4UY85

Molecular basis for the ribosome functioning as a l-tryptophan sensor - cryo-em structure of a tnac stalled e.coli ribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
148
structure length
148
Chain Sequence
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S RIBOSOMAL PROTEIN L32
publication title Molecular Basis for the Ribosome Functioning as an L-Tryptophan Sensor.
pubmed doi rcsb
total genus 18
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uy8501
5GAHI 1ZAXA 4NWBA 5GAGI 3J7YI 5GADI 5D8HB 5GAEI 4V19J 3J7Z5 3A1YG 1ZAVA 1ZAWA 5D6GA 3JSYA 2QA4G 4UY85
chains in the Genus database with same CATH superfamily
4ZIVA 4ECRA 3FRYA 3O6QA 3VQTA 1RAFB 2NSCA 3U7JA 3L7UA 3I32A 1N0UA 3OL8A 1RT4A 1N54B 3R1HA 4J9RA 4DV3F 4NCGB 2E44A 1DBDA 2EFVA 1R8AA 4DLEA 1WHYA 4GVLA 3UNYA 2XS7A 3LOUA 5GVQA 1GXTA 5D6GA 2V69A 2XULA 2GFFA 3W9IA 3H59A 1H2TZ 3OFHA 2AEMA 5DLFA 5ETSA 1SJ3P 1XNRJ 4OYAA 1MMNA 4DV6F 1WNEA 3K5NA 1XK8A 4ZVQB 3R1LA 5BYQA 3RG6A 3ZZ0A 3ZTRA 3TI0A 1YRXA 3IBFB 4X62F 3S7RA 3KK1B 2HFSA 9RUBA 3QNWB 1WJ9A 4LRAA 3MFIA 2MY8A 2MKHA 1Y5NB 3N28A 1NPKA 1UVJA 4DV2J 4Y3CA 3RAQA 3QGGA 1O6XA 3EICA 1Q86T 3VGUA 3DOKA 3M2RA 3GIJA 4EO6A 3I6PA 3FQLA 2W9BA 1DFDA 1MU2B 1QE1A 3W8GA 3GJTB 1S7IA 6FDRA 3BR8A 1S1UA 3ILLA 4CTAA 4WP3A 4N7TA 4JV0A 2CPEA 3KUGA 4DV5J 4LRDA 1RCXB 2CQCA 1RT6B 3EUNA 3JSRA 4KJIA 4LQ9A 1X4GA 4CO1A 5D3GB 3MOZA 2E9ZA 2RAQA 4ZHRA 5F8LA 4HT5A 1LFPA 2B9XA 4QU6A 1NHUA 1EARA 3GIMA 5KG0A 2CQBA 3I9ZA 1HBNB 2BKOA 4CH0S 5CD4A 3BO2A 4I1TA 4IG3B 4LBPA 4DHVA 5A8KA 3HVTA 1QSYA 3C14A 2FY1A 2GMHA 3KXDA 1JJCB 4F3OA 1TR0A 3QO9B 4K2JA 1VQ4S 4QW9A 3LWMA 4YQWA 1SL2A 2K1RB 1KOOA 1FXDA 3J80U 2HHWA 3LO3A 2XLJA 4USVA 1BQNB 2F40A 4MIBA 4DR3J 4U7UK 3PM9A 4LR8A 4NWBA 4LF8F 3TAQA 2GJFA 3FCHA 1FWKA 3ONQA 3MMAA 1F3VA 2CZ4A 1I5OB 2W01A 2ZEJA 2QTWA 3L4BC 1SL1A 2XC9A 2AMCB 2M8HA 4YB1P 1RHQB 3IG1B 3D67A 3AB4B 2FHOB 3TQ1A 4JBCA 5KOXA 4F0HA 3G6VA 1Q1KA 5H9EK 2QMUB 2KVIA 1GX6A 2RDDA 1Y00A 2QJ3A 2XHWA 1N6QB 4B3RF 1FDBA 2MGZB 4DSFA 2YNIA 1F2GA 4A8FA 1S4EA 4RBTA 4ELVA 4FBTA 2W2PP 3M2VA 4F3QA 2UVUA 2FZGB 1WC3A 2EFQA 4IOBA 3M8ZA 4EZ9A 1ZM4A 3QIPA 2AEFA 3B4DA 2IM0A 4LFAJ 4OYWA 4I2PA 2HSEB 4DSEA 2DRAA 5LMNJ 2A0FB 1X31C 2JL9A 2DCUB 3CC7S 2M0GB 4URQU 3BGUA 1S9EA 3Q8PB 2Z2MA 1Y5LB 1OY8A 2XHCA 3SV3A 1VQ5S 3CPWR 2BJ9A 2XMTA 5JJBA 4TU9A 3DHWC 3V81B 1Y9OA 2AD9A 4EWTA 3QZ8A 4DUZF 5H9FK 4RW8A 2W2QP 1K0TA 1QSLA 2VODA 3CJKA 1ZAXA 4RW9B 1DQ8A 2H48B 1FK9A 3VAGA 4PPZA 3HHEA 2BW2A 1B0PA 4K50A 4IRCA 4FKYA 3TUPA 2V8HA 3GV7B 1WEYA 3N5BA 1FJ7A 4WP8A 2XCPA 5HO4A 1VISA 4O3PA 3B78A 1RTHA 2NYHA 3G8QA 3QIDA 3DOMB 2HFZA 3L7PA 4YN3B 3QFWA 2RRAA 2WVFA 3UR0A 4CP5A 1IJFB 1FERA 1RWUA 3CVKA 4X65F 2FZCB 2KXHA 2RVJA 4PZVA 5RUBA 2CJQA 1X5TA 2BE9B 1K1SA 3GJRB 5KFTA 3B6BA 4X64J 4P7VA 1VK3A 1UTAA 2CFXA 2FHJA 1WEXA 3KLGA 2D7SA 1I1GA 1HNIA 4L75A 2AF6A 1U8WA 3K5MA 1BQMB 1HWJA 3W61A 2XM3A 2N7YA 2VASA 3ET6B 4ELTA 3ZO7A 3ZTOA 2DO4A 4HHUA 2GQCA 1VBXA 2V9WA 3M9OB 1GEHA 2FHJD 1T05B 3GG1A 3W8PA 4NEZA 1NB7A 5A8KB 1JJHA 1UWBA 1KD1T 5IM0B 3SV4A 3THTA 3GE9A 4R8UA 3DI6A 3TZXA 2ROGA 1HNVA 3BH7B 2CJKA 4I69A 3ZTPA 2YKQA 2AJFE 5DG7A 2D3ZA 2DGTA 1L3SA 3J7A1 3I55S 1RT2A 3BQ2A 3QAEA 3OTCA 2SXLA 3FUYA 2AJ0A 4YS2A 2GHPA 2MZJA 2YKMA 1CJTA 3ZZYA 3LUYA 4G1QA 2RRNA 5HQLA 2YVSA 5CZVA 2VKZG 1XERA 4ZOSA 3ZNUA 1B7YB 1NZ8A 2DB1A 2PEBA 2GIFA 1XNQJ 1TMJA 4NLTA 2ALZA 3UQSA 2FLLA 4MT1A 4DS5A 3E3XA 1ZOTA 2GJIA 5KFAA 1AZSB 5JVHQ 1IKYA 2F1FA 3PRBA 3BGRA 2W9AA 1GX5A 4M5NA 3CJ5A 2AKWB 4MH8A 1GMVA 4K4TA 3X3UA 2XMUA 3JS9A 3MM7B 4ZITA 4Y0FA 2VG6A 4BBYA 2X1AA 4WKYA 1KQGB 4F7VA 2B6AA 3CE8A 4DX8H 1S1TA 2MDAA 2HNZB 2IRYA 3G71S 1LWFB 3KK2B 1SPBP 1N5QA 3D4JA 4WJBA 4ES1A 3IA0A 2XGPA 3CJ2A 2CQ3A 5E3QA 1NM2A 4UY85 3Q86A 3PYEA 5BR8F 3FEZA 2CZ9A 3H98A 1BGXT 2ZNYA 5KFIA 4ILLA 2WBMA 3D9BA 1GXLA 1XEZA 4OIXA 2DJWA 1U02A 3GLJA 2LVWA 4QWCA 1N34F 3JYTA 1RTDA 4LF4J 4BWJA 1NK0A 1UVKA 5KOWA 2QL9B 2O1PA 1F9HA 2Q66A 1XR7A 1XR6A 2VG5B 3HCXA 4NZ0A 4DR4F 8AT1B 1Y10A 3IS9A 4C48A 3KLFA 4OQJA 1U1MA 4Y2CA 2RRBA 3FVYA 3UCGA 4K4ZA 4HI1A 1RTZA 4GO7X 3NWGA 2UXDF 2F5GA 2C3UA 1N36J 2CKWA 1GMUA 4B3MF 4QBUA 1LNQA 4DR1J 5D0GA 4HKQA 1RJJA 4DU8A 3FSXA 2HHTA 1M5PC 1S1WA 4YB5A 1U49A 1FFGB 3CJTA 4ZP7A 4MKYA 1SIZA 1RTHB 3KHGA 3OJUA 3TAMA 2QFIA 1XN9A 4ZVEA 3MEDB 3BGFA 2PA3A 2W2NP 1NCLA 3I0RA 1FNXH 1KKHA 2I5JB 2B9EA 2RILA 2VQEJ 2MQNA 2YX7A 3NY0A 3M6WA 4BC7A 3H42A 4DQRA 1RWOB 4NE9C 4A8OA 5HBMA 4WFAQ 2ATCB 1KHWA 2DHSA 2Z57B 1Z4UA 3PR4A 3TR5A 4OI6A 3ZZUA 4DR7F 2FJEB 4AXJA 4P2SA 4F50A 1Q5VA 3FEYB 4LF7F 4WXOA 5F8NA 3LP2A 3VHQA 1XMQF 1RISA 1S99A 3OR1A 1EHWA 1F60B 4P73A 3ETMA 4M5HA 3NAHA 2XO7A 1TK5A 2E66A 2Y1RI 5DZ6A 2YNFB 1EETB 5HLFA 1M5VC 3QJPA 1TMMA 1CULB 2F4FA 2LA6A 2ZH9A 2ADCA 4RX6A 1UJ5A 3EGWB 2E29A 2V50A 2UXCJ 2HVEA 3F44A 1LW2A 3JB9k 2M5YA 2APOA 1MWYA 3LANA 2CWXA 3ISND 1VC5A 2EXUA 4KTQA 5KFYA 5U47A 3BEGB 2DGXA 1BMQB 2GS8A 5KG7A 4ZJLA 1S6PA 1BD6A 3AXKA 3W7BA 2YXLA 1U09A 2MZQA 1HMVA 2GZOA 1S49A 3QATA 2PC6A 8RUCA 4KO0A 2D9PA 9ATCB 3EJMA 4OJ1A 1GFWB 1CC7A 1T11A 4IO1A 5KFWA 2BJ7A 3R9LA 2XY5A 2XNRA 3VR1A 5KFNA 2YWFA 3HVWA 3TW0A 1WF0A 3GV5B 3PIOQ 2CQ2A 5J2MA 3IRWP 3H90A 3VF0B 1SC4B 1C1BA 4ZVPB 3UPFA 5AE2A 2CQIA 5KFBA 2MQ8A 2GHWA 4TY8B 5HROA 2KJVA 3LPYA 4WZQA 2DCLA 1PIEA 4ERDA 2KFYA 2JNJA 5B0EA 1M1HA 5DS7A 2Z2ZA 1HHTP 1QAXA 4F4YA 2QLWA 1S5ZA 1RQ0A 1X8DA 3L95X 2GGPA 2J6TA 1U1KA 2EFNA 4CLTA 5A8RA 3J7ZT 2DHHA 5EX0A 3MPYA 2RD5C 1JLQB 1L3TA 4ED1A 1DTTA 2YWHA 2KI2A 5HI7A 4CLWA 1WHWA 4DUYF 3HJFA 4MIAA 4DR6F 1GAOA 4FP9A 1VQ8S 2E1AA 5T7LB 4NLOA 3KOAA 2AV5A 2HK2A 3VGVA 4DPWA 4CO3A 3ENWA 1DJ0A 1S6UA 4C7QA 2C42A 1N8RT 4DS4A 4KY3A 1NDKA 3G82A 1KEKA 4PUOA 4C9DA 1NJZA 3PO5A 2XYPB 2EG1A 4FVCA 4RWWA 3UDEA 2BEFA 2VC0A 3B54A 2JJ4D 1FF2A 3SFUA 4A8WA 1ACMB 2V9KA 2VB6A 4QWBA 5LL6d 1W2BR 3GJSB 1PILA 4PG8A 2AZ1A 3UCUP 3E2EA 3HHLD 2RU3A 2H5IB 2V2QA 4D3HA 4HL9A 4ZPCA 2ATLA 4FF2A 2ZBQA 2XEXA 2X7IA 2E5LF 3DOLB 2GC8A 2H4YB 4I4BA 1RYSA 2XB2D 2HRYA 3H25A 2QN6B 1RT3B 5KFQA 3C6TB 2M52A 5DO2A 1IWGA 1M1GA 4O3RA 3GFHA 2MKKA 3WBZA 3UVJA 1AFJA 3JSYA 2ZD1B 1DY3A 2O3DA 1UPMB 3DRPA 1X7VA 3KLEA 3IO1A 2MZ1A 3OTBA 5FDLB 5I42B 3GILA 3G4SS 2DNQA 1RB0A 4RNHA 1UW9A 2XNQA 4X4SA 4KV8A 1N4LA 1U48A 3V4MA 3DLEA 1TVRA 1JKHB 1X4AA 2J6UA 2HVHA 2C28A 1BLUA 4RW4A 2C3OA 3T5HA 3QJLA 3FC9A 4CO5A 1WC4A 2IM1A 4AUKA 2FTRA 3VVTA 1TAUA 3C3LA 4LF1A 3DC2A 2DGSA 2KB2A 3OHAA 2OJ3A 1NK4A 4DSJA 4ECWA 3JQKA 1B0TA 4C2MA 1UZDA 2RUGA 3A8JA 3CCQS 4B9NA 2CZVC 3EX7B 3Q83A 3UI3A 2HQDA 2RHSB 3KJVB 1R8BA 4USMA 1G2EA 4I2QA 1AB8A 3O5TB 3OR2B 3BQ1A 3SQGA 1N5YB 2BUNA 3W2WB 2CXEA 3DDKA 4H4KA 4AL7A 1RGVA 4MFBB 4LF6J 3BKUA 2Z30B 3E51A 2C2KB 1FKPA 3J80Y 1NKEA 3DRYA 1HMVB 3NXZA 5DQGA 5HP1B 5HL7Q 2BRLA 3Q22A 1FFWB 1R27B 1TUVA 2IVYA 3OD2A 1IXKA 4ED3A 3CUNA 2VU5A 4FF4A 2EG2A 4K59A 2G0JA 2D69A 3KHHA 3BYRA 1R31A 1D9FA 3KLHB 2WBRA 3M8RA 2F8HA 5JXSA 1T8EA 2KFNA 4QYRA 1NKCA 2HNDA 4OZLA 2N82B 1WORA 2W7OA 2RS2A 5DQIA 3T1HJ 2LQJA 1E6YA 5J2NA 1CJVA 3MCOA 2NCKL 1P9QC 3D6HB 3FDSA 2QG9B 4EYHB 3V6KA 3VGSA 4DPUA 2UVRA 3IMQJ 4CLKA 5I3QA 2B7CB 4Q0BB 2AJQA 3Q23A 1TKTA 2DNOA 4G1PA 5M2RA 1XC9A 1JLEA 4UF4A 2DISA 4NLSA 5I3UB 1DURA 3H2LA 4DPYA 3AB2B 4X4RA 2M7SA 2LFVA 2LEPA 3I0SA 4KGVB 5LXYA 1ZTWA 2X51A 4GVBB 2JEJA 1LK7A 2OPSB 5CD4H 2E5IA 4KT0C 4ED5A 2GCFA 1GQEA 3HI9A 5BXIA 8ATCB 3MTKA 2VG7A 3BBBA 3K57A 3NKYA 1YJWS 1XWLA 1FWLA 1KP6A 2P5VA 3HHLB 1YRTA 4UQTA 1Y7PA 2GO8A 2PMHA 5K5MA 2BJEA 1XMOJ 3G8SA 1DTQA 1KTVA 1T03B 3PCOB 4HACB 1KR4A 1D09B 2OPQA 1VBKA 2CPZA 4UOFA 3GG0A 1RHJB 2HG4A 4JP8A 1QLNA 2UXBJ 2B5JB 1S0NA 2JEGA 3Q8SB 2OPPA 1ZPWX 2NQPA 3RRHA 4NLPA 3KLIA 2J9EA 4Q8EA 3ZZTA 1RA6A 4M8LA 2HVIA 1RAAB 2EI5A 3KG1A 3M2UA 3NBPA 3IAS9 3C2PA 4UOHA 4N41A 2CPIA 1PAUB 1H98A 1MROA 3FFIB 4IDKB 1FD8A 3SSQA 1EP4B 4IFYA 1EZZB 2AP6A 2HFUA 2FLOA 5KFPA 1UW4A 4WFNQ 4TLRA 1S9GB 1NDPA 3DXBA 3QFHA 3QWUA 3I31A 3EPIA 2F9JA 3MCSA 4A8MP 1IBLJ 2F8MA 4TVAB 3NCPA 1W7WA 2R8GA 4NXMJ 1N32F 2HAFA 2AX0A 2L08A 3NS5A 4RBUA 2P8IA 3A12A 1VQKS 4LFBF 4IH6A 4QQBA 3KK3B 4RO0A 4F4XA 3DCAA 2FJAB 3OBIA 2VQFF 1KWMA 1WKJA 1VRUB 1G1XA 2ILYA 1SC1B 3CJ4A 2GIQA 2HRUA 2PDAA 3BDEA 2JOQA 1VQLS 3DGPA 1KHVA 2KYZA 1FE0A 2HBYB 4KHMA 1Q53A 2ASDA 1V5IB 3K5LA 3FBEA 1HNZJ 2HS4A 3P49B 3R7NB 4GKKJ 2VPXB 4F67A 4B3SF 3CDUA 3AT1B 2M3DA 4RLEA 2DBBA 4M5LA 4C8KA 4C8OA 1VRTB 4FYWB 5F0WA 3KKFA 2V4JB 3QT7A 4R25A 3O44A 3T9ZA 4KPCA 2H3EB 2YNHB 3SSSA 5LT5A 3GFYA 1JK9B 2P9GA 2CQDA 2UXDJ 4K4VA 4XDDA 1F3FA 3MUMP 1SKRA 2JRSA 1LEOA 4IH5A 1IR2A 3OT9A 1R0AB 3BYPA 3QGIA 2F7VA 2BZ2A 2LP4A 1RTJA 4YDXA 2G0IA 2R7TA 2R7OA 4K2XA 3AJDA 3QPIA 3HULA 3MURP 2MKJA 1RHUB 1YJNS 2X3DA 1TL3A 2J0SD 1KDNA 2H1YA 1VQPS 1JLBA 4EU0A 2ZE2B 4XPEA 5ETMA 5F0UA 5F9NA 5KG3A 3KWMA 1NH8A 2LU1A 1C2PA 4FVMA 1RTIA 4RR5A 2E5HA 3OXFA 3M8QB 1VLYA 2H4WB 3HFVA 1VC6A 2N3LA 2HNYA 2DRBA 1RWNB 4OZ1A 2VFVA 2XMKA 1TKXB 4ZLPA 1ULRA 5J1PA 3BF4A 3IAM9 1T9YA 3EVOA 2EEYA 2EKNA 1P6TA 2Y1JA 3D1HA 3Q24A 4IOCQ 1JNRB 3J7YI 1KLNA 2ZH2A 4J90A 2J0QD 3PW4A 4B3OB 4Q43A 4P9SA 6AT1B 3MM8B 2HQFA 4RW6A 2VKRA 4JI3F 2OPPB 1PC5A 2ZITA 5IT9U 1OQ3A 1VHIA 1MW7A 1NJWA 4OMFG 5HAOA 5ETQA 1QVFR 4JI7F 3NBPB 2DNGA 4LF5F 3M7VA 1IVZA 3AJ1A 3L09A 4B3TF 1IKXB 1REGX 1H2UX 5LSOA 3V6DB 2AWZA 4KH0B 3PVXA 1HPZA 1B70B 2RUSA 1VQSA 2ZJPQ 2AEJA 1T9WA 2RH3A 4E98A 2XMJA 3Q2TC 4YHHF 1NHKL 3MEEB 3DRRA 1RKJA 4NLDA 4PQAA 1SI9A 2HAIA 1U25A 2U2FA 2YKOA 3G9CA 1KFDA 4CRJA 4OI4A 3LW5C 2KG0A 1CLFA 2V5HG 1WHVA 1ZPVA 1ZA1B 2WCXA 3ENAA 1U1NA 2IBOA 1H2VZ 3VZIA 4USUA 4DMZA 2Q3PA 2CQ0A 1U26A 5K8NA 3QT6A 3VAIA 2XMWA 2UUWA 5CCLA 5DDOC 1FTRA 2RSQA 4R5PA 2NYIA 1LQ9A 2P9EA 1UP1A 3KDNA 4CO4A 2BQ3A 2XLKA 5LMUF 1YIJS 4F4ZA 4Q2MA 3W63A 3OSNA 3JQJA 4OYOA 1TUWA 3A8IA 2ASLA 1FVSA 1FRXA 3M8PB 5KFXA 3UE2A 5ADZA 1OWXA 5ETNA 3RB4A 1RABB 2C2MB 4IG0A 1UKUA 3UN5A 3PW7A 3UCZP 1RHKB 1HWUA 1IUJA 5FD1A 2OIHA 3A13A 1H73A 1TL7A 1KQSR 1LW0A 2QA2A 3O8WA 4DG1A 1WKKA 4ZLLA 2OKQA 1UA1A 2DNPA 4CLLA 4YOEA 1AA1B 4CLSA 5AE3A 2UUAF 4X4TA 2B4OA 1HQUA 4ZVTB 2OPRA 4X2BA 3NRBA 4ZN1A 1HWLA 4HT7A 2XGQA 4FDFA 3W62A 4P2FA 4JV2A 3GIRA 2GIRA 3LP0B 2A3JA 2LQ8A 3T41A 1PJ7A 2VPZB 3ENQA 4M5DA 3MUVP 1JMTA 1YHQS 2OELA 4IO9Q 1CJUA 1UETA 1VRQC 3DYAB 5ETKA 1WOSA 3IR6B 1S6OA 2V94A 4TY9A 3LALA 4J9UE 3HKWA 1C1CA 3IM9A 2ZM6J 3MPUB 2HURA 3MECB 4F26A 2EFGA 5L1LA 2YTCA 1U0HB 1S9FA 1NDLA 2XO6A 2NS1B 2B9WA 3R7SB 2ZOMA 4YB7A 3MM6B 3IP0A 5J1EB 1K47A 4JI8J 4JI5J 3QSYB 2MMYA 3AD7C 5ITHA 1CS4B 3T5KA 3P4UB 5C42A 1BWVA 2VBYA 1WOOA 4PRFA 3HT0A 3DFEA 1HNXF 4C11B 3TAPA 5HMWA 2IA0A 1TFWA 5KFUA 4E0DA 2Z8QA 3T5LA 2L9DA 1B3TA 2WK4A 3C15A 3MMJA 1F5AA 2RB7A 2WONA 1YBUA 1S1VB 4CO2A 3CMES 1HLWA 1HHSA 4J5OA 4M95A 5B0DA 1LWXA 4Z2XA 4UT4A 1DZ5A 4EMDA 2LDIA 4FYDA 1QY7A 1Q8BA 2AHOB 4GKJJ 5G4DA 5AJ3F 1HR0J 1IBKJ 2ZH1A 2XI2A 3C8YA 4JI2J 1E6VA 1RAEB 2ZH5A 1U45A 5KFJA 1RHRB 1I94J 3B82A 1X0FA 2A2CA 3BBCA 3PG9A 2GVDA 2GW8A 4QWAA 1YBTA 2BVZA 1VQOS 1ZETA 3W2VB 1S59A 4DCPB 1DHMA 5DDRC 1S97A 1URRA 3GJQB 1FRIA 2FHMA 5EWFA 3R27A 3MMCA 3J81U 3MEGB 4DWIA 4DV0F 1ZZFA 2P6TA 4HHJA 1M5OC 2C2RA 2L9WA 3ITHB 4NL5A 1R6VA 5K14A 2ALYB 3MM9B 1ZM2A 1IBMJ 3OTDA 4XDCA 2W7AA 1Q78A 2GAHC 4PQUB 2J6SA 4X66J 1S48A 4PWUA 2ADBA 3BSOA 1U24A 3M05A 3MF5A 4NLXA 2AYEA 4ZCKA 2VC1A 1NK6A 2AJ1A 2KHDA 5MAOA 1AW0A 3OW2R 4IYQA 3V4IB 2FB0A 1CSJA 3FCVA 2ZJQQ 3N9UC 3SCJE 2VFSA 1FDDA 3N4WA 3W66A 1P9YA 3FK4A 3D2WA 4U8VA 2DPJA 2NXCA 5IV4A 1GK8A 4WXWA 3R2CJ 3VAJA 3MAHA 4OHZA 2QYGA 4DPTA 3G6XA 2YWKA 3D3CJ 3BPDA 1V6HA 2HQGA 2YX1A 1WHXA 5IWAF 5KFSA 1T3OA 4ZLJA 2VBXA 1FRJA 4ICLB 4PG5A 1UFLA 4JI6J 2A18A 2IM3A 4PXEA 3NGKA 1FX2A 4IFVB 2MQPA 1NJIT 3M30A 4PPDA 3RYLA 3DRSB 4K4XA 1O8BA 2UU9F 2NXJA 3TEGA 4DQQA 1UCNA 5F8JA 4USWA 5AXLA 2KVQE 4QIVA 3EVWA 1YTYA 3PRVA 4OX9F 3DMJB 4OI2A 1M1KT 4NLRA 1HD1A 1JLFA 1CJKB 1JXEA 4XTTA 2V2KA 5KFRA 1ZBTA 3BR9A 2DIVA 2YKNA 3MUTP 4OZNA 2PFDA 1NAQA 2EBGA 4WWSA 3LA0A 2W24A 5H9FJ 2DH9A 1EB0A 5M2UA 4P71A 1UVIA 2GQQA 1REVB 5G0RA 4NOHA 1RT1B 1H0HB 4NYZA 1IQZA 2COLA 1SVDA 5ETPA 4USKA 1U0SA 2MQOA 3BZQA 4ECXA 3CD0A 2BV3A 2DIUA 4KGKA 3LGNA 2F4VF 3WHIA 3K8VA 2IJFA 1UJ4A 2PEHA 3K7RA 5HMYA 1IKWB 4OZ0A 3NAIA 3BSAA 2QMWA 2BANA 2IAJB 3WQPA 5E0OA 3JSMB 2RQ4A 2CPYA 3HHKA 2NXNA 4ZMMA 1X5PA 5A6WA 4KFBA 5KFEA 3CJSA 1A6LA 1H72C 1FJCA 2KYXA 1S1XB 1SJ1A 4L3KA 2MHEA 4I6YA 1YLXA 3GQCA 1D3WA 1KOHA 2FGOA 5D77A 2VJUA 4PR6A 1GNKA 1LWEA 3IRXB 2IC3A 4H4MA 1YWXA 1FKOB 1IQTA 1XMBA 7AT1B 3CMQA 3C6UA 5K8MA 2MQQA 4ZS6A 2ZOGA 3NCRA 5KT7A 3UDCA 4W90B 1NXIA 2ZHOA 4MAKA 2V8PA 1LWCA 3MMCB 3W65A 4F3MA 2WVCA 4CZCA 1SH3A 1TL1A 5HJXA 4NA2A 4L74A 5A0YB 3D6MB 4CO0A 2LLZA 4N5SA 2QL7B 3SSRA 4KHPJ 5K14B 3LAMA 5B0BA 1RAOA 4X4QA 3MD1A 4WCEQ 4KGXB 1D8YA 1Y4ZB 3EYZA 3H0PA 6FD1A 5KG6A 3T1AA 3CCVS 2KJWA 2BM0A 4IQXA 1N48A 1RUSA 4TYAA 1PO6A 5KT3A 2MHNA 3ZXWA 2J7WA 2W9CB 2IM2A 4QIWD 4DEZA 3HLUA 4G65A 1RACB 1U6FA 3DDNA 1NBEB 4E8UA 3UDVA 4DX7A 4LSNB 4LF2A 4LRFA 2J5AA 2PIIA 3GFZA 3NOCA 4ED0A 3D6TB 4K5SA 3TYTA 4KYZA 1DLOA 1V3ZA 3RBDA 3H20A 1NH7A 4JYAJ 2RIJA 4RU9A 3K89A 2DNNA 1YKWA 2Y0BB 4DBQA 2OUGA 5LOQA 3UD4P 4BCAA 2IVMA 1SUQB 3OVAA 2UZAA 3KJFB 3MMBB 4KE5A 4HHHA 1SJ4P 4A8YA 5I4MA 1SBRA 4F25A 1FEEA 3RAMA 3KUEA 4DN9A 4O4GA 1B0VA 2HMIA 4WZMA 2WTFA 1OS5A 3UO0A 3ZFVA 4CLPA 5F8IA 3AAWB 3LAKA 3X1LB 5HVGA 2HHHF 5DDQC 2CQPA 3CD7A 5DRKA 1CQNA 4Y2AA 4DV7F 1TKDA 4LSZB 3H5UA 2DGWA 2DNRA 2RJZA 5DGAA 4F36A 1TZ0A 1YVFA 1SL0A 3RB3A 1VR6A 3MCNA 5F3TA 4C3MA 2M70A 1HNWJ 1PSDA 2I38A 5D4LA 2BX6A 2M4MA 3VGTA 2UP1A 1SB6A 5DM6Q 4RUBA 4H4OB 4X84A 4CH1A 5F8HA 4DSIA 1NMEB 2XSFA 4ES3A 4JI4F 3OXGA 3G8TA 1TELA 3QGHA 1PKUA 3OFEA 4WYWA 4DCOB 2YNGB 1CBKA 2IHR1 1UEVA 2ZKTA 1NHVA 4F04B 3D68A 1EJ7L 3HHNB 4C98A 4YR0A 2YBVA 2BJ3A 4LFCF 2PFFB 1J5OA 2JHEA 4YMEA 1VLOA 3OUYA 1VQNS 2DHAA 3OXLA 4ANCA 3LF0A 3P45B 1RT5A 4ZK7M 2FY8A 2FJBB 4LF9F 3AJ2A 5IS2A 3O1LA 4A46A 2JLFA 4CH7A 4B9SA 3GFXA 3W60A 2QLFB 4DL5A 1IKVA 4NXNF 3W5ZA 4ZPBA 4CM0A 1TV6B 3OTOJ 5B0AA 2R7UA 2UVVA 1G6BA 2R8JA 2DITA 1D9DA 2IBKA 4NZ6A 3EDRB 1V3RA 4RNOA 3TQEA 3UN2A 2ZZMA 2P9CA 3GIKA 4ID8A 2GV1A 3MHYA 4OV6A 5L8RC 2J9DA 2W1BA 4DV4J 1UPPA 4JI0J 4DL6A 2GVZA 4ZP9A 4F0MA 3I5AA 3K2YA 2XMAA 2V34A 3C16B 1S6QA 2C2DA 2XBPA 5C24B 3J7AN 4TYBA 3DLLQ 5JMNA 2HQCA 5L1JA 1JWWA 4RPFA 3POTB 1NK5A 5B0GA 4TN2A 1TKZB 4TLQA 3TA1A 4K0KF 4QR1A 1YJUA 3NS6A 4WFYA 4BS2A 4WPAA 1UVNA 1RDRA 4DFMA 3DLKA 1XTZA 4H4KC 3BN4A 1RT7A 1N0VC 4ZP8A 2UUBJ 3CJRA 4PWDB 2CPXA 5E3AA 1IWAA 4NA1A 4NMLA 5AXNA 3QRRA 1MN7A 4EUVA 3K17A 4U8YA 4QPTA 1QJHA 3MAAA 2CPFA 2CYYA 1KC8T 4I67A 3FMWA 4Y2MA 3GP9A 3RW6A 2R7VA 1L3KA 2WAQD 2ZC3A 1FCAA 4EBEA 4DF4A 2LU2A 1HBMB 3W5XA 2A6OA 3GPAA 1WC0A 2VD3A 4U95A 3CCLS 3E01A 4ANDA 4C8LA 4M1KA 2DO0A 3IGVA 2JEFA 5GAHI 1HIYA 1WDTA 1KBRA 3Q2SC 1JLCB 2BE2B 3DM2A 4IOAQ 2ASJA 3JTPA 4DFPA 3THPA 4YR2A 3CJQA 4HLBA 1XNRF 2IMWP 1ZH5A 3TOQA 5CXTA 4O3SA 2BQUA 1Y3JA 4UZCA 3AY0A 3D0IE 3NGUA 1G4CA 2VFRA 3HSGA 1FRLA 5HMZA 3HHDA 3T6JA 4WBFA 3FKBA 2IYGA 2FGCA 3N0VA 3R5DA 4DV2F 3PEJA 4UUWA 2HFVA 4FZVA 3RBXA 3D7SB 1FVQA 1KVIA 2HZVA 4ZCLA 1VQMS 3M6UA 3I5BA 3R5BA 3AOBA 2ZBRA 3PZPA 4WU2A 3NG8A 1J5EJ 5GMDA 3CWJA 1C0UA 4ECTA 5CYQA 4C6AA 2DGUA 4DR5J 2QX0A 3M1VB 3J81j 4DV5F 3FMBA 4WIQA 3ILOA 3MM5B 4FYYB 5AXMA 2MJUA 3MR6A 5CYMA 3K59A 1RAJA 2NUUG 1VIXA 4V19J 1HBUB 3SDEA 5DG8A 3ICLA 3N5FA 4KPYA 3NOGA 4RUHA 3HSJA 2RKIB 2V63A 3A1YG 1SV5A 2B0GA 2ZUGA 2V8VA 2PT0A 1NUEA 4DV0J 1RT4B 1JLAA 1JXVA 3MI7X 4IR9A 1KS2A 5L39A 2M9KA 2V68A 3F0NA 4RNFA 2G13A 4Y2KA 3TRGA 5IQQA 4S0MA 3HVAA 3ZZOA 4Z37A 1XQIA 3KMSA 5J2QA 1HYSA 3QYYA 3U27A 3RUBL 5DJBA 2VIHA 1XJWB 5IT0A 3H5SA 5DGBA 4ZVUB 4DR3F 2CNNB 2AYMA 1LKZA 3PNIA 2HLUA 4X4UA 2R8KA 4E2FB 5J2PA 2VUGA 2KM8C 2HGMA 4ZIWA 1NJXA 1QTMA 4CYUA 4M5KA 5KFHA 2DTJA 1RAGB 3GSDA 1NLKL 1FNOA 1HQEA 1HBOA 2MY7A 3D0HE 2CVEA 4JV5J 2N3OA 4AQYJ 3DOKB 3M2RB 3VVUA 3G96A 3MR5A 2W9BB 1R7IA 1KRPA 4URGA 1QE1B 2DNLA 3CCJS 3UR3C 1FI4A 4NI2A 4HH1A 3C46A 5IWAJ 5E7OB 1S1UB 3HD1A 3IR7B 2FVCA 4CTAB 1RBOB 3DLKB 1OMSA 4HTIA 2HW3A 4WE1A 2RNEA 4I7FA 3J81Y 4LFAF 4ZHRB 2MZTA 1IM6A 2VL1A 5LMNF 2WOMA 4MK8A 2YY3A 1M5HA 3MAAB 1YJ9S 2BW7A 4ZPAA 3RR7A 1U2RA 2CNLB 5HATA 4U96A 5D4PA 4UOGA 1IJEB 2CNOB 2UUCJ 1VFJA 1JLGA 3U1NA 2BQRA 3LP1A 3HVTB 2X1BA 2DEJA 3C14B 1KLMA 4ED6A 4UW2A 4L72B 1VMBA 1B4SA 2HWHA 3A3PB 3QSIA 4P75A 3BJYA 3HF5A 2Y9HA 5GAHU 2XLIA 3QAUA 1NNDA 2EFPA 2E5GA 4FYVB 1D9AA 2W4DA 5KFOA 5HMXA 1N56A 3CCES 2C1EB 3M8WA 3PX0A 2BABA 4CT8A 2HGNA 3BQ0A 3IWNC 1MNEA 2B8QA 2ZKUA 2R7QA 1DAXA 3NNCA 3GYXB 4U6PA 1U7LA 4PAAA 4DFKA 1MMDA 3TP2A 2G2ZA 1C0TA 4EGLA 5A8WA 3MMAB 4K4YA 1S76D 1FWPA 1EKSA 1R8PA 4KSEB 3SEOA 3HSZA 1RHMB 3U1LA 4F4WA 4B9UA 1EAYC 3BREA 3OL7A 4DR2J 4UTGA 5EWGA 4DQPA 2Q6BA 4GC6A 2V8GA 1EIYB 2ZJRQ 3T1YJ 4NLYA 4CLZA 1F9FA 3TX8A 2WSEC 2R7WA 1NSAA 4NLWA 4OJGA 4QR2A 3EGVA 3K58A 1EKRA 4ED7A 4PG4A 2LYVA 3PW2A 2BJDA 2K06A 2YNIB 4X64F 4O0NA 3OLBA 2AQ4A 3M2VB 4ZJOA 4ZDNA 2VOPA 2D1CA 3QIPB 4ECSA 2DR5A 1AUDA 4I2PB 1N33J 4ALZA 4JUZA 3PX6A 1UEKA 4P52A 3CCMS 5E5NA 2V4QA 4K4SA 4WIIA 1SH2A 5KFCA 1S9EB 2XI3A 5A76A 2KT3A 3BKTA 3G6ES 4ID5A 3FRZA 4KH1B 4CIOA 2J8AA 4USHA 1H7XA 1PYOB 3FQKA 2J0XA 4YY3J 2CPDA 2ILZA 2Z58B 3M32A 1P8GA 4DPOA 5E41A 4ZPTR 3GB0A 2VOOA 4RW8B 3IFEA 3E8OA 3CJKB 1TAQA 4JI1J 1YG0A 2BKNA 4KC5A 4DCJB 1C4CA 2QIFA 1FK9B 1I6JA 4C3LA 2RF2A 2KFZA 1JQGA 1TP7A 4M94A 1VGYA 1UFWA 2QGFB 2VFTA 3CDEA 1XNQF 1B99A 4X4NA 5D78A 2W4CA 5CAAA 1GT8A 4ZPDA 4EBCA 1FJGJ 4AFFA 4ZPWR 1S10A 4OYZA 4DL7A 4NCGA 3PYDA 2QZ8A 5K8OA 3TEHB 2VV5A 1WG1A 4YFUA 3TUZC 4J9QA 3D1QA 4GO5X 2D3O1 2DNHA 4OHXA 4FBUA 1S12A 3THVA 1LV5A 1VBYA 2R7SA 2F3JA 4A48A 4DV1J 4CQ1A 1UJ6A 4J9MA 2NR0A 2GMLA 2FC9A 2XZWA 1NZAA 3FJ2A 4OZ2A 3KLGB 1YSJA 1MG7A 2W2OP 1HNIB 4G6VB 3PXGa 2MQLA 4V19X 2F63A 5CZXA 3KK1A 3EZ5A 4I68A 3NWRA 3N79A 4OYBA 4WTOB 4UQGA 2CIMA 1T3NA 1X5SA 5DDPC 4N47A 4J9VA 4K5RA 4ZJQA 1VC0A 4LF4F 4ETXA 2B43A 4MK9A 2YWGA 1UWBB 4AT1B 1SC3B 4W92B 4R8UB 1W25A 1L3UA 3DI6B 1MU2A 5DETA 1HNVB 4TQRA 5E3CA 2RDJA 2BYCA 4B9VA 4KRWA 4O3NA 3CDAA 1T7PA 1RT2B 5E33A 5AE1A 2D41A 2RS8A 1VS3A 1KSPA 1RT6A 5D3GA 1YGYA 2OHDA 2YKMB 1CJTB 4G1QB 4DR1F 2I8EA 4O3OA 4FN5A 1V5VA 3I4PA 3JTNA 2I9SA 1HBNA 3IWLA 3D6FB 2Q79A 3BH6B 3ENVA 1U4BA 1RI7A 4IG3A 3G2XA 3TVZA 1CPZA 1IKYB 3BGRB 3WC0A 2RQKA 4PYAA 3M8SA 3HM9A 2VBWA 4ZVRB 4IRDA 1WEZA 1K73T 4DV3J 2VG6B 3RRKA 2B3TB 4QIFA 3JAMY 1HFEL 2AGPA 3QO9A 2B6AB 2NLWA 4MKVA 1S1TB 2VQEF 2BJ1A 5FLXU 2K1RA 1N5TA 2HVDA 1X4DA 2O67A 2HGLA 4I6AA 3P5TL 7FDRA 1UWAA 1BQNA 1EX8A 1PJ5A 1SQFA 2ZH7A 2BXJA 1L5UA 4N8NA 4DV6J 3H2VE 3Q8VA 4ECQA 2DPIA 2R8IA 3K8WA 3TJ9A 4X62J 2KT5A 1A9NB 1F6TA 3SCIE 3CC4S 5GMKa 5KT4A 4F0KA 3NP5A 3AOAA 2B7BB 3IG1A 3JYTB 1RTDB 4WK3A 2X1GA 2XSJA 2DT9A 4UY8T 3L3CA 2L41A 2LXFA 1N6QA 2QA1A 2BRKA 3IS9B 2MGZA 3KLFB 2CJYB 5ETRA 3WZ0A 3ADAC 4DL0C 2UXCF 2BOPA 1NO8A 3HVRA 4ELUA 2A1BA 3EM1A 2MZRA 2R3VA 4DI6A 1HWKA 2B56A 3A3OB 1H38A 2WVBA 1SJRA 2H5JB 1S1WB 3QRPA 1XIQA 3HD2A 4J9SA 5ETTA 1FXRA 3R97A 1RP5A 2VHGA 2ZVSA 5D15A 2ZH6A 1RKIA 1FFSB 3TAMB 4BLGA 2QSWA 3V81A 5IQ6A 3OPKA 1HQ2A 2GMJA 3ILIA 4QYZJ 3R6LB 2QC3A 2RE1A 3I0RB 3UDLA 2ACYA 2ZDOA 4LUBA 1BWEA 3WX8A 4ECVA 2K3KA 1U8SA 2VJVA 1TQLA 4OYIA 4RW9A 3H40A 5KTQA 4AYBD 5HBMB 5LJ3Y 2OFHX 3G6YA 1J2VA 2N4DA 1NK8A 1BHNA 4HH0A 4LF8J 1OY9A 3JSBA 1X4BA 3CIZA 1F5BA 5DLGA 1X9WA 2QLBB 3DOMA 3LP2B 1X60A 2LDYA 1X4EA 2W4PA 5BJRA 3QT5A 3OR1B 3KNGA 1CEZA 2PE8A 3PHTA 5L46A 2EVZA 2V67A 1DARA 4C0BA 1KONA 4B3RJ 5HLFB 3EVMA 4EEYA 2KZZA 3TARA 4MYUA 2KO1A 1QSSA 3FBCA 4LBHA 3RBZA 3CCTA 4AL5A 5L1IA 1OSCA 2PI4A 5DM7Q 1X4HA 1SQEA 2ABYA 2I6WA 1BQMA 2HS3A 1LW2B 1U2CA 4UUXA 3H8YA 2ZBIA 5L1KA 2IFXA 1SKSA 2E7XA 3ET6A 2IJNA 3DKDA 2HQ3A 2JDJA 3I96A 1AYEA 4EK2A 1T05A 2OTLS 1S6PB 2E7VA 5IM0A 3BGLA 2KRRA 4LJMA 3Q0AA 3KTQA 5KAKA 5T14A 1HA1A 1Z2LA 2MJNA 4KO0B 4CNYA 5SZTA 2CQ1A 4XK8C 4LIRA 5D0EA 3IGNA 4PG7A 2DHGA 4DPXA 3PY8A 5EDWA 4DUZJ 3OL6A 3CJ0A 2CAJA 5C7PA 2WVDA 5J2MB 1VQ9S 3ZTQA 1C1BB 3VWSA 2IJRA 1T9TA 4I6WA 2R7XA 2CVIA 1LOUA 5HROB 3R6GB 1OYDA 4IH7A 4RNNA 5D8HB 4AD6A 1Y11A 3IWXA 1VCTA 2FDNA 2DK2A 4FPRA 4L3NA 1AZSA 1TK0A 2C2OB 3PX4A 2BM1A 5E3RA 2GGPB 3MM7A 3C66A 5A8RB 3AD8C 3UD5A 2FYXA 2GX8A 3C19A 2XSJB 1X9MA 2M88A 1DTTB 1PCAA 4KR0B 4Q2LA 1M5KC 3ZC4A 4X65J 2HNZA 4WFBQ 1SJFA 3KDOA 1LWFA 3KK2A 3Q8UA 2ZWPA 2H9ZA 3SCLE 4V1Ak 4N76A 4KAIA 4R0JA 5LXRA 2ZFHA 3LGHA 1UAWA 3EXCX 4RUAA 1DQ9A 2XYHB 1WWHA 4MTPA 2HBQB 5KFZA 3G82B 1QD1A 4PUOB 2OEMA 4Q45A 4YEAA 3PRDA 4FXVA 3HP6A 4MKAA 1H3DA 1NSPA 3IBCB 4ZKAA 1IR0A 4GRSA 3CCUS 4RWXA 4LF6F 4F4KA 1DRZA 2EC2A 5CYJA 5L9XA 3QJJA 1OYEA 2CADA 2DGOA 2J8SA 2X3GA 4PCQA 2AGQA 2VG5A 2IA6A 1K9MT 3CJ8A 2LEAA 3K5PA 2MLYA 3R5JB 1T94A 2HIQA 2QFJA 2PD1A 1AROP 1NEEA 4B17A 3MR3A 2MEWA 4FS2A 1WI8A 1WD6A 4QCLA 2KHCA 3UVJB 3KG4A 5B09A 3DRPB 2E7WA 2J9DE 1SCJB 3KLEB 3MFHA 3AODA 1M0SA 3T1HF 4URSA 1ZM3A 2KZMA 3WDOA 3HX9A 4DJBA 3GYNA 4OJ3A 5JVGQ 3PACA 3NGRA 4KV8B 1T95A 2QSFA 5CHCB 2CWKA 3DGVA 2CJBA 1P1LA 4ZVHA 3QWPA 3JTOA 3MEDA 2M2BA 3DLEB 5KG4A 1FHTA 1TVRB 1KVKA 3BO4A 2YWEA 4RW4B 2QRRA 4ENOA 3EDQB 1RZMA 3L7OA 2FPHX 2POKA 2I5JA 3R8YA 3ELHA 1U2FA 2W8KA 4LVNP 3U1MA 4YR3A 5D4OA 3G87A 4Q44A 2YH0A 3JXOA 5K8PA 5KFLA 2Y1IA 2VF3A 5BR8J 5KT6A 2MYFA 3F56A 5EX3A 3HJVA 1S57A 3CW2C 2OGUA 4DLGA 2VZ9A 4I2QB 1XMOF 4GC7A 2Y3YA 3O2IA 1NPPA 4QZVB 2XG8A 3SQGB 3CSKA 3CTRA 3S6EA 5HVHA 1FO1A 3LGMA 1N34J 3AD9C 3G86A 4WYLA 2Y1LB 1IM4A 3R7BB 1RXOB 1PYTA 4ETZA 3IN5A 5K20B 4DF8A 1FKPB 2YNFA 2UXBF 1EETA 1WACA 1Y3KA 4HYKA 4DR4J 3OTEA 1YJTA 1CULA 1PJ6A 2QA4G 2G1HA 5E3PA 4JB8B 4IRKA 4QIGA 2AIRB 2I1RA 1W2IA 3EGNA 3TA0A 3FCWA 2Y0SD 2JZ5A 5LM7E 4A8KA 2YPYA 4B3MJ 3DU6A 3EGZA 2YQ3A 1WTFA 2HNDB 3HFZB 1FDAA 4R0EA 2IPOB 1E6YB 1ZAWA 1CJVB 5J2NB 3TZYA 1T9VA 3W1YC 1IN0A 3NNAA 4MK7A 1ITPA 2WB4A 1U1RA 4OI0A 2L48A 4J91A 1OIAA 4ECUA 2BA9A 1IBLF 4ZVFA 3SCKE 1TKTB 4AL6A 1JLEB 2JLGA 3N6MA 3QMQA 3T19A 4NXMF 2G2YA 1TUGB 2DR7A 1KNZA 1VHFA 2RT3A 2OSQA 4BC9A 2KU7A 2XMMA 1H6KX 2WW8A 3W9HA 1B7FA 3CT9A 3I0SB 4JV1A 3I82A 3FBFA 3MZIA 2CG4A 3FNNA 1IBCB 3J7Z5 2ZZNA 4OI3A 2G2OA 4TY8A 3ZZZA 4U9RA 3NS7B 2FJXA 1RWKB 2VG7B 2D9OA 2LECA 1UL3A 4DR7J 1VYAA 3W9JA 3RBEA 3CD6S 3KJNB 4LF7J 2K7JA 3IM8A 1DTQB 4P2MA 1XMQJ 2YQ0A 1HNZF 2KTQA 2OPQB 4GKKF 4NPOA 3RB6A 1JLQA 4B9MA 3UW1A 1S72S 4KBIA 2XZDB 4MMOA 3CXCR 3VAKA 3HMJG 3RRGA 1VQYA 3L9ZA 1NJYA 4C8ZA 1EQ0A 3BB5A 5T7LA 2HVZA 2DR6A 2E5JA 5J1NA 3KLIB 2BE7D 4B9TA 4Y65A 2HZCA 3M2UB 4QW8A 3IXQA 3PJ9A 4NCBA 1MROB 1HD0A 2F9DA 3HZGA 3OVSA 2FUG9 2DR8A 4IFYB 4DZDA 2PMZD 4UOCA 3TNVA 2BBEA 3R5CA 3PYGA 2EBEA 2R42A 5HK4A 4C8MA 2IRXA 3MPDA 4IUFA 5C5JA 5HQ8A 1LFWA 1R8HA 4QYZK 3BS9A 2JFDA 2ROEA 3CO0P 3DOLA 3FZBA 2H65B 5IT4A 1Z1ZA 3S1TA 3MR2A 2KM8B 2ZZTA 3T9NA 2R2TA 1RT3A 5FIIA 2FD2A 3C6TA 2F8EX 3OFGA 2AX1A 2J9CA 3MPVA 1Q95G 3US5A 5CH7B 2ZD1A 3EPGA 4DX6A 1O0PA 3H7HB 2B4PA 2ZNZA 5FDLA 4X4VA 3VV2B 5I42A 4FF3A 5ETOA 3DGPB 2G9OA 5D4NA 1HKAA 3GMGA 2R8HA 3CDBA 4CCHA 3IC1A 3TJAA 5D0RA 1JKHA 2BACA 1UA0A 1BY9A 1GTHA 4LREA 2OD4A 3BBFA 4H54A 4DUYJ 2HLTA 2H51B 4DR6J 3SZ2A 3WIVA 2MKCA 4DOZA 2CA9A 2ZHBA 4Y00A 3MOJB 5B08A 2ZVIA 3TA2A 3PIPQ 1RBAA 1FJEB 3WC2A 3VCDA 3OFFA 2OD6A 3TWZA 5B0CA 4OHVA 4PEOA 3A4TA 3KJVA 3OR2A 2OSRA 1N5YA 3W2WA 3PHEA 1RTJB 2DH8A 4MFBA 2H5EA 1FTCA 3CMAS 2R4FA 3CGIA 1NKBA 1YBAA 4P72A 3RTVA 5FLXY 2R9LA 1PG5B 4DZ6A 5HP1A 3EE3A 3ZNJ1 1Q82T 1TL3B 1UFKA 3DNCA 1JLBB 2IDEA 2PN6A 2IIHA 3SYZA 1ZAVA 2E5LJ 4Q8FA 3QRQA 2E1RA 3NMRA 1KQFB 2FVSA 2MB0B 2A2DA 1FT8A 2JX2A 3SFGA 3OLAA 1RTIB 2R2SA 3R2DJ 1JIHA 3QBCA 3KLHA 2KKHA 2FHKA 4OX8A 3V5RA 2HRTA 3PKYA 4TU7A 2HNYB 1VJWA 2I0XA 2WVEA 2DHXA 1QUPA 2HBZB 1MWZA 3KFWX 4USJC 4ECYA 1VBZA 3PO4A 1KQKA 3BPSP 2EC0A 4O23A 2HHQA 4O4RA 3KHLA 3J7YU 4KKOA 1S79A 4NRUA 4Q0BA 1N88A 4NYOA 2AYBA 4BWMA 3D5MA 5A2QU 1F0XA 2JC0A 2DKOB 1CVJA 1HW8A 4USIA 1NU4A 5I3UA 2ZOFA 3CEDA 3S8SA 1GTEA 4GVBA 4RW6B 1FEHA 2AJ2A 1FA0A 2OPSA 4C4WA 1A7GE 4Y6IA 5KFVA 5B7WA 4WKRA 2OTJS 3AFGA 3MR7A 4ZLNA 3JQMA 4NA3A 2IRUA 4RKUC 3DDIA 2A6MA 1LXNA 3FGVA 1H7WA 3HHLA 1PAEX 3DN9A 3TZWA 2C3MA 4G1IA 5IV3A 4USTA 3BSNA 1T03A 4HACA 1TL4A 1HPZB 1HARA 3P8BB 2MXYA 3FSIA 2AW0A 2K7KA 4FPIA 1RLDA 5F41A 3M8YA 4ES2A 3H4BA 2U1AA 3DRRB 1HWIA 2B5JA 3W3SA 1Q79A 1F9EB 4DX5A 1Q7LB 3AA9A 3PDNA 3MGJA 3TUIC 3LQVA 3QQCD 2ZM6F 1C4AA 2L9NA 1RBLA 3CCZA 2LKZA 2EW9A 4F2RA 4WFXA 3K0JA 4O44A 1VOMA 2JVOA 4JI8F 2Z4PA 3BN7A 4JI5F 2OEJA 2V2ZA 4J9OA 2CQHA 3FFIA 2HHSA 4IDKA 4OJHA 4A47A 1FRHA 1EP4A 2VDHA 1R6YA 2VPYB 2KXFA 4R5PB 3IR5B 3SMZA 3NEKA 1NSQA 1BE4A 1N5VA 1S9GA 3CDWA 4TXSA 2UUTA 2OH2A 2FLNA 2CDRB 4ED8A 1ZM9A 3DLHA 3TUJC 3TO8A 2E9RX 1OY6A 3DXSX 3RB0A 4QWDA 1CG2A 2EK6A 2CRLA 2BDPA 4B02A 4ZCMA 5KFKA 2RQCA 1WF1A 2KH9A 2QLXA 3KK3A 1AT1B 2F65A 5M2PA 4IG0B 1FKAF 2DXFA 4ZN3A 2VA3A 4GKJF 4K4WA 2R7RA 1TL7B 1VRUA 1HR0F 1IBKF 3R5AA 2CDQA 1LW0B 5THWA 1BUXA 4NX9A 3F73A 4DG1B 2ZH4A 2HZAA 4J9KA 4JI2F 4HVZA 5F8MA 4W4MA 3VAMA 1I94F 3HKZD 3LPEA 3MEKA 3AQPA 3KLVA 3FSYA 1HQUB 3SXLA 2OPRB 3QT8A 4B08A 4CLUA 5IOLA 3MDFA 4F4AA 2W7PA 5L9NA 1YZ7A 4JOUA 4OHYA 4M5DB 2P6SA 1VRTA 1CJUB 4M63A 2NZCA 4EI2A 2CJ9A 2MQMA 2V4JA 1YZ6A 3GCWP 4Q7AA 4PXDA 2FC8A 3GR0A 1C1CB 5DQHA 3OSPA 2YNHA 2W25A 1A0OB 4P74A 2Q6CA 4NLGA 1HI0P 1IBMF 2MTLA 2EWHA 4A8SA 3V6JA 3SI8A 4QWEA 4P7TA 3UD3P 1RAHB 1ZZNA 2FIUA 1R0AA 4X66F 1WC1A 1MN9A 1NB2A 1K8AT 1D1UA 5C42B 3AQOA 4MJKA 1QTNB 4C0OC 4M5IA 3RR8A 4WP9A 4Q5VA 2VFUA 2W2MP 4KKOB 4OYMA 3KHRA 3A8EA 2ZE2A 2WZ1A 4XO0A 2EKYA 2M8DB 3C15B 5HQMA 1WUUA 1OPIA 5AT1B 1CQMA 3TX0A 2WONB 1N32J 4NLUA 2FVRA 3P6YC 4FKXA 1S7HA 3OL9A 4LFBJ 3M8QA 4M5MA 2DRDA 2HHUA 4C8NA 3PV8A 4ITSA 4K4UA 1PC4A 1TKXA 2VQFJ 5IXUA 4KHRA 2ZH8A 4EZ6A 1RAIB 4JI6F 1E6VB 4RNMA 4DQSA 2C2EA 3PKMA 4RJVA 3NL0A 2GVDB 1Q81T 5KT2A 1JX4A 1KN6A 1X4CA 2L3MA 3D0GE 2E1PA 4OZ5A 4HDHA 1WI6A 2QE5A 4B3OA 1MLAA 2BKPA 2IYIA 4B3SJ 2MLZA 2O66A 1NSKL 3MM8A 2WSCC 3O3LA 3CF5Q 3RGIA 4FNHA 2ZBPA 1JXLA 5GAGI 2DGVA 4J9LA 4RBVA 1VJQA 2D74B 4QJVA 2DNKA 4O44B 2XS2A 5BYRA 4FF1A 2BR0A 2QA4S 1FE4A 2NUHA 1IKXA 2LQ9A 1UMJA 3GSIA 4YB6A 1YI2S 3DRXA 3V6DA 2VDIA 3RAXA 1ZA2B 3CJ3A 2HBRB 4NCAA 4MYTA 3Q8YA 4PXCA 2WHOA 1R0CB 1V3SA 3MEEA 5LSRA 3DU5A 4NLVA 5DZ7A 3Q8RB 3B8HA 4ZPVR 5E2QA 1X9SA 4DSLA 2IDLA 4OI1A 3NLCA 2YWWA 1YDLA 2AZ3A 1XR5A 2QL5B 2AT1B 1X0PA 2CPHA 3GTYX 3D3BJ 4D3GA 5KG2A 4ZVOB 1PBAA 4LSLA 2DY9A 5A6PA 1U6BA 1QAIA 2XQCA 1SIWB 3OJSA 2O5DA 1CC8A 4HI2A 3M30B 4PG6A 2RU9A 2WSFC 2CUYA 2ZC4A 3PW5A 4J9NA 4LT6A 2J0WA 4RZRA 1YJ7A 2OLWA 2Z2LA 2DEIA 3GONA 5D0HA 3OV7A 2AU0A 3M8PA 1JLFB 3MD3A 1XBWA 3QLHA 4JI3J 2ZHAA 2BJ8A 4X4PA 5CABA 2DD8S 2GAGC 2YKNB 3V6HA 3R3TA 1FD2A 3RZAA 4IR1A 4IQMA 1HI8A 4KHPF 1I3OB 4C0HA 5GADI 4JI7J 4LF5J 5K9FA 1BXNA 2OFGX 3PJXA 1U1PA 2MKSA 4B9LA 4B3TJ 4ECZA 2QEXS 2X1FA 1WSVA 4OLOA 1QVGR 1QDUB 5G0RB 4J7CA 4OZ3A 3LP0A 2C3YA 4NASA 3SQOP 2N4CA 4WFZA 4EBDA 4A8XA 4NZ7A 1LK5A 4XAKA 1SKUB 3P96A 2BOAA 4YHHJ 3DYAA 3ZTSA 2WW4A 2BMBA 2HS0A 4RW7A 4FXWA 4NMXA 3A3NB 2AYGA 2QMXA 1Q5YA 3UFCX 2B51A 2MKIA 3MECA 1RWVB 5EHHA 5HN0A 2BANB 1U0HA 4JYAF 2Z0GA 2XY7A 3PJWA 4OZJA 2HWTA 1HL6A 3MM6A 5J1EA 2YX4A 3EXYA 3GIIA 4DQIA 3SBMA 3BKFA 4KFBB 5F8GA 3VAHA 1CS4A 1WG5A 1SQGA 2AJ4A 2HHPA 2OEKA 2QO3A 1Q16B 1GXUA 3MTJA 4OHWA 4N77A 1L3VA 4C11A 2JWNA 1VQ6S 1LWEB 2IC3B 4H4MB 4C3KA 2QYCA 2J7KA 4NYPA 1VIOA 5IT9Y 3C6UB 4K7QA 3AA8A 4LQ3A 5LMUJ 1S1VA 1ZTTA 1K0VA 1NK9A 4OX6A 4DU7A 3VALA 3U02A 1X5OA 2J76E 1LWCB 4EO8A 3UN3A 3QZ7A 1OO0B 1GH8A 3PR5B 1G3OA 2GNKA 4WTYA 3KUHA 3BM7A 1GMWA 5IC4B 1T9UA 1Q0NA 5IC6B 5GAGU 2CG8A 1HNWF 1TL1B 1P1TA 1WF2A 4CT9A 4QPXA 3I5CA 3T5JA 4XPCA 4IKAA 3TVKA 2E1MC 2ASYA 4EYIB 2OP5A 2EPIA 2UUAJ 1GMWD 4QIEA 4CLFA 3CNQP 3W2VA 3EZOA 2CQGA 4ILRA 4QOTA 1RK8A 5ETLA 1KVJA 4M5GA 2QT7A 1JB0C 3DHXA 2JVRA 3PFEA 2PSZA 1LXJA 1K44A 3MEGA 3NGSA 4L6V3 4N56A 1TFYA 2Q43A 3TVYA 3CD5A 2B4VA 2IMOA 3I87A 3A8KA 1DLOB 1EQMA 3ITHA 2FVQA 4P10A 3MM9A 3K5OA 2JSXA 3AOCA 2FVPA 3OTOF 1TL5A 4PQUA 2DNYA 4LSLB 4QR0A 2PMWA 2FJDB 4ED4A 1APSA 3T6BA 3WIUA 4C97A 4ZCIA 3CC2S 2YKAA 1P27B 2HFNA 1WSRA 2ZBCA 2LQBA 4O4GB 4X4OA 2HMIB 2MSSA 4DV4F 1HNXJ 2NXUA 4JI0F 2V2VA 2CNKB 3V4IA 2V4RA 4TKTA 2GQ2A 2KDOA 5IFMA 2DGQA 3GZ7A 5B0FA 2JEIA 4ZP6A 4FYXB 2B8PA 1FDNA 1RWWB 1YX2A 1U1LA 2JH3A 1X4FA 2OMOA 1Q8IA 3QLHB 2KRBA 2HHXA 4P2XA 1WG4A 5CA5A 1QUVA 3LTOA 5AJ3J 4ANEA 5GADU 5KFFA 3EZUA 3IBWA 3FBBA 4ICLA 2YPZA 5HANA 4NEYA 4IFVA 3BSCA 1D0EA 2HQIA 1IR1A 2W8LA 2UUBF 1KTQA 1SH0A 2B4UA 2LEBA 4DDFA 5KFDA 1QAYA 3DRSA 1YRUA 2FQQB 3UNGC 4UZBA 7FD1A 2VA2A 2HK3A 4PWWA 3KNAA 3DLGA 1J5OB 2PI5A 2C22A 1RYRA 4WK1A 3DMJA 2DY1A 1RE1B 4LR7A 1RA7A 3OQ2A 1ZYQA 3OUYB 4RW7B 2HYIB 1K1QA 1CJKA 3ISZA 4DSKA 1RT5B 3H2UB 5SUHA 2H54B 5I3PA 3HK2A 1O51A 4U7CA 5LSLA 2B9YA 4OX7A 4J9PA 2ERRA 5EUHA 1WTBA 2DXEA 3MWBA 4EFAC 1IKVB 3CIMA 4Y2IA 4AXIA 3RW7A 2MLXA 1S77D 4I64A 4KIAA 4DFJA 1REVA 3M6XA 5A2QY 1RWXB 1HHQA 1RT1A 4G3IA 2XYGB 2ZWOA 4DN0A 2J7UA 4LRBA 5KG5A 3P5BP 4DL3A 2KXNB 4FNIA 1ZS6A 2HHVA 4F02A 3H4DA 1UVMA 1S0VA 1RADB 1V9OA 3M9NB 4J37A 2RQMA 4QU7A 2GVZB 4U67Q 3M6VA 4KGZB 4U7UD 3F41A 4BDPA 4DL2A 2CJAA 1IKWA 1S6QB 5KT5A 1ROFA 2G4BA 1D8ZA 2IAJA 2HIYA 2N7CA 2OI2A 3NNHA 2MSTA 4ZVSB 5LJ5Y 3JSMA 3CCWA 3AXMA 1JJ2R 1ELOA 1H74A 4F8RA 1J5EF 4OFZA 2GO9A 4I56A 2Q1LA 5GMEA 5F9LA 4YUDA 2DNMA 4DR5F 3TJ8A 1S1XA 3TANA 4CLYA 2EFOA 1RT7B 3GR1A 2WB1D 2HWIA 4GMKA 2PA8D 5F3ZA 2FJVA 3IRXA 4BHQA 1WKLA 2V6AA 1FKOA 3V2UC 2UU9J 2UV8G 2AGOA 5AXKA 4LMZA 1UVLA 1WOPA 1FX4A 1NDCA 4OX9J 3HFKA 3B4MA 3HPOA 4HTJA 1RSCA 1BC6A 3HXMA 1URNA 1FESA 5A0YA 2ZDPA 4HDGA 5DG9A 5EN1A 4CM2A 3E01B 4ER8A 3HDSA 2DR9A 2CQ4A 1TK8A 5HSPA 3D28A 3DM2B 3GV8B 1AUSL 1U6ZA 5GAEI 3BV8A 4RL1A 1R8CA 1R3NA 4N8OA 4M5JA 2W9CA 3PW0A 2GJ2A 2QV6A 1R89A 1U47A 4WF9Q 1VK8A 2F4VJ 1OJ4A 5JUMA 2HFOA 4LSNA 4HEA9 3GWCA 1SJQA 4JV5F 3CULA 1HW9A 2QLJB 3D54A 4AQYF 2VBZA 4OLPA 3ILJA 2CJXB 3PEHA 3N6NA 2A10A 5H9EJ 2ZUAA 1Q8KA 1R43A 5KFGA 5C2CA 2C3PA 4KQZA 4TQSA 1YJVA 3EMTA 1N52B 2RDIA 1SUQA 3DLJA 2KT2A 3MMBA 4ED2A 2Y8WA 1C0UB 2V0NA 3MAQA 1YK9A 3D66A 3GYGA 5CYQB 1WC6A 4CWBA 3I56S 4RU2A 5CCMA 1S0MA 3VQSA 2OMLA 3LWLA 1FRKA 5CYMB 4Y34A 1RWMB 1YQHA 5CQGA 5C25A 1U1OA 4L73A 2PO4A 3SDEB 1F5CA 1TTHB 3DLGB 2UUCF 2DH7A 1NPRA 3MXHP 2VONA 1SV5B 4TNOA 1I51B 2G0CA 1R0BG 3VTIA 3H5XA 1JJ4A 4W98A 2DNZA 1JLAB 1JNZB 1F1BB 3TZZA 2FZKB 1WELA 3RU0A 2Y8YA 3H5YA 1RCOB 1OQ6A 2NPIA 2EK1A 2MZSA 4H4OA 4PABA 1FRMA 2UVWA 1HYSB 5J2QB 3AHPA 3BDPA 2R2RA 1T02A 1M90T 4Z7YA 2YNGA 2YH1A 1DQAA 4OV1A 3I4HX 2KG1A 2PGCA 2XS5A 2XCAA 3EWGA 4ZA1A 3PTWA 4DXLA 5J2PB 3GCXP 2FLPA 3Q8QB 1Q8LA 3D1OA 4CYUB 2LCWA 1VQ7S 4CI0B 4FS1A 3GU0A 3ETOA 1HQEB 3DLBA 1Q4RA 1HBOB 4AE5A 5KFMA 4MIWA 3ZZPA 4DR2F 1KFSA 2LXIA 2XY6A 3Q89A 2LXUA 3ULHA 3KYLA 3T1YF 3OHBA 3CB4A 3RJMB 2O01C 2RHQB 3NGTA 1RU1A 4NLQA 4HR2A 3M4XA 1TV6A 3OVBA 5FJ4A 4DL4A 4NI2B 2KN4A 4C8YA 3HT3A 2DVIA 3BO3A 2Z2YB 2D3OR 4A4JA 4LR9A 1WDDA 3KG0A 4LIWA 2G1DA 4WE1B 2IY5B 2VICA 3MCMA 4I7FB 1S0OA 4K8RA 2K8GA 2RMLA 5EGYA 3CCRS 2JFKA 2OAUA 1FNMA 2ROPA 1N33F 3MPWA 1VI7A 3S01A 2HHHJ 2WOMB 2VPWB 1PGZA 1QM9A 3UWTA 4Z7CA 2C2ZB 3NGDA 3C16A 4RUCA 3HSDA 4PYDA 4DUTA 4TU8A 5ETVA 1BQXA 4DV7J 3R5GA 3ISNC 5C24A 3T3FA 1JLGB 5IZHA 4KB7A 3NMAA 1F2HA 3LP1B 3POTA 2NSBA 1VDHA 5T41A 2V8DA 1TKZA 1KLMB 2IVFB 4YY3F 2C2NA 1UZHA 1MMLA 1ICEB 5EWEA 3W64A 2LA4A 4PKDB 1QAJA 1OSDA 2KL8A 3P3DA 3ZZRA 2ZH3A 1MSWD 2UV8A 5H1SV 2ACMA 4JI1F 5GAEU 1N36F 1FXLA 4PWDA 2MPUA 4JI4J 5HVFA 4PXBA 4FXDA 1MWQA 4YDDB 1Q7YT 1RLCL 1U1QA 1NRKA 2HPUA 1S4FA 3CCSS 4LFCJ 1AXQA 2GA7A 2K2PA 4YP3A 3KMQA 2NZ4A 1C0TB 4O0IA 5A8WB 2XWYA 1FJGF 1Z2ZA 1PYSB 4ATNA 1T0TV 1YITS 1HBMA 2XWXA 4ZVGA 2R2UA 4LF9J 5C2GA 2Z56B 4WU3A 2NPFA 1M5SA 2NREA 1RWPB 2YKPA 1W26A 2NXEA 3N01A 1Y0HA 2FJWA 1YJRA 3WX4A 4NXNJ 1TU0B 4CDIA 1JLCA 2BE2A 1N5SA 5KG1A 3CO9A 2XTJP 2CPJA 4DV1F 2JLEA 3LH2S 1T9XA 4OYXA 4OL8A 2VH7A 3HO1A 3JAMU 3W5YA 5MLCV 3VZHA 3KJQB 1RU2A 3I9V9 4XIUA 3M9MB 5L38A 1OPZA 2LMIA 4I0WA 3BGOP 5HJYA 2GHVC 2P2CB 5C25B 4KGMA 1O5JA 4LRCA 2HEKA 1UEUA 4Y28C 4ID5B 4OYPA 1SXLA 4A8QA 4LVOP 1Y5IB 4MKBA 3SIPB 1PBUA 5BYSA 1NK7A 4L76A 4F2SA 2HKEA 2I2YA 4K0KJ 1B64A 3N6LA 3HHLC 3M32B 2XMVA 2D3UA 2JC1A 2WRMA 3PYFA 2XZTB 1J27A 1SKWA 3M1VA 1AFIA 2OO4A 2LQ5A 1HI1A 3VAFA 3NCQA 4LBIA 4P6QA 3MM5A 2E9TA 1G7CB 2MKYA 2K3IA 3QGPA 2DYAA 2DXDA 3FZ2A 4CNZA 2YQ1A 3AH6A 2RF2B 1HBUA 3FEXB 4ILMA 2E1CA 3HZEA 3PFOA 1SC6A 4O3QA 1WC5A 2RKIA 4NRTA
chains in the Genus database with same CATH topology
2W4DA 5KFOA 2BZ2A 5HMXA 1C4AA 2ZM6F 2L9NA 3CCZA 2LKZA 4ECRA 1RTJA 2EW9A 4YDXA 3FRYA 1N56A 3O6QA 2R7TA 2R7OA 3VQTA 4F2RA 3CCES 2NSCA 4WFXA 3U7JA 3I32A 3PX0A 2BABA 1N0UA 4K2XA 3OL8A 1RT4A 3QPIA 4CT8A 3K0JA 1N54B 4O44A 2HGNA 4J9RA 1VOMA 4DV3F 4NCGB 3R1HA 3MURP 2E44A 3BQ0A 2MKJA 3IWNC 1DBDA 1MNEA 2EFVA 2JVOA 1R8AA 1YJNS 2ZKUA 4DLEA 1WHYA 1DAXA 2R7QA 3NNCA 1TL3A 4JI8F 2Z4PA 3BN7A 4JI5F 2J0SD 1VQPS 3GYXB 4J9OA 1JLBA 4EU0A 4U6PA 2XS7A 2CQHA 2ZE2B 4XPEA 3FFIA 1U7LA 3LOUA 5GVQA 4DFKA 2HHSA 1GXTA 4IDKA 1MMDA 4OJHA 3TP2A 4A47A 5D6GA 1FRHA 1C0TA 1EP4A 4EGLA 5A8WA 3MMAB 4K4YA 5F0UA 1S76D 5F9NA 2XULA 2GFFA 1R6YA 1R8PA 5KG3A 3KWMA 1NH8A 4KSEB 3H59A 2LU1A 1H2TZ 1C2PA 2VPYB 3SEOA 2KXFA 4R5PB 3IR5B 4FVMA 3U1LA 3SMZA 1RTIA 3OFHA 4F4WA 1N5VA 1S9GA 2E5HA 3CDWA 3OXFA 4TXSA 4B9UA 5DLFA 1SJ3P 2UUTA 2OH2A 1MMNA 4DV6F 1WNEA 3M8QB 3K5NA 3BREA 1XK8A 1VLYA 2FLNA 3OL7A 3R1LA 5BYQA 3ZZ0A 5EWGA 4ED8A 1ZM9A 3TI0A 4DQPA 1VC6A 1YRXA 2N3LA 2Q6BA 2HNYA 2DRBA 3DLHA 4GC6A 2V8GA 4OZ1A 2VFVA 2XMKA 4X62F 2ZJRQ 3TUJC 1TKXB 4NLYA 4ZLPA 3S7RA 3TO8A 2E9RX 3DXSX 3KK1B 1F9FA 3RB0A 3TX8A 2WSEC 1ULRA 5J1PA 4QWDA 3BF4A 3IAM9 1CG2A 2R7WA 4NLWA 4OJGA 3MFIA 2MY8A 2MKHA 1Y5NB 2EK6A 2CRLA 2BDPA 4QR2A 4B02A 4ZCMA 5KFKA 3N28A 2RQCA 3K58A 1UVJA 4ED7A 4PG4A 1P6TA 1WF1A 2LYVA 3PW2A 2Y1JA 2BJDA 2KH9A 2YNIB 4Y3CA 3D1HA 4X64F 3RAQA 3QGGA 3OLBA 2QLXA 3Q24A 4IOCQ 1JNRB 3KK3A 2AQ4A 1Q86T 5M2PA 4IG0B 1FKAF 3M2VB 3J7YI 3DOKA 3M2RA 3GIJA 4ZDNA 1KLNA 4EO6A 2ZH2A 2VOPA 3I6PA 2D1CA 3QIPB 4ECSA 3FQLA 2DR5A 2W9BA 2VA3A 4GKJF 4K4WA 2J0QD 2R7RA 3PW4A 4B3OB 1MU2B 1VRUA 1QE1A 1AUDA 1HR0F 1IBKF 3R5AA 4Q43A 2CDQA 4I2PB 1LW0B 4ALZA 5THWA 4NX9A 4JUZA 3F73A 4DG1B 2ZH4A 3PX6A 4J9KA 3CCMS 4JI2F 4HVZA 5E5NA 5F8MA 2V4QA 4K4SA 4WIIA 3VAMA 3MM8B 1SH2A 1I94F 3HKZD 6FDRA 5KFCA 3BR8A 1S1UA 1S9EB 2XI3A 3MEKA 3AQPA 4CTAA 3KLVA 3FSYA 4RW6A 2VKRA 1HQUB 2KT3A 3SXLA 2OPRB 4JI3F 2OPPB 2CPEA 4JV0A 1PC5A 2CQCA 3G6ES 1RT6B 3EUNA 4ID5A 3JSRA 4KJIA 2ZITA 4B08A 4LQ9A 3FRZA 1X4GA 1OQ3A 4CO1A 5D3GB 3MOZA 1MW7A 4CIOA 2J8AA 4USHA 3MDFA 2E9ZA 1H7XA 4ZHRA 2W7PA 5L9NA 3FQKA 2J0XA 5F8LA 4HT5A 1NJWA 4OMFG 4JOUA 1LFPA 2CPDA 2ILZA 2B9XA 1QVFR 3M32A 4OHYA 4JI7F 1P8GA 3NBPB 2DNGA 4M5DB 4LF5F 4DPOA 5E41A 4QU6A 1NHUA 4ZPTR 3GIMA 2P6SA 3AJ1A 3L09A 1VRTA 5KG0A 4M63A 4B3TF 2CJ9A 2CQBA 1HBNB 2MQMA 3I9ZA 1IKXB 3GB0A 2VOOA 1H2UX 2V4JA 5LSOA 4Q7AA 4RW8B 4CH0S 4PXDA 3BO2A 2FC8A 4I1TA 3GR0A 1C1CB 3IFEA 4IG3B 5A8KA 3E8OA 4DHVA 3V6DB 2AWZA 5DQHA 3PVXA 3HVTA 1HPZA 3CJKB 3OSPA 2YNHA 1TAQA 1QSYA 1YG0A 2W25A 1VQSA 4KC5A 2FY1A 2GMHA 2ZJPQ 1C4CA 2QIFA 1FK9B 1I6JA 4C3LA 2RH3A 2RF2A 2KFZA 4E98A 2Q6CA 1G1XA 4NLGA 1TP7A 1HI0P 2XMJA 3Q2TC 1IBMF 2EWHA 4YHHF 4A8SA 4F3OA 1TR0A 4M94A 3V6JA 3SI8A 1VGYA 1UFWA 3MEEB 4QWEA 3DRRA 1RKJA 3QO9B 4NLDA 4P7TA 3UD3P 2VFTA 1ZZNA 3CDEA 2FIUA 1R0AA 1XNQF 1VQ4S 4X66F 4QW9A 4X4NA 3LWMA 4YQWA 1SL2A 5D78A 2W4CA 2K1RB 4PQAA 1SI9A 1KOOA 1FXDA 1GT8A 2HAIA 1U25A 2U2FA 4ZPDA 1K8AT 2HHWA 2YKOA 1D1UA 4EBCA 3LO3A 4AFFA 5C42B 2XLJA 3G9CA 3AQOA 1KFDA 4MJKA 4ZPWR 4OI4A 3LW5C 1BQNB 1S10A 2KG0A 4DL7A 2F40A 4C0OC 4NCGA 1CLFA 4MIBA 2V5HG 1WHVA 1ZPVA 2QZ8A 5K8OA 3RR8A 4U7UK 3PM9A 4Q5VA 2WCXA 2VFUA 2VV5A 4KKOB 1WG1A 1U1NA 2IBOA 1H2VZ 4NWBA 3VZIA 4YFUA 3KHRA 3A8EA 4DMZA 3TUZC 3TAQA 4LF8F 2Q3PA 4J9QA 2ZE2A 2CQ0A 1U26A 5K8NA 3FCHA 4XO0A 3D1QA 2EKYA 4GO5X 3VAIA 2M8DB 2XMWA 3ONQA 2DNHA 2UUWA 4OHXA 5CCLA 5DDOC 3MMAA 1OPIA 2CZ4A 1FTRA 1CQMA 2RSQA 4FBUA 2WONB 3THVA 1LV5A 1VBYA 4NLUA 4R5PA 2F3JA 2FVRA 2R7SA 4A48A 2NYIA 3P6YC 1LQ9A 1SL1A 1S7HA 2XC9A 4CQ1A 1UJ6A 2P9EA 3OL9A 1UP1A 2M8HA 4YB1P 4J9MA 2NR0A 2GMLA 3M8QA 2FC9A 3IG1B 2XZWA 3AB4B 1NZAA 2HHUA 2FHOB 3TQ1A 3FJ2A 4JBCA 5KOXA 4C8NA 3G6VA 1Q1KA 3KLGB 1YSJA 3PV8A 4ITSA 2KVIA 4K4UA 1GX6A 1PC4A 1HNIB 4G6VB 1Y00A 4CO4A 3PXGa 2XHWA 1TKXA 2MQLA 4V19X 5CZXA 3KK1A 2BQ3A 2XLKA 3EZ5A 4I68A 5IXUA 4KHRA 1N6QB 4B3RF 3N79A 5LMUF 2ZH8A 1YIJS 4F4ZA 4EZ6A 4Q2MA 3OSNA 4UQGA 1FDBA 4JI6F 2CIMA 1E6VB 4RNMA 2MGZB 4DQSA 1T3NA 2C2EA 3PKMA 4DSFA 1X5SA 5DDPC 2YNIA 4N47A 4K5RA 2ASLA 3NL0A 1FVSA 1FRXA 3M8PB 5KFXA 3UE2A 4RBTA 5ADZA 1VC0A 5KT2A 1Q81T 1JX4A 4ETXA 4A8FA 4LF4F 1OWXA 1KN6A 4ELVA 3RB4A 1X4CA 2L3MA 2B43A 4IG0A 4MK9A 4FBTA 1UKUA 3M2VA 4F3QA 3PW7A 2UVUA 2YWGA 3UCZP 2EFQA 3D0GE 1UWBB 4IOBA 4EZ9A 1HWUA 1IUJA 5FD1A 1ZM4A 2OIHA 3QIPA 3B4DA 4W92B 4OZ5A 1W25A 2IM0A 4HDHA 1WI6A 4R8UB 3DI6B 1L3UA 2QE5A 1MU2A 4B3OA 1KQSR 5DETA 4I2PA 1LW0A 2QA2A 4DSEA 1HNVB 2DRAA 2IYIA 3O8WA 4DG1A 2OKQA 4TQRA 1UA1A 2JL9A 5E3CA 2DNPA 2O66A 2RDJA 3MM8A 2BYCA 2DCUB 4B9VA 4YOEA 2WSCC 4KRWA 3CC7S 5AE3A 2M0GB 3O3LA 4URQU 4O3NA 3CF5Q 3BGUA 2UUAF 3CDAA 1S9EA 1T7PA 4X4TA 2B4OA 1RT2B 3Q8PB 5E33A 5AE1A 1HQUA 2D41A 2Z2MA 2RS8A 2OPRA 4X2BA 1VS3A 3NRBA 1Y5LB 1HWLA 4HT7A 2XGQA 1KSPA 4FNHA 1RT6A 3SV3A 1JXLA 5GAGI 1VQ5S 4JV2A 2DGVA 3CPWR 4J9LA 5D3GA 2GIRA 2XMTA 3LP0B 4RBVA 5JJBA 1YGYA 2A3JA 4TU9A 2YKMB 2D74B 4G1QB 3DHWC 3V81B 4DR1F 4QJVA 2I8EA 2DNKA 1Y9OA 2AD9A 4O44B 4O3OA 2XS2A 2VPZB 4FN5A 4EWTA 3ENQA 5BYRA 4M5DA 3MUVP 3I4PA 4FF1A 1JMTA 3JTNA 1YHQS 4IO9Q 2BR0A 2I9SA 1FE4A 1UETA 2QA4S 3DYAB 1HBNA 2NUHA 3QZ8A 1IKXA 3IWLA 2Q79A 3IR6B 1S6OA 2LQ9A 4DUZF 2V94A 1UMJA 3ENVA 4TY9A 3LALA 4RW8A 4YB6A 1U4BA 3HKWA 1C1CA 1RI7A 4IG3A 1YI2S 3DRXA 3V6DA 1QSLA 1K0TA 3RAXA 3TVZA 3CJ3A 2VODA 3CJKA 1CPZA 1IKYB 3MECB 4NCAA 1ZAXA 4F26A 4RW9B 1DQ8A 3BGRB 4MYTA 3WC0A 2RQKA 2EFGA 3M8SA 5L1LA 2YTCA 3HM9A 2VBWA 1S9FA 4PXCA 4IRDA 2WHOA 1FK9A 3VAGA 2NS1B 4PPZA 1WEZA 2BW2A 3HHEA 1K73T 2B9WA 1B0PA 2VG6B 2ZOMA 4YB7A 3RRKA 2B3TB 4K50A 4IRCA 3MM6B 5J1EB 4QIFA 3JAMY 1V3SA 5LSRA 3MEEA 1HFEL 2AGPA 3QO9A 3DU5A 4NLVA 2V8HA 3GV7B 1WEYA 2B6AB 2NLWA 3N5BA 3Q8RB 2MMYA 3B8HA 1FJ7A 1S1TB 4ZPVR 2VQEF 5E2QA 1X9SA 4DSLA 2XCPA 2K1RA 5HO4A 5ITHA 1N5TA 4OI1A 4O3PA 3NLCA 1X4DA 3B78A 3T5KA 1RTHA 1XR5A 5C42A 2O67A 3G8QA 2HGLA 3QIDA 4I6AA 3P5TL 7FDRA 2HFZA 1BQNA 2VBYA 1X0PA 2CPHA 4PRFA 2ZH7A 2BXJA 1L5UA 3L7PA 3DFEA 4N8NA 2RRAA 1HNXF 4C11B 3TAPA 5HMWA 2IA0A 3H2VE 4D3GA 1TFWA 5KFUA 3UR0A 4ECQA 5KG2A 2DPIA 1IJFB 2R8IA 1FHTA 3K8WA 4E0DA 2Z8QA 4LSLA 3T5LA 1FERA 1RWUA 2L9DA 3CVKA 5A6PA 2KT5A 4X65F 2WK4A 1U6BA 3MMJA 1QAIA 1F5AA 1A9NB 2RB7A 1SIWB 2KXHA 3SCIE 2WONA 3OJSA 3CC4S 2RVJA 1S1VB 2O5DA 5GMKa 5KT4A 1CC8A 4CO2A 3CMES 2CJQA 1X5TA 1F2GA 4HI2A 3NP5A 1K1SA 1HHSA 2B7BB 4J5OA 5KFTA 3M30B 3VAFA 4M95A 5B0DA 4PG6A 3IG1A 4Z2XA 3JYTB 4P7VA 1RTDB 4WK3A 1VK3A 2RU9A 2X1GA 1DZ5A 2WSFC 2CFXA 2FHJA 2XSJA 1WEXA 2ZC4A 2LDIA 2DT9A 3KLGA 2D7SA 3PW5A 4FYDA 1I1GA 1QY7A 4J9NA 1HNIA 4LT6A 4UY8T 2J0WA 3L3CA 1Q8BA 2L41A 2AF6A 2LXFA 3K5MA 1BQMB 4RZRA 1HWJA 5G4DA 5AJ3F 1N6QA 2QA1A 2BRKA 2N7YA 2VASA 2ZH1A 4ELTA 2XI2A 3C8YA 3IS9B 1E6VA 2OLWA 2Z2LA 2MGZA 2ZH5A 1U45A 5KFJA 2DO4A 3B82A 3KLFB 1X0FA 2A2CA 3OV7A 2AU0A 2GQCA 1VBXA 3M8PA 3WZ0A 1JLFB 3MD3A 1XBWA 2GW8A 2V9WA 4QWAA 3M9OB 2BVZA 3QLHA 2FHJD 1VQOS 3GG1A 1ZETA 1T05B 3W2VB 4DL0C 2ZHAA 1DHMA 2UXCF 2BOPA 1NB7A 5A8KB 4X4PA 1NO8A 1JJHA 1UWBA 3HVRA 1KD1T 5IM0B 2DD8S 3SV4A 3THTA 4ELUA 2A1BA 3GE9A 5DDRC 1S97A 2YKNB 4R8UA 3V6HA 1URRA 3DI6A 3R3TA 2ROGA 1FRIA 2MZRA 1FD2A 3RZAA 4IR1A 4IQMA 1HI8A 1HNVA 4KHPF 1HWKA 2CJKA 4I69A 4C0HA 2YKQA 5GADI 2AJFE 2B56A 5DG7A 2FHMA 5K9FA 1H38A 2OFGX 1SJRA 2D3ZA 5EWFA 3PJXA 2DGTA 2MKSA 1S1WB 1U1PA 3R27A 1L3SA 4B9LA 3J7A1 3MMCA 3MEGB 3I55S 4ECZA 1RT2A 4J9SA 3BQ2A 4DWIA 3QAEA 2QEXS 2X1FA 3OTCA 1FXRA 4DV0F 4OLOA 1QVGR 1ZZFA 1RP5A 2P6TA 5G0RB 2SXLA 2ZVSA 2AJ0A 4HHJA 3LP0A 1M5OC 2C2RA 2C3YA 2ZH6A 2GHPA 1RKIA 2MZJA 2YKMA 2L9WA 3TAMB 2QSWA 3ITHB 3LUYA 4G1QA 3ZZYA 3V81A 2N4CA 4WFZA 5IQ6A 4EBDA 4NL5A 4A8XA 2RRNA 3OPKA 4NZ7A 5K14A 2GMJA 1LK5A 2YVSA 4XAKA 3MM9B 5CZVA 4QYZJ 1ZM2A 2VKZG 1XERA 4ZOSA 3P96A 2RE1A 3I0RB 3UDLA 2ACYA 2DB1A 3DYAA 3OTDA 4XDCA 2ZDOA 2W7AA 1Q78A 2HS0A 4LUBA 4RW7A 4PQUB 2J6SA 1BWEA 4FXWA 4NLTA 2ALZA 2AYGA 2QMXA 3UQSA 4ECVA 2FLLA 1S48A 2K3KA 1U8SA 4PWUA 3E3XA 1ZOTA 2GJIA 5KFAA 4DS5A 2ADBA 3UFCX 2B51A 1U24A 2MKIA 3BSOA 1TQLA 5JVHQ 1IKYA 3MECA 2F1FA 3PRBA 5EHHA 4RW9A 3BGRA 2W9AA 5HN0A 1GX5A 2BANB 3H40A 3M05A 3CJ5A 5KTQA 4JYAF 4MH8A 4AYBD 3MF5A 4NLXA 5HBMB 2Z0GA 4K4TA 5LJ3Y 3X3UA 2OFHX 2XMUA 3MM7B 3G6YA 1J2VA 2N4DA 4Y0FA 2VG6A 2AYEA 4ZCKA 2XY7A 2VC1A 3PJWA 1NK6A 4BBYA 2X1AA 4OZJA 2HWTA 1HL6A 3MM6A 4WKYA 2AJ1A 2KHDA 5J1EA 1KQGB 5MAOA 1NK8A 1AW0A 2YX4A 3OW2R 4IYQA 2B6AA 3CE8A 3EXYA 4HH0A 3V4IB 4DX8H 3GIIA 2FB0A 1S1TA 1CSJA 3JSBA 4DQIA 2ZJQQ 2MDAA 3N9UC 2VFSA 4KFBB 3SCJE 5F8GA 1FDDA 2HNZB 2IRYA 3VAHA 1WG5A 1X4BA 3CIZA 3N4WA 1F5BA 3G71S 5DLGA 1X9WA 1LWFB 2AJ4A 2HHPA 3KK2B 1N5QA 2QO3A 4WJBA 1Q16B 4ES1A 3DOMA 3D2WA 1GXUA 3MTJA 3LP2B 3IA0A 4OHWA 2XGPA 2LDYA 2W4PA 1X4EA 2DPJA 3CJ