3EVOA

Crystal structure of the mimivirus ndk +kpn mutant complexed with dtdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3evoA00
3EVMA 3FBBA 5BXIA 4EK2A 1S57A 1VYAA 1BHNA 1BUXA 2AZ3A 3Q8UA 3GPAA 1PKUA 4O0NA 1NB2A 4ANDA 4HR2A 3ENAA 3NGRA 1S59A 4DZ6A 3VVTA 2HURA 3Q8VA 3EMTA 1W7WA 1BE4A 4KPCA 5C7PA 1MN7A 2NCKL 1NDKA 4ENOA 3BH6B 5CAAA 3Q89A 2DYAA 2DXEA 1LEOA 4F36A 3VGVA 4DI6A 2HVDA 2BEFA 1S5ZA 3R9LA 5CABA 1XIQA 4C6AA 3EJMA 1NCLA 3ELHA 1PAEX 4W98A 1WKJA 2B8PA 1B99A 2BX6A 3JS9A 3FBEA 3GP9A 1WKKA 1HIYA 3ZTPA 3VVUA 3B54A 3EVWA 3EM1A 3FC9A 1B4SA 3ZTRA 4UOHA 3DKDA 2CWKA 3NGSA 3Q8YA 4WBFA 3BBFA 3EVOA 4FKYA 4UOFA 3ZTSA 1JXVA 1F6TA 4CP5A 1NDLA 4S0MA 2VU5A 3VGUA 3B6BA 3FBFA 3PJ9A 1XQIA 3FBCA 3ZTQA 1WKLA 1NLKL 3FCVA 1F3FA 1HLWA 4DUTA 2DXDA 3BBCA 3VGTA 3FKBA 3ZTOA 1NUEA 1NPKA 4ANEA 3L7UA 1NDCA 3Q86A 1MN9A 3NGTA 4FKXA 3MPDA 1NSPA 2B8QA 3VGSA 4ANCA 2DY9A 1U8WA 2HVEA 1HHQA 1LWXA 1ZS6A 2AZ1A 3ETMA 1NDPA 3G2XA 3PRVA 1EHWA 1NHKL 3FCWA 3EE3A 2DXFA 3Q83A 1K44A 4UOGA 3BH7B 4F4AA 1KDNA 3DDIA 3EICA 3BBBA 1UCNA 5IOLA 3WX8A 1NSKL 3NGUA 1NSQA 2ZUAA
chains in the Genus database with same CATH superfamily
3PYGA 4DL6A 2HRYA 1BHNA 2B4VA 2LDIA 2V9WA 2OO4A 2XEXA 2J9CA 2P9EA 5GVQA 1SJ3P 4ALZA 1NK5A 2AEMA 3TJ9A 2AHOB 4KPCA 5B08A 3CD7A 1BQXA 1S1VA 1RTZA 4ZVOB 4U67Q 2N3LA 1HBMB 5HJYA 1QVGR 3L7OA 2IMOA 3BO2A 4DS4A 4ZN3A 3M6VA 2C2EA 3TAQA 2CWKA 5G0RB 3SQOP 4FKYA 3HVAA 4LREA 2BKPA 5HP1A 2R7QA 1NU4A 2B5JB 2AYGA 4GKJF 4GRSA 1L3TA 2VG7B 4FYXB 3KUHA 2HGMA 4Z2XA 4ANEA 3LH2S 3Q86A 2B6AA 2CJBA 1JB0C 4DSFA 3JYTA 3P4UB 1TVRB 4M5LA 3T5KA 1SV5B 4B3SJ 4C0BA 3BBBA 3BO4A 4QCLA 4N8OA 4OJ1A 4EU0A 2DGQA 2J0WA 1FKOB 3IM8A 2GVDB 5H9EJ 4C8NA 1FRHA 5LJ5Y 3ILOA 2HFOA 3FEXB 2H51B 3D6MB 4YY3F 1FWKA 1P1LA 3Q8RB 5KFCA 3RBDA 4TQSA 1TL1A 2CQBA 3B8HA 3F73A 2LECA 4HI1A 4NLVA 1S5ZA 4DV7F 1WTFA 4KTQA 5A2QU 3KNGA 3DGPB 3UD3P 1KQFB 1HPZB 1ZA1B 3GIKA 1OSDA 2IPOB 4CQ1A 1E6VB 1D0EA 3KKFA 1YSJA 4C11B 1S6QB 4DL0C 4OLPA 3H2UB 1ZM4A 2N82B 1G1XA 3J80U 3ULHA 2Y9HA 1N5SA 5T7LA 1ZBTA 2HNYB 3A3NB 3HKWA 3K0JA 4QIWD 4H4OA 4NXNJ 3QAEA 3PX6A 3L3CA 3H0PA 2X3DA 2MLYA 1RU2A 2ILZA 3R97A 5GAGU 2HZCA 2E5LJ 2RT3A 3H5UA 5IOLA 3R1HA 2DHGA 3GLJA 2CQDA 4R8UA 3WQPA 3ZZUA 1PC4A 5LOQA 1J27A 2VKRA 1IVZA 3DI6A 2JOQA 1SKWA 4UUWA 4B9LA 1XNRF 2CJKA 3DLEB 1U1MA 4C3MA 4DX8H 1VRUB 4MJKA 3ITHB 2W9BA 2V34A 3D0HE 2MGZB 2RRBA 2DIVA 2J8AA 2V4QA 2Y1IA 2CA9A 3F41A 3DLHA 1HQ2A 3ILJA 3DYAB 2BKNA 3IWNC 3NMRA 5A8KA 3WC0A 2AJ4A 1URNA 3UR3C 4ZLJA 5IM0B 4AQYJ 4UQGA 2VOOA 1S9GA 4P75A 1XK8A 4CNZA 5H1SV 3MPYA 3IC1A 1UVNA 5A76A 3T1YJ 4LQ9A 4Y3CA 2P2CB 1RB0A 1DHMA 2AYEA 1OPIA 1HNXF 1S4EA 5B0GA 1U8SA 1QUPA 2B43A 2MDAA 4RW6B 3RR7A 2X1BA 2CZ9A 3U1LA 2OI2A 2EFVA 4QYZJ 3PG9A 1VQNS 2RJZA 2UZAA 3FMBA 1RA7A 4LBIA 1LWCA 3DOLB 2L08A 2H5IB 1YJWS 3CXCR 1VIOA 1VRQC 2WBMA 2ZOMA 2QL9B 2C3YA 4DV0F 2PMHA 3G71S 4GKJJ 3RRGA 4I6WA 2QE5A 1NPPA 2G2YA 1T7PA 3PJ9A 5GAHU 4KYZA 4DX7A 2B9WA 4DS5A 3CW2C 2HKEA 2KYXA 1IXKA 2NXEA 2X7IA 1K0TA 2BJDA 2WONB 3N5FA 2C1EB 1NBEB 2WW4A 4ITSA 5F3TA 3CCUS 1H2UX 2HK2A 1P27B 2DJWA 3SFGA 4ZPDA 2YX1A 3HCXA 4RR5A 3VZIA 2XCPA 2OPRA 5J2QA 3W9JA 2ATCB 4YY3J 4N8NA 2V0NA 4ECTA 2MQLA 4CO2A 1KNZA 4MFBB 2EI5A 4HR2A 2HFNA 4NZ0A 2CZ4A 1RT1A 2YVSA 4FYWB 4RW7A 4DV7J 1S97A 3V6DA 1A9NB 4L76A 1G7CB 1U2CA 5GAEI 8ATCB 3PEJA 2RB7A 1KLNA 5CH7B 2DH8A 4TKTA 1DARA 4NL5A 1LWFB 2ZH4A 3QGGA 2RRAA 3I5AA 2LFVA 3OT9A 4ZVUB 2BE2A 2ADBA 3EX7B 4DQSA 2ZBRA 1IWAA 1RWUA 5KFNA 5IT0A 3SSSA 1IKYA 4DSKA 1RWVB 3T5HA 3VGSA 3N01A 3THTA 2WOMB 1SC1B 4G1IA 1UA0A 4ZCMA 4O3NA 2VPYB 2UUWA 5CD4A 4KC5A 3J81Y 3B4DA 3NAIA 3UWTA 5T14A 4DG1B 3HHEA 1XMQF 4QYRA 1G4CA 1VBZA 2V2VA 1U0HB 3DGVA 4LRDA 5L1LA 2YKMA 1N48A 3ELHA 2BOAA 2FHOB 3HD1A 3FJ2A 3GYXB 3RR8A 4EO8A 4K8RA 2NUUG 2XHCA 1T9YA 3J7ZT 2ASJA 4G6VB 5HMYA 3FSYA 5B0BA 2BJ1A 1KOOA 2LEBA 1B3TA 4IDKA 5E3RA 4EWTA 2BM1A 2FHJD 1Q1KA 1LNQA 1PIEA 3IG1A 3M8YA 4P10A 4PXEA 3NCPA 2BOPA 4HH1A 2CPJA 2C2ZB 1T9XA 2D1CA 4URGA 4P9SA 1HNXJ 3FCWA 3LPYA 2MHEA 3UDVA 4RW9B 1RKJA 2XI2A 5DDQC 4DXLA 3HHLB 3T19A 3AH6A 2ZBPA 6FDRA 1AB8A 4RL1A 3CDUA 4G1QA 1R6VA 2W4PA 3GYGA 2YWGA 2MB0B 3ENWA 2QMXA 3KLHB 2QFJA 4O4GA 1BE4A 2WSEC 4BHQA 1VHIA 4IFVA 1YQHA 3GIJA 1HNIB 4C8MA 1PAEX 4CTAB 4DV0J 5L8RC 4DQIA 1H72C 3JAMY 1HQEA 3C6UB 4C2MA 4OZ0A 1RCXB 1FNXH 4PXBA 4PZVA 3T5LA 2VODA 1JK9B 2DNPA 2W7AA 1ZPVA 3DN9A 3PXGa 4IFYB 1ROFA 4ZP7A 3SV4A 1IM6A 3MPDA 2GVZB 2KVIA 2U2FA 4PQUA 3OVAA 1RTIB 1KTQA 1RAHB 2LA4A 2RU3A 4ZJQA 2NPFA 2M3DA 3GIMA 2J9DE 2CJXB 2GQQA 3GWCA 4J5OA 2HHSA 4Z37A 5DDOC 8AT1B 2V2QA 1ZPWX 2VKZG 5KFFA 3U1MA 3A12A 4ED1A 4I68A 4F4ZA 4YS2A 2G2ZA 4X4UA 2BDPA 2YNFB 1VQMS 1FDDA 2KXFA 4O3QA 2CZVC 4QW8A 1UJ6A 1T05A 2OD6A 1XEZA 1SUQA 4CLUA 1IR0A 1T94A 2F40A 1F0XA 2NYIA 4B9MA 2MYFA 1QAIA 3RW6A 4CLPA 3W5YA 2CQCA 2JEIA 4ZJLA 3E51A 2PDAA 3K59A 1HBNB 1S6PB 3FFIB 3Q83A 1AUDA 2DCUB 2LU2A 3U7JA 2QLWA 1ZH5A 1S76D 5F8JA 3HJVA 1V3ZA 3AA9A 3MMAB 3KOAA 1CS4B 1S7IA 4YN3B 1XMQJ 2ALYB 2RQKA 2RS8A 1N5TA 2BR0A 4OL8A 4Y65A 1JLQB 2AX1A 1QM9A 2XG8A 4ZVEA 4M5GA 1XWLA 4M94A 1FJCA 3KLFA 4IYQA 2DH9A 4M8LA 1HFEL 2J6UA 4ILMA 1RGVA 1EX8A 3W5ZA 2U1AA 3CCZA 5C25A 4QQBA 2NLWA 4ECQA 4IR1A 1GMVA 4FPIA 1UVMA 3N79A 1VHFA 5KFYA 1UA1A 2E7XA 2ZM6F 3I5BA 3P45B 1RT4B 4AL7A 2AZ1A 4LF7F 1EKRA 4DHVA 3MMCB 3Q8QB 2AV5A 3L95X 1Q4RA 2UVUA 2W9CB 4I7FB 1GXUA 2IDLA 4LFAF 2Q43A 3OQ2A 3IWXA 1Z2ZA 2FLLA 4JV0A 2YPZA 1UEVA 5BXIA 4CO3A 1WI6A 4RNMA 5LMUF 5G4DA 2JLGA 1F5BA 4B02A 2C2NA 1UJ4A 1QY7A 1VI7A 3HF5A 4KV8A 3P49B 1FVSA 2NYHA 1FWPA 3BZQA 3R9LA 3SCKE 4M5HA 2R8KA 2ZDPA 3VTIA 1RTDB 3Q23A 5CCMA 1RHQB 3CMAS 5F0UA 4LF8J 2CQPA 4DPTA 4WP9A 1XNQJ 5DZ6A 2NXJA 4OHVA 3ZZZA 5F8GA 4HTIA 4RW8A 1HWIA 4KO0B 2GIFA 4CO1A 5J1EA 2A0FB 2QLFB 1YZ6A 1NPKA 3H59A 3CCES 1MMDA 1N5YA 3UQSA 2XQCA 4ZK7M 4DV3F 2ZITA 3I9ZA 5K14A 1TL7B 4NA2A 2JVRA 3QQCD 2KH9A 5IS2A 3MR7A 4XDCA 4Y28C 5RUBA 3WX8A 4KGXB 5A8RA 1RAJA 3CC7S 2ZC4A 2NXUA 2BQ3A 4FN5A 3GV8B 2BACA 4OX8A 2CPIA 3T6BA 3SSQA 1GMUA 5E3CA 1BQMA 4ICLB 1KVJA 4K2JA 5LJ3Y 4N5SA 1XR6A 3QWPA 5D4LA 4XK8C 2BRKA 3O8WA 1HD1A 4L75A 4NLPA 5B0FA 3PW2A 1BWEA 2V4JA 4MT1A 3DOKB 3M2RB 5LXYA 1JLFA 2QJ3A 1CPZA 3A13A 3MD1A 4Y34A 3QBCA 2VJUA 1ZOTA 4EYIB 2IYIA 2EG2A 4KHPF 3MZIA 3NY0A 2ZH9A 4EBEA 3ZTOA 2N4DA 1VBXA 1FK9A 4RU9A 1H2VZ 1RCOB 4KT0C 3CT9A 2IA6A 3GMGA 4RZRA 2ZH8A 3JSMB 1AZSA 1H7WA 3C46A 3KXDA 3D3CJ 2CIMA 3K8VA 1B0VA 3CD0A 4IG0A 2X51A 4JI6F 1L3UA 3Q24A 1M0SA 1VQYA 2HWIA 2POKA 3R5AA 4P2MA 3MCOA 3LW5C 1SIZA 4U7CA 4ANDA 5BYRA 1Y10A 3GTYX 2Z2ZA 3DM2A 2K1RA 4N56A 3TX0A 4JV5F 2KFYA 3M30B 2J6TA 3DDNA 1LWEA 2HWTA 3UDCA 3JB9k 2ZWOA 3VAJA 1NKEA 1URRA 2JH3A 2XCAA 1IKVB 1SH0A 1JLCB 1KEKA 3QO9A 5BR8F 2LXFA 3NGSA 5F8NA 3NRBA 3LALA 2HIQA 2OUGA 5DZ7A 3KLEB 1M1KT 2ZM6J 3OTBA 2HLUA 3LO3A 1QSLA 3BR8A 1QD1A 2M88A 3CC4S 2LEPA 1MMNA 2QV6A 3OPKA 3PCOB 2CDQA 4LF7J 2JWNA 3GSIA 3TVKA 2YH0A 4BCAA 1APSA 3HSZA 2NREA 2W24A 4LFAJ 3LP0B 1RTJA 3LGHA 2HPUA 5LMUJ 1VBKA 4NLOA 1KQSR 3W3SA 3ILLA 2AD9A 1AUSL 1PJ7A 3LTOA 4KKOA 5HL7Q 1DTTB 1BXNA 3KK1A 3C16B 1RBAA 2VD3A 2RNEA 5B7WA 3TQEA 3TAMB 1F9HA 4PWUA 3US5A 1MROA 3IBCB 1K47A 3SV3A 1SJQA 3QLHA 4HH0A 4W92B 3W66A 4WFXA 5ITHA 4WYWA 2BRLA 3LAMA 1TL3A 3J81j 2G1DA 3LP1B 3AOCA 1N32J 1H3DA 1CG2A 1TKZB 3HLUA 1NJWA 2AEFA 4NCGA 3OR2B 1DZ5A 2AW0A 2DXDA 3ENVA 1UZDA 1NHVA 1LW0A 1TKXA 3FZBA 3CJ0A 4DLEA 2MZRA 2OP5A 1CJKB 2QA2A 4GVBA 5I4MA 3D6TB 2B4OA 4JI1F 3TZXA 3SQGB 3AFGA 4DCJB 2XMUA 3QNWB 3M8ZA 2JX2A 4LFBF 2B51A 5JXSA 4WKYA 4R0JA 2KHCA 3QFHA 3RRHA 1S6UA 4DI6A 5F41A 5ETMA 2QC3A 1XIQA 2V8HA 2VG5B 1K73T 1SCJB 3G8TA 2BKOA 2F8EX 3CCMS 1FD2A 4F26A 3C19A 1FA0A 5J2MA 3FCHA 2QA4S 1AXQA 2D9PA 3SEOA 4BS2A 3I0RB 4KHPJ 2YTCA 1F6TA 1CJTB 1YRUA 1Y3KA 4OZLA 2XMKA 1XTZA 5HQ8A 5ETNA 3QT5A 3DDKA 4UUXA 4I56A 4FYDA 2EXUA 3MF5A 3G82B 2Z0GA 1C0TB 1U8WA 2ZE2A 3GCXP 3M2UA 1IBLF 1DBDA 2RKIA 1HKAA 2BABA 4JI6J 3I9V9 2OPQA 1OY6A 1F1BB 5FLXY 3GFYA 2JEFA 3GCWP 4QWEA 3UNGC 1S1UA 3DU6A 1Q53A 2CKWA 4JV5J 2HK3A 4DX6A 3K89A 2SXLA 1T8EA 1S77D 5HROA 1F5CA 4F7VA 2J7UA 4YUDA 5ETPA 1K1QA 4FPRA 5JMNA 3KJNB 4I2QB 3H42A 5HMWA 2GQ2A 4F36A 1J5OA 3VZHA 4OHXA 3NGKA 3KDNA 1JKHA 3TUZC 2VBYA 3R8YA 3LAKA 2W8KA 2OGUA 3ET6A 1WI8A 4K7QA 3Q8YA 5KFUA 4A8XA 3PW4A 1YHQS 3OD2A 2FJAB 1U7LA 3X1LB 4FP9A 5CZXA 5EWFA 5KT4A 2QLBB 3PX0A 2OPSB 3CD5A 2ABYA 2FJXA 4U6PA 3PNIA 5KFOA 2HS0A 4E98A 1HNVB 4C4WA 2Y0BB 4OYZA 1KS2A 3PR4A 2N3OA 2BANA 1REVA 5CYMA 1D9DA 3M2VB 3BSNA 3PW5A 4F0MA 5B0AA 3VAIA 3LUYA 2RQCA 1KLMA 4JP8A 4QJVA 4UY85 4C48A 2EK6A 5I42A 4JI0F 1BQNA 3EGVA 2ZH1A 2C2MB 1RHKB 2IVYA 1RA6A 4GC6A 3AAWB 2XZTB 3OHAA 3M8QA 3TRGA 3ISNC 2CQGA 3L4BC 2F65A 2R7TA 3BPSP 4HACB 3ZTPA 3G87A 3EDRB 4F4XA 3AXKA 1IJEB 1TP7A 4LSLB 3P5TL 4ZPCA 3TZYA 3S8SA 4QR1A 2UVVA 3A4TA 4PABA 1W2IA 2K3KA 2PIIA 3MUMP 3V4IB 4DR4J 1HLWA 4DQQA 4X4TA 2JEGA 3IO1A 1C1BB 4EBCA 2HHVA 2KT2A 2CJ9A 3IRXA 2BE7D 3BS9A 3PW0A 3OUYA 1TV6B 4IG3A 5ETLA 2A18A 4ID5A 3QIDA 1RHJB 1YVFA 2UU9F 2A6OA 4USIA 4YB5A 4LFBJ 2VG6A 2YNHB 1R8PA 1SKRA 1OQ3A 5I3UB 2GGPB 3ENAA 3CVKA 1RYRA 2ATLA 4TYBA 4ED0A 2VA3A 2CXEA 2WW8A 4O0IA 2K8GA 2YQ0A 1LW2A 3OR1B 2YKNA 4CLLA 4LUBA 1U48A 5KAKA 1TKTB 2C3MA 3IGNA 4LF6F 4LR7A 5AXMA 1Q7LB 1XJWB 3VWSA 2P6TA 3I6PA 1EB0A 4DEZA 2R7RA 2ROEA 1JJ4A 4GC7A 4IUFA 1NH7A 1KN6A 5EUHA 2FQQB 2OEKA 3HFKA 3AT1B 1YX2A 2AEJA 1NNDA 3N0VA 1IBLJ 2FUG9 4DL3A 1WNEA 2HS3A 4L6V3 3R5DA 1VQ7S 2DXFA 3LP2A 4FBUA 3W5XA 5LM7E 2ACMA 3C8YA 3NNCA 2HQGA 3UD4P 5D4OA 2EFNA 4A8QA 1FDNA 1VK3A 4A4JA 2ROPA 1F5AA 1T11A 1M90T 2DNQA 4ZHRA 3GR0A 2RDJA 2Z2MA 1SC4B 3HO1A 1S1WA 1UFLA 3LGMA 2VICA 1RT7B 3MMBA 2FYXA 4AFFA 2HHHF 1TAUA 2R42A 3MECB 2DGWA 3X3UA 1RT5B 3MEKA 1VQ6S 3M32B 3VGUA 1GT8A 4C0HA 1VC0A 3KK3A 5HVFA 1DFDA 3NKYA 3CF5Q 1UVIA 4F50A 1JLBA 3MURP 4UOCA 1GMWA 3HDSA 2KFNA 3WC2A 1P6TA 1RK8A 1RT2A 3BGLA 3KLGA 2AJQA 2IBOA 4K4YA 1ZETA 1NJYA 5KFRA 1SXLA 2KZMA 4N41A 4RNHA 2DT9A 1KRPA 1VJQA 3HVRA 4DCPB 4OJHA 2JHEA 2QYGA 4JYAJ 4YDXA 5KFDA 2E1RA 1S59A 5IFMA 3PYFA 4OI2A 4MKAA 5DETA 2H1YA 3VQTA 2AIRB 1IBKF 3BH6B 2EVZA 4OZ1A 2PA3A 3UO0A 5ETTA 5LSRA 1RKIA 5D78A 4EI2A 3G6YA 1OY8A 4NLTA 4A48A 4ZPVR 5HBMB 4M5JA 1HW9A 4ED5A 4C0OC 2HLTA 5SZTA 2XM3A 5KT5A 3MTJA 4OFZA 3FBCA 3VAHA 2DNOA 2XSJB 1KBRA 1FE4A 4Q44A 4R5PA 4HT5A 1S1TA 2YKAA 5C2CA 5AE2A 4B9UA 2KN4A 2MJNA 4RKUC 2HAIA 2MKYA 1SQGA 1OYEA 4NLXA 2UU9J 3PY8A 1SB6A 3C14B 5E0OA 4CO5A 4ZCKA 1YBTA 4YR0A 3M8RA 1VQ5S 2KU7A 1SL2A 1SL1A 4USVA 4OYPA 4YHHJ 4CI0B 1RWWB 3JQMA 3KHHA 1HWUA 1ZM9A 5IZHA 2OMLA 4FBTA 3I87A 1IKXA 3Q89A 3ZFVA 2W2NP 3K5PA 4Y2AA 2RUSA 4KSEB 3KLIA 4LF6J 4NA1A 4NYZA 2AJFE 3EDQB 3FBEA 4LSNA 2DGXA 4FVMA 3I0SA 2P8IA 1VQ8S 5LXRA 1JLGA 4PG7A 4F67A 4X4QA 2XS7A 4ES1A 5JJBA 1NJXA 2A3JA 4V19J 2HIYA 1T9UA 4TN2A 3OV7A 1LXJA 3TA2A 4P7TA 1MW7A 4LBPA 5EWEA 4FF3A 3D66A 1I94F 4DSEA 1M1GA 4F4WA 3ZTQA 3HVTB 2IY5B 1AA1B 3V81B 3BBCA 4UZBA 2BQRA 3DOMA 2XHWA 2PI5A 4WE1A 2EC2A 1B7FA 3EYZA 1LWXA 3R5CA 3HT0A 4KFBA 4F4AA 2M7SA 1XR7A 1O5JA 2MY8A 1K1SA 1NSQA 3TOQA 1N52B 2FTRA 4G1QB 4YP3A 3SCIE 3MEEA 3Q8VA 2M8DB 4K50A 1U24A 1YJUA 2J9EA 2NCKL 3TWZA 2D41A 4OV1A 4OHWA 1FJ7A 3NG8A 3OW2R 3L09A 2XNQA 1I5OB 4Q0BA 1UZHA 3J7YI 1ZA2B 2HHHJ 3MUVP 5A8WA 1G2EA 3VVUA 2R8JA 3CJKA 2F4FA 1Y11A 5D4NA 1PO6A 1FJEB 3R2DJ 2O66A 2H4WB 1ZYQA 2ZVSA 4NPOA 4KY3A 2BQUA 2GW8A 1ZAVA 2UUTA 4O4RA 2AYBA 4AL5A 3KHGA 4X2BA 4A8FA 1IR1A 1L5UA 4DR3F 1FERA 3G6XA 2Y1JA 2E1AA 4PWDB 4B3OB 1NK8A 1U6ZA 2RDIA 2DRAA 5HO4A 1U45A 5C42B 3M9NB 2F8HA 4ECYA 5KG6A 1D9AA 4XPEA 4BWMA 1XMBA 3EVMA 2VHGA 5KFKA 4Y2CA 2PGCA 2KDOA 2QA4G 4OIXA 1FX2A 2ERRA 2Y8YA 2IC3A 1ZAWA 1YJNS 4QPTA 5T41A 2NS1B 2QYCA 5E33A 4NLUA 4DFKA 1OIAA 4USJC 5AE3A 2DB1A 2HNZB 4X84A 2DD8S 4OV6A 4EBDA 3PO5A 1JLEA 1EP4B 1LXNA 4DPXA 1EQ0A 1CJVA 3BGRB 1MU2A 1N6QA 2D3O1 3HMJG 3A8JA 5DDPC 1MWZA 3DRRB 2ASYA 2H3EB 1VQSA 4K4TA 2IVFB 2WTFA 1DRZA 5KFWA 3EGZA 5B0EA 4J9NA 1FEEA 3C15B 1V5IB 1FKPB 2JLFA 3LGNA 4DX5A 4GKKF 2GV1A 3S01A 1VS3A 2HHTA 5FDLB 2L9WA 4IQXA 1E6YB 1DY3A 1JJHA 4LRAA 3LWMA 2FGCA 1K8AT 1VYAA 3D0IE 5ETQA 2C3UA 3MM8B 3W1YC 2J7WA 3QATA 2F7VA 2DGTA 4G3IA 4QWCA 1N36J 1HMVA 2F1FA 5KFVA 4ELUA 2FJDB 3EMTA 3NOCA 1SKUB 4WTYA 1M5VC 2FVPA 2V8GA 2ZOFA 2Q66A 3HP6A 4KGKA 5D3GA 5DQIA 2OFGX 1Z2LA 4ZP6A 1TZ0A 3B4MA 3HPOA 1CQMA 1UMJA 2BA9A 4L3KA 1T02A 3IS9A 3GFXA 4A8OA 2B7CB 4LF5J 4OZ2A 5K8NA 2D3OR 1I94J 3NBPA 5KFJA 1VISA 1YJTA 2E5HA 3TO8A 2R8GA 1A0OB 1VLYA 2GS8A 2QGFB 2XYPB 2ZHBA 1WF2A 3DRPA 1C1CA 4LF4F 1EETA 4JI4F 2PT0A 3PFEA 1MN9A 3O1LA 1S0MA 3G8QA 3QT7A 3TARA 4DR7F 3NNHA 2DNKA 2FIUA 1ULRA 2B0GA 4IR9A 2RAQA 4LJMA 2CNKB 1VDHA 4HEA9 4UOGA 3MEGA 4WYLA 1QVFR 3TW0A 3H20A 2YQ1A 5DG9A 2VFRA 4QBUA 3CEDA 2WRMA 3W61A 4CH1A 3UE2A 2Y3YA 5AXKA 2D9OA 1ZTWA 1FXDA 4P52A 4PUOB 2XGQA 2FJEB 1WEZA 3BQ0A 3GV7B 1NDKA 4C98A 2H9ZA 1IQZA 2DKOB 1N0VC 1RT3B 4EYHB 5M2RA 3T41A 1HR0F 1KHVA 3BKTA 5D0RA 4OX6A 4M95A 1ZAXA 3P3DA 2XB2D 3CCQS 3HI9A 2JL9A 5BYSA 1HBMA 3Q2SC 1FF2A 2RD5C 1XQIA 1D8ZA 2ROGA 1KVIA 2BJ8A 4DR3J 4LFCF 4WP3A 5G0RA 3DLGB 5AJ3F 2GC8A 4OZ3A 2B5JA 4XIUA 3L7PA 4QR0A 1TTHB 3CJ5A 1RWPB 2VG7A 3EE3A 3LOUA 1IM4A 1QAYA 3FEYB 1N5VA 1HNZF 1W25A 3VAKA 3SZ2A 4ELTA 1TVRA 1SV5A 3D6FB 5F3ZA 4WP8A 1BGXT 2Q79A 1F3VA 1FKOA 2GVDA 3AQOA 2LQ5A 1DJ0A 1WKJA 2YWFA 5IV3A 3N5BA 2QIFA 2UXCF 2VOPA 4KHMA 4WFZA 3GSDA 1U1KA 1ACMB 1NDLA 3W60A 5B0CA 2P5VA 3DGPA 3N6LA 1WSRA 1LK7A 1XC9A 2YKOA 2ASDA 1HPZA 4K4UA 3PJWA 3MM6B 3R7NB 2F8MA 4K5SA 1E6VA 2XLKA 4USTA 4C11A 1S6QA 2J0XA 3LQVA 3A8EA 2KRBA 2JLEA 3PHEA 1VOMA 3BGOP 4F02A 4I6AA 2V8VA 4UQTA 4B08A 3RUBL 3IM9A 4WIQA 3C6TB 4DV6J 1RWMB 3S1TA 1KSPA 2DIUA 3W9HA 4OYIA 1QE1B 2ZZMA 3JQJA 3QPIA 4CYUB 2MQOA 1K0VA 5F9NA 1MN7A 4HYKA 3VQSA 1JQGA 3CJ8A 2HVDA 1X4DA 2W7PA 2LYVA 1F9EB 2OEJA 2IM0A 1TFYA 1TQLA 2WCXA 2ZDOA 2AYMA 3DLEA 4LF4J 1VRUA 4M1KA 4JI4J 1V3RA 3ITHA 4MYTA 1FKAF 4XO0A 1TL4A 2MGZA 2LA6A 1JNZB 4DR7J 1UW9A 2CG8A 1Q8BA 3MM9B 3VR1A 5D15A 4ECSA 1NSPA 2RF2B 3DYAA 3AD7C 4WFBQ 5ETRA 1T03B 2OIHA 1CC8A 4O23A 5IM0A 2AJ2A 3AB4B 3BR9A 4TLRA 4URQU 4Y2MA 3GFZA 3CNQP 1VK8A 4LBHA 2MQQA 2B3TB 1U47A 5A2QY 3OL9A 2PC6A 3BYRA 2XZWA 2ZEJA 1TU0B 1HR0J 2DXEA 4RW6A 2EKNA 4OHYA 2BBEA 2V94A 1NO8A 2J9DA 4PG4A 3MMJA 5HN0A 4DLGA 1I3OB 3W65A 3SDEB 3J80Y 1RLCL 3DOLA 1ZM3A 4TU7A 3LA0A 1FESA 5AE1A 4RLEA 4LFCJ 4LR9A 5AJ3J 1NLKL 2VQFF 1PG5B 2HHQA 1J5EF 4F3MA 1TKXB 4QW9A 1X5OA 5EX3A 2ZKTA 3BSOA 2B4PA 4DV1F 3GG0A 2OSQA 1KOHA 2WONA 1HNZJ 5H9FK 3D0GE 2MLXA 4ETXA 1NAQA 5C24B 2E9TA 4EMDA 2XY6A 2A2CA 5KFIA 2LQBA 2OMOA 4PXCA 1RT6B 2ZKUA 1HL6A 3MM5B 2FPHX 3RAMA 1RAOA 2G0JA 2P9GA 1SJ4P 3VF0B 4MFBA 3CO9A 2HRTA 3SIPB 2IFXA 2CYYA 3GG1A 3GP9A 2ZD1B 3ZZ0A 2VF3A 3KDOA 3B54A 5J2PB 1M5PC 1HQUB 1NRKA 2RU9A 3ENQA 1LWFA 4CLKA 2FHJA 4OZJA 2HHUA 2C42A 1R27B 2COLA 3BKFA 2W2QP 3E2EA 4N7TA 2OEMA 3TZZA 3JSBA 4OMFG 2C2DA 1HYSB 3VHQA 4M5IA 2R7OA 1TUGB 3E01B 4WJBA 1HWKA 2LQJA 4IOCQ 1XBWA 3IR7B 3M1VA 2ZZNA 3MAAB 2R7UA 4ZS6A 3HXMA 4F4YA 2CQHA 4KIAA 3OVSA 2JZ5A 4P74A 4I4BA 4M5DB 4RNNA 2WOMA 3WBZA 3MR3A 2HFUA 4X4RA 1C4AA 2XLJA 3RGIA 1WDTA 2GO9A 1Q5YA 1X4BA 5FJ4A 1K9MT 2FLNA 3UW1A 3AODA 2H54B 4DG1A 1U0HA 4YMEA 2EFGA 3HHLC 2YH1A 3RYLA 2OHDA 2WZ1A 3RB0A 2HVZA 1BLUA 1F3FA 1MNEA 1MSWD 2G4BA 4TLQA 3BJYA 3QZ7A 2HVEA 2BJ3A 5KOWA 5HQMA 4B17A 1EJ7L 4Y0FA 1T9VA 4R25A 4YB6A 3OL6A 4PR6A 1JXEA 2M52A 2OPPB 2VIHA 3GPAA 3UN5A 5IT9U 3IR5B 2VQEF 3FVYA 4RW9A 3ISZA 4TNOA 1P9YA 3T6JA 3HHLA 3MOZA 1BC6A 2ZHOA 4ZP9A 2D3UA 2VONA 3P96A 3KLHA 1M5OC 2M2BA 4CCHA 1O51A 3PZPA 1HNIA 3HSJA 5A0YB 2JFDA 3Q8SB 4CTAA 1RU1A 1WACA 1J5EJ 4H4MB 1RWKB 3C6UA 5I3PA 1TELA 2F5GA 4AL6A 4P6QA 3NMAA 2RS2A 4LIWA 4O3PA 3J7Z5 2B9XA 4DV1J 3OFHA 3A8IA 4IFYA 2HW3A 1EHWA 4U95A 4DMZA 1A6LA 3DDIA 4DQPA 1DLOB 1W2BR 3F0NA 2GVZA 3D54A 1RTIA 2VPZB 2GIRA 3OL7A 1FRLA 4L72B 4YEAA 2NSBA 3IA0A 3CCSS 4QWAA 3UN2A 1DTQB 4C9DA 2XY7A 3BO3A 4A8YA 5AT1B 1RAEB 1WEXA 3GILA 3CCLS 4TY8B 4ZVHA 2J0SD 5SUHA 1B99A 4Y2IA 1DAXA 4WFAQ 5KFPA 4USKA 2FZKB 3SYZA 5L1IA 3U02A 3EPGA 3UPFA 2Y1RI 2K7JA 2DR7A 4B3MF 2YNFA 4NLDA 1KWMA 3BSCA 4J90A 4WPAA 3NEKA 2CPYA 4XTTA 2EG1A 1WHXA 2HFVA 3POTB 4DN9A 3O44A 2V8PA 1VQKS 5FD1A 2XI3A 4B3RF 4DPWA 3QJJA 4ZVPB 4DDFA 3RB3A 4LT6A 1SH3A 4MTPA 2BUNA 1HW8A 3RAXA 2GIQA 1CULB 3CDEA 2YNGB 4I69A 4PYAA 1HBNA 4PPDA 1S6PA 3R5JB 3H5SA 3FFIA 1PYTA 2JC0A 2R3VA 4QR2A 2IRUA 2PI4A 4B9TA 2VBZA 4ENOA 5CAAA 3MMAA 2YWHA 3W2VB 2HZAA 3SCLE 2XWXA 5LSLA 3ZNUA 4TQRA 4LMZA 5FIIA 2A6MA 2ZNYA 1S0VA 2WB1D 2IM1A 4UOHA 1JLQA 3BM7A 1IJFB 1WOSA 1FDBA 1OPZA 3HFVA 1WF0A 1GEHA 3OL8A 5JVHQ 2KXHA 3OLBA 4CH7A 3A3PB 1M5SA 4MIWA 4AUKA 3L7UA 4QU7A 2B8QA 3MM7B 3MCMA 3M7VA 1RT2B 2Q1LA 4J9VA 1XNRJ 2OAUA 5HANA 2R8IA 1PILA 2EFQA 5CA5A 2EBEA 1X4EA 4PG8A 2P6SA 1RT4A 3CTRA 4EK2A 2BM0A 4ECXA 2KXNB 3MMCA 1KTVA 3M8SA 2HHPA 2HURA 2RHQB 2R2TA 1T9TA 2W9CA 1FRIA 4I7FA 1H0HB 3MEDB 2G1HA 2MKJA 4AE5A 3HT3A 4DOZA 1H74A 3B78A 1VQOS 1VC6A 2MLZA 3DMJB 5IT4A 2WVBA 2R2UA 3AHPA 5KG1A 3EVWA 2I5JB 1WC0A 3CPWR 4LSZB 2ZOGA 3IBWA 1QDUB 1PYSB 2VH7A 2VASA 1RTDA 5CYJA 3TUJC 2M70A 5DGAA 4FXDA 2XMTA 4F04B 1JLAB 5KFBA 1UFKA 2DNHA 5GAEU 1FFGB 2JSXA 4X4NA 4OQJA 3ZNJ1 2QX0A 4KO0A 4G65A 2ZBIA 2EPIA 2GNKA 3D1QA 3C66A 3T1HF 2Y1LB 2NR0A 1X60A 4DR6F 3PDNA 2ZUAA 4KAIA 1TL7A 4M63A 1FO1A 2FC9A 3FUYA 3K5MA 3N9UC 4ZP8A 2IVMA 2ZH5A 4Q8EA 2DNMA 1FE0A 3OXLA 3OJUA 2XBPA 5CABA 4ZMMA 1EIYB 2PMWA 2QA1A 1O8BA 2IA0A 4ICLA 3NL0A 2MXYA 5J2NB 4B3MJ 1U02A 1SJ1A 3TZWA 3SFUA 4FNIA 3A3OB 2MJUA 1MWQA 2IBKA 4IH5A 2ZNZA 5L46A 2W01A 1S7HA 1WKLA 1UWBB 5EGYA 2DTJA 3DOKA 3M2RA 1YITS 4K0KF 4ZIVA 3HHKA 3D1OA 3GFHA 5KG5A 3UCGA 4B3RJ 5HVHA 2XYHB 4CLSA 2GMJA 2QFIA 3D9BA 3CMES 1VLOA 3IR6B 2DO4A 2QN6B 1IQTA 3KHRA 2VPWB 1FXRA 3HHLD 3PHTA 3N6MA 2PO4A 2NPIA 3JSMA 1LKZA 4U9RA 2OLWA 2PE8A 5HMZA 1WC1A 3TA1A 3IN5A 5U47A 1FNOA 2LQ9A 1RXOB 1GX6A 1AFJA 5BJRA 2XY5A 4C8LA 3M30A 3OFEA 1B4SA 2G13A 1R0BG 2KHDA 2V50A 4CDIA 2MZQA 2AT1B 2CVIA 2ZH7A 1U1NA 3EXCX 4BLGA 2ALZA 4S0MA 1IKVA 2LU1A 2RE1A 1JLCA 4NMLA 1WC3A 1HNWF 4F25A 4J9OA 1YJVA 4A8MP 2FVRA 1BMQB 1FWLA 3KLEA 4PKDB 3TJ8A 3H5XA 1GQEA 4UW2A 1YRTA 2DY1A 1ZS6A 1G3OA 4GMKA 2FHKA 1FJGF 4FF4A 1YJRA 1IKWB 3JQKA 5CQGA 3MHYA 2UV8G 1MG7A 1VGYA 4R0EA 4RW4B 5ETOA 4O3RA 3QZ8A 2FZCB 3W63A 4E8UA 2Z8QA 3UCZP 2OFHX 3LP0A 1W26A 1RTHB 3BSAA 3MTKA 2K7KA 2XTJP 2APOA 4B3SF 3RJMB 3TEGA 3R2CJ 1DTTA 3PIPQ 2DPJA 5DDRC 3C16A 1WKKA 3FMWA 1WSVA 1Z1ZA 3KG4A 3TAMA 1PBUA 4X62F 5EWGA 2GHWA 3S7RA 2XS5A 3KK2B 1FFSB 1NK7A 5DQHA 7FD1A 4RPFA 2RVJA 5C5JA 1HHSA 1GH8A 3GJQB 1Y5NB 1U49A 2AWZA 5CXTA 4I2PB 1C2PA 3AJ1A 3LP1A 1S9EB 1TKZA 2W25A 4H54A 1Y0HA 1WEYA 4OI1A 3OR2A 2FLOA 4F3OA 3NGDA 3BQ1A 3MR2A 1CJKA 1BWVA 3K17A 3DC2A 2BE9B 1Q8LA 4JI5F 2EEYA 2F9DA 1KHWA 3RZAA 4FVCA 4DN0A 4V19X 1NZAA 5CYQB 5ETSA 4ZVGA 3HKZD 4ED4A 4N77A 3CCRS 3SQGA 1X8DA 1LEOA 1VMBA 3ZZYA 2YX7A 4ZITA 1S1XB 2ASLA 3QGIA 4CH0S 3QT8A 5HLFB 1YGYA 1S99A 5EX0A 3QJLA 3PR5B 1OSCA 3N6NA 1RP5A 2VG5A 1M5KC 1V3SA 3DFEA 2XYGB 3LF0A 3OTDA 3TYTA 1UJ5A 4ZPAA 1HA1A 3IXQA 1X5TA 2XNRA 3DRSB 3NS6A 3KJVB 3I0RA 2BJ7A 3D28A 3H90A 1CJTA 4RBTA 4C8ZA 2W2PP 4YB7A 3I96A 1LQ9A 3VV2B 3Q0AA 1NKCA 4DV2F 2FB0A 2MQNA 5H9EK 3WX4A 2MTLA 3G82A 1HD0A 1C0TA 1AFIA 3H2VE 3UN3A 2HNDB 1JXLA 3Q8PB 3ZO7A 2FGOA 2V9KA 4N76A 4ECWA 4LVOP 4NLGA 2W2OP 7AT1B 3DHXA 2DRDA 3T1YF 2DNNA 1VRTB 5F8HA 2X1FA 1VJWA 3I32A 2AJ0A 4FZVA 5ADZA 4DV5F 3HZGA 3NP5A 4Q8FA 4I2QA 1HBUB 2MEWA 3R7SB 5GAGI 3CIZA 4IH6A 2VU5A 1GXLA 1HNWJ 4ZKAA 4X4OA 4MK8A 3CCTA 5DG7A 1OQ6A 1UL3A 1WOOA 4A8WA 4KQZA 1FJGJ 4M5NA 4AYBD 2QZ8A 1C0UB 3QIPB 5DRKA 5KG2A 3DLKB 3M8PB 4UZCA 4WKRA 1Y9OA 2FY8A 4YFUA 4P2SA 1TMMA 4CLZA 4USWA 4C97A 3CE8A 2OPSA 3TQ1A 3OSPA 4FXVA 3H4BA 4I6YA 3GB0A 2IAJB 1HNVA 5K9FA 5E2QA 4OYWA 3EZUA 5KFLA 2MZJA 1R3NA 2HGNA 3DNCA 1N4LA 3D1HA 3M2VA 2XULA 4NLRA 5B0DA 1N5QA 5KFEA 2VDHA 2DK2A 3SSRA 3R3TA 4I0WA 1FXLA 5BYQA 3HJFA 4DWIA 3AJDA 3BV8A 1HBOB 4X62J 4DL5A 2C22A 3ICLA 1CJUB 1YJ9S 5EDWA 4USUA 4NI2B 2JFKA 4EEYA 3VALA 1U4BA 1CLFA 2ZBCA 4HACA 4KGMA 3OJSA 4EFAC 2YNIB 4LSLA 1NUEA 2WK4A 1YLXA 4OYMA 1TUWA 2OH2A 2F9JA 2O5DA 1SJRA 3PVXA 1F60B 3HD2A 4UTGA 1HWJA 2W2MP 3T5JA 1KVKA 2ZUGA 3KYLA 3V4IA 4X65F 3LWLA 1RUSA 3PTWA 1UCNA 5K8OA 1C1BA 4JI5J 1R0AB 1UEKA 3TUPA 4QYZK 5J1PA 1YZ7A 4K59A 2VFTA 1TV6A 4U8VA 1Q5VA 5GAHI 4NYPA 4W90B 1GTHA 2LCWA 2E66A 5D4PA 3U27A 2YKQA 4J9LA 3J7AN 1JIHA 2YNHA 3TJAA 2BEFA 3CC2S 5KFSA 3MCSA 3CWJA 3NWRA 5I3UA 2GGPA 5F8IA 3EPIA 2MQ8A 4OYBA 2KFZA 4NWBA 2QT7A 3JXOA 4DV3J 3K5OA 2BW7A 4H4KC 3MR6A 3CCWA 4EGLA 7FDRA 3NCQA 3OR1A 4ID8A 4C8KA 1C4CA 2UVRA 1DQ9A 2QLXA 2CQIA 2X3GA 2OD4A 2HMIB 1TKTA 4A8KA 1U2RA 4HT7A 1U09A 4E2FB 2MHNA 2H4YB 2E44A 2J76E 3P5BP 1IN0A 3E8OA 3A8KA 4DV2J 1Q78A 1NMEB 3FNNA 1NDPA 4OYAA 2P9CA 5HAOA 2FY1A 1RABB 3RRKA 2KT5A 3O2IA 1WC6A 4IRCA 2ZC3A 2CQ2A 4OI6A 2MKIA 4JI3F 4U7UK 4K4ZA 4V1Ak 4OX7A 3QRQA 1UEUA 3UVJB 4H4KA 1Y4ZB 1ZZFA 3WIVA 5CCLA 1VIXA 5DLFA 1RAGB 5D6GA 4DV5J 3CDBA 2CNNB 1IBCB 1OJ4A 4WXOA 3W2WB 4NZ6A 1ITPA 2QMUB 5CD4H 2RUGA 2R7WA 2G0IA 4FYVB 1SC6A 4O44B 2DO0A 1RT7A 4EZ9A 4OI0A 3EGNA 3Q2TC 3W8GA 2ZBQA 5E3PA 1H7XA 3MECA 3MAQA 1RT5A 3M32A 3ZZRA 1RWOB 2W8LA 3BDEA 2GJ2A 3MPVA 1S49A 1RE1B 5D77A 3KJFB 3SMZA 3PEHA 4P73A 4JUZA 1S1VB 2CAJA 5DS7A 2XMJA 1WHWA 3QMQA 4U8YA 1GNKA 2IMWP 5BR8J 1U6BA 2VL1A 3NGRA 4NE9C 4GVLA 2AKWB 3TNVA 2H65B 2X1GA 2RHSB 5KFMA 2MKHA 4RUCA 1S48A 4N47A 2GHPA 2R7VA 1VBYA 3H25A 5HP1B 3GZ7A 1WWHA 3OBIA 1M1HA 2I9SA 3NLCA 2QSFA 3AD8C 3TX8A 2B6AB 1U1RA 4FXWA 3CJSA 3FBFA 3JYTB 2R2SA 1B64A 2G2OA 1S0OA 5IC6B 5HBMA 3TR5A 1QAJA 1RAFB 1NK4A 1YWXA 2KI2A 3GJRB 2YWWA 3CO0P 3BQ2A 2DY9A 2E1MC 1NHUA 5KG7A 4X65J 2I6WA 2XSJA 1PC5A 2HRUA 3WIUA 2DR9A 3M1VB 4ED3A 1AYEA 1TL1B 2M4MA 2BXJA 2HHWA 1S57A 4ZVFA 4RBVA 1Y3JA 5L1KA 3C14A 4JI7F 5KFAA 2IHR1 4J9PA 4J9KA 2CNOB 1U1OA 1N33F 2UV8A 1Q82T 1NJIT 1VQ9S 3KUEA 2N7YA 3JSRA 2QRRA 1X0FA 5T7LB 1D09B 2EFPA 2IRYA 2HG4A 1FRKA 1T95A 3LANA 4JI1J 1I51B 3GV5B 4UOFA 4C8OA 5K5MA 2ZH3A 2MKSA 4H4OB 1RLDA 1RSCA 4X4PA 2VA2A 4YDDB 2DITA 5LSOA 5B09A 1VCTA 2R4FA 6AT1B 2KM8C 2RSQA 2A1BA 4F2RA 3SI8A 3HVTA 4R8UB 3KNAA 3AY0A 2ZJQQ 4ETZA 5L9XA 3V81A 4O3OA 1KDNA 1R0CB 3BB5A 2PSZA 4JI3J 4Z7YA 1YTYA 3OTEA 3DI6B 2YKPA 1AW0A 4DL4A 3TA0A 4Q43A 2HAFA 3TUIC 1WORA 4NMXA 1X9WA 3FSIA 5HK4A 2KRRA 2FHMA 2W9BB 2C3OA 1KD1T 2I2YA 1R8BA 3FDSA 4TVAB 2AJ1A 1TUVA 2QG9B 1I1GA 3R6GB 1X4GA 3IRWP 2B8PA 2JJ4D 5A8KB 1TMJA 2E9ZA 4PXDA 4NRUA 3FC9A 3W8PA 4ZIWA 3I4HX 3O6QA 2IIHA 4CRJA 4HHUA 2XZDB 1P1TA 5AXNA 2WHOA 2HQCA 1S9GB 3K57A 2C2OB 4WCEQ 1TKDA 1R8HA 4C8YA 2IDEA 2R9LA 3O3LA 2PD1A 3PACA 1JWWA 3ADAC 4NZ7A 3F56A 4LF8F 3VCDA 1XNQF 4L3NA 5KFQA 2DR6A 1NHKL 3AOBA 3BH7B 2EK1A 2LEAA 4PG6A 3IFEA 4ECUA 2DBBA 1NSKL 2YX4A 1LWCB 2W4DA 2GQCA 1FI4A 2HBQB 2KJWA 1KP6A 3PIOQ 4PWDA 4B3OA 4CM0A 4MKVA 4OZ5A 3QRPA 4MMOA 2CNLB 4HDGA 2VBXA 5C42A 3O5TB 4W4MA 3J81U 4LF9F 2FZGB 5ETKA 3K2YA 4EUVA 1JJ2R 1S0NA 2YBVA 2JEJA 1QTNB 2R7SA 1HIYA 4JI2F 2NQPA 4UT4A 1CQNA 3V6JA 4XDDA 2CJYB 4DL2A 4ED6A 4DPUA 3GU0A 4P72A 3ZZOA 4HHHA 1LK5A 4WU2A 2HNZA 1YKWA 1RHRB 2V6AA 5DG8A 3GQCA 2YXLA 3UNYA 3MPWA 3M6WA 3FKBA 1EP4A 3DLBA 4PPZA 4YQWA 1N0UA 1SKSA 3OTCA 1LFPA 3BGRA 4JI0J 3WHIA 2OPRB 5J2QB 5KG4A 1D8YA 2WBRA 3DRRA 2A10A 5K8MA 3D68A 1RT1B 4Q7AA 2AF6A 4K4SA 3HHNB 4RW7B 3V6DB 4TYAA 2HS4A 1HHTP 3C15A 4P2FA 3H40A 2V68A 1PJ5A 2R7XA 1FKPA 4JI7J 4C7QA 2WVDA 3PM9A 3C3LA 4J91A 2LMIA 2DPIA 5FDLA 2E5GA 1N33J 4Y6IA 2PA8D 1E6YA 4C3KA 2ZZTA 1NB7A 2BE2B 5DGBA 3PFOA 3VGVA 1FFWB 3MM8A 2DHXA 1F2GA 3NCRA 5HQLA 5KFHA 4ERDA 1IKYB 1TK5A 4MH8A 1MLAA 3IBFB 5D0GA 2Z58B 1SVDA 2V4RA 2YY3A 4LF2A 4L73A 4NOHA 3NXZA 5IWAF 4IH7A 3JAMU 2IM3A 3GIIA 3NS7B 2OKQA 2XLIA 2CPXA 1UP1A 2E7VA 4PRFA 3MXHP 2HWHA 3V5RA 4BC9A 2F63A 4ANCA 1FEHA 5GMEA 1VQPS 4IRDA 1YK9A 2CPFA 1Y5LB 3W9IA 2B9YA 4XPCA 3B82A 2UVWA 4ECZA 9RUBA 2X1AA 2KO1A 4QWBA 1SQFA 2NZCA 4NASA 2C28A 3D2WA 4WIIA 5A6WA 1RI7A 3FBBA 3IGVA 5DLGA 1RADB 2HBYB 5GMKa 5DQGA 2YKMB 4TU8A 2J0QD 2MZ1A 1RHMB 4U7UD 4FYYB 2KT3A 1FVQA 1GX5A 5IQQA 2NSCA 2O67A 4PAAA 1KKHA 1XR5A 2ZHAA 3P6YC 1R8AA 1UPMB 2FJWA 4PUOA 3I82A 3AJ2A 1RBLA 4IDKB 3NOGA 3QJPA 2DNYA 3T9ZA 3MCNA 1RT3A 1JMTA 3R6LB 2QL5B 3IG1B 1T3NA 3ONQA 4AT1B 3DLLQ 2DRBA 4YB1P 1UTAA 4ZVRB 2PN6A 5HSPA 4DFPA 4I1TA 3W7BA 1X5PA 3BF4A 2GMLA 2FVCA 4UF4A 1XERA 4AD6A 4WWSA 2PFDA 1QUVA 1FHTA 3T1AA 2RIJA 4TU9A 1N56A 4O4GB 1J2VA 3EZ5A 2KM8B 3DLGA 1N32F 3NS5A 4IFVB 4ZLNA 2L3MA 2BVZA 4DBQA 2BJEA 4K2XA 5KT2A 4LF9J 2BJ9A 3HM9A 1CC7A 2Q6BA 1HQEB 1LV5A 4RUAA 1NK6A 4USMA 2W1BA 3KFWX 4JI2J 1NK0A 2VC0A 2B4UA 4A8SA 1VFJA 1I6JA 5L9NA 3N28A 3RBXA 1PSDA 1TR0A 4DV4F 4I64A 3FRZA 3ZTRA 4WBFA 4L74A 1VR6A 3M6UA 1GXTA 4HKQA 1WDDA 3TVZA 1UVKA 2HHXA 4PQUB 3G4SS 4OLOA 3G9CA 1U26A 4CIOA 1O0PA 1Q0NA 2KG0A 2JVOA 2XC9A 3NGTA 4ILLA 1Q81T 2UUAF 1V5VA 3VAFA 1IBKJ 4KHRA 2DR5A 1T0TV 2DEIA 3MM6A 1VQ4S 2KZZA 4KH1B 2VFUA 2QMWA 4DL7A 3M05A 3CB4A 3BYPA 5E7OB 2LDYA 2MZSA 1UW4A 1WF1A 3K7RA 2VB6A 1DURA 3KHLA 2AGQA 3R5GA 1PAUB 1W7WA 1Y5IB 3C6TA 3PYDA 1U2FA 1T05B 4DCOB 3GR1A 1U1PA 1SUQB 2Z2LA 4IO1A 1QE1A 1NH8A 4CYUA 4WFNQ 3AQPA 5KFXA 4F0HA 5IWAJ 1R89A 3LPEA 2YPYA 2JNJA 3RW7A 2AGPA 2D74B 4AXJA 4PEOA 1JXVA 1H2TZ 3JTPA 1OS5A 2FJVA 1AROP 3JTOA 2CQ3A 2D3ZA 4QIGA 4LF1A 3J7YU 2G9OA 4FF1A 3CJQA 3H5YA 2VPXB 2UUBF 2ACYA 3UFCX 3D4JA 2Z4PA 3D5MA 1R7IA 5A6PA 2VJVA 3MM9A 4A47A 1U25A 2CPDA 2O3DA 3EZOA 2RF2A 5GADU 1WOPA 4FDFA 3QRRA 1T03A 3K8WA 1BUXA 4CLYA 2QTWA 2GO8A 1JJCB 3OSNA 1PKUA 4K4VA 1Q95G 3KLFB 2E29A 2HBZB 4HLBA 1D1UA 1H98A 2D69A 2NZ4A 3KG0A 3D7SB 3R27A 4NLWA 4QIEA 2IRXA 5C25B 4QU6A 1PBAA 4DU8A 4IO9Q 4RBUA 2W4CA 4QIVA 5MAOA 2WVFA 2BYCA 3ZZTA 2GFFA 1Q86T 3C2PA 3ZZPA 2DHHA 3HVWA 3TEHB 3IMQJ 3KMQA 1VC5A 1SH2A 3D67A 3PYEA 5IV4A 3SDEA 1PJ6A 3GIRA 1XMOF 1NPRA 3CJ3A 3PX4A 3T3FA 4A46A 3CCJS 2J5AA 2AX0A 3M8WA 4MYUA 2HYIB 2PEHA 3RBEA 1CBKA 1N34F 4CNYA 1S12A 5AXLA 4Q45A 4KV8B 3H4DA 4J9UE 4DR4F 4RJVA 2HSEB 3PRDA 3QT6A 6FD1A 1HWLA 2EC0A 3WDOA 4DR2F 1R6YA 4KBIA 4LQ3A 1PGZA 5C7PA 2AQ4A 2AGOA 4ZJOA 2Z2YB 4RW8B 3THVA 5C24A 4DV4J 1YJ7A 4D3GA 4ZVQB 5J1EB 2LXIA 3OXFA 2QL7B 1B70B 2E1CA 1RT6A 4WK3A 3DKDA 1S4FA 3MM5A 2DHAA 2DEJA 1UETA 4M5MA 1N5YB 2UXBF 4CLWA 4NLQA 4PCQA 5K14B 5EN1A 2ZD1A 1ICEB 3KLVA 2KTQA 2DCLA 2OSRA 3SXLA 5J2PA 3J7A1 2MKKA 2UUAJ 4P7VA 3FQLA 4DPYA 4FKXA 2RQMA 2BV3A 5A8RB 3V6HA 1HQUA 3EWGA 2M8HA 2V67A 4ZDNA 4B3TF 3ZXWA 2VFVA 2WVCA 1BQMB 2FC8A 1YG0A 5KFTA 3KWMA 1HYSA 1SI9A 5DJBA 2K06A 2HVHA 1AT1B 3E01A 2E7WA 2CQ4A 3VVTA 4WU3A 2H5JB 3MAAA 2V4JB 2KB2A 3TI0A 3EXYA 4HDHA 3OVBA 2DHSA 4RNFA 1JLFB 1R31A 4ES3A 5E3AA 4M5DA 4MK9A 3RU0A 2EFOA 2DVIA 1KFSA 4C3LA 4NRTA 1B7YB 2B9EA 3OTOF 5DO2A 4KPYA 4ELVA 5K20B 2LXUA 1KQGB 1QSSA 2K2PA 4KJIA 4GKKJ 4NEYA 1FK9B 4DFMA 5I3QA 5LL6d 2RILA 1NXIA 4QWDA 1VQLS 2Z56B 1AZSB 5KT6A 3DRXA 2HNYA 3QGPA 1FTRA 2DNGA 4X66F 4IG0B 1U1QA 2UUBJ 5DM7Q 1D9FA 4AXIA 2C2RA 4D3HA 2OELA 1F9FA 3PKMA 5HATA 5KT7A 4NLSA 3IAS9 5IQ6A 4HHJA 4OJ3A 2DGOA 5F8LA 3DM2B 4K4WA 2DGSA 2K1RB 3HULA 1IUJA 1OWXA 5D8HB 3PRBA 2ADCA 4IQMA 1LWEB 2N4CA 3FK4A 3AA8A 3ZC4A 5JUMA 2QO3A 1V9OA 4OI4A 1H38A 1HI8A 3M9MB 2K3IA 3FSXA 1ZTTA 3CJTA 2XMAA 3QO9B 2OPPA 4WK1A 5CZVA 4DF4A 1FX4A 2V5HG 3QYYA 4NXMF 4C6AA 2HFZA 1L3KA 1Q7YT 2G0CA 1REGX 3DXBA 4DJBA 4BWJA 3HSGA 4JYAF 2VFSA 3EUNA 2E5JA 4JBCA 1S10A 3R1LA 3CMQA 2GX8A 3H7HB 1OMSA 3VAMA 4OYOA 2O01C 1Q16B 3DU5A 4BBYA 3KTQA 1B0PA 1V6HA 1XMOJ 3RB4A 4NCAA 3MD3A 4J7CA 1FNMA 3VGTA 2RDDA 1RTJB 4J9QA 1FRXA 4DUZF 4EZ6A 1NDCA 2C3PA 4J9SA 5A0YA 4YR2A 2IYGA 1N34J 1WC4A 2WB4A 4KKOB 4H4MA 1X31C 3KK1B 2MPUA 4ZCLA 2BZ2A 4RUBA 5L38A 4DR2J 2EW9A 3ETOA 1MROB 5FLXU 4E0DA 3QLHB 1UVLA 1DLOA 3K5NA 2GAHC 4OHZA 2QEXS 3QFWA 4J9RA 3BEGB 1TL3B 2YQ3A 2DNRA 1RZMA 4GO7X 4NCGB 3PKYA 1Y7PA 1ZZNA 1DTQA 4YHHF 1ZM2A 2UXBJ 1R43A 2IM2A 2LP4A 1LW0B 1X4AA 5F8MA 3RAQA 3G8SA 2Y0SD 1CEZA 3UDLA 4TY8A 3FRYA 4GVBB 3MWBA 2KKHA 2ZJRQ 4FNHA 4IOAQ 3MAHA 2HQDA 1QAXA 4B3TJ 2VC1A 2MQMA 2E1PA 3DRYA 1TL5A 1NZ8A 4NEZA 1KR4A 4WFYA 5IT9Y 5D0EA 3POTA 4KE5A 3GYNA 1S72S 3BREA 4ZPWR 4PQAA 2VV5A 5HI7A 2QLJB 2UXCJ 4LVNP 4NYOA 3QSYB 5J2MB 2CDRB 1SL0A 4DSJA 2XS2A 1XN9A 4ZN1A 3OTOJ 2HVIA 1CULA 2YNGA 4OYXA 4MIAA 5HMXA 4Q5VA 2MSTA 5MLCV 4KGVB 4CLFA 3ILIA 2XMMA 2YWEA 5CHCB 2YWKA 4LRBA 4NCBA 3W2VA 2J8SA 4WZQA 3ZTSA 2CQ1A 2FVQA 3CCVS 2ZE2B 3M2UB 1TK0A 4DR5F 4X66J 3V4MA 2RKIB 2C2KB 2OPQB 4O3SA 2W7OA 2Z30B 3FZ2A 2J6SA 1X9MA 2XO7A 2XMVA 3MDFA 3IAM9 1S1UB 4UY8T 3MUTP 1WG1A 2B56A 2LVWA 3AOAA 5HROB 3KJQB 2WAQD 4OX9F 3H98A 3FGVA 1QTMA 1N8RT 5KFGA 2ZH6A 3MM7A 4ZLLA 2E5IA 1J5OB 4F8RA 3MFHA 2ZH2A 1P8GA 2AZ3A 5H9FJ 2GJIA 3I5CA 1JKHB 2GJFA 1KONA 2V2ZA 4DZ6A 2VDIA 3I31A 4NXMJ 3ET6B 4I67A 4PG5A 2R2RA 1RQ0A 5IC4B 4JI8F 1Q8IA 1YDLA 1U0SA 2LQ8A 3UDEA 3HHDA 1EKSA 2L48A 1S9FA 2CVEA 2DGVA 3CGIA 1DQAA 1EZZB 3MEDA 1BY9A 4TXSA 4QIFA 3PV8A 4P71A 1GTEA 1SPBP 4J37A 3HSDA 3T9NA 3DMJA 4DUZJ 3B6BA 4JOUA 5EHHA 1R8CA 2VBWA 2BANB 4OJGA 1REVB 2I5JA 1U1LA 5CYMB 2L41A 2XWYA 3FQKA 4JV1A 1BD6A 4HI2A 1KLMB 5I42B 1KFDA 1RAIB 1BQNB 3KUGA 3AD9C 1JLAA 3CUNA 4ECVA 2WSFC 1FRMA 4CT9A 3MOJB 5LT5A 2IJFA 4HL9A 2EBGA 3CJRA 3CULA 1WC5A 4J9MA 3H8YA 2NUHA 3OFFA 1EARA 3BN4A 2NXNA 3M8QB 1FRJA 4F3QA 5LMNF 4ECRA 5E5NA 1WG4A 3UD5A 1EAYC 1HI0P 4RWXA 2VQFJ 4K5RA 4WF9Q 2I1RA 1P9QC 1D3WA 3JS9A 2N7CA 4ZPBA 1T3OA 5HVGA 1RJJA 2CQ0A 2KG1A 4QOTA 1N36F 4DZDA 2O1PA 4ZA1A 4NX9A 1Q8KA 2RQ4A 1RWXB 1YRXA 2FVSA 3IRXB 2XMWA 3OUYB 4DSLA 2M5YA 2CWXA 2H48B 4DUTA 4IG3B 2JDJA 5J2NA 2DH7A 4URSA 4ID5B 2V2KA 3DHWC 2MKCA 1Y00A 4LF5F 4WXWA 2VG6B 4ES2A 2PEBA 3BGFA 2OTLS 2GA7A 3G2XA 3PRVA 5E3QA 1RDRA 1UWBA 4X4SA 2HBRB 2GAGC 1NJZA 3AB2B 4LIRA 1Q79A 4DSIA 1N88A 2NXCA 1FTCA 1LW2B 3L9ZA 2MMYA 3Q8UA 2YKNB 2JC1A 4NLYA 5ETVA 1JNRB 4ED7A 2KJVA 4LRCA 1M5HA 1CSJA 2RH3A 2B7BB 2F3JA 2FDNA 3G86A 2AMCB 1SBRA 1NEEA 2CUYA 4HTJA 4U96A 1G6BA 1L3SA 4X64F 2V8DA 2AU0A 4DR5J 1QLNA 2DR8A 2EKYA 2Q6CA 4KB7A 3BKUA 3QGHA 4CO0A 2R8HA 3FCVA 5THWA 3LP2B 3RTVA 1UFWA 2HZVA 2CFXA 1EQMA 4F2SA 4DUYF 4OX9J 5GADI 3ETMA 2MQPA 2ZWPA 3PJXA 1FDAA 2L9NA 3EICA 3G96A 3GJTB 5KOXA 2D7SA 2PMZD 4ZHRB 1CS4A 2HQIA 1WJ9A 1DQ8A 3QAUA 4O0NA 3ISND 1S1WB 1IKWA 3MMBB 4JI8J 2IJRA 3HX9A 4BC7A 4DR1F 1RBOB 4RW4A 2UP1A 3WZ0A 2H5EA 2CJQA 3MI7X 1NCLA 3N4WA 4W98A 1NM2A 4ZCIA 1RTHA 2L9DA 5F0WA 3KK3B 2HFSA 1S6OA 3CSKA 3EM1A 1IWGA 4M5KA 1FCAA 1JLBB 1HARA 5J1NA 3MR5A 3SCJE 4PWWA 2RRNA 4IRKA 4RO0A 3KLGB 3OLAA 2HQFA 4KR0B 2J7KA 3FEZA 1QSYA 1NK9A 4WZMA 3BDPA 2IJNA 2VQEJ 1X4FA 5KFZA 2Z57B 1MMLA 1TFWA 1GK8A 3M9OB 1SIWB 5DM6Q 3KK2A 4BDPA 1WHVA 3BN7A 2XGPA 1UWAA 4CLTA 1YBAA 1NSAA 5IXUA 4I2PA 5LMNJ 1YIJS 1PYOB 1L3VA 1RYSA 1S9EA 4CO4A 4Z7CA 3H2LA 1KQKA 3F44A 1TAQA 2DISA 1SJFA 2CPEA 1OO0B 2KYZA 4HVZA 9ATCB 2FJBB 3I55S 2EWHA 2BW2A 3OXGA 2HEKA 4F0KA 5CYQA 4DV6F 3TANA 1WHYA 1PCAA 4R5PB 2CADA 3BBFA 1S1TB 1GAOA 2VZ9A 2WVEA 1H73A 1S1XA 4Q2MA 3CDAA 2I0XA 2M0GB 5HLFA 5GMDA 3TAPA 4PYDA 4CM2A 3UR0A 2CPZA 1LOUA 3R5BA 1GMWD 3BGUA 1OYDA 2F4VF 4Y00A 4RX6A 3E3XA 4OZNA 3PO4A 4MAKA 2WSCC 3DRSA 1CVJA 1Z4UA 5KTQA 3KJVA 2PFFB 5L39A 1WD6A 4TY9A 1IKXB 2RMLA 4IKAA 2V63A 4B9VA 1UVJA 5F9LA 3KLIB 5HJXA 4X4VA 3THPA 1X5SA 1A7GE 2UUCF 4B9NA 4LSNB 5JVGQ 1RWNB 3I0SB 2ILYA 1JLGB 4YR3A 2CRLA 4NA3A 5KG3A 3RB6A 3PW7A 3UCUP 2JRSA 2HNDA 4X64J 3HZEA 4FS2A 3DOMB 2XO6A 3RBZA 3NWGA 3I4PA 1IBMF 1VRTA 3D6HB 4WE1B 4CP5A 2CPHA 2I8EA 3MPUB 4KFBB 4F4KA 4XAKA 4DU7A 1HI1A 1HBUA 1O6XA 4DUYJ 1T9WA 4FS1A 4G1PA 1OY9A 4LR8A 4MKBA 3TVYA 4ED8A 1B0TA 2AP6A 3MEEB 5M2UA 2CG4A 4RWWA 3MFIA 4KGZB 2KVQE 1H6KX 2UXDF 2BMBA 3NGUA 1ELOA 1U6FA 4EO6A 1C0UA 3QIPA 4QZVB 3DLKA 4KH0B 4Q0BB 4WTOB 3M8PA 3K58A 4DR1J 3JTNA 3W64A 5A8WB 3IP0A 3D3BJ 3CJKB 2DYAA 2IAJA 3GJSB 3QSIA 1QJHA 3HFZB 2MSSA 1X0PA 1RACB 4B9SA 4P2XA 3VAGA 2V69A 2ZVIA 2LKZA 3EVOA 3HK2A 2M9KA 4ER8A 4CZCA 2CJAA 1HBOA 5KG0A 4YOEA 1CJUA 1WELA 2MY7A 5C2GA 1FD8A 4NI2A 1RISA 3CIMA 4RNOA 2GCFA 4ATNA 1HHQA 3M4XA 2MZTA 3NNAA 3P8BB 3EGWB 2GHVC 2YNIA 1K44A 4CWBA 4QPXA 3OFGA 1WTBA 2IC3B 2ZFHA 4ED2A 3SBMA 2A2DA 1X7VA 1NB2A 4JB8B 1UKUA 3BPDA 1TK8A 3JSYA 3DCAA 3Q22A 1R0AA 1JLEB 1F2HA 2XSFA 1CJVB 3AXMA 1MU2B 5M2PA 1N6QB 5KT3A 8RUCA 2FLPA 3I56S 2OJ3A 4ZPTR 2GZOA 4IOBA 3GE9A 1SQEA 3R7BB 2ZJPQ 1X9SA 1UPPA 1N54B 3CDWA 2FD2A 2VUGA 4MK7A 2E9RX 5L1JA 2LLZA 2DNZA 3M6XA 3T1HJ 1X4HA 4DR6J 3RG6A 2DGUA 4MKYA 1NKBA 2F4VJ 3IWLA 3CD6S 3S6EA 3G6VA 2HMIA 4DQRA 4MIBA 3TP2A 1HMVB 4Q2LA 4NXNF 3CJ2A 2QSWA 4USHA 5D3GB 2KL8A 1S79A 2UUCJ 2I38A 2E5LF 1YBUA 2HQ3A 1KC8T 5K8PA 3IS9B 3V2UC 4KRWA 3KMSA 2Q3PA 4ILRA 3CJ4A 3OHBA 4DF8A 1RHUB 3NBPB 3GONA 3K5LA 3DXSX 3EJMA 1SC3B 1YI2S 1IR2A 2W9AA 4K0KJ 2BX6A 1JX4A 3G6ES 2OTJS 4LRFA 3UVJA 3MGJA 3NAHA 1WUUA 3DRPB 1IBMJ 1C1CB 3UI3A 4Y2KA 1UAWA 1EETB 4RUHA 1X4CA 2GMHA 1LFWA 4CT8A 4ZLPA 5E41A 3W2WA 1RAAB 2Y8WA 4JV2A 3U1NA 3W62A 4DPOA 4GO5X 3MEGB 4ZVSB 4FF2A 1WG5A 3A1YG 4RU2A 3V6KA 4OI3A 2HGLA 5D0HA 3DLJA 3KG1A 4AQYF 4O44A 4ZVTB 2UXDJ 2DNLA 1GFWB 1FT8A 4DFJA 4K4XA 3QWUA 4ZOSA 1MWYA
chains in the Genus database with same CATH topology
3EVMA 3FBBA 5BXIA 4EK2A 1S57A 1VYAA 1BHNA 1BUXA 2AZ3A 3Q8UA 3GPAA 1PKUA 4O0NA 1NB2A 4ANDA 4HR2A 3ENAA 3NGRA 1S59A 4DZ6A 3VVTA 2HURA 3Q8VA 3EMTA 1W7WA 1BE4A 4KPCA 5C7PA 1MN7A 2NCKL 1NDKA 4ENOA 3BH6B 5CAAA 3Q89A 2DYAA 2DXEA 1LEOA 4F36A 3VGVA 4DI6A 2HVDA 2BEFA 1S5ZA 3R9LA 5CABA 1XIQA 4C6AA 3EJMA 1NCLA 3ELHA 1PAEX 4W98A 1WKJA 2B8PA 1B99A 2BX6A 3JS9A 3FBEA 3GP9A 1WKKA 1HIYA 3ZTPA 3VVUA 3B54A 3EVWA 3EM1A 3FC9A 1B4SA 3ZTRA 4UOHA 3DKDA 2CWKA 3NGSA 3Q8YA 4WBFA 3BBFA 3EVOA 4FKYA 4UOFA 3ZTSA 1JXVA 1F6TA 4CP5A 1NDLA 4S0MA 2VU5A 3VGUA 3B6BA 3FBFA 3PJ9A 1XQIA 3FBCA 3ZTQA 1WKLA 1NLKL 3FCVA 1F3FA 1HLWA 4DUTA 2DXDA 3BBCA 3VGTA 3FKBA 3ZTOA 1NUEA 1NPKA 4ANEA 3L7UA 1NDCA 3Q86A 1MN9A 3NGTA 4FKXA 3MPDA 1NSPA 2B8QA 3VGSA 4ANCA 2DY9A 1U8WA 2HVEA 1HHQA 1LWXA 1ZS6A 2AZ1A 3ETMA 1NDPA 3G2XA 3PRVA 1EHWA 1NHKL 3FCWA 3EE3A 2DXFA 3Q83A 1K44A 4UOGA 3BH7B 4F4AA 1KDNA 3DDIA 3EICA 3BBBA 1UCNA 5IOLA 3WX8A 1NSKL 3NGUA 1NSQA 2ZUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVM A;  3FBB A;  5BXI A;  4EK2 A;  1S57 A;  1VYA A;  1BHN A;  1BUX A;  2AZ3 A;  3Q8U A;  3GPA A;  1PKU A;  4O0N A;  1NB2 A;  4AND A;  4HR2 A;  3ENA A;  3NGR A;  1S59 A;  4DZ6 A;  3VVT A;  2HUR A;  3Q8V A;  3EMT A;  1W7W A;  1BE4 A;  4KPC A;  5C7P A;  1MN7 A;  2NCK L;  1NDK A;  4ENO A;  3BH6 B;  5CAA A;  3Q89 A;  2DYA A;  2DXE A;  1LEO A;  4F36 A;  3VGV A;  4DI6 A;  2HVD A;  2BEF A;  1S5Z A;  3R9L A;  5CAB A;  1XIQ A;  4C6A A;  3EJM A;  1NCL A;  3ELH A;  1PAE X;  4W98 A;  1WKJ A;  2B8P A;  1B99 A;  2BX6 A;  3JS9 A;  3FBE A;  3GP9 A;  1WKK A;  1HIY A;  3ZTP A;  3VVU A;  3B54 A;  3EVW A;  3EM1 A;  3FC9 A;  1B4S A;  3ZTR A;  4UOH A;  3DKD A;  2CWK A;  3NGS A;  3Q8Y A;  4WBF A;  3BBF A;  3EVO A;  4FKY A;  4UOF A;  3ZTS A;  1JXV A;  1F6T A;  4CP5 A;  1NDL A;  4S0M A;  2VU5 A;  3VGU A;  3B6B A;  3FBF A;  3PJ9 A;  1XQI A;  3FBC A;  3ZTQ A;  1WKL A;  1NLK L;  3FCV A;  1F3F A;  1HLW A;  4DUT A;  2DXD A;  3BBC A;  3VGT A;  3FKB A;  3ZTO A;  1NUE A;  1NPK A;  4ANE A;  3L7U A;  1NDC A;  3Q86 A;  1MN9 A;  3NGT A;  4FKX A;  3MPD A;  1NSP A;  2B8Q A;  3VGS A;  4ANC A;  2DY9 A;  1U8W A;  2HVE A;  1HHQ A;  1LWX A;  1ZS6 A;  2AZ1 A;  3ETM A;  1NDP A;  3G2X A;  3PRV A;  1EHW A;  1NHK L;  3FCW A;  3EE3 A;  2DXF A;  3Q83 A;  1K44 A;  4UOG A;  3BH7 B;  4F4A A;  1KDN A;  3DDI A;  3EIC A;  3BBB A;  1UCN A;  5IOL A;  3WX8 A;  1NSK L;  3NGU A;  1NSQ A;  2ZUA A; 
#chains in the Genus database with same CATH topology
 3PYG A;  4DL6 A;  2HRY A;  1BHN A;  2B4V A;  2LDI A;  2V9W A;  2OO4 A;  2XEX A;  2J9C A;  2P9E A;  5GVQ A;  1SJ3 P;  4ALZ A;  1NK5 A;  2AEM A;  3TJ9 A;  2AHO B;  4KPC A;  5B08 A;  3CD7 A;  1BQX A;  1S1V A;  1RTZ A;  4ZVO B;  4U67 Q;  2N3L A;  1HBM B;  5HJY A;  1QVG R;  3L7O A;  2IMO A;  3BO2 A;  4DS4 A;  4ZN3 A;  3M6V A;  2C2E A;  3TAQ A;  2CWK A;  5G0R B;  3SQO P;  4FKY A;  3HVA A;  4LRE A;  2BKP A;  5HP1 A;  2R7Q A;  1NU4 A;  2B5J B;  2AYG A;  4GKJ F;  4GRS A;  1L3T A;  2VG7 B;  4FYX B;  3KUH A;  2HGM A;  4Z2X A;  4ANE A;  3LH2 S;  3Q86 A;  2B6A A;  2CJB A;  1JB0 C;  4DSF A;  3JYT A;  3P4U B;  1TVR B;  4M5L A;  3T5K A;  1SV5 B;  4B3S J;  4C0B A;  3BBB A;  3BO4 A;  4QCL A;  4N8O A;  4OJ1 A;  4EU0 A;  2DGQ A;  2J0W A;  1FKO B;  3IM8 A;  2GVD B;  5H9E J;  4C8N A;  1FRH A;  5LJ5 Y;  3ILO A;  2HFO A;  3FEX B;  2H51 B;  3D6M B;  4YY3 F;  1FWK A;  1P1L A;  3Q8R B;  5KFC A;  3RBD A;  4TQS A;  1TL1 A;  2CQB A;  3B8H A;  3F73 A;  2LEC A;  4HI1 A;  4NLV A;  1S5Z A;  4DV7 F;  1WTF A;  4KTQ A;  5A2Q U;  3KNG A;  3DGP B;  3UD3 P;  1KQF B;  1HPZ B;  1ZA1 B;  3GIK A;  1OSD A;  2IPO B;  4CQ1 A;  1E6V B;  1D0E A;  3KKF A;  1YSJ A;  4C11 B;  1S6Q B;  4DL0 C;  4OLP A;  3H2U B;  1ZM4 A;  2N82 B;  1G1X A;  3J80 U;  3ULH A;  2Y9H A;  1N5S A;  5T7L A;  1ZBT A;  2HNY B;  3A3N B;  3HKW A;  3K0J A;  4QIW D;  4H4O A;  4NXN J;  3QAE A;  3PX6 A;  3L3C A;  3H0P A;  2X3D A;  2MLY A;  1RU2 A;  2ILZ A;  3R97 A;  5GAG U;  2HZC A;  2E5L J;  2RT3 A;  3H5U A;  5IOL A;  3R1H A;  2DHG A;  3GLJ A;  2CQD A;  4R8U A;  3WQP A;  3ZZU A;  1PC4 A;  5LOQ A;  1J27 A;  2VKR A;  1IVZ A;  3DI6 A;  2JOQ A;  1SKW A;  4UUW A;  4B9L A;  1XNR F;  2CJK A;  3DLE B;  1U1M A;  4C3M A;  4DX8 H;  1VRU B;  4MJK A;  3ITH B;  2W9B A;  2V34 A;  3D0H E;  2MGZ B;  2RRB A;  2DIV A;  2J8A A;  2V4Q A;  2Y1I A;  2CA9 A;  3F41 A;  3DLH A;  1HQ2 A;  3ILJ A;  3DYA B;  2BKN A;  3IWN C;  3NMR A;  5A8K A;  3WC0 A;  2AJ4 A;  1URN A;  3UR3 C;  4ZLJ A;  5IM0 B;  4AQY J;  4UQG A;  2VOO A;  1S9G A;  4P75 A;  1XK8 A;  4CNZ A;  5H1S V;  3MPY A;  3IC1 A;  1UVN A;  5A76 A;  3T1Y J;  4LQ9 A;  4Y3C A;  2P2C B;  1RB0 A;  1DHM A;  2AYE A;  1OPI A;  1HNX F;  1S4E A;  5B0G A;  1U8S A;  1QUP A;  2B43 A;  2MDA A;  4RW6 B;  3RR7 A;  2X1B A;  2CZ9 A;  3U1L A;  2OI2 A;  2EFV A;  4QYZ J;  3PG9 A;  1VQN S;  2RJZ A;  2UZA A;  3FMB A;  1RA7 A;  4LBI A;  1LWC A;  3DOL B;  2L08 A;  2H5I B;  1YJW S;  3CXC R;  1VIO A;  1VRQ C;  2WBM A;  2ZOM A;  2QL9 B;  2C3Y A;  4DV0 F;  2PMH A;  3G71 S;  4GKJ J;  3RRG A;  4I6W A;  2QE5 A;  1NPP A;  2G2Y A;  1T7P A;  3PJ9 A;  5GAH U;  4KYZ A;  4DX7 A;  2B9W A;  4DS5 A;  3CW2 C;  2HKE A;  2KYX A;  1IXK A;  2NXE A;  2X7I A;  1K0T A;  2BJD A;  2WON B;  3N5F A;  2C1E B;  1NBE B;  2WW4 A;  4ITS A;  5F3T A;  3CCU S;  1H2U X;  2HK2 A;  1P27 B;  2DJW A;  3SFG A;  4ZPD A;  2YX1 A;  3HCX A;  4RR5 A;  3VZI A;  2XCP A;  2OPR A;  5J2Q A;  3W9J A;  2ATC B;  4YY3 J;  4N8N A;  2V0N A;  4ECT A;  2MQL A;  4CO2 A;  1KNZ A;  4MFB B;  2EI5 A;  4HR2 A;  2HFN A;  4NZ0 A;  2CZ4 A;  1RT1 A;  2YVS A;  4FYW B;  4RW7 A;  4DV7 J;  1S97 A;  3V6D A;  1A9N B;  4L76 A;  1G7C B;  1U2C A;  5GAE I;  8ATC B;  3PEJ A;  2RB7 A;  1KLN A;  5CH7 B;  2DH8 A;  4TKT A;  1DAR A;  4NL5 A;  1LWF B;  2ZH4 A;  3QGG A;  2RRA A;  3I5A A;  2LFV A;  3OT9 A;  4ZVU B;  2BE2 A;  2ADB A;  3EX7 B;  4DQS A;  2ZBR A;  1IWA A;  1RWU A;  5KFN A;  5IT0 A;  3SSS A;  1IKY A;  4DSK A;  1RWV B;  3T5H A;  3VGS A;  3N01 A;  3THT A;  2WOM B;  1SC1 B;  4G1I A;  1UA0 A;  4ZCM A;  4O3N A;  2VPY B;  2UUW A;  5CD4 A;  4KC5 A;  3J81 Y;  3B4D A;  3NAI A;  3UWT A;  5T14 A;  4DG1 B;  3HHE A;  1XMQ F;  4QYR A;  1G4C A;  1VBZ A;  2V2V A;  1U0H B;  3DGV A;  4LRD A;  5L1L A;  2YKM A;  1N48 A;  3ELH A;  2BOA A;  2FHO B;  3HD1 A;  3FJ2 A;  3GYX B;  3RR8 A;  4EO8 A;  4K8R A;  2NUU G;  2XHC A;  1T9Y A;  3J7Z T;  2ASJ A;  4G6V B;  5HMY A;  3FSY A;  5B0B A;  2BJ1 A;  1KOO A;  2LEB A;  1B3T A;  4IDK A;  5E3R A;  4EWT A;  2BM1 A;  2FHJ D;  1Q1K A;  1LNQ A;  1PIE A;  3IG1 A;  3M8Y A;  4P10 A;  4PXE A;  3NCP A;  2BOP A;  4HH1 A;  2CPJ A;  2C2Z B;  1T9X A;  2D1C A;  4URG A;  4P9S A;  1HNX J;  3FCW A;  3LPY A;  2MHE A;  3UDV A;  4RW9 B;  1RKJ A;  2XI2 A;  5DDQ C;  4DXL A;  3HHL B;  3T19 A;  3AH6 A;  2ZBP A;  6FDR A;  1AB8 A;  4RL1 A;  3CDU A;  4G1Q A;  1R6V A;  2W4P A;  3GYG A;  2YWG A;  2MB0 B;  3ENW A;  2QMX A;  3KLH B;  2QFJ A;  4O4G A;  1BE4 A;  2WSE C;  4BHQ A;  1VHI A;  4IFV A;  1YQH A;  3GIJ A;  1HNI B;  4C8M A;  1PAE X;  4CTA B;  4DV0 J;  5L8R C;  4DQI A;  1H72 C;  3JAM Y;  1HQE A;  3C6U B;  4C2M A;  4OZ0 A;  1RCX B;  1FNX H;  4PXB A;  4PZV A;  3T5L A;  2VOD A;  1JK9 B;  2DNP A;  2W7A A;  1ZPV A;  3DN9 A;  3PXG a;  4IFY B;  1ROF A;  4ZP7 A;  3SV4 A;  1IM6 A;  3MPD A;  2GVZ B;  2KVI A;  2U2F A;  4PQU A;  3OVA A;  1RTI B;  1KTQ A;  1RAH B;  2LA4 A;  2RU3 A;  4ZJQ A;  2NPF A;  2M3D A;  3GIM A;  2J9D E;  2CJX B;  2GQQ A;  3GWC A;  4J5O A;  2HHS A;  4Z37 A;  5DDO C;  8AT1 B;  2V2Q A;  1ZPW X;  2VKZ G;  5KFF A;  3U1M A;  3A12 A;  4ED1 A;  4I68 A;  4F4Z A;  4YS2 A;  2G2Z A;  4X4U A;  2BDP A;  2YNF B;  1VQM S;  1FDD A;  2KXF A;  4O3Q A;  2CZV C;  4QW8 A;  1UJ6 A;  1T05 A;  2OD6 A;  1XEZ A;  1SUQ A;  4CLU A;  1IR0 A;  1T94 A;  2F40 A;  1F0X A;  2NYI A;  4B9M A;  2MYF A;  1QAI A;  3RW6 A;  4CLP A;  3W5Y A;  2CQC A;  2JEI A;  4ZJL A;  3E51 A;  2PDA A;  3K59 A;  1HBN B;  1S6P B;  3FFI B;  3Q83 A;  1AUD A;  2DCU B;  2LU2 A;  3U7J A;  2QLW A;  1ZH5 A;  1S76 D;  5F8J A;  3HJV A;  1V3Z A;  3AA9 A;  3MMA B;  3KOA A;  1CS4 B;  1S7I A;  4YN3 B;  1XMQ J;  2ALY B;  2RQK A;  2RS8 A;  1N5T A;  2BR0 A;  4OL8 A;  4Y65 A;  1JLQ B;  2AX1 A;  1QM9 A;  2XG8 A;  4ZVE A;  4M5G A;  1XWL A;  4M94 A;  1FJC A;  3KLF A;  4IYQ A;  2DH9 A;  4M8L A;  1HFE L;  2J6U A;  4ILM A;  1RGV A;  1EX8 A;  3W5Z A;  2U1A A;  3CCZ A;  5C25 A;  4QQB A;  2NLW A;  4ECQ A;  4IR1 A;  1GMV A;  4FPI A;  1UVM A;  3N79 A;  1VHF A;  5KFY A;  1UA1 A;  2E7X A;  2ZM6 F;  3I5B A;  3P45 B;  1RT4 B;  4AL7 A;  2AZ1 A;  4LF7 F;  1EKR A;  4DHV A;  3MMC B;  3Q8Q B;  2AV5 A;  3L95 X;  1Q4R A;  2UVU A;  2W9C B;  4I7F B;  1GXU A;  2IDL A;  4LFA F;  2Q43 A;  3OQ2 A;  3IWX A;  1Z2Z A;  2FLL A;  4JV0 A;  2YPZ A;  1UEV A;  5BXI A;  4CO3 A;  1WI6 A;  4RNM A;  5LMU F;  5G4D A;  2JLG A;  1F5B A;  4B02 A;  2C2N A;  1UJ4 A;  1QY7 A;  1VI7 A;  3HF5 A;  4KV8 A;  3P49 B;  1FVS A;  2NYH A;  1FWP A;  3BZQ A;  3R9L A;  3SCK E;  4M5H A;  2R8K A;  2ZDP A;  3VTI A;  1RTD B;  3Q23 A;  5CCM A;  1RHQ B;  3CMA S;  5F0U A;  4LF8 J;  2CQP A;  4DPT A;  4WP9 A;  1XNQ J;  5DZ6 A;  2NXJ A;  4OHV A;  3ZZZ A;  5F8G A;  4HTI A;  4RW8 A;  1HWI A;  4KO0 B;  2GIF A;  4CO1 A;  5J1E A;  2A0F B;  2QLF B;  1YZ6 A;  1NPK A;  3H59 A;  3CCE S;  1MMD A;  1N5Y A;  3UQS A;  2XQC A;  4ZK7 M;  4DV3 F;  2ZIT A;  3I9Z A;  5K14 A;  1TL7 B;  4NA2 A;  2JVR A;  3QQC D;  2KH9 A;  5IS2 A;  3MR7 A;  4XDC A;  4Y28 C;  5RUB A;  3WX8 A;  4KGX B;  5A8R A;  1RAJ A;  3CC7 S;  2ZC4 A;  2NXU A;  2BQ3 A;  4FN5 A;  3GV8 B;  2BAC A;  4OX8 A;  2CPI A;  3T6B A;  3SSQ A;  1GMU A;  5E3C A;  1BQM A;  4ICL B;  1KVJ A;  4K2J A;  5LJ3 Y;  4N5S A;  1XR6 A;  3QWP A;  5D4L A;  4XK8 C;  2BRK A;  3O8W A;  1HD1 A;  4L75 A;  4NLP A;  5B0F A;  3PW2 A;  1BWE A;  2V4J A;  4MT1 A;  3DOK B;  3M2R B;  5LXY A;  1JLF A;  2QJ3 A;  1CPZ A;  3A13 A;  3MD1 A;  4Y34 A;  3QBC A;  2VJU A;  1ZOT A;  4EYI B;  2IYI A;  2EG2 A;  4KHP F;  3MZI A;  3NY0 A;  2ZH9 A;  4EBE A;  3ZTO A;  2N4D A;  1VBX A;  1FK9 A;  4RU9 A;  1H2V Z;  1RCO B;  4KT0 C;  3CT9 A;  2IA6 A;  3GMG A;  4RZR A;  2ZH8 A;  3JSM B;  1AZS A;  1H7W A;  3C46 A;  3KXD A;  3D3C J;  2CIM A;  3K8V A;  1B0V A;  3CD0 A;  4IG0 A;  2X51 A;  4JI6 F;  1L3U A;  3Q24 A;  1M0S A;  1VQY A;  2HWI A;  2POK A;  3R5A A;  4P2M A;  3MCO A;  3LW5 C;  1SIZ A;  4U7C A;  4AND A;  5BYR A;  1Y10 A;  3GTY X;  2Z2Z A;  3DM2 A;  2K1R A;  4N56 A;  3TX0 A;  4JV5 F;  2KFY A;  3M30 B;  2J6T A;  3DDN A;  1LWE A;  2HWT A;  3UDC A;  3JB9 k;  2ZWO A;  3VAJ A;  1NKE A;  1URR A;  2JH3 A;  2XCA A;  1IKV B;  1SH0 A;  1JLC B;  1KEK A;  3QO9 A;  5BR8 F;  2LXF A;  3NGS A;  5F8N A;  3NRB A;  3LAL A;  2HIQ A;  2OUG A;  5DZ7 A;  3KLE B;  1M1K T;  2ZM6 J;  3OTB A;  2HLU A;  3LO3 A;  1QSL A;  3BR8 A;  1QD1 A;  2M88 A;  3CC4 S;  2LEP A;  1MMN A;  2QV6 A;  3OPK A;  3PCO B;  2CDQ A;  4LF7 J;  2JWN A;  3GSI A;  3TVK A;  2YH0 A;  4BCA A;  1APS A;  3HSZ A;  2NRE A;  2W24 A;  4LFA J;  3LP0 B;  1RTJ A;  3LGH A;  2HPU A;  5LMU J;  1VBK A;  4NLO A;  1KQS R;  3W3S A;  3ILL A;  2AD9 A;  1AUS L;  1PJ7 A;  3LTO A;  4KKO A;  5HL7 Q;  1DTT B;  1BXN A;  3KK1 A;  3C16 B;  1RBA A;  2VD3 A;  2RNE A;  5B7W A;  3TQE A;  3TAM B;  1F9H A;  4PWU A;  3US5 A;  1MRO A;  3IBC B;  1K47 A;  3SV3 A;  1SJQ A;  3QLH A;  4HH0 A;  4W92 B;  3W66 A;  4WFX A;  5ITH A;  4WYW A;  2BRL A;  3LAM A;  1TL3 A;  3J81 j;  2G1D A;  3LP1 B;  3AOC A;  1N32 J;  1H3D A;  1CG2 A;  1TKZ B;  3HLU A;  1NJW A;  2AEF A;  4NCG A;  3OR2 B;  1DZ5 A;  2AW0 A;  2DXD A;  3ENV A;  1UZD A;  1NHV A;  1LW0 A;  1TKX A;  3FZB A;  3CJ0 A;  4DLE A;  2MZR A;  2OP5 A;  1CJK B;  2QA2 A;  4GVB A;  5I4M A;  3D6T B;  2B4O A;  4JI1 F;  3TZX A;  3SQG B;  3AFG A;  4DCJ B;  2XMU A;  3QNW B;  3M8Z A;  2JX2 A;  4LFB F;  2B51 A;  5JXS A;  4WKY A;  4R0J A;  2KHC A;  3QFH A;  3RRH A;  1S6U A;  4DI6 A;  5F41 A;  5ETM A;  2QC3 A;  1XIQ A;  2V8H A;  2VG5 B;  1K73 T;  1SCJ B;  3G8T A;  2BKO A;  2F8E X;  3CCM S;  1FD2 A;  4F26 A;  3C19 A;  1FA0 A;  5J2M A;  3FCH A;  2QA4 S;  1AXQ A;  2D9P A;  3SEO A;  4BS2 A;  3I0R B;  4KHP J;  2YTC A;  1F6T A;  1CJT B;  1YRU A;  1Y3K A;  4OZL A;  2XMK A;  1XTZ A;  5HQ8 A;  5ETN A;  3QT5 A;  3DDK A;  4UUX A;  4I56 A;  4FYD A;  2EXU A;  3MF5 A;  3G82 B;  2Z0G A;  1C0T B;  1U8W A;  2ZE2 A;  3GCX P;  3M2U A;  1IBL F;  1DBD A;  2RKI A;  1HKA A;  2BAB A;  4JI6 J;  3I9V 9;  2OPQ A;  1OY6 A;  1F1B B;  5FLX Y;  3GFY A;  2JEF A;  3GCW P;  4QWE A;  3UNG C;  1S1U A;  3DU6 A;  1Q53 A;  2CKW A;  4JV5 J;  2HK3 A;  4DX6 A;  3K89 A;  2SXL A;  1T8E A;  1S77 D;  5HRO A;  1F5C A;  4F7V A;  2J7U A;  4YUD A;  5ETP A;  1K1Q A;  4FPR A;  5JMN A;  3KJN B;  4I2Q B;  3H42 A;  5HMW A;  2GQ2 A;  4F36 A;  1J5O A;  3VZH A;  4OHX A;  3NGK A;  3KDN A;  1JKH A;  3TUZ C;  2VBY A;  3R8Y A;  3LAK A;  2W8K A;  2OGU A;  3ET6 A;  1WI8 A;  4K7Q A;  3Q8Y A;  5KFU A;  4A8X A;  3PW4 A;  1YHQ S;  3OD2 A;  2FJA B;  1U7L A;  3X1L B;  4FP9 A;  5CZX A;  5EWF A;  5KT4 A;  2QLB B;  3PX0 A;  2OPS B;  3CD5 A;  2ABY A;  2FJX A;  4U6P A;  3PNI A;  5KFO A;  2HS0 A;  4E98 A;  1HNV B;  4C4W A;  2Y0B B;  4OYZ A;  1KS2 A;  3PR4 A;  2N3O A;  2BAN A;  1REV A;  5CYM A;  1D9D A;  3M2V B;  3BSN A;  3PW5 A;  4F0M A;  5B0A A;  3VAI A;  3LUY A;  2RQC A;  1KLM A;  4JP8 A;  4QJV A;  4UY8 5;  4C48 A;  2EK6 A;  5I42 A;  4JI0 F;  1BQN A;  3EGV A;  2ZH1 A;  2C2M B;  1RHK B;  2IVY A;  1RA6 A;  4GC6 A;  3AAW B;  2XZT B;  3OHA A;  3M8Q A;  3TRG A;  3ISN C;  2CQG A;  3L4B C;  2F65 A;  2R7T A;  3BPS P;  4HAC B;  3ZTP A;  3G87 A;  3EDR B;  4F4X A;  3AXK A;  1IJE B;  1TP7 A;  4LSL B;  3P5T L;  4ZPC A;  3TZY A;  3S8S A;  4QR1 A;  2UVV A;  3A4T A;  4PAB A;  1W2I A;  2K3K A;  2PII A;  3MUM P;  3V4I B;  4DR4 J;  1HLW A;  4DQQ A;  4X4T A;  2JEG A;  3IO1 A;  1C1B B;  4EBC A;  2HHV A;  2KT2 A;  2CJ9 A;  3IRX A;  2BE7 D;  3BS9 A;  3PW0 A;  3OUY A;  1TV6 B;  4IG3 A;  5ETL A;  2A18 A;  4ID5 A;  3QID A;  1RHJ B;  1YVF A;  2UU9 F;  2A6O A;  4USI A;  4YB5 A;  4LFB J;  2VG6 A;  2YNH B;  1R8P A;  1SKR A;  1OQ3 A;  5I3U B;  2GGP B;  3ENA A;  3CVK A;  1RYR A;  2ATL A;  4TYB A;  4ED0 A;  2VA3 A;  2CXE A;  2WW8 A;  4O0I A;  2K8G A;  2YQ0 A;  1LW2 A;  3OR1 B;  2YKN A;  4CLL A;  4LUB A;  1U48 A;  5KAK A;  1TKT B;  2C3M A;  3IGN A;  4LF6 F;  4LR7 A;  5AXM A;  1Q7L B;  1XJW B;  3VWS A;  2P6T A;  3I6P A;  1EB0 A;  4DEZ A;  2R7R A;  2ROE A;  1JJ4 A;  4GC7 A;  4IUF A;  1NH7 A;  1KN6 A;  5EUH A;  2FQQ B;  2OEK A;  3HFK A;  3AT1 B;  1YX2 A;  2AEJ A;  1NND A;  3N0V A;  1IBL J;  2FUG 9;  4DL3 A;  1WNE A;  2HS3 A;  4L6V 3;  3R5D A;  1VQ7 S;  2DXF A;  3LP2 A;  4FBU A;  3W5X A;  5LM7 E;  2ACM A;  3C8Y A;  3NNC A;  2HQG A;  3UD4 P;  5D4O A;  2EFN A;  4A8Q A;  1FDN A;  1VK3 A;  4A4J A;  2ROP A;  1F5A A;  1T11 A;  1M90 T;  2DNQ A;  4ZHR A;  3GR0 A;  2RDJ A;  2Z2M A;  1SC4 B;  3HO1 A;  1S1W A;  1UFL A;  3LGM A;  2VIC A;  1RT7 B;  3MMB A;  2FYX A;  4AFF A;  2HHH F;  1TAU A;  2R42 A;  3MEC B;  2DGW A;  3X3U A;  1RT5 B;  3MEK A;  1VQ6 S;  3M32 B;  3VGU A;  1GT8 A;  4C0H A;  1VC0 A;  3KK3 A;  5HVF A;  1DFD A;  3NKY A;  3CF5 Q;  1UVI A;  4F50 A;  1JLB A;  3MUR P;  4UOC A;  1GMW A;  3HDS A;  2KFN A;  3WC2 A;  1P6T A;  1RK8 A;  1RT2 A;  3BGL A;  3KLG A;  2AJQ A;  2IBO A;  4K4Y A;  1ZET A;  1NJY A;  5KFR A;  1SXL A;  2KZM A;  4N41 A;  4RNH A;  2DT9 A;  1KRP A;  1VJQ A;  3HVR A;  4DCP B;  4OJH A;  2JHE A;  2QYG A;  4JYA J;  4YDX A;  5KFD A;  2E1R A;  1S59 A;  5IFM A;  3PYF A;  4OI2 A;  4MKA A;  5DET A;  2H1Y A;  3VQT A;  2AIR B;  1IBK F;  3BH6 B;  2EVZ A;  4OZ1 A;  2PA3 A;  3UO0 A;  5ETT A;  5LSR A;  1RKI A;  5D78 A;  4EI2 A;  3G6Y A;  1OY8 A;  4NLT A;  4A48 A;  4ZPV R;  5HBM B;  4M5J A;  1HW9 A;  4ED5 A;  4C0O C;  2HLT A;  5SZT A;  2XM3 A;  5KT5 A;  3MTJ A;  4OFZ A;  3FBC A;  3VAH A;  2DNO A;  2XSJ B;  1KBR A;  1FE4 A;  4Q44 A;  4R5P A;  4HT5 A;  1S1T A;  2YKA A;  5C2C A;  5AE2 A;  4B9U A;  2KN4 A;  2MJN A;  4RKU C;  2HAI A;  2MKY A;  1SQG A;  1OYE A;  4NLX A;  2UU9 J;  3PY8 A;  1SB6 A;  3C14 B;  5E0O A;  4CO5 A;  4ZCK A;  1YBT A;  4YR0 A;  3M8R A;  1VQ5 S;  2KU7 A;  1SL2 A;  1SL1 A;  4USV A;  4OYP A;  4YHH J;  4CI0 B;  1RWW B;  3JQM A;  3KHH A;  1HWU A;  1ZM9 A;  5IZH A;  2OML A;  4FBT A;  3I87 A;  1IKX A;  3Q89 A;  3ZFV A;  2W2N P;  3K5P A;  4Y2A A;  2RUS A;  4KSE B;  3KLI A;  4LF6 J;  4NA1 A;  4NYZ A;  2AJF E;  3EDQ B;  3FBE A;  4LSN A;  2DGX A;  4FVM A;  3I0S A;  2P8I A;  1VQ8 S;  5LXR A;  1JLG A;  4PG7 A;  4F67 A;  4X4Q A;  2XS7 A;  4ES1 A;  5JJB A;  1NJX A;  2A3J A;  4V19 J;  2HIY A;  1T9U A;  4TN2 A;  3OV7 A;  1LXJ A;  3TA2 A;  4P7T A;  1MW7 A;  4LBP A;  5EWE A;  4FF3 A;  3D66 A;  1I94 F;  4DSE A;  1M1G A;  4F4W A;  3ZTQ A;  3HVT B;  2IY5 B;  1AA1 B;  3V81 B;  3BBC A;  4UZB A;  2BQR A;  3DOM A;  2XHW A;  2PI5 A;  4WE1 A;  2EC2 A;  1B7F A;  3EYZ A;  1LWX A;  3R5C A;  3HT0 A;  4KFB A;  4F4A A;  2M7S A;  1XR7 A;  1O5J A;  2MY8 A;  1K1S A;  1NSQ A;  3TOQ A;  1N52 B;  2FTR A;  4G1Q B;  4YP3 A;  3SCI E;  3MEE A;  3Q8V A;  2M8D B;  4K50 A;  1U24 A;  1YJU A;  2J9E A;  2NCK L;  3TWZ A;  2D41 A;  4OV1 A;  4OHW A;  1FJ7 A;  3NG8 A;  3OW2 R;  3L09 A;  2XNQ A;  1I5O B;  4Q0B A;  1UZH A;  3J7Y I;  1ZA2 B;  2HHH J;  3MUV P;  5A8W A;  1G2E A;  3VVU A;  2R8J A;  3CJK A;  2F4F A;  1Y11 A;  5D4N A;  1PO6 A;  1FJE B;  3R2D J;  2O66 A;  2H4W B;  1ZYQ A;  2ZVS A;  4NPO A;  4KY3 A;  2BQU A;  2GW8 A;  1ZAV A;  2UUT A;  4O4R A;  2AYB A;  4AL5 A;  3KHG A;  4X2B A;  4A8F A;  1IR1 A;  1L5U A;  4DR3 F;  1FER A;  3G6X A;  2Y1J A;  2E1A A;  4PWD B;  4B3O B;  1NK8 A;  1U6Z A;  2RDI A;  2DRA A;  5HO4 A;  1U45 A;  5C42 B;  3M9N B;  2F8H A;  4ECY A;  5KG6 A;  1D9A A;  4XPE A;  4BWM A;  1XMB A;  3EVM A;  2VHG A;  5KFK A;  4Y2C A;  2PGC A;  2KDO A;  2QA4 G;  4OIX A;  1FX2 A;  2ERR A;  2Y8Y A;  2IC3 A;  1ZAW A;  1YJN S;  4QPT A;  5T41 A;  2NS1 B;  2QYC A;  5E33 A;  4NLU A;  4DFK A;  1OIA A;  4USJ C;  5AE3 A;  2DB1 A;  2HNZ B;  4X84 A;  2DD8 S;  4OV6 A;  4EBD A;  3PO5 A;  1JLE A;  1EP4 B;  1LXN A;  4DPX A;  1EQ0 A;  1CJV A;  3BGR B;  1MU2 A;  1N6Q A;  2D3O 1;  3HMJ G;  3A8J A;  5DDP C;  1MWZ A;  3DRR B;  2ASY A;  2H3E B;  1VQS A;  4K4T A;  2IVF B;  2WTF A;  1DRZ A;  5KFW A;  3EGZ A;  5B0E A;  4J9N A;  1FEE A;  3C15 B;  1V5I B;  1FKP B;  2JLF A;  3LGN A;  4DX5 A;  4GKK F;  2GV1 A;  3S01 A;  1VS3 A;  2HHT A;  5FDL B;  2L9W A;  4IQX A;  1E6Y B;  1DY3 A;  1JJH A;  4LRA A;  3LWM A;  2FGC A;  1K8A T;  1VYA A;  3D0I E;  5ETQ A;  2C3U A;  3MM8 B;  3W1Y C;  2J7W A;  3QAT A;  2F7V A;  2DGT A;  4G3I A;  4QWC A;  1N36 J;  1HMV A;  2F1F A;  5KFV A;  4ELU A;  2FJD B;  3EMT A;  3NOC A;  1SKU B;  4WTY A;  1M5V C;  2FVP A;  2V8G A;  2ZOF A;  2Q66 A;  3HP6 A;  4KGK A;  5D3G A;  5DQI A;  2OFG X;  1Z2L A;  4ZP6 A;  1TZ0 A;  3B4M A;  3HPO A;  1CQM A;  1UMJ A;  2BA9 A;  4L3K A;  1T02 A;  3IS9 A;  3GFX A;  4A8O A;  2B7C B;  4LF5 J;  4OZ2 A;  5K8N A;  2D3O R;  1I94 J;  3NBP A;  5KFJ A;  1VIS A;  1YJT A;  2E5H A;  3TO8 A;  2R8G A;  1A0O B;  1VLY A;  2GS8 A;  2QGF B;  2XYP B;  2ZHB A;  1WF2 A;  3DRP A;  1C1C A;  4LF4 F;  1EET A;  4JI4 F;  2PT0 A;  3PFE A;  1MN9 A;  3O1L A;  1S0M A;  3G8Q A;  3QT7 A;  3TAR A;  4DR7 F;  3NNH A;  2DNK A;  2FIU A;  1ULR A;  2B0G A;  4IR9 A;  2RAQ A;  4LJM A;  2CNK B;  1VDH A;  4HEA 9;  4UOG A;  3MEG A;  4WYL A;  1QVF R;  3TW0 A;  3H20 A;  2YQ1 A;  5DG9 A;  2VFR A;  4QBU A;  3CED A;  2WRM A;  3W61 A;  4CH1 A;  3UE2 A;  2Y3Y A;  5AXK A;  2D9O A;  1ZTW A;  1FXD A;  4P52 A;  4PUO B;  2XGQ A;  2FJE B;  1WEZ A;  3BQ0 A;  3GV7 B;  1NDK A;  4C98 A;  2H9Z A;  1IQZ A;  2DKO B;  1N0V C;  1RT3 B;  4EYH B;  5M2R A;  3T41 A;  1HR0 F;  1KHV A;  3BKT A;  5D0R A;  4OX6 A;  4M95 A;  1ZAX A;  3P3D A;  2XB2 D;  3CCQ S;  3HI9 A;  2JL9 A;  5BYS A;  1HBM A;  3Q2S C;  1FF2 A;  2RD5 C;  1XQI A;  1D8Z A;  2ROG A;  1KVI A;  2BJ8 A;  4DR3 J;  4LFC F;  4WP3 A;  5G0R A;  3DLG B;  5AJ3 F;  2GC8 A;  4OZ3 A;  2B5J A;  4XIU A;  3L7P A;  4QR0 A;  1TTH B;  3CJ5 A;  1RWP B;  2VG7 A;  3EE3 A;  3LOU A;  1IM4 A;  1QAY A;  3FEY B;  1N5V A;  1HNZ F;  1W25 A;  3VAK A;  3SZ2 A;  4ELT A;  1TVR A;  1SV5 A;  3D6F B;  5F3Z A;  4WP8 A;  1BGX T;  2Q79 A;  1F3V A;  1FKO A;  2GVD A;  3AQO A;  2LQ5 A;  1DJ0 A;  1WKJ A;  2YWF A;  5IV3 A;  3N5B A;  2QIF A;  2UXC F;  2VOP A;  4KHM A;  4WFZ A;  3GSD A;  1U1K A;  1ACM B;  1NDL A;  3W60 A;  5B0C A;  2P5V A;  3DGP A;  3N6L A;  1WSR A;  1LK7 A;  1XC9 A;  2YKO A;  2ASD A;  1HPZ A;  4K4U A;  3PJW A;  3MM6 B;  3R7N B;  2F8M A;  4K5S A;  1E6V A;  2XLK A;  4UST A;  4C11 A;  1S6Q A;  2J0X A;  3LQV A;  3A8E A;  2KRB A;  2JLE A;  3PHE A;  1VOM A;  3BGO P;  4F02 A;  4I6A A;  2V8V A;  4UQT A;  4B08 A;  3RUB L;  3IM9 A;  4WIQ A;  3C6T B;  4DV6 J;  1RWM B;  3S1T A;  1KSP A;  2DIU A;  3W9H A;  4OYI A;  1QE1 B;  2ZZM A;  3JQJ A;  3QPI A;  4CYU B;  2MQO A;  1K0V A;  5F9N A;  1MN7 A;  4HYK A;  3VQS A;  1JQG A;  3CJ8 A;  2HVD A;  1X4D A;  2W7P A;  2LYV A;  1F9E B;  2OEJ A;  2IM0 A;  1TFY A;  1TQL A;  2WCX A;  2ZDO A;  2AYM A;  3DLE A;  4LF4 J;  1VRU A;  4M1K A;  4JI4 J;  1V3R A;  3ITH A;  4MYT A;  1FKA F;  4XO0 A;  1TL4 A;  2MGZ A;  2LA6 A;  1JNZ B;  4DR7 J;  1UW9 A;  2CG8 A;  1Q8B A;  3MM9 B;  3VR1 A;  5D15 A;  4ECS A;  1NSP A;  2RF2 B;  3DYA A;  3AD7 C;  4WFB Q;  5ETR A;  1T03 B;  2OIH A;  1CC8 A;  4O23 A;  5IM0 A;  2AJ2 A;  3AB4 B;  3BR9 A;  4TLR A;  4URQ U;  4Y2M A;  3GFZ A;  3CNQ P;  1VK8 A;  4LBH A;  2MQQ A;  2B3T B;  1U47 A;  5A2Q Y;  3OL9 A;  2PC6 A;  3BYR A;  2XZW A;  2ZEJ A;  1TU0 B;  1HR0 J;  2DXE A;  4RW6 A;  2EKN A;  4OHY A;  2BBE A;  2V94 A;  1NO8 A;  2J9D A;  4PG4 A;  3MMJ A;  5HN0 A;  4DLG A;  1I3O B;  3W65 A;  3SDE B;  3J80 Y;  1RLC L;  3DOL A;  1ZM3 A;  4TU7 A;  3LA0 A;  1FES A;  5AE1 A;  4RLE A;  4LFC J;  4LR9 A;  5AJ3 J;  1NLK L;  2VQF F;  1PG5 B;  2HHQ A;  1J5E F;  4F3M A;  1TKX B;  4QW9 A;  1X5O A;  5EX3 A;  2ZKT A;  3BSO A;  2B4P A;  4DV1 F;  3GG0 A;  2OSQ A;  1KOH A;  2WON A;  1HNZ J;  5H9F K;  3D0G E;  2MLX A;  4ETX A;  1NAQ A;  5C24 B;  2E9T A;  4EMD A;  2XY6 A;  2A2C A;  5KFI A;  2LQB A;  2OMO A;  4PXC A;  1RT6 B;  2ZKU A;  1HL6 A;  3MM5 B;  2FPH X;  3RAM A;  1RAO A;  2G0J A;  2P9G A;  1SJ4 P;  3VF0 B;  4MFB A;  3CO9 A;  2HRT A;  3SIP B;  2IFX A;  2CYY A;  3GG1 A;  3GP9 A;  2ZD1 B;  3ZZ0 A;  2VF3 A;  3KDO A;  3B54 A;  5J2P B;  1M5P C;  1HQU B;  1NRK A;  2RU9 A;  3ENQ A;  1LWF A;  4CLK A;  2FHJ A;  4OZJ A;  2HHU A;  2C42 A;  1R27 B;  2COL A;  3BKF A;  2W2Q P;  3E2E A;  4N7T A;  2OEM A;  3TZZ A;  3JSB A;  4OMF G;  2C2D A;  1HYS B;  3VHQ A;  4M5I A;  2R7O A;  1TUG B;  3E01 B;  4WJB A;  1HWK A;  2LQJ A;  4IOC Q;  1XBW A;  3IR7 B;  3M1V A;  2ZZN A;  3MAA B;  2R7U A;  4ZS6 A;  3HXM A;  4F4Y A;  2CQH A;  4KIA A;  3OVS A;  2JZ5 A;  4P74 A;  4I4B A;  4M5D B;  4RNN A;  2WOM A;  3WBZ A;  3MR3 A;  2HFU A;  4X4R A;  1C4A A;  2XLJ A;  3RGI A;  1WDT A;  2GO9 A;  1Q5Y A;  1X4B A;  5FJ4 A;  1K9M T;  2FLN A;  3UW1 A;  3AOD A;  2H54 B;  4DG1 A;  1U0H A;  4YME A;  2EFG A;  3HHL C;  2YH1 A;  3RYL A;  2OHD A;  2WZ1 A;  3RB0 A;  2HVZ A;  1BLU A;  1F3F A;  1MNE A;  1MSW D;  2G4B A;  4TLQ A;  3BJY A;  3QZ7 A;  2HVE A;  2BJ3 A;  5KOW A;  5HQM A;  4B17 A;  1EJ7 L;  4Y0F A;  1T9V A;  4R25 A;  4YB6 A;  3OL6 A;  4PR6 A;  1JXE A;  2M52 A;  2OPP B;  2VIH A;  3GPA A;  3UN5 A;  5IT9 U;  3IR5 B;  2VQE F;  3FVY A;  4RW9 A;  3ISZ A;  4TNO A;  1P9Y A;  3T6J A;  3HHL A;  3MOZ A;  1BC6 A;  2ZHO A;  4ZP9 A;  2D3U A;  2VON A;  3P96 A;  3KLH A;  1M5O C;  2M2B A;  4CCH A;  1O51 A;  3PZP A;  1HNI A;  3HSJ A;  5A0Y B;  2JFD A;  3Q8S B;  4CTA A;  1RU1 A;  1WAC A;  1J5E J;  4H4M B;  1RWK B;  3C6U A;  5I3P A;  1TEL A;  2F5G A;  4AL6 A;  4P6Q A;  3NMA A;  2RS2 A;  4LIW A;  4O3P A;  3J7Z 5;  2B9X A;  4DV1 J;  3OFH A;  3A8I A;  4IFY A;  2HW3 A;  1EHW A;  4U95 A;  4DMZ A;  1A6L A;  3DDI A;  4DQP A;  1DLO B;  1W2B R;  3F0N A;  2GVZ A;  3D54 A;  1RTI A;  2VPZ B;  2GIR A;  3OL7 A;  1FRL A;  4L72 B;  4YEA A;  2NSB A;  3IA0 A;  3CCS S;  4QWA A;  3UN2 A;  1DTQ B;  4C9D A;  2XY7 A;  3BO3 A;  4A8Y A;  5AT1 B;  1RAE B;  1WEX A;  3GIL A;  3CCL S;  4TY8 B;  4ZVH A;  2J0S D;  5SUH A;  1B99 A;  4Y2I A;  1DAX A;  4WFA Q;  5KFP A;  4USK A;  2FZK B;  3SYZ A;  5L1I A;  3U02 A;  3EPG A;  3UPF A;  2Y1R I;  2K7J A;  2DR7 A;  4B3M F;  2YNF A;  4NLD A;  1KWM A;  3BSC A;  4J90 A;  4WPA A;  3NEK A;  2CPY A;  4XTT A;  2EG1 A;  1WHX A;  2HFV A;  3POT B;  4DN9 A;  3O44 A;  2V8P A;  1VQK S;  5FD1 A;  2XI3 A;  4B3R F;  4DPW A;  3QJJ A;  4ZVP B;  4DDF A;  3RB3 A;  4LT6 A;  1SH3 A;  4MTP A;  2BUN A;  1HW8 A;  3RAX A;  2GIQ A;  1CUL B;  3CDE A;  2YNG B;  4I69 A;  4PYA A;  1HBN A;  4PPD A;  1S6P A;  3R5J B;  3H5S A;  3FFI A;  1PYT A;  2JC0 A;  2R3V A;  4QR2 A;  2IRU A;  2PI4 A;  4B9T A;  2VBZ A;  4ENO A;  5CAA A;  3MMA A;  2YWH A;  3W2V B;  2HZA A;  3SCL E;  2XWX A;  5LSL A;  3ZNU A;  4TQR A;  4LMZ A;  5FII A;  2A6M A;  2ZNY A;  1S0V A;  2WB1 D;  2IM1 A;  4UOH A;  1JLQ A;  3BM7 A;  1IJF B;  1WOS A;  1FDB A;  1OPZ A;  3HFV A;  1WF0 A;  1GEH A;  3OL8 A;  5JVH Q;  2KXH A;  3OLB A;  4CH7 A;  3A3P B;  1M5S A;  4MIW A;  4AUK A;  3L7U A;  4QU7 A;  2B8Q A;  3MM7 B;  3MCM A;  3M7V A;  1RT2 B;  2Q1L A;  4J9V A;  1XNR J;  2OAU A;  5HAN A;  2R8I A;  1PIL A;  2EFQ A;  5CA5 A;  2EBE A;  1X4E A;  4PG8 A;  2P6S A;  1RT4 A;  3CTR A;  4EK2 A;  2BM0 A;  4ECX A;  2KXN B;  3MMC A;  1KTV A;  3M8S A;  2HHP A;  2HUR A;  2RHQ B;  2R2T A;  1T9T A;  2W9C A;  1FRI A;  4I7F A;  1H0H B;  3MED B;  2G1H A;  2MKJ A;  4AE5 A;  3HT3 A;  4DOZ A;  1H74 A;  3B78 A;  1VQO S;  1VC6 A;  2MLZ A;  3DMJ B;  5IT4 A;  2WVB A;  2R2U A;  3AHP A;  5KG1 A;  3EVW A;  2I5J B;  1WC0 A;  3CPW R;  4LSZ B;  2ZOG A;  3IBW A;  1QDU B;  1PYS B;  2VH7 A;  2VAS A;  1RTD A;  5CYJ A;  3TUJ C;  2M70 A;  5DGA A;  4FXD A;  2XMT A;  4F04 B;  1JLA B;  5KFB A;  1UFK A;  2DNH A;  5GAE U;  1FFG B;  2JSX A;  4X4N A;  4OQJ A;  3ZNJ 1;  2QX0 A;  4KO0 A;  4G65 A;  2ZBI A;  2EPI A;  2GNK A;  3D1Q A;  3C66 A;  3T1H F;  2Y1L B;  2NR0 A;  1X60 A;  4DR6 F;  3PDN A;  2ZUA A;  4KAI A;  1TL7 A;  4M63 A;  1FO1 A;  2FC9 A;  3FUY A;  3K5M A;  3N9U C;  4ZP8 A;  2IVM A;  2ZH5 A;  4Q8E A;  2DNM A;  1FE0 A;  3OXL A;  3OJU A;  2XBP A;  5CAB A;  4ZMM A;  1EIY B;  2PMW A;  2QA1 A;  1O8B A;  2IA0 A;  4ICL A;  3NL0 A;  2MXY A;  5J2N B;  4B3M J;  1U02 A;  1SJ1 A;  3TZW A;  3SFU A;  4FNI A;  3A3O B;  2MJU A;  1MWQ A;  2IBK A;  4IH5 A;  2ZNZ A;  5L46 A;  2W01 A;  1S7H A;  1WKL A;  1UWB B;  5EGY A;  2DTJ A;  3DOK A;  3M2R A;  1YIT S;  4K0K F;  4ZIV A;  3HHK A;  3D1O A;  3GFH A;  5KG5 A;  3UCG A;  4B3R J;  5HVH A;  2XYH B;  4CLS A;  2GMJ A;  2QFI A;  3D9B A;  3CME S;  1VLO A;  3IR6 B;  2DO4 A;  2QN6 B;  1IQT A;  3KHR A;  2VPW B;  1FXR A;  3HHL D;  3PHT A;  3N6M A;  2PO4 A;  2NPI A;  3JSM A;  1LKZ A;  4U9R A;  2OLW A;  2PE8 A;  5HMZ A;  1WC1 A;  3TA1 A;  3IN5 A;  5U47 A;  1FNO A;  2LQ9 A;  1RXO B;  1GX6 A;  1AFJ A;  5BJR A;  2XY5 A;  4C8L A;  3M30 A;  3OFE A;  1B4S A;  2G13 A;  1R0B G;  2KHD A;  2V50 A;  4CDI A;  2MZQ A;  2AT1 B;  2CVI A;  2ZH7 A;  1U1N A;  3EXC X;  4BLG A;  2ALZ A;  4S0M A;  1IKV A;  2LU1 A;  2RE1 A;  1JLC A;  4NML A;  1WC3 A;  1HNW F;  4F25 A;  4J9O A;  1YJV A;  4A8M P;  2FVR A;  1BMQ B;  1FWL A;  3KLE A;  4PKD B;  3TJ8 A;  3H5X A;  1GQE A;  4UW2 A;  1YRT A;  2DY1 A;  1ZS6 A;  1G3O A;  4GMK A;  2FHK A;  1FJG F;  4FF4 A;  1YJR A;  1IKW B;  3JQK A;  5CQG A;  3MHY A;  2UV8 G;  1MG7 A;  1VGY A;  4R0E A;  4RW4 B;  5ETO A;  4O3R A;  3QZ8 A;  2FZC B;  3W63 A;  4E8U A;  2Z8Q A;  3UCZ P;  2OFH X;  3LP0 A;  1W26 A;  1RTH B;  3BSA A;  3MTK A;  2K7K A;  2XTJ P;  2APO A;  4B3S F;  3RJM B;  3TEG A;  3R2C J;  1DTT A;  3PIP Q;  2DPJ A;  5DDR C;  3C16 A;  1WKK A;  3FMW A;  1WSV A;  1Z1Z A;  3KG4 A;  3TAM A;  1PBU A;  4X62 F;  5EWG A;  2GHW A;  3S7R A;  2XS5 A;  3KK2 B;  1FFS B;  1NK7 A;  5DQH A;  7FD1 A;  4RPF A;  2RVJ A;  5C5J A;  1HHS A;  1GH8 A;  3GJQ B;  1Y5N B;  1U49 A;  2AWZ A;  5CXT A;  4I2P B;  1C2P A;  3AJ1 A;  3LP1 A;  1S9E B;  1TKZ A;  2W25 A;  4H54 A;  1Y0H A;  1WEY A;  4OI1 A;  3OR2 A;  2FLO A;  4F3O A;  3NGD A;  3BQ1 A;  3MR2 A;  1CJK A;  1BWV A;  3K17 A;  3DC2 A;  2BE9 B;  1Q8L A;  4JI5 F;  2EEY A;  2F9D A;  1KHW A;  3RZA A;  4FVC A;  4DN0 A;  4V19 X;  1NZA A;  5CYQ B;  5ETS A;  4ZVG A;  3HKZ D;  4ED4 A;  4N77 A;  3CCR S;  3SQG A;  1X8D A;  1LEO A;  1VMB A;  3ZZY A;  2YX7 A;  4ZIT A;  1S1X B;  2ASL A;  3QGI A;  4CH0 S;  3QT8 A;  5HLF B;  1YGY A;  1S99 A;  5EX0 A;  3QJL A;  3PR5 B;  1OSC A;  3N6N A;  1RP5 A;  2VG5 A;  1M5K C;  1V3S A;  3DFE A;  2XYG B;  3LF0 A;  3OTD A;  3TYT A;  1UJ5 A;  4ZPA A;  1HA1 A;  3IXQ A;  1X5T A;  2XNR A;  3DRS B;  3NS6 A;  3KJV B;  3I0R A;  2BJ7 A;  3D28 A;  3H90 A;  1CJT A;  4RBT A;  4C8Z A;  2W2P P;  4YB7 A;  3I96 A;  1LQ9 A;  3VV2 B;  3Q0A A;  1NKC A;  4DV2 F;  2FB0 A;  2MQN A;  5H9E K;  3WX4 A;  2MTL A;  3G82 A;  1HD0 A;  1C0T A;  1AFI A;  3H2V E;  3UN3 A;  2HND B;  1JXL A;  3Q8P B;  3ZO7 A;  2FGO A;  2V9K A;  4N76 A;  4ECW A;  4LVO P;  4NLG A;  2W2O P;  7AT1 B;  3DHX A;  2DRD A;  3T1Y F;  2DNN A;  1VRT B;  5F8H A;  2X1F A;  1VJW A;  3I32 A;  2AJ0 A;  4FZV A;  5ADZ A;  4DV5 F;  3HZG A;  3NP5 A;  4Q8F A;  4I2Q A;  1HBU B;  2MEW A;  3R7S B;  5GAG I;  3CIZ A;  4IH6 A;  2VU5 A;  1GXL A;  1HNW J;  4ZKA A;  4X4O A;  4MK8 A;  3CCT A;  5DG7 A;  1OQ6 A;  1UL3 A;  1WOO A;  4A8W A;  4KQZ A;  1FJG J;  4M5N A;  4AYB D;  2QZ8 A;  1C0U B;  3QIP B;  5DRK A;  5KG2 A;  3DLK B;  3M8P B;  4UZC A;  4WKR A;  1Y9O A;  2FY8 A;  4YFU A;  4P2S A;  1TMM A;  4CLZ A;  4USW A;  4C97 A;  3CE8 A;  2OPS A;  3TQ1 A;  3OSP A;  4FXV A;  3H4B A;  4I6Y A;  3GB0 A;  2IAJ B;  1HNV A;  5K9F A;  5E2Q A;  4OYW A;  3EZU A;  5KFL A;  2MZJ A;  1R3N A;  2HGN A;  3DNC A;  1N4L A;  3D1H A;  3M2V A;  2XUL A;  4NLR A;  5B0D A;  1N5Q A;  5KFE A;  2VDH A;  2DK2 A;  3SSR A;  3R3T A;  4I0W A;  1FXL A;  5BYQ A;  3HJF A;  4DWI A;  3AJD A;  3BV8 A;  1HBO B;  4X62 J;  4DL5 A;  2C22 A;  3ICL A;  1CJU B;  1YJ9 S;  5EDW A;  4USU A;  4NI2 B;  2JFK A;  4EEY A;  3VAL A;  1U4B A;  1CLF A;  2ZBC A;  4HAC A;  4KGM A;  3OJS A;  4EFA C;  2YNI B;  4LSL A;  1NUE A;  2WK4 A;  1YLX A;  4OYM A;  1TUW A;  2OH2 A;  2F9J A;  2O5D A;  1SJR A;  3PVX A;  1F60 B;  3HD2 A;  4UTG A;  1HWJ A;  2W2M P;  3T5J A;  1KVK A;  2ZUG A;  3KYL A;  3V4I A;  4X65 F;  3LWL A;  1RUS A;  3PTW A;  1UCN A;  5K8O A;  1C1B A;  4JI5 J;  1R0A B;  1UEK A;  3TUP A;  4QYZ K;  5J1P A;  1YZ7 A;  4K59 A;  2VFT A;  1TV6 A;  4U8V A;  1Q5V A;  5GAH I;  4NYP A;  4W90 B;  1GTH A;  2LCW A;  2E66 A;  5D4P A;  3U27 A;  2YKQ A;  4J9L A;  3J7A N;  1JIH A;  2YNH A;  3TJA A;  2BEF A;  3CC2 S;  5KFS A;  3MCS A;  3CWJ A;  3NWR A;  5I3U A;  2GGP A;  5F8I A;  3EPI A;  2MQ8 A;  4OYB A;  2KFZ A;  4NWB A;  2QT7 A;  3JXO A;  4DV3 J;  3K5O A;  2BW7 A;  4H4K C;  3MR6 A;  3CCW A;  4EGL A;  7FDR A;  3NCQ A;  3OR1 A;  4ID8 A;  4C8K A;  1C4C A;  2UVR A;  1DQ9 A;  2QLX A;  2CQI A;  2X3G A;  2OD4 A;  2HMI B;  1TKT A;  4A8K A;  1U2R A;  4HT7 A;  1U09 A;  4E2F B;  2MHN A;  2H4Y B;  2E44 A;  2J76 E;  3P5B P;  1IN0 A;  3E8O A;  3A8K A;  4DV2 J;  1Q78 A;  1NME B;  3FNN A;  1NDP A;  4OYA A;  2P9C A;  5HAO A;  2FY1 A;  1RAB B;  3RRK A;  2KT5 A;  3O2I A;  1WC6 A;  4IRC A;  2ZC3 A;  2CQ2 A;  4OI6 A;  2MKI A;  4JI3 F;  4U7U K;  4K4Z A;  4V1A k;  4OX7 A;  3QRQ A;  1UEU A;  3UVJ B;  4H4K A;  1Y4Z B;  1ZZF A;  3WIV A;  5CCL A;  1VIX A;  5DLF A;  1RAG B;  5D6G A;  4DV5 J;  3CDB A;  2CNN B;  1IBC B;  1OJ4 A;  4WXO A;  3W2W B;  4NZ6 A;  1ITP A;  2QMU B;  5CD4 H;  2RUG A;  2R7W A;  2G0I A;  4FYV B;  1SC6 A;  4O44 B;  2DO0 A;  1RT7 A;  4EZ9 A;  4OI0 A;  3EGN A;  3Q2T C;  3W8G A;  2ZBQ A;  5E3P A;  1H7X A;  3MEC A;  3MAQ A;  1RT5 A;  3M32 A;  3ZZR A;  1RWO B;  2W8L A;  3BDE A;  2GJ2 A;  3MPV A;  1S49 A;  1RE1 B;  5D77 A;  3KJF B;  3SMZ A;  3PEH A;  4P73 A;  4JUZ A;  1S1V B;  2CAJ A;  5DS7 A;  2XMJ A;  1WHW A;  3QMQ A;  4U8Y A;  1GNK A;  2IMW P;  5BR8 J;  1U6B A;  2VL1 A;  3NGR A;  4NE9 C;  4GVL A;  2AKW B;  3TNV A;  2H65 B;  2X1G A;  2RHS B;  5KFM A;  2MKH A;  4RUC A;  1S48 A;  4N47 A;  2GHP A;  2R7V A;  1VBY A;  3H25 A;  5HP1 B;  3GZ7 A;  1WWH A;  3OBI A;  1M1H A;  2I9S A;  3NLC A;  2QSF A;  3AD8 C;  3TX8 A;  2B6A B;  1U1R A;  4FXW A;  3CJS A;  3FBF A;  3JYT B;  2R2S A;  1B64 A;  2G2O A;  1S0O A;  5IC6 B;  5HBM A;  3TR5 A;  1QAJ A;  1RAF B;  1NK4 A;  1YWX A;  2KI2 A;  3GJR B;  2YWW A;  3CO0 P;  3BQ2 A;  2DY9 A;  2E1M C;  1NHU A;  5KG7 A;  4X65 J;  2I6W A;  2XSJ A;  1PC5 A;  2HRU A;  3WIU A;  2DR9 A;  3M1V B;  4ED3 A;  1AYE A;  1TL1 B;  2M4M A;  2BXJ A;  2HHW A;  1S57 A;  4ZVF A;  4RBV A;  1Y3J A;  5L1K A;  3C14 A;  4JI7 F;  5KFA A;  2IHR 1;  4J9P A;  4J9K A;  2CNO B;  1U1O A;  1N33 F;  2UV8 A;  1Q82 T;  1NJI T;  1VQ9 S;  3KUE A;  2N7Y A;  3JSR A;  2QRR A;  1X0F A;  5T7L B;  1D09 B;  2EFP A;  2IRY A;  2HG4 A;  1FRK A;  1T95 A;  3LAN A;  4JI1 J;  1I51 B;  3GV5 B;  4UOF A;  4C8O A;  5K5M A;  2ZH3 A;  2MKS A;  4H4O B;  1RLD A;  1RSC A;  4X4P A;  2VA2 A;  4YDD B;  2DIT A;  5LSO A;  5B09 A;  1VCT A;  2R4F A;  6AT1 B;  2KM8 C;  2RSQ A;  2A1B A;  4F2R A;  3SI8 A;  3HVT A;  4R8U B;  3KNA A;  3AY0 A;  2ZJQ Q;  4ETZ A;  5L9X A;  3V81 A;  4O3O A;  1KDN A;  1R0C B;  3BB5 A;  2PSZ A;  4JI3 J;  4Z7Y A;  1YTY A;  3OTE A;  3DI6 B;  2YKP A;  1AW0 A;  4DL4 A;  3TA0 A;  4Q43 A;  2HAF A;  3TUI C;  1WOR A;  4NMX A;  1X9W A;  3FSI A;  5HK4 A;  2KRR A;  2FHM A;  2W9B B;  2C3O A;  1KD1 T;  2I2Y A;  1R8B A;  3FDS A;  4TVA B;  2AJ1 A;  1TUV A;  2QG9 B;  1I1G A;  3R6G B;  1X4G A;  3IRW P;  2B8P A;  2JJ4 D;  5A8K B;  1TMJ A;  2E9Z A;  4PXD A;  4NRU A;  3FC9 A;  3W8P A;  4ZIW A;  3I4H X;  3O6Q A;  2IIH A;  4CRJ A;  4HHU A;  2XZD B;  1P1T A;  5AXN A;  2WHO A;  2HQC A;  1S9G B;  3K57 A;  2C2O B;  4WCE Q;  1TKD A;  1R8H A;  4C8Y A;  2IDE A;  2R9L A;  3O3L A;  2PD1 A;  3PAC A;  1JWW A;  3ADA C;  4NZ7 A;  3F56 A;  4LF8 F;  3VCD A;  1XNQ F;  4L3N A;  5KFQ A;  2DR6 A;  1NHK L;  3AOB A;  3BH7 B;  2EK1 A;  2LEA A;  4PG6 A;  3IFE A;  4ECU A;  2DBB A;  1NSK L;  2YX4 A;  1LWC B;  2W4D A;  2GQC A;  1FI4 A;  2HBQ B;  2KJW A;  1KP6 A;  3PIO Q;  4PWD A;  4B3O A;  4CM0 A;  4MKV A;  4OZ5 A;  3QRP A;  4MMO A;  2CNL B;  4HDG A;  2VBX A;  5C42 A;  3O5T B;  4W4M A;  3J81 U;  4LF9 F;  2FZG B;  5ETK A;  3K2Y A;  4EUV A;  1JJ2 R;  1S0N A;  2YBV A;  2JEJ A;  1QTN B;  2R7S A;  1HIY A;  4JI2 F;  2NQP A;  4UT4 A;  1CQN A;  3V6J A;  4XDD A;  2CJY B;  4DL2 A;  4ED6 A;  4DPU A;  3GU0 A;  4P72 A;  3ZZO A;  4HHH A;  1LK5 A;  4WU2 A;  2HNZ A;  1YKW A;  1RHR B;  2V6A A;  5DG8 A;  3GQC A;  2YXL A;  3UNY A;  3MPW A;  3M6W A;  3FKB A;  1EP4 A;  3DLB A;  4PPZ A;  4YQW A;  1N0U A;  1SKS A;  3OTC A;  1LFP A;  3BGR A;  4JI0 J;  3WHI A;  2OPR B;  5J2Q B;  5KG4 A;  1D8Y A;  2WBR A;  3DRR A;  2A10 A;  5K8M A;  3D68 A;  1RT1 B;  4Q7A A;  2AF6 A;  4K4S A;  3HHN B;  4RW7 B;  3V6D B;  4TYA A;  2HS4 A;  1HHT P;  3C15 A;  4P2F A;  3H40 A;  2V68 A;  1PJ5 A;  2R7X A;  1FKP A;  4JI7 J;  4C7Q A;  2WVD A;  3PM9 A;  3C3L A;  4J91 A;  2LMI A;  2DPI A;  5FDL A;  2E5G A;  1N33 J;  4Y6I A;  2PA8 D;  1E6Y A;  4C3K A;  2ZZT A;  1NB7 A;  2BE2 B;  5DGB A;  3PFO A;  3VGV A;  1FFW B;  3MM8 A;  2DHX A;  1F2G A;  3NCR A;  5HQL A;  5KFH A;  4ERD A;  1IKY B;  1TK5 A;  4MH8 A;  1MLA A;  3IBF B;  5D0G A;  2Z58 B;  1SVD A;  2V4R A;  2YY3 A;  4LF2 A;  4L73 A;  4NOH A;  3NXZ A;  5IWA F;  4IH7 A;  3JAM U;  2IM3 A;  3GII A;  3NS7 B;  2OKQ A;  2XLI A;  2CPX A;  1UP1 A;  2E7V A;  4PRF A;  3MXH P;  2HWH A;  3V5R A;  4BC9 A;  2F63 A;  4ANC A;  1FEH A;  5GME A;  1VQP S;  4IRD A;  1YK9 A;  2CPF A;  1Y5L B;  3W9I A;  2B9Y A;  4XPC A;  3B82 A;  2UVW A;  4ECZ A;  9RUB A;  2X1A A;  2KO1 A;  4QWB A;  1SQF A;  2NZC A;  4NAS A;  2C28 A;  3D2W A;  4WII A;  5A6W A;  1RI7 A;  3FBB A;  3IGV A;  5DLG A;  1RAD B;  2HBY B;  5GMK a;  5DQG A;  2YKM B;  4TU8 A;  2J0Q D;  2MZ1 A;  1RHM B;  4U7U D;  4FYY B;  2KT3 A;  1FVQ A;  1GX5 A;  5IQQ A;  2NSC A;  2O67 A;  4PAA A;  1KKH A;  1XR5 A;  2ZHA A;  3P6Y C;  1R8A A;  1UPM B;  2FJW A;  4PUO A;  3I82 A;  3AJ2 A;  1RBL A;  4IDK B;  3NOG A;  3QJP A;  2DNY A;  3T9Z A;  3MCN A;  1RT3 A;  1JMT A;  3R6L B;  2QL5 B;  3IG1 B;  1T3N A;  3ONQ A;  4AT1 B;  3DLL Q;  2DRB A;  4YB1 P;  1UTA A;  4ZVR B;  2PN6 A;  5HSP A;  4DFP A;  4I1T A;  3W7B A;  1X5P A;  3BF4 A;  2GML A;  2FVC A;  4UF4 A;  1XER A;  4AD6 A;  4WWS A;  2PFD A;  1QUV A;  1FHT A;  3T1A A;  2RIJ A;  4TU9 A;  1N56 A;  4O4G B;  1J2V A;  3EZ5 A;  2KM8 B;  3DLG A;  1N32 F;  3NS5 A;  4IFV B;  4ZLN A;  2L3M A;  2BVZ A;  4DBQ A;  2BJE A;  4K2X A;  5KT2 A;  4LF9 J;  2BJ9 A;  3HM9 A;  1CC7 A;  2Q6B A;  1HQE B;  1LV5 A;  4RUA A;  1NK6 A;  4USM A;  2W1B A;  3KFW X;  4JI2 J;  1NK0 A;  2VC0 A;  2B4U A;  4A8S A;  1VFJ A;  1I6J A;  5L9N A;  3N28 A;  3RBX A;  1PSD A;  1TR0 A;  4DV4 F;  4I64 A;  3FRZ A;  3ZTR A;  4WBF A;  4L74 A;  1VR6 A;  3M6U A;  1GXT A;  4HKQ A;  1WDD A;  3TVZ A;  1UVK A;  2HHX A;  4PQU B;  3G4S S;  4OLO A;  3G9C A;  1U26 A;  4CIO A;  1O0P A;  1Q0N A;  2KG0 A;  2JVO A;  2XC9 A;  3NGT A;  4ILL A;  1Q81 T;  2UUA F;  1V5V A;  3VAF A;  1IBK J;  4KHR A;  2DR5 A;  1T0T V;  2DEI A;  3MM6 A;  1VQ4 S;  2KZZ A;  4KH1 B;  2VFU A;  2QMW A;  4DL7 A;  3M05 A;  3CB4 A;  3BYP A;  5E7O B;  2LDY A;  2MZS A;  1UW4 A;  1WF1 A;  3K7R A;  2VB6 A;  1DUR A;  3KHL A;  2AGQ A;  3R5G A;  1PAU B;  1W7W A;  1Y5I B;  3C6T A;  3PYD A;  1U2F A;  1T05 B;  4DCO B;  3GR1 A;  1U1P A;  1SUQ B;  2Z2L A;  4IO1 A;  1QE1 A;  1NH8 A;  4CYU A;  4WFN Q;  3AQP A;  5KFX A;  4F0H A;  5IWA J;  1R89 A;  3LPE A;  2YPY A;  2JNJ A;  3RW7 A;  2AGP A;  2D74 B;  4AXJ A;  4PEO A;  1JXV A;  1H2T Z;  3JTP A;  1OS5 A;  2FJV A;  1ARO P;  3JTO A;  2CQ3 A;  2D3Z A;  4QIG A;  4LF1 A;  3J7Y U;  2G9O A;  4FF1 A;  3CJQ A;  3H5Y A;  2VPX B;  2UUB F;  2ACY A;  3UFC X;  3D4J A;  2Z4P A;  3D5M A;  1R7I A;  5A6P A;  2VJV A;  3MM9 A;  4A47 A;  1U25 A;  2CPD A;  2O3D A;  3EZO A;  2RF2 A;  5GAD U;  1WOP A;  4FDF A;  3QRR A;  1T03 A;  3K8W A;  1BUX A;  4CLY A;  2QTW A;  2GO8 A;  1JJC B;  3OSN A;  1PKU A;  4K4V A;  1Q95 G;  3KLF B;  2E29 A;  2HBZ B;  4HLB A;  1D1U A;  1H98 A;  2D69 A;  2NZ4 A;  3KG0 A;  3D7S B;  3R27 A;  4NLW A;  4QIE A;  2IRX A;  5C25 B;  4QU6 A;  1PBA A;  4DU8 A;  4IO9 Q;  4RBU A;  2W4C A;  4QIV A;  5MAO A;  2WVF A;  2BYC A;  3ZZT A;  2GFF A;  1Q86 T;  3C2P A;  3ZZP A;  2DHH A;  3HVW A;  3TEH B;  3IMQ J;  3KMQ A;  1VC5 A;  1SH2 A;  3D67 A;  3PYE A;  5IV4 A;  3SDE A;  1PJ6 A;  3GIR A;  1XMO F;  1NPR A;  3CJ3 A;  3PX4 A;  3T3F A;  4A46 A;  3CCJ S;  2J5A A;  2AX0 A;  3M8W A;  4MYU A;  2HYI B;  2PEH A;  3RBE A;  1CBK A;  1N34 F;  4CNY A;  1S12 A;  5AXL A;  4Q45 A;  4KV8 B;  3H4D A;  4J9U E;  4DR4 F;  4RJV A;  2HSE B;  3PRD A;  3QT6 A;  6FD1 A;  1HWL A;  2EC0 A;  3WDO A;  4DR2 F;  1R6Y A;  4KBI A;  4LQ3 A;  1PGZ A;  5C7P A;  2AQ4 A;  2AGO A;  4ZJO A;  2Z2Y B;  4RW8 B;  3THV A;  5C24 A;  4DV4 J;  1YJ7 A;  4D3G A;  4ZVQ B;  5J1E B;  2LXI A;  3OXF A;  2QL7 B;  1B70 B;  2E1C A;  1RT6 A;  4WK3 A;  3DKD A;  1S4F A;  3MM5 A;  2DHA A;  2DEJ A;  1UET A;  4M5M A;  1N5Y B;  2UXB F;  4CLW A;  4NLQ A;  4PCQ A;  5K14 B;  5EN1 A;  2ZD1 A;  1ICE B;  3KLV A;  2KTQ A;  2DCL A;  2OSR A;  3SXL A;  5J2P A;  3J7A 1;  2MKK A;  2UUA J;  4P7V A;  3FQL A;  4DPY A;  4FKX A;  2RQM A;  2BV3 A;  5A8R B;  3V6H A;  1HQU A;  3EWG A;  2M8H A;  2V67 A;  4ZDN A;  4B3T F;  3ZXW A;  2VFV A;  2WVC A;  1BQM B;  2FC8 A;  1YG0 A;  5KFT A;  3KWM A;  1HYS A;  1SI9 A;  5DJB A;  2K06 A;  2HVH A;  1AT1 B;  3E01 A;  2E7W A;  2CQ4 A;  3VVT A;  4WU3 A;  2H5J B;  3MAA A;  2V4J B;  2KB2 A;  3TI0 A;  3EXY A;  4HDH A;  3OVB A;  2DHS A;  4RNF A;  1JLF B;  1R31 A;  4ES3 A;  5E3A A;  4M5D A;  4MK9 A;  3RU0 A;  2EFO A;  2DVI A;  1KFS A;  4C3L A;  4NRT A;  1B7Y B;  2B9E A;  3OTO F;  5DO2 A;  4KPY A;  4ELV A;  5K20 B;  2LXU A;  1KQG B;  1QSS A;  2K2P A;  4KJI A;  4GKK J;  4NEY A;  1FK9 B;  4DFM A;  5I3Q A;  5LL6 d;  2RIL A;  1NXI A;  4QWD A;  1VQL S;  2Z56 B;  1AZS B;  5KT6 A;  3DRX A;  2HNY A;  3QGP A;  1FTR A;  2DNG A;  4X66 F;  4IG0 B;  1U1Q A;  2UUB J;  5DM7 Q;  1D9F A;  4AXI A;  2C2R A;  4D3H A;  2OEL A;  1F9F A;  3PKM A;  5HAT A;  5KT7 A;  4NLS A;  3IAS 9;  5IQ6 A;  4HHJ A;  4OJ3 A;  2DGO A;  5F8L A;  3DM2 B;  4K4W A;  2DGS A;  2K1R B;  3HUL A;  1IUJ A;  1OWX A;  5D8H B;  3PRB A;  2ADC A;  4IQM A;  1LWE B;  2N4C A;  3FK4 A;  3AA8 A;  3ZC4 A;  5JUM A;  2QO3 A;  1V9O A;  4OI4 A;  1H38 A;  1HI8 A;  3M9M B;  2K3I A;  3FSX A;  1ZTT A;  3CJT A;  2XMA A;  3QO9 B;  2OPP A;  4WK1 A;  5CZV A;  4DF4 A;  1FX4 A;  2V5H G;  3QYY A;  4NXM F;  4C6A A;  2HFZ A;  1L3K A;  1Q7Y T;  2G0C A;  1REG X;  3DXB A;  4DJB A;  4BWJ A;  3HSG A;  4JYA F;  2VFS A;  3EUN A;  2E5J A;  4JBC A;  1S10 A;  3R1L A;  3CMQ A;  2GX8 A;  3H7H B;  1OMS A;  3VAM A;  4OYO A;  2O01 C;  1Q16 B;  3DU5 A;  4BBY A;  3KTQ A;  1B0P A;  1V6H A;  1XMO J;  3RB4 A;  4NCA A;  3MD3 A;  4J7C A;  1FNM A;  3VGT A;  2RDD A;  1RTJ B;  4J9Q A;  1FRX A;  4DUZ F;  4EZ6 A;  1NDC A;  2C3P A;  4J9S A;  5A0Y A;  4YR2 A;  2IYG A;  1N34 J;  1WC4 A;  2WB4 A;  4KKO B;  4H4M A;  1X31 C;  3KK1 B;  2MPU A;  4ZCL A;  2BZ2 A;  4RUB A;  5L38 A;  4DR2 J;  2EW9 A;  3ETO A;  1MRO B;  5FLX U;  4E0D A;  3QLH B;  1UVL A;  1DLO A;  3K5N A;  2GAH C;  4OHZ A;  2QEX S;  3QFW A;  4J9R A;  3BEG B;  1TL3 B;  2YQ3 A;  2DNR A;  1RZM A;  4GO7 X;  4NCG B;  3PKY A;  1Y7P A;  1ZZN A;  1DTQ A;  4YHH F;  1ZM2 A;  2UXB J;  1R43 A;  2IM2 A;  2LP4 A;  1LW0 B;  1X4A A;  5F8M A;  3RAQ A;  3G8S A;  2Y0S D;  1CEZ A;  3UDL A;  4TY8 A;  3FRY A;  4GVB B;  3MWB A;  2KKH A;  2ZJR Q;  4FNH A;  4IOA Q;  3MAH A;  2HQD A;  1QAX A;  4B3T J;  2VC1 A;  2MQM A;  2E1P A;  3DRY A;  1TL5 A;  1NZ8 A;  4NEZ A;  1KR4 A;  4WFY A;  5IT9 Y;  5D0E A;  3POT A;  4KE5 A;  3GYN A;  1S72 S;  3BRE A;  4ZPW R;  4PQA A;  2VV5 A;  5HI7 A;  2QLJ B;  2UXC J;  4LVN P;  4NYO A;  3QSY B;  5J2M B;  2CDR B;  1SL0 A;  4DSJ A;  2XS2 A;  1XN9 A;  4ZN1 A;  3OTO J;  2HVI A;  1CUL A;  2YNG A;  4OYX A;  4MIA A;  5HMX A;  4Q5V A;  2MST A;  5MLC V;  4KGV B;  4CLF A;  3ILI A;  2XMM A;  2YWE A;  5CHC B;  2YWK A;  4LRB A;  4NCB A;  3W2V A;  2J8S A;  4WZQ A;  3ZTS A;  2CQ1 A;  2FVQ A;  3CCV S;  2ZE2 B;  3M2U B;  1TK0 A;  4DR5 F;  4X66 J;  3V4M A;  2RKI B;  2C2K B;  2OPQ B;  4O3S A;  2W7O A;  2Z30 B;  3FZ2 A;  2J6S A;  1X9M A;  2XO7 A;  2XMV A;  3MDF A;  3IAM 9;  1S1U B;  4UY8 T;  3MUT P;  1WG1 A;  2B56 A;  2LVW A;  3AOA A;  5HRO B;  3KJQ B;  2WAQ D;  4OX9 F;  3H98 A;  3FGV A;  1QTM A;  1N8R T;  5KFG A;  2ZH6 A;  3MM7 A;  4ZLL A;  2E5I A;  1J5O B;  4F8R A;  3MFH A;  2ZH2 A;  1P8G A;  2AZ3 A;  5H9F J;  2GJI A;  3I5C A;  1JKH B;  2GJF A;  1KON A;  2V2Z A;  4DZ6 A;  2VDI A;  3I31 A;  4NXM J;  3ET6 B;  4I67 A;  4PG5 A;  2R2R A;  1RQ0 A;  5IC4 B;  4JI8 F;  1Q8I A;  1YDL A;  1U0S A;  2LQ8 A;  3UDE A;  3HHD A;  1EKS A;  2L48 A;  1S9F A;  2CVE A;  2DGV A;  3CGI A;  1DQA A;  1EZZ B;  3MED A;  1BY9 A;  4TXS A;  4QIF A;  3PV8 A;  4P71 A;  1GTE A;  1SPB P;  4J37 A;  3HSD A;  3T9N A;  3DMJ A;  4DUZ J;  3B6B A;  4JOU A;  5EHH A;  1R8C A;  2VBW A;  2BAN B;  4OJG A;  1REV B;  2I5J A;  1U1L A;  5CYM B;  2L41 A;  2XWY A;  3FQK A;  4JV1 A;  1BD6 A;  4HI2 A;  1KLM B;  5I42 B;  1KFD A;  1RAI B;  1BQN B;  3KUG A;  3AD9 C;  1JLA A;  3CUN A;  4ECV A;  2WSF C;  1FRM A;  4CT9 A;  3MOJ B;  5LT5 A;  2IJF A;  4HL9 A;  2EBG A;  3CJR A;  3CUL A;  1WC5 A;  4J9M A;  3H8Y A;  2NUH A;  3OFF A;  1EAR A;  3BN4 A;  2NXN A;  3M8Q B;  1FRJ A;  4F3Q A;  5LMN F;  4ECR A;  5E5N A;  1WG4 A;  3UD5 A;  1EAY C;  1HI0 P;  4RWX A;  2VQF J;  4K5R A;  4WF9 Q;  2I1R A;  1P9Q C;  1D3W A;  3JS9 A;  2N7C A;  4ZPB A;  1T3O A;  5HVG A;  1RJJ A;  2CQ0 A;  2KG1 A;  4QOT A;  1N36 F;  4DZD A;  2O1P A;  4ZA1 A;  4NX9 A;  1Q8K A;  2RQ4 A;  1RWX B;  1YRX A;  2FVS A;  3IRX B;  2XMW A;  3OUY B;  4DSL A;  2M5Y A;  2CWX A;  2H48 B;  4DUT A;  4IG3 B;  2JDJ A;  5J2N A;  2DH7 A;  4URS A;  4ID5 B;  2V2K A;  3DHW C;  2MKC A;  1Y00 A;  4LF5 F;  4WXW A;  2VG6 B;  4ES2 A;  2PEB A;  3BGF A;  2OTL S;  2GA7 A;  3G2X A;  3PRV A;  5E3Q A;  1RDR A;  1UWB A;  4X4S A;  2HBR B;  2GAG C;  1NJZ A;  3AB2 B;  4LIR A;  1Q79 A;  4DSI A;  1N88 A;  2NXC A;  1FTC A;  1LW2 B;  3L9Z A;  2MMY A;  3Q8U A;  2YKN B;  2JC1 A;  4NLY A;  5ETV A;  1JNR B;  4ED7 A;  2KJV A;  4LRC A;  1M5H A;  1CSJ A;  2RH3 A;  2B7B B;  2F3J A;  2FDN A;  3G86 A;  2AMC B;  1SBR A;  1NEE A;  2CUY A;  4HTJ A;  4U96 A;  1G6B A;  1L3S A;  4X64 F;  2V8D A;  2AU0 A;  4DR5 J;  1QLN A;  2DR8 A;  2EKY A;  2Q6C A;  4KB7 A;  3BKU A;  3QGH A;  4CO0 A;  2R8H A;  3FCV A;  5THW A;  3LP2 B;  3RTV A;  1UFW A;  2HZV A;  2CFX A;  1EQM A;  4F2S A;  4DUY F;  4OX9 J;  5GAD I;  3ETM A;  2MQP A;  2ZWP A;  3PJX A;  1FDA A;  2L9N A;  3EIC A;  3G96 A;  3GJT B;  5KOX A;  2D7S A;  2PMZ D;  4ZHR B;  1CS4 A;  2HQI A;  1WJ9 A;  1DQ8 A;  3QAU A;  4O0N A;  3ISN D;  1S1W B;  1IKW A;  3MMB B;  4JI8 J;  2IJR A;  3HX9 A;  4BC7 A;  4DR1 F;  1RBO B;  4RW4 A;  2UP1 A;  3WZ0 A;  2H5E A;  2CJQ A;  3MI7 X;  1NCL A;  3N4W A;  4W98 A;  1NM2 A;  4ZCI A;  1RTH A;  2L9D A;  5F0W A;  3KK3 B;  2HFS A;  1S6O A;  3CSK A;  3EM1 A;  1IWG A;  4M5K A;  1FCA A;  1JLB B;  1HAR A;  5J1N A;  3MR5 A;  3SCJ E;  4PWW A;  2RRN A;  4IRK A;  4RO0 A;  3KLG B;  3OLA A;  2HQF A;  4KR0 B;  2J7K A;  3FEZ A;  1QSY A;  1NK9 A;  4WZM A;  3BDP A;  2IJN A;  2VQE J;  1X4F A;  5KFZ A;  2Z57 B;  1MML A;  1TFW A;  1GK8 A;  3M9O B;  1SIW B;  5DM6 Q;  3KK2 A;  4BDP A;  1WHV A;  3BN7 A;  2XGP A;  1UWA A;  4CLT A;  1YBA A;  1NSA A;  5IXU A;  4I2P A;  5LMN J;  1YIJ S;  1PYO B;  1L3V A;  1RYS A;  1S9E A;  4CO4 A;  4Z7C A;  3H2L A;  1KQK A;  3F44 A;  1TAQ A;  2DIS A;  1SJF A;  2CPE A;  1OO0 B;  2KYZ A;  4HVZ A;  9ATC B;  2FJB B;  3I55 S;  2EWH A;  2BW2 A;  3OXG A;  2HEK A;  4F0K A;  5CYQ A;  4DV6 F;  3TAN A;  1WHY A;  1PCA A;  4R5P B;  2CAD A;  3BBF A;  1S1T B;  1GAO A;  2VZ9 A;  2WVE A;  1H73 A;  1S1X A;  4Q2M A;  3CDA A;  2I0X A;  2M0G B;  5HLF A;  5GMD A;  3TAP A;  4PYD A;  4CM2 A;  3UR0 A;  2CPZ A;  1LOU A;  3R5B A;  1GMW D;  3BGU A;  1OYD A;  2F4V F;  4Y00 A;  4RX6 A;  3E3X A;  4OZN A;  3PO4 A;  4MAK A;  2WSC C;  3DRS A;  1CVJ A;  1Z4U A;  5KTQ A;  3KJV A;  2PFF B;  5L39 A;  1WD6 A;  4TY9 A;  1IKX B;  2RML A;  4IKA A;  2V63 A;  4B9V A;  1UVJ A;  5F9L A;  3KLI B;  5HJX A;  4X4V A;  3THP A;  1X5S A;  1A7G E;  2UUC F;  4B9N A;  4LSN B;  5JVG Q;  1RWN B;  3I0S B;  2ILY A;  1JLG B;  4YR3 A;  2CRL A;  4NA3 A;  5KG3 A;  3RB6 A;  3PW7 A;  3UCU P;  2JRS A;  2HND A;  4X64 J;  3HZE A;  4FS2 A;  3DOM B;  2XO6 A;  3RBZ A;  3NWG A;  3I4P A;  1IBM F;  1VRT A;  3D6H B;  4WE1 B;  4CP5 A;  2CPH A;  2I8E A;  3MPU B;  4KFB B;  4F4K A;  4XAK A;  4DU7 A;  1HI1 A;  1HBU A;  1O6X A;  4DUY J;  1T9W A;  4FS1 A;  4G1P A;  1OY9 A;  4LR8 A;  4MKB A;  3TVY A;  4ED8 A;  1B0T A;  2AP6 A;  3MEE B;  5M2U A;  2CG4 A;  4RWW A;  3MFI A;  4KGZ B;  2KVQ E;  1H6K X;  2UXD F;  2BMB A;  3NGU A;  1ELO A;  1U6F A;  4EO6 A;  1C0U A;  3QIP A;  4QZV B;  3DLK A;  4KH0 B;  4Q0B B;  4WTO B;  3M8P A;  3K58 A;  4DR1 J;  3JTN A;  3W64 A;  5A8W B;  3IP0 A;  3D3B J;  3CJK B;  2DYA A;  2IAJ A;  3GJS B;  3QSI A;  1QJH A;  3HFZ B;  2MSS A;  1X0P A;  1RAC B;  4B9S A;  4P2X A;  3VAG A;  2V69 A;  2ZVI A;  2LKZ A;  3EVO A;  3HK2 A;  2M9K A;  4ER8 A;  4CZC A;  2CJA A;  1HBO A;  5KG0 A;  4YOE A;  1CJU A;  1WEL A;  2MY7 A;  5C2G A;  1FD8 A;  4NI2 A;  1RIS A;  3CIM A;  4RNO A;  2GCF A;  4ATN A;  1HHQ A;  3M4X A;  2MZT A;  3NNA A;  3P8B B;  3EGW B;  2GHV C;  2YNI A;  1K44 A;  4CWB A;  4QPX A;  3OFG A;  1WTB A;  2IC3 B;  2ZFH A;  4ED2 A;  3SBM A;  2A2D A;  1X7V A;  1NB2 A;  4JB8 B;  1UKU A;  3BPD A;  1TK8 A;  3JSY A;  3DCA A;  3Q22 A;  1R0A A;  1JLE B;  1F2H A;  2XSF A;  1CJV B;  3AXM A;  1MU2 B;  5M2P A;  1N6Q B;  5KT3 A;  8RUC A;  2FLP A;  3I56 S;  2OJ3 A;  4ZPT R;  2GZO A;  4IOB A;  3GE9 A;  1SQE A;  3R7B B;  2ZJP Q;  1X9S A;  1UPP A;  1N54 B;  3CDW A;  2FD2 A;  2VUG A;  4MK7 A;  2E9R X;  5L1J A;  2LLZ A;  2DNZ A;  3M6X A;  3T1H J;  1X4H A;  4DR6 J;  3RG6 A;  2DGU A;  4MKY A;  1NKB A;  2F4V J;  3IWL A;  3CD6 S;  3S6E A;  3G6V A;  2HMI A;  4DQR A;  4MIB A;  3TP2 A;  1HMV B;  4Q2L A;  4NXN F;  3CJ2 A;  2QSW A;  4USH A;  5D3G B;  2KL8 A;  1S79 A;  2UUC J;  2I38 A;  2E5L F;  1YBU A;  2HQ3 A;  1KC8 T;  5K8P A;  3IS9 B;  3V2U C;  4KRW A;  3KMS A;  2Q3P A;  4ILR A;  3CJ4 A;  3OHB A;  4DF8 A;  1RHU B;  3NBP B;  3GON A;  3K5L A;  3DXS X;  3EJM A;  1SC3 B;  1YI2 S;  1IR2 A;  2W9A A;  4K0K J;  2BX6 A;  1JX4 A;  3G6E S;  2OTJ S;  4LRF A;  3UVJ A;  3MGJ A;  3NAH A;  1WUU A;  3DRP B;  1IBM J;  1C1C B;  3UI3 A;  4Y2K A;  1UAW A;  1EET B;  4RUH A;  1X4C A;  2GMH A;  1LFW A;  4CT8 A;  4ZLP A;  5E41 A;  3W2W A;  1RAA B;  2Y8W A;  4JV2 A;  3U1N A;  3W62 A;  4DPO A;  4GO5 X;  3MEG B;  4ZVS B;  4FF2 A;  1WG5 A;  3A1Y G;  4RU2 A;  3V6K A;  4OI3 A;  2HGL A;  5D0H A;  3DLJ A;  3KG1 A;  4AQY F;  4O44 A;  4ZVT B;  2UXD J;  2DNL A;  1GFW B;  1FT8 A;  4DFJ A;  4K4X A;  3QWU A;  4ZOS A;  1MWY A; 
#chains in the Genus database with same CATH homology
 3EVM A;  3FBB A;  5BXI A;  4EK2 A;  1S57 A;  1VYA A;  1BHN A;  1BUX A;  2AZ3 A;  3Q8U A;  3GPA A;  1PKU A;  4O0N A;  1NB2 A;  4AND A;  4HR2 A;  3ENA A;  3NGR A;  1S59 A;  4DZ6 A;  3VVT A;  2HUR A;  3Q8V A;  3EMT A;  1W7W A;  1BE4 A;  4KPC A;  5C7P A;  1MN7 A;  2NCK L;  1NDK A;  4ENO A;  3BH6 B;  5CAA A;  3Q89 A;  2DYA A;  2DXE A;  1LEO A;  4F36 A;  3VGV A;  4DI6 A;  2HVD A;  2BEF A;  1S5Z A;  3R9L A;  5CAB A;  1XIQ A;  4C6A A;  3EJM A;  1NCL A;  3ELH A;  1PAE X;  4W98 A;  1WKJ A;  2B8P A;  1B99 A;  2BX6 A;  3JS9 A;  3FBE A;  3GP9 A;  1WKK A;  1HIY A;  3ZTP A;  3VVU A;  3B54 A;  3EVW A;  3EM1 A;  3FC9 A;  1B4S A;  3ZTR A;  4UOH A;  3DKD A;  2CWK A;  3NGS A;  3Q8Y A;  4WBF A;  3BBF A;  3EVO A;  4FKY A;  4UOF A;  3ZTS A;  1JXV A;  1F6T A;  4CP5 A;  1NDL A;  4S0M A;  2VU5 A;  3VGU A;  3B6B A;  3FBF A;  3PJ9 A;  1XQI A;  3FBC A;  3ZTQ A;  1WKL A;  1NLK L;  3FCV A;  1F3F A;  1HLW A;  4DUT A;  2DXD A;  3BBC A;  3VGT A;  3FKB A;  3ZTO A;  1NUE A;  1NPK A;  4ANE A;  3L7U A;  1NDC A;  3Q86 A;  1MN9 A;  3NGT A;  4FKX A;  3MPD A;  1NSP A;  2B8Q A;  3VGS A;  4ANC A;  2DY9 A;  1U8W A;  2HVE A;  1HHQ A;  1LWX A;  1ZS6 A;  2AZ1 A;  3ETM A;  1NDP A;  3G2X A;  3PRV A;  1EHW A;  1NHK L;  3FCW A;  3EE3 A;  2DXF A;  3Q83 A;  1K44 A;  4UOG A;  3BH7 B;  4F4A A;  1KDN A;  3DDI A;  3EIC A;  3BBB A;  1UCN A;  5IOL A;  3WX8 A;  1NSK L;  3NGU A;  1NSQ A;  2ZUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...