1NO8A

Solution structure of the nuclear factor aly rbd domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
GKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Nuclear Factor ALY: Insights into Post-Transcriptional Regulatory and mRNA Nuclear Export Processes
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords ALY
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1no8A00
1R8PA 4WFNQ 3G96A 3OW2R 2DNYA 3CCJS 2J0SD 2CQIA 4IOCQ 2L9WA 3S01A 1D9AA 1NJIT 2MB0B 4TU7A 2E44A 1R8HA 1VBXA 1X4DA 2LCWA 5CXTA 2EK1A 3CMAS 2MGZB 2DNMA 2ERRA 4ZKAA 1YJ9S 5GAEU 2MZ1A 2CJKA 2LQ5A 1OWXA 2CPYA 4WIIA 2KT5A 3P6YC 1WEXA 2LYVA 2DGWA 2MHNA 4QQBA 3UD4P 1WTBA 4W90B 2QEXS 2DB1A 3MDFA 2CPHA 5IQQA 2MXYA 3NNHA 2KRBA 2KM8B 5IM0B 3VAGA 3CCUS 3S8SA 3VAFA 5IM0A 2MKJA 2DO0A 1YJNS 2MKHA 3CCQS 1U1LA 3HHNB 1HD1A 1XN9A 3HI9A 3NNAA 2RQCA 3V4MA 4WKRA 4P6QA 1FJCA 2JWNA 2F9DA 4OZ0A 3J7ZT 1X5PA 1M90T 2DH8A 2DGTA 2CQBA 2MQNA 4LIRA 3TYTA 5DDPC 2CQ1A 2KVIA 2O3DA 2FHOB 2CPEA 4WFAQ 1DRZA 1YWXA 2DGUA 2LMIA 2X1BA 2KG0A 2MJNA 2JVOA 2DNPA 5DDOC 1P27B 2OTLS 2LKZA 2QA4S 1SXLA 2CQGA 2FC8A 4ERDA 1WG4A 5FJ4A 2JRSA 2E5HA 2DNGA 2KXHA 4YB1P 3UCUP 2MZTA 2ZJQQ 4YOEA 2AD9A 3U1LA 2L41A 4OZ1A 1DHMA 3BO4A 1K73T 1H2VZ 1X4FA 3R27A 3CXCR 2E5GA 2CQ0A 2KG1A 3MXHP 1X4HA 1U1OA 2PEHA 2M9KA 3R1HA 1Q86T 2CPZA 1UP1A 1YTYA 1VQ8S 4IO9Q 2M70A 1SJRA 2N82B 3G8SA 3P5TL 2MKCA 2OSQA 1VQ9S 2VOPA 1VQKS 1VQMS 2XSFA 2MKKA 2LEAA 4LMZA 4TU8A 2X1AA 5JVGQ 2CQDA 1WI6A 4Z2XA 4WF9Q 1HL6A 2V94A 1OIAA 1ZZFA 2DGOA 2LA6A 1N54B 2KRRA 2MMYA 3I56S 4IUFA 2VONA 4Y0FA 2MGZA 2XNRA 5CA5A 3CCVS 2KFYA 1RKJA 2RS2A 2G4BA 1NU4A 2GO9A 4C7QA 1O0PA 3CULA 1CVJA 1YI2S 1N8RT 3G8TA 5GAGU 2NZ4A 5DM6Q 1G2EA 3IRWP 3DLLQ 4V19X 2QFJA 2M2BA 2DISA 5JVHQ 5D77A 1KD1T 3B4MA 2F9JA 2DHAA 1WG5A 1VBYA 2MQPA 1RK8A 3UCGA 1FHTA 5LXYA 1WF0A 3G71S 2JX2A 2K8GA 2MQLA 3D2WA 3CC2S 2CQPA 2VODA 1WHWA 2DITA 3DXBA 1YITS 4ED5A 1U1NA 3S7RA 1OO0B 4A8XA 2SXLA 4PR6A 1D8ZA 3ZZYA 2XS5A 3MOJB 1A7GE 2DNHA 3TP2A 2BZ2A 2RU3A 4C4WA 2CQHA 5EN1A 5D78A 1JJHA 1PO6A 5HL7Q 2DK2A 2F3JA 1L3KA 3VF0B 2EVZA 3UCZP 2MJUA 1U1PA 2MYFA 2XS7A 3SDEA 2MSSA 3L3CA 2LEBA 2ADBA 2KI2A 4J5OA 4QPTA 3Q2SC 1U1RA 1X4CA 2CQ3A 5DDRC 3MUVP 3THTA 3J7YU 1UAWA 1M5PC 1WF2A 5DETA 1SJQA 2RT3A 2ADCA 2VOOA 1SJ4P 3I55S 2XNQA 1VBZA 1ZH5A 2NLWA 1FO1A 2DNLA 2RRAA 3EX7B 2KXNB 2LXUA 1AUDA 2KN4A 2YKAA 2N3OA 1X0FA 1KOHA 2DHGA 1FNXH 3NMRA 1FXLA 3U1MA 2HGMA 4PKDB 2MZRA 1YIJS 2DGVA 2I38A 5GMKa 3Q2TC 4IOAQ 1U2FA 2HYIB 1U1MA 1HA1A 3THPA 1FJ7A 3CCES 1FJEB 3VAKA 5GAHU 2DNQA 3FEYB 4YUDA 1WG1A 3UE2A 3BS9A 1X4BA 3LPYA 1W2BR 3UWTA 2M0GB 3CF5Q 1YHQS 1M1KT 1X5TA 2HGNA 1KOOA 2MPUA 3CC7S 1U6FA 3IWNC 1WEZA 5DDQC 1X5SA 2DHSA 3H2UB 2DNKA 2HZCA 1DBDA 1WI8A 1QVFR 3H2VE 4UY8T 2LECA 5DM7Q 2X1GA 3EGNA 3VAMA 1WEYA 2CPIA 1X4GA 3ULHA 2RQ4A 2AYBA 2EK6A 2FY1A 1F9FA 4M5DB 1H2UX 1WHVA 3N9UC 2N7CA 3VAJA 1WHYA 2AYEA 2YH0A 3G9CA 1VQNS 3MUTP 3CD6S 1N52B 3VAHA 2OSRA 3R1LA 4C0OC 5GADU 2G1DA 2DNOA 1H2TZ 4CH1A 3SXLA 1FT8A 4FXWA 2J8AA 2G0CA 3JB9k 4UQTA 2JVRA 2DNNA 1M5VC 4F02A 1WHXA 2OJ3A 2BOPA 1URNA 2L08A 4FXVA 3LQVA 4TU9A 3CCMS 2ZJRQ 3CPWR 1JJ2R 1Q7YT 3NNCA 1SJFA 2RVJA 2MY7A 2MSTA 2MZQA 5H1SV 3CCLS 2J0QD 2LA4A 5GVQA 1NO8A 2M52A 2LXIA 1WF1A 3US5A 4CQ1A 1K9MT 2YWKA 2MKIA 1DZ5A 2MKSA 2M4MA 2UP1A 1K8AT 3CC4S 5LJ5Y 2MQQA 2CQ4A 4PRFA 2MY8A 2N3LA 2PE8A 2M88A 2J76E 2OIHA 2U2FA 2DGQA 1B7FA 3TO8A 2YTCA 2HGLA 2MZJA 1YJWS 1QM9A 2DIVA 4QU7A 2FC9A 4TLQA 2DGSA 2MZSA 5IFMA 4WCEQ 2KM8C 3UD3P 2M8DB 5BJRA 1X4EA 1VQOS 1A9NB 1VC6A 3B4DA 1U1KA 3EGZA 2E5IA 2D9PA 1U6BA 1PGZA 1BY9A 2CPJA 4CIOA 1KQSR 4U67Q 2RRBA 3SDEB 1M5KC 3MURP 3NS5A 1VC5A 1Q82T 2KXFA 4WFBQ 3CCSS 1VC0A 3ZZZA 2DNRA 2YH1A 2M7SA 2KYXA 1VQ5S 2AYGA 2CQCA 2RUGA 3RW7A 4Y00A 3FEXB 3CTRA 2AYMA 1JMTA 4F25A 2KHCA 1VQLS 2FPHX 3RW6A 1WWHA 3K0JA 3BO2A 3G4SS 4F26A 2DO4A 1S72S 2E5JA 3P3DA 5HO4A 3MD1A 3BEGB 5LXRA 5MLCV 2KU7A 1Q81T 2DHXA 2WBRA 1VQ4S 2CPDA 1JJ4A 3P49B 3PIPQ 1VQ6S 3MI7X 2GHPA 4QU6A 3CMES 4W92B 2XS2A 2KH9A 3CCRS 4BS2A 2DH9A 1HD0A 2OTJS 1S79A 5LSOA 2DIUA 3G6ES 3CUNA 1H6KX 4EGLA 1QVGR 1ZZNA 1U1QA 1VQPS 1OPIA 2RNEA 2B0GA 2M8HA 2D9OA 2I2YA 3SMZA 2HVZA 4RU2A 1IQTA 2DNZA 2DGXA 3MUMP 4LJMA 2XB2D 2DH7A 1X5OA 2CPFA 2CPXA 1KC8T 3NS6A 2RS8A 3BO3A 1WELA 3MD3A 3PIOQ 5ITHA 2K3KA 1SJ3P 1M5OC 5LJ3Y 2X1FA 4CH0S 5LSLA 1UW4A 2ZJPQ 3VAIA 1P1TA 2D3OR 2MQOA 1VQ7S 2CQ2A 2A3JA 2U1AA 1UFWA 1N88A 3VALA 1X4AA 5CYJA 3S6EA 2MQMA 2Q79A
chains in the Genus database with same CATH superfamily
5J2PA 4Y2IA 1SQFA 4BHQA 2JDJA 4ILLA 4NYPA 2CQIA 4IOCQ 4EBDA 1HWKA 2G0JA 2V0NA 2AJ0A 3FKBA 1HKAA 3CE8A 3ITHB 4IO1A 3S01A 1KONA 4B9TA 1RTHB 2P2CB 4ICLA 1NBEB 3AB4B 3DMJA 1UVKA 1EJ7L 4DR1F 5HQ8A 4G1QB 1SCJB 3LF0A 4ZIWA 4NCAA 5I42A 2F5GA 3K8WA 4OI6A 1FD8A 2KB2A 1S6OA 3TRGA 4HYKA 3RB0A 2MGZB 1UVMA 3ZC4A 3PY8A 3QGGA 2GHWA 2KZZA 1YJ9S 2KVQE 4UF4A 4X4TA 1N4LA 4LF6J 4X4UA 1Z2LA 4B17A 4CTAA 5KFHA 1T8EA 1RYRA 4RNHA 1T3NA 3QGHA 5LMNJ 3MM6A 2R7RA 4AXJA 3AD8C 2DVIA 2OI2A 1MLAA 2ZOMA 1JLCB 2CPYA 1V6HA 4NEZA 4CDIA 4ED8A 4A8YA 2LYVA 3IM9A 2XY6A 4DV7J 2JEJA 2IBKA 1VRQC 3D4JA 4LFBF 1FXDA 1S9EA 2FIUA 2JHEA 4M63A 4D3HA 3A8EA 5CYQA 4ID5A 5KFQA 1WOOA 2UVVA 2JC0A 2KM8B 3KG0A 2BJ9A 1S76D 1M1GA 2QA1A 3EJMA 2NPFA 2NXEA 5IQ6A 3S8SA 4E2FB 1XMOF 1VK3A 1NK0A 4LVOP 5IM0A 2HNDA 2HHWA 4XO0A 1RWUA 1X8DA 2WONB 3JQKA 1NK7A 2MKHA 2XZTB 4OHWA 4XPEA 4MMOA 1JX4A 3LP1A 1YVFA 6FDRA 3TUIC 3SCKE 2VA3A 1BLUA 3IBFB 1IR0A 1RWKB 3HHLB 2WRMA 2YX1A 5A6PA 1QAIA 3OFFA 2Z0GA 2YWFA 2HKEA 3NCQA 4DPXA 3H90A 2WVEA 3MECB 4ECSA 4WKRA 4M5GA 3GCXP 2DBBA 3PACA 4KV8A 2C22A 4RW9B 4B3MJ 2GJIA 4DOZA 1P8GA 2F9DA 4OZ0A 4A8KA 1V3RA 1R6YA 4P2SA 3I6PA 1X5PA 2J7WA 2AEFA 3OXFA 3SV4A 2OP5A 2NXJA 4USTA 2R2SA 2O3DA 4N77A 4OYPA 2FHOB 2CPEA 4KIAA 2B3TB 2VF3A 4WXOA 4B3TJ 4FKYA 2R4FA 2G2OA 3ILLA 5L1LA 2PT0A 2HWHA 1IUJA 3W2VA 2GVZB 1MROA 2VH7A 4C8OA 4B3OA 3TJ8A 3BH6B 5A6WA 3JSRA 2WAQD 5HVFA 3VGSA 1JLGA 2QSWA 2B5JB 2ZDOA 4IFVB 2VG5A 4B3SF 4NXNJ 1SXLA 1WG4A 3FBCA 1MW7A 4UTGA 1MWZA 2DKOB 1VRTA 4NRTA 1H7WA 4YR2A 2MZTA 2MLYA 2X3DA 3GB0A 5M2RA 2FJXA 2E7XA 2ZHAA 2HFNA 2ZZTA 2GCFA 1EARA 1S1VA 2Z2LA 3U1LA 4CO4A 1RU2A 1JJCB 1DAXA 1IKVB 3HHDA 3QBCA 4DV3J 1RHQB 4LR9A 3R27A 5IWAF 3CXCR 3KHHA 4M5IA 2E5GA 1H98A 1X9MA 3N0VA 5E3RA 5C42A 1T9TA 1SC3B 1XR6A 4FVCA 5J2MB 1KLMB 2YWEA 4YHHJ 1X4HA 4WZQA 2GMLA 4B08A 4IG3B 1YDLA 2PEHA 2G9OA 2HWTA 1HBOA 1N33F 4KH0B 1Q5VA 3SYZA 3ZZUA 2HQFA 1GMUA 5E3QA 2M9KA 5A0YB 5CYMA 5H9EJ 2BOAA 5D0RA 1YJRA 2IA6A 4ES2A 1LWFB 2R2UA 1XERA 5D4LA 2AMCB 3GILA 2HS0A 2M70A 4CLPA 2LEPA 1SJ1A 3MFHA 2EFNA 1V3ZA 1FA0A 3AA8A 1C0TA 3MM7A 2FVRA 1UPMB 1IR2A 3T1HF 4LF8F 3HVAA 1RJJA 4PXDA 2EKYA 4LMZA 4Z2XA 1CULB 2XMTA 1HL6A 4IYQA 3KLVA 1U48A 2DCLA 2V94A 1FJGF 4JOUA 2FGOA 2DGOA 3JQMA 1N54B 2ZBIA 4MFBB 1R8AA 1DTQA 1RQ0A 2ZD1B 2XMUA 4Y0FA 3RBXA 1U45A 3I4PA 6FD1A 4XDCA 4P2MA 4UT4A 1FTRA 1HBMB 3AA9A 3DM2B 4NZ0A 3NRBA 4GKKJ 3G8QA 3ZZPA 1OYEA 1TL1B 4C0HA 2JEGA 1RKJA 4ZHRA 5KTQA 2NPIA 3M2RA 4QWEA 2DXDA 4P72A 3BGFA 4OX8A 4JI1F 2OPQB 3FDSA 4ZPVR 3MR6A 1S49A 1UJ6A 3VCDA 3W8GA 4ED0A 1VS3A 2J0WA 1JLQA 3AY0A 2GIFA 3EMTA 2FVQA 1FHTA 4WXWA 1KFDA 4U6PA 2ATLA 1IWGA 1VGYA 2W7PA 2BYCA 3WHIA 1VLYA 4JI2J 4RW4A 3GPAA 1RK8A 1Q5YA 2OUGA 4MTPA 2EFOA 1H38A 4Q8EA 5E5NA 2W24A 5KG7A 1HPZB 3M8YA 1FKPB 2D3ZA 4UZBA 3CC2S 2Z2MA 1TVRB 2CQPA 4U8VA 2YNFA 3W1YC 4TQSA 4K4UA 3I96A 1UPPA 3WDOA 2ZUAA 4PEOA 4ED5A 1RT6B 4QWBA 5HN0A 3PZPA 3WZ0A 1HI1A 2ZH9A 3W3SA 5IT9Y 3GIJA 2XWYA 2HFUA 1HW8A 5GMDA 1D8ZA 2HZAA 1U8SA 1HNVA 2XS5A 1RAOA 1A7GE 2UV8A 1RHUB 2ACMA 2NCKL 3FSYA 4U9RA 5KT4A 4KGKA 5ETPA 2HMIA 2QV6A 3M2UB 4F0MA 1XBWA 5EN1A 3CVKA 1R8BA 5HL7Q 3D6HB 2DK2A 1FK9B 4M1KA 3CCZA 1CQNA 1L3KA 1FI4A 5CZVA 3BSAA 4O3OA 3VF0B 5J1EB 5A8KB 4R5PA 3NGDA 4MIWA 2I9SA 2OMOA 1U1PA 2MYFA 3RTVA 4DN0A 1BQNB 3BR8A 1N36F 2MSSA 3L3CA 2CJ9A 2AX0A 3H5YA 1EAYC 3M32B 1HD1A 2KI2A 4QPTA 2ZH4A 2PI4A 4JI2F 3KMQA 1TK8A 2CQ3A 2JLFA 5DDRC 3FQLA 1KDNA 3THTA 4D3GA 3J7YU 3DOKA 3H4BA 4ZVRB 1UAWA 3MGJA 5KG1A 5T14A 2PD1A 2FJVA 3BDPA 1UVLA 2EFGA 1SJQA 2UXCF 2IFXA 3PG9A 3BBBA 2RT3A 3HKWA 2EFPA 3ZZTA 3EVWA 1VIOA 4BDPA 4KJIA 3M8PB 1BC6A 4O3QA 1VYAA 4BC7A 4ZN1A 5LOQA 1NRKA 2PMHA 3I55S 3DRSB 3DM2A 5B0DA 3MAQA 1GAOA 2E7VA 3PRVA 4ITSA 2E5LF 4LQ3A 2DNLA 2DT9A 4OYMA 4PWDB 4I6YA 2RRAA 1PC5A 3HPOA 5J2QA 3DLGA 1NDKA 2UUBF 3DHWC 1OSDA 3RAMA 4LFAF 1FXLA 2B9XA 1P1LA 2MZRA 2OAUA 1C4AA 3FGVA 4K7QA 4FZVA 2Q6BA 2XC9A 5GMKa 1RT2A 1NCLA 3HFVA 1PAEX 1RT4B 4NLXA 4P2XA 3QNWB 5HLFA 1U1MA 4C2MA 3SCJE 3J80Y 1QE1B 2IA0A 3LH2S 2A6OA 4USIA 1L3TA 3CCES 3PYDA 3VAKA 2N7YA 5GAHU 1UEUA 1NZAA 2DRBA 4O3SA 4NCGB 1HW9A 4QWDA 1JXVA 5B0BA 5D0EA 1S12A 1Y5NB 4RUBA 4ZVTB 4E98A 3LPYA 3T6JA 3K5MA 4JI4J 3K0JA 1S59A 3MM9B 3QO9B 4GVBA 1ZTWA 2E9ZA 2AJ2A 3GMGA 4H4OA 4G3IA 2R7QA 2A18A 3V5RA 2FVSA 4EU0A 3CDWA 4M8LA 1TKTB 3KK1B 1SL0A 1TL3B 2KFZA 3D3BJ 4WE1A 2HFSA 4PABA 2E9TA 2HS4A 1SI9A 2LDIA 2ZWPA 3CT9A 5DDQC 5KG2A 3K89A 5L1JA 1XMBA 2VQFF 2FHKA 3OTEA 1KVJA 5CAAA 4MH8A 1YGYA 4LRCA 2KT3A 2YKNB 4NA2A 5DGBA 4X66J 4JV5F 3EICA 1BHNA 2FJBB 4M5NA 4H4MA 1YK9A 1F5CA 3EXYA 4FF2A 2LP4A 3JXOA 1JLBA 1RAFB 4WWSA 5JXSA 3WBZA 1WEYA 1PJ6A 1X4GA 2IDEA 2ZVIA 3PTWA 3R5AA 4H4OB 4ED3A 1ZM2A 2AYBA 5DJBA 4RKUC 2EK6A 3OL6A 3NBPA 2FY1A 3D6MB 4M5DB 2UU9J 4ZMMA 3CO0P 1SH2A 1H2UX 1WHVA 5I3PA 2N7CA 3KLEB 1TQLA 2VG7B 2YH0A 3CD7A 3N6NA 4AT1B 1VJQA 5A8WB 4HKQA 3D67A 3ISZA 3CB4A 2AZ3A 4PQUA 3PR5B 1HMVA 4QIGA 3VAHA 3CJ8A 3ENQA 3R1LA 1O5JA 4C0OC 5GADU 2R7VA 5HLFB 2DXEA 2LU1A 2IM3A 5L38A 3HVRA 4B3TF 1FF2A 2UUTA 2RDDA 2DNOA 4OYWA 2WTFA 1BWEA 3PX6A 4Q0BB 3DGPA 5A2QY 4EZ9A 4G1PA 3MR7A 4WU2A 4R8UA 2EBEA 1TZ0A 2J8AA 2Q43A 3IRXA 1RAJA 3U1NA 5B7WA 3PX4A 1R0AA 1H72C 4FN5A 2IJNA 5DG7A 1XWLA 2BANB 5KFTA 3JB9k 3V4IA 2FZKB 2JVRA 3IA0A 5F8HA 4WFXA 1CBKA 1WHXA 1M0SA 4OI1A 1URNA 3T5KA 2GW8A 2L08A 3DOKB 2BJEA 4ZVSB 5A8WA 3QRQA 3BGLA 2CDRB 3J7Z5 3A3PB 3CPWR 1NH7A 1TL4A 3SSRA 3EVMA 5D3GA 2MZQA 3EGVA 1WSVA 1S7IA 1T9YA 4OI2A 3M4XA 5GVQA 5HAOA 1XMOJ 2R7SA 2IM0A 1NO8A 2FY8A 4DF4A 4CQ1A 3DRPB 2NQPA 4CYUA 3ONQA 1N48A 2CXEA 2W8KA 1TKZA 1TV6B 4RW4B 1K8AT 3AOCA 3DOLA 3FFIB 1VI7A 2CYYA 3KJFB 4OZ2A 2CWKA 2BJ1A 2L48A 3QATA 1WC1A 2GJ2A 2OIHA 4F04B 4J9QA 4AL5A 1GH8A 4LF1A 2YTCA 3M05A 4JI1J 2RF2A 3HSJA 4QU7A 3R2DJ 2C28A 4G1QA 5IFMA 5K14A 4WCEQ 3UD3P 4GC7A 2M8DB 4ATNA 4DLEA 1UJ5A 1NJWA 4GRSA 1S6QB 4DV5F 2DR8A 2WOMB 5D0HA 3VGVA 1VHIA 3SZ2A 1VQOS 1QSSA 2UUCJ 3SCIE 3B4DA 4A8WA 1OY6A 1U1KA 3MEDA 4NE9C 2E5IA 4Y6IA 1PGZA 1BY9A 2F8HA 3SQGB 3AHPA 4LR8A 4JYAF 4J9UE 5LM7E 2RUSA 1EB0A 1VDHA 2CPJA 2V8PA 2VFVA 4UOHA 1QE1A 4U67Q 3SDEB 4F3OA 4I0WA 1LWXA 3JSMA 3POTB 2V4JB 1KVKA 2ZBPA 1DLOA 1YJ7A 4ZCLA 4DFJA 4ELVA 3TR5A 4FF3A 1FDBA 2AJQA 1VQ5S 1PBUA 2AJ1A 2P6SA 2CQCA 4P2FA 3PHTA 3IBCB 4RLEA 5ETMA 1KS2A 4Y00A 1C0TB 3UDCA 4X66F 3CTRA 3VGTA 1XMQF 1AFJA 3Q89A 2FB0A 2R42A 4OZLA 1K0TA 2KHCA 2VFUA 5L9NA 2PDAA 4CI0B 2VFSA 4P7VA 3FZ2A 3I0RB 3L09A 3ENVA 4FP9A 4MKAA 3P45B 3BO2A 5I3UA 3NCPA 4DXLA 1TKDA 1NJXA 5B08A 4N76A 7AT1B 2XMMA 4N56A 3MD1A 1NKBA 5IT0A 3HP6A 4F4WA 1SC1B 4ZP7A 4DFPA 4FVMA 4B02A 1RYSA 3PKMA 1ULRA 2YVSA 2C2MB 5HROA 1JJ4A 2FLLA 3PIPQ 3P49B 5D0GA 4QCLA 3T5HA 2B7BB 3MWBA 2J9DA 1RT7B 3ZNJ1 1LK7A 4LBIA 2BJ8A 4LBPA 4NLWA 2YKQA 3GCWP 4JI0J 3QRPA 2L41A 3KUHA 5HJYA 3CCRS 3HX9A 1S57A 2EC0A 3MEGA 2ZHBA 1AUSL 5LSOA 1HWLA 2HBRB 4OYIA 1CJUB 2RILA 4ALZA 3WC2A 1D9DA 2OO4A 2X7IA 1JLGB 5M2UA 2RU9A 5KT7A 4F4YA 1NHVA 2QSFA 1SL1A 1T94A 1QSYA 1VQPS 1L5UA 2Z57B 2X1FA 2M8HA 2D9OA 3TZYA 3BDEA 3C14B 4DV1F 1IQTA 2QX0A 3JS9A 1YJUA 4LJMA 2PA3A 1QY7A 5A0YA 3W63A 4JI3J 1ELOA 1FKOB 2FUG9 2YWGA 2MHEA 4KGZB 4AL7A 1R27B 2AHOB 4ENOA 1S6PA 3NS6A 1IBKF 2RS8A 1WNEA 2A10A 1S9FA 3R5CA 1EIYB 2FDNA 4ES1A 3M9OB 2V6AA 5K20B 3WQPA 3PNIA 1LEOA 1SJ3P 1HLWA 1NXIA 1FRLA 1FWKA 1RBLA 3QWPA 4CO1A 3V81A 4ELTA 5E2QA 3C3LA 4KAIA 1RWPB 2HQCA 2ILZA 1UCNA 3QLHB 5BYSA 3VAIA 3HHLA 5KFLA 2VHGA 4FXDA 1VQYA 2D3OR 2IM1A 4HEA9 3VHQA 1F9HA 3LANA 3DRPA 4LREA 2YQ1A 2CQ2A 2A3JA 4OHYA 1UFWA 3PFEA 5D4PA 2NYIA 1RGVA 2VZ9A 4OZJA 5E41A 2H51B 2BKNA 5CYJA 4K4XA 2KVIA 2Q79A 2HHUA 1R8PA 4B9SA 4MK7A 1N56A 1B4SA 1YJVA 2COLA 3FBBA 2OHDA 2GV1A 3OT9A 4LSLA 1AW0A 2VPZB 5KFGA 2B43A 2QRRA 2XCPA 3Q0AA 1R0CB 4TU7A 5HQMA 4C3KA 1LW0A 3ELHA 5KFSA 2ZE2B 2CA9A 3ZZ0A 4K4YA 1FFGB 4DX6A 1R8HA 1VBXA 1J5EF 1ZPVA 2GIQA 5CXTA 5H9FK 4Z7CA 2HK2A 2BJDA 2VG6B 3TNVA 2R2RA 2ASDA 3P5BP 3HHLD 5EWFA 2OMLA 2I5JB 2MZ1A 4O23A 4NCBA 2CJKA 2LQ5A 3DLKB 4OYBA 5IC4B 2G1HA 1RWNB 2F1FA 4S0MA 2ZBCA 1OWXA 4NASA 5HQLA 1R0AB 2OPSA 3UVJB 4Y28C 1KFSA 1I51B 1VRUA 3H5SA 4KHMA 2KT5A 3NWRA 4LSNA 4FS1A 1SUQB 4TLRA 2DGWA 3LGHA 1GXLA 1WTBA 4OJ3A 1BD6A 4I1TA 2RSQA 5KFEA 2QEXS 4FF1A 1CQMA 4LSZB 5AT1B 2DB1A 3GLJA 2QA4G 2CPHA 4DQQA 2JL9A 3QJLA 4PYDA 1XJWB 3NNHA 2IVFB 3GJRB 3PW0A 3QSIA 1UWBB 4F2RA 2HLUA 3AB2B 5IM0B 3VAGA 1S1XA 4K2XA 4KYZA 4F4XA 3BBCA 1TUGB 4TNOA 3T5LA 1RAHB 3VAFA 2PEBA 2C3YA 4KH1B 2K3IA 5E33A 2W2PP 3TZZA 1MMNA 1YJNS 4WZMA 3HHNB 1TKXA 2ZFHA 3W65A 4YDDB 2D3O1 3JYTB 4PAAA 4YDXA 1RLCL 1KHVA 3FBFA 2YNHB 1S9EB 1KQKA 1GQEA 1HQ2A 5KG6A 3PW2A 1Y10A 2QLWA 3BPDA 4O3NA 4LF7F 3IAM9 2PIIA 3HT0A 3PJXA 1Q8KA 2A6MA 2CG4A 1YSJA 1YLXA 2EPIA 4CLSA 3R97A 4Q43A 1FJCA 4RW7A 1K0VA 5I42B 2RQKA 4LQ9A 1RLDA 5HVGA 2RQMA 2Y0SD 1VLOA 4MYTA 2HFVA 1M90T 3OL7A 1HI8A 3GSDA 1MG7A 3FQKA 1U47A 4TY9A 1LW2A 5FLXU 1Y00A 4KFBB 4JI3F 3MFIA 1GT8A 1S1XB 4DX7A 4ED1A 1DRZA 4YN3B 4C9DA 1RISA 1UWBA 4URGA 3KTQA 4TKTA 2P9EA 3N6LA 2DGUA 3QAEA 1WJ9A 3C14A 4ANCA 1B7FA 4ICLB 4FNHA 4DQPA 1Q79A 5IV3A 1A6LA 3T19A 1AT1B 3JSYA 3HFKA 3CJ2A 2MJNA 5L9XA 1S7HA 1H74A 2DNPA 2M5YA 5DDOC 2YNFB 5C7PA 2CQGA 3PEHA 4YS2A 4HH0A 3PR4A 2JRSA 1JNZB 1VFJA 3WIVA 3RBEA 2XTJP 2E5HA 2GGPB 2DNGA 2YNGA 5T7LA 5C5JA 3UCUP 4AE5A 1SPBP 1HQEB 2M3DA 2VJUA 2IC3A 1NNDA 2CUYA 4RWWA 1RSCA 3A1YG 2D3UA 3FZBA 4OZ1A 1B70B 4ZPTR 5AE2A 1FRHA 1V9OA 2FHJA 3I31A 4KC5A 2E1CA 3T41A 4O4GA 1AZSA 4NLGA 5KFDA 5E7OB 3BR9A 3QIDA 4OYOA 2KG1A 1Y5IB 2ROGA 2CZ4A 3DFEA 3QSYB 1IKXB 3J80U 3CO9A 2NYHA 3RB4A 4P71A 4P10A 2C2OB 4KE5A 4IQMA 3KLIA 2CPZA 4UOGA 3DDIA 5LT5A 1YTYA 1F3VA 4LFCF 1VQ8S 4OJHA 3KK3A 1WSRA 2XSJB 2XCAA 1W25A 4TQRA 2N82B 3G8SA 1R7IA 2MKCA 2IDLA 1UEKA 3TJ9A 1VQKS 2DPIA 1Q95G 4RW6A 4CLYA 2MKKA 2RE1A 2D74B 4N41A 1SUQA 2LEAA 3CGIA 1HYSA 3IBWA 2AX1A 3M7VA 5F3ZA 2RKIA 4TU8A 3THVA 2HNZA 2H9ZA 4I68A 4ZVPB 3ET6A 3D9BA 4WFYA 3TVKA 2E66A 1EETA 2MMYA 3I56S 5CHCB 2W7OA 4IUFA 4JYAJ 1VBKA 2C3OA 1N6QB 3IP0A 2EI5A 3L7OA 1MMLA 1T9VA 2CIMA 2IRXA 5AXKA 5GMEA 3W7BA 2MGZA 4CLZA 1S0OA 4CCHA 1EQMA 4ZPCA 2R8GA 4DSJA 1ZOTA 4ZPDA 3OHBA 4RW8A 4B9UA 3CCVS 4H4KC 2W7AA 2ZOGA 1AROP 1PG5B 4OV1A 1I6JA 2H54B 3I0SA 2GO9A 4GO5X 1O0PA 3CJSA 2IRUA 4A8OA 2UXBJ 1IM6A 2AJ4A 2VBYA 1N8RT 5C2GA 4JI6F 5DM6Q 2WSCC 1MU2A 4DZ6A 3DLLQ 1G2EA 4LF4J 1RKIA 4Y65A 2K06A 2HBQB 1S1TB 2QA2A 3J81j 2DISA 5AJ3F 3OVBA 2HHVA 1PAUB 4MK9A 3V6HA 2V8VA 5J2MA 2F9JA 3HLUA 5M2PA 3RRGA 3CIZA 1Y9OA 2W9CB 4ECZA 5LXYA 1WF0A 3G71S 1HPZA 2JX2A 3K59A 4ZN3A 2ZM6F 3KG4A 4DL7A 4ANEA 1GK8A 2FD2A 2ZVSA 3P96A 3QGPA 4X64F 5H9EK 1FRJA 2O66A 3GG0A 3R6GB 3D2WA 1WC0A 1M1HA 1WTFA 3W2WA 3TUPA 2V8GA 2QLBB 2XMJA 3E01A 5CZXA 2B5JA 4LF9F 3DOMA 1XC9A 2F65A 2FYXA 2DITA 4IFYB 1DY3A 1JXEA 1YITS 3GFHA 3B8HA 4IH7A 2FZCB 3S7RA 4DSFA 2RMLA 3KLFB 1SB6A 3AD9C 1U4BA 4NLTA 2KHDA 1TMJA 1Q0NA 2SXLA 1MU2B 1NLKL 2D7SA 4L3KA 3MM8A 3LUYA 4PR6A 4DR1J 3HJVA 1ZYQA 2ATCB 2VC1A 1FESA 4LRAA 5CD4H 4JI5J 4NI2A 2CQHA 3AJDA 4C4WA 1JB0C 1N6QA 5D78A 1FRKA 3HMJG 3F44A 2V2VA 2VJVA 2HIQA 4MYUA 3R5JB 1U7LA 4EWTA 3A3OB 2MJUA 3Q8VA 4IG0B 3WX8A 4Z7YA 4C8NA 4Z37A 4DF8A 4F7VA 5CH7B 1RTDA 1NUEA 3C15A 4Y2CA 4OX7A 3PXGa 4KB7A 2AGPA 1XK8A 1VCTA 3EUNA 5T7LB 5LL6d 4C3LA 4QBUA 2LEBA 4M5HA 4DQRA 1GXTA 3PW5A 2ADBA 2VG7A 1RACB 4DR3F 3RAQA 4E0DA 4ZP9A 1X4CA 4AFFA 1G4CA 1SL2A 3CJ0A 2F4VJ 4ZJLA 2IBOA 3MAAB 2FZGB 3VQSA 3KHGA 3BN4A 2KT2A 4ZS6A 4C11B 4WKYA 1T03A 4ZLPA 4ETXA 4DEZA 3UDLA 2HVHA 1PCAA 2PFFB 4ZCIA 4NA1A 1PBAA 2AEMA 4J9RA 2ADCA 2V5HG 2HQGA 1JLBB 2J7KA 2FGCA 2W01A 1GTHA 4RW7B 2MDAA 4ZLNA 3GFXA 1ZH5A 1FO1A 1R3NA 3BGUA 2I8EA 2YKNA 3PM9A 2HQ3A 4ZVGA 1LXNA 3CJKB 4C8LA 3J81Y 1RAEB 1VISA 2QFIA 4H4MB 4BCAA 1SV5B 3WX4A 2B4UA 1KEKA 2KN4A 2AQ4A 1KHWA 1KOHA 1FVSA 2DHGA 2O67A 1FDNA 1S1WB 3CMQA 4PYAA 5K5MA 4EYIB 3NMRA 2KZMA 4PKDB 1WUUA 1N5VA 4ZJQA 4X4VA 4J9KA 1CJTB 2I38A 1UMJA 1NB2A 3BKFA 3PJWA 1M5SA 1GMWD 2HYIB 1H73A 2PI5A 5D3GB 1QD1A 1HA1A 2BXJA 2MTLA 1N0VC 2Z30B 3TAPA 2XMWA 3THPA 3IWLA 4JI7J 3TW0A 2YBVA 2E7WA 3PW7A 1VQSA 3JTPA 1FJEB 1FKAF 3LO3A 5DZ6A 4ZA1A 3W5ZA 1K47A 2DY9A 2QMWA 5K8MA 3FEYB 3L95X 9RUBA 4LSNB 3H25A 1RT1A 1Q1KA 2YQ0A 3BS9A 4WYWA 5CD4A 4H4KA 1L3VA 4L3NA 4L6V3 3BM7A 1HHQA 2JLEA 4B9VA 3KHLA 3CF5Q 3D1OA 1F5BA 1R43A 2LU2A 3CEDA 2IPOB 4ZVUB 3BQ1A 3T3FA 1RUSA 2P9GA 2HEKA 3PO5A 2WSFC 4OYXA 4KFBA 1BE4A 1HNIA 5CQGA 4KV8B 3EPGA 5ETLA 1X5SA 2OPRA 3H2UB 2DNKA 2YKMB 4CNYA 1TELA 2FVCA 2I5JA 2VICA 1WI8A 3MZIA 2E5LJ 2NREA 4IR9A 1QVFR 3UR3C 4ECUA 4X65J 3HULA 2LECA 3DRYA 2HURA 3NGUA 4HHJA 1IBLF 2WCXA 2JEIA 3EM1A 3AXKA 1D3WA 3IR5B 4ZVOB 4BLGA 2CPIA 1EKRA 2EXUA 3QFWA 3K58A 4NPOA 4ZPWR 3TJAA 1IXKA 1LV5A 1ZPWX 1N32J 1F9FA 5DO2A 5KFKA 2BQ3A 1HNXF 2W4DA 2MKYA 4WBFA 4LUBA 1K44A 2HHSA 1RTIA 1JLFB 1WHYA 2CNOB 2AYEA 2H4WB 2HK3A 2LQBA 3KUEA 3OTDA 3AAWB 4P75A 4Y2KA 3W9HA 1ICEB 1KBRA 4QIVA 3K57A 1N36J 4KHPF 4CLWA 2RDIA 4KT0C 5G0RB 4DU8A 4I67A 1N52B 1S4FA 2IYIA 2OSRA 3QLHA 4QIEA 3NAIA 2BE2B 3M8ZA 1TUWA 1N5SA 3POTA 3RU0A 4U95A 4O0IA 1RWXB 3IRXB 3QMQA 5HJXA 3MPDA 1FT8A 1H7XA 1NB7A 3KDOA 4OFZA 4FXWA 4UUWA 2C2RA 3UN5A 1I94J 2Y9HA 1WC4A 4J91A 2YX4A 2F40A 2EFQA 2MLXA 4L76A 3D0IE 3JSBA 4JUZA 2IC3B 4F4ZA 3C19A 4DPYA 1L3SA 1RWWB 4I2QB 2Y8WA 3R2CJ 3I0SB 4OLOA 5DG8A 2C3UA 3VR1A 4AYBD 4LSLB 1SVDA 2R2TA 4JI7F 1TFYA 4DQIA 1FVQA 4TU9A 2V4RA 4Q44A 2ZJRQ 1LW0B 2EW9A 2ZNZA 3BPSP 1Q7YT 4EZ6A 3QZ7A 2RVJA 2HFZA 5KFMA 1XNQJ 3O3LA 1RHMB 1LQ9A 4ES3A 2B8QA 3BF4A 1ZAXA 3D1QA 4WP3A 4ZDNA 1QAJA 4Y3CA 2M52A 1K9MT 3US5A 4DLGA 2OLWA 3KJQB 2XBPA 3W2WB 1N5YB 2MKSA 4MK8A 2M4MA 4DCJB 2Q3PA 4ECWA 1QLNA 3LALA 4JI0F 2MQQA 2CRLA 1FWPA 2LDYA 3ENWA 1VK8A 4G1IA 1MN7A 1R89A 1N34F 2J9EA 2DGQA 2U2FA 3BB5A 5A8RA 3TA1A 3TO8A 5GAGI 2W9CA 1HR0F 1S77D 5F8IA 2FC9A 4WE1B 1NJZA 1WKLA 2JC1A 4HI1A 2DGSA 2H3EB 2MZSA 4NYOA 4URQU 3T1AA 2EKNA 3TZXA 3OSPA 4M94A 4K0KF 2KM8C 4K4VA 5DQHA 4HI2A 3U02A 4K50A 3BYRA 5B0EA 2AWZA 3UN3A 4DCOB 3EYZA 1RTJB 3M2RB 3IS9B 5IC6B 5L39A 5J2NA 4KPYA 4GKKF 2BE9B 3GP9A 2FLNA 1YRUA 4HH1A 4XK8C 4ZP6A 1Q8LA 4KGXB 5E0OA 2GNKA 4PXBA 1NHKL 3ENAA 4A8SA 4MFBA 2OELA 4N8NA 5EX3A 3R6LB 2BA9A 1M5KC 2J9CA 1G3OA 2B56A 1GX6A 2V2QA 4YY3F 3K5OA 2KXFA 3H20A 4ED4A 4WFBQ 3PW4A 2J6TA 3KNAA 4ECTA 4K4TA 5AXLA 3HSDA 4HLBA 5AXMA 1RTDB 3EPIA 1LWEB 2OD4A 3HZGA 1OYDA 4JB8B 1ZA2B 2RUGA 3CJQA 3PKYA 4QPXA 1U09A 4J9SA 3R5GA 1JMTA 1HYSB 4L72B 5JMNA 3RW6A 1HNVB 1M5HA 3DLJA 1HBUB 1F1BB 4USJC 1I5OB 2HAFA 2DO4A 3NY0A 4FNIA 3GSIA 2QLJB 4YFUA 2XHCA 2BRKA 2NS1B 1S72S 2WW4A 4DL5A 3BEGB 1SC4B 3GG1A 4I2PB 5HROB 2R7TA 2DTJA 5ETQA 2RF2B 2EFVA 1RT3B 1HBNA 1TVRA 3LWLA 1IKWA 1LWFA 2FJDB 2DHXA 3L9ZA 4OV6A 2WVDA 1ZTTA 1HHTP 3ILIA 3TA2A 2Y0BB 3BGRA 5FD1A 3HZEA 1KLNA 1EX8A 4LRDA 5I3QA 1SQEA 2HG4A 4IKAA 5EGYA 1UKUA 4BS2A 4YB5A 2IY5B 1BQNA 1AZSB 1OQ3A 2DH9A 5AJ3J 2AGOA 5JJBA 4O44B 3OTBA 2V9KA 1S79A 3FUYA 3SSSA 3OUYA 2DIUA 4OYAA 3K5PA 2CDQA 5HP1B 4BBYA 2F8MA 1H6KX 3JSMB 4USHA 3DU6A 4HR2A 1FK9A 4ECXA 4CT8A 1HIYA 1VOMA 3HFZB 4DWIA 4YR0A 1U1QA 2ASJA 1S9GB 4USWA 1OQ6A 4QZVB 3EZ5A 4ANDA 3V81B 2I2YA 3SMZA 2XGQA 4F8RA 2X51A 1RT3A 1FDDA 3CJTA 3E51A 1KSPA 3P8BB 2DGXA 3GONA 4B3SJ 1DTTB 4KKOB 4OIXA 2XB2D 2GMHA 2Y3YA 3L7UA 4ECYA 2CPXA 2HQDA 5A76A 2BJ3A 4RUCA 4QYRA 1FEHA 4PPZA 3LAMA 3LW5C 4I6AA 4XDDA 4B3MF 1WELA 1Z4UA 3PIOQ 4ECVA 2WOMA 3IR7B 3D5MA 2HSEB 3OHAA 2CNKB 3VZHA 5BYQA 4I56A 4K4WA 1S97A 1UW4A 1V5IB 1S9GA 2QL5B 5K14B 4GVLA 3Q8RB 4DFMA 4U7UD 3E8OA 3MAHA 2C2ZB 4I64A 3M2VB 4PG7A 1A0OB 1G1XA 1AFIA 4QOTA 2WVBA 2HNZB 4X4OA 3OD2A 1UA0A 1VQ7S 1RTIB 1Q53A 4OHVA 1QDUB 4WTOB 5U47A 3DDNA 5KFFA 3VALA 3R7NB 4LFCJ 3TAMB 3VTIA 4X4RA 3KJVA 1YG0A 1NKCA 2RH3A 3J7A1 1KWMA 3MPWA 4EI2A 1FFSB 1JLFA 1S5ZA 3G96A 3OW2R 2DR7A 2DNYA 3B6BA 5C25B 3CCJS 4IRKA 3T9ZA 1TUVA 2L9WA 2V34A 3IS9A 2XEXA 4ID5B 1D9AA 4QR2A 3BGOP 5J2NB 4MKBA 1T7PA 4KHPJ 4AQYJ 4LFBJ 5E3CA 1IKXA 2YX7A 3TUJC 2XY7A 2V4QA 3Q23A 4DPUA 3AFGA 5LMNF 1X4DA 2LCWA 1HNXJ 3F41A 5KFPA 5J1EA 4OLPA 3ISND 3CMAS 4JV1A 3OL9A 3M2VA 2ERRA 1X9SA 3TVZA 4ZKAA 3ZO7A 3J7YI 1FRXA 1D0EA 3JQJA 5GAEU 4F4AA 5KFCA 2UUWA 3UNGC 5F41A 5HBMA 2BV3A 1IM4A 1Q8IA 1CJKA 2ZC3A 3D7SB 3FNNA 4HHUA 4L74A 4A8MP 3DLKA 2BDPA 1Z2ZA 1FX2A 4PZVA 4DUZF 1TKTA 4WIIA 3KK1A 1LWEA 1WEXA 3LOUA 3NS7B 3P6YC 4QJVA 2OD6A 2MHNA 3EXCX 3DMJB 1S6PB 5ETNA 5EX0A 2QL9B 2HRUA 1DLOB 2HRYA 2IJFA 3E3XA 3MDFA 5IQQA 3QYYA 3D0HE 1YKWA 4AD6A 1FFWB 2KRBA 5DG9A 4IDKA 2XYGB 1KVIA 2QIFA 2Y1RI 1REGX 1RTHA 4HHHA 3I32A 5KOWA 5FLXY 2OGUA 3C8YA 2HNYA 1KQGB 4R0JA 3FBEA 5DZ7A 5DQGA 1XNRJ 1SIWB 3Q8QB 4L73A 3CCQS 1U1LA 3C2PA 2D41A 3NBPB 4USMA 1T95A 3OUYB 4ZCKA 4EUVA 4K0KJ 1RU1A 5HBMB 4J9MA 2GQ2A 4EBEA 2RAQA 4LF7J 3LAKA 2VPXB 5L8RC 2WB1D 2C2NA 1FXRA 2RQCA 4TYAA 3NNAA 1JWWA 4JV5J 4UUXA 1HR0J 5EWGA 2W4PA 5F8GA 2QTWA 3DLGB 5KFRA 2UVWA 1CSJA 2FHJD 3BGRB 3PJ9A 1L3UA 1JKHA 4A8FA 1HHSA 4ZP8A 2AW0A 4PWDA 4RO0A 3FC9A 2DH8A 3WIUA 2DGTA 2CQBA 3TYTA 2CQ1A 3OFEA 4EK2A 1EKSA 1Y0HA 5KFWA 1Y11A 4R25A 4WFAQ 3T5JA 4FYYB 2UXDJ 4NCGA 3PYFA 2Z2YB 3L4BC 4JI4F 3OR1B 1PYOB 2DRDA 2GQQA 4UZCA 3CDUA 3A12A 3QO9A 5EHHA 2HBYB 4C11A 1WOPA 2KG0A 1T03B 3KXDA 1S0MA 1I3OB 2JVOA 4DV0J 4XIUA 3C15B 3D6FB 1P27B 1OY9A 2RHQB 4DZDA 2E29A 1V3SA 2FC8A 3UN2A 5HK4A 3MCSA 2QA4S 3TQ1A 4ERDA 5FJ4A 2XWXA 2XMVA 3IR6B 4PG5A 3RB3A 1YBTA 4YB1P 1NK4A 2GVDA 5AE1A 4DG1A 3FJ2A 2ZJQQ 2VASA 3GYNA 1U0HA 3R5DA 2AD9A 3V4IB 2WVCA 3DRXA 4TVAB 4IH6A 3UVJA 3ZZRA 4DHVA 1H2VZ 3HSZA 3IMQJ 3M2UA 3TI0A 4LF5F 4ZPAA 3GV7B 1J5EJ 5D4NA 4NL5A 2EG1A 4DN9A 2CQ0A 5HSPA 1Y7PA 2W9BB 2QT7A 4DV4J 1XNQF 1BQXA 2Q1LA 3MOJB 1NEEA 1RE1B 3ETOA 2XULA 1WKKA 5GADI 3DGVA 1U02A 1FD2A 2IM2A 3DRRA 3HJFA 2GZOA 3G6YA 1RT1B 3R1HA 4CO5A 3DOMB 3IGNA 1MWQA 2XLJA 1Q86T 4B3RJ 3GZ7A 2JJ4D 2J7UA 3VVTA 1REVA 5C24B 5IT4A 3GJTB 4F36A 2WBMA 5LSRA 1UTAA 3DRSA 4NLRA 2V69A 5SUHA 4IH5A 1F3FA 3NEKA 1SJRA 1RDRA 3K7RA 2V2KA 1C4CA 4LVNP 4IO9Q 2QO3A 3PVXA 2R8HA 2UXCJ 4DR4J 1NM2A 3QPIA 1SKSA 4TY8B 5KFIA 5HP1A 1FTCA 3NG8A 3F0NA 1TK0A 1VQ9S 2RJZA 1JLAA 1NSAA 1S1VB 4MKVA 1VQMS 2C1EB 3DNCA 2HPUA 3DLEB 5JVGQ 1HARA 3A4TA 1AA1B 2GAGC 4WF9Q 3ICLA 4X62J 3OLBA 3LGNA 2LA6A 5D15A 3UD5A 2VONA 2KRRA 4UW2A 3M6VA 2IRYA 1U8WA 1IBCB 3NOGA 1K1SA 2VC0A 1S1TA 3TA0A 2H1YA 4KHRA 2B9EA 2PN6A 3MR2A 2XI2A 3SCLE 4KGVB 2XNRA 1C0UB 2WZ1A 3O1LA 2ZKUA 3ETMA 1RCXB 1WC5A 2ASYA 4P74A 4JI8F 4DCPB 4DBQA 2AU0A 2RS2A 5B0AA 2G4BA 4C7QA 3MPVA 3Q8YA 2BM1A 2QYCA 5F3TA 3CULA 1MNEA 2V8HA 1YI2S 1X31C 5KG3A 1FNOA 1NSPA 3G8TA 2NZ4A 5HMZA 8RUCA 2FLPA 3IRWP 4V19X 2E1MC 1DQ8A 4NLYA 2ASLA 1UEVA 2QFJA 2M2BA 3DC2A 4X4PA 1GFWB 2LFVA 3BREA 2ZD1A 5D77A 1KD1T 2AT1B 2VU5A 3B4MA 1XTZA 3IG1B 1KR4A 1OJ4A 2B51A 1WG5A 3AQOA 1VBYA 1NMEB 2JSXA 4W98A 2BKPA 2AJFE 2B4VA 2MQPA 2LLZA 1T9UA 4RUHA 3G86A 3X1LB 3CIMA 3D66A 3ZTOA 1RT7A 2WVFA 2O1PA 1NK5A 3TUZC 3I5CA 2CJQA 3MMAB 4LF2A 3C16A 3G2XA 2DYAA 2MQLA 3PRBA 5RUBA 4RBVA 3FCHA 1PC4A 1O8BA 4WYLA 2QG9B 3SEOA 3KK2B 5J2QB 3FSXA 3KLIB 2R7OA 1BXNA 2YY3A 5BYRA 3HVTB 4USKA 4P52A 4UQGA 3CJKA 3MR5A 3EZUA 2QYGA 4A8XA 4PXEA 1IN0A 1QAXA 2OPQA 1KLMA 2VBZA 4C8KA 2HS3A 4QR0A 3QT8A 2Z56B 4J9VA 2V63A 4YB7A 1IBMJ 3TQEA 1BGXT 2BZ2A 3GIRA 1RHKB 5AE3A 2I1RA 4YHHF 2D1CA 5I3UB 7FDRA 5KT2A 3BQ0A 2QLFB 4OI0A 3C16B 1JJHA 3Q83A 4DV3F 1HI0P 5KG5A 1ZM4A 3GTYX 3GYXB 5KT5A 1EQ0A 2HLTA 1ACMB 1OMSA 1GXUA 3LP0B 3CJ3A 1SKUB 1VRTB 5L46A 3ILOA 1NZ8A 3AJ1A 4KSEB 1WOSA 2EVZA 2LQ9A 3AT1B 5A8RB 3UCZP 2VG5B 4YR3A 3TX0A 3RRKA 2BACA 5B0GA 2QN6B 2XS7A 4OL8A 3DLBA 3LA0A 3SDEA 2J8SA 4NWBA 2C2EA 2HHQA 3HD1A 2B6AA 3GR0A 4J5OA 4NX9A 3R3TA 3TEGA 3T1HJ 2ABYA 1U1RA 2VA2A 3PCOB 3OXLA 3R9LA 2G2ZA 3IN5A 1QTMA 2UUCF 2V68A 5KFJA 3MUVP 2BABA 2NXCA 3M6WA 1DQAA 1WF2A 5DETA 1UVIA 1TAUA 5KFYA 5DLFA 1TFWA 4B9LA 4DUYF 2VV5A 2BJ7A 3OR2B 2VOOA 2K7JA 2KL8A 2WHOA 2J0XA 3BZQA 3RGIA 1CG2A 2XNQA 2FJEB 4QR1A 4RW9A 2NLWA 4HVZA 3G82A 1VIXA 1TL5A 3KKFA 1V5VA 2VPYB 3K2YA 1RT5B 4CLFA 2LXUA 4X4SA 3FFIA 3RR8A 2N3OA 1X0FA 1S1UA 2QMXA 1U49A 1FWLA 1UW9A 3QIPA 3QWUA 1FNXH 3SQOP 3U1MA 4CO3A 1O51A 2YWWA 3VWSA 1B0TA 2HFOA 2N4CA 4AQYF 1YIJS 2YPYA 1PYSB 5KFAA 1CJVB 1N34J 3GJSB 1TV6A 3Q2TC 4DPWA 3OJSA 4O0NA 2BE2A 4MIAA 1SBRA 1U6ZA 4F0KA 2OEJA 1IBKJ 3I9V9 2QGFB 4NEYA 3ZNUA 3RR7A 2YQ3A 5AXNA 2DPJA 5L1KA 2XSJA 1K1QA 1WORA 1PJ7A 4KR0B 4B3OB 1FDAA 3W64A 3M6XA 4IFVA 2DNQA 4M95A 4YUDA 3AJ2A 1WG1A 4WP9A 4JP8A 1W7WA 4ILRA 4P9SA 3UE2A 3MMCA 2W8LA 3M1VB 2PMZD 2Z58B 3UWTA 2HAIA 2KO1A 2C42A 4CRJA 1M1KT 1N5QA 2GX8A 2R7UA 2W4CA 3T6BA 3AD7C 4LR7A 3ZFVA 4OQJA 2YKMA 1NDPA 1U6FA 3D54A 4LBHA 2V67A 4DJBA 4JV0A 1NK8A 3I82A 3IWNC 2X3GA 4MAKA 1SH0A 5CCMA 4ZVQB 3DLHA 2L9NA 2DHSA 2IVYA 2Z8QA 3ZTSA 3UR0A 3P4UB 4EO6A 5IT9U 3HSGA 3M8SA 2OPRB 4KBIA 2XI3A 4RUAA 3H40A 3ET6B 4UY8T 4RBTA 2UUAJ 3WC0A 3MMCB 1J27A 4DL0C 3V6DA 4RNNA 2GA7A 3EGNA 4LF5J 3QRRA 3PO4A 2H5IB 1P6TA 2KYZA 3CNQP 3CW2C 2DEJA 2AF6A 2RQ4A 3KLHA 3GIMA 1M5PC 1W26A 1DFDA 3LP1B 4J9NA 4KRWA 3PYEA 1I1GA 3N9UC 4TYBA 5D4OA 2XYPB 3EGWB 3ZTPA 5KT3A 5ETTA 3VAJA 3TEHB 3G9CA 3B82A 4DR6F 3MHYA 4L75A 1P9QC 1IJEB 1LWCA 3MUTP 3KYLA 2ZWOA 1AYEA 3NAHA 4DI6A 1FEEA 3M9NB 2UXDF 2G1DA 3HDSA 4CLKA 1EP4B 3CDEA 4MT1A 4DV7F 4I4BA 3D1HA 3KLGB 3LP0A 3AOAA 4CH1A 3SXLA 5F8NA 2JH3A 4CO2A 4YQWA 3MM5A 4HT5A 1X7VA 4X65F 1RBAA 2POKA 3MEKA 4OJ1A 1S10A 2XO6A 2IAJA 1C1CB 3GR1A 3EE3A 3UNYA 2R7XA 2G0CA 3OFHA 1SV5A 3JYTA 5D8HB 2AKWB 2JLGA 3OR2A 3MEEA 4A47A 4KTQA 3IGVA 4UQTA 3W60A 1CEZA 4CWBA 4F02A 1EHWA 3EZOA 4DR5F 1XR5A 2GGPA 1Q4RA 2YNGB 2NSCA 3QQCD 1CLFA 1TMMA 4FXVA 3NLCA 1TL1A 3LQVA 1XQIA 3NCRA 2IVMA 2VL1A 4XTTA 4WP8A 1TL7B 1JJ2R 2L9DA 5IOLA 5HMXA 3SBMA 5H1SV 4KO0A 2N4DA 2DY1A 1HBUA 2VDIA 3ITHA 3MMJA 3W2VB 2LA4A 3O8WA 2NXNA 4Y34A 5FIIA 5B09A 1UL3A 4DR7J 4DU7A 2PFDA 1WF1A 3VQTA 5F8LA 2VUGA 2YWKA 2H48B 3W66A 4IG0A 2MKIA 3GE9A 4NLUA 5ETVA 5DGAA 2UUBJ 2JEFA 2MLZA 1ITPA 2RKIB 4CM0A 4PCQA 3W5YA 2DCUB 1R0BG 3GV5B 2BEFA 2CQ4A 4H54A 4QWAA 3IG1A 4PRFA 2R3VA 2PE8A 1RAGB 2BX6A 2J76E 3MOZA 1SIZA 4WTYA 3DN9A 1RZMA 4Q8FA 2MZJA 4O3RA 1QM9A 2DIVA 3CJ4A 4TLQA 2P8IA 2W2MP 2HVEA 3MCNA 5CCLA 4J9LA 2KTQA 4WU3A 4C98A 4DV2F 4FYWB 2ZE2A 4NZ6A 3K17A 2NXUA 3MMBB 3M6UA 4ECRA 4YMEA 4A46A 1X4EA 1VC6A 3ADAC 4OHXA 5CYMB 4U8YA 4ZITA 2WONA 3PV8A 4DR2J 4DX8H 4FBTA 2J6SA 3NOCA 2DR6A 4DR6J 5ADZA 2P9CA 1ZS6A 3EVOA 3OBIA 3I0RA 3GFZA 3KJVB 4ED2A 3DI6B 1KQSR 2J6UA 1YBUA 1VR6A 1GMVA 1C1BA 2ZH1A 3KHRA 2BR0A 1VC5A 1B0PA 4WPAA 2XZDB 4FF4A 2Y8YA 4OI4A 3QT6A 5A8KA 1Q82T 4O4RA 3CCSS 3HM9A 3Q8UA 1VC0A 2CJYB 1HQEA 2DNRA 2XHWA 3ZZZA 1XR7A 2YH1A 2KJVA 2DR5A 2KYXA 2JNJA 1RWVB 2AYGA 2FHMA 4RZRA 1VRUB 3CCTA 5ETSA 3RW7A 5KFNA 5BR8F 4XPCA 3SSQA 3FEXB 2UVUA 4DSKA 2AYMA 2A2CA 3K8VA 4BC9A 1XMQJ 2G0IA 1ZAVA 1WACA 1FRMA 3NKYA 3TZWA 2BMBA 1WC6A 2FPHX 1Q8BA 1QUVA 1FNMA 4Y2MA 4B9MA 4B3RF 3I5BA 2HHTA 3D3CJ 3RBDA 3RB6A 3GIIA 2VBXA 4I7FA 2XQCA 4CLUA 4QYZK 3MEDB 3P3DA 2CVIA 5HO4A 2YXLA 5LXRA 5MLCV 4ZLLA 4EMDA 2XM3A 3E2EA 3IAS9 1UVNA 2RD5C 3NGKA 1NDLA 2IMOA 1HNZJ 3MEEB 2B4OA 4P73A 1VQ6S 2ZZMA 2W25A 3MI7X 2KFNA 2OPPA 2GHPA 3L7PA 4NZ7A 3KNGA 5D6GA 1HQUA 2KH9A 4HL9A 1YRXA 3UO0A 1U0HB 3KLGA 3QFHA 1HD0A 3M8QB 4DG1B 2A2DA 3H4DA 3GQCA 4DV0F 1FERA 1IWAA 3G6ES 1JLEB 1UFLA 1MWYA 2PA8D 4PWWA 1QVGR 3HHLC 2A1BA 4HDHA 5KG0A 4RW6B 3S1TA 4PUOA 2RNEA 2B0GA 4WIQA 1S6UA 2OEMA 4DQSA 1UFKA 1PKUA 2HVZA 4LRFA 5C24A 2XMKA 2UZAA 4K5RA 4FYXB 4OJGA 5HMWA 3IWXA 4RU2A 1IBLJ 4IQXA 3MUMP 5K9FA 1CC8A 3DRRB 3OXGA 2K1RB 3KUGA 4CO0A 4IRCA 3M30A 2CFXA 2NUHA 5F9NA 3SFUA 2BKOA 4ILMA 3V6JA 2UVRA 2XG8A 3BBFA 3RG6A 3BSNA 4Q2MA 3AQPA 3HVTA 4GMKA 1ROFA 2EWHA 3MF5A 4CNZA 1T0TV 3KMSA 1E6VB 4C8YA 2E1RA 4NLOA 5ITHA 5SZTA 4DL4A 2G13A 1IKYA 1R31A 1C2PA 3JTOA 1ZM9A 3NP5A 4CH0S 4DS5A 4OX6A 4URSA 2ZJPQ 1P1TA 4DR7F 5GAHI 2B4PA 2G2YA 2KJWA 3ILJA 4O4GB 1RA6A 3R7SB 3LP2A 4EO8A 3A8JA 1CJUA 2AZ1A 2OKQA 1FJGJ 4OX9J 5F8MA 2IIHA 3UFCX 4USUA 1JXLA 1QTNB 2BW7A 4A4JA 4OI3A 3W61A 2F8EX 4PQUB 3CD0A 2FVPA 3SQGA 1DQ9A 3S6EA 3TX8A 1RABB 3IFEA 5DS7A 4WFNQ 2R8KA 2PMWA 2P5VA 2J0SD 5T41A 1HWJA 3OTOJ 4ZCMA 1UWAA 4UY85 1S6QA 1GNKA 2R7WA 1NJIT 3G6XA 1J5OB 4HT7A 3OR1A 4P7TA 2MB0B 3MTJA 3DU5A 2BM0A 2E44A 1W2IA 3QAUA 4EBCA 4DV6J 2VDHA 3H98A 3N79A 2IJRA 3ZTQA 2UU9F 1S48A 2EK1A 4NLQA 2DNMA 5KFZA 3TARA 1RWOB 3HXMA 4ZVEA 1URRA 2CG8A 2Z4PA 5B0FA 2Y1JA 2A0FB 2GHVC 1OY8A 3HHKA 4FPIA 5E3AA 4NOHA 3C6UA 2O5DA 3PRDA 4NYZA 2VQEF 4DV6F 2C3MA 3MM9A 4GVBB 3GIKA 4CTAB 5IWAJ 2W2NP 1TKXB 1MMDA 4Y2AA 1UJ4A 4C8ZA 4QQBA 3UD4P 3CCWA 1CPZA 4TXSA 3ISNC 2XMAA 1NJYA 4W90B 3W9JA 2UXBF 3TAQA 1O6XA 1NPKA 2MXYA 1ZBTA 3CDBA 2V2ZA 2BRLA 4DR3J 3W62A 4DSIA 2HNYB 3HVWA 2QLXA 4NXNF 5J1NA 3CCUS 1X60A 4KQZA 4X4QA 1REVB 2ZDPA 2MKJA 2DO0A 3CJ5A 1P9YA 1CS4B 4J7CA 4OX9F 4OZ5A 2PO4A 3R8YA 3BSOA 4WK3A 2RDJA 4C0BA 1ZETA 1S0VA 3QJPA 5MAOA 3M8WA 3SI8A 1XN9A 3DXSX 3BKTA 3HI9A 3BYPA 4RWXA 2R8JA 4A8QA 2ALYB 2HVIA 3V4MA 5EUHA 3V6DB 1J2VA 5H9FJ 3DYAB 3Q8PB 3M9MB 2FQQB 2OPSB 5KFBA 4P6QA 2JWNA 3J7ZT 1DARA 5JUMA 4ER8A 4HACB 3FMBA 4U96A 1Y3JA 4LIRA 1IKYB 2EG2A 2MQNA 5DDPC 4IRDA 1HWUA 3U27A 3M30B 4DV5J 1Q78A 4CH7A 1RP5A 3AH6A 5IXUA 3DCAA 1YRTA 4LF9J 4DPOA 1YWXA 3OPKA 1NK9A 2XLIA 1C0UA 4NMXA 3OVSA 4JI8J 4FYVB 1WC3A 3JAMU 4F4KA 1KN6A 1NK6A 2LMIA 3N5BA 3UDEA 5EDWA 2X1BA 2ZOFA 4RL1A 3UQSA 2CADA 5HANA 4PUOB 4DL6A 4RX6A 1Y5LB 3KK2A 2VKRA 2LKZA 2CNLB 3HF5A 5CYQB 2OTLS 2VFTA 1F0XA 3VZIA 2KXHA 4YOEA 1LKZA 2DD8S 4LF6F 1IR1A 4K4ZA 1ZA1B 1DHMA 2ACYA 4M5JA 3BO4A 1K73T 1X4FA 4ID8A 5FDLB 4LF4F 1CJVA 2HMIB 1HNIB 4DV4F 1JNRB 5F0WA 4C8MA 4R8UB 1T05B 1HNZF 4NRUA 3MXHP 4KPCA 2GC8A 3QIPB 1U1OA 5IZHA 2VG6A 1RB0A 5C2CA 2L3MA 1J5OA 1JIHA 4XAKA 4C6AA 1DTTA 1ZAWA 4U7UK 4OZ3A 4CP5A 1UP1A 3RZAA 5DLGA 1SKWA 1G7CB 4RU9A 1TAQA 3NL0A 2C3PA 4ELUA 4KKOA 3CJRA 1RCOB 4ZOSA 4C97A 4F2SA 3IO1A 2W9BA 4PWUA 2NZCA 1N0UA 3H59A 3P5TL 2RB7A 2OSQA 1WKJA 2W1BA 1GX5A 3FRYA 4LIWA 4AUKA 4F50A 2VOPA 2GQCA 1HNWF 2XSFA 4GKJJ 2VIHA 2VPWB 2UV8G 4NMLA 2X1AA 3DOLB 2CQDA 4YP3A 4X4NA 5ETRA 1KKHA 1TKZB 1WI6A 2B9WA 2I0XA 4K59A 3DLEA 2VKZG 3C6UB 1OIAA 1ZZFA 5HI7A 2D69A 4IOBA 2LVWA 4W4MA 1NSQA 5KFVA 2O01C 3FCWA 2ZZNA 2YPZA 3R7BB 4TY8A 2NSBA 4Q5VA 1U24A 5JVHQ 4ZHRB 3QZ8A 1RXOB 5CA5A 4DX5A 4I2PA 1RAAB 1NKEA 2VFRA 2KFYA 1NH8A 3HT3A 3RYLA 3KK3B 3F73A 3MCOA 4B9NA 3HHEA 3A8IA 2HVDA 1HBMA 2CWXA 1NU4A 1YJTA 1GTEA 1SC6A 3CSKA 4ZVHA 1HBNB 1VJWA 2DJWA 4A48A 3GFYA 3N01A 3FSIA 4DV2J 4HACA 2XY5A 1CVJA 1D9FA 1RTZA 5GAGU 2K7KA 1H3DA 1B0VA 3LTOA 1LFPA 5C25A 8ATCB 2E9RX 3D28A 4X84A 3N6MA 1YQHA 3MMBA 4FKXA 4OMFG 4RPFA 2VQFJ 3OSNA 1G6BA 3CWJA 3MCMA 2Y1LB 2WW8A 2FTRA 5HATA 1F6TA 4M5MA 5KOXA 1N5TA 2DHAA 4Q0BA 3KJNB 2CJXB 2GMJA 1RT4A 2CJAA 3UDVA 5DQIA 4EEYA 1E6YB 3C6TB 3UCGA 4CZCA 1T02A 6AT1B 1XEZA 2RHSB 1NPRA 3A8KA 3MMAA 4OZNA 4CLLA 1N5YA 1U25A 4LFAJ 3GU0A 4ZPBA 3X3UA 1HFEL 1QAYA 2GVDB 1RBOB 2K8GA 1KTQA 4X2BA 3HO1A 2QMUB 4O3PA 1X0PA 5ETKA 4F3MA 2VODA 1WHWA 4IDKB 4NLDA 5F8JA 5I4MA 4JV2A 3DXBA 1PILA 5F9LA 4DR5J 5KT6A 4QW9A 1U1NA 4KO0B 1OO0B 2CJBA 1SKRA 4OYZA 4NXMF 3FK4A 1FE4A 1QUPA 4C48A 1TK5A 3FMWA 4Q2LA 3ZZYA 1KP6A 2DNHA 3QT5A 3TP2A 2ZITA 4X62F 2W9AA 2RU3A 4DL3A 4DUZJ 1PJ5A 1C1CA 2J5AA 5FDLA 3N4WA 2HWIA 2K2PA 2MEWA 8AT1B 3BQ2A 1M5OC 3RBZA 4GC6A 3TANA 2FJWA 1PO6A 2E1AA 1FE0A 3KDNA 1TR0A 2AP6A 4YEAA 2F3JA 3AXMA 4HTJA 3A3NB 1BQMB 1RHJB 4CYUB 2ALZA 3I4HX 1YBAA 3HD2A 3CD5A 3QT7A 1RAIB 1Z1ZA 2YNIB 3KFWX 4Q7AA 3O44A 1HQUB 2JZ5A 2BE7D 1F5AA 3PFOA 7FD1A 4Q45A 3Q2SC 1Y3KA 3UW1A 3VGUA 4BWJA 1TTHB 3ZXWA 1LWCB 3KG1A 4I69A 1JLAB 2ROEA 1MROB 4K8RA 4MJKA 3T9NA 3TOQA 1IKWB 3QJJA 4HDGA 1QSLA 1FCAA 3PHEA 3GWCA 4OHZA 4KGMA 5LMUJ 2MQ8A 1BMQB 2BANA 4M5KA 4F0HA 4J9PA 1SJ4P 1B3TA 2UUAF 3O2IA 4DSLA 4JI6J 3TWZA 2ZUGA 1KTVA 4QIFA 1VBZA 3DKDA 2H65B 3N28A 2ZC4A 3KLHB 3NWGA 3HK2A 2BUNA 4I6WA 1RT6A 1DTQB 3GV8B 4MKYA 2RIJA 1EETB 2KXNB 3EX7B 3H42A 1Q7LB 3SIPB 3BH7B 2CAJA 4RNOA 2HRTA 2EBGA 1AUDA 3NXZA 2YKAA 2NUUG 4DDFA 2Y1IA 1PSDA 2XO7A 4DSEA 2H5JB 2HGMA 1GEHA 2APOA 1SH3A 4V1Ak 1HMVB 1DJ0A 2DGVA 3DGPB 2V8DA 3Q8SB 1EZZB 2ZNYA 4RBUA 2XGPA 3CDAA 4NA3A 3Q22A 5HVHA 4V19J 4IOAQ 1SQGA 1U2FA 3NGRA 1FX4A 2B7CB 4N47A 5A2QU 3IC1A 3OQ2A 2YKOA 2ZBQA 2DHHA 4UOCA 5K8OA 2HHHJ 3M1VA 3PDNA 1FJ7A 4MIBA 4EYHB 4U7CA 1T9XA 1AXQA 2GIRA 3OJUA 2V50A 3SV3A 3I87A 2HHPA 2OFGX 1X4BA 1ZM3A 4RR5A 1W2BR 3MM6B 1B7YB 2CNNB 2KKHA 2M0GB 1YHQS 1RHRB 1X5TA 1AB8A 1Q16B 2HGNA 1CC7A 3MPUB 5KG4A 2R9LA 3MTKA 1KOOA 2MPUA 2P6TA 4PG6A 3CC7S 1S1WA 2ZH3A 2ILYA 2GAHC 4N7TA 2EC2A 1WEZA 3D6TB 2Q6CA 2OPPB 3EWGA 3O5TB 2GS8A 5BXIA 1MN9A 2QZ8A 2XLKA 2HZCA 4FPRA 4N8OA 1DBDA 2C2KB 5E3PA 2JOQA 4DL2A 2LQJA 1YX2A 3H2VE 3SFGA 2CKWA 2GJFA 4CLTA 5DM7Q 1RT5A 2B8PA 4PG4A 2BVZA 3BN7A 4LT6A 2X1GA 4J9OA 4DV1J 1BUXA 4AL6A 2AEJA 2H4YB 3OTOF 3VAMA 4ED6A 3RRHA 3H8YA 4WK1A 3ULHA 3B78A 1F9EB 1PYTA 3IXQA 2F63A 2GVZA 1FKOA 5GAEI 3OLAA 4FDFA 1LK5A 1RI7A 2LQ8A 4WFZA 3FRZA 3UPFA 3TVYA 1WDTA 4M5DA 4DUYJ 5K8PA 3MPYA 1LW2B 1VQNS 5KFXA 2IHR1 1PIEA 1CJTA 3DHXA 2Z2ZA 4I2QA 3CD6S 1NPPA 2ZEJA 1S99A 2R8IA 3W5XA 1R8CA 4USVA 4LF8J 3BKUA 2B6AB 1N33J 3K5LA 5DRKA 1NHUA 1VMBA 2YNIA 2B9YA 1CJKB 3Q24A 1HBOB 2YWHA 3LP2B 1E6VA 1JK9B 2HQIA 1H2TZ 4ETZA 2W2QP 4JI5F 4ZJOA 3DI6A 1KNZA 1NDCA 1S0NA 4J37A 3G87A 4K5SA 4CT9A 1BQMA 2VQEJ 1LXJA 2YNHA 1IBMF 2CVEA 2WSEC 5F0UA 1TL3A 4FBUA 2ZH5A 1T3OA 2OFHX 3MR3A 4FYDA 2PC6A 3D68A 1YZ7A 1RWMB 2J9DE 2DNNA 2VBWA 5G0RA 5THWA 1M5VC 5CABA 1KRPA 2HHHF 2OJ3A 2F7VA 2OEKA 3NGTA 5J1PA 2BOPA 2DEIA 3K5NA 3C46A 1RA7A 3MAAA 1XNRF 3I9ZA 1IQZA 3ZZOA 5HMYA 3CCMS 4KY3A 1X9WA 1F2GA 3NNCA 4X64J 1OPZA 3A13A 2MY7A 4TN2A 2MSTA 1SJFA 3CCLS 2ZM6J 2J0QD 3M32A 3JTNA 3VVUA 2V9WA 3GYGA 3RAXA 2AIRB 3M8QA 4G6VB 4NLSA 1OS5A 2QL7B 9ATCB 3PX0A 1U2CA 2LXIA 3FEZA 4IR1A 1JLEA 3OL8A 1RT2B 5EWEA 1DZ5A 2WB4A 2HHXA 2XZWA 2UP1A 3TAMA 3OVAA 5LJ5Y 2WK4A 2YKPA 2BQRA 5K8NA 3H0PA 5L1IA 2MY8A 2N3LA 4DS4A 2M88A 2PGCA 2ZH8A 3MM7B 1BWVA 1WD6A 3NGSA 4K2JA 1R6VA 4R5PB 1S4EA 2HGLA 1YJWS 4ED7A 2GFFA 2JFKA 3D0GE 3GJQB 3I5AA 3J7AN 1D1UA 4PPDA 1LOUA 4RJVA 2CZVC 2H5EA 4NI2B 4K4SA 5BJRA 2VD3A 3M8PA 4M5LA 4IFYA 3MM8B 1CS4A 2W2OP 3BSCA 3KWMA 3EGZA 5LMUF 2D9PA 2LXFA 1H0HB 4CM2A 2DXFA 2FLOA 2C2DA 1U6BA 2DRAA 2K1RA 1JQGA 3V2UC 4LRBA 3R5BA 1T9WA 1U26A 4CIOA 1I94F 3ZTRA 2RRBA 5BR8J 4ZK7M 3EDQB 4ZLJA 2HIYA 3MURP 3NS5A 3E01B 2GO8A 3V6KA 5KAKA 1Y4ZB 1B99A 3O6QA 3U7JA 2DR9A 4C3MA 1IVZA 2M7SA 2ZBRA 1UVJA 1NAQA 1JLCA 4RNFA 1JLQB 2E1PA 1S1UB 4N5SA 4AXIA 1F60B 2F4FA 1T11A 4QIWD 4O44A 4BWMA 4E8UA 1IJFB 4F25A 1OSCA 1U0SA 1VQLS 2NR0A 3LWMA 1WWHA 1UETA 4NLPA 3UI3A 2HZVA 3AOBA 3G4SS 4F26A 3BJYA 1WDDA 4DFKA 3KOAA 1D8YA 1N32F 3JAMY 1VHFA 2JFDA 2E5JA 2XYHB 4DR4F 2KU7A 5KFOA 3G6VA 1MSWD 3W9IA 4I7FB 4JBCA 2RRNA 2IMWP 3F56A 4DUTA 1Q81T 2Q66A 4GO7X 4PQAA 1HNWJ 2WBRA 4NXMJ 1VQ4S 2I6WA 2CPDA 2ROPA 4RW8B 3J81U 1QJHA 4F67A 1LNQA 4YY3J 4F3QA 3HCXA 5J2PB 4QU6A 1FKPA 3MECA 3QGIA 3CMES 4W92B 2XS2A 1YZ6A 4RNMA 3RUBL 3HKZD 3MEGB 1T05A 5IV4A 1KQFB 3B54A 1A9NB 4DPTA 1NSKL 3M8RA 2OTJS 3H2LA 4DMZA 3H5XA 1CULA 1E6YA 1GMWA 3C6TA 4QW8A 4ZIVA 3CUNA 1C1BB 4EGLA 1TL7A 4WJBA 1ZZNA 4PG8A 1UA1A 2HNDB 2VB6A 4YB6A 3NMAA 4QYZJ 3PYGA 2HW3A 3DDKA 1OPIA 4EFAC 5ETOA 1B64A 5KFUA 3KLEA 1XIQA 3C66A 4J90A 4PXCA 2ZH7A 1TU0B 2DNZA 1U2RA 2QJ3A 2DH7A 1X5OA 2CPFA 4UOFA 5G4DA 1KC8T 1APSA 4DR2F 2IAJB 2BQUA 5B0CA 1LFWA 3KLFA 2ZKTA 3RJMB 1RADB 2AV5A 3T1YF 1FRIA 3W8PA 3EDRB 3BO3A 2AGQA 1JKHB 3MD3A 4HTIA 3AODA 3FVYA 2ZHOA 3OTCA 1RTJA 3N5FA 2K3KA 1HWIA 4G65A 2QE5A 5LJ3Y 1IKVA 1DURA 3LPEA 4IG3A 3IM8A 3FCVA 5LSLA 4R0EA 4QWCA 2BBEA 2F4VF 2EEYA 3MM5B 4GKJF 5C42B 4ZVFA 3T1YJ 4FS2A 3G82B 3OV7A 2FJAB 2QC3A 2CZ9A 3H7HB 3PEJA 1EP4A 2ZH6A 3DYAA 1TP7A 1UZDA 2PSZA 3BV8A 1D09B 4NLVA 2BW2A 2MQOA 1UZHA 2V4JA 3Q86A 2OH2A 3H5UA 2U1AA 2KDOA 1N88A 2IYGA 3VV2B 1F2HA 3LGMA 5IS2A 2ZH2A 1X4AA 4ECQA 3CC4S 2MQMA 3OFGA 2HBZB
chains in the Genus database with same CATH topology
5J2PA 4Y2IA 4BHQA 2JDJA 4ILLA 4NYPA 2CQIA 4IOCQ 4EBDA 1HWKA 2V0NA 2AJ0A 4IO1A 3S01A 3CE8A 3ITHB 1KONA 4B9TA 1RTHB 4ICLA 3AB4B 3DMJA 1UVKA 4DR1F 5HQ8A 4G1QB 3LF0A 4NCAA 5I42A 3W3SA 3K8WA 4OI6A 1FD8A 2KB2A 1S6OA 3TRGA 4HYKA 3RB0A 2MGZB 1UVMA 3ZC4A 3PY8A 3QGGA 2GHWA 2KZZA 1YJ9S 4X4TA 1N4LA 4X4UA 1Z2LA 4B17A 4CTAA 5KFHA 1T8EA 1RYRA 4RNHA 1T3NA 3QGHA 3MM6A 2R7RA 4AXJA 2DVIA 4ED8A 2ZOMA 1JLCB 2CPYA 1V6HA 4A8YA 2LYVA 2XY6A 2JEJA 2IBKA 4LFBF 1FXDA 1S9EA 2FIUA 2JHEA 4M63A 4D3HA 3A8EA 5CYQA 4ID5A 5KFQA 2UVVA 2JC0A 2KM8B 3KG0A 1S76D 2QA1A 2NPFA 5IQ6A 3S8SA 1XMOF 1NK0A 1VK3A 4LVOP 5IM0A 2HNDA 2HHWA 4XO0A 1RWUA 1X8DA 2WONB 1NK7A 2MKHA 4XPEA 4OHWA 1JX4A 4MMOA 3LP1A 1YVFA 6FDRA 3TUIC 3SCKE 2VA3A 1BLUA 1IR0A 3HHLB 2WRMA 2YX1A 5A6PA 1QAIA 3OFFA 2Z0GA 2YWFA 3NCQA 4ECSA 4WKRA 3MECB 3PACA 2DBBA 4KV8A 2C22A 4RW9B 2GJIA 4DOZA 1P8GA 2F9DA 4OZ0A 4A8KA 1V3RA 1R6YA 4P2SA 3I6PA 1X5PA 2J7WA 3OXFA 3SV4A 2OP5A 2R2SA 2O3DA 4N77A 2FHOB 2CPEA 4KIAA 2B3TB 4WXOA 2R4FA 3NMAA 5L1LA 2PT0A 2HWHA 1IUJA 3W2VA 2VH7A 1MROA 4C8OA 4B3OA 5A6WA 3JSRA 2WAQD 1JLGA 2QSWA 2B5JB 2ZDOA 4IFVB 2VG5A 4B3SF 1SXLA 1WG4A 1MW7A 1MWZA 1VRTA 4NRTA 1H7WA 4YR2A 2MZTA 3GB0A 5M2RA 2FJXA 2E7XA 2ZHAA 2HFNA 3U1LA 2GCFA 1S1VA 2Z2LA 4CO4A 1DAXA 1IKVB 3HHDA 3R27A 5IWAF 3CXCR 3KHHA 2E5GA 1H98A 1X9MA 3N0VA 5E3RA 5C42A 1XR6A 4FVCA 5J2MB 1KLMB 2YWEA 4WZQA 1X4HA 2GMLA 4B08A 4IG3B 2PEHA 2G9OA 2HWTA 1HBOA 1N33F 3SYZA 3ZZUA 5E3QA 2M9KA 5A0YB 5CYMA 5H9EJ 1YJRA 2IA6A 4ES2A 1LWFB 2R2UA 1XERA 5D4LA 3GILA 2HS0A 2M70A 2LEPA 1SJ1A 3MFHA 2EFNA 1V3ZA 1FA0A 3AA8A 1C0TA 3MM7A 2FVRA 3T1HF 4LF8F 3HVAA 1RJJA 4PXDA 2EKYA 4LMZA 4Z2XA 2XMTA 1HL6A 4IYQA 3KLVA 1U48A 2DCLA 2V94A 1FJGF 4JOUA 2FGOA 2DGOA 1N54B 2ZBIA 4MFBB 1R8AA 1DTQA 2ZD1B 1RQ0A 2XMUA 4Y0FA 1U45A 3I4PA 6FD1A 4XDCA 1FTRA 1HBMB 3AA9A 3DM2B 4NZ0A 3NRBA 3G8QA 3ZZPA 1TL1B 4C0HA 2JEGA 1RKJA 4ZHRA 5KTQA 2NPIA 3M2RA 4QWEA 3BGFA 4OX8A 4JI1F 2OPQB 3FDSA 4ZPVR 3MR6A 1S49A 1UJ6A 3VCDA 4ED0A 1VS3A 3AY0A 1JLQA 2J0WA 2FVQA 4WXWA 1KFDA 4U6PA 2ATLA 1VGYA 2W7PA 2BYCA 1VLYA 4RW4A 1RK8A 4MTPA 2EFOA 1H38A 4Q8EA 5E5NA 2W24A 5KG7A 1HPZB 1FKPB 2D3ZA 3CC2S 2Z2MA 1TVRB 2CQPA 4TQSA 2YNFA 4K4UA 3I96A 3WDOA 4ED5A 1RT6B 4QWBA 5HN0A 3PZPA 3WZ0A 1HI1A 2ZH9A 5IT9Y 3GIJA 2XWYA 1HW8A 1D8ZA 1U8SA 1HNVA 2XS5A 4U9RA 1A7GE 2UV8A 3MFIA 3MOJB 3FSYA 5KT4A 4KGKA 2HMIA 2QV6A 3M2UB 1XBWA 5EN1A 3CVKA 1R8BA 5HL7Q 2DK2A 1FK9B 4M1KA 3CCZA 1CQNA 1L3KA 5CZVA 3VF0B 3BSAA 4O3OA 5J1EB 4R5PA 5A8KB 3NGDA 4MIWA 2I9SA 2OMOA 1U1PA 2MYFA 3RTVA 4DN0A 1BQNB 3BR8A 1N36F 2MSSA 3L3CA 2CJ9A 2AX0A 3H5YA 3M32B 2KI2A 4QPTA 2ZH4A 2PI4A 4JI2F 3KMQA 1TK8A 2CQ3A 2JLFA 5DDRC 3FQLA 3THTA 4D3GA 3J7YU 3DOKA 3H4BA 5KG1A 1UAWA 3MGJA 5T14A 2FJVA 2PD1A 3BDPA 1UVLA 2EFGA 1SJQA 2UXCF 2IFXA 3ZZTA 4KJIA 2RT3A 3HKWA 2EFPA 4BDPA 1VIOA 3M8PB 1BC6A 4O3QA 3I55S 4BC7A 1NRKA 2PMHA 3DRSB 3DM2A 5B0DA 3MAQA 1GAOA 4ITSA 2E5LF 4LQ3A 2DNLA 2DT9A 4PWDB 4I6YA 2RRAA 1PC5A 3HPOA 5J2QA 3DLGA 2UUBF 3DHWC 1OSDA 3RAMA 4LFAF 1FXLA 2B9XA 2MZRA 2OAUA 1P1LA 1C4AA 3FGVA 4FZVA 2Q6BA 2XC9A 5GMKa 1RT2A 4NLXA 1RT4B 5HLFA 1U1MA 4C2MA 3SCJE 3J80Y 1QE1B 2IA0A 3LH2S 4USIA 1L3TA 3CCES 3VAKA 2N7YA 5GAHU 1UEUA 1NZAA 2DRBA 4O3SA 4NCGB 1HW9A 4QWDA 5B0BA 1Y5NB 4E98A 3LPYA 3T6JA 3K5MA 3QO9B 3MM9B 1ZTWA 2E9ZA 3GMGA 4H4OA 4G3IA 2R7QA 2A18A 3V5RA 4EU0A 3CDWA 4M8LA 1TKTB 3KK1B 1SL0A 1TL3B 2KFZA 4WE1A 2HS4A 1SI9A 2LDIA 3CT9A 5DDQC 5KG2A 5L1JA 1KVJA 1XMBA 2VQFF 2FHKA 3OTEA 4MH8A 1YGYA 2KT3A 2YKNB 4NA2A 5DGBA 4JV5F 2FJBB 4H4MA 1F5CA 3EXYA 4FF2A 1JLBA 5JXSA 3WBZA 1WEYA 4ED3A 1X4GA 3R5AA 4H4OB 2AYBA 1ZM2A 5DJBA 4RKUC 2EK6A 3OL6A 3NBPA 2FY1A 4M5DB 4ZMMA 1SH2A 1H2UX 1WHVA 5I3PA 2N7CA 3KLEB 1TQLA 2VG7B 2YH0A 3CD7A 3N6NA 5A8WB 4HKQA 3ISZA 3CB4A 4PQUA 3PR5B 1HMVA 4QIGA 3VAHA 3ENQA 3R1LA 1O5JA 4C0OC 5GADU 2R7VA 5HLFB 2LU1A 2IM3A 5L38A 3HVRA 4B3TF 1FF2A 2UUTA 1BWEA 2DNOA 2WTFA 3PX6A 4Q0BB 3DGPA 5A2QY 4EZ9A 4G1PA 4WU2A 4R8UA 2EBEA 1TZ0A 2J8AA 2Q43A 3IRXA 1RAJA 3U1NA 5B7WA 3PX4A 1R0AA 4FN5A 2IJNA 5DG7A 1XWLA 2BANB 5KFTA 3JB9k 3V4IA 2JVRA 3IA0A 5F8HA 4WFXA 1WHXA 1M0SA 4OI1A 1URNA 3T5KA 2GW8A 2L08A 3DOKB 2BJEA 5A8WA 3BGLA 3J7Z5 3CPWR 1NH7A 1TL4A 3SSRA 5D3GA 2MZQA 4OI2A 3M4XA 5GVQA 2R7SA 2IM0A 1NO8A 4DF4A 4CQ1A 3DRPB 2NQPA 3ONQA 1N48A 2W8KA 1TKZA 1TV6B 4RW4B 1K8AT 3DOLA 3FFIB 1VI7A 2CYYA 2L48A 2OIHA 2GJ2A 4J9QA 4AL5A 1GH8A 2YTCA 3M05A 2RF2A 4QU7A 2C28A 4G1QA 5IFMA 5K14A 4WCEQ 3UD3P 4GC7A 2M8DB 4ATNA 4DLEA 1UJ5A 1NJWA 1S6QB 4DV5F 2DR8A 2WOMB 3SZ2A 1VQOS 1QSSA 1A9NB 3SCIE 3B4DA 4A8WA 1U1KA 3MEDA 2E5IA 4Y6IA 1PGZA 1BY9A 2F8HA 3SQGB 3AHPA 4JYAF 3BSOA 2VFVA 2CPJA 1QE1A 4U67Q 3SDEB 4F3OA 4I0WA 3JSMA 3POTB 2V4JB 1DLOA 4ZCLA 4DFJA 4ELVA 3TR5A 4FF3A 1FDBA 2AJQA 1VQ5S 2AJ1A 2P6SA 2CQCA 4RLEA 3UDCA 4X66F 4Y00A 1KS2A 1AFJA 1C0TB 1XMQF 3CTRA