 1BHNA 4UOFA 2DY9A 1LEOA 1HIYA 3ZTOA 3ETMA 3NGTA 3VGSA 3EMTA 4S0MA 3Q8YA 3BBCA 3EVWA 1WKLA 4DUTA 2CWKA 1LWXA
chains in the Genus database with same CATH superfamily
3DLJA 2F8HA 1S6QA 2KT2A 2EG2A 4PPZA 4HTJA 1BWEA 3S7RA 1N54B 3CD6S 3LP1B 4DI6A 2HVDA 2MLXA 3MECB 3MM5B 3N9UC 4ICLB 2GGPB 1RHJB 1C1BA 1LWEB 2C3MA 3GPAA 2XO6A 3KJVB 1FTRA 4I6YA 1YDLA 4MK7A 3FFIA 3MECA 2M8HA 4BC9A 4EUVA 4BLGA 3TAMA 4YHHF 3UVJB 2WBRA 4Q8EA 3Q23A 2CUYA 5KG2A 5LT5A 1FERA 2KXNB 2P5VA 3ZTRA 2VQFF 1ZETA 2LFVA 2KXFA 4X4RA 2FVRA 1K0TA 1S4EA 4RW7A 4KHPJ 3MD3A 2HNDA 3IC1A 4I7FB 3W9IA 2R7UA 3MM6B 1HLWA 3SSRA 1HBNB 3LGHA 2YNFB 5GVQA 2VZ9A 1QSSA 2LDYA 5BYRA 5B0DA 2OSRA 5B0EA 3CCJS 2C2EA 4GKJF 1P8GA 1UFKA 2P8IA 2X1BA 3BZQA 2MQOA 4OX9F 3MAQA 4G65A 2LVWA 3HX9A 3CJKB 3MR7A 3O5TB 1S9EA 4LR7A 4EMDA 2N7CA 2KT3A 2OPQA 4U7UK 2Y1JA 1KEKA 4FF4A 1BUXA 4IG0A 2VD3A 2Z56B 3F73A 4YQWA 3T5JA 2IMWP 4RU2A 4ECSA 1Q1KA 2RRBA 3D68A 2EI5A 5EUHA 3W8GA 5HQ8A 1PO6A 4ZVRB 3LF0A 3G82A 1WG1A 4RL1A 4GO7X 4ECVA 3LWMA 1KFSA 3H7HB 2F9JA 3M1VB 3DLEB 4IH5A 2XMAA 5J1EA 1KSPA 3KMQA 3ISZA 3O3LA 3THTA 3M05A 2KB2A 4ZIWA 1IKVB 5J2PB 2HKEA 2C3YA 4LSZB 3C14B 4PEOA 4ZP8A 2PSZA 4ZVPB 1H3DA 2QGFB 4A48A 5HMZA 4LSLA 1NAQA 3EICA 2VG7B 3BN7A 3V5RA 1FKOA 1YBAA 2WCXA 3RBZA 2QT7A 2DNHA 5ETMA 5KFAA 4QBUA 2HHHF 2ZH4A 3VAMA 2UUCJ 2VICA 2BJ1A 1X5SA 2CA9A 2FLOA 1DTTB 3FSXA 2BE7D 2D41A 1S4FA 2AX0A 4L3KA 3KLIA 5LM7E 3W65A 4DL4A 1JMTA 4P7VA 4USUA 2LKZA 1HBMA 2XI2A 2DHHA 1YI2S 5F8MA 2ZC4A 4XDCA 3DLBA 4RLEA 4RW4A 2JEGA 1BD6A 1VHFA 2ZWOA 3DGPA 3R5CA 4Z2XA 2J0SD 3JS9A 4M5HA 2DGTA 4Y34A 5E7OB 5LSRA 4J9KA 3BQ2A 4TVAB 2GS8A 4RW4B 3FGVA 4C11B 3KK3B 1ZM9A 3BGLA 4A8KA 2MY8A 4ED2A 3UW1A 1VQKS 4FF1A 1N0VC 3Q8VA 4YEAA 2IVFB 3HP6A 1DURA 3KUGA 4RNOA 2MGZB 3Q24A 1F3VA 3J7A1 3PX6A 1NDLA 5I4MA 1FKOB 1G6BA 3LPEA 5RUBA 5CQGA 2CQPA 1LEOA 3HHLD 2E5LF 1FXLA 1M0SA 5M2PA 3PIOQ 3VGSA 1U25A 3M2VB 5J1EB 2EFOA 3ZZOA 2WSEC 2FUG9 3TOQA 2D9PA 2DJWA 1SKSA 3QAEA 1D0EA 1FJ7A 1U2CA 4X4VA 4LRDA 1R0CB 3MEGB 3H5SA 4WPAA 2HZVA 2HK3A 4DV7J 2J9EA 1XK8A 4XK8C 1VI7A 3G6XA 4OZ0A 4CO1A 5DQHA 1JJ2R 2A0FB 4LFAF 4OV1A 3GLJA 4X65J 4R5PA 4DV0J 1FA0A 1LXJA 4N47A 3UNGC 3RRHA 1HBOA 5C2GA 1SH3A 4X4TA 3BM7A 1YHQS 1NJYA 1Q82T 4C8NA 4IOAQ 4C4WA 4DR4J 4CT9A 3LAMA 2IRYA 2FY1A 1UPPA 1LK7A 1LWFA 5FDLB 4DS5A 1QD1A 3CE8A 4XPCA 4GC7A 1EP4A 2LEBA 4OX8A 4NASA 1P27B 1T9TA 2QSFA 2X7IA 1JKHB 2FJAB 2Q3PA 4LREA 4B9UA 4X84A 5KFVA 1EHWA 2ZZMA 1LWCB 4JI3F 2LDIA 1WUUA 2Z4PA 2K06A 2LQ8A 5T7LA 4ZPBA 5U47A 3ICLA 3ZC4A 4ZJLA 2G0CA 1AZSA 2YWGA 5D77A 2YPYA 3H25A 2W8LA 1YJUA 2V8HA 5CXTA 4JI3J 3CDWA 4MK8A 3KLGA 2W7OA 2XB2D 5CH7B 2ZUGA 5KT2A 2JFKA 3NBPA 4MJKA 3IRWP 1T9YA 1RAJA 3E01B 2UVWA 2VFTA 3IFEA 4YN3B 2IHR1 2NCKL 4URGA 4WFXA 3NS5A 4FZVA 4Z7CA 3PZPA 3UD3P 1TZ0A 1VS3A 4KT0C 3R97A 2XS7A 2HHSA 5E2QA 4U7CA 2F40A 2G1HA 3OXGA 2XYHB 1RE1B 4CO0A 2UUWA 2HHPA 4TLQA 2A2DA 2IMOA 1KVKA 3VR1A 5SZTA 3DOKB 1LNQA 3ET6B 5HVFA 3KLHA 2XZDB 4CLKA 5E3RA 3SIPB 4FPIA 4LF4F 5LOQA 3TARA 2AYBA 5IOLA 4CLTA 4HACA 1IKXA 1HI1A 4CQ1A 4ELTA 1ZM3A 4QU6A 3CMES 5EX3A 2JVOA 5B09A 4K7QA 2ZJRQ 4ZJOA 1S7IA 2O5DA 3A3NB 4CLYA 1XJWB 1K44A 1KP6A 5K14A 4ZKAA 4C48A 3G8QA 2B4UA 3SZ2A 2O67A 2VASA 1FFSB 3EJMA 2LU2A 2E7WA 2ZBPA 2QMUB 1NK6A 1TUVA 1S79A 2GJFA 5HATA 2PC6A 3OR1A 3DYAB 4ZP6A 4OHZA 3AY0A 2QA4G 2PN6A 3W2WB 2CADA 1VQNS 2OHDA 2NPIA 2RIJA 5HP1A 2YNIA 4I1TA 1AFJA 1S1XA 3LUYA 5A8RB 3FCWA 4Y2CA 3GILA 3EX7B 4LF5F 2HW3A 5CYQB 3CJ2A 2QG9B 1RWKB 2FVCA 2IBOA 1TAQA 3C6UB 4PWUA 3W9HA 5KFGA 3QWUA 3R2CJ 8AT1B 5HVHA 4LF6J 2MEWA 3M32A 4ED6A 3QZ7A 3PDNA 1WI8A 4UOFA 2I5JA 3HHLA 1NKBA 1HA1A 3W61A 2UU9J 2MKCA 2ZD1A 2DNMA 2GVZA 4ZLPA 3KHHA 3MM9A 3RBXA 3HSZA 1HNWJ 2XLIA 1KR4A 4OIXA 2IDLA 2M3DA 3HVTB 5DM7Q 3H5YA 1MROA 2BBEA 1UMJA 2CXEA 2NLWA 3PJWA 2WBMA 4ILRA 1MWQA 2RQKA 2Q43A 3M9OB 3OW2R 5HMWA 3HULA 1HD1A 4DR5J 1BGXT 4OI2A 2MKSA 2DGSA 2HLTA 4DL7A 2ZEJA 2DNGA 2FJXA 4LRAA 4M5GA 4CLSA 3BDEA 2E5HA 1X4EA 2Y1RI 3P5TL 2BJ8A 1YZ7A 3MGJA 4EBDA 1ZZFA 3D66A 2QL7B 3KUEA 4N56A 1S1XB 5A8RA 1M1KT 3T9ZA 4OLOA 4LRBA 3QNWB 3DLGB 5J1PA 1U8WA 2R7OA 5H9FK 5I3UB 2J7UA 1TL4A 2HURA 5KFMA 2DXEA 3B78A 1N5QA 5HMXA 4DEZA 3BBFA 4PWWA 5C42A 1ZZNA 1E6YB 3W63A 2IA0A 3I0RA 2K2PA 4TXSA 5FJ4A 2B43A 1Q5VA 2VPYB 3AJ1A 3I32A 5F3TA 5KG1A 3US5A 1NDPA 3JSMA 2UXCF 3OBIA 1RTIA 1IQTA 5B08A 3C16A 3VV2B 2EWHA 1NSPA 3M8PB 1UCNA 1M5SA 5A2QU 2OTJS 3DXSX 5CD4A 2XC9A 1LQ9A 2FD2A 2J0WA 1XR5A 3CDBA 1HI0P 1FRHA 3TO8A 4RBUA 5C25B 7AT1B 3EDQB 2VJUA 1EQMA 2JEIA 4DV1J 1S6UA 2GFFA 1H6KX 2D3UA 3G8SA 4ECYA 1RGVA 3KK2A 4LVOP 2QMWA 2W2PP 5A2QY 1R6YA 1Y3KA 2L48A 4ZPCA 1KQFB 2HEKA 3EE3A 5KFTA 1K1QA 2RD5C 3W66A 2KH9A 2W2QP 3B4MA 3OL7A 3HHLC 4DV1F 1ZBTA 1TVRA 3IA0A 5AJ3J 4ZOSA 3CJ4A 1T03A 1UW9A 2F63A 4QPTA 3R1LA 3UN3A 1RWNB 2LLZA 4NLWA 3MCOA 5I3QA 3OSNA 1T0TV 3HVRA 2JLGA 5CYMA 1BE4A 1JLFA 2VC0A 4YY3J 3MM8A 1G4CA 5AJ3F 2VONA 1CJUA 1F2GA 1RBLA 1TL1B 4A46A 3D9BA 2PMHA 1S0MA 1C2PA 4ZPAA 2CIMA 4J9LA 1N4LA 4JI8J 4FN5A 4DV0F 1FXRA 1Y4ZB 2XY7A 1NHVA 3EVMA 2ZNZA 3ZZ0A 4DV3F 3PYDA 3IO1A 2ZH6A 4HYKA 1Z1ZA 2DISA 1I5OB 1HI8A 3I4HX 1HWIA 3DOLB 4NLTA 2DIVA 2MZTA 1Q7YT 2PE8A 1U09A 7FD1A 5HQMA 1SL2A 2HFUA 3C6TB 1S76D 3CF5Q 2M52A 1NPPA 1VCTA 2KTQA 4UZCA 1RCOB 1VISA 1WKKA 5T7LB 1B3TA 3R5AA 2HWHA 3G6VA 2V8DA 4B9NA 3I87A 1AT1B 2OPSA 2V8PA 4NLRA 3AOBA 1KRPA 4DR7F 1O5JA 2BE2A 1K9MT 2OGUA 4ZP9A 1BQXA 1T95A 5AXMA 2PI4A 1B64A 1F9FA 3VGVA 3IS9B 2R7XA 4ETZA 5DQGA 4DF8A 1V3SA 2KL8A 1WC4A 1VQ6S 4ILLA 3ELHA 1H38A 2ATCB 3Q8UA 5BR8F 2I8EA 1AUSL 1TL7B 2PD1A 3VVTA 2YKMB 4EFAC 2HGLA 1SBRA 2V0NA 3FDSA 3FCHA 3IG1A 4PZVA 4J9NA 3QJPA 2FJEB 2NPFA 4ALZA 3CULA 1SQGA 1L3SA 1JK9B 1JLBA 2L08A 1IVZA 3P6YC 1R8PA 2W2NP 3R5JB 4KJIA 5KFDA 1HIYA 3MMCA 3NEKA 4ATNA 1SL1A 2WW8A 3NGTA 4QU7A 2FLLA 2IAJA 5CA5A 1XBWA 3EMTA 2CQCA 4KYZA 3OUYA 2V50A 2R7QA 2DVIA 4YS2A 3KG4A 1X5TA 4WFBQ 4HHUA 3RBDA 5G4DA 4EWTA 1D8YA 1X9SA 1Q8BA 3LP2B 3BJYA 1VQ9S 2OFGX 1TFYA 2RKIB 2MKYA 4QR1A 3MPYA 2GW8A 4I0WA 4LSNB 4NYPA 3T9NA 2JJ4D 4ZCMA 3T5HA 3TUZC 2MZRA 3D3BJ 2WB4A 3RTVA 1CEZA 4KPYA 1RABB 3POTA 2KVIA 3OPKA 2ZBIA 3MMAA 4L72B 1HWUA 3BYRA 3AFGA 4MT1A 4YR0A 4WFAQ 3GYNA 2CG8A 3NAIA 3PYEA 3QGPA 2R7RA 1EETA 3OV7A 4BBYA 2V69A 2VIHA 4NL5A 4H4KC 4J9RA 5J2QA 2ZOGA 3J81U 3NGDA 1ZAXA 2NXCA 3V4MA 5H9EJ 3BN4A 4KHMA 3CC4S 3PO4A 1PKUA 3CJ0A 3S6EA 1IKWA 1EKSA 2JWNA 2R2RA 1CJTA 3SSQA 3D6FB 1TL1A 1QSYA 2ZBCA 1U1OA 1NH7A 1WI6A 2GVZB 1NUEA 5KG6A 1DLOB 4FVCA 1UA1A 2F4FA 1OO0B 3HMJG 1TELA 1RBOB 2C2KB 1XMBA 1N0UA 2GO8A 3M32B 4HI2A 1JLAB 3UDEA 4LF5J 2YWEA 1IBCB 1R6VA 2MLZA 2BYCA 2ZH1A 4F4KA 2GZOA 1W25A 1FFGB 3IBCB 1R8HA 3LALA 3P8BB 1IBMF 1BQNB 2BACA 1J2VA 4U67Q 3L09A 1HBUA 3PFEA 4ZVEA 3SCIE 3V6HA 2GVDA 1IUJA 4IYQA 4LSLB 1RA6A 3EVOA 3LP2A 1NB7A 3BGOP 1TV6A 2H48B 4B08A 4ZPDA 2VDHA 1JLQA 3NOGA 5DLGA 2OIHA 2H9ZA 2J0XA 1MN9A 4LBIA 3AD7C 2IVYA 4M8LA 3RUBL 4DV5F 2VG6B 1TU0B 1RHQB 3I5CA 2CPHA 1DQ8A 4FNHA 3H40A 4ID8A 1WEXA 2WK4A 2CPXA 2VFUA 4O3NA 5HVGA 4EBCA 3RW7A 3OLAA 5BYSA 2WVEA 1VRTB 1U6BA 3LGMA 1XIQA 1UJ4A 2AP6A 4KV8B 2J9CA 4HI1A 2OPPB 1TL5A 3LOUA 3QGGA 4LMZA 4HACB 1VQ7S 3PW5A 4C8YA 3N6NA 1YSJA 1OWXA 1HFEL 2OPQB 2POKA 4JI7J 4WP8A 1YBUA 4WCEQ 1SI9A 2MKHA 4XAKA 2RJZA 2VHGA 4X65F 1L3UA 3QRRA 3PIPQ 4F02A 5KFCA 1QDUB 4O4GA 1UP1A 4QR0A 4USTA 3U1MA 4N76A 2EC0A 2CPIA 2UUTA 2H3EB 2XEXA 3AH6A 3BGFA 2QC3A 3UQSA 3E8OA 4X62F 3GIJA 2C22A 2RS8A 1JXEA 4ZIVA 3GE9A 3GV7B 5AT1B 2VQFJ 4DQPA 2CJAA 4DCPB 2HVEA 4CH0S 3ZZPA 1LK5A 2RRNA 4ETXA 2HNDB 1NJIT 2DR8A 2DGQA 4YOEA 3NGRA 5L39A 1AA1B 1F60B 1SVDA 4X4PA 1U4BA 2Y8WA 1NRKA 2JC1A 3C8YA 1I51B 5G0RB 3CPWR 2NR0A 1GAOA 1U48A 2F3JA 1HNIA 1WC1A 4G1PA 4H4OA 5DRKA 2RDIA 3W1YC 4CNZA 1VRQC 2YVSA 3TI0A 2ROGA 3TAQA 4DPTA 3D1HA 2KRRA 3KLVA 4DG1A 4WP3A 3AT1B 2K7JA 4F3QA 4DV4F 5HO4A 4NZ6A 2CJ9A 2ZBRA 2ZVSA 3B6BA 1H72C 2IJFA 1CQNA 1JQGA 1EETB 1VJWA 2L9WA 2IC3A 3EGNA 3KNGA 3HHLB 4HDHA 4ZVQB 3OSPA 1TFWA 2LA4A 2LYVA 4RO0A 5M2UA 3LP1A 1PSDA 2WVFA 4NMLA 2HWTA 5GAEI 3BO2A 1L3VA 3D3CJ 4BDPA 2X1FA 2E9ZA 3M4XA 3FJ2A 4Z37A 3LP0B 3QIPB 1S1UB 4ZVTB 3PNIA 3OR1B 2VQEF 1EP4B 3QJLA 1S9FA 2CQ4A 3A3OB 1VLOA 4RNHA 1N36F 1AB8A 3RZAA 2PO4A 3EUNA 3G86A 3EZOA 1RU1A 3N01A 3HF5A 1CS4B 3K8VA 2HSEB 3UO0A 4C97A 3ZZYA 1F2HA 3W9JA 2DIUA 5HAOA 1RT1A 3HJVA 1LFPA 2IA6A 2RILA 3OD2A 2FQQB 4OYMA 2IBKA 4JI7F 1FDNA 4ZMMA 4ZVOB 2LU1A 2HZAA 1L5UA 2VF3A 3MPWA 4NCGB 5D4LA 3ZO7A 1ACMB 4C6AA 2CDQA 1GNKA 1RTHB 2ZDPA 4YB5A 1UL3A 2NQPA 3WIUA 2FJBB 3RBEA 4JI5F 4HDGA 1FF2A 2GQCA 3N79A 3SFUA 2BXJA 3DRSA 3BO4A 1X0FA 2BEFA 2WW4A 2ASDA 3PW4A 3T6JA 1HQUA 1O51A 3DLKA 2R7WA 4P71A 1VLYA 2BZ2A 1RWMB 2FC8A 3H2VE 4IFVA 5L1IA 4DR7J 3THPA 3GJRB 5T14A 1TL3B 2NYHA 4RWXA 1XNRF 1W26A 4DPUA 1X5PA 4M1KA 1T3NA 1X4CA 1AFIA 3DOMA 1FHTA 2QRRA 2E1AA 3I4PA 3ULHA 3PHEA 2C42A 4DV4J 3MEDA 3NNAA 3ETOA 3OT9A 4M5LA 3K5MA 5KAKA 1IXKA 4DHVA 2B4PA 1RT5B 5SUHA 3EDRB 1KC8T 2RVJA 2DXFA 2GIFA 2ZKUA 5F9LA 2G13A 3NG8A 4PR6A 3BH6B 2VA3A 3KHRA 4JI4J 3IGNA 1H7WA 2AHOB 2B0GA 3IAM9 3LA0A 1R8AA 4KHRA 1V5IB 4LIWA 1TK8A 3HD1A 3Q0AA 4WF9Q 2W9BA 4AD6A 3MTJA 4DR2J 1RKJA 5J2QB 5D4NA 2UV8A 3OHAA 1CC8A 1UAWA 2BQ3A 3OFEA 4KIAA 5C2CA 3ZZTA 2GQ2A 2VKZG 3RAMA 1RAIB 1SJQA 4RNNA 2L41A 1S0VA 4QIGA 3R1HA 1YJTA 3QAUA 1P6TA 4E98A 2HHXA 2IM2A 4PG8A 1TTHB 3Q8QB 3D1QA 4EBEA 5IT4A 3AAWB 2X1GA 4CTAA 1PC4A 2HWIA 2GNKA 3C46A 5K8MA 2JH3A 2RU9A 1TKTB 1HHSA 4JI0J 2EEYA 5C25A 3U1LA 1SL0A 1S5ZA 2BVZA 2ZH8A 4RR5A 4WFYA 4FXWA 2CNLB 3SCJE 4MKBA 1CSJA 2DNRA 3V81A 1NK4A 2ROPA 1YG0A 1MNEA 4UY85 3KKFA 3D4JA 4HL9A 5E5NA 4PXDA 3AHPA 1V9OA 1FEEA 3IM9A 3TUIC 2R8IA 1Y9OA 5L1KA 4FYWB 1Y5NB 5C42B 1C0TB 3IBWA 1TL7A 4DXLA 2DNPA 3BO3A 4LF8F 4FXVA 2AGOA 2DPIA 4RNFA 1CVJA 5GMDA 4PXBA 1WDTA 4ZS6A 3ZXWA 4DX5A 4GKJJ 2LQBA 1SUQA 1EX8A 4G6VB 3J80Y 2UVRA 2U1AA 2V63A 5F8LA 1YBTA 1X4BA 2MJUA 1SV5A 1U7LA 2OD4A 3OFHA 4OV6A 3TYTA 1OYEA 2I6WA 1EB0A 2RF2B 1YJ7A 4ZPWR 2V8VA 2VKRA 4F4WA 3MM6A 1KONA 2D9OA 2HQFA 1G3OA 4K2XA 3ZZZA 4C0OC 3V4IA 2E1RA 2AYEA 4S0MA 4JI4F 3UCGA 4JI6J 5LSLA 1NZ8A 1GK8A 3BBCA 3OTOJ 1XWLA 3C6TA 3G6YA 1H2TZ 1ZS6A 1NH8A 3KFWX 4JOUA 1LWXA 3MI7X 4ZPTR 1OIAA 1PBAA 3CCWA 3TA2A 2ILYA 2N82B 2C2RA 1PJ5A 3OXFA 4TNOA 1KHVA 3DHXA 3DI6A 2C3UA 4KY3A 4WU3A 1UWBB 1N36J 1I94J 3GONA 2CQGA 4OLPA 2W9CB 4HEA9 1VFJA 4CO2A 4FNIA 4EGLA 1C1BB 1LWEA 4F3OA 5LSOA 5DGBA 1FJGF 2V6AA 3BKUA 3PW7A 1GXTA 1ZYQA 4L73A 4X62J 4ED4A 5EWEA 1VQ4S 1NPRA 1MG7A 2R8JA 2JFDA 1RAOA 2DK2A 2BJEA 1NDCA 1M5HA 1A0OB 1RLCL 5DG8A 4GO5X 3RGIA 3UI3A 2BABA 3WC2A 1O0PA 2GAGC 4JI0F 5A8KA 4FYVB 1MU2A 1H2VZ 5K9FA 4IOBA 4ZVSB 1YLXA 2X51A 1RWXB 3K5PA 1B4SA 3BREA 1LWFB 2W2MP 4HH0A 3FEYB 1M90T 1N5VA 1Q95G 5FLXY 3OUYB 1GT8A 2AW0A 2HQIA 5EN1A 2DGWA 2LEPA 3D1OA 4ANDA 4B9LA 4B3SF 3CB4A 4EYHB 2MMYA 2UV8G 3GWCA 2DNNA 3VWSA 2VU5A 3FQLA 3OTEA 2XS2A 4B3RF 1B99A 3FBCA 1GTEA 2HQDA 4B9VA 2KN4A 2LECA 3BR9A 3I9ZA 1U0HB 1UWAA 4MKAA 4P72A 2R2TA 1HWLA 2NYIA 1S9EB 4RUBA 3UN2A 3I0RB 1W7WA 4DFPA 2HQCA 4W98A 3RRKA 1GMWA 1C4AA 1URRA 5HLFB 1J5EJ 3IS9A 3ZTQA 4B3MF 5M2RA 3TZXA 5F8JA 2Z58B 1K1SA 1HBNA 2I9SA 4ID5B 1YTYA 4FBTA 2WVCA 3LP0A 1PIEA 3NP5A 4H4MB 2O01C 1RZMA 1LXNA 2KU7A 5HQLA 4XTTA 3CCSS 2KT5A 1QLNA 5CZVA 4UUWA 3PYGA 4PXCA 2VBYA 3LW5C 2ZH9A 4QCLA 5HK4A 2JNJA 2BOPA 2A6OA 1AROP 4I2QB 4XIUA 1IR2A 2MPUA 1U49A 3TA0A 3CW2C 2KI2A 1QAIA 1IWGA 3TJ8A 1YJVA 3GIRA 2DNZA 1T9WA 3ILJA 3NS6A 1NSAA 4KQZA 4J5OA 2ERRA 2V67A 4LRFA 4OZJA 8ATCB 1V5VA 2XCPA 1XTZA 3GSIA 1O6XA 4NA2A 4OI6A 2ZD1B 1JLFB 3KYLA 2VODA 4AUKA 4I68A 1QSLA 2HZCA 3U02A 3BYPA 5GMKa 3CO0P 1ZAVA 2HFSA 1S9GA 2CAJA 3CT9A 1RKIA 1GTHA 2BKOA 2KM8B 4YR2A 1TKXA 2KYZA 2RDJA 1S72S 1N5YB 1JNRB 3CJQA 4X66J 1T02A 3I96A 3L7PA 2E44A 3SCKE 4QPXA 2GHPA 4USHA 2OMLA 4OHVA 4ZJQA 5KFWA 5FDLA 2CJBA 4C8MA 4DV6J 1RACB 1U6FA 3IWLA 4P10A 4WK1A 3W2WA 5IZHA 1Q81T 2OFHX 1ITPA 2CDRB 2FZGB 4RW9B 1FFWB 3C14A 2MQPA 3HLUA 4F67A 4C3KA 4DL0C 1IBMJ 4HVZA 3MAAA 2V4QA 4G3IA 2LCWA 4UZBA 1RYRA 4P52A 3DU6A 2AJQA 2OD6A 1LW2A 4LF9F 3ZTOA 3FRZA 3CMAS 1RA7A 4M5JA 1N32J 4A8WA 1R7IA 1TMMA 5E3PA 4NXNF 1XMQF 4OYWA 4DQIA 1GH8A 3CC7S 1RWVB 1PCAA 1EAYC 3QRQA 1HQEB 2F4VF 1APSA 1TMJA 2JLFA 3TRGA 1WNEA 2MSSA 1WTFA 1Y10A 2FYXA 3GB0A 4IO9Q 4B9MA 2AX1A 2CG4A 5I3PA 3LQVA 2WONA 3HFZB 3JSMB 3MAAB 4KR0B 1GMUA 5ETQA 2J7KA 1HBUB 1S7HA 3H0PA 2RQMA 4H4KA 3RU0A 3UE2A 3W60A 4TU7A 5KTQA 2HFZA 3ET6A 3KLHB 2YBVA 1X7VA 2YKQA 1HHTP 2MQ8A 3JYTA 4RUHA 3FSIA 5KG0A 1WSVA 3SV3A 2G2OA 2Z0GA 4IDKA 3TX8A 5AE1A 3MFIA 4OX6A 1JLAA 4N41A 1H73A 1FVSA 5J1NA 1KVJA 3CTRA 3ENQA 2BJ9A 5D0EA 2NZCA 4JI2F 3X1LB 4CO4A 1UPMB 2C2OB 2CQDA 5DDQC 3DHWC 1A7GE 5A0YB 4R25A 3JSBA 1IKYA 3VAKA 4DQRA 5I42A 3GR1A 3R7BB 3SXLA 4GKKF 3CGIA 2A10A 4YHHJ 3CNQP 2MSTA 5DQIA 3MM9B 3I6PA 3B54A 3KJVA 1XC9A 2AEMA 3Q86A 2ACMA 1SC3B 1VQMS 4WZQA 2JL9A 1FT8A 2GGPA 4B3OA 2NUUG 2OH2A 2I5JB 1YJNS 3HO1A 1S1VA 5L8RC 4C8LA 1MN7A 3EM1A 2V2VA 1BC6A 2CQHA 1T11A 1OQ6A 1SXLA 4UQGA 5H9FJ 2BUNA 1WOOA 1UVIA 2P6SA 1M1GA 4O3QA 2I0XA 4TU8A 3KXDA 5DGAA 3MZIA 1SQEA 3IMQJ 1U1LA 2IIHA 3DXBA 1TKZA 4J91A 1GMWD 2DGOA 4C3LA 2X1AA 3Q89A 4ES1A 2KFNA 3FCVA 3NWRA 4V1Ak 3W5ZA 4FYYB 3D0IE 3IR6B 3BPSP 1J5OA 1WHXA 2BMBA 2GQQA 3CJRA 4DQSA 3FK4A 4F3MA 5KFFA 2IAJB 4I69A 4QWDA 2ADBA 3H4DA 2UUCF 1JWWA 4ZLLA 4I67A 4CLLA 1VRUB 2GMHA 1JLBB 4F50A 1RTJB 4OZ3A 1U0HA 1S48A 2KJWA 4RX6A 2R7VA 3KNAA 3HHKA 4NX9A 1RQ0A 4IG0B 3MEGA 4LF2A 4DPWA 4B17A 2DKOB 1ZOTA 2FGCA 3HSGA 1F5BA 1KQGB 3WHIA 1RT3B 2RE1A 2VH7A 4K4WA 1WTBA 3M8RA 1WKJA 1Q78A 4IKAA 2ZH5A 2PMWA 1SKWA 4N77A 3N6LA 1YK9A 5FIIA 2YNFA 4DQQA 1MWYA 2PI5A 4LBHA 3CXCR 4WIIA 1XR7A 1Y5IB 1UEVA 2KRBA 3IP0A 3IRXA 2WTFA 1X9MA 3PCOB 4GKKJ 1NO8A 3NRBA 3DRYA 4R8UB 5E41A 2KHCA 2MGZA 2XBPA 1VDHA 1T3OA 5B0CA 5GMEA 3AD9C 4LR9A 5EGYA 2ALZA 2AWZA 4KO0A 2J9DA 1XNRJ 2HPUA 4NPOA 4RZRA 4A8YA 1SJ4P 2D7SA 4UF4A 8RUCA 3K7RA 4O44A 2OEMA 1GXUA 5F8NA 3K2YA 4OHWA 1DHMA 3KLGB 5HMYA 1F9EB 1QAXA 1HPZA 3ZZUA 4ZHRA 4I56A 1BXNA 3MM5A 5E3QA 5D3GA 3JSRA 1HWKA 2VC1A 3DGPB 4Y2AA 4PWDB 3MM8B 2DBBA 2QE5A 2ZC3A 2Q6BA 3JTPA 4K8RA 4WE1B 5CYMB 1X4HA 5KFHA 1RHUB 2A1BA 2E1PA 3D28A 2G4BA 3NKYA 3MWBA 2ZE2A 1S6QB 3DN9A 3MEEB 4K5SA 3QT5A 4NLQA 4U96A 4R8UA 3TZWA 3GSDA 3EGVA 2JX2A 2CPYA 3QGHA 3M2UB 4X64J 1MMNA 1WC5A 2BV3A 1HWJA 3MD1A 1P9YA 3L7UA 3R6LB 4NXMJ 3P49B 2P9GA 2VBWA 3LPYA 1QE1A 1MMDA 5BYQA 1X60A 4K0KF 1WF0A 1TUWA 3H98A 2A2CA 3KK2B 3RR8A 3D2WA 1D3WA 1DARA 2VFRA 3M9NB 2HIQA 2HHUA 1IKVA 2ZVIA 5ETLA 1DFDA 3UD4P 2DHXA 4YMEA 2H5EA 5LJ5Y 3NNHA 4NLSA 4OI0A 3Q8RB 4CLUA 2MQLA 1XR6A 2KO1A 2PMZD 1SJ3P 4F2RA 4NEZA 1RTIB 2QIFA 3AQPA 2Y9HA 3OL6A 1FX4A 3R2DJ 1OY9A 3V6DA 3MPVA 4DCOB 3R8YA 3GP9A 3MF5A 3DFEA 4EO8A 2H4WB 2C2MB 2RDDA 2GMLA 3CDEA 4U95A 4CH1A 2JEJA 2UVVA 2FHKA 4X2BA 2E66A 1VC6A 1NSQA 2BJ3A 5B0BA 1CJVB 5L38A 3M2VA 5KFRA 5GAEU 3PV8A 3MAHA 5IS2A 3N5BA 2IYGA 4ECZA 1J5OB 3RJMB 4K4SA 2V4JA 4L76A 4QR2A 1HNVA 1FWLA 5KFEA 1CULB 2HLUA 3V6JA 2ZFHA 3UCUP 1U45A 1FD8A 1RUSA 3HHEA 1NK8A 1KDNA 3TJ9A 3G4SS 1HL6A 1RT7B 1U2RA 4MK9A 4ECQA 2MB0B 4NLXA 2N3LA 4ZVUB 2Q79A 2NXEA 2YTCA 2EG1A 3T1HF 3W5XA 5BJRA 3UCZP 2D3O1 1KKHA 4RUAA 2OPRB 4MIAA 4AQYJ 5IQQA 1DY3A 5HROA 1IBKJ 2MY7A 2NSBA 2HQ3A 1REGX 3UN5A 5L9NA 1R31A 1B7YB 3TAMB 4DZDA 2MZSA 4MFBB 2VG5B 1KVIA 2RH3A 4DR6F 3AB2B 4IH7A 3OTBA 3QSYB 2EK6A 3BGUA 4A8SA 1RLDA 3OFGA 4BC7A 2DNQA 5ETPA 2ZH3A 4ICLA 3VTIA 1DQ9A 4ANCA 4B3MJ 1N33J 4NZ7A 1U1PA 1KQSR 4Y3CA 4TQSA 2C28A 4ZK7M 4FPRA 2AT1B 1FK9B 1LW0A 1QAYA 1WHYA 3VF0B 2GJ2A 2H51B 3BR8A 4DFMA 2HRTA 2XMKA 1RYSA 1PJ6A 3L4BC 1XN9A 1JX4A 3GR0A 3BDPA 2YWKA 5HP1B 2XY5A 1URNA 1FJCA 2B6AA 2GIQA 2FGOA 4H4MA 4DV2J 3BPDA 4IFVB 2CNKB 2ABYA 4P75A 3BH7B 4C8OA 3IR7B 2BX6A 1BQMB 1KLMB 2DH7A 2V8GA 3JSYA 3TVYA 1S49A 1CJVA 1C4CA 2G0IA 2CZVC 1NU4A 5D0GA 4ED8A 1RT3A 3D6TB 3N5FA 4WTYA 2MKJA 4DUYF 2CFXA 4UUXA 2AYGA 1UZDA 1Q4RA 3F0NA 2K8GA 2OI2A 3TANA 2LQ5A 1YKWA 1WEYA 3TZZA 3AA9A 1IKXB 3CUNA 3H4BA 5F0UA 4DUYJ 3CJSA 2XHWA 1LV5A 4PG7A 3IN5A 4ED3A 4RW8B 1VRUA 1Y7PA 2HNZA 4RWWA 2D3OR 1H0HB 3PJ9A 4X66F 4ZVFA 2MDAA 2OTLS 4P2FA 2UVUA 4QIEA 1RAHB 1FNMA 1R0AA 1BQMA 1KLMA 3E51A 4NWBA 4O23A 4D3GA 5JUMA 4RNMA 2HS0A 1KTVA 3KK1A 3EZ5A 4DR2F 1B0TA 6FDRA 5IWAF 3OTDA 1RB0A 4DR5F 1D1UA 4KB7A 1TKXB 4P7TA 2QMXA 2QV6A 2FC9A 1S1UA 4DF4A 1RAGB 2RAQA 2UZAA 2YKOA 4M63A 4ELUA 2C2ZB 1NHUA 1ZA2B 3LO3A 4BWMA 5C7PA 2NZ4A 1VQOS 1KOOA 2QTWA 3K58A 1KWMA 3SSSA 1PAEX 2E29A 5HJXA 1HPZB 4KSEB 1CBKA 4DJBA 3F56A 4ZHRB 2RU3A 2BANB 5D3GB 1NCLA 1DJ0A 2B5JA 4CO5A 5GAHU 3CCUS 4OZ1A 3MPUB 1AZSB 4ZP7A 4JYAJ 1V3RA 2G9OA 2R3VA 2HVZA 3PJXA 2DCUB 5LXRA 1KS2A 1U6ZA 5GADI 2CPZA 5IM0A 2HQGA 5HI7A 3LWLA 2WSCC 2HFVA 2KG1A 4DR1J 3NY0A 4FF3A 3AD8C 2ASLA 1W2IA 1T94A 2MQMA 2CQ2A 2BKPA 1IM6A 2ZM6F 5DDOC 4CT8A 4O4RA 5KT4A 1HKAA 4NLPA 4X4QA 2ZJPQ 2GO9A 3AQOA 5BR8J 1TR0A 9ATCB 4LVNP 3TX0A 3BQ0A 2YNHA 4OJ1A 1SCJB 2NSCA 2VUGA 3ILLA 4ED7A 4RUCA 3GU0A 1Z2LA 3KG0A 4O4GB 3GCXP 2O3DA 4PCQA 2EVZA 3VQSA 4CWBA 4OL8A 1JLCB 2AJ2A 3CMQA 2WONB 3LTOA 4OZNA 4K50A 5MAOA 2BW2A 4F4YA 5DG9A 5HSPA 2XY6A 1N48A 4OYXA 2ZOMA 3B8HA 3GV8B 2LXUA 1YZ6A 2XS5A 1X4GA 1U47A 2R8GA 3WQPA 2HHTA 4X4OA 1REVB 3G2XA 3R3TA 3T3FA 4M95A 1ZPWX 1LW2B 3FZBA 3QT7A 2B7BB 4DV3J 1JLQB 2RB7A 3M2RA 3NAHA 2QZ8A 3MDFA 1RSCA 3PFOA 4MYUA 1KOHA 5HROB 1AXQA 1ICEB 2Z2MA 2HVIA 3MEKA 2KVQE 3MPDA 3T41A 1UVKA 3KJQB 5KFSA 1RISA 5B7WA 2CQBA 1IJFB 1FTCA 5L46A 3PR5B 2YWWA 3FEXB 1FRMA 4UW2A 2HHHJ 2ZE2B 3MEEA 4F0MA 2ALYB 3K17A 3K57A 2EFQA 4DPOA 3Q83A 1NK7A 2UXDJ 4TLRA 4PQUA 1RWWB 1F6TA 2J7WA 4F26A 3F41A 1KLNA 2KXHA 4B3TJ 1T8EA 2R4FA 4E0DA 4USIA 3B4DA 2G1DA 2Y1LB 4CYUA 1NXIA 5F8HA 1Z4UA 1Q5YA 3D0GE 4PQUB 1DBDA 1RWOB 3CJ3A 4CM0A 2IM0A 3GYGA 1QVGR 2LEAA 4UT4A 3MUMP 4B3TF 4DSIA 2AQ4A 3A4TA 1CJKB 5JJBA 1FCAA 3H59A 3BV8A 3IGVA 1JB0C 3UPFA 3BSCA 4E2FB 4CM2A 3I55S 2YH1A 2RUSA 2W7AA 1ELOA 1WORA 3HFKA 1VBKA 2BM0A 2HBZB 4NRUA 2EFVA 3AXKA 1OYDA 3DCAA 3POTB 3ITHB 3KMSA 3V6KA 1CULA 2DY9A 2XMWA 5IC6B 2QLWA 2V34A 3OTOF 1VBZA 3SBMA 4USMA 3RRGA 2MTLA 4LSNA 3MXHP 1JLEA 2KYXA 2RKIA 2WHOA 5IQ6A 2R42A 5IV4A 5GAGI 4IOCQ 4DSFA 1H74A 1RHMB 5DETA 5H1SV 4LFCJ 1G7CB 3SDEA 3QO9A 3HK2A 5AXNA 2KDOA 2LP4A 1JLGB 3FRYA 3EWGA 3M7VA 1Y00A 2VA2A 2BRLA 2PIIA 3M8ZA 5KFBA 5LJ3Y 2KFYA 1RBAA 4G1QA 1JXLA 1PILA 2V68A 4N8OA 1KD1T 3HHDA 3SQGB 4WFNQ 1VC5A 2R8HA 2DHAA 3T6BA 4TU9A 4DCJB 3FBFA 3ILIA 2ROEA 1RTDA 4KTQA 4NLDA 1FKAF 3MMBB 2APOA 2HHQA 5CD4H 5D0HA 4CTAB 3TVKA 3G71S 4W4MA 2G2ZA 2HRYA 1RP5A 4K2JA 2EK1A 4DBQA 3J81Y 4YFUA 1N5YA 4ZITA 2PDAA 2GAHC 3OTCA 5A8KB 4QWAA 5ETKA 4ECTA 4ED1A 3UDCA 3HXMA 3OL9A 1FWPA 3WC0A 1XMOJ 4A8OA 2GX8A 3ISNC 1X31C 4OYAA 3JB9k 3L7OA 4WE1A 1EARA 3BEGB 4P2SA 2EC2A 2D1CA 1VR6A 2HNYA 3EXYA 2ATLA 3FFIB 4J37A 1VJQA 1SH0A 2RNEA 1R89A 4KE5A 4TY8A 2U2FA 2XULA 1JXVA 3LGNA 3OR2B 4PKDB 2M4MA 4J9UE 4DG1B 2EBEA 4NA3A 2NUHA 4FVMA 1X4FA 2Z2LA 2V4RA 3BSOA 2WZ1A 4DV5J 2B9XA 5GADU 2XM3A 2W25A 3NWGA 3PHTA 1IKYB 2LQJA 4ZCKA 5J2MA 4QZVB 4IFYB 3NS7B 3DRXA 4QYRA 2HBRB 3ZNUA 3DGVA 2DR7A 4JI1J 4JV5J 1TL3A 1FVQA 1VGYA 3R6GB 4Y65A 1B7FA 1S1WB 2M9KA 2UP1A 2VFVA 3FC9A 3TZYA 2V9WA 3GFXA 4AXIA 1SKRA 1T03B 3GMGA 3JYTB 3CCLS 4OYOA 2ASYA 3K5NA 4P74A 2OJ3A 3SMZA 1S6PA 4ECRA 1NJZA 3W3SA 3LAKA 3CDAA 4IO1A 1QUPA 1I3OB 2W1BA 1UZHA 2M70A 1C0TA 4C0HA 1BMQB 5ADZA 1HMVA 2IDEA 4Y6IA 2YKNB 3MOJB 2IRXA 3HD2A 3TP2A 5JMNA 4OI1A 1F9HA 3I56S 2ZKTA 3HZEA 1U26A 1RWPB 4N8NA 1S57A 4HHJA 1HR0F 4UQTA 2QN6B 4HLBA 4WBFA 1GFWB 1TAUA 1N6QB 3CCMS 3EZUA 3W62A 2ZM6J 3CC2S 4MKYA 2E1CA 4C0BA 2AD9A 1TV6B 1GX5A 3PO5A 1FO1A 4DLGA 4ED0A 4P2MA 2DHSA 4C8ZA 5LMUJ 3QLHA 3C15B 3M30B 3MR5A 5DLFA 5CYJA 3DLGA 2W9AA 3GCWP 2DNKA 4QOTA 3QQCD 5LMNJ 3H20A 4V19X 3FMBA 3GV5B 2HS3A 4DPYA 2VL1A 3ADAC 5L1LA 2IM1A 4FS2A 1N32F 3NNCA 1FK9A 1LW0B 1UEUA 4IR1A 1HYSA 3RYLA 1C0UB 3AA8A 1S1VB 5B0AA 1KQKA 2IC3B 3P96A 3OHBA 4GMKA 5A8WA 4DDFA 2HS4A 4K5RA 4PRFA 5C24A 5KFPA 4OZLA 2YKPA 3DI6B 2QSWA 3NLCA 2BQRA 4C8KA 4DSKA 2OAUA 2YX7A 1S77D 4H4OB 1HNIB 4O3RA 3TAPA 2AGQA 2OPRA 2YH0A 3WBZA 1VQYA 3RR7A 2N7YA 3LH2S 2C1EB 3MMJA 3VAHA 2R7SA 2DB1A 3MEDB 4KH0B 4MH8A 3N0VA 1MSWD 4HKQA 1QUVA 1H7XA 1XQIA 1ZA1B 2RF2A 5KFYA 4QWEA 4JI2J 3QATA 3KOAA 2B4OA 1F5AA 4DSEA 2YNGA 3MMAB 1QJHA 4EU0A 1YJ9S 2V94A 3F44A 5L1JA 3BKTA 4GVBA 3HM9A 2VPWB 3HT0A 1ZM4A 4UOCA 3MCSA 4K4XA 2VPXB 2M8DB 2ZH2A 1D9AA 1NZAA 2R8KA 2AEFA 4MTPA 1P9QC 1U1KA 5C5JA 3RW6A 2JDJA 3CO9A 3C3LA 4NZ0A 4O3PA 2MHEA 3E2EA 4TY9A 5HBMA 4OQJA 2Q1LA 4HH1A 3DMJA 2MXYA 2OPPA 3AJ2A 3C66A 3P45B 4O0NA 1NK5A 1PYOB 3R5GA 3H2UB 3KTQA 2P2CB 2NS1B 2CQ3A 4ZVHA 5CCLA 4QYZK 3W8PA 3V81B 2YQ1A 3JAMY 1RT4B 1IR1A 4PQAA 2VG6A 2XMUA 3DDKA 2W24A 1YGYA 1S1TB 2XMTA 4IG3B 5CCMA 5MLCV 2ZBQA 3J80U 2HMIA 2OKQA 3A8KA 3IWXA 3M8QB 4M5DA 4EEYA 2AZ1A 4YDDB 3RB0A 3HI9A 1RT2A 1FRLA 1S6PB 3CD5A 3D67A 3R9LA 3W5YA 1U1NA 2BKNA 3HFVA 1YVFA 3QSIA 4OX9J 3QWPA 3R7NB 1B70B 5HN0A 3EYZA 2BE2B 3JAMU 4TN2A 2XQCA 1SJFA 1HNXF 2FVPA 4LFBJ 1S9GB 2BRKA 4NCAA 1R3NA 4EI2A 4WP9A 4ZPVR 3BBBA 1M5VC 2VJVA 2BR0A 2EKYA 1EZZB 2DGVA 3AB4B 2VQEJ 2Y0BB 1Q53A 2W9BB 2QFJA 1K0VA 4Y00A 4AL7A 3DM2B 5ETRA 1CJTB 5IT0A 3NGKA 2KZMA 4WIQA 3N6MA 3PRVA 3NBPB 4CDIA 5A6PA 4FF2A 1VBYA 1UWBA 2XMJA 2JOQA 4DR4F 2HG4A 3N28A 3HPOA 3DDIA 4KGVB 2B51A 4KO0B 1LKZA 4URSA 3ZZRA 2F7VA 3NGUA 2KZZA 2BJDA 2CJXB 4DZ6A 2HAFA 3FKBA 1VQLS 4QQBA 1L3KA 3DOMB 2BM1A 5F9NA 3FZ2A 3MUVP 1HW8A 3VQTA 4QW8A 1WD6A 2QJ3A 4IQXA 1WF2A 4KGXB 3PKYA 1K73T 3TQEA 2AZ3A 3PM9A 4B3SJ 2K3IA 1XNQF 1SPBP 2D69A 3DRSB 5F0WA 3WIVA 4QWCA 1SUQB 2PGCA 4N7TA 1RT2B 1WSRA 4K59A 2FZCB 3S01A 1X9WA 1RTDB 4DFKA 2DTJA 4M5IA 5KFJA 2E5LJ 3MM7A 5D78A 2WRMA 5A6WA 1XNQJ 1WC6A 4ERDA 4GC6A 1CG2A 4N5SA 4KV8A 1FX2A 2AGPA 1S1TA 2VV5A 1R27B 4F0HA 2H65B 1RT1B 4Q5VA 4DN0A 3QT6A 3SI8A 3IG1B 4RJVA 1N56A 2H5JB 1OS5A 2ZZTA 5KG4A 1I94F 2F8MA 1B0PA 2OSQA 3IBFB 3ISND 5IV3A 5HBMB 3J7YU 1FNXH 1X4DA 3PX4A 2Q66A 1TKDA 1SC1B 2FZKB 1CLFA 3MCNA 4YB1P 5DJBA 2PT0A 1AUDA 5KT3A 5KG3A 1SIZA 1BQNA 2OPSB 1HNZF 5ETSA 1EQ0A 4FKYA 4GVBB 4WKYA 2BOAA 3G8TA 1S97A 3Q22A 2K1RB 2M5YA 1X4AA 2LA6A 4RBTA 4MKVA 5BXIA 2BJ7A 4ECUA 1D9DA 3UDLA 1VQSA 1VOMA 2XLKA 4ZN3A 3GJSB 3EGZA 5D8HB 1FE0A 3QGIA 4WJBA 5H9EK 2A3JA 4OHYA 3CD7A 1CJKA 2FHOB 4K0KJ 5DZ7A 3DOLA 5ETOA 1T9VA 2FB0A 3UWTA 1BY9A 3BQ1A 2AJFE 1NKCA 4PG5A 3U27A 4UOGA 1SB6A 2W2OP 3TUJC 1MROB 2FJWA 1G2EA 1UETA 1U8SA 2UXDF 5KOWA 2VFSA 1NBEB 4PABA 5C24B 3RG6A 1S6OA 4FP9A 5A0YA 1WF1A 2VBZA 2HFOA 4B02A 5GAGU 3VZHA 1RJJA 1YQHA 3L9ZA 1X0PA 3BS9A 3UNYA 4USKA 4BCAA 3KLEB 4MAKA 4FBUA 1NMEB 3BGRB 5LMNF 1SJ1A 3A13A 2RRAA 3EGWB 2J8SA 3C6UA 1T05B 3M6XA 4CIOA 3D6MB 3GTYX 5EDWA 3PW0A 1SV5B 3R5BA 4ECXA 4LF6F 3KJNB 3KUHA 4K4TA 1PC5A 1HARA 1IBKF 4Y2IA 4LR8A 4KRWA 4IRKA 3I0SA 2VG7A 4G1IA 4TYAA 5E3CA 3T1AA 5LXYA 2KM8C 2AJ1A 3BB5A 3M8QA 4M5DB 2CQ1A 3O2IA 4AXJA 3T1YJ 2WSFC 3MFHA 4PUOA 2ZOFA 1OPZA 2ACYA 4NOHA 1NKEA 5THWA 1XERA 2Z2ZA 2XO7A 2QA4S 2VOPA 3WZ0A 4J9VA 4W92B 1E6VB 3FBBA 5DZ6A 3VZIA 2N3OA 1YJRA 4NI2A 1EIYB 4IR9A 3Q2TC 1RT4A 3HKZD 4NCGA 3M8PA 1UFWA 1D8ZA 4JI6F 3T1YF 4A47A 3DLHA 2D74B 2XZWA 2M7SA 3PVXA 1K47A 4NI2B 3TWZA 3ZTPA 2YKNA 3DMJB 4X64F 1HMVB 1UA0A 4NXMF 3C2PA 4C3MA 4DV7F 2M0GB 3OXLA 3G6ES 2AU0A 2W4PA 1F1BB 1TQLA 3BSAA 5I3UA 3K89A 3EPGA 2I2YA 1D9FA 3D54A 4OYZA 3NGSA 3W7BA 3H2LA 1SC6A 2ZZNA 2QO3A 3DLLQ 4FYXB 4LF4J 5F41A 2MZQA 2YQ3A 1U1RA 2J9DE 5F8IA 3VAGA 4OJ3A 3M8WA 2HYIB 3PW2A 1S1WA 4TKTA 5KFZA 4RW6B 3CIZA 3KLEA 2DRDA 1RDRA 2PEHA 2V2QA 4C98A 1LFWA 2KHDA 3M6VA 4OMFG 3VALA 5F8GA 5KFIA 2MQQA 1YRUA 3ZTSA 3D7SB 2CNNB 2RHSB 2UUAF 2CKWA 4FYDA 3ENVA 4KH1B 1IKWB 4Q2MA 2J6SA 3X3UA 1RADB 1X5OA 2DO4A 4C2MA 4DR3F 4ZA1A 1RT5A 2C2DA 4F7VA 5AE3A 1AYEA 5A8WB 5DDRC 3J7YI 3GIIA 3I82A 4OYPA 2OEJA 1Q8LA 3R7SB 2DO0A 5DDPC 3G87A 1H98A 4QJVA 1QTNB 4XDDA 1ULRA 4WFZA 2NXJA 5K20B 4U6PA 3FNNA 2ZHBA 4DR3J 3RB4A 1WELA 3HZGA 1NJWA 2N4DA 2DNYA 2RUGA 3DLKB 3PX0A 4DFJA 5A76A 9RUBA 2DRAA 2GC8A 3QJJA 2CWKA 4LF9J 2IFXA 1JJCB 1V6HA 4ES3A 1F3FA 4DPXA 3M6WA 4HT7A 1XMQJ 4OFZA 1U1QA 1N6QA 1N34F 3MURP 4ZVGA 4X4UA 1PBUA 4IRCA 3DRRA 2AIRB 4XO0A 2M88A 1UVLA 1U0SA 2E5IA 4I64A 4NLOA 1NLKL 3TQ1A 2Y8YA 1Y11A 2B56A 4G1QB 1GEHA 4DR1F 3DRRB 1M5OC 2ZHOA 1GX6A 2HGMA 4F4XA 1Y0HA 1RHKB 2IM3A 1HD0A 1R8BA 3QO9B 3SDEB 4LF1A 3OLBA 1GXLA 1UTAA 2XYPB 4DV2F 4PUOB 2DR5A 1UVMA 3HHNB 3K0JA 1NK9A 4LRCA 4K4UA 2JSXA 4NE9C 1VIXA 2DGXA 1ZAWA 2CYYA 2Y1IA 4ER8A 4ENOA 1M5KC 2W4CA 3QIPA 3AODA 3D6HB 2Z57B 4AYBD 1RCXB 3LANA 1F5CA 3PRBA 4H54A 1Q7LB 4DU8A 1Q86T 4NLYA 2DR9A 1A9NB 1JIHA 2DITA 2UXCJ 2JC0A 3BKFA 2CPDA 3BGRA 4KPCA 6FD1A 2ZUAA 2R2SA 1YITS 5B0GA 4O3SA 3NL0A 2DR6A 2E7XA 2EFPA 2IJRA 2Y0SD 3GG1A 2DEJA 2G2YA 2V2KA 3TW0A 2X3GA 4DUZF 2XLJA 1FRKA 2O1PA 4XPEA 4YY3F 2Z30B 4OX7A 2PFDA 4LFCF 4KC5A 3FBEA 4IH6A 1MWZA 5G0RA 4JI8F 4QYZJ 2FY8A 2H5IB 2HNYB 1CJUB 1U2FA 1Y5LB 2RT3A 3M6UA 1NDKA 4I4BA 1PYTA 1UW4A 3MR3A 1FRJA 3WX4A 3H5XA 4ECWA 3CEDA 3PR4A 2BW7A 1FKPA 4LUBA 4DL6A 4FXDA 4LIRA 1SH2A 2E5JA 5EWGA 2XWXA 3KLIB 4P9SA 4HR2A 2WAQD 2AJ4A 1DTTA 3P5BP 5EX0A 3CCVS 2C2NA 2GCFA 2AV5A 4DWIA 3D5MA 4DSLA 3KJFB 4L6V3 2I38A 4ZLNA 3NMAA 2X3DA 4ED5A 1WJ9A 5ETNA 3SEOA 3IWNC 3DRPB 1I1GA 3HSDA 2DPJA 1B0VA 1PGZA 2FLNA 1HNVB 2KFZA 3FVYA 4A4JA 2HMIB 2CNOB 3M8YA 4J9SA 1VYAA 1RTZA 2B9EA 2CJQA 5DO2A 4Q45A 4JUZA 2FPHX 2FLPA 1PG5B 3DLEA 2IJNA 1VRTA 2W01A 4Q0BB 4Q0BA 3HKWA 4OYIA 4LFAJ 4OI4A 1FDBA 3MMCB 4MIWA 4DX6A 3M8SA 2DRBA 1SJRA 1VC0A 3TR5A 2MLYA 5B0FA 3GQCA 1E6VA 1U02A 1WACA 3VGTA 2DCLA 3K5OA 1YIJS 2J76E 4KHPF 1JJHA 2HHVA 1WG4A 2EW9A 2XSFA 2YKMA 4BHQA 3N4WA 4TQRA 1OJ4A 3JTNA 5KFLA 1NJXA 4JV2A 1N52B 2V2ZA 2B9YA 4AT1B 3OVAA 3I0SB 2OMOA 1R43A 2DXDA 2QL9B 4KGMA 1S59A 3P4UB 1R0BG 4CCHA 2J5AA 5D6GA 3HVWA 3G9CA 2UUBF 4QW9A 2LXFA 3DNCA 4AQYF 1S10A 4AFFA 1T05A 2JRSA 2B7CB 2DNLA 1FKPB 4I7FA 2FIUA 1Y3JA 2P9EA 1RXOB 5ETTA 4Q43A 1DLOA 1T9UA 2P9CA 2YWHA 2XSJA 3UR3C 4E8UA 4Y0FA 4CNYA 2HFNA 1VQPS 2UUBJ 3PY8A 2MJNA 4ZLJA 5J2MB 1M1HA 2M2BA 1EJ7L 3H90A 2H1YA 2PA3A 2CPEA 3MHYA 3UVJA 1N33F 1C1CA 2ZWPA 3A12A 3BF4A 3GFZA 3HVTA 4RKUC 4Q7AA 3MR6A 1S0OA 1VQ8S 4LF7F 2FDNA 1NK0A 4DL3A 4JV0A 1HHQA 2DHGA 3HJFA 2F65A 4RBVA 4TY8B 4Y28C 5ETVA 5T41A 2F9DA 4F25A 3GG0A 4F04B 3E3XA 4ZDNA 4CLPA 5JVGQ 4J90A 4CLWA 3DM2A 2IVMA 3GIMA 1C0UA 2KKHA 2R7TA 4RU9A 5HJYA 1RT6B 4DX8H 1HNZJ 1VMBA 4AE5A 1SIWB 2DT9A 2K1RA 4KKOB 5CYQA 3PACA 3TJAA 2QEXS 2GHWA 3MTKA 1LWCA 3Q8PB 1IBLJ 2OUGA 1JKHA 4J7CA 3IRXB 3PG9A 1HQUB 5E0OA 3EXCX 2YY3A 3QLHB 2L3MA 3VAFA 4A8QA 2MZJA 3PXGa 3SCLE 3GJTB 3OJUA 1WDDA 2H4YB 4USWA 3KK1B 2UUAJ 3RAQA 1IM4A 3NCPA 4B3RJ 3CVKA 1J27A 2XG8A 2QLJB 3H8YA 5K14B 4EK2A 1REVA 1VIOA 2ZDOA 3G82B 2RMLA 1QTMA 1NPKA 3SYZA 1Q16B 3RB6A 1I6JA 3CWJA 4LQ3A 1WWHA 3WX8A 4V19J 3CJ5A 2CQIA 2HAIA 3C16B 2FVQA 4B9TA 1TP7A 4NYZA 1MLAA 2LMIA 5KFNA 3J7Z5 1J5EF 3MM7B 1CS4A 2L9NA 1RHRB 1FRXA 1RTJA 4WTOB 1YWXA 2BA9A 3O1LA 4R0JA 3G96A 3W64A 3CJKA 2VOOA 2XHCA 3GZ7A 1OY6A 3QMQA 3DDNA 1K8AT 3IAS9 2HK2A 3CCZA 3DOKA 2MQNA 2ZNYA 7FDRA 3UD5A 3CD0A 1IWAA 2EKNA 3D0HE 3DC2A 3HCXA 4CLZA 2DH9A 1S12A 4DU7A 2XNRA 4PYAA 1FNOA 3GJQB 1UJ5A 3S8SA 1LOUA 1TKZB 2YNGB 2B9WA 4ES2A 2OELA 2FJVA 5FD1A 2CPFA 2CVEA 3CCQS 2GV1A 4CO3A 2QL5B 1H2UX 4USVA 4YUDA 1N5TA 1NHKL 1QAJA 3NCQA 1RWUA 3VHQA 5J2NA 2ADCA 3A8JA 4NRTA 4JYAF 2HRUA 4Q8FA 3O6QA 2NXNA 1N5SA 4QIVA 1RK8A 5IT9U 3NMRA 4B3OB 4DX7A 3U7JA 4D3HA 5CAAA 1N88A 2MKKA 1V3ZA 4WXOA 5KFUA 3UFCX 4CYUB 4B9SA 4AL5A 1UEKA 6AT1B 1S0NA 1ZH5A 2Z8QA 4I6AA 1FDDA 4Z7YA 2ZHAA 4AL6A 2CZ9A 3V2UC 4QIFA 1FESA 2F1FA 1HW9A 4ZN1A 3CJTA 2CRLA 4C9DA 3P3DA 4RW6A 2WB1D 1P1TA 3JQMA 4L3NA 3M9MB 1Q8IA 4CI0B 3EPIA 1EKRA 2MYFA 3UR0A 2ZH7A 1GMVA 1XMOF 3A1YG 1SQFA 3Q2SC 3A3PB 1PJ7A 3K59A 1ZTTA 2AMCB 1WEZA 1DRZA 2BQUA 2UXBJ 4OZ2A 1Q79A 3GIKA 3NCRA 4EO6A 4IDKB 1QM9A 1MMLA 3C15A 3M30A 3MMBA 2QLFB 2W4DA 2V5HG 2XI3A 3DYAA 4ILMA 1T9XA 5IWAJ 1BHNA 1WOPA 2H54B 2V4JB 2XYGB 4NLUA 3K5LA 1HBOB 2C3OA 2RS2A 4IUFA 1P1LA 1IQZA 1F0XA 1PYSB 2HNZB 3SQGA 1TUGB 2JLEA 2K3KA 4URQU 4R5PB 4K4VA 3ONQA 2OEKA 3M1VA 4A8XA 2VB6A 4KFBB 5KT7A 4LFBF 4L75A 4PPDA 2RHQB 3KHLA 4HT5A 3A8EA 2OLWA 3Q8YA 5EWFA 3WDOA 1WKLA 3V6DB 4QWBA 5KFOA 5ITHA 3AJDA 3GYXB 4KGZB 4CLFA 4WXWA 5K8OA 1RAAB 1E6YA 3J81j 1AW0A 3PEHA 4KFBA 1YX2A 2GHVC 2GMJA 4LJMA 2G0JA 3QBCA 1WC0A 2EBGA 1TK5A 1JLCA 3L3CA 2PA8D 2GVDB 3T5KA 3A8IA 1OY8A 2YNHB 2EPIA 1ZTWA 2AYMA 5KFQA 4I6WA 3MUTP 2ASJA 5IC4B 4PAAA 3TNVA 2CJYB 2DD8S 5KG5A 4NCBA 2CJKA 4X4NA 3I5BA 3FQKA 4RW7B 2JVRA 2VDIA 1JJ4A 5FLXU 3KLFA 1WG5A 1KFDA 1Q8KA 5KFXA 4U8YA 2P6TA 4L74A 4WWSA 5D4PA 3S1TA 2I1RA 3QT8A 1GQEA 3KK3A 1A6LA 4NYOA 5IM0B 2DYAA 3SFGA 4O0IA 2ILZA 1OQ3A 4LF8J 4YB6A 1WOSA 2SXLA 2ZITA 4M5NA 4NMXA 4PXEA 4WKRA 3H5UA 2XWYA 3OR2A 2JEFA 2HVHA 4W90B 1FWKA 2B5JB 5AXLA 2XMMA 1X8DA 4UTGA 4NA1A 5D15A 3TVZA 5K8NA 4DSJA 2E9RX 1YRTA 5LMUF 4R0EA 4WK3A 3DKDA 4CH7A 1WHWA 4A8MP 2R9LA 4F8RA 1HBMB 4JBCA 1HYSB 3PRDA 2L9DA 3CDUA 3HSJA 4DMZA 1KN6A 2XGQA 3RB3A 3W2VA 5CZXA 1FRIA 1HNXJ 4EZ6A 4JI5J 3I31A 2QYGA 2F5GA 2B8PA 2YNIB 3NOCA 1RT7A 1UJ6A 2LQ9A 1FD2A 3O8WA 3ENWA 4JV1A 3QIDA 4DS4A 3TUPA 5AE2A 1RAFB 2Z2YB 2QA2A 5J2PA 2V9KA 1O8BA 2RSQA 4M5KA 4DN9A 5CHCB 1D09B 2DNOA 2CWXA 2OP5A 1DAXA 3DU5A 5KOXA 1R0AB 1HNWF 1PAUB 5HLFA 5DG7A 4RPFA 4EYIB 1SKUB 4F4ZA 2FHJA 3MCMA 4F2SA 3RAXA 3SQOP 2EFNA 2YQ0A 2W7PA 3VGUA 3PKMA 1WC3A 4I2PA 1FXDA 4YR3A 3K8WA 1BLUA 4M94A 1OSCA 4BWJA 4I2PB 2DEIA 2QFIA 3JXOA 3FUYA 1MW7A 1WHVA 4UOHA 2MZ1A 1R8CA 2RQCA 3T5LA 4CZCA 1DTQB 2J6UA 3JQKA 2R2UA 5KT6A 3CCES 2J8AA 2J6TA 1G1XA 1IR0A 4ZCLA 1VK8A 3SV4A 3PTWA 1BWVA 1QE1B 4A8FA 4EZ9A 2NXUA 1Q0NA 3OVBA 2WVBA 3L95X 3IM8A 3I5AA 1DZ5A 2AKWB 4IFYA 3VAIA 3QYYA 2HHWA 4OZ5A 2FTRA 2N4CA 2WOMB 4YB7A 2RQ4A 4P2XA 2F4VJ 2PEBA 1HQ2A 1M5PC 4KKOA 3I9V9 2JHEA 3TEHB 3E01A 3QFHA 1RT6A 3HVAA 4NLVA 4LT6A 1UVJA 1RI7A 1YJWS 5CABA 3THVA 2YX4A 4U9RA 1VHIA 4GRSA 5F3ZA 1T7PA 3MR2A 4FDFA 2MKIA 2VG5A 4DLEA 2QA1A 4JI1F 4JV5F 2B4VA 3CCTA 1C1CB 3FSYA 5DS7A 5EHHA 4DUZJ 2BDPA 4ELVA 2GA7A 4DR6J 3J7ZT 3OVSA 4K4ZA 2K7KA 2IPOB 4PG6A 4Y2KA 2DGUA 1S99A 3GFYA 4P73A 2XSJB 5L9XA 4DUTA 3KLFB 4O3OA 2W9CA 1TVRB 4OI3A 3V4IB 2FHMA 1UKUA 4F4AA 4MIBA 1KTQA 5IT9Y 4ANEA 4OYBA 1RAEB 3PEJA 1U1MA 1DQAA 3CSKA 3AXMA 4CRJA 3CCRS 2B3TB 3VCDA 2CZ4A 5GAHI 1ZPVA 3UDVA 1DTQA 3OQ2A 2CVIA 3KHGA 4IG3A 1FE4A 1OMSA 3J7AN 4KGKA 3QPIA 1CPZA 4ITSA 3AOCA 4JB8B 2B8QA 1IN0A 1RU2A 3B82A 3CJ8A 2E9TA 2YPZA 1HQEA 5IFMA 1U24A 2YKAA 4DL5A 3VAJA 2XTJP 2AEJA 1JLGA 3CIMA 2IY5B 5JVHQ 4C7QA 1VK3A 2JZ5A 3FMWA 2HIYA 1IBLF 4CP5A 5D0RA 3VVUA 3ZNJ1 4OHXA 4F36A 4WYWA 1JLEB 3QFWA 4LQ9A 5K5MA 4TYBA 4DL2A 1KHWA 2EFGA 4HHHA 4J9MA 2UXBF 2E7VA 2ZJQQ 4JP8A 4DV6F 1FI4A 1TKTA 2LXIA 1N8RT 1KNZA 4RW9A 1FDAA 3ITHA 3DRPA 5HL7Q 2NREA 4PYDA 2B6AB 4NLGA 2XGPA 4Q44A 2DH8A 3R27A 1NM2A 5KFKA 1UVNA 2HBYB 3KG1A 2GIRA 5IXUA 2QLBB 4FS1A 2VPZB 3W2VB 4NXNJ 3QRPA 2AF6A 2YXLA 4GVLA 1W2BR 3GFHA 2C3PA 3AOAA 2DY1A 4OJGA 3TEGA 4Y2MA 4MMOA 2XNQA 5HANA 4C11A 4PWDA 4J9PA 3IXQA 3T1HJ 3ZFVA 1KBRA 2QYCA 1ZM2A 1CC7A 1FEHA 1NSKL 1XEZA 2CQ0A 3OFFA 4HTIA 2FHJD 2BANA 4MFBA 2CPJA 3OJSA 2COLA 4O44B 3FEZA 5I42B 3PYFA 4I2QA 4NEYA 4YP3A 2MHNA 5J2NB 5KT5A 4IRDA 4LF7J 1OSDA 3MOZA 2WOMA 2YWFA 3C19A 1FJGJ 3KDOA 3JTOA 3R5DA 4IQMA 4FKXA 2Q6CA 4P6QA 1SC4B 4F0KA 4WYLA 1ROFA 3KDNA 4U8VA 1NNDA 3H42A 4M5MA 4OJHA 2VBXA 4X4SA 4WZMA 4ID5A 2AJ0A 3M2RB 4KAIA 4J9QA 4PG4A 2E5GA 1OPIA 2Y3YA 4LBPA 5JXSA 3IR5B 2HBQB 1QY7A 2J0QD 1QVFR 3HDSA 2F8EX 2O66A 3OL8A 4BS2A 4UY8T 1HR0J 1NEEA 1RTHA 2D3ZA 5DM6Q 2IYIA 4K4YA 4RW8A 3KWMA 3U1NA 2KG0A 3ENAA 3BSNA 2FJDB 4USJC 2EXUA 3JQJA 3TA1A 1TK0A 2PFFB 5D4OA 3QZ8A 2BE9B 5LL6d 1YRXA 1CQMA 4ZCIA 3HT3A 4U7UD 2A18A 1JNZB 4J9OA 1NB2A 2OO4A 2GJIA 1Z2ZA 3O44A 1UFLA 3NXZA 5K8PA 5KG7A 4YDXA 3Q8SB 1IJEB 1L3TA 4Q2LA 1FJEB 4KBIA 3T19A 2E1MC 2FVSA 4DOZA 5AXKA 2A6MA 2XMVA 3ETMA 1VBXA 2KJVA 2XCAA 2W8KA 2YX1A 2IRUA 5E3AA 4MYTA 1N34J 2HGNA 3M2UA 2WVDA 3EVWA 1MU2B 4WU2A 2XZTB 5E33A 2QLXA 2UU9F 2QX0A 3ILOA 4QIWD 1VQ5S
chains in the Genus database with same CATH topology
1F3FA 3L7UA 4F4AA 1HHQA 5C7PA 4FKYA 4ANEA 4DI6A 2HVDA 5BXIA 1XQIA 1ZS6A 1PAEX 1NLKL 3FBFA 1NCLA 3GPAA 1NDCA 1U8WA 4C6AA 2B8QA 2HURA 2DXEA 4UOGA 1PKUA 3BBFA 3GP9A 3ZTRA 4O0NA 2BEFA 1B4SA 1EHWA 2DYAA 1NDPA 1NSQA 1HLWA 3VVUA 1NUEA 4CP5A 4ENOA 4F36A 1NSPA 3B54A 4ANDA 1UCNA 4EK2A 3Q86A 1NPKA 3DKDA 2VU5A 1MN7A 4KPCA 3EM1A 3WX8A 2ZUAA 1KDNA 1B99A 1JXVA 3FBCA 2AZ1A 2B8PA 3R9LA 1BUXA 2DXFA 3EE3A 1W7WA 3BH6B 3EVOA 4W98A 2NCKL 3FBEA 1MN9A 3FBBA 3Q89A 3ZTQA 3FCVA 3G2XA 1NDKA 3BBBA 3FC9A 1BE4A 1NSKL 1XIQA 3ZTPA 4ANCA 3VGUA 3PRVA 3EICA 4HR2A 1NHKL 3EVMA 3MPDA 3DDIA 5IOLA 3NGSA 4UOHA 4FKXA 3NGUA 4DZ6A 5CAAA 3FKBA 1S5ZA 1VYAA 1S57A 1WKJA 1WKKA 3Q83A 2HVEA 3BH7B 1F6TA 1K44A 2BX6A 4WBFA 3JS9A 3NGRA 3EJMA 2AZ3A 3VGVA 3ZTSA 3VGTA 3ENAA 3ELHA 3Q8UA 3Q8VA 3FCWA 3B6BA 3VVTA 2DXDA 1S59A 1NB2A 1NDLA 3PJ9A 5CABA 1BHNA 4UOFA 2DY9A 1LEOA 1HIYA 3ZTOA 3ETMA 3NGTA 3VGSA 3EMTA 4S0MA 3Q8YA 3BBCA 3EVWA 1WKLA 4DUTA 2CWKA 1LWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3F A;  3L7U A;  4F4A A;  1HHQ A;  5C7P A;  4FKY A;  4ANE A;  4DI6 A;  2HVD A;  5BXI A;  1XQI A;  1ZS6 A;  1PAE X;  1NLK L;  3FBF A;  1NCL A;  3GPA A;  1NDC A;  1U8W A;  4C6A A;  2B8Q A;  2HUR A;  2DXE A;  4UOG A;  1PKU A;  3BBF A;  3GP9 A;  3ZTR A;  4O0N A;  2BEF A;  1B4S A;  1EHW A;  2DYA A;  1NDP A;  1NSQ A;  1HLW A;  3VVU A;  1NUE A;  4CP5 A;  4ENO A;  4F36 A;  1NSP A;  3B54 A;  4AND A;  1UCN A;  4EK2 A;  3Q86 A;  1NPK A;  3DKD A;  2VU5 A;  1MN7 A;  4KPC A;  3EM1 A;  3WX8 A;  2ZUA A;  1KDN A;  1B99 A;  1JXV A;  3FBC A;  2AZ1 A;  2B8P A;  3R9L A;  1BUX A;  2DXF A;  3EE3 A;  1W7W A;  3BH6 B;  3EVO A;  4W98 A;  2NCK L;  3FBE A;  1MN9 A;  3FBB A;  3Q89 A;  3ZTQ A;  3FCV A;  3G2X A;  1NDK A;  3BBB A;  3FC9 A;  1BE4 A;  1NSK L;  1XIQ A;  3ZTP A;  4ANC A;  3VGU A;  3PRV A;  3EIC A;  4HR2 A;  1NHK L;  3EVM A;  3MPD A;  3DDI A;  5IOL A;  3NGS A;  4UOH A;  4FKX A;  3NGU A;  4DZ6 A;  5CAA A;  3FKB A;  1S5Z A;  1VYA A;  1S57 A;  1WKJ A;  1WKK A;  3Q83 A;  2HVE A;  3BH7 B;  1F6T A;  1K44 A;  2BX6 A;  4WBF A;  3JS9 A;  3NGR A;  3EJM A;  2AZ3 A;  3VGV A;  3ZTS A;  3VGT A;  3ENA A;  3ELH A;  3Q8U A;  3Q8V A;  3FCW A;  3B6B A;  3VVT A;  2DXD A;  1S59 A;  1NB2 A;  1NDL A;  3PJ9 A;  5CAB A;  1BHN A;  4UOF A;  2DY9 A;  1LEO A;  1HIY A;  3ZTO A;  3ETM A;  3NGT A;  3VGS A;  3EMT A;  4S0M A;  3Q8Y A;  3BBC A;  3EVW A;  1WKL A;  4DUT A;  2CWK A;  1LWX A; 
#chains in the Genus database with same CATH topology
 3DLJ A;  2F8H A;  1S6Q A;  2KT2 A;  2EG2 A;  4PPZ A;  4HTJ A;  1BWE A;  3S7R A;  1N54 B;  3CD6 S;  3LP1 B;  4DI6 A;  2HVD A;  2MLX A;  3MEC B;  3MM5 B;  3N9U C;  4ICL B;  2GGP B;  1RHJ B;  1C1B A;  1LWE B;  2C3M A;  3GPA A;  2XO6 A;  3KJV B;  1FTR A;  4I6Y A;  1YDL A;  4MK7 A;  3FFI A;  3MEC A;  2M8H A;  4BC9 A;  4EUV A;  4BLG A;  3TAM A;  4YHH F;  3UVJ B;  2WBR A;  4Q8E A;  3Q23 A;  2CUY A;  5KG2 A;  5LT5 A;  1FER A;  2KXN B;  2P5V A;  3ZTR A;  2VQF F;  1ZET A;  2LFV A;  2KXF A;  4X4R A;  2FVR A;  1K0T A;  1S4E A;  4RW7 A;  4KHP J;  3MD3 A;  2HND A;  3IC1 A;  4I7F B;  3W9I A;  2R7U A;  3MM6 B;  1HLW A;  3SSR A;  1HBN B;  3LGH A;  2YNF B;  5GVQ A;  2VZ9 A;  1QSS A;  2LDY A;  5BYR A;  5B0D A;  2OSR A;  5B0E A;  3CCJ S;  2C2E A;  4GKJ F;  1P8G A;  1UFK A;  2P8I A;  2X1B A;  3BZQ A;  2MQO A;  4OX9 F;  3MAQ A;  4G65 A;  2LVW A;  3HX9 A;  3CJK B;  3MR7 A;  3O5T B;  1S9E A;  4LR7 A;  4EMD A;  2N7C A;  2KT3 A;  2OPQ A;  4U7U K;  2Y1J A;  1KEK A;  4FF4 A;  1BUX A;  4IG0 A;  2VD3 A;  2Z56 B;  3F73 A;  4YQW A;  3T5J A;  2IMW P;  4RU2 A;  4ECS A;  1Q1K A;  2RRB A;  3D68 A;  2EI5 A;  5EUH A;  3W8G A;  5HQ8 A;  1PO6 A;  4ZVR B;  3LF0 A;  3G82 A;  1WG1 A;  4RL1 A;  4GO7 X;  4ECV A;  3LWM A;  1KFS A;  3H7H B;  2F9J A;  3M1V B;  3DLE B;  4IH5 A;  2XMA A;  5J1E A;  1KSP A;  3KMQ A;  3ISZ A;  3O3L A;  3THT A;  3M05 A;  2KB2 A;  4ZIW A;  1IKV B;  5J2P B;  2HKE A;  2C3Y A;  4LSZ B;  3C14 B;  4PEO A;  4ZP8 A;  2PSZ A;  4ZVP B;  1H3D A;  2QGF B;  4A48 A;  5HMZ A;  4LSL A;  1NAQ A;  3EIC A;  2VG7 B;  3BN7 A;  3V5R A;  1FKO A;  1YBA A;  2WCX A;  3RBZ A;  2QT7 A;  2DNH A;  5ETM A;  5KFA A;  4QBU A;  2HHH F;  2ZH4 A;  3VAM A;  2UUC J;  2VIC A;  2BJ1 A;  1X5S A;  2CA9 A;  2FLO A;  1DTT B;  3FSX A;  2BE7 D;  2D41 A;  1S4F A;  2AX0 A;  4L3K A;  3KLI A;  5LM7 E;  3W65 A;  4DL4 A;  1JMT A;  4P7V A;  4USU A;  2LKZ A;  1HBM A;  2XI2 A;  2DHH A;  1YI2 S;  5F8M A;  2ZC4 A;  4XDC A;  3DLB A;  4RLE A;  4RW4 A;  2JEG A;  1BD6 A;  1VHF A;  2ZWO A;  3DGP A;  3R5C A;  4Z2X A;  2J0S D;  3JS9 A;  4M5H A;  2DGT A;  4Y34 A;  5E7O B;  5LSR A;  4J9K A;  3BQ2 A;  4TVA B;  2GS8 A;  4RW4 B;  3FGV A;  4C11 B;  3KK3 B;  1ZM9 A;  3BGL A;  4A8K A;  2MY8 A;  4ED2 A;  3UW1 A;  1VQK S;  4FF1 A;  1N0V C;  3Q8V A;  4YEA A;  2IVF B;  3HP6 A;  1DUR A;  3KUG A;  4RNO A;  2MGZ B;  3Q24 A;  1F3V A;  3J7A 1;  3PX6 A;  1NDL A;  5I4M A;  1FKO B;  1G6B A;  3LPE A;  5RUB A;  5CQG A;  2CQP A;  1LEO A;  3HHL D;  2E5L F;  1FXL A;  1M0S A;  5M2P A;  3PIO Q;  3VGS A;  1U25 A;  3M2V B;  5J1E B;  2EFO A;  3ZZO A;  2WSE C;  2FUG 9;  3TOQ A;  2D9P A;  2DJW A;  1SKS A;  3QAE A;  1D0E A;  1FJ7 A;  1U2C A;  4X4V A;  4LRD A;  1R0C B;  3MEG B;  3H5S A;  4WPA A;  2HZV A;  2HK3 A;  4DV7 J;  2J9E A;  1XK8 A;  4XK8 C;  1VI7 A;  3G6X A;  4OZ0 A;  4CO1 A;  5DQH A;  1JJ2 R;  2A0F B;  4LFA F;  4OV1 A;  3GLJ A;  4X65 J;  4R5P A;  4DV0 J;  1FA0 A;  1LXJ A;  4N47 A;  3UNG C;  3RRH A;  1HBO A;  5C2G A;  1SH3 A;  4X4T A;  3BM7 A;  1YHQ S;  1NJY A;  1Q82 T;  4C8N A;  4IOA Q;  4C4W A;  4DR4 J;  4CT9 A;  3LAM A;  2IRY A;  2FY1 A;  1UPP A;  1LK7 A;  1LWF A;  5FDL B;  4DS5 A;  1QD1 A;  3CE8 A;  4XPC A;  4GC7 A;  1EP4 A;  2LEB A;  4OX8 A;  4NAS A;  1P27 B;  1T9T A;  2QSF A;  2X7I A;  1JKH B;  2FJA B;  2Q3P A;  4LRE A;  4B9U A;  4X84 A;  5KFV A;  1EHW A;  2ZZM A;  1LWC B;  4JI3 F;  2LDI A;  1WUU A;  2Z4P A;  2K06 A;  2LQ8 A;  5T7L A;  4ZPB A;  5U47 A;  3ICL A;  3ZC4 A;  4ZJL A;  2G0C A;  1AZS A;  2YWG A;  5D77 A;  2YPY A;  3H25 A;  2W8L A;  1YJU A;  2V8H A;  5CXT A;  4JI3 J;  3CDW A;  4MK8 A;  3KLG A;  2W7O A;  2XB2 D;  5CH7 B;  2ZUG A;  5KT2 A;  2JFK A;  3NBP A;  4MJK A;  3IRW P;  1T9Y A;  1RAJ A;  3E01 B;  2UVW A;  2VFT A;  3IFE A;  4YN3 B;  2IHR 1;  2NCK L;  4URG A;  4WFX A;  3NS5 A;  4FZV A;  4Z7C A;  3PZP A;  3UD3 P;  1TZ0 A;  1VS3 A;  4KT0 C;  3R97 A;  2XS7 A;  2HHS A;  5E2Q A;  4U7C A;  2F40 A;  2G1H A;  3OXG A;  2XYH B;  1RE1 B;  4CO0 A;  2UUW A;  2HHP A;  4TLQ A;  2A2D A;  2IMO A;  1KVK A;  3VR1 A;  5SZT A;  3DOK B;  1LNQ A;  3ET6 B;  5HVF A;  3KLH A;  2XZD B;  4CLK A;  5E3R A;  3SIP B;  4FPI A;  4LF4 F;  5LOQ A;  3TAR A;  2AYB A;  5IOL A;  4CLT A;  4HAC A;  1IKX A;  1HI1 A;  4CQ1 A;  4ELT A;  1ZM3 A;  4QU6 A;  3CME S;  5EX3 A;  2JVO A;  5B09 A;  4K7Q A;  2ZJR Q;  4ZJO A;  1S7I A;  2O5D A;  3A3N B;  4CLY A;  1XJW B;  1K44 A;  1KP6 A;  5K14 A;  4ZKA A;  4C48 A;  3G8Q A;  2B4U A;  3SZ2 A;  2O67 A;  2VAS A;  1FFS B;  3EJM A;  2LU2 A;  2E7W A;  2ZBP A;  2QMU B;  1NK6 A;  1TUV A;  1S79 A;  2GJF A;  5HAT A;  2PC6 A;  3OR1 A;  3DYA B;  4ZP6 A;  4OHZ A;  3AY0 A;  2QA4 G;  2PN6 A;  3W2W B;  2CAD A;  1VQN S;  2OHD A;  2NPI A;  2RIJ A;  5HP1 A;  2YNI A;  4I1T A;  1AFJ A;  1S1X A;  3LUY A;  5A8R B;  3FCW A;  4Y2C A;  3GIL A;  3EX7 B;  4LF5 F;  2HW3 A;  5CYQ B;  3CJ2 A;  2QG9 B;  1RWK B;  2FVC A;  2IBO A;  1TAQ A;  3C6U B;  4PWU A;  3W9H A;  5KFG A;  3QWU A;  3R2C J;  8AT1 B;  5HVH A;  4LF6 J;  2MEW A;  3M32 A;  4ED6 A;  3QZ7 A;  3PDN A;  1WI8 A;  4UOF A;  2I5J A;  3HHL A;  1NKB A;  1HA1 A;  3W61 A;  2UU9 J;  2MKC A;  2ZD1 A;  2DNM A;  2GVZ A;  4ZLP A;  3KHH A;  3MM9 A;  3RBX A;  3HSZ A;  1HNW J;  2XLI A;  1KR4 A;  4OIX A;  2IDL A;  2M3D A;  3HVT B;  5DM7 Q;  3H5Y A;  1MRO A;  2BBE A;  1UMJ A;  2CXE A;  2NLW A;  3PJW A;  2WBM A;  4ILR A;  1MWQ A;  2RQK A;  2Q43 A;  3M9O B;  3OW2 R;  5HMW A;  3HUL A;  1HD1 A;  4DR5 J;  1BGX T;  4OI2 A;  2MKS A;  2DGS A;  2HLT A;  4DL7 A;  2ZEJ A;  2DNG A;  2FJX A;  4LRA A;  4M5G A;  4CLS A;  3BDE A;  2E5H A;  1X4E A;  2Y1R I;  3P5T L;  2BJ8 A;  1YZ7 A;  3MGJ A;  4EBD A;  1ZZF A;  3D66 A;  2QL7 B;  3KUE A;  4N56 A;  1S1X B;  5A8R A;  1M1K T;  3T9Z A;  4OLO A;  4LRB A;  3QNW B;  3DLG B;  5J1P A;  1U8W A;  2R7O A;  5H9F K;  5I3U B;  2J7U A;  1TL4 A;  2HUR A;  5KFM A;  2DXE A;  3B78 A;  1N5Q A;  5HMX A;  4DEZ A;  3BBF A;  4PWW A;  5C42 A;  1ZZN A;  1E6Y B;  3W63 A;  2IA0 A;  3I0R A;  2K2P A;  4TXS A;  5FJ4 A;  2B43 A;  1Q5V A;  2VPY B;  3AJ1 A;  3I32 A;  5F3T A;  5KG1 A;  3US5 A;  1NDP A;  3JSM A;  2UXC F;  3OBI A;  1RTI A;  1IQT A;  5B08 A;  3C16 A;  3VV2 B;  2EWH A;  1NSP A;  3M8P B;  1UCN A;  1M5S A;  5A2Q U;  2OTJ S;  3DXS X;  5CD4 A;  2XC9 A;  1LQ9 A;  2FD2 A;  2J0W A;  1XR5 A;  3CDB A;  1HI0 P;  1FRH A;  3TO8 A;  4RBU A;  5C25 B;  7AT1 B;  3EDQ B;  2VJU A;  1EQM A;  2JEI A;  4DV1 J;  1S6U A;  2GFF A;  1H6K X;  2D3U A;  3G8S A;  4ECY A;  1RGV A;  3KK2 A;  4LVO P;  2QMW A;  2W2P P;  5A2Q Y;  1R6Y A;  1Y3K A;  2L48 A;  4ZPC A;  1KQF B;  2HEK A;  3EE3 A;  5KFT A;  1K1Q A;  2RD5 C;  3W66 A;  2KH9 A;  2W2Q P;  3B4M A;  3OL7 A;  3HHL C;  4DV1 F;  1ZBT A;  1TVR A;  3IA0 A;  5AJ3 J;  4ZOS A;  3CJ4 A;  1T03 A;  1UW9 A;  2F63 A;  4QPT A;  3R1L A;  3UN3 A;  1RWN B;  2LLZ A;  4NLW A;  3MCO A;  5I3Q A;  3OSN A;  1T0T V;  3HVR A;  2JLG A;  5CYM A;  1BE4 A;  1JLF A;  2VC0 A;  4YY3 J;  3MM8 A;  1G4C A;  5AJ3 F;  2VON A;  1CJU A;  1F2G A;  1RBL A;  1TL1 B;  4A46 A;  3D9B A;  2PMH A;  1S0M A;  1C2P A;  4ZPA A;  2CIM A;  4J9L A;  1N4L A;  4JI8 J;  4FN5 A;  4DV0 F;  1FXR A;  1Y4Z B;  2XY7 A;  1NHV A;  3EVM A;  2ZNZ A;  3ZZ0 A;  4DV3 F;  3PYD A;  3IO1 A;  2ZH6 A;  4HYK A;  1Z1Z A;  2DIS A;  1I5O B;  1HI8 A;  3I4H X;  1HWI A;  3DOL B;  4NLT A;  2DIV A;  2MZT A;  1Q7Y T;  2PE8 A;  1U09 A;  7FD1 A;  5HQM A;  1SL2 A;  2HFU A;  3C6T B;  1S76 D;  3CF5 Q;  2M52 A;  1NPP A;  1VCT A;  2KTQ A;  4UZC A;  1RCO B;  1VIS A;  1WKK A;  5T7L B;  1B3T A;  3R5A A;  2HWH A;  3G6V A;  2V8D A;  4B9N A;  3I87 A;  1AT1 B;  2OPS A;  2V8P A;  4NLR A;  3AOB A;  1KRP A;  4DR7 F;  1O5J A;  2BE2 A;  1K9M T;  2OGU A;  4ZP9 A;  1BQX A;  1T95 A;  5AXM A;  2PI4 A;  1B64 A;  1F9F A;  3VGV A;  3IS9 B;  2R7X A;  4ETZ A;  5DQG A;  4DF8 A;  1V3S A;  2KL8 A;  1WC4 A;  1VQ6 S;  4ILL A;  3ELH A;  1H38 A;  2ATC B;  3Q8U A;  5BR8 F;  2I8E A;  1AUS L;  1TL7 B;  2PD1 A;  3VVT A;  2YKM B;  4EFA C;  2HGL A;  1SBR A;  2V0N A;  3FDS A;  3FCH A;  3IG1 A;  4PZV A;  4J9N A;  3QJP A;  2FJE B;  2NPF A;  4ALZ A;  3CUL A;  1SQG A;  1L3S A;  1JK9 B;  1JLB A;  2L08 A;  1IVZ A;  3P6Y C;  1R8P A;  2W2N P;  3R5J B;  4KJI A;  5KFD A;  1HIY A;  3MMC A;  3NEK A;  4ATN A;  1SL1 A;  2WW8 A;  3NGT A;  4QU7 A;  2FLL A;  2IAJ A;  5CA5 A;  1XBW A;  3EMT A;  2CQC A;  4KYZ A;  3OUY A;  2V50 A;  2R7Q A;  2DVI A;  4YS2 A;  3KG4 A;  1X5T A;  4WFB Q;  4HHU A;  3RBD A;  5G4D A;  4EWT A;  1D8Y A;  1X9S A;  1Q8B A;  3LP2 B;  3BJY A;  1VQ9 S;  2OFG X;  1TFY A;  2RKI B;  2MKY A;  4QR1 A;  3MPY A;  2GW8 A;  4I0W A;  4LSN B;  4NYP A;  3T9N A;  2JJ4 D;  4ZCM A;  3T5H A;  3TUZ C;  2MZR A;  3D3B J;  2WB4 A;  3RTV A;  1CEZ A;  4KPY A;  1RAB B;  3POT A;  2KVI A;  3OPK A;  2ZBI A;  3MMA A;  4L72 B;  1HWU A;  3BYR A;  3AFG A;  4MT1 A;  4YR0 A;  4WFA Q;  3GYN A;  2CG8 A;  3NAI A;  3PYE A;  3QGP A;  2R7R A;  1EET A;  3OV7 A;  4BBY A;  2V69 A;  2VIH A;  4NL5 A;  4H4K C;  4J9R A;  5J2Q A;  2ZOG A;  3J81 U;  3NGD A;  1ZAX A;  2NXC A;  3V4M A;  5H9E J;  3BN4 A;  4KHM A;  3CC4 S;  3PO4 A;  1PKU A;  3CJ0 A;  3S6E A;  1IKW A;  1EKS A;  2JWN A;  2R2R A;  1CJT A;  3SSQ A;  3D6F B;  1TL1 A;  1QSY A;  2ZBC A;  1U1O A;  1NH7 A;  1WI6 A;  2GVZ B;  1NUE A;  5KG6 A;  1DLO B;  4FVC A;  1UA1 A;  2F4F A;  1OO0 B;  3HMJ G;  1TEL A;  1RBO B;  2C2K B;  1XMB A;  1N0U A;  2GO8 A;  3M32 B;  4HI2 A;  1JLA B;  3UDE A;  4LF5 J;  2YWE A;  1IBC B;  1R6V A;  2MLZ A;  2BYC A;  2ZH1 A;  4F4K A;  2GZO A;  1W25 A;  1FFG B;  3IBC B;  1R8H A;  3LAL A;  3P8B B;  1IBM F;  1BQN B;  2BAC A;  1J2V A;  4U67 Q;  3L09 A;  1HBU A;  3PFE A;  4ZVE A;  3SCI E;  3V6H A;  2GVD A;  1IUJ A;  4IYQ A;  4LSL B;  1RA6 A;  3EVO A;  3LP2 A;  1NB7 A;  3BGO P;  1TV6 A;  2H48 B;  4B08 A;  4ZPD A;  2VDH A;  1JLQ A;  3NOG A;  5DLG A;  2OIH A;  2H9Z A;  2J0X A;  1MN9 A;  4LBI A;  3AD7 C;  2IVY A;  4M8L A;  3RUB L;  4DV5 F;  2VG6 B;  1TU0 B;  1RHQ B;  3I5C A;  2CPH A;  1DQ8 A;  4FNH A;  3H40 A;  4ID8 A;  1WEX A;  2WK4 A;  2CPX A;  2VFU A;  4O3N A;  5HVG A;  4EBC A;  3RW7 A;  3OLA A;  5BYS A;  2WVE A;  1VRT B;  1U6B A;  3LGM A;  1XIQ A;  1UJ4 A;  2AP6 A;  4KV8 B;  2J9C A;  4HI1 A;  2OPP B;  1TL5 A;  3LOU A;  3QGG A;  4LMZ A;  4HAC B;  1VQ7 S;  3PW5 A;  4C8Y A;  3N6N A;  1YSJ A;  1OWX A;  1HFE L;  2OPQ B;  2POK A;  4JI7 J;  4WP8 A;  1YBU A;  4WCE Q;  1SI9 A;  2MKH A;  4XAK A;  2RJZ A;  2VHG A;  4X65 F;  1L3U A;  3QRR A;  3PIP Q;  4F02 A;  5KFC A;  1QDU B;  4O4G A;  1UP1 A;  4QR0 A;  4UST A;  3U1M A;  4N76 A;  2EC0 A;  2CPI A;  2UUT A;  2H3E B;  2XEX A;  3AH6 A;  3BGF A;  2QC3 A;  3UQS A;  3E8O A;  4X62 F;  3GIJ A;  2C22 A;  2RS8 A;  1JXE A;  4ZIV A;  3GE9 A;  3GV7 B;  5AT1 B;  2VQF J;  4DQP A;  2CJA A;  4DCP B;  2HVE A;  4CH0 S;  3ZZP A;  1LK5 A;  2RRN A;  4ETX A;  2HND B;  1NJI T;  2DR8 A;  2DGQ A;  4YOE A;  3NGR A;  5L39 A;  1AA1 B;  1F60 B;  1SVD A;  4X4P A;  1U4B A;  2Y8W A;  1NRK A;  2JC1 A;  3C8Y A;  1I51 B;  5G0R B;  3CPW R;  2NR0 A;  1GAO A;  1U48 A;  2F3J A;  1HNI A;  1WC1 A;  4G1P A;  4H4O A;  5DRK A;  2RDI A;  3W1Y C;  4CNZ A;  1VRQ C;  2YVS A;  3TI0 A;  2ROG A;  3TAQ A;  4DPT A;  3D1H A;  2KRR A;  3KLV A;  4DG1 A;  4WP3 A;  3AT1 B;  2K7J A;  4F3Q A;  4DV4 F;  5HO4 A;  4NZ6 A;  2CJ9 A;  2ZBR A;  2ZVS A;  3B6B A;  1H72 C;  2IJF A;  1CQN A;  1JQG A;  1EET B;  1VJW A;  2L9W A;  2IC3 A;  3EGN A;  3KNG A;  3HHL B;  4HDH A;  4ZVQ B;  3OSP A;  1TFW A;  2LA4 A;  2LYV A;  4RO0 A;  5M2U A;  3LP1 A;  1PSD A;  2WVF A;  4NML A;  2HWT A;  5GAE I;  3BO2 A;  1L3V A;  3D3C J;  4BDP A;  2X1F A;  2E9Z A;  3M4X A;  3FJ2 A;  4Z37 A;  3LP0 B;  3QIP B;  1S1U B;  4ZVT B;  3PNI A;  3OR1 B;  2VQE F;  1EP4 B;  3QJL A;  1S9F A;  2CQ4 A;  3A3O B;  1VLO A;  4RNH A;  1N36 F;  1AB8 A;  3RZA A;  2PO4 A;  3EUN A;  3G86 A;  3EZO A;  1RU1 A;  3N01 A;  3HF5 A;  1CS4 B;  3K8V A;  2HSE B;  3UO0 A;  4C97 A;  3ZZY A;  1F2H A;  3W9J A;  2DIU A;  5HAO A;  1RT1 A;  3HJV A;  1LFP A;  2IA6 A;  2RIL A;  3OD2 A;  2FQQ B;  4OYM A;  2IBK A;  4JI7 F;  1FDN A;  4ZMM A;  4ZVO B;  2LU1 A;  2HZA A;  1L5U A;  2VF3 A;  3MPW A;  4NCG B;  5D4L A;  3ZO7 A;  1ACM B;  4C6A A;  2CDQ A;  1GNK A;  1RTH B;  2ZDP A;  4YB5 A;  1UL3 A;  2NQP A;  3WIU A;  2FJB B;  3RBE A;  4JI5 F;  4HDG A;  1FF2 A;  2GQC A;  3N79 A;  3SFU A;  2BXJ A;  3DRS A;  3BO4 A;  1X0F A;  2BEF A;  2WW4 A;  2ASD A;  3PW4 A;  3T6J A;  1HQU A;  1O51 A;  3DLK A;  2R7W A;  4P71 A;  1VLY A;  2BZ2 A;  1RWM B;  2FC8 A;  3H2V E;  4IFV A;  5L1I A;  4DR7 J;  3THP A;  3GJR B;  5T14 A;  1TL3 B;  2NYH A;  4RWX A;  1XNR F;  1W26 A;  4DPU A;  1X5P A;  4M1K A;  1T3N A;  1X4C A;  1AFI A;  3DOM A;  1FHT A;  2QRR A;  2E1A A;  3I4P A;  3ULH A;  3PHE A;  2C42 A;  4DV4 J;  3MED A;  3NNA A;  3ETO A;  3OT9 A;  4M5L A;  3K5M A;  5KAK A;  1IXK A;  4DHV A;  2B4P A;  1RT5 B;  5SUH A;  3EDR B;  1KC8 T;  2RVJ A;  2DXF A;  2GIF A;  2ZKU A;  5F9L A;  2G13 A;  3NG8 A;  4PR6 A;  3BH6 B;  2VA3 A;  3KHR A;  4JI4 J;  3IGN A;  1H7W A;  2AHO B;  2B0G A;  3IAM 9;  3LA0 A;  1R8A A;  4KHR A;  1V5I B;  4LIW A;  1TK8 A;  3HD1 A;  3Q0A A;  4WF9 Q;  2W9B A;  4AD6 A;  3MTJ A;  4DR2 J;  1RKJ A;  5J2Q B;  5D4N A;  2UV8 A;  3OHA A;  1CC8 A;  1UAW A;  2BQ3 A;  3OFE A;  4KIA A;  5C2C A;  3ZZT A;  2GQ2 A;  2VKZ G;  3RAM A;  1RAI B;  1SJQ A;  4RNN A;  2L41 A;  1S0V A;  4QIG A;  3R1H A;  1YJT A;  3QAU A;  1P6T A;  4E98 A;  2HHX A;  2IM2 A;  4PG8 A;  1TTH B;  3Q8Q B;  3D1Q A;  4EBE A;  5IT4 A;  3AAW B;  2X1G A;  4CTA A;  1PC4 A;  2HWI A;  2GNK A;  3C46 A;  5K8M A;  2JH3 A;  2RU9 A;  1TKT B;  1HHS A;  4JI0 J;  2EEY A;  5C25 A;  3U1L A;  1SL0 A;  1S5Z A;  2BVZ A;  2ZH8 A;  4RR5 A;  4WFY A;  4FXW A;  2CNL B;  3SCJ E;  4MKB A;  1CSJ A;  2DNR A;  3V81 A;  1NK4 A;  2ROP A;  1YG0 A;  1MNE A;  4UY8 5;  3KKF A;  3D4J A;  4HL9 A;  5E5N A;  4PXD A;  3AHP A;  1V9O A;  1FEE A;  3IM9 A;  3TUI C;  2R8I A;  1Y9O A;  5L1K A;  4FYW B;  1Y5N B;  5C42 B;  1C0T B;  3IBW A;  1TL7 A;  4DXL A;  2DNP A;  3BO3 A;  4LF8 F;  4FXV A;  2AGO A;  2DPI A;  4RNF A;  1CVJ A;  5GMD A;  4PXB A;  1WDT A;  4ZS6 A;  3ZXW A;  4DX5 A;  4GKJ J;  2LQB A;  1SUQ A;  1EX8 A;  4G6V B;  3J80 Y;  2UVR A;  2U1A A;  2V63 A;  5F8L A;  1YBT A;  1X4B A;  2MJU A;  1SV5 A;  1U7L A;  2OD4 A;  3OFH A;  4OV6 A;  3TYT A;  1OYE A;  2I6W A;  1EB0 A;  2RF2 B;  1YJ7 A;  4ZPW R;  2V8V A;  2VKR A;  4F4W A;  3MM6 A;  1KON A;  2D9O A;  2HQF A;  1G3O A;  4K2X A;  3ZZZ A;  4C0O C;  3V4I A;  2E1R A;  2AYE A;  4S0M A;  4JI4 F;  3UCG A;  4JI6 J;  5LSL A;  1NZ8 A;  1GK8 A;  3BBC A;  3OTO J;  1XWL A;  3C6T A;  3G6Y A;  1H2T Z;  1ZS6 A;  1NH8 A;  3KFW X;  4JOU A;  1LWX A;  3MI7 X;  4ZPT R;  1OIA A;  1PBA A;  3CCW A;  3TA2 A;  2ILY A;  2N82 B;  2C2R A;  1PJ5 A;  3OXF A;  4TNO A;  1KHV A;  3DHX A;  3DI6 A;  2C3U A;  4KY3 A;  4WU3 A;  1UWB B;  1N36 J;  1I94 J;  3GON A;  2CQG A;  4OLP A;  2W9C B;  4HEA 9;  1VFJ A;  4CO2 A;  4FNI A;  4EGL A;  1C1B B;  1LWE A;  4F3O A;  5LSO A;  5DGB A;  1FJG F;  2V6A A;  3BKU A;  3PW7 A;  1GXT A;  1ZYQ A;  4L73 A;  4X62 J;  4ED4 A;  5EWE A;  1VQ4 S;  1NPR A;  1MG7 A;  2R8J A;  2JFD A;  1RAO A;  2DK2 A;  2BJE A;  1NDC A;  1M5H A;  1A0O B;  1RLC L;  5DG8 A;  4GO5 X;  3RGI A;  3UI3 A;  2BAB A;  3WC2 A;  1O0P A;  2GAG C;  4JI0 F;  5A8K A;  4FYV B;  1MU2 A;  1H2V Z;  5K9F A;  4IOB A;  4ZVS B;  1YLX A;  2X51 A;  1RWX B;  3K5P A;  1B4S A;  3BRE A;  1LWF B;  2W2M P;  4HH0 A;  3FEY B;  1M90 T;  1N5V A;  1Q95 G;  5FLX Y;  3OUY B;  1GT8 A;  2AW0 A;  2HQI A;  5EN1 A;  2DGW A;  2LEP A;  3D1O A;  4AND A;  4B9L A;  4B3S F;  3CB4 A;  4EYH B;  2MMY A;  2UV8 G;  3GWC A;  2DNN A;  3VWS A;  2VU5 A;  3FQL A;  3OTE A;  2XS2 A;  4B3R F;  1B99 A;  3FBC A;  1GTE A;  2HQD A;  4B9V A;  2KN4 A;  2LEC A;  3BR9 A;  3I9Z A;  1U0H B;  1UWA A;  4MKA A;  4P72 A;  2R2T A;  1HWL A;  2NYI A;  1S9E B;  4RUB A;  3UN2 A;  3I0R B;  1W7W A;  4DFP A;  2HQC A;  4W98 A;  3RRK A;  1GMW A;  1C4A A;  1URR A;  5HLF B;  1J5E J;  3IS9 A;  3ZTQ A;  4B3M F;  5M2R A;  3TZX A;  5F8J A;  2Z58 B;  1K1S A;  1HBN A;  2I9S A;  4ID5 B;  1YTY A;  4FBT A;  2WVC A;  3LP0 A;  1PIE A;  3NP5 A;  4H4M B;  2O01 C;  1RZM A;  1LXN A;  2KU7 A;  5HQL A;  4XTT A;  3CCS S;  2KT5 A;  1QLN A;  5CZV A;  4UUW A;  3PYG A;  4PXC A;  2VBY A;  3LW5 C;  2ZH9 A;  4QCL A;  5HK4 A;  2JNJ A;  2BOP A;  2A6O A;  1ARO P;  4I2Q B;  4XIU A;  1IR2 A;  2MPU A;  1U49 A;  3TA0 A;  3CW2 C;  2KI2 A;  1QAI A;  1IWG A;  3TJ8 A;  1YJV A;  3GIR A;  2DNZ A;  1T9W A;  3ILJ A;  3NS6 A;  1NSA A;  4KQZ A;  4J5O A;  2ERR A;  2V67 A;  4LRF A;  4OZJ A;  8ATC B;  1V5V A;  2XCP A;  1XTZ A;  3GSI A;  1O6X A;  4NA2 A;  4OI6 A;  2ZD1 B;  1JLF B;  3KYL A;  2VOD A;  4AUK A;  4I68 A;  1QSL A;  2HZC A;  3U02 A;  3BYP A;  5GMK a;  3CO0 P;  1ZAV A;  2HFS A;  1S9G A;  2CAJ A;  3CT9 A;  1RKI A;  1GTH A;  2BKO A;  2KM8 B;  4YR2 A;  1TKX A;  2KYZ A;  2RDJ A;  1S72 S;  1N5Y B;  1JNR B;  3CJQ A;  4X66 J;  1T02 A;  3I96 A;  3L7P A;  2E44 A;  3SCK E;  4QPX A;  2GHP A;  4USH A;  2OML A;  4OHV A;  4ZJQ A;  5KFW A;  5FDL A;  2CJB A;  4C8M A;  4DV6 J;  1RAC B;  1U6F A;  3IWL A;  4P10 A;  4WK1 A;  3W2W A;  5IZH A;  1Q81 T;  2OFH X;  1ITP A;  2CDR B;  2FZG B;  4RW9 B;  1FFW B;  3C14 A;  2MQP A;  3HLU A;  4F67 A;  4C3K A;  4DL0 C;  1IBM J;  4HVZ A;  3MAA A;  2V4Q A;  4G3I A;  2LCW A;  4UZB A;  1RYR A;  4P52 A;  3DU6 A;  2AJQ A;  2OD6 A;  1LW2 A;  4LF9 F;  3ZTO A;  3FRZ A;  3CMA S;  1RA7 A;  4M5J A;  1N32 J;  4A8W A;  1R7I A;  1TMM A;  5E3P A;  4NXN F;  1XMQ F;  4OYW A;  4DQI A;  1GH8 A;  3CC7 S;  1RWV B;  1PCA A;  1EAY C;  3QRQ A;  1HQE B;  2F4V F;  1APS A;  1TMJ A;  2JLF A;  3TRG A;  1WNE A;  2MSS A;  1WTF A;  1Y10 A;  2FYX A;  3GB0 A;  4IO9 Q;  4B9M A;  2AX1 A;  2CG4 A;  5I3P A;  3LQV A;  2WON A;  3HFZ B;  3JSM B;  3MAA B;  4KR0 B;  1GMU A;  5ETQ A;  2J7K A;  1HBU B;  1S7H A;  3H0P A;  2RQM A;  4H4K A;  3RU0 A;  3UE2 A;  3W60 A;  4TU7 A;  5KTQ A;  2HFZ A;  3ET6 A;  3KLH B;  2YBV A;  1X7V A;  2YKQ A;  1HHT P;  2MQ8 A;  3JYT A;  4RUH A;  3FSI A;  5KG0 A;  1WSV A;  3SV3 A;  2G2O A;  2Z0G A;  4IDK A;  3TX8 A;  5AE1 A;  3MFI A;  4OX6 A;  1JLA A;  4N41 A;  1H73 A;  1FVS A;  5J1N A;  1KVJ A;  3CTR A;  3ENQ A;  2BJ9 A;  5D0E A;  2NZC A;  4JI2 F;  3X1L B;  4CO4 A;  1UPM B;  2C2O B;  2CQD A;  5DDQ C;  3DHW C;  1A7G E;  5A0Y B;  4R25 A;  3JSB A;  1IKY A;  3VAK A;  4DQR A;  5I42 A;  3GR1 A;  3R7B B;  3SXL A;  4GKK F;  3CGI A;  2A10 A;  4YHH J;  3CNQ P;  2MST A;  5DQI A;  3MM9 B;  3I6P A;  3B54 A;  3KJV A;  1XC9 A;  2AEM A;  3Q86 A;  2ACM A;  1SC3 B;  1VQM S;  4WZQ A;  2JL9 A;  1FT8 A;  2GGP A;  4B3O A;  2NUU G;  2OH2 A;  2I5J B;  1YJN S;  3HO1 A;  1S1V A;  5L8R C;  4C8L A;  1MN7 A;  3EM1 A;  2V2V A;  1BC6 A;  2CQH A;  1T11 A;  1OQ6 A;  1SXL A;  4UQG A;  5H9F J;  2BUN A;  1WOO A;  1UVI A;  2P6S A;  1M1G A;  4O3Q A;  2I0X A;  4TU8 A;  3KXD A;  5DGA A;  3MZI A;  1SQE A;  3IMQ J;  1U1L A;  2IIH A;  3DXB A;  1TKZ A;  4J91 A;  1GMW D;  2DGO A;  4C3L A;  2X1A A;  3Q89 A;  4ES1 A;  2KFN A;  3FCV A;  3NWR A;  4V1A k;  3W5Z A;  4FYY B;  3D0I E;  3IR6 B;  3BPS P;  1J5O A;  1WHX A;  2BMB A;  2GQQ A;  3CJR A;  4DQS A;  3FK4 A;  4F3M A;  5KFF A;  2IAJ B;  4I69 A;  4QWD A;  2ADB A;  3H4D A;  2UUC F;  1JWW A;  4ZLL A;  4I67 A;  4CLL A;  1VRU B;  2GMH A;  1JLB B;  4F50 A;  1RTJ B;  4OZ3 A;  1U0H A;  1S48 A;  2KJW A;  4RX6 A;  2R7V A;  3KNA A;  3HHK A;  4NX9 A;  1RQ0 A;  4IG0 B;  3MEG A;  4LF2 A;  4DPW A;  4B17 A;  2DKO B;  1ZOT A;  2FGC A;  3HSG A;  1F5B A;  1KQG B;  3WHI A;  1RT3 B;  2RE1 A;  2VH7 A;  4K4W A;  1WTB A;  3M8R A;  1WKJ A;  1Q78 A;  4IKA A;  2ZH5 A;  2PMW A;  1SKW A;  4N77 A;  3N6L A;  1YK9 A;  5FII A;  2YNF A;  4DQQ A;  1MWY A;  2PI5 A;  4LBH A;  3CXC R;  4WII A;  1XR7 A;  1Y5I B;  1UEV A;  2KRB A;  3IP0 A;  3IRX A;  2WTF A;  1X9M A;  3PCO B;  4GKK J;  1NO8 A;  3NRB A;  3DRY A;  4R8U B;  5E41 A;  2KHC A;  2MGZ A;  2XBP A;  1VDH A;  1T3O A;  5B0C A;  5GME A;  3AD9 C;  4LR9 A;  5EGY A;  2ALZ A;  2AWZ A;  4KO0 A;  2J9D A;  1XNR J;  2HPU A;  4NPO A;  4RZR A;  4A8Y A;  1SJ4 P;  2D7S A;  4UF4 A;  8RUC A;  3K7R A;  4O44 A;  2OEM A;  1GXU A;  5F8N A;  3K2Y A;  4OHW A;  1DHM A;  3KLG B;  5HMY A;  1F9E B;  1QAX A;  1HPZ A;  3ZZU A;  4ZHR A;  4I56 A;  1BXN A;  3MM5 A;  5E3Q A;  5D3G A;  3JSR A;  1HWK A;  2VC1 A;  3DGP B;  4Y2A A;  4PWD B;  3MM8 B;  2DBB A;  2QE5 A;  2ZC3 A;  2Q6B A;  3JTP A;  4K8R A;  4WE1 B;  5CYM B;  1X4H A;  5KFH A;  1RHU B;  2A1B A;  2E1P A;  3D28 A;  2G4B A;  3NKY A;  3MWB A;  2ZE2 A;  1S6Q B;  3DN9 A;  3MEE B;  4K5S A;  3QT5 A;  4NLQ A;  4U96 A;  4R8U A;  3TZW A;  3GSD A;  3EGV A;  2JX2 A;  2CPY A;  3QGH A;  3M2U B;  4X64 J;  1MMN A;  1WC5 A;  2BV3 A;  1HWJ A;  3MD1 A;  1P9Y A;  3L7U A;  3R6L B;  4NXM J;  3P49 B;  2P9G A;  2VBW A;  3LPY A;  1QE1 A;  1MMD A;  5BYQ A;  1X60 A;  4K0K F;  1WF0 A;  1TUW A;  3H98 A;  2A2C A;  3KK2 B;  3RR8 A;  3D2W A;  1D3W A;  1DAR A;  2VFR A;  3M9N B;  2HIQ A;  2HHU A;  1IKV A;  2ZVI A;  5ETL A;  1DFD A;  3UD4 P;  2DHX A;  4YME A;  2H5E A;  5LJ5 Y;  3NNH A;  4NLS A;  4OI0 A;  3Q8R B;  4CLU A;  2MQL A;  1XR6 A;  2KO1 A;  2PMZ D;  1SJ3 P;  4F2R A;  4NEZ A;  1RTI B;  2QIF A;  3AQP A;  2Y9H A;  3OL6 A;  1FX4 A;  3R2D J;  1OY9 A;  3V6D A;  3MPV A;  4DCO B;  3R8Y A;  3GP9 A;  3MF5 A;  3DFE A;  4EO8 A;  2H4W B;  2C2M B;  2RDD A;  2GML A;  3CDE A;  4U95 A;  4CH1 A;  2JEJ A;  2UVV A;  2FHK A;  4X2B A;  2E66 A;  1VC6 A;  1NSQ A;  2BJ3 A;  5B0B A;  1CJV B;  5L38 A;  3M2V A;  5KFR A;  5GAE U;  3PV8 A;  3MAH A;  5IS2 A;  3N5B A;  2IYG A;  4ECZ A;  1J5O B;  3RJM B;  4K4S A;  2V4J A;  4L76 A;  4QR2 A;  1HNV A;  1FWL A;  5KFE A;  1CUL B;  2HLU A;  3V6J A;  2ZFH A;  3UCU P;  1U45 A;  1FD8 A;  1RUS A;  3HHE A;  1NK8 A;  1KDN A;  3TJ9 A;  3G4S S;  1HL6 A;  1RT7 B;  1U2R A;  4MK9 A;  4ECQ A;  2MB0 B;  4NLX A;  2N3L A;  4ZVU B;  2Q79 A;  2NXE A;  2YTC A;  2EG1 A;  3T1H F;  3W5X A;  5BJR A;  3UCZ P;  2D3O 1;  1KKH A;  4RUA A;  2OPR B;  4MIA A;  4AQY J;  5IQQ A;  1DY3 A;  5HRO A;  1IBK J;  2MY7 A;  2NSB A;  2HQ3 A;  1REG X;  3UN5 A;  5L9N A;  1R31 A;  1B7Y B;  3TAM B;  4DZD A;  2MZS A;  4MFB B;  2VG5 B;  1KVI A;  2RH3 A;  4DR6 F;  3AB2 B;  4IH7 A;  3OTB A;  3QSY B;  2EK6 A;  3BGU A;  4A8S A;  1RLD A;  3OFG A;  4BC7 A;  2DNQ A;  5ETP A;  2ZH3 A;  4ICL A;  3VTI A;  1DQ9 A;  4ANC A;  4B3M J;  1N33 J;  4NZ7 A;  1U1P A;  1KQS R;  4Y3C A;  4TQS A;  2C28 A;  4ZK7 M;  4FPR A;  2AT1 B;  1FK9 B;  1LW0 A;  1QAY A;  1WHY A;  3VF0 B;  2GJ2 A;  2H51 B;  3BR8 A;  4DFM A;  2HRT A;  2XMK A;  1RYS A;  1PJ6 A;  3L4B C;  1XN9 A;  1JX4 A;  3GR0 A;  3BDP A;  2YWK A;  5HP1 B;  2XY5 A;  1URN A;  1FJC A;  2B6A A;  2GIQ A;  2FGO A;  4H4M A;  4DV2 J;  3BPD A;  4IFV B;  2CNK B;  2ABY A;  4P75 A;  3BH7 B;  4C8O A;  3IR7 B;  2BX6 A;  1BQM B;  1KLM B;  2DH7 A;  2V8G A;  3JSY A;  3TVY A;  1S49 A;  1CJV A;  1C4C A;  2G0I A;  2CZV C;  1NU4 A;  5D0G A;  4ED8 A;  1RT3 A;  3D6T B;  3N5F A;  4WTY A;  2MKJ A;  4DUY F;  2CFX A;  4UUX A;  2AYG A;  1UZD A;  1Q4R A;  3F0N A;  2K8G A;  2OI2 A;  3TAN A;  2LQ5 A;  1YKW A;  1WEY A;  3TZZ A;  3AA9 A;  1IKX B;  3CUN A;  3H4B A;  5F0U A;  4DUY J;  3CJS A;  2XHW A;  1LV5 A;  4PG7 A;  3IN5 A;  4ED3 A;  4RW8 B;  1VRU A;  1Y7P A;  2HNZ A;  4RWW A;  2D3O R;  1H0H B;  3PJ9 A;  4X66 F;  4ZVF A;  2MDA A;  2OTL S;  4P2F A;  2UVU A;  4QIE A;  1RAH B;  1FNM A;  1R0A A;  1BQM A;  1KLM A;  3E51 A;  4NWB A;  4O23 A;  4D3G A;  5JUM A;  4RNM A;  2HS0 A;  1KTV A;  3KK1 A;  3EZ5 A;  4DR2 F;  1B0T A;  6FDR A;  5IWA F;  3OTD A;  1RB0 A;  4DR5 F;  1D1U A;  4KB7 A;  1TKX B;  4P7T A;  2QMX A;  2QV6 A;  2FC9 A;  1S1U A;  4DF4 A;  1RAG B;  2RAQ A;  2UZA A;  2YKO A;  4M63 A;  4ELU A;  2C2Z B;  1NHU A;  1ZA2 B;  3LO3 A;  4BWM A;  5C7P A;  2NZ4 A;  1VQO S;  1KOO A;  2QTW A;  3K58 A;  1KWM A;  3SSS A;  1PAE X;  2E29 A;  5HJX A;  1HPZ B;  4KSE B;  1CBK A;  4DJB A;  3F56 A;  4ZHR B;  2RU3 A;  2BAN B;  5D3G B;  1NCL A;  1DJ0 A;  2B5J A;  4CO5 A;  5GAH U;  3CCU S;  4OZ1 A;  3MPU B;  1AZS B;  4ZP7 A;  4JYA J;  1V3R A;  2G9O A;  2R3V A;  2HVZ A;  3PJX A;  2DCU B;  5LXR A;  1KS2 A;  1U6Z A;  5GAD I;  2CPZ A;  5IM0 A;  2HQG A;  5HI7 A;  3LWL A;  2WSC C;  2HFV A;  2KG1 A;  4DR1 J;  3NY0 A;  4FF3 A;  3AD8 C;  2ASL A;  1W2I A;  1T94 A;  2MQM A;  2CQ2 A;  2BKP A;  1IM6 A;  2ZM6 F;  5DDO C;  4CT8 A;  4O4R A;  5KT4 A;  1HKA A;  4NLP A;  4X4Q A;  2ZJP Q;  2GO9 A;  3AQO A;  5BR8 J;  1TR0 A;  9ATC B;  4LVN P;  3TX0 A;  3BQ0 A;  2YNH A;  4OJ1 A;  1SCJ B;  2NSC A;  2VUG A;  3ILL A;  4ED7 A;  4RUC A;  3GU0 A;  1Z2L A;  3KG0 A;  4O4G B;  3GCX P;  2O3D A;  4PCQ A;  2EVZ A;  3VQS A;  4CWB A;  4OL8 A;  1JLC B;  2AJ2 A;  3CMQ A;  2WON B;  3LTO A;  4OZN A;  4K50 A;  5MAO A;  2BW2 A;  4F4Y A;  5DG9 A;  5HSP A;  2XY6 A;  1N48 A;  4OYX A;  2ZOM A;  3B8H A;  3GV8 B;  2LXU A;  1YZ6 A;  2XS5 A;  1X4G A;  1U47 A;  2R8G A;  3WQP A;  2HHT A;  4X4O A;  1REV B;  3G2X A;  3R3T A;  3T3F A;  4M95 A;  1ZPW X;  1LW2 B;  3FZB A;  3QT7 A;  2B7B B;  4DV3 J;  1JLQ B;  2RB7 A;  3M2R A;  3NAH A;  2QZ8 A;  3MDF A;  1RSC A;  3PFO A;  4MYU A;  1KOH A;  5HRO B;  1AXQ A;  1ICE B;  2Z2M A;  2HVI A;  3MEK A;  2KVQ E;  3MPD A;  3T41 A;  1UVK A;  3KJQ B;  5KFS A;  1RIS A;  5B7W A;  2CQB A;  1IJF B;  1FTC A;  5L46 A;  3PR5 B;  2YWW A;  3FEX B;  1FRM A;  4UW2 A;  2HHH J;  2ZE2 B;  3MEE A;  4F0M A;  2ALY B;  3K17 A;  3K57 A;  2EFQ A;  4DPO A;  3Q83 A;  1NK7 A;  2UXD J;  4TLR A;  4PQU A;  1RWW B;  1F6T A;  2J7W A;  4F26 A;  3F41 A;  1KLN A;  2KXH A;  4B3T J;  1T8E A;  2R4F A;  4E0D A;  4USI A;  3B4D A;  2G1D A;  2Y1L B;  4CYU A;  1NXI A;  5F8H A;  1Z4U A;  1Q5Y A;  3D0G E;  4PQU B;  1DBD A;  1RWO B;  3CJ3 A;  4CM0 A;  2IM0 A;  3GYG A;  1QVG R;  2LEA A;  4UT4 A;  3MUM P;  4B3T F;  4DSI A;  2AQ4 A;  3A4T A;  1CJK B;  5JJB A;  1FCA A;  3H59 A;  3BV8 A;  3IGV A;  1JB0 C;  3UPF A;  3BSC A;  4E2F B;  4CM2 A;  3I55 S;  2YH1 A;  2RUS A;  2W7A A;  1ELO A;  1WOR A;  3HFK A;  1VBK A;  2BM0 A;  2HBZ B;  4NRU A;  2EFV A;  3AXK A;  1OYD A;  3DCA A;  3POT B;  3ITH B;  3KMS A;  3V6K A;  1CUL A;  2DY9 A;  2XMW A;  5IC6 B;  2QLW A;  2V34 A;  3OTO F;  1VBZ A;  3SBM A;  4USM A;  3RRG A;  2MTL A;  4LSN A;  3MXH P;  1JLE A;  2KYX A;  2RKI A;  2WHO A;  5IQ6 A;  2R42 A;  5IV4 A;  5GAG I;  4IOC Q;  4DSF A;  1H74 A;  1RHM B;  5DET A;  5H1S V;  4LFC J;  1G7C B;  3SDE A;  3QO9 A;  3HK2 A;  5AXN A;  2KDO A;  2LP4 A;  1JLG B;  3FRY A;  3EWG A;  3M7V A;  1Y00 A;  2VA2 A;  2BRL A;  2PII A;  3M8Z A;  5KFB A;  5LJ3 Y;  2KFY A;  1RBA A;  4G1Q A;  1JXL A;  1PIL A;  2V68 A;  4N8O A;  1KD1 T;  3HHD A;  3SQG B;  4WFN Q;  1VC5 A;  2R8H A;  2DHA A;  3T6B A;  4TU9 A;  4DCJ B;  3FBF A;  3ILI A;  2ROE A;  1RTD A;  4KTQ A;  4NLD A;  1FKA F;  3MMB B;  2APO A;  2HHQ A;  5CD4 H;  5D0H A;  4CTA B;  3TVK A;  3G71 S;  4W4M A;  2G2Z A;  2HRY A;  1RP5 A;  4K2J A;  2EK1 A;  4DBQ A;  3J81 Y;  4YFU A;  1N5Y A;  4ZIT A;  2PDA A;  2GAH C;  3OTC A;  5A8K B;  4QWA A;  5ETK A;  4ECT A;  4ED1 A;  3UDC A;  3HXM A;  3OL9 A;  1FWP A;  3WC0 A;  1XMO J;  4A8O A;  2GX8 A;  3ISN C;  1X31 C;  4OYA A;  3JB9 k;  3L7O A;  4WE1 A;  1EAR A;  3BEG B;  4P2S A;  2EC2 A;  2D1C A;  1VR6 A;  2HNY A;  3EXY A;  2ATL A;  3FFI B;  4J37 A;  1VJQ A;  1SH0 A;  2RNE A;  1R89 A;  4KE5 A;  4TY8 A;  2U2F A;  2XUL A;  1JXV A;  3LGN A;  3OR2 B;  4PKD B;  2M4M A;  4J9U E;  4DG1 B;  2EBE A;  4NA3 A;  2NUH A;  4FVM A;  1X4F A;  2Z2L A;  2V4R A;  3BSO A;  2WZ1 A;  4DV5 J;  2B9X A;  5GAD U;  2XM3 A;  2W25 A;  3NWG A;  3PHT A;  1IKY B;  2LQJ A;  4ZCK A;  5J2M A;  4QZV B;  4IFY B;  3NS7 B;  3DRX A;  4QYR A;  2HBR B;  3ZNU A;  3DGV A;  2DR7 A;  4JI1 J;  4JV5 J;  1TL3 A;  1FVQ A;  1VGY A;  3R6G B;  4Y65 A;  1B7F A;  1S1W B;  2M9K A;  2UP1 A;  2VFV A;  3FC9 A;  3TZY A;  2V9W A;  3GFX A;  4AXI A;  1SKR A;  1T03 B;  3GMG A;  3JYT B;  3CCL S;  4OYO A;  2ASY A;  3K5N A;  4P74 A;  2OJ3 A;  3SMZ A;  1S6P A;  4ECR A;  1NJZ A;  3W3S A;  3LAK A;  3CDA A;  4IO1 A;  1QUP A;  1I3O B;  2W1B A;  1UZH A;  2M70 A;  1C0T A;  4C0H A;  1BMQ B;  5ADZ A;  1HMV A;  2IDE A;  4Y6I A;  2YKN B;  3MOJ B;  2IRX A;  3HD2 A;  3TP2 A;  5JMN A;  4OI1 A;  1F9H A;  3I56 S;  2ZKT A;  3HZE A;  1U26 A;  1RWP B;  4N8N A;  1S57 A;  4HHJ A;  1HR0 F;  4UQT A;  2QN6 B;  4HLB A;  4WBF A;  1GFW B;  1TAU A;  1N6Q B;  3CCM S;  3EZU A;  3W62 A;  2ZM6 J;  3CC2 S;  4MKY A;  2E1C A;  4C0B A;  2AD9 A;  1TV6 B;  1GX5 A;  3PO5 A;  1FO1 A;  4DLG A;  4ED0 A;  4P2M A;  2DHS A;  4C8Z A;  5LMU J;  3QLH A;  3C15 B;  3M30 B;  3MR5 A;  5DLF A;  5CYJ A;  3DLG A;  2W9A A;  3GCW P;  2DNK A;  4QOT A;  3QQC D;  5LMN J;  3H20 A;  4V19 X;  3FMB A;  3GV5 B;  2HS3 A;  4DPY A;  2VL1 A;  3ADA C;  5L1L A;  2IM1 A;  4FS2 A;  1N32 F;  3NNC A;  1FK9 A;  1LW0 B;  1UEU A;  4IR1 A;  1HYS A;  3RYL A;  1C0U B;  3AA8 A;  1S1V B;  5B0A A;  1KQK A;  2IC3 B;  3P96 A;  3OHB A;  4GMK A;  5A8W A;  4DDF A;  2HS4 A;  4K5R A;  4PRF A;  5C24 A;  5KFP A;  4OZL A;  2YKP A;  3DI6 B;  2QSW A;  3NLC A;  2BQR A;  4C8K A;  4DSK A;  2OAU A;  2YX7 A;  1S77 D;  4H4O B;  1HNI B;  4O3R A;  3TAP A;  2AGQ A;  2OPR A;  2YH0 A;  3WBZ A;  1VQY A;  3RR7 A;  2N7Y A;  3LH2 S;  2C1E B;  3MMJ A;  3VAH A;  2R7S A;  2DB1 A;  3MED B;  4KH0 B;  4MH8 A;  3N0V A;  1MSW D;  4HKQ A;  1QUV A;  1H7X A;  1XQI A;  1ZA1 B;  2RF2 A;  5KFY A;  4QWE A;  4JI2 J;  3QAT A;  3KOA A;  2B4O A;  1F5A A;  4DSE A;  2YNG A;  3MMA B;  1QJH A;  4EU0 A;  1YJ9 S;  2V94 A;  3F44 A;  5L1J A;  3BKT A;  4GVB A;  3HM9 A;  2VPW B;  3HT0 A;  1ZM4 A;  4UOC A;  3MCS A;  4K4X A;  2VPX B;  2M8D B;  2ZH2 A;  1D9A A;  1NZA A;  2R8K A;  2AEF A;  4MTP A;  1P9Q C;  1U1K A;  5C5J A;  3RW6 A;  2JDJ A;  3CO9 A;  3C3L A;  4NZ0 A;  4O3P A;  2MHE A;  3E2E A;  4TY9 A;  5HBM A;  4OQJ A;  2Q1L A;  4HH1 A;  3DMJ A;  2MXY A;  2OPP A;  3AJ2 A;  3C66 A;  3P45 B;  4O0N A;  1NK5 A;  1PYO B;  3R5G A;  3H2U B;  3KTQ A;  2P2C B;  2NS1 B;  2CQ3 A;  4ZVH A;  5CCL A;  4QYZ K;  3W8P A;  3V81 B;  2YQ1 A;  3JAM Y;  1RT4 B;  1IR1 A;  4PQA A;  2VG6 A;  2XMU A;  3DDK A;  2W24 A;  1YGY A;  1S1T B;  2XMT A;  4IG3 B;  5CCM A;  5MLC V;  2ZBQ A;  3J80 U;  2HMI A;  2OKQ A;  3A8K A;  3IWX A;  3M8Q B;  4M5D A;  4EEY A;  2AZ1 A;  4YDD B;  3RB0 A;  3HI9 A;  1RT2 A;  1FRL A;  1S6P B;  3CD5 A;  3D67 A;  3R9L A;  3W5Y A;  1U1N A;  2BKN A;  3HFV A;  1YVF A;  3QSI A;  4OX9 J;  3QWP A;  3R7N B;  1B70 B;  5HN0 A;  3EYZ A;  2BE2 B;  3JAM U;  4TN2 A;  2XQC A;  1SJF A;  1HNX F;  2FVP A;  4LFB J;  1S9G B;  2BRK A;  4NCA A;  1R3N A;  4EI2 A;  4WP9 A;  4ZPV R;  3BBB A;  1M5V C;  2VJV A;  2BR0 A;  2EKY A;  1EZZ B;  2DGV A;  3AB4 B;  2VQE J;  2Y0B B;  1Q53 A;  2W9B B;  2QFJ A;  1K0V A;  4Y00 A;  4AL7 A;  3DM2 B;  5ETR A;  1CJT B;  5IT0 A;  3NGK A;  2KZM A;  4WIQ A;  3N6M A;  3PRV A;  3NBP B;  4CDI A;  5A6P A;  4FF2 A;  1VBY A;  1UWB A;  2XMJ A;  2JOQ A;  4DR4 F;  2HG4 A;  3N28 A;  3HPO A;  3DDI A;  4KGV B;  2B51 A;  4KO0 B;  1LKZ A;  4URS A;  3ZZR A;  2F7V A;  3NGU A;  2KZZ A;  2BJD A;  2CJX B;  4DZ6 A;  2HAF A;  3FKB A;  1VQL S;  4QQB A;  1L3K A;  3DOM B;  2BM1 A;  5F9N A;  3FZ2 A;  3MUV P;  1HW8 A;  3VQT A;  4QW8 A;  1WD6 A;  2QJ3 A;  4IQX A;  1WF2 A;  4KGX B;  3PKY A;  1K73 T;  3TQE A;  2AZ3 A;  3PM9 A;  4B3S J;  2K3I A;  1XNQ F;  1SPB P;  2D69 A;  3DRS B;  5F0W A;  3WIV A;  4QWC A;  1SUQ B;  2PGC A;  4N7T A;  1RT2 B;  1WSR A;  4K59 A;  2FZC B;  3S01 A;  1X9W A;  1RTD B;  4DFK A;  2DTJ A;  4M5I A;  5KFJ A;  2E5L J;  3MM7 A;  5D78 A;  2WRM A;  5A6W A;  1XNQ J;  1WC6 A;  4ERD A;  4GC6 A;  1CG2 A;  4N5S A;  4KV8 A;  1FX2 A;  2AGP A;  1S1T A;  2VV5 A;  1R27 B;  4F0H A;  2H65 B;  1RT1 B;  4Q5V A;  4DN0 A;  3QT6 A;  3SI8 A;  3IG1 B;  4RJV A;  1N56 A;  2H5J B;  1OS5 A;  2ZZT A;  5KG4 A;  1I94 F;  2F8M A;  1B0P A;  2OSQ A;  3IBF B;  3ISN D;  5IV3 A;  5HBM B;  3J7Y U;  1FNX H;  1X4D A;  3PX4 A;  2Q66 A;  1TKD A;  1SC1 B;  2FZK B;  1CLF A;  3MCN A;  4YB1 P;  5DJB A;  2PT0 A;  1AUD A;  5KT3 A;  5KG3 A;  1SIZ A;  1BQN A;  2OPS B;  1HNZ F;  5ETS A;  1EQ0 A;  4FKY A;  4GVB B;  4WKY A;  2BOA A;  3G8T A;  1S97 A;  3Q22 A;  2K1R B;  2M5Y A;  1X4A A;  2LA6 A;  4RBT A;  4MKV A;  5BXI A;  2BJ7 A;  4ECU A;  1D9D A;  3UDL A;  1VQS A;  1VOM A;  2XLK A;  4ZN3 A;  3GJS B;  3EGZ A;  5D8H B;  1FE0 A;  3QGI A;  4WJB A;  5H9E K;  2A3J A;  4OHY A;  3CD7 A;  1CJK A;  2FHO B;  4K0K J;  5DZ7 A;  3DOL A;  5ETO A;  1T9V A;  2FB0 A;  3UWT A;  1BY9 A;  3BQ1 A;  2AJF E;  1NKC A;  4PG5 A;  3U27 A;  4UOG A;  1SB6 A;  2W2O P;  3TUJ C;  1MRO B;  2FJW A;  1G2E A;  1UET A;  1U8S A;  2UXD F;  5KOW A;  2VFS A;  1NBE B;  4PAB A;  5C24 B;  3RG6 A;  1S6O A;  4FP9 A;  5A0Y A;  1WF1 A;  2VBZ A;  2HFO A;  4B02 A;  5GAG U;  3VZH A;  1RJJ A;  1YQH A;  3L9Z A;  1X0P A;  3BS9 A;  3UNY A;  4USK A;  4BCA A;  3KLE B;  4MAK A;  4FBU A;  1NME B;  3BGR B;  5LMN F;  1SJ1 A;  3A13 A;  2RRA A;  3EGW B;  2J8S A;  3C6U A;  1T05 B;  3M6X A;  4CIO A;  3D6M B;  3GTY X;  5EDW A;  3PW0 A;  1SV5 B;  3R5B A;  4ECX A;  4LF6 F;  3KJN B;  3KUH A;  4K4T A;  1PC5 A;  1HAR A;  1IBK F;  4Y2I A;  4LR8 A;  4KRW A;  4IRK A;  3I0S A;  2VG7 A;  4G1I A;  4TYA A;  5E3C A;  3T1A A;  5LXY A;  2KM8 C;  2AJ1 A;  3BB5 A;  3M8Q A;  4M5D B;  2CQ1 A;  3O2I A;  4AXJ A;  3T1Y J;  2WSF C;  3MFH A;  4PUO A;  2ZOF A;  1OPZ A;  2ACY A;  4NOH A;  1NKE A;  5THW A;  1XER A;  2Z2Z A;  2XO7 A;  2QA4 S;  2VOP A;  3WZ0 A;  4J9V A;  4W92 B;  1E6V B;  3FBB A;  5DZ6 A;  3VZI A;  2N3O A;  1YJR A;  4NI2 A;  1EIY B;  4IR9 A;  3Q2T C;  1RT4 A;  3HKZ D;  4NCG A;  3M8P A;  1UFW A;  1D8Z A;  4JI6 F;  3T1Y F;  4A47 A;  3DLH A;  2D74 B;  2XZW A;  2M7S A;  3PVX A;  1K47 A;  4NI2 B;  3TWZ A;  3ZTP A;  2YKN A;  3DMJ B;  4X64 F;  1HMV B;  1UA0 A;  4NXM F;  3C2P A;  4C3M A;  4DV7 F;  2M0G B;  3OXL A;  3G6E S;  2AU0 A;  2W4P A;  1F1B B;  1TQL A;  3BSA A;  5I3U A;  3K89 A;  3EPG A;  2I2Y A;  1D9F A;  3D54 A;  4OYZ A;  3NGS A;  3W7B A;  3H2L A;  1SC6 A;  2ZZN A;  2QO3 A;  3DLL Q;  4FYX B;  4LF4 J;  5F41 A;  2MZQ A;  2YQ3 A;  1U1R A;  2J9D E;  5F8I A;  3VAG A;  4OJ3 A;  3M8W A;  2HYI B;  3PW2 A;  1S1W A;  4TKT A;  5KFZ A;  4RW6 B;  3CIZ A;  3KLE A;  2DRD A;  1RDR A;  2PEH A;  2V2Q A;  4C98 A;  1LFW A;  2KHD A;  3M6V A;  4OMF G;  3VAL A;  5F8G A;  5KFI A;  2MQQ A;  1YRU A;  3ZTS A;  3D7S B;  2CNN B;  2RHS B;  2UUA F;  2CKW A;  4FYD A;  3ENV A;  4KH1 B;  1IKW B;  4Q2M A;  2J6S A;  3X3U A;  1RAD B;  1X5O A;  2DO4 A;  4C2M A;  4DR3 F;  4ZA1 A;  1RT5 A;  2C2D A;  4F7V A;  5AE3 A;  1AYE A;  5A8W B;  5DDR C;  3J7Y I;  3GII A;  3I82 A;  4OYP A;  2OEJ A;  1Q8L A;  3R7S B;  2DO0 A;  5DDP C;  3G87 A;  1H98 A;  4QJV A;  1QTN B;  4XDD A;  1ULR A;  4WFZ A;  2NXJ A;  5K20 B;  4U6P A;  3FNN A;  2ZHB A;  4DR3 J;  3RB4 A;  1WEL A;  3HZG A;  1NJW A;  2N4D A;  2DNY A;  2RUG A;  3DLK B;  3PX0 A;  4DFJ A;  5A76 A;  9RUB A;  2DRA A;  2GC8 A;  3QJJ A;  2CWK A;  4LF9 J;  2IFX A;  1JJC B;  1V6H A;  4ES3 A;  1F3F A;  4DPX A;  3M6W A;  4HT7 A;  1XMQ J;  4OFZ A;  1U1Q A;  1N6Q A;  1N34 F;  3MUR P;  4ZVG A;  4X4U A;  1PBU A;  4IRC A;  3DRR A;  2AIR B;  4XO0 A;  2M88 A;  1UVL A;  1U0S A;  2E5I A;  4I64 A;  4NLO A;  1NLK L;  3TQ1 A;  2Y8Y A;  1Y11 A;  2B56 A;  4G1Q B;  1GEH A;  4DR1 F;  3DRR B;  1M5O C;  2ZHO A;  1GX6 A;  2HGM A;  4F4X A;  1Y0H A;  1RHK B;  2IM3 A;  1HD0 A;  1R8B A;  3QO9 B;  3SDE B;  4LF1 A;  3OLB A;  1GXL A;  1UTA A;  2XYP B;  4DV2 F;  4PUO B;  2DR5 A;  1UVM A;  3HHN B;  3K0J A;  1NK9 A;  4LRC A;  4K4U A;  2JSX A;  4NE9 C;  1VIX A;  2DGX A;  1ZAW A;  2CYY A;  2Y1I A;  4ER8 A;  4ENO A;  1M5K C;  2W4C A;  3QIP A;  3AOD A;  3D6H B;  2Z57 B;  4AYB D;  1RCX B;  3LAN A;  1F5C A;  3PRB A;  4H54 A;  1Q7L B;  4DU8 A;  1Q86 T;  4NLY A;  2DR9 A;  1A9N B;  1JIH A;  2DIT A;  2UXC J;  2JC0 A;  3BKF A;  2CPD A;  3BGR A;  4KPC A;  6FD1 A;  2ZUA A;  2R2S A;  1YIT S;  5B0G A;  4O3S A;  3NL0 A;  2DR6 A;  2E7X A;  2EFP A;  2IJR A;  2Y0S D;  3GG1 A;  2DEJ A;  2G2Y A;  2V2K A;  3TW0 A;  2X3G A;  4DUZ F;  2XLJ A;  1FRK A;  2O1P A;  4XPE A;  4YY3 F;  2Z30 B;  4OX7 A;  2PFD A;  4LFC F;  4KC5 A;  3FBE A;  4IH6 A;  1MWZ A;  5G0R A;  4JI8 F;  4QYZ J;  2FY8 A;  2H5I B;  2HNY B;  1CJU B;  1U2F A;  1Y5L B;  2RT3 A;  3M6U A;  1NDK A;  4I4B A;  1PYT A;  1UW4 A;  3MR3 A;  1FRJ A;  3WX4 A;  3H5X A;  4ECW A;  3CED A;  3PR4 A;  2BW7 A;  1FKP A;  4LUB A;  4DL6 A;  4FXD A;  4LIR A;  1SH2 A;  2E5J A;  5EWG A;  2XWX A;  3KLI B;  4P9S A;  4HR2 A;  2WAQ D;  2AJ4 A;  1DTT A;  3P5B P;  5EX0 A;  3CCV S;  2C2N A;  2GCF A;  2AV5 A;  4DWI A;  3D5M A;  4DSL A;  3KJF B;  4L6V 3;  2I38 A;  4ZLN A;  3NMA A;  2X3D A;  4ED5 A;  1WJ9 A;  5ETN A;  3SEO A;  3IWN C;  3DRP B;  1I1G A;  3HSD A;  2DPJ A;  1B0V A;  1PGZ A;  2FLN A;  1HNV B;  2KFZ A;  3FVY A;  4A4J A;  2HMI B;  2CNO B;  3M8Y A;  4J9S A;  1VYA A;  1RTZ A;  2B9E A;  2CJQ A;  5DO2 A;  4Q45 A;  4JUZ A;  2FPH X;  2FLP A;  1PG5 B;  3DLE A;  2IJN A;  1VRT A;  2W01 A;  4Q0B B;  4Q0B A;  3HKW A;  4OYI A;  4LFA J;  4OI4 A;  1FDB A;  3MMC B;  4MIW A;  4DX6 A;  3M8S A;  2DRB A;  1SJR A;  1VC0 A;  3TR5 A;  2MLY A;  5B0F A;  3GQC A;  1E6V A;  1U02 A;  1WAC A;  3VGT A;  2DCL A;  3K5O A;  1YIJ S;  2J76 E;  4KHP F;  1JJH A;  2HHV A;  1WG4 A;  2EW9 A;  2XSF A;  2YKM A;  4BHQ A;  3N4W A;  4TQR A;  1OJ4 A;  3JTN A;  5KFL A;  1NJX A;  4JV2 A;  1N52 B;  2V2Z A;  2B9Y A;  4AT1 B;  3OVA A;  3I0S B;  2OMO A;  1R43 A;  2DXD A;  2QL9 B;  4KGM A;  1S59 A;  3P4U B;  1R0B G;  4CCH A;  2J5A A;  5D6G A;  3HVW A;  3G9C A;  2UUB F;  4QW9 A;  2LXF A;  3DNC A;  4AQY F;  1S10 A;  4AFF A;  1T05 A;  2JRS A;  2B7C B;  2DNL A;  1FKP B;  4I7F A;  2FIU A;  1Y3J A;  2P9E A;  1RXO B;  5ETT A;  4Q43 A;  1DLO A;  1T9U A;  2P9C A;  2YWH A;  2XSJ A;  3UR3 C;  4E8U A;  4Y0F A;  4CNY A;  2HFN A;  1VQP S;  2UUB J;  3PY8 A;  2MJN A;  4ZLJ A;  5J2M B;  1M1H A;  2M2B A;  1EJ7 L;  3H90 A;  2H1Y A;  2PA3 A;  2CPE A;  3MHY A;  3UVJ A;  1N33 F;  1C1C A;  2ZWP A;  3A12 A;  3BF4 A;  3GFZ A;  3HVT A;  4RKU C;  4Q7A A;  3MR6 A;  1S0O A;  1VQ8 S;  4LF7 F;  2FDN A;  1NK0 A;  4DL3 A;  4JV0 A;  1HHQ A;  2DHG A;  3HJF A;  2F65 A;  4RBV A;  4TY8 B;  4Y28 C;  5ETV A;  5T41 A;  2F9D A;  4F25 A;  3GG0 A;  4F04 B;  3E3X A;  4ZDN A;  4CLP A;  5JVG Q;  4J90 A;  4CLW A;  3DM2 A;  2IVM A;  3GIM A;  1C0U A;  2KKH A;  2R7T A;  4RU9 A;  5HJY A;  1RT6 B;  4DX8 H;  1HNZ J;  1VMB A;  4AE5 A;  1SIW B;  2DT9 A;  2K1R A;  4KKO B;  5CYQ A;  3PAC A;  3TJA A;  2QEX S;  2GHW A;  3MTK A;  1LWC A;  3Q8P B;  1IBL J;  2OUG A;  1JKH A;  4J7C A;  3IRX B;  3PG9 A;  1HQU B;  5E0O A;  3EXC X;  2YY3 A;  3QLH B;  2L3M A;  3VAF A;  4A8Q A;  2MZJ A;  3PXG a;  3SCL E;  3GJT B;  3OJU A;  1WDD A;  2H4Y B;  4USW A;  3KK1 B;  2UUA J;  3RAQ A;  1IM4 A;  3NCP A;  4B3R J;  3CVK A;  1J27 A;  2XG8 A;  2QLJ B;  3H8Y A;  5K14 B;  4EK2 A;  1REV A;  1VIO A;  2ZDO A;  3G82 B;  2RML A;  1QTM A;  1NPK A;  3SYZ A;  1Q16 B;  3RB6 A;  1I6J A;  3CWJ A;  4LQ3 A;  1WWH A;  3WX8 A;  4V19 J;  3CJ5 A;  2CQI A;  2HAI A;  3C16 B;  2FVQ A;  4B9T A;  1TP7 A;  4NYZ A;  1MLA A;  2LMI A;  5KFN A;  3J7Z 5;  1J5E F;  3MM7 B;  1CS4 A;  2L9N A;  1RHR B;  1FRX A;  1RTJ A;  4WTO B;  1YWX A;  2BA9 A;  3O1L A;  4R0J A;  3G96 A;  3W64 A;  3CJK A;  2VOO A;  2XHC A;  3GZ7 A;  1OY6 A;  3QMQ A;  3DDN A;  1K8A T;  3IAS 9;  2HK2 A;  3CCZ A;  3DOK A;  2MQN A;  2ZNY A;  7FDR A;  3UD5 A;  3CD0 A;  1IWA A;  2EKN A;  3D0H E;  3DC2 A;  3HCX A;  4CLZ A;  2DH9 A;  1S12 A;  4DU7 A;  2XNR A;  4PYA A;  1FNO A;  3GJQ B;  1UJ5 A;  3S8S A;  1LOU A;  1TKZ B;  2YNG B;  2B9W A;  4ES2 A;  2OEL A;  2FJV A;  5FD1 A;  2CPF A;  2CVE A;  3CCQ S;  2GV1 A;  4CO3 A;  2QL5 B;  1H2U X;  4USV A;  4YUD A;  1N5T A;  1NHK L;  1QAJ A;  3NCQ A;  1RWU A;  3VHQ A;  5J2N A;  2ADC A;  3A8J A;  4NRT A;  4JYA F;  2HRU A;  4Q8F A;  3O6Q A;  2NXN A;  1N5S A;  4QIV A;  1RK8 A;  5IT9 U;  3NMR A;  4B3O B;  4DX7 A;  3U7J A;  4D3H A;  5CAA A;  1N88 A;  2MKK A;  1V3Z A;  4WXO A;  5KFU A;  3UFC X;  4CYU B;  4B9S A;  4AL5 A;  1UEK A;  6AT1 B;  1S0N A;  1ZH5 A;  2Z8Q A;  4I6A A;  1FDD A;  4Z7Y A;  2ZHA A;  4AL6 A;  2CZ9 A;  3V2U C;  4QIF A;  1FES A;  2F1F A;  1HW9 A;  4ZN1 A;  3CJT A;  2CRL A;  4C9D A;  3P3D A;  4RW6 A;  2WB1 D;  1P1T A;  3JQM A;  4L3N A;  3M9M B;  1Q8I A;  4CI0 B;  3EPI A;  1EKR A;  2MYF A;  3UR0 A;  2ZH7 A;  1GMV A;  1XMO F;  3A1Y G;  1SQF A;  3Q2S C;  3A3P B;  1PJ7 A;  3K59 A;  1ZTT A;  2AMC B;  1WEZ A;  1DRZ A;  2BQU A;  2UXB J;  4OZ2 A;  1Q79 A;  3GIK A;  3NCR A;  4EO6 A;  4IDK B;  1QM9 A;  1MML A;  3C15 A;  3M30 A;  3MMB A;  2QLF B;  2W4D A;  2V5H G;  2XI3 A;  3DYA A;  4ILM A;  1T9X A;  5IWA J;  1BHN A;  1WOP A;  2H54 B;  2V4J B;  2XYG B;  4NLU A;  3K5L A;  1HBO B;  2C3O A;  2RS2 A;  4IUF A;  1P1L A;  1IQZ A;  1F0X A;  1PYS B;  2HNZ B;  3SQG A;  1TUG B;  2JLE A;  2K3K A;  4URQ U;  4R5P B;  4K4V A;  3ONQ A;  2OEK A;  3M1V A;  4A8X A;  2VB6 A;  4KFB B;  5KT7 A;  4LFB F;  4L75 A;  4PPD A;  2RHQ B;  3KHL A;  4HT5 A;  3A8E A;  2OLW A;  3Q8Y A;  5EWF A;  3WDO A;  1WKL A;  3V6D B;  4QWB A;  5KFO A;  5ITH A;  3AJD A;  3GYX B;  4KGZ B;  4CLF A;  4WXW A;  5K8O A;  1RAA B;  1E6Y A;  3J81 j;  1AW0 A;  3PEH A;  4KFB A;  1YX2 A;  2GHV C;  2GMJ A;  4LJM A;  2G0J A;  3QBC A;  1WC0 A;  2EBG A;  1TK5 A;  1JLC A;  3L3C A;  2PA8 D;  2GVD B;  3T5K A;  3A8I A;  1OY8 A;  2YNH B;  2EPI A;  1ZTW A;  2AYM A;  5KFQ A;  4I6W A;  3MUT P;  2ASJ A;  5IC4 B;  4PAA A;  3TNV A;  2CJY B;  2DD8 S;  5KG5 A;  4NCB A;  2CJK A;  4X4N A;  3I5B A;  3FQK A;  4RW7 B;  2JVR A;  2VDI A;  1JJ4 A;  5FLX U;  3KLF A;  1WG5 A;  1KFD A;  1Q8K A;  5KFX A;  4U8Y A;  2P6T A;  4L74 A;  4WWS A;  5D4P A;  3S1T A;  2I1R A;  3QT8 A;  1GQE A;  3KK3 A;  1A6L A;  4NYO A;  5IM0 B;  2DYA A;  3SFG A;  4O0I A;  2ILZ A;  1OQ3 A;  4LF8 J;  4YB6 A;  1WOS A;  2SXL A;  2ZIT A;  4M5N A;  4NMX A;  4PXE A;  4WKR A;  3H5U A;  2XWY A;  3OR2 A;  2JEF A;  2HVH A;  4W90 B;  1FWK A;  2B5J B;  5AXL A;  2XMM A;  1X8D A;  4UTG A;  4NA1 A;  5D15 A;  3TVZ A;  5K8N A;  4DSJ A;  2E9R X;  1YRT A;  5LMU F;  4R0E A;  4WK3 A;  3DKD A;  4CH7 A;  1WHW A;  4A8M P;  2R9L A;  4F8R A;  1HBM B;  4JBC A;  1HYS B;  3PRD A;  2L9D A;  3CDU A;  3HSJ A;  4DMZ A;  1KN6 A;  2XGQ A;  3RB3 A;  3W2V A;  5CZX A;  1FRI A;  1HNX J;  4EZ6 A;  4JI5 J;  3I31 A;  2QYG A;  2F5G A;  2B8P A;  2YNI B;  3NOC A;  1RT7 A;  1UJ6 A;  2LQ9 A;  1FD2 A;  3O8W A;  3ENW A;  4JV1 A;  3QID A;  4DS4 A;  3TUP A;  5AE2 A;  1RAF B;  2Z2Y B;  2QA2 A;  5J2P A;  2V9K A;  1O8B A;  2RSQ A;  4M5K A;  4DN9 A;  5CHC B;  1D09 B;  2DNO A;  2CWX A;  2OP5 A;  1DAX A;  3DU5 A;  5KOX A;  1R0A B;  1HNW F;  1PAU B;  5HLF A;  5DG7 A;  4RPF A;  4EYI B;  1SKU B;  4F4Z A;  2FHJ A;  3MCM A;  4F2S A;  3RAX A;  3SQO P;  2EFN A;  2YQ0 A;  2W7P A;  3VGU A;  3PKM A;  1WC3 A;  4I2P A;  1FXD A;  4YR3 A;  3K8W A;  1BLU A;  4M94 A;  1OSC A;  4BWJ A;  4I2P B;  2DEI A;  2QFI A;  3JXO A;  3FUY A;  1MW7 A;  1WHV A;  4UOH A;  2MZ1 A;  1R8C A;  2RQC A;  3T5L A;  4CZC A;  1DTQ B;  2J6U A;  3JQK A;  2R2U A;  5KT6 A;  3CCE S;  2J8A A;  2J6T A;  1G1X A;  1IR0 A;  4ZCL A;  1VK8 A;  3SV4 A;  3PTW A;  1BWV A;  1QE1 B;  4A8F A;  4EZ9 A;  2NXU A;  1Q0N A;  3OVB A;  2WVB A;  3L95 X;  3IM8 A;  3I5A A;  1DZ5 A;  2AKW B;  4IFY A;  3VAI A;  3QYY A;  2HHW A;  4OZ5 A;  2FTR A;  2N4C A;  2WOM B;  4YB7 A;  2RQ4 A;  4P2X A;  2F4V J;  2PEB A;  1HQ2 A;  1M5P C;  4KKO A;  3I9V 9;  2JHE A;  3TEH B;  3E01 A;  3QFH A;  1RT6 A;  3HVA A;  4NLV A;  4LT6 A;  1UVJ A;  1RI7 A;  1YJW S;  5CAB A;  3THV A;  2YX4 A;  4U9R A;  1VHI A;  4GRS A;  5F3Z A;  1T7P A;  3MR2 A;  4FDF A;  2MKI A;  2VG5 A;  4DLE A;  2QA1 A;  4JI1 F;  4JV5 F;  2B4V A;  3CCT A;  1C1C B;  3FSY A;  5DS7 A;  5EHH A;  4DUZ J;  2BDP A;  4ELV A;  2GA7 A;  4DR6 J;  3J7Z T;  3OVS A;  4K4Z A;  2K7K A;  2IPO B;  4PG6 A;  4Y2K A;  2DGU A;  1S99 A;  3GFY A;  4P73 A;  2XSJ B;  5L9X A;  4DUT A;  3KLF B;  4O3O A;  2W9C A;  1TVR B;  4OI3 A;  3V4I B;  2FHM A;  1UKU A;  4F4A A;  4MIB A;  1KTQ A;  5IT9 Y;  4ANE A;  4OYB A;  1RAE B;  3PEJ A;  1U1M A;  1DQA A;  3CSK A;  3AXM A;  4CRJ A;  3CCR S;  2B3T B;  3VCD A;  2CZ4 A;  5GAH I;  1ZPV A;  3UDV A;  1DTQ A;  3OQ2 A;  2CVI A;  3KHG A;  4IG3 A;  1FE4 A;  1OMS A;  3J7A N;  4KGK A;  3QPI A;  1CPZ A;  4ITS A;  3AOC A;  4JB8 B;  2B8Q A;  1IN0 A;  1RU2 A;  3B82 A;  3CJ8 A;  2E9T A;  2YPZ A;  1HQE A;  5IFM A;  1U24 A;  2YKA A;  4DL5 A;  3VAJ A;  2XTJ P;  2AEJ A;  1JLG A;  3CIM A;  2IY5 B;  5JVH Q;  4C7Q A;  1VK3 A;  2JZ5 A;  3FMW A;  2HIY A;  1IBL F;  4CP5 A;  5D0R A;  3VVU A;  3ZNJ 1;  4OHX A;  4F36 A;  4WYW A;  1JLE B;  3QFW A;  4LQ9 A;  5K5M A;  4TYB A;  4DL2 A;  1KHW A;  2EFG A;  4HHH A;  4J9M A;  2UXB F;  2E7V A;  2ZJQ Q;  4JP8 A;  4DV6 F;  1FI4 A;  1TKT A;  2LXI A;  1N8R T;  1KNZ A;  4RW9 A;  1FDA A;  3ITH A;  3DRP A;  5HL7 Q;  2NRE A;  4PYD A;  2B6A B;  4NLG A;  2XGP A;  4Q44 A;  2DH8 A;  3R27 A;  1NM2 A;  5KFK A;  1UVN A;  2HBY B;  3KG1 A;  2GIR A;  5IXU A;  2QLB B;  4FS1 A;  2VPZ B;  3W2V B;  4NXN J;  3QRP A;  2AF6 A;  2YXL A;  4GVL A;  1W2B R;  3GFH A;  2C3P A;  3AOA A;  2DY1 A;  4OJG A;  3TEG A;  4Y2M A;  4MMO A;  2XNQ A;  5HAN A;  4C11 A;  4PWD A;  4J9P A;  3IXQ A;  3T1H J;  3ZFV A;  1KBR A;  2QYC A;  1ZM2 A;  1CC7 A;  1FEH A;  1NSK L;  1XEZ A;  2CQ0 A;  3OFF A;  4HTI A;  2FHJ D;  2BAN A;  4MFB A;  2CPJ A;  3OJS A;  2COL A;  4O44 B;  3FEZ A;  5I42 B;  3PYF A;  4I2Q A;  4NEY A;  4YP3 A;  2MHN A;  5J2N B;  5KT5 A;  4IRD A;  4LF7 J;  1OSD A;  3MOZ A;  2WOM A;  2YWF A;  3C19 A;  1FJG J;  3KDO A;  3JTO A;  3R5D A;  4IQM A;  4FKX A;  2Q6C A;  4P6Q A;  1SC4 B;  4F0K A;  4WYL A;  1ROF A;  3KDN A;  4U8V A;  1NND A;  3H42 A;  4M5M A;  4OJH A;  2VBX A;  4X4S A;  4WZM A;  4ID5 A;  2AJ0 A;  3M2R B;  4KAI A;  4J9Q A;  4PG4 A;  2E5G A;  1OPI A;  2Y3Y A;  4LBP A;  5JXS A;  3IR5 B;  2HBQ B;  1QY7 A;  2J0Q D;  1QVF R;  3HDS A;  2F8E X;  2O66 A;  3OL8 A;  4BS2 A;  4UY8 T;  1HR0 J;  1NEE A;  1RTH A;  2D3Z A;  5DM6 Q;  2IYI A;  4K4Y A;  4RW8 A;  3KWM A;  3U1N A;  2KG0 A;  3ENA A;  3BSN A;  2FJD B;  4USJ C;  2EXU A;  3JQJ A;  3TA1 A;  1TK0 A;  2PFF B;  5D4O A;  3QZ8 A;  2BE9 B;  5LL6 d;  1YRX A;  1CQM A;  4ZCI A;  3HT3 A;  4U7U D;  2A18 A;  1JNZ B;  4J9O A;  1NB2 A;  2OO4 A;  2GJI A;  1Z2Z A;  3O44 A;  1UFL A;  3NXZ A;  5K8P A;  5KG7 A;  4YDX A;  3Q8S B;  1IJE B;  1L3T A;  4Q2L A;  1FJE B;  4KBI A;  3T19 A;  2E1M C;  2FVS A;  4DOZ A;  5AXK A;  2A6M A;  2XMV A;  3ETM A;  1VBX A;  2KJV A;  2XCA A;  2W8K A;  2YX1 A;  2IRU A;  5E3A A;  4MYT A;  1N34 J;  2HGN A;  3M2U A;  2WVD A;  3EVW A;  1MU2 B;  4WU2 A;  2XZT B;  5E33 A;  2QLX A;  2UU9 F;  2QX0 A;  3ILO A;  4QIW D;  1VQ5 S; 
#chains in the Genus database with same CATH homology
 1F3F A;  3L7U A;  4F4A A;  1HHQ A;  5C7P A;  4FKY A;  4ANE A;  4DI6 A;  2HVD A;  5BXI A;  1XQI A;  1ZS6 A;  1PAE X;  1NLK L;  3FBF A;  1NCL A;  3GPA A;  1NDC A;  1U8W A;  4C6A A;  2B8Q A;  2HUR A;  2DXE A;  4UOG A;  1PKU A;  3BBF A;  3GP9 A;  3ZTR A;  4O0N A;  2BEF A;  1B4S A;  1EHW A;  2DYA A;  1NDP A;  1NSQ A;  1HLW A;  3VVU A;  1NUE A;  4CP5 A;  4ENO A;  4F36 A;  1NSP A;  3B54 A;  4AND A;  1UCN A;  4EK2 A;  3Q86 A;  1NPK A;  3DKD A;  2VU5 A;  1MN7 A;  4KPC A;  3EM1 A;  3WX8 A;  2ZUA A;  1KDN A;  1B99 A;  1JXV A;  3FBC A;  2AZ1 A;  2B8P A;  3R9L A;  1BUX A;  2DXF A;  3EE3 A;  1W7W A;  3BH6 B;  3EVO A;  4W98 A;  2NCK L;  3FBE A;  1MN9 A;  3FBB A;  3Q89 A;  3ZTQ A;  3FCV A;  3G2X A;  1NDK A;  3BBB A;  3FC9 A;  1BE4 A;  1NSK L;  1XIQ A;  3ZTP A;  4ANC A;  3VGU A;  3PRV A;  3EIC A;  4HR2 A;  1NHK L;  3EVM A;  3MPD A;  3DDI A;  5IOL A;  3NGS A;  4UOH A;  4FKX A;  3NGU A;  4DZ6 A;  5CAA A;  3FKB A;  1S5Z A;  1VYA A;  1S57 A;  1WKJ A;  1WKK A;  3Q83 A;  2HVE A;  3BH7 B;  1F6T A;  1K44 A;  2BX6 A;  4WBF A;  3JS9 A;  3NGR A;  3EJM A;  2AZ3 A;  3VGV A;  3ZTS A;  3VGT A;  3ENA A;  3ELH A;  3Q8U A;  3Q8V A;  3FCW A;  3B6B A;  3VVT A;  2DXD A;  1S59 A;  1NB2 A;  1NDL A;  3PJ9 A;  5CAB A;  1BHN A;  4UOF A;  2DY9 A;  1LEO A;  1HIY A;  3ZTO A;  3ETM A;  3NGT A;  3VGS A;  3EMT A;  4S0M A;  3Q8Y A;  3BBC A;  3EVW A;  1WKL A;  4DUT A;  2CWK A;  1LWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...