4UY85

Molecular basis for the ribosome functioning as a l-tryptophan sensor - cryo-em structure of a tnac stalled e.coli ribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
148
structure length
148
Chain Sequence
b'MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L32
publication title Molecular Basis for the Ribosome Functioning as an L-Tryptophan Sensor.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uy8501
3J7YI 5GAHI 5GAEI 5D8HB 1ZAVA 5GADI 5D6GA 2QA4G 3JSYA 4V19J 3A1YG 1ZAWA 4NWBA 1ZAXA 5GAGI 3J7Z5 4UY85
chains in the Genus database with same CATH superfamily
2JX2A 3MTJA 1U48A 4NXMF 3D3BJ 3QSIA 2P8IA 3MM6B 4GKJJ 3W5ZA 4ENOA 4U95A 2Q79A 3HD1A 3GSDA 1X4EA 4M8LA 1OO0B 1SKSA 3TNVA 5K8MA 1B0TA 2UZAA 4U6PA 3H4BA 2J0XA 3KDOA 4QYZK 4CYUB 2KI2A 2R2TA 2DYAA 3CUNA 2IDLA 2W25A 2BANB 4P52A 3OHAA 2XHWA 4QIEA 3RRKA 4LIWA 2W9CB 2IAJA 2GCFA 3AODA 4Z7YA 5HO4A 1H7XA 2DB1A 4WP9A 5KG6A 3VAKA 1YJRA 2XG8A 1SXLA 4L3NA 3T5JA 2BKOA 4WCEQ 3LWLA 2DRDA 2YKQA 2YKMA 1V6HA 2FC9A 2RS8A 4L73A 2E66A 1RE1B 1WHWA 4WIQA 3EX7B 3ELHA 3IA0A 3DU6A 1U6BA 2K3KA 2DHGA 2R4FA 1Q16B 1NSQA 5DDOC 5KFPA 1JJHA 3HLUA 2VHGA 1PC4A 4N56A 2HS0A 1C1BA 2V8GA 4KV8A 5I3QA 4IH6A 3EGNA 3J7ZT 3M6WA 2KFYA 1V3SA 3UFCX 1FK9A 3TAQA 1ZZFA 3OD2A 1SB6A 1KTVA 3F73A 3HHLB 1C0UB 3BBCA 4ZVSB 4WIIA 2KFZA 3QGHA 4O3NA 3U1MA 2DGTA 3TX8A 2ZITA 3IG1A 1RHKB 3JSMB 1QVFR 1UFLA 3H90A 3OXLA 5B0DA 3MR7A 1S0OA 4OIXA 2XYGB 3RRGA 4KPCA 4E2FB 2VKRA 1FKPB 4ECSA 2ROGA 4FYYB 3SQOP 3D7SB 2J6TA 3KNGA 3AOBA 3SI8A 4WFYA 2EXUA 3PW2A 4OZJA 3DU5A 2XLJA 1RAJA 4PWWA 3MZIA 1DJ0A 2IA6A 1VQ8S 3MR2A 2W2MP 5B08A 5BXIA 5ETOA 4KHPJ 3HSDA 4ZN3A 1HNIB 2CPYA 2RDDA 3DLEA 2FUG9 2KT5A 4YB6A 4RW8A 2G1HA 5LM7E 1HD0A 3KJQB 4J9UE 2ASJA 2D7SA 4CI0B 1ZM4A 2BJ9A 3T1YF 3DRSA 2ZC4A 1X4AA 4IH7A 2BJDA 2H5JB 3SYZA 4DU8A 4K2JA 4ECYA 3AXMA 2VV5A 1M1HA 3OJSA 4Y00A 1AFJA 2NPIA 2GNKA 1N52B 5DQHA 1U47A 2LU1A 2DXEA 5JVGQ 3IFEA 3H4DA 5LXYA 2D9OA 4ED5A 3RAMA 3I31A 1VDHA 3QNWB 1C2PA 1B0VA 1VQKS 3IM9A 5E3CA 3C2PA 1TFYA 1G4CA 4FF4A 3GILA 2ZOMA 3ZZ0A 3TJ8A 2X3GA 2IBOA 3Q2TC 5KG4A 2LA4A 2E29A 2W4DA 2K06A 2V4RA 3TYTA 2GVZA 2QFJA 2PT0A 2ACMA 2AYMA 3NWRA 4LR8A 1CEZA 4DUYF 5KTQA 4NCAA 4B3OB 5HBMA 3D9BA 4DV3F 3IWLA 4LBHA 5B0BA 5D4NA 3SCIE 3JS9A 2BABA 4NCGB 2BE2B 4CTAA 4Q0BB 2OLWA 1X4FA 2JEIA 1WKKA 3W1YC 1JXEA 1U1RA 3R7BB 2CFXA 1YQHA 1RT1B 3MM5B 3DDKA 4UZBA 2AGOA 3FMWA 2CG8A 4I68A 3ZNUA 3LP0A 1ZTWA 4RUCA 1CS4A 3A4TA 2AGPA 3W2VB 2VQFF 4Q8FA 2FZGB 4ERDA 4Y2AA 3NNCA 3GIJA 3JAMU 3KLFA 2DD8S 1JIHA 1GMWA 3L7OA 5JJBA 4CLLA 3NS7B 1OSCA 2KYZA 3A3PB 2D74B 3R2DJ 3GV5B 4F2SA 2NREA 2N7CA 1L5UA 3TUIC 2MHEA 4F0KA 2DY9A 3PRDA 3BQ0A 1NPRA 3POTB 3A12A 2RS2A 1MG7A 2PMHA 1KTQA 5HQMA 4AFFA 5AXLA 4C4WA 2F4VF 4M5DA 1RT4B 3GR1A 2ZH2A 5K9FA 2FHJA 1RABB 4F04B 3EDRB 3PO5A 1VISA 4IQXA 1JLGA 2EKNA 3K2YA 4F50A 3M6VA 2J7WA 4LFCJ 3DLGB 4X62F 4DZDA 3DOMB 4P6QA 2HFUA 4PG6A 1IQZA 5F9LA 3CMQA 4MAKA 5KT7A 4GKKF 2ZM6J 1T9XA 4K59A 5IQQA 2XGQA 1WOSA 1SJ1A 1RKJA 2Z2MA 4DR3J 1J5EJ 2V2QA 1X4GA 4C8OA 3FEZA 2R8GA 2G4BA 1YRTA 3NCRA 1Y7PA 4C8YA 1LK5A 4KJIA 1CJTB 1G6BA 3AQOA 3NOCA 4NZ0A 3KJVB 1I51B 3MECA 4RNHA 2J8AA 2HAFA 2V8PA 3R2CJ 1ZAVA 2Q6BA 3M2VB 9ATCB 1FJCA 3KWMA 4ATNA 4YN3B 2B9XA 4UY85 2DNQA 3MCSA 3KK3A 1ZBTA 2MZQA 3JQKA 5T7LA 2FZCB 2JEGA 2CPXA 1FWLA 4KIAA 2X1GA 5C42A 2Y1LB 1FA0A 2F1FA 1UVNA 4ZLJA 1U1QA 1JK9B 1TL3B 1VC0A 2AKWB 3H59A 4LMZA 3DOLA 2GA7A 2FZKB 3EGZA 2LP4A 4ILRA 2BM0A 4USJC 3MAQA 1P1LA 2KVIA 3FEYB 2E7XA 3QZ8A 2OPSA 1K44A 2QE5A 2V2KA 2MHNA 2D3OR 5D4PA 3FBEA 4O3RA 2B9WA 2DO0A 1FJ7A 1UPPA 4ECTA 3OW2R 3MHYA 1AUSL 2DR5A 1PIEA 1F1BB 1LWFA 1S0NA 3GYNA 5KAKA 5CA5A 3Q0AA 1XIQA 3VWSA 2HK3A 2AD9A 5J1PA 2AJ0A 1Q82T 2CPZA 1HHSA 4N8OA 1XR5A 4FNHA 1S1XA 4HHJA 1N4LA 3E8OA 4LSNA 2J8SA 2FVCA 1VC5A 2CQCA 3CB4A 2FIUA 2VF3A 4ED4A 4K4XA 3CCMS 4RW7A 4USIA 3TQ1A 4DSEA 4P74A 4LFAF 1EAYC 1WKJA 4K50A 2MYFA 4AL6A 3TARA 4L75A 4P72A 2DR8A 3CJ5A 4ZVOB 1UETA 4K5RA 1Z1ZA 4A8QA 4FYWB 5HLFB 4FYDA 4LR7A 1LW0B 2IAJB 4LRFA 2Y9HA 3HKZD 4WU3A 1PGZA 1REVB 3VR1A 3ONQA 3DRRB 2VODA 1CJVA 3GIMA 3MPVA 2CQ2A 2FTRA 2G13A 1YJUA 3JYTB 2A6MA 1UP1A 2ILYA 1JJ4A 3X3UA 1D8ZA 4CNYA 1IKXA 3LO3A 4KB7A 2GIRA 4USMA 2LXUA 4OI0A 2K8GA 1C1BB 3CJ2A 5A0YA 1FNOA 4MK9A 4G1QA 1S1UA 2OP5A 1IBMF 1O5JA 2BJ8A 4CO0A 1OMSA 2H65B 1OPIA 3KG0A 4B3TF 3L7UA 3HHLD 4DS5A 1VQNS 2R2SA 1PO6A 3GPAA 1T03A 2PA8D 4OFZA 3IG1B 3BO3A 3PYGA 2QGFB 3OFHA 2R8HA 5KT5A 1FI4A 2IA0A 2YX4A 3T19A 3D1HA 2LQJA 2UV8G 1FE0A 4PWDA 3QAUA 1QTNB 4TQRA 5M2PA 2YWEA 4AYBD 1DHMA 4HDGA 1M5KC 3U27A 1HNZJ 1QSSA 3NKYA 1IKYA 2XY7A 3DC2A 1ELOA 2YWKA 2JLEA 4JI6F 5L1KA 4NZ6A 1FERA 2WOMB 4PXCA 1FDBA 3P3DA 1XMOF 2DO4A 3DLEB 2W01A 1IJFB 1V9OA 3PW4A 3RGIA 3EMTA 1FT8A 1AA1B 1B7YB 2MPUA 1YLXA 3UNYA 5B0FA 2AX1A 4K4UA 4JI0F 4WWSA 1UZDA 2E1AA 3DRSB 1CJUB 2V9WA 4DQPA 2AMCB 1KLMA 5KFJA 2JC1A 2PE8A 2MKCA 5A2QU 1RT3A 2WBMA 3UD5A 1GTHA 2O1PA 1FKOB 3OVSA 3KJNB 4OX9J 2BM1A 4G3IA 2V8HA 1GX5A 2BX6A 2HZAA 2D3O1 2QZ8A 1RWUA 2W2OP 1Y5IB 4DV2J 5A8WA 2FVRA 2OMLA 1SI9A 3AB4B 3WQPA 4GRSA 2DGUA 1TP7A 1FX4A 2W9AA 3G6YA 2GVZB 2MGZA 2RF2A 3CDUA 2JJ4D 2XNQA 3UW1A 4XO0A 4MIAA 4Z2XA 3JSYA 2APOA 3CWJA 1TK8A 2Z2ZA 2CWXA 3HHNB 3D1QA 4CTAB 4LF5J 2OSQA 5KFOA 3UN2A 2EFNA 5F8NA 3EPGA 3UI3A 5CYQB 4PQUA 1KDNA 3N4WA 1MLAA 1MSWD 1DZ5A 3LP0B 1CS4B 3M1VB 2QSWA 3R5GA 4AL5A 1X9MA 1YGYA 5IT9U 2ZBPA 4NEZA 4X4SA 3K5MA 3HSGA 1P9QC 3F0NA 4DR7J 2HGNA 3PRVA 4IUFA 1QSLA 1GXTA 4J9MA 3ZZTA 5D4OA 2ZUGA 3KLFB 5IOLA 5KFMA 2DGXA 5KG0A 3MD3A 4USVA 4ZJOA 2R7RA 2VBWA 4JI3J 1LXNA 4UF4A 2MXYA 3CCVS 1YJVA 1FESA 3ENQA 4OHVA 2MKHA 1RISA 4DV7F 5GADU 4QWCA 1T9YA 4NLOA 3PIOQ 2HIQA 1B7FA 4M1KA 2UUCF 3ISNC 1S4EA 4ED1A 2M4MA 2CQDA 2H5EA 1RYSA 3D1OA 4OV6A 5I42A 4C7QA 1N5TA 3MEKA 2F7VA 4J9LA 1JLGB 2DNOA 1C0TA 4ZS6A 2HPUA 5D78A 2GW8A 2IJNA 2VUGA 1H0HB 1O8BA 2GVDA 4DPOA 2DHXA 3SV3A 4NZ7A 3DRXA 1SJFA 2UVVA 1WC5A 2I6WA 3KXDA 1JJ2R 3Q2SC 1S48A 4I6WA 2OELA 1RJJA 4JV0A 2MJNA 3PX4A 3MR6A 5LMNJ 1HWUA 2HNDA 4GO7X 2WHOA 1NPKA 2W9BA 3JSRA 2HVHA 2LECA 1X60A 4OJ3A 3DLBA 3EWGA 4ZVEA 3ZZYA 1RAAB 1YDLA 1XC9A 1RTHA 4FYVB 1Q53A 3BM7A 3LP1A 1M1GA 3EZOA 2DPIA 1TAQA 4DU7A 3NRBA 4V19J 3DLHA 3CCWA 3QT8A 1G1XA 2YNIB 4H54A 1T11A 2ZJPQ 4JYAJ 2V69A 2F63A 3C6TB 2UV8A 2XLKA 1QAJA 2OPRA 2C2KB 5T7LB 1CSJA 3G86A 1PSDA 3H5UA 1YK9A 2OFGX 1PJ7A 3CJ8A 2DGVA 4NPOA 4HH0A 2W8KA 4B9LA 2JFKA 2VFVA 1R8CA 5ETQA 1RCXB 3TJAA 4RU2A 2R7SA 1DTQA 2UXCJ 1FRMA 5ETNA 2MZ1A 5CD4A 3UPFA 5K5MA 4HR2A 5HJXA 4Q8EA 4L6V3 1OQ3A 1OYEA 3LW5C 1NDCA 4OYMA 2MEWA 3IBFB 2IBKA 2CJQA 1LK7A 4P2FA 4YHHF 1Q78A 1CJKA 4EZ6A 1EB0A 5F8JA 3MR5A 1REGX 1YZ6A 4F4XA 3T6JA 3R7SB 3TZWA 3PKYA 2C1EB 2G2YA 3T1HJ 2OI2A 5DS7A 4M94A 2WBRA 3OUYA 1S1XB 1PYTA 2RD5C 4F4YA 4PEOA 4USWA 4C2MA 3KMSA 3PW0A 1PJ5A 1U7LA 4UUXA 4K4VA 2UXDJ 3BDPA 3KG4A 2XO7A 4JI1F 1EHWA 1KONA 1SUQB 3DLJA 1HQEA 1JLCB 1LWCA 5KFSA 5HQ8A 4ES1A 1B99A 1S0MA 3CDBA 2F65A 2VFSA 2J6SA 1MMNA 2LYVA 2W2NP 2V6AA 4YB1P 2W24A 1RTDA 1IR0A 2HW3A 4DQQA 2VA3A 4C11A 1QJHA 2JHEA 2QLFB 2LFVA 3BPDA 2MKIA 3CJ0A 1S76D 5K20B 2ZJQQ 3H42A 4LF2A 3ILOA 4IG3B 2A0FB 4DV4J 4ILLA 5JVHQ 1TKXA 2W7PA 3NOGA 2JVOA 1MWYA 3W7BA 5DG8A 1IVZA 1RAOA 4NRUA 2VG7B 1RTIB 1S99A 1UTAA 3CDAA 1TUWA 1Q79A 2ZBCA 3NS6A 3BJYA 4CNZA 4FF2A 4MIBA 3VAHA 1HNWF 4CH1A 1UEVA 3OXGA 5E0OA 3QJPA 3HSJA 2MKJA 1IKXB 4X64J 4E0DA 1E6YA 1T9WA 3AFGA 3DMJA 1RCOB 4C8MA 2AEMA 5A0YB 2VFRA 3C14A 5HP1A 1UW9A 2YKAA 2UXBJ 2PFFB 3KLHB 4JI8F 3HPOA 1N34J 2GZOA 3GP9A 1T03B 1F9HA 2CQ3A 4O4GB 3NS5A 2V63A 1Z2LA 5AJ3F 3E01B 1VQOS 4URGA 4OYBA 1XR7A 3R3TA 2DNNA 5K14A 4PUOA 1VIOA 1Y10A 5FD1A 1F2GA 4PWDB 3VZIA 2IRUA 2HZCA 2XWYA 4FBUA 4TQSA 4C0BA 1VS3A 1UVJA 3PHEA 1JB0C 3DLKA 4RNMA 1OYDA 1SC6A 1IKYB 1HD1A 2YNHA 2NYHA 4DPXA 2J6UA 3K58A 4B9MA 2DHSA 4PG5A 5K8PA 2AW0A 5GAEU 4Y2KA 1TUGB 4I1TA 4PXDA 2F40A 2E5GA 2J9EA 1ZPWX 2HZVA 2V2VA 1HI1A 2EW9A 4ECRA 3V5RA 2KO1A 3I56S 5LOQA 1DURA 3DM2A 1HL6A 2J9DA 5T41A 1HIYA 1ZYQA 4EBEA 1S59A 4X4TA 1YX2A 4C3LA 1TU0B 3MPWA 1KLMB 3QT6A 2GHVC 4IRDA 2ZE2A 1S1VA 1M90T 5D6GA 2DNMA 4OYZA 4FS2A 2BJ7A 4M5IA 4HTJA 4N76A 1HFEL 1TUVA 4V19X 1VOMA 3CSKA 3M6UA 3S7RA 3R6LB 1S6QB 2W2QP 3HF5A 5ETVA 4OHZA 4WTYA 3M7VA 4YUDA 1I94J 3VAFA 1GX6A 1UCNA 2EG1A 4CQ1A 5GADI 5A8WB 2Y0SD 4BHQA 1RTJA 2KL8A 2P9GA 1BQMB 2XS5A 2HSEB 1LOUA 2MGZB 4RW9A 3QWPA 2RUSA 2RF2B 1VQLS 1QAIA 2BRKA 1FRXA 1ZAWA 3PR4A 3G6ES 2R7WA 1MROB 4DDFA 1AW0A 3IGNA 1RGVA 4OZ5A 3CD6S 2B4PA 3MEEB 1CULA 1FFSB 2DHHA 1OY8A 2QO3A 3I6PA 3ILIA 4C8KA 8AT1B 1IBCB 2H9ZA 3I0RB 2HQFA 2DPJA 1H6KX 2OPPA 2HVIA 4L74A 1FNMA 1H7WA 1X4BA 3E2EA 4PG8A 3OQ2A 4IDKB 3EZ5A 3J7Z5 3NGTA 2HS3A 2XB2D 5LMUJ 2GGPB 3R5DA 5HI7A 4WFXA 4X4OA 2CQIA 2IJRA 1URNA 5D0HA 2L48A 2OFHX 3H5YA 3R7NB 4S0MA 1JX4A 4X4RA 2Z4PA 2Y8WA 2H48B 1FE4A 4OHWA 4HVZA 3GMGA 4ETXA 4JV5F 1P6TA 4PWUA 2EI5A 1N6QA 3D6MB 1R8AA 4F3QA 1OIAA 4U7CA 1U49A 1PILA 5EGYA 3DYAA 3V81B 1VQ4S 5I42B 3ZXWA 2QYGA 2G2OA 2HBZB 2HGMA 2ZNZA 4CLUA 2V68A 2BVZA 3P96A 2U1AA 4G6VB 1HYSA 4MKYA 3GIKA 2AYBA 4QIFA 5EUHA 1WG1A 2OTJS 2QYCA 5I3UB 3BGFA 2IVFB 1GH8A 5ITHA 3H8YA 4USUA 4J90A 1D0EA 4PRFA 2CWKA 3R9LA 4DG1A 3U1NA 3W8PA 2R7OA 3SQGA 4H4MB 5KFYA 4LUBA 2VPZB 4TU9A 2M88A 5EN1A 1HNVA 2AF6A 5BYSA 2HNYB 2A2DA 5KT6A 2ZKTA 1V3ZA 1RTHB 1R0CB 3CGIA 3EXYA 1R6VA 3SDEA 5CZVA 4IO9Q 3A8IA 3ZZOA 1NB7A 1TK5A 4Q7AA 3I87A 1ITPA 1HR0F 5KFHA 2V5HG 2YQ0A 3CCLS 1J2VA 5RUBA 2OPRB 1RLDA 1RHRB 3M9OB 4O44A 4BWJA 4ZA1A 4ED0A 4PYAA 4NXNF 1BY9A 3GE9A 4YDDB 4NRTA 2BMBA 4NA3A 4EEYA 4DUZF 1OPZA 2DISA 5H1SV 2KXNB 1F9EB 3HDSA 4KKOA 2RRNA 5CABA 1SJ4P 1FFWB 3M8QA 2XSFA 1B3TA 4USTA 2KM8B 3W3SA 2YWHA 3CJSA 3PX0A 4YB5A 2CPHA 4WKYA 3KHLA 2CQ4A 1KC8T 1FKAF 5HQLA 4F0MA 2E5LJ 1GXLA 4JI2J 3W62A 3KJFB 4W4MA 1FXRA 1JMTA 1IWGA 2Q66A 2GMLA 2HWHA 2ZBIA 3QIPA 1N0UA 3NNAA 1JXVA 4X4VA 2AGQA 5DQGA 4ES3A 3KK2B 2KFNA 3LGNA 4QIGA 3OUYB 1G2EA 4DLGA 2VIHA 1RWMB 4LBIA 1JXLA 2MQ8A 1XQIA 5HVGA 1NDPA 1V5VA 4TU8A 2LA6A 2JEFA 3MM9A 4AUKA 4TNOA 2P9EA 4MT1A 5L9NA 4NLDA 1LWCB 4DQSA 5IM0A 3ZNJ1 2NSBA 2ZD1A 3RBXA 1XTZA 3VGSA 4DHVA 3HZGA 1YG0A 1WEXA 3TEGA 1LWEB 4N77A 3IC1A 2JL9A 2HHUA 1H2VZ 2E9RX 1WUUA 1RTDB 2RQMA 4QWEA 3NCPA 5KFAA 2CJXB 2MQOA 4MK8A 2MSTA 5ETSA 2FLNA 4CLYA 1M1KT 4ZP6A 2COLA 1KOOA 2B7BB 1UVMA 2FJBB 1HWLA 4Y2MA 4DR5F 3ZTSA 4A8MP 4P71A 1S72S 1RXOB 2AJ1A 2VPYB 3K5PA 1T05B 3ZC4A 2V0NA 1YJWS 2CG4A 4KGKA 2HQDA 1I5OB 2KJVA 3ULHA 4GVLA 4U8VA 1S9GB 4DFPA 3DRYA 1FCAA 2KHCA 4A8WA 1VI7A 2LKZA 2EFPA 1GXUA 2ACYA 4AT1B 5LT5A 5IWAJ 2LU2A 4PAAA 1U1NA 4DI6A 5CZXA 1HKAA 2CZ4A 5ETTA 4CP5A 1YZ7A 3DGPA 5HP1B 4GKJF 3TZYA 2FC8A 5J2MB 2WVBA 1T02A 2PMZD 2H5IB 1SKRA 1KQSR 4N41A 1JLBB 2A18A 4P9SA 3HK2A 1FRLA 4ECVA 2VFUA 1FDDA 4WFNQ 2ZZTA 4TXSA 3DI6A 3TVYA 1NZ8A 1U8SA 5L8RC 3K57A 3MMBA 4KTQA 4JI7J 1VBYA 3RYLA 4ZVFA 2WSEC 3MEGA 2A2CA 1R27B 4DUYJ 3BKTA 1VCTA 3DKDA 5GVQA 5K14B 3LF0A 4PUOB 4P75A 1GQEA 3OXFA 1R31A 4J91A 3P49B 3MM6A 1N5QA 5L1LA 1XEZA 2JLGA 4ZHRB 4TYBA 2A1BA 1RQ0A 3UDVA 3DLKB 3PYEA 2YH1A 1RAEB 4Y2IA 2HFZA 5D0GA 3ISZA 4P2SA 4N5SA 2RE1A 3RW6A 5CQGA 3CCQS 2LMIA 4WE1A 1QDUB 4IO1A 3CTRA 4CYUA 4WZMA 1WEZA 3KUGA 1N33F 3CW2C 1RUSA 4O0IA 4DUTA 3PZPA 4DSJA 3R6GB 2BANA 1N32J 1RA7A 1ZAXA 2W9CA 5LXRA 4URSA 3MAAB 5KOWA 1HQUA 1O0PA 4JI4J 4DX6A 2QMXA 2ZE2B 1S1VB 1EP4B 1X5OA 3SSQA 3QZ7A 2X1BA 3CD0A 2HFSA 4RZRA 1NK9A 4I2QB 2V4QA 1K0VA 5D8HB 4PCQA 3KHGA 2ASYA 4D3HA 3NXZA 2A6OA 1ULRA 3PY8A 2GHPA 3WIUA 2YXLA 2F8HA 2XZTB 4DJBA 1IM6A 1EJ7L 2JFDA 4DXLA 1HPZB 3BO4A 2HWTA 2ZBRA 3R1LA 4X62J 1P9YA 2FY8A 5M2RA 4RW9B 3K7RA 3NMRA 4F36A 4H4KC 3J81Y 1NXIA 2R7XA 1DLOB 4PYDA 4LR9A 2XY6A 5D3GA 4MKVA 2AJ4A 4I7FB 3HHLA 2Y8YA 3LOUA 4WZQA 2KDOA 2E5JA 3JSMA 1KD1T 2XI3A 2ADCA 4LJMA 1R43A 3ILLA 2R2RA 3OHBA 4UOFA 2FYXA 4HYKA 4F3OA 4K8RA 2XMAA 3IO1A 1FKPA 3HXMA 1QAXA 2DITA 4J9OA 2LXFA 2Y1JA 1AZSB 2VL1A 3HT3A 1VHIA 3P4UB 4I69A 1RT6A 2MTLA 1RT7A 3KUEA 3E51A 2EK6A 1HNIA 1TKDA 3CJQA 3BB5A 4KHMA 3SFGA 2I2YA 3C8YA 1TKTA 3IRWP 2VBZA 4DL4A 3I5AA 1CLFA 1D09B 5D0EA 2MZSA 2ZH9A 4JV2A 2U2FA 1JLEA 4F4ZA 2XWXA 4KGMA 4BC7A 4ZCMA 3M05A 5J2PA 2MQNA 4J37A 1OY9A 2P9CA 3PX6A 4UZCA 3DYAB 4RWWA 1XMBA 4O23A 4RBVA 1KVIA 1JQGA 2CYYA 2R8KA 1TMMA 1HYSB 3HKWA 3ZO7A 2CQBA 4QWBA 1IBLJ 2M5YA 3K5NA 1Y5LB 4XPCA 2DH7A 4QWAA 1NJIT 1HWKA 3T1AA 2DNGA 2QMWA 4LSZB 3UR0A 3J80U 3D67A 3OR2B 2FVSA 4NX9A 3S1TA 1X7VA 4Y3CA 2IM3A 2WTFA 2GQQA 4Y0FA 1TL4A 1NK8A 1H73A 2VQEJ 3A8JA 3VAIA 1EARA 4NYOA 1NK4A 4B3OA 3EM1A 4LBPA 2P5VA 1FVSA 3HMJG 4C6AA 3PO4A 1RA6A 3BN4A 2YX1A 2L9DA 2EBEA 2QA1A 1HI0P 3EICA 4NCGA 2BE2A 3SDEB 4Q0BA 3UD3P 2XMTA 2GIFA 3DDNA 3HO1A 1UVKA 4OI3A 1VIXA 4QIWD 3GJTB 3AY0A 4WFZA 5E5NA 3MF5A 1SIWB 2KRBA 1CVJA 3MM5A 3ZFVA 1S1WB 4DR1F 3CCZA 2FLLA 4GVBA 4O44B 4FZVA 3GJSB 1HWJA 2O3DA 5BR8J 4PXBA 3W2VA 3PTWA 2LVWA 1JKHA 4YDXA 1RWWB 4NYPA 3C15A 3D3CJ 3ET6B 2G0IA 2K1RB 4LFCF 3QJLA 2XC9A 1LW2B 3FKBA 3OR1B 1RI7A 4DL2A 2FHMA 2E1MC 4C8ZA 4KGZB 1TZ0A 2WW8A 1FXDA 1NJZA 4J9RA 4M5KA 3QT7A 2PO4A 4U8YA 3BQ1A 2DCLA 4P2XA 5CCMA 2VA2A 5ETMA 4Q5VA 4DR3F 2QT7A 2QL5B 1J5EF 3FGVA 3SV4A 4FF3A 2MLXA 1WEYA 4ANCA 3GZ7A 2OO4A 2B5JB 4R25A 1RT4A 1MNEA 3QIPB 2KZZA 3LH2S 3QGGA 5HN0A 1Q0NA 1G7CB 1LNQA 3D0HE 2F5GA 3TA0A 2YKNB 2LQ9A 5FJ4A 4DPWA 3HHDA 1IBMJ 1M5PC 1RLCL 1SCJB 3DLGA 4RX6A 4B3TJ 3DOMA 2KXHA 3MM9B 5KG5A 1VQ5S 2CJ9A 2B56A 2YX7A 2C42A 3CF5Q 2K2PA 5SUHA 1DTTB 3NGDA 5B0EA 3MM8B 2KHDA 1X4DA 4RJVA 4ZMMA 3OVBA 3PM9A 1HNXJ 3RZAA 4BC9A 5IV3A 5B0CA 1A6LA 3AA9A 5KT4A 4DQIA 4RW4B 3M2VA 4RUAA 2HQGA 2R9LA 2HHHJ 2KYXA 2Z8QA 1C1CB 3CCES 1T9VA 2WCXA 3I0SB 1HHTP 1SC1B 1TL5A 4JI6J 1NKEA 1UEKA 2VDIA 4UUWA 1KVJA 4FKYA 5EWFA 3UWTA 3JTPA 4WK1A 2Q3PA 3MMCA 2JH3A 1UZHA 2CVEA 1XR6A 4OQJA 1ZH5A 4G1IA 4XPEA 2B9YA 4A8YA 2LEAA 3I32A 1U6ZA 3R5BA 4EI2A 1RAIB 1TKZB 3PJXA 1C4CA 3WC2A 4IRKA 1WJ9A 3M32B 1E6VB 4B3RJ 5THWA 1JLFB 3HULA 1DRZA 1Q86T 2M9KA 2VOPA 2YKPA 4OZLA 3HFVA 3MDFA 2KG1A 5F8LA 2YNFA 1IKWA 4J9VA 1VQYA 3DGPB 2X51A 1WC4A 1VK3A 2AYEA 1KQFB 1UA0A 3FMBA 2MB0B 1S1TA 2AWZA 2MLYA 4OJHA 3CD7A 2EPIA 3IXQA 4DX8H 5KFNA 1BQXA 2Z58B 4KSEB 3IWNC 3K5LA 1B64A 2GMJA 1R0BG 1QUVA 4DCPB 5F9NA 2ZWPA 3H98A 1XNQF 3KFWX 4OX6A 2XULA 2YBVA 3G8SA 4RPFA 4B9NA 4IOAQ 1CQMA 4OYIA 4DV5F 4B3SF 5ETRA 2AV5A 3UDEA 2QIFA 3VTIA 4YB7A 3GYGA 4I0WA 1Q5YA 2IM1A 1U1MA 3GFZA 4B3MJ 4OZ2A 1VRTA 1S12A 4WE1B 3HCXA 4IR1A 1RKIA 4M63A 4EUVA 2B6AA 4G65A 5HMXA 3NBPA 3DLLQ 2XCPA 2FVQA 4HKQA 3ICLA 1KQGB 2UVRA 1RACB 2C3OA 1KKHA 5HLFA 3V6DA 2PFDA 1LW0A 2G0JA 1HQUB 2YH0A 2A3JA 2DBBA 3PV8A 4JUZA 1REVA 5B0AA 3DRRA 3CDWA 4ZITA 3CIZA 4DV7J 4OZ0A 3O44A 2DXDA 3HVTB 1NHUA 3M8WA 4C9DA 4XAKA 1H3DA 3JYTA 4X4UA 2L08A 1YJTA 4TY9A 1JJCB 4ICLB 3THPA 3C66A 2QA2A 3LAMA 2MKKA 3VCDA 2ROEA 1YVFA 1SBRA 5FDLB 3KG1A 3GFXA 3BZQA 2OAUA 4DF4A 3CMAS 2F8MA 1VBZA 1WSVA 2RRAA 1NJWA 4ZLPA 5C25B 2F8EX 3GG1A 4NI2A 1UFWA 4ZPDA 5F8HA 3TANA 1PBUA 3EVOA 1F60B 2G1DA 1FDNA 3UN5A 2UUAF 4AQYJ 2J5AA 4M5HA 2DVIA 5F0WA 2BYCA 1HNZF 1PAUB 3OTOJ 5D3GB 3LTOA 4F26A 4ZJQA 2LDYA 3GONA 2V50A 5ADZA 4NLRA 3MM7B 2E7VA 1WHXA 1XERA 1WD6A 3LP2B 5IT4A 1ZS6A 2WK4A 2PD1A 4EFAC 5DLGA 4EBCA 5HMYA 3D28A 1EZZB 1H2TZ 1WORA 2XY5A 1UWBB 3NLCA 2RUGA 2OTLS 2VG5B 5GAGU 4FKXA 1MU2A 1UPMB 1TL7B 2DT9A 3P6YC 1RT6B 4TLRA 1RT7B 2VG6B 1WHYA 2WOMA 3PCOB 3MAHA 1S9EB 1S9FA 2C28A 4V1Ak 3T3FA 3LPYA 1QD1A 3NWGA 1TKTB 2VH7A 3GLJA 5KG7A 3EGVA 3DXBA 4LRAA 4ID5B 3DCAA 1I1GA 3R27A 2NLWA 1JLEB 3HFZB 4DV2F 1CJUA 3I5BA 5MAOA 5J2PB 1H38A 2OUGA 2HFVA 1NJYA 2CVIA 5AE3A 5L38A 1NLKL 1FKOA 1R8BA 4YHHJ 2AEJA 3CCTA 2RHQB 3N28A 1TVRA 2CIMA 3LQVA 3FBFA 3D6FB 1F3FA 3GFYA 4MMOA 3UDCA 3TJ9A 2XQCA 1W2IA 1NHVA 1DARA 5KFXA 3LUYA 3W5YA 1Q7YT 5A8KA 5B0GA 2IC3B 4QR1A 2M52A 4WBFA 4IR9A 1CC7A 3MUMP 2OD4A 3ENVA 2MLZA 4NLTA 5L1JA 5I4MA 2XHCA 1RHQB 2C2RA 2NQPA 2XNRA 3Q8UA 5KFZA 2OEMA 3VV2B 2M3DA 3QPIA 2VDHA 1N5YB 2Z0GA 4DR7F 4EYHB 3I9V9 2HQIA 2DEIA 2V94A 2YQ3A 2XMKA 1NDLA 3KMQA 3HFKA 5CYQA 1BQNA 1FD2A 4M5GA 1R6YA 2VICA 2ZJRQ 4OX7A 2RU9A 3N9UC 5A8RB 2HHSA 3E3XA 4GVBB 2B3TB 5HL7Q 2H4WB 5H9EJ 3ISND 3M1VA 2ZH7A 2YPYA 2Q6CA 5KFKA 2QRRA 2XMMA 5L39A 3V2UC 1WF0A 1JKHB 4G1PA 4ZIVA 3C15B 2Y1RI 3CNQP 1NO8A 3BBBA 2RU3A 4C98A 4L3KA 1BXNA 4DMZA 4OYPA 4OZ1A 3QLHA 1NM2A 2V4JB 2J9CA 3RBDA 4PR6A 4U9RA 2VB6A 2XI2A 5D4LA 1KVKA 5LMNF 1S6UA 2BACA 3QMQA 2VKZG 3UCUP 1RU1A 3TW0A 3U7JA 2NXJA 2BJ1A 2CADA 3FJ2A 1RB0A 2PN6A 1SJQA 2ZFHA 4CT8A 3CJKB 2XYHB 4YS2A 2QEXS 1HBUB 1Q8LA 3WDOA 3N01A 2RSQA 4DSIA 2W2PP 3SCKE 4A8SA 4HACA 4JYAF 4XDDA 2B9EA 2KN4A 3VF0B 1NZAA 2CKWA 5AJ3J 4K0KF 3RBZA 4P10A 3US5A 4WFAQ 3R5CA 4IFYA 4DPTA 5LSOA 1YITS 4YY3F 3BKUA 2HAIA 1WC6A 2HBYB 5GMKa 4M5NA 1J5OB 4LRCA 4FXVA 2AP6A 2QN6B 2BE7D 3BBFA 4XIUA 1WWHA 3RB0A 1NU4A 3OLAA 1M5OC 1A9NB 3KK1B 2M8HA 3BPSP 4UQGA 3H25A 2YNIA 3MMCB 3F41A 3C6TA 3BGLA 4O3QA 4RUBA 1T8EA 2N3OA 4JOUA 2ADBA 4DL7A 4RO0A 5H9FJ 3GIIA 4Q2MA 2FGCA 1FRHA 3DHXA 2UU9J 4YEAA 4ANDA 4ZLNA 1SKWA 3OTCA 1QLNA 2W1BA 4W98A 3IR6B 2QC3A 3HT0A 3B6BA 3JTOA 4CRJA 4DX7A 5CXTA 3L09A 5DG9A 2GO9A 1YRUA 3BGUA 2YNFB 3K5OA 2HYIB 1IKWB 2CQGA 3ETMA 2M70A 4WU2A 1Q81T 1S1TB 1WC0A 2MZTA 4IOCQ 4I4BA 3MWBA 1URRA 4ITSA 2YWWA 5IC6B 3R5JB 5HANA 1RHMB 2NXCA 4DEZA 3G2XA 1QE1B 2Z2YB 4OL8A 1KN6A 4DFMA 3PR5B 4YR0A 2NPFA 3Q24A 6FDRA 4NLUA 4OYOA 1IN0A 3HVRA 3BN7A 4DF8A 1NSAA 2DXFA 2XEXA 3T5KA 4DV4F 4NLPA 1SUQA 2K7KA 3AJDA 1JLCA 2KT3A 3T6BA 1HWIA 1EETB 1ZM9A 1RHUB 2HVZA 3D66A 2E1RA 1VRTB 3FFIA 1CG2A 2DKOB 1N56A 1IBKJ 5AE2A 1WI8A 2B6AB 3NBPB 3AJ1A 2DJWA 3TQEA 3MPYA 3UQSA 1UVLA 3SSRA 4X64F 3I9ZA 3V6DB 2HHTA 2CPFA 2CQPA 4CLZA 4IG3A 4CLPA 1TTHB 4X2BA 5GAGI 3TZXA 2B4VA 2CPIA 1FWKA 5LJ5Y 2F3JA 1UMJA 4QU7A 4R8UB 2VG7A 1RTIA 2IRYA 5E41A 2UXBF 5EDWA 2DTJA 1N34F 2DRBA 1S6OA 2QLBB 3I55S 1S49A 2HLTA 4FF1A 3VQTA 1QY7A 3BSAA 4LQ9A 3QO9B 3ZTRA 4NI2B 4Y2CA 1RWPB 4DR2J 4DR6F 3CJ4A 3MXHP 1Q1KA 3BGOP 1FFGB 2ASDA 1ZA1B 2VBXA 4Z37A 1WC3A 3KLHA 1F5CA 1K1SA 3GJRB 1TELA 2D1CA 4EGLA 1Q5VA 2IM0A 3G8QA 4MYTA 4O4GA 2ILZA 3E01A 5KT2A 2GQ2A 4DPUA 2N82B 2VJVA 2XS2A 1WI6A 3KLGA 4LF9J 2FJVA 4P2MA 1RAHB 2ZVSA 2RHSB 5HK4A 3TEHB 2HMIB 1MU2B 1S7IA 4ZVRB 2MSSA 3BKFA 5EX0A 3HSZA 4CT9A 1FTCA 1LWXA 1X5SA 1ICEB 2BBEA 2W7AA 4OZNA 3C46A 2UUWA 4NXNJ 2V2ZA 1NEEA 4JBCA 3NGRA 3HP6A 1I94F 2CQHA 1SH0A 4LVOP 5KFQA 3ADAC 3OSNA 5LL6d 1M5VC 3OV7A 3CXCR 2VJUA 4R5PA 4K7QA 2VC1A 2KU7A 1KEKA 1XNRJ 4LREA 2D69A 1SJ3P 4DFKA 1SVDA 3AOAA 3LA0A 4MKBA 2FGOA 2HBQB 3SXLA 2HBRB 4QR0A 3L3CA 3BSCA 5F41A 1BWEA 1TVRB 3GWCA 2N7YA 2ZNYA 1S6QA 1WOPA 3W65A 3KLEB 3LGHA 4KC5A 1SV5B 2PA3A 3SSSA 1JWWA 1U1LA 4FNIA 3Q8RB 3C16B 5A8KB 4RU9A 2DNPA 2R8IA 1XK8A 1DAXA 1S4FA 1KQKA 4F7VA 2VZ9A 1BQMA 5CHCB 5A2QY 4HTIA 5GAHU 4QU6A 4OX8A 2B0GA 2POKA 4X4PA 2GX8A 4CLWA 1XMQF 2R7VA 2W4PA 3WZ0A 2V34A 5LMUF 3THTA 1MROA 3A8KA 4R0EA 3MPDA 3FSYA 4O3SA 3MEEA 4ED7A 1BGXT 3N5BA 2QA4S 4F3MA 1KLNA 2NXNA 2J0SD 2WB4A 1K47A 1QSYA 4IRCA 3IAM9 3SFUA 4DFJA 1MMDA 4CDIA 1V5IB 1BQNB 3I0RA 3TOQA 2OJ3A 4KGXB 2UUBJ 5F3TA 4NASA 2ZHBA 5G0RB 3EPIA 2ASLA 4NLVA 4BBYA 4IDKA 3GJQB 4DR5J 3JQMA 2GGPA 3QQCD 4ZCLA 3MCNA 2AYGA 2RQCA 3AT1B 3TVKA 1NHKL 2BW7A 1U02A 3FSIA 1K73T 3A1YG 3NGUA 5K8OA 3H2LA 3OL7A 3AA8A 2HS4A 4ELTA 3QLHB 2Y1IA 2DY1A 1T7PA 4WXWA 3NAHA 4J9QA 4LSLB 2HHWA 4OJ1A 4AD6A 5B7WA 3RR8A 5IT9Y 3FUYA 1H74A 4KRWA 5DLFA 3D6HB 3JQJA 2XCAA 5H9EK 4C8LA 3V81A 4H4OB 4ZCKA 2IRXA 5F8IA 2FJDB 4DV6F 3JXOA 1HBNA 3V4MA 4DSFA 2AHOB 3FNNA 4ED3A 1BE4A 3NGKA 3M2UB 2HQCA 5AT1B 1FTRA 5I3UA 4GO5X 5BJRA 3TWZA 4K4TA 1FNXH 3J7YU 4DR4J 3AD7C 4WYLA 2G2ZA 3X1LB 1APSA 2Z2LA 4MFBA 3F44A 2IM2A 5KFFA 1R0AA 4HACB 3KNAA 1HQ2A 1WSRA 2RJZA 2RQ4A 2XMWA 1K0TA 4PG4A 2ZKUA 4EK2A 4IFYB 4H4MA 3DDIA 2ATLA 3LPEA 2DGSA 3R97A 3KLIA 3Q22A 3MPUB 1PAEX 3Q86A 2L41A 2HNYA 5IT0A 1U09A 3VVTA 4I6YA 4PKDB 4F2RA 1NSPA 2W7OA 2ZC3A 1LQ9A 1OQ6A 4DL3A 1SL0A 2GIQA 5C24A 2DK2A 2I1RA 2KRRA 1N0VC 2H3EB 3QFHA 4O3OA 3CDEA 5E3RA 2OMOA 1N33J 2C2MB 4EO8A 2CA9A 3VGTA 1F5AA 2MDAA 5KFIA 2BE9B 1RDRA 4TLQA 2E5LF 2CDRB 4JI2F 3HHEA 1RSCA 4ED8A 2QLJB 2RIJA 1HMVB 2VOOA 1AYEA 2EFGA 1L3TA 1NH8A 3M2RB 4QCLA 4Y34A 2KH9A 1MWQA 2BOAA 1S0VA 2JWNA 4I67A 1GNKA 1HBMB 1U45A 1NUEA 2HG4A 3VZHA 4CH0S 3TA1A 3ETOA 4WTOB 3PFOA 2HRTA 4PABA 4WF9Q 2QX0A 4USKA 3IS9A 3H7HB 2XLIA 2GFFA 4K4SA 3O1LA 4OYAA 2I0XA 5H9FK 3EGWB 1XN9A 3H5XA 1T95A 5F0UA 7AT1B 3TRGA 2QL9B 2XO6A 1CBKA 1NAQA 4OI4A 2NUUG 3KK2A 1R89A 1UW4A 3BGRB 3NP5A 1X9WA 1I6JA 2GHWA 5AXKA 3CCJS 4KBIA 4ECQA 5IV4A 1X8DA 3RU0A 2NXEA 4MK7A 5F8GA 1VC6A 2IYGA 3OL8A 4ZPBA 2XMVA 3EVMA 4ECZA 1U0HB 1ZTTA 2SXLA 3FCVA 1T9UA 1UJ5A 1LWEA 1NJXA 3KHHA 3M9NB 3FFIB 3TA2A 5HROA 3VGVA 3F56A 1U2CA 2V9KA 4LIRA 2D9PA 4TY8B 4LF8J 3W2WA 2XS7A 1JLAB 2ERRA 3QATA 1UKUA 2O66A 2ZHOA 5IWAF 2FQQB 1Q4RA 2DGQA 2LLZA 5E2QA 4RWXA 2RMLA 2YWFA 3QGIA 1NK0A 2KB2A 3I4HX 2MQLA 4FVCA 2NYIA 3J7AN 1M0SA 1T05A 5D77A 3H5SA 3CJ3A 4JV1A 1VBXA 1S6PA 1LEOA 3Q8PB 3W66A 1TR0A 3Q8SB 4OI6A 3PXGa 4HDHA 1H98A 3S8SA 1S9GA 4EMDA 3RB3A 1U6FA 2MKSA 4JI7F 2RKIA 3DN9A 3HJVA 3GV7B 4IH5A 5DJBA 2EFOA 1DQ8A 1D3WA 4NCBA 1NH7A 2PDAA 2YVSA 1LFWA 3CMES 2GAHC 3GB0A 3T9ZA 4X65F 4LT6A 4HHHA 5J2MA 1F6TA 3HJFA 4MYUA 2EFQA 2DR9A 3DRPB 3O2IA 1JLBA 3TX0A 2V8DA 3BDEA 1RWNB 2CQ0A 2Y0BB 3UN3A 1U2FA 1N36J 3DOKB 1Q95G 8ATCB 3GG0A 1OWXA 1N5SA 5EWGA 3IWXA 3KTQA 1N48A 2JRSA 1RWVB 3V4IA 2WRMA 4U96A 1YBAA 2HWIA 3A8EA 2R7UA 2LQBA 4CZCA 2QFIA 2AIRB 3IM8A 3AHPA 3T41A 4M95A 5KT3A 1MN7A 2MY8A 4FXDA 2RNEA 3KLGB 1N32F 1HBOB 2RB7A 4DS4A 2I5JB 4A8FA 5GAHI 4TN2A 1NKCA 1FF2A 1ROFA 4JI4F 4ZHRA 9RUBA 4LRDA 5L9XA 5J1NA 1VQMS 4ZP9A 4DN9A 4X66J 4DL6A 3PJ9A 3NG8A 3P45B 4DR1J 4ZN1A 1TV6B 1ZM3A 1A7GE 1P1TA 2PI4A 8RUCA 1NMEB 1WG5A 3DFEA 4GMKA 2HNZB 1LXJA 4ZVUB 2KM8C 3BYPA 5IQ6A 5CYMB 3MAAA 4ES2A 4OLOA 3BV8A 4R5PB 4LF4J 2VBYA 3CC7S 2GJ2A 4IG0B 2MZRA 4LF7J 1IM4A 1EP4A 3T9NA 3LAKA 1L3SA 5HMWA 4ZK7M 1VBKA 3V6KA 4DBQA 2E9TA 1B70B 4F4KA 2BXJA 4I2QA 3TVZA 2NS1B 2VONA 4CO3A 3M8SA 3DNCA 2LEPA 2N4CA 1FJGJ 4ZPVR 1KS2A 3S6EA 3WX8A 4LQ3A 3JB9k 3BH7B 1NNDA 1HPZA 2BQRA 4KGVB 4PZVA 4NEYA 1RT5B 1FEEA 2FJEB 4LFBJ 1RK8A 2O01C 2OGUA 3FEXB 3SCLE 2VU5A 2XSJA 1DLOA 1Q8IA 1DY3A 3VAJA 1RWOB 2HVDA 1GMUA 4XTTA 4ZVGA 3OTDA 1ZA2B 4I7FA 2J76E 4FDFA 5J2NA 4LF1A 2GQCA 1W7WA 2XM3A 3J7YI 4DV1J 3HVWA 4CO2A 4DV0F 3JTNA 3CO9A 2J9DE 4ZLLA 4TYAA 1T3OA 2IHR1 4HH1A 1VRQC 1VJWA 4ZPWR 2ATCB 1AZSA 1R8PA 2NSCA 4LF6F 4QW8A 3KHRA 1WDTA 4ZP8A 3CC4S 4NOHA 4K4WA 1KRPA 2BJEA 3MCOA 4IOBA 2E5IA 1IBLF 1C4AA 5M2UA 1MN9A 2DH9A 5D15A 3CT9A 2I38A 2B8PA 3LANA 3HM9A 2F9JA 5CCLA 1R3NA 3QFWA 4D3GA 1NSKL 4NLXA 1Y4ZB 2LXIA 2CZVC 4JI5J 2VQEF 2F4FA 1HBNB 4NMXA 1WACA 2DGWA 3ZZUA 1ZM2A 2E7WA 4LRBA 1RADB 3BSNA 4CLSA 1X0PA 3G6VA 3D54A 1UWAA 1YJNS 2PSZA 2J0QD 1JNZB 5C5JA 4YQWA 1F2HA 4MFBB 1R0AB 4QWDA 4J9NA 3RAQA 4JP8A 3OR2A 1XNQJ 1X4CA 3OTBA 5EHHA 3G4SS 3NL0A 1YTYA 1SL2A 3AD9C 1S77D 4NXMJ 2DNZA 3KLIB 1UEUA 3MOJB 2H51B 3FCWA 2P6TA 5BR8F 4F25A 4DV5J 4B3SJ 1JLQA 4A4JA 1EQ0A 3GCWP 3IBWA 2IPOB 1KHWA 4WP8A 5DZ7A 3SBMA 5KFWA 5DM7Q 3NEKA 1R7IA 2FHKA 3FVYA 4EU0A 5C24B 4ID8A 3RB6A 2I8EA 4A47A 2YKMB 2EFVA 4BLGA 1S1WA 2QJ3A 2CNOB 3AXKA 1Y9OA 2BJ3A 2JOQA 1RTZA 4KYZA 3KOAA 1WTFA 5EWEA 3CO0P 1D9DA 2CDQA 5KFUA 3QIDA 2CJAA 2Z56B 3LALA 4KV8B 1RYRA 1B4SA 2E44A 3ET6A 2K1RA 1FK9B 1LW2A 3O3LA 2HRUA 3FCHA 3UE2A 3M8ZA 1B0PA 3OR1A 1QAYA 2WONA 3HHKA 1U8WA 2ZUAA 3ENAA 2CJKA 3IS9B 3W9HA 3FK4A 4CH7A 5DRKA 3OFEA 3EYZA 3B78A 1VQSA 4AL7A 3TUPA 4DL0C 1HNXF 2G0CA 2B5JA 1U1PA 2MJUA 3FZ2A 2YKNA 2UUAJ 2M7SA 2IJFA 2HHHF 2BA9A 4CLKA 2ZVIA 2GO8A 1S57A 3AD8C 4K2XA 2R42A 5KG1A 5B09A 5AXNA 1SJRA 1U0SA 1DTTA 1SPBP 3MM8A 1SH3A 3HI9A 3MUTP 3PHTA 4RW8B 2BQ3A 2ABYA 1RBLA 1U24A 5HROB 3M8RA 3K8VA 4CLFA 4RW4A 3W2WB 4OI1A 3SEOA 3VQSA 4ALZA 1KHVA 3RR7A 3M8YA 2HHXA 1C1CA 4C48A 3I0SA 5KFBA 4WK3A 5AE1A 4B3RF 5KFGA 3G82A 1ZPVA 5KFVA 2RT3A 2EBGA 4WJBA 5KG3A 1LKZA 4QPTA 5IS2A 3CIMA 2DNRA 1S6PB 4I6AA 2K3IA 1GFWB 1RU2A 2YWGA 4BS2A 3T1YJ 1S7HA 2EK1A 3R5AA 2KVQE 2HFNA 2ZOFA 1A0OB 1TKZA 3FQKA 3TAPA 2RKIB 4ZPAA 3CULA 2MZJA 3M32A 1E6VA 1JLFA 3BREA 3QBCA 2OKQA 3HD2A 5HBMB 1WKLA 1X5TA 3UNGC 1RHJB 1YBUA 2Q43A 3B82A 2C3YA 3UO0A 1KBRA 4F02A 3I82A 2X1FA 5HSPA 3T5LA 2AJ2A 2ZHAA 3N5FA 4MKAA 3K89A 2CNKB 4N47A 4QBUA 4C0OC 5HJYA 3U02A 4B3MF 5E33A 5J2QA 1N54B 1NCLA 4L76A 3KUHA 2HURA 3V4IB 2GS8A 1UVIA 4CIOA 4HHUA 5IXUA 2DEJA 1I3OB 2RQKA 3L7PA 4DV3J 1YKWA 3BQ2A 2Z57B 2WVDA 4NA2A 4HL9A 1PBAA 2CQ1A 1DQ9A 5A6WA 2BKNA 3OSPA 4YR3A 2CXEA 1U25A 5HVHA 2L9WA 5HVFA 2LQ8A 3NAIA 5HMZA 2LQ5A 4ZP7A 1NK7A 4ECUA 4DLEA 3B4DA 2VPWB 5DO2A 4P7VA 2NXUA 1S10A 2ZZNA 3EXCX 1WC1A 2M8DB 3J81j 2JEJA 4M5DB 1H72C 2VQFJ 5BYQA 1XWLA 2XYPB 3TAMA 3QRPA 3IBCB 2WB1D 1NPPA 3VAMA 5DG7A 3ZZPA 4AQYF 1CPZA 3KDNA 1DQAA 4O3PA 4DX5A 3PYFA 2DRAA 3EUNA 4BDPA 3HVTA 3OTOF 3N6MA 1Y5NB 2E5HA 2AJQA 4KO0A 4MIWA 1DBDA 3VAGA 4RNOA 4ICLA 2F4VJ 2ZH5A 2GMHA 5FDLA 3DXSX 3MECB 2D3ZA 5L46A 2ZH3A 5JMNA 1O6XA 5DGBA 1Q8KA 5C25A 2XTJP 3WC0A 2YKOA 3D0GE 1MWZA 1W2BR 2B4OA 2FDNA 4ECXA 2QSFA 4I56A 3ENWA 2XSJB 4GKKJ 4RNNA 2MY7A 1VJQA 3K17A 5LSRA 1TQLA 4KHPF 4DOZA 3QAEA 3W5XA 1TAUA 3KK3B 3AQPA 3GCXP 4XDCA 4ELVA 3MM7A 4M5JA 1T0TV 4K0KJ 5J2NB 3TUZC 5DDPC 2UUTA 3LP2A 2ZH8A 3W61A 5C42B 1M5HA 4YY3J 2BQUA 1ZETA 4X84A 1OJ4A 2YPZA 2KXFA 3DOLB 4QJVA 2CPEA 4FS1A 1UWBA 2BZ2A 1NK6A 2VG5A 4KY3A 3GTYX 6FD1A 1HLWA 1TL7A 3G87A 2RRBA 2XGPA 2OPSB 1WDDA 4KHRA 2VG6A 4R0JA 2C2DA 1U26A 1S9EA 1LWFB 3CE8A 2RAQA 4WFBQ 3GU0A 4NLGA 3KKFA 5LSLA 3PACA 4ID5A 2RILA 2BV3A 2E1PA 1U1OA 3EE3A 5A76A 2EWHA 4N7TA 2C22A 2GAGC 3PEHA 4LSNB 1LFPA 1RBAA 1TFWA 4MTPA 1IQTA 1QUPA 4USHA 2LDIA 4RW7B 1PCAA 2UVWA 3FZBA 3AAWB 3OT9A 1SL1A 5FLXY 2FB0A 4OMFG 4OJGA 2JVRA 4EBDA 1NDKA 1PYSB 3CCRS 3BR9A 5KFCA 1Z2ZA 3WX4A 1BWVA 4C3KA 2WSFC 1HARA 2IC3A 2KT2A 1PC5A 3N6NA 1CC8A 3N6LA 3TI0A 1KFSA 5C7PA 4IFVA 1R8HA 4C97A 4ZVPB 1RP5A 3K0JA 3L9ZA 1JLQB 2DIVA 2BDPA 1N5YA 2HHQA 3PDNA 2NUHA 2IDEA 3CJRA 2DR7A 2GV1A 3QGPA 4LFAJ 4MJKA 4NL5A 2QV6A 2B43A 1YIJS 4CLTA 2HIYA 3J80Y 1CJVB 2CNNB 1FRIA 4HLBA 5A8RA 2YQ1A 3MMAA 1D1UA 3CJTA 1L3KA 4RW6A 3DGVA 4AXJA 2GJFA 2ZEJA 4OLPA 3BF4A 5T14A 2RH3A 3QJJA 3PYDA 4CCHA 4RL1A 5KFDA 3FRYA 1MW7A 5JXSA 1T9TA 4G1QB 5DDRC 1UA1A 1S1UB 3L4BC 3TUJC 2OEJA 4RNFA 2JZ5A 1FHTA 4Q45A 4FXWA 2WONB 1S5ZA 3A3OB 1MMLA 2AZ3A 2ZM6F 4PXEA 1YSJA 2V4JA 2DNLA 3UDLA 4HEA9 2ROPA 2AU0A 4OI2A 1VRUA 2OD6A 3NMAA 3OL6A 4RUHA 2D41A 4DR6J 5IZHA 3TZZA 3CJKA 2R8JA 3HHLC 1AUDA 1PKUA 3ZTOA 3ZTQA 1EKRA 1HBUA 1J27A 2PEBA 3UCZP 2AX0A 1QM9A 1VQ9S 3R8YA 3SMZA 3FQLA 4NMLA 5G4DA 1D8YA 2NZCA 3O5TB 4RR5A 3FC9A 3KLVA 1F5BA 3RTVA 1IKVA 4CO5A 4IKAA 1O51A 5MLCV 2C3UA 2YTCA 1UFKA 4NA1A 1U4BA 4URQU 2UU9F 2FJXA 1J5OA 2YNGA 3PKMA 4UTGA 4NYZA 1RT3B 1OSDA 2HGLA 3IAS9 3G82B 1GK8A 3KK1A 5E3QA 1WF2A 1XMOJ 4MH8A 3U1LA 5L1IA 3PEJA 1YBTA 3P5BP 3PIPQ 2WVEA 5F3ZA 3PNIA 2B51A 4NLSA 1H2UX 1UAWA 4JI0J 3D6TB 2OSRA 3G9CA 2HVEA 2HK2A 3HX9A 2X1AA 5SZTA 2P2CB 3NCQA 2O5DA 2MQPA 2LCWA 3VALA 3G96A 4F67A 2OH2A 3OJUA 1XJWB 1SC3B 3PVXA 2W4CA 3BS9A 4Q2LA 2HHPA 4ZJLA 1S97A 4J9PA 3RJMB 2KJWA 1L3UA 4ZPCA 5KOXA 2QLXA 1OY6A 4X4NA 2E9ZA 1ZZNA 2N4DA 4PQUB 1Z4UA 4NLYA 1QE1A 3RRHA 5J2QB 1TMJA 2UP1A 3CVKA 3OTEA 2RDIA 3D2WA 1QVGR 1IBKF 1XMQJ 4TKTA 2JLFA 1HI8A 2LEBA 2FLOA 2HHVA 2IVYA 1GMWD 1K1QA 1RWXB 3MURP 4QPXA 3D5MA 5DETA 1RT2A 3QSYB 3FSXA 3RAXA 3DHWC 5HATA 4DPYA 2B7CB 2GC8A 4RBTA 1YRXA 4FP9A 2KZMA 1EETA 3MCMA 2WVFA 1IWAA 1SIZA 3NGSA 5F8MA 1AB8A 4HI2A 4CM2A 2A10A 5ETLA 1IJEB 2YY3A 2FHJD 4BCAA 4WKRA 2X3DA 4KH1B 2E1CA 4U7UK 1C0TB 3TAMB 3W60A 4X4QA 4KE5A 2CJBA 2GVDB 3G8TA 2PI5A 4DZ6A 1NB2A 4EYIB 4DR2F 4B02A 1TL1A 2WAQD 1D9FA 4OHXA 4R8UA 1F9FA 2FD2A 1VLYA 1WELA 3TO8A 4UY8T 3FBCA 2UUCJ 3GQCA 4KO0B 1U1KA 2H54B 1X9SA 3VHQA 4NE9C 5AXMA 2BKPA 1FRKA 2HNDB 4RLEA 2XMJA 2W9BB 1WG4A 4B9SA 3BSOA 2L3MA 2ZWOA 3UR3C 4DV6J 3O6QA 3QO9A 3ITHA 3MMJA 3VVUA 3CPWR 3RBEA 4FYXB 2ZDPA 4GC6A 1SH2A 5HAOA 3LGMA 2ZH1A 4LF9F 2BEFA 3LP1B 4FVMA 4KT0C 2OEKA 3FDSA 2F9DA 4DN0A 4KQZA 4KAIA 3IRXA 1KNZA 2IVMA 1VMBA 2VPXB 5FIIA 1VQPS 4DWIA 2IY5B 4E8UA 4FPIA 2DNKA 2FY1A 1GT8A 1D9AA 3WBZA 1BD6A 3RUBL 1U2RA 3M30A 3W63A 1Y3JA 4EWTA 1YHQS 1DTQB 2CZ9A 2JNJA 4WP3A 4K4YA 3H2UB 2EC2A 2HMIA 3SZ2A 5DGAA 4B9UA 5U47A 4YMEA 2JSXA 2R2UA 2X7IA 1XNRF 1BMQB 3W9JA 2NCKL 4FPRA 1V3RA 4KFBA 3OFGA 3EJMA 3OBIA 3RW7A 1CJKB 5KFLA 4EZ9A 1KP6A 4OX9F 1PG5B 4O4RA 2AEFA 1IR1A 3C3LA 3QYYA 3QWUA 3RB4A 2DGOA 4Y65A 3AOCA 2D3UA 3M4XA 3V6HA 4J5OA 2ALZA 4UOCA 1EIYB 5J1EA 2QMUB 3CCUS 1HQEB 3IMQJ 3GFHA 4H4KA 5DDQC 3KLEA 4B08A 2KG0A 4LF5F 4K5SA 2BOPA 1SV5A 2EC0A 1W25A 3N79A 3T5HA 1Y0HA 3C16A 1X0FA 4M5MA 4DQRA 1BC6A 4C11B 7FD1A 2UUBF 3D68A 2FJWA 3H0PA 2K7JA 4OV1A 4IFVB 4DCJB 4F4AA 2WVCA 3UVJA 4JI1J 1YWXA 1FWPA 1TKXB 4UW2A 4DSKA 2AT1B 2OPQA 4W90B 4JI3F 2Q1LA 2DNYA 4DSLA 4PQAA 2JC0A 3D0IE 5GAEI 4IQMA 2ZBQA 4A48A 1RAGB 3HZEA 2MQMA 2ZOGA 4HT5A 3MEDA 5G0RA 1VGYA 3MMAB 3MFIA 2C2EA 1ACMB 1KFDA 3S01A 4Z7CA 4RW6B 1SQFA 4XK8C 2PIIA 4GC7A 2QA4G 3K8WA 3O8WA 1FEHA 1E6YB 2XZWA 1FRJA 4NLQA 1T3NA 1YI2S 2PMWA 3DMJB 3QRQA 1GMVA 1IXKA 1VQ7S 3C14B 4P7TA 2VC0A 3M8PA 2J0WA 3MI7X 1N8RT 4QOTA 5DZ6A 2CUYA 2AJFE 2J7UA 1NK5A 1N88A 4I2PA 4DCOB 2H1YA 1N5VA 1WF1A 3C6UA 4DR4F 2IMOA 4QYZJ 1HNWJ 1AFIA 3H40A 2QLWA 5E3AA 4LSLA 3OPKA 1SKUB 5IFMA 4OYWA 2VFTA 2NZ4A 1RZMA 3MD1A 2O67A 4I64A 4A46A 1EKSA 1VRUB 4H4OA 2P6SA 2VASA 3IP0A 3JAMY 3SCJE 3CEDA 3K59A 3V6JA 4X65J 3B54A 1HA1A 4CM0A 1JNRB 2CPJA 3M2UA 3G71S 1QTMA 2R7QA 5K8NA 2J7KA 2C2ZB 3AJ2A 4J9SA 4JI8J 2YNHB 4WXOA 3ZTPA 2V67A 3J7A1 3M9MB 3B8HA 5DQIA 1KSPA 3GIRA 2KTQA 4QZVB 1W26A 2IIHA 2GJIA 2MQQA 1X4HA 4KPYA 4U7UD 4OHYA 1UJ6A 3JSBA 2VD3A 5KFTA 4Q44A 4AXIA 2EEYA 1IKVB 3DM2B 2HQ3A 1FXLA 4KH0B 2MKYA 1IUJA 1OS5A 2Y3YA 4DL5A 4LVNP 4ZVHA 1K8AT 5CD4H 4BWMA 1FO1A 3P8BB 1G3OA 2UXCF 2YNGB 2EG2A 1Q7LB 3IR7B 3I5CA 4TU7A 1S79A 3CC2S 3J81U 2BR0A 1KOHA 3FBBA 3P5TL 3OFFA 3Q89A 1YJ9S 3PFEA 3W64A 4F4WA 5E3PA 1XBWA 2XZDB 4C8NA 2DCUB 1AXQA 3CCSS 2BW2A 1BLUA 4A8OA 4YFUA 4HT7A 4QR2A 1RBOB 4ZOSA 2HRYA 1RTJB 4IYQA 1HMVA 4Y6IA 4ILMA 1FVQA 2C2NA 1RAFB 4WPAA 5EX3A 2IMWP 3M2RA 4RBUA 1BUXA 3T1HF 4ZVTB 1GTEA 3NNHA 1HBMA 5KFEA 4WYWA 2CRLA 2UXDF 3MUVP 1CULB 1C0UA 1F3VA 2ZH4A 2OHDA 2NR0A 2DNHA 4OZ3A 3UD4P 3THVA 4ECWA 4A8KA 2OIHA 3BH6B 2CJYB 4ETZA 3MOZA 4B9VA 3MGJA 2JDJA 3Q8QB 1FJEB 2OPPB 2L9NA 1AROP 1VYAA 3H20A 3ZZRA 4ANEA 2Z30B 1HW8A 2G9OA 2BRLA 3BO2A 2DR6A 2C2OB 2WZ1A 4LF8F 3N0VA 4PG7A 2H4YB 3BGRA 1BHNA 4OYXA 4CWBA 2WW4A 1CQNA 5CYJA 1RT2B 3A13A 4NWBA 2M0GB 3PW5A 2RDJA 2M2BA 4U67Q 1FX2A 2FHOB 4DV0J 2HLUA 5C2CA 1U0HA 1VK8A 5IC4B 5FLXU 4Q43A 1N6QB 4C0HA 3VGUA 4J9KA 2DHAA 4CO1A 3W9IA 2DH8A 3CD5A 3RG6A 2EVZA 2C3PA 2B8QA 2XBPA 4TY8A 1WTBA 4QW9A 1FDAA 1Q8BA 2CNLB 1JLAA 3A3NB 4LF6J 4C3MA 4UT4A 3I96A 2ZDOA 3QT5A 4O0NA 1Y00A 4W92B 3IR5B 4ER8A 2HFOA 2QL7B 1TL1B 3PG9A 4JV5J 2PEHA 3SIPB 1TK0A 3WIVA 4B17A 4F8RA 1P8GA 4PPDA 2R3VA 2XMUA 2HKEA 3W8GA 5DM6Q 1X5PA 6AT1B 1N36F 3OVAA 5I3PA 1SQGA 4DG1B 1FD8A 3MFHA 3GR0A 3SQGB 2HEKA 2PGCA 3GYXB 7FDRA 1AT1B 3AH6A 3ILJA 4QQBA 4QYRA 1GAOA 1HNVB 4UQTA 3ITHB 4YOEA 4ED6A 3H2VE 3KYLA 2CPDA 2ZZMA 1L3VA 4Y28C 2MMYA 1WOOA 1KR4A 1SQEA 3IRXB 1VHFA 3DRPA 1RWKB 5ETKA 2ZH6A 2IFXA 3WHIA 3DOKA 5C2GA 1RT1A 1VR6A 3AB2B 4ZIWA 4X66F 1VFJA 5D0RA 3M6XA 4F0HA 3M30B 3GV8B 1HW9A 3Q23A 4M5LA 3BEGB 1HBOA 1K9MT 1NBEB 4RKUC 2I5JA 4TVAB 4FBTA 1M5SA 4E98A 4KKOB 4LF4F 1PYOB 3M8QB 4LF7F 2QG9B 1HR0J 2W8LA 1P27B 4JB8B 1WHVA 5A6PA 1UJ4A 2DIUA 4KFBB 1TV6A 2AQ4A 1UL3A 3IGVA 3POTA 4CO4A 4ZVQB 5GMDA 3BYRA 3TP2A 3Q8YA 3BR8A 1YJ7A 1HHQA 4YP3A 1FJGF 5KG2A 4UOHA 2IYIA 2HNZA 4J7CA 4DUZJ 5CYMA 3PRBA 5CH7B 3PW7A 4IG0A 2PC6A 1NRKA 1VLOA 3I4PA 5ETPA 4LFBF 5KFRA 3Q83A 3LWMA 1KWMA 5J1EB 3ZZZA 2UVUA 3GSIA 3UCGA 5IM0B 2WSCC 3EZUA 4ELUA 2ZD1B 4ZDNA 4P73A 1EQMA 4N8NA 1CJTA 1ZOTA 4ZKAA 1Y3KA 3KJVA 2N3LA 4DV1F 5GMEA 2R7TA 5LJ3Y 4B9TA 4K4ZA 1X31C 3HVAA 4ZPTR 3PJWA 3OL9A 1RT5A 3R1HA 3FRZA 2FJAB 4HI1A 3OLBA 4L72B 3NY0A 2CAJA 3UVJB 5E7OB 4QIVA 5JUMA 1LV5A 1PJ6A 1DFDA 4EO6A 2FVPA 2OPQB 4PPZA 3Q8VA 2C3MA 3EVWA 4A8XA 4AE5A 3EDQB 2V8VA 1TL3A 2AZ1A 1IR2A 4NLWA 4ED2A 3MEDB 2KKHA 3D4JA 4YR2A 4FN5A 5BYRA 5CAAA 3L95X 2QTWA 4JI5F 3QRRA 1F0XA 1EX8A 2EKYA 2RVJA 2ALYB 3M8PB 2FPHX 3B4MA 3MR3A 3IN5A 3MTKA 1VQ6S 4I2PB 3G6XA 1NKBA 2FLPA 4KR0B 3DI6B 3C6UB 3C19A 3MMBB 1Y11A 1GEHA 4UOGA 4ZCIA 2I9SA 3TR5A 3MEGB 1WNEA 1T94A 1SC4B 2B4UA 2BUNA
chains in the Genus database with same CATH topology
3VAMA 2JX2A 3BGLA 3MTJA 4O3QA 3ZZPA 1H6KX 5DG7A 1U48A 1T8EA 4NXMF 2N3OA 2OPPA 4JOUA 4AQYF 2HVIA 1CPZA 1DQAA 4O3PA 2ADBA 1FNMA 1H7WA 4DL7A 3MM6B 1X4BA 3E2EA 2DRAA 4PG8A 3EUNA 5H9FJ 3GIIA 4BDPA 3HVTA 4Q2MA 3OTOF 3N6MA 3OQ2A 1Y5NB 4IDKB 3EZ5A 2E5HA 2FGCA 2Q79A 3J7Z5 2AJQA 2HS3A 1FRHA 4KO0A 4MIWA 2GGPB 2XB2D 3R5DA 1DBDA 3GSDA 3DHXA 5HI7A 4YEAA 3VAGA 4RNOA 4WFXA 4X4OA 2CQIA 1X4EA 4M8LA 1OO0B 1SKSA 3TNVA 4ICLA 5K8MA 1SKWA 3OTCA 1B0TA 1URNA 1QLNA 2ZH5A 2L48A 2UZAA 2GMHA 2OFHX 4U6PA 3IR6B 5FDLA 3H4BA 3DXSX 3H5YA 2J0XA 1JX4A 4X4RA 3MECB 2D3ZA 3JTOA 2Z4PA 5CXTA 2ZH3A 3L09A 5DG9A 5DGBA 1FE4A 5C25A 2GO9A 4OHWA 2KI2A 4HVZA 1YRUA 3BGUA 3GMGA 2R2TA 2YNFB 4ETXA 4JV5F 3K5OA 3WC0A 2HYIB 1P6TA 1IKWB 2CQGA 2YKOA 3D0GE 1MWZA 3CUNA 4PWUA 2EI5A 1N6QA 1W2BR 2B4OA 2FDNA 2W25A 4ECXA 2BANB 2M70A 2QSFA 2XHWA 4I56A 3ENWA 4QIEA 4WU2A 3RRKA 3OHAA 1S1TB 1Q81T 2XSJB 2MZTA 4IOCQ 1R8AA 4LIWA 2W9CB 4I4BA 3MWBA 4RNNA 4F3QA 2IAJA 1URRA 2GCFA 4ITSA 1OIAA 2MY7A 4U7CA 1U49A 5LSRA 1TQLA 4KHPF 4DOZA 5HO4A 3QAEA 1TAUA 3KK3B 3AQPA 1PILA 1H7XA 4DEZA 5EGYA 2DB1A 4XDCA 3DYAA 5KG6A 4ELVA 1QE1B 3MM7A 3V81B 1VQ4S 5I42B 5J2NB 3TUZC 5DDPC 2HGMA 2UUTA 2ZNZA 3LP2A 2ZH8A 4OL8A 1KN6A 3VAKA 1YJRA 2XG8A 1SXLA 4DFMA 2BVZA 4L3NA 3P96A 5C42B 3PR5B 3T5JA 1M5HA 2U1AA 4G6VB 4YR0A 4WCEQ 3LWLA 2YKQA 2BQUA 2NPFA 1HYSA 4MKYA 3GIKA 2YKMA 3Q24A 1ZETA 2AYBA 4X84A 4QIFA 5EUHA 6FDRA 1V6HA 1WG1A 2OTJS 2QYCA 5I3UB 4NLUA 2KXFA 3DOLB 3BGFA 2FC9A 2RS8A 4QJVA 2CPEA 1IN0A 2E66A 1WHWA 2IVFB 3EX7B 3HVRA 4FS1A 1UWBA 3BN7A 4DF8A 1GH8A 3IA0A 3DU6A 2BZ2A 2XEXA 3T5KA 1NK6A 2VG5A 5ITHA 2K3KA 3H8YA 1U6BA 4DV4F 2DHGA 4NLPA 6FD1A 1SUQA 2K7KA 2R4FA 1Q16B 1JLCA 2RRBA 1D0EA 5DDOC 2XGPA 4PRFA 2OPSB 5KFPA 1JJHA 3HLUA 2KT3A 3T6BA 1PC4A 4DG1A 4KHRA 4N56A 1HWIA 2HS0A 1C1BA 1EETB 3U1NA 2R7OA 1ZM9A 3SQGA 4H4MB 2HVZA 2V8GA 5KFYA 4LUBA 2VPZB 2VG6A 4KV8A 4R0JA 5I3QA 4IH6A 2E1RA 2C2DA 3EGNA 1VRTB 1U26A 1S9EA 4TU9A 3J7ZT 3FFIA 1CG2A 3M6WA 2M88A 2KFYA 5EN1A 1HNVA 2AF6A 1V3SA 3UFCX 1FK9A 5BYSA 1LWFB 3CE8A 3TAQA 2HNYB 1ZZFA 1N56A 2A2DA 5AE2A 5KT6A 1WI8A 2B6AB 1V3ZA 2ZKTA 4WFBQ 3NBPB 3AJ1A 2DJWA 4NLGA 1RTHB 3KKFA 1SB6A 3MPYA 3PACA 1KTVA 4ID5A 5LSLA 2RILA 3F73A 2BV3A 3CGIA 3UQSA 3EXYA 1UVLA 3SSRA 3HHLB 1C0UB 3SDEA 5CZVA 1U1OA 4WIIA 3I9ZA 4X64F 3V6DB 4IO9Q 2KFZA 3QGHA 4O3NA 2HHTA 2CPFA 3U1MA 2DGTA 3TX8A 3ZZOA 2CQPA 2ZITA 3IG1A 1NB7A 3JSMB 1TK5A 1QVFR 4Q7AA 3I87A 2EWHA 4IG3A 5KFHA 1UFLA 1HR0F 3OXLA 5B0DA 2V5HG 2C22A 3PEHA 4X2BA 1S0OA 4OIXA 5GAGI 3CCLS 1J2VA 2OPRB 2B4VA 2CPIA 3RRGA 4LSNB 5LJ5Y 2F3JA 1LFPA 1UMJA 4QU7A 2VKRA 4R8UB 2VG7A 1FKPB 3M9OB 4O44A 1RTIA 4BWJA 4ZA1A 4ECSA 4ED0A 2ROGA 4NXNF 1BY9A 2IRYA 3GE9A 1TFWA 4YDDB 3KNGA 2J6TA 4MTPA 5E41A 1IQTA 1QUPA 2UXBF 4USHA 3SI8A 4WFYA 2LDIA 4RW7B 3PW2A 4OZJA 3DU5A 2XLJA 2UVWA 1RAJA 3FZBA 4NRTA 5EDWA 2DTJA 3AAWB 3MZIA 1DJ0A 2IA6A 1VQ8S 3MR2A 1SL1A 5B08A 1N34F 5FLXY 2FB0A 2DRBA 4NA3A 4OMFG 4OJGA 4EEYA 2JVRA 4EBDA 4DUZF 1OPZA 1S6OA 2DISA 3CCRS 3BR9A 1HNIB 5KFCA 5H1SV 3I55S 1S49A 2CPYA 1Z2ZA 2HLTA 3VQTA 3WX4A 2KXNB 4FF1A 3DLEA 1QY7A 3HDSA 3BSAA 4KKOA 2RRNA 1SJ4P 4C3KA 2WSFC 4LQ9A 3M8QA 3QO9B 1HARA 2XSFA 2FUG9 2KM8B 3W3SA 2IC3A 2YWHA 3PX0A 4Y2CA 4YB5A 2CPHA 2KT5A 4YB6A 2KT2A 1PC5A 4RW8A 3N6NA 4WKYA 4DR6F 3CJ4A 3MXHP 1CC8A 3KHLA 1Q1KA 3N6LA 1HD0A 2ASDA 2CQ4A 2ASJA 3TI0A 2D7SA 1KC8T 4CI0B 1FKAF 1KFSA 4IFVA 1ZM4A 1R8HA 2VBXA 3T1YF 4C97A 3DRSA 1RP5A 2ZC4A 3K0JA 1X4AA 4IH7A 2BJDA 4Z37A 1JLQB 2DIVA 1GXLA 2BDPA 3KLHA 3SYZA 1N5YA 2HHQA 3PDNA 1F5CA 1FXRA 4ECYA 2NUHA 1K1SA 2VV5A 1JMTA 2DR7A 2Q66A 2GV1A 3OJSA 4Y00A 3QGPA 2GMLA 2HWHA 2ZBIA 3QIPA 2D1CA 1AFJA 1N0UA 4MJKA 4EGLA 4NL5A 2QV6A 3NNAA 2NPIA 4X4VA 2GNKA 2B43A 2AGQA 1N52B 5DQGA 2IM0A 3G8QA 4MYTA 4ES3A 5DQHA 3KK2B 2KFNA 3LGNA 1U47A 2LU1A 4O4GA 5JVGQ 4QIGA 3IFEA 1YIJS 3OUYB 2ILZA 1G2EA 3J80Y 4DLGA 3H4DA 5LXYA 2D9OA 3E01A 5KT2A 2GQ2A 1JXLA 4ED5A 1FRIA 2N82B 4HLBA 3RAMA 3I31A 2XS2A 1WI6A 5A8RA 4TU8A 2LA6A 2JEFA 3KLGA 3MMAA 2FJVA 3MM9A 4AUKA 4TNOA 1D1UA 1C2PA 2P9EA 1B0VA 1VQKS 1L3KA 4RW6A 5E3CA 2ZVSA 4AXJA 2HMIB 3C2PA 1TFYA 4FF4A 1MU2B 2ZOMA 3GILA 3ZZ0A 5L9NA 2MSSA 4NLDA 1LWCB 4OLPA 3BF4A 5EX0A 5T14A 4DQSA 5IM0A 2X3GA 2IBOA 2RH3A 2NSBA 3Q2TC 3QJJA 2ZD1A 4CCHA 5KG4A 5KFDA 3FRYA 2LA4A 2E29A 4CT9A 2W4DA 1MW7A 1XTZA 1FTCA 5JXSA 3TYTA 2V4RA 2QFJA 2PT0A 4DHVA 3HZGA 4G1QB 1YG0A 5DDRC 1WEXA 1X5SA 1LWEB 1UA1A 1S1UB 2BBEA 2AYMA 4N77A 3IC1A 2JL9A 2W7AA 1H2VZ 2E9RX 2HHUA 3TUJC 1CEZA 4RNFA 4DUYF 5KTQA 4NCAA 1RTDB 2RQMA 4OZNA 3C46A 4QWEA 2UUWA 3NCPA 2JZ5A 5KFAA 5HBMA 4B3OB 4DV3F 1FHTA 4Q45A 3IWLA 4FXWA 2MQOA 4MK8A 1NEEA 2WONB 2MSTA 2FLNA 5B0BA 4JBCA 5D4NA 3SCIE 3HP6A 1M1KT 1I94F 2BABA 1MMLA 4ZP6A 2CQHA 2ZM6F 2COLA 1SH0A 4LVOP 5KFQA 4NCGB 2BE2B 1KOOA 2B7BB 4CTAA 4PXEA 4Q0BB 1YSJA 2V4JA 1UVMA 2OLWA 1X4FA 2JEIA 2FJBB 1HWLA 4Y2MA 3OSNA 4DR5F 5LL6d 4A8MP 1JXEA 2DNLA 1M5VC 3OV7A 3CXCR 4R5PA 1U1RA 1S72S 2AJ1A 3UDLA 2CFXA 2VC1A 1YQHA 1RT1B 2VPYB 3K5PA 2KU7A 4HEA9 1T05B 2ROPA 3ZC4A 2V0NA 3MM5B 2AU0A 1YJWS 4OI2A 1KEKA 1VRUA 2OD6A 3DDKA 2AGOA 3FMWA 2CG4A 3NMAA 3OL6A 4KGKA 2D41A 4I68A 4RUHA 1SJ3P 4DFKA 2KJVA 5IZHA 3LP0A 3ULHA 4MKBA 2FGOA 1ZTWA 3CJKA 4RUCA 3SXLA 2R8JA 2AGPA 4QR0A 3HHLC 3L3CA 3BSCA 1AUDA 5F41A 1S9GB 4DFPA 3DRYA 1FCAA 1BWEA 1TVRB 3GWCA 3W2VB 2KHCA 2N7YA 1S6QA 2ZNYA 1HBUA 2VQFF 4Q8FA 3KLEB 4ERDA 4Y2AA 4A8WA 3UCZP 1VI7A 2AX0A 3NNCA 4KC5A 2LKZA 2EFPA 1SV5B 1QM9A 2PA3A 3SSSA 1GXUA 1JWWA 3GIJA 3KLFA 2DD8S 1VQ9S 1JIHA 1U1LA 2ACYA 3L7OA 5JJBA 3SMZA 5LT5A 4FNIA 2LU2A 3FQLA 1U1NA 3Q8RB 4NMLA 5G4DA 1OSCA 2KYZA 5A8KB 1D8YA 2D74B 4RU9A 2DNPA 2R8IA 1XK8A 3O5TB 1DAXA 3GV5B 1S4FA 1KQKA 2VZ9A 5CZXA 2CZ4A 1BQMA 3KLVA 5CHCB 4F2SA 2NREA 2N7CA 1F5BA 5A2QY 1L5UA 3RTVA 4HTIA 3TUIC 2MHEA 3DGPA 5GAHU 1IKVA 5HP1B 4CO5A 4QU6A 4GKJF 4IKAA 4OX8A 1O51A 3PRDA 5MLCV 3BQ0A 2B0GA 2C3UA 2FC8A 2POKA 2YTCA 2GX8A 5J2MB 4X4PA 1T02A 1XMQF 2R7VA 2W4PA 3WZ0A 3POTB 2PMZD 4NA1A 1U4BA 1SKRA 1KQSR 5LMUF 3THTA 4N41A 4URQU 2RS2A 2PMHA 1KTQA 1JLBB 1MROA 2UU9F 2A18A 2FJXA 4R0EA 4AFFA 3FSYA 5AXLA 3HK2A 1FRLA 4ECVA 2VFUA 1FDDA 4WFNQ 4O3SA 1J5OA 4TXSA 4C4WA 2YNGA 3DI6A 3MEEA 4M5DA 2F4VF 4ED7A 1BGXT 1RT4B 3TVYA 3PKMA 3GR1A 1U8SA 3N5BA 5K9FA 3MMBA 5L8RC 2FHJA 3K57A 2ZH2A 4F3MA 4NYZA 2QA4S 1RT3B 1OSDA 2HGLA 1KLNA 4KTQA 3PO5A 3IAS9 4IQXA 1JLGA 1VBYA 3RYLA 3KK1A 2J0SD 5E3QA 2WB4A 4ZVFA 2WSEC 1QSYA 4IRCA 3MEGA 1WF2A 3IAM9 3SFUA 4DFJA 1MMDA 2A2CA 1BQNB 1R27B 3K2YA 2J7WA 3M6VA 4MH8A 4F50A 3I0RA 3DLGB 3TOQA 4X62F 3U1LA 5GVQA 5L1IA 3PEJA 4P6QA 5K14B 2OJ3A 3LF0A 4PUOB 3PIPQ 4PG6A 5F3TA 5F3ZA 2ZHBA 3PNIA 1IQZA 5G0RB 2B51A 5F9LA 1GQEA 3EPIA 2ASLA 3OXFA 1R31A 4NLSA 3P49B 1H2UX 1UAWA 1N5QA 3MM6A 4MAKA 4NLVA 5KT7A 4GKKF 4BBYA 5L1LA 4K59A 5IQQA 2XGQA 4IDKA 2OSRA 3G9CA 1XEZA 1SJ1A 4ZHRB 2Z2MA 4TYBA 2A1BA 2JLGA 1RQ0A 3HX9A 1RKJA 2X1AA 2GGPA 5SZTA 3DLKB 3NCQA 4ZCLA 2O5DA 1X4GA 2MQPA 4C8OA 2LCWA 3FEZA 3VALA 2R8GA 2YH1A 2G4BA 1YRTA 4Y2IA 3NCRA 3G96A 2AYGA 4F67A 2OH2A 1Y7PA 2RQCA 3TVKA 4C8YA 3OJUA 2HFZA 1LK5A 4KJIA 1G6BA 3ISZA 3PVXA 4P2SA 3AQOA 4N5SA 2RE1A 3FSIA 4NZ0A 3KJVB 2W4CA 3BS9A 3MECA 4Q2LA 3RW6A 5CQGA 3CCQS 2LMIA 4RNHA 2HHPA 4WE1A 4IO1A 1K73T 3A1YG 2J8AA 1S97A 3CTRA 4WZMA 1WEZA 4J9PA 5K8OA 1N33F 3H2LA 1ZAVA 3OL7A 2Q6BA 3M2VB 3AA8A 2HS4A 2KJWA 4O0IA 1L3UA 4ZPCA 4ELTA 3QLHB 2Y1IA 5KOXA 3PZPA 4WXWA 1T7PA 1FJCA 4DSJA 2BANA 2QLXA 3KWMA 1RA7A 3NAHA 1ZAXA 4ATNA 2W9CA 4J9QA 4LSLB 2HHWA 5LXRA 4URSA 4X4NA 2E9ZA 4OJ1A 1ZZNA 2B9XA 2N4DA 5KOWA 4UY85 4PQUB 1HQUA 1O0PA 1Z4UA 5B7WA 3RR8A 5IT9Y 2QMXA 2DNQA 2ZE2B 3MCSA 4KRWA 3KK3A 1S1VB 1EP4B 5DLFA 4NLYA 1ZBTA 2XCAA 1QE1A 2MZQA 4C8LA 1X5OA 3RRHA 5J2QB 4H4OB 4ZCKA 5T7LA 2IRXA 3V81A 2UP1A 3SSQA 5F8IA 3CVKA 3QZ7A 2FJDB 3OTEA 2JEGA 4DV6F 2RDIA 3D2WA 2CPXA 4KIAA 2X1BA 2X1GA 1QVGR 5C42A 1HBNA 3V4MA 4DSFA 1IBKF 3CD0A 3FNNA 4ED3A 1FA0A 2F1FA 4TKTA 4RZRA 1NK9A 4I2QB 3NGKA 3M2UB 1UVNA 2V4QA 1U1QA 1JK9B 1TL3B 1K0VA 2JLFA 1HI8A 2LEBA 1VC0A 3H59A 4LMZA 1FTRA 2FLOA 5I3UA 2HHVA 5D8HB 3DOLA 2GA7A 4GO5X 4PCQA 5BJRA 2IVYA 3KHGA 2ASYA 1K1QA 4D3HA 3EGZA 4K4TA 1FNXH 3MURP 3J7YU 1ULRA 4QPXA 3D5MA 4ILRA 2BM0A 4USJC 4WYLA 5DETA 3PY8A 1RT2A 3MAQA 1P1LA 2GHPA 2KVIA 3X1LB 3FSXA 1APSA 3RAXA 2Z2LA 4MFBA 2F8HA 3F44A 2IM2A 3FEYB 5KFFA 3DHWC 1R0AA 3KNAA 2E7XA 2RJZA 2RQ4A 4DJBA 2XMWA 3QZ8A 2B7CB 2GC8A 2JFDA 2OPSA 4RBTA 1HPZB 2QE5A 1YRXA 2V2KA 3BO4A 2MHNA 2D3OR 2HWTA 4FP9A 5D4PA 1K0TA 4PG4A 2KZMA 2ZKUA 1EETA 3R1LA 4IFYB 4O3RA 5M2RA 2B9WA 4H4MA 4RW9B 2DO0A 2ATLA 3K7RA 1FJ7A 2DGSA 1SIZA 3KLIA 3Q22A 4ECTA 3OW2R 3MHYA 3NMRA 4H4KC 3J81Y 5F8MA 1DLOB 2DR5A 2R7XA 2L41A 1LWFA 4HI2A 1S0NA 2HNYA 2A10A 5IT0A 1U09A 1IJEB 2YY3A 2XY6A 3GYN