2DNLA

Solution structure of rna binding domain in cytoplasmic polyadenylation element binding protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
GSSGSSGSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords cytoplasmic polyadenylation element binding protein 3
publication title Solution structure of RNA binding domain in Cytoplasmic polyadenylation element binding protein 3
rcsb
source organism Homo sapiens
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnlA01
1VBYA 2V94A 2HGLA 1FHTA 5HL7Q 1XN9A 3BO4A 2MQNA 2XSFA 1X5TA 2CQ2A 1WG1A 4WFBQ 2DGSA 2MY8A 2MMYA 2MQLA 1U1RA 3P6YC 2KT5A 3MDFA 4C0OC 2J0SD 3CTRA 1VBXA 2M8HA 4ED5A 2M70A 2KVIA 1WF0A 1B7FA 4WFAQ 2RVJA 2DIVA 2AYGA 2KRRA 2AYMA 3CC2S 5DDPC 4CH0S 2CQ4A 1N88A 1S79A 1WEXA 2N7CA 2PEHA 3FEYB 3R1HA 3CPWR 3CULA 3TO8A 3VAHA 2I38A 4LMZA 3SDEA 4RU2A 1A7GE 2N3OA 2LYVA 3UWTA 5LSLA 1X5SA 4OZ0A 4LIRA 1RKJA 4ERDA 3NNAA 2FC9A 3IRWP 1KD1T 2G4BA 4FXVA 3S6EA 2OSQA 2CQ3A 2DNLA 2F3JA 2NZ4A 1H6KX 2E5HA 2LXIA 2RUGA 2A3JA 3NNHA 3CF5Q 1UP1A 3CC4S 2XB2D 2VONA 1KOHA 1X4EA 1BY9A 1SXLA 4EGLA 1M5KC 4QU6A 5BJRA 1WF1A 1SJRA 2E5IA 1NO8A 5GVQA 1RK8A 2ADCA 1YIJS 1WG4A 2KM8B 3MOJB 2L9WA 3MI7X 4OZ1A 5LSOA 2OIHA 3U1LA 5LJ5Y 2BOPA 2U2FA 2RU3A 1ZZNA 1YJ9S 2I2YA 3VAIA 3CCVS 2KH9A 2L41A 1U1PA 1NU4A 5LXYA 3BO2A 2DK2A 2M0GB 1FNXH 5IQQA 3VAKA 2M9KA 3H2VE 1X4DA 2DH9A 3S8SA 2ADBA 1PGZA 3ZZZA 4M5DB 1CVJA 1VQMS 1WI6A 2DGOA 5LJ3Y 2YH0A 1U1QA 2QEXS 2MKIA 2MY7A 1P1TA 3UCZP 3L3CA 4IOCQ 5GAEU 1DHMA 2DNHA 4PKDB 1YJNS 2JVRA 1WF2A 4CQ1A 1WI8A 2CPDA 4TU8A 2KHCA 4P6QA 3ULHA 3BS9A 1VQLS 5DDOC 1AUDA 1VQ6S 2X1AA 2JX2A 1YJWS 3MUTP 2G1DA 1QM9A 1U1LA 1U2FA 2DNOA 1G2EA 2DB1A 2EK1A 2JWNA 2YWKA 4WIIA 2MJUA 5LXRA 1X4BA 1WEYA 5HO4A 3VF0B 4UY8T 2XS7A 1H2UX 2XS2A 2OTLS 3TYTA 2FC8A 4CIOA 4IOAQ 3RW6A 2DGWA 2E44A 3G9CA 5FJ4A 1D9AA 1KC8T 3G4SS 3CD6S 4BS2A 3VAMA 2MZQA 3MURP 2MSTA 2K8GA 2JRSA 2DGVA 5IM0A 3VAGA 2HYIB 3NNCA 4C4WA 2HVZA 3UD4P 1QVFR 2DNKA 1HA1A 2CJKA 2CQDA 1YWXA 2D3OR 4QQBA 4V19X 3LPYA 2MKHA 2MQQA 2DHXA 1VQNS 2DO4A 1X4GA 1OIAA 2SXLA 2RS2A 3SDEB 1VC0A 2AYEA 5CXTA 1WHVA 2Q79A 2RS8A 1VC5A 3HI9A 2FY1A 1Q82T 1VQPS 2M7SA 2X1BA 5H1SV 1YHQS 3FEXB 1HL6A 2F9JA 4FXWA 1WEZA 5D77A 1ZH5A 1M90T 2XS5A 4W92B 2MZSA 1L3KA 2D9PA 5DDQC 2DH7A 2X1GA 1U6BA 4ZKAA 2MXYA 4UQTA 3K0JA 1PO6A 3TP2A 2YKAA 1U1NA 2CQGA 2MPUA 2MGZB 5ITHA 2MGZA 1W2BR 2CPZA 2E5GA 3G96A 2ZJQQ 2NLWA 2QFJA 1YI2S 1U6FA 1N54B 1UFWA 1VQ5S 2AD9A 3HHNB 2ZJRQ 3RW7A 4F02A 1VC6A 2DH8A 1X5OA 3NMRA 1VBZA 2VOPA 2M4MA 4W90B 1FJEB 3MXHP 4LJMA 2DGQA 2CQBA 1VQKS 1WWHA 3MUVP 3CCLS 3Q2SC 5GAGU 3UD3P 2CPXA 1S72S 2PE8A 2MYFA 1DZ5A 4C7QA 1X5PA 2DNNA 5CA5A 2X1FA 4YOEA 2N3LA 1QVGR 2DGTA 3H2UB 1U1OA 1K8AT 3DLLQ 3CCSS 2L08A 3S01A 2ERRA 3CC7S 3I55S 4WF9Q 1U1MA 2EK6A 1URNA 4YB1P 3G8SA 3N9UC 1SJ3P 2E5JA 5MLCV 1N52B 2HGNA 1VQ4S 1X4AA 4WCEQ 2UP1A 2LEAA 5GAHU 4Y00A 2CQCA 2KXFA 4F26A 2KI2A 2DHAA 1P27B 2M52A 1FO1A 1DBDA 1OO0B 2KN4A 1YTYA 2DNQA 2GO9A 3BO3A 4TU7A 2JVOA 5DDRC 2CQ1A 2CQPA 2QA4S 2LXUA 2MKJA 4QU7A 1D8ZA 1WHYA 1K73T 3CMES 5IFMA 4PR6A 2MQPA 2VOOA 1X4FA 3THPA 1M1KT 4WKRA 1VQ7S 2DNMA 2LA4A 2GHPA 2MKCA 1OWXA 1DRZA 2AYBA 2YTCA 1WTBA 1JJHA 3Q2TC 2VODA 3JB9k 3SMZA 2HGMA 3S7RA 2LCWA 2OSRA 2N82B 3CUNA 2CPHA 2U1AA 1R8HA 4Y0FA 2DHSA 1K9MT 2M2BA 5IM0B 1JJ2R 1FT8A 1Q7YT 5JVGQ 2MQMA 4PRFA 2DGUA 3B4MA 3CCRS 1NJIT 3CCQS 2KXHA 1O0PA 1F9FA 1WHWA 2RRBA 1HD1A 5GADU 3VAJA 2YH1A 3J7ZT 4YUDA 2OJ3A 3NS6A 1FXLA 2CQIA 2ZJPQ 2LQ5A 3CCUS 2MZ1A 2XNRA 3IWNC 1WHXA 3D2WA 2LKZA 2MZTA 2LMIA 1X0FA 3CMAS 1SJ4P 3PIPQ 3MD3A 2MB0B 1N8RT 3OW2R 2MSSA 1U1KA 5D78A 2CPYA 5EN1A 2DNYA 1JMTA 2FPHX 3US5A 2KU7A 2K3KA 1YITS 2DNZA 1A9NB 3VAFA 2DGXA 1SJFA 3B4DA 3BEGB 3U1MA 4J5OA 1X4HA 5CYJA 1OPIA 2J76E 3CCJS 2LEBA 5DM6Q 3UCUP 2D9OA 2MKKA 2WBRA 2MZJA 5DETA 3R27A 2DNGA 3I56S 2RQ4A 3CCES 4QPTA 2MHNA 1JJ4A 3G6ES 4WFNQ 2CQHA 3G8TA 2DNPA 2MJNA 2CQ0A 1KQSR 3UCGA 2B0GA 2M88A 2KXNB 2KM8C 2KG1A 3R1LA 3PIOQ 1Q81T 1H2TZ 3THTA 1WELA 4U67Q 3CCMS 5DM7Q 1M5VC 1FJ7A 2DNRA 3J7YU 4IO9Q 3EX7B 2BZ2A 2MKSA 1IQTA 2EVZA 1UAWA 3MD1A 1SJQA 2DISA 4TU9A 2RRAA 4CH1A 2HZCA 3VALA 3CXCR 2G0CA 1FJCA 2XNQA 4Z2XA 3DXBA 2CPFA 2KRBA 2J8AA 1M5OC 2OTJS 2KG0A 1WG5A 1UW4A 3LQVA 2CPIA 3MUMP 1ZZFA 2RT3A 1X4CA 1VQOS 2FHOB 2DITA 2O3DA 4TLQA 2M8DB 1VQ8S 2KFYA 4A8XA 3P49B 3P5TL 1VQ9S 2CPEA 1Q86T 2KYXA 3V4MA 5GMKa 2MZRA 1HD0A 2CPJA 1R8PA 3G71S 3NS5A 4IUFA 2J0QD 3EGNA 2DO0A 3UE2A 1M5PC 2MQOA 3EGZA 2RQCA 2RNEA 3P3DA 3ZZYA 2LECA 2LA6A 4F25A 1H2VZ 1KOOA 2DIUA 3SXLA 5JVHQ 2DHGA 2F9DA
chains in the Genus database with same CATH superfamily
4X2BA 5L1LA 3L7OA 2IM3A 3MR7A 2NS1B 4UQGA 2QFIA 2WVBA 1G7CB 2ZH9A 3ISND 2MMYA 1UJ4A 4ANCA 4ED5A 5HLFA 3HSGA 4WFAQ 4DI6A 2ZNYA 4LFBF 1CJVB 4DOZA 3FEYB 3CB4A 2C3YA 3CPWR 2Y9HA 1R0CB 2B7CB 2YPZA 4OZ5A 3PFOA 2R7VA 4GVBB 3SDEA 1FJGF 4NLSA 1SH0A 1HWJA 4JI0F 4LSNB 3CJSA 4LF4J 1EX8A 1H6KX 3W7BA 2OPSA 2E5HA 4N8NA 1UP1A 2HVHA 4O3RA 2Y3YA 4X4NA 2EBGA 1MW7A 4JI4F 5BJRA 3I32A 2RDJA 4CO4A 2AEMA 1SL2A 1NJYA 4OZ1A 3F73A 2BOPA 2I2YA 4F4ZA 3CCZA 2Z57B 3QIPA 1WORA 2XMWA 3MPDA 1RA6A 4NPOA 4U8YA 4P2FA 4DV6F 3ZZZA 3V6HA 4WXOA 1V3SA 2YX7A 4UUWA 5D4LA 1QDUB 1CPZA 1VGYA 4CQ1A 1WI8A 2HG4A 2J6SA 4ES2A 2CDRB 3MZIA 2G1HA 4QWAA 1S9GA 1PC5A 3MUTP 3Q83A 1U49A 4DR3J 3M6WA 2AZ3A 5CCLA 2JWNA 4DPYA 1UCNA 1X4BA 1AFIA 2XS2A 3H40A 3ONQA 3G9CA 2K1RB 3WX4A 1S57A 1S6PA 3OPKA 4ED2A 3B78A 4K4WA 4I7FB 2MZQA 4NEYA 3H5YA 1TL1B 1RA7A 3TR5A 2G2ZA 3LP1B 3GP9A 1GQEA 3EVOA 4GKJF 4MJKA 4IR1A 3LPYA 1UEVA 3KTQA 3C8YA 4Y2MA 2ALYB 1TKDA 3WC0A 4KH1B 3QO9B 5H1SV 4FDFA 1TK8A 1Y5IB 1EB0A 1HL6A 3F56A 3NWGA 2D9PA 1RWVB 3L09A 3PV8A 2HNDB 4FF2A 2O1PA 3D4JA 2HKEA 1FEHA 3OQ2A 3QZ7A 1KBRA 4B3RJ 4P73A 4QYRA 3AA8A 2YNGB 2OFHX 2D3UA 1HWIA 3JQKA 1S9FA 2HLUA 2CQBA 1PC4A 2VFRA 4ZVEA 2MYFA 1B3TA 4K0KJ 4DL7A 2B51A 2PT0A 3MM7B 3OFHA 3ZTQA 5H9FK 5GAHU 1D8YA 2CQCA 2KXFA 4Q8FA 3NGKA 3KNAA 4ZPWR 3DRPB 1U6ZA 2DR9A 5F9NA 1YBAA 4DQRA 2EWHA 4IKAA 1C2PA 3M8PA 1D8ZA 5IFMA 4OV6A 2AJFE 4JYAF 2GMLA 3BBFA 3A12A 4QIEA 3M6UA 3PX0A 4WE1B 2E7XA 3LAKA 1M0SA 4RUBA 1GXUA 2A2DA 3B4MA 2KXHA 1AT1B 1WHWA 2IYIA 2R8IA 4MYTA 4NLUA 1IKVA 3QT6A 1TUGB 3Q22A 1R7IA 3J7Z5 2MZ1A 5DZ7A 1WHXA 2EBEA 3P96A 4ED4A 3QGIA 4G6VB 4DPUA 3GFYA 4CYUA 2JEGA 4DX5A 2QN6B 2A1BA 3KLIA 1YITS 3ISNC 2LEBA 2B3TB 5C24A 5KFPA 2VDHA 3VCDA 5D6GA 1QY7A 2RQ4A 4AE5A 3DCAA 1KNZA 3MFHA 2D41A 4OL8A 5I3PA 2DKOB 1C1BA 4OZJA 5DM7Q 3CCMS 2VH7A 4DV4J 3ICLA 3PVXA 1QAIA 4LREA 1SJQA 2C2ZB 1DTTB 2XNQA 3LQVA 1VQOS 1U0SA 4TLQA 2KFYA 2XGPA 3MPWA 1WC4A 3QJJA 4CLUA 1RLCL 4M1KA 5C25A 1Q95G 2EKYA 5KFXA 3NOGA 5L8RC 3OHBA 4ZPTR 1HI0P 2RDIA 3FEZA 1Q8BA 2RNEA 3ZZYA 4KGVB 2WOMA 1MROB 5HBMA 3HHLB 4CO3A 1HMVA 3TZZA 5CAAA 5SZTA 1DQAA 7FD1A 4DFJA 3PW4A 2MQNA 2ZH2A 4UF4A 3RBXA 3P6YC 1IR2A 4YHHJ 1VBXA 4ZVQB 5HLFB 2EC2A 3TZXA 4OYAA 3GJTB 1ZTTA 2B9XA 3R8YA 1Z2ZA 2CWXA 3IS9A 4CDIA 1MMDA 4CLWA 3OTOF 4LFAF 4DR2J 4KR0B 3UW1A 2HFSA 3Q0AA 4F8RA 1MWZA 2W4CA 3WDOA 2OPPA 3DN9A 5J2NA 1RADB 4TKTA 3BGRA 1FRJA 4PAAA 3DNCA 3MAHA 1PCAA 1PIEA 2NXCA 3E51A 3H59A 3L7PA 3D6HB 3MI7X 3M1VA 4AQYF 4DJBA 1U0HA 2HQFA 2NSCA 4URSA 1UFKA 3FCWA 2VFSA 3QIPB 2B5JA 4ZVSB 2M9KA 2CNLB 2XMMA 1HNXF 2UXBJ 3GIRA 2CPDA 2HQDA 5CYMA 3BS9A 4DV7J 4XPEA 1S9GB 1QUVA 2W9BA 1QM9A 1U1LA 3QWPA 2YQ1A 1H2UX 3TAMA 3PO5A 5E3RA 5AT1B 5FJ4A 1S6PB 2PA3A 1D3WA 4BS2A 4IYQA 1NMEB 2AEFA 4CT9A 5IM0A 2CRLA 2XULA 1XQIA 4HT5A 3KJFB 1XBWA 5DLGA 2YVSA 4NL5A 1FX2A 3BM7A 2RS8A 4PUOA 1YJVA 4BWMA 3KJQB 3FEXB 2VQEJ 2ZH8A 3DLKB 2X1GA 4F0HA 4C2MA 3UNGC 1P9QC 2MPUA 2EFNA 2FJXA 5E41A 4XK8C 1N54B 1N6QA 4DBQA 4KSEB 1E6VA 4DSLA 3ZNUA 4F02A 2A18A 5HJYA 3NKYA 5E0OA 3MUVP 5GAGU 3X3UA 2ZC4A 1R89A 2AEJA 2VBZA 2KDOA 2EPIA 1NK8A 1M1HA 1JJCB 3DDNA 4WF9Q 1SL0A 4YY3J 5RUBA 1HW8A 3ENQA 4N56A 2GQ2A 3DRRB 2XHWA 3J81Y 1Y7PA 5F41A 3FZ2A 2DNQA 1BUXA 1EP4A 4NCGA 3QYYA 4WWSA 5DDRC 1SQEA 2FJDB 3AFGA 2Z2MA 4YEAA 2R9LA 1L3TA 3SMZA 2Q43A 4A8KA 1KFSA 4ZP7A 2HSEB 2DGUA 2ZM6J 2E5LJ 2KVQE 5E3PA 1IKVB 3Q8YA 3K5OA 3RGIA 3OR2B 2JJ4D 2IBOA 2MZTA 5D0EA 1RAAB 4F3OA 5U47A 4CYUB 2B56A 2VG6A 2ROPA 4DV2F 3CCJS 3IC1A 1IWAA 1PYOB 3AQOA 2RUSA 3G8TA 1P1LA 3M2VB 3CJ3A 1C1BB 3DKDA 5DS7A 2DT9A 4CNYA 4RW9A 1U26A 5JJBA 2LFVA 2A6MA 2EFGA 3DXBA 5KFLA 1EIYB 1WG5A 2V8PA 1RTDA 1GTEA 3PEHA 2XCAA 4KKOA 4EUVA 3A3NB 3GCXP 1YBTA 2QL9B 2ZC3A 3LAMA 1HQUA 1B7YB 2FZCB 4H4MA 2MQOA 4WFZA 1FVQA 5LOQA 3ZTRA 1NPRA 2WOMB 3CCWA 2DHGA 1HMVB 3FNNA 3TWZA 1XR7A 4P7VA 3ETMA 1L3SA 3KKFA 1BC6A 2CQ2A 3K57A 4K50A 5BYQA 4C0OC 5SUHA 3KYLA 4MIWA 3PTWA 2UUAF 2AYGA 5AXNA 2VKZG 3CJQA 5DDPC 4FYWB 4E2FB 3AT1B 2BE2B 1PILA 3FCVA 2IHR1 3M8QA 5E5NA 2I38A 1BXNA 2DD8S 3L9ZA 2IPOB 4DL6A 1KD1T 2IJRA 3S6EA 1TL5A 5J2NB 1SBRA 2XB2D 2YKPA 2V0NA 4TLRA 3PDNA 1WC6A 3AOBA 2BE9B 2HHTA 4QU6A 1T11A 1HNWF 3MM9B 3MOJB 1U0HB 2G0IA 4ZLJA 2WB4A 1HYSA 4JV2A 4J9OA 2AQ4A 5CZVA 1PGZA 4F4KA 4DEZA 1DQ8A 2KO1A 4EWTA 3AOCA 4B3MF 3I87A 1EQ0A 2MY7A 1XMOJ 1U8SA 4LF7J 4Q44A 4UTGA 2HHXA 3H4BA 3RRHA 2IAJA 4F36A 1NBEB 2W9BB 1YRTA 1YJWS 4Q2LA 2OMLA 5A76A 4LUBA 2MJUA 2DR7A 4A8SA 1B4SA 3TAMB 5LMNJ 3EGVA 4ZP9A 2IY5B 2CADA 3TQEA 1VIXA 2Z2YB 5EX3A 1NLKL 1FRMA 4KB7A 3LW5C 2JRSA 1Q8IA 1Z1ZA 1Q1KA 4DR5J 1HKAA 1UWAA 1ZA2B 4H4OB 1FRXA 1J5EF 2PFDA 4PUOB 2BR0A 5KFYA 4ZLLA 1VC5A 1I3OB 2HHQA 4P75A 1VQPS 3VGTA 4DUZJ 3UN2A 2FB0A 5L1IA 2KFNA 5DDQC 1OY6A 4NYOA 3M9NB 5HVFA 4URGA 2QMXA 2ZH1A 2DEIA 2VUGA 1N6QB 3SI8A 4N5SA 1E6VB 2H9ZA 4EI2A 1R31A 1F60B 1FE0A 4USUA 1O6XA 3T1HJ 3GV8B 3CDUA 4IRKA 2K7JA 3U27A 4K2JA 3RRGA 2KJVA 4O3PA 1Z4UA 2VU5A 3J7A1 1AW0A 2W8KA 1CSJA 3LOUA 4LF4F 4LRCA 2VFTA 1JNZB 3KMSA 2E5JA 1S1WA 3FMBA 4OJGA 1DY3A 2VPXB 3KUEA 2J7KA 1EP4B 4NCGB 5IT0A 1DTQA 3NOCA 2JC0A 1K73T 4QBUA 4MMOA 1GEHA 4JI7J 2FTRA 1IWGA 4HKQA 4WP9A 3K58A 1JLAA 3T19A 2PC6A 3VZIA 3R5BA 1K9MT 1GH8A 2ALZA 4DV0J 3DYAA 1JJ2R 4ZCMA 2CVEA 3FJ2A 4EBCA 2AJ0A 3GV7B 4YUDA 4ZVGA 4X84A 1I6JA 3Q8UA 3M8RA 1FXDA 3IWNC 4DR3F 4DFMA 1SJ4P 4FYVB 1U1KA 4ID5A 4ECTA 1Y9OA 3JSMA 2CJYB 2G13A 3BSAA 2VG6B 3TZYA 3DRSB 4J5OA 2CWKA 5JXSA 4ZP8A 1F3VA 4GVLA 1ELOA 3KHRA 3W1YC 3I96A 4XPCA 3GG1A 2IM0A 1UKUA 5B7WA 3CVKA 2VBWA 1QE1A 1Q8KA 3PFEA 4RW9B 2HVEA 1IQTA 3DMJB 3KLFA 1KWMA 2HRTA 4IG0A 1TP7A 2E9ZA 4CH1A 3VALA 5L38A 3A1YG 4TY9A 4BLGA 3J7AN 4UOFA 3MUMP 4OJ3A 1W26A 1YJTA 3E3XA 1RTDB 3UN5A 4IRCA 2IA6A 1VQ8S 2JL9A 1XC9A 3EDQB 2QLXA 3GMGA 2GMJA 2HHHJ 5E2QA 4B3RF 4DR7J 4ICLA 2IJNA 3EGNA 1TAUA 1YRXA 1VBYA 5HL7Q 1K44A 3L7UA 4K0KF 2XSFA 2GVDA 3SCJE 2DGSA 2H3EB 3AD8C 3ILOA 1VISA 4ILRA 3MDFA 3CTRA 4F4WA 3D5MA 3E01A 2B4VA 4ZJOA 4I6AA 3FQLA 2KRRA 2IJFA 4EBDA 4A8YA 1N88A 1WEXA 3C6TA 3FSYA 2BQUA 1IJFB 2CJBA 2WTFA 2GQCA 5M2RA 3M8QB 3IR5B 1KQKA 3V6JA 2BJ3A 3ZTPA 1TV6A 3UWTA 1NHUA 1X5SA 4J37A 4ERDA 3QRQA 4USKA 1RHKB 2YNHA 4LQ9A 3RAQA 1VMBA 2V5HG 3ENVA 2XG8A 2GV1A 4F0MA 1M5KC 4X4UA 2R42A 2WVDA 5KFSA 2JLGA 2HFOA 2RILA 3O2IA 3VQTA 2OH2A 1RHUB 2G2YA 2FZKB 2W8LA 4DQIA 1Q53A 1JXEA 1FCAA 4NLYA 1NSPA 1HYSB 5BR8F 5DQIA 2R2TA 2LQBA 2VZ9A 3R5GA 4A4JA 3MEKA 2JZ5A 4WU3A 4J9MA 1DHMA 2OEJA 2FVCA 2JVRA 1WF2A 1H73A 2KYZA 2IAJB 3EVMA 3W2VA 1MN7A 4UT4A 1F1BB 3B54A 4HTIA 1BWVA 2YWKA 3TA1A 4DUTA 4FNIA 3MWBA 1B0PA 2EXUA 1D9AA 1UZDA 4K4XA 2WSEC 1SUQA 5L39A 4DFKA 1ZETA 2PSZA 3K8VA 4N41A 5AE2A 5KFCA 1QD1A 3EICA 3GYGA 1VFJA 3RB6A 5J1NA 3BBBA 1HNZJ 2VQFJ 2E1MC 5C2GA 2J9EA 1VJWA 2WVCA 2GIRA 2LU2A 5A6WA 1RWPB 4O0IA 4ANDA 4MIBA 2MGZA 2AHOB 3M8WA 5LM7E 4O3SA 4DSKA 2OGUA 4YHHF 4BC9A 4OZ2A 2AD9A 4ED7A 4LQ3A 3MAQA 2DH8A 1Y4ZB 2FD2A 2VOPA 5DG9A 1L5UA 5A8WA 4OYBA 3CJKA 5F8IA 1RB0A 2J6UA 3IGNA 4F67A 2R8KA 4K4TA 4TQSA 1REVA 1K8AT 3WIVA 1S1UA 3SZ2A 2FJWA 1T9UA 2PI4A 1S1WB 3PEJA 4Y00A 2OMOA 2GVZA 3QJPA 5B09A 4HDGA 3QIDA 3ET6B 4TU7A 1DTQB 3ENWA 1T9XA 1NZAA 1IXKA 1V3ZA 1OWXA 4ECUA 3N5FA 2ZKUA 1FDBA 2QSFA 3M6XA 1JLAB 4YB5A 2M2BA 4DV3J 3JTNA 3NS7B 3OLBA 4RWXA 4N8OA 1UJ5A 2CJXB 2UXBF 3CJ0A 4ZVUB 4L76A 1GNKA 1N36J 3CJ8A 1HD1A 3SQGB 3TJAA 4EBEA 2CQIA 4DV7F 3BPSP 1T02A 2V2KA 3D2WA 5H9EK 2XMJA 4O44A 1HNVA 4I6YA 2ZDOA 2QYCA 2IMOA 4AXJA 4NX9A 3JSMB 2JFKA 3LP0A 1FWLA 3VAFA 3B4DA 5A2QY 1RJJA 5CYJA 1EZZB 1MMNA 4ZN3A 2HFZA 3MOZA 5ETPA 2Q1LA 2WBRA 2MZJA 2DNGA 2CQ0A 2B0GA 4DHVA 1U48A 1EARA 3X1LB 3K5PA 3PACA 1QE1B 4B9SA 3RB3A 1RI7A 2WONA 3GFZA 4GC6A 1YBUA 3KLFB 1AROP 4WP3A 5EUHA 4IG0B 1JLGB 4NA1A 4A8QA 4CO5A 3CXCR 1S1VA 3CD7A 4KO0A 4XAKA 2VQEF 2OLWA 4U7UD 4LR9A 3PHEA 4DUYJ 2WRMA 3P5TL 2POKA 4ICLB 2P8IA 3GYNA 3NS5A 2MHEA 1JXLA 3THVA 1C0TA 5KFUA 1YRUA 4OYZA 3HSDA 1WOOA 2GMHA 2I9SA 1GT8A 2DXEA 1LWFB 2F4FA 1S0NA 3RB4A 4PG7A 1WKJA 2GVDB 4P9SA 1CJKB 3TVZA 4YY3F 5AE3A 2HK3A 3E01B 5HN0A 4WTOB 1HBNB 3ZFVA 1QJHA 1JWWA 3CNQP 1NXIA 1S4FA 2WK4A 1AXQA 3TO8A 3KJVB 1A7GE 1TV6B 4Q5VA 3PYFA 4WK3A 4M5GA 5J2MB 3UVJA 3RAMA 2YNHB 2HFUA 4LT6A 2XYHB 1KOHA 5GADI 6FD1A 2GJ2A 3LGHA 4F3QA 4NYPA 3C19A 4WXWA 2OEMA 1RK8A 1WG4A 4Q0BA 1SH2A 5KFAA 2UVWA 3U1LA 2FY8A 1SIZA 3NGUA 3EYZA 1ZZNA 4F4YA 2B7BB 1TKXB 5ETVA 4N76A 2PDAA 2M0GB 2MEWA 3J80Y 3I5CA 2FHKA 5KFHA 2ADBA 1RAJA 3GJQB 4CLPA 3PHTA 4C97A 4A8OA 3W2VB 4DL3A 4M5HA 1V5IB 2FYXA 4P71A 3GIMA 2NQPA 1WUUA 3V6DB 1UW9A 3HDSA 2XS7A 2R8JA 1LNQA 1CULA 2FC8A 2E44A 3W60A 3W9IA 2XI3A 1SUQB 3HXMA 1F5AA 2XMAA 2I5JA 4A8FA 3RZAA 1ZM9A 3M2RA 1RAGB 4P72A 4URQU 1HFEL 1T9YA 1T95A 3Q86A 3GR0A 2VF3A 1WHVA 3DLEA 3NXZA 1ZAVA 2V2QA 2Q79A 2JC1A 2EFOA 1D9FA 2BBEA 5EX0A 4I1TA 4A46A 3OTCA 1AFJA 1CEZA 2V8GA 2CAJA 3BF4A 3EWGA 4DV6J 2HVIA 4M5NA 4UQTA 3K0JA 4RR5A 2MGZB 5ITHA 2HEKA 3DI6A 3FMWA 3T3FA 3PKMA 1DAXA 4RBTA 2ZITA 3TZWA 5A8WB 3UD3P 2AP6A 2M5YA 2DRBA 1REVB 3H2UB 1EJ7L 3WBZA 3KOAA 1S1UB 3CC7S 4HVZA 4NLGA 1LFPA 2V9KA 5HJXA 1Y5NB 3N9UC 3A13A 2LEAA 1YKWA 2GVZB 4ECXA 1FK9A 4WBFA 3IM9A 1HI1A 2IFXA 2VOOA 1X4FA 4DX7A 3HZGA 4LRAA 2VICA 3HVTA 4QW8A 3HKWA 1Q7YT 3IRXA 4HACA 3DOKB 4CZCA 4X4SA 4WU2A 3AJ1A 1XMOF 1T03A 2BM0A 1EKSA 4NA2A 3VAJA 4LF7F 2OJ3A 3C15A 2ZJPQ 2FDNA 1N56A 5M2PA 2LKZA 3G2XA 3NP5A 5M2UA 4O44B 1X0FA 1MU2B 1N8RT 3LH2S 4ECQA 3JQJA 5LMNF 2VFVA 1RT5A 2EI5A 2J76E 3PW2A 3KFWX 2Y1IA 1XEZA 3G6ES 3D67A 4OI0A 5HMXA 4USWA 1GMWD 4DPXA 5I42A 3TUIC 3HFVA 5FD1A 4DR5F 1T9TA 5IV3A 2WONB 1FX4A 5EGYA 2Y1RI 1B64A 3MD1A 4JYAJ 1NPKA 3H90A 3CWJA 2UUTA 5KFOA 1FFGB 2ZH5A 2UZAA 3SYZA 4DUZF 1S1VB 1JX4A 4KO0B 3BH6B 1AZSB 4DPWA 2H4WB 4K59A 5K8OA 5C42B 4QIVA 4Y28C 1O51A 4ZPBA 3MECA 4CM2A 2DRDA 3TJ9A 1IR1A 2BQRA 1C0TB 2MLXA 3IG1B 1Y11A 2OP5A 2JEIA 4PXEA 1H2VZ 3T1HF 2L9DA 4P2SA 2A0FB 2CJ9A 2ZUAA 1VQYA 2OD4A 4Y3CA 1YG0A 1ZAWA 2ZH7A 5KFDA 4WFBQ 2AJ4A 1KVIA 4RW6A 5ADZA 5F0UA 4KJIA 3PJ9A 2AMCB 5FIIA 2XM3A 3CC2S 2LQ9A 2CQ4A 2ZEJA 3QFHA 4MFBA 3W5XA 1NM2A 1T8EA 5DRKA 3HVWA 4ZHRA 1OQ3A 1XJWB 1KR4A 3ZNJ1 2UV8G 3OSNA 4C11A 1RHQB 1RT3B 3CMQA 4JI7F 2CQ3A 3UVJB 1NKBA 1NK7A 5T14A 3NY0A 4F7VA 2A3JA 3NNHA 4QWCA 3VQSA 1P8GA 1XMQF 3D0HE 3P4UB 4EGLA 4DV0F 5F0WA 4ZVFA 1YIJS 1XNQJ 2K06A 4Q0BB 4L6V3 3O6QA 5DG7A 3CIMA 3NEKA 4C8MA 3A4TA 2J9DE 1H74A 2ZUGA 2ILYA 1S6OA 3IBFB 2HVDA 3S1TA 4ELVA 5L1JA 3MMAA 4LSLA 1F9EB 1WC1A 4C8ZA 2FVSA 2XQCA 2QEXS 4JB8B 1F0XA 3L3CA 3QT8A 3DLGA 4OYPA 3KLEA 2EG1A 1UMJA 3QAUA 3QRRA 3Q8SB 4PWWA 1MWQA 2BKOA 1PJ5A 3OTOJ 4LFAJ 1CULB 3RW6A 5HROA 4ECSA 4DL4A 5KG2A 4FF4A 2GGPA 5KOXA 1B99A 2K8GA 4F2SA 3M2RB 5DO2A 5KFEA 1RISA 2D3OR 1FD8A 3FBFA 2IVMA 1PSDA 2HHHF 4K5RA 2KHDA 5CXTA 4DR7F 2H65B 2L48A 3LGMA 4B9MA 1NJXA 4N77A 4X4VA 3GJRB 1CQNA 1B0VA 1M1GA 4HH1A 5F8HA 1RT6B 1YHQS 3SFUA 2FHMA 2VA3A 2ILZA 1NJZA 2AF6A 1HNIA 2NUUG 2XS5A 1L3KA 2HS4A 3KK2A 2MXYA 1VS3A 2ZBRA 2YWHA 3MPUB 1YQHA 1U1NA 1HNXJ 5KFNA 3DI6B 1ZTWA 4DQQA 3M8ZA 2W2NP 1K47A 1PG5B 2RDDA 3VGVA 2BRKA 5DZ6A 2O67A 1R8AA 3V2UC 3WZ0A 4B17A 2WB1D 2DGQA 3QSIA 1QTNB 3RR7A 5CA5A 1NK9A 1WOSA 1QTMA 3OR1A 3HHLD 3W66A 3OSPA 3AB2B 2YX1A 3FRZA 1ZM2A 3MTJA 2GO8A 1TKZA 2AWZA 5IWAJ 4DSFA 2ZNZA 2V4JA 3R97A 1SQGA 1YJ7A 2AKWB 2UXCJ 3RRKA 3THPA 3T1YF 3UNYA 1U45A 4RNNA 1PAUB 1S9EB 2LCWA 3LP2A 3H5UA 4HH0A 3HVTB 2JLFA 4L74A 4HEA9 3IRXB 1MWYA 2W7AA 2XHCA 4HACB 4DV5F 2ATCB 1IBKF 4KFBB 3OTEA 4AL7A 1T03B 4QJVA 1CJTB 2PMWA 2A6OA 3C15B 1FXLA 5HI7A 4R0JA 4MKAA 4JI1J 1WNEA 1X9SA 2HK2A 1HHTP 5GMDA 2VG5A 4WZMA 3W61A 1VK8A 1S1TA 1GXTA 3JYTA 4HI1A 4O4RA 4B3TJ 1DFDA 5I42B 3H5XA 4X65J 2M88A 5KG6A 2OI2A 5KFMA 1IKYA 1EKRA 4JI5F 1AUSL 3P5BP 3I5BA 4R8UA 4NXNJ 3C14A 1HNZF 1JLQA 3MM8B 2RRAA 2VQFF 4FYDA 1FERA 5D8HB 1N34J 1S0OA 3UFCX 1FJCA 1R6YA 3OTBA 4OZLA 4C48A 2R2RA 2KG0A 3E8OA 8RUCA 2CVIA 6AT1B 2XLJA 4KH0B 2F63A 1NH8A 1BQNB 4PEOA 4IQXA 3G6XA 5GMKa 4DZDA 2HBQB 4KV8A 3H2LA 3H7HB 2ASLA 2E1RA 3P3DA 1IVZA 2RIJA 2O66A 3NGSA 2VDIA 5HQLA 1UEUA 5IQ6A 5ETSA 3DGPB 4RPFA 3GR1A 3MEDB 4DCOB 4AFFA 5E3CA 4PXCA 1CQMA 2DVIA 3CDEA 3PO4A 4ZLPA 1TL1A 2QL5B 4C98A 3A8EA 1BGXT 3KLHA 4G1IA 4BC7A 2IRXA 1SKRA 4ZHRB 3N4WA 2F8MA 2LYVA 2WCXA 4C11B 3D0GE 4FXVA 2NZ4A 3R2CJ 4JI6J 2D3ZA 4U9RA 3RB0A 1U8WA 5KG7A 3T1AA 4C0HA 3BKUA 4DV3F 2HNDA 2PO4A 4P2MA 1VRTA 4GMKA 3C2PA 3BSCA 2GC8A 2UUCJ 3I4PA 3NLCA 4ZIWA 3MR3A 1PBAA 4NA3A 2YQ0A 1N36F 2YNGA 2XYGB 2L9NA 3PXGa 3NG8A 2AX0A 1S49A 1U25A 3I9V9 2X3GA 3D54A 2HFNA 1CJUA 5F9LA 3MMAB 4LSLB 3KG0A 1NAQA 3HHDA 3PG9A 1XNRJ 4XDCA 1U1QA 3G8QA 5KFGA 2AW0A 1V3RA 4ZCLA 5KFZA 5EHHA 4ETZA 1KP6A 3HHKA 3KLEB 3W2WA 4DSJA 3CO9A 1Y0HA 1HHSA 4FP9A 4ZJLA 3BQ0A 2H51B 2WHOA 2Z58B 3SV4A 2F7VA 2BQ3A 5HROB 3BB5A 3HHLC 2LDYA 4MYUA 2IA0A 2YY3A 5ETMA 4I67A 3JS9A 5IC4B 4H4KC 1Y10A 3ZZPA 1RWNB 4EK2A 4DUYF 4JOUA 2SXLA 3DHXA 2RS2A 3LF0A 2CFXA 1SCJB 4J9SA 4WTYA 2VV5A 2EFQA 3TOQA 1FF2A 4M8LA 5D77A 4FXWA 1HNIB 2XZDB 4ENOA 1LXNA 2CQGA 3FCHA 4IH6A 1C4AA 2PIIA 1FDAA 1VRQC 2PMHA 3MXHP 3EPGA 2CPXA 2BOAA 2BE7D 5J1EB 5K9FA 4EZ9A 2CG8A 1QVGR 1URRA 2L08A 5HP1A 4KGZB 3OR1B 4N47A 3K17A 5A8KA 4OHZA 4U96A 1N52B 3HX9A 3CCTA 1TKZB 4F4AA 4HHUA 3POTA 1RLDA 3BYPA 1IKXB 4R5PB 4YP3A 1S5ZA 5ETNA 4PR6A 1M1KT 3TNVA 4IFVB 2DCUB 4OI6A 4OX7A 4BWJA 2MLZA 3LP2B 1S76D 4G3IA 4OI3A 4X62J 1FT8A 4FKXA 1KHVA 3GIKA 4H4KA 4A8WA 2YWGA 1SQFA 5KG3A 2VBYA 4NZ0A 4ZIVA 5D78A 4G1PA 3M4XA 2VG5B 4DR1J 1Q8LA 3PJXA 5CABA 1S1TB 3BEGB 1X4HA 2HWIA 5DM6Q 3JYTB 4W4MA 2D9OA 4DDFA 1RWUA 2KJWA 1LKZA 1TL7B 2CQHA 3RBDA 3NBPA 4AL5A 2HZAA 3UCGA 4D3GA 1RYRA 1IKYB 2W2PP 2ZBQA 2IMWP 1H3DA 1IR0A 4R8UB 3C14B 3VTIA 2JDJA 2MKSA 1OSDA 1JLQB 4PPZA 1SH3A 2GFFA 3UR0A 3MM5B 2CA9A 1O8BA 5K8NA 1FFSB 2VC1A 2FHOB 3NCQA 2CNOB 1PJ7A 3PR4A 3P49B 2IC3A 1Q86T 3W8GA 3JSBA 2DBBA 4KV8B 5HSPA 1HR0J 4O4GB 2RQCA 1OY9A 2E9RX 3ZZTA 2DHHA 4Q45A 2HGLA 1RT4B 4J9NA 1XN9A 2YQ3A 1WG1A 4YMEA 2NUHA 2HFVA 2R7WA 2KT5A 3GFHA 2IIHA 3A8JA 3BN4A 2Y0BB 2KVIA 1WF0A 4CP5A 4DSEA 2OPQA 2PEHA 3KLHB 4WJBA 3AXKA 2CXEA 4RZRA 5CHCB 1S59A 2V9WA 3VR1A 2I1RA 1YZ6A 4B3SF 1A0OB 4QW9A 2FC9A 2G4BA 4ED1A 2Y8WA 3LANA 3DLKA 3OVSA 1E6YA 1F6TA 4NLVA 1LWEA 3CIZA 1KLNA 5BXIA 1VRTB 4X4RA 1SJRA 4FS2A 1NO8A 1TELA 3CDAA 2GCFA 4CLSA 4ELTA 5CD4H 3BKFA 2L41A 1MN9A 3RYLA 1CJUB 5DJBA 5IQQA 3S8SA 1G3OA 3JXOA 3C16A 3W65A 4CH7A 4J90A 3W9HA 1S6QA 4MT1A 3ULHA 3FSXA 4G1QA 1RBOB 3W62A 1LFWA 3DRRA 3SQOP 5F8NA 3W2WB 3U02A 1U2FA 1X9WA 4NI2B 5LXRA 2J6TA 4DR4F 4CIOA 5ETKA 5T7LA 2P9EA 1U02A 3D66A 1WDDA 3M32B 2MLYA 3N0VA 3VAGA 1LQ9A 1FTRA 1CC7A 2DO4A 4U6PA 3A3PB 4EZ6A 3H4DA 3UD5A 4USTA 2BANB 2YNIA 5KTQA 3OR2A 5THWA 5BR8J 4KHRA 4ZPAA 8AT1B 2R8GA 3WC2A 2DH7A 5D4NA 2YKAA 3FBEA 4P10A 5KFWA 4NZ7A 1HBUA 2QFJA 2VA2A 1P9YA 3RW7A 2V4RA 1X5OA 3M2VA 3GFXA 5A6PA 3EUNA 2D69A 2CNNB 3Q2SC 2APOA 1X5PA 3IBWA 3M9MB 1BMQB 3M8SA 3IXQA 5HP1B 5B0GA 5A8KB 1S0MA 2UV8A 4Y65A 3SV3A 4ATNA 2GAGC 3ILLA 3TUZC 2HQIA 3POTB 3GSDA 1XNQF 4CM0A 2LXUA 5IV4A 5G0RA 3CMES 2MQPA 2PGCA 3K8WA 4QWEA 3QGPA 1DRZA 1WTBA 3RR8A 3GIJA 3K2YA 2FGCA 2BJEA 3V4IA 5IT4A 4ECRA 1D1UA 3QQCD 4OZNA 1YJUA 2FZGB 1U2CA 2VPZB 3HZEA 1O0PA 3F0NA 1FRKA 4DG1A 3FVYA 4UZBA 1JXVA 1HBMA 2CJAA 1LW2B 1W2IA 1TQLA 2BE2A 2Q6CA 3DOMA 2LQ8A 3TX0A 3US5A 1A9NB 1DURA 4HHHA 3U1MA 2ZH3A 2QG9B 3UCUP 5DETA 2EFVA 4OHXA 2L3MA 3NBPB 3RBEA 4OZ3A 4Y2CA 2HIYA 3RU0A 2R7XA 3MM9A 4U67Q 3R7SB 1S0VA 1F5CA 1RAHB 5D3GB 4QWDA 1HQ2A 4PQUA 2W25A 1N33J 2IM2A 4OX8A 4M5KA 3JAMU 4Z2XA 1ZZFA 1FNMA 1X4CA 4B08A 1SI9A 1PYSB 2WVFA 4WK1A 1SL1A 4ZOSA 1RHMB 1J5OA 2IC3B 3W8PA 2QT7A 1NSQA 2XO6A 4O3QA 5E7OB 2CPJA 1R6VA 4C8OA 4DL5A 1IBMJ 3TARA 3EGZA 4UZCA 2GJFA 4NMLA 2HHVA 1TL4A 1NB2A 2V94A 4RW4B 5C2CA 5L46A 5J2QA 2Q3PA 2AGQA 3EXYA 3N28A 1SKWA 4USJC 5AXMA 2VIHA 1U7LA 2IM1A 4TN2A 3TQ1A 2X51A 2IDLA 5HANA 5IWAF 1WC5A 2OPQB 5AE1A 2P6SA 5IS2A 2UU9J 1TU0B 5L9NA 1RBLA 2UVVA 4LMZA 4H4OA 2UXCF 1FD2A 3ETOA 2G9OA 2XMVA 1C0UA 4IDKB 1CC8A 4LVOP 1UA1A 1R27B 2BUNA 2HBZB 1E6YB 1LWEB 5DLFA 5LSRA 2HHWA 2YKMA 1GMUA 4H54A 3ELHA 3J81j 4MIAA 3SSRA 5HVGA 2OIHA 4J9LA 3BPDA 2BYCA 1ITPA 1FNOA 3WX8A 5HMWA 4JI1F 3H98A 3PY8A 3H42A 4GC7A 3NWRA 4M5DA 3VZHA 3C16B 3Q8RB 2RU9A 1P1TA 2C42A 3MPYA 1S6QB 2DR8A 3D0IE 5FDLA 3MHYA 1HPZA 3DDIA 4F3MA 4G1QB 1OMSA 4B3TF 2H4YB 4DPOA 4X65F 1R43A 2HRUA 2XWYA 2DNOA 2V2ZA 2EK1A 4NXNF 4UY8T 2ACYA 2Y1LB 4MH8A 2GX8A 5T7LB 1KC8T 5D15A 1N34F 5GAEI 4NEZA 3D3BJ 1V9OA 1CS4B 1JIHA 4FKYA 4X4TA 1L3UA 3NNCA 3UD4P 2QA4G 2CJKA 4UOGA 3OLAA 2YNIB 2RJZA 3BH7B 2QIFA 1UETA 1UJ6A 2LVWA 4MKVA 2ZFHA 4LRFA 1U6BA 4ED6A 1TR0A 1CG2A 3KWMA 1PO6A 3DRSA 2C22A 1HARA 1NB7A 1HBUB 2CG4A 3BGFA 3G96A 3PW5A 4NLOA 5HMYA 4GKKJ 4LRDA 3OVAA 2ZJRQ 2XLIA 4L72B 4JV0A 3NMRA 3B6BA 1YX2A 1FDNA 3CCLS 4NLXA 1S72S 2PE8A 2NXJA 2X1FA 2N3LA 2DGTA 3DMJA 2JH3A 4JI2J 3S01A 2ERRA 4K4SA 1RU1A 1YGYA 4LF6J 1OSCA 1ZM3A 4JI6F 1R0BG 1X4AA 1RBAA 2ZVSA 4QIGA 1KFDA 3EGWB 3T41A 3BO3A 2UUCF 3ZZUA 4ALZA 3AA9A 4WFXA 3OUYA 2CQPA 1WHYA 5G0RB 2CDQA 1VQ7S 2XZWA 3PX4A 4FF3A 1NNDA 3JB9k 2HGMA 4KTQA 3V4IB 1T3NA 3PRDA 3CUNA 3UDEA 2U1AA 2CNKB 3DU5A 3MMJA 1XNRF 4CLYA 4EO6A 1QSYA 3G6YA 4DG1B 2O5DA 2XYPB 1UVMA 1WJ9A 1HBMB 4GO5X 4USIA 1OYDA 5K5MA 2GIQA 1T0TV 2HHPA 2JLEA 3BQ1A 3DOMB 1KEKA 3PM9A 2MSSA 3IFEA 5IOLA 4LVNP 1Q0NA 3T5JA 3DRYA 5F8JA 2WVEA 5KAKA 4RX6A 3HK2A 3K59A 2ZBIA 3CCES 2YNFA 4ED0A 3MMBA 2KZMA 1WELA 2CYYA 2P5VA 5KFIA 3ZTOA 2BZ2A 3M8YA 1JLEA 4PQUB 4ZPDA 2G2OA 4HT7A 2RKIB 3PYEA 4B9LA 4IH5A 2Q6BA 2Y0SD 4X4QA 5KT5A 2HBYB 2V4QA 3N5BA 4QIFA 1UW4A 3M05A 2C2RA 2DITA 2QLBB 4K4ZA 2O3DA 1SC3B 1S1XB 4B9TA 2YKQA 1NK5A 1J5OB 5HATA 1VQ9S 4FPIA 2CPEA 3V81B 2F40A 3EZ5A 4NLTA 3J7YI 1R8PA 2Z2ZA 1M5PC 4OI4A 3O8WA 5D0GA 3HJFA 4ZS6A 3BDEA 1KRPA 2VBXA 2QZ8A 1QSSA 2XMKA 1WSRA 2XCPA 5J2QB 4ED3A 4Z7YA 3QLHA 2W2MP 4FXDA 1S6UA 4NWBA 4USVA 3O1LA 1Y3KA 2ZKTA 4AD6A 4DV1J 5B0DA 1NDLA 2AYMA 5BYSA 4CLTA 5IT9U 2CZ4A 1JK9B 4LFCF 1Y3JA 4RUAA 3OJSA 3ILJA 2KB2A 4RU2A 3NCPA 3OL8A 4FS1A 1VRUA 4DS4A 5LSLA 2GW8A 1C0UB 1U47A 2DNLA 1YSJA 1R8CA 4FZVA 4M5IA 1FVSA 3AQPA 3TVKA 4K4YA 3AH6A 4X62F 2W24A 2Z8QA 2YKMB 4KT0C 3G87A 4ZCIA 2OKQA 1WKKA 4CCHA 2U2FA 1YJ9S 1RTIB 2W2QP 3VAIA 1WACA 3MAAB 2KH9A 5LXYA 1HHQA 3CSKA 3HVRA 4O3NA 5CZXA 1CVJA 4M5DB 3AJDA 3TANA 3D9BA 4DR1F 3UCZP 2X7IA 1UPMB 1K0TA 2DNHA 5FDLB 1LK7A 4EEYA 2QGFB 1HPZB 3HO1A 3KNGA 1ZA1B 1EQMA 1SC6A 4RL1A 2ZOFA 3C6UA 4B3OA 3CDWA 1G2EA 3ET6A 1KS2A 1KLMA 5HO4A 2ZZNA 2VPYB 3NMAA 2BW2A 4UY85 4O0NA 4J9UE 4LF8F 1TK0A 3H25A 1Q16B 3G4SS 3DOLA 1XMQJ 4ZLNA 2KKHA 3MEEB 3MURP 4LF5J 2MSTA 4PYDA 3D6MB 4C8LA 2I0XA 2HVZA 1S10A 4LF1A 2A10A 1HA1A 4NRTA 2DHXA 1ZS6A 5D4OA 1VC0A 1Q7LB 3SQGA 2ZHOA 2BMBA 4KAIA 3HI9A 1HR0F 2W1BA 5CD4A 3IR6B 2RF2A 4MK7A 1RYSA 4LBPA 3NGRA 1RSCA 2WW8A 4XO0A 3ZZOA 2ZH4A 1IBLJ 3R6LB 5FLXY 2ZJQQ 2NLWA 3T6BA 2HS3A 1UEKA 4NOHA 2V50A 3LWLA 4OYOA 2AJQA 1TVRA 3EMTA 2CKWA 1UFLA 3FGVA 2I6WA 1NEEA 4ZVHA 3ITHA 2NXUA 3CCSS 1JLGA 3I55S 1U1MA 3G8SA 5KT3A 2DJWA 1VQ4S 4WCEQ 2BJ9A 2C2EA 3OFGA 2HZVA 2AGOA 4WYLA 2JNJA 2P9CA 1M5HA 1N48A 3OUYB 1XTZA 4JV5F 3PW0A 2FLOA 2YTCA 4CNZA 2VJVA 3M6VA 1KHWA 2FVPA 1L3VA 3S7RA 1LWFA 4RKUC 2BX6A 3IO1A 3HKZD 4I56A 1CJKA 3DGVA 3R5JB 3W63A 2C2OB 3TJ8A 2HW3A 3CCUS 1HBNA 1X60A 2XGQA 3QJLA 2X3DA 3VHQA 4E8UA 2HNYA 4QOTA 3KJVA 1UWBA 2FPHX 4KIAA 5I3UB 2DGXA 2UVUA 1OPIA 1OJ4A 4OYXA 3DM2B 5J2MA 2Z56B 2YNFB 2MHNA 1JJ4A 3ZZRA 2C3UA 3MMBB 5KG0A 5A2QU 1XMBA 4UUXA 4CTAA 4QYZK 3FQKA 2I8EA 2B8PA 4M95A 4IO9Q 3EX7B 2JOQA 2XY5A 2E7WA 3T5KA 1JLEB 1UAWA 4RO0A 3T1YJ 1U09A 4RUHA 1TKXA 5CH7B 5HK4A 1M5OC 2EFPA 2QLWA 4F4XA 4DV5J 1N5QA 3HMJG 3BREA 1IBKJ 3CD5A 4CI0B 4C3KA 2JHEA 3MMCB 1FWPA 1RAOA 1T3OA 4LBHA 3RTVA 2DO0A 3UE2A 5DGBA 3CJTA 4I0WA 4IFYB 3HHLA 1WD6A 2P9GA 2D1CA 1VCTA 1HWLA 4IR9A 2F9DA 4C9DA 2CJQA 4ZP6A 2C3MA 3V6DA 2FHJA 2OELA 5T41A 1QLNA 3QLHB 3BO4A 5CQGA 1X5TA 3KDOA 1RT7B 3K5MA 4LF9J 1WDTA 3CJ5A 4Q8EA 2M70A 3W3SA 3GYXB 3KLGB 1S79A 1RAIB 2AT1B 2J0WA 4JI5J 3MTKA 2BRLA 1GTHA 3NAHA 3I6PA 3VAHA 2DPIA 4D3HA 4JV1A 1VRUB 3ENAA 4KHPJ 3TEHB 3NNAA 3IRWP 1WC0A 1TZ0A 4K2XA 1VHFA 3NCRA 5I3QA 3IWXA 3Q23A 4C3MA 4U95A 3OXLA 3M7VA 2E1AA 5GVQA 3DC2A 2GNKA 1N4LA 2L9WA 4IG3B 4DXLA 2GHVC 3KK1B 3DXSX 4NLPA 4ZK7M 1I94J 2RU3A 4OFZA 4C8YA 2FLNA 3ADAC 4PG4A 1TAQA 3KHGA 3DU6A 4FBTA 3IM8A 4M5LA 1FKOA 1Q79A 4R0EA 3LWMA 5J1PA 3CJ2A 1N32J 2FQQB 2MKIA 4KY3A 4TVAB 2PD1A 5GAEU 4DS5A 3J80U 4PKDB 4BHQA 3HFKA 4J9KA 1NDKA 3F41A 3PNIA 4OYMA 1UTAA 4V1Ak 1MNEA 1RWXB 3KG4A 3Q8PB 2X1AA 1ULRA 4FYYB 3G86A 3PRVA 3C6UB 4B3OB 2V2VA 4YS2A 2N4DA 2DB1A 4WIIA 3I0SA 1KLMB 1NDCA 3E2EA 5EWGA 5AJ3J 1N33F 2JEJA 1OYEA 3DOLB 3CGIA 2OFGX 2ROGA 2Z4PA 4Z7CA 1X9MA 2KT3A 1HIYA 4GO7X 3IA0A 5ETQA 2ZHBA 3DOKA 1G4CA 2DNKA 1XIQA 2B9WA 1VQNS 3Q89A 2EKNA 3R5CA 4CRJA 3SDEB 4EYIB 1IBMF 4I64A 3CE8A 1RTHA 2OPSB 2RRNA 2J9DA 2RF2B 1MU2A 3C46A 1S4EA 3F44A 1LWXA 1QUPA 2KFZA 7AT1B 3QBCA 3EM1A 1UFWA 5KFRA 2R4FA 3RG6A 3HHNB 1TVRB 3A8IA 2M4MA 2KZZA 1FJEB 2UU9F 3QRPA 4LJMA 2B8QA 3B8HA 3TI0A 4ZMMA 3ITHB 1U1OA 3PW7A 3DLLQ 3PCOB 3H0PA 4USMA 2EK6A 3I4HX 1SJ3P 2HS0A 1AZSA 2UP1A 2C1EB 5KG1A 4HDHA 1DBDA 5C42A 5F8MA 2JVOA 3BQ2A 2XO7A 3IG1A 4B9VA 2FVQA 1M5SA 2ACMA 3OT9A 4NASA 4LIWA 2XZTB 4YB6A 2HWTA 3DRXA 3EJMA 1ZOTA 4M94A 3FSIA 3GV5B 1RTJA 3OL7A 3L4BC 4W98A 3MGJA 3HD1A 4PG8A 4YDXA 4U7CA 2XNRA 2ZE2A 1RCOB 1W25A 2HPUA 3OL9A 9ATCB 2LMIA 4RJVA 1KTQA 3MD3A 4UOHA 2EEYA 2HNYB 5ETTA 2BJ1A 3HF5A 4DLGA 1UWBB 4OX9J 1W7WA 3K5NA 1FKPA 3KJNB 2HRYA 1RT3A 3FC9A 4J9PA 5JMNA 4WFNQ 3HPOA 3ZXWA 4NE9C 4PG5A 1MSWD 2YWFA 3GONA 1FEEA 3GZ7A 2VASA 4J9VA 4CTAB 1B70B 1I1GA 1FJ7A 3J7YU 4RU9A 2DISA 4OQJA 2WAQD 2F8HA 1EAYC 2N4CA 2ZD1A 3LPEA 4CWBA 2CPFA 2K2PA 2OTJS 1NH7A 2BM1A 4N7TA 2M8DB 1FRIA 4LRBA 1HI8A 3GIIA 4FVCA 4QZVB 3M8PB 3N6NA 4GKKF 2R7OA 3K89A 2IVFB 3DFEA 4L3KA 3SXLA 5EDWA 2FJEB 3PKYA 2MTLA 4PWDA 3HJVA 2LP4A 1UPPA 2DYAA 4DF8A 5CYQA 2AZ1A 1IKWA 1T9VA 3AODA 4JI2F 4LF6F 3QZ8A 1B7FA 2KT2A 3MCMA 1FRLA 5KFFA 4S0MA 4TYBA 2IVYA 3HT0A 1YJRA 2HAIA 2JEFA 1RT2A 1SKUB 3KLIB 3UQSA 4EU0A 5C24B 1RT6A 4KGXB 4WPAA 2LXIA 4NXMJ 5EWEA 2XWXA 1N5TA 2W4PA 3GWCA 2VFUA 4CLFA 3UI3A 1CBKA 4KYZA 1Y5LB 1LWCA 4Q7AA 5KG4A 3JAMY 4HTJA 5KFJA 2A2CA 2B4PA 4MAKA 1WOPA 1S77D 2UXDF 3T6JA 2V8VA 3ZC4A 3BO2A 2ABYA 4OYIA 1FKOB 1X4DA 2DH9A 4CLKA 3LUYA 3PJWA 5LJ3Y 1JNRB 1BQXA 2Y8YA 1N0UA 4C6AA 5C25B 3LA0A 2QA1A 2AJ2A 3SEOA 4FBUA 1VQ6S 4CO2A 2JX2A 4QWBA 2G1DA 2VD3A 4WZQA 5HBMB 2XC9A 1S7HA 1VOMA 3I0SB 1EHWA 1WEYA 1VQSA 2EW9A 2OTLS 4B3SJ 2PN6A 3FZBA 3VVTA 3KG1A 3BV8A 4F50A 4OI1A 1S9EA 3BYRA 3D6FB 1RWOB 1F9HA 2DGVA 3G82A 4CO1A 4PPDA 2HWHA 1QVFR 2OHDA 4B02A 4KFBA 3NGDA 3I9ZA 1X4GA 3IS9B 2GHWA 4O23A 1CJTA 1SKSA 1RXOB 2DCLA 3BZQA 1VDHA 1SPBP 1RTHB 1NK6A 2OPPB 2F9JA 1WEZA 2W2OP 3BGRB 4I69A 3R5AA 1TTHB 3TX8A 3MF5A 3MCSA 2E5GA 3IMQJ 3M1VB 1R0AA 3QATA 4QCLA 4DV1F 3AXMA 3NRBA 4DWIA 2K3IA 2C2NA 2B5JB 4Y6IA 2E1CA 1S48A 4HLBA 1ZPWX 4DR4J 3HLUA 1GAOA 3TUPA 1VIOA 3MM8A 4QR2A 3D68A 5HQMA 4DQPA 5CYMB 2MDAA 5H9FJ 1N5SA 4CO0A 1HQEA 2RQKA 3RBZA 4F26A 3HSJA 4IRDA 2HQ3A 3AD7C 3DLHA 2KN4A 1BQNA 2GO9A 1VJQA 4JI8F 5B0AA 4OLOA 4HYKA 2QA4S 4ZVOB 4WKRA 5E3AA 2DNMA 2GHPA 4ZDNA 4E98A 1J27A 3FBBA 4UW2A 4Y0FA 4DL2A 5IM0B 3DGPA 3R7NB 2GS8A 2QC3A 3MEDA 5JVGQ 4KQZA 4PRFA 3JQMA 3CCRS 4OJ1A 2R3VA 1RTJB 3MEGA 3OXFA 4OLPA 1D9DA 3R9LA 4OI2A 2LQ5A 2ZE2B 3ZO7A 1RABB 4DFPA 3OFFA 3AB4B 5EN1A 1JMTA 2GZOA 4Y34A 3WQPA 1F5BA 1FKPB 1RAEB 2DY1A 3T9ZA 4F0KA 2CZVC 3A3OB 4LF5F 2DNPA 4OJHA 3W9JA 1KQSR 1FFWB 3TW0A 5B0EA 5AXKA 3R1LA 1Q81T 3THTA 4AL6A 3QNWB 5EWFA 1RUSA 2EVZA 1SB6A 3H20A 4NYZA 4DU7A 1H0HB 4OMFG 4NLDA 2G0CA 2ZD1B 2ZHAA 7FDRA 2BA9A 2C3PA 2KRBA 4O3OA 3RJMB 2J7WA 2CPIA 2UUBJ 1YZ7A 3ILIA 2DR6A 3IBCB 3LO3A 1IBLF 1FI4A 3K7RA 4DPTA 4C8KA 4ZJQA 5KFBA 2LECA 2QMUB 3R3TA 3IAS9 5JVHQ 1VI7A 3OD2A 4PWDB 3ZZ0A 1FHTA 5CYQB 1IKWB 2JSXA 3BGUA 2ZOGA 1FDDA 2MY8A 2ASJA 1KKHA 4DN9A 2VG7A 2H5JB 1NCLA 1REGX 2HQGA 1WSVA 4CLZA 2MKYA 3H5SA 1XWLA 1NPPA 2YBVA 3ISZA 1KONA 1RT2B 5K8MA 3FRYA 2N3OA 1PJ6A 2BVZA 2DY9A 4NLQA 1RGVA 4ZVRB 4OZ0A 1RKJA 2J5AA 2OSQA 2NCKL 1X7VA 4FN5A 1UA0A 8ATCB 1JLFA 1X31C 4Q43A 1BQMA 1I51B 1LWCB 2GQQA 1Z2LA 4X64J 2HURA 4PCQA 3DLBA 4J7CA 4ZVPB 3FK4A 4TYAA 1U1PA 4YR3A 3TEGA 4MKYA 2Z30B 2DK2A 2R7RA 5D0RA 3LALA 3VAKA 2ZH6A 5J1EA 1PBUA 2IDEA 3LTOA 2YH0A 1VLOA 4KKOB 3AHPA 2PI5A 4DQSA 1YJNS 2YKOA 3D28A 1HQUB 1KDNA 4H4MB 1JLCA 1S99A 5HMZA 4RNOA 1KVKA 2DXDA 5HVHA 2FVRA 1D09B 2LDIA 1VK3A 3FBCA 5HAOA 1IKXA 3CT9A 4R5PA 3N6LA 4IOAQ 1RHRB 2C2KB 4IFVA 5IT9Y 3VAMA 1RWWB 2HLTA 2COLA 3G82B 2HQCA 2R8HA 2YWEA 2XLKA 3BR8A 2CIMA 3GPAA 4K7QA 2CQDA 2OEKA 4V19X 1LEOA 2MKHA 3G6VA 4X66J 2AYEA 2QRRA 3EZUA 1BLUA 1KQGB 2WZ1A 4RBUA 3C66A 2DXFA 1TMMA 5A0YA 3PRBA 3U7JA 3JSRA 4KC5A 3I5AA 4YR2A 1SC1B 3KMQA 2F5GA 3CJ4A 2XSJA 1ZBTA 4LF9F 1W2BR 3RUBL 1R0AB 4RW8A 3KHLA 5J2PA 1TL7A 1VQ5S 2W4DA 1VBZA 1YVFA 4I6WA 1WWHA 2HIQA 4K8RA 5LMUJ 1AYEA 2RQMA 4YOEA 4MTPA 1UVNA 3OVBA 1P6TA 4KHPF 4Q2MA 5MLCV 1RWMB 3MM5A 4AXIA 2QA2A 2NXEA 4YR0A 1HQEB 4M63A 5B08A 1RACB 1DJ0A 1NK0A 3KLVA 4KPCA 4NZ6A 3D3CJ 1H72C 2C28A 2F1FA 4DV4F 1KN6A 2QJ3A 2PFFB 1I94F 5B0CA 5KT2A 4O4GA 3SCKE 2VHGA 2VODA 4OV1A 3SFGA 4NLWA 4J91A 1RZMA 1RT4A 3NGTA 1N32F 1U2RA 2PMZD 1NJIT 3MEGB 4OHVA 1OY8A 1F2HA 1U24A 5GADU 2YH1A 1MMLA 2NREA 1Y00A 4EYHB 2W9AA 2XY6A 4MK9A 2DR5A 3V5RA 3OW2R 4NCAA 1ZYQA 1N5YA 1XR5A 4FNHA 1H98A 3R7BB 3PYDA 5AJ3F 4HI2A 3V6KA 1T9WA 2F8EX 4PWUA 3R27A 3I56S 4QPTA 2P6TA 3L95X 4OX6A 3UPFA 4JI3J 2LXFA 1GMVA 4P7TA 4ECVA 2JFDA 3GTYX 1DLOA 2ZWOA 4DR2F 4RNMA 3KXDA 4DCJB 2BJDA 1FTCA 3T5HA 2J8AA 1LW0A 2AIRB 3HT3A 2WBMA 2V8HA 4BCAA 1FA0A 4DMZA 2W7PA 2LEPA 1HD0A 3G71S 2BEFA 3BR9A 3UN3A 2LA6A 1BWEA 3M2UA 3I82A 3HULA 1RP5A 3P45B 4NI2A 4Y2AA 3DYAB 2Q66A 5C7PA 1TFWA 4K4VA 3TA2A 3O3LA 2MQLA 2ZBCA 1UL3A 2VG7B 3M32A 2RVJA 3D1OA 5L9XA 4IO1A 5KG5A 3N01A 4NCBA 4TY8A 3R1HA 3P8BB 4JUZA 4ID5B 3TA0A 5CCMA 3QFWA 2IRYA 4PXBA 2BANA 3NL0A 2HAFA 3QT5A 1JLFB 4YN3B 3CC4S 1X4EA 3EXCX 2YKNA 1SXLA 1BQMB 5DQGA 2E5IA 1H7XA 1ROFA 2V68A 5LSOA 3GILA 2J0XA 3PZPA 2VB6A 3GSIA 1OQ6A 3MR5A 3CCVS 4DZ6A 1NU4A 4JBCA 2D7SA 3BSNA 1TFYA 3H2VE 1LV5A 2AX1A 3AAWB 1VQMS 4OX9F 3DLJA 1WI6A 3W64A 4UOCA 2VL1A 1X0PA 4NRUA 1RTZA 4DU8A 1GK8A 3SCLE 3GLJA 1T7PA 4P6QA 4NMXA 3DHWC 2AGPA 1JLCB 4OHWA 1C1CA 3SCIE 1UVKA 5E3QA 2W7OA 2BXJA 4LFCJ 2ATLA 2YX4A 3R2DJ 4AUKA 2E9TA 5KT6A 1QSLA 4JP8A 4Y2IA 3OXGA 3EPIA 4LBIA 3CD6S 3UDVA 2LU1A 3M30A 4K4UA 3GJSB 3QAEA 2HYIB 3C6TB 4XDDA 2FJAB 4ANEA 4YB7A 3GG0A 1T05A 2X1BA 1LW2A 1LOUA 5A0YB 3JTOA 3GB0A 4ILLA 4DR6J 2QSWA 3MPVA 1M90T 2XEXA 3BGOP 4ZN1A 3VGUA 4HL9A 3N79A 4C3LA 2XSJB 1N0VC 2IBKA 1U4BA 2F4VJ 4I2PA 4KHMA 2ZM6F 1NKCA 3KDNA 2E5LF 2XTJP 1XERA 1VHIA 1U6FA 4RNHA 4RW8B 2KL8A 5J2PB 1KSPA 1GX5A 1R3NA 2GIFA 2J8SA 1XK8A 2DTJA 4L75A 2FIUA 4ZVTB 2DNNA 3VVUA 5D3GA 2E1PA 4ZA1A 3D1HA 4L73A 4LF8J 3UDCA 2K7KA 3UR3C 1TUWA 4NXMF 4RBVA 4LFBJ 3TAQA 4Y2KA 2OO4A 4RW7A 1NHKL 2V34A 1FO1A 2QMWA 1YTYA 5G4DA 3GU0A 3T5LA 3I0RA 1FJGJ 4ECZA 1NJWA 2BV3A 3CO0P 4JI0J 1RCXB 1HWUA 3OTDA 2HHUA 3HVAA 3Q2TC 2V67A 2OSRA 3C3LA 1FWKA 1H7WA 4RW4A 4WIQA 4JI4J 5A8RA 1KQFB 1LXJA 1NK4A 1F9FA 2OAUA 3SSQA 1OS5A 1BHNA 5K14A 4PQAA 2RHSB 2J7UA 2MB0B 2DEJA 1N5YB 2CPYA 5KFVA 2QE5A 2R7QA 4PYAA 1FESA 2P2CB 1G6BA 3KUGA 1SJFA 3HD2A 4IDKA 3GE9A 3LGNA 1PAEX 3IAM9 3CD0A 5LT5A 1VR6A 2FLLA 2GAHC 4GRSA 4KGKA 2ZZMA 2KM8C 2R2UA 1DQ9A 1M5VC 4JV5J 3CJKB 1TKTA 2XI2A 4X4OA 1IJEB 2LLZA 1DLOB 2ROEA 2VKRA 2O01C 2HZCA 5K8PA 1RE1B 4EFAC 1R8BA 4R25A 1S7IA 1LW0B 3QMQA 2RT3A 3JTPA 5MAOA 1BD6A 2BABA 2WSFC 1VYAA 4J9QA 1RHJB 4DF4A 4GKJJ 4DN0A 5DQHA 2B9YA 1QAJA 1Q4RA 2RH3A 2KYXA 3V4MA 2EG2A 2MZRA 3KK3A 3O5TB 1RQ0A 1FXRA 2FUG9 2D74B 3AJ2A 5GMEA 2PA8D 4EMDA 2RB7A 2XMTA 1J2VA 2DIUA 5BYRA 3PX6A 3H8YA 1GX6A 2QLFB 3M2UB 2XBPA 3OFEA 2XMUA 1ZM4A 2HMIA 4KBIA 3IP0A 1U1RA 4ECYA 4BDPA 3QGGA 3IGVA 2YXLA 1CS4A 4Z37A 4CH0S 2N7CA 2R7TA 4TY8B 1HNVB 1SC4B 4OYWA 4OHYA 3IR7B 1QAYA 5K20B 2B6AA 4MKBA 4LF2A 3LP0B 2QTWA 1SIWB 2H48B 2FJVA 4LIRA 1HBOA 2M3DA 3BJYA 1TUVA 3CF5Q 1SVDA 2YKNB 1BY9A 3FUYA 3IWLA 4RNFA 4QYZJ 3EZOA 3BN7A 4IQMA 1RWKB 2V69A 1FNXH 3BSOA 2CZ9A 4ITSA 3D7SB 3FFIA 3R6GB 4I4BA 2Z0GA 5KFQA 2HBRB 2NPFA 4QIWD 2RHQB 3MFIA 1SV5A 2AV5A 2KHCA 1VQLS 5DDOC 1HWKA 1F3FA 1IBCB 1C1CB 2HNZA 3Q24A 1EETA 2PEBA 4DX8H 3VF0B 1IQZA 3HCXA 4LSZB 2EC0A 2Z2LA 2IYGA 3QT7A 3TYTA 3J81U 2DGWA 3T9NA 5ETOA 5IXUA 3M30B 1JKHA 4I2QA 4XTTA 2BW7A 2UUBF 1IM4A 3VGSA 1VLYA 2GJIA 1YWXA 3U1NA 2RAQA 3MCNA 1NRKA 1T05B 4ZPCA 2FY1A 2V63A 1Q82T 2M7SA 3HHEA 1G1XA 3DDKA 2RD5C 1ZH5A 1YLXA 4W92B 2VPWB 2YWWA 4ES3A 2MZSA 4J9RA 4HR2A 1V5VA 2WSCC 1QAXA 2AJ1A 2OUGA 1Q5VA 3GCWP 3TP2A 4A48A 3AY0A 4I2PB 3NAIA 2CPZA 1B0TA 1YI2S 4DCPB 1KVJA 2QO3A 4W90B 5B0BA 1VQKS 3FKBA 1AA1B 1KTVA 4X4PA 3HFZB 2H54B 2RKIA 3EE3A 2OPRA 1IUJA 2YPYA 3VV2B 2OD6A 3UO0A 1P27B 4RW7B 2M52A 2V6AA 2ZOMA 1S1XA 2ZBPA 4V19J 4ED8A 3V81A 3TUJC 4X64F 2CQ1A 3I0RB 4QU7A 2MKJA 2FLPA 4FVMA 2FGOA 2BDPA 3Q8QB 1UVIA 3O44A 2ZZTA 2V8DA 1YK9A 3R5DA 3ZTSA 2I5JB 1VBKA 2FJBB 1JB0C 5GAHI 5A8RB 1GFWB 2UVRA 2NYHA 1CLFA 4AQYJ 1HLWA 4EO8A 4M5JA 3DLEB 3NS6A 5K14B 4KPYA 4PZVA 5H9EJ 5L1KA 3CMAS 1NDPA 1WC3A 4USHA 1FE4A 2C2DA 2DNYA 2IRUA 2B4UA 2K3KA 2DNZA 1K1QA 3PYGA 2NYIA 3CEDA 1RT1A 3W5YA 2MKKA 1A6LA 2H1YA 5DGAA 3WIUA 5KFKA 5DG8A 2KXNB 3PR5B 3PIOQ 1UVJA 2QX0A 4ILMA 4X66F 1TKTB 4CT8A 3QGHA 1RTIA 4B9UA 3OV7A 4TU9A 3MAAA 4ECWA 2LQJA 1BE4A 1Q5YA 1TL3A 4WYWA 3B82A 4WP8A 1FK9B 4A8XA 5I4MA 1RKIA 2CUYA 4QPXA 3KK3B 1X8DA 2NSBA 1FKAF 4IUFA 3MM6A 5F3ZA 1C4CA 2E7VA 3VWSA 3M9OB 1JLBA 2B43A 3BKTA 2ZDPA 1JQGA 2DPJA 2W9CA 2UUWA 1N5VA 2B4OA 4A8MP 5E33A 5LMUF 1HW9A 2C3OA 3A8KA 4F04B 4DLEA 2D3O1 2Y1JA 2HMIB 3EVWA 2J0SD 2M8HA 1ZAXA 2DIVA 3MEEA 1LK5A 1CJVA 1NSAA 4FPRA 5KOWA 1O5JA 3CULA 2B6AB 5IC6B 4RUCA 2BJ8A 4ZCKA 4GVBA 2WW4A 1RT5B 4CLLA 3OJUA 4LSNA 1HBOB 2F3JA 3I31A 3GQCA 2RUGA 2VONA 3W5ZA 4AT1B 1WF1A 2ASDA 2ADCA 2VC0A 1UVLA 3HSZA 1XR6A 2KM8B 1RU2A 2BJ7A 3SIPB 3KUHA 5LJ5Y 4K5SA 3KHHA 4L3NA 1K1SA 4MK8A 2VJUA 1F2GA 3CDBA 1APSA 2NPIA 4U7UK 3FFIB 4TQRA 1GXLA 4ID8A 2DGOA 4DX6A 1GMWA 2R7SA 3HM9A 4IOCQ 1IN0A 3MECB 1SV5B 3FDSA 2QYGA 1PYTA 4TU8A 3CJRA 4XIUA 3D1QA 1AUDA 4C0BA 2HNZB 1UZHA 1EETB 3OL6A 9RUBA 3IN5A 4WKYA 1NHVA 4ER8A 1WKLA 4QR1A 4JI3F 4KRWA 4YDDB 5KFTA 4KGMA 4IOBA 2J9CA 2NR0A 4DV2J 3AD9C 2K1RA 4RW6B 1TMJA 2B9EA 4I7FA 1JKHB 4I2QB 2QL7B 4C8NA 4OIXA 4DSIA 3LP1A 4PABA 1DARA 3EDRB 4C4WA 4MFBB 3HP6A 3BBCA 3QWUA 5ETLA 4M5MA 4QQBA 2MQQA 3TAPA 1H38A 1OIAA 2DRAA 5IZHA 2HHSA 2RMLA 4FYXB 3SBMA 2ZVIA 2UXDJ 1FRHA 1TK5A 6FDRA 5HQ8A 3QO9A 4HHJA 3SSSA 1ICEB 1IM6A 2C2MB 3CW2C 3OHAA 4ZKAA 4ES1A 1ACMB 5I3UA 1MG7A 1S12A 3AOAA 3DM2A 1AB8A 4G65A 2H5IB 5KT7A 1VC6A 4E0DA 5FLXU 2BKPA 3BGLA 5JUMA 5F8GA 1DZ5A 4C7QA 4ZPVR 1Q78A 3MM7A 2AU0A 2OPRB 4LR7A 4RLEA 1URNA 1RDRA 3DLGB 3MCOA 4YB1P 5F8LA 2HGNA 2UUAJ 2BACA 2FHJD 2KI2A 2DHAA 4TNOA 2NXNA 4RWWA 4PXDA 1OO0B 3DRPA 3MMCA 4P52A 3RAXA 5D0HA 4LR8A 5GAGI 3N6MA 1WTFA 1S97A 2LA4A 2MKCA 2AYBA 4IFYA 1JJHA 4ELUA 1OPZA 2GGPB 2N82B 4WE1A 3UDLA 2CPHA 1R8HA 1YDLA 2QLJB 2DHSA 2F65A 2MQMA 3QSYB 1HNWJ 3CCQS 1MLAA 1RT7A 2ASYA 3QPIA 2G0JA 2RRBA 3TVYA 4NLRA 3J7ZT 4B9NA 4BBYA 2H5EA 3KLGA 1I5OB 3MR2A 4TXSA 4PG6A 2E66A 3PIPQ 3KK2B 1V6HA 3D6TB 2BKNA 5B0FA 1D0EA 2KU7A 4DL0C 4B3MJ 1PKUA 1NKEA 1K0VA 3TRGA 2GA7A 4P74A 3OBIA 5F3TA 1RT1B 2XY7A 4F2RA 1ZPVA 5AXLA 4IH7A 4FF1A 3JSYA 4KE5A 1T94A 4YFUA 2R7UA 1RAFB 2MJNA 3Q8VA 2KTQA 2MQ8A 2KG1A 2E29A 4YQWA 1H2TZ 4JI8J 2DNRA 4WFYA 4IG3A 3KK1A 2RSQA 1SJ1A 4QR0A 4ZITA 3K5LA 2ZWPA 5ETRA 1NSKL 5D4PA 2QV6A 1DTTA 1TL3B 4DR6F 5C5JA 1NUEA 4P2XA 3BDPA 3WHIA 2V4JB 2W01A 2NZCA 2F4VF 1NZ8A 4I68A 5LL6d 4AYBD 4U8VA 1J5EJ 4ETXA 2J0QD 3MM6B 2RE1A 2N7YA 2R2SA 1JLBB 5KT4A 4F25A 1KOOA 4A47A 1MROA 2W9CB 3MR6A
chains in the Genus database with same CATH topology
1LWFB 4X2BA 5L1LA 2V94A 4PWDB 3ZZ0A 4RW4B 1FHTA 3L7OA 2IM3A 5J2QA 3RB4A 1S0NA 5CYQB 2NS1B 2Q3PA 4UQGA 1IKWB 4PG7A 2JSXA 1G7CB 2ZH9A 2AGQA 3BGUA 3EXYA 3ISND 2ZOGA 1FDDA 2MY8A 2MMYA 3N28A 2ASJA 1SKWA 3TVZA 4YY3F 4DN9A 1UJ4A 5AE3A 4ED5A 3E01B 2VG7A 5HN0A 5HLFA 4WFAQ 4USJC 5AXMA 2ZNYA 4LFBF 1U7LA 2IM1A 4TN2A 3TQ1A 2X51A 1HBNB 3ZFVA 1QJHA 1JWWA 5IWAF 2OPQB 5AE1A 2P6SA 5IS2A 4DOZA 3FEYB 1S4FA 2WK4A 3CB4A 3H5SA 2C3YA 3CPWR 1XWLA 1AXQA 5L9NA 3TO8A 2B7CB 2UVVA 3KJVB 3ISZA 4OZ5A 3PFOA 1KONA 4LMZA 3SDEA 4H4OA 1RT2B 2UXCF 2R7VA 1FJGF 5K8MA 3FRYA 1A7GE 1FD2A 3ETOA 1TV6B 2N3OA 4Q5VA 4NLSA 2BVZA 1SH0A 2G9OA 2XMVA 1HWJA 1RGVA 4NLQA 4OZ0A 4JI0F 1RKJA 2J5AA 4WK3A 1C0UA 4IDKB 4LSNB 1CC8A 4LVOP 5J2MB 2OSQA 1UA1A 1X7VA 1H6KX 1R27B 2OPSA 2E5HA 4FN5A 4N8NA 2BUNA 3W7BA 3RAMA 2YNHB 1UA0A 1JLFA 4LT6A 1UP1A 1E6YB 2HVHA 4O3RA 1KOHA 1LWEB 5GADI 6FD1A 5LSRA 5DLFA 4X4NA 2GJ2A 4Q43A 2EBGA 1BQMA 1MW7A 4F3QA 4JI4F 5BJRA 4NYPA 2HHWA 3I32A 2RDJA 2YKMA 4CO4A 4WXWA 1LWCB 4H54A 1RK8A 2GQQA 4MIAA 1SL2A 1WG4A 3SSRA 4Q0BA 1NJYA 1Z2LA 4OZ1A 1SH2A 5KFAA 2OIHA 2UVWA 3F73A 3U1LA 1SIZA 4PCQA 4J9LA 3EYZA 2BYCA 2BOPA 1ZZNA 2I2YA 1FNOA 3DLBA 4F4YA 2B7BB 4F4ZA 3CCZA 4TYAA 5HMWA 1TKXB 1U1PA 4N76A 4YR3A 4JI1F 2PDAA 4MKYA 2DK2A 2R7RA 2M0GB 3QIPA 3H98A 3PY8A 3LALA 3J80Y 3I5CA 2XMWA 3VAKA 1RA6A 4NPOA 2ZH6A 2FHKA 5KFHA 4GC7A 2ADBA 5J1EA 1RAJA 4DV6F 3ZZZA 4M5DA 3VZHA 3Q8RB 3V6HA 4WXOA 1V3SA 2YX7A 4UUWA 2RU9A 2YH0A 5D4LA 1P1TA 4C97A 2C42A 3MPYA 1S6QB 4KKOB 1CPZA 3AHPA 2DR8A 2PI5A 4DQSA 1YJNS 3D0IE 1VGYA 2YKOA 5FDLA 4CQ1A 1WI8A 2HG4A 4A8OA 3MHYA 1HPZA 4F3MA 3D28A 2J6SA 4ES2A 1HQUB 3MZIA 3W2VB 4G1QB 4H4MB 1JLCA 1S99A 4QWAA 5HMZA 1S9GA 4B3TF 4DPOA 4RNOA 1PC5A 2FVRA 4X65F 3MUTP 1R43A 4DL3A 1U49A 2HRUA 3M6WA 2XWYA 2LDIA 2DNOA 1VK3A 3GIMA 1IKXA 5CCLA 2NQPA 3CT9A 2EK1A 2JWNA 4NXNF 1X4BA 3V6DB 4R5PA 4UY8T 3HDSA 2XS7A 2R8JA 1AFIA 3N6LA 2XS2A 2ACYA 3H40A 3ONQA 4MH8A 2GX8A 2FC8A 4IOAQ 5T7LB 2E44A 3G9CA 1KC8T 2XI3A 2K1RB 4IFVA 3WX4A 5IT9Y 1SUQB 1N34F 3OPKA 1S6PA 4ED2A 3B78A 1F5AA 5GAEI 3HXMA 4K4WA 4I7FB 3VAMA 2MZQA 1V9OA 1JIHA 2HLTA 2COLA 3H5YA 4X4TA 2I5JA 4A8FA 1TL1B 1RA7A 3TR5A 3LP1B 1L3UA 2R8HA 3NNCA 1GQEA 3RZAA 2YWEA 1ZM9A 3M2RA 2XLKA 3BR8A 3UD4P 4URQU 4GKJF 1HFEL 2CIMA 4MJKA 2QA4G 1T95A 2CJKA 2CQDA 4V19X 4IR1A 3LPYA 1UEVA 2MKHA 3KTQA 3C8YA 3G6VA 4Y2MA 2AYEA 3OLAA 3GR0A 2QRRA 1WHVA 3EZUA 3DLEA 1BLUA 1KQGB 1ZAVA 4RBUA 2Q79A 2YNIB 2JC1A 2RJZA 3C66A 2EFOA 1TKDA 2QIFA 3WC0A 1D9FA 2BBEA 5EX0A 4I1TA 3QO9B 4A46A 5H1SV 5A0YA 3PRBA 3OTCA 1UETA 1TK8A 3U7JA 1AFJA 1Y5IB 1CEZA 1UJ6A 2V8GA 2LVWA 1HL6A 3JSRA 3F56A 4KC5A 3I5AA 3BF4A 4YR2A 2ZFHA 3NWGA 2D9PA 2HVIA 3L09A 1U6BA 4ED6A 4UQTA 3K0JA 3PV8A 3KMQA 1TR0A 1CG2A 2HNDB 3KWMA 1PO6A 4FF2A 2O1PA 3CJ4A 2XSJA 1ZBTA 3DRSA 2C22A 1HARA 2W9CB 2MGZB 5ITHA 1FEHA 3OQ2A 1NB7A 3DI6A 1W2BR 4LF9F 1HBUB 2CG4A 3BGFA 3G96A 3QZ7A 3PW5A 1R0AB 4NLOA 3FMWA 4RW8A 4QYRA 5HMYA 3AA8A 3KHLA 3T3FA 2YNGB 2OFHX 3OVAA 5J2PA 3PKMA 1DAXA 1VQ5S 2ZJRQ 2D3UA 2XLIA 4L72B 4JV0A 4RBTA 2W4DA 2ZITA 1HWIA 1S9FA 3NMRA 1VBZA 1YVFA 5A8WB 4I6WA 2HLUA 1FDNA 2CQBA 1WWHA 3CCLS 1PC4A 2VFRA 2HIQA 2AP6A 4NLXA 3UD3P 1S72S 2PE8A 4ZVEA 2MYFA 2M5YA 2RQMA 2DRBA 2X1FA 4YOEA 1REVB 2N3LA 4MTPA 2DGTA 3DMJA 2JH3A 3H2UB 4DL7A 1UVNA 3WBZA 2B51A 1S1UB 2PT0A 3S01A 2ERRA 4HVZA 3MM7B 3CC7S 4NLGA 3OFHA 4K4SA 1LFPA 2V9KA 3OVBA 1P6TA 4KHPF 1YGYA 1OSCA 1Y5NB 3N9UC 1ZM3A 4Q2MA 5MLCV 4JI6F 1X4AA 3MM5A 4AXIA 2LEAA 5GAHU 2QA2A 1D8YA 4YR0A 1HQEB 4M63A 2CQCA 2KXFA 5B08A 4Q8FA 3NGKA 2ZVSA 1DJ0A 1NK0A 4QIGA 3KLVA 4ECXA 1KFDA 3KNAA 4NZ6A 1FK9A 3EGWB 4ZPWR 3DRPB 2UUCF 3BO3A 2C28A 1U6ZA 3ZZUA 4ALZA 3AA9A 4WFXA 2DR9A 5F9NA 1YBAA 3OUYA 4DQRA 2F1FA 4DV4F 2EWHA 1HI1A 2CQPA 2IFXA 1KN6A 4IKAA 1C2PA 3M8PA 2PFFB 1D8ZA 1WHYA 5G0RB 1I94F 5IFMA 2VOOA 5B0CA 2CDQA 5KT2A 1X4FA 2AJFE 4JYAF 4O4GA 1VQ7S 3SCKE 2GMLA 3HZGA 2XZWA 3PX4A 4FF3A 4QIEA 1NNDA 2VODA 3JB9k 3M6UA 2HGMA 4KTQA 4OV1A 3PX0A 3V4IB 1T3NA 4WE1B 3PRDA 3CUNA 2U1AA 3SFGA 3HVTA 4QW8A 4NLWA 2E7XA 3DU5A 3HKWA 1M0SA 3LAKA 3MMJA 1GXUA 2A2DA 1Q7YT 3IRXA 1XNRF 1RT4A 1N32F 3DOKB 1U2RA 3B4MA 2PMZD 1NJIT 4CZCA 2KXHA 4X4SA 4EO6A 3MEGB 1WHWA 4OHVA 4WU2A 3AJ1A 1XMOF 2IYIA 1T03A 1QSYA 2BM0A 4DG1B 3G6YA 2R8IA 4MYTA 2O5DA 4NLUA 1U24A 5GADU 4NA2A 1IKVA 3VAJA 2YH1A 4LF7F 1UVMA 2OJ3A 1MMLA 2ZJPQ 2FDNA 3Q22A 1HBMB 1R7IA 4GO5X 2NREA 1Y00A 4USIA 3J7Z5 4EYHB 2W9AA 2MZ1A 1N56A 1WHXA 2XY6A 5K5MA 2GIQA 5M2PA 4MK9A 2DR5A 2LKZA 3V5RA 2HHPA 3NP5A 2EBEA 2JLEA 3P96A 4O44B 5M2UA 1X0FA 3BQ1A 1MU2B 3QGIA 4G6VB 1KEKA 3GFYA 3PM9A 1N8RT 3OW2R 2JEGA 2MSSA 3LH2S 4NCAA 1ZYQA 4ECQA 1N5YA 3IFEA 1XR5A 4FNHA 2A1BA 5LMNF 2VFVA 3KLIA 1YITS 1H98A 1RT5A 4LVNP 2EI5A 5AJ3F 3ISNC 4HI2A 3V6KA 2LEBA 2B3TB 2F8EX 3T5JA 2J76E 3DRYA 5C24A 5KFPA 5F8JA 4PWUA 3VCDA 3PW2A 3KFWX 5D6GA 5KAKA