3EVOA

Crystal structure of the mimivirus ndk +kpn mutant complexed with dtdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3evoA00
1NUEA 1S5ZA 1BE4A 1NSKL 1LWXA 1F6TA 1ZS6A 1HHQA 3EE3A 1PAEX 1WKLA 3FCVA 3VGVA 3EVMA 1NDKA 1XIQA 3EICA 1PKUA 1MN9A 3GP9A 2NCKL 1VYAA 3NGTA 3BBCA 4C6AA 3FC9A 1HLWA 4KPCA 1F3FA 3ZTRA 4UOGA 1NCLA 3EVWA 2AZ1A 1BHNA 3B54A 2DYAA 3Q86A 2AZ3A 3Q89A 4UOHA 3NGRA 1S59A 1HIYA 3BBFA 2B8PA 3NGSA 5BXIA 1BUXA 4FKYA 1W7WA 1U8WA 1WKKA 3BH7B 3VGTA 3PRVA 4F4AA 4DZ6A 3EM1A 2DXDA 3JS9A 4HR2A 3DKDA 4DUTA 2CWKA 1NB2A 1EHWA 1UCNA 5C7PA 1JXVA 2HVEA 1MN7A 3VVUA 1S57A 3FCWA 4ANDA 5CAAA 2DY9A 1XQIA 4DI6A 4UOFA 3PJ9A 3VVTA 3FBEA 3GPAA 4F36A 2B8QA 3ZTQA 3ZTOA 4FKXA 1NSQA 3FBBA 4ANEA 1K44A 3ZTSA 5IOLA 2DXEA 3DDIA 3MPDA 3R9LA 3VGUA 1LEOA 2DXFA 1WKJA 4WBFA 2HURA 1NSPA 3FBCA 2HVDA 3B6BA 3FKBA 4S0MA 3ELHA 2BX6A 3ZTPA 1KDNA 3EVOA 3EJMA 3WX8A 1NLKL 3BH6B 2ZUAA 1NDCA 1NHKL 2VU5A 4O0NA 5CABA 3FBFA 4CP5A 3Q83A 4EK2A 1NDPA 3G2XA 3ENAA 3Q8UA 4ENOA 1NPKA 3VGSA 2BEFA 1B4SA 3Q8VA 1NDLA 3L7UA 3Q8YA 3NGUA 3ETMA 4ANCA 3EMTA 3BBBA 4W98A 1B99A
chains in the Genus database with same CATH superfamily
3N6NA 2MHEA 4RW8B 5EN1A 2MQMA 5J2QA 2RRAA 3DYAA 2DNNA 2X7IA 2D3OR 1P6TA 4H54A 2OD6A 4C7QA 3GWCA 4DJBA 2YWFA 4B08A 3RTVA 2HYIB 2N4DA 1OPZA 1IKWA 4J91A 1YBUA 1JMTA 1NMEB 2J7WA 2JVOA 4EYIB 4E0DA 2YX1A 4DR7F 2ZOMA 3CIMA 4M5KA 1NK0A 1DJ0A 4LQ3A 4PUOB 2V63A 1VYAA 1JLEA 3FEXB 3OTOJ 3NS7B 2LEBA 1TR0A 4KPCA 5IC4B 2UXBF 3MAAA 2MZRA 4DR5J 2DIVA 2A10A 4TU8A 2HG4A 2FJXA 1FESA 3IM8A 3QNWB 2ZM6J 1OY6A 1ZOTA 1BXNA 2GHPA 4HLBA 4DEZA 1FVSA 3PNIA 4R5PA 2UUAJ 3H98A 4QR2A 4RUCA 2OIHA 2F65A 5LSLA 4MIAA 2OO4A 1FERA 5K20B 5LSRA 4XIUA 1RU1A 1RAOA 2W9AA 1FKOB 1CJTA 1UJ6A 1ZM9A 2H5EA 1S6QB 2V2ZA 1Q86T 2QSFA 1S0VA 2GMHA 2OPRA 1RKJA 3T9NA 3DNCA 3WIVA 5JJBA 2KZZA 1N5SA 2EWHA 2GGPB 1RT2A 1RP5A 4HHJA 1RLDA 3QZ8A 3FGVA 1PG5B 2VBWA 4X4TA 5KG0A 1RHRB 2ZM6F 2DNRA 4YMEA 3JQJA 4N7TA 5E7OB 5K9FA 4U7CA 4AUKA 4CTAB 2CDQA 2OPQA 2J0SD 2JEIA 4JI8J 4C97A 2VBZA 3ENWA 4OV6A 2CPYA 3OJSA 1PCAA 1UCNA 2IYGA 2R7SA 5IS2A 1Q8IA 1RT7B 1Y00A 2P9CA 1TZ0A 2KFYA 4MT1A 4Y28C 1F3VA 2ZBPA 1Q4RA 5D0EA 1V3ZA 4CLPA 4LBHA 1Q8LA 5EWGA 3VVUA 5GADU 2ZH3A 4RUBA 2OEJA 3VAGA 1TUVA 3ITHB 2QX0A 3KLHB 3JSMB 1JX4A 1QSSA 4KJIA 1RTJB 4KYZA 5B0BA 1CJKB 3X1LB 4LFAF 3ZC4A 2EG2A 1D8ZA 4TLQA 3DRXA 2EBGA 2CNKB 2DR9A 2D3O1 5C25A 5F0UA 3BR8A 1ROFA 3RG6A 4DR2F 5I3UA 2KRBA 2ACMA 2B8QA 2EK1A 3TX8A 5G4DA 2MSTA 4CO4A 4FNIA 4BLGA 4QW8A 3OFGA 3PIPQ 4CLLA 4FYYB 4LF5J 1F9FA 5H9FK 3D6HB 2E7XA 2E5JA 1XJWB 3DI6A 1LEOA 3LUYA 2F63A 3MOZA 3BSOA 2JH3A 1U6BA 2EC2A 3OTCA 1Q8KA 4ICLB 4PEOA 1MMNA 4KSEB 1DFDA 1REVB 4RW4A 4DFPA 1RHQB 3DLHA 5AXLA 4P2XA 2HQDA 5HAOA 4U95A 4ZPTR 5F8JA 2LECA 2ALZA 1A9NB 1LWEA 2HNYB 2I38A 4CI0B 1SJ3P 2JVRA 2XZDB 2LXIA 1F5BA 4CH0S 5C5JA 1RLCL 2J7UA 2DGWA 4I4BA 4KGXB 1VQPS 4N56A 2NSBA 1Y3JA 2QV6A 5DDPC 5H9EJ 4LF5F 3Q2SC 1N34J 3FBFA 7AT1B 4WXOA 4ZHRB 1U45A 4ZHRA 2AGQA 2IM0A 3GYGA 2EFOA 4FZVA 2R2TA 4IH5A 5HP1B 3OQ2A 3NWGA 1U1RA 3C19A 4HTJA 4F3MA 3AT1B 1VQLS 1RAJA 3H42A 4LF4J 2MKJA 3PG9A 3T1HF 2R42A 4B3TF 1R0AA 4HHUA 3CCQS 1U1NA 2CQBA 2FJWA 3KFWX 1TUWA 2WZ1A 1U4BA 4IDKA 3TOQA 2HBQB 5U47A 3QT6A 4X4VA 2R2SA 3CEDA 2NYHA 2NLWA 5KFVA 1MROB 1ZS6A 2AHOB 4DPUA 4KH0B 1SV5A 2K3IA 2BM1A 2J0XA 2JFDA 2LDYA 2VH7A 1NK8A 3GCWP 4HEA9 2X1GA 2AJ4A 2HVZA 3L09A 4G65A 4KAIA 1RAEB 5H1SV 2ZH1A 3NWRA 5M2UA 3K5LA 3V6KA 1HHTP 4F04B 1HNXJ 1TAUA 1F0XA 2HLUA 3SXLA 3VCDA 3OW2R 3T5KA 2FPHX 4FBUA 4UTGA 3DDKA 1RT5B 5EX0A 1HLWA 5KFTA 1SV5B 4OX7A 2HHUA 1EAYC 4DL2A 4GO5X 2KJWA 3G8QA 2VJUA 1T9XA 1BHNA 2GVDB 2V4JA 2F40A 4UZCA 4PXBA 4DV1J 5ETRA 2W7PA 1UVMA 4DCOB 1YZ7A 4M5LA 1Q7YT 5IT9U 1EKSA 3OHAA 2XYHB 4QZVB 4K5RA 5DDQC 3J80Y 3VAFA 3LP2B 1AZSA 1PYSB 4UF4A 2BJ3A 2OEKA 2XC9A 2WVCA 4EEYA 1EP4B 3DXBA 2J0QD 2JHEA 1UJ4A 1F9HA 5IT4A 3W7BA 5LMUF 3K0JA 1IKYB 3KK2B 4DV1F 3RZAA 4Q44A 2XGPA 2BQUA 4RW6A 3AA9A 2IVFB 2VBYA 5FD1A 5GADI 1SC4B 2YVSA 1CSJA 1P27B 3AH6A 4OZ1A 2PMZD 4C8MA 5I4MA 1RAFB 2YQ0A 3A8IA 4YR2A 1X5PA 2MKHA 2OI2A 4KC5A 2GIQA 2VUGA 2YNGA 3BZQA 2V94A 4UW2A 4DZ6A 4X4RA 2UUTA 1SC3B 2G2ZA 2CA9A 3QYYA 4OZ0A 4D3HA 1EHWA 3TZXA 2FJEB 3H4DA 4RBVA 4U8YA 1DARA 1N56A 1YSJA 2XS5A 3MMBA 1Y7PA 2YH1A 2HHQA 1ZM4A 2LQ8A 4C0OC 1AA1B 4QWDA 1XR6A 4DBQA 5I3PA 1TKTA 3FCWA 2XGQA 3DU6A 1IKXA 2J9CA 2RU9A 3IMQJ 5ETQA 2N3OA 1M90T 1RTDA 4EBEA 2YXLA 4UOFA 2W1BA 1S72S 1E6YA 1S1VA 4YS2A 4KGZB 3IGVA 4LREA 5GAGU 3KJVB 3IRWP 3SV3A 1N32F 1XERA 1R8CA 2FHKA 5KG4A 3ISNC 4DL4A 5A6PA 2F8HA 4WKRA 2ASLA 3HFKA 4HL9A 4O4GB 1OY8A 2M8DB 4PQUB 4C2MA 1NO8A 2HIQA 2IDEA 2OFGX 4YEAA 4MYTA 5EWEA 2YKMA 3HZEA 1ZPWX 2OAUA 9RUBA 1S0OA 3GV5B 2J9EA 3JSMA 4RJVA 3BPSP 2VJVA 5D8HB 2I2YA 1RT3A 3G8SA 2PE8A 1NU4A 1S1XA 3PYDA 1C1CA 2AJFE 2CQIA 2XHWA 4OHXA 4OYWA 4F7VA 3EWGA 5EDWA 1VS3A 3FJ2A 3PCOB 2ZH2A 4I67A 3POTA 2RF2B 1LK5A 1MWZA 2CZ9A 5FIIA 2L3MA 1EETB 1S99A 2KT5A 2YKMB 3CSKA 4IG3B 4NWBA 1NJIT 3LW5C 4LF6J 3J81U 4TN2A 4O3SA 4PG7A 3QIPB 5JXSA 2HGMA 2VFUA 5K8NA 3D0GE 4KE5A 1HBMA 3CO0P 3PJXA 4AT1B 3DYAB 5A0YB 3POTB 4O0NA 2XO6A 3I55S 1SJFA 3ILOA 1M0SA 2IBOA 3CPWR 2X1FA 4OZ5A 2VPYB 3OVAA 2XMAA 3KJNB 1REGX 1WC6A 4ES2A 2ZH9A 1S1WA 2B5JB 2I5JB 3CW2C 5A8RA 1LNQA 1X4BA 3W61A 1VJWA 2NUUG 2QYGA 3C6TA 3CD7A 1X7VA 3FFIA 3GJTB 1UMJA 1HNZF 3CMQA 1S76D 3D9BA 2CQ1A 2RT3A 2N4CA 1NZ8A 3D3CJ 4ZJQA 5M2PA 1FWLA 4I6AA 4OV1A 5JMNA 4GMKA 1F5AA 1YLXA 3QWUA 4USTA 4U7UK 4YB1P 4YB5A 2NR0A 1RWWB 4LR7A 4YFUA 1N5YB 1BY9A 2O67A 2Y1RI 1D9FA 2ZBCA 3CCSS 4IRCA 4LFCJ 1S77D 4KY3A 2QN6B 3NGDA 7FD1A 3UVJB 1N6QA 5CXTA 4TU7A 1HNZJ 1IKXB 1SKWA 2IMWP 3F41A 1VHFA 3TVYA 3ZNJ1 1KLMB 1OO0B 3GYNA 3QRPA 1PKUA 3KHHA 3T5LA 3V2UC 1H98A 2B6AB 1P1TA 2GJ2A 2WK4A 4OIXA 2RQKA 2QTWA 5D77A 3H2LA 3OHBA 3CTRA 3B8HA 1J5EJ 2F4VJ 1PJ6A 4ED5A 3CJ5A 1GXTA 4DDFA 1RT1B 4F3OA 1T3OA 1QM9A 2E66A 3EDRB 4DUYF 1CBKA 4USUA 5IV3A 3F0NA 1RISA 2KXHA 2UUWA 4LF7F 2UP1A 4XO0A 1AYEA 1VRUB 4KKOA 1RT6A 2DR5A 2VC1A 1RBOB 3O44A 3UDVA 3NS6A 2CQ0A 4ZVFA 3QZ7A 1RT1A 1I1GA 3IN5A 1OMSA 1R6VA 2V8PA 1TV6B 1E6VB 3N5BA 4OJ3A 3CD0A 1FRMA 2ALYB 2B8PA 3NGSA 3QMQA 2BMBA 3KG1A 4JBCA 3BS9A 5E33A 4ER8A 2HQCA 2V50A 3D54A 4WKYA 2I6WA 4LJMA 2L41A 1F2GA 1NSAA 1RQ0A 3TZYA 3HI9A 5HVHA 1VQ9S 1U8SA 2WBRA 4L6V3 2MPUA 1DAXA 1T0TV 3UD4P 3E01B 3FQKA 1U2FA 2Y8WA 4GO7X 4B9SA 4U67Q 4K4UA 1ZZFA 3GFXA 4PWDB 4PWDA 1S9GB 5ETKA 2HFOA 5L9XA 1GMUA 3FQLA 1HQ2A 4WP8A 5C7PA 1U0SA 1HWIA 1YBAA 4DS5A 3MM6B 1LXJA 2J9DE 4C3KA 3HSZA 2MZSA 1RUSA 1Q0NA 4EMDA 1JXEA 4TY8B 5AJ3J 1PC5A 3AJ1A 3TW0A 2QA4S 2DEJA 2LVWA 2RHSB 3AXKA 3O5TB 4ALZA 1RK8A 3ZO7A 2FHMA 3H90A 1C0UB 1Q79A 3D6FB 4NLPA 1H2VZ 2CPFA 4M5DB 2GW8A 2DBBA 3GV8B 2SXLA 4EFAC 3ZZYA 2VFVA 2P8IA 2K1RA 4PWWA 2ATCB 2ZITA 3DOLA 5J1PA 4RNMA 3ZTOA 5KT7A 1KSPA 1R0BG 4J90A 3GIJA 1TU0B 5IOLA 3M8QB 5KG7A 5DG8A 1C1BA 1A6LA 2F8MA 2O1PA 3LTOA 4HDHA 5DO2A 5L38A 4I0WA 4LFBJ 1NH8A 3GR1A 1FKPA 3P3DA 1VRTB 2QLJB 2JLGA 2BANB 2I9SA 4F0HA 1ICEB 3CD5A 1NPRA 3EYZA 3UCGA 3IR6B 2PI5A 1F1BB 2M88A 2EXUA 4V1Ak 5J2NB 4ED1A 1IWAA 3W1YC 1U09A 3F56A 2X1AA 2CZVC 5HP1A 1VC6A 1HI8A 1SI9A 2ZD1B 3D68A 4FPRA 3MPWA 5A8KA 1RTDB 2LEPA 3AA8A 4L3KA 2G2YA 1U6ZA 2UZAA 4QW9A 2R7XA 3TUIC 2HNZA 4NZ0A 2X1BA 1LW2A 3SQOP 3GB0A 3ENAA 5HO4A 5LMNF 4UUWA 4PPZA 4HACB 4M8LA 4PG6A 4IQXA 2VFRA 3MCOA 1HNVA 1S10A 4YY3F 4Z7YA 4ZDNA 2BKNA 1NZAA 4IFVB 1ZPVA 4P74A 2XCPA 3P49B 1X8DA 3DLKB 2DO0A 3DOKA 3MR7A 4IRDA 1B99A 2GO9A 1RTZA 1NUEA 2DGQA 2CXEA 2HZAA 3C14A 1RT7A 3CJ3A 5AE3A 3G96A 1HBUA 1S1TB 5J1NA 3HF5A 2P2CB 4C8OA 1N33F 2MY8A 4MJKA 4USHA 1U1KA 2HHWA 2E5GA 4DV6F 4UOCA 2RQMA 4NE9C 4ZVEA 2ZZMA 4H4KA 2RRBA 3R2DJ 1H38A 1GH8A 5J2QB 2XM3A 3CCJS 2NCKL 3B4MA 5A0YA 3HSJA 3TP2A 4CNYA 6FDRA 4TY8A 4XAKA 2DR7A 4QPXA 1Z2LA 2A2CA 5IV4A 3HHKA 4J9OA 4UOGA 1JLQA 5T41A 4OHVA 1X0FA 2F5GA 5HLFB 3EVWA 4CLZA 2E1CA 2EFQA 4BHQA 4ED8A 2AZ1A 1H7WA 5FDLA 1FXDA 3NMRA 4K4VA 1WC0A 5C42B 4RX6A 3D7SB 1L3TA 2ERRA 4JI4F 2QFIA 1LOUA 2BXJA 2OP5A 3A3PB 4RPFA 4ZLJA 4X4QA 2KG0A 5J2PB 2R8GA 1NEEA 1D1UA 2VG5B 3KLFA 4LSNA 4DV6J 1HBNB 4OYMA 4F26A 1UTAA 3UCZP 3A8KA 3M8SA 5C42A 3M1VB 2ZDPA 3GFHA 4ZVOB 2HS4A 2W7OA 5CYMB 2ZH8A 1BWVA 3ILIA 1EARA 2IM3A 3CC7S 4ZVQB 2VICA 3M8ZA 1KLMA 3TAMA 2XCAA 5D4OA 1CS4B 3B82A 3NCQA 1XMBA 3KJVA 1U7LA 4HI1A 5DZ7A 2E29A 2V8GA 4F0MA 3KDOA 4KO0A 3IWNC 2OTJS 3DLGA 2FY1A 1WHVA 3MTJA 3BB5A 5FLXY 1FRKA 1NHVA 1RADB 2H48B 5HMXA 5BYRA 1KR4A 1SVDA 2OPSB 5KT4A 2MQQA 1K9MT 3JSYA 4TLRA 1V3SA 2YX4A 3DOKB 1EIYB 4MFBB 3IP0A 1WTFA 4JV0A 1CULB 3WBZA 1TK8A 1JLGA 2IYIA 2NYIA 3PJ9A 3WC0A 4QWAA 4OL8A 3GSIA 3CJKA 5B7WA 2PFDA 3OTDA 3LAKA 4DFMA 3MF5A 4NLUA 2B9XA 1TL3B 4P6QA 2H5JB 3MM7A 3CULA 3DGPA 5J2MA 1UVIA 1ZBTA 3AB2B 3HDSA 3KLGA 2GHWA 1UEUA 2DXEA 5E2QA 3M8YA 2G1HA 4AD6A 3VAIA 2N7YA 1UL3A 4HKQA 4LR9A 4DR6F 5D3GB 2HURA 1QTNB 1C2PA 2M3DA 5F9NA 1EP4A 4DCPB 5KFRA 2R3VA 1HWKA 5ETVA 3QGPA 2XSJB 4WFAQ 3D66A 2RS8A 1WDDA 2CAJA 5BYSA 3EVOA 4JV1A 4GRSA 4Y6IA 1JQGA 3SQGB 3Q23A 2YH0A 4ECZA 3ADAC 3M9OB 3J7AN 1DBDA 2V8HA 4H4OB 3QAUA 2DITA 4H4OA 5KG2A 4K4WA 2K7JA 5KT3A 3T5HA 2H65B 4LQ9A 1R8BA 1RWPB 1KKHA 1T9WA 4ECTA 2BQRA 2MLXA 2Y0BB 3OTOF 5B0DA 2K1RB 4B9VA 1K47A 3W5XA 2FVPA 5KFXA 4DR1F 2QG9B 3THTA 4CH7A 1NH7A 2JJ4D 4C11B 3NNCA 1U1OA 4DL6A 2FJDB 1DTTA 4ZP7A 2DT9A 2G0CA 2GZOA 4WK1A 2RHQB 3OL6A 2QMXA 4BDPA 4YHHJ 3GILA 2VG7A 4JI0F 1U2RA 1N88A 1X9MA 2VA3A 1G6BA 2CKWA 4ECVA 2HGNA 2HFNA 2WCXA 5IFMA 5GAHU 3I0SB 5LXYA 1QSYA 1NXIA 3EVMA 4MFBA 4NI2B 4FS1A 4F4ZA 3SEOA 3DFEA 1I94J 3BGUA 3HHLC 4QWBA 1T9UA 3I5BA 3SI8A 1VQ6S 4XK8C 1YTYA 1RB0A 4NXMF 4NCAA 2C3YA 2DR8A 1JB0C 2FVQA 1FI4A 1MWQA 4X84A 1TL1A 4JV5F 3H20A 4Y3CA 1FHTA 1OQ6A 2MY7A 1X9WA 1V5VA 2DGUA 2ROPA 4PQUA 4PYDA 2ILZA 2QLFB 3WIUA 1LWFA 2R7OA 3NGKA 3KYLA 1S6UA 1PC4A 2V8VA 3DRRA 1S4EA 3MCSA 3WDOA 2KXNB 1S9FA 1SKRA 2BJ1A 4M5JA 4R8UB 3V4IB 2VZ9A 2IVMA 2V4JB 4DQQA 1ZYQA 3PRDA 1HQUB 1P9QC 2I1RA 4JB8B 4O3QA 1KD1T 2ZZNA 2D69A 2BV3A 2ABYA 5J1EA 5HBMB 4E8UA 1U8WA 3HVTB 3CJ8A 5DM6Q 4IOAQ 2AJ1A 2DB1A 2DD8S 2DNYA 2XBPA 1LFPA 1VLOA 3VGTA 3UN5A 3FFIB 2D41A 3KLIB 3OXFA 3DKDA 3SDEB 4RNFA 4IH7A 1KBRA 2PEHA 3M30B 1IKWB 8ATCB 5HQMA 2IJRA 4J7CA 1NB7A 1H74A 1RAIB 2C3MA 3GFYA 1MU2A 4K59A 1WD6A 5F8NA 1BQMB 4C0BA 3DRPA 3M6VA 4C8KA 4JYAF 2DHXA 1G4CA 3GYXB 4CLKA 1W26A 4ZLLA 4JI1F 1SJ4P 3J7YU 1YGYA 2MQ8A 2PMWA 3QPIA 2GVZA 4K4XA 4OYXA 5JVHQ 1MLAA 4Q5VA 3VVTA 1ZTTA 1JK9B 2K06A 3TA1A 4U7UD 4X64J 3IFEA 2HFSA 1R31A 4F36A 2GGPA 3BQ2A 4DV2J 4ANEA 1R0AB 2C3OA 1K44A 2KXFA 2WB4A 4DG1B 3C15A 2Z58B 2QLXA 3FSIA 2PMHA 4CO2A 5CCMA 4UT4A 4KFBB 1CJTB 2OPQB 2MSSA 3DRSB 4KKOB 1RDRA 1SPBP 1UZDA 4ZA1A 2C3PA 4BWMA 4J9MA 4K0KF 2KM8C 3RB0A 1HBOB 4CYUA 2A6OA 4R25A 2XMWA 2C3UA 3PW7A 2DCUB 3HX9A 3QIDA 3G6XA 3MAHA 3W9HA 1AFIA 2ZC3A 2AX0A 2ZDOA 3ILLA 5IWAJ 2AU0A 1LK7A 3I5AA 1NLKL 1X4CA 1BD6A 2J5AA 2V69A 2ZOFA 2ZUAA 3FUYA 4ZLPA 3TUZC 3R7SB 2MQPA 1NHUA 2WONB 2Z4PA 4CYUB 5GAEU 2WONA 1U1PA 4C8YA 1LWFB 3K7RA 3N79A 2JDJA 2RKIB 1FRXA 3FZ2A 3LP0B 3O3LA 3Q8UA 2ZWPA 2UUBF 4O3RA 4FF1A 4WFZA 1NPPA 3PHTA 4YDDB 3AHPA 5B08A 3A4TA 3BF4A 2V8DA 3Q8VA 6AT1B 3CCES 2ZFHA 3IG1A 2CPEA 3A1YG 2VQFF 1EQMA 2W2OP 4LMZA 1DLOB 3GTYX 4X62J 3CB4A 3FSYA 3UN3A 3GIMA 2HBZB 4L3NA 5IWAF 4PUOA 1FJEB 3UPFA 2VL1A 1S5ZA 2IM2A 3DRYA 2W24A 1N0VC 5A6WA 2ZE2A 2UU9J 2QO3A 2VKZG 4TU9A 2VD3A 3L4BC 1PAEX 1NDKA 1SKUB 5DQHA 3M8QA 5E0OA 4A48A 5E3CA 4P75A 4YOEA 5KFHA 3DDNA 1T9VA 3M9MB 2COLA 1NRKA 4MMOA 1GEHA 2DNQA 2IC3B 1SQEA 1RE1B 3ZTRA 3M32A 1JLBA 5BJRA 3PV8A 1SC1B 3CO9A 3J7Z5 1S12A 4RWXA 3NNAA 5CZVA 2MGZB 1ULRA 3MPYA 4FS2A 3SZ2A 2ZHBA 1VIXA 1OPIA 5F3TA 3LO3A 1WORA 2RAQA 5C24B 2IIHA 2DRBA 3I4PA 2UU9F 5L8RC 2JEFA 1S9EB 5L1LA 1EKRA 2IC3A 2FLNA 4DR3J 3MWBA 2EC0A 1FDNA 3I5CA 4OX9F 2VPZB 3W64A 3T19A 4WXWA 2LMIA 1HPZA 3DHXA 2W9CA 3CCZA 1RHKB 2CPIA 1OYDA 2PSZA 1HIYA 2HFUA 2Z2MA 4TYBA 8RUCA 1FKOA 1Z1ZA 2CQ4A 3LGNA 3N9UC 5BXIA 3K58A 1Q82T 2VDIA 3KJQB 1K0VA 3N4WA 1YIJS 3DMJA 1RT6B 3PZPA 4J9NA 2YNFB 4DL0C 1IJEB 1NK7A 3BDEA 1MNEA 2ZOGA 3HHLB 3RAQA 3JS9A 4I2QA 4HR2A 2D74B 3H25A 2G4BA 1K8AT 3TJ8A 1OSDA 1RAAB 3H2UB 3U27A 4YP3A 1VQ4S 2YWWA 2CJAA 3HVWA 3H5SA 4RW8A 1X5TA 1RTHB 2CG8A 1WF0A 2HRUA 2L48A 2XI3A 3MEGB 4USMA 4DV4F 4ECYA 3RBEA 1U49A 4EO8A 4CCHA 1IUJA 4C3LA 3W3SA 4RNOA 2Y1LB 4RNHA 3BJYA 4K4TA 3K5OA 1QAIA 3Q2TC 4KV8A 3KK1A 1TL5A 2HKEA 1WF2A 2D9OA 2DNZA 1YJRA 5G0RA 3PW5A 2BKOA 3GE9A 2OJ3A 3DOLB 2GMLA 1M5PC 4ECRA 1I51B 4B9LA 4OHYA 5HJYA 1X60A 2H1YA 4NCBA 3SCIE 4B9TA 3R5GA 2FQQB 4ZVTB 1N34F 1TMJA 3MPDA 3C6TB 1IKYA 3R9LA 3KK2A 3I32A 1K73T 3MMAA 1WKJA 3CNQP 3SQGA 1VQ7S 2OGUA 5DZ6A 2HVDA 3RJMB 3KHRA 1F5CA 2J7KA 3ZXWA 2FD2A 1HBNA 4BCAA 3D1QA 3N28A 1SJ1A 4KB7A 5F41A 4JI3F 2I8EA 5C2GA 4H4KC 5I3QA 5C24A 3J80U 1YJ9S 1D9AA 2LXUA 1TELA 3IAS9 1U24A 4PPDA 5CYMA 4ZP6A 2CPZA 4LF8F 2FIUA 2J8SA 3TO8A 3TRGA 4OZ2A 1UPPA 4F4YA 4DFKA 3IWXA 1U2CA 2F1FA 2DH8A 3WZ0A 2ACYA 1TK0A 3LALA 2W8KA 4NXNJ 2CPJA 1FEEA 1G7CB 1NDCA 3BYRA 4WJBA 2ZJRQ 4ATNA 1ITPA 3AD7C 2Q6BA 1TAQA 1FCAA 4NASA 2L08A 1TTHB 2DISA 3BR9A 3C16A 4ZVUB 1V5IB 1J5EF 2DJWA 3HT0A 4A46A 4RU9A 4DV7F 5H9FJ 2BJ8A 1C0TA 3FNNA 4J37A 4FPIA 3PIOQ 2O66A 1N5QA 1H2UX 3QAEA 5B09A 1FX4A 2IRXA 2VIHA 4F2RA 4W90B 2DH7A 2BQ3A 2YBVA 3ETMA 2GIFA 3EX7B 4W98A 3VR1A 5JUMA 5GAHI 4PKDB 3QATA 3BO3A 3PYEA 2KM8B 3DXSX 4OI4A 3US5A 3G9CA 1UEVA 1YBTA 2D7SA 3K8WA 5ETOA 3TJ9A 1HARA 4Y2AA 4DU7A 1SBRA 2OH2A 4JI6J 3I87A 3LP0A 2HBYB 4KV8B 4IOBA 2OELA 4OFZA 2IBKA 3GIRA 3V4IA 4NA2A 1HBUB 1S1TA 2XMUA 4ZJOA 3W5YA 4CO3A 1DQ8A 2Z30B 2C2KB 1MMLA 2LA6A 3EGNA 3JTOA 3VZHA 3B78A 2H5IB 3FC9A 3I56S 4P71A 2FUG9 4G1PA 1RWXB 2MQOA 2XS7A 3QRRA 4N8NA 3VTIA 1XNQJ 3DLEA 3TQEA 3GJQB 5D78A 4OX6A 3MAQA 1FD8A 1YX2A 3N5FA 4HTIA 1IBLJ 3FEYB 3M2RA 2AZ3A 5ETMA 1SKSA 3H8YA 5DLGA 2HK3A 3T6BA 2B0GA 4ICLA 4D3GA 2HPUA 3GJSB 5BYQA 3C8YA 1RI7A 5FDLB 3BKFA 2I5JA 1UJ5A 5A8RB 3M1VA 2N82B 1S59A 3HSDA 3DLBA 1VBYA 4FXWA 4LRFA 1S6OA 2G0JA 4WIIA 3K8VA 1C4AA 4NZ6A 3C3LA 1XK8A 1GXLA 2HRTA 3NXZA 1LV5A 3KLFB 4DQIA 1WUUA 1FK9B 2F4FA 4UY85 4TQRA 3OV7A 2UVWA 4B9UA 5LL6d 1G2EA 2DGXA 5E3PA 2CFXA 1UETA 2R7WA 3PX0A 3M2UA 4EBDA 1U26A 4ID5A 4TKTA 3P8BB 5B0GA 3JSBA 4I2PA 4EO6A 2UVRA 1SL0A 1JXVA 5T14A 1UAWA 1VLYA 1X4FA 4LRDA 1H3DA 2ZBRA 2V6AA 3BKUA 3MEEB 4NLOA 1S9EA 4NEYA 2R7QA 2JFKA 3M8PB 1X5SA 4EYHB 4NRTA 3UD5A 4ANDA 2CVIA 1YG0A 3E2EA 4DWIA 1UWBA 2F7VA 1SJQA 2W2PP 3PFOA 3NG8A 1AUSL 4WYWA 3GV7B 5DM7Q 1WEYA 3DM2B 1PYTA 1RT5A 1N5TA 1LW2B 2A3JA 1FTRA 4P9SA 4DXLA 3ZTQA 5LMNJ 1WHXA 1FRIA 3UI3A 4F25A 4DLGA 3PW0A 2JEJA 3TJAA 4C4WA 4DUZJ 1IVZA 2DR6A 1B70B 4OI3A 1M5SA 2B4OA 2POKA 3MECB 4ZVSB 3J7YI 1E6VA 1IR0A 1N8RT 4NXMJ 1K1QA 2WRMA 3HHDA 3MM5A 1FFSB 3QLHB 2V2KA 2WSFC 3G8TA 4X4SA 2GFFA 2XY7A 5HATA 1YRUA 3P4UB 4USJC 1XR5A 2XSFA 3KUHA 1B64A 3M6WA 4ZOSA 5D3GA 1JLAA 2GAGC 2QZ8A 5KT5A 3NOCA 2QMWA 3ULHA 4DCJB 2E9ZA 2B7CB 1JKHA 2XULA 3CJRA 1UZHA 1Y10A 2OKQA 3CJ2A 3KTQA 3MFIA 1KFSA 3VV2B 4GC7A 5EWFA 4LF4F 5GMEA 4EK2A 1NDPA 4F4WA 3UR3C 2LQ9A 3W63A 1DLOA 1Q95G 3PTWA 4DQSA 4Y34A 1WC4A 1QSLA 2GMJA 1DTTB 1HKAA 3NY0A 2BUNA 2HS3A 4J9UE 5A8WB 4DL5A 2DEIA 4DFJA 1WJ9A 2G13A 3A8JA 3R97A 3BSCA 4DLEA 4ZJLA 3QT7A 3BO2A 3P6YC 2J8AA 3IC1A 2WBMA 2IY5B 2IA6A 3W2VA 2RVJA 3HVRA 3D1HA 3TAMB 1Q81T 3K5MA 2LA4A 1SQFA 1D8YA 1BE4A 2EW9A 3DLJA 4MIBA 1QJHA 2CPXA 1SH0A 2RJZA 4KO0B 1T02A 3MM8B 2EBEA 1RCOB 4KGKA 4RWWA 4XTTA 5T7LA 3OUYB 3PW2A 1VCTA 3C15B 2XI2A 4KIAA 2OPPA 5KFUA 2DO4A 3BGRA 4Y2KA 1TKDA 2AJQA 1VBKA 3FMBA 2PGCA 2X3DA 4KQZA 1WDTA 1NKEA 2X51A 2YKAA 4IOCQ 1VRQC 1SL1A 1S1UB 2IMOA 3MEKA 3HP6A 3B54A 2FZGB 1GQEA 3NS5A 4MH8A 4RL1A 5LJ3Y 2N7CA 4AQYJ 2AIRB 2DNLA 3W8PA 2RB7A 4KHPF 3EXCX 5H9EK 3PYGA 1TL3A 2HSEB 1GX5A 1CJUB 3OT9A 4DSFA 3OFHA 2CQHA 1S1XB 3UNGC 1Y9OA 1HBMB 3ZZ0A 2C2NA 5CCLA 3TI0A 3QJPA 3PJWA 4J9KA 1FD2A 5DQIA 2LQBA 2KFZA 1EETA 1V3RA 4IFYB 3OR2A 3T5JA 1M5VC 4W92B 3RBZA 2WTFA 1BUXA 2QLBB 4YDXA 4ES1A 3K5NA 3HD1A 2LP4A 1S7IA 2HQIA 3HFVA 3C14B 3MZIA 5KFAA 1IQZA 5ETLA 4B3MF 5D0HA 4C8ZA 2PDAA 3IG1B 4FVMA 4MIWA 3RUBL 1DTQB 2RDIA 1VC0A 1D0EA 4B3OB 2NREA 3HM9A 4OZ3A 2CWKA 1JJCB 3R8YA 4EWTA 3DGVA 4J9VA 3BGLA 3R5CA 1MWYA 1SL2A 2AGPA 3IO1A 2W2NP 1LFWA 3M4XA 4OZNA 1Q5VA 4OJ1A 4QJVA 5K14B 1N32J 4LSZB 2W8LA 4LBIA 1KOOA 2APOA 3FRYA 4Y2IA 2W25A 1PYOB 3TVZA 1H7XA 2PEBA 3MUVP 2C2DA 4WU2A 4FXDA 4X62F 3PR5B 1FXLA 2HHXA 3RRGA 1CPZA 1UP1A 1FRJA 3OXLA 4AXJA 4XDCA 1FO1A 2HHVA 1AFJA 3MHYA 5KFFA 2HK2A 3ENVA 2IPOB 3ZZRA 4U6PA 4DR4F 2VG5A 4ZK7M 5KG5A 3R7NB 1YRXA 4HT7A 4DR1J 4CLFA 3ZNUA 2GNKA 2GQ2A 2JOQA 4C98A 4YY3J 5DJBA 2GVZB 3TANA 2R7TA 5AXKA 3NKYA 3UE2A 1X9SA 1S0MA 4OZLA 4K4YA 2ZHAA 2DNKA 3NNHA 2LYVA 1Z4UA 3CCLS 4OYIA 1TVRA 4C8LA 4QYRA 1IKVB 1R27B 1WEXA 2CVEA 2C1EB 4YN3B 4ZCIA 1N0UA 3BQ1A 3TQ1A 4ELVA 3VAHA 2OPPB 2CJXB 2BANA 1VC5A 4WWSA 3R5BA 3TR5A 3IRXA 1YJUA 1VBXA 1BMQB 2KT3A 1SUQB 3ENQA 2QLWA 1VQYA 2ZBIA 3UWTA 4DPYA 4K4ZA 3OSNA 3KXDA 3PYFA 4DR5F 4ED6A 1NJWA 2GJFA 4K50A 3VZIA 2E5HA 1T03B 4LF7J 3PKYA 1T03A 4PABA 2UV8G 2C2OB 2VONA 3DLKA 4K2JA 4ZP9A 2Q6CA 2VF3A 3K89A 2KB2A 3NAHA 4ENOA 2VQEJ 3QWPA 3EPGA 1SQGA 3VGSA 3RB4A 3S7RA 1FDDA 2BEFA 1UVNA 4QPTA 2Q66A 1SIWB 3R5JB 3V5RA 2C42A 2HFVA 2VB6A 1YQHA 2AYBA 4JI7J 3OL8A 3E01A 3NGUA 4PCQA 4ANCA 4RW9B 4NOHA 4IQMA 2CQ3A 3HVTA 5CD4A 1TUGB 3W62A 3NL0A 1WC3A 2ZBQA 3A12A 3LWLA 4JI3J 3MM6A 3KMSA 4WPAA 3KOAA 1VISA 2E5IA 5G0RB 4K4SA 4DV4J 1FFWB 2FC9A 2RUSA 1HHQA 2Z0GA 4G6VB 1NK6A 1TFWA 4ZVPB 3SBMA 1KC8T 2WVFA 4X2BA 1S6PB 3ET6A 4B3RJ 4FNHA 4KHPJ 4FVCA 1YJWS 5KFPA 3Q24A 3OFFA 1ZETA 1ZA2B 2PFFB 2CUYA 3NAIA 4HI2A 4C6AA 3DHWC 2FLLA 4NA1A 2Y1IA 3T9ZA 2MZQA 4ZN3A 5DGBA 4A8FA 4FBTA 1UFWA 2A6MA 2XS2A 4DV7J 3CCWA 3MEDA 4IYQA 1IJFB 3D5MA 4LFAJ 4N76A 2YNGB 1M1KT 4ITSA 1KTQA 4ECQA 4I6YA 2V34A 4ELTA 2LQ5A 4WFNQ 3EGVA 2W4CA 5E3QA 4ELUA 2UUCF 2KFNA 2VC0A 5IM0A 2R7VA 1GAOA 2X3GA 2ZKTA 4OYZA 1HHSA 5GVQA 1VQSA 2ADCA 2EVZA 3CWJA 4LF9J 1TKZA 2CQCA 2QA2A 2B9WA 1JIHA 2FY8A 1TP7A 5L1IA 3RBXA 4LF8J 2UUCJ 1U47A 3DMJB 3HO1A 5F9LA 4M5IA 2MLYA 2CNOB 1HD1A 1XNRF 1HBOA 4NLWA 3MUTP 1X4EA 2DXDA 3X3UA 1BQNA 2GHVC 4DUTA 2AKWB 3DRSA 3KKFA 4OJGA 1JLFA 5HN0A 2L9NA 5HSPA 1V6HA 2MYFA 1DURA 1H6KX 2D3UA 2B7BB 2QT7A 4F3QA 5LMUJ 4OLOA 3RYLA 1FJCA 4H4MA 3BGOP 4PXDA 1FWKA 2CPDA 2OSQA 4DU8A 3D2WA 4GC6A 1QVGR 5I3UB 5KFCA 1X5OA 4O3NA 2NZ4A 4HH1A 4RW9A 2BZ2A 3VHQA 4UQTA 4LF2A 1S57A 1S9GA 4L74A 1RT3B 5CHCB 5HI7A 1T11A 4CO0A 5KOXA 4DPTA 3I0RA 3QIPA 3ILJA 4ZVGA 3RW7A 1SIZA 4DPXA 5KFOA 3Q8RB 1WEZA 2DNOA 2DNMA 4FN5A 2Y1JA 1IBLF 1UVLA 2UUAF 4NYPA 4EZ9A 4LT6A 1X31C 3HPOA 4URQU 2QA4G 1PSDA 5HMZA 3UDCA 4FYDA 3ITHA 3KLHA 3IS9B 4PQAA 1N54B 5HMWA 2QJ3A 3O1LA 5CYJA 4BS2A 3RW6A 4KGMA 3OXGA 4NA3A 3ICLA 2HNYA 4CRJA 1D3WA 4GKJF 1XWLA 1S49A 5CYQA 3M30A 2FHOB 1QLNA 4ZPCA 1CJVB 2YNIA 2M2BA 4I7FA 1RA7A 2ASYA 3HHEA 3R5AA 2E1RA 4F50A 4NMXA 4RKUC 3KUEA 1O8BA 3U02A 2QA1A 4LF1A 4P52A 3TA2A 4PRFA 1KP6A 2FZKB 2V4QA 3U7JA 2KL8A 3NMAA 4YR0A 4X66J 2RUGA 4JI5F 3LQVA 4F4XA 2EEYA 2YX7A 3MR2A 1YK9A 1LWCA 3NBPA 3WQPA 2B6AA 4A47A 1NHKL 1WHWA 3EDQB 4LUBA 5CABA 1TFYA 4HVZA 3HHNB 4R5PB 5IQ6A 5LJ5Y 1JJ2R 4YB7A 5LOQA 1VRTA 1R43A 1T9TA 4CIOA 4M94A 2WB1D 1HWJA 5IQQA 3VQTA 3JAMY 3H4BA 1L3VA 1HI0P 1BWEA 3AQPA 1N33J 2QL9B 1NDLA 3RRKA 5HMYA 1R8AA 1F2HA 2XYPB 3BV8A 3TEHB 5IZHA 2JEGA 3H5UA 1Y11A 2R4FA 4X66F 4JI5J 2YNFA 3BPDA 2YKNB 4KR0B 4U8VA 5EX3A 2HVIA 2G9OA 2VFSA 2QFJA 4KGVB 4RW7B 4KFBA 4FXVA 3R27A 1R0CB 3C6UA 3D6TB 1VQOS 1RTJA 3TAPA 1RCXB 3CGIA 4LRCA 5HROB 3AY0A 3M2VA 3PACA 4R0EA 4KH1B 3PW4A 1MN9A 2LXFA 2DHGA 3E51A 4X65F 2VG6A 3NGTA 3S6EA 4MK8A 3JYTB 1J5OA 3GCXP 3LP2A 2Z57B 2OSRA 2ZH5A 4U96A 3C6UB 2XNQA 3QLHA 4Y2CA 1NKCA 1WOOA 2EG1A 1CJKA 3N6MA 2HAFA 5DS7A 1RHUB 3G82B 2GVDA 4WFBQ 3BKTA 2CIMA 2Q43A 1ZH5A 2EFGA 4OJHA 4J9LA 4FF4A 2VG6B 3CDWA 3JYTA 1XR7A 5F8IA 1AZSB 3CC2S 3GLJA 1GTHA 4QCLA 3SMZA 3J7ZT 3KK3A 1Y5IB 4ZVHA 1YZ6A 3EGWB 3NGRA 4J9PA 2CG4A 3KLIA 1WWHA 2YPZA 3SDEA 1MSWD 2HMIB 1WOPA 3QO9A 4NPOA 2VOPA 1FX2A 2MJUA 4AL6A 5D15A 3BQ0A 1W7WA 3D0IE 4DV0F 3HKZD 3ISZA 4ETZA 2XY5A 3NBPB 4AE5A 4DUYJ 1WKKA 3NEKA 2XWYA 4F4AA 1QVFR 2R9LA 5ADZA 2HIYA 2MQNA 3FVYA 3MMAB 3NRBA 3SFUA 3W9IA 4DR2J 2MKCA 1UEKA 5GAGI 4FYWB 1J27A 2Z2YB 1HNXF 2PO4A 2YKPA 4WU3A 4DL3A 1T05B 2GQQA 1CG2A 2M7SA 3PDNA 1VBZA 2YQ3A 1P8GA 3K17A 5SZTA 3MMBB 4QQBA 3QSIA 2AYEA 3KLVA 5GMKa 1LQ9A 3THPA 3HJVA 3IBWA 1K1SA 5K8OA 4USKA 3W65A 1O6XA 2KO1A 4AQYF 4DI6A 2BM0A 4CLSA 3W5ZA 3TNVA 5F3ZA 4Y0FA 3LPYA 2B4PA 4EGLA 1VMBA 3R1HA 4DR6J 3KLEB 4RZRA 4BC9A 3BO4A 2UUBJ 2M52A 1GMWA 2R8HA 4LF9F 4X4UA 3NOGA 4FKXA 3L7PA 1FJGJ 1FFGB 3DDIA 4NLRA 4OHZA 2FLPA 2QGFB 2QIFA 1RWOB 3G87A 2HHHF 2WOMA 1JJHA 5KT2A 4DQRA 3M7VA 1NSPA 5D0RA 4AL7A 1KONA 3SSRA 3AJDA 4JP8A 4ZCKA 3OLBA 1X0PA 3L9ZA 5DLFA 3PVXA 2E5LF 5KFGA 4N8OA 1T3NA 2J6UA 3OFEA 4Y00A 1ZAWA 3JQKA 1IQTA 5HVGA 4BC7A 1P9YA 5DRKA 1UFLA 3GIKA 3V6DA 3T1HJ 2BJ9A 2XQCA 1Q16B 3WX8A 1S1WB 2B5JA 4QYZJ 2XHCA 1KQGB 1FJ7A 3W9JA 1G3OA 3CVKA 3HVAA 3R2CJ 4R0JA 4NCGA 3UW1A 4CLWA 2AEMA 5J1EB 2VKRA 4MAKA 2WHOA 4N47A 3ETOA 1NPKA 3T1AA 3HHLD 3TA0A 1Q1KA 3KK1B 1VK3A 1PILA 3N01A 1LXNA 4Q2LA 4JI2J 1K0TA 3MUMP 1IBMF 2ZE2B 4YR3A 2CQDA 1JLQB 3R5DA 1UWAA 2H51B 3W2VB 1ZM2A 2EFPA 4WZMA 1W25A 2HBRB 4WCEQ 1T05A 2DIUA 1YJTA 5K5MA 4P2MA 1Q78A 5LSOA 2GAHC 2R7UA 1PJ5A 1NJZA 3P5BP 2KG1A 1ZA1B 4DN0A 1S4FA 1SCJB 3CJSA 3H0PA 1GMWD 4ID5B 4ZPVR 1KHWA 1RABB 3CDBA 1IBMJ 1N36F 3MAAB 1URNA 4EI2A 3EZUA 3QSYB 4YB6A 2Y0SD 4CM2A 2HHTA 3EICA 5I42A 1QE1A 2D1CA 1WI6A 1KEKA 3ZFVA 1XMQJ 1P1LA 2A2DA 2FDNA 2BE2A 2VASA 2VQEF 3TZZA 3CCMS 1YHQS 3RR8A 4V19X 1N6QB 1IKVA 4DR4J 3CJTA 4LSLA 1HPZB 2E1AA 4ZMMA 5KT6A 3WC2A 2CNNB 1TMMA 2IRYA 5ETPA 4ZS6A 2DYAA 2IHR1 3SCLE 3UFCX 1L3UA 2OPSA 1TL7A 2B9EA 4ED0A 4C3MA 4WIQA 3BGFA 5DDRC 1UVJA 4QU7A 3FDSA 5KFLA 4ERDA 2BOPA 1JXLA 3R3TA 1SJRA 2DHSA 2EFNA 3EUNA 1PJ7A 2U1AA 3I4HX 5KFJA 4DQPA 1EJ7L 1VOMA 4I1TA 2RU3A 1MMDA 1QY7A 1RKIA 2BRLA 2NXJA 3FEZA 4M63A 3TVKA 1KLNA 4JI7F 2JC0A 3LP1B 4WZQA 2CJQA 1HMVB 2XG8A 4O0IA 2HNDB 1KNZA 4WE1B 2HVHA 2LLZA 4DX8H 4JV5J 2IJNA 4DUZF 4KRWA 3G4SS 3LGHA 4X65J 3GMGA 2K8GA 1H2TZ 2RMLA 3OR2B 3QGHA 1AXQA 4CNZA 5F8LA 2FJVA 4B3RF 3C66A 1EX8A 4PG8A 1NB2A 2HLTA 5FJ4A 2M0GB 3KHLA 4NLDA 2MTLA 3NP5A 1LKZA 1WOSA 2XSJA 1FE4A 3EPIA 4OI6A 3IWLA 2XMKA 2KJVA 2DTJA 2B56A 1W2BR 3E3XA 4OYAA 3IBCB 4A4JA 2DHAA 1EB0A 2XMTA 1B7YB 3MMCA 5DG9A 5B0FA 1AT1B 2PA3A 4HDGA 2BYCA 3ZZTA 2XB2D 2J76E 4CH1A 3OBIA 4A8WA 4K0KJ 2V2VA 4P73A 1U1LA 1ELOA 4DL7A 3QJJA 4EZ6A 3QJLA 2WVDA 2H4WB 3QT5A 3J7A1 2MKIA 4C8NA 2QL7B 2MKYA 1FNMA 3AAWB 1VJQA 1JLBB 3JXOA 2HZVA 5D4LA 4M1KA 4OYOA 2NXNA 2XMJA 4WP3A 2KI2A 2XMVA 1FDBA 1TL7B 2G2OA 2CDRB 2ZWOA 2V4RA 4NYZA 5GAEI 5KTQA 1HNWJ 4DSIA 3FCHA 4LSLB 2P9EA 4FF3A 2ZNYA 4PWUA 4DG1A 3G6VA 2HFZA 2O5DA 3MR3A 3UO0A 1ZAVA 1FKAF 4MTPA 2LFVA 2RIJA 2ASJA 1X4DA 2YPYA 2VQFJ 1G1XA 3HZGA 2P5VA 7FDRA 4ECUA 1RHMB 3PHEA 2LDIA 3V81B 1UA1A 4N77A 4WP9A 3PX6A 1RTHA 2PC6A 1R8PA 3I9V9 3L7OA 3KG4A 2W4DA 2JZ5A 4LIWA 4WFXA 5ETNA 4DX5A 5IT0A 3MPVA 4CO1A 3BDPA 1XNRJ 1GT8A 3I96A 1DQAA 1Q5YA 3RR7A 1XTZA 1RYRA 3BBBA 4CDIA 3MXHP 2EPIA 2OUGA 3A3OB 3HT3A 2GCFA 3T41A 2JWNA 1RBAA 3MEGA 1IWGA 3Q0AA 4HH0A 4RUAA 2R8KA 4B3SF 5DETA 2QL5B 1RWNB 3AQOA 2W7AA 4ZPAA 1F6TA 1LWXA 3DU5A 1HR0F 4Q8EA 3FCVA 3GJRB 4ILRA 3V6DB 4LFBF 1AROP 1VFJA 4ECSA 4ZCMA 2Z2ZA 4A8XA 4QWCA 1RWKB 4C0HA 4K7QA 2BABA 2BRKA 3TAQA 4LBPA 5D6GA 3GU0A 2BJ7A 3RBDA 1WHYA 4NCGB 1VQNS 1X4AA 3LGMA 5C25B 4OYPA 5GMDA 1NCLA 2JSXA 5HJXA 5HQ8A 1ACMB 3W2WA 1QUPA 3KWMA 1C0UA 5AXNA 4MKVA 3OVSA 1GNKA 4CT8A 2GA7A 4B3TJ 4FYVB 2BA9A 1HL6A 3OVBA 1WSRA 3UDLA 2DVIA 3ONQA 2E1PA 1NJXA 1HQEA 3AOAA 2OFHX 2DGSA 2IAJA 4OMFG 4B17A 1FVQA 1Y5NB 1SH3A 1CQNA 1R7IA 3MEDB 1BGXT 1HNIB 1JLCB 5CH7B 3PKMA 3GZ7A 1WG5A 2ZHOA 3BBFA 2BE2B 2YNHA 3AJ2A 2BBEA 4DV5J 1KQSR 1MW7A 4GKKF 2DGTA 5KFIA 2P6TA 3PY8A 1FWPA 2MQLA 3VALA 5KFKA 4MKYA 2AEJA 1QUVA 2ZNZA 3OPKA 1VIOA 2I0XA 2BKPA 3I0SA 1S6QA 4RO0A 4CT9A 3UN2A 2VHGA 4ILLA 3SV4A 2BJDA 1XMOF 4M5MA 1HNVB 1Q8BA 3WHIA 4ZN1A 4O4GA 2YKNA 3PEHA 5KFEA 3TARA 2RDJA 2ZVSA 1JNZB 1SXLA 3I6PA 1L3KA 4NMLA 3KLEA 1DZ5A 1RTIA 4ZPWR 4CO5A 1IM4A 1YVFA 3PRBA 3RB3A 3HHLA 3ZZUA 3PX4A 5B0AA 3HULA 3FBEA 4P2SA 4ECWA 3DLLQ 4ZPDA 4WTOB 3KMQA 2N3LA 2KT2A 1H72C 1Z2ZA 3MM9A 1IBKF 2C2EA 1D9DA 3FBBA 4IO9Q 4Q7AA 3CJQA 1A0OB 1KWMA 4G1IA 3PM9A 3P45B 5CD4H 3V6JA 1ZTWA 1XMOJ 2QRRA 2C28A 2UVUA 3Q8QB 3EGZA 3QT8A 3SYZA 2F8EX 2KVIA 2BJEA 1RAHB 3VGUA 4B3MJ 3AOCA 4PG5A 5F8HA 3MMCB 4B02A 2ROEA 4S0MA 4JOUA 3JB9k 2BOAA 1I94F 2HMIA 4XDDA 1JLEB 3NLCA 3AXMA 2ADBA 1CVJA 3AODA 1PAUB 2BE9B 3EJMA 3A3NB 3QO9B 1YJNS 3QQCD 4LRBA 4Q0BB 3KJFB 4L73A 5CYQB 3R7BB 4HHHA 4FP9A 4IR9A 4MKAA 4KPYA 2HQGA 3FMWA 3K59A 1FNXH 2QC3A 4TQSA 5JVGQ 1NK5A 1OIAA 1JLCA 3M8RA 4XPEA 2Z2LA 3HCXA 2DNGA 2YY3A 4I56A 4ZCLA 4J9SA 2KHDA 3IXQA 2JLEA 5J2PA 3HJFA 3RAXA 3G2XA 3R6GB 4WF9Q 3HLUA 4CM0A 2V68A 2FTRA 4FDFA 2JX2A 3A8EA 1AW0A 1IXKA 3N6LA 3UQSA 2V5HG 2CRLA 5MAOA 4DV0J 5K8MA 1TK5A 3F44A 4NLQA 4Y2MA 1VR6A 5KFZA 2YWEA 3M9NB 3Q8YA 4JI6F 1FA0A 2MJNA 1HNWF 2AJ0A 4DX7A 3C16B 4UZBA 4IH6A 2KTQA 3QBCA 3N0VA 4LRAA 5E5NA 4CZCA 2MKKA 2U2FA 5HANA 3BGRB 1M5HA 2AWZA 1E6YB 1QAXA 2HZCA 2HWIA 3PO4A 4NYOA 4JI4J 1T7PA 1VI7A 2ZC4A 1TKXA 1CEZA 3VGVA 2OD4A 5J2NA 1IR2A 3KNAA 3V81A 2O3DA 4RLEA 1TKTB 2XYGB 4TYAA 2KZMA 2MEWA 3H2VE 3H5XA 3TYTA 2M9KA 4DF4A 3MGJA 4IDKB 1IN0A 2KH9A 2RE1A 2KHCA 3MDFA 2DPJA 2HNZB 2BR0A 1S1VB 2XLKA 1RT4A 2FLOA 5D0GA 1TKXB 4OQJA 1DY3A 4NI2A 2YTCA 4QIVA 1B7FA 1S79A 2D9PA 2NS1B 4DMZA 1F9EB 2GC8A 3DOMA 4OLPA 4ED4A 3MURP 4XPCA 2BW7A 4I2QB 4MK7A 2CJBA 2KN4A 3DRRB 5KFNA 1KVKA 4KHMA 5MLCV 2R8JA 2PI4A 3MM7B 1YI2S 4ILMA 4P7VA 1XBWA 3V4MA 3B4DA 2IDLA 2AF6A 3SSQA 3FRZA 2ZKUA 4G1QB 4B9MA 3C2PA 4ZIWA 1M1HA 1OY9A 1DTQA 3I31A 4B3OA 4DX6A 4ZIVA 3D67A 3AFGA 5A76A 4AL5A 4YHHF 2D3ZA 1JWWA 3IS9A 2H3EB 4USWA 3D4JA 4OI1A 3KK3B 2YKOA 3UD3P 3DRPB 5F8MA 2CQGA 1FXRA 2ASDA 4PZVA 2E7VA 2E1MC 1NNDA 4K5SA 4M5HA 4PYAA 4ZKAA 1XC9A 1VQKS 1PBUA 4BWJA 2UXBJ 4CWBA 2RDDA 2CWXA 3AD8C 2E7WA 4USIA 4A8MP 3V6HA 1OSCA 3W2WB 2AV5A 1RWVB 1XN9A 2OEMA 4AFFA 4C11A 3MD1A 4L76A 2HHSA 1QAJA 1WNEA 2XZTB 2LEAA 5KFMA 4DF8A 3CDUA 1HW8A 2J9DA 3MMJA 2GQCA 3MPUB 4X4OA 4DV5F 4GKKJ 2PN6A 3KDNA 2VODA 4Z2XA 5CAAA 4M5GA 2K3KA 2WVBA 1VQMS 1D09B 1XQIA 4JUZA 4NEZA 1DRZA 2J0WA 1Y0HA 4CLYA 3RAMA 2A1BA 2MKSA 3Q22A 2GV1A 5AJ3F 3D28A 3HMJG 4OYBA 3Q8PB 1FEHA 3SCKE 5T7LB 3R1LA 2ZD1A 5A8KB 4RR5A 5KFQA 4DR7J 4DV3F 1TKZB 1WG1A 1EZZB 5LM7E 5IM0B 1OYEA 2V2QA 2O01C 2WSEC 3A13A 1ZM3A 2BW2A 4UUXA 2K2PA 1ZAXA 1RTIB 2H9ZA 4URGA 5BR8J 3HXMA 4FF2A 1NAQA 4KHRA 2RH3A 3OL7A 4TNOA 4P72A 2DNHA 1YJVA 5CZXA 3BN4A 3LWMA 3K5PA 4M5NA 3OTBA 4K2XA 4CQ1A 5EGYA 2MLZA 1J2VA 1Q53A 5F0WA 5KG6A 2FB0A 4IO1A 1FF2A 1PIEA 3PXGa 1NK9A 2XNRA 3LP1A 3SSSA 5HROA 1O51A 2VPXB 1LW0A 3GSDA 2B51A 2CPHA 2V9KA 2AEFA 4A8OA 4G1QA 4DZDA 1CULA 1VQ8S 2BE7D 4JI0J 2LQJA 3OTEA 1U1MA 3TZWA 2VBXA 4DV3J 4YUDA 4Z37A 3CDEA 3PO5A 2HQFA 1HW9A 3MM5B 4ZLNA 1IBKJ 2B3TB 1LW0B 2HRYA 1DHMA 2MMYA 2Q1LA 3I0RB 4F8RA 3THVA 4Q8FA 1BC6A 2B43A 2OMLA 1WTBA 4ZVRB 1NK4A 2RKIA 2WAQD 2OMOA 4LVOP 3D1OA 4QBUA 2CYYA 4J5OA 4QYZK 1Q7LB 4RUHA 3DI6B 5KFDA 3EZ5A 3EE3A 4RW6B 4A8KA 4L75A 3M32B 1WKLA 1JNRB 1GXUA 2F3JA 3H7HB 5B0CA 4QWEA 3Q8SB 4JV2A 5HLFA 1UA0A 2DH9A 3RGIA 2CJYB 2UXCF 2QE5A 1XIQA 2AYMA 3J81Y 3GP9A 1KS2A 2QMUB 3IBFB 1H73A 1W2IA 1WSVA 4M5DA 2M4MA 3BBCA 2HWHA 5L1JA 3BN7A 1R3NA 3SIPB 2FGCA 2NXUA 3BREA 5AXMA 2AMCB 2MGZA 1UW9A 3KG0A 2PT0A 3BEGB 2Y9HA 2YWKA 2YWHA 1RACB 2P6SA 3MCMA 2FVSA 3VAMA 1RU2A 1TQLA 3MEEA 1UPMB 4NLVA 4O3OA 4QIGA 3P5TL 1RT2B 4EUVA 2CJ9A 4I2PB 2DNPA 2FJAB 1TL4A 1HYSB 3O2IA 4B3SJ 1UKUA 3CUNA 3BSNA 8AT1B 4CTAA 4AXIA 4PXCA 2E9RX 3RB6A 1RT4B 2RNEA 1A7GE 2JL9A 2GJIA 4NX9A 2RS2A 2KU7A 1I5OB 2ZEJA 4FKYA 4HACA 1S0NA 2W9BA 4DS4A 3EXYA 4W4MA 3H59A 2F4VF 4Y65A 4JI2F 3D3BJ 4LVNP 2AD9A 2XEXA 1NKBA 5A2QY 4IFVA 1HFEL 4O44B 2HHHJ 2IVYA 4O4RA 3C46A 2GO8A 4DSJA 4X64F 5DDOC 1FRHA 4NLYA 1JLFB 1U48A 5M2RA 4ZPBA 3TEGA 2ATLA 3HK2A 3KUGA 3F73A 3T6JA 2EKYA 5L46A 3CCVS 3T3FA 4P2FA 3OSPA 2DHHA 2FVCA 1RBLA 2ZUGA 4OX8A 1N36J 3U1NA 2ZVIA 3EZOA 5HBMA 3TWZA 1RA6A 5THWA 2M8HA 3O8WA 3H5YA 1RJJA 1GFWB 1KFDA 5AE2A 4J9RA 3MOJB 5SUHA 1HQUA 4TY9A 3OLAA 2IJFA 3GPAA 4DR3F 1U25A 2ROGA 2XTJP 4GVBA 2NPIA 3CJ0A 4J9QA 5HQLA 2DPIA 4OI0A 2B4UA 1M1GA 3FSXA 2QSWA 2LKZA 2YQ1A 4I7FB 1KHVA 3GR0A 1JKHB 1R6YA 4PAAA 1AB8A 1S7HA 3RRHA 3KNGA 4A8YA 1BQXA 2XMMA 5L1KA 3S1TA 1FTCA 1WG4A 1KTVA 2W2QP 2WW4A 3ZZPA 4Q0BA 4LSNB 3VQSA 3BYPA 3U1MA 3CCTA 2HS0A 9ATCB 3ELHA 2MZTA 1N4LA 5KFWA 1BQMA 4RBUA 1PBAA 4NRUA 1U6FA 2PIIA 4L72B 2HW3A 3LF0A 1KQFB 1Y4ZB 4NLSA 4GVLA 2KVQE 2YNHB 4QU6A 3HD2A 1QAYA 2A18A 1CC7A 4N41A 3CD6S 2PA8D 3LH2S 2AQ4A 1HYSA 3VWSA 1XNQF 2CADA 4P7TA 3CJ4A 3QFWA 5EHHA 4N5SA 4RU2A 2AW0A 3IRXB 2OTLS 4M95A 5BR8F 2Q79A 3MR5A 2BDPA 5F8GA 4GKJJ 2OPRB 1CQMA 3MM8A 3VAKA 1NJYA 5AT1B 2AP6A 1OJ4A 2E44A 1WACA 2AX1A 3DN9A 3JSRA 4C48A 2KKHA 4QR1A 4RW7A 3L95X 1O5JA 1BQNB 3NCPA 4U9RA 2XLIA 5LT5A 3CF5Q 4UY8T 2MB0B 1B0PA 3HKWA 3EMTA 3M8PA 5LXRA 2MZ1A 1VRUA 1C1CB 1WI8A 1FJGF 3DCAA 1YKWA 4H4MB 1T8EA 2NXEA 2VV5A 1S97A 2FVRA 3TUPA 2FJBB 3DOMB 3HSGA 1NSKL 4MKBA 3CJKB 2HAIA 4ETXA 5KFBA 2WOMB 1C4CA 1MROA 5KFYA 4UQGA 3TUJC 3CCRS 2JNJA 4DN9A 1WELA 4Q45A 3KLGB 1ZZNA 2V0NA 2MHNA 1M5OC 5DGAA 4OX9J 2RF2A 3SCJE 3OR1A 2V67A 2V9WA 3QRQA 3ZZZA 3AB4B 4IFYA 1QD1A 4IUFA 2EKNA 2B4VA 2YWGA 3G86A 3W66A 3MD3A 1S6PA 3ET6B 1JLAB 5FLXU 1YJ7A 2UV8A 3M6UA 5L39A 1GX6A 1PO6A 3AD9C 1IR1A 2UXDJ 3D6MB 5RUBA 3JAMU 3OR1B 4DHVA 2OLWA 3JTPA 2CNLB 3GIIA 4NLGA 1FRLA 3CC4S 1REVA 3CDAA 4RW4B 2A0FB 1IBCB 1I3OB 1LWCB 2IFXA 2JLFA 3ISND 1Y3KA 3HFZB 3K2YA 4UOHA 4WK3A 2VPWB 3E8OA 4JYAJ 3GG0A 1F60B 2UXDF 2HGLA 4JI1J 2IAJB 1L3SA 5ETTA 1X4HA 2P9GA 2WW8A 2ZH6A 2WVEA 3MFHA 2VOOA 2DCLA 5DG7A 1WC5A 1UFKA 1HI1A 2RD5C 3M2UB 3DLGB 3UVJA 2IM1A 1UWBB 1I6JA 1U1QA 1DQ9A 1NM2A 2IA0A 1HWUA 3MTKA 4A8QA 5K8PA 2Z8QA 1FK9A 5CA5A 1CS4A 4F0KA 2R8IA 2HVEA 2VA2A 4ED3A 2R7RA 4IR1A 2FHJD 4IG0A 3RU0A 1YRTA 2Y3YA 3IR7B 4URSA 4BBYA 1TVRB 3M8WA 2W9BB 3PEJA 3GQCA 3OUYA 4EBCA 1U0HB 3MR6A 1C0TB 1OWXA 2GS8A 1RWMB 5HVFA 2J6SA 1YWXA 3G71S 1GMVA 2XLJA 1YDLA 1O0PA 3QFHA 3I9ZA 2W01A 5HK4A 2F9JA 4IG0B 4O44A 2NQPA 4DSKA 1CJUA 4RNNA 1NSQA 1M5KC 3TX0A 4WE1A 1KOHA 2DRAA 2EFVA 3M2VB 3ZTSA 1WC1A 1KN6A 4PG4A 1JLGB 3T1YF 1RWUA 3O6QA 3P96A 1JJ4A 4V19J 1FE0A 2LU1A 1N48A 2FHJA 2RRNA 4OHWA 2CJKA 3CT9A 2G0IA 4IG3A 3AOBA 5KG3A 3B6BA 4KT0C 3J81j 2FC8A 4R8UA 3FKBA 2HEKA 2NZCA 5J2MB 2CQPA 3BM7A 1PGZA 3KHGA 2QEXS 3D0HE 2HWTA 2C2MB 5IC6B 3ZTPA 1KDNA 2ILYA 3M6XA 2MZJA 5HL7Q 1HR0J 2B9YA 2NPFA 3LAMA 5KOWA 3DLEB 3R6LB 1GTEA 3BH6B 3IA0A 4ZP8A 3S01A 3CXCR 4I69A 3T1YJ 4PR6A 2VU5A 1SB6A 4YQWA 4IRKA 3JQMA 3JTNA 3Q83A 3K57A 2BACA 4E2FB 1R8HA 3CIZA 1CJVA 2YNIB 3MI7X 3CMES 2IRUA 1RSCA 5B0EA 1QDUB 2UVVA 4X4NA 4KTQA 1B4SA 1XMQF 4E98A 1N5YA 5KFSA 5A8WA 3UCUP 2L9WA 4F4KA 1RZMA 3IGNA 2R2RA 2AT1B 2KYXA 4DOZA 1APSA 2RSQA 2RQCA 1BLUA 4CLUA 1VK8A 2KDOA 2VDHA 2WSCC 1MU2B 4WFYA 5I42B 1B0VA 1OQ3A 1QE1B 2DGOA 3M05A 1KRPA 1VHIA 3UDEA 1KVIA 2H4YB 1SC6A 4Q2MA 2G1DA 6FD1A 3OL9A 2XWXA 5EUHA 3I82A 3OJUA 5IXUA 2EI5A 2RQ4A 3MCNA 3W8GA 2R2UA 2GX8A 2ZZTA 2MXYA 2K7KA 2CZ4A 4O23A 4USVA 5CQGA 2JRSA 2AGOA 1CC8A 4JI8F 1F3FA 1RGVA 3CCUS 4I6WA 4QR0A 5ETSA 3UR0A 1S1UA 3IAM9 2NUHA 1U0HA 2ZJQQ 2C2ZB 2XY6A 4WTYA 4ID8A 1GK8A 1HD0A 2H54B 3QGGA 3MECA 2W9CB 1RYSA 3Q86A 3LPEA 2XO7A 1U02A 1YITS 1XEZA 3G6YA 2DKOB 4C9DA 3Q89A 1URRA 1HMVA 3W60A 4DPWA 1TL1B 3LOUA 3GG1A 2Y8YA 4QIWD 2FZCB 2HHPA 3H40A 2BVZA 1TV6A 4NLXA 2VFTA 5E41A 4MYUA 2NXCA 3CMAS 1QTMA 4F02A 5KAKA 3MM9B 3DGPB 2HNDA 5DQGA 4I68A 3LANA 4F2SA 2FGOA 3BH7B 1X4GA 3PRVA 3EM1A 3GFZA 3M2RB 4NL5A 1V9OA 2XZWA 4ES3A 2W2MP 5ITHA 4Q43A 2UXCJ 4LIRA 2EK6A 3GONA 4KBIA 3G6ES 1R89A 4QIFA 5K14A 1MN7A 2KYZA 4DSLA 3VAJA 2KRRA 2AJ2A 4GVBB 3FK4A 4AYBD 5L9NA 1WF1A 2ZH4A 4X4PA 4LF6F 2C22A 1T94A 2DY9A 1S48A 5KG1A 3VF0B 1C1BB 1HNIA 5AE1A 2HQ3A 4DPOA 2PD1A 4DSEA 3PR4A 1RAGB 1LWEB 3OD2A 4WYLA 3WX4A 1HQEB 4P10A 1H0HB 2DRDA 2ZJPQ 4OI2A 5E3RA 3S8SA 2E5LJ 4G3IA 1FKPB 1UVKA 4QOTA 1RXOB 4LR8A 2W4PA 4FYXB 3QGIA 4QIEA 2Z56B 5C2CA 3IR5B 3PFEA 2DY1A 2DGVA 1RHJB 1Y5LB 2DXFA 2F9DA 5A2QU 4HYKA 4WBFA 4ED7A 2GIRA 4B9NA 1KVJA 3FBCA 4LFCF 2ZH7A 1FDAA 2VG7B 4I64A 1OS5A 4EU0A 3U1LA 4IKAA 4ED2A 1N5VA 4OZJA 5IT9Y 5D4PA 1IM6A 1T95A 2BX6A 2CQ2A 2NSCA 3BSAA 1B0TA 3IM9A 4K8RA 3NCRA 3DM2A 1KQKA 4A8SA 1MG7A 4CLTA 1HWLA 2JC1A 1AUDA 2M5YA 2LU2A 2M70A 3SFGA 1SUQA 1NBEB 4TXSA 2AYGA 1VDHA 2L9DA 2LCWA 1SH2A 3L3CA 2Q3PA 2J6TA 1UW4A 1L5UA 2QYCA 3UNYA 4MK9A 2YKQA 4PXEA 2C2RA 4CP5A 1J5OB 1B3TA 4Z7CA 2MDAA 4RBTA 4ECXA 1FNOA 1N52B 3FZBA 4NLTA 3CE8A 3DC2A 2OHDA 2FYXA 4DV2F 1FT8A 3G82A 1T9YA 1HA1A 5D4NA 4F67A 4TVAB 1VQ5S 4NZ7A 4NXNF 2E9TA 3L7UA 5E3AA 4HT5A 4ZITA 4O3PA 1CLFA 2DK2A 3LA0A 3ZZOA 1EQ0A 1VGYA 2RILA
chains in the Genus database with same CATH topology
1NUEA 1S5ZA 1BE4A 1NSKL 1LWXA 1F6TA 1ZS6A 1HHQA 3EE3A 1PAEX 1WKLA 3FCVA 3VGVA 3EVMA 1NDKA 1XIQA 3EICA 1PKUA 1MN9A 3GP9A 2NCKL 1VYAA 3NGTA 3BBCA 4C6AA 3FC9A 1HLWA 4KPCA 1F3FA 3ZTRA 4UOGA 1NCLA 3EVWA 2AZ1A 1BHNA 3B54A 2DYAA 3Q86A 2AZ3A 3Q89A 4UOHA 3NGRA 1S59A 1HIYA 3BBFA 2B8PA 3NGSA 5BXIA 1BUXA 4FKYA 1W7WA 1U8WA 1WKKA 3BH7B 3VGTA 3PRVA 4F4AA 4DZ6A 3EM1A 2DXDA 3JS9A 4HR2A 3DKDA 4DUTA 2CWKA 1NB2A 1EHWA 1UCNA 5C7PA 1JXVA 2HVEA 1MN7A 3VVUA 1S57A 3FCWA 4ANDA 5CAAA 2DY9A 1XQIA 4DI6A 4UOFA 3PJ9A 3VVTA 3FBEA 3GPAA 4F36A 2B8QA 3ZTQA 3ZTOA 4FKXA 1NSQA 3FBBA 4ANEA 1K44A 3ZTSA 5IOLA 2DXEA 3DDIA 3MPDA 3R9LA 3VGUA 1LEOA 2DXFA 1WKJA 4WBFA 2HURA 1NSPA 3FBCA 2HVDA 3B6BA 3FKBA 4S0MA 3ELHA 2BX6A 3ZTPA 1KDNA 3EVOA 3EJMA 3WX8A 1NLKL 3BH6B 2ZUAA 1NDCA 1NHKL 2VU5A 4O0NA 5CABA 3FBFA 4CP5A 3Q83A 4EK2A 1NDPA 3G2XA 3ENAA 3Q8UA 4ENOA 1NPKA 3VGSA 2BEFA 1B4SA 3Q8VA 1NDLA 3L7UA 3Q8YA 3NGUA 3ETMA 4ANCA 3EMTA 3BBBA 4W98A 1B99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUE A;  1S5Z A;  1BE4 A;  1NSK L;  1LWX A;  1F6T A;  1ZS6 A;  1HHQ A;  3EE3 A;  1PAE X;  1WKL A;  3FCV A;  3VGV A;  3EVM A;  1NDK A;  1XIQ A;  3EIC A;  1PKU A;  1MN9 A;  3GP9 A;  2NCK L;  1VYA A;  3NGT A;  3BBC A;  4C6A A;  3FC9 A;  1HLW A;  4KPC A;  1F3F A;  3ZTR A;  4UOG A;  1NCL A;  3EVW A;  2AZ1 A;  1BHN A;  3B54 A;  2DYA A;  3Q86 A;  2AZ3 A;  3Q89 A;  4UOH A;  3NGR A;  1S59 A;  1HIY A;  3BBF A;  2B8P A;  3NGS A;  5BXI A;  1BUX A;  4FKY A;  1W7W A;  1U8W A;  1WKK A;  3BH7 B;  3VGT A;  3PRV A;  4F4A A;  4DZ6 A;  3EM1 A;  2DXD A;  3JS9 A;  4HR2 A;  3DKD A;  4DUT A;  2CWK A;  1NB2 A;  1EHW A;  1UCN A;  5C7P A;  1JXV A;  2HVE A;  1MN7 A;  3VVU A;  1S57 A;  3FCW A;  4AND A;  5CAA A;  2DY9 A;  1XQI A;  4DI6 A;  4UOF A;  3PJ9 A;  3VVT A;  3FBE A;  3GPA A;  4F36 A;  2B8Q A;  3ZTQ A;  3ZTO A;  4FKX A;  1NSQ A;  3FBB A;  4ANE A;  1K44 A;  3ZTS A;  5IOL A;  2DXE A;  3DDI A;  3MPD A;  3R9L A;  3VGU A;  1LEO A;  2DXF A;  1WKJ A;  4WBF A;  2HUR A;  1NSP A;  3FBC A;  2HVD A;  3B6B A;  3FKB A;  4S0M A;  3ELH A;  2BX6 A;  3ZTP A;  1KDN A;  3EVO A;  3EJM A;  3WX8 A;  1NLK L;  3BH6 B;  2ZUA A;  1NDC A;  1NHK L;  2VU5 A;  4O0N A;  5CAB A;  3FBF A;  4CP5 A;  3Q83 A;  4EK2 A;  1NDP A;  3G2X A;  3ENA A;  3Q8U A;  4ENO A;  1NPK A;  3VGS A;  2BEF A;  1B4S A;  3Q8V A;  1NDL A;  3L7U A;  3Q8Y A;  3NGU A;  3ETM A;  4ANC A;  3EMT A;  3BBB A;  4W98 A;  1B99 A; 
#chains in the Genus database with same CATH topology
 3N6N A;  2MHE A;  4RW8 B;  5EN1 A;  2MQM A;  5J2Q A;  2RRA A;  3DYA A;  2DNN A;  2X7I A;  2D3O R;  1P6T A;  4H54 A;  2OD6 A;  4C7Q A;  3GWC A;  4DJB A;  2YWF A;  4B08 A;  3RTV A;  2HYI B;  2N4D A;  1OPZ A;  1IKW A;  4J91 A;  1YBU A;  1JMT A;  1NME B;  2J7W A;  2JVO A;  4EYI B;  4E0D A;  2YX1 A;  4DR7 F;  2ZOM A;  3CIM A;  4M5K A;  1NK0 A;  1DJ0 A;  4LQ3 A;  4PUO B;  2V63 A;  1VYA A;  1JLE A;  3FEX B;  3OTO J;  3NS7 B;  2LEB A;  1TR0 A;  4KPC A;  5IC4 B;  2UXB F;  3MAA A;  2MZR A;  4DR5 J;  2DIV A;  2A10 A;  4TU8 A;  2HG4 A;  2FJX A;  1FES A;  3IM8 A;  3QNW B;  2ZM6 J;  1OY6 A;  1ZOT A;  1BXN A;  2GHP A;  4HLB A;  4DEZ A;  1FVS A;  3PNI A;  4R5P A;  2UUA J;  3H98 A;  4QR2 A;  4RUC A;  2OIH A;  2F65 A;  5LSL A;  4MIA A;  2OO4 A;  1FER A;  5K20 B;  5LSR A;  4XIU A;  1RU1 A;  1RAO A;  2W9A A;  1FKO B;  1CJT A;  1UJ6 A;  1ZM9 A;  2H5E A;  1S6Q B;  2V2Z A;  1Q86 T;  2QSF A;  1S0V A;  2GMH A;  2OPR A;  1RKJ A;  3T9N A;  3DNC A;  3WIV A;  5JJB A;  2KZZ A;  1N5S A;  2EWH A;  2GGP B;  1RT2 A;  1RP5 A;  4HHJ A;  1RLD A;  3QZ8 A;  3FGV A;  1PG5 B;  2VBW A;  4X4T A;  5KG0 A;  1RHR B;  2ZM6 F;  2DNR A;  4YME A;  3JQJ A;  4N7T A;  5E7O B;  5K9F A;  4U7C A;  4AUK A;  4CTA B;  2CDQ A;  2OPQ A;  2J0S D;  2JEI A;  4JI8 J;  4C97 A;  2VBZ A;  3ENW A;  4OV6 A;  2CPY A;  3OJS A;  1PCA A;  1UCN A;  2IYG A;  2R7S A;  5IS2 A;  1Q8I A;  1RT7 B;  1Y00 A;  2P9C A;  1TZ0 A;  2KFY A;  4MT1 A;  4Y28 C;  1F3V A;  2ZBP A;  1Q4R A;  5D0E A;  1V3Z A;  4CLP A;  4LBH A;  1Q8L A;  5EWG A;  3VVU A;  5GAD U;  2ZH3 A;  4RUB A;  2OEJ A;  3VAG A;  1TUV A;  3ITH B;  2QX0 A;  3KLH B;  3JSM B;  1JX4 A;  1QSS A;  4KJI A;  1RTJ B;  4KYZ A;  5B0B A;  1CJK B;  3X1L B;  4LFA F;  3ZC4 A;  2EG2 A;  1D8Z A;  4TLQ A;  3DRX A;  2EBG A;  2CNK B;  2DR9 A;  2D3O 1;  5C25 A;  5F0U A;  3BR8 A;  1ROF A;  3RG6 A;  4DR2 F;  5I3U A;  2KRB A;  2ACM A;  2B8Q A;  2EK1 A;  3TX8 A;  5G4D A;  2MST A;  4CO4 A;  4FNI A;  4BLG A;  4QW8 A;  3OFG A;  3PIP Q;  4CLL A;  4FYY B;  4LF5 J;  1F9F A;  5H9F K;  3D6H B;  2E7X A;  2E5J A;  1XJW B;  3DI6 A;  1LEO A;  3LUY A;  2F63 A;  3MOZ A;  3BSO A;  2JH3 A;  1U6B A;  2EC2 A;  3OTC A;  1Q8K A;  4ICL B;  4PEO A;  1MMN A;  4KSE B;  1DFD A;  1REV B;  4RW4 A;  4DFP A;  1RHQ B;  3DLH A;  5AXL A;  4P2X A;  2HQD A;  5HAO A;  4U95 A;  4ZPT R;  5F8J A;  2LEC A;  2ALZ A;  1A9N B;  1LWE A;  2HNY B;  2I38 A;  4CI0 B;  1SJ3 P;  2JVR A;  2XZD B;  2LXI A;  1F5B A;  4CH0 S;  5C5J A;  1RLC L;  2J7U A;  2DGW A;  4I4B A;  4KGX B;  1VQP S;  4N56 A;  2NSB A;  1Y3J A;  2QV6 A;  5DDP C;  5H9E J;  4LF5 F;  3Q2S C;  1N34 J;  3FBF A;  7AT1 B;  4WXO A;  4ZHR B;  1U45 A;  4ZHR A;  2AGQ A;  2IM0 A;  3GYG A;  2EFO A;  4FZV A;  2R2T A;  4IH5 A;  5HP1 B;  3OQ2 A;  3NWG A;  1U1R A;  3C19 A;  4HTJ A;  4F3M A;  3AT1 B;  1VQL S;  1RAJ A;  3H42 A;  4LF4 J;  2MKJ A;  3PG9 A;  3T1H F;  2R42 A;  4B3T F;  1R0A A;  4HHU A;  3CCQ S;  1U1N A;  2CQB A;  2FJW A;  3KFW X;  1TUW A;  2WZ1 A;  1U4B A;  4IDK A;  3TOQ A;  2HBQ B;  5U47 A;  3QT6 A;  4X4V A;  2R2S A;  3CED A;  2NYH A;  2NLW A;  5KFV A;  1MRO B;  1ZS6 A;  2AHO B;  4DPU A;  4KH0 B;  1SV5 A;  2K3I A;  2BM1 A;  2J0X A;  2JFD A;  2LDY A;  2VH7 A;  1NK8 A;  3GCW P;  4HEA 9;  2X1G A;  2AJ4 A;  2HVZ A;  3L09 A;  4G65 A;  4KAI A;  1RAE B;  5H1S V;  2ZH1 A;  3NWR A;  5M2U A;  3K5L A;  3V6K A;  1HHT P;  4F04 B;  1HNX J;  1TAU A;  1F0X A;  2HLU A;  3SXL A;  3VCD A;  3OW2 R;  3T5K A;  2FPH X;  4FBU A;  4UTG A;  3DDK A;  1RT5 B;  5EX0 A;  1HLW A;  5KFT A;  1SV5 B;  4OX7 A;  2HHU A;  1EAY C;  4DL2 A;  4GO5 X;  2KJW A;  3G8Q A;  2VJU A;  1T9X A;  1BHN A;  2GVD B;  2V4J A;  2F40 A;  4UZC A;  4PXB A;  4DV1 J;  5ETR A;  2W7P A;  1UVM A;  4DCO B;  1YZ7 A;  4M5L A;  1Q7Y T;  5IT9 U;  1EKS A;  3OHA A;  2XYH B;  4QZV B;  4K5R A;  5DDQ C;  3J80 Y;  3VAF A;  3LP2 B;  1AZS A;  1PYS B;  4UF4 A;  2BJ3 A;  2OEK A;  2XC9 A;  2WVC A;  4EEY A;  1EP4 B;  3DXB A;  2J0Q D;  2JHE A;  1UJ4 A;  1F9H A;  5IT4 A;  3W7B A;  5LMU F;  3K0J A;  1IKY B;  3KK2 B;  4DV1 F;  3RZA A;  4Q44 A;  2XGP A;  2BQU A;  4RW6 A;  3AA9 A;  2IVF B;  2VBY A;  5FD1 A;  5GAD I;  1SC4 B;  2YVS A;  1CSJ A;  1P27 B;  3AH6 A;  4OZ1 A;  2PMZ D;  4C8M A;  5I4M A;  1RAF B;  2YQ0 A;  3A8I A;  4YR2 A;  1X5P A;  2MKH A;  2OI2 A;  4KC5 A;  2GIQ A;  2VUG A;  2YNG A;  3BZQ A;  2V94 A;  4UW2 A;  4DZ6 A;  4X4R A;  2UUT A;  1SC3 B;  2G2Z A;  2CA9 A;  3QYY A;  4OZ0 A;  4D3H A;  1EHW A;  3TZX A;  2FJE B;  3H4D A;  4RBV A;  4U8Y A;  1DAR A;  1N56 A;  1YSJ A;  2XS5 A;  3MMB A;  1Y7P A;  2YH1 A;  2HHQ A;  1ZM4 A;  2LQ8 A;  4C0O C;  1AA1 B;  4QWD A;  1XR6 A;  4DBQ A;  5I3P A;  1TKT A;  3FCW A;  2XGQ A;  3DU6 A;  1IKX A;  2J9C A;  2RU9 A;  3IMQ J;  5ETQ A;  2N3O A;  1M90 T;  1RTD A;  4EBE A;  2YXL A;  4UOF A;  2W1B A;  1S72 S;  1E6Y A;  1S1V A;  4YS2 A;  4KGZ B;  3IGV A;  4LRE A;  5GAG U;  3KJV B;  3IRW P;  3SV3 A;  1N32 F;  1XER A;  1R8C A;  2FHK A;  5KG4 A;  3ISN C;  4DL4 A;  5A6P A;  2F8H A;  4WKR A;  2ASL A;  3HFK A;  4HL9 A;  4O4G B;  1OY8 A;  2M8D B;  4PQU B;  4C2M A;  1NO8 A;  2HIQ A;  2IDE A;  2OFG X;  4YEA A;  4MYT A;  5EWE A;  2YKM A;  3HZE A;  1ZPW X;  2OAU A;  9RUB A;  1S0O A;  3GV5 B;  2J9E A;  3JSM A;  4RJV A;  3BPS P;  2VJV A;  5D8H B;  2I2Y A;  1RT3 A;  3G8S A;  2PE8 A;  1NU4 A;  1S1X A;  3PYD A;  1C1C A;  2AJF E;  2CQI A;  2XHW A;  4OHX A;  4OYW A;  4F7V A;  3EWG A;  5EDW A;  1VS3 A;  3FJ2 A;  3PCO B;  2ZH2 A;  4I67 A;  3POT A;  2RF2 B;  1LK5 A;  1MWZ A;  2CZ9 A;  5FII A;  2L3M A;  1EET B;  1S99 A;  2KT5 A;  2YKM B;  3CSK A;  4IG3 B;  4NWB A;  1NJI T;  3LW5 C;  4LF6 J;  3J81 U;  4TN2 A;  4O3S A;  4PG7 A;  3QIP B;  5JXS A;  2HGM A;  2VFU A;  5K8N A;  3D0G E;  4KE5 A;  1HBM A;  3CO0 P;  3PJX A;  4AT1 B;  3DYA B;  5A0Y B;  3POT B;  4O0N A;  2XO6 A;  3I55 S;  1SJF A;  3ILO A;  1M0S A;  2IBO A;  3CPW R;  2X1F A;  4OZ5 A;  2VPY B;  3OVA A;  2XMA A;  3KJN B;  1REG X;  1WC6 A;  4ES2 A;  2ZH9 A;  1S1W A;  2B5J B;  2I5J B;  3CW2 C;  5A8R A;  1LNQ A;  1X4B A;  3W61 A;  1VJW A;  2NUU G;  2QYG A;  3C6T A;  3CD7 A;  1X7V A;  3FFI A;  3GJT B;  1UMJ A;  1HNZ F;  3CMQ A;  1S76 D;  3D9B A;  2CQ1 A;  2RT3 A;  2N4C A;  1NZ8 A;  3D3C J;  4ZJQ A;  5M2P A;  1FWL A;  4I6A A;  4OV1 A;  5JMN A;  4GMK A;  1F5A A;  1YLX A;  3QWU A;  4UST A;  4U7U K;  4YB1 P;  4YB5 A;  2NR0 A;  1RWW B;  4LR7 A;  4YFU A;  1N5Y B;  1BY9 A;  2O67 A;  2Y1R I;  1D9F A;  2ZBC A;  3CCS S;  4IRC A;  4LFC J;  1S77 D;  4KY3 A;  2QN6 B;  3NGD A;  7FD1 A;  3UVJ B;  1N6Q A;  5CXT A;  4TU7 A;  1HNZ J;  1IKX B;  1SKW A;  2IMW P;  3F41 A;  1VHF A;  3TVY A;  3ZNJ 1;  1KLM B;  1OO0 B;  3GYN A;  3QRP A;  1PKU A;  3KHH A;  3T5L A;  3V2U C;  1H98 A;  2B6A B;  1P1T A;  2GJ2 A;  2WK4 A;  4OIX A;  2RQK A;  2QTW A;  5D77 A;  3H2L A;  3OHB A;  3CTR A;  3B8H A;  1J5E J;  2F4V J;  1PJ6 A;  4ED5 A;  3CJ5 A;  1GXT A;  4DDF A;  1RT1 B;  4F3O A;  1T3O A;  1QM9 A;  2E66 A;  3EDR B;  4DUY F;  1CBK A;  4USU A;  5IV3 A;  3F0N A;  1RIS A;  2KXH A;  2UUW A;  4LF7 F;  2UP1 A;  4XO0 A;  1AYE A;  1VRU B;  4KKO A;  1RT6 A;  2DR5 A;  2VC1 A;  1RBO B;  3O44 A;  3UDV A;  3NS6 A;  2CQ0 A;  4ZVF A;  3QZ7 A;  1RT1 A;  1I1G A;  3IN5 A;  1OMS A;  1R6V A;  2V8P A;  1TV6 B;  1E6V B;  3N5B A;  4OJ3 A;  3CD0 A;  1FRM A;  2ALY B;  2B8P A;  3NGS A;  3QMQ A;  2BMB A;  3KG1 A;  4JBC A;  3BS9 A;  5E33 A;  4ER8 A;  2HQC A;  2V50 A;  3D54 A;  4WKY A;  2I6W A;  4LJM A;  2L41 A;  1F2G A;  1NSA A;  1RQ0 A;  3TZY A;  3HI9 A;  5HVH A;  1VQ9 S;  1U8S A;  2WBR A;  4L6V 3;  2MPU A;  1DAX A;  1T0T V;  3UD4 P;  3E01 B;  3FQK A;  1U2F A;  2Y8W A;  4GO7 X;  4B9S A;  4U67 Q;  4K4U A;  1ZZF A;  3GFX A;  4PWD B;  4PWD A;  1S9G B;  5ETK A;  2HFO A;  5L9X A;  1GMU A;  3FQL A;  1HQ2 A;  4WP8 A;  5C7P A;  1U0S A;  1HWI A;  1YBA A;  4DS5 A;  3MM6 B;  1LXJ A;  2J9D E;  4C3K A;  3HSZ A;  2MZS A;  1RUS A;  1Q0N A;  4EMD A;  1JXE A;  4TY8 B;  5AJ3 J;  1PC5 A;  3AJ1 A;  3TW0 A;  2QA4 S;  2DEJ A;  2LVW A;  2RHS B;  3AXK A;  3O5T B;  4ALZ A;  1RK8 A;  3ZO7 A;  2FHM A;  3H90 A;  1C0U B;  1Q79 A;  3D6F B;  4NLP A;  1H2V Z;  2CPF A;  4M5D B;  2GW8 A;  2DBB A;  3GV8 B;  2SXL A;  4EFA C;  3ZZY A;  2VFV A;  2P8I A;  2K1R A;  4PWW A;  2ATC B;  2ZIT A;  3DOL A;  5J1P A;  4RNM A;  3ZTO A;  5KT7 A;  1KSP A;  1R0B G;  4J90 A;  3GIJ A;  1TU0 B;  5IOL A;  3M8Q B;  5KG7 A;  5DG8 A;  1C1B A;  1A6L A;  2F8M A;  2O1P A;  3LTO A;  4HDH A;  5DO2 A;  5L38 A;  4I0W A;  4LFB J;  1NH8 A;  3GR1 A;  1FKP A;  3P3D A;  1VRT B;  2QLJ B;  2JLG A;  2BAN B;  2I9S A;  4F0H A;  1ICE B;  3CD5 A;  1NPR A;  3EYZ A;  3UCG A;  3IR6 B;  2PI5 A;  1F1B B;  2M88 A;  2EXU A;  4V1A k;  5J2N B;  4ED1 A;  1IWA A;  3W1Y C;  1U09 A;  3F56 A;  2X1A A;  2CZV C;  5HP1 A;  1VC6 A;  1HI8 A;  1SI9 A;  2ZD1 B;  3D68 A;  4FPR A;  3MPW A;  5A8K A;  1RTD B;  2LEP A;  3AA8 A;  4L3K A;  2G2Y A;  1U6Z A;  2UZA A;  4QW9 A;  2R7X A;  3TUI C;  2HNZ A;  4NZ0 A;  2X1B A;  1LW2 A;  3SQO P;  3GB0 A;  3ENA A;  5HO4 A;  5LMN F;  4UUW A;  4PPZ A;  4HAC B;  4M8L A;  4PG6 A;  4IQX A;  2VFR A;  3MCO A;  1HNV A;  1S10 A;  4YY3 F;  4Z7Y A;  4ZDN A;  2BKN A;  1NZA A;  4IFV B;  1ZPV A;  4P74 A;  2XCP A;  3P49 B;  1X8D A;  3DLK B;  2DO0 A;  3DOK A;  3MR7 A;  4IRD A;  1B99 A;  2GO9 A;  1RTZ A;  1NUE A;  2DGQ A;  2CXE A;  2HZA A;  3C14 A;  1RT7 A;  3CJ3 A;  5AE3 A;  3G96 A;  1HBU A;  1S1T B;  5J1N A;  3HF5 A;  2P2C B;  4C8O A;  1N33 F;  2MY8 A;  4MJK A;  4USH A;  1U1K A;  2HHW A;  2E5G A;  4DV6 F;  4UOC A;  2RQM A;  4NE9 C;  4ZVE A;  2ZZM A;  4H4K A;  2RRB A;  3R2D J;  1H38 A;  1GH8 A;  5J2Q B;  2XM3 A;  3CCJ S;  2NCK L;  3B4M A;  5A0Y A;  3HSJ A;  3TP2 A;  4CNY A;  6FDR A;  4TY8 A;  4XAK A;  2DR7 A;  4QPX A;  1Z2L A;  2A2C A;  5IV4 A;  3HHK A;  4J9O A;  4UOG A;  1JLQ A;  5T41 A;  4OHV A;  1X0F A;  2F5G A;  5HLF B;  3EVW A;  4CLZ A;  2E1C A;  2EFQ A;  4BHQ A;  4ED8 A;  2AZ1 A;  1H7W A;  5FDL A;  1FXD A;  3NMR A;  4K4V A;  1WC0 A;  5C42 B;  4RX6 A;  3D7S B;  1L3T A;  2ERR A;  4JI4 F;  2QFI A;  1LOU A;  2BXJ A;  2OP5 A;  3A3P B;  4RPF A;  4ZLJ A;  4X4Q A;  2KG0 A;  5J2P B;  2R8G A;  1NEE A;  1D1U A;  2VG5 B;  3KLF A;  4LSN A;  4DV6 J;  1HBN B;  4OYM A;  4F26 A;  1UTA A;  3UCZ P;  3A8K A;  3M8S A;  5C42 A;  3M1V B;  2ZDP A;  3GFH A;  4ZVO B;  2HS4 A;  2W7O A;  5CYM B;  2ZH8 A;  1BWV A;  3ILI A;  1EAR A;  2IM3 A;  3CC7 S;  4ZVQ B;  2VIC A;  3M8Z A;  1KLM A;  3TAM A;  2XCA A;  5D4O A;  1CS4 B;  3B82 A;  3NCQ A;  1XMB A;  3KJV A;  1U7L A;  4HI1 A;  5DZ7 A;  2E29 A;  2V8G A;  4F0M A;  3KDO A;  4KO0 A;  3IWN C;  2OTJ S;  3DLG A;  2FY1 A;  1WHV A;  3MTJ A;  3BB5 A;  5FLX Y;  1FRK A;  1NHV A;  1RAD B;  2H48 B;  5HMX A;  5BYR A;  1KR4 A;  1SVD A;  2OPS B;  5KT4 A;  2MQQ A;  1K9M T;  3JSY A;  4TLR A;  1V3S A;  2YX4 A;  3DOK B;  1EIY B;  4MFB B;  3IP0 A;  1WTF A;  4JV0 A;  1CUL B;  3WBZ A;  1TK8 A;  1JLG A;  2IYI A;  2NYI A;  3PJ9 A;  3WC0 A;  4QWA A;  4OL8 A;  3GSI A;  3CJK A;  5B7W A;  2PFD A;  3OTD A;  3LAK A;  4DFM A;  3MF5 A;  4NLU A;  2B9X A;  1TL3 B;  4P6Q A;  2H5J B;  3MM7 A;  3CUL A;  3DGP A;  5J2M A;  1UVI A;  1ZBT A;  3AB2 B;  3HDS A;  3KLG A;  2GHW A;  1UEU A;  2DXE A;  5E2Q A;  3M8Y A;  2G1H A;  4AD6 A;  3VAI A;  2N7Y A;  1UL3 A;  4HKQ A;  4LR9 A;  4DR6 F;  5D3G B;  2HUR A;  1QTN B;  1C2P A;  2M3D A;  5F9N A;  1EP4 A;  4DCP B;  5KFR A;  2R3V A;  1HWK A;  5ETV A;  3QGP A;  2XSJ B;  4WFA Q;  3D66 A;  2RS8 A;  1WDD A;  2CAJ A;  5BYS A;  3EVO A;  4JV1 A;  4GRS A;  4Y6I A;  1JQG A;  3SQG B;  3Q23 A;  2YH0 A;  4ECZ A;  3ADA C;  3M9O B;  3J7A N;  1DBD A;  2V8H A;  4H4O B;  3QAU A;  2DIT A;  4H4O A;  5KG2 A;  4K4W A;  2K7J A;  5KT3 A;  3T5H A;  2H65 B;  4LQ9 A;  1R8B A;  1RWP B;  1KKH A;  1T9W A;  4ECT A;  2BQR A;  2MLX A;  2Y0B B;  3OTO F;  5B0D A;  2K1R B;  4B9V A;  1K47 A;  3W5X A;  2FVP A;  5KFX A;  4DR1 F;  2QG9 B;  3THT A;  4CH7 A;  1NH7 A;  2JJ4 D;  4C11 B;  3NNC A;  1U1O A;  4DL6 A;  2FJD B;  1DTT A;  4ZP7 A;  2DT9 A;  2G0C A;  2GZO A;  4WK1 A;  2RHQ B;  3OL6 A;  2QMX A;  4BDP A;  4YHH J;  3GIL A;  2VG7 A;  4JI0 F;  1U2R A;  1N88 A;  1X9M A;  2VA3 A;  1G6B A;  2CKW A;  4ECV A;  2HGN A;  2HFN A;  2WCX A;  5IFM A;  5GAH U;  3I0S B;  5LXY A;  1QSY A;  1NXI A;  3EVM A;  4MFB A;  4NI2 B;  4FS1 A;  4F4Z A;  3SEO A;  3DFE A;  1I94 J;  3BGU A;  3HHL C;  4QWB A;  1T9U A;  3I5B A;  3SI8 A;  1VQ6 S;  4XK8 C;  1YTY A;  1RB0 A;  4NXM F;  4NCA A;  2C3Y A;  2DR8 A;  1JB0 C;  2FVQ A;  1FI4 A;  1MWQ A;  4X84 A;  1TL1 A;  4JV5 F;  3H20 A;  4Y3C A;  1FHT A;  1OQ6 A;  2MY7 A;  1X9W A;  1V5V A;  2DGU A;  2ROP A;  4PQU A;  4PYD A;  2ILZ A;  2QLF B;  3WIU A;  1LWF A;  2R7O A;  3NGK A;  3KYL A;  1S6U A;  1PC4 A;  2V8V A;  3DRR A;  1S4E A;  3MCS A;  3WDO A;  2KXN B;  1S9F A;  1SKR A;  2BJ1 A;  4M5J A;  4R8U B;  3V4I B;  2VZ9 A;  2IVM A;  2V4J B;  4DQQ A;  1ZYQ A;  3PRD A;  1HQU B;  1P9Q C;  2I1R A;  4JB8 B;  4O3Q A;  1KD1 T;  2ZZN A;  2D69 A;  2BV3 A;  2ABY A;  5J1E A;  5HBM B;  4E8U A;  1U8W A;  3HVT B;  3CJ8 A;  5DM6 Q;  4IOA Q;  2AJ1 A;  2DB1 A;  2DD8 S;  2DNY A;  2XBP A;  1LFP A;  1VLO A;  3VGT A;  3UN5 A;  3FFI B;  2D41 A;  3KLI B;  3OXF A;  3DKD A;  3SDE B;  4RNF A;  4IH7 A;  1KBR A;  2PEH A;  3M30 B;  1IKW B;  8ATC B;  5HQM A;  2IJR A;  4J7C A;  1NB7 A;  1H74 A;  1RAI B;  2C3M A;  3GFY A;  1MU2 A;  4K59 A;  1WD6 A;  5F8N A;  1BQM B;  4C0B A;  3DRP A;  3M6V A;  4C8K A;  4JYA F;  2DHX A;  1G4C A;  3GYX B;  4CLK A;  1W26 A;  4ZLL A;  4JI1 F;  1SJ4 P;  3J7Y U;  1YGY A;  2MQ8 A;  2PMW A;  3QPI A;  2GVZ A;  4K4X A;  4OYX A;  5JVH Q;  1MLA A;  4Q5V A;  3VVT A;  1ZTT A;  1JK9 B;  2K06 A;  3TA1 A;  4U7U D;  4X64 J;  3IFE A;  2HFS A;  1R31 A;  4F36 A;  2GGP A;  3BQ2 A;  4DV2 J;  4ANE A;  1R0A B;  2C3O A;  1K44 A;  2KXF A;  2WB4 A;  4DG1 B;  3C15 A;  2Z58 B;  2QLX A;  3FSI A;  2PMH A;  4CO2 A;  5CCM A;  4UT4 A;  4KFB B;  1CJT B;  2OPQ B;  2MSS A;  3DRS B;  4KKO B;  1RDR A;  1SPB P;  1UZD A;  4ZA1 A;  2C3P A;  4BWM A;  4J9M A;  4K0K F;  2KM8 C;  3RB0 A;  1HBO B;  4CYU A;  2A6O A;  4R25 A;  2XMW A;  2C3U A;  3PW7 A;  2DCU B;  3HX9 A;  3QID A;  3G6X A;  3MAH A;  3W9H A;  1AFI A;  2ZC3 A;  2AX0 A;  2ZDO A;  3ILL A;  5IWA J;  2AU0 A;  1LK7 A;  3I5A A;  1NLK L;  1X4C A;  1BD6 A;  2J5A A;  2V69 A;  2ZOF A;  2ZUA A;  3FUY A;  4ZLP A;  3TUZ C;  3R7S B;  2MQP A;  1NHU A;  2WON B;  2Z4P A;  4CYU B;  5GAE U;  2WON A;  1U1P A;  4C8Y A;  1LWF B;  3K7R A;  3N79 A;  2JDJ A;  2RKI B;  1FRX A;  3FZ2 A;  3LP0 B;  3O3L A;  3Q8U A;  2ZWP A;  2UUB F;  4O3R A;  4FF1 A;  4WFZ A;  1NPP A;  3PHT A;  4YDD B;  3AHP A;  5B08 A;  3A4T A;  3BF4 A;  2V8D A;  3Q8V A;  6AT1 B;  3CCE S;  2ZFH A;  3IG1 A;  2CPE A;  3A1Y G;  2VQF F;  1EQM A;  2W2O P;  4LMZ A;  1DLO B;  3GTY X;  4X62 J;  3CB4 A;  3FSY A;  3UN3 A;  3GIM A;  2HBZ B;  4L3N A;  5IWA F;  4PUO A;  1FJE B;  3UPF A;  2VL1 A;  1S5Z A;  2IM2 A;  3DRY A;  2W24 A;  1N0V C;  5A6W A;  2ZE2 A;  2UU9 J;  2QO3 A;  2VKZ G;  4TU9 A;  2VD3 A;  3L4B C;  1PAE X;  1NDK A;  1SKU B;  5DQH A;  3M8Q A;  5E0O A;  4A48 A;  5E3C A;  4P75 A;  4YOE A;  5KFH A;  3DDN A;  1T9V A;  3M9M B;  2COL A;  1NRK A;  4MMO A;  1GEH A;  2DNQ A;  2IC3 B;  1SQE A;  1RE1 B;  3ZTR A;  3M32 A;  1JLB A;  5BJR A;  3PV8 A;  1SC1 B;  3CO9 A;  3J7Z 5;  1S12 A;  4RWX A;  3NNA A;  5CZV A;  2MGZ B;  1ULR A;  3MPY A;  4FS2 A;  3SZ2 A;  2ZHB A;  1VIX A;  1OPI A;  5F3T A;  3LO3 A;  1WOR A;  2RAQ A;  5C24 B;  2IIH A;  2DRB A;  3I4P A;  2UU9 F;  5L8R C;  2JEF A;  1S9E B;  5L1L A;  1EKR A;  2IC3 A;  2FLN A;  4DR3 J;  3MWB A;  2EC0 A;  1FDN A;  3I5C A;  4OX9 F;  2VPZ B;  3W64 A;  3T19 A;  4WXW A;  2LMI A;  1HPZ A;  3DHX A;  2W9C A;  3CCZ A;  1RHK B;  2CPI A;  1OYD A;  2PSZ A;  1HIY A;  2HFU A;  2Z2M A;  4TYB A;  8RUC A;  1FKO A;  1Z1Z A;  2CQ4 A;  3LGN A;  3N9U C;  5BXI A;  3K58 A;  1Q82 T;  2VDI A;  3KJQ B;  1K0V A;  3N4W A;  1YIJ S;  3DMJ A;  1RT6 B;  3PZP A;  4J9N A;  2YNF B;  4DL0 C;  1IJE B;  1NK7 A;  3BDE A;  1MNE A;  2ZOG A;  3HHL B;  3RAQ A;  3JS9 A;  4I2Q A;  4HR2 A;  2D74 B;  3H25 A;  2G4B A;  1K8A T;  3TJ8 A;  1OSD A;  1RAA B;  3H2U B;  3U27 A;  4YP3 A;  1VQ4 S;  2YWW A;  2CJA A;  3HVW A;  3H5S A;  4RW8 A;  1X5T A;  1RTH B;  2CG8 A;  1WF0 A;  2HRU A;  2L48 A;  2XI3 A;  3MEG B;  4USM A;  4DV4 F;  4ECY A;  3RBE A;  1U49 A;  4EO8 A;  4CCH A;  1IUJ A;  4C3L A;  3W3S A;  4RNO A;  2Y1L B;  4RNH A;  3BJY A;  4K4T A;  3K5O A;  1QAI A;  3Q2T C;  4KV8 A;  3KK1 A;  1TL5 A;  2HKE A;  1WF2 A;  2D9O A;  2DNZ A;  1YJR A;  5G0R A;  3PW5 A;  2BKO A;  3GE9 A;  2OJ3 A;  3DOL B;  2GML A;  1M5P C;  4ECR A;  1I51 B;  4B9L A;  4OHY A;  5HJY A;  1X60 A;  2H1Y A;  4NCB A;  3SCI E;  4B9T A;  3R5G A;  2FQQ B;  4ZVT B;  1N34 F;  1TMJ A;  3MPD A;  3C6T B;  1IKY A;  3R9L A;  3KK2 A;  3I32 A;  1K73 T;  3MMA A;  1WKJ A;  3CNQ P;  3SQG A;  1VQ7 S;  2OGU A;  5DZ6 A;  2HVD A;  3RJM B;  3KHR A;  1F5C A;  2J7K A;  3ZXW A;  2FD2 A;  1HBN A;  4BCA A;  3D1Q A;  3N28 A;  1SJ1 A;  4KB7 A;  5F41 A;  4JI3 F;  2I8E A;  5C2G A;  4H4K C;  5I3Q A;  5C24 A;  3J80 U;  1YJ9 S;  1D9A A;  2LXU A;  1TEL A;  3IAS 9;  1U24 A;  4PPD A;  5CYM A;  4ZP6 A;  2CPZ A;  4LF8 F;  2FIU A;  2J8S A;  3TO8 A;  3TRG A;  4OZ2 A;  1UPP A;  4F4Y A;  4DFK A;  3IWX A;  1U2C A;  2F1F A;  2DH8 A;  3WZ0 A;  2ACY A;  1TK0 A;  3LAL A;  2W8K A;  4NXN J;  2CPJ A;  1FEE A;  1G7C B;  1NDC A;  3BYR A;  4WJB A;  2ZJR Q;  4ATN A;  1ITP A;  3AD7 C;  2Q6B A;  1TAQ A;  1FCA A;  4NAS A;  2L08 A;  1TTH B;  2DIS A;  3BR9 A;  3C16 A;  4ZVU B;  1V5I B;  1J5E F;  2DJW A;  3HT0 A;  4A46 A;  4RU9 A;  4DV7 F;  5H9F J;  2BJ8 A;  1C0T A;  3FNN A;  4J37 A;  4FPI A;  3PIO Q;  2O66 A;  1N5Q A;  1H2U X;  3QAE A;  5B09 A;  1FX4 A;  2IRX A;  2VIH A;  4F2R A;  4W90 B;  2DH7 A;  2BQ3 A;  2YBV A;  3ETM A;  2GIF A;  3EX7 B;  4W98 A;  3VR1 A;  5JUM A;  5GAH I;  4PKD B;  3QAT A;  3BO3 A;  3PYE A;  2KM8 B;  3DXS X;  4OI4 A;  3US5 A;  3G9C A;  1UEV A;  1YBT A;  2D7S A;  3K8W A;  5ETO A;  3TJ9 A;  1HAR A;  4Y2A A;  4DU7 A;  1SBR A;  2OH2 A;  4JI6 J;  3I87 A;  3LP0 A;  2HBY B;  4KV8 B;  4IOB A;  2OEL A;  4OFZ A;  2IBK A;  3GIR A;  3V4I A;  4NA2 A;  1HBU B;  1S1T A;  2XMU A;  4ZJO A;  3W5Y A;  4CO3 A;  1DQ8 A;  2Z30 B;  2C2K B;  1MML A;  2LA6 A;  3EGN A;  3JTO A;  3VZH A;  3B78 A;  2H5I B;  3FC9 A;  3I56 S;  4P71 A;  2FUG 9;  4G1P A;  1RWX B;  2MQO A;  2XS7 A;  3QRR A;  4N8N A;  3VTI A;  1XNQ J;  3DLE A;  3TQE A;  3GJQ B;  5D78 A;  4OX6 A;  3MAQ A;  1FD8 A;  1YX2 A;  3N5F A;  4HTI A;  1IBL J;  3FEY B;  3M2R A;  2AZ3 A;  5ETM A;  1SKS A;  3H8Y A;  5DLG A;  2HK3 A;  3T6B A;  2B0G A;  4ICL A;  4D3G A;  2HPU A;  3GJS B;  5BYQ A;  3C8Y A;  1RI7 A;  5FDL B;  3BKF A;  2I5J A;  1UJ5 A;  5A8R B;  3M1V A;  2N82 B;  1S59 A;  3HSD A;  3DLB A;  1VBY A;  4FXW A;  4LRF A;  1S6O A;  2G0J A;  4WII A;  3K8V A;  1C4A A;  4NZ6 A;  3C3L A;  1XK8 A;  1GXL A;  2HRT A;  3NXZ A;  1LV5 A;  3KLF B;  4DQI A;  1WUU A;  1FK9 B;  2F4F A;  4UY8 5;  4TQR A;  3OV7 A;  2UVW A;  4B9U A;  5LL6 d;  1G2E A;  2DGX A;  5E3P A;  2CFX A;  1UET A;  2R7W A;  3PX0 A;  3M2U A;  4EBD A;  1U26 A;  4ID5 A;  4TKT A;  3P8B B;  5B0G A;  3JSB A;  4I2P A;  4EO6 A;  2UVR A;  1SL0 A;  1JXV A;  5T14 A;  1UAW A;  1VLY A;  1X4F A;  4LRD A;  1H3D A;  2ZBR A;  2V6A A;  3BKU A;  3MEE B;  4NLO A;  1S9E A;  4NEY A;  2R7Q A;  2JFK A;  3M8P B;  1X5S A;  4EYH B;  4NRT A;  3UD5 A;  4AND A;  2CVI A;  1YG0 A;  3E2E A;  4DWI A;  1UWB A;  2F7V A;  1SJQ A;  2W2P P;  3PFO A;  3NG8 A;  1AUS L;  4WYW A;  3GV7 B;  5DM7 Q;  1WEY A;  3DM2 B;  1PYT A;  1RT5 A;  1N5T A;  1LW2 B;  2A3J A;  1FTR A;  4P9S A;  4DXL A;  3ZTQ A;  5LMN J;  1WHX A;  1FRI A;  3UI3 A;  4F25 A;  4DLG A;  3PW0 A;  2JEJ A;  3TJA A;  4C4W A;  4DUZ J;  1IVZ A;  2DR6 A;  1B70 B;  4OI3 A;  1M5S A;  2B4O A;  2POK A;  3MEC B;  4ZVS B;  3J7Y I;  1E6V A;  1IR0 A;  1N8R T;  4NXM J;  1K1Q A;  2WRM A;  3HHD A;  3MM5 A;  1FFS B;  3QLH B;  2V2K A;  2WSF C;  3G8T A;  4X4S A;  2GFF A;  2XY7 A;  5HAT A;  1YRU A;  3P4U B;  4USJ C;  1XR5 A;  2XSF A;  3KUH A;  1B64 A;  3M6W A;  4ZOS A;  5D3G A;  1JLA A;  2GAG C;  2QZ8 A;  5KT5 A;  3NOC A;  2QMW A;  3ULH A;  4DCJ B;  2E9Z A;  2B7C B;  1JKH A;  2XUL A;  3CJR A;  1UZH A;  1Y10 A;  2OKQ A;  3CJ2 A;  3KTQ A;  3MFI A;  1KFS A;  3VV2 B;  4GC7 A;  5EWF A;  4LF4 F;  5GME A;  4EK2 A;  1NDP A;  4F4W A;  3UR3 C;  2LQ9 A;  3W63 A;  1DLO A;  1Q95 G;  3PTW A;  4DQS A;  4Y34 A;  1WC4 A;  1QSL A;  2GMJ A;  1DTT B;  1HKA A;  3NY0 A;  2BUN A;  2HS3 A;  4J9U E;  5A8W B;  4DL5 A;  2DEI A;  4DFJ A;  1WJ9 A;  2G13 A;  3A8J A;  3R97 A;  3BSC A;  4DLE A;  4ZJL A;  3QT7 A;  3BO2 A;  3P6Y C;  2J8A A;  3IC1 A;  2WBM A;  2IY5 B;  2IA6 A;  3W2V A;  2RVJ A;  3HVR A;  3D1H A;  3TAM B;  1Q81 T;  3K5M A;  2LA4 A;  1SQF A;  1D8Y A;  1BE4 A;  2EW9 A;  3DLJ A;  4MIB A;  1QJH A;  2CPX A;  1SH0 A;  2RJZ A;  4KO0 B;  1T02 A;  3MM8 B;  2EBE A;  1RCO B;  4KGK A;  4RWW A;  4XTT A;  5T7L A;  3OUY B;  3PW2 A;  1VCT A;  3C15 B;  2XI2 A;  4KIA A;  2OPP A;  5KFU A;  2DO4 A;  3BGR A;  4Y2K A;  1TKD A;  2AJQ A;  1VBK A;  3FMB A;  2PGC A;  2X3D A;  4KQZ A;  1WDT A;  1NKE A;  2X51 A;  2YKA A;  4IOC Q;  1VRQ C;  1SL1 A;  1S1U B;  2IMO A;  3MEK A;  3HP6 A;  3B54 A;  2FZG B;  1GQE A;  3NS5 A;  4MH8 A;  4RL1 A;  5LJ3 Y;  2N7C A;  4AQY J;  2AIR B;  2DNL A;  3W8P A;  2RB7 A;  4KHP F;  3EXC X;  5H9E K;  3PYG A;  1TL3 A;  2HSE B;  1GX5 A;  1CJU B;  3OT9 A;  4DSF A;  3OFH A;  2CQH A;  1S1X B;  3UNG C;  1Y9O A;  1HBM B;  3ZZ0 A;  2C2N A;  5CCL A;  3TI0 A;  3QJP A;  3PJW A;  4J9K A;  1FD2 A;  5DQI A;  2LQB A;  2KFZ A;  1EET A;  1V3R A;  4IFY B;  3OR2 A;  3T5J A;  1M5V C;  4W92 B;  3RBZ A;  2WTF A;  1BUX A;  2QLB B;  4YDX A;  4ES1 A;  3K5N A;  3HD1 A;  2LP4 A;  1S7I A;  2HQI A;  3HFV A;  3C14 B;  3MZI A;  5KFA A;  1IQZ A;  5ETL A;  4B3M F;  5D0H A;  4C8Z A;  2PDA A;  3IG1 B;  4FVM A;  4MIW A;  3RUB L;  1DTQ B;  2RDI A;  1VC0 A;  1D0E A;  4B3O B;  2NRE A;  3HM9 A;  4OZ3 A;  2CWK A;  1JJC B;  3R8Y A;  4EWT A;  3DGV A;  4J9V A;  3BGL A;  3R5C A;  1MWY A;  1SL2 A;  2AGP A;  3IO1 A;  2W2N P;  1LFW A;  3M4X A;  4OZN A;  1Q5V A;  4OJ1 A;  4QJV A;  5K14 B;  1N32 J;  4LSZ B;  2W8L A;  4LBI A;  1KOO A;  2APO A;  3FRY A;  4Y2I A;  2W25 A;  1PYO B;  3TVZ A;  1H7X A;  2PEB A;  3MUV P;  2C2D A;  4WU2 A;  4FXD A;  4X62 F;  3PR5 B;  1FXL A;  2HHX A;  3RRG A;  1CPZ A;  1UP1 A;  1FRJ A;  3OXL A;  4AXJ A;  4XDC A;  1FO1 A;  2HHV A;  1AFJ A;  3MHY A;  5KFF A;  2HK2 A;  3ENV A;  2IPO B;  3ZZR A;  4U6P A;  4DR4 F;  2VG5 A;  4ZK7 M;  5KG5 A;  3R7N B;  1YRX A;  4HT7 A;  4DR1 J;  4CLF A;  3ZNU A;  2GNK A;  2GQ2 A;  2JOQ A;  4C98 A;  4YY3 J;  5DJB A;  2GVZ B;  3TAN A;  2R7T A;  5AXK A;  3NKY A;  3UE2 A;  1X9S A;  1S0M A;  4OZL A;  4K4Y A;  2ZHA A;  2DNK A;  3NNH A;  2LYV A;  1Z4U A;  3CCL S;  4OYI A;  1TVR A;  4C8L A;  4QYR A;  1IKV B;  1R27 B;  1WEX A;  2CVE A;  2C1E B;  4YN3 B;  4ZCI A;  1N0U A;  3BQ1 A;  3TQ1 A;  4ELV A;  3VAH A;  2OPP B;  2CJX B;  2BAN A;  1VC5 A;  4WWS A;  3R5B A;  3TR5 A;  3IRX A;  1YJU A;  1VBX A;  1BMQ B;  2KT3 A;  1SUQ B;  3ENQ A;  2QLW A;  1VQY A;  2ZBI A;  3UWT A;  4DPY A;  4K4Z A;  3OSN A;  3KXD A;  3PYF A;  4DR5 F;  4ED6 A;  1NJW A;  2GJF A;  4K50 A;  3VZI A;  2E5H A;  1T03 B;  4LF7 J;  3PKY A;  1T03 A;  4PAB A;  2UV8 G;  2C2O B;  2VON A;  3DLK A;  4K2J A;  4ZP9 A;  2Q6C A;  2VF3 A;  3K89 A;  2KB2 A;  3NAH A;  4ENO A;  2VQE J;  3QWP A;  3EPG A;  1SQG A;  3VGS A;  3RB4 A;  3S7R A;  1FDD A;  2BEF A;  1UVN A;  4QPT A;  2Q66 A;  1SIW B;  3R5J B;  3V5R A;  2C42 A;  2HFV A;  2VB6 A;  1YQH A;  2AYB A;  4JI7 J;  3OL8 A;  3E01 A;  3NGU A;  4PCQ A;  4ANC A;  4RW9 B;  4NOH A;  4IQM A;  2CQ3 A;  3HVT A;  5CD4 A;  1TUG B;  3W62 A;  3NL0 A;  1WC3 A;  2ZBQ A;  3A12 A;  3LWL A;  4JI3 J;  3MM6 A;  3KMS A;  4WPA A;  3KOA A;  1VIS A;  2E5I A;  5G0R B;  4K4S A;  4DV4 J;  1FFW B;  2FC9 A;  2RUS A;  1HHQ A;  2Z0G A;  4G6V B;  1NK6 A;  1TFW A;  4ZVP B;  3SBM A;  1KC8 T;  2WVF A;  4X2B A;  1S6P B;  3ET6 A;  4B3R J;  4FNH A;  4KHP J;  4FVC A;  1YJW S;  5KFP A;  3Q24 A;  3OFF A;  1ZET A;  1ZA2 B;  2PFF B;  2CUY A;  3NAI A;  4HI2 A;  4C6A A;  3DHW C;  2FLL A;  4NA1 A;  2Y1I A;  3T9Z A;  2MZQ A;  4ZN3 A;  5DGB A;  4A8F A;  4FBT A;  1UFW A;  2A6M A;  2XS2 A;  4DV7 J;  3CCW A;  3MED A;  4IYQ A;  1IJF B;  3D5M A;  4LFA J;  4N76 A;  2YNG B;  1M1K T;  4ITS A;  1KTQ A;  4ECQ A;  4I6Y A;  2V34 A;  4ELT A;  2LQ5 A;  4WFN Q;  3EGV A;  2W4C A;  5E3Q A;  4ELU A;  2UUC F;  2KFN A;  2VC0 A;  5IM0 A;  2R7V A;  1GAO A;  2X3G A;  2ZKT A;  4OYZ A;  1HHS A;  5GVQ A;  1VQS A;  2ADC A;  2EVZ A;  3CWJ A;  4LF9 J;  1TKZ A;  2CQC A;  2QA2 A;  2B9W A;  1JIH A;  2FY8 A;  1TP7 A;  5L1I A;  3RBX A;  4LF8 J;  2UUC J;  1U47 A;  3DMJ B;  3HO1 A;  5F9L A;  4M5I A;  2MLY A;  2CNO B;  1HD1 A;  1XNR F;  1HBO A;  4NLW A;  3MUT P;  1X4E A;  2DXD A;  3X3U A;  1BQN A;  2GHV C;  4DUT A;  2AKW B;  3DRS A;  3KKF A;  4OJG A;  1JLF A;  5HN0 A;  2L9N A;  5HSP A;  1V6H A;  2MYF A;  1DUR A;  1H6K X;  2D3U A;  2B7B B;  2QT7 A;  4F3Q A;  5LMU J;  4OLO A;  3RYL A;  1FJC A;  4H4M A;  3BGO P;  4PXD A;  1FWK A;  2CPD A;  2OSQ A;  4DU8 A;  3D2W A;  4GC6 A;  1QVG R;  5I3U B;  5KFC A;  1X5O A;  4O3N A;  2NZ4 A;  4HH1 A;  4RW9 A;  2BZ2 A;  3VHQ A;  4UQT A;  4LF2 A;  1S57 A;  1S9G A;  4L74 A;  1RT3 B;  5CHC B;  5HI7 A;  1T11 A;  4CO0 A;  5KOX A;  4DPT A;  3I0R A;  3QIP A;  3ILJ A;  4ZVG A;  3RW7 A;  1SIZ A;  4DPX A;  5KFO A;  3Q8R B;  1WEZ A;  2DNO A;  2DNM A;  4FN5 A;  2Y1J A;  1IBL F;  1UVL A;  2UUA F;  4NYP A;  4EZ9 A;  4LT6 A;  1X31 C;  3HPO A;  4URQ U;  2QA4 G;  1PSD A;  5HMZ A;  3UDC A;  4FYD A;  3ITH A;  3KLH A;  3IS9 B;  4PQA A;  1N54 B;  5HMW A;  2QJ3 A;  3O1L A;  5CYJ A;  4BS2 A;  3RW6 A;  4KGM A;  3OXG A;  4NA3 A;  3ICL A;  2HNY A;  4CRJ A;  1D3W A;  4GKJ F;  1XWL A;  1S49 A;  5CYQ A;  3M30 A;  2FHO B;  1QLN A;  4ZPC A;  1CJV B;  2YNI A;  2M2B A;  4I7F A;  1RA7 A;  2ASY A;  3HHE A;  3R5A A;  2E1R A;  4F50 A;  4NMX A;  4RKU C;  3KUE A;  1O8B A;  3U02 A;  2QA1 A;  4LF1 A;  4P52 A;  3TA2 A;  4PRF A;  1KP6 A;  2FZK B;  2V4Q A;  3U7J A;  2KL8 A;  3NMA A;  4YR0 A;  4X66 J;  2RUG A;  4JI5 F;  3LQV A;  4F4X A;  2EEY A;  2YX7 A;  3MR2 A;  1YK9 A;  1LWC A;  3NBP A;  3WQP A;  2B6A A;  4A47 A;  1NHK L;  1WHW A;  3EDQ B;  4LUB A;  5CAB A;  1TFY A;  4HVZ A;  3HHN B;  4R5P B;  5IQ6 A;  5LJ5 Y;  1JJ2 R;  4YB7 A;  5LOQ A;  1VRT A;  1R43 A;  1T9T A;  4CIO A;  4M94 A;  2WB1 D;  1HWJ A;  5IQQ A;  3VQT A;  3JAM Y;  3H4B A;  1L3V A;  1HI0 P;  1BWE A;  3AQP A;  1N33 J;  2QL9 B;  1NDL A;  3RRK A;  5HMY A;  1R8A A;  1F2H A;  2XYP B;  3BV8 A;  3TEH B;  5IZH A;  2JEG A;  3H5U A;  1Y11 A;  2R4F A;  4X66 F;  4JI5 J;  2YNF A;  3BPD A;  2YKN B;  4KR0 B;  4U8V A;  5EX3 A;  2HVI A;  2G9O A;  2VFS A;  2QFJ A;  4KGV B;  4RW7 B;  4KFB A;  4FXV A;  3R27 A;  1R0C B;  3C6U A;  3D6T B;  1VQO S;  1RTJ A;  3TAP A;  1RCX B;  3CGI A;  4LRC A;  5HRO B;  3AY0 A;  3M2V A;  3PAC A;  4R0E A;  4KH1 B;  3PW4 A;  1MN9 A;  2LXF A;  2DHG A;  3E51 A;  4X65 F;  2VG6 A;  3NGT A;  3S6E A;  4MK8 A;  3JYT B;  1J5O A;  3GCX P;  3LP2 A;  2Z57 B;  2OSR A;  2ZH5 A;  4U96 A;  3C6U B;  2XNQ A;  3QLH A;  4Y2C A;  1NKC A;  1WOO A;  2EG1 A;  1CJK A;  3N6M A;  2HAF A;  5DS7 A;  1RHU B;  3G82 B;  2GVD A;  4WFB Q;  3BKT A;  2CIM A;  2Q43 A;  1ZH5 A;  2EFG A;  4OJH A;  4J9L A;  4FF4 A;  2VG6 B;  3CDW A;  3JYT A;  1XR7 A;  5F8I A;  1AZS B;  3CC2 S;  3GLJ A;  1GTH A;  4QCL A;  3SMZ A;  3J7Z T;  3KK3 A;  1Y5I B;  4ZVH A;  1YZ6 A;  3EGW B;  3NGR A;  4J9P A;  2CG4 A;  3KLI A;  1WWH A;  2YPZ A;  3SDE A;  1MSW D;  2HMI B;  1WOP A;  3QO9 A;  4NPO A;  2VOP A;  1FX2 A;  2MJU A;  4AL6 A;  5D15 A;  3BQ0 A;  1W7W A;  3D0I E;  4DV0 F;  3HKZ D;  3ISZ A;  4ETZ A;  2XY5 A;  3NBP B;  4AE5 A;  4DUY J;  1WKK A;  3NEK A;  2XWY A;  4F4A A;  1QVF R;  2R9L A;  5ADZ A;  2HIY A;  2MQN A;  3FVY A;  3MMA B;  3NRB A;  3SFU A;  3W9I A;  4DR2 J;  2MKC A;  1UEK A;  5GAG I;  4FYW B;  1J27 A;  2Z2Y B;  1HNX F;  2PO4 A;  2YKP A;  4WU3 A;  4DL3 A;  1T05 B;  2GQQ A;  1CG2 A;  2M7S A;  3PDN A;  1VBZ A;  2YQ3 A;  1P8G A;  3K17 A;  5SZT A;  3MMB B;  4QQB A;  3QSI A;  2AYE A;  3KLV A;  5GMK a;  1LQ9 A;  3THP A;  3HJV A;  3IBW A;  1K1S A;  5K8O A;  4USK A;  3W65 A;  1O6X A;  2KO1 A;  4AQY F;  4DI6 A;  2BM0 A;  4CLS A;  3W5Z A;  3TNV A;  5F3Z A;  4Y0F A;  3LPY A;  2B4P A;  4EGL A;  1VMB A;  3R1H A;  4DR6 J;  3KLE B;  4RZR A;  4BC9 A;  3BO4 A;  2UUB J;  2M52 A;  1GMW A;  2R8H A;  4LF9 F;  4X4U A;  3NOG A;  4FKX A;  3L7P A;  1FJG J;  1FFG B;  3DDI A;  4NLR A;  4OHZ A;  2FLP A;  2QGF B;  2QIF A;  1RWO B;  3G87 A;  2HHH F;  2WOM A;  1JJH A;  5KT2 A;  4DQR A;  3M7V A;  1NSP A;  5D0R A;  4AL7 A;  1KON A;  3SSR A;  3AJD A;  4JP8 A;  4ZCK A;  3OLB A;  1X0P A;  3L9Z A;  5DLF A;  3PVX A;  2E5L F;  5KFG A;  4N8O A;  1T3N A;  2J6U A;  3OFE A;  4Y00 A;  1ZAW A;  3JQK A;  1IQT A;  5HVG A;  4BC7 A;  1P9Y A;  5DRK A;  1UFL A;  3GIK A;  3V6D A;  3T1H J;  2BJ9 A;  2XQC A;  1Q16 B;  3WX8 A;  1S1W B;  2B5J A;  4QYZ J;  2XHC A;  1KQG B;  1FJ7 A;  3W9J A;  1G3O A;  3CVK A;  3HVA A;  3R2C J;  4R0J A;  4NCG A;  3UW1 A;  4CLW A;  2AEM A;  5J1E B;  2VKR A;  4MAK A;  2WHO A;  4N47 A;  3ETO A;  1NPK A;  3T1A A;  3HHL D;  3TA0 A;  1Q1K A;  3KK1 B;  1VK3 A;  1PIL A;  3N01 A;  1LXN A;  4Q2L A;  4JI2 J;  1K0T A;  3MUM P;  1IBM F;  2ZE2 B;  4YR3 A;  2CQD A;  1JLQ B;  3R5D A;  1UWA A;  2H51 B;  3W2V B;  1ZM2 A;  2EFP A;  4WZM A;  1W25 A;  2HBR B;  4WCE Q;  1T05 A;  2DIU A;  1YJT A;  5K5M A;  4P2M A;  1Q78 A;  5LSO A;  2GAH C;  2R7U A;  1PJ5 A;  1NJZ A;  3P5B P;  2KG1 A;  1ZA1 B;  4DN0 A;  1S4F A;  1SCJ B;  3CJS A;  3H0P A;  1GMW D;  4ID5 B;  4ZPV R;  1KHW A;  1RAB B;  3CDB A;  1IBM J;  1N36 F;  3MAA B;  1URN A;  4EI2 A;  3EZU A;  3QSY B;  4YB6 A;  2Y0S D;  4CM2 A;  2HHT A;  3EIC A;  5I42 A;  1QE1 A;  2D1C A;  1WI6 A;  1KEK A;  3ZFV A;  1XMQ J;  1P1L A;  2A2D A;  2FDN A;  2BE2 A;  2VAS A;  2VQE F;  3TZZ A;  3CCM S;  1YHQ S;  3RR8 A;  4V19 X;  1N6Q B;  1IKV A;  4DR4 J;  3CJT A;  4LSL A;  1HPZ B;  2E1A A;  4ZMM A;  5KT6 A;  3WC2 A;  2CNN B;  1TMM A;  2IRY A;  5ETP A;  4ZS6 A;  2DYA A;  2IHR 1;  3SCL E;  3UFC X;  1L3U A;  2OPS A;  1TL7 A;  2B9E A;  4ED0 A;  4C3M A;  4WIQ A;  3BGF A;  5DDR C;  1UVJ A;  4QU7 A;  3FDS A;  5KFL A;  4ERD A;  2BOP A;  1JXL A;  3R3T A;  1SJR A;  2DHS A;  2EFN A;  3EUN A;  1PJ7 A;  2U1A A;  3I4H X;  5KFJ A;  4DQP A;  1EJ7 L;  1VOM A;  4I1T A;  2RU3 A;  1MMD A;  1QY7 A;  1RKI A;  2BRL A;  2NXJ A;  3FEZ A;  4M63 A;  3TVK A;  1KLN A;  4JI7 F;  2JC0 A;  3LP1 B;  4WZQ A;  2CJQ A;  1HMV B;  2XG8 A;  4O0I A;  2HND B;  1KNZ A;  4WE1 B;  2HVH A;  2LLZ A;  4DX8 H;  4JV5 J;  2IJN A;  4DUZ F;  4KRW A;  3G4S S;  3LGH A;  4X65 J;  3GMG A;  2K8G A;  1H2T Z;  2RML A;  3OR2 B;  3QGH A;  1AXQ A;  4CNZ A;  5F8L A;  2FJV A;  4B3R F;  3C66 A;  1EX8 A;  4PG8 A;  1NB2 A;  2HLT A;  5FJ4 A;  2M0G B;  3KHL A;  4NLD A;  2MTL A;  3NP5 A;  1LKZ A;  1WOS A;  2XSJ A;  1FE4 A;  3EPI A;  4OI6 A;  3IWL A;  2XMK A;  2KJV A;  2DTJ A;  2B56 A;  1W2B R;  3E3X A;  4OYA A;  3IBC B;  4A4J A;  2DHA A;  1EB0 A;  2XMT A;  1B7Y B;  3MMC A;  5DG9 A;  5B0F A;  1AT1 B;  2PA3 A;  4HDG A;  2BYC A;  3ZZT A;  2XB2 D;  2J76 E;  4CH1 A;  3OBI A;  4A8W A;  4K0K J;  2V2V A;  4P73 A;  1U1L A;  1ELO A;  4DL7 A;  3QJJ A;  4EZ6 A;  3QJL A;  2WVD A;  2H4W B;  3QT5 A;  3J7A 1;  2MKI A;  4C8N A;  2QL7 B;  2MKY A;  1FNM A;  3AAW B;  1VJQ A;  1JLB B;  3JXO A;  2HZV A;  5D4L A;  4M1K A;  4OYO A;  2NXN A;  2XMJ A;  4WP3 A;  2KI2 A;  2XMV A;  1FDB A;  1TL7 B;  2G2O A;  2CDR B;  2ZWO A;  2V4R A;  4NYZ A;  5GAE I;  5KTQ A;  1HNW J;  4DSI A;  3FCH A;  4LSL B;  2P9E A;  4FF3 A;  2ZNY A;  4PWU A;  4DG1 A;  3G6V A;  2HFZ A;  2O5D A;  3MR3 A;  3UO0 A;  1ZAV A;  1FKA F;  4MTP A;  2LFV A;  2RIJ A;  2ASJ A;  1X4D A;  2YPY A;  2VQF J;  1G1X A;  3HZG A;  2P5V A;  7FDR A;  4ECU A;  1RHM B;  3PHE A;  2LDI A;  3V81 B;  1UA1 A;  4N77 A;  4WP9 A;  3PX6 A;  1RTH A;  2PC6 A;  1R8P A;  3I9V 9;  3L7O A;  3KG4 A;  2W4D A;  2JZ5 A;  4LIW A;  4WFX A;  5ETN A;  4DX5 A;  5IT0 A;  3MPV A;  4CO1 A;  3BDP A;  1XNR J;  1GT8 A;  3I96 A;  1DQA A;  1Q5Y A;  3RR7 A;  1XTZ A;  1RYR A;  3BBB A;  4CDI A;  3MXH P;  2EPI A;  2OUG A;  3A3O B;  3HT3 A;  2GCF A;  3T41 A;  2JWN A;  1RBA A;  3MEG A;  1IWG A;  3Q0A A;  4HH0 A;  4RUA A;  2R8K A;  4B3S F;  5DET A;  2QL5 B;  1RWN B;  3AQO A;  2W7A A;  4ZPA A;  1F6T A;  1LWX A;  3DU5 A;  1HR0 F;  4Q8E A;  3FCV A;  3GJR B;  4ILR A;  3V6D B;  4LFB F;  1ARO P;  1VFJ A;  4ECS A;  4ZCM A;  2Z2Z A;  4A8X A;  4QWC A;  1RWK B;  4C0H A;  4K7Q A;  2BAB A;  2BRK A;  3TAQ A;  4LBP A;  5D6G A;  3GU0 A;  2BJ7 A;  3RBD A;  1WHY A;  4NCG B;  1VQN S;  1X4A A;  3LGM A;  5C25 B;  4OYP A;  5GMD A;  1NCL A;  2JSX A;  5HJX A;  5HQ8 A;  1ACM B;  3W2W A;  1QUP A;  3KWM A;  1C0U A;  5AXN A;  4MKV A;  3OVS A;  1GNK A;  4CT8 A;  2GA7 A;  4B3T J;  4FYV B;  2BA9 A;  1HL6 A;  3OVB A;  1WSR A;  3UDL A;  2DVI A;  3ONQ A;  2E1P A;  1NJX A;  1HQE A;  3AOA A;  2OFH X;  2DGS A;  2IAJ A;  4OMF G;  4B17 A;  1FVQ A;  1Y5N B;  1SH3 A;  1CQN A;  1R7I A;  3MED B;  1BGX T;  1HNI B;  1JLC B;  5CH7 B;  3PKM A;  3GZ7 A;  1WG5 A;  2ZHO A;  3BBF A;  2BE2 B;  2YNH A;  3AJ2 A;  2BBE A;  4DV5 J;  1KQS R;  1MW7 A;  4GKK F;  2DGT A;  5KFI A;  2P6T A;  3PY8 A;  1FWP A;  2MQL A;  3VAL A;  5KFK A;  4MKY A;  2AEJ A;  1QUV A;  2ZNZ A;  3OPK A;  1VIO A;  2I0X A;  2BKP A;  3I0S A;  1S6Q A;  4RO0 A;  4CT9 A;  3UN2 A;  2VHG A;  4ILL A;  3SV4 A;  2BJD A;  1XMO F;  4M5M A;  1HNV B;  1Q8B A;  3WHI A;  4ZN1 A;  4O4G A;  2YKN A;  3PEH A;  5KFE A;  3TAR A;  2RDJ A;  2ZVS A;  1JNZ B;  1SXL A;  3I6P A;  1L3K A;  4NML A;  3KLE A;  1DZ5 A;  1RTI A;  4ZPW R;  4CO5 A;  1IM4 A;  1YVF A;  3PRB A;  3RB3 A;  3HHL A;  3ZZU A;  3PX4 A;  5B0A A;  3HUL A;  3FBE A;  4P2S A;  4ECW A;  3DLL Q;  4ZPD A;  4WTO B;  3KMQ A;  2N3L A;  2KT2 A;  1H72 C;  1Z2Z A;  3MM9 A;  1IBK F;  2C2E A;  1D9D A;  3FBB A;  4IO9 Q;  4Q7A A;  3CJQ A;  1A0O B;  1KWM A;  4G1I A;  3PM9 A;  3P45 B;  5CD4 H;  3V6J A;  1ZTW A;  1XMO J;  2QRR A;  2C28 A;  2UVU A;  3Q8Q B;  3EGZ A;  3QT8 A;  3SYZ A;  2F8E X;  2KVI A;  2BJE A;  1RAH B;  3VGU A;  4B3M J;  3AOC A;  4PG5 A;  5F8H A;  3MMC B;  4B02 A;  2ROE A;  4S0M A;  4JOU A;  3JB9 k;  2BOA A;  1I94 F;  2HMI A;  4XDD A;  1JLE B;  3NLC A;  3AXM A;  2ADB A;  1CVJ A;  3AOD A;  1PAU B;  2BE9 B;  3EJM A;  3A3N B;  3QO9 B;  1YJN S;  3QQC D;  4LRB A;  4Q0B B;  3KJF B;  4L73 A;  5CYQ B;  3R7B B;  4HHH A;  4FP9 A;  4IR9 A;  4MKA A;  4KPY A;  2HQG A;  3FMW A;  3K59 A;  1FNX H;  2QC3 A;  4TQS A;  5JVG Q;  1NK5 A;  1OIA A;  1JLC A;  3M8R A;  4XPE A;  2Z2L A;  3HCX A;  2DNG A;  2YY3 A;  4I56 A;  4ZCL A;  4J9S A;  2KHD A;  3IXQ A;  2JLE A;  5J2P A;  3HJF A;  3RAX A;  3G2X A;  3R6G B;  4WF9 Q;  3HLU A;  4CM0 A;  2V68 A;  2FTR A;  4FDF A;  2JX2 A;  3A8E A;  1AW0 A;  1IXK A;  3N6L A;  3UQS A;  2V5H G;  2CRL A;  5MAO A;  4DV0 J;  5K8M A;  1TK5 A;  3F44 A;  4NLQ A;  4Y2M A;  1VR6 A;  5KFZ A;  2YWE A;  3M9N B;  3Q8Y A;  4JI6 F;  1FA0 A;  2MJN A;  1HNW F;  2AJ0 A;  4DX7 A;  3C16 B;  4UZB A;  4IH6 A;  2KTQ A;  3QBC A;  3N0V A;  4LRA A;  5E5N A;  4CZC A;  2MKK A;  2U2F A;  5HAN A;  3BGR B;  1M5H A;  2AWZ A;  1E6Y B;  1QAX A;  2HZC A;  2HWI A;  3PO4 A;  4NYO A;  4JI4 J;  1T7P A;  1VI7 A;  2ZC4 A;  1TKX A;  1CEZ A;  3VGV A;  2OD4 A;  5J2N A;  1IR2 A;  3KNA A;  3V81 A;  2O3D A;  4RLE A;  1TKT B;  2XYG B;  4TYA A;  2KZM A;  2MEW A;  3H2V E;  3H5X A;  3TYT A;  2M9K A;  4DF4 A;  3MGJ A;  4IDK B;  1IN0 A;  2KH9 A;  2RE1 A;  2KHC A;  3MDF A;  2DPJ A;  2HNZ B;  2BR0 A;  1S1V B;  2XLK A;  1RT4 A;  2FLO A;  5D0G A;  1TKX B;  4OQJ A;  1DY3 A;  4NI2 A;  2YTC A;  4QIV A;  1B7F A;  1S79 A;  2D9P A;  2NS1 B;  4DMZ A;  1F9E B;  2GC8 A;  3DOM A;  4OLP A;  4ED4 A;  3MUR P;  4XPC A;  2BW7 A;  4I2Q B;  4MK7 A;  2CJB A;  2KN4 A;  3DRR B;  5KFN A;  1KVK A;  4KHM A;  5MLC V;  2R8J A;  2PI4 A;  3MM7 B;  1YI2 S;  4ILM A;  4P7V A;  1XBW A;  3V4M A;  3B4D A;  2IDL A;  2AF6 A;  3SSQ A;  3FRZ A;  2ZKU A;  4G1Q B;  4B9M A;  3C2P A;  4ZIW A;  1M1H A;  1OY9 A;  1DTQ A;  3I31 A;  4B3O A;  4DX6 A;  4ZIV A;  3D67 A;  3AFG A;  5A76 A;  4AL5 A;  4YHH F;  2D3Z A;  1JWW A;  3IS9 A;  2H3E B;  4USW A;  3D4J A;  4OI1 A;  3KK3 B;  2YKO A;  3UD3 P;  3DRP B;  5F8M A;  2CQG A;  1FXR A;  2ASD A;  4PZV A;  2E7V A;  2E1M C;  1NND A;  4K5S A;  4M5H A;  4PYA A;  4ZKA A;  1XC9 A;  1VQK S;  1PBU A;  4BWJ A;  2UXB J;  4CWB A;  2RDD A;  2CWX A;  3AD8 C;  2E7W A;  4USI A;  4A8M P;  3V6H A;  1OSC A;  3W2W B;  2AV5 A;  1RWV B;  1XN9 A;  2OEM A;  4AFF A;  4C11 A;  3MD1 A;  4L76 A;  2HHS A;  1QAJ A;  1WNE A;  2XZT B;  2LEA A;  5KFM A;  4DF8 A;  3CDU A;  1HW8 A;  2J9D A;  3MMJ A;  2GQC A;  3MPU B;  4X4O A;  4DV5 F;  4GKK J;  2PN6 A;  3KDN A;  2VOD A;  4Z2X A;  5CAA A;  4M5G A;  2K3K A;  2WVB A;  1VQM S;  1D09 B;  1XQI A;  4JUZ A;  4NEZ A;  1DRZ A;  2J0W A;  1Y0H A;  4CLY A;  3RAM A;  2A1B A;  2MKS A;  3Q22 A;  2GV1 A;  5AJ3 F;  3D28 A;  3HMJ G;  4OYB A;  3Q8P B;  1FEH A;  3SCK E;  5T7L B;  3R1L A;  2ZD1 A;  5A8K B;  4RR5 A;  5KFQ A;  4DR7 J;  4DV3 F;  1TKZ B;  1WG1 A;  1EZZ B;  5LM7 E;  5IM0 B;  1OYE A;  2V2Q A;  2O01 C;  2WSE C;  3A13 A;  1ZM3 A;  2BW2 A;  4UUX A;  2K2P A;  1ZAX A;  1RTI B;  2H9Z A;  4URG A;  5BR8 J;  3HXM A;  4FF2 A;  1NAQ A;  4KHR A;  2RH3 A;  3OL7 A;  4TNO A;  4P72 A;  2DNH A;  1YJV A;  5CZX A;  3BN4 A;  3LWM A;  3K5P A;  4M5N A;  3OTB A;  4K2X A;  4CQ1 A;  5EGY A;  2MLZ A;  1J2V A;  1Q53 A;  5F0W A;  5KG6 A;  2FB0 A;  4IO1 A;  1FF2 A;  1PIE A;  3PXG a;  1NK9 A;  2XNR A;  3LP1 A;  3SSS A;  5HRO A;  1O51 A;  2VPX B;  1LW0 A;  3GSD A;  2B51 A;  2CPH A;  2V9K A;  2AEF A;  4A8O A;  4G1Q A;  4DZD A;  1CUL A;  1VQ8 S;  2BE7 D;  4JI0 J;  2LQJ A;  3OTE A;  1U1M A;  3TZW A;  2VBX A;  4DV3 J;  4YUD A;  4Z37 A;  3CDE A;  3PO5 A;  2HQF A;  1HW9 A;  3MM5 B;  4ZLN A;  1IBK J;  2B3T B;  1LW0 B;  2HRY A;  1DHM A;  2MMY A;  2Q1L A;  3I0R B;  4F8R A;  3THV A;  4Q8F A;  1BC6 A;  2B43 A;  2OML A;  1WTB A;  4ZVR B;  1NK4 A;  2RKI A;  2WAQ D;  2OMO A;  4LVO P;  3D1O A;  4QBU A;  2CYY A;  4J5O A;  4QYZ K;  1Q7L B;  4RUH A;  3DI6 B;  5KFD A;  3EZ5 A;  3EE3 A;  4RW6 B;  4A8K A;  4L75 A;  3M32 B;  1WKL A;  1JNR B;  1GXU A;  2F3J A;  3H7H B;  5B0C A;  4QWE A;  3Q8S B;  4JV2 A;  5HLF A;  1UA0 A;  2DH9 A;  3RGI A;  2CJY B;  2UXC F;  2QE5 A;  1XIQ A;  2AYM A;  3J81 Y;  3GP9 A;  1KS2 A;  2QMU B;  3IBF B;  1H73 A;  1W2I A;  1WSV A;  4M5D A;  2M4M A;  3BBC A;  2HWH A;  5L1J A;  3BN7 A;  1R3N A;  3SIP B;  2FGC A;  2NXU A;  3BRE A;  5AXM A;  2AMC B;  2MGZ A;  1UW9 A;  3KG0 A;  2PT0 A;  3BEG B;  2Y9H A;  2YWK A;  2YWH A;  1RAC B;  2P6S A;  3MCM A;  2FVS A;  3VAM A;  1RU2 A;  1TQL A;  3MEE A;  1UPM B;  4NLV A;  4O3O A;  4QIG A;  3P5T L;  1RT2 B;  4EUV A;  2CJ9 A;  4I2P B;  2DNP A;  2FJA B;  1TL4 A;  1HYS B;  3O2I A;  4B3S J;  1UKU A;  3CUN A;  3BSN A;  8AT1 B;  4CTA A;  4AXI A;  4PXC A;  2E9R X;  3RB6 A;  1RT4 B;  2RNE A;  1A7G E;  2JL9 A;  2GJI A;  4NX9 A;  2RS2 A;  2KU7 A;  1I5O B;  2ZEJ A;  4FKY A;  4HAC A;  1S0N A;  2W9B A;  4DS4 A;  3EXY A;  4W4M A;  3H59 A;  2F4V F;  4Y65 A;  4JI2 F;  3D3B J;  4LVN P;  2AD9 A;  2XEX A;  1NKB A;  5A2Q Y;  4IFV A;  1HFE L;  4O44 B;  2HHH J;  2IVY A;  4O4R A;  3C46 A;  2GO8 A;  4DSJ A;  4X64 F;  5DDO C;  1FRH A;  4NLY A;  1JLF B;  1U48 A;  5M2R A;  4ZPB A;  3TEG A;  2ATL A;  3HK2 A;  3KUG A;  3F73 A;  3T6J A;  2EKY A;  5L46 A;  3CCV S;  3T3F A;  4P2F A;  3OSP A;  2DHH A;  2FVC A;  1RBL A;  2ZUG A;  4OX8 A;  1N36 J;  3U1N A;  2ZVI A;  3EZO A;  5HBM A;  3TWZ A;  1RA6 A;  5THW A;  2M8H A;  3O8W A;  3H5Y A;  1RJJ A;  1GFW B;  1KFD A;  5AE2 A;  4J9R A;  3MOJ B;  5SUH A;  1HQU A;  4TY9 A;  3OLA A;  2IJF A;  3GPA A;  4DR3 F;  1U25 A;  2ROG A;  2XTJ P;  4GVB A;  2NPI A;  3CJ0 A;  4J9Q A;  5HQL A;  2DPI A;  4OI0 A;  2B4U A;  1M1G A;  3FSX A;  2QSW A;  2LKZ A;  2YQ1 A;  4I7F B;  1KHV A;  3GR0 A;  1JKH B;  1R6Y A;  4PAA A;  1AB8 A;  1S7H A;  3RRH A;  3KNG A;  4A8Y A;  1BQX A;  2XMM A;  5L1K A;  3S1T A;  1FTC A;  1WG4 A;  1KTV A;  2W2Q P;  2WW4 A;  3ZZP A;  4Q0B A;  4LSN B;  3VQS A;  3BYP A;  3U1M A;  3CCT A;  2HS0 A;  9ATC B;  3ELH A;  2MZT A;  1N4L A;  5KFW A;  1BQM A;  4RBU A;  1PBA A;  4NRU A;  1U6F A;  2PII A;  4L72 B;  2HW3 A;  3LF0 A;  1KQF B;  1Y4Z B;  4NLS A;  4GVL A;  2KVQ E;  2YNH B;  4QU6 A;  3HD2 A;  1QAY A;  2A18 A;  1CC7 A;  4N41 A;  3CD6 S;  2PA8 D;  3LH2 S;  2AQ4 A;  1HYS A;  3VWS A;  1XNQ F;  2CAD A;  4P7T A;  3CJ4 A;  3QFW A;  5EHH A;  4N5S A;  4RU2 A;  2AW0 A;  3IRX B;  2OTL S;  4M95 A;  5BR8 F;  2Q79 A;  3MR5 A;  2BDP A;  5F8G A;  4GKJ J;  2OPR B;  1CQM A;  3MM8 A;  3VAK A;  1NJY A;  5AT1 B;  2AP6 A;  1OJ4 A;  2E44 A;  1WAC A;  2AX1 A;  3DN9 A;  3JSR A;  4C48 A;  2KKH A;  4QR1 A;  4RW7 A;  3L95 X;  1O5J A;  1BQN B;  3NCP A;  4U9R A;  2XLI A;  5LT5 A;  3CF5 Q;  4UY8 T;  2MB0 B;  1B0P A;  3HKW A;  3EMT A;  3M8P A;  5LXR A;  2MZ1 A;  1VRU A;  1C1C B;  1WI8 A;  1FJG F;  3DCA A;  1YKW A;  4H4M B;  1T8E A;  2NXE A;  2VV5 A;  1S97 A;  2FVR A;  3TUP A;  2FJB B;  3DOM B;  3HSG A;  1NSK L;  4MKB A;  3CJK B;  2HAI A;  4ETX A;  5KFB A;  2WOM B;  1C4C A;  1MRO A;  5KFY A;  4UQG A;  3TUJ C;  3CCR S;  2JNJ A;  4DN9 A;  1WEL A;  4Q45 A;  3KLG B;  1ZZN A;  2V0N A;  2MHN A;  1M5O C;  5DGA A;  4OX9 J;  2RF2 A;  3SCJ E;  3OR1 A;  2V67 A;  2V9W A;  3QRQ A;  3ZZZ A;  3AB4 B;  4IFY A;  1QD1 A;  4IUF A;  2EKN A;  2B4V A;  2YWG A;  3G86 A;  3W66 A;  3MD3 A;  1S6P A;  3ET6 B;  1JLA B;  5FLX U;  1YJ7 A;  2UV8 A;  3M6U A;  5L39 A;  1GX6 A;  1PO6 A;  3AD9 C;  1IR1 A;  2UXD J;  3D6M B;  5RUB A;  3JAM U;  3OR1 B;  4DHV A;  2OLW A;  3JTP A;  2CNL B;  3GII A;  4NLG A;  1FRL A;  3CC4 S;  1REV A;  3CDA A;  4RW4 B;  2A0F B;  1IBC B;  1I3O B;  1LWC B;  2IFX A;  2JLF A;  3ISN D;  1Y3K A;  3HFZ B;  3K2Y A;  4UOH A;  4WK3 A;  2VPW B;  3E8O A;  4JYA J;  3GG0 A;  1F60 B;  2UXD F;  2HGL A;  4JI1 J;  2IAJ B;  1L3S A;  5ETT A;  1X4H A;  2P9G A;  2WW8 A;  2ZH6 A;  2WVE A;  3MFH A;  2VOO A;  2DCL A;  5DG7 A;  1WC5 A;  1UFK A;  1HI1 A;  2RD5 C;  3M2U B;  3DLG B;  3UVJ A;  2IM1 A;  1UWB B;  1I6J A;  1U1Q A;  1DQ9 A;  1NM2 A;  2IA0 A;  1HWU A;  3MTK A;  4A8Q A;  5K8P A;  2Z8Q A;  1FK9 A;  5CA5 A;  1CS4 A;  4F0K A;  2R8I A;  2HVE A;  2VA2 A;  4ED3 A;  2R7R A;  4IR1 A;  2FHJ D;  4IG0 A;  3RU0 A;  1YRT A;  2Y3Y A;  3IR7 B;  4URS A;  4BBY A;  1TVR B;  3M8W A;  2W9B B;  3PEJ A;  3GQC A;  3OUY A;  4EBC A;  1U0H B;  3MR6 A;  1C0T B;  1OWX A;  2GS8 A;  1RWM B;  5HVF A;  2J6S A;  1YWX A;  3G71 S;  1GMV A;  2XLJ A;  1YDL A;  1O0P A;  3QFH A;  3I9Z A;  2W01 A;  5HK4 A;  2F9J A;  4IG0 B;  4O44 A;  2NQP A;  4DSK A;  1CJU A;  4RNN A;  1NSQ A;  1M5K C;  3TX0 A;  4WE1 A;  1KOH A;  2DRA A;  2EFV A;  3M2V B;  3ZTS A;  1WC1 A;  1KN6 A;  4PG4 A;  1JLG B;  3T1Y F;  1RWU A;  3O6Q A;  3P96 A;  1JJ4 A;  4V19 J;  1FE0 A;  2LU1 A;  1N48 A;  2FHJ A;  2RRN A;  4OHW A;  2CJK A;  3CT9 A;  2G0I A;  4IG3 A;  3AOB A;  5KG3 A;  3B6B A;  4KT0 C;  3J81 j;  2FC8 A;  4R8U A;  3FKB A;  2HEK A;  2NZC A;  5J2M B;  2CQP A;  3BM7 A;  1PGZ A;  3KHG A;  2QEX S;  3D0H E;  2HWT A;  2C2M B;  5IC6 B;  3ZTP A;  1KDN A;  2ILY A;  3M6X A;  2MZJ A;  5HL7 Q;  1HR0 J;  2B9Y A;  2NPF A;  3LAM A;  5KOW A;  3DLE B;  3R6L B;  1GTE A;  3BH6 B;  3IA0 A;  4ZP8 A;  3S01 A;  3CXC R;  4I69 A;  3T1Y J;  4PR6 A;  2VU5 A;  1SB6 A;  4YQW A;  4IRK A;  3JQM A;  3JTN A;  3Q83 A;  3K57 A;  2BAC A;  4E2F B;  1R8H A;  3CIZ A;  1CJV A;  2YNI B;  3MI7 X;  3CME S;  2IRU A;  1RSC A;  5B0E A;  1QDU B;  2UVV A;  4X4N A;  4KTQ A;  1B4S A;  1XMQ F;  4E98 A;  1N5Y A;  5KFS A;  5A8W A;  3UCU P;  2L9W A;  4F4K A;  1RZM A;  3IGN A;  2R2R A;  2AT1 B;  2KYX A;  4DOZ A;  1APS A;  2RSQ A;  2RQC A;  1BLU A;  4CLU A;  1VK8 A;  2KDO A;  2VDH A;  2WSC C;  1MU2 B;  4WFY A;  5I42 B;  1B0V A;  1OQ3 A;  1QE1 B;  2DGO A;  3M05 A;  1KRP A;  1VHI A;  3UDE A;  1KVI A;  2H4Y B;  1SC6 A;  4Q2M A;  2G1D A;  6FD1 A;  3OL9 A;  2XWX A;  5EUH A;  3I82 A;  3OJU A;  5IXU A;  2EI5 A;  2RQ4 A;  3MCN A;  3W8G A;  2R2U A;  2GX8 A;  2ZZT A;  2MXY A;  2K7K A;  2CZ4 A;  4O23 A;  4USV A;  5CQG A;  2JRS A;  2AGO A;  1CC8 A;  4JI8 F;  1F3F A;  1RGV A;  3CCU S;  4I6W A;  4QR0 A;  5ETS A;  3UR0 A;  1S1U A;  3IAM 9;  2NUH A;  1U0H A;  2ZJQ Q;  2C2Z B;  2XY6 A;  4WTY A;  4ID8 A;  1GK8 A;  1HD0 A;  2H54 B;  3QGG A;  3MEC A;  2W9C B;  1RYS A;  3Q86 A;  3LPE A;  2XO7 A;  1U02 A;  1YIT S;  1XEZ A;  3G6Y A;  2DKO B;  4C9D A;  3Q89 A;  1URR A;  1HMV A;  3W60 A;  4DPW A;  1TL1 B;  3LOU A;  3GG1 A;  2Y8Y A;  4QIW D;  2FZC B;  2HHP A;  3H40 A;  2BVZ A;  1TV6 A;  4NLX A;  2VFT A;  5E41 A;  4MYU A;  2NXC A;  3CMA S;  1QTM A;  4F02 A;  5KAK A;  3MM9 B;  3DGP B;  2HND A;  5DQG A;  4I68 A;  3LAN A;  4F2S A;  2FGO A;  3BH7 B;  1X4G A;  3PRV A;  3EM1 A;  3GFZ A;  3M2R B;  4NL5 A;  1V9O A;  2XZW A;  4ES3 A;  2W2M P;  5ITH A;  4Q43 A;  2UXC J;  4LIR A;  2EK6 A;  3GON A;  4KBI A;  3G6E S;  1R89 A;  4QIF A;  5K14 A;  1MN7 A;  2KYZ A;  4DSL A;  3VAJ A;  2KRR A;  2AJ2 A;  4GVB B;  3FK4 A;  4AYB D;  5L9N A;  1WF1 A;  2ZH4 A;  4X4P A;  4LF6 F;  2C22 A;  1T94 A;  2DY9 A;  1S48 A;  5KG1 A;  3VF0 B;  1C1B B;  1HNI A;  5AE1 A;  2HQ3 A;  4DPO A;  2PD1 A;  4DSE A;  3PR4 A;  1RAG B;  1LWE B;  3OD2 A;  4WYL A;  3WX4 A;  1HQE B;  4P10 A;  1H0H B;  2DRD A;  2ZJP Q;  4OI2 A;  5E3R A;  3S8S A;  2E5L J;  4G3I A;  1FKP B;  1UVK A;  4QOT A;  1RXO B;  4LR8 A;  2W4P A;  4FYX B;  3QGI A;  4QIE A;  2Z56 B;  5C2C A;  3IR5 B;  3PFE A;  2DY1 A;  2DGV A;  1RHJ B;  1Y5L B;  2DXF A;  2F9D A;  5A2Q U;  4HYK A;  4WBF A;  4ED7 A;  2GIR A;  4B9N A;  1KVJ A;  3FBC A;  4LFC F;  2ZH7 A;  1FDA A;  2VG7 B;  4I64 A;  1OS5 A;  4EU0 A;  3U1L A;  4IKA A;  4ED2 A;  1N5V A;  4OZJ A;  5IT9 Y;  5D4P A;  1IM6 A;  1T95 A;  2BX6 A;  2CQ2 A;  2NSC A;  3BSA A;  1B0T A;  3IM9 A;  4K8R A;  3NCR A;  3DM2 A;  1KQK A;  4A8S A;  1MG7 A;  4CLT A;  1HWL A;  2JC1 A;  1AUD A;  2M5Y A;  2LU2 A;  2M70 A;  3SFG A;  1SUQ A;  1NBE B;  4TXS A;  2AYG A;  1VDH A;  2L9D A;  2LCW A;  1SH2 A;  3L3C A;  2Q3P A;  2J6T A;  1UW4 A;  1L5U A;  2QYC A;  3UNY A;  4MK9 A;  2YKQ A;  4PXE A;  2C2R A;  4CP5 A;  1J5O B;  1B3T A;  4Z7C A;  2MDA A;  4RBT A;  4ECX A;  1FNO A;  1N52 B;  3FZB A;  4NLT A;  3CE8 A;  3DC2 A;  2OHD A;  2FYX A;  4DV2 F;  1FT8 A;  3G82 A;  1T9Y A;  1HA1 A;  5D4N A;  4F67 A;  4TVA B;  1VQ5 S;  4NZ7 A;  4NXN F;  2E9T A;  3L7U A;  5E3A A;  4HT5 A;  4ZIT A;  4O3P A;  1CLF A;  2DK2 A;  3LA0 A;  3ZZO A;  1EQ0 A;  1VGY A;  2RIL A; 
#chains in the Genus database with same CATH homology
 1NUE A;  1S5Z A;  1BE4 A;  1NSK L;  1LWX A;  1F6T A;  1ZS6 A;  1HHQ A;  3EE3 A;  1PAE X;  1WKL A;  3FCV A;  3VGV A;  3EVM A;  1NDK A;  1XIQ A;  3EIC A;  1PKU A;  1MN9 A;  3GP9 A;  2NCK L;  1VYA A;  3NGT A;  3BBC A;  4C6A A;  3FC9 A;  1HLW A;  4KPC A;  1F3F A;  3ZTR A;  4UOG A;  1NCL A;  3EVW A;  2AZ1 A;  1BHN A;  3B54 A;  2DYA A;  3Q86 A;  2AZ3 A;  3Q89 A;  4UOH A;  3NGR A;  1S59 A;  1HIY A;  3BBF A;  2B8P A;  3NGS A;  5BXI A;  1BUX A;  4FKY A;  1W7W A;  1U8W A;  1WKK A;  3BH7 B;  3VGT A;  3PRV A;  4F4A A;  4DZ6 A;  3EM1 A;  2DXD A;  3JS9 A;  4HR2 A;  3DKD A;  4DUT A;  2CWK A;  1NB2 A;  1EHW A;  1UCN A;  5C7P A;  1JXV A;  2HVE A;  1MN7 A;  3VVU A;  1S57 A;  3FCW A;  4AND A;  5CAA A;  2DY9 A;  1XQI A;  4DI6 A;  4UOF A;  3PJ9 A;  3VVT A;  3FBE A;  3GPA A;  4F36 A;  2B8Q A;  3ZTQ A;  3ZTO A;  4FKX A;  1NSQ A;  3FBB A;  4ANE A;  1K44 A;  3ZTS A;  5IOL A;  2DXE A;  3DDI A;  3MPD A;  3R9L A;  3VGU A;  1LEO A;  2DXF A;  1WKJ A;  4WBF A;  2HUR A;  1NSP A;  3FBC A;  2HVD A;  3B6B A;  3FKB A;  4S0M A;  3ELH A;  2BX6 A;  3ZTP A;  1KDN A;  3EVO A;  3EJM A;  3WX8 A;  1NLK L;  3BH6 B;  2ZUA A;  1NDC A;  1NHK L;  2VU5 A;  4O0N A;  5CAB A;  3FBF A;  4CP5 A;  3Q83 A;  4EK2 A;  1NDP A;  3G2X A;  3ENA A;  3Q8U A;  4ENO A;  1NPK A;  3VGS A;  2BEF A;  1B4S A;  3Q8V A;  1NDL A;  3L7U A;  3Q8Y A;  3NGU A;  3ETM A;  4ANC A;  3EMT A;  3BBB A;  4W98 A;  1B99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...