4UY85

Molecular basis for the ribosome functioning as a l-tryptophan sensor - cryo-em structure of a tnac stalled e.coli ribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
148
structure length
148
Chain Sequence
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L32
publication title Molecular Basis for the Ribosome Functioning as an L-Tryptophan Sensor.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uy8501
3A1YG 5GADI 4NWBA 3JSYA 5GAEI 5GAHI 3J7Z5 3J7YI 5D6GA 4UY85 1ZAVA 1ZAXA 2QA4G 5GAGI 1ZAWA 4V19J 5D8HB
chains in the Genus database with same CATH superfamily
2C3OA 4A47A 4TU8A 1PSDA 1XEZA 1S77D 3QLHB 2ZJQQ 2DY9A 3QRPA 1X9MA 4G1PA 2OMLA 3IM9A 5E3AA 5D0GA 3R7NB 5LJ3Y 1E6YA 3LGHA 4YMEA 2BQ3A 1LNQA 3EPGA 2OPQB 4WPAA 5J1EB 3MECA 3CDBA 1RAHB 1T02A 3KK1B 3HZEA 4E8UA 3ILJA 3DRRB 1ZPVA 5IS2A 2UVRA 1FD8A 2HHVA 3KLEA 4DS5A 4NLYA 2MKSA 2BANB 1U1KA 2GA7A 1U0HA 4NLTA 5D4NA 3RW6A 1JMTA 1N54B 1WKLA 1Z2LA 2IY5B 4DF4A 1IXKA 1U6BA 4FF1A 3OXLA 2Y1IA 3OUYB 4DFPA 2FVRA 3AOCA 3QJPA 4W90B 3MCMA 1D0EA 3OTOF 4KKOB 1YSJA 3GSDA 2V8VA 3PYGA 3BKUA 3LANA 4RW4A 3CO9A 4DCPB 1D9AA 4Q7AA 2YQ1A 5DG9A 1P9YA 2FQQB 2ZOMA 4EEYA 1QTNB 3B82A 5GAEU 2K7JA 5GADU 3CJSA 4CP5A 1U24A 4USKA 1RT4A 3QRQA 2BRLA 1SUQA 5JVHQ 5DQHA 2XGPA 1FO1A 3QQCD 1FNXH 3NG8A 5KFQA 4UOHA 3UD3P 5KFLA 2ZEJA 2IPOB 4IR1A 3PX4A 1HNXF 4UOFA 3DLKB 2ZZMA 3R27A 1JLBA 4ZJQA 2HHSA 3MD3A 2EI5A 3CC7S 2R8JA 2Z2ZA 4ATNA 3V6HA 3RRHA 5HANA 5B09A 3LALA 1RB0A 4DSFA 4B3SJ 1DTQA 1WC0A 1KHVA 5DLGA 2GQQA 3EXYA 4A8MP 1WSRA 4NLOA 4G1QB 2EW9A 1SJQA 2CQIA 2ZWOA 2OSQA 2ASYA 2GZOA 4X64F 2XCPA 1HL6A 1C0UB 4DLEA 1QAYA 1RAGB 4LRAA 4KGMA 4UZBA 2JOQA 4USHA 1BY9A 4PWDB 3CCLS 2HYIB 3MM5A 1PBAA 3GFZA 4EMDA 3DYAA 1FWKA 2HVZA 1FEEA 2ZITA 4K5SA 2FVSA 2CG8A 2AJ0A 3D6TB 2V68A 1FXLA 2VFRA 3MUMP 3W2WB 3ET6A 1YKWA 2J7KA 2AZ3A 4DSIA 2Q66A 4QR1A 3FMWA 3QGIA 4WIIA 1PBUA 2MTLA 4M5KA 3AXKA 2LFVA 2JWNA 1YQHA 2OPSA 1A9NB 1IKYB 4X66J 3G87A 1JLQA 4NMLA 4KGKA 4QWBA 4K4XA 2MY8A 4M5MA 1RT1A 4A4JA 3UPFA 2V4QA 4MYUA 2EFPA 4M5IA 4CLLA 3PO4A 3R5JB 1IR1A 2AZ1A 4K8RA 4FS2A 2HFZA 4XPCA 1UFLA 4KV8A 1RT3A 1S6UA 2WONA 4ETXA 4ZK7M 1Q82T 3WDOA 2LXFA 4ALZA 1RT6B 3A8JA 2MLXA 4WCEQ 3MEGB 1VC5A 4CTAA 1HYSB 3ZTQA 3H98A 5IV4A 3LWLA 1SV5A 2ZH4A 4U7CA 1EKSA 3M8PB 1NZ8A 1PO6A 2XYPB 2QO3A 1EP4A 5CHCB 2XQCA 4NLSA 3HSJA 3LW5C 1VLOA 2XZTB 2GMLA 1F5BA 4LR7A 3DI6B 3TZWA 4RUBA 3R5GA 5D3GB 1S9GB 2VQEF 4R8UB 1N48A 2R2SA 1JKHB 3PR5B 3OR2B 1FE4A 1FJGJ 3EGNA 5DRKA 2CA9A 5KFIA 2O3DA 1HI1A 3VGVA 5GMDA 2FHJD 1ZETA 4QZVB 3CXCR 1ULRA 5BYQA 3UNGC 4ZVQB 3WQPA 2YXLA 2F4VJ 4CNYA 1PJ5A 4C8NA 2COLA 3AY0A 1ZM2A 3Q8PB 1TV6A 1LWFA 3UFCX 1UVMA 2PE8A 2EWHA 3T41A 2QFIA 1G2EA 2OD4A 5KG6A 4RO0A 3K8WA 1FKOB 5M2PA 4NASA 1KTVA 5DETA 3QAEA 1FXRA 5E3CA 1JIHA 1T11A 3WIVA 2M4MA 5LL6d 1I5OB 2K06A 4YB6A 2B56A 1N36J 2DRAA 1SC3B 4PKDB 2CQ3A 3TUJC 2IM1A 1U45A 4B02A 4DUZJ 1AT1B 3N28A 1WDDA 3RAQA 4KQZA 1ZH5A 2HNDA 2VBWA 1PGZA 9ATCB 1UKUA 3WX8A 4HEA9 1Q79A 4E2FB 3GV5B 3CVKA 5J2NA 3HD2A 3QO9A 4OJHA 3UW1A 1HHQA 4O4GB 2KDOA 1KR4A 2V2ZA 3D1OA 1F60B 5B7WA 4B9LA 2QG9B 2DR7A 1YRUA 1JXEA 3O44A 3J7YI 1Q7YT 4PXBA 2XS7A 2HIYA 4YEAA 2W8LA 1SIWB 2MJNA 4DR6F 1HQUB 2OH2A 4KSEB 3KDNA 5DQIA 5F9NA 3SMZA 2H4YB 2X51A 3TAMA 1CULA 1BQMB 2VUGA 4EBDA 2WVDA 4ERDA 2H5EA 4WIQA 1NPKA 5EDWA 4U8VA 2MSTA 1ZS6A 3QSIA 1NRKA 2O66A 3IMQJ 1X4CA 2RF2B 1B3TA 1LK7A 1GEHA 3BH6B 4ZPCA 4NYOA 2XO6A 4MKYA 1XNQJ 3DRPB 1S1XA 3VQTA 1HKAA 3MTKA 4R25A 3Q23A 3DM2A 4DX8H 1LWEB 1U1PA 1JLCB 2K2PA 2BUNA 1UVIA 2RSQA 4YB1P 4FF4A 2AHOB 1CJKA 3KLGB 1C1CB 2CQPA 4RUCA 4X4UA 1VRTA 4HHJA 5KFFA 2I38A 2LXIA 8ATCB 2XMKA 2OP5A 1GT8A 1VHFA 1YJWS 2IDEA 1JK9B 3QATA 3PYEA 4WE1A 4O3RA 1HQEA 2O1PA 3C16B 4USUA 2CG4A 1N8RT 3V6KA 5IXUA 1REVB 2PA3A 3OL9A 3M7VA 1D9DA 1ZBTA 3RBXA 2XY6A 2DH9A 2UXBF 3OFHA 2I5JA 2XHWA 3L7OA 1TMMA 1URRA 3EVMA 2YKNB 4DWIA 4DUYJ 3DGPB 3OHBA 1RTDA 3BYRA 4JI8J 3GJSB 3NEKA 4FF2A 2EBGA 1RE1B 4ZCIA 5CYMA 4I68A 3G71S 2ASDA 2UXDF 3IM8A 2R8GA 2HWHA 3ENAA 2BYCA 1RHRB 3NS6A 4NLQA 3HHKA 2OPRB 3OVBA 4NXMJ 3CTRA 3M32A 3QFWA 1FK9B 2XWXA 2QTWA 2EFNA 2RRBA 2Q43A 3IR7B 2VBYA 2GW8A 1UFWA 4MKVA 4QIFA 1YZ7A 2UUWA 2XGQA 4KJIA 1N6QA 3DMJB 2KG1A 2W2OP 4JP8A 4B3SF 1Y7PA 2HWIA 4MKAA 3GMGA 4J9QA 4N76A 5CZXA 2DCUB 3P6YC 1X4BA 1RLCL 3W1YC 5B0AA 4PPZA 3TQEA 3CCMS 4Y2IA 2ZKTA 4ES3A 3NGTA 1DBDA 2E1CA 5D0RA 3D4JA 2HFVA 4I4BA 4NZ7A 1CQNA 3EVWA 1XWLA 1Q78A 3GB0A 2DHSA 1R31A 1F9FA 2PMHA 5AJ3J 4CCHA 1IWGA 3CNQP 2W9BB 3GWCA 4ZDNA 3VAIA 4FS1A 3NKYA 3KHLA 1X5SA 3AB4B 1S12A 1QAIA 3KK3A 1IUJA 2DNOA 1U6ZA 2BRKA 1WC6A 2E1AA 1VHIA 1U8SA 3BREA 1H6KX 4PRFA 4KHMA 5DGAA 1SQFA 5A8WA 4ZHRB 4ZPBA 2V50A 1URNA 3MCOA 3PZPA 4DL3A 2RUSA 3JSMB 2Q6CA 4X66F 3CCTA 4QWDA 3HP6A 4DL2A 3JSBA 3DGVA 4M5HA 4ZVTB 5IC4B 3M6XA 2YKAA 5LMUF 1VQKS 4NLXA 1SJ1A 5L1LA 4DG1A 3AJDA 3TZYA 1RHKB 4IFVB 4DCJB 1AB8A 4F25A 2PA8D 3ZZPA 4L76A 3RB3A 1YDLA 2E29A 1RYRA 2KB2A 4CQ1A 3QJJA 2IJFA 1RA7A 3QSYB 2GHPA 1Q5YA 1QAXA 3C6UA 3OLAA 2DJWA 3U7JA 1RAJA 4CZCA 4CO1A 2R2UA 2DEIA 2FJAB 1HPZB 2KYZA 3ILIA 5A2QY 5LJ5Y 4RNMA 1YJNS 2V67A 2QZ8A 2XMTA 1S0NA 1YI2S 2DCLA 3G82B 3BS9A 3OJUA 2DHAA 5T14A 1I94J 2KM8B 3K7RA 3UR0A 1VBZA 2DHGA 3NGSA 1FJGF 3CD6S 3CJ5A 2XHCA 4M63A 1Y9OA 2FGOA 3DDNA 1W26A 2Z57B 3N4WA 5HVHA 2IA0A 2GVZA 2XG8A 2HZAA 2F4VF 1OYEA 3FFIA 4BWJA 2KXNB 2RU3A 4KGZB 4UY85 3AA9A 2DR6A 1EQMA 4ZPVR 2VASA 1VRQC 1N5YB 1UTAA 2ZE2B 2FZCB 4I2QA 4KFBB 1IBMF 3DDKA 2ZHAA 4ZPDA 1JNZB 1KFSA 1FDAA 1EIYB 3G86A 3IN5A 4H4MA 3BBCA 3MM6B 1Q86T 1TTHB 1TKZB 4C0HA 1HNZF 3BQ0A 3IC1A 5HQ8A 2BEFA 4JUZA 4LF9J 4C3LA 4LF6F 4PG4A 4MAKA 3HHLB 2E5LF 4DR1F 2J9CA 1IKWB 2HMIA 1KEKA 1S6OA 4K4ZA 2VKZG 5M2UA 1IKVB 2DNGA 2LYVA 4A8YA 1IQZA 1LKZA 4BC7A 3EJMA 3TA0A 2X3GA 1UVNA 3LP1B 3HHNB 4ECWA 4ZIVA 1BLUA 4GKJF 4XPEA 1K0TA 2WVFA 4OV6A 2I1RA 4Z2XA 1UWBB 1KTQA 2MGZB 4NA2A 3M8SA 4DV1J 2RILA 3MTJA 2IYIA 1GMWD 4KHPF 1O5JA 2LLZA 2V69A 2DKOB 1RWKB 2J9EA 1RSCA 3CIMA 2KJVA 3MOJB 4IRKA 2WSCC 1SH0A 4KBIA 3MUVP 3HXMA 1S97A 2F9JA 4PWWA 3W9HA 3IS9B 3CJTA 2D3O1 5DG8A 1ZYQA 1KD1T 1W25A 3QT5A 3DLEB 5J1PA 4OLPA 4A48A 3UQSA 1CJTA 4ZP8A 2Y9HA 1QUVA 2DH7A 4O3PA 2GIRA 4IRDA 1WC4A 3KLHA 3A3NB 4WFNQ 1NO8A 4OYAA 4IRCA 1XR6A 1APSA 3MMBA 4B3TF 1M5VC 1ITPA 2GGPA 1NKCA 3AA8A 2Z2MA 2E66A 3GJRB 4RNFA 2L08A 4L73A 1ICEB 1RTIB 4CDIA 2VC1A 3QLHA 2P2CB 3I0SB 1M5OC 1NK6A 3EVOA 1XC9A 2CNOB 5HSPA 2MKYA 3HT0A 1ZA2B 4ILMA 2JL9A 4I2PA 5HAOA 2K8GA 5E3RA 5D4OA 2OPQA 2DNRA 4O3OA 4DR3J 5J1EA 4ZVGA 2B9XA 2HHUA 1TK8A 5CYQA 1DAXA 3GFHA 2K3IA 2V0NA 3KKFA 3UDVA 1HI8A 2UVUA 5I3PA 1YWXA 4P10A 2N7CA 1FTCA 2EPIA 2EK1A 1YGYA 3IG1B 4PPDA 2GVDA 4OI0A 3HLUA 2QX0A 1SVDA 2C3YA 2CPYA 2LA4A 4FNHA 4LSNA 5T7LB 1DQ9A 4BBYA 3OUYA 4NZ6A 3M8YA 3OL6A 5THWA 2UXCF 1ZTTA 2XWYA 2V4JB 4M8LA 4Q2MA 5IT9U 2BZ2A 2ZDOA 1Q7LB 1PC4A 1B64A 5IT0A 3G8QA 2X1FA 5HN0A 2IRXA 2ZH9A 3QZ8A 4GO7X 4H4OB 1T9YA 2DXDA 3BGRA 5KFSA 3ZZRA 2W9AA 2EFGA 3MHYA 4YHHF 2WBRA 2LKZA 2Q1LA 1QDUB 3I5CA 1U2CA 8AT1B 3BN7A 1XMQF 1OSDA 1X4AA 4R5PA 2JSXA 4PABA 3UVJB 1MWQA 3X1LB 3HSDA 1B0TA 3LUYA 1YLXA 1C1BA 5HBMA 1AZSA 1NAQA 3M9MB 1ZZFA 3DLKA 1RHUB 3E8OA 4LFAJ 2KXHA 2ZC3A 4OJGA 4RX6A 2MZSA 4OJ1A 2NXUA 1UA1A 1T9VA 3UI3A 4F2SA 2L9DA 2DR5A 1X4DA 4C6AA 1FKPB 4L75A 5C24A 2CAJA 2LP4A 2JX2A 5EN1A 5AJ3F 1MNEA 4OYPA 1ZA1B 3HK2A 3AB2B 5CH7B 1R0AB 4GKKJ 2NUHA 1C0UA 1LWCB 2DNNA 3JQKA 2YPZA 3I82A 1EZZB 3OD2A 2GIFA 3R3TA 3BGLA 4OX7A 3MM9A 2EBEA 1RWPB 2OFGX 4LF7J 1GMUA 4NCGB 2Z58B 3KHGA 4ECRA 3ETMA 4LF2A 1HW9A 3JQMA 2QMWA 5LM7E 2OO4A 4ZLJA 5CYJA 4ECTA 2FVQA 3W2WA 1U47A 2MDAA 3H8YA 4CNZA 4KGVB 1VRUB 4MIWA 3FQKA 4DLGA 3B8HA 2HHTA 2FJDB 4DX6A 1BHNA 2V9KA 4F4KA 3C19A 4BCAA 2AD9A 2JDJA 2MHNA 1SCJB 4KT0C 3OSNA 3NY0A 1B7FA 1NCLA 1BWVA 2OSRA 1RI7A 3CJQA 4ED3A 3GQCA 3SV4A 2QA1A 5RUBA 1JXLA 1IQTA 4G1IA 3VAHA 3BN4A 3J81j 4U7UK 2WZ1A 2M0GB 4IH6A 1LV5A 2I6WA 4PYAA 2XO7A 2NS1B 4XDCA 3M2UB 4UQTA 4NI2B 3QRRA 3M8PA 2DO4A 1YJ9S 1FRLA 1UPPA 4X4PA 5J2QA 1UPMB 1VQSA 5KFXA 5L39A 1LXJA 3U27A 3A8KA 3GR0A 3KLFB 5D3GA 1S9GA 1K8AT 4R8UA 2ACMA 1JKHA 5ETTA 2Y3YA 3NWRA 4WP9A 1I3OB 1XMOF 1NEEA 4NL5A 5HJXA 2NXJA 3VWSA 2HK3A 2X1BA 1P6TA 4TLRA 1EJ7L 2XMVA 3MEDB 2J7WA 2XLKA 4DR5F 1FDNA 3PX6A 5K8MA 1PIEA 2QA2A 1FRXA 5CZVA 3VAKA 4PCQA 4RW9B 4KE5A 2BE2A 4RWWA 2MKCA 5FJ4A 2FGCA 4B3MJ 3NXZA 4X4VA 1MLAA 4LF9F 2R7OA 3DLJA 2YNGB 1J27A 1U2RA 3PHTA 2CQCA 3GV8B 3HI9A 1WORA 3JTNA 3IR6B 2D3UA 1NH8A 4OYZA 3P49B 2G0IA 3BPSP 2F1FA 1F6TA 1U25A 4ZVOB 4CLPA 3D7SB 4DV5F 4ZP9A 1U8WA 2VONA 2F8MA 2XMUA 4NYZA 4MH8A 3QGHA 4FYWB 4ECVA 5B0FA 3TEGA 1S99A 2UU9J 1SJ4P 4LF8F 2ZFHA 4RW7A 5ETNA 2VA3A 3K17A 2V2VA 4DV1F 3M9NB 2ZUGA 1N33J 2D41A 1J5EJ 1S1TB 5KFAA 1QVGR 4J9OA 3HO1A 1P8GA 3EMTA 5FDLA 4M1KA 4M5DB 2ZBRA 3CB4A 1QLNA 2R4FA 3KLIB 2DK2A 3GZ7A 2CNNB 3AQOA 2IAJA 3CMES 2CKWA 3ZC4A 5HMZA 3HZGA 4EWTA 4OX9F 3MZIA 4O0IA 4JI3J 2YWKA 4USTA 1H72C 2DNZA 4N77A 3K59A 2E9RX 1MU2B 4ZCKA 2D7SA 1AFIA 2BR0A 2J76E 1NUEA 3V4IA 2ASJA 2IIHA 2ZBPA 2BVZA 3DRPA 1RWMB 1T0TV 2DISA 2YKQA 8RUCA 2OD6A 3DU5A 6FD1A 2DD8S 2Z2YB 2QT7A 1B0PA 4X4QA 3DLBA 4JI0J 3Q8RB 1HD1A 2R7TA 2CJYB 1OMSA 1QSYA 2ZBIA 4X4RA 1G3OA 3FKBA 2Y8WA 1BUXA 4DN0A 5KOWA 5GAHU 4ZN3A 2J0WA 2HGNA 3CD0A 5F0WA 4FXDA 4I56A 1C0TB 4LVOP 2HS0A 2PT0A 2VG7B 4DR3F 4NCBA 2XSJB 2E5IA 2HLUA 1F0XA 1CJVA 1HNIB 1TAQA 3E01B 2JLEA 1WOSA 3DLGA 1M5HA 3TJ8A 3OFEA 3PVXA 3GE9A 1SH2A 3KHHA 4DN9A 1Y4ZB 3A13A 4UUWA 1TKDA 5D78A 3PY8A 5K20B 5C42A 1FA0A 3BB5A 5L1KA 1KRPA 2OLWA 1S5ZA 4AT1B 3LA0A 1Q81T 3Q2TC 4OHYA 1I51B 4NXNF 4HDGA 3JS9A 2IVMA 4J9MA 4ELVA 2BMBA 2VG5B 4O3SA 2CNLB 3N6LA 5IFMA 2G4BA 3KG0A 2XMMA 2FB0A 1KN6A 1N32J 4UW2A 3NCRA 3L4BC 4A8FA 3HVWA 1JWWA 2B7CB 1WI6A 1NM2A 4TQSA 3W2VA 2MYFA 4WXOA 1HBOA 3CJ2A 2C28A 5LOQA 4TVAB 1RT2B 4GVBB 2YNFB 1M1GA 3M30A 2CQGA 2MKHA 2XS2A 4CO4A 2AMCB 4ZLPA 2CJAA 1AA1B 1GXTA 1TK5A 1RT7A 3MMCB 1NB7A 4D3HA 5ETRA 4IQXA 2XS5A 2EC0A 2RH3A 3FUYA 3K58A 2OPPB 5MLCV 2R3VA 4C3KA 1KQGB 4ANDA 3Q8SB 4LSLB 2PFDA 4PZVA 2GAHC 4B3OB 3IBWA 1RTJB 4LBPA 1TL7A 5B0CA 2RRAA 4A8QA 4O0NA 3C15A 1BD6A 4GKKF 3N6NA 2IMWP 4D3GA 1OQ6A 1VK3A 3PCOB 2CZ9A 5J1NA 1SH3A 2HFUA 2OI2A 2YKOA 3J7Z5 4X65F 1X9SA 2RD5C 4LF7F 2MZJA 2R42A 5C25B 5HMWA 2QE5A 1NDKA 3EDQB 2R2RA 4J9KA 2MLYA 4DFJA 2FHKA 4WK1A 3LGNA 2NXCA 1VQMS 2UUTA 5CD4H 5HQLA 4HTIA 5ETVA 4CH1A 4WP3A 3NNHA 2A3JA 1JJHA 1IKXB 2BJ9A 3ZZ0A 2FJWA 2VBZA 1JXVA 1SL1A 4CH7A 2WRMA 3PFEA 3SCJE 2FHMA 3HVTA 2VU5A 4QIVA 3TI0A 4QJVA 2UVWA 3IRXA 1DLOB 1KFDA 1HBNB 4Y2KA 3TAPA 4AL6A 5F3TA 3MR7A 2J5AA 5IC6B 2CDQA 3ZZUA 4CRJA 2U1AA 3RUBL 3MR2A 4JI6J 1WHXA 3VTIA 3M9OB 1PKUA 3GP9A 4ZVFA 3MXHP 1YITS 3M2VA 1ZM3A 3HHLD 3EZUA 1FVSA 2HVEA 3TVKA 4IUFA 4I6WA 4F4ZA 4QR0A 2CPZA 3KMQA 2J9DE 4NA3A 1VC6A 3DHXA 1Y11A 1MW7A 2YWEA 4FP9A 4WP8A 3UO0A 4USJC 3NBPA 2KVIA 3DRSB 2AGOA 4EO6A 3Q22A 5GMKa 1UJ5A 2MXYA 4IOBA 2J6UA 3I87A 2HZVA 1XQIA 2YNHB 4OZ5A 1Q5VA 5CCLA 1UZDA 4HT5A 4C11A 4C8MA 2E7WA 3MPUB 1GNKA 3M8QA 4ZPTR 4ZLNA 3KUHA 3ZTPA 1Q8LA 1MG7A 5EWFA 2MQLA 4V1Ak 2YPYA 5SUHA 1S76D 5I3UB 3PEJA 4Y2CA 4FVMA 3VCDA 2MLZA 4ZPWR 4P7VA 2BJDA 2YH0A 1HFEL 2HEKA 2ZE2A 1T05B 5B0DA 3RZAA 4LF5F 1X5OA 2JZ5A 3MDFA 1UVLA 2M52A 3W9JA 2B5JA 2EKNA 1R8CA 1RHQB 2IVFB 1S6QB 5JMNA 3BBFA 4JB8B 3KNGA 2WOMA 4OZJA 3MAAB 3EGWB 3ZZYA 3LP2A 4DZDA 2EXUA 2XI3A 3MM6A 3S01A 3CJ0A 1AXQA 4FKYA 4QPXA 2HS4A 4PAAA 2BJ1A 1YJRA 2BW7A 3HHLA 2QGFB 3KJFB 3LO3A 1PC5A 2R8IA 1FFSB 5KFHA 5F8MA 3TQ1A 1JJ4A 2KVQE 3KK2B 2YNIA 3SBMA 1HBUA 3CJ3A 3GLJA 4RW6A 2XM3A 3L9ZA 4DV0J 1S72S 1FX2A 3OTBA 4PUOA 1IR2A 2AJ2A 4Q0BA 3H4BA 4HLBA 1WTFA 3PW2A 2MGZA 1K47A 5D0HA 3HHEA 1FD2A 2OKQA 4RW8A 3F44A 1Y5NB 5F8JA 3M8RA 4ER8A 2IJRA 3GCWP 2L3MA 4XAKA 5ETKA 4P71A 1N5QA 2LU1A 4Q45A 3H0PA 2VHGA 1FHTA 5CCMA 3NRBA 5ETSA 1NPPA 3U1LA 1OO0B 3MMAB 3LAMA 1DFDA 2ALZA 4ZVRB 1S0MA 4TU9A 4KTQA 3CSKA 3CC4S 1KDNA 1NJZA 2LQ8A 4DL0C 3J7A1 1IN0A 4ZCMA 9RUBA 4DQPA 4YY3F 1PJ6A 2D69A 4CT9A 4XIUA 3LF0A 3PYDA 1DQAA 3PW4A 4OX8A 2MQQA 4J9SA 1QM9A 2GHVC 3PKMA 3W64A 4USIA 2N4CA 1UETA 3VHQA 2QSWA 1T03A 2N4DA 1FJCA 4X64J 3I0SA 2EK6A 3S7RA 5KFPA 2KT2A 1QE1B 2OTJS 3CJKB 1TUVA 4MK8A 4DS4A 4X62J 2BXJA 3RAMA 2DGVA 3QPIA 3R1HA 1UCNA 5ETQA 2E5JA 4U67Q 2PC6A 3DOLB 4JV5F 2RDJA 4B9SA 1HNVA 2FYXA 2AJ1A 2WK4A 4F4AA 2RQMA 1VQ7S 4F0MA 1N5VA 3DDIA 5DM7Q 4H4KC 2CUYA 4K4YA 3F0NA 3QT6A 2Y1RI 2KRRA 3RAXA 3V2UC 3DXSX 2J6TA 5FLXY 2HQFA 2WVCA 1OY6A 4DR7F 2KJWA 5DLFA 1DTTB 2FUG9 1UWAA 5HQMA 2HVHA 3TVYA 3BM7A 4ED6A 4IDKB 4ANCA 1TL3B 1U02A 4WFZA 4L72B 2N7YA 3PKYA 1JNRB 3MEKA 2K1RA 4TY8A 2B9EA 1NDPA 1GTHA 5HLFA 5CD4A 1K0VA 1H74A 3IBFB 1E6VA 2DNKA 3HCXA 2PMZD 4DR4F 2BKPA 1TMJA 2V2QA 2W4PA 3P96A 3C14B 3P3DA 5A76A 2IBKA 1NDLA 3BSAA 3KHRA 4JI7F 3V81B 2CVEA 1NSQA 3B78A 4B08A 4KYZA 1JLGB 4K2JA 3G9CA 4OQJA 2VQEJ 2DNPA 3VALA 3SSRA 3BQ1A 2CPXA 2GMHA 4A8KA 5K14A 4WZQA 2CPEA 3MR6A 3GSIA 3D3CJ 2MJUA 4NMXA 2CJKA 4DPOA 1F5AA 2HQIA 4AXJA 1GFWB 1RT5B 1T3OA 2J0QD 1UEKA 1FNMA 3POTA 4B17A 1CQMA 2ZHOA 3BGUA 4WKRA 3E51A 4OYIA 2ZKUA 4N47A 4G3IA 1PJ7A 1NSPA 1RWOB 4OV1A 2VA2A 2ZOGA 3HF5A 2OJ3A 5KFZA 2W2MP 3CGIA 4DL5A 1X8DA 2BOPA 1KC8T 2XULA 4RU9A 1TVRB 4F7VA 1UJ6A 1T9TA 3BO2A 5DS7A 1RKJA 1KONA 2BKNA 1TZ0A 3M1VA 3MM8B 2R2TA 5KFGA 2IM2A 1VCTA 3I32A 4FKXA 4CO0A 3PIPQ 2B51A 3PDNA 2DIUA 4PEOA 4XTTA 2HNZA 1KNZA 2W9CA 1PILA 3OR1A 4PQUA 1X0FA 2VL1A 3LGMA 1F2HA 3UCUP 4K0KJ 2BKOA 3TX0A 5BJRA 2FLPA 1F9EB 3L7UA 4DV3J 2VPYB 2AKWB 2HW3A 1TKXA 1TK0A 1RUSA 2ABYA 4S0MA 1T9XA 2V8GA 3QGGA 1T95A 1E6YB 2VBXA 2AP6A 4NRUA 1JLFA 3RYLA 4HACA 3ZZZA 5KG5A 4P2FA 4DV2F 3CF5Q 2VICA 4KO0A 4O3NA 5CA5A 3GYGA 3KLEB 2GC8A 1VIOA 3SFGA 1TUWA 3L7PA 1OYDA 1U0HB 2QL5B 2U2FA 2A10A 1SJ3P 1YRTA 2ZD1A 2VODA 3NGKA 4C0OC 1V5VA 2XB2D 1JLAA 2CJBA 2XNRA 2NXNA 2M8HA 3ETOA 2E9TA 1RBAA 4RW4B 1U7LA 2Z0GA 2P5VA 2QMXA 3I55S 3QWPA 2ATCB 4UZCA 2NYHA 2JEGA 3M6UA 3MI7X 3KFWX 1HBMA 3BO4A 2KFNA 2AJFE 1RT4B 3R9LA 1SUQB 2PMWA 1RBOB 4IQMA 4F2RA 4WTOB 3NGUA 2Z8QA 4OFZA 3CD5A 1YK9A 3DOKA 3N79A 2AEMA 2LEBA 4DR2F 4P74A 3PO5A 3G8SA 5L9XA 1WF2A 3H2LA 1JLBB 1FNOA 2VIHA 4ID5A 2CQBA 3MWBA 1RGVA 4JI1J 1A0OB 1FESA 1FE0A 1DTQB 2W7PA 3KJNB 1NZAA 1WKKA 3LP0B 2DXFA 2UXBJ 4LRBA 4DV0F 2ZBQA 3DN9A 4NWBA 1G4CA 3DKDA 2HBZB 2MQMA 1VQ9S 1IWAA 2DHXA 3GIMA 2RRNA 3TJAA 2W25A 3SQGA 2G1DA 1H3DA 4ZP6A 4PQAA 2WB1D 2AX0A 4JI5F 2H3EB 1MROA 3AAWB 3FK4A 3FSIA 7AT1B 2I9SA 3MM5B 1Q53A 3KG4A 4ED7A 1IBLF 3AD8C 4XO0A 3X3UA 3D3BJ 2UXDJ 5I42A 2NSCA 3VAJA 1XJWB 3ZZOA 3ET6B 1R8BA 2F8EX 3D0GE 3I31A 2O01C 1TL5A 1NK9A 2FLNA 2D9OA 2G13A 2XYHB 5I4MA 3F73A 3KYLA 5E0OA 4OI2A 1V3ZA 2DGQA 3I96A 1S9EA 1VLYA 2BJ3A 3IBCB 1LFWA 2A1BA 1BQNA 1JLQB 1NK0A 1CPZA 1KWMA 1RT1B 5E5NA 3AXMA 3MPWA 4FBUA 2J0XA 4MJKA 1P1LA 3VV2B 1ZOTA 4DQIA 4PXCA 1RKIA 2CADA 2G2OA 3CO0P 4KV8B 5F41A 3W7BA 1WOOA 2F4FA 2J0SD 2DR9A 1RT3B 2WONB 2FZKB 2Y0BB 3W8GA 5HROA 1U1LA 2NZ4A 3C6TA 2MZQA 5A2QU 3AT1B 4RNOA 2C1EB 3SDEA 4CTAB 4F02A 2BX6A 3J80U 4TQRA 5EUHA 4I6AA 1KKHA 1SV5B 1BMQB 4X62F 1C0TA 3JSRA 2A0FB 2QA4S 3HMJG 4B9VA 3NNAA 2KO1A 1B0VA 1EP4B 4NX9A 5EHHA 4EK2A 1GQEA 3ISZA 5KFBA 5LMNF 5GMEA 1TELA 3VGUA 1NJXA 1VI7A 4K4TA 3RBZA 3DC2A 2MZ1A 4Y6IA 4B3RF 1LW0A 2JEFA 1S1WA 1HA1A 3W63A 3T5HA 1H73A 5K8PA 3NWGA 1VS3A 4Q2LA 1IR0A 2A2DA 2HPUA 4J9NA 5LMUJ 4TYBA 1G1XA 1X5PA 1WEXA 3AOBA 1S48A 2BE7D 1VQ6S 1JJ2R 2GNKA 2VG5A 3SXLA 1TV6B 2M9KA 5DM6Q 1LWFB 4QW8A 4BC9A 4V19J 4K2XA 5KG7A 1FFGB 5D4PA 2B8PA 3VVTA 1HWKA 1I1GA 5HK4A 2V63A 4X4TA 4C8KA 5KT3A 3TUZC 5KFNA 1NK4A 3P45B 4F4XA 2VPWB 2CVIA 1D3WA 3WBZA 2MY7A 2KTQA 2HNDB 2DPJA 2GFFA 2PD1A 1RA6A 3I56S 4HVZA 2CFXA 5C5JA 2Z2LA 5J2NB 3QO9B 3I5AA 4MK9A 3QYYA 2CQ0A 3CMAS 1FDDA 2E5HA 2X3DA 5EGYA 4F67A 4DXLA 5KFMA 4MFBA 3KJVB 4RZRA 3IGNA 3A3PB 5DZ7A 4ANEA 2F63A 4B3OA 4ZVHA 2DGWA 4PXEA 2W2QP 3FEZA 4DV7J 3HX9A 4EZ9A 3N5BA 3FEYB 4LRFA 1U6FA 1QAJA 1U48A 3NAHA 2KRBA 2XYGB 4YS2A 1SC4B 1U1NA 2FLLA 4C4WA 5E3PA 1V3SA 3TAMB 4ZIWA 2XZWA 1CULB 3QMQA 3HFVA 3KUGA 2C2MB 1VQOS 1IBMJ 5HI7A 1S59A 4YP3A 4KHRA 3D2WA 2HHWA 2HLTA 1A6LA 1IJEB 5AE1A 3HPOA 3DNCA 2RE1A 3CT9A 4CO3A 3V6DA 2B8QA 5CAAA 2HK2A 1S1XB 1HNZJ 4LREA 3DRXA 3M6VA 2EKYA 3G6YA 3AOAA 4G65A 1G7CB 3DM2B 4CM2A 4ECXA 4LF6J 4LBIA 3BR9A 2E5LJ 4DR1J 3T6BA 2GQCA 4K0KF 1YJTA 5IWAF 1S1UA 2IRUA 3QT8A 1LQ9A 4DV3F 1R7IA 3UCGA 4BWMA 2C2NA 1H2VZ 4ED1A 1DLOA 1NHVA 3IFEA 1CJKB 4JI4F 3NNCA 3C3LA 5IT4A 1VRTB 1NSAA 4GKJJ 4FBTA 4IG3A 4Q8FA 4ILRA 4F3MA 1RLDA 4CLSA 3IWLA 2C2KB 4WE1B 1HQEB 2CPIA 1F3FA 5DZ6A 3PIOQ 3H5SA 4HYKA 3OLBA 1S1VB 4NLDA 2FHJA 3BH7B 2ZH2A 4KHPJ 2CJQA 3ILLA 4X4NA 5D0EA 1S7IA 3S6EA 4K50A 2XEXA 2LCWA 2D9PA 2FC9A 4F4WA 2IJNA 1X31C 4R0JA 4DPWA 1M5PC 5BR8F 2I5JB 3HSZA 2LMIA 4HI2A 5J2MA 1X4EA 1OSCA 2X1AA 2VKRA 3OV7A 5G0RA 5E41A 3R6GB 3PW7A 1RTDB 1KQKA 4ECSA 1VC0A 3FSXA 2A18A 2VOPA 3OFFA 2OHDA 2XY5A 3WIUA 5CYMB 2FD2A 2R7RA 3H2UB 5G4DA 1FRJA 3FC9A 2GQ2A 3CDUA 5LXYA 4B3TJ 2AEJA 5EX3A 4B9NA 2XI2A 3R2DJ 2G0JA 1SIZA 5HMYA 4Z7YA 3J81Y 3D9BA 2HZCA 1NH7A 2J8AA 3M32B 1TAUA 1TKTA 5A8KA 2YKPA 3G8TA 4JI1F 3ZZTA 3TUPA 4H4KA 4I64A 1N6QB 2EFVA 5L38A 1B4SA 4UT4A 2XBPA 3B6BA 5HATA 2FLOA 1WHWA 3D66A 1VFJA 1J5OA 3JYTA 3O5TB 3D6FB 3CJ4A 4XK8C 3TJ9A 1RCXB 1L3VA 3ILOA 3D6HB 4KPYA 1PG5B 4RNNA 1OY9A 2ROEA 3PV8A 3H20A 2KFYA 5IZHA 2UUCF 4ZA1A 4LVNP 2CNKB 3TZXA 4WKYA 1S6PA 2UXCJ 4IFYA 2GCFA 5JUMA 4ELTA 3C66A 3BQ2A 4HH1A 3KK3B 4M94A 3ISND 3FBBA 3TARA 2HBYB 2MQNA 5A8WB 1GX5A 4YOEA 4DMZA 4GMKA 3KMSA 2UZAA 4YHHJ 4ZVUB 1SL2A 3ZTSA 2HNYA 1TU0B 3PTWA 1YJUA 2PN6A 4W92B 3OTEA 1XK8A 1XMQJ 2FVPA 2PI5A 5AE3A 2DPIA 3PM9A 1N0UA 1MMNA 3CEDA 4DG1B 4O44A 1ACMB 3A4TA 3NLCA 1HWJA 5KFUA 3QZ7A 2IC3A 2X7IA 2VQFF 3H2VE 1BXNA 5GAEI 3OJSA 1RXOB 3Q0AA 3HHDA 4DSEA 5GADI 1UL3A 4ZITA 2BJEA 3QIPA 3C6UB 4KH0B 4EZ6A 2YWWA 1CS4A 3CCES 3TOQA 3H90A 4EYHB 3T5LA 2OEKA 3CCRS 1X4GA 2ZNYA 4K4SA 2RHSB 3TRGA 3FCHA 2C22A 2D74B 1RWNB 2HWTA 4L3NA 3BJYA 4LT6A 4TY9A 5D6GA 3MCSA 3CW2C 2B6AA 5C2CA 1CVJA 1Q8KA 3N9UC 4TKTA 1PAUB 3UR3C 3P5BP 4WU3A 1JLEA 4OZ1A 1M1HA 3BKTA 3TA2A 2WW4A 4OHXA 1DJ0A 2RJZA 5HVFA 2QJ3A 3PACA 3BPDA 4CYUA 4CLFA 2QYCA 1YIJS 2QL9B 3FFIB 2RDIA 2BM1A 2VG6A 1ZAWA 3DCAA 3MAHA 4USMA 3MEEA 3FDSA 2R7UA 1KLNA 4YDXA 2AV5A 1T3NA 4I2QB 3ZO7A 1M1KT 2NLWA 4M5JA 1RTHA 3NL0A 2E1RA 3K5MA 4WK3A 3LOUA 3N0VA 3J80Y 1TL3A 3GPAA 1VQ4S 4H4MB 3J7YU 1WJ9A 1WDTA 1JQGA 4EU0A 1BC6A 4NEZA 4NEYA 2VJVA 3OW2R 5J2PA 1X4HA 3NOCA 4ICLA 1HWUA 4QOTA 1OIAA 3HJVA 3IWXA 4CLUA 2XZDB 3CDWA 2HMIB 2BBEA 3I0RA 2Z56B 2B9WA 2E1MC 3A3OB 4EI2A 1EKRA 3UN3A 4IOAQ 2D3ZA 3P4UB 4OZNA 5A8RB 4DSLA 2ZOFA 1LW2A 3VZHA 4CLYA 3EX7B 4DV7F 1UEUA 4JYAF 2IM0A 3MM7A 1VJQA 2IHR1 1Y3JA 4NLWA 1XMOJ 3GFXA 5AT1B 3G2XA 1TL1A 1D8ZA 1FX4A 2CPFA 3NS5A 3IR5B 3ENVA 4B9UA 4C9DA 1L3UA 2EG1A 4MIBA 3QIDA 3MMJA 4N5SA 2NUUG 4U7UD 3GG1A 3K5LA 1Q4RA 4DR5J 2YWGA 4P7TA 3M8WA 5KT6A 2HVDA 2BOAA 4BDPA 1ZM9A 3CC2S 1U49A 3W61A 2KYXA 2YWHA 3D67A 1GXUA 3US5A 4QR2A 1TVRA 3O1LA 4IG0B 1O8BA 1CJTB 1N0VC 4PXDA 2AYBA 3R97A 4ENOA 3KLHB 2UUBF 4DV4J 2NPIA 1L3SA 5LXRA 1KQSR 1S4FA 1UEVA 3H5UA 4DV5J 3MMBB 3MCNA 5IM0A 3R5DA 2GGPB 4FDFA 3VVUA 4ECUA 1WACA 1IBCB 4FVCA 1RWXB 1WWHA 4HI1A 2OTLS 1WG5A 4LF8J 2AW0A 4K59A 1UZHA 4ZMMA 1SBRA 3VGSA 2F9DA 2ZHBA 4NLRA 4K4WA 3GJQB 4I2PB 2AGQA 2KL8A 4AD6A 4CT8A 2MEWA 2ZH5A 5CYQB 2KKHA 3G6ES 3GIKA 5A0YA 3OL7A 4ED2A 3ZTRA 2P6TA 4OX9J 2AEFA 2QSFA 2VDIA 5CABA 3GTYX 1KVJA 2GVDB 5ETOA 1QTMA 2R8KA 4FNIA 1H2TZ 5C2GA 4Y65A 3GIIA 4LSNB 2GX8A 1QJHA 1SQEA 4ZVSB 4PWUA 2DNLA 2NSBA 2KM8C 1LFPA 1VISA 5F8IA 3AD9C 1HNWF 5H9EJ 4HKQA 4EO8A 1U26A 2GIQA 3T19A 1Q8BA 2JNJA 2ZZTA 2G2ZA 3CD7A 1KLMB 2H5JB 1Y5IB 2M70A 3BGRB 5EWGA 4ZVEA 1Q95G 2N3OA 1CC8A 3Q2SC 4HHHA 2DBBA 1HARA 3EPIA 1U1RA 3PJ9A 1SC6A 1FERA 4UOGA 3V5RA 1VBKA 1UJ4A 2WAQD 1H38A 5E2QA 4R5PB 2DNQA 2LEAA 3GYNA 3KK1A 2J7UA 2V34A 2NCKL 4DDFA 1S0OA 4YN3B 5F8NA 2ZVIA 3DRRA 4U95A 1C1BB 5HBMB 4MK7A 1AZSB 3ZTOA 4AQYF 1RAFB 2X1GA 1WEZA 4L3KA 3WC2A 3TW0A 2BANA 3WC0A 1XNRF 1GMWA 3LWMA 1QY7A 2E44A 4KB7A 1XR5A 2ADBA 3AJ2A 3NAIA 3QFHA 4HL9A 4YQWA 3SI8A 5C24B 4ZLLA 2O5DA 3CUNA 3LP0A 1S0VA 3BDEA 3HHLC 2VH7A 1VGYA 1SKWA 4KKOA 4NXNJ 1OY8A 2WCXA 3A8EA 5KG4A 1K9MT 4ES2A 5KFRA 1NMEB 2KXFA 3MGJA 1XTZA 3TX8A 3MM9B 2XLIA 5D77A 2CWXA 2ZH6A 2Z4PA 1VQ5S 2ZWPA 4OX6A 1WHYA 4QWEA 2F7VA 1AUDA 1UA0A 3NMRA 3THPA 4AUKA 4A8SA 2E9ZA 5KG3A 1YVFA 2DR8A 2DNMA 2AWZA 2GO9A 1RTZA 4LQ9A 3T1YJ 5KFOA 1TFWA 1NNDA 3THTA 3PW5A 4N8NA 2XC9A 1WF1A 4I67A 3RBDA 1ROFA 4XDDA 5IOLA 2DY1A 1LOUA 5EX0A 2MZTA 3HULA 4URQU 1TFYA 4L74A 4OZ3A 4PG8A 2DITA 1FT8A 2V8HA 2P8IA 1L3TA 1EETB 3U02A 3CDEA 4G1QA 5FIIA 2NQPA 4URSA 2EFOA 1VQ8S 1WG4A 1GX6A 4P75A 3BF4A 3RBEA 2GJ2A 4PWDA 4X65J 1A7GE 2M3DA 2V8PA 5EWEA 5KT4A 3RB4A 3NS7B 4P2XA 4UF4A 5J2QB 2VV5A 4YDDB 5KT5A 2Y1LB 3MPDA 2E7VA 1RWWB 2C3MA 3R5AA 5F8HA 4F3OA 2O67A 2DGUA 2ZBCA 4QWCA 1MMLA 4LIWA 2KHCA 2GHWA 3THVA 1IKYA 2FJBB 3SSQA 2OFHX 5JVGQ 4J90A 3A8IA 4MIAA 3FSYA 3ADAC 2AQ4A 1QSLA 1OPIA 4QYZJ 1KBRA 2ZM6F 3T1HF 1CJUB 1J2VA 3OT9A 1FVQA 4JBCA 2VB6A 2GS8A 3EICA 2IYGA 1EQ0A 3VAGA 2DEJA 1EB0A 4WU2A 4RBTA 1BQXA 4J9VA 5F8GA 2DRBA 1RT6A 2BE2B 2V5HG 2MSSA 3MEGA 1Z1ZA 2AYMA 1FRMA 1HYSA 2M2BA 3TYTA 3IWNC 2P9GA 3MPYA 2IBOA 1LK5A 1FWLA 2PEHA 4LSZB 2IM3A 3DFEA 4UUXA 2HQDA 4F04B 4P6QA 3ITHB 2BACA 3K8VA 3Q8QB 2QIFA 3DI6A 2ROPA 2HHQA 3SCLE 3S1TA 1GK8A 1BWEA 3OHAA 4J9RA 4C7QA 5HMXA 4RW7B 4EGLA 3OR2A 4LUBA 3Q89A 2MHEA 1F3VA 2V94A 1T94A 4F4YA 2HS3A 4CH0S 3G6VA 4Y2AA 1JB0C 2WHOA 1KS2A 3KJVA 3B4MA 1FRIA 1NHUA 1Z4UA 3HVAA 2B3TB 3K2YA 3EE3A 5FDLB 4X4OA 2BM0A 2M5YA 1D8YA 3BR8A 2MKJA 2IAJB 3DXBA 2L41A 1FKOA 3BSNA 3TAQA 2FY1A 3CPWR 4LF5J 2MQ8A 4C8OA 4NOHA 3W8PA 3W5YA 1C4CA 4DV4F 4MTPA 4EBCA 3V4IB 1N5TA 5HVGA 1HHSA 4O23A 4P52A 1FCAA 3AHPA 3UDLA 4GO5X 2ACYA 1YHQS 4MMOA 2UV8A 4O4GA 4PG6A 4DL6A 2VF3A 1SKSA 1IVZA 2XMJA 3PFOA 3W60A 1UP1A 4WYWA 2HQCA 2JC0A 5JJBA 2MKIA 3HVRA 5DDOC 2QN6B 4DPUA 3BO3A 1CJVB 1CC7A 4NPOA 1EX8A 1HQUA 4ECQA 1WC1A 1M90T 1MWYA 3DLGB 4DUTA 4ID8A 5DO2A 1LXNA 3HT3A 2PIIA 1S1VA 2KU7A 3RG6A 2FDNA 1BQMA 3ZNUA 4OLOA 1R8HA 4CO5A 1VIXA 1QUPA 2WB4A 5C42B 1JJCB 2W8KA 2RF2A 1FF2A 3GU0A 2PGCA 2H9ZA 1N34J 5D8HB 5FLXU 2RVJA 1XMBA 4JV2A 3OQ2A 1M5SA 1LWEA 4KY3A 3PG9A 1JLCA 2HKEA 4DCOB 4DL7A 4YY3J 3KUEA 3MR5A 2PSZA 3W2VB 3FEXB 2NYIA 3UDCA 2G1HA 4WZMA 1HBOB 1P1TA 2FJVA 5A6PA 3KLGA 4WYLA 1C1CA 2LQ5A 1MN7A 3M30B 1WOPA 2AJ4A 1WHVA 2JC1A 2DYAA 1X9WA 3D6MB 2GV1A 1XR7A 4YFUA 4PR6A 3BGOP 2JEJA 2HG4A 1RT7B 2DT9A 3C16A 3R8YA 5L46A 4CM0A 2QLBB 3QT7A 1REVA 3NCQA 2HAFA 4E0DA 2RS2A 5T41A 2FHOB 2CDRB 4RR5A 2RQ4A 2JVOA 4JV5J 4ZPAA 1S7HA 2GO8A 4EYIB 1TL7B 2B9YA 2RIJA 3KOAA 3JAMU 1CBKA 3P5TL 3C15B 4U6PA 5DDQC 4DPYA 4OYMA 2BABA 2YKNA 1X4FA 3DGPA 3DOMB 4WBFA 4WXWA 1AROP 2W7AA 3M4XA 2QRRA 2DNYA 7FDRA 4GRSA 2V8DA 4K4UA 2XCAA 3FBEA 4DR7J 1NKEA 1XBWA 3W3SA 4UY8T 2BA9A 7FD1A 3FBFA 2A2CA 4L6V3 2H65B 1RYSA 3PEHA 2RHQB 2DRDA 3P8BB 2OPRA 4AE5A 3T1YF 3PR4A 4CIOA 3FNNA 3K89A 4LQ3A 1FK9A 2KZZA 1M5KC 4Y34A 4M95A 2RUGA 2CRLA 4Y00A 1LEOA 4O4RA 4DR4J 1CLFA 3HVTB 1W2IA 4RWXA 3DMJA 3RW7A 3UN5A 1B70B 2ZH3A 3IRXB 3SV3A 2IVYA 5E3QA 3CJRA 4QCLA 3CIZA 3RGIA 1G6BA 1RHJB 1KOOA 4QBUA 4JI7J 1UW9A 2B0GA 3DU6A 1K1QA 2VJUA 4HDHA 1XIQA 2HHPA 2LXUA 1OQ3A 2L9NA 5HP1B 2V2KA 2CPDA 2YH1A 5D15A 1H98A 2OELA 1F2GA 2GMJA 1U1QA 3M2VB 2CPJA 4I0WA 3VR1A 3GIJA 4Z7CA 4URGA 4NLGA 2W9BA 2YVSA 5MAOA 5H9FJ 2YQ3A 3BKFA 2RDDA 3R5BA 3BSOA 1D9FA 1HMVB 2PO4A 3NBPB 2LECA 3R7SB 5DG7A 2YKMB 3C46A 1O0PA 3FMBA 1WNEA 2PDAA 3IO1A 4ZHRA 2VZ9A 3VGTA 1YX2A 2DNHA 1SKRA 3BZQA 4OJ3A 3FRZA 3JSMA 1U1MA 5KOXA 3H40A 2MPUA 3TR5A 1RAOA 3NP5A 3F56A 4C11B 4AYBD 2R7VA 2G2YA 1SB6A 3M8QB 3WHIA 1D1UA 2H51B 3KLVA 3N5FA 1KHWA 2B43A 4RPFA 2HIQA 2Q6BA 4IFVA 2W2PP 1RWVB 5IV3A 1WEYA 2W4CA 3UD5A 4DHVA 5L1IA 3R1LA 4I69A 1PAEX 3HFKA 4FN5A 2UP1A 3ENQA 2B5JB 2QLWA 1K73T 1HPZA 4OYXA 1K1SA 2WOMB 3DLLQ 4JV0A 2KI2A 1U2FA 1N36F 2F8HA 3OL8A 4Y0FA 2B4VA 3LP2B 2IA6A 2YWFA 4M5LA 4DUZF 3UNYA 4DV2J 4X84A 4OHVA 2AJQA 3SQOP 3G82A 1V3RA 2OUGA 5ETLA 1X7VA 4LJMA 4A8WA 4C2MA 2CQ1A 4E98A 3W66A 1SJRA 2DIVA 1OS5A 3L09A 4LF4J 2YNIB 3A1YG 1HBUB 1WUUA 5A8RA 4RW6B 2CQ4A 3PYFA 3N6MA 4NA1A 2C2OB 4KC5A 4PUOB 1WC5A 2F3JA 1ZTWA 1HR0J 4Q0BB 3HKZD 4M5NA 3K5PA 1NBEB 1R6YA 3JTPA 3M2RB 5LSRA 4OZ0A 4AL7A 2ERRA 1N5YA 4OI4A 4RW8B 5KFYA 4FPRA 1XN9A 1VQNS 2VFSA 5LSOA 3VZIA 4KFBA 4BLGA 4NRTA 4H54A 3V6JA 2XMAA 3CCWA 3WX4A 1ELOA 2ADCA 3KNAA 1WD6A 2CWKA 3RRKA 1HW8A 4FPIA 4ED0A 1XNQF 1VYAA 2GJFA 1Y10A 1TKZA 2AYEA 4CWBA 1YBAA 1MMDA 3D1HA 3TVZA 2W2NP 4DR2J 1NLKL 2JHEA 4TU7A 3AH6A 1R8AA 3BSCA 4OZ2A 1IKWA 4IG0A 1SI9A 1KVIA 1BE4A 5HL7Q 3O2IA 4LF1A 4X2BA 3W62A 1IKVA 2DXEA 3AJ1A 1DZ5A 2L48A 2Z30B 4DU7A 1EARA 1AYEA 2WVEA 1ZZNA 4F8RA 2R7WA 2KH9A 3LP1A 5H1SV 1H7WA 4TXSA 4U96A 1T03B 4Q43A 2LEPA 3JSYA 5B0EA 1DQ8A 1UWBA 1NDCA 4JI5J 4RLEA 3BEGB 4GVLA 2C2ZB 2VFVA 2AIRB 2FTRA 3UD4P 1IBLJ 2KFZA 1AUSL 3NOGA 4U8YA 4LFCJ 1HNVB 2RNEA 2FY8A 2WW8A 4ZKAA 2RAQA 4CLTA 1N34F 3IS9A 4OZLA 4NLUA 4DUYF 4LIRA 3SYZA 1NK5A 3DLEA 1X5TA 3TWZA 3WZ0A 4JI8F 1NU4A 3K5OA 3MOZA 3L3CA 4CO2A 1GXLA 2AF6A 2NXEA 2ZNZA 2AYGA 2EFQA 5GAGI 4TYAA 3H5YA 3SEOA 4CLWA 2I8EA 4ECYA 2YX7A 3RB6A 3I9ZA 2D3OR 1KLMA 4TNOA 3TUIC 2B7BB 3S8SA 1RTIA 5H9EK 3FGVA 2K1RB 2FJXA 4LR9A 4TY8B 2HBQB 4NXMF 5HLFB 5KG0A 1RU1A 1FJEB 2OAUA 2BJ7A 1E6VB 1M0SA 2GAGC 3EM1A 3GILA 1MN9A 2R7QA 3OXFA 3U1MA 2B4PA 1H7XA 2W24A 4ZVPB 4DU8A 3JB9k 2RKIB 2K3KA 3QJLA 4KH1B 5LMNJ 2LU2A 4B3RJ 3HM9A 2RMLA 1S9FA 2ZUAA 4YR0A 3KXDA 5KFDA 2N82B 3IG1A 2CXEA 5GAHI 2JH3A 1KSPA 4IO1A 5K14B 4RL1A 4QU7A 1R8PA 2WSEC 2LQ9A 5U47A 1GH8A 4J91A 4UQGA 5T7LA 2GJIA 2KG0A 1KOHA 2J6SA 1VK8A 3HDSA 4I7FB 2V4JA 1CSJA 3QNWB 4CI0B 1JX4A 4NYPA 3POTB 5L9NA 1C4AA 3SFUA 3EZ5A 2HGLA 1YJVA 5KFVA 3IGVA 3GR1A 1IJFB 2C2RA 1F5CA 1RACB 3B4DA 3K57A 4H4OA 1SPBP 2JJ4D 5KAKA 2A6OA 3Q8VA 4DQQA 2B4UA 3M6WA 1TQLA 4X4SA 2R7XA 4ELUA 5ITHA 3TO8A 1S49A 2OGUA 2C2DA 3FZ2A 4FYYB 1RK8A 1T8EA 3UVJA 1F1BB 4P2MA 3M1VB 1D09B 5IQ6A 1YBTA 4HHUA 1QD1A 1Q0NA 1N5SA 2QLJB 4P2SA 4LMZA 1RZMA 3L95X 3IXQA 2RQKA 3NCPA 2HNZB 2W9CB 2YX4A 2HSEB 3OR1B 1O51A 1Y5LB 4PQUB 3TEHB 3FVYA 3JQJA 1UAWA 2XTJP 2VOOA 1FDBA 2WVBA 3JAMY 1YRXA 1FKPA 1L5UA 1TKXB 3DLHA 2EVZA 2QFJA 1WF0A 1EETA 4TLQA 1JLFB 4J7CA 2HFNA 4HACB 1QSSA 4OL8A 2A6MA 4KO0B 1R0AA 3I4PA 3HKWA 1LWCA 5BXIA 3Q8YA 2BQUA 3K5NA 1CG2A 4RUHA 1ZM4A 1I94F 2F5GA 2FVCA 5KFKA 1N88A 3W5XA 3KTQA 4NCGA 2Q3PA 4NCAA 3MF5A 3KJQB 2HQGA 2ZD1B 5AXNA 3IAS9 4P73A 1VOMA 1R27B 3GV7B 2QA4G 1V9OA 5KFJA 1JLAB 4C97A 5B0GA 1PYOB 1CEZA 3F41A 5AXLA 4QU6A 1VRUA 4QQBA 3CCJS 2VPXB 3ULHA 4DFKA 2WTFA 4LFBJ 4ED8A 4JV1A 4B9MA 3ZXWA 2XLJA 3FCVA 4K7QA 4RUAA 2LA6A 3H7HB 1Y0HA 5DGBA 2BW2A 3ISNC 4RBVA 5DJBA 5IWAJ 2YTCA 2K7KA 2RT3A 4ZJOA 1CJUA 1HBMB 1REGX 2BV3A 1F9HA 2H54B 3J81U 4QYZK 1RDRA 3QBCA 2AU0A 3OVSA 4JI4J 1RWUA 2J8SA 3MECB 2W01A 5ADZA 4CLKA 4OYOA 3DOKB 1VR6A 2MB0B 2IFXA 2HRYA 2POKA 4ID5B 5AE2A 4WWSA 4F36A 1ZAVA 1RHMB 1VQYA 3GYXB 2I2YA 3M2UA 4RKUC 1RCOB 4NI2A 4MT1A 4JI2J 1R0CB 2DGOA 4V19X 1IM4A 3PRBA 4LF4F 4KGXB 4NZ0A 4C0BA 1FKAF 3ITHA 2ZH1A 3FJ2A 3Q86A 2RB7A 3EUNA 3BV8A 2CJXB 2CQDA 5BR8J 3KLFA 2ZZNA 4ZP7A 1HHTP 4MKBA 4N8OA 2M8DB 1HLWA 3FZBA 2CZVC 2XMWA 3EYZA 1HR0F 3CCUS 3GFYA 3SQGB 3RRGA 3SIPB 5CQGA 1DY3A 3TA1A 3ZFVA 1MROB 2FIUA 2P9CA 3QAUA 3G4SS 4RNHA 4ZOSA 4OYBA 4IH5A 4Z37A 2OMOA 3MEDA 5A6WA 5I42B 1WC3A 4YR3A 4EFAC 4J5OA 3H25A 5GAGU 1YTYA 3LTOA 1WSVA 4RW9A 3I5BA 4BHQA 3OVAA 1DARA 2Y8YA 3EWGA 1S9EB 4W98A 1B7YB 2YNGA 4A8XA 3OTCA 1BQNB 3OBIA 5ETPA 2C3PA 3H5XA 2JVRA 4GC7A 2E7XA 5L8RC 4ILLA 3MPVA 4KAIA 3LPYA 5DQGA 4Q5VA 4PG5A 3W5ZA 1KVKA 2APOA 4ETZA 4USVA 1W2BR 3CJ8A 1ZPWX 1PCAA 5HROB 3FQLA 3CE8A 2ILZA 3C6TB 2FJEB 5E7OB 2HRTA 3SDEB 2R9LA 2HAIA 1UVKA 3SZ2A 1FEHA 2QV6A 4OHZA 2UUCJ 2HFSA 3TZZA 1C2PA 2IDLA 3LQVA 3PJWA 3T9ZA 3D0HE 3O6QA 4EBEA 2QEXS 3DYAB 3GIRA 1S1TA 4OI6A 4C8YA 1HWLA 4UTGA 1R3NA 4M5DA 3UDEA 4F0HA 4DL4A 3PX0A 3H59A 3J7ZT 4LFCF 3KLIA 5I3QA 2HBRB 4YB5A 2UUAJ 2ALYB 4C48A 3MR3A 1LW0B 4WFAQ 2IRYA 1S1WB 2OPSB 4DSKA 1TR0A 5AXMA 1MU2A 1RAIB 3D54A 5DDPC 2KT3A 3AODA 3RR7A 2V9WA 1RABB 5IQQA 4HTJA 2KZMA 4QIEA 2H4WB 5K8NA 3D0IE 2YBVA 4ED5A 3CCQS 4A8OA 4ECZA 1NXIA 5K9FA 2VQFJ 2CYYA 4HR2A 4OMFG 1I6JA 3MFIA 2H48B 4WFYA 3ICLA 1UMJA 5CXTA 3GCXP 4A46A 3HJFA 2OEJA 4QWAA 1U0SA 5KTQA 3VAMA 2WBMA 1HWIA 1UFKA 2DGSA 1R43A 3O8WA 1GAOA 2VG7A 1Q16B 2XSJA 1WTBA 4RJVA 1HNIA 3V4MA 3E01A 1IBKJ 1VQLS 4FXWA 3C2PA 3I9V9 2E5GA 1GTEA 2NREA 1KP6A 2ASLA 4LFAF 1N56A 1N52B 3MUTP 3T5KA 2R7SA 1SJFA 2LDYA 4K4VA 3MAQA 1DRZA 5KG1A 2YQ0A 2JEIA 1T9WA 1TL4A 2QMUB 3IAM9 4MFBB 4G6VB 2HVIA 2HHHJ 3C8YA 4EUVA 4HT7A 1NJWA 5F8LA 2EG2A 3CCVS 1R0BG 1T7PA 3HD1A 3QGPA 3DOMA 4LRCA 4P72A 3K0JA 4J37A 3W9IA 5IT9Y 1W7WA 3BDPA 2W4DA 2JLFA 3EGZA 3J7AN 2LQJA 3CULA 2YY3A 4QYRA 1PYSB 2AT1B 1H2UX 1RT2A 3A12A 4GVBA 3LPEA 3OTDA 2YNFA 2ZH8A 1RJJA 1NB2A 3M05A 3V6DB 3E3XA 4DPTA 3EZOA 2FC8A 3MFHA 3MMCA 4WF9Q 1NK7A 2N3LA 2VFTA 2QL7B 2DTJA 1DHMA 2EC2A 1XERA 1RAEB 2MKKA 2ZC4A 2RQCA 2DB1A 2LDIA 5HJYA 1S1UB 3CDAA 2OPPA 4Q8EA 1HQ2A 4QPTA 1U1OA 4LSLA 4C8ZA 1EHWA 4K5RA 2KN4A 1FXDA 3PW0A 4ED4A 4J9PA 1RTJA 3PXGa 4JYAJ 2Q79A 5D4LA 4QW9A 1WELA 3R5CA 5KG2A 1Y00A 3CCZA 3CMQA 4IG3B 3BBBA 4J9UE 5LT5A 2V4RA 1HI0P 1VMBA 4IO9Q 5HP1A 1PYTA 4FYVB 3MD1A 4WTYA 4DV6J 5KFEA 1SL0A 5KFWA 3M8ZA 5C25A 4DEZA 3I6PA 4IOCQ 1YJ7A 3CWJA 5M2RA 4TN2A 4W4MA 4IYQA 2G0CA 1HMVA 2W1BA 4ITSA 4UOCA 1R6VA 5H9FK 2YKMA 5LSLA 1AW0A 2F65A 3D68A 4DSJA 4KIAA 4F26A 5J2MB 4LFBF 1NJIT 1IKXA 5G0RB 2DHHA 2ZJRQ 2ZJPQ 1X60A 2HHXA 1KQFB 2KT5A 1V6HA 1SKUB 4KR0B 4DFMA 4U9RA 1FWPA 3T6JA 4C98A 1YBUA 3AQPA 2UUBJ 2YX1A 1RADB 4NLPA 5FD1A 1HBNA 2JLGA 4CLZA 5C7PA 2W7OA 1FJ7A 2RU9A 3T3FA 3RJMB 3ENWA 2CPHA 5AXKA 4P9SA 3D5MA 1H0HB 3SCKE 4B3MF 1RP5A 1LWXA 2H1YA 1TKTB 5A8KB 3UE2A 1SQGA 2DGXA 1UW4A 1UVJA 1FTRA 1YG0A 1K44A 4JI2F 2QYGA 1VDHA 3PNIA 2VC0A 3DHWC 5BYSA 4NE9C 5L1JA 1Y3KA 3BGFA 3IA0A 4PYDA 3G6XA 1J5OB 1IM6A 3JYTB 4N41A 3RR8A 4O3QA 3DRSA 1S4EA 5BYRA 2UU9F 2JRSA 3PHEA 2HRUA 3GG0A 1NKBA 3VF0B 2YNHA 5E33A 4B9TA 3TP2A 4AL5A 1N33F 1HIYA 1S6PB 3FRYA 2CZ4A 4IFYB 1J5EF 4Y28C 4DI6A 2DGTA 5K5MA 2ZH7A 3OTOJ 5I3UA 2R8HA 2CQ2A 1HNWJ 4AXIA 3ZNJ1 4RBUA 3H4DA 2M88A 2VDHA 3T5JA 3M2RA 3ELHA 3TANA 1BGXT 1FRKA 2NR0A 3R6LB 3R2CJ 5GVQA 2MQPA 4JI3F 5HO4A 2HURA 1T05A 2MZRA 5SZTA 1Q8IA 4HH0A 2PI4A 2NZCA 2HNYB 2BDPA 3HSGA 3UCZP 1S6QA 3EXCX 1U09A 3JTOA 3MAAA 1P9QC 1B99A 4KRWA 4O44B 2AGPA 3D1QA 3PJXA 1HNXJ 1RQ0A 4N7TA 4AQYJ 2IC3B 4IR9A 1GMVA 4M5GA 3TNVA 4F50A 1XNRJ 5B0BA 4JI0F 3RTVA 1P27B 3QIPB 4JOUA 1RU2A 4IH7A 3SCIE 1CS4B 3FBCA 3KK2A 2M7SA 3LH2S 1WI8A 3KG1A 1NPRA 4F3QA 2P9EA 3KWMA 3SSSA 1RBLA 1WG1A 5KFCA 1Q1KA 3D28A 4PG7A 3RB0A 4BS2A 2CQHA 2UUAF 1FRHA 2Y0SD 2EEYA 4DX7A 2C42A 2AX1A 3UN2A 2MMYA 2B6AB 1V5IB 3GONA 1VBYA 2CJ9A 3I4HX 1JLEB 2VPZB 3AFGA 4Y3CA 2HFOA 2ZVSA 2BJ8A 3NGDA 2LQBA 2RS8A 2OEMA 2QLXA 4MYTA 4DPXA 3IP0A 3G96A 4RU2A 3U1NA 1RISA 4N56A 3OPKA 2ATLA 4CYUB 3N01A 2XY7A 4J9LA 3MMAA 1VJWA 4ZN1A 1T9UA 4Y2MA 4GC6A 3B54A 2VG6B 1N32F 2MQOA 1OJ4A 3HFZB 3LAKA 3ONQA 1WKJA 3KDOA 3MEEB 1N4LA 1Z2ZA 2PFFB 4F0KA 4FYXB 4WJBA 3H42A 2J9DA 1RTHB 4YUDA 2C3UA 1NSKL 5ETMA 3NMAA 4YB7A 3EGVA 4QIGA 4QIWD 3EDRB 2G9OA 1OPZA 4DJBA 2BE9B 4ZJLA 4I6YA 1IBKF 3MURP 5J2PB 4FYDA 4LR8A 4ICLB 1OWXA 1S57A 4NLVA 4Q44A 6AT1B 2E1PA 1QE1A 3NGRA 3CJKA 3UWTA 2I0XA 3I0RB 3T9NA 2HGMA 3JXOA 4OIXA 4OI3A 1VBXA 4C3MA 2VFUA 3OXGA 2RKIA 3DOLA 2JFKA 3Q8UA 4DQSA 3OFGA 2HHHF 1LW2B 2QC3A 2GVZB 5DDRC 1TP7A 4OHWA 6FDRA 5KT2A 1FI4A 3MM7B 5K8OA 3OSPA 1TL1B 1X0PA 4FXVA 1ZAXA 4AFFA 2OIHA 4DX5A 2WSFC 1YZ6A 4OYWA 4USWA 1RAAB 2ZM6J 3O3LA 4YR2A 4LBHA 3T1HJ 1MWZA 4I7FA 1DTTA 1FFWB 2PEBA 3E2EA 3Q83A 3VQSA 2C2EA 2QLFB 2F40A 2Y1JA 4IDKA 3CCSS 2H5IB 2DH8A 2VD3A 4IKAA 4OI1A 1S10A 4ES1A 2KHDA 2ILYA 5F3ZA 2XSFA 3T1AA 4FF3A 2SXLA 1S79A 4DQRA 2ROGA 4I1TA 3Q24A 1TUGB 1MSWD 2B4OA 4ZCLA 1AFJA 3R7BB 2UVVA 2IMOA 3C14A 5F9LA 1R89A 2XNQA 3GJTB 4WFXA 4ZS6A 5IM0B 2HQ3A 4R0EA 5JXSA 1QVFR 3V81A 1SXLA 2P6SA 4C8LA 2NPFA 3DRYA 1JLGA 2FPHX 2UV8G 2FZGB 4WFBQ 4JI6F 3AD7C 2D1CA 3FCWA 4FZVA 1EAYC 4DV6F 3PRDA 4DF8A 3PRVA 2DO0A 1O6XA 2DVIA 1VQPS 1RT5A 1NHKL 1DURA 4LRDA 3W65A 1SC1B 2V6AA 1HD0A 4DOZA 3IRWP 2LVWA 3QWUA 5A0YB 5F0UA 2JFDA 1U4BA 4DR6J 5KFTA 1NK8A 2ZDPA 2L9WA 2CIMA 1L3KA 3RU0A 4DZ6A 2BQRA 5KT7A 3VAFA 3BYPA 5B08A 4DBQA 4KPCA 3MM8A 1NJYA
chains in the Genus database with same CATH topology
2C3OA 3H5SA 4HYKA 4A47A 1NH8A 3HKZD 3K5PA 3OLBA 1S1VB 4NLDA 2FHJA 1R6YA 3P49B 3JTPA 3M2RB 5LSRA 2ZH2A 2F1FA 4TU8A 1U25A 2CJQA 4OZ0A 4AL7A 2ERRA 1PSDA 1N5YA 4X4NA 4OI4A 4RW8B 5KFYA 4FPRA 4DV5F 1XN9A 4ZP9A 1XEZA 1VQNS 2F8MA 2XMUA 2VONA 2VFSA 4NYZA 5LSOA 4MH8A 3S6EA 4K50A 2XEXA 2LCWA 3VZIA 4KFBA 1S77D 2D9PA 2FC9A 3QLHB 4NRTA 4F4WA 4H54A 3QGHA 3V6JA 2IJNA 3CCWA 3WX4A 1ELOA 4R0JA 2ADCA 3KNAA 4ECVA 5B0FA 2ZJQQ 1WD6A 1M5PC 1S99A 5BR8F 2I5JB 3RRKA 1HW8A 1X9MA 1SJ4P 4G1PA 2OMLA 4LF8F 2ZFHA 4RW7A 5E3AA 2LMIA 4ED0A 4HI2A 5J2MA 1X4EA 2VA3A 1XNQF 5LJ3Y 1OSCA 1E6YA 2X1AA 1TKZA 2AYEA 2VKRA 4YMEA 2BQ3A 3EPGA 2OPQB 3OV7A 1YBAA 1MMDA 3D1HA 5G0RA 4DV1F 3M9NB 5E41A 5J1EB 3MECA 3TVZA 2ZUGA 3CDBA 3PW7A 1T02A 2JHEA 1RTDB 2D41A 3KK1B 3HZEA 1KQKA 4TU7A 1S1TB 3AH6A 4E8UA 4ECSA 1VC0A 5KFAA 3FSXA 1R8AA 2A18A 1QVGR 2VOPA 3BSCA 3OFFA 3DRRB 1ZPVA 4J9OA 5IS2A 3HO1A 1P8GA 2UVRA 5FDLA 1FD8A 1IKWA 4IG0A 4M1KA 4M5DB 5CYMB 1SI9A 3KLEA 2XY5A 2HHVA 4DS5A 2FD2A 3CB4A 1QLNA 2R7RA 3H2UB 1KVIA 5HL7Q 3O2IA 5G4DA 2R4FA 4X2BA 1FRJA 4NLYA 2MKSA 3KLIB 2BANB 2DK2A 1IKVA 2GQ2A 1U1KA 2GA7A 3AJ1A 3GZ7A 4NLTA 5D4NA 3RW6A 3AQOA 2IAJA 3CDUA 1DZ5A 1JMTA 3CMES 5LXYA 2L48A 1N54B 1Z2LA 2CKWA 5EX3A 3ZC4A 4DF4A 1IXKA 4B9NA 5HMZA 3HZGA 4EWTA 1ZZNA 4OX9F 4F8RA 1U6BA 2XI2A 3MZIA 4O0IA 2YWKA 4FF1A 1SIZA 5HMYA 3OXLA 2R7WA 2KH9A 3J81Y 2Y1IA 3LP1A 5H1SV 2DNZA 4N77A 3OUYB 1H7WA 3K59A 2E9RX 4DFPA 2FVRA 1MU2B 4ZCKA 3QJPA 2HZCA 1NH7A 2J8AA 3M32B 4TXSA 2D7SA 1TAUA 4W90B 1T03B 2ZZNA 1AFIA 4Q43A 1TKTA 2LEPA 5A8KA 3OTOF 1D0EA 3JSYA 2YKPA 5B0EA 1DQ8A 4KKOB 2BR0A 1YSJA 2J76E 3GSDA 3G8TA 1UWBA 4JI1F 2V8VA 3LANA 3ZZTA 4RW4A 3CO9A 3V4IA 2ASJA 4RLEA 2BVZA 3BEGB 4H4KA 4I64A 1N6QB 1D9AA 2EFVA 5L38A 3DRPA 4Q7AA 5DG9A 2VFVA 2FTRA 2XBPA 2DISA 2YKQA 3UD4P 2ZOMA 4EEYA 2KFZA 2FLOA 3B82A 2OD6A 5GAEU 2K7JA 3DU5A 1WHWA 6FD1A 1VFJA 2DD8S 5GADU 1J5OA 3JYTA 3O5TB 2QT7A 1B0PA 3CJ4A 4X4QA 3DLBA 3Q8RB 1HD1A 1U24A 2R7TA 4XK8C 1RT4A 1QSYA 2ZBIA 4X4RA 1G3OA 1L3VA 2BRLA 1SUQA 5JVHQ 1HNVB 2RNEA 5DQHA 2XGPA 4DN0A 1FO1A 2WW8A 5KOWA 5GAHU 2J0WA 1FNXH 3NG8A 4ZKAA 4KPYA 4RNNA 2ROEA 2HGNA 1N34F 3PV8A 3IS9A 3CD0A 3H20A 5KFQA 5F0WA 2KFYA 5IZHA 2UUCF 4FXDA 3UD3P 4I56A 4OZLA 5KFLA 4ZA1A 1C0TB 4LVOP 4NLUA 2HS0A 4DUYF 4LIRA 2PT0A 2VG7B 4LVNP 4DR3F 3SYZA 1NK5A 3DLEA 1X5TA 4NCBA 4IR1A 2XSJB 4WKYA 2E5IA 2HLUA 3PX4A 1F0XA 1HNXF 1S6PA 3DLKB 4IFYA 3WZ0A 4JI8F 1HNIB 2GCFA 5JUMA 2ZZMA 4ELTA 3R27A 1TAQA 1JLBA 1NU4A 3E01B 3K5OA 2HHSA 3MOZA 3L3CA 3MD3A 4CO2A 2EI5A 3CC7S 2R8JA 2JLEA 3C66A 1GXLA 3DLGA 3BQ2A 1M5HA 4ATNA 2AF6A 3OFEA 3V6HA 3PVXA 4HH1A 3RRHA 3GE9A 2ZNZA 2AYGA 5B09A 1SH2A 3LALA 3KK3B 3KHHA 4DN9A 2EFQA 5GAGI 1Y4ZB 4M94A 3ISND 4DSFA 4TYAA 1DTQA 3H5YA 4UUWA 3TARA 2MQNA 3SEOA 5A8WB 1GX5A 1KHVA 1TKDA 5D78A 2I8EA 4GMKA 4DMZA 3KMSA 4ECYA 2YX7A 5C42A 3RB6A 3PY8A 2UZAA 3I9ZA 5DLGA 1FA0A 2GQQA 3EXYA 4A8MP 2D3OR 1KLMA 4TNOA 3TUIC 3BB5A 5L1KA 2B7BB 3S8SA 1KRPA 2OLWA 1SL2A 1RTIA 3FGVA 2K1RB 4NLOA 4G1QB 4TY8B 2FJXA 1Q81T 4NXMF 3Q2TC 4OHYA 2EW9A 2HNYA 1SJQA 2CQIA 5HLFB 5KG0A 2OSQA 1YJUA 2ASYA 2PN6A 4X64F 1FJEB 2XCPA 1HL6A 4W92B 3OTEA 1C0UB 2OAUA 1XK8A 4NXNF 1E6VB 4HDGA 2FVPA 1M0SA 2PI5A 4DLEA 1QAYA 2IVMA 5AE3A 4J9MA 4ELVA 2DPIA 3PM9A 1N0UA 2VG5B 4KGMA 3GILA 4O3SA 1MMNA 2JOQA 4USHA 3N6LA 1BY9A 5IFMA 4PWDB 3CEDA 2R7QA 4DG1B 3OXFA 4O44A 3U1MA 3CCLS 2HYIB 2G4BA 2B4PA 1H7XA 2W24A 3KG0A 3MM5A 2XMMA 2FB0A 3NLCA 1KN6A 1HWJA 3JB9k 3GFZA 2RKIB 4UW2A 5KFUA 3QZ7A 3NCRA 2K3KA 3DYAA 2HVZA 2IC3A 3QJLA 2VQFF 1FEEA 4A8FA 2ZITA 3H2VE 3HVWA 4K5SA 5GAEI 3OJSA 2FVSA 1JWWA 2AJ0A 3Q0AA 3HHDA 4DSEA 2B7CB 1FXLA 1WI6A 5GADI 1UL3A 2LU2A 3HM9A 2VFRA 2RMLA 4TQSA 2BJEA 3W2VA 3W2WB 3QIPA 4YR0A 3MUMP 3C6UB 2MYFA 5KFDA 2N82B 1S9FA 4EZ6A 2J7KA 4WXOA 1HBOA 3CJ2A 3CCES 3IG1A 3TOQA 4DSIA 2C28A 2Q66A 4QR1A 3FMWA 5GAHI 2JH3A 1RT2B 1KSPA 3QGIA 4WIIA 4EYHB 3T5LA 2YNFB 4IO1A 3M30A 5K14B 4QU7A 2CQGA 1R8PA 3CCRS 2WSEC 2JWNA 1YQHA 2OPSA 2MKHA 2LQ9A 5U47A 1GH8A 4UQGA 1A9NB 5T7LA 1X4GA 2ZNYA 2XS2A 1IKYB 4K4SA 3TRGA 1JLQA 4NMLA 4CO4A 4KGKA 2GJIA 2KG0A 4QWBA 4K4XA 2MY8A 3FCHA 4ZLPA 1KOHA 1RT1A 2CJAA 2C22A 1VK8A 2J6SA 2D74B 1GXTA 1TK5A 4A4JA 2HWTA 1RT7A 3HDSA 3MMCB 4I7FB 1NB7A 2V4JA 1CSJA 4CI0B 3UPFA 1JX4A 4D3HA 4NYPA 3POTB 4L3NA 5L9NA 2V4QA 3BJYA 4MYUA 2EFPA 3PO4A 1C4AA 4IQXA 4LT6A 3SFUA 2XS5A 3EZ5A 2EC0A 2HGLA 4FS2A 1YJVA 5KFVA 4TY9A 2HFZA 2RH3A 3IGVA 5D6GA 3GR1A 4XPCA 3K58A 1IJFB 2OPPB 5MLCV 3MCSA 2C2RA 1UFLA 4C3KA 1F5CA 2B6AA 1CVJA 1KQGB 4KV8A 3N9UC 4TKTA 4LSLB 3UR3C 3Q8SB 3B4DA 3K57A 4H4OA 1RT3A 1S6UA 2WONA 4WU3A 2JJ4D 1JLEA 4OZ1A 4ETXA 4ZK7M 1Q82T 3WDOA 2LXFA 4B3OB 4ALZA 3IBWA 1RT6B 1RTJB 5KAKA 5B0CA 3TA2A 4OHXA 4WCEQ 2B4UA 4DQQA 3MEGB 3M6WA 2RRAA 1TQLA 4X4SA 1DJ0A 4A8QA 1VC5A 2R7XA 2RJZA 4CTAA 4ELUA 1BD6A 5ITHA 3TO8A 4GKKF 1S49A 3N6NA 1HYSB 3H98A 3PACA 2C2DA 3FZ2A 2IMWP 4D3GA 3LWLA 1RK8A 1OQ6A 1T8EA 1VK3A 1SV5A 2QYCA 1YIJS 5J1NA 1SH3A 3FFIB 2YKOA 2ZH4A 3M1VB 2RDIA 2BM1A 3J7Z5 5IQ6A 4U7CA 4X65F 3M8PB 2VG6A 1X9SA 1N5SA 2RD5C 4LF7F 1PO6A 2MZJA 4P2SA 4LMZA 2QO3A 1ZAWA 1EP4A 3DCAA 3L95X 5CHCB 5C25B 5HMWA 2QE5A 3IXQA 3MAHA 3MEEA 2RQKA 3FDSA 4NLSA 3NCPA 2HNZB 2R7UA 3LW5C 2W9CB 1KLNA 2YX4A 4YDXA 2AV5A 2R2RA 2GMLA 1T3NA 3OR1B 4I2QB 1O51A 1Y5LB 4PQUB 1F5BA 3FVYA 3DI6B 4J9KA 1M1KT 2NLWA 1UAWA 4DFJA 5D3GB 2FHKA 1S9GB 4WK1A 1RTHA 2VOOA 1FDBA 3LGNA 3NL0A 2VQEF 2E1RA 4R8UB 3K5MA 4WK3A 3LOUA 1VQMS 2UUTA 3JAMY 1JKHB 1YRXA 2R2SA 1N48A 1FKPA 3N0VA 5CD4H 1L5UA 3PR5B 1TKXB 3J80Y 1TL3A 1FE4A 3OR2B 4HTIA 1VQ4S 3DLHA 2EVZA 2QFJA 4H4MB 1WF0A 3EGNA 3J7YU 5DRKA 4CH1A 3NNHA 2A3JA 1JJHA 1IKXB 1EETA 4TLQA 4EU0A 5KFIA 2O3DA 1BC6A 3ZZ0A 1JLFB 2HFNA 2FJWA 2VBZA 1HI1A 1QSSA 3OW2R 1SL1A 2FHJD 4CH7A 4OL8A 2WRMA 1X4HA 5J2PA 1ZETA 4ICLA 4QZVB 1HWUA 3CXCR 4QOTA 4KO0B 3PFEA 3SCJE 1R0AA 1ULRA 2FHMA 1OIAA 3I4PA 5BYQA 3HKWA 3UNGC 1LWCA 3HVTA 3IWXA 3CDWA 2BQUA 4QIVA 3K5NA 3TI0A 2HMIB 4QJVA 4CNYA 2UVWA 1CG2A 2BBEA 4C8NA 3IRXA 4RUHA 3I0RA 2COLA 1ZM4A 1DLOB 3AY0A 1ZM2A 1I94F 3Q8PB 1KFDA 1TV6A 2FVCA 5KFKA 1LWFA 3UFCX 1UVMA 1N88A 1HBNB 2PE8A 4Y2KA 3TAPA 4AL6A 5F3TA 2EWHA 2B9WA 2J5AA 3KTQA 4NCGA 1G2EA 2CDQA 2Q3PA 2OD4A 3MF5A 4NCAA 2E1MC 3ZZUA 2ZD1B 5AXNA 3IAS9 2U1AA 5KG6A 2D3ZA 5A8RB 4IOAQ 1VOMA 1R27B 4OZNA 3GV7B 3K8WA 4DSLA 2ZOFA 1FKOB 5M2PA 3MR2A 2QA4G 1KTVA 1V9OA 1LW2A 3VZHA 5DETA 3QAEA 3EX7B 5KFJA 1FXRA 5E3CA 4DV7F 1WHXA 1JIHA 1JLAB 1UEUA 4C97A 4JYAF 5B0GA 3VTIA 2M4MA 3M9OB 2IM0A 5LL6d 1CEZA 3F41A 4ZVFA 4YB6A 3MXHP 5AXLA 4QU6A 3MM7A 1YITS 2IHR1 1Y3JA 2B56A 1VRUA 3M2VA 4QQBA 3CCJS 4NLWA 1ZM3A 2VPXB 3ULHA 3HHLD 2DRAA 3GFXA 1TL1A 3EZUA 1D8ZA 2CQ3A 4PKDB 3TUJC 1FVSA 2IM1A 3TVKA 4DFKA 2WTFA 1U45A 4B02A 4IUFA 4I6WA 4ED8A 3N28A 4B9MA 4JV1A 2CPFA 2XLJA 3NS5A 3IR5B 4F4ZA 4QR0A 3ENVA 3RAQA 4B9UA 4KQZA 4C9DA 4RUAA 2CPZA 1L3UA 2LA6A 1ZH5A 3KMQA 2HNDA 2J9DE 4NA3A 2EG1A 1VC6A 3DHXA 4MIBA 3QIDA 1Y0HA 2VBWA 3MMJA 4N5SA 2NUUG 1PGZA 5DGBA 1MW7A 2BW2A 2YWEA 3ISNC 4FP9A 4RBVA 1UKUA 3GG1A 3K5LA 5DJBA 4USJC 4HEA9 1Q79A 1Q4RA 2YTCA 2K7KA 3GV5B 2RT3A 3CVKA 3NBPA 5J2NA 1HBMB 2KVIA 3DRSB 3QO9A 2YWGA 2BV3A 4OJHA 4P7TA 2AGOA 3UW1A 4EO6A 3Q22A 5GMKa 4O4GB 2KDOA 1KR4A 3D1OA 5B7WA 1F60B 5KT6A 4B9LA 1RDRA 1UJ5A 2MXYA 2AU0A 2DR7A 4BDPA 1ZM9A 4IOBA 1YRUA 3CC2S 2J6UA 3OVSA 1U49A 3I87A 1RWUA 3MECB 2KYXA 2YWHA 1JXEA 1GXUA 3O44A 2YNHB 5ADZA 3J7YI 3US5A 4PXBA 1Q7YT 2XS7A 4OZ5A 4YEAA 5CCLA 4HT5A 4QR2A 4C11A 4C8MA 2E7WA 3DOKB 2W8LA 1GNKA 1SIWB 2MB0B 3M8QA 4ZPTR 1TVRA 2HRYA 2IFXA 3O1LA 4IG0B 1O8BA 1N0VC 4PXDA 1Q8LA 2MJNA 5EWFA 2AYBA 4DR6F 1HQUB 2MQLA 2POKA 4ID5B 5AE2A 5SUHA 1ZAVA 3KLHB 1S76D 5I3UB 1VQYA 3GYXB 2I2YA 3M2UA 3PEJA 4Y2CA 4RKUC 2UUBF 2NPIA 4FVMA 3VCDA 1L3SA 5LXRA 2OH2A 1KQSR 1S4FA 4KSEB 2DGOA 4V19X 1IM4A 3PRBA 5DQIA 1UEVA 5F9NA 4ZPWR 3SMZA 4P7VA 3H5UA 4LF4F 2X51A 3TAMA 3MMBB 1BQMB 2BJDA 5IM0A 3R5DA 2YH0A 2VUGA 4EBDA 4ERDA 2GGPB 2H5EA 1HFEL 5EDWA 4NZ0A 4C0BA 1FKAF 4ECUA 3ITHA 2MSTA 1WACA 2ZH1A 2ZE2A 1T05B 3FJ2A 5B0DA 1NRKA 2O66A 2RB7A 3EUNA 4FVCA 2CQDA 3RZAA 3KLFA 4LF5F 1X5OA 1WWHA 1X4CA 2RF2B 1WG5A 4HI1A 2JZ5A 4ZP7A 1LK7A 3MDFA 2OTLS 1HHTP 4MKBA 4N8OA 2M52A 2M8DB 1UVLA 2B5JA 4ZPCA 1R8CA 2AW0A 3FZBA 4K59A 2CZVC 4NYOA 4MKYA 2XMWA 4ZMMA 3EYZA 1HR0F 2IVFB 1S6QB 1SBRA 3CCUS 2F9DA 2ZHBA 3GFYA 3KNGA 2WOMA 4NLRA 3SQGB 4OZJA 3RRGA 3EGWB 4K4WA 3ZZYA 3DRPB 3LP2A 1S1XA 4I2PB 3VQTA 2AGQA 3Q23A 3MTKA 4R25A 5CQGA 2XI3A 3TA1A 3ZFVA 3MM6A 3DM2A 1MROB 2FIUA 2P9CA 3QAUA 4CT8A 4DX8H 3G4SS 3S01A 4RNHA 3CJ0A 2ZH5A 1AXQA 4QPXA 1LWEB 4ZOSA 4IH5A 2HS4A 5CYQB 4Z37A 2KKHA 2OMOA 1U1PA 1JLCB 3MEDA 3G6ES 5A6WA 1YJRA 3GIKA 2K2PA 5A0YA 3HHLA 3OL7A 5I42B 2BUNA 3LO3A 1PC5A 4YR3A 2R8IA 1UVIA 4ED2A<