2HVDA

Human nucleoside diphosphate kinase a complexed with adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
b'ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase A
publication title Crystal Structures of S120G Mutant and Wild Type of Human Nucleoside Diphosphate Kinase A in Complex with ADP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hvdA00
3FBBA 5BXIA 1LEOA 4EK2A 3MPDA 4KPCA 2BX6A 3FBFA 3L7UA 1EHWA 1MN7A 3FCVA 1F6TA 4FKYA 4W98A 1U8WA 3GPAA 5IOLA 3JS9A 4UOHA 2DXFA 3Q8UA 4S0MA 3ZTSA 3EM1A 1PAEX 4C6AA 1S5ZA 4HR2A 2HVDA 3B6BA 2DYAA 3FBCA 1KDNA 1NCLA 1BHNA 3ETMA 3PRVA 1S57A 3DKDA 3Q89A 1JXVA 1XQIA 1NDLA 4ANEA 2B8PA 1WKKA 2B8QA 4DUTA 3VVTA 1HHQA 3VGSA 3BH6B 2DY9A 3PJ9A 3DDIA 1BE4A 4ANCA 3B54A 1ZS6A 3VGTA 2HURA 3EMTA 1S59A 3ZTQA 4UOFA 3NGSA 3FKBA 1LWXA 1NSKL 1NHKL 3BBFA 3VGUA 1F3FA 5C7PA 3GP9A 3NGTA 4DI6A 3VGVA 3NGRA 1NDKA 4WBFA 3EE3A 1NPKA 1NDPA 1NB2A 2AZ3A 2AZ1A 1WKLA 1XIQA 3EJMA 4F36A 1PKUA 1NDCA 2DXEA 1WKJA 1NSQA 3VVUA 3Q83A 4O0NA 2VU5A 1B99A 1NUEA 3ZTOA 2NCKL 1MN9A 2BEFA 1HLWA 3EICA 1W7WA 1NLKL 3BBBA 3EVMA 3Q86A 3FCWA 3BBCA 1K44A 3EVOA 4CP5A 4DZ6A 4FKXA 3NGUA 3ZTRA 1NSPA 3ENAA 1BUXA 1VYAA 3WX8A 3ELHA 2DXDA 4F4AA 3FBEA 4ANDA 4UOGA 1HIYA 4ENOA 3ZTPA 3Q8YA 3R9LA 5CAAA 1B4SA 2CWKA 5CABA 3Q8VA 1UCNA 3EVWA 2HVEA 3BH7B 3FC9A 3G2XA 2ZUAA
chains in the Genus database with same CATH superfamily
3DGVA 4DN9A 2DITA 3EXCX 3K5MA 4LFCJ 5GAEU 3SI8A 4UOHA 4N41A 4K2XA 3TA0A 1VLOA 4UUXA 3MPWA 4QOTA 3VAHA 1TL7A 2P9EA 3CC2S 3C6UA 4UTGA 4RW8A 2GO9A 5CZVA 3J80Y 4G3IA 4BLGA 1K73T 5E2QA 3E01B 5AE2A 3D1OA 3KK2B 1KRPA 3CDAA 4AYBD 4FXVA 2GO8A 3CD0A 1JB0C 2UXBF 1X4DA 5F8HA 3FGVA 1TL3B 3T9NA 1HQ2A 4K4VA 1TKTA 5DDRC 4HEA9 3HHLC 5CH7B 4X4PA 3H8YA 1FERA 2M52A 3DOMA 4RBVA 4Y2AA 2E44A 4ZLLA 2MQQA 5EWEA 4U8YA 2BACA 1KR4A 4MK7A 3AHPA 4KGVB 3MMCA 2H65B 4NCGA 2CWXA 3MM9B 4HI1A 4DV5J 4FF3A 2KJVA 3BN7A 3HVRA 3MECB 1UEVA 2MKHA 1UVLA 3T19A 4IRKA 1YBTA 1W26A 1GX5A 1E6VB 3WHIA 4Q43A 3PIPQ 2XY5A 4DR6F 4R5PA 3HSGA 2BMBA 5HP1A 1SKUB 2XS5A 5K8OA 4N56A 1WC3A 3POTB 4H54A 5L9XA 2VUGA 2WVCA 3IM9A 3JTNA 2RQ4A 5F8JA 3OTEA 4KGZB 3NNCA 3DN9A 1U1QA 1NXIA 4LF1A 8AT1B 1G4CA 2DNKA 4IDKA 1REGX 1FRMA 1C0TA 1K47A 1S6OA 2HEKA 1NB2A 4DS4A 2AGPA 1IN0A 1NSAA 1FFWB 4C9DA 4O0NA 2H48B 2MY7A 4WYLA 3CVKA 4OHVA 3TAMA 3MD1A 1WJ9A 1X0FA 1DBDA 5SZTA 4D3HA 4DSJA 5CAAA 4KO0A 2IY5B 3TR5A 3TEGA 3J81U 4YN3B 1UCNA 4N47A 3CSKA 1N32J 2DB1A 3P5BP 3MEEB 1MN7A 5J2MB 4LF2A 1RAFB 4JI2F 3PW0A 4HKQA 2VZ9A 3JTOA 4QU7A 2DHSA 4C3KA 4NMXA 2JFDA 2AGOA 4PUOA 4PWDA 2BRKA 4ECSA 1KQKA 3CMES 1RT4B 1NPRA 2LP4A 2GAHC 3FMWA 4F2SA 3MAAA 2VQEJ 3AD9C 2DO4A 2Y1JA 5KTQA 3EMTA 3ZTQA 2IM2A 2ZH7A 5B08A 2GZOA 4X84A 3QJLA 1ZM2A 1RI7A 2XHWA 1RWKB 5HJXA 3QGHA 4QYRA 2AZ1A 1HR0F 2ZJPQ 3T1YJ 1Q81T 4TY9A 1EZZB 3UD4P 3B78A 4ZLPA 2J0XA 3OJSA 5T14A 1TK0A 1MU2A 3JYTB 2PN6A 2BDPA 5F8NA 1VQ4S 5B0AA 3CMQA 1WG4A 3MM7A 4OX7A 4C8LA 1RYRA 1FK9B 1S6UA 3OFGA 2DRDA 2K06A 1SL1A 3TX0A 1QVGR 2ZWOA 1PC4A 4WCEQ 3UCUP 2E1AA 5HMYA 1NEEA 2V50A 1UJ4A 1SQGA 4HI2A 3J7Z5 3P3DA 1S76D 1QAJA 5KG3A 2XWXA 1RAGB 2KH9A 2W4CA 4G1IA 2HNYA 4J9KA 2E7WA 2R7SA 2OEMA 3EZUA 4LRFA 5K5MA 1RT1A 1FD2A 1RA6A 3HDSA 1FX4A 1M5VC 1SIZA 3D28A 4EU0A 1HNXJ 1LNQA 2ATLA 4DBQA 3C15A 5GAEI 4ZVTB 1HI0P 3NWRA 2I1RA 2IPOB 2AW0A 4DR1F 2OP5A 2LU1A 1D8YA 4YB6A 1T05A 4J9UE 4LRBA 1KSPA 1T3NA 3OL8A 1UEKA 2XGPA 1VQYA 4QWDA 4J7CA 2HVEA 1RP5A 5F3ZA 4RPFA 4ZP8A 5F41A 4M5NA 1ICEB 3W1YC 3PJXA 1T9WA 3UI3A 2AX1A 1VQ8S 5D3GA 3BEGB 5HK4A 2JEJA 4NX9A 4RNHA 4X66J 3BGUA 2IVFB 5ETRA 1AROP 1GQEA 3UDLA 3NS5A 1H6KX 1IBKF 3L7PA 5KT3A 3A3OB 4WFAQ 4DQPA 4ILRA 1LK7A 5DDOC 1VQNS 1JLFB 3VQTA 3PY8A 1REVB 4MIBA 3IO1A 1NPKA 3H90A 1B0PA 3OFHA 4LFBF 4DR2F 4ZP9A 1TKXA 2LECA 2UXCJ 2R7VA 2QC3A 1OSDA 3TAQA 1NSPA 2CJXB 4ZCIA 1F5BA 2HLUA 3C8YA 1BY9A 5CXTA 4KPYA 3TW0A 1IKVA 4WP8A 2F8HA 5H9FJ 4RUCA 3M9NB 1QSSA 3MEDA 1TMJA 1F9FA 1TTHB 1TMMA 1M5SA 1CJUB 2RAQA 4PPDA 3GONA 5BYSA 2F1FA 4C6AA 4CLZA 1SIWB 3CTRA 2CADA 3T5KA 3LGHA 5JVHQ 5LMUJ 4IUFA 1RBLA 2FZCB 4DV4J 5HQMA 1DFDA 2J0QD 2BOAA 2B8PA 3CD7A 2PI5A 4HACA 4O3SA 4KFBB 3R5CA 1S1TA 4QR2A 3E3XA 1U47A 2HFZA 2HHQA 3TARA 4IRCA 4DL5A 3AFGA 1YJTA 2ZBRA 3UR3C 2M8HA 2M4MA 2BM0A 1U1MA 2QL5B 1M5OC 4FYWB 1WDDA 1KFSA 1RTHA 4P75A 1X0PA 4I68A 1WF1A 2V94A 4P2SA 3H4DA 2W9CB 5CYJA 3THPA 2ZBIA 4QPTA 3BPDA 3MM6A 2XM3A 2UVVA 2MZTA 2K8GA 2CQ2A 4CTAA 5E3CA 3TX8A 4CIOA 5GAGU 1XNQJ 2WB4A 4URQU 3Q24A 2MJUA 3W9JA 2W7PA 3UFCX 2DH7A 4N7TA 4OJ3A 4JI4F 3I4PA 1JLQB 3QT5A 2QO3A 1PJ7A 4PXCA 3FZBA 4RZRA 1WF2A 3A8JA 2GVZB 4IG0B 4XTTA 3OVSA 2IMWP 3KJVA 1WC0A 2IHR1 2DH8A 3I5CA 1AW0A 1WORA 3AA8A 5DDPC 4DL2A 2L9NA 1X7VA 4X62J 1S6PA 4YEAA 5AXLA 1SC6A 2PFFB 2QA4S 1MG7A 1W7WA 4K4ZA 4DR5J 2FJBB 4N77A 4DF4A 2MXYA 4DQSA 4FBTA 3NKYA 4DJBA 4ILMA 1NKBA 1RGVA 3OR1A 1UETA 2MZ1A 5F8IA 1YI2S 3ZZTA 1S9FA 2BYCA 5BYRA 1ULRA 2R2TA 4JI6J 2B4VA 1C4AA 1D9AA 4MKYA 3EDQB 2KJWA 3RBZA 2JEIA 2YBVA 4X2BA 3HJFA 3RGIA 2FJAB 3SZ2A 4KHRA 1HYSB 2UV8G 2E1RA 5JXSA 3AB2B 2L9WA 2V8VA 4HHHA 1BQMA 3BBFA 3IGNA 5HQ8A 2IVYA 3GIJA 1WHVA 2M0GB 2VDIA 4KT0C 3OTOF 3SV3A 1NJYA 1B0VA 4IOBA 5IWAJ 4XIUA 1WKJA 2XY7A 2KDOA 2GHPA 4DUZF 3NLCA 4TVAB 2L08A 2BEFA 1C4CA 4DV6J 3VAGA 1RHRB 4Y6IA 2MZSA 3LW5C 4ENOA 4DWIA 4Q44A 3BQ2A 4TN2A 1CG2A 2DO0A 2V8DA 1RT2A 4LF6F 2P6SA 3QZ7A 2GVDB 4ECYA 4P72A 4TYAA 3NP5A 3DNCA 3DRSB 1RWMB 2LEAA 1OWXA 3R7SB 3SSRA 3ET6A 2HBYB 4ID8A 2UUAF 4K4WA 3MM8B 2BRLA 5M2PA 1U49A 5C2GA 2RRAA 1SJFA 3MM9A 2OEJA 1ZA1B 1TQLA 2RMLA 2N7CA 3W2VB 1SI9A 5B0GA 1DAXA 4DCJB 7FD1A 5J1PA 3OBIA 1VQ6S 4F0KA 4HLBA 1AUDA 5FIIA 1R0AB 3SQGB 1U09A 3KG1A 4Z37A 2IDEA 2HGNA 3RB0A 1FRKA 2IBKA 2HVIA 4DZ6A 4DUYF 5EDWA 2EFQA 5LXRA 4K2JA 5GMEA 4ED0A 5D6GA 1FVQA 2FJEB 5KFMA 2KFNA 1Q1KA 4EGLA 1CULB 4J9SA 2YNIB 2BJDA 3HT0A 1ZOTA 4ILLA 3UVJA 1HARA 2EBGA 2HFOA 2ZH8A 2DR7A 2BX6A 5KFRA 4ZLJA 1FI4A 2EKNA 2CFXA 4P2FA 2VOOA 4S0MA 4M5HA 3BGRB 3AOCA 4DR7F 2DT9A 5CCMA 3KKFA 4DZDA 4V19J 3PRVA 3FFIB 4BHQA 3CCES 2LYVA 3JB9k 1YJ9S 2E9ZA 4KAIA 1HBUA 7AT1B 3IR7B 2QEXS 3S7RA 4CO4A 5C7PA 2J9DE 2OSRA 4M95A 3M2VA 4QIGA 3MEEA 5CYQB 4IOAQ 6FD1A 4OX9J 4IFYB 1GAOA 2B6AB 3ZTOA 1WHYA 2DR5A 1TK8A 2DISA 2H51B 3DXSX 3C66A 2CPEA 4B3RF 1SKRA 2CNLB 3HI9A 2DHGA 3DOLB 1C0UB 1RT4A 2COLA 4N8NA 3CPWR 4YUDA 1R8PA 2X51A 1AT1B 1U4BA 5E3PA 1Q86T 4ITSA 3OUYA 2QIFA 4O44A 5GMKa 2XI2A 1U0SA 3EM1A 4ED6A 2LFVA 2V8HA 5B0CA 2GJ2A 3IR6B 3KFWX 4ZVOB 3H2VE 2H1YA 3FK4A 4ES2A 1RT3B 3GJRB 5HATA 2W4DA 3IRXB 4K5SA 2FHJD 1TFYA 3QJJA 1FK9A 1SXLA 3FSYA 2HK3A 1V9OA 4UF4A 4CM2A 4YY3F 1IBLF 1UKUA 1MWQA 4TKTA 4I1TA 1U48A 3PJWA 1N48A 4QJVA 4CO1A 4F04B 3R8YA 1HBNA 5C42B 2JFKA 2MQOA 4WU2A 1IKYB 3C19A 3W5ZA 4DV0J 3THVA 4ECTA 4CO5A 1GXTA 3TJ9A 2RQMA 4Z7YA 4NASA 4ZJLA 2HGLA 3M05A 2HK2A 2B5JA 3DGPB 1FRJA 2QSFA 5C2CA 3VAMA 3QT6A 4RWXA 5IT0A 4MFBA 4ALZA 1VK8A 1U8WA 1TL1A 2EFPA 1KLNA 3UQSA 3M2RB 4DV7J 1HQUB 3K17A 3PW4A 1EKSA 4B17A 1Q8IA 1KVJA 3HKWA 1BHNA 3Q89A 2MSSA 4B9MA 2W2OP 4ANEA 3MPYA 1HHQA 2R7OA 1U7LA 1PG5B 1OSCA 2XMAA 2GW8A 2W2MP 1J5EF 4H4OB 1R8BA 4OYXA 3TZWA 3FKBA 5GMDA 4LFCF 1WG1A 1F3FA 1YRTA 4X65J 1XNRJ 1GH8A 2HFNA 1CJKA 3GCXP 5G0RA 2C2OB 3H98A 4EI2A 4I2PB 1DHMA 4O4GA 4FN5A 1KBRA 3ZZYA 1U1KA 3JAMY 2K1RA 2AMCB 3OFEA 2CQ1A 4ERDA 1X4CA 2L41A 1XK8A 1JLAB 3EVWA 3C46A 3M6VA 2NXEA 1H2VZ 1WSVA 4WE1B 1HWIA 3QRRA 1QE1A 3FCVA 2DGWA 3QPIA 1QSYA 5J1EA 2V69A 3V6JA 1I6JA 4I7FA 1C1CA 1S79A 1WKKA 4CYUB 4DUTA 5M2UA 2ADBA 4CLSA 4BCAA 1VC0A 4YDDB 4DV5F 4G1PA 3I6PA 1WACA 1ELOA 4KYZA 4UZBA 4WZMA 2IM3A 2OSQA 1RAEB 4TY8B 2N7YA 3QYYA 3K7RA 1UW4A 1RBOB 2KZMA 1WKLA 2U2FA 2LQBA 3RRKA 2I0XA 2NPFA 5E3AA 4ETZA 3MR7A 1O5JA 4RO0A 2KT2A 2JX2A 2KTQA 1SUQB 2RSQA 2AWZA 2D41A 3PKYA 2BW2A 5F8LA 2QN6B 2GMLA 3MD3A 1IJEB 4CLYA 2FDNA 1X4BA 1MMDA 4EWTA 1S9EA 3SV4A 3KLHA 5DG8A 3FDSA 2JWNA 2IYIA 2OHDA 3HSJA 3BQ0A 2UZAA 3BH7B 3ISNC 2BV3A 4HDGA 2NS1B 5IOLA 4JI5J 5J2QA 1WWHA 1YG0A 4NCBA 4IH5A 5DG7A 3MDFA 3AQPA 2FZKB 3AB4B 3DM2B 2W9CA 2V67A 3DLKB 2RJZA 4TLRA 1GEHA 3MTJA 1N32F 2WVEA 1KP6A 4ED8A 1Q8BA 2FGOA 2A6OA 3MAHA 1VBYA 2AJ4A 4DHVA 3M8YA 3V4MA 3K5PA 4ZN3A 2KHCA 3R5JB 2HAIA 2IAJB 4XAKA 1UJ6A 1N5QA 2FHMA 4PR6A 4G6VB 2MB0B 1FKPA 2VQEF 3AY0A 4FKXA 3NEKA 3PW5A 1IQTA 3Q0AA 1Y5LB 4WFBQ 3LP1A 4B3TJ 2VFVA 4GC7A 2L3MA 4ZPAA 5HROA 1KVIA 2YNGA 3BPSP 3NNAA 2W9BB 3PEHA 2MZJA 5HANA 3R6LB 5HAOA 3T1YF 4HT5A 4C8KA 3RZAA 2LEBA 5KOWA 4C8MA 3GPAA 4C2MA 2WW4A 3OD2A 2FJWA 4DR4J 4IQXA 3HHLB 5ETQA 5BR8F 4UOCA 3E51A 1BWEA 3PNIA 2CZ4A 4ATNA 3S8SA 1G1XA 1HQEB 1XR6A 1Q95G 4A48A 3UR0A 2AJ0A 4DS5A 4E98A 1QTNB 1F5AA 3UNGC 2V4RA 5KFXA 4K8RA 2G9OA 1FRHA 3GTYX 3RB4A 4QU6A 3M8SA 2VA3A 1QAIA 2CXEA 5JJBA 1F1BB 2V4JB 3I87A 3SBMA 4LF5J 5DG9A 1SCJB 2RH3A 1G6BA 2KB2A 3ONQA 1PO6A 3V81B 1AZSB 1LWFB 2NCKL 5DLGA 2FQQB 2GMJA 2OLWA 1D09B 2YX4A 1ZAXA 5KFLA 4UQTA 4AUKA 5IV4A 1S48A 2CAJA 1F3VA 2MKIA 3WC2A 1HNXF 4QBUA 3HX9A 4OLOA 2MZRA 1OY9A 4ED7A 4J90A 3G87A 1GK8A 4ZHRA 3MMJA 4R8UA 3KLIB 2ZJQQ 2GGPB 1NKEA 1T11A 4ZN1A 4RW4A 1JWWA 3U7JA 2DPJA 4ECVA 3R7NB 2QV6A 4C0BA 4CZCA 2GIFA 4M5GA 2VONA 2R7RA 1J5OB 3WX4A 3LQVA 2M88A 4ZJQA 4LF7J 1VQ7S 3KK1B 3R1LA 2ZD1B 5T7LB 4KC5A 4A8FA 4RR5A 5J2PA 3C2PA 3W62A 2WSEC 1DY3A 4DSFA 3IBFB 1CEZA 3SCIE 4RWWA 3BGFA 3AODA 1MW7A 3PIOQ 1KEKA 1WC6A 2YKQA 4X66F 1JLCA 2QG9B 3MOZA 3VALA 3PFEA 2JVOA 4FYXB 1PC5A 4PWUA 2RU9A 3GWCA 2DY1A 2KI2A 2XMKA 2WK4A 4ELTA 3W2VA 3BN4A 2HNDB 3F56A 4FNIA 3D1HA 2QRRA 3MR2A 2WVBA 1R0AA 1WNEA 4EO8A 1UFKA 5D0EA 2UXCF 2EK6A 4GO5X 4OI4A 1YRXA 2LXFA 3PO5A 4RW9B 1RTJA 1NK7A 2Y8YA 3RG6A 2CDRB 4DLGA 3C14A 3PHEA 4B9SA 4DV1J 1P6TA 3TJAA 1W2BR 3CB4A 1B7YB 3MPVA 1RTDA 4LSLB 2JEFA 4X4VA 3CCSS 4ELVA 2G2YA 1OY8A 2MKKA 1HL6A 3EPIA 1H3DA 1E6YB 2BQRA 2Z8QA 2VG6B 1S1XA 3MEGA 3J7YU 1YBAA 5LMUF 4DV4F 1S7IA 1YWXA 2OPRB 1N0UA 5HVHA 4QIFA 2W1BA 2E5HA 1SV5A 3W65A 2NLWA 3QGPA 3U1LA 1FCAA 2QFJA 2UV8A 4RNFA 3H25A 2VDHA 3M2UB 1DLOB 3SCJE 3OXLA 4HHJA 1EHWA 2O01C 2OUGA 1EP4B 4XK8C 4IH7A 1R7IA 4A4JA 4HR2A 1A0OB 1D9DA 2B6AA 2DYAA 2DBBA 3NWGA 3W5YA 2CKWA 3IC1A 2RDDA 1L5UA 1WHXA 4KIAA 5IFMA 3I9V9 3QAEA 5D77A 3SDEB 5E33A 2C2RA 1XNQF 1RBAA 2F4VJ 1Q8LA 4ID5B 4QCLA 2NREA 3KUHA 2C2ZB 2PI4A 1HHSA 3SCKE 2RUGA 2RDJA 1IBMJ 3WQPA 5KFWA 5AT1B 1S1UA 3ITHA 4ED1A 1YIJS 4WJBA 1G7CB 3P96A 2LDIA 3PEJA 2E5JA 2DHAA 1JNRB 5T41A 4PQUB 3B8HA 4OZJA 1F60B 4DMZA 4JV2A 3X3UA 3TZYA 2HAFA 5L1LA 1TU0B 3KOAA 3N5FA 2ASYA 4KV8B 5AXNA 3JSMA 1HNWJ 2B4OA 4X62F 1FJEB 4OZ1A 2DD8S 3HP6A 1N6QB 3TVZA 3CIMA 3DI6A 5HBMA 1N8RT 2E5IA 4DSKA 3MI7X 3OHAA 2QMXA 3D1QA 4DR5F 4I6YA 1SKWA 3G9CA 4F3MA 4OI1A 2WBRA 1LW2A 3TJ8A 3OTCA 3LAKA 3N0VA 3QATA 1ZZNA 1KOHA 3GV7B 2OH2A 3G82A 4ZK7M 4JI6F 4L72B 3CCMS 3VVUA 3M2RA 4QW8A 3NL0A 2F8EX 3FSXA 3FSIA 4DQRA 4G1QA 3J80U 2J6UA 3DRYA 4WFXA 2DR9A 4J9QA 1DQAA 3AT1B 1EQ0A 2DHXA 2E7VA 2CWKA 2XS7A 4OYIA 2M8DB 1FJGJ 3ETOA 5IWAF 4ZPCA 1HWLA 1RT5B 2R8IA 1U6BA 2B4UA 2O3DA 4DG1B 5A2QY 1TKZB 4DV6F 3DMJB 3JQJA 3EPGA 1N36J 4ZVSB 4CLPA 4AFFA 2AEFA 3BYPA 1HMVA 1CC8A 5IM0A 5HL7Q 2K3KA 1ZZFA 5D15A 1HNIB 4PG7A 2HS0A 2I5JB 4QQBA 2MZQA 2CQHA 1EETA 2NXUA 1BD6A 3BQ1A 2WONB 2WB1D 1RAHB 4IH6A 2ADCA 4BC7A 4ER8A 3UO0A 3PO4A 4F02A 2BABA 3VV2B 3F0NA 1Q7YT 2FVPA 4P10A 5IZHA 3MMAB 2YKNB 2AQ4A 1FDBA 2W24A 3W2WB 3SFUA 4CYUA 2I6WA 1VYAA 3H5XA 3UN5A 1RQ0A 3N79A 3MCMA 3OR2B 4LFBJ 3G8SA 1H72C 1TK5A 2JJ4D 3Q8VA 1D1UA 2IA0A 2R4FA 4PABA 3T5HA 3TZXA 1XN9A 4QIWD 2CPXA 3J7YI 4WK3A 3D5MA 1FRIA 3SSSA 2G13A 2DGSA 1XQIA 3HSZA 3PYDA 2BKOA 2CPZA 1R89A 4RU9A 2H5EA 5F0WA 3LP0A 1Y10A 1CBKA 4OHWA 1SL0A 4Z7CA 2E5LF 4YOEA 1P9YA 1VIOA 3PR5B 2KYZA 2XLJA 2VKRA 3GIIA 3GU0A 2VG7B 3V2UC 1MWYA 3TOQA 1IQZA 2E1CA 4RL1A 1RKJA 3QO9B 1IKWB 3HXMA 1OQ6A 2KU7A 4NLOA 1UVNA 1ZPWX 3DLKA 3R1HA 3Q2SC 3WIUA 2OPPA 5A8KB 1V6HA 4HYKA 3N5BA 3OHBA 3CW2C 3RW7A 3ZZZA 1VR6A 2D3ZA 3TI0A 4OX9F 2EXUA 5LMNJ 2M70A 1O8BA 4P6QA 4WIIA 4B08A 3GB0A 2ZUGA 2IAJA 2FJVA 5H9EJ 1QM9A 1MLAA 2CRLA 2MKYA 3Q8QB 4HVZA 3U27A 4KY3A 4I2QA 3HO1A 2DY9A 3E8OA 2ZE2A 2W9BA 3J7ZT 5BJRA 3TANA 1CQNA 5F8MA 3I5BA 4F36A 3KUGA 2ZNZA 3G6YA 3BZQA 1NPPA 5E5NA 1NLKL 1VQ9S 3M1VA 2HQ3A 4F4AA 2MGZB 3NCQA 4DPYA 4MK8A 3KK3A 1FRXA 1RWOB 4P2XA 1UL3A 5IXUA 3W61A 2Z2MA 3DCAA 3S1TA 2HHSA 3GYNA 3UN2A 2ZBCA 1N5VA 3SCLE 4NEYA 2AGQA 2BM1A 3HK2A 3CWJA 4LR9A 3GV8B 1U1LA 1NK4A 2R7TA 1FKOA 2AJQA 3VAIA 3GJQB 4DV0F 1S6QA 3D68A 3D6MB 3T5LA 5ETOA 2HVZA 2YY3A 4ECQA 4K4UA 2YWEA 3BH6B 2AKWB 2OPSB 4RBUA 1CPZA 2PMHA 2NSCA 2GQQA 1EAYC 1WG5A 2DGUA 4WYWA 1Y00A 4M5DA 1JLGA 2BE2B 4LF4J 2LXUA 1SJ1A 1FE0A 3OTDA 4F7VA 5LSRA 1RWUA 1CJVB 1L3UA 2CJYB 5KFJA 4DV7F 5H9FK 1UWAA 2ZWPA 1Q53A 3KLFB 3O8WA 2IFXA 4Z2XA 2C1EB 1Q5YA 2APOA 1A9NB 1YJVA 2HSEB 1KTVA 1J5OA 4J9MA 3CCZA 4WF9Q 4RNMA 4X65F 2OPQB 3TUZC 3KK1A 1XNRF 1IKXB 3VAFA 2ASLA 5IC6B 1SJ4P 2ZH5A 2NPIA 3C6TB 1FNOA 1GT8A 3DOKB 2D3O1 3DDNA 3V6KA 4A8QA 1KDNA 4P9SA 1A7GE 4FBUA 1YTYA 2GQ2A 1S1VB 2A1BA 2YKMA 3HFVA 1MSWD 3DLBA 2ZH2A 1H74A 5B0EA 1PJ6A 1MROB 5IT9Y 4NLPA 3PRBA 3NGTA 4L6V3 5F9NA 4PAAA 1N34J 3GQCA 2HS3A 3L3CA 5F3TA 4NLSA 1KHWA 1RDRA 2IDLA 1KLMB 1L3KA 1KTQA 2D3OR 2DR6A 4M8LA 1U6ZA 3LGMA 1UP1A 3SIPB 3V6HA 3KLGB 3PYGA 1U1NA 5CZXA 4W92B 1HNVB 1TUWA 2BA9A 3LANA 3MEKA 4ZITA 2GC8A 3MF5A 4LBIA 4J9OA 2O5DA 1UVMA 3IS9A 4IQMA 1OPZA 1JLBB 2ROPA 2WVDA 2KM8B 2ZH4A 2YWKA 1NDLA 3T6BA 1S72S 2XEXA 4ZIWA 1HBMB 4QR1A 5HI7A 4B3MJ 3BSNA 1FJCA 3W3SA 3NGSA 2HMIA 1YGYA 5B0FA 5MAOA 2BE9B 1MWZA 1FA0A 2XWYA 1T9TA 2V63A 3NS6A 4LSNB 1LWEA 4JI5F 1B0TA 2JNJA 3TVYA 1HHTP 1T7PA 1ACMB 4YR2A 1R43A 1FO1A 3O44A 3DYAB 1T9XA 1YITS 4USMA 4OV6A 3GSDA 4ICLA 3EICA 3BBBA 3Q86A 2YNFA 1D3WA 3P49B 5L1KA 2HQCA 3FBEA 4TU8A 4K59A 2ZOMA 3MTKA 3HVTA 3DLLQ 4Y34A 2C2DA 1O51A 1RSCA 3IAM9 5CD4H 3LP2A 4DV2J 2CQ3A 5KAKA 2QFIA 1QAXA 3CC4S 2MLXA 5C25A 3R2CJ 1RT7B 2IJNA 1C2PA 4TYBA 4DN0A 4CLTA 3H4BA 4RW6A 3IWXA 3JXOA 2EBEA 4PQUA 4B3TF 2GAGC 4J9RA 4ANCA 4PQAA 2D69A 4EYIB 1X4HA 2IBOA 2KRRA 3VWSA 2FHOB 5K9FA 4DI6A 4U7CA 2CIMA 3D4JA 4DR4F 3PXGa 2BJEA 3FNNA 4Y00A 3H2UB 3Q2TC 2E1MC 3DLGA 3LGNA 2VC1A 1Q79A 2RF2A 2IJRA 2ZOGA 2X1AA 2Z58B 2QJ3A 3IM8A 4CI0B 2X3DA 2XULA 2KVQE 2EFNA 4NMLA 4LF5F 3RRGA 1JXEA 4I67A 4DL0C 3L09A 1RTIA 5D4LA 1S9GB 3FBFA 2MQMA 3ULHA 3H5SA 4KB7A 4OYWA 2CPJA 1RUSA 4MKAA 3QBCA 2Y1RI 1TKDA 2DNZA 3IGVA 2C2KB 1B3TA 2MQLA 1HI1A 2IIHA 5FDLA 4LRDA 1NHVA 3KTQA 4CLLA 2HHUA 2AYBA 3H40A 1YJWS 4A8MP 4ECXA 3GJSB 4DPUA 1SH3A 4DXLA 2H5JB 1B70B 2JLGA 4WXWA 1T02A 1XIQA 1PGZA 5GADI 2E9RX 3QFWA 4RW7A 5A8RA 3U1MA 2RQCA 2BBEA 2FC9A 3BSCA 2QE5A 2VFRA 3BSOA 1VRTB 3QWUA 1RE1B 2LU2A 4X4OA 4MKVA 4LF7F 3HHLD 1RWVB 3H5YA 4I69A 4YHHJ 2HW3A 2R8HA 1HNIA 2GFFA 1HBOB 2BZ2A 4RNOA 2DRAA 2HNZB 4MYTA 2HFVA 3PRDA 2Z57B 4FKYA 5DQGA 4JP8A 2A2DA 3MMAA 4XO0A 4F4ZA 2WAQD 2B43A 1N5YA 1FVSA 2WSCC 3CT9A 2I9SA 2P6TA 3W2WA 4WK1A 1X5PA 5I3QA 1ZM4A 2VG5A 4R0EA 2FGCA 3FQLA 1ZPVA 3M8ZA 4ZCKA 2DGQA 2Y0BB 3KDOA 2JRSA 2YKPA 3W9IA 2A2CA 5LSOA 1CVJA 3K58A 1WELA 2GQCA 4PYDA 3EDRB 5EWGA 1TUGB 2A3JA 2QLWA 1CS4A 3NBPB 4J9LA 2DNOA 4MT1A 4CP5A 2CPYA 1VRUB 4DV1F 3JSBA 4U6PA 4B3OB 1VJWA 1V3SA 3NGKA 1QTMA 1M5PC 3G6XA 4ECZA 3V5RA 3QZ8A 3LOUA 2CQIA 2J0SD 5BXIA 3C16A 2KKHA 2LVWA 5A8WB 2MJNA 2CZ9A 4LBHA 1FESA 4WP3A 4PEOA 1WC4A 1D9FA 2QL9B 1NM2A 2FJXA 1Q82T 4F2RA 3R3TA 5I4MA 3EGWB 4I6WA 3B54A 3TUPA 1GMWD 2AT1B 1YVFA 3NCPA 2WOMB 2OELA 2LQ8A 3LH2S 1TV6B 1LQ9A 2R42A 2HBZB 2VH7A 3QAUA 2YH0A 1F2GA 4RJVA 2PIIA 2WCXA 2UVRA 4ZPBA 2HG4A 2F4VF 1VOMA 1FKAF 2FLLA 2HHWA 4ANDA 4UOGA 1IBMF 1CJTB 4NYZA 4DL4A 1KN6A 4I56A 3PCOB 2I2YA 1BGXT 2IC3B 2VODA 4IOCQ 2A0FB 4DPXA 5I3UA 4J37A 4JV5J 2M7SA 4Q7AA 5CCLA 1HPZB 4DFMA 1YLXA 4QYZJ 2C3YA 2FY8A 4FPIA 5ADZA 5KFCA 1QD1A 2VFSA 1S1WA 3AJ1A 1OMSA 4OJGA 1SPBP 3V4IB 3O5TB 2HFUA 1UZDA 1KC8T 3NAHA 4NWBA 3QJPA 3Q23A 3RB3A 3I0SB 1HNWF 5BR8J 1DTQB 4BWJA 3ADAC 1PYTA 1FFSB 1N33J 2EW9A 1TL4A 3FEZA 4OL8A 3TRGA 2J9CA 2H9ZA 2AYEA 2DJWA 1GMVA 5E41A 3UDCA 3P45B 2WW8A 4IFVB 5ETTA 1OQ3A 1I94J 3NCRA 3QGIA 2LQ5A 2N3LA 5AE3A 2OPSA 3FRYA 1RISA 1VRQC 4DR3J 2OD4A 1TL7B 3M8QA 3C6UB 4RLEA 4RW8B 2JC0A 2PSZA 4P74A 5EHHA 1SJ3P 1LEOA 1IBCB 3TWZA 3QMQA 3RAQA 3JS9A 2YXLA 3K89A 1NNDA 3QRQA 2DEJA 3CXCR 4A46A 3LUYA 3T1AA 2HRUA 5J2NA 4C3MA 3JAMU 4OHYA 5DZ6A 2XMVA 2P8IA 4I6AA 3DDIA 4ZOSA 1TKTB 5EX3A 1ZS6A 2QTWA 2YNHA 1FJGF 4CDIA 3BV8A 1U26A 4MMOA 2ZHBA 2OO4A 2GHVC 3DOMB 3OXFA 2PC6A 2O67A 2G1DA 1J2VA 2D3UA 2HQDA 3OSNA 3M8PA 2DXEA 3Q83A 3MMCB 3HLUA 4BWMA 1N36F 2V6AA 4NCGB 3TA1A 1Q4RA 4NXMJ 3SYZA 4ECWA 1R8HA 2LCWA 2RS8A 1UTAA 4OJ1A 4MAKA 3I0RA 1K44A 5RUBA 3FEYB 5LL6d 3RRHA 4FXDA 1S99A 4OLPA 3UD3P 3W7BA 1JKHA 4H4MA 4JYAF 1CQMA 4DOZA 4EFAC 4ZA1A 4R5PB 2RVJA 5CABA 1FX2A 5C24A 5HP1B 4K7QA 1XBWA 5I42A 1FJ7A 3DRPA 2DHHA 3MPDA 2Z4PA 1SH0A 2X1GA 3CCTA 2V2KA 3MHYA 2RUSA 4M5IA 2R2SA 1J27A 2J8AA 2WBMA 2BUNA 1UVKA 1VI7A 4IDKB 1C0TB 2B8QA 2CG8A 2FZGB 1KKHA 2J9EA 2UUBJ 1Y7PA 1SVDA 2NSBA 4IO9Q 1Z2LA 2XSJA 3VTIA 3MZIA 5D8HB 5KFGA 3TAMB 4QPXA 3OSPA 2MQ8A 3MMBA 2XLIA 1NDKA 3ZZOA 1HWKA 3N01A 1RADB 1T03A 3IFEA 4FF1A 1KWMA 4F26A 2AX0A 1YQHA 4C98A 1F2HA 4KE5A 4C11A 4KO0B 4F3OA 3AOAA 2ZITA 3K2YA 3EGZA 5AE1A 1WOPA 2A18A 1U2FA 2B9WA 1AFJA 4Q0BA 1HBMA 5AJ3J 3DHXA 4IKAA 1DTTA 3UCZP 1XC9A 2W25A 4BC9A 4PWDB 2RU3A 1OS5A 1Y4ZB 1GXUA 3GSIA 4O3OA 1IM4A 3MAAB 3CD5A 1FE4A 5A0YA 1KVKA 4CNZA 3R97A 2CDQA 1RACB 2X3GA 2BVZA 3IBCB 4ZCMA 4CLFA 5DETA 5AXMA 1YZ7A 2KZZA 2QA2A 4C7QA 4DPOA 4KKOA 2XNQA 4A8WA 4DQQA 1KS2A 5LMNF 1MU2B 1OYDA 3BDPA 1N88A 2AHOB 3P5TL 3I4HX 3ZFVA 1RU1A 3KHLA 1SL2A 3EJMA 1JJ4A 1PKUA 2DNRA 1NDCA 4J9VA 1NO8A 4Y0FA 1WC1A 3FRZA 3PYEA 1M5KC 4XPCA 5DQIA 3H59A 1QDUB 2W2PP 4O3NA 3GG1A 3I82A 4MTPA 2KYXA 4CLWA 4CO0A 2YWWA 4DQIA 3CD6S 4P7VA 4EBCA 4KPCA 2Y8WA 4P7TA 1F6TA 4OZ2A 3UN3A 3CC7S 3GJTB 1CC7A 4QIVA 4IYQA 2Q43A 2HNYB 3W8PA 3IWLA 2QZ8A 1NH8A 4Y2IA 1S10A 1RT1B 2XY6A 2RIJA 4DFKA 2LQJA 3C15B 1H2TZ 4DU8A 1SH2A 1FHTA 2VF3A 2FVCA 5FD1A 1RK8A 2H5IB 2KXNB 4URSA 2FTRA 3MWBA 2OIHA 1T05B 2XI3A 1H7WA 4RU2A 1NSQA 3NRBA 4TNOA 4AE5A 4CH1A 1X4EA 1QVFR 5K20B 2B7CB 4CT9A 2DPIA 2C3UA 2ACMA 3TUJC 3KNGA 4EO6A 3EUNA 1X4GA 4LF4F 5K8MA 3BKUA 3BKTA 3D3BJ 3GLJA 4OJHA 3HVWA 3CJKB 2AJFE 2XYPB 5D3GB 2ZEJA 3CCJS 5E7OB 1P8GA 3ZXWA 3MURP 3RBDA 1ZETA 4M63A 4GMKA 3AXKA 2BANA 4CO2A 1BMQB 2OFHX 3D9BA 4RUHA 2KT3A 3OV7A 1VRTA 4U8VA 2XC9A 4ZPTR 1NJXA 4M5MA 2P2CB 3GV5B 2B56A 3EWGA 3CO0P 3PR4A 2E9TA 2F65A 1TKXB 2YX7A 2F8MA 4KGKA 4LJMA 3NGRA 3GIMA 2CJBA 2CQBA 2R7UA 3M9MB 3E01A 4DDFA 3KK2A 1NJWA 2YQ1A 2EG2A 2NUHA 1HLWA 1B64A 3IN5A 3MEDB 4JI0J 1FTRA 3ENAA 3BF4A 1TL3A 3KHGA 5FLXY 2DNHA 4F25A 4R25A 4Y2KA 3PV8A 4IR9A 3A3NB 4OI2A 4ZJOA 4USUA 1N34F 2Y0SD 4LR8A 2MKSA 4W98A 2C3OA 4HACB 3HPOA 2EC2A 4Q8FA 2JL9A 2JOQA 1S1TB 1NBEB 2G0CA 2CQPA 2F9DA 3G86A 3NBPA 1XWLA 5E3QA 3MECA 1S57A 4EUVA 2ZDPA 2VASA 3T6JA 3HHKA 2G1HA 2DNGA 2C42A 1VDHA 1E6VA 3RYLA 3VHQA 1TVRB 2VBWA 4LF8J 4HDHA 2HURA 4QWBA 2XO6A 1RTHB 2HWHA 1VJQA 3POTA 2Z0GA 4DSLA 5G4DA 1ROFA 3OFFA 5E3RA 2CA9A 2ZNYA 2M3DA 2YWFA 4JB8B 1B99A 2J5AA 4CTAB 2EEYA 1X8DA 5GVQA 4X64J 1U2CA 1LXNA 1M1KT 2QGFB 3ZTRA 5B09A 3AOBA 4FYDA 2E5LJ 5DGBA 1QLNA 4B3MF 1HIYA 2W01A 4ES3A 1VQOS 2AV5A 2B0GA 1OY6A 3LF0A 2ALYB 2QX0A 1TV6A 2RKIB 2GS8A 4DU7A 1URNA 2BQ3A 2OKQA 4PG8A 4RKUC 1YJUA 3ENVA 4IR1A 2L48A 3B6BA 4OYPA 1F9HA 4J91A 5GAGI 4WZQA 3DKDA 4OYOA 3IG1B 3BDEA 4WFNQ 1UA1A 5J2MA 3VGSA 5D4OA 3BB5A 3RR7A 1BE4A 4DV2F 3BGOP 1S6PB 1WF0A 4BBYA 4FXWA 2WVFA 1ZA2B 4UOFA 1S0MA 1RAIB 1CJTA 1M90T 5FJ4A 2N4DA 5DS7A 3TYTA 2IC3A 4WIQA 4OHXA 4ZIVA 6AT1B 3LALA 3OR1B 1HPZA 3CJ3A 5KT5A 1LK5A 3KYLA 1IUJA 3H2LA 3W66A 2UUWA 3Q8RB 3DC2A 1U02A 1Q8KA 5EWFA 3BO4A 2AF6A 1RA7A 2H54B 2KFZA 1QAYA 3B4MA 5IC4B 3D0GE 1WTFA 4DFJA 3I0SA 3JYTA 1VIXA 5KFYA 1VK3A 4DCOB 3IA0A 2XCPA 4CWBA 3HZGA 4L3NA 2PT0A 1PAEX 4OYMA 2GMHA 1BQMB 2V2QA 3I96A 1NCLA 2XBPA 5D4PA 3GYXB 1TFWA 1ZBTA 3CJ2A 3IXQA 3HHNB 3CEDA 4LF9J 3RBXA 3PFOA 3QLHB 1UPMB 2GHWA 2KHDA 2JDJA 2AD9A 4XDCA 1G2EA 4OX6A 3DLJA 2J9DA 5A2QU 1NUEA 2MDAA 5KG4A 3R5AA 4DPWA 4OI0A 1RT2B 2W8KA 3TQ1A 4NLWA 5KFUA 2HHTA 3GE9A 2F63A 3ILLA 3HD1A 2Z2YB 3G8TA 5ETPA 1VC6A 1RXOB 1R0CB 2HRYA 2DKOB 1D8ZA 1UWBB 5D0RA 2EC0A 1SJQA 2R8KA 1FXDA 4LVOP 3MR5A 3GIKA 3AA9A 3ET6B 4NLYA 1V3RA 4DL7A 2HHXA 1W2IA 2JLEA 2W7AA 5D0HA 3K8VA 3HVAA 5L39A 9RUBA 4NI2B 1NMEB 3K5OA 3J81j 4EZ6A 1HA1A 4YHHF 3D6FB 2CVEA 4NLQA 2HZVA 2KFYA 3PACA 5DZ7A 2VPXB 3EZOA 2KO1A 2F40A 5CYMB 1NK0A 3TNVA 2HS4A 4HT7A 1BQNB 1M1GA 3QNWB 2DRBA 5ETSA 2XLKA 1JLFA 3UVJB 1REVA 4MIWA 4C97A 5H9EK 1VFJA 2FPHX 4K0KJ 1QJHA 3OVBA 4OYAA 3BREA 4CH0S 1K0VA 1R6VA 2Y9HA 2HIQA 4ZS6A 1X5TA 2XZWA 3FCHA 4LUBA 3ISND 4ZPWR 1HBUB 1WI6A 3FBCA 1H7XA 3JSYA 2CQGA 1AXQA 3CDUA 3M2VB 4A8KA 4J9NA 1CJUA 1HWUA 4GVBB 3I31A 4CT8A 4OI6A 2RHSB 1V3ZA 4FF2A 2QLJB 4C8NA 3VGVA 4C48A 1Z2ZA 4KFBA 4PZVA 1OO0B 4NZ0A 4QWAA 4HH1A 1HWJA 1IWGA 2KN4A 5DM6Q 2GA7A 1T8EA 2VHGA 1RJJA 3RAXA 3QSYB 1JXLA 1MN9A 5HVFA 3OUYB 4O44B 4KHPJ 3GIRA 3IP0A 4U95A 1XR7A 2DGXA 1NAQA 2ASDA 2CNOB 3MXHP 4Q5VA 2LEPA 2R7XA 3M8WA 3WZ0A 1YZ6A 3G2XA 3MUTP 4FS2A 2NYIA 2VPZB 5DLFA 4AXIA 1S0VA 4DF8A 4UT4A 2F7VA 2VBZA 3R2DJ 3CCQS 2WSFC 4KH0B 2DK2A 3A13A 2CG4A 2XYGB 2RRNA 4M1KA 1RHKB 4UQGA 1ZAWA 1U1OA 5ETNA 1JLQA 1HBNB 2CPFA 2BXJA 2ZBPA 3K8WA 3MCOA 4YP3A 2NZCA 3W63A 1R27B 5HN0A 2GVZA 1N5TA 4IG0A 2VKZG 1U45A 4JV5F 3QIPB 4QR0A 1P1TA 5THWA 3US5A 5KG0A 2B5JB 3CDWA 2LXIA 2HRTA 4MFBB 1EB0A 4IRDA 1AFIA 3FEXB 3IWNC 4NCAA 1TL1B 3RR8A 2IVMA 5SUHA 3MOJB 5D4NA 2X1FA 1Q16B 2YVSA 2ASJA 1APSA 4M5KA 3HSDA 1N33F 2IJFA 4EK2A 3JQMA 2ZZTA 2YWHA 3M6WA 4JV0A 2UUCJ 2YTCA 1U1RA 4P2MA 2DNLA 4NLGA 3NG8A 1VS3A 2M9KA 1RT6B 2JEGA 3KLVA 3MUMP 1I94F 2UXDJ 5D78A 1URRA 4NOHA 2VJVA 3BYRA 4CLUA 4DR3F 1CJKB 5G0RB 2DNYA 4Q2MA 3I55S 2LMIA 1FWKA 1X4FA 1P27B 4F4YA 2FVRA 3OVAA 4O4GB 3M6XA 5KFDA 3CJKA 3HZEA 5IT4A 3SMZA 4I0WA 3ZC4A 3D54A 1HYSA 1X4AA 2K2PA 2K1RB 2PA3A 2ZH1A 2W2NP 4K4YA 4UY85 1RAJA 2YQ0A 2XGQA 1FXLA 2QT7A 4B9TA 1WEZA 1K8AT 4X4UA 3LTOA 3FCWA 4ZVHA 1VBKA 4ZP7A 1QE1B 2DXDA 1BC6A 1B7FA 1UVIA 5J1EB 4NA3A 1TR0A 1VBXA 5IT9U 2XYHB 2OFGX 4I7FB 2P9GA 1C1CB 1VMBA 3AXMA 4FYVB 2MYFA 1GX6A 1LFPA 4IG3B 3Q8UA 4NXMF 2J7WA 3G8QA 1SC1B 2V68A 1FWLA 2HVDA 3QIDA 3D7SB 4OHZA 3ICLA 1MMNA 4LT6A 2ERRA 2GVDA 1NKCA 4NZ6A 3DRSA 4TQSA 3KLEB 1R31A 3KJNB 1VGYA 3VGUA 2X7IA 4RUBA 1SC3B 2QYCA 1S9EB 3CJ5A 3KLHB 3MM8A 4TXSA 3N6NA 3N6LA 2CPIA 2ROGA 1UAWA 4ES1A 4NRTA 2B51A 3DU5A 4KRWA 2UUBF 3FJ2A 1JMTA 1XMOJ 2PGCA 4OQJA 2K3IA 1X9SA 1UW9A 3FVYA 1S49A 6FDRA 3SQGA 1KNZA 1Q78A 1TVRA 2XNRA 4L3KA 1XTZA 4DX6A 1Q0NA 2HHVA 5J2QB 2MSTA 2E29A 1C1BB 3EYZA 3DRRB 4ZPVR 3CCRS 2DXFA 2OEKA 3MCNA 3VZHA 1Y9OA 4HH0A 1CULA 2ZH6A 2YNIA 2FLNA 1PYSB 3W5XA 2J6TA 4JI7J 4K4XA 2IRUA 2UVUA 4HTJA 5AXKA 3JTPA 5AJ3F 4FYYB 4LBPA 3BGRA 4MYUA 3RTVA 2M5YA 4MIAA 2PDAA 3ZZPA 3LWLA 3IR5B 4XPEA 4DL3A 2RKIA 3QRPA 1FKPB 3FFIA 1NK6A 3KWMA 4EBDA 2PFDA 3OL6A 1VQPS 1EQMA 1WTBA 3LP1B 5HROB 2LKZA 2YNGB 2KXHA 4A8OA 2KRBA 4W90B 5H1SV 3IG1A 5CYQA 4IFYA 4UZCA 1VBZA 4F8RA 2DNNA 2YPZA 2NUUG 2DNMA 4NL5A 3GR1A 3MPUB 4QW9A 4RBTA 4NLXA 3DOLA 1U0HB 1C0UA 2BJ7A 4EBEA 3CF5Q 1FEHA 1K9MT 1IWAA 2JC1A 3IAS9 2HIYA 3SSQA 3BJYA 5GAHU 2QLBB 2AEMA 5ETVA 1YKWA 2Q6CA 1LV5A 3OL7A 4U7UK 2ZZMA 4Q8EA 2V34A 3IMQJ 3A4TA 4AL7A 3I5AA 5KFPA 3GZ7A 5LT5A 3RW6A 2EI5A 1EIYB 2KL8A 1TAUA 3LPEA 1RHUB 1RT3A 4YMEA 5KG2A 3IRXA 5LOQA 4PKDB 5IS2A 2YKOA 2EG1A 2Q3PA 2VU5A 2FLPA 2K7KA 4JI3J 3MR3A 2P9CA 2J7KA 8ATCB 2N3OA 2UU9F 3EVMA 3F73A 3H20A 4F4WA 2DIUA 5KFVA 2RT3A 1NZAA 3BO2A 1HFEL 2A6MA 4ED3A 4ZHRB 1UPPA 3GCWP 3ZNUA 2VD3A 4R8UB 3QLHA 4YR0A 4RW4B 4KGMA 5IQ6A 1JLEB 5C42A 3BGLA 1GTEA 1YDLA 4GC6A 1IKYA 1IR1A 4ZVUB 2WZ1A 3TQEA 1DQ8A 2OJ3A 2R2UA 2CQ4A 2AP6A 4ZCLA 3DXBA 5HMXA 1UJ5A 3ETMA 3DGPA 1Z4UA 1N52B 2JHEA 3UPFA 1UA0A 3DRXA 5J2PB 1Q7LB 4AT1B 1N4LA 1ZH5A 1HQUA 1UZHA 1XJWB 4NYOA 3ISZA 1UWBA 1LW0B 1JLCB 2OD6A 2ZKUA 3CNQP 1H0HB 4H4OA 4EMDA 3GFHA 2C3MA 2V4QA 3NY0A 3ZO7A 4NI2A 3BBCA 4NA2A 1WDTA 2ZKTA 2YH1A 2W2QP 3NOCA 2EPIA 1CSJA 3HJVA 3RAMA 2VB6A 4I2PA 5KG1A 3T3FA 5KFFA 3VAJA 4P52A 1K1SA 1R6YA 2Q6BA 2HFSA 3FC9A 2I8EA 2PE8A 3T9ZA 3KHRA 3PG9A 1RTJB 4DCPB 5L1IA 1RHQB 3R6GB 5CYMA 2XCAA 3C14B 2CJ9A 2ZC3A 4JYAJ 1FEEA 3VF0B 1RTDB 4JI0F 1JLAA 1BQNA 1SB6A 2RE1A 5EN1A 3L95X 4WE1A 3PZPA 4OZ0A 4PWWA 2JLFA 3K0JA 1S1XB 1PCAA 3MEGB 1LOUA 4V19X 4DV3J 2XQCA 3PX6A 3F44A 2UVWA 4NPOA 1YX2A 4FF4A 2ZH9A 2IRYA 1HNZJ 1SV5B 3FZ2A 2WTFA 4ZVPB 1P1LA 4QWCA 2X1BA 4M5LA 5KT7A 4PRFA 1FFGB 2NQPA 2R7QA 4PG5A 4I64A 3ZZ0A 1YRUA 4Y3CA 2EKYA 2HQFA 1ITPA 3OTBA 4TY8A 3WIVA 1BLUA 2RD5C 1XERA 1KD1T 4LF8F 2QA4G 4GVBA 3J7A1 4LR7A 4QYZK 1Y5IB 2DNQA 3P4UB 4O3PA 1SUQA 3UW1A 1WUUA 2LLZA 2HKEA 4URGA 4DPTA 2XMTA 5K8NA 3O2IA 3KG4A 1NH7A 1LKZA 1VLYA 4DSIA 3N9UC 3I56S 4X64F 2NXJA 5EX0A 4WXOA 2C2MB 4DX5A 1FRLA 3CE8A 4LIWA 4ECUA 2MLYA 4JBCA 3BR8A 4N8OA 3LAMA 4Y2MA 2CPHA 3GFXA 3T1HJ 1S1UB 4DSEA 1S59A 4N5SA 5EUHA 4ZVFA 3BS9A 1AB8A 3ITHB 3D6HB 3H7HB 3J81Y 1U25A 4BS2A 3L7OA 4OI3A 4RX6A 3NNHA 2XMWA 2AZ3A 3DM2A 2VQFJ 3W8GA 1R0BG 2RNEA 2ZM6J 4ZVEA 3NMRA 4JI8J 5E0OA 5GAHI 2F4FA 4ZVGA 4TLQA 3JSMB 3PVXA 3ELHA 1X5SA 2VL1A 3D0HE 5LXYA 3DI6B 5HBMB 4DX7A 5HSPA 4M94A 2GNKA 4WKYA 2KM8C 3O1LA 4OX8A 3ILJA 1ZTTA 5A6PA 1LW2B 5CQGA 2EWHA 2O1PA 1VQMS 2VBXA 4C0OC 4L74A 4LSZB 2HBRB 2K7JA 2FVSA 1TELA 3QIPA 4JI1J 3M30B 3CJRA 2OMOA 1YK9A 3G82B 3NXZA 3R5DA 2Z2ZA 5EGYA 3TA2A 3HHLA 2R9LA 1YSJA 5KT2A 1PILA 4QZVB 2MTLA 4AL5A 1IXKA 1PJ5A 1HQEA 4G1QB 1DRZA 2XMJA 4OIXA 5KFIA 2N4CA 1GNKA 2XTJP 3OQ2A 1Q5VA 2Y1LB 2CJQA 1RT6A 3PW2A 2V4JA 1PYOB 3P6YC 4LF9F 4ED2A 5CA5A 2R7WA 4OYZA 1YJRA 4OZ5A 3TVKA 3NGDA 3NS7B 3UCGA 1RWPB 5KFEA 2VICA 3Q8YA 3V81A 1AZSA 1LWFA 3B4DA 1WC5A 1H73A 2W9AA 4X4RA 5KFNA 4B3SJ 5KG5A 1RAOA 1FF2A 1HMVB 2ZHOA 5IM0B 3MM5B 2MKCA 4OZNA 1S5ZA 3D66A 1NK9A 4GO7X 7FDRA 1EETB 2OAUA 2ZHAA 4V1Ak 1WHWA 2YWGA 2W7OA 2LQ9A 3KLIA 2HPUA 2GGPA 4DFPA 3L9ZA 4LIRA 3GFYA 3TP2A 1BXNA 3N28A 4ZMMA 4NXNJ 2V9WA 4IG3A 4I4BA 3MFHA 1GMUA 3QFHA 4DX8H 4FPRA 3S01A 4FZVA 1OPIA 2ZD1A 5T7LA 2BW7A 2OI2A 4B02A 1YJ7A 1DARA 2PEHA 2NZ4A 1BUXA 4U67Q 2ROEA 4MK9A 2FB0A 4G65A 4GKJJ 3KLEA 2GCFA 3R9LA 2KT5A 1GMWA 2DIVA 1FDDA 5U47A 4NLVA 1SKSA 2POKA 4GRSA 3PX4A 2FD2A 5LM7E 1XMQJ 2XZTB 4ZP6A 3LP0B 2IRXA 3G96A 2E7XA 2VC0A 2NXCA 2HNDA 4LFAJ 3HF5A 3EZ5A 4U96A 1GTHA 1KONA 2MEWA 3V6DB 4K0KF 2YPYA 3CJQA 2WHOA 5HLFB 1RWXB 3LA0A 3F41A 1RU2A 3EXYA 2DH9A 1SQEA 4OZLA 4B9LA 1NHKL 1YHQS 4O23A 1JX4A 3M6UA 4RW9A 4GKKJ 2W4PA 3QWPA 1C1BA 4ZVQB 4C3LA 1NDPA 3DRRA 2VFTA 4AQYJ 3KHHA 1QUVA 2OPPB 4K5RA 2JH3A 4LSLA 4KR0B 3WC0A 4QIEA 1OYEA 2A10A 2HVHA 1MNEA 2FIUA 4JUZA 3Q8PB 4WP9A 5KFAA 1E6YA 1U1PA 4KBIA 2VG6A 4WPAA 2UUTA 1H98A 4USHA 3CCLS 3H42A 2OPRA 4JOUA 2R3VA 1Y3KA 2HWTA 2YX1A 4I2QB 4YQWA 4KH1B 3GYGA 3AJDA 4W4MA 4KHPF 4USIA 4YR3A 4LQ3A 1EX8A 3J7AN 2ZE2B 4C8YA 1I5OB 1O6XA 2CQ0A 1DLOA 3M2UA 3DLEB 4YB5A 5KT6A 4ED5A 1EP4A 1YJNS 2ZBQA 1WOOA 2HHHJ 1NZ8A 3M32B 1PSDA 4J5OA 1KQSR 4P71A 1K0TA 1JJCB 3M1VB 1U0HA 3HCXA 2DCUB 3M9OB 3SDEA 1RLDA 4LRCA 4ID5A 3KK3B 1FTCA 2C22A 3HHEA 2XSFA 3CO9A 2BE7D 5HQLA 1RWWB 2MMYA 3NGUA 3D0IE 1RB0A 3C3LA 3GR0A 1UMJA 1FDNA 4ETXA 1OIAA 3IRWP 1FKOB 4KGXB 2H4WB 3O3LA 2RILA 3U1NA 3R5BA 3CJSA 3FBBA 1S6QB 4F3QA 2I38A 4QWEA 2M2BA 2CQDA 3KJFB 2E1PA 3UNYA 1Y11A 2D1CA 5DJBA 1G3OA 3MGJA 1RHMB 4FNHA 4M5DB 1JLGB 4KV8A 4PXEA 1DURA 1WI8A 4PXBA 1N6QA 1FNXH 2OGUA 1RABB 3OXGA 1JLEA 3HD2A 5CHCB 3PX0A 2UUCF 2HHPA 4TU7A 4CH7A 2VJUA 2G0IA 3THTA 2UXDF 1LWCB 1FDAA 1SJRA 4CQ1A 2CJKA 2QLFB 4H4KC 1N5SA 2DCLA 3OLBA 2VIHA 3M7VA 1GFWB 2U1AA 3PKMA 4F67A 3U02A 5ETMA 1B4SA 5LJ3Y 1M1HA 1LW0A 2V5HG 3HHDA 2YKMB 2FLOA 2UXBJ 1JIHA 2HLTA 3D2WA 3O6QA 1JJ2R 4F4KA 2Q66A 3D67A 2FYXA 1RCXB 1JK9B 1VQLS 4OV1A 4PCQA 1RT5A 4LREA 1WD6A 4USVA 5JVGQ 2DGVA 3G4SS 5FLXU 1X9WA 4CO3A 2G0JA 1KQGB 4DG1A 2BJ3A 2ACYA 1TKZA 2CNNB 3DMJA 2ZVIA 2GJIA 2HZCA 2SXLA 3ZNJ1 3AH6A 1F9EB 1NSKL 3AJ2A 5L9NA 5K14B 2IYGA 2DGTA 2HWIA 4AL6A 2BJ1A 3CJ0A 5DRKA 3GILA 2I5JA 5KFQA 2ABYA 3WBZA 2EFVA 4KSEB 4DR6J 1FXRA 4Q45A 2EFGA 2WONA 4OFZA 2RB7A 4CNYA 4E8UA 1X31C 1JNZB 4LMZA 1EARA 3IS9B 1HKAA 1BQXA 3MUVP 3KNAA 1S4EA 3KXDA 1S12A 2VPYB 4F0MA 2YKNA 2IM0A 3FMBA 1PBAA 4L76A 4IO1A 3HFKA 2EFOA 1X5OA 4A8SA 5HVGA 2AU0A 3SXLA 3OR2A 3TZZA 1DJ0A 4WKRA 1NK8A 3PDNA 2XMUA 1H38A 2FY1A 3SFGA 2HMIB 5KFBA 1XMOF 5KG6A 2XMMA 4RNNA 5DGAA 3GMGA 1KFDA 2DEIA 3OW2R 1LWEB 4ELUA 2J7UA 5ETKA 3D6TB 1N56A 3AQOA 5MLCV 1R8CA 1NB7A 4ICLB 3QGGA 4J9PA 2YNFB 2MKJA 1QSLA 3ZZUA 4KJIA 2QLXA 2RDIA 2CQCA 4MH8A 4WFZA 2GIQA 4JI7F 1FD8A 2V8GA 3S6EA 4JI2J 4LRAA 2P5VA 3HVTB 3HM9A 1A6LA 4GVLA 1ZM9A 3LP2B 1U24A 1PBUA 5C25B 4O0IA 3ILOA 2V2ZA 4EEYA 2R8GA 4FVMA 1T0TV 1YBUA 1S7HA 1H2UX 3LWMA 4ED4A 2VG7A 4JV1A 4RW6B 1L3TA 3H0PA 3QO9A 2MQNA 3PM9A 1IKWA 4CRJA 2V8PA 3A8EA 1Y3JA 2JVRA 1PAUB 5B0DA 2IA6A 5A8KA 2QYGA 1V5VA 1HR0J 3WDOA 4OZ3A 1D0EA 1BWVA 3CJTA 5IQQA 4WWSA 2MPUA 2PA8D 2IMOA 4OMFG 3DLGB 4HHUA 9ATCB 3NMAA 3VQSA 1HD0A 4L75A 2RF2B 4AXJA 4F4XA 4EZ9A 1EKRA 3QT7A 1SC4B 1WEXA 2PMWA 3Q8SB 5HO4A 1F5CA 4USJC 5L38A 3M30A 2MQPA 1RTIB 5B0BA 3CMAS 1VISA 3GG0A 3RB6A 5DM7Q 3RU0A 1K1QA 1JJHA 2BQUA 3I9ZA 2CYYA 4AD6A 2BKPA 1RKIA 4DL6A 2L9DA 3L4BC 3MFIA 2LDYA 4C4WA 1X60A 1U6FA 5FDLB 2ALZA 4C0HA 2F3JA 2HQIA 5I3PA 2PO4A 3PYFA 2MGZA 4JI3F 4ZLNA 2CPDA 2OTJS 2XB2D 2C2NA 4PG4A 1FT8A 5KG7A 4RUAA 2B9EA 4FP9A 1S4FA 2QL7B 4DR1J 3BSAA 2KG1A 4X4QA 3PJ9A 1UFWA 3VAKA 4RW7B 5A8RB 4WFYA 3DLHA 1ZAVA 4ECRA 2AJ1A 5DQHA 2B3TB 3P8BB 2AJ2A 2VBYA 4YB7A 2F5GA 1U8SA 1VC5A 2RQKA 3MM5A 1HW8A 1V5IB 2BE2A 4K4SA 3EGNA 3QT8A 4NA1A 1CJVA 4O4RA 2QSWA 1ZYQA 5LSLA 3KLFA 2DTJA 5F8GA 1IBKJ 4C8OA 1N5YB 1SBRA 2ZFHA 2BJ8A 3OPKA 2EVZA 3FUYA 4NYPA 4O3QA 2VG5B 2HYIB 2Z30B 5C5JA 1MMLA 2Q79A 2MHNA 2OPQA 3OL9A 4DR2J 1DQ9A 1IKXA 3CUNA 3K59A 3C6TA 2GX8A 2HZAA 3DOKA 1U2RA 5KFTA 4Q2LA 4F0HA 4X4TA 2KVIA 2ATCB 2AYMA 4PG6A 2ZH3A 1LWXA 1CS4B 4PPZA 2C3PA 4MJKA 1IR2A 1S1VA 4WBFA 4NZ7A 1GXLA 1VHFA 4NRUA 3TO8A 4B9NA 3HFZB 2KXFA 2DR8A 4ZPDA 1RZMA 4ZDNA 3TUIC 1MROA 2DNPA 1Z1ZA 4UUWA 3NOGA 3CCVS 3C16B 2IM1A 2Z2LA 3G6ES 4KTQA 3V6DA 4DV3F 5HLFA 4LVNP 4O3RA 5KOXA 1KLMA 2BR0A 3H5UA 1HNZF 1QUPA 3AD8C 2KG0A 2J0WA 2YKAA 2XO7A 3KLGA 2AEJA 5KFOA 3X1LB 1UVJA 3MR6A 4YFUA 4ZVRB 4CLKA 1HNVA 2B9XA 2NYHA 1SQFA 2Y3YA 2R8JA 2J76E 3CDEA 2ZC4A 3HULA 4NLTA 4TU9A 3KG0A 2D9PA 2Q1LA 2MLZA 5JUMA 1KQFB 1JLBA 2WRMA 3CULA 1QY7A 3KMQA 5K8PA 2ZVSA 3HKZD 1ZTWA 5HMZA 2FHJA 4JI4J 2AIRB 2CJAA 1VHIA 1RCOB 2Y1IA 4D3GA 3KUEA 4KQZA 4PUOB 1IJFB 1RHJB 3DLEA 2NR0A 4LSNA 2UP1A 3T1HF 5B7WA 3K57A 1R8AA 3VR1A 3DDKA 3DYAA 5I3UB 3M32A 4Y65A 2XG8A 4OYBA 3DFEA 3RUBL 2VQFF 4N76A 5L46A 3CGIA 1S1WB 2ZM6F 4JI8F 3ZTSA 1S97A 3QSIA 3QQCD 5KFHA 2G2ZA 3AAWB 2Z56B 1L3SA 2G2OA 3HMJG 5J1NA 2RRBA 2E5GA 1RT7A 3MM7B 4MKBA 1UEUA 1RAAB 2GV1A 2YQ3A 2CUYA 3GP9A 1NK5A 1UFLA 2FJDB 3UE2A 4JI1F 5F9LA 2AYGA 3M8QB 3G71S 4KHMA 1I3OB 8RUCA 1M5HA 4FDFA 2MY8A 3K5LA 3W64A 4PXDA 1VQ5S 5HJYA 4UY8T 4NLUA 5KT4A 5HMWA 2NXNA 5J2NB 4X4SA 4A8XA 4U7UD 2B7BB 3ZZRA 4E2FB 1VCTA 2JZ5A 2UU9J 3L7UA 2F9JA 3AD7C 1T3OA 4YB1P 3OTOJ 2YNHB 1LWCA 2RHQB 1NRKA 4TQRA 1S9GA 4DUZJ 2HGMA 2C2EA 3VVTA 5GADU 3I32A 4NLDA 2D9OA 3D3CJ 1AYEA 3M8PB 2BOPA 3VGTA 2H4YB 3HT3A 2JSXA 2ILYA 3VCDA 4USWA 4UW2A 4B3SF 1OJ4A 1IR0A 2O66A 3I0RB 2XS2A 4LF6J 2W8LA 3CJ8A 4K50A 4X4NA 2PD1A 1JKHB 4H4MB 5KFSA 4CCHA 5JMNA 4F50A 3BO3A 3UWTA 4WU3A 1M0SA 5C24B 5KFZA 2QMWA 5I42B 1I1GA 3W9HA 1TUVA 2C28A 3DRPB 1TAQA 1TP7A 4LQ9A 3KMSA 1W25A 3WX8A 5F0UA 1TL5A 2PEBA 1Y0HA 1LFWA 2V2VA 3ZTPA 5DO2A 4L73A 3TEHB 4R0JA 1EJ7L 2UUAJ 2DGOA 4ZKAA 4WTYA 2QA1A 4NXNF 1Y5NB 2ZUAA 5K14A 2ZZNA 1AA1B 3G6VA 4YDXA 2ZDOA 3JQKA 3LO3A 4USKA 2XSJB 1HBOA 2B4PA 5ETLA 3MMBB 2HNZA 2BJ9A 1JXVA 3GFZA 1O0PA 3MAQA 4GKJF 1T03B 3A3PB 4DUYJ 1HD1A 3BKFA 1KOOA 2E66A 5KFKA 3ENQA 3FQKA 4C11B 4P73A 1IKVB 4B9VA 2VPWB 5LJ5Y 2VA2A 1JQGA 2LA4A 1XMQF 3RBEA 3PTWA 2HBQB 1NJZA 3A8KA 1CLFA 2VOPA 4Q0BB 3OT9A 1RLCL 4WTOB 2N82B 1T9VA 1TZ0A 5L1JA 4U9RA 1DTTB 3PHTA 4DR7J 4LFAF 2XHCA 2CZVC 2ZOFA 1NU4A 3CIZA 1T9YA 5L8RC 3ILIA 5A0YB 2V9KA 2VV5A 3M4XA 1VQKS 5CD4A 2ZJRQ 4GKKF 1HI8A 4PYAA 1NHUA 2DVIA 3NAIA 4NE9C 3MCSA 1NJIT 4AQYF 1VRUA 3DU6A 5A6WA 4M5JA 4B3OA 5DDQC 4HTIA 1T94A 1XR5A 3CDBA 3SEOA 4KKOB 2D7SA 3RJMB 1WEYA 4HL9A 3IBWA 1FWPA 2FUG9 3KDNA 2VFUA 2V0NA 3N6MA 2ILZA 1P9QC 2GIRA 4E0DA 2FC8A 2EK1A 2BKNA 5A76A 5A8WA 3BM7A 4B3RJ 1PIEA 2LA6A 3UDEA 3MM6B 1N54B 2FVQA 3R27A 3M8RA 2J8SA 3E2EA 2OMLA 3OJUA 4Y2CA 1X9MA 4FS1A 3EGVA 3Q22A 4CM0A 3EE3A 2GJFA 1FNMA 3ENWA 1XMBA 4USTA 2CVIA 2WOMA 2QMUB 4EYHB 4XDDA 3OLAA 1N0VC 2XZDB 2HHHF 4DEZA 4K4TA 3CCUS 2HQGA 3EX7B 5ITHA 1R3NA 1DZ5A 1VQSA 1KHVA 3SQOP 4A8YA 3KJVB 3A12A 3VZIA 3TAPA 1LXJA 4YY3J 1IBLJ 3LPYA 3BR9A 3A8IA 2R2RA 5BYQA 5M2RA 5D0GA 1F0XA 1T9UA 4H4KA 4YS2A 1RYSA 2RS2A 1HW9A 4NLRA 3KJQB 1WSRA 3W60A 2J6SA 1XEZA 1I51B 1S0NA 1ZM3A 3T5JA 4C8ZA 1T95A 2MHEA 4NEZA 1RWNB 3R7BB 1IVZA 3N4WA 3CCWA 3V4IA 1S77D 4DLEA 3B82A 3UDVA 1IM6A 3K5NA 2D74B 2PMZD 1AUSL 4B9UA 3UD5A 5IV3A 2CNKB 2B9YA 1DTQA 2H3EB 3EVOA 1WOSA 3CJ4A 4Y28C 2G4BA 3A1YG 2OTLS 3T41A 1S0OA 3DHWC 1RTZA 4BDPA 3JSRA 4A47A 3PW7A 2BANB 1L3VA 1J5EJ 3R5GA 4FVCA 4IFVA 2FHKA
chains in the Genus database with same CATH topology
3FBBA 5BXIA 1LEOA 4EK2A 3MPDA 4KPCA 2BX6A 3FBFA 3L7UA 1EHWA 1MN7A 3FCVA 1F6TA 4FKYA 4W98A 1U8WA 3GPAA 5IOLA 3JS9A 4UOHA 2DXFA 3Q8UA 4S0MA 3ZTSA 3EM1A 1PAEX 4C6AA 1S5ZA 4HR2A 2HVDA 3B6BA 2DYAA 3FBCA 1KDNA 1NCLA 1BHNA 3ETMA 3PRVA 1S57A 3DKDA 3Q89A 1JXVA 1XQIA 1NDLA 4ANEA 2B8PA 1WKKA 2B8QA 4DUTA 3VVTA 1HHQA 3VGSA 3BH6B 2DY9A 3PJ9A 3DDIA 1BE4A 4ANCA 3B54A 1ZS6A 3VGTA 2HURA 3EMTA 1S59A 3ZTQA 4UOFA 3NGSA 3FKBA 1LWXA 1NSKL 1NHKL 3BBFA 3VGUA 1F3FA 5C7PA 3GP9A 3NGTA 4DI6A 3VGVA 3NGRA 1NDKA 4WBFA 3EE3A 1NPKA 1NDPA 1NB2A 2AZ3A 2AZ1A 1WKLA 1XIQA 3EJMA 4F36A 1PKUA 1NDCA 2DXEA 1WKJA 1NSQA 3VVUA 3Q83A 4O0NA 2VU5A 1B99A 1NUEA 3ZTOA 2NCKL 1MN9A 2BEFA 1HLWA 3EICA 1W7WA 1NLKL 3BBBA 3EVMA 3Q86A 3FCWA 3BBCA 1K44A 3EVOA 4CP5A 4DZ6A 4FKXA 3NGUA 3ZTRA 1NSPA 3ENAA 1BUXA 1VYAA 3WX8A 3ELHA 2DXDA 4F4AA 3FBEA 4ANDA 4UOGA 1HIYA 4ENOA 3ZTPA 3Q8YA 3R9LA 5CAAA 1B4SA 2CWKA 5CABA 3Q8VA 1UCNA 3EVWA 2HVEA 3BH7B 3FC9A 3G2XA 2ZUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBB A;  5BXI A;  1LEO A;  4EK2 A;  3MPD A;  4KPC A;  2BX6 A;  3FBF A;  3L7U A;  1EHW A;  1MN7 A;  3FCV A;  1F6T A;  4FKY A;  4W98 A;  1U8W A;  3GPA A;  5IOL A;  3JS9 A;  4UOH A;  2DXF A;  3Q8U A;  4S0M A;  3ZTS A;  3EM1 A;  1PAE X;  4C6A A;  1S5Z A;  4HR2 A;  2HVD A;  3B6B A;  2DYA A;  3FBC A;  1KDN A;  1NCL A;  1BHN A;  3ETM A;  3PRV A;  1S57 A;  3DKD A;  3Q89 A;  1JXV A;  1XQI A;  1NDL A;  4ANE A;  2B8P A;  1WKK A;  2B8Q A;  4DUT A;  3VVT A;  1HHQ A;  3VGS A;  3BH6 B;  2DY9 A;  3PJ9 A;  3DDI A;  1BE4 A;  4ANC A;  3B54 A;  1ZS6 A;  3VGT A;  2HUR A;  3EMT A;  1S59 A;  3ZTQ A;  4UOF A;  3NGS A;  3FKB A;  1LWX A;  1NSK L;  1NHK L;  3BBF A;  3VGU A;  1F3F A;  5C7P A;  3GP9 A;  3NGT A;  4DI6 A;  3VGV A;  3NGR A;  1NDK A;  4WBF A;  3EE3 A;  1NPK A;  1NDP A;  1NB2 A;  2AZ3 A;  2AZ1 A;  1WKL A;  1XIQ A;  3EJM A;  4F36 A;  1PKU A;  1NDC A;  2DXE A;  1WKJ A;  1NSQ A;  3VVU A;  3Q83 A;  4O0N A;  2VU5 A;  1B99 A;  1NUE A;  3ZTO A;  2NCK L;  1MN9 A;  2BEF A;  1HLW A;  3EIC A;  1W7W A;  1NLK L;  3BBB A;  3EVM A;  3Q86 A;  3FCW A;  3BBC A;  1K44 A;  3EVO A;  4CP5 A;  4DZ6 A;  4FKX A;  3NGU A;  3ZTR A;  1NSP A;  3ENA A;  1BUX A;  1VYA A;  3WX8 A;  3ELH A;  2DXD A;  4F4A A;  3FBE A;  4AND A;  4UOG A;  1HIY A;  4ENO A;  3ZTP A;  3Q8Y A;  3R9L A;  5CAA A;  1B4S A;  2CWK A;  5CAB A;  3Q8V A;  1UCN A;  3EVW A;  2HVE A;  3BH7 B;  3FC9 A;  3G2X A;  2ZUA A; 
#chains in the Genus database with same CATH topology
 3DGV A;  4DN9 A;  2DIT A;  3EXC X;  3K5M A;  4LFC J;  5GAE U;  3SI8 A;  4UOH A;  4N41 A;  4K2X A;  3TA0 A;  1VLO A;  4UUX A;  3MPW A;  4QOT A;  3VAH A;  1TL7 A;  2P9E A;  3CC2 S;  3C6U A;  4UTG A;  4RW8 A;  2GO9 A;  5CZV A;  3J80 Y;  4G3I A;  4BLG A;  1K73 T;  5E2Q A;  3E01 B;  5AE2 A;  3D1O A;  3KK2 B;  1KRP A;  3CDA A;  4AYB D;  4FXV A;  2GO8 A;  3CD0 A;  1JB0 C;  2UXB F;  1X4D A;  5F8H A;  3FGV A;  1TL3 B;  3T9N A;  1HQ2 A;  4K4V A;  1TKT A;  5DDR C;  4HEA 9;  3HHL C;  5CH7 B;  4X4P A;  3H8Y A;  1FER A;  2M52 A;  3DOM A;  4RBV A;  4Y2A A;  2E44 A;  4ZLL A;  2MQQ A;  5EWE A;  4U8Y A;  2BAC A;  1KR4 A;  4MK7 A;  3AHP A;  4KGV B;  3MMC A;  2H65 B;  4NCG A;  2CWX A;  3MM9 B;  4HI1 A;  4DV5 J;  4FF3 A;  2KJV A;  3BN7 A;  3HVR A;  3MEC B;  1UEV A;  2MKH A;  1UVL A;  3T19 A;  4IRK A;  1YBT A;  1W26 A;  1GX5 A;  1E6V B;  3WHI A;  4Q43 A;  3PIP Q;  2XY5 A;  4DR6 F;  4R5P A;  3HSG A;  2BMB A;  5HP1 A;  1SKU B;  2XS5 A;  5K8O A;  4N56 A;  1WC3 A;  3POT B;  4H54 A;  5L9X A;  2VUG A;  2WVC A;  3IM9 A;  3JTN A;  2RQ4 A;  5F8J A;  3OTE A;  4KGZ B;  3NNC A;  3DN9 A;  1U1Q A;  1NXI A;  4LF1 A;  8AT1 B;  1G4C A;  2DNK A;  4IDK A;  1REG X;  1FRM A;  1C0T A;  1K47 A;  1S6O A;  2HEK A;  1NB2 A;  4DS4 A;  2AGP A;  1IN0 A;  1NSA A;  1FFW B;  4C9D A;  4O0N A;  2H48 B;  2MY7 A;  4WYL A;  3CVK A;  4OHV A;  3TAM A;  3MD1 A;  1WJ9 A;  1X0F A;  1DBD A;  5SZT A;  4D3H A;  4DSJ A;  5CAA A;  4KO0 A;  2IY5 B;  3TR5 A;  3TEG A;  3J81 U;  4YN3 B;  1UCN A;  4N47 A;  3CSK A;  1N32 J;  2DB1 A;  3P5B P;  3MEE B;  1MN7 A;  5J2M B;  4LF2 A;  1RAF B;  4JI2 F;  3PW0 A;  4HKQ A;  2VZ9 A;  3JTO A;  4QU7 A;  2DHS A;  4C3K A;  4NMX A;  2JFD A;  2AGO A;  4PUO A;  4PWD A;  2BRK A;  4ECS A;  1KQK A;  3CME S;  1RT4 B;  1NPR A;  2LP4 A;  2GAH C;  3FMW A;  4F2S A;  3MAA A;  2VQE J;  3AD9 C;  2DO4 A;  2Y1J A;  5KTQ A;  3EMT A;  3ZTQ A;  2IM2 A;  2ZH7 A;  5B08 A;  2GZO A;  4X84 A;  3QJL A;  1ZM2 A;  1RI7 A;  2XHW A;  1RWK B;  5HJX A;  3QGH A;  4QYR A;  2AZ1 A;  1HR0 F;  2ZJP Q;  3T1Y J;  1Q81 T;  4TY9 A;  1EZZ B;  3UD4 P;  3B78 A;  4ZLP A;  2J0X A;  3OJS A;  5T14 A;  1TK0 A;  1MU2 A;  3JYT B;  2PN6 A;  2BDP A;  5F8N A;  1VQ4 S;  5B0A A;  3CMQ A;  1WG4 A;  3MM7 A;  4OX7 A;  4C8L A;  1RYR A;  1FK9 B;  1S6U A;  3OFG A;  2DRD A;  2K06 A;  1SL1 A;  3TX0 A;  1QVG R;  2ZWO A;  1PC4 A;  4WCE Q;  3UCU P;  2E1A A;  5HMY A;  1NEE A;  2V50 A;  1UJ4 A;  1SQG A;  4HI2 A;  3J7Z 5;  3P3D A;  1S76 D;  1QAJ A;  5KG3 A;  2XWX A;  1RAG B;  2KH9 A;  2W4C A;  4G1I A;  2HNY A;  4J9K A;  2E7W A;  2R7S A;  2OEM A;  3EZU A;  4LRF A;  5K5M A;  1RT1 A;  1FD2 A;  1RA6 A;  3HDS A;  1FX4 A;  1M5V C;  1SIZ A;  3D28 A;  4EU0 A;  1HNX J;  1LNQ A;  2ATL A;  4DBQ A;  3C15 A;  5GAE I;  4ZVT B;  1HI0 P;  3NWR A;  2I1R A;  2IPO B;  2AW0 A;  4DR1 F;  2OP5 A;  2LU1 A;  1D8Y A;  4YB6 A;  1T05 A;  4J9U E;  4LRB A;  1KSP A;  1T3N A;  3OL8 A;  1UEK A;  2XGP A;  1VQY A;  4QWD A;  4J7C A;  2HVE A;  1RP5 A;  5F3Z A;  4RPF A;  4ZP8 A;  5F41 A;  4M5N A;  1ICE B;  3W1Y C;  3PJX A;  1T9W A;  3UI3 A;  2AX1 A;  1VQ8 S;  5D3G A;  3BEG B;  5HK4 A;  2JEJ A;  4NX9 A;  4RNH A;  4X66 J;  3BGU A;  2IVF B;  5ETR A;  1ARO P;  1GQE A;  3UDL A;  3NS5 A;  1H6K X;  1IBK F;  3L7P A;  5KT3 A;  3A3O B;  4WFA Q;  4DQP A;  4ILR A;  1LK7 A;  5DDO C;  1VQN S;  1JLF B;  3VQT A;  3PY8 A;  1REV B;  4MIB A;  3IO1 A;  1NPK A;  3H90 A;  1B0P A;  3OFH A;  4LFB F;  4DR2 F;  4ZP9 A;  1TKX A;  2LEC A;  2UXC J;  2R7V A;  2QC3 A;  1OSD A;  3TAQ A;  1NSP A;  2CJX B;  4ZCI A;  1F5B A;  2HLU A;  3C8Y A;  1BY9 A;  5CXT A;  4KPY A;  3TW0 A;  1IKV A;  4WP8 A;  2F8H A;  5H9F J;  4RUC A;  3M9N B;  1QSS A;  3MED A;  1TMJ A;  1F9F A;  1TTH B;  1TMM A;  1M5S A;  1CJU B;  2RAQ A;  4PPD A;  3GON A;  5BYS A;  2F1F A;  4C6A A;  4CLZ A;  1SIW B;  3CTR A;  2CAD A;  3T5K A;  3LGH A;  5JVH Q;  5LMU J;  4IUF A;  1RBL A;  2FZC B;  4DV4 J;  5HQM A;  1DFD A;  2J0Q D;  2BOA A;  2B8P A;  3CD7 A;  2PI5 A;  4HAC A;  4O3S A;  4KFB B;  3R5C A;  1S1T A;  4QR2 A;  3E3X A;  1U47 A;  2HFZ A;  2HHQ A;  3TAR A;  4IRC A;  4DL5 A;  3AFG A;  1YJT A;  2ZBR A;  3UR3 C;  2M8H A;  2M4M A;  2BM0 A;  1U1M A;  2QL5 B;  1M5O C;  4FYW B;  1WDD A;  1KFS A;  1RTH A;  4P75 A;  1X0P A;  4I68 A;  1WF1 A;  2V94 A;  4P2S A;  3H4D A;  2W9C B;  5CYJ A;  3THP A;  2ZBI A;  4QPT A;  3BPD A;  3MM6 A;  2XM3 A;  2UVV A;  2MZT A;  2K8G A;  2CQ2 A;  4CTA A;  5E3C A;  3TX8 A;  4CIO A;  5GAG U;  1XNQ J;  2WB4 A;  4URQ U;  3Q24 A;  2MJU A;  3W9J A;  2W7P A;  3UFC X;  2DH7 A;  4N7T A;  4OJ3 A;  4JI4 F;  3I4P A;  1JLQ B;  3QT5 A;  2QO3 A;  1PJ7 A;  4PXC A;  3FZB A;  4RZR A;  1WF2 A;  3A8J A;  2GVZ B;  4IG0 B;  4XTT A;  3OVS A;  2IMW P;  3KJV A;  1WC0 A;  2IHR 1;  2DH8 A;  3I5C A;  1AW0 A;  1WOR A;  3AA8 A;  5DDP C;  4DL2 A;  2L9N A;  1X7V A;  4X62 J;  1S6P A;  4YEA A;  5AXL A;  1SC6 A;  2PFF B;  2QA4 S;  1MG7 A;  1W7W A;  4K4Z A;  4DR5 J;  2FJB B;  4N77 A;  4DF4 A;  2MXY A;  4DQS A;  4FBT A;  3NKY A;  4DJB A;  4ILM A;  1NKB A;  1RGV A;  3OR1 A;  1UET A;  2MZ1 A;  5F8I A;  1YI2 S;  3ZZT A;  1S9F A;  2BYC A;  5BYR A;  1ULR A;  2R2T A;  4JI6 J;  2B4V A;  1C4A A;  1D9A A;  4MKY A;  3EDQ B;  2KJW A;  3RBZ A;  2JEI A;  2YBV A;  4X2B A;  3HJF A;  3RGI A;  2FJA B;  3SZ2 A;  4KHR A;  1HYS B;  2UV8 G;  2E1R A;  5JXS A;  3AB2 B;  2L9W A;  2V8V A;  4HHH A;  1BQM A;  3BBF A;  3IGN A;  5HQ8 A;  2IVY A;  3GIJ A;  1WHV A;  2M0G B;  2VDI A;  4KT0 C;  3OTO F;  3SV3 A;  1NJY A;  1B0V A;  4IOB A;  5IWA J;  4XIU A;  1WKJ A;  2XY7 A;  2KDO A;  2GHP A;  4DUZ F;  3NLC A;  4TVA B;  2L08 A;  2BEF A;  1C4C A;  4DV6 J;  3VAG A;  1RHR B;  4Y6I A;  2MZS A;  3LW5 C;  4ENO A;  4DWI A;  4Q44 A;  3BQ2 A;  4TN2 A;  1CG2 A;  2DO0 A;  2V8D A;  1RT2 A;  4LF6 F;  2P6S A;  3QZ7 A;  2GVD B;  4ECY A;  4P72 A;  4TYA A;  3NP5 A;  3DNC A;  3DRS B;  1RWM B;  2LEA A;  1OWX A;  3R7S B;  3SSR A;  3ET6 A;  2HBY B;  4ID8 A;  2UUA F;  4K4W A;  3MM8 B;  2BRL A;  5M2P A;  1U49 A;  5C2G A;  2RRA A;  1SJF A;  3MM9 A;  2OEJ A;  1ZA1 B;  1TQL A;  2RML A;  2N7C A;  3W2V B;  1SI9 A;  5B0G A;  1DAX A;  4DCJ B;  7FD1 A;  5J1P A;  3OBI A;  1VQ6 S;  4F0K A;  4HLB A;  1AUD A;  5FII A;  1R0A B;  3SQG B;  1U09 A;  3KG1 A;  4Z37 A;  2IDE A;  2HGN A;  3RB0 A;  1FRK A;  2IBK A;  2HVI A;  4DZ6 A;  4DUY F;  5EDW A;  2EFQ A;  5LXR A;  4K2J A;  5GME A;  4ED0 A;  5D6G A;  1FVQ A;  2FJE B;  5KFM A;  2KFN A;  1Q1K A;  4EGL A;  1CUL B;  4J9S A;  2YNI B;  2BJD A;  3HT0 A;  1ZOT A;  4ILL A;  3UVJ A;  1HAR A;  2EBG A;  2HFO A;  2ZH8 A;  2DR7 A;  2BX6 A;  5KFR A;  4ZLJ A;  1FI4 A;  2EKN A;  2CFX A;  4P2F A;  2VOO A;  4S0M A;  4M5H A;  3BGR B;  3AOC A;  4DR7 F;  2DT9 A;  5CCM A;  3KKF A;  4DZD A;  4V19 J;  3PRV A;  3FFI B;  4BHQ A;  3CCE S;  2LYV A;  3JB9 k;  1YJ9 S;  2E9Z A;  4KAI A;  1HBU A;  7AT1 B;  3IR7 B;  2QEX S;  3S7R A;  4CO4 A;  5C7P A;  2J9D E;  2OSR A;  4M95 A;  3M2V A;  4QIG A;  3MEE A;  5CYQ B;  4IOA Q;  6FD1 A;  4OX9 J;  4IFY B;  1GAO A;  2B6A B;  3ZTO A;  1WHY A;  2DR5 A;  1TK8 A;  2DIS A;  2H51 B;  3DXS X;  3C66 A;  2CPE A;  4B3R F;  1SKR A;  2CNL B;  3HI9 A;  2DHG A;  3DOL B;  1C0U B;  1RT4 A;  2COL A;  4N8N A;  3CPW R;  4YUD A;  1R8P A;  2X51 A;  1AT1 B;  1U4B A;  5E3P A;  1Q86 T;  4ITS A;  3OUY A;  2QIF A;  4O44 A;  5GMK a;  2XI2 A;  1U0S A;  3EM1 A;  4ED6 A;  2LFV A;  2V8H A;  5B0C A;  2GJ2 A;  3IR6 B;  3KFW X;  4ZVO B;  3H2V E;  2H1Y A;  3FK4 A;  4ES2 A;  1RT3 B;  3GJR B;  5HAT A;  2W4D A;  3IRX B;  4K5S A;  2FHJ D;  1TFY A;  3QJJ A;  1FK9 A;  1SXL A;  3FSY A;  2HK3 A;  1V9O A;  4UF4 A;  4CM2 A;  4YY3 F;  1IBL F;  1UKU A;  1MWQ A;  4TKT A;  4I1T A;  1U48 A;  3PJW A;  1N48 A;  4QJV A;  4CO1 A;  4F04 B;  3R8Y A;  1HBN A;  5C42 B;  2JFK A;  2MQO A;  4WU2 A;  1IKY B;  3C19 A;  3W5Z A;  4DV0 J;  3THV A;  4ECT A;  4CO5 A;  1GXT A;  3TJ9 A;  2RQM A;  4Z7Y A;  4NAS A;  4ZJL A;  2HGL A;  3M05 A;  2HK2 A;  2B5J A;  3DGP B;  1FRJ A;  2QSF A;  5C2C A;  3VAM A;  3QT6 A;  4RWX A;  5IT0 A;  4MFB A;  4ALZ A;  1VK8 A;  1U8W A;  1TL1 A;  2EFP A;  1KLN A;  3UQS A;  3M2R B;  4DV7 J;  1HQU B;  3K17 A;  3PW4 A;  1EKS A;  4B17 A;  1Q8I A;  1KVJ A;  3HKW A;  1BHN A;  3Q89 A;  2MSS A;  4B9M A;  2W2O P;  4ANE A;  3MPY A;  1HHQ A;  2R7O A;  1U7L A;  1PG5 B;  1OSC A;  2XMA A;  2GW8 A;  2W2M P;  1J5E F;  4H4O B;  1R8B A;  4OYX A;  3TZW A;  3FKB A;  5GMD A;  4LFC F;  1WG1 A;  1F3F A;  1YRT A;  4X65 J;  1XNR J;  1GH8 A;  2HFN A;  1CJK A;  3GCX P;  5G0R A;  2C2O B;  3H98 A;  4EI2 A;  4I2P B;  1DHM A;  4O4G A;  4FN5 A;  1KBR A;  3ZZY A;  1U1K A;  3JAM Y;  2K1R A;  2AMC B;  3OFE A;  2CQ1 A;  4ERD A;  1X4C A;  2L41 A;  1XK8 A;  1JLA B;  3EVW A;  3C46 A;  3M6V A;  2NXE A;  1H2V Z;  1WSV A;  4WE1 B;  1HWI A;  3QRR A;  1QE1 A;  3FCV A;  2DGW A;  3QPI A;  1QSY A;  5J1E A;  2V69 A;  3V6J A;  1I6J A;  4I7F A;  1C1C A;  1S79 A;  1WKK A;  4CYU B;  4DUT A;  5M2U A;  2ADB A;  4CLS A;  4BCA A;  1VC0 A;  4YDD B;  4DV5 F;  4G1P A;  3I6P A;  1WAC A;  1ELO A;  4KYZ A;  4UZB A;  4WZM A;  2IM3 A;  2OSQ A;  1RAE B;  4TY8 B;  2N7Y A;  3QYY A;  3K7R A;  1UW4 A;  1RBO B;  2KZM A;  1WKL A;  2U2F A;  2LQB A;  3RRK A;  2I0X A;  2NPF A;  5E3A A;  4ETZ A;  3MR7 A;  1O5J A;  4RO0 A;  2KT2 A;  2JX2 A;  2KTQ A;  1SUQ B;  2RSQ A;  2AWZ A;  2D41 A;  3PKY A;  2BW2 A;  5F8L A;  2QN6 B;  2GML A;  3MD3 A;  1IJE B;  4CLY A;  2FDN A;  1X4B A;  1MMD A;  4EWT A;  1S9E A;  3SV4 A;  3KLH A;  5DG8 A;  3FDS A;  2JWN A;  2IYI A;  2OHD A;  3HSJ A;  3BQ0 A;  2UZA A;  3BH7 B;  3ISN C;  2BV3 A;  4HDG A;  2NS1 B;  5IOL A;  4JI5 J;  5J2Q A;  1WWH A;  1YG0 A;  4NCB A;  4IH5 A;  5DG7 A;  3MDF A;  3AQP A;  2FZK B;  3AB4 B;  3DM2 B;  2W9C A;  2V67 A;  3DLK B;  2RJZ A;  4TLR A;  1GEH A;  3MTJ A;  1N32 F;  2WVE A;  1KP6 A;  4ED8 A;  1Q8B A;  2FGO A;  2A6O A;  3MAH A;  1VBY A;  2AJ4 A;  4DHV A;  3M8Y A;  3V4M A;  3K5P A;  4ZN3 A;  2KHC A;  3R5J B;  2HAI A;  2IAJ B;  4XAK A;  1UJ6 A;  1N5Q A;  2FHM A;  4PR6 A;  4G6V B;  2MB0 B;  1FKP A;  2VQE F;  3AY0 A;  4FKX A;  3NEK A;  3PW5 A;  1IQT A;  3Q0A A;  1Y5L B;  4WFB Q;  3LP1 A;  4B3T J;  2VFV A;  4GC7 A;  2L3M A;  4ZPA A;  5HRO A;  1KVI A;  2YNG A;  3BPS P;  3NNA A;  2W9B B;  3PEH A;  2MZJ A;  5HAN A;  3R6L B;  5HAO A;  3T1Y F;  4HT5 A;  4C8K A;  3RZA A;  2LEB A;  5KOW A;  4C8M A;  3GPA A;  4C2M A;  2WW4 A;  3OD2 A;  2FJW A;  4DR4 J;  4IQX A;  3HHL B;  5ETQ A;  5BR8 F;  4UOC A;  3E51 A;  1BWE A;  3PNI A;  2CZ4 A;  4ATN A;  3S8S A;  1G1X A;  1HQE B;  1XR6 A;  1Q95 G;  4A48 A;  3UR0 A;  2AJ0 A;  4DS5 A;  4E98 A;  1QTN B;  1F5A A;  3UNG C;  2V4R A;  5KFX A;  4K8R A;  2G9O A;  1FRH A;  3GTY X;  3RB4 A;  4QU6 A;  3M8S A;  2VA3 A;  1QAI A;  2CXE A;  5JJB A;  1F1B B;  2V4J B;  3I87 A;  3SBM A;  4LF5 J;  5DG9 A;  1SCJ B;  2RH3 A;  1G6B A;  2KB2 A;  3ONQ A;  1PO6 A;  3V81 B;  1AZS B;  1LWF B;  2NCK L;  5DLG A;  2FQQ B;  2GMJ A;  2OLW A;  1D09 B;  2YX4 A;  1ZAX A;  5KFL A;  4UQT A;  4AUK A;  5IV4 A;  1S48 A;  2CAJ A;  1F3V A;  2MKI A;  3WC2 A;  1HNX F;  4QBU A;  3HX9 A;  4OLO A;  2MZR A;  1OY9 A;  4ED7 A;  4J90 A;  3G87 A;  1GK8 A;  4ZHR A;  3MMJ A;  4R8U A;  3KLI B;  2ZJQ Q;  2GGP B;  1NKE A;  1T11 A;  4ZN1 A;  4RW4 A;  1JWW A;  3U7J A;  2DPJ A;  4ECV A;  3R7N B;  2QV6 A;  4C0B A;  4CZC A;  2GIF A;  4M5G A;  2VON A;  2R7R A;  1J5O B;  3WX4 A;  3LQV A;  2M88 A;  4ZJQ A;  4LF7 J;  1VQ7 S;  3KK1 B;  3R1L A;  2ZD1 B;  5T7L B;  4KC5 A;  4A8F A;  4RR5 A;  5J2P A;  3C2P A;  3W62 A;  2WSE C;  1DY3 A;  4DSF A;  3IBF B;  1CEZ A;  3SCI E;  4RWW A;  3BGF A;  3AOD A;  1MW7 A;  3PIO Q;  1KEK A;  1WC6 A;  2YKQ A;  4X66 F;  1JLC A;  2QG9 B;  3MOZ A;  3VAL A;  3PFE A;  2JVO A;  4FYX B;  1PC5 A;  4PWU A;  2RU9 A;  3GWC A;  2DY1 A;  2KI2 A;  2XMK A;  2WK4 A;  4ELT A;  3W2V A;  3BN4 A;  2HND B;  3F56 A;  4FNI A;  3D1H A;  2QRR A;  3MR2 A;  2WVB A;  1R0A A;  1WNE A;  4EO8 A;  1UFK A;  5D0E A;  2UXC F;  2EK6 A;  4GO5 X;  4OI4 A;  1YRX A;  2LXF A;  3PO5 A;  4RW9 B;  1RTJ A;  1NK7 A;  2Y8Y A;  3RG6 A;  2CDR B;  4DLG A;  3C14 A;  3PHE A;  4B9S A;  4DV1 J;  1P6T A;  3TJA A;  1W2B R;  3CB4 A;  1B7Y B;  3MPV A;  1RTD A;  4LSL B;  2JEF A;  4X4V A;  3CCS S;  4ELV A;  2G2Y A;  1OY8 A;  2MKK A;  1HL6 A;  3EPI A;  1H3D A;  1E6Y B;  2BQR A;  2Z8Q A;  2VG6 B;  1S1X A;  3MEG A;  3J7Y U;  1YBA A;  5LMU F;  4DV4 F;  1S7I A;  1YWX A;  2OPR B;  1N0U A;  5HVH A;  4QIF A;  2W1B A;  2E5H A;  1SV5 A;  3W65 A;  2NLW A;  3QGP A;  3U1L A;  1FCA A;  2QFJ A;  2UV8 A;  4RNF A;  3H25 A;  2VDH A;  3M2U B;  1DLO B;  3SCJ E;  3OXL A;  4HHJ A;  1EHW A;  2O01 C;  2OUG A;  1EP4 B;  4XK8 C;  4IH7 A;  1R7I A;  4A4J A;  4HR2 A;  1A0O B;  1D9D A;  2B6A A;  2DYA A;  2DBB A;  3NWG A;  3W5Y A;  2CKW A;  3IC1 A;  2RDD A;  1L5U A;  1WHX A;  4KIA A;  5IFM A;  3I9V 9;  3QAE A;  5D77 A;  3SDE B;  5E33 A;  2C2R A;  1XNQ F;  1RBA A;  2F4V J;  1Q8L A;  4ID5 B;  4QCL A;  2NRE A;  3KUH A;  2C2Z B;  2PI4 A;  1HHS A;  3SCK E;  2RUG A;  2RDJ A;  1IBM J;  3WQP A;  5KFW A;  5AT1 B;  1S1U A;  3ITH A;  4ED1 A;  1YIJ S;  4WJB A;  1G7C B;  3P96 A;  2LDI A;  3PEJ A;  2E5J A;  2DHA A;  1JNR B;  5T41 A;  4PQU B;  3B8H A;  4OZJ A;  1F60 B;  4DMZ A;  4JV2 A;  3X3U A;  3TZY A;  2HAF A;  5L1L A;  1TU0 B;  3KOA A;  3N5F A;  2ASY A;  4KV8 B;  5AXN A;  3JSM A;  1HNW J;  2B4O A;  4X62 F;  1FJE B;  4OZ1 A;  2DD8 S;  3HP6 A;  1N6Q B;  3TVZ A;  3CIM A;  3DI6 A;  5HBM A;  1N8R T;  2E5I A;  4DSK A;  3MI7 X;  3OHA A;  2QMX A;  3D1Q A;  4DR5 F;  4I6Y A;  1SKW A;  3G9C A;  4F3M A;  4OI1 A;  2WBR A;  1LW2 A;  3TJ8 A;  3OTC A;  3LAK A;  3N0V A;  3QAT A;  1ZZN A;  1KOH A;  3GV7 B;  2OH2 A;  3G82 A;  4ZK7 M;  4JI6 F;  4L72 B;  3CCM S;  3VVU A;  3M2R A;  4QW8 A;  3NL0 A;  2F8E X;  3FSX A;  3FSI A;  4DQR A;  4G1Q A;  3J80 U;  2J6U A;  3DRY A;  4WFX A;  2DR9 A;  4J9Q A;  1DQA A;  3AT1 B;  1EQ0 A;  2DHX A;  2E7V A;  2CWK A;  2XS7 A;  4OYI A;  2M8D B;  1FJG J;  3ETO A;  5IWA F;  4ZPC A;  1HWL A;  1RT5 B;  2R8I A;  1U6B A;  2B4U A;  2O3D A;  4DG1 B;  5A2Q Y;  1TKZ B;  4DV6 F;  3DMJ B;  3JQJ A;  3EPG A;  1N36 J;  4ZVS B;  4CLP A;  4AFF A;  2AEF A;  3BYP A;  1HMV A;  1CC8 A;  5IM0 A;  5HL7 Q;  2K3K A;  1ZZF A;  5D15 A;  1HNI B;  4PG7 A;  2HS0 A;  2I5J B;  4QQB A;  2MZQ A;  2CQH A;  1EET A;  2NXU A;  1BD6 A;  3BQ1 A;  2WON B;  2WB1 D;  1RAH B;  4IH6 A;  2ADC A;  4BC7 A;  4ER8 A;  3UO0 A;  3PO4 A;  4F02 A;  2BAB A;  3VV2 B;  3F0N A;  1Q7Y T;  2FVP A;  4P10 A;  5IZH A;  3MMA B;  2YKN B;  2AQ4 A;  1FDB A;  2W24 A;  3W2W B;  3SFU A;  4CYU A;  2I6W A;  1VYA A;  3H5X A;  3UN5 A;  1RQ0 A;  3N79 A;  3MCM A;  3OR2 B;  4LFB J;  3G8S A;  1H72 C;  1TK5 A;  2JJ4 D;  3Q8V A;  1D1U A;  2IA0 A;  2R4F A;  4PAB A;  3T5H A;  3TZX A;  1XN9 A;  4QIW D;  2CPX A;  3J7Y I;  4WK3 A;  3D5M A;  1FRI A;  3SSS A;  2G13 A;  2DGS A;  1XQI A;  3HSZ A;  3PYD A;  2BKO A;  2CPZ A;  1R89 A;  4RU9 A;  2H5E A;  5F0W A;  3LP0 A;  1Y10 A;  1CBK A;  4OHW A;  1SL0 A;  4Z7C A;  2E5L F;  4YOE A;  1P9Y A;  1VIO A;  3PR5 B;  2KYZ A;  2XLJ A;  2VKR A;  3GII A;  3GU0 A;  2VG7 B;  3V2U C;  1MWY A;  3TOQ A;  1IQZ A;  2E1C A;  4RL1 A;  1RKJ A;  3QO9 B;  1IKW B;  3HXM A;  1OQ6 A;  2KU7 A;  4NLO A;  1UVN A;  1ZPW X;  3DLK A;  3R1H A;  3Q2S C;  3WIU A;  2OPP A;  5A8K B;  1V6H A;  4HYK A;  3N5B A;  3OHB A;  3CW2 C;  3RW7 A;  3ZZZ A;  1VR6 A;  2D3Z A;  3TI0 A;  4OX9 F;  2EXU A;  5LMN J;  2M70 A;  1O8B A;  4P6Q A;  4WII A;  4B08 A;  3GB0 A;  2ZUG A;  2IAJ A;  2FJV A;  5H9E J;  1QM9 A;  1MLA A;  2CRL A;  2MKY A;  3Q8Q B;  4HVZ A;  3U27 A;  4KY3 A;  4I2Q A;  3HO1 A;  2DY9 A;  3E8O A;  2ZE2 A;  2W9B A;  3J7Z T;  5BJR A;  3TAN A;  1CQN A;  5F8M A;  3I5B A;  4F36 A;  3KUG A;  2ZNZ A;  3G6Y A;  3BZQ A;  1NPP A;  5E5N A;  1NLK L;  1VQ9 S;  3M1V A;  2HQ3 A;  4F4A A;  2MGZ B;  3NCQ A;  4DPY A;  4MK8 A;  3KK3 A;  1FRX A;  1RWO B;  4P2X A;  1UL3 A;  5IXU A;  3W61 A;  2Z2M A;  3DCA A;  3S1T A;  2HHS A;  3GYN A;  3UN2 A;  2ZBC A;  1N5V A;  3SCL E;  4NEY A;  2AGQ A;  2BM1 A;  3HK2 A;  3CWJ A;  4LR9 A;  3GV8 B;  1U1L A;  1NK4 A;  2R7T A;  1FKO A;  2AJQ A;  3VAI A;  3GJQ B;  4DV0 F;  1S6Q A;  3D68 A;  3D6M B;  3T5L A;  5ETO A;  2HVZ A;  2YY3 A;  4ECQ A;  4K4U A;  2YWE A;  3BH6 B;  2AKW B;  2OPS B;  4RBU A;  1CPZ A;  2PMH A;  2NSC A;  2GQQ A;  1EAY C;  1WG5 A;  2DGU A;  4WYW A;  1Y00 A;  4M5D A;  1JLG A;  2BE2 B;  4LF4 J;  2LXU A;  1SJ1 A;  1FE0 A;  3OTD A;  4F7V A;  5LSR A;  1RWU A;  1CJV B;  1L3U A;  2CJY B;  5KFJ A;  4DV7 F;  5H9F K;  1UWA A;  2ZWP A;  1Q53 A;  3KLF B;  3O8W A;  2IFX A;  4Z2X A;  2C1E B;  1Q5Y A;  2APO A;  1A9N B;  1YJV A;  2HSE B;  1KTV A;  1J5O A;  4J9M A;  3CCZ A;  4WF9 Q;  4RNM A;  4X65 F;  2OPQ B;  3TUZ C;  3KK1 A;  1XNR F;  1IKX B;  3VAF A;  2ASL A;  5IC6 B;  1SJ4 P;  2ZH5 A;  2NPI A;  3C6T B;  1FNO A;  1GT8 A;  3DOK B;  2D3O 1;  3DDN A;  3V6K A;  4A8Q A;  1KDN A;  4P9S A;  1A7G E;  4FBU A;  1YTY A;  2GQ2 A;  1S1V B;  2A1B A;  2YKM A;  3HFV A;  1MSW D;  3DLB A;  2ZH2 A;  1H74 A;  5B0E A;  1PJ6 A;  1MRO B;  5IT9 Y;  4NLP A;  3PRB A;  3NGT A;  4L6V 3;  5F9N A;  4PAA A;  1N34 J;  3GQC A;  2HS3 A;  3L3C A;  5F3T A;  4NLS A;  1KHW A;  1RDR A;  2IDL A;  1KLM B;  1L3K A;  1KTQ A;  2D3O R;  2DR6 A;  4M8L A;  1U6Z A;  3LGM A;  1UP1 A;  3SIP B;  3V6H A;  3KLG B;  3PYG A;  1U1N A;  5CZX A;  4W92 B;  1HNV B;  1TUW A;  2BA9 A;  3LAN A;  3MEK A;  4ZIT A;  2GC8 A;  3MF5 A;  4LBI A;  4J9O A;  2O5D A;  1UVM A;  3IS9 A;  4IQM A;  1OPZ A;  1JLB B;  2ROP A;  2WVD A;  2KM8 B;  2ZH4 A;  2YWK A;  1NDL A;  3T6B A;  1S72 S;  2XEX A;  4ZIW A;  1HBM B;  4QR1 A;  5HI7 A;  4B3M J;  3BSN A;  1FJC A;  3W3S A;  3NGS A;  2HMI A;  1YGY A;  5B0F A;  5MAO A;  2BE9 B;  1MWZ A;  1FA0 A;  2XWY A;  1T9T A;  2V63 A;  3NS6 A;  4LSN B;  1LWE A;  4JI5 F;  1B0T A;  2JNJ A;  3TVY A;  1HHT P;  1T7P A;  1ACM B;  4YR2 A;  1R43 A;  1FO1 A;  3O44 A;  3DYA B;  1T9X A;  1YIT S;  4USM A;  4OV6 A;  3GSD A;  4ICL A;  3EIC A;  3BBB A;  3Q86 A;  2YNF A;  1D3W A;  3P49 B;  5L1K A;  2HQC A;  3FBE A;  4TU8 A;  4K59 A;  2ZOM A;  3MTK A;  3HVT A;  3DLL Q;  4Y34 A;  2C2D A;  1O51 A;  1RSC A;  3IAM 9;  5CD4 H;  3LP2 A;  4DV2 J;  2CQ3 A;  5KAK A;  2QFI A;  1QAX A;  3CC4 S;  2MLX A;  5C25 A;  3R2C J;  1RT7 B;  2IJN A;  1C2P A;  4TYB A;  4DN0 A;  4CLT A;  3H4B A;  4RW6 A;  3IWX A;  3JXO A;  2EBE A;  4PQU A;  4B3T F;  2GAG C;  4J9R A;  4ANC A;  4PQA A;  2D69 A;  4EYI B;  1X4H A;  2IBO A;  2KRR A;  3VWS A;  2FHO B;  5K9F A;  4DI6 A;  4U7C A;  2CIM A;  3D4J A;  4DR4 F;  3PXG a;  2BJE A;  3FNN A;  4Y00 A;  3H2U B;  3Q2T C;  2E1M C;  3DLG A;  3LGN A;  2VC1 A;  1Q79 A;  2RF2 A;  2IJR A;  2ZOG A;  2X1A A;  2Z58 B;  2QJ3 A;  3IM8 A;  4CI0 B;  2X3D A;  2XUL A;  2KVQ E;  2EFN A;  4NML A;  4LF5 F;  3RRG A;  1JXE A;  4I67 A;  4DL0 C;  3L09 A;  1RTI A;  5D4L A;  1S9G B;  3FBF A;  2MQM A;  3ULH A;  3H5S A;  4KB7 A;  4OYW A;  2CPJ A;  1RUS A;  4MKA A;  3QBC A;  2Y1R I;  1TKD A;  2DNZ A;  3IGV A;  2C2K B;  1B3T A;  2MQL A;  1HI1 A;  2IIH A;  5FDL A;  4LRD A;  1NHV A;  3KTQ A;  4CLL A;  2HHU A;  2AYB A;  3H40 A;  1YJW S;  4A8M P;  4ECX A;  3GJS B;  4DPU A;  1SH3 A;  4DXL A;  2H5J B;  1B70 B;  2JLG A;  4WXW A;  1T02 A;  1XIQ A;  1PGZ A;  5GAD I;  2E9R X;  3QFW A;  4RW7 A;  5A8R A;  3U1M A;  2RQC A;  2BBE A;  2FC9 A;  3BSC A;  2QE5 A;  2VFR A;  3BSO A;  1VRT B;  3QWU A;  1RE1 B;  2LU2 A;  4X4O A;  4MKV A;  4LF7 F;  3HHL D;  1RWV B;  3H5Y A;  4I69 A;  4YHH J;  2HW3 A;  2R8H A;  1HNI A;  2GFF A;  1HBO B;  2BZ2 A;  4RNO A;  2DRA A;  2HNZ B;  4MYT A;  2HFV A;  3PRD A;  2Z57 B;  4FKY A;  5DQG A;  4JP8 A;  2A2D A;  3MMA A;  4XO0 A;  4F4Z A;  2WAQ D;  2B43 A;  1N5Y A;  1FVS A;  2WSC C;  3CT9 A;  2I9S A;  2P6T A;  3W2W A;  4WK1 A;  1X5P A;  5I3Q A;  1ZM4 A;  2VG5 A;  4R0E A;  2FGC A;  3FQL A;  1ZPV A;  3M8Z A;  4ZCK A;  2DGQ A;  2Y0B B;  3KDO A;  2JRS A;  2YKP A;  3W9I A;  2A2C A;  5LSO A;  1CVJ A;  3K58 A;  1WEL A;  2GQC A;  4PYD A;  3EDR B;  5EWG A;  1TUG B;  2A3J A;  2QLW A;  1CS4 A;  3NBP B;  4J9L A;  2DNO A;  4MT1 A;  4CP5 A;  2CPY A;  1VRU B;  4DV1 F;  3JSB A;  4U6P A;  4B3O B;  1VJW A;  1V3S A;  3NGK A;  1QTM A;  1M5P C;  3G6X A;  4ECZ A;  3V5R A;  3QZ8 A;  3LOU A;  2CQI A;  2J0S D;  5BXI A;  3C16 A;  2KKH A;  2LVW A;  5A8W B;  2MJN A;  2CZ9 A;  4LBH A;  1FES A;  4WP3 A;  4PEO A;  1WC4 A;  1D9F A;  2QL9 B;  1NM2 A;  2FJX A;  1Q82 T;  4F2R A;  3R3T A;  5I4M A;  3EGW B;  4I6W A;  3B54 A;  3TUP A;  1GMW D;  2AT1 B;  1YVF A;  3NCP A;  2WOM B;  2OEL A;  2LQ8 A;  3LH2 S;  1TV6 B;  1LQ9 A;  2R42 A;  2HBZ B;  2VH7 A;  3QAU A;  2YH0 A;  1F2G A;  4RJV A;  2PII A;  2WCX A;  2UVR A;  4ZPB A;  2HG4 A;  2F4V F;  1VOM A;  1FKA F;  2FLL A;  2HHW A;  4AND A;  4UOG A;  1IBM F;  1CJT B;  4NYZ A;  4DL4 A;  1KN6 A;  4I56 A;  3PCO B;  2I2Y A;  1BGX T;  2IC3 B;  2VOD A;  4IOC Q;  2A0F B;  4DPX A;  5I3U A;  4J37 A;  4JV5 J;  2M7S A;  4Q7A A;  5CCL A;  1HPZ B;  4DFM A;  1YLX A;  4QYZ J;  2C3Y A;  2FY8 A;  4FPI A;  5ADZ A;  5KFC A;  1QD1 A;  2VFS A;  1S1W A;  3AJ1 A;  1OMS A;  4OJG A;  1SPB P;  3V4I B;  3O5T B;  2HFU A;  1UZD A;  1KC8 T;  3NAH A;  4NWB A;  3QJP A;  3Q23 A;  3RB3 A;  3I0S B;  1HNW F;  5BR8 J;  1DTQ B;  4BWJ A;  3ADA C;  1PYT A;  1FFS B;  1N33 J;  2EW9 A;  1TL4 A;  3FEZ A;  4OL8 A;  3TRG A;  2J9C A;  2H9Z A;  2AYE A;  2DJW A;  1GMV A;  5E41 A;  3UDC A;  3P45 B;  2WW8 A;  4IFV B;  5ETT A;  1OQ3 A;  1I94 J;  3NCR A;  3QGI A;  2LQ5 A;  2N3L A;  5AE3 A;  2OPS A;  3FRY A;  1RIS A;  1VRQ C;  4DR3 J;  2OD4 A;  1TL7 B;  3M8Q A;  3C6U B;  4RLE A;  4RW8 B;  2JC0 A;  2PSZ A;  4P74 A;  5EHH A;  1SJ3 P;  1LEO A;  1IBC B;  3TWZ A;  3QMQ A;  3RAQ A;  3JS9 A;  2YXL A;  3K89 A;  1NND A;  3QRQ A;  2DEJ A;  3CXC R;  4A46 A;  3LUY A;  3T1A A;  2HRU A;  5J2N A;  4C3M A;  3JAM U;  4OHY A;  5DZ6 A;  2XMV A;  2P8I A;  4I6A A;  3DDI A;  4ZOS A;  1TKT B;  5EX3 A;  1ZS6 A;  2QTW A;  2YNH A;  1FJG F;  4CDI A;  3BV8 A;  1U26 A;  4MMO A;  2ZHB A;  2OO4 A;  2GHV C;  3DOM B;  3OXF A;  2PC6 A;  2O67 A;  2G1D A;  1J2V A;  2D3U A;  2HQD A;  3OSN A;  3M8P A;  2DXE A;  3Q83 A;  3MMC B;  3HLU A;  4BWM A;  1N36 F;  2V6A A;  4NCG B;  3TA1 A;  1Q4R A;  4NXM J;  3SYZ A;  4ECW A;  1R8H A;  2LCW A;  2RS8 A;  1UTA A;  4OJ1 A;  4MAK A;  3I0R A;  1K44 A;  5RUB A;  3FEY B;  5LL6 d;  3RRH A;  4FXD A;  1S99 A;  4OLP A;  3UD3 P;  3W7B A;  1JKH A;  4H4M A;  4JYA F;  1CQM A;  4DOZ A;  4EFA C;  4ZA1 A;  4R5P B;  2RVJ A;  5CAB A;  1FX2 A;  5C24 A;  5HP1 B;  4K7Q A;  1XBW A;  5I42 A;  1FJ7 A;  3DRP A;  2DHH A;  3MPD A;  2Z4P A;  1SH0 A;  2X1G A;  3CCT A;  2V2K A;  3MHY A;  2RUS A;  4M5I A;  2R2S A;  1J27 A;  2J8A A;  2WBM A;  2BUN A;  1UVK A;  1VI7 A;  4IDK B;  1C0T B;  2B8Q A;  2CG8 A;  2FZG B;  1KKH A;  2J9E A;  2UUB J;  1Y7P A;  1SVD A;  2NSB A;  4IO9 Q;  1Z2L A;  2XSJ A;  3VTI A;  3MZI A;  5D8H B;  5KFG A;  3TAM B;  4QPX A;  3OSP A;  2MQ8 A;  3MMB A;  2XLI A;  1NDK A;  3ZZO A;  1HWK A;  3N01 A;  1RAD B;  1T03 A;  3IFE A;  4FF1 A;  1KWM A;  4F26 A;  2AX0 A;  1YQH A;  4C98 A;  1F2H A;  4KE5 A;  4C11 A;  4KO0 B;  4F3O A;  3AOA A;  2ZIT A;  3K2Y A;  3EGZ A;  5AE1 A;  1WOP A;  2A18 A;  1U2F A;  2B9W A;  1AFJ A;  4Q0B A;  1HBM A;  5AJ3 J;  3DHX A;  4IKA A;  1DTT A;  3UCZ P;  1XC9 A;  2W25 A;  4BC9 A;  4PWD B;  2RU3 A;  1OS5 A;  1Y4Z B;  1GXU A;  3GSI A;  4O3O A;  1IM4 A;  3MAA B;  3CD5 A;  1FE4 A;  5A0Y A;  1KVK A;  4CNZ A;  3R97 A;  2CDQ A;  1RAC B;  2X3G A;  2BVZ A;  3IBC B;  4ZCM A;  4CLF A;  5DET A;  5AXM A;  1YZ7 A;  2KZZ A;  2QA2 A;  4C7Q A;  4DPO A;  4KKO A;  2XNQ A;  4A8W A;  4DQQ A;  1KS2 A;  5LMN F;  1MU2 B;  1OYD A;  3BDP A;  1N88 A;  2AHO B;  3P5T L;  3I4H X;  3ZFV A;  1RU1 A;  3KHL A;  1SL2 A;  3EJM A;  1JJ4 A;  1PKU A;  2DNR A;  1NDC A;  4J9V A;  1NO8 A;  4Y0F A;  1WC1 A;  3FRZ A;  3PYE A;  1M5K C;  4XPC A;  5DQI A;  3H59 A;  1QDU B;  2W2P P;  4O3N A;  3GG1 A;  3I82 A;  4MTP A;  2KYX A;  4CLW A;  4CO0 A;  2YWW A;  4DQI A;  3CD6 S;  4P7V A;  4EBC A;  4KPC A;  2Y8W A;  4P7T A;  1F6T A;  4OZ2 A;  3UN3 A;  3CC7 S;  3GJT B;  1CC7 A;  4QIV A;  4IYQ A;  2Q43 A;  2HNY B;  3W8P A;  3IWL A;  2QZ8 A;  1NH8 A;  4Y2I A;  1S10 A;  1RT1 B;  2XY6 A;  2RIJ A;  4DFK A;  2LQJ A;  3C15 B;  1H2T Z;  4DU8 A;  1SH2 A;  1FHT A;  2VF3 A;  2FVC A;  5FD1 A;  1RK8 A;  2H5I B;  2KXN B;  4URS A;  2FTR A;  3MWB A;  2OIH A;  1T05 B;  2XI3 A;  1H7W A;  4RU2 A;  1NSQ A;  3NRB A;  4TNO A;  4AE5 A;  4CH1 A;  1X4E A;  1QVF R;  5K20 B;  2B7C B;  4CT9 A;  2DPI A;  2C3U A;  2ACM A;  3TUJ C;  3KNG A;  4EO6 A;  3EUN A;  1X4G A;  4LF4 F;  5K8M A;  3BKU A;  3BKT A;  3D3B J;  3GLJ A;  4OJH A;  3HVW A;  3CJK B;  2AJF E;  2XYP B;  5D3G B;  2ZEJ A;  3CCJ S;  5E7O B;  1P8G A;  3ZXW A;  3MUR P;  3RBD A;  1ZET A;  4M63 A;  4GMK A;  3AXK A;  2BAN A;  4CO2 A;  1BMQ B;  2OFH X;  3D9B A;  4RUH A;  2KT3 A;  3OV7 A;  1VRT A;  4U8V A;  2XC9 A;  4ZPT R;  1NJX A;  4M5M A;  2P2C B;  3GV5 B;  2B56 A;  3EWG A;  3CO0 P;  3PR4 A;  2E9T A;  2F65 A;  1TKX B;  2YX7 A;  2F8M A;  4KGK A;  4LJM A;  3NGR A;  3GIM A;  2CJB A;  2CQB A;  2R7U A;  3M9M B;  3E01 A;  4DDF A;  3KK2 A;  1NJW A;  2YQ1 A;  2EG2 A;  2NUH A;  1HLW A;  1B64 A;  3IN5 A;  3MED B;  4JI0 J;  1FTR A;  3ENA A;  3BF4 A;  1TL3 A;  3KHG A;  5FLX Y;  2DNH A;  4F25 A;  4R25 A;  4Y2K A;  3PV8 A;  4IR9 A;  3A3N B;  4OI2 A;  4ZJO A;  4USU A;  1N34 F;  2Y0S D;  4LR8 A;  2MKS A;  4W98 A;  2C3O A;  4HAC B;  3HPO A;  2EC2 A;  4Q8F A;  2JL9 A;  2JOQ A;  1S1T B;  1NBE B;  2G0C A;  2CQP A;  2F9D A;  3G86 A;  3NBP A;  1XWL A;  5E3Q A;  3MEC A;  1S57 A;  4EUV A;  2ZDP A;  2VAS A;  3T6J A;  3HHK A;  2G1H A;  2DNG A;  2C42 A;  1VDH A;  1E6V A;  3RYL A;  3VHQ A;  1TVR B;  2VBW A;  4LF8 J;  4HDH A;  2HUR A;  4QWB A;  2XO6 A;  1RTH B;  2HWH A;  1VJQ A;  3POT A;  2Z0G A;  4DSL A;  5G4D A;  1ROF A;  3OFF A;  5E3R A;  2CA9 A;  2ZNY A;  2M3D A;  2YWF A;  4JB8 B;  1B99 A;  2J5A A;  4CTA B;  2EEY A;  1X8D A;  5GVQ A;  4X64 J;  1U2C A;  1LXN A;  1M1K T;  2QGF B;  3ZTR A;  5B09 A;  3AOB A;  4FYD A;  2E5L J;  5DGB A;  1QLN A;  4B3M F;  1HIY A;  2W01 A;  4ES3 A;  1VQO S;  2AV5 A;  2B0G A;  1OY6 A;  3LF0 A;  2ALY B;  2QX0 A;  1TV6 A;  2RKI B;  2GS8 A;  4DU7 A;  1URN A;  2BQ3 A;  2OKQ A;  4PG8 A;  4RKU C;  1YJU A;  3ENV A;  4IR1 A;  2L48 A;  3B6B A;  4OYP A;  1F9H A;  4J91 A;  5GAG I;  4WZQ A;  3DKD A;  4OYO A;  3IG1 B;  3BDE A;  4WFN Q;  1UA1 A;  5J2M A;  3VGS A;  5D4O A;  3BB5 A;  3RR7 A;  1BE4 A;  4DV2 F;  3BGO P;  1S6P B;  1WF0 A;  4BBY A;  4FXW A;  2WVF A;  1ZA2 B;  4UOF A;  1S0M A;  1RAI B;  1CJT A;  1M90 T;  5FJ4 A;  2N4D A;  5DS7 A;  3TYT A;  2IC3 A;  4WIQ A;  4OHX A;  4ZIV A;  6AT1 B;  3LAL A;  3OR1 B;  1HPZ A;  3CJ3 A;  5KT5 A;  1LK5 A;  3KYL A;  1IUJ A;  3H2L A;  3W66 A;  2UUW A;  3Q8R B;  3DC2 A;  1U02 A;  1Q8K A;  5EWF A;  3BO4 A;  2AF6 A;  1RA7 A;  2H54 B;  2KFZ A;  1QAY A;  3B4M A;  5IC4 B;  3D0G E;  1WTF A;  4DFJ A;  3I0S A;  3JYT A;  1VIX A;  5KFY A;  1VK3 A;  4DCO B;  3IA0 A;  2XCP A;  4CWB A;  3HZG A;  4L3N A;  2PT0 A;  1PAE X;  4OYM A;  2GMH A;  1BQM B;  2V2Q A;  3I96 A;  1NCL A;  2XBP A;  5D4P A;  3GYX B;  1TFW A;  1ZBT A;  3CJ2 A;  3IXQ A;  3HHN B;  3CED A;  4LF9 J;  3RBX A;  3PFO A;  3QLH B;  1UPM B;  2GHW A;  2KHD A;  2JDJ A;  2AD9 A;  4XDC A;  1G2E A;  4OX6 A;  3DLJ A;  2J9D A;  5A2Q U;  1NUE A;  2MDA A;  5KG4 A;  3R5A A;  4DPW A;  4OI0 A;  1RT2 B;  2W8K A;  3TQ1 A;  4NLW A;  5KFU A;  2HHT A;  3GE9 A;  2F63 A;  3ILL A;  3HD1 A;  2Z2Y B;  3G8T A;  5ETP A;  1VC6 A;  1RXO B;  1R0C B;  2HRY A;  2DKO B;  1D8Z A;  1UWB B;  5D0R A;  2EC0 A;  1SJQ A;  2R8K A;  1FXD A;  4LVO P;  3MR5 A;  3GIK A;  3AA9 A;  3ET6 B;  4NLY A;  1V3R A;  4DL7 A;  2HHX A;  1W2I A;  2JLE A;  2W7A A;  5D0H A;  3K8V A;  3HVA A;  5L39 A;  9RUB A;  4NI2 B;  1NME B;  3K5O A;  3J81 j;  4EZ6 A;  1HA1 A;  4YHH F;  3D6F B;  2CVE A;  4NLQ A;  2HZV A;  2KFY A;  3PAC A;  5DZ7 A;  2VPX B;  3EZO A;  2KO1 A;  2F40 A;  5CYM B;  1NK0 A;  3TNV A;  2HS4 A;  4HT7 A;  1BQN B;  1M1G A;  3QNW B;  2DRB A;  5ETS A;  2XLK A;  1JLF A;  3UVJ B;  1REV A;  4MIW A;  4C97 A;  5H9E K;  1VFJ A;  2FPH X;  4K0K J;  1QJH A;  3OVB A;  4OYA A;  3BRE A;  4CH0 S;  1K0V A;  1R6V A;  2Y9H A;  2HIQ A;  4ZS6 A;  1X5T A;  2XZW A;  3FCH A;  4LUB A;  3ISN D;  4ZPW R;  1HBU B;  1WI6 A;  3FBC A;  1H7X A;  3JSY A;  2CQG A;  1AXQ A;  3CDU A;  3M2V B;  4A8K A;  4J9N A;  1CJU A;  1HWU A;  4GVB B;  3I31 A;  4CT8 A;  4OI6 A;  2RHS B;  1V3Z A;  4FF2 A;  2QLJ B;  4C8N A;  3VGV A;  4C48 A;  1Z2Z A;  4KFB A;  4PZV A;  1OO0 B;  4NZ0 A;  4QWA A;  4HH1 A;  1HWJ A;  1IWG A;  2KN4 A;  5DM6 Q;  2GA7 A;  1T8E A;  2VHG A;  1RJJ A;  3RAX A;  3QSY B;  1JXL A;  1MN9 A;  5HVF A;  3OUY B;  4O44 B;  4KHP J;  3GIR A;  3IP0 A;  4U95 A;  1XR7 A;  2DGX A;  1NAQ A;  2ASD A;  2CNO B;  3MXH P;  4Q5V A;  2LEP A;  2R7X A;  3M8W A;  3WZ0 A;  1YZ6 A;  3G2X A;  3MUT P;  4FS2 A;  2NYI A;  2VPZ B;  5DLF A;  4AXI A;  1S0V A;  4DF8 A;  4UT4 A;  2F7V A;  2VBZ A;  3R2D J;  3CCQ S;  2WSF C;  4KH0 B;  2DK2 A;  3A13 A;  2CG4 A;  2XYG B;  2RRN A;  4M1K A;  1RHK B;  4UQG A;  1ZAW A;  1U1O A;  5ETN A;  1JLQ A;  1HBN B;  2CPF A;  2BXJ A;  2ZBP A;  3K8W A;  3MCO A;  4YP3 A;  2NZC A;  3W63 A;  1R27 B;  5HN0 A;  2GVZ A;  1N5T A;  4IG0 A;  2VKZ G;  1U45 A;  4JV5 F;  3QIP B;  4QR0 A;  1P1T A;  5THW A;  3US5 A;  5KG0 A;  2B5J B;  3CDW A;  2LXI A;  2HRT A;  4MFB B;  1EB0 A;  4IRD A;  1AFI A;  3FEX B;  3IWN C;  4NCA A;  1TL1 B;  3RR8 A;  2IVM A;  5SUH A;  3MOJ B;  5D4N A;  2X1F A;  1Q16 B;  2YVS A;  2ASJ A;  1APS A;  4M5K A;  3HSD A;  1N33 F;  2IJF A;  4EK2 A;  3JQM A;  2ZZT A;  2YWH A;  3M6W A;  4JV0 A;  2UUC J;  2YTC A;  1U1R A;  4P2M A;  2DNL A;  4NLG A;  3NG8 A;  1VS3 A;  2M9K A;  1RT6 B;  2JEG A;  3KLV A;  3MUM P;  1I94 F;  2UXD J;  5D78 A;  1URR A;  4NOH A;  2VJV A;  3BYR A;  4CLU A;  4DR3 F;  1CJK B;  5G0R B;  2DNY A;  4Q2M A;  3I55 S;  2LMI A;  1FWK A;  1X4F A;  1P27 B;  4F4Y A;  2FVR A;  3OVA A;  4O4G B;  3M6X A;  5KFD A;  3CJK A;  3HZE A;  5IT4 A;  3SMZ A;  4I0W A;  3ZC4 A;  3D54 A;  1HYS A;  1X4A A;  2K2P A;  2K1R B;  2PA3 A;  2ZH1 A;  2W2N P;  4K4Y A;  4UY8 5;  1RAJ A;  2YQ0 A;  2XGQ A;  1FXL A;  2QT7 A;  4B9T A;  1WEZ A;  1K8A T;  4X4U A;  3LTO A;  3FCW A;  4ZVH A;  1VBK A;  4ZP7 A;  1QE1 B;  2DXD A;  1BC6 A;  1B7F A;  1UVI A;  5J1E B;  4NA3 A;  1TR0 A;  1VBX A;  5IT9 U;  2XYH B;  2OFG X;  4I7F B;  2P9G A;  1C1C B;  1VMB A;  3AXM A;  4FYV B;  2MYF A;  1GX6 A;  1LFP A;  4IG3 B;  3Q8U A;  4NXM F;  2J7W A;  3G8Q A;  1SC1 B;  2V68 A;  1FWL A;  2HVD A;  3QID A;  3D7S B;  4OHZ A;  3ICL A;  1MMN A;  4LT6 A;  2ERR A;  2GVD A;  1NKC A;  4NZ6 A;  3DRS A;  4TQS A;  3KLE B;  1R31 A;  3KJN B;  1VGY A;  3VGU A;  2X7I A;  4RUB A;  1SC3 B;  2QYC A;  1S9E B;  3CJ5 A;  3KLH B;  3MM8 A;  4TXS A;  3N6N A;  3N6L A;  2CPI A;  2ROG A;  1UAW A;  4ES1 A;  4NRT A;  2B51 A;  3DU5 A;  4KRW A;  2UUB F;  3FJ2 A;  1JMT A;  1XMO J;  2PGC A;  4OQJ A;  2K3I A;  1X9S A;  1UW9 A;  3FVY A;  1S49 A;  6FDR A;  3SQG A;  1KNZ A;  1Q78 A;  1TVR A;  2XNR A;  4L3K A;  1XTZ A;  4DX6 A;  1Q0N A;  2HHV A;  5J2Q B;  2MST A;  2E29 A;  1C1B B;  3EYZ A;  3DRR B;  4ZPV R;  3CCR S;  2DXF A;  2OEK A;  3MCN A;  3VZH A;  1Y9O A;  4HH0 A;  1CUL A;  2ZH6 A;  2YNI A;  2FLN A;  1PYS B;  3W5X A;  2J6T A;  4JI7 J;  4K4X A;  2IRU A;  2UVU A;  4HTJ A;  5AXK A;  3JTP A;  5AJ3 F;  4FYY B;  4LBP A;  3BGR A;  4MYU A;  3RTV A;  2M5Y A;  4MIA A;  2PDA A;  3ZZP A;  3LWL A;  3IR5 B;  4XPE A;  4DL3 A;  2RKI A;  3QRP A;  1FKP B;  3FFI A;  1NK6 A;  3KWM A;  4EBD A;  2PFD A;  3OL6 A;  1VQP S;  1EQM A;  1WTB A;  3LP1 B;  5HRO B;  2LKZ A;  2YNG B;  2KXH A;  4A8O A;  2KRB A;  4W90 B;  5H1S V;  3IG1 A;  5CYQ A;  4IFY A;  4UZC A;  1VBZ A;  4F8R A;  2DNN A;  2YPZ A;  2NUU G;  2DNM A;  4NL5 A;  3GR1 A;  3MPU B;  4QW9 A;  4RBT A;  4NLX A;  3DOL A;  1U0H B;  1C0U A;  2BJ7 A;  4EBE A;  3CF5 Q;  1FEH A;  1K9M T;  1IWA A;  2JC1 A;  3IAS 9;  2HIY A;  3SSQ A;  3BJY A;  5GAH U;  2QLB B;  2AEM A;  5ETV A;  1YKW A;  2Q6C A;  1LV5 A;  3OL7 A;  4U7U K;  2ZZM A;  4Q8E A;  2V34 A;  3IMQ J;  3A4T A;  4AL7 A;  3I5A A;  5KFP A;  3GZ7 A;  5LT5 A;  3RW6 A;  2EI5 A;  1EIY B;  2KL8 A;  1TAU A;  3LPE A;  1RHU B;  1RT3 A;  4YME A;  5KG2 A;  3IRX A;  5LOQ A;  4PKD B;  5IS2 A;  2YKO A;  2EG1 A;  2Q3P A;  2VU5 A;  2FLP A;  2K7K A;  4JI3 J;  3MR3 A;  2P9C A;  2J7K A;  8ATC B;  2N3O A;  2UU9 F;  3EVM A;  3F73 A;  3H20 A;  4F4W A;  2DIU A;  5KFV A;  2RT3 A;  1NZA A;  3BO2 A;  1HFE L;  2A6M A;  4ED3 A;  4ZHR B;  1UPP A;  3GCW P;  3ZNU A;  2VD3 A;  4R8U B;  3QLH A;  4YR0 A;  4RW4 B;  4KGM A;  5IQ6 A;  1JLE B;  5C42 A;  3BGL A;  1GTE A;  1YDL A;  4GC6 A;  1IKY A;  1IR1 A;  4ZVU B;  2WZ1 A;  3TQE A;  1DQ8 A;  2OJ3 A;  2R2U A;  2CQ4 A;  2AP6 A;  4ZCL A;  3DXB A;  5HMX A;  1UJ5 A;  3ETM A;  3DGP A;  1Z4U A;  1N52 B;  2JHE A;  3UPF A;  1UA0 A;  3DRX A;  5J2P B;  1Q7L B;  4AT1 B;  1N4L A;  1ZH5 A;  1HQU A;  1UZH A;  1XJW B;  4NYO A;  3ISZ A;  1UWB A;  1LW0 B;  1JLC B;  2OD6 A;  2ZKU A;  3CNQ P;  1H0H B;  4H4O A;  4EMD A;  3GFH A;  2C3M A;  2V4Q A;  3NY0 A;  3ZO7 A;  4NI2 A;  3BBC A;  4NA2 A;  1WDT A;  2ZKT A;  2YH1 A;  2W2Q P;  3NOC A;  2EPI A;  1CSJ A;  3HJV A;  3RAM A;  2VB6 A;  4I2P A;  5KG1 A;  3T3F A;  5KFF A;  3VAJ A;  4P52 A;  1K1S A;  1R6Y A;  2Q6B A;  2HFS A;  3FC9 A;  2I8E A;  2PE8 A;  3T9Z A;  3KHR A;  3PG9 A;  1RTJ B;  4DCP B;  5L1I A;  1RHQ B;  3R6G B;  5CYM A;  2XCA A;  3C14 B;  2CJ9 A;  2ZC3 A;  4JYA J;  1FEE A;  3VF0 B;  1RTD B;  4JI0 F;  1JLA A;  1BQN A;  1SB6 A;  2RE1 A;  5EN1 A;  3L95 X;  4WE1 A;  3PZP A;  4OZ0 A;  4PWW A;  2JLF A;  3K0J A;  1S1X B;  1PCA A;  3MEG B;  1LOU A;  4V19 X;  4DV3 J;  2XQC A;  3PX6 A;  3F44 A;  2UVW A;  4NPO A;  1YX2 A;  4FF4 A;  2ZH9 A;  2IRY A;  1HNZ J;  1SV5 B;  3FZ2 A;  2WTF A;  4ZVP B;  1P1L A;  4QWC A;  2X1B A;  4M5L A;  5KT7 A;  4PRF A;  1FFG B;  2NQP A;  2R7Q A;  4PG5 A;  4I64 A;  3ZZ0 A;  1YRU A;  4Y3C A;  2EKY A;  2HQF A;  1ITP A;  3OTB A;  4TY8 A;  3WIV A;  1BLU A;  2RD5 C;  1XER A;  1KD1 T;  4LF8 F;  2QA4 G;  4GVB A;  3J7A 1;  4LR7 A;  4QYZ K;  1Y5I B;  2DNQ A;  3P4U B;  4O3P A;  1SUQ A;  3UW1 A;  1WUU A;  2LLZ A;  2HKE A;  4URG A;  4DPT A;  2XMT A;  5K8N A;  3O2I A;  3KG4 A;  1NH7 A;  1LKZ A;  1VLY A;  4DSI A;  3N9U C;  3I56 S;  4X64 F;  2NXJ A;  5EX0 A;  4WXO A;  2C2M B;  4DX5 A;  1FRL A;  3CE8 A;  4LIW A;  4ECU A;  2MLY A;  4JBC A;  3BR8 A;  4N8O A;  3LAM A;  4Y2M A;  2CPH A;  3GFX A;  3T1H J;  1S1U B;  4DSE A;  1S59 A;  4N5S A;  5EUH A;  4ZVF A;  3BS9 A;  1AB8 A;  3ITH B;  3D6H B;  3H7H B;  3J81 Y;  1U25 A;  4BS2 A;  3L7O A;  4OI3 A;  4RX6 A;  3NNH A;  2XMW A;  2AZ3 A;  3DM2 A;  2VQF J;  3W8G A;  1R0B G;  2RNE A;  2ZM6 J;  4ZVE A;  3NMR A;  4JI8 J;  5E0O A;  5GAH I;  2F4F A;  4ZVG A;  4TLQ A;  3JSM B;  3PVX A;  3ELH A;  1X5S A;  2VL1 A;  3D0H E;  5LXY A;  3DI6 B;  5HBM B;  4DX7 A;  5HSP A;  4M94 A;  2GNK A;  4WKY A;  2KM8 C;  3O1L A;  4OX8 A;  3ILJ A;  1ZTT A;  5A6P A;  1LW2 B;  5CQG A;  2EWH A;  2O1P A;  1VQM S;  2VBX A;  4C0O C;  4L74 A;  4LSZ B;  2HBR B;  2K7J A;  2FVS A;  1TEL A;  3QIP A;  4JI1 J;  3M30 B;  3CJR A;  2OMO A;  1YK9 A;  3G82 B;  3NXZ A;  3R5D A;  2Z2Z A;  5EGY A;  3TA2 A;  3HHL A;  2R9L A;  1YSJ A;  5KT2 A;  1PIL A;  4QZV B;  2MTL A;  4AL5 A;  1IXK A;  1PJ5 A;  1HQE A;  4G1Q B;  1DRZ A;  2XMJ A;  4OIX A;  5KFI A;  2N4C A;  1GNK A;  2XTJ P;  3OQ2 A;  1Q5V A;  2Y1L B;  2CJQ A;  1RT6 A;  3PW2 A;  2V4J A;  1PYO B;  3P6Y C;  4LF9 F;  4ED2 A;  5CA5 A;  2R7W A;  4OYZ A;  1YJR A;  4OZ5 A;  3TVK A;  3NGD A;  3NS7 B;  3UCG A;  1RWP B;  5KFE A;  2VIC A;  3Q8Y A;  3V81 A;  1AZS A;  1LWF A;  3B4D A;  1WC5 A;  1H73 A;  2W9A A;  4X4R A;  5KFN A;  4B3S J;  5KG5 A;  1RAO A;  1FF2 A;  1HMV B;  2ZHO A;  5IM0 B;  3MM5 B;  2MKC A;  4OZN A;  1S5Z A;  3D66 A;  1NK9 A;  4GO7 X;  7FDR A;  1EET B;  2OAU A;  2ZHA A;  4V1A k;  1WHW A;  2YWG A;  2W7O A;  2LQ9 A;  3KLI A;  2HPU A;  2GGP A;  4DFP A;  3L9Z A;  4LIR A;  3GFY A;  3TP2 A;  1BXN A;  3N28 A;  4ZMM A;  4NXN J;  2V9W A;  4IG3 A;  4I4B A;  3MFH A;  1GMU A;  3QFH A;  4DX8 H;  4FPR A;  3S01 A;  4FZV A;  1OPI A;  2ZD1 A;  5T7L A;  2BW7 A;  2OI2 A;  4B02 A;  1YJ7 A;  1DAR A;  2PEH A;  2NZ4 A;  1BUX A;  4U67 Q;  2ROE A;  4MK9 A;  2FB0 A;  4G65 A;  4GKJ J;  3KLE A;  2GCF A;  3R9L A;  2KT5 A;  1GMW A;  2DIV A;  1FDD A;  5U47 A;  4NLV A;  1SKS A;  2POK A;  4GRS A;  3PX4 A;  2FD2 A;  5LM7 E;  1XMQ J;  2XZT B;  4ZP6 A;  3LP0 B;  2IRX A;  3G96 A;  2E7X A;  2VC0 A;  2NXC A;  2HND A;  4LFA J;  3HF5 A;  3EZ5 A;  4U96 A;  1GTH A;  1KON A;  2MEW A;  3V6D B;  4K0K F;  2YPY A;  3CJQ A;  2WHO A;  5HLF B;  1RWX B;  3LA0 A;  3F41 A;  1RU2 A;  3EXY A;  2DH9 A;  1SQE A;  4OZL A;  4B9L A;  1NHK L;  1YHQ S;  4O23 A;  1JX4 A;  3M6U A;  4RW9 A;  4GKK J;  2W4P A;  3QWP A;  1C1B A;  4ZVQ B;  4C3L A;  1NDP A;  3DRR A;  2VFT A;  4AQY J;  3KHH A;  1QUV A;  2OPP B;  4K5R A;  2JH3 A;  4LSL A;  4KR0 B;  3WC0 A;  4QIE A;  1OYE A;  2A10 A;  2HVH A;  1MNE A;  2FIU A;  4JUZ A;  3Q8P B;  4WP9 A;  5KFA A;  1E6Y A;  1U1P A;  4KBI A;  2VG6 A;  4WPA A;  2UUT A;  1H98 A;  4USH A;  3CCL S;  3H42 A;  2OPR A;  4JOU A;  2R3V A;  1Y3K A;  2HWT A;  2YX1 A;  4I2Q B;  4YQW A;  4KH1 B;  3GYG A;  3AJD A;  4W4M A;  4KHP F;  4USI A;  4YR3 A;  4LQ3 A;  1EX8 A;  3J7A N;  2ZE2 B;  4C8Y A;  1I5O B;  1O6X A;  2CQ0 A;  1DLO A;  3M2U A;  3DLE B;  4YB5 A;  5KT6 A;  4ED5 A;  1EP4 A;  1YJN S;  2ZBQ A;  1WOO A;  2HHH J;  1NZ8 A;  3M32 B;  1PSD A;  4J5O A;  1KQS R;  4P71 A;  1K0T A;  1JJC B;  3M1V B;  1U0H A;  3HCX A;  2DCU B;  3M9O B;  3SDE A;  1RLD A;  4LRC A;  4ID5 A;  3KK3 B;  1FTC A;  2C22 A;  3HHE A;  2XSF A;  3CO9 A;  2BE7 D;  5HQL A;  1RWW B;  2MMY A;  3NGU A;  3D0I E;  1RB0 A;  3C3L A;  3GR0 A;  1UMJ A;  1FDN A;  4ETX A;  1OIA A;  3IRW P;  1FKO B;  4KGX B;  2H4W B;  3O3L A;  2RIL A;  3U1N A;  3R5B A;  3CJS A;  3FBB A;  1S6Q B;  4F3Q A;  2I38 A;  4QWE A;  2M2B A;  2CQD A;  3KJF B;  2E1P A;  3UNY A;  1Y11 A;  2D1C A;  5DJB A;  1G3O A;  3MGJ A;  1RHM B;  4FNH A;  4M5D B;  1JLG B;  4KV8 A;  4PXE A;  1DUR A;  1WI8 A;  4PXB A;  1N6Q A;  1FNX H;  2OGU A;  1RAB B;  3OXG A;  1JLE A;  3HD2 A;  5CHC B;  3PX0 A;  2UUC F;  2HHP A;  4TU7 A;  4CH7 A;  2VJU A;  2G0I A;  3THT A;  2UXD F;  1LWC B;  1FDA A;  1SJR A;  4CQ1 A;  2CJK A;  2QLF B;  4H4K C;  1N5S A;  2DCL A;  3OLB A;  2VIH A;  3M7V A;  1GFW B;  2U1A A;  3PKM A;  4F67 A;  3U02 A;  5ETM A;  1B4S A;  5LJ3 Y;  1M1H A;  1LW0 A;  2V5H G;  3HHD A;  2YKM B;  2FLO A;  2UXB J;  1JIH A;  2HLT A;  3D2W A;  3O6Q A;  1JJ2 R;  4F4K A;  2Q66 A;  3D67 A;  2FYX A;  1RCX B;  1JK9 B;  1VQL S;  4OV1 A;  4PCQ A;  1RT5 A;  4LRE A;  1WD6 A;  4USV A;  5JVG Q;  2DGV A;  3G4S S;  5FLX U;  1X9W A;  4CO3 A;  2G0J A;  1KQG B;  4DG1 A;  2BJ3 A;  2ACY A;  1TKZ A;  2CNN B;  3DMJ A;  2ZVI A;  2GJI A;  2HZC A;  2SXL A;  3ZNJ 1;  3AH6 A;  1F9E B;  1NSK L;  3AJ2 A;  5L9N A;  5K14 B;  2IYG A;  2DGT A;  2HWI A;  4AL6 A;  2BJ1 A;  3CJ0 A;  5DRK A;  3GIL A;  2I5J A;  5KFQ A;  2ABY A;  3WBZ A;  2EFV A;  4KSE B;  4DR6 J;  1FXR A;  4Q45 A;  2EFG A;  2WON A;  4OFZ A;  2RB7 A;  4CNY A;  4E8U A;  1X31 C;  1JNZ B;  4LMZ A;  1EAR A;  3IS9 B;  1HKA A;  1BQX A;  3MUV P;  3KNA A;  1S4E A;  3KXD A;  1S12 A;  2VPY B;  4F0M A;  2YKN A;  2IM0 A;  3FMB A;  1PBA A;  4L76 A;  4IO1 A;  3HFK A;  2EFO A;  1X5O A;  4A8S A;  5HVG A;  2AU0 A;  3SXL A;  3OR2 A;  3TZZ A;  1DJ0 A;  4WKR A;  1NK8 A;  3PDN A;  2XMU A;  1H38 A;  2FY1 A;  3SFG A;  2HMI B;  5KFB A;  1XMO F;  5KG6 A;  2XMM A;  4RNN A;  5DGA A;  3GMG A;  1KFD A;  2DEI A;  3OW2 R;  1LWE B;  4ELU A;  2J7U A;  5ETK A;  3D6T B;  1N56 A;  3AQO A;  5MLC V;  1R8C A;  1NB7 A;  4ICL B;  3QGG A;  4J9P A;  2YNF B;  2MKJ A;  1QSL A;  3ZZU A;  4KJI A;  2QLX A;  2RDI A;  2CQC A;  4MH8 A;  4WFZ A;  2GIQ A;  4JI7 F;  1FD8 A;  2V8G A;  3S6E A;  4JI2 J;  4LRA A;  2P5V A;  3HVT B;  3HM9 A;  1A6L A;  4GVL A;  1ZM9 A;  3LP2 B;  1U24 A;  1PBU A;  5C25 B;  4O0I A;  3ILO A;  2V2Z A;  4EEY A;  2R8G A;  4FVM A;  1T0T V;  1YBU A;  1S7H A;  1H2U X;  3LWM A;  4ED4 A;  2VG7 A;  4JV1 A;  4RW6 B;  1L3T A;  3H0P A;  3QO9 A;  2MQN A;  3PM9 A;  1IKW A;  4CRJ A;  2V8P A;  3A8E A;  1Y3J A;  2JVR A;  1PAU B;  5B0D A;  2IA6 A;  5A8K A;  2QYG A;  1V5V A;  1HR0 J;  3WDO A;  4OZ3 A;  1D0E A;  1BWV A;  3CJT A;  5IQQ A;  4WWS A;  2MPU A;  2PA8 D;  2IMO A;  4OMF G;  3DLG B;  4HHU A;  9ATC B;  3NMA A;  3VQS A;  1HD0 A;  4L75 A;  2RF2 B;  4AXJ A;  4F4X A;  4EZ9 A;  1EKR A;  3QT7 A;  1SC4 B;  1WEX A;  2PMW A;  3Q8S B;  5HO4 A;  1F5C A;  4USJ C;  5L38 A;  3M30 A;  2MQP A;  1RTI B;  5B0B A;  3CMA S;  1VIS A;  3GG0 A;  3RB6 A;  5DM7 Q;  3RU0 A;  1K1Q A;  1JJH A;  2BQU A;  3I9Z A;  2CYY A;  4AD6 A;  2BKP A;  1RKI A;  4DL6 A;  2L9D A;  3L4B C;  3MFI A;  2LDY A;  4C4W A;  1X60 A;  1U6F A;  5FDL B;  2ALZ A;  4C0H A;  2F3J A;  2HQI A;  5I3P A;  2PO4 A;  3PYF A;  2MGZ A;  4JI3 F;  4ZLN A;  2CPD A;  2OTJ S;  2XB2 D;  2C2N A;  4PG4 A;  1FT8 A;  5KG7 A;  4RUA A;  2B9E A;  4FP9 A;  1S4F A;  2QL7 B;  4DR1 J;  3BSA A;  2KG1 A;  4X4Q A;  3PJ9 A;  1UFW A;  3VAK A;  4RW7 B;  5A8R B;  4WFY A;  3DLH A;  1ZAV A;  4ECR A;  2AJ1 A;  5DQH A;  2B3T B;  3P8B B;  2AJ2 A;  2VBY A;  4YB7 A;  2F5G A;  1U8S A;  1VC5 A;  2RQK A;  3MM5 A;  1HW8 A;  1V5I B;  2BE2 A;  4K4S A;  3EGN A;  3QT8 A;  4NA1 A;  1CJV A;  4O4R A;  2QSW A;  1ZYQ A;  5LSL A;  3KLF A;  2DTJ A;  5F8G A;  1IBK J;  4C8O A;  1N5Y B;  1SBR A;  2ZFH A;  2BJ8 A;  3OPK A;  2EVZ A;  3FUY A;  4NYP A;  4O3Q A;  2VG5 B;  2HYI B;  2Z30 B;  5C5J A;  1MML A;  2Q79 A;  2MHN A;  2OPQ A;  3OL9 A;  4DR2 J;  1DQ9 A;  1IKX A;  3CUN A;  3K59 A;  3C6T A;  2GX8 A;  2HZA A;  3DOK A;  1U2R A;  5KFT A;  4Q2L A;  4F0H A;  4X4T A;  2KVI A;  2ATC B;  2AYM A;  4PG6 A;  2ZH3 A;  1LWX A;  1CS4 B;  4PPZ A;  2C3P A;  4MJK A;  1IR2 A;  1S1V A;  4WBF A;  4NZ7 A;  1GXL A;  1VHF A;  4NRU A;  3TO8 A;  4B9N A;  3HFZ B;  2KXF A;  2DR8 A;  4ZPD A;  1RZM A;  4ZDN A;  3TUI C;  1MRO A;  2DNP A;  1Z1Z A;  4UUW A;  3NOG A;  3CCV S;  3C16 B;  2IM1 A;  2Z2L A;  3G6E S;  4KTQ A;  3V6D A;  4DV3 F;  5HLF A;  4LVN P;  4O3R A;  5KOX A;  1KLM A;  2BR0 A;  3H5U A;  1HNZ F;  1QUP A;  3AD8 C;  2KG0 A;  2J0W A;  2YKA A;  2XO7 A;  3KLG A;  2AEJ A;  5KFO A;  3X1L B;  1UVJ A;  3MR6 A;  4YFU A;  4ZVR B;  4CLK A;  1HNV A;  2B9X A;  2NYH A;  1SQF A;  2Y3Y A;  2R8J A;  2J76 E;  3CDE A;  2ZC4 A;  3HUL A;  4NLT A;  4TU9 A;  3KG0 A;  2D9P A;  2Q1L A;  2MLZ A;  5JUM A;  1KQF B;  1JLB A;  2WRM A;  3CUL A;  1QY7 A;  3KMQ A;  5K8P A;  2ZVS A;  3HKZ D;  1ZTW A;  5HMZ A;  2FHJ A;  4JI4 J;  2AIR B;  2CJA A;  1VHI A;  1RCO B;  2Y1I A;  4D3G A;  3KUE A;  4KQZ A;  4PUO B;  1IJF B;  1RHJ B;  3DLE A;  2NR0 A;  4LSN A;  2UP1 A;  3T1H F;  5B7W A;  3K57 A;  1R8A A;  3VR1 A;  3DDK A;  3DYA A;  5I3U B;  3M32 A;  4Y65 A;  2XG8 A;  4OYB A;  3DFE A;  3RUB L;  2VQF F;  4N76 A;  5L46 A;  3CGI A;  1S1W B;  2ZM6 F;  4JI8 F;  3ZTS A;  1S97 A;  3QSI A;  3QQC D;  5KFH A;  2G2Z A;  3AAW B;  2Z56 B;  1L3S A;  2G2O A;  3HMJ G;  5J1N A;  2RRB A;  2E5G A;  1RT7 A;  3MM7 B;  4MKB A;  1UEU A;  1RAA B;  2GV1 A;  2YQ3 A;  2CUY A;  3GP9 A;  1NK5 A;  1UFL A;  2FJD B;  3UE2 A;  4JI1 F;  5F9L A;  2AYG A;  3M8Q B;  3G71 S;  4KHM A;  1I3O B;  8RUC A;  1M5H A;  4FDF A;  2MY8 A;  3K5L A;  3W64 A;  4PXD A;  1VQ5 S;  5HJY A;  4UY8 T;  4NLU A;  5KT4 A;  5HMW A;  2NXN A;  5J2N B;  4X4S A;  4A8X A;  4U7U D;  2B7B B;  3ZZR A;  4E2F B;  1VCT A;  2JZ5 A;  2UU9 J;  3L7U A;  2F9J A;  3AD7 C;  1T3O A;  4YB1 P;  3OTO J;  2YNH B;  1LWC A;  2RHQ B;  1NRK A;  4TQR A;  1S9G A;  4DUZ J;  2HGM A;  2C2E A;  3VVT A;  5GAD U;  3I32 A;  4NLD A;  2D9O A;  3D3C J;  1AYE A;  3M8P B;  2BOP A;  3VGT A;  2H4Y B;  3HT3 A;  2JSX A;  2ILY A;  3VCD A;  4USW A;  4UW2 A;  4B3S F;  1OJ4 A;  1IR0 A;  2O66 A;  3I0R B;  2XS2 A;  4LF6 J;  2W8L A;  3CJ8 A;  4K50 A;  4X4N A;  2PD1 A;  1JKH B;  4H4M B;  5KFS A;  4CCH A;  5JMN A;  4F50 A;  3BO3 A;  3UWT A;  4WU3 A;  1M0S A;  5C24 B;  5KFZ A;  2QMW A;  5I42 B;  1I1G A;  3W9H A;  1TUV A;  2C28 A;  3DRP B;  1TAQ A;  1TP7 A;  4LQ9 A;  3KMS A;  1W25 A;  3WX8 A;  5F0U A;  1TL5 A;  2PEB A;  1Y0H A;  1LFW A;  2V2V A;  3ZTP A;  5DO2 A;  4L73 A;  3TEH B;  4R0J A;  1EJ7 L;  2UUA J;  2DGO A;  4ZKA A;  4WTY A;  2QA1 A;  4NXN F;  1Y5N B;  2ZUA A;  5K14 A;  2ZZN A;  1AA1 B;  3G6V A;  4YDX A;  2ZDO A;  3JQK A;  3LO3 A;  4USK A;  2XSJ B;  1HBO A;  2B4P A;  5ETL A;  3MMB B;  2HNZ A;  2BJ9 A;  1JXV A;  3GFZ A;  1O0P A;  3MAQ A;  4GKJ F;  1T03 B;  3A3P B;  4DUY J;  1HD1 A;  3BKF A;  1KOO A;  2E66 A;  5KFK A;  3ENQ A;  3FQK A;  4C11 B;  4P73 A;  1IKV B;  4B9V A;  2VPW B;  5LJ5 Y;  2VA2 A;  1JQG A;  2LA4 A;  1XMQ F;  3RBE A;  3PTW A;  2HBQ B;  1NJZ A;  3A8K A;  1CLF A;  2VOP A;  4Q0B B;  3OT9 A;  1RLC L;  4WTO B;  2N82 B;  1T9V A;  1TZ0 A;  5L1J A;  4U9R A;  1DTT B;  3PHT A;  4DR7 J;  4LFA F;  2XHC A;  2CZV C;  2ZOF A;  1NU4 A;  3CIZ A;  1T9Y A;  5L8R C;  3ILI A;  5A0Y B;  2V9K A;  2VV5 A;  3M4X A;  1VQK S;  5CD4 A;  2ZJR Q;  4GKK F;  1HI8 A;  4PYA A;  1NHU A;  2DVI A;  3NAI A;  4NE9 C;  3MCS A;  1NJI T;  4AQY F;  1VRU A;  3DU6 A;  5A6W A;  4M5J A;  4B3O A;  5DDQ C;  4HTI A;  1T94 A;  1XR5 A;  3CDB A;  3SEO A;  4KKO B;  2D7S A;  3RJM B;  1WEY A;  4HL9 A;  3IBW A;  1FWP A;  2FUG 9;  3KDN A;  2VFU A;  2V0N A;  3N6M A;  2ILZ A;  1P9Q C;  2GIR A;  4E0D A;  2FC8 A;  2EK1 A;  2BKN A;  5A76 A;  5A8W A;  3BM7 A;  4B3R J;  1PIE A;  2LA6 A;  3UDE A;  3MM6 B;  1N54 B;  2FVQ A;  3R27 A;  3M8R A;  2J8S A;  3E2E A;  2OML A;  3OJU A;  4Y2C A;  1X9M A;  4FS1 A;  3EGV A;  3Q22 A;  4CM0 A;  3EE3 A;  2GJF A;  1FNM A;  3ENW A;  1XMB A;  4UST A;  2CVI A;  2WOM A;  2QMU B;  4EYH B;  4XDD A;  3OLA A;  1N0V C;  2XZD B;  2HHH F;  4DEZ A;  4K4T A;  3CCU S;  2HQG A;  3EX7 B;  5ITH A;  1R3N A;  1DZ5 A;  1VQS A;  1KHV A;  3SQO P;  4A8Y A;  3KJV B;  3A12 A;  3VZI A;  3TAP A;  1LXJ A;  4YY3 J;  1IBL J;  3LPY A;  3BR9 A;  3A8I A;  2R2R A;  5BYQ A;  5M2R A;  5D0G A;  1F0X A;  1T9U A;  4H4K A;  4YS2 A;  1RYS A;  2RS2 A;  1HW9 A;  4NLR A;  3KJQ B;  1WSR A;  3W60 A;  2J6S A;  1XEZ A;  1I51 B;  1S0N A;  1ZM3 A;  3T5J A;  4C8Z A;  1T95 A;  2MHE A;  4NEZ A;  1RWN B;  3R7B B;  1IVZ A;  3N4W A;  3CCW A;  3V4I A;  1S77 D;  4DLE A;  3B82 A;  3UDV A;  1IM6 A;  3K5N A;  2D74 B;  2PMZ D;  1AUS L;  4B9U A;  3UD5 A;  5IV3 A;  2CNK B;  2B9Y A;  1DTQ A;  2H3E B;  3EVO A;  1WOS A;  3CJ4 A;  4Y28 C;  2G4B A;  3A1Y G;  2OTL S;  3T41 A;  1S0O A;  3DHW C;  1RTZ A;  4BDP A;  3JSR A;  4A47 A;  3PW7 A;  2BAN B;  1L3V A;  1J5E J;  3R5G A;  4FVC A;  4IFV A;  2FHK A; 
#chains in the Genus database with same CATH homology
 3FBB A;  5BXI A;  1LEO A;  4EK2 A;  3MPD A;  4KPC A;  2BX6 A;  3FBF A;  3L7U A;  1EHW A;  1MN7 A;  3FCV A;  1F6T A;  4FKY A;  4W98 A;  1U8W A;  3GPA A;  5IOL A;  3JS9 A;  4UOH A;  2DXF A;  3Q8U A;  4S0M A;  3ZTS A;  3EM1 A;  1PAE X;  4C6A A;  1S5Z A;  4HR2 A;  2HVD A;  3B6B A;  2DYA A;  3FBC A;  1KDN A;  1NCL A;  1BHN A;  3ETM A;  3PRV A;  1S57 A;  3DKD A;  3Q89 A;  1JXV A;  1XQI A;  1NDL A;  4ANE A;  2B8P A;  1WKK A;  2B8Q A;  4DUT A;  3VVT A;  1HHQ A;  3VGS A;  3BH6 B;  2DY9 A;  3PJ9 A;  3DDI A;  1BE4 A;  4ANC A;  3B54 A;  1ZS6 A;  3VGT A;  2HUR A;  3EMT A;  1S59 A;  3ZTQ A;  4UOF A;  3NGS A;  3FKB A;  1LWX A;  1NSK L;  1NHK L;  3BBF A;  3VGU A;  1F3F A;  5C7P A;  3GP9 A;  3NGT A;  4DI6 A;  3VGV A;  3NGR A;  1NDK A;  4WBF A;  3EE3 A;  1NPK A;  1NDP A;  1NB2 A;  2AZ3 A;  2AZ1 A;  1WKL A;  1XIQ A;  3EJM A;  4F36 A;  1PKU A;  1NDC A;  2DXE A;  1WKJ A;  1NSQ A;  3VVU A;  3Q83 A;  4O0N A;  2VU5 A;  1B99 A;  1NUE A;  3ZTO A;  2NCK L;  1MN9 A;  2BEF A;  1HLW A;  3EIC A;  1W7W A;  1NLK L;  3BBB A;  3EVM A;  3Q86 A;  3FCW A;  3BBC A;  1K44 A;  3EVO A;  4CP5 A;  4DZ6 A;  4FKX A;  3NGU A;  3ZTR A;  1NSP A;  3ENA A;  1BUX A;  1VYA A;  3WX8 A;  3ELH A;  2DXD A;  4F4A A;  3FBE A;  4AND A;  4UOG A;  1HIY A;  4ENO A;  3ZTP A;  3Q8Y A;  3R9L A;  5CAA A;  1B4S A;  2CWK A;  5CAB A;  3Q8V A;  1UCN A;  3EVW A;  2HVE A;  3BH7 B;  3FC9 A;  3G2X A;  2ZUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...