3EVOA

Crystal structure of the mimivirus ndk +kpn mutant complexed with dtdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3evoA00
1B4SA 1K44A 3B6BA 3BH7B 1JXVA 1NUEA 1NSKL 1HLWA 1WKKA 3NGTA 3VVUA 2BX6A 1WKLA 3PJ9A 3BH6B 1U8WA 3EJMA 4WBFA 1LEOA 3ELHA 1PAEX 3MPDA 3EVOA 1VYAA 4UOHA 3EVWA 1B99A 1F3FA 3ETMA 3NGUA 1S59A 2B8PA 3PRVA 3Q83A 3Q89A 2AZ1A 1NDKA 4HR2A 3B54A 3R9LA 4CP5A 2ZUAA 1HIYA 3ZTSA 3Q8VA 3FBBA 3DDIA 3G2XA 4UOFA 4ANDA 3Q86A 3EMTA 4C6AA 2HVEA 2DXFA 1BHNA 3EM1A 2HURA 3VGVA 3EICA 4S0MA 4EK2A 1NLKL 3BBCA 1UCNA 1PKUA 4KPCA 3FCVA 2B8QA 3ZTRA 4F4AA 1XQIA 1NHKL 3FBCA 3JS9A 3GPAA 1LWXA 4FKYA 1NSQA 3ZTPA 1WKJA 2DXEA 3Q8UA 4O0NA 2DY9A 2NCKL 1KDNA 3NGSA 5CABA 1MN9A 1NB2A 2VU5A 3GP9A 5C7PA 1NSPA 3VGTA 3VVTA 1NCLA 1BUXA 3EVMA 3ENAA 5BXIA 1S57A 4ANEA 3L7UA 1F6TA 3ZTOA 5CAAA 3FKBA 4UOGA 3BBBA 4W98A 1ZS6A 1NDPA 2DYAA 1BE4A 2AZ3A 3WX8A 4F36A 4DI6A 4ENOA 3FBFA 2HVDA 3VGSA 3FCWA 2BEFA 1NDCA 3BBFA 3FC9A 1W7WA 3NGRA 3FBEA 1NPKA 5IOLA 3ZTQA 1XIQA 2DXDA 4DUTA 4ANCA 3DKDA 4DZ6A 3VGUA 1HHQA 3EE3A 3Q8YA 1NDLA 4FKXA 1S5ZA 1EHWA 2CWKA 1MN7A
chains in the Genus database with same CATH superfamily
1FF2A 2MZQA 1RK8A 4OHWA 1UEUA 2AQ4A 1Q78A 1Q86T 4X66J 3K89A 3DRYA 1DLOB 4I56A 4JV5J 5I3UB 4ZKAA 2GGPA 1PJ7A 3HDSA 2ASDA 2ZUAA 3TJ8A 2R8KA 4ANDA 5CYMB 5H9EJ 2AJFE 4TQSA 5HQ8A 4DUYJ 4PQAA 3EZ5A 1WC6A 3LGNA 2ZZTA 3EX7B 3JSMA 4LFAJ 2Z30B 4CT9A 1REGX 2AWZA 1SVDA 3K5LA 1GTEA 1S57A 2Z58B 3VAFA 5K8OA 1JKHA 1YLXA 2DBBA 2HHQA 5HROB 2N7YA 4GVLA 3CCTA 2MJNA 4QZVB 5F41A 1Q95G 1TL1B 2IRYA 1RQ0A 4I2QB 1F2GA 2XO7A 4B3SJ 5DGAA 5A0YA 3MUMP 2FHJD 2YNGB 3UD5A 3H4BA 1IKXB 2C3YA 4CT8A 2F8HA 5KTQA 3D1HA 3A8EA 3ILIA 3K5PA 4TU8A 4OV1A 4RW6B 4ZPTR 4K5SA 2DY1A 1X60A 4P6QA 2L08A 2KVIA 4DSFA 2WCXA 1EQ0A 4ZPDA 2K06A 4ZPWR 1D8YA 5F8IA 1PKUA 5E41A 4LSLB 9RUBA 4AYBD 1XQIA 1NSQA 1KBRA 1Q53A 5CZVA 4NEYA 3CDBA 1VR6A 4IG0B 4RNMA 2ZBPA 1ZH5A 4U7CA 2X51A 2B9YA 4F04B 3WX8A 2BJ7A 3MMCB 4QCLA 4B9NA 4YY3J 2J6UA 1XERA 2VOOA 2AHOB 4ECZA 3I31A 5C25A 1UL3A 2IRUA 1H6KX 1CC8A 3KXDA 3B6BA 1WC5A 4NWBA 1DTTA 4TYBA 4A46A 2ZVIA 3TJ9A 3J7A1 1ZM3A 4QIEA 3D6HB 3OTDA 1V3SA 3BH6B 4TXSA 1ZPWX 1JQGA 2CNOB 1JLBB 1HHSA 3Q89A 2MXYA 2RSQA 4HI2A 1X4BA 3ZTSA 2DEJA 1OSCA 2WHOA 3FFIA 3GTYX 3SQGB 1HNIB 1WDTA 2A6MA 4N47A 4NCGA 3V81B 3SCJE 1Q8KA 3T41A 4WE1B 2COLA 2V50A 1X31C 3MTKA 4WK3A 5GMDA 3U27A 4KHPF 4Y6IA 1BC6A 2MY8A 3SI8A 4ZVSB 2ZNZA 1IBCB 2M9KA 2H51B 2R8GA 3MR7A 4RW9A 3MM7A 2B3TB 3QAUA 4O4GB 5DM7Q 3NMAA 4ICLA 1FX2A 3LAMA 2IA0A 3FBEA 3QJJA 2OAUA 2GC8A 1RLDA 2D1CA 3T1HF 1R0BG 3EGZA 2JZ5A 1RWOB 3F0NA 5IT4A 2LKZA 3ETOA 1IWAA 1DZ5A 2XTJP 3NNCA 2FQQB 1BMQB 1LV5A 1VQMS 2VIHA 3UCZP 4Q2LA 1G2EA 1RAEB 2XYPB 3HSGA 2BDPA 1X9SA 3GIIA 3HSJA 4FPRA 1YRTA 1DQ9A 2VKZG 5CCLA 2RS2A 4ATNA 1I51B 1CSJA 2R7QA 1D9DA 3TAPA 3G4SS 2KRRA 1DURA 3HVRA 2JSXA 2HLTA 3M6XA 2YQ1A 1FTRA 4USWA 1UPMB 2O66A 3QRQA 2KHDA 4MYUA 2U1AA 2POKA 4CO2A 3L4BC 3OJUA 3UWTA 3DLKA 2B43A 4HH0A 1KD1T 3DLJA 3M30B 2V68A 4DI6A 1VQKS 2IJRA 3HZEA 4DX8H 4FBTA 2O01C 2MKSA 4ED7A 1TQLA 4ID5B 2MMYA 2HIYA 2R3VA 1RT4B 2NS1B 3CPWR 3AQOA 3J81j 4DUYF 2I0XA 1GH8A 2YQ0A 1KONA 3G9CA 4NXNJ 4KPYA 4LFAF 2V94A 3BPSP 4M5NA 1KLNA 2VG5A 2CYYA 1VRUA 3M32A 5RUBA 1V5VA 2ZM6J 2PE8A 2ZNYA 2EFOA 4FF4A 2YWHA 2G2YA 3IWXA 1F9FA 4ZN1A 1HIYA 2CQBA 2ZOMA 3D28A 1Y9OA 1ZM9A 4A8FA 4FNIA 3OTOF 3ZZUA 2IJFA 3OR1A 4B3SF 1SL0A 1ZZNA 3R1LA 4WXOA 3JAMU 4JI1F 2E5GA 1P6TA 2JEIA 3QO9A 3BM7A 3RRKA 1KDNA 1FDAA 1U48A 2VU5A 2BE2A 1UFKA 5D4OA 1HHTP 3L7UA 3CCRS 2CG8A 1ELOA 1JLEA 3O1LA 2X1AA 4ZPBA 2D69A 2VJVA 5HMWA 1WC0A 4G1IA 3IG1B 3HI9A 5MAOA 3KWMA 2BJ8A 4YHHJ 3K0JA 4CNZA 4DL3A 2Q3PA 4OI6A 4K4WA 4O3PA 1REVB 1HBNA 3PX6A 4CWBA 4DSEA 5L1LA 2DNYA 5IQQA 4DCPB 3ELHA 2O5DA 4M5KA 4LBIA 4KRWA 4NZ7A 1C1CA 4HTIA 4DR1J 3TZXA 2C2OB 3GE9A 3NOCA 1TR0A 3W8GA 2XI3A 1HNZJ 1VC5A 2CZ4A 1CEZA 4X2BA 4DMZA 4PG6A 4ZP9A 2ZH2A 1RAIB 4L74A 4OYZA 2GJFA 4L73A 4U96A 5KFPA 1B64A 2EWHA 4I0WA 1Q16B 4OQJA 2ASYA 4LF9J 1P1LA 1H2VZ 8RUCA 2OPRA 3CWJA 1G4CA 4ZVRB 4CLZA 5E3CA 2YX7A 3AODA 1ZS6A 2R7TA 2WSFC 4CO5A 4ZCLA 1RADB 2W9BA 4KH1B 4LVNP 4H4MB 3JTNA 3BBFA 4CLWA 1SV5A 4WFNQ 3D1OA 3X3UA 5GAGU 2LXUA 4EYHB 2AIRB 4I64A 3PYDA 3KDNA 2MLZA 3J80Y 2CPEA 1QJHA 1RT1A 2IC3B 3LALA 4G1QA 2GCFA 3TWZA 2QMWA 2CQ3A 2VPWB 3ULHA 4IDKB 2RF2B 3D3CJ 4DFKA 4QWCA 3L7PA 3QATA 5H9EK 3QBCA 1U1NA 5KT6A 1RAOA 4ECXA 2P9GA 1LWCA 4CH7A 3J7YU 5J2MB 3V4IB 4OZ3A 3T5KA 2UVVA 3VTIA 2FC8A 4KB7A 4F3OA 4ERDA 3GONA 3Q8SB 2B4UA 2LQJA 2BW2A 1V3ZA 2E5LJ 1U1RA 4ELVA 3P96A 1HWIA 2OTLS 3MAHA 5CZXA 2A6OA 5GAEU 4LIRA 1O6XA 1KQFB 3M2VB 3D1QA 4DPYA 1XEZA 1UJ6A 4WKRA 4ZP8A 1S6UA 1S9EA 3C46A 5DDQC 2Q6CA 3KK3A 3FQLA 4Y00A 2AV5A 5LXRA 3IS9B 2FHJA 3FUYA 5LL6d 2IBOA 1OMSA 3DU6A 3D66A 5IC4B 1T3NA 4HHUA 4CYUB 2PDAA 1H0HB 2SXLA 4IH5A 1NKBA 2YKNB 3PTWA 2KJWA 4TU9A 4DPXA 1D09B 2PIIA 1XR6A 1K8AT 5EWFA 2DIUA 2E5IA 4MKYA 4NCBA 2X1FA 3DOMB 1N6QA 1NKCA 2W4CA 3BGLA 5EWEA 2KFZA 3EPIA 1N4LA 2E7XA 2IDLA 3BQ1A 3VGSA 3KK1A 2XYHB 4JI4F 2WONB 2DH7A 1EJ7L 4JI8J 4OYXA 5AE3A 4WU3A 1NDLA 1CULB 2ALZA 1VIXA 3UVJB 1S6PB 1B4SA 4YB7A 1RAHB 2CZ9A 5C24B 3G6ES 3DLEB 4DN0A 1IKYB 3T1YF 3LAKA 2K7JA 2AGQA 3C19A 4DQPA 3HHKA 2LEPA 3HJFA 4B3OA 3EGVA 4NPOA 1IKVB 2O1PA 2C3MA 2M52A 3G82A 2FZCB 2ROEA 1SH0A 4RUCA 1TL5A 1UZDA 1QE1B 1HQEA 3H59A 1YG0A 5ETKA 5GAGI 2ROGA 4MFBB 4DPTA 5KFFA 1B7FA 1FFWB 4IOCQ 1NB2A 1QVFR 2PFDA 1CQNA 5KFJA 2W2MP 1PYSB 2GQCA 5LXYA 1YJWS 3MEGA 1WF2A 2ZH1A 2ZZNA 2FZKB 1S99A 1RA6A 1R89A 1M5PC 2V4JA 3TA1A 4NMXA 3RBXA 4P2XA 4NZ0A 2F3JA 3FSYA 3PY8A 2DHGA 4O44B 2HHUA 1M5OC 2AYBA 1HLWA 3VVUA 1TV6A 2KZMA 4Z7YA 4LF9F 1HMVA 1V6HA 2QV6A 2GA7A 3TYTA 3C6TA 4KTQA 5KFNA 2QT7A 3F41A 3EDRB 4DOZA 5J2QA 1K1QA 5EN1A 2M8DB 3HD2A 4FXDA 3BSAA 5GAEI 2OMLA 3D0IE 2KVQE 4LRDA 4NA1A 5F8NA 1N34F 1WJ9A 2EW9A 3KLEB 1MLAA 5DQIA 3TUJC 2UUAF 5I42A 3NNHA 2GAGC 3TUPA 3SCKE 1NSPA 1RISA 5KG5A 1PO6A 1FKPA 5HL7Q 4J9SA 4ZOSA 2GO9A 1ZYQA 2KXFA 2I1RA 5D3GB 3Q8RB 2C3OA 2X3DA 3KHHA 2NXCA 2HVDA 4LF7J 2LMIA 4DU7A 5KFUA 2HRTA 4J9VA 3ICLA 4NOHA 2AYGA 2GJIA 5HP1B 1LW0B 1U1KA 1S6QA 1YRXA 2DGQA 1EHWA 4IFVB 4AD6A 3CCLS 1NJWA 4X65F 1VISA 4DSIA 2C2MB 2WB1D 3TEGA 4ED1A 2ZBIA 1R8AA 1YZ6A 3MPVA 2F1FA 1PAUB 1RU1A 4MT1A 4DX7A 4QR0A 4PG4A 1B0VA 1XR7A 3OTCA 5M2UA 1T9TA 4ECTA 2N82B 5L38A 2MPUA 4J9UE 5HN0A 3M1VB 3MM5B 1JX4A 4EO8A 4K4TA 1MWZA 5ETRA 2EI5A 1F3VA 5M2RA 2YNFB 1WG5A 4QJVA 3OJSA 2KRBA 1RTDB 3PX4A 2AF6A 3MPYA 1U1MA 2MQMA 3CULA 3MCMA 3I56S 2DVIA 4IRCA 4OJ3A 2ILZA 3TRGA 1NJYA 3GJSB 1SH2A 3T6BA 3SYZA 3SXLA 1FT8A 5HBMA 1S0NA 4PXBA 1WTBA 2VASA 2CRLA 4AL5A 2YKMA 1M5KC 4JOUA 1QAXA 4DL7A 2AJQA 1B99A 2GVDA 4C8OA 3QSYB 3I32A 1YITS 4J9MA 3RR8A 2DGVA 3CDEA 3FDSA 1R7IA 2DD8S 4U7UD 2R4FA 3KG4A 1U1OA 4BC7A 3AB2B 2HFOA 1U49A 1RHUB 4JV2A 1LQ9A 3FCVA 4PQUA 4Y2KA 1UA1A 1NJIT 1C0TA 4KHRA 2LA4A 2HWIA 2OHDA 3OHBA 1DHMA 4YB5A 2DR9A 4CI0B 1XC9A 3C8YA 1IBKF 1FKAF 3GYNA 4L76A 3OR2B 1IBLF 2C2ZB 3K5NA 5E7OB 2UVWA 2A1BA 2LDYA 3GR1A 1FXLA 4F4YA 1PBUA 1NDCA 2BKOA 3JSRA 4B17A 4DXLA 1QDUB 1EETA 2XCAA 4ILLA 1HWLA 1GK8A 3PEHA 5KG3A 1Q0NA 2MHNA 2QEXS 1OS5A 4RWXA 4NXMF 5LMUJ 1DLOA 3D54A 2MZTA 3ENQA 5I3UA 5DS7A 3H5YA 1RXOB 2XM3A 2P5VA 4RNHA 3H2VE 1R27B 4KGKA 2FZGB 2HGLA 5CYMA 2AEMA 3HVWA 2HFUA 1KTVA 4FS1A 2ZHAA 5ETQA 1VIOA 1HR0J 1X9MA 2EFGA 2DKOB 1N0UA 3U1MA 4P75A 3RU0A 1GXUA 2PSZA 1EIYB 2QN6B 1XK8A 2BJ3A 4EFAC 2W9CB 1IR0A 1U7LA 2FLOA 2KKHA 2V8HA 2R2TA 1XMQJ 5HROA 3ZZOA 4B3TJ 3LWLA 3NBPB 2HPUA 2VFRA 3THTA 3CDWA 3TJAA 2FIUA 1Y5IB 2QA2A 1TL1A 4I2QA 3ZC4A 1JLAB 3GQCA 1DFDA 4MIWA 1NJXA 2YNGA 4AFFA 1IKXA 3DCAA 2BJEA 2ZJQQ 4FKXA 5DZ6A 3IR7B 1R31A 4RW6A 5AE1A 4ECVA 1HWKA 3EVOA 4DUZJ 1SUQB 1U2CA 1B3TA 2B4OA 2OTJS 4C8MA 4HACB 2L41A 4C97A 1JJ2R 1DRZA 3PR5B 2GAHC 2GHVC 1KWMA 2JH3A 3FMBA 4KGMA 1IVZA 2HURA 3LANA 4LSLA 2DNKA 1AROP 4K4XA 2XLKA 2LVWA 1U26A 3ZZYA 2XI2A 3DI6B 4JB8B 1FVSA 5KG0A 3A1YG 4IG0A 2AD9A 3R2DJ 5JMNA 1P1TA 1KSPA 3MAAB 4RPFA 1QUPA 4HVZA 1BY9A 4X62J 1UVKA 2DCUB 3MMCA 1HBOB 3FCWA 4XPCA 2R7OA 3W5XA 1VC6A 2F65A 4W4MA 2HW3A 2GHPA 3DKDA 3VAIA 3SIPB 3K2YA 3K17A 3AD7C 2OP5A 2GIQA 1YZ7A 2VPZB 1FK9B 1JLBA 3N0VA 2C3UA 1JXEA 2HHSA 2XMWA 5D0HA 1NB7A 4IO9Q 2BJ9A 3ZNJ1 1NH8A 2AP6A 3Q83A 3SEOA 4RNOA 5LMNJ 1N33J 2JLGA 2G13A 1LKZA 1HNIA 1PSDA 1S1XB 3HM9A 2DPIA 3V81A 1X5TA 1IN0A 5HSPA 1N5QA 2YQ3A 1U6BA 3S01A 3DFEA 1U45A 3B4MA 4WE1A 1LWXA 1UVNA 4DZDA 3TI0A 3QYYA 1ZM2A 2H48B 2XULA 5L1KA 2DGUA 2R2RA 3M9OB 2D3OR 2HHHF 4O4GA 3ILJA 4ZLNA 2CIMA 2JC1A 3SQOP 3JQKA 1KN6A 3UR3C 2L48A 1G1XA 3NAIA 5KOWA 1SL2A 5HVGA 1XIQA 2JNJA 4AQYJ 3I87A 3RB4A 5GADU 4FNHA 1D1UA 1FE4A 5HMYA 2Q66A 1RAJA 3NGTA 1EB0A 2C42A 3CJQA 3O5TB 4WBFA 2H5IB 5IT9Y 2CAJA 2R7SA 2BKNA 3GSDA 4RWWA 4DR5J 1HNXJ 1S59A 2MQ8A 2D9PA 2JDJA 1JLQB 5IQ6A 3KK2B 3QIPB 4Q43A 4HLBA 3TX8A 3NGDA 2KJVA 1KP6A 3UO0A 3BKTA 3W62A 4ER8A 4XK8C 4F7VA 4LF5F 2ILYA 2VDIA 3K8WA 1ULRA 1CJVB 4USHA 4IUFA 2ZH4A 3MPUB 4Z37A 1AB8A 3M30A 1RWNB 3VF0B 1CBKA 3W9IA 4USJC 4AUKA 2GVZB 1HI0P 2QYCA 3A3NB 4P71A 4ID5A 2XQCA 1RT4A 4RUAA 3TP2A 5J2NB 2CWKA 3IAS9 4JI6F 1SJQA 4ZPAA 4ZIVA 5DJBA 2WVFA 4Y2CA 4DS4A 1RKJA 1EARA 2OKQA 1SKUB 5D4LA 4JI2F 1LNQA 2RQ4A 2BA9A 1N5TA 1U1PA 1A6LA 1M1HA 5SZTA 3CD6S 3PW0A 3MPWA 1XN9A 2E9ZA 4UTGA 4CLPA 1SC4B 3VAKA 1F2HA 4GKJF 2EKNA 4ED0A 2DR6A 4DX6A 1URNA 5CYJA 3I5CA 3N28A 3D6TB 3PDNA 5BR8F 1SC1B 2D74B 3OFGA 1G7CB 1C4AA 1U24A 3I96A 2OPSB 2MKJA 5JJBA 4X64F 4DUZF 1RHKB 1L5UA 4LF6J 3IG1A 1AT1B 2JEJA 5AXMA 3IWLA 2RT3A 2CQ2A 1F1BB 2YNIB 4ZVUB 1REVA 2OFGX 1D9AA 4OI1A 3HSDA 2ATLA 3CJ4A 4RO0A 4ID8A 2BACA 3UDEA 4URSA 1WF0A 3O2IA 1T05B 2WBRA 1K1SA 1VRTB 3MPDA 2EXUA 5GMEA 2XZDB 1HNWJ 5DETA 4C8YA 4UUWA 2DH9A 3G2XA 4OYOA 3W9HA 4P52A 4LBHA 1WELA 1H2UX 3DNCA 1SI9A 4NE9C 1SL1A 5GADI 3MGJA 3CNQP 1WACA 1HBUB 1TKZB 4ZA1A 4CCHA 2QLWA 3H40A 3C14B 3TO8A 4ITSA 2LECA 1VLOA 8ATCB 4AL6A 2APOA 2UVRA 4AXIA 4H4MA 2V5HG 4RUBA 5LMNF 4HT7A 2BEFA 1N33F 1DARA 1PILA 2LU2A 2RVJA 4ZVEA 1R6VA 4DCJB 3QZ7A 5KG4A 1B0TA 4DV0F 1RCXB 1IQZA 1AA1B 5JVHQ 2IC3A 4I69A 2NXJA 1Q8LA 3J7AN 2MZSA 3IBFB 4IDKA 1VLYA 2B5JB 2RF2A 1QSLA 2JVRA 1KOOA 1JIHA 1KVKA 3NGUA 2QL9B 2OEMA 4M5IA 4DV1F 2ZITA 3GSIA 4M63A 1NH7A 2BM0A 1S12A 1G3OA 1D3WA 5J2MA 3V4IA 3IBWA 3BJYA 3UDCA 1YJNS 4UQGA 3KNGA 2CQDA 1SJFA 1EKSA 2BQUA 4C3MA 2L9NA 1PBAA 4TN2A 4GRSA 4LQ3A 1M1GA 4JI0F 5DDPC 2JHEA 4KGVB 4LJMA 3ZTOA 4Y3CA 7AT1B 1ZM4A 4N5SA 2AT1B 1RAFB 3FSIA 1J2VA 3HFZB 1M5SA 4DR5F 1AYEA 2Y0SD 1T9WA 5G0RB 3VWSA 5D8HB 1YSJA 3GCXP 3IRWP 3HT0A 3M2VA 4QIVA 3QGIA 2Z0GA 2BVZA 3M9NB 3JTPA 2MGZB 3IS9A 1WHXA 1SJ1A 4GC6A 1NSAA 2OEKA 2EG2A 3M2UB 4ZVQB 1MROB 1HYSB 2LEBA 4ELUA 5IT0A 1FTCA 3I5AA 3ZNUA 1QVGR 1TU0B 4U95A 2KM8C 3FBBA 1WC3A 3G6YA 4CYUA 2V2VA 3DLLQ 2OELA 4K2JA 1VMBA 5L9NA 2B4PA 2RUGA 2YKNA 4PAAA 5F0WA 3E01B 1XNQF 1OWXA 2M8HA 3DOMA 3KKFA 3CD5A 4P2FA 3M8WA 1OPIA 4FPIA 2CXEA 3KMSA 2WONA 2WK4A 1KEKA 3WIUA 4BLGA 5FDLB 1CULA 4Z2XA 2EKYA 3UVJA 1S6PA 5HQMA 1TFYA 5C24A 3DLEA 1IKYA 1L3KA 1VK3A 1IM4A 1WEYA 1RUSA 3BSOA 3PJ9A 2YWFA 4H4KA 2XG8A 4JI3J 2GQQA 4I4BA 1FFGB 1UWBB 4FYYB 4C98A 1IKVA 4NRTA 1TAUA 5J2PB 3OW2R 4QW8A 2P8IA 4LF6F 2HRYA 2B51A 3GFHA 1A7GE 1QE1A 3GJRB 1ZOTA 2CJBA 1HQUB 3VGVA 1HD0A 2CWXA 2JC0A 2VBWA 4R25A 4UOCA 3M2RB 4CTAB 4MFBA 4CNYA 4NYOA 2B8QA 5BYQA 3I4PA 3JS9A 3WQPA 5J1EB 1S1UB 1TKTB 1P8GA 4LF8F 4UW2A 4Q44A 5LJ3Y 3G8TA 2WSEC 4FYXB 1XBWA 1UKUA 5IWAJ 3KHGA 2V2QA 2WB4A 2GHWA 1LXJA 2VQEJ 3KHRA 2UV8A 5LM7E 2VONA 3HHLC 3R5GA 5EWGA 1T9YA 3CCZA 3NLCA 5B7WA 4O44A 2LQBA 3CJ5A 4ILRA 1AW0A 3KTQA 3A13A 2J6TA 5T14A 3CCSS 1T3OA 2LLZA 3RRHA 1NK4A 2VZ9A 4F3MA 1J27A 1TKXB 2KL8A 4C6AA 5L8RC 4DLEA 4J9LA 3BBCA 4DV3J 4EZ6A 3M8RA 2QTWA 2ZD1B 2W2OP 3KLEA 2D9OA 2PA3A 2VFUA 2G0JA 2FVQA 4BWJA 4WZQA 2KTQA 1KNZA 1VDHA 2KI2A 2UUTA 4ZN3A 2PT0A 4NA2A 4K8RA 4QWAA 5L9XA 3MEKA 1AZSB 4DSLA 2DGWA 5D3GA 2EFQA 5M2PA 4X4TA 2ZH7A 1WUUA 2X7IA 3C66A 1FRHA 4B3MF 2Q43A 4DBQA 1EP4B 4DV5J 1FA0A 1GX5A 5HP1A 2BRKA 1LW0A 5D4PA 4DU8A 3U1LA 2OI2A 3SCLE 3L09A 4IFVA 1GXLA 3D0HE 1TAQA 3CUNA 2HQGA 4NLGA 4DS5A 1VK8A 3PFOA 2VICA 4U6PA 4FYWB 4KIAA 1LWFB 4K4UA 2K1RB 4O0IA 3MECB 1Y5LB 4CP5A 1CPZA 4C48A 2HVEA 4DR3J 3WIVA 3N5BA 3M1VA 3MM5A 4K4ZA 5BYRA 2WW4A 2WSCC 3FBCA 4RBTA 2V8GA 3I9V9 2CJKA 3JSBA 3KLIB 1K9MT 3CCWA 3T1AA 2YNFA 4NLTA 5F8GA 4DV2J 1RTDA 3BO3A 5B0CA 4OYBA 1FRIA 2GMHA 2ZHOA 3IM9A 3CJ0A 1RT7B 2IBKA 1Y11A 3IFEA 3GIKA 1Y4ZB 3R6LB 1TL7B 2ASLA 3IN5A 3SV3A 5JUMA 2CPFA 2D3ZA 2IVFB 1VFJA 2W2NP 2EC2A 1OIAA 1U09A 2WTFA 2DNQA 4DV4F 1MSWD 1NEEA 4WFXA 2GMLA 4NYZA 1OPZA 2G4BA 1U2RA 1WOPA 2JWNA 4BS2A 4H4OB 2OPPB 2RKIB 3FRYA 3N79A 4GC7A 3VHQA 2UXDF 4K0KF 4MIBA 1XNRF 1C0UB 3DN9A 3OR2A 2FJWA 5A8WB 5HVHA 1RHJB 3SFUA 2H5EA 5HJYA 2O67A 3OSNA 1U47A 4LMZA 2R2UA 3FBFA 2CNNB 2E66A 2QLBB 1I1GA 3ZTQA 2OH2A 5KFSA 1HD1A 1I5OB 4A8MP 1S5ZA 1S4FA 4N76A 1B70B 4ECUA 2JFDA 1E6YB 1WI8A 3RBZA 1DQ8A 1NSKL 4ILMA 4F25A 5HANA 2QL5B 1WKKA 1YBTA 3CCUS 3VAGA 3MD1A 1OJ4A 2L3MA 2OPQB 1WD6A 3EVWA 4OJHA 3TAMB 2BW7A 5IWAF 1TUWA 4CLFA 1SQEA 3R7BB 2MB0B 3NWGA 2VQEF 4LF4F 5H9FK 4YR2A 2DGSA 1MMLA 4X4RA 3H20A 1YKWA 4J37A 2FLNA 4ZLLA 2KU7A 3B78A 2W9CA 1S1WB 4DR2J 3VGTA 5AJ3J 2UUCJ 2HVHA 3NBPA 1RDRA 3IMQJ 2R7WA 1LWEB 1BE4A 2VBZA 2VDHA 5D0GA 1JLAA 2HWTA 4RNFA 1W7WA 3H5UA 4WFYA 5T41A 2VPYB 2BJ1A 4XDDA 5DLFA 4ZJLA 3QWPA 3M8PB 4O3OA 2PMHA 4NLOA 2GV1A 3MM9B 1RTIB 5HI7A 3QRRA 1LEOA 1SUQA 4HACA 2FHKA 3QQCD 2AJ4A 3H4DA 2NZCA 4HI1A 5AXKA 3G8SA 2WVCA 2HVZA 3GCWP 5KFLA 2Q1LA 4RKUC 3DI6A 4B9LA 5F9NA 1Q1KA 1NHVA 1JWWA 2ABYA 2M0GB 3QT6A 1VI7A 3MAAA 3ZZZA 5ETOA 1HBOA 2DGOA 2ATCB 5GMKa 4MJKA 2NR0A 3S8SA 3EPGA 4WKYA 2VUGA 4LR9A 2H54B 4DR3F 3KLGB 2AX0A 1HI8A 4HEA9 4JI5J 5KT2A 4KY3A 2ZVSA 3HP6A 3NCPA 2IMOA 3HFVA 1FK9A 3MCOA 1JLCB 3BREA 1S1VB 3WDOA 1SKRA 1TL3B 1HW9A 2B9WA 4Y2AA 2ZDPA 1Q8BA 2BM1A 3MR2A 1TUGB 2GQ2A 4GO5X 4PXCA 1M90T 2J0QD 2A2CA 3DRSB 2FY8A 5C2GA 1S1XA 3Q86A 3AOAA 3CCJS 3AA9A 3GIJA 3MEDB 4XPEA 2J7KA 3GB0A 1QAIA 1OY9A 1X5SA 2ASJA 3DLGB 2ZWPA 1RTZA 2DNGA 1KOHA 3US5A 1SQGA 2UUBJ 3H7HB 2XY7A 3GV5B 4HL9A 2HQ3A 2NYHA 1T9UA 3BBBA 2CDRB 3A8JA 3UDVA 1IBMJ 3DDNA 1J5EJ 2Z8QA 1FWLA 1QTMA 5F3ZA 2BQRA 4B9SA 2DEIA 3TW0A 4CLTA 3FCHA 2WVEA 4J91A 5FIIA 3CJ3A 4N41A 2QIFA 4LT6A 3SZ2A 5F0UA 5JXSA 2HMIB 1S76D 3AJ2A 3RR7A 1PYOB 2N4CA 2E9TA 5LSRA 1IXKA 1T0TV 3PIOQ 1JLQA 4PWDB 3IO1A 3MUVP 3KK2A 3QIPA 4EBDA 2ROPA 2UXBJ 2XY5A 4A8KA 3KUEA 4ZVOB 4PYAA 3T5JA 1NXIA 1WHWA 4LFCJ 1S0MA 1CJVA 4G65A 2XB2D 5C7PA 2ZBRA 3MEEB 3VVTA 2HAFA 2VB6A 4ELTA 2YVSA 3CSKA 2Y8WA 1YVFA 2DHHA 3HO1A 1VQ5S 2KXHA 2FJDB 4E0DA 2GVZA 1CJUB 3PFEA 2VFSA 3V6JA 4K7QA 4RX6A 2I38A 4DR6J 3BGRB 5B08A 3GFZA 1L3SA 1QAYA 1U6ZA 5J2NA 1JLFB 1DJ0A 2NUUG 2KZZA 3EUNA 3QPIA 4GKKJ 1GX6A 1HWUA 2FY1A 4A8XA 4KFBB 4K5RA 2BRLA 2CNLB 5LT5A 3K7RA 2JJ4D 3SFGA 4PCQA 2ZH6A 2RRBA 1RWKB 1H98A 4ZVPB 4ZITA 3M8QB 2N4DA 4USMA 5DLGA 3PYGA 3EWGA 2ERRA 1NLKL 2IJNA 3DLHA 3MD3A 1YJVA 5KFGA 3GJTB 2DK2A 4PG8A 1HQ2A 4IH6A 2MY7A 2MKYA 1RGVA 1S0VA 3QLHB 2PGCA 3DYAB 2OPSA 2QL7B 3PO4A 3EGNA 4OJGA 2QSWA 3RW6A 1N52B 2V63A 3RZAA 1CJTB 5D0RA 2YNIA 2Y8YA 3D9BA 1YRUA 2DO4A 2HBYB 3KJNB 3CT9A 4P2SA 1YTYA 1LXNA 6FDRA 2C28A 4IYQA 4DEZA 1RWWB 2RQKA 4LSNB 3CC4S 2ZC4A 1T05A 1VRTA 2E7WA 3GFYA 5L1IA 4LRCA 1T95A 3E2EA 1T02A 2MKKA 2NXNA 2E29A 2O3DA 3H0PA 2Y0BB 3JAMY 3EM1A 2FLLA 3GFXA 3HFKA 5KFQA 1HBUA 4EEYA 1TKZA 3OVBA 3LGMA 1EQMA 1UVMA 3MMBB 3C14A 3AH6A 4TYAA 2IFXA 1U2FA 3Q24A 2CPHA 1GEHA 2V4RA 1I94J 3OXLA 3CCVS 4DV7J 4NLXA 2VL1A 4DCOB 4C11B 4DSKA 4LIWA 5LJ5Y 3QO9B 3SSRA 1WOOA 2LDIA 5IOLA 3L9ZA 3AB4B 4NLPA 4DZ6A 3CJ2A 3TARA 1WC4A 3OXGA 4R0JA 3BH7B 3PO5A 2CQGA 2VA3A 5IZHA 2B5JA 4OFZA 4DPUA 1PJ5A 3W66A 2CQCA 4P2MA 1Q7LB 3PHEA 4K59A 4I1TA 3KDOA 2E1CA 1R0AB 1SC6A 2CPDA 3QNWB 1T9VA 1PCAA 1YIJS 2QFJA 4X66F 4DV6J 1RHMB 1KHVA 2BYCA 4JV5F 1EAYC 4AT1B 4IH7A 4C0OC 3HX9A 5E3RA 2M3DA 1VHFA 1N56A 3FEYB 5DG9A 4TY9A 2XMTA 3NS5A 3DOKB 5E33A 5G0RA 4TQRA 1X4FA 4C9DA 3K5OA 3ILLA 2RDIA 2NXEA 4DR4J 4Q8EA 5KFOA 1TMMA 1ZAWA 4M5JA 1CS4B 3N4WA 1RB0A 4QR1A 3W3SA 2LCWA 3VGUA 3SBMA 2MGZA 1T03A 1T9XA 5HAOA 1S79A 2R9LA 1YBUA 3NMRA 7FD1A 1U4BA 4USIA 3M2UA 1MROA 4EGLA 1WWHA 1HYSA 3P5BP 4B3RJ 2GMJA 3D6FB 3ZZPA 2ZOGA 5F8LA 2RAQA 5J1NA 1M5HA 2HQCA 3TUIC 4F26A 2IYIA 3I0RB 4DLGA 3MURP 4C8KA 2YX1A 4HDHA 3K58A 1FRXA 1PYTA 1UJ4A 3E01A 5D6GA 2RQMA 3MCNA 5E0OA 4FKYA 4YDXA 2FDNA 3HXMA 3PRBA 2ADBA 5HK4A 4XDCA 1N32J 4NLDA 3OFFA 3CC7S 3OL8A 3D3BJ 4W92B 2EVZA 3FKBA 5ETTA 3TVYA 4H54A 2WOMB 4F02A 2ZKTA 2C2EA 2E1PA 5FDLA 3CDAA 4E2FB 4ED6A 3CW2C 2NZ4A 5E3PA 3OSPA 2Y1IA 1S10A 4L3KA 2WVBA 2B0GA 1ZPVA 1S4EA 2HKEA 3EYZA 4DL2A 1LFPA 1L3VA 5DO2A 1UTAA 4YY3F 1UWBA 2RJZA 2I5JB 1T11A 3KG1A 3ZZ0A 3N6MA 1NK8A 3N6NA 4B9UA 5J2PA 5IFMA 1LK5A 2J9CA 2CJXB 4Q45A 4HR2A 3PZPA 4PUOB 1W25A 3DDIA 1HQUA 3VAJA 2NPFA 2MDAA 3M2RA 3QT7A 4CTAA 1F9HA 1NZ8A 5GVQA 3QJLA 3O6QA 3FVYA 4NYPA 4YDDB 5J1EA 1S1UA 2B4VA 1JLGB 1TKTA 2YXLA 1HWJA 4F2SA 4RZRA 4I6WA 2MZRA 5BJRA 3IRXB 2W25A 5CABA 4EBEA 3CDUA 5KAKA 5FJ4A 1RACB 4IO1A 4MKVA 2FJVA 2HSEB 2BR0A 3N5FA 3VALA 3UCGA 4MK7A 4F4XA 4YB1P 1MW7A 3CJRA 1TMJA 3MOJB 3RGIA 2HNDB 2IM1A 1ICEB 2PMZD 2H1YA 3LP1B 3GWCA 2NSCA 3AOBA 5HLFB 1NUEA 4ES2A 1WEXA 3GG0A 2QYGA 2UVUA 2VOPA 5C2CA 3R5DA 3DM2B 2A18A 4C0BA 3S1TA 4CIOA 4EUVA 1TKXA 2GIRA 3Q8PB 4OX8A 2KM8B 4GMKA 1CLFA 1VOMA 2DXFA 4WCEQ 1U6FA 3HVTB 3L7OA 2V4QA 3ZZRA 3E3XA 2ZD1A 3B8HA 3QT5A 1U1LA 3D2WA 4ZJQA 1GMUA 1YJUA 2YX4A 1RT2B 1MU2B 2DPJA 3Q0AA 1YJRA 1Y00A 1HPZB 1VJQA 5CXTA 2H5JB 3G71S 1BUXA 1AZSA 1X7VA 2CJAA 1RWPB 1NKEA 1KVIA 2J0XA 3LUYA 3SCIE 1ROFA 3WBZA 4K4YA 1EP4A 1VC0A 3D68A 4U7UK 5A6PA 4UZCA 3DMJB 4LUBA 3AFGA 4YUDA 1FVQA 1MN7A 2XMAA 4WWSA 1VHIA 4DHVA 1UMJA 3CVKA 1LWFA 1WKLA 2M5YA 2K1RA 1VQOS 2XMVA 2ZZMA 3MECA 1J5OB 3FRZA 4CO3A 3LP2B 3PW7A 3BGFA 5D0EA 2XS7A 4NXNF 4A8WA 2Z2LA 2ZM6F 1Y10A 5KT4A 3ISND 1EKRA 4RW8B 3NGKA 4ED2A 3KLIA 5CQGA 1HI1A 3W2WB 3D67A 3TQEA 2DNOA 3DU5A 2I2YA 4Q7AA 2L9DA 5CD4A 2PC6A 4R0EA 2DYAA 3V2UC 3HKWA 2EFVA 1X4DA 1S72S 2R42A 3HHLB 1RT7A 3KG0A 1U0HB 5ETMA 5KOXA 2PO4A 1DBDA 4J9RA 2DGXA 5KFHA 1TL7A 1VQ4S 4V19J 3POTB 2VG6B 4OYWA 3W2VB 2IDEA 5DM6Q 1TELA 2QSFA 5KFRA 1N32F 4YHHF 1F5CA 3IWNC 5DG7A 2KYXA 1VQPS 3MDFA 3V5RA 1LK7A 1FKOB 2CFXA 4ZHRB 4IRDA 1FD8A 2Y9HA 4PEOA 1BQXA 4GVBB 4X4UA 2YBVA 3UN5A 1UAWA 4H4OA 2OPPA 3CD0A 4U8VA 4A47A 4MK8A 4RBUA 2RKIA 1YI2S 3EXCX 4DR1F 4YEAA 2UXCJ 2YWKA 3CIMA 4HHJA 1C0UA 3OQ2A 4Y65A 2HQFA 3NEKA 5A8WA 1KFDA 3RAMA 2V67A 3LH2S 1HNZF 1FESA 4C7QA 1KFSA 4N7TA 1WSRA 4OV6A 3F73A 1H2TZ 2G1DA 2K7KA 1B0PA 5A8RB 3PJWA 4QIGA 2NSBA 2Y1LB 4KQZA 1E6YA 4I7FB 4OYIA 2OFHX 3CD7A 4CLLA 2D7SA 3PW4A 2EFNA 2QMXA 3EZUA 2J8AA 3BQ0A 2NPIA 5A2QU 2HS3A 2VV5A 1IJFB 1UVJA 2DTJA 2OPQA 1FHTA 3PXGa 3TAMA 2EEYA 3JQMA 3KUHA 5CD4H 3VAMA 3HKZD 3FK4A 3O3LA 2DNZA 1XMOJ 1FJEB 2K3KA 4DL6A 2X1BA 2KHCA 4KHPJ 1IUJA 4YFUA 2KXNB 4J9NA 5T7LB 2MQNA 3JQJA 4EBCA 1S1WA 1UVIA 3DXBA 9ATCB 2NXUA 3K8VA 2ZH8A 1LWEA 4QU7A 1FFSB 3T1HJ 5B0FA 2AMCB 4OHYA 2ACYA 4F0HA 1NDPA 2XHCA 1RLCL 2M88A 1S77D 4J7CA 1F5BA 3SSSA 4F50A 1ZAXA 4ECRA 4TKTA 2HK2A 1RA7A 3KOAA 2E5LF 3M8PA 4G1PA 4CO0A 3MM9A 1NJZA 1UW9A 3M8SA 1RTIA 4Q8FA 5K20B 4ZVGA 2R2SA 4YP3A 3C16B 2ZC3A 3PACA 3Q2SC 3LP0B 2IM3A 2XLIA 1WF1A 3J7ZT 2B6AB 3UNGC 2E5HA 3UR0A 3ILOA 3THVA 3KJQB 4PXEA 3J81U 1WORA 2M2BA 2RILA 3E8OA 1F60B 3AHPA 3AJDA 5C5JA 5EUHA 4R8UB 3GPAA 5K8PA 1UP1A 2K2PA 3RUBL 4D3HA 2XMMA 5A8KB 3BEGB 3OHAA 5C42B 3NL0A 1NCLA 2C2KB 1S6OA 3PKYA 2HHVA 1TK8A 4F0KA 2XC9A 2RHQB 4DN9A 1TL4A 1QUVA 1UFWA 3N6LA 3CTRA 3KLGA 1BWVA 2CPJA 4OHXA 3MF5A 4ZK7M 3MAQA 3VQSA 3R5BA 2GZOA 4JI7J 3BR8A 2GX8A 1FCAA 4IQMA 1K73T 1JLCA 1S1VA 1X4AA 2ZBCA 2YKPA 1TL3A 3AXMA 3FZBA 4O3SA 3Q22A 3OTOJ 2G1HA 3G96A 2AJ1A 5L39A 3R5AA 4JI8F 3M8ZA 4WYLA 5FLXU 3DRSA 2CJQA 4USTA 4JI1J 2F40A 1O8BA 5HMXA 4KR0B 4FF1A 2BE7D 1Z1ZA 2N3OA 3C15B 3MEDA 4ZCMA 2ACMA 1HARA 4B9TA 4S0MA 4CLUA 3CC2S 2DITA 2Z2ZA 1UCNA 3R1HA 3DLGA 4AXJA 4F4AA 4QWDA 2ZJPQ 3RB0A 3KLVA 2XO6A 2IAJB 3AQPA 3HSZA 1KC8T 5SUHA 1OQ3A 5F8HA 2J9DE 3V4MA 1FXRA 2RU9A 4X4VA 3LQVA 2V8DA 3GG1A 2AKWB 7FDRA 2DRDA 3BN4A 1RZMA 1VQ9S 2IRXA 3MM8B 4X4PA 1XR5A 1WI6A 4ECQA 1QSYA 2VPXB 4L6V3 4UY85 2OEJA 5KFMA 2EK6A 3EZOA 2PEBA 2AJ0A 5DQHA 4QIWD 2HMIA 2UXCF 2IMWP 4P74A 2E1MC 3SDEB 3TQ1A 4PG5A 1OSDA 1X5OA 2YKQA 4PWDA 3ONQA 3BQ2A 2JLEA 4B9MA 3QRPA 3PEJA 3IM8A 4DPWA 3NS7B 3RB6A 2V2ZA 4FN5A 4UY8T 4NA3A 4ZIWA 4HHHA 2R7UA 3KJVB 4DWIA 3ZTRA 3GLJA 2QFIA 1JNRB 4QU6A 2HIQA 5IV4A 3MEEA 4KKOB 4URGA 3NCQA 5E3QA 3MR6A 3EGWB 2QG9B 3MR3A 1H73A 2DO0A 1CJUA 5DZ7A 2A0FB 2V0NA 4KC5A 2BOPA 3IR5B 2HG4A 3P45B 5F8JA 3BGRA 1WG4A 1XMOF 3MOZA 1CJKB 4YS2A 1JLFA 4Y2MA 1A0OB 4ANCA 2XSJB 3BDPA 2FJXA 3EE3A 2VH7A 2FYXA 5CH7B 2MHEA 2R7XA 1FDNA 2RDJA 4UZBA 4KFBA 4PR6A 4LF7F 3MMAB 4WIIA 2RIJA 3HHDA 5IXUA 3S7RA 3FMWA 4CLKA 4DQQA 3M8QA 2CA9A 4MKBA 3OBIA 2QX0A 1VQSA 3HD1A 3QGHA 1RYRA 1TVRB 2AEJA 1RT5B 3RAQA 3QLHA 3HHLD 2R7RA 3DYAA 4J9KA 1WOSA 3NAHA 3NS6A 3DRPB 2VF3A 2DR8A 1PG5B 3T5HA 4NLQA 4RUHA 1TZ0A 1S48A 1NAQA 5KFKA 1SXLA 3WHIA 1CJTA 4M8LA 1Y3KA 4B02A 2HAIA 3C6UB 2V8PA 4M5HA 4DDFA 2FHMA 3TX0A 4IG3B 4LSNA 3KMQA 1YHQS 3SQGA 5D77A 3LA0A 1F5AA 4KBIA 3G87A 1Q81T 4ETXA 2VFTA 3PG9A 1WC1A 5CHCB 3MXHP 1IQTA 2RE1A 4ES1A 3CMES 1XWLA 4C3KA 2XGQA 4EU0A 2Y1RI 4KO0B 3TA2A 2HS4A 1NM2A 4A48A 1GAOA 3HF5A 3I4HX 3EICA 2CQ4A 4YOEA 2NLWA 1KKHA 4WU2A 1FJGJ 4JI7F 2W4PA 4OZ0A 3ISNC 5B09A 3MMBA 1VJWA 1SJ4P 5IM0B 3AAWB 3BR9A 2YNHB 4JI4J 5KFWA 4OZ2A 4A8QA 2HQDA 4WFBQ 1X0FA 5MLCV 4C11A 1O51A 3OVSA 1BQNB 1FRMA 4EZ9A 3ADAC 2MJUA 1P9YA 1GFWB 3EDQB 3MI7X 5I3QA 3BPDA 1H7WA 3T1YJ 3JYTB 1OY6A 2Z2YB 2KB2A 3R6GB 4M95A 1RHQB 4ED5A 3BKUA 5A6WA 4WP3A 2HQIA 1I3OB 2QRRA 2LYVA 4RW7B 1NK5A 4Q2MA 4F4ZA 5B0AA 5HATA 2PI5A 2UUWA 5EGYA 1R0AA 5KFTA 4IFYB 3S6EA 5KG1A 4BCAA 3QMQA 3FEZA 3ETMA 2C2RA 2DRAA 2OJ3A 3R7NB 4OI3A 1S9GB 4OLOA 2XNRA 4ED3A 5LMUF 3MWBA 5KFBA 4F4WA 2R8JA 4U67Q 2FVCA 4XAKA 2W8KA 2N7CA 4BC9A 2XZWA 2BQ3A 3ENWA 3TZYA 1GXTA 3ENVA 5CYQB 1GT8A 1HR0F 3DOKA 2XMKA 4DFPA 1C4CA 3NG8A 1OQ6A 2E44A 3AY0A 4FF2A 3PW5A 2HWHA 2KDOA 3CJSA 1CS4A 1VS3A 1FRLA 5KFAA 1S97A 4N77A 4DG1B 4RBVA 1XMQF 4B3TF 2VJUA 2GW8A 4OZ5A 2P2CB 4HH1A 1FEHA 4KE5A 2OIHA 3GV7B 2LQ9A 4J9QA 2GIFA 1WHYA 3NKYA 1RWUA 3P49B 3G6VA 2LEAA 4OHVA 1DY3A 1N88A 1RHRB 5KG6A 5ETSA 4OYMA 1N34J 3I0RA 3W60A 2KG1A 2UUAJ 4CDIA 4N56A 2ZJRQ 8AT1B 2QA4G 1P9QC 4IR9A 4PWWA 2ZHBA 3OPKA 1N5VA 3K57A 4HDGA 2F8EX 5EX0A 3PRDA 3ZTPA 1FJCA 4NEZA 1JNZB 2UP1A 1KVJA 1BQMB 4QQBA 1NRKA 3AXKA 2WOMA 2CZVC 4D3GA 4DJBA 1BGXT 2FJAB 2QMUB 2JRSA 3HLUA 1FNXH 4X65J 2I9SA 3T5LA 5U47A 1C2PA 4X62F 2UU9J 1BWEA 2MLXA 3MUTP 1RWMB 1U8SA 2YKOA 2I5JA 3UD3P 4KT0C 4Q0BB 1Q5VA 2AX1A 1YWXA 4KGXB 1DQAA 2DRBA 1CQMA 1CG2A 1DTQB 4PUOA 2AZ1A 4MAKA 2HBRB 4K4SA 2DNPA 2DJWA 2ZH3A 2HK3A 4FXWA 2EPIA 4OYPA 2J7WA 3SSQA 1JLGA 4OI4A 2HVIA 3IRXA 2HNZB 2HZCA 3ZFVA 1LOUA 4PABA 2HHWA 1Z2ZA 4OZLA 3I5BA 4GO7X 1RABB 2UZAA 4I68A 4CLYA 4W98A 1AFIA 3H5XA 3CO0P 4C8LA 2MSTA 4J90A 4M5LA 3FNNA 1ZZFA 2HNDA 3UDLA 2WAQD 1NBEB 4OX9J 5K5MA 3SV4A 4U9RA 1MNEA 4FF3A 1X8DA 1RT3B 2XEXA 3LP1A 5HLFA 4YN3B 3I9ZA 3M8YA 3H90A 1FJGF 2DCLA 2OLWA 3BO4A 3O8WA 2F4VJ 1GMWD 1UFLA 3DM2A 1Q7YT 2EFPA 2Q6BA 3WZ0A 2ZUGA 3J80U 1S7IA 1PAEX 3RAXA 4OI2A 4AQYF 3FZ2A 3PHTA 4ZVTB 1Y0HA 1R8HA 3OFEA 1HNVB 3WC0A 3HVTA 3W8PA 1IBKJ 4RU9A 4QYZJ 3DRXA 1QTNB 4R5PB 1IBLJ 1RT2A 1MU2A 1HNXF 3QGPA 4RU2A 1HPZA 4QW9A 2V8VA 2G9OA 4KHMA 2YTCA 4USVA 4QR2A 3H98A 1G6BA 2DR5A 3GZ7A 3WC2A 2X3GA 4QIFA 2ZFHA 3DLBA 1S0OA 2Q79A 1JJ4A 2VFVA 3LOUA 4HTJA 2WZ1A 4NXMJ 4FP9A 5BYSA 4ENOA 2F4FA 3DMJA 2LFVA 3AOCA 2OUGA 3CMQA 1H38A 2DH8A 2CVEA 3QJPA 1RTJB 4P7TA 2HNYB 1KLMB 3R5CA 1SIZA 4U8YA 4MTPA 5AXLA 3NP5A 4JYAJ 5IV3A 2BOAA 1NMEB 1SCJB 2DNLA 5ADZA 1J5OA 3I6PA 4NI2B 1TK0A 3LP2A 3H25A 2DNNA 3GR0A 4FBUA 1RYSA 4UOHA 2XHWA 4BHQA 4CO4A 3J7YI 3H2LA 2KYZA 2V69A 3HZGA 3Q8VA 1ZAVA 2D3O1 3R27A 4HT5A 4LVOP 5AE2A 4RW8A 2HGMA 4WTOB 3DRRB 1VQ6S 2KT5A 1YJTA 4OMFG 3V6DB 3W2WA 2DHXA 3BF4A 3OL7A 2QLJB 3BB5A 2J9EA 3LO3A 3ZXWA 1IKWB 3C2PA 2B9XA 4CZCA 2PI4A 4LR8A 1KHWA 5D78A 3T19A 2JEFA 5KT3A 4DPOA 4USUA 2RNEA 3GYXB 1NZAA 4LREA 2DHSA 4LBPA 3HHLA 4WZMA 2HBZB 1C1BB 3OV7A 4EMDA 1U0HA 2XLJA 2IVYA 4WIQA 1VGYA 2F9DA 2QA4S 1RI7A 4DFJA 2CPIA 2MKIA 4QYRA 3POTA 5DQGA 2W9AA 2JL9A 1O5JA 2VG6A 2V9WA 2VBYA 3W2VA 1RBAA 1SBRA 5D4NA 3VZHA 3CCES 2ZBQA 5ETPA 3HHNB 4O4RA 2HZVA 1FKOA 1IWGA 3KLFB 4ZHRA 1NDKA 2H4YB 2PN6A 4GVBA 2W8LA 1KRPA 2YH0A 3AA8A 3QFHA 1RT6B 3M7VA 4O3QA 1HBMB 3IP0A 3ET6B 3R3TA 2UU9F 1X5PA 1HNWF 2YY3A 2N3LA 4F4KA 3NGSA 4YR3A 1Z4UA 4J5OA 4EI2A 2W1BA 3W63A 4ZCIA 2IM2A 2W4DA 4JP8A 2GNKA 5A8RA 2G2ZA 4OX7A 1N36J 3BO2A 4LSZB 4I7FA 4BDPA 4Z7CA 3PYFA 3ISZA 5G4DA 1TUVA 2OMOA 4N8NA 3BV8A 2H4WB 2FGCA 1PIEA 4UF4A 2E5JA 3JXOA 3D7SB 3UPFA 4LFBJ 2VODA 1X4EA 2Z56B 3M6UA 1CC7A 1OYDA 4OX9F 4FYDA 3CMAS 3V6KA 4DR7J 5T7LA 1RE1B 4G3IA 2E7VA 4EYIB 2HHHJ 5L1JA 3MM6B 3G6XA 3OLBA 2QZ8A 2R8HA 3PR4A 4OZNA 4FVMA 2XS2A 5DDRC 3TVZA 3DDKA 2F4VF 3OXFA 3L3CA 5AT1B 1TP7A 4PPZA 2EG1A 3UN2A 2PMWA 2V34A 4G6VB 2JFKA 4F36A 2C2NA 1N54B 3CB4A 3A3OB 3FC9A 1D8ZA 1NPKA 1N5YB 1E6VB 3Q2TC 3LPYA 2W01A 2B9EA 3NCRA 3IGNA 4ZP6A 4P7VA 1GTHA 3G86A 3C16A 3VCDA 1QD1A 4IRKA 1H7XA 3UFCX 3LP0A 1PC4A 3PJXA 4DF8A 2ZDOA 4RW4B 5L46A 2B6AA 3VZIA 4LF5J 1NK9A 4RJVA 3THPA 2HHXA 5B0GA 1SC3B 4WXWA 4TY8B 3TA0A 2BANB 3D6MB 5K14B 3U1NA 4R8UA 1ITPA 3O44A 4OYAA 3B82A 2KO1A 4CM2A 1X4CA 2A3JA 2MTLA 4A8YA 4M5MA 4A8OA 2QGFB 3CEDA 4KV8B 5A8KA 3W61A 4WPAA 5E2QA 4ED4A 2YPZA 5C42A 5LSLA 1JXLA 2J9DA 3ITHB 3GP9A 4I2PB 4JYAF 4JBCA 3QZ8A 3CCMS 3RTVA 2HZAA 4C3LA 2XSFA 3TEHB 3R2CJ 1AUSL 4DF4A 4NL5A 3OTEA 4JI6J 3IR6B 4ZP7A 3OL6A 1S1TB 1BD6A 3I0SB 4JI2J 1K0VA 4PXDA 2W2PP 3BSCA 1R8CA 4AL7A 2F7VA 2ZE2B 4M5DB 2BV3A 2HS0A 3BS9A 4RL1A 4ZS6A 4ZLPA 3IGVA 2FTRA 2LXIA 1KTQA 4OZ1A 4GKJJ 4O3RA 3KJFB 4Y34A 4OLPA 4KYZA 3HT3A 1U02A 3I82A 1JB0C 2MQOA 3JB9k 4MKAA 3C15A 3BYRA 3OUYB 5THWA 5E3AA 5EDWA 5BR8J 2BABA 4JI3F 4Y2IA 3H2UB 4DX5A 2HFNA 1ZETA 4KPCA 4X64J 3LGHA 1FERA 1PJ6A 5J1PA 1KQGB 3DGPB 3CJKB 5B0DA 2IAJA 1IR1A 1W26A 1WDDA 1PC5A 4ED8A 3FSXA 3MR5A 1FD2A 4F0MA 4UOGA 2YPYA 4P9SA 3W1YC 3PKMA 5K8NA 1L3TA 2EBEA 5DG8A 1I6JA 2AW0A 2VG7B 3MM8A 2BBEA 3CJ8A 4OI0A 3WX4A 1KQSR 2J8SA 3K5MA 3X1LB 3SDEA 3AD9C 1EZZB 3KLHB 5CA5A 1M1KT 4KAIA 1OY8A 4C0HA 1NU4A 2HYIB 4HKQA 3NOGA 4QYZK 1GMWA 3R9LA 2AYEA 3N01A 1RP5A 2RMLA 1BXNA 3KJVA 1N36F 2HFSA 2V6AA 3GV8B 5LSOA 3NXZA 2U2FA 2J76E 3P4UB 4KKOA 1RSCA 3Q8UA 1V9OA 3BN7A 1LW2B 3DOLB 1RTHB 4ZLJA 2QC3A 1FJ7A 2C1EB 3EVMA 1RAAB 4JV0A 2CKWA 4CM0A 4DV3F 4DV0J 4LFBF 2XWXA 1CJKA 3A8IA 2CPYA 4MYTA 4PYDA 2VC0A 2RD5C 2XSJA 4DR7F 1SB6A 4QPXA 2VQFJ 1O0PA 3SMZA 3PNIA 2FJEB 3RYLA 3U02A 2C2DA 2FJBB 4DV1J 1MWQA 1YDLA 3MMAA 4XO0A 4Y28C 4DV5F 4MMOA 1IM6A 4JV1A 5FD1A 3I55S 2IM0A 2P6SA 3AJ1A 1FRJA 3IXQA 2IHR1 3UD4P 5HO4A 2K8GA 2AYMA 2GGPB 1VCTA 1FEEA 2RQCA 5KFIA 4XIUA 4JI0J 2FUG9 2GJ2A 2RB7A 3HULA 5KFXA 5LOQA 3DHXA 1TVRA 4ZJOA 1RT5A 5KFZA 1ACMB 3UCUP 2J5AA 2MKHA 2CQHA 2VBXA 2QLXA 2X1GA 3JSMB 1YQHA 2FVPA 4KSEB 2CQIA 1SJRA 3DRPA 1S9FA 4WF9Q 3L95X 4W90B 2OD6A 1JKHB 1SH3A 1GNKA 5H1SV 3F44A 2NQPA 4M1KA 2M7SA 4OX6A 3C6UA 1RAGB 2DXDA 2QA1A 4IG3A 4DV2F 3BSNA 2DNRA 4TLQA 3QAEA 4PRFA 5A0YB 5K8MA 1SKSA 4KJIA 2CDQA 2BX6A 3MFIA 1FWKA 3TVKA 5HQLA 1NNDA 3N9UC 2LA6A 5IC6B 1D9FA 2OO4A 1XNQJ 4LRFA 2J0SD 4KO0A 1XJWB 4CH0S 2YKAA 2W7OA 3B54A 2KG0A 3M4XA 4WFZA 4J9PA 1VQLS 1AFJA 1FO1A 5KT7A 2F63A 4EK2A 1IR2A 1P27B 4I67A 5IM0A 1KS2A 2YNHA 3PM9A 4UQTA 4ZVHA 3R7SB 3CIZA 2KT2A 3OL9A 3DC2A 3MMJA 4WP9A 4NLVA 2MZ1A 3VV2B 4ALZA 2P6TA 3PYEA 1BQNA 2NYIA 2XWYA 3FGVA 4X84A 3M6WA 2AZ3A 3JYTA 4M94A 1BLUA 3LWMA 2HBQB 3RRGA 3BDEA 2PEHA 1QSSA 2F8MA 4A8SA 1FNMA 1RWXB 4USKA 5C25B 4RW7A 3TOQA 2OGUA 3PIPQ 2MKCA 1CVJA 3P6YC 1DTTB 4IOAQ 4IFYA 1HW8A 3ZO7A 1Q79A 3TUZC 1TFWA 1S9GA 3JTOA 1DAXA 2BZ2A 5IT9U 5KT5A 4LF8J 2EK1A 1UW4A 3BZQA 3FFIB 2DGTA 1Z2LA 3MHYA 2Z2MA 4NCGB 4P72A 2AEFA 1TTHB 6FD1A 2DXEA 2PA8D 4C2MA 5CYQA 2ZH9A 3C3LA 5EX3A 2DISA 1KR4A 2B7BB 4NX9A 1RKIA 2RH3A 1TK5A 3FEXB 1R0CB 4OL8A 4MK9A 1X9WA 4V19X 2OD4A 3T6JA 1UPPA 4RW9B 1YK9A 2BUNA 3MM7B 4NMLA 2AU0A 4OZJA 3KHLA 3TAQA 1T7PA 3GMGA 4DG1A 4DR2F 3HMJG 3KNAA 4ICLB 5AJ3F 4DUTA 3MZIA 2UUCF 2DNHA 1WSVA 2MQQA 3RBEA 1XTZA 1X0PA 2DIVA 3A4TA 4B9VA 1W2IA 3E51A 3M05A 2DNMA 4F67A 3LF0A 3OVAA 4C4WA 1YBAA 3RB3A 2IA6A 3D4JA 4FVCA 2FVRA 2I6WA 3LW5C 4PG7A 2B56A 2HLUA 4DFMA 1FE0A 1TKDA 2K3IA 2G2OA 3IC1A 1W2BR 2VQFF 2R8IA 2XZTB 4ZPCA 2Y1JA 3NWRA 3IBCB 4B3MJ 4FYVB 1NK6A 2BJDA 4O0NA 2NCKL 5KFDA 5B0EA 1BQMA 4XTTA 3QIDA 4QBUA 3JSYA 4PKDB 4WFAQ 2EC0A 3UI3A 1VRQC 5H9FJ 4YQWA 3DLKB 5GAHU 1YX2A 3R8YA 4LR7A 1U0SA 2XGPA 3W9JA 4UUXA 3LTOA 4WK1A 1R43A 2LU1A 1YGYA 5D15A 4CO1A 4A4JA 4Q0BA 4KH0B 5I4MA 4IOBA 5KG2A 2IY5B 2VG5B 2HRUA 3GYGA 2CQ0A 2VA2A 1DTQA 1VRUB 3M32B 4P10A 4JI5F 3UW1A 5CCMA 5KFYA 3HPOA 4LQ9A 3P3DA 1UWAA 4L3NA 3EMTA 3CO9A 1L3UA 4FDFA 1T03B 2Z4PA 2J6SA 2HNZA 3OR1B 4QWEA 2RRAA 2G0CA 2LQ8A 1Q82T 4IQXA 2DY9A 2LP4A 1VBZA 2C22A 2FB0A 4WP8A 5HMZA 2XYGB 2BE2B 3QGGA 5HJXA 4CRJA 2ALYB 3T3FA 2VKRA 2IVMA 1JK9B 2WVDA 1JLEB 1RBLA 4PPDA 3V6HA 3OFHA 1RT3A 4TU7A 2LXFA 3D0GE 2WRMA 3CCQS 2RS8A 2UUBF 2P9EA 2JLFA 1Q5YA 4CLSA 3DXSX 3DGVA 1MMNA 2JEGA 1K44A 2ADCA 2UV8G 1IBMF 3CGIA 1FNOA 2RUSA 2GO8A 1HBNB 4DV4J 1J5EF 4NLSA 4N8OA 4YR0A 1MG7A 3PV8A 3TANA 4X4NA 4DL4A 1YJ9S 3PX0A 1VYAA 2XNQA 2QO3A 4B08A 4DQSA 4K50A 1HNVA 1C1CB 4NLWA 1F0XA 2HEKA 5EHHA 2UXDJ 2C3PA 1VQNS 4K0KJ 4QOTA 1XNRJ 5KFCA 1FX4A 1RJJA 1HA1A 4R5PA 2MQPA 2CQ1A 3MTJA 3LPEA 1SJ3P 3A8KA 1ZBTA 2W7PA 4YB6A 1VBXA 4NRUA 4X4OA 1MN9A 1UEVA 1FDDA 3W7BA 4NLYA 2P9CA 2AGOA 1T8EA 5ETLA 2UXBF 1F6TA 2OPRB 2A2DA 1Y5NB 2FD2A 2W24A 4LFCF 3HJVA 2ZH5A 4LRBA 2XBPA 2W9BB 1S49A 2CNKB 1RTJA 4PWUA 3NGRA 2HNYA 2KH9A 1AXQA 1Y3JA 2E1RA 2FLPA 1KLMA 1SV5B 2GFFA 3OLAA 1VBYA 5F8MA 2YWGA 1N0VC 1WEZA 5B0BA 4WTYA 2HHPA 4NI2A 4LF4J 4DR6F 3CE8A 3K59A 4ECWA 2L9WA 1RT1B 1U8WA 3EJMA 4ZVFA 4G1QB 5A76A 1APSA 4H4KC 2B8PA 4QPTA 5GAHI 3UN3A 1M5VC 4GKKF 3T9ZA 1ZTWA 3M9MB 2DR7A 1IJEB 4Q5VA 4EO6A 3DRRA 5F9LA 2ZWOA 3V6DA 2EBGA 3RW7A 1LWCB 1MMDA 2CJYB 4M5GA 4NLRA 1IKWA 4ZDNA 5IS2A 4IKAA 5I3PA 5DGBA 5BXIA 3VR1A 2OSRA 2CVIA 2OSQA 5ETNA 5HVFA 1C1BA 4JUZA 2KN4A 1NK0A 4RNNA 3QFWA 2ZOFA 3OTBA 2I8EA 4V1Ak 3MFHA 1GMVA 4TLRA 3Q8YA 1SPBP 1VQ7S 1RBOB 2MSSA 1VQYA 4HYKA 4NCAA 1QAJA 5K9FA 1UJ5A 3D5MA 4OIXA 2FGOA 1S9EB 4MIAA 1U25A 3KK3B 3KLFA 1X4HA 3QWUA 4ES3A 3HK2A 3BGOP 2DT9A 4MH8A 3H5SA 2PD1A 1FWPA 3R97A 3CF5Q 5KFEA 4UOFA 2BKPA 1RT6A 4PZVA 2RRNA 3IA0A 1HBMA 4FS2A 3ET6A 3W5YA 3OD2A 1M0SA 2KFNA 1NHKL 2VD3A 1WKJA 2CJ9A 1B7YB 3FQKA 3AD8C 3QSIA 1HL6A 3B4DA 1OYEA 4DL0C 1N6QB 1QY7A 1OO0B 1K47A 4ETZA 3NY0A 1XMBA 1Q8IA 2B7CB 3KFWX 1AUDA 1Q4RA 2YWWA 2MEWA 4WJBA 3KK1B 4DQIA 1VBKA 1NO8A 1GQEA 4E98A 2AJ2A 2M4MA 3VAHA 2M70A 1NPRA 1I94F 4DV7F 2BMBA 3BGUA 1NPPA 1URRA 2VHGA 2XMJA 2YWEA 1UVLA 3DHWC 5DRKA 2RU3A 2IPOB 4B3OB 4UT4A 6AT1B 2HGNA 1WHVA 2G0IA 5JVGQ 1UZHA 1R8PA 3G82B 3MM6A 3W65A 2CUYA 1HFEL 1R8BA 1ZA2B 1FRKA 1HQEB 3A3PB 1WNEA 3RBDA 2XMUA 4BBYA 1JMTA 2JVOA 4NZ6A 4DV6F 1ZA1B 2JOQA 4YMEA 3TR5A 2YH1A 2FC9A 2MQLA 4CH1A 3GU0A 2IIHA 1SIWB 3MEGB 1A9NB 4F2RA 1UETA 3RG6A 4J9OA 3BKFA 1N5YA 4I6AA 1E6VA 3TNVA 4C8NA 1X4GA 4ZMMA 5A2QY 2QE5A 1HHQA 2V4JB 5KG7A 3P8BB 3UQSA 4LF1A 5F3TA 3Q8QB 4DR4F 4RW4A 2R7VA 1N48A 3HHEA 1TV6B 4L72B 4DL5A 4TNOA 1HMVB 2CG4A 2H9ZA 2FPHX 3C6TB 3PRVA 4RR5A 4TY8A 1SKWA 3G8QA 3NRBA 2BANA 5K14A 1SQFA 3HCXA 4LF2A 4P73A 1N5SA 4FXVA 5J2QB 4NLUA 3QT8A 2DHAA 4B3RF 4KV8A 3T9NA 1FI4A 2MLYA 4ECSA 1H72C 1HKAA 4O3NA 3NNAA 2BXJA 2VC1A 2NREA 3ITHA 4I2PA 3TZWA 3M6VA 2Z57B 1UA0A 4X4SA 4KGZB 5ETVA 5I42B 3A12A 1WG1A 3R5JB 3ENAA 3RJMB 2RDDA 5CAAA 2XCPA 1FKPB 2E9RX 2FHOB 2D41A 1KQKA 4OJ1A 4K4VA 2WBMA 1S1TA 3IAM9 3I0SA 1Y7PA 1EX8A 1N8RT 1RCOB 1RU2A 1MWYA 2ZE2A 4TVAB 4M5DA 1S7HA 3PVXA 3PW2A 4QWBA 3CJTA 2LQ5A 3GJQB 4RLEA 4EWTA 1FXDA 2CPZA 2H65B 4I6YA 4F3QA 1S6QB 2J0WA 1PGZA 2RHSB 2DB1A 2PFFB 2JX2A 3F56A 2F5GA 2WW8A 4C8ZA 1VQ8S 3W5ZA 3J81Y 3KYLA 3HVAA 3OUYA 4L75A 1R3NA 3FJ2A 4ZCKA 4BWMA 2MYFA 1H74A 1FDBA 3GILA 3BYPA 2HFZA 3DGPA 2NUHA 3CJKA 4URQU 4X4QA 3PCOB 3OT9A 2MZJA 2HHTA 4ANEA 1JJHA 1NHUA 3CXCR 1H3DA 2KT3A 2HFVA 3MCSA 4DSJA 2BE9B 2VG7A 1U1QA 5AXNA 1LFWA 3EXYA 3H42A 3UE2A 1RWVB 1JXVA 1YJ7A 2E1AA 3KLHA 5HBMB 3KUGA 1WTFA 3U7JA 2CADA 5FLXY 1NK7A 1V5IB 1QM9A 2J7UA 4O23A 2YKMB 3P5TL 1F9EB 3GIRA 1F3FA 1K0TA 3VQTA 2ZEJA 2CPXA 2F9JA 3H8YA 2GVDB 4Y0FA 2H3EB 2W7AA 2IYGA 2QLFB 2FVSA 4F8RA 2A10A 1BHNA 4NASA 1R6YA 4OHZA 2D3UA 2V2KA 2QJ3A 4CQ1A 3UNYA 4IR1A 3GIMA 2Y3YA 4AE5A 1LW2A 3DOLA 1JJCB 4PQUB 1RTHA 5ITHA 2XY6A 4ZPVR 1C0TB 3W64A 5DDOC 2GS8A 4LRAA 3J7Z5 4FZVA 1QLNA 4DQRA 2W2QP 2ZKUA 2CQPA 4E8UA 5E5NA 3ZZTA 1V3RA 4WYWA 2V9KA 1D0EA 3TZZA 2XS5A 3AT1B 1T94A 1ZTTA 2AGPA 4ECYA 1UEKA 1EETB 2KFYA 4K2XA 5KFVA 3Q23A
chains in the Genus database with same CATH topology
1B4SA 1K44A 3B6BA 3BH7B 1JXVA 1NUEA 1NSKL 1HLWA 1WKKA 3NGTA 3VVUA 2BX6A 1WKLA 3PJ9A 3BH6B 1U8WA 3EJMA 4WBFA 1LEOA 3ELHA 1PAEX 3MPDA 3EVOA 1VYAA 4UOHA 3EVWA 1B99A 1F3FA 3ETMA 3NGUA 1S59A 2B8PA 3PRVA 3Q83A 3Q89A 2AZ1A 1NDKA 4HR2A 3B54A 3R9LA 4CP5A 2ZUAA 1HIYA 3ZTSA 3Q8VA 3FBBA 3DDIA 3G2XA 4UOFA 4ANDA 3Q86A 3EMTA 4C6AA 2HVEA 2DXFA 1BHNA 3EM1A 2HURA 3VGVA 3EICA 4S0MA 4EK2A 1NLKL 3BBCA 1UCNA 1PKUA 4KPCA 3FCVA 2B8QA 3ZTRA 4F4AA 1XQIA 1NHKL 3FBCA 3JS9A 3GPAA 1LWXA 4FKYA 1NSQA 3ZTPA 1WKJA 2DXEA 3Q8UA 4O0NA 2DY9A 2NCKL 1KDNA 3NGSA 5CABA 1MN9A 1NB2A 2VU5A 3GP9A 5C7PA 1NSPA 3VGTA 3VVTA 1NCLA 1BUXA 3EVMA 3ENAA 5BXIA 1S57A 4ANEA 3L7UA 1F6TA 3ZTOA 5CAAA 3FKBA 4UOGA 3BBBA 4W98A 1ZS6A 1NDPA 2DYAA 1BE4A 2AZ3A 3WX8A 4F36A 4DI6A 4ENOA 3FBFA 2HVDA 3VGSA 3FCWA 2BEFA 1NDCA 3BBFA 3FC9A 1W7WA 3NGRA 3FBEA 1NPKA 5IOLA 3ZTQA 1XIQA 2DXDA 4DUTA 4ANCA 3DKDA 4DZ6A 3VGUA 1HHQA 3EE3A 3Q8YA 1NDLA 4FKXA 1S5ZA 1EHWA 2CWKA 1MN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4S A;  1K44 A;  3B6B A;  3BH7 B;  1JXV A;  1NUE A;  1NSK L;  1HLW A;  1WKK A;  3NGT A;  3VVU A;  2BX6 A;  1WKL A;  3PJ9 A;  3BH6 B;  1U8W A;  3EJM A;  4WBF A;  1LEO A;  3ELH A;  1PAE X;  3MPD A;  3EVO A;  1VYA A;  4UOH A;  3EVW A;  1B99 A;  1F3F A;  3ETM A;  3NGU A;  1S59 A;  2B8P A;  3PRV A;  3Q83 A;  3Q89 A;  2AZ1 A;  1NDK A;  4HR2 A;  3B54 A;  3R9L A;  4CP5 A;  2ZUA A;  1HIY A;  3ZTS A;  3Q8V A;  3FBB A;  3DDI A;  3G2X A;  4UOF A;  4AND A;  3Q86 A;  3EMT A;  4C6A A;  2HVE A;  2DXF A;  1BHN A;  3EM1 A;  2HUR A;  3VGV A;  3EIC A;  4S0M A;  4EK2 A;  1NLK L;  3BBC A;  1UCN A;  1PKU A;  4KPC A;  3FCV A;  2B8Q A;  3ZTR A;  4F4A A;  1XQI A;  1NHK L;  3FBC A;  3JS9 A;  3GPA A;  1LWX A;  4FKY A;  1NSQ A;  3ZTP A;  1WKJ A;  2DXE A;  3Q8U A;  4O0N A;  2DY9 A;  2NCK L;  1KDN A;  3NGS A;  5CAB A;  1MN9 A;  1NB2 A;  2VU5 A;  3GP9 A;  5C7P A;  1NSP A;  3VGT A;  3VVT A;  1NCL A;  1BUX A;  3EVM A;  3ENA A;  5BXI A;  1S57 A;  4ANE A;  3L7U A;  1F6T A;  3ZTO A;  5CAA A;  3FKB A;  4UOG A;  3BBB A;  4W98 A;  1ZS6 A;  1NDP A;  2DYA A;  1BE4 A;  2AZ3 A;  3WX8 A;  4F36 A;  4DI6 A;  4ENO A;  3FBF A;  2HVD A;  3VGS A;  3FCW A;  2BEF A;  1NDC A;  3BBF A;  3FC9 A;  1W7W A;  3NGR A;  3FBE A;  1NPK A;  5IOL A;  3ZTQ A;  1XIQ A;  2DXD A;  4DUT A;  4ANC A;  3DKD A;  4DZ6 A;  3VGU A;  1HHQ A;  3EE3 A;  3Q8Y A;  1NDL A;  4FKX A;  1S5Z A;  1EHW A;  2CWK A;  1MN7 A; 
#chains in the Genus database with same CATH topology
 1FF2 A;  2MZQ A;  1RK8 A;  4OHW A;  1UEU A;  2AQ4 A;  1Q78 A;  1Q86 T;  4X66 J;  3K89 A;  3DRY A;  1DLO B;  4I56 A;  4JV5 J;  5I3U B;  4ZKA A;  2GGP A;  1PJ7 A;  3HDS A;  2ASD A;  2ZUA A;  3TJ8 A;  2R8K A;  4AND A;  5CYM B;  5H9E J;  2AJF E;  4TQS A;  5HQ8 A;  4DUY J;  4PQA A;  3EZ5 A;  1WC6 A;  3LGN A;  2ZZT A;  3EX7 B;  3JSM A;  4LFA J;  2Z30 B;  4CT9 A;  1REG X;  2AWZ A;  1SVD A;  3K5L A;  1GTE A;  1S57 A;  2Z58 B;  3VAF A;  5K8O A;  1JKH A;  1YLX A;  2DBB A;  2HHQ A;  5HRO B;  2N7Y A;  4GVL A;  3CCT A;  2MJN A;  4QZV B;  5F41 A;  1Q95 G;  1TL1 B;  2IRY A;  1RQ0 A;  4I2Q B;  1F2G A;  2XO7 A;  4B3S J;  5DGA A;  5A0Y A;  3MUM P;  2FHJ D;  2YNG B;  3UD5 A;  3H4B A;  1IKX B;  2C3Y A;  4CT8 A;  2F8H A;  5KTQ A;  3D1H A;  3A8E A;  3ILI A;  3K5P A;  4TU8 A;  4OV1 A;  4RW6 B;  4ZPT R;  4K5S A;  2DY1 A;  1X60 A;  4P6Q A;  2L08 A;  2KVI A;  4DSF A;  2WCX A;  1EQ0 A;  4ZPD A;  2K06 A;  4ZPW R;  1D8Y A;  5F8I A;  1PKU A;  5E41 A;  4LSL B;  9RUB A;  4AYB D;  1XQI A;  1NSQ A;  1KBR A;  1Q53 A;  5CZV A;  4NEY A;  3CDB A;  1VR6 A;  4IG0 B;  4RNM A;  2ZBP A;  1ZH5 A;  4U7C A;  2X51 A;  2B9Y A;  4F04 B;  3WX8 A;  2BJ7 A;  3MMC B;  4QCL A;  4B9N A;  4YY3 J;  2J6U A;  1XER A;  2VOO A;  2AHO B;  4ECZ A;  3I31 A;  5C25 A;  1UL3 A;  2IRU A;  1H6K X;  1CC8 A;  3KXD A;  3B6B A;  1WC5 A;  4NWB A;  1DTT A;  4TYB A;  4A46 A;  2ZVI A;  3TJ9 A;  3J7A 1;  1ZM3 A;  4QIE A;  3D6H B;  3OTD A;  1V3S A;  3BH6 B;  4TXS A;  1ZPW X;  1JQG A;  2CNO B;  1JLB B;  1HHS A;  3Q89 A;  2MXY A;  2RSQ A;  4HI2 A;  1X4B A;  3ZTS A;  2DEJ A;  1OSC A;  2WHO A;  3FFI A;  3GTY X;  3SQG B;  1HNI B;  1WDT A;  2A6M A;  4N47 A;  4NCG A;  3V81 B;  3SCJ E;  1Q8K A;  3T41 A;  4WE1 B;  2COL A;  2V50 A;  1X31 C;  3MTK A;  4WK3 A;  5GMD A;  3U27 A;  4KHP F;  4Y6I A;  1BC6 A;  2MY8 A;  3SI8 A;  4ZVS B;  2ZNZ A;  1IBC B;  2M9K A;  2H51 B;  2R8G A;  3MR7 A;  4RW9 A;  3MM7 A;  2B3T B;  3QAU A;  4O4G B;  5DM7 Q;  3NMA A;  4ICL A;  1FX2 A;  3LAM A;  2IA0 A;  3FBE A;  3QJJ A;  2OAU A;  2GC8 A;  1RLD A;  2D1C A;  3T1H F;  1R0B G;  3EGZ A;  2JZ5 A;  1RWO B;  3F0N A;  5IT4 A;  2LKZ A;  3ETO A;  1IWA A;  1DZ5 A;  2XTJ P;  3NNC A;  2FQQ B;  1BMQ B;  1LV5 A;  1VQM S;  2VIH A;  3UCZ P;  4Q2L A;  1G2E A;  1RAE B;  2XYP B;  3HSG A;  2BDP A;  1X9S A;  3GII A;  3HSJ A;  4FPR A;  1YRT A;  1DQ9 A;  2VKZ G;  5CCL A;  2RS2 A;  4ATN A;  1I51 B;  1CSJ A;  2R7Q A;  1D9D A;  3TAP A;  3G4S S;  2KRR A;  1DUR A;  3HVR A;  2JSX A;  2HLT A;  3M6X A;  2YQ1 A;  1FTR A;  4USW A;  1UPM B;  2O66 A;  3QRQ A;  2KHD A;  4MYU A;  2U1A A;  2POK A;  4CO2 A;  3L4B C;  3OJU A;  3UWT A;  3DLK A;  2B43 A;  4HH0 A;  1KD1 T;  3DLJ A;  3M30 B;  2V68 A;  4DI6 A;  1VQK S;  2IJR A;  3HZE A;  4DX8 H;  4FBT A;  2O01 C;  2MKS A;  4ED7 A;  1TQL A;  4ID5 B;  2MMY A;  2HIY A;  2R3V A;  1RT4 B;  2NS1 B;  3CPW R;  3AQO A;  3J81 j;  4DUY F;  2I0X A;  1GH8 A;  2YQ0 A;  1KON A;  3G9C A;  4NXN J;  4KPY A;  4LFA F;  2V94 A;  3BPS P;  4M5N A;  1KLN A;  2VG5 A;  2CYY A;  1VRU A;  3M32 A;  5RUB A;  1V5V A;  2ZM6 J;  2PE8 A;  2ZNY A;  2EFO A;  4FF4 A;  2YWH A;  2G2Y A;  3IWX A;  1F9F A;  4ZN1 A;  1HIY A;  2CQB A;  2ZOM A;  3D28 A;  1Y9O A;  1ZM9 A;  4A8F A;  4FNI A;  3OTO F;  3ZZU A;  2IJF A;  3OR1 A;  4B3S F;  1SL0 A;  1ZZN A;  3R1L A;  4WXO A;  3JAM U;  4JI1 F;  2E5G A;  1P6T A;  2JEI A;  3QO9 A;  3BM7 A;  3RRK A;  1KDN A;  1FDA A;  1U48 A;  2VU5 A;  2BE2 A;  1UFK A;  5D4O A;  1HHT P;  3L7U A;  3CCR S;  2CG8 A;  1ELO A;  1JLE A;  3O1L A;  2X1A A;  4ZPB A;  2D69 A;  2VJV A;  5HMW A;  1WC0 A;  4G1I A;  3IG1 B;  3HI9 A;  5MAO A;  3KWM A;  2BJ8 A;  4YHH J;  3K0J A;  4CNZ A;  4DL3 A;  2Q3P A;  4OI6 A;  4K4W A;  4O3P A;  1REV B;  1HBN A;  3PX6 A;  4CWB A;  4DSE A;  5L1L A;  2DNY A;  5IQQ A;  4DCP B;  3ELH A;  2O5D A;  4M5K A;  4LBI A;  4KRW A;  4NZ7 A;  1C1C A;  4HTI A;  4DR1 J;  3TZX A;  2C2O B;  3GE9 A;  3NOC A;  1TR0 A;  3W8G A;  2XI3 A;  1HNZ J;  1VC5 A;  2CZ4 A;  1CEZ A;  4X2B A;  4DMZ A;  4PG6 A;  4ZP9 A;  2ZH2 A;  1RAI B;  4L74 A;  4OYZ A;  2GJF A;  4L73 A;  4U96 A;  5KFP A;  1B64 A;  2EWH A;  4I0W A;  1Q16 B;  4OQJ A;  2ASY A;  4LF9 J;  1P1L A;  1H2V Z;  8RUC A;  2OPR A;  3CWJ A;  1G4C A;  4ZVR B;  4CLZ A;  5E3C A;  2YX7 A;  3AOD A;  1ZS6 A;  2R7T A;  2WSF C;  4CO5 A;  4ZCL A;  1RAD B;  2W9B A;  4KH1 B;  4LVN P;  4H4M B;  3JTN A;  3BBF A;  4CLW A;  1SV5 A;  4WFN Q;  3D1O A;  3X3U A;  5GAG U;  2LXU A;  4EYH B;  2AIR B;  4I64 A;  3PYD A;  3KDN A;  2MLZ A;  3J80 Y;  2CPE A;  1QJH A;  1RT1 A;  2IC3 B;  3LAL A;  4G1Q A;  2GCF A;  3TWZ A;  2QMW A;  2CQ3 A;  2VPW B;  3ULH A;  4IDK B;  2RF2 B;  3D3C J;  4DFK A;  4QWC A;  3L7P A;  3QAT A;  5H9E K;  3QBC A;  1U1N A;  5KT6 A;  1RAO A;  4ECX A;  2P9G A;  1LWC A;  4CH7 A;  3J7Y U;  5J2M B;  3V4I B;  4OZ3 A;  3T5K A;  2UVV A;  3VTI A;  2FC8 A;  4KB7 A;  4F3O A;  4ERD A;  3GON A;  3Q8S B;  2B4U A;  2LQJ A;  2BW2 A;  1V3Z A;  2E5L J;  1U1R A;  4ELV A;  3P96 A;  1HWI A;  2OTL S;  3MAH A;  5CZX A;  2A6O A;  5GAE U;  4LIR A;  1O6X A;  1KQF B;  3M2V B;  3D1Q A;  4DPY A;  1XEZ A;  1UJ6 A;  4WKR A;  4ZP8 A;  1S6U A;  1S9E A;  3C46 A;  5DDQ C;  2Q6C A;  3KK3 A;  3FQL A;  4Y00 A;  2AV5 A;  5LXR A;  3IS9 B;  2FHJ A;  3FUY A;  5LL6 d;  2IBO A;  1OMS A;  3DU6 A;  3D66 A;  5IC4 B;  1T3N A;  4HHU A;  4CYU B;  2PDA A;  1H0H B;  2SXL A;  4IH5 A;  1NKB A;  2YKN B;  3PTW A;  2KJW A;  4TU9 A;  4DPX A;  1D09 B;  2PII A;  1XR6 A;  1K8A T;  5EWF A;  2DIU A;  2E5I A;  4MKY A;  4NCB A;  2X1F A;  3DOM B;  1N6Q A;  1NKC A;  2W4C A;  3BGL A;  5EWE A;  2KFZ A;  3EPI A;  1N4L A;  2E7X A;  2IDL A;  3BQ1 A;  3VGS A;  3KK1 A;  2XYH B;  4JI4 F;  2WON B;  2DH7 A;  1EJ7 L;  4JI8 J;  4OYX A;  5AE3 A;  4WU3 A;  1NDL A;  1CUL B;  2ALZ A;  1VIX A;  3UVJ B;  1S6P B;  1B4S A;  4YB7 A;  1RAH B;  2CZ9 A;  5C24 B;  3G6E S;  3DLE B;  4DN0 A;  1IKY B;  3T1Y F;  3LAK A;  2K7J A;  2AGQ A;  3C19 A;  4DQP A;  3HHK A;  2LEP A;  3HJF A;  4B3O A;  3EGV A;  4NPO A;  1IKV B;  2O1P A;  2C3M A;  2M52 A;  3G82 A;  2FZC B;  2ROE A;  1SH0 A;  4RUC A;  1TL5 A;  1UZD A;  1QE1 B;  1HQE A;  3H59 A;  1YG0 A;  5ETK A;  5GAG I;  2ROG A;  4MFB B;  4DPT A;  5KFF A;  1B7F A;  1FFW B;  4IOC Q;  1NB2 A;  1QVF R;  2PFD A;  1CQN A;  5KFJ A;  2W2M P;  1PYS B;  2GQC A;  5LXY A;  1YJW S;  3MEG A;  1WF2 A;  2ZH1 A;  2ZZN A;  2FZK B;  1S99 A;  1RA6 A;  1R89 A;  1M5P C;  2V4J A;  3TA1 A;  4NMX A;  3RBX A;  4P2X A;  4NZ0 A;  2F3J A;  3FSY A;  3PY8 A;  2DHG A;  4O44 B;  2HHU A;  1M5O C;  2AYB A;  1HLW A;  3VVU A;  1TV6 A;  2KZM A;  4Z7Y A;  4LF9 F;  1HMV A;  1V6H A;  2QV6 A;  2GA7 A;  3TYT A;  3C6T A;  4KTQ A;  5KFN A;  2QT7 A;  3F41 A;  3EDR B;  4DOZ A;  5J2Q A;  1K1Q A;  5EN1 A;  2M8D B;  3HD2 A;  4FXD A;  3BSA A;  5GAE I;  2OML A;  3D0I E;  2KVQ E;  4LRD A;  4NA1 A;  5F8N A;  1N34 F;  1WJ9 A;  2EW9 A;  3KLE B;  1MLA A;  5DQI A;  3TUJ C;  2UUA F;  5I42 A;  3NNH A;  2GAG C;  3TUP A;  3SCK E;  1NSP A;  1RIS A;  5KG5 A;  1PO6 A;  1FKP A;  5HL7 Q;  4J9S A;  4ZOS A;  2GO9 A;  1ZYQ A;  2KXF A;  2I1R A;  5D3G B;  3Q8R B;  2C3O A;  2X3D A;  3KHH A;  2NXC A;  2HVD A;  4LF7 J;  2LMI A;  4DU7 A;  5KFU A;  2HRT A;  4J9V A;  3ICL A;  4NOH A;  2AYG A;  2GJI A;  5HP1 B;  1LW0 B;  1U1K A;  1S6Q A;  1YRX A;  2DGQ A;  1EHW A;  4IFV B;  4AD6 A;  3CCL S;  1NJW A;  4X65 F;  1VIS A;  4DSI A;  2C2M B;  2WB1 D;  3TEG A;  4ED1 A;  2ZBI A;  1R8A A;  1YZ6 A;  3MPV A;  2F1F A;  1PAU B;  1RU1 A;  4MT1 A;  4DX7 A;  4QR0 A;  4PG4 A;  1B0V A;  1XR7 A;  3OTC A;  5M2U A;  1T9T A;  4ECT A;  2N82 B;  5L38 A;  2MPU A;  4J9U E;  5HN0 A;  3M1V B;  3MM5 B;  1JX4 A;  4EO8 A;  4K4T A;  1MWZ A;  5ETR A;  2EI5 A;  1F3V A;  5M2R A;  2YNF B;  1WG5 A;  4QJV A;  3OJS A;  2KRB A;  1RTD B;  3PX4 A;  2AF6 A;  3MPY A;  1U1M A;  2MQM A;  3CUL A;  3MCM A;  3I56 S;  2DVI A;  4IRC A;  4OJ3 A;  2ILZ A;  3TRG A;  1NJY A;  3GJS B;  1SH2 A;  3T6B A;  3SYZ A;  3SXL A;  1FT8 A;  5HBM A;  1S0N A;  4PXB A;  1WTB A;  2VAS A;  2CRL A;  4AL5 A;  2YKM A;  1M5K C;  4JOU A;  1QAX A;  4DL7 A;  2AJQ A;  1B99 A;  2GVD A;  4C8O A;  3QSY B;  3I32 A;  1YIT S;  4J9M A;  3RR8 A;  2DGV A;  3CDE A;  3FDS A;  1R7I A;  2DD8 S;  4U7U D;  2R4F A;  3KG4 A;  1U1O A;  4BC7 A;  3AB2 B;  2HFO A;  1U49 A;  1RHU B;  4JV2 A;  1LQ9 A;  3FCV A;  4PQU A;  4Y2K A;  1UA1 A;  1NJI T;  1C0T A;  4KHR A;  2LA4 A;  2HWI A;  2OHD A;  3OHB A;  1DHM A;  4YB5 A;  2DR9 A;  4CI0 B;  1XC9 A;  3C8Y A;  1IBK F;  1FKA F;  3GYN A;  4L76 A;  3OR2 B;  1IBL F;  2C2Z B;  3K5N A;  5E7O B;  2UVW A;  2A1B A;  2LDY A;  3GR1 A;  1FXL A;  4F4Y A;  1PBU A;  1NDC A;  2BKO A;  3JSR A;  4B17 A;  4DXL A;  1QDU B;  1EET A;  2XCA A;  4ILL A;  1HWL A;  1GK8 A;  3PEH A;  5KG3 A;  1Q0N A;  2MHN A;  2QEX S;  1OS5 A;  4RWX A;  4NXM F;  5LMU J;  1DLO A;  3D54 A;  2MZT A;  3ENQ A;  5I3U A;  5DS7 A;  3H5Y A;  1RXO B;  2XM3 A;  2P5V A;  4RNH A;  3H2V E;  1R27 B;  4KGK A;  2FZG B;  2HGL A;  5CYM A;  2AEM A;  3HVW A;  2HFU A;  1KTV A;  4FS1 A;  2ZHA A;  5ETQ A;  1VIO A;  1HR0 J;  1X9M A;  2EFG A;  2DKO B;  1N0U A;  3U1M A;  4P75 A;  3RU0 A;  1GXU A;  2PSZ A;  1EIY B;  2QN6 B;  1XK8 A;  2BJ3 A;  4EFA C;  2W9C B;  1IR0 A;  1U7L A;  2FLO A;  2KKH A;  2V8H A;  2R2T A;  1XMQ J;  5HRO A;  3ZZO A;  4B3T J;  3LWL A;  3NBP B;  2HPU A;  2VFR A;  3THT A;  3CDW A;  3TJA A;  2FIU A;  1Y5I B;  2QA2 A;  1TL1 A;  4I2Q A;  3ZC4 A;  1JLA B;  3GQC A;  1DFD A;  4MIW A;  1NJX A;  2YNG A;  4AFF A;  1IKX A;  3DCA A;  2BJE A;  2ZJQ Q;  4FKX A;  5DZ6 A;  3IR7 B;  1R31 A;  4RW6 A;  5AE1 A;  4ECV A;  1HWK A;  3EVO A;  4DUZ J;  1SUQ B;  1U2C A;  1B3T A;  2B4O A;  2OTJ S;  4C8M A;  4HAC B;  2L41 A;  4C97 A;  1JJ2 R;  1DRZ A;  3PR5 B;  2GAH C;  2GHV C;  1KWM A;  2JH3 A;  3FMB A;  4KGM A;  1IVZ A;  2HUR A;  3LAN A;  4LSL A;  2DNK A;  1ARO P;  4K4X A;  2XLK A;  2LVW A;  1U26 A;  3ZZY A;  2XI2 A;  3DI6 B;  4JB8 B;  1FVS A;  5KG0 A;  3A1Y G;  4IG0 A;  2AD9 A;  3R2D J;  5JMN A;  1P1T A;  1KSP A;  3MAA B;  4RPF A;  1QUP A;  4HVZ A;  1BY9 A;  4X62 J;  1UVK A;  2DCU B;  3MMC A;  1HBO B;  3FCW A;  4XPC A;  2R7O A;  3W5X A;  1VC6 A;  2F65 A;  4W4M A;  2HW3 A;  2GHP A;  3DKD A;  3VAI A;  3SIP B;  3K2Y A;  3K17 A;  3AD7 C;  2OP5 A;  2GIQ A;  1YZ7 A;  2VPZ B;  1FK9 B;  1JLB A;  3N0V A;  2C3U A;  1JXE A;  2HHS A;  2XMW A;  5D0H A;  1NB7 A;  4IO9 Q;  2BJ9 A;  3ZNJ 1;  1NH8 A;  2AP6 A;  3Q83 A;  3SEO A;  4RNO A;  5LMN J;  1N33 J;  2JLG A;  2G13 A;  1LKZ A;  1HNI A;  1PSD A;  1S1X B;  3HM9 A;  2DPI A;  3V81 A;  1X5T A;  1IN0 A;  5HSP A;  1N5Q A;  2YQ3 A;  1U6B A;  3S01 A;  3DFE A;  1U45 A;  3B4M A;  4WE1 A;  1LWX A;  1UVN A;  4DZD A;  3TI0 A;  3QYY A;  1ZM2 A;  2H48 B;  2XUL A;  5L1K A;  2DGU A;  2R2R A;  3M9O B;  2D3O R;  2HHH F;  4O4G A;  3ILJ A;  4ZLN A;  2CIM A;  2JC1 A;  3SQO P;  3JQK A;  1KN6 A;  3UR3 C;  2L48 A;  1G1X A;  3NAI A;  5KOW A;  1SL2 A;  5HVG A;  1XIQ A;  2JNJ A;  4AQY J;  3I87 A;  3RB4 A;  5GAD U;  4FNH A;  1D1U A;  1FE4 A;  5HMY A;  2Q66 A;  1RAJ A;  3NGT A;  1EB0 A;  2C42 A;  3CJQ A;  3O5T B;  4WBF A;  2H5I B;  5IT9 Y;  2CAJ A;  2R7S A;  2BKN A;  3GSD A;  4RWW A;  4DR5 J;  1HNX J;  1S59 A;  2MQ8 A;  2D9P A;  2JDJ A;  1JLQ B;  5IQ6 A;  3KK2 B;  3QIP B;  4Q43 A;  4HLB A;  3TX8 A;  3NGD A;  2KJV A;  1KP6 A;  3UO0 A;  3BKT A;  3W62 A;  4ER8 A;  4XK8 C;  4F7V A;  4LF5 F;  2ILY A;  2VDI A;  3K8W A;  1ULR A;  1CJV B;  4USH A;  4IUF A;  2ZH4 A;  3MPU B;  4Z37 A;  1AB8 A;  3M30 A;  1RWN B;  3VF0 B;  1CBK A;  3W9I A;  4USJ C;  4AUK A;  2GVZ B;  1HI0 P;  2QYC A;  3A3N B;  4P71 A;  4ID5 A;  2XQC A;  1RT4 A;  4RUA A;  3TP2 A;  5J2N B;  2CWK A;  3IAS 9;  4JI6 F;  1SJQ A;  4ZPA A;  4ZIV A;  5DJB A;  2WVF A;  4Y2C A;  4DS4 A;  1RKJ A;  1EAR A;  2OKQ A;  1SKU B;  5D4L A;  4JI2 F;  1LNQ A;  2RQ4 A;  2BA9 A;  1N5T A;  1U1P A;  1A6L A;  1M1H A;  5SZT A;  3CD6 S;  3PW0 A;  3MPW A;  1XN9 A;  2E9Z A;  4UTG A;  4CLP A;  1SC4 B;  3VAK A;  1F2H A;  4GKJ F;  2EKN A;  4ED0 A;  2DR6 A;  4DX6 A;  1URN A;  5CYJ A;  3I5C A;  3N28 A;  3D6T B;  3PDN A;  5BR8 F;  1SC1 B;  2D74 B;  3OFG A;  1G7C B;  1C4A A;  1U24 A;  3I96 A;  2OPS B;  2MKJ A;  5JJB A;  4X64 F;  4DUZ F;  1RHK B;  1L5U A;  4LF6 J;  3IG1 A;  1AT1 B;  2JEJ A;  5AXM A;  3IWL A;  2RT3 A;  2CQ2 A;  1F1B B;  2YNI B;  4ZVU B;  1REV A;  2OFG X;  1D9A A;  4OI1 A;  3HSD A;  2ATL A;  3CJ4 A;  4RO0 A;  4ID8 A;  2BAC A;  3UDE A;  4URS A;  1WF0 A;  3O2I A;  1T05 B;  2WBR A;  1K1S A;  1VRT B;  3MPD A;  2EXU A;  5GME A;  2XZD B;  1HNW J;  5DET A;  4C8Y A;  4UUW A;  2DH9 A;  3G2X A;  4OYO A;  3W9H A;  4P52 A;  4LBH A;  1WEL A;  1H2U X;  3DNC A;  1SI9 A;  4NE9 C;  1SL1 A;  5GAD I;  3MGJ A;  3CNQ P;  1WAC A;  1HBU B;  1TKZ B;  4ZA1 A;  4CCH A;  2QLW A;  3H40 A;  3C14 B;  3TO8 A;  4ITS A;  2LEC A;  1VLO A;  8ATC B;  4AL6 A;  2APO A;  2UVR A;  4AXI A;  4H4M A;  2V5H G;  4RUB A;  5LMN F;  4HT7 A;  2BEF A;  1N33 F;  1DAR A;  1PIL A;  2LU2 A;  2RVJ A;  4ZVE A;  1R6V A;  4DCJ B;  3QZ7 A;  5KG4 A;  1B0T A;  4DV0 F;  1RCX B;  1IQZ A;  1AA1 B;  5JVH Q;  2IC3 A;  4I69 A;  2NXJ A;  1Q8L A;  3J7A N;  2MZS A;  3IBF B;  4IDK A;  1VLY A;  2B5J B;  2RF2 A;  1QSL A;  2JVR A;  1KOO A;  1JIH A;  1KVK A;  3NGU A;  2QL9 B;  2OEM A;  4M5I A;  4DV1 F;  2ZIT A;  3GSI A;  4M63 A;  1NH7 A;  2BM0 A;  1S12 A;  1G3O A;  1D3W A;  5J2M A;  3V4I A;  3IBW A;  3BJY A;  3UDC A;  1YJN S;  4UQG A;  3KNG A;  2CQD A;  1SJF A;  1EKS A;  2BQU A;  4C3M A;  2L9N A;  1PBA A;  4TN2 A;  4GRS A;  4LQ3 A;  1M1G A;  4JI0 F;  5DDP C;  2JHE A;  4KGV B;  4LJM A;  3ZTO A;  4Y3C A;  7AT1 B;  1ZM4 A;  4N5S A;  2AT1 B;  1RAF B;  3FSI A;  1J2V A;  3HFZ B;  1M5S A;  4DR5 F;  1AYE A;  2Y0S D;  1T9W A;  5G0R B;  3VWS A;  5D8H B;  1YSJ A;  3GCX P;  3IRW P;  3HT0 A;  3M2V A;  4QIV A;  3QGI A;  2Z0G A;  2BVZ A;  3M9N B;  3JTP A;  2MGZ B;  3IS9 A;  1WHX A;  1SJ1 A;  4GC6 A;  1NSA A;  2OEK A;  2EG2 A;  3M2U B;  4ZVQ B;  1MRO B;  1HYS B;  2LEB A;  4ELU A;  5IT0 A;  1FTC A;  3I5A A;  3ZNU A;  1QVG R;  1TU0 B;  4U95 A;  2KM8 C;  3FBB A;  1WC3 A;  3G6Y A;  4CYU A;  2V2V A;  3DLL Q;  2OEL A;  4K2J A;  1VMB A;  5L9N A;  2B4P A;  2RUG A;  2YKN A;  4PAA A;  5F0W A;  3E01 B;  1XNQ F;  1OWX A;  2M8H A;  3DOM A;  3KKF A;  3CD5 A;  4P2F A;  3M8W A;  1OPI A;  4FPI A;  2CXE A;  3KMS A;  2WON A;  2WK4 A;  1KEK A;  3WIU A;  4BLG A;  5FDL B;  1CUL A;  4Z2X A;  2EKY A;  3UVJ A;  1S6P A;  5HQM A;  1TFY A;  5C24 A;  3DLE A;  1IKY A;  1L3K A;  1VK3 A;  1IM4 A;  1WEY A;  1RUS A;  3BSO A;  3PJ9 A;  2YWF A;  4H4K A;  2XG8 A;  4JI3 J;  2GQQ A;  4I4B A;  1FFG B;  1UWB B;  4FYY B;  4C98 A;  1IKV A;  4NRT A;  1TAU A;  5J2P B;  3OW2 R;  4QW8 A;  2P8I A;  4LF6 F;  2HRY A;  2B51 A;  3GFH A;  1A7G E;  1QE1 A;  3GJR B;  1ZOT A;  2CJB A;  1HQU B;  3VGV A;  1HD0 A;  2CWX A;  2JC0 A;  2VBW A;  4R25 A;  4UOC A;  3M2R B;  4CTA B;  4MFB A;  4CNY A;  4NYO A;  2B8Q A;  5BYQ A;  3I4P A;  3JS9 A;  3WQP A;  5J1E B;  1S1U B;  1TKT B;  1P8G A;  4LF8 F;  4UW2 A;  4Q44 A;  5LJ3 Y;  3G8T A;  2WSE C;  4FYX B;  1XBW A;  1UKU A;  5IWA J;  3KHG A;  2V2Q A;  2WB4 A;  2GHW A;  1LXJ A;  2VQE J;  3KHR A;  2UV8 A;  5LM7 E;  2VON A;  3HHL C;  3R5G A;  5EWG A;  1T9Y A;  3CCZ A;  3NLC A;  5B7W A;  4O44 A;  2LQB A;  3CJ5 A;  4ILR A;  1AW0 A;  3KTQ A;  3A13 A;  2J6T A;  5T14 A;  3CCS S;  1T3O A;  2LLZ A;  3RRH A;  1NK4 A;  2VZ9 A;  4F3M A;  1J27 A;  1TKX B;  2KL8 A;  4C6A A;  5L8R C;  4DLE A;  4J9L A;  3BBC A;  4DV3 J;  4EZ6 A;  3M8R A;  2QTW A;  2ZD1 B;  2W2O P;  3KLE A;  2D9O A;  2PA3 A;  2VFU A;  2G0J A;  2FVQ A;  4BWJ A;  4WZQ A;  2KTQ A;  1KNZ A;  1VDH A;  2KI2 A;  2UUT A;  4ZN3 A;  2PT0 A;  4NA2 A;  4K8R A;  4QWA A;  5L9X A;  3MEK A;  1AZS B;  4DSL A;  2DGW A;  5D3G A;  2EFQ A;  5M2P A;  4X4T A;  2ZH7 A;  1WUU A;  2X7I A;  3C66 A;  1FRH A;  4B3M F;  2Q43 A;  4DBQ A;  1EP4 B;  4DV5 J;  1FA0 A;  1GX5 A;  5HP1 A;  2BRK A;  1LW0 A;  5D4P A;  4DU8 A;  3U1L A;  2OI2 A;  3SCL E;  3L09 A;  4IFV A;  1GXL A;  3D0H E;  1TAQ A;  3CUN A;  2HQG A;  4NLG A;  4DS5 A;  1VK8 A;  3PFO A;  2VIC A;  4U6P A;  4FYW B;  4KIA A;  1LWF B;  4K4U A;  2K1R B;  4O0I A;  3MEC B;  1Y5L B;  4CP5 A;  1CPZ A;  4C48 A;  2HVE A;  4DR3 J;  3WIV A;  3N5B A;  3M1V A;  3MM5 A;  4K4Z A;  5BYR A;  2WW4 A;  2WSC C;  3FBC A;  4RBT A;  2V8G A;  3I9V 9;  2CJK A;  3JSB A;  3KLI B;  1K9M T;  3CCW A;  3T1A A;  2YNF A;  4NLT A;  5F8G A;  4DV2 J;  1RTD A;  3BO3 A;  5B0C A;  4OYB A;  1FRI A;  2GMH A;  2ZHO A;  3IM9 A;  3CJ0 A;  1RT7 B;  2IBK A;  1Y11 A;  3IFE A;  3GIK A;  1Y4Z B;  3R6L B;  1TL7 B;  2ASL A;  3IN5 A;  3SV3 A;  5JUM A;  2CPF A;  2D3Z A;  2IVF B;  1VFJ A;  2W2N P;  2EC2 A;  1OIA A;  1U09 A;  2WTF A;  2DNQ A;  4DV4 F;  1MSW D;  1NEE A;  4WFX A;  2GML A;  4NYZ A;  1OPZ A;  2G4B A;  1U2R A;  1WOP A;  2JWN A;  4BS2 A;  4H4O B;  2OPP B;  2RKI B;  3FRY A;  3N79 A;  4GC7 A;  3VHQ A;  2UXD F;  4K0K F;  4MIB A;  1XNR F;  1C0U B;  3DN9 A;  3OR2 A;  2FJW A;  5A8W B;  5HVH A;  1RHJ B;  3SFU A;  2H5E A;  5HJY A;  2O67 A;  3OSN A;  1U47 A;  4LMZ A;  2R2U A;  3FBF A;  2CNN B;  2E66 A;  2QLB B;  1I1G A;  3ZTQ A;  2OH2 A;  5KFS A;  1HD1 A;  1I5O B;  4A8M P;  1S5Z A;  1S4F A;  4N76 A;  1B70 B;  4ECU A;  2JFD A;  1E6Y B;  1WI8 A;  3RBZ A;  1DQ8 A;  1NSK L;  4ILM A;  4F25 A;  5HAN A;  2QL5 B;  1WKK A;  1YBT A;  3CCU S;  3VAG A;  3MD1 A;  1OJ4 A;  2L3M A;  2OPQ B;  1WD6 A;  3EVW A;  4OJH A;  3TAM B;  2BW7 A;  5IWA F;  1TUW A;  4CLF A;  1SQE A;  3R7B B;  2MB0 B;  3NWG A;  2VQE F;  4LF4 F;  5H9F K;  4YR2 A;  2DGS A;  1MML A;  4X4R A;  3H20 A;  1YKW A;  4J37 A;  2FLN A;  4ZLL A;  2KU7 A;  3B78 A;  2W9C A;  1S1W B;  4DR2 J;  3VGT A;  5AJ3 J;  2UUC J;  2HVH A;  3NBP A;  1RDR A;  3IMQ J;  2R7W A;  1LWE B;  1BE4 A;  2VBZ A;  2VDH A;  5D0G A;  1JLA A;  2HWT A;  4RNF A;  1W7W A;  3H5U A;  4WFY A;  5T41 A;  2VPY B;  2BJ1 A;  4XDD A;  5DLF A;  4ZJL A;  3QWP A;  3M8P B;  4O3O A;  2PMH A;  4NLO A;  2GV1 A;  3MM9 B;  1RTI B;  5HI7 A;  3QRR A;  1LEO A;  1SUQ A;  4HAC A;  2FHK A;  3QQC D;  2AJ4 A;  3H4D A;  2NZC A;  4HI1 A;  5AXK A;  3G8S A;  2WVC A;  2HVZ A;  3GCW P;  5KFL A;  2Q1L A;  4RKU C;  3DI6 A;  4B9L A;  5F9N A;  1Q1K A;  1NHV A;  1JWW A;  2ABY A;  2M0G B;  3QT6 A;  1VI7 A;  3MAA A;  3ZZZ A;  5ETO A;  1HBO A;  2DGO A;  2ATC B;  5GMK a;  4MJK A;  2NR0 A;  3S8S A;  3EPG A;  4WKY A;  2VUG A;  4LR9 A;  2H54 B;  4DR3 F;  3KLG B;  2AX0 A;  1HI8 A;  4HEA 9;  4JI5 J;  5KT2 A;  4KY3 A;  2ZVS A;  3HP6 A;  3NCP A;  2IMO A;  3HFV A;  1FK9 A;  3MCO A;  1JLC B;  3BRE A;  1S1V B;  3WDO A;  1SKR A;  1TL3 B;  1HW9 A;  2B9W A;  4Y2A A;  2ZDP A;  1Q8B A;  2BM1 A;  3MR2 A;  1TUG B;  2GQ2 A;  4GO5 X;  4PXC A;  1M90 T;  2J0Q D;  2A2C A;  3DRS B;  2FY8 A;  5C2G A;  1S1X A;  3Q86 A;  3AOA A;  3CCJ S;  3AA9 A;  3GIJ A;  3MED B;  4XPE A;  2J7K A;  3GB0 A;  1QAI A;  1OY9 A;  1X5S A;  2ASJ A;  3DLG B;  2ZWP A;  1RTZ A;  2DNG A;  1KOH A;  3US5 A;  1SQG A;  2UUB J;  3H7H B;  2XY7 A;  3GV5 B;  4HL9 A;  2HQ3 A;  2NYH A;  1T9U A;  3BBB A;  2CDR B;  3A8J A;  3UDV A;  1IBM J;  3DDN A;  1J5E J;  2Z8Q A;  1FWL A;  1QTM A;  5F3Z A;  2BQR A;  4B9S A;  2DEI A;  3TW0 A;  4CLT A;  3FCH A;  2WVE A;  4J91 A;  5FII A;  3CJ3 A;  4N41 A;  2QIF A;  4LT6 A;  3SZ2 A;  5F0U A;  5JXS A;  2HMI B;  1S76 D;  3AJ2 A;  3RR7 A;  1PYO B;  2N4C A;  2E9T A;  5LSR A;  1IXK A;  1T0T V;  3PIO Q;  1JLQ A;  4PWD B;  3IO1 A;  3MUV P;  3KK2 A;  3QIP A;  4EBD A;  2ROP A;  2UXB J;  2XY5 A;  4A8K A;  3KUE A;  4ZVO B;  4PYA A;  3T5J A;  1NXI A;  1WHW A;  4LFC J;  1S0M A;  1CJV A;  4G65 A;  2XB2 D;  5C7P A;  2ZBR A;  3MEE B;  3VVT A;  2HAF A;  2VB6 A;  4ELT A;  2YVS A;  3CSK A;  2Y8W A;  1YVF A;  2DHH A;  3HO1 A;  1VQ5 S;  2KXH A;  2FJD B;  4E0D A;  2GVZ A;  1CJU B;  3PFE A;  2VFS A;  3V6J A;  4K7Q A;  4RX6 A;  2I38 A;  4DR6 J;  3BGR B;  5B08 A;  3GFZ A;  1L3S A;  1QAY A;  1U6Z A;  5J2N A;  1JLF B;  1DJ0 A;  2NUU G;  2KZZ A;  3EUN A;  3QPI A;  4GKK J;  1GX6 A;  1HWU A;  2FY1 A;  4A8X A;  4KFB B;  4K5R A;  2BRL A;  2CNL B;  5LT5 A;  3K7R A;  2JJ4 D;  3SFG A;  4PCQ A;  2ZH6 A;  2RRB A;  1RWK B;  1H98 A;  4ZVP B;  4ZIT A;  3M8Q B;  2N4D A;  4USM A;  5DLG A;  3PYG A;  3EWG A;  2ERR A;  1NLK L;  2IJN A;  3DLH A;  3MD3 A;  1YJV A;  5KFG A;  3GJT B;  2DK2 A;  4PG8 A;  1HQ2 A;  4IH6 A;  2MY7 A;  2MKY A;  1RGV A;  1S0V A;  3QLH B;  2PGC A;  3DYA B;  2OPS A;  2QL7 B;  3PO4 A;  3EGN A;  4OJG A;  2QSW A;  3RW6 A;  1N52 B;  2V63 A;  3RZA A;  1CJT B;  5D0R A;  2YNI A;  2Y8Y A;  3D9B A;  1YRU A;  2DO4 A;  2HBY B;  3KJN B;  3CT9 A;  4P2S A;  1YTY A;  1LXN A;  6FDR A;  2C28 A;  4IYQ A;  4DEZ A;  1RWW B;  2RQK A;  4LSN B;  3CC4 S;  2ZC4 A;  1T05 A;  1VRT A;  2E7W A;  3GFY A;  5L1I A;  4LRC A;  1T95 A;  3E2E A;  1T02 A;  2MKK A;  2NXN A;  2E29 A;  2O3D A;  3H0P A;  2Y0B B;  3JAM Y;  3EM1 A;  2FLL A;  3GFX A;  3HFK A;  5KFQ A;  1HBU A;  4EEY A;  1TKZ A;  3OVB A;  3LGM A;  1EQM A;  1UVM A;  3MMB B;  3C14 A;  3AH6 A;  4TYA A;  2IFX A;  1U2F A;  3Q24 A;  2CPH A;  1GEH A;  2V4R A;  1I94 J;  3OXL A;  3CCV S;  4DV7 J;  4NLX A;  2VL1 A;  4DCO B;  4C11 B;  4DSK A;  4LIW A;  5LJ5 Y;  3QO9 B;  3SSR A;  1WOO A;  2LDI A;  5IOL A;  3L9Z A;  3AB4 B;  4NLP A;  4DZ6 A;  3CJ2 A;  3TAR A;  1WC4 A;  3OXG A;  4R0J A;  3BH7 B;  3PO5 A;  2CQG A;  2VA3 A;  5IZH A;  2B5J A;  4OFZ A;  4DPU A;  1PJ5 A;  3W66 A;  2CQC A;  4P2M A;  1Q7L B;  3PHE A;  4K59 A;  4I1T A;  3KDO A;  2E1C A;  1R0A B;  1SC6 A;  2CPD A;  3QNW B;  1T9V A;  1PCA A;  1YIJ S;  2QFJ A;  4X66 F;  4DV6 J;  1RHM B;  1KHV A;  2BYC A;  4JV5 F;  1EAY C;  4AT1 B;  4IH7 A;  4C0O C;  3HX9 A;  5E3R A;  2M3D A;  1VHF A;  1N56 A;  3FEY B;  5DG9 A;  4TY9 A;  2XMT A;  3NS5 A;  3DOK B;  5E33 A;  5G0R A;  4TQR A;  1X4F A;  4C9D A;  3K5O A;  3ILL A;  2RDI A;  2NXE A;  4DR4 J;  4Q8E A;  5KFO A;  1TMM A;  1ZAW A;  4M5J A;  1CS4 B;  3N4W A;  1RB0 A;  4QR1 A;  3W3S A;  2LCW A;  3VGU A;  3SBM A;  2MGZ A;  1T03 A;  1T9X A;  5HAO A;  1S79 A;  2R9L A;  1YBU A;  3NMR A;  7FD1 A;  1U4B A;  4USI A;  3M2U A;  1MRO A;  4EGL A;  1WWH A;  1HYS A;  3P5B P;  4B3R J;  2GMJ A;  3D6F B;  3ZZP A;  2ZOG A;  5F8L A;  2RAQ A;  5J1N A;  1M5H A;  2HQC A;  3TUI C;  4F26 A;  2IYI A;  3I0R B;  4DLG A;  3MUR P;  4C8K A;  2YX1 A;  4HDH A;  3K58 A;  1FRX A;  1PYT A;  1UJ4 A;  3E01 A;  5D6G A;  2RQM A;  3MCN A;  5E0O A;  4FKY A;  4YDX A;  2FDN A;  3HXM A;  3PRB A;  2ADB A;  5HK4 A;  4XDC A;  1N32 J;  4NLD A;  3OFF A;  3CC7 S;  3OL8 A;  3D3B J;  4W92 B;  2EVZ A;  3FKB A;  5ETT A;  3TVY A;  4H54 A;  2WOM B;  4F02 A;  2ZKT A;  2C2E A;  2E1P A;  5FDL A;  3CDA A;  4E2F B;  4ED6 A;  3CW2 C;  2NZ4 A;  5E3P A;  3OSP A;  2Y1I A;  1S10 A;  4L3K A;  2WVB A;  2B0G A;  1ZPV A;  1S4E A;  2HKE A;  3EYZ A;  4DL2 A;  1LFP A;  1L3V A;  5DO2 A;  1UTA A;  4YY3 F;  1UWB A;  2RJZ A;  2I5J B;  1T11 A;  3KG1 A;  3ZZ0 A;  3N6M A;  1NK8 A;  3N6N A;  4B9U A;  5J2P A;  5IFM A;  1LK5 A;  2J9C A;  2CJX B;  4Q45 A;  4HR2 A;  3PZP A;  4PUO B;  1W25 A;  3DDI A;  1HQU A;  3VAJ A;  2NPF A;  2MDA A;  3M2R A;  3QT7 A;  4CTA A;  1F9H A;  1NZ8 A;  5GVQ A;  3QJL A;  3O6Q A;  3FVY A;  4NYP A;  4YDD B;  5J1E A;  1S1U A;  2B4V A;  1JLG B;  1TKT A;  2YXL A;  1HWJ A;  4F2S A;  4RZR A;  4I6W A;  2MZR A;  5BJR A;  3IRX B;  2W25 A;  5CAB A;  4EBE A;  3CDU A;  5KAK A;  5FJ4 A;  1RAC B;  4IO1 A;  4MKV A;  2FJV A;  2HSE B;  2BR0 A;  3N5F A;  3VAL A;  3UCG A;  4MK7 A;  4F4X A;  4YB1 P;  1MW7 A;  3CJR A;  1TMJ A;  3MOJ B;  3RGI A;  2HND B;  2IM1 A;  1ICE B;  2PMZ D;  2H1Y A;  3LP1 B;  3GWC A;  2NSC A;  3AOB A;  5HLF B;  1NUE A;  4ES2 A;  1WEX A;  3GG0 A;  2QYG A;  2UVU A;  2VOP A;  5C2C A;  3R5D A;  3DM2 B;  2A18 A;  4C0B A;  3S1T A;  4CIO A;  4EUV A;  1TKX A;  2GIR A;  3Q8P B;  4OX8 A;  2KM8 B;  4GMK A;  1CLF A;  1VOM A;  2DXF A;  4WCE Q;  1U6F A;  3HVT B;  3L7O A;  2V4Q A;  3ZZR A;  3E3X A;  2ZD1 A;  3B8H A;  3QT5 A;  1U1L A;  3D2W A;  4ZJQ A;  1GMU A;  1YJU A;  2YX4 A;  1RT2 B;  1MU2 B;  2DPJ A;  3Q0A A;  1YJR A;  1Y00 A;  1HPZ B;  1VJQ A;  5CXT A;  2H5J B;  3G71 S;  1BUX A;  1AZS A;  1X7V A;  2CJA A;  1RWP B;  1NKE A;  1KVI A;  2J0X A;  3LUY A;  3SCI E;  1ROF A;  3WBZ A;  4K4Y A;  1EP4 A;  1VC0 A;  3D68 A;  4U7U K;  5A6P A;  4UZC A;  3DMJ B;  4LUB A;  3AFG A;  4YUD A;  1FVQ A;  1MN7 A;  2XMA A;  4WWS A;  1VHI A;  4DHV A;  1UMJ A;  3CVK A;  1LWF A;  1WKL A;  2M5Y A;  2K1R A;  1VQO S;  2XMV A;  2ZZM A;  3MEC A;  1J5O B;  3FRZ A;  4CO3 A;  3LP2 B;  3PW7 A;  3BGF A;  5D0E A;  2XS7 A;  4NXN F;  4A8W A;  2Z2L A;  2ZM6 F;  1Y10 A;  5KT4 A;  3ISN D;  1EKR A;  4RW8 B;  3NGK A;  4ED2 A;  3KLI A;  5CQG A;  1HI1 A;  3W2W B;  3D67 A;  3TQE A;  2DNO A;  3DU5 A;  2I2Y A;  4Q7A A;  2L9D A;  5CD4 A;  2PC6 A;  4R0E A;  2DYA A;  3V2U C;  3HKW A;  2EFV A;  1X4D A;  1S72 S;  2R42 A;  3HHL B;  1RT7 A;  3KG0 A;  1U0H B;  5ETM A;  5KOX A;  2PO4 A;  1DBD A;  4J9R A;  2DGX A;  5KFH A;  1TL7 A;  1VQ4 S;  4V19 J;  3POT B;  2VG6 B;  4OYW A;  3W2V B;  2IDE A;  5DM6 Q;  1TEL A;  2QSF A;  5KFR A;  1N32 F;  4YHH F;  1F5C A;  3IWN C;  5DG7 A;  2KYX A;  1VQP S;  3MDF A;  3V5R A;  1LK7 A;  1FKO B;  2CFX A;  4ZHR B;  4IRD A;  1FD8 A;  2Y9H A;  4PEO A;  1BQX A;  4GVB B;  4X4U A;  2YBV A;  3UN5 A;  1UAW A;  4H4O A;  2OPP A;  3CD0 A;  4U8V A;  4A47 A;  4MK8 A;  4RBU A;  2RKI A;  1YI2 S;  3EXC X;  4DR1 F;  4YEA A;  2UXC J;  2YWK A;  3CIM A;  4HHJ A;  1C0U A;  3OQ2 A;  4Y65 A;  2HQF A;  3NEK A;  5A8W A;  1KFD A;  3RAM A;  2V67 A;  3LH2 S;  1HNZ F;  1FES A;  4C7Q A;  1KFS A;  4N7T A;  1WSR A;  4OV6 A;  3F73 A;  1H2T Z;  2G1D A;  2K7K A;  1B0P A;  5A8R B;  3PJW A;  4QIG A;  2NSB A;  2Y1L B;  4KQZ A;  1E6Y A;  4I7F B;  4OYI A;  2OFH X;  3CD7 A;  4CLL A;  2D7S A;  3PW4 A;  2EFN A;  2QMX A;  3EZU A;  2J8A A;  3BQ0 A;  2NPI A;  5A2Q U;  2HS3 A;  2VV5 A;  1IJF B;  1UVJ A;  2DTJ A;  2OPQ A;  1FHT A;  3PXG a;  3TAM A;  2EEY A;  3JQM A;  3KUH A;  5CD4 H;  3VAM A;  3HKZ D;  3FK4 A;  3O3L A;  2DNZ A;  1XMO J;  1FJE B;  2K3K A;  4DL6 A;  2X1B A;  2KHC A;  4KHP J;  1IUJ A;  4YFU A;  2KXN B;  4J9N A;  5T7L B;  2MQN A;  3JQJ A;  4EBC A;  1S1W A;  1UVI A;  3DXB A;  9ATC B;  2NXU A;  3K8V A;  2ZH8 A;  1LWE A;  4QU7 A;  1FFS B;  3T1H J;  5B0F A;  2AMC B;  4OHY A;  2ACY A;  4F0H A;  1NDP A;  2XHC A;  1RLC L;  2M88 A;  1S77 D;  4J7C A;  1F5B A;  3SSS A;  4F50 A;  1ZAX A;  4ECR A;  4TKT A;  2HK2 A;  1RA7 A;  3KOA A;  2E5L F;  3M8P A;  4G1P A;  4CO0 A;  3MM9 A;  1NJZ A;  1UW9 A;  3M8S A;  1RTI A;  4Q8F A;  5K20 B;  4ZVG A;  2R2S A;  4YP3 A;  3C16 B;  2ZC3 A;  3PAC A;  3Q2S C;  3LP0 B;  2IM3 A;  2XLI A;  1WF1 A;  3J7Z T;  2B6A B;  3UNG C;  2E5H A;  3UR0 A;  3ILO A;  3THV A;  3KJQ B;  4PXE A;  3J81 U;  1WOR A;  2M2B A;  2RIL A;  3E8O A;  1F60 B;  3AHP A;  3AJD A;  5C5J A;  5EUH A;  4R8U B;  3GPA A;  5K8P A;  1UP1 A;  2K2P A;  3RUB L;  4D3H A;  2XMM A;  5A8K B;  3BEG B;  3OHA A;  5C42 B;  3NL0 A;  1NCL A;  2C2K B;  1S6O A;  3PKY A;  2HHV A;  1TK8 A;  4F0K A;  2XC9 A;  2RHQ B;  4DN9 A;  1TL4 A;  1QUV A;  1UFW A;  3N6L A;  3CTR A;  3KLG A;  1BWV A;  2CPJ A;  4OHX A;  3MF5 A;  4ZK7 M;  3MAQ A;  3VQS A;  3R5B A;  2GZO A;  4JI7 J;  3BR8 A;  2GX8 A;  1FCA A;  4IQM A;  1K73 T;  1JLC A;  1S1V A;  1X4A A;  2ZBC A;  2YKP A;  1TL3 A;  3AXM A;  3FZB A;  4O3S A;  3Q22 A;  3OTO J;  2G1H A;  3G96 A;  2AJ1 A;  5L39 A;  3R5A A;  4JI8 F;  3M8Z A;  4WYL A;  5FLX U;  3DRS A;  2CJQ A;  4UST A;  4JI1 J;  2F40 A;  1O8B A;  5HMX A;  4KR0 B;  4FF1 A;  2BE7 D;  1Z1Z A;  2N3O A;  3C15 B;  3MED A;  4ZCM A;  2ACM A;  1HAR A;  4B9T A;  4S0M A;  4CLU A;  3CC2 S;  2DIT A;  2Z2Z A;  1UCN A;  3R1H A;  3DLG A;  4AXJ A;  4F4A A;  4QWD A;  2ZJP Q;  3RB0 A;  3KLV A;  2XO6 A;  2IAJ B;  3AQP A;  3HSZ A;  1KC8 T;  5SUH A;  1OQ3 A;  5F8H A;  2J9D E;  3V4M A;  1FXR A;  2RU9 A;  4X4V A;  3LQV A;  2V8D A;  3GG1 A;  2AKW B;  7FDR A;  2DRD A;  3BN4 A;  1RZM A;  1VQ9 S;  2IRX A;  3MM8 B;  4X4P A;  1XR5 A;  1WI6 A;  4ECQ A;  1QSY A;  2VPX B;  4L6V 3;  4UY8 5;  2OEJ A;  5KFM A;  2EK6 A;  3EZO A;  2PEB A;  2AJ0 A;  5DQH A;  4QIW D;  2HMI A;  2UXC F;  2IMW P;  4P74 A;  2E1M C;  3SDE B;  3TQ1 A;  4PG5 A;  1OSD A;  1X5O A;  2YKQ A;  4PWD A;  3ONQ A;  3BQ2 A;  2JLE A;  4B9M A;  3QRP A;  3PEJ A;  3IM8 A;  4DPW A;  3NS7 B;  3RB6 A;  2V2Z A;  4FN5 A;  4UY8 T;  4NA3 A;  4ZIW A;  4HHH A;  2R7U A;  3KJV B;  4DWI A;  3ZTR A;  3GLJ A;  2QFI A;  1JNR B;  4QU6 A;  2HIQ A;  5IV4 A;  3MEE A;  4KKO B;  4URG A;  3NCQ A;  5E3Q A;  3MR6 A;  3EGW B;  2QG9 B;  3MR3 A;  1H73 A;  2DO0 A;  1CJU A;  5DZ7 A;  2A0F B;  2V0N A;  4KC5 A;  2BOP A;  3IR5 B;  2HG4 A;  3P45 B;  5F8J A;  3BGR A;  1WG4 A;  1XMO F;  3MOZ A;  1CJK B;  4YS2 A;  1JLF A;  4Y2M A;  1A0O B;  4ANC A;  2XSJ B;  3BDP A;  2FJX A;  3EE3 A;  2VH7 A;  2FYX A;  5CH7 B;  2MHE A;  2R7X A;  1FDN A;  2RDJ A;  4UZB A;  4KFB A;  4PR6 A;  4LF7 F;  3MMA B;  4WII A;  2RIJ A;  3HHD A;  5IXU A;  3S7R A;  3FMW A;  4CLK A;  4DQQ A;  3M8Q A;  2CA9 A;  4MKB A;  3OBI A;  2QX0 A;  1VQS A;  3HD1 A;  3QGH A;  1RYR A;  1TVR B;  2AEJ A;  1RT5 B;  3RAQ A;  3QLH A;  3HHL D;  2R7R A;  3DYA A;  4J9K A;  1WOS A;  3NAH A;  3NS6 A;  3DRP B;  2VF3 A;  2DR8 A;  1PG5 B;  3T5H A;  4NLQ A;  4RUH A;  1TZ0 A;  1S48 A;  1NAQ A;  5KFK A;  1SXL A;  3WHI A;  1CJT A;  4M8L A;  1Y3K A;  4B02 A;  2HAI A;  3C6U B;  2V8P A;  4M5H A;  4DDF A;  2FHM A;  3TX0 A;  4IG3 B;  4LSN A;  3KMQ A;  1YHQ S;  3SQG A;  5D77 A;  3LA0 A;  1F5A A;  4KBI A;  3G87 A;  1Q81 T;  4ETX A;  2VFT A;  3PG9 A;  1WC1 A;  5CHC B;  3MXH P;  1IQT A;  2RE1 A;  4ES1 A;  3CME S;  1XWL A;  4C3K A;  2XGQ A;  4EU0 A;  2Y1R I;  4KO0 B;  3TA2 A;  2HS4 A;  1NM2 A;  4A48 A;  1GAO A;  3HF5 A;  3I4H X;  3EIC A;  2CQ4 A;  4YOE A;  2NLW A;  1KKH A;  4WU2 A;  1FJG J;  4JI7 F;  2W4P A;  4OZ0 A;  3ISN C;  5B09 A;  3MMB A;  1VJW A;  1SJ4 P;  5IM0 B;  3AAW B;  3BR9 A;  2YNH B;  4JI4 J;  5KFW A;  4OZ2 A;  4A8Q A;  2HQD A;  4WFB Q;  1X0F A;  5MLC V;  4C11 A;  1O51 A;  3OVS A;  1BQN B;  1FRM A;  4EZ9 A;  3ADA C;  2MJU A;  1P9Y A;  1GFW B;  3EDQ B;  3MI7 X;  5I3Q A;  3BPD A;  1H7W A;  3T1Y J;  3JYT B;  1OY6 A;  2Z2Y B;  2KB2 A;  3R6G B;  4M95 A;  1RHQ B;  4ED5 A;  3BKU A;  5A6W A;  4WP3 A;  2HQI A;  1I3O B;  2QRR A;  2LYV A;  4RW7 B;  1NK5 A;  4Q2M A;  4F4Z A;  5B0A A;  5HAT A;  2PI5 A;  2UUW A;  5EGY A;  1R0A A;  5KFT A;  4IFY B;  3S6E A;  5KG1 A;  4BCA A;  3QMQ A;  3FEZ A;  3ETM A;  2C2R A;  2DRA A;  2OJ3 A;  3R7N B;  4OI3 A;  1S9G B;  4OLO A;  2XNR A;  4ED3 A;  5LMU F;  3MWB A;  5KFB A;  4F4W A;  2R8J A;  4U67 Q;  2FVC A;  4XAK A;  2W8K A;  2N7C A;  4BC9 A;  2XZW A;  2BQ3 A;  3ENW A;  3TZY A;  1GXT A;  3ENV A;  5CYQ B;  1GT8 A;  1HR0 F;  3DOK A;  2XMK A;  4DFP A;  1C4C A;  3NG8 A;  1OQ6 A;  2E44 A;  3AY0 A;  4FF2 A;  3PW5 A;  2HWH A;  2KDO A;  3CJS A;  1CS4 A;  1VS3 A;  1FRL A;  5KFA A;  1S97 A;  4N77 A;  4DG1 B;  4RBV A;  1XMQ F;  4B3T F;  2VJU A;  2GW8 A;  4OZ5 A;  2P2C B;  4HH1 A;  1FEH A;  4KE5 A;  2OIH A;  3GV7 B;  2LQ9 A;  4J9Q A;  2GIF A;  1WHY A;  3NKY A;  1RWU A;  3P49 B;  3G6V A;  2LEA A;  4OHV A;  1DY3 A;  1N88 A;  1RHR B;  5KG6 A;  5ETS A;  4OYM A;  1N34 J;  3I0R A;  3W60 A;  2KG1 A;  2UUA J;  4CDI A;  4N56 A;  2ZJR Q;  8AT1 B;  2QA4 G;  1P9Q C;  4IR9 A;  4PWW A;  2ZHB A;  3OPK A;  1N5V A;  3K57 A;  4HDG A;  2F8E X;  5EX0 A;  3PRD A;  3ZTP A;  1FJC A;  4NEZ A;  1JNZ B;  2UP1 A;  1KVJ A;  1BQM B;  4QQB A;  1NRK A;  3AXK A;  2WOM A;  2CZV C;  4D3G A;  4DJB A;  1BGX T;  2FJA B;  2QMU B;  2JRS A;  3HLU A;  1FNX H;  4X65 J;  2I9S A;  3T5L A;  5U47 A;  1C2P A;  4X62 F;  2UU9 J;  1BWE A;  2MLX A;  3MUT P;  1RWM B;  1U8S A;  2YKO A;  2I5J A;  3UD3 P;  4KT0 C;  4Q0B B;  1Q5V A;  2AX1 A;  1YWX A;  4KGX B;  1DQA A;  2DRB A;  1CQM A;  1CG2 A;  1DTQ B;  4PUO A;  2AZ1 A;  4MAK A;  2HBR B;  4K4S A;  2DNP A;  2DJW A;  2ZH3 A;  2HK3 A;  4FXW A;  2EPI A;  4OYP A;  2J7W A;  3SSQ A;  1JLG A;  4OI4 A;  2HVI A;  3IRX A;  2HNZ B;  2HZC A;  3ZFV A;  1LOU A;  4PAB A;  2HHW A;  1Z2Z A;  4OZL A;  3I5B A;  4GO7 X;  1RAB B;  2UZA A;  4I68 A;  4CLY A;  4W98 A;  1AFI A;  3H5X A;  3CO0 P;  4C8L A;  2MST A;  4J90 A;  4M5L A;  3FNN A;  1ZZF A;  2HND A;  3UDL A;  2WAQ D;  1NBE B;  4OX9 J;  5K5M A;  3SV4 A;  4U9R A;  1MNE A;  4FF3 A;  1X8D A;  1RT3 B;  2XEX A;  3LP1 A;  5HLF A;  4YN3 B;  3I9Z A;  3M8Y A;  3H90 A;  1FJG F;  2DCL A;  2OLW A;  3BO4 A;  3O8W A;  2F4V J;  1GMW D;  1UFL A;  3DM2 A;  1Q7Y T;  2EFP A;  2Q6B A;  3WZ0 A;  2ZUG A;  3J80 U;  1S7I A;  1PAE X;  3RAX A;  4OI2 A;  4AQY F;  3FZ2 A;  3PHT A;  4ZVT B;  1Y0H A;  1R8H A;  3OFE A;  1HNV B;  3WC0 A;  3HVT A;  3W8P A;  1IBK J;  4RU9 A;  4QYZ J;  3DRX A;  1QTN B;  4R5P B;  1IBL J;  1RT2 A;  1MU2 A;  1HNX F;  3QGP A;  4RU2 A;  1HPZ A;  4QW9 A;  2V8V A;  2G9O A;  4KHM A;  2YTC A;  4USV A;  4QR2 A;  3H98 A;  1G6B A;  2DR5 A;  3GZ7 A;  3WC2 A;  2X3G A;  4QIF A;  2ZFH A;  3DLB A;  1S0O A;  2Q79 A;  1JJ4 A;  2VFV A;  3LOU A;  4HTJ A;  2WZ1 A;  4NXM J;  4FP9 A;  5BYS A;  4ENO A;  2F4F A;  3DMJ A;  2LFV A;  3AOC A;  2OUG A;  3CMQ A;  1H38 A;  2DH8 A;  2CVE A;  3QJP A;  1RTJ B;  4P7T A;  2HNY B;  1KLM B;  3R5C A;  1SIZ A;  4U8Y A;  4MTP A;  5AXL A;  3NP5 A;  4JYA J;  5IV3 A;  2BOA A;  1NME B;  1SCJ B;  2DNL A;  5ADZ A;  1J5O A;  3I6P A;  4NI2 B;  1TK0 A;  3LP2 A;  3H25 A;  2DNN A;  3GR0 A;  4FBU A;  1RYS A;  4UOH A;  2XHW A;  4BHQ A;  4CO4 A;  3J7Y I;  3H2L A;  2KYZ A;  2V69 A;  3HZG A;  3Q8V A;  1ZAV A;  2D3O 1;  3R27 A;  4HT5 A;  4LVO P;  5AE2 A;  4RW8 A;  2HGM A;  4WTO B;  3DRR B;  1VQ6 S;  2KT5 A;  1YJT A;  4OMF G;  3V6D B;  3W2W A;  2DHX A;  3BF4 A;  3OL7 A;  2QLJ B;  3BB5 A;  2J9E A;  3LO3 A;  3ZXW A;  1IKW B;  3C2P A;  2B9X A;  4CZC A;  2PI4 A;  4LR8 A;  1KHW A;  5D78 A;  3T19 A;  2JEF A;  5KT3 A;  4DPO A;  4USU A;  2RNE A;  3GYX B;  1NZA A;  4LRE A;  2DHS A;  4LBP A;  3HHL A;  4WZM A;  2HBZ B;  1C1B B;  3OV7 A;  4EMD A;  1U0H A;  2XLJ A;  2IVY A;  4WIQ A;  1VGY A;  2F9D A;  2QA4 S;  1RI7 A;  4DFJ A;  2CPI A;  2MKI A;  4QYR A;  3POT A;  5DQG A;  2W9A A;  2JL9 A;  1O5J A;  2VG6 A;  2V9W A;  2VBY A;  3W2V A;  1RBA A;  1SBR A;  5D4N A;  3VZH A;  3CCE S;  2ZBQ A;  5ETP A;  3HHN B;  4O4R A;  2HZV A;  1FKO A;  1IWG A;  3KLF B;  4ZHR A;  1NDK A;  2H4Y B;  2PN6 A;  4GVB A;  2W8L A;  1KRP A;  2YH0 A;  3AA8 A;  3QFH A;  1RT6 B;  3M7V A;  4O3Q A;  1HBM B;  3IP0 A;  3ET6 B;  3R3T A;  2UU9 F;  1X5P A;  1HNW F;  2YY3 A;  2N3L A;  4F4K A;  3NGS A;  4YR3 A;  1Z4U A;  4J5O A;  4EI2 A;  2W1B A;  3W63 A;  4ZCI A;  2IM2 A;  2W4D A;  4JP8 A;  2GNK A;  5A8R A;  2G2Z A;  4OX7 A;  1N36 J;  3BO2 A;  4LSZ B;  4I7F A;  4BDP A;  4Z7C A;  3PYF A;  3ISZ A;  5G4D A;  1TUV A;  2OMO A;  4N8N A;  3BV8 A;  2H4W B;  2FGC A;  1PIE A;  4UF4 A;  2E5J A;  3JXO A;  3D7S B;  3UPF A;  4LFB J;  2VOD A;  1X4E A;  2Z56 B;  3M6U A;  1CC7 A;  1OYD A;  4OX9 F;  4FYD A;  3CMA S;  3V6K A;  4DR7 J;  5T7L A;  1RE1 B;  4G3I A;  2E7V A;  4EYI B;  2HHH J;  5L1J A;  3MM6 B;  3G6X A;  3OLB A;  2QZ8 A;  2R8H A;  3PR4 A;  4OZN A;  4FVM A;  2XS2 A;  5DDR C;  3TVZ A;  3DDK A;  2F4V F;  3OXF A;  3L3C A;  5AT1 B;  1TP7 A;  4PPZ A;  2EG1 A;  3UN2 A;  2PMW A;  2V34 A;  4G6V B;  2JFK A;  4F36 A;  2C2N A;  1N54 B;  3CB4 A;  3A3O B;  3FC9 A;  1D8Z A;  1NPK A;  1N5Y B;  1E6V B;  3Q2T C;  3LPY A;  2W01 A;  2B9E A;  3NCR A;  3IGN A;  4ZP6 A;  4P7V A;  1GTH A;  3G86 A;  3C16 A;  3VCD A;  1QD1 A;  4IRK A;  1H7X A;  3UFC X;  3LP0 A;  1PC4 A;  3PJX A;  4DF8 A;  2ZDO A;  4RW4 B;  5L46 A;  2B6A A;  3VZI A;  4LF5 J;  1NK9 A;  4RJV A;  3THP A;  2HHX A;  5B0G A;  1SC3 B;  4WXW A;  4TY8 B;  3TA0 A;  2BAN B;  3D6M B;  5K14 B;  3U1N A;  4R8U A;  1ITP A;  3O44 A;  4OYA A;  3B82 A;  2KO1 A;  4CM2 A;  1X4C A;  2A3J A;  2MTL A;  4A8Y A;  4M5M A;  4A8O A;  2QGF B;  3CED A;  4KV8 B;  5A8K A;  3W61 A;  4WPA A;  5E2Q A;  4ED4 A;  2YPZ A;  5C42 A;  5LSL A;  1JXL A;  2J9D A;  3ITH B;  3GP9 A;  4I2P B;  4JYA F;  4JBC A;  3QZ8 A;  3CCM S;  3RTV A;  2HZA A;  4C3L A;  2XSF A;  3TEH B;  3R2C J;  1AUS L;  4DF4 A;  4NL5 A;  3OTE A;  4JI6 J;  3IR6 B;  4ZP7 A;  3OL6 A;  1S1T B;  1BD6 A;  3I0S B;  4JI2 J;  1K0V A;  4PXD A;  2W2P P;  3BSC A;  1R8C A;  4AL7 A;  2F7V A;  2ZE2 B;  4M5D B;  2BV3 A;  2HS0 A;  3BS9 A;  4RL1 A;  4ZS6 A;  4ZLP A;  3IGV A;  2FTR A;  2LXI A;  1KTQ A;  4OZ1 A;  4GKJ J;  4O3R A;  3KJF B;  4Y34 A;  4OLP A;  4KYZ A;  3HT3 A;  1U02 A;  3I82 A;  1JB0 C;  2MQO A;  3JB9 k;  4MKA A;  3C15 A;  3BYR A;  3OUY B;  5THW A;  5E3A A;  5EDW A;  5BR8 J;  2BAB A;  4JI3 F;  4Y2I A;  3H2U B;  4DX5 A;  2HFN A;  1ZET A;  4KPC A;  4X64 J;  3LGH A;  1FER A;  1PJ6 A;  5J1P A;  1KQG B;  3DGP B;  3CJK B;  5B0D A;  2IAJ A;  1IR1 A;  1W26 A;  1WDD A;  1PC5 A;  4ED8 A;  3FSX A;  3MR5 A;  1FD2 A;  4F0M A;  4UOG A;  2YPY A;  4P9S A;  3W1Y C;  3PKM A;  5K8N A;  1L3T A;  2EBE A;  5DG8 A;  1I6J A;  2AW0 A;  2VG7 B;  3MM8 A;  2BBE A;  3CJ8 A;  4OI0 A;  3WX4 A;  1KQS R;  2J8S A;  3K5M A;  3X1L B;  3SDE A;  3AD9 C;  1EZZ B;  3KLH B;  5CA5 A;  1M1K T;  4KAI A;  1OY8 A;  4C0H A;  1NU4 A;  2HYI B;  4HKQ A;  3NOG A;  4QYZ K;  1GMW A;  3R9L A;  2AYE A;  3N01 A;  1RP5 A;  2RML A;  1BXN A;  3KJV A;  1N36 F;  2HFS A;  2V6A A;  3GV8 B;  5LSO A;  3NXZ A;  2U2F A;  2J76 E;  3P4U B;  4KKO A;  1RSC A;  3Q8U A;  1V9O A;  3BN7 A;  1LW2 B;  3DOL B;  1RTH B;  4ZLJ A;  2QC3 A;  1FJ7 A;  2C1E B;  3EVM A;  1RAA B;  4JV0 A;  2CKW A;  4CM0 A;  4DV3 F;  4DV0 J;  4LFB F;  2XWX A;  1CJK A;  3A8I A;  2CPY A;  4MYT A;  4PYD A;  2VC0 A;  2RD5 C;  2XSJ A;  4DR7 F;  1SB6 A;  4QPX A;  2VQF J;  1O0P A;  3SMZ A;  3PNI A;  2FJE B;  3RYL A;  3U02 A;  2C2D A;  2FJB B;  4DV1 J;  1MWQ A;  1YDL A;  3MMA A;  4XO0 A;  4Y28 C;  4DV5 F;  4MMO A;  1IM6 A;  4JV1 A;  5FD1 A;  3I55 S;  2IM0 A;  2P6S A;  3AJ1 A;  1FRJ A;  3IXQ A;  2IHR 1;  3UD4 P;  5HO4 A;  2K8G A;  2AYM A;  2GGP B;  1VCT A;  1FEE A;  2RQC A;  5KFI A;  4XIU A;  4JI0 J;  2FUG 9;  2GJ2 A;  2RB7 A;  3HUL A;  5KFX A;  5LOQ A;  3DHX A;  1TVR A;  4ZJO A;  1RT5 A;  5KFZ A;  1ACM B;  3UCU P;  2J5A A;  2MKH A;  2CQH A;  2VBX A;  2QLX A;  2X1G A;  3JSM B;  1YQH A;  2FVP A;  4KSE B;  2CQI A;  1SJR A;  3DRP A;  1S9F A;  4WF9 Q;  3L95 X;  4W90 B;  2OD6 A;  1JKH B;  1SH3 A;  1GNK A;  5H1S V;  3F44 A;  2NQP A;  4M1K A;  2M7S A;  4OX6 A;  3C6U A;  1RAG B;  2DXD A;  2QA1 A;  4IG3 A;  4DV2 F;  3BSN A;  2DNR A;  4TLQ A;  3QAE A;  4PRF A;  5A0Y B;  5K8M A;  1SKS A;  4KJI A;  2CDQ A;  2BX6 A;  3MFI A;  1FWK A;  3TVK A;  5HQL A;  1NND A;  3N9U C;  2LA6 A;  5IC6 B;  1D9F A;  2OO4 A;  1XNQ J;  4LRF A;  2J0S D;  4KO0 A;  1XJW B;  4CH0 S;  2YKA A;  2W7O A;  3B54 A;  2KG0 A;  3M4X A;  4WFZ A;  4J9P A;  1VQL S;  1AFJ A;  1FO1 A;  5KT7 A;  2F63 A;  4EK2 A;  1IR2 A;  1P27 B;  4I67 A;  5IM0 A;  1KS2 A;  2YNH A;  3PM9 A;  4UQT A;  4ZVH A;  3R7S B;  3CIZ A;  2KT2 A;  3OL9 A;  3DC2 A;  3MMJ A;  4WP9 A;  4NLV A;  2MZ1 A;  3VV2 B;  4ALZ A;  2P6T A;  3PYE A;  1BQN A;  2NYI A;  2XWY A;  3FGV A;  4X84 A;  3M6W A;  2AZ3 A;  3JYT A;  4M94 A;  1BLU A;  3LWM A;  2HBQ B;  3RRG A;  3BDE A;  2PEH A;  1QSS A;  2F8M A;  4A8S A;  1FNM A;  1RWX B;  4USK A;  5C25 B;  4RW7 A;  3TOQ A;  2OGU A;  3PIP Q;  2MKC A;  1CVJ A;  3P6Y C;  1DTT B;  4IOA Q;  4IFY A;  1HW8 A;  3ZO7 A;  1Q79 A;  3TUZ C;  1TFW A;  1S9G A;  3JTO A;  1DAX A;  2BZ2 A;  5IT9 U;  5KT5 A;  4LF8 J;  2EK1 A;  1UW4 A;  3BZQ A;  3FFI B;  2DGT A;  1Z2L A;  3MHY A;  2Z2M A;  4NCG B;  4P72 A;  2AEF A;  1TTH B;  6FD1 A;  2DXE A;  2PA8 D;  4C2M A;  5CYQ A;  2ZH9 A;  3C3L A;  5EX3 A;  2DIS A;  1KR4 A;  2B7B B;  4NX9 A;  1RKI A;  2RH3 A;  1TK5 A;  3FEX B;  1R0C B;  4OL8 A;  4MK9 A;  1X9W A;  4V19 X;  2OD4 A;  3T6J A;  1UPP A;  4RW9 B;  1YK9 A;  2BUN A;  3MM7 B;  4NML A;  2AU0 A;  4OZJ A;  3KHL A;  3TAQ A;  1T7P A;  3GMG A;  4DG1 A;  4DR2 F;  3HMJ G;  3KNA A;  4ICL B;  5AJ3 F;  4DUT A;  3MZI A;  2UUC F;  2DNH A;  1WSV A;  2MQQ A;  3RBE A;  1XTZ A;  1X0P A;  2DIV A;  3A4T A;  4B9V A;  1W2I A;  3E51 A;  3M05 A;  2DNM A;  4F67 A;  3LF0 A;  3OVA A;  4C4W A;  1YBA A;  3RB3 A;  2IA6 A;  3D4J A;  4FVC A;  2FVR A;  2I6W A;  3LW5 C;  4PG7 A;  2B56 A;  2HLU A;  4DFM A;  1FE0 A;  1TKD A;  2K3I A;  2G2O A;  3IC1 A;  1W2B R;  2VQF F;  2R8I A;  2XZT B;  4ZPC A;  2Y1J A;  3NWR A;  3IBC B;  4B3M J;  4FYV B;  1NK6 A;  2BJD A;  4O0N A;  2NCK L;  5KFD A;  5B0E A;  1BQM A;  4XTT A;  3QID A;  4QBU A;  3JSY A;  4PKD B;  4WFA Q;  2EC0 A;  3UI3 A;  1VRQ C;  5H9F J;  4YQW A;  3DLK B;  5GAH U;  1YX2 A;  3R8Y A;  4LR7 A;  1U0S A;  2XGP A;  3W9J A;  4UUX A;  3LTO A;  4WK1 A;  1R43 A;  2LU1 A;  1YGY A;  5D15 A;  4CO1 A;  4A4J A;  4Q0B A;  4KH0 B;  5I4M A;  4IOB A;  5KG2 A;  2IY5 B;  2VG5 B;  2HRU A;  3GYG A;  2CQ0 A;  2VA2 A;  1DTQ A;  1VRU B;  3M32 B;  4P10 A;  4JI5 F;  3UW1 A;  5CCM A;  5KFY A;  3HPO A;  4LQ9 A;  3P3D A;  1UWA A;  4L3N A;  3EMT A;  3CO9 A;  1L3U A;  4FDF A;  1T03 B;  2Z4P A;  2J6S A;  2HNZ A;  3OR1 B;  4QWE A;  2RRA A;  2G0C A;  2LQ8 A;  1Q82 T;  4IQX A;  2DY9 A;  2LP4 A;  1VBZ A;  2C22 A;  2FB0 A;  4WP8 A;  5HMZ A;  2XYG B;  2BE2 B;  3QGG A;  5HJX A;  4CRJ A;  2ALY B;  3T3F A;  2VKR A;  2IVM A;  1JK9 B;  2WVD A;  1JLE B;  1RBL A;  4PPD A;  3V6H A;  3OFH A;  1RT3 A;  4TU7 A;  2LXF A;  3D0G E;  2WRM A;  3CCQ S;  2RS8 A;  2UUB F;  2P9E A;  2JLF A;  1Q5Y A;  4CLS A;  3DXS X;  3DGV A;  1MMN A;  2JEG A;  1K44 A;  2ADC A;  2UV8 G;  1IBM F;  3CGI A;  1FNO A;  2RUS A;  2GO8 A;  1HBN B;  4DV4 J;  1J5E F;  4NLS A;  4N8O A;  4YR0 A;  1MG7 A;  3PV8 A;  3TAN A;  4X4N A;  4DL4 A;  1YJ9 S;  3PX0 A;  1VYA A;  2XNQ A;  2QO3 A;  4B08 A;  4DQS A;  4K50 A;  1HNV A;  1C1C B;  4NLW A;  1F0X A;  2HEK A;  5EHH A;  2UXD J;  2C3P A;  1VQN S;  4K0K J;  4QOT A;  1XNR J;  5KFC A;  1FX4 A;  1RJJ A;  1HA1 A;  4R5P A;  2MQP A;  2CQ1 A;  3MTJ A;  3LPE A;  1SJ3 P;  3A8K A;  1ZBT A;  2W7P A;  4YB6 A;  1VBX A;  4NRU A;  4X4O A;  1MN9 A;  1UEV A;  1FDD A;  3W7B A;  4NLY A;  2P9C A;  2AGO A;  1T8E A;  5ETL A;  2UXB F;  1F6T A;  2OPR B;  2A2D A;  1Y5N B;  2FD2 A;  2W24 A;  4LFC F;  3HJV A;  2ZH5 A;  4LRB A;  2XBP A;  2W9B B;  1S49 A;  2CNK B;  1RTJ A;  4PWU A;  3NGR A;  2HNY A;  2KH9 A;  1AXQ A;  1Y3J A;  2E1R A;  2FLP A;  1KLM A;  1SV5 B;  2GFF A;  3OLA A;  1VBY A;  5F8M A;  2YWG A;  1N0V C;  1WEZ A;  5B0B A;  4WTY A;  2HHP A;  4NI2 A;  4LF4 J;  4DR6 F;  3CE8 A;  3K59 A;  4ECW A;  2L9W A;  1RT1 B;  1U8W A;  3EJM A;  4ZVF A;  4G1Q B;  5A76 A;  1APS A;  4H4K C;  2B8P A;  4QPT A;  5GAH I;  3UN3 A;  1M5V C;  4GKK F;  3T9Z A;  1ZTW A;  3M9M B;  2DR7 A;  1IJE B;  4Q5V A;  4EO6 A;  3DRR A;  5F9L A;  2ZWO A;  3V6D A;  2EBG A;  3RW7 A;  1LWC B;  1MMD A;  2CJY B;  4M5G A;  4NLR A;  1IKW A;  4ZDN A;  5IS2 A;  4IKA A;  5I3P A;  5DGB A;  5BXI A;  3VR1 A;  2OSR A;  2CVI A;  2OSQ A;  5ETN A;  5HVF A;  1C1B A;  4JUZ A;  2KN4 A;  1NK0 A;  4RNN A;  3QFW A;  2ZOF A;  3OTB A;  2I8E A;  4V1A k;  3MFH A;  1GMV A;  4TLR A;  3Q8Y A;  1SPB P;  1VQ7 S;  1RBO B;  2MSS A;  1VQY A;  4HYK A;  4NCA A;  1QAJ A;  5K9F A;  1UJ5 A;  3D5M A;  4OIX A;  2FGO A;  1S9E B;  4MIA A;  1U25 A;  3KK3 B;  3KLF A;  1X4H A;  3QWU A;  4ES3 A;  3HK2 A;  3BGO P;  2DT9 A;  4MH8 A;  3H5S A;  2PD1 A;  1FWP A;  3R97 A;  3CF5 Q;  5KFE A;  4UOF A;  2BKP A;  1RT6 A;  4PZV A;  2RRN A;  3IA0 A;  1HBM A;  4FS2 A;  3ET6 A;  3W5Y A;  3OD2 A;  1M0S A;  2KFN A;  1NHK L;  2VD3 A;  1WKJ A;  2CJ9 A;  1B7Y B;  3FQK A;  3AD8 C;  3QSI A;  1HL6 A;  3B4D A;  1OYE A;  4DL0 C;  1N6Q B;  1QY7 A;  1OO0 B;  1K47 A;  4ETZ A;  3NY0 A;  1XMB A;  1Q8I A;  2B7C B;  3KFW X;  1AUD A;  1Q4R A;  2YWW A;  2MEW A;  4WJB A;  3KK1 B;  4DQI A;  1VBK A;  1NO8 A;  1GQE A;  4E98 A;  2AJ2 A;  2M4M A;  3VAH A;  2M70 A;  1NPR A;  1I94 F;  4DV7 F;  2BMB A;  3BGU A;  1NPP A;  1URR A;  2VHG A;  2XMJ A;  2YWE A;  1UVL A;  3DHW C;  5DRK A;  2RU3 A;  2IPO B;  4B3O B;  4UT4 A;  6AT1 B;  2HGN A;  1WHV A;  2G0I A;  5JVG Q;  1UZH A;  1R8P A;  3G82 B;  3MM6 A;  3W65 A;  2CUY A;  1HFE L;  1R8B A;  1ZA2 B;  1FRK A;  1HQE B;  3A3P B;  1WNE A;  3RBD A;  2XMU A;  4BBY A;  1JMT A;  2JVO A;  4NZ6 A;  4DV6 F;  1ZA1 B;  2JOQ A;  4YME A;  3TR5 A;  2YH1 A;  2FC9 A;  2MQL A;  4CH1 A;  3GU0 A;  2IIH A;  1SIW B;  3MEG B;  1A9N B;  4F2R A;  1UET A;  3RG6 A;  4J9O A;  3BKF A;  1N5Y A;  4I6A A;  1E6V A;  3TNV A;  4C8N A;  1X4G A;  4ZMM A;  5A2Q Y;  2QE5 A;  1HHQ A;  2V4J B;  5KG7 A;  3P8B B;  3UQS A;  4LF1 A;  5F3T A;  3Q8Q B;  4DR4 F;  4RW4 A;  2R7V A;  1N48 A;  3HHE A;  1TV6 B;  4L72 B;  4DL5 A;  4TNO A;  1HMV B;  2CG4 A;  2H9Z A;  2FPH X;  3C6T B;  3PRV A;  4RR5 A;  4TY8 A;  1SKW A;  3G8Q A;  3NRB A;  2BAN A;  5K14 A;  1SQF A;  3HCX A;  4LF2 A;  4P73 A;  1N5S A;  4FXV A;  5J2Q B;  4NLU A;  3QT8 A;  2DHA A;  4B3R F;  4KV8 A;  3T9N A;  1FI4 A;  2MLY A;  4ECS A;  1H72 C;  1HKA A;  4O3N A;  3NNA A;  2BXJ A;  2VC1 A;  2NRE A;  3ITH A;  4I2P A;  3TZW A;  3M6V A;  2Z57 B;  1UA0 A;  4X4S A;  4KGZ B;  5ETV A;  5I42 B;  3A12 A;  1WG1 A;  3R5J B;  3ENA A;  3RJM B;  2RDD A;  5CAA A;  2XCP A;  1FKP B;  2E9R X;  2FHO B;  2D41 A;  1KQK A;  4OJ1 A;  4K4V A;  2WBM A;  1S1T A;  3IAM 9;  3I0S A;  1Y7P A;  1EX8 A;  1N8R T;  1RCO B;  1RU2 A;  1MWY A;  2ZE2 A;  4TVA B;  4M5D A;  1S7H A;  3PVX A;  3PW2 A;  4QWB A;  3CJT A;  2LQ5 A;  3GJQ B;  4RLE A;  4EWT A;  1FXD A;  2CPZ A;  2H65 B;  4I6Y A;  4F3Q A;  1S6Q B;  2J0W A;  1PGZ A;  2RHS B;  2DB1 A;  2PFF B;  2JX2 A;  3F56 A;  2F5G A;  2WW8 A;  4C8Z A;  1VQ8 S;  3W5Z A;  3J81 Y;  3KYL A;  3HVA A;  3OUY A;  4L75 A;  1R3N A;  3FJ2 A;  4ZCK A;  4BWM A;  2MYF A;  1H74 A;  1FDB A;  3GIL A;  3BYP A;  2HFZ A;  3DGP A;  2NUH A;  3CJK A;  4URQ U;  4X4Q A;  3PCO B;  3OT9 A;  2MZJ A;  2HHT A;  4ANE A;  1JJH A;  1NHU A;  3CXC R;  1H3D A;  2KT3 A;  2HFV A;  3MCS A;  4DSJ A;  2BE9 B;  2VG7 A;  1U1Q A;  5AXN A;  1LFW A;  3EXY A;  3H42 A;  3UE2 A;  1RWV B;  1JXV A;  1YJ7 A;  2E1A A;  3KLH A;  5HBM B;  3KUG A;  1WTF A;  3U7J A;  2CAD A;  5FLX Y;  1NK7 A;  1V5I B;  1QM9 A;  2J7U A;  4O23 A;  2YKM B;  3P5T L;  1F9E B;  3GIR A;  1F3F A;  1K0T A;  3VQT A;  2ZEJ A;  2CPX A;  2F9J A;  3H8Y A;  2GVD B;  4Y0F A;  2H3E B;  2W7A A;  2IYG A;  2QLF B;  2FVS A;  4F8R A;  2A10 A;  1BHN A;  4NAS A;  1R6Y A;  4OHZ A;  2D3U A;  2V2K A;  2QJ3 A;  4CQ1 A;  3UNY A;  4IR1 A;  3GIM A;  2Y3Y A;  4AE5 A;  1LW2 A;  3DOL A;  1JJC B;  4PQU B;  1RTH A;  5ITH A;  2XY6 A;  4ZPV R;  1C0T B;  3W64 A;  5DDO C;  2GS8 A;  4LRA A;  3J7Z 5;  4FZV A;  1QLN A;  4DQR A;  2W2Q P;  2ZKU A;  2CQP A;  4E8U A;  5E5N A;  3ZZT A;  1V3R A;  4WYW A;  2V9K A;  1D0E A;  3TZZ A;  2XS5 A;  3AT1 B;  1T94 A;  1ZTT A;  2AGP A;  4ECY A;  1UEK A;  1EET B;  2KFY A;  4K2X A;  5KFV A;  3Q23 A; 
#chains in the Genus database with same CATH homology
 1B4S A;  1K44 A;  3B6B A;  3BH7 B;  1JXV A;  1NUE A;  1NSK L;  1HLW A;  1WKK A;  3NGT A;  3VVU A;  2BX6 A;  1WKL A;  3PJ9 A;  3BH6 B;  1U8W A;  3EJM A;  4WBF A;  1LEO A;  3ELH A;  1PAE X;  3MPD A;  3EVO A;  1VYA A;  4UOH A;  3EVW A;  1B99 A;  1F3F A;  3ETM A;  3NGU A;  1S59 A;  2B8P A;  3PRV A;  3Q83 A;  3Q89 A;  2AZ1 A;  1NDK A;  4HR2 A;  3B54 A;  3R9L A;  4CP5 A;  2ZUA A;  1HIY A;  3ZTS A;  3Q8V A;  3FBB A;  3DDI A;  3G2X A;  4UOF A;  4AND A;  3Q86 A;  3EMT A;  4C6A A;  2HVE A;  2DXF A;  1BHN A;  3EM1 A;  2HUR A;  3VGV A;  3EIC A;  4S0M A;  4EK2 A;  1NLK L;  3BBC A;  1UCN A;  1PKU A;  4KPC A;  3FCV A;  2B8Q A;  3ZTR A;  4F4A A;  1XQI A;  1NHK L;  3FBC A;  3JS9 A;  3GPA A;  1LWX A;  4FKY A;  1NSQ A;  3ZTP A;  1WKJ A;  2DXE A;  3Q8U A;  4O0N A;  2DY9 A;  2NCK L;  1KDN A;  3NGS A;  5CAB A;  1MN9 A;  1NB2 A;  2VU5 A;  3GP9 A;  5C7P A;  1NSP A;  3VGT A;  3VVT A;  1NCL A;  1BUX A;  3EVM A;  3ENA A;  5BXI A;  1S57 A;  4ANE A;  3L7U A;  1F6T A;  3ZTO A;  5CAA A;  3FKB A;  4UOG A;  3BBB A;  4W98 A;  1ZS6 A;  1NDP A;  2DYA A;  1BE4 A;  2AZ3 A;  3WX8 A;  4F36 A;  4DI6 A;  4ENO A;  3FBF A;  2HVD A;  3VGS A;  3FCW A;  2BEF A;  1NDC A;  3BBF A;  3FC9 A;  1W7W A;  3NGR A;  3FBE A;  1NPK A;  5IOL A;  3ZTQ A;  1XIQ A;  2DXD A;  4DUT A;  4ANC A;  3DKD A;  4DZ6 A;  3VGU A;  1HHQ A;  3EE3 A;  3Q8Y A;  1NDL A;  4FKX A;  1S5Z A;  1EHW A;  2CWK A;  1MN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...