2DNLA

Solution structure of rna binding domain in cytoplasmic polyadenylation element binding protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
GSSGSSGSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cytoplasmic polyadenylation element binding protein 3
publication title Solution structure of RNA binding domain in Cytoplasmic polyadenylation element binding protein 3
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnlA01
4QPTA 1JMTA 2CQ2A 2DNNA 5CYJA 3MUMP 5EN1A 1D9AA 3SDEB 1YIJS 2U1AA 5CA5A 2KHCA 2D9OA 1QVGR 2MZRA 2N7CA 2LYVA 2YWKA 5DETA 1K8AT 1VQNS 2LXIA 2VONA 4UY8T 2M7SA 1M5KC 3CC4S 2N82B 3CULA 2MGZB 1BY9A 3Q2SC 2DGVA 2RRBA 1YHQS 5LSLA 2FPHX 2YTCA 2MYFA 3RW7A 4WIIA 3CCVS 1X5SA 5HO4A 4TU9A 1JJ2R 4ZKAA 3CCJS 2LKZA 2CQ3A 1U6FA 2Q79A 2KYXA 3VAIA 2KRRA 3UCZP 3MOJB 1WI6A 4C7QA 1U1OA 2MQOA 1A7GE 3DLLQ 1X5PA 2LEBA 1Q86T 1YTYA 1WELA 2MKKA 4F02A 2F9JA 2HYIB 2CQCA 2CPXA 2MJUA 2MPUA 1DZ5A 2CQHA 1FHTA 1X4FA 4M5DB 1OIAA 5D77A 1Q7YT 2G0CA 2MKHA 3G9CA 1WG4A 5LSOA 3CMAS 3P6YC 3S01A 1M5OC 3CF5Q 1X4DA 2ERRA 4UQTA 2DH8A 3R27A 2KM8B 2MQQA 3J7ZT 3P49B 3NNHA 3Q2TC 4Y00A 1N8RT 3BO2A 4C4WA 2DNGA 1S79A 4OZ1A 4IOCQ 1RKJA 4WKRA 2AYEA 1SJRA 2F9DA 3NNAA 2DNYA 2RUGA 3UD3P 5FJ4A 2PE8A 4OZ0A 3VAHA 1G2EA 1VC0A 1YITS 3BO3A 3MUTP 1PGZA 1H2UX 1A9NB 1U6BA 1SJ4P 1UW4A 1Q81T 2FHOB 2HGMA 1WG1A 3U1MA 3G6ES 3B4DA 2F3JA 1WF2A 2RU3A 1WHWA 2CPHA 2RT3A 2BZ2A 1X4GA 1QVFR 1NU4A 1FJEB 5DDOC 3R1HA 1VQMS 3OW2R 2CPDA 2DGOA 2HZCA 5GAHU 2D3OR 1WWHA 3NS6A 1URNA 3D2WA 5CXTA 2LXUA 5H1SV 2DNMA 1SXLA 4LJMA 2QEXS 1X4HA 2J76E 3U1LA 3G96A 3CCQS 1W2BR 3DXBA 3LQVA 3HI9A 2XS2A 3LPYA 2MZQA 4IUFA 2J8AA 2HGNA 1VBZA 2XSFA 3CCLS 2DNLA 2RQCA 2CQ0A 2EK1A 3UD4P 4J5OA 4W92B 2E5JA 1Q82T 3TO8A 2RNEA 2JVOA 3NNCA 2MKJA 4QU7A 2L08A 2V94A 3BEGB 2MZJA 2YKAA 3UCGA 2MQLA 2DITA 2QFJA 5DDQC 1X4BA 1X4AA 3CMES 3THTA 3UWTA 2DGWA 5LJ5Y 3FEYB 1OPIA 3B4MA 4P6QA 1DRZA 2MKCA 5DDRC 3G8SA 1WEYA 2KVIA 1WEXA 2M4MA 2CQIA 4IOAQ 1RK8A 1U2FA 2M0GB 1FO1A 1HD1A 2CJKA 1YI2S 1KC8T 5GVQA 4Y0FA 4QQBA 2X1GA 4FXVA 2LECA 3BO4A 2MHNA 1P1TA 3SMZA 2DGXA 4WCEQ 1P27B 1YWXA 2QA4S 4WF9Q 2RS2A 3VAMA 2N3LA 5LXYA 1UAWA 4TLQA 5IM0B 3IRWP 3MD3A 2MQMA 1VC6A 3MUVP 1M1KT 4QU6A 1VQ4S 1VQ9S 2J0SD 1U1PA 1VQLS 2KI2A 4EGLA 1IQTA 2A3JA 1U1RA 3SDEA 2DIUA 5GAEU 2DISA 3ULHA 2CQGA 1M90T 1WF0A 2E5HA 2DGUA 2MXYA 3S6EA 1M5VC 3ZZYA 4U67Q 3ZZZA 1WI8A 1VQ5S 2HGLA 2L9WA 2MSTA 2XS7A 2FC8A 3CCRS 3R1LA 4YB1P 1WHVA 5GAGU 5GADU 2M88A 2MJNA 2M8DB 1HD0A 2DB1A 5ITHA 1VQOS 2OJ3A 3VF0B 2XS5A 2M70A 1K73T 2KG1A 1WTBA 2K8GA 1JJ4A 1X0FA 3VALA 3S7RA 1M5PC 4YOEA 1WEZA 3CCES 1QM9A 2M52A 2XNRA 2O3DA 1WG5A 2CPFA 2ZJQQ 3CC2S 3VAKA 1OWXA 4TU8A 2M9KA 1AUDA 1F9FA 3VAJA 1O0PA 2KRBA 2DHAA 1X4EA 4ERDA 2OIHA 5IFMA 2NZ4A 3US5A 1L3KA 2DGTA 2ZJPQ 3P5TL 2N3OA 5JVHQ 2MKIA 2MQNA 4TU7A 1VQ7S 2CQDA 2LA6A 2EVZA 2KXNB 2AYBA 2CPZA 2OTJS 1KOHA 2NLWA 2X1AA 2DNKA 3V4MA 3I56S 3MD1A 4WFBQ 2KN4A 3CCSS 2OTLS 2ZJRQ 3MDFA 2HVZA 1UFWA 1NJIT 1X5TA 2CPYA 2GHPA 5HL7Q 1NO8A 2FC9A 3L3CA 2ADBA 2LMIA 2DH7A 2DO4A 3G4SS 4PR6A 5D78A 1X4CA 3J7YU 2YH1A 2DIVA 1X5OA 2E5GA 2MMYA 1SJQA 2DNQA 1HL6A 2X1BA 1H2TZ 3G8TA 2I2YA 1WHYA 5BJRA 2UP1A 2LQ5A 3P3DA 3EGZA 1U1MA 1FJ7A 3JB9k 2RRAA 2LCWA 2K3KA 2AYMA 2RS8A 2KM8C 2M2BA 1U1KA 2J0QD 2DGQA 1U1QA 2ADCA 1S72S 3CUNA 3CTRA 1ZZNA 2LEAA 2MKSA 5LXRA 1KD1T 2MY8A 2MB0B 3PIPQ 3HHNB 1YJ9S 3CD6S 3I55S 2DHXA 1FXLA 5DM6Q 4V19X 2DHGA 2CQ1A 2AD9A 1HA1A 2U2FA 4A8XA 2MZ1A 2X1FA 1ZZFA 2MZSA 2YH0A 1ZH5A 4LIRA 2DNHA 2CQBA 2DNZA 3CPWR 2JWNA 3RW6A 3EGNA 3SXLA 2PEHA 1YJWS 2D9PA 2KXHA 2VODA 2E44A 2KT5A 2RVJA 3PIOQ 2G4BA 1DBDA 2VOOA 2DGSA 2OSQA 2FY1A 3FEXB 2XNQA 4F25A 4W90B 1N54B 3H2VE 4CQ1A 3N9UC 2XB2D 2CPJA 2OSRA 2JVRA 1WHXA 3MURP 2L41A 1YJNS 2DNPA 1D8ZA 4F26A 2LA4A 3MI7X 4IO9Q 5MLCV 1CVJA 1PO6A 4C0OC 2DHSA 5DDPC 1VQ6S 3S8SA 1VC5A 2DNOA 4PRFA 2MQPA 1R8PA 4CH1A 2MY7A 2B0GA 2KH9A 3CC7S 1JJHA 4BS2A 2MGZA 4PKDB 2CQ4A 4WFNQ 2I38A 1VBXA 1KQSR 4FXWA 1FJCA 1H6KX 3CXCR 3CCUS 1FNXH 2DNRA 1N52B 1N88A 2WBRA 2KXFA 2E5IA 1DHMA 4WFAQ 5DM7Q 3NMRA 2MZTA 2JX2A 3H2UB 1VQPS 4CIOA 2BOPA 2DH9A 3IWNC 2EK6A 3THPA 2AYGA 2KU7A 3TP2A 3TYTA 1U1LA 2MSSA 1U1NA 1SJFA 2DK2A 3NS5A 5IM0A 4CH0S 2KFYA 4Z2XA 3MXHP 1UP1A 2RQ4A 2JRSA 2GO9A 1H2VZ 4LMZA 4YUDA 1R8HA 3CCMS 1KOOA 3VAGA 1VQKS 1VBYA 3UE2A 2CQPA 2DO0A 5IQQA 5LJ3Y 2M8HA 3UCUP 2CPIA 2CPEA 3BS9A 1B7FA 3K0JA 5GMKa 4RU2A 3G71S 1VQ8S 4ED5A 1OO0B 1SJ3P 2G1DA 1K9MT 2SXLA 1FT8A 1WF1A 3EX7B 5JVGQ 3VAFA 2KG0A 2VOPA 1XN9A
chains in the Genus database with same CATH superfamily
2RHQB 2LQ9A 1QVGR 3BN7A 2DKOB 3DLEB 5KG3A 1PKUA 3PDNA 1KFDA 2LYVA 3OR1A 5G0RB 3VCDA 1MWQA 3Q24A 2I8EA 3GYNA 4L72B 4YQWA 4A47A 3HHDA 2VQFJ 4WIIA 4ZCIA 2XO7A 3I96A 2WAQD 3Q83A 2IA6A 3HHLA 3MOJB 3MFIA 1WI6A 4NOHA 2VD3A 1X5PA 2AJ4A 2H5JB 3MEDB 4CYUA 4F8RA 3QIDA 4PXBA 2J0WA 2IAJA 5ETMA 3HT0A 3K5LA 5GMDA 4B9VA 3MPVA 4WIQA 5F8MA 4ZLPA 3QT6A 4PXDA 1N8RT 3DGVA 4P2SA 4AYBD 1JLEA 2YQ0A 1S79A 3ADAC 2ZH5A 4DS4A 3CDBA 1E6VA 2ZOFA 3I0SA 3PYGA 2N7YA 2DY9A 4F0MA 1NPRA 1ZBTA 4X84A 3LA0A 3N79A 1HBMB 5CQGA 4ECSA 5DLGA 3KK2A 2DNMA 1S5ZA 4EBEA 3CO0P 3OVSA 2J76E 2QZ8A 2IA0A 3KNGA 4JI3J 3IG1A 2DR5A 1Y9OA 3EZUA 4WXOA 2JLFA 3ITHB 1JLGA 2ROPA 2W2NP 5C5JA 1X60A 3CJKB 1S97A 2RQMA 1Y7PA 2DR9A 2L08A 5C42A 1C4AA 4DCJB 3AA8A 3KLIA 2FJXA 4KGVB 4ECZA 1OY9A 4Z37A 4MFBB 2C3PA 5HJXA 2B7BB 1QTMA 4OX8A 4DUYJ 1IBLJ 3KG0A 2KT2A 3QFWA 1RAGB 5AXNA 3POTB 2WOMB 3C16B 1JLQB 4ELVA 3V6HA 5DGAA 3PYFA 2KI2A 3VR1A 2BQ3A 2XWYA 2H5EA 3CE8A 4ANEA 3ZZYA 3ZZZA 2DPJA 3L7UA 1BC6A 2R9LA 2FC8A 1N5TA 4AD6A 4UF4A 2EKNA 2LEPA 1ZAVA 3C6TB 3JTPA 2OPSA 3VF0B 3M2RB 3PW2A 3DCAA 3GCWP 4KY3A 2NR0A 2YKMA 1T9UA 3DRYA 4CI0B 2W2PP 3MPWA 2DHAA 5E0OA 3X3UA 2DGTA 1VQ7S 4ED8A 2OTJS 1YDLA 1KOHA 3SCKE 5KT6A 4PEOA 4M8LA 1YGYA 3F41A 1NO8A 4C3MA 2ZH4A 5A76A 3LGHA 4M1KA 2F4VF 2PC6A 3FDSA 3WC2A 4B9TA 3GONA 2FQQB 1U1MA 1FJ7A 3BKTA 1RHRB 4CO1A 4N76A 1N33J 5B0CA 3CUNA 1IM4A 2LQBA 4M5NA 1MROB 1KS2A 2Z2YB 1WC5A 3M30A 2D9PA 3BREA 1LXJA 5A8WA 3SI8A 5J2MA 1J5EJ 3QSIA 5CCMA 2HRTA 2ZH7A 4ECRA 3PZPA 1FKOA 1Q5VA 4DUTA 1O6XA 4BBYA 3SZ2A 4DFMA 2JOQA 1VQ6S 2VHGA 3S8SA 3QJLA 4NLYA 3I4HX 1S6QB 2XI3A 2I38A 1E6YA 3LO3A 3BM7A 4P73A 3D54A 5E33A 1Y00A 2E9RX 4L6V3 1S6PA 4QIGA 1SL0A 4NASA 3IGNA 3NMRA 4NCGA 2DH9A 4CLPA 4HACB 4UOCA 3MXHP 3JTOA 1H2VZ 3C3LA 1SKWA 2CQPA 4ZIVA 2GGPA 2V4RA 1NHKL 5GMKa 2BE7D 2YNHA 3SQGA 2HHXA 1RA7A 1C0TB 1TMMA 4QJVA 3VGVA 3ETMA 2C2ZB 4F4ZA 3M8YA 4IG0B 3SDEB 1T9VA 3IXQA 4U6PA 3QQCD 3KLVA 4Q7AA 2DEIA 1TZ0A 3Q0AA 2VL1A 5DETA 1SQEA 3TARA 3PFEA 4UY8T 2YNGB 1VDHA 1EIYB 4K59A 4N8NA 1O5JA 3HXMA 3Q2SC 1D8YA 3UNGC 2YTCA 2VBXA 2UUBF 3OL7A 4KQZA 3CCVS 4CO0A 5HO4A 2FVCA 1RHUB 1SIWB 2BUNA 1JJ2R 4GMKA 5HLFA 2CQ3A 1UJ6A 3T9ZA 4H4MB 2QLXA 4MIAA 1WC4A 2XG8A 3OXFA 3TJ8A 5C2GA 2R2RA 1DLOA 1NSKL 2H9ZA 3RGIA 2CPXA 2XY6A 2CQHA 1F5CA 4UZBA 1FFGB 2JDJA 3JSBA 1TV6A 3G9CA 4KKOB 4LF1A 1EJ7L 4I56A 1EHWA 1AA1B 2MTLA 3T9NA 2H3EB 4TQSA 2BM0A 1RKJA 4KGZB 3W5ZA 3GILA 1HWKA 2RUGA 3KG1A 2ZHBA 2Z4PA 3DHXA 5MAOA 1SJ4P 2OGUA 4U8YA 4LF6F 2FHOB 3J80U 1TKTB 3G6ES 4WK3A 4B9MA 4XO0A 3W66A 3C46A 5A8KA 1NH7A 1J5OB 2CDQA 4ED1A 3DLGB 2VPXB 3D2WA 1I1GA 2XMKA 1N34F 4DR6F 1F9HA 3G96A 4RKUC 1SQGA 1SUQA 3J81U 2G13A 3ENQA 3A8EA 3UD5A 1CJVB 4QU7A 5K8NA 3BEGB 1RWMB 5IT4A 4KFBA 1FJGF 5T7LA 2YNFA 4V1Ak 3OJUA 4M5MA 2RSQA 1TTHB 5GAHI 2QFJA 4OHYA 3BPSP 2FZCB 4HI2A 3VWSA 1GH8A 2IIHA 5LL6d 1DQ9A 1RACB 1SI9A 3MEGB 1V3SA 4DL7A 4ZP7A 1R8BA 4LSNA 5HMYA 4DS5A 2RS2A 2LU1A 1D1UA 2IRXA 3VAMA 3K5NA 3GYXB 3ZTOA 4C98A 4QR0A 5KFUA 1VQ9S 1RE1B 5F8GA 2AW0A 1UWAA 3IMQJ 2IPOB 2XHWA 2Y1LB 2XYHB 3Q8QB 3QSYB 1Y3JA 3NWRA 2MXYA 4ZN3A 1K0TA 1KP6A 5HROA 3M2UA 3OXGA 4X2BA 4ZCLA 1BXNA 1ZETA 5GAGU 2MJNA 2M8DB 4C2MA 4HYKA 1JJ4A 1QM9A 1QE1B 4NL5A 2FJAB 2ZUAA 3TUPA 1OWXA 4ED7A 3AB2B 3TJ9A 3FCVA 2HFSA 2VDHA 1RT5A 3QT5A 3M05A 2X1AA 2DNKA 3GFYA 1TQLA 2J5AA 2KN4A 5D8HB 4J37A 1KNZA 4J9QA 2ZJRQ 2F4VJ 5THWA 2EFPA 2NXEA 1IUJA 1I3OB 1JLBA 5JXSA 2DO4A 1RAFB 1XMBA 4X4SA 3FBCA 1R0BG 5E3AA 4LFCF 1LKZA 1WHYA 5AE2A 3OTEA 4I7FB 4FKYA 2VU5A 4C48A 3HHNB 5IOLA 3CJTA 4WYWA 3MMJA 1HBUA 2CZ4A 2JLGA 1ZTWA 4KO0A 2OH2A 1QLNA 3P4UB 2W1BA 3GE9A 1VISA 4IFYA 3DDKA 4DSIA 4O3RA 2KT5A 1EB0A 3T5HA 1H73A 2B9WA 2OPRA 2HS3A 2IRYA 1S0NA 1HQUB 3R6LB 4ED0A 3AT1B 4J9NA 2XM3A 1S9GB 2YQ1A 3RBXA 1UETA 1VC5A 4NXNJ 1DARA 2N4DA 2OKQA 2V8HA 1B99A 2V9WA 2CQ4A 3CDAA 2EG1A 2DNRA 3L4BC 2V2ZA 2W01A 2JX2A 1TFYA 2R4FA 2R8GA 4DOZA 3HO1A 1UFLA 4L73A 4L75A 4PWDA 4EI2A 4CH0S 2JRSA 1YJRA 4QIEA 3OUYB 2IBOA 4QW9A 2X3DA 3MR6A 1WC0A 1RQ0A 3B8HA 3G71S 4DV0F 2Y0BB 4P75A 5J2QB 1HHTP 5ETTA 4TYBA 2SXLA 3CDWA 4MMOA 2NSBA 3MR7A 2HHSA 2XGQA 1NSQA 1AFIA 3FC9A 2HNZB 2W9CB 2PN6A 2UUBJ 4C3LA 1FXDA 3TVZA 4G6VB 4AL5A 4OI6A 4JV1A 2Z56B 4LRCA 4ICLB 1FK9A 3PRBA 3I5CA 4YB6A 2AIRB 2F8EX 3RTVA 2LEBA 1IBKF 4FBTA 2ASLA 2F9JA 4M5JA 4HEA9 2AMCB 1EKSA 3M7VA 1BWEA 1TK8A 4AL6A 1FHTA 4C11B 1GTEA 5M2UA 2ATLA 5I4MA 3R7BB 3KJVB 4F3QA 3NCPA 4Y28C 1U0HA 4UQTA 4WPAA 4PPZA 1ROFA 1R43A 3AY0A 2WW8A 4LF6J 2HW3A 4OJGA 3MAHA 1B4SA 1PGZA 4KT0C 2EEYA 1A9NB 1T94A 3NGKA 3CMQA 1S10A 3FQLA 3MR5A 3I82A 1PC5A 4DQPA 1NUEA 3M6VA 2W2MP 5L1JA 1WTFA 2PGCA 1Q8KA 3TNVA 4OYAA 2HZCA 4PXCA 3R2DJ 1Z1ZA 2QLJB 3L9ZA 4PWWA 5DZ6A 1LV5A 3CCQS 1RT6A 4IRDA 2H5IB 4ENOA 1FJGJ 1S0OA 2DNLA 4BC9A 1W7WA 4W92B 1F6TA 1VLOA 4F4XA 3TVKA 2MKJA 1QAIA 3L7PA 1VCTA 5KFRA 1LW2B 1UVMA 1X4AA 3TUZC 2W2OP 1S6OA 1OPIA 4KYZA 4HVZA 3UN2A 2QA1A 4P72A 1RK8A 2ASYA 3FUYA 2X1GA 3RYLA 2KTQA 3AOAA 3SMZA 3DGPB 3MEEA 3DU5A 5A8RA 4H4KA 1C1BB 1S1TA 3ZTQA 1X31C 2J0SD 4L3KA 3BDPA 3DN9A 5B0FA 3CD5A 1XR6A 5CABA 2R7RA 1XERA 2VFRA 3MM5B 4OYMA 5D3GB 3R1LA 2JH3A 2E7VA 5D15A 3MTJA 4OZ5A 2CVIA 1HD0A 1IVZA 3MAAB 1FWKA 1REVB 3FSIA 2OI2A 2M70A 1OYDA 2E7XA 2KG1A 4NLSA 4BC7A 5J2NA 2WB4A 3EE3A 4C8ZA 1WEZA 1ZS6A 1YX2A 2IVYA 2J9EA 2K1RB 1NSPA 1RLDA 1X4EA 3KK3A 4H54A 2MQNA 4Z7CA 1YJTA 2EVZA 2AYBA 2C2OB 2BOAA 4A8QA 3RB0A 1F2GA 5F41A 1ZM4A 3PXGa 4JI7F 4R8UB 3QNWB 1IKWA 4DZ6A 2W8LA 3EZ5A 1DTTB 1FDNA 3H98A 4MKVA 1CBKA 2C3YA 4I64A 2BQUA 1QUPA 2CZ9A 4RBUA 1U1KA 2DRDA 3ZZTA 3EICA 2MKSA 1JLAB 2MY8A 3KLEB 5CZXA 3KHGA 1G1XA 1GFWB 3DRRA 4Q0BA 4AL7A 3DOLA 1RYRA 5I3UB 3D68A 4NEZA 2KKHA 3CW2C 1SBRA 3PIOQ 1QAXA 2GJ2A 1YRXA 2ZUGA 1PSDA 2W7PA 1WHXA 3NBPB 1NSAA 5ETLA 3DRSA 2JEFA 2HLTA 5B09A 3J7Z5 3KKFA 1HQEA 4DSEA 5EWEA 3A13A 1BUXA 2CG4A 3MCMA 1RWOB 1TL4A 3W61A 2F1FA 4JI4F 3PYEA 3Q8VA 3H2UB 5ADZA 4NI2B 3SQOP 2E9ZA 1ZPWX 1URRA 4OJHA 4G65A 3GR0A 1FXRA 3HVAA 3PCOB 4DL0C 1XNQF 4M5DA 1YSJA 1GX5A 1TL7A 4DJBA 2OEMA 4DSKA 3BS9A 4RWXA 5A6WA 1VQ8S 4PCQA 3HT3A 2F4FA 4RBTA 4E98A 3ENAA 3R7NB 1D9FA 3MUMP 4DPUA 4EBCA 1LEOA 1MWZA 2MZRA 4RBVA 4WZQA 3ET6A 3IAS9 4ZVEA 3KLFA 4WJBA 2LXIA 2M7SA 1KSPA 4CO4A 4EFAC 4ZVSB 3T6BA 4RW8A 1RAEB 3NEKA 4RNFA 1NHVA 4ZITA 3CCJS 3WX4A 3UCZP 2VQEF 3IWLA 1TVRA 4RW7B 2WSCC 4ES1A 4FDFA 4Y34A 3W2WA 1UZHA 3VGUA 2LDYA 5KG2A 1HIYA 1PAEX 3DU6A 1RT4B 4USIA 3FSXA 3CVKA 4USHA 4RUHA 4ZJOA 1VHIA 3KK1A 3G87A 1S0VA 3M8PB 5A2QY 4CO5A 3MCSA 4DR1F 3HVTA 3MR2A 3R27A 1SH3A 3JAMY 3NGRA 3SV3A 1UPPA 3QBCA 2HQIA 3OT9A 4WKRA 4GO7X 1WKJA 3OL9A 2O1PA 3UDLA 2PE8A 1B7YB 1YITS 5K9FA 4HR2A 2FUG9 1CJKA 1NJXA 4ZHRB 2W4CA 4RW4A 1QAYA 4EYIB 3C14A 4FNIA 3QZ7A 4USVA 8AT1B 3U7JA 3MTKA 1O8BA 3NS6A 3L7OA 5CXTA 2V9KA 4NLGA 3BYPA 5M2PA 3TEGA 1X4HA 4A8SA 1TKXB 2UVWA 2XMMA 3TX0A 2JC1A 2NZCA 4ECTA 1WC6A 5HVGA 1Q82T 4KV8A 3DC2A 4YY3F 2VA3A 4HL9A 3UCGA 1IKYA 1GEHA 3IRXB 2MQLA 4I68A 1FX2A 4JI0F 3B54A 4ZVFA 3HVRA 3GIKA 1T7PA 3C15B 4IFVA 4DG1B 2FJWA 2GFFA 2QMXA 2GJIA 1FO1A 3NMAA 2ZZNA 1RU1A 1AT1B 2BE2B 2K7KA 2DD8S 2A10A 1OY6A 2BX6A 1T0TV 3ILOA 2HWIA 2ZDPA 3PR4A 2HQCA 3F56A 3TEHB 1HPZA 1Z2ZA 1U1RA 3M32B 3RBEA 5HMXA 2XO6A 2E7WA 1WF0A 2QLBB 3PW7A 1IKXB 3TW0A 2K2PA 1UVKA 1T8EA 4P2XA 4FN5A 1VQOS 3WDOA 4FF4A 4YOEA 1TK0A 3BBBA 3M6XA 3AD7C 1NRKA 1L3KA 2ZJPQ 4JI7J 2XTJP 2RDJA 2HNYB 3K8WA 4OI2A 3H5YA 5GAGI 4B3OB 2CG8A 4C8OA 3SBMA 4DR5F 4CP5A 1VLYA 3I0RB 1DJ0A 2LMIA 1BQNB 4LF9F 4O4GB 2I2YA 3TR5A 1NMEB 3H59A 2I5JA 2ROEA 3JB9k 3PTWA 1S72S 3ICLA 4ES3A 5LXRA 3W9IA 4YHHF 2JEGA 3PHTA 1X7VA 3AQPA 3OHAA 1ZH5A 4BCAA 4LIRA 1C4CA 4HT7A 1NXIA 2X3GA 3RW6A 3EGNA 4ID5A 2E1MC 1LWEA 1UZDA 3V4IB 3MMAB 3V81B 7FD1A 3R9LA 2XC9A 4PYAA 1CVJA 2DHSA 3HHKA 4DCOB 2MQPA 4Q8EA 2VF3A 4JI4J 3KLHB 2BEFA 4X4OA 4WFZA 4CZCA 1R8CA 1N52B 3W2VA 3GCXP 1XNQJ 2E9TA 2WZ1A 2DY1A 4ZP9A 2AT1B 2QL9B 2DK2A 3G82B 3IWXA 1S1VB 1AZSA 3NG8A 3HLUA 4CTAB 2CPIA 1QDUB 2DYAA 3M4XA 5J1EB 4DDFA 2R42A 1JKHB 4R5PB 2ZE2B 3VAFA 2KG0A 1MLAA 2DNNA 1EZZB 3FFIB 5BYRA 1TL3B 5KG4A 3VQSA 3R5DA 1TELA 1M5KC 4O23A 1RT2B 1YHQS 2VQEJ 3TUJC 4DV4J 3RW7A 4QIWD 3OHBA 1CULB 2C42A 1NDLA 4ZKAA 2Q79A 3SFGA 2HFVA 3D5MA 1B0TA 1SV5A 3VGTA 2MKKA 3U02A 3AJ2A 4ZPDA 2HYIB 4OYWA 2J6SA 3GIIA 2V67A 2HMIB 2AJ2A 4BWMA 4PQAA 4DR1J 3EMTA 3M1VB 3CMAS 4DL3A 3Q8UA 2H4WB 4F3MA 3Q8YA 5L9XA 5CHCB 4JI2F 4E2FB 5A0YB 5EWFA 2YKQA 2HKEA 4KGXB 4M95A 3I9V9 1VRUA 2C2DA 1SC4B 2ZBCA 2OEKA 1W26A 1WHWA 4ECUA 2PO4A 1HNIA 4Y2IA 2FJBB 1ZM2A 3MFHA 3ZZPA 2CJBA 2J0XA 1HNVA 2HRUA 3CT9A 2EK1A 5IZHA 4JI0J 3TO8A 3M8QB 3HHEA 3CJ2A 2BM1A 2YQ3A 2Y0SD 2H4YB 3HFKA 3EGWB 1UA1A 3MF5A 1OJ4A 5CD4H 1RT3B 5IV4A 2JNJA 3EVWA 5DDQC 3IS9B 2VG5A 1QD1A 2MKCA 3ILLA 3IBCB 4ALZA 5ETNA 4QQBA 3TA2A 4N56A 4WCEQ 3MD3A 1I94F 5H9FJ 1T9WA 2HFUA 1VQ4S 3FK4A 4EZ9A 4LRAA 1R0AB 1NK4A 4NLPA 4LSLB 1HBNB 1S0MA 3ULHA 4DPTA 1VMBA 2V68A 3LOUA 2M88A 2DB1A 3IM8A 5FD1A 4P2FA 3PY8A 4OHVA 4ECVA 1K0VA 1SJ1A 1S9FA 2WK4A 3MMCA 2COLA 3QRQA 4B17A 4F4KA 2Z8QA 3CC2S 1RWNB 2M9KA 5L8RC 1O0PA 4NPOA 1GXLA 1S57A 2XGPA 5JVHQ 2D74B 4DR5J 1NJWA 2CPZA 3MD1A 4QIFA 3HHLB 2RIJA 2IBKA 4LF9J 2B5JB 2B4VA 5IC4B 3I9ZA 3GJTB 2I0XA 4DL6A 1V3RA 3JQKA 3K89A 2ZNZA 2RKIB 3LH2S 2GQ2A 2ZHOA 3QYYA 4JV2A 2R7XA 2B4OA 2YKNB 2DGQA 1FE0A 2ZH1A 2R7VA 1KQKA 1JLCA 1JLEB 1WDDA 3BBCA 5ETKA 3WZ0A 2CQ1A 2AD9A 2UV8G 3I87A 1S4EA 5L46A 4JI6F 2APOA 5ETRA 2AGOA 5JUMA 3QZ8A 3RRHA 3DOMA 4XDCA 4DV1F 1F0XA 4LVNP 4S0MA 4QYZJ 4J9VA 2XY7A 1R27B 2WONB 3RR7A 1D8ZA 3MI7X 3H25A 3DLEA 3PRDA 4Q43A 3N4WA 4WE1B 5G0RA 4PRFA 4QPXA 3CDEA 2HVEA 1JLGB 3UR0A 1KQSR 1M1GA 1FKPB 1GXTA 4DR4F 2Z58B 2XLIA 2NPIA 4OLOA 1JQGA 2LDIA 2WSFC 3MEDA 4FZVA 4MIBA 2BW7A 2A1BA 4K4SA 3ENWA 2GO9A 1P8GA 1N36F 1PG5B 1OYEA 3UE2A 3CEDA 2VPWB 2M8HA 2HPUA 3K5PA 1Q7LB 1BLUA 3Q89A 4OJ3A 2XZTB 2HHVA 3DOKB 2E5LF 5JMNA 5B0BA 4DR3F 1P1LA 2WTFA 1G4CA 4C8NA 2AF6A 3ZTRA 3FKBA 2IRUA 3PG9A 2HQ3A 1V6HA 5DGBA 2YWKA 4F04B 1VQYA 5E5NA 2CRLA 4LRFA 2N82B 3FNNA 3DFEA 1HBMA 3VHQA 1X5SA 4IQMA 1HI0P 4MJKA 5D0RA 3ITHA 2HEKA 5F8NA 4O0NA 1HFEL 1PIEA 3CJKA 2O66A 2PA8D 3HKZD 3BGLA 2BDPA 5D77A 3LW5C 1WG4A 2KZMA 3BSNA 3CF5Q 4HHUA 4JI2J 2XWXA 2DH8A 4DV5J 3P49B 4MFBA 3R5CA 4Y00A 4B3MF 4QOTA 4DHVA 5HMWA 4IOCQ 4ZVRB 1SJRA 3N6NA 3AD9C 2DR8A 5FJ4A 2JJ4D 1WSRA 4OZ0A 3VAHA 1G2EA 2DRAA 3UPFA 3BB5A 1NPKA 3POTA 4I6YA 5HQMA 1H2UX 2WOMA 3C16A 1RAJA 1JLQA 3U1MA 5KFKA 1S77D 2F65A 1LXNA 1F5AA 4QWCA 1T11A 1KKHA 5DDOC 4RJVA 1GMWA 1H3DA 1T3OA 1TUWA 3OW2R 2D3OR 2ZHAA 2W9BB 2LVWA 4USKA 1T05B 5KFOA 5E3QA 2ALYB 3BSAA 1FKOB 1GT8A 4RR5A 3M2RA 3NNCA 2Q1LA 3OVBA 3ETOA 4G1QA 2MZJA 1RWPB 2CDRB 3I6PA 2UVUA 3CMES 4BLGA 1VFJA 1NKCA 1E6YB 4WU2A 2CWKA 3LF0A 2HK2A 1S6PB 3DDNA 4EWTA 3QGGA 4NCGB 4O44B 2ZKUA 2AU0A 4C8MA 2DGXA 2LFVA 3N5BA 3RB4A 3IRWP 1FEHA 2EBEA 2BA9A 3QWUA 3PX0A 1WOOA 2LP4A 2ZEJA 3JSMB 2IJRA 4ECWA 1HNXF 4GVBB 1S1UB 3GU0A 3SQGB 2E5HA 2R7OA 3S6EA 4U96A 2IVMA 4USJC 2QC3A 3CCRS 1KQGB 2UV8A 2CNNB 3UDEA 3SSRA 4OI3A 3ZTPA 1NJYA 1XEZA 4RNNA 1F5BA 1NZ8A 5HJYA 2Y1JA 2VBYA 1AYEA 3S7RA 2EI5A 3CCES 2O3DA 1UA0A 2Z2LA 1LFPA 1UEUA 2YNIB 3N6MA 3M8SA 3ZO7A 2Y9HA 2YWEA 5HANA 4I69A 4ZP6A 3LAMA 2JFKA 1U49A 3O44A 3RG6A 4C0BA 3CJRA 2CNOB 1UFWA 2FLLA 1S6QA 4UTGA 4DQIA 3N01A 2CUYA 5KFQA 2ADBA 4KPCA 1FRIA 1KDNA 3NL0A 5CAAA 1T03A 3TWZA 3PEHA 3KDOA 3MZIA 2LQ5A 3P3DA 4KE5A 1FWPA 3EUNA 5EGYA 1U1QA 4DFJA 4HACA 4JI6J 3BR9A 4ANCA 3PIPQ 1GXUA 3I55S 4DV1J 2LQJA 3TZXA 2XSJB 2CQBA 3CPWR 4OHWA 2PI4A 4YB5A 4NXMF 4WKYA 2VODA 1C0TA 4LR9A 3LPEA 4LFBF 2XB2D 4IG0A 3GTYX 4X4PA 3R97A 2WW4A 3THVA 1PO6A 5KFBA 1JLFB 4DQQA 2YNGA 3A8JA 4CH1A 4DR4J 5C7PA 4Y2AA 4C0HA 1SUQB 1VBXA 2C2MB 5DG8A 1FJCA 5AXLA 1KHWA 2QJ3A 3EZOA 4I1TA 5DZ7A 4H4MA 4L76A 5A2QU 3MECA 1HWLA 2PEBA 1HYSB 2OMLA 4J9MA 3TP2A 4NRUA 7AT1B 1RCOB 3R5BA 1H98A 4CRJA 1L3UA 1VBYA 6FD1A 4OQJA 5LJ3Y 4DR3J 4AFFA 1UEKA 1B7FA 1N5YB 2KVQE 4IG3B 1RTHA 4PG8A 1SL2A 3QIPA 2R3VA 2G1DA 3JTNA 3KHLA 3PYDA 3LP1B 3HPOA 3MPDA 5KFSA 1YBTA 3OLBA 3NGSA 3JQJA 2DXDA 3QT7A 1Q16B 4ZN1A 4I6AA 1UFKA 2UUAF 4RW6B 1TKTA 1XMQF 1A0OB 1J5OA 4EBDA 4DCPB 3DLGA 2KL8A 2FLOA 3LWLA 3MHYA 2K7JA 4FVCA 2C2NA 1CS4B 4IH5A 4A8YA 4CNZA 3BH7B 1YKWA 3HM9A 1CJVA 4LREA 4ZPTR 4NYZA 1Q7YT 2HWTA 4B3MJ 3O5TB 4DLGA 3E2EA 2V69A 3BO2A 4C4WA 2DNGA 4LR7A 2OD4A 2W8KA 2QIFA 1BE4A 2VPZB 3NKYA 1V9OA 3MUTP 2YXLA 3W8PA 2D7SA 1U6BA 5HP1A 2AX0A 5HMZA 4MK7A 1HBUB 3FSYA 4USUA 4TVAB 4LF8J 5K8MA 1URNA 3AFGA 2F8HA 2ASDA 2IMOA 4ZVGA 2QEXS 1GMVA 3LQVA 4F0HA 4ETXA 1VBZA 2XSFA 4NMLA 2RQCA 2CQ0A 1M5HA 2CIMA 4F36A 4KTQA 1IBCB 3X1LB 2RHSB 3FRZA 4A8OA 1QE1A 2N4CA 2C22A 2OUGA 2IM3A 3O6QA 4OHZA 3FEYB 2WB1D 1C0UB 3B4MA 4ECYA 2QLFB 2XLKA 1HD1A 1LNQA 4ZA1A 1YBUA 2PDAA 3I5BA 4B9UA 2EFVA 3ZFVA 1P27B 1KEKA 2N3LA 1C1CB 2WHOA 1RB0A 3K5MA 2XMVA 3W3SA 4QU6A 1RISA 4PAAA 2J9DA 1XNRF 3RAQA 1BWVA 2C3MA 1HKAA 1VK3A 4QWBA 5D4LA 2VH7A 4DPXA 1RSCA 4P10A 4JI1F 4I7FA 2ZD1B 2IYGA 3IR7B 3BH6B 2OPPA 5C24A 5HVHA 5IV3A 4DV6J 4ECXA 2JHEA 4GO5X 4LQ3A 5ETOA 2BABA 4PXEA 3B6BA 3H5SA 1CC7A 4OV6A 3OV7A 3EM1A 4NA1A 1WG5A 1TFWA 1HQUA 5IFMA 3HX9A 2NZ4A 1KRPA 2E1PA 1RTZA 4TU7A 5KFTA 1S9GA 1MWYA 4WFBQ 3AJ1A 2OTLS 1JIHA 4U9RA 3MDFA 2DHHA 1KVJA 1RAHB 3L3CA 4ZJQA 5C25A 4YDXA 1KHVA 3NGUA 2AJFE 1SJQA 4KGKA 1TKDA 4PG6A 5BJRA 4JOUA 4UY85 4TLRA 1XQIA 1U0HB 4M5IA 1VYAA 5KFNA 1RTDB 3W63A 1NKBA 1EQMA 4Y65A 1RHMB 4D3HA 4NXMJ 1FXLA 5DM6Q 3OUYA 2YH0A 3K7RA 3D0GE 2IMWP 5IWAF 1R89A 4WFYA 4OL8A 1M1HA 2GW8A 4XIUA 2CFXA 1YG0A 3HJFA 5J2QA 2E44A 2G4BA 2HVDA 4J9PA 3G6VA 3OQ2A 2FY1A 2XNQA 3DLJA 4KAIA 2XMTA 3PKYA 1M5SA 3GFZA 2Y8WA 2XMJA 2QMUB 2AKWB 4V19J 3MURP 2GAHC 2HNZA 2W9CA 5KG0A 3VVUA 1GK8A 2JEIA 3H0PA 1T3NA 4RL1A 2HHQA 1EARA 1N32F 2B0GA 1JJHA 2O5DA 1KVIA 3HK2A 1H6KX 4Q45A 4ICLA 3R7SB 1JXVA 2WBRA 2OEJA 1R0CB 1H7WA 2NYIA 4X66F 5DM7Q 4U7UK 4ILMA 3SCJE 2NS1B 2OAUA 1XMOF 4ZLJA 1HW8A 1KTQA 3HMJG 2RQ4A 4C11A 2Z2MA 4LMZA 2P2CB 1UKUA 1TU0B 1RBLA 3KJVA 3KJQB 3TAMB 2CPEA 1AXQA 2FTRA 4RU2A 4K8RA 2L48A 3H8YA 1FRLA 3UDVA 1SJ3P 4E8UA 4J9OA 4B02A 2UUAJ 1YIJS 1XMQJ 4NLDA 1FTCA 2QMWA 2HHTA 5T14A 1U7LA 2DCLA 1I5OB 4HTJA 1LQ9A 2DGVA 4LR8A 2B9YA 2FPHX 3KLGA 1VI7A 1KN6A 2H54B 4TU9A 3Q86A 3WIUA 3DI6B 1CPZA 1TK5A 2GIQA 2KYXA 9ATCB 2MQOA 3DLLQ 4R25A 1GNKA 1QSYA 2BJEA 2MJUA 4OI1A 1NH8A 5D0HA 4OYIA 1LW2A 4K0KF 4NLXA 2B4PA 1SQFA 2KM8B 1U6ZA 1X9SA 3K58A 3HSDA 1LWCA 2F9DA 1QTNB 3GQCA 3DGPA 3VVTA 1C1BA 2BKPA 3GPAA 4ZMMA 4P71A 4K2JA 4X62F 1UW4A 1OY8A 4ANDA 3IO1A 2AJ1A 1H72C 2BZ2A 3PACA 1QVFR 5K14B 1FJEB 4J9KA 1FI4A 1CJTA 1VQMS 4UZCA 1N56A 3KUGA 1SXLA 2GMLA 4UOHA 5LM7E 2YX4A 5D3GA 2XS2A 1B3TA 4K4TA 4N47A 3UW1A 1K47A 1RABB 1JNRB 1RHQB 5KT2A 1S7HA 1REVA 4NRTA 4X64J 4C8KA 3DRSB 1S48A 5J2PA 3NOCA 1NHUA 3AD8C 4U95A 9RUBA 1YJ7A 2E66A 2K1RA 1WOSA 3PX6A 4M63A 4LFAF 1VJQA 2VJUA 2NXNA 2G9OA 3E3XA 2C2EA 4X4NA 1U2FA 2AHOB 1YI2S 3KOAA 2FIUA 4R8UA 4MAKA 3W7BA 2G2ZA 1U24A 4JI1J 1DTTA 4I2QB 5F0WA 5LMNF 1TL7B 2XHCA 2VIHA 5M2RA 4LF7F 5SZTA 1GMUA 1Y5IB 2BJ9A 1DURA 4NYPA 2B3TB 1Q8BA 2L9WA 4HH0A 2CWXA 1RU2A 1T95A 1NEEA 3D66A 1WHVA 5GADU 2KT3A 5I3UA 1VBKA 1S1XB 4LRBA 4DEZA 1JNZB 1M5PC 1IQZA 2XNRA 4OZ3A 2B9XA 4B9LA 2POKA 3OR2A 1F9FA 1O51A 3NBPA 5CZVA 3KHRA 1TAUA 3C2PA 5KFMA 4X65F 2GJFA 2BW2A 3A3NB 3KHHA 1XWLA 1ACMB 1RP5A 3NAHA 4WTOB 4OYBA 4B3SF 1I6JA 3EXCX 4ZLNA 1Y5NB 3PW5A 4ZS6A 2FC9A 1Q79A 4EUVA 2DIVA 3GFHA 2UP1A 4I67A 3FCWA 3JYTB 2BBEA 2QV6A 1XJWB 1FD8A 2K3KA 1FESA 4TY9A 4WBFA 3H40A 2LEAA 4JP8A 3HSJA 2YWGA 4K7QA 4FYVB 1EETB 1YJ9S 1HA1A 3NY0A 3MM8B 2MHEA 5AT1B 2Y8YA 2L3MA 2HAIA 2FYXA 1CC8A 3BQ2A 2DNZA 2ILYA 3P8BB 1EP4B 2KXHA 1FA0A 4IR9A 2VOOA 2OO4A 4NZ6A 2QA2A 4OZLA 2FLPA 2F40A 2W24A 1N32J 2AX1A 2L41A 4JI8F 2V8DA 2R7WA 2VJVA 4KGMA 4XK8C 2F8MA 1IXKA 1TL5A 1R8PA 4X66J 4H4KC 1Q1KA 4A48A 3I31A 2NUUG 2ZH3A 2Q6BA 6FDRA 3GR1A 4U8VA 4TQRA 1BQXA 2HHUA 1XMOJ 2VC1A 2YKPA 1W2IA 3QJPA 1VQPS 4Y2CA 3H4DA 4RW7A 2V8VA 1U47A 2KU7A 2UXCF 2MSSA 1SJFA 2C2KB 5CD4A 3C19A 3RBDA 1RT4A 4IFVB 4UQGA 3BQ0A 5F0UA 3MM9B 3EDRB 3M8PA 1OO0B 2WVFA 4OV1A 4YMEA 2BE9B 4GKJF 4H4OB 4KPYA 1FTRA 3W1YC 2KJVA 3GFXA 4ES2A 3DDIA 5CA5A 2NPFA 4QR2A 5CYMB 2NSCA 2DBBA 1AB8A 3T3FA 2ZH6A 4RX6A 1PC4A 1RWUA 4ZHRA 2IC3B 2GQQA 3OFEA 3VZHA 4QWDA 1CQMA 3OXLA 4AE5A 4AXJA 3CC4S 4OX9F 4DV2F 1R3NA 2RUSA 5DS7A 4O3SA 3TUIC 3ISND 3DXSX 4JYAF 1LOUA 3AHPA 1TKXA 1PCAA 3VAIA 3NCRA 1N6QA 2IYIA 4CDIA 2IM2A 1KTVA 1NK8A 1WELA 2CQCA 2Z30B 4K0KJ 2VZ9A 5DRKA 4B3RF 2VFTA 4GC6A 3IRXA 2EFOA 3S01A 5F3TA 3DRXA 3GZ7A 4LBHA 4UUWA 2R8HA 2C28A 1Q4RA 3PJWA 3C15A 4DG1A 2RDDA 4MYUA 3VTIA 1HNWF 2MLYA 2PFFB 4CLYA 3PFOA 2V5HG 2BE2A 3BO3A 3QLHB 3PW0A 2RE1A 1D9DA 3LGNA 2BJ7A 2YVSA 1LWFB 3LWMA 4AQYF 2RU3A 1UL3A 2DRBA 1NK0A 8RUCA 2LXUA 1APSA 4R0EA 3QRPA 1IKXA 1JJCB 3G2XA 3HFVA 1JXEA 1ELOA 2HGNA 4F7VA 3SCIE 4WWSA 4LFAJ 3BGRB 1KR4A 3C6UA 2KZZA 2HRYA 3MCNA 2CAJA 3A8IA 3KMQA 1WKLA 4EK2A 2BQRA 1RADB 1WEYA 3W2VB 3DM2B 1WEXA 2Z0GA 2BKOA 4IOAQ 3EDQB 5IT0A 2L9NA 4B3OA 4C8YA 2IY5B 1VRTA 2A6MA 5LMNJ 2BJ8A 2QA4S 3HVWA 4LF7J 2MQMA 4KRWA 4X4RA 4OYZA 4ECQA 3M9OB 2KHDA 1F3FA 3QO9B 2A3JA 2KFZA 1CG2A 1M5VC 2MSTA 2HLUA 1RAAB 3M2VB 1EX8A 2YWHA 2OJ3A 1KLMA 4DBQA 4FF2A 2UUCF 2VDIA 4X4QA 5FLXY 4X65J 3TQEA 3MMAA 3V81A 2Q6CA 1RKIA 3F73A 1SCJB 3GSIA 4B3SJ 3OD2A 2FHJD 4IH7A 4NMXA 3PJXA 2YX1A 1F3VA 3V6KA 2XMWA 2ZFHA 2VUGA 4OFZA 3KLHA 3KDNA 3TAPA 1HW9A 4WP8A 3ELHA 3G8TA 1H2TZ 2ZBQA 2LCWA 4ZJLA 3Q22A 2EW9A 1NK9A 5KFPA 2P9EA 3AJDA 4CTAA 2EC0A 1JXLA 2DNHA 2RU9A 2FLNA 2EC2A 4RNOA 4FKXA 5J1EA 2P9CA 4R5PA 4JI8J 2ZE2A 1TKZB 3HFZB 4F25A 3QAUA 4W90B 1LK7A 3H2VE 2JZ5A 1MN7A 3FFIA 3J7A1 2GV1A 2MQ8A 5KFIA 1HNIB 1YJNS 5GMEA 4K2XA 1DTQB 1LW0B 3W65A 3A1YG 2KFNA 4ZCKA 3DRPB 4KH0B 4DFPA 4ZLLA 4UOFA 1RT2A 3W9HA 3W64A 4XPEA 2GHVC 3BBFA 4N77A 3CJ3A 1SH0A 1CULA 4CT8A 4K4ZA 3CCUS 2UXCJ 2AV5A 3HJVA 2IHR1 4TKTA 3GJRB 5DLFA 2BOPA 1S49A 5B0AA 4KSEB 1Q78A 1SH2A 5F3ZA 3G6YA 5HQ8A 3VGSA 5IM0A 2HZVA 5HBMB 4CT9A 2HMIA 2WVBA 1KOOA 4DWIA 1VQKS 3RAMA 3OTCA 3KYLA 3M1VA 1N34J 4DR6J 1F2HA 4YDDB 5I3QA 2HQFA 4RUAA 4PQUB 2Z57B 2GZOA 5KG1A 2HHWA 4ER8A 3IN5A 5B08A 3ZC4A 3EX7B 1HBOB 2CJAA 5A0YA 4Q2LA 5EN1A 1D9AA 4KHRA 1JX4A 1AFJA 2MDAA 2PSZA 4KR0B 5B0GA 1RZMA 1N0VC 1TL1A 4JYAJ 1UJ4A 2ABYA 1PYTA 2HBQB 1CEZA 1BY9A 3J7YI 2ZWPA 5D0EA 4YR3A 3B82A 3QGPA 1UWBB 4ZVHA 5HN0A 1BMQB 5J1PA 4B3RJ 2EXUA 1EKRA 4IRCA 5KFXA 1ZA1B 1YQHA 1ZPVA 1XBWA 1S9EB 2MPUA 3M8QA 4DN0A 2IFXA 5LSOA 2KB2A 3KXDA 2RAQA 1PJ7A 1RT3A 1F9EB 3A8KA 2ERRA 3Q2TC 3ZNUA 1DQ8A 3D0HE 2D41A 2V4JA 4OZ1A 2AYEA 1U2CA 3NNAA 2VA2A 2DNYA 3LALA 4AQYJ 2HVIA 2MKYA 4QR1A 3KJFB 2HGMA 1WG1A 1IR1A 1RAOA 4PG4A 1R0AA 4F0KA 4LSLA 1HBNA 3ILJA 1VOMA 5H1SV 3DOMB 5D6GA 2QO3A 1RWKB 3HI9A 4O3NA 2BJ3A 4LFCJ 2DEJA 3BYRA 3FGVA 3NWGA 3MEKA 1Q95G 4EU0A 2XY5A 4K4UA 5IC6B 3CO9A 1IKVB 3O1LA 1WC3A 1X4BA 1DY3A 1WJ9A 1Y11A 4DPWA 3G8SA 2M4MA 2CQIA 4DR2F 3QMQA 1YK9A 3T5KA 2MHNA 4IDKB 4FS1A 2B5JA 3CIZA 1S99A 5LXYA 4URSA 1MMNA 1UAWA 4OHXA 2D3ZA 1W25A 4XAKA 4EYHB 1OQ6A 2GVZB 4YN3B 2OFGX 4EGLA 5HATA 2RKIA 4F4WA 3HHLD 3CGIA 2YKNA 4NCAA 3H4BA 5KFLA 3MCOA 4U67Q 4Q8FA 4IO1A 2NCKL 1U2RA 4RZRA 1CJUB 1MMLA 2UUCJ 1MG7A 3GMGA 2VPYB 5ITHA 3SSQA 3IA0A 3RBZA 5CYQA 1K73T 3GWCA 2M3DA 3ONQA 3DLKB 5D4OA 4YEAA 4AT1B 2ZJQQ 1RT7A 4OX7A 1D3WA 3HZEA 2WONA 3UNYA 2N3OA 3V6JA 4F2SA 4DV0J 4WE1A 3D6HB 4G1IA 5GADI 4IH6A 3M9MB 3BGFA 2QFIA 1LWXA 4PYDA 1FKPA 5DG7A 1BQMB 2E5GA 3LUYA 4TYAA 3I5AA 5F8JA 2AGPA 4A8WA 3EGZA 3FBFA 5AJ3F 2QL5B 2ZWOA 1RJJA 2BJ1A 2V2VA 2V4QA 3W62A 3CD6S 4DQSA 1ZZFA 3V5RA 3WC0A 1SVDA 2JWNA 2DT9A 4C9DA 2PEHA 1IBKJ 4DU7A 3DOKA 1FNOA 1NK6A 3C66A 4Q2MA 4U7UD 3KTQA 5HAOA 5D0GA 1F1BB 4FP9A 2ZBRA 3OFGA 1S4FA 5H9FK 3DMJB 5AXKA 3LP2B 2HAFA 3FBEA 3C8YA 8ATCB 4EO8A 3GG0A 1SC6A 2DPIA 2J9DE 2HZAA 1RTJB 3RB3A 4G1QB 1DHMA 1V5VA 5KFDA 3NAIA 3KG4A 2NXJA 3IWNC 1S7IA 2R7UA 3WX8A 4DSFA 3U27A 4NX9A 3E8OA 2GHWA 1Q8IA 4ELTA 2QYGA 4RW9B 3CCMS 4Y2KA 1IWGA 1HWUA 2HIQA 4MH8A 2CADA 5KOWA 3IAM9 2AZ3A 3HD1A 3N6LA 4ZPAA 2CQ2A 2YWFA 3OLAA 4CO2A 3TQ1A 5J1NA 2EFNA 3J81j 1N4LA 2F63A 4UOGA 1ITPA 2GIRA 1J2VA 2B6AA 1A6LA 3TZWA 1PJ6A 3MM6A 3PNIA 2RRBA 5I42B 5LSLA 5JJBA 3CCZA 2ZITA 2W9BA 2CJ9A 4HKQA 3EPIA 4CLUA 2EWHA 3N0VA 1TUGB 4B08A 1ZA2B 4FYDA 1T05A 2CVEA 2HURA 3VZIA 3HULA 3NLCA 5KOXA 1N0UA 5AXMA 2FZKB 2BKNA 5F8HA 3PM9A 2G0CA 2RF2B 1RGVA 2MLZA 3D9BA 4QYZK 3PHEA 4CLWA 3MOZA 1YZ6A 4ITSA 3WBZA 4NXNF 4ZPBA 5BYSA 1T03B 3NOGA 3QWPA 4O44A 3OSPA 4CLKA 4IQXA 2J7KA 2V0NA 3F0NA 3CJ5A 4LQ9A 2EFGA 3JSMA 3H2LA 2RT3A 1X4GA 3KFWX 2DTJA 4GVBA 5K5MA 1S1UA 4EO6A 4DX5A 2VG6B 3AOCA 4LJMA 5E3PA 3U1LA 1U48A 1FRXA 2ZZTA 4IUFA 3O8WA 1LK5A 2FY8A 3UD4P 4O0IA 1K1QA 2QSFA 3KJNB 3PKMA 4ZVQB 1HWJA 1HMVB 4DR2J 3CWJA 1RI7A 2BMBA 1DFDA 2YNIA 3UFCX 3RRGA 4QZVB 3O3LA 2AWZA 1XIQA 5LJ5Y 4I2PA 5FDLB 3RJMB 2OP5A 1FRJA 2FB0A 5GVQA 3MECB 4FXVA 1S1WB 4WF9Q 4KH1B 4MT1A 2GVDB 5F8LA 2PFDA 1FE4A 3QPIA 3MMBB 4OZJA 1N48A 4P7TA 1RTHB 4XTTA 2CNLB 3QIPB 4QBUA 4PUOB 2HWHA 2FHMA 2L9DA 2Z2ZA 2G0IA 2XSJA 1RTIA 2XS5A 3CJ0A 4FVMA 4TY8A 1JB0C 4PZVA 4MTPA 4B9SA 4TU8A 2Y1IA 2R8KA 4KJIA 4WTYA 4OYPA 3UN3A 4DPOA 3LTOA 4JUZA 3DYAB 4FF1A 3OTOF 3T1AA 4RNMA 2CQDA 2LA6A 2KXNB 3M6WA 3V4MA 1JLFA 2YWWA 1R6VA 4BDPA 4WYLA 4LIWA 1R31A 1IBMF 1X5TA 3D6FB 4WP3A 5AJ3J 2YPYA 1X4CA 2YH1A 2DNQA 3GV8B 1MU2A 1X8DA 5D4NA 1NDKA 3R5AA 1R7IA 2XMAA 2J7UA 1HYSA 2KM8C 2M2BA 2HFZA 5E3CA 2JL9A 3TOQA 5A6PA 2AEFA 1IR2A 1WC1A 5L39A 3BDEA 3GG1A 1TUVA 1N5YA 4IG3A 2E1RA 4TXSA 4NLWA 1CSJA 2RVJA 1NB2A 5HP1B 2QG9B 3D28A 1FVSA 3FEXB 1B70B 2R2UA 2PMZD 3LP1A 3CCWA 4F67A 2BANB 4AXIA 4IO9Q 4ZIWA 1RA6A 3PX4A 4RW6A 1VIOA 3K5OA 5L1LA 4FYYB 2KH9A 4BS2A 3E01B 4I0WA 4PKDB 3HKWA 3UDCA 2WVCA 1VS3A 2KXFA 4WFAQ 4HI1A 3T5LA 2HIYA 4DU8A 1VHFA 1CS4A 1SIZA 1Y10A 4P7VA 1IN0A 2EBGA 2V63A 2W4DA 3LGMA 4DN9A 2GQCA 1OQ3A 2DO0A 1D0EA 1XR5A 3UCUP 2VG7B 4E0DA 3EXYA 2MEWA 3SCLE 3GYGA 5KT4A 3H42A 1WDTA 2A2DA 3MGJA 4ILLA 4YY3J 5JVGQ 1EAYC 2VOPA 2WSEC 3T41A 5EUHA 5DO2A 1U8WA 4DQRA 3QJJA 2PD1A 2Q43A 4YB7A 2YBVA 2QL7B 2OPPB 4LVOP 5C24B 4Q44A 2HNDA 2MGZB 4FBUA 1RT1B 4IYQA 4FF3A 4DL2A 2KRRA 1Q53A 1A7GE 3MM7B 1HI1A 1HLWA 4FPRA 4CLSA 1ZOTA 4IR1A 1M0SA 3QGHA 2OPQB 3EYZA 5IS2A 3BR8A 1WOPA 3UVJB 1FWLA 4TNOA 1DQAA 1QSLA 4KHMA 1C0UA 5KAKA 4DI6A 1UVLA 2LXFA 5C25B 3SSSA 2LQ8A 3LP0B 4Y2MA 3V6DB 4DXLA 2WRMA 3HP6A 3UN5A 3UQSA 2X7IA 4QYRA 1YVFA 2C1EB 1VC0A 5C2CA 4UT4A 2BRKA 2VBWA 2AJQA 1C1CA 4OZNA 5KFZA 3OR1B 2B7CB 2F3JA 4KB7A 2XMUA 3GLJA 1WF2A 3IR5B 2W7AA 2OMOA 4BHQA 5KFAA 3R1HA 3NGTA 2WBMA 1WWHA 5FLXU 2PMHA 4JV0A 2ZD1A 4NE9C 3F44A 2P9GA 1W2BR 3FEZA 3DXBA 4ED4A 3RUBL 3LPYA 2MZQA 2LLZA 3DLBA 1SL1A 4CYUB 4HLBA 2ZM6F 2JVOA 2IAJB 3RR8A 3JSYA 2V94A 4YHHJ 2UU9F 2R2SA 4QWAA 3PW4A 3BN4A 1MW7A 3ZXWA 2GAGC 2AP6A 1SC1B 2CJKA 1XK8A 1RWVB 3SFUA 1P1TA 2HSEB 4RWWA 2P6SA 2CJQA 1E6VB 3I0SB 4K5RA 1M1KT 3HF5A 2PT0A 5KFYA 2K06A 4YR0A 4CNYA 2DIUA 4OIXA 1T9XA 4MKBA 1M90T 4DX6A 1RTDA 3KK2B 4MK8A 3FRYA 1VQ5S 2HGLA 3FMWA 2XS7A 3IG1B 1S76D 3K8VA 3CNQP 2RRNA 1R8AA 2R7QA 1T9YA 4CM0A 2AEJA 5C42B 3OTOJ 4ED6A 3KLIB 5T41A 2QRRA 3KLGB 3SYZA 2NYHA 1IBMJ 5L1IA 3IBWA 2YPZA 3QRRA 5EHHA 2FVSA 5KFWA 1NLKL 5D78A 1AUSL 4CLZA 2M5YA 2AGQA 5K8OA 2J0QD 2ADCA 1N5QA 3OJSA 3CTRA 3IGVA 1VGYA 1LWCB 4PG7A 3CB4A 2MZ1A 2QA4G 3TAMA 4X4UA 3GJSB 1FD2A 2OPSB 5K20B 4G3IA 3SXLA 2C3OA 3BF4A 1OSDA 1DBDA 1FDAA 2YKMB 2XZDB 5D4PA 1FDDA 1CJTB 2H51B 2G2OA 2VV5A 3FQKA 2I1RA 1UTAA 4USWA 2K3IA 2HS0A 2ZZMA 4FXWA 1FNXH 5J2PB 3DI6A 1YJVA 4P52A 2B8QA 1B64A 1UVNA 2MZTA 4TN2A 4K5SA 3TA0A 2IDLA 2ACYA 3UO0A 1OPZA 2HQDA 1YJUA 4ED2A 1U1LA 2KFYA 3H5UA 5E41A 4X4TA 1UP1A 2Y3YA 1PYOB 4YUDA 3VAGA 2HK3A 1I51B 4M5GA 3HCXA 2RJZA 3TANA 2ZH8A 4FXDA 4ED5A 1AW0A 3M30B 4MKYA 3A3OB 2JEJA 1BHNA 5A8WB 5J2MB 4QPTA 2CJYB 4RNHA 1FRKA 2PMWA 2U1AA 3C6TA 2D9OA 1VQSA 2N7CA 3R8YA 5L9NA 4NA3A 3LANA 3MAQA 3JQMA 4XDDA 5K14A 4A8KA 1LFWA 3D67A 3BPDA 3MPUB 4LSZB 5L38A 1U6FA 2IM0A 2DCUB 1I94J 4C7QA 2BJDA 2XCAA 3V2UC 3H90A 3OR2B 4F02A 2DXFA 4PABA 4ATNA 2MKHA 3FCHA 2GGPB 1M5OC 3GSDA 1X4DA 3OFHA 2YNHB 3AODA 2ZNYA 5KFGA 4DSLA 2HHHF 4DMZA 1MROA 1L3SA 2C3UA 3UD3P 5ETPA 2HFNA 1WNEA 2V2KA 1MN9A 2VICA 3QFHA 5B7WA 2KO1A 4I2QA 3QGIA 4OI4A 4KHPF 1GTHA 2WVDA 2HG4A 1XTZA 4ZPWR 3E51A 5E2QA 4M5LA 4HTIA 5HLFB 2ZM6J 1EQ0A 1GX6A 1JK9B 3MPYA 1U02A 4KIAA 2E29A 3G86A 3DLHA 3CCLS 3D1QA 1ULRA 1FX4A 2UU9J 1DLOB 3ISZA 1S1XA 3FBBA 1L3TA 1TV6B 2DITA 4ZPCA 1VRQC 4K50A 2FJEB 1FERA 3THTA 5KFEA 2QTWA 2DGWA 2Q66A 2D1CA 4P6QA 5KG6A 4QCLA 4GC7A 1NAQA 4CLTA 1WUUA 5AE3A 4DV4F 2LECA 1UW9A 3QT8A 3IFEA 1K1SA 2ACMA 1HHQA 3G8QA 2ZOMA 1HWIA 1ZM3A 1QAJA 2VFUA 5A8KB 2EPIA 3JYTA 3SDEA 2ILZA 5GAEU 4OYXA 2CQGA 2QSWA 4WZMA 3SIPB 1EETA 3ZNJ1 3MM8A 2XEXA 4J7CA 1EP4A 4J9RA 1BD6A 5LOQA 2UXDF 2H48B 4KFBB 5T7LB 2W25A 2YNFB 2ZC4A 1RWXB 2CPFA 2AJ0A 4J9SA 3Q8RB 5ETSA 1AUDA 4PPDA 1UCNA 1N36J 1YZ7A 3US5A 3BQ1A 1S12A 2MKIA 3D0IE 4JB8B 2NLWA 4ZVTB 2YKOA 5E7OB 5KT5A 1N6QB 4KKOA 2E5LJ 1SKRA 4MYTA 4LSNB 2WCXA 1YRUA 1L3VA 1J27A 1SKSA 1HHSA 5K8PA 3BJYA 3AXKA 3G4SS 2V50A 4D3GA 4Y3CA 4FYWB 2RRAA 2RS8A 5DQGA 2BV3A 2UZAA 5HROB 3M2UB 1FRHA 3NCQA 2ROGA 2DHXA 3FJ2A 2DHGA 3PV8A 1WKKA 4ZCMA 3MM9A 3H5XA 5HK4A 2CXEA 2FJDB 4YS2A 4NLRA 4WP9A 1HARA 1FFSB 4H4OA 4J9LA 3HD2A 4CQ1A 4DZDA 2P8IA 1DAXA 5CYMA 1RDRA 1RT5B 4DLEA 2LU2A 2DNPA 5F9NA 4F26A 5MLCV 4C0OC 3OL6A 2IC3A 1RCXB 4USTA 2MY7A 3D1OA 3CC7S 4XPCA 3BZQA 5G4DA 4M5KA 4WFNQ 1JLBB 3C6UB 1V3ZA 3H7HB 4CIOA 1TAQA 3TX8A 3MEGA 1HR0F 5HQLA 5EX0A 3M6UA 2EK6A 2HQGA 3THPA 2PI5A 3OVAA 4ID8A 3NS5A 4R0JA 1MMDA 3DNCA 2QX0A 2V34A 4CLLA 4Z2XA 1R8HA 3IBFB 3Q8SB 5IQQA 2XQCA 2NREA 2C2RA 1VRTB 2JFDA 4QW8A 4KO0B 4ZVUB 1ZM9A 2KYZA 4IFYB 3ZZUA 1K9MT 4C97A 2HVHA 2OPRB 1XN9A 3A12A 4NEYA 5IT9Y 2HBYB 2KHCA 3MWBA 3QLHA 5KTQA 3A4TA 4JBCA 3DKDA 3CD0A 1VQNS 1LWFA 1U45A 1MNEA 2DR6A 3A3PB 3CULA 2VKZG 1KLMB 5ETVA 3TZYA 2CKWA 1QY7A 2LKZA 1RYSA 4DFKA 5BXIA 1TMJA 1U1OA 1TR0A 1Q86T 2W9AA 4PWUA 5B0DA 3FZBA 3G6XA 3TVYA 4PWDB 1XR7A 1HNXJ 5BR8F 5KFVA 1OIAA 3PO5A 2W7OA 3BGRA 4RU9A 1NDPA 2B9EA 1B0PA 2HHHJ 3S1TA 4LF4F 2VC0A 4N41A 4YFUA 1GQEA 2F7VA 4ZPVR 1BGXT 3K17A 3M8RA 3J7ZT 1RUSA 3DM2A 5B0EA 4WU3A 2BYCA 2QLWA 1CLFA 2VB6A 5LT5A 7FDRA 3CCTA 2B51A 4KHPJ 3TAQA 2AQ4A 1Q81T 1IJEB 2ZC3A 2XULA 2CYYA 3AXMA 4DUZF 3QO9A 1NU4A 2DGOA 1FK9B 3T5JA 1KWMA 1V5IB 3O2IA 2V6AA 4P9SA 2GMJA 3M2VA 4RUCA 1Q8LA 3GP9A 1JWWA 4J5OA 2E5JA 4K4XA 1H7XA 3PJ9A 4W98A 3TA1A 2IJFA 2CJXB 2G0JA 3TRGA 3JXOA 5BYQA 3NRBA 1UVIA 2OD6A 3P45B 2KVIA 3T1YF 2VASA 2J6UA 4M94A 1XC9A 1H38A 3FVYA 1YRTA 3ISNC 4F50A 3CJ4A 2GA7A 3PR5B 3D3BJ 3BSOA 2FVRA 3RAXA 4I6WA 4LFBJ 2VFVA 3GV5B 5IM0B 3MUVP 2E1AA 2RB7A 4A8MP 3UI3A 1VQLS 5LSRA 1MSWD 1OS5A 5E3RA 3GIRA 1X9MA 3PEJA 1UJ5A 2DGUA 3GB0A 1WI8A 3AA9A 1RT6B 2XI2A 2UXDJ 1U4BA 4DV5F 2W4PA 1KONA 3KUEA 4ZVPB 3WQPA 5HI7A 3AOBA 4N7TA 4WK1A 3RRKA 3ILIA 1TL1B 5DQIA 1L5UA 3N28A 1TKZA 4OYOA 1RHJB 4C8LA 2UXBF 2FZGB 2KRBA 4ERDA 2OIHA 2WVEA 3OL8A 4GVLA 4A8FA 1DTQA 1LW0A 3I56S 3DRPA 2XYPB 2HVZA 3MEEB 3PO4A 2NUHA 5A8RB 1KQFB 5HL7Q 1S1TB 3KNAA 1NJZA 4YR2A 3J7YU 3B78A 2MMYA 3JSRA 1Y3KA 5KFCA 4QWEA 2AYMA 4FNHA 3QATA 1HNZF 5ETQA 5HVFA 1Y0HA 1NDCA 3I4PA 5HBMA 2MLXA 3WIVA 1KFSA 2MB0B 2V4JB 1Z4UA 4MKAA 1S6UA 2U2FA 2X1FA 2MZSA 6AT1B 1RHKB 1OSCA 3PVXA 2DVIA 4PQUA 5RUBA 1YJWS 5J2NB 4MK9A 5AE1A 4DV7F 5KT7A 1SKUB 2RD5C 1HBOA 4GKKF 4DPYA 2CPJA 1PJ5A 3KK3B 4ILRA 2OFHX 4F4YA 2HS4A 3T1HF 3NS7B 4NA2A 2RH3A 2EFQA 3ZZOA 4PG5A 2BRLA 3H20A 2HHPA 2R7SA 1IKWB 5H9EK 2GO8A 1NM2A 3BKUA 1HR0J 1N88A 2EG2A 1HQ2A 3HSZA 1UWBA 2E5IA 2FJVA 1OMSA 1P6TA 2NXUA 2XCPA 2I9SA 1S9EA 3R2CJ 2O01C 2XBPA 2GMHA 5F8IA 3DRRB 2CA9A 2P5VA 4Q0BB 3DOLB 3D6TB 3IM9A 1FT8A 3MM5A 4Z7YA 3LAKA 5CYJA 4HDGA 4LF5F 3MAAA 1G6BA 2QYCA 2FGOA 3CJQA 1CQNA 2VONA 1HQEB 4K4YA 5KFJA 1Y5LB 1UPMB 1U26A 5CYQB 4O3PA 4C6AA 1FCAA 2HBRB 2ZH2A 4F2RA 3Q8PB 5BR8J 1RT7B 4DR7F 5KT3A 2D3UA 3AH6A 2QGFB 3CJSA 2HFOA 4IOBA 4HDHA 1XNRJ 3TI0A 4DV3F 4CCHA 3AAWB 4LF4J 3ZTSA 1X4FA 4M5DB 2GX8A 1FNMA 1PBAA 5DJBA 1NBEB 5KFHA 3J7AN 3P6YC 1WORA 3KMSA 1IKVA 4ZP8A 2GS8A 2J9CA 2YX7A 2MQQA 3NNHA 1JLAA 3KLEA 4NCBA 1SC3B 4IDKA 4IKAA 3GIMA 4DUZJ 2OLWA 3K59A 3ET6B 1RWWB 4LBPA 3KLFB 4B3TF 1AROP 3B4DA 1YLXA 3JS9A 5DG9A 1NK5A 2GVZA 2UUTA 2FD2A 1N5VA 5F9LA 1PAUB 4OMFG 2AEMA 3SEOA 2CPDA 4RW8B 3CSKA 2RILA 1CJUA 2PIIA 3ENVA 1TVRB 2J8AA 2R8JA 2ALZA 2JLEA 3W2WB 2IM1A 3R5GA 1ZAWA 2RNEA 2RDIA 1RLCL 4CH7A 1Q0NA 1Z2LA 3DLKA 1KVKA 2DXEA 2YKAA 4ZDNA 2XLJA 3T19A 3T1YJ 4NI2A 3KK1B 3FZ2A 2AZ1A 4O3OA 3UWTA 3OTDA 3HVTB 3T6JA 5IWAJ 2RMLA 3M9NB 2A18A 2M0GB 4RPFA 1RAIB 1KC8T 3W60A 4Y0FA 3BO4A 4ED3A 4OX6A 5LMUF 3VQTA 1CJKB 4TLQA 3SV4A 1NCLA 4JI5F 2CZVC 2B4UA 1VC6A 4RW4B 1BQMA 2DJWA 2VBZA 1U1PA 3C14B 1NZAA 1IQTA 4N8OA 2J6TA 2DISA 1F60B 3AB4B 3NGDA 1IM6A 2F5GA 1ZAXA 5KG7A 1UVJA 3ZZRA 1REGX 3IR6B 5EWGA 1WD6A 4IRKA 3J80Y 4CLFA 4YB1P 5CCLA 1FKAF 2BR0A 3K57A 5SUHA 4KV8B 2ZBIA 4FPIA 2UXBJ 2UVVA 2KJWA 4EEYA 1X0FA 2B6AB 3VV2B 1IKYB 4KBIA 5GAEI 3MM6B 3IC1A 4RUBA 4OZ2A 3DMJA 3J81Y 4G1PA 4P74A 2PA3A 3P5BP 2FGCA 3LP2A 3W9JA 4MIWA 4LF8F 4DX8H 3U1NA 1NJIT 1N5SA 2CPYA 3EJMA 4CWBA 1RTJA 2P6TA 2NXCA 1GAOA 4AUKA 3HZGA 1HNZJ 4NLOA 3RB6A 1GMWD 2OHDA 2V8PA 2X1BA 1HPZB 1B0VA 3EVMA 4L3NA 1ZZNA 3CDUA 2QT7A 1KD1T 4RW9A 3TJAA 1PBUA 3AQOA 4V19X 4WXWA 3HDSA 4DV7J 2H65B 2VKRA 4GKKJ 4DL5A 3N5FA 3M8ZA 4NLTA 1RXOB 3R5JB 4HHHA 4CO3A 2DGSA 2OSQA 3T1HJ 1SB6A 3W5YA 2GIFA 3N9UC 3GV7B 3RZAA 2OSRA 2ZKTA 2JVRA 5IXUA 1P9QC 2B8PA 5KG5A 3EVOA 4ZK7M 1RBOB 5DDPC 3HHLC 2R8IA 1Y4ZB 2GCFA 4GRSA 2J8SA 4C3KA 3DHWC 3L95X 5I42A 2NQPA 3OFFA 1ICEB 3CXCR 1FEEA 3CJ8A 1NB7A 4DV6F 4KC5A 4X62J 2OELA 2XZWA 2I5JB 1R6YA 1KBRA 3TYTA 1U1NA 3P96A 4I2PB 1PILA 2BACA 1X0PA 2RF2A 4NLVA 4ETZA 4O3QA 3K0JA 3M32A 1U25A 4LF5J 2FDNA 1S59A 3NXZA 4ID5B 2ZVIA 1LWEB 4EZ6A 4NWBA 2KDOA 1JMTA 1T9TA 4JV5F 4ZOSA 4F4AA 4U7CA 2B43A 1K8AT 1NK7A 3BGUA 3EGVA 5FIIA 3W5XA 3BGOP 1RTIB 4A4JA 1U8SA 2MYFA 4QIVA 4DR7J 2VG6A 5IQ6A 4TY8B 2FHKA 4LF2A 2HNYA 5U47A 4DV3J 3OTBA 4OLPA 2VQFF 1WACA 1YTYA 1QJHA 3I0RA 4M5HA 4USMA 1FVQA 1BQNA 1DZ5A 2BXJA 4O4GA 2H1YA 1AZSB 3TZZA 3W8GA 2VFSA 1HMVA 4HH1A 3FMBA 2HBZB 1G3OA 5H9EJ 2A2CA 2B56A 3D4JA 5FDLA 3OBIA 4RO0A 4CM2A 2X51A 5EDWA 1MU2B 4B3TJ 4X4VA 1IWAA 2ZOGA 1S1WA 4HT5A 3JAMU 2FHJA 3I32A 2GVDA 4P2MA 4NLUA 2O67A 4F3OA 4Y6IA 3V4IA 2Y1RI 3MMBA 2CPHA 1FRMA 4DX7A 5GAHU 3EPGA 4UUXA 2A6OA 1PYSB 4PUOA 4LT6A 2W2QP 4NYOA 1SV5B 4DL4A 3BKFA 2QE5A 2FVQA 4JI3F 4O4RA 4OI0A 4B9NA 3D7SB 2IJNA 3R6GB 2IDEA 4K4VA 3DYAA 1KLNA 1DRZA 2FVPA 5DDRC 1NNDA 3KWMA 3G82A 1S1VA 5LMUJ 3GJQB 4JI5J 4OJ1A 4ELUA 4LRDA 2ASJA 1YWXA 4UW2A 1VRUB 1IJFB 2V2QA 1X9WA 2CNKB 4DUYF 1IBLF 1JKHA 3NP5A 1H74A 2GNKA 2YY3A 3ZZ0A 1VR6A 3HSGA 1FFWB 5DQHA 2QN6B 4I4BA 1TL3A 2IVFB 2E1CA 1NPPA 3QAEA 1VIXA 1HNVB 2I6WA 3R3TA 1SPBP 1RBAA 4LBIA 1U0SA 4EMDA 3D3CJ 2A0FB 1WTBA 1ZYQA 2K8GA 3VALA 1FDBA 2M52A 2HNDB 3KUHA 4URGA 3VAKA 3BV8A 1UEVA 3VAJA 2R7TA 2VG5B 1YBAA 2ZDOA 3P5TL 2BANA 4K4WA 1D09B 1ZTTA 2RQKA 2J7WA 3GIJA 4YP3A 3CCSS 3MR3A 4HHJA 2BVZA 5I3PA 4GKJJ 2G2YA 3E01A 3D1HA 2GHPA 1QUVA 2DH7A 1C2PA 4PR6A 1T02A 1X5OA 4BWJA 4N5SA 1HL6A 4FS2A 1VK8A 2ZH9A 4NLQA 5EX3A 1U09A 4DF8A 4X64F 4DF4A 1H0HB 1WSVA 2D69A 5HSPA 4LUBA 4DV2J 4OX9J 2ZBPA 1K44A 2UVRA 2DR7A 2EKYA 4URQU 2GC8A 3CD7A 5IT9U 5CH7B 4WFXA 3D6MB 1UMJA 4RLEA 2JC0A 4A8XA 1N33F 4NZ0A 4NZ7A 2VG7A 4J90A 2ATCB 3UR3C 4J9UE 1QSSA 3MMCB 4FYXB 2D3O1 4W4MA 1IR0A 3K2YA 1N54B 1HI8A 1NKEA 2UUWA 2Q3PA 2R2TA 2V8GA 3L09A 2LA4A 5KFFA 1G7CB 1J5EF 1FF2A 2JSXA 2DNOA 4J91A 3RU0A 2ZVSA 3PRVA 3WHIA 2MGZA 2XYGB 1HNWJ 3IS9A 1RT1A 4A46A 1Q5YA 4Q5VA 3OSNA 3Q23A 4L74A 5L1KA 3MM7A 2AYGA 3OPKA 3M8WA 1P9YA 1JLCB 4DSJA 2G1HA 3BSCA 1VJWA 2OPQA 3UVJA 3EWGA 3IP0A 1TP7A 4ZVOB 4JV5J 3LP0A 3CIMA 3V6DA 1WF1A
chains in the Genus database with same CATH topology
5J2MB 4QPTA 2DNNA 4RNHA 1FRKA 3FFIB 2KJVA 3GFXA 4ES2A 2U1AA 5CA5A 2NPFA 2LQ9A 3C6TA 4QR2A 5CYMB 2D9OA 2NSCA 1VQSA 3BN7A 5BYRA 1QVGR 2DBBA 2N7CA 1TL3B 3DLEB 5KG4A 3T3FA 2ZH6A 5KG3A 3VQSA 3PDNA 3R5DA 4RX6A 1PC4A 1KFDA 2LYVA 5L9NA 1RWUA 3OR1A 4ZHRA 2IC3B 5G0RB 2GQQA 3OFEA 3VCDA 3VZHA 4QWDA 4NA3A 1CQMA 1M5KC 3OXLA 4AE5A 4AXJA 3Q24A 3LANA 4O23A 3MAQA 1RT2B 2I8EA 3GYNA 3CC4S 4OX9F 4DV2F 1R3NA 4L72B 5K14A 4XDDA 4A47A 4YQWA 3HHDA 1YHQS 4A8KA 1LFWA 3TUJC 5DS7A 3RW7A 4QIWD 4WIIA 3OHBA 4O3SA 3TUIC 5L38A 4ZCIA 3ISND 3DXSX 2C42A 4JYAF 2XO7A 3I96A 4ZKAA 2WAQD 1U6FA 1LOUA 2IM0A 3AHPA 1TKXA 2Q79A 2DCUB 2IA6A 3HHLA 3SFGA 3VAIA 3MOJB 3MFIA 1WI6A 3NCRA 4NOHA 4C7QA 1N6QA 2IYIA 2BJDA 2XCAA 3V2UC 2IM2A 2VD3A 1X5PA 2AJ4A 3MEDB 4F8RA 1KTVA 3OR2B 3D5MA 3QIDA 1NK8A 1B0TA 1SV5A 4PXBA 1WELA 2J0WA 2MKKA 3U02A 4F02A 3AJ2A 4ZPDA 2HYIB 2J6SA 3GIIA 2CQCA 2IAJA 2HMIB 4BWMA 4ATNA 4PQAA 2VZ9A 5DRKA 4B3RF 2VFTA 3K5LA 4GC6A 2MKHA 3M1VB 4B9VA 3IRXA 3MPVA 3CMAS 3FCHA 4DL3A 2EFOA 2GGPB 3S01A 5F3TA 1M5OC 3DRXA 3GSDA 5F8MA 1X4DA 3GZ7A 4UUWA 2R8HA 3OFHA 4F3MA 4ZLPA 2C28A 2YNHB 1Q4RA 4PXDA 1N8RT 4P2SA 3PJWA 4AYBD 2ZNYA 5L9XA 5KFGA 1JLEA 4DG1A 1S79A 4DSLA 2HHHF 4MYUA 4DMZA 2ZH5A 5CHCB 3VTIA 1HNWF 4JI2F 1MROA 5A0YB 5EWFA 2PFFB 2YKQA 1L3SA 3PFOA 4M95A 4DS4A 2V5HG 2C3UA 2BE2A 3UD3P 3I9V9 3CDBA 3BO3A 2HFNA 1VRUA 2C2DA 1WNEA 3QLHB 3PW0A 1E6VA 2V2KA 2ZOFA 3I0SA 2RE1A 1D9DA 3LGNA 2YVSA 5B7WA 1LWFB 2N7YA 2KO1A 2ZBCA 3LWMA 4I2QA 3QGIA 4OI4A 4AQYF 4KHPF 2RU3A 1WHWA 1ZBTA 4ECUA 1UL3A 1GTHA 4X84A 3N79A 2HG4A 1XTZA 4ZPWR 3E51A 2DRBA 1HBMB 2PO4A 5CQGA 1HNIA 4Y2IA 5E2QA 4ECSA 1NK0A 4HTIA 2FJBB 2LXUA 5DLGA 3KK2A 1APSA 1ZM2A 2DNMA 4R0EA 3MFHA 4EBEA 5HLFB 1IKXA 2CJBA 3ZZPA 1GX6A 3OVSA 2J76E 2QZ8A 1JK9B 2IA0A 3KNGA 2J0XA 3MPYA 4KIAA 1JXEA 2E29A 3IG1A 1Y9OA 2AU0A 2DR5A 3EZUA 1HNVA 1ELOA 3G86A 2HGNA 4WXOA 2HRUA 3DLHA 2JLFA 3ITHB 1JLGA 2ROPA 3CCLS 3CT9A 3D1QA 2EK1A 5IZHA 1ULRA 5C5JA 3SCIE 3TO8A 3CJKB 1DLOB 3ISZA 1S97A 2RQMA 1Y7PA 3HHEA 3M8QB 2DR9A 3CJ2A 2BM1A 1S1XA 2YQ3A 2Y0SD 2L08A 3HFKA 3BGRB 1KR4A 5C42A 1C4AA 3C6UA 1L3TA 3EGWB 1TV6B 1UA1A 2KZZA 3MF5A 2DITA 3AA8A 3KLIA 5CD4H 4ZPCA 4K50A 2FJXA 1RT3B 2HRYA 2FJEB 4ECZA 5DDQC 3IS9B 1FERA 3THTA 5KFEA 4Z37A 3KMQA 2DGWA 2VG5A 2Q66A 2D1CA 4MFBB 2C3PA 4P6QA 2MKCA 5KG6A 2BQRA 4QCLA 1WEYA 3W2VB 4GC7A 3DM2B 1WEXA 2Z0GA 4IOAQ 1NAQA 2B7BB 1QTMA 5IT0A 2L9NA 5AE3A 4ALZA 4OX8A 4B3OA 4QQBA 4C8YA 4DV4F 2LECA 1VRTA 3TA2A 3IFEA 3KG0A 4N56A 1K1SA 4WCEQ 2KT2A 2QA4S 3HVWA 3POTB 5AXNA 2WOMB 3MD3A 3G8QA 2MQMA 1I94F 5H9FJ 4KRWA 2ZOMA 4X4RA 4ECQA 3M9OB 1JLQB 1HWIA 1VQ4S 1ZM3A 2KHDA 4ELVA 4EZ9A 1QAJA 2VFUA 3V6HA 1R0AB 5DGAA 5A8KB 3QO9B 1NK4A 2EPIA 2KI2A 3VR1A 2A3JA 3JYTA 2BQ3A 4NLPA 4LSLB 3SDEA 2ILZA 5GAEU 1HBNB 1S0MA 2XWYA 3ULHA 2KFZA 1CG2A 2H5EA 2CQGA 2QSWA 3CE8A 1M5VC 3ZZYA 3ZZZA 2DPJA 4WZMA 1BC6A 1EETA 2MSTA 2R9LA 2FC8A 1N5TA 1VMBA 2HLUA 3M2VB 3MM8A 3LOUA 2LEPA 2M88A 2YWHA 1ZAVA 2XEXA 2DB1A 3C6TB 3JTPA 2OJ3A 1KLMA 2OPSA 3VF0B 4DBQA 5FD1A 4FF2A 2UUCF 1EP4A 4J9RA 1BD6A 3PY8A 3M2RB 3PW2A 3DCAA 4OHVA 2UXDF 4X4QA 4ECVA 1K0VA 1SJ1A 5FLXY 2WK4A 1S9FA 4KFBB 2NR0A 3MMCA 2W25A 2COLA 2YKMA 5T7LB 2YNFB 4B17A 3DRYA 2ZC4A 2Z8QA 2CPFA 4F4KA 3MMAA 4CI0B 3CC2S 2DR7A 3V81A 2AJ0A 4J9SA 2Q6CA 3Q8RB 1RKIA 2M9KA 5L8RC 1AUDA 4PPDA 3F73A 1O0PA 3MPWA 2DHAA 1GXLA 4NPOA 2XGPA 5E0OA 3X3UA 3US5A 3BQ1A 2DGTA 5JVHQ 2D74B 2MKIA 3D0IE 1VQ7S 2FHJD 4ED8A 4IH7A 1NJWA 2CPZA 2OTJS 1KOHA 2NLWA 3SCKE 3MD1A 5KT6A 3PJXA 2YX1A 4QIFA 2YKOA 3HHLB 4M8LA 3V6KA 1YGYA 5E7OB 2RIJA 5KT5A 1N6QB 2XMWA 2IBKA 4KKOA 2ZFHA 1SKRA 4MYTA 4LSNB 2VUGA 2B5JB 2B4VA 1YRUA 2WCXA 3F41A 4OFZA 3KLHA 1L3VA 1NO8A 3I9ZA 1SKSA 1HHSA 5K8PA 3BJYA 2I0XA 4C3MA 3G4SS 3TAPA 2ZH4A 4DL6A 1V3RA 1HW9A 4D3GA 4M1KA 2F4VF 3G8TA 1H2TZ 4Y3CA 2PC6A 3FDSA 3WC2A 4B9TA 1U1MA 2ZNZA 2RKIB 3LH2S 1FJ7A 2GQ2A 2RRAA 2LCWA 2ZHOA 2RS8A 3QYYA 4JV2A 2R7XA 2B4OA 4CO1A 2YKNB 2DGQA 1FE0A 5DQGA 4N76A 2ZH1A 3Q22A 2R7VA 5B0CA 3CUNA 1KQKA 2EW9A 2BV3A 1IM4A 2LQBA 1JLCA 1JLEB 2UZAA 5HROB 3M2UB 1NK9A 3WZ0A 1FRHA 3NCQA 2ROGA 2DHXA 5KFPA 3FJ2A 2DHGA 1MROB 2CQ1A 2AD9A 3PV8A 1KS2A 2UV8G 3I87A 2P9EA 4ZCMA 4CTAA 2EC0A 1JXLA 4JI6F 2APOA 2DNHA 3MM9A 2RU9A 2AGOA 3H5XA 2FLNA 4RNOA 3M30A 2D9PA 2FJDB 5JUMA 3QZ8A 5J1EA 3BREA 3RRHA 2P9CA 1LXJA 3DOMA 4XDCA 4DV1F 1F0XA 4NLRA 4R5PA 1HARA 4LVNP 2ZE2A 4H4OA 1TKZB 5A8WA 4F25A 4J9LA 3SI8A 3QAUA 5J2MA 4W90B 1LK7A 3H2VE 2JZ5A 3FFIA 4CQ1A 5CCMA 3J7A1 2GV1A 4QYZJ 2XY7A 2ZH7A 1R27B 5KFIA 1DAXA 5CYMA 1RDRA 1HNIB 2WONB 1RT5B 4DLEA 4ECRA 3PZPA 1YJNS 3RR7A 1FKOA 2LU2A 2DNPA 1D8ZA 4F26A 5F9NA 3MI7X 3H25A 3DLEA 5MLCV 4BBYA 4K2XA 3SZ2A 1DTQB 1LW0B 3PRDA 4DFMA 2JOQA 4C0OC 4Q43A 1VQ6S 3A1YG 3N4WA 2IC3A 4WE1B 5G0RA 3S8SA 3OL6A 2KFNA 4ZCKA 4PRFA 4QPXA 3DRPB 3CDEA 4DFPA 3QJLA 2MY7A 3D1OA 3CC7S 4XPCA