2DNLA

Solution structure of rna binding domain in cytoplasmic polyadenylation element binding protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
GSSGSSGSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of RNA binding domain in Cytoplasmic polyadenylation element binding protein 3
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords cytoplasmic polyadenylation element binding protein 3
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnlA01
1R8HA 5IQQA 4WIIA 2MKJA 1DZ5A 2MZRA 2KRBA 2LEAA 1U1MA 1U6BA 2F9JA 2RRBA 1P1TA 4TLQA 2CQIA 3CCJS 1WF0A 5HL7Q 3MD1A 2J0QD 2KXHA 2MKCA 4Y00A 5CXTA 4C4WA 1X4HA 2DNMA 2M0GB 3VAJA 3CCQS 1HD1A 3CMAS 1X4CA 2CQ3A 2UP1A 2I38A 2DH8A 1SXLA 2D9OA 2J8AA 2KVIA 4FXVA 3VAFA 3NNAA 2GO9A 4QU7A 2CPDA 1U1LA 5EN1A 2MY7A 3UE2A 2CQHA 2DNYA 1WG5A 2DISA 2DGUA 2MKIA 4WCEQ 2NZ4A 2MZSA 2MZJA 3US5A 1DRZA 2MKSA 3VAKA 1Q7YT 1U1RA 5CA5A 1VBZA 5FJ4A 1KC8T 2PEHA 3MUMP 2CPEA 1X5OA 3CXCR 1YJWS 4YB1P 2CQDA 3U1MA 3UCUP 2XSFA 1G2EA 5DDQC 2HZCA 2MZ1A 3HHNB 3HI9A 4YUDA 3UCZP 3Q2TC 1VQ6S 2KG0A 1YTYA 1H2UX 2HVZA 1XN9A 4FXWA 2M7SA 2JVOA 1FJCA 3JB9k 5IM0B 5H1SV 1VQNS 2KU7A 1U1OA 1PGZA 2L08A 1YITS 1K9MT 1JJ2R 1QVGR 2RNEA 2DNLA 5MLCV 3DXBA 5LXYA 3BO3A 1K8AT 1SJ3P 1X4GA 3S7RA 2KRRA 1FT8A 2M88A 2DHXA 5HO4A 2X1FA 2DGXA 2HGMA 2N3LA 1DBDA 2CJKA 3CC2S 4UY8T 3LQVA 1JJHA 5LXRA 1S72S 4IO9Q 3H2VE 2DO4A 1M1KT 2CPXA 4F25A 2MGZA 2FY1A 4C0OC 5IFMA 2YH0A 2DGVA 2DK2A 2MQQA 2KM8B 2KXNB 2J76E 4WFNQ 3G8TA 1K73T 4IOCQ 4PR6A 2KYXA 2DGQA 1X4BA 5GMKa 1WEXA 2OTLS 3ULHA 3V4MA 3UD4P 4P6QA 5JVHQ 1N88A 2DH7A 3LPYA 3BS9A 1DHMA 2MSSA 4U67Q 2JX2A 4W92B 3MXHP 2KM8C 1CVJA 2JVRA 1VQMS 1AUDA 2MZTA 4WF9Q 1B7FA 2DHGA 2KHCA 2L41A 2M8DB 3VF0B 2XS2A 2X1AA 3RW7A 2J0SD 1A9NB 1U2FA 1WI6A 2GHPA 3FEYB 3MOJB 1WHWA 1OWXA 2XS7A 3IWNC 1Q82T 3G71S 3CC7S 3CUNA 3I56S 2PE8A 1VQ5S 3K0JA 5DDPC 2QA4S 2ZJPQ 3SXLA 2CPHA 3S8SA 1VC6A 2D9PA 3CCUS 2MQPA 2QFJA 1VQ8S 1X5PA 2CQ4A 2E5HA 4QPTA 2OIHA 1OPIA 1NJIT 1U6FA 2F9DA 2RRAA 2BZ2A 5DDOC 4QQBA 2MGZB 3VALA 2YKAA 2ADCA 4F26A 1U1NA 2O3DA 2G0CA 2DO0A 3G9CA 2AYMA 3L3CA 3PIPQ 1Q81T 5IM0A 2QEXS 3VAIA 4M5DB 1X4AA 1RK8A 4CQ1A 3N9UC 3UWTA 1SJRA 2DGTA 3IRWP 1L3KA 2CPZA 2DIVA 3P3DA 2DHSA 2DNPA 1WELA 3THTA 2I2YA 2KXFA 1F9FA 1WF2A 1OIAA 1URNA 1R8PA 2FPHX 3R1LA 2HGLA 4CH0S 3P6YC 2FHOB 4LMZA 3NS6A 2E5JA 1M5OC 1KOHA 1H2TZ 1WEYA 1KQSR 1N52B 3VAMA 4WKRA 2N7CA 2CPIA 1D8ZA 1U1KA 2Q79A 1WEZA 2M70A 2RVJA 2DNOA 4PKDB 2YWKA 4TU9A 1U1PA 3G4SS 4WFBQ 3CC4S 1P27B 2CQPA 2KG1A 2LQ5A 2XNRA 2ZJQQ 2X1BA 2DNNA 1UAWA 2E44A 1UFWA 3MURP 4A8XA 5ITHA 2ERRA 1W2BR 2ZJRQ 2E5IA 3MD3A 2VODA 2VOOA 2RU3A 3OW2R 3SMZA 1VQ7S 4OZ1A 3UD3P 3B4MA 1FJ7A 2D3OR 2MZQA 1ZH5A 1X0FA 1X4DA 5GAHU 1YJNS 1WHYA 2CQ1A 5BJRA 5LSOA 3RW6A 2MMYA 3J7ZT 5GADU 2MQOA 2LXIA 2CPYA 3NMRA 4PRFA 2DITA 5D78A 2MB0B 1WF1A 4IUFA 2G1DA 4ED5A 1H6KX 1SJ4P 2AYBA 1VC5A 4J5OA 2LA4A 3I55S 2G4BA 2EK1A 2LXUA 4TU8A 3CULA 2LEBA 2MJUA 1H2VZ 2RQ4A 2DNHA 1YHQS 2RQCA 2DNKA 5LJ3Y 2LYVA 4Y0FA 5D77A 5GAEU 3P49B 3THPA 3TYTA 2KFYA 1YI2S 1WTBA 2XS5A 2CPJA 4LIRA 2MQNA 1X4EA 3DLLQ 2DIUA 4CIOA 2FC9A 5DM6Q 2MXYA 1UP1A 1YJ9S 1WHXA 4CH1A 2EVZA 1PO6A 4V19X 1HA1A 3NNHA 3Q2SC 4LJMA 2DNGA 2N82B 1WHVA 1ZZFA 1FNXH 2L9WA 5DDRC 1N8RT 1RKJA 1NO8A 1ZZNA 2LECA 1A7GE 2CQ0A 2M52A 1VBYA 2WBRA 2U2FA 4EGLA 1X5TA 2OTJS 2MHNA 3EGZA 4ERDA 1FO1A 4OZ0A 3EGNA 2DB1A 5JVGQ 2VONA 1BY9A 2DHAA 2LA6A 4BS2A 3NS5A 2AYEA 2AYGA 2HYIB 2XNQA 4C7QA 3CF5Q 1M90T 2A3JA 2MQMA 3MUVP 2JWNA 2KT5A 2M4MA 2M9KA 4IOAQ 5GAGU 1VQ9S 3CPWR 3SDEA 2K3KA 2F3JA 3FEXB 4F02A 2FC8A 2OSQA 2V94A 1KD1T 1YWXA 3EX7B 2AD9A 1VQPS 1KOOA 3BO4A 2DNRA 2KH9A 1U1QA 4UQTA 1HL6A 1N54B 2VOPA 1UW4A 2HGNA 1IQTA 2KN4A 4RU2A 1M5PC 3CCLS 1O0PA 4WFAQ 3H2UB 3VAGA 2M8HA 1FJEB 1JJ4A 2YTCA 5DETA 1JMTA 3ZZZA 1SJQA 2CQBA 1WG1A 3MI7X 4QU6A 1OO0B 2M2BA 2MJNA 3VAHA 3D2WA 1S79A 2DGWA 2JRSA 4Z2XA 2CQCA 2DNQA 3B4DA 3UCGA 3CCVS 3CTRA 2OJ3A 1WG4A 2MQLA 1HD0A 2RS8A 4YOEA 1QM9A 1X5SA 3MUTP 1M5VC 1VQ4S 4ZKAA 3S01A 2OSRA 2EK6A 2BOPA 1YIJS 1VQOS 1VBXA 2LMIA 2DH9A 3NNCA 2CQGA 1FHTA 2MKKA 3J7YU 5CYJA 1D9AA 5LJ5Y 3PIOQ 3CCES 2YH1A 5GVQA 3P5TL 1VC0A 2LKZA 2MYFA 3BO2A 3R1HA 2X1GA 1FXLA 2U1AA 2DGSA 1SJFA 2CQ2A 4TU7A 3CCRS 3ZZYA 1M5KC 5LSLA 2E5GA 2RT3A 1WWHA 5DM7Q 2B0GA 2RS2A 3CMES 2ADBA 2MPUA 2XB2D 2MKHA 3U1LA 2LCWA 3G6ES 2N3OA 3G96A 1VQLS 3SDEB 3TO8A 2K8GA 2DNZA 3CCMS 1NU4A 2KI2A 3CD6S 2NLWA 2MSTA 3S6EA 3TP2A 2RUGA 3CCSS 1VQKS 2MY8A 1X4FA 3MDFA 3G8SA 3BEGB 3R27A 2SXLA 1WI8A 2CPFA 2DGOA 1QVFR 1Q86T 4W90B
chains in the Genus database with same CATH superfamily
1RBAA 2YNGB 3GG1A 1R8HA 5IT9Y 1RWUA 2BE7D 3HZGA 2BJ1A 1DY3A 1CC7A 2FJVA 2MZRA 3CIMA 3IO1A 4OQJA 4QPXA 1CLFA 2W1BA 3H4BA 1NEEA 1HW9A 2GVZA 1Y3JA 4IYQA 5KFYA 1X9WA 3DLGA 5SUHA 2B9YA 5I3UA 1ZETA 2HBYB 2V68A 3HVWA 3QFHA 1RTHB 1P1TA 1B0PA 1U09A 2KYZA 3I0RA 4Q0BA 1XR6A 1VK3A 5F9LA 2ZH3A 2EFNA 1FDBA 4Y00A 2YWFA 2UU9F 2OGUA 2H51B 1C1CB 1URRA 1X4HA 2Z2LA 2XY7A 2AJQA 3AODA 4BBYA 3A8JA 1HWLA 4Q44A 2YNHB 2XMMA 3SQOP 4RUCA 4LF5F 2CQ3A 1GMVA 2XTJP 2HURA 3V6JA 4NYPA 1APSA 4EBEA 1Q0NA 5M2UA 1IBMF 3RBZA 1JLBB 2VDHA 1ZA1B 1SXLA 1TAQA 2J8AA 4FXVA 2E9RX 4ATNA 1EKSA 1KLMB 4RZRA 1P1LA 1U1LA 1ROFA 1CS4B 2XY6A 3QO9A 3ZTRA 1ITPA 5EN1A 2WCXA 2NREA 2NCKL 2ZDPA 3F0NA 4OV6A 5GAGI 2F8EX 4O44B 2N4DA 3PFEA 1TL1A 1FKPA 1Q8KA 2Q6CA 2XEXA 2NPIA 3D4JA 4OLPA 3TR5A 5BYSA 3VAKA 1S9FA 1NK8A 5FJ4A 2VL1A 1FD8A 5KFKA 1KC8T 4PQUB 1NSPA 3LANA 1YDLA 2DY1A 4IRCA 3UCUP 5KT2A 2DXEA 5DDQC 1K0TA 3HHNB 4P2MA 1H7WA 3VZIA 3D7SB 4MIBA 3NGRA 4C0BA 4EK2A 4O4RA 4YUDA 1JKHB 2O1PA 3UCZP 3Q89A 1RQ0A 3BGFA 3DLKB 3Q2TC 1RU1A 1YTYA 1S6QB 3EVMA 2HZVA 2LDYA 1FNOA 2YQ1A 4K8RA 3JB9k 4G65A 3GTYX 5H1SV 2D3UA 3QGPA 4NLOA 1F2HA 5KOWA 1VQNS 2W9CA 1IUJA 2BJDA 1VCTA 1U1OA 4ELUA 4Q2LA 4M5JA 5CYMB 2OPRB 3R5CA 4A4JA 1YITS 1PGZA 1FTCA 3LO3A 4OZ3A 2Z2YB 4PYDA 1HBUA 1TFWA 2MEWA 4USWA 2ZM6J 1MMLA 1XNRJ 2VFSA 3DXBA 5LXYA 4GMKA 3PW0A 1HNVA 1D0EA 4MMOA 3FCHA 3S7RA 3JYTB 5E33A 2PFFB 4QJVA 4JI6J 2AX0A 4KB7A 4W92B 4RNOA 2GIQA 2X1FA 2QRRA 1IKVB 2HGMA 2N3LA 3CE8A 2CJKA 5B0FA 4DG1B 3CC2S 2JEFA 2VU5A 1F2GA 8ATCB 4C8LA 1YSJA 4DL0C 2BW7A 1UFLA 3DCAA 4NYOA 1G6BA 1D9DA 5JUMA 4IFYA 4NLVA 4OFZA 3RG6A 3DNCA 3AJ2A 3S1TA 1RAJA 4Q45A 2FY1A 3DLGB 4P2SA 3W66A 1T9UA 4CLPA 6FDRA 3DRRA 2EKYA 3M30B 1RXOB 4BLGA 2DEIA 2VBXA 4WFNQ 4IFVA 2O66A 3HFVA 3WDOA 3AA9A 2G0IA 3TUJC 3TX8A 1R6VA 3QFWA 5EWGA 1UVJA 2XYHB 4TKTA 2CRLA 3HSGA 4FKXA 4M5GA 4O23A 1U49A 3HF5A 3SI8A 2L9NA 1G4CA 3M6UA 4ETXA 5E3QA 4QWAA 4K4YA 2VFUA 3T5KA 2HVIA 3A8KA 3ISNC 2ACYA 7FDRA 4Y28C 3TEGA 4C97A 3DMJB 4KHRA 3HULA 2OPPB 1S5ZA 1GEHA 1UVIA 4QCLA 2BABA 4BC7A 3I9V9 1FK9B 1FEEA 3M8PA 1R0CB 3MPUB 3R9LA 4DCPB 2IFXA 1I3OB 4DUYJ 1B3TA 2VBZA 2B4UA 3LPYA 3M6WA 4OHXA 4LFAF 4R0JA 1UWBB 3OL9A 2MSSA 2RU9A 5JXSA 4GRSA 5CD4H 4DPTA 3VGUA 1RLDA 1S59A 1S9EB 1T02A 3OFGA 3I0SB 4UZCA 2UUAJ 4C8OA 4F4ZA 1YBUA 2CADA 2V67A 2XHCA 1AUDA 2MZTA 3PRBA 2DHGA 4GVBA 4YS2A 2KHCA 3C6UB 3I0RB 2IMWP 2XS2A 2X1AA 4KGXB 1BWVA 2EG2A 2KHDA 1A9NB 5C42A 1C1CA 2GHPA 3FEYB 2VC0A 4FYWB 1FVQA 2JC0A 1OWXA 1ELOA 3EDQB 4ZITA 1SCJB 1FWLA 3PYEA 4ZMMA 5KFWA 2OFHX 4KFBB 3JSMA 2PE8A 4L75A 3RRHA 4UW2A 5DDPC 3EYZA 1OPZA 3D6MB 1RDRA 2R8GA 1FFSB 3E01A 4YDXA 4KO0B 3OTEA 1TL7A 1TR0A 3CJ8A 4DV4J 2PDAA 4K59A 1VIXA 3JSRA 3GV8B 1P9QC 3R5AA 2HHUA 3CJKA 2YKQA 2MQPA 1BQXA 1RT7A 3MPVA 3R3TA 3BBCA 3OFEA 1FDNA 3M8QB 3V6HA 5F8LA 3ILIA 3M8WA 5F3ZA 3AXKA 4N47A 2HHXA 5HSPA 2E29A 2VBYA 1S1TB 3BGRB 3ZXWA 2XLJA 3MECA 2F9DA 2JZ5A 1G7CB 3NAIA 1F5CA 1S7HA 2QO3A 2X3GA 3EWGA 1PYTA 4OYMA 4A8MP 1HNXF 1NKEA 1I94F 4NX9A 4QYZK 4QQBA 1U0SA 3H8YA 2OEKA 3VALA 5J2PA 2IRXA 1XQIA 1PILA 1IKWA 4M5HA 2XMVA 4DL3A 2B8PA 3RR7A 2G0CA 2DO0A 3IFEA 2PMHA 2VFTA 3TUPA 3ILOA 3LW5C 1YJ9S 4WYLA 3LTOA 3RRGA 1EETA 1WKKA 2BJ7A 1LWEB 2KDOA 3U27A 3G6XA 4H4OB 1Q81T 2QEXS 3VAIA 1SL2A 4OYXA 1JLGB 3KDOA 1X4AA 3OTDA 2PD1A 4RW7A 3KG0A 1SKWA 4ZVGA 4KPCA 3ZTQA 2W4DA 2V9KA 4QIEA 2VD3A 3UWTA 1UEKA 4RW8A 1R6YA 1SJRA 4PG4A 2DGTA 3M2UA 2PFDA 5K14A 1TKTA 1RACB 2HIYA 4Z7YA 1FDAA 3KK1B 1IBMJ 4LF4J 3FQLA 1HKAA 2QZ8A 2QX0A 5ETTA 1UEUA 3M9OB 4JI8F 3KLEA 3OR2A 3T5HA 2VQFF 1F9FA 3NAHA 1YKWA 3BGOP 2HVDA 5KFZA 3CSKA 5HMXA 4LF5J 4CH0S 3MEEB 2WVFA 2A10A 2IAJA 5ETKA 5G0RB 4J9NA 3EUNA 1WJ9A 1LW0A 1M5OC 3OV7A 3RB6A 1H2TZ 2F40A 3TAPA 1N52B 1PBUA 3KUHA 3A1YG 3EMTA 3CDWA 1FD2A 2NYIA 1OYEA 1Z2ZA 4WP3A 5B08A 2N7CA 1NBEB 2ZD1A 4PG5A 5G4DA 2ZC3A 3NWRA 3OSNA 3CDEA 2ZNYA 5F8NA 1DQ8A 1MU2A 3NXZA 4DQQA 4CLUA 3BGUA 1I94J 3FVYA 2F63A 2HFUA 2QSWA 3PHTA 3J7A1 2XCAA 4IFVB 3CMQA 2FD2A 3M2RA 3BYRA 1OQ3A 5E3CA 1Q7LB 2CQPA 1FRMA 2V50A 3IS9A 2LQ5A 4KGMA 2DR6A 2X1BA 1UAWA 2AF6A 3BF4A 4NMXA 1C2PA 3N01A 5EX3A 2V2VA 3MURP 1ACMB 4RNHA 4ID8A 3W60A 1QSYA 4P10A 1JX4A 2ZJRQ 4GO5X 1T05B 2DXFA 4C8ZA 4UOGA 3WZ0A 4ALZA 2ZM6F 3QMQA 1XNRF 2XLKA 2VOOA 4CTAA 1RWXB 1SQEA 3FC9A 4CNYA 2WSCC 3CCTA 3C19A 5FD1A 4FYVB 4KAIA 3KLIB 2H3EB 1IM4A 4ZPDA 3TUZC 4RUAA 4JI8J 4DL6A 3I0SA 4RU9A 2D3OR 1EP4B 1ZH5A 4DR4F 4DR1F 1EKRA 4NA3A 3LAKA 4CWBA 5GAHU 4IH5A 4TQSA 2WOMA 2IM1A 2C42A 3DOLB 2GJIA 3I5AA 4O4GB 3RYLA 3A4TA 1VHIA 1VJQA 5DQGA 3QQCD 2CQ1A 4URQU 5BJRA 5K8MA 5HP1A 2MMYA 4B9TA 3NCPA 1SKSA 2J9DA 5GADU 2F8MA 2R7SA 5F8MA 4TVAB 1CJUA 2X3DA 3MAAB 1I6JA 2I6WA 4ZVUB 4PRFA 1XMQJ 1Q4RA 1Z4UA 5D78A 3UDLA 3K5MA 5HJYA 3JXOA 5ETLA 2MB0B 5D3GB 3AB4B 5KTQA 4IUFA 1XNQF 2E9ZA 3SYZA 4OYIA 4X4PA 1VC5A 3I6PA 1HYSB 1N33J 3JTOA 3IM9A 3BQ0A 3RAMA 1S1UB 3R8YA 3GIJA 2EK1A 4B3MJ 3O5TB 1RT7B 2K7JA 2XO6A 3JQMA 3BR8A 4NI2A 2HAFA 3HHEA 2IC3A 1A0OB 5A76A 2LEBA 3D9BA 4MYUA 4ZVRB 2RQ4A 1H2VZ 3ZZ0A 1S1WB 3IN5A 1RTIA 3WC0A 2DNHA 2ZWOA 2RQCA 4QIVA 4UT4A 3A3NB 4FF4A 4ZVSB 1QUVA 4FN5A 3D5MA 1ZAVA 3THPA 1JLEB 3TYTA 4DEZA 1SC4B 4RWXA 3E51A 3V81B 5HQMA 2ZH2A 3B6BA 4ICLA 4J91A 4KJIA 2FIUA 2DIUA 2ILYA 3PTWA 4CO4A 3SCLE 4ES3A 2FC9A 5DM6Q 4CCHA 3R5BA 4IQXA 1A6LA 3BGLA 2DPJA 2WAQD 2EVZA 2W2QP 4LIWA 2HQCA 5H9EJ 4V19J 3MCNA 3MM8A 3HFZB 2V4JB 3Q2SC 4E0DA 5AXNA 5L1JA 1AFJA 3MM7A 4LR7A 1C4CA 2N82B 2XSJB 4R8UA 1Y00A 2ASLA 2GGPA 4IR1A 2NXNA 2NQPA 4HACB 3M2UB 3FRZA 3MMCA 4I2QA 2L9WA 2W9CB 1LK5A 1YX2A 2RQKA 3POTA 4URSA 5B0GA 2BRLA 1Q8LA 4RNMA 2V4QA 1RKJA 1TK8A 2V69A 2LECA 4FBUA 1A7GE 4GVLA 2WBRA 2U2FA 2VZ9A 3J81Y 1X5TA 3IA0A 2O01C 4RUHA 1HQEA 4A8WA 2GIFA 1FO1A 3EGZA 3KLIA 4DUZJ 5GADI 2QE5A 3MHYA 2DB1A 4WPAA 5J1EA 3M2VB 4MK8A 3W8PA 1BY9A 3OLBA 1GT8A 1ZAXA 2CVEA 4ECYA 4C0HA 2V2QA 2C1EB 2A1BA 3CJ4A 3FFIB 4OYZA 2G9OA 2GA7A 3IWLA 1NNDA 2LQ8A 1SV5B 3HPOA 3MGJA 4TQRA 3VQSA 2YWWA 3J7Z5 2KT5A 4DQRA 4O3SA 1NPPA 1RZMA 2OPSA 4HI1A 1FKOB 3QT5A 4PXEA 5I3PA 2M9KA 5E5NA 2CJQA 3DLKA 2G1HA 2A18A 4QWBA 5LM7E 1XJWB 4IFYB 3GU0A 4L73A 3SDEA 3ITHB 2YNIA 3GLJA 3KLGA 4TYBA 4M95A 2C2OB 2QTWA 5D3GA 4F02A 2V94A 2G2YA 3EXCX 4DZDA 2XI2A 3K8VA 4XK8C 1VS3A 3PYDA 1VQPS 4BDPA 4OLOA 3OT9A 2AGQA 1SL0A 4B9MA 3H5XA 5C2CA 2Y3YA 4IDKB 2IJNA 2J0XA 2HGNA 2B4PA 4DCOB 3ZZTA 2G2ZA 1M5PC 3CCLS 1TMMA 4ZN1A 1KP6A 4NYZA 5KFVA 2E7WA 2QLJB 1S49A 2LQBA 3GFZA 1RA7A 1TL5A 1RHMB 1S0NA 1IKVA 4FF3A 2Z4PA 2KZZA 2BKNA 2CQBA 1HBMB 3CDUA 2ZUGA 1LFPA 4YB5A 1S48A 1HNWJ 2XLIA 1S79A 3KFWX 3VWSA 3RB0A 5A8RA 2K06A 2CNLB 1DQAA 2CFXA 3GONA 2C2ZB 2RHQB 3CCVS 1JXLA 4ED3A 2OJ3A 4BHQA 4CT9A 4L74A 4ZLPA 3LOUA 1HD0A 1ZBTA 3I31A 3LA0A 4OHWA 1CSJA 4OYPA 3JSYA 2BRKA 2KVQE 4TY8B 3MUTP 4MT1A 1VQ4S 1YRTA 2EK6A 5SZTA 2BOPA 4HTJA 1HWKA 4WYWA 1IKXB 1YIJS 1VBXA 3UD5A 3W5XA 2DH9A 1J5OA 1CBKA 1VRTB 2MTLA 1SH2A 3Q86A 3M6XA 2R42A 4EO8A 1CJTB 2HHTA 1FHTA 2MKKA 5JMNA 1Q5VA 2IJRA 1RLCL 1VBKA 1D9AA 2NPFA 3PIOQ 1S0OA 3C16A 2EXUA 2YH1A 3P5TL 2Z2ZA 1LWFA 1VFJA 4FF1A 3WIUA 1EHWA 4FVMA 2U1AA 3NGSA 2ILZA 3E8OA 4F2SA 1MMDA 2CAJA 4FYYB 4TU7A 4K4XA 3ZZYA 3R2CJ 5LSLA 4R0EA 2E5GA 2GHVC 2ZH1A 1HQEB 1SUQA 1PIEA 2B0GA 2L48A 3QNWB 4MFBB 2HMIA 4ZCLA 2HFVA 1FRKA 4GKKF 2ADBA 5C7PA 2ZH8A 4OL8A 2XB2D 4O0IA 3C8YA 3FSXA 4B9SA 2FJEB 2ZH9A 1RWMB 2RDIA 2XWYA 3DRYA 1AYEA 3T1AA 3TW0A 5K8OA 3QSYB 3TAQA 1XMOJ 1NH8A 4LSLB 4OI0A 2UXBJ 4CYUA 1FVSA 1NB2A 1SQGA 2OLWA 3OXGA 3SDEB 3OJUA 1NU4A 4NOHA 2KI2A 4OYWA 4WZMA 2Y1RI 3C15A 3WC2A 2J8SA 1WC3A 3CCSS 2DTJA 3DRXA 4DU8A 3G2XA 5KFNA 4EBCA 3NY0A 5L1LA 4H4OA 2NXEA 1S6UA 4PXDA 2P6SA 4LRCA 2CDRB 4ZVFA 4A8SA 2BR0A 1C0UA 1GXLA 2DYAA 2LU2A 2CPFA 5CYQA 2UV8A 3K5LA 4ZPBA 2R2SA 4CLSA 1YJ7A 1RTHA 4OHYA 1RABB 3IGNA 1MNEA 4F0HA 1DZ5A 2LEAA 4JB8B 1HLWA 3TANA 4YR0A 2R7XA 4M5DA 2DRDA 3T1HF 3LPEA 3MAHA 3IXQA 1CJVA 4K7QA 4P75A 3ZZOA 1XMOF 1U6BA 1S1TA 2F9JA 2HWHA 3MECB 3W9HA 4F36A 2CQIA 3QRRA 1YGYA 3BN4A 1N34J 1YBTA 1X0PA 5A8RB 3ZZPA 2HS3A 4C4WA 2XCPA 3HXMA 5DQIA 2ROPA 4UOFA 5F41A 3MR3A 5G0RA 3WX8A 2R7RA 1HBMA 1IM6A 1LKZA 4ED7A 3PYGA 1HD1A 3SV4A 3CMAS 1X4CA 1LW0B 1RA6A 2MKYA 1SC1B 3D6FB 3L4BC 5MAOA 5C5JA 1N48A 4DQPA 2XO7A 4KR0B 1XBWA 2IMOA 2YBVA 3UFCX 5IWAJ 1N32J 3N6NA 1X9SA 2UXBF 2J9DE 5D15A 4LF8J 2ZNZA 3IC1A 1OSDA 2P9CA 1JXEA 1T9WA 4LFCJ 3LP0B 2IVMA 4LSNB 1C1BB 2BXJA 3H5UA 4WWSA 1N0VC 4UZBA 4N56A 1RISA 1U0HA 2DISA 3LGMA 2MKIA 1UA1A 1Y9OA 1J2VA 1W2IA 2C2KB 2MZJA 2JHEA 3M2RB 4YHHF 2MKSA 4X66F 2BANB 1H74A 3W8GA 1U1RA 3VVTA 1Q7YT 1J27A 1WD6A 2E1PA 1FCAA 3IGVA 4NRUA 1VBZA 1N36J 2FJDB 2PEHA 1D8YA 3Q8VA 4HI2A 1FERA 4ZCKA 3PJXA 1ICEB 1RAIB 5A8WB 2AJ1A 5A2QY 2VKZG 3TZZA 2CJ9A 4K2XA 1UVLA 5J1PA 2VASA 1QE1B 3M8SA 2WRMA 3EZUA 2R2TA 1VQ6S 3NEKA 2KG0A 3AA8A 2AHOB 2B3TB 2HVZA 4FKYA 3LAMA 5DO2A 1N32F 4GC7A 5C25A 4FXWA 5CABA 2V4RA 3GFXA 1LQ9A 4FVCA 3TAMA 1TUVA 3W62A 3J7AN 4DR1J 2Q43A 4B3OA 1R89A 3RUBL 3NCQA 3JYTA 4NCGA 7FD1A 3RB3A 1IR1A 2A2CA 1F5AA 2AEFA 2AWZA 2CWXA 2L08A 4P2XA 1JJ2R 2DRAA 1ZOTA 1CJKB 1Q8BA 1NH7A 2CZ4A 3D54A 2HFNA 8AT1B 5L39A 5LT5A 3GILA 1QVGR 2XM3A 3TWZA 3L09A 5MLCV 1VRQC 2G0JA 1VQSA 3CJRA 2I0XA 3ZZUA 2E1CA 1SJ3P 1GXTA 1GTEA 1RT4A 2YWGA 2IVFB 5ETVA 3TQ1A 1MROA 1FT8A 4GKJJ 2V8GA 2ASDA 3DOLA 4O4GA 2CZVC 5HANA 2CJBA 4C98A 3LGNA 5HO4A 4HYKA 3TUIC 3R2DJ 4X4UA 1BC6A 1DBDA 1GFWB 1GQEA 3CO9A 1HI0P 2Z8QA 3FEZA 5C24B 2CJAA 5DRKA 4PG8A 3Q8QB 1S72S 3LP2B 2GHWA 3H2VE 3H90A 3D6HB 1M1KT 3B82A 4RNFA 3F41A 2P8IA 1F9HA 4ZVEA 2QN6B 2FVQA 2UUCF 4C0OC 2EBEA 3W2VB 1M1HA 2YH0A 4I64A 3MPWA 3IBCB 1XTZA 1LNQA 2ATCB 2NXUA 3MF5A 2MQQA 2KXNB 2H5JB 2NYHA 1HNZF 4K5RA 2EI5A 2COLA 3QLHA 2HRTA 4X4TA 1T0TV 1S76D 2FVPA 3OXFA 2GZOA 4PPDA 4U7CA 2G13A 3T1YJ 1S9EA 1HNWF 1TAUA 4AL6A 4ER8A 4ZVOB 3V81A 2ZZNA 2FVSA 3C66A 2WB1D 3OR1A 3ZZRA 4AT1B 3J81j 2D74B 1RT1B 1T3NA 2ALYB 4QR1A 4Y34A 1D1UA 1TVRA 1JLCB 4NA1A 1PCAA 3KDNA 3ULHA 4UY85 1XR7A 1BGXT 3DGPB 4ZDNA 4K4TA 1F3FA 5ETMA 2UUBJ 4LSNA 1N88A 1X7VA 4XO0A 4MJKA 3CNQP 4JV1A 1RAGB 4YR2A 4Q8EA 2LQ9A 1HWIA 4JV5F 3PO5A 3MXHP 3O8WA 2HBQB 2IM3A 4OZLA 3MM8B 1WOSA 5DLGA 1ZM2A 2JVRA 2RSQA 3DLJA 5DZ7A 1VQMS 3ENQA 2J5AA 2HNDB 2XSJA 3NLCA 1B7FA 3FMWA 2EEYA 3FCVA 4O3QA 3GZ7A 1IKYB 1UJ4A 1T03A 4OI2A 5HBMA 3M8ZA 2RE1A 4LF1A 2ZZMA 5HMWA 1U2FA 3KJNB 1S97A 1P6TA 1WHWA 2RF2B 4RO0A 3V5RA 2XS7A 2B9WA 3IWNC 2W4CA 3L7PA 4C8YA 5THWA 5KFRA 2GAGC 3TJ9A 3FFIA 4CO3A 5IZHA 3G71S 5L1KA 4MK9A 2DR8A 2HBZB 3NGDA 2V63A 2QA4S 3K0JA 4F50A 1Q1KA 3GJTB 3GYXB 3SXLA 2W4PA 3DU6A 3QGGA 4ID5A 1EX8A 2CPHA 2ZOMA 2ZITA 2YNGA 3MM5B 3KYLA 3MM7B 3T9NA 3IWXA 3EM1A 4DPWA 2QFJA 2XMJA 1U8WA 3VV2B 3ITHA 3R5DA 1VQ8S 4J9OA 5T14A 3G6VA 2CQ4A 2E5HA 4HR2A 5BR8J 1DTTA 3M9MB 1K1QA 4LF6J 4EFAC 2OIHA 3I5CA 1OPIA 3NP5A 1DAXA 4WE1A 5K8NA 4WFZA 4IG0A 2QLXA 3GE9A 2W8KA 4ZLLA 2C3MA 2BZ2A 1LWEA 4LREA 1L3TA 1WOPA 2QJ3A 3BDPA 5GMEA 5L46A 5DDOC 3I96A 3PFOA 3FQKA 1FXRA 4RNNA 3MR2A 3HT3A 4CH7A 3VGTA 4F26A 1U1NA 2HFOA 4ECSA 1KVIA 3H42A 2DCLA 4FS2A 1NZ8A 2MQ8A 3G9CA 4FYDA 2B51A 1HARA 1JNZB 1Q16B 1C0TA 1U2CA 5IC6B 3PIPQ 3K5NA 4K50A 4OJHA 1TKXB 3AJDA 2IDLA 2YX1A 1MG7A 4NZ6A 2NSCA 2AJ2A 3BB5A 4ES2A 3D28A 2HNZA 3LP1A 2GFFA 3MCMA 2PMWA 5DETA 4CQ1A 1SH3A 1HHQA 2HLTA 4M5KA 4A46A 1N56A 3LH2S 2A6MA 3BV8A 4RJVA 1NJWA 4F2RA 4WU3A 1JXVA 3M1VA 2DT9A 5D8HB 4LF6F 5F8IA 1FKPB 4P74A 1RWKB 3MM9B 2DIVA 2EC0A 3P3DA 3CJ5A 1DJ0A 2AGOA 4OYOA 2X51A 5KFIA 2DNPA 3DYAB 4UF4A 4WTOB 5J2QB 2I2YA 1NMEB 3MMAB 4AUKA 3KTQA 2IBOA 3CVKA 2UV8G 5HLFB 2F8HA 4DR5J 1TKDA 1URNA 4Q0BB 2FPHX 3PG9A 2HGLA 3P6YC 3NKYA 4HT7A 5KFCA 2UU9J 3QBCA 2GW8A 4PAAA 1VRUA 3PV8A 5HQ8A 2M3DA 3NS6A 1IBCB 4YFUA 7AT1B 1KOHA 2RIJA 4HHJA 1KQSR 3VAMA 2ACMA 1VOMA 3KLHA 1QTMA 3I4PA 1OY8A 5HBMB 3RBEA 4ZVTB 1KNZA 4K4ZA 2Q79A 1YG0A 3IS9B 4LRBA 3Q8SB 2CG4A 5IT4A 2BYCA 2HNDA 4YEAA 3K5OA 1WC0A 4JBCA 2PGCA 2M70A 4KKOB 2WVDA 4ZS6A 1NJXA 3CD0A 2HHHF 2BX6A 1NSAA 1FF2A 1OYDA 3G4SS 1T05A 3CC4S 1DLOA 2BJEA 4ZLNA 3KXDA 3E3XA 5FIIA 4ZIWA 4YB6A 1NK5A 2BJ8A 1RADB 2XNRA 1WORA 2P9EA 3MEDA 4OZNA 4OI4A 1UFWA 3UO0A 4C3KA 3BZQA 1JLCA 4G1QA 2PI5A 1W2BR 1LWXA 2KT2A 3CJ3A 4DDFA 4ID5B 3TVKA 3ZTSA 4P71A 3DDNA 3K8WA 3AD7C 3OW2R 3BSCA 3OUYA 1WNEA 3SMZA 3M32A 4B3TF 3DLEA 3GMGA 3I9ZA 1HMVA 1T11A 5LOQA 2GO8A 5DG8A 3UD3P 4JI1F 2UXCF 3KLFB 2MZQA 2QFIA 5T41A 3W65A 3QJJA 4HL9A 1X4DA 2JLEA 1U24A 2H5IB 1YJNS 1QD1A 3SCIE 2XY5A 1IKYA 1WHYA 3IR7B 3T41A 5LSOA 2VQEJ 1T9YA 4PZVA 5D0EA 3PW4A 1LFWA 3T6BA 3PXGa 4LF7F 4H4MB 4WK3A 4Y3CA 1S10A 4JI5F 1JLAA 3DRPA 4RX6A 1U6ZA 2DITA 1N34F 5H9EK 3SSQA 1C0TB 4B3RF 3GFHA 4DF8A 2AW0A 4AXIA 4AYBD 1B70B 1DARA 2G1DA 4LSZB 4P72A 5J2NB 3GV7B 2AYBA 4USIA 1VISA 1MWQA 2ZBIA 3W5ZA 1IWAA 4IR9A 3VZHA 2AP6A 3LWMA 3BJYA 1ZYQA 2Q3PA 3QYYA 2DR5A 5HN0A 3IM8A 3I55S 2RQMA 4ED4A 3CT9A 3FCWA 2C2RA 3CULA 3RTVA 2HWTA 1KVKA 1JLEA 2HQDA 2AEJA 3LALA 4DSEA 1PJ7A 3N0VA 3PY8A 2XMAA 3J81U 4KT0C 1T3OA 2C2EA 1TL4A 3NGTA 3H20A 2DNKA 2X7IA 3U1NA 5RUBA 4DR6J 2UUBF 1JK9B 1OY9A 2XMKA 4HT5A 3Q8PB 1ZA2B 2C3OA 3AD8C 5GAEU 4J9MA 2CZ9A 1T8EA 1IR2A 2GJ2A 2IYGA 3NG8A 3NGKA 5KFQA 2XS5A 4E2FB 4LF9J 3R6GB 1HBNA 2LVWA 3DLLQ 4DU7A 1KKHA 1F60B 3KWMA 2OP5A 3MMCB 4CH1A 1VMBA 1R0AA 4N76A 2K3IA 5KT4A 1PO6A 2K1RB 4V19X 2VDIA 1HA1A 2H65B 4I7FA 3NNHA 2VC1A 1MSWD 3HT0A 3AH6A 3DLBA 3R97A 3OD2A 4GVBB 4PG7A 3I82A 2JLFA 4B08A 1FNXH 1FWKA 3AHPA 4DS4A 3T3FA 1O6XA 2YQ3A 2BVZA 3BGRA 2ZKTA 4HDGA 4Y2AA 1NO8A 2JDJA 1YJRA 5F0WA 3BSOA 1G1XA 1KEKA 4C8NA 4X65J 1PC5A 2ASYA 1BQNA 2GJFA 4U8YA 1S1XB 2OMLA 4ENOA 5KFSA 4LUBA 2MHNA 4ERDA 5HJXA 2OTJS 5ETPA 1U0HB 3EGNA 4DR2J 4QIGA 2L3MA 3HSJA 2BV3A 3F56A 4USMA 3BM7A 3CW2C 1IKWB 1SQFA 1TL7B 4LF9F 4LQ3A 1EZZB 1WC4A 2AYEA 3D68A 4ZVQB 1O51A 4KFBA 3A3OB 3UR0A 5CD4A 3JSMB 2IRYA 4LVNP 1ZM9A 2GMLA 2NXJA 3CF5Q 2PMZD 1M90T 3E01B 2MQMA 2VG5B 4ITSA 3GYNA 2BM1A 1RT5B 1T95A 2DCUB 2AJ0A 3GCXP 3CPWR 1V3ZA 1VQ9S 3HHLB 4F8RA 2VPZB 3OVSA 4I2PB 4UTGA 2FC8A 5HATA 2AIRB 2OSQA 1SV5A 3MR6A 1YWXA 4KE5A 4C11B 1NB7A 2AD9A 1N5YA 3K59A 2GVDB 4UOCA 2R7QA 1W25A 8RUCA 2KH9A 1V6HA 1I5OB 2EFOA 3NMAA 1RSCA 1TELA 4ZP9A 4CO5A 3WIVA 1NXIA 1UW4A 3CD7A 4KGKA 2J7KA 1IQTA 4KBIA 1WC5A 3H98A 2UXDF 3UVJA 4DPOA 2POKA 3JS9A 5I42B 3QWUA 3FSIA 2AQ4A 1R8AA 1Y5NB 3P5BP 4OZ5A 3LF0A 3PJWA 2VJUA 1KHWA 2HVEA 2J9CA 1UPPA 2H5EA 2RH3A 3ET6A 4PG6A 5CQGA 5LMUJ 2M8HA 1RE1B 2GMJA 3PKMA 2BE2A 3O1LA 2GVZB 3DN9A 2FLNA 4I0WA 4XTTA 4UUWA 3CDAA 4M1KA 1WG1A 2E1AA 4DPYA 2J6TA 5C24A 3AOBA 1UFKA 2FZGB 4MYTA 1NJZA 5AE1A 2XC9A 2FLOA 3L7OA 4IKAA 1VRTA 2DGWA 2JRSA 3HHDA 3B4DA 1UJ5A 3UCGA 4Z2XA 5A8KA 1AW0A 3CTRA 3SIPB 4OX9J 3MM6A 3EICA 1QM9A 1X5SA 2WONA 3CJTA 3OBIA 4KIAA 1M5VC 4B9UA 1RKIA 3PDNA 1KFDA 4ANDA 3PM9A 5KT6A 1RBOB 4OZJA 2LMIA 2ZOGA 4DQSA 2FZCB 1TP7A 3BH6B 4I56A 3FBEA 2AX1A 2VB6A 2YKMB 4V1Ak 4XAKA 2EFPA 5CZVA 5CZXA 2YKOA 1KN6A 3P96A 1MWYA 1H7XA 4LFAJ 3VVUA 5CYJA 1Q79A 4Q5VA 4FP9A 3IP0A 1IBKF 1HHTP 3RZAA 3MOZA 1EARA 4MKAA 3QGHA 2LKZA 4DCJB 4G3IA 1RT2B 2C2NA 2CNKB 1OJ4A 5HROB 3HJFA 1J5OB 1FXLA 3L9ZA 1RHUB 3I87A 2R4FA 2RF2A 1WC6A 4MK7A 3V4IA 1FKAF 4NXNF 4ZVHA 2KJWA 4TY8A 4NRTA 4TY9A 2R8KA 2WOMB 1X60A 1TK0A 2F7VA 5AJ3F 1WWHA 2VIHA 2FVCA 2RS2A 1ZM3A 3X3UA 4F0KA 3AFGA 4PYAA 4YMEA 3SQGB 1N6QB 2GC8A 1RTJA 4F4YA 2LCWA 3G6ES 2N3OA 4Q7AA 4X4OA 1JB0C 5KFEA 4RW4A 1KVJA 4CTAB 1S9GA 2YWEA 2HW3A 1YJUA 2DNZA 1SUQB 4I2PA 4CLYA 3TI0A 4BWJA 4KQZA 3JAMU 1KLNA 1FRHA 4I6WA 6AT1B 4OV1A 1D3WA 3TP2A 3GIIA 5D4PA 4OYAA 2Q66A 5KFFA 2QL5B 1NK9A 1GMUA 1VQKS 4DV2F 2MY8A 5KFBA 1NSKL 3DI6A 3FDSA 3QRPA 5U47A 2IRUA 3BEGB 3DOMA 1JWWA 1H98A 2VUGA 1WI8A 1CJVB 1NHKL 3LP1B 1DTQB 5KG6A 4RLEA 1Q86T 1RTDB 5I42A 2D1CA 3AQPA 3M8RA 1RAAB 2BE9B 2DRBA 1DFDA 3MAAA 4MH8A 4O3RA 1TFYA 3LUYA 3DM2B 3V6DB 4NEZA 2RHSB 4ETZA 3Q83A 2MKJA 1YZ6A 1QTNB 4B02A 3GQCA 3FRYA 2R7OA 4ED0A 4Y2KA 4DG1A 5ETQA 3MFHA 1WSRA 4UQGA 1U1MA 2VG6B 4NMLA 4DV6J 3N4WA 1CEZA 3RBDA 1S6OA 4HTIA 3H59A 2HHWA 4TLQA 1NSQA 1WF0A 3W64A 3PNIA 2YVSA 3W2WB 1VHFA 2D3ZA 2KXHA 4WFXA 1WKJA 5CXTA 4A8FA 3KK2A 3DOKB 2IC3B 2BM0A 2N7YA 1CPZA 1ULRA 2VG5A 1EIYB 1T9VA 3KKFA 4IG3B 2UP1A 4XIUA 1DURA 2FUG9 2I38A 4LR9A 5HLFA 2QA2A 2B8QA 1U47A 2ZE2B 2V2KA 2DH8A 3PVXA 3KJFB 2Y1JA 3M05A 2D9OA 2KVIA 3VAFA 1AUSL 2OPPA 2QLBB 4LFBJ 1SKUB 2CPDA 4W98A 1RCOB 1VYAA 3VGVA 4ICLB 4WK1A 4FS1A 4DXLA 2MY7A 2JEJA 3T9ZA 2DNYA 1WG5A 1TKZB 2W9BA 2ZH4A 4ED2A 3IBFB 3MEGA 4KYZA 4CLLA 4WCEQ 2MZSA 2NZ4A 1U25A 2AJ4A 3US5A 1HHSA 4RBVA 2NR0A 2UZAA 4DV2J 3MCSA 3KNGA 5B7WA 3TQEA 4CNZA 3MUMP 2F4VJ 2CPEA 3CXCR 1BE4A 4ZIVA 1GMWA 4DV7J 1G2EA 2WW4A 2XSFA 5LSRA 2HZCA 3ET6B 1Y3KA 3BPSP 2I5JB 3A8IA 1WC1A 2HPUA 3ADAC 3HI9A 4L3NA 5KFOA 4B3OB 2FHKA 1ZTWA 1FKOA 2V4JA 3N5FA 3G82B 3IBWA 3RGIA 4ED1A 1TK5A 1H2UX 4CI0B 4FPRA 1C1BA 1SIZA 2QA1A 2ZKUA 3KLGB 1L3UA 2IJFA 2HFSA 2GGPB 2M7SA 3D3CJ 3NOCA 4P7TA 3BSAA 5CCLA 1U45A 4DSJA 1FJCA 4JI1J 4CLTA 3D3BJ 1V9OA 2WW8A 3JQKA 1QE1A 2IVYA 1HBOB 1ZPVA 3EZ5A 3M2VA 2KU7A 1Q8IA 2WBMA 1GXUA 3D0HE 9ATCB 4QYZJ 3ZTOA 1VLYA 1FE4A 3TOQA 3HSZA 3CJKB 2KFZA 3QZ8A 4OJGA 1KRPA 3DOMB 3I32A 4ED8A 2RNEA 2DNLA 4KO0A 5DGBA 2GQCA 2Y8WA 2BDPA 3HKZD 5F8JA 3P4UB 5J1EB 3BO3A 1DTQA 4JI2F 2F4VF 1X4GA 3OTCA 3EVOA 1Y11A 2KRRA 5FLXU 4IOBA 5FDLA 2M88A 2DHXA 4F67A 3H40A 2CVIA 3QIPB 4DSLA 2DGXA 3CO0P 3FZ2A 4X62F 3AXMA 3RR8A 1H3DA 2H54B 4Z7CA 1K47A 3LQVA 4PWWA 2AT1B 4XDDA 4J9LA 1JJHA 1RT1A 2HS0A 5LXRA 4IO9Q 2DO4A 4DFJA 3HVTA 4G1IA 1RHKB 4WXWA 2E1MC 2CPXA 2YNIB 5ETOA 2OKQA 2VA3A 4ZHRB 1TU0B 5IFMA 4JI0J 5HAOA 2DGVA 1EQ0A 2DK2A 5KAKA 2VG6A 3QAUA 2R9LA 1K1SA 4TN2A 5KFPA 4RW7B 3M6VA 4DX6A 2EPIA 1E6YA 3PO4A 3TA2A 1GAOA 2ROEA 3G8TA 2PA3A 4LVOP 4I1TA 3KK1A 4JI2J 1UTAA 4QR0A 3H5SA 4B3MF 1H72C 4QBUA 5EWEA 1X4BA 3A12A 5GMKa 3MZIA 3LP2A 5I3QA 1WEXA 3DXSX 3KG1A 3KLEB 2OTLS 2RDDA 1TUGB 2HZAA 2EFGA 4J9VA 5GAHI 2QMXA 1NUEA 2BQRA 3ZFVA 5K14B 3UD4P 3G87A 2AJFE 3N28A 5B0AA 2A6OA 5IV3A 3KMQA 3BQ1A 1CQMA 4P6QA 4ZOSA 2EWHA 5B0EA 3BREA 3TJ8A 4DFMA 3AQOA 1S7IA 1HBNB 2KZMA 2B5JB 1UWAA 1YQHA 1UW9A 2YQ0A 1FRXA 2ZVSA 3FKBA 5AT1B 2DH7A 2XGPA 1KSPA 4FNHA 5CCMA 1R27B 1DHMA 4M5MA 2CNOB 2JX2A 3O2IA 3RJMB 2VFRA 1TQLA 3VHQA 3WQPA 5A0YB 4KPYA 1MU2B 1BQNB 1HFEL 4WF9Q 2CJXB 1RHJB 4KSEB 2L41A 5IV4A 2DVIA 2KO1A 4K4WA 3M8YA 4CZCA 2FJXA 2J0SD 2C22A 1WI6A 1KONA 5E7OB 4Z37A 3N6LA 4WTYA 4CDIA 4DFPA 4ZCIA 1S6QA 1Q82T 4IG0B 1N5SA 2YXLA 4X4NA 3KLVA 3I56S 1LWFB 4USJC 3QRQA 2BOAA 1RT6B 2OD4A 3KK3A 5J2MB 1YRXA 1MLAA 2VQFJ 2EC2A 2RAQA 5EDWA 1R0AB 4U7UD 3AOCA 4WKYA 4HKQA 4MIWA 2GMHA 3HJVA 5L9NA 4DN0A 1S1VB 2QA4G 2D41A 4DL4A 2D9PA 4FDFA 4DUZF 4WP9A 5A6PA 1MWZA 4NI2B 4IRDA 2H48B 2HMIB 4JOUA 2XWXA 3MEGB 2NZCA 4O44A 4QPTA 4C11A 3LGHA 3C15B 4DV1J 2CKWA 4JV0A 4ZP7A 2DJWA 4DUTA 2PEBA 4ECTA 1NKCA 1B0TA 4CYUB 4DJBA 4EWTA 3BQ2A 1HQUB 2W2NP 1R43A 2HK2A 2OHDA 1L3VA 4NLQA 2YKAA 4RW9A 2ADCA 4NLUA 1GK8A 3HD2A 4PEOA 3U02A 2E5LJ 1V5VA 2HSEB 2V6AA 3MPDA 4RPFA 5LMUF 2AYMA 5KFXA 3L3CA 3BN7A 2FHJD 3BH7B 3SFGA 2I9SA 2XZWA 2YPYA 3MM9A 3QPIA 2W8LA 2ZHOA 1KDNA 4DV5F 1NK4A 2V0NA 4M5DB 5CYQB 4FZVA 1N4LA 2F5GA 3DRRB 4NLYA 4AL7A 1LXNA 2JC1A 3FUYA 4CLKA 3N6MA 1UVNA 4DV3J 3IR6B 2WHOA 1L3KA 3AJ1A 4PWUA 3H4DA 4OX9F 4NEYA 3Q22A 3DLHA 2HQIA 2DHSA 2XYGB 3SBMA 4J9PA 4DV1F 1N5VA 1S4FA 1PJ5A 1LW2A 2FGOA 5D4LA 5BYQA 3THTA 1N5YB 1X31C 1EJ7L 2IPOB 2XI3A 1HNXJ 1NM2A 1WF2A 1OIAA 4DMZA 3SZ2A 3R1LA 1FNMA 5AE2A 4C9DA 2YKMA 2FHOB 1SJ1A 2BA9A 3MM6B 1AT1B 3OQ2A 2IA6A 1VI7A 3M8PB 3UVJB 1RGVA 2E5JA 2CNNB 2ZBQA 3K7RA 3KHHA 1NDLA 3TZYA 3Q8RB 4JV2A 1FEHA 2JFKA 1RT2A 1KBRA 3N79A 1LV5A 4NCBA 4X4VA 2CPIA 1U1KA 4NXNJ 1KQGB 5IS2A 5IWAF 1TL3A 1UVKA 3V4IB 1YRUA 5AXLA 1KR4A 2FDNA 3DYAA 3MEDB 1E6VB 3MMAA 4USVA 2YNFB 5E3RA 1JLQB 2ZVIA 2HQGA 4R5PB 4DV3F 3D0IE 4PKDB 2PIIA 1Q53A 1U7LA 2YWKA 4ECUA 1U1PA 5IQ6A 4KRWA 1RI7A 3O44A 3T6JA 4LF4F 2RILA 5HMYA 1P27B 3ZTPA 5D0GA 2APOA 4H54A 1UEVA 2HBRB 1MROB 3DRSA 2MHEA 3W7BA 1CC8A 2E44A 4DLEA 1S0MA 1IN0A 1XERA 2V8PA 1RAHB 4OMFG 1KTVA 1V3SA 2C3UA 2J9EA 3M8QA 1HMVB 3UW1A 5KG4A 4A8XA 2IDEA 1UZDA 2KKHA 2IBKA 1NJYA 5HK4A 1RTJB 1NK0A 2HIQA 4ANCA 3Q23A 3MD3A 4NPOA 1N33F 3ILLA 2RU3A 2J7WA 3Q8YA 4OHZA 4EEYA 1VQ7S 2QYCA 2FVRA 3DU5A 1QAJA 4F3QA 1RBLA 4BCAA 3GJRB 2LDIA 4Y2IA 4FXDA 1EB0A 5AXKA 4MTPA 2VV5A 3P45B 4CO0A 4AXJA 5K20B 2HK3A 2ALZA 4LQ9A 1KQFB 3C6UA 1CJKA 2QT7A 2LXFA 3DLEB 4R25A 1H38A 1OY6A 5KT7A 2JH3A 3W3SA 3GYGA 1JLGA 4OI6A 1N5TA 2LXIA 2RUSA 2XYPB 3PJ9A 3UDVA 3D1HA 4JI0F 3W1YC 5C42B 2W7OA 3NMRA 3CWJA 1SC6A 3DM2A 3V6DA 3C14A 1IKXA 1F5BA 2GCFA 1WF1A 1PC4A 2HFZA 3CEDA 1WACA 4U6PA 2YPZA 1T9TA 4ED5A 4RBTA 1H6KX 2BKPA 4PXCA 5J2MA 3BBFA 3FK4A 3RB4A 1SJ4P 2Y9HA 3W2VA 4RUBA 4K4VA 5H9FK 5KFDA 4ZJOA 2D7SA 2OMOA 2EG1A 3ENVA 2LA4A 4J5OA 1PG5B 2W2MP 4P9SA 4ILLA 1CG2A 4HHUA 5D0HA 1NPKA 3W61A 4Y2MA 4DF4A 1NK7A 3PX6A 5LMNJ 1ZM4A 2QGFB 3HM9A 2LQJA 3MR7A 4G6VB 4DX8H 1VQYA 1Y5IB 5KG0A 5E41A 4AQYF 1NK6A 2DR7A 1YHQS 2FLPA 2D69A 1EQMA 3OR1B 2HHSA 2XG8A 4QR2A 2J7UA 4P7VA 3B54A 4PXBA 4Y0FA 4DUYF 5D77A 4QOTA 2OAUA 3HHKA 2AZ1A 5I4MA 2NUHA 2K1RA 2EFVA 2KFYA 1YI2S 2Z30B 4JI7F 4AD6A 2UVRA 4LIRA 2ZH5A 2QIFA 3NS7B 1FE0A 4R5PA 4DV7F 3MAQA 4PQAA 4I6YA 4EMDA 2W01A 4PWDA 3C6TB 4DR4J 4K4UA 4ECXA 4MKYA 3G8QA 3AB2B 2QL7B 1Y4ZB 4F3OA 2IIHA 1NRKA 1AROP 2QMUB 1E6VA 2JL9A 4QZVB 1QLNA 4PQUA 4OX8A 4LBPA 4L6V3 3TNVA 3TEHB 3GIKA 4ZPVR 5IOLA 3KMSA 5LMNF 5F3TA 1WHVA 1XIQA 1ZZFA 5T7LB 4XPEA 1TZ0A 4NXMJ 3E2EA 1N8RT 1JKHA 1XMQF 4QWEA 4Y2CA 4ZCMA 1H73A 2Y1LB 3G86A 4DWIA 2FB0A 3H2LA 2QL9B 1UJ6A 2CQ0A 2HEKA 4Q8FA 2JNJA 1YVFA 4DX5A 2W2OP 3OHAA 3M7VA 2JEGA 1T03B 4JI7J 2OEMA 4H4KA 1Y0HA 3MEEA 2RJZA 5L9XA 3FGVA 3EPGA 1NLKL 5JVGQ 1D9FA 2VONA 4J9UE 2LA6A 1HI1A 5KFUA 4JI6F 2YY3A 3NS5A 4BS2A 3JQJA 1I51B 1IQZA 5FDLB 1HWUA 3A3PB 5CAAA 4W4MA 5ETNA 1S1XA 2AYGA 2UVUA 4C7QA 4OIXA 3OL7A 2XHWA 2H4YB 2E66A 2M5YA 3CJSA 2ZD1B 2JWNA 1EP4A 2YX4A 3UPFA 3MUVP 2HRUA 4FBTA 1AFIA 1B64A 3UDEA 2J6UA 4X2BA 4IOAQ 4P52A 5GAGU 2FLLA 2VF3A 2Y0SD 3HDSA 1FRIA 2E5LF 1G3OA 2PI4A 2K3KA 1PAEX 2F3JA 1VJWA 3KNAA 2LP4A 3KJQB 4IQMA 3W5YA 4JUZA 1SVDA 1XEZA 2IM2A 3HX9A 1KD1T 3VTIA 3IAS9 4BC9A 2R8JA 3ENAA 1HYSA 3G6YA 2P9GA 4RL1A 2V9WA 1E6YB 5HMZA 1I1GA 2DNRA 1S6PA 3CCWA 4KH1B 4USUA 1FXDA 3HD1A 2GV1A 4KV8B 3HO1A 2DEJA 3MMJA 2F4FA 2XGQA 3LWLA 2R8IA 1K8AT 2KN4A 4NZ0A 4KGZB 2HNZB 1JNRB 1NHVA 1TUWA 3EDRB 4CLWA 1RWWB 1S1UA 4CLFA 3H2UB 3OFFA 3PYFA 4EO6A 2HVHA 3KG4A 2BQUA 2DPIA 2GNKA 3VAGA 2C28A 3MEKA 3FBBA 1FJEB 2LLZA 5FLXY 1IJEB 1WUUA 3J80Y 2OO4A 2HAIA 2YTCA 1JMTA 1GMWD 3ETMA 3GSDA 1SJQA 3GIRA 3ZZZA 3MI7X 1RB0A 1OO0B 2M2BA 2ATLA 4KKOA 2MJNA 1MN9A 1FX4A 5L8RC 2RRNA 3EE3A 2FTRA 1UWBA 1WSVA 1HPZA 3BYPA 4ZP6A 4U95A 5F9NA 2CG8A 2B56A 4L3KA 2H9ZA 3TRGA 5KFMA 4M8LA 1WG4A 4K0KF 2GX8A 4K2JA 3QIDA 4YOEA 5J2QA 1R0BG 3PEHA 4DSIA 4A47A 3S01A 3LP0A 2VJVA 2NUUG 1SBRA 2V34A 4IH7A 4DSFA 3M9NB 4R8UB 1VQOS 3W63A 3GFYA 3W9IA 5T7LA 3NNCA 1BUXA 2A0FB 3V6KA 2W7AA 2ROGA 1GTHA 2J0WA 5E3PA 1L5UA 1SH0A 2BEFA 3UN5A 3IAM9 3PR5B 2R3VA 3T1HJ 1BLUA 2CDQA 3IG1A 1S9GB 1SC3B 2ZC4A 1VC0A 4JV5J 2R2UA 5HVFA 2FYXA 2MYFA 3DGVA 3BO2A 1RT6A 3DDIA 4DV4F 5DG7A 3R1HA 1LWCB 2C2DA 1S99A 1RWVB 2WSEC 2C3YA 2XMWA 3SQGA 3L95X 2VPWB 3U7JA 2PC6A 1F1BB 3KLFA 2YKNA 2L9DA 1QSSA 1QDUB 5ADZA 3DKDA 3CCRS 2XZTB 4CT8A 2B5JA 1RWPB 4O0NA 1M5KC 2PO4A 2RT3A 3SFUA 4B3SJ 2EW9A 4YY3J 1RYRA 4NZ7A 3KHLA 3MMBA 1U26A 4LRDA 2R8HA 2MPUA 2EKNA 3MR5A 4NASA 3U1LA 3X1LB 1RHRB 2AEMA 3G96A 1HNIB 4AFFA 3DI6B 4LF8F 4NLXA 3DHXA 3TX0A 3CCMS 1BQMB 4PWDB 3TAMB 2ZHAA 4RW9B 1OS5A 2NLWA 2DBBA 4Y65A 2MSTA 3S6EA 2ASJA 1FA0A 4ILRA 4DR6F 5I3UB 5DGAA 3HMJG 1RT4B 1QJHA 3TZWA 3TARA 2UVWA 4OYBA 2LEPA 4RW4B 3C3LA 1H0HB 4WJBA 3KHGA 3QATA 2Y1IA 4K0KJ 4JP8A 4KHMA 4IDKA 1OMSA 2H4WB 1REVA 3FNNA 3R5GA 2SXLA 2K7KA 3H7HB 4HACA 4I2QB 5D4NA 2Z0GA 3QZ7A 1UCNA 4ZPWR 2J6SA 1F6TA 4B9NA 1NAQA 1Q95G 5IQQA 4B3SF 4YY3F 2B9EA 4OHVA 4WIIA 4DPXA 4N5SA 2FHMA 4ECVA 5DJBA 4O3PA 2KRBA 4GKKJ 3HKWA 3DOKA 4A8OA 1TKTB 1RAOA 2OPQA 6FD1A 4URGA 3PR4A 1YJTA 3BPDA 3GR0A 2JSXA 1UMJA 2FY8A 3QWPA 3B78A 4YHHJ 4NCAA 2HLUA 3T5JA 4A48A 2RRBA 1KWMA 4RW6A 2FZKB 3CCJS 1IVZA 3ISND 3TA1A 3UR3C 5K9FA 4D3GA 1U8SA 5HL7Q 4B3RJ 3MD1A 2J0QD 2MKCA 4QWCA 2XULA 3CD5A 4ECZA 3KOAA 2VBWA 2DNMA 5J2PB 2M0GB 1GX5A 1NHUA 3MCOA 1LW2B 3F44A 4I7FB 4LT6A 3VAJA 2OPSB 3CCQS 4HHHA 1QY7A 4QYRA 2DKOB 4CO1A 2O5DA 3GJSB 3OXLA 4G1PA 3NNAA 1B7YB 3KK2B 4QU7A 2GO9A 1O8BA 2JFDA 3RBXA 2WTFA 3ISZA 3ENWA 2RD5C 4DR5F 2RB7A 3PRVA 4LRAA 3SV3A 2V8DA 2CQHA 2OFGX 1BMQB 1TVRB 3AY0A 3UE2A 3VCDA 4CM0A 2DGUA 4FYXB 3DHWC 4X84A 1HQ2A 4ZK7M 2PN6A 1U48A 1CULA 4K4SA 1MN7A 2V5HG 3R5JB 1ZS6A 3DGPA 4NL5A 1DRZA 4F4WA 1HR0F 3C46A 5CA5A 3NGUA 1KLMA 1R3NA 3GCWP 1WOOA 1AB8A 2DY9A 4PABA 5KFJA 5DLFA 3IRXA 1U4BA 4NXMF 3OR2B 1PAUB 1X5OA 1Y5LB 3IG1B 5H9FJ 2LU1A 2Z58B 5D4OA 4X4SA 1YJWS 4F3MA 4YB1P 2CQDA 2FJAB 3U1MA 2Z2MA 4DOZA 2MLYA 4MFBA 2MZ1A 1TL1B 2V8HA 2AGPA 1AXQA 3ONQA 1Z1ZA 2ZZTA 2E9TA 1IR0A 3DRSB 4HEA9 4M5NA 2KL8A 2AKWB 4N77A 1J5EJ 2IA0A 1XN9A 4U8VA 1VR6A 2EBGA 2JVOA 4HLBA 3R7NB 1B99A 3GPAA 3PACA 5IM0B 3OL8A 1R8BA 3I5BA 4CP5A 5KFHA 3NRBA 3FBFA 3H25A 3KHRA 3OVAA 1UPMB 4X4QA 1K9MT 1HW8A 3RAQA 2UXCJ 1RWNB 2B6AA 4O3NA 3AT1B 3MPYA 2F65A 3T1YF 2ZUAA 1EAYC 2FHJA 3HSDA 3HZEA 3R6LB 2ZWPA 5KG3A 5AXMA 4WU2A 5D0RA 1HBOA 2YKPA 5KOXA 1ZTTA 3G82A 2W25A 2ABYA 3PEJA 4MKVA 3PZPA 2OPRA 1XNQJ 1UL3A 2Y8YA 4LBIA 1PJ6A 4ZHRA 4PCQA 4ES1A 1XWLA 5EUHA 4YQWA 1FDDA 4UY8T 1TV6A 3KUGA 5KG1A 3FBCA 4J9SA 3OPKA 4KHPF 4LF2A 4LBHA 3J7YI 3RRKA 4YR3A 3ELHA 2DHHA 4J90A 4F25A 4PPZA 3GR1A 5EWFA 2MGZA 1N36F 2DD8S 1HWJA 3CCZA 4AQYJ 4JI5J 3NBPB 3JTNA 1UETA 2IM0A 4ZJQA 5C2GA 1KS2A 2KM8B 4JI4F 2J76E 1HNIA 2BACA 3CJ2A 4N8NA 4NLTA 4NA2A 1Z2LA 3TA0A 1NDCA 4ZLJA 5LL6d 2Z57B 4F0MA 2GIRA 3SSSA 4IOCQ 4PR6A 3W9JA 1K73T 1SPBP 4I69A 4F4AA 1JJCB 2KYXA 1LEOA 2W2PP 4ZP8A 3UNGC 2DGQA 3WHIA 1K0VA 5A0YA 1KHVA 2GAHC 3R7SB 3RAXA 2RKIA 4N7TA 1RWOB 4TNOA 1PBAA 2KT3A 2DXDA 2V2ZA 5HI7A 4N41A 4F7VA 3BDEA 1Q78A 1P8GA 3QT8A 3V4MA 2CA9A 1BD6A 1CULB 3EJMA 1U02A 2BE2B 4U7UK 1VLOA 2GQ2A 1W26A 5JVHQ 4YB7A 1HR0J 4IRKA 1VRUB 3TZXA 3NL0A 4KHPJ 2B4OA 4A8YA 3Q8UA 2UUCJ 3BS9A 4U67Q 1MMNA 2KM8C 1C4AA 4OJ3A 4FNIA 2DR9A 1CVJA 4TXSA 3WX4A 5HVHA 3HK2A 2IY5B 1S1VA 2HWIA 3CJ0A 4Y6IA 5B0DA 1S77D 4RW6B 1MW7A 4LR8A 1S0VA 3KK3B 3VF0B 2M8DB 4TYAA 3K58A 2QSFA 3RW7A 4O3OA 3DC2A 5KFGA 3MOJB 2CJYB 2C2MB 1RT3B 3UDCA 1Y7PA 3UN3A 1M5SA 2VPXB 4ELTA 4DSKA 3CC7S 3CUNA 4NWBA 1FRLA 1T9XA 1VQ5S 2A2DA 4DV0J 1DLOB 1REGX 1ZPWX 4C2MA 2ZJPQ 2WK4A 4HH1A 4NCGB 1S4EA 2XQCA 3S8SA 1VC6A 3QGIA 3CCUS 4DR2F 1N0UA 2OD6A 4RKUC 2ZDOA 3ZNJ1 2HNYA 1X5PA 4J37A 5HVGA 4G1QB 3HLUA 1Q5YA 3SSRA 4W90B 3RU0A 2VPYB 4DLGA 3EGWB 1NJIT 1RAEB 1U6FA 1S6PB 2ZH7A 3CIZA 3OUYB 2YX7A 2RRAA 4DS5A 4U96A 5A8WA 4QW9A 4OJ1A 1VIOA 2MGZB 1FFGB 1VGYA 2PT0A 3KJVB 1RJJA 2O3DA 1GX6A 3OHBA 4AL5A 3K89A 4RW8B 4C3MA 2HQFA 3H5YA 4DR7J 1HQUA 1BHNA 2QC3A 5DS7A 2QLFB 5IC4B 5IM0A 3R7BB 1FJGF 3FMBA 2E7VA 3FZBA 4M94A 4M63A 3THVA 1RK8A 1WKLA 4B9LA 5K8PA 2BUNA 3K2YA 3N9UC 4NLSA 2R2RA 1GH8A 1TKZA 2W9BB 4DFKA 1U2RA 5DG9A 1M0SA 5A6WA 5EHHA 3IRWP 4ELVA 2B9XA 3TVZA 4EYIB 2D3O1 2CPZA 4EZ6A 1GNKA 2ZOFA 3CJQA 4L76A 2QG9B 4PUOA 4ECRA 5KT3A 1WELA 2RKIB 3P8BB 3QJPA 4C8MA 2KXFA 4N8OA 4DV6F 4DV0F 3OJSA 1PKUA 4M5IA 2UUWA 4QIFA 1R8PA 4OX7A 3W2WA 1VDHA 1QAYA 2E7XA 1CJTA 2WZ1A 1OQ6A 3ETOA 4LMZA 4S0MA 5CH7B 4X66J 1B4SA 4IG3A 2WVBA 2ZBCA 3QO9B 5KFTA 5EGYA 4DQIA 4DR7F 1WEYA 4ZPCA 4WKRA 4FPIA 1F3VA 2ZE2A 1LWCA 4NLPA 2HQ3A 1UVMA 1D8ZA 5GMDA 3HHLD 1FTRA 1RT3A 3GSIA 4LFBF 3GG0A 4J9RA 1WEZA 1SKRA 2LFVA 1BXNA 2DNOA 2RVJA 2CUYA 4M5LA 3PKYA 3QLHB 2AMCB 4TU9A 1SL1A 1J5EF 2KB2A 4WFBQ 3FJ2A 3D1QA 3MMBB 3TJAA 4QWDA 2Y0BB 2ZFHA 3UNYA 1ZAWA 5KG5A 1F0XA 4KTQA 2KG1A 1HIYA 1TL3B 2GVDA 4QIWD 2ZEJA 4X4RA 1T7PA 3K17A 2I8EA 2ZJQQ 2DNNA 4ZVPB 4AE5A 1M5HA 2Q1LA 1QSLA 1R7IA 2EFQA 5ITHA 2ERRA 5K5MA 2E5IA 1FWPA 2VG7A 5B09A 4GO7X 5F8HA 3ZC4A 1RHQB 4DR3F 3UN2A 1O5JA 1RP5A 1CJUB 2VICA 4A8KA 3D0GE 3M4XA 4DL2A 2VODA 2HHQA 1LOUA 1LK7A 5CYMA 2Z56B 2ZBRA 2H1YA 2WSFC 5F8GA 4GKJF 2BJ9A 1REVB 3N5BA 4OZ1A 4UUXA 2XMTA 4IO1A 1V3RA 1YBAA 3F73A 3B4MA 3ICLA 4TLRA 4E8UA 1X0FA 3OTBA 1HNVB 4F4XA 3C14B 1RT5A 2ZBPA 3PCOB 4NLDA 5E0OA 2NS1B 4P73A 4XPCA 3EPIA 2RDJA 1PSDA 4ECQA 3RW6A 4OZ2A 2WVEA 2V8VA 4L72B 3J7ZT 2CIMA 3EGVA 1S1WA 4I67A 2CPYA 4ZN3A 1VK8A 2XMUA 3OLAA 1M1GA 2FGCA 2JJ4D 4XDCA 3OL6A 1FJ7A 3CB4A 3H0PA 2WVCA 2YWHA 3QIPA 5D6GA 4JI4J 4ZA1A 5HP1B 3SCJE 4X62J 1W7WA 1YK9A 2P6TA 3OFHA 3PRDA 4KY3A 4Q43A 2XBPA 5JJBA 3K5PA 3MTJA 5L38A 3KUEA 2CXEA 2RMLA 5E2QA 4CLZA 4DBQA 4EYHB 3M30A 2G4BA 1YLXA 4JYAF 2LXUA 4TU8A 2R7WA 3HVTB 2IHR1 2BKOA 2B7BB 2HNYB 3BSNA 4GC6A 1N5QA 2OI2A 2HRYA 4DL7A 3NWGA 3O6QA 2VA2A 2QLWA 1DTTB 1FI4A 4LFCF 2MJUA 4WZQA 1FESA 4A8QA 3PW7A 2QYGA 2ZHBA 4WE1B 4F4KA 3A8EA 2K2PA 4CM2A 2LYVA 5LJ3Y 2E1RA 3VR1A 1FRJA 4NLRA 2NXCA 3P49B 3HVAA 4UOHA 2VH7A 2OPQB 2BANA 1WTBA 5F0UA 2CPJA 4OI3A 1RAFB 5GAEI 4USTA 1IBLF 2MQNA 2WONB 1FK9A 3L7UA 1X4EA 5KG7A 1PYOB 4C8KA 4CIOA 3OVBA 2W7PA 2MXYA 4CRJA 3T5LA 3GP9A 4ZPTR 4B17A 1UP1A 5L1IA 5A8KB 4QW8A 3I4HX 4CO2A 1WHXA 3NOGA 4F04B 1TKXA 2FJBB 3DMJA 4EI2A 5IXUA 3HFKA 2HG4A 3AOAA 4YP3A 3BBBA 4JYAJ 2W9AA 5J1NA 3IRXB 1QUPA 1R8CA 4LJMA 4X64F 1AA1B 2DNGA 5M2PA 3VGSA 1YZ7A 4WP8A 2AZ3A 2R7VA 3M1VB 4EBDA 3C6TA 4EZ9A 3HVRA 4LF7J 5E3AA 2OELA 5DDRC 5ETSA 1SIWB 3GB0A 3SEOA 4C3LA 5HQLA 3D67A 1ZZNA 4PUOB 3BKFA 2R7UA 2P2CB 3IMQJ 4KC5A 2M52A 2GQQA 5C25B 1VBYA 4EGLA 2B6AB 4USHA 4OZ0A 2B4VA 5HROA 3D1OA 4OI1A 5B0CA 2BBEA 1JLFA 3QT6A 1IBLJ 3PX4A 2CYYA 2JLGA 1JIHA 3OSPA 3MFIA 3A13A 1SI9A 5BR8F 2DHAA 1WTFA 2Q6BA 4MIAA 3QT7A 2QV6A 2UXDJ 5IT0A 3PW5A 4B9VA 2KTQA 4Q2MA 1OSCA 4BWMA 2ZH6A 2VHGA 1EETB 3GJQB 1DQ9A 2XNQA 4DN9A 1CQNA 4ZPAA 2HYIB 3KLHB 2A3JA 4KH0B 1IJFB 5KFAA 3POTB 1QAXA 4X64J 2YNHA 3BKUA 4IH6A 1NCLA 2M4MA 3BKTA 4RWWA 3V2UC 2I1RA 3ZNUA 4DPUA 2HKEA 1TTHB 1RYSA 3QJLA 4RR5A 3SCKE 4JI3J 4WIQA 3QSIA 3FEXB 4ECWA 1N6QA 2UUTA 5J2NA 1IXKA 3O3LA 1WDDA 3CGIA 2HHVA 4H4MA 3EX7B 5B0BA 1RTDA 2KFNA 3GWCA 1JLAB 3DRPB 1HNZJ 1KOOA 5KT5A 3BO4A 2UVVA 3D66A 2OUGA 4RBUA 4D3HA 1HPZB 2HS4A 4UQTA 1U1QA 1NPRA 1HL6A 5BXIA 1IWGA 1N54B 1RU2A 1RCXB 2CWKA 3NCRA 4LRFA 4WXOA 4P2FA 2PSZA 4EU0A 4RU2A 2VOPA 2VG7B 1O0PA 2IYIA 1AZSB 2W24A 3DDKA 3WBZA 4WFAQ 3GIMA 2MLXA 1SB6A 4J9QA 3MTKA 4ZJLA 2QMWA 3Q24A 2PA8D 2AV5A 5EX0A 1KTQA 3M32B 4KV8A 3JSBA 2AU0A 1V5IB 4EUVA 4NLWA 4X65F 1JJ4A 2WB4A 4I68A 5KG2A 5DZ6A 4DV5J 1X9MA 4QU6A 1TV6B 4C48A 2YNFA 3EXYA 5DQHA 4JI3F 2JEIA 1UKUA 5BYRA 3JAMY 3VAHA 3D2WA 2CQCA 2DNQA 5CHCB 1KFSA 2P5VA 4J9KA 2MQLA 3NBPA 4U9RA 2RS8A 3UQSA 4HH0A 3OTOJ 4ANEA 1CS4A 5AE3A 4ZKAA 2OSRA 2GS8A 2OEJA 1HI8A 1XK8A 2B43A 5KFLA 1HBUB 1JLBA 2C3PA 2XZDB 4DI6A 1KQKA 2O67A 4WBFA 3J80U 4C6AA 2FJWA 4ILMA 5A2QU 2CQGA 1X8DA 2IAJB 2BJ3A 2HHHJ 3J7YU 3IR5B 1RUSA 1NDKA 4H4KC 4USKA 5LJ5Y 3CCES 4LSLA 1Y10A 3JTPA 2NSBA 4MKBA 3T19A 3HCXA 2VFVA 5GVQA 4DL5A 2UUAF 4J7CA 1R31A 1T94A 2X1GA 2N4CA 3CDBA 3EZOA 4YN3B 1NDPA 2DGSA 5IT9U 1SJFA 2BMBA 2CQ2A 4E98A 2MQOA 3PW2A 1NKBA 1YJVA 2R7TA 3BR9A 1UZHA 2JOQA 3EVWA 4HDHA 4KGVB 4WFYA 3ZO7A 1QAIA 4DX7A 2VKRA 3QAEA 4DR3J 1JLQA 1NZAA 4YDDB 2B7CB 1BQMA 5DM7Q 3K57A 1B0VA 1S57A 1XR5A 2FQQB 2I5JA 3AD9C 3CMES 1JLFB 2OH2A 1C0UB 3D6TB 2MKHA 4K5SA 4B3TJ 1WDTA 3UI3A 1JQGA 3C2PA 4OX6A 3MM5A 1FFWB 1TMJA 1PYSB 2KJVA 3C16B 3TVYA 1VQLS 1BWEA 2MDAA 3MWBA 4I6AA 5ETRA 3HHLC 1RTZA 2G2OA 3VQTA 3TO8A 2K8GA 1S12A 3HP6A 2F1FA 3B8HA 3CD6S 2HHPA 3KJVA 3Q0AA 2BQ3A 4NE9C 1K44A 2VQEF 1XC9A 1L3SA 2RUGA 1LXJA 2YKNB 9RUBA 4ED6A 1IBKJ 1F9EB 3AAWB 1P9YA 5M2RA 4HVZA 3HHLA 3DFEA 1X4FA 1D09B 3MDFA 3G8SA 3PX0A 1FJGJ 3FSYA 3R27A 1UA0A 3OTOF 3PHEA 4DZ6A 4NLGA 2BW2A 2MLZA 4DHVA 3ILJA 1RTIB 3GV5B 2DGOA 4FF2A 1QVFR 1AZSA 1FX2A 4I4BA 4MAKA 1XMBA 5AJ3J
chains in the Genus database with same CATH topology
2YNGB 3GG1A 1R8HA 5IT9Y 1RWUA 3HZGA 1CC7A 2FJVA 2MZRA 3CIMA 3IO1A 4OQJA 4QPXA 1CLFA 3H4BA 1NEEA 1HW9A 4IYQA 1Y3JA 1X9WA 5KFYA 3DLGA 5SUHA 2B9YA 5I3UA 1ZETA 3HVWA 1RTHB 1P1TA 1B0PA 1U09A 2KYZA 3I0RA 4Q0BA 1XR6A 1VK3A 5F9LA 2ZH3A 2EFNA 1FDBA 4Y00A 2YWFA 2UU9F 1C1CB 1URRA 1X4HA 2Z2LA 2XY7A 2AJQA 4BBYA 1HWLA 4Q44A 2YNHB 2XMMA 4RUCA 4LF5F 2CQ3A 3V6JA 4NYPA 1APSA 4EBEA 5M2UA 1IBMF 1JLBB 1SXLA 1TAQA 2J8AA 4FXVA 2E9RX 4ATNA 1KLMB 4RZRA 1P1LA 1U1LA 1ROFA 2XY6A 3QO9A 5EN1A 2WCXA 2NREA 2ZDPA 5GAGI 2F8EX 4O44B 2N4DA 3PFEA 1TL1A 1FKPA 2XEXA 2Q6CA 4OLPA 2NPIA 3TR5A 5BYSA 3VAKA 1NK8A 1S9FA 5FJ4A 2VL1A 1FD8A 5KFKA 1KC8T 4PQUB 3LANA 4IRCA 3UCUP 5KT2A 5DDQC 1K0TA 3HHNB 1H7WA 3VZIA 4C0BA 4MIBA 4YUDA 3UCZP 2AU0A 4O4RA 1JKHB 2O1PA 3Q2TC 1RQ0A 3BGFA 3DLKB 1YTYA 1S6QB 2LDYA 1FNOA 3JB9k 5H1SV 2D3UA 3QGPA 4NLOA 5KOWA 1VQNS 2W9CA 1IUJA 2BJDA 1U1OA 4ELUA 4Q2LA 5CYMB 4LQ3A 2OPRB 3R5CA 4A4JA 1YITS 1PGZA 1FTCA 3LO3A 1TFWA 1HBUA 1MMLA 2VFSA 3DXBA 5LXYA 4GMKA 3PW0A 1HNVA 1D0EA 4MMOA 3FCHA 3S7RA 3JYTB 5E33A 2PFFB 4QJVA 2AX0A 4KB7A 4RNOA 2GIQA 2X1FA 2QRRA 1IKVB 2HGMA 2N3LA 3CE8A 2CJKA 5B0FA 4DG1B 3CC2S 2JEFA 1F2GA 4C8LA 1YSJA 4DL0C 1UFLA 3DCAA 4NYOA 1G6BA 1D9DA 5JUMA 4IFYA 4NLVA 4OFZA 2FY1A 3DNCA 3AJ2A 3S1TA 1RAJA 4Q45A 3DLGB 4P2SA 6FDRA 3DRRA 2EKYA 3M30B 2VBXA 4WFNQ 4IFVA 2O66A 3WDOA 3AA9A 3TUJC 3TX8A 5EWGA 1UVJA 4TKTA 2CRLA 4O23A 1U49A 3HF5A 3SI8A 2L9NA 3M6UA 4ETXA 3T5KA 5E3QA 4QWAA 4K4YA 2VFUA 2HVIA 3ISNC 2ACYA 7FDRA 4Y28C 4C97A 3DMJB 4KHRA 2OPPB 4QCLA 1UVIA 2BABA 4BC7A 3I9V9 1FK9B 1FEEA 3M8PA 2IFXA 2VBZA 2B4UA 3LPYA 3M6WA 4OHXA 4LFAF 4R0JA 1UWBB 3OL9A 2MSSA 2RU9A 5JXSA 5CD4H 4W92B 1T02A 1S9EB 3OFGA 3I0SB 4C8OA 4F4ZA 1AUDA 2MZTA 3PRBA 2DHGA 2KHCA 3C6UB 3I0RB 2IMWP 2XS2A 2X1AA 2EG2A 2KHDA 1A9NB 5C42A 1C1CA 2GHPA 3FEYB 2VC0A 1FVQA 1OWXA 2JC0A 1ELOA 5KFWA 4ZMMA 2OFHX 4KFBB 3JSMA 2PE8A 3RRHA 4UW2A 5DDPC 3EYZA 1OPZA 1RDRA 2R8GA 3TAQA 3E01A 4YDXA 4KO0B 3OTEA 1TR0A 2PDAA 4K59A 1VIXA 3JSRA 3GV8B 1P9QC 3R5AA 2HHUA 3CJKA 2YKQA 2MQPA 1BQXA 1RT7A 3MPVA 3R3TA 3OFEA 1FDNA 3M8QB 3V6HA 5F8LA 5F3ZA 4N47A 2HHXA 2E29A 2VBYA 1S1TB 3BGRB 2XLJA 3MECA 2F9DA 2JZ5A 1G7CB 3NAIA 1F5CA 1S7HA 2QO3A 2X3GA 4A8MP 1HNXF 1NKEA 1I94F 4NX9A 4QQBA 3H8YA 3VALA 5J2PA 2IRXA 1PILA 1IKWA 2XMVA 4DL3A 3RR7A 2G0CA 2DO0A 3IFEA 2PMHA 2VFTA 3LW5C 1YJ9S 4WYLA 3RRGA 1EETA 2KDOA 1LWEB 3U27A 3G6XA 4H4OB 1Q81T 2QEXS 3VAIA 1SL2A 1JLGB 1X4AA 3OTDA 2PD1A 4RW7A 3KG0A 1SKWA 4ZVGA 2W4DA 2V9KA 4QIEA 2VD3A 3UWTA 4RW8A 1R6YA 1SJRA 4PG4A 2DGTA 3M2UA 5K14A 1TKTA 3KK1B 1FDAA 3FQLA 2QZ8A 3M9OB 3T5HA 1UEUA 4JI8F 3KLEA 3OR2A 2VQFF 1F9FA 3NAHA 5KFZA 3CSKA 5HMXA 4CH0S 3MEEB 2A10A 2IAJA 5G0RB 4J9NA 3EUNA 1LW0A 1M5OC 3OV7A 3RB6A 1H2TZ 2F40A 3TAPA 1N52B 3A1YG 5B08A 3CDWA 1FD2A 2NYIA 2N7CA 1Z2ZA 4O0IA 5G4DA 2ZD1A 4PG5A 2ZC3A 3OSNA 3CDEA 2ZNYA 1DQ8A 1MU2A 4DQQA 3BGUA 3FVYA 2QSWA 3J7A1 2XCAA 4IFVB 2FD2A 3M2RA 1OQ3A 5E3CA 1Q7LB 2CQPA 1FRMA 3IS9A 4KGMA 2LQ5A 2X1BA 3BF4A 1UAWA 2AF6A 1C2PA 3N01A 5EX3A 3MURP 4RNHA 4ID8A 1QSYA 1JX4A 2ZJRQ 4GO5X 1T05B 4C8ZA 3WZ0A 4ALZA 2ZM6F 3QMQA 1XNRF 2XLKA 2VOOA 4CTAA 1SQEA 4CNYA 2WSCC 3CCTA 5FD1A 4KAIA 3KLIB 3TUZC 1IM4A 4ZPDA 4RUAA 4DL6A 3I0SA 4RU9A 2D3OR 1EP4B 1ZH5A 4DR4F 4DR1F 1FJ7A 4NA3A 3LAKA 5GAHU 4IH5A 4TQSA 2WOMA 2IM1A 2C42A 3DOLB 2GJIA 3I5AA 4O4GB 3RYLA 5DQGA 2CQ1A 4URQU 5BJRA 5K8MA 5HP1A 2MMYA 4B9TA 3NCPA 1SKSA 2J9DA 5GADU 2F8MA 2R7SA 5F8MA 1I6JA 4PRFA 1Q4RA 1Z4UA 5D78A 3UDLA 3K5MA 2MB0B 5D3GB 3AB4B 5KTQA 4IUFA 1XNQF 2E9ZA 3SYZA 4X4PA 1VC5A 1HYSB 3JTOA 3BQ0A 3RAMA 1S1UB 3GIJA 2EK1A 3O5TB 1RT7B 2K7JA 3BR8A 3HHEA 2IC3A 2LEBA 4MYUA 2RQ4A 1H2VZ 3ZZ0A 1S1WB 3IN5A 1RTIA 3WC0A 2DNHA 2RQCA 4QIVA 4FF4A 1QUVA 4FN5A 3D5MA 1ZAVA 3THPA 1JLEB 3TYTA 4DEZA 4RWXA 3E51A 3V81B 2ZH2A 4ICLA 4KJIA 2FIUA 2DIUA 2ILYA 4CCHA 4CO4A 3SCLE 4ES3A 2FC9A 5DM6Q 4IQXA 3R5BA 1A6LA 3BGLA 2DPJA 2WAQD 2EVZA 4LIWA 5H9EJ 4V19J 3MM8A 4E0DA 2V4JB 3Q2SC 5AXNA 5L1JA 1AFJA 3MM7A 1C4CA 2N82B 2XSJB 4R8UA 1Y00A 2ASLA 2GGPA 4IR1A 3M2UB 3FRZA 3MMCA 4I2QA 2L9WA 2W9CB 1LK5A 3POTA 2RQKA 4URSA 5B0GA 4RNMA 2BRLA 1Q8LA 2V4QA 1RKJA 1TK8A 4FBUA 2LECA 1A7GE 2WBRA 2U2FA 2VZ9A 3J81Y 1X5TA 3IA0A 2O01C 4RUHA 1HQEA 4A8WA 3EGZA 1FO1A 3KLIA 5GADI 2QE5A 3MHYA 2DB1A 5J1EA 3M2VB 4MK8A 3OLBA 1BY9A 4ECYA 1GT8A 1ZAXA 2CVEA 4C0HA 2A1BA 3CJ4A 3FFIB 2G9OA 2GA7A 3IWLA 1NNDA 1SV5B 3HPOA 3MGJA 4TQRA 3VQSA 3J7Z5 2KT5A 4DQRA 4O3SA 2OPSA 4PXEA 4HI1A 3ZZRA 1FKOB 5I3PA 2M9KA 5E5NA 2CJQA 3DLKA 4QWBA 2A18A 4IFYB 2HHQA 3SDEA 3KLGA 3ITHB 2YNIA 4M95A 5D3GA 4TYBA 4F02A 2V94A 3EXCX 2XI2A 3K8VA 4XK8C 1VS3A 1VQPS 4BDPA 4OLOA 2AGQA 1SL0A 4B9MA 3H5XA 4IDKB 2IJNA 2J0XA 2HGNA 2B4PA 3ZZTA 1M5PC 3CCLS 4NYZA 5KFVA 2E7WA 1S49A 2LQBA 3GFZA 1RA7A 1TL5A 1S0NA 1IKVA 4FF3A 2Z4PA 2KZZA 2CQBA 1HBMB 3CDUA 2ZUGA 1LFPA 4YB5A 1S48A 2XLIA