1U8WA

Crystal structure of arabidopsis thaliana nucleoside diphosphate kinase 1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase I
publication title Structural analysis of Arabidopsis thaliana nucleoside diphosphate kinase-2 for phytochrome-mediated light signaling
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 42
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1u8wA00
3DDIA 3BBBA 1NSKL 3ZTQA 3ENAA 3FCWA 1NLKL 1WKLA 2BEFA 3ZTPA 4FKXA 3EVMA 3FKBA 3BH7B 3B54A 5C7PA 4UOGA 3EMTA 2B8PA 3Q83A 3VGSA 3ELHA 3ZTOA 3VVUA 2AZ3A 2CWKA 3G2XA 4O0NA 2DXFA 1S59A 2HVEA 2HURA 1F3FA 3MPDA 3NGUA 3JS9A 1LWXA 4HR2A 1NSPA 4S0MA 1B4SA 1BE4A 3L7UA 1NUEA 5CABA 1ZS6A 1W7WA 3R9LA 4ANCA 3Q86A 1MN7A 2NCKL 4EK2A 2DXDA 1F6TA 3BBFA 3ZTRA 1U8WA 4C6AA 1NHKL 3NGRA 3FBEA 4ANDA 4FKYA 3FC9A 1B99A 3ZTSA 3FBBA 3VGVA 3EICA 2BX6A 3ETMA 5CAAA 1MN9A 3Q89A 1NDCA 3PJ9A 1NB2A 2HVDA 4F36A 4ANEA 1NDPA 3FBFA 1EHWA 1XQIA 1NDKA 2B8QA 3VVTA 3Q8UA 3Q8VA 4CP5A 4UOFA 1HIYA 1HLWA 1NPKA 3BH6B 3EVOA 2AZ1A 1WKJA 3DKDA 1PAEX 1BUXA 3BBCA 3EE3A 3FBCA 3FCVA 1NDLA 1HHQA 3VGTA 1NSQA 3EJMA 1JXVA 1VYAA 3WX8A 1K44A 3VGUA 2DXEA 5BXIA 3PRVA 4KPCA 4WBFA 3NGSA 2ZUAA 1LEOA 3GPAA 3GP9A 1XIQA 3NGTA 1UCNA 1S57A 1BHNA 1NCLA 1S5ZA 2DYAA 1KDNA 1PKUA 2VU5A 3EVWA 3Q8YA 4W98A 4DUTA 3B6BA 2DY9A 4UOHA 5IOLA 4DI6A 3EM1A 4ENOA 4F4AA 4DZ6A 1WKKA
chains in the Genus database with same CATH superfamily
1VC6A 4DV2F 1N33J 3J7ZT 2RQ4A 2I5JB 1RT6A 1CG2A 3C6UA 2NS1B 2FVPA 3QJPA 2PI5A 2DHAA 3HD1A 2WSCC 3MM5B 4CLFA 3LQVA 4OYXA 3MECA 1FI4A 1EX8A 3OSPA 1KRPA 4QJVA 4CWBA 2ZC4A 1G4CA 2VASA 4B9TA 5HP1B 1X9WA 2CKWA 1XQIA 2MY8A 3JTOA 4OYWA 2ZEJA 3MAAB 3I0RA 2IJRA 3OFHA 2RKIB 1JKHA 1RWOB 3VQSA 3NWRA 2R2UA 3TVYA 1NSQA 1IWGA 3PKMA 4IUFA 1L3VA 1LEOA 2YKOA 5CH7B 5KFHA 4X84A 5HQMA 3MEDA 4X64F 4H4MB 4B3SF 2CPIA 4ZHRA 2BEFA 1CEZA 4MKBA 1NHVA 2Z8QA 5C7PA 2KYXA 1HD1A 3FCHA 2IJNA 3RR7A 2CZ9A 2OELA 1REVB 2LVWA 4ZS6A 1CS4B 4QW8A 4KTQA 1DQ9A 1S77D 2EBEA 2J7UA 4WTYA 1D1UA 4B3TJ 1RU1A 3D68A 1S7IA 3JXOA 2IA6A 3CCTA 1WG4A 1FNOA 5IC6B 2JL9A 3WQPA 1X0FA 1JIHA 2DNPA 3GWCA 5HMYA 3FBBA 3ET6B 1U26A 5EX3A 2DNQA 3C19A 4RW6B 5F8GA 5HMZA 2MQQA 2KHCA 4NYZA 3C66A 2J7WA 1VQ5S 4ICLB 3H4BA 4NLUA 3U1LA 3D0GE 3HFKA 2RQKA 1T94A 5T7LB 3D6HB 3AD8C 3RB4A 2M5YA 4CLPA 3FBCA 1JLCA 1GT8A 1V9OA 4DV0J 3HM9A 4TLQA 3AT1B 1JMTA 2A0FB 5HATA 1VQPS 5HBMB 1HBUA 1BHNA 3P49B 3MR2A 3MR5A 1P27B 2CQ3A 2Q6CA 4CH0S 2XC9A 3W5XA 3RU0A 1TMJA 2WVFA 4U95A 3H7HB 5KFFA 2GIRA 3BYPA 1VMBA 4QIEA 2DCUB 2EXUA 3FSIA 2ZFHA 1XNQJ 1H2UX 3HHLA 2UU9F 3BGFA 3CJSA 4TU8A 2BBEA 3HHDA 3MDFA 5JVHQ 3T1AA 2O66A 1Z2ZA 4XPEA 1C1BB 3LANA 1DLOB 3BGLA 5U47A 3DN9A 2CQPA 2AHOB 2G1DA 2N7CA 3R1HA 2KM8C 3MPUB 5L39A 4AXIA 1XMBA 3VAKA 1R43A 2J9EA 1ELOA 3MD3A 1GMWD 3FMBA 4I6AA 1FDAA 2CUYA 1FE4A 1NJZA 4G1PA 3EVWA 3TO8A 3MM8A 1D0EA 3MMCB 2LP4A 5I3QA 5IXUA 3KJFB 1JLQA 4FF3A 5DG7A 3KUEA 3GJQB 4ZVOB 1PYSB 1HQUA 3RR8A 4C2MA 4NEZA 1XMQF 3MPDA 2VG5A 1VBZA 2XYHB 4IFYA 3H2VE 4U96A 1TELA 2R8IA 3AA8A 2V6AA 3CULA 2HNDB 5KTQA 2KXNB 1J5EF 4X4OA 3IXQA 3TEGA 3ETOA 3DRRA 2OPPA 3N01A 5DGBA 3P8BB 2CXEA 4B9NA 1FK9A 4TYAA 4LQ3A 2C28A 1U1KA 2HNYB 2YNIA 3PY8A 1QVGR 1OMSA 2OI2A 1RT7A 2VB6A 2JEJA 3AQPA 5KG6A 1Y5LB 1QAYA 3TZZA 1WG1A 4AXJA 3MEGA 4EGLA 3KLFB 5BJRA 1FVSA 2FHMA 1UWAA 3GIRA 4ZJOA 3POTB 3BZQA 4C9DA 2V4JA 1S9EB 2KN4A 1KVIA 5KT4A 1U6FA 2RQMA 2V2KA 4MAKA 4BCAA 4KH0B 1UW9A 3H59A 2M2BA 3DCAA 2HFVA 1NUEA 4FXVA 3OXFA 2VFTA 4DPWA 1G3OA 2Y1LB 4ERDA 1CJVB 3KK2A 4R5PB 3MHYA 1IJFB 3PFEA 4ECXA 2I0XA 4KQZA 3OR1B 4XAKA 2QA4G 4Q2LA 1JLEB 1FKOA 1QJHA 1C4AA 4KBIA 3RAXA 2GQ2A 4J37A 4HACA 3DM2A 2GVZB 1AYEA 2UXCJ 1QSSA 3E01B 4FS2A 3MEEA 4PG8A 1ZBTA 1VK3A 1RKIA 4UUWA 2HS3A 4YHHF 1LXNA 1LWFA 1N6QB 1FWKA 1RU2A 2VL1A 2OMOA 4OFZA 4K2JA 4I7FB 1YITS 1X4AA 2RUGA 2MZRA 3FRZA 2CPEA 4U7UD 1VQLS 3CWJA 1HMVA 1EJ7L 2KFZA 4WPAA 2YKQA 2R7UA 2CJYB 2FJWA 4NLVA 4RNHA 2AGQA 2R8JA 5I42B 1FEEA 5ETNA 3AHPA 4ED5A 4FVMA 2UUAF 5D3GB 4A8SA 1QSYA 3MUVP 4DR6F 4EUVA 1SJRA 1Q7YT 4CP5A 1KONA 2VZ9A 2BA9A 3C6TA 2H5IB 3ILIA 3TZXA 4FDFA 2F8EX 4CLYA 1AFIA 5BXIA 5IQ6A 3HT0A 2HNZB 1CSJA 2HK2A 3DHXA 4LF9F 4KFBA 5KFCA 4AL6A 4U8YA 3NGTA 2D1CA 1RTDA 1QY7A 3EPIA 2GQQA 3QLHA 3RTVA 2HRUA 3EVMA 4C8NA 4AQYJ 4R25A 1F5BA 1DBDA 2JFDA 3CIMA 1FWPA 2W25A 4KAIA 1R3NA 2CJXB 3PW5A 2A1BA 2HURA 2J5AA 3M32A 4ZLPA 1RAOA 3MR7A 1S99A 4OYPA 4MH8A 1X4GA 2FY1A 4ES2A 2ZD1A 4QU6A 1SI9A 3G96A 4RBUA 5GADU 4J9NA 4RUHA 2XCAA 1SC3B 4C3KA 1S1XA 1I6JA 4LF1A 4FPIA 1EP4B 2UVWA 3QO9A 2EWHA 1L3SA 1F0XA 5BYQA 4RU2A 4EBDA 2D9OA 2A2DA 2QMWA 3LP2B 2B7BB 4C8MA 5EDWA 2VPXB 3BR9A 2W9AA 1JLBB 4O3SA 3VAGA 2YWGA 1TQLA 3FSXA 2NPFA 2ZM6F 2ZH5A 5IFMA 2X1AA 4WXWA 2ABYA 4QYRA 3PO5A 4K7QA 1VQSA 4M5KA 5IOLA 1FCAA 1SL0A 2A18A 4TU7A 4LSLA 5CYQA 4PUOA 1I94F 3M6UA 2I1RA 4G6VB 2DR6A 2CPZA 4RUAA 5HQLA 5DQGA 2MKJA 4USTA 1CULB 1C4CA 3Q2SC 2WRMA 2DGTA 3W66A 2NSBA 1RWVB 4O44A 2KI2A 4QPXA 4JI3F 2MY7A 5CD4H 4M63A 3JTPA 4DV5F 2NUUG 4PXBA 2CQCA 4IG3B 2E5GA 3GJRB 3M9OB 5C5JA 3ZTSA 1RZMA 2H4YB 1J2VA 1P9QC 3W9JA 1GXUA 3IGNA 4DL0C 2JEGA 2HQFA 4QCLA 4IDKB 2LQBA 4RUBA 1F5CA 2KHDA 1S4EA 5L1JA 1MMNA 1U25A 3PX4A 3AXKA 5CQGA 4K8RA 2RMLA 1IBMF 2NXUA 5CXTA 2BJ8A 4LMZA 3BM7A 1VYAA 3G82A 3I4HX 2R7OA 3EXCX 2N3OA 2I8EA 1YBUA 3VAHA 3W9HA 4NCAA 3FEZA 1RHJB 4K50A 2K3IA 1YRTA 2X1GA 1F60B 3UN5A 2E5LF 5CZVA 2F4VF 3R2DJ 1RWUA 4A8MP 5HMXA 2MZTA 2MB0B 4QYZJ 2OPQB 2IC3A 2Z56B 3OHAA 1JLFA 4LR8A 2CNLB 4J9VA 3NGUA 2CQ0A 3OPKA 2VDHA 4P9SA 3G87A 3OUYB 3VQTA 2RUSA 4CZCA 4ES1A 4ZLLA 4G1QB 1PBUA 2Y1IA 3CCZA 2ACYA 1YTYA 4I64A 1XTZA 2ZZTA 4OYIA 2M4MA 2I5JA 2QX0A 2FPHX 3IAS9 5C2GA 4PQUB 3MURP 2IPOB 5HVFA 2ACMA 2M8HA 1NNDA 3T5LA 1HQ2A 2KL8A 3GLJA 2AMCB 2B6AA 4CRJA 4ZVRB 1XR5A 4RO0A 3MM5A 1Q78A 1FVQA 1NBEB 5DDQC 1WOSA 1NK9A 1S7HA 2MGZB 1N32J 4IRKA 4FF1A 1R6YA 2V9KA 5GMDA 3DHWC 3B4MA 3KK1B 2BJ3A 4MMOA 4QR2A 2XY6A 3VGSA 3MAAA 4XIUA 2RKIA 3R6GB 5CYMB 4UZBA 2F5GA 4OYAA 1YJUA 3M6XA 3HSJA 1OYEA 2JHEA 2R2TA 4YB6A 3G86A 4X62J 7FD1A 2ZE2B 4U67Q 2JX2A 4KHMA 5IV4A 3LA0A 3UDVA 5LMNF 4H4MA 2JEIA 4BS2A 1VQKS 3OTCA 5A8WB 4C8YA 2XLIA 2HK3A 3A8EA 4RWWA 4PEOA 1REVA 5K20B 3HCXA 4UOFA 5AT1B 4OHYA 2VKRA 2E1RA 2FVQA 2JC1A 3VAFA 2W01A 4ZVHA 2HMIB 4LR9A 3HVRA 4WCEQ 5KFTA 4B02A 2I38A 3K5MA 2XMVA 1PKUA 1N0UA 2FD2A 2LEAA 3ET6A 4Q44A 3NOGA 4RW6A 4JI8J 3ZTPA 3A1YG 4ICLA 4I2PB 2MHNA 4F02A 1VQNS 1WC5A 3VVUA 1HNZF 2HHXA 1UTAA 5T7LA 1K0VA 1RHRB 2F8MA 4K4ZA 2B4VA 1SC4B 5L1LA 2QSFA 1F6TA 2CQDA 5HBMA 2XG8A 3QRQA 1EB0A 4WF9Q 3UNYA 5RUBA 1AB8A 4ZVTB 2BXJA 4GO7X 1MW7A 1HNXF 3RZAA 1U1QA 3BJYA 3D67A 3HLUA 1TUVA 2R7SA 1HR0F 2Y3YA 2Y8YA 4ELVA 1IUJA 3V4IB 4OYOA 3M1VB 3IFEA 3AOCA 3GTYX 3DRSB 4Q5VA 1RYSA 1K44A 2QLWA 1MROB 3CD7A 3O6QA 2FGCA 5KT5A 1LXJA 1S57A 4ELUA 4W98A 2AEJA 2X1BA 5E41A 2L9DA 2V2ZA 3S01A 3CJQA 2KTQA 1S97A 1YGYA 2YH0A 4GMKA 2JFKA 1C1BA 2Y0BB 1DLOA 4Q8EA 4JB8B 2X51A 1N36J 3NRBA 2E9ZA 4X65F 2LQ8A 5IT9U 2NYHA 3L3CA 4DUZF 1GMVA 1DFDA 1RBLA 3QAEA 2ILZA 3LUYA 3RAQA 3SV4A 4GKJF 2E5JA 4UUXA 1GQEA 4PXCA 3CCMS 3HJFA 2J76E 2G0JA 3MMCA 4P10A 3DGPB 3RBZA 3J7A1 1LW2B 2HRTA 2OSQA 4RW9A 3D6MB 4NA2A 4NLWA 2W2MP 5GAEI 3LWMA 2MPUA 5HI7A 3CJRA 3LAMA 1N5TA 2HNDA 4MFBA 3MR3A 3O5TB 4ZCLA 1X5TA 1R0CB 3MTJA 4JI7J 4DPYA 4CT9A 5AJ3F 2DB1A 2PO4A 3PDNA 1H3DA 3PJXA 4IR1A 1P8GA 2HNYA 5LT5A 2NXNA 1K0TA 4E2FB 4USVA 4BWJA 1FA0A 1NK7A 3R6LB 4C0OC 4YUDA 5D77A 4Y3CA 3RRHA 1N8RT 4JYAJ 4DPXA 3PFOA 1Z2LA 1HYSA 3A4TA 3D6TB 1V3ZA 1AXQA 3PM9A 2PC6A 2YKNB 3KLFA 4WFYA 2NQPA 3L09A 1W26A 3M4XA 3KLVA 2QGFB 4XTTA 3POTA 3FNNA 4QIGA 1FRIA 3NKYA 4EBCA 1S9EA 4DR5F 2J9CA 4A47A 1FRJA 4KGKA 5GAGU 2KDOA 1WKJA 3ZZPA 5F0WA 1Q95G 2OAUA 4LFBF 3N6NA 3W2WA 5BR8J 5HLFB 1KFSA 1TK8A 2ZBRA 4JV0A 2XYPB 2RF2B 1CJVA 4R5PA 2XCPA 2UV8A 4LF7J 4DV6F 4DV7F 4KPYA 2VJVA 1JLEA 2LEBA 2H5JB 1KC8T 3UD4P 2GVZA 4B3RF 2KYZA 2BJ1A 1BMQB 3E01A 4X4VA 3BDEA 3ZZ0A 1GXLA 4NLXA 1S6PB 3KG4A 4GO5X 2CNNB 5DGAA 3IA0A 4JI4F 3HPOA 3M05A 1N6QA 3TYTA 1UFKA 2IRYA 1URRA 3L9ZA 5FJ4A 1TMMA 4PG7A 1WEXA 1OJ4A 3A8KA 3FMWA 1HWJA 2RAQA 5I42A 1HA1A 3MOJB 1DTTB 4DLEA 1NHUA 1IBLF 4KKOB 5D3GA 2OFHX 3I5BA 3RBEA 2YX4A 3B6BA 4LF8J 4CNYA 3TA0A 2KVIA 1IBKJ 4DX6A 4JV5J 2UUCJ 3FZBA 3ENAA 4NLPA 5LXRA 2XY7A 4OHWA 4X4UA 2D3UA 1FKPB 3HVWA 4N8OA 2V4QA 1H7XA 3AD9C 2HWTA 3EZOA 3OVAA 3TUZC 4NCGB 4BWMA 1GMWA 3K0JA 3GIJA 3VGVA 2HAIA 1M5PC 4JOUA 3KLEB 4HTIA 4PG5A 1T9XA 2CZVC 3IG1B 3QGHA 1GFWB 3MM6A 1XR6A 3WHIA 2H54B 2D41A 3PEHA 4DV2J 1U4BA 2IVFB 5IQQA 5KAKA 2IM3A 4RJVA 4L73A 4OI1A 1SJFA 3BPDA 1RTIB 2RE1A 1LK5A 4I68A 3NBPB 4YB7A 3IR6B 5AE2A 2BW7A 1IR1A 3UDEA 4RU9A 4DSJA 1X5OA 4RLEA 1LV5A 1CJTB 2N4CA 3RBDA 3MM7B 2H3EB 1Y3KA 3CD6S 2L08A 4MKVA 2EKNA 4ED0A 3TZYA 1RWNB 2HIYA 1KEKA 1JLBA 5F3TA 1Q16B 3GFYA 3O44A 3QATA 3Q86A 1FD2A 1RACB 2YNGB 2GHVC 1UVIA 4A8OA 3UN2A 1WTFA 2KM8B 1SKSA 4ITSA 5THWA 5IV3A 1QUVA 3U02A 1V3SA 5HJYA 2RHSB 3MCOA 5EHHA 5F8IA 3OL9A 4ZVFA 1C0UA 6AT1B 4LRDA 3Q8VA 4X64J 2HHVA 4B3SJ 1CULA 3BH6B 4C3LA 2CG4A 3BYRA 2PFDA 2R42A 4YR3A 2LMIA 1F9FA 4Y00A 3DMJA 3D5MA 4IG3A 3ILLA 3CJ0A 5A6WA 4V19J 2G2ZA 3MCSA 4C8ZA 2LDYA 1M0SA 3I31A 5IM0B 1EIYB 4ELTA 3DLEB 2QMXA 1TL4A 4IDKA 3M9NB 3D1QA 3OXGA 4LT6A 3OTBA 2RDIA 1ZM3A 2P9EA 3AY0A 4O0NA 3KMSA 3ZO7A 2MJNA 4P75A 4WK3A 2BYCA 4NA3A 1ACMB 5C42A 4I2QB 1ZZNA 2DITA 2FVCA 4EO6A 4DWIA 4K4XA 2ZNZA 1KQKA 3G8SA 5EUHA 2YKPA 3HD2A 1GAOA 4HL9A 2HVDA 3DLKB 3R7NB 1G7CB 3KTQA 2B8QA 2E7WA 1OWXA 1CBKA 1MWQA 4HHUA 4QWCA 3GR0A 4QPTA 1RADB 2HQIA 1E6YB 5KG7A 5F9LA 1ZAWA 2CNOB 3OUYA 2K7JA 1RI7A 3C8YA 4AUKA 1WHXA 4G1QA 1QSLA 5K8MA 4NOHA 1N4LA 2JLEA 5FD1A 4K5SA 4D3HA 2NXCA 3SEOA 2UU9J 2ROPA 1WKLA 4DSIA 3PW2A 4NLYA 4PQUA 2B8PA 4FXDA 2OUGA 3I6PA 5A6PA 3UDCA 4C3MA 1ICEB 2BVZA 3QAUA 3W2VB 5ADZA 1MSWD 2YKAA 1IKVB 3J81U 1S9FA 1EQ0A 1V6HA 2CQBA 4L72B 3DLBA 3QGPA 2ADBA 2QYCA 3P96A 2DHXA 4LVNP 2R4FA 3WZ0A 2C2OB 2GFFA 4ZPWR 3KK1A 3UW1A 1NB2A 4J9MA 1NK0A 1OPIA 2K06A 1RQ0A 1WC4A 1W2IA 5CYMA 2GO8A 3T9NA 5HAOA 2WTFA 1FX2A 4ZDNA 3M8SA 1VRQC 2QL7B 1X60A 2ZE2A 1WF2A 4YEAA 4ZCMA 4CYUB 1IM6A 3FVYA 3D7SB 1XMQJ 5A8WA 2D74B 1NSKL 3M8PB 1Q81T 2HG4A 2VQEF 1KNZA 1J5EJ 1U45A 2J6UA 3GSDA 2G4BA 3DDKA 2RD5C 1YVFA 3A3OB 4B3OB 1BQMB 2W4DA 1WEYA 1RWMB 5KT2A 2CIMA 2DH7A 3V81B 4TLRA 5D6GA 2UVVA 2HMIA 2ALZA 1Y9OA 1BC6A 3QGGA 3C6UB 1N88A 3PNIA 5EX0A 5CA5A 5M2UA 1AT1B 4F36A 4H4OB 3C16B 4I2PA 4HH0A 1NDKA 2OIHA 1RLCL 3AJDA 2RNEA 3KJNB 2BABA 1QTNB 4QR0A 1O51A 4QWAA 2JSXA 5ETOA 1Q8KA 2JWNA 2OTJS 1FHTA 4Y2KA 2XZWA 1TK0A 2W2OP 2ZWOA 1T9WA 3N5FA 4BLGA 3IM8A 4DDFA 2GS8A 3U1MA 2YPYA 4WFXA 1RT3A 2XM3A 1SH0A 2A10A 1YJNS 2A3JA 2EI5A 3M1VA 5HJXA 2HPUA 3DRSA 2JH3A 1VRTB 1U1RA 4ED1A 1MROA 5DJBA 3W8PA 2MEWA 1XNRF 1S9GB 3TANA 1NH7A 4PWWA 4OQJA 1BQXA 3N6MA 1R0AA 3M8WA 4OIXA 4U9RA 2BANB 3JAMY 3LTOA 2HBZB 3QBCA 3J81j 4DQPA 4WZQA 3UQSA 4C48A 4HVZA 4YHHJ 3MCNA 4LRAA 3TUIC 2DHGA 4H54A 1K47A 1W2BR 4X4NA 2PDAA 2KG1A 5HL7Q 1U24A 3TA1A 2EKYA 2HKEA 2C2RA 3NEKA 5E3PA 3BN7A 3RB3A 6FDRA 1VQ6S 2GV1A 2UUAJ 3CJ8A 3DOLB 3DGPA 1X7VA 3OHBA 1LW2A 4NASA 2IRUA 4NMXA 4DR6J 3QJLA 4V19X 2AZ3A 3RB6A 2D9PA 3UDLA 1S1VB 4M1KA 5KFOA 4DL7A 4X4QA 2GGPB 2BJDA 1NK6A 4C4WA 5D78A 1TL1B 4ED8A 3P5TL 5IT4A 3GJSB 4LF9J 5JJBA 1CC7A 3TAMB 4J9KA 2OTLS 3NMRA 2XYGB 3QT6A 3LGHA 3KJQB 2KT5A 1NK8A 2C2KB 2ZH1A 1RHQB 2HGLA 3E3XA 3KNGA 2JVOA 2GQCA 1OY6A 1QTMA 2FJVA 3H4DA 2YKNA 2Z2ZA 3HF5A 5DZ6A 4MIWA 4FP9A 5F8LA 1JLAB 4CNZA 2H9ZA 4ZITA 4ECQA 3CCES 4GKKF 1B0TA 5D4PA 4UY85 4JI5F 4YOEA 2EPIA 2Q79A 1KKHA 2DXFA 2CZ4A 1G2EA 4ZLJA 1PIEA 5HLFA 2M7SA 3KHLA 3R8YA 4XK8C 5DLGA 2R9LA 2RF2A 2BM1A 1ITPA 3TOQA 2NPIA 2RT3A 2EFVA 1M5OC 3SCIE 2LA6A 2ZM6J 3ZZRA 3Q89A 4H4KC 1V5VA 3Q8RB 4DL2A 3D1HA 4RUCA 2L9NA 2FQQB 2C3PA 3B8HA 3I32A 4MIBA 1I94J 3VF0B 2HSEB 2ZWPA 3K8WA 3HZEA 3NGSA 1FFGB 2MKCA 2BE7D 4U8VA 3BDPA 1RTJB 2H48B 2HAFA 5J1EA 4NLDA 4DV5J 1SJ3P 1RAJA 3OTOF 4A48A 1NZAA 3GFHA 1RT7B 4Y65A 4ER8A 2R3VA 2C3YA 2DKOB 2PT0A 4F26A 4LFCF 3SCLE 3CDAA 4RNNA 2VC1A 1ZYQA 1LWXA 3PJWA 1DTTA 1PJ5A 2UXDJ 4KKOA 1AUDA 2HWIA 2EFNA 4FKYA 4ECVA 4B9LA 2E9TA 2OD6A 1S48A 1IBMJ 3DGVA 2HQCA 1FDDA 3NS7B 4U6PA 8AT1B 3CJTA 4ANEA 4DX5A 4BC7A 1X9SA 1FKPA 2W7PA 2FGOA 2DO4A 2D3ZA 1TR0A 3JSBA 2E5LJ 1UZHA 1BUXA 2F4VJ 3WC2A 4Y2AA 4NCGA 4OI6A 4YN3B 1R8HA 3CE8A 2RQCA 1VLOA 1L3KA 3LWLA 3TRGA 5FLXY 4ZIWA 4AL7A 3KLEA 2HHTA 4LRCA 3T1YF 4AL5A 4IO1A 3IG1A 2CQ4A 4HACB 1VI7A 4F25A 1KVKA 3W60A 2CDRB 2CJBA 5LXYA 3TWZA 1WHWA 4OZ0A 3CD0A 2WVCA 4ZVSB 2HVEA 4WXOA 5DO2A 2CQHA 1F3FA 2MQOA 5F8HA 3QQCD 4KHPJ 2LYVA 4O4RA 4ILLA 2ZUGA 1RTIA 4OI0A 1O8BA 3R5JB 5KG2A 1WDTA 3BSAA 1HMVB 2HHQA 4OYMA 4ZVQB 2DIUA 2MKSA 1NKEA 1UJ6A 1CJTA 5A8RA 2HFOA 3D66A 3MM7A 3O3LA 2GNKA 2Y1RI 5HN0A 3SFUA 2L41A 1VDHA 1T3NA 1WWHA 2OLWA 2VFSA 3HZGA 3SCKE 2AEMA 3MXHP 4ILMA 1HL6A 1HNWF 1SKUB 3ZNUA 2EK1A 1NCLA 2WK4A 2ASYA 1UFLA 3N9UC 3ZNJ1 2UVUA 1RK8A 2BRKA 2Z2YB 5ETLA 3DLGB 3TARA 3HSDA 4WZMA 4KFBB 2XS5A 2OH2A 2CJAA 4Q45A 5LMNJ 2P6SA 3UVJB 3PW7A 1MMLA 3I87A 3TAPA 1RDRA 2W4CA 4KJIA 4U7CA 3EDQB 4P74A 4CIOA 2I2YA 4HDGA 1ZPVA 4MKAA 5KFNA 2OSRA 1S79A 4Q0BB 5IM0A 3DLEA 1IR2A 1WHVA 1QAXA 1S0NA 4I0WA 1HWIA 2ZD1B 2IAJB 5J2NA 4N8NA 2IHR1 4DV3F 4X4RA 4OI2A 5F8JA 1PAEX 1RAAB 5HANA 3TI0A 4B9MA 1RE1B 2R2SA 1N56A 1HWLA 2AX0A 1Y00A 3DRYA 3D4JA 4I2QA 1HNZJ 5H1SV 3PYGA 1XNQF 5KFMA 4N5SA 2GO9A 4ZIVA 2YWEA 3BPSP 3QSYB 4Y34A 2GJFA 4W92B 2U2FA 1FWLA 3DLKA 1GXTA 4W90B 1U02A 3ZXWA 1T9UA 3MOZA 1KR4A 2AEFA 1HNXJ 2MXYA 4R8UA 4MK9A 1HW8A 3JQJA 2ZHBA 1TL5A 3R7SB 2R8GA 3B78A 4DX7A 2QIFA 1HR0J 4OJ3A 3R3TA 5FIIA 1JJ2R 4WKRA 3NG8A 2CQ2A 2DRBA 2KRBA 2ASDA 4O44B 2BJEA 3EX7B 1X0PA 5HQ8A 3S1TA 3CCVS 3UD5A 1OSCA 3BQ0A 4DS5A 2O67A 5GAHI 1CQMA 3OLAA 3NLCA 1BWVA 1IKVA 4QR1A 1YQHA 1ZM4A 1RT1B 1Q53A 2VQFF 4TQSA 3CDWA 2C2NA 3C14B 4RW4B 2XMMA 4X65J 4F4AA 1U6BA 4I4BA 1AA1B 3PV8A 4DUZJ 1YLXA 1M1GA 2O3DA 1EKRA 4GKJJ 4RBTA 5LM7E 3JTNA 4CH7A 5K8NA 1ZTWA 2UUBF 5LMUF 1L5UA 5D8HB 2QTWA 1SPBP 1HI1A 1BLUA 3Q0AA 1NPRA 3JQMA 4HH1A 1JQGA 4DG1B 5KFPA 2C2EA 3D2WA 4CYUA 3NGRA 4OZ5A 1HI0P 1RT4B 1SL1A 4MK8A 5LOQA 3THTA 3M8PA 3G4SS 1EKSA 4PXEA 2AWZA 3S8SA 2MSSA 1M5VC 2FJXA 4A8FA 1VC5A 2XMJA 2ZDOA 4HLBA 4B3OA 1RKJA 3ISNC 3K5OA 3V81A 4OX7A 4ETXA 2ASJA 1K8AT 3R27A 1T9YA 1Z4UA 3PIPQ 3M7VA 5AXMA 3NOCA 3J7Z5 1TKZB 2QLJB 5L1KA 1SIWB 4FN5A 4C8OA 5GADI 2B6AB 3QWPA 1KQGB 3K58A 4H4OA 1I3OB 3C16A 2JEFA 5K14A 2IDLA 2DHSA 4Q8FA 2JJ4D 3M6WA 3PHEA 1R89A 3EZUA 3JS9A 4TYBA 5C24B 4KHRA 4QW9A 3S7RA 3I5AA 2ZDPA 1JX4A 4LF2A 4I1TA 4IH7A 3FUYA 4XDCA 4O3QA 4ZK7M 4LFBJ 4B17A 2FLOA 3AH6A 1U6ZA 2L3MA 3W1YC 2VIHA 3TNVA 2QO3A 4PZVA 4DV7J 2M0GB 3BGRB 5I3PA 1VRTA 2OEJA 4DR2F 1TTHB 2G9OA 3VAIA 4DF8A 2ZITA 1S9GA 3LOUA 1R27B 1RT2B 1ZOTA 3ZZYA 2CPFA 2CQ1A 2FVSA 2YX1A 4B3RJ 5D0RA 2KT2A 2BANA 3IO1A 2BOAA 4EEYA 2VBYA 5ETVA 8RUCA 3B54A 4M5IA 1SJ4P 1PJ7A 3ZC4A 2HQDA 3OFFA 3P3DA 1VQYA 4NCBA 4ZMMA 2G2YA 2Y0SD 3GIIA 3H40A 3UFCX 3KJVA 3ZTRA 1S0VA 1LKZA 1NHKL 2V67A 2BJ9A 2UXBF 4ZP8A 2HWHA 5B0CA 5FDLA 1FXLA 3K5LA 4ID8A 1IBLJ 2WBRA 3DOLA 2M88A 2RHQB 2ZBIA 1X4HA 2VJUA 2YQ1A 4J9RA 2ROEA 3CXCR 5AXLA 2F40A 3DKDA 3P6YC 1S1VA 4ECYA 1XWLA 4X4PA 2DR5A 5M2RA 2DXEA 4OJ1A 2GGPA 1T11A 5J2MB 4TXSA 1TL1A 2ZH2A 2KJWA 1NSAA 3GIMA 2VBZA 5L9NA 3TAMA 1QE1B 5L8RC 4KGMA 4HYKA 4QZVB 3KLIA 1MG7A 2OMLA 2OKQA 1R0BG 1KWMA 2UUTA 2XZDB 3H8YA 4PRFA 5DDOC 3NNHA 4URQU 3SV3A 3EZ5A 3HULA 2KO1A 1UW4A 3WBZA 5B08A 1FRXA 3GIKA 4ANDA 2HVZA 4PWUA 5HSPA 4USJC 5ETRA 1N5QA 2WHOA 1JLAA 2DNOA 2QSWA 4DL3A 2POKA 3UD3P 2W1BA 4F4WA 2AP6A 1LFWA 1X8DA 2Y8WA 2E29A 2AYBA 4BBYA 1RAFB 4YDDB 5C2CA 4QQBA 3M2VB 3Q8SB 2EFPA 1ZM9A 1TVRB 5GVQA 1H0HB 3MCMA 5KG3A 1CQNA 1YRUA 1S5ZA 4RW9B 3OR2B 2CPJA 4NI2A 2PMZD 2XI2A 5J2PB 4DR1F 4GVBB 3KHHA 1A7GE 3MAQA 4NE9C 2H51B 4UOGA 5KOXA 4F0MA 4MFBB 3DOMB 2AJ4A 5LSOA 3OT9A 4ZCKA 3NGKA 1LWEB 1X5PA 3TUJC 2D3O1 1I1GA 3OV7A 1B4SA 2YWHA 2KZMA 1BXNA 2V34A 1RTJA 2MZJA 4USUA 1KN6A 4N7TA 3SSRA 3RBXA 4IOCQ 1Z1ZA 4LREA 5KFWA 4KH1B 3SSSA 1KBRA 3CC2S 2F4FA 3QWUA 2RIJA 3NCRA 1N0VC 3OTDA 2J6SA 1HYSB 3VVTA 1LFPA 3UWTA 1M5KC 2FIUA 4QU7A 1X31C 2KZZA 2XSFA 4ZPTR 3CMAS 1XJWB 2QLXA 2ROGA 4ZP6A 2E1MC 2DGUA 4KYZA 5HVGA 3THVA 3T6BA 2VFRA 3H42A 4DFPA 4Z7CA 2IFXA 1QVFR 1JNRB 1WKKA 3W2WB 5GMKa 2AJFE 3W64A 1ROFA 2DR9A 4NX9A 2DISA 3GB0A 5KFYA 2CQIA 3I96A 2WB1D 5K8PA 3J80Y 1JK9B 2LA4A 4NZ0A 5KFEA 5KFDA 1HWUA 3F41A 1J27A 1QM9A 2AKWB 4ANCA 2NCKL 4NLGA 1LQ9A 3UNGC 5F0UA 2V2VA 5GMEA 1XEZA 1N32F 4UY8T 7AT1B 3TJAA 4IRDA 1J5OB 5F3ZA 4ZVUB 1I51B 4X2BA 2CYYA 3HKWA 4DN0A 3NL0A 2V8HA 3HVTB 2D69A 1MNEA 5KFJA 2V8DA 2K3KA 2XNRA 3ICLA 4J9SA 4RPFA 2KFNA 1PO6A 2VUGA 3FCVA 3VCDA 2BW2A 3FEXB 4WBFA 2Q3PA 4K4VA 2B43A 1NRKA 2DR8A 3DOKB 3RW7A 3DC2A 3ZTQA 2WVDA 3KLGA 2WZ1A 2EFGA 4ATNA 2XHCA 4J9UE 3QZ7A 2IBOA 1U2CA 2WW8A 2DNRA 1WNEA 3CSKA 4P73A 5DZ7A 2E44A 1VQOS 1Q7LB 1NB7A 1ZAVA 2WSFC 2RJZA 4YY3F 4PWDB 3UCGA 3UCUP 4TKTA 4P6QA 4K0KF 2LFVA 2OPSB 2VG7A 2AJ0A 5CAAA 4ALZA 5HROB 2OJ3A 4USHA 4JV1A 3DLGA 1FTRA 3OL7A 1EHWA 1T0TV 1E6VB 1U1OA 3UVJA 1RAHB 2DGWA 1Y0HA 2UP1A 4TN2A 3FGVA 3SIPB 4ZP9A 2VQEJ 2MQMA 3MM6B 4AD6A 4ZN3A 3LF0A 3EWGA 4CM0A 4LBIA 1KOHA 4YMEA 3M8RA 2DJWA 2O1PA 1EAYC 4USMA 1SV5B 3PX0A 3H25A 4Q0BA 1Q79A 2DNMA 2B4UA 4F4YA 4C11B 1EARA 4KE5A 2IAJA 3ZTOA 1VBKA 4WP3A 3IRXB 5A2QY 3BS9A 2DGVA 3MGJA 2P2CB 1D9FA 3GILA 2VFUA 3EPGA 3KKFA 3IRWP 5GAGI 1YZ6A 2VKZG 4LF6F 1KTQA 2WB4A 1VOMA 2DD8S 3F56A 3CC7S 5K8OA 1WF1A 1X5SA 4DU8A 5SUHA 2W8KA 1PSDA 4DPOA 3SZ2A 3PJ9A 1S1TB 3HO1A 1MU2B 3MFHA 3W9IA 5G0RA 2PI4A 4DMZA 3T9ZA 1RBAA 3PO4A 2J0QD 4K5RA 4JI1F 1V5IB 4J9OA 3W62A 2O5DA 2DIVA 4DV4F 1KQFB 1Y11A 1RT5B 4RNFA 5B0GA 3LH2S 1C0UB 4ECTA 1WI6A 4K2XA 2PMHA 3C46A 1PBAA 1S6UA 1S1WA 2Y9HA 3JYTB 1XNRJ 2WW4A 3WIVA 1DARA 3DMJB 2BQ3A 2J8SA 3PVXA 1ZPWX 4ZP7A 3K17A 3L95X 1SQFA 1X4BA 4HTJA 4KV8B 3GFXA 3HHKA 4S0MA 1RT1A 5B0DA 4OX9F 2IM1A 4DFMA 5KG4A 4OZLA 1YBAA 1QDUB 1HWKA 3NP5A 4ZJQA 5E7OB 4C7QA 3C14A 3KUGA 4RW4A 3NWGA 3JSRA 2YY3A 3SFGA 2E9RX 4F04B 1R8PA 2C3UA 5LL6d 4ES3A 1YIJS 3DLHA 4O3NA 5C42B 1HI8A 4ZLNA 3CCRS 1QD1A 4C97A 4ZVEA 4L3NA 4USKA 2J7KA 2L9WA 4ZPDA 2ILYA 5KFVA 4DG1A 3Q24A 5D4LA 4MIAA 2MQPA 3QJJA 3VGUA 2N82B 4EZ9A 1PCAA 3GPAA 1Y7PA 3JSMB 3HMJG 3W5ZA 4J90A 1RT4A 2NLWA 3H90A 2ZH7A 4JBCA 4FZVA 1YG0A 2QA1A 2COLA 1H7WA 4ED6A 3D9BA 4DR4F 1SB6A 1R8AA 1S72S 2V4RA 1KLNA 1T9VA 5D4OA 4EU0A 3ENQA 1IVZA 2EK6A 3BO4A 2HBRB 2MTLA 4L76A 1TL7B 2WSEC 4FYVB 1M90T 2WBMA 5KT6A 2F7VA 5F8NA 2RSQA 3MF5A 2MLYA 4P52A 3TJ9A 1VJWA 4F2RA 3M30B 1TKZA 2XI3A 3RJMB 3GG1A 2VBWA 4NLRA 3QIPB 4MTPA 4LR7A 3QGIA 2XY5A 1KHWA 3KLHB 2QZ8A 3CB4A 4LRBA 1GMUA 2QV6A 2W7OA 5LJ3Y 5C24A 5B7WA 3PR4A 4DOZA 3GONA 4OX8A 3BO2A 1BQNB 4JI5J 1N5YB 3MMAB 3T6JA 2VDIA 3S6EA 3X1LB 2CG8A 1Q8IA 1WORA 2V5HG 1KDNA 2RRAA 2GVDB 2CPYA 1N34F 1H6KX 2PA8D 2EFQA 4OZ1A 4ED4A 3H5YA 1DHMA 4LSNB 2IMWP 1IKXB 1I5OB 3MMBB 2ZJPQ 2PN6A 2NZ4A 3FK4A 1DTQB 2VG6A 3BGRA 2AF6A 4W4MA 3W3SA 4YR0A 1K9MT 1FE0A 1RT2A 2DXDA 2E5IA 1MWYA 2VOOA 3LGNA 3C2PA 3ISND 1LK7A 4KO0B 5I4MA 3ETMA 2ZHAA 4FS1A 1TU0B 1YZ7A 1WJ9A 1JJCB 4M95A 4DF4A 2D3OR 2N3LA 1IQTA 2XLJA 1C0TB 3OTOJ 3A3NB 2HGMA 4HT5A 4IG0B 1BY9A 4WFNQ 1FDBA 1JXVA 4LFCJ 2GC8A 2QA4S 1HQEB 1UCNA 1WC6A 2ZH3A 1U1LA 2P9GA 2DK2A 3AB2B 3IC1A 4JV2A 1HD0A 1FT8A 3D1OA 1GEHA 5D0HA 2AGPA 4UQTA 3MPYA 2UUWA 2B9YA 2HRYA 4Q7AA 7FDRA 2YQ3A 5MLCV 2CPHA 2F65A 2XTJP 4NLQA 1OQ6A 2LEPA 4K4YA 1GK8A 1IN0A 1UZDA 1AFJA 1RT3B 3EXYA 2RS2A 2IDEA 4J9LA 1RWXB 5D4NA 4DS4A 5J2MA 1F1BB 3PW4A 4FYYB 3TAQA 4F0KA 3DU6A 3OBIA 4ETZA 3Q23A 2IBKA 2HQGA 2A2CA 4AFFA 1QE1A 2R7TA 2HLUA 2BKPA 4JI6F 2Z30B 2B9WA 3T1YJ 4DLGA 1WHYA 2VODA 1RLDA 3PIOQ 1R0AB 1AW0A 2ALYB 3W65A 3I5CA 2R7XA 1R8CA 1N5SA 4LUBA 4DUYF 3PRVA 3PW0A 1FO1A 4C98A 4RNOA 3O2IA 1S0OA 1FXRA 5K5MA 2DYAA 4ZKAA 4DI6A 3I0SB 4PAAA 4C8LA 3V5RA 4JI2J 3I55S 4OLOA 2V8VA 1OY9A 1WTBA 3H2UB 5JUMA 3ELHA 2W2NP 1ZM2A 4ECUA 2EG2A 4CQ1A 3M2VA 5E5NA 5M2PA 3IWLA 4P2FA 4EMDA 2GCFA 4IR9A 3MPWA 1YJRA 1X4DA 3BR8A 1FEHA 1TVRA 1PG5B 4WIIA 2OO4A 2UVRA 2HFNA 4CTAB 3OR2A 3V6HA 3TQEA 1WSVA 1KQSR 2E1CA 1HNWJ 5J2PA 4GVBA 3LALA 2R8KA 4C0BA 3DOMA 1LWEA 2YH1A 3PXGa 4Q2MA 3CCSS 4R0JA 5SZTA 2B51A 3FQKA 9RUBA 2UZAA 2GAHC 3IWNC 3PTWA 2DNNA 2OPRB 1FX4A 5F9NA 2LLZA 1SKRA 5DS7A 4OX6A 3MTKA 1SL2A 4KGZB 3GR1A 1WD6A 4A4JA 1NK4A 5H9EK 5LJ5Y 4YS2A 1IJEB 4NLSA 4J91A 4XO0A 4YFUA 4P2MA 3BKUA 4ID5B 5F41A 3OD2A 3T5HA 1Q8LA 3OVBA 1PILA 4CO3A 3A8IA 3I9V9 2YNHB 3VALA 1NO8A 2MQNA 1UJ5A 2HGNA 2QT7A 4C8KA 4DV3J 4I69A 1T8EA 3M2UB 1FRMA 1XK8A 2J9DA 2E66A 1DAXA 1LNQA 1RUSA 4DV1F 3DRXA 4K4UA 5HMWA 3OL6A 1SJ1A 3OJSA 2JOQA 4XPCA 2XHWA 1H38A 1RWWB 3T5KA 3HFVA 3GV8B 1YX2A 2Q1LA 1WELA 1GX5A 2YWKA 3LW5C 1JXLA 2PFFB 3Q8YA 3Q22A 2W9BB 2AQ4A 4N56A 4NZ7A 1J5OA 2MYFA 1M1HA 2HBQB 1YI2S 1NU4A 4FBUA 2RU9A 3HVTA 2XULA 1UKUA 3THPA 1IQZA 2FHKA 1M5SA 3HSZA 5J1EB 1VIOA 4L6V3 4HR2A 3ZZUA 3D0HE 2LQJA 4N76A 1RISA 1Y4ZB 4PABA 2IM0A 3V6DB 1LW0B 3DOKA 1NJYA 2MZQA 3B82A 4F50A 4BHQA 2BR0A 2VQFJ 2AIRB 4M5MA 2NXJA 1IKYA 1RWPB 2IYIA 1D8ZA 2PE8A 4J9PA 1NJIT 4I67A 3CF5Q 4CLKA 5KFAA 3NAIA 3OXLA 4OI3A 4A46A 4PG4A 3G8QA 2KRRA 3PEJA 2IA0A 2UUBJ 4PWDA 5LMUJ 1FRLA 2NYIA 1XIQA 4Y6IA 5D0GA 1FJGF 1JLGB 3J7YU 2OPSA 3KG1A 2CADA 2K1RB 4MYTA 5HROA 2ADCA 1NLKL 4FPRA 2V50A 4DN9A 1UETA 1H73A 3JB9k 1E6VA 4WJBA 1L3TA 1U09A 3IN5A 2DNGA 3CDEA 1VLYA 5C25B 2CWKA 3UE2A 2VHGA 5KG1A 2BDPA 1RA6A 3T41A 1MWZA 1VIXA 3K89A 1RJJA 1TKTB 3CGIA 5DDPC 2VF3A 3K8VA 5L38A 4M5LA 1Q1KA 5KFZA 2JDJA 4NWBA 4Y28C 3BO3A 5H9FK 4LF5F 1SV5A 4URGA 5L1IA 2FHOB 2HW3A 4OV6A 4CLLA 1HKAA 3CCLS 4CCHA 2J6TA 2C2ZB 4C11A 3OW2R 4DJBA 2DGSA 4KRWA 4AT1B 5CYJA 3IRXA 3F44A 3CT9A 2ZH6A 4AYBD 2FVRA 3TP2A 1OY8A 4UZCA 2LXFA 5A8RB 2DGOA 4F67A 2K2PA 4KIAA 5D0EA 1YJTA 5AXNA 4ECZA 3V6JA 3NCPA 1NKCA 3ULHA 4DUTA 1CJKA 1NM2A 1RAGB 2OEKA 3SDEB 4LFAF 1S1TA 2XMUA 1MU2A 3N5BA 2BOPA 2P6TA 5KFKA 3IM9A 3I82A 3BKFA 4Y2CA 3OFGA 3TX0A 1U47A 3K5NA 4QIVA 1OPZA 3WX4A 4B3MF 3SXLA 1XERA 6FD1A 1RT5A 5KFQA 5GAHU 2W2QP 4DCPB 1VR6A 3U1NA 1RCXB 4DR2J 3KHRA 2XZTB 3TQ1A 3X3UA 1MN9A 3JYTA 4OZNA 1WEZA 2CJKA 3P5BP 3QPIA 1Q82T 3RW6A 5IWAF 5KOWA 3SSQA 4ZCIA 1RYRA 2IRXA 2RB7A 1X9MA 1OO0B 3BF4A 3B4DA 1U1NA 2E7VA 4KV8A 4DQQA 3D6FB 3HHNB 4PR6A 3VZIA 4H4KA 2FLNA 3TW0A 3G6XA 4K4WA 1TKXA 3SQGB 2MZ1A 4NEYA 4PPZA 1Y3JA 5J2NB 3JQKA 2KG0A 3GJTB 2HFZA 2DY9A 4ENOA 2CFXA 3FZ2A 2QA2A 1HNVB 2DRAA 5JVGQ 2U1AA 3EGWB 4P7TA 1KS2A 2UXBJ 5ETSA 2X3DA 1UA1A 2DVIA 3DXBA 3G6VA 2FDNA 2FZCB 3N0VA 2R7VA 3BREA 1KVJA 3H98A 4DL5A 2C42A 4DZDA 2FB0A 5KG5A 1TAUA 3Q8QB 1SXLA 2J8AA 1TUGB 5KFXA 4O23A 4C6AA 3JSMA 2AYEA 4J5OA 4R8UB 1SVDA 4WYWA 2EBGA 2HFSA 4EI2A 1ZETA 1NKBA 2NSCA 4IH6A 3W5YA 3WC0A 1VCTA 4RBVA 1O6XA 2DO0A 3BQ2A 3AJ2A 4DEZA 3UO0A 3IS9B 1TL7A 2E5HA 2DGXA 1REGX 4KGXB 3A13A 3D3CJ 4KPCA 3CUNA 1HBOB 3TEHB 3E2EA 1U8SA 4UQGA 2LQ5A 2H1YA 1C2PA 1WDDA 2J9DE 2B4OA 3M30A 3ISZA 2H5EA 4RWXA 3O1LA 2YXLA 3L4BC 1RBOB 2YQ0A 3DLJA 3FEYB 1F3VA 2ZZMA 4OZ3A 4KGVB 1YJWS 3QIPA 4BC9A 3KLHA 2IYGA 3NY0A 5JXSA 4DSEA 3LPYA 1N52B 2BQRA 1KLMA 3CC4S 2P9CA 4NLOA 1BQNA 1N5YA 3MMAA 2OGUA 1HHTP 2DEJA 3MFIA 1RP5A 4TVAB 3CW2C 2H4WB 2KB2A 4NMLA 2GVDA 2IIHA 2P8IA 2IY5B 5A8KB 4DR7F 1PJ6A 2DH8A 2NXEA 2D7SA 1SIZA 3EDRB 1UL3A 4DR3F 3JSYA 3QT5A 3FBFA 2RDDA 4LSNA 1IKXA 1HNIA 3MMBA 3QIDA 1DTQA 5KT7A 1HLWA 2ZBPA 2IM2A 4FYWB 4DR1J 2VICA 1S1UB 2QN6B 1FNMA 2KJVA 3GYNA 1JXEA 2AT1B 3WIUA 2RS8A 5B09A 1S10A 2UXDF 4KO0A 4LRFA 4Y2MA 3WDOA 2CVEA 2ZVIA 3D3BJ 3DDIA 4RW7B 4IO9Q 1OYDA 3FSYA 3V2UC 1NJWA 4TY8B 1UEUA 3LP1B 3HHLC 2WAQD 1RTHA 3D28A 4PXDA 1C0TA 2Z4PA 3EUNA 2FLPA 1SCJB 4ZN1A 3GU0A 3N4WA 2AX1A 1HBNB 4IG0A 5E3QA 2Z57B 4YQWA 2ZBQA 1CC8A 2F8HA 4PPDA 5KG0A 4NXNF 4GRSA 4O4GB 5K14B 1HQEA 4B9UA 4FNIA 3KK3B 4OYZA 1QLNA 3C15B 1CJUA 1SKWA 4LF4F 2MLXA 2M52A 1T05B 3VAMA 3BGUA 2LU2A 2HHPA 5CZXA 2BKOA 2R8HA 2PSZA 2C2MB 3EJMA 1A0OB 2CQGA 1UVNA 2K8GA 4KHPF 2M70A 2FHJD 4EO8A 1TUWA 4QIFA 2PEBA 1YRXA 4UOHA 2MHEA 3ITHB 2KVQE 1VBXA 3E51A 1O5JA 2GJ2A 2YKMB 1FFWB 4NRUA 4QWDA 3SYZA 3GMGA 2F3JA 3LAKA 1FKAF 3QRPA 2JZ5A 3HKZD 4DSLA 5DRKA 3PRBA 5CABA 5HP1A 1FJ7A 2VONA 4TQRA 3OSNA 5KFIA 1UEVA 2HZAA 1SUQB 1BWEA 2XMKA 5J2QB 1WACA 2XMAA 4CI0B 1UJ4A 3I0SA 5BYRA 1R31A 2AU0A 2DRDA 2C3MA 3K7RA 2JC0A 1PC5A 3HP6A 2ZZNA 4DSFA 4MK7A 3KJVB 2R7WA 5IC4B 3GE9A 2DCLA 5HK4A 1S76D 1UVLA 2JVRA 5FDLB 2DTJA 1QUPA 2B5JB 3BSNA 4HKQA 1D3WA 4WK1A 4OJHA 4I56A 1FERA 3G6ES 4CTAA 4E8UA 4A8XA 5DQHA 5I3UB 1CS4A 2B3TB 3IMQJ 4NPOA 1RABB 2EG1A 4OYBA 3RGIA 1H2VZ 4K4TA 4GC6A 5A0YB 3BB5A 4YY3J 2HHHF 4HEA9 4CLUA 3BH7B 2XGPA 3VZHA 1F2GA 2MLZA 4K0KJ 3V6KA 2DGQA 3CCUS 2UV8G 3AFGA 4KR0B 1S59A 2ZH4A 2CA9A 5HVHA 3US5A 4RW8B 5IT9Y 3K59A 1EETB 1B70B 4QWEA 2OPRA 2QJ3A 3HXMA 3JAMU 1YBTA 3IWXA 3KLIB 4J9QA 1FDNA 2AJ2A 3CDBA 4O0IA 4KY3A 2N4DA 3AQOA 1RA7A 4A8WA 4X66F 3EGZA 4ZOSA 2RDJA 3Q8UA 4IFVB 1M1KT 3ZZTA 1XMOF 2B9XA 4ID5A 1K1QA 5EN1A 4HDHA 4B9SA 1HHQA 2FY8A 3T1HF 2YNHA 4RZRA 3BKTA 2ZOMA 1HHSA 3RRGA 3FFIB 2FJAB 1IBCB 1UEKA 3LGMA 3M9MB 1TAQA 2A6OA 1G6BA 4MJKA 3R1LA 3M2UA 1TV6B 2HBYB 4X4SA 3K57A 4LF6J 2MKIA 2HS4A 2RILA 3A8JA 2LU1A 2ZC3A 3R5DA 4GC7A 1ZA1B 4NRTA 2ERRA 3NXZA 3CJ4A 3CMES 5L46A 3ZZOA 1WOPA 4NI2B 1WUUA 3NCQA 3UN3A 1DQ8A 3DXSX 2XSJB 1RWKB 4CLTA 3R9LA 4JI1J 4EK2A 2GMHA 2GHWA 4WE1B 1HW9A 3FDSA 2W9BA 3PZPA 4DV4J 5DDRC 2BX6A 4FNHA 4F3QA 1C1CB 4DSKA 1FF2A 4CO5A 1VS3A 4JI0F 4JI3J 3SCJE 1PAUB 2HVIA 4EWTA 3I9ZA 4YB1P 3IR5B 4Z2XA 1Y5NB 2X7IA 2XGQA 2W9CB 3V6DA 4NXMF 4JUZA 4DCJB 1LW0A 2G0CA 3MM9B 4N77A 1GH8A 2NZCA 4OX9J 2M3DA 2PA3A 3AOBA 4HHJA 2JRSA 1WOOA 1TFYA 2XEXA 1K1SA 2N7YA 1F9EB 4M5GA 3BQ1A 3QT8A 1U7LA 1H72C 3MR6A 2EW9A 3GV7B 3MUTP 1B7FA 2XWYA 2MKYA 1YKWA 1VRUB 3T3FA 2AYMA 3HK2A 1N33F 4FYXB 1SJQA 1U8WA 4DPTA 1BD6A 1JLGA 4XDDA 2C3OA 2K7KA 4F4KA 2K1RA 1S4FA 3PKYA 2JLFA 1UWBB 4WFAQ 1ZAXA 1TKDA 3CDUA 1ULRA 2APOA 5G4DA 3RG6A 5LSLA 2QLBB 2R7QA 5C25A 1NXIA 2AZ1A 1VHIA 5F8MA 4DR4J 3M8ZA 2DEIA 2J0XA 1TKTA 2CPDA 5LSRA 4E0DA 4DHVA 2WVEA 1VQ7S 2E7XA 1RHUB 3ILOA 1NPPA 1D09B 2FC9A 1S0MA 1ZTTA 4WWSA 1SC1B 3BV8A 5H9EJ 1UVJA 2Z0GA 4FBTA 3DI6B 5ETQA 2VBXA 2QRRA 2OHDA 3G2XA 1H2TZ 1U0SA 3SQOP 3ZFVA 2ZOFA 2C2DA 3PX6A 4EZ6A 4CT8A 3L7UA 3KLGB 1VQ8S 1ZS6A 4UW2A 2GA7A 3OR1A 5EWEA 4KB7A 4CM2A 2GMJA 1FJCA 2WOMB 1Q0NA 2FJDB 3MZIA 3IR7B 1FJEB 3SDEA 3VAJA 3CTRA 1ZZFA 4B3TF 4NL5A 1VC0A 3RUBL 3BN4A 4QIWD 3SMZA 1Q8BA 3VV2B 1WC0A 1N34J 2PGCA 2VG7B 2YBVA 4I7FA 2QEXS 1TZ0A 4GVLA 1HARA 4PKDB 3MEKA 2Q43A 3OVSA 3GP9A 1H98A 5FLXU 1NJXA 3AAWB 1GTEA 1VQ4S 3I56S 3OL8A 1OIAA 2HEKA 3BBBA 5DM7Q 3OTEA 3DRPB 4EFAC 2YPZA 4DV0F 2FJBB 3AB4B 4QBUA 3EMTA 3M8YA 2IJFA 2WONB 4F3MA 4WIQA 3R5GA 3CNQP 1X4FA 2V2QA 2V9WA 1NSPA 3F73A 4NA1A 2G13A 4I6YA 3NNCA 2XO6A 3SQGA 4ED7A 3HI9A 4FVCA 5KT3A 4NYOA 3UR3C 3RYLA 4OLPA 1U0HB 2G0IA 4K59A 1HNVA 4RX6A 3VR1A 2HNZA 1GTHA 5ETKA 2ZHOA 1WC3A 4WKYA 3CCWA 1FESA 4LIWA 5E3CA 4B08A 3HVAA 3H20A 9ATCB 2YX7A 5G0RB 1XN9A 4HI2A 3LO3A 4OHVA 2HHWA 1EZZB 3DFEA 3SI8A 3LP0B 3A3PB 4M5DB 2ZBCA 4A8KA 1JB0C 2C1EB 2M8DB 1URNA 2BUNA 1LOUA 1U1MA 4KC5A 1WG5A 5AE3A 2HYIB 3GV5B 3TA2A 2GW8A 4M5JA 3GCWP 1FD8A 1VISA 3RRKA 1IR0A 3IS9A 3W63A 2MKHA 2JNJA 1S1WB 1EP4A 1VQMS 4M8LA 1AZSB 2LECA 1HBOA 4JI6J 2LDIA 3LP2A 5H9FJ 2RU3A 1N5VA 4EBEA 1IM4A 8ATCB 4USIA 2PEHA 3TVZA 4DUYJ 2Q66A 4FYDA 1LWCB 4CO1A 1UA0A 2XS2A 3PYDA 2CWXA 3TJ8A 1UMJA 4L3KA 4ZPAA 1JJ4A 3CMQA 4PQAA 1RB0A 4F0HA 2ZUAA 1RHMB 1FTCA 2OFGX 5IS2A 3AOAA 4I6WA 1SBRA 2YNFB 5A8KA 5E0OA 2W2PP 3VTIA 1RAEB 2Z58B 3TVKA 1HFEL 4LBHA 3M8QB 3M6VA 3DNCA 2A6MA 3NS5A 1F9HA 2ZJQQ 3PG9A 4WP9A 4DBQA 1HPZB 1B3TA 1S6QB 3EYZA 1S1UA 4A8YA 4IOBA 1GX6A 4M94A 2VD3A 3J81Y 2DH9A 3CJKB 5E3RA 1TL3B 4IOAQ 2FYXA 1B0PA 4OL8A 2I6WA 3FC9A 3KDNA 2BACA 2HS0A 4P2XA 4RW7A 5AJ3J 3NGDA 4TY8A 3BSOA 1QAIA 3LP1A 4NZ6A 5ITHA 4L74A 5T41A 3CD5A 3MWBA 3QZ8A 2QL5B 2VPYB 1B64A 1HBNA 2ZKUA 1UAWA 4IRCA 3J7AN 2M9KA 1KHVA 1V3RA 4O4GA 1VJQA 2OPQA 3U7JA 4OMFG 1YDLA 2ATLA 3E8OA 2QYGA 4ED3A 1R7IA 3CJ3A 1WF0A 1U48A 2GX8A 3KK3A 1KD1T 2BV3A 4CH1A 4N47A 5IT0A 3C15A 3FRYA 3FCWA 4IH5A 5T14A 1T05A 4DR5J 5DG8A 1VGYA 2UXCF 2MMYA 2PMWA 2WCXA 3DYAB 2DR7A 2FZGB 3CCQS 2LQ9A 2MDAA 1N48A 4DV1J 3GG0A 4DPUA 1SQEA 2BZ2A 2HHUA 3KWMA 1DQAA 5AXKA 2XBPA 2O01C 3M2RB 1B99A 4DV6J 4LQ9A 2VG6B 3ITHA 4WU3A 3T5JA 4IYQA 1S49A 2YKMA 4D3GA 2AV5A 5D15A 5KFSA 3OFEA 2MGZA 2QFJA 1T03B 2F9JA 1NPKA 2DNHA 1U2FA 1Q86T 1IKWB 5CD4A 3KYLA 4F4XA 3HHLD 4JI4J 2G2OA 3A12A 3HX9A 2QC3A 1SUQA 5J2QA 3GYGA 3K5PA 2V68A 1RXOB 4PYAA 4ZVPB 2LXUA 1HBMB 2Y1JA 2GHPA 2BE2B 1D8YA 4KT0C 3L7PA 2YWFA 2V0NA 5GAEU 4EYIB 3CIZA 4TU9A 2B5JA 2F1FA 1QAJA 1RCOB 5EGYA 5ETPA 1SH3A 2CJQA 4HI1A 5KFRA 4AQYF 4F3OA 5I3UA 4P72A 1PYTA 5J1NA 2FLLA 5A0YA 2QG9B 3N6LA 1Q5YA 1TP7A 2EC2A 1FJGJ 1PYOB 1RT6B 4X4TA 1P1LA 2H65B 1B0VA 1WI8A 2VPZB 4BDPA 4OHZA 2P5VA 5IZHA 2DBBA 4P2SA 4L75A 4F7VA 2GAGC 2VOPA 3WX8A 1PGZA 4RW8A 4PCQA 1EETA 3SBMA 1Y10A 4RKUC 2W8LA 1YSJA 3MECB 4DFJA 5CCLA 3EM1A 1UVMA 4FXWA 4HHHA 3IBWA 4C0HA 2DT9A 2NR0A 4WP8A 3R5AA 2ZNYA 4LF5J 4TNOA 2B56A 4IFVA 3I0RB 2XB2D 2FTRA 2AYGA 2KKHA 4G1IA 1JKHB 3MAHA 4RL1A 1W7WA 2IMOA 1WSRA 3FFIA 4YR2A 5ETMA 3FBEA 1TV6A 1MMDA 5EWFA 3V4IA 2BRLA 3MEDB 2CAJA 3AA9A 3MD1A 3L7OA 1NDCA 1CVJA 4G65A 2DNKA 4ZHRB 3P4UB 4HT7A 5B0AA 3NAHA 4FF4A 2MJUA 2AGOA 4NYPA 4ECSA 4LFAJ 4YP3A 4ZA1A 1UPMB 1NH8A 3Q2TC 3BEGB 2XSJA 2R2RA 1L3UA 2E1PA 1T3OA 1R6VA 1T9TA 5MAOA 4WE1A 4JP8A 4B3MJ 4LJMA 3ONQA 3BGOP 2C22A 2IVYA 2HVHA 1C1CA 1T02A 2VH7A 1W25A 1JNZB 3UPFA 4QWBA 2LKZA 5B0BA 4DX8H 1O0PA 2DNYA 4DXLA 1A6LA 2ASLA 2VPWB 2I9SA 2ZVSA 5DLFA 2KT3A 3ADAC 3R97A 4MT1A 4OV1A 4CDIA 1YJ7A 2SXLA 4O3PA 4DQRA 4DL6A 1JLCB 5IWAJ 4EYHB 4CO4A 2W9CA 4Z7YA 1RAIB 2FHJA 3GFZA 2ZKTA 3MM9A 1HBUB 2Q6BA 2ZH8A 2DHHA 1APSA 2XO7A 4ZPVR 1ZH5A 1NDPA 2CPXA 3G6YA 1RHKB 5KFLA 3G9CA 2MZSA 5DETA 1CLFA 3UCZP 1X4EA 3BBCA 2CVIA 5HO4A 3I4PA 3KMQA 1VRUA 4DU7A 3AD7C 3HHLB 2LXIA 3PYFA 2BKNA 4ZPBA 2QL9B 1F5AA 4OJGA 2BQUA 2E1AA 4DZ6A 2W7AA 1UWBA 2W4PA 3HFZB 3FKBA 3Q8PB 3K2YA 3PRDA 3IGVA 3PHTA 1FFSB 2X1FA 3Q83A 1DY3A 1U2RA 1XR7A 2VV5A 1UFWA 2DNLA 1A9NB 1BGXT 3QSIA 5E33A 2PIIA 1YWXA 4DL4A 3D54A 1UP1A 3MMJA 1NZ8A 3CCJS 3NMAA 1DURA 2KU7A 2YVSA 4USWA 4OZJA 4LVOP 3MM8B 3O8WA 1RTZA 3CPWR 3KDOA 4O3RA 4PG6A 3G8TA 2AW0A 3IAM9 3DI6A 1JLQB 1T95A 2GJIA 4LSZB 2Z2MA 4X62F 1NMEB 2AD9A 3R2CJ 4ECWA 1HQUB 1Q4RA 2G1HA 2HZVA 2VG5B 1IKYB 4V1Ak 4IFYB 2MQ8A 4WFBQ 3CO9A 2YWWA 3D0IE 1DRZA 2WOMA 1IXKA 3PCOB 1ZA2B 5EWGA 2EEYA 1SH2A 3G71S 1WC1A 3DRRB 2VA2A 2OPPB 3HJVA 3AXMA 5AE1A 3GCXP 4NLTA 1S12A 1S6PA 2KXHA 3KXDA 4F8RA 3J80U 1FK9B 4CLZA 4DR7J 3QMQA 1FRKA 1R8BA 2JLGA 4J7CA 4F4ZA 2YNIB 4E98A 1BE4A 4DR3J 2IVMA 3CJ2A 2YTCA 3LPEA 2QFIA 4JI8F 2Z2LA 1MN7A 1YK9A 3NNAA 4DFKA 2GMLA 2RVJA 2L48A 3MEGB 3TUPA 3MUMP 1UPPA 3KFWX 3UR0A 1DZ5A 4RNMA 3DRPA 5J1PA 3OJUA 5L9XA 3EGNA 5CCMA 3CO0P 3GSIA 2V4JB 2OP5A 1RSCA 2WONA 3EVOA 2GIQA 1CPZA 4QOTA 1PC4A 4B9VA 2EFOA 3CJ5A 3ENWA 1N54B 2V63A 3KK2B 3IBFB 2QMUB 3R5CA 1U0HA 2OEMA 1OSDA 4CO2A 3QFWA 3R5BA 4URSA 2AJQA 3ENVA 4Z37A 4NXNJ 2HZCA 2BJ7A 3W8GA 4Q43A 4DQSA 1P6TA 3VWSA 2FC8A 2VC0A 1TFWA 4YDXA 3BSCA 3EGVA 5K9FA 4ZJLA 1CJKB 1FKOB 4KSEB 1M5HA 1KOOA 1NEEA 4FF2A 4G3IA 4LF4J 1SC6A 2OD4A 3DM2B 2HLTA 1P1TA 3KUHA 1YJ9S 2RRNA 1OS5A 3MEEB 3R7BB 3MI7X 3LP0A 1EQMA 3NS6A 1H74A 4OHXA 4M5DA 1N36F 3UI3A 2XNQA 1K73T 2XQCA 3H0PA 1LWFB 4Y2IA 5CHCB 3N28A 3PYEA 1JWWA 3GQCA 1NAQA 2X3GA 2MSTA 1U49A 4JI2F 3VHQA 3NBPA 2BMBA 3KNAA 2J0WA 1Y5IB 5BYSA 2FJEB 3U27A 4UOCA 2QLFB 1AZSA 3HHEA 3H5SA 3VGTA 4WYLA 2R7RA 1Q5VA 2EVZA 4CO0A 4M5HA 3KHGA 1YHQS 4ED2A 1UVKA 4OI4A 3IBCB 3AODA 1LWCA 1VFJA 1DJ0A 2RH3A 2CRLA 1U1PA 2VA3A 4RR5A 4QYZK 5A2QU 1TKXB 3RAMA 2YNGA 3OQ2A 1VQ9S 3CVKA 5DQIA 4IQMA 3QT7A 3C6TB 2MKKA 1VK8A 2DNZA 3T19A 1FXDA 2DPJA 4JI7F 4K4SA 4M5NA 2XLKA 3BBFA 1JJHA 2HFUA 5KFBA 1AUSL 1RTDB 3IP0A 2F9DA 2YNFA 4P7VA 5E2QA 3ZZZA 2MQLA 4DCOB 3QLHB 4IQXA 3J7YI 3M8QA 2EC0A 3ILJA 1D9DA 2XS7A 3CEDA 2BE9B 2V69A 4OZ2A 4JYAF 2ATCB 4ILRA 1G1XA 1HPZA 1S6QA 2KXFA 3N79A 2F63A 2FZKB 4UT4A 2HHHJ 3EE3A 3M32B 3FQLA 4AE5A 2V94A 3HSGA 1NK5A 2B9EA 2DPIA 4P71A 2XMTA 2HIQA 3CJKA 1TL3A 5DG9A 2B7CB 2GZOA 4WFZA 2WVBA 1S1XB 1P9YA 5KFGA 2CNKB 3HT3A 5BR8F 4R0EA 3QO9B 5JMNA 3QYYA 2XWXA 4CLWA 3P45B 4O3OA 1F2HA 1YJVA 2KH9A 2ZH9A 4IKAA 2ZJRQ 4LF7F 1OQ3A 3PACA 4X66J 5DM6Q 1KP6A 2DY1A 2LCWA 4WTOB 1VBYA 4MYUA 1XMOJ 2HHSA 1D9AA 2XMWA 3TZWA 2FUG9 1E6YA 1XC9A 3EICA 2QE5A 2W24A 2HQ3A 3T1HJ 4ZVGA 1KLMB 4YB5A 3GZ7A 4N41A 4LSLB 2BM0A 4GKKJ 3TX8A 5CYQB 4PUOB 5E3AA 2KFYA 1X4CA 2CDQA 1S6OA 2RRBA 2ZOGA 3DYAA 3H5XA 1HIYA 4UTGA 3DDNA 2PD1A 4MKYA 4LIRA 5B0FA 3QNWB 1MLAA 4CLSA 3KOAA 2CJ9A 2V8PA 3V4MA 5A76A 3TR5A 3F0NA 4DQIA 1HNIB 3M2RA 2AJ1A 3H5UA 4TY9A 3KG0A 3QFHA 3W2VA 4ECRA 1T7PA 3GYXB 4A8QA 4FKXA 1SQGA 2NREA 1T03A 1KFDA 3HDSA 1VHFA 1XBWA 4WU2A 4LBPA 1FNXH 1GNKA 1IKWA 4Y0FA 4LF8F 3C3LA 1IBKF 3PR5B 3DU5A 4PYDA 4JV5F 1RGVA 5B0EA 4U7UK 3RB0A 3G82B 3FJ2A 2UUCF 4JI0J 2NUHA 1RTHB 3DLLQ 1B7YB 3AJ1A 3QRRA 3H2LA 1AROP 1HBMA 3OLBA 2V8GA 2B0GA 2BE2A 4NXMJ 2B4PA 2IC3B 5ETTA 2J0SD 3W61A 1JLFB 3W7BA 2VFVA 4F2SA 1CJUB 1NDLA 1IWAA 1KSPA 4ZPCA 5KFUA 2GIFA 1TK5A 4UF4A 1FRHA 1BQMA 2VU5A 3MPVA 1KTVA
chains in the Genus database with same CATH topology
3DDIA 3BBBA 1NSKL 3ZTQA 3ENAA 3FCWA 1NLKL 1WKLA 2BEFA 3ZTPA 4FKXA 3EVMA 3FKBA 3BH7B 3B54A 5C7PA 4UOGA 3EMTA 2B8PA 3Q83A 3VGSA 3ELHA 3ZTOA 3VVUA 2AZ3A 2CWKA 3G2XA 4O0NA 2DXFA 1S59A 2HVEA 2HURA 1F3FA 3MPDA 3NGUA 3JS9A 1LWXA 4HR2A 1NSPA 4S0MA 1B4SA 1BE4A 3L7UA 1NUEA 5CABA 1ZS6A 1W7WA 3R9LA 4ANCA 3Q86A 1MN7A 2NCKL 4EK2A 2DXDA 1F6TA 3BBFA 3ZTRA 1U8WA 4C6AA 1NHKL 3NGRA 3FBEA 4ANDA 4FKYA 3FC9A 1B99A 3ZTSA 3FBBA 3VGVA 3EICA 2BX6A 3ETMA 5CAAA 1MN9A 3Q89A 1NDCA 3PJ9A 1NB2A 2HVDA 4F36A 4ANEA 1NDPA 3FBFA 1EHWA 1XQIA 1NDKA 2B8QA 3VVTA 3Q8UA 3Q8VA 4CP5A 4UOFA 1HIYA 1HLWA 1NPKA 3BH6B 3EVOA 2AZ1A 1WKJA 3DKDA 1PAEX 1BUXA 3BBCA 3EE3A 3FBCA 3FCVA 1NDLA 1HHQA 3VGTA 1NSQA 3EJMA 1JXVA 1VYAA 3WX8A 1K44A 3VGUA 2DXEA 5BXIA 3PRVA 4KPCA 4WBFA 3NGSA 2ZUAA 1LEOA 3GPAA 3GP9A 1XIQA 3NGTA 1UCNA 1S57A 1BHNA 1NCLA 1S5ZA 2DYAA 1KDNA 1PKUA 2VU5A 3EVWA 3Q8YA 4W98A 4DUTA 3B6BA 2DY9A 4UOHA 5IOLA 4DI6A 3EM1A 4ENOA 4F4AA 4DZ6A 1WKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDI A;  3BBB A;  1NSK L;  3ZTQ A;  3ENA A;  3FCW A;  1NLK L;  1WKL A;  2BEF A;  3ZTP A;  4FKX A;  3EVM A;  3FKB A;  3BH7 B;  3B54 A;  5C7P A;  4UOG A;  3EMT A;  2B8P A;  3Q83 A;  3VGS A;  3ELH A;  3ZTO A;  3VVU A;  2AZ3 A;  2CWK A;  3G2X A;  4O0N A;  2DXF A;  1S59 A;  2HVE A;  2HUR A;  1F3F A;  3MPD A;  3NGU A;  3JS9 A;  1LWX A;  4HR2 A;  1NSP A;  4S0M A;  1B4S A;  1BE4 A;  3L7U A;  1NUE A;  5CAB A;  1ZS6 A;  1W7W A;  3R9L A;  4ANC A;  3Q86 A;  1MN7 A;  2NCK L;  4EK2 A;  2DXD A;  1F6T A;  3BBF A;  3ZTR A;  1U8W A;  4C6A A;  1NHK L;  3NGR A;  3FBE A;  4AND A;  4FKY A;  3FC9 A;  1B99 A;  3ZTS A;  3FBB A;  3VGV A;  3EIC A;  2BX6 A;  3ETM A;  5CAA A;  1MN9 A;  3Q89 A;  1NDC A;  3PJ9 A;  1NB2 A;  2HVD A;  4F36 A;  4ANE A;  1NDP A;  3FBF A;  1EHW A;  1XQI A;  1NDK A;  2B8Q A;  3VVT A;  3Q8U A;  3Q8V A;  4CP5 A;  4UOF A;  1HIY A;  1HLW A;  1NPK A;  3BH6 B;  3EVO A;  2AZ1 A;  1WKJ A;  3DKD A;  1PAE X;  1BUX A;  3BBC A;  3EE3 A;  3FBC A;  3FCV A;  1NDL A;  1HHQ A;  3VGT A;  1NSQ A;  3EJM A;  1JXV A;  1VYA A;  3WX8 A;  1K44 A;  3VGU A;  2DXE A;  5BXI A;  3PRV A;  4KPC A;  4WBF A;  3NGS A;  2ZUA A;  1LEO A;  3GPA A;  3GP9 A;  1XIQ A;  3NGT A;  1UCN A;  1S57 A;  1BHN A;  1NCL A;  1S5Z A;  2DYA A;  1KDN A;  1PKU A;  2VU5 A;  3EVW A;  3Q8Y A;  4W98 A;  4DUT A;  3B6B A;  2DY9 A;  4UOH A;  5IOL A;  4DI6 A;  3EM1 A;  4ENO A;  4F4A A;  4DZ6 A;  1WKK A; 
#chains in the Genus database with same CATH topology
 1VC6 A;  4DV2 F;  1N33 J;  3J7Z T;  2RQ4 A;  2I5J B;  1RT6 A;  1CG2 A;  3C6U A;  2NS1 B;  2FVP A;  3QJP A;  2PI5 A;  2DHA A;  3HD1 A;  2WSC C;  3MM5 B;  4CLF A;  3LQV A;  4OYX A;  3MEC A;  1FI4 A;  1EX8 A;  3OSP A;  1KRP A;  4QJV A;  4CWB A;  2ZC4 A;  1G4C A;  2VAS A;  4B9T A;  5HP1 B;  1X9W A;  2CKW A;  1XQI A;  2MY8 A;  3JTO A;  4OYW A;  2ZEJ A;  3MAA B;  3I0R A;  2IJR A;  3OFH A;  2RKI B;  1JKH A;  1RWO B;  3VQS A;  3NWR A;  2R2U A;  3TVY A;  1NSQ A;  1IWG A;  3PKM A;  4IUF A;  1L3V A;  1LEO A;  2YKO A;  5CH7 B;  5KFH A;  4X84 A;  5HQM A;  3MED A;  4X64 F;  4H4M B;  4B3S F;  2CPI A;  4ZHR A;  2BEF A;  1CEZ A;  4MKB A;  1NHV A;  2Z8Q A;  5C7P A;  2KYX A;  1HD1 A;  3FCH A;  2IJN A;  3RR7 A;  2CZ9 A;  2OEL A;  1REV B;  2LVW A;  4ZS6 A;  1CS4 B;  4QW8 A;  4KTQ A;  1DQ9 A;  1S77 D;  2EBE A;  2J7U A;  4WTY A;  1D1U A;  4B3T J;  1RU1 A;  3D68 A;  1S7I A;  3JXO A;  2IA6 A;  3CCT A;  1WG4 A;  1FNO A;  5IC6 B;  2JL9 A;  3WQP A;  1X0F A;  1JIH A;  2DNP A;  3GWC A;  5HMY A;  3FBB A;  3ET6 B;  1U26 A;  5EX3 A;  2DNQ A;  3C19 A;  4RW6 B;  5F8G A;  5HMZ A;  2MQQ A;  2KHC A;  4NYZ A;  3C66 A;  2J7W A;  1VQ5 S;  4ICL B;  3H4B A;  4NLU A;  3U1L A;  3D0G E;  3HFK A;  2RQK A;  1T94 A;  5T7L B;  3D6H B;  3AD8 C;  3RB4 A;  2M5Y A;  4CLP A;  3FBC A;  1JLC A;  1GT8 A;  1V9O A;  4DV0 J;  3HM9 A;  4TLQ A;  3AT1 B;  1JMT A;  2A0F B;  5HAT A;  1VQP S;  5HBM B;  1HBU A;  1BHN A;  3P49 B;  3MR2 A;  3MR5 A;  1P27 B;  2CQ3 A;  2Q6C A;  4CH0 S;  2XC9 A;  3W5X A;  3RU0 A;  1TMJ A;  2WVF A;  4U95 A;  3H7H B;  5KFF A;  2GIR A;  3BYP A;  1VMB A;  4QIE A;  2DCU B;  2EXU A;  3FSI A;  2ZFH A;  1XNQ J;  1H2U X;  3HHL A;  2UU9 F;  3BGF A;  3CJS A;  4TU8 A;  2BBE A;  3HHD A;  3MDF A;  5JVH Q;  3T1A A;  2O66 A;  1Z2Z A;  4XPE A;  1C1B B;  3LAN A;  1DLO B;  3BGL A;  5U47 A;  3DN9 A;  2CQP A;  2AHO B;  2G1D A;  2N7C A;  3R1H A;  2KM8 C;  3MPU B;  5L39 A;  4AXI A;  1XMB A;  3VAK A;  1R43 A;  2J9E A;  1ELO A;  3MD3 A;  1GMW D;  3FMB A;  4I6A A;  1FDA A;  2CUY A;  1FE4 A;  1NJZ A;  4G1P A;  3EVW A;  3TO8 A;  3MM8 A;  1D0E A;  3MMC B;  2LP4 A;  5I3Q A;  5IXU A;  3KJF B;  1JLQ A;  4FF3 A;  5DG7 A;  3KUE A;  3GJQ B;  4ZVO B;  1PYS B;  1HQU A;  3RR8 A;  4C2M A;  4NEZ A;  1XMQ F;  3MPD A;  2VG5 A;  1VBZ A;  2XYH B;  4IFY A;  3H2V E;  4U96 A;  1TEL A;  2R8I A;  3AA8 A;  2V6A A;  3CUL A;  2HND B;  5KTQ A;  2KXN B;  1J5E F;  4X4O A;  3IXQ A;  3TEG A;  3ETO A;  3DRR A;  2OPP A;  3N01 A;  5DGB A;  3P8B B;  2CXE A;  4B9N A;  1FK9 A;  4TYA A;  4LQ3 A;  2C28 A;  1U1K A;  2HNY B;  2YNI A;  3PY8 A;  1QVG R;  1OMS A;  2OI2 A;  1RT7 A;  2VB6 A;  2JEJ A;  3AQP A;  5KG6 A;  1Y5L B;  1QAY A;  3TZZ A;  1WG1 A;  4AXJ A;  3MEG A;  4EGL A;  3KLF B;  5BJR A;  1FVS A;  2FHM A;  1UWA A;  3GIR A;  4ZJO A;  3POT B;  3BZQ A;  4C9D A;  2V4J A;  1S9E B;  2KN4 A;  1KVI A;  5KT4 A;  1U6F A;  2RQM A;  2V2K A;  4MAK A;  4BCA A;  4KH0 B;  1UW9 A;  3H59 A;  2M2B A;  3DCA A;  2HFV A;  1NUE A;  4FXV A;  3OXF A;  2VFT A;  4DPW A;  1G3O A;  2Y1L B;  4ERD A;  1CJV B;  3KK2 A;  4R5P B;  3MHY A;  1IJF B;  3PFE A;  4ECX A;  2I0X A;  4KQZ A;  3OR1 B;  4XAK A;  2QA4 G;  4Q2L A;  1JLE B;  1FKO A;  1QJH A;  1C4A A;  4KBI A;  3RAX A;  2GQ2 A;  4J37 A;  4HAC A;  3DM2 A;  2GVZ B;  1AYE A;  2UXC J;  1QSS A;  3E01 B;  4FS2 A;  3MEE A;  4PG8 A;  1ZBT A;  1VK3 A;  1RKI A;  4UUW A;  2HS3 A;  4YHH F;  1LXN A;  1LWF A;  1N6Q B;  1FWK A;  1RU2 A;  2VL1 A;  2OMO A;  4OFZ A;  4K2J A;  4I7F B;  1YIT S;  1X4A A;  2RUG A;  2MZR A;  3FRZ A;  2CPE A;  4U7U D;  1VQL S;  3CWJ A;  1HMV A;  1EJ7 L;  2KFZ A;  4WPA A;  2YKQ A;  2R7U A;  2CJY B;  2FJW A;  4NLV A;  4RNH A;  2AGQ A;  2R8J A;  5I42 B;  1FEE A;  5ETN A;  3AHP A;  4ED5 A;  4FVM A;  2UUA F;  5D3G B;  4A8S A;  1QSY A;  3MUV P;  4DR6 F;  4EUV A;  1SJR A;  1Q7Y T;  4CP5 A;  1KON A;  2VZ9 A;  2BA9 A;  3C6T A;  2H5I B;  3ILI A;  3TZX A;  4FDF A;  2F8E X;  4CLY A;  1AFI A;  5BXI A;  5IQ6 A;  3HT0 A;  2HNZ B;  1CSJ A;  2HK2 A;  3DHX A;  4LF9 F;  4KFB A;  5KFC A;  4AL6 A;  4U8Y A;  3NGT A;  2D1C A;  1RTD A;  1QY7 A;  3EPI A;  2GQQ A;  3QLH A;  3RTV A;  2HRU A;  3EVM A;  4C8N A;  4AQY J;  4R25 A;  1F5B A;  1DBD A;  2JFD A;  3CIM A;  1FWP A;  2W25 A;  4KAI A;  1R3N A;  2CJX B;  3PW5 A;  2A1B A;  2HUR A;  2J5A A;  3M32 A;  4ZLP A;  1RAO A;  3MR7 A;  1S99 A;  4OYP A;  4MH8 A;  1X4G A;  2FY1 A;  4ES2 A;  2ZD1 A;  4QU6 A;  1SI9 A;  3G96 A;  4RBU A;  5GAD U;  4J9N A;  4RUH A;  2XCA A;  1SC3 B;  4C3K A;  1S1X A;  1I6J A;  4LF1 A;  4FPI A;  1EP4 B;  2UVW A;  3QO9 A;  2EWH A;  1L3S A;  1F0X A;  5BYQ A;  4RU2 A;  4EBD A;  2D9O A;  2A2D A;  2QMW A;  3LP2 B;  2B7B B;  4C8M A;  5EDW A;  2VPX B;  3BR9 A;  2W9A A;  1JLB B;  4O3S A;  3VAG A;  2YWG A;  1TQL A;  3FSX A;  2NPF A;  2ZM6 F;  2ZH5 A;  5IFM A;  2X1A A;  4WXW A;  2ABY A;  4QYR A;  3PO5 A;  4K7Q A;  1VQS A;  4M5K A;  5IOL A;  1FCA A;  1SL0 A;  2A18 A;  4TU7 A;  4LSL A;  5CYQ A;  4PUO A;  1I94 F;  3M6U A;  2I1R A;  4G6V B;  2DR6 A;  2CPZ A;  4RUA A;  5HQL A;  5DQG A;  2MKJ A;  4UST A;  1CUL B;  1C4C A;  3Q2S C;  2WRM A;  2DGT A;  3W66 A;  2NSB A;  1RWV B;  4O44 A;  2KI2 A;  4QPX A;  4JI3 F;  2MY7 A;  5CD4 H;  4M63 A;  3JTP A;  4DV5 F;  2NUU G;  4PXB A;  2CQC A;  4IG3 B;  2E5G A;  3GJR B;  3M9O B;  5C5J A;  3ZTS A;  1RZM A;  2H4Y B;  1J2V A;  1P9Q C;  3W9J A;  1GXU A;  3IGN A;  4DL0 C;  2JEG A;  2HQF A;  4QCL A;  4IDK B;  2LQB A;  4RUB A;  1F5C A;  2KHD A;  1S4E A;  5L1J A;  1MMN A;  1U25 A;  3PX4 A;  3AXK A;  5CQG A;  4K8R A;  2RML A;  1IBM F;  2NXU A;  5CXT A;  2BJ8 A;  4LMZ A;  3BM7 A;  1VYA A;  3G82 A;  3I4H X;  2R7O A;  3EXC X;  2N3O A;  2I8E A;  1YBU A;  3VAH A;  3W9H A;  4NCA A;  3FEZ A;  1RHJ B;  4K50 A;  2K3I A;  1YRT A;  2X1G A;  1F60 B;  3UN5 A;  2E5L F;  5CZV A;  2F4V F;  3R2D J;  1RWU A;  4A8M P;  5HMX A;  2MZT A;  2MB0 B;  4QYZ J;  2OPQ B;  2IC3 A;  2Z56 B;  3OHA A;  1JLF A;  4LR8 A;  2CNL B;  4J9V A;  3NGU A;  2CQ0 A;  3OPK A;  2VDH A;  4P9S A;  3G87 A;  3OUY B;  3VQT A;  2RUS A;  4CZC A;  4ES1 A;  4ZLL A;  4G1Q B;  1PBU A;  2Y1I A;  3CCZ A;  2ACY A;  1YTY A;  4I64 A;  1XTZ A;  2ZZT A;  4OYI A;  2M4M A;  2I5J A;  2QX0 A;  2FPH X;  3IAS 9;  5C2G A;  4PQU B;  3MUR P;  2IPO B;  5HVF A;  2ACM A;  2M8H A;  1NND A;  3T5L A;  1HQ2 A;  2KL8 A;  3GLJ A;  2AMC B;  2B6A A;  4CRJ A;  4ZVR B;  1XR5 A;  4RO0 A;  3MM5 A;  1Q78 A;  1FVQ A;  1NBE B;  5DDQ C;  1WOS A;  1NK9 A;  1S7H A;  2MGZ B;  1N32 J;  4IRK A;  4FF1 A;  1R6Y A;  2V9K A;  5GMD A;  3DHW C;  3B4M A;  3KK1 B;  2BJ3 A;  4MMO A;  4QR2 A;  2XY6 A;  3VGS A;  3MAA A;  4XIU A;  2RKI A;  3R6G B;  5CYM B;  4UZB A;  2F5G A;  4OYA A;  1YJU A;  3M6X A;  3HSJ A;  1OYE A;  2JHE A;  2R2T A;  4YB6 A;  3G86 A;  4X62 J;  7FD1 A;  2ZE2 B;  4U67 Q;  2JX2 A;  4KHM A;  5IV4 A;  3LA0 A;  3UDV A;  5LMN F;  4H4M A;  2JEI A;  4BS2 A;  1VQK S;  3OTC A;  5A8W B;  4C8Y A;  2XLI A;  2HK3 A;  3A8E A;  4RWW A;  4PEO A;  1REV A;  5K20 B;  3HCX A;  4UOF A;  5AT1 B;  4OHY A;  2VKR A;  2E1R A;  2FVQ A;  2JC1 A;  3VAF A;  2W01 A;  4ZVH A;  2HMI B;  4LR9 A;  3HVR A;  4WCE Q;  5KFT A;  4B02 A;  2I38 A;  3K5M A;  2XMV A;  1PKU A;  1N0U A;  2FD2 A;  2LEA A;  3ET6 A;  4Q44 A;  3NOG A;  4RW6 A;  4JI8 J;  3ZTP A;  3A1Y G;  4ICL A;  4I2P B;  2MHN A;  4F02 A;  1VQN S;  1WC5 A;  3VVU A;  1HNZ F;  2HHX A;  1UTA A;  5T7L A;  1K0V A;  1RHR B;  2F8M A;  4K4Z A;  2B4V A;  1SC4 B;  5L1L A;  2QSF A;  1F6T A;  2CQD A;  5HBM A;  2XG8 A;  3QRQ A;  1EB0 A;  4WF9 Q;  3UNY A;  5RUB A;  1AB8 A;  4ZVT B;  2BXJ A;  4GO7 X;  1MW7 A;  1HNX F;  3RZA A;  1U1Q A;  3BJY A;  3D67 A;  3HLU A;  1TUV A;  2R7S A;  1HR0 F;  2Y3Y A;  2Y8Y A;  4ELV A;  1IUJ A;  3V4I B;  4OYO A;  3M1V B;  3IFE A;  3AOC A;  3GTY X;  3DRS B;  4Q5V A;  1RYS A;  1K44 A;  2QLW A;  1MRO B;  3CD7 A;  3O6Q A;  2FGC A;  5KT5 A;  1LXJ A;  1S57 A;  4ELU A;  4W98 A;  2AEJ A;  2X1B A;  5E41 A;  2L9D A;  2V2Z A;  3S01 A;  3CJQ A;  2KTQ A;  1S97 A;  1YGY A;  2YH0 A;  4GMK A;  2JFK A;  1C1B A;  2Y0B B;  1DLO A;  4Q8E A;  4JB8 B;  2X51 A;  1N36 J;  3NRB A;  2E9Z A;  4X65 F;  2LQ8 A;  5IT9 U;  2NYH A;  3L3C A;  4DUZ F;  1GMV A;  1DFD A;  1RBL A;  3QAE A;  2ILZ A;  3LUY A;  3RAQ A;  3SV4 A;  4GKJ F;  2E5J A;  4UUX A;  1GQE A;  4PXC A;  3CCM S;  3HJF A;  2J76 E;  2G0J A;  3MMC A;  4P10 A;  3DGP B;  3RBZ A;  3J7A 1;  1LW2 B;  2HRT A;  2OSQ A;  4RW9 A;  3D6M B;  4NA2 A;  4NLW A;  2W2M P;  5GAE I;  3LWM A;  2MPU A;  5HI7 A;  3CJR A;  3LAM A;  1N5T A;  2HND A;  4MFB A;  3MR3 A;  3O5T B;  4ZCL A;  1X5T A;  1R0C B;  3MTJ A;  4JI7 J;  4DPY A;  4CT9 A;  5AJ3 F;  2DB1 A;  2PO4 A;  3PDN A;  1H3D A;  3PJX A;  4IR1 A;  1P8G A;  2HNY A;  5LT5 A;  2NXN A;  1K0T A;  4E2F B;  4USV A;  4BWJ A;  1FA0 A;  1NK7 A;  3R6L B;  4C0O C;  4YUD A;  5D77 A;  4Y3C A;  3RRH A;  1N8R T;  4JYA J;  4DPX A;  3PFO A;  1Z2L A;  1HYS A;  3A4T A;  3D6T B;  1V3Z A;  1AXQ A;  3PM9 A;  2PC6 A;  2YKN B;  3KLF A;  4WFY A;  2NQP A;  3L09 A;  1W26 A;  3M4X A;  3KLV A;  2QGF B;  4XTT A;  3POT A;  3FNN A;  4QIG A;  1FRI A;  3NKY A;  4EBC A;  1S9E A;  4DR5 F;  2J9C A;  4A47 A;  1FRJ A;  4KGK A;  5GAG U;  2KDO A;  1WKJ A;  3ZZP A;  5F0W A;  1Q95 G;  2OAU A;  4LFB F;  3N6N A;  3W2W A;  5BR8 J;  5HLF B;  1KFS A;  1TK8 A;  2ZBR A;  4JV0 A;  2XYP B;  2RF2 B;  1CJV A;  4R5P A;  2XCP A;  2UV8 A;  4LF7 J;  4DV6 F;  4DV7 F;  4KPY A;  2VJV A;  1JLE A;  2LEB A;  2H5J B;  1KC8 T;  3UD4 P;  2GVZ A;  4B3R F;  2KYZ A;  2BJ1 A;  1BMQ B;  3E01 A;  4X4V A;  3BDE A;  3ZZ0 A;  1GXL A;  4NLX A;  1S6P B;  3KG4 A;  4GO5 X;  2CNN B;  5DGA A;  3IA0 A;  4JI4 F;  3HPO A;  3M05 A;  1N6Q A;  3TYT A;  1UFK A;  2IRY A;  1URR A;  3L9Z A;  5FJ4 A;  1TMM A;  4PG7 A;  1WEX A;  1OJ4 A;  3A8K A;  3FMW A;  1HWJ A;  2RAQ A;  5I42 A;  1HA1 A;  3MOJ B;  1DTT B;  4DLE A;  1NHU A;  1IBL F;  4KKO B;  5D3G A;  2OFH X;  3I5B A;  3RBE A;  2YX4 A;  3B6B A;  4LF8 J;  4CNY A;  3TA0 A;  2KVI A;  1IBK J;  4DX6 A;  4JV5 J;  2UUC J;  3FZB A;  3ENA A;  4NLP A;  5LXR A;  2XY7 A;  4OHW A;  4X4U A;  2D3U A;  1FKP B;  3HVW A;  4N8O A;  2V4Q A;  1H7X A;  3AD9 C;  2HWT A;  3EZO A;  3OVA A;  3TUZ C;  4NCG B;  4BWM A;  1GMW A;  3K0J A;  3GIJ A;  3VGV A;  2HAI A;  1M5P C;  4JOU A;  3KLE B;  4HTI A;  4PG5 A;  1T9X A;  2CZV C;  3IG1 B;  3QGH A;  1GFW B;  3MM6 A;  1XR6 A;  3WHI A;  2H54 B;  2D41 A;  3PEH A;  4DV2 J;  1U4B A;  2IVF B;  5IQQ A;  5KAK A;  2IM3 A;  4RJV A;  4L73 A;  4OI1 A;  1SJF A;  3BPD A;  1RTI B;  2RE1 A;  1LK5 A;  4I68 A;  3NBP B;  4YB7 A;  3IR6 B;  5AE2 A;  2BW7 A;  1IR1 A;  3UDE A;  4RU9 A;  4DSJ A;  1X5O A;  4RLE A;  1LV5 A;  1CJT B;  2N4C A;  3RBD A;  3MM7 B;  2H3E B;  1Y3K A;  3CD6 S;  2L08 A;  4MKV A;  2EKN A;  4ED0 A;  3TZY A;  1RWN B;  2HIY A;  1KEK A;  1JLB A;  5F3T A;  1Q16 B;  3GFY A;  3O44 A;  3QAT A;  3Q86 A;  1FD2 A;  1RAC B;  2YNG B;  2GHV C;  1UVI A;  4A8O A;  3UN2 A;  1WTF A;  2KM8 B;  1SKS A;  4ITS A;  5THW A;  5IV3 A;  1QUV A;  3U02 A;  1V3S A;  5HJY A;  2RHS B;  3MCO A;  5EHH A;  5F8I A;  3OL9 A;  4ZVF A;  1C0U A;  6AT1 B;  4LRD A;  3Q8V A;  4X64 J;  2HHV A;  4B3S J;  1CUL A;  3BH6 B;  4C3L A;  2CG4 A;  3BYR A;  2PFD A;  2R42 A;  4YR3 A;  2LMI A;  1F9F A;  4Y00 A;  3DMJ A;  3D5M A;  4IG3 A;  3ILL A;  3CJ0 A;  5A6W A;  4V19 J;  2G2Z A;  3MCS A;  4C8Z A;  2LDY A;  1M0S A;  3I31 A;  5IM0 B;  1EIY B;  4ELT A;  3DLE B;  2QMX A;  1TL4 A;  4IDK A;  3M9N B;  3D1Q A;  3OXG A;  4LT6 A;  3OTB A;  2RDI A;  1ZM3 A;  2P9E A;  3AY0 A;  4O0N A;  3KMS A;  3ZO7 A;  2MJN A;  4P75 A;  4WK3 A;  2BYC A;  4NA3 A;  1ACM B;  5C42 A;  4I2Q B;  1ZZN A;  2DIT A;  2FVC A;  4EO6 A;  4DWI A;  4K4X A;  2ZNZ A;  1KQK A;  3G8S A;  5EUH A;  2YKP A;  3HD2 A;  1GAO A;  4HL9 A;  2HVD A;  3DLK B;  3R7N B;  1G7C B;  3KTQ A;  2B8Q A;  2E7W A;  1OWX A;  1CBK A;  1MWQ A;  4HHU A;  4QWC A;  3GR0 A;  4QPT A;  1RAD B;  2HQI A;  1E6Y B;  5KG7 A;  5F9L A;  1ZAW A;  2CNO B;  3OUY A;  2K7J A;  1RI7 A;  3C8Y A;  4AUK A;  1WHX A;  4G1Q A;  1QSL A;  5K8M A;  4NOH A;  1N4L A;  2JLE A;  5FD1 A;  4K5S A;  4D3H A;  2NXC A;  3SEO A;  2UU9 J;  2ROP A;  1WKL A;  4DSI A;  3PW2 A;  4NLY A;  4PQU A;  2B8P A;  4FXD A;  2OUG A;  3I6P A;  5A6P A;  3UDC A;  4C3M A;  1ICE B;  2BVZ A;  3QAU A;  3W2V B;  5ADZ A;  1MSW D;  2YKA A;  1IKV B;  3J81 U;  1S9F A;  1EQ0 A;  1V6H A;  2CQB A;  4L72 B;  3DLB A;  3QGP A;  2ADB A;  2QYC A;  3P96 A;  2DHX A;  4LVN P;  2R4F A;  3WZ0 A;  2C2O B;  2GFF A;  4ZPW R;  3KK1 A;  3UW1 A;  1NB2 A;  4J9M A;  1NK0 A;  1OPI A;  2K06 A;  1RQ0 A;  1WC4 A;  1W2I A;  5CYM A;  2GO8 A;  3T9N A;  5HAO A;  2WTF A;  1FX2 A;  4ZDN A;  3M8S A;  1VRQ C;  2QL7 B;  1X60 A;  2ZE2 A;  1WF2 A;  4YEA A;  4ZCM A;  4CYU B;  1IM6 A;  3FVY A;  3D7S B;  1XMQ J;  5A8W A;  2D74 B;  1NSK L;  3M8P B;  1Q81 T;  2HG4 A;  2VQE F;  1KNZ A;  1J5E J;  1U45 A;  2J6U A;  3GSD A;  2G4B A;  3DDK A;  2RD5 C;  1YVF A;  3A3O B;  4B3O B;  1BQM B;  2W4D A;  1WEY A;  1RWM B;  5KT2 A;  2CIM A;  2DH7 A;  3V81 B;  4TLR A;  5D6G A;  2UVV A;  2HMI A;  2ALZ A;  1Y9O A;  1BC6 A;  3QGG A;  3C6U B;  1N88 A;  3PNI A;  5EX0 A;  5CA5 A;  5M2U A;  1AT1 B;  4F36 A;  4H4O B;  3C16 B;  4I2P A;  4HH0 A;  1NDK A;  2OIH A;  1RLC L;  3AJD A;  2RNE A;  3KJN B;  2BAB A;  1QTN B;  4QR0 A;  1O51 A;  4QWA A;  2JSX A;  5ETO A;  1Q8K A;  2JWN A;  2OTJ S;  1FHT A;  4Y2K A;  2XZW A;  1TK0 A;  2W2O P;  2ZWO A;  1T9W A;  3N5F A;  4BLG A;  3IM8 A;  4DDF A;  2GS8 A;  3U1M A;  2YPY A;  4WFX A;  1RT3 A;  2XM3 A;  1SH0 A;  2A10 A;  1YJN S;  2A3J A;  2EI5 A;  3M1V A;  5HJX A;  2HPU A;  3DRS A;  2JH3 A;  1VRT B;  1U1R A;  4ED1 A;  1MRO A;  5DJB A;  3W8P A;  2MEW A;  1XNR F;  1S9G B;  3TAN A;  1NH7 A;  4PWW A;  4OQJ A;  1BQX A;  3N6M A;  1R0A A;  3M8W A;  4OIX A;  4U9R A;  2BAN B;  3JAM Y;  3LTO A;  2HBZ B;  3QBC A;  3J81 j;  4DQP A;  4WZQ A;  3UQS A;  4C48 A;  4HVZ A;  4YHH J;  3MCN A;  4LRA A;  3TUI C;  2DHG A;  4H54 A;  1K47 A;  1W2B R;  4X4N A;  2PDA A;  2KG1 A;  5HL7 Q;  1U24 A;  3TA1 A;  2EKY A;  2HKE A;  2C2R A;  3NEK A;  5E3P A;  3BN7 A;  3RB3 A;  6FDR A;  1VQ6 S;  2GV1 A;  2UUA J;  3CJ8 A;  3DOL B;  3DGP A;  1X7V A;  3OHB A;  1LW2 A;  4NAS A;  2IRU A;  4NMX A;  4DR6 J;  3QJL A;  4V19 X;  2AZ3 A;  3RB6 A;  2D9P A;  3UDL A;  1S1V B;  4M1K A;  5KFO A;  4DL7 A;  4X4Q A;  2GGP B;  2BJD A;  1NK6 A;  4C4W A;  5D78 A;  1TL1 B;  4ED8 A;  3P5T L;  5IT4 A;  3GJS B;  4LF9 J;  5JJB A;  1CC7 A;  3TAM B;  4J9K A;  2OTL S;  3NMR A;  2XYG B;  3QT6 A;  3LGH A;  3KJQ B;  2KT5 A;  1NK8 A;  2C2K B;  2ZH1 A;  1RHQ B;  2HGL A;  3E3X A;  3KNG A;  2JVO A;  2GQC A;  1OY6 A;  1QTM A;  2FJV A;  3H4D A;  2YKN A;  2Z2Z A;  3HF5 A;  5DZ6 A;  4MIW A;  4FP9 A;  5F8L A;  1JLA B;  4CNZ A;  2H9Z A;  4ZIT A;  4ECQ A;  3CCE S;  4GKK F;  1B0T A;  5D4P A;  4UY8 5;  4JI5 F;  4YOE A;  2EPI A;  2Q79 A;  1KKH A;  2DXF A;  2CZ4 A;  1G2E A;  4ZLJ A;  1PIE A;  5HLF A;  2M7S A;  3KHL A;  3R8Y A;  4XK8 C;  5DLG A;  2R9L A;  2RF2 A;  2BM1 A;  1ITP A;  3TOQ A;  2NPI A;  2RT3 A;  2EFV A;  1M5O C;  3SCI E;  2LA6 A;  2ZM6 J;  3ZZR A;  3Q89 A;  4H4K C;  1V5V A;  3Q8R B;  4DL2 A;  3D1H A;  4RUC A;  2L9N A;  2FQQ B;  2C3P A;  3B8H A;  3I32 A;  4MIB A;  1I94 J;  3VF0 B;  2HSE B;  2ZWP A;  3K8W A;  3HZE A;  3NGS A;  1FFG B;  2MKC A;  2BE7 D;  4U8V A;  3BDP A;  1RTJ B;  2H48 B;  2HAF A;  5J1E A;  4NLD A;  4DV5 J;  1SJ3 P;  1RAJ A;  3OTO F;  4A48 A;  1NZA A;  3GFH A;  1RT7 B;  4Y65 A;  4ER8 A;  2R3V A;  2C3Y A;  2DKO B;  2PT0 A;  4F26 A;  4LFC F;  3SCL E;  3CDA A;  4RNN A;  2VC1 A;  1ZYQ A;  1LWX A;  3PJW A;  1DTT A;  1PJ5 A;  2UXD J;  4KKO A;  1AUD A;  2HWI A;  2EFN A;  4FKY A;  4ECV A;  4B9L A;  2E9T A;  2OD6 A;  1S48 A;  1IBM J;  3DGV A;  2HQC A;  1FDD A;  3NS7 B;  4U6P A;  8AT1 B;  3CJT A;  4ANE A;  4DX5 A;  4BC7 A;  1X9S A;  1FKP A;  2W7P A;  2FGO A;  2DO4 A;  2D3Z A;  1TR0 A;  3JSB A;  2E5L J;  1UZH A;  1BUX A;  2F4V J;  3WC2 A;  4Y2A A;  4NCG A;  4OI6 A;  4YN3 B;  1R8H A;  3CE8 A;  2RQC A;  1VLO A;  1L3K A;  3LWL A;  3TRG A;  5FLX Y;  4ZIW A;  4AL7 A;  3KLE A;  2HHT A;  4LRC A;  3T1Y F;  4AL5 A;  4IO1 A;  3IG1 A;  2CQ4 A;  4HAC B;  1VI7 A;  4F25 A;  1KVK A;  3W60 A;  2CDR B;  2CJB A;  5LXY A;  3TWZ A;  1WHW A;  4OZ0 A;  3CD0 A;  2WVC A;  4ZVS B;  2HVE A;  4WXO A;  5DO2 A;  2CQH A;  1F3F A;  2MQO A;  5F8H A;  3QQC D;  4KHP J;  2LYV A;  4O4R A;  4ILL A;  2ZUG A;  1RTI A;  4OI0 A;  1O8B A;  3R5J B;  5KG2 A;  1WDT A;  3BSA A;  1HMV B;  2HHQ A;  4OYM A;  4ZVQ B;  2DIU A;  2MKS A;  1NKE A;  1UJ6 A;  1CJT A;  5A8R A;  2HFO A;  3D66 A;  3MM7 A;  3O3L A;  2GNK A;  2Y1R I;  5HN0 A;  3SFU A;  2L41 A;  1VDH A;  1T3N A;  1WWH A;  2OLW A;  2VFS A;  3HZG A;  3SCK E;  2AEM A;  3MXH P;  4ILM A;  1HL6 A;  1HNW F;  1SKU B;  3ZNU A;  2EK1 A;  1NCL A;  2WK4 A;  2ASY A;  1UFL A;  3N9U C;  3ZNJ 1;  2UVU A;  1RK8 A;  2BRK A;  2Z2Y B;  5ETL A;  3DLG B;  3TAR A;  3HSD A;  4WZM A;  4KFB B;  2XS5 A;  2OH2 A;  2CJA A;  4Q45 A;  5LMN J;  2P6S A;  3UVJ B;  3PW7 A;  1MML A;  3I87 A;  3TAP A;  1RDR A;  2W4C A;  4KJI A;  4U7C A;  3EDQ B;  4P74 A;  4CIO A;  2I2Y A;  4HDG A;  1ZPV A;  4MKA A;  5KFN A;  2OSR A;  1S79 A;  4Q0B B;  5IM0 A;  3DLE A;  1IR2 A;  1WHV A;  1QAX A;  1S0N A;  4I0W A;  1HWI A;  2ZD1 B;  2IAJ B;  5J2N A;  4N8N A;  2IHR 1;  4DV3 F;  4X4R A;  4OI2 A;  5F8J A;  1PAE X;  1RAA B;  5HAN A;  3TI0 A;  4B9M A;  1RE1 B;  2R2S A;  1N56 A;  1HWL A;  2AX0 A;  1Y00 A;  3DRY A;  3D4J A;  4I2Q A;  1HNZ J;  5H1S V;  3PYG A;  1XNQ F;  5KFM A;  4N5S A;  2GO9 A;  4ZIV A;  2YWE A;  3BPS P;  3QSY B;  4Y34 A;  2GJF A;  4W92 B;  2U2F A;  1FWL A;  3DLK A;  1GXT A;  4W90 B;  1U02 A;  3ZXW A;  1T9U A;  3MOZ A;  1KR4 A;  2AEF A;  1HNX J;  2MXY A;  4R8U A;  4MK9 A;  1HW8 A;  3JQJ A;  2ZHB A;  1TL5 A;  3R7S B;  2R8G A;  3B78 A;  4DX7 A;  2QIF A;  1HR0 J;  4OJ3 A;  3R3T A;  5FII A;  1JJ2 R;  4WKR A;  3NG8 A;  2CQ2 A;  2DRB A;  2KRB A;  2ASD A;  4O44 B;  2BJE A;  3EX7 B;  1X0P A;  5HQ8 A;  3S1T A;  3CCV S;  3UD5 A;  1OSC A;  3BQ0 A;  4DS5 A;  2O67 A;  5GAH I;  1CQM A;  3OLA A;  3NLC A;  1BWV A;  1IKV A;  4QR1 A;  1YQH A;  1ZM4 A;  1RT1 B;  1Q53 A;  2VQF F;  4TQS A;  3CDW A;  2C2N A;  3C14 B;  4RW4 B;  2XMM A;  4X65 J;  4F4A A;  1U6B A;  4I4B A;  1AA1 B;  3PV8 A;  4DUZ J;  1YLX A;  1M1G A;  2O3D A;  1EKR A;  4GKJ J;  4RBT A;  5LM7 E;  3JTN A;  4CH7 A;  5K8N A;  1ZTW A;  2UUB F;  5LMU F;  1L5U A;  5D8H B;  2QTW A;  1SPB P;  1HI1 A;  1BLU A;  3Q0A A;  1NPR A;  3JQM A;  4HH1 A;  1JQG A;  4DG1 B;  5KFP A;  2C2E A;  3D2W A;  4CYU A;  3NGR A;  4OZ5 A;  1HI0 P;  1RT4 B;  1SL1 A;  4MK8 A;  5LOQ A;  3THT A;  3M8P A;  3G4S S;  1EKS A;  4PXE A;  2AWZ A;  3S8S A;  2MSS A;  1M5V C;  2FJX A;  4A8F A;  1VC5 A;  2XMJ A;  2ZDO A;  4HLB A;  4B3O A;  1RKJ A;  3ISN C;  3K5O A;  3V81 A;  4OX7 A;  4ETX A;  2ASJ A;  1K8A T;  3R27 A;  1T9Y A;  1Z4U A;  3PIP Q;  3M7V A;  5AXM A;  3NOC A;  3J7Z 5;  1TKZ B;  2QLJ B;  5L1K A;  1SIW B;  4FN5 A;  4C8O A;  5GAD I;  2B6A B;  3QWP A;  1KQG B;  3K58 A;  4H4O A;  1I3O B;  3C16 A;  2JEF A;  5K14 A;  2IDL A;  2DHS A;  4Q8F A;  2JJ4 D;  3M6W A;  3PHE A;  1R89 A;  3EZU A;  3JS9 A;  4TYB A;  5C24 B;  4KHR A;  4QW9 A;  3S7R A;  3I5A A;  2ZDP A;  1JX4 A;  4LF2 A;  4I1T A;  4IH7 A;  3FUY A;  4XDC A;  4O3Q A;  4ZK7 M;  4LFB J;  4B17 A;  2FLO A;  3AH6 A;  1U6Z A;  2L3M A;  3W1Y C;  2VIH A;  3TNV A;  2QO3 A;  4PZV A;  4DV7 J;  2M0G B;  3BGR B;  5I3P A;  1VRT A;  2OEJ A;  4DR2 F;  1TTH B;  2G9O A;  3VAI A;  4DF8 A;  2ZIT A;  1S9G A;  3LOU A;  1R27 B;  1RT2 B;  1ZOT A;  3ZZY A;  2CPF A;  2CQ1 A;  2FVS A;  2YX1 A;  4B3R J;  5D0R A;  2KT2 A;  2BAN A;  3IO1 A;  2BOA A;  4EEY A;  2VBY A;  5ETV A;  8RUC A;  3B54 A;  4M5I A;  1SJ4 P;  1PJ7 A;  3ZC4 A;  2HQD A;  3OFF A;  3P3D A;  1VQY A;  4NCB A;  4ZMM A;  2G2Y A;  2Y0S D;  3GII A;  3H40 A;  3UFC X;  3KJV A;  3ZTR A;  1S0V A;  1LKZ A;  1NHK L;  2V67 A;  2BJ9 A;  2UXB F;  4ZP8 A;  2HWH A;  5B0C A;  5FDL A;  1FXL A;  3K5L A;  4ID8 A;  1IBL J;  2WBR A;  3DOL A;  2M88 A;  2RHQ B;  2ZBI A;  1X4H A;  2VJU A;  2YQ1 A;  4J9R A;  2ROE A;  3CXC R;  5AXL A;  2F40 A;  3DKD A;  3P6Y C;  1S1V A;  4ECY A;  1XWL A;  4X4P A;  2DR5 A;  5M2R A;  2DXE A;  4OJ1 A;  2GGP A;  1T11 A;  5J2M B;  4TXS A;  1TL1 A;  2ZH2 A;  2KJW A;  1NSA A;  3GIM A;  2VBZ A;  5L9N A;  3TAM A;  1QE1 B;  5L8R C;  4KGM A;  4HYK A;  4QZV B;  3KLI A;  1MG7 A;  2OML A;  2OKQ A;  1R0B G;  1KWM A;  2UUT A;  2XZD B;  3H8Y A;  4PRF A;  5DDO C;  3NNH A;  4URQ U;  3SV3 A;  3EZ5 A;  3HUL A;  2KO1 A;  1UW4 A;  3WBZ A;  5B08 A;  1FRX A;  3GIK A;  4AND A;  2HVZ A;  4PWU A;  5HSP A;  4USJ C;  5ETR A;  1N5Q A;  2WHO A;  1JLA A;  2DNO A;  2QSW A;  4DL3 A;  2POK A;  3UD3 P;  2W1B A;  4F4W A;  2AP6 A;  1LFW A;  1X8D A;  2Y8W A;  2E29 A;  2AYB A;  4BBY A;  1RAF B;  4YDD B;  5C2C A;  4QQB A;  3M2V B;  3Q8S B;  2EFP A;  1ZM9 A;  1TVR B;  5GVQ A;  1H0H B;  3MCM A;  5KG3 A;  1CQN A;  1YRU A;  1S5Z A;  4RW9 B;  3OR2 B;  2CPJ A;  4NI2 A;  2PMZ D;  2XI2 A;  5J2P B;  4DR1 F;  4GVB B;  3KHH A;  1A7G E;  3MAQ A;  4NE9 C;  2H51 B;  4UOG A;  5KOX A;  4F0M A;  4MFB B;  3DOM B;  2AJ4 A;  5LSO A;  3OT9 A;  4ZCK A;  3NGK A;  1LWE B;  1X5P A;  3TUJ C;  2D3O 1;  1I1G A;  3OV7 A;  1B4S A;  2YWH A;  2KZM A;  1BXN A;  2V34 A;  1RTJ A;  2MZJ A;  4USU A;  1KN6 A;  4N7T A;  3SSR A;  3RBX A;  4IOC Q;  1Z1Z A;  4LRE A;  5KFW A;  4KH1 B;  3SSS A;  1KBR A;  3CC2 S;  2F4F A;  3QWU A;  2RIJ A;  3NCR A;  1N0V C;  3OTD A;  2J6S A;  1HYS B;  3VVT A;  1LFP A;  3UWT A;  1M5K C;  2FIU A;  4QU7 A;  1X31 C;  2KZZ A;  2XSF A;  4ZPT R;  3CMA S;  1XJW B;  2QLX A;  2ROG A;  4ZP6 A;  2E1M C;  2DGU A;  4KYZ A;  5HVG A;  3THV A;  3T6B A;  2VFR A;  3H42 A;  4DFP A;  4Z7C A;  2IFX A;  1QVF R;  1JNR B;  1WKK A;  3W2W B;  5GMK a;  2AJF E;  3W64 A;  1ROF A;  2DR9 A;  4NX9 A;  2DIS A;  3GB0 A;  5KFY A;  2CQI A;  3I96 A;  2WB1 D;  5K8P A;  3J80 Y;  1JK9 B;  2LA4 A;  4NZ0 A;  5KFE A;  5KFD A;  1HWU A;  3F41 A;  1J27 A;  1QM9 A;  2AKW B;  4ANC A;  2NCK L;  4NLG A;  1LQ9 A;  3UNG C;  5F0U A;  2V2V A;  5GME A;  1XEZ A;  1N32 F;  4UY8 T;  7AT1 B;  3TJA A;  4IRD A;  1J5O B;  5F3Z A;  4ZVU B;  1I51 B;  4X2B A;  2CYY A;  3HKW A;  4DN0 A;  3NL0 A;  2V8H A;  3HVT B;  2D69 A;  1MNE A;  5KFJ A;  2V8D A;  2K3K A;  2XNR A;  3ICL A;  4J9S A;  4RPF A;  2KFN A;  1PO6 A;  2VUG A;  3FCV A;  3VCD A;  2BW2 A;  3FEX B;  4WBF A;  2Q3P A;  4K4V A;  2B43 A;  1NRK A;  2DR8 A;  3DOK B;  3RW7 A;  3DC2 A;  3ZTQ A;  2WVD A;  3KLG A;  2WZ1 A;  2EFG A;  4ATN A;  2XHC A;  4J9U E;  3QZ7 A;  2IBO A;  1U2C A;  2WW8 A;  2DNR A;  1WNE A;  3CSK A;  4P73 A;  5DZ7 A;  2E44 A;  1VQO S;  1Q7L B;  1NB7 A;  1ZAV A;  2WSF C;  2RJZ A;  4YY3 F;  4PWD B;  3UCG A;  3UCU P;  4TKT A;  4P6Q A;  4K0K F;  2LFV A;  2OPS B;  2VG7 A;  2AJ0 A;  5CAA A;  4ALZ A;  5HRO B;  2OJ3 A;  4USH A;  4JV1 A;  3DLG A;  1FTR A;  3OL7 A;  1EHW A;  1T0T V;  1E6V B;  1U1O A;  3UVJ A;  1RAH B;  2DGW A;  1Y0H A;  2UP1 A;  4TN2 A;  3FGV A;  3SIP B;  4ZP9 A;  2VQE J;  2MQM A;  3MM6 B;  4AD6 A;  4ZN3 A;  3LF0 A;  3EWG A;  4CM0 A;  4LBI A;  1KOH A;  4YME A;  3M8R A;  2DJW A;  2O1P A;  1EAY C;  4USM A;  1SV5 B;  3PX0 A;  3H25 A;  4Q0B A;  1Q79 A;  2DNM A;  2B4U A;  4F4Y A;  4C11 B;  1EAR A;  4KE5 A;  2IAJ A;  3ZTO A;  1VBK A;  4WP3 A;  3IRX B;  5A2Q Y;  3BS9 A;  2DGV A;  3MGJ A;  2P2C B;  1D9F A;  3GIL A;  2VFU A;  3EPG A;  3KKF A;  3IRW P;  5GAG I;  1YZ6 A;  2VKZ G;  4LF6 F;  1KTQ A;  2WB4 A;  1VOM A;  2DD8 S;  3F56 A;  3CC7 S;  5K8O A;  1WF1 A;  1X5S A;  4DU8 A;  5SUH A;  2W8K A;  1PSD A;  4DPO A;  3SZ2 A;  3PJ9 A;  1S1T B;  3HO1 A;  1MU2 B;  3MFH A;  3W9I A;  5G0R A;  2PI4 A;  4DMZ A;  3T9Z A;  1RBA A;  3PO4 A;  2J0Q D;  4K5R A;  4JI1 F;  1V5I B;  4J9O A;  3W62 A;  2O5D A;  2DIV A;  4DV4 F;  1KQF B;  1Y11 A;  1RT5 B;  4RNF A;  5B0G A;  3LH2 S;  1C0U B;  4ECT A;  1WI6 A;  4K2X A;  2PMH A;  3C46 A;  1PBA A;  1S6U A;  1S1W A;  2Y9H A;  3JYT B;  1XNR J;  2WW4 A;  3WIV A;  1DAR A;  3DMJ B;  2BQ3 A;  2J8S A;  3PVX A;  1ZPW X;  4ZP7 A;  3K17 A;  3L95 X;  1SQF A;  1X4B A;  4HTJ A;  4KV8 B;  3GFX A;  3HHK A;  4S0M A;  1RT1 A;  5B0D A;  4OX9 F;  2IM1 A;  4DFM A;  5KG4 A;  4OZL A;  1YBA A;  1QDU B;  1HWK A;  3NP5 A;  4ZJQ A;  5E7O B;  4C7Q A;  3C14 A;  3KUG A;  4RW4 A;  3NWG A;  3JSR A;  2YY3 A;  3SFG A;  2E9R X;  4F04 B;  1R8P A;  2C3U A;  5LL6 d;  4ES3 A;  1YIJ S;  3DLH A;  4O3N A;  5C42 B;  1HI8 A;  4ZLN A;  3CCR S;  1QD1 A;  4C97 A;  4ZVE A;  4L3N A;  4USK A;  2J7K A;  2L9W A;  4ZPD A;  2ILY A;  5KFV A;  4DG1 A;  3Q24 A;  5D4L A;  4MIA A;  2MQP A;  3QJJ A;  3VGU A;  2N82 B;  4EZ9 A;  1PCA A;  3GPA A;  1Y7P A;  3JSM B;  3HMJ G;  3W5Z A;  4J90 A;  1RT4 A;  2NLW A;  3H90 A;  2ZH7 A;  4JBC A;  4FZV A;  1YG0 A;  2QA1 A;  2COL A;  1H7W A;  4ED6 A;  3D9B A;  4DR4 F;  1SB6 A;  1R8A A;  1S72 S;  2V4R A;  1KLN A;  1T9V A;  5D4O A;  4EU0 A;  3ENQ A;  1IVZ A;  2EK6 A;  3BO4 A;  2HBR B;  2MTL A;  4L76 A;  1TL7 B;  2WSE C;  4FYV B;  1M90 T;  2WBM A;  5KT6 A;  2F7V A;  5F8N A;  2RSQ A;  3MF5 A;  2MLY A;  4P52 A;  3TJ9 A;  1VJW A;  4F2R A;  3M30 B;  1TKZ A;  2XI3 A;  3RJM B;  3GG1 A;  2VBW A;  4NLR A;  3QIP B;  4MTP A;  4LR7 A;  3QGI A;  2XY5 A;  1KHW A;  3KLH B;  2QZ8 A;  3CB4 A;  4LRB A;  1GMU A;  2QV6 A;  2W7O A;  5LJ3 Y;  5C24 A;  5B7W A;  3PR4 A;  4DOZ A;  3GON A;  4OX8 A;  3BO2 A;  1BQN B;  4JI5 J;  1N5Y B;  3MMA B;  3T6J A;  2VDI A;  3S6E A;  3X1L B;  2CG8 A;  1Q8I A;  1WOR A;  2V5H G;  1KDN A;  2RRA A;  2GVD B;  2CPY A;  1N34 F;  1H6K X;  2PA8 D;  2EFQ A;  4OZ1 A;  4ED4 A;  3H5Y A;  1DHM A;  4LSN B;  2IMW P;  1IKX B;  1I5O B;  3MMB B;  2ZJP Q;  2PN6 A;  2NZ4 A;  3FK4 A;  1DTQ B;  2VG6 A;  3BGR A;  2AF6 A;  4W4M A;  3W3S A;  4YR0 A;  1K9M T;  1FE0 A;  1RT2 A;  2DXD A;  2E5I A;  1MWY A;  2VOO A;  3LGN A;  3C2P A;  3ISN D;  1LK7 A;  4KO0 B;  5I4M A;  3ETM A;  2ZHA A;  4FS1 A;  1TU0 B;  1YZ7 A;  1WJ9 A;  1JJC B;  4M95 A;  4DF4 A;  2D3O R;  2N3L A;  1IQT A;  2XLJ A;  1C0T B;  3OTO J;  3A3N B;  2HGM A;  4HT5 A;  4IG0 B;  1BY9 A;  4WFN Q;  1FDB A;  1JXV A;  4LFC J;  2GC8 A;  2QA4 S;  1HQE B;  1UCN A;  1WC6 A;  2ZH3 A;  1U1L A;  2P9G A;  2DK2 A;  3AB2 B;  3IC1 A;  4JV2 A;  1HD0 A;  1FT8 A;  3D1O A;  1GEH A;  5D0H A;  2AGP A;  4UQT A;  3MPY A;  2UUW A;  2B9Y A;  2HRY A;  4Q7A A;  7FDR A;  2YQ3 A;  5MLC V;  2CPH A;  2F65 A;  2XTJ P;  4NLQ A;  1OQ6 A;  2LEP A;  4K4Y A;  1GK8 A;  1IN0 A;  1UZD A;  1AFJ A;  1RT3 B;  3EXY A;  2RS2 A;  2IDE A;  4J9L A;  1RWX B;  5D4N A;  4DS4 A;  5J2M A;  1F1B B;  3PW4 A;  4FYY B;  3TAQ A;  4F0K A;  3DU6 A;  3OBI A;  4ETZ A;  3Q23 A;  2IBK A;  2HQG A;  2A2C A;  4AFF A;  1QE1 A;  2R7T A;  2HLU A;  2BKP A;  4JI6 F;  2Z30 B;  2B9W A;  3T1Y J;  4DLG A;  1WHY A;  2VOD A;  1RLD A;  3PIO Q;  1R0A B;  1AW0 A;  2ALY B;  3W65 A;  3I5C A;  2R7X A;  1R8C A;  1N5S A;  4LUB A;  4DUY F;  3PRV A;  3PW0 A;  1FO1 A;  4C98 A;  4RNO A;  3O2I A;  1S0O A;  1FXR A;  5K5M A;  2DYA A;  4ZKA A;  4DI6 A;  3I0S B;  4PAA A;  4C8L A;  3V5R A;  4JI2 J;  3I55 S;  4OLO A;  2V8V A;  1OY9 A;  1WTB A;  3H2U B;  5JUM A;  3ELH A;  2W2N P;  1ZM2 A;  4ECU A;  2EG2 A;  4CQ1 A;  3M2V A;  5E5N A;  5M2P A;  3IWL A;  4P2F A;  4EMD A;  2GCF A;  4IR9 A;  3MPW A;  1YJR A;  1X4D A;  3BR8 A;  1FEH A;  1TVR A;  1PG5 B;  4WII A;  2OO4 A;  2UVR A;  2HFN A;  4CTA B;  3OR2 A;  3V6H A;  3TQE A;  1WSV A;  1KQS R;  2E1C A;  1HNW J;  5J2P A;  4GVB A;  3LAL A;  2R8K A;  4C0B A;  3DOM A;  1LWE A;  2YH1 A;  3PXG a;  4Q2M A;  3CCS S;  4R0J A;  5SZT A;  2B51 A;  3FQK A;  9RUB A;  2UZA A;  2GAH C;  3IWN C;  3PTW A;  2DNN A;  2OPR B;  1FX4 A;  5F9N A;  2LLZ A;  1SKR A;  5DS7 A;  4OX6 A;  3MTK A;  1SL2 A;  4KGZ B;  3GR1 A;  1WD6 A;  4A4J A;  1NK4 A;  5H9E K;  5LJ5 Y;  4YS2 A;  1IJE B;  4NLS A;  4J91 A;  4XO0 A;  4YFU A;  4P2M A;  3BKU A;  4ID5 B;  5F41 A;  3OD2 A;  3T5H A;  1Q8L A;  3OVB A;  1PIL A;  4CO3 A;  3A8I A;  3I9V 9;  2YNH B;  3VAL A;  1NO8 A;  2MQN A;  1UJ5 A;  2HGN A;  2QT7 A;  4C8K A;  4DV3 J;  4I69 A;  1T8E A;  3M2U B;  1FRM A;  1XK8 A;  2J9D A;  2E66 A;  1DAX A;  1LNQ A;  1RUS A;  4DV1 F;  3DRX A;  4K4U A;  5HMW A;  3OL6 A;  1SJ1 A;  3OJS A;  2JOQ A;  4XPC A;  2XHW A;  1H38 A;  1RWW B;  3T5K A;  3HFV A;  3GV8 B;  1YX2 A;  2Q1L A;  1WEL A;  1GX5 A;  2YWK A;  3LW5 C;  1JXL A;  2PFF B;  3Q8Y A;  3Q22 A;  2W9B B;  2AQ4 A;  4N56 A;  4NZ7 A;  1J5O A;  2MYF A;  1M1H A;  2HBQ B;  1YI2 S;  1NU4 A;  4FBU A;  2RU9 A;  3HVT A;  2XUL A;  1UKU A;  3THP A;  1IQZ A;  2FHK A;  1M5S A;  3HSZ A;  5J1E B;  1VIO A;  4L6V 3;  4HR2 A;  3ZZU A;  3D0H E;  2LQJ A;  4N76 A;  1RIS A;  1Y4Z B;  4PAB A;  2IM0 A;  3V6D B;  1LW0 B;  3DOK A;  1NJY A;  2MZQ A;  3B82 A;  4F50 A;  4BHQ A;  2BR0 A;  2VQF J;  2AIR B;  4M5M A;  2NXJ A;  1IKY A;  1RWP B;  2IYI A;  1D8Z A;  2PE8 A;  4J9P A;  1NJI T;  4I67 A;  3CF5 Q;  4CLK A;  5KFA A;  3NAI A;  3OXL A;  4OI3 A;  4A46 A;  4PG4 A;  3G8Q A;  2KRR A;  3PEJ A;  2IA0 A;  2UUB J;  4PWD A;  5LMU J;  1FRL A;  2NYI A;  1XIQ A;  4Y6I A;  5D0G A;  1FJG F;  1JLG B;  3J7Y U;  2OPS A;  3KG1 A;  2CAD A;  2K1R B;  4MYT A;  5HRO A;  2ADC A;  1NLK L;  4FPR A;  2V50 A;  4DN9 A;  1UET A;  1H73 A;  3JB9 k;  1E6V A;  4WJB A;  1L3T A;  1U09 A;  3IN5 A;  2DNG A;  3CDE A;  1VLY A;  5C25 B;  2CWK A;  3UE2 A;  2VHG A;  5KG1 A;  2BDP A;  1RA6 A;  3T41 A;  1MWZ A;  1VIX A;  3K89 A;  1RJJ A;  1TKT B;  3CGI A;  5DDP C;  2VF3 A;  3K8V A;  5L38 A;  4M5L A;  1Q1K A;  5KFZ A;  2JDJ A;  4NWB A;  4Y28 C;  3BO3 A;  5H9F K;  4LF5 F;  1SV5 A;  4URG A;  5L1I A;  2FHO B;  2HW3 A;  4OV6 A;  4CLL A;  1HKA A;  3CCL S;  4CCH A;  2J6T A;  2C2Z B;  4C11 A;  3OW2 R;  4DJB A;  2DGS A;  4KRW A;  4AT1 B;  5CYJ A;  3IRX A;  3F44 A;  3CT9 A;  2ZH6 A;  4AYB D;  2FVR A;  3TP2 A;  1OY8 A;  4UZC A;  2LXF A;  5A8R B;  2DGO A;  4F67 A;  2K2P A;  4KIA A;  5D0E A;  1YJT A;  5AXN A;  4ECZ A;  3V6J A;  3NCP A;  1NKC A;  3ULH A;  4DUT A;  1CJK A;  1NM2 A;  1RAG B;  2OEK A;  3SDE B;  4LFA F;  1S1T A;  2XMU A;  1MU2 A;  3N5B A;  2BOP A;  2P6T A;  5KFK A;  3IM9 A;  3I82 A;  3BKF A;  4Y2C A;  3OFG A;  3TX0 A;  1U47 A;  3K5N A;  4QIV A;  1OPZ A;  3WX4 A;  4B3M F;  3SXL A;  1XER A;  6FD1 A;  1RT5 A;  5KFQ A;  5GAH U;  2W2Q P;  4DCP B;  1VR6 A;  3U1N A;  1RCX B;  4DR2 J;  3KHR A;  2XZT B;  3TQ1 A;  3X3U A;  1MN9 A;  3JYT A;  4OZN A;  1WEZ A;  2CJK A;  3P5B P;  3QPI A;  1Q82 T;  3RW6 A;  5IWA F;  5KOW A;  3SSQ A;  4ZCI A;  1RYR A;  2IRX A;  2RB7 A;  1X9M A;  1OO0 B;  3BF4 A;  3B4D A;  1U1N A;  2E7V A;  4KV8 A;  4DQQ A;  3D6F B;  3HHN B;  4PR6 A;  3VZI A;  4H4K A;  2FLN A;  3TW0 A;  3G6X A;  4K4W A;  1TKX A;  3SQG B;  2MZ1 A;  4NEY A;  4PPZ A;  1Y3J A;  5J2N B;  3JQK A;  2KG0 A;  3GJT B;  2HFZ A;  2DY9 A;  4ENO A;  2CFX A;  3FZ2 A;  2QA2 A;  1HNV B;  2DRA A;  5JVG Q;  2U1A A;  3EGW B;  4P7T A;  1KS2 A;  2UXB J;  5ETS A;  2X3D A;  1UA1 A;  2DVI A;  3DXB A;  3G6V A;  2FDN A;  2FZC B;  3N0V A;  2R7V A;  3BRE A;  1KVJ A;  3H98 A;  4DL5 A;  2C42 A;  4DZD A;  2FB0 A;  5KG5 A;  1TAU A;  3Q8Q B;  1SXL A;  2J8A A;  1TUG B;  5KFX A;  4O23 A;  4C6A A;  3JSM A;  2AYE A;  4J5O A;  4R8U B;  1SVD A;  4WYW A;  2EBG A;  2HFS A;  4EI2 A;  1ZET A;  1NKB A;  2NSC A;  4IH6 A;  3W5Y A;  3WC0 A;  1VCT A;  4RBV A;  1O6X A;  2DO0 A;  3BQ2 A;  3AJ2 A;  4DEZ A;  3UO0 A;  3IS9 B;  1TL7 A;  2E5H A;  2DGX A;  1REG X;  4KGX B;  3A13 A;  3D3C J;  4KPC A;  3CUN A;  1HBO B;  3TEH B;  3E2E A;  1U8S A;  4UQG A;  2LQ5 A;  2H1Y A;  1C2P A;  1WDD A;  2J9D E;  2B4O A;  3M30 A;  3ISZ A;  2H5E A;  4RWX A;  3O1L A;  2YXL A;  3L4B C;  1RBO B;  2YQ0 A;  3DLJ A;  3FEY B;  1F3V A;  2ZZM A;  4OZ3 A;  4KGV B;  1YJW S;  3QIP A;  4BC9 A;  3KLH A;  2IYG A;  3NY0 A;  5JXS A;  4DSE A;  3LPY A;  1N52 B;  2BQR A;  1KLM A;  3CC4 S;  2P9C A;  4NLO A;  1BQN A;  1N5Y A;  3MMA A;  2OGU A;  1HHT P;  2DEJ A;  3MFI A;  1RP5 A;  4TVA B;  3CW2 C;  2H4W B;  2KB2 A;  4NML A;  2GVD A;  2IIH A;  2P8I A;  2IY5 B;  5A8K B;  4DR7 F;  1PJ6 A;  2DH8 A;  2NXE A;  2D7S A;  1SIZ A;  3EDR B;  1UL3 A;  4DR3 F;  3JSY A;  3QT5 A;  3FBF A;  2RDD A;  4LSN A;  1IKX A;  1HNI A;  3MMB A;  3QID A;  1DTQ A;  5KT7 A;  1HLW A;  2ZBP A;  2IM2 A;  4FYW B;  4DR1 J;  2VIC A;  1S1U B;  2QN6 B;  1FNM A;  2KJV A;  3GYN A;  1JXE A;  2AT1 B;  3WIU A;  2RS8 A;  5B09 A;  1S10 A;  2UXD F;  4KO0 A;  4LRF A;  4Y2M A;  3WDO A;  2CVE A;  2ZVI A;  3D3B J;  3DDI A;  4RW7 B;  4IO9 Q;  1OYD A;  3FSY A;  3V2U C;  1NJW A;  4TY8 B;  1UEU A;  3LP1 B;  3HHL C;  2WAQ D;  1RTH A;  3D28 A;  4PXD A;  1C0T A;  2Z4P A;  3EUN A;  2FLP A;  1SCJ B;  4ZN1 A;  3GU0 A;  3N4W A;  2AX1 A;  1HBN B;  4IG0 A;  5E3Q A;  2Z57 B;  4YQW A;  2ZBQ A;  1CC8 A;  2F8H A;  4PPD A;  5KG0 A;  4NXN F;  4GRS A;  4O4G B;  5K14 B;  1HQE A;  4B9U A;  4FNI A;  3KK3 B;  4OYZ A;  1QLN A;  3C15 B;  1CJU A;  1SKW A;  4LF4 F;  2MLX A;  2M52 A;  1T05 B;  3VAM A;  3BGU A;  2LU2 A;  2HHP A;  5CZX A;  2BKO A;  2R8H A;  2PSZ A;  2C2M B;  3EJM A;  1A0O B;  2CQG A;  1UVN A;  2K8G A;  4KHP F;  2M70 A;  2FHJ D;  4EO8 A;  1TUW A;  4QIF A;  2PEB A;  1YRX A;  4UOH A;  2MHE A;  3ITH B;  2KVQ E;  1VBX A;  3E51 A;  1O5J A;  2GJ2 A;  2YKM B;  1FFW B;  4NRU A;  4QWD A;  3SYZ A;  3GMG A;  2F3J A;  3LAK A;  1FKA F;  3QRP A;  2JZ5 A;  3HKZ D;  4DSL A;  5DRK A;  3PRB A;  5CAB A;  5HP1 A;  1FJ7 A;  2VON A;  4TQR A;  3OSN A;  5KFI A;  1UEV A;  2HZA A;  1SUQ B;  1BWE A;  2XMK A;  5J2Q B;  1WAC A;  2XMA A;  4CI0 B;  1UJ4 A;  3I0S A;  5BYR A;  1R31 A;  2AU0 A;  2DRD A;  2C3M A;  3K7R A;  2JC0 A;  1PC5 A;  3HP6 A;  2ZZN A;  4DSF A;  4MK7 A;  3KJV B;  2R7W A;  5IC4 B;  3GE9 A;  2DCL A;  5HK4 A;  1S76 D;  1UVL A;  2JVR A;  5FDL B;  2DTJ A;  1QUP A;  2B5J B;  3BSN A;  4HKQ A;  1D3W A;  4WK1 A;  4OJH A;  4I56 A;  1FER A;  3G6E S;  4CTA A;  4E8U A;  4A8X A;  5DQH A;  5I3U B;  1CS4 A;  2B3T B;  3IMQ J;  4NPO A;  1RAB B;  2EG1 A;  4OYB A;  3RGI A;  1H2V Z;  4K4T A;  4GC6 A;  5A0Y B;  3BB5 A;  4YY3 J;  2HHH F;  4HEA 9;  4CLU A;  3BH7 B;  2XGP A;  3VZH A;  1F2G A;  2MLZ A;  4K0K J;  3V6K A;  2DGQ A;  3CCU S;  2UV8 G;  3AFG A;  4KR0 B;  1S59 A;  2ZH4 A;  2CA9 A;  5HVH A;  3US5 A;  4RW8 B;  5IT9 Y;  3K59 A;  1EET B;  1B70 B;  4QWE A;  2OPR A;  2QJ3 A;  3HXM A;  3JAM U;  1YBT A;  3IWX A;  3KLI B;  4J9Q A;  1FDN A;  2AJ2 A;  3CDB A;  4O0I A;  4KY3 A;  2N4D A;  3AQO A;  1RA7 A;  4A8W A;  4X66 F;  3EGZ A;  4ZOS A;  2RDJ A;  3Q8U A;  4IFV B;  1M1K T;  3ZZT A;  1XMO F;  2B9X A;  4ID5 A;  1K1Q A;  5EN1 A;  4HDH A;  4B9S A;  1HHQ A;  2FY8 A;  3T1H F;  2YNH A;  4RZR A;  3BKT A;  2ZOM A;  1HHS A;  3RRG A;  3FFI B;  2FJA B;  1IBC B;  1UEK A;  3LGM A;  3M9M B;  1TAQ A;  2A6O A;  1G6B A;  4MJK A;  3R1L A;  3M2U A;  1TV6 B;  2HBY B;  4X4S A;  3K57 A;  4LF6 J;  2MKI A;  2HS4 A;  2RIL A;  3A8J A;  2LU1 A;  2ZC3 A;  3R5D A;  4GC7 A;  1ZA1 B;  4NRT A;  2ERR A;  3NXZ A;  3CJ4 A;  3CME S;  5L46 A;  3ZZO A;  1WOP A;  4NI2 B;  1WUU A;  3NCQ A;  3UN3 A;  1DQ8 A;  3DXS X;  2XSJ B;  1RWK B;  4CLT A;  3R9L A;  4JI1 J;  4EK2 A;  2GMH A;  2GHW A;  4WE1 B;  1HW9 A;  3FDS A;  2W9B A;  3PZP A;  4DV4 J;  5DDR C;  2BX6 A;  4FNH A;  4F3Q A;  1C1C B;  4DSK A;  1FF2 A;  4CO5 A;  1VS3 A;  4JI0 F;  4JI3 J;  3SCJ E;  1PAU B;  2HVI A;  4EWT A;  3I9Z A;  4YB1 P;  3IR5 B;  4Z2X A;  1Y5N B;  2X7I A;  2XGQ A;  2W9C B;  3V6D A;  4NXM F;  4JUZ A;  4DCJ B;  1LW0 A;  2G0C A;  3MM9 B;  4N77 A;  1GH8 A;  2NZC A;  4OX9 J;  2M3D A;  2PA3 A;  3AOB A;  4HHJ A;  2JRS A;  1WOO A;  1TFY A;  2XEX A;  1K1S A;  2N7Y A;  1F9E B;  4M5G A;  3BQ1 A;  3QT8 A;  1U7L A;  1H72 C;  3MR6 A;  2EW9 A;  3GV7 B;  3MUT P;  1B7F A;  2XWY A;  2MKY A;  1YKW A;  1VRU B;  3T3F A;  2AYM A;  3HK2 A;  1N33 F;  4FYX B;  1SJQ A;  1U8W A;  4DPT A;  1BD6 A;  1JLG A;  4XDD A;  2C3O A;  2K7K A;  4F4K A;  2K1R A;  1S4F A;  3PKY A;  2JLF A;  1UWB B;  4WFA Q;  1ZAX A;  1TKD A;  3CDU A;  1ULR A;  2APO A;  5G4D A;  3RG6 A;  5LSL A;  2QLB B;  2R7Q A;  5C25 A;  1NXI A;  2AZ1 A;  1VHI A;  5F8M A;  4DR4 J;  3M8Z A;  2DEI A;  2J0X A;  1TKT A;  2CPD A;  5LSR A;  4E0D A;  4DHV A;  2WVE A;  1VQ7 S;  2E7X A;  1RHU B;  3ILO A;  1NPP A;  1D09 B;  2FC9 A;  1S0M A;  1ZTT A;  4WWS A;  1SC1 B;  3BV8 A;  5H9E J;  1UVJ A;  2Z0G A;  4FBT A;  3DI6 B;  5ETQ A;  2VBX A;  2QRR A;  2OHD A;  3G2X A;  1H2T Z;  1U0S A;  3SQO P;  3ZFV A;  2ZOF A;  2C2D A;  3PX6 A;  4EZ6 A;  4CT8 A;  3L7U A;  3KLG B;  1VQ8 S;  1ZS6 A;  4UW2 A;  2GA7 A;  3OR1 A;  5EWE A;  4KB7 A;  4CM2 A;  2GMJ A;  1FJC A;  2WOM B;  1Q0N A;  2FJD B;  3MZI A;  3IR7 B;  1FJE B;  3SDE A;  3VAJ A;  3CTR A;  1ZZF A;  4B3T F;  4NL5 A;  1VC0 A;  3RUB L;  3BN4 A;  4QIW D;  3SMZ A;  1Q8B A;  3VV2 B;  1WC0 A;  1N34 J;  2PGC A;  2VG7 B;  2YBV A;  4I7F A;  2QEX S;  1TZ0 A;  4GVL A;  1HAR A;  4PKD B;  3MEK A;  2Q43 A;  3OVS A;  3GP9 A;  1H98 A;  5FLX U;  1NJX A;  3AAW B;  1GTE A;  1VQ4 S;  3I56 S;  3OL8 A;  1OIA A;  2HEK A;  3BBB A;  5DM7 Q;  3OTE A;  3DRP B;  4EFA C;  2YPZ A;  4DV0 F;  2FJB B;  3AB4 B;  4QBU A;  3EMT A;  3M8Y A;  2IJF A;  2WON B;  4F3M A;  4WIQ A;  3R5G A;  3CNQ P;  1X4F A;  2V2Q A;  2V9W A;  1NSP A;  3F73 A;  4NA1 A;  2G13 A;  4I6Y A;  3NNC A;  2XO6 A;  3SQG A;  4ED7 A;  3HI9 A;  4FVC A;  5KT3 A;  4NYO A;  3UR3 C;  3RYL A;  4OLP A;  1U0H B;  2G0I A;  4K59 A;  1HNV A;  4RX6 A;  3VR1 A;  2HNZ A;  1GTH A;  5ETK A;  2ZHO A;  1WC3 A;  4WKY A;  3CCW A;  1FES A;  4LIW A;  5E3C A;  4B08 A;  3HVA A;  3H20 A;  9ATC B;  2YX7 A;  5G0R B;  1XN9 A;  4HI2 A;  3LO3 A;  4OHV A;  2HHW A;  1EZZ B;  3DFE A;  3SI8 A;  3LP0 B;  3A3P B;  4M5D B;  2ZBC A;  4A8K A;  1JB0 C;  2C1E B;  2M8D B;  1URN A;  2BUN A;  1LOU A;  1U1M A;  4KC5 A;  1WG5 A;  5AE3 A;  2HYI B;  3GV5 B;  3TA2 A;  2GW8 A;  4M5J A;  3GCW P;  1FD8 A;  1VIS A;  3RRK A;  1IR0 A;  3IS9 A;  3W63 A;  2MKH A;  2JNJ A;  1S1W B;  1EP4 A;  1VQM S;  4M8L A;  1AZS B;  2LEC A;  1HBO A;  4JI6 J;  2LDI A;  3LP2 A;  5H9F J;  2RU3 A;  1N5V A;  4EBE A;  1IM4 A;  8ATC B;  4USI A;  2PEH A;  3TVZ A;  4DUY J;  2Q66 A;  4FYD A;  1LWC B;  4CO1 A;  1UA0 A;  2XS2 A;  3PYD A;  2CWX A;  3TJ8 A;  1UMJ A;  4L3K A;  4ZPA A;  1JJ4 A;  3CMQ A;  4PQA A;  1RB0 A;  4F0H A;  2ZUA A;  1RHM B;  1FTC A;  2OFG X;  5IS2 A;  3AOA A;  4I6W A;  1SBR A;  2YNF B;  5A8K A;  5E0O A;  2W2P P;  3VTI A;  1RAE B;  2Z58 B;  3TVK A;  1HFE L;  4LBH A;  3M8Q B;  3M6V A;  3DNC A;  2A6M A;  3NS5 A;  1F9H A;  2ZJQ Q;  3PG9 A;  4WP9 A;  4DBQ A;  1HPZ B;  1B3T A;  1S6Q B;  3EYZ A;  1S1U A;  4A8Y A;  4IOB A;  1GX6 A;  4M94 A;  2VD3 A;  3J81 Y;  2DH9 A;  3CJK B;  5E3R A;  1TL3 B;  4IOA Q;  2FYX A;  1B0P A;  4OL8 A;  2I6W A;  3FC9 A;  3KDN A;  2BAC A;  2HS0 A;  4P2X A;  4RW7 A;  5AJ3 J;  3NGD A;  4TY8 A;  3BSO A;  1QAI A;  3LP1 A;  4NZ6 A;  5ITH A;  4L74 A;  5T41 A;  3CD5 A;  3MWB A;  3QZ8 A;  2QL5 B;  2VPY B;  1B64 A;  1HBN A;  2ZKU A;  1UAW A;  4IRC A;  3J7A N;  2M9K A;  1KHV A;  1V3R A;  4O4G A;  1VJQ A;  2OPQ A;  3U7J A;  4OMF G;  1YDL A;  2ATL A;  3E8O A;  2QYG A;  4ED3 A;  1R7I A;  3CJ3 A;  1WF0 A;  1U48 A;  2GX8 A;  3KK3 A;  1KD1 T;  2BV3 A;  4CH1 A;  4N47 A;  5IT0 A;  3C15 A;  3FRY A;  3FCW A;  4IH5 A;  5T14 A;  1T05 A;  4DR5 J;  5DG8 A;  1VGY A;  2UXC F;  2MMY A;  2PMW A;  2WCX A;  3DYA B;  2DR7 A;  2FZG B;  3CCQ S;  2LQ9 A;  2MDA A;  1N48 A;  4DV1 J;  3GG0 A;  4DPU A;  1SQE A;  2BZ2 A;  2HHU A;  3KWM A;  1DQA A;  5AXK A;  2XBP A;  2O01 C;  3M2R B;  1B99 A;  4DV6 J;  4LQ9 A;  2VG6 B;  3ITH A;  4WU3 A;  3T5J A;  4IYQ A;  1S49 A;  2YKM A;  4D3G A;  2AV5 A;  5D15 A;  5KFS A;  3OFE A;  2MGZ A;  2QFJ A;  1T03 B;  2F9J A;  1NPK A;  2DNH A;  1U2F A;  1Q86 T;  1IKW B;  5CD4 A;  3KYL A;  4F4X A;  3HHL D;  4JI4 J;  2G2O A;  3A12 A;  3HX9 A;  2QC3 A;  1SUQ A;  5J2Q A;  3GYG A;  3K5P A;  2V68 A;  1RXO B;  4PYA A;  4ZVP B;  2LXU A;  1HBM B;  2Y1J A;  2GHP A;  2BE2 B;  1D8Y A;  4KT0 C;  3L7P A;  2YWF A;  2V0N A;  5GAE U;  4EYI B;  3CIZ A;  4TU9 A;  2B5J A;  2F1F A;  1QAJ A;  1RCO B;  5EGY A;  5ETP A;  1SH3 A;  2CJQ A;  4HI1 A;  5KFR A;  4AQY F;  4F3O A;  5I3U A;  4P72 A;  1PYT A;  5J1N A;  2FLL A;  5A0Y A;  2QG9 B;  3N6L A;  1Q5Y A;  1TP7 A;  2EC2 A;  1FJG J;  1PYO B;  1RT6 B;  4X4T A;  1P1L A;  2H65 B;  1B0V A;  1WI8 A;  2VPZ B;  4BDP A;  4OHZ A;  2P5V A;  5IZH A;  2DBB A;  4P2S A;  4L75 A;  4F7V A;  2GAG C;  2VOP A;  3WX8 A;  1PGZ A;  4RW8 A;  4PCQ A;  1EET A;  3SBM A;  1Y10 A;  4RKU C;  2W8L A;  1YSJ A;  3MEC B;  4DFJ A;  5CCL A;  3EM1 A;  1UVM A;  4FXW A;  4HHH A;  3IBW A;  4C0H A;  2DT9 A;  2NR0 A;  4WP8 A;  3R5A A;  2ZNY A;  4LF5 J;  4TNO A;  2B56 A;  4IFV A;  3I0R B;  2XB2 D;  2FTR A;  2AYG A;  2KKH A;  4G1I A;  1JKH B;  3MAH A;  4RL1 A;  1W7W A;  2IMO A;  1WSR A;  3FFI A;  4YR2 A;  5ETM A;  3FBE A;  1TV6 A;  1MMD A;  5EWF A;  3V4I A;  2BRL A;  3MED B;  2CAJ A;  3AA9 A;  3MD1 A;  3L7O A;  1NDC A;  1CVJ A;  4G65 A;  2DNK A;  4ZHR B;  3P4U B;  4HT7 A;  5B0A A;  3NAH A;  4FF4 A;  2MJU A;  2AGO A;  4NYP A;  4ECS A;  4LFA J;  4YP3 A;  4ZA1 A;  1UPM B;  1NH8 A;  3Q2T C;  3BEG B;  2XSJ A;  2R2R A;  1L3U A;  2E1P A;  1T3O A;  1R6V A;  1T9T A;  5MAO A;  4WE1 A;  4JP8 A;  4B3M J;  4LJM A;  3ONQ A;  3BGO P;  2C22 A;  2IVY A;  2HVH A;  1C1C A;  1T02 A;  2VH7 A;  1W25 A;  1JNZ B;  3UPF A;  4QWB A;  2LKZ A;  5B0B A;  4DX8 H;  1O0P A;  2DNY A;  4DXL A;  1A6L A;  2ASL A;  2VPW B;  2I9S A;  2ZVS A;  5DLF A;  2KT3 A;  3ADA C;  3R97 A;  4MT1 A;  4OV1 A;  4CDI A;  1YJ7 A;  2SXL A;  4O3P A;  4DQR A;  4DL6 A;  1JLC B;  5IWA J;  4EYH B;  4CO4 A;  2W9C A;  4Z7Y A;  1RAI B;  2FHJ A;  3GFZ A;  2ZKT A;  3MM9 A;  1HBU B;  2Q6B A;  2ZH8 A;  2DHH A;  1APS A;  2XO7 A;  4ZPV R;  1ZH5 A;  1NDP A;  2CPX A;  3G6Y A;  1RHK B;  5KFL A;  3G9C A;  2MZS A;  5DET A;  1CLF A;  3UCZ P;  1X4E A;  3BBC A;  2CVI A;  5HO4 A;  3I4P A;  3KMQ A;  1VRU A;  4DU7 A;  3AD7 C;  3HHL B;  2LXI A;  3PYF A;  2BKN A;  4ZPB A;  2QL9 B;  1F5A A;  4OJG A;  2BQU A;  2E1A A;  4DZ6 A;  2W7A A;  1UWB A;  2W4P A;  3HFZ B;  3FKB A;  3Q8P B;  3K2Y A;  3PRD A;  3IGV A;  3PHT A;  1FFS B;  2X1F A;  3Q83 A;  1DY3 A;  1U2R A;  1XR7 A;  2VV5 A;  1UFW A;  2DNL A;  1A9N B;  1BGX T;  3QSI A;  5E33 A;  2PII A;  1YWX A;  4DL4 A;  3D54 A;  1UP1 A;  3MMJ A;  1NZ8 A;  3CCJ S;  3NMA A;  1DUR A;  2KU7 A;  2YVS A;  4USW A;  4OZJ A;  4LVO P;  3MM8 B;  3O8W A;  1RTZ A;  3CPW R;  3KDO A;  4O3R A;  4PG6 A;  3G8T A;  2AW0 A;  3IAM 9;  3DI6 A;  1JLQ B;  1T95 A;  2GJI A;  4LSZ B;  2Z2M A;  4X62 F;  1NME B;  2AD9 A;  3R2C J;  4ECW A;  1HQU B;  1Q4R A;  2G1H A;  2HZV A;  2VG5 B;  1IKY B;  4V1A k;  4IFY B;  2MQ8 A;  4WFB Q;  3CO9 A;  2YWW A;  3D0I E;  1DRZ A;  2WOM A;  1IXK A;  3PCO B;  1ZA2 B;  5EWG A;  2EEY A;  1SH2 A;  3G71 S;  1WC1 A;  3DRR B;  2VA2 A;  2OPP B;  3HJV A;  3AXM A;  5AE1 A;  3GCX P;  4NLT A;  1S12 A;  1S6P A;  2KXH A;  3KXD A;  4F8R A;  3J80 U;  1FK9 B;  4CLZ A;  4DR7 J;  3QMQ A;  1FRK A;  1R8B A;  2JLG A;  4J7C A;  4F4Z A;  2YNI B;  4E98 A;  1BE4 A;  4DR3 J;  2IVM A;  3CJ2 A;  2YTC A;  3LPE A;  2QFI A;  4JI8 F;  2Z2L A;  1MN7 A;  1YK9 A;  3NNA A;  4DFK A;  2GML A;  2RVJ A;  2L48 A;  3MEG B;  3TUP A;  3MUM P;  1UPP A;  3KFW X;  3UR0 A;  1DZ5 A;  4RNM A;  3DRP A;  5J1P A;  3OJU A;  5L9X A;  3EGN A;  5CCM A;  3CO0 P;  3GSI A;  2V4J B;  2OP5 A;  1RSC A;  2WON A;  3EVO A;  2GIQ A;  1CPZ A;  4QOT A;  1PC4 A;  4B9V A;  2EFO A;  3CJ5 A;  3ENW A;  1N54 B;  2V63 A;  3KK2 B;  3IBF B;  2QMU B;  3R5C A;  1U0H A;  2OEM A;  1OSD A;  4CO2 A;  3QFW A;  3R5B A;  4URS A;  2AJQ A;  3ENV A;  4Z37 A;  4NXN J;  2HZC A;  2BJ7 A;  3W8G A;  4Q43 A;  4DQS A;  1P6T A;  3VWS A;  2FC8 A;  2VC0 A;  1TFW A;  4YDX A;  3BSC A;  3EGV A;  5K9F A;  4ZJL A;  1CJK B;  1FKO B;  4KSE B;  1M5H A;  1KOO A;  1NEE A;  4FF2 A;  4G3I A;  4LF4 J;  1SC6 A;  2OD4 A;  3DM2 B;  2HLT A;  1P1T A;  3KUH A;  1YJ9 S;  2RRN A;  1OS5 A;  3MEE B;  3R7B B;  3MI7 X;  3LP0 A;  1EQM A;  3NS6 A;  1H74 A;  4OHX A;  4M5D A;  1N36 F;  3UI3 A;  2XNQ A;  1K73 T;  2XQC A;  3H0P A;  1LWF B;  4Y2I A;  5CHC B;  3N28 A;  3PYE A;  1JWW A;  3GQC A;  1NAQ A;  2X3G A;  2MST A;  1U49 A;  4JI2 F;  3VHQ A;  3NBP A;  2BMB A;  3KNA A;  2J0W A;  1Y5I B;  5BYS A;  2FJE B;  3U27 A;  4UOC A;  2QLF B;  1AZS A;  3HHE A;  3H5S A;  3VGT A;  4WYL A;  2R7R A;  1Q5V A;  2EVZ A;  4CO0 A;  4M5H A;  3KHG A;  1YHQ S;  4ED2 A;  1UVK A;  4OI4 A;  3IBC B;  3AOD A;  1LWC A;  1VFJ A;  1DJ0 A;  2RH3 A;  2CRL A;  1U1P A;  2VA3 A;  4RR5 A;  4QYZ K;  5A2Q U;  1TKX B;  3RAM A;  2YNG A;  3OQ2 A;  1VQ9 S;  3CVK A;  5DQI A;  4IQM A;  3QT7 A;  3C6T B;  2MKK A;  1VK8 A;  2DNZ A;  3T19 A;  1FXD A;  2DPJ A;  4JI7 F;  4K4S A;  4M5N A;  2XLK A;  3BBF A;  1JJH A;  2HFU A;  5KFB A;  1AUS L;  1RTD B;  3IP0 A;  2F9D A;  2YNF A;  4P7V A;  5E2Q A;  3ZZZ A;  2MQL A;  4DCO B;  3QLH B;  4IQX A;  3J7Y I;  3M8Q A;  2EC0 A;  3ILJ A;  1D9D A;  2XS7 A;  3CED A;  2BE9 B;  2V69 A;  4OZ2 A;  4JYA F;  2ATC B;  4ILR A;  1G1X A;  1HPZ A;  1S6Q A;  2KXF A;  3N79 A;  2F63 A;  2FZK B;  4UT4 A;  2HHH J;  3EE3 A;  3M32 B;  3FQL A;  4AE5 A;  2V94 A;  3HSG A;  1NK5 A;  2B9E A;  2DPI A;  4P71 A;  2XMT A;  2HIQ A;  3CJK A;  1TL3 A;  5DG9 A;  2B7C B;  2GZO A;  4WFZ A;  2WVB A;  1S1X B;  1P9Y A;  5KFG A;  2CNK B;  3HT3 A;  5BR8 F;  4R0E A;  3QO9 B;  5JMN A;  3QYY A;  2XWX A;  4CLW A;  3P45 B;  4O3O A;  1F2H A;  1YJV A;  2KH9 A;  2ZH9 A;  4IKA A;  2ZJR Q;  4LF7 F;  1OQ3 A;  3PAC A;  4X66 J;  5DM6 Q;  1KP6 A;  2DY1 A;  2LCW A;  4WTO B;  1VBY A;  4MYU A;  1XMO J;  2HHS A;  1D9A A;  2XMW A;  3TZW A;  2FUG 9;  1E6Y A;  1XC9 A;  3EIC A;  2QE5 A;  2W24 A;  2HQ3 A;  3T1H J;  4ZVG A;  1KLM B;  4YB5 A;  3GZ7 A;  4N41 A;  4LSL B;  2BM0 A;  4GKK J;  3TX8 A;  5CYQ B;  4PUO B;  5E3A A;  2KFY A;  1X4C A;  2CDQ A;  1S6O A;  2RRB A;  2ZOG A;  3DYA A;  3H5X A;  1HIY A;  4UTG A;  3DDN A;  2PD1 A;  4MKY A;  4LIR A;  5B0F A;  3QNW B;  1MLA A;  4CLS A;  3KOA A;  2CJ9 A;  2V8P A;  3V4M A;  5A76 A;  3TR5 A;  3F0N A;  4DQI A;  1HNI B;  3M2R A;  2AJ1 A;  3H5U A;  4TY9 A;  3KG0 A;  3QFH A;  3W2V A;  4ECR A;  1T7P A;  3GYX B;  4A8Q A;  4FKX A;  1SQG A;  2NRE A;  1T03 A;  1KFD A;  3HDS A;  1VHF A;  1XBW A;  4WU2 A;  4LBP A;  1FNX H;  1GNK A;  1IKW A;  4Y0F A;  4LF8 F;  3C3L A;  1IBK F;  3PR5 B;  3DU5 A;  4PYD A;  4JV5 F;  1RGV A;  5B0E A;  4U7U K;  3RB0 A;  3G82 B;  3FJ2 A;  2UUC F;  4JI0 J;  2NUH A;  1RTH B;  3DLL Q;  1B7Y B;  3AJ1 A;  3QRR A;  3H2L A;  1ARO P;  1HBM A;  3OLB A;  2V8G A;  2B0G A;  2BE2 A;  4NXM J;  2B4P A;  2IC3 B;  5ETT A;  2J0S D;  3W61 A;  1JLF B;  3W7B A;  2VFV A;  4F2S A;  1CJU B;  1NDL A;  1IWA A;  1KSP A;  4ZPC A;  5KFU A;  2GIF A;  1TK5 A;  4UF4 A;  1FRH A;  1BQM A;  2VU5 A;  3MPV A;  1KTV A; 
#chains in the Genus database with same CATH homology
 3DDI A;  3BBB A;  1NSK L;  3ZTQ A;  3ENA A;  3FCW A;  1NLK L;  1WKL A;  2BEF A;  3ZTP A;  4FKX A;  3EVM A;  3FKB A;  3BH7 B;  3B54 A;  5C7P A;  4UOG A;  3EMT A;  2B8P A;  3Q83 A;  3VGS A;  3ELH A;  3ZTO A;  3VVU A;  2AZ3 A;  2CWK A;  3G2X A;  4O0N A;  2DXF A;  1S59 A;  2HVE A;  2HUR A;  1F3F A;  3MPD A;  3NGU A;  3JS9 A;  1LWX A;  4HR2 A;  1NSP A;  4S0M A;  1B4S A;  1BE4 A;  3L7U A;  1NUE A;  5CAB A;  1ZS6 A;  1W7W A;  3R9L A;  4ANC A;  3Q86 A;  1MN7 A;  2NCK L;  4EK2 A;  2DXD A;  1F6T A;  3BBF A;  3ZTR A;  1U8W A;  4C6A A;  1NHK L;  3NGR A;  3FBE A;  4AND A;  4FKY A;  3FC9 A;  1B99 A;  3ZTS A;  3FBB A;  3VGV A;  3EIC A;  2BX6 A;  3ETM A;  5CAA A;  1MN9 A;  3Q89 A;  1NDC A;  3PJ9 A;  1NB2 A;  2HVD A;  4F36 A;  4ANE A;  1NDP A;  3FBF A;  1EHW A;  1XQI A;  1NDK A;  2B8Q A;  3VVT A;  3Q8U A;  3Q8V A;  4CP5 A;  4UOF A;  1HIY A;  1HLW A;  1NPK A;  3BH6 B;  3EVO A;  2AZ1 A;  1WKJ A;  3DKD A;  1PAE X;  1BUX A;  3BBC A;  3EE3 A;  3FBC A;  3FCV A;  1NDL A;  1HHQ A;  3VGT A;  1NSQ A;  3EJM A;  1JXV A;  1VYA A;  3WX8 A;  1K44 A;  3VGU A;  2DXE A;  5BXI A;  3PRV A;  4KPC A;  4WBF A;  3NGS A;  2ZUA A;  1LEO A;  3GPA A;  3GP9 A;  1XIQ A;  3NGT A;  1UCN A;  1S57 A;  1BHN A;  1NCL A;  1S5Z A;  2DYA A;  1KDN A;  1PKU A;  2VU5 A;  3EVW A;  3Q8Y A;  4W98 A;  4DUT A;  3B6B A;  2DY9 A;  4UOH A;  5IOL A;  4DI6 A;  3EM1 A;  4ENO A;  4F4A A;  4DZ6 A;  1WKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...