2HVDA

Human nucleoside diphosphate kinase a complexed with adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase A
publication title Crystal Structures of S120G Mutant and Wild Type of Human Nucleoside Diphosphate Kinase A in Complex with ADP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hvdA00
2B8PA 4DI6A 3ENAA 3GPAA 4ANEA 5BXIA 3ZTOA 1W7WA 4HR2A 1NPKA 4F4AA 4DUTA 3DDIA 1UCNA 3EMTA 3EVOA 3Q8YA 4O0NA 1XQIA 4UOFA 3VGTA 1F3FA 3FBCA 3FBBA 1NSPA 3FBFA 3NGRA 3Q89A 2DXFA 1PKUA 1EHWA 1NDCA 1BE4A 1HHQA 1WKJA 1BUXA 4S0MA 3VGSA 1ZS6A 1VYAA 3FKBA 3GP9A 3EVMA 3NGTA 1WKLA 3ZTPA 3DKDA 3FCVA 2AZ1A 1S5ZA 1F6TA 1NCLA 2CWKA 3EVWA 3NGUA 2BX6A 1NUEA 3Q83A 3VGVA 3B54A 3WX8A 3EE3A 4ANDA 1NB2A 2DY9A 3VGUA 4FKYA 3Q8UA 3R9LA 3ZTQA 3JS9A 1NSKL 3EJMA 3ZTSA 2DXDA 2HURA 3BH7B 4W98A 4ANCA 4CP5A 4UOGA 3NGSA 5IOLA 1BHNA 1HLWA 1XIQA 3VVTA 5CABA 1PAEX 2B8QA 1NSQA 2DYAA 3ZTRA 1NHKL 3FC9A 3FBEA 4KPCA 2NCKL 4C6AA 1LWXA 1NDPA 3FCWA 1JXVA 4ENOA 4F36A 3EICA 2HVEA 3Q86A 3ETMA 1LEOA 3BBBA 1S59A 1NDKA 1B4SA 1B99A 1S57A 1NDLA 3B6BA 1HIYA 5C7PA 3ELHA 4EK2A 1MN7A 2BEFA 4FKXA 3EM1A 3Q8VA 3BBCA 2HVDA 1U8WA 1NLKL 4DZ6A 2ZUAA 3MPDA 1WKKA 1K44A 1MN9A 1KDNA 3BH6B 3VVUA 2VU5A 3L7UA 4UOHA 3BBFA 5CAAA 4WBFA 3G2XA 3PJ9A 2AZ3A 2DXEA 3PRVA
chains in the Genus database with same CATH superfamily
1VQ6S 2ZD1B 3RW7A 1IR1A 2W1BA 1C4CA 2K8GA 2V34A 1TR0A 4JI2F 1F9EB 3OUYA 3LP1B 3NGKA 2JEFA 5IZHA 2LEBA 2WSEC 1LWCA 3KLVA 2XSJB 1TUGB 4RW8A 4B08A 3ITHB 2MZ1A 4RLEA 3IS9B 3C6UB 5G0RB 1XMOJ 5KG1A 4L3KA 1N34J 5KFYA 2AHOB 1TZ0A 4CH0S 3W64A 3OTDA 2B43A 2UUWA 2XLKA 5ITHA 3DLBA 5GAHI 4OHWA 3E51A 1T9YA 1SJ4P 2BQ3A 1IQZA 3HHKA 3RU0A 1U49A 3KLEB 3CXCR 1PG5B 1K9MT 5KOXA 3QIPB 4M63A 1CS4A 2VDIA 3P5TL 4LSNA 1YZ6A 1YBTA 2FVRA 1H7XA 4HI1A 1KDNA 4KT0C 3HMJG 3K7RA 3CJTA 3DRRB 2ZBQA 3ZC4A 3NOCA 1PGZA 1OSDA 3LO3A 3E3XA 4NLRA 3VAIA 3NS6A 4Z2XA 3N5FA 3FZ2A 5LSLA 3RRGA 3K0JA 2EBEA 1VQOS 4ZIWA 2L08A 3ZZ0A 4MFBB 1HD1A 4A8YA 3RR8A 1FJGF 3LPYA 3L9ZA 4DOZA 3PIOQ 2OKQA 4DG1B 2HHPA 3TA1A 1FTCA 3JSBA 2UUAF 2CQ2A 1H74A 4W98A 1X4GA 3F0NA 1FEHA 3OVBA 4RO0A 1Q4RA 5CABA 2Y0BB 3GR1A 1F1BB 2VQFF 2GMHA 3HHLA 3OPKA 3QT8A 2DO0A 3ZNJ1 2CNNB 4RU2A 2N3LA 4AQYF 2FYXA 4YB6A 3CDUA 5A8RA 2NQPA 4ZPTR 1WI8A 2RRNA 1UA1A 1U8WA 3BO4A 4FDFA 5KFDA 3DRPB 2XB2D 3S6EA 1XMBA 3MD3A 3MUVP 2KG1A 2XC9A 4CLLA 2BRKA 1EETA 4F2RA 4NASA 2OPRA 4IKAA 3OUYB 1LWCB 5GMDA 1N5VA 3VGTA 3QO9B 2RAQA 5HATA 2U1AA 2Y1JA 4G1PA 3PX0A 4URGA 2QA4G 2H4WB 2PA3A 3T9ZA 3CT9A 3W5XA 1PJ7A 1I1GA 5I3UA 1RTDB 3CJSA 1Q7LB 2CJXB 3H5UA 4C11B 4V19X 1UW4A 4DV0J 5DGBA 4NYZA 1TU0B 1EKSA 1X8DA 2R2TA 4ETZA 3L09A 4WFAQ 4U95A 2A6MA 2FIUA 2NUHA 2GIFA 1SQGA 2HIYA 3OLBA 1CLFA 1IBMF 3EXYA 2G4BA 5EHHA 3B4DA 4QCLA 3G6VA 1RWXB 3C16A 4CLFA 1PYTA 5E3PA 4NLPA 3CCTA 4HH1A 3GJRB 4WFZA 4OI3A 3GZ7A 1NH7A 1BUXA 2KXHA 4CLYA 1NKEA 1UFWA 1DBDA 4ZKAA 1S6PA 2HFUA 3UNGC 5ETSA 1WTBA 3O1LA 5B08A 1VQ4S 6AT1B 3BKFA 4DCJB 2MEWA 1YBUA 3NGUA 2G0JA 2IM2A 2PC6A 3DHWC 1RT4A 3B54A 3MFIA 4AE5A 1M5OC 1S0MA 3MM5A 1V3SA 2DXDA 3BH7B 2V9WA 1CJVA 1LFPA 2IJNA 3CE8A 1VIOA 1UWAA 3OR1A 2VIHA 4C8LA 3QPIA 2JX2A 1NAQA 4GKJF 4Q43A 5A8RB 2XNQA 4A8KA 1H98A 4N41A 1S99A 2CYYA 3GMGA 1N0VC 1VI7A 4LFCJ 2VOOA 4H4KC 2DHGA 3G96A 1HIYA 1Y0HA 3CDEA 5C24A 3VQTA 2J8AA 1GTHA 2DNLA 1B0VA 3W62A 2OPRB 3HM9A 1AFIA 3EDRB 2XGPA 4Q2LA 1PC5A 4KTQA 1C1BB 4ICLA 2B8PA 5E3AA 3QSIA 1M5PC 2WZ1A 1S9EA 1Q79A 3CCWA 3C8YA 1VQMS 3QJJA 3RR7A 1YKWA 2KYZA 5HQ8A 4IH5A 1HW9A 3PHTA 3Q89A 3TUIC 4EYIB 4ZLLA 5KG0A 1RHRB 4LF7F 1SV5B 3IG1A 3PACA 1ZAVA 4RKUC 2JH3A 1KS2A 1NUEA 2QMXA 2UXDF 4MKYA 2PE8A 3ZXWA 4HI2A 1S1WA 2XULA 3MECB 1NDPA 2ZITA 2EC2A 3IGNA 4GVLA 2MHNA 1UETA 1PJ6A 2OI2A 5E5NA 2SXLA 2XM3A 5BR8F 4DR1J 1SC6A 2GHWA 3NBPA 2R7TA 1AXQA 4AUKA 4TY9A 3TNVA 4LF5J 3LOUA 4Z7YA 3SMZA 1PSDA 3RBDA 4ZP6A 5DQIA 2BJ7A 3KUEA 1NJIT 2ZZMA 1G6BA 1KOOA 3ETOA 4JV2A 3OSNA 5AXKA 1HFEL 4CNYA 2C3OA 4Q8FA 1Y3KA 1NU4A 2H51B 2MXYA 3D0GE 1WKLA 1JLFA 3CJ3A 2QO3A 2N3OA 1RT1A 4M5HA 2VH7A 3NOGA 1CJVB 3NS5A 2F4VF 2OELA 5M2PA 2R7XA 2QLXA 1RBLA 3T5JA 1VQPS 4L72B 2E5JA 3DM2A 4X4PA 2C2DA 1FJEB 3DOMA 4ZN3A 3DLLQ 2CPIA 5HN0A 3MM8A 3KK2A 3LA0A 1QD1A 3P4UB 5MLCV 2XS5A 2XMJA 3EM1A 4M95A 5EGYA 3CJQA 2RKIB 5AXLA 1VJWA 1S9EB 5J2MA 2YNFB 4F26A 2OTLS 4K5SA 4LVOP 1N56A 2YNHB 4JUZA 3IC1A 2JWNA 3M6XA 3MR6A 1P27B 2KN4A 3HT3A 3AHPA 2B9XA 5AE2A 1FKOA 2B4PA 2YNGA 3IG1B 3FCHA 3MOZA 1OS5A 4I2QB 3PKYA 4ED1A 3M1VB 4IG3A 4O44B 5C42A 1NCLA 1JLBB 1UEUA 1WNEA 3QRQA 1IKYA 3CD6S 4ZLPA 3W7BA 1KP6A 2KO1A 3QLHB 2EW9A 3BDPA 2VUGA 4ED2A 3BQ1A 4ZVSB 2IRXA 3HJVA 4Y28C 2V6AA 2DIUA 4U7UK 5B0AA 1TKDA 1D9AA 2IC3B 4B9LA 4ELVA 3M8RA 3Q2TC 2QEXS 2HQFA 5KFGA 2KL8A 4ID5B 4OYAA 1NK7A 1LXJA 1AUSL 1Y3JA 2QFJA 3PRDA 1M5HA 2RVJA 4QIFA 4NCGB 1AZSA 5D8HB 4I6YA 2PMHA 1K8AT 2JC0A 2ZHOA 1FT8A 3MM6A 1TKZA 2D69A 1OY8A 5CD4H 1HBNA 1GEHA 1JLFB 3LGHA 1G7CB 4JI5J 4B3RJ 2MSTA 4WIQA 5KFQA 1XWLA 4WU3A 2ZDPA 3DM2B 2C28A 5A0YA 2C3PA 4I69A 2P6TA 5IM0A 2VONA 2XZTB 2V4JA 4PYAA 3KK2B 3DLJA 3LAMA 2E44A 3M9OB 4JI4J 3H98A 1AA1B 3K5NA 2G0CA 2AQ4A 3IR6B 4B3OA 3M9MB 3KWMA 1RQ0A 1E6YA 5KFIA 2VPYB 2DNKA 4WFXA 1REVA 1WEXA 1YLXA 4DR3F 1JLCA 5F8LA 2AGOA 3R5DA 1H2UX 3NCRA 3EZUA 1F3VA 1U8SA 2YNGB 1V6HA 2MMYA 4M5LA 4ZVQB 3OTOJ 4ES3A 1PCAA 2R7SA 3IAS9 4O4GB 4FF2A 3JQJA 2W7PA 4Y2MA 4IQXA 2IMOA 3C3LA 2RSQA 4OZ0A 2P8IA 5IQ6A 3IP0A 3CO0P 1R8PA 1WDTA 4PG4A 4OZ1A 2J9DA 5KFSA 4DPTA 3NGDA 2ZUGA 4KC5A 1D3WA 1HL6A 2GFFA 3UR0A 5EX0A 5KFOA 2KRBA 2IA6A 4QYZJ 4J9PA 4PWDA 2XMWA 4PKDB 1NZAA 1NO8A 3BGFA 2YWEA 4O3NA 3BGRA 1U1NA 3I87A 1AZSB 2ZH7A 5KFNA 1QDUB 1AFJA 1BXNA 3BS9A 3MM6B 1S49A 5A6WA 2HG4A 4LSZB 2HVIA 1WC0A 3G4SS 5ADZA 1U1RA 4P9SA 2IRUA 1EIYB 2D3OR 4QYZK 1CJUA 1TAQA 1HHQA 2JEGA 2DITA 1Q7YT 4ATNA 4OYWA 1S97A 4DX8H 2CJYB 4WXWA 2VJUA 2C2EA 3A8IA 5G4DA 2GZOA 5HJXA 1YZ7A 3GILA 4TNOA 2V4JB 3C6TA 3HVAA 3GIKA 1NKBA 1U24A 2PEHA 1CJTB 2G9OA 4ZVGA 3FBEA 4ECYA 5AJ3J 3NCQA 2FGCA 2Q79A 3DXSX 4ILLA 4B3OB 3VR1A 1KEKA 1E6YB 1C2PA 4I64A 1REVB 3CDWA 3H4DA 1XMQJ 3QGPA 2MPUA 3R5CA 3VAMA 4D3HA 5KT5A 1YQHA 5KTQA 4A4JA 1SH3A 2M52A 1YJ7A 4DU7A 1AYEA 3MI7X 3HHEA 3T1AA 4DV6J 3OFEA 1FKPA 1M0SA 1YJUA 1S10A 3NEKA 4O0NA 3N28A 1FJ7A 2W9BA 2VPXB 2MQ8A 3NGRA 1HKAA 1ACMB 3MAHA 2VASA 4J9RA 1JLQA 1K0TA 3VAGA 4DV2F 1DHMA 2EFNA 2IFXA 3EVWA 1FNMA 2JHEA 4ITSA 2XHWA 4JI6J 1FFGB 3HD1A 1FF2A 1RYRA 1RUSA 3WX4A 5LSRA 3V81A 4ED5A 2NCKL 1UVIA 2ADCA 3RAMA 3R1HA 3H8YA 4X64F 1BQMA 3UN2A 1NDLA 4NXMF 4OLOA 3HO1A 1YVFA 3HFZB 3SQGA 5GVQA 4DUZF 3KUGA 1ZZNA 5L1LA 3OFHA 1H72C 2AYEA 2J76E 2HHXA 2A0FB 2M4MA 3MF5A 3H40A 1MSWD 5E0OA 2H65B 2LCWA 3AXMA 4QPTA 4A8XA 2RQCA 2W25A 1YJ9S 4G1QA 2D3UA 2N82B 1VQ9S 2DNPA 2NZ4A 3GSIA 3I82A 1QSSA 2HQDA 2W4CA 5KFKA 5H9FJ 1M1GA 1UJ6A 2R7OA 4URSA 2W4DA 1KLNA 2UP1A 3PR5B 2WOMB 3CSKA 3RB6A 2J6SA 1SL0A 3J7A1 3GU0A 2HHTA 2DNGA 4RW4A 1YHQS 4RWXA 2ZJRQ 1SL1A 2J0WA 3MCNA 2MYFA 2DT9A 2NS1B 1U6FA 4K7QA 3ZTSA 3HJFA 2FJVA 1TL5A 5L1IA 1X9SA 2RS8A 1HNXF 1RDRA 3THPA 4LQ3A 4M5DA 4J90A 3QT5A 3LWLA 2ZM6J 1U6BA 2UXCF 5H9FK 4LUBA 2XYPB 1S1UB 3MMBB 4DR4J 2Z8QA 4W90B 1IM6A 5DQHA 4O23A 2ALZA 2AP6A 3SDEA 1RWOB 4X2BA 1RT7B 1WC1A 4B3MJ 1FKPB 2RDJA 5IS2A 3IWNC 1GK8A 2LFVA 4AYBD 5DDRC 2UXBF 4OI0A 3PFEA 2F9JA 2MLXA 3DCAA 1KFSA 2FJBB 3PW0A 1VC5A 1VFJA 2EEYA 2BJEA 1CJKB 4USKA 5ETPA 5EUHA 5E33A 5DLFA 3E01B 1GH8A 1MU2B 1TL3A 3WHIA 1R8CA 4KGKA 4LF8J 1RT3A 1IUJA 3AT1B 3CVKA 1QJHA 2BJ9A 3FC9A 4Q0BA 3MM9A 5EWFA 3J7AN 1RYSA 3RBZA 1U1PA 3CIZA 3DOLA 2BJDA 1KTQA 3SQGB 3EXCX 2APOA 4KIAA 5A2QU 5KFMA 2D9PA 3FMBA 3GFHA 1DAXA 1RTHB 3K17A 4JV5F 4QR2A 3ENVA 4WXOA 1UPPA 1VK3A 4PRFA 4YEAA 1YRXA 4H4MB 5HROB 4KGVB 1NPRA 2P9CA 2DISA 3QYYA 4C8MA 2CNKB 5JMNA 3EGZA 2V4QA 5C25A 1NSAA 1VIXA 3CD0A 2IA0A 3BN4A 4ZPDA 2ZOGA 4DV5F 3UD3P 2BQRA 4DXLA 5B09A 3I4HX 2J7WA 4KV8B 4JI3F 2W2PP 5DS7A 2PDAA 2AGQA 2M3DA 2XG8A 4X66F 3PEJA 4K8RA 1AT1B 2IBOA 1ZAXA 5H9EJ 1RHKB 1H3DA 3S8SA 3N5BA 1FJGJ 1SIWB 5T41A 1RXOB 4K0KF 1XNRF 1DRZA 2PMZD 1HLWA 2RH3A 2L41A 2CA9A 3ZZUA 1SUQB 2UUAJ 3AOCA 2HLUA 2AT1B 1SQFA 2CQHA 3KNGA 3I0SB 5ETNA 4FP9A 2F40A 2FVQA 1TUWA 1BC6A 2R2RA 1R8BA 4AQYJ 3K5PA 4CO5A 2UV8A 5H9EK 1KNZA 1RZMA 1Z2ZA 4DS4A 2GJ2A 4NXNF 2HFZA 2OSQA 1YBAA 2LYVA 1RWMB 4ZCKA 2MLZA 2PI4A 1XERA 3I31A 3VHQA 2KFZA 2VFVA 1V9OA 4D3GA 1EKRA 1TL3B 4OZLA 2ATLA 1NB7A 2QV6A 1VS3A 1Z4UA 1C0UA 2BE7D 3GYNA 2MQQA 3Q83A 3R2DJ 1NRKA 2DNQA 2QTWA 2XI3A 1HBUB 1Q5VA 1RAGB 3QT7A 2CPFA 2E1RA 2UVUA 3SV4A 3W2WB 2QFIA 1TL4A 1P9QC 2C22A 1AUDA 4RBUA 1S0VA 3THVA 4KGXB 2GQQA 2COLA 3OFFA 2BR0A 3CC2S 1R6YA 3QFHA 1UFLA 2R7RA 3N79A 1TK0A 1JMTA 4ZPVR 1TFWA 4CO0A 2OUGA 3HZEA 1HYSA 2XMTA 3L7UA 3CCJS 3SV3A 3MCSA 4UF4A 4AXIA 4HEA9 5JUMA 3TQEA 1HHTP 3PKMA 2XY7A 3OJSA 3I32A 3TAMB 3QAUA 2WONA 1IBMJ 4BCAA 2CKWA 3ENQA 5MAOA 2DR6A 3IBFB 2R7VA 3IAM9 1EB0A 5D4LA 1VYAA 2UUTA 4A8OA 3DRSB 4USWA 1NJWA 2P9GA 5E3CA 1NJYA 4MH8A 3MZIA 3POTA 2IPOB 4CP5A 2H9ZA 4IH6A 1XN9A 4NRTA 3GE9A 4OZNA 3QIDA 3EICA 2DR7A 1IBKF 3A12A 2AIRB 1EX8A 3QZ7A 1UL3A 3PYEA 4PABA 5HAOA 4GKJJ 3VAJA 2E5GA 4O4RA 3ELHA 1TQLA 4M1KA 4DZ6A 3OSPA 2XZWA 3DOKA 3HSDA 1IR2A 4K2JA 1R0AA 2WTFA 3HDSA 2QJ3A 1FRHA 5LXYA 2HBRB 1U02A 1CPZA 2PEBA 4HACA 3AD7C 5D15A 3D54A 3RRHA 1UCNA 3DLGB 4EO8A 3SXLA 3KJQB 4M5MA 4RNHA 4IRKA 2F4FA 4A8WA 3HFKA 1EJ7L 5D0RA 2DR8A 1C0UB 1JNZB 2NXJA 4BLGA 4MIBA 4OHXA 1TK5A 2CQ4A 3IXQA 3KG1A 4LF7J 4ANDA 1G2EA 2CVEA 1WF0A 4WZMA 3D66A 1ZYQA 3G6YA 1FDBA 2EG2A 3TJ9A 4DQQA 2ZH9A 1SJRA 5I3PA 4TU9A 3H4BA 2YTCA 2UXDJ 4YHHF 1B3TA 1T9UA 5BJRA 4V19J 1IXKA 1RT5A 4OI4A 4CLSA 1WOOA 2DY1A 1B99A 3MAAA 3M6VA 4ZOSA 3LAKA 1U26A 4DJBA 1X7VA 4BHQA 1JIHA 4RW6B 1SQEA 3A3OB 3TZYA 2H5EA 5HANA 1ROFA 3LANA 3OJUA 2I5JB 1U1QA 2WONB 2YKMB 2PD1A 3PRVA 5BR8J 2KT5A 1HBOB 3BM7A 3CD7A 4DUTA 2DGSA 4DSEA 5A6PA 1ZPWX 1H2VZ 3GFYA 5J2PA 2VBXA 4GKKF 1GXLA 3DHXA 1SJ1A 2UU9F 1MMNA 4TLQA 3RTVA 1HA1A 3VWSA 2XMAA 4I7FB 2GCFA 5KFUA 2M8HA 2IHR1 2MZQA 4OZ3A 5GAGU 2Q3PA 1YRTA 2M0GB 3JS9A 3ZTQA 5DETA 3AOBA 3IGVA 1KQKA 2HAFA 4WK3A 2E5LF 1AW0A 3MEGA 2W4PA 2CG8A 1CG2A 1PO6A 1LWXA 3SYZA 3M30B 4JI0F 4M8LA 3N6MA 1LWEA 1J5OB 4USUA 1VBZA 1VMBA 3DOKB 2Z30B 2E1MC 2JLFA 3H2UB 4O3OA 4UQGA 1FWLA 4DSLA 2HFOA 4OV1A 3KK1A 3H5YA 2GO9A 2HNYB 3D0IE 4X4QA 4WTOB 1QM9A 5CZVA 1VHFA 3TWZA 3W9JA 3T19A 3T5HA 2KXNB 2O67A 2VBWA 3QT6A 3GPAA 3OL7A 2OEMA 1PJ5A 1FX4A 1U1OA 2HLTA 2AV5A 4QW8A 4TVAB 2MLYA 3SBMA 1LW2A 1VOMA 1L3UA 3RAQA 2FHJD 2MJNA 2VG7B 3MM7B 2HMIA 1N88A 3DRXA 2EVZA 3BSOA 1S6QA 4HH0A 1IVZA 1OQ6A 5AXMA 1NB2A 1FNXH 1D1UA 3D1HA 3KLFA 2Y0SD 2WB4A 4KGZB 1KKHA 2ZWOA 1KQGB 2MQOA 1JKHB 5L1JA 4ECSA 1RT5B 2JEIA 4KPCA 1UVJA 3IMQJ 1TL7B 3BV8A 4BBYA 4ZDNA 4PXEA 2VOPA 1T9XA 4DV1F 4HHHA 1BQXA 4PG7A 3UN5A 4F4XA 4Y00A 3TUZC 4P75A 4FYDA 3ZZRA 3MOJB 2FGOA 2LDYA 3EDQB 3UVJA 3QRPA 2POKA 4FNHA 3DGVA 3G8TA 2HKEA 2HYIB 5J2PB 1XJWB 1SKSA 2BRLA 2GAHC 4UOFA 1FCAA 2R7QA 3H59A 1T05A 2QSWA 4MKVA 1NK0A 2NPIA 4WYLA 1HHSA 4YB5A 3NL0A 4ED0A 4I68A 1N52B 4ZMMA 3IM8A 3MEGB 2KJVA 3KLGA 1WD6A 4UOGA 2AEFA 5DDOC 2QC3A 4NZ6A 1NHKL 2M8DB 2E7WA 4U9RA 1B7FA 4IDKB 3TANA 5D4PA 4GC6A 3TI0A 1B4SA 4LBHA 4HLBA 2FHOB 2E1CA 2MKCA 4LF6F 3RJMB 5F9LA 4DFPA 2G1DA 1WHWA 3KLHB 5IT0A 4JV1A 4EEYA 2LECA 3M8YA 1IKWB 1WHYA 1DQAA 1VRUB 1YK9A 3LP2B 4DR3J 2W7OA 4O3PA 4OZ5A 5C2CA 4LVNP 2RS2A 1VQ8S 3FJ2A 2FQQB 4CTAA 1HNVA 1NXIA 2EK6A 3FFIB 1W2IA 1BE4A 1O8BA 2RUSA 1X4BA 2QLWA 2VL1A 2HFVA 4F2SA 3H42A 5A8KA 2C2ZB 2DNYA 2FTRA 2DNHA 3RRKA 2MSSA 4MT1A 1RT2B 4Q5VA 1L3SA 2PMWA 2GMJA 2GVDA 3OXLA 3KLFB 1VLYA 2AGPA 3BGUA 3FRZA 3J81j 1KWMA 4OYBA 4DV4F 3J7YU 3T41A 4ANCA 4ECXA 4PWUA 1JLAA 3D6MB 4GVBA 3CC7S 2AWZA 1FHTA 2B5JA 2LQ9A 3ZTRA 3I55S 4ED8A 3BYPA 3W9HA 2J6TA 3NNCA 3QQCD 2FJAB 2I9SA 4F4YA 2NSCA 1YRUA 3P45B 1LEOA 2ZE2B 7FDRA 1I5OB 4UQTA 4M94A 3DFEA 2HBYB 2LQ5A 3M2UB 3IA0A 1G1XA 2H4YB 5HQMA 2JVOA 3JTOA 1KD1T 2VC0A 3UNYA 2YWHA 3MGJA 2UUCJ 3JSYA 2PGCA 3QFWA 3M7VA 2Z4PA 4FF1A 3MPWA 3RAXA 3X1LB 1X5OA 4FPIA 4UUXA 3CJRA 2VICA 4MJKA 2YH0A 3IBCB 2D1CA 4PUOA 1C0TA 3X3UA 3MMCB 1URNA 3G87A 2ZH2A 2EBGA 1R3NA 2CPYA 2CWKA 2FJWA 3NY0A 3MEEA 2HNZA 1NMEB 3OT9A 4FF4A 1R0BG 3I9ZA 4DQSA 2K1RA 1FXDA 1HQEB 1ZTWA 4MK8A 2VJVA 5CD4A 1IBLF 5HSPA 3AH6A 4NI2A 2DNOA 3JYTA 1TV6B 4A48A 4RUHA 4OHVA 5GADI 4LSLA 3MTKA 3WQPA 2A3JA 3S01A 1J5EF 2JJ4D 1YJVA 1EP4A 1GAOA 2CG4A 3ET6A 3PFOA 1QAIA 5CYMB 2G13A 4CTAB 4WE1A 1FD8A 5C2GA 5IC6B 2QLBB 2Q66A 2GQ2A 1VRTB 2GQCA 2OPSA 1X0FA 1Y9OA 2LMIA 2OLWA 5FLXU 4OQJA 4DL5A 5DZ6A 4Y2CA 2N4CA 1VISA 1S1TA 3D3CJ 4F4KA 3C15B 3CCES 4S0MA 2GVDB 4QBUA 1S48A 4ES1A 3DMJB 1NHVA 4IO9Q 3EVMA 3KMSA 2YNIA 1AB8A 4ZVRB 2E9RX 4PPDA 1JLAB 2ZH6A 1D09B 4R25A 2V8HA 2HHWA 3HPOA 2BVZA 4P72A 3DDKA 4IH7A 4DV2J 4EZ9A 4LF9F 1TUVA 4EBDA 4DQIA 1NEEA 1X4EA 5BYSA 5L39A 3M8PB 4IR1A 2DHXA 2GC8A 4J9NA 1KONA 4P73A 1RT6B 2CPDA 1UEVA 5A8WB 4U7UD 3B6BA 5C7PA 5J1EA 4N77A 4F02A 4WFYA 2NPFA 3AD8C 2H48B 3MMAB 2K06A 4X64J 5FIIA 4O3QA 3G86A 2R8IA 2RDIA 4NXMJ 2LKZA 4NLTA 4XPCA 4DUZJ 4IYQA 5KG5A 1VBKA 2RQ4A 3T3FA 4UZBA 2PT0A 1F0XA 1DJ0A 5J2QA 1YJRA 2AJ2A 3D6HB 1MLAA 3D0HE 2HNDB 4LF4J 2AJFE 1BGXT 2BOAA 2RUGA 1FTRA 2J0QD 5AXNA 3HHLD 2HNZB 2ASYA 1S0OA 3CCZA 5J1PA 4LFAJ 4WYWA 4OJ3A 1LK5A 4E8UA 2CZVC 3ILJA 4P52A 3G71S 2DCLA 5FD1A 3NGSA 4NI2B 3PIPQ 1S9FA 2OAUA 4ZIVA 2OIHA 2DBBA 2MTLA 3K89A 3BGLA 5LJ5Y 2R8HA 1R8HA 4LSLB 3P5BP 1HNXJ 2FJEB 4E2FB 3VAHA 1EP4B 3K5OA 2UXCJ 4ZVHA 1HQ2A 4FN5A 1KR4A 2LXFA 1VQ7S 4PQUA 5KFCA 3BH6B 5L38A 2QZ8A 3D7SB 3NRBA 3THTA 5J2NA 3TAQA 2QA2A 4ILRA 5T7LB 4QIGA 2IBKA 3GWCA 2FZCB 4DUYF 4KB7A 2UXBJ 2NR0A 5KFBA 4ECZA 3KJVA 3CO9A 4CO2A 1S12A 4P7TA 2ZHBA 4OYOA 4YDDB 1DTQB 5DO2A 2DY9A 3BGOP 1RAFB 2JSXA 4AL7A 1IWAA 1PIEA 2DGTA 3DGPB 1SIZA 3L4BC 1BLUA 4Y65A 2XYHB 3W60A 2HSEB 4KSEB 1O0PA 2VQEJ 2GAGC 3OV7A 3ETMA 5L46A 5EDWA 4F0KA 2RMLA 4TQRA 5CHCB 5IV3A 3UR3C 5T14A 5CH7B 5K8MA 3UDLA 3TA0A 2IVYA 2Z2LA 3TJ8A 3GCWP 4JV5J 2VV5A 5KT6A 2BE2B 2V94A 1MMDA 3BPDA 3ZTOA 3VCDA 1SC3B 4DLEA 4F3MA 4DS5A 4HHJA 3FSXA 3C46A 3JTNA 1WELA 4MTPA 1S1XA 2JLGA 4F8RA 4FF3A 3CIMA 2CZ9A 4DV5J 4DR7F 3CEDA 1VR6A 1JLGB 5K8NA 4JI3J 4N8OA 1V3ZA 3MCOA 2DKOB 2NXNA 4NLXA 1F5CA 2EFVA 4ZCLA 4KJIA 1D9DA 2B9WA 3V4MA 3ZZYA 3F41A 1UWBA 3I0RA 2RRAA 3TP2A 3HULA 3PO4A 2Y3YA 4C8ZA 1AROP 4K0KJ 3J81U 4DCOB 4QJVA 2W7AA 3KDOA 3I5AA 4PQUB 2U2FA 4PWWA 2KRRA 1HPZB 5LXRA 4R8UA 4FBTA 3QRRA 1MG7A 5J2NB 3V2UC 2NREA 2DK2A 4DL3A 3OL9A 1S77D 2EFQA 4X4TA 1LK7A 5DDPC 5KAKA 1HMVB 5BYRA 1OIAA 2BA9A 5HVFA 1Q16B 4NRUA 4P2FA 2ZJQQ 4NLSA 4NXNJ 3KK3B 4NA3A 1X5TA 3VGSA 4DL4A 4KE5A 1Z2LA 3K8WA 2YWWA 3Q8SB 1IJFB 3M32A 2JLEA 3VALA 4K4YA 2YKNA 3OQ2A 2MKYA 3VGUA 4H54A 4OHZA 3TUPA 1NSKL 2MZJA 1W2BR 4CYUA 4ER8A 2DEJA 2I2YA 3LP0B 2MY7A 4BS2A 1GNKA 1P1LA 1CULA 3ZZZA 3BSCA 4K4WA 2K7KA 1QTNB 1RU1A 4NLVA 4YQWA 3BBBA 2WSCC 2JRSA 2K3IA 2XWXA 2AU0A 1OSCA 3BQ2A 1XC9A 2HQ3A 4JI8F 1K44A 1JK9B 4GO5X 2ROEA 1VQSA 3BR8A 3EZOA 3QJLA 2G1HA 5B0EA 1K1SA 3W8GA 1F3FA 1TMMA 3TVZA 3MEDB 2W2NP 2EXUA 5I42A 2EPIA 4CLZA 4FYYB 4C2MA 1HI1A 4CM2A 2RQMA 2R9LA 5CYQA 4CI0B 3SCLE 5U47A 2J8SA 1KLMA 4DLGA 3ISNC 2CPZA 3UO0A 1WSRA 3I0RB 2EWHA 4MKAA 1HW8A 2Y9HA 1D0EA 1RABB 2JOQA 5DQGA 3T1HF 3PVXA 2CDRB 3KLIB 2OPPB 3UCGA 1L3KA 3DLKA 4R8UB 2KYXA 4JI7F 2BACA 2BBEA 1J2VA 2KDOA 2DVIA 2PN6A 2P2CB 2NXUA 3FQKA 1S7IA 1IBKJ 1VGYA 4YB7A 2V8VA 4EYHB 1WKKA 4OIXA 3RBEA 4M5JA 1MWZA 5DG7A 4DL6A 1TKTA 2ZKTA 4Q7AA 2HPUA 2L9WA 2VFUA 3MUTP 5A76A 2Y1IA 3RUBL 5ETVA 4YMEA 1FWKA 2YWFA 1FDDA 3ZZOA 3K8VA 1RACB 5F8MA 5CQGA 2ZBCA 2CQ1A 3NXZA 2BKOA 4LIWA 1SL2A 2R8JA 3V6HA 3O3LA 3M32B 3R5GA 1VLOA 5LMUJ 4ECTA 5IFMA 3HVTA 2EG1A 1SVDA 3HT0A 3A4TA 2CJBA 3A1YG 2AJ0A 3DYAB 1VQNS 2HVHA 5F41A 3PW7A 2KI2A 4WP9A 5KFWA 3TO8A 4ZP8A 2X3GA 3TYTA 3PW2A 3C14B 1FERA 2AKWB 2HQGA 4ZK7M 2NXCA 4QR1A 4ENOA 2FC8A 3M2VA 3TVYA 2RNEA 4YHHJ 2KTQA 3TARA 1FFWB 4X62F 1NLKL 2XO6A 1SC1B 4CM0A 4RW8B 2NLWA 4FKXA 5KG2A 5J1NA 2XO7A 3NLCA 2GIRA 3LTOA 3N6LA 4MAKA 2A1BA 1U48A 1L3TA 2ASJA 4U6PA 5I42B 3EUNA 1NSPA 1PKUA 3RG6A 1S9GA 2O01C 2V2ZA 3DDNA 3W2VA 2IJFA 4FVCA 3TR5A 1MWYA 3U02A 2V2QA 2QGFB 2J9DE 5HJYA 2UU9J 4YB1P 1RE1B 4ID8A 5M2RA 3EE3A 2H54B 2CQ0A 2B56A 1RLCL 1CS4B 4LSNB 3PYFA 2VG6A 2W2MP 1E6VA 1RBOB 3R97A 5H1SV 1ZETA 5LOQA 4C0BA 2EC0A 2HZVA 5GAEI 4ED3A 1G3OA 1TP7A 2IIHA 4KYZA 2E5LJ 2ZEJA 4ZCMA 2RDDA 4DV3J 3KJNB 4L76A 1SCJB 2CFXA 3SZ2A 4OLPA 4JI0J 1U25A 2J6UA 5CXTA 2X1FA 2XS7A 2I8EA 3D5MA 4Y3CA 4FS1A 2VPZB 3R5AA 4OJGA 4DX6A 2ALYB 4DI6A 4JI1J 2UUBF 3ILLA 4OI2A 2W9CA 1X4HA 1UVLA 2DEIA 1XR7A 3CC4S 4RNFA 3MXHP 1IKVA 3M05A 3SFGA 1RB0A 4JB8B 4MMOA 3AA9A 3HHLB 4IRDA 3OXGA 2KVIA 3D2WA 4XK8C 5SZTA 3IR7B 2J0XA 2E9TA 4HT7A 2AYGA 3PRBA 3RGIA 4LR7A 2D3O1 2FHMA 4ALZA 1EETB 2XMUA 2W2OP 2XI2A 4C6AA 2MZSA 2BOPA 2DJWA 2R42A 4QOTA 1DTTA 3GYGA 2IDLA 1UPMB 3BDEA 1YGYA 3CJ8A 3KYLA 2XZDB 4A8SA 3FSYA 4J9MA 4DV1J 3D1OA 5KOWA 1S1VA 2CDQA 1CQMA 4OYMA 3BJYA 3DI6A 1Q1KA 3NS7B 4J37A 1OYEA 1F60B 5I3UB 4CLPA 4DPUA 2ZH8A 3JB9k 2F8MA 3QWPA 1YG0A 2HGNA 4ZCIA 2OEJA 2NYHA 2UVVA 1SJQA 2GVZA 1RJJA 3WX8A 3GJQB 3Q8PB 3TUJC 4LR9A 3EJMA 1R89A 2DR9A 2E7VA 1WOPA 2F1FA 2VFSA 4F0HA 2B8QA 4RU9A 2L48A 1FRIA 1NK4A 4K2XA 2C2OB 3C16B 1M90T 2K2PA 3CCUS 4J9VA 4OYPA 5B0CA 2P9EA 1T9VA 4IO1A 4LIRA 3T9NA 4DQPA 2F9DA 4YN3B 2BEFA 3J7ZT 3K5LA 2ROPA 1S6PB 3HSGA 3RB0A 2W9CB 2UZAA 1RU2A 2AEJA 1DURA 1RT4B 2OEKA 4K50A 2W2QP 3CNQP 3MM5B 3Q8YA 5GAHU 5K8PA 2V8DA 3M6UA 1YI2S 3KUHA 4G65A 3DLEA 1RAOA 2O1PA 3OR1B 4FYXB 2DXFA 2RD5C 3H5XA 2XCPA 2E66A 1VCTA 4C7QA 7AT1B 2GGPA 3DKDA 4EGLA 1XBWA 2VA2A 4MKBA 4JI5F 1WG5A 3M8QA 2CPHA 1U4BA 1FRXA 5C24B 3UFCX 3Q8UA 3TEHB 1QY7A 2HGLA 1HD0A 3OTCA 2R7WA 1NSQA 4DV4J 3HHLC 1DTTB 4KO0A 3UW1A 1JB0C 4ICLB 3MD1A 3U7JA 4C3KA 1H38A 3HXMA 2HQIA 1YX2A 1U0SA 2VKZG 4EZ6A 1X5PA 3H0PA 3WC2A 2HWTA 1S1VB 4EK2A 1FNOA 3BB5A 4KHPJ 3DI6B 2BM0A 2ATCB 3D68A 1T03A 4AL6A 4KKOA 4Q45A 2D7SA 4PAAA 5KG7A 2IYIA 4DR6F 3G6ES 3GQCA 4U8YA 4F3OA 4G6VB 4JP8A 2VBYA 2WSFC 5KG6A 5EX3A 3HX9A 1S1WB 5K20B 1EHWA 3AD9C 4OJHA 2I1RA 1TL1A 2BKPA 3FNNA 4U7CA 1IR0A 5IT9Y 4DSJA 4DPXA 2DR5A 3I9V9 2B7BB 3T5KA 1RKJA 1HNIA 1T9TA 4OFZA 3NBPB 2G2YA 1PAEX 2YQ1A 1SJFA 4CT8A 2YX4A 3U27A 3F56A 4I4BA 3UDCA 4DN9A 2F63A 2DO4A 1LKZA 4A47A 4TKTA 3P96A 4F04B 1IBLJ 2B4OA 3R7NB 4OI1A 1HI0P 3CJKA 1TK8A 2I6WA 1S6UA 1Q5YA 3EWGA 2OPQA 2ASLA 1RT1B 3CW2C 2W8LA 1UW9A 2DD8S 4HR2A 3I5BA 1X0PA 2ZH4A 1Q78A 3IWLA 3AB4B 3V6JA 1ZPVA 4I1TA 1SKRA 5I3QA 1VQLS 5HL7Q 2GGPB 4P74A 4R0JA 5HVHA 4PXDA 4DCPB 3DOMB 4UOCA 5LSOA 3RZAA 3FQLA 1JXEA 4R5PA 3KHLA 2HWHA 4DV7J 1S72S 4IQMA 4KY3A 2DNZA 3MM8B 1F9HA 1MROA 2PFFB 4ZJQA 3RBXA 2CZ4A 4ZLNA 1EQ0A 1IM4A 2WBRA 2AX1A 3LW5C 1LWFA 2Z0GA 2FPHX 1BHNA 5KFFA 5J2MB 1SKWA 2LXUA 5GMEA 4LF9J 1C4AA 1FKOB 1NK5A 4DR5F 1HWJA 1SH0A 4I67A 4DHVA 3H25A 5KT3A 2BZ2A 4XAKA 4HVZA 4B9SA 2YPZA 2FUG9 1WC3A 4IG3B 3DC2A 3GLJA 5C42B 3PZPA 5EWEA 1U1KA 2AD9A 2NXEA 4K5RA 2UVWA 2VG5A 1IKYB 3O44A 5F8GA 2W9AA 1XK8A 1IN0A 1H6KX 2H3EB 4NX9A 2A6OA 1SBRA 1C1CA 1T3OA 4J9KA 3IRXA 1RAJA 2E29A 2EFOA 2JDJA 4EI2A 2OFGX 3OR2A 2ZD1A 3A8JA 2HW3A 1U2FA 4FXDA 1NHUA 5DG9A 1K73T 4USMA 3UQSA 3WZ0A 3LP1A 1SKUB 6FDRA 4C4WA 3EPIA 1HR0F 4O0IA 3OD2A 3DLHA 1U1MA 2N4DA 1RGVA 4C8NA 4DSKA 2FVCA 3CJKB 3ITHA 1SXLA 3IS9A 3C6UA 1OY6A 1TKZB 5G0RA 3VF0B 3BPSP 3VAKA 1M5VC 4LFBF 1X60A 1P1TA 3FSIA 2C3YA 1HBNB 4P71A 1WORA 3GIJA 3AOAA 4NL5A 1BWVA 3HSJA 2AW0A 3LUYA 5A0YB 4QWDA 3QIPA 5IM0B 1LV5A 1ZM4A 1FE4A 1N36F 3HF5A 3TA2A 3SIPB 4WF9Q 1EAYC 3E2EA 3KHGA 3EGVA 2CQIA 1RADB 2JZ5A 1PC4A 4RL1A 4DUYJ 3GV5B 4U96A 1LWFB 4XDDA 1WEZA 2O5DA 3P8BB 4YDXA 2JFKA 4TN2A 2A18A 4RNNA 4ZJLA 2RU9A 2ZZTA 3NAHA 4CLKA 1JLCB 4GO7X 3VVTA 4OX6A 5DM7Q 5L9NA 1GXUA 2DH7A 4MFBA 2BW2A 2ZC3A 2M9KA 3GFZA 5B0BA 3GG0A 2GO8A 2V67A 5HMWA 3GR0A 3N0VA 1VDHA 3AFGA 2KZZA 4H4KA 2V50A 1QUVA 4DG1A 2CQ3A 3OHAA 3QJPA 2FJDB 3K2YA 3CTRA 1H0HB 4FS2A 2Y8WA 4OMFG 2AZ3A 4DL2A 3CF5Q 3PYDA 2LEAA 3W61A 2Q43A 5IC4B 2ZBPA 4IOAQ 3WDOA 2W24A 2F5GA 3ENWA 2R4FA 3QGHA 3CULA 3W65A 3P49B 3MPUB 3NGTA 3DRPA 2HHHF 4PWDB 4OX9F 3I56S 4DR7J 3BGRB 4FXVA 3MR5A 2KT3A 5LMNF 4G3IA 3QO9A 4NEZA 4WIIA 1FXLA 4NLYA 2VC1A 4LF8F 3CCVS 1ZZFA 4CH1A 1U0HA 3GTYX 2HWIA 4PEOA 5F9NA 2W8KA 4XO0A 1CJUB 1QAJA 2HEKA 3MPDA 5IWAF 1RTDA 4YOEA 1KVKA 4CT9A 1WTFA 3ZZPA 3H5SA 1WG4A 2J9CA 4C11A 3SEOA 4YR3A 4ANEA 2C2MB 2CQBA 3C6TB 3CWJA 4P6QA 2XGQA 3EGWB 4YY3F 3N6NA 2JC1A 3H2LA 3M9NB 4J9SA 2KHDA 1OPZA 1QLNA 2V2VA 2R2UA 3JAMU 4JV0A 5IT4A 1RTZA 4TXSA 5CCLA 1RHMB 2FB0A 1F6TA 3DRYA 3V4IA 4CDIA 4A8MP 3AXKA 1YDLA 3AJDA 2DNRA 1I51B 2VF3A 2IRYA 1ZTTA 1D8YA 3BREA 1WWHA 4CNZA 1N4LA 2DGUA 4CRJA 4M5IA 4YS2A 1UFKA 2XLJA 4C97A 2XCAA 4K4UA 2W9BB 1B70B 4JYAF 3EPGA 1DLOA 1GFWB 1JLQB 4WBFA 4JI2J 2BE9B 4HL9A 4F3QA 2RF2A 2LDIA 2KM8B 2CNLB 1QVFR 4JI8J 3CD5A 3ILIA 2J7UA 4Y2KA 3ICLA 4L74A 1UJ4A 3CJ4A 2XY6A 3BKUA 2E1AA 2CPJA 2DNNA 3V81B 3GFXA 1FWPA 1EARA 2YX7A 3GB0A 2E9ZA 1BQMB 1C1BA 2G2ZA 3OVSA 2J7KA 4C98A 2KVQE 3CJ0A 2LEPA 1LXNA 3DN9A 1TMJA 1BWEA 3J80U 1U0HB 1JWWA 2EKYA 3ADAC 2XY5A 2MGZA 2GA7A 3LALA 4G1QB 1SV5A 3IN5A 2P6SA 3T1HJ 2XSFA 2Y1RI 5DM6Q 1IQTA 5AT1B 1CVJA 1LFWA 3IBWA 2WK4A 2HVDA 4JI7J 5KFLA 2Y1LB 2BM1A 4EBCA 2GIQA 4RW4B 3MECA 3ENAA 2WBMA 5FLXY 1RHQB 2IM1A 2AJ4A 4LRDA 3OLAA 4UUWA 3NKYA 3D4JA 1WG1A 1DFDA 4M5DB 2HHVA 1HWLA 4MYTA 3V4IB 3HVWA 1FJCA 4CH7A 1QSLA 2OFHX 4NA2A 1K0VA 4NCAA 1LOUA 4TY8A 2VQFJ 2OGUA 3SDEB 2X1GA 1F5AA 4CZCA 2NUUG 3W3SA 2FVPA 2VDHA 2ERRA 4JBCA 3SCJE 4Y34A 3PXGa 4X4RA 4X4VA 8ATCB 2D41A 1DLOB 3AAWB 2QMUB 4DF8A 2XQCA 4ZVFA 2B9YA 2RF2B 2WRMA 3RB3A 1WOSA 2A2DA 1GMVA 4Y2IA 4X62J 2GNKA 4QW9A 4Q8EA 3R7SB 4X4SA 2KFNA 1FD2A 2B4UA 4PG6A 2HFNA 1RT3B 4DZDA 2HBZB 2L3MA 2YBVA 2DRAA 1WJ9A 4LQ9A 4HHUA 4Q0BB 2O3DA 3OVAA 3MM9B 3LGMA 2RKIA 2QIFA 3DOLB 4ELTA 1GMWA 4ZPAA 2Z58B 2YNFA 2QRRA 4E98A 2KM8C 5F8NA 4I6WA 3G9CA 4LMZA 2YNHA 4BC7A 1WF2A 2BDPA 2CJ9A 1F9FA 1X9MA 2ZBRA 1EZZB 1YJTA 4Y0FA 2MGZB 3I5CA 2QLFB 2OHDA 3CCQS 3UI3A 1FXRA 2DRDA 2IDEA 4F25A 2ZVIA 2DCUB 1HQUA 1IWGA 4I2QA 5C25B 3OBIA 5L1KA 3M1VA 4O44A 4ECQA 3WIVA 3LH2S 5D77A 4J9LA 4ZVEA 5F3TA 3TX0A 5E2QA 1JLBA 4B3SF 5HMZA 4ZPBA 3L3CA 3QLHA 2X51A 1B7YB 1JJ2R 2Z56B 4JOUA 1HNWF 1V3RA 3CMAS 2IC3A 3MR7A 7FD1A 4ZVTB 1I94F 3QNWB 1FDNA 3ZO7A 4ID5A 3KMQA 2YKOA 2FLOA 2UUBJ 3W9IA 1RWWB 4QWAA 1UKUA 4RNOA 1ZS6A 1N5TA 3PNIA 3QGIA 3MURP 3FEXB 2DPJA 3GV7B 2PIIA 4M5NA 2ZH5A 1Q0NA 1W26A 3MWBA 4TY8B 5HI7A 4NCGA 2V4RA 4ZP9A 4DWIA 1KBRA 5F0UA 5SUHA 4TYBA 2HS0A 3F73A 3GCXP 4F4WA 1OQ3A 3KDNA 4X4OA 3GYXB 4LBIA 3TQ1A 5HO4A 2CVIA 1HWIA 4FXWA 4QZVB 1FFSB 4IFYA 1QSYA 3BSNA 4USIA 3LPEA 2XWYA 4YR0A 3H7HB 4K4VA 1FE0A 1T3NA 1P8GA 3NWRA 1R7IA 3FK4A 2Z2MA 4PYDA 3PX6A 5B7WA 5BXIA 4ZITA 5ETKA 1Y5NB 3ZZTA 2UV8G 3HK2A 1UVKA 3FBBA 3B82A 2F3JA 2KFYA 2HFSA 1U6ZA 2QYGA 1FA0A 5HP1A 5IV4A 5JXSA 3KHRA 1ZBTA 1K47A 1S5ZA 2YQ0A 1N32F 4N56A 1VC6A 3OL8A 4AL5A 3FMWA 5ETOA 1KSPA 1HQUB 2VFRA 4O4GA 1HYSB 3PDNA 1RA6A 1NJZA 1NKCA 1UZHA 3MTJA 3J81Y 1YTYA 3EGNA 2MY8A 3HZGA 2D74B 4X65F 4WJBA 3TZWA 3AY0A 1B64A 3LWMA 4RNMA 4B9NA 1Q8BA 5HVGA 2ZUAA 1Q8KA 2CJQA 4ZJOA 2LXIA 1TTHB 5CAAA 5KFEA 1URRA 5CYJA 2Q1LA 1RHUB 5LJ3Y 2MDAA 2RU3A 4NMLA 4IUFA 4ZPCA 3POTB 3KJFB 1FRKA 1YJWS 3MEKA 4NYOA 1WKJA 3WC0A 3K5MA 2YWGA 4KGMA 1NBEB 4N7TA 3PTWA 1N33F 3BKTA 1ZH5A 2F4VJ 3O5TB 4ZVUB 2ACYA 4RUAA 2HQCA 1R43A 4CQ1A 3PM9A 4OL8A 5JVGQ 4F0MA 2BJ8A 3SSRA 1UVMA 3FEZA 2DHAA 1TKXA 4CCHA 1R0AB 4IFYB 5F8IA 2YKPA 4K4ZA 2O66A 4NEYA 3PW5A 4HACB 3KTQA 2R7UA 2MB0B 5HLFA 1P6TA 3K59A 2XLIA 1ZOTA 1SH2A 1RI7A 2F8HA 1YIJS 2PI5A 2PA8D 1PBUA 4C3LA 1GXTA 5EWGA 2XHCA 4X4NA 3IRWP 1CQNA 3ISND 1CJTA 2VB6A 2GW8A 4NZ7A 3NMAA 4P2MA 1HWUA 2OTJS 4QWEA 1NNDA 1H2TZ 1U47A 4DR6J 2AJ1A 5HP1B 2KKHA 3GP9A 3K58A 1TELA 3ZTPA 1NK6A 2ZNZA 2AZ1A 3MAAB 3BO3A 1A6LA 4NMXA 5B0FA 5IOLA 5K5MA 4QQBA 3V6DA 5ETTA 4NLWA 2FZKB 3FCWA 4Y2AA 2WVFA 4ELUA 3UD4P 4RBVA 4DX5A 3FVYA 5HK4A 1PYOB 2WW4A 1WI6A 2DPIA 5E41A 5HMXA 3SSSA 4NLUA 2CQDA 4UOHA 3T6JA 3PR4A 2XS2A 3P6YC 1PYSB 4RUBA 4USJC 1UA0A 3VAFA 3T1YF 2UUCF 3V5RA 3KG0A 1VHIA 3D9BA 1N48A 4DU8A 2CIMA 3FBCA 3CPWR 3N4WA 3D3BJ 4QIVA 4F67A 4EUVA 3C66A 2Z57B 4PQAA 1LWEB 1RTIA 3KNAA 2ZC4A 1TKXB 2AYMA 3E8OA 3Q8QB 4CLTA 3KK1B 1RISA 4OX8A 4OX7A 3BO2A 5HLFB 3R6GB 2YH1A 1Y00A 2RRBA 2Q6BA 1FRLA 2ZFHA 1VC0A 3CCRS 3AQPA 2FLPA 2PSZA 1RP5A 2WOMA 4RJVA 3L7PA 4OZ2A 1LW2B 2ZWPA 4DFJA 4A46A 2HGMA 3M6WA 1FDAA 2KU7A 2HMIB 1KTVA 2NZCA 1S6QB 5DLGA 4DR5J 5CCMA 4EU0A 1Q82T 1L3VA 3MMBA 1CSJA 1MNEA 1S1UA 3KXDA 3UDEA 1ICEB 1H7WA 1VJQA 4GRSA 2R2SA 2DGXA 4BC9A 2ASDA 4NWBA 5IXUA 2M7SA 1RT7A 4DN0A 2RJZA 4OHYA 4N47A 2X3DA 3B8HA 2ROGA 2YKQA 4AFFA 4URQU 1KQFB 3V6DB 4ED4A 4DSFA 5I4MA 4LJMA 3D6FB 3UVJB 2CQCA 3ZFVA 4XPEA 3JQMA 2QA1A 1QE1A 2WVCA 1DY3A 2XBPA 3CDAA 4YUDA 3CCMS 2WVEA 1IBCB 4WWSA 1CJKA 2J9EA 4LRAA 1NDKA 1S57A 1HR0J 3E01A 1SC4B 1ULRA 4C3MA 1MU2A 1CC7A 5HBMA 1J27A 1GT8A 1HI8A 1T05B 1KVJA 1FO1A 3B78A 4LFBJ 4J9QA 2HBQB 4NLDA 5CA5A 4USHA 4RPFA 3KLGB 4IRCA 1X5SA 1KC8T 1Y7PA 3P3DA 4O3SA 2DB1A 2CQGA 3WIUA 3FEYB 1RTHA 2HVZA 4J5OA 1RTIB 3VZIA 4H4MA 3Q22A 5HROA 1N36J 4LF4F 4FPRA 2MQNA 2IJRA 1FI4A 4PXCA 8RUCA 2CJAA 5F8HA 5E7OB 4LFAF 5IQQA 5KFRA 2N7YA 4ERDA 3LQVA 1YWXA 3R7BB 4KV8A 4HTIA 4YR2A 3D6TB 2HHUA 4BWJA 2BMBA 4LRBA 2EKNA 5KT4A 4USVA 3S1TA 2XNRA 3PG9A 1HNVB 3OL6A 4ECUA 1N54B 4U67Q 2OJ3A 3IO1A 2JVRA 1UVNA 1F2HA 3TVKA 4GC7A 1V5VA 5A8KB 3MHYA 1HNZF 5KG3A 8AT1B 2ILYA 4LF2A 2ZVSA 3Q8RB 1SUQA 1Z1ZA 4B9UA 3I0SA 3D67A 1WEYA 1X4FA 2XMVA 4GVBB 1DARA 2QMWA 2B5JB 1UAWA 3ULHA 4CIOA 2CWXA 4DR2F 4HDGA 4MK7A 1UMJA 4PG5A 1N5YA 1ELOA 5AE1A 2HHHJ 3OHBA 1QE1B 1N5QA 3HKWA 4FZVA 2Y8YA 4OX9J 2V0NA 1FX2A 4DEZA 2CJKA 2OMOA 5ETLA 1T0TV 3KFWX 1JXVA 4XDCA 2GS8A 2VPWB 5LMNJ 3HI9A 4P7VA 5HBMB 3KHHA 3R5BA 4KH1B 5DGAA 3GJSB 2VQEF 4U8VA 2CPEA 1ITPA 2LLZA 2RT3A 4LRCA 5GAGI 4PUOB 3R1LA 1OJ4A 2LVWA 1C0TB 4IR9A 1HBUA 3W2WA 4V1Ak 2A2CA 1RWKB 5IWAJ 3BQ0A 5DZ7A 4HKQA 3MEEB 2N7CA 3BR9A 4F4AA 1F5BA 2C3MA 4ECWA 1ZM3A 2K1RB 2V2KA 2HZAA 1R6VA 1MWQA 3O6QA 4YY3J 3JYTB 1S0NA 5LT5A 3UCZP 4K4SA 3IR5B 1QVGR 3HHNB 4Y6IA 2JEJA 3TAMA 3L95X 5HMYA 3NWGA 5KG4A 1CBKA 3ET6B 1EQMA 4NLGA 4B3TF 4NYPA 1JX4A 1O6XA 3FUYA 5AE3A 4DSIA 4WE1B 2VBZA 4LR8A 1FRJA 4XTTA 1O5JA 2OPSB 4NA1A 1Q8LA 3IWXA 2P5VA 4KR0B 1TVRA 2CADA 3DRSA 2HRTA 1F2GA 3NNHA 1S1TB 3SFUA 3QAEA 4L6V3 2MHEA 2CAJA 3NCPA 2WVBA 4EFAC 4W92B 1UEKA 3SCKE 2YNIB 4J9UE 3VTIA 4ZVOB 5K8OA 2ZOMA 4JYAJ 4M5KA 3EVOA 4IFVA 5LM7E 1XQIA 1CC8A 2WB1D 2KH9A 4F50A 1JJ4A 1U1LA 1N5YB 1VQ5S 1PAUB 2RHQB 3BSAA 2ZOFA 4TLRA 1NK9A 3N9UC 1D9FA 5J1EB 1VBYA 2C2RA 3PYGA 3DLGA 3D1QA 4OYZA 1A0OB 2FDNA 4C0HA 4DL7A 2VA3A 3OTBA 4UT4A 3Q86A 1XNQF 4IOBA 5JJBA 2LU2A 3CGIA 3G6XA 5J2QB 1Q86T 3FGVA 4K4TA 3RYLA 1U2RA 1WHXA 3HCXA 2EFGA 3CB4A 5D4NA 1VBXA 3PJXA 3QSYB 3M8WA 4NE9C 1HARA 1U2CA 3EMTA 4LT6A 2WW8A 2YY3A 3AB2B 4YFUA 5D0HA 3OTEA 4RR5A 3I6PA 1OWXA 4X66J 4HYKA 2ADBA 4HDHA 2RE1A 1XMOF 1OPIA 4RW6A 2YWKA 1N34F 1K1QA 1B0PA 2FD2A 2I5JA 3NP5A 2YKMA 2FLNA 3HD2A 3VV2B 1OYDA 3A3NB 2FHKA 1XNRJ 1YJNS 1HBOA 4B02A 1U45A 3R9LA 2FVSA 4P2XA 4DFMA 1B0TA 2CXEA 4N5SA 3NMRA 3CCLS 4CLUA 2IMWP 1TVRB 2VODA 1SI9A 4HTJA 2MQMA 4WKYA 1VK8A 5IT9U 3FDSA 4I7FA 1S59A 2KXFA 4KBIA 3UN3A 3W66A 3OFGA 3N01A 5KT7A 1JLEA 3QATA 4QYRA 3DU6A 1S4FA 3KJVB 3J7YI 3FZBA 4C8YA 2PO4A 3Q24A 4IFVB 2RB7A 4I56A 2WCXA 4L75A 3M30A 2ZHAA 4AXJA 2WHOA 1X4AA 2Q6CA 5KT2A 1J5OA 3SI8A 1S6OA 3PX4A 2HNYA 4QU6A 4QR0A 2QL7B 2OSRA 4UY8T 5GADU 4C9DA 4NZ0A 4TYAA 2I0XA 4UTGA 5LMUF 2HIQA 2LQBA 4WPAA 4WFBQ 4UY85 2VZ9A 3JSRA 5JVHQ 4AD6A 4I2PA 2DYAA 2IM3A 2VG7A 2ZH3A 3MM7A 2X7IA 2VD3A 2UVRA 2ACMA 4DQRA 4NPOA 5DJBA 2CUYA 3IM9A 3QMQA 1S1XB 1WUUA 3OXFA 1GTEA 1MN9A 4RW9A 1Q95G 1JKHA 1U7LA 2DXEA 4B3SJ 1X9WA 1RAEB 1FRMA 1TL7A 1QAXA 3HLUA 3SCIE 4KFBA 2A10A 1KRPA 4WKRA 4DPYA 4C48A 4ES2A 1UP1A 2QX0A 1Q8IA 1HNWJ 1UWBB 3A8KA 3OW2R 1WDDA 1MW7A 2MQPA 4OV6A 4ZVPB 4K59A 5DRKA 1I94J 3PCOB 4OJ1A 4ZLJA 4G1IA 1NH8A 3DU5A 4Z37A 1OMSA 3VGVA 2BKNA 3MFHA 5D6GA 9RUBA 3A8EA 2HURA 2HK3A 1RK8A 2LU1A 4DPOA 1T8EA 4DV0F 4PXBA 2LQJA 1L5UA 1RWNB 2G0IA 5K14A 4ECVA 1M1KT 5F3ZA 2ZDOA 1JLEB 2ZKUA 3MPVA 3PJWA 1KQSR 1WACA 4OI6A 1XR6A 3M8SA 2ZJPQ 2FJXA 4DV3F 1DQ9A 3G8SA 1H73A 4DL0C 3VVUA 3QWUA 4P10A 1V5IB 2MKIA 1QTMA 4ECRA 2QT7A 1HBMA 4C0OC 2BABA 2YKNB 4PZVA 2DHSA 3GIMA 4DX7A 4ILMA 2OP5A 4IDKA 5KFTA 1Y11A 4CYUB 1ZAWA 2HK2A 4JI1F 3HSZA 4TU7A 1A9NB 2C1EB 1CULB 4AT1B 2HRYA 2D9OA 2HRUA 3KLHA 1XR5A 4WTYA 2M88A 3I4PA 3UPFA 4QWCA 1IKWA 1VRUA 2R8GA 1OY9A 3LP2A 3MPYA 4B9VA 2MKKA 4I2PB 3ILOA 4YP3A 3FFIA 1N32J 3WBZA 4LFCF 1Y10A 2E7XA 1ZM2A 5B0DA 1NZ8A 1RT2A 1ZA1B 2OD4A 3GONA 1KOHA 3EZ5A 4RW9B 2BXJA 2GHPA 3QBCA 1R31A 4X65J 2AX0A 2M2BA 1G4CA 2X1AA 4KFBB 3HVRA 2L9DA 4USTA 4DF4A 1LNQA 4FYWB 5CYQB 3AA8A 2CQPA 3H90A 1KLMB 3DDIA 2ZE2A 4KH0B 4GKKJ 2CPXA 1TAUA 3AODA 1X4DA 3M2UA 3CUNA 2H5JB 3NNAA 2F65A 3HFVA 4KHMA 2C42A 3JAMY 2ILZA 1RAAB 2B3TB 3DLKB 4UW2A 5K9FA 1VQKS 3FCVA 1WHVA 2JFDA 2QYCA 3B4MA 3TOQA 2QG9B 3R2CJ 4IG0A 2V8GA 1N33J 3NG8A 1FEEA 4I0WA 5ETQA 2B6AA 1N8RT 4TQSA 2ZH1A 5K14B 3W1YC 1BQNA 4WFNQ 2CNOB 1Y5IB 2V5HG 1TKTB 4KPYA 4ZHRA 1NJXA 2FZGB 3MMCA 4KRWA 4PR6A 4DR1F 4ZPWR 4LF5F 3CCSS 2WVDA 2AMCB 3MAQA 3MR3A 1HBMB 3W63A 3R27A 1YITS 1HQEA 1NK8A 3HVTB 3AJ1A 3IFEA 2FY8A 3KOAA 1TV6A 2HZCA 3UD5A 3FBFA 4CO4A 1NDCA 1R0CB 1RCOB 4BDPA 3BF4A 1PILA 2FY1A 1RAIB 3GJTB 1RCXB 3M2VB 5CYMA 2F7VA 4Q44A 2IVFB 4O3RA 5ETRA 2B51A 4PCQA 1VRTA 2GX8A 4WK1A 3AQOA 4MIWA 4W4MA 3J80Y 5A2QY 1JJCB 3C2PA 2QLJB 3RB4A 2MKJA 2VHGA 1M5KC 3C15A 1BMQB 5KFAA 3DMJA 1RWPB 2HVEA 2DTJA 5RUBA 1SJ3P 2QSFA 2BANA 2J5AA 2KHCA 2HS4A 3QGGA 4KHRA 4OYXA 3Q23A 3Q8VA 1T9WA 1S9GB 2D3ZA 5E3QA 3VZHA 3W2VB 2BW7A 4RW7A 4A8QA 4KHPF 1WC4A 1ZM9A 3G2XA 1BY9A 3M8PA 4I6AA 3PY8A 3C19A 5C5JA 2M5YA 5L8RC 5B0GA 1RT6A 3CJ5A 3MCMA 2Z2ZA 5F8JA 1RLDA 5A8WA 4N76A 2Z2YB 3K57A 1WSVA 2BJ1A 2VG6B 1LW0A 1NM2A 1E6VB 5EN1A 5L9XA 3T1YJ 1KFDA 2GV1A 3MMAA 5M2UA 3UE2A 5BYQA 2ZZNA 3FKBA 3AJ2A 4IG0B 2MKSA 5D3GA 1GMUA 2LP4A 2WAQD 4ZA1A 3MDFA 2XEXA 2B6AB 3PW4A 1T02A 3EYZA 2IY5B 4WP3A 1XTZA 2XTJP 1BQNB 5THWA 1T7PA 4ZHRB 1RTJA 2K7JA 4MYUA 3UWTA 3RW6A 1MMLA 1SPBP 1QUPA 4MIAA 1IJEB 3US5A 1GX5A 2YXLA 2HNDA 1OO0B 2XYGB 3JXOA 1N6QA 3G82A 2GJFA 3A3PB 4HT5A 4C8OA 3J7Z5 2I38A 4LF6J 1WF1A 6FD1A 4UZCA 1WC5A 1KHWA 1UZDA 2GJIA 5D0EA 1IKVB 2J0SD 4C8KA 4FBUA 4FYVB 3TRGA 5FJ4A 2YX1A 4NLQA 1LQ9A 1Y5LB 4J91A 4LRFA 2YKAA 5KFVA 2BV3A 2QN6B 4LREA 2GMLA 1W7WA 2CRLA 2H1YA 3BYRA 2IVMA 1T11A 4B3RF 1RBAA 9ATCB 4RX6A 2BJ3A 1JXLA 1FESA 2E1PA 3MUMP 2DGOA 4DMZA 4GMKA 2QL5B 4F4ZA 2E5IA 3TJAA 4B9MA 1FK9A 4N8NA 5D4OA 2DGWA 3NAIA 4ZS6A 5ETMA 2YQ3A 1A7GE 4DV7F 5D78A 4QU7A 3T5LA 1SB6A 5T7LA 2PFDA 2MZTA 1JNRB 2MQLA 2IAJA 5GMKa 4FNIA 1S4EA 4JI4F 4MK9A 3SSQA 2BANB 4ED7A 3CMQA 1VRQC 1U09A 4F36A 3BEGB 4CWBA 2F8EX 2M70A 2QA4S 5F0WA 1DTQA 2XMKA 4RW7B 2KB2A 2C2KB 4RUCA 1UTAA 3BBCA 4DPWA 4DDFA 3DGPA 3M2RA 3GIIA 3OTOF 3TW0A 2BQUA 4NOHA 2DHHA 3CMES 2GVZB 3PEHA 1LW0B 1NPKA 3Q0AA 3Q2SC 4WU2A 4ED6A 1RKIA 1REGX 4WCEQ 1X31C 3ONQA 3R8YA 3DXBA 5D3GB 3GV8B 2V68A 5DDQC 2DGQA 3G8QA 1YSJA 2RQKA 1XEZA 1X4CA 2JL9A 1RTJB 4NCBA 2B7CB 2BE2A 4X4UA 4L73A 3F44A 2MZRA 4PG8A 4FKYA 2VFTA 4OYIA 2OO4A 1N6QB 3G82B 3TZXA 2FHJA 4EBEA 1I3OB 3GIRA 3PO5A 4P2SA 3EX7B 3JSMA 3W5ZA 2V63A 1JLGA 4EMDA 3W5YA 1J5EJ 3O2IA 5KFJA 3DLEB 4EO6A 3UDVA 1T95A 2GHVC 1KHVA 1ZA2B 3H20A 2AF6A 4CLWA 5DG8A 2C3UA 2V69A 2B0GA 4LBPA 3BBFA 1O51A 3CDBA 2AJQA 2EI5A 3M8QB 1JJHA 4RZRA 1HNZJ 1Q81T 3JTPA 3M4XA 5E3RA 2AYBA 2K3KA 3HKZD 2ZNYA 2DH9A 4QIEA 1FK9B 1D8ZA 1HPZA 2C2NA 1KVIA 3M8ZA 2QL9B 5GAEU 2FC9A 3R5JB 4KO0B 2W01A 2HAIA 1W25A 4PPZA 4ZP7A 2QE5A 3BN7A 4L3NA 2HS3A 1I6JA 3JQKA 1FVQA 4DBQA 3LGNA 3L7OA 1M5SA 2BX6A 4DR2J 4QPXA 1HMVA 2E5HA 3PV8A 2IAJB 5FDLA 3U1NA 5AJ3F 2KZMA 1S7HA 3TAPA 3TX8A 3SQOP 4WP8A 1Q53A 3TZZA 4IOCQ 1T03B 3QZ8A 4KKOB 2V8PA 3KKFA 3KK3A 2OMLA 2ABYA 1XMQF 3ISZA 3LF0A 2ZBIA 4H4OA 1N5SA 2L9NA 2B9EA 2V9KA 3M2RB 3GSDA 2YVSA 2DH8A 3HHDA 1HWKA 2JNJA 4QIWD 2NSBA 4B9TA 5D0GA 1TL1B 2LQ8A 2VU5A 3LP0A 3U1MA 1T94A 4DV6F 3I96A 2KT2A 2MKHA 1IKXA 1WC6A 1GQEA 1HNIB 4WZQA 2RILA 2OH2A 2NYIA 2BUNA 4F7VA 2RHSB 1VQYA 4FVMA 1Y4ZB 4NLOA 4A8FA 1RWVB 4OZJA 5KFHA 2R3VA 3A13A 3CJ2A 3FRYA 5KFPA 5CZXA 3VQSA 2EFPA 5KFXA 4JI6F 1P9YA 1APSA 4J9OA 2XSJA 3TEGA 2RIJA 2LA6A 3BZQA 2B4VA 4BWMA 2YPYA 3S7RA 4Q2MA 1UJ5A 4XIUA 3JSMB 3H2VE 1XIQA 4DFKA 3W8PA 5HQLA 1CEZA 2FLLA 4TU8A 3MEDA 2OPQB 1PBAA 3R6LB 4EWTA 3U1LA 2KG0A 3DNCA 4B3TJ 1DZ5A 1RSCA 4K4XA 2HHSA 2H5IB 1R8AA 3V6KA 1RHJB 2LA4A 1RAHB 1MN7A 3KLEA 1KN6A 4R5PB 2DIVA 2HHQA 1S79A 2DGVA 1BD6A 2BYCA 3PJ9A 1TFYA 2VKRA 3KG4A 3MMJA 4M5GA 1S76D 1GMWD 2OD6A 3KLIA 3D28A 1MROB 2IM0A 1FVSA 2OPPA 2DRBA 2X1BA 3DRRA 5KFZA 2KJWA 2AEMA 4R0EA 4CO1A 2IYGA 3UCUP 2EK1A 3GG1A 4X84A 4J7CA 3R3TA 4LF1A 5FDLB 2R8KA 4Z7CA 1GX6A 3O8WA 1QAYA 1R27B 1M1HA 2ZM6F 5LL6d 3ZNUA 4DR4F 1RA7A 2XMMA 4CO3A 4H4OB 1N0UA 4E0DA 3PHEA 4RWWA 1FKAF 2VG5B 4QWBA 1C1CB 1DQ8A 1RWUA 3DYAA 4B3MF 2MJUA 1XNQJ 4KQZA 3IRXB 1JQGA 2DNMA 4ETXA 3HP6A 1IKXB 3T6BA 4B17A 4RBTA 4ZN1A 3OR2B 4KAIA 2G2OA 3C14A 1NPPA 3MR2A
chains in the Genus database with same CATH topology
2B8PA 4DI6A 3ENAA 3GPAA 4ANEA 5BXIA 3ZTOA 1W7WA 4HR2A 1NPKA 4F4AA 4DUTA 3DDIA 1UCNA 3EMTA 3EVOA 3Q8YA 4O0NA 1XQIA 4UOFA 3VGTA 1F3FA 3FBCA 3FBBA 1NSPA 3FBFA 3NGRA 3Q89A 2DXFA 1PKUA 1EHWA 1NDCA 1BE4A 1HHQA 1WKJA 1BUXA 4S0MA 3VGSA 1ZS6A 1VYAA 3FKBA 3GP9A 3EVMA 3NGTA 1WKLA 3ZTPA 3DKDA 3FCVA 2AZ1A 1S5ZA 1F6TA 1NCLA 2CWKA 3EVWA 3NGUA 2BX6A 1NUEA 3Q83A 3VGVA 3B54A 3WX8A 3EE3A 4ANDA 1NB2A 2DY9A 3VGUA 4FKYA 3Q8UA 3R9LA 3ZTQA 3JS9A 1NSKL 3EJMA 3ZTSA 2DXDA 2HURA 3BH7B 4W98A 4ANCA 4CP5A 4UOGA 3NGSA 5IOLA 1BHNA 1HLWA 1XIQA 3VVTA 5CABA 1PAEX 2B8QA 1NSQA 2DYAA 3ZTRA 1NHKL 3FC9A 3FBEA 4KPCA 2NCKL 4C6AA 1LWXA 1NDPA 3FCWA 1JXVA 4ENOA 4F36A 3EICA 2HVEA 3Q86A 3ETMA 1LEOA 3BBBA 1S59A 1NDKA 1B4SA 1B99A 1S57A 1NDLA 3B6BA 1HIYA 5C7PA 3ELHA 4EK2A 1MN7A 2BEFA 4FKXA 3EM1A 3Q8VA 3BBCA 2HVDA 1U8WA 1NLKL 4DZ6A 2ZUAA 3MPDA 1WKKA 1K44A 1MN9A 1KDNA 3BH6B 3VVUA 2VU5A 3L7UA 4UOHA 3BBFA 5CAAA 4WBFA 3G2XA 3PJ9A 2AZ3A 2DXEA 3PRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8P A;  4DI6 A;  3ENA A;  3GPA A;  4ANE A;  5BXI A;  3ZTO A;  1W7W A;  4HR2 A;  1NPK A;  4F4A A;  4DUT A;  3DDI A;  1UCN A;  3EMT A;  3EVO A;  3Q8Y A;  4O0N A;  1XQI A;  4UOF A;  3VGT A;  1F3F A;  3FBC A;  3FBB A;  1NSP A;  3FBF A;  3NGR A;  3Q89 A;  2DXF A;  1PKU A;  1EHW A;  1NDC A;  1BE4 A;  1HHQ A;  1WKJ A;  1BUX A;  4S0M A;  3VGS A;  1ZS6 A;  1VYA A;  3FKB A;  3GP9 A;  3EVM A;  3NGT A;  1WKL A;  3ZTP A;  3DKD A;  3FCV A;  2AZ1 A;  1S5Z A;  1F6T A;  1NCL A;  2CWK A;  3EVW A;  3NGU A;  2BX6 A;  1NUE A;  3Q83 A;  3VGV A;  3B54 A;  3WX8 A;  3EE3 A;  4AND A;  1NB2 A;  2DY9 A;  3VGU A;  4FKY A;  3Q8U A;  3R9L A;  3ZTQ A;  3JS9 A;  1NSK L;  3EJM A;  3ZTS A;  2DXD A;  2HUR A;  3BH7 B;  4W98 A;  4ANC A;  4CP5 A;  4UOG A;  3NGS A;  5IOL A;  1BHN A;  1HLW A;  1XIQ A;  3VVT A;  5CAB A;  1PAE X;  2B8Q A;  1NSQ A;  2DYA A;  3ZTR A;  1NHK L;  3FC9 A;  3FBE A;  4KPC A;  2NCK L;  4C6A A;  1LWX A;  1NDP A;  3FCW A;  1JXV A;  4ENO A;  4F36 A;  3EIC A;  2HVE A;  3Q86 A;  3ETM A;  1LEO A;  3BBB A;  1S59 A;  1NDK A;  1B4S A;  1B99 A;  1S57 A;  1NDL A;  3B6B A;  1HIY A;  5C7P A;  3ELH A;  4EK2 A;  1MN7 A;  2BEF A;  4FKX A;  3EM1 A;  3Q8V A;  3BBC A;  2HVD A;  1U8W A;  1NLK L;  4DZ6 A;  2ZUA A;  3MPD A;  1WKK A;  1K44 A;  1MN9 A;  1KDN A;  3BH6 B;  3VVU A;  2VU5 A;  3L7U A;  4UOH A;  3BBF A;  5CAA A;  4WBF A;  3G2X A;  3PJ9 A;  2AZ3 A;  2DXE A;  3PRV A; 
#chains in the Genus database with same CATH topology
 1VQ6 S;  2ZD1 B;  3RW7 A;  1IR1 A;  2W1B A;  1C4C A;  2K8G A;  2V34 A;  1TR0 A;  4JI2 F;  1F9E B;  3OUY A;  3LP1 B;  3NGK A;  2JEF A;  5IZH A;  2LEB A;  2WSE C;  1LWC A;  3KLV A;  2XSJ B;  1TUG B;  4RW8 A;  4B08 A;  3ITH B;  2MZ1 A;  4RLE A;  3IS9 B;  3C6U B;  5G0R B;  1XMO J;  5KG1 A;  4L3K A;  1N34 J;  5KFY A;  2AHO B;  1TZ0 A;  4CH0 S;  3W64 A;  3OTD A;  2B43 A;  2UUW A;  2XLK A;  5ITH A;  3DLB A;  5GAH I;  4OHW A;  3E51 A;  1T9Y A;  1SJ4 P;  2BQ3 A;  1IQZ A;  3HHK A;  3RU0 A;  1U49 A;  3KLE B;  3CXC R;  1PG5 B;  1K9M T;  5KOX A;  3QIP B;  4M63 A;  1CS4 A;  2VDI A;  3P5T L;  4LSN A;  1YZ6 A;  1YBT A;  2FVR A;  1H7X A;  4HI1 A;  1KDN A;  4KT0 C;  3HMJ G;  3K7R A;  3CJT A;  3DRR B;  2ZBQ A;  3ZC4 A;  3NOC A;  1PGZ A;  1OSD A;  3LO3 A;  3E3X A;  4NLR A;  3VAI A;  3NS6 A;  4Z2X A;  3N5F A;  3FZ2 A;  5LSL A;  3RRG A;  3K0J A;  2EBE A;  1VQO S;  4ZIW A;  2L08 A;  3ZZ0 A;  4MFB B;  1HD1 A;  4A8Y A;  3RR8 A;  1FJG F;  3LPY A;  3L9Z A;  4DOZ A;  3PIO Q;  2OKQ A;  4DG1 B;  2HHP A;  3TA1 A;  1FTC A;  3JSB A;  2UUA F;  2CQ2 A;  1H74 A;  4W98 A;  1X4G A;  3F0N A;  1FEH A;  3OVB A;  4RO0 A;  1Q4R A;  5CAB A;  2Y0B B;  3GR1 A;  1F1B B;  2VQF F;  2GMH A;  3HHL A;  3OPK A;  3QT8 A;  2DO0 A;  3ZNJ 1;  2CNN B;  4RU2 A;  2N3L A;  4AQY F;  2FYX A;  4YB6 A;  3CDU A;  5A8R A;  2NQP A;  4ZPT R;  1WI8 A;  2RRN A;  1UA1 A;  1U8W A;  3BO4 A;  4FDF A;  5KFD A;  3DRP B;  2XB2 D;  3S6E A;  1XMB A;  3MD3 A;  3MUV P;  2KG1 A;  2XC9 A;  4CLL A;  2BRK A;  1EET A;  4F2R A;  4NAS A;  2OPR A;  4IKA A;  3OUY B;  1LWC B;  5GMD A;  1N5V A;  3VGT A;  3QO9 B;  2RAQ A;  5HAT A;  2U1A A;  2Y1J A;  4G1P A;  3PX0 A;  4URG A;  2QA4 G;  2H4W B;  2PA3 A;  3T9Z A;  3CT9 A;  3W5X A;  1PJ7 A;  1I1G A;  5I3U A;  1RTD B;  3CJS A;  1Q7L B;  2CJX B;  3H5U A;  4C11 B;  4V19 X;  1UW4 A;  4DV0 J;  5DGB A;  4NYZ A;  1TU0 B;  1EKS A;  1X8D A;  2R2T A;  4ETZ A;  3L09 A;  4WFA Q;  4U95 A;  2A6M A;  2FIU A;  2NUH A;  2GIF A;  1SQG A;  2HIY A;  3OLB A;  1CLF A;  1IBM F;  3EXY A;  2G4B A;  5EHH A;  3B4D A;  4QCL A;  3G6V A;  1RWX B;  3C16 A;  4CLF A;  1PYT A;  5E3P A;  4NLP A;  3CCT A;  4HH1 A;  3GJR B;  4WFZ A;  4OI3 A;  3GZ7 A;  1NH7 A;  1BUX A;  2KXH A;  4CLY A;  1NKE A;  1UFW A;  1DBD A;  4ZKA A;  1S6P A;  2HFU A;  3UNG C;  5ETS A;  1WTB A;  3O1L A;  5B08 A;  1VQ4 S;  6AT1 B;  3BKF A;  4DCJ B;  2MEW A;  1YBU A;  3NGU A;  2G0J A;  2IM2 A;  2PC6 A;  3DHW C;  1RT4 A;  3B54 A;  3MFI A;  4AE5 A;  1M5O C;  1S0M A;  3MM5 A;  1V3S A;  2DXD A;  3BH7 B;  2V9W A;  1CJV A;  1LFP A;  2IJN A;  3CE8 A;  1VIO A;  1UWA A;  3OR1 A;  2VIH A;  4C8L A;  3QPI A;  2JX2 A;  1NAQ A;  4GKJ F;  4Q43 A;  5A8R B;  2XNQ A;  4A8K A;  1H98 A;  4N41 A;  1S99 A;  2CYY A;  3GMG A;  1N0V C;  1VI7 A;  4LFC J;  2VOO A;  4H4K C;  2DHG A;  3G96 A;  1HIY A;  1Y0H A;  3CDE A;  5C24 A;  3VQT A;  2J8A A;  1GTH A;  2DNL A;  1B0V A;  3W62 A;  2OPR B;  3HM9 A;  1AFI A;  3EDR B;  2XGP A;  4Q2L A;  1PC5 A;  4KTQ A;  1C1B B;  4ICL A;  2B8P A;  5E3A A;  3QSI A;  1M5P C;  2WZ1 A;  1S9E A;  1Q79 A;  3CCW A;  3C8Y A;  1VQM S;  3QJJ A;  3RR7 A;  1YKW A;  2KYZ A;  5HQ8 A;  4IH5 A;  1HW9 A;  3PHT A;  3Q89 A;  3TUI C;  4EYI B;  4ZLL A;  5KG0 A;  1RHR B;  4LF7 F;  1SV5 B;  3IG1 A;  3PAC A;  1ZAV A;  4RKU C;  2JH3 A;  1KS2 A;  1NUE A;  2QMX A;  2UXD F;  4MKY A;  2PE8 A;  3ZXW A;  4HI2 A;  1S1W A;  2XUL A;  3MEC B;  1NDP A;  2ZIT A;  2EC2 A;  3IGN A;  4GVL A;  2MHN A;  1UET A;  1PJ6 A;  2OI2 A;  5E5N A;  2SXL A;  2XM3 A;  5BR8 F;  4DR1 J;  1SC6 A;  2GHW A;  3NBP A;  2R7T A;  1AXQ A;  4AUK A;  4TY9 A;  3TNV A;  4LF5 J;  3LOU A;  4Z7Y A;  3SMZ A;  1PSD A;  3RBD A;  4ZP6 A;  5DQI A;  2BJ7 A;  3KUE A;  1NJI T;  2ZZM A;  1G6B A;  1KOO A;  3ETO A;  4JV2 A;  3OSN A;  5AXK A;  1HFE L;  4CNY A;  2C3O A;  4Q8F A;  1Y3K A;  1NU4 A;  2H51 B;  2MXY A;  3D0G E;  1WKL A;  1JLF A;  3CJ3 A;  2QO3 A;  2N3O A;  1RT1 A;  4M5H A;  2VH7 A;  3NOG A;  1CJV B;  3NS5 A;  2F4V F;  2OEL A;  5M2P A;  2R7X A;  2QLX A;  1RBL A;  3T5J A;  1VQP S;  4L72 B;  2E5J A;  3DM2 A;  4X4P A;  2C2D A;  1FJE B;  3DOM A;  4ZN3 A;  3DLL Q;  2CPI A;  5HN0 A;  3MM8 A;  3KK2 A;  3LA0 A;  1QD1 A;  3P4U B;  5MLC V;  2XS5 A;  2XMJ A;  3EM1 A;  4M95 A;  5EGY A;  3CJQ A;  2RKI B;  5AXL A;  1VJW A;  1S9E B;  5J2M A;  2YNF B;  4F26 A;  2OTL S;  4K5S A;  4LVO P;  1N56 A;  2YNH B;  4JUZ A;  3IC1 A;  2JWN A;  3M6X A;  3MR6 A;  1P27 B;  2KN4 A;  3HT3 A;  3AHP A;  2B9X A;  5AE2 A;  1FKO A;  2B4P A;  2YNG A;  3IG1 B;  3FCH A;  3MOZ A;  1OS5 A;  4I2Q B;  3PKY A;  4ED1 A;  3M1V B;  4IG3 A;  4O44 B;  5C42 A;  1NCL A;  1JLB B;  1UEU A;  1WNE A;  3QRQ A;  1IKY A;  3CD6 S;  4ZLP A;  3W7B A;  1KP6 A;  2KO1 A;  3QLH B;  2EW9 A;  3BDP A;  2VUG A;  4ED2 A;  3BQ1 A;  4ZVS B;  2IRX A;  3HJV A;  4Y28 C;  2V6A A;  2DIU A;  4U7U K;  5B0A A;  1TKD A;  1D9A A;  2IC3 B;  4B9L A;  4ELV A;  3M8R A;  3Q2T C;  2QEX S;  2HQF A;  5KFG A;  2KL8 A;  4ID5 B;  4OYA A;  1NK7 A;  1LXJ A;  1AUS L;  1Y3J A;  2QFJ A;  3PRD A;  1M5H A;  2RVJ A;  4QIF A;  4NCG B;  1AZS A;  5D8H B;  4I6Y A;  2PMH A;  1K8A T;  2JC0 A;  2ZHO A;  1FT8 A;  3MM6 A;  1TKZ A;  2D69 A;  1OY8 A;  5CD4 H;  1HBN A;  1GEH A;  1JLF B;  3LGH A;  1G7C B;  4JI5 J;  4B3R J;  2MST A;  4WIQ A;  5KFQ A;  1XWL A;  4WU3 A;  2ZDP A;  3DM2 B;  2C28 A;  5A0Y A;  2C3P A;  4I69 A;  2P6T A;  5IM0 A;  2VON A;  2XZT B;  2V4J A;  4PYA A;  3KK2 B;  3DLJ A;  3LAM A;  2E44 A;  3M9O B;  4JI4 J;  3H98 A;  1AA1 B;  3K5N A;  2G0C A;  2AQ4 A;  3IR6 B;  4B3O A;  3M9M B;  3KWM A;  1RQ0 A;  1E6Y A;  5KFI A;  2VPY B;  2DNK A;  4WFX A;  1REV A;  1WEX A;  1YLX A;  4DR3 F;  1JLC A;  5F8L A;  2AGO A;  3R5D A;  1H2U X;  3NCR A;  3EZU A;  1F3V A;  1U8S A;  2YNG B;  1V6H A;  2MMY A;  4M5L A;  4ZVQ B;  3OTO J;  4ES3 A;  1PCA A;  2R7S A;  3IAS 9;  4O4G B;  4FF2 A;  3JQJ A;  2W7P A;  4Y2M A;  4IQX A;  2IMO A;  3C3L A;  2RSQ A;  4OZ0 A;  2P8I A;  5IQ6 A;  3IP0 A;  3CO0 P;  1R8P A;  1WDT A;  4PG4 A;  4OZ1 A;  2J9D A;  5KFS A;  4DPT A;  3NGD A;  2ZUG A;  4KC5 A;  1D3W A;  1HL6 A;  2GFF A;  3UR0 A;  5EX0 A;  5KFO A;  2KRB A;  2IA6 A;  4QYZ J;  4J9P A;  4PWD A;  2XMW A;  4PKD B;  1NZA A;  1NO8 A;  3BGF A;  2YWE A;  4O3N A;  3BGR A;  1U1N A;  3I87 A;  1AZS B;  2ZH7 A;  5KFN A;  1QDU B;  1AFJ A;  1BXN A;  3BS9 A;  3MM6 B;  1S49 A;  5A6W A;  2HG4 A;  4LSZ B;  2HVI A;  1WC0 A;  3G4S S;  5ADZ A;  1U1R A;  4P9S A;  2IRU A;  1EIY B;  2D3O R;  4QYZ K;  1CJU A;  1TAQ A;  1HHQ A;  2JEG A;  2DIT A;  1Q7Y T;  4ATN A;  4OYW A;  1S97 A;  4DX8 H;  2CJY B;  4WXW A;  2VJU A;  2C2E A;  3A8I A;  5G4D A;  2GZO A;  5HJX A;  1YZ7 A;  3GIL A;  4TNO A;  2V4J B;  3C6T A;  3HVA A;  3GIK A;  1NKB A;  1U24 A;  2PEH A;  1CJT B;  2G9O A;  4ZVG A;  3FBE A;  4ECY A;  5AJ3 J;  3NCQ A;  2FGC A;  2Q79 A;  3DXS X;  4ILL A;  4B3O B;  3VR1 A;  1KEK A;  1E6Y B;  1C2P A;  4I64 A;  1REV B;  3CDW A;  3H4D A;  1XMQ J;  3QGP A;  2MPU A;  3R5C A;  3VAM A;  4D3H A;  5KT5 A;  1YQH A;  5KTQ A;  4A4J A;  1SH3 A;  2M52 A;  1YJ7 A;  4DU7 A;  1AYE A;  3MI7 X;  3HHE A;  3T1A A;  4DV6 J;  3OFE A;  1FKP A;  1M0S A;  1YJU A;  1S10 A;  3NEK A;  4O0N A;  3N28 A;  1FJ7 A;  2W9B A;  2VPX B;  2MQ8 A;  3NGR A;  1HKA A;  1ACM B;  3MAH A;  2VAS A;  4J9R A;  1JLQ A;  1K0T A;  3VAG A;  4DV2 F;  1DHM A;  2EFN A;  2IFX A;  3EVW A;  1FNM A;  2JHE A;  4ITS A;  2XHW A;  4JI6 J;  1FFG B;  3HD1 A;  1FF2 A;  1RYR A;  1RUS A;  3WX4 A;  5LSR A;  3V81 A;  4ED5 A;  2NCK L;  1UVI A;  2ADC A;  3RAM A;  3R1H A;  3H8Y A;  4X64 F;  1BQM A;  3UN2 A;  1NDL A;  4NXM F;  4OLO A;  3HO1 A;  1YVF A;  3HFZ B;  3SQG A;  5GVQ A;  4DUZ F;  3KUG A;  1ZZN A;  5L1L A;  3OFH A;  1H72 C;  2AYE A;  2J76 E;  2HHX A;  2A0F B;  2M4M A;  3MF5 A;  3H40 A;  1MSW D;  5E0O A;  2H65 B;  2LCW A;  3AXM A;  4QPT A;  4A8X A;  2RQC A;  2W25 A;  1YJ9 S;  4G1Q A;  2D3U A;  2N82 B;  1VQ9 S;  2DNP A;  2NZ4 A;  3GSI A;  3I82 A;  1QSS A;  2HQD A;  2W4C A;  5KFK A;  5H9F J;  1M1G A;  1UJ6 A;  2R7O A;  4URS A;  2W4D A;  1KLN A;  2UP1 A;  3PR5 B;  2WOM B;  3CSK A;  3RB6 A;  2J6S A;  1SL0 A;  3J7A 1;  3GU0 A;  2HHT A;  2DNG A;  4RW4 A;  1YHQ S;  4RWX A;  2ZJR Q;  1SL1 A;  2J0W A;  3MCN A;  2MYF A;  2DT9 A;  2NS1 B;  1U6F A;  4K7Q A;  3ZTS A;  3HJF A;  2FJV A;  1TL5 A;  5L1I A;  1X9S A;  2RS8 A;  1HNX F;  1RDR A;  3THP A;  4LQ3 A;  4M5D A;  4J90 A;  3QT5 A;  3LWL A;  2ZM6 J;  1U6B A;  2UXC F;  5H9F K;  4LUB A;  2XYP B;  1S1U B;  3MMB B;  4DR4 J;  2Z8Q A;  4W90 B;  1IM6 A;  5DQH A;  4O23 A;  2ALZ A;  2AP6 A;  3SDE A;  1RWO B;  4X2B A;  1RT7 B;  1WC1 A;  4B3M J;  1FKP B;  2RDJ A;  5IS2 A;  3IWN C;  1GK8 A;  2LFV A;  4AYB D;  5DDR C;  2UXB F;  4OI0 A;  3PFE A;  2F9J A;  2MLX A;  3DCA A;  1KFS A;  2FJB B;  3PW0 A;  1VC5 A;  1VFJ A;  2EEY A;  2BJE A;  1CJK B;  4USK A;  5ETP A;  5EUH A;  5E33 A;  5DLF A;  3E01 B;  1GH8 A;  1MU2 B;  1TL3 A;  3WHI A;  1R8C A;  4KGK A;  4LF8 J;  1RT3 A;  1IUJ A;  3AT1 B;  3CVK A;  1QJH A;  2BJ9 A;  3FC9 A;  4Q0B A;  3MM9 A;  5EWF A;  3J7A N;  1RYS A;  3RBZ A;  1U1P A;  3CIZ A;  3DOL A;  2BJD A;  1KTQ A;  3SQG B;  3EXC X;  2APO A;  4KIA A;  5A2Q U;  5KFM A;  2D9P A;  3FMB A;  3GFH A;  1DAX A;  1RTH B;  3K17 A;  4JV5 F;  4QR2 A;  3ENV A;  4WXO A;  1UPP A;  1VK3 A;  4PRF A;  4YEA A;  1YRX A;  4H4M B;  5HRO B;  4KGV B;  1NPR A;  2P9C A;  2DIS A;  3QYY A;  4C8M A;  2CNK B;  5JMN A;  3EGZ A;  2V4Q A;  5C25 A;  1NSA A;  1VIX A;  3CD0 A;  2IA0 A;  3BN4 A;  4ZPD A;  2ZOG A;  4DV5 F;  3UD3 P;  2BQR A;  4DXL A;  5B09 A;  3I4H X;  2J7W A;  4KV8 B;  4JI3 F;  2W2P P;  5DS7 A;  2PDA A;  2AGQ A;  2M3D A;  2XG8 A;  4X66 F;  3PEJ A;  4K8R A;  1AT1 B;  2IBO A;  1ZAX A;  5H9E J;  1RHK B;  1H3D A;  3S8S A;  3N5B A;  1FJG J;  1SIW B;  5T41 A;  1RXO B;  4K0K F;  1XNR F;  1DRZ A;  2PMZ D;  1HLW A;  2RH3 A;  2L41 A;  2CA9 A;  3ZZU A;  1SUQ B;  2UUA J;  3AOC A;  2HLU A;  2AT1 B;  1SQF A;  2CQH A;  3KNG A;  3I0S B;  5ETN A;  4FP9 A;  2F40 A;  2FVQ A;  1TUW A;  1BC6 A;  2R2R A;  1R8B A;  4AQY J;  3K5P A;  4CO5 A;  2UV8 A;  5H9E K;  1KNZ A;  1RZM A;  1Z2Z A;  4DS4 A;  2GJ2 A;  4NXN F;  2HFZ A;  2OSQ A;  1YBA A;  2LYV A;  1RWM B;  4ZCK A;  2MLZ A;  2PI4 A;  1XER A;  3I31 A;  3VHQ A;  2KFZ A;  2VFV A;  1V9O A;  4D3G A;  1EKR A;  1TL3 B;  4OZL A;  2ATL A;  1NB7 A;  2QV6 A;  1VS3 A;  1Z4U A;  1C0U A;  2BE7 D;  3GYN A;  2MQQ A;  3Q83 A;  3R2D J;  1NRK A;  2DNQ A;  2QTW A;  2XI3 A;  1HBU B;  1Q5V A;  1RAG B;  3QT7 A;  2CPF A;  2E1R A;  2UVU A;  3SV4 A;  3W2W B;  2QFI A;  1TL4 A;  1P9Q C;  2C22 A;  1AUD A;  4RBU A;  1S0V A;  3THV A;  4KGX B;  2GQQ A;  2COL A;  3OFF A;  2BR0 A;  3CC2 S;  1R6Y A;  3QFH A;  1UFL A;  2R7R A;  3N79 A;  1TK0 A;  1JMT A;  4ZPV R;  1TFW A;  4CO0 A;  2OUG A;  3HZE A;  1HYS A;  2XMT A;  3L7U A;  3CCJ S;  3SV3 A;  3MCS A;  4UF4 A;  4AXI A;  4HEA 9;  5JUM A;  3TQE A;  1HHT P;  3PKM A;  2XY7 A;  3OJS A;  3I32 A;  3TAM B;  3QAU A;  2WON A;  1IBM J;  4BCA A;  2CKW A;  3ENQ A;  5MAO A;  2DR6 A;  3IBF B;  2R7V A;  3IAM 9;  1EB0 A;  5D4L A;  1VYA A;  2UUT A;  4A8O A;  3DRS B;  4USW A;  1NJW A;  2P9G A;  5E3C A;  1NJY A;  4MH8 A;  3MZI A;  3POT A;  2IPO B;  4CP5 A;  2H9Z A;  4IH6 A;  1XN9 A;  4NRT A;  3GE9 A;  4OZN A;  3QID A;  3EIC A;  2DR7 A;  1IBK F;  3A12 A;  2AIR B;  1EX8 A;  3QZ7 A;  1UL3 A;  3PYE A;  4PAB A;  5HAO A;  4GKJ J;  3VAJ A;  2E5G A;  4O4R A;  3ELH A;  1TQL A;  4M1K A;  4DZ6 A;  3OSP A;  2XZW A;  3DOK A;  3HSD A;  1IR2 A;  4K2J A;  1R0A A;  2WTF A;  3HDS A;  2QJ3 A;  1FRH A;  5LXY A;  2HBR B;  1U02 A;  1CPZ A;  2PEB A;  4HAC A;  3AD7 C;  5D15 A;  3D54 A;  3RRH A;  1UCN A;  3DLG B;  4EO8 A;  3SXL A;  3KJQ B;  4M5M A;  4RNH A;  4IRK A;  2F4F A;  4A8W A;  3HFK A;  1EJ7 L;  5D0R A;  2DR8 A;  1C0U B;  1JNZ B;  2NXJ A;  4BLG A;  4MIB A;  4OHX A;  1TK5 A;  2CQ4 A;  3IXQ A;  3KG1 A;  4LF7 J;  4AND A;  1G2E A;  2CVE A;  1WF0 A;  4WZM A;  3D66 A;  1ZYQ A;  3G6Y A;  1FDB A;  2EG2 A;  3TJ9 A;  4DQQ A;  2ZH9 A;  1SJR A;  5I3P A;  4TU9 A;  3H4B A;  2YTC A;  2UXD J;  4YHH F;  1B3T A;  1T9U A;  5BJR A;  4V19 J;  1IXK A;  1RT5 A;  4OI4 A;  4CLS A;  1WOO A;  2DY1 A;  1B99 A;  3MAA A;  3M6V A;  4ZOS A;  3LAK A;  1U26 A;  4DJB A;  1X7V A;  4BHQ A;  1JIH A;  4RW6 B;  1SQE A;  3A3O B;  3TZY A;  2H5E A;  5HAN A;  1ROF A;  3LAN A;  3OJU A;  2I5J B;  1U1Q A;  2WON B;  2YKM B;  2PD1 A;  3PRV A;  5BR8 J;  2KT5 A;  1HBO B;  3BM7 A;  3CD7 A;  4DUT A;  2DGS A;  4DSE A;  5A6P A;  1ZPW X;  1H2V Z;  3GFY A;  5J2P A;  2VBX A;  4GKK F;  1GXL A;  3DHX A;  1SJ1 A;  2UU9 F;  1MMN A;  4TLQ A;  3RTV A;  1HA1 A;  3VWS A;  2XMA A;  4I7F B;  2GCF A;  5KFU A;  2M8H A;  2IHR 1;  2MZQ A;  4OZ3 A;  5GAG U;  2Q3P A;  1YRT A;  2M0G B;  3JS9 A;  3ZTQ A;  5DET A;  3AOB A;  3IGV A;  1KQK A;  2HAF A;  4WK3 A;  2E5L F;  1AW0 A;  3MEG A;  2W4P A;  2CG8 A;  1CG2 A;  1PO6 A;  1LWX A;  3SYZ A;  3M30 B;  4JI0 F;  4M8L A;  3N6M A;  1LWE A;  1J5O B;  4USU A;  1VBZ A;  1VMB A;  3DOK B;  2Z30 B;  2E1M C;  2JLF A;  3H2U B;  4O3O A;  4UQG A;  1FWL A;  4DSL A;  2HFO A;  4OV1 A;  3KK1 A;  3H5Y A;  2GO9 A;  2HNY B;  3D0I E;  4X4Q A;  4WTO B;  1QM9 A;  5CZV A;  1VHF A;  3TWZ A;  3W9J A;  3T19 A;  3T5H A;  2KXN B;  2O67 A;  2VBW A;  3QT6 A;  3GPA A;  3OL7 A;  2OEM A;  1PJ5 A;  1FX4 A;  1U1O A;  2HLT A;  2AV5 A;  4QW8 A;  4TVA B;  2MLY A;  3SBM A;  1LW2 A;  1VOM A;  1L3U A;  3RAQ A;  2FHJ D;  2MJN A;  2VG7 B;  3MM7 B;  2HMI A;  1N88 A;  3DRX A;  2EVZ A;  3BSO A;  1S6Q A;  4HH0 A;  1IVZ A;  1OQ6 A;  5AXM A;  1NB2 A;  1FNX H;  1D1U A;  3D1H A;  3KLF A;  2Y0S D;  2WB4 A;  4KGZ B;  1KKH A;  2ZWO A;  1KQG B;  2MQO A;  1JKH B;  5L1J A;  4ECS A;  1RT5 B;  2JEI A;  4KPC A;  1UVJ A;  3IMQ J;  1TL7 B;  3BV8 A;  4BBY A;  4ZDN A;  4PXE A;  2VOP A;  1T9X A;  4DV1 F;  4HHH A;  1BQX A;  4PG7 A;  3UN5 A;  4F4X A;  4Y00 A;  3TUZ C;  4P75 A;  4FYD A;  3ZZR A;  3MOJ B;  2FGO A;  2LDY A;  3EDQ B;  3UVJ A;  3QRP A;  2POK A;  4FNH A;  3DGV A;  3G8T A;  2HKE A;  2HYI B;  5J2P B;  1XJW B;  1SKS A;  2BRL A;  2GAH C;  4UOF A;  1FCA A;  2R7Q A;  3H59 A;  1T05 A;  2QSW A;  4MKV A;  1NK0 A;  2NPI A;  4WYL A;  1HHS A;  4YB5 A;  3NL0 A;  4ED0 A;  4I68 A;  1N52 B;  4ZMM A;  3IM8 A;  3MEG B;  2KJV A;  3KLG A;  1WD6 A;  4UOG A;  2AEF A;  5DDO C;  2QC3 A;  4NZ6 A;  1NHK L;  2M8D B;  2E7W A;  4U9R A;  1B7F A;  4IDK B;  3TAN A;  5D4P A;  4GC6 A;  3TI0 A;  1B4S A;  4LBH A;  4HLB A;  2FHO B;  2E1C A;  2MKC A;  4LF6 F;  3RJM B;  5F9L A;  4DFP A;  2G1D A;  1WHW A;  3KLH B;  5IT0 A;  4JV1 A;  4EEY A;  2LEC A;  3M8Y A;  1IKW B;  1WHY A;  1DQA A;  1VRU B;  1YK9 A;  3LP2 B;  4DR3 J;  2W7O A;  4O3P A;  4OZ5 A;  5C2C A;  4LVN P;  2RS2 A;  1VQ8 S;  3FJ2 A;  2FQQ B;  4CTA A;  1HNV A;  1NXI A;  2EK6 A;  3FFI B;  1W2I A;  1BE4 A;  1O8B A;  2RUS A;  1X4B A;  2QLW A;  2VL1 A;  2HFV A;  4F2S A;  3H42 A;  5A8K A;  2C2Z B;  2DNY A;  2FTR A;  2DNH A;  3RRK A;  2MSS A;  4MT1 A;  1RT2 B;  4Q5V A;  1L3S A;  2PMW A;  2GMJ A;  2GVD A;  3OXL A;  3KLF B;  1VLY A;  2AGP A;  3BGU A;  3FRZ A;  3J81 j;  1KWM A;  4OYB A;  4DV4 F;  3J7Y U;  3T41 A;  4ANC A;  4ECX A;  4PWU A;  1JLA A;  3D6M B;  4GVB A;  3CC7 S;  2AWZ A;  1FHT A;  2B5J A;  2LQ9 A;  3ZTR A;  3I55 S;  4ED8 A;  3BYP A;  3W9H A;  2J6T A;  3NNC A;  3QQC D;  2FJA B;  2I9S A;  4F4Y A;  2NSC A;  1YRU A;  3P45 B;  1LEO A;  2ZE2 B;  7FDR A;  1I5O B;  4UQT A;  4M94 A;  3DFE A;  2HBY B;  2LQ5 A;  3M2U B;  3IA0 A;  1G1X A;  2H4Y B;  5HQM A;  2JVO A;  3JTO A;  1KD1 T;  2VC0 A;  3UNY A;  2YWH A;  3MGJ A;  2UUC J;  3JSY A;  2PGC A;  3QFW A;  3M7V A;  2Z4P A;  4FF1 A;  3MPW A;  3RAX A;  3X1L B;  1X5O A;  4FPI A;  4UUX A;  3CJR A;  2VIC A;  4MJK A;  2YH0 A;  3IBC B;  2D1C A;  4PUO A;  1C0T A;  3X3U A;  3MMC B;  1URN A;  3G87 A;  2ZH2 A;  2EBG A;  1R3N A;  2CPY A;  2CWK A;  2FJW A;  3NY0 A;  3MEE A;  2HNZ A;  1NME B;  3OT9 A;  4FF4 A;  1R0B G;  3I9Z A;  4DQS A;  2K1R A;  1FXD A;  1HQE B;  1ZTW A;  4MK8 A;  2VJV A;  5CD4 A;  1IBL F;  5HSP A;  3AH6 A;  4NI2 A;  2DNO A;  3JYT A;  1TV6 B;  4A48 A;  4RUH A;  4OHV A;  5GAD I;  4LSL A;  3MTK A;  3WQP A;  2A3J A;  3S01 A;  1J5E F;  2JJ4 D;  1YJV A;  1EP4 A;  1GAO A;  2CG4 A;  3ET6 A;  3PFO A;  1QAI A;  5CYM B;  2G13 A;  4CTA B;  4WE1 A;  1FD8 A;  5C2G A;  5IC6 B;  2QLB B;  2Q66 A;  2GQ2 A;  1VRT B;  2GQC A;  2OPS A;  1X0F A;  1Y9O A;  2LMI A;  2OLW A;  5FLX U;  4OQJ A;  4DL5 A;  5DZ6 A;  4Y2C A;  2N4C A;  1VIS A;  1S1T A;  3D3C J;  4F4K A;  3C15 B;  3CCE S;  4S0M A;  2GVD B;  4QBU A;  1S48 A;  4ES1 A;  3DMJ B;  1NHV A;  4IO9 Q;  3EVM A;  3KMS A;  2YNI A;  1AB8 A;  4ZVR B;  2E9R X;  4PPD A;  1JLA B;  2ZH6 A;  1D09 B;  4R25 A;  2V8H A;  2HHW A;  3HPO A;  2BVZ A;  4P72 A;  3DDK A;  4IH7 A;  4DV2 J;  4EZ9 A;  4LF9 F;  1TUV A;  4EBD A;  4DQI A;  1NEE A;  1X4E A;  5BYS A;  5L39 A;  3M8P B;  4IR1 A;  2DHX A;  2GC8 A;  4J9N A;  1KON A;  4P73 A;  1RT6 B;  2CPD A;  1UEV A;  5A8W B;  4U7U D;  3B6B A;  5C7P A;  5J1E A;  4N77 A;  4F02 A;  4WFY A;  2NPF A;  3AD8 C;  2H48 B;  3MMA B;  2K06 A;  4X64 J;  5FII A;  4O3Q A;  3G86 A;  2R8I A;  2RDI A;  4NXM J;  2LKZ A;  4NLT A;  4XPC A;  4DUZ J;  4IYQ A;  5KG5 A;  1VBK A;  2RQ4 A;  3T3F A;  4UZB A;  2PT0 A;  1F0X A;  1DJ0 A;  5J2Q A;  1YJR A;  2AJ2 A;  3D6H B;  1MLA A;  3D0H E;  2HND B;  4LF4 J;  2AJF E;  1BGX T;  2BOA A;  2RUG A;  1FTR A;  2J0Q D;  5AXN A;  3HHL D;  2HNZ B;  2ASY A;  1S0O A;  3CCZ A;  5J1P A;  4LFA J;  4WYW A;  4OJ3 A;  1LK5 A;  4E8U A;  2CZV C;  3ILJ A;  4P52 A;  3G71 S;  2DCL A;  5FD1 A;  3NGS A;  4NI2 B;  3PIP Q;  1S9F A;  2OAU A;  4ZIV A;  2OIH A;  2DBB A;  2MTL A;  3K89 A;  3BGL A;  5LJ5 Y;  2R8H A;  1R8H A;  4LSL B;  3P5B P;  1HNX J;  2FJE B;  4E2F B;  3VAH A;  1EP4 B;  3K5O A;  2UXC J;  4ZVH A;  1HQ2 A;  4FN5 A;  1KR4 A;  2LXF A;  1VQ7 S;  4PQU A;  5KFC A;  3BH6 B;  5L38 A;  2QZ8 A;  3D7S B;  3NRB A;  3THT A;  5J2N A;  3TAQ A;  2QA2 A;  4ILR A;  5T7L B;  4QIG A;  2IBK A;  3GWC A;  2FZC B;  4DUY F;  4KB7 A;  2UXB J;  2NR0 A;  5KFB A;  4ECZ A;  3KJV A;  3CO9 A;  4CO2 A;  1S12 A;  4P7T A;  2ZHB A;  4OYO A;  4YDD B;  1DTQ B;  5DO2 A;  2DY9 A;  3BGO P;  1RAF B;  2JSX A;  4AL7 A;  1IWA A;  1PIE A;  2DGT A;  3DGP B;  1SIZ A;  3L4B C;  1BLU A;  4Y65 A;  2XYH B;  3W60 A;  2HSE B;  4KSE B;  1O0P A;  2VQE J;  2GAG C;  3OV7 A;  3ETM A;  5L46 A;  5EDW A;  4F0K A;  2RML A;  4TQR A;  5CHC B;  5IV3 A;  3UR3 C;  5T14 A;  5CH7 B;  5K8M A;  3UDL A;  3TA0 A;  2IVY A;  2Z2L A;  3TJ8 A;  3GCW P;  4JV5 J;  2VV5 A;  5KT6 A;  2BE2 B;  2V94 A;  1MMD A;  3BPD A;  3ZTO A;  3VCD A;  1SC3 B;  4DLE A;  4F3M A;  4DS5 A;  4HHJ A;  3FSX A;  3C46 A;  3JTN A;  1WEL A;  4MTP A;  1S1X A;  2JLG A;  4F8R A;  4FF3 A;  3CIM A;  2CZ9 A;  4DV5 J;  4DR7 F;  3CED A;  1VR6 A;  1JLG B;  5K8N A;  4JI3 J;  4N8O A;  1V3Z A;  3MCO A;  2DKO B;  2NXN A;  4NLX A;  1F5C A;  2EFV A;  4ZCL A;  4KJI A;  1D9D A;  2B9W A;  3V4M A;  3ZZY A;  3F41 A;  1UWB A;  3I0R A;  2RRA A;  3TP2 A;  3HUL A;  3PO4 A;  2Y3Y A;  4C8Z A;  1ARO P;  4K0K J;  3J81 U;  4DCO B;  4QJV A;  2W7A A;  3KDO A;  3I5A A;  4PQU B;  2U2F A;  4PWW A;  2KRR A;  1HPZ B;  5LXR A;  4R8U A;  4FBT A;  3QRR A;  1MG7 A;  5J2N B;  3V2U C;  2NRE A;  2DK2 A;  4DL3 A;  3OL9 A;  1S77 D;  2EFQ A;  4X4T A;  1LK7 A;  5DDP C;  5KAK A;  1HMV B;  5BYR A;  1OIA A;  2BA9 A;  5HVF A;  1Q16 B;  4NRU A;  4P2F A;  2ZJQ Q;  4NLS A;  4NXN J;  3KK3 B;  4NA3 A;  1X5T A;  3VGS A;  4DL4 A;  4KE5 A;  1Z2L A;  3K8W A;  2YWW A;  3Q8S B;  1IJF B;  3M32 A;  2JLE A;  3VAL A;  4K4Y A;  2YKN A;  3OQ2 A;  2MKY A;  3VGU A;  4H54 A;  4OHZ A;  3TUP A;  1NSK L;  2MZJ A;  1W2B R;  4CYU A;  4ER8 A;  2DEJ A;  2I2Y A;  3LP0 B;  2MY7 A;  4BS2 A;  1GNK A;  1P1L A;  1CUL A;  3ZZZ A;  3BSC A;  4K4W A;  2K7K A;  1QTN B;  1RU1 A;  4NLV A;  4YQW A;  3BBB A;  2WSC C;  2JRS A;  2K3I A;  2XWX A;  2AU0 A;  1OSC A;  3BQ2 A;  1XC9 A;  2HQ3 A;  4JI8 F;  1K44 A;  1JK9 B;  4GO5 X;  2ROE A;  1VQS A;  3BR8 A;  3EZO A;  3QJL A;  2G1H A;  5B0E A;  1K1S A;  3W8G A;  1F3F A;  1TMM A;  3TVZ A;  3MED B;  2W2N P;  2EXU A;  5I42 A;  2EPI A;  4CLZ A;  4FYY B;  4C2M A;  1HI1 A;  4CM2 A;  2RQM A;  2R9L A;  5CYQ A;  4CI0 B;  3SCL E;  5U47 A;  2J8S A;  1KLM A;  4DLG A;  3ISN C;  2CPZ A;  3UO0 A;  1WSR A;  3I0R B;  2EWH A;  4MKA A;  1HW8 A;  2Y9H A;  1D0E A;  1RAB B;  2JOQ A;  5DQG A;  3T1H F;  3PVX A;  2CDR B;  3KLI B;  2OPP B;  3UCG A;  1L3K A;  3DLK A;  4R8U B;  2KYX A;  4JI7 F;  2BAC A;  2BBE A;  1J2V A;  2KDO A;  2DVI A;  2PN6 A;  2P2C B;  2NXU A;  3FQK A;  1S7I A;  1IBK J;  1VGY A;  4YB7 A;  2V8V A;  4EYH B;  1WKK A;  4OIX A;  3RBE A;  4M5J A;  1MWZ A;  5DG7 A;  4DL6 A;  1TKT A;  2ZKT A;  4Q7A A;  2HPU A;  2L9W A;  2VFU A;  3MUT P;  5A76 A;  2Y1I A;  3RUB L;  5ETV A;  4YME A;  1FWK A;  2YWF A;  1FDD A;  3ZZO A;  3K8V A;  1RAC B;  5F8M A;  5CQG A;  2ZBC A;  2CQ1 A;  3NXZ A;  2BKO A;  4LIW A;  1SL2 A;  2R8J A;  3V6H A;  3O3L A;  3M32 B;  3R5G A;  1VLO A;  5LMU J;  4ECT A;  5IFM A;  3HVT A;  2EG1 A;  1SVD A;  3HT0 A;  3A4T A;  2CJB A;  3A1Y G;  2AJ0 A;  3DYA B;  1VQN S;  2HVH A;  5F41 A;  3PW7 A;  2KI2 A;  4WP9 A;  5KFW A;  3TO8 A;  4ZP8 A;  2X3G A;  3TYT A;  3PW2 A;  3C14 B;  1FER A;  2AKW B;  2HQG A;  4ZK7 M;  2NXC A;  4QR1 A;  4ENO A;  2FC8 A;  3M2V A;  3TVY A;  2RNE A;  4YHH J;  2KTQ A;  3TAR A;  1FFW B;  4X62 F;  1NLK L;  2XO6 A;  1SC1 B;  4CM0 A;  4RW8 B;  2NLW A;  4FKX A;  5KG2 A;  5J1N A;  2XO7 A;  3NLC A;  2GIR A;  3LTO A;  3N6L A;  4MAK A;  2A1B A;  1U48 A;  1L3T A;  2ASJ A;  4U6P A;  5I42 B;  3EUN A;  1NSP A;  1PKU A;  3RG6 A;  1S9G A;  2O01 C;  2V2Z A;  3DDN A;  3W2V A;  2IJF A;  4FVC A;  3TR5 A;  1MWY A;  3U02 A;  2V2Q A;  2QGF B;  2J9D E;  5HJY A;  2UU9 J;  4YB1 P;  1RE1 B;  4ID8 A;  5M2R A;  3EE3 A;  2H54 B;  2CQ0 A;  2B56 A;  1RLC L;  1CS4 B;  4LSN B;  3PYF A;  2VG6 A;  2W2M P;  1E6V A;  1RBO B;  3R97 A;  5H1S V;  1ZET A;  5LOQ A;  4C0B A;  2EC0 A;  2HZV A;  5GAE I;  4ED3 A;  1G3O A;  1TP7 A;  2IIH A;  4KYZ A;  2E5L J;  2ZEJ A;  4ZCM A;  2RDD A;  4DV3 J;  3KJN B;  4L76 A;  1SCJ B;  2CFX A;  3SZ2 A;  4OLP A;  4JI0 J;  1U25 A;  2J6U A;  5CXT A;  2X1F A;  2XS7 A;  2I8E A;  3D5M A;  4Y3C A;  4FS1 A;  2VPZ B;  3R5A A;  4OJG A;  4DX6 A;  2ALY B;  4DI6 A;  4JI1 J;  2UUB F;  3ILL A;  4OI2 A;  2W9C A;  1X4H A;  1UVL A;  2DEI A;  1XR7 A;  3CC4 S;  4RNF A;  3MXH P;  1IKV A;  3M05 A;  3SFG A;  1RB0 A;  4JB8 B;  4MMO A;  3AA9 A;  3HHL B;  4IRD A;  3OXG A;  2KVI A;  3D2W A;  4XK8 C;  5SZT A;  3IR7 B;  2J0X A;  2E9T A;  4HT7 A;  2AYG A;  3PRB A;  3RGI A;  4LR7 A;  2D3O 1;  2FHM A;  4ALZ A;  1EET B;  2XMU A;  2W2O P;  2XI2 A;  4C6A A;  2MZS A;  2BOP A;  2DJW A;  2R42 A;  4QOT A;  1DTT A;  3GYG A;  2IDL A;  1UPM B;  3BDE A;  1YGY A;  3CJ8 A;  3KYL A;  2XZD B;  4A8S A;  3FSY A;  4J9M A;  4DV1 J;  3D1O A;  5KOW A;  1S1V A;  2CDQ A;  1CQM A;  4OYM A;  3BJY A;  3DI6 A;  1Q1K A;  3NS7 B;  4J37 A;  1OYE A;  1F60 B;  5I3U B;  4CLP A;  4DPU A;  2ZH8 A;  3JB9 k;  2F8M A;  3QWP A;  1YG0 A;  2HGN A;  4ZCI A;  2OEJ A;  2NYH A;  2UVV A;  1SJQ A;  2GVZ A;  1RJJ A;  3WX8 A;  3GJQ B;  3Q8P B;  3TUJ C;  4LR9 A;  3EJM A;  1R89 A;  2DR9 A;  2E7V A;  1WOP A;  2F1F A;  2VFS A;  4F0H A;  2B8Q A;  4RU9 A;  2L48 A;  1FRI A;  1NK4 A;  4K2X A;  2C2O B;  3C16 B;  1M90 T;  2K2P A;  3CCU S;  4J9V A;  4OYP A;  5B0C A;  2P9E A;  1T9V A;  4IO1 A;  4LIR A;  3T9N A;  4DQP A;  2F9D A;  4YN3 B;  2BEF A;  3J7Z T;  3K5L A;  2ROP A;  1S6P B;  3HSG A;  3RB0 A;  2W9C B;  2UZA A;  1RU2 A;  2AEJ A;  1DUR A;  1RT4 B;  2OEK A;  4K50 A;  2W2Q P;  3CNQ P;  3MM5 B;  3Q8Y A;  5GAH U;  5K8P A;  2V8D A;  3M6U A;  1YI2 S;  3KUH A;  4G65 A;  3DLE A;  1RAO A;  2O1P A;  3OR1 B;  4FYX B;  2DXF A;  2RD5 C;  3H5X A;  2XCP A;  2E66 A;  1VCT A;  4C7Q A;  7AT1 B;  2GGP A;  3DKD A;  4EGL A;  1XBW A;  2VA2 A;  4MKB A;  4JI5 F;  1WG5 A;  3M8Q A;  2CPH A;  1U4B A;  1FRX A;  5C24 B;  3UFC X;  3Q8U A;  3TEH B;  1QY7 A;  2HGL A;  1HD0 A;  3OTC A;  2R7W A;  1NSQ A;  4DV4 J;  3HHL C;  1DTT B;  4KO0 A;  3UW1 A;  1JB0 C;  4ICL B;  3MD1 A;  3U7J A;  4C3K A;  1H38 A;  3HXM A;  2HQI A;  1YX2 A;  1U0S A;  2VKZ G;  4EZ6 A;  1X5P A;  3H0P A;  3WC2 A;  2HWT A;  1S1V B;  4EK2 A;  1FNO A;  3BB5 A;  4KHP J;  3DI6 B;  2BM0 A;  2ATC B;  3D68 A;  1T03 A;  4AL6 A;  4KKO A;  4Q45 A;  2D7S A;  4PAA A;  5KG7 A;  2IYI A;  4DR6 F;  3G6E S;  3GQC A;  4U8Y A;  4F3O A;  4G6V B;  4JP8 A;  2VBY A;  2WSF C;  5KG6 A;  5EX3 A;  3HX9 A;  1S1W B;  5K20 B;  1EHW A;  3AD9 C;  4OJH A;  2I1R A;  1TL1 A;  2BKP A;  3FNN A;  4U7C A;  1IR0 A;  5IT9 Y;  4DSJ A;  4DPX A;  2DR5 A;  3I9V 9;  2B7B B;  3T5K A;  1RKJ A;  1HNI A;  1T9T A;  4OFZ A;  3NBP B;  2G2Y A;  1PAE X;  2YQ1 A;  1SJF A;  4CT8 A;  2YX4 A;  3U27 A;  3F56 A;  4I4B A;  3UDC A;  4DN9 A;  2F63 A;  2DO4 A;  1LKZ A;  4A47 A;  4TKT A;  3P96 A;  4F04 B;  1IBL J;  2B4O A;  3R7N B;  4OI1 A;  1HI0 P;  3CJK A;  1TK8 A;  2I6W A;  1S6U A;  1Q5Y A;  3EWG A;  2OPQ A;  2ASL A;  1RT1 B;  3CW2 C;  2W8L A;  1UW9 A;  2DD8 S;  4HR2 A;  3I5B A;  1X0P A;  2ZH4 A;  1Q78 A;  3IWL A;  3AB4 B;  3V6J A;  1ZPV A;  4I1T A;  1SKR A;  5I3Q A;  1VQL S;  5HL7 Q;  2GGP B;  4P74 A;  4R0J A;  5HVH A;  4PXD A;  4DCP B;  3DOM B;  4UOC A;  5LSO A;  3RZA A;  3FQL A;  1JXE A;  4R5P A;  3KHL A;  2HWH A;  4DV7 J;  1S72 S;  4IQM A;  4KY3 A;  2DNZ A;  3MM8 B;  1F9H A;  1MRO A;  2PFF B;  4ZJQ A;  3RBX A;  2CZ4 A;  4ZLN A;  1EQ0 A;  1IM4 A;  2WBR A;  2AX1 A;  3LW5 C;  1LWF A;  2Z0G A;  2FPH X;  1BHN A;  5KFF A;  5J2M B;  1SKW A;  2LXU A;  5GME A;  4LF9 J;  1C4A A;  1FKO B;  1NK5 A;  4DR5 F;  1HWJ A;  1SH0 A;  4I67 A;  4DHV A;  3H25 A;  5KT3 A;  2BZ2 A;  4XAK A;  4HVZ A;  4B9S A;  2YPZ A;  2FUG 9;  1WC3 A;  4IG3 B;  3DC2 A;  3GLJ A;  5C42 B;  3PZP A;  5EWE A;  1U1K A;  2AD9 A;  2NXE A;  4K5R A;  2UVW A;  2VG5 A;  1IKY B;  3O44 A;  5F8G A;  2W9A A;  1XK8 A;  1IN0 A;  1H6K X;  2H3E B;  4NX9 A;  2A6O A;  1SBR A;  1C1C A;  1T3O A;  4J9K A;  3IRX A;  1RAJ A;  2E29 A;  2EFO A;  2JDJ A;  4EI2 A;  2OFG X;  3OR2 A;  2ZD1 A;  3A8J A;  2HW3 A;  1U2F A;  4FXD A;  1NHU A;  5DG9 A;  1K73 T;  4USM A;  3UQS A;  3WZ0 A;  3LP1 A;  1SKU B;  6FDR A;  4C4W A;  3EPI A;  1HR0 F;  4O0I A;  3OD2 A;  3DLH A;  1U1M A;  2N4D A;  1RGV A;  4C8N A;  4DSK A;  2FVC A;  3CJK B;  3ITH A;  1SXL A;  3IS9 A;  3C6U A;  1OY6 A;  1TKZ B;  5G0R A;  3VF0 B;  3BPS P;  3VAK A;  1M5V C;  4LFB F;  1X60 A;  1P1T A;  3FSI A;  2C3Y A;  1HBN B;  4P71 A;  1WOR A;  3GIJ A;  3AOA A;  4NL5 A;  1BWV A;  3HSJ A;  2AW0 A;  3LUY A;  5A0Y B;  4QWD A;  3QIP A;  5IM0 B;  1LV5 A;  1ZM4 A;  1FE4 A;  1N36 F;  3HF5 A;  3TA2 A;  3SIP B;  4WF9 Q;  1EAY C;  3E2E A;  3KHG A;  3EGV A;  2CQI A;  1RAD B;  2JZ5 A;  1PC4 A;  4RL1 A;  4DUY J;  3GV5 B;  4U96 A;  1LWF B;  4XDD A;  1WEZ A;  2O5D A;  3P8B B;  4YDX A;  2JFK A;  4TN2 A;  2A18 A;  4RNN A;  4ZJL A;  2RU9 A;  2ZZT A;  3NAH A;  4CLK A;  1JLC B;  4GO7 X;  3VVT A;  4OX6 A;  5DM7 Q;  5L9N A;  1GXU A;  2DH7 A;  4MFB A;  2BW2 A;  2ZC3 A;  2M9K A;  3GFZ A;  5B0B A;  3GG0 A;  2GO8 A;  2V67 A;  5HMW A;  3GR0 A;  3N0V A;  1VDH A;  3AFG A;  2KZZ A;  4H4K A;  2V50 A;  1QUV A;  4DG1 A;  2CQ3 A;  3OHA A;  3QJP A;  2FJD B;  3K2Y A;  3CTR A;  1H0H B;  4FS2 A;  2Y8W A;  4OMF G;  2AZ3 A;  4DL2 A;  3CF5 Q;  3PYD A;  2LEA A;  3W61 A;  2Q43 A;  5IC4 B;  2ZBP A;  4IOA Q;  3WDO A;  2W24 A;  2F5G A;  3ENW A;  2R4F A;  3QGH A;  3CUL A;  3W65 A;  3P49 B;  3MPU B;  3NGT A;  3DRP A;  2HHH F;  4PWD B;  4OX9 F;  3I56 S;  4DR7 J;  3BGR B;  4FXV A;  3MR5 A;  2KT3 A;  5LMN F;  4G3I A;  3QO9 A;  4NEZ A;  4WII A;  1FXL A;  4NLY A;  2VC1 A;  4LF8 F;  3CCV S;  1ZZF A;  4CH1 A;  1U0H A;  3GTY X;  2HWI A;  4PEO A;  5F9N A;  2W8K A;  4XO0 A;  1CJU B;  1QAJ A;  2HEK A;  3MPD A;  5IWA F;  1RTD A;  4YOE A;  1KVK A;  4CT9 A;  1WTF A;  3ZZP A;  3H5S A;  1WG4 A;  2J9C A;  4C11 A;  3SEO A;  4YR3 A;  4ANE A;  2C2M B;  2CQB A;  3C6T B;  3CWJ A;  4P6Q A;  2XGQ A;  3EGW B;  4YY3 F;  3N6N A;  2JC1 A;  3H2L A;  3M9N B;  4J9S A;  2KHD A;  1OPZ A;  1QLN A;  2V2V A;  2R2U A;  3JAM U;  4JV0 A;  5IT4 A;  1RTZ A;  4TXS A;  5CCL A;  1RHM B;  2FB0 A;  1F6T A;  3DRY A;  3V4I A;  4CDI A;  4A8M P;  3AXK A;  1YDL A;  3AJD A;  2DNR A;  1I51 B;  2VF3 A;  2IRY A;  1ZTT A;  1D8Y A;  3BRE A;  1WWH A;  4CNZ A;  1N4L A;  2DGU A;  4CRJ A;  4M5I A;  4YS2 A;  1UFK A;  2XLJ A;  4C97 A;  2XCA A;  4K4U A;  2W9B B;  1B70 B;  4JYA F;  3EPG A;  1DLO A;  1GFW B;  1JLQ B;  4WBF A;  4JI2 J;  2BE9 B;  4HL9 A;  4F3Q A;  2RF2 A;  2LDI A;  2KM8 B;  2CNL B;  1QVF R;  4JI8 J;  3CD5 A;  3ILI A;  2J7U A;  4Y2K A;  3ICL A;  4L74 A;  1UJ4 A;  3CJ4 A;  2XY6 A;  3BKU A;  2E1A A;  2CPJ A;  2DNN A;  3V81 B;  3GFX A;  1FWP A;  1EAR A;  2YX7 A;  3GB0 A;  2E9Z A;  1BQM B;  1C1B A;  2G2Z A;  3OVS A;  2J7K A;  4C98 A;  2KVQ E;  3CJ0 A;  2LEP A;  1LXN A;  3DN9 A;  1TMJ A;  1BWE A;  3J80 U;  1U0H B;  1JWW A;  2EKY A;  3ADA C;  2XY5 A;  2MGZ A;  2GA7 A;  3LAL A;  4G1Q B;  1SV5 A;  3IN5 A;  2P6S A;  3T1H J;  2XSF A;  2Y1R I;  5DM6 Q;  1IQT A;  5AT1 B;  1CVJ A;  1LFW A;  3IBW A;  2WK4 A;  2HVD A;  4JI7 J;  5KFL A;  2Y1L B;  2BM1 A;  4EBC A;  2GIQ A;  4RW4 B;  3MEC A;  3ENA A;  2WBM A;  5FLX Y;  1RHQ B;  2IM1 A;  2AJ4 A;  4LRD A;  3OLA A;  4UUW A;  3NKY A;  3D4J A;  1WG1 A;  1DFD A;  4M5D B;  2HHV A;  1HWL A;  4MYT A;  3V4I B;  3HVW A;  1FJC A;  4CH7 A;  1QSL A;  2OFH X;  4NA2 A;  1K0V A;  4NCA A;  1LOU A;  4TY8 A;  2VQF J;  2OGU A;  3SDE B;  2X1G A;  1F5A A;  4CZC A;  2NUU G;  3W3S A;  2FVP A;  2VDH A;  2ERR A;  4JBC A;  3SCJ E;  4Y34 A;  3PXG a;  4X4R A;  4X4V A;  8ATC B;  2D41 A;  1DLO B;  3AAW B;  2QMU B;  4DF8 A;  2XQC A;  4ZVF A;  2B9Y A;  2RF2 B;  2WRM A;  3RB3 A;  1WOS A;  2A2D A;  1GMV A;  4Y2I A;  4X62 J;  2GNK A;  4QW9 A;  4Q8E A;  3R7S B;  4X4S A;  2KFN A;  1FD2 A;  2B4U A;  4PG6 A;  2HFN A;  1RT3 B;  4DZD A;  2HBZ B;  2L3M A;  2YBV A;  2DRA A;  1WJ9 A;  4LQ9 A;  4HHU A;  4Q0B B;  2O3D A;  3OVA A;  3MM9 B;  3LGM A;  2RKI A;  2QIF A;  3DOL B;  4ELT A;  1GMW A;  4ZPA A;  2Z58 B;  2YNF A;  2QRR A;  4E98 A;  2KM8 C;  5F8N A;  4I6W A;  3G9C A;  4LMZ A;  2YNH A;  4BC7 A;  1WF2 A;  2BDP A;  2CJ9 A;  1F9F A;  1X9M A;  2ZBR A;  1EZZ B;  1YJT A;  4Y0F A;  2MGZ B;  3I5C A;  2QLF B;  2OHD A;  3CCQ S;  3UI3 A;  1FXR A;  2DRD A;  2IDE A;  4F25 A;  2ZVI A;  2DCU B;  1HQU A;  1IWG A;  4I2Q A;  5C25 B;  3OBI A;  5L1K A;  3M1V A;  4O44 A;  4ECQ A;  3WIV A;  3LH2 S;  5D77 A;  4J9L A;  4ZVE A;  5F3T A;  3TX0 A;  5E2Q A;  1JLB A;  4B3S F;  5HMZ A;  4ZPB A;  3L3C A;  3QLH A;  2X51 A;  1B7Y B;  1JJ2 R;  2Z56 B;  4JOU A;  1HNW F;  1V3R A;  3CMA S;  2IC3 A;  3MR7 A;  7FD1 A;  4ZVT B;  1I94 F;  3QNW B;  1FDN A;  3ZO7 A;  4ID5 A;  3KMQ A;  2YKO A;  2FLO A;  2UUB J;  3W9I A;  1RWW B;  4QWA A;  1UKU A;  4RNO A;  1ZS6 A;  1N5T A;  3PNI A;  3QGI A;  3MUR P;  3FEX B;  2DPJ A;  3GV7 B;  2PII A;  4M5N A;  2ZH5 A;  1Q0N A;  1W26 A;  3MWB A;  4TY8 B;  5HI7 A;  4NCG A;  2V4R A;  4ZP9 A;  4DWI A;  1KBR A;  5F0U A;  5SUH A;  4TYB A;  2HS0 A;  3F73 A;  3GCX P;  4F4W A;  1OQ3 A;  3KDN A;  4X4O A;  3GYX B;  4LBI A;  3TQ1 A;  5HO4 A;  2CVI A;  1HWI A;  4FXW A;  4QZV B;  1FFS B;  4IFY A;  1QSY A;  3BSN A;  4USI A;  3LPE A;  2XWY A;  4YR0 A;  3H7H B;  4K4V A;  1FE0 A;  1T3N A;  1P8G A;  3NWR A;  1R7I A;  3FK4 A;  2Z2M A;  4PYD A;  3PX6 A;  5B7W A;  5BXI A;  4ZIT A;  5ETK A;  1Y5N B;  3ZZT A;  2UV8 G;  3HK2 A;  1UVK A;  3FBB A;  3B82 A;  2F3J A;  2KFY A;  2HFS A;  1U6Z A;  2QYG A;  1FA0 A;  5HP1 A;  5IV4 A;  5JXS A;  3KHR A;  1ZBT A;  1K47 A;  1S5Z A;  2YQ0 A;  1N32 F;  4N56 A;  1VC6 A;  3OL8 A;  4AL5 A;  3FMW A;  5ETO A;  1KSP A;  1HQU B;  2VFR A;  4O4G A;  1HYS B;  3PDN A;  1RA6 A;  1NJZ A;  1NKC A;  1UZH A;  3MTJ A;  3J81 Y;  1YTY A;  3EGN A;  2MY8 A;  3HZG A;  2D74 B;  4X65 F;  4WJB A;  3TZW A;  3AY0 A;  1B64 A;  3LWM A;  4RNM A;  4B9N A;  1Q8B A;  5HVG A;  2ZUA A;  1Q8K A;  2CJQ A;  4ZJO A;  2LXI A;  1TTH B;  5CAA A;  5KFE A;  1URR A;  5CYJ A;  2Q1L A;  1RHU B;  5LJ3 Y;  2MDA A;  2RU3 A;  4NML A;  4IUF A;  4ZPC A;  3POT B;  3KJF B;  1FRK A;  1YJW S;  3MEK A;  4NYO A;  1WKJ A;  3WC0 A;  3K5M A;  2YWG A;  4KGM A;  1NBE B;  4N7T A;  3PTW A;  1N33 F;  3BKT A;  1ZH5 A;  2F4V J;  3O5T B;  4ZVU B;  2ACY A;  4RUA A;  2HQC A;  1R43 A;  4CQ1 A;  3PM9 A;  4OL8 A;  5JVG Q;  4F0M A;  2BJ8 A;  3SSR A;  1UVM A;  3FEZ A;  2DHA A;  1TKX A;  4CCH A;  1R0A B;  4IFY B;  5F8I A;  2YKP A;  4K4Z A;  2O66 A;  4NEY A;  3PW5 A;  4HAC B;  3KTQ A;  2R7U A;  2MB0 B;  5HLF A;  1P6T A;  3K59 A;  2XLI A;  1ZOT A;  1SH2 A;  1RI7 A;  2F8H A;  1YIJ S;  2PI5 A;  2PA8 D;  1PBU A;  4C3L A;  1GXT A;  5EWG A;  2XHC A;  4X4N A;  3IRW P;  1CQN A;  3ISN D;  1CJT A;  2VB6 A;  2GW8 A;  4NZ7 A;  3NMA A;  4P2M A;  1HWU A;  2OTJ S;  4QWE A;  1NND A;  1H2T Z;  1U47 A;  4DR6 J;  2AJ1 A;  5HP1 B;  2KKH A;  3GP9 A;  3K58 A;  1TEL A;  3ZTP A;  1NK6 A;  2ZNZ A;  2AZ1 A;  3MAA B;  3BO3 A;  1A6L A;  4NMX A;  5B0F A;  5IOL A;  5K5M A;  4QQB A;  3V6D A;  5ETT A;  4NLW A;  2FZK B;  3FCW A;  4Y2A A;  2WVF A;  4ELU A;  3UD4 P;  4RBV A;  4DX5 A;  3FVY A;  5HK4 A;  1PYO B;  2WW4 A;  1WI6 A;  2DPI A;  5E41 A;  5HMX A;  3SSS A;  4NLU A;  2CQD A;  4UOH A;  3T6J A;  3PR4 A;  2XS2 A;  3P6Y C;  1PYS B;  4RUB A;  4USJ C;  1UA0 A;  3VAF A;  3T1Y F;  2UUC F;  3V5R A;  3KG0 A;  1VHI A;  3D9B A;  1N48 A;  4DU8 A;  2CIM A;  3FBC A;  3CPW R;  3N4W A;  3D3B J;  4QIV A;  4F67 A;  4EUV A;  3C66 A;  2Z57 B;  4PQA A;  1LWE B;  1RTI A;  3KNA A;  2ZC4 A;  1TKX B;  2AYM A;  3E8O A;  3Q8Q B;  4CLT A;  3KK1 B;  1RIS A;  4OX8 A;  4OX7 A;  3BO2 A;  5HLF B;  3R6G B;  2YH1 A;  1Y00 A;  2RRB A;  2Q6B A;  1FRL A;  2ZFH A;  1VC0 A;  3CCR S;  3AQP A;  2FLP A;  2PSZ A;  1RP5 A;  2WOM A;  4RJV A;  3L7P A;  4OZ2 A;  1LW2 B;  2ZWP A;  4DFJ A;  4A46 A;  2HGM A;  3M6W A;  1FDA A;  2KU7 A;  2HMI B;  1KTV A;  2NZC A;  1S6Q B;  5DLG A;  4DR5 J;  5CCM A;  4EU0 A;  1Q82 T;  1L3V A;  3MMB A;  1CSJ A;  1MNE A;  1S1U A;  3KXD A;  3UDE A;  1ICE B;  1H7W A;  1VJQ A;  4GRS A;  2R2S A;  2DGX A;  4BC9 A;  2ASD A;  4NWB A;  5IXU A;  2M7S A;  1RT7 A;  4DN0 A;  2RJZ A;  4OHY A;  4N47 A;  2X3D A;  3B8H A;  2ROG A;  2YKQ A;  4AFF A;  4URQ U;  1KQF B;  3V6D B;  4ED4 A;  4DSF A;  5I4M A;  4LJM A;  3D6F B;  3UVJ B;  2CQC A;  3ZFV A;  4XPE A;  3JQM A;  2QA1 A;  1QE1 A;  2WVC A;  1DY3 A;  2XBP A;  3CDA A;  4YUD A;  3CCM S;  2WVE A;  1IBC B;  4WWS A;  1CJK A;  2J9E A;  4LRA A;  1NDK A;  1S57 A;  1HR0 J;  3E01 A;  1SC4 B;  1ULR A;  4C3M A;  1MU2 A;  1CC7 A;  5HBM A;  1J27 A;  1GT8 A;  1HI8 A;  1T05 B;  1KVJ A;  1FO1 A;  3B78 A;  4LFB J;  4J9Q A;  2HBQ B;  4NLD A;  5CA5 A;  4USH A;  4RPF A;  3KLG B;  4IRC A;  1X5S A;  1KC8 T;  1Y7P A;  3P3D A;  4O3S A;  2DB1 A;  2CQG A;  3WIU A;  3FEY B;  1RTH A;  2HVZ A;  4J5O A;  1RTI B;  3VZI A;  4H4M A;  3Q22 A;  5HRO A;  1N36 J;  4LF4 F;  4FPR A;  2MQN A;  2IJR A;  1FI4 A;  4PXC A;  8RUC A;  2CJA A;  5F8H A;  5E7O B;  4LFA F;  5IQQ A;  5KFR A;  2N7Y A;  4ERD A;  3LQV A;  1YWX A;  3R7B B;  4KV8 A;  4HTI A;  4YR2 A;  3D6T B;  2HHU A;  4BWJ A;  2BMB A;  4LRB A;  2EKN A;  5KT4 A;  4USV A;  3S1T A;  2XNR A;  3PG9 A;  1HNV B;  3OL6 A;  4ECU A;  1N54 B;  4U67 Q;  2OJ3 A;  3IO1 A;  2JVR A;  1UVN A;  1F2H A;  3TVK A;  4GC7 A;  1V5V A;  5A8K B;  3MHY A;  1HNZ F;  5KG3 A;  8AT1 B;  2ILY A;  4LF2 A;  2ZVS A;  3Q8R B;  1SUQ A;  1Z1Z A;  4B9U A;  3I0S A;  3D67 A;  1WEY A;  1X4F A;  2XMV A;  4GVB B;  1DAR A;  2QMW A;  2B5J B;  1UAW A;  3ULH A;  4CIO A;  2CWX A;  4DR2 F;  4HDG A;  4MK7 A;  1UMJ A;  4PG5 A;  1N5Y A;  1ELO A;  5AE1 A;  2HHH J;  3OHB A;  1QE1 B;  1N5Q A;  3HKW A;  4FZV A;  2Y8Y A;  4OX9 J;  2V0N A;  1FX2 A;  4DEZ A;  2CJK A;  2OMO A;  5ETL A;  1T0T V;  3KFW X;  1JXV A;  4XDC A;  2GS8 A;  2VPW B;  5LMN J;  3HI9 A;  4P7V A;  5HBM B;  3KHH A;  3R5B A;  4KH1 B;  5DGA A;  3GJS B;  2VQE F;  4U8V A;  2CPE A;  1ITP A;  2LLZ A;  2RT3 A;  4LRC A;  5GAG I;  4PUO B;  3R1L A;  1OJ4 A;  2LVW A;  1C0T B;  4IR9 A;  1HBU A;  3W2W A;  4V1A k;  2A2C A;  1RWK B;  5IWA J;  3BQ0 A;  5DZ7 A;  4HKQ A;  3MEE B;  2N7C A;  3BR9 A;  4F4A A;  1F5B A;  2C3M A;  4ECW A;  1ZM3 A;  2K1R B;  2V2K A;  2HZA A;  1R6V A;  1MWQ A;  3O6Q A;  4YY3 J;  3JYT B;  1S0N A;  5LT5 A;  3UCZ P;  4K4S A;  3IR5 B;  1QVG R;  3HHN B;  4Y6I A;  2JEJ A;  3TAM A;  3L95 X;  5HMY A;  3NWG A;  5KG4 A;  1CBK A;  3ET6 B;  1EQM A;  4NLG A;  4B3T F;  4NYP A;  1JX4 A;  1O6X A;  3FUY A;  5AE3 A;  4DSI A;  4WE1 B;  2VBZ A;  4LR8 A;  1FRJ A;  4XTT A;  1O5J A;  2OPS B;  4NA1 A;  1Q8L A;  3IWX A;  2P5V A;  4KR0 B;  1TVR A;  2CAD A;  3DRS A;  2HRT A;  1F2G A;  3NNH A;  1S1T B;  3SFU A;  3QAE A;  4L6V 3;  2MHE A;  2CAJ A;  3NCP A;  2WVB A;  4EFA C;  4W92 B;  1UEK A;  3SCK E;  2YNI B;  4J9U E;  3VTI A;  4ZVO B;  5K8O A;  2ZOM A;  4JYA J;  4M5K A;  3EVO A;  4IFV A;  5LM7 E;  1XQI A;  1CC8 A;  2WB1 D;  2KH9 A;  4F50 A;  1JJ4 A;  1U1L A;  1N5Y B;  1VQ5 S;  1PAU B;  2RHQ B;  3BSA A;  2ZOF A;  4TLR A;  1NK9 A;  3N9U C;  1D9F A;  5J1E B;  1VBY A;  2C2R A;  3PYG A;  3DLG A;  3D1Q A;  4OYZ A;  1A0O B;  2FDN A;  4C0H A;  4DL7 A;  2VA3 A;  3OTB A;  4UT4 A;  3Q86 A;  1XNQ F;  4IOB A;  5JJB A;  2LU2 A;  3CGI A;  3G6X A;  5J2Q B;  1Q86 T;  3FGV A;  4K4T A;  3RYL A;  1U2R A;  1WHX A;  3HCX A;  2EFG A;  3CB4 A;  5D4N A;  1VBX A;  3PJX A;  3QSY B;  3M8W A;  4NE9 C;  1HAR A;  1U2C A;  3EMT A;  4LT6 A;  2WW8 A;  2YY3 A;  3AB2 B;  4YFU A;  5D0H A;  3OTE A;  4RR5 A;  3I6P A;  1OWX A;  4X66 J;  4HYK A;  2ADB A;  4HDH A;  2RE1 A;  1XMO F;  1OPI A;  4RW6 A;  2YWK A;  1N34 F;  1K1Q A;  1B0P A;  2FD2 A;  2I5J A;  3NP5 A;  2YKM A;  2FLN A;  3HD2 A;  3VV2 B;  1OYD A;  3A3N B;  2FHK A;  1XNR J;  1YJN S;  1HBO A;  4B02 A;  1U45 A;  3R9L A;  2FVS A;  4P2X A;  4DFM A;  1B0T A;  2CXE A;  4N5S A;  3NMR A;  3CCL S;  4CLU A;  2IMW P;  1TVR B;  2VOD A;  1SI9 A;  4HTJ A;  2MQM A;  4WKY A;  1VK8 A;  5IT9 U;  3FDS A;  4I7F A;  1S59 A;  2KXF A;  4KBI A;  3UN3 A;  3W66 A;  3OFG A;  3N01 A;  5KT7 A;  1JLE A;  3QAT A;  4QYR A;  3DU6 A;  1S4F A;  3KJV B;  3J7Y I;  3FZB A;  4C8Y A;  2PO4 A;  3Q24 A;  4IFV B;  2RB7 A;  4I56 A;  2WCX A;  4L75 A;  3M30 A;  2ZHA A;  4AXJ A;  2WHO A;  1X4A A;  2Q6C A;  5KT2 A;  1J5O A;  3SI8 A;  1S6O A;  3PX4 A;  2HNY A;  4QU6 A;  4QR0 A;  2QL7 B;  2OSR A;  4UY8 T;  5GAD U;  4C9D A;  4NZ0 A;  4TYA A;  2I0X A;  4UTG A;  5LMU F;  2HIQ A;  2LQB A;  4WPA A;  4WFB Q;  4UY8 5;  2VZ9 A;  3JSR A;  5JVH Q;  4AD6 A;  4I2P A;  2DYA A;  2IM3 A;  2VG7 A;  2ZH3 A;  3MM7 A;  2X7I A;  2VD3 A;  2UVR A;  2ACM A;  4DQR A;  4NPO A;  5DJB A;  2CUY A;  3IM9 A;  3QMQ A;  1S1X B;  1WUU A;  3OXF A;  1GTE A;  1MN9 A;  4RW9 A;  1Q95 G;  1JKH A;  1U7L A;  2DXE A;  4B3S J;  1X9W A;  1RAE B;  1FRM A;  1TL7 A;  1QAX A;  3HLU A;  3SCI E;  4KFB A;  2A10 A;  1KRP A;  4WKR A;  4DPY A;  4C48 A;  4ES2 A;  1UP1 A;  2QX0 A;  1Q8I A;  1HNW J;  1UWB B;  3A8K A;  3OW2 R;  1WDD A;  1MW7 A;  2MQP A;  4OV6 A;  4ZVP B;  4K59 A;  5DRK A;  1I94 J;  3PCO B;  4OJ1 A;  4ZLJ A;  4G1I A;  1NH8 A;  3DU5 A;  4Z37 A;  1OMS A;  3VGV A;  2BKN A;  3MFH A;  5D6G A;  9RUB A;  3A8E A;  2HUR A;  2HK3 A;  1RK8 A;  2LU1 A;  4DPO A;  1T8E A;  4DV0 F;  4PXB A;  2LQJ A;  1L5U A;  1RWN B;  2G0I A;  5K14 A;  4ECV A;  1M1K T;  5F3Z A;  2ZDO A;  1JLE B;  2ZKU A;  3MPV A;  3PJW A;  1KQS R;  1WAC A;  4OI6 A;  1XR6 A;  3M8S A;  2ZJP Q;  2FJX A;  4DV3 F;  1DQ9 A;  3G8S A;  1H73 A;  4DL0 C;  3VVU A;  3QWU A;  4P10 A;  1V5I B;  2MKI A;  1QTM A;  4ECR A;  2QT7 A;  1HBM A;  4C0O C;  2BAB A;  2YKN B;  4PZV A;  2DHS A;  3GIM A;  4DX7 A;  4ILM A;  2OP5 A;  4IDK A;  5KFT A;  1Y11 A;  4CYU B;  1ZAW A;  2HK2 A;  4JI1 F;  3HSZ A;  4TU7 A;  1A9N B;  2C1E B;  1CUL B;  4AT1 B;  2HRY A;  2D9O A;  2HRU A;  3KLH A;  1XR5 A;  4WTY A;  2M88 A;  3I4P A;  3UPF A;  4QWC A;  1IKW A;  1VRU A;  2R8G A;  1OY9 A;  3LP2 A;  3MPY A;  4B9V A;  2MKK A;  4I2P B;  3ILO A;  4YP3 A;  3FFI A;  1N32 J;  3WBZ A;  4LFC F;  1Y10 A;  2E7X A;  1ZM2 A;  5B0D A;  1NZ8 A;  1RT2 A;  1ZA1 B;  2OD4 A;  3GON A;  1KOH A;  3EZ5 A;  4RW9 B;  2BXJ A;  2GHP A;  3QBC A;  1R31 A;  4X65 J;  2AX0 A;  2M2B A;  1G4C A;  2X1A A;  4KFB B;  3HVR A;  2L9D A;  4UST A;  4DF4 A;  1LNQ A;  4FYW B;  5CYQ B;  3AA8 A;  2CQP A;  3H90 A;  1KLM B;  3DDI A;  2ZE2 A;  4KH0 B;  4GKK J;  2CPX A;  1TAU A;  3AOD A;  1X4D A;  3M2U A;  3CUN A;  2H5J B;  3NNA A;  2F65 A;  3HFV A;  4KHM A;  2C42 A;  3JAM Y;  2ILZ A;  1RAA B;  2B3T B;  3DLK B;  4UW2 A;  5K9F A;  1VQK S;  3FCV A;  1WHV A;  2JFD A;  2QYC A;  3B4M A;  3TOQ A;  2QG9 B;  3R2C J;  4IG0 A;  2V8G A;  1N33 J;  3NG8 A;  1FEE A;  4I0W A;  5ETQ A;  2B6A A;  1N8R T;  4TQS A;  2ZH1 A;  5K14 B;  3W1Y C;  1BQN A;  4WFN Q;  2CNO B;  1Y5I B;  2V5H G;  1TKT B;  4KPY A;  4ZHR A;  1NJX A;  2FZG B;  3MMC A;  4KRW A;  4PR6 A;  4DR1 F;  4ZPW R;  4LF5 F;  3CCS S;  2WVD A;  2AMC B;  3MAQ A;  3MR3 A;  1HBM B;  3W63 A;  3R27 A;  1YIT S;  1HQE A;  1NK8 A;  3HVT B;  3AJ1 A;  3IFE A;  2FY8 A;  3KOA A;  1TV6 A;  2HZC A;  3UD5 A;  3FBF A;  4CO4 A;  1NDC A;  1R0C B;  1RCO B;  4BDP A;  3BF4 A;  1PIL A;  2FY1 A;  1RAI B;  3GJT B;  1RCX B;  3M2V B;  5CYM A;  2F7V A;  4Q44 A;  2IVF B;  4O3R A;  5ETR A;  2B51 A;  4PCQ A;  1VRT A;  2GX8 A;  4WK1 A;  3AQO A;  4MIW A;  4W4M A;  3J80 Y;  5A2Q Y;  1JJC B;  3C2P A;  2QLJ B;  3RB4 A;  2MKJ A;  2VHG A;  1M5K C;  3C15 A;  1BMQ B;  5KFA A;  3DMJ A;  1RWP B;  2HVE A;  2DTJ A;  5RUB A;  1SJ3 P;  2QSF A;  2BAN A;  2J5A A;  2KHC A;  2HS4 A;  3QGG A;  4KHR A;  4OYX A;  3Q23 A;  3Q8V A;  1T9W A;  1S9G B;  2D3Z A;  5E3Q A;  3VZH A;  3W2V B;  2BW7 A;  4RW7 A;  4A8Q A;  4KHP F;  1WC4 A;  1ZM9 A;  3G2X A;  1BY9 A;  3M8P A;  4I6A A;  3PY8 A;  3C19 A;  5C5J A;  2M5Y A;  5L8R C;  5B0G A;  1RT6 A;  3CJ5 A;  3MCM A;  2Z2Z A;  5F8J A;  1RLD A;  5A8W A;  4N76 A;  2Z2Y B;  3K57 A;  1WSV A;  2BJ1 A;  2VG6 B;  1LW0 A;  1NM2 A;  1E6V B;  5EN1 A;  5L9X A;  3T1Y J;  1KFD A;  2GV1 A;  3MMA A;  5M2U A;  3UE2 A;  5BYQ A;  2ZZN A;  3FKB A;  3AJ2 A;  4IG0 B;  2MKS A;  5D3G A;  1GMU A;  2LP4 A;  2WAQ D;  4ZA1 A;  3MDF A;  2XEX A;  2B6A B;  3PW4 A;  1T02 A;  3EYZ A;  2IY5 B;  4WP3 A;  1XTZ A;  2XTJ P;  1BQN B;  5THW A;  1T7P A;  4ZHR B;  1RTJ A;  2K7J A;  4MYU A;  3UWT A;  3RW6 A;  1MML A;  1SPB P;  1QUP A;  4MIA A;  1IJE B;  3US5 A;  1GX5 A;  2YXL A;  2HND A;  1OO0 B;  2XYG B;  3JXO A;  1N6Q A;  3G82 A;  2GJF A;  3A3P B;  4HT5 A;  4C8O A;  3J7Z 5;  2I38 A;  4LF6 J;  1WF1 A;  6FD1 A;  4UZC A;  1WC5 A;  1KHW A;  1UZD A;  2GJI A;  5D0E A;  1IKV B;  2J0S D;  4C8K A;  4FBU A;  4FYV B;  3TRG A;  5FJ4 A;  2YX1 A;  4NLQ A;  1LQ9 A;  1Y5L B;  4J91 A;  4LRF A;  2YKA A;  5KFV A;  2BV3 A;  2QN6 B;  4LRE A;  2GML A;  1W7W A;  2CRL A;  2H1Y A;  3BYR A;  2IVM A;  1T11 A;  4B3R F;  1RBA A;  9ATC B;  4RX6 A;  2BJ3 A;  1JXL A;  1FES A;  2E1P A;  3MUM P;  2DGO A;  4DMZ A;  4GMK A;  2QL5 B;  4F4Z A;  2E5I A;  3TJA A;  4B9M A;  1FK9 A;  4N8N A;  5D4O A;  2DGW A;  3NAI A;  4ZS6 A;  5ETM A;  2YQ3 A;  1A7G E;  4DV7 F;  5D78 A;  4QU7 A;  3T5L A;  1SB6 A;  5T7L A;  2PFD A;  2MZT A;  1JNR B;  2MQL A;  2IAJ A;  5GMK a;  4FNI A;  1S4E A;  4JI4 F;  4MK9 A;  3SSQ A;  2BAN B;  4ED7 A;  3CMQ A;  1VRQ C;  1U09 A;  4F36 A;  3BEG B;  4CWB A;  2F8E X;  2M70 A;  2QA4 S;  5F0W A;  1DTQ A;  2XMK A;  4RW7 B;  2KB2 A;  2C2K B;  4RUC A;  1UTA A;  3BBC A;  4DPW A;  4DDF A;  3DGP A;  3M2R A;  3GII A;  3OTO F;  3TW0 A;  2BQU A;  4NOH A;  2DHH A;  3CME S;  2GVZ B;  3PEH A;  1LW0 B;  1NPK A;  3Q0A A;  3Q2S C;  4WU2 A;  4ED6 A;  1RKI A;  1REG X;  4WCE Q;  1X31 C;  3ONQ A;  3R8Y A;  3DXB A;  5D3G B;  3GV8 B;  2V68 A;  5DDQ C;  2DGQ A;  3G8Q A;  1YSJ A;  2RQK A;  1XEZ A;  1X4C A;  2JL9 A;  1RTJ B;  4NCB A;  2B7C B;  2BE2 A;  4X4U A;  4L73 A;  3F44 A;  2MZR A;  4PG8 A;  4FKY A;  2VFT A;  4OYI A;  2OO4 A;  1N6Q B;  3G82 B;  3TZX A;  2FHJ A;  4EBE A;  1I3O B;  3GIR A;  3PO5 A;  4P2S A;  3EX7 B;  3JSM A;  3W5Z A;  2V63 A;  1JLG A;  4EMD A;  3W5Y A;  1J5E J;  3O2I A;  5KFJ A;  3DLE B;  4EO6 A;  3UDV A;  1T95 A;  2GHV C;  1KHV A;  1ZA2 B;  3H20 A;  2AF6 A;  4CLW A;  5DG8 A;  2C3U A;  2V69 A;  2B0G A;  4LBP A;  3BBF A;  1O51 A;  3CDB A;  2AJQ A;  2EI5 A;  3M8Q B;  1JJH A;  4RZR A;  1HNZ J;  1Q81 T;  3JTP A;  3M4X A;  5E3R A;  2AYB A;  2K3K A;  3HKZ D;  2ZNY A;  2DH9 A;  4QIE A;  1FK9 B;  1D8Z A;  1HPZ A;  2C2N A;  1KVI A;  3M8Z A;  2QL9 B;  5GAE U;  2FC9 A;  3R5J B;  4KO0 B;  2W01 A;  2HAI A;  1W25 A;  4PPZ A;  4ZP7 A;  2QE5 A;  3BN7 A;  4L3N A;  2HS3 A;  1I6J A;  3JQK A;  1FVQ A;  4DBQ A;  3LGN A;  3L7O A;  1M5S A;  2BX6 A;  4DR2 J;  4QPX A;  1HMV A;  2E5H A;  3PV8 A;  2IAJ B;  5FDL A;  3U1N A;  5AJ3 F;  2KZM A;  1S7H A;  3TAP A;  3TX8 A;  3SQO P;  4WP8 A;  1Q53 A;  3TZZ A;  4IOC Q;  1T03 B;  3QZ8 A;  4KKO B;  2V8P A;  3KKF A;  3KK3 A;  2OML A;  2ABY A;  1XMQ F;  3ISZ A;  3LF0 A;  2ZBI A;  4H4O A;  1N5S A;  2L9N A;  2B9E A;  2V9K A;  3M2R B;  3GSD A;  2YVS A;  2DH8 A;  3HHD A;  1HWK A;  2JNJ A;  4QIW D;  2NSB A;  4B9T A;  5D0G A;  1TL1 B;  2LQ8 A;  2VU5 A;  3LP0 A;  3U1M A;  1T94 A;  4DV6 F;  3I96 A;  2KT2 A;  2MKH A;  1IKX A;  1WC6 A;  1GQE A;  1HNI B;  4WZQ A;  2RIL A;  2OH2 A;  2NYI A;  2BUN A;  4F7V A;  2RHS B;  1VQY A;  4FVM A;  1Y4Z B;  4NLO A;  4A8F A;  1RWV B;  4OZJ A;  5KFH A;  2R3V A;  3A13 A;  3CJ2 A;  3FRY A;  5KFP A;  5CZX A;  3VQS A;  2EFP A;  5KFX A;  4JI6 F;  1P9Y A;  1APS A;  4J9O A;  2XSJ A;  3TEG A;  2RIJ A;  2LA6 A;  3BZQ A;  2B4V A;  4BWM A;  2YPY A;  3S7R A;  4Q2M A;  1UJ5 A;  4XIU A;  3JSM B;  3H2V E;  1XIQ A;  4DFK A;  3W8P A;  5HQL A;  1CEZ A;  2FLL A;  4TU8 A;  3MED A;  2OPQ B;  1PBA A;  3R6L B;  4EWT A;  3U1L A;  2KG0 A;  3DNC A;  4B3T J;  1DZ5 A;  1RSC A;  4K4X A;  2HHS A;  2H5I B;  1R8A A;  3V6K A;  1RHJ B;  2LA4 A;  1RAH B;  1MN7 A;  3KLE A;  1KN6 A;  4R5P B;  2DIV A;  2HHQ A;  1S79 A;  2DGV A;  1BD6 A;  2BYC A;  3PJ9 A;  1TFY A;  2VKR A;  3KG4 A;  3MMJ A;  4M5G A;  1S76 D;  1GMW D;  2OD6 A;  3KLI A;  3D28 A;  1MRO B;  2IM0 A;  1FVS A;  2OPP A;  2DRB A;  2X1B A;  3DRR A;  5KFZ A;  2KJW A;  2AEM A;  4R0E A;  4CO1 A;  2IYG A;  3UCU P;  2EK1 A;  3GG1 A;  4X84 A;  4J7C A;  3R3T A;  4LF1 A;  5FDL B;  2R8K A;  4Z7C A;  1GX6 A;  3O8W A;  1QAY A;  1R27 B;  1M1H A;  2ZM6 F;  5LL6 d;  3ZNU A;  4DR4 F;  1RA7 A;  2XMM A;  4CO3 A;  4H4O B;  1N0U A;  4E0D A;  3PHE A;  4RWW A;  1FKA F;  2VG5 B;  4QWB A;  1C1C B;  1DQ8 A;  1RWU A;  3DYA A;  4B3M F;  2MJU A;  1XNQ J;  4KQZ A;  3IRX B;  1JQG A;  2DNM A;  4ETX A;  3HP6 A;  1IKX B;  3T6B A;  4B17 A;  4RBT A;  4ZN1 A;  3OR2 B;  4KAI A;  2G2O A;  3C14 A;  1NPP A;  3MR2 A; 
#chains in the Genus database with same CATH homology
 2B8P A;  4DI6 A;  3ENA A;  3GPA A;  4ANE A;  5BXI A;  3ZTO A;  1W7W A;  4HR2 A;  1NPK A;  4F4A A;  4DUT A;  3DDI A;  1UCN A;  3EMT A;  3EVO A;  3Q8Y A;  4O0N A;  1XQI A;  4UOF A;  3VGT A;  1F3F A;  3FBC A;  3FBB A;  1NSP A;  3FBF A;  3NGR A;  3Q89 A;  2DXF A;  1PKU A;  1EHW A;  1NDC A;  1BE4 A;  1HHQ A;  1WKJ A;  1BUX A;  4S0M A;  3VGS A;  1ZS6 A;  1VYA A;  3FKB A;  3GP9 A;  3EVM A;  3NGT A;  1WKL A;  3ZTP A;  3DKD A;  3FCV A;  2AZ1 A;  1S5Z A;  1F6T A;  1NCL A;  2CWK A;  3EVW A;  3NGU A;  2BX6 A;  1NUE A;  3Q83 A;  3VGV A;  3B54 A;  3WX8 A;  3EE3 A;  4AND A;  1NB2 A;  2DY9 A;  3VGU A;  4FKY A;  3Q8U A;  3R9L A;  3ZTQ A;  3JS9 A;  1NSK L;  3EJM A;  3ZTS A;  2DXD A;  2HUR A;  3BH7 B;  4W98 A;  4ANC A;  4CP5 A;  4UOG A;  3NGS A;  5IOL A;  1BHN A;  1HLW A;  1XIQ A;  3VVT A;  5CAB A;  1PAE X;  2B8Q A;  1NSQ A;  2DYA A;  3ZTR A;  1NHK L;  3FC9 A;  3FBE A;  4KPC A;  2NCK L;  4C6A A;  1LWX A;  1NDP A;  3FCW A;  1JXV A;  4ENO A;  4F36 A;  3EIC A;  2HVE A;  3Q86 A;  3ETM A;  1LEO A;  3BBB A;  1S59 A;  1NDK A;  1B4S A;  1B99 A;  1S57 A;  1NDL A;  3B6B A;  1HIY A;  5C7P A;  3ELH A;  4EK2 A;  1MN7 A;  2BEF A;  4FKX A;  3EM1 A;  3Q8V A;  3BBC A;  2HVD A;  1U8W A;  1NLK L;  4DZ6 A;  2ZUA A;  3MPD A;  1WKK A;  1K44 A;  1MN9 A;  1KDN A;  3BH6 B;  3VVU A;  2VU5 A;  3L7U A;  4UOH A;  3BBF A;  5CAA A;  4WBF A;  3G2X A;  3PJ9 A;  2AZ3 A;  2DXE A;  3PRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...