1U8WA

Crystal structure of arabidopsis thaliana nucleoside diphosphate kinase 1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase I
publication title Structural analysis of Arabidopsis thaliana nucleoside diphosphate kinase-2 for phytochrome-mediated light signaling
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 42
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1u8wA00
1NSQA 1BUXA 1NSKL 4ENOA 3G2XA 4F36A 1HHQA 2HURA 1S5ZA 3VGTA 2DXFA 3ZTSA 3Q86A 1MN7A 1NPKA 3EMTA 3B6BA 4EK2A 1HLWA 3PRVA 1XIQA 1LEOA 3NGTA 4ANCA 4F4AA 1VYAA 4FKXA 4WBFA 1EHWA 3BBCA 3JS9A 5C7PA 2BEFA 1ZS6A 4KPCA 1BE4A 3FBEA 3VGSA 1S59A 3Q8YA 3FBCA 3VGVA 1K44A 3Q83A 1NCLA 1NUEA 3EICA 3NGRA 1NDCA 3VGUA 3FBBA 1KDNA 1UCNA 2B8QA 3B54A 1NLKL 1PKUA 2DXDA 3VVTA 1F3FA 4DUTA 3FCVA 3ENAA 1MN9A 4UOGA 2ZUAA 3BH6B 3EJMA 2BX6A 2DXEA 2AZ1A 4HR2A 4C6AA 2B8PA 5IOLA 3DDIA 3FKBA 1S57A 1W7WA 4UOHA 3WX8A 2CWKA 2VU5A 3L7UA 3EE3A 3ZTQA 3BBFA 4S0MA 1LWXA 3EM1A 1NSPA 1NB2A 1BHNA 1U8WA 3NGSA 1B99A 1NDLA 4DZ6A 5CABA 1WKJA 4O0NA 1B4SA 3Q89A 3ZTOA 1NDKA 2HVDA 1WKKA 1JXVA 2AZ3A 2DYAA 3Q8UA 4DI6A 4ANDA 4UOFA 5CAAA 3NGUA 3BH7B 2HVEA 3EVMA 1NDPA 1HIYA 3ZTRA 3MPDA 3DKDA 3ELHA 4ANEA 4CP5A 3GP9A 4FKYA 3GPAA 5BXIA 1WKLA 4W98A 2DY9A 3EVOA 1NHKL 1XQIA 3FCWA 3EVWA 3VVUA 3PJ9A 3FBFA 2NCKL 3FC9A 3Q8VA 3R9LA 3ETMA 1PAEX 3BBBA 3ZTPA 1F6TA
chains in the Genus database with same CATH superfamily
4WPAA 4EU0A 2OPPA 2QA1A 4LF2A 4YDXA 4ZVEA 4DR2F 1K1SA 2Y9HA 3P4UB 1U02A 1QTNB 5K14A 5KFMA 3KK3B 4RBVA 1KOOA 2Y3YA 1T03A 3IWLA 2IVFB 2CJBA 3ET6A 5G0RA 3IO1A 1KN6A 2ZHOA 4ED7A 6FDRA 1JKHB 3BSNA 1RBOB 2UUBF 3PHEA 2UP1A 2D3UA 3LP1B 2XY7A 4WFYA 1B4SA 4OYBA 5HP1A 3DC2A 3ILLA 3A8KA 4BWMA 4GKKF 5DJBA 4N76A 4PQUA 1L3KA 4CTAA 1KBRA 5DM6Q 2MLZA 1FTCA 1EIYB 3TA0A 4ERDA 1HI0P 1RWNB 4Z7YA 3QSIA 3CUNA 1IQZA 1X5OA 3KLEA 1HMVA 3D67A 3MAAB 2FQQB 2PDAA 2HHUA 1FDBA 2R7VA 2YNGB 1UMJA 4C4WA 1S1TA 3I0RA 1R8HA 2NZ4A 1V6HA 2IA6A 5KFJA 1UVKA 4TQRA 1W26A 3ZNUA 2BMBA 1ZM4A 4LF5F 3EICA 1TR0A 4QWBA 4DSKA 2V8GA 2RDIA 4X84A 1MU2A 2N7CA 1UEKA 2E7WA 3RBZA 1FK9A 2LA6A 1RAJA 4NLSA 4F4ZA 2Z4PA 2DRAA 2GMLA 3IA0A 3PCOB 3W9HA 2XZTB 2MSSA 1VRQC 1NSPA 1H38A 1R6VA 3NS6A 1DBDA 2RF2A 1UFLA 1N0UA 2BANA 2DHSA 4DR6F 5ADZA 1MW7A 1V5IB 2OJ3A 2UU9F 1HR0F 4LF8F 7FD1A 2RU9A 3CJ2A 3R9LA 3TAQA 2G4BA 4P2XA 4TY8B 3IGNA 3UPFA 1NRKA 4YN3B 1TKXB 2XCAA 1LV5A 3GFZA 5L1JA 2BJ3A 4U67Q 4DR7J 3H7HB 1Q5YA 1A7GE 2WB4A 5A0YA 3E51A 1WSRA 3OUYB 3THPA 3LW5C 4WP3A 1N5VA 3NXZA 3UW1A 3LAKA 5L46A 4I7FB 3HDSA 5D4OA 5F8GA 1FFGB 2OD6A 1YWXA 5DG9A 3POTA 4IG0A 3G82B 1ZA1B 2JLGA 3KHHA 4RW7A 1U25A 2RHQB 1RTJB 4KHPF 2ZH5A 3UVJA 1SL1A 1VMBA 1VGYA 3QRQA 5D6GA 1VQ9S 2UVRA 4A8XA 2LXIA 1PYOB 2V5HG 4ZIWA 1Y10A 5C42A 4UOFA 2KVQE 2HMIA 1FKPA 1GXTA 1TUWA 2PMHA 3ITHB 2ACYA 2Z2LA 4FF4A 1DFDA 2HSEB 1Z2ZA 1FDDA 4DSEA 2BKPA 4IO1A 2H4WB 3VQTA 3HT3A 1HPZB 2NREA 4H4KC 3OR2B 5E3RA 1BQMA 4PXBA 1F0XA 4QWDA 4ZVPB 5HQ8A 3C3LA 2VIHA 5E41A 3M6VA 4ZCKA 3BGFA 2UVWA 4IYQA 4AXJA 2G2YA 4U7UK 2W25A 4U9RA 3SFUA 3C66A 5KFHA 3MM7A 4JI7F 1LFWA 5D3GA 1RTDA 2ZJPQ 4J9VA 2XLIA 5CQGA 1TMJA 2GS8A 4LF9J 5BR8F 2OTLS 5LMNJ 3C19A 1FKOA 3TQ1A 3MR3A 2W7AA 4N41A 3DLKB 3QIPB 1H2VZ 3KLGB 3FRYA 2HHPA 4AD6A 3OXFA 1UP1A 2WK4A 2Z58B 1WTFA 2CQCA 4ZN3A 4HKQA 2XMVA 4MKAA 5HBMB 4LBPA 1HNZF 5BJRA 2KRBA 2KFYA 1S1WB 4NZ6A 3Q8VA 1PAEX 3O2IA 3PX0A 2XZDB 2OSRA 2VFRA 2H1YA 1P9QC 2IPOB 4ZLLA 2P9EA 1GQEA 3QYYA 1HLWA 4ELVA 3NGTA 1BWEA 2RKIB 1BC6A 1TL5A 4ZOSA 5EX3A 3M2UB 1TZ0A 4ZS6A 4JP8A 3RTVA 5LJ3Y 4WTOB 2NS1B 4ECVA 1CLFA 4NYPA 3DRYA 3AHPA 1WHVA 5IC6B 1URRA 1WUUA 3C6UA 4DWIA 3UR3C 5F9LA 3L09A 3KHLA 2GVDA 2ALZA 3HVTA 3PRDA 3UD3P 3M6UA 4DLEA 4DR3J 3NEKA 2FHOB 2W2OP 4CT9A 1RKJA 2A2DA 2ZOGA 6AT1B 1VBYA 1G1XA 1WC4A 2HQGA 3BO4A 4X64J 1SQGA 1KLMA 3HKWA 1U6BA 3A8EA 1NK8A 1T05A 3C6TB 2EFVA 2WSCC 2MQQA 3UD4P 4G1QB 2RUSA 4DR4J 2CPXA 2QMUB 2EC0A 2IC3B 3PNIA 3IN5A 2OLWA 1MWZA 3CJRA 3CCTA 2JNJA 2JVRA 4P72A 4KGVB 3T9ZA 1WOOA 2Z2MA 4QR2A 1KOHA 2VPXB 1R3NA 4V1Ak 3PYGA 2RB7A 3V6JA 3DRSA 1X4BA 2MQOA 1VQYA 3QSYB 2HFUA 4JI2J 2YWWA 3BQ0A 2ZJQQ 3P5TL 2X1BA 4WFBQ 4NL5A 4PQAA 1WG5A 3M8RA 5HLFB 3PYEA 2JEFA 2PA8D 3M8ZA 4AL6A 3T5KA 3BQ1A 4ZCLA 3Q8UA 1IKWA 3FUYA 3FK4A 2DGOA 4RU9A 2XWXA 1P27B 3CO0P 3N5FA 3KJFB 4I6AA 1N36J 3JSMA 2DNHA 2EFNA 4B3OA 3LP0A 3AAWB 2IRYA 1FI4A 3MMCB 4K5RA 1SL2A 4P2MA 5F8HA 4NI2A 1HNXJ 2WVFA 3JSYA 2OGUA 5ETMA 4LRBA 3JTNA 5J2PB 3UCZP 3W64A 3MWBA 3VAFA 2HLUA 1JLQA 2P9GA 1BLUA 1P1LA 4OYOA 4H4OA 3CCRS 1F2HA 4LSNA 3R97A 4ECXA 3MPYA 1CULB 2ZH2A 3PYFA 3V6HA 1RWUA 2OEJA 4FS1A 1JIHA 1UZHA 2EFGA 1F3FA 1WELA 3EPIA 3QATA 2ZH6A 2O67A 2DGUA 2LDIA 2PSZA 4AYBD 3SQOP 3BO3A 2HWIA 2UXBJ 3NY0A 1TL4A 1N88A 3R5GA 2ZDPA 1QAXA 3DOKA 5F0WA 1J5OB 2JVOA 2VD3A 1F9EB 3LQVA 4OZ0A 1B99A 5GAEU 3Q2TC 3MURP 3N4WA 1S72S 2KDOA 1VQ5S 1U4BA 1JX4A 4B3MF 2B4OA 4DF8A 3CJTA 2DEIA 3B4DA 4L72B 1TL7B 1ULRA 4LMZA 2ZM6F 2HW3A 4B02A 1SKWA 3US5A 1NSKL 4NWBA 4TNOA 4QPTA 4AQYJ 1EETB 4P9SA 1DAXA 4JBCA 2HBRB 4DS4A 4RNOA 4DV5F 2DVIA 5F3ZA 1FRMA 3GFXA 2AQ4A 3UWTA 1Q79A 2NSCA 4ZJOA 1J2VA 3IR6B 2JZ5A 3KLIB 2IJRA 2WVDA 5IC4B 3M9MB 1S4FA 2LEPA 2E7VA 2J76E 2F8HA 2W4PA 2RJZA 4P52A 5FDLB 3PRBA 2V8PA 1JJ4A 1N32F 4GMKA 5DM7Q 1QSYA 1PGZA 2CRLA 2CZ4A 2HVDA 2XS5A 1HARA 2JX2A 3EZ5A 2BM1A 4WTYA 1UPPA 1FJ7A 4OQJA 4DOZA 3I0SB 1WJ9A 3CD5A 3LWMA 2AMCB 2J0WA 1CQNA 4I67A 4U7CA 3EVWA 1AT1B 3MAHA 3GTYX 3I5CA 3O44A 1OIAA 3K5LA 5EUHA 1CBKA 4C98A 3V2UC 2VF3A 4CRJA 2R7UA 4EK2A 3C16A 3R7NB 1S6QA 4F04B 2UUAF 1CJTA 1Q81T 5ETRA 3BYRA 5IT9U 3AQPA 2P6SA 1V5VA 5JVHQ 4CH0S 2PD1A 4L74A 2IIHA 5KFXA 2QC3A 2DGSA 4J9RA 4O3RA 3OHBA 4DV3J 2EVZA 3KK2A 2IAJB 2EC2A 1SIZA 3O8WA 2G1DA 2G0IA 2WSEC 4LFCJ 1M5HA 2E1PA 2R42A 2YNFB 2XHWA 4CLSA 2D69A 4KH0B 3DLJA 1GH8A 2A6MA 3TP2A 3WQPA 2X1AA 1SVDA 2HHSA 4W92B 1VHFA 5KT3A 4L3NA 3ETMA 2W9CB 2A2CA 1AW0A 2AU0A 3OL6A 3KKFA 3FSYA 1NK9A 2M52A 3MR7A 2CNKB 3CF5Q 4U8YA 4L3KA 1K9MT 2GQ2A 5KFUA 3OHAA 2V6AA 4WK3A 4LFBF 2XWYA 3E8OA 2P8IA 2DNPA 2VONA 2NLWA 1I3OB 3QGIA 3L3CA 1QD1A 1QJHA 4KE5A 3H40A 1VK3A 3FSIA 2XMTA 3OFGA 1U1KA 4YY3J 1Z2LA 3V81A 1BWVA 1NB2A 2E5LF 2VKRA 2BJ7A 3W8PA 4OHVA 3V6DA 4HT5A 1QSLA 1QE1B 2CZ9A 5IWAF 1SJ3P 1F5BA 4EZ6A 1JQGA 3TZWA 3EPGA 1T9YA 2AJ0A 5HATA 2VQEJ 2PI5A 4A47A 5ETLA 1X5PA 4DSJA 2DXFA 1GMWD 2CJYB 2LVWA 1FRLA 1XMOF 4IR1A 4OMFG 2HGNA 1X31C 2EXUA 3KK3A 1RP5A 4I56A 1S77D 3BO2A 1JWWA 1NLKL 5M2RA 1MWYA 4UY85 2DH8A 4CYUB 2GJIA 4DUYJ 4C6AA 1GEHA 3A3OB 4K5SA 1FT8A 2OI2A 5E0OA 2V63A 1JKHA 2HFSA 3IBCB 3LP1A 2YNIB 2DB1A 2PE8A 3IM9A 2KT5A 2E66A 1C2PA 4O0NA 2VB6A 4BBYA 1HYSB 4C0OC 4UZBA 2YX1A 2Q66A 4I1TA 2WONB 3NBPB 2XTJP 4Y34A 1GXLA 4K4VA 3CMQA 3AODA 4WK1A 4JI3J 3ILIA 1VC6A 4DUZJ 4DPOA 1DQ9A 4AXIA 2K2PA 1TKTB 1QUVA 3CMAS 2DHAA 4AL7A 1KRPA 3I9ZA 3MAAA 1SKUB 5KFWA 3GCXP 2R7QA 4GRSA 2ZH8A 2YNGA 1LWCB 3D3CJ 1XBWA 2V8VA 2YKOA 3PJWA 4KGZB 1AUDA 3B6BA 4BS2A 3DCAA 3IGVA 1MG7A 3Q24A 4NLDA 5HO4A 1C0TB 1NPRA 2KYXA 1PCAA 2MQLA 2HQ3A 4IG3B 1WEXA 2JRSA 3GV7B 2QN6B 3NP5A 5T7LA 5F8IA 2ZH3A 5GAGI 1G4CA 1GFWB 2CJ9A 1Q8KA 4Y2MA 1Q4RA 2DITA 3P8BB 1ROFA 3KNAA 4CLTA 4IOAQ 4RX6A 3N9UC 2ILYA 1NEEA 4QJVA 5KFIA 2GC8A 3QGPA 2DNRA 3AOBA 4DZ6A 4X4QA 2C3OA 3RRKA 2AKWB 1U6FA 2RS2A 2IY5B 1L5UA 2CQDA 2FJBB 3HD2A 2ILZA 4DV7J 4K4WA 1R0AB 4MAKA 4ES3A 1TVRB 4OHXA 4O3QA 4NA2A 2VOPA 2D7SA 4TY8A 2HHHJ 2W7OA 1TKXA 3WC0A 5AT1B 1HBOB 3G2XA 2W9AA 4K8RA 3DFEA 2CJXB 3N6MA 3M2RB 1Z1ZA 2BM0A 3I96A 1MSWD 3H90A 3OUYA 4F4AA 2OEKA 1ZTWA 1N34J 2EK1A 5M2UA 4I7FA 3D1OA 1IKVB 4X65J 1NCLA 1YK9A 2KB2A 3T1YJ 2QYCA 3G82A 1EZZB 4OJ3A 2DRDA 2LA4A 3PM9A 1OS5A 2RVJA 4YP3A 3K2YA 4J9NA 1RTJA 3P6YC 1ZAWA 3W8GA 1NMEB 4JB8B 2G13A 4O4RA 1M1HA 1YJ9S 4ICLB 3GZ7A 4ECSA 3CD0A 2U1AA 1I94J 4DR7F 1B64A 3EM1A 4W90B 1GAOA 2ADCA 3PDNA 2DHHA 3V4IB 4ZVGA 3P5BP 5IT0A 5GADU 3RW6A 3ITHA 5BXIA 4IDKB 1Y5NB 4KFBB 5GAHU 3SZ2A 4I68A 3S01A 3KUEA 5K5MA 1HPZA 3HULA 3MECB 2R8IA 3LPYA 5H9FK 3OR2A 1H0HB 1WF1A 1NK5A 4I69A 4ILMA 1XMBA 5J1PA 4NEYA 4K4XA 3P45B 3PX4A 1P9YA 1OSCA 5A76A 2Y1RI 2GIFA 5T41A 4J9OA 2MPUA 1SC4B 2CPEA 2RDDA 3JQJA 4DL4A 3HZGA 1RT4A 4QOTA 1KVJA 5DLFA 4QIEA 2FD2A 2V50A 3F73A 1MMDA 3H4DA 4B3RJ 4B9UA 3LGNA 4FXDA 4GC6A 3EXCX 3DLKA 3QIPA 3KLGA 4JV5J 1T11A 4LBIA 1M90T 4P71A 5DS7A 1U09A 1KS2A 1LOUA 2B6AB 1A0OB 5HBMA 1PJ5A 4CLZA 1S1WA 3VHQA 2O5DA 2EI5A 3D68A 4MFBB 1RI7A 1ZETA 2XI2A 3CTRA 4DV6J 4IOBA 4ECQA 1FRJA 2CQHA 3HKZD 4LF9F 1RLCL 2DNLA 3GCWP 2QYGA 5LMNF 2JJ4D 1RABB 4OYMA 2XMJA 3AOCA 4UZCA 1UZDA 1GTHA 2RKIA 2WTFA 1OY9A 3IRXB 3M2UA 3OT9A 1SC3B 2CYYA 2WOMB 1UFWA 3I87A 1FX2A 2F9DA 1RHKB 2BA9A 4NLXA 2CQGA 2QT7A 3CJSA 4FYXB 2OPQB 5KFRA 2GIRA 3H5UA 2E1CA 1LWFB 1FWLA 3L7UA 4DQPA 4JI6J 5EHHA 3PFEA 4OHYA 2B4UA 1RZMA 1XR6A 2YNHB 4DSFA 3CULA 1WOPA 2HLTA 1JB0C 2NCKL 3BPDA 1IM6A 5KFTA 4ZLJA 2FPHX 2GA7A 3C6TA 3AXMA 3BF4A 4G1QA 1QTMA 1GTEA 1ZPWX 1Q8BA 1R8PA 2XNQA 2IC3A 5F41A 3IM8A 3M7VA 3RZAA 1X4EA 4YUDA 2AT1B 4A8WA 4TU9A 3MAQA 4F8RA 2HKEA 5KT6A 4DR3F 3L9ZA 4FN5A 1HQEB 4NA3A 4K4ZA 2JC1A 4X64F 5LM7E 2YWEA 3Q8PB 2CQ0A 4X4RA 2R8HA 2AW0A 1X4CA 1WI8A 4NE9C 3I55S 5CYJA 3DRRB 4DR4F 5B0EA 1TFYA 3RB6A 4DFPA 1RAGB 1JLEB 4DI6A 2BE2B 2HZCA 4CH1A 2M2BA 2BQRA 1WACA 5KG6A 4CO3A 3MMCA 4K2JA 4YB7A 3L7OA 1QAJA 2J7UA 2V8DA 3M1VB 4M5IA 4JI2F 5KG3A 5DETA 5J2PA 4AFFA 2C22A 3AB2B 3ISZA 1Y3KA 4FBUA 4PG5A 1SCJB 4HTIA 3G86A 1CULA 3VAKA 3PW7A 3QPIA 3CJ8A 3QAUA 3Q83A 2VG7B 1KWMA 2HVIA 2COLA 2B51A 5LL6d 1XJWB 3SMZA 1YTYA 3ENVA 4FVMA 1H6KX 2ZUAA 3DM2B 2QA4S 1LK5A 2B8PA 1B7FA 1FNOA 1KQSR 3DDIA 3NKYA 4K0KF 2YVSA 4QCLA 4NXMJ 1HNXF 2D3OR 4C0HA 2R2SA 1J5OA 4HLBA 2ZEJA 1B7YB 2MLYA 5D15A 4R8UB 2G0JA 3R7BB 1YKWA 4Y0FA 2LU1A 4A8OA 1N5TA 3BH7B 4JV0A 4DDFA 2W01A 4ZN1A 3HM9A 1TL7A 4PWDB 4FKYA 4C8MA 2H9ZA 5RUBA 2F4VJ 1SBRA 3PXGa 1FKAF 2J0XA 4FNHA 3S6EA 4WIIA 3QT8A 3MZIA 2BJ1A 1EETA 3M9OB 2UXBF 2UUWA 3HJVA 4RWWA 4J90A 4F0KA 2ASLA 3H59A 3H5XA 3MUMP 2QMWA 1B0VA 4LQ3A 3QZ8A 1D1UA 1JLCB 2M8HA 2CPJA 1JXLA 3R1HA 1H7XA 2HIYA 4KR0B 3NNHA 3KLIA 2H5EA 1NU4A 5I3UB 1FDNA 2HRTA 3AD8C 4C9DA 5DG7A 4ZP8A 4QW9A 1RHJB 1A6LA 4RKUC 5FDLA 4NZ7A 1RT5B 1YRTA 3MR5A 3MMJA 4AQYF 4BC9A 3GE9A 4OJGA 3MOZA 3K59A 1X0PA 4DX6A 2DR8A 1HQ2A 1VBXA 3MHYA 2RS8A 1K47A 2H4YB 4PABA 3G8TA 3GJTB 1F5AA 3I0SA 2Y1IA 1S6OA 2IDLA 3I82A 5E3AA 1HW9A 1ZM2A 3RRGA 1RU2A 3D7SB 5HAOA 5IV4A 3AJDA 4DPTA 2J8SA 2V4RA 2HS3A 3NOCA 4IUFA 4OZJA 2J6SA 1C4CA 4MIBA 2J0SD 1IVZA 3H2VE 2B0GA 2KRRA 4F26A 3BGLA 2GCFA 4CQ1A 2DEJA 3HHKA 2CNLB 4ILLA 2CDRB 5KFVA 3FBEA 3DXSX 5CH7B 4J9QA 2CJAA 2FJDB 2ZVSA 2D3ZA 1H3DA 4DUTA 2O01C 2IAJA 2LKZA 2ZC4A 1JLBB 1SJ1A 2OEMA 2W24A 3AT1B 2YPZA 1UVNA 4K59A 2YNFA 2QA2A 2MY7A 4DV2J 2LEAA 4I64A 2E5IA 3CEDA 4P73A 1P1TA 2XSFA 3R5BA 1OSDA 2GQQA 3PFOA 1TP7A 1RSCA 1LW2B 1Q16B 2HHVA 1HNWJ 2OUGA 2F9JA 3WBZA 1ACMB 2KJVA 2XGQA 4NMLA 2W9CA 1FJGF 3RB3A 4HH1A 1S12A 1V9OA 4DV3F 1K8AT 3G87A 3N0VA 3MEEB 1IM4A 3J7YI 4DU7A 4LFCF 1HNIB 1FJCA 3KK1B 3BBCA 2J0QD 4KPYA 3RB0A 2BABA 3UCUP 4YB1P 5B0AA 2O1PA 3K5MA 2GMHA 2DGTA 1CSJA 2PEBA 4KV8B 3QJLA 2XY5A 1KONA 5FLXY 4ED2A 3BBFA 1W25A 2ACMA 3MTJA 1HWJA 1EKSA 1QE1A 4MK8A 4JUZA 3CB4A 1XR5A 1O5JA 2HK3A 2HYIB 5GVQA 4ANDA 3GU0A 2Q43A 2F40A 3G8QA 1RWXB 4O44B 2RRNA 5K8PA 2GW8A 1GMUA 4HI1A 3KJVA 4RJVA 4PAAA 3EDRB 1UTAA 4ZP9A 1WC0A 2FYXA 2EKYA 2N3OA 4YY3F 5B0BA 1VQLS 3KLHB 4F2SA 4X4PA 4OX8A 3D2WA 3G96A 3GIRA 2VHGA 5U47A 2E5JA 3ZFVA 3KMSA 4CO0A 2KKHA 4DXLA 2XC9A 2APOA 1FEHA 4USVA 1BGXT 1UW4A 1ZS6A 2HFVA 4LFAF 5A8WB 2DNGA 2F1FA 4X66J 2JL9A 4DL3A 3T5HA 1UJ6A 2ZUGA 4CYUA 2PIIA 1GMWA 5LT5A 3HVRA 5CCLA 2VQEF 4UT4A 3KG0A 2CWKA 4ED8A 2P5VA 4DFKA 1RAIB 2YNIA 1WC3A 3CJ4A 4USKA 1U2RA 4W4MA 1HYSA 4NLUA 3CCES 4NLWA 2WONA 4DV0J 3NBPA 3G6YA 4ANEA 5B7WA 2ZBIA 5EX0A 5ETOA 3PVXA 1XQIA 2CJKA 1TKTA 2FIUA 3TVYA 4DUYF 1JXEA 4RLEA 3DLLQ 1LWCA 3TR5A 3IG1B 5CD4H 1C0TA 5ITHA 2BZ2A 3I31A 3J81Y 5DZ7A 5LMUJ 2OO4A 4IG3A 3J7Z5 3G6VA 9RUBA 2GO8A 1IR0A 2AIRB 3FDSA 2FLLA 2JC0A 1GT8A 1E6VB 4DUZF 2P9CA 1KEKA 2XG8A 1FNMA 3Q2SC 1NKBA 4KKOB 3H5YA 5A6PA 3W9IA 3J7ZT 4RNMA 1U6ZA 1FWPA 4MK9A 4OJHA 1R0AA 1Q7YT 1S48A 1TVRA 4DN9A 2I38A 3CE8A 2L9WA 3R2CJ 2XQCA 2WB1D 3DLEB 4KAIA 1VBKA 4CI0B 5D0GA 1HBOA 2W2MP 4GO5X 1U1OA 3M6XA 4RL1A 1D8ZA 3TQEA 1FRHA 4DL6A 7AT1B 2OIHA 2QL5B 1VYAA 4DL7A 5BYRA 5AJ3J 3KHGA 2XS2A 1ZBTA 3HI9A 1YI2S 2BEFA 1IKVA 4ZA1A 2K7KA 3IMQJ 4DV7F 2R7TA 1C4AA 2U2FA 2C2KB 2W1BA 2ZOFA 5DZ6A 1YHQS 3R5AA 4HR2A 4C3MA 2I1RA 1KVKA 4F4YA 1HBMB 1T95A 3OTDA 4ICLA 5KT5A 4IH7A 4PZVA 3GYNA 4WE1B 2AJFE 4C11B 3OBIA 4N77A 4A8SA 2VDIA 3V4IA 2EEYA 3KDNA 2AZ3A 1IUJA 4FZVA 4IDKA 1N34F 4ID8A 4KFBA 1X5SA 4X65F 3MECA 2B4VA 4PRFA 3T1YF 5DLGA 3CJQA 5E5NA 4ZKAA 1OQ3A 3CCUS 3VV2B 3UN3A 1WORA 1JK9B 4EYIB 4RPFA 5ETKA 1I94F 2A3JA 5L38A 1XEZA 3OW2R 2CUYA 1DLOB 5HJXA 2R4FA 1JMTA 3L4BC 1VR6A 1IBKJ 4YR3A 5J1EB 2BRKA 1U1NA 2NR0A 2LU2A 5JUMA 3ADAC 3TEHB 2VJVA 2XYGB 2AD9A 1UJ5A 4TU8A 1NM2A 5DQHA 4A46A 4NLTA 2HVZA 1N33J 1HI1A 5B09A 2VC1A 2F63A 3H42A 2IM3A 3BGUA 1OY6A 2B6AA 1RYRA 1HQUB 1I1GA 4KRWA 4MFBA 4H54A 3IRWP 3QGHA 4ZCMA 4LF6J 1IBCB 3TX0A 4G6VB 1F3VA 2VFUA 1XN9A 4G65A 1X9MA 3R8YA 3V6KA 3R27A 5DG8A 1Q78A 2GO9A 2BBEA 4B3RF 2AYBA 3W7BA 1I51B 3IS9B 4JV5F 4ANCA 3IRXA 1XWLA 1IBLJ 4YR0A 2MZQA 5IS2A 3BJYA 3QRPA 3S7RA 2WOMA 3OFHA 4X62J 3MM9A 2OPQA 4OHWA 3HX9A 3NCPA 1YITS 4Y2AA 4TXSA 3LH2S 1OPIA 5H9EJ 4DN0A 4DV6F 3MFHA 1LWFA 4OL8A 4C8ZA 1MMLA 3W66A 4RNHA 5DQGA 1YQHA 3TANA 4H4KA 5ETNA 5FJ4A 2RILA 5ETSA 1OJ4A 4F4KA 1LXNA 2FZGB 2X51A 1U24A 1FVSA 2YNHA 2V9WA 4GO7X 2IYIA 1O6XA 2MLXA 1IWAA 2PC6A 3SFGA 4B9TA 2YH1A 1YG0A 3IC1A 4LF4J 4ED1A 4B9VA 1AZSB 1T8EA 4NYZA 3JXOA 1BXNA 2XYHB 3Q8RB 2R2TA 3H5SA 4WFXA 3MD3A 2ZDOA 4JI6F 4NCGB 5A2QY 3PW5A 5KT7A 2G2OA 2ASJA 1KSPA 1XR7A 1HQEA 2EG2A 3MMAA 4YQWA 3KJNB 1LQ9A 2LMIA 4K4UA 5L1KA 1YRUA 3LP2B 4R0JA 3FEYB 4RWXA 2LLZA 5B0FA 5JJBA 2CQIA 4DG1B 1LW0B 2F4FA 1H2UX 2KL8A 3DRRA 4YS2A 2O3DA 2XO6A 4PXEA 4A8MP 5D0EA 3MM6B 5AXLA 1Q5VA 5E3PA 1JLEA 2EPIA 4R5PB 2BE2A 5HQLA 3EGVA 2KXHA 4X4SA 3MPDA 2KZZA 2FLNA 3DLBA 2ASYA 4UTGA 2QTWA 3FEZA 4E98A 3CCSS 3FQKA 3MR2A 1TK5A 3SI8A 4LREA 3M1VA 4PR6A 1VBZA 3CSKA 1REVB 3VZHA 4XK8C 4Q43A 2D74B 1UJ4A 2QL7B 1TAQA 1GX6A 5F9NA 1T9UA 3JS9A 2R7RA 2VG7A 1FEEA 3IWNC 4DX5A 4KGXB 5K9FA 1CJUB 1N56A 3HVAA 3LPEA 3DM2A 3GSDA 5KFFA 5JMNA 3BKFA 3A1YG 2DPJA 2XZWA 3NMRA 1WC5A 1WHWA 4NEZA 4U8VA 3GR1A 3QWPA 3M2VB 4P2SA 2CFXA 2CQ1A 5HI7A 2V67A 3DLGB 4DL0C 3AY0A 1KD1T 3QAEA 1BHNA 4YR2A 4R8UA 5GAEI 4XO0A 3DN9A 4CM2A 3ZTOA 4RO0A 4JI0J 4P7TA 4PWDA 1TUVA 3VAJA 5A8RB 3TRGA 1TK8A 4HHHA 5KOXA 1U48A 2MQNA 2R9LA 1CPZA 4QIWD 2OTJS 4NXMF 2IRUA 1MROA 2BQUA 1S49A 2BE9B 2VPYB 4PXCA 4QYRA 1ITPA 1JLCA 3MPUB 2DNYA 5L8RC 4F0MA 4DFMA 1SUQA 4A8QA 3KLFB 4ZVUB 2JOQA 1FHTA 2R3VA 4B08A 1NUEA 5I3UA 4MKVA 3OLAA 2F4VF 2QMXA 1YJVA 2YH0A 1UWBB 4NLQA 3TAMB 5H1SV 1RT5A 1S0NA 3TA2A 2MKHA 1PYTA 2R7OA 4ZVRB 1WDTA 3FMWA 4OFZA 2EK6A 2MB0B 1YRXA 4ED6A 3IBWA 1VK8A 4HHUA 4NLOA 1NJXA 2K3KA 3CCJS 3MR6A 2ZHBA 2W7PA 4ZHRB 4YDDB 1JLAB 3T3FA 1R0BG 1NHUA 3FQLA 3JTOA 2XSJB 3BQ2A 5LSLA 5KFGA 2FTRA 1TELA 4WJBA 1RADB 2M9KA 4WIQA 3CC2S 2D1CA 4WKYA 4FPIA 2NXJA 2FVCA 2NXEA 3OFEA 1Y11A 4CIOA 2FVRA 3J81j 3EUNA 3I4HX 2HBZB 2C42A 1RLDA 3GFYA 4BDPA 1NHVA 2UUTA 3KUGA 1JLBA 4DR6J 5AXMA 2BOPA 4TN2A 5KFCA 2QFJA 1S0MA 4C3LA 1KQFB 3OR1B 4DLGA 1F9HA 4KHMA 3T1AA 2W9BB 2HNZB 1PILA 2D9PA 4QYZJ 1NDLA 2DIVA 8AT1B 5ETVA 3CC7S 2C2ZB 1RK8A 2V94A 5L9XA 1KC8T 3LO3A 3GSIA 1LW2A 3GV8B 4USHA 3HSJA 3NCRA 3MM8B 1VQSA 1P8GA 1CQMA 2EFQA 1RDRA 3NNCA 3BN7A 4BHQA 1PC4A 1YX2A 3MEEA 2YBVA 4USUA 5HN0A 4RW9B 1URNA 2MY8A 1HNIA 1NK0A 2X3GA 4IRKA 4RR5A 3KK1A 4DV2F 3WZ0A 5IXUA 1LNQA 2K06A 5HMWA 1SH0A 3CD7A 4O3SA 3KFWX 1NNDA 2E9RX 2VG5B 2JLEA 4BC7A 2RT3A 4DZDA 3I5BA 1NH8A 3P49B 4RUBA 3MXHP 2FHJD 2C2NA 4RW8B 4KV8A 2NUHA 4DEZA 5KTQA 5KAKA 1YBUA 4FVCA 2QLJB 3CW2C 3OL8A 1RGVA 3KDOA 3R6GB 3BS9A 3HK2A 1YDLA 2PO4A 1N5SA 2Z8QA 5A8KB 3OTOJ 3HXMA 4DFJA 4EEYA 4I6YA 3H2LA 3UFCX 3MGJA 3D4JA 2FC8A 1X9WA 4N8NA 4ZVOB 4O44A 3DU6A 1D9FA 2RD5C 4J9PA 1J5EJ 3K0JA 3VQSA 3EWGA 4QR1A 1WOSA 3NRBA 1B70B 3HFZB 4CNZA 1M5PC 3KLHA 4RZRA 2MZSA 2A1BA 3Q86A 5E3QA 1X4DA 3A13A 2VG6B 3PRVA 5K8NA 1LWEB 3DGPB 1UVJA 4V19X 1JJ2R 3DLHA 5HVHA 4K50A 3EGNA 5A8WA 2YWKA 2C1EB 4D3HA 2HS4A 4M5HA 1S6UA 2VKZG 2NXUA 4B9MA 4R0EA 1ZM3A 4XDCA 1Q86T 1FE4A 2BX6A 1SI9A 3RB4A 2CQ2A 4BCAA 1FRKA 1WEZA 3GIKA 1CS4B 3MD1A 3J7AN 4LF1A 2QL9B 3DRXA 3KXDA 3HFVA 2L9DA 4QR0A 4JV2A 1Q53A 3VCDA 2LEBA 2BVZA 1OY8A 1SJRA 2LQ5A 2LQJA 3CO9A 2M7SA 1OO0B 4CP5A 5JXSA 4X66F 3PW0A 1ZTTA 3H2UB 3W61A 3DMJB 4QBUA 2I9SA 3ENWA 1FFSB 4JOUA 1K73T 2B5JB 3IG1A 2KO1A 4ECRA 3PKMA 2CDQA 2EW9A 3TNVA 2HPUA 5B0CA 1Z4UA 1FRIA 3BGOP 4MTPA 5EWGA 1H73A 4DV0F 3KMQA 4RNFA 4LR7A 4OV1A 1IR2A 2MZRA 1E6VA 4QZVB 1LK7A 3QO9B 3VVTA 4HACB 4HTJA 2FVQA 1S9EA 1KFDA 1M5VC 1O8BA 1D3WA 4FXWA 1Y9OA 3PV8A 1FERA 4KKOA 4Q8EA 4HT7A 4FBTA 3NNAA 5IZHA 2ADBA 4FF3A 1YSJA 2R2UA 5LMUF 1JXVA 2IMWP 3NGUA 2JH3A 3EVMA 1N48A 2BUNA 5DDRC 2CVIA 3SBMA 7FDRA 3DLEA 4NRUA 4K4TA 2I5JB 4OX9J 2QRRA 4OYIA 1PYSB 2FJXA 2XGPA 4RBTA 1DHMA 2MSTA 4ZJQA 1YZ6A 4OHZA 4ZP7A 3PEJA 2HHQA 2XLJA 4USJC 2CG4A 1NPKA 2G1HA 3CXCR 1VISA 2JDJA 1BMQB 3M32B 4GVLA 3PR4A 2QA4G 1UVIA 2AEFA 3ZZTA 3TI0A 2QV6A 1R7IA 4WYLA 4KGMA 1WHYA 4CCHA 1ZYQA 4U6PA 1R27B 4JI1J 2RHSB 2XB2D 2RU3A 4G1PA 1VHIA 2AZ1A 2GHWA 1HBMA 2F3JA 5J2QA 3SSQA 1UETA 4ZPWR 4WE1A 4NLYA 4E2FB 4OI2A 4O0IA 1WG1A 3OFFA 4C11A 3GJQB 1S0OA 2DCUB 3RG6A 5SUHA 3RAXA 4ECTA 5AJ3F 4N56A 3SCJE 2B4PA 2C3UA 3AB4B 2I0XA 3RUBL 3BSAA 2LP4A 3UN2A 2MKKA 4W98A 5J2MB 2P2CB 2YQ3A 4DPWA 3PO4A 2X7IA 3CIMA 2B7BB 2KJWA 3B78A 1V3ZA 4J91A 9ATCB 3M8PB 4OX7A 1QDUB 3D5MA 3CT9A 1DLOA 4M8LA 3ZZYA 4HHJA 2DNNA 1RKIA 2H48B 3QT7A 1RAFB 1UPMB 1Y3JA 5J1EA 1SKSA 2KZMA 2K3IA 3OQ2A 3H4BA 3QJPA 2DTJA 5E33A 1Q8IA 3KLVA 5FLXU 3HFKA 2CQ3A 3VGUA 2CNNB 3RBXA 2IVYA 4M5LA 1Q0NA 1RAEB 5HQMA 3X3UA 4Y65A 4NPOA 3W5XA 3FKBA 3I32A 1SJQA 4ALZA 3UE2A 4B3MJ 1HHTP 1RISA 1PC5A 3BB5A 3W2WB 1VQ8S 5GMKa 3ZNJ1 1DTQB 2ZOMA 2UXCJ 1IBKF 1HQUA 1RTIB 3NG8A 4DSIA 1FESA 4OZ5A 4A4JA 4YB5A 2LECA 2HFNA 4DQQA 2G9OA 3DOMB 3FBFA 1C0UB 4WZQA 4J37A 4ZLPA 2QJ3A 4BWJA 1UVMA 2OPRB 3ZZZA 2KM8C 5JVGQ 5C5JA 5CYQB 4D3GA 2AEJA 4IOCQ 3IS9A 2W4CA 1CG2A 3EMTA 3TZYA 3F56A 1N33F 3VZIA 3FGVA 2YX4A 4KO0B 2NQPA 1QVGR 3CDBA 4PEOA 4P2FA 4C2MA 2DY1A 2B8QA 2ZBPA 5KG5A 4ZPTR 4NCBA 4LF6F 1FD2A 3K7RA 1DQ8A 2OFGX 4XPCA 1NPPA 1ZPVA 1W7WA 3D0IE 2D3O1 3Q23A 5LSRA 3M8YA 4DX8H 4KH1B 3WDOA 2P6TA 1T3NA 3FMBA 1IBLF 1VRUB 2WVCA 1D9AA 1PG5B 3MCSA 1HIYA 1NBEB 4AT1B 4YMEA 2N7YA 4X62F 3UNYA 3AJ2A 3J81U 4ZK7M 1AZSA 3A8JA 3T19A 2L9NA 3E2EA 5K20B 3LGMA 4XTTA 4ZVHA 4Q45A 4Q2MA 1NK7A 1PAUB 5K8MA 1AFJA 3GIIA 4NCGA 1LEOA 2F8EX 1TV6B 3VAMA 2EFOA 2VICA 2JEGA 3H25A 3HJFA 4C8NA 1ELOA 2H5JB 3IR7B 3QNWB 3RAQA 1EP4B 1ICEB 4GVBB 1ZAXA 4WU3A 3MPVA 3LP2A 4TYBA 2DXEA 2JHEA 4ZIVA 4LF4F 4DG1A 1LW0A 1XNRJ 2IYGA 1EQ0A 3TOQA 2SXLA 3UR0A 5HSPA 4GKJJ 4LIWA 2MJNA 2ZNZA 2KTQA 3MM6A 2ZVIA 2I8EA 4R5PA 1RB0A 1GK8A 4MMOA 3GLJA 2V8HA 3ULHA 4NASA 2DHXA 4OX6A 4ED3A 1NB7A 2NYHA 1N5QA 2V4JB 3PYDA 2CIMA 1CEZA 2E7XA 1RAAB 4ES1A 3G6ES 2POKA 2XMMA 3IFEA 1RWVB 1REVA 4LFBJ 1S9GB 4KC5A 1BUXA 3DI6B 1JJHA 2FHMA 3SQGB 5ETPA 2V4QA 5D8HB 2HS0A 3TWZA 3U1LA 1XIQA 4TLQA 2ZH7A 2ZITA 3W62A 3I56S 3OPKA 1ZZFA 1CJUA 1YBAA 3BGRB 3J7YU 2J9EA 5F8NA 3M2VA 2IBOA 3DLGA 4LBHA 3J7A1 2AGQA 1RA6A 1WEYA 4LIRA 2J5AA 3SXLA 1WF2A 4ECZA 2HEKA 1H98A 3NGSA 3PEHA 4UQGA 2JSXA 4KIAA 2L3MA 4A8FA 3FZBA 5A8RA 4U7UD 2VZ9A 2QIFA 1X4GA 4DBQA 1OPZA 2GHVC 2HQCA 1FD8A 2CPHA 4ZLNA 4PG7A 3I4PA 8ATCB 1F1BB 5HMXA 3ETOA 1XC9A 1EAYC 1VQ6S 2DGQA 3PG9A 3RU0A 4FS2A 4DU8A 3LWLA 1UFKA 2RH3A 2DCLA 4WXWA 2ZWOA 5HANA 2Q6BA 2B9XA 4PPDA 5J1NA 1SQFA 2FZKB 1YJUA 2HNDB 2LQBA 2E44A 1EHWA 2WHOA 3KLFA 4DQRA 2XEXA 3AD9C 4M63A 4JI0F 3HSZA 1HHSA 4CO5A 1X4HA 2GIQA 4OZLA 2ZKUA 3M8QB 1SQEA 1UWBA 3O6QA 1RCXB 2E5HA 1XMQJ 5CYMB 3TAMA 2JWNA 3R6LB 4Q7AA 1DTTB 2DH9A 5MAOA 2ROPA 5C24B 4LRDA 3TYTA 2E1AA 1RXOB 4DQIA 3W60A 4M5NA 1EB0A 1SB6A 2DT9A 2FZCB 2R8JA 4E8UA 4V19J 4PXDA 4CZCA 5D4PA 4Y28C 4ZHRA 1RHMB 1JLAA 3EX7B 1T9XA 3HP6A 1UVLA 5DGAA 2Q3PA 2FB0A 1HBNB 3PJ9A 3MI7X 3MCMA 5F8MA 2OMOA 3ZTPA 2XSJA 1KFSA 3NGDA 4B9NA 2KT3A 3RR7A 4X4VA 3W65A 1UWAA 1GXUA 2YKAA 4ZPVR 2KHCA 4JI4J 5C25B 1VFJA 3CIZA 4WP9A 1RA7A 2E9ZA 3D6MB 4DV1J 1VQKS 5CCMA 2CJQA 2DHGA 4X2BA 1HFEL 3EJMA 4CO1A 3P3DA 1OYEA 1YJ7A 1X0FA 3OR1A 1VCTA 3BEGB 3TJ8A 2W9BA 2HNZA 2R2RA 3TW0A 2JLFA 3KJQB 5T7LB 1RQ0A 3DDNA 1GX5A 3FCHA 1TL1B 2ATCB 2B9YA 2AWZA 4P10A 2HRUA 2YWFA 4KJIA 4F4WA 3MM8A 4Y00A 2UXDJ 4NLGA 5LOQA 3MEDB 3I6PA 1U1LA 2HK2A 3VAHA 2DR9A 2H65B 1JLFB 4LQ9A 3VVUA 3IBFB 5A2QU 3VF0B 1VQOS 3LALA 3W5ZA 2EKNA 4RW9A 4RUCA 5KG1A 1FXLA 3T5LA 1OYDA 5EN1A 3A3PB 4C8LA 1TKZB 3HHDA 3HHNB 2XLKA 4FF1A 1FRXA 4KPCA 5IFMA 1BQXA 2VG5A 3EZUA 4JI8J 2ZBRA 4DR5J 2VFVA 1U47A 2QGFB 3ENAA 4RW8A 2Y8WA 3KNGA 3H98A 4HL9A 3SYZA 4JV1A 3TZXA 2MXYA 3IWXA 2E29A 5A8KA 5KFSA 1VQNS 2VBWA 4DJBA 1IJFB 2DD8S 3OJSA 4IH6A 2YWGA 2DR5A 1KHVA 3K58A 1IR1A 3I5AA 1QUPA 2FHJA 2ZWPA 4MIAA 3G8SA 1U1RA 1X8DA 2E9TA 3WIVA 2Q6CA 3FVYA 1Y5LB 3Q22A 3BM7A 3OVSA 3LAMA 2M5YA 3JAMY 1KLNA 4USWA 4B9SA 2GJ2A 2J9DA 2UVVA 2VG6A 1LWEA 1RTZA 3DGPA 3M4XA 3OTOF 4R25A 2AYMA 2EG1A 5C2CA 2CWXA 4IO9Q 2DNKA 3C14B 5DDQC 2RRAA 1AXQA 3C8YA 1PBAA 1J5EF 2B9WA 1K0TA 3J80Y 2GVZB 1CS4A 1WD6A 4Q2LA 4HI2A 3H0PA 4M5DB 3JQMA 3THVA 1TTHB 5KG0A 2ZE2B 2GX8A 3BDEA 2HZAA 1HWUA 1OWXA 3RR8A 2GGPB 4DS5A 1RT4B 2M3DA 2YXLA 2UV8G 2HVEA 2HZVA 3K89A 4UQTA 1NH7A 4MK7A 3DMJA 4RW4B 4LVOP 1WWHA 1U2CA 1X5TA 4QPXA 2PT0A 3NCQA 2XM3A 2VUGA 4NX9A 2B5JA 1NSQA 4RU2A 4DMZA 3ILJA 1IKYB 5I3QA 1S5ZA 3HLUA 3CMES 2RQMA 4WFNQ 5KT4A 1MN7A 2F8MA 2YKMB 5KG7A 4LSZB 2ZC3A 1WG4A 4U96A 3LTOA 2C2DA 2UV8A 3QO9A 4EUVA 1UCNA 3GMGA 1RHUB 4HACA 4PUOB 3A3NB 3E01B 3VWSA 3CCWA 3EGZA 2BQ3A 1SC1B 5D0HA 3OL7A 3BR9A 3CJ0A 3D28A 2Z0GA 2PEHA 1D09B 1I6JA 3B4MA 2UVUA 2M88A 2QLFB 3OSPA 1L3TA 2GZOA 1F2GA 1SXLA 3OVBA 4Y2CA 3TUZC 5CHCB 4ETZA 3BKTA 2ZH9A 2DYAA 3JQKA 2QX0A 4CO4A 5BYSA 3D1QA 4PG4A 4F4XA 1VJWA 2C2OB 2I5JA 4F3OA 2DBBA 3EVOA 2MZTA 3LA0A 3PO5A 5F0UA 5ETTA 3NWGA 5LXRA 2DGXA 1UL3A 3OLBA 1RAOA 1DURA 2Y1JA 2KI2A 3R7SB 3T6JA 3M32A 1TAUA 5HMZA 3EZOA 1HNVB 5KFKA 2VQFJ 2BKOA 3HHLC 3JYTB 2ZZTA 5EWEA 3CVKA 3DOLB 5HLFA 2A0FB 1PJ6A 2DNOA 2N4CA 2DPIA 4O4GB 1X4FA 8RUCA 3TVZA 4OX9F 2LQ9A 3ZC4A 2UUCJ 2EBGA 3JB9k 2EWHA 4CLWA 3EE3A 2WW8A 4S0MA 2AEMA 2YY3A 3OTCA 3IP0A 4NZ0A 5E7OB 2CPZA 2BDPA 3DGVA 3AFGA 1IJEB 5KFYA 3CDWA 5J2MA 2B3TB 2RQ4A 4JI1F 4A48A 4RBUA 2V9KA 3TARA 1FO1A 4ZCIA 2D41A 3M8PA 4ENOA 3SV3A 3PHTA 1UKUA 1HHQA 2DNZA 1S4EA 2ZH1A 2QZ8A 3R5JB 4EMDA 2DR6A 3PJXA 5HMYA 1N36F 1SV5B 1CJKB 3D6FB 2J7WA 2HQDA 4ITSA 4K0KJ 3FRZA 2W4DA 1HD0A 4KYZA 3B54A 1O51A 3FCVA 3GJSB 4XAKA 2HHWA 1AROP 3RAMA 3W2WA 3OSNA 2PFFB 4N8OA 1E6YB 1DTQA 2GHPA 3O3LA 1NJZA 1U8WA 3EYZA 1RTIA 3Q89A 2BXJA 2OMLA 4FYWB 5E3CA 4XIUA 1IQTA 4LSLB 2FVPA 2XCPA 5L1LA 4B3SJ 1APSA 2WRMA 4U95A 2W8KA 3DOMA 3NWRA 5HVGA 1C0UA 5FD1A 1U2FA 3M30B 2WCXA 3RYLA 1N6QB 2OPRA 4L73A 2YX7A 4WZMA 1S76D 5CYQA 4ZVSB 1VRTB 2KFNA 4ZP6A 2F5GA 4TKTA 4ZVFA 4OV6A 3AQOA 4QIVA 4M94A 4KO0A 4CH7A 2UXCF 1R89A 3CJKB 5ETQA 1RAHB 4L6V3 2WBMA 4LVNP 2V0NA 1CVJA 4IFYB 2IM2A 2YKNB 1EARA 2W2QP 3F41A 4G3IA 2RUGA 1G3OA 4P75A 4OLPA 2IM1A 4FF2A 3KYLA 1VI7A 1QSSA 1VRUA 2JFKA 4WF9Q 2RIJA 4G1IA 2MQMA 1WKKA 1NSAA 3EXYA 3BN4A 1SKRA 1MLAA 1SL0A 1KHWA 4J9LA 2CKWA 2DY9A 3OV7A 1U1MA 1H72C 2XBPA 1WDDA 4LRAA 1WC1A 3N6NA 3T41A 3FJ2A 1NZ8A 4M95A 2PMZD 2MKCA 4X4OA 4PPZA 2Z2ZA 2VC0A 2MKSA 3LANA 2IJFA 1SJ4P 1TV6A 4YHHJ 4KSEB 2HIQA 2N3LA 5KFLA 4F50A 1EP4A 1RT6B 3AOAA 3VGSA 2VFTA 4GVBA 2GQCA 1HI8A 2C3MA 3CD6S 3FBBA 3C15B 1PKUA 4YFUA 1MN9A 2XI3A 1KNZA 2J6TA 2BJ8A 3CCVS 2DISA 4C8KA 1M1KT 4FDFA 4UOHA 3RJMB 2R7WA 2B43A 2HWHA 3RGIA 3L95X 2KM8B 1FJGJ 2PN6A 4C8OA 3NS7B 3H20A 5G4DA 3AA9A 5I42B 2V4JA 1MMNA 3UDCA 4P74A 3DKDA 2XNRA 3GONA 3SCKE 2AGPA 1P6TA 4DQSA 3S8SA 1ZA2B 5HL7Q 1S9GA 2VL1A 3UI3A 3DI6A 1XNRF 3SQGA 4PYAA 1QLNA 3QIDA 4ZPDA 4GKJF 3R2DJ 2FC9A 4ZVTB 4J5OA 4KY3A 2HFOA 3MEKA 4X4UA 2QLXA 2CPDA 1GMVA 3C46A 3BGRA 1K44A 4FXVA 4CT8A 2BV3A 2CQPA 2DXDA 2HQIA 5D4LA 3BH6B 3C2PA 1FX4A 5T14A 2IHR1 3D0GE 1S57A 1X9SA 1VC5A 3SCIE 4RUHA 2VOOA 1RTHB 2LQ8A 4IH5A 3IXQA 4TQSA 4DL2A 4QWAA 2VJUA 4IRDA 2R8GA 2VBXA 2KFZA 3DYAB 2IJNA 1YIJS 2QLBB 2AJ2A 2ZD1B 4JYAJ 4WXOA 2MDAA 2IM0A 1U49A 5IM0B 5M2PA 2BR0A 3DHXA 1EKRA 2XY6A 3WC2A 2X1FA 2L41A 2QEXS 1EQMA 1ZH5A 2OPSB 3MMBB 4LFAJ 1YVFA 3GG1A 2J8AA 1L3SA 4M5MA 2JEIA 2HNDA 1FF2A 5H9FJ 2H5IB 4MKBA 3HZEA 3KJVB 2CAJA 4NLRA 2IBKA 4URQU 3QT6A 3CDEA 2AX1A 3KWMA 3M8QA 2MGZB 5J2NB 3HSGA 5CYMA 4OI6A 3M6WA 5HROB 1J27A 2DRBA 1FXDA 2QE5A 1DTTA 3WX4A 3VTIA 2KU7A 5C24A 4CLYA 1T94A 2B9EA 1W2IA 1U1QA 2YKPA 2H54B 1R6YA 3KOAA 2HHXA 2ZH4A 1FE0A 3CJ3A 1TMMA 4DR1J 1IXKA 4B3TJ 1U0HB 3K5OA 4AL5A 3SIPB 4CLLA 4OZ2A 5DO2A 1RCOB 5K8OA 4CLPA 1PIEA 2C3PA 5KFAA 2VPWB 4L75A 1HBNA 1D0EA 2GNKA 2IRXA 3OXLA 4HVZA 2CPFA 3FZ2A 2XO7A 3D6TB 3HMJG 1XMQF 5IQ6A 1S1VB 2DH7A 4E0DA 5AE2A 2OD4A 4I2QB 3EDQB 5C25A 3SSRA 4NLPA 4UY8T 1NXIA 4JI3F 3T9NA 3M9NB 1VLOA 3QWUA 1HL6A 3R3TA 1UA0A 4MT1A 3HCXA 1BE4A 3AH6A 3Q8YA 4QIFA 3FBCA 2XMKA 1H74A 2FHKA 3V4MA 3FFIB 5D77A 3NL0A 3DDKA 5A6WA 2ROGA 3B8HA 2V2ZA 1VLYA 3QBCA 5KT2A 2ZJRQ 3UN5A 2KG0A 5KFNA 4LUBA 2A6OA 4LJMA 3CJ5A 4UUWA 4JI4F 3BSOA 2AYGA 2QG9B 2X1GA 1TL1A 1WKJA 5L9NA 1RHRB 4EBDA 3U27A 4N5SA 2WBRA 2XULA 3QJJA 2NXCA 2J9DE 4DV4J 3PW4A 3MEDA 3M2RA 4J9KA 4DV1F 2KH9A 2IVMA 1HWLA 1JLFA 3ISNC 1DRZA 3BBBA 1YZ7A 4ELTA 1RBAA 2HNYB 5KFOA 4TY9A 2WW4A 3UQSA 1VQ4S 4F3QA 3QLHB 5E2QA 4CLFA 2AV5A 2HURA 2PFDA 4WYWA 1I5OB 4NXNJ 3NAHA 1R8BA 1TKZA 2O66A 2HHHF 4MKYA 5GMDA 4J9MA 3TVKA 2K1RB 2PMWA 4DPUA 3H8YA 4OJ1A 1N4LA 2Z57B 4P7VA 2UXDF 3DRPB 4C48A 2IA0A 5AE3A 3U02A 2DIUA 3GIMA 2Y0BB 3HT0A 3VALA 1VOMA 2IDEA 2QFIA 1HWKA 5HK4A 3VAIA 4I4BA 1WTBA 1FCAA 2G2ZA 1IBMJ 4IFVB 1B0PA 3U1MA 3VAGA 1JLGB 2YPYA 1QVFR 1KQGB 4MJKA 1OMSA 4DL5A 4NOHA 1HBUB 1T9WA 2DO4A 1NDKA 3W2VB 1K0VA 1F9FA 2GFFA 4CLKA 3OD2A 4JI8F 2VODA 4KTQA 1X7VA 1TL3B 4DR5F 1WHXA 4J9UE 2XYPB 4ID5B 4KBIA 3LOUA 3QRRA 2AX0A 3BR8A 4ED0A 5C2GA 1U7LA 5BYQA 3ENQA 2KHDA 4JI5J 4DHVA 3N6LA 1RT2B 3C14A 4LR8A 4O3NA 3CCLS 4RW6B 5AE1A 1G7CB 2ATLA 2BW7A 2Y8YA 1S1UB 3BSCA 4CO2A 3NGRA 3W9JA 4HDHA 4OYPA 5B0GA 2VFSA 3UD5A 3SV4A 1N54B 2GVZA 2IFXA 3TEGA 1VIXA 4M5DA 3SDEB 3MOJB 3MF5A 3GR0A 4K4SA 3M8SA 4WU2A 3WHIA 2I6WA 2ZE2A 3FSXA 1N0VC 4ER8A 1WI6A 3A12A 2RSQA 4OI0A 2GGPA 2V68A 1ZOTA 1C1BB 2KYZA 3RBDA 3ZZUA 1VC0A 3K57A 2MKYA 3MFIA 4N47A 4RW4A 1LFPA 1IWGA 1FWKA 2ZBCA 5I3PA 4IKAA 4PG6A 1IKYA 4LF7J 4NLVA 2YKMA 2R7SA 2OP5A 1VQPS 4TU7A 4ZPCA 4OI4A 2FY8A 2HHTA 4XDDA 3PKYA 1FDAA 3T1HJ 3JSRA 1Y4ZB 3ZXWA 1CC7A 5LXYA 4ZITA 4PUOA 1TU0B 1BD6A 3IR5B 3E01A 3OTBA 1TKDA 4UUXA 2PA3A 3KG1A 4UOGA 4F02A 1Y0HA 4ES2A 1D8YA 4ECUA 1N5YB 2CQBA 3BV8A 4ATNA 1SC6A 4KT0C 3D3BJ 4TLRA 3CC4S 1R8CA 4FP9A 4DPXA 2CPIA 3MM9B 5HJYA 3TUPA 1RT7B 3VR1A 3MM5B 1KQKA 1S97A 2X3DA 2R7XA 1DJ0A 3MEGB 3SEOA 4UOCA 1M5OC 2WZ1A 4OLOA 1PSDA 5D4NA 2EFPA 3BYPA 1EX8A 1Y5IB 3FC9A 2V69A 1C1CB 1NK4A 3K8VA 2QSWA 2FLOA 3K5PA 1U1PA 1HNVA 3D9BA 3JYTA 1IKXB 5DDOC 2M4MA 1RWKB 4EZ9A 1XNQJ 1WC6A 3DOLA 3T5JA 1U8SA 2N82B 4O4GA 3BDPA 3UCGA 2XMUA 2NUUG 4ELUA 3PY8A 4NMXA 4Q0BB 4ECWA 3W5YA 1FA0A 1RT3B 1LXJA 5KG4A 2M8DB 5KOWA 1VQMS 1S7HA 3W1YC 3MMAB 3UDEA 4MYTA 1RT1B 4TYAA 1RWOB 1HKAA 3X1LB 2MQ8A 4Q8FA 2AYEA 2VQFF 2B56A 3Q8QB 2KN4A 5KG2A 1RHQB 5CAAA 2J6UA 5CXTA 4F2RA 5KFQA 1CJVB 5CA5A 1DZ5A 2UUCF 2AJQA 3MCNA 4ED4A 2CXEA 2R8KA 2ALYB 4H4MB 2FJEB 3AJ1A 1SV5A 1CJKA 2K8GA 4EWTA 1NZAA 2MQPA 3N79A 4HEA9 4OYZA 2C28A 2AJ4A 1BQNB 1AYEA 4EO8A 1YJNS 1M0SA 1Q95G 2AP6A 1FTRA 2HG4A 5B0DA 5THWA 3M05A 3HHLD 3N28A 1E6YA 4TVAB 4OI3A 4DR2J 4EBCA 3TA1A 3HVWA 4LSLA 1AFIA 2UZAA 3JAMU 1S0VA 1S6PB 4ZPBA 4J7CA 4OIXA 4M5KA 4X4NA 1REGX 3ELHA 4QU6A 3HHLB 3M30A 3CPWR 1N6QA 2L48A 1MWQA 4DX7A 3PW2A 3O5TB 4I2PB 3WIUA 5D78A 2NSBA 1S1XB 1VRTA 2OPPB 3QFHA 4URSA 2BJDA 2UUBJ 5LJ5Y 4NA1A 2BW2A 3J80U 5H9EK 5C7PA 3CJKA 1NK6A 1AB8A 1S59A 4GKKJ 5K14B 4O23A 4B3SF 1NDCA 1MROB 2MZ1A 4OZNA 2V2QA 4IFYA 2HWTA 1A9NB 2YKNA 1T03B 5F3TA 3UDVA 3GYXB 1QAYA 1ZZNA 1VDHA 3AD7C 3GB0A 1SUQB 3WX8A 2CVEA 2HAIA 2M70A 3ET6B 4YEAA 2VU5A 5G0RB 3K5NA 3CNQP 1CC8A 3G6XA 3KG4A 3D1HA 4Y6IA 4FPRA 5HP1B 4LF5J 3ZTRA 2W8LA 2C2RA 2MTLA 1TFWA 4NYOA 2KG1A 4PQUB 3V5RA 1T9TA 1Q8LA 5AXKA 4CTAB 1RE1B 2E1RA 3N01A 4HH0A 3DHWC 1UW9A 3KLEB 1HMVB 3ZTSA 2YQ0A 2RRBA 1XK8A 4MYUA 1VIOA 2AGOA 5KFPA 5EWFA 4FKXA 1S1TB 1RT6A 3I0RB 2Y0SD 4YOEA 2MHEA 3LF0A 1LKZA 2HBQB 2PI4A 2UU9J 1HR0J 4EGLA 2XS7A 4LF8J 3C15A 4ILRA 3CCMS 3GG0A 5GAGU 4ETXA 5IQQA 2RNEA 1MU2B 3LUYA 3PR5B 1FK9B 3QMQA 5F8JA 1RWWB 2DGVA 3CGIA 1QAIA 3MUTP 1G2EA 3ZO7A 2A10A 4DCJB 3F44A 4O3PA 4Q44A 3PZPA 3MUVP 4CDIA 4YHHF 5I42A 1NKEA 2HBYB 5MLCV 2RF2B 1FJEB 2BANB 3ZZ0A 3GP9A 1YJWS 1WKLA 1RBLA 2VDHA 1H7WA 4PYDA 3ILOA 1XTZA 3TJAA 4LT6A 3E3XA 3RBEA 3M8WA 4CLUA 1S7IA 4B17A 1DQAA 4DF4A 2GMJA 2YTCA 1Q7LB 1Q82T 4OYAA 4KHPJ 4XPEA 2JEJA 3HO1A 2BJEA 3MPWA 2C3YA 4MIWA 1HNWF 1YJTA 4PKDB 4MH8A 1VS3A 1RYSA 5A0YB 4WBFA 3TX8A 1NAQA 5EGYA 4UW2A 5D0RA 3RW7A 5KFDA 4EFAC 5CZXA 1BY9A 4F3MA 3BKUA 3O1LA 3TZZA 2HQFA 5IOLA 3POTB 4IG0B 1SH2A 4WFZA 1XERA 2BACA 1YGYA 5KFEA 2L08A 1RTHA 4RW7B 3U7JA 2BKNA 4QWEA 3OJUA 3NLCA 2NZCA 4QU7A 3UVJB 3CCZA 3I9V9 1F5CA 4B9LA 3BPSP 2XMWA 3TO8A 3DYAA 3CDAA 4IR9A 1RU1A 1VJQA 1RUSA 2ZD1A 5HVFA 3TUJC 4C97A 2D9OA 2KVIA 3W3SA 3TUIC 1F60B 3IAM9 1KVIA 4JI7J 5C42B 5IM0A 4C3KA 4UF4A 2WAQD 1FKPB 2HMIB 2OH2A 3L7PA 2CG8A 2FY1A 5DRKA 1HD1A 2OPSA 2PGCA 3MMBA 4LRFA 5BR8J 1BQMB 3NMAA 2F65A 2H51B 4M5GA 1N52B 4Y3CA 1SJFA 2DNQA 2VASA 2W2PP 4EO6A 3DU5A 1NJIT 3A4TA 3GILA 2RQCA 1M1GA 2FJVA 3OTEA 2VPZB 1YLXA 2MGZA 4JYAF 5J2NA 3K17A 3HPOA 5HROA 1KDNA 4C7QA 1HNZJ 3MM7B 2RAQA 2ZHAA 4ZJLA 5KFZA 4F67A 5D3GB 3ICLA 1RTDB 3KTQA 2LDYA 3MTKA 5KFBA 3NAIA 2MKIA 3DNCA 2DR7A 5DDPC 1DARA 3ZZRA 1V3SA 1JNZB 4RUAA 4GC7A 3Q8SB 3F0NA 1U0HA 3MDFA 1FKOB 3T6BA 1WF0A 4OYXA 2FGOA 1R31A 2VH7A 4F7VA 4WCEQ 3FEXB 2MHNA 4CNYA 2VBYA 1KKHA 1YJRA 4QQBA 5FIIA 1B0TA 3FCWA 1S1VA 5LSOA 3B82A 1QY7A 2MEWA 4I2QA 3ZZPA 1K1QA 3BZQA 2FJWA 2GAHC 1UEVA 1D9DA 4RNNA 1T9VA 4DR1F 4B3TF 4WFAQ 3QGGA 1X4AA 4M5JA 3QT5A 3G4SS 2VBZA 2OHDA 4KHRA 1JJCB 1KTVA 2WVBA 4NCAA 3FFIA 3S1TA 4QYZK 1TQLA 2ZNYA 2OAUA 1FNXH 4BLGA 4LR9A 2C2EA 1KR4A 3JTPA 5IT9Y 2XHCA 3C6UB 3PIOQ 4YB6A 2HRYA 5IV3A 4ED5A 1SIWB 4AE5A 3D6HB 2WSFC 2IMOA 2RMLA 2GVDB 2YKQA 1S9EB 2ERRA 3SCLE 3HVTB 5L1IA 3TJ9A 2CNOB 1UEUA 4FYYB 2CQ4A 2OFHX 2BRLA 2E5GA 4CWBA 2HNYA 3QLHA 3A8IA 4DPYA 2ZFHA 1KLMB 4F36A 1U45A 2FUG9 5GMEA 1UA1A 5L39A 1Y7PA 1T05B 2DNMA 1FXRA 3HF5A 2K1RA 2ROEA 2Q79A 3K8WA 4ZMMA 3LGHA 4F25A 1Y00A 4P6QA 3DRPA 1U26A 4DV4F 3TAPA 3D0HE 1L3VA 2FDNA 1HA1A 3P96A 4L76A 2KT2A 2AF6A 2HGMA 3DRSB 2HFZA 5GADI 4IFVA 2N4DA 2LFVA 3OXGA 1KP6A 1JLGA 5GAHI 4EYHB 3ZTQA 1RWMB 4NXNF 3KUHA 1HBUA 1RACB 2KXFA 5CABA 3W2VA 4F0HA 3W63A 5AXNA 1M5KC 4J9SA 1W2BR 4QW8A 4FYVB 5J2QB 1NDPA 2DKOB 1TL3A 4EI2A 1IKWB 2NXNA 2BJ9A 1NHKL 4NRTA 4M1KA 3THTA 1L3UA 4ID5A 3JSMB 4B3OB 1T7PA 3LP0B 2FGCA 4DCOB 1IBMF 1YBTA 4I6WA 2QO3A 1R8AA 3CCQS 4NI2B 3VGTA 4Z37A 4PCQA 1RT2A 2A18A 3ISND 4RW6A 2LCWA 2W2NP 1S1UA 1JLQB 1DY3A 3GWCA 4H4OB 4LSNB 3EGWB 2GJFA 1S79A 1Q1KA 3SDEA 2ZM6J 2DK2A 3ZZOA 2V34A 3PACA 2DO0A 2E1MC 4HYKA 4OZ1A 2J9CA 2FLPA 2CZVC 2VA2A 5SZTA 1NJYA 2LXFA 1LWXA 2OSQA 3SSSA 2G0CA 1C1BA 4JI5F 3DOKB 4DV5J 4Y2KA 4CM0A 4KQZA 4DSLA 4N7TA 2ZZNA 2HAFA 3RRHA 1V3RA 3GPAA 1WNEA 4I0WA 2HGLA 5I4MA 3IAS9 1HW8A 2F7VA 2ZZMA 3UO0A 2ZBQA 2CA9A 1KTQA 1FVQA 3QFWA 4Q5VA 1R43A 2RDJA 3HSDA 2NYIA 2Q1LA 1T0TV 2KXNB 1N32J 4IQMA 3PIPQ 1VQ7S 1PJ7A 2YQ1A 2MKJA 3CDUA 3GYGA 3Q0AA 2OKQA 2YWHA 3VGVA 4KB7A 4EBEA 4WWSA 1OQ6A 3NOGA 4IRCA 1ZM9A 3GQCA 4USIA 4ZVQB 1N5YA 1RWPB 3MCOA 1MNEA 4LF7F 2H3EB 2MZJA 1B3TA 2RE1A 3HD1A 6FD1A 2MMYA 2QSFA 4PWUA 1SH3A 1RT7A 3MM5A 2CADA 4A8YA 3GIJA 4OYWA 2UUAJ 2V2VA 3MEGA 4FNIA 2CPYA 2RQKA 3T1HF 3NS5A 4A8KA 2LYVA 5CD4A 2M0GB 4K4YA 3U1NA 3AXKA 4C0BA 4QWCA 3ONQA 2MJUA 3D66A 3CWJA 3DXBA 4USMA 5B08A 3D54A 5DQIA 3KHRA 2FVSA 1C1CA 1RJJA 1PBUA 4C8YA 1GNKA 2C2MB 2AJ1A 4IQXA 1S9FA 3N5BA 2WVEA 3GFHA 1N8RT 3QZ7A 1IKXA 1R0CB 4FYDA 1S10A 3C16B 5EDWA 2GV1A 2BYCA 1NKCA 1S6QB 1PO6A 1UAWA 1CJTB 3PX6A 1H2TZ 2MYFA 4Q0BA 3FNNA 3R1LA 2I2YA 1RT3A 3HHEA 2HVHA 3OVAA 2ASDA 2ZKTA 3KK2B 1RT1A 4K2XA 3R5DA 4USTA 1JNRB 1NO8A 4KGKA 2DGWA 1O0PA 1AA1B 1T02A 1XNQF 2ABYA 1QM9A 3G71S 2Y1LB 5DGBA 3G9CA 2VA3A 4PWWA 4Y2IA 2QLWA 2Z56B 1M5SA 1CJVA 3R5CA 5F8LA 2VV5A 4ZDNA 1FFWB 1F6TA 2Z2YB 4H4MA 3UDLA 4X4TA 5IT4A 4URGA 3PTWA 4LRCA 4WP8A 1EJ7L 1IN0A 2E5LJ 3OL9A 1TK0A 1T3OA 1BQNA 2JFDA 1ZAVA 1S99A 1X60A 4ZPAA 5IWAJ 1NJWA 4Z7CA 1TUGB 2FJAB 2OELA 1AUSL 2Z30B 2GAGC 1G6BA 4ECYA 4OZ3A 4Z2XA 1SPBP 1WSVA 4HDGA 2B7CB 4QIGA 4PG8A 3NGKA 3QQCD 2DJWA 4K7QA 4DCPB 3GJRB 1HWIA 2AHOB 2K7JA 2LXUA 1XMOJ 3V81B 3UNGC 5CZVA 1S6PA 2J7KA 4AUKA 3V6DB 2EBEA 3AA8A 2BOAA 1U0SA 2NPFA 2XMAA 3HHLA 4OI1A 2V2KA 4WKRA 3BREA 2NPIA 3JSBA 4I2PA 4O3OA 3GV5B 1S1XA 2BE7D
chains in the Genus database with same CATH topology
1NSQA 1BUXA 1NSKL 4ENOA 3G2XA 4F36A 1HHQA 2HURA 1S5ZA 3VGTA 2DXFA 3ZTSA 3Q86A 1MN7A 1NPKA 3EMTA 3B6BA 4EK2A 1HLWA 3PRVA 1XIQA 1LEOA 3NGTA 4ANCA 4F4AA 1VYAA 4FKXA 4WBFA 1EHWA 3BBCA 3JS9A 5C7PA 2BEFA 1ZS6A 4KPCA 1BE4A 3FBEA 3VGSA 1S59A 3Q8YA 3FBCA 3VGVA 1K44A 3Q83A 1NCLA 1NUEA 3EICA 3NGRA 1NDCA 3VGUA 3FBBA 1KDNA 1UCNA 2B8QA 3B54A 1NLKL 1PKUA 2DXDA 3VVTA 1F3FA 4DUTA 3FCVA 3ENAA 1MN9A 4UOGA 2ZUAA 3BH6B 3EJMA 2BX6A 2DXEA 2AZ1A 4HR2A 4C6AA 2B8PA 5IOLA 3DDIA 3FKBA 1S57A 1W7WA 4UOHA 3WX8A 2CWKA 2VU5A 3L7UA 3EE3A 3ZTQA 3BBFA 4S0MA 1LWXA 3EM1A 1NSPA 1NB2A 1BHNA 1U8WA 3NGSA 1B99A 1NDLA 4DZ6A 5CABA 1WKJA 4O0NA 1B4SA 3Q89A 3ZTOA 1NDKA 2HVDA 1WKKA 1JXVA 2AZ3A 2DYAA 3Q8UA 4DI6A 4ANDA 4UOFA 5CAAA 3NGUA 3BH7B 2HVEA 3EVMA 1NDPA 1HIYA 3ZTRA 3MPDA 3DKDA 3ELHA 4ANEA 4CP5A 3GP9A 4FKYA 3GPAA 5BXIA 1WKLA 4W98A 2DY9A 3EVOA 1NHKL 1XQIA 3FCWA 3EVWA 3VVUA 3PJ9A 3FBFA 2NCKL 3FC9A 3Q8VA 3R9LA 3ETMA 1PAEX 3BBBA 3ZTPA 1F6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSQ A;  1BUX A;  1NSK L;  4ENO A;  3G2X A;  4F36 A;  1HHQ A;  2HUR A;  1S5Z A;  3VGT A;  2DXF A;  3ZTS A;  3Q86 A;  1MN7 A;  1NPK A;  3EMT A;  3B6B A;  4EK2 A;  1HLW A;  3PRV A;  1XIQ A;  1LEO A;  3NGT A;  4ANC A;  4F4A A;  1VYA A;  4FKX A;  4WBF A;  1EHW A;  3BBC A;  3JS9 A;  5C7P A;  2BEF A;  1ZS6 A;  4KPC A;  1BE4 A;  3FBE A;  3VGS A;  1S59 A;  3Q8Y A;  3FBC A;  3VGV A;  1K44 A;  3Q83 A;  1NCL A;  1NUE A;  3EIC A;  3NGR A;  1NDC A;  3VGU A;  3FBB A;  1KDN A;  1UCN A;  2B8Q A;  3B54 A;  1NLK L;  1PKU A;  2DXD A;  3VVT A;  1F3F A;  4DUT A;  3FCV A;  3ENA A;  1MN9 A;  4UOG A;  2ZUA A;  3BH6 B;  3EJM A;  2BX6 A;  2DXE A;  2AZ1 A;  4HR2 A;  4C6A A;  2B8P A;  5IOL A;  3DDI A;  3FKB A;  1S57 A;  1W7W A;  4UOH A;  3WX8 A;  2CWK A;  2VU5 A;  3L7U A;  3EE3 A;  3ZTQ A;  3BBF A;  4S0M A;  1LWX A;  3EM1 A;  1NSP A;  1NB2 A;  1BHN A;  1U8W A;  3NGS A;  1B99 A;  1NDL A;  4DZ6 A;  5CAB A;  1WKJ A;  4O0N A;  1B4S A;  3Q89 A;  3ZTO A;  1NDK A;  2HVD A;  1WKK A;  1JXV A;  2AZ3 A;  2DYA A;  3Q8U A;  4DI6 A;  4AND A;  4UOF A;  5CAA A;  3NGU A;  3BH7 B;  2HVE A;  3EVM A;  1NDP A;  1HIY A;  3ZTR A;  3MPD A;  3DKD A;  3ELH A;  4ANE A;  4CP5 A;  3GP9 A;  4FKY A;  3GPA A;  5BXI A;  1WKL A;  4W98 A;  2DY9 A;  3EVO A;  1NHK L;  1XQI A;  3FCW A;  3EVW A;  3VVU A;  3PJ9 A;  3FBF A;  2NCK L;  3FC9 A;  3Q8V A;  3R9L A;  3ETM A;  1PAE X;  3BBB A;  3ZTP A;  1F6T A; 
#chains in the Genus database with same CATH topology
 4WPA A;  4EU0 A;  2OPP A;  2QA1 A;  4LF2 A;  4YDX A;  4ZVE A;  4DR2 F;  1K1S A;  2Y9H A;  3P4U B;  1U02 A;  1QTN B;  5K14 A;  5KFM A;  3KK3 B;  4RBV A;  1KOO A;  2Y3Y A;  1T03 A;  3IWL A;  2IVF B;  2CJB A;  3ET6 A;  5G0R A;  3IO1 A;  1KN6 A;  2ZHO A;  4ED7 A;  6FDR A;  1JKH B;  3BSN A;  1RBO B;  2UUB F;  3PHE A;  2UP1 A;  2D3U A;  3LP1 B;  2XY7 A;  4WFY A;  1B4S A;  4OYB A;  5HP1 A;  3DC2 A;  3ILL A;  3A8K A;  4BWM A;  4GKK F;  5DJB A;  4N76 A;  4PQU A;  1L3K A;  4CTA A;  1KBR A;  5DM6 Q;  2MLZ A;  1FTC A;  1EIY B;  3TA0 A;  4ERD A;  1HI0 P;  1RWN B;  4Z7Y A;  3QSI A;  3CUN A;  1IQZ A;  1X5O A;  3KLE A;  1HMV A;  3D67 A;  3MAA B;  2FQQ B;  2PDA A;  2HHU A;  1FDB A;  2R7V A;  2YNG B;  1UMJ A;  4C4W A;  1S1T A;  3I0R A;  1R8H A;  2NZ4 A;  1V6H A;  2IA6 A;  5KFJ A;  1UVK A;  4TQR A;  1W26 A;  3ZNU A;  2BMB A;  1ZM4 A;  4LF5 F;  3EIC A;  1TR0 A;  4QWB A;  4DSK A;  2V8G A;  2RDI A;  4X84 A;  1MU2 A;  2N7C A;  1UEK A;  2E7W A;  3RBZ A;  1FK9 A;  2LA6 A;  1RAJ A;  4NLS A;  4F4Z A;  2Z4P A;  2DRA A;  2GML A;  3IA0 A;  3PCO B;  3W9H A;  2XZT B;  2MSS A;  1VRQ C;  1NSP A;  1H38 A;  1R6V A;  3NS6 A;  1DBD A;  2RF2 A;  1UFL A;  1N0U A;  2BAN A;  2DHS A;  4DR6 F;  5ADZ A;  1MW7 A;  1V5I B;  2OJ3 A;  2UU9 F;  1HR0 F;  4LF8 F;  7FD1 A;  2RU9 A;  3CJ2 A;  3R9L A;  3TAQ A;  2G4B A;  4P2X A;  4TY8 B;  3IGN A;  3UPF A;  1NRK A;  4YN3 B;  1TKX B;  2XCA A;  1LV5 A;  3GFZ A;  5L1J A;  2BJ3 A;  4U67 Q;  4DR7 J;  3H7H B;  1Q5Y A;  1A7G E;  2WB4 A;  5A0Y A;  3E51 A;  1WSR A;  3OUY B;  3THP A;  3LW5 C;  4WP3 A;  1N5V A;  3NXZ A;  3UW1 A;  3LAK A;  5L46 A;  4I7F B;  3HDS A;  5D4O A;  5F8G A;  1FFG B;  2OD6 A;  1YWX A;  5DG9 A;  3POT A;  4IG0 A;  3G82 B;  1ZA1 B;  2JLG A;  3KHH A;  4RW7 A;  1U25 A;  2RHQ B;  1RTJ B;  4KHP F;  2ZH5 A;  3UVJ A;  1SL1 A;  1VMB A;  1VGY A;  3QRQ A;  5D6G A;  1VQ9 S;  2UVR A;  4A8X A;  2LXI A;  1PYO B;  2V5H G;  4ZIW A;  1Y10 A;  5C42 A;  4UOF A;  2KVQ E;  2HMI A;  1FKP A;  1GXT A;  1TUW A;  2PMH A;  3ITH B;  2ACY A;  2Z2L A;  4FF4 A;  1DFD A;  2HSE B;  1Z2Z A;  1FDD A;  4DSE A;  2BKP A;  4IO1 A;  2H4W B;  3VQT A;  3HT3 A;  1HPZ B;  2NRE A;  4H4K C;  3OR2 B;  5E3R A;  1BQM A;  4PXB A;  1F0X A;  4QWD A;  4ZVP B;  5HQ8 A;  3C3L A;  2VIH A;  5E41 A;  3M6V A;  4ZCK A;  3BGF A;  2UVW A;  4IYQ A;  4AXJ A;  2G2Y A;  4U7U K;  2W25 A;  4U9R A;  3SFU A;  3C66 A;  5KFH A;  3MM7 A;  4JI7 F;  1LFW A;  5D3G A;  1RTD A;  2ZJP Q;  4J9V A;  2XLI A;  5CQG A;  1TMJ A;  2GS8 A;  4LF9 J;  5BR8 F;  2OTL S;  5LMN J;  3C19 A;  1FKO A;  3TQ1 A;  3MR3 A;  2W7A A;  4N41 A;  3DLK B;  3QIP B;  1H2V Z;  3KLG B;  3FRY A;  2HHP A;  4AD6 A;  3OXF A;  1UP1 A;  2WK4 A;  2Z58 B;  1WTF A;  2CQC A;  4ZN3 A;  4HKQ A;  2XMV A;  4MKA A;  5HBM B;  4LBP A;  1HNZ F;  5BJR A;  2KRB A;  2KFY A;  1S1W B;  4NZ6 A;  3Q8V A;  1PAE X;  3O2I A;  3PX0 A;  2XZD B;  2OSR A;  2VFR A;  2H1Y A;  1P9Q C;  2IPO B;  4ZLL A;  2P9E A;  1GQE A;  3QYY A;  1HLW A;  4ELV A;  3NGT A;  1BWE A;  2RKI B;  1BC6 A;  1TL5 A;  4ZOS A;  5EX3 A;  3M2U B;  1TZ0 A;  4ZS6 A;  4JP8 A;  3RTV A;  5LJ3 Y;  4WTO B;  2NS1 B;  4ECV A;  1CLF A;  4NYP A;  3DRY A;  3AHP A;  1WHV A;  5IC6 B;  1URR A;  1WUU A;  3C6U A;  4DWI A;  3UR3 C;  5F9L A;  3L09 A;  3KHL A;  2GVD A;  2ALZ A;  3HVT A;  3PRD A;  3UD3 P;  3M6U A;  4DLE A;  4DR3 J;  3NEK A;  2FHO B;  2W2O P;  4CT9 A;  1RKJ A;  2A2D A;  2ZOG A;  6AT1 B;  1VBY A;  1G1X A;  1WC4 A;  2HQG A;  3BO4 A;  4X64 J;  1SQG A;  1KLM A;  3HKW A;  1U6B A;  3A8E A;  1NK8 A;  1T05 A;  3C6T B;  2EFV A;  2WSC C;  2MQQ A;  3UD4 P;  4G1Q B;  2RUS A;  4DR4 J;  2CPX A;  2QMU B;  2EC0 A;  2IC3 B;  3PNI A;  3IN5 A;  2OLW A;  1MWZ A;  3CJR A;  3CCT A;  2JNJ A;  2JVR A;  4P72 A;  4KGV B;  3T9Z A;  1WOO A;  2Z2M A;  4QR2 A;  1KOH A;  2VPX B;  1R3N A;  4V1A k;  3PYG A;  2RB7 A;  3V6J A;  3DRS A;  1X4B A;  2MQO A;  1VQY A;  3QSY B;  2HFU A;  4JI2 J;  2YWW A;  3BQ0 A;  2ZJQ Q;  3P5T L;  2X1B A;  4WFB Q;  4NL5 A;  4PQA A;  1WG5 A;  3M8R A;  5HLF B;  3PYE A;  2JEF A;  2PA8 D;  3M8Z A;  4AL6 A;  3T5K A;  3BQ1 A;  4ZCL A;  3Q8U A;  1IKW A;  3FUY A;  3FK4 A;  2DGO A;  4RU9 A;  2XWX A;  1P27 B;  3CO0 P;  3N5F A;  3KJF B;  4I6A A;  1N36 J;  3JSM A;  2DNH A;  2EFN A;  4B3O A;  3LP0 A;  3AAW B;  2IRY A;  1FI4 A;  3MMC B;  4K5R A;  1SL2 A;  4P2M A;  5F8H A;  4NI2 A;  1HNX J;  2WVF A;  3JSY A;  2OGU A;  5ETM A;  4LRB A;  3JTN A;  5J2P B;  3UCZ P;  3W64 A;  3MWB A;  3VAF A;  2HLU A;  1JLQ A;  2P9G A;  1BLU A;  1P1L A;  4OYO A;  4H4O A;  3CCR S;  1F2H A;  4LSN A;  3R97 A;  4ECX A;  3MPY A;  1CUL B;  2ZH2 A;  3PYF A;  3V6H A;  1RWU A;  2OEJ A;  4FS1 A;  1JIH A;  1UZH A;  2EFG A;  1F3F A;  1WEL A;  3EPI A;  3QAT A;  2ZH6 A;  2O67 A;  2DGU A;  2LDI A;  2PSZ A;  4AYB D;  3SQO P;  3BO3 A;  2HWI A;  2UXB J;  3NY0 A;  1TL4 A;  1N88 A;  3R5G A;  2ZDP A;  1QAX A;  3DOK A;  5F0W A;  1J5O B;  2JVO A;  2VD3 A;  1F9E B;  3LQV A;  4OZ0 A;  1B99 A;  5GAE U;  3Q2T C;  3MUR P;  3N4W A;  1S72 S;  2KDO A;  1VQ5 S;  1U4B A;  1JX4 A;  4B3M F;  2B4O A;  4DF8 A;  3CJT A;  2DEI A;  3B4D A;  4L72 B;  1TL7 B;  1ULR A;  4LMZ A;  2ZM6 F;  2HW3 A;  4B02 A;  1SKW A;  3US5 A;  1NSK L;  4NWB A;  4TNO A;  4QPT A;  4AQY J;  1EET B;  4P9S A;  1DAX A;  4JBC A;  2HBR B;  4DS4 A;  4RNO A;  4DV5 F;  2DVI A;  5F3Z A;  1FRM A;  3GFX A;  2AQ4 A;  3UWT A;  1Q79 A;  2NSC A;  4ZJO A;  1J2V A;  3IR6 B;  2JZ5 A;  3KLI B;  2IJR A;  2WVD A;  5IC4 B;  3M9M B;  1S4F A;  2LEP A;  2E7V A;  2J76 E;  2F8H A;  2W4P A;  2RJZ A;  4P52 A;  5FDL B;  3PRB A;  2V8P A;  1JJ4 A;  1N32 F;  4GMK A;  5DM7 Q;  1QSY A;  1PGZ A;  2CRL A;  2CZ4 A;  2HVD A;  2XS5 A;  1HAR A;  2JX2 A;  3EZ5 A;  2BM1 A;  4WTY A;  1UPP A;  1FJ7 A;  4OQJ A;  4DOZ A;  3I0S B;  1WJ9 A;  3CD5 A;  3LWM A;  2AMC B;  2J0W A;  1CQN A;  4I67 A;  4U7C A;  3EVW A;  1AT1 B;  3MAH A;  3GTY X;  3I5C A;  3O44 A;  1OIA A;  3K5L A;  5EUH A;  1CBK A;  4C98 A;  3V2U C;  2VF3 A;  4CRJ A;  2R7U A;  4EK2 A;  3C16 A;  3R7N B;  1S6Q A;  4F04 B;  2UUA F;  1CJT A;  1Q81 T;  5ETR A;  3BYR A;  5IT9 U;  3AQP A;  2P6S A;  1V5V A;  5JVH Q;  4CH0 S;  2PD1 A;  4L74 A;  2IIH A;  5KFX A;  2QC3 A;  2DGS A;  4J9R A;  4O3R A;  3OHB A;  4DV3 J;  2EVZ A;  3KK2 A;  2IAJ B;  2EC2 A;  1SIZ A;  3O8W A;  2G1D A;  2G0I A;  2WSE C;  4LFC J;  1M5H A;  2E1P A;  2R42 A;  2YNF B;  2XHW A;  4CLS A;  2D69 A;  4KH0 B;  3DLJ A;  1GH8 A;  2A6M A;  3TP2 A;  3WQP A;  2X1A A;  1SVD A;  2HHS A;  4W92 B;  1VHF A;  5KT3 A;  4L3N A;  3ETM A;  2W9C B;  2A2C A;  1AW0 A;  2AU0 A;  3OL6 A;  3KKF A;  3FSY A;  1NK9 A;  2M52 A;  3MR7 A;  2CNK B;  3CF5 Q;  4U8Y A;  4L3K A;  1K9M T;  2GQ2 A;  5KFU A;  3OHA A;  2V6A A;  4WK3 A;  4LFB F;  2XWY A;  3E8O A;  2P8I A;  2DNP A;  2VON A;  2NLW A;  1I3O B;  3QGI A;  3L3C A;  1QD1 A;  1QJH A;  4KE5 A;  3H40 A;  1VK3 A;  3FSI A;  2XMT A;  3OFG A;  1U1K A;  4YY3 J;  1Z2L A;  3V81 A;  1BWV A;  1NB2 A;  2E5L F;  2VKR A;  2BJ7 A;  3W8P A;  4OHV A;  3V6D A;  4HT5 A;  1QSL A;  1QE1 B;  2CZ9 A;  5IWA F;  1SJ3 P;  1F5B A;  4EZ6 A;  1JQG A;  3TZW A;  3EPG A;  1T9Y A;  2AJ0 A;  5HAT A;  2VQE J;  2PI5 A;  4A47 A;  5ETL A;  1X5P A;  4DSJ A;  2DXF A;  1GMW D;  2CJY B;  2LVW A;  1FRL A;  1XMO F;  4IR1 A;  4OMF G;  2HGN A;  1X31 C;  2EXU A;  3KK3 A;  1RP5 A;  4I56 A;  1S77 D;  3BO2 A;  1JWW A;  1NLK L;  5M2R A;  1MWY A;  4UY8 5;  2DH8 A;  4CYU B;  2GJI A;  4DUY J;  4C6A A;  1GEH A;  3A3O B;  4K5S A;  1FT8 A;  2OI2 A;  5E0O A;  2V63 A;  1JKH A;  2HFS A;  3IBC B;  3LP1 A;  2YNI B;  2DB1 A;  2PE8 A;  3IM9 A;  2KT5 A;  2E66 A;  1C2P A;  4O0N A;  2VB6 A;  4BBY A;  1HYS B;  4C0O C;  4UZB A;  2YX1 A;  2Q66 A;  4I1T A;  2WON B;  3NBP B;  2XTJ P;  4Y34 A;  1GXL A;  4K4V A;  3CMQ A;  3AOD A;  4WK1 A;  4JI3 J;  3ILI A;  1VC6 A;  4DUZ J;  4DPO A;  1DQ9 A;  4AXI A;  2K2P A;  1TKT B;  1QUV A;  3CMA S;  2DHA A;  4AL7 A;  1KRP A;  3I9Z A;  3MAA A;  1SKU B;  5KFW A;  3GCX P;  2R7Q A;  4GRS A;  2ZH8 A;  2YNG A;  1LWC B;  3D3C J;  1XBW A;  2V8V A;  2YKO A;  3PJW A;  4KGZ B;  1AUD A;  3B6B A;  4BS2 A;  3DCA A;  3IGV A;  1MG7 A;  3Q24 A;  4NLD A;  5HO4 A;  1C0T B;  1NPR A;  2KYX A;  1PCA A;  2MQL A;  2HQ3 A;  4IG3 B;  1WEX A;  2JRS A;  3GV7 B;  2QN6 B;  3NP5 A;  5T7L A;  5F8I A;  2ZH3 A;  5GAG I;  1G4C A;  1GFW B;  2CJ9 A;  1Q8K A;  4Y2M A;  1Q4R A;  2DIT A;  3P8B B;  1ROF A;  3KNA A;  4CLT A;  4IOA Q;  4RX6 A;  3N9U C;  2ILY A;  1NEE A;  4QJV A;  5KFI A;  2GC8 A;  3QGP A;  2DNR A;  3AOB A;  4DZ6 A;  4X4Q A;  2C3O A;  3RRK A;  2AKW B;  1U6F A;  2RS2 A;  2IY5 B;  1L5U A;  2CQD A;  2FJB B;  3HD2 A;  2ILZ A;  4DV7 J;  4K4W A;  1R0A B;  4MAK A;  4ES3 A;  1TVR B;  4OHX A;  4O3Q A;  4NA2 A;  2VOP A;  2D7S A;  4TY8 A;  2HHH J;  2W7O A;  1TKX A;  3WC0 A;  5AT1 B;  1HBO B;  3G2X A;  2W9A A;  4K8R A;  3DFE A;  2CJX B;  3N6M A;  3M2R B;  1Z1Z A;  2BM0 A;  3I96 A;  1MSW D;  3H90 A;  3OUY A;  4F4A A;  2OEK A;  1ZTW A;  1N34 J;  2EK1 A;  5M2U A;  4I7F A;  3D1O A;  1IKV B;  4X65 J;  1NCL A;  1YK9 A;  2KB2 A;  3T1Y J;  2QYC A;  3G82 A;  1EZZ B;  4OJ3 A;  2DRD A;  2LA4 A;  3PM9 A;  1OS5 A;  2RVJ A;  4YP3 A;  3K2Y A;  4J9N A;  1RTJ A;  3P6Y C;  1ZAW A;  3W8G A;  1NME B;  4JB8 B;  2G13 A;  4O4R A;  1M1H A;  1YJ9 S;  4ICL B;  3GZ7 A;  4ECS A;  3CD0 A;  2U1A A;  1I94 J;  4DR7 F;  1B64 A;  3EM1 A;  4W90 B;  1GAO A;  2ADC A;  3PDN A;  2DHH A;  3V4I B;  4ZVG A;  3P5B P;  5IT0 A;  5GAD U;  3RW6 A;  3ITH A;  5BXI A;  4IDK B;  1Y5N B;  4KFB B;  5GAH U;  3SZ2 A;  4I68 A;  3S01 A;  3KUE A;  5K5M A;  1HPZ A;  3HUL A;  3MEC B;  2R8I A;  3LPY A;  5H9F K;  3OR2 A;  1H0H B;  1WF1 A;  1NK5 A;  4I69 A;  4ILM A;  1XMB A;  5J1P A;  4NEY A;  4K4X A;  3P45 B;  3PX4 A;  1P9Y A;  1OSC A;  5A76 A;  2Y1R I;  2GIF A;  5T41 A;  4J9O A;  2MPU A;  1SC4 B;  2CPE A;  2RDD A;  3JQJ A;  4DL4 A;  3HZG A;  1RT4 A;  4QOT A;  1KVJ A;  5DLF A;  4QIE A;  2FD2 A;  2V50 A;  3F73 A;  1MMD A;  3H4D A;  4B3R J;  4B9U A;  3LGN A;  4FXD A;  4GC6 A;  3EXC X;  3DLK A;  3QIP A;  3KLG A;  4JV5 J;  1T11 A;  4LBI A;  1M90 T;  4P71 A;  5DS7 A;  1U09 A;  1KS2 A;  1LOU A;  2B6A B;  1A0O B;  5HBM A;  1PJ5 A;  4CLZ A;  1S1W A;  3VHQ A;  2O5D A;  2EI5 A;  3D68 A;  4MFB B;  1RI7 A;  1ZET A;  2XI2 A;  3CTR A;  4DV6 J;  4IOB A;  4ECQ A;  1FRJ A;  2CQH A;  3HKZ D;  4LF9 F;  1RLC L;  2DNL A;  3GCW P;  2QYG A;  5LMN F;  2JJ4 D;  1RAB B;  4OYM A;  2XMJ A;  3AOC A;  4UZC A;  1UZD A;  1GTH A;  2RKI A;  2WTF A;  1OY9 A;  3IRX B;  3M2U A;  3OT9 A;  1SC3 B;  2CYY A;  2WOM B;  1UFW A;  3I87 A;  1FX2 A;  2F9D A;  1RHK B;  2BA9 A;  4NLX A;  2CQG A;  2QT7 A;  3CJS A;  4FYX B;  2OPQ B;  5KFR A;  2GIR A;  3H5U A;  2E1C A;  1LWF B;  1FWL A;  3L7U A;  4DQP A;  4JI6 J;  5EHH A;  3PFE A;  4OHY A;  2B4U A;  1RZM A;  1XR6 A;  2YNH B;  4DSF A;  3CUL A;  1WOP A;  2HLT A;  1JB0 C;  2NCK L;  3BPD A;  1IM6 A;  5KFT A;  4ZLJ A;  2FPH X;  2GA7 A;  3C6T A;  3AXM A;  3BF4 A;  4G1Q A;  1QTM A;  1GTE A;  1ZPW X;  1Q8B A;  1R8P A;  2XNQ A;  2IC3 A;  5F41 A;  3IM8 A;  3M7V A;  3RZA A;  1X4E A;  4YUD A;  2AT1 B;  4A8W A;  4TU9 A;  3MAQ A;  4F8R A;  2HKE A;  5KT6 A;  4DR3 F;  3L9Z A;  4FN5 A;  1HQE B;  4NA3 A;  4K4Z A;  2JC1 A;  4X64 F;  5LM7 E;  2YWE A;  3Q8P B;  2CQ0 A;  4X4R A;  2R8H A;  2AW0 A;  1X4C A;  1WI8 A;  4NE9 C;  3I55 S;  5CYJ A;  3DRR B;  4DR4 F;  5B0E A;  1TFY A;  3RB6 A;  4DFP A;  1RAG B;  1JLE B;  4DI6 A;  2BE2 B;  2HZC A;  4CH1 A;  2M2B A;  2BQR A;  1WAC A;  5KG6 A;  4CO3 A;  3MMC A;  4K2J A;  4YB7 A;  3L7O A;  1QAJ A;  2J7U A;  2V8D A;  3M1V B;  4M5I A;  4JI2 F;  5KG3 A;  5DET A;  5J2P A;  4AFF A;  2C22 A;  3AB2 B;  3ISZ A;  1Y3K A;  4FBU A;  4PG5 A;  1SCJ B;  4HTI A;  3G86 A;  1CUL A;  3VAK A;  3PW7 A;  3QPI A;  3CJ8 A;  3QAU A;  3Q83 A;  2VG7 B;  1KWM A;  2HVI A;  2COL A;  2B51 A;  5LL6 d;  1XJW B;  3SMZ A;  1YTY A;  3ENV A;  4FVM A;  1H6K X;  2ZUA A;  3DM2 B;  2QA4 S;  1LK5 A;  2B8P A;  1B7F A;  1FNO A;  1KQS R;  3DDI A;  3NKY A;  4K0K F;  2YVS A;  4QCL A;  4NXM J;  1HNX F;  2D3O R;  4C0H A;  2R2S A;  1J5O A;  4HLB A;  2ZEJ A;  1B7Y B;  2MLY A;  5D15 A;  4R8U B;  2G0J A;  3R7B B;  1YKW A;  4Y0F A;  2LU1 A;  4A8O A;  1N5T A;  3BH7 B;  4JV0 A;  4DDF A;  2W01 A;  4ZN1 A;  3HM9 A;  1TL7 A;  4PWD B;  4FKY A;  4C8M A;  2H9Z A;  5RUB A;  2F4V J;  1SBR A;  3PXG a;  1FKA F;  2J0X A;  4FNH A;  3S6E A;  4WII A;  3QT8 A;  3MZI A;  2BJ1 A;  1EET A;  3M9O B;  2UXB F;  2UUW A;  3HJV A;  4RWW A;  4J90 A;  4F0K A;  2ASL A;  3H59 A;  3H5X A;  3MUM P;  2QMW A;  1B0V A;  4LQ3 A;  3QZ8 A;  1D1U A;  1JLC B;  2M8H A;  2CPJ A;  1JXL A;  3R1H A;  1H7X A;  2HIY A;  4KR0 B;  3NNH A;  3KLI A;  2H5E A;  1NU4 A;  5I3U B;  1FDN A;  2HRT A;  3AD8 C;  4C9D A;  5DG7 A;  4ZP8 A;  4QW9 A;  1RHJ B;  1A6L A;  4RKU C;  5FDL A;  4NZ7 A;  1RT5 B;  1YRT A;  3MR5 A;  3MMJ A;  4AQY F;  4BC9 A;  3GE9 A;  4OJG A;  3MOZ A;  3K59 A;  1X0P A;  4DX6 A;  2DR8 A;  1HQ2 A;  1VBX A;  3MHY A;  2RS8 A;  1K47 A;  2H4Y B;  4PAB A;  3G8T A;  3GJT B;  1F5A A;  3I0S A;  2Y1I A;  1S6O A;  2IDL A;  3I82 A;  5E3A A;  1HW9 A;  1ZM2 A;  3RRG A;  1RU2 A;  3D7S B;  5HAO A;  5IV4 A;  3AJD A;  4DPT A;  2J8S A;  2V4R A;  2HS3 A;  3NOC A;  4IUF A;  4OZJ A;  2J6S A;  1C4C A;  4MIB A;  2J0S D;  1IVZ A;  3H2V E;  2B0G A;  2KRR A;  4F26 A;  3BGL A;  2GCF A;  4CQ1 A;  2DEJ A;  3HHK A;  2CNL B;  4ILL A;  2CDR B;  5KFV A;  3FBE A;  3DXS X;  5CH7 B;  4J9Q A;  2CJA A;  2FJD B;  2ZVS A;  2D3Z A;  1H3D A;  4DUT A;  2O01 C;  2IAJ A;  2LKZ A;  2ZC4 A;  1JLB B;  1SJ1 A;  2OEM A;  2W24 A;  3AT1 B;  2YPZ A;  1UVN A;  4K59 A;  2YNF A;  2QA2 A;  2MY7 A;  4DV2 J;  2LEA A;  4I64 A;  2E5I A;  3CED A;  4P73 A;  1P1T A;  2XSF A;  3R5B A;  1OSD A;  2GQQ A;  3PFO A;  1TP7 A;  1RSC A;  1LW2 B;  1Q16 B;  2HHV A;  1HNW J;  2OUG A;  2F9J A;  3WBZ A;  1ACM B;  2KJV A;  2XGQ A;  4NML A;  2W9C A;  1FJG F;  3RB3 A;  4HH1 A;  1S12 A;  1V9O A;  4DV3 F;  1K8A T;  3G87 A;  3N0V A;  3MEE B;  1IM4 A;  3J7Y I;  4DU7 A;  4LFC F;  1HNI B;  1FJC A;  3KK1 B;  3BBC A;  2J0Q D;  4KPY A;  3RB0 A;  2BAB A;  3UCU P;  4YB1 P;  5B0A A;  2O1P A;  3K5M A;  2GMH A;  2DGT A;  1CSJ A;  2PEB A;  4KV8 B;  3QJL A;  2XY5 A;  1KON A;  5FLX Y;  4ED2 A;  3BBF A;  1W25 A;  2ACM A;  3MTJ A;  1HWJ A;  1EKS A;  1QE1 A;  4MK8 A;  4JUZ A;  3CB4 A;  1XR5 A;  1O5J A;  2HK3 A;  2HYI B;  5GVQ A;  4AND A;  3GU0 A;  2Q43 A;  2F40 A;  3G8Q A;  1RWX B;  4O44 B;  2RRN A;  5K8P A;  2GW8 A;  1GMU A;  4HI1 A;  3KJV A;  4RJV A;  4PAA A;  3EDR B;  1UTA A;  4ZP9 A;  1WC0 A;  2FYX A;  2EKY A;  2N3O A;  4YY3 F;  5B0B A;  1VQL S;  3KLH B;  4F2S A;  4X4P A;  4OX8 A;  3D2W A;  3G96 A;  3GIR A;  2VHG A;  5U47 A;  2E5J A;  3ZFV A;  3KMS A;  4CO0 A;  2KKH A;  4DXL A;  2XC9 A;  2APO A;  1FEH A;  4USV A;  1BGX T;  1UW4 A;  1ZS6 A;  2HFV A;  4LFA F;  5A8W B;  2DNG A;  2F1F A;  4X66 J;  2JL9 A;  4DL3 A;  3T5H A;  1UJ6 A;  2ZUG A;  4CYU A;  2PII A;  1GMW A;  5LT5 A;  3HVR A;  5CCL A;  2VQE F;  4UT4 A;  3KG0 A;  2CWK A;  4ED8 A;  2P5V A;  4DFK A;  1RAI B;  2YNI A;  1WC3 A;  3CJ4 A;  4USK A;  1U2R A;  4W4M A;  1HYS A;  4NLU A;  3CCE S;  4NLW A;  2WON A;  4DV0 J;  3NBP A;  3G6Y A;  4ANE A;  5B7W A;  2ZBI A;  5EX0 A;  5ETO A;  3PVX A;  1XQI A;  2CJK A;  1TKT A;  2FIU A;  3TVY A;  4DUY F;  1JXE A;  4RLE A;  3DLL Q;  1LWC A;  3TR5 A;  3IG1 B;  5CD4 H;  1C0T A;  5ITH A;  2BZ2 A;  3I31 A;  3J81 Y;  5DZ7 A;  5LMU J;  2OO4 A;  4IG3 A;  3J7Z 5;  3G6V A;  9RUB A;  2GO8 A;  1IR0 A;  2AIR B;  3FDS A;  2FLL A;  2JC0 A;  1GT8 A;  1E6V B;  4DUZ F;  2P9C A;  1KEK A;  2XG8 A;  1FNM A;  3Q2S C;  1NKB A;  4KKO B;  3H5Y A;  5A6P A;  3W9I A;  3J7Z T;  4RNM A;  1U6Z A;  1FWP A;  4MK9 A;  4OJH A;  1R0A A;  1Q7Y T;  1S48 A;  1TVR A;  4DN9 A;  2I38 A;  3CE8 A;  2L9W A;  3R2C J;  2XQC A;  2WB1 D;  3DLE B;  4KAI A;  1VBK A;  4CI0 B;  5D0G A;  1HBO A;  2W2M P;  4GO5 X;  1U1O A;  3M6X A;  4RL1 A;  1D8Z A;  3TQE A;  1FRH A;  4DL6 A;  7AT1 B;  2OIH A;  2QL5 B;  1VYA A;  4DL7 A;  5BYR A;  5AJ3 J;  3KHG A;  2XS2 A;  1ZBT A;  3HI9 A;  1YI2 S;  2BEF A;  1IKV A;  4ZA1 A;  2K7K A;  3IMQ J;  4DV7 F;  2R7T A;  1C4A A;  2U2F A;  2C2K B;  2W1B A;  2ZOF A;  5DZ6 A;  1YHQ S;  3R5A A;  4HR2 A;  4C3M A;  2I1R A;  1KVK A;  4F4Y A;  1HBM B;  1T95 A;  3OTD A;  4ICL A;  5KT5 A;  4IH7 A;  4PZV A;  3GYN A;  4WE1 B;  2AJF E;  4C11 B;  3OBI A;  4N77 A;  4A8S A;  2VDI A;  3V4I A;  2EEY A;  3KDN A;  2AZ3 A;  1IUJ A;  4FZV A;  4IDK A;  1N34 F;  4ID8 A;  4KFB A;  1X5S A;  4X65 F;  3MEC A;  2B4V A;  4PRF A;  3T1Y F;  5DLG A;  3CJQ A;  5E5N A;  4ZKA A;  1OQ3 A;  3CCU S;  3VV2 B;  3UN3 A;  1WOR A;  1JK9 B;  4EYI B;  4RPF A;  5ETK A;  1I94 F;  2A3J A;  5L38 A;  1XEZ A;  3OW2 R;  2CUY A;  1DLO B;  5HJX A;  2R4F A;  1JMT A;  3L4B C;  1VR6 A;  1IBK J;  4YR3 A;  5J1E B;  2BRK A;  1U1N A;  2NR0 A;  2LU2 A;  5JUM A;  3ADA C;  3TEH B;  2VJV A;  2XYG B;  2AD9 A;  1UJ5 A;  4TU8 A;  1NM2 A;  5DQH A;  4A46 A;  4NLT A;  2HVZ A;  1N33 J;  1HI1 A;  5B09 A;  2VC1 A;  2F63 A;  3H42 A;  2IM3 A;  3BGU A;  1OY6 A;  2B6A A;  1RYR A;  1HQU B;  1I1G A;  4KRW A;  4MFB A;  4H54 A;  3IRW P;  3QGH A;  4ZCM A;  4LF6 J;  1IBC B;  3TX0 A;  4G6V B;  1F3V A;  2VFU A;  1XN9 A;  4G65 A;  1X9M A;  3R8Y A;  3V6K A;  3R27 A;  5DG8 A;  1Q78 A;  2GO9 A;  2BBE A;  4B3R F;  2AYB A;  3W7B A;  1I51 B;  3IS9 B;  4JV5 F;  4ANC A;  3IRX A;  1XWL A;  1IBL J;  4YR0 A;  2MZQ A;  5IS2 A;  3BJY A;  3QRP A;  3S7R A;  2WOM A;  3OFH A;  4X62 J;  3MM9 A;  2OPQ A;  4OHW A;  3HX9 A;  3NCP A;  1YIT S;  4Y2A A;  4TXS A;  3LH2 S;  1OPI A;  5H9E J;  4DN0 A;  4DV6 F;  3MFH A;  1LWF A;  4OL8 A;  4C8Z A;  1MML A;  3W66 A;  4RNH A;  5DQG A;  1YQH A;  3TAN A;  4H4K A;  5ETN A;  5FJ4 A;  2RIL A;  5ETS A;  1OJ4 A;  4F4K A;  1LXN A;  2FZG B;  2X51 A;  1U24 A;  1FVS A;  2YNH A;  2V9W A;  4GO7 X;  2IYI A;  1O6X A;  2MLX A;  1IWA A;  2PC6 A;  3SFG A;  4B9T A;  2YH1 A;  1YG0 A;  3IC1 A;  4LF4 J;  4ED1 A;  4B9V A;  1AZS B;  1T8E A;  4NYZ A;  3JXO A;  1BXN A;  2XYH B;  3Q8R B;  2R2T A;  3H5S A;  4WFX A;  3MD3 A;  2ZDO A;  4JI6 F;  4NCG B;  5A2Q Y;  3PW5 A;  5KT7 A;  2G2O A;  2ASJ A;  1KSP A;  1XR7 A;  1HQE A;  2EG2 A;  3MMA A;  4YQW A;  3KJN B;  1LQ9 A;  2LMI A;  4K4U A;  5L1K A;  1YRU A;  3LP2 B;  4R0J A;  3FEY B;  4RWX A;  2LLZ A;  5B0F A;  5JJB A;  2CQI A;  4DG1 B;  1LW0 B;  2F4F A;  1H2U X;  2KL8 A;  3DRR A;  4YS2 A;  2O3D A;  2XO6 A;  4PXE A;  4A8M P;  5D0E A;  3MM6 B;  5AXL A;  1Q5V A;  5E3P A;  1JLE A;  2EPI A;  4R5P B;  2BE2 A;  5HQL A;  3EGV A;  2KXH A;  4X4S A;  3MPD A;  2KZZ A;  2FLN A;  3DLB A;  2ASY A;  4UTG A;  2QTW A;  3FEZ A;  4E98 A;  3CCS S;  3FQK A;  3MR2 A;  1TK5 A;  3SI8 A;  4LRE A;  3M1V A;  4PR6 A;  1VBZ A;  3CSK A;  1REV B;  3VZH A;  4XK8 C;  4Q43 A;  2D74 B;  1UJ4 A;  2QL7 B;  1TAQ A;  1GX6 A;  5F9N A;  1T9U A;  3JS9 A;  2R7R A;  2VG7 A;  1FEE A;  3IWN C;  4DX5 A;  4KGX B;  5K9F A;  1CJU B;  1N56 A;  3HVA A;  3LPE A;  3DM2 A;  3GSD A;  5KFF A;  5JMN A;  3BKF A;  3A1Y G;  2DPJ A;  2XZW A;  3NMR A;  1WC5 A;  1WHW A;  4NEZ A;  4U8V A;  3GR1 A;  3QWP A;  3M2V B;  4P2S A;  2CFX A;  2CQ1 A;  5HI7 A;  2V67 A;  3DLG B;  4DL0 C;  3AY0 A;  1KD1 T;  3QAE A;  1BHN A;  4YR2 A;  4R8U A;  5GAE I;  4XO0 A;  3DN9 A;  4CM2 A;  3ZTO A;  4RO0 A;  4JI0 J;  4P7T A;  4PWD A;  1TUV A;  3VAJ A;  5A8R B;  3TRG A;  1TK8 A;  4HHH A;  5KOX A;  1U48 A;  2MQN A;  2R9L A;  1CPZ A;  4QIW D;  2OTJ S;  4NXM F;  2IRU A;  1MRO A;  2BQU A;  1S49 A;  2BE9 B;  2VPY B;  4PXC A;  4QYR A;  1ITP A;  1JLC A;  3MPU B;  2DNY A;  5L8R C;  4F0M A;  4DFM A;  1SUQ A;  4A8Q A;  3KLF B;  4ZVU B;  2JOQ A;  1FHT A;  2R3V A;  4B08 A;  1NUE A;  5I3U A;  4MKV A;  3OLA A;  2F4V F;  2QMX A;  1YJV A;  2YH0 A;  1UWB B;  4NLQ A;  3TAM B;  5H1S V;  1RT5 A;  1S0N A;  3TA2 A;  2MKH A;  1PYT A;  2R7O A;  4ZVR B;  1WDT A;  3FMW A;  4OFZ A;  2EK6 A;  2MB0 B;  1YRX A;  4ED6 A;  3IBW A;  1VK8 A;  4HHU A;  4NLO A;  1NJX A;  2K3K A;  3CCJ S;  3MR6 A;  2ZHB A;  2W7P A;  4ZHR B;  4YDD B;  1JLA B;  3T3F A;  1R0B G;  1NHU A;  3FQL A;  3JTO A;  2XSJ B;  3BQ2 A;  5LSL A;  5KFG A;  2FTR A;  1TEL A;  4WJB A;  1RAD B;  2M9K A;  4WIQ A;  3CC2 S;  2D1C A;  4WKY A;  4FPI A;  2NXJ A;  2FVC A;  2NXE A;  3OFE A;  1Y11 A;  4CIO A;  2FVR A;  3J81 j;  3EUN A;  3I4H X;  2HBZ B;  2C42 A;  1RLD A;  3GFY A;  4BDP A;  1NHV A;  2UUT A;  3KUG A;  1JLB A;  4DR6 J;  5AXM A;  2BOP A;  4TN2 A;  5KFC A;  2QFJ A;  1S0M A;  4C3L A;  1KQF B;  3OR1 B;  4DLG A;  1F9H A;  4KHM A;  3T1A A;  2W9B B;  2HNZ B;  1PIL A;  2D9P A;  4QYZ J;  1NDL A;  2DIV A;  8AT1 B;  5ETV A;  3CC7 S;  2C2Z B;  1RK8 A;  2V94 A;  5L9X A;  1KC8 T;  3LO3 A;  3GSI A;  1LW2 A;  3GV8 B;  4USH A;  3HSJ A;  3NCR A;  3MM8 B;  1VQS A;  1P8G A;  1CQM A;  2EFQ A;  1RDR A;  3NNC A;  3BN7 A;  4BHQ A;  1PC4 A;  1YX2 A;  3MEE A;  2YBV A;  4USU A;  5HN0 A;  4RW9 B;  1URN A;  2MY8 A;  1HNI A;  1NK0 A;  2X3G A;  4IRK A;  4RR5 A;  3KK1 A;  4DV2 F;  3WZ0 A;  5IXU A;  1LNQ A;  2K06 A;  5HMW A;  1SH0 A;  3CD7 A;  4O3S A;  3KFW X;  1NND A;  2E9R X;  2VG5 B;  2JLE A;  4BC7 A;  2RT3 A;  4DZD A;  3I5B A;  1NH8 A;  3P49 B;  4RUB A;  3MXH P;  2FHJ D;  2C2N A;  4RW8 B;  4KV8 A;  2NUH A;  4DEZ A;  5KTQ A;  5KAK A;  1YBU A;  4FVC A;  2QLJ B;  3CW2 C;  3OL8 A;  1RGV A;  3KDO A;  3R6G B;  3BS9 A;  3HK2 A;  1YDL A;  2PO4 A;  1N5S A;  2Z8Q A;  5A8K B;  3OTO J;  3HXM A;  4DFJ A;  4EEY A;  4I6Y A;  3H2L A;  3UFC X;  3MGJ A;  3D4J A;  2FC8 A;  1X9W A;  4N8N A;  4ZVO B;  4O44 A;  3DU6 A;  1D9F A;  2RD5 C;  4J9P A;  1J5E J;  3K0J A;  3VQS A;  3EWG A;  4QR1 A;  1WOS A;  3NRB A;  1B70 B;  3HFZ B;  4CNZ A;  1M5P C;  3KLH A;  4RZR A;  2MZS A;  2A1B A;  3Q86 A;  5E3Q A;  1X4D A;  3A13 A;  2VG6 B;  3PRV A;  5K8N A;  1LWE B;  3DGP B;  1UVJ A;  4V19 X;  1JJ2 R;  3DLH A;  5HVH A;  4K50 A;  3EGN A;  5A8W A;  2YWK A;  2C1E B;  4D3H A;  2HS4 A;  4M5H A;  1S6U A;  2VKZ G;  2NXU A;  4B9M A;  4R0E A;  1ZM3 A;  4XDC A;  1Q86 T;  1FE4 A;  2BX6 A;  1SI9 A;  3RB4 A;  2CQ2 A;  4BCA A;  1FRK A;  1WEZ A;  3GIK A;  1CS4 B;  3MD1 A;  3J7A N;  4LF1 A;  2QL9 B;  3DRX A;  3KXD A;  3HFV A;  2L9D A;  4QR0 A;  4JV2 A;  1Q53 A;  3VCD A;  2LEB A;  2BVZ A;  1OY8 A;  1SJR A;  2LQ5 A;  2LQJ A;  3CO9 A;  2M7S A;  1OO0 B;  4CP5 A;  5JXS A;  4X66 F;  3PW0 A;  1ZTT A;  3H2U B;  3W61 A;  3DMJ B;  4QBU A;  2I9S A;  3ENW A;  1FFS B;  4JOU A;  1K73 T;  2B5J B;  3IG1 A;  2KO1 A;  4ECR A;  3PKM A;  2CDQ A;  2EW9 A;  3TNV A;  2HPU A;  5B0C A;  1Z4U A;  1FRI A;  3BGO P;  4MTP A;  5EWG A;  1H73 A;  4DV0 F;  3KMQ A;  4RNF A;  4LR7 A;  4OV1 A;  1IR2 A;  2MZR A;  1E6V A;  4QZV B;  1LK7 A;  3QO9 B;  3VVT A;  4HAC B;  4HTJ A;  2FVQ A;  1S9E A;  1KFD A;  1M5V C;  1O8B A;  1D3W A;  4FXW A;  1Y9O A;  3PV8 A;  1FER A;  4KKO A;  4Q8E A;  4HT7 A;  4FBT A;  3NNA A;  5IZH A;  2ADB A;  4FF3 A;  1YSJ A;  2R2U A;  5LMU F;  1JXV A;  2IMW P;  3NGU A;  2JH3 A;  3EVM A;  1N48 A;  2BUN A;  5DDR C;  2CVI A;  3SBM A;  7FDR A;  3DLE A;  4NRU A;  4K4T A;  2I5J B;  4OX9 J;  2QRR A;  4OYI A;  1PYS B;  2FJX A;  2XGP A;  4RBT A;  1DHM A;  2MST A;  4ZJQ A;  1YZ6 A;  4OHZ A;  4ZP7 A;  3PEJ A;  2HHQ A;  2XLJ A;  4USJ C;  2CG4 A;  1NPK A;  2G1H A;  3CXC R;  1VIS A;  2JDJ A;  1BMQ B;  3M32 B;  4GVL A;  3PR4 A;  2QA4 G;  1UVI A;  2AEF A;  3ZZT A;  3TI0 A;  2QV6 A;  1R7I A;  4WYL A;  4KGM A;  1WHY A;  4CCH A;  1ZYQ A;  4U6P A;  1R27 B;  4JI1 J;  2RHS B;  2XB2 D;  2RU3 A;  4G1P A;  1VHI A;  2AZ1 A;  2GHW A;  1HBM A;  2F3J A;  5J2Q A;  3SSQ A;  1UET A;  4ZPW R;  4WE1 A;  4NLY A;  4E2F B;  4OI2 A;  4O0I A;  1WG1 A;  3OFF A;  4C11 A;  3GJQ B;  1S0O A;  2DCU B;  3RG6 A;  5SUH A;  3RAX A;  4ECT A;  5AJ3 F;  4N56 A;  3SCJ E;  2B4P A;  2C3U A;  3AB4 B;  2I0X A;  3RUB L;  3BSA A;  2LP4 A;  3UN2 A;  2MKK A;  4W98 A;  5J2M B;  2P2C B;  2YQ3 A;  4DPW A;  3PO4 A;  2X7I A;  3CIM A;  2B7B B;  2KJW A;  3B78 A;  1V3Z A;  4J91 A;  9ATC B;  3M8P B;  4OX7 A;  1QDU B;  3D5M A;  3CT9 A;  1DLO A;  4M8L A;  3ZZY A;  4HHJ A;  2DNN A;  1RKI A;  2H48 B;  3QT7 A;  1RAF B;  1UPM B;  1Y3J A;  5J1E A;  1SKS A;  2KZM A;  2K3I A;  3OQ2 A;  3H4B A;  3QJP A;  2DTJ A;  5E33 A;  1Q8I A;  3KLV A;  5FLX U;  3HFK A;  2CQ3 A;  3VGU A;  2CNN B;  3RBX A;  2IVY A;  4M5L A;  1Q0N A;  1RAE B;  5HQM A;  3X3U A;  4Y65 A;  4NPO A;  3W5X A;  3FKB A;  3I32 A;  1SJQ A;  4ALZ A;  3UE2 A;  4B3M J;  1HHT P;  1RIS A;  1PC5 A;  3BB5 A;  3W2W B;  1VQ8 S;  5GMK a;  3ZNJ 1;  1DTQ B;  2ZOM A;  2UXC J;  1IBK F;  1HQU A;  1RTI B;  3NG8 A;  4DSI A;  1FES A;  4OZ5 A;  4A4J A;  4YB5 A;  2LEC A;  2HFN A;  4DQQ A;  2G9O A;  3DOM B;  3FBF A;  1C0U B;  4WZQ A;  4J37 A;  4ZLP A;  2QJ3 A;  4BWJ A;  1UVM A;  2OPR B;  3ZZZ A;  2KM8 C;  5JVG Q;  5C5J A;  5CYQ B;  4D3G A;  2AEJ A;  4IOC Q;  3IS9 A;  2W4C A;  1CG2 A;  3EMT A;  3TZY A;  3F56 A;  1N33 F;  3VZI A;  3FGV A;  2YX4 A;  4KO0 B;  2NQP A;  1QVG R;  3CDB A;  4PEO A;  4P2F A;  4C2M A;  2DY1 A;  2B8Q A;  2ZBP A;  5KG5 A;  4ZPT R;  4NCB A;  4LF6 F;  1FD2 A;  3K7R A;  1DQ8 A;  2OFG X;  4XPC A;  1NPP A;  1ZPV A;  1W7W A;  3D0I E;  2D3O 1;  3Q23 A;  5LSR A;  3M8Y A;  4DX8 H;  4KH1 B;  3WDO A;  2P6T A;  1T3N A;  3FMB A;  1IBL F;  1VRU B;  2WVC A;  1D9A A;  1PG5 B;  3MCS A;  1HIY A;  1NBE B;  4AT1 B;  4YME A;  2N7Y A;  4X62 F;  3UNY A;  3AJ2 A;  3J81 U;  4ZK7 M;  1AZS A;  3A8J A;  3T19 A;  2L9N A;  3E2E A;  5K20 B;  3LGM A;  4XTT A;  4ZVH A;  4Q45 A;  4Q2M A;  1NK7 A;  1PAU B;  5K8M A;  1AFJ A;  3GII A;  4NCG A;  1LEO A;  2F8E X;  1TV6 B;  3VAM A;  2EFO A;  2VIC A;  2JEG A;  3H25 A;  3HJF A;  4C8N A;  1ELO A;  2H5J B;  3IR7 B;  3QNW B;  3RAQ A;  1EP4 B;  1ICE B;  4GVB B;  1ZAX A;  4WU3 A;  3MPV A;  3LP2 A;  4TYB A;  2DXE A;  2JHE A;  4ZIV A;  4LF4 F;  4DG1 A;  1LW0 A;  1XNR J;  2IYG A;  1EQ0 A;  3TOQ A;  2SXL A;  3UR0 A;  5HSP A;  4GKJ J;  4LIW A;  2MJN A;  2ZNZ A;  2KTQ A;  3MM6 A;  2ZVI A;  2I8E A;  4R5P A;  1RB0 A;  1GK8 A;  4MMO A;  3GLJ A;  2V8H A;  3ULH A;  4NAS A;  2DHX A;  4OX6 A;  4ED3 A;  1NB7 A;  2NYH A;  1N5Q A;  2V4J B;  3PYD A;  2CIM A;  1CEZ A;  2E7X A;  1RAA B;  4ES1 A;  3G6E S;  2POK A;  2XMM A;  3IFE A;  1RWV B;  1REV A;  4LFB J;  1S9G B;  4KC5 A;  1BUX A;  3DI6 B;  1JJH A;  2FHM A;  3SQG B;  5ETP A;  2V4Q A;  5D8H B;  2HS0 A;  3TWZ A;  3U1L A;  1XIQ A;  4TLQ A;  2ZH7 A;  2ZIT A;  3W62 A;  3I56 S;  3OPK A;  1ZZF A;  1CJU A;  1YBA A;  3BGR B;  3J7Y U;  2J9E A;  5F8N A;  3M2V A;  2IBO A;  3DLG A;  4LBH A;  3J7A 1;  2AGQ A;  1RA6 A;  1WEY A;  4LIR A;  2J5A A;  3SXL A;  1WF2 A;  4ECZ A;  2HEK A;  1H98 A;  3NGS A;  3PEH A;  4UQG A;  2JSX A;  4KIA A;  2L3M A;  4A8F A;  3FZB A;  5A8R A;  4U7U D;  2VZ9 A;  2QIF A;  1X4G A;  4DBQ A;  1OPZ A;  2GHV C;  2HQC A;  1FD8 A;  2CPH A;  4ZLN A;  4PG7 A;  3I4P A;  8ATC B;  1F1B B;  5HMX A;  3ETO A;  1XC9 A;  1EAY C;  1VQ6 S;  2DGQ A;  3PG9 A;  3RU0 A;  4FS2 A;  4DU8 A;  3LWL A;  1UFK A;  2RH3 A;  2DCL A;  4WXW A;  2ZWO A;  5HAN A;  2Q6B A;  2B9X A;  4PPD A;  5J1N A;  1SQF A;  2FZK B;  1YJU A;  2HND B;  2LQB A;  2E44 A;  1EHW A;  2WHO A;  3KLF A;  4DQR A;  2XEX A;  3AD9 C;  4M63 A;  4JI0 F;  3HSZ A;  1HHS A;  4CO5 A;  1X4H A;  2GIQ A;  4OZL A;  2ZKU A;  3M8Q B;  1SQE A;  1UWB A;  3O6Q A;  1RCX B;  2E5H A;  1XMQ J;  5CYM B;  3TAM A;  2JWN A;  3R6L B;  4Q7A A;  1DTT B;  2DH9 A;  5MAO A;  2ROP A;  5C24 B;  4LRD A;  3TYT A;  2E1A A;  1RXO B;  4DQI A;  3W60 A;  4M5N A;  1EB0 A;  1SB6 A;  2DT9 A;  2FZC B;  2R8J A;  4E8U A;  4V19 J;  4PXD A;  4CZC A;  5D4P A;  4Y28 C;  4ZHR A;  1RHM B;  1JLA A;  3EX7 B;  1T9X A;  3HP6 A;  1UVL A;  5DGA A;  2Q3P A;  2FB0 A;  1HBN B;  3PJ9 A;  3MI7 X;  3MCM A;  5F8M A;  2OMO A;  3ZTP A;  2XSJ A;  1KFS A;  3NGD A;  4B9N A;  2KT3 A;  3RR7 A;  4X4V A;  3W65 A;  1UWA A;  1GXU A;  2YKA A;  4ZPV R;  2KHC A;  4JI4 J;  5C25 B;  1VFJ A;  3CIZ A;  4WP9 A;  1RA7 A;  2E9Z A;  3D6M B;  4DV1 J;  1VQK S;  5CCM A;  2CJQ A;  2DHG A;  4X2B A;  1HFE L;  3EJM A;  4CO1 A;  3P3D A;  1OYE A;  1YJ7 A;  1X0F A;  3OR1 A;  1VCT A;  3BEG B;  3TJ8 A;  2W9B A;  2HNZ A;  2R2R A;  3TW0 A;  2JLF A;  3KJQ B;  5T7L B;  1RQ0 A;  3DDN A;  1GX5 A;  3FCH A;  1TL1 B;  2ATC B;  2B9Y A;  2AWZ A;  4P10 A;  2HRU A;  2YWF A;  4KJI A;  4F4W A;  3MM8 A;  4Y00 A;  2UXD J;  4NLG A;  5LOQ A;  3MED B;  3I6P A;  1U1L A;  2HK2 A;  3VAH A;  2DR9 A;  2H65 B;  1JLF B;  4LQ9 A;  3VVU A;  3IBF B;  5A2Q U;  3VF0 B;  1VQO S;  3LAL A;  3W5Z A;  2EKN A;  4RW9 A;  4RUC A;  5KG1 A;  1FXL A;  3T5L A;  1OYD A;  5EN1 A;  3A3P B;  4C8L A;  1TKZ B;  3HHD A;  3HHN B;  2XLK A;  4FF1 A;  1FRX A;  4KPC A;  5IFM A;  1BQX A;  2VG5 A;  3EZU A;  4JI8 J;  2ZBR A;  4DR5 J;  2VFV A;  1U47 A;  2QGF B;  3ENA A;  4RW8 A;  2Y8W A;  3KNG A;  3H98 A;  4HL9 A;  3SYZ A;  4JV1 A;  3TZX A;  2MXY A;  3IWX A;  2E29 A;  5A8K A;  5KFS A;  1VQN S;  2VBW A;  4DJB A;  1IJF B;  2DD8 S;  3OJS A;  4IH6 A;  2YWG A;  2DR5 A;  1KHV A;  3K58 A;  1IR1 A;  3I5A A;  1QUP A;  2FHJ A;  2ZWP A;  4MIA A;  3G8S A;  1U1R A;  1X8D A;  2E9T A;  3WIV A;  2Q6C A;  3FVY A;  1Y5L B;  3Q22 A;  3BM7 A;  3OVS A;  3LAM A;  2M5Y A;  3JAM Y;  1KLN A;  4USW A;  4B9S A;  2GJ2 A;  2J9D A;  2UVV A;  2VG6 A;  1LWE A;  1RTZ A;  3DGP A;  3M4X A;  3OTO F;  4R25 A;  2AYM A;  2EG1 A;  5C2C A;  2CWX A;  4IO9 Q;  2DNK A;  3C14 B;  5DDQ C;  2RRA A;  1AXQ A;  3C8Y A;  1PBA A;  1J5E F;  2B9W A;  1K0T A;  3J80 Y;  2GVZ B;  1CS4 A;  1WD6 A;  4Q2L A;  4HI2 A;  3H0P A;  4M5D B;  3JQM A;  3THV A;  1TTH B;  5KG0 A;  2ZE2 B;  2GX8 A;  3BDE A;  2HZA A;  1HWU A;  1OWX A;  3RR8 A;  2GGP B;  4DS5 A;  1RT4 B;  2M3D A;  2YXL A;  2UV8 G;  2HVE A;  2HZV A;  3K89 A;  4UQT A;  1NH7 A;  4MK7 A;  3DMJ A;  4RW4 B;  4LVO P;  1WWH A;  1U2C A;  1X5T A;  4QPX A;  2PT0 A;  3NCQ A;  2XM3 A;  2VUG A;  4NX9 A;  2B5J A;  1NSQ A;  4RU2 A;  4DMZ A;  3ILJ A;  1IKY B;  5I3Q A;  1S5Z A;  3HLU A;  3CME S;  2RQM A;  4WFN Q;  5KT4 A;  1MN7 A;  2F8M A;  2YKM B;  5KG7 A;  4LSZ B;  2ZC3 A;  1WG4 A;  4U96 A;  3LTO A;  2C2D A;  2UV8 A;  3QO9 A;  4EUV A;  1UCN A;  3GMG A;  1RHU B;  4HAC A;  4PUO B;  3A3N B;  3E01 B;  3VWS A;  3CCW A;  3EGZ A;  2BQ3 A;  1SC1 B;  5D0H A;  3OL7 A;  3BR9 A;  3CJ0 A;  3D28 A;  2Z0G A;  2PEH A;  1D09 B;  1I6J A;  3B4M A;  2UVU A;  2M88 A;  2QLF B;  3OSP A;  1L3T A;  2GZO A;  1F2G A;  1SXL A;  3OVB A;  4Y2C A;  3TUZ C;  5CHC B;  4ETZ A;  3BKT A;  2ZH9 A;  2DYA A;  3JQK A;  2QX0 A;  4CO4 A;  5BYS A;  3D1Q A;  4PG4 A;  4F4X A;  1VJW A;  2C2O B;  2I5J A;  4F3O A;  2DBB A;  3EVO A;  2MZT A;  3LA0 A;  3PO5 A;  5F0U A;  5ETT A;  3NWG A;  5LXR A;  2DGX A;  1UL3 A;  3OLB A;  1RAO A;  1DUR A;  2Y1J A;  2KI2 A;  3R7S B;  3T6J A;  3M32 A;  1TAU A;  5HMZ A;  3EZO A;  1HNV B;  5KFK A;  2VQF J;  2BKO A;  3HHL C;  3JYT B;  2ZZT A;  5EWE A;  3CVK A;  3DOL B;  5HLF A;  2A0F B;  1PJ6 A;  2DNO A;  2N4C A;  2DPI A;  4O4G B;  1X4F A;  8RUC A;  3TVZ A;  4OX9 F;  2LQ9 A;  3ZC4 A;  2UUC J;  2EBG A;  3JB9 k;  2EWH A;  4CLW A;  3EE3 A;  2WW8 A;  4S0M A;  2AEM A;  2YY3 A;  3OTC A;  3IP0 A;  4NZ0 A;  5E7O B;  2CPZ A;  2BDP A;  3DGV A;  3AFG A;  1IJE B;  5KFY A;  3CDW A;  5J2M A;  2B3T B;  2RQ4 A;  4JI1 F;  4A48 A;  4RBU A;  2V9K A;  3TAR A;  1FO1 A;  4ZCI A;  2D41 A;  3M8P A;  4ENO A;  3SV3 A;  3PHT A;  1UKU A;  1HHQ A;  2DNZ A;  1S4E A;  2ZH1 A;  2QZ8 A;  3R5J B;  4EMD A;  2DR6 A;  3PJX A;  5HMY A;  1N36 F;  1SV5 B;  1CJK B;  3D6F B;  2J7W A;  2HQD A;  4ITS A;  4K0K J;  3FRZ A;  2W4D A;  1HD0 A;  4KYZ A;  3B54 A;  1O51 A;  3FCV A;  3GJS B;  4XAK A;  2HHW A;  1ARO P;  3RAM A;  3W2W A;  3OSN A;  2PFF B;  4N8O A;  1E6Y B;  1DTQ A;  2GHP A;  3O3L A;  1NJZ A;  1U8W A;  3EYZ A;  1RTI A;  3Q89 A;  2BXJ A;  2OML A;  4FYW B;  5E3C A;  4XIU A;  1IQT A;  4LSL B;  2FVP A;  2XCP A;  5L1L A;  4B3S J;  1APS A;  2WRM A;  4U95 A;  2W8K A;  3DOM A;  3NWR A;  5HVG A;  1C0U A;  5FD1 A;  1U2F A;  3M30 B;  2WCX A;  3RYL A;  1N6Q B;  2OPR A;  4L73 A;  2YX7 A;  4WZM A;  1S76 D;  5CYQ A;  4ZVS B;  1VRT B;  2KFN A;  4ZP6 A;  2F5G A;  4TKT A;  4ZVF A;  4OV6 A;  3AQO A;  4QIV A;  4M94 A;  4KO0 A;  4CH7 A;  2UXC F;  1R89 A;  3CJK B;  5ETQ A;  1RAH B;  4L6V 3;  2WBM A;  4LVN P;  2V0N A;  1CVJ A;  4IFY B;  2IM2 A;  2YKN B;  1EAR A;  2W2Q P;  3F41 A;  4G3I A;  2RUG A;  1G3O A;  4P75 A;  4OLP A;  2IM1 A;  4FF2 A;  3KYL A;  1VI7 A;  1QSS A;  1VRU A;  2JFK A;  4WF9 Q;  2RIJ A;  4G1I A;  2MQM A;  1WKK A;  1NSA A;  3EXY A;  3BN4 A;  1SKR A;  1MLA A;  1SL0 A;  1KHW A;  4J9L A;  2CKW A;  2DY9 A;  3OV7 A;  1U1M A;  1H72 C;  2XBP A;  1WDD A;  4LRA A;  1WC1 A;  3N6N A;  3T41 A;  3FJ2 A;  1NZ8 A;  4M95 A;  2PMZ D;  2MKC A;  4X4O A;  4PPZ A;  2Z2Z A;  2VC0 A;  2MKS A;  3LAN A;  2IJF A;  1SJ4 P;  1TV6 A;  4YHH J;  4KSE B;  2HIQ A;  2N3L A;  5KFL A;  4F50 A;  1EP4 A;  1RT6 B;  3AOA A;  3VGS A;  2VFT A;  4GVB A;  2GQC A;  1HI8 A;  2C3M A;  3CD6 S;  3FBB A;  3C15 B;  1PKU A;  4YFU A;  1MN9 A;  2XI3 A;  1KNZ A;  2J6T A;  2BJ8 A;  3CCV S;  2DIS A;  4C8K A;  1M1K T;  4FDF A;  4UOH A;  3RJM B;  2R7W A;  2B43 A;  2HWH A;  3RGI A;  3L95 X;  2KM8 B;  1FJG J;  2PN6 A;  4C8O A;  3NS7 B;  3H20 A;  5G4D A;  3AA9 A;  5I42 B;  2V4J A;  1MMN A;  3UDC A;  4P74 A;  3DKD A;  2XNR A;  3GON A;  3SCK E;  2AGP A;  1P6T A;  4DQS A;  3S8S A;  1ZA2 B;  5HL7 Q;  1S9G A;  2VL1 A;  3UI3 A;  3DI6 A;  1XNR F;  3SQG A;  4PYA A;  1QLN A;  3QID A;  4ZPD A;  4GKJ F;  3R2D J;  2FC9 A;  4ZVT B;  4J5O A;  4KY3 A;  2HFO A;  3MEK A;  4X4U A;  2QLX A;  2CPD A;  1GMV A;  3C46 A;  3BGR A;  1K44 A;  4FXV A;  4CT8 A;  2BV3 A;  2CQP A;  2DXD A;  2HQI A;  5D4L A;  3BH6 B;  3C2P A;  1FX4 A;  5T14 A;  2IHR 1;  3D0G E;  1S57 A;  1X9S A;  1VC5 A;  3SCI E;  4RUH A;  2VOO A;  1RTH B;  2LQ8 A;  4IH5 A;  3IXQ A;  4TQS A;  4DL2 A;  4QWA A;  2VJU A;  4IRD A;  2R8G A;  2VBX A;  2KFZ A;  3DYA B;  2IJN A;  1YIJ S;  2QLB B;  2AJ2 A;  2ZD1 B;  4JYA J;  4WXO A;  2MDA A;  2IM0 A;  1U49 A;  5IM0 B;  5M2P A;  2BR0 A;  3DHX A;  1EKR A;  2XY6 A;  3WC2 A;  2X1F A;  2L41 A;  2QEX S;  1EQM A;  1ZH5 A;  2OPS B;  3MMB B;  4LFA J;  1YVF A;  3GG1 A;  2J8A A;  1L3S A;  4M5M A;  2JEI A;  2HND A;  1FF2 A;  5H9F J;  2H5I B;  4MKB A;  3HZE A;  3KJV B;  2CAJ A;  4NLR A;  2IBK A;  4URQ U;  3QT6 A;  3CDE A;  2AX1 A;  3KWM A;  3M8Q A;  2MGZ B;  5J2N B;  3HSG A;  5CYM A;  4OI6 A;  3M6W A;  5HRO B;  1J27 A;  2DRB A;  1FXD A;  2QE5 A;  1DTT A;  3WX4 A;  3VTI A;  2KU7 A;  5C24 A;  4CLY A;  1T94 A;  2B9E A;  1W2I A;  1U1Q A;  2YKP A;  2H54 B;  1R6Y A;  3KOA A;  2HHX A;  2ZH4 A;  1FE0 A;  3CJ3 A;  1TMM A;  4DR1 J;  1IXK A;  4B3T J;  1U0H B;  3K5O A;  4AL5 A;  3SIP B;  4CLL A;  4OZ2 A;  5DO2 A;  1RCO B;  5K8O A;  4CLP A;  1PIE A;  2C3P A;  5KFA A;  2VPW B;  4L75 A;  1HBN A;  1D0E A;  2GNK A;  2IRX A;  3OXL A;  4HVZ A;  2CPF A;  3FZ2 A;  2XO7 A;  3D6T B;  3HMJ G;  1XMQ F;  5IQ6 A;  1S1V B;  2DH7 A;  4E0D A;  5AE2 A;  2OD4 A;  4I2Q B;  3EDQ B;  5C25 A;  3SSR A;  4NLP A;  4UY8 T;  1NXI A;  4JI3 F;  3T9N A;  3M9N B;  1VLO A;  3QWU A;  1HL6 A;  3R3T A;  1UA0 A;  4MT1 A;  3HCX A;  1BE4 A;  3AH6 A;  3Q8Y A;  4QIF A;  3FBC A;  2XMK A;  1H74 A;  2FHK A;  3V4M A;  3FFI B;  5D77 A;  3NL0 A;  3DDK A;  5A6W A;  2ROG A;  3B8H A;  2V2Z A;  1VLY A;  3QBC A;  5KT2 A;  2ZJR Q;  3UN5 A;  2KG0 A;  5KFN A;  4LUB A;  2A6O A;  4LJM A;  3CJ5 A;  4UUW A;  4JI4 F;  3BSO A;  2AYG A;  2QG9 B;  2X1G A;  1TL1 A;  1WKJ A;  5L9N A;  1RHR B;  4EBD A;  3U27 A;  4N5S A;  2WBR A;  2XUL A;  3QJJ A;  2NXC A;  2J9D E;  4DV4 J;  3PW4 A;  3MED A;  3M2R A;  4J9K A;  4DV1 F;  2KH9 A;  2IVM A;  1HWL A;  1JLF A;  3ISN C;  1DRZ A;  3BBB A;  1YZ7 A;  4ELT A;  1RBA A;  2HNY B;  5KFO A;  4TY9 A;  2WW4 A;  3UQS A;  1VQ4 S;  4F3Q A;  3QLH B;  5E2Q A;  4CLF A;  2AV5 A;  2HUR A;  2PFD A;  4WYW A;  1I5O B;  4NXN J;  3NAH A;  1R8B A;  1TKZ A;  2O66 A;  2HHH F;  4MKY A;  5GMD A;  4J9M A;  3TVK A;  2K1R B;  2PMW A;  4DPU A;  3H8Y A;  4OJ1 A;  1N4L A;  2Z57 B;  4P7V A;  2UXD F;  3DRP B;  4C48 A;  2IA0 A;  5AE3 A;  3U02 A;  2DIU A;  3GIM A;  2Y0B B;  3HT0 A;  3VAL A;  1VOM A;  2IDE A;  2QFI A;  1HWK A;  5HK4 A;  3VAI A;  4I4B A;  1WTB A;  1FCA A;  2G2Z A;  1IBM J;  4IFV B;  1B0P A;  3U1M A;  3VAG A;  1JLG B;  2YPY A;  1QVF R;  1KQG B;  4MJK A;  1OMS A;  4DL5 A;  4NOH A;  1HBU B;  1T9W A;  2DO4 A;  1NDK A;  3W2V B;  1K0V A;  1F9F A;  2GFF A;  4CLK A;  3OD2 A;  4JI8 F;  2VOD A;  4KTQ A;  1X7V A;  1TL3 B;  4DR5 F;  1WHX A;  4J9U E;  2XYP B;  4ID5 B;  4KBI A;  3LOU A;  3QRR A;  2AX0 A;  3BR8 A;  4ED0 A;  5C2G A;  1U7L A;  5BYQ A;  3ENQ A;  2KHD A;  4JI5 J;  4DHV A;  3N6L A;  1RT2 B;  3C14 A;  4LR8 A;  4O3N A;  3CCL S;  4RW6 B;  5AE1 A;  1G7C B;  2ATL A;  2BW7 A;  2Y8Y A;  1S1U B;  3BSC A;  4CO2 A;  3NGR A;  3W9J A;  4HDH A;  4OYP A;  5B0G A;  2VFS A;  3UD5 A;  3SV4 A;  1N54 B;  2GVZ A;  2IFX A;  3TEG A;  1VIX A;  4M5D A;  3SDE B;  3MOJ B;  3MF5 A;  3GR0 A;  4K4S A;  3M8S A;  4WU2 A;  3WHI A;  2I6W A;  2ZE2 A;  3FSX A;  1N0V C;  4ER8 A;  1WI6 A;  3A12 A;  2RSQ A;  4OI0 A;  2GGP A;  2V68 A;  1ZOT A;  1C1B B;  2KYZ A;  3RBD A;  3ZZU A;  1VC0 A;  3K57 A;  2MKY A;  3MFI A;  4N47 A;  4RW4 A;  1LFP A;  1IWG A;  1FWK A;  2ZBC A;  5I3P A;  4IKA A;  4PG6 A;  1IKY A;  4LF7 J;  4NLV A;  2YKM A;  2R7S A;  2OP5 A;  1VQP S;  4TU7 A;  4ZPC A;  4OI4 A;  2FY8 A;  2HHT A;  4XDD A;  3PKY A;  1FDA A;  3T1H J;  3JSR A;  1Y4Z B;  3ZXW A;  1CC7 A;  5LXY A;  4ZIT A;  4PUO A;  1TU0 B;  1BD6 A;  3IR5 B;  3E01 A;  3OTB A;  1TKD A;  4UUX A;  2PA3 A;  3KG1 A;  4UOG A;  4F02 A;  1Y0H A;  4ES2 A;  1D8Y A;  4ECU A;  1N5Y B;  2CQB A;  3BV8 A;  4ATN A;  1SC6 A;  4KT0 C;  3D3B J;  4TLR A;  3CC4 S;  1R8C A;  4FP9 A;  4DPX A;  2CPI A;  3MM9 B;  5HJY A;  3TUP A;  1RT7 B;  3VR1 A;  3MM5 B;  1KQK A;  1S97 A;  2X3D A;  2R7X A;  1DJ0 A;  3MEG B;  3SEO A;  4UOC A;  1M5O C;  2WZ1 A;  4OLO A;  1PSD A;  5D4N A;  2EFP A;  3BYP A;  1EX8 A;  1Y5I B;  3FC9 A;  2V69 A;  1C1C B;  1NK4 A;  3K8V A;  2QSW A;  2FLO A;  3K5P A;  1U1P A;  1HNV A;  3D9B A;  3JYT A;  1IKX B;  5DDO C;  2M4M A;  1RWK B;  4EZ9 A;  1XNQ J;  1WC6 A;  3DOL A;  3T5J A;  1U8S A;  2N82 B;  4O4G A;  3BDP A;  3UCG A;  2XMU A;  2NUU G;  4ELU A;  3PY8 A;  4NMX A;  4Q0B B;  4ECW A;  3W5Y A;  1FA0 A;  1RT3 B;  1LXJ A;  5KG4 A;  2M8D B;  5KOW A;  1VQM S;  1S7H A;  3W1Y C;  3MMA B;  3UDE A;  4MYT A;  1RT1 B;  4TYA A;  1RWO B;  1HKA A;  3X1L B;  2MQ8 A;  4Q8F A;  2AYE A;  2VQF F;  2B56 A;  3Q8Q B;  2KN4 A;  5KG2 A;  1RHQ B;  5CAA A;  2J6U A;  5CXT A;  4F2R A;  5KFQ A;  1CJV B;  5CA5 A;  1DZ5 A;  2UUC F;  2AJQ A;  3MCN A;  4ED4 A;  2CXE A;  2R8K A;  2ALY B;  4H4M B;  2FJE B;  3AJ1 A;  1SV5 A;  1CJK A;  2K8G A;  4EWT A;  1NZA A;  2MQP A;  3N79 A;  4HEA 9;  4OYZ A;  2C28 A;  2AJ4 A;  1BQN B;  1AYE A;  4EO8 A;  1YJN S;  1M0S A;  1Q95 G;  2AP6 A;  1FTR A;  2HG4 A;  5B0D A;  5THW A;  3M05 A;  3HHL D;  3N28 A;  1E6Y A;  4TVA B;  4OI3 A;  4DR2 J;  4EBC A;  3TA1 A;  3HVW A;  4LSL A;  1AFI A;  2UZA A;  3JAM U;  1S0V A;  1S6P B;  4ZPB A;  4J7C A;  4OIX A;  4M5K A;  4X4N A;  1REG X;  3ELH A;  4QU6 A;  3HHL B;  3M30 A;  3CPW R;  1N6Q A;  2L48 A;  1MWQ A;  4DX7 A;  3PW2 A;  3O5T B;  4I2P B;  3WIU A;  5D78 A;  2NSB A;  1S1X B;  1VRT A;  2OPP B;  3QFH A;  4URS A;  2BJD A;  2UUB J;  5LJ5 Y;  4NA1 A;  2BW2 A;  3J80 U;  5H9E K;  5C7P A;  3CJK A;  1NK6 A;  1AB8 A;  1S59 A;  4GKK J;  5K14 B;  4O23 A;  4B3S F;  1NDC A;  1MRO B;  2MZ1 A;  4OZN A;  2V2Q A;  4IFY A;  2HWT A;  1A9N B;  2YKN A;  1T03 B;  5F3T A;  3UDV A;  3GYX B;  1QAY A;  1ZZN A;  1VDH A;  3AD7 C;  3GB0 A;  1SUQ B;  3WX8 A;  2CVE A;  2HAI A;  2M70 A;  3ET6 B;  4YEA A;  2VU5 A;  5G0R B;  3K5N A;  3CNQ P;  1CC8 A;  3G6X A;  3KG4 A;  3D1H A;  4Y6I A;  4FPR A;  5HP1 B;  4LF5 J;  3ZTR A;  2W8L A;  2C2R A;  2MTL A;  1TFW A;  4NYO A;  2KG1 A;  4PQU B;  3V5R A;  1T9T A;  1Q8L A;  5AXK A;  4CTA B;  1RE1 B;  2E1R A;  3N01 A;  4HH0 A;  3DHW C;  1UW9 A;  3KLE B;  1HMV B;  3ZTS A;  2YQ0 A;  2RRB A;  1XK8 A;  4MYU A;  1VIO A;  2AGO A;  5KFP A;  5EWF A;  4FKX A;  1S1T B;  1RT6 A;  3I0R B;  2Y0S D;  4YOE A;  2MHE A;  3LF0 A;  1LKZ A;  2HBQ B;  2PI4 A;  2UU9 J;  1HR0 J;  4EGL A;  2XS7 A;  4LF8 J;  3C15 A;  4ILR A;  3CCM S;  3GG0 A;  5GAG U;  4ETX A;  5IQQ A;  2RNE A;  1MU2 B;  3LUY A;  3PR5 B;  1FK9 B;  3QMQ A;  5F8J A;  1RWW B;  2DGV A;  3CGI A;  1QAI A;  3MUT P;  1G2E A;  3ZO7 A;  2A10 A;  4DCJ B;  3F44 A;  4O3P A;  4Q44 A;  3PZP A;  3MUV P;  4CDI A;  4YHH F;  5I42 A;  1NKE A;  2HBY B;  5MLC V;  2RF2 B;  1FJE B;  2BAN B;  3ZZ0 A;  3GP9 A;  1YJW S;  1WKL A;  1RBL A;  2VDH A;  1H7W A;  4PYD A;  3ILO A;  1XTZ A;  3TJA A;  4LT6 A;  3E3X A;  3RBE A;  3M8W A;  4CLU A;  1S7I A;  4B17 A;  1DQA A;  4DF4 A;  2GMJ A;  2YTC A;  1Q7L B;  1Q82 T;  4OYA A;  4KHP J;  4XPE A;  2JEJ A;  3HO1 A;  2BJE A;  3MPW A;  2C3Y A;  4MIW A;  1HNW F;  1YJT A;  4PKD B;  4MH8 A;  1VS3 A;  1RYS A;  5A0Y B;  4WBF A;  3TX8 A;  1NAQ A;  5EGY A;  4UW2 A;  5D0R A;  3RW7 A;  5KFD A;  4EFA C;  5CZX A;  1BY9 A;  4F3M A;  3BKU A;  3O1L A;  3TZZ A;  2HQF A;  5IOL A;  3POT B;  4IG0 B;  1SH2 A;  4WFZ A;  1XER A;  2BAC A;  1YGY A;  5KFE A;  2L08 A;  1RTH A;  4RW7 B;  3U7J A;  2BKN A;  4QWE A;  3OJU A;  3NLC A;  2NZC A;  4QU7 A;  3UVJ B;  3CCZ A;  3I9V 9;  1F5C A;  4B9L A;  3BPS P;  2XMW A;  3TO8 A;  3DYA A;  3CDA A;  4IR9 A;  1RU1 A;  1VJQ A;  1RUS A;  2ZD1 A;  5HVF A;  3TUJ C;  4C97 A;  2D9O A;  2KVI A;  3W3S A;  3TUI C;  1F60 B;  3IAM 9;  1KVI A;  4JI7 J;  5C42 B;  5IM0 A;  4C3K A;  4UF4 A;  2WAQ D;  1FKP B;  2HMI B;  2OH2 A;  3L7P A;  2CG8 A;  2FY1 A;  5DRK A;  1HD1 A;  2OPS A;  2PGC A;  3MMB A;  4LRF A;  5BR8 J;  1BQM B;  3NMA A;  2F65 A;  2H51 B;  4M5G A;  1N52 B;  4Y3C A;  1SJF A;  2DNQ A;  2VAS A;  2W2P P;  4EO6 A;  3DU5 A;  1NJI T;  3A4T A;  3GIL A;  2RQC A;  1M1G A;  2FJV A;  3OTE A;  2VPZ B;  1YLX A;  2MGZ A;  4JYA F;  5J2N A;  3K17 A;  3HPO A;  5HRO A;  1KDN A;  4C7Q A;  1HNZ J;  3MM7 B;  2RAQ A;  2ZHA A;  4ZJL A;  5KFZ A;  4F67 A;  5D3G B;  3ICL A;  1RTD B;  3KTQ A;  2LDY A;  3MTK A;  5KFB A;  3NAI A;  2MKI A;  3DNC A;  2DR7 A;  5DDP C;  1DAR A;  3ZZR A;  1V3S A;  1JNZ B;  4RUA A;  4GC7 A;  3Q8S B;  3F0N A;  1U0H A;  3MDF A;  1FKO B;  3T6B A;  1WF0 A;  4OYX A;  2FGO A;  1R31 A;  2VH7 A;  4F7V A;  4WCE Q;  3FEX B;  2MHN A;  4CNY A;  2VBY A;  1KKH A;  1YJR A;  4QQB A;  5FII A;  1B0T A;  3FCW A;  1S1V A;  5LSO A;  3B82 A;  1QY7 A;  2MEW A;  4I2Q A;  3ZZP A;  1K1Q A;  3BZQ A;  2FJW A;  2GAH C;  1UEV A;  1D9D A;  4RNN A;  1T9V A;  4DR1 F;  4B3T F;  4WFA Q;  3QGG A;  1X4A A;  4M5J A;  3QT5 A;  3G4S S;  2VBZ A;  2OHD A;  4KHR A;  1JJC B;  1KTV A;  2WVB A;  4NCA A;  3FFI A;  3S1T A;  4QYZ K;  1TQL A;  2ZNY A;  2OAU A;  1FNX H;  4BLG A;  4LR9 A;  2C2E A;  1KR4 A;  3JTP A;  5IT9 Y;  2XHC A;  3C6U B;  3PIO Q;  4YB6 A;  2HRY A;  5IV3 A;  4ED5 A;  1SIW B;  4AE5 A;  3D6H B;  2WSF C;  2IMO A;  2RML A;  2GVD B;  2YKQ A;  1S9E B;  2ERR A;  3SCL E;  3HVT B;  5L1I A;  3TJ9 A;  2CNO B;  1UEU A;  4FYY B;  2CQ4 A;  2OFH X;  2BRL A;  2E5G A;  4CWB A;  2HNY A;  3QLH A;  3A8I A;  4DPY A;  2ZFH A;  1KLM B;  4F36 A;  1U45 A;  2FUG 9;  5GME A;  1UA1 A;  5L39 A;  1Y7P A;  1T05 B;  2DNM A;  1FXR A;  3HF5 A;  2K1R A;  2ROE A;  2Q79 A;  3K8W A;  4ZMM A;  3LGH A;  4F25 A;  1Y00 A;  4P6Q A;  3DRP A;  1U26 A;  4DV4 F;  3TAP A;  3D0H E;  1L3V A;  2FDN A;  1HA1 A;  3P96 A;  4L76 A;  2KT2 A;  2AF6 A;  2HGM A;  3DRS B;  2HFZ A;  5GAD I;  4IFV A;  2N4D A;  2LFV A;  3OXG A;  1KP6 A;  1JLG A;  5GAH I;  4EYH B;  3ZTQ A;  1RWM B;  4NXN F;  3KUH A;  1HBU A;  1RAC B;  2KXF A;  5CAB A;  3W2V A;  4F0H A;  3W63 A;  5AXN A;  1M5K C;  4J9S A;  1W2B R;  4QW8 A;  4FYV B;  5J2Q B;  1NDP A;  2DKO B;  1TL3 A;  4EI2 A;  1IKW B;  2NXN A;  2BJ9 A;  1NHK L;  4NRT A;  4M1K A;  3THT A;  1L3U A;  4ID5 A;  3JSM B;  4B3O B;  1T7P A;  3LP0 B;  2FGC A;  4DCO B;  1IBM F;  1YBT A;  4I6W A;  2QO3 A;  1R8A A;  3CCQ S;  4NI2 B;  3VGT A;  4Z37 A;  4PCQ A;  1RT2 A;  2A18 A;  3ISN D;  4RW6 A;  2LCW A;  2W2N P;  1S1U A;  1JLQ B;  1DY3 A;  3GWC A;  4H4O B;  4LSN B;  3EGW B;  2GJF A;  1S79 A;  1Q1K A;  3SDE A;  2ZM6 J;  2DK2 A;  3ZZO A;  2V34 A;  3PAC A;  2DO0 A;  2E1M C;  4HYK A;  4OZ1 A;  2J9C A;  2FLP A;  2CZV C;  2VA2 A;  5SZT A;  1NJY A;  2LXF A;  1LWX A;  2OSQ A;  3SSS A;  2G0C A;  1C1B A;  4JI5 F;  3DOK B;  4DV5 J;  4Y2K A;  4CM0 A;  4KQZ A;  4DSL A;  4N7T A;  2ZZN A;  2HAF A;  3RRH A;  1V3R A;  3GPA A;  1WNE A;  4I0W A;  2HGL A;  5I4M A;  3IAS 9;  1HW8 A;  2F7V A;  2ZZM A;  3UO0 A;  2ZBQ A;  2CA9 A;  1KTQ A;  1FVQ A;  3QFW A;  4Q5V A;  1R43 A;  2RDJ A;  3HSD A;  2NYI A;  2Q1L A;  1T0T V;  2KXN B;  1N32 J;  4IQM A;  3PIP Q;  1VQ7 S;  1PJ7 A;  2YQ1 A;  2MKJ A;  3CDU A;  3GYG A;  3Q0A A;  2OKQ A;  2YWH A;  3VGV A;  4KB7 A;  4EBE A;  4WWS A;  1OQ6 A;  3NOG A;  4IRC A;  1ZM9 A;  3GQC A;  4USI A;  4ZVQ B;  1N5Y A;  1RWP B;  3MCO A;  1MNE A;  4LF7 F;  2H3E B;  2MZJ A;  1B3T A;  2RE1 A;  3HD1 A;  6FD1 A;  2MMY A;  2QSF A;  4PWU A;  1SH3 A;  1RT7 A;  3MM5 A;  2CAD A;  4A8Y A;  3GIJ A;  4OYW A;  2UUA J;  2V2V A;  3MEG A;  4FNI A;  2CPY A;  2RQK A;  3T1H F;  3NS5 A;  4A8K A;  2LYV A;  5CD4 A;  2M0G B;  4K4Y A;  3U1N A;  3AXK A;  4C0B A;  4QWC A;  3ONQ A;  2MJU A;  3D66 A;  3CWJ A;  3DXB A;  4USM A;  5B08 A;  3D54 A;  5DQI A;  3KHR A;  2FVS A;  1C1C A;  1RJJ A;  1PBU A;  4C8Y A;  1GNK A;  2C2M B;  2AJ1 A;  4IQX A;  1S9F A;  3N5B A;  2WVE A;  3GFH A;  1N8R T;  3QZ7 A;  1IKX A;  1R0C B;  4FYD A;  1S10 A;  3C16 B;  5EDW A;  2GV1 A;  2BYC A;  1NKC A;  1S6Q B;  1PO6 A;  1UAW A;  1CJT B;  3PX6 A;  1H2T Z;  2MYF A;  4Q0B A;  3FNN A;  3R1L A;  2I2Y A;  1RT3 A;  3HHE A;  2HVH A;  3OVA A;  2ASD A;  2ZKT A;  3KK2 B;  1RT1 A;  4K2X A;  3R5D A;  4UST A;  1JNR B;  1NO8 A;  4KGK A;  2DGW A;  1O0P A;  1AA1 B;  1T02 A;  1XNQ F;  2ABY A;  1QM9 A;  3G71 S;  2Y1L B;  5DGB A;  3G9C A;  2VA3 A;  4PWW A;  4Y2I A;  2QLW A;  2Z56 B;  1M5S A;  1CJV A;  3R5C A;  5F8L A;  2VV5 A;  4ZDN A;  1FFW B;  1F6T A;  2Z2Y B;  4H4M A;  3UDL A;  4X4T A;  5IT4 A;  4URG A;  3PTW A;  4LRC A;  4WP8 A;  1EJ7 L;  1IN0 A;  2E5L J;  3OL9 A;  1TK0 A;  1T3O A;  1BQN A;  2JFD A;  1ZAV A;  1S99 A;  1X60 A;  4ZPA A;  5IWA J;  1NJW A;  4Z7C A;  1TUG B;  2FJA B;  2OEL A;  1AUS L;  2Z30 B;  2GAG C;  1G6B A;  4ECY A;  4OZ3 A;  4Z2X A;  1SPB P;  1WSV A;  4HDG A;  2B7C B;  4QIG A;  4PG8 A;  3NGK A;  3QQC D;  2DJW A;  4K7Q A;  4DCP B;  3GJR B;  1HWI A;  2AHO B;  2K7J A;  2LXU A;  1XMO J;  3V81 B;  3UNG C;  5CZV A;  1S6P A;  2J7K A;  4AUK A;  3V6D B;  2EBE A;  3AA8 A;  2BOA A;  1U0S A;  2NPF A;  2XMA A;  3HHL A;  4OI1 A;  2V2K A;  4WKR A;  3BRE A;  2NPI A;  3JSB A;  4I2P A;  4O3O A;  3GV5 B;  1S1X A;  2BE7 D; 
#chains in the Genus database with same CATH homology
 1NSQ A;  1BUX A;  1NSK L;  4ENO A;  3G2X A;  4F36 A;  1HHQ A;  2HUR A;  1S5Z A;  3VGT A;  2DXF A;  3ZTS A;  3Q86 A;  1MN7 A;  1NPK A;  3EMT A;  3B6B A;  4EK2 A;  1HLW A;  3PRV A;  1XIQ A;  1LEO A;  3NGT A;  4ANC A;  4F4A A;  1VYA A;  4FKX A;  4WBF A;  1EHW A;  3BBC A;  3JS9 A;  5C7P A;  2BEF A;  1ZS6 A;  4KPC A;  1BE4 A;  3FBE A;  3VGS A;  1S59 A;  3Q8Y A;  3FBC A;  3VGV A;  1K44 A;  3Q83 A;  1NCL A;  1NUE A;  3EIC A;  3NGR A;  1NDC A;  3VGU A;  3FBB A;  1KDN A;  1UCN A;  2B8Q A;  3B54 A;  1NLK L;  1PKU A;  2DXD A;  3VVT A;  1F3F A;  4DUT A;  3FCV A;  3ENA A;  1MN9 A;  4UOG A;  2ZUA A;  3BH6 B;  3EJM A;  2BX6 A;  2DXE A;  2AZ1 A;  4HR2 A;  4C6A A;  2B8P A;  5IOL A;  3DDI A;  3FKB A;  1S57 A;  1W7W A;  4UOH A;  3WX8 A;  2CWK A;  2VU5 A;  3L7U A;  3EE3 A;  3ZTQ A;  3BBF A;  4S0M A;  1LWX A;  3EM1 A;  1NSP A;  1NB2 A;  1BHN A;  1U8W A;  3NGS A;  1B99 A;  1NDL A;  4DZ6 A;  5CAB A;  1WKJ A;  4O0N A;  1B4S A;  3Q89 A;  3ZTO A;  1NDK A;  2HVD A;  1WKK A;  1JXV A;  2AZ3 A;  2DYA A;  3Q8U A;  4DI6 A;  4AND A;  4UOF A;  5CAA A;  3NGU A;  3BH7 B;  2HVE A;  3EVM A;  1NDP A;  1HIY A;  3ZTR A;  3MPD A;  3DKD A;  3ELH A;  4ANE A;  4CP5 A;  3GP9 A;  4FKY A;  3GPA A;  5BXI A;  1WKL A;  4W98 A;  2DY9 A;  3EVO A;  1NHK L;  1XQI A;  3FCW A;  3EVW A;  3VVU A;  3PJ9 A;  3FBF A;  2NCK L;  3FC9 A;  3Q8V A;  3R9L A;  3ETM A;  1PAE X;  3BBB A;  3ZTP A;  1F6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...