4UY85

Molecular basis for the ribosome functioning as a l-tryptophan sensor - cryo-em structure of a tnac stalled e.coli ribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
148
structure length
148
Chain Sequence
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Ribosome Functioning as an L-Tryptophan Sensor.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S RIBOSOMAL PROTEIN L32
total genus 18
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uy8501
5GAHI 1ZAWA 3A1YG 1ZAVA 5D6GA 2QA4G 3JSYA 4NWBA 5GAEI 4UY85 5GADI 3J7Z5 5D8HB 3J7YI 4V19J 5GAGI 1ZAXA
chains in the Genus database with same CATH superfamily
2UUWA 2KFYA 3MOJB 1URRA 1M5KC 5D4LA 2PFFB 4LFAF 2AV5A 3O2IA 1WKJA 2M88A 3I0RA 3CCES 4HT7A 4I0WA 1N88A 2BA9A 4J9KA 1C2PA 1RBLA 3QLHB 1AUDA 4B3SJ 1JX4A 1BLUA 1GK8A 1O6XA 2MY7A 2VC1A 2BMBA 1BMQB 2CWKA 4I2QA 4X4UA 3IR6B 2FIUA 4GO7X 4FZVA 2R9LA 4ZP8A 4DG1B 2J7WA 3CMES 2JZ5A 1G3OA 2YWWA 3I4PA 5HMZA 2R42A 1T8EA 1O5JA 1YJVA 4OX7A 4IH5A 2R7SA 2OMOA 2QA2A 2VBYA 1S4EA 2QL9B 3MAAA 4G1IA 4DBQA 2B51A 3Q8PB 4IO9Q 4ECZA 4NLOA 2QLJB 3NNHA 1M1KT 3KOAA 3QIDA 1UETA 1SJ1A 2WBRA 1TL3A 5C2CA 1LW0B 8RUCA 2XO7A 4F3OA 2HHUA 2O01C 2Y0SD 3US5A 3QIPA 5E5NA 4EI2A 1IM6A 3HZGA 3DYAA 4LRDA 2WOMA 4WKRA 1RAHB 1RADB 1VR6A 3M2VB 1GMVA 1IXKA 4ENOA 1XNRJ 2IA0A 1FNOA 2XLJA 5L46A 4YDXA 1HW8A 2I5JA 2O66A 1WSRA 2QT7A 2XHCA 3KNGA 2J6UA 1NSAA 4DV1F 4X64F 3J7AN 2DH9A 3TX0A 2BJDA 3ZTPA 2V2VA 2FVRA 1HBUB 4EU0A 5AXLA 4JI5F 2H65B 1ZETA 2ZDOA 1Y0HA 2P9EA 2IVMA 2FJDB 2FGCA 3B4MA 3C6UB 4RR5A 5HMWA 3K5LA 2RJZA 2XEXA 2M5YA 4WPAA 1LV5A 2XYHB 5CHCB 2PN6A 3CJ0A 4HI2A 3I5CA 2M2BA 3WQPA 2DR8A 3SDEA 2K06A 3HT0A 1TVRA 3GG0A 2B4VA 2I6WA 3G6ES 1N5QA 2AJQA 4U7CA 2MY8A 1WTBA 3CCLS 1RTJA 4C8MA 5ADZA 1U02A 3QWUA 4R8UA 1I5OB 3MMCA 1NJIT 1BXNA 2W9BB 2XY5A 3R97A 4CLFA 2VQFJ 2MEWA 3P5TL 2J0SD 2B5JA 2QEXS 1SC6A 1S4FA 3B78A 4RBUA 1UWBB 1S6PA 4KFBB 1NK9A 4NPOA 2W01A 3JSRA 3N6LA 4USJC 2GW8A 4MJKA 1ZM3A 4GVBB 3TQEA 4CH7A 3NMRA 3NBPB 4MKBA 3W5YA 3DLEA 4DSIA 1WKLA 3OTOJ 3BQ1A 2E29A 3U27A 1NDCA 4UTGA 2I2YA 4DN0A 4Q0BB 5GAEI 2AYBA 4PRFA 4ILRA 1IN0A 1NB2A 2UU9J 1NDPA 1XWLA 3QO9A 3G8QA 1Z4UA 1YBTA 4WFXA 3M2UA 1O51A 1TMJA 3TOQA 3DGVA 3VTIA 1TFYA 3BO2A 1X0FA 4RW9B 1F2HA 4TU9A 4ER8A 1RT5A 2MQOA 2CPFA 2W7PA 4NYPA 2PIIA 1QSSA 4PG7A 3VAHA 4USVA 1LOUA 1LWEB 1S59A 4M5JA 1SJ4P 1VBXA 2C2DA 3S01A 1N33F 3IFEA 2HK2A 2AJFE 3HZEA 4CO1A 4NLGA 4NZ6A 4C7QA 2Y1IA 3DC2A 5G4DA 1N36J 3D66A 1XQIA 2OI2A 1VBKA 2QMUB 5KFBA 2VG7B 3KHRA 1MMNA 2NR0A 4AL5A 2RRNA 1EIYB 4TQSA 4WFZA 1OPZA 4NLXA 2FC8A 2IVFB 1SQEA 2B6AB 1S9EB 2J0WA 5HLFA 1I1GA 1FA0A 3QZ7A 1IJFB 1Y9OA 2GS8A 3BKFA 3SFGA 4Q44A 1JKHA 3BGOP 1DJ0A 3F56A 4P71A 3ZTSA 4A8XA 2HHHJ 2C2OB 1MWYA 2NXCA 5LJ3Y 5KFAA 4NLSA 2R2RA 4XTTA 5G0RB 2C3MA 1AW0A 1RBOB 2VFSA 3R27A 9RUBA 3ZTRA 2JDJA 3DKDA 3UPFA 1NJXA 3FCHA 2XMWA 3HVRA 5DDQC 3NXZA 2XM3A 4ZCMA 1SH3A 2GJIA 3FBCA 5K9FA 1LWFB 5JVHQ 1RAEB 3MPWA 1Q8LA 2FHOB 5KFKA 5E0OA 1AA1B 1F0XA 1KQFB 5DZ7A 5KFJA 3FSYA 3BPDA 4AL7A 1KS2A 2CQBA 2ZWPA 1Q79A 2GX8A 2KJWA 2PMWA 4LSNA 1QAJA 3W7BA 2DR5A 2MHNA 1T7PA 2BKPA 4L75A 3ZTQA 3K8WA 3V4IA 4WYLA 2V8PA 3VAGA 4TYBA 2D3O1 1UVNA 1GMWA 2G0IA 2WB4A 4NLPA 2DO4A 1X4CA 3DXSX 4ZPVR 4NE9C 1VRUA 1FTRA 2AJ1A 3WX8A 3ILOA 5I3QA 3DFEA 1U1NA 2VZ9A 2PMHA 4P2XA 1CVJA 1SVDA 5HBMB 2KVQE 1EP4B 2FHJA 4YY3J 3OQ2A 3GFHA 5SUHA 3S6EA 2C3YA 1U49A 2J6SA 2J6TA 4KGMA 4U8VA 4N8NA 4CLYA 1KOOA 2EKYA 4ZK7M 3UCZP 1YITS 3Q83A 4PXBA 3H2VE 1B0PA 1TKXA 1WNEA 3NNCA 2C2KB 4K59A 3BBBA 3EYZA 2CXEA 2CADA 5CA5A 2VHGA 4ZP6A 4RKUC 2VONA 3W1YC 4J9SA 2UUBF 4QW9A 4CLKA 2RH3A 4PXDA 2WAQD 4OYXA 3K59A 3N0VA 2JLEA 3M8ZA 2GZOA 1CQMA 1GH8A 1XNQF 2BJEA 5D3GB 3QJPA 1RHUB 2DD8S 4CNZA 2ASDA 2GQ2A 2HFNA 3V5RA 4OYMA 2BACA 2CPYA 3V6JA 2ZE2A 4F04B 3S1TA 2X7IA 1HMVB 5JJBA 1FRJA 4CYUB 4LFBF 1DLOA 5IXUA 4IFYB 5HP1A 4I6AA 3CD0A 1ZM2A 1OS5A 3MMBA 4DUYJ 3AHPA 2CUYA 2HFZA 2RUSA 3BSOA 1BQNA 3MECB 3THVA 3NCRA 4YN3B 1AXQA 3EE3A 3NRBA 1NK6A 1RTHB 2BBEA 1UVMA 5J2NB 5F9NA 1VQMS 2FDNA 4C0OC 3BR8A 2FLNA 4OZ0A 4JI8J 2AEJA 5CQGA 1H38A 1CEZA 2HNZA 1YVFA 4I4BA 1N34F 4HTJA 2V9WA 4PZVA 2IM3A 1RA7A 1XC9A 3K89A 2ZD1A 3CDWA 1F9FA 3NGSA 2WONA 2ZUAA 4K4VA 1ZBTA 1TAQA 4JYAJ 1NH7A 2NXJA 4OI6A 4B08A 4CTAB 4QQBA 1SJFA 3GIRA 4ZLNA 2QSWA 3BREA 2E5LF 3J80U 1FCAA 4DV0J 1FKPA 1C1BA 2WVEA 5KFYA 1LQ9A 4WWSA 5B0EA 2CJQA 1QD1A 2HRTA 3GWCA 5KFSA 5KFIA 2HHXA 3HSZA 2PE8A 1WC1A 3D6HB 2RQCA 2XSFA 3PRDA 2X3DA 4O4RA 1TL7B 4P75A 2N3OA 3PVXA 3UD4P 4FPRA 5IV3A 3FZ2A 5E41A 3J7A1 5IT9Y 3T6JA 1RP5A 3N6MA 2IJNA 1O0PA 2LDIA 1SV5A 1RI7A 4HLBA 2DXEA 4S0MA 1RACB 2DIVA 3NCPA 4D3GA 1U4BA 3KUGA 4AXJA 1IR1A 4N5SA 4ZDNA 3PR5B 1TELA 3OTEA 2HG4A 3M30A 2BRKA 3OLAA 3CMQA 5K5MA 2F8HA 2KJVA 4NA3A 1HNWF 2DGOA 1AFJA 1GX6A 1OWXA 4MKVA 2AW0A 4P7TA 4IUFA 2UUTA 1Q4RA 2HS0A 1AYEA 2ZZTA 4PWDA 1LW0A 2VBXA 2Z58B 7FDRA 2NZ4A 4A8MP 1RT2A 2MQ8A 4DR5F 1FJEB 4IO1A 2F4VJ 2BZ2A 4ECWA 4BBYA 2XC9A 3C14A 4ZVRB 1VC0A 3DI6A 2GFFA 2HVIA 5F8MA 2WOMB 1KFSA 5IFMA 4RX6A 3GIMA 1AUSL 5AXNA 1N5VA 2EFGA 2FJAB 2DNYA 2XI2A 5I3UB 1Y7PA 5HQMA 1TKZA 2HVEA 2RS2A 4MK7A 4B3TJ 3VWSA 3E01A 4OJ1A 1YIJS 2V8GA 2FQQB 3M2RB 5HATA 1PBAA 4YB7A 3L9ZA 4ES1A 2CVEA 3BR9A 1BC6A 3ICLA 2BE9B 3DU5A 1UW4A 3V2UC 3C6UA 4X64J 2JC0A 3RRHA 3RB6A 2W2MP 2EKNA 5JMNA 5CYJA 3IRWP 4ZP7A 4ECYA 4I56A 4NCBA 3KLGA 4RUBA 1TVRB 4G1PA 2KM8B 2DNZA 3KK3A 2YXLA 2L9DA 2V2QA 3ONQA 1YJ9S 3Q8UA 1N5YB 3BDPA 4LRBA 2Q3PA 4ZN1A 1S1WB 4CWBA 4QR0A 3BDEA 1Z2ZA 2OPSA 4DPXA 4ZMMA 1RWVB 2QE5A 4FXDA 4DL2A 4DR4J 2AX1A 2M7SA 2RSQA 2XZTB 3PHTA 4NXNF 1YG0A 1D9AA 3I5BA 3KHHA 2G13A 1NSPA 3MPDA 3TVYA 3NP5A 2VQFF 1P27B 1D9FA 1VJQA 3DLHA 4EZ9A 5A8RB 2XB2D 1EAYC 2HZAA 2WB1D 2WHOA 3MEDB 4GVBA 1TK8A 1OY8A 3QFHA 3C2PA 4C8NA 5AE1A 2QZ8A 2F63A 1GXLA 4LF9F 1W26A 4B9SA 1P9QC 1PKUA 2XHWA 4OI4A 2IM0A 1RZMA 1PIEA 5D0GA 1Q86T 3NCQA 3M8RA 4DFPA 2C22A 3MAQA 2FC9A 2DNNA 1UA1A 3GYXB 2B4UA 3S8SA 2N82B 3I5AA 1KHVA 1F9EB 2VFTA 4ZIVA 1LWCB 1KN6A 1RT5B 3FRYA 3ISND 4JV0A 2UU9F 2BXJA 2YWHA 4ICLA 4YFUA 4AL6A 1X9MA 4LF4J 2JEIA 1OY6A 1S97A 2AU0A 1B7FA 4L72B 3I0SB 2R7OA 3ZZOA 4ECRA 4FXVA 1RT7B 2HWTA 3A8EA 3HHLA 4DR6F 2CDQA 1M1GA 4ES2A 4A8QA 3P5BP 3UNYA 5CYQB 2CZVC 1NK5A 1FK9B 1WHXA 5IT0A 1JXEA 1B7YB 2DJWA 3W60A 2VV5A 3AXKA 5D78A 5DQIA 4LBIA 4X4SA 1XEZA 4AD6A 1C0UA 3EGVA 3RUBL 2VBWA 1HNIA 2BKNA 2DIUA 2OELA 4RWXA 2E1CA 5HJYA 4DV7F 4I2PB 5ETVA 3ET6A 2GQCA 4DV2F 1UPPA 2OAUA 4NLUA 2AEMA 1WDDA 1A7GE 3TAMA 2V9KA 4NYZA 3UFCX 2HYIB 1KTVA 4BWJA 3HKWA 4WZMA 4K4XA 1RE1B 3I56S 2ZZNA 1Q0NA 3DLKB 1HKAA 2HAFA 5EWEA 1YI2S 1FRKA 3MM8B 5K14B 1H7WA 2VKRA 1FDBA 3C66A 3T1YJ 3AQOA 3G2XA 1Q78A 1QDUB 2DHGA 2ALYB 1JQGA 3GP9A 1ZZFA 4R25A 5IQQA 3D5MA 1N54B 4NI2A 3CJKA 4DL0C 1UFKA 4QWAA 3SV3A 1X9SA 3SCKE 2E7XA 4ANDA 5GAHU 2DY1A 5D4NA 5EX3A 5CXTA 3AJDA 5CYMB 3DM2B 3SYZA 3V4IB 1R0BG 3SEOA 3GB0A 3KWMA 3W65A 5J1EA 2RKIB 4LF4F 2LA6A 5CZVA 5HVGA 4FF2A 1TKTB 4ECTA 4QU7A 5A76A 1E6VA 1FERA 2DITA 3DRSB 3KYLA 2D3ZA 2B56A 4JI1F 4YY3F 4R5PB 4DL5A 1IBKF 2RRBA 1NAQA 2DGWA 3RU0A 3BV8A 2QLFB 4ZJOA 3G8TA 2QRRA 3K5OA 3N5FA 3Q0AA 4OX9J 1VK3A 4WP9A 4NLRA 1SUQA 1ZAVA 3MGJA 4ZLPA 3AODA 3BS9A 3MM6B 4DPUA 3GSDA 4EGLA 3POTA 4ETZA 2FD2A 4OZNA 2IAJA 1HBMA 3I9ZA 3CIZA 1FWPA 1ITPA 4DSFA 2K3IA 1IVZA 1X4BA 3QT8A 2YNGB 2DNLA 2MKCA 3M8PA 3H2UB 3THTA 3JQMA 2PMZD 4O3NA 4LF6F 1FI4A 3HPOA 4JI1J 3CULA 3OL6A 1GMWD 3N9UC 2HBQB 2HKEA 2PI4A 2DGVA 3MWBA 3M32B 1D9DA 4O3QA 1TL4A 3QGPA 6FD1A 4F7VA 5IZHA 4UY85 2F9DA 3THPA 2MQPA 2HQ3A 1OSDA 1PC4A 3UN5A 2WRMA 2DRBA 2NREA 2CQPA 3LP2A 2ZJRQ 1YJTA 1YRUA 1HL6A 5D15A 2Y1JA 1NH8A 1TV6B 2MZQA 5HSPA 1NK8A 3BSAA 2IRUA 4B02A 4CLLA 2KZZA 3CIMA 1WC0A 2MDAA 2VUGA 2FHMA 2V0NA 3SSSA 1REVA 2Z57B 1RWXB 1IUJA 2XG8A 4LT6A 4USIA 3I32A 3I31A 4WZQA 2DNGA 2RDIA 1G2EA 5F0UA 5KFEA 3EZUA 1HHTP 5HANA 8AT1B 5IOLA 2QO3A 2GVZB 2ZH4A 4OI3A 1R0AA 5ETKA 1F6TA 2KH9A 1SC3B 3HSDA 4JP8A 3DLGB 1M1HA 1Q8BA 4IDKB 4TKTA 2F3JA 1HNWJ 1RWPB 2NZCA 2CIMA 1XERA 2L08A 1GXUA 4I6WA 2R7TA 2XQCA 3TZYA 1RT3A 2MQQA 5IM0B 5BJRA 1PCAA 3R1HA 5F8IA 1XMOF 4JI2J 2YBVA 2LP4A 2RE1A 3C15B 3PYFA 4DX8H 3DU6A 5IT4A 1J5EJ 5A2QY 3DLBA 4F2SA 1RWUA 1L3VA 4XO0A 2W9BA 2MGZB 2GVDA 1WEXA 2VASA 4FBUA 1DY3A 2ZM6F 2FZKB 1R0CB 1XBWA 2B5JB 1C4CA 5HQLA 3EVWA 4PG6A 1DTQB 4JI6J 3ENQA 4C3LA 2EC2A 4ZHRB 1WC4A 4NXMJ 1S12A 2EXUA 4P74A 1Y5NB 4DDFA 2GIRA 4RUCA 4LFBJ 4NCGA 4O44A 5AXMA 1QLNA 2B4PA 5E3CA 4DR5J 3M9MB 1NUEA 3D0IE 1I6JA 3ETOA 2B9YA 2JLGA 2PEBA 2ZHAA 1TKZB 3HHNB 2B9XA 1DFDA 1GEHA 1XMQJ 3C46A 3M8QB 4TLQA 2EK6A 2CPEA 2LLZA 2PD1A 4Z7YA 2NPFA 3SIPB 1NK7A 3R5BA 3V6HA 1FESA 1WD6A 3A3PB 2AZ1A 3MF5A 1JLQB 4DCJB 1QSYA 2EFNA 5RUBA 1FX2A 3UR3C 3OV7A 2XMAA 3K5NA 3DGPB 2ADCA 1VQKS 3N28A 2VQEJ 3UVJB 3KLGB 4IR9A 3Q86A 5FLXY 1S1VB 2AHOB 2AF6A 2VC0A 3FBBA 3OXFA 1N4LA 2F40A 2BM1A 1SQFA 4F4XA 2IJFA 3K57A 1IR0A 3MD3A 3OL9A 1A9NB 3O44A 2UP1A 3ZZ0A 2PT0A 2N7CA 1SKRA 4BS2A 1FE4A 3UDVA 1H2UX 1S7IA 1WOOA 1LEOA 2DPIA 2HBZB 3FGVA 3SCIE 2DRAA 1HWJA 1AFIA 1FKAF 5KFDA 5HLFB 2XYPB 2AQ4A 2CQ0A 4ZPBA 4RU2A 1KRPA 4M5HA 3GIJA 1JKHB 2JVRA 2IC3A 5H9FJ 3BSNA 4PQUA 4DR1J 3MEDA 1DTTA 4P52A 3PYDA 3UDCA 3CUNA 3L7PA 2J5AA 3N01A 3QMQA 4LFAJ 2CJBA 3GR0A 1DQ9A 1LNQA 1RT6A 4ZVEA 2ZVSA 2BW2A 2XZDB 4I69A 4JI7J 4MIAA 1F2GA 4B3MF 4DQIA 1FF2A 3M8SA 1VC5A 2H5EA 1RCXB 1LWFA 4FVCA 2PGCA 2V6AA 1X60A 2BE2A 1X5OA 2QYCA 4WP3A 2BEFA 3OD2A 5CCLA 4HDGA 4XDDA 1LWCA 2W1BA 4ED1A 2CPXA 3GIKA 5L1JA 3QJLA 2OSRA 5EUHA 2V8HA 4CO2A 2VOOA 4PXEA 1UEKA 4DF4A 1EB0A 4C8YA 5H9FK 1CC8A 1MW7A 4M8LA 3ISZA 3VHQA 4JI8F 2C3OA 3NEKA 4OYAA 1REGX 2NPIA 4R8UB 5K20B 3HMJG 3GV5B 1VCTA 2M3DA 4ECQA 3CO0P 2AKWB 1FK9A 4F26A 2UXBJ 4ZVPB 3U1LA 1RAAB 4WYWA 1HQEA 4OYBA 3CD5A 3D67A 3R5DA 4DR6J 1QE1B 2ZNZA 4DV2J 1HNIB 2NYHA 1WORA 4DSJA 2H5JB 5ETRA 5HBMA 4Y2KA 1FDAA 4WXOA 2IHR1 2ROEA 2WZ1A 4AFFA 1Q82T 2CQCA 5KFOA 2BOPA 1MLAA 3KJFB 4PUOA 3A13A 4EZ6A 1IKXA 3HI9A 1G4CA 1H2TZ 4ZLLA 1FJ7A 2F8EX 2RS8A 3AJ2A 3FZBA 4NRTA 2DR7A 4O3RA 3NLCA 1T9XA 3GLJA 4G1QA 5ETQA 3VQTA 3IBCB 2IMOA 5LXRA 2X1FA 2EBGA 2NYIA 1RAJA 3LQVA 3FUYA 4KIAA 5CH7B 3CCVS 3CCWA 4DQPA 2MSTA 4JI7F 1F9HA 1X5SA 2JNJA 5IV4A 4J90A 4P2SA 1U2FA 3M8YA 5C24A 1JNRB 2FJVA 1JJCB 1W2IA 2D3UA 4IYQA 3VAJA 1WG1A 3A12A 3MCMA 1JLGB 3PY8A 2AWZA 4TXSA 4C97A 2ILZA 1ZPVA 4B17A 2CQ4A 1HQ2A 3R6LB 3PW0A 4DV4J 3PTWA 5LSRA 2E5HA 4J9UE 3DRYA 3H0PA 5HP1B 5J1EB 4B9MA 4FNIA 3QRPA 3O6QA 3CW2C 2CNNB 3ISNC 5AXKA 2Z2ZA 1BQNB 2P5VA 2W24A 1NMEB 3IBWA 2JHEA 2XNQA 4GC7A 4PPZA 4DR7J 2BE7D 3TRGA 4CH1A 2HK3A 2MJNA 3SXLA 3IWXA 1U0HA 2HNZB 1N5SA 3BN7A 2EFVA 3BJYA 3A4TA 3LOUA 1HQUB 5IT9U 4CO5A 2Z30B 1JLCA 2WONB 4ED2A 3HVAA 1B4SA 1RABB 1FFGB 3POTB 1SIWB 3OLBA 3K17A 3SBMA 4ZITA 2ATLA 2RB7A 1SL0A 5M2RA 2LQBA 5K8PA 3ILLA 3LWMA 1UJ4A 2W8KA 4DV4F 1NU4A 1WWHA 4USWA 2DHSA 3TW0A 5FLXU 5IWAF 4F4WA 1U47A 1JLBA 2YKPA 4CLZA 1NPKA 3CCMS 3K8VA 2JLFA 3GV8B 1N56A 3P45B 2AD9A 4LF9J 1RWKB 4ID5A 4F4ZA 4E8UA 2IPOB 3TUPA 1TL7A 2HHHF 4DL6A 5CD4H 4FYWB 2QSFA 3QYYA 4M5IA 1M5SA 4URGA 1JLFB 4PUOB 2R2TA 1S0VA 2PA3A 2ZH1A 4K4SA 1RISA 3I87A 1V5VA 3HSJA 5CZXA 3EGWB 3SSQA 1E6YB 4QWCA 3D68A 1BY9A 5C25A 4F8RA 2X1AA 4L74A 4RUAA 4JI3F 4U7UK 2DYAA 4B9VA 2XY7A 3CDBA 1IQTA 4YR2A 2VPZB 4N77A 4KQZA 3OSNA 3HD1A 1UWAA 1PSDA 2B43A 4N8OA 1YTYA 4K7QA 1HHSA 1ZS6A 4TY8B 5GVQA 4OJGA 3RW6A 1RU1A 3MI7X 1YBUA 3DHXA 3HHEA 4HTIA 4WFBQ 4UY8T 1J5OB 1S5ZA 1UFLA 3AD8C 2L3MA 4P2FA 4OMFG 4HHJA 3PO5A 2FVPA 4J9MA 1I51B 3IAM9 4JI0J 2HHTA 2MYFA 3MDFA 1SJ3P 1CC7A 3DOMB 4RNNA 3IGNA 4C0HA 3K5PA 1DQAA 3EXYA 3CEDA 1TAUA 4BCAA 1TKDA 5SZTA 2UVWA 1PYTA 3X1LB 2ILYA 1L3TA 5DRKA 4QR1A 1FRHA 1S6QB 3EM1A 3E01B 5KG2A 3BH6B 3Q8QB 2R7VA 3BYRA 1D8ZA 1KHWA 2BVZA 3GU0A 2W7OA 1KNZA 3PW2A 4CLWA 4LMZA 5IS2A 2B3TB 4Q7AA 3UD3P 3KLEB 3FFIA 2LU1A 2KRRA 4DR2F 3MURP 1T95A 1VBYA 2DEIA 2BJ1A 4JI6F 4DQRA 1VIXA 3TI0A 4NCAA 4OJ3A 3VV2B 1MMDA 2UUBJ 2XMVA 4DJBA 2FZCB 4F67A 1T02A 2MQMA 1AROP 4NZ0A 4UUWA 3GQCA 2JVOA 3CWJA 3T41A 1FVSA 3M1VB 2MGZA 4NLQA 5B7WA 4U6PA 3AY0A 4DUYF 2CZ9A 4ZPWR 4O3SA 2I38A 1FO1A 4LREA 2P2CB 1SIZA 4M5MA 5GMDA 3NWRA 1VRTA 3SFUA 2BKOA 5I42B 3CE8A 5DG7A 2XCPA 1ZAXA 5BR8J 4LBHA 1RHRB 3MM5A 1JJHA 1R43A 3W62A 2ZH6A 3G71S 2ZFHA 2HBYB 2DK2A 2G2OA 2EFPA 2JOQA 2K2PA 1Y10A 4FKXA 3ZZPA 2EWHA 3GE9A 4DL3A 1OSCA 4I2QB 4WIQA 2CQDA 2HZCA 3ILIA 4WFNQ 3KK1A 2FY1A 4KV8B 1S1TB 1VQ6S 3IC1A 3N4WA 4NZ7A 3WIUA 4IR1A 4ETXA 3JTPA 4IRDA 2JRSA 3KNAA 5ETTA 1JJ2R 1K47A 4H4MB 3NL0A 1OPIA 4DX5A 2HIYA 3OL7A 2X1BA 1DAXA 2L41A 3MAHA 2HQGA 4USKA 3J7Z5 4IQXA 1UVLA 1JXLA 4Z37A 2BRLA 3FMWA 4FF1A 3U7JA 2AJ4A 1WI8A 4ZOSA 3C3LA 4KJIA 4X4NA 2ERRA 2Y3YA 4HHHA 3HD2A 5F0WA 4F36A 1APSA 1UL3A 3ENWA 3A3NB 2VH7A 1HBNA 2IRYA 3DRRB 5HQ8A 3OTBA 3G9CA 2CYYA 3ZC4A 3J7YU 1K1SA 4OJHA 3LANA 3ZNUA 1HBUA 2G9OA 4KKOA 1XR7A 3CJSA 3ZZTA 3CCQS 5JVGQ 1FHTA 3GPAA 1FJCA 1XMBA 4FF4A 3J81j 1S6UA 4ZCIA 4FP9A 1J27A 3AAWB 2N7YA 4UZCA 2HGNA 1FVQA 3M6WA 5ETSA 4IKAA 2DNOA 2AP6A 2I8EA 4KGKA 4KHRA 1WJ9A 3SDEB 2Y8WA 2Q79A 1HIYA 2VU5A 3D2WA 5K14A 1C1CA 1HPZB 1R8AA 2K7KA 1CJTA 2ACMA 1RTJB 4RW4B 1RTDB 2R8KA 4ERDA 2UXDJ 3TEHB 4A8OA 2W2NP 2RT3A 1K0TA 2CZ4A 1T11A 3UE2A 1YZ7A 2V4JA 1NLKL 2K1RA 1FEEA 2YKNA 4QYRA 3GV7B 3TZXA 1CSJA 2IDEA 3BH7B 3C19A 1PAUB 3MPUB 4NA1A 3QT7A 2V50A 4LQ3A 4X4VA 2QFIA 1SKWA 1UWBA 5DJBA 3LALA 3PX4A 2A10A 4RW7B 3DOLB 1FWLA 2YKMA 3MCOA 4PEOA 5L38A 4B3SF 2KXFA 3PYGA 3M4XA 2QGFB 4OI2A 4MIBA 1T9UA 2DNMA 4HR2A 3SMZA 1PILA 3PO4A 2C2RA 1H0HB 4C2MA 1LKZA 2ZEJA 3KK2B 3MTKA 1LK5A 5D4PA 4FYYB 4NEZA 1RWMB 4F3MA 1IKXB 1T0TV 1SUQB 3G4SS 1VLOA 3A3OB 4Y2AA 4LF5F 4LF7J 3A1YG 3LGNA 5BYQA 2IM1A 2D41A 5A8WA 3R7NB 2IAJB 1L3SA 3H8YA 1LWXA 2NUHA 3FCVA 4Q2MA 2L9NA 2BQUA 4LIRA 3UR0A 4X4PA 2YNGA 1XK8A 2XSJB 3G86A 3M8PB 4L76A 4NLVA 3RJMB 3VAIA 1XMOJ 2E7VA 3SCJE 1FT8A 1N6QB 2E9RX 2HHWA 2OSQA 1D3WA 4KHMA 4P9SA 1JLGA 1LK7A 3FEYB 4F50A 4IQMA 1RT4A 4Y2MA 2LYVA 3W5ZA 3QSIA 3W8GA 3WHIA 4YHHJ 4U7UD 1RB0A 2VFRA 2E1AA 2O1PA 3M32A 3HF5A 5KOXA 3LTOA 5D6GA 2KXNB 2B7CB 3TA2A 2DH7A 3MMAA 4DCOB 1XIQA 3OW2R 4NXNJ 3EZOA 2ZKUA 5LSOA 2VQEF 4CH0S 5T7LA 1NKCA 2UV8A 2E1PA 1Y3KA 2HHQA 1Y3JA 2Q43A 3JSYA 4H4OA 3W2WB 2OPQB 4NX9A 2H54B 3KFWX 3RAQA 2LQ8A 1WI6A 3PW5A 3BGLA 3D6MB 5ETOA 1RAOA 4P6QA 4IG3A 4RW8B 3UW1A 5EWFA 3EUNA 3NAHA 3U1MA 3HHKA 1REVB 4W98A 2ZITA 1IBLJ 2CRLA 3HFKA 3W2VB 2ZH8A 1T05B 4N41A 2ZDPA 1NM2A 3D1QA 2MZJA 3I55S 5LSLA 2CAJA 3NG8A 4I67A 2DNPA 4DZDA 2KVIA 3DRPA 4IH7A 1R8BA 2KYZA 2ZJQQ 3FBEA 4KE5A 4TQRA 1R0AB 2KKHA 3KHLA 2YX4A 3ITHB 3J81Y 3R7BB 3A8JA 3AD9C 2C2MB 4P73A 2YQ3A 1KQGB 2AGPA 3O1LA 3ZFVA 4Z7CA 1S10A 2C3UA 3KLVA 4WFAQ 3B54A 3NOGA 1I3OB 2IIHA 3GSIA 2R8HA 4A8SA 4G6VB 3IM8A 1FNXH 1T94A 1WHWA 1G1XA 1E6YA 3QGHA 2GV1A 3CCUS 1U1QA 2Q1LA 1Q8IA 1XR6A 2KT2A 1S6OA 4N7TA 1T3OA 4ZPDA 3UO0A 4DOZA 4K2XA 3KJVB 2D9PA 1L3UA 3NNAA 4QU6A 3T1YF 3CDUA 5KFGA 2NS1B 5IC4B 4X65F 3H2LA 3CJ5A 5A8KB 3C6TA 3K58A 3JQKA 4FYXB 4DUZJ 1FRIA 2AZ3A 4LRAA 2H9ZA 1R27B 1JJ4A 1S79A 5D0HA 1RAGB 2LCWA 2R7WA 3NY0A 3UD5A 5DGAA 1M5OC 1NPRA 4NCGB 4O44B 1FJGF 2R7RA 1NSQA 2VG5B 5ITHA 1F1BB 2ATCB 3I0RB 2O3DA 3VQSA 5GADI 1U1PA 4ZJQA 1KQSR 1UJ5A 3BO4A 4N76A 2GNKA 1NSKL 1VYAA 2BUNA 2DHAA 4WXWA 2E7WA 3PW7A 2HQFA 2HWHA 6AT1B 1FFSB 3D6FB 3MM7A 1GAOA 3KKFA 4KHPJ 5F8NA 3D54A 1NZAA 2KG0A 4ED6A 3IGVA 1JXVA 3MECA 4FKYA 1JLQA 1LXNA 4OX9F 4DF8A 2HNYB 1U8WA 3W3SA 4X65J 3EVMA 4OLPA 1L5UA 4RPFA 4Q8FA 3MAAB 2RRAA 3TR5A 2LMIA 4USTA 2MTLA 4RWWA 1F5CA 1M5PC 5KT2A 1CULB 2MXYA 1VQYA 3KDOA 3FDSA 4QBUA 2HFUA 4ECUA 4K8RA 1FX4A 3QIPB 1M5HA 3QWPA 3IG1B 2CFXA 4LR7A 3TO8A 4ILMA 2FUG9 2JL9A 1NBEB 3FEXB 4QWEA 3JAMU 4DSEA 2AGOA 1RA6A 4LF6J 3Q2TC 3M2VA 2XCAA 1TK5A 3KG4A 4FXWA 3HVTA 3KLIA 4HVZA 4CT9A 2QYGA 4MYTA 3TQ1A 2B9WA 1X8DA 2GHWA 2RAQA 2I5JB 2YWEA 3UCGA 5KFWA 1FNMA 2MLXA 2IC3B 5GMEA 4P7VA 5F8HA 3GILA 4DUZF 2CPIA 3Q22A 1U1KA 4PQUB 2YQ0A 4PWUA 4CLSA 2VG6B 2NLWA 1UZHA 3HDSA 5J1NA 2OD4A 1ZTTA 2UUAF 3D7SB 3QJJA 3ZNJ1 1HNVB 2DGXA 2HAIA 4ZVUB 3RBXA 3L95X 1S1TA 3FEZA 3CTRA 4KV8A 4K4WA 1VQSA 1NO8A 2KRBA 3EDQB 2BE2B 4RO0A 1VRQC 4XDCA 4DR4F 1G6BA 1ZH5A 2NXNA 3ZZUA 4DWIA 2B8PA 3SSRA 3BQ2A 1R8HA 3LUYA 3LP1A 1NB7A 2FPHX 4WIIA 3T5KA 5DDPC 1PAEX 1NHKL 1YQHA 4J9RA 3CC2S 1WUUA 3C16B 3Q8RB 1S7HA 2HLTA 4ZJLA 1S6PB 4OLOA 3R3TA 5FIIA 4JV1A 4U95A 2XS5A 1VQOS 3RBDA 2YQ1A 4FBTA 4B3RF 5EN1A 3CNQP 2EG2A 3CJTA 3DDIA 3DLEB 3JSBA 2H4WB 3JTOA 3PV8A 2YX1A 3UWTA 5IC6B 2QFJA 1ICEB 4EBDA 3OUYA 4DLGA 3EGNA 4PCQA 4LSZB 1BGXT 5B0GA 2HQDA 1ZYQA 4QIFA 3HHDA 4ANCA 1NHUA 2UXDF 2P9GA 1DQ8A 2BJ7A 3IR5B 3NS6A 5HK4A 4DUTA 4ID8A 2FVCA 1CG2A 3OXGA 4WJBA 3EPGA 2DEJA 3PEJA 1KP6A 4G1QB 4OYPA 4DFJA 3MR5A 1CJKA 3TA0A 2EFOA 1Q81T 3I82A 3JSMB 5E3AA 5L9NA 4B9LA 1IKYB 1ZM9A 1C1CB 3DOKB 4B9UA 4C8LA 4F02A 4E0DA 1X4FA 2HFSA 2DT9A 2K7JA 2EVZA 4RW6A 2AMCB 3AXMA 2ZBQA 1Y4ZB 4CLTA 5HMYA 3PR4A 3F73A 1HNXJ 2M52A 2NUUG 5D4OA 4YUDA 1LFPA 1LW2A 2FTRA 2XZWA 4X84A 2Q6BA 3TUJC 4C3KA 1QUVA 1S76D 2W2OP 1IQZA 5E3QA 1UCNA 4KSEB 4OHZA 5KFTA 2ZBPA 1S1UA 3MEEA 2JH3A 3M9NB 2VF3A 1MN7A 4JB8B 1UTAA 5L1IA 2VB6A 5F41A 4KGVB 2I9SA 2KN4A 5G0RA 4QPXA 1CJUA 2QA1A 3BF4A 2JWNA 3AOBA 2NQPA 4LF2A 1EETB 2ROGA 3CCJS 3CDEA 2B8QA 1W2BR 2VDIA 1S1XB 3AB2B 4K4ZA 1A6LA 1DURA 1NK4A 1RU2A 5DO2A 2FJXA 3P96A 2ASYA 2F5GA 3FC9A 3RYLA 4DX7A 4WK3A 3TAPA 4K4UA 5A8WB 2OLWA 4FDFA 1VDHA 2DGUA 3RBZA 1U1MA 3UI3A 4KPCA 5KT6A 1T3NA 2JX2A 3MCSA 1VQLS 2LDYA 2LU2A 3P8BB 2YH0A 3Q8SB 3T19A 9ATCB 4NOHA 1Q7YT 1QTMA 1SC4B 5J2QB 3CD7A 3TYTA 2WCXA 2VFVA 2CJYB 3FK4A 3LAMA 4L6V3 4KT0C 1R89A 2DGQA 1DRZA 1F3FA 1IBMF 1OIAA 1TUWA 1VK8A 2HVZA 4DPWA 3MUMP 1X9WA 1T9YA 5C25B 3QT5A 1YJNS 2XYGB 1PYSB 3L7UA 3L4BC 4ATNA 2GGPA 4X62J 3PJ9A 5JUMA 1MNEA 2OJ3A 2FY8A 2W7AA 3FSXA 2O67A 2OEKA 3OTOF 1URNA 3CGIA 3D28A 2BANB 4PR6A 4KAIA 1VQ4S 4ITSA 2LQ9A 3H42A 3HFZB 4EBCA 3MMJA 4ZPTR 2Y1RI 4YMEA 3FVYA 1RUSA 2QTWA 3OHAA 2X1GA 4ZVGA 3WBZA 2G0JA 1UEVA 2QV6A 4U8YA 3W2VA 2MZSA 2FHKA 3BM7A 4TVAB 4ZVTB 4DN9A 1RBAA 5M2PA 4JOUA 3PHEA 3U02A 2HS4A 1FD8A 3DRXA 4OIXA 5KG5A 3T5JA 1RLCL 2QX0A 4BC9A 2MHEA 4OZ3A 4X66F 3N5BA 4EO6A 3PDNA 3W66A 1S6QA 1QY7A 2GA7A 3MR7A 3PCOB 3GJQB 5C5JA 2B4OA 4O4GB 1MWQA 5DDRC 3LWLA 2RKIA 5LMUF 4DV0F 1UVJA 4DR2J 2CWXA 4KBIA 5H9EK 3NS5A 1MU2A 1YBAA 2EEYA 3CCTA 1U1OA 2UXBF 3EDRB 4Q45A 4WBFA 2MKYA 7AT1B 2MKKA 3OFHA 4J9NA 5DLGA 3V6KA 3KLHA 2U1AA 5C42B 4Y2IA 1ZA2B 3UN2A 4XK8C 2P8IA 2HSEB 5EGYA 4GC6A 1XTZA 3BKUA 3A8IA 1KQKA 1HI0P 1MSWD 2WBMA 1KKHA 2V5HG 4WFYA 3NGRA 3MM6A 1UP1A 1JLEA 3FRZA 3TJ9A 5KT3A 2UV8G 2J7KA 2DNQA 1VHFA 1FWKA 2GO9A 3DN9A 1OQ3A 3MOZA 4Y6IA 5D77A 1VFJA 3K2YA 4HACB 4AT1B 5BR8F 3MZIA 2IFXA 3GZ7A 2OPRA 4RNHA 2YPZA 3PFOA 4V19X 4U9RA 4K0KF 2E5GA 5BXIA 2ZWOA 1JMTA 3R8YA 2R7QA 4ZPCA 3W5XA 5DG8A 2B7BB 1SJRA 3CD6S 1VOMA 3TANA 2APOA 4KFBA 4KR0B 3UDEA 4J9QA 2R4FA 4GMKA 2WVBA 5KTQA 5J1PA 3VALA 2JFKA 4ED4A 1EQ0A 4DSKA 4UQTA 1WG4A 2V4QA 1AT1B 2DGSA 1UVIA 5T41A 2G1DA 4ELUA 3KK1B 2CQ3A 4C4WA 3MM7B 4QIGA 1QTNB 4HHUA 3OXLA 2EG1A 2UVVA 3M30B 4ELTA 2F65A 1U26A 2V67A 3L09A 3R5AA 4ED7A 1U48A 2HNYA 3DNCA 5D0EA 5AJ3F 3WC2A 4H4MA 1FDNA 4W90B 5IQ6A 1GFWB 3M2UB 3MTJA 3HP6A 4F4YA 3SI8A 2FVSA 4KGXB 4KRWA 2NCKL 2PO4A 4JI4F 1GT8A 1WC5A 1JWWA 1HA1A 1VQ8S 4IH6A 4JV2A 4K0KJ 4PABA 3HSGA 1YSJA 4A8WA 1T9WA 4I7FA 2PEHA 5GMKa 2DXDA 2ADBA 1LWEA 2XMMA 4ZVSB 2KTQA 1WG5A 2KHCA 1RSCA 4TNOA 5K8NA 5KFHA 3G8SA 5LT5A 1KSPA 3JXOA 2MB0B 3V81B 2GAGC 4OI1A 2UVRA 2A6MA 3KTQA 2VDHA 3OR1A 4KH0B 3AB4B 2JEGA 3IWNC 1UMJA 3M7VA 3DDNA 1MMLA 4UOCA 4JV5J 2AYMA 3ZZZA 2EFQA 3B8HA 3QQCD 4MKYA 3GIIA 1TMMA 2D7SA 4CM0A 4O3PA 1FXDA 1R7IA 1U1RA 3PACA 3AD7C 1J2VA 3NGUA 1KR4A 2COLA 1WEYA 2IY5B 1UVKA 1H73A 3DLJA 3GR1A 4PG4A 4DCPB 3KMQA 1C0TA 5L8RC 3QGGA 3VCDA 2J8AA 5KG0A 5DQHA 3RR7A 2C28A 1PYOB 2ZVIA 4EWTA 1RAFB 3OHBA 2A0FB 3CB4A 1Z1ZA 2J7UA 5FD1A 2XO6A 3TUZC 1Q95G 3W9JA 1PBUA 2HWIA 2YNHB 2HRYA 1S1WA 4MH8A 1BE4A 4E2FB 5HL7Q 4B3RJ 5ETNA 2YNIB 3ELHA 1DARA 1TFWA 2JFDA 2HHVA 3PM9A 3B82A 4DV6F 4M63A 3IP0A 4Y28C 3H25A 1ZA1B 3T5HA 2YWKA 4CCHA 2LXIA 2NXEA 1R8PA 3GJRB 1RT1A 2LXFA 3ADAC 4OZ1A 2HPUA 4FS2A 4KO0A 2OD6A 4DV5J 3QFWA 4HH1A 2UUCJ 3GONA 4Y34A 3UQSA 1GQEA 1YZ6A 2MKHA 4EBEA 2V94A 4B9NA 1VRUB 5JXSA 3QATA 5KT4A 2OPPA 3KLFA 4XPEA 2W8LA 1FRMA 4WP8A 1IWAA 2WK4A 2J9DA 4W4MA 4USMA 2EC0A 3TWZA 2OEMA 3WDOA 2J8SA 3I4HX 1MN9A 1D1UA 4ED8A 1EP4A 3P4UB 2HZVA 5DGBA 3RR8A 1T9VA 3KDNA 2J0XA 4ZLJA 1HNXF 3JTNA 3DMJB 2J0QD 3RB3A 1S48A 3M05A 2POKA 3VAMA 3CC7S 4ICLB 4HEA9 3UVJA 4DR3F 2FGOA 1OYEA 2C2ZB 4X4TA 5DM6Q 3EICA 4B3MJ 2Z2LA 2XSJA 4I68A 3EGZA 3I0SA 2MPUA 2OFGX 3CVKA 5I3PA 3FJ2A 4YHHF 3OR2B 4DR1F 4DV5F 1K8AT 1F3VA 3CMAS 5KFNA 3H5YA 1OMSA 1D0EA 4ZKAA 4UOFA 2YTCA 4C0BA 2V4RA 2FJEB 2CNLB 2M4MA 2CPJA 3G82A 2FZGB 4CO3A 3G6XA 4CYUA 2Y0BB 1DLOB 1NPPA 2K8GA 3GYNA 4Y65A 3MEEB 2MKIA 4DI6A 1DTTB 4K5RA 4QIEA 4DG1A 4DPYA 1U45A 4GKJJ 5FJ4A 1VGYA 2FJWA 1RQ0A 1HBOB 2ROPA 1KWMA 2AGQA 4M5LA 4IG0A 3UDLA 2E1RA 3UNGC 3R5GA 2R8GA 1CLFA 1IR2A 1KD1T 2LECA 3DLKA 1RKJA 4F0MA 2VJUA 4H54A 3KJQB 1JLAB 3MD1A 1S0MA 2D69A 1NKEA 4KHPF 1Q16B 1HYSA 4W92B 5T14A 2ACYA 3IAS9 2JSXA 3RW7A 3VVTA 2HVHA 3U1NA 1X31C 2G4BA 2WW4A 2QL7B 2Y8YA 3MXHP 4DX6A 1MWZA 2DNHA 4NI2B 4ED0A 1N32F 2FJBB 5AE3A 5LMNJ 4IOBA 2A6OA 3O8WA 2DPJA 2QA4G 1RHJB 1NJWA 2W4DA 4ECXA 4F4KA 2KHDA 3NGDA 1SXLA 2CA9A 1C1BB 1XMQF 3IO1A 4RL1A 1VIOA 2OTJS 2M8HA 4EO8A 1WOPA 3AOAA 4LSLA 3L3CA 3KJNB 2UXCF 4R5PA 1PJ5A 1QE1A 2V8VA 4NMXA 4M5DA 4YB6A 4AXIA 5B0AA 2W2PP 3HCXA 3MR3A 3PW4A 3CCZA 3FMBA 1SV5B 3EZ5A 4Z2XA 1RWWB 1U24A 5KG1A 3W61A 1BQMA 2WW8A 2XTJP 5KG3A 4TN2A 1QAYA 2VJVA 5CABA 1KC8T 1RK8A 4DS4A 2BANA 3AJ1A 3SQGB 2J9EA 3EJMA 5A8KA 1K9MT 3C6TB 4L73A 2WVCA 4ZS6A 4DV3J 1X5PA 3F41A 2LEPA 4OZ2A 1FXLA 2E5LJ 1CPZA 1AZSB 4PG5A 4NEYA 3ZTOA 2OH2A 1WELA 2CQGA 1X4DA 4OHVA 3OFFA 3HT3A 2PDAA 2GJ2A 2W4CA 2V34A 2UXCJ 4TLRA 1UAWA 3W63A 1SC1B 1RKIA 2CQHA 4CO4A 4KB7A 1HR0J 3NBPA 4NMLA 1QVGR 2QG9B 2N3LA 2YKAA 2RILA 4AUKA 5I4MA 4O4GA 3TVZA 4C3MA 2MSSA 2JEFA 1YX2A 1RHQB 1RDRA 5LMNF 1U6BA 3Q8YA 2AT1B 2BOAA 4K2JA 5BYSA 1U2RA 4Q43A 1YHQS 2YKQA 2XS7A 3QO9B 2ASLA 4NLYA 2E1MC 2GAHC 2GHVC 2XMUA 2ZHOA 3LGMA 3BGRB 1TUGB 5F8GA 4DV7J 2Z56B 2BYCA 4RW9A 3KLHB 2CJKA 1MROB 5C42A 3NWGA 3IRXA 5CAAA 4ZCLA 2XS2A 4F4AA 3OL8A 2VICA 1HQUA 4JI2F 4NRUA 5J2MB 1YK9A 3IG1A 3D9BA 3KG1A 4MFBA 1P8GA 3LPYA 1N5YA 4GKKF 2WTFA 2RF2A 3RG6A 3E8OA 3HVTB 2FLOA 3KLIB 4WKYA 2OPSB 8ATCB 4XPCA 4DL4A 3EXCX 2GVZA 3N6NA 2X51A 2P6SA 1FE0A 1IKVB 3V4MA 1WACA 4RBVA 2KM8C 4K50A 3D6TB 3DLGA 1VC6A 3IWLA 4IDKA 4A46A 1N36F 2GHPA 4UW2A 2XMJA 4CI0B 2YNFB 3K5MA 3MFHA 4UT4A 2Y9HA 2BDPA 4ZIWA 5KT7A 4HDHA 4MT1A 2VPYB 3A8KA 3FQKA 3T1HJ 1YWXA 2H4YB 4UF4A 5L39A 3EVOA 4BDPA 3GTYX 2R7UA 3O5TB 3FSIA 3CT9A 3SCLE 2IM2A 3ZZYA 1LXJA 3VGVA 4C8ZA 1Q53A 4QYZJ 1SL2A 2GVDB 3R9LA 3OVAA 4TY8A 2DR6A 2QMXA 1HNZF 2ABYA 3CJ4A 1P9YA 2HFVA 2HIQA 5MLCV 5D0RA 1UZDA 2CJAA 4C11B 2N4CA 2HQIA 1RHKB 3HHLD 1C4AA 3KXDA 2WSCC 3PFEA 3R6GB 4OV6A 3CF5Q 3TJ8A 3LH2S 1QSLA 2C3PA 2GIFA 4M5GA 1QAIA 2V69A 2YWFA 2IJRA 3K7RA 1K44A 1EX8A 1X5TA 3H5XA 5E3PA 2VPWB 2XY6A 1WOSA 1ZPWX 4QOTA 1B70B 4MK9A 1X0PA 3M8QA 2WVFA 4MK8A 4N56A 4DS5A 1T03A 1KBRA 4CNYA 1BD6A 3N79A 2GIQA 2LXUA 4I2PA 4OQJA 3TARA 1BWVA 3NMAA 1EHWA 4WU3A 3VGUA 3MUTP 3HKZD 3FFIB 2GO8A 1U25A 2Y1LB 3CJ2A 4O23A 5KFVA 2W9AA 2CKWA 2EPIA 1K73T 4ELVA 3R2CJ 2Z0GA 1TU0B 1TKXB 3AOCA 2J9CA 3H4BA 1TTHB 2CPZA 1RWOB 3AH6A 1A0OB 1IKYA 3H98A 4QIVA 1ZM4A 2DBBA 3VR1A 5E3RA 2PI5A 4IRKA 4LUBA 4WF9Q 1H3DA 3NGKA 4LR8A 1YRXA 5D3GA 1JNZB 3PKMA 2PSZA 3KUEA 4Q5VA 2ZBCA 4P72A 2AYEA 3HJFA 1HMVA 3FCWA 4LVOP 4I1TA 3GMGA 4QWBA 5CYMA 3I6PA 4KH1B 3IN5A 2VA2A 3QRQA 1RT1B 4B3OA 1KVIA 3MM5B 2JC1A 4DEZA 4GRSA 5K8OA 4YP3A 3MMBB 4G3IA 4RLEA 3MUVP 2D3OR 4WCEQ 1TKTA 4I64A 4KC5A 4OYIA 3H40A 1CJUB 1ZZNA 1KEKA 4ZVOB 2C2EA 1FEHA 3H20A 2VIHA 3RTVA 1RTHA 2HHSA 1V3RA 4NLDA 2Q6CA 4ILLA 4DU7A 1S1XA 3CCSS 3L7OA 4ZVFA 3V6DB 3PG9A 2G2ZA 2HBRB 1IBCB 2DHHA 3CO9A 4OFZA 3GYGA 3NKYA 3T5LA 4EFAC 1HHQA 4K4TA 3RGIA 1IJEB 4WU2A 2XMKA 3LGHA 3ETMA 2XWXA 3DHWC 1J5EF 5DETA 3WX4A 4BC7A 4PQAA 5F8JA 4WTOB 1P6TA 2H51B 5DLFA 5A6WA 1Y5LB 4C9DA 3CJRA 2UUAJ 1S72S 2F7VA 1QUPA 1SI9A 1M0SA 2XWYA 2HMIA 3TZWA 2CVIA 4MIWA 3GG1A 4WE1A 4ZCKA 3PRVA 1V3ZA 3IS9A 1HBNB 3PZPA 3DRRA 2FHJD 2BW7A 3FNNA 4PXCA 5J2PA 2XNRA 1BQXA 4URSA 2HVDA 3IMQJ 1ZOTA 4USUA 5EDWA 4LF8F 4JI5J 4J5OA 1Y11A 1CJVB 4X2BA 5DS7A 5DM7Q 4IG0B 2R7XA 2ASJA 3LF0A 1TL5A 3LP2B 5A0YA 4EUVA 2W9CB 2ZH5A 2KYXA 4GKJF 2XMTA 1M5VC 2KO1A 2H48B 3TAQA 3RBEA 1TV6A 3PEHA 1CJTB 4RW4A 2CPHA 1N32J 4UUXA 1RT2B 2ZOMA 4J9VA 1QAXA 1GXTA 5KFUA 5C24B 4ZVQB 1SQGA 1AB8A 2A2DA 3MPVA 4R0JA 4WTYA 4DFKA 4J7CA 1PGZA 1HI1A 1HWKA 2V4JB 2W9CA 1GTHA 2SXLA 2D1CA 2QLXA 3PJWA 5KFQA 4X4OA 4GKKJ 5LM7E 1K1QA 2W2QP 4RNMA 5D8HB 5AE2A 3BBFA 3LO3A 5L9XA 1TK0A 5KFFA 3MHYA 4ZA1A 3G96A 2P6TA 5BYRA 4LFCF 4LSLB 3LP0B 3TUIC 2YKOA 5F8LA 1H72C 2MZRA 5FDLB 4DFMA 2KI2A 1RYRA 3ILJA 4M5DB 2RNEA 4R0EA 5F3TA 5KAKA 4ED3A 5L1KA 1HW9A 3H5SA 1S0NA 1RT3B 4HI1A 3PYEA 2LFVA 1EKSA 5HAOA 3SV4A 2XLKA 4MTPA 1BQMB 2RHQB 1WF0A 4DV6J 1FFWB 3C15A 2MZ1A 2VKZG 2MKJA 1N0UA 1YJWS 2ZKTA 2HW3A 1TP7A 2H1YA 3ENAA 4L3KA 2HURA 3SQGA 5KFPA 4HACA 2E9ZA 1KLMA 2VD3A 4JUZA 2QJ3A 4Y3CA 2GMHA 1N5TA 3GCXP 1KFDA 4UOHA 2C1EB 1VI7A 1JLBB 2OTLS 3M6UA 3AT1B 2QMWA 1DTQA 4B3TF 1PG5B 4OHYA 3C8YA 4USHA 4ZHRA 1U1LA 2RQMA 4LVNP 1N6QA 1B64A 2I0XA 3BGUA 3OTDA 3CDAA 4ZPAA 5KFXA 4A8FA 3MM9A 1RT4B 1X4HA 2DISA 2Z8QA 2G0CA 2A3JA 2M0GB 3BEGB 5AT1B 3BSCA 1NKBA 2OFHX 5KFZA 3W64A 3MMAB 4ED5A 1W25A 2DNKA 3QLHA 1X4GA 2EBEA 3BGFA 4PG8A 1DZ5A 3CSKA 1VQ9S 4Y0FA 2CG8A 2Z2MA 5T7LB 2BABA 2HRUA 4N47A 1KDNA 3CXCR 1FKOB 4H4KA 1JK9B 4F3QA 4K4YA 4EYHB 2BR0A 4A47A 3IXQA 2UVUA 4M1KA 3LA0A 3F0NA 2DY9A 3F44A 2WSFC 3QBCA 1GNKA 5KT5A 2ZHBA 4KYZA 1RXOB 5U47A 3J7YI 3OJUA 5EWGA 1PC5A 2YWGA 3DGPA 2BM0A 3JYTA 1N8RT 4J37A 1WF1A 1F5AA 1V6HA 4RW8A 2MZTA 4JBCA 3W9IA 3CC4S 2AJ2A 3GFZA 3WIVA 4YS2A 1S1VA 5J2MA 3R2DJ 2V2KA 1VQNS 2DO0A 3NOCA 3CPWR 3DOMA 4MFBB 5HROA 1T05A 1RT7A 3HHLB 3IR7B 4C98A 1RWNB 5HN0A 4JV5F 1IKWB 1HLWA 2KG1A 1IBMJ 1RLDA 3OR1B 3Q8VA 2VA3A 2DGTA 3BZQA 5B0CA 1KTQA 1ELOA 2BJ3A 5H9EJ 3T1AA 3B4DA 3TP2A 2F8MA 1XN9A 3D1OA 1U8SA 3D0HE 3SQOP 2OKQA 1RTIB 3ITHA 1CS4A 1YJRA 2VL1A 5LJ5Y 2EW9A 4OL8A 4LIWA 2V63A 5GAGI 3CCRS 1SL1A 3FKBA 1K0VA 2RUGA 2W4PA 3HO1A 2YNFA 1HWLA 2HNDA 4FYVB 1C0TB 3TAMB 3ZXWA 2CDRB 4Y00A 1B3TA 4HL9A 4DQSA 3HX9A 4B9TA 5H1SV 2KZMA 3QSYB 2KFZA 1RJJA 3TVKA 6FDRA 1ZAWA 3GJSB 2KB2A 4GVLA 4KGZB 1OO0B 4U96A 2F4FA 2C42A 4NA2A 5LXYA 1SB6A 4PYDA 1X7VA 4OYOA 2JEJA 2YNIA 2WVDA 2MKSA 3M1VA 3BQ0A 1WSVA 1UJ6A 2PFDA 3MMCB 4F25A 3PX6A 4C11A 1RYSA 4IFVB 1B99A 1U6FA 3J7ZT 3OJSA 2DTJA 5KOWA 3E51A 3H4DA 1JIHA 1WTFA 4YB5A 1S9GB 1Q5VA 3FBFA 2IYIA 4LRCA 1UKUA 1XNQJ 3I96A 3AA8A 1FTCA 1Z2LA 2VG5A 4DMZA 4KO0B 2YX7A 3R5CA 2WSEC 5E33A 4C48A 4RNOA 1HD1A 5KFLA 5GAEU 1V5IB 1E6VB 1SKUB 3DRSA 1VS3A 5THWA 2ZH9A 3EMTA 1SBRA 2GJFA 1HQEB 3OSPA 2NSBA 3HJVA 2OPPB 4HT5A 1H2VZ 4NLTA 3QPIA 2O5DA 4OHWA 5KFMA 1T03B 2RHSB 4Q0BA 2RDJA 2VODA 2XBPA 2CQ1A 2M8DB 4QWDA 4DR3J 2FVQA 3QAUA 1YJ7A 2G1HA 3JS9A 5GAHI 4L3NA 3DMJA 3K0JA 3D1HA 4ALZA 1QVFR 5B0DA 3IM9A 4K5SA 4EYIB 3MEGB 2HS3A 4A4JA 1CBKA 1WC6A 4JI4J 1NZ8A 3PNIA 2XGPA 5GADU 3HM9A 1WEZA 3G6YA 3D0GE 1VHIA 3OR2A 5L1LA 3R1LA 1DHMA 5HVHA 4FF3A 1U09A 1O8BA 1YRTA 2B0GA 4PAAA 4RBTA 3TEGA 2ZUGA 5K8MA 1RCOB 4HH0A 1TZ0A 3HK2A 4I6YA 4QCLA 3G82B 3T6BA 2FLLA 3J80Y 4OX6A 2BQ3A 1I94F 4CRJA 1BHNA 5B08A 2CJ9A 4LQ9A 3MPYA 4B3OB 2B6AA 3OVSA 3EWGA 3HULA 3UN3A 4JYAF 2DRDA 3DCAA 4KKOB 3CJQA 3P3DA 4E98A 5C2GA 1HBOA 2QA4S 3TZZA 2BJ8A 5DQGA 2AJ0A 2IBOA 3W2WA 1HNVA 3M8WA 3M9OB 2CJXB 1S9FA 4A48A 4QW8A 1JLAA 2H5IB 2P9CA 4DHVA 2NXUA 2RU9A 4F0HA 1P1LA 3Q23A 1U0HB 1HYSB 4AYBD 1RTDA 3TX8A 3BYPA 1PO6A 3R5JB 2C2NA 4CM2A 3W9HA 5AJ3J 4M94A 2VFUA 1JLCB 3DDKA 4NASA 2M70A 4URQU 3KHGA 2QLBB 1JB0C 3P6YC 2QIFA 1UA0A 2HQCA 3ZZRA 3OT9A 1R6YA 3BKTA 4X4RA 1Q7LB 1KONA 2ZH2A 5LOQA 2K3KA 2E5IA 4RW7A 4LSNB 1HWUA 3MR2A 2YKMB 3PRBA 2LKZA 3KUHA 1EZZB 2HMIB 4OHXA 1PJ6A 2V2ZA 5KG7A 4ID5B 4LRFA 4OX8A 2GMLA 4PYAA 4ECVA 3OFGA 3X3UA 4QJVA 2ZOFA 1W7WA 4GO5X 4WE1B 2FB0A 2F4VF 3Q89A 2RQKA 4CLPA 1UFWA 2E44A 2YY3A 2Z2YB 3KK2A 1YKWA 2M9KA 4NWBA 5IM0A 3H7HB 4BWMA 4IOCQ 2XI3A 4C8KA 2IMWP 2CPDA 1HNZJ 4TYAA 1F5BA 2AYGA 1I94J 2OHDA 3OPKA 4IOAQ 1N52B 1SPBP 5F3ZA 1TL1B 2CQIA 3QRRA 1H7XA 2DKOB 5CD4A 2KXHA 3OFEA 3EX7B 2XULA 1NEEA 1YDLA 4RJVA 4ZN3A 2MQLA 5A2QU 4YOEA 3JSMA 1NHVA 1VQ5S 3GCWP 2HGMA 1B0TA 1SJQA 2R3VA 2YH1A 1AZSA 4HYKA 1J5OA 4CT8A 2IBKA 3QGIA 2QN6B 4LR9A 3RAXA 2LA4A 3H90A 3IA0A 2RU3A 3H59A 3MCNA 3EPIA 3VZIA 4CLUA 1SKSA 3BB5A 1VBZA 3RRGA 2LVWA 1LW2B 3RB0A 1UPMB 1WDTA 4FS1A 2GCFA 1EJ7L 1OJ4A 4A8YA 1HARA 2ZE2B 4LFCJ 2F9JA 1HWIA 2F1FA 3VF0B 1WC3A 3HXMA 4NXMF 4TU8A 2IYGA 4IFYA 3G87A 4JI3J 1S1UB 3M6XA 4ES3A 4YR3A 2Q66A 2GQQA 5E7OB 4DPTA 3PKYA 1YGYA 1FRXA 1D8YA 4H4KC 3VGTA 1YJUA 3BGRA 2YVSA 3O3LA 3JAMY 1DBDA 1NNDA 2LEAA 2PC6A 3Q24A 1MROA 3BO3A 1X4EA 1EETA 2BV3A 3CJ8A 2ZC4A 3E3XA 2EI5A 2RQ4A 3IRXB 4IG3B 4YR0A 5J2NA 2IDLA 5LL6d 1IM4A 1N0VC 2G2YA 4J91A 1UEUA 1TL3B 1N48A 4PWWA 2MLZA 3VAFA 2OMLA 2ZD1B 2RF2B 2DCUB 3JQJA 3Q2SC 4LJMA 3VVUA 2AIRB 3CJ3A 4J9PA 1ZTWA 3DYAB 4OI0A 4UZBA 2R8JA 1TR0A 3DRPB 1M90T 4DV1J 4KPYA 1WHVA 4CTAA 3QAEA 1IKVA 1V9OA 2ZJPQ 3RB4A 2KDOA 3TA1A 4CP5A 1BWEA 5J2QA 1SH0A 2Z4PA 5I42A 3I9V9 4UOGA 1XNRF 3MM9B 3MR6A 3R7SB 1G7CB 2GMJA 4RZRA 1TUVA 2W25A 1LFWA 1Q5YA 4FPIA 4YQWA 2X3GA 1RT6B 4QPTA 2KT3A 5GAGU 2A1BA 3W8PA 4X66J 1OQ6A 4KY3A 3TNVA 2MMYA 3BBCA 3WZ0A 4DZ6A 4XIUA 2GGPB 4P10A 5LMUJ 4Q2LA 1Q8KA 1QJHA 1FKOA 1UW9A 1IWGA 1WKKA 4DR7F 4C6AA 1PJ7A 1U6ZA 1FD2A 2LQJA 4DU8A 1HFEL 4M95A 2D9OA 2CNOB 3HVWA 1NCLA 2H3EB 3MFIA 3VAKA 2DB1A 3OBIA 4O3OA 3D3BJ 4M5KA 2V8DA 3KMSA 2ZNYA 2R2UA 3UCUP 5B09A 1NJZA 4PWDB 3BN4A 1S77D 5HROB 3KG0A 4V19J 1F60B 2OO4A 1IKWA 4D3HA 1SH2A 5EHHA 2FLPA 3ENVA 3C14B 3HHLC 2KU7A 3DI6B 1KLNA 4PKDB 3VGSA 2E5JA 1U2CA 2AEFA 3GFYA 4P2MA 5HO4A 1U0SA 1RTIA 3NGTA 4V1Ak 5I3UA 1CS4B 1R8CA 3LW5C 4OZ5A 2ZH7A 3HLUA 4CO0A 4DV3F 1MU2B 4C8OA 5HI7A 1OYDA 2LEBA 2VBZA 2HNDB 1Y5IB 3M2RA 2B9EA 5B0BA 1H98A 2OP5A 2AX0A 2E66A 1RAIB 4ECSA 1Y00A 4RU9A 2OEJA 4O0IA 1BUXA 4U67Q 1NK0A 1IBLF 1N33J 3OTCA 3WC0A 1CULA 3D4JA 1H74A 2UZAA 1XR5A 2HHPA 1RTZA 4J9LA 3KK3B 3AA9A 1HPZA 1JLEB 1VMBA 3RRKA 2RDDA 1TQLA 5DG9A 1VJWA 4AQYJ 1HR0F 2KT5A 4QZVB 1RGVA 4IFVA 4JI0F 2VG7A 2OPRB 2IA6A 2RMLA 2K1RB 2YKNB 4BHQA 2DR9A 4TY9A 5HJXA 4DXLA 3G6VA 1OY9A 1FRLA 1EKRA 2QL5B 4LBPA 1S9EA 2ZBIA 1S9GA 3AFGA 3QNWB 4F2RA 2HEKA 2VG6A 3DOLA 5MAOA 2CG4A 1NRKA 5A8RA 1ACMB 3NS7B 2YPYA 3QT6A 2VPXB 4X62F 1S49A 2VOPA 1MG7A 2DHXA 3ULHA 1U7LA 3LAKA 3ZO7A 2ZOGA 1NDKA 1NDLA 1R6VA 3PXGa 3RAMA 2ZC3A 3V6DA 2D74B 2HFOA 2JJ4D 2ALZA 1VISA 1NJYA 1RHMB 2QLWA 1GTEA 4DPOA 4MKAA 3SZ2A 2L9WA 1HD0A 2BJ9A 4X4QA 2FYXA 2ZBRA 3M6VA 2KL8A 3MEGA 5KFRA 5HMXA 5EX0A 3LP1B 3GFXA 1FJGJ 4AE5A 4CIOA 2U2FA 3QZ8A 3C16A 1EARA 1SCJB 4I7FB 3PX0A 1S57A 2RVJA 4NLWA 5KG4A 4ZP9A 2RIJA 3T9ZA 1CQNA 4OZJA 4IRCA 4DQQA 4EEYA 3JYTB 3V81A 1ULRA 1X4AA 4RNFA 2IVYA 4OV1A 5F9LA 2MLYA 2A2CA 1Q1KA 2OUGA 2EK1A 3GJTB 5CYQA 5DDOC 3OVBA 3D3CJ 2GC8A 4HKQA 2CNKB 1P1TA 2PA8D 3IS9B 1JLFA 1VQPS 5HVFA 3S7RA 1GX5A 3OUYB 1V3SA 1C0UB 4FN5A 4XAKA 4YB1P 4LF8J 5J2PB 1S0OA 3T1HF 4ZVHA 4UQGA 3P49B 4QIWD 3IBFB 3T9NA 1KOHA 7FD1A 3ET6B 1CJVA 2MQNA 4LF5J 2DH8A 4LF7F 3LPEA 3JB9k 2A18A 2L48A 2OGUA 3T3FA 4H4OB 4NL5A 1CJKB 5DZ6A 3BPSP 2OPQA 4NYOA 1R31A 1FDDA 2V68A 5KG6A 5A0YB 2CQ2A 2HLUA 1QM9A 1S99A 1KVKA 4J9OA 1L3KA 5IWAJ 4YDDB 5M2UA 3DOKA 2XGQA 4FVMA 5E2QA 2YNHA 4MMOA 4RW6B 1WHYA 1EQMA 3MM8A 4ANEA 3NAIA 5C7PA 2RD5C 4KTQA 5A6PA 3FQLA 3DXBA 2N4DA 3B6BA 3PIOQ 2QC3A 4DSLA 4RUHA 1HI8A 2UUCF 3PIPQ 4Q8EA 4CZCA 1XJWB 4G65A 3CJKB 2MJUA 3HFVA 3AQPA 1VLYA 1FXRA 5ETPA 3VZHA 4TU7A 5ETMA 4F0KA 4AQYF 2OIHA 2J76E 3H5UA 1R3NA 2J9DE 3DM2A 2ZZMA 1D09B 1GMUA 2ZM6J 3LP0A 2LQ5A 4CQ1A 2DNRA 4CDIA 1VQ7S 5FDLA 1NXIA 2DCLA 4QYZK 2NSCA 4MYUA 2KFNA 2E9TA 2BQRA 3KLEA 1KVJA 4Y2CA 4OYZA 1N34J 4FNHA 3KLFB 4DLEA 4EMDA 4OZLA 5ETLA 4QR2A 5B0FA 2DVIA 4M5NA 4MAKA 3TJAA 4YEAA 4A8KA 3E2EA 2ZH3A 1IBKJ 5CCMA 1TL1A 2XLIA 2HGLA 3MEKA 3RZAA 2R2SA 3DLLQ 3KJVA 1KLMB 4BLGA 2R8IA 2I1RA 2IRXA 3J81U 1ROFA 4WK1A 4O0NA 2DXFA 4FYDA 4DL7A 2BX6A 5KFCA 1T9TA 1H6KX 1HBMB 1WF2A 4EK2A 4LF1A 4OYWA 1B0VA 4PPDA 1YLXA 1VRTB 3PJXA 1FKPB
chains in the Genus database with same CATH topology
2UUWA 2KFYA 3MOJB 1URRA 5D4LA 2PFFB 4LFAF 2AV5A 3O2IA 2M88A 3I0RA 3CCES 4HT7A 4I0WA 1N88A 2BA9A 4J9KA 1C2PA 3QLHB 1AUDA 1JX4A 1BLUA 2MY7A 2VC1A 4I2QA 4X4UA 3IR6B 2FIUA 4GO7X 4FZVA 2R9LA 4ZP8A 4DG1B 2J7WA 3CMES 2JZ5A 1G3OA 3I4PA 5HMZA 1T8EA 1O5JA 1YJVA 4OX7A 4IH5A 2R7SA 2OMOA 2QA2A 2VBYA 4DBQA 3JYTB 4IO9Q 4G1IA 4ECZA 2B51A 3Q8PB 4NLOA 3NNHA 1M1KT 3KOAA 3QIDA 1UETA 1SJ1A 2WBRA 1TL3A 4F3OA 1LW0B 2XO7A 2HHUA 2O01C 2Y0SD 3US5A 3QIPA 3HZGA 3DYAA 2WOMA 4WKRA 3M2VB 1IXKA 2IA0A 1FNOA 2XLJA 4YDXA 1HW8A 2I5JA 2O66A 2J6UA 2QT7A 3KNGA 4DV1F 4X64F 2DH9A 2BJDA 2FVRA 1HBUB 4EU0A 5AXLA 4JI5F 1ZETA 2ZDOA 1Y0HA 2P9EA 2IVMA 2FJDB 2FGCA 3B4MA 3C6UB 5HMWA 3K5LA 2RJZA 2XEXA 2M5YA 1LV5A 5CHCB 2PN6A 3CJ0A 4HI2A 3I5CA 2M2BA 2DR8A 3SDEA 1TVRA 3GG0A 2B4VA 3G6ES 1N5QA 2AJQA 4U7CA 2MY8A 1WTBA 3CCLS 1RTJA 4C8MA 5ADZA 4R8UA 3QWUA 3MMCA 1NJIT 2W9BB 2XY5A 3P5TL 2J0SD 2B5JA 2QEXS 1SC6A 1S4FA 3B78A 4RBUA 1UWBB 1S6PA 4KFBB 1NK9A 4NPOA 3JSRA 3N6LA 4USJC 2GW8A 4MJKA 1ZM3A 4CH7A 3NMRA 3NBPB 4MKBA 3DLEA 4DSIA 3BQ1A 2E29A 3U27A 2I2YA 4Q0BB 4DN0A 5GAEI 2AYBA 4PRFA 4ILRA 1IN0A 1XWLA 3QO9A 3G8QA 1Z4UA 4WFXA 3TOQA 3M2UA 1O51A 3VTIA 1TFYA 3BO2A 1X0FA 4RW9B 4TU9A 1RT5A 2MQOA 2CPFA 2W7PA 4NYPA 2PIIA 1QSSA 4PG7A 3VAHA 1LOUA 1LWEB 1SJ4P 1VBXA 2C2DA 3S01A 1N33F 3IFEA 4CO1A 2AJFE 3HZEA 4NLGA 4NZ6A 4C7QA 2Y1IA 3DC2A 5G4DA 5KFBA 2NR0A 2VG7B 3KHRA 1MMNA 4AL5A 2RRNA 4TQSA 4WFZA 1OPZA 4NLXA 2FC8A 2IVFB 1SQEA 2B6AB 1S9EB 2J0WA 5HLFA 1I1GA 1FA0A 3QZ7A 1IJFB 1Y9OA 3SFGA 4Q44A 1JKHA 1DJ0A 3F56A 4A8XA 1MWYA 5LJ3Y 5KFAA 4NLSA 2R2RA 5G0RB 2C3MA 1AW0A 2VFSA 3R27A 2JDJA 3UPFA 1NJXA 3FCHA 2XMWA 3HVRA 5DDQC 4ZCMA 1SH3A 2GJIA 5K9FA 1LWFB 5JVHQ 3MPWA 1Q8LA 2FHOB 5KFKA 5E0OA 1F0XA 1KQFB 5KFJA 3FSYA 4AL7A 1KS2A 2CQBA 1Q79A 2GX8A 2KJWA 1QAJA 4LSNA 2DR5A 3W7BA 1T7PA 2MHNA 3K8WA 3V4IA 4WYLA 3VAGA 4TYBA 1UVNA 2WB4A 4NLPA 2DO4A 1X4CA 3DXSX 4ZPVR 5I3QA 1VRUA 1FTRA 2AJ1A 3C46A 3DFEA 1U1NA 2VZ9A 2PMHA 1CVJA 5HBMB 1EP4B 2FHJA 1U49A 3OQ2A 3GFHA 5SUHA 3S6EA 2C3YA 2J6SA 2J6TA 4KGMA 4N8NA 1KOOA 2EKYA 4ZK7M 3UCZP 1YITS 4PXBA 3H2VE 1B0PA 1TKXA 1WNEA 3NNCA 4K59A 3EYZA 5CA5A 4ZP6A 4RKUC 2VONA 4J9SA 2UUBF 4QW9A 2RH3A 4PXDA 2WAQD 3K59A 3N0VA 2JLEA 1CQMA 1GH8A 1XNQF 2BJEA 5D3GB 3QJPA 2DD8S 4CNZA 2ASDA 2GQ2A 2HFNA 3V5RA 3V6JA 2BACA 2CPYA 2ZE2A 3S1TA 5JJBA 1HMVB 1FRJA 4LFBF 1DLOA 5IXUA 4IFYB 5HP1A 4I6AA 3CD0A 1ZM2A 1OS5A 3MMBA 3AHPA 2HFZA 3BSOA 1BQNA 3MECB 3THVA 3NCRA 1AXQA 3NRBA 1NK6A 1RTHB 2BBEA 1UVMA 5J2NB 5F9NA 1VQMS 2FDNA 4C0OC 3BR8A 2FLNA 4OZ0A 5CQGA 1H38A 1CEZA 2HNZA 1YVFA 4I4BA 1N34F 4HTJA 2V9WA 2IM3A 1RA7A 1XC9A 2ZD1A 3CDWA 1F9FA 2WONA 4K4VA 1ZBTA 1TAQA 1NH7A 4OI6A 4B08A 4CTAB 4QQBA 1SJFA 2QSWA 3BREA 2E5LF 1FCAA 1FKPA 1C1BA 5KFYA 1LQ9A 5B0EA 2CJQA 3GWCA 5KFSA 5KFIA 2HHXA 2PE8A 2RQCA 2XSFA 3PRDA 4O4RA 2N3OA 3PVXA 3UD4P 4FPRA 3J7A1 3FZ2A 5E41A 5IT9Y 3T6JA 1RP5A 3N6MA 2IJNA 1O0PA 2LDIA 1SV5A 1RI7A 4HLBA 5E5NA 4D3GA 3NCPA 2DIVA 3Q24A 1U4BA 4AXJA 4N5SA 3PR5B 4ZDNA 3OTEA 2HG4A 3M30A 2BRKA 3OLAA 5K5MA 2F8HA 2KJVA 4NA3A 1HNWF 2DGOA 1AFJA 1GX6A 1OWXA 2AW0A 4P7TA 4IUFA 2UUTA 1Q4RA 2HS0A 4PWDA 2NZ4A 1LW0A 2VBXA 7FDRA 4A8MP 1RT2A 4DR5F 1FJEB 4IO1A 2BZ2A 4ECWA 4BBYA 2XC9A 1VC0A 3DI6A 2GFFA 5F8MA 2WOMB 1KFSA 5IFMA 4RX6A 3GIMA 1N5VA 2EFGA 2FJAB 2DNYA 2XI2A 5I3UB 1Y7PA 1TKZA 2RS2A 4MK7A 3VWSA 3E01A 4OJ1A 1YIJS 2V8GA 3M2RB 4YB7A 4ES1A 2CVEA 3BR9A 3ICLA 3DU5A 1UW4A 3V2UC 3C6UA 2JC0A 3RB6A 3IRWP 5CYJA 4ECYA 4ZP7A 4I56A 4NCBA 3KLGA 1TVRB 4G1PA 2KM8B 2DNZA 3KK3A 2L9DA 3ONQA 1YJ9S 1N5YB 3BDPA 2Q3PA 1S1WB 4QR0A 3BDEA 1Z2ZA 2OPSA 4ZMMA 2QE5A 4FXDA 4DL2A 2AX1A 2M7SA 2RSQA 4NXNF 1YG0A 1D9AA 3I5BA 3KHHA 2G13A 3TVYA 3NP5A 2VQFF 1P27B 3DLHA 4EZ9A 5A8RB 2XB2D 2WB1D 2WHOA 1TK8A 3MEDB 3C2PA 4C8NA 5AE1A 2QZ8A 4LF9F 1GXLA 4B9SA 1P9QC 2XHWA 4OI4A 2IM0A 1Q86T 3NCQA 3M8RA 4DFPA 2C22A 3MAQA 2FC9A 2DNNA 1UA1A 3GYXB 2B4UA 3S8SA 2N82B 3I5AA 1KHVA 2VFTA 1LWCB 1RT5B 3FRYA 3ISND 4JV0A 2UU9F 2BXJA 2YWHA 4ICLA 4YFUA 4AL6A 1X9MA 2JEIA 1S97A 2AU0A 1B7FA 4L72B 3I0SB 2R7OA 3ZZOA 4ECRA 4FXVA 1RT7B 2HWTA 3A8EA 3HHLA 4DR6F 2CDQA 4ES2A 4A8QA 1NK5A 5CYQB 2CZVC 1FK9B 1WHXA 5IT0A 1JXEA 2DJWA 4X4SA 5DQIA 2VV5A 5D78A 1D9FA 1XEZA 1C0UA 2VBWA 1HNIA 2DIUA 2E1CA 4RWXA 4DV7F 4I2PB 2GQCA 4DV2F 2OAUA 4NLUA 3TAMA 1A7GE 2V9KA 4NYZA 3UFCX 2HYIB 1KTVA 4BWJA 3HKWA 4WZMA 4K4XA 3I56S 2ZZNA 3DLKB 5EWEA 1YI2S 1FRKA 3MM8B 5K14B 1H7WA 2VKRA 1FDBA 3C66A 3AQOA 1Q78A 2DHGA 4R25A 1ZZFA 5IQQA 3D5MA 1N54B 3CJKA 4DL0C 4QWAA 3SV3A 1X9SA 3SCKE 2E7XA 5GAHU 5D4NA 5EX3A 5CXTA 5CYMB 3DM2B 3SYZA 3V4IB 5J1EA 3SEOA 3GB0A 3KWMA 2RKIB 4LF4F 2LA6A 5CZVA 4FF2A 1TKTB 4ECTA 4QU7A 1E6VA 1FERA 2DITA 3DRSB 3KYLA 2D3ZA 2B56A 4JI1F 4YY3F 4R5PB 1IBKF 2RRBA 1NAQA 2DGWA 3RU0A 3G8TA 2QRRA 3K5OA 3N5FA 3Q0AA 1VK3A 4NLRA 1SUQA 1ZAVA 3MGJA 4ZLPA 3MM6B 3BS9A 3GSDA 4EGLA 3POTA 4ETZA 2FD2A 4OZNA 2IAJA 1HBMA 3I9ZA 3CIZA 4DSFA 2K3IA 1X4BA 2YNGB 2DNLA 2MKCA 3M8PA 3H2UB 3THTA 2PMZD 4O3NA 4LF6F 3CULA 3HPOA 3OL6A 3N9UC 2PI4A 2DGVA 3MWBA 3M32B 1D9DA 4O3QA 1TL4A 3QGPA 6FD1A 5IZHA 4UY85 2F9DA 3THPA 2MQPA 2HQ3A 1OSDA 1PC4A 2DRBA 2WRMA 2NREA 2CQPA 3LP2A 2ZJRQ 1YJTA 1YRUA 1HL6A 2Y1JA 1NH8A 1TV6B 2MZQA 1NK8A 3BSAA 2IRUA 4B02A 3CIMA 2MDAA 2VUGA 2FHMA 2V0NA 3SSSA 1REVA 2XG8A 1IUJA 4LT6A 4USIA 3I32A 3I31A 4WZQA 2DNGA 2RDIA 1G2EA 5F0UA 5KFEA 3EZUA 1HHTP 2QO3A 2ZH4A 4OI3A 1R0AA 2KH9A 3DLGB 1Q8BA 4IDKB 4TKTA 2F3JA 2CIMA 1XERA 2L08A 1GXUA 4I6WA 2R7TA 1RT3A 2MQQA 5IM0B 5BJRA 3R1HA 5F8IA 1XMOF 2RE1A 4DX8H 5IT4A 3DU6A 5A2QY 3DLBA 4F2SA 1RWUA 1L3VA 4XO0A 2W9BA 2MGZB 1WEXA 2VASA 4FBUA 2ZM6F 1XBWA 1C4CA 2B5JB 4PG6A 1DTQB 3ENQA 4C3LA 4ZHRB 4DDFA 1Y5NB 2GIRA 4RUCA 4NCGA 4O44A 5AXMA 1QLNA 2B4PA 5E3CA 3M9MB 3D0IE 1I6JA 3ETOA 2B9YA 2JLGA 2ZHAA 3HHNB 1TKZB 1DFDA 2B9XA 3M8QB 4TLQA 2EK6A 2CPEA 2LLZA 2PD1A 2NPFA 1NK7A 3R5BA 3V6HA 1FESA 1WD6A 3MF5A 1JLQB 1QSYA 2EFNA 3UR3C 3K5NA 3OV7A 1VQKS 2ADCA 3N28A 4IR9A 3KLGB 5FLXY 1S1VB 2AF6A 2VC0A 3OXFA 1N4LA 2F40A 2BM1A 4F4XA 2IJFA 3K57A 1IR0A 3MD3A 3OL9A 1A9NB 3O44A 2UP1A 3ZZ0A 2PT0A 2N7CA 1SKRA 4BS2A 1FE4A 1H2UX 2DPIA 3FGVA 3SCIE 2DRAA 1HWJA 1AFIA 1FKAF 5KFDA 5HLFB 2AQ4A 2CQ0A 4ZPBA 4RU2A 1KRPA 3GIJA 1JKHB 2JVRA 2IC3A 5H9FJ 3BSNA 4PQUA 3MEDA 1DTTA 3UDCA 3CUNA 3L7PA 2J5AA 3N01A 3QMQA 2CJBA 3GR0A 1DQ9A 1RT6A 4ZVEA 2ZVSA 2BW2A 4I69A 4MIAA 1F2GA 4B3MF 4DQIA 1FF2A 3M8SA 1VC5A 2H5EA 1LWFA 4FVCA 2PGCA 2BE2A 1X5OA 2QYCA 5CCLA 4HDGA 4XDDA 1LWCA 2CPXA 3GIKA 5L1JA 3QJLA 2OSRA 5EUHA 2V8HA 4CO2A 2VOOA 4PXEA 4DF4A 4C8YA 1CC8A 1MW7A 4M8LA 3ISZA 4JI8F 2C3OA 2NPIA 3GV5B 3HMJG 2M3DA 4ECQA 1FK9A 4F26A 3U1LA 4WYWA 1HQEA 3CD5A 3R5DA 1QE1B 2ZNZA 1HNIB 5HBMA 4Y2KA 1FDAA 4WXOA 2IHR1 2ROEA 4AFFA 1Q82T 2BOPA 2CQCA 5KFOA 4PUOA 4EZ6A 1IKXA 3HI9A 1H2TZ 1FJ7A 2F8EX 2RS8A 3AJ2A 3FZBA 4NRTA 2DR7A 4O3RA 3NLCA 4G1QA 3VQTA 2X1FA 2IMOA 5LXRA 2EBGA 2NYIA 1RAJA 3LQVA 4KIAA 5CH7B 3CCVS 4DQPA 3CCWA 2MSTA 4JI7F 1X5SA 4P2SA 1U2FA 5C24A 1JNRB 2FJVA 1W2IA 2D3UA 4IYQA 3VAJA 1WG1A 1JLGB 3PY8A 2AWZA 4TXSA 4C97A 2ILZA 1ZPVA 4B17A 2CQ4A 3PW0A 5HP1B 5LSRA 2E5HA 3DRYA 5J1EB 4B9MA 4FNIA 3O6QA 3ISNC 5AXKA 1BQNB 2P5VA 2W24A 3IBWA 2JHEA 2XNQA 4GC7A 4PPZA 3TRGA 4CH1A 2MJNA 3SXLA 3IWXA 2HNZB 1N5SA 3BN7A 2EFVA 3BJYA 3LOUA 1HQUB 4CO5A 1JLCA 2WONB 4ED2A 3HVAA 3POTB 1SIWB 3OLBA 1SL0A 2ATLA 2RB7A 5M2RA 2LQBA 5K8PA 3LWMA 1UJ4A 2W8KA 4DV4F 1NU4A 1WWHA 2DHSA 3TW0A 1U47A 5IWAF 4F4WA 1JLBA 2YKPA 3CCMS 3K8VA 2JLFA 3GV8B 1N56A 2AD9A 4ID5A 4F4ZA 4E8UA 2HHHF 5CD4H 2QSFA 3QYYA 4URGA 1M5SA 1S0VA 1JLFB 4PUOB 2R2TA 2PA3A 2ZH1A 4K4SA 1RISA 3I87A 5CZXA 3SSQA 3EGWB 4QWCA 1E6YB 1BY9A 5C25A 4F8RA 2X1AA 4JI3F 4RUAA 4U7UK 4B9VA 2XY7A 3CDBA 1IQTA 4YR2A 2VPZB 4N77A 4KQZA 3OSNA 1PSDA 2B43A 4N8OA 1YTYA 1HHSA 4TY8B 5GVQA 4OJGA 3RW6A 4HTIA 3MI7X 4WFBQ 3DHXA 3HHEA 4UY8T 1J5OB 1UFLA 3PO5A 2L3MA 4OMFG 4HHJA 2FVPA 4J9MA 3IAM9 2HHTA 2MYFA 3MDFA 1SJ3P 1CC7A 4RNNA 3IGNA 4C0HA 3K5PA 1DQAA 3EXYA 3CEDA 1TAUA 4BCAA 1TKDA 5SZTA 2UVWA 3X1LB 2ILYA 1L3TA 5DRKA 4QR1A 1FRHA 1S6QB 5KG2A 3E01B 3Q8QB 2R7VA 1D8ZA 1KHWA 2BVZA 2W7OA 1KNZA 3PW2A 4LMZA 5IS2A 2B3TB 4Q7AA 3UD3P 3KLEB 3FFIA 2LU1A 2KRRA 4DR2F 3MURP 1T95A 1VBYA 4DQRA 4JI6F 3TI0A 1VIXA 4NCAA 4OJ3A 1MMDA 2XMVA 4DJBA 4F67A 1T02A 2MQMA 1AROP 4NZ0A 4UUWA 3GQCA 2JVOA 3CWJA 2MGZA 1FVSA 3M1VB 4NLQA 5B7WA 4U6PA 3AY0A 4DUYF 4ZPWR 4O3SA 2I38A 1FO1A 1SIZA 1VRTA 3SFUA 5I42B 3CE8A 5DG7A 2XCPA 1ZAXA 3MM5A 1JJHA 1R43A 2ZH6A 3G71S 2ZFHA 2DK2A 2EFPA 2JOQA 2K2PA 3ZZPA 2EWHA 3GE9A 4DL3A 1OSCA 4I2QB 4WFNQ 2CQDA 2HZCA 3KK1A 2FY1A 1VQ6S 4OL8A 4KV8B 1S1TB 3IC1A 3N4WA 4NZ7A 4ETXA 3JTPA 4IRDA 2JRSA 3KNAA 1JJ2R 4H4MB 3NL0A 1OPIA 3OL7A 2X1BA 1DAXA 2L41A 3MAHA 4IQXA 3J7Z5 1UVLA 1JXLA