1NO8A

Solution structure of the nuclear factor aly rbd domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
GKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords ALY
publication title Structure of the Nuclear Factor ALY: Insights into Post-Transcriptional Regulatory and mRNA Nuclear Export Processes
pubmed doi rcsb
source organism Mus musculus
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1no8A00
1WHYA 5GAGU 2PEHA 5IM0B 1KOHA 2OIHA 2E44A 3EGNA 5IQQA 2JWNA 2XS7A 3CCMS 2DIVA 2LECA 1U1NA 2MYFA 2MZRA 2FHOB 2LXUA 1VQPS 1W2BR 1WEYA 5GAHU 3ZZYA 1VQOS 3UCGA 5CYJA 5DDRC 1DBDA 1F9FA 2MKSA 2RQ4A 1HA1A 3SXLA 3VAGA 1HL6A 2DNKA 3RW6A 4TU8A 2M8HA 5JVGQ 2M52A 3P5TL 1X5OA 2KFYA 1OWXA 3RW7A 1Q86T 4LIRA 1A7GE 2ERRA 2MJUA 3CC4S 3CMES 3I56S 4F26A 2VODA 1D8ZA 2GO9A 3CPWR 2CQ1A 4PKDB 1U1RA 4CH0S 2ZJRQ 1YJWS 3CCQS 2ZJPQ 2UP1A 3NMRA 2DISA 3R1HA 2LXIA 2DK2A 3N9UC 1O0PA 5LJ3Y 1AUDA 2VOOA 2CPFA 4WIIA 4IUFA 2DNLA 3P3DA 2YKAA 2CQBA 2D9PA 2ADBA 1X4EA 4C0OC 2DB1A 3H2VE 1PO6A 1FJ7A 3IRWP 2M2BA 4QU6A 3MI7X 4CH1A 2M88A 2MQOA 4WFAQ 1NJIT 2KG1A 2DHAA 2ADCA 2JX2A 2XSFA 2MXYA 2DH8A 1H6KX 1N52B 1M5OC 3P6YC 2MZQA 2YH1A 1VBYA 2OTJS 5LJ5Y 3G71S 1D9AA 1UW4A 1L3KA 3CCSS 3J7YU 1DHMA 2LEAA 2CQCA 3MD1A 3MDFA 4QPTA 2JRSA 2MQMA 2EK6A 3R1LA 2HGMA 1M1KT 4UQTA 2RVJA 3CCLS 5LSLA 4FXVA 3OW2R 3UD4P 2KXFA 3UE2A 1FT8A 2U1AA 2DO4A 2CPYA 2RNEA 3BS9A 4CIOA 2L08A 2KM8B 1VQMS 3VAIA 5HO4A 3CTRA 3R27A 2FC9A 2F9DA 2DNHA 2MQNA 2DNYA 2CQ0A 2FY1A 1M5KC 2FPHX 1JJ2R 2E5HA 3FEXB 3UD3P 1Q82T 3U1LA 5IFMA 2DITA 2LMIA 3J7ZT 2N3LA 3NS5A 2M7SA 1QVFR 3U1MA 3PIPQ 1SJRA 1JJHA 3MUTP 1XN9A 5FJ4A 2JVOA 1P27B 2RS8A 1SJFA 1U6BA 5CA5A 2XS5A 1UAWA 4WKRA 2PE8A 4M5DB 2MKIA 3VAFA 2DHGA 2MZJA 1B7FA 1UP1A 2CQ2A 4Z2XA 1H2UX 2LYVA 2FC8A 2HVZA 4ZKAA 3TO8A 4P6QA 3LPYA 1G2EA 2CQ4A 2GHPA 2HGLA 2CQDA 1A9NB 5GAEU 3VAKA 2XNRA 5DDQC 1YWXA 1WF0A 2MQQA 1U1LA 1QVGR 2KN4A 2DH7A 1SJQA 2DGQA 4Y0FA 2VOPA 1YJNS 2DNMA 3MOJB 3MXHP 3CMAS 1FNXH 1ZZFA 2G4BA 2CQ3A 2EVZA 4QU7A 1Q81T 4TU7A 2MZ1A 2N82B 1YIJS 1WHXA 3UWTA 3S01A 3B4MA 4Y00A 3ULHA 4OZ1A 1S79A 2KRRA 2AYEA 1WI8A 4W90B 4EGLA 3CCVS 1WI6A 4TU9A 1X4FA 3S7RA 1PGZA 5BJRA 1H2TZ 2CPHA 3G6ES 1Q7YT 2CPIA 2OTLS 2YTCA 1K9MT 3HHNB 2YH0A 1U2FA 3BO2A 1FHTA 3Q2TC 5DETA 1R8HA 4PR6A 1RK8A 2KG0A 3MUMP 3NNHA 3CXCR 1WG5A 3H2UB 4OZ0A 3THTA 5LXRA 2I38A 1OO0B 3LQVA 3ZZZA 2DNZA 2KU7A 2EK1A 1VQKS 1X0FA 1N54B 1CVJA 1RKJA 2MZSA 5IM0A 3G96A 3CD6S 4RU2A 5HL7Q 1K8AT 1BY9A 2CPZA 5GMKa 2OSQA 1VQLS 1QM9A 3G9CA 3UCZP 1ZZNA 1X5TA 5DM6Q 1VC6A 5EN1A 3BO3A 3NS6A 1VC5A 2D9OA 2DGUA 2MY8A 2MKCA 2CPEA 1YJ9S 3TP2A 2DNNA 3DXBA 4U67Q 1JMTA 3D2WA 2HYIB 3VAHA 1YHQS 2DGOA 2ZJQQ 1N8RT 2HGNA 2VONA 3S6EA 3I55S 5JVHQ 1DZ5A 4IOAQ 1M5PC 3VALA 2MSTA 1VBXA 4W92B 1U1PA 4CQ1A 2DHXA 4F25A 5GVQA 1M90T 2DNQA 1OIAA 2RRBA 3CULA 2DGXA 1N88A 1IQTA 2CQHA 2MHNA 3CCRS 1M5VC 2RS2A 2F9JA 3EGZA 2CPDA 1X4AA 2MPUA 4IO9Q 2LQ5A 2MKHA 5LSOA 2XB2D 2KI2A 3BEGB 5CXTA 2N3OA 3CUNA 2O3DA 1VQ9S 3HI9A 4FXWA 2DGTA 2NZ4A 1X4HA 3G4SS 2LEBA 5LXYA 2QFJA 3CCES 3B4DA 1HD0A 2F3JA 2X1AA 3TYTA 2RRAA 3IWNC 1X4DA 1NO8A 2V94A 3PIOQ 1VQ4S 1KD1T 3Q2SC 4YOEA 4BS2A 2E5GA 2QA4S 2K8GA 2AYGA 3VF0B 3CF5Q 1JJ4A 4QQBA 5DDPC 4UY8T 3K0JA 1WEXA 1U1OA 2E5JA 2CPXA 1WHVA 2KXNB 2L41A 5D77A 1SXLA 2DNGA 4ERDA 1DRZA 1VQ6S 1ZH5A 1KOOA 2MGZA 5H1SV 2RUGA 4IOCQ 1H2VZ 2DH9A 1FJEB 3US5A 4WFNQ 2M8DB 2N7CA 3S8SA 2MKJA 2MQPA 2DGSA 2M4MA 3G8SA 2CQIA 2CQGA 2AYMA 2MY7A 3SDEA 2DNRA 1WG4A 1VQ7S 1U1KA 1SJ3P 1X4CA 1OPIA 3EX7B 2X1BA 2G0CA 3MURP 2DHSA 2BZ2A 1KC8T 2MQLA 2NLWA 2LKZA 5MLCV 4A8XA 3NNCA 2OJ3A 2DIUA 2J0SD 1X4GA 2KVIA 1URNA 2D3OR 4C7QA 4WF9Q 2KM8C 3L3CA 1UFWA 2J8AA 2MSSA 2KXHA 1FO1A 3VAMA 2A3JA 2RU3A 2DGVA 3CC7S 1U1MA 3SMZA 2E5IA 1YITS 3MD3A 2DNPA 3P49B 4YUDA 2B0GA 1SJ4P 3JB9k 1KQSR 2MJNA 2OSRA 4WFBQ 4V19X 2CJKA 5ITHA 1WEZA 2L9WA 1P1TA 1WHWA 3BO4A 2X1GA 2BOPA 1NU4A 1WF1A 3NNAA 1X5PA 2M70A 4WCEQ 3VAJA 4F02A 4C4WA 5DM7Q 2MKKA 2LCWA 1U1QA 1VC0A 1WWHA 2DGWA 2I2YA 2LA4A 2M0GB 1WELA 1WTBA 2RQCA 2LA6A 4YB1P 1HD1A 3MUVP 1VBZA 2M9KA 2KRBA 3CCUS 2KH9A 2Q79A 2J0QD 2K3KA 4LJMA 2DO0A 4LMZA 1U6FA 2J76E 1FJCA 3G8TA 2U2FA 1WF2A 2MGZB 4PRFA 4ED5A 4J5OA 2WBRA 1R8PA 3THPA 2AD9A 2HZCA 2SXLA 1WG1A 2KYXA 2CQPA 3FEYB 3CC2S 1VQ5S 1VQNS 1FXLA 2XS2A 2AYBA 5DDOC 3V4MA 1YTYA 1X5SA 2KHCA 2MZTA 3SDEB 2G1DA 2DNOA 3UCUP 1K73T 2QEXS 1VQ8S 5GADU 2MMYA 2YWKA 5D78A 1X4BA 2MB0B 1YI2S 3DLLQ 1S72S 2JVRA 2XNQA 2X1FA 2KT5A 3CCJS 4TLQA 2RT3A 2CPJA
chains in the Genus database with same CATH superfamily
4F0HA 3D4JA 4A8YA 4F4WA 2VU5A 3NGUA 2H4YB 1Q8KA 2LECA 1U1NA 2FHOB 1PJ5A 3Q86A 3G6VA 4L76A 2BJDA 2K1RB 2KVQE 3HVAA 3V4IA 1Z2ZA 3TVYA 2NXUA 4JV5J 3IBCB 1FDBA 2OMOA 2UXBJ 2L9NA 4P2MA 1S6QA 2FTRA 1A7GE 2JDJA 3FGVA 1MMDA 1GH8A 4ZVOB 2H5JB 3AOAA 2F40A 1NZ8A 1TMMA 4AL7A 3FSXA 5KG3A 1BQXA 5AXMA 2XGQA 2D9PA 2JJ4D 4B9UA 3GU0A 4WFAQ 4KV8A 2VQEF 1RHJB 5K8MA 4ILLA 4X66F 1Q79A 4KSEB 5D8HB 1EHWA 2KJVA 1U02A 4OI1A 1N32J 2XMMA 3BS9A 1VJWA 3FMWA 3RAXA 3R3TA 2DNHA 4DL5A 3IGNA 3KLFB 4JV1A 2FY1A 3BR8A 1S9GB 2AKWB 4QWDA 3W5YA 1UJ4A 1TAUA 2NSBA 3DN9A 1C1BA 5ETNA 1GMWD 4NXNJ 4X4QA 4C8OA 3KHLA 1IR1A 5L1KA 3TUZC 1EB0A 4TKTA 2GGPB 3AOBA 3DYAA 4EU0A 1FFGB 2ZE2A 2CQ4A 4H54A 2QT7A 3Q23A 1F9HA 5F9NA 3NAHA 2R2SA 2B4VA 3OVAA 2VOPA 1RUSA 3FFIA 4LSLA 4DFPA 2G4BA 2AX1A 3GJRB 2E9ZA 3FZBA 3H5XA 2PFFB 4OZ1A 2HVHA 1HMVB 4IKAA 4K4XA 1IBKJ 1QAXA 2V2ZA 2YH0A 2J0XA 3GSDA 1U2FA 5KT3A 5J2PA 1HLWA 2AF6A 2FVRA 3BGUA 2BW2A 5C25A 2XQCA 1ITPA 1VQKS 3E01B 1CVJA 2YNIA 4WPAA 5IM0A 1TUVA 3OTDA 2YWFA 2D69A 3E51A 2HS4A 4AL6A 4GRSA 1U8WA 1X7VA 1UZHA 2FHKA 4FF1A 2D3UA 2ZKTA 2DGUA 5KFZA 3TUPA 2LLZA 5HK4A 2WONB 2KJWA 1RAJA 2E1CA 3DGPA 1RAOA 2ZNYA 2ZHBA 1ZM3A 3GJSB 5K14B 1UEKA 3HHLA 1NSKL 1NM2A 1IQTA 3FBCA 2MPUA 4DPOA 2KI2A 2GVDA 4DU8A 1WNEA 4MK9A 4M5LA 2FVPA 3G82B 2HBQB 3J7YI 1R0BG 3FNNA 1T03B 1HD0A 4KY3A 4B3SF 3OFHA 5KFVA 3OJUA 2DY1A 4IG0A 1TV6A 2OUGA 5KTQA 4UY8T 3MEKA 3UDCA 4OHVA 1RCOB 4OHZA 1NSQA 4YHHF 2Y0SD 4GVBB 4WFNQ 1LFWA 4UUXA 4GVLA 4X4PA 3SQOP 2AYMA 2DNRA 1SJ3P 3H25A 4ID5A 2G0CA 2DHSA 3LW5C 4LFBJ 3W61A 3NNCA 2W8KA 2HVDA 2JNJA 3HFZB 4NLTA 4NMXA 1TZ0A 2J8AA 4OX7A 2YKQA 3B82A 4K4VA 1H7WA 1QAIA 2VPZB 3UVJB 2YKOA 4LVOP 3BYRA 4PG7A 4RLEA 5LMNJ 2CJ9A 1S0NA 4ED3A 1CC8A 3GFHA 3BO4A 4KPCA 4IYQA 1LQ9A 2MLZA 1JNRB 4BDPA 3EPIA 1WOSA 3QFHA 4ETXA 4ANCA 3UNGC 4O44A 3GIIA 4AE5A 3PYEA 4PAAA 1GFWB 2J0QD 4RZRA 4H4OA 1NK5A 3D68A 4LMZA 4KAIA 4ED5A 3ZC4A 3CNQP 2WBRA 1HNWJ 2VFRA 1LXNA 3Q22A 5HVFA 2YNFA 5DDOC 1HKAA 2YX1A 4DR1J 2HIYA 1IXKA 1CJVB 2ZM6J 2P9GA 2JVRA 2R7QA 5AXNA 1EETA 4OZLA 2Y1JA 4JI4J 4U95A 5CYMB 2IY5B 5M2PA 3MM6A 1B99A 4Y2IA 5SZTA 1FFWB 2YNHA 5HROB 3A8IA 2DNKA 2KFYA 5D6GA 2UXCJ 3HXMA 4DSJA 4WZMA 3I56S 4K4ZA 1IJEB 3KJVA 4M5DA 2ZJRQ 5IZHA 4D3GA 2QMUB 4Q43A 1YKWA 2VG5B 1TP7A 1KQGB 4WIIA 5F3ZA 3P3DA 1EJ7L 4C0OC 3MM7B 2EFNA 1NJXA 3AT1B 3W60A 1SBRA 3DRPB 4FS1A 5F3TA 2HFVA 3UDEA 1D9AA 4C98A 1VFJA 3CCLS 4K4SA 1KONA 4MAKA 2CPYA 1JX4A 3VVUA 1CJUB 5C24A 4TY8A 3ETOA 4N8NA 4USIA 4DR6J 3OQ2A 2GNKA 5IFMA 1EP4A 2EW9A 5I3QA 2C3YA 2J6SA 3MR3A 1GTEA 4X4SA 3GWCA 2UV8A 1FFSB 2VJVA 4R8UB 2GHPA 5H9EJ 2C3OA 3OR1B 1CQMA 4U9RA 3M9OB 3GONA 3BH6B 1FWPA 2B9XA 2YVSA 5AE1A 3MF5A 5THWA 2OELA 4QU7A 2E9TA 1ZA2B 4N56A 4DL0C 1OS5A 1FRHA 4DR5J 1MWYA 2IBKA 1FE0A 3T1YJ 4YEAA 1PSDA 4N41A 1QDUB 3QGGA 3Q2TC 3NWRA 2WVFA 3DOLB 2Z4PA 4EZ6A 3I5CA 5GAHI 4UTGA 5K9FA 5HMWA 2MZSA 1TL3A 4KTQA 1TKXB 5HBMB 3J80Y 3EM1A 2HVIA 3NS6A 1DY3A 4A8SA 4OQJA 1IM6A 4ILRA 5CAAA 3UDVA 3SFGA 1FWKA 2PC6A 5ETOA 3C2PA 1R0AB 2O66A 4RR5A 2XBPA 4IOAQ 4CDIA 5H9EK 1RWKB 1OY9A 3PX4A 3UI3A 2CWXA 4K5SA 4NLUA 4AXJA 3HHKA 1LXJA 4DOZA 3CUNA 1RI7A 2V0NA 4ZP9A 3CIZA 3UQSA 3JS9A 3PNIA 2IVMA 1R8BA 4CZCA 5SUHA 3R6GB 4LR7A 2ZBIA 3O44A 1EKSA 4QR1A 3QO9B 3I9ZA 1B64A 1XTZA 3VF0B 3BSAA 5B0CA 1U1OA 4B9TA 4GKJJ 3RB4A 2HQIA 4LT6A 4DQRA 3ET6B 2I0XA 2HNYB 4PYAA 1LWFB 3PRVA 1J5EJ 3FQLA 2DH9A 2ZWOA 2MQPA 5IT0A 2DCLA 3TJ9A 4XPCA 4LFCF 4F4KA 1V3SA 3PY8A 3LH2S 1X4CA 5HMXA 1RWPB 1XMOF 4ZLLA 3OUYB 1GMVA 4NA3A 3RB0A 3F41A 2YXLA 2MSSA 3Q8QB 5LMUJ 1K1SA 1LWEA 4CO3A 4CLUA 2YKPA 4O3OA 2A1BA 2W4CA 3MD3A 2J9DA 3P49B 1HR0J 2ASYA 1V3ZA 5KFQA 4ZS6A 3M30B 1Y10A 2MJNA 4MK7A 1RWMB 9ATCB 2B5JB 5C42A 3R7SB 3LUYA 1S1UA 5IT4A 1E6YB 4MFBA 3FBFA 4YDXA 2C2RA 4LF9F 2ZNZA 1VBZA 4DR7J 3CCUS 4C2MA 3DRYA 3GG0A 2YKNA 3LP0B 2R8GA 5D3GB 3M8PA 2CG4A 4OIXA 4Q2LA 1HW9A 1S72S 4N5SA 3K5NA 1NK7A 1SB6A 4IG3A 4KKOA 4EBEA 2WB1D 3I0SA 2IIHA 2XO6A 4DUYJ 1R31A 1WC4A 3GYNA 1HBUA 3UCGA 1JXEA 1Z2LA 4C8LA 1U2RA 1QE1B 1ZA1B 2EG1A 1Q86T 4JI8F 3ELHA 1FRKA 3F0NA 4DR2F 4F26A 5FD1A 1RT7A 1RBLA 3DRRB 2VA3A 1J2VA 5E2QA 2AGOA 2AX0A 1REVA 3RRGA 2CFXA 2YWEA 1B0PA 5LJ3Y 2HQGA 3IBFB 7FD1A 2DPIA 3H8YA 2LVWA 2MQOA 3QIDA 3EMTA 2ATCB 3QYYA 4DI6A 2XSFA 1RADB 2BDPA 3RAMA 2IVYA 1XERA 2BKPA 1KNZA 2KL8A 3MEGB 3EVOA 1SH2A 4HYKA 4WTYA 3RBEA 4QYRA 5J2QA 1VQMS 1Z4UA 1KP6A 2BW7A 4FNHA 5KG1A 2F9DA 3HLUA 4B9MA 1S12A 2FPHX 3QNWB 3M1VA 2RDDA 1PBAA 1SJRA 4X66J 3T5KA 2HBZB 3CB4A 4DFMA 3V81B 4CRJA 2PA8D 4HH0A 1U6ZA 2CJBA 4ECZA 2HNZB 4FYWB 3VHQA 4Q7AA 4DQQA 2VG6A 3C8YA 5E33A 3EPGA 2HS0A 4G1QA 2QL7B 3OD2A 4OJHA 2HLTA 5F8JA 4OYXA 2B7CB 2HMIB 4IFVA 3K57A 3HKWA 1FERA 3UWTA 2ALZA 3JQKA 2FJAB 5DLGA 1PILA 1D09B 1UVJA 3DOMB 3KHGA 1FKPA 4D3HA 1HBOA 2WW4A 2KG0A 3MUMP 3V5RA 4X4OA 3UO0A 3KXDA 4JI2F 3R5DA 1Q0NA 3ZZUA 3G9CA 5IS2A 3N5BA 2BM1A 3IM8A 1AZSB 3QIPB 3TANA 5E3PA 1YJ9S 2DNNA 4ECTA 4LBHA 1IWAA 4M5JA 2XZDB 2DGOA 3FSIA 3BSCA 3I55S 4N47A 2H5IB 3VALA 4MKAA 3QWUA 4RNNA 3BREA 3MGJA 4YB5A 4PYDA 2CVIA 3X3UA 5LSOA 1L3UA 2QV6A 1BWEA 1LW2B 4DV2F 3G4SS 2HBYB 1U24A 2BE2B 3BJYA 4E2FB 2AYGA 5MAOA 5CZVA 4ICLB 1JLCA 2V8PA 2G0IA 2DNGA 3CT9A 3L9ZA 3C19A 3I32A 2RUGA 2Q1LA 4G1IA 1LKZA 2R42A 2F4VJ 1U25A 1NH8A 4X84A 4F7VA 2HIQA 4DV0F 4Y3CA 3LP1A 2C1EB 3FKBA 2ZBPA 3ZXWA 4A8XA 5GAEI 3MM8A 2KVIA 3W7BA 1PCAA 5AJ3F 3L3CA 4YHHJ 1K0TA 2GA7A 2KXHA 3QT5A 5KG5A 2A3JA 5HMYA 4J9MA 1VLOA 1F9EB 3C6UB 1YITS 3CJQA 4K4TA 2HHXA 2FDNA 4ZA1A 1DFDA 4I2QA 2BA9A 1WHWA 2LQBA 1NK4A 1KTQA 5KFYA 1GAOA 4HDHA 5KFFA 1RT2A 2LA6A 3QZ8A 4NOHA 2VKZG 1FJCA 3LALA 4FZVA 3G8TA 3AHPA 3BN7A 1R8PA 4PPZA 3CD0A 3HFKA 1VQ5S 1EZZB 2EPIA 4OHXA 4A4JA 3Q89A 5HLFB 4X4NA 1U7LA 1AYEA 4Q45A 4PXBA 4ECSA 2AGPA 5EX0A 1JLEA 1Y9OA 2R3VA 5M2RA 4CLFA 1WACA 2CPJA 1KOHA 1UMJA 2JWNA 3PW2A 3GLJA 1XMQJ 2PSZA 2RILA 1WEYA 3MAAB 3DLJA 3MTJA 4LRAA 5KFBA 2HLUA 2RQ4A 1KVIA 3VAGA 1QSSA 1XK8A 2EC0A 5KFTA 3BBFA 3HT0A 4G3IA 3A8KA 1X8DA 2CUYA 1IBMF 3CC4S 1NDCA 3ZNUA 1MROB 3ZTOA 1D8YA 5T7LA 3MCMA 1JKHA 4TNOA 4PKDB 3KK1B 2LDYA 1IKWB 2WOMA 4WFYA 1RTJA 2OEJA 3D0HE 2BOAA 1OSCA 6AT1B 3W5ZA 4CH1A 2QA1A 2DHAA 5IWAF 2JX2A 4DQIA 2VBZA 4C3KA 3NG8A 2UVRA 4R0JA 1RWXB 3MM5B 5L38A 5KFPA 2LEAA 2CKWA 4LFAF 1M1KT 2KT2A 2GS8A 2R9LA 2E7WA 4CIOA 2UUCF 3R27A 2FC9A 1RISA 1C0TA 4Q0BA 4DU7A 3M2RB 1UVMA 1JJHA 3MMBB 3LOUA 2UZAA 1H74A 1HI1A 2VBXA 2PMHA 3CJ2A 3PYDA 3ENQA 2PE8A 1PAEX 5L46A 1NK8A 3OJSA 4FXDA 2W2NP 3W8PA 1FF2A 5A8WA 1NK0A 4L72B 2WSCC 4PZVA 5FLXY 2JEIA 3P45B 4JI6F 3NGRA 3POTB 3PFOA 3H7HB 4MT1A 5GADI 4Y00A 3ULHA 4FKXA 5G0RA 2DY9A 1WJ9A 3HP6A 5HJXA 2XSJB 3BO2A 2ZOMA 4DSIA 1KFSA 1FRLA 1NSAA 5EWGA 1RKJA 4JI3F 3C14B 5J2MB 1K8AT 2CPZA 1CJTA 1RT6B 2OSQA 3OXGA 1OY8A 2HK3A 4WK1A 5DM6Q 4BC9A 5D4OA 2CA9A 5CQGA 4M95A 4Y2KA 4USWA 2W9BA 4F67A 4Q8FA 4HH1A 3KJQB 4P2FA 5IT9U 2V9WA 4ATNA 3A3OB 1RWUA 1WOOA 1RHQB 2RKIA 3MR7A 3ENVA 4RW7A 1M90T 4WTOB 1M0SA 1IKVA 4QIWD 4J9NA 3OTBA 3IRXB 3SI8A 2O3DA 5F8IA 2CNNB 1S9EB 2BQ3A 1F3FA 1RYSA 1RHMB 2HRYA 3BGRA 4HACB 1X4DA 4O3PA 2V94A 2AEJA 3PIOQ 2VKRA 1DQ8A 4J9SA 1N56A 4BS2A 2E5GA 2EI5A 1Y5IB 3W8GA 2EBGA 3DRXA 3VR1A 2KB2A 2HEKA 2V6AA 1NK6A 1SL2A 3H4DA 3NBPB 1HNIA 5H1SV 3GILA 3M2VB 1RT3A 2V4RA 4F4YA 3S8SA 2GZOA 2NPFA 2E5LF 5KG2A 3H59A 4RU9A 2D7SA 2BZ2A 3Q8VA 5J1EB 1NEEA 4ES1A 2H51B 2RQKA 1VQSA 1MLAA 3VAMA 1RACB 2A2DA 1SCJB 4LFCJ 3N28A 1XMOJ 4BCAA 2WSEC 1VK8A 1UPPA 3DM2B 4RL1A 4XTTA 1WF1A 4DSEA 2WCXA 1HYSA 1V3RA 3KK3A 4G65A 3OFEA 1U1QA 4B08A 1WELA 2JC0A 4K4YA 3JSMA 1S77D 4LJMA 4C0HA 2MGZB 1IBLF 5A8KB 4J5OA 1FJGF 1JLAA 2NXJA 3THPA 2HZCA 1ICEB 4ZCMA 1HQEA 1S4EA 1NH7A 4R5PA 2G1DA 4LF9J 1LWCA 4ZVEA 1VQ8S 2ZHOA 3H5SA 3MMJA 5C25B 2G9OA 1T3NA 1UKUA 1WHYA 3DOKA 5IM0B 3DLHA 2GAHC 2GVZA 4K2JA 3GR0A 3BKUA 2XMKA 4X4TA 1SQGA 3NEKA 5DO2A 3TRGA 4JB8B 1VQOS 2JH3A 3N6LA 3ISZA 3GZ7A 2YPZA 2E7VA 3RW6A 3HFVA 1QTMA 1TKZA 2L3MA 2FJXA 1VRTA 4YP3A 5CABA 2MJUA 1JLQA 2VQFF 4RBUA 4UOFA 4ZPCA 2I5JA 2L48A 2CQ1A 2JEJA 4WU2A 2VV5A 5I3UA 2C2ZB 3CDAA 1GMWA 2CPFA 5KG4A 4K2XA 4IUFA 4WIQA 5E7OB 2VICA 1EARA 4DR2J 4CNZA 3IRWP 2NPIA 3KLGA 3M8QA 1KRPA 2OPPB 3M9MB 4KPYA 3P6YC 4B3RF 4ZCKA 1XQIA 4ED6A 1TV6B 1RB0A 5AE2A 4FF3A 4MYUA 2C2MB 1Y0HA 2RVJA 1U45A 3M2UB 4UUWA 3UD4P 1FTRA 3NOCA 2XMTA 2B9YA 1SUQB 1F3VA 3J7Z5 2C2EA 3UD3P 1VRUB 3GSIA 4JI0J 3GV8B 1VYAA 1RT4A 1UAWA 2DHGA 1UJ6A 1NDKA 3J81U 1BQMA 3ZZOA 1Y7PA 5FDLB 3TO8A 1PBUA 2H5EA 1TKTA 3MPUB 2HNDB 3M7VA 2QLFB 4YQWA 1F60B 3TZYA 3C6TA 4RUHA 3I82A 1JB0C 4H4MA 3PEJA 3Q24A 4AFFA 2MZ1A 1QUVA 4DL4A 1YZ6A 1T94A 3L7PA 2F5GA 4EGLA 2Y3YA 4O0IA 4AL5A 2H1YA 5BJRA 2C2DA 3NCRA 2COLA 3FVYA 3ILOA 1C1CA 2CVEA 2EK1A 3RYLA 5KT2A 2YNGA 3BKTA 2CADA 5GMKa 1RBAA 3GJQB 3PKMA 5EN1A 1R0CB 2ACMA 4WYLA 2D9OA 2MY8A 4MK8A 1DQAA 3KG1A 4Y6IA 2AHOB 4DG1B 1KVJA 3L7OA 3PR4A 4OYZA 1RWWB 4P71A 2HGNA 2VPYB 4W92B 1U1PA 1S6OA 1RDRA 2XYPB 1REGX 2Q6CA 2APOA 3GP9A 1WKJA 1M5VC 2CPDA 5KOWA 1D3WA 2BBEA 2E1PA 2IFXA 2BQUA 4U7CA 1KQKA 3LP2A 4B3OB 3NCPA 3CDBA 3GG1A 5L1JA 2E29A 3OSPA 4LF5J 5G4DA 4TY9A 5LXYA 3CCES 1S6PB 5E41A 3V6DB 1R8AA 4WXOA 3HMJG 4YOEA 4JYAF 3E3XA 4CM2A 2FZCB 3K5MA 3PDNA 3C46A 2CPXA 4ETZA 1DRZA 1G7CB 5KG6A 4DV2J 4USMA 1KHWA 4LF2A 3AD9C 1HBNB 3MECB 2N7CA 2ZH8A 2M4MA 2CQGA 4PUOA 2Y1LB 2HHQA 4XDCA 2XY5A 2NLWA 1RTIB 2O01C 5HQLA 4TY8B 1PKUA 2OH2A 4PWUA 3TUJC 4NZ6A 4V1Ak 1HWUA 2OEKA 1RSCA 3IWLA 2V2QA 1FVQA 1AT1B 2I9SA 1WKLA 3DXSX 4QW8A 3CDWA 3BN4A 2D3O1 1SC1B 1ZPWX 2B0GA 1KQSR 4AUKA 5AJ3J 2IRUA 2BOPA 1CULB 4CLLA 4BHQA 4I2PB 4KFBB 5I42A 3OTEA 3A8EA 1YLXA 3SSRA 2B6AA 1KQFB 1VQYA 1WC1A 2R2UA 1SQFA 3NL0A 2XEXA 2BRLA 3HZGA 4TYBA 4I6WA 3OXLA 2HHVA 3ITHA 2FIUA 4ECRA 1XR6A 3C15A 2YWKA 3DLLQ 4JV0A 3HZEA 3PFEA 1SKSA 5HJYA 5C2GA 3M6UA 4YB7A 2MZRA 3TQ1A 1MMLA 1RAFB 3G87A 5CYJA 1BD6A 5J2NA 5HANA 2K06A 4TVAB 2EFGA 1U8SA 3EDQB 3MEDB 1TK5A 1JLBB 1RKIA 4HTIA 2BANA 3RW7A 1UETA 3A8JA 3CWJA 3MTKA 3KLEA 2FZKB 4ZPVR 4HLBA 3O3LA 1GQEA 3HJFA 5J1PA 2HHHF 3UPFA 4KRWA 2OEMA 4P10A 3TEGA 2ACYA 3KK2A 5LOQA 1IBMJ 4NCGB 3BM7A 4PPDA 4J9QA 4RUCA 5KOXA 3PV8A 3KG0A 1NJIT 1C4AA 2V8DA 4OI6A 2CJXB 2CYYA 2OAUA 2UXDF 4XIUA 3CCSS 1TK0A 3FBBA 2B7BB 2JRSA 5A8RB 1SKUB 3V6HA 2KXFA 3MWBA 2AZ3A 4GKKF 3IS9A 1CJKA 1MW7A 1CPZA 2DKOB 3SQGA 4LFAJ 1P27B 1EAYC 2QSFA 1FKOA 4L6V3 4MYTA 4USVA 4ZPDA 2B56A 3VGTA 2WZ1A 4NEYA 1Y00A 1RABB 2CNOB 1FWLA 1HWLA 3DDNA 4MKBA 2DNMA 4NRUA 2PI4A 4O4GA 2EVZA 1IM4A 1A0OB 4DZ6A 1S79A 2K7KA 4W90B 2OPQB 4W98A 1X4FA 2KHDA 5HQMA 1PGZA 4DV5F 4USJC 1R8HA 1HI8A 1XIQA 3I31A 4OZ0A 2XTJP 1IBCB 4K5RA 2DNZA 3W2VB 2AU0A 4RBVA 2ZFHA 4LSNA 3AAWB 4NLSA 3KLHB 2PA3A 3ZTRA 1PC5A 5HVHA 2R4FA 4ZMMA 4WXWA 2R2RA 3KHRA 2ZZMA 2ZZTA 1SC3B 4A8FA 4FVMA 2QFIA 3SFUA 1SKWA 3VAHA 3I0SB 2VJUA 3DLGB 3A1YG 4NYOA 4ECWA 4JI3J 5KFNA 2LFVA 3UN5A 1F2GA 4DF4A 1HI0P 2MHNA 3EGZA 1M1GA 2AJFE 2D74B 2C3MA 2XY6A 2N3OA 2A10A 3OL7A 3RBDA 3B4DA 1VJQA 4IQXA 2RRAA 1JLFB 1IN0A 4EBDA 2XMWA 5KFIA 4HTJA 1T11A 2IHR1 1TUWA 1WHVA 5D77A 3W62A 4USUA 4U7UD 1N5YA 3JSYA 1ZYQA 2OGUA 4RJVA 1KHVA 1ZTWA 1RAEB 5LT5A 4DUZF 4RW6A 4RUAA 2HBRB 1WG4A 3DC2A 4L3KA 2GQQA 3EDRB 1T9VA 1SVDA 2FJDB 2DXFA 4C8MA 1KLMA 4NI2B 4CO2A 1I3OB 1RA7A 4BWMA 4I0WA 4URGA 2GW8A 3O5TB 2E5LJ 1QY7A 3DLBA 1CG2A 2G0JA 3QAUA 1VGYA 2K1RA 4U6PA 3W9HA 7AT1B 4V19X 2OSRA 3MPDA 2ALYB 1FA0A 1BQNB 4TXSA 2BXJA 3AFGA 1DARA 2A2CA 2F1FA 5DM7Q 2B4PA 2LCWA 3CDEA 3NGDA 4GC6A 2IAJB 4MH8A 4B3MF 1DTQB 2ZITA 4CNYA 2RQCA 5A0YB 4KYZA 4NX9A 2YX4A 2QIFA 2U2FA 4HT5A 1P8GA 3FMBA 2AD9A 3CC2S 3HVTB 2A18A 2MLYA 3LA0A 5L1LA 4Z7YA 2CG8A 3PACA 2MMYA 1SV5B 4XK8C 1TL4A 4WKYA 2KT5A 1D0EA 1ELOA 1IBLJ 2Z58B 2HHUA 1FJGJ 2OIHA 1LW0B 1S57A 2BJ7A 4X4VA 3AXKA 2XS7A 3CCMS 2DIVA 4JP8A 4J9RA 2CAJA 3H5YA 4QR2A 4CLKA 2RF2B 3KLFA 2J7UA 1HHSA 4ER8A 3GPAA 3KLIB 1S9GA 5HMZA 1XEZA 4PWDB 3RBZA 3DMJB 1RU2A 5ETKA 2Y1IA 3TJAA 1R3NA 2ZC4A 2ZBQA 2QE5A 2W9CA 2ZH9A 1Y11A 1T9UA 3CCQS 3HT3A 3JTPA 3DFEA 4ZJOA 1S59A 4BWJA 2M2BA 2H3EB 4ZLNA 3N6MA 2JFKA 2RD5C 1HHQA 1HMVA 1DHMA 3C66A 2UUAF 3AH6A 3R1LA 5E0OA 3GV7B 1JLCB 3SV3A 2DO4A 1RE1B 1SIZA 3CD7A 5HO4A 2EG2A 1FESA 4NYPA 4YR2A 3E01A 5DZ7A 2JFDA 3FEXB 3NKYA 2FJBB 3U1LA 2DITA 3U1MA 1PJ7A 3T5JA 2MKIA 1RT1B 1B7FA 2IRYA 4N76A 2LYVA 2FD2A 2AIRB 3MMAB 3W2WB 2HGLA 3F56A 1TL1B 5K14A 1YBUA 4U7UK 4Q8EA 2VH7A 4F04B 1NNDA 3OHAA 4CLWA 1S76D 1YJNS 4JUZA 4Q44A 1HNXF 2V69A 3G82A 3PR5B 5IV3A 1Q7YT 1T03A 3A3NB 1HIYA 2ZH3A 3I0RB 1FHTA 3RU0A 3O8WA 2GFFA 2DEIA 4LRCA 2HZAA 4ZVRB 4ED1A 2KU7A 5IXUA 2MQ8A 1WC6A 3LGHA 3KFWX 1AUSL 3HO1A 4P7TA 2UVWA 1BY9A 2B9WA 3WQPA 3ZTQA 4F3MA 2CWKA 1T9XA 5HP1B 3OVBA 4R25A 3QSIA 4GVBA 3MEEB 3NGSA 5KFOA 2EFQA 5A76A 3FCHA 2FJEB 4XAKA 1NJYA 2XYHB 1AXQA 1VBXA 2MLXA 1S1TB 1RQ0A 2C28A 5EDWA 2I8EA 5GMEA 4DV1J 1I6JA 5KT6A 2MHEA 2IA6A 5T7LB 4FXWA 2DGTA 4NLQA 2VC1A 3CMQA 4QIFA 1S0VA 4X62J 2RHSB 1FVSA 3PHTA 3D0GE 1RTJB 4CCHA 3MPWA 3DLKB 3OTOF 1H38A 5JXSA 2NYHA 4RBTA 4ERDA 2VG7B 3D54A 5DJBA 2V5HG 2Q3PA 3JTNA 2GMHA 1FD2A 2G2ZA 4NASA 2AT1B 3TZZA 4Q2MA 1K44A 2DR9A 2KO1A 3OLAA 5CYQA 3F44A 2MY7A 1VHIA 2ZD1B 3AY0A 1RHRB 3DKDA 1HARA 2DR8A 1CJVA 4K8RA 4WF9Q 2XCAA 3PCOB 1C4CA 2VDHA 5CYMA 4WP3A 3EXCX 2V50A 3PW5A 1U1MA 3EJMA 4NLRA 2QX0A 5HROA 3OFFA 2J7WA 2LQJA 3SIPB 3RB3A 3J81j 3R9LA 5BR8J 4KC5A 3IC1A 3CE8A 5A8WB 5AT1B 3AB4B 2XZTB 3RJMB 1S7IA 4KGVB 4LSZB 3MUVP 3D3CJ 4MKVA 2KH9A 3ILLA 4OYBA 2DO0A 3N01A 2VG5A 4RX6A 3W66A 1HWKA 3H20A 2ZH4A 3FBEA 3MM7A 1X5SA 2CZVC 2MZTA 3SDEB 4LVNP 3DRPA 3JTOA 1TL7B 5D78A 1R6VA 2Q6BA 3Q8PB 1QSYA 5EHHA 2RUSA 4NEZA 4FPRA 2R8JA 3MOZA 2V2VA 2PEHA 3HK2A 1RT5B 3DU5A 3IM9A 2OD4A 1NK9A 5KG0A 2QYCA 2MYFA 2LXUA 1CJUA 1XJWB 2QGFB 1OJ4A 1DBDA 2XZWA 2MKSA 3OV7A 3QJJA 4JBCA 3SXLA 1R27B 2M8HA 3H90A 4CT9A 1X5OA 2CRLA 4F2RA 1N5QA 2G2YA 2YQ3A 4O4RA 2H54B 3PW0A 4DV7F 2EWHA 2YKMB 2P5VA 4RW7B 2PN6A 1T7PA 4CLPA 2DISA 3NRBA 4R8UA 2WW8A 3N9UC 3OR1A 2HSEB 3QQCD 2Y8YA 3TEHB 3GQCA 2YKAA 3MR2A 3SSSA 2IM3A 1QJHA 3KKFA 1S1VB 3MI7X 1H6KX 2HHHJ 4X64J 1BE4A 2NYIA 3QJLA 3Q8YA 1MWQA 3MDFA 1AROP 2UUBF 1V9OA 4KGMA 3M32B 3DOLA 2L9DA 2QLJB 3JYTB 3UN3A 2DNYA 2UXDJ 1S48A 1JLGB 2VPXB 5B0GA 1QVFR 1TKXA 4IOBA 5HBMA 1UVLA 3TA1A 5T41A 4J9LA 4M5IA 1U6BA 4ENOA 2XS5A 4P9SA 1B0TA 2UXBF 4KO0B 1MMNA 3WZ0A 1H2UX 4Y34A 2FC8A 2VDIA 3CJKB 3PJXA 1R0AA 4GKKJ 4I64A 1GEHA 2ZUAA 4TN2A 4CO0A 3CMAS 1N48A 2CQ3A 3D1OA 3T6BA 1YIJS 1WHXA 3S01A 1U0SA 2UUTA 1WI8A 2BEFA 2R7UA 1RWOB 2BUNA 3S7RA 1AFIA 2YTCA 3BGFA 4ECYA 2RSQA 4LRBA 5I3PA 3QO9A 5LM7E 3UR3C 1RAHB 1N32F 4OX6A 1N4LA 4DLGA 2VFSA 2FUG9 3ET6A 1MN7A 3IAM9 3PJWA 2KFNA 2HNYA 4DV5J 1LWFA 3BF4A 1B0VA 3B54A 3KJFB 4ES2A 1SQEA 4NCAA 4WK3A 2HYIB 5KFXA 1CSJA 4OV6A 3OUYA 4DXLA 2WSFC 1TR0A 3HD1A 4LR9A 3QT8A 2DHXA 2CJYB 5GVQA 4EYIB 4P7VA 2KYZA 5BYQA 1X4AA 2FLNA 4H4KC 4E8UA 3JAMU 3QMQA 1X9SA 4QWCA 4EFAC 4IH7A 4E98A 2G2OA 3M30A 5B7WA 3AOCA 3TR5A 4CO4A 1OMSA 2B5JA 1Q4RA 1HPZB 1IBKF 4ZCLA 5DRKA 1XNRF 1E6YA 1T9YA 4NLGA 5HQ8A 4FPIA 4KH0B 4A8OA 3L4BC 4QQBA 1SIWB 5DDPC 3IG1B 4F50A 5ETSA 1BXNA 5KFGA 3M8QB 3RG6A 1W26A 3R7NB 4OX8A 3GIRA 2H4WB 3D9BA 3LP0A 1QAYA 3WDOA 3TQEA 2DGSA 3HHDA 4LF7F 2WBMA 2C3UA 1NUEA 5D3GA 1VI7A 1OY6A 3DI6B 2J9CA 4NWBA 2R8KA 2DIUA 2HAFA 1UCNA 3RTVA 2V2KA 4ED7A 4OYWA 2DGVA 4MJKA 1WSRA 3LO3A 3TUIC 3OL8A 3KDNA 2JLEA 4QWAA 4QWBA 4NYZA 4J91A 1T9TA 3THVA 2L9WA 1QE1A 1HNVB 4OYPA 1U0HA 3Q8SB 3ADAC 2AGQA 4C4WA 1HNZJ 1T0TV 4UOGA 3AD7C 3KTQA 3MM9B 1TK8A 1XNQF 4OJ3A 3DRRA 3P5BP 2HHSA 1DLOB 1CQNA 4NLYA 3IP0A 4WE1B 1JXLA 5DGAA 1LNQA 1VQNS 2AEMA 2VB6A 4OI2A 3PEHA 3KUHA 4ED4A 4P75A 1PYSB 2HVEA 3FUYA 4PXDA 4RKUC 2IYGA 1WSVA 1K73T 4YS2A 2ASDA 3CO9A 5KAKA 1BWVA 3PG9A 1YBAA 1F5CA 4OJGA 1KR4A 5GAGU 2DR7A 2E44A 4LFBF 2QTWA 3MEGA 2QLBB 4PXEA 2B4UA 1NRKA 4USTA 1ZM4A 3ZZYA 4Q5VA 2LU1A 4J9KA 2GMLA 2GAGC 4NLWA 4NL5A 3ISNC 3OLBA 2DHHA 4ID8A 5LMNF 5IC4B 3QT7A 4F3QA 3L95X 4ZDNA 3LAMA 2HWTA 1S1WB 1PG5B 3V81A 2VODA 2CNLB 4OMFG 1O6XA 2GJIA 1FRXA 3D6HB 5AE3A 4DPUA 2UP1A 2YWGA 2HNZA 3MCOA 1RGVA 1UVNA 2VOOA 3H42A 4P72A 2DNLA 3ENAA 3I96A 4WP8A 1FJ7A 1K47A 4IQMA 1HNWF 3TNVA 3MMCB 4MIWA 2HFZA 2HMIA 3M9NB 3QATA 4X2BA 3PX6A 1L3KA 8AT1B 1T05B 3MD1A 3DOMA 5K8PA 4UQTA 4YDDB 1RZMA 1WC5A 3M6WA 2HQDA 2L08A 2WK4A 4NLPA 4JI4F 1HQUB 4DR3F 3DDIA 2FVCA 3WIVA 4HL9A 3MZIA 2GO8A 3CJRA 5KFMA 4ZHRB 4CYUB 3PIPQ 2UUAJ 1N33J 3HDSA 2JVOA 1TUGB 1RXOB 2WVCA 4M1KA 1AZSA 3QIPA 2UXCF 3KUGA 3TW0A 4Z2XA 1JJCB 3TA0A 2MEWA 1PAUB 3FZ2A 4YFUA 4U8VA 4FBTA 4DS5A 4RW8B 2ZOFA 4DCPB 1YWXA 4B9VA 1WKKA 3CVKA 2XWYA 2RMLA 4Y0FA 5DQGA 1NJZA 8ATCB 3HVWA 2R8IA 2R7TA 4QCLA 2G1HA 3BGLA 3R2CJ 1H98A 4LBPA 4J37A 2IC3B 2VUGA 2X7IA 2YQ1A 2XCPA 1LW2A 3G6ES 3Q8UA 2BE2A 5K8NA 3WBZA 5DETA 2QA2A 3N0VA 1NSPA 3HHEA 3THTA 5LXRA 3LQVA 2ZOGA 2FGCA 5GMDA 3DRSB 2QC3A 2I1RA 1HNXJ 2VASA 4OL8A 4DR6F 3UCZP 1X5TA 2OHDA 3IO1A 3EYZA 3DXBA 3IBWA 3CJTA 3O2IA 1J5OB 3KYLA 3AODA 4QYZJ 1IKXB 3M05A 4OZNA 2W4DA 4YR0A 2OFHX 4PEOA 4F4ZA 2P9EA 2XC9A 2RRBA 1S1XB 1UA1A 1IKYA 2VPWB 1AA1B 2XHCA 2B4OA 2F9JA 3OR2B 3NY0A 3C6UA 4KJIA 2LQ5A 2MKHA 1P1LA 3IWXA 3D66A 1W25A 3TYTA 3KK2B 1NO8A 4DR5F 3IXQA 2K8GA 4UY85 1YJUA 3CF5Q 1M5HA 3QLHA 3WC2A 1C0UB 2FVQA 3MAHA 1KOOA 3K2YA 4HT7A 1V6HA 2FLLA 4AYBD 5KG7A 3P8BB 2FYXA 5U47A 4CM0A 5HLFA 3AJ2A 1U1KA 3GCXP 3OTOJ 1NHVA 3BYPA 4QYZK 4ZITA 1GNKA 5MLCV 2VD3A 2J0SD 1URNA 4DPXA 6FD1A 3VV2B 4ZVQB 4OZJA 4ED2A 3QFWA 3VGVA 4GC7A 1G4CA 3SMZA 3RB6A 3SQGB 2FZGB 2P2CB 3ZTPA 2QMWA 4NZ7A 3MAAA 3ZZ0A 4PG6A 5L39A 1TTHB 3SV4A 1F2HA 3V6JA 4Z37A 5KFDA 1LV5A 2V63A 2M70A 3AXMA 3ZNJ1 1GMUA 1VC0A 1FDNA 1MROA 2C2OB 4I7FB 1CS4B 3O1LA 2GX8A 2ZH7A 5LSRA 1SKRA 3QPIA 2K3KA 2FVSA 3DDKA 2J76E 1IKWA 4WU3A 4PRFA 1WF2A 3CJSA 1UWBA 3E2EA 4I68A 4OJ1A 2XLIA 2VQEJ 2UV8G 3EICA 2MDAA 2G13A 4NLXA 1O51A 3CCZA 4WP9A 4C11B 2MB0B 1VCTA 4CT8A 4HHJA 1XR7A 4UOHA 3MM5A 4PQUB 4DL6A 5ADZA 1N34F 2IM1A 2VFTA 1VQPS 3D67A 5B0EA 3N5FA 1AW0A 4ZVHA 1WC0A 1YDLA 1XR5A 3H98A 2ZBRA 3VGSA 1NKBA 4DX5A 3M2RA 2GC8A 2OPSB 1FK9A 3MMBA 3QT6A 1Q8LA 4KH1B 3T1AA 1RA6A 3R97A 1I1GA 2AMCB 1U1RA 3R5GA 1YJWS 2PMZD 3RR8A 2AWZA 4NE9C 1N0UA 2AJ2A 2CQBA 3MR6A 4ZVUB 1PO6A 4CLYA 2OMLA 3SCJE 2M88A 2HZVA 4DV7J 2B43A 1H7XA 3POTA 2F8EX 2UVUA 1NHKL 4MIAA 4CH7A 3VWSA 1Q8BA 4WFZA 2V8HA 2XSJA 3JXOA 3FEZA 3AQPA 6FDRA 1YVFA 2BABA 1MU2B 5AXKA 1HBMB 3EZ5A 4YR3A 1QSLA 4RO0A 1U09A 3C14A 5J2MA 1RT6A 2QO3A 3TJ8A 1NDLA 1IVZA 3TAMB 1D9FA 1ROFA 4WKRA 5IT9Y 1V5IB 1UP1A 2CQ2A 2LQ9A 2VZ9A 3NMAA 3JQJA 1G2EA 2V9KA 3FJ2A 4PQAA 2VIHA 2QL5B 1HWJA 2P8IA 3U27A 3MOJB 1YJVA 2Y0BB 3SYZA 1Q81T 1HHTP 2DD8S 3R5AA 2DR5A 4IO1A 5M2UA 3IRXA 3NWGA 1S9EA 3WHIA 3CCVS 3V6KA 1WI6A 4B3SJ 1T9WA 1YX2A 3LGNA 1QUPA 2CPHA 1UA0A 2OTLS 3QZ7A 3HHNB 1L3VA 1NCLA 2AEFA 3H4BA 4HACA 1R7IA 1XWLA 4QIGA 4RW4B 5EWEA 2IMOA 2XO7A 1LK5A 1OQ3A 2LQ8A 4R0EA 1TFYA 4K4UA 3ONQA 2B51A 4FYVB 1DTTA 1L5UA 3NBPA 2OPRB 3M2VA 2GIRA 1X60A 2YQ0A 1TQLA 4RW9B 5ETPA 1E6VB 3RR7A 3GYXB 3FQKA 1DZ5A 5J1EA 3C16B 1UVIA 2WAQD 3HULA 2RE1A 3EZOA 2BM0A 4B9LA 1RLDA 4LREA 1YRTA 2DBBA 4ZJQA 3U1NA 1X9MA 2W9CB 2V4JB 3DM2A 3NAIA 3I4PA 2W7AA 3GIJA 5DG7A 1UVKA 2B8PA 2J9EA 2O5DA 2MGZA 5A8KA 1I94F 3R5CA 2W7OA 1FJEB 2M8DB 3LANA 4KGZB 4WFXA 1KEKA 1FRIA 1XNRJ 5JJBA 3IA0A 1VQ7S 1J27A 1U2CA 1KC8T 3PW7A 2W7PA 4V19J 4K0KF 1S4FA 1RJJA 2GCFA 4XDDA 4LF6F 1NBEB 4LF7J 4IFYB 5D15A 3T9NA 1Q95G 4WFBQ 1UZDA 1N6QB 5F8LA 4MKYA 1P1TA 3CIMA 2X1GA 4F3OA 3M8YA 1TFWA 5LL6d 1ZOTA 4F02A 1JNZB 4FNIA 3IFEA 4OZ5A 2RJZA 1HD1A 4J9VA 2X3DA 3BDEA 5L1IA 3K5OA 4DPTA 4IDKB 3IR6B 3ZTSA 1RWVB 3SCIE 3RUBL 3EE3A 2WB4A 1ULRA 2F4VF 2ZEJA 2OPPA 4JOUA 4ELVA 1XNQJ 5ETQA 3RRHA 2X1FA 1YK9A 2JLFA 1VHFA 2KKHA 1NMEB 3M2UA 4CLTA 4XPEA 5A2QU 4ZPBA 1DQ9A 2NXEA 1SUQA 5DDRC 3W1YC 4L3NA 4Y65A 1RTHB 1LEOA 2ZH1A 1P9QC 3NOGA 1YG0A 1VRUA 5DS7A 2XHWA 5EUHA 1RTDB 3H40A 3G8QA 4X4RA 3J81Y 3BGOP 2OKQA 1XC9A 3CPWR 4AT1B 3KMSA 3NGKA 2IA0A 5FDLA 3PRBA 1T02A 2ZJPQ 5D0RA 2XMUA 4FYXB 2HNDA 4K7QA 2WVBA 1X4EA 2DB1A 3SBMA 3AJ1A 5B0FA 1FRMA 1HW8A 2CJQA 2UU9F 4A8QA 4DFKA 2QA4G 1ZAVA 1W7WA 3J7YU 2YPYA 1KSPA 3CCWA 3AA9A 2HGMA 5LSLA 1RAAB 3CTRA 2HFOA 2NZCA 3O6QA 5E5NA 1XMQF 3V4IB 1WUUA 5CYQB 1EIYB 4O3NA 4C8ZA 1Q8IA 2EEYA 1Q82T 2LMIA 3HCXA 4ZPAA 2FHJD 1S6QB 1XN9A 4M63A 4P73A 3G2XA 3QAEA 4KBIA 4ZP6A 1EQMA 2MZJA 4M5MA 1WTFA 4DG1A 3HHLC 4KHRA 3UD5A 4DR3J 2HVZA 1M5SA 4RWXA 3KLVA 2XNRA 4FS2A 5DDQC 4CLZA 4Y2CA 1U1LA 1QVGR 2DRBA 1LWXA 2DH7A 2GIQA 3AB2B 2HFUA 8RUCA 4KV8B 2HK2A 1ZZFA 1YJRA 5IQ6A 3FCVA 2DRDA 4B3OA 1F0XA 3RZAA 2ZBCA 3MHYA 4OLPA 2B9EA 4KIAA 1VS3A 4I56A 1K9MT 1JQGA 2EC2A 5HSPA 3TAPA 2EXUA 3QRQA 1S6PA 2YY3A 3V6DA 2HFSA 2I38A 5A6WA 1X0PA 4DSKA 3ISND 1N54B 1NPKA 2ZZNA 1Q16B 3G96A 4RU2A 5HN0A 4OFZA 4NLVA 1VQLS 2OP5A 2FQQB 4QZVB 1C1BB 1HBNA 4WWSA 3MECA 4DHVA 1NDPA 5FIIA 4U67Q 3DU6A 1JMTA 2KZMA 3DYAB 2ZE2B 4J9OA 2Z56B 2MKYA 1RTIA 4ZP7A 3QWPA 3S6EA 5JVHQ 2MSTA 2Z2YB 3T3FA 1OIAA 1GX6A 2IDEA 2CQHA 3L09A 3FFIB 4LSLB 4NPOA 4LRFA 2W4PA 3ETMA 4FKYA 3QGHA 1LK7A 3OVSA 2HWHA 1CULA 5J2PB 2HKEA 4I2PA 4DUTA 4KFBA 1S0MA 5RUBA 1C2PA 1VR6A 1XBWA 2YNIB 5D0HA 5DG9A 4Y2MA 2Q66A 2ROGA 3PJ9A 1RAGB 1FXDA 1S49A 5DG8A 1VQ6S 3M8WA 4C8KA 1Y3JA 4L75A 3NLCA 1PYTA 1BUXA 3L7UA 2JZ5A 3OSNA 1TAQA 2KZZA 3CO0P 1KDNA 2V34A 3DGPB 3EX7B 4OLOA 1FKAF 2RHQB 3A4TA 2LKZA 2LU2A 3HHLB 3PO4A 4QR0A 1H73A 1GK8A 1UFWA 2BYCA 1VRQC 5D0GA 1ZTTA 1MNEA 3BR9A 2HG4A 5B0DA 1Q53A 3PO5A 2GVDB 3GFXA 1URRA 1OYEA 4JI8J 4L74A 3DLEA 2GQCA 2XWXA 3BQ1A 5ITHA 2CJKA 3MEDA 4DFJA 4BBYA 1JLBA 1N5VA 2Z57B 1NU4A 4ZIVA 3VAJA 3T1HF 1G3OA 2IYIA 3VQSA 4IG0B 4QIVA 3BZQA 4LIWA 3U7JA 4C8NA 2KRBA 3CEDA 3SCLE 3VCDA 2Z0GA 3BDPA 4NMLA 4P2SA 3OT9A 2F63A 4AD6A 1WG1A 2KYXA 1FXLA 4QWEA 1MWZA 2XS2A 3PYGA 4NCGA 4ZPTR 1NPRA 1F1BB 3G6XA 1NHUA 3ZFVA 2FJWA 4ID5B 1ZAWA 3LPEA 4QBUA 4ZPWR 5IC6B 3J7AN 1VIOA 3GV5B 1EKRA 5L8RC 4NRTA 2ROPA 3EXYA 3WX8A 5IQQA 5CD4H 3UR0A 4DPWA 5A8RA 4LF4F 4C8YA 5ETRA 1T3OA 4ELTA 5GAHU 3IR7B 3PHEA 1WOPA 3NGTA 4ZLJA 4OI4A 1Q78A 4I6YA 2ZHAA 1OWXA 1RAIB 1BLUA 3CMES 5CCLA 1N34J 1LFPA 3QJPA 4O44B 3KG4A 1NPPA 4WJBA 2Z8QA 1MG7A 1M1HA 4H4OB 1WC3A 2W2OP 3K58A 3R1HA 1KTVA 1AUDA 4EUVA 2CNKB 3K8VA 2ADBA 2YNFB 3RBXA 3H2VE 2ABYA 3CW2C 1IQZA 4FYYB 3TX0A 2KG1A 4I6AA 4ECQA 2LEPA 2FHMA 1APSA 2DTJA 5ETTA 1ZM9A 1UW4A 1EETB 3PYFA 1O8BA 2R7VA 1NXIA 2OPQA 3EVMA 4ECUA 5IOLA 2MQMA 2I6WA 1KVKA 2JL9A 1VIXA 4J90A 3MPVA 2JEGA 2U1AA 2RNEA 3MM6B 3W9JA 4JI2J 2RB7A 4NA2A 2YNHB 3W2VA 4BC7A 5C2CA 3BKFA 3KLHA 3BBBA 4KHPF 3HX9A 3GTYX 5FJ4A 1YBTA 1SJFA 1NJWA 5CA5A 1JWWA 2V68A 1R89A 3KJVB 4X65F 4M5DB 3VAFA 2XMAA 3TVKA 3K5LA 1Y3KA 2DVIA 5F9LA 4DV3F 3DLGA 2XYGB 4ED8A 1FTCA 4ILMA 4NLOA 2RU9A 5L9XA 3CJ8A 4PG4A 2B8QA 1U0HB 3G86A 2AQ4A 3B4MA 2E7XA 2C2NA 4TU9A 1D1UA 2C2KB 2E1AA 3CJ0A 3D6TB 1JLFA 1ZPVA 5KT4A 3NNHA 1CEZA 5C5JA 5C24B 3A12A 2BJEA 4C3LA 1X0FA 1CC7A 4IH5A 2OLWA 1EP4B 1FE4A 5HL7Q 3GFYA 1BC6A 2JHEA 1MN9A 4KT0C 3RAQA 2MKCA 1B3TA 4ZVPB 4DV0J 4LUBA 4JI0F 3PM9A 4RNFA 4EEYA 2IVFB 1VBKA 4PG5A 2ZJQQ 1X31C 2XLKA 4MMOA 4DCJB 2E66A 4LF1A 3GJTB 4NI2A 3CULA 2GMJA 3HSZA 4F2SA 3BEGB 5CXTA 3D6FB 1ZS6A 3BPDA 4DQSA 1UJ5A 3D3BJ 1BQNA 4F4AA 1H3DA 4YY3F 3KHHA 2IAJA 4F0MA 1DTQA 4EBCA 2OD6A 1TL3B 5A0YA 3NCQA 4HKQA 3WX4A 2E5JA 4N8OA 3H0PA 4FBUA 2N4CA 3J80U 4O3QA 5KFUA 3HSDA 3HVTA 2BJ8A 5F0WA 3G8SA 1HQ2A 2CQIA 1KS2A 4Y28C 5KT7A 3P4UB 1SV5A 2ZKUA 4DZDA 4C7QA 4G6VB 2VL1A 5KFCA 1I94J 3OTCA 2JOQA 1LW0A 2DYAA 1VLYA 4X4UA 1JXVA 4M5HA 3R5JB 2P9CA 5D4NA 3HJVA 1SJ4P 2RF2A 3TX8A 3W65A 3KLIA 3EUNA 2RAQA 2HFNA 3IN5A 4K0KJ 4Y2AA 3D5MA 3NXZA 1QAJA 1SJ1A 4WCEQ 2VF3A 4PWDA 3HKZD 4LF5F 4PG8A 3DMJA 4LF6J 1NAQA 2I2YA 2LA4A 2M0GB 4HI1A 1SH3A 1U49A 4DV6F 3KUEA 3H5UA 4DL3A 5IWAJ 3AJDA 4DN9A 2QSWA 2F65A 3V4MA 4MTPA 1YTYA 1I51B 1TVRA 4ANDA 1S6UA 2DNOA 3OPKA 1EX8A 3HD2A 3SEOA 3G6YA 3W64A 2NS1B 1FRJA 2UUCJ 1LWEB 3EGNA 4PABA 1Q7LB 4KGKA 3MFHA 4KE5A 1VDHA 2BVZA 2E1RA 3B78A 1F9FA 2XM3A 1HL6A 4TU8A 3LGMA 5HAOA 5F41A 5C42B 3HF5A 1VK3A 4TQSA 2ERRA 1S1UB 4MFBB 2DPJA 1ZM2A 2GO9A 1IR2A 5B0BA 1RT1A 2X3GA 4C97A 4CH0S 1SL0A 1IKYB 4ZN1A 1SC4B 3MMAA 2J9DE 3W2WA 3NMRA 2RIJA 2LXIA 2XMJA 2DK2A 2YKNB 1TL1A 3N6NA 4JI6J 2C22A 3CDUA 3M8PB 3T5HA 2ADCA 2XG8A 4HR2A 2MXYA 5F8MA 4M5GA 2MZQA 4QW9A 1EQ0A 2POKA 3QLHB 4IG3B 3W9IA 4KKOB 4ZVGA 4OHWA 2B3TB 3I0RA 2OFGX 3OW2R 5KFAA 2ZC3A 5E3QA 1HBUB 4RNOA 1B4SA 2UU9J 3GYGA 2CQ0A 1M5KC 2V8VA 3QRPA 3J7ZT 3NS5A 1HFEL 2F8HA 2M7SA 2BE9B 3MUTP 3TZXA 2CDQA 5HP1A 5JMNA 3I87A 2F7VA 1R8CA 2WHOA 1RT7B 3MEEA 3QGIA 4DQPA 2ASLA 4UQGA 1REVB 4ZCIA 3I6PA 4P6QA 2J8SA 2QLXA 2CJAA 1A9NB 5GAEU 4IR1A 2JEFA 3PVXA 2ILZA 4UF4A 1DURA 3LTOA 2HQ3A 1SJQA 2DGQA 1S1TA 1TMJA 2AW0A 2C3PA 3OFGA 3ZZPA 4TU7A 2EKNA 4DR4F 2DCUB 5ETVA 1PIEA 1UEVA 2AYEA 4KB7A 4CTAA 5D0EA 5J2QB 4I1TA 4PR6A 1UWBB 4HEA9 1TU0B 2H9ZA 2E1MC 3ZZZA 1WD6A 3DLKA 4ZVFA 4OZ2A 4OX9F 5KFWA 3M1VB 2YX7A 1QM9A 2VG7A 1LOUA 4JI5F 1NKCA 4QIEA 3BO3A 4USKA 1VC5A 3MCSA 2CPEA 4ITSA 2E9RX 4CLSA 1O5JA 2ZD1A 1OSDA 1RTZA 1N8RT 2QJ3A 4ED0A 4M8LA 2IPOB 2ATLA 4IRDA 2VG6B 1N36F 4G1QB 2DNQA 2AJ4A 2IM2A 3I9V9 2RS2A 4IFVB 1YSJA 1FK9B 3A13A 4CI0B 3OL9A 1U48A 3KJNB 2N7YA 4JI7F 4NXMF 2AJQA 4AXIA 5B09A 2QFJA 1FKPB 3D28A 1HBOB 1UEUA 3VQTA 1G6BA 4OZ3A 5BXIA 4HDGA 1P6TA 2VFUA 5K8OA 3TARA 2PEBA 3Q2SC 1ACMB 1ZBTA 4DSFA 4C48A 2HS3A 1ZH5A 4ZVTB 4IOCQ 1CBKA 2PD1A 3US5A 4ANEA 3HHLD 2H48B 1AB8A 1V5VA 1RP5A 3SDEA 3WIUA 4WZQA 2MTLA 1TL7A 2EFVA 2V4QA 1R6YA 1X4GA 1KWMA 4IRKA 2FY8A 1QTNB 2KM8C 3FSYA 2J7KA 1H0HB 1RT5A 2GGPA 2NXCA 1GXLA 2E5IA 2K7JA 4ECVA 5DQIA 5JUMA 4YUDA 2BJ1A 1QLNA 4JI1F 2VQFJ 4ES3A 1NKEA 2RH3A 3VZIA 1X5PA 2Y9HA 4DJBA 3D1QA 4LR8A 2YKMA 4YB1P 2PT0A 2Q43A 2ZWPA 4DL7A 2NCKL 1K1QA 4UZCA 2R8HA 2ZUGA 3M8ZA 2SXLA 2IJRA 2HQFA 3T1HJ 5EX3A 4B02A 2ZDPA 4B3RJ 1S1VA 2KHCA 2PI5A 2VBWA 4PCQA 5GADU 2PDAA 5B0AA 3LP1B 1X4BA 2DXEA 1YI2S 3MM8B 2Y8WA 3AA8A 2QYGA 3SCKE 2WONA 1YZ7A 4TYAA 1DTTB 2V67A 2YBVA 2NR0A 4EYHB 4YN3B 3M32A 4B3TF 5CH7B 3JYTA 1YQHA 2GIFA 1WDTA 2GJ2A 4IR9A 2A6MA 4I2QB 1KN6A 3UFCX 1JLGA 3D6MB 2M52A 5KFKA 2QN6B 1YRUA 1RT2B 4EK2A 5ETLA 1XMBA 2PFDA 1SI9A 4LF4J 4KO0A 3TZWA 3PX0A 3ILJA 3CJKA 4K50A 4JV2A 1O0PA 2ZH6A 4U8YA 1FI4A 2XI3A 1SH0A 3CGIA 4UW2A 3KMQA 3UNYA 1N0VC 3BPSP 1SC6A 1N52B 4DL2A 2YH1A 1JLEB 1F5AA 3VVTA 1NB7A 4AQYF 3K59A 3Q83A 3R7BB 3F73A 1N5TA 2Z2ZA 1FT8A 2V8GA 2HURA 2KM8B 3BQ2A 4YB6A 4O3RA 4KQZA 4F4XA 3PW4A 3W3SA 4DBQA 3BBCA 4FDFA 4DPYA 1FDDA 3BH7B 5KFSA 1RCXB 2ASJA 3UVJA 1TELA 4HVZA 4NLDA 4C3MA 4C6AA 1JKHB 2W9AA 3RRKA 3SZ2A 4MIBA 2WOMB 3LPYA 3NS7B 3M8SA 4DV4F 3PZPA 2NQPA 3CJ3A 2J6TA 4KHPJ 2BQRA 2VHGA 1WF0A 2KN4A 3A3PB 3AD8C 4LF8F 3JAMY 3ZZRA 1FNXH 4X65J 5L9NA 1GXUA 4DV3J 4Z7CA 3TA2A 3KWMA 1H2TZ 2HQCA 2P6TA 3LWLA 3GIMA 1BMQB 2KFZA 4KR0B 1OPZA 1Y5NB 4JYAJ 1L3SA 2K3IA 4F36A 2BR0A 1NZAA 5CCMA 5KFHA 1YJTA 1HPZA 3M6XA 2KDOA 2AJ1A 1C0TB 4Q0BB 3JQMA 3IG1A 3V2UC 2DRAA 2M3DA 5A6PA 3M4XA 4YMEA 3GB0A 3TVZA 4PWWA 3CJ5A 3KOAA 1S99A 3NP5A 1KKHA 3D2WA 3DI6A 3LAKA 3BQ0A 4FP9A 2DR6A 4DX6A 5F8GA 4I4BA 1K0VA 4F25A 3DGVA 1OQ6A 1YRXA 5FLXU 3PKYA 5F0UA 2XB2D 3DHXA 5G0RB 1NLKL 2FB0A 4QPXA 2NXNA 1HNVA 2F3JA 4LQ9A 2WTFA 2XI2A 2PMWA 1FDAA 3K89A 3MM9A 4UT4A 2QA4S 4A8WA 1JJ4A 2PGCA 3PRDA 1WEXA 4IH6A 3K17A 5DLFA 1CJTB 2IJFA 3CD5A 4P74A 1DLOA 2F4FA 4DF8A 4WE1A 1H2VZ 2JLGA 1T95A 1RHUB 2W9BB 1GT8A 1U26A 4YY3J 2NUHA 4UZBA 3X1LB 3BSNA 4OHYA 2Z30B 4FVCA 2MQLA 4USHA 3WC0A 3M6VA 2RKIB 3VTIA 3FK4A 4F0KA 1IKVB 4KGXB 3OL6A 4O0NA 5CD4A 3OHBA 2W01A 4GMKA 4DV1F 4CP5A 1S7HA 4H4KA 2HAIA 3TOQA 1TKDA 4EMDA 4ZIWA 5CZXA 3DNCA 3BGRB 4A46A 4OI3A 1UTAA 1FCAA 1FEEA 1S1WA 1WWHA 4X62F 2DGWA 3EGWB 5D4LA 2Q79A 3B8HA 1S0OA 4EZ9A 1U6FA 4OYIA 1HNIB 4DWIA 4OI0A 1RT3B 1VMBA 2AYBA 1Z1ZA 3MCNA 2QMXA 3UCUP 2QEXS 3MMCA 5T14A 4JV5F 1T8EA 4DV6J 2XNQA 2RT3A 1T05A 2IM0A 1RU1A 1W2BR 2J5AA 3EWGA 2QG9B 1Y5LB 1HQUA 3FRYA 3ICLA 2GQ2A 3U02A 4CWBA 4A47A 4ZHRA 2W2MP 4ZN3A 5JVGQ 2KT3A 1MSWD 4CYUA 1HYSB 2EFPA 4M5NA 5KFRA 3KK3B 3I4HX 3FDSA 4K59A 3IR5B 1D8ZA 2NSCA 2QL9B 3D1HA 1I5OB 5BR8F 2FHJA 3JSMB 2BV3A 5KFJA 1JK9B 2W2PP 2EFOA 5DGBA 2NREA 1JLAB 3KDOA 4RW8A 2A0FB 4OYOA 3PXGa 1HQEB 3Q8RB 4R5PB 4DDFA 4EO8A 1LWCB 2ZDOA 2CDRB 4M94A 4QJVA 1M5OC 2OTJS 5LJ5Y 3G71S 2IC3A 1BHNA 2CQCA 3DOKB 2GVZB 4NXNF 2CZ9A 2DXDA 1S97A 3UE2A 1ZAXA 5C7PA 4UOCA 3VAIA 4OV1A 3OBIA 3DRSA 2E5HA 3JSRA 1TKZB 2N3LA 1VRTB 3BV8A 2EBEA 1JLQB 2RS8A 3FC9A 2ZH5A 2I5JB 1ZETA 1TL5A 1J5OA 4ZKAA 4A8KA 1IKXA 1PC4A 5I3UB 4NA1A 4B9NA 5HI7A 2CQDA 3D0IE 1UFLA 4XO0A 4TQRA 3DLEB 2HHWA 4CO5A 3K8WA 2FLPA 1S1XA 3KLGB 3MXHP 2IBOA 2XLJA 1G1XA 1NB2A 3IGVA 3HSJA 3OR2A 2DEJA 4EO6A 3VZHA 1S9FA 4LBIA 2RQMA 2KRRA 4ECXA 2FJVA 1BGXT 3R8YA 3S1TA 4X64F 5GAGI 2ZVSA 1WG5A 3H2UB 2D41A 4PXCA 4FF2A 2BRKA 3QGPA 4EI2A 4DR4J 3GMGA 4DMZA 3GIKA 4DUZJ 5EWFA 1C0UA 2XY7A 2ROEA 4DCOB 1RT4B 2CIMA 5ETMA 3TP2A 3I5AA 1BQMB 1HWIA 2QRRA 2RDJA 2HHTA 1GXTA 1FXRA 2BKNA 1YHQS 4OX9J 2GHVC 1TKTB 3W63A 2M5YA 4M5KA 4LRDA 1KFDA 3C6TB 4JI5J 2DGXA 5K20B 3CCRS 2O1PA 2ZVIA 4H4MB 1UL3A 4K4WA 4GO5X 4IO9Q 2UVVA 3PTWA 1VQ9S 3HI9A 4OYMA 2NZ4A 1U4BA 1X4HA 1VOMA 4RNMA 4B3MJ 2X1AA 1C1CB 1N36J 5CHCB 2BX6A 1KD1T 2PO4A 4I7FA 1CS4A 2HHPA 2W2QP 3HVRA 2YNGB 3MAQA 3R5BA 2W8LA 3M8RA 2BKOA 2KXNB 2L41A 1SXLA 4JI7J 1WORA 4NXMJ 3K7RA 4NZ0A 1L3TA 2AV5A 2WRMA 2BJ9A 2MKJA 1YJ7A 2Z2LA 4TLRA 4ZLPA 4BLGA 2JC1A 3UDLA 2X1BA 4ALZA 4G1PA 4C11A 2ILYA 5BYRA 1F5BA 4W4MA 1IWGA 1PYOB 2D3OR 3CCTA 4PQUA 1FO1A 1IR0A 2LDIA 2O67A 3CC7S 4ZK7M 5I4MA 2DNPA 2OO4A 3LP2B 2R7SA 2ZH2A 1FX2A 2GJFA 3TAQA 5KT5A 2AJ0A 1WEZA 4ZVSB 3NNAA 1H72C 2OPSA 3EZUA 3D7SB 3K5PA 2MKKA 4EWTA 2R2TA 1Q1KA 1JIHA 4DR1F 1WTBA 4A48A 4FF4A 3EVWA 2M9KA 2ZM6F 2RDIA 4P52A 2QZ8A 4J9PA 2OI2A 2GHWA 4JI1J 3ZZTA 3QSYB 3QRRA 5D4PA 2CQPA 3FEYB 7FDRA 2IRXA 3KNAA 1KLNA 4RWWA 3T41A 4PUOB 5E3CA 4U96A 2N4DA 5HATA 3MPYA 1VISA 2AP6A 3DCAA 3CCJS 2J0WA 4B9SA 3T9ZA 1UWAA 3UN2A 1P9YA 4GO7X 2R7OA 1MU2A 1QD1A 1HBMA 2BJ3A 1HA1A 3GFZA 4L73A 3P5TL 4QOTA 3P96A 4LIRA 1YGYA 3B6BA 5J1NA 5BYSA 4I67A 3TAMA 5I42B 1IUJA 4F8RA 3C3LA 4ZOSA 3DHWC 1HNZF 2B6AB 4B3TJ 3MR5A 4DX8H 5E3RA 3QBCA 3ITHB 2C42A 2PIIA 4QU6A 4ICLA 1FX4A 4DLEA 3C15B 3GCWP 3LF0A 2IDLA 1WDDA 2DH8A 2UUWA 2A6OA 4URSA 1VBYA 4ZP8A 4QPTA 2J6UA 2EK6A 3RGIA 4FXVA 5F8HA 3E8OA 4C0BA 1FNOA 4RW4A 4WYWA 2MQNA 5J2NB 3OXFA 4OYAA 1JJ2R 3IMQJ 2EKYA 2BANB 2HPUA 4WBFA 1S10A 3KLEB 4AQYJ 4J7CA 1UPMB 4DSLA 2OPRA 1UW9A 4N77A 1RBOB 2R7RA 1B70B 3CSKA 3UW1A 2KTQA 4RW9A 2DT9A 4ZJLA 1E6VA 1FNMA 1D9DA 2H65B 2VC0A 3ZO7A 3VAKA 3C16A 3T1YF 1CLFA 2MQQA 3H2LA 3BB5A 1F6TA 2HW3A 5KFEA 2N82B 4S0MA 3TWZA 4IRCA 2VBYA 1AFJA 4HHHA 2HWIA 5H9FJ 4DV4J 2CPIA 2FLOA 2V4JA 3FCWA 2AZ1A 1RLCL 5E3AA 1RK8A 5EGYA 3CXCR 4LF8J 4NCBA 1OO0B 2YWHA 4I69A 2D1CA 4CO1A 3I5BA 3IS9B 1TVRB 3CD6S 1FEHA 3BSOA 2VA2A 1CJKB 1ZZNA 1VC6A 3T19A 1FKOB 1SL1A 3R6LB 2W24A 3Q0AA 4RNHA 3CJ4A 1N33F 1GTHA 3HPOA 1RYRA 2R7WA 1IJFB 4E0DA 1Y4ZB 4RUBA 4B17A 2XMVA 2VONA 5B08A 2BACA 1M5PC 4CQ1A 2F8MA 3ENWA 1N88A 5K5MA 3VGUA 3KK1A 3GR1A 1GX5A 4A8MP 4O4GB 1U47A 2WVDA 2K2PA 1X9WA 4IFYA 4GKJF 1OYDA 5AXLA 3EGVA 2LEBA 2LXFA 2CXEA 1RHKB 1N6QA 1N5SA 1J5EF 5H9FK 2HRTA 1Q5YA 1PJ6A 3IWNC 2VFVA 4URQU 3JSBA 1VQ4S 4O3SA 5HVGA 4LSNB 2BE7D 4P2XA 2HRUA 3IAS9 3K0JA 5KFLA 4HI2A 3T6JA 1KBRA 4FN5A 4ELUA 4IDKA 3T5LA 5DQHA 5LMUF 4O23A 1SPBP 2FGOA 2IMWP 3R2DJ 1UFKA 2X51A 1HR0F 1OPIA 4N7TA 3KNGA 2W25A 4KHMA 4RPFA 3MURP 3TI0A 9RUBA 4C9DA 3N4WA 2BMBA 2OJ3A 3HSGA 2RRNA 1B7YB 4DS4A 5F8NA 3N79A 3GE9A 4DX7A 2RU3A 5A2QY 2D3ZA 1DJ0A 1A6LA 2W1BA 2LP4A 3LWMA 2DJWA 4DR7F 1S5ZA 3JB9k 2P6SA 2NUUG 2R7XA 3AQOA 1RTHA 1Q5VA 2WVEA 1RWNB 4FYDA 2XGPA 4HHUA 1RTDA 5DZ6A 3ILIA 3W5XA 2Y1RI 2JSXA 3J7A1 3HM9A 3SSQA 2XULA 3FRZA 2YWWA 4J9UE 3MFIA 1N5YB 4DN0A 4LQ3A 2CZ4A 4RW6B 4DUYF 4CTAB 2QLWA 1DAXA 5IV4A 1R43A 2IJNA 2UUBJ 4DEZA 2GV1A 1FD8A 1KLMB 2Z2MA 4TLQA 1W2IA
chains in the Genus database with same CATH topology
1KR4A 1WHYA 5GAGU 2DR7A 3DOKA 5IM0B 4F4WA 1LWEB 2E44A 3EGNA 4A8YA 4LFBF 3DLHA 1Q7LB 3MEGA 4KGKA 4PXEA 3MFHA 2B4UA 2LECA 3GR0A 1NRKA 1U1NA 2XMKA 4KE5A 4X4TA 2FHOB 2BVZA 1ZM4A 3G6VA 5DO2A 3TRGA 2E1RA 3ZZYA 2BJDA 1VQOS 4Q5VA 2JH3A 2LU1A 3B78A 3N6LA 3ISZA 4J9KA 3GZ7A 2K1RB 3HVAA 3V4IA 1F9FA 2GMLA 1Z2ZA 3TVYA 2NXUA 4NLWA 1HL6A 4NL5A 3ISNC 3RW6A 4TU8A 3OLBA 1QTMA 3LGMA 4ID8A 5LMNF 1FDBA 1TKZA 5F41A 2L3MA 2OMOA 2FJXA 5C42B 4F3QA 3L95X 2L9NA 4ZDNA 1VRTA 1S6QA 3LAMA 2FTRA 4YP3A 3HF5A 1VK3A 2HWTA 1A7GE 4TQSA 2MJUA 1S1UB 2ERRA 1JLQA 2JDJA 2VQFF 4MFBB 1S1WB 2DPJA 3FGVA 1MMDA 1GH8A 3V81A 2VODA 4RBUA 1ZM2A 2GO9A 4OMFG 5B0BA 4ZPCA 2I5JA 2F40A 2CQ1A 2L48A 1RT1A 2GJIA 2X3GA 4C97A 4CH0S 1SL0A 1IKYB 1FRXA 2JEJA 5AE3A 3MMAA 2J9DE 4WU2A 2VV5A 3W2WA 5I3UA 2UP1A 2YWGA 2HNZA 2RIJA 4AL7A 3NMRA 3FSXA 2LXIA 1RGVA 2XMJA 3CDAA 5KG3A 1BQXA 2DK2A 5AXMA 1UVNA 2VOOA 2XGQA 2CPFA 2YKNB 1TL1A 3N6NA 5KG4A 4K2XA 2C22A 4IUFA 2DNLA 2D9PA 5E7OB 3I96A 3CDUA 2JJ4D 3M8PB 4B9UA 4CNZA 3IRWP 2NPIA 1FJ7A 4IQMA 1HNWF 3TNVA 4WFAQ 4KV8A 3KLGA 2VQEF 3T5HA 2ADCA 3MMCB 4MIWA 2HFZA 2XG8A 3M8QA 1KRPA 2HMIA 5K8MA 4ILLA 2OPPB 2MXYA 3M9MB 3M9NB 4KPYA 5F8MA 4X2BA 3P6YC 2MZQA 4B3RF 4ZCKA 4QW9A 3PX6A 4ED6A 1L3KA 1TV6B 4X66F 1Q79A 1T05B 4KSEB 3MD1A 2POKA 3DOMA 3QLHB 4IG3B 5D8HB 5K8PA 4UQTA 2KJVA 4MYUA 4KKOB 2RVJA 1Y0HA 4ZVGA 4OHWA 2B3TB 4YDDB 1U45A 3I0RA 3M2UB 2OFGX 3OW2R 4UUWA 2ZC3A 4OI1A 5KFAA 2XMMA 1FTRA 5E3QA 3UD4P 3BS9A 1VJWA 3M6WA 2WK4A 2L08A 4NLPA 1HBUB 4JI4F 3FMWA 1HQUB 4DR3F 3R3TA 3RAXA 2DNHA 4RNOA 4DL5A 2XMTA 2B9YA 1SUQB 2FVCA 3IGNA 3KLFB 2CQ0A 4HL9A 3MZIA 2GO8A 3BR8A 2FY1A 2V8VA 4JV1A 5KFMA 1M5KC 3J7Z5 2C2EA 3UD3P 4ZHRB 1S9GB 3J7ZT 3NS5A 4QWDA 1HFEL 2F8HA 2M7SA 3PIPQ 2HHWA 1UJ4A 1VRUB 3MUTP 5HP1A 2CDQA 3GV8B 3HDSA 3I87A 2JVOA 1TAUA 2NSBA 3DN9A 1C1BA 2F7VA 1R8CA 4M1KA 2WHOA 4X4QA 1RT4A 1UAWA 3QIPA 4C8OA 1RT7B 3KHLA 3MEEA 5L1KA 3QGIA 2DHGA 1UJ6A 3TUZC 4DQPA 1BQMA 3ZZOA 2UXCF 3TW0A 4Z2XA 1Y7PA 4TKTA 2GGPB 2ASLA 4UQGA 1REVB 3DYAA 5FDLB 3TA0A 4EU0A 3TO8A 4ZCIA 3I6PA 3FZ2A 2ZE2A 4P6QA 2CQ4A 2QLXA 4YFUA 2CJAA 4H54A 1A9NB 5GAEU 4IR1A 2QT7A 4FBTA 3Q23A 2H5EA 4DS5A 1TKTA 2JEFA 2HNDB 5F9NA 4YQWA 4RW8B 2ZOFA 3NAHA 3PVXA 1YWXA 1F60B 2R2SA 4B9VA 2ILZA 3CVKA 2B4VA 1DURA 2HQ3A 1SJQA 2DGQA 2XWYA 3C6TA 1S1TA 2RMLA 4Y0FA 3OVAA 2VOPA 4RUHA 3I82A 2AW0A 5DQGA 3FFIA 1NJZA 4LSLA 1JB0C 4H4MA 2C3PA 4DFPA 3HVWA 3PEJA 2R8IA 3OFGA 3Q24A 3ZZPA 2AX1A 4AFFA 4TU7A 2G4BA 4DR4F 2DCUB 2MZ1A 4QCLA 3BGLA 1QUVA 2E9ZA 1UEVA 4DL4A 3FZBA 3H5XA 2PFFB 4OZ1A 1H98A 2HVHA 2AYEA 1T94A 4J37A 1HMVB 2IC3B 2VUGA 3L7PA 4IKAA 2XCPA 4EGLA 1LW2A 4O0IA 4K4XA 4AL5A 4KB7A 5BJRA 3G6ES 2C2DA 1QAXA 3NCRA 4CTAA 2BE2A 2COLA 2J0XA 2YH0A 3GSDA 5K8NA 1U2FA 3FVYA 3WBZA 5KT3A 5DETA 2QA2A 1C1CA 5J2QB 4I1TA 4PR6A 1UWBB 2AF6A 3N0VA 4HEA9 5J2PA 2FVRA 3BGUA 3HHEA 2BW2A 2H9ZA 3THTA 2E1MC 5C25A 5LXRA 2CVEA 3LQVA 2ZOGA 3ZZZA 2FGCA 2EK1A 1VQKS 1WD6A 3DRSB 3E01B 3RYLA 5KT2A 2YNGA 1CVJA 2YNIA 3DLKA 4ZVFA 2I1RA 4OX9F 5KFWA 5IM0A 1TUVA 3M1VB 3OTDA 2YWFA 5GMKa 2YX7A 3E51A 2VASA 1QM9A 4OL8A 2HS4A 2VG7A 1LOUA 4AL6A 4DR6F 3UCZP 1X5TA 3PKMA 5EN1A 4JI5F 1X7VA 3IO1A 4QIEA 4WYLA 3BO3A 1NKCA 2FHKA 4FF1A 2D3UA 3EYZA 2ZKTA 1VC5A 2D9OA 2DGUA 2MY8A 3MCSA 4MK8A 1DQAA 3KG1A 5KFZA 2CPEA 4Y6IA 2LLZA 4ITSA 2WONB 3DXBA 4DG1B 3IBWA 3O2IA 1KVJA 3L7OA 2KJWA 3PR4A 1J5OB 3KYLA 2E9RX 1RAJA 2E1CA 1O5JA 2ZD1A 4QYZJ 1IKXB 3DGPA 2ZNYA 1OSDA 2ZHBA 1ZM3A 1N8RT 2HGNA 3M05A 5K14B 2VPYB 3HHLA 4ED0A 4W92B 4OZNA 1U1PA 4M8LA 1S6OA 2ATLA 1RDRA 4IRDA 2VG6B 2W4DA 4YR0A 2OFHX 4F4ZA 1N36F 2P9EA 2Q6CA 4G1QB 2APOA 2XC9A 2DNQA 2RRBA 1IQTA 1S1XB 1UA1A 1IKYA 2VPWB 1M5VC 2AJ4A 2IM2A 3I9V9 2RS2A 2B4OA 2F9JA 4IFVB 1YSJA 2CPDA 1FK9B 3OR2B 5KOWA 3C6UA 2MPUA 1D3WA 2BBEA 4KJIA 4CI0B 2IFXA 2LQ5A 2MKHA 2BQUA 4DPOA 2KI2A 4U7CA 1KQKA 3OL9A 3LP2A 4B3OB 1U48A 3NCPA 1P1LA 2N7YA 3CDBA 1WNEA 3GG1A 4MK9A 2FVPA 4JI7F 5L1JA 4NXMF 2E29A 3IWXA 3J7YI 3OSPA 2AJQA 5G4DA 4AXIA 4TY9A 5B09A 5LXYA 2QFJA 3FNNA 1FKPB 3D28A 3CCES 1T03B 1HBOB 1UEUA 3VQTA 1HD0A 1W25A 1G6BA 3TYTA 4HDGA 1P6TA 1S6PB 5E41A 3KK2B 3V6DB 1NO8A 4B3SF 4DR5F 3OFHA 5KFVA 1R8AA 2VFUA 3IXQA 3OJUA 5K8OA 3TARA 4IG0A 4WXOA 3Q2SC 3HMJG 1TV6A 4YOEA 4JYAF 1ZBTA 2K8GA 3E3XA 5KTQA 1YJUA 4UY85 3CF5Q 4DSFA 1M5HA 3QLHA 3K5MA 3MEKA 3PDNA 4UY8T 3UDCA 3C46A 4OHVA 2CPXA 4ETZA 2HS3A 3WC2A 1DRZA 1G7CB 1C0UB 5KG6A 2FVQA 1KHWA 3MAHA 4OHZA 1ZH5A 1KOOA 4YHHF 2Y0SD 3K2YA 4HT7A 4IOCQ 1V6HA 2FLLA 4AYBD 1HBNB 3MECB 2PD1A 5KG7A 3US5A 4WFNQ 2N7CA 3HHLD 1LFWA 5AE2A 4UUXA 2ZH8A 5U47A 2M4MA 2CQGA 4X4PA 4PUOA 1RP5A 2AYMA 5HLFA 3SDEA 3AJ2A 2DNRA 2HHQA 1U1KA 4WZQA 1SJ3P 3H25A 2EFVA 4ID5A 2G0CA 4XDCA 1NHVA 2XY5A 2DHSA 3LW5C 2V4QA 2NLWA 1RTIB 1GNKA 5MLCV 2VD3A 3NNCA 2J0SD 2W8KA 1R6YA 1X4GA 2O01C 4TY8B 1URNA 4IRKA 4NLTA 6FD1A