2HVDA

Human nucleoside diphosphate kinase a complexed with adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords Nucleoside diphosphate kinase A
publication title Crystal Structures of S120G Mutant and Wild Type of Human Nucleoside Diphosphate Kinase A in Complex with ADP
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hvdA00
1K44A 3EJMA 3EICA 1VYAA 3BBCA 1B4SA 5CAAA 2VU5A 2HURA 4CP5A 1KDNA 1WKLA 3B54A 4UOFA 3BH6B 4ANCA 3FBCA 4ENOA 3VGSA 1BUXA 3VVTA 1NDKA 3Q86A 3Q89A 3Q8YA 2DXDA 1NDLA 2DXEA 3MPDA 1ZS6A 3FBFA 3EVOA 2AZ3A 2DYAA 2B8PA 1WKKA 4W98A 2CWKA 1XIQA 3ETMA 1NLKL 3Q83A 5CABA 3ZTPA 2HVEA 4HR2A 3VGVA 4F4AA 3PJ9A 1W7WA 3PRVA 1BHNA 1NSKL 3Q8VA 2ZUAA 4F36A 3NGSA 3DKDA 4EK2A 4UOGA 1S5ZA 1B99A 4O0NA 5C7PA 3JS9A 3VGUA 2DXFA 3BBFA 3EM1A 2DY9A 3BBBA 3B6BA 1NSPA 1NCLA 3ZTRA 3NGRA 1S57A 3ZTQA 3FBBA 4FKYA 1NHKL 1LWXA 3BH7B 4C6AA 3VGTA 2HVDA 2B8QA 1HLWA 4DUTA 1NSQA 3GP9A 3R9LA 3WX8A 1F6TA 1NUEA 3FBEA 3FCVA 1MN7A 1WKJA 3FKBA 3L7UA 3Q8UA 3NGTA 1MN9A 3FC9A 3GPAA 1HIYA 3NGUA 3EVMA 3VVUA 1PAEX 4S0MA 3ELHA 4FKXA 3ENAA 2AZ1A 3EVWA 3ZTOA 1HHQA 5IOLA 3EE3A 1BE4A 4ANEA 1NPKA 3G2XA 3ZTSA 1EHWA 3FCWA 1JXVA 1LEOA 1NB2A 4DZ6A 3EMTA 4WBFA 4KPCA 1PKUA 1F3FA 3DDIA 1NDPA 1U8WA 1NDCA 1UCNA 4DI6A 5BXIA 2BEFA 2BX6A 4ANDA 4UOHA 1S59A 1XQIA 2NCKL
chains in the Genus database with same CATH superfamily
1D8ZA 1Q4RA 1HBUA 4O3NA 4NYPA 4I6WA 1NJIT 4UF4A 1HNZJ 2KZZA 2KM8C 2CPYA 3V5RA 3O6QA 3CC7S 1U25A 3RRGA 1RQ0A 1RU2A 2QLWA 2VA2A 2H48B 3FNNA 2F9DA 3M6UA 2CWKA 4CT8A 4JI6J 4IO9Q 1XJWB 4O44A 4XAKA 2HNDA 5HL7Q 4DWIA 2FZCB 4USJC 3M8WA 5LM7E 2B9EA 4CDIA 4M5DA 5BYQA 1S4EA 3ZTRA 2FD2A 4PWWA 5D6GA 2HWTA 2EFNA 1T03B 1Q1KA 2XO6A 5D4LA 4ETZA 3D54A 2R2SA 3DU5A 2HNYB 4M1KA 1CJTB 1VQ8S 2MSSA 4LF4J 4F3OA 1NB7A 3OLAA 4NE9C 1FJGJ 3THPA 4HTJA 3TP2A 1YHQS 1DRZA 5DG8A 3MDFA 2RE1A 1LW2B 1HNXJ 1JLGA 4ZCLA 5HJXA 5IM0A 1SH0A 3KG1A 2BRLA 1S76D 2QL5B 3TVZA 1KFDA 1VHFA 2YNHA 4ZCKA 4USKA 4IOBA 3LO3A 3DXBA 2ALZA 1WHYA 3ET6B 2Y0SD 1KLMA 1MU2A 1N33F 2WHOA 3G86A 3VCDA 1XNQJ 3D1OA 3NGSA 4EI2A 1VK8A 4QIVA 5L39A 4NCGA 1WSVA 2MY8A 3Q22A 5K8MA 3MAAA 2V63A 1DBDA 2XWXA 3MPUB 4IH5A 4GVLA 2HBQB 4ES1A 1FDBA 3OW2R 3HMJG 1VQ7S 1FKPA 5GVQA 1UP1A 2E1AA 4IR1A 3D5MA 3AOCA 1QDUB 1EKSA 2KO1A 4B3OA 4M5JA 1RA6A 3HK2A 3V6HA 2KKHA 1OSDA 3KDNA 1VOMA 4DOZA 2PA3A 1MMLA 1YBTA 2OAUA 1RWUA 3J7YU 1VQ9S 2ZH8A 1K44A 2ZKTA 2YX7A 3DYAA 3NNHA 4QPTA 2F4FA 1EJ7L 2CG8A 2B3TB 1FA0A 3QGPA 3EGZA 4YN3B 1GAOA 5J1NA 4B3SJ 4QYZK 2GO8A 4FYVB 2DHSA 3R3TA 5HSPA 5LJ3Y 1TL5A 1WF2A 1RTJB 4D3HA 2GA7A 2Z2LA 3R5JB 3WDOA 2A10A 1DARA 4AE5A 1D9AA 1U6FA 2ZJRQ 1J2VA 3LP1B 3VGUA 4ELUA 1VRTA 3IGNA 3KJVA 4FKYA 1P27B 5HP1B 2ATLA 1OY9A 5J2MB 4OJGA 1DQAA 2MLYA 3NXZA 2Z30B 1G2EA 2F8EX 3AD8C 2VBWA 3O1LA 3M6WA 4O0IA 4C0OC 5B0GA 3ITHA 3PG9A 4PUOA 3W64A 4ECYA 3KUGA 2R3VA 1AUSL 3GSDA 3GYXB 3PHEA 4PR6A 2XSFA 1HMVB 3I9V9 3R6GB 5IWAJ 1HKAA 3I0RA 4ECRA 4WK1A 1QSLA 2VASA 2MQNA 1ROFA 1PJ6A 2NXJA 1HARA 4L74A 3MECB 2BRKA 2HFVA 1ZAWA 2EKNA 1SQGA 5JXSA 5JMNA 2DNPA 1H2UX 4DF4A 1QLNA 1T7PA 1IJEB 3JYTB 3OVAA 4EYIB 2CG4A 1KWMA 5LOQA 2AGOA 3KHLA 3TVYA 2Y1LB 4DUZF 3MEKA 4Q0BB 2V9WA 4N41A 1GMUA 2DHGA 3HD1A 4ZLNA 2OLWA 2RVJA 4FBUA 2BE7D 4B9NA 3KLFA 1X60A 2KT3A 1ITPA 4NZ6A 5KOWA 4DV6F 2KB2A 5F8LA 3OFEA 1T94A 3BSOA 3W65A 4ETXA 3OR2A 3KOAA 1OJ4A 4ZCIA 2CPIA 3D0GE 4BS2A 4B3RJ 3OD2A 1WORA 2XCPA 2CAJA 1C1BA 3Q24A 2R7WA 2VBYA 1S1VA 2AJQA 2QGFB 2M3DA 1LW0B 4LQ9A 4KH0B 4CI0B 4K5SA 2NZ4A 1LOUA 1QAIA 1U24A 4C8ZA 4L6V3 1SV5A 4ICLB 3LP2B 4DSKA 3VQSA 3UD5A 4M5KA 2IVYA 4B08A 2BJ8A 4HH1A 3M8PA 1T05A 3GIRA 3QO9A 5BYRA 1Q79A 1H73A 4HL9A 2QC3A 1I94F 1HD1A 3I5CA 2RIJA 2CA9A 2F4VF 4NWBA 3G71S 5B0DA 1P9QC 2XMUA 3QIPA 2CQIA 2XMTA 5DDOC 2HVIA 4OHVA 4QU6A 5ETSA 5AXMA 3B4DA 5KFMA 3DM2B 1SH2A 4J9LA 5FIIA 3MMBB 3BJYA 3IG1A 2NYIA 2UXBJ 4A8SA 2ASJA 2CZVC 2B7CB 3M8YA 3OSPA 1TV6A 4OHZA 1RTZA 1PIEA 4USWA 2YH0A 3H5YA 4X2BA 2EFGA 1U7LA 2W4CA 2XQCA 2BOPA 2DITA 2IJNA 4F0MA 3UR0A 1IWGA 2DEJA 2M0GB 2W9BB 2YKNB 3D0IE 2AKWB 2Q1LA 2W2PP 3EPIA 4M94A 3MURP 4JI2J 1WHWA 3M8RA 4QYZJ 4NCAA 2WVEA 1P1LA 3IFEA 2DO0A 3VAIA 4ZCMA 2E9ZA 3BO3A 2WK4A 4RW9B 1JLEA 4DR2J 3G87A 2HVEA 2MB0B 2J7UA 3SFUA 1DTTB 3FSXA 2ZZTA 4RNFA 2UVUA 1UKUA 3Q2SC 1F5CA 2UUWA 2JC1A 4OZ3A 2ROGA 4DFMA 2BE2A 4OQJA 4A48A 4LFAJ 3MR7A 1QE1A 3BZQA 3C3LA 2W9AA 3J80Y 2PIIA 5HMWA 2LECA 3US5A 3G82B 3WX8A 5K8PA 3FCVA 3TUJC 2ASLA 6FD1A 2FZGB 3HHKA 2CPDA 4TLRA 4R0JA 1HHQA 2CQ0A 2FJDB 3C6TB 2UU9J 2DR6A 2WAQD 1IR1A 2HHWA 2QG9B 5ETPA 4QBUA 4ANDA 4C4WA 4KFBB 3GMGA 4DR7F 2GMLA 4JI5F 4QWCA 4YY3J 2W01A 1TL4A 3OVSA 2VQEF 4JI4F 1YSJA 1RZMA 4RW8B 1YBAA 1F3VA 2G9OA 1O5JA 3TAQA 3HULA 4YR2A 2QTWA 2RHSB 1PAUB 1RAFB 2DEIA 1TU0B 3KLIA 2Z4PA 3GE9A 1TVRB 3IM9A 3JXOA 5KFWA 2RT3A 3M2VA 1IBMJ 2ZBPA 1LWFB 3BF4A 2DHHA 4LJMA 3HT3A 4B17A 4MJKA 1LKZA 2NPFA 1KQFB 1PG5B 4DPUA 1NPRA 3F44A 1O51A 3M2RB 3R2CJ 4RL1A 2GV1A 1L3TA 1RT6B 4KO0B 5HO4A 2JEJA 1SI9A 2ZBQA 4MKAA 4C11A 2E5JA 3PIPQ 3B82A 4WFXA 2XMJA 1V9OA 2M88A 1N34J 5GADI 4X4SA 4MIBA 1VJQA 3JSMB 2BX6A 1RT1B 2CQBA 1S0NA 4C98A 3BQ2A 1VIXA 1VR6A 2VQFF 4DR5J 5J2NB 3LAKA 3ILLA 2EEYA 2YNIA 3UPFA 5KT3A 5CYQA 1ZS6A 1FD2A 2HMIA 2J5AA 4ED3A 5KG7A 1CULB 2VG7A 4ED5A 4ZDNA 1JLAB 5T7LB 2LDYA 1MMDA 2J76E 1FFWB 3JTPA 3LOUA 4KHMA 4YB7A 5IC6B 1DZ5A 2ATCB 4JI8F 2Y8WA 4DMZA 1N54B 3S7RA 1APSA 2ROEA 4GVBA 4I4BA 5FLXY 3Q8RB 3FEZA 2V4RA 2UXDF 4CLSA 2D9PA 2HHHJ 1QUPA 2DISA 1YJTA 3H20A 1RT5B 4Q45A 3NS6A 5F8IA 3D68A 4WIIA 4DL3A 1OSCA 2RF2A 2L48A 3H90A 3ZZUA 1HNZF 2GMJA 1HNVB 3VQTA 4RNOA 2DCUB 4RPFA 3EE3A 2FUG9 3EMTA 4KIAA 4JI6F 2G2ZA 4MAKA 3KK1A 3T1HJ 2EWHA 4YB6A 4HT5A 4CM0A 3RU0A 3NAHA 4WK3A 2DH9A 1NAQA 3KLEA 4ZJOA 3NNAA 3H8YA 1HNIA 4LMZA 5HAOA 2J0QD 5L8RC 2MZ1A 1JLQA 4HACA 4ZIWA 3RAMA 1UVMA 3QQCD 3R2DJ 3OUYB 4LF4F 1Q86T 2B6AA 5MLCV 2Q43A 1NBEB 1FJGF 2YTCA 2DR8A 3SZ2A 2RQMA 4RWWA 1F2GA 1S9GB 1PJ5A 1HNXF 2OI2A 5EWFA 5KFOA 1PGZA 2IMOA 3BO2A 3FQKA 2IVFB 2OPPB 1FXRA 5HVHA 3CCMS 4IG0A 2KJWA 1LWEA 3Q8UA 1RWKB 1CEZA 2KYZA 4F3QA 4ZPCA 1KFSA 1Y10A 3MFIA 1RAHB 4I68A 1HR0F 5DQIA 3SQGA 4I2QA 4DLGA 5ETNA 4EZ6A 5FDLB 1WHVA 1XNQF 2DGQA 1LFPA 3G6YA 4OI4A 3HHDA 3WZ0A 1RE1B 2HRTA 1WTBA 2HHSA 4H4KA 3FBFA 4ES2A 4DQRA 4TY8A 2B9YA 5D3GA 1RTDA 1RWOB 4K2JA 2XEXA 3WC2A 1DLOB 2OO4A 3U02A 4Y2MA 1ZYQA 1XMOJ 2P9GA 3M2UB 4PXBA 3KXDA 2AEMA 3I82A 2AJ4A 4X4UA 3T1YJ 3MTJA 2DKOB 3PFEA 3TI0A 2CFXA 3OL7A 2YBVA 2MPUA 4UUWA 4FXDA 3U1NA 3TNVA 1NHKL 1TL1B 1T9XA 2PSZA 3T9NA 2FZKB 2ZNYA 1ZM9A 5RUBA 3WQPA 1SKSA 1CS4A 2YNGB 4DX5A 1T3OA 4B3SF 2FY8A 2A2CA 2BABA 1P8GA 2FVSA 3PNIA 5DDQC 1NPPA 4KAIA 2Q6BA 1QJHA 4F4WA 4DL7A 3KUEA 5IV4A 2DTJA 2OSQA 3BBCA 1U48A 1IQTA 4F2RA 3OHAA 2H4YB 4Y0FA 1SCJB 4OI0A 1UW9A 2UP1A 1YIJS 1RK8A 2MYFA 4L72B 1PC4A 2DXEA 3D3BJ 2VDIA 4YQWA 4PXEA 3W2VB 2B0GA 4F4AA 1RCOB 3THVA 3E51A 5IT9Y 4RZRA 3AA8A 1RP5A 3LTOA 2K7JA 2C2NA 2E1RA 5H1SV 3H4BA 1S6PA 1NSPA 2CYYA 1IR0A 2XLIA 2I2YA 1Q7LB 2O67A 3M8QA 1OPIA 3KMQA 2ZM6J 2MGZB 5CYMB 5IWAF 4F04B 2NXNA 2DCLA 2DNNA 4J9MA 1TKZB 2N7YA 3QLHB 3R6LB 1K0VA 2RILA 1SXLA 3K5MA 1YITS 3BREA 2V4JA 1WG4A 1FE4A 3BGLA 2UUTA 3CCRS 1HYSB 5E3PA 2QE5A 3F73A 1SKRA 1L3SA 4JI1J 4BBYA 4DS5A 4HTIA 2MZRA 2XG8A 2DXDA 2XSJA 1Y5IB 2KG0A 3W2WA 2W9CA 2KT5A 4W98A 1GTEA 1D8YA 4MK7A 4CO3A 1RHRB 1D9FA 1WI8A 1U1KA 5I42B 1FCAA 4DQQA 2C1EB 2GIRA 3C8YA 1MNEA 4O0NA 2CPEA 2XHWA 2D69A 4WF9Q 3UD3P 2VHGA 3OTEA 4NLSA 2R8HA 4B3RF 3ILJA 4HLBA 2OEKA 4ECXA 4F3MA 1SJ4P 4U7UK 3HJVA 1U1OA 1WSRA 5JJBA 4FYXB 3K5LA 4LF8J 3AQOA 2FGOA 4DV1J 4YOEA 3MOJB 1HQ2A 2IC3B 4KHPJ 4HHUA 2MZJA 3T1AA 2JJ4D 2BJ1A 4GMKA 1NDPA 3QFHA 3SSSA 4ZHRA 1K0TA 2NCKL 2GJ2A 3DGPB 1JWWA 4A8XA 4YDXA 5HLFA 5KFEA 3BM7A 1JLBA 1GXLA 3K7RA 1GK8A 3K5PA 3LPYA 5LSOA 1SQEA 1CG2A 2HQDA 4LBIA 3DMJB 1Y7PA 4W4MA 4FVMA 1N8RT 2NQPA 2JVRA 2HQFA 1CJVB 1B3TA 2UXBF 3KLGA 2VF3A 4GO7X 3ILOA 4I7FB 3C16A 4ITSA 3DRRA 1CJUA 2NYHA 2VBXA 1HW8A 4NA1A 2KJVA 3L4BC 4DFPA 3IAS9 3I0SB 3EZ5A 1AYEA 3ZZPA 5E0OA 2GVDA 4OJ1A 1G4CA 1RA7A 3ENAA 2LVWA 5F9LA 1VQOS 3PHTA 2Y1JA 3FCWA 3DRPA 1X5PA 4DR2F 3TA0A 2OPSB 1VQ4S 4K4TA 3DHWC 4C8YA 1YJRA 4P2SA 3Q23A 1V5IB 2PFFB 3IWXA 4LFAF 3CDBA 4DN0A 3TAMB 5LXRA 1HL6A 2D74B 3PO4A 1Y00A 3MCOA 4ED0A 1NHVA 3UVJA 1IKXB 5C42B 3CB4A 1U02A 4ILLA 4NMLA 5E3RA 1YJVA 4A8OA 4K2XA 2PFDA 4NMXA 3BR9A 4LRCA 5KAKA 2KRRA 4C6AA 3UDEA 3AQPA 1IWAA 3S1TA 1L5UA 1OS5A 4Z7YA 4X65J 1AFIA 2NUHA 5CXTA 3PRBA 4WYLA 4TYAA 2VJVA 4O4GA 1N0UA 2M8DB 3K5NA 4ZP8A 1NB2A 5KT5A 1LWCB 4Y2KA 2BW2A 2XLJA 3BB5A 1UWBB 2CQDA 1ZPWX 2HIYA 1QTMA 3CC4S 4AYBD 2KHCA 3EXCX 1A7GE 2BBEA 1IBMF 1FRXA 4A8QA 4ENOA 1NDKA 3PXGa 3G4SS 4KGMA 3VZHA 1HI8A 3PYFA 2AQ4A 2IRUA 4ELTA 1TQLA 2AYGA 4U8VA 1WEYA 4ZKAA 1NK6A 1VQKS 2XMWA 4LRFA 4NYZA 4R0EA 2XZTB 2DPIA 4LVNP 1LFWA 4K50A 1JJCB 5IT4A 1S10A 1N34F 2Y1RI 2HHQA 4CTAB 2KZMA 3E01B 1WELA 5LT5A 2RNEA 1NSQA 4NX9A 4MIWA 2OKQA 2C22A 2R7TA 4ELVA 2HHUA 1SJQA 3IRWP 4DR5F 2WVDA 3HKWA 4DCPB 1VBYA 1NNDA 3ZZRA 5IOLA 3GJRB 4ZPAA 1LW2A 1PYOB 5EDWA 2F7VA 4OJHA 1NK7A 1BXNA 1VQ6S 1D3WA 3FK4A 2FLOA 2MQ8A 4TNOA 3TQ1A 1UPMB 2W7PA 3SI8A 3D6FB 2VZ9A 5KFYA 2HLTA 5KFKA 5LSRA 5HROA 1R8PA 3CCVS 2PEHA 2AX1A 3EWGA 1IN0A 4A8KA 4DZDA 3ET6A 2HHHF 3SCIE 3VGVA 3O3LA 4U6PA 4RW7A 2MMYA 1JLCA 4WFAQ 2KXHA 3IGVA 3SYZA 1NH8A 5IV3A 2XMKA 1FWPA 2B9WA 2XB2D 4DV2F 2G13A 4OYWA 3RZAA 4DPWA 3WX4A 3T1HF 2B5JA 3M32B 5F8GA 2WVFA 1WUUA 4KKOB 3O2IA 2R7VA 1KP6A 5LL6d 1OYEA 4RR5A 2LCWA 3BDEA 4J9PA 1T9TA 3J7AN 1U26A 1U1QA 2AHOB 2CNNB 2W8LA 1VRUB 5K14B 2HIQA 1TL3B 2IBOA 4K7QA 1S6QB 1VLOA 1B0TA 3HX9A 1CVJA 2EC2A 3NGKA 4IOAQ 4UQGA 4LT6A 2IA6A 2JLEA 2KFNA 3IBFB 1RWPB 4MTPA 5C24A 3DOKA 5HN0A 2RD5C 1HBMB 4ZVHA 1UETA 3PKMA 2UXCJ 2DGWA 2CIMA 1WOOA 2JC0A 4O23A 2CJXB 2QV6A 3KK3B 3QRPA 4ER8A 5HI7A 3TUPA 2E5LJ 1FRLA 4ED8A 4W90B 2L9WA 3PW0A 3CULA 2BXJA 1NZ8A 3BR8A 3P96A 5HP1A 5J2MA 3D28A 5I4MA 2PI5A 2BQ3A 4DPOA 4S0MA 4LRAA 4GC7A 3C46A 3D6TB 1LEOA 3RRKA 1X5SA 5ETTA 2HYIB 3NLCA 2GVZA 2HAIA 1C4CA 1XMOF 3Q8QB 3T19A 3T1YF 2DNGA 2WBMA 2J6UA 4PWDB 2GQCA 2V2VA 2J8AA 3DI6B 1W2IA 1AZSB 4ES3A 1XR7A 4USTA 4OLOA 5JVGQ 3BV8A 1RWWB 2E5GA 3PJ9A 1MWZA 3M05A 5GAGI 4F26A 3D0HE 1F9FA 4CT9A 5I3UA 4FN5A 4ID8A 1Q81T 3E2EA 5KT7A 1R0CB 2AJFE 2DRDA 4DR6F 3NWRA 4Q0BA 2WB1D 2MQPA 3IAM9 3ADAC 5KFHA 1QM9A 1YX2A 4DQIA 1CQNA 5K8NA 3AOBA 3PX4A 1NKEA 3MPWA 3M30B 2C28A 1DJ0A 5BYSA 1YJ7A 2L08A 2ZH7A 4FYDA 3GJTB 3K58A 1TTHB 2NUUG 5HQMA 3MR2A 3HHEA 2QT7A 3AAWB 2HZAA 5C25B 1A6LA 2RDIA 4HVZA 5GAEU 2XY7A 5A2QY 1LW0A 3CXCR 1G3OA 1YGYA 1LK5A 4DV4J 2DYAA 2V8DA 1XR6A 2ZM6F 3RW6A 2JHEA 3LP2A 4L75A 3BPDA 1RT7B 2RB7A 2HHVA 2VG6B 4X4VA 3PRVA 5F8MA 4PG8A 2MZQA 1BQMB 3G6ES 2Y3YA 3TZZA 2MKYA 1UJ5A 1MMNA 2IIHA 3RR8A 2FJXA 1SC3B 1X9WA 2GC8A 1NK5A 5EX0A 1TKTB 1RT2B 2RDDA 4DXLA 4DF8A 4U7UD 1XEZA 4QW8A 3ZZ0A 1QAXA 5D15A 2XGQA 3BGRA 4CLUA 4DPYA 5F3TA 1Z2LA 1BWEA 4JI1F 2C2ZB 3QRQA 2HSEB 2MEWA 3MMBA 1S0VA 3RBEA 2LYVA 3GB0A 2GFFA 4M5HA 3D67A 5IT0A 4ILMA 1UEKA 1NPKA 1NHUA 3OJSA 2K8GA 4ED1A 1IVZA 3MPVA 2IM0A 4CLPA 3EICA 3UDVA 4IRKA 2YKNA 2EK6A 3DU6A 3W7BA 4LRBA 2M52A 3CJRA 3LQVA 1GMWD 3IRXB 5L9XA 3MXHP 2C3MA 2WW4A 3HPOA 2AEFA 4TLQA 2DVIA 1N0VC 3NCQA 4DUYJ 2C2EA 4RW9A 1SBRA 3FEXB 1H74A 3FGVA 4LR7A 2RRNA 1DTTA 4LF8F 2CZ4A 2E5IA 1O0PA 3B6BA 4B3TJ 3FFIA 4DV1F 2HQGA 1FVQA 2DGUA 3SSRA 4KHPF 2JEFA 3SV4A 2XYGB 1R27B 5I3PA 4B9UA 4ZIVA 4EBEA 1T95A 4GRSA 1FJCA 4FKXA 2V34A 1ZPVA 4M5IA 2ZH5A 1R8BA 4Q44A 1FD8A 3VZIA 5EWGA 1R6VA 3C6TA 2V0NA 1SC4B 4ZN3A 3CJ2A 2F65A 2H5JB 3KLVA 4NLXA 2HURA 4KFBA 3QJLA 2CQ2A 4WCEQ 2XMAA 3QT7A 4N8NA 4G1PA 3J7Z5 3HVTA 4KGVB 2ZE2A 3GIMA 2IDLA 3C14B 4RW4A 4IFVA 4RW8A 3KMSA 5KFDA 2KU7A 4MIAA 1N33J 4QZVB 1TVRA 3KFWX 3I55S 1IKYB 4RU2A 2EFVA 1LWFA 1FE0A 3KHRA 2QMUB 1IBLJ 4CZCA 1SJFA 3W60A 1JJ4A 2UV8G 4NLWA 2AYMA 4TU8A 2E9RX 3VF0B 3SDEB 3RBDA 3MM7B 1WF1A 3M2RA 2I9SA 2DGSA 4KO0A 2QJ3A 1HQEA 4R5PB 2VPXB 1LK7A 2R7RA 4PEOA 4WIQA 5KFRA 2EKYA 4KQZA 2YPYA 3LAMA 2JOQA 4URQU 1CBKA 4LFBF 2JLGA 3PYEA 3I4PA 2ZC4A 3MGJA 3L7PA 5ETMA 1VYAA 2K06A 5CAAA 1G1XA 2EFQA 2FJWA 3MTKA 2U2FA 2O1PA 3P5TL 3JSRA 1PC5A 2EI5A 4AD6A 4Z2XA 2R42A 4E98A 5KFUA 1J5OB 3H2VE 4TQSA 2BJ9A 2AGQA 1CPZA 1OIAA 2D1CA 1ACMB 1REVB 1AB8A 1RHKB 1TMJA 4QJVA 3CE8A 1XC9A 3Q2TC 4C0HA 2XM3A 3W62A 4IYQA 3L3CA 4UT4A 2DY9A 1JXEA 3F41A 1EIYB 3HVAA 1E6VA 2ZHBA 4KV8A 5THWA 4OLPA 2KL8A 1T9WA 2JDJA 1HBOB 2NLWA 3DLKB 4M63A 4MYUA 3V6DB 4LSNA 2YKMB 5DGAA 1RT5A 1S49A 3A3PB 4QQBA 4USIA 3GILA 1Q7YT 5A0YB 4OI1A 2U1AA 3MZIA 4LF2A 2CKWA 4OV1A 4DSJA 4KPCA 2BMBA 2GQ2A 3JSBA 1TK8A 1RBAA 2E1CA 2FY1A 5E7OB 5IFMA 2EFOA 1RAAB 1F9EB 4LFCF 5B7WA 2O3DA 4FBTA 2GMHA 3JTOA 4PABA 3CD0A 2MQQA 3TUIC 2CQHA 2QZ8A 2CPHA 4TVAB 4UQTA 1V3ZA 3A4TA 1GMVA 5DZ7A 4DX6A 3OVBA 3WIVA 3POTA 2YXLA 1W25A 2QYCA 1U09A 2KRBA 4DBQA 3IWLA 1HD0A 2C3OA 1N88A 4Z7CA 5SZTA 1H7WA 1FRHA 5ETLA 2LXFA 2QFJA 2DY1A 5M2RA 4V19J 3ONQA 2MTLA 3ZTSA 2VD3A 3I6PA 5A6WA 5KFBA 2BKOA 3KWMA 1N5QA 3GV5B 4WE1B 2OSRA 4KR0B 1JJ2R 3IP0A 5LSLA 4RW6B 4UOFA 2HGLA 2Y1IA 2BKPA 5FDLA 3GJQB 4P10A 1R89A 5KFVA 1V6HA 1RKIA 4O3PA 1HBUB 4NEYA 5A76A 4LQ3A 3N9UC 2FJBB 4ZN1A 4PQUB 1JIHA 3BS9A 4UOGA 4UY85 4NLVA 4O44B 3ENQA 2HNDB 2B9XA 2FLNA 1UVIA 4EZ9A 2E7XA 2AT1B 4OX7A 4O3SA 3MM9A 4WWSA 1LNQA 1MW7A 1NUEA 4M5DB 3PO5A 2XMVA 3OXFA 1ZA2B 1WKJA 1TL1A 3P6YC 2GGPA 5DGBA 2QA1A 2BQRA 4UUXA 1U1PA 3PYGA 1HPZB 5FJ4A 1FFGB 1WG1A 2EFPA 2YNGA 3QRRA 1WJ9A 3CJTA 2IBKA 2OPRA 3LGHA 1D0EA 2CJ9A 4IQMA 4DI6A 4Y3CA 4JP8A 3ZXWA 5G4DA 2C3YA 1MLAA 2MJUA 3DRSA 4DV7F 1YZ7A 1OPZA 3JAMU 2G2OA 3Q8YA 4JV2A 1Q5YA 3G6VA 5IM0B 3EVOA 3HFZB 2D3ZA 3M1VA 2E5LF 1KOOA 1TL7B 1XN9A 2ASYA 5F0UA 3M4XA 1EP4B 2Z2MA 2VH7A 2ZD1A 3GCXP 2KHDA 4CO4A 3W2VA 3OXGA 2I0XA 4OYXA 1MU2B 4X4RA 2QL7B 1J5EJ 1SJ1A 5D4OA 2HFOA 3VAHA 2HBYB 3DLHA 3EGVA 4ZJLA 2ERRA 5K9FA 1X9MA 4DV3F 4O3OA 5KG6A 5C5JA 3NGDA 2ZITA 2MGZA 5CYMA 1R43A 4NCGB 3H42A 1G7CB 3D3CJ 5T14A 5HVGA 2HS4A 2YPZA 1TKZA 2W4DA 5KFLA 2AZ1A 2OELA 2HWHA 1KHVA 5AXLA 2KYXA 2PO4A 4Y65A 1S1XB 4F8RA 1RWXB 1WACA 4DPXA 4WTYA 1R0BG 3FJ2A 4PG5A 2JVOA 2LKZA 4DS4A 4ECSA 3B54A 2BW7A 1HYSA 1FDNA 4DR7J 1ULRA 4JI5J 3MF5A 1Q0NA 3G8SA 2CQCA 3DYAB 4FNHA 4F4XA 4G1QB 4TQRA 2R7XA 3SIPB 3GFYA 2HQ3A 4L76A 4JI7J 3RB3A 1WI6A 3NCRA 5H9FK 1F60B 2P8IA 2VL1A 4ZPBA 3VAKA 4X4QA 2ACMA 3EDQB 2P6SA 2W2QP 3NKYA 1BMQB 2DH7A 4BC7A 2RKIA 4NLOA 2Q3PA 1EETB 1S57A 4DSEA 3VGTA 2DNHA 4IH6A 2D3UA 1F6TA 5G0RA 1EAYC 2HHXA 3HHLC 1HIYA 1M5VC 4WU3A 3ZZZA 1QVFR 4A8MP 1NJYA 1JKHA 2DGVA 3QT5A 2KXNB 2MLXA 2F8HA 5AT1B 4DV4F 4DJBA 1NXIA 4EO8A 3CSKA 3ITHB 2ZOGA 1RB0A 2IC3A 4PUOB 5KG5A 3ICLA 3MOZA 4C0BA 5D0GA 1S0OA 2LEAA 4I0WA 2O66A 2VKZG 4NLDA 3OL9A 3PYDA 2BE9B 1Q8IA 5A8KA 1QVGR 4RLEA 3KYLA 3I0RB 2C3PA 3LGNA 1U6BA 1Q78A 2LQ9A 3UR3C 2CQPA 5LMNJ 5DLGA 2UUAJ 2KM8B 4OZLA 4LR9A 2ZBCA 2LQ8A 3CCTA 2XY6A 1P6TA 3WIUA 3O8WA 4DU8A 1S9FA 3R7NB 3ZNJ1 4I7FA 1FXLA 4M5GA 2RHQB 3TO8A 3CIZA 3GP9A 5AXKA 4QWBA 1JXLA 2J6SA 1JQGA 4N56A 2ZDPA 3UI3A 1RUSA 2KI2A 4FP9A 3FEYB 2VJUA 1GNKA 4OI3A 3I56S 1R6YA 3CJKA 2HQIA 3KLFB 1GX6A 5HQLA 4DR1J 3FRZA 2J9CA 4C3MA 4DUYF 5ETKA 4RKUC 1ZZFA 2IM3A 3HP6A 4JV5J 2OPQB 2GHVC 3MEEA 2QLXA 4DLEA 4B3TF 2VV5A 4FF2A 2HGNA 3M6VA 2OFHX 2M5YA 1WDDA 4PG4A 4DR4J 2YVSA 5CABA 3FMBA 4LF6F 2L9NA 1XNRJ 3RB0A 3MEDA 1UVJA 2ACYA 4K4UA 5I3QA 5DDRC 2V2ZA 1B99A 5C42A 4RBTA 4PZVA 2G1DA 3M8PB 1T05B 4CH1A 1KVIA 3MCSA 4ZVGA 2ZFHA 1LWXA 2C42A 4XIUA 1EQMA 3OXLA 3GYGA 5E3CA 5HVFA 3OL8A 2R8IA 3UCZP 3NCPA 3BYRA 1AT1B 3GPAA 4NYOA 4WP9A 3B4MA 3QZ8A 1Z1ZA 3QIPB 5HBMA 1DY3A 3TJ9A 4OI2A 4JI3F 1TZ0A 6FDRA 2BA9A 4F0HA 3IG1B 1JNRB 2MHEA 3BGUA 4BLGA 5HQ8A 1TV6B 3TRGA 1FKOB 2HFNA 1HR0J 1L3KA 1KR4A 1SUQB 3TOQA 3WC0A 3DXSX 2R7OA 2OEJA 1S1WA 2UUBJ 1RYRA 3HJFA 1S0MA 1IBLF 2GS8A 1Q82T 3Q8SB 2C2OB 1DAXA 3IBWA 5AJ3F 3PRDA 3PV8A 5H9FJ 3ZZOA 3WBZA 2WBRA 3ETOA 4HEA9 1JLEB 3RGIA 4O4RA 1NCLA 4ECUA 4M5MA 4DL0C 2QL9B 2WSCC 3DFEA 1GQEA 2ZBIA 2Y9HA 4J9KA 2V2KA 4GKKJ 2QSFA 2VFRA 4QWEA 3HHLA 1X31C 1KSPA 3AH6A 3CF5Q 1QE1B 3FDSA 2KFYA 2LMIA 1KVJA 4DZ6A 3GONA 2FYXA 1FJEB 4H4MA 2RAQA 4V1Ak 1H2TZ 1H98A 3GG0A 1NSAA 4FF4A 2FGCA 1NRKA 3LPEA 2MLZA 4KBIA 3QSIA 3P5BP 3IM8A 2VG5B 4DDFA 1NO8A 4AXIA 3V6JA 2CJKA 1T3NA 1R0AA 2DGOA 4LIRA 1C1CA 2RSQA 2HLUA 1VISA 3IBCB 2K1RB 2VBZA 4G6VB 2HZCA 2IM2A 1DTQB 5L38A 2LQBA 1UVNA 3AOAA 3C15A 3GU0A 4DU7A 3ZNUA 4KJIA 1FJ7A 1PYSB 3IXQA 3FBBA 2WZ1A 1FFSB 5KFSA 3M2VB 3W9JA 2F40A 1R8AA 3KNAA 4CLYA 4KKOA 1QD1A 3QWUA 1OY6A 2CQ1A 1T9YA 2FIUA 2LLZA 2QN6B 1I51B 2V4QA 4GC6A 2VDHA 1M5SA 4Z37A 1XMQJ 1VRUA 3UCGA 2HQCA 1F0XA 1TL3A 4C11B 3GIJA 1NK0A 4ZVSB 2AYEA 3AT1B 1U47A 4LUBA 2I5JA 1AFJA 1Q8KA 1R7IA 4X4OA 1BUXA 2UV8A 4KHRA 3Q89A 1UFKA 4RUHA 2V8HA 2NREA 1FXDA 2CVIA 2V68A 1NK9A 1HBMA 3OTDA 3HKZD 3P4UB 3MUMP 4NLYA 2LDIA 1KC8T 1RWVB 2YNIB 1U2FA 5E5NA 5CYQB 3CDWA 1MROB 2C2DA 2HMIB 1S77D 1IKVA 1KD1T 2VG7B 3T5KA 2J7WA 2EK1A 4PAAA 1EB0A 1TFWA 3CJ4A 4J9RA 4RUAA 2A2DA 1HFEL 1FNXH 1RTHB 2W7AA 2CQ3A 4OZ0A 2GNKA 3NL0A 4PPZA 4ECVA 4WZQA 4CO5A 4OIXA 3AODA 3UO0A 2CWXA 2RF2B 3EGWB 5LXYA 3LF0A 3C66A 3AJ2A 2IFXA 5KG3A 1QAYA 1ZM3A 2DNKA 2GQQA 5ETRA 3V4IB 3KK1B 2FLLA 3BO4A 4DX7A 4R8UA 2QLFB 4PWDA 2MKKA 4MFBA 3KLEB 5CA5A 1A0OB 3DI6A 3VV2B 4WU2A 2H54B 3NY0A 1WF0A 3MMJA 4M5LA 4X64J 1JLQB 4LF9F 4PQAA 2NSCA 2YKPA 4KGKA 1OO0B 1U0HB 2HNZA 5E3QA 1PILA 7FDRA 2FHJA 2JFDA 3H98A 3V81B 3NP5A 1BQXA 3B8HA 1S79A 4FYYB 4AQYJ 3VAMA 4L3NA 4YR3A 1DHMA 3NGUA 3PEHA 3ZC4A 4I1TA 1VLYA 2B4VA 1FX4A 3IC1A 4DV5J 2Z58B 1H0HB 4IG0B 1IKWA 1PKUA 4A46A 4C9DA 4F4ZA 4X84A 3QBCA 4IFYA 4CIOA 2QEXS 5J1PA 2X1AA 4BC9A 5KFZA 2EG2A 1WKLA 3GR1A 1UW4A 2MXYA 4F67A 4ZVOB 3QAEA 3VVTA 3DOLA 4ECZA 4MT1A 1X4EA 4MKVA 1J5EF 3J80U 4I2QB 2IJFA 2F3JA 1BY9A 3R5DA 4PCQA 4CLZA 1IR2A 4KPYA 2R8GA 1C0UA 2FC8A 3VAJA 3MR3A 2X1GA 3J7YI 2VG6A 3VWSA 3HF5A 2HK2A 5D3GB 4IDKA 2FVCA 1U0SA 1VQMS 1M5OC 4DG1B 3M8ZA 5KFIA 4USHA 1NKBA 2PT0A 1BWVA 4KRWA 2XYHB 3H5SA 1WNEA 1RT2A 1RTIA 4MKYA 4HYKA 5B0FA 3CJSA 1BGXT 1UA0A 2BANA 1NH7A 3VHQA 2WSEC 1MWYA 5EN1A 2L41A 4FVCA 1CC8A 4FXVA 2RRAA 4OYPA 3DDIA 3MWBA 4JI7F 4H4KC 2C2KB 2CDQA 3KJNB 1FF2A 4XDCA 4IOCQ 3MMAB 3BEGB 1U8SA 3UN3A 2OD4A 2D3O1 1YK9A 3JB9k 3RTVA 4WKRA 1M1HA 5J2PB 2XO7A 2FDNA 4B9VA 1M1KT 1WC6A 1PCAA 3PR4A 2ZJQQ 2CXEA 4WKYA 2EC0A 3R5CA 4I56A 4CQ1A 2GCFA 3H4DA 4WP3A 3EM1A 5ETVA 3P3DA 4I69A 1JLFB 4OYAA 4ECTA 1S6PB 2IHR1 2ZH4A 4CLKA 1NJWA 2H65B 1KQKA 3FBEA 4IRDA 1VI7A 1FWKA 5FD1A 4H4OB 4C8MA 4F7VA 3M8QB 4OZ5A 3FRYA 1NM2A 2KDOA 4XPCA 2G0IA 2V8GA 5DETA 5LMNF 4P2FA 4QIWD 4TYBA 2UUAF 3TZYA 3CMQA 3KNGA 3IR6B 2ZNZA 3H40A 4ILRA 1FWLA 4TN2A 4P2MA 5FLXU 2MY7A 2IPOB 4CLFA 2GAGC 2H51B 2XS7A 2J9DA 4CNYA 2EVZA 1G6BA 5E41A 2K3IA 1M5HA 4CRJA 4Q8FA 3A8IA 5L9NA 4Y34A 3RR7A 1YRXA 3UN2A 3RAXA 1NK4A 1RAOA 3W2WB 2W9CB 3RRHA 2IRYA 2LA4A 5B0AA 4ED6A 3MEGA 3HSGA 2ZUGA 3TEGA 2HK3A 5EGYA 2J9EA 3UFCX 2F8MA 4DR1F 3CGIA 4A8FA 4DV2J 5KFPA 2OGUA 1IBKJ 2DR7A 1FI4A 4JV5F 3SDEA 4F4YA 3MM7A 2RJZA 1T9VA 4U9RA 3JAMY 4RWXA 3NOCA 3D1QA 4R5PA 1X4BA 3HZGA 4Y2CA 1RT4A 1RBLA 3GQCA 3CJ3A 3NWGA 5F8HA 4DR4F 2GX8A 2A6MA 1X4FA 1XNRF 1SQFA 3OTOF 1VMBA 8AT1B 1VIOA 3A12A 3K5OA 3F56A 4DPTA 2LQ5A 2AGPA 2JSXA 5A6PA 3NG8A 3M9NB 3GIKA 2R7UA 3QYYA 1WKKA 3TEHB 3DHXA 3TA2A 3RG6A 5HLFB 1JLBB 4ZVEA 3TA1A 3HZEA 1S9EA 2DK2A 2M9KA 3MUTP 2OJ3A 1T0TV 1N32J 2XMMA 2QMXA 4ED2A 2O01C 4NI2A 4WFNQ 3HT0A 1X5OA 1S7IA 2YWEA 1Z4UA 4NRUA 1X7VA 2KVQE 2N4DA 3C19A 3C16B 4FF1A 1HBOA 3DRRB 1CJUB 3C6UB 2GHWA 2YKAA 1S99A 3V6DA 3FVYA 2UUBF 2AJ1A 2YKMA 2X7IA 1ZH5A 3RAQA 3ZFVA 1WG5A 3KK2B 4ERDA 3J7A1 4NLQA 2GVDB 2KT2A 2ZOFA 1N48A 3CT9A 4K4SA 2ROPA 3DRPB 3Q86A 4J9SA 2CPJA 4G3IA 3LUYA 5KT2A 4KSEB 1P1TA 3QFWA 2AEJA 2W24A 4DFJA 1CQMA 3J81Y 3R5AA 1V5VA 4WTOB 3QT8A 1VRQC 3KG4A 2J0WA 3VR1A 4GKKF 4QU7A 2PA8D 3CPWR 1HWUA 1SKWA 4IG3A 3F0NA 2O5DA 3PW5A 2P2CB 2XHCA 3OPKA 3UVJB 3A8KA 1KTQA 4DR6J 3KDOA 3HD2A 3JSYA 5D0EA 1REGX 5U47A 2X51A 2ASDA 4FXWA 3PM9A 3LWMA 2PEBA 5B0BA 5KG4A 5DG9A 1ZETA 1TAUA 1UEVA 3FCHA 3TQEA 2BEFA 3R7BB 5HK4A 1FTCA 4X4TA 1YJUA 3PX0A 1EQ0A 4CH0S 4FDFA 3DLEA 4WE1A 1YG0A 3RBXA 1GH8A 3T6JA 3W1YC 1NK8A 1FNMA 4KH1B 1JX4A 1XWLA 1ZZNA 2J0XA 1X5TA 2LU1A 1JK9B 3AXKA 3MCMA 4PQUA 2DNQA 3CNQP 4UTGA 3X1LB 3BBFA 1JNZB 5D77A 3OQ2A 3AY0A 1WEZA 1XMQF 2YY3A 3NBPB 3MM5A 4N76A 2DR9A 4YB5A 2DBBA 4Y2AA 1DURA 3ENVA 4KE5A 3OSNA 4MMOA 2LP4A 4AFFA 3SXLA 2AMCB 1VCTA 1RHMB 5LJ5Y 2AIRB 1HPZA 4LF1A 1VQSA 4Q8EA 1RHQB 2VFTA 3BGOP 1F3FA 5J1EB 1VGYA 5CYJA 5L1KA 1IUJA 2XNRA 2HWIA 1KQGB 2QLBB 3CJ8A 2J8SA 1CJKA 4ZVQB 4CM2A 3BH6B 4U96A 4UOCA 3VAFA 4CYUB 3GFZA 4M8LA 2BOAA 1HBNB 2XZDB 3MPDA 4IUFA 2D41A 3MFHA 5CZXA 3P49B 2BJDA 2HPUA 3MM8A 2HZVA 3H5XA 2M4MA 3ZTPA 5EX3A 1TL7A 5HROB 4BCAA 1EP4A 2PE8A 3BSNA 4NLGA 3JS9A 3UD4P 4A47A 1XTZA 2BJ7A 4B9LA 4RW7B 4Y00A 5KFTA 3PTWA 2R7QA 1JLCB 2V8PA 1WC4A 3N6NA 4F25A 3K8WA 3H5UA 2PD1A 3GG1A 2CJYB 4HI1A 4FYWB 3VVUA 1N5YB 4MYTA 2ZHOA 3PCOB 2B5JB 3D7SB 2HRYA 3CDAA 5B09A 2P9CA 3A1YG 3G2XA 2EPIA 4ZP7A 4OV6A 2H3EB 4OX9F 1S59A 1S1XA 4CH7A 1B4SA 3HDSA 1RSCA 5KT4A 4CP5A 4X64F 1O8BA 3J7ZT 1MSWD 5J2QB 1PSDA 2AW0A 1QSYA 2J0SD 1PBUA 2V50A 5DQHA 3S8SA 1YZ6A 5F41A 3H2LA 5HMZA 3MM6B 2HVZA 4LSZB 2RUSA 4G1QA 4X66J 5KFGA 3IA0A 3TX0A 4AQYF 1W7WA 2VOPA 2MQMA 2Y0BB 5C24B 3DOKB 3MR5A 2MKJA 4LSLA 2X3GA 3R1LA 1E6YA 2IY5B 3LW5C 3GFHA 3ZTQA 4DV5F 1RLDA 4C97A 1W2BR 5GAHI 4P7TA 4NLUA 1EETA 1IXKA 2NR0A 3IS9B 1T8EA 4Y6IA 1MN7A 2CQ4A 3AB4B 1F5BA 1RAEB 3OT9A 8ATCB 3HSJA 4P9SA 3HFVA 2MKCA 1EHWA 5L46A 1T11A 4B9TA 3I31A 3MMCB 2V69A 1S7HA 1U1RA 4ZK7M 1RHUB 2I6WA 3IWNC 2RQKA 3K2YA 3DLBA 4LFBJ 1V3SA 2HAFA 1KQSR 4A4JA 4JI0J 2XTJP 2WRMA 1HWLA 3QGIA 3DGVA 4LVOP 5H9EK 2WW8A 4J9NA 1K8AT 2GVZB 4EMDA 2YNFB 3S01A 2M70A 3RW7A 3D6MB 3FMWA 5B0CA 3PACA 4QR0A 2OHDA 1M5PC 1RT3A 1K1SA 3CO0P 5IQ6A 2ZHAA 2IAJB 1LXNA 5GADU 3QT6A 2ABYA 1F9HA 1VQNS 3NGRA 5DM6Q 5ADZA 4YS2A 3MUVP 4A8WA 5I3UB 4ZLLA 3BPSP 3NMAA 2UVRA 3SBMA 1SC1B 4I2PA 1C4AA 1PAEX 1N6QB 1TKXB 2DT9A 2EBGA 3DLGB 4ANEA 2E7VA 3BN4A 2PMHA 4EUVA 5L1IA 1I6JA 4MK8A 2XS2A 1H2VZ 4YHHJ 3W61A 3CD6S 3I5BA 1FKAF 3QZ7A 1EKRA 4NOHA 2JZ5A 4RX6A 1UZDA 4YR0A 1V3RA 2JLFA 1JJHA 2OPQA 1FEHA 4LFCJ 4FNIA 4KC5A 3TJAA 3CJ0A 1LXJA 2COLA 3KKFA 1H3DA 4RUCA 4ATNA 5CCLA 1FTRA 2K3KA 1RBOB 3DN9A 4B3MF 4J9QA 2RS2A 1T03A 1WC3A 3JQKA 3GLJA 2HNYA 1D1UA 1CJTA 1FK9B 3U1LA 2CJAA 5GMKa 2APOA 3BQ0A 3Q8PB 2XS5A 4JUZA 2Z0GA 2H1YA 2XCAA 2FTRA 2NZCA 1HWIA 3AJDA 2G1HA 5BR8J 5EUHA 2Q6CA 4PRFA 1FRJA 3A13A 5GMEA 4ZJQA 1TELA 4F4KA 1TK0A 5JVHQ 1HI1A 1X4CA 2RUGA 3Q0AA 2X1BA 3R7SB 1GXTA 3BGRB 2DD8S 3K8VA 3LA0A 2DO4A 1YKWA 4GO5X 2MQLA 4P2XA 3SEOA 3FSIA 1X8DA 3HI9A 4X4PA 3SFGA 5HANA 4ZP6A 7AT1B 1FKOA 1KDNA 1YJNS 5DS7A 2ILZA 1SUQA 3UNYA 3D9BA 5E3AA 1WHXA 3GV8B 4DV0J 1S1UB 2MJNA 4HHHA 2YWKA 4JYAJ 1FERA 1WD6A 2CZ9A 5A8RB 3CCUS 4UY8T 2DNRA 4XTTA 1IBKF 3U7JA 4EGLA 4ZLPA 2XY5A 4B02A 3LANA 3PW2A 2FC9A 1X9SA 1RJJA 1ZTTA 5M2PA 3GZ7A 3M8SA 1I5OB 2WONB 2HFZA 1J27A 2A1BA 2ZOMA 2W8KA 4CO1A 3LWLA 2J6TA 4DUTA 1N5VA 4TXSA 3D6HB 5EWEA 2RQCA 2JFKA 3FFIB 3NGTA 1N5SA 3EVMA 3C2PA 2CDRB 3GIIA 5AE1A 2ZZNA 1BE4A 2W1BA 2C2RA 3GFXA 1OMSA 3DOMB 4OYZA 3UN5A 3CD7A 4UOHA 2BV3A 1S72S 1RTJA 2VU5A 5B08A 2ZH1A 1ZOTA 1N32F 3FBCA 5H9EJ 1ZM2A 4DV7J 4Q5VA 4R25A 4EFAC 5DM7Q 4K4XA 2VG5A 1D9DA 3OR1B 3LP1A 1S48A 4ZOSA 3U27A 4CLWA 2LFVA 2V6AA 2K1RA 3BKFA 1DTQA 3HVTB 3JQJA 2ZE2B 1S5ZA 4RW4B 4ZVPB 4IFVB 4NZ0A 3W8PA 6AT1B 2H5EA 1O6XA 3CCSS 1Q8LA 5A8WB 1ZAVA 3GWCA 5F3ZA 1YI2S 3H25A 4YDDB 2ALYB 2KVIA 4DV3J 1HMVA 1ZM4A 3A3OB 1MG7A 5IS2A 1L3UA 4EBCA 1KEKA 1HWJA 4WJBA 3V2UC 2ADCA 2VC1A 4OL8A 3MECA 3TAPA 1RYSA 3CO9A 2PGCA 1HQEB 2PMZD 5KG2A 4A8YA 1Q8BA 4ZVFA 3CJ5A 3FUYA 4DR3F 1S97A 3JYTA 1NDLA 3QWPA 5F8JA 4QIGA 3AB2B 2CADA 4YMEA 3PEJA 1TKDA 2N7CA 3KLHB 1ZA1B 2R2TA 4X4NA 2WOMB 3HVRA 2QA2A 2OTJS 1UPPA 4NXNJ 2UUCJ 3W3SA 4USUA 2F9JA 1KN6A 1MROA 4JBCA 4OZNA 2DXFA 2R8JA 1TAQA 3KJQB 3BBBA 2XYPB 2AWZA 3T3FA 4HT7A 1VHIA 4WFYA 1RU1A 4ZPWR 2PDAA 5A2QU 2B43A 5KFJA 1B64A 1RTHA 1E6VB 4ZVUB 1SC6A 1U4BA 2MSTA 4RBVA 4KV8B 4CO2A 2Z57B 1NMEB 3IO1A 1JXVA 2IA0A 4XDDA 4LSNB 1DQ8A 4DQSA 2JEGA 4Q43A 4ICLA 1N56A 3M9OB 1WC1A 3QPIA 3BKUA 1IQZA 2BACA 1VBXA 5K20B 2IM1A 3V4IA 2PN6A 2VPYB 1WWHA 5KFCA 4EWTA 4BDPA 2VFVA 3BSAA 4OHYA 3S6EA 4JB8B 1M0SA 1BHNA 2ZUAA 5JUMA 3PY8A 2Z8QA 1Y0HA 2OTLS 4P75A 1F1BB 3DM2A 3L9ZA 2JX2A 1VQYA 1U0HA 3HHNB 3GYNA 2L9DA 2C3UA 3MAHA 2QSWA 3POTB 3V81A 1Q5VA 2FJVA 1S1TB 3G96A 1YJ9S 4NA3A 4U8YA 2W9BA 2P9EA 2W2MP 4XO0A 2P6TA 2GJIA 1XR5A 3N79A 2W2OP 2I1RA 4U7CA 2VIHA 2BDPA 2VPWB 1X4DA 2LA6A 1QUVA 4IO1A 2EBEA 2B51A 4OZ1A 4AL5A 3FZ2A 4OYIA 1FVSA 1CSJA 3KTQA 4I64A 4ANCA 3B78A 2G0JA 4NZ7A 3UCUP 4DSFA 4CLLA 5CH7B 4AL6A 3CCWA 2XNQA 4ID5B 2R8KA 2HRUA 4IQXA 3G8QA 4PXDA 4C2MA 2QA4S 1OQ6A 4AL7A 2HVHA 4LF6J 5GAHU 4F50A 4LBHA 4QOTA 2A3JA 3G82A 4NRTA 3ULHA 1UVKA 2ZEJA 4M95A 3A8JA 4DG1A 2N3LA 5E2QA 1RAJA 3OJUA 5D0RA 1SJRA 1KLNA 4MK9A 3OBIA 1IJFB 2FB0A 1WOSA 1WC0A 1M1GA 1F5AA 2ADBA 2F63A 1BQNB 3AJ1A 4EBDA 2IVMA 3VALA 4FF3A 3HCXA 1X4AA 3MM9B 2B4PA 3QAUA 1HI0P 2AU0A 2E44A 3TYTA 2GO9A 2GGPB 4JI3J 3CCLS 3CMES 4X66F 5F0WA 2IYIA 2ZH3A 2E66A 2JL9A 4G1IA 2CUYA 3UDCA 4CCHA 1HHTP 1U1NA 3W5ZA 1IM6A 2OPRB 2G2YA 1C0TB 3MMAA 1SJ3P 3NEKA 3OTBA 3I87A 2EXUA 1FHTA 3DRSB 3I32A 5J2PA 4QPXA 3CCJS 4G65A 3EPGA 1SKUB 2Y8YA 5AJ3J 4DFKA 4PYDA 3FQLA 3M1VB 3FZBA 4LREA 1RT6A 3L09A 3GTYX 3MCNA 2ZD1B 2VUGA 2KFZA 1JLFA 3LP0B 2XI2A 2D3OR 4UZCA 1I3OB 1TR0A 5DQGA 1ELOA 5DG7A 3FC9A 2NXEA 4JI0F 3JSMA 1RT1A 4H4OA 1HQUB 1VJWA 1VS3A 2ZH6A 5J2NA 1U49A 2V8VA 1FRMA 2HS3A 1N36J 2HBRB 2JWNA 3QNWB 3DRYA 1CULA 1DQ9A 3O44A 2G0CA 1R8CA 1JLAA 5T7LA 3RYLA 2CJQA 4URGA 3CEDA 4NASA 5KOXA 5E33A 3CCQS 4KT0C 4KGXB 4I67A 1QSSA 2YH1A 3MD3A 1FDDA 1P9YA 3LH2S 3R5BA 4O3RA 4QIFA 1VDHA 2VICA 4ZA1A 3D4JA 2BZ2A 2W4PA 4PG6A 5GAEI 2A6OA 4ED7A 1KS2A 3T5JA 1HNVA 4ECQA 1AA1B 4YHHF 2AYBA 2GZOA 2E29A 2N4CA 2RKIB 3SMZA 2YX4A 3TZWA 1AROP 5KFFA 1B0PA 3QJJA 2W7OA 2NPIA 1B7YB 3ISND 3D1HA 3NOGA 3RUBL 5G0RB 5KFAA 2FVRA 2GIQA 4OZJA 2R7SA 2I38A 1JKHB 1GXUA 1K47A 3VGSA 4LF5J 3OUYA 1YJWS 2M2BA 2WCXA 2BM1A 2V9KA 4K59A 4ZMMA 5L1JA 4DEZA 3LALA 1S9GA 5A8KB 3OFGA 4E0DA 5BR8F 4EU0A 2VA3A 3NRBA 4EK2A 3NNCA 2OUGA 5M2UA 2OPPA 3UDLA 4RNHA 3K89A 4WYWA 4DCOB 1KBRA 4NEZA 4QR2A 3OHBA 2FHKA 3SCJE 3PVXA 2HVDA 1TP7A 3W9IA 2BM0A 3QGGA 2GJFA 4ZPVR 4LF7J 2HHTA 2CNLB 2BJEA 3TJ8A 1B70B 2N82B 3VTIA 3R8YA 3ISNC 3C6UA 4TU7A 1PJ7A 3EXYA 2FLPA 4DV0F 2XBPA 4X62J 4JYAF 4P52A 3KHGA 2DGTA 4JI2F 5DDPC 3KK2A 1Q95G 1URNA 2HFSA 2DRBA 3CJKB 1QY7A 3OFHA 1DLOA 2XLKA 3M2UA 2YQ3A 2E9TA 1VK3A 5CD4H 2QMWA 3M9MB 3MEEB 3BYPA 4KY3A 3W66A 1RISA 3P45B 4LR8A 1NU4A 3A8EA 3EGNA 5D8HB 5DJBA 3GSIA 2ZH9A 4LF9J 4PG7A 3MEDB 1TUWA 4EEYA 2ZZMA 4RBUA 3UQSA 1OY8A 2ZWPA 3W8GA 2NXUA 3R97A 4XPEA 3T5HA 2A0FB 3RBZA 2UU9F 2ZWOA 3ELHA 3QMQA 1JLGB 3MHYA 3KHHA 4L73A 2B7BB 2OMLA 2AF6A 3L7OA 1UFLA 5GAGU 3BGFA 1U8WA 5MAOA 3CCZA 4IH7A 2FHOB 4PYAA 5HBMB 4YY3F 4K4YA 2YNHB 2UZAA 3H7HB 5CCMA 2RS8A 2IYGA 1RDRA 4DL5A 1S6UA 2OH2A 1GEHA 1KLMB 4WP8A 2ZDOA 5D78A 1S1WB 4E2FB 1IM4A 5K8OA 3TW0A 3I9ZA 3R27A 3CC2S 3MAAB 1U1LA 4GKJJ 3HHLD 3SV3A 1OQ3A 1URRA 3KG0A 3N6MA 3PKYA 3DRXA 3QLHA 5KG0A 3R9LA 3NBPA 1FKPB 1KVKA 1HA1A 3EDRB 2HGMA 1UMJA 3W9HA 4B3OB 3UW1A 1YWXA 2YKQA 5D0HA 5IXUA 3K0JA 1HNWJ 1GX5A 2C2MB 3HHLB 3M7VA 5T41A 5D4NA 4USMA 1UCNA 4DL6A 1FRIA 4U95A 3K57A 1U6ZA 1WTFA 2K2PA 5J1EA 2DRAA 4NXNF 3IR7B 2UUCF 4F2SA 3FSYA 4OX8A 4Y28C 2MKIA 3W5YA 2Q66A 4H4MB 5I42A 1ZTWA 2Z2ZA 1RKJA 2MZSA 1VQ5S 4N47A 3H0PA 2CPFA 3CDUA 1FX2A 4CYUA 3OV7A 2JRSA 1YBUA 1HBNA 1H72C 2RDJA 3Q83A 1H38A 3RB4A 1Q53A 4NXMJ 1RGVA 1SL0A 3MR6A 2RMLA 4J9OA 1R0AB 3BKTA 2GW8A 1C1CB 1VRTB 2FQQB 4J37A 1DFDA 3KJVB 4P72A 1X4GA 5K5MA 3GJSB 4HDHA 4HI2A 4ZVTB 1Z2ZA 2DJWA 1HLWA 3C15B 1RACB 4DN9A 2X1FA 2IDEA 3H59A 5B0EA 1Q16B 2SXLA 1ZAXA 3QJPA 3MD1A 3PFOA 1WEXA 3DGPA 2CPZA 1N5YA 3GCWP 3A3NB 3L95X 2P5VA 4OJ3A 1Y11A 4I6YA 1KHWA 3V6KA 3T5LA 2BUNA 3DMJA 4B9SA 4JV0A 2VPZB 4FPIA 4NLTA 3U1MA 5J2QA 2VFUA 1CJVA 3UNGC 1GTHA 4B9MA 4NLPA 2I5JB 3K59A 2PC6A 4HHJA 3HXMA 1D09B 3MM6A 4K4WA 4NA2A 1RWNB 3ZO7A 4F36A 3OLBA 4RO0A 5AE3A 3CUNA 1UA1A 1W26A 5CHCB 5LMUJ 3I0SA 5F9NA 2WTFA 2R2UA 1VC0A 1A9NB 1N4LA 3AD9C 1T9UA 3G6XA 1Y3KA 2D7SA 1IKVB 3CIMA 2DNYA 4UZBA 2OEMA 1WOPA 3IS9A 2RU9A 3KUHA 3N01A 4TU9A 3N28A 3TARA 2OPSA 3OR2B 4TKTA 2QX0A 4DL2A 1C1BB 2IMWP 5KTQA 2LEBA 2H4WB 1S1VB 3M6XA 5C2GA 3MMCA 1XQIA 3I96A 4OHXA 3J81j 5IC4B 4K0KJ 5KFXA 2MKSA 3OTOJ 5D4PA 4WFZA 3TAMA 1SV5B 4OHWA 3SCLE 2PI4A 5KG1A 1IKXA 2E1PA 3DLJA 1RLCL 1UJ6A 4N77A 3QO9B 4MH8A 2YNFA 3OFFA 2OFGX 1XERA 1K9MT 2QLJB 2FHJD 1C2PA 4DHVA 5ETQA 4DCJB 1S4FA 7FD1A 1QAJA 2MKHA 4R8UB 5DLFA 4MFBB 3K17A 2GHPA 2IAJA 2HG4A 4Q7AA 4NPOA 2LU2A 2YWGA 3I5AA 4K4VA 1CC7A 3NAIA 1FO1A 4I6AA 3MI7X 5C2CA 2KG1A 2BYCA 2KH9A 1LWCA 3LGMA 2HNZB 1EARA 2DH8A 1UWBA 2FVPA 4KGZB 3ZTOA 1N6QA 2DNLA 1TKXA 1UL3A 3DLLQ 2VOOA 3DLGA 1NDCA 1S12A 3KJFB 2ZBRA 3I4HX 4MKBA 1IKWB 4BHQA 2FVQA 4IFYB 2XC9A 3EUNA 3O5TB 2LXUA 4HH0A 3IN5A 4YUDA 2B8PA 3OTCA 3DOLB 4DX8H 1NSKL 4QYRA 4ECWA 4CTAA 2Q79A 3E01A 2AV5A 5EHHA 1YRTA 5KT6A 1UEUA 1C0UB 2BE2B 1PYTA 4QWAA 1SVDA 1FK9A 3WHIA 3ILIA 2DPJA 2ZVIA 4FS1A 3TX8A 4RUBA 1N36F 4IDKB 1YQHA 3RB6A 4OX6A 8RUCA 2YWHA 3H2UB 3HM9A 3R1HA 3DNCA 3PR5B 1X0FA 1XK8A 2DNMA 3DDNA 4QCLA 4F0KA 1RTIB 3EYZA 4DSIA 3BN7A 2HHPA 3PW7A 2RH3A 4YP3A 3W5XA 2BANB 1FNOA 1PBAA 3SQOP 4FPRA 2XULA 4DQPA 4BWMA 3AD7C 3PJWA 4ZLJA 2BJ3A 2OD6A 1Y9OA 3KLIB 2R9LA 1S1UA 1KOHA 2KTQA 3CJQA 4J9UE 3TVKA 5A8RA 2DNOA 1RAIB 4C8OA 1WC5A 4EO6A 5HMXA 1VFJA 1KONA 3M32A 2DNZA 1H6KX 1SH3A 1UFWA 2WONA 2V67A 4KYZA 4LRDA 1NKCA 3EX7B 4PXCA 1FT8A 3P8BB 5K14A 3QSYB 4QWDA 5CQGA 1S6QA 4N8OA 4OYOA 4JV1A 4LF5F 4C8NA 2XZWA 2B56A 1GFWB 4FZVA 2J7KA 3ZZTA 1UZHA 2ILYA 2DB1A 1Y3JA 3E8OA 3DOMA 2AJ2A 3CDEA 4ED4A 5HATA 5CZVA 3BQ1A 1HW9A 2OP5A 4OMFG 1HHSA 1UAWA 3MAQA 2VONA 3NMRA 3PX6A 3KK3A 5DZ6A 3OR1A 2E7WA 3T6BA 4LF7F 4Q2LA 2HS0A 4J7CA 5C7PA 4GVBB 4OI6A 4E8UA 3CMAS 4IRCA 4ZP9A 2CNKB 1KRPA 3TUZC 4C3KA 3V4MA 4X62F 5A8WA 5DRKA 1B7FA 2UVWA 2CPXA 1N5TA 3MEGB 3HSZA 1YRUA 2QIFA 3FKBA 4NLRA 1Y5NB 2IRXA 4BWJA 2H9ZA 1VC6A 4TY9A 1WDTA 2FHMA 5AE2A 4C8KA 4WBFA 4RJVA 1TK5A 1KNZA 1TUVA 4C8LA 1SB6A 3EJMA 3N5FA 4OX9J 1HNIB 1PO6A 1AZSA 2BKNA 1JMTA 1U1MA 1FESA 1U2RA 4Q2MA 2W2NP 1RT4B 2F5GA 4HACB 3AFGA 1M5KC 2WB4A 3G9CA 3ETMA 2EG1A 2B6AB 2MZTA 3KLHA 2DHAA 2DGXA 3N0VA 2H5IB 2WOMA 1LV5A 2F1FA 5HJYA 1ICEB 4XK8C 3IMQJ 4Y2IA 3HLUA 1EZZB 1EX8A 1L3VA 4HKQA 2FPHX 4RNNA 4P73A 3X3UA 5KFNA 9ATCB 2RU3A 3ENWA 2ZH2A 1S9EB 4IR9A 4LIWA 1AW0A 3M30A 4X65F 1LWEB 4L3KA 2ZC3A 4NI2B 1MN9A 3DDKA 1XMBA 3CCES 2A18A 2JEIA 1RXOB 2BQUA 3HVWA 5C25A 3SQGB 3CVKA 1BC6A 2HEKA 1VBKA 4FS2A 2YQ1A 4NL5A 4AUKA 4ZVRB 4J9VA 2DIVA 2W25A 2QRRA 2IJRA 4K5RA 3TR5A 2V94A 1RT7A 2R4FA 4TY8B 4GKJF 4YB1P 2LEPA 1RTDB 4KTQA 1BQMA 2VODA 1OWXA 2CVEA 1XIQA 4ZS6A 4EYHB 3HFKA 3T41A 4CWBA 3AA9A 2VC0A 2NS1B 4HDGA 4ALZA 1YTYA 1M90T 2R2RA 1TKTA 2E1MC 1K73T 3DCAA 5L1LA 2MDAA 2KXFA 3RJMB 1HNWF 3E3XA 4J90A 5GMDA 1RHJB 5DO2A 1SL1A 4IG3B 4IKAA 1T02A 1CS4B 2JNJA 4OZ2A 3OL6A 2OIHA 3G8TA 2L3MA 2Z2YB 1QTNB 1S1TA 4DUZJ 1BLUA 3GV7B 4YEAA 4OYBA 1RCXB 3AHPA 4WXWA 4J91A 3TZXA 3IRXA 2V5HG 5CD4A 2YKOA 4NXMF 4UW2A 3TWZA 1UTAA 4U67Q 2XGPA 4DV6J 2Z56B 1FDAA 1S6OA 2WVBA 2QYGA 4N5SA 3PW4A 3PJXA 1VC5A 1CLFA 4ZPDA 2HW3A 3DLEB 1SL2A 1UJ4A 4H54A 1N52B 1GMWA 4ID5A 3Q8VA 4B3MJ 4PWUA 2CRLA 3QGHA 1I1GA 1HWKA 5ETOA 4URSA 3BDPA 5HMYA 2J9DE 2N3OA 4CLTA 1FEEA 2QFIA 3CWJA 2VFSA 1RI7A 1TMMA 9RUBA 2HBZB 2WVCA 4CNZA 1I94J 2RQ4A 4K8RA 1NZAA 3MM5B 1BQNA 2F4VJ 3VAGA 1RAGB 2HKEA 3PDNA 2V4JB 1BD6A 4LBPA 2MQOA 4P7VA 3AXMA 1NJXA 3C14A 3UWTA 3QIDA 2XSJB 3JQMA 2AP6A 5LMUF 2OMOA 1C0TA 1UWAA 4QIEA 2JH3A 2UXCF 1CJKB 1IKYA 2D9OA 1RWMB 4HR2A 2B4UA 2ZKUA 3N5BA 4DSLA 1NEEA 4C7QA 1RADB 3MPYA 3DC2A 4YFUA 1JB0C 3W63A 1VBZA 3MM8B 4C48A 2WSFC 2AJ0A 4D3GA 2FJEB 4C3LA 4RNMA 2BVZA 1F2HA 3PZPA 2M7SA 2UVVA 4ZITA 2B4OA 3D66A 4ZPTR 1U2CA 3LP0A 4PKDB 2LXIA 1YDLA 2BR0A 4V19X 4USVA 4K0KF 2NXCA 5BJRA 1R3NA 3IR5B 2V2QA 3N4WA 2FJAB 1VQPS 1HQUA 2VKRA 1Y5LB 4ZHRB 1SIZA 1LQ9A 5BXIA 1TFYA 1J5OA 4WXOA 2RRBA 2X3DA 1REVA 2QO3A 5KFQA 4WZMA 4F02A 2AZ3A 3QATA 4AT1B 1K1QA 1R8HA 2YWWA 3R5GA 4OYMA 1NLKL 4M5NA 3KLGB 2ZVSA 2AD9A 3DKDA 4O3QA 5SUHA 4W92B 4QW9A 1TUGB 2GAHC 2LQJA 3DLKA 2VQEJ 4JI4J 1KTVA 2NSBA 3THTA 4WFBQ 5IQQA 2B8QA 5A0YA 4LSLB 3N6LA 3TANA 1VQLS 1E6YB 1Y4ZB 2M8HA 2YWFA 2VB6A 2AX0A 4P74A 4KB7A 1X0PA 1YVFA 2PMWA 3HO1A 3J81U 1SPBP 4WPAA 2K7KA 3EVWA 3SSQA 4K4ZA 2YQ0A 2YX1A 4OFZA 2EW9A 2CJBA 2MHNA 1B0VA 3HSDA 4DL4A 3T9ZA 1RABB 2POKA 3BSCA 2XI3A 2CQGA 1U45A 3SCKE 3ISZA 3CD5A 4PPDA 3GR0A 2DIUA 1ZBTA 4QR1A 4DR3J 1AXQA 3NS7B 3CTRA 1FRKA 4CO0A 1AUDA 2ZJPQ 5ITHA 2VQFJ 1H7XA 3JTNA 2GIFA 3CW2C 1MWQA 4NCBA 3ZZYA 2QA4G 1OYDA 3D2WA 5IZHA 4RU9A 1RT3B 2DHXA 1X4HA 3BH7B 4JOUA 2HFUA 1KKHA 4J5OA 1UVLA 3EZUA 3PIOQ 5AXNA 5IT9U 4N7TA 2G4BA 3L7UA 2CNOB 1R31A 5F8NA 4O4GB 4P6QA 2I8EA 1YLXA 2KN4A 4P71A 4JI8J 3UE2A 3EZOA 1GT8A 1XBWA 4AXJA 2DR5A 2XWYA 4RW6A 1IBCB 1SIWB 2E5HA 4I2PB 1NJZA 2UXDJ 3NS5A
chains in the Genus database with same CATH topology
1K44A 3EJMA 3EICA 1VYAA 3BBCA 1B4SA 5CAAA 2VU5A 2HURA 4CP5A 1KDNA 1WKLA 3B54A 4UOFA 3BH6B 4ANCA 3FBCA 4ENOA 3VGSA 1BUXA 3VVTA 1NDKA 3Q86A 3Q89A 3Q8YA 2DXDA 1NDLA 2DXEA 3MPDA 1ZS6A 3FBFA 3EVOA 2AZ3A 2DYAA 2B8PA 1WKKA 4W98A 2CWKA 1XIQA 3ETMA 1NLKL 3Q83A 5CABA 3ZTPA 2HVEA 4HR2A 3VGVA 4F4AA 3PJ9A 1W7WA 3PRVA 1BHNA 1NSKL 3Q8VA 2ZUAA 4F36A 3NGSA 3DKDA 4EK2A 4UOGA 1S5ZA 1B99A 4O0NA 5C7PA 3JS9A 3VGUA 2DXFA 3BBFA 3EM1A 2DY9A 3BBBA 3B6BA 1NSPA 1NCLA 3ZTRA 3NGRA 1S57A 3ZTQA 3FBBA 4FKYA 1NHKL 1LWXA 3BH7B 4C6AA 3VGTA 2HVDA 2B8QA 1HLWA 4DUTA 1NSQA 3GP9A 3R9LA 3WX8A 1F6TA 1NUEA 3FBEA 3FCVA 1MN7A 1WKJA 3FKBA 3L7UA 3Q8UA 3NGTA 1MN9A 3FC9A 3GPAA 1HIYA 3NGUA 3EVMA 3VVUA 1PAEX 4S0MA 3ELHA 4FKXA 3ENAA 2AZ1A 3EVWA 3ZTOA 1HHQA 5IOLA 3EE3A 1BE4A 4ANEA 1NPKA 3G2XA 3ZTSA 1EHWA 3FCWA 1JXVA 1LEOA 1NB2A 4DZ6A 3EMTA 4WBFA 4KPCA 1PKUA 1F3FA 3DDIA 1NDPA 1U8WA 1NDCA 1UCNA 4DI6A 5BXIA 2BEFA 2BX6A 4ANDA 4UOHA 1S59A 1XQIA 2NCKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K44 A;  3EJM A;  3EIC A;  1VYA A;  3BBC A;  1B4S A;  5CAA A;  2VU5 A;  2HUR A;  4CP5 A;  1KDN A;  1WKL A;  3B54 A;  4UOF A;  3BH6 B;  4ANC A;  3FBC A;  4ENO A;  3VGS A;  1BUX A;  3VVT A;  1NDK A;  3Q86 A;  3Q89 A;  3Q8Y A;  2DXD A;  1NDL A;  2DXE A;  3MPD A;  1ZS6 A;  3FBF A;  3EVO A;  2AZ3 A;  2DYA A;  2B8P A;  1WKK A;  4W98 A;  2CWK A;  1XIQ A;  3ETM A;  1NLK L;  3Q83 A;  5CAB A;  3ZTP A;  2HVE A;  4HR2 A;  3VGV A;  4F4A A;  3PJ9 A;  1W7W A;  3PRV A;  1BHN A;  1NSK L;  3Q8V A;  2ZUA A;  4F36 A;  3NGS A;  3DKD A;  4EK2 A;  4UOG A;  1S5Z A;  1B99 A;  4O0N A;  5C7P A;  3JS9 A;  3VGU A;  2DXF A;  3BBF A;  3EM1 A;  2DY9 A;  3BBB A;  3B6B A;  1NSP A;  1NCL A;  3ZTR A;  3NGR A;  1S57 A;  3ZTQ A;  3FBB A;  4FKY A;  1NHK L;  1LWX A;  3BH7 B;  4C6A A;  3VGT A;  2HVD A;  2B8Q A;  1HLW A;  4DUT A;  1NSQ A;  3GP9 A;  3R9L A;  3WX8 A;  1F6T A;  1NUE A;  3FBE A;  3FCV A;  1MN7 A;  1WKJ A;  3FKB A;  3L7U A;  3Q8U A;  3NGT A;  1MN9 A;  3FC9 A;  3GPA A;  1HIY A;  3NGU A;  3EVM A;  3VVU A;  1PAE X;  4S0M A;  3ELH A;  4FKX A;  3ENA A;  2AZ1 A;  3EVW A;  3ZTO A;  1HHQ A;  5IOL A;  3EE3 A;  1BE4 A;  4ANE A;  1NPK A;  3G2X A;  3ZTS A;  1EHW A;  3FCW A;  1JXV A;  1LEO A;  1NB2 A;  4DZ6 A;  3EMT A;  4WBF A;  4KPC A;  1PKU A;  1F3F A;  3DDI A;  1NDP A;  1U8W A;  1NDC A;  1UCN A;  4DI6 A;  5BXI A;  2BEF A;  2BX6 A;  4AND A;  4UOH A;  1S59 A;  1XQI A;  2NCK L; 
#chains in the Genus database with same CATH topology
 1D8Z A;  1Q4R A;  1HBU A;  4O3N A;  4NYP A;  4I6W A;  1NJI T;  4UF4 A;  1HNZ J;  2KZZ A;  2KM8 C;  2CPY A;  3V5R A;  3O6Q A;  3CC7 S;  1U25 A;  3RRG A;  1RQ0 A;  1RU2 A;  2QLW A;  2VA2 A;  2H48 B;  3FNN A;  2F9D A;  3M6U A;  2CWK A;  4CT8 A;  4JI6 J;  4IO9 Q;  1XJW B;  4O44 A;  4XAK A;  2HND A;  5HL7 Q;  4DWI A;  2FZC B;  4USJ C;  3M8W A;  5LM7 E;  2B9E A;  4CDI A;  4M5D A;  5BYQ A;  1S4E A;  3ZTR A;  2FD2 A;  4PWW A;  5D6G A;  2HWT A;  2EFN A;  1T03 B;  1Q1K A;  2XO6 A;  5D4L A;  4ETZ A;  3D54 A;  2R2S A;  3DU5 A;  2HNY B;  4M1K A;  1CJT B;  1VQ8 S;  2MSS A;  4LF4 J;  4F3O A;  1NB7 A;  3OLA A;  4NE9 C;  1FJG J;  3THP A;  4HTJ A;  3TP2 A;  1YHQ S;  1DRZ A;  5DG8 A;  3MDF A;  2RE1 A;  1LW2 B;  1HNX J;  1JLG A;  4ZCL A;  5HJX A;  5IM0 A;  1SH0 A;  3KG1 A;  2BRL A;  1S76 D;  2QL5 B;  3TVZ A;  1KFD A;  1VHF A;  2YNH A;  4ZCK A;  4USK A;  4IOB A;  3LO3 A;  3DXB A;  2ALZ A;  1WHY A;  3ET6 B;  2Y0S D;  1KLM A;  1MU2 A;  1N33 F;  2WHO A;  3G86 A;  3VCD A;  1XNQ J;  3D1O A;  3NGS A;  4EI2 A;  1VK8 A;  4QIV A;  5L39 A;  4NCG A;  1WSV A;  2MY8 A;  3Q22 A;  5K8M A;  3MAA A;  2V63 A;  1DBD A;  2XWX A;  3MPU B;  4IH5 A;  4GVL A;  2HBQ B;  4ES1 A;  1FDB A;  3OW2 R;  3HMJ G;  1VQ7 S;  1FKP A;  5GVQ A;  1UP1 A;  2E1A A;  4IR1 A;  3D5M A;  3AOC A;  1QDU B;  1EKS A;  2KO1 A;  4B3O A;  4M5J A;  1RA6 A;  3HK2 A;  3V6H A;  2KKH A;  1OSD A;  3KDN A;  1VOM A;  4DOZ A;  2PA3 A;  1MML A;  1YBT A;  2OAU A;  1RWU A;  3J7Y U;  1VQ9 S;  2ZH8 A;  1K44 A;  2ZKT A;  2YX7 A;  3DYA A;  3NNH A;  4QPT A;  2F4F A;  1EJ7 L;  2CG8 A;  2B3T B;  1FA0 A;  3QGP A;  3EGZ A;  4YN3 B;  1GAO A;  5J1N A;  4B3S J;  4QYZ K;  2GO8 A;  4FYV B;  2DHS A;  3R3T A;  5HSP A;  5LJ3 Y;  1TL5 A;  1WF2 A;  1RTJ B;  4D3H A;  2GA7 A;  2Z2L A;  3R5J B;  3WDO A;  2A10 A;  1DAR A;  4AE5 A;  1D9A A;  1U6F A;  2ZJR Q;  1J2V A;  3LP1 B;  3VGU A;  4ELU A;  1VRT A;  3IGN A;  3KJV A;  4FKY A;  1P27 B;  5HP1 B;  2ATL A;  1OY9 A;  5J2M B;  4OJG A;  1DQA A;  2MLY A;  3NXZ A;  2Z30 B;  1G2E A;  2F8E X;  3AD8 C;  2VBW A;  3O1L A;  3M6W A;  4O0I A;  4C0O C;  5B0G A;  3ITH A;  3PG9 A;  4PUO A;  3W64 A;  4ECY A;  3KUG A;  2R3V A;  1AUS L;  3GSD A;  3GYX B;  3PHE A;  4PR6 A;  2XSF A;  1HMV B;  3I9V 9;  3R6G B;  5IWA J;  1HKA A;  3I0R A;  4ECR A;  4WK1 A;  1QSL A;  2VAS A;  2MQN A;  1ROF A;  1PJ6 A;  2NXJ A;  1HAR A;  4L74 A;  3MEC B;  2BRK A;  2HFV A;  1ZAW A;  2EKN A;  1SQG A;  5JXS A;  5JMN A;  2DNP A;  1H2U X;  4DF4 A;  1QLN A;  1T7P A;  1IJE B;  3JYT B;  3OVA A;  4EYI B;  2CG4 A;  1KWM A;  5LOQ A;  2AGO A;  3KHL A;  3TVY A;  2Y1L B;  4DUZ F;  3MEK A;  4Q0B B;  2V9W A;  4N41 A;  1GMU A;  2DHG A;  3HD1 A;  4ZLN A;  2OLW A;  2RVJ A;  4FBU A;  2BE7 D;  4B9N A;  3KLF A;  1X60 A;  2KT3 A;  1ITP A;  4NZ6 A;  5KOW A;  4DV6 F;  2KB2 A;  5F8L A;  3OFE A;  1T94 A;  3BSO A;  3W65 A;  4ETX A;  3OR2 A;  3KOA A;  1OJ4 A;  4ZCI A;  2CPI A;  3D0G E;  4BS2 A;  4B3R J;  3OD2 A;  1WOR A;  2XCP A;  2CAJ A;  1C1B A;  3Q24 A;  2R7W A;  2VBY A;  1S1V A;  2AJQ A;  2QGF B;  2M3D A;  1LW0 B;  4LQ9 A;  4KH0 B;  4CI0 B;  4K5S A;  2NZ4 A;  1LOU A;  1QAI A;  1U24 A;  4C8Z A;  4L6V 3;  1SV5 A;  4ICL B;  3LP2 B;  4DSK A;  3VQS A;  3UD5 A;  4M5K A;  2IVY A;  4B08 A;  2BJ8 A;  4HH1 A;  3M8P A;  1T05 A;  3GIR A;  3QO9 A;  5BYR A;  1Q79 A;  1H73 A;  4HL9 A;  2QC3 A;  1I94 F;  1HD1 A;  3I5C A;  2RIJ A;  2CA9 A;  2F4V F;  4NWB A;  3G71 S;  5B0D A;  1P9Q C;  2XMU A;  3QIP A;  2CQI A;  2XMT A;  5DDO C;  2HVI A;  4OHV A;  4QU6 A;  5ETS A;  5AXM A;  3B4D A;  5KFM A;  3DM2 B;  1SH2 A;  4J9L A;  5FII A;  3MMB B;  3BJY A;  3IG1 A;  2NYI A;  2UXB J;  4A8S A;  2ASJ A;  2CZV C;  2B7C B;  3M8Y A;  3OSP A;  1TV6 A;  4OHZ A;  1RTZ A;  1PIE A;  4USW A;  2YH0 A;  3H5Y A;  4X2B A;  2EFG A;  1U7L A;  2W4C A;  2XQC A;  2BOP A;  2DIT A;  2IJN A;  4F0M A;  3UR0 A;  1IWG A;  2DEJ A;  2M0G B;  2W9B B;  2YKN B;  3D0I E;  2AKW B;  2Q1L A;  2W2P P;  3EPI A;  4M94 A;  3MUR P;  4JI2 J;  1WHW A;  3M8R A;  4QYZ J;  4NCA A;  2WVE A;  1P1L A;  3IFE A;  2DO0 A;  3VAI A;  4ZCM A;  2E9Z A;  3BO3 A;  2WK4 A;  4RW9 B;  1JLE A;  4DR2 J;  3G87 A;  2HVE A;  2MB0 B;  2J7U A;  3SFU A;  1DTT B;  3FSX A;  2ZZT A;  4RNF A;  2UVU A;  1UKU A;  3Q2S C;  1F5C A;  2UUW A;  2JC1 A;  4OZ3 A;  2ROG A;  4DFM A;  2BE2 A;  4OQJ A;  4A48 A;  4LFA J;  3MR7 A;  1QE1 A;  3BZQ A;  3C3L A;  2W9A A;  3J80 Y;  2PII A;  5HMW A;  2LEC A;  3US5 A;  3G82 B;  3WX8 A;  5K8P A;  3FCV A;  3TUJ C;  2ASL A;  6FD1 A;  2FZG B;  3HHK A;  2CPD A;  4TLR A;  4R0J A;  1HHQ A;  2CQ0 A;  2FJD B;  3C6T B;  2UU9 J;  2DR6 A;  2WAQ D;  1IR1 A;  2HHW A;  2QG9 B;  5ETP A;  4QBU A;  4AND A;  4C4W A;  4KFB B;  3GMG A;  4DR7 F;  2GML A;  4JI5 F;  4QWC A;  4YY3 J;  2W01 A;  1TL4 A;  3OVS A;  2VQE F;  4JI4 F;  1YSJ A;  1RZM A;  4RW8 B;  1YBA A;  1F3V A;  2G9O A;  1O5J A;  3TAQ A;  3HUL A;  4YR2 A;  2QTW A;  2RHS B;  1PAU B;  1RAF B;  2DEI A;  1TU0 B;  3KLI A;  2Z4P A;  3GE9 A;  1TVR B;  3IM9 A;  3JXO A;  5KFW A;  2RT3 A;  3M2V A;  1IBM J;  2ZBP A;  1LWF B;  3BF4 A;  2DHH A;  4LJM A;  3HT3 A;  4B17 A;  4MJK A;  1LKZ A;  2NPF A;  1KQF B;  1PG5 B;  4DPU A;  1NPR A;  3F44 A;  1O51 A;  3M2R B;  3R2C J;  4RL1 A;  2GV1 A;  1L3T A;  1RT6 B;  4KO0 B;  5HO4 A;  2JEJ A;  1SI9 A;  2ZBQ A;  4MKA A;  4C11 A;  2E5J A;  3PIP Q;  3B82 A;  4WFX A;  2XMJ A;  1V9O A;  2M88 A;  1N34 J;  5GAD I;  4X4S A;  4MIB A;  1VJQ A;  3JSM B;  2BX6 A;  1RT1 B;  2CQB A;  1S0N A;  4C98 A;  3BQ2 A;  1VIX A;  1VR6 A;  2VQF F;  4DR5 J;  5J2N B;  3LAK A;  3ILL A;  2EEY A;  2YNI A;  3UPF A;  5KT3 A;  5CYQ A;  1ZS6 A;  1FD2 A;  2HMI A;  2J5A A;  4ED3 A;  5KG7 A;  1CUL B;  2VG7 A;  4ED5 A;  4ZDN A;  1JLA B;  5T7L B;  2LDY A;  1MMD A;  2J76 E;  1FFW B;  3JTP A;  3LOU A;  4KHM A;  4YB7 A;  5IC6 B;  1DZ5 A;  2ATC B;  4JI8 F;  2Y8W A;  4DMZ A;  1N54 B;  3S7R A;  1APS A;  2ROE A;  4GVB A;  4I4B A;  5FLX Y;  3Q8R B;  3FEZ A;  2V4R A;  2UXD F;  4CLS A;  2D9P A;  2HHH J;  1QUP A;  2DIS A;  1YJT A;  3H20 A;  1RT5 B;  4Q45 A;  3NS6 A;  5F8I A;  3D68 A;  4WII A;  4DL3 A;  1OSC A;  2RF2 A;  2L48 A;  3H90 A;  3ZZU A;  1HNZ F;  2GMJ A;  1HNV B;  3VQT A;  4RNO A;  2DCU B;  4RPF A;  3EE3 A;  2FUG 9;  3EMT A;  4KIA A;  4JI6 F;  2G2Z A;  4MAK A;  3KK1 A;  3T1H J;  2EWH A;  4YB6 A;  4HT5 A;  4CM0 A;  3RU0 A;  3NAH A;  4WK3 A;  2DH9 A;  1NAQ A;  3KLE A;  4ZJO A;  3NNA A;  3H8Y A;  1HNI A;  4LMZ A;  5HAO A;  2J0Q D;  5L8R C;  2MZ1 A;  1JLQ A;  4HAC A;  4ZIW A;  3RAM A;  1UVM A;  3QQC D;  3R2D J;  3OUY B;  4LF4 F;  1Q86 T;  2B6A A;  5MLC V;  2Q43 A;  1NBE B;  1FJG F;  2YTC A;  2DR8 A;  3SZ2 A;  2RQM A;  4RWW A;  1F2G A;  1S9G B;  1PJ5 A;  1HNX F;  2OI2 A;  5EWF A;  5KFO A;  1PGZ A;  2IMO A;  3BO2 A;  3FQK A;  2IVF B;  2OPP B;  1FXR A;  5HVH A;  3CCM S;  4IG0 A;  2KJW A;  1LWE A;  3Q8U A;  1RWK B;  1CEZ A;  2KYZ A;  4F3Q A;  4ZPC A;  1KFS A;  1Y10 A;  3MFI A;  1RAH B;  4I68 A;  1HR0 F;  5DQI A;  3SQG A;  4I2Q A;  4DLG A;  5ETN A;  4EZ6 A;  5FDL B;  1WHV A;  1XNQ F;  2DGQ A;  1LFP A;  3G6Y A;  4OI4 A;  3HHD A;  3WZ0 A;  1RE1 B;  2HRT A;  1WTB A;  2HHS A;  4H4K A;  3FBF A;  4ES2 A;  4DQR A;  4TY8 A;  2B9Y A;  5D3G A;  1RTD A;  1RWO B;  4K2J A;  2XEX A;  3WC2 A;  1DLO B;  2OO4 A;  3U02 A;  4Y2M A;  1ZYQ A;  1XMO J;  2P9G A;  3M2U B;  4PXB A;  3KXD A;  2AEM A;  3I82 A;  2AJ4 A;  4X4U A;  3T1Y J;  3MTJ A;  2DKO B;  3PFE A;  3TI0 A;  2CFX A;  3OL7 A;  2YBV A;  2MPU A;  4UUW A;  4FXD A;  3U1N A;  3TNV A;  1NHK L;  1TL1 B;  1T9X A;  2PSZ A;  3T9N A;  2FZK B;  2ZNY A;  1ZM9 A;  5RUB A;  3WQP A;  1SKS A;  1CS4 A;  2YNG B;  4DX5 A;  1T3O A;  4B3S F;  2FY8 A;  2A2C A;  2BAB A;  1P8G A;  2FVS A;  3PNI A;  5DDQ C;  1NPP A;  4KAI A;  2Q6B A;  1QJH A;  4F4W A;  4DL7 A;  3KUE A;  5IV4 A;  2DTJ A;  2OSQ A;  3BBC A;  1U48 A;  1IQT A;  4F2R A;  3OHA A;  2H4Y B;  4Y0F A;  1SCJ B;  4OI0 A;  1UW9 A;  2UP1 A;  1YIJ S;  1RK8 A;  2MYF A;  4L72 B;  1PC4 A;  2DXE A;  3D3B J;  2VDI A;  4YQW A;  4PXE A;  3W2V B;  2B0G A;  4F4A A;  1RCO B;  3THV A;  3E51 A;  5IT9 Y;  4RZR A;  3AA8 A;  1RP5 A;  3LTO A;  2K7J A;  2C2N A;  2E1R A;  5H1S V;  3H4B A;  1S6P A;  1NSP A;  2CYY A;  1IR0 A;  2XLI A;  2I2Y A;  1Q7L B;  2O67 A;  3M8Q A;  1OPI A;  3KMQ A;  2ZM6 J;  2MGZ B;  5CYM B;  5IWA F;  4F04 B;  2NXN A;  2DCL A;  2DNN A;  4J9M A;  1TKZ B;  2N7Y A;  3QLH B;  3R6L B;  1K0V A;  2RIL A;  1SXL A;  3K5M A;  1YIT S;  3BRE A;  2V4J A;  1WG4 A;  1FE4 A;  3BGL A;  2UUT A;  3CCR S;  1HYS B;  5E3P A;  2QE5 A;  3F73 A;  1SKR A;  1L3S A;  4JI1 J;  4BBY A;  4DS5 A;  4HTI A;  2MZR A;  2XG8 A;  2DXD A;  2XSJ A;  1Y5I B;  2KG0 A;  3W2W A;  2W9C A;  2KT5 A;  4W98 A;  1GTE A;  1D8Y A;  4MK7 A;  4CO3 A;  1RHR B;  1D9F A;  1WI8 A;  1U1K A;  5I42 B;  1FCA A;  4DQQ A;  2C1E B;  2GIR A;  3C8Y A;  1MNE A;  4O0N A;  2CPE A;  2XHW A;  2D69 A;  4WF9 Q;  3UD3 P;  2VHG A;  3OTE A;  4NLS A;  2R8H A;  4B3R F;  3ILJ A;  4HLB A;  2OEK A;  4ECX A;  4F3M A;  1SJ4 P;  4U7U K;  3HJV A;  1U1O A;  1WSR A;  5JJB A;  4FYX B;  3K5L A;  4LF8 J;  3AQO A;  2FGO A;  4DV1 J;  4YOE A;  3MOJ B;  1HQ2 A;  2IC3 B;  4KHP J;  4HHU A;  2MZJ A;  3T1A A;  2JJ4 D;  2BJ1 A;  4GMK A;  1NDP A;  3QFH A;  3SSS A;  4ZHR A;  1K0T A;  2NCK L;  2GJ2 A;  3DGP B;  1JWW A;  4A8X A;  4YDX A;  5HLF A;  5KFE A;  3BM7 A;  1JLB A;  1GXL A;  3K7R A;  1GK8 A;  3K5P A;  3LPY A;  5LSO A;  1SQE A;  1CG2 A;  2HQD A;  4LBI A;  3DMJ B;  1Y7P A;  4W4M A;  4FVM A;  1N8R T;  2NQP A;  2JVR A;  2HQF A;  1CJV B;  1B3T A;  2UXB F;  3KLG A;  2VF3 A;  4GO7 X;  3ILO A;  4I7F B;  3C16 A;  4ITS A;  3DRR A;  1CJU A;  2NYH A;  2VBX A;  1HW8 A;  4NA1 A;  2KJV A;  3L4B C;  4DFP A;  3IAS 9;  3I0S B;  3EZ5 A;  1AYE A;  3ZZP A;  5E0O A;  2GVD A;  4OJ1 A;  1G4C A;  1RA7 A;  3ENA A;  2LVW A;  5F9L A;  1VQO S;  3PHT A;  2Y1J A;  3FCW A;  3DRP A;  1X5P A;  4DR2 F;  3TA0 A;  2OPS B;  1VQ4 S;  4K4T A;  3DHW C;  4C8Y A;  1YJR A;  4P2S A;  3Q23 A;  1V5I B;  2PFF B;  3IWX A;  4LFA F;  3CDB A;  4DN0 A;  3TAM B;  5LXR A;  1HL6 A;  2D74 B;  3PO4 A;  1Y00 A;  3MCO A;  4ED0 A;  1NHV A;  3UVJ A;  1IKX B;  5C42 B;  3CB4 A;  1U02 A;  4ILL A;  4NML A;  5E3R A;  1YJV A;  4A8O A;  4K2X A;  2PFD A;  4NMX A;  3BR9 A;  4LRC A;  5KAK A;  2KRR A;  4C6A A;  3UDE A;  3AQP A;  1IWA A;  3S1T A;  1L5U A;  1OS5 A;  4Z7Y A;  4X65 J;  1AFI A;  2NUH A;  5CXT A;  3PRB A;  4WYL A;  4TYA A;  2VJV A;  4O4G A;  1N0U A;  2M8D B;  3K5N A;  4ZP8 A;  1NB2 A;  5KT5 A;  1LWC B;  4Y2K A;  2BW2 A;  2XLJ A;  3BB5 A;  1UWB B;  2CQD A;  1ZPW X;  2HIY A;  1QTM A;  3CC4 S;  4AYB D;  2KHC A;  3EXC X;  1A7G E;  2BBE A;  1IBM F;  1FRX A;  4A8Q A;  4ENO A;  1NDK A;  3PXG a;  3G4S S;  4KGM A;  3VZH A;  1HI8 A;  3PYF A;  2AQ4 A;  2IRU A;  4ELT A;  1TQL A;  2AYG A;  4U8V A;  1WEY A;  4ZKA A;  1NK6 A;  1VQK S;  2XMW A;  4LRF A;  4NYZ A;  4R0E A;  2XZT B;  2DPI A;  4LVN P;  1LFW A;  4K50 A;  1JJC B;  5IT4 A;  1S10 A;  1N34 F;  2Y1R I;  2HHQ A;  4CTA B;  2KZM A;  3E01 B;  1WEL A;  5LT5 A;  2RNE A;  1NSQ A;  4NX9 A;  4MIW A;  2OKQ A;  2C22 A;  2R7T A;  4ELV A;  2HHU A;  1SJQ A;  3IRW P;  4DR5 F;  2WVD A;  3HKW A;  4DCP B;  1VBY A;  1NND A;  3ZZR A;  5IOL A;  3GJR B;  4ZPA A;  1LW2 A;  1PYO B;  5EDW A;  2F7V A;  4OJH A;  1NK7 A;  1BXN A;  1VQ6 S;  1D3W A;  3FK4 A;  2FLO A;  2MQ8 A;  4TNO A;  3TQ1 A;  1UPM B;  2W7P A;  3SI8 A;  3D6F B;  2VZ9 A;  5KFY A;  2HLT A;  5KFK A;  5LSR A;  5HRO A;  1R8P A;  3CCV S;  2PEH A;  2AX1 A;  3EWG A;  1IN0 A;  4A8K A;  4DZD A;  3ET6 A;  2HHH F;  3SCI E;  3VGV A;  3O3L A;  4U6P A;  4RW7 A;  2MMY A;  1JLC A;  4WFA Q;  2KXH A;  3IGV A;  3SYZ A;  1NH8 A;  5IV3 A;  2XMK A;  1FWP A;  2B9W A;  2XB2 D;  4DV2 F;  2G13 A;  4OYW A;  3RZA A;  4DPW A;  3WX4 A;  3T1H F;  2B5J A;  3M32 B;  5F8G A;  2WVF A;  1WUU A;  4KKO B;  3O2I A;  2R7V A;  1KP6 A;  5LL6 d;  1OYE A;  4RR5 A;  2LCW A;  3BDE A;  4J9P A;  1T9T A;  3J7A N;  1U26 A;  1U1Q A;  2AHO B;  2CNN B;  2W8L A;  1VRU B;  5K14 B;  2HIQ A;  1TL3 B;  2IBO A;  4K7Q A;  1S6Q B;  1VLO A;  1B0T A;  3HX9 A;  1CVJ A;  2EC2 A;  3NGK A;  4IOA Q;  4UQG A;  4LT6 A;  2IA6 A;  2JLE A;  2KFN A;  3IBF B;  1RWP B;  4MTP A;  5C24 A;  3DOK A;  5HN0 A;  2RD5 C;  1HBM B;  4ZVH A;  1UET A;  3PKM A;  2UXC J;  2DGW A;  2CIM A;  1WOO A;  2JC0 A;  4O23 A;  2CJX B;  2QV6 A;  3KK3 B;  3QRP A;  4ER8 A;  5HI7 A;  3TUP A;  2E5L J;  1FRL A;  4ED8 A;  4W90 B;  2L9W A;  3PW0 A;  3CUL A;  2BXJ A;  1NZ8 A;  3BR8 A;  3P96 A;  5HP1 A;  5J2M A;  3D28 A;  5I4M A;  2PI5 A;  2BQ3 A;  4DPO A;  4S0M A;  4LRA A;  4GC7 A;  3C46 A;  3D6T B;  1LEO A;  3RRK A;  1X5S A;  5ETT A;  2HYI B;  3NLC A;  2GVZ A;  2HAI A;  1C4C A;  1XMO F;  3Q8Q B;  3T19 A;  3T1Y F;  2DNG A;  2WBM A;  2J6U A;  4PWD B;  2GQC A;  2V2V A;  2J8A A;  3DI6 B;  1W2I A;  1AZS B;  4ES3 A;  1XR7 A;  4UST A;  4OLO A;  5JVG Q;  3BV8 A;  1RWW B;  2E5G A;  3PJ9 A;  1MWZ A;  3M05 A;  5GAG I;  4F26 A;  3D0H E;  1F9F A;  4CT9 A;  5I3U A;  4FN5 A;  4ID8 A;  1Q81 T;  3E2E A;  5KT7 A;  1R0C B;  2AJF E;  2DRD A;  4DR6 F;  3NWR A;  4Q0B A;  2WB1 D;  2MQP A;  3IAM 9;  3ADA C;  5KFH A;  1QM9 A;  1YX2 A;  4DQI A;  1CQN A;  5K8N A;  3AOB A;  3PX4 A;  1NKE A;  3MPW A;  3M30 B;  2C28 A;  1DJ0 A;  5BYS A;  1YJ7 A;  2L08 A;  2ZH7 A;  4FYD A;  3GJT B;  3K58 A;  1TTH B;  2NUU G;  5HQM A;  3MR2 A;  3HHE A;  2QT7 A;  3AAW B;  2HZA A;  5C25 B;  1A6L A;  2RDI A;  4HVZ A;  5GAE U;  2XY7 A;  5A2Q Y;  1LW0 A;  3CXC R;  1G3O A;  1YGY A;  1LK5 A;  4DV4 J;  2DYA A;  2V8D A;  1XR6 A;  2ZM6 F;  3RW6 A;  2JHE A;  3LP2 A;  4L75 A;  3BPD A;  1RT7 B;  2RB7 A;  2HHV A;  2VG6 B;  4X4V A;  3PRV A;  5F8M A;  4PG8 A;  2MZQ A;  1BQM B;  3G6E S;  2Y3Y A;  3TZZ A;  2MKY A;  1UJ5 A;  1MMN A;  2IIH A;  3RR8 A;  2FJX A;  1SC3 B;  1X9W A;  2GC8 A;  1NK5 A;  5EX0 A;  1TKT B;  1RT2 B;  2RDD A;  4DXL A;  4DF8 A;  4U7U D;  1XEZ A;  4QW8 A;  3ZZ0 A;  1QAX A;  5D15 A;  2XGQ A;  3BGR A;  4CLU A;  4DPY A;  5F3T A;  1Z2L A;  1BWE A;  4JI1 F;  2C2Z B;  3QRQ A;  2HSE B;  2MEW A;  3MMB A;  1S0V A;  3RBE A;  2LYV A;  3GB0 A;  2GFF A;  4M5H A;  3D67 A;  5IT0 A;  4ILM A;  1UEK A;  1NPK A;  1NHU A;  3OJS A;  2K8G A;  4ED1 A;  1IVZ A;  3MPV A;  2IM0 A;  4CLP A;  3EIC A;  3UDV A;  4IRK A;  2YKN A;  2EK6 A;  3DU6 A;  3W7B A;  4LRB A;  2M52 A;  3CJR A;  3LQV A;  1GMW D;  3IRX B;  5L9X A;  3MXH P;  2C3M A;  2WW4 A;  3HPO A;  2AEF A;  4TLQ A;  2DVI A;  1N0V C;  3NCQ A;  4DUY J;  2C2E A;  4RW9 A;  1SBR A;  3FEX B;  1H74 A;  3FGV A;  4LR7 A;  2RRN A;  1DTT A;  4LF8 F;  2CZ4 A;  2E5I A;  1O0P A;  3B6B A;  4B3T J;  3FFI A;  4DV1 F;  2HQG A;  1FVQ A;  2DGU A;  3SSR A;  4KHP F;  2JEF A;  3SV4 A;  2XYG B;  1R27 B;  5I3P A;  4B9U A;  4ZIV A;  4EBE A;  1T95 A;  4GRS A;  1FJC A;  4FKX A;  2V34 A;  1ZPV A;  4M5I A;  2ZH5 A;  1R8B A;  4Q44 A;  1FD8 A;  3VZI A;  5EWG A;  1R6V A;  3C6T A;  2V0N A;  1SC4 B;  4ZN3 A;  3CJ2 A;  2F65 A;  2H5J B;  3KLV A;  4NLX A;  2HUR A;  4KFB A;  3QJL A;  2CQ2 A;  4WCE Q;  2XMA A;  3QT7 A;  4N8N A;  4G1P A;  3J7Z 5;  3HVT A;  4KGV B;  2ZE2 A;  3GIM A;  2IDL A;  3C14 B;  4RW4 A;  4IFV A;  4RW8 A;  3KMS A;  5KFD A;  2KU7 A;  4MIA A;  1N33 J;  4QZV B;  1TVR A;  3KFW X;  3I55 S;  1IKY B;  4RU2 A;  2EFV A;  1LWF A;  1FE0 A;  3KHR A;  2QMU B;  1IBL J;  4CZC A;  1SJF A;  3W60 A;  1JJ4 A;  2UV8 G;  4NLW A;  2AYM A;  4TU8 A;  2E9R X;  3VF0 B;  3SDE B;  3RBD A;  3MM7 B;  1WF1 A;  3M2R A;  2I9S A;  2DGS A;  4KO0 A;  2QJ3 A;  1HQE A;  4R5P B;  2VPX B;  1LK7 A;  2R7R A;  4PEO A;  4WIQ A;  5KFR A;  2EKY A;  4KQZ A;  2YPY A;  3LAM A;  2JOQ A;  4URQ U;  1CBK A;  4LFB F;  2JLG A;  3PYE A;  3I4P A;  2ZC4 A;  3MGJ A;  3L7P A;  5ETM A;  1VYA A;  2K06 A;  5CAA A;  1G1X A;  2EFQ A;  2FJW A;  3MTK A;  2U2F A;  2O1P A;  3P5T L;  3JSR A;  1PC5 A;  2EI5 A;  4AD6 A;  4Z2X A;  2R42 A;  4E98 A;  5KFU A;  1J5O B;  3H2V E;  4TQS A;  2BJ9 A;  2AGQ A;  1CPZ A;  1OIA A;  2D1C A;  1ACM B;  1REV B;  1AB8 A;  1RHK B;  1TMJ A;  4QJV A;  3CE8 A;  1XC9 A;  3Q2T C;  4C0H A;  2XM3 A;  3W62 A;  4IYQ A;  3L3C A;  4UT4 A;  2DY9 A;  1JXE A;  3F41 A;  1EIY B;  3HVA A;  1E6V A;  2ZHB A;  4KV8 A;  5THW A;  4OLP A;  2KL8 A;  1T9W A;  2JDJ A;  1HBO B;  2NLW A;  3DLK B;  4M63 A;  4MYU A;  3V6D B;  4LSN A;  2YKM B;  5DGA A;  1RT5 A;  1S49 A;  3A3P B;  4QQB A;  4USI A;  3GIL A;  1Q7Y T;  5A0Y B;  4OI1 A;  2U1A A;  3MZI A;  4LF2 A;  2CKW A;  4OV1 A;  4DSJ A;  4KPC A;  2BMB A;  2GQ2 A;  3JSB A;  1TK8 A;  1RBA A;  2E1C A;  2FY1 A;  5E7O B;  5IFM A;  2EFO A;  1RAA B;  1F9E B;  4LFC F;  5B7W A;  2O3D A;  4FBT A;  2GMH A;  3JTO A;  4PAB A;  3CD0 A;  2MQQ A;  3TUI C;  2CQH A;  2QZ8 A;  2CPH A;  4TVA B;  4UQT A;  1V3Z A;  3A4T A;  1GMV A;  5DZ7 A;  4DX6 A;  3OVB A;  3WIV A;  3POT A;  2YXL A;  1W25 A;  2QYC A;  1U09 A;  2KRB A;  4DBQ A;  3IWL A;  1HD0 A;  2C3O A;  1N88 A;  4Z7C A;  5SZT A;  1H7W A;  1FRH A;  5ETL A;  2LXF A;  2QFJ A;  2DY1 A;  5M2R A;  4V19 J;  3ONQ A;  2MTL A;  3ZTS A;  2VD3 A;  3I6P A;  5A6W A;  5KFB A;  2BKO A;  3KWM A;  1N5Q A;  3GV5 B;  4WE1 B;  2OSR A;  4KR0 B;  1JJ2 R;  3IP0 A;  5LSL A;  4RW6 B;  4UOF A;  2HGL A;  2Y1I A;  2BKP A;  5FDL A;  3GJQ B;  4P10 A;  1R89 A;  5KFV A;  1V6H A;  1RKI A;  4O3P A;  1HBU B;  4NEY A;  5A76 A;  4LQ3 A;  3N9U C;  2FJB B;  4ZN1 A;  4PQU B;  1JIH A;  3BS9 A;  4UOG A;  4UY8 5;  4NLV A;  4O44 B;  3ENQ A;  2HND B;  2B9X A;  2FLN A;  1UVI A;  4EZ9 A;  2E7X A;  2AT1 B;  4OX7 A;  4O3S A;  3MM9 A;  4WWS A;  1LNQ A;  1MW7 A;  1NUE A;  4M5D B;  3PO5 A;  2XMV A;  3OXF A;  1ZA2 B;  1WKJ A;  1TL1 A;  3P6Y C;  2GGP A;  5DGB A;  2QA1 A;  2BQR A;  4UUX A;  1U1P A;  3PYG A;  1HPZ B;  5FJ4 A;  1FFG B;  1WG1 A;  2EFP A;  2YNG A;  3QRR A;  1WJ9 A;  3CJT A;  2IBK A;  2OPR A;  3LGH A;  1D0E A;  2CJ9 A;  4IQM A;  4DI6 A;  4Y3C A;  4JP8 A;  3ZXW A;  5G4D A;  2C3Y A;  1MLA A;  2MJU A;  3DRS A;  4DV7 F;  1YZ7 A;  1OPZ A;  3JAM U;  2G2O A;  3Q8Y A;  4JV2 A;  1Q5Y A;  3G6V A;  5IM0 B;  3EVO A;  3HFZ B;  2D3Z A;  3M1V A;  2E5L F;  1KOO A;  1TL7 B;  1XN9 A;  2ASY A;  5F0U A;  3M4X A;  1EP4 B;  2Z2M A;  2VH7 A;  2ZD1 A;  3GCX P;  2KHD A;  4CO4 A;  3W2V A;  3OXG A;  2I0X A;  4OYX A;  1MU2 B;  4X4R A;  2QL7 B;  1J5E J;  1SJ1 A;  5D4O A;  2HFO A;  3VAH A;  2HBY B;  3DLH A;  3EGV A;  4ZJL A;  2ERR A;  5K9F A;  1X9M A;  4DV3 F;  4O3O A;  5KG6 A;  5C5J A;  3NGD A;  2ZIT A;  2MGZ A;  5CYM A;  1R43 A;  4NCG B;  3H42 A;  1G7C B;  3D3C J;  5T14 A;  5HVG A;  2HS4 A;  2YPZ A;  1TKZ A;  2W4D A;  5KFL A;  2AZ1 A;  2OEL A;  2HWH A;  1KHV A;  5AXL A;  2KYX A;  2PO4 A;  4Y65 A;  1S1X B;  4F8R A;  1RWX B;  1WAC A;  4DPX A;  4WTY A;  1R0B G;  3FJ2 A;  4PG5 A;  2JVO A;  2LKZ A;  4DS4 A;  4ECS A;  3B54 A;  2BW7 A;  1HYS A;  1FDN A;  4DR7 J;  1ULR A;  4JI5 J;  3MF5 A;  1Q0N A;  3G8S A;  2CQC A;  3DYA B;  4FNH A;  4F4X A;  4G1Q B;  4TQR A;  2R7X A;  3SIP B;  3GFY A;  2HQ3 A;  4L76 A;  4JI7 J;  3RB3 A;  1WI6 A;  3NCR A;  5H9F K;  1F60 B;  2P8I A;  2VL1 A;  4ZPB A;  3VAK A;  4X4Q A;  2ACM A;  3EDQ B;  2P6S A;  2W2Q P;  3NKY A;  1BMQ B;  2DH7 A;  4BC7 A;  2RKI A;  4NLO A;  2Q3P A;  1EET B;  1S57 A;  4DSE A;  3VGT A;  2DNH A;  4IH6 A;  2D3U A;  1F6T A;  5G0R A;  1EAY C;  2HHX A;  3HHL C;  1HIY A;  1M5V C;  4WU3 A;  3ZZZ A;  1QVF R;  4A8M P;  1NJY A;  1JKH A;  2DGV A;  3QT5 A;  2KXN B;  2MLX A;  2F8H A;  5AT1 B;  4DV4 F;  4DJB A;  1NXI A;  4EO8 A;  3CSK A;  3ITH B;  2ZOG A;  1RB0 A;  2IC3 A;  4PUO B;  5KG5 A;  3ICL A;  3MOZ A;  4C0B A;  5D0G A;  1S0O A;  2LEA A;  4I0W A;  2O66 A;  2VKZ G;  4NLD A;  3OL9 A;  3PYD A;  2BE9 B;  1Q8I A;  5A8K A;  1QVG R;  4RLE A;  3KYL A;  3I0R B;  2C3P A;  3LGN A;  1U6B A;  1Q78 A;  2LQ9 A;  3UR3 C;  2CQP A;  5LMN J;  5DLG A;  2UUA J;  2KM8 B;  4OZL A;  4LR9 A;  2ZBC A;  2LQ8 A;  3CCT A;  2XY6 A;  1P6T A;  3WIU A;  3O8W A;  4DU8 A;  1S9F A;  3R7N B;  3ZNJ 1;  4I7F A;  1FXL A;  4M5G A;  2RHQ B;  3TO8 A;  3CIZ A;  3GP9 A;  5AXK A;  4QWB A;  1JXL A;  2J6S A;  1JQG A;  4N56 A;  2ZDP A;  3UI3 A;  1RUS A;  2KI2 A;  4FP9 A;  3FEY B;  2VJU A;  1GNK A;  4OI3 A;  3I56 S;  1R6Y A;  3CJK A;  2HQI A;  3KLF B;  1GX6 A;  5HQL A;  4DR1 J;  3FRZ A;  2J9C A;  4C3M A;  4DUY F;  5ETK A;  4RKU C;  1ZZF A;  2IM3 A;  3HP6 A;  4JV5 J;  2OPQ B;  2GHV C;  3MEE A;  2QLX A;  4DLE A;  4B3T F;  2VV5 A;  4FF2 A;  2HGN A;  3M6V A;  2OFH X;  2M5Y A;  1WDD A;  4PG4 A;  4DR4 J;  2YVS A;  5CAB A;  3FMB A;  4LF6 F;  2L9N A;  1XNR J;  3RB0 A;  3MED A;  1UVJ A;  2ACY A;  4K4U A;  5I3Q A;  5DDR C;  2V2Z A;  1B99 A;  5C42 A;  4RBT A;  4PZV A;  2G1D A;  3M8P B;  1T05 B;  4CH1 A;  1KVI A;  3MCS A;  4ZVG A;  2ZFH A;  1LWX A;  2C42 A;  4XIU A;  1EQM A;  3OXL A;  3GYG A;  5E3C A;  5HVF A;  3OL8 A;  2R8I A;  3UCZ P;  3NCP A;  3BYR A;  1AT1 B;  3GPA A;  4NYO A;  4WP9 A;  3B4M A;  3QZ8 A;  1Z1Z A;  3QIP B;  5HBM A;  1DY3 A;  3TJ9 A;  4OI2 A;  4JI3 F;  1TZ0 A;  6FDR A;  2BA9 A;  4F0H A;  3IG1 B;  1JNR B;  2MHE A;  3BGU A;  4BLG A;  5HQ8 A;  1TV6 B;  3TRG A;  1FKO B;  2HFN A;  1HR0 J;  1L3K A;  1KR4 A;  1SUQ B;  3TOQ A;  3WC0 A;  3DXS X;  2R7O A;  2OEJ A;  1S1W A;  2UUB J;  1RYR A;  3HJF A;  1S0M A;  1IBL F;  2GS8 A;  1Q82 T;  3Q8S B;  2C2O B;  1DAX A;  3IBW A;  5AJ3 F;  3PRD A;  3PV8 A;  5H9F J;  3ZZO A;  3WBZ A;  2WBR A;  3ETO A;  4HEA 9;  1JLE B;  3RGI A;  4O4R A;  1NCL A;  4ECU A;  4M5M A;  4DL0 C;  2QL9 B;  2WSC C;  3DFE A;  1GQE A;  2ZBI A;  2Y9H A;  4J9K A;  2V2K A;  4GKK J;  2QSF A;  2VFR A;  4QWE A;  3HHL A;  1X31 C;  1KSP A;  3AH6 A;  3CF5 Q;  1QE1 B;  3FDS A;  2KFY A;  2LMI A;  1KVJ A;  4DZ6 A;  3GON A;  2FYX A;  1FJE B;  4H4M A;  2RAQ A;  4V1A k;  1H2T Z;  1H98 A;  3GG0 A;  1NSA A;  4FF4 A;  2FGC A;  1NRK A;  3LPE A;  2MLZ A;  4KBI A;  3QSI A;  3P5B P;  3IM8 A;  2VG5 B;  4DDF A;  1NO8 A;  4AXI A;  3V6J A;  2CJK A;  1T3N A;  1R0A A;  2DGO A;  4LIR A;  1C1C A;  2RSQ A;  2HLU A;  1VIS A;  3IBC B;  2K1R B;  2VBZ A;  4G6V B;  2HZC A;  2IM2 A;  1DTQ B;  5L38 A;  2LQB A;  1UVN A;  3AOA A;  3C15 A;  3GU0 A;  4DU7 A;  3ZNU A;  4KJI A;  1FJ7 A;  1PYS B;  3IXQ A;  3FBB A;  2WZ1 A;  1FFS B;  5KFS A;  3M2V B;  3W9J A;  2F40 A;  1R8A A;  3KNA A;  4CLY A;  4KKO A;  1QD1 A;  3QWU A;  1OY6 A;  2CQ1 A;  1T9Y A;  2FIU A;  2LLZ A;  2QN6 B;  1I51 B;  2V4Q A;  4GC6 A;  2VDH A;  1M5S A;  4Z37 A;  1XMQ J;  1VRU A;  3UCG A;  2HQC A;  1F0X A;  1TL3 A;  4C11 B;  3GIJ A;  1NK0 A;  4ZVS B;  2AYE A;  3AT1 B;  1U47 A;  4LUB A;  2I5J A;  1AFJ A;  1Q8K A;  1R7I A;  4X4O A;  1BUX A;  2UV8 A;  4KHR A;  3Q89 A;  1UFK A;  4RUH A;  2V8H A;  2NRE A;  1FXD A;  2CVI A;  2V68 A;  1NK9 A;  1HBM A;  3OTD A;  3HKZ D;  3P4U B;  3MUM P;  4NLY A;  2LDI A;  1KC8 T;  1RWV B;  2YNI B;  1U2F A;  5E5N A;  5CYQ B;  3CDW A;  1MRO B;  2C2D A;  2HMI B;  1S77 D;  1IKV A;  1KD1 T;  2VG7 B;  3T5K A;  2J7W A;  2EK1 A;  4PAA A;  1EB0 A;  1TFW A;  3CJ4 A;  4J9R A;  4RUA A;  2A2D A;  1HFE L;  1FNX H;  1RTH B;  2W7A A;  2CQ3 A;  4OZ0 A;  2GNK A;  3NL0 A;  4PPZ A;  4ECV A;  4WZQ A;  4CO5 A;  4OIX A;  3AOD A;  3UO0 A;  2CWX A;  2RF2 B;  3EGW B;  5LXY A;  3LF0 A;  3C66 A;  3AJ2 A;  2IFX A;  5KG3 A;  1QAY A;  1ZM3 A;  2DNK A;  2GQQ A;  5ETR A;  3V4I B;  3KK1 B;  2FLL A;  3BO4 A;  4DX7 A;  4R8U A;  2QLF B;  4PWD A;  2MKK A;  4MFB A;  3KLE B;  5CA5 A;  1A0O B;  3DI6 A;  3VV2 B;  4WU2 A;  2H54 B;  3NY0 A;  1WF0 A;  3MMJ A;  4M5L A;  4X64 J;  1JLQ B;  4LF9 F;  4PQA A;  2NSC A;  2YKP A;  4KGK A;  1OO0 B;  1U0H B;  2HNZ A;  5E3Q A;  1PIL A;  7FDR A;  2FHJ A;  2JFD A;  3H98 A;  3V81 B;  3NP5 A;  1BQX A;  3B8H A;  1S79 A;  4FYY B;  4AQY J;  3VAM A;  4L3N A;  4YR3 A;  1DHM A;  3NGU A;  3PEH A;  3ZC4 A;  4I1T A;  1VLY A;  2B4V A;  1FX4 A;  3IC1 A;  4DV5 J;  2Z58 B;  1H0H B;  4IG0 B;  1IKW A;  1PKU A;  4A46 A;  4C9D A;  4F4Z A;  4X84 A;  3QBC A;  4IFY A;  4CIO A;  2QEX S;  5J1P A;  2X1A A;  4BC9 A;  5KFZ A;  2EG2 A;  1WKL A;  3GR1 A;  1UW4 A;  2MXY A;  4F67 A;  4ZVO B;  3QAE A;  3VVT A;  3DOL A;  4ECZ A;  4MT1 A;  1X4E A;  4MKV A;  1J5E F;  3J80 U;  4I2Q B;  2IJF A;  2F3J A;  1BY9 A;  3R5D A;  4PCQ A;  4CLZ A;  1IR2 A;  4KPY A;  2R8G A;  1C0U A;  2FC8 A;  3VAJ A;  3MR3 A;  2X1G A;  3J7Y I;  2VG6 A;  3VWS A;  3HF5 A;  2HK2 A;  5D3G B;  4IDK A;  2FVC A;  1U0S A;  1VQM S;  1M5O C;  4DG1 B;  3M8Z A;  5KFI A;  4USH A;  1NKB A;  2PT0 A;  1BWV A;  4KRW A;  2XYH B;  3H5S A;  1WNE A;  1RT2 A;  1RTI A;  4MKY A;  4HYK A;  5B0F A;  3CJS A;  1BGX T;  1UA0 A;  2BAN A;  1NH7 A;  3VHQ A;  2WSE C;  1MWY A;  5EN1 A;  2L41 A;  4FVC A;  1CC8 A;  4FXV A;  2RRA A;  4OYP A;  3DDI A;  3MWB A;  4JI7 F;  4H4K C;  2C2K B;  2CDQ A;  3KJN B;  1FF2 A;  4XDC A;  4IOC Q;  3MMA B;  3BEG B;  1U8S A;  3UN3 A;  2OD4 A;  2D3O 1;  1YK9 A;  3JB9 k;  3RTV A;  4WKR A;  1M1H A;  5J2P B;  2XO7 A;  2FDN A;  4B9V A;  1M1K T;  1WC6 A;  1PCA A;  3PR4 A;  2ZJQ Q;  2CXE A;  4WKY A;  2EC0 A;  3R5C A;  4I56 A;  4CQ1 A;  2GCF A;  3H4D A;  4WP3 A;  3EM1 A;  5ETV A;  3P3D A;  4I69 A;  1JLF B;  4OYA A;  4ECT A;  1S6P B;  2IHR 1;  2ZH4 A;  4CLK A;  1NJW A;  2H65 B;  1KQK A;  3FBE A;  4IRD A;  1VI7 A;  1FWK A;  5FD1 A;  4H4O B;  4C8M A;  4F7V A;  3M8Q B;  4OZ5 A;  3FRY A;  1NM2 A;  2KDO A;  4XPC A;  2G0I A;  2V8G A;  5DET A;  5LMN F;  4P2F A;  4QIW D;  4TYB A;  2UUA F;  3TZY A;  3CMQ A;  3KNG A;  3IR6 B;  2ZNZ A;  3H40 A;  4ILR A;  1FWL A;  4TN2 A;  4P2M A;  5FLX U;  2MY7 A;  2IPO B;  4CLF A;  2GAG C;  2H51 B;  2XS7 A;  2J9D A;  4CNY A;  2EVZ A;  1G6B A;  5E41 A;  2K3I A;  1M5H A;  4CRJ A;  4Q8F A;  3A8I A;  5L9N A;  4Y34 A;  3RR7 A;  1YRX A;  3UN2 A;  3RAX A;  1NK4 A;  1RAO A;  3W2W B;  2W9C B;  3RRH A;  2IRY A;  2LA4 A;  5B0A A;  4ED6 A;  3MEG A;  3HSG A;  2ZUG A;  3TEG A;  2HK3 A;  5EGY A;  2J9E A;  3UFC X;  2F8M A;  4DR1 F;  3CGI A;  4A8F A;  4DV2 J;  5KFP A;  2OGU A;  1IBK J;  2DR7 A;  1FI4 A;  4JV5 F;  3SDE A;  4F4Y A;  3MM7 A;  2RJZ A;  1T9V A;  4U9R A;  3JAM Y;  4RWX A;  3NOC A;  3D1Q A;  4R5P A;  1X4B A;  3HZG A;  4Y2C A;  1RT4 A;  1RBL A;  3GQC A;  3CJ3 A;  3NWG A;  5F8H A;  4DR4 F;  2GX8 A;  2A6M A;  1X4F A;  1XNR F;  1SQF A;  3OTO F;  1VMB A;  8AT1 B;  1VIO A;  3A12 A;  3K5O A;  3F56 A;  4DPT A;  2LQ5 A;  2AGP A;  2JSX A;  5A6P A;  3NG8 A;  3M9N B;  3GIK A;  2R7U A;  3QYY A;  1WKK A;  3TEH B;  3DHX A;  3TA2 A;  3RG6 A;  5HLF B;  1JLB B;  4ZVE A;  3TA1 A;  3HZE A;  1S9E A;  2DK2 A;  2M9K A;  3MUT P;  2OJ3 A;  1T0T V;  1N32 J;  2XMM A;  2QMX A;  4ED2 A;  2O01 C;  4NI2 A;  4WFN Q;  3HT0 A;  1X5O A;  1S7I A;  2YWE A;  1Z4U A;  4NRU A;  1X7V A;  2KVQ E;  2N4D A;  3C19 A;  3C16 B;  4FF1 A;  1HBO A;  3DRR B;  1CJU B;  3C6U B;  2GHW A;  2YKA A;  1S99 A;  3V6D A;  3FVY A;  2UUB F;  2AJ1 A;  2YKM A;  2X7I A;  1ZH5 A;  3RAQ A;  3ZFV A;  1WG5 A;  3KK2 B;  4ERD A;  3J7A 1;  4NLQ A;  2GVD B;  2KT2 A;  2ZOF A;  1N48 A;  3CT9 A;  4K4S A;  2ROP A;  3DRP B;  3Q86 A;  4J9S A;  2CPJ A;  4G3I A;  3LUY A;  5KT2 A;  4KSE B;  1P1T A;  3QFW A;  2AEJ A;  2W24 A;  4DFJ A;  1CQM A;  3J81 Y;  3R5A A;  1V5V A;  4WTO B;  3QT8 A;  1VRQ C;  3KG4 A;  2J0W A;  3VR1 A;  4GKK F;  4QU7 A;  2PA8 D;  3CPW R;  1HWU A;  1SKW A;  4IG3 A;  3F0N A;  2O5D A;  3PW5 A;  2P2C B;  2XHC A;  3OPK A;  3UVJ B;  3A8K A;  1KTQ A;  4DR6 J;  3KDO A;  3HD2 A;  3JSY A;  5D0E A;  1REG X;  5U47 A;  2X51 A;  2ASD A;  4FXW A;  3PM9 A;  3LWM A;  2PEB A;  5B0B A;  5KG4 A;  5DG9 A;  1ZET A;  1TAU A;  1UEV A;  3FCH A;  3TQE A;  2BEF A;  3R7B B;  5HK4 A;  1FTC A;  4X4T A;  1YJU A;  3PX0 A;  1EQ0 A;  4CH0 S;  4FDF A;  3DLE A;  4WE1 A;  1YG0 A;  3RBX A;  1GH8 A;  3T6J A;  3W1Y C;  1NK8 A;  1FNM A;  4KH1 B;  1JX4 A;  1XWL A;  1ZZN A;  2J0X A;  1X5T A;  2LU1 A;  1JK9 B;  3AXK A;  3MCM A;  4PQU A;  2DNQ A;  3CNQ P;  4UTG A;  3X1L B;  3BBF A;  1JNZ B;  5D77 A;  3OQ2 A;  3AY0 A;  1WEZ A;  1XMQ F;  2YY3 A;  3NBP B;  3MM5 A;  4N76 A;  2DR9 A;  4YB5 A;  2DBB A;  4Y2A A;  1DUR A;  3ENV A;  4KE5 A;  3OSN A;  4MMO A;  2LP4 A;  4AFF A;  3SXL A;  2AMC B;  1VCT A;  1RHM B;  5LJ5 Y;  2AIR B;  1HPZ A;  4LF1 A;  1VQS A;  4Q8E A;  1RHQ B;  2VFT A;  3BGO P;  1F3F A;  5J1E B;  1VGY A;  5CYJ A;  5L1K A;  1IUJ A;  2XNR A;  2HWI A;  1KQG B;  2QLB B;  3CJ8 A;  2J8S A;  1CJK A;  4ZVQ B;  4CM2 A;  3BH6 B;  4U96 A;  4UOC A;  3VAF A;  4CYU B;  3GFZ A;  4M8L A;  2BOA A;  1HBN B;  2XZD B;  3MPD A;  4IUF A;  2D41 A;  3MFH A;  5CZX A;  3P49 B;  2BJD A;  2HPU A;  3MM8 A;  2HZV A;  3H5X A;  2M4M A;  3ZTP A;  5EX3 A;  1TL7 A;  5HRO B;  4BCA A;  1EP4 A;  2PE8 A;  3BSN A;  4NLG A;  3JS9 A;  3UD4 P;  4A47 A;  1XTZ A;  2BJ7 A;  4B9L A;  4RW7 B;  4Y00 A;  5KFT A;  3PTW A;  2R7Q A;  1JLC B;  2V8P A;  1WC4 A;  3N6N A;  4F25 A;  3K8W A;  3H5U A;  2PD1 A;  3GG1 A;  2CJY B;  4HI1 A;  4FYW B;  3VVU A;  1N5Y B;  4MYT A;  2ZHO A;  3PCO B;  2B5J B;  3D7S B;  2HRY A;  3CDA A;  5B09 A;  2P9C A;  3A1Y G;  3G2X A;  2EPI A;  4ZP7 A;  4OV6 A;  2H3E B;  4OX9 F;  1S59 A;  1S1X A;  4CH7 A;  1B4S A;  3HDS A;  1RSC A;  5KT4 A;  4CP5 A;  4X64 F;  1O8B A;  3J7Z T;  1MSW D;  5J2Q B;  1PSD A;  2AW0 A;  1QSY A;  2J0S D;  1PBU A;  2V50 A;  5DQH A;  3S8S A;  1YZ6 A;  5F41 A;  3H2L A;  5HMZ A;  3MM6 B;  2HVZ A;  4LSZ B;  2RUS A;  4G1Q A;  4X66 J;  5KFG A;  3IA0 A;  3TX0 A;  4AQY F;  1W7W A;  2VOP A;  2MQM A;  2Y0B B;  5C24 B;  3DOK B;  3MR5 A;  2MKJ A;  4LSL A;  2X3G A;  3R1L A;  1E6Y A;  2IY5 B;  3LW5 C;  3GFH A;  3ZTQ A;  4DV5 F;  1RLD A;  4C97 A;  1W2B R;  5GAH I;  4P7T A;  4NLU A;  1EET A;  1IXK A;  2NR0 A;  3IS9 B;  1T8E A;  4Y6I A;  1MN7 A;  2CQ4 A;  3AB4 B;  1F5B A;  1RAE B;  3OT9 A;  8ATC B;  3HSJ A;  4P9S A;  3HFV A;  2MKC A;  1EHW A;  5L46 A;  1T11 A;  4B9T A;  3I31 A;  3MMC B;  2V69 A;  1S7H A;  1U1R A;  4ZK7 M;  1RHU B;  2I6W A;  3IWN C;  2RQK A;  3K2Y A;  3DLB A;  4LFB J;  1V3S A;  2HAF A;  1KQS R;  4A4J A;  4JI0 J;  2XTJ P;  2WRM A;  1HWL A;  3QGI A;  3DGV A;  4LVO P;  5H9E K;  2WW8 A;  4J9N A;  1K8A T;  2GVZ B;  4EMD A;  2YNF B;  3S01 A;  2M70 A;  3RW7 A;  3D6M B;  3FMW A;  5B0C A;  3PAC A;  4QR0 A;  2OHD A;  1M5P C;  1RT3 A;  1K1S A;  3CO0 P;  5IQ6 A;  2ZHA A;  2IAJ B;  1LXN A;  5GAD U;  3QT6 A;  2ABY A;  1F9H A;  1VQN S;  3NGR A;  5DM6 Q;  5ADZ A;  4YS2 A;  3MUV P;  4A8W A;  5I3U B;  4ZLL A;  3BPS P;  3NMA A;  2UVR A;  3SBM A;  1SC1 B;  4I2P A;  1C4A A;  1PAE X;  1N6Q B;  1TKX B;  2DT9 A;  2EBG A;  3DLG B;  4ANE A;  2E7V A;  3BN4 A;  2PMH A;  4EUV A;  5L1I A;  1I6J A;  4MK8 A;  2XS2 A;  1H2V Z;  4YHH J;  3W61 A;  3CD6 S;  3I5B A;  1FKA F;  3QZ7 A;  1EKR A;  4NOH A;  2JZ5 A;  4RX6 A;  1UZD A;  4YR0 A;  1V3R A;  2JLF A;  1JJH A;  2OPQ A;  1FEH A;  4LFC J;  4FNI A;  4KC5 A;  3TJA A;  3CJ0 A;  1LXJ A;  2COL A;  3KKF A;  1H3D A;  4RUC A;  4ATN A;  5CCL A;  1FTR A;  2K3K A;  1RBO B;  3DN9 A;  4B3M F;  4J9Q A;  2RS2 A;  1T03 A;  1WC3 A;  3JQK A;  3GLJ A;  2HNY A;  1D1U A;  1CJT A;  1FK9 B;  3U1L A;  2CJA A;  5GMK a;  2APO A;  3BQ0 A;  3Q8P B;  2XS5 A;  4JUZ A;  2Z0G A;  2H1Y A;  2XCA A;  2FTR A;  2NZC A;  1HWI A;  3AJD A;  2G1H A;  5BR8 J;  5EUH A;  2Q6C A;  4PRF A;  1FRJ A;  3A13 A;  5GME A;  4ZJQ A;  1TEL A;  4F4K A;  1TK0 A;  5JVH Q;  1HI1 A;  1X4C A;  2RUG A;  3Q0A A;  2X1B A;  3R7S B;  1GXT A;  3BGR B;  2DD8 S;  3K8V A;  3LA0 A;  2DO4 A;  1YKW A;  4GO5 X;  2MQL A;  4P2X A;  3SEO A;  3FSI A;  1X8D A;  3HI9 A;  4X4P A;  3SFG A;  5HAN A;  4ZP6 A;  7AT1 B;  1FKO A;  1KDN A;  1YJN S;  5DS7 A;  2ILZ A;  1SUQ A;  3UNY A;  3D9B A;  5E3A A;  1WHX A;  3GV8 B;  4DV0 J;  1S1U B;  2MJN A;  4HHH A;  2YWK A;  4JYA J;  1FER A;  1WD6 A;  2CZ9 A;  5A8R B;  3CCU S;  4UY8 T;  2DNR A;  4XTT A;  1IBK F;  3U7J A;  4EGL A;  4ZLP A;  2XY5 A;  4B02 A;  3LAN A;  3PW2 A;  2FC9 A;  1X9S A;  1RJJ A;  1ZTT A;  5M2P A;  3GZ7 A;  3M8S A;  1I5O B;  2WON B;  2HFZ A;  1J27 A;  2A1B A;  2ZOM A;  2W8K A;  4CO1 A;  3LWL A;  2J6T A;  4DUT A;  1N5V A;  4TXS A;  3D6H B;  5EWE A;  2RQC A;  2JFK A;  3FFI B;  3NGT A;  1N5S A;  3EVM A;  3C2P A;  2CDR B;  3GII A;  5AE1 A;  2ZZN A;  1BE4 A;  2W1B A;  2C2R A;  3GFX A;  1OMS A;  3DOM B;  4OYZ A;  3UN5 A;  3CD7 A;  4UOH A;  2BV3 A;  1S72 S;  1RTJ A;  2VU5 A;  5B08 A;  2ZH1 A;  1ZOT A;  1N32 F;  3FBC A;  5H9E J;  1ZM2 A;  4DV7 J;  4Q5V A;  4R25 A;  4EFA C;  5DM7 Q;  4K4X A;  2VG5 A;  1D9D A;  3OR1 B;  3LP1 A;  1S48 A;  4ZOS A;  3U27 A;  4CLW A;  2LFV A;  2V6A A;  2K1R A;  3BKF A;  1DTQ A;  3HVT B;  3JQJ A;  2ZE2 B;  1S5Z A;  4RW4 B;  4ZVP B;  4IFV B;  4NZ0 A;  3W8P A;  6AT1 B;  2H5E A;  1O6X A;  3CCS S;  1Q8L A;  5A8W B;  1ZAV A;  3GWC A;  5F3Z A;  1YI2 S;  3H25 A;  4YDD B;  2ALY B;  2KVI A;  4DV3 J;  1HMV A;  1ZM4 A;  3A3O B;  1MG7 A;  5IS2 A;  1L3U A;  4EBC A;  1KEK A;  1HWJ A;  4WJB A;  3V2U C;  2ADC A;  2VC1 A;  4OL8 A;  3MEC A;  3TAP A;  1RYS A;  3CO9 A;  2PGC A;  1HQE B;  2PMZ D;  5KG2 A;  4A8Y A;  1Q8B A;  4ZVF A;  3CJ5 A;  3FUY A;  4DR3 F;  1S97 A;  3JYT A;  1NDL A;  3QWP A;  5F8J A;  4QIG A;  3AB2 B;  2CAD A;  4YME A;  3PEJ A;  1TKD A;  2N7C A;  3KLH B;  1ZA1 B;  2R2T A;  4X4N A;  2WOM B;  3HVR A;  2QA2 A;  2OTJ S;  1UPP A;  4NXN J;  2UUC J;  3W3S A;  4USU A;  2F9J A;  1KN6 A;  1MRO A;  4JBC A;  4OZN A;  2DXF A;  2R8J A;  1TAQ A;  3KJQ B;  3BBB A;  2XYP B;  2AWZ A;  3T3F A;  4HT7 A;  1VHI A;  4WFY A;  1RU1 A;  4ZPW R;  2PDA A;  5A2Q U;  2B43 A;  5KFJ A;  1B64 A;  1RTH A;  1E6V B;  4ZVU B;  1SC6 A;  1U4B A;  2MST A;  4RBV A;  4KV8 B;  4CO2 A;  2Z57 B;  1NME B;  3IO1 A;  1JXV A;  2IA0 A;  4XDD A;  4LSN B;  1DQ8 A;  4DQS A;  2JEG A;  4Q43 A;  4ICL A;  1N56 A;  3M9O B;  1WC1 A;  3QPI A;  3BKU A;  1IQZ A;  2BAC A;  1VBX A;  5K20 B;  2IM1 A;  3V4I A;  2PN6 A;  2VPY B;  1WWH A;  5KFC A;  4EWT A;  4BDP A;  2VFV A;  3BSA A;  4OHY A;  3S6E A;  4JB8 B;  1M0S A;  1BHN A;  2ZUA A;  5JUM A;  3PY8 A;  2Z8Q A;  1Y0H A;  2OTL S;  4P75 A;  1F1B B;  3DM2 A;  3L9Z A;  2JX2 A;  1VQY A;  1U0H A;  3HHN B;  3GYN A;  2L9D A;  2C3U A;  3MAH A;  2QSW A;  3POT B;  3V81 A;  1Q5V A;  2FJV A;  1S1T B;  3G96 A;  1YJ9 S;  4NA3 A;  4U8Y A;  2W9B A;  2P9E A;  2W2M P;  4XO0 A;  2P6T A;  2GJI A;  1XR5 A;  3N79 A;  2W2O P;  2I1R A;  4U7C A;  2VIH A;  2BDP A;  2VPW B;  1X4D A;  2LA6 A;  1QUV A;  4IO1 A;  2EBE A;  2B51 A;  4OZ1 A;  4AL5 A;  3FZ2 A;  4OYI A;  1FVS A;  1CSJ A;  3KTQ A;  4I64 A;  4ANC A;  3B78 A;  2G0J A;  4NZ7 A;  3UCU P;  4DSF A;  4CLL A;  5CH7 B;  4AL6 A;  3CCW A;  2XNQ A;  4ID5 B;  2R8K A;  2HRU A;  4IQX A;  3G8Q A;  4PXD A;  4C2M A;  2QA4 S;  1OQ6 A;  4AL7 A;  2HVH A;  4LF6 J;  5GAH U;  4F50 A;  4LBH A;  4QOT A;  2A3J A;  3G82 A;  4NRT A;  3ULH A;  1UVK A;  2ZEJ A;  4M95 A;  3A8J A;  4DG1 A;  2N3L A;  5E2Q A;  1RAJ A;  3OJU A;  5D0R A;  1SJR A;  1KLN A;  4MK9 A;  3OBI A;  1IJF B;  2FB0 A;  1WOS A;  1WC0 A;  1M1G A;  1F5A A;  2ADB A;  2F63 A;  1BQN B;  3AJ1 A;  4EBD A;  2IVM A;  3VAL A;  4FF3 A;  3HCX A;  1X4A A;  3MM9 B;  2B4P A;  3QAU A;  1HI0 P;  2AU0 A;  2E44 A;  3TYT A;  2GO9 A;  2GGP B;  4JI3 J;  3CCL S;  3CME S;  4X66 F;  5F0W A;  2IYI A;  2ZH3 A;  2E66 A;  2JL9 A;  4G1I A;  2CUY A;  3UDC A;  4CCH A;  1HHT P;  1U1N A;  3W5Z A;  1IM6 A;  2OPR B;  2G2Y A;  1C0T B;  3MMA A;  1SJ3 P;  3NEK A;  3OTB A;  3I87 A;  2EXU A;  1FHT A;  3DRS B;  3I32 A;  5J2P A;  4QPX A;  3CCJ S;  4G65 A;  3EPG A;  1SKU B;  2Y8Y A;  5AJ3 J;  4DFK A;  4PYD A;  3FQL A;  3M1V B;  3FZB A;  4LRE A;  1RT6 A;  3L09 A;  3GTY X;  3MCN A;  2ZD1 B;  2VUG A;  2KFZ A;  1JLF A;  3LP0 B;  2XI2 A;  2D3O R;  4UZC A;  1I3O B;  1TR0 A;  5DQG A;  1ELO A;  5DG7 A;  3FC9 A;  2NXE A;  4JI0 F;  3JSM A;  1RT1 A;  4H4O A;  1HQU B;  1VJW A;  1VS3 A;  2ZH6 A;  5J2N A;  1U49 A;  2V8V A;  1FRM A;  2HS3 A;  1N36 J;  2HBR B;  2JWN A;  3QNW B;  3DRY A;  1CUL A;  1DQ9 A;  3O44 A;  2G0C A;  1R8C A;  1JLA A;  5T7L A;  3RYL A;  2CJQ A;  4URG A;  3CED A;  4NAS A;  5KOX A;  5E33 A;  3CCQ S;  4KT0 C;  4KGX B;  4I67 A;  1QSS A;  2YH1 A;  3MD3 A;  1FDD A;  1P9Y A;  3LH2 S;  3R5B A;  4O3R A;  4QIF A;  1VDH A;  2VIC A;  4ZA1 A;  3D4J A;  2BZ2 A;  2W4P A;  4PG6 A;  5GAE I;  2A6O A;  4ED7 A;  1KS2 A;  3T5J A;  1HNV A;  4ECQ A;  1AA1 B;  4YHH F;  2AYB A;  2GZO A;  2E29 A;  2N4C A;  2RKI B;  3SMZ A;  2YX4 A;  3TZW A;  1ARO P;  5KFF A;  1B0P A;  3QJJ A;  2W7O A;  2NPI A;  1B7Y B;  3ISN D;  3D1H A;  3NOG A;  3RUB L;  5G0R B;  5KFA A;  2FVR A;  2GIQ A;  4OZJ A;  2R7S A;  2I38 A;  1JKH B;  1GXU A;  1K47 A;  3VGS A;  4LF5 J;  3OUY A;  1YJW S;  2M2B A;  2WCX A;  2BM1 A;  2V9K A;  4K59 A;  4ZMM A;  5L1J A;  4DEZ A;  3LAL A;  1S9G A;  5A8K B;  3OFG A;  4E0D A;  5BR8 F;  4EU0 A;  2VA3 A;  3NRB A;  4EK2 A;  3NNC A;  2OUG A;  5M2U A;  2OPP A;  3UDL A;  4RNH A;  3K89 A;  4WYW A;  4DCO B;  1KBR A;  4NEZ A;  4QR2 A;  3OHB A;  2FHK A;  3SCJ E;  3PVX A;  2HVD A;  1TP7 A;  3W9I A;  2BM0 A;  3QGG A;  2GJF A;  4ZPV R;  4LF7 J;  2HHT A;  2CNL B;  2BJE A;  3TJ8 A;  1B70 B;  2N82 B;  3VTI A;  3R8Y A;  3ISN C;  3C6U A;  4TU7 A;  1PJ7 A;  3EXY A;  2FLP A;  4DV0 F;  2XBP A;  4X62 J;  4JYA F;  4P52 A;  3KHG A;  2DGT A;  4JI2 F;  5DDP C;  3KK2 A;  1Q95 G;  1URN A;  2HFS A;  2DRB A;  3CJK B;  1QY7 A;  3OFH A;  1DLO A;  2XLK A;  3M2U A;  2YQ3 A;  2E9T A;  1VK3 A;  5CD4 H;  2QMW A;  3M9M B;  3MEE B;  3BYP A;  4KY3 A;  3W66 A;  1RIS A;  3P45 B;  4LR8 A;  1NU4 A;  3A8E A;  3EGN A;  5D8H B;  5DJB A;  3GSI A;  2ZH9 A;  4LF9 J;  4PG7 A;  3MED B;  1TUW A;  4EEY A;  2ZZM A;  4RBU A;  3UQS A;  1OY8 A;  2ZWP A;  3W8G A;  2NXU A;  3R97 A;  4XPE A;  3T5H A;  2A0F B;  3RBZ A;  2UU9 F;  2ZWO A;  3ELH A;  3QMQ A;  1JLG B;  3MHY A;  3KHH A;  4L73 A;  2B7B B;  2OML A;  2AF6 A;  3L7O A;  1UFL A;  5GAG U;  3BGF A;  1U8W A;  5MAO A;  3CCZ A;  4IH7 A;  2FHO B;  4PYA A;  5HBM B;  4YY3 F;  4K4Y A;  2YNH B;  2UZA A;  3H7H B;  5CCM A;  2RS8 A;  2IYG A;  1RDR A;  4DL5 A;  1S6U A;  2OH2 A;  1GEH A;  1KLM B;  4WP8 A;  2ZDO A;  5D78 A;  1S1W B;  4E2F B;  1IM4 A;  5K8O A;  3TW0 A;  3I9Z A;  3R27 A;  3CC2 S;  3MAA B;  1U1L A;  4GKJ J;  3HHL D;  3SV3 A;  1OQ3 A;  1URR A;  3KG0 A;  3N6M A;  3PKY A;  3DRX A;  3QLH A;  5KG0 A;  3R9L A;  3NBP A;  1FKP B;  1KVK A;  1HA1 A;  3EDR B;  2HGM A;  1UMJ A;  3W9H A;  4B3O B;  3UW1 A;  1YWX A;  2YKQ A;  5D0H A;  5IXU A;  3K0J A;  1HNW J;  1GX5 A;  2C2M B;  3HHL B;  3M7V A;  5T41 A;  5D4N A;  4USM A;  1UCN A;  4DL6 A;  1FRI A;  4U95 A;  3K57 A;  1U6Z A;  1WTF A;  2K2P A;  5J1E A;  2DRA A;  4NXN F;  3IR7 B;  2UUC F;  4F2S A;  3FSY A;  4OX8 A;  4Y28 C;  2MKI A;  3W5Y A;  2Q66 A;  4H4M B;  5I42 A;  1ZTW A;  2Z2Z A;  1RKJ A;  2MZS A;  1VQ5 S;  4N47 A;  3H0P A;  2CPF A;  3CDU A;  1FX2 A;  4CYU A;  3OV7 A;  2JRS A;  1YBU A;  1HBN A;  1H72 C;  2RDJ A;  3Q83 A;  1H38 A;  3RB4 A;  1Q53 A;  4NXM J;  1RGV A;  1SL0 A;  3MR6 A;  2RML A;  4J9O A;  1R0A B;  3BKT A;  2GW8 A;  1C1C B;  1VRT B;  2FQQ B;  4J37 A;  1DFD A;  3KJV B;  4P72 A;  1X4G A;  5K5M A;  3GJS B;  4HDH A;  4HI2 A;  4ZVT B;  1Z2Z A;  2DJW A;  1HLW A;  3C15 B;  1RAC B;  4DN9 A;  2X1F A;  2IDE A;  3H59 A;  5B0E A;  1Q16 B;  2SXL A;  1ZAX A;  3QJP A;  3MD1 A;  3PFO A;  1WEX A;  3DGP A;  2CPZ A;  1N5Y A;  3GCW P;  3A3N B;  3L95 X;  2P5V A;  4OJ3 A;  1Y11 A;  4I6Y A;  1KHW A;  3V6K A;  3T5L A;  2BUN A;  3DMJ A;  4B9S A;  4JV0 A;  2VPZ B;  4FPI A;  4NLT A;  3U1M A;  5J2Q A;  2VFU A;  1CJV A;  3UNG C;  1GTH A;  4B9M A;  4NLP A;  2I5J B;  3K59 A;  2PC6 A;  4HHJ A;  3HXM A;  1D09 B;  3MM6 A;  4K4W A;  4NA2 A;  1RWN B;  3ZO7 A;  4F36 A;  3OLB A;  4RO0 A;  5AE3 A;  3CUN A;  1UA1 A;  1W26 A;  5CHC B;  5LMU J;  3I0S A;  5F9N A;  2WTF A;  2R2U A;  1VC0 A;  1A9N B;  1N4L A;  3AD9 C;  1T9U A;  3G6X A;  1Y3K A;  2D7S A;  1IKV B;  3CIM A;  2DNY A;  4UZB A;  2OEM A;  1WOP A;  3IS9 A;  2RU9 A;  3KUH A;  3N01 A;  4TU9 A;  3N28 A;  3TAR A;  2OPS A;  3OR2 B;  4TKT A;  2QX0 A;  4DL2 A;  1C1B B;  2IMW P;  5KTQ A;  2LEB A;  2H4W B;  1S1V B;  3M6X A;  5C2G A;  3MMC A;  1XQI A;  3I96 A;  4OHX A;  3J81 j;  5IC4 B;  4K0K J;  5KFX A;  2MKS A;  3OTO J;  5D4P A;  4WFZ A;  3TAM A;  1SV5 B;  4OHW A;  3SCL E;  2PI4 A;  5KG1 A;  1IKX A;  2E1P A;  3DLJ A;  1RLC L;  1UJ6 A;  4N77 A;  3QO9 B;  4MH8 A;  2YNF A;  3OFF A;  2OFG X;  1XER A;  1K9M T;  2QLJ B;  2FHJ D;  1C2P A;  4DHV A;  5ETQ A;  4DCJ B;  1S4F A;  7FD1 A;  1QAJ A;  2MKH A;  4R8U B;  5DLF A;  4MFB B;  3K17 A;  2GHP A;  2IAJ A;  2HG4 A;  4Q7A A;  4NPO A;  2LU2 A;  2YWG A;  3I5A A;  4K4V A;  1CC7 A;  3NAI A;  1FO1 A;  4I6A A;  3MI7 X;  5C2C A;  2KG1 A;  2BYC A;  2KH9 A;  1LWC A;  3LGM A;  2HNZ B;  1EAR A;  2DH8 A;  1UWB A;  2FVP A;  4KGZ B;  3ZTO A;  1N6Q A;  2DNL A;  1TKX A;  1UL3 A;  3DLL Q;  2VOO A;  3DLG A;  1NDC A;  1S12 A;  3KJF B;  2ZBR A;  3I4H X;  4MKB A;  1IKW B;  4BHQ A;  2FVQ A;  4IFY B;  2XC9 A;  3EUN A;  3O5T B;  2LXU A;  4HH0 A;  3IN5 A;  4YUD A;  2B8P A;  3OTC A;  3DOL B;  4DX8 H;  1NSK L;  4QYR A;  4ECW A;  4CTA A;  2Q79 A;  3E01 A;  2AV5 A;  5EHH A;  1YRT A;  5KT6 A;  1UEU A;  1C0U B;  2BE2 B;  1PYT A;  4QWA A;  1SVD A;  1FK9 A;  3WHI A;  3ILI A;  2DPJ A;  2ZVI A;  4FS1 A;  3TX8 A;  4RUB A;  1N36 F;  4IDK B;  1YQH A;  3RB6 A;  4OX6 A;  8RUC A;  2YWH A;  3H2U B;  3HM9 A;  3R1H A;  3DNC A;  3PR5 B;  1X0F A;  1XK8 A;  2DNM A;  3DDN A;  4QCL A;  4F0K A;  1RTI B;  3EYZ A;  4DSI A;  3BN7 A;  2HHP A;  3PW7 A;  2RH3 A;  4YP3 A;  3W5X A;  2BAN B;  1FNO A;  1PBA A;  3SQO P;  4FPR A;  2XUL A;  4DQP A;  4BWM A;  3AD7 C;  3PJW A;  4ZLJ A;  2BJ3 A;  2OD6 A;  1Y9O A;  3KLI B;  2R9L A;  1S1U A;  1KOH A;  2KTQ A;  3CJQ A;  4J9U E;  3TVK A;  5A8R A;  2DNO A;  1RAI B;  4C8O A;  1WC5 A;  4EO6 A;  5HMX A;  1VFJ A;  1KON A;  3M32 A;  2DNZ A;  1H6K X;  1SH3 A;  1UFW A;  2WON A;  2V67 A;  4KYZ A;  4LRD A;  1NKC A;  3EX7 B;  4PXC A;  1FT8 A;  3P8B B;  5K14 A;  3QSY B;  4QWD A;  5CQG A;  1S6Q A;  4N8O A;  4OYO A;  4JV1 A;  4LF5 F;  4C8N A;  2XZW A;  2B56 A;  1GFW B;  4FZV A;  2J7K A;  3ZZT A;  1UZH A;  2ILY A;  2DB1 A;  1Y3J A;  3E8O A;  3DOM A;  2AJ2 A;  3CDE A;  4ED4 A;  5HAT A;  5CZV A;  3BQ1 A;  1HW9 A;  2OP5 A;  4OMF G;  1HHS A;  1UAW A;  3MAQ A;  2VON A;  3NMR A;  3PX6 A;  3KK3 A;  5DZ6 A;  3OR1 A;  2E7W A;  3T6B A;  4LF7 F;  4Q2L A;  2HS0 A;  4J7C A;  5C7P A;  4GVB B;  4OI6 A;  4E8U A;  3CMA S;  4IRC A;  4ZP9 A;  2CNK B;  1KRP A;  3TUZ C;  4C3K A;  3V4M A;  4X62 F;  5A8W A;  5DRK A;  1B7F A;  2UVW A;  2CPX A;  1N5T A;  3MEG B;  3HSZ A;  1YRU A;  2QIF A;  3FKB A;  4NLR A;  1Y5N B;  2IRX A;  4BWJ A;  2H9Z A;  1VC6 A;  4TY9 A;  1WDT A;  2FHM A;  5AE2 A;  4C8K A;  4WBF A;  4RJV A;  1TK5 A;  1KNZ A;  1TUV A;  4C8L A;  1SB6 A;  3EJM A;  3N5F A;  4OX9 J;  1HNI B;  1PO6 A;  1AZS A;  2BKN A;  1JMT A;  1U1M A;  1FES A;  1U2R A;  4Q2M A;  2W2N P;  1RT4 B;  2F5G A;  4HAC B;  3AFG A;  1M5K C;  2WB4 A;  3G9C A;  3ETM A;  2EG1 A;  2B6A B;  2MZT A;  3KLH A;  2DHA A;  2DGX A;  3N0V A;  2H5I B;  2WOM A;  1LV5 A;  2F1F A;  5HJY A;  1ICE B;  4XK8 C;  3IMQ J;  4Y2I A;  3HLU A;  1EZZ B;  1EX8 A;  1L3V A;  4HKQ A;  2FPH X;  4RNN A;  4P73 A;  3X3U A;  5KFN A;  9ATC B;  2RU3 A;  3ENW A;  2ZH2 A;  1S9E B;  4IR9 A;  4LIW A;  1AW0 A;  3M30 A;  4X65 F;  1LWE B;  4L3K A;  2ZC3 A;  4NI2 B;  1MN9 A;  3DDK A;  1XMB A;  3CCE S;  2A18 A;  2JEI A;  1RXO B;  2BQU A;  3HVW A;  5C25 A;  3SQG B;  3CVK A;  1BC6 A;  2HEK A;  1VBK A;  4FS2 A;  2YQ1 A;  4NL5 A;  4AUK A;  4ZVR B;  4J9V A;  2DIV A;  2W25 A;  2QRR A;  2IJR A;  4K5R A;  3TR5 A;  2V94 A;  1RT7 A;  2R4F A;  4TY8 B;  4GKJ F;  4YB1 P;  2LEP A;  1RTD B;  4KTQ A;  1BQM A;  2VOD A;  1OWX A;  2CVE A;  1XIQ A;  4ZS6 A;  4EYH B;  3HFK A;  3T41 A;  4CWB A;  3AA9 A;  2VC0 A;  2NS1 B;  4HDG A;  4ALZ A;  1YTY A;  1M90 T;  2R2R A;  1TKT A;  2E1M C;  1K73 T;  3DCA A;  5L1L A;  2MDA A;  2KXF A;  3RJM B;  1HNW F;  3E3X A;  4J90 A;  5GMD A;  1RHJ B;  5DO2 A;  1SL1 A;  4IG3 B;  4IKA A;  1T02 A;  1CS4 B;  2JNJ A;  4OZ2 A;  3OL6 A;  2OIH A;  3G8T A;  2L3M A;  2Z2Y B;  1QTN B;  1S1T A;  4DUZ J;  1BLU A;  3GV7 B;  4YEA A;  4OYB A;  1RCX B;  3AHP A;  4WXW A;  4J91 A;  3TZX A;  3IRX A;  2V5H G;  5CD4 A;  2YKO A;  4NXM F;  4UW2 A;  3TWZ A;  1UTA A;  4U67 Q;  2XGP A;  4DV6 J;  2Z56 B;  1FDA A;  1S6O A;  2WVB A;  2QYG A;  4N5S A;  3PW4 A;  3PJX A;  1VC5 A;  1CLF A;  4ZPD A;  2HW3 A;  3DLE B;  1SL2 A;  1UJ4 A;  4H54 A;  1N52 B;  1GMW A;  4ID5 A;  3Q8V A;  4B3M J;  4PWU A;  2CRL A;  3QGH A;  1I1G A;  1HWK A;  5ETO A;  4URS A;  3BDP A;  5HMY A;  2J9D E;  2N3O A;  4CLT A;  1FEE A;  2QFI A;  3CWJ A;  2VFS A;  1RI7 A;  1TMM A;  9RUB A;  2HBZ B;  2WVC A;  4CNZ A;  1I94 J;  2RQ4 A;  4K8R A;  1NZA A;  3MM5 B;  1BQN A;  2F4V J;  3VAG A;  1RAG B;  2HKE A;  3PDN A;  2V4J B;  1BD6 A;  4LBP A;  2MQO A;  4P7V A;  3AXM A;  1NJX A;  3C14 A;  3UWT A;  3QID A;  2XSJ B;  3JQM A;  2AP6 A;  5LMU F;  2OMO A;  1C0T A;  1UWA A;  4QIE A;  2JH3 A;  2UXC F;  1CJK B;  1IKY A;  2D9O A;  1RWM B;  4HR2 A;  2B4U A;  2ZKU A;  3N5B A;  4DSL A;  1NEE A;  4C7Q A;  1RAD B;  3MPY A;  3DC2 A;  4YFU A;  1JB0 C;  3W63 A;  1VBZ A;  3MM8 B;  4C48 A;  2WSF C;  2AJ0 A;  4D3G A;  2FJE B;  4C3L A;  4RNM A;  2BVZ A;  1F2H A;  3PZP A;  2M7S A;  2UVV A;  4ZIT A;  2B4O A;  3D66 A;  4ZPT R;  1U2C A;  3LP0 A;  4PKD B;  2LXI A;  1YDL A;  2BR0 A;  4V19 X;  4USV A;  4K0K F;  2NXC A;  5BJR A;  1R3N A;  3IR5 B;  2V2Q A;  3N4W A;  2FJA B;  1VQP S;  1HQU A;  2VKR A;  1Y5L B;  4ZHR B;  1SIZ A;  1LQ9 A;  5BXI A;  1TFY A;  1J5O A;  4WXO A;  2RRB A;  2X3D A;  1REV A;  2QO3 A;  5KFQ A;  4WZM A;  4F02 A;  2AZ3 A;  3QAT A;  4AT1 B;  1K1Q A;  1R8H A;  2YWW A;  3R5G A;  4OYM A;  1NLK L;  4M5N A;  3KLG B;  2ZVS A;  2AD9 A;  3DKD A;  4O3Q A;  5SUH A;  4W92 B;  4QW9 A;  1TUG B;  2GAH C;  2LQJ A;  3DLK A;  2VQE J;  4JI4 J;  1KTV A;  2NSB A;  3THT A;  4WFB Q;  5IQQ A;  2B8Q A;  5A0Y A;  4LSL B;  3N6L A;  3TAN A;  1VQL S;  1E6Y B;  1Y4Z B;  2M8H A;  2YWF A;  2VB6 A;  2AX0 A;  4P74 A;  4KB7 A;  1X0P A;  1YVF A;  2PMW A;  3HO1 A;  3J81 U;  1SPB P;  4WPA A;  2K7K A;  3EVW A;  3SSQ A;  4K4Z A;  2YQ0 A;  2YX1 A;  4OFZ A;  2EW9 A;  2CJB A;  2MHN A;  1B0V A;  3HSD A;  4DL4 A;  3T9Z A;  1RAB B;  2POK A;  3BSC A;  2XI3 A;  2CQG A;  1U45 A;  3SCK E;  3ISZ A;  3CD5 A;  4PPD A;  3GR0 A;  2DIU A;  1ZBT A;  4QR1 A;  4DR3 J;  1AXQ A;  3NS7 B;  3CTR A;  1FRK A;  4CO0 A;  1AUD A;  2ZJP Q;  5ITH A;  2VQF J;  1H7X A;  3JTN A;  2GIF A;  3CW2 C;  1MWQ A;  4NCB A;  3ZZY A;  2QA4 G;  1OYD A;  3D2W A;  5IZH A;  4RU9 A;  1RT3 B;  2DHX A;  1X4H A;  3BH7 B;  4JOU A;  2HFU A;  1KKH A;  4J5O A;  1UVL A;  3EZU A;  3PIO Q;  5AXN A;  5IT9 U;  4N7T A;  2G4B A;  3L7U A;  2CNO B;  1R31 A;  5F8N A;  4O4G B;  4P6Q A;  2I8E A;  1YLX A;  2KN4 A;  4P71 A;  4JI8 J;  3UE2 A;  3EZO A;  1GT8 A;  1XBW A;  4AXJ A;  2DR5 A;  2XWY A;  4RW6 A;  1IBC B;  1SIW B;  2E5H A;  4I2P B;  1NJZ A;  2UXD J;  3NS5 A; 
#chains in the Genus database with same CATH homology
 1K44 A;  3EJM A;  3EIC A;  1VYA A;  3BBC A;  1B4S A;  5CAA A;  2VU5 A;  2HUR A;  4CP5 A;  1KDN A;  1WKL A;  3B54 A;  4UOF A;  3BH6 B;  4ANC A;  3FBC A;  4ENO A;  3VGS A;  1BUX A;  3VVT A;  1NDK A;  3Q86 A;  3Q89 A;  3Q8Y A;  2DXD A;  1NDL A;  2DXE A;  3MPD A;  1ZS6 A;  3FBF A;  3EVO A;  2AZ3 A;  2DYA A;  2B8P A;  1WKK A;  4W98 A;  2CWK A;  1XIQ A;  3ETM A;  1NLK L;  3Q83 A;  5CAB A;  3ZTP A;  2HVE A;  4HR2 A;  3VGV A;  4F4A A;  3PJ9 A;  1W7W A;  3PRV A;  1BHN A;  1NSK L;  3Q8V A;  2ZUA A;  4F36 A;  3NGS A;  3DKD A;  4EK2 A;  4UOG A;  1S5Z A;  1B99 A;  4O0N A;  5C7P A;  3JS9 A;  3VGU A;  2DXF A;  3BBF A;  3EM1 A;  2DY9 A;  3BBB A;  3B6B A;  1NSP A;  1NCL A;  3ZTR A;  3NGR A;  1S57 A;  3ZTQ A;  3FBB A;  4FKY A;  1NHK L;  1LWX A;  3BH7 B;  4C6A A;  3VGT A;  2HVD A;  2B8Q A;  1HLW A;  4DUT A;  1NSQ A;  3GP9 A;  3R9L A;  3WX8 A;  1F6T A;  1NUE A;  3FBE A;  3FCV A;  1MN7 A;  1WKJ A;  3FKB A;  3L7U A;  3Q8U A;  3NGT A;  1MN9 A;  3FC9 A;  3GPA A;  1HIY A;  3NGU A;  3EVM A;  3VVU A;  1PAE X;  4S0M A;  3ELH A;  4FKX A;  3ENA A;  2AZ1 A;  3EVW A;  3ZTO A;  1HHQ A;  5IOL A;  3EE3 A;  1BE4 A;  4ANE A;  1NPK A;  3G2X A;  3ZTS A;  1EHW A;  3FCW A;  1JXV A;  1LEO A;  1NB2 A;  4DZ6 A;  3EMT A;  4WBF A;  4KPC A;  1PKU A;  1F3F A;  3DDI A;  1NDP A;  1U8W A;  1NDC A;  1UCN A;  4DI6 A;  5BXI A;  2BEF A;  2BX6 A;  4AND A;  4UOH A;  1S59 A;  1XQI A;  2NCK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...