1NO8A

Solution structure of the nuclear factor aly rbd domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
GKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALY
publication title Structure of the Nuclear Factor ALY: Insights into Post-Transcriptional Regulatory and mRNA Nuclear Export Processes
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1no8A00
3LQVA 1FJCA 2MGZB 1HD0A 1R8PA 2VOOA 3NS6A 1X4FA 2A3JA 2QFJA 1VC6A 1G2EA 1D9AA 3MOJB 2LMIA 2ZJPQ 2DK2A 1SJFA 3CC7S 2E5HA 3L3CA 3CXCR 2RS8A 2LYVA 2KVIA 1U1MA 1S79A 3VALA 1X0FA 1U2FA 3G9CA 2CQDA 3B4DA 2EK1A 3TP2A 1SJ4P 2AYGA 4QQBA 5D78A 2DO0A 2DNOA 4FXWA 2MZRA 2DIUA 1FHTA 2MZ1A 4LIRA 2RVJA 5GAGU 2DNYA 1PO6A 2DNHA 2HVZA 5GVQA 3HHNB 3B4MA 3P6YC 4F26A 1X4CA 2XNRA 2KN4A 2DNGA 2ERRA 2RNEA 2CQGA 2MKCA 3V4MA 1UP1A 5JVGQ 4W92B 2ADCA 2LXIA 1VQ6S 2DNLA 2J0QD 2MYFA 3BO2A 1KD1T 2YTCA 1FXLA 1M5PC 5FJ4A 2M8DB 1Q81T 4TU9A 3VAHA 3SXLA 2OJ3A 4C7QA 1RKJA 5MLCV 2RS2A 2RUGA 4BS2A 2KRRA 1DBDA 1H6KX 1N52B 3UCGA 3EX7B 3FEYB 4J5OA 2KHCA 5LJ5Y 2LQ5A 2J0SD 3J7YU 2K3KA 4WFBQ 3IRWP 2E44A 2M52A 2KG0A 2RQCA 1YJNS 4YOEA 3IWNC 1JJHA 2ZJRQ 2LXUA 2CQPA 1WEXA 5IM0A 3RW6A 1UAWA 2GO9A 2MKSA 3HI9A 3CCUS 2MSTA 4YUDA 5LXYA 1YI2S 1U1OA 2SXLA 3G96A 5H1SV 1H2VZ 5HL7Q 2KXHA 3R1HA 3CUNA 2DGQA 1VQ8S 3J7ZT 5GAEU 4LMZA 5GMKa 1QM9A 2D3OR 2MZQA 4WFAQ 4OZ0A 2AYBA 2EVZA 4IUFA 2CPYA 5LJ3Y 1X4HA 2RU3A 2M0GB 3S7RA 5LSLA 4CIOA 1VQ9S 2MQMA 3BO3A 1U1KA 2RQ4A 1U6BA 2LKZA 1A9NB 2X1BA 4U67Q 2MKIA 3VAIA 2CQBA 2CQ2A 4V19X 1ZZFA 2MPUA 2Q79A 3P49B 2KXFA 4P6QA 3R1LA 2N82B 5LSOA 2MB0B 3CMES 2XS5A 2O3DA 2DNRA 3RW7A 2FY1A 1U1RA 3THTA 2MQNA 4WIIA 2DNMA 1UW4A 3CCVS 1WTBA 2DNNA 2HZCA 1X5OA 1SXLA 1XN9A 3D2WA 1FT8A 1HD1A 1VQ4S 2N3LA 1ZH5A 1X4BA 1U1QA 2JX2A 3S6EA 1HA1A 1VQLS 2J76E 2D9PA 5IM0B 2FPHX 1KOOA 1DRZA 4EGLA 2JRSA 4CH0S 3U1LA 5GAHU 2DHSA 1VBZA 1IQTA 2G0CA 1K73T 2KRBA 2F9JA 2M2BA 1CVJA 1RK8A 4TU8A 5DDQC 3CC2S 2DITA 5D77A 4PKDB 1M5VC 1VQKS 1NJIT 2M4MA 3CCLS 4IOCQ 5EN1A 2X1AA 2DH8A 2LA4A 3S8SA 3Q2TC 1OPIA 2LCWA 5IQQA 2VONA 2M8HA 1NU4A 2BOPA 1B7FA 2E5IA 4PRFA 2CPFA 3VAJA 2N3OA 1M5KC 2OTJS 2AD9A 1WHXA 2MKKA 5DETA 1U1PA 2XNQA 4IO9Q 3VAKA 2DIVA 3G8TA 5ITHA 4WCEQ 3BO4A 2PEHA 1YHQS 2MZTA 3ZZYA 2KU7A 3P3DA 2U1AA 2HGMA 2L9WA 3CPWR 3ZZZA 1H2UX 1WG4A 4F25A 2XS2A 4A8XA 1X4DA 4C0OC 2DGOA 1WI8A 3G8SA 1UFWA 5DDRC 1Q7YT 4QPTA 3MI7X 3MD1A 4TLQA 3CCRS 2CQ3A 2EK6A 2YH1A 1BY9A 1URNA 1A7GE 3S01A 2CPDA 2NLWA 2CPIA 3PIPQ 4QU7A 1VQPS 2CPZA 2CQCA 3CCQS 2CQ1A 3UD4P 1WI6A 5CXTA 1WF1A 2DH9A 3I56S 1VC0A 1JMTA 1N88A 4WFNQ 2DB1A 1L3KA 1W2BR 2FHOB 1QVFR 3MURP 2M9KA 3MXHP 3JB9k 2CQIA 2MSSA 5CA5A 2LEAA 2DGVA 2MY8A 3CD6S 2MGZA 2FC8A 3UCZP 4WF9Q 2MKJA 1KOHA 1OO0B 2LECA 3ULHA 2ZJQQ 1YJWS 2BZ2A 5LXRA 2L08A 2DNQA 3SMZA 1SJQA 3CCMS 2DNPA 4TU7A 2DISA 2WBRA 1ZZNA 3CF5Q 1YIJS 2KM8C 2M88A 2DGTA 4RU2A 2RT3A 3BS9A 3G71S 2DHGA 2VODA 2RRAA 2KT5A 1KQSR 3TO8A 2XS7A 3CTRA 2AYEA 5JVHQ 5BJRA 2I2YA 3SDEA 4C4WA 1P1TA 2MHNA 2XB2D 3N9UC 4FXVA 2CPXA 2CQ4A 2DGWA 2JWNA 2DGUA 2X1FA 3NNAA 2MY7A 2DNKA 2KFYA 1NO8A 1VBYA 1OIAA 2F9DA 2HGLA 2J8AA 3K0JA 1WWHA 1YWXA 2PE8A 1FJEB 2MJUA 3H2UB 1U1NA 1VQ5S 1X4EA 2MQPA 2HYIB 3EGZA 2LEBA 1VC5A 5DDPC 1YITS 3THPA 1DZ5A 4LJMA 1WF2A 2AYMA 1R8HA 2KG1A 2YKAA 2RRBA 1VQ7S 1N8RT 3UCUP 4ED5A 2MXYA 1FO1A 5DM7Q 1F9FA 1S72S 1Q86T 4Y00A 4M5DB 2KH9A 2MZJA 2L41A 2DHAA 2QA4S 1K8AT 3MUVP 2KXNB 3Q2SC 2DGXA 5GADU 2DNZA 2MQLA 1X5SA 3NNCA 3DLLQ 1HL6A 4UQTA 1AUDA 2LA6A 4PR6A 2DHXA 3BEGB 2ADBA 2MQQA 1WHYA 2DGSA 1WELA 3SDEB 2QEXS 2G4BA 1WG1A 1X5PA 2MQOA 2E5GA 3CCES 2MZSA 2OTLS 2DH7A 3PIOQ 1YJ9S 2CJKA 2E5JA 4OZ1A 5DM6Q 4ERDA 2VOPA 2HGNA 2KYXA 3US5A 5DDOC 1QVGR 2B0GA 3FEXB 2CPEA 1VQOS 1PGZA 1U6FA 3CCSS 1YTYA 3NNHA 3MUTP 2FC9A 2YWKA 1U1LA 2U2FA 2OSRA 2D9OA 2F3JA 1X5TA 2CQ0A 1P27B 1WHWA 3H2VE 2I38A 3NS5A 1SJ3P 2X1GA 2OIHA 3U1MA 1OWXA 3NMRA 4W90B 3MUMP 2DO4A 3G4SS 4QU6A 1X4AA 3EGNA 2M7SA 4UY8T 2N7CA 3MD3A 5CYJA 3CULA 1SJRA 2G1DA 5IFMA 1WEYA 1WF0A 1O0PA 3P5TL 1WEZA 5HO4A 1K9MT 1WHVA 2CPJA 4CQ1A 3MDFA 1H2TZ 4ZKAA 3G6ES 3TYTA 4CH1A 4Y0FA 2K8GA 1KC8T 4Z2XA 4YB1P 4F02A 3CC4S 1FJ7A 2UP1A 1D8ZA 2CPHA 4WKRA 4IOAQ 3DXBA 1JJ4A 2GHPA 2OSQA 1DHMA 1N54B 3VF0B 1FNXH 2MKHA 1M90T 3VAMA 2M70A 2KI2A 2NZ4A 1VBXA 1JJ2R 1WG5A 1X4GA 1M5OC 3R27A 2YH0A 2MJNA 2V94A 1M1KT 3OW2R 2JVRA 3LPYA 3VAGA 1VQNS 3UE2A 2CQHA 3UWTA 3CMAS 2JVOA 1VQMS 2KM8B 3I55S 1Q82T 3UD3P 2XSFA 3VAFA 3CCJS 2MMYA
chains in the Genus database with same CATH superfamily
2HK2A 2OPRA 2WSFC 1ZPWX 2AX0A 1HBNB 1SC3B 2ILZA 2I6WA 2CQDA 4AUKA 4IFYB 1JXLA 2HFZA 2MZ1A 2HQCA 9RUBA 4ILLA 4QWAA 4MIBA 1LW0A 4B3MF 1MN7A 5CYMB 1T3NA 5L1LA 3SQGB 1CJKA 1L3TA 4IG0B 1HQEB 1TAUA 4ZP8A 3GPAA 5C5JA 4EK2A 2BRKA 3KMSA 2B5JA 3IXQA 5B7WA 1NZ8A 2K7KA 4TU9A 2V4JB 2EFPA 2OJ3A 2RUGA 2KRRA 1FERA 1IKWB 5B09A 3JTOA 3NWGA 2E1RA 3IWNC 2HQIA 2CQPA 1RTJB 1K1SA 1CLFA 3BR9A 5H1SV 4OX9J 1OS5A 1TVRB 1JKHB 5EWFA 2EVZA 2GAHC 2FQQB 3H98A 2ASDA 5KTQA 3MR2A 1HWIA 2HFOA 1U45A 2CQBA 2XO7A 2J9DE 2OEJA 2UUBF 3O3LA 4Y2IA 1EARA 1WTBA 3CCVS 4LR9A 5EWEA 4KPYA 4ETZA 2G2OA 1X4BA 3MGJA 3QRQA 3NS7B 4M5LA 3MPVA 4C8OA 1DRZA 4EGLA 1SQFA 4CH0S 1UJ5A 3BREA 4LFBF 2YWGA 3FSYA 4DF4A 3V4IA 1RAEB 2DITA 4JI4F 2QFIA 2M4MA 4DR4F 4Y2CA 2LA4A 1APSA 1ZETA 3DI6A 4ZPVR 4DUZF 2YX1A 4WP3A 5L46A 3M2VB 2MKKA 2W7AA 2F40A 1YJTA 1S77D 1VIXA 3G6VA 3C15A 3CJ8A 3RAQA 5AXLA 4CO1A 3M8PB 2HHSA 3O6QA 4ANDA 5L1JA 3MD1A 2AJ4A 5THWA 3K5LA 2XY7A 3IR7B 1SL1A 2V8DA 2R2SA 3NBPB 2LU1A 1NDCA 2WONA 4Q2LA 3BDPA 3PVXA 1YKWA 4JI5F 4YS2A 4ZVFA 3RBEA 4LRAA 4F0HA 3HXMA 1JMTA 2GZOA 3DMJA 4FYYB 3KK3A 5KT3A 1SI9A 2XLJA 1NHUA 2FYXA 5LXRA 4HYKA 1PILA 3AJDA 4YR3A 4V19J 2XG8A 4M1KA 3LP2B 2YKQA 4P2FA 4J9LA 4I2PA 3TVZA 1N5QA 1RB0A 6FDRA 4B3RF 5KFYA 4F0KA 3EDRB 2AU0A 3HT3A 3IRXA 2F9DA 4PXCA 7AT1B 4TQRA 2EFVA 2XMVA 4OI6A 4OZLA 2C2KB 5L39A 1UVMA 1UA0A 4C3LA 2HK3A 4DSEA 2KH9A 1ZBTA 3ETOA 2IA6A 4LF5F 3NGSA 3R2CJ 1TKXB 3BEGB 2PDAA 1VR6A 3HVAA 1D3WA 1RTHA 2CRLA 1BLUA 4ZCMA 1VS3A 3MEEA 4IDKB 4PG8A 1YJRA 1XK8A 3M2RA 1QVGR 4WTYA 2BJEA 1PSDA 5IQ6A 4QIGA 2CAJA 1RBOB 1WOOA 3CMQA 1KVJA 5J2NB 1REVA 1UEUA 2A18A 4B3TF 3ZTSA 2AEJA 2FJVA 2XI2A 2MLXA 1SJRA 1WEYA 4FXDA 2HNZA 2Y1IA 2YQ3A 2QLBB 3DOLB 1QD1A 2EWHA 4CH1A 1KC8T 3CSKA 4NE9C 1S1WA 3FCVA 1HARA 1RU1A 2J8SA 1D9FA 2MKHA 2KT3A 3PR4A 5GMEA 5C25A 2A2CA 2CJ9A 1I94J 2QMUB 3NRBA 2O01C 3FSXA 2V94A 2E9TA 1DFDA 2AJFE 3GFHA 2GIFA 1S1UA 2CQHA 3UWTA 1JLAB 3Q83A 1FRXA 1XWLA 4KO0A 4RO0A 3VGTA 1HMVB 3LQVA 1S7HA 1N36J 4KH0B 3DU6A 3SFUA 3KLHA 3KG0A 5D0RA 2RS8A 4M8LA 2ZBRA 3DLKA 3HSJA 2PT0A 1AFJA 2AW0A 4PYDA 1R3NA 3M2UB 3QT8A 5E3CA 4OJ3A 3CD0A 2AX1A 1UPPA 5IS2A 3V4MA 3TARA 2WSCC 2P9CA 2JL9A 1KLNA 1AW0A 5KOXA 1QUPA 1SUQB 2DNLA 4AD6A 3LGHA 5KFBA 4UOCA 4O23A 1FXLA 4DXLA 1CS4A 4XPEA 4GKJF 2XYPB 3P45B 4HHHA 8ATCB 4FNHA 1AB8A 2BEFA 2RRNA 4WFBQ 2M52A 2KZZA 2AP6A 3LP0B 5IM0A 2L3MA 2OELA 3RGIA 1IM4A 2C22A 3CCUS 3BN7A 1U1OA 3UNGC 1WSRA 1VIOA 5L38A 2LDYA 1S6PB 3DLBA 4RNFA 3H4BA 3OL8A 1SC4B 2V8VA 1XERA 3CO9A 5J2QA 3DHWC 4MK7A 4OHWA 2PMWA 4JI0J 2N3LA 1HQUB 2ZKTA 2N4DA 3KTQA 3QPIA 3S6EA 2RDJA 4L75A 1PIEA 3D1QA 3PFEA 1IQTA 2GVDB 4C8KA 4LBHA 1CVJA 4LSLB 4J90A 4FF4A 4KC5A 4PKDB 4QYZJ 3S8SA 3Q2TC 1OPIA 1NUEA 1NU4A 2YNHA 4YP3A 2AD9A 2KB2A 4L74A 3ADAC 2FVSA 1Y10A 5D0EA 5C24B 5K8MA 4WCEQ 1RT2B 3P3DA 1T03B 2LXFA 5F9NA 4DR5J 4ID5A 1YVFA 4J91A 2PA8D 1KWMA 4C0OC 4NXMF 1GAOA 1S4FA 4TLQA 3TZZA 4J9PA 3C2PA 3S01A 1KEKA 5D0HA 3K58A 1MLAA 3A8EA 4IG3B 3FMBA 3OVSA 3C8YA 3PEHA 1K1QA 2OHDA 3FCHA 5J2PB 4D3HA 2FC8A 1R8AA 1IKYB 3Q8UA 3AD7C 4ZPAA 2OH2A 1I3OB 2V68A 2HRTA 3HHLD 2HWIA 2DR8A 4TVAB 4G1PA 2FIUA 1U0SA 1XQIA 2IY5B 3M7VA 4QIWD 3EZ5A 4ZVHA 3H40A 1DJ0A 1S49A 1YWXA 2J0XA 1XNQJ 2HYIB 1HNVA 1N48A 4HKQA 5B0EA 4EMDA 5SUHA 1RYSA 1WUUA 2ZDPA 2AYMA 4K4XA 4DV0F 3V6HA 1R0CB 4ZVUB 1RT7A 4XPCA 3ISZA 3NCPA 2LQ9A 2MZJA 3TVYA 2BE9B 5E2QA 3D9BA 3DLLQ 3ENVA 4KHRA 4B9LA 5IV3A 3RJMB 1KHWA 4OV6A 2QA2A 4ZA1A 1QE1A 3JS9A 2P5VA 1LEOA 4O4RA 3C14B 4KTQA 2F3JA 4RU9A 1U0HA 1J5OB 3NL0A 1YQHA 2CJXB 4YEAA 1SV5B 1BWEA 2M7SA 4UY8T 2WBMA 3CULA 1EX8A 3K2YA 4NMLA 1NJWA 2PIIA 2HHHF 2W2OP 1HBNA 2GVZB 3SIPB 2GX8A 2DR9A 3QZ8A 1RLDA 1S6QB 1SL2A 4AT1B 4RLEA 2XHCA 1WG5A 2J9CA 3J7A1 2CIMA 1X4GA 1FJGJ 1S1TB 1XMOF 5CYMA 4ZVQB 3SQGA 3QO9B 2UXCF 4DEZA 4IG0A 1HQEA 1WTFA 4HDHA 4ZVGA 3PZPA 2VQFJ 3VAFA 1TFYA 4UOHA 4DPYA 1U25A 2LVWA 1N5VA 2DK2A 4LSZB 2B7BB 4YHHJ 4FDFA 4WIQA 2R8GA 2V4JA 2FHMA 1SJ4P 2EK1A 4WU3A 3RAMA 5ETMA 1YRTA 1B70B 1S1VB 5CZXA 3R5AA 4F67A 2YVSA 2VHGA 1YLXA 2RH3A 2PEBA 5HJXA 4MT1A 5KT5A 4PG5A 1RTJA 3Q22A 2AQ4A 1TVRA 1JKHA 2J6UA 1ZS6A 3Q8PB 4XAKA 4K0KF 3MCSA 1D1UA 2VC1A 3EGVA 5C42B 2R2RA 2W2NP 4LRBA 4ES3A 2XQCA 3TZWA 2DRBA 3PX0A 1IN0A 2J7UA 2H48B 2LXUA 4N7TA 1FNMA 3Q24A 1UAWA 3PNIA 2UVVA 2AF6A 1ULRA 2ZVSA 2YX7A 4LBPA 4WK1A 1JLGB 4C11B 2B6AB 1RT3A 3TQ1A 3OTBA 1GX5A 2X3GA 1GQEA 5KOWA 3QJPA 1A6LA 2IM2A 4F4WA 4BCAA 4DR2J 3KHHA 1HD1A 1FT8A 2ROEA 3IA0A 4M5GA 4DJBA 3IWXA 4DR2F 4QPXA 3LWLA 4DQPA 2FPHX 1HBMB 1W7WA 3LP1B 3M8PA 3CO0P 3CDWA 1PYSB 2Y1LB 2KVQE 4A8MP 3UFCX 3CC2S 1HWUA 3ILIA 2DT9A 2VONA 3NBPA 4N5SA 4I2QB 4NLQA 1Y5NB 4MIWA 2C28A 4X66F 4ZJLA 4DV6F 2OEMA 5KG3A 1OQ6A 2ZWOA 4JBCA 3NXZA 2BA9A 2R3VA 3CCTA 4X4OA 2BR0A 1TL1B 1N5YB 2VBYA 4OYXA 1MN9A 2E7XA 3CCRS 2EK6A 1Q8IA 2IMWP 1FKAF 2NLWA 3LP2A 4DPUA 2YKPA 4Y2AA 2HHVA 3IGNA 3HHLB 1KFSA 3AT1B 3EDQB 5DO2A 3OR2B 1VC0A 5LMNJ 4ZLNA 3BGRB 3T6JA 5HVHA 1VJWA 5CHCB 1U49A 3IR5B 3MECB 2R2UA 2WBRA 3JQMA 1S10A 2NXEA 3KUHA 4RU2A 2EC2A 3GCWP 2JEIA 1S0VA 3BBCA 2OPSB 2J0WA 1TKXA 4O3PA 3HM9A 2Q6BA 3TNVA 3HT0A 3RR7A 3BPDA 2V8PA 5HLFB 4K2JA 4IDKA 2PE8A 3TA1A 1Q5VA 4ITSA 4YDXA 5A8WA 1SKRA 5M2RA 3CJ5A 3OFFA 4CT9A 2BE2B 3NP5A 4I7FB 4USUA 3QYYA 4M5DB 4H4MA 2HURA 3BH6B 2YKMB 1DTTB 2DGXA 2ZUAA 1AUDA 3JSBA 1AUSL 2XYHB 3DHXA 2DGSA 3SDEB 2QLXA 1IR2A 2OTLS 4EO8A 4X65J 1IWGA 1HBOA 4X65F 2B0GA 1M1GA 1PGZA 4F3MA 1YSJA 2U2FA 2OSRA 3T9NA 4WP9A 3J7YI 2GFFA 1U8SA 4CLSA 4ZLLA 2H3EB 3G4SS 5A8KB 4U6PA 1XMQF 1FE4A 2ZZTA 3TWZA 1LWCB 1H2TZ 3AAWB 2QL5B 4JUZA 1TUGB 2HS4A 1ZAWA 1RHKB 2KDOA 1LK7A 4Y2MA 4Y34A 2CNOB 1HW9A 2WHOA 2IIHA 1FDBA 4KHPF 3E2EA 3HF5A 1L3SA 3M2UA 4LQ9A 5LL6d 4MFBB 2H9ZA 4GO7X 3PYDA 2MJNA 5IOLA 4NYPA 4K4ZA 2FZGB 4RL1A 3ET6A 3CIMA 3HZEA 3SBMA 2XSFA 1J27A 3ZZ0A 3MR5A 1SUQA 1LV5A 3N5BA 2MGZB 5D4NA 3MOJB 5ETPA 1SJFA 3CD5A 3PTWA 3CC7S 1U1MA 2HVIA 1YBTA 3ZXWA 4MKVA 1IKXB 2IVYA 2OPPB 1T02A 2ZH9A 1HNIB 1CC8A 2E29A 3W8PA 3ILJA 4GKKF 2RVJA 4USMA 2DNYA 2AJ1A 3LP0A 4PPDA 1U24A 3OL9A 2QV6A 3PY8A 4HI1A 3UI3A 3V81B 2LXIA 2NYIA 2C3UA 4AQYF 4WZMA 2YTCA 4WTOB 1FX4A 5FJ4A 1WOPA 5A76A 3EVMA 4TY9A 2GHWA 2APOA 1U09A 2KHDA 1RT1B 2DXEA 4ECUA 4ELVA 5LJ5Y 4P7VA 2K3KA 1HQUA 1YRUA 3LALA 2XCPA 3D0GE 2KG0A 1RBLA 4YB6A 4L3KA 2PD1A 3RU0A 4LF8F 1YDLA 5CH7B 5LMUJ 2GVDA 2DGQA 4F4YA 1NZAA 3K17A 4DQRA 4LSLA 1QM9A 2D3OR 2FVRA 4OZ0A 1X4HA 1UFLA 4W98A 1QAJA 3AXMA 5FDLB 2XZDB 3WC2A 5C2CA 4OYOA 5F8IA 3WDOA 2ZDOA 3MR3A 4WIIA 3AJ2A 3DRYA 1CULB 1WKKA 3BYRA 4CRJA 4B3SJ 5C24A 1U1QA 4CLUA 1RT2A 2JRSA 2O66A 3IC1A 2HMIB 1S0OA 3AQPA 3BGLA 4ICLA 2JSXA 4DFJA 2AV5A 4Q0BB 5H9FK 2D3UA 4ZPTR 1ROFA 5LT5A 4NLGA 2FB0A 4IG3A 2JLGA 1S6OA 4FYDA 1U1PA 3H0PA 4OYWA 4CLLA 3PDNA 5ITHA 2DXFA 1S0NA 4LVOP 5J2PA 1AXQA 1E6VA 2VJUA 1OYDA 4DL4A 4ZOSA 3Q8QB 4NCGB 1H2UX 4O3SA 2XS2A 1IKYA 4JI7F 1I51B 4FS2A 2DEJA 2W9BB 2P9EA 4F3OA 4PABA 1QSYA 1SKWA 4DPOA 5D3GB 2LP4A 2AGPA 2YH1A 1URNA 3OBIA 3KHLA 4FBTA 3NCRA 2YKNB 2K1RB 2CQCA 1F6TA 5IXUA 1U8WA 3FSIA 4WYWA 5AXKA 3QAUA 1TFWA 3W5ZA 2AWZA 5D4LA 2V9KA 1W26A 4A8QA 2IJFA 2IYIA 3FBFA 1XNRJ 3SSRA 3T5LA 3CJ2A 4P10A 4NWBA 1RCOB 5DQIA 2RQKA 2HS0A 4PAAA 2OP5A 3KK1B 2VU5A 4WBFA 2CYYA 2YNIB 1YK9A 1B7YB 5KFDA 1KBRA 2AZ3A 2QC3A 3W2VB 4ZIWA 4BC7A 1TMMA 4QR0A 3OHBA 5CCMA 2ZNYA 1TV6B 5DS7A 1KONA 1X4EA 3BPSP 4K2XA 3JSMB 1UEKA 3C14A 3CCWA 5F3TA 5SZTA 3DDKA 3K8VA 5KG0A 1KTVA 1SV5A 4P2SA 3K5NA 3PRDA 4CP5A 4EU0A 3NNCA 5EDWA 1LKZA 4PR6A 3HP6A 1W25A 1F5AA 1S6UA 4DG1B 1T95A 1S9GB 3K7RA 2WB1D 2OFHX 3DLGB 3AA8A 4ID8A 2QX0A 1U1LA 1FF2A 3MMBB 1S6QA 5DZ7A 4X4NA 3AA9A 2OIHA 3LTOA 1HR0F 2Z57B 1S1TA 3PEJA 1IBMJ 5F8JA 5HMWA 1S97A 3QO9A 5A6WA 5T14A 3OTOJ 3CE8A 5K8PA 3EXYA 4X62F 3LUYA 4ZP9A 3EJMA 2R7VA 4Z2XA 2DR6A 3C6TB 3C3LA 1QDUB 1Q95G 3Q8RB 4NPOA 4DL7A 3BGOP 3N5FA 3M8YA 3A8KA 5T41A 1S1VA 5K8OA 3NG8A 2UVWA 4E2FB 1U48A 1M5OC 3IGVA 1EZZB 2ZOGA 3JSYA 2OKQA 3AQOA 1VQNS 3FZBA 3V6JA 2GGPB 3QIDA 3OV7A 3QSYB 4TKTA 4OZJA 2A3JA 1D9AA 2I9SA 4AXIA 1UA1A 1U2FA 3SCIE 1RISA 5C42A 2HZVA 2DO0A 3UN3A 1O51A 1FI4A 2DIUA 2AMCB 2QLWA 2ALYB 3P6YC 1RHQB 1TKTB 4YN3B 1RACB 1HFEL 2RSQA 3HKZD 3P4UB 3GFZA 5A2QY 3R9LA 2LLZA 1JLGA 1IR1A 4C8ZA 2B6AA 3MAQA 3E8OA 1LOUA 2AJ0A 1T3OA 3H90A 2R7SA 2IC3B 3HHLC 3L7OA 2RS2A 3DOKB 3FEYB 2ZM6F 2FVCA 4Q44A 4M63A 2XTJP 3MOZA 2Z56B 1RGVA 2DPIA 4OYBA 4RW4B 2Y1RI 3K8WA 3LP1A 1Q8KA 3G96A 4KJIA 4DR6J 3M6WA 1VQ8S 4LFCJ 2BABA 2W1BA 1IBCB 2UZAA 4LFCF 4NYZA 1GEHA 3HVRA 2BMBA 3Q89A 5HVGA 4PQUB 4AE5A 2RQ4A 5E5NA 2W7OA 1FWPA 1OY9A 2IAJB 4I2QA 4P6QA 2NR0A 1FXRA 5E3PA 5J2MB 1MMLA 4LQ3A 1W2IA 1XN9A 1UW9A 2JC1A 2D9PA 1X31C 4PXDA 4A8FA 1GT8A 1VBZA 2G0CA 2Q6CA 1TL1A 1N5YA 1L5UA 3P96A 3GIRA 1RK8A 3CDAA 3CCLS 1X9WA 4C97A 5LSRA 3TEGA 4G1IA 4M5KA 2BJDA 4Z37A 3KLEB 2W4CA 4ECYA 5DETA 3QT6A 3OR2A 4IO9Q 5KT4A 3CT9A 4Q8FA 3M30B 3IO1A 3AD9C 3FDSA 4WWSA 2PEHA 5H9EJ 3TOQA 3SSQA 4GRSA 2KU7A 3BGRA 2YWHA 3ZZZA 4MKAA 4DFMA 1UFKA 2JFDA 3D1OA 3MECA 3PKYA 5AE1A 4JI3J 2B4UA 1EETB 4RW6B 1NJZA 2OPSA 1EKSA 1MW7A 3CCQS 4LFAJ 2GA7A 4NMXA 2CQ1A 4WFYA 5A8RA 2D3ZA 3KXDA 5HLFA 4HL9A 3PX6A 2RDIA 2CQIA 2W4DA 4LF7F 3A8JA 2EFOA 1Q7LB 1KOHA 3CJ3A 4J37A 2BE2A 3NEKA 1TK5A 4I7FA 3CF5Q 4M5DA 4CO3A 3AXKA 1F5BA 1DTTA 4DV1J 3GV7B 3CTRA 4F36A 2FJDB 1HNXJ 4NLXA 1MWZA 2CG4A 3SDEA 4C4WA 1NSAA 2Q43A 4FXVA 2CQ4A 2DGWA 1EP4B 2KYZA 2B7CB 4Q45A 2KFYA 1NO8A 2B3TB 3H2UB 1OY6A 1H74A 5DDPC 3PO5A 1FX2A 2VPXB 4TNOA 3R5BA 4DL0C 1B0VA 3MTKA 5A8KA 2C3MA 2F1FA 2IMOA 2DHAA 5F3ZA 4OFZA 1LWCA 3UD5A 3D0HE 2ADBA 3AB2B 3D6HB 2EEYA 3H5XA 4TN2A 2VG6B 4DX5A 3HPOA 2D7SA 4DPXA 2HGNA 2KYXA 1JNZB 2CPEA 3KJVA 3HHKA 2BX6A 1OY8A 1SJ3P 5KT6A 4MFBA 3U1MA 3K89A 3R3TA 2YPZA 1TUVA 5HN0A 1X4AA 2C3OA 3PRBA 3VZIA 2C2EA 1NKEA 1DY3A 4ZCKA 3QIPB 4BDPA 1R27B 2K8GA 4O0NA 2R7OA 2ZC4A 5T7LB 1N54B 5HAOA 1FNXH 3TANA 1IKXA 2FTRA 3WIUA 2KI2A 1HNIA 2AZ1A 1NKBA 3WIVA 4N8OA 2HBRB 5HMZA 1HNWF 2B4PA 1Q82T 3V81A 1PJ7A 2F4VF 1N34F 2XZTB 2D74B 1VQYA 3KLGB 2ZH5A 4EWTA 2E5HA 2LQJA 1S79A 5IT9Y 3QLHB 4QQBA 1RT1A 3J81j 3E01B 4FXWA 5ADZA 4B08A 1UCNA 3J7AN 1PAEX 1PO6A 2DNHA 1KKHA 2QA4G 4I56A 1TK8A 2DY1A 2Y1JA 2RNEA 3E3XA 1QY7A 5A2QU 3BO2A 1HHQA 2CVEA 4C9DA 4YY3F 2XC9A 2GQCA 2E9RX 1Q8LA 1R8BA 3EXCX 5FDLA 1REGX 2EFNA 2HNDB 2PA3A 2A0FB 2KHCA 1CULA 3C16B 3J7YU 3DLJA 5ETOA 3OXFA 4Y3CA 2Q3PA 4HH1A 3PO4A 3Q8VA 4CI0B 3DRRB 4FN5A 3SSSA 2HMIA 3JAMU 3D3BJ 2MZQA 2M0GB 2V2KA 2E5LJ 4UZCA 2GQQA 2HHQA 4EYHB 2E5LF 5I3UB 1PC4A 3VAIA 3JTNA 3EE3A 3UVJB 2HFUA 4LF2A 4K4WA 4X4RA 2KL8A 5DG8A 3P5BP 2J76E 3DYAB 2D3O1 2VA3A 5DRKA 3K59A 1U7LA 4NCGA 3GR1A 1ZYQA 1BUXA 1M0SA 4U8YA 2N7YA 2HLUA 2W9BA 2NXCA 2RHQB 3HFKA 2NREA 5D3GA 5FIIA 4TY8B 5FLXU 4B9TA 1FWKA 5F8HA 2YKNA 2K1RA 2OTJS 3OT9A 3R5DA 3W9HA 3M8RA 5EX3A 4OI4A 1U02A 2JDJA 1SH3A 1YHQS 2U1AA 2GCFA 4F25A 1RWPB 3GIJA 3FKBA 3NGTA 4NLDA 3KK1A 2HQGA 1IBLJ 1BY9A 4U7UK 2CPIA 1SL0A 4KB7A 5KG6A 2WRMA 3W2VA 3OR1B 1O5JA 1F2HA 3HKWA 4ED4A 2GNKA 2OD4A 4B9UA 1TV6A 5KFTA 2IVFB 4K59A 3JSMA 2DGVA 1FK9B 4DR1F 4C0HA 3GYGA 1Q4RA 3M6XA 4ECZA 1O8BA 2DISA 1CG2A 1V3SA 1NK8A 3ITHB 3UDVA 2K2PA 5E7OB 1G1XA 1AROP 3L7UA 4I4BA 3D6FB 4EBEA 2IRUA 4DG1A 2VB6A 1S9GA 6AT1B 3K0JA 1Y5LB 4UZBA 2H5EA 3DLGA 3FGVA 1R43A 3EGZA 4Q2MA 2AGQA 5KFEA 2OI2A 3MMBA 4PWDB 1N8RT 2P2CB 4OZ3A 1FFGB 2DBBA 3TW0A 3GTYX 3T1HF 2VPWB 1WHYA 4AL6A 4LF1A 4KT0C 3IBFB 2WVCA 3KJFB 4YQWA 3W5YA 3C6TA 1BXNA 2UUWA 1KHVA 1S59A 3A3NB 2CQ0A 2D1CA 3NAIA 1G6BA 1QAXA 3EICA 4J9QA 4OIXA 1TKZB 1NK7A 2OUGA 3RRKA 5ETVA 5GAEI 4USVA 3F56A 3MDFA 2GJ2A 1IVZA 1YX2A 1CSJA 1FRMA 2ZH6A 1H3DA 1D8ZA 2QO3A 5K20B 4KSEB 3AHPA 2NPFA 3IM8A 4UUXA 1N4LA 2A2DA 3DLEB 2HBZB 4FF1A 1JLBB 4KGZB 4PWUA 4RBUA 1RLCL 1HNZJ 2Z2LA 1TKTA 4KBIA 5GAHI 3HVTB 3KNGA 4MYTA 5L9NA 4M5MA 3U02A 2WW8A 1RTDA 3SI8A 3X3UA 1XC9A 3GONA 2DJWA 5D15A 2H4WB 4JYAF 2Z8QA 2IC3A 1J5EF 2IM0A 1KQKA 1RAJA 3M6UA 1VLOA 3B8HA 4ZP7A 5D78A 3WZ0A 3UR0A 5IT9U 1C0UB 3DOKA 3SYZA 3J81Y 1JLQB 1HI0P 3MR6A 1Y9OA 2HS3A 3M6VA 2RUSA 4ZPDA 4N56A 2ZNZA 3DRPB 3DRSA 2DNGA 2HBQB 3NGRA 3M9MB 4RW4A 1QTMA 2NUHA 2RQMA 3I9V9 1U2CA 1VQ6S 4KYZA 1YZ7A 5D4OA 4A8YA 2RIJA 3L95X 1KFDA 4NRUA 1UWAA 4IR9A 2IBOA 4J9UE 2UVUA 1Q81T 4PQUA 4UTGA 3HZGA 2IAJA 2ZITA 1S1XB 1H6KX 4QOTA 5J2MA 4F4ZA 1TKDA 3QGGA 4P71A 4YOEA 3TZYA 1FFSB 3HI9A 1N33J 2K7JA 5LXYA 4MYUA 4M5HA 4OYPA 3PYFA 1VRQC 3QGIA 4LMZA 5HMYA 1F2GA 4GC7A 4DV5F 1RAHB 3WHIA 2RU3A 3MWBA 5AT1B 2HIYA 2X1BA 2MPUA 2Q79A 3KLEA 3CMES 2GMJA 3QJJA 1U1RA 3MCMA 3OXGA 4URGA 1TK0A 4F2RA 1X5OA 2HAFA 1SKUB 2WVEA 3CB4A 3M30A 5I3PA 4O3NA 3HVWA 4JI1J 2V4RA 3TEHB 3F0NA 4JI1F 4IYQA 3RB6A 4DN0A 1FVSA 2DHSA 4MMOA 2RAQA 4DLEA 4CTAB 2FJEB 2NQPA 2BQUA 1RKIA 4HH0A 3HSDA 1G7CB 1EETA 4RW6A 3F44A 2M8HA 5HK4A 2E5IA 3OSPA 2N3OA 2BKOA 2VKRA 3PV8A 4N8NA 3FBCA 3UO0A 4Q7AA 1RE1B 2VA2A 2XMKA 3OLAA 3GIMA 2UUAF 3EPIA 4LF4J 3HLUA 5MAOA 4YDDB 1KS2A 5DG7A 4LR8A 2C2OB 1NHKL 3DLHA 1JJCB 4TYAA 5B0GA 3I32A 3M32B 3W65A 4JI6J 2J9DA 2FJWA 3FK4A 4KR0B 1CBKA 1UWBB 2B8PA 3UD4P 3PRVA 3OUYB 1EP4A 1Y00A 1KNZA 5KFZA 4NLVA 3PKMA 1RSCA 2C2DA 4URSA 2GMLA 3QATA 3ENAA 2H51B 4H4KA 4W4MA 4TLRA 3EZOA 1TAQA 4I6AA 1N32F 2L08A 4UQGA 4KGXB 2XMAA 2HLTA 3PW0A 2ASYA 1ELOA 1BMQB 1GMVA 5K9FA 1T05B 2AEMA 3C6UB 4Q5VA 5J1PA 1WKJA 3FBEA 4WXOA 3I5AA 4OYZA 2AJQA 3MM8B 3RR8A 2VG6A 3D54A 3RRHA 1P9YA 2YXLA 2RDDA 2RJZA 3ZFVA 1VQ5S 3FCWA 5BXIA 1IBKJ 2LDIA 3JQJA 1X8DA 3PYGA 2ZEJA 2WSEC 3G8QA 2CJQA 1SKSA 4NI2B 2KG1A 4EO6A 5IZHA 1EQ0A 3WBZA 1S9EA 2JEGA 1S72S 1F60B 2EPIA 2L41A 1K8AT 2CNNB 1BD6A 4IRDA 3QIPA 4UQTA 3F41A 4ES2A 4LR7A 1VISA 2DXDA 3BB5A 3SEOA 2KFZA 4CLPA 2HRUA 5T7LA 4HHUA 3MUTP 1N0UA 4C6AA 3MMCB 4DR3J 1GMUA 1WHWA 4M5IA 1Q16B 4NZ0A 2LU2A 5KFRA 1SBRA 1EHWA 2VUGA 1K0VA 3KNAA 2XLKA 5CYJA 1NAQA 2G1DA 3DC2A 4CLTA 2FLOA 3GB0A 4LRDA 4DZDA 3CJ0A 2QSFA 3KLGA 3CC4S 1WC3A 4USKA 2AHOB 5HANA 2EC0A 3QLHA 4EYIB 4I69A 2BXJA 4OX9F 2ROPA 3BGUA 3I87A 3E01A 4O4GB 3VCDA 1QSSA 1R6YA 4HTIA 2XMUA 1BGXT 2BBEA 3PX4A 4B02A 2NYHA 2UUTA 3OW2R 1RXOB 2I1RA 1NRKA 2ZC3A 3I55S 3Q8YA 4LF6J 3FFIB 1RWVB 3CCJS 5F9LA 3CJTA 4WPAA 4NCAA 1X0FA 3I0SB 2HNDA 5DGBA 1RHUB 2DNOA 3QFHA 3ENWA 1XR6A 3C16A 1RABB 1P6TA 4NZ6A 3J81U 2HVZA 3D66A 1X60A 3SV3A 1RTZA 2ZBPA 3DRRA 4W92B 4RNMA 4IQXA 3MPUB 4JI2J 2VG7B 5B08A 2W2MP 2WK4A 3MAAB 1K44A 2OAUA 2ZH4A 4DSLA 2RE1A 4BS2A 4ECVA 3UVJA 3EX7B 3GMGA 1X0PA 2KO1A 5DZ6A 3OFGA 4RX6A 4ED0A 3PW4A 3BR8A 3GJQB 3DYAA 3PJXA 3KDNA 3VTIA 1F3VA 3CJQA 3THVA 1AT1B 3ISNC 4KH1B 2ACMA 2QYGA 2C3PA 4K50A 2KTQA 3S7RA 1HIYA 4TY8A 2ZVIA 4QW9A 3GILA 2EBEA 2FY1A 3R7NB 3VVUA 3X1LB 3R6LB 2GS8A 4F2SA 3B78A 2HNYB 4DUYJ 1RAFB 4NXNJ 4OMFG 2HEKA 4DCPB 2E1MC 3VZHA 2M2BA 4LVNP 3WQPA 5GMDA 3VGUA 5AXNA 1H7XA 1DAXA 5KFPA 3T5KA 5IQQA 2XI3A 5KFCA 4PYAA 6FD1A 4OHYA 3RTVA 5I42B 3OR1A 2YX4A 4UW2A 4IH5A 1XTZA 4URQU 4PUOB 5DG9A 1NNDA 3KLFA 5AXMA 3D5MA 4DV4J 4NZ7A 1PKUA 2AJ2A 4DV7J 2HGMA 1FK9A 4DV4F 2C2MB 2D41A 3LPEA 3CPWR 3T1YJ 4A8XA 1R31A 1KN6A 2DR7A 1WDDA 2LFVA 4ZITA 3ITHA 3IBWA 4N41A 4GVBB 4QWDA 2DR5A 1HLWA 2X7IA 2NXUA 3H5SA 4WZQA 3JTPA 7FDRA 2V2ZA 1L3VA 4K4TA 2A1BA 3M8QB 3JB9k 2MKYA 1RT4B 1T9VA 3QGPA 4J9OA 2ZJQQ 3PYEA 3UN5A 5AJ3J 4PWDA 2DNQA 3OTDA 1H98A 2DNPA 1B64A 1Q5YA 1Q79A 3ZO7A 3QWUA 4UOGA 4NL5A 4RNNA 4LSNB 1I94F 3N9UC 3V6KA 2JWNA 4M94A 2YY3A 1XJWB 3NWRA 2BJ3A 5J1NA 1UZHA 4I67A 1YBUA 3THPA 4DPWA 3AJ1A 5JUMA 1N36F 3I4PA 3MCNA 4QBUA 2C2ZB 5F0WA 1TKZA 4OX7A 4J9RA 1RUSA 2IDEA 3TUZC 1X5SA 3M8SA 7FD1A 3MMJA 1RU2A 2QEXS 2CG8A 4ELTA 3PIOQ 5KG5A 1RAOA 4R8UB 1VJQA 4NLTA 4MAKA 2E5JA 3GLJA 3EVWA 4EBCA 1VHIA 3UQSA 2QL7B 3DLEA 2I38A 1JLBA 3A12A 4YB7A 1FRJA 2DO4A 2K06A 1BQMB 1H73A 3EGNA 2HFVA 3W8GA 3HVTA 1DURA 2IRXA 2NCKL 3VR1A 4IOBA 1VFJA 3DOMB 3MM6B 3P5TL 3AD8C 1K9MT 3W3SA 1ZA2B 2GO8A 2W2QP 3PG9A 4OI1A 4ZN3A 4O3OA 5L1IA 4IOAQ 4J9NA 1C0UA 1JLQA 2R8KA 3R97A 3DFEA 4KGKA 3TAMB 4USTA 3DRPA 1T9XA 1WKLA 3UD3P 2MMYA 4JI0F 1TR0A 3NGDA 2ZBCA 2QYCA 4DBQA 1WSVA 3CDEA 3TP2A 1UZDA 2I0XA 2VICA 1S1XA 3CWJA 3RBDA 2XWYA 1PJ5A 2MZRA 4OQJA 3W60A 5DQHA 5F41A 2GC8A 1Q53A 4EBDA 5ETNA 4F26A 1X4CA 1LFWA 3B6BA 2H5IB 5BYQA 3FUYA 5KFNA 3IRXB 2BQ3A 3D6MB 4EFAC 1RWUA 3BKTA 4C48A 4RWWA 1FDDA 3NGUA 5DLFA 2UXBJ 3SXLA 4DR5F 1AZSB 4HTJA 1FESA 2J7WA 4H54A 1DBDA 4O0IA 2B9YA 2VPYB 5EWGA 2I8EA 3DM2A 2W9AA 2BJ1A 4JI8J 2ZKUA 3G6XA 2GO9A 3MEEB 1RDRA 1FVQA 2UUCJ 4IQMA 3MEDB 3R1HA 5KFHA 4CTAA 5GAEU 3SZ2A 4NRTA 3GYXB 2F4FA 2QMWA 1N56A 4B9MA 5CCLA 1U1KA 2M5YA 3MEKA 3FVYA 2FGCA 3A4TA 2F5GA 2HZCA 1IKVA 4FNIA 3J7Z5 4DV2J 2FY8A 3QSIA 3U1LA 1JNRB 3OJSA 4YFUA 5GAHU 5KFSA 4I68A 3B54A 1O6XA 2YWWA 4XDDA 1T8EA 4K5RA 1XNQF 3AOCA 2IYGA 2LCWA 3LO3A 2CPFA 2EXUA 3VAJA 1UWBA 1GXUA 1FA0A 1D09B 1YZ6A 3OUYA 3U27A 1CEZA 3G8TA 1RWWB 2NSCA 3NLCA 2POKA 2KJVA 2BDPA 4FKYA 4PXEA 1TMJA 2VDHA 4X4TA 5IT0A 4B9VA 1T05A 2HPUA 3IR6B 3C6UA 3IS9B 1PG5B 2CPZA 2PFFB 1N6QB 2EKYA 3MM8A 4A8SA 3NMAA 1T7PA 4DU8A 3I56S 4DI6A 2X3DA 3D3CJ 2DB1A 2N4CA 1T0TV 3N6NA 3HCXA 5HP1A 2B4OA 4DZ6A 4Q43A 2GAGC 3T6BA 2MKJA 4F8RA 1CS4B 3CJSA 4KQZA 3ULHA 1B4SA 2XGQA 4NI2A 2QGFB 3OTEA 3A3PB 5B0AA 2CDQA 4JV5J 2ILYA 4ZVPB 4TU7A 4GC6A 4IFYA 1YIJS 4JV5F 2ZH2A 4DV3J 3BS9A 3O44A 3G71S 1U47A 1SC1B 1FJGF 2VF3A 1DTQB 2O67A 2DGUA 2ZWPA 2X1FA 2QJ3A 2QSWA 3NY0A 1VRTB 3NNAA 5KG7A 4NLWA 3HULA 1FJEB 2MQPA 3UDCA 3MMCA 2VQFF 1CQNA 1IR0A 2V2VA 4NA3A 2R7UA 2G2YA 3POTB 3IN5A 4C98A 4YHHF 4DWIA 1F9EB 1JLEB 4USJC 3W63A 1IKWA 3LF0A 3MUVP 3Q2SC 2CADA 2R7XA 4LIWA 3HD1A 2DHXA 2G2ZA 1TL4A 4OI2A 3PJ9A 2AT1B 3G82B 4MIAA 5G0RB 1YBAA 5K8NA 4FYXB 2CJKA 1URRA 3GCXP 1MWYA 3FEXB 1U6FA 5HQ8A 4O4GA 4A8KA 3W7BA 1GMWD 3NMRA 3MUMP 3V6DB 4P7TA 5IFMA 1S76D 3FFIA 5KAKA 2CPJA 1NK9A 2QE5A 5I4MA 3N79A 1FXDA 4O44B 1LNQA 2GHPA 2OSQA 2V9WA 3I0SA 3VF0B 1IXKA 3MM9B 4OI3A 2CXEA 2F8MA 4ZVTB 4XK8C 5B0CA 1BQXA 3N6LA 5H9FJ 2BKNA 3R27A 2HQ3A 2H65B 4RW8B 1M1KT 1KRPA 3M2VA 2HVDA 3OHAA 1CC7A 4F04B 5ETTA 2KM8B 4NEYA 3ENQA 2C1EB 3FC9A 3N01A 3I82A 3I31A 2VG7A 4RNHA 3MAAA 1NK4A 4DMZA 3VQSA 4JV2A 3ZZUA 1CJUB 2QN6B 5D0GA 3BSCA 1FHTA 2J9EA 3GV5B 3BGFA 2PMHA 2XSJB 3NOGA 2IM1A 5E3QA 3QWPA 2CQGA 2V6AA 1Y7PA 4WKYA 2Z2YB 2BYCA 2HBYB 1UTAA 2R7RA 4RUAA 2HSEB 1QLNA 3PACA 4J5OA 3H2LA 2CWKA 2X51A 4OYIA 1SQEA 2B43A 1GFWB 1R7IA 4ZS6A 2MKSA 4YUDA 1YI2S 2HAIA 2EI5A 5LMNF 1MMDA 5GMKa 1M5SA 2WOMB 2XULA 4DCJB 1TL3B 2UU9J 1U6BA 4PCQA 3G6YA 2CQ2A 2W4PA 1HWLA 2O3DA 2BVZA 2QG9B 5I42A 2DNMA 1RP5A 1VQ4S 4PUOA 5A6PA 4QIVA 1PYTA 1WC4A 1HWKA 3VHQA 1K73T 3GV8B 5BR8J 4OHZA 3OVBA 3UN2A 5M2PA 5BR8F 1NJIT 4IOCQ 5GADI 4B3MJ 5J2NA 4GVBA 4DSFA 1M5KC 4KPCA 3ZNUA 2WVBA 1RT6B 1XR7A 2XNQA 9ATCB 2ZUGA 4EUVA 5BYRA 3M8QA 2XMMA 1ZM9A 1RADB 3M1VB 3DOLA 5K14B 1RA7A 4FYWB 1RT4A 4B9SA 2OPQB 3DRXA 1X4DA 2RB7A 4Z7YA 3G8SA 4LREA 1UFWA 3MM5B 3MI7X 1T9UA 1Z1ZA 2BJ8A 2W8KA 4LSNA 1R0AB 2HFNA 1XMBA 3DCAA 5KFMA 3EPGA 2GJIA 3SCKE 1V5IB 2P6TA 4BWJA 1JLAA 2Y9HA 3NCQA 5HQLA 1HMVA 3R5GA 3D0IE 2UUBJ 4BBYA 1SJQA 2YPYA 4X4PA 3MZIA 3H59A 4TXSA 3GIIA 4QIFA 4L72B 1KQSR 2RU9A 2AYEA 1MG7A 1WACA 5JVHQ 3I0RB 3PW2A 2XM3A 1RBAA 4LFBJ 2Z58B 4R8UA 4JP8A 1ZM4A 1KSPA 3K57A 2B51A 4JI4J 2J8AA 5D4PA 1GTEA 1WWHA 2MJUA 4DR4J 4DS4A 2LEBA 3KLVA 1RT3B 2XZWA 2CZ4A 3RBZA 3KWMA 4DUZJ 1SCJB 4DU7A 2YKAA 3MTJA 2HZAA 1PBUA 4ED5A 2VBWA 1FO1A 1BQMA 4Y00A 3IFEA 3D67A 5DQGA 3OVAA 3PFOA 3DOMA 3MM6A 1IJEB 1HL6A 4OHXA 3GG1A 2VZ9A 3DDIA 2F7VA 1WC6A 4WE1B 3TJAA 3NNHA 3KHRA 2IJRA 3AOBA 1S6PA 3EVOA 2VG5B 4X4VA 4QR1A 2YNGB 1ZAVA 4JI5J 3TAMA 4R25A 2LQ8A 4I64A 4ZCLA 1OJ4A 1GX6A 1Z2ZA 2OEKA 4DOZA 3G6ES 5LM7E 4ZK7M 1FE0A 2UP1A 4ZPBA 4JV0A 1Y4ZB 3DXBA 1JJ4A 1GH8A 1DHMA 2ZHBA 3R7SB 5LMUF 4QZVB 4UF4A 1FNOA 1UPMB 3AY0A 4IH7A 2EFGA 4L73A 1UJ6A 4LBIA 4FF3A 3HMJG 3PW7A 4B3RJ 2YH0A 4RUHA 4ZHRB 3ZTOA 2IBKA 4RW9B 4DQQA 4B3SF 1FJCA 2IRYA 2QFJA 3TQEA 1T03A 3L3CA 2LYVA 2KVIA 4QWBA 1NJYA 3VALA 1BQNB 1AZSA 4ZDNA 2D69A 4LF5J 1ZM2A 2G9OA 4DPTA 4F3QA 2CJYB 1D0EA 1VK8A 1CQMA 4ZP6A 2XYGB 1FEEA 3M8WA 4FBUA 4CO4A 3MEDA 4XO0A 1S0MA 4MK8A 5A8WB 3MFHA 2R8IA 3UPFA 2Z0GA 1RCXB 1M5PC 4B3TJ 3DDNA 4G1QB 1VDHA 4ECWA 4HACB 5KFWA 1IJFB 4H4MB 2OMLA 5FD1A 2WVDA 2DY9A 1GNKA 2LQ5A 1Z4UA 2FLPA 2MTLA 2QIFA 1RWOB 1PCAA 1HBOB 3C19A 1N5SA 5HL7Q 2FHKA 3KJQB 3CUNA 3J7ZT 3WX8A 3DNCA 2JH3A 2V63A 4ZMMA 5LJ3Y 4M5JA 4C8NA 4CM0A 4A4JA 5LSLA 1ITPA 2XMWA 2MKIA 1AYEA 1XNRF 2ZZMA 4ZJOA 2GQ2A 3QMQA 2MQNA 4J9VA 3MHYA 1Q8BA 4C2MA 2FLNA 2EG2A 2VFSA 4YB5A 4OZ5A 3TZXA 4RKUC 1LXNA 3CVKA 4NA2A 5C7PA 1C4CA 2HG4A 2R42A 1YRXA 2F9JA 4CCHA 1HHSA 1PYOB 5DDQC 2ZE2B 5D77A 1Q78A 4YMEA 5EN1A 4X2BA 2DH8A 1RZMA 3SQOP 1J5OA 3IS9A 2PN6A 5D6GA 1N6QA 4CO2A 2J6TA 4CLYA 3BKUA 3E51A 3R5JB 1RAIB 2BE7D 3ET6B 5KFFA 2IPOB 2EBGA 4S0MA 2DIVA 3AB4B 2XLIA 1EQMA 4J9SA 1TZ0A 1M5HA 3GR0A 2F63A 2Y0BB 4GKJJ 5HROB 2OFGX 1WG4A 4ZCIA 1HWJA 1S9FA 1WC5A 2GVZA 5DDRC 2AEFA 1MNEA 5KFOA 1V3RA 2B56A 2FZCB 4QU7A 3TI0A 3RB4A 1VQPS 3EUNA 1UETA 2IHR1 3MR7A 1DTQA 5KFGA 2C3YA 1IBMF 4WK3A 1VRTA 1VHFA 3ZZOA 2ATCB 4AL5A 3OTOF 3Q8SB 1JIHA 3MMAB 4A8WA 1YJWS 3TJ8A 1FRLA 3EWGA 3LANA 3POTA 4OYMA 1JLEA 2VIHA 1CJVB 2KM8C 4NYOA 4E8UA 2DHGA 2VODA 2E1AA 2VFRA 4NX9A 4ZJQA 2MHNA 2XB2D 4QYRA 3G82A 5G0RA 3OPKA 4LRCA 2DNKA 2ZD1B 3WC0A 1C1CB 1T9YA 1E6YB 3AH6A 2DCUB 1YITS 2BQRA 4F4KA 3Q86A 1HW8A 3QNWB 3C66A 4KFBB 3G2XA 3V6DA 2ZH8A 4J9KA 4HT5A 2XEXA 1JWWA 2MQLA 3R5CA 2ZBQA 1HBUB 2MDAA 2MZSA 3I5BA 4NXMJ 3A13A 1GTHA 4K4UA 4B9NA 5DM6Q 4YR2A 4O44A 2W7PA 4C11A 3MM9A 3W66A 1GXLA 4ICLB 5EUHA 5B0DA 3H2VE 1F0XA 4USIA 5ETSA 3ILLA 3A1YG 4W90B 4HR2A 4RW8A 4QU6A 2B8QA 4CLKA 3BZQA 3MD3A 1SIZA 4BC9A 1E6VB 4ZKAA 1HBMA 4V1Ak 2RILA 2HHPA 3A8IA 5HMXA 4CLZA 3H42A 2HIQA 2UXDJ 1M90T 1CJUA 5HVFA 2YQ1A 4DR6F 2UXDF 3MEGB 5KT7A 1P8GA 2ZOFA 2XSJA 3CDBA 4CZCA 3BM7A 1RT5B 3DU5A 1X7VA 3I4HX 4GMKA 1YJUA 2V2QA 5CYQB 4IRCA 3GSIA 1HD0A 1G2EA 2R7TA 3QQCD 4DV0J 3EGWB 2YKOA 3GG0A 3G9CA 2FDNA 3CIZA 2L48A 3UDLA 1RAGB 2V69A 2C42A 3PHTA 2MLYA 1NSQA 2BJ7A 3T41A 3HHLA 4Y2KA 2COLA 4RNOA 4NLSA 3W1YC 2QT7A 3IAM9 4CWBA 2MYFA 2WOMA 1Q0NA 1S99A 1TL3A 1TELA 1UEVA 2VC0A 5KFLA 1N5TA 2OO4A 1SVDA 1N52B 4K5SA 4O3RA 4XDCA 1OQ3A 4JI3F 3IRWP 2RQCA 1TTHB 2HHHJ 4N47A 1OSDA 4DL3A 2BW7A 4KY3A 4LFAF 2SXLA 3OQ2A 1KR4A 1F3FA 4QWEA 4IUFA 2NXJA 2AGOA 5HBMB 1XMOJ 3BO3A 2Y8WA 1TP7A 4C8MA 4X4QA 1Q1KA 2UXCJ 3DGPB 2KXFA 1FEHA 5E41A 4GVLA 1GK8A 3THTA 5CQGA 1RT6A 1UW4A 3UNYA 3GYNA 2YKMA 3D2WA 3BBBA 4PG4A 3OL6A 2JX2A 4ZVSB 1HA1A 4DV1F 3M1VA 1SIWB 5K14A 2H1YA 3GSDA 1HNXF 2OPQA 3FZ2A 1FDNA 4DFKA 1C4AA 4KAIA 5E3AA 3ISND 3TX8A 3MM5A 2XBPA 3W9IA 5F0UA 2GJFA 4QR2A 2R8HA 4IRKA 2R8JA 1JLCB 1Z2LA 1R0AA 4ANEA 1KQFB 1QAYA 3GIKA 4UT4A 1Y3KA 1WHXA 1R8CA 4IO1A 3WX4A 1DARA 2CUYA 5CAAA 1OPZA 4CT8A 2R2TA 4K0KJ 2XHWA 4AXJA 4R5PB 3VV2B 3FJ2A 1FRIA 2CZVC 3MF5A 3AFGA 4JB8B 4FKXA 2MEWA 4ZPWR 2UV8G 2CQ3A 1VI7A 2Z2ZA 4MKBA 3I0RA 1WI6A 4ER8A 3NOCA 4NA1A 2BW2A 3ICLA 3BQ2A 2FHOB 3PM9A 5KFJA 3MXHP 5CA5A 1WDTA 4CNZA 3U7JA 2MY8A 2MGZA 1WJ9A 1VCTA 1HPZB 3RG6A 1NDLA 1OO0B 4DFPA 2G0JA 2V34A 5B0BA 3UR3C 2P8IA 2OPPA 2WVFA 1NK6A 5CZVA 3ZTQA 2FLLA 4RJVA 2RT3A 4P72A 1GMWA 2W9CB 4CYUB 1WORA 4RBTA 1UJ4A 4I0WA 3CDUA 1KVKA 2GIRA 2HGLA 2V8HA 1RWNB 4WE1A 3OLBA 4K8RA 1UVJA 3T1AA 1H7WA 2VG5A 2J6SA 2YNGA 3M9NB 3IMQJ 2VD3A 1H38A 4X66J 4DV6J 4RW7B 2O5DA 2Y0SD 3M05A 1Q86T 4NOHA 2M3DA 2CNKB 4DSKA 5GADU 2VKZG 2LA6A 4DX6A 5KFUA 2MQQA 5J1EB 4DL6A 2MQOA 1EJ7L 3CCES 3OSNA 1FKPB 4OZ1A 3BYPA 1WC0A 1MWQA 5DDOC 1UVIA 4PQAA 1X5TA 5K5MA 3MPWA 2HHUA 4QYZK 4NLUA 1SH0A 2LQBA 3GQCA 5A0YB 2B9XA 4ZHRA 3ZZTA 4HHJA 4E98A 1UKUA 2N7CA 3MPDA 1WEZA 1RWXB 4PG6A 4RW9A 2FZKB 1QAIA 4Y0FA 4ALZA 1FJ7A 1NPPA 2F65A 3K5MA 3HHDA 1RQ0A 1K47A 3N4WA 2WTFA 4N76A 1BQNA 3VAMA 4CO5A 1C1BB 4Q0BA 2GHVC 5A8RB 3LPYA 3VAGA 2HKEA 2ZH3A 2C2NA 4ZLPA 1NK5A 2HHWA 1LW2B 2VOOA 3NS6A 4DQIA 3RYLA 3BSNA 4USHA 4DDFA 1HYSB 4UUWA 4OX6A 4G1QA 4HVZA 1FD2A 1V6HA 2AYGA 4HACA 3H8YA 1NPKA 5U47A 1HKAA 3GJSB 3IM9A 1L3UA 2W8LA 4ZVEA 3HK2A 4Y28C 3CCZA 2R4FA 2XNRA 5IV4A 2RF2B 3QT7A 1C0TB 3PCOB 1RAAB 3H5UA 1NLKL 5JXSA 2I5JB 2OD6A 2JJ4D 3I9ZA 2JZ5A 1RKJA 4R0JA 2YBVA 3CEDA 1XMQJ 2FJXA 1HI8A 4EZ6A 1Y3JA 2YNIA 2J0SD 1FKOB 1A0OB 1IBLF 1YJNS 1VK3A 5I3QA 1WEXA 4ZIVA 1LWXA 4BWMA 1H2VZ 1VLYA 3KJVB 1VBKA 4ILMA 4KHPJ 5L1KA 2AYBA 3LOUA 2ZE2A 2HWHA 1VQ9S 4F0MA 2VBXA 2IA0A 1ZZFA 3BBFA 4B3OB 3L4BC 1MROB 1NSKL 2DRDA 1V5VA 1R0BG 5LSOA 3RW7A 3SCJE 3G87A 4IFVB 1UVNA 5KG4A 2PI5A 5HROA 3IAS9 4JOUA 2BACA 4U9RA 4PWWA 4N77A 4GKKJ 2WAQD 1IWAA 1G4CA 2X1AA 5CABA 4KRWA 1LQ9A 3IWLA 4ANCA 4P2XA 5KT2A 3GU0A 4ZPCA 4AQYJ 1IQZA 4ECSA 5CD4H 1TL5A 3OFHA 5RUBA 3MMAA 1U4BA 1RTIB 4FVCA 4C3KA 3BV8A 4DSIA 3RB3A 1CJVA 3MAHA 1TL7B 5ETKA 3PIPQ 1NM2A 1Y5IB 2VFUA 2VPZB 4LF8J 1UL3A 3CGIA 3N0VA 1FRKA 4WU2A 2DH9A 4ILRA 4DUTA 3QRRA 3CJRA 2GGPA 3VWSA 2ZD1A 1N88A 1W2BR 1C1CA 4FF2A 1E6YA 2MSSA 5AE3A 4WF9Q 2FVQA 2FHJD 2JFKA 3Q23A 2HVEA 2QZ8A 4DX7A 3MM7B 3SMZA 4KFBA 3TVKA 2EW9A 4J9MA 4KGVB 3H25A 1ZZNA 2M88A 3ETMA 2DPJA 2BANB 2JOQA 4KV8B 4HEA9 2RKIB 3TO8A 4OLPA 1HBUA 4XTTA 4MJKA 3TX0A 4U8VA 3ZTPA 3KG4A 1HNZF 3LA0A 1I6JA 4M95A 1RA6A 2H4YB 1U1NA 1VC5A 3GWCA 1UVKA 3PW5A 2VQEJ 4RZRA 2L9DA 5GAGI 2VQEF 4B17A 5F8GA 2NUUG 3KFWX 2RMLA 1YJVA 2W2PP 2KXNB 1B99A 2G4BA 1WG1A 1X5PA 2XMTA 1KQGB 4JI7J 2CZ9A 5KFAA 4P52A 5LOQA 4ERDA 2VOPA 3US5A 1VQOS 4RPFA 4IR1A 2YWKA 2Q66A 2D9OA 2JHEA 3CW2C 3MEGA 1T9TA 1S57A 3KLIB 5KFIA 2CJBA 1DQAA 4A47A 1RT5A 1LXJA 1O0PA 3FQLA 5KFXA 3QBCA 3RBXA 5CYQA 1WHVA 2FJAB 3LGNA 4ETXA 4WKRA 4EZ9A 2A6MA 3HJVA 4OLOA 1N33F 1JK9B 1K0TA 2NXNA 2M70A 4OYAA 4X4UA 5JMNA 4IH6A 2EKNA 4Y65A 1VBXA 1SPBP 1P1LA 5IWAJ 1GXTA 1JLFB 4PEOA 3LGMA 2CJAA 2DRAA 5IWAF 2JVRA 2XGPA 1QTNB 1NEEA 2PO4A 5EHHA 2BUNA 2BOAA 3JYTB 1XEZA 1BE4A 2GMHA 3SFGA 3OL7A 1UMJA 3DKDA 4DX8H 3LAKA 3M8ZA 1F5CA 1X4FA 2E66A 1VC6A 2NS1B 5HSPA 4AFFA 2DCLA 3CXCR 4OJ1A 1QUVA 3B4DA 4ATNA 2W25A 3T19A 1SC6A 3HX9A 2V8GA 4BHQA 1B0TA 3KMQA 4X64J 3QFWA 3B4MA 1KDNA 4X64F 1KLMB 2ERRA 3AOAA 2MKCA 3CJKB 4LRFA 4P73A 5JVGQ 2WCXA 2J0QD 1HR0J 2M8DB 5HBMA 3HDSA 1JX4A 4LF4F 3TUIC 4C7QA 3TUPA 5MLCV 2VV5A 3DGPA 4NLPA 4MTPA 1S48A 4A48A 2B4VA 4X62J 2CWXA 4JI6F 2F8EX 2ZBIA 2Z30B 3LH2S 4WXWA 2BRLA 2DKOB 1YJ7A 3QZ7A 4CDIA 2JEJA 3RB0A 2GV1A 1T94A 3L9ZA 1DLOB 4JV1A 2KXHA 1PC5A 3I6PA 2VL1A 2FVPA 2GW8A 4X4SA 2DYAA 1JLCA 1PAUB 4U67Q 4V19X 3GE9A 2ZFHA 2IJNA 2HQDA 3TR5A 4H4OB 2A6OA 3J80Y 1D9DA 2YNFB 4U95A 2KT2A 3HHEA 2ASLA 1VQLS 3IP0A 4R5PA 1KP6A 2E1PA 3HO1A 2DEIA 1ACMB 1IBKF 1FRHA 5HI7A 3AODA 4L3NA 2BOPA 1VQSA 1FCAA 4PRFA 4ZVRB 2KFNA 3P8BB 4CLWA 4LUBA 3R2DJ 1RTDB 3D6TB 2Z4PA 2BKPA 2MZTA 1UVLA 1P9QC 3IG1B 2L9WA 4YR0A 1MU2B 1HPZA 2DGOA 2ZM6J 1WI8A 2AIRB 4NLYA 4KIAA 1A7GE 4DR3F 2W9CA 2V0NA 4CYUA 3VQTA 4O3QA 3KKFA 2L9NA 3DRSB 2W01A 1LWFB 4RUBA 1WF1A 3JAMY 3EMTA 3W62A 4WFNQ 2R7QA 1L3KA 4FPRA 3MURP 4WP8A 3OTCA 2HWTA 3MPYA 2LEAA 1ICEB 3UCZP 3ELHA 2V50A 4ED6A 4A46A 3TA2A 2LECA 4PPZA 3CCMS 2ASJA 1FWLA 4RW7A 2HRYA 1NPRA 2DGTA 3OFEA 3VGVA 2RRAA 4ED2A 5L9XA 4EI2A 2OGUA 4RBVA 2XWXA 1MSWD 3NGKA 5J1EA 1WC1A 1P1TA 2XMJA 2QTWA 3KK2B 2MY7A 1FKPA 1VBYA 1U6ZA 1FD8A 5FLXY 4LF6F 5BYSA 4R0EA 2E1CA 4LJMA 4RWXA 2CDRB 5ETLA 2CFXA 1R8HA 5A0YA 3F73A 2QRRA 1R89A 2DVIA 3KDOA 3W61A 2ACYA 2E7WA 1JB0C 4ES1A 4RR5A 4FYVB 1CJTB 3KYLA 1NK0A 4OL8A 4WYLA 3CCSS 1QJHA 3L7PA 1Y0HA 2G0IA 3NS5A 5F8MA 1C1BA 4JI2F 1VRUB 1OWXA 5DGAA 5I3UA 3BSOA 1QSLA 4FP9A 4U7UD 3W2WB 1WF0A 1EIYB 5HO4A 2YWFA 4LF7J 3O8WA 1LW2A 2ZHAA 4ECXA 5G4DA 1I5OB 2OMOA 2E7VA 3N28A 4F02A 1HYSA 4KKOB 1EKRA 1MMNA 4K4YA 1BWVA 4AL7A 3BN4A 4OV1A 4WJBA 2VFTA 4PZVA 3BJYA 3FQKA 3BQ0A 2DHHA 1JJ2R 3BH7B 3OD2A 4ED3A 4C0BA 5E3RA 2B9WA 5KG1A 3UE2A 2RF2A 1C0TA 3N6MA 2H54B 2XY5A 3W64A 5CD4A 3FEZA 2I5JA 4P74A 3GJRB 3GFYA 2ZJPQ 4DUYF 4NXNF 4OJHA 3H5YA 4DN9A 2VASA 3M4XA 4MKYA 2KZMA 2W24A 1KVIA 1FKOA 1NHVA 1RJJA 3LW5C 3HFZB 5AE2A 2NSBA 4CO0A 2BM0A 2KN4A 2FGOA 4GO5X 3FRZA 5ETQA 1UP1A 2KKHA 1X9MA 2FD2A 8AT1B 2ADCA 1LWEB 2OPRB 3GFXA 1J2VA 2RD5C 3PR5B 4DV7F 3VAHA 3BQ1A 1S9EB 3T1YF 4B3OA 1MROA 3UCGA 3UW1A 2DD8S 4IFVA 3B82A 1AA1B 2F8HA 5HATA 4IKAA 1LW0B 1JJHA 2ZJRQ 3QGHA 4RUCA 3KUGA 2KJWA 1CJKB 1JXEA 3BKFA 5IC6B 2K3IA 4ED1A 3QRPA 3KUEA 2B5JB 4PG7A 4OI0A 2CPYA 5KG2A 2CNLB 3M9OB 2MQMA 1OSCA 3H4DA 1A9NB 2PSZA 4DLGA 3DN9A 1HNWJ 3R7BB 4G65A 2XO6A 2HVHA 3R1LA 3A3OB 4C8YA 1TU0B 5AJ3F 2DNRA 2F4VJ 5KFKA 1N34J 3I96A 2VFVA 2J7KA 2HQFA 3J80U 1B0PA 1VOMA 4ZVOB 3T9ZA 4QW8A 4L6V3 2FUG9 5KFVA 4P2MA 4DL5A 3MFIA 3FMWA 1ZPVA 1RTIA 2KRBA 1FTCA 2ZHOA 2PC6A 1VQKS 4WFZA 2G13A 1TL7A 3SCLE 1NH8A 2P6SA 3GP9A 3KOAA 4FPIA 1B7FA 4U7CA 1SQGA 3R6GB 4USWA 5IC4B 2WB4A 5EX0A 2JC0A 4M5NA 3VAKA 1H72C 4YY3J 3HFVA 3BO4A 4ZLJA 3ZZYA 4UOFA 4A8OA 1V9OA 4L76A 5C2GA 2IFXA 1OYEA 3MM7A 2XCAA 3V4IB 2GIQA 1Q7YT 2VH7A 4QWCA 4C3MA 2BANA 4KV8A 3DI6B 1NB7A 3DGVA 2RKIA 1S4EA 4CM2A 2FJBB 4MH8A 3C15B 4EEYA 4OZNA 3V5RA 2M9KA 1JQGA 4QJVA 1X9SA 3CD6S 3KG1A 1NSPA 2Y3YA 1OMSA 4J7CA 5B0FA 3JSRA 1S12A 3O5TB 2H5JB 3JXOA 3Q0AA 2HW3A 3BDEA 1NDPA 2KT5A 2XS7A 2WONB 3T3FA 1VGYA 5BJRA 3G86A 3EZUA 3VVTA 3VGSA 4FZVA 2CPXA 4HDGA 2QLFB 1OIAA 2XY6A 3DMJB 3KK3B 4NCBA 1WD6A 2IVMA 4OX8A 1RHRB 2HFSA 3D4JA 2PGCA 3KLIA 4NLRA 1VQ7S 1HHTP 4HI2A 3UCUP 2MXYA 1F9FA 3H20A 2CKWA 2J5AA 2DNZA 4I2PB 4CLFA 5KFQA 2NPIA 2E5GA 3TAQA 2DH7A 1YJ9S 4I1TA 4LT6A 2OLWA 3IBCB 3W5XA 3CNQP 1PJ6A 2PI4A 1R6VA 4G6VB 1NDKA 2JLFA 2LEPA 2FC9A 3CD7A 4AYBD 4I6WA 3V2UC 3ONQA 3NKYA 3W9JA 3TJ9A 1JLFA 4ED7A 1LFPA 3QAEA 1V3ZA 2UXBF 2HHXA 1IM6A 5E0OA 2JEFA 3JYTA 4Z7CA 2ATLA 2YWEA 3KLFB 3PHEA 4MK9A 5H9EK 4QCLA 4DR1J 5HQMA 3TYTA 1RTHB 2C2RA 1B3TA 1JXVA 1RYRA 2CPHA 4JI8F 8RUCA 3FNNA 3M2RB 2P9GA 5EGYA 3FBBA 2UUCF 1XIQA 2ALZA 3H7HB 2IDLA 2Z2MA 1REVB 5HJYA 3OXLA 2WZ1A 1ZTWA 2B9EA 3GZ7A 4ECRA 1TUWA 3L09A 1ZAXA 1KLMA 4ED8A 2JVOA 2HNZB 1VQMS 3CJKA 4BLGA 4D3GA 2BV3A 3GJTB 3RUBL 5L8RC 2HHTA 3FRYA 2VJVA 1R8PA 1ZA1B 4NLOA 4DV2F 1NMEB 2LMIA 4F4XA 1S1WB 4DSJA 4K7QA 3DXSX 3RRGA 3ZNJ1 2NZCA 4DQSA 2CVIA 4TQSA 2JLEA 5C25B 3M32A 1NBEB 4PXBA 2E9ZA 3D68A 5E33A 3T1HJ 1ZOTA 4LIRA 1HQ2A 5GAGU 2MQ8A 5GVQA 3HHNB 4ELUA 3KHGA 1SJ1A 3HSZA 3PJWA 1S1UB 4KHMA 2YQ0A 2BM1A 2AKWB 4KO0B 1DLOA 4KE5A 3ZC4A 4X84A 3R8YA 3I5CA 1KD1T 1RHMB 1PBAA 3KLHB 3DLKB 2O1PA 1ZM3A 3OJUA 4TYBA 4H4OA 3D28A 2ZH7A 1F9HA 2YNFA 2R9LA 4DCOB 2E44A 4ECQA 4Q8EA 2MLZA 2RHSB 3RW6A 4E0DA 2MSTA 1S5ZA 1Y11A 4WFAQ 4K4VA 2ZH1A 4CIOA 2LKZA 3HSGA 3P49B 3RAXA 2N82B 2MB0B 3U1NA 3JQKA 2XS5A 1D8YA 1VYAA 2DNNA 1SXLA 1FTRA 1ZH5A 3TUJC 1YG0A 4P9SA 4DV3F 2A10A 5IM0B 1KOOA 3IG1A 4JYAJ 3ILOA 1MU2A 2BJ9A 1J5EJ 4ECTA 3QJLA 4TU8A 3PXGa 2QLJB 4OJGA 1M5VC 2FHJA 4U96A 4DF8A 1KTQA 1LK5A 4XIUA 5J2QB 4QIEA 1LWFA 1NCLA 1ZTTA 2CA9A 5M2UA 5D8HB 2EFQA 3ZZPA 1RI7A 4NEZA 4I6YA 4F7VA 3QT5A 1NJXA 2MHEA 3D7SB 3S1TA 4KGMA 4OZ2A 4NASA 2PFDA 4HLBA 4OHVA 1EB0A 1HI1A 1FDAA 1DQ8A 4QPTA 1NH7A 2JNJA 3HD2A 4ENOA 1F1BB 2CPDA 3O2IA 5F8NA 1C2PA 3LWMA 3T5HA 2YNHB 3EM1A 5CXTA 5DLGA 1XBWA 3LAMA 3ZTRA 3KK2A 2UVRA 4DV5J 3K5PA 1S7IA 1WOSA 3O1LA 1QVFR 3BSAA 2ROGA 4DS5A 3ZZRA 2WW4A 2ZOMA 4ID5B 2V4QA 3UDEA 2BZ2A 2VBZA 1TQLA 2QA1A 1EAYC 5JJBA 3TRGA 1YGYA 4FS1A 2IM3A 1RWKB 4DHVA 3DM2B 4H4KC 2I2YA 5ETRA 3SV4A 4K4SA 1IUJA 1CJTA 1T11A 1M1HA 2V5HG 4F4AA 4P75A 3K5OA 2PMZD 3T5JA 5F8LA 1SB6A 2VDIA 5IT4A 1DZ5A 1BHNA 1WF2A 1AFIA 1VRUA 2DTJA 5DJBA 2RRBA 3NAHA 5DM7Q 1NKCA 2R7WA 1N0VC 1IKVB 2QA4S 3W2WA 2UUAJ 1CPZA 3C46A 4F50A 2G1HA 1U26A 4CH7A 1NB2A 1WELA 4KKOA 4LF9J 1RHJB 4ZN1A 4FVMA 2UV8A 4LF9F 1YTYA 4CNYA 1HNVB 2Q1LA 1FFWB 1H0HB 4HT7A 1P27B 3TA0A 1U2RA 2V67A 4DR7J 2X1GA 2ABYA 3EYZA 2Y8YA 4G3IA 3TAPA 3BF4A 4DR7F 1RT7B 4WFXA 1WNEA 2QL9B 4CQ1A 2HNYA 1N32J 1BC6A 1XR5A 4YB1P 1QE1B 3CJ4A 3D1HA 1T9WA 1G3OA 3MCOA 4DL2A 2QMXA 3KJNB 1VMBA 4UY85 2NZ4A 1U0HB 1DQ9A 2ZZNA 3RZAA 4C8LA 1RWMB 2UU9F 1I1GA 4Y6IA 1SH2A 3CMAS 2EG1A 1NXIA 3HJFA 1LWEA 5HP1B
chains in the Genus database with same CATH topology
4JI0F 1TR0A 3NGDA 1LW2B 2VOOA 3NS6A 4OZJA 4DQIA 2A3JA 3RYLA 2OPRA 2ZBCA 2WSFC 1D9AA 2QYCA 4USHA 1ZPWX 3BSNA 2AX0A 2I9SA 4DDFA 1HYSB 4AXIA 4UUWA 4OX6A 1UA1A 1HBNB 4G1QA 1U2FA 3SCIE 4HVZA 2ILZA 4DBQA 1FD2A 2CQDA 1V6HA 3CDEA 3TP2A 4AUKA 1RISA 2I0XA 2AYGA 5C42A 1S1XA 3CWJA 3H8YA 4IFYB 2DO0A 1O51A 1JXLA 3RBDA 5U47A 2XWYA 2MZRA 4OQJA 2HFZA 2DIUA 2MZ1A 5DQHA 1L3UA 2W8LA 4ILLA 5F41A 2QLWA 2GC8A 1Q53A 4QWAA 4ZVEA 4EBDA 4MIBA 1LW0A 4B3MF 3HK2A 4Y28C 5CYMB 1T3NA 3CCZA 2R4FA 5L1LA 3P6YC 4F26A 1X4CA 1LFWA 3SQGB 2XNRA 1TKTB 5BYQA 1L3TA 5KFNA 4IG0B 2RF2B 1HQEB 1C0TB 1HFEL 2RSQA 3HKZD 3IRXB 3GFZA 2BQ3A 4EFAC 5A2QY 1TAUA 4ZP8A 3H5UA 5C5JA 1RWUA 2LLZA 2BRKA 1JLGA 5JXSA 3KMSA 2I5JB 4C8ZA 2B5JA 2B6AA 2OD6A 4RWWA 3IXQA 3MAQA 5B7WA 3E8OA 1LOUA 1FDDA 2AJ0A 2JJ4D 2K7KA 3I9ZA 1T3OA 4TU9A 5DLFA 2R7SA 2V4JB 2EFPA 2JZ5A 3SXLA 2OJ3A 2IC3B 3HHLC 4R0JA 3L7OA 1RKJA 4DR5F 2RS2A 2RUGA 2KRRA 4HTJA 1FERA 3CEDA 1FESA 2J7WA 4H54A 1DBDA 2FJXA 3DOKB 1IKWB 5B09A 4O0IA 3FEYB 2B9YA 2VPYB 2ZM6F 3JTOA 2FVCA 1HI8A 3NWGA 4EZ6A 1Y3JA 5EWGA 4Q44A 4M63A 2YNIA 2J0SD 2I8EA 1FKOB 1IBLF 1YJNS 2E1RA 1VK3A 3DM2A 3IWNC 3MOZA 2HQIA 2W9AA 2CQPA 1RGVA 1WEXA 5I3QA 2ZKUA 3G6XA 2DPIA 2GO9A 3MEEB 1RTJB 4RW4B 1K1SA 1RDRA 1FVQA 2Y1RI 3K8WA 3LP1A 4BWMA 1CLFA 3G96A 3BR9A 4IQMA 1H2VZ 5H1SV 3MEDB 1VLYA 3R1HA 1OS5A 1TVRB 5KFHA 3KJVB 1JKHB 3M6WA 4CTAA 4KJIA 1VQ8S 4ILMA 5GAEU 2BABA 3SZ2A 5L1KA 4NRTA 3GYXB 5EWFA 2UZAA 2AYBA 3LOUA 2EVZA 2ZE2A 4LFCF 2HWHA 4NYZA 3HVRA 2QMWA 3H98A 2ASDA 5KTQA 1N56A 4B9MA 1VQ9S 5CCLA 4PQUB 4AE5A 1U1KA 2RQ4A 2M5YA 3MEKA 5E5NA 3MR2A 1HWIA 2HFOA 2VBXA 2W7OA 2IA0A 1U45A 2CQBA 1ZZFA 2IAJB 2XO7A 4B3OB 2J9DE 3FVYA 4I2QA 1MROB 4P6QA 2UUBF 2NR0A 3O3LA 1FXRA 2FGCA 5LSOA 5E3PA 4Y2IA 3RW7A 3SCJE 1WTBA 5J2MB 3CCVS 1MMLA 4LQ3A 1W2IA 5EWEA 4KPYA 2HZCA 4IFVB 1UVNA 1IKVA 1XN9A 4ETZA 1X4BA 4FNIA 5KG4A 3MGJA 3J7Z5 2JC1A 2PI5A 3MPVA 4C8OA 2D9PA 1DRZA 4EGLA 4PXDA 4CH0S 3U1LA 4A8FA 5HROA 1JNRB 3OJSA 4YFUA 5GAHU 3IAS9 4JOUA 2BACA 1GT8A 1UJ5A 4U9RA 5KFSA 1VBZA 3BREA 2G0CA 2Q6CA 4I68A 1TL1A 1N5YA 1L5UA 4LFBF 2YWGA 3P96A 4N77A 3FSYA 2WAQD 1RK8A 4DF4A 3V4IA 2DITA 4JI4F 4XDDA 1T8EA 3CDAA 4K5RA 2M4MA 3CCLS 1X9WA 4C97A 5LSRA 2X1AA 4Y2CA 1XNQF 4DR4F 2IYGA 2LA4A 1APSA 4G1IA 1ZETA 2LCWA 3DI6A 4KRWA 1LQ9A 4ZPVR 4DUZF 2YX1A 3LO3A 2CPFA 2BJDA 3IWLA 3M2VB 4Z37A 1UWBA 3KLEB 3VAJA 2W4CA 2MKKA 1GXUA 2W7AA 2F40A 1FA0A 1YJTA 1S77D 1VIXA 4ECYA 5DETA 3OUYA 3U27A 5KT2A 3G6VA 3OR2A 4IO9Q 5KT4A 1CEZA 4ZPCA 3CT9A 3G8TA 4Q8FA 3M30B 3IO1A 3FDSA 1IQZA 3RAQA 5AXLA 2PEHA 2NSCA 3NLCA 4CO1A 5H9EJ 3TOQA 3SSQA 2POKA 2KU7A 2KJVA 3BGRA 4ECSA 2YWHA 5CD4H 3ZZZA 3M8PB 2BDPA 1TL5A 4MKAA 4DFMA 3OFHA 3MMAA 1U4BA 2JFDA 1RTIB 4PXEA 3D1OA 4FVCA 4C3KA 3MECA 2HHSA 3O6QA 4X4TA 5L1JA 3PKYA 5AE1A 5IT0A 3MD1A 4DSIA 2AJ4A 3RB3A 5THWA 4B9VA 2B4UA 3K5LA 2XY7A 1EETB 4RW6B 1T05A 2HPUA 3IR6B 3C6UA 3MAHA 3IR7B 3PIPQ 1SL1A 1NJZA 2OPSA 3IS9B 2V8DA 1Y5IB 2VFUA 2R2SA 3NBPB 2CPZA 2LU1A 2VPZB 2PFFB 2WONA 1MW7A 1N6QB 3CCQS 2EKYA 2GA7A 1UL3A 3CGIA 2CQ1A 3N0VA 4Q2LA 3BDPA 1FRKA 4WU2A 3MM8A 3PVXA 4JI5F 4A8SA 3NMAA 4WFYA 5A8RA 2D3ZA 4ZVFA 3RBEA 1T7PA 2DH9A 3HXMA 4ILRA 3I56S 1JMTA 5HLFA 3VWSA 2GGPA 2ZD1A 1N88A 4HL9A 2DB1A 3PX6A 1W2BR 1C1CA 4FF2A 2N4CA 2RDIA 3DMJA 3N6NA 1E6YA 2CQIA 2MSSA 3KK3A 5HP1A 2B4OA 5KT3A 4Q43A 5AE3A 2W4DA 3T6BA 4WF9Q 4LF7F 2MKJA 2EFOA 2FVQA 2FHJD 4F8RA 2JFKA 1Q7LB 1SI9A 1KOHA 3CJ3A 2XLJA 4KQZA 4J37A 3ULHA 3Q23A 1NHUA 2QZ8A 5LXRA 2XGQA 4HYKA 2BE2A 3MM7B 3OTEA 1PILA 1TK5A 3SMZA 4I7FA 4KFBA 2CDQA 5B0AA 3TVKA 2EW9A 2ILYA 4J9MA 4TU7A 3H25A 4GC6A 4YR3A 4V19J 2XG8A 4IFYA 3CF5Q 1ZZNA 1YIJS 4JV5F 4M5DA 2M88A 2ZH2A 4CO3A 4M1KA 1F5BA 2DPJA 2BANB 2JOQA 1DTTA 2YKQA 3BS9A 3LP2B 3O44A 4HEA9 4KV8B 3G71S 3GV7B 2RKIB 3TO8A 3CTRA 4J9LA 2FJDB 4I2PA 3TVZA 1U47A 4OLPA 1HBUA 4NLXA 1MWZA 2CG4A 4MJKA 3SDEA 1N5QA 4C4WA 2Q43A 1FJGF 4FXVA 6FDRA 4B3RF 2CQ4A 5KFYA 3KG4A 1DTQB 2DGWA 2O67A 1EP4B 1HNZF 2DGUA 2KYZA 2X1FA 2AU0A 2QSWA 3NNAA 1VRTB 3HT3A 1I6JA 2B7CB 4Q45A 2KFYA 5KG7A 1NO8A 3IRXA 2F9DA 4NLWA 4M95A 1RA6A 4PXCA 2B3TB 1FJEB 3H2UB 1U1NA 2MQPA 1VC5A 5DDPC 3PO5A 3GWCA 1UVKA 3UDCA 3PW5A 4TQRA 3MMCA 2VPXB 4TNOA 4RZRA 2VQFF 2EFVA 2L9DA 1CQNA 5GAGI 1IR0A 2VQEF 4B17A 2XMVA 4NA3A 3R5BA 4OI6A 4OZLA 1UVMA 5L39A 2R7UA 3POTB 2NUUG 3KFWX 5F8GA 1UA0A 4C3LA 3IN5A 4C98A 4DL0C 2RMLA 4YHHF 4DWIA 4DSEA 1JLEB 4USJC 1B0VA 3MTKA 5A8KA 2KH9A 2C3MA 2F1FA 1IKWA 2IMOA 3LF0A 1YJVA 2DHAA 1ZBTA 3ETOA 2IA6A 3MUVP 2KXNB 3Q2SC 4LF5F 2R7XA 5F3ZA 4OFZA 1TKXB 4LIWA 1LWCA 2DHXA 3BEGB 3D0HE 2ADBA 3AB2B 1TL4A 4OI2A 2G4BA 1WG1A 1X5PA 2XMTA 2PDAA 3HVAA 1KQGB 5KFAA 1D3WA 1RTHA 3H5XA 5G0RB 2CRLA 1BLUA 1YBAA 1VS3A 2VG6B 4MIAA 4TN2A 4ZCMA 5K8NA 2CJKA 3MEEA 3HPOA 4IDKB 1URRA 2D7SA 4ERDA 4PG8A 2VOPA 2HGNA 1YJRA 2KYXA 1MWYA 1XK8A 3M2RA