2DNLA

Solution structure of rna binding domain in cytoplasmic polyadenylation element binding protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cytoplasmic polyadenylation element binding protein 3
publication title Solution structure of RNA binding domain in Cytoplasmic polyadenylation element binding protein 3
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnlA01
2E44A 3R27A 1X4EA 2NZ4A 2NLWA 3SDEA 2ZJPQ 1U6BA 1VQPS 3J7ZT 1SXLA 3VAHA 2B0GA 2RUGA 1YWXA 2M2BA 1M5PC 5GVQA 3VAGA 2LYVA 2MSSA 2BOPA 2HVZA 1FXLA 4IUFA 4F26A 2CPJA 4CQ1A 2SXLA 2DNHA 1VQ9S 1S72S 3CCVS 2KFYA 2KVIA 2QFJA 1X4CA 2G1DA 2DGWA 2CQPA 3CCLS 1WF1A 1SJ3P 4M5DB 1NJIT 3H2UB 3MD1A 2KM8C 2HYIB 2LMIA 1VC6A 1WI8A 2DIUA 1U1OA 2L08A 3UD3P 2CQIA 1KOHA 2MGZA 3D2WA 1WHXA 1QM9A 2CQHA 2JRSA 3MD3A 5GADU 1ZZNA 2KM8B 1VQNS 2CPYA 1VQMS 5LSOA 2HGMA 3TO8A 2ERRA 2DH7A 1UW4A 2U1AA 5HO4A 2MQPA 4LMZA 2DHAA 2DGTA 3CC7S 2CQ4A 3JB9k 1DHMA 2L9WA 2DNMA 2DGSA 4FXVA 3CC2S 1QVGR 2D9PA 3I55S 2MY7A 2CQ3A 2WBRA 5CA5A 2RRAA 2F3JA 2I38A 1YJNS 1VQLS 1WF0A 2EK6A 3THPA 4ERDA 3TYTA 2CJKA 2OSQA 3VAIA 4OZ1A 2MQQA 5EN1A 5DDRC 2CPEA 1KD1T 2DGQA 2DGOA 2KXNB 3US5A 2Q79A 3Q2TC 1DZ5A 2VONA 2DHSA 2M7SA 1X4FA 2X1GA 2UP1A 2X1FA 2J0SD 1H6KX 2CQBA 2GHPA 3MURP 3UE2A 4QU7A 2MQMA 5ITHA 2KHCA 1URNA 1YJWS 1KC8T 2OSRA 1RKJA 2RU3A 2XSFA 2D9OA 2M8HA 4QU6A 4A8XA 1S79A 1JJ4A 3B4DA 4WFBQ 3P49B 2DIVA 1N88A 2EVZA 5DETA 2FC8A 3P5TL 2LEBA 3CPWR 1XN9A 1JJ2R 3SMZA 3L3CA 2J8AA 2MB0B 1NU4A 2PEHA 2KG0A 1U2FA 2PE8A 1K9MT 2XS5A 3I56S 3LPYA 1WHYA 2MGZB 3UD4P 2HZCA 2X1BA 2U2FA 4YOEA 2DH9A 3RW7A 4W92B 1OWXA 2RQ4A 5MLCV 3CUNA 2CQ0A 1YTYA 3CULA 2RVJA 1M5KC 1YI2S 1F9FA 3UWTA 3HI9A 3IWNC 3CCUS 2M4MA 2DNQA 2G0CA 3CMES 1X4HA 2DNZA 2E5JA 1WHVA 3VF0B 1IQTA 4YB1P 2CPHA 1VQOS 2KT5A 2J76E 2LKZA 2K3KA 5HL7Q 3NMRA 2YTCA 5IM0B 1X5OA 1VQ6S 1WTBA 1FT8A 1R8PA 3BO4A 4Z2XA 2BZ2A 3CCRS 5CXTA 1HL6A 2E5GA 1WEXA 3CD6S 1O0PA 1U1KA 2XNQA 3G4SS 2G4BA 2VOOA 2RQCA 3FEYB 4WFAQ 1W2BR 1N54B 1X4GA 2MZQA 2YKAA 1FHTA 2KH9A 1KQSR 4IOAQ 2KRRA 2MHNA 2MZ1A 3PIPQ 4ED5A 2DO0A 3FEXB 2DHGA 3OW2R 2I2YA 2M52A 2CQ2A 1FNXH 1HD0A 1CVJA 1Q7YT 4RU2A 2M9KA 2N3LA 4C0OC 3R1HA 5IM0A 1VQ4S 4YUDA 2L41A 2FY1A 5IQQA 3U1MA 2MSTA 3BS9A 2DNYA 3UCGA 1OPIA 1M90T 5GMKa 2V94A 3EGNA 2X1AA 1H2TZ 1Q82T 1VBYA 2XB2D 2JX2A 2LEAA 5FJ4A 3MXHP 3BO3A 2OJ3A 3ZZZA 1P27B 2N7CA 1OO0B 2CQ1A 2MJNA 3NS5A 3UCUP 1VBXA 1ZH5A 1YIJS 2YH1A 2N3OA 1VQKS 2DH8A 2M70A 3G8TA 1X5TA 2XS2A 1BY9A 2YWKA 4QQBA 1Q86T 2GO9A 2ADBA 3CCQS 4IOCQ 4UQTA 1UFWA 1UP1A 2CPZA 1VC5A 2MQNA 3S7RA 1SJRA 1UAWA 4Y00A 3U1LA 2DITA 2J0QD 5IFMA 2DNRA 1M5OC 1AUDA 1WHWA 2E5HA 1K8AT 2RS8A 2JVRA 1HD1A 2MMYA 3DXBA 3CTRA 1SJQA 2DNGA 2AYEA 2LQ5A 2RT3A 3MDFA 1L3KA 2EK1A 3MOJB 1VC0A 4OZ0A 5DM7Q 1YITS 1H2VZ 2M88A 5GAGU 3MUVP 2CPIA 2M0GB 3DLLQ 5GAEU 5CYJA 2DISA 2CPFA 4LJMA 5DM6Q 2D3OR 2MJUA 1VBZA 2DB1A 2JVOA 2DNNA 2DNPA 1U1QA 4C7QA 2KI2A 2O3DA 2A3JA 3MI7X 3NNAA 2MZTA 3S6EA 2MQOA 1A9NB 1U1LA 3N9UC 2MZJA 4PKDB 1K73T 3UCZP 2KYXA 3G9CA 3NNHA 1JMTA 3K0JA 2MKKA 2HGNA 1X4AA 3LQVA 1SJFA 4IO9Q 4CH1A 2LA4A 3Q2SC 1N52B 3IRWP 3NNCA 1YJ9S 3NS6A 2LCWA 3CCJS 1U1PA 2MPUA 2MKJA 4ZKAA 4TU8A 4UY8T 2M8DB 1JJHA 2ZJQQ 5JVHQ 2MY8A 3BO2A 4C4WA 3G6ES 4EGLA 1D9AA 1WI6A 1HA1A 1WG5A 2MQLA 2MZSA 2KN4A 2AYMA 1N8RT 1X4BA 2DHXA 2CQCA 1FJ7A 1KOOA 5LXYA 4TU9A 1U1MA 2DO4A 1RK8A 1U1RA 2VOPA 2RRBA 2LXIA 2CQGA 4LIRA 1VQ7S 1VQ5S 5D78A 1WEZA 1X5SA 2MYFA 1FO1A 2KG1A 1DRZA 2KXHA 4CIOA 3CF5Q 5LJ5Y 4BS2A 2DGXA 2DNLA 3CCSS 4TLQA 2HGLA 2AYBA 2OTLS 2VODA 2OIHA 1VQ8S 3VAJA 3G71S 5GAHU 2KU7A 4WFNQ 3G8SA 1WEYA 2LXUA 1P1TA 2FHOB 3B4MA 2CPXA 5BJRA 3CCMS 2CQDA 2AD9A 5LXRA 2MKIA 4F25A 1WF2A 2DNOA 3P6YC 1WG1A 2DGUA 4W90B 2F9JA 3P3DA 3J7YU 3EGZA 2N82B 5H1SV 1B7FA 2RS2A 2MXYA 3HHNB 4WIIA 1WG4A 1U1NA 4Y0FA 4U67Q 4QPTA 4WCEQ 1X5PA 1NO8A 2DK2A 2MKCA 1R8HA 3R1LA 2LA6A 3S01A 3MUMP 4J5OA 3ULHA 3VALA 2XS7A 3CC4S 1OIAA 1DBDA 3EX7B 3G96A 2RNEA 1PGZA 4CH0S 1ZZFA 3ZZYA 2OTJS 1H2UX 1QVFR 1WELA 4FXWA 1M1KT 1X4DA 1D8ZA 2MKSA 2AYGA 2MZRA 2YH0A 3BEGB 3V4MA 2ADCA 3THTA 1FJEB 3MUTP 3SDEB 2XNRA 4PR6A 2MKHA 1A7GE 3CCES 2QEXS 4P6QA 1Q81T 5D77A 1U6FA 1YHQS 1FJCA 3VAKA 3H2VE 2E5IA 2JWNA 1M5VC 5DDQC 3TP2A 2KRBA 2CPDA 4F02A 3CMAS 5JVGQ 3CXCR 4PRFA 1WWHA 2DNKA 3S8SA 2FC9A 5LJ3Y 4V19X 2K8GA 2QA4S 2DGVA 2LECA 4WKRA 2F9DA 3PIOQ 1PO6A 4TU7A 1SJ4P 5DDOC 5DDPC 3SXLA 2FPHX 1G2EA 4WF9Q 3VAMA 2KXFA 1X0FA 2ZJRQ 3VAFA 3RW6A 5LSLA
chains in the Genus database with same CATH superfamily
3IGVA 2AEJA 2BOPA 4WIQA 2SXLA 4M5IA 1MG7A 1J2VA 5G0RA 3MCOA 3IM8A 1VRUA 4M5DB 4MKYA 3TZYA 4OHVA 5HVFA 4I6AA 1WKLA 1QM9A 2Z4PA 2A6MA 1VQMS 2D3ZA 2GNKA 4KPYA 3HDSA 2C2NA 3DM2B 1WKJA 2HMIA 1VQSA 5KOXA 4GMKA 2Y0BB 5KFTA 4RW7B 4WK1A 3HZEA 3AOCA 2ZD1A 4OHYA 4NA3A 2XLKA 2Q79A 2X7IA 3HVAA 3LWLA 4DCPB 1YJUA 3OV7A 5ETTA 2XO6A 5CCMA 2XSFA 3D3CJ 1T3OA 5KT4A 2XO7A 3ILLA 4JI1J 3GJSB 2QYGA 3OFHA 2PEHA 2YKMA 3TUJC 3LPYA 1TV6B 1B3TA 5AE2A 1P1LA 3K8VA 1YDLA 2H48B 1JNRB 1M5KC 3DOLA 5GAEI 1QSLA 2EFPA 2C2ZB 4O3OA 1MLAA 3GIJA 2CPHA 3VVTA 2ZH3A 2AP6A 3HPOA 2OELA 3RRKA 3LF0A 3KHGA 1XR5A 3KHLA 5L1IA 2DCUB 4KQZA 1UJ6A 3VGVA 3B6BA 2CNKB 5D3GA 3JAMU 1W7WA 4DQIA 3DMJA 4CLPA 1NPRA 2GQCA 5KTQA 3PX6A 3R8YA 3N6LA 4HACB 4DR5J 4ECVA 3MFHA 2LU2A 3R1HA 4PQUA 1WDTA 2L41A 4B9LA 3GIKA 4TY8B 4IG3B 1ZH5A 5M2UA 1NAQA 2QLFB 3D6HB 3JSMA 3GZ7A 2HNYB 1FFSB 5KAKA 5B0AA 3H42A 2KT3A 4DI6A 4ZP6A 4M5HA 5C24A 2Q1LA 4Y00A 2DITA 2DNRA 3MGJA 3MZIA 3DXBA 4BWJA 5DM7Q 2R7SA 4UUXA 3LUYA 4ZS6A 3POTA 3V6KA 4X4OA 5HN0A 3W3SA 3MM8A 5IT9U 2C3OA 4CLLA 2KI2A 1HBUA 2CYYA 1U1LA 1WDDA 3NNHA 4AL6A 2C3UA 4B02A 4IO9Q 4IR1A 3M1VA 2G2ZA 2RIJA 3W9HA 2KFZA 4JI8F 1ELOA 2X51A 2WB4A 1FTRA 2MY8A 4M94A 5J2NB 4LSNA 2E5LJ 1HA1A 1N8RT 4DSLA 3VWSA 3HFVA 1CJUA 1RK8A 2LXIA 1OSCA 2OPQA 4ZP7A 2OEJA 1WEZA 4KE5A 2ASJA 5HANA 1MU2B 1YBUA 2HGLA 1KNZA 1T7PA 2OIHA 1TL1B 4FVCA 4DR7J 2XSJB 1SV5B 2GJFA 1U48A 2C3YA 4FDFA 4DPTA 2I9SA 2XZDB 2LXUA 3IS9B 1T11A 4MYTA 3OLAA 1NSAA 3CDEA 1WG1A 1HWKA 1NHVA 2DT9A 4QR2A 4IDKA 4GKKJ 2JLFA 5KT3A 1WG4A 4WCEQ 2D3O1 1R8HA 3J81Y 3HHLA 4DLGA 1WUUA 1JXEA 3CC4S 5LMNF 1T9TA 2MKSA 2YWEA 1F2GA 5DGBA 2MZRA 3V4MA 3Q89A 3BGFA 5DQHA 2B8PA 4R0JA 2DEJA 1JB0C 4RW9A 1HI1A 4DQPA 3CMAS 5G0RB 1SKUB 3SZ2A 1RKIA 3OXLA 2I6WA 4HVZA 5DDPC 4QYZK 3F41A 4LF6F 4H4MA 2XGQA 2J9DE 2YKQA 4KSEB 1FX4A 2VIHA 2XY5A 3CCZA 2RDDA 4UOGA 1VQ9S 2HKEA 4ETXA 2ZH4A 4DR3J 1FWPA 1X0PA 4NLOA 5KFGA 2HWHA 4K2JA 3HD1A 2OMOA 4X4NA 3QZ8A 2OI2A 3AD7C 2OUGA 1R0BG 5CQGA 4P9SA 2CPYA 1WD6A 1JK9B 1RAIB 2IJFA 3RB4A 2G0JA 5KT6A 3Q8PB 4ECSA 2WCXA 2XYPB 2DHAA 4B9MA 3Q83A 2OLWA 5KFLA 3PYDA 2QC3A 5E0OA 2WRMA 4LF1A 3JTOA 1UJ5A 2XYGB 3NRBA 4D3GA 2C2DA 3PVXA 4PG4A 1OSDA 1N5TA 1RCOB 2QGFB 5DDRC 1S48A 4CO5A 3R5AA 4KJIA 2HWTA 2XI2A 1UFLA 3ILOA 3RG6A 4JI3J 3M30A 2DR9A 1OQ3A 1IKYA 3B4DA 1TAUA 3TAMA 4RUCA 4OJ3A 4G6VB 3IWLA 1N48A 1S9GA 2C1EB 5HMXA 5KFRA 3NY0A 1EARA 3H5SA 3MAQA 2NCKL 2H4YB 3BQ1A 3PNIA 4YOEA 3DMJB 1RBAA 3CULA 1YI2S 1QSYA 1YBAA 2B4PA 2AT1B 3UO0A 1OMSA 3ZZRA 2DNQA 1YJRA 4DU7A 5J2QA 4TN2A 3MR3A 2G13A 3AY0A 2PFDA 4KKOB 1VHFA 4RLEA 1RT4B 5F0WA 1NKEA 4Q45A 3M8PA 2B4OA 2DCLA 2C2RA 1XC9A 1UA0A 1OQ6A 2F4VF 2MZQA 2GC8A 2N7YA 1ZOTA 4ZJLA 3DGVA 1U47A 3V6DB 3VQTA 1SBRA 1NPPA 3ISNC 1SUQB 1HD0A 4ECRA 1Q7YT 4RU2A 3T9ZA 1RTHA 4RNHA 1UFKA 5IM0A 3ENWA 2PFFB 3QSYB 4I69A 1YGYA 2YNIA 3SV3A 3BREA 3MMAB 2V94A 3W2WB 2G2YA 3MXHP 2R8HA 2YH1A 3DYAB 3QAUA 3UR3C 4XDCA 4WP3A 4FF1A 2RSQA 1VK8A 3S1TA 4NX9A 5KFEA 3NEKA 3ITHB 1BGXT 4TYBA 1RHMB 4NEYA 3KLEA 3TI0A 3VGSA 5EUHA 3D4JA 1ZPVA 3K2YA 3MOJB 3J7AN 1RAAB 5GAGU 2CPIA 1SH3A 1EX8A 1KTVA 4K59A 3WX4A 3TAQA 2RQMA 2W9BA 3HHDA 4OLPA 1J5OA 4AYBD 4C8YA 3G9CA 3V6JA 1NRKA 3LQVA 4LF9F 5EX3A 1OY6A 1CQNA 1BQMA 4RWXA 5HQMA 1YRXA 2HHVA 2LEPA 2LQJA 5L1JA 1PBUA 4DV2J 5B09A 1GXLA 3D67A 1FDBA 1FD8A 2KN4A 2E1PA 5DZ7A 1VQ7S 1N32J 2QLBB 3H2LA 3NAIA 3DGPB 2KXHA 5ETLA 1NCLA 2DR7A 1CBKA 2HS0A 3VAJA 1GMUA 2IAJA 5G4DA 4O4GA 1F3FA 3DLBA 2Y3YA 2AD9A 4PXDA 4ZA1A 3NGTA 2V8GA 3IMQJ 3WZ0A 4HI1A 2HNDA 3S01A 3KLIB 1YG0A 3TVZA 1OIAA 3NAHA 1BQNB 4DV3F 4F2SA 1CPZA 2BV3A 4OYAA 2XBPA 3FMWA 2ADCA 3FFIA 3EYZA 1HNWF 3OR1B 3D54A 2J7KA 3ZTRA 3EGWB 2FJAB 4DV6F 3VVUA 4L75A 2E5IA 5D4PA 3DOKA 4XO0A 4K4ZA 1HQ2A 4L3KA 1AROP 2E1AA 1F5CA 1G7CB 5KOWA 5EDWA 1HNXF 3QIPA 1GK8A 2ZJRQ 1ZS6A 3RW6A 3X1LB 2NLWA 2ZJPQ 2HLUA 5T41A 3ICLA 1PKUA 1UL3A 1XNRF 3T1YF 3M8QA 2ATCB 4ZK7M 2HVZA 1DTTB 2E1MC 4WP9A 2CJQA 2CPJA 1S72S 2F63A 1N34J 4PYAA 1RAOA 1MROB 3QWPA 1NEEA 1F2HA 2W2QP 2HYIB 1RAJA 3OFEA 2B3TB 5AE3A 4Q0BA 4M5GA 4CH7A 2KM8B 2QMWA 1B4SA 5ETQA 4NLGA 4TKTA 2B43A 3HLUA 3SCIE 3C6TA 4C0BA 2XY7A 1R8AA 1O51A 2BRLA 3G6XA 4K0KF 3CGIA 4DL6A 3DLKB 4ZLPA 4NLPA 2RDIA 2DGQA 2ASLA 1GH8A 3CD0A 1KQFB 5K8MA 3TNVA 4JI6F 1Y00A 4NZ0A 5J2QB 4A8XA 4BDPA 2DIVA 3A12A 3PTWA 2FHMA 3K5LA 2HQIA 4DL7A 5D0GA 3BF4A 3C14B 1K9MT 5E3RA 1P9QC 4N8OA 4FS2A 1E6YA 5D4OA 1OWXA 3NS7B 3IWNC 2YX1A 3UN2A 4HKQA 2JLEA 1C4CA 4AFFA 1IQTA 3DRRA 3KJVB 2BR0A 4PZVA 4ZHRA 2K3KA 4B3RF 3HKZD 4ZITA 2RHSB 5IM0B 1P9YA 4WFXA 3R3TA 5IV3A 3QT6A 5U47A 4MFBB 2W7PA 5HQLA 3CDUA 1HL6A 3BBCA 3H0PA 1DURA 3H40A 1Q8LA 4USHA 3PM9A 2CVEA 4FNIA 3FEYB 5EWGA 5DJBA 1APSA 1Y11A 4XPCA 1KTQA 1BWVA 3PW2A 2CQ2A 3GONA 1UVNA 2VQFJ 4O0IA 5HMWA 4LRCA 4OYOA 2M9KA 1FEHA 2JEFA 3BR9A 1CJTB 2GQ2A 2V9WA 4C8MA 3KMSA 3BO3A 3SSQA 1OO0B 4RNOA 5C7PA 4NLVA 1N4LA 4QWDA 1BC6A 1TVRB 1BY9A 1GNKA 2GMJA 1Q86T 1Q1KA 5J2PA 2RMLA 4ECXA 4OFZA 2J0QD 1EZZB 1S57A 2HEKA 1TL7B 3HD2A 1BUXA 2EK1A 5KFOA 3EPGA 3DLEA 1RACB 4B9TA 4EEYA 4ZPAA 2MDAA 1VLYA 4ZPCA 2DPIA 1WKKA 3HJFA 3HULA 1AW0A 1PCAA 1BMQB 4CO3A 4DCOB 2VC1A 3W2VB 4O4GB 3LANA 3H59A 1K47A 3OUYA 1O5JA 4JI7F 4IRDA 1C0TA 5JVHQ 4K4XA 1RHKB 3BO2A 3TUPA 2VG5B 2EBEA 2MQLA 5LXYA 1EB0A 2GQQA 3VTIA 1KONA 4JI4F 4DR1J 5D8HB 1F5AA 5EX0A 4JYAJ 1NUEA 1N56A 2DGXA 2VODA 3R5JB 3NBPA 2WSCC 3OTCA 4BHQA 2KU7A 2HBZB 3EICA 4USVA 5ETMA 1N33J 2VH7A 3B4MA 4OYZA 1RB0A 2L9DA 1CJVA 4P7VA 1FKOA 4C8LA 5H1SV 4DR5F 4K4TA 3DOKB 4RNFA 5GADI 4KBIA 4DPWA 5LM7E 3EE3A 2NYIA 5IZHA 2JLGA 4KHPJ 1WC1A 1PGZA 2EXUA 1EQ0A 4WZMA 1RYRA 1PC5A 4NI2B 1QDUB 2CZVC 1IQZA 2D1CA 3M8QB 3ZNJ1 2FZGB 1YHQS 2AEFA 3P5BP 1ZAWA 5DDQC 4LFAJ 4BWMA 1V9OA 2ZE2B 4CP5A 1FJGF 2DXEA 3IC1A 5IC6B 3D3BJ 3PIOQ 5DDOC 1TUVA 5LSLA 2EC0A 2E44A 4PPZA 3C16B 1B64A 1U6BA 4R8UA 1IWAA 4C3MA 8AT1B 1NK9A 3VAHA 5FLXU 2PMZD 5E3QA 2XHCA 2HIYA 1RT5A 2G1DA 2V4QA 4TQRA 4PEOA 2GV1A 3G8QA 2E5LF 5F8NA 5LMUJ 4ZCLA 4DL2A 3FDSA 2QLXA 1UETA 3QLHB 4HH1A 4DR7F 1VYAA 4L72B 1RT1A 2DNMA 1JX4A 1TTHB 5A8KB 1DARA 4P52A 3W8GA 3A3NB 2FB0A 1WTFA 2LDIA 2EK6A 1S1XA 4DFMA 4PUOB 3BBBA 4GKKF 1LFPA 1K0VA 1WC3A 3QT8A 4Y2IA 1AFJA 2YX7A 2E9ZA 2J0SD 4B9NA 4RW6A 1H6KX 2CQBA 1RT6B 3UQSA 1XR7A 4AQYJ 4D3HA 2M8HA 3DCAA 4MKBA 2KO1A 4X66J 1ZBTA 4KHRA 1Q4RA 1UVLA 1X7VA 3D28A 4FYDA 3N0VA 1D09B 3JQJA 2IBKA 3WQPA 1CEZA 3GV5B 3I56S 1KBRA 3RJMB 3PRBA 2ZH8A 3DI6B 4EZ9A 4Q5VA 4NLUA 3H4BA 1UPPA 1TU0B 2CDRB 1JKHB 2YKOA 2R8KA 2VB6A 1QAJA 5HL7Q 1GEHA 2LP4A 2R3VA 1GXTA 2AU0A 4B08A 3D6FB 2BJEA 2N4CA 2V8VA 3JTNA 1MMDA 5B7WA 2BUNA 2C42A 2GS8A 4DPOA 3ENAA 5J2PB 4DR3F 4GKJJ 2DRAA 1S10A 4C0OC 4KO0B 1JJCB 3AFGA 4EO6A 2JDJA 2R7XA 2MSTA 4GVBB 3JSRA 4XAKA 2DR8A 1I6JA 2CRLA 5FJ4A 4P2MA 3LAMA 3SV4A 2FVRA 2ADBA 4LSLB 2HQDA 6FD1A 1UAWA 5FIIA 3M6VA 4B9SA 5J2MB 3ZTOA 1C0TB 1FNMA 1VK3A 1URRA 5AJ3F 6FDRA 3PW0A 2LQBA 4OZ0A 4Y34A 4FYVB 4LF4J 1S59A 2WW4A 3BKUA 2DISA 4LJMA 3IM9A 3MCSA 1A9NB 2HHTA 3NBPB 3JQKA 4NXMJ 2OPPB 2WAQD 3NNCA 1U1PA 5ETSA 2PIIA 3MAAB 4AL5A 3I5BA 4G1PA 4P2XA 4X62J 4C4WA 3DHXA 4YDXA 4N56A 4ECYA 4DS4A 2E7WA 1FJ7A 1G4CA 2QTWA 1QAIA 3KXDA 3Q23A 4J9VA 2RUSA 1FO1A 2KG1A 4DV5J 3K5PA 2V68A 3CF5Q 2DNLA 2AYBA 3OJSA 1R0AA 3FC9A 3G8SA 3AH6A 3LO3A 2CQDA 2HAFA 1NK0A 3HMJG 4J90A 1HHTP 4IG0B 5EHHA 2XMVA 3K57A 4LUBA 1B7FA 3DRPA 1W26A 3MEEA 2QA2A 1NK5A 1NK4A 2V69A 2LA6A 2XS7A 1N5SA 1RYSA 3PYGA 2L48A 1ZZFA 1JLFA 4YFUA 1S7HA 2EEYA 2DYAA 4O23A 3WIUA 2B5JB 3UN5A 4WWSA 1NH7A 3H8YA 3NWGA 1FRKA 4DV0J 3I31A 3V2UC 4AE5A 1HBMA 5HVHA 1TK8A 2H1YA 4ED2A 3MM9B 3MPUB 4P2SA 4PYDA 4AXIA 2CG8A 3DRYA 4ID8A 5HAOA 2GJIA 1NPKA 2FGOA 1HR0J 1G2EA 1GFWB 4F4XA 3PCOB 1S1WA 1P8GA 2HURA 5RUBA 1TP7A 3TJ8A 2FGCA 5I42A 1U8WA 2D74B 2ZH6A 1KLMA 4ILMA 2FJDB 1WACA 3PR4A 4NXNJ 2VFTA 4L73A 3HVTB 1NZAA 1S1XB 2HRUA 2BANA 1TKXA 4DV2F 2ALYB 5BR8F 3QPIA 1Y9OA 5CCLA 1X9WA 2Y9HA 4C11A 1N32F 3N28A 1JXLA 2UV8A 4Q7AA 1TL3A 1U0HA 3A3PB 2CQ4A 5F8MA 1Y3JA 3AB4B 2D9PA 3UNYA 2CUYA 3FNNA 2ZHAA 2VG6B 1UVKA 1HPZA 2JOQA 3H20A 3QJLA 3VAIA 4LRBA 2QT7A 5EN1A 1KD1T 2UVUA 2OFHX 2OMLA 3T1HF 4W4MA 5A8RA 2V2KA 3EVMA 5K8NA 4U7CA 2X1FA 1HNVA 4WBFA 2GHPA 1FKPA 3R2CJ 1LWCA 2NSBA 7AT1B 4ZN1A 3DDKA 4WFBQ 4TQSA 4EBCA 1HQEA 2QIFA 1DAXA 2HVIA 1TL5A 2C2MB 1Y5IB 3FSYA 2OPRA 3ILJA 3UD4P 2LVWA 2O67A 2UXBJ 2RB7A 4C6AA 2YPYA 3ETMA 2EKNA 3MM5A 5F8JA 2DNZA 2XMJA 4DV1J 4YP3A 3G6VA 3NG8A 3DDNA 1KLNA 5KFHA 3JS9A 2A1BA 4OX7A 1S6UA 1DTQB 2WVDA 1O0PA 3O5TB 1MN9A 2OKQA 1U0SA 4KV8A 4ZMMA 1YVFA 4F7VA 4O3PA 1N34F 5DS7A 2YQ3A 2FJBB 5JXSA 2FY8A 2DO0A 3QZ7A 3OW2R 4YS2A 1MMNA 4RZRA 4KB7A 4X2BA 2GVZA 2XMUA 1C1BB 1QUVA 2N3LA 2WVEA 4V1Ak 3UVJB 4DOZA 1GX5A 5IQQA 4CT9A 2X1AA 1N6QB 1FRXA 2B4UA 2QL9B 2XC9A 3P8BB 2D7SA 2N4DA 2ZVSA 2M70A 4FPIA 4QQBA 3BGRA 3P96A 2OD6A 5IS2A 4R5PA 1XK8A 4I7FB 1CULA 3AD9C 5HK4A 3IR7B 3RB3A 5B0EA 2CNOB 3HSJA 3NMAA 2JVOA 3DU5A 1RHQB 2IA0A 2ZNYA 3FSXA 5HROA 3R5BA 3MEGA 3GTYX 2R2SA 1IR1A 2XGPA 1VHIA 3CJ4A 1T9WA 1AT1B 2OP5A 4CH1A 3DNCA 4FPRA 3Q8UA 3W5ZA 3HSZA 4WFZA 3KYLA 2GVDB 4DZ6A 4ZKAA 4UY8T 4RBVA 2G9OA 4H4OB 3TEHB 4EGLA 2ROGA 4I6WA 3GFHA 3N4WA 2WTFA 1DJ0A 1U4BA 1VR6A 1NZ8A 4WFNQ 3OT9A 3TW0A 1UWBB 1R7IA 3CCMS 5LXRA 5B0FA 1PYTA 2DTJA 1V5IB 2DGUA 2ZC3A 5CHCB 5CYQA 2IJNA 2VQFF 3EGVA 4Y0FA 3W62A 4HLBA 1X5PA 2VFVA 4AD6A 1CS4A 3E8OA 4I2QB 3VZHA 3QT7A 5E3AA 2AWZA 2BMBA 4O3RA 2UXCJ 1FXRA 5DO2A 5THWA 5KFXA 5LOQA 4A8QA 1JWWA 5I42B 3IO1A 2EG2A 1EETA 1RT7A 2V4JA 1MWYA 1RT3B 4F02A 1JQGA 2ZBQA 4UTGA 4PRFA 1TKXB 3MECB 4ZIVA 1QAXA 3LP0B 2FZKB 2GA7A 3ADAC 2YNGB 4LFBJ 3BKFA 2ZBPA 2JZ5A 2IA6A 4PABA 1N5YA 3R27A 3GG0A 3AQPA 2W1BA 1HNZJ 3TA0A 1TL3B 3GYNA 1NBEB 5GVQA 2BM1A 2MSSA 3UDLA 5HJYA 4IUFA 4W98A 2R7UA 4LR7A 3N01A 2DNHA 4FF4A 2KVIA 3HVWA 1HPZB 3KFWX 3R2DJ 4PPDA 5LSRA 4WZQA 5C42A 2AJQA 5A8RB 2XM3A 1U1OA 1F60B 2JRSA 4YB7A 4PXBA 2BE2B 2DH7A 1TMJA 4WJBA 1VQYA 1XNQJ 5C25B 4EMDA 3SEOA 3CC2S 4DUYJ 3HF5A 4ELVA 3I0RA 1N33F 1I51B 3RB6A 4KGKA 2D3UA 3NL0A 3W8PA 3FVYA 3OVBA 1S12A 2VZ9A 3V81A 4F3OA 3PFOA 4P2FA 4ZPTR 2HHUA 1TFWA 2DEIA 3HCXA 3JXOA 2HRTA 3NWRA 1IR2A 1S0VA 3T5LA 4OI3A 4DFPA 3QRQA 5ITHA 4ZVOB 2WVFA 3MWBA 3A8KA 2O01C 3OTOJ 2ZH7A 1VRQC 1FESA 3EDQB 4HHJA 5A2QY 3V4IA 3P49B 1B70B 3LP1B 2QMUB 5ETRA 3L3CA 5ETVA 1CQMA 3CJTA 2BACA 1U2FA 2XS5A 3AOBA 3OVSA 3LH2S 4C8OA 4LFAF 4UZCA 2J7UA 4A8SA 1U26A 2HFSA 1LWEA 3IA0A 3HT0A 3JYTA 1RISA 3PYEA 2E5JA 1Y10A 4ZLNA 1PC4A 2V9KA 4UT4A 3ZXWA 4QR1A 3KK3A 3IRXA 2W8LA 1WEXA 5KFZA 2XMAA 3SSSA 1LWFA 3KNGA 3CW2C 3G4SS 1HI8A 2WONA 3FEZA 1X4GA 1F9HA 4Z7CA 1HYSA 2CXEA 4ED5A 4RW4A 2I2YA 5D0EA 1Z2LA 3RRGA 5LMUF 4B3MF 2FVPA 4KFBB 3ET6B 1PJ5A 3U1MA 3UCGA 4ITSA 4DBQA 1B0PA 4DMZA 3OSPA 2YNFB 5GAHI 5HP1B 3J80Y 3MMBA 3Q8YA 5KFUA 4DL3A 4I67A 1U2RA 4N41A 4CNYA 1I94J 4ZLJA 1WORA 3AB2B 4F4AA 1FNOA 1TL4A 1IKVA 1SJRA 1IVZA 4FYWB 2W4DA 3E01A 4O3NA 3KDOA 1GXUA 1RT2A 1VC0A 3O3LA 4MTPA 1YITS 2EC2A 4GO7X 2WSEC 4ATNA 3W7BA 2MJUA 1K1QA 2DNNA 3MI7X 1K73T 1LW0A 2MKKA 1IM6A 1LW2B 4OYBA 3FGVA 3KKFA 1JLBB 3CJ0A 4X4UA 3NGSA 2YX4A 2E1CA 5CYQB 3C15A 2VASA 3L7OA 1C1CA 3LWMA 2AJ0A 2B6AB 5K20B 5J1NA 2E66A 3IN5A 1WI6A 1WG5A 3C8YA 2W2NP 1YX2A 3SFGA 3KLGB 5IWAJ 2ZWPA 4QOTA 1IJEB 2L3MA 3QQCD 1DRZA 2FLPA 5HI7A 1T0TV 3KTQA 1RTJB 3KJNB 4YY3J 3C6UA 3DHWC 2LQ9A 1P1TA 3LGMA 3D0GE 5HBMA 3LA0A 3VGUA 4DX7A 2WW8A 4GKJF 4K5SA 1Z2ZA 3EGZA 2V4JB 4NA2A 4WIIA 1RA7A 1B99A 3IG1B 2MEWA 4OI4A 4WP8A 1YQHA 1D8ZA 4NA1A 4M5DA 1N5YB 1QTNB 4DX5A 1VIOA 3C66A 3E51A 4YB6A 1UA1A 4UUWA 3DM2A 3QFHA 1RSCA 3CIMA 4YR3A 1TK0A 3DLJA 3TP2A 3EVOA 3DLGB 3BQ2A 4OHWA 4RW7A 3PEJA 1FRHA 4MH8A 4DN9A 2BQRA 4KTQA 5DG8A 4TLRA 3S8SA 2H3EB 2RRNA 3MMJA 2LECA 1F0XA 4NMLA 3KLHA 4ECWA 1FXDA 1VQPS 2DY1A 3JAMY 2RUGA 4O3SA 4NXMF 5KG7A 3CE8A 3I0RB 2GHWA 3LPEA 1T3NA 4KGVB 3PO4A 1BD6A 2KFYA 4DR4J 5KT7A 4BCAA 4X62F 3CJRA 3R5CA 5HQ8A 2DVIA 1SJ3P 1AYEA 4K5RA 1TELA 5E7OB 2JL9A 1RWUA 1TV6A 1KOHA 4F04B 4AT1B 4AXJA 1FA0A 2YKPA 4RW8B 2HBYB 4DV5F 5LSOA 3O6QA 3PEHA 2U1AA 2NXNA 3RU0A 2OPSB 1GTEA 5B0CA 2HHPA 3BM7A 2CQ3A 3L4BC 2KYZA 2B9EA 4ZJOA 3TYTA 2VBXA 4DX6A 2R8JA 3QAEA 1DZ5A 1D1UA 4Y2CA 4KR0B 3BV8A 3QT5A 1X4FA 3ZZUA 4ES3A 3BH6B 1KVKA 4RBUA 5IT9Y 2CWXA 2B51A 5IXUA 4ECTA 5DETA 3P5TL 4IQXA 3WDOA 2XHWA 3IBWA 4ZVUB 2J8AA 2MB0B 1EIYB 4DV0F 2ZVIA 5J1EB 2JH3A 4NLXA 4TY8A 2BJ8A 3QATA 2ROEA 3GFZA 2MGZB 4JOUA 2BRKA 4IG3A 5K5MA 5LL6d 2X1BA 2VICA 5MLCV 1OPZA 1M0SA 2G0CA 2HNYA 1X4HA 3I5CA 4IOBA 1HR0F 1T8EA 4F3QA 2R4FA 3OR2B 4QIWD 1SQEA 4LR8A 2OEMA 4LF2A 5KFFA 3BDPA 4FF3A 1A6LA 5T14A 4EO8A 5E3CA 4GO5X 2CJBA 4EWTA 4EZ6A 3RR7A 4WXOA 3EZUA 1BE4A 3ZTQA 2V8DA 4NYPA 2ZHBA 4A48A 4CO2A 5EWEA 4QPXA 2MZ1A 5GMDA 3ISND 2DHGA 1KVJA 3CCWA 3BR8A 1YRUA 2CG4A 3MM6B 5KFJA 2OFGX 5E41A 4ZP9A 4YUDA 3BQ0A 4UOFA 1SC6A 3DRSA 2Z2MA 3MM7B 1YJTA 4OJHA 3FQLA 2RF2B 3P4UB 2JX2A 3CSKA 2J0WA 4MK9A 1NKBA 4N77A 3JSYA 4MT1A 4DUTA 3J7YI 5CD4H 1MU2A 1BXNA 1TFYA 4I0WA 3M9NB 1TL1A 4IFYB 2XSJA 1SV5A 3HZGA 1AUDA 3D1HA 2JVRA 3IS9A 2MMYA 3HVRA 4A8WA 4C8ZA 4QIFA 3MDFA 3BSAA 2WZ1A 4OZ3A 5CZVA 3G6YA 2CPFA 4FS1A 1S6PB 1U02A 3FZ2A 5L8RC 2BKPA 1SJFA 1N52B 2C2EA 2M3DA 3IRWP 3CCJS 1RAHB 2LCWA 3GP9A 4JUZA 3K5OA 2JHEA 2UXBF 2ZKUA 3LAKA 2AX0A 2HNZA 4N47A 3CJ8A 1D9AA 3IGNA 3OJUA 4P75A 2DHXA 3EUNA 1IJFB 5C2CA 1VQ5S 1X5SA 3BPDA 1DLOB 1LK7A 1F9EB 2YBVA 3U27A 3GE9A 3D68A 1WEYA 5D4LA 3QNWB 2W9AA 2IY5B 4DV7J 1RGVA 3O44A 3PHEA 4W90B 1UWAA 2P8IA 3DOMB 3IBFB 3KUGA 2W7AA 2MKYA 1RU2A 5DZ6A 5A76A 1NO8A 5CD4A 1BWEA 2E9RX 5IOLA 4CLFA 1DBDA 4C48A 1HMVB 3KLHB 3OTEA 4DR6J 2PGCA 3IAM9 1SQGA 1Q16B 4HT5A 1XTZA 1ZM2A 4JP8A 4NLDA 1GTHA 3MF5A 4ZVRB 3WIVA 4P6QA 4Z7YA 4EK2A 4M5JA 3GYXB 2UXDJ 4DJBA 2W9CB 3HX9A 1MWZA 3ZZOA 3WHIA 3SQGB 4JB8B 5MAOA 2I1RA 3BYRA 3UDEA 1G1XA 3CD7A 4WPAA 4FF2A 1RWOB 1SJ4P 1NSKL 3SXLA 5HLFB 1U6ZA 1X0FA 4ZCIA 4USWA 1NDPA 3MOZA 1HBOB 3H5XA 1RHRB 2ATLA 3J7ZT 4L6V3 5T7LB 1SXLA 4NCGB 1AZSB 3CDWA 1NK7A 4PG7A 2PN6A 1M5PC 4HHHA 3F0NA 3ZTSA 4C3KA 3PW4A 1FD2A 3KUHA 3C46A 2VUGA 1RWWB 3CCLS 1JXVA 2LU1A 4Y2MA 3HFKA 2GMHA 2A6OA 4L76A 3UD3P 4DSKA 3QO9A 3E2EA 3D2WA 3GJRB 1HARA 3GPAA 1TKTB 3OHBA 1PJ6A 2WBRA 1ZAXA 2DRBA 4CI0B 4KKOA 4ZVPB 3HJVA 3THPA 3W66A 1Q0NA 3R9LA 1RT4A 4MJKA 4A8FA 2QL7B 2CPEA 1IM4A 2DGOA 3Q2TC 1F5BA 1D9FA 3IAS9 4ZVSB 4AL7A 2UUAF 3FCVA 3TJ9A 2IYGA 3V6DA 3M05A 2UXCF 4QU6A 1SUQA 2GZOA 3MTJA 3ZZPA 1RHUB 1UPMB 2EW9A 4OLOA 1JJ2R 3SMZA 3MMAA 1XIQA 1S6QA 3JSBA 2AW0A 3W2WA 2IRXA 5B0DA 4W92B 3CJKB 1YTYA 3DYAA 4RUAA 1X60A 3PZPA 1UEVA 5IC4B 4LFBF 3ZZTA 3ITHA 1KS2A 3OL8A 3KMQA 4UQGA 2W4PA 2V0NA 3M2VB 5AE1A 4CO4A 3GMGA 3DRSB 4K2XA 2J9EA 4YQWA 5K8PA 2XCPA 5L46A 2R42A 3TX8A 3PJWA 1RXOB 3SCLE 1KQGB 3SFUA 3IXQA 2H5EA 4X65J 3H5YA 2P2CB 2K7KA 5KFNA 3HP6A 3EWGA 1FHTA 1U24A 2DD8S 2WVCA 3LP2A 1KQSR 2NXEA 2P9CA 2MHEA 3DLHA 1X9SA 1W25A 3H7HB 1PSDA 2CFXA 4LRFA 2R7RA 1UCNA 2PMHA 4U8VA 4F0MA 3B78A 4NLSA 5JMNA 4DSIA 1XNQF 1KP6A 2XTJP 3OFGA 4DUYF 3AJ1A 2O5DA 1FVSA 2QA4G 3DGPA 4KHMA 3K8WA 4FN5A 2YWFA 3PKMA 1Q7LB 2R2RA 4ICLB 3EJMA 4OX8A 3GV7B 4E0DA 1VC5A 2R9LA 3CB4A 8ATCB 5IFMA 1FX2A 2Z56B 2ZBCA 4QZVB 3G87A 2HNZB 4DL4A 1SL0A 5F9LA 1H2VZ 5GAEU 4OZLA 5KFCA 4IQMA 4CTAB 3EXYA 3KG1A 4ZVGA 3G2XA 4JI8J 3N9UC 4NYZA 4ZIWA 2AJ4A 5I3PA 1QUPA 3KLIA 1CJKB 4RX6A 1YBTA 3EDRB 1IBMJ 3ENQA 1BQNA 3IR6B 1RTDB 3NGKA 2MKJA 3KLVA 4WU3A 5KT2A 3OR1A 5B0BA 3LGHA 2B56A 3HFZB 4NL5A 3KNAA 2KZZA 5KG4A 1HNIA 2MZSA 4OI2A 2BJ7A 4TU9A 2DO4A 4EUVA 3K7RA 2WOMB 2VFRA 1NJWA 4PAAA 1HLWA 3KK2B 4RU9A 1NK8A 4DQQA 5I4MA 1T9VA 2HK2A 3TA1A 2FIUA 4F25A 3P6YC 2ZBIA 2IIHA 1PG5B 3PKYA 2HRYA 2A2CA 3FQKA 2EFOA 3L09A 1DTTA 4PG8A 1JLEA 2UUTA 3QYYA 4KGMA 2GMLA 4U6PA 2RNEA 1MROA 4CH0S 1IKXB 2AJ2A 2DPJA 3FK4A 2JC0A 3OPKA 2MKHA 3W63A 2DXFA 3M2RA 3J7A1 3D0IE 4DQRA 2K1RB 3ELHA 4UOCA 4QCLA 2EWHA 5LJ3Y 1U49A 4ANDA 5HVGA 5ADZA 1C0UB 2J6SA 3DLKA 2EPIA 4A8MP 4XIUA 3QO9B 4Q2MA 3DRXA 3LGNA 5KG2A 2ZH9A 2QFIA 2B0GA 1YWXA 3VV2B 3HHKA 2DXDA 1M5SA 3N6MA 4RL1A 2ZDOA 2V2QA 4KGXB 2YWWA 4EBDA 1T03B 2VHGA 2YQ0A 2JJ4D 4HEA9 1SIZA 1NKCA 2QA1A 3C14A 2LMIA 3ZNUA 4C0HA 2HK3A 5AT1B 5BYRA 3TQ1A 1S0NA 1FERA 4I2PB 4YY3F 4UOHA 3MPVA 3NCPA 3KJVA 4M95A 1H38A 3UPFA 2H65B 4FKYA 5D0RA 1RTIB 2HBRB 3WX8A 4JI2J 1YJNS 1S6QB 1CC8A 1S6OA 4MFBA 3FCHA 2MQQA 2OD4A 3CD5A 1E6VB 2ZH5A 4CLSA 2E7VA 2EFGA 3UR0A 2X1GA 1VMBA 4B3SF 4I68A 1KDNA 2MQMA 2KHCA 1URNA 1IBLJ 1JJ4A 1W2IA 4GC7A 3A3OB 1LWXA 1P6TA 2NSCA 2IHR1 3UN3A 2Q3PA 4NEZA 2AGQA 1CJTA 2RAQA 2VJUA 1WHYA 2Q6CA 1T9XA 4ID5B 3AJDA 1VI7A 2K06A 3CUNA 3LP2B 4I56A 1FK9B 1RBLA 1TVRA 3LW5C 2VDHA 1Q53A 3VF0B 2APOA 1VQOS 1TZ0A 2X3GA 2XCAA 1REVA 1TL7A 2V6AA 2E5GA 4U95A 3KLFB 3CD6S 1PYOB 3NCRA 1SKSA 8RUCA 3MAHA 2W2PP 4DR4F 1F3VA 1ZTWA 4IFVB 1IKWB 3FBEA 4ETZA 5A0YB 4OYMA 3W2VA 3R5DA 5FDLB 2AEMA 1KHVA 4WTYA 4BC7A 4DU8A 1S76D 2PO4A 1H2TZ 3T5JA 2LEAA 2FJEB 3VZIA 2VG5A 4LREA 1ULRA 4A8OA 1RA6A 1WOPA 4RNMA 5CYMB 3G8TA 1RWMB 4ZOSA 2BE9B 2GO9A 2A2DA 2PA8D 1OJ4A 3SI8A 2MQNA 3S7RA 2WBMA 1K8AT 4UW2A 4CLTA 4JI5F 2XQCA 1S1VB 3UD5A 2G1HA 4P71A 1HNIB 3DLLQ 5CYJA 2CZ9A 2J6TA 4C7QA 5FLXY 2MZTA 3OQ2A 4NI2A 1OY9A 4NRUA 2VBWA 2ZJQQ 1QE1B 4DF8A 1S1UB 1XJWB 3RUBL 1VISA 2FD2A 1JLEB 2HZAA 4OX9J 2ZE2A 4B3TJ 3MFIA 2HBQB 4TLQA 4ED1A 4O44B 2FVSA 1AUSL 5KFWA 2YQ1A 2XI3A 4LFCJ 3G82B 3R97A 1V6HA 3O8WA 2RQKA 1JLCB 3C16A 2VPXB 3FKBA 1BLUA 3M2RB 4WE1B 4DV3J 3KWMA 2YPZA 2EI5A 3BBFA 2V2VA 5C5JA 1VLOA 2B9XA 2BJ3A 3PACA 3T5KA 3L9ZA 3Q8SB 2YNHB 3CEDA 3CJ5A 2ACYA 3ULHA 3QGHA 3ZO7A 2AJFE 1L3VA 1WELA 4FXWA 1M1KT 2XULA 5F8LA 3A8EA 5A8WB 3GSDA 4WXWA 1SB6A 4Y65A 4MAKA 4PR6A 1NB7A 2F7VA 4DHVA 2XG8A 1S1TB 2FVQA 1UVMA 3QLHA 4J9SA 2GGPB 2VQEJ 1EAYC 3CT9A 2R2TA 2IYIA 5A8KA 3GIMA 4PQAA 1ZM9A 1WWHA 2FC9A 3BB5A 4B3OB 4PUOA 1XNRJ 2GAHC 3T1YJ 3V6HA 3MR6A 2C28A 3FUYA 4Y3CA 4CM2A 2QV6A 1X4EA 3NCQA 2XWXA 1RT6A 5F3TA 1NHUA 1XMQJ 2HQFA 4DG1B 5KFYA 4C97A 2VDIA 2LYVA 1FXLA 2VJVA 1ZM3A 3M8WA 2CQPA 3H98A 3TZZA 4QWCA 1EJ7L 4ZPBA 3MD1A 3FBFA 2EG1A 4BLGA 4ILLA 2AZ3A 4NYOA 1ZZNA 2ZOFA 3DI6A 2HGMA 4FKXA 1DQ8A 3I9V9 1JKHA 1S4FA 1DHMA 2AJ1A 6AT1B 4F0HA 3TOQA 2VKZG 4ECZA 4X4TA 2I38A 2Z58B 4DV7F 1R8BA 4J9UE 1WF0A 1EHWA 3OL6A 5ETNA 2I5JB 2OSQA 4OZ1A 1AB8A 2Z2LA 4HDHA 4U7UK 1KFDA 3US5A 4DSEA 4P73A 3A8JA 2LFVA 3TR5A 4Y2AA 2GJ2A 4QU7A 4H4KC 4J9RA 1TR0A 4JV1A 1ITPA 1YJWS 1RKJA 3QMQA 2GIQA 2COLA 1DQAA 3QJJA 1U45A 2CNLB 4KO0A 3DN9A 3RBXA 1REVB 3FBBA 4GVBA 2FLOA 2UXDF 2A10A 4B3RJ 3M32B 2HZCA 4JI1F 2CNNB 2W8KA 3HI9A 2F40A 5HJXA 3CCUS 5K9FA 1NJXA 2CJXB 2M4MA 4FP9A 4LSLA 1RJJA 2R8GA 1AA1B 2LKZA 5J2MA 3I32A 4YB5A 1RWNB 5CXTA 3CJ3A 1R89A 1U1KA 3D6TB 4Y6IA 2G4BA 2VOOA 1JLAB 2RQCA 1W2BR 4HDGA 2KH9A 4QWEA 4IOAQ 1B7YB 2Z8QA 3W1YC 2VBZA 2OPPA 3GQCA 3MAAA 2Y1IA 4CCHA 3EGNA 4CYUB 3R7SB 2ZFHA 2B8QA 2ZEJA 3K58A 1UZDA 4C8NA 3NOCA 2CQ1A 3WC0A 1VBXA 1EQMA 1T02A 3PX4A 2YWKA 4ED7A 4UQTA 2BEFA 3U1LA 5K14B 2PSZA 1S9EB 2LQ5A 3MTKA 2ZUGA 5F8IA 5AXKA 2M0GB 4IG0A 2EFQA 4FYYB 2CJAA 3UI3A 2D3OR 3TVYA 4EFAC 4JI7J 3NNAA 1KN6A 3ILIA 5D0HA 2IVFB 5I3UB 3SCJE 1RE1B 1KVIA 5F9NA 3Q2SC 3E3XA 2I0XA 1SH2A 1MN7A 2B5JA 2AZ1A 2MPUA 4JI4J 2HVEA 1S97A 1HBNA 3MCNA 4IKAA 3C19A 1JIHA 3GV8B 3AT1B 1YZ7A 2DR5A 1DFDA 2AGOA 2CQCA 3MM9A 1FDDA 3I0SA 2FJVA 5KFBA 3UDCA 4F50A 1FCAA 1GX6A 2MYFA 1X31C 1UVJA 4F67A 4LVNP 3KUEA 2HQCA 3VGTA 1GT8A 4IR9A 4X65F 4MYUA 2FHOB 4NLRA 4NLQA 3U02A 4ALZA 2QL5B 1PILA 2Z2YB 3CWJA 1SC4B 2Y1JA 1U1NA 2GO8A 4QPTA 2IC3B 4HYKA 3HVTA 2I8EA 1LKZA 3VALA 3HM9A 1VOMA 2OTJS 1X4DA 3M6XA 2W2OP 1RLCL 3SQOP 1FE4A 2QMXA 3MPDA 1TKZA 1FJGJ 4Q44A 4K4UA 4OZ2A 2KFNA 9RUBA 4M5NA 2IMWP 1FE0A 1GMVA 5KFSA 1WC5A 2J5AA 3I6PA 2XMKA 2VG6A 4V19X 3N5BA 1H3DA 3TEGA 2NZ4A 1YZ6A 2NUUG 4ILRA 5D4NA 2RKIB 2CDQA 1IBMF 3T6BA 2HVDA 2BYCA 5CABA 2VA2A 3D0HE 1HQUB 4F26A 2M5YA 1NMEB 4G65A 1UEKA 4KYZA 4Q8FA 4ZVTB 2YWGA 1D3WA 5KFMA 5D6GA 4QWBA 3Q24A 2IPOB 3H2UB 1N5QA 3OXFA 4DUZJ 3KK1B 5GADU 3BGLA 3OL9A 4M5KA 2YWHA 3GJQB 4C2MA 1TK5A 4LMZA 2L9WA 2UUBJ 3RAMA 3BDEA 2AGPA 4U8YA 3M2UB 5CA5A 2CAJA 2BE7D 1VQLS 3PJ9A 2IVMA 4DPYA 5D15A 1IN0A 1HI0P 3TJAA 1DTQA 1RP5A 3RTVA 4X4SA 2M7SA 2LDYA 2AV5A 1IXKA 4ENOA 2CVIA 3B54A 3MURP 2AKWB 2K3IA 2W4CA 4LF5J 1NDKA 1C1BA 2HFUA 4CO0A 2FC8A 2LEBA 4S0MA 4WYWA 3UVJA 3CPWR 2PMWA 1Y3KA 2HFVA 1VRUB 4JI3F 4NLTA 1N6QA 1S4EA 5EGYA 5E33A 1NHKL 2BX6A 5H9EJ 2ZBRA 1D8YA 3M4XA 2CQ0A 5GAGI 5IV4A 2HMIB 4M5MA 2FJXA 4OI0A 3BGOP 4YB1P 3WC2A 4L3NA 3AQOA 4G1QA 3NMRA 4ED6A 1FWLA 1ZAVA 4I7FA 4URSA 2UU9J 1B0VA 2ZD1B 2ZZNA 2IM3A 2F5GA 3GLJA 4X4PA 4KH0B 4DSJA 2NS1B 4U96A 4M1KA 4BBYA 4N8NA 1CVJA 2GVDA 2IDLA 3BS9A 2DHHA 4FVMA 2H54B 5GMKa 2CWKA 2YKMB 4H4OA 2HHHJ 4ED4A 2NZCA 2HS4A 2ACMA 2VU5A 3M6UA 3NS5A 1HKAA 5BYSA 2AHOB 4EI2A 4LF7J 4JI2F 3P45B 2N3OA 1VQKS 2CJ9A 3DOLB 1R27B 5AJ3J 3N79A 2R8IA 1ACMB 2B7BB 1R3NA 2E5HA 5L1LA 1HBNB 1UWBA 5KFAA 2B4VA 1IBLF 3I9ZA 2FZCB 2M88A 1M1GA 3NLCA 4KC5A 5D3GB 2DB1A 3I0SB 4TVAB 3W64A 4M5LA 2MZJA 3D7SB 1JNZB 4MKVA 2KYXA 4U9RA 4I2QA 2IM2A 4Q2LA 3KHHA 1IUJA 4PQUB 4K8RA 3IWXA 4NLYA 2XZTB 2BM0A 3A13A 3HHLC 1ZTTA 2OO4A 3J7Z5 1KOOA 2UVRA 1RT3A 2RRBA 2EFNA 3JSMB 1UW9A 4URQU 4WTOB 5D78A 1SKWA 1VIXA 4CIOA 1VJQA 3MECA 3CCSS 1PYSB 3LP0A 4LIWA 1RQ0A 5C24B 3G71S 1NJYA 2YNGA 1HWLA 3M9MB 3DXSX 2E9TA 1TKZB 4F2RA 1S5ZA 3POTB 2D69A 2B7CB 3MM8B 4DEZA 4J9LA 3VCDA 3HKWA 1QJHA 1HBUB 2DK2A 3R1LA 4ZPWR 4K50A 1FRMA 2CJYB 4URGA 1SH0A 3M1VB 4V19J 4PWUA 3W5YA 1IBCB 4HT7A 5E5NA 2ZUAA 4OIXA 2XLIA 3L7UA 2F8MA 2CA9A 3ONQA 1QY7A 2BE2A 2PI5A 1S9FA 4LSNB 1RWPB 2NYHA 5C25A 1CJUB 2CPDA 3GJTB 2OPQB 1LQ9A 3MR5A 3EVWA 3UNGC 4ZCKA 4I4BA 2ZKTA 4QJVA 3I82A 2ZZMA 3W61A 4CWBA 1WC6A 2CADA 3PX0A 4USUA 1PAUB 1LEOA 4IDKB 4J7CA 5BR8J 3DU6A 2M2BA 1RAFB 3ISZA 2L9NA 1WNEA 2W24A 2GAGC 2PDAA 2KB2A 3LP1A 3HHLB 1I3OB 2DGWA 2P9EA 2Q6BA 2KM8C 1MMLA 4IO1A 2DIUA 3EXCX 2QSWA 2HQGA 4OX9F 4B3TF 2BW2A 3GB0A 4ZJQA 5J1PA 4RW9B 1S49A 1F6TA 4DR2J 1GAOA 3T1HJ 4LFCF 5HMZA 2EFVA 3QIDA 1QLNA 1TUGB 1VRTA 1CG2A 4KRWA 2V67A 5H9FJ 2X3DA 1BQXA 1PIEA 1X9MA 4H4MB 1IBKJ 3RZAA 3R7NB 1OY8A 4BC9A 2GIRA 1Q8BA 4G1QB 2F4FA 3J81U 2RDJA 3CNQP 2ILZA 3TUZC 2EVZA 4J9OA 1LXNA 2NXCA 4KFBA 3ET6A 4J37A 3K89A 2YNFA 5HP1A 2VQEF 2Y8WA 2DH9A 1XMBA 4MIAA 1N0VC 1F9FA 1T95A 3H4DA 1HWIA 1A0OB 1FKAF 3LOUA 4HHUA 1WHVA 2V63A 3CCTA 4CT8A 5KG5A 2KDOA 3BO4A 4B9VA 4G3IA 4O3QA 2V50A 1XMQF 3MCMA 2V34A 3LTOA 1U8SA 2H5JB 2XNQA 3AAWB 5E2QA 3BSCA 2YKAA 2EBGA 4U7UD 3GILA 3M30B 4DXLA 4ES2A 1YJ7A 1IKYB 1LW2A 2PD1A 4OZ5A 2R7QA 3TAMB 1JLBA 4JV5J 1S9GB 1R0CB 4OYPA 2DNYA 2XYHB 3DFEA 3Q0AA 1QTMA 5AXNA 4O0NA 5KG1A 4WU2A 2B6AA 1WOSA 3MR7A 2N7CA 2MJNA 3KLGA 2F8HA 2VC0A 2FTRA 1H98A 4CLUA 3CCQS 1RTJA 4IOCQ 4PG5A 1V3RA 4I1TA 2HWIA 4Z37A 4EBEA 1H73A 1M5OC 4DWIA 3V5RA 2DNGA 2AYEA 5SUHA 3ZTPA 2NPFA 3BYPA 3BJYA 3I4PA 3M8PB 1WC4A 5DM6Q 4EYHB 1U1QA 2ZZTA 2HSEB 3W60A 4PKDB 4QIVA 2Z57B 3IG1A 2J8SA 1LXJA 2CZ4A 2UZAA 4A8KA 4QWAA 3HXMA 1RTHB 4HI2A 2OAUA 4ZVEA 3MHYA 4A46A 2YNIB 4WK3A 3M8SA 3I96A 2MLYA 5DQGA 3O2IA 3QGPA 1ZYQA 1J27A 3G6ES 2CIMA 1R43A 3RBDA 1CLFA 2ZM6J 4X4QA 4K4YA 3DLGA 4J9NA 2DR6A 3T6JA 1RWVB 2OTLS 3W65A 2QE5A 3BGUA 1SL2A 4J9MA 1J5EJ 2ILYA 1O6XA 3KLEB 5BXIA 1WSRA 4DR1F 1S0OA 3KJFB 1FDNA 4JYAF 2DNOA 1VS3A 2ZC4A 2F9JA 3KG4A 2N82B 4DL0C 2RS2A 3PV8A 1FWKA 4U67Q 2W9BB 1J5OB 3CDAA 5ETOA 4R25A 4TYAA 4PWDA 2KTQA 7FDRA 3ZZYA 3BEGB 1XQIA 3G86A 1BQMB 3CO9A 2AQ4A 1K44A 4KHPF 2R7VA 4RW8A 4LBPA 2BA9A 1FJCA 2OPSA 3MPYA 3PO5A 3M8RA 2G2OA 2WK4A 1NB2A 3CXCR 2KVQE 2K8GA 2UVWA 1QAYA 2QA4S 3PRDA 2F9DA 2BABA 2IAJB 3UDVA 4AUKA 2KXFA 1RDRA 4TNOA 2RH3A 2R7TA 1EP4A 1S0MA 4DV4J 1MW7A 2WHOA 1Q79A 4KGZB 3K5NA 4ZVQB 3IR5B 3PRVA 4CQ1A 2HVHA 1VRTB 2HNDB 4B17A 1B0TA 4Y28C 2ZOGA 1WF1A 2NXJA 5J1EA 3A4TA 3FFIB 1WI8A 1H72C 2MGZA 2CQHA 4F3MA 3B82A 3EPIA 3DC2A 3A1YG 4P10A 4IH7A 2HFZA 4KPCA 4HR2A 2VL1A 2MQPA 4OL8A 4DPXA 2DGSA 1QVGR 3OR2A 2MTLA 2POKA 2WB1D 3C2PA 3QIPB 1NJZA 2VONA 2DHSA 1JLGA 3QFWA 4NWBA 1I5OB 3BZQA 4NASA 4LQ3A 2R2UA 3TA2A 4P74A 2YKNA 1S79A 2NR0A 4E8UA 3MM6A 4F4YA 1XN9A 3NOGA 2IMOA 4AQYF 3MM7A 2BJ1A 2PE8A 2RF2A 2RJZA 2C22A 4Q0BB 5BYQA 4X66F 4OHZA 2RQ4A 4KT0C 3UWTA 1RADB 3FRZA 3K17A 5C2GA 3CMES 1RHJB 3C6TB 4O4RA 2AMCB 2HFOA 3T41A 4IFYA 1X5OA 3QRRA 1LFWA 2UUCJ 2P6SA 1M5HA 2QRRA 2BZ2A 1HWJA 5KG3A 1ZA1B 4XK8C 4B3MJ 1S6PA 4F4ZA 2VF3A 1Q8KA 2KRRA 2MHNA 1HHQA 1T9UA 3FZBA 2BQUA 2HIQA 3FEXB 3OBIA 2B9WA 4CO1A 2QZ8A 4QBUA 4DUZF 1KWMA 2V8PA 5IT4A 5AXMA 5L39A 1Q8IA 4CNZA 4A8YA 3LALA 2VBYA 5KFVA 4K4SA 1K1SA 3M9OB 3QWUA 1VBYA 2XB2D 2BBEA 3RAXA 1E6YB 3ZC4A 2UUBF 1XWLA 2F65A 1IWGA 5DGAA 4NMXA 3AXMA 2FQQB 1TUWA 1F1BB 1ZA2B 1X5TA 3FSIA 4ZLLA 1DLOA 3MMCA 3KHRA 2B9YA 3DRRB 4ZHRB 2ZDPA 1UP1A 2QX0A 2BVZA 1R6VA 1HD1A 1NSPA 3L7PA 4LBHA 1UVIA 2RT3A 4PCQA 4LQ9A 3KJQB 2V2ZA 2ROPA 4LF5F 2VKRA 3DOMA 2C3MA 2QLJB 4EU0A 4QW9A 4NRTA 3ZZ0A 5SZTA 2Z0GA 3EZOA 4LF4F 4JI0J 4KY3A 3BKTA 3I5AA 3VQSA 4DZDA 1HMVA 2FDNA 1U25A 3BH7B 1JJHA 2JNJA 4JV0A 1XERA 2DBBA 2V8HA 2W9CA 1XMOJ 3J81j 2UU9F 2PI4A 3PY8A 3SQGA 4PWDB 3TAPA 1OYEA 1CC7A 3CJ2A 1VQ8S 5GAHU 2DRDA 1SI9A 5HLFA 4USJC 4LRDA 5BJRA 4LSZB 5KFDA 1HBOA 3DLEB 5T7LA 4NCGA 1AZSA 2ZITA 3A8IA 2QJ3A 2DY9A 3TVKA 1H2UX 2HHHF 1H7XA 4ED8A 2BOAA 4ECQA 3OUYB 3OFFA 3NXZA 2XNRA 4LF7F 1EP4B 4USMA 2QEXS 1Q81T 1SKRA 5D77A 3T1AA 3SCKE 1TKTA 1KEKA 3OHAA 3QRPA 1L5UA 1YRTA 1VJWA 2KZMA 3ZFVA 2HW3A 4GVLA 2BKOA 2KJWA 5CZXA 1OYDA 5KFKA 2H5IB 4CLZA 4NE9C 4C98A 3VAFA 2J6UA 5DLGA 4FNHA 1Y0HA 1CJVB 3D9BA 4ZDNA 1NDLA 2DJWA 1FKOB 4KH1B 1NH8A 1YJVA 2Y8YA 2QFJA 1EKSA 1H74A 1KQKA 3PXGa 4QYRA 4NXNF 3NGDA 4RUBA 2YVSA 3Q8VA 1XR6A 1JLGB 2H51B 1U2CA 2L08A 5A6PA 1R31A 3OLBA 3KOAA 4PXEA 4IRKA 3SYZA 3CJKA 2AF6A 2ZH1A 3T5HA 1HWUA 4LF8J 2A18A 1DQ9A 2IRYA 2YKNB 2RU9A 3D1QA 2DGTA 4FXVA 2MY7A 1LNQA 4ZCMA 2GX8A 3M2VA 4HTJA 2BW7A 4E2FB 3VHQA 4G1IA 4ER8A 4X84A 4K4WA 3F56A 3DDIA 2KXNB 5KFQA 2HQ3A 2DKOB 4RR5A 1WSVA 4R8UB 1RWXB 5M2PA 2WVBA 3H5UA 4CLKA 4P72A 1KC8T 2OSRA 4OZNA 2D9OA 2VFUA 4ELTA 2Q66A 3R5GA 1UKUA 4XDDA 5H9EK 1RT5B 4IH6A 2NPIA 5DG9A 5KT5A 1KSPA 4C3LA 3BSNA 1ZPWX 2IDEA 3MEDA 4X64J 5JUMA 1TAQA 4USTA 4J91A 2RVJA 2QSFA 1FRLA 3QSIA 3UW1A 4F4KA 4NPOA 2P6TA 4CRJA 1RT1B 5DLFA 2BDPA 4ICLA 2KT5A 2J76E 3M7VA 3K59A 2MLZA 1VQ6S 2HFNA 1WTBA 1HW9A 2VG7A 5F3ZA 4Z2XA 2ASDA 2HHQA 1FTCA 3FMBA 4DV1F 3SIPB 4CTAA 4GRSA 1UJ4A 4WFAQ 4RW6B 1NM2A 4YHHJ 1NNDA 1U7LA 3CIZA 3MMCB 3PR5B 3PIPQ 3TARA 1CJKA 3U7JA 1VGYA 2Z2ZA 1FNXH 2XMMA 1SVDA 1D0EA 1HW8A 4OYXA 3NKYA 1RTDA 1VQ4S 2FY1A 4ECUA 1OPIA 1KRPA 4MIWA 3OVAA 3RR8A 2ZWOA 4F4WA 4DR2F 3UCUP 1V5VA 4DLEA 4I64A 4JBCA 2WOMA 2DH8A 2FYXA 3HSGA 1REGX 1PAEX 3BN7A 3IFEA 4QW8A 5L9XA 2IM1A 3RAQA 3KK2A 1UFWA 3TRGA 1MNEA 3ENVA 5A6WA 1IBKF 3X3UA 3N6NA 4PWWA 1WHWA 3W9JA 4F0KA 1FDAA 2JSXA 1RAEB 2IFXA 2HG4A 3CO0P 1N36J 2KKHA 4RPFA 3H25A 1RWKB 3M6WA 4USKA 1VDHA 3AJ2A 2O3DA 4K4VA 3F73A 2Y0SD 4DS5A 1MWQA 1YK9A 5HMYA 3K0JA 2V5HG 2FLNA 5B08A 1IKXA 1I1GA 4M8LA 3AA8A 3HSDA 4MK7A 5I3QA 4KAIA 2AYMA 4CZCA 1ZETA 4RUHA 1MSWD 2HPUA 2VOPA 2K1RA 4DX8H 2CQGA 3QGGA 4LIRA 2E1RA 4J9QA 5LJ5Y 4BS2A 2Z30B 1NXIA 1C0UA 4QIGA 2CPXA 2KHDA 3JTPA 1WF2A 3PYFA 4FXDA 3P3DA 3J7YU 4L74A 2HLTA 3TZWA 3RRHA 2R7OA 1FEEA 4JV5F 1Q95G 1Z1ZA 2MKCA 4OMFG 4FYXB 5ETPA 2XWYA 3QBCA 5JJBA 4LBIA 1T03A 3EX7B 2FLLA 2HHSA 4N76A 3AA9A 3THTA 2VD3A 2FVCA 5KG0A 5M2RA 1U6FA 4I2PA 2KRBA 3KDNA 1NDCA 5JVGQ 2VA3A 1K0TA 1H7WA 2VFSA 1RTIA 1TMMA 1LOUA 2J0XA 2DGVA 1R0AB 1BHNA 1KFSA 1Y7PA 2WSFC 3PW5A 4WF9Q 3VAMA 2FHJD 1E6VA 4NCBA 5DRKA 3SDEA 1RABB 4C9DA 2JEGA 1SIWB 4OJ1A 1G3OA 3DRPB 3JQMA 4QYZJ 3MEEB 3D66A 2G0IA 4RJVA 1HNZF 1X4CA 3M8ZA 4CDIA 3D6MB 2HHWA 1JLFB 4FZVA 2K2PA 2E7XA 1SC3B 1VC6A 2Q43A 2VPZB 2ZM6F 3AOAA 2W2MP 1SC1B 4XPEA 3AXKA 1RLDA 3MD3A 4ID5A 4UF4A 2ERRA 1FK9A 1TKDA 1HBMB 1OS5A 5HO4A 1J5EF 5H9FK 5IT0A 2ASYA 2W7OA 3IP0A 2F8EX 2F3JA 3R6GB 2BKNA 4DSFA 2UUAJ 2CJKA 2QYCA 1YKWA 3NGUA 3M8YA 3KLFA 1S1WB 3MEDB 5IQ6A 1S99A 4CM0A 2UP1A 1Y5NB 5B0GA 3UE2A 1L3SA 1KLMB 3GR0A 3Q8QB 3BPSP 4B9UA 5F8GA 5F0UA 4IFVA 4Y2KA 2ZH2A 1IKWA 5A0YA 4FBUA 4YDDB 2VPWB 1N88A 3SSRA 3MR2A 1ROFA 4RBTA 5FDLA 2VG7B 2FJWA 3EMTA 1RBOB 2BANB 4DQSA 1R8CA 1NU4A 3MPWA 3OTOF 3RBEA 1U09A 2C3PA 1UTAA 3IBCB 4TXSA 2ABYA 4C11B 2U2FA 3W9IA 1RAGB 3VR1A 1U0HB 5CYMA 1G6BA 1JLQA 4OQJA 5K8OA 4MK8A 4KIAA 2HZVA 3UFCX 2YTCA 4NLWA 1FT8A 4TY9A 4DV4F 3U1NA 1O8BA 1RZMA 4YN3B 1S1VA 4ZPDA 1H0HB 5F8HA 1GMWD 2W25A 2LQ8A 2PC6A 3RYLA 2QLWA 1HNVB 2D41A 1FKPB 2F1FA 1S7IA 1LWCB 4DFJA 1ZM4A 4ZVHA 1S77D 5KFIA 2ZHOA 2IBOA 3ETOA 1HQEB 3BSOA 1TQLA 4IYQA 9ATCB 3SBMA 3H90A 4OV6A 7FD1A 1M90T 1QE1A 1Q82T 4ANEA 3WBZA 4A4JA 1S1UA 5LMNJ 4FBTA 2OPRB 2XY6A 1PBAA 1P27B 2ZNZA 3GG1A 1YIJS 3CJSA 5HSPA 3MM5B 4WYLA 1IR0A 1Q5VA 4O44A 1L3UA 2RS8A 1UEUA 3CTRA 1HIYA 1R6YA 1SJQA 3G82A 1I94F 1JLCA 3NP5A 3MUVP 2A0FB 1FI4A 3I4HX 2YY3A 3RBZA 4WE1A 4KV8B 2GW8A 1NSQA 1N5VA 2DNPA 4LF6J 1Q78A 3S6EA 2MQOA 2YNHA 1WC0A 1QSSA 3FRYA 4E98A 1JMTA 2HGNA 2BJ9A 1X4AA 2XZWA 2GVZB 2LA4A 2GIFA 4XTTA 4OI6A 5A8WA 1YJ9S 4QR0A 2QN6B 4TU8A 3TX0A 1L3TA 2HHXA 3B8HA 1LK5A 1S1TA 3EZ5A 1T05A 4ZPVR 4OYWA 4OZJA 2GGPA 1X4BA 2OEKA 3GCXP 2PEBA 2GFFA 2UUCF 3HT3A 2RE1A 3PJXA 5L38A 3FJ2A 3BGRB 3AHPA 4GC6A 4B3OA 4R5PB 1YSJA 4UZBA 5IWAF 1CULB 4A47A 1Z4UA 2MKIA 1X8DA 1Y5LB 1D9DA 3GYGA 3T9NA 2E29A 2MLXA 4DG1A 2MXYA 5HROB 3MEGB 2UUWA 4DF4A 3MUMP 3NGRA 3G96A 1HFEL 4OYIA 4Q8EA 1WJ9A 3D5MA 4RNNA 2AYGA 2UV8G 2YH0A 3Q86A 1FJEB 3SDEB 1V3SA 4HTIA 2QG9B 2FUG9 1A7GE 3CDBA 1KKHA 5KG6A 5AXLA 5E3PA 3H2VE 2JWNA 4LVOP 1M1HA 2BJDA 1RCXB 3AD8C 3Q8RB 2DNKA 2KT2A 2EKYA 4WKRA 2I5JA 1PO6A 2FPHX 1SJ1A 2JEJA 1DY3A 2V4RA 4RKUC 1WOOA 1YLXA 4JI0F 3OTBA 4NZ7A 2H9ZA 3HK2A 3KG0A 3VAGA 2LXFA 4ANCA 2VPYB 4F8RA 4R0EA 3PG9A 1CS4B 2F4VJ 1VCTA 3CCVS 3OSNA 2QO3A 2OHDA 3GSIA 2IJRA 4ED3A 1FFWB 3CMQA 1HHSA 2J9DA 1NJIT 4UY85 1XMOF 2CQIA 4NCAA 1WHXA 3M32A 3GFYA 1VBKA 1VQNS 4H54A 5ETKA 4MKAA 4RWWA 3TO8A 1QD1A 3PW7A 1EETB 2JEIA 1UW4A 2KL8A 1RT7B 1GQEA 2FHJA 3CC7S 4J9KA 3JB9k 2P9GA 3T19A 4ZN3A 5L9NA 1FRIA 3I55S 4OI1A 1T9YA 4CLWA 3CVKA 2RRAA 4B3SJ 3HO1A 2IM0A 4ERDA 4OHXA 3GIRA 3D1OA 3I87A 3OD2A 2O66A 2J7WA 2PT0A 4PXCA 4X4VA 2UVVA 1V3ZA 2GHVC 1JLAA 1XBWA 4ED0A 1VFJA 4DCJB 1JLQB 1RI7A 2RU3A 4IRCA 1XEZA 2HAIA 2ALZA 4OJGA 2XLJA 4YR0A 1RTZA 2JC1A 5F41A 5C42B 4C8KA 4ZVFA 4CYUA 1T94A 2KG0A 2AIRB 4LF9J 3R6LB 5DQIA 4JV2A 2HS3A 2RD5C 4MIBA 1NK6A 2BQ3A 3RW7A 4OX6A 4NZ6A 5LT5A 4CLYA 2Y1LB 5KFPA 3W5XA 3PDNA 4H4KA 4DL5A 5L1KA 3C3LA 3L95X 2VV5A 5K14A 1UMJA 1R8PA 5GMEA 5DG7A 1S9EA 1EKRA 2AX1A 3V81B 1UZHA 3EM1A 3CCRS 4X4RA 4N7TA 3GU0A 1FF2A 4NOHA 4YEAA 2GCFA 4PG6A 1N0UA 1N54B 1CSJA 4WFYA 5I3UA 2M52A 2OH2A 3V4IB 1FVQA 3TWZA 2FHKA 3GR1A 1FRJA 3GCWP 1SPBP 2R7WA 3R7BB 4LF8F 2C2KB 3Q22A 2OJ3A 3ZZZA 1LWEB 3TANA 4ELUA 2MQ8A 1HNWJ 2PA3A 1LV5A 3JYTB 3TUIC 2C2OB 4JI5J 1SL1A 2XS2A 5HATA 4P7TA 1GMWA 3T3FA 4WKYA 4DV6J 2CPZA 3MEKA 4HACA 2CKWA 4HL9A 1Y4ZB 2RHQB 3OXGA 1C4AA 1L3KA 1SCJB 4IH5A 3GFXA 5EWFA 3KK3B 1T05B 3IRXB 4N5SA 3RGIA 3GIIA 1LWFB 1HNXJ 1VBZA 2WONB 3THVA 3DKDA 4LR9A 2A3JA 2IC3A 3CJQA 1KR4A 1HYSB 2XMWA 3OTDA 4LT6A 3UCZP 5A2QU 4I6YA 4J9PA 4RW4B 2JFDA 1NLKL 2Y1RI 4Q43A 4X64F 4MMOA 2P5VA 3NS6A 2OGUA 4QIEA 3F44A 2M8DB 3FBCA 1AFIA 3HHLD 4OV1A 2NUHA 2J9CA 3MMBB 4ZP8A 1SQFA 5CH7B 2XMTA 2NQPA 4M63A 1U1MA 1U1RA 2NXUA 3TQEA 2NREA 1IKVB 1AXQA 2IRUA 4F36A 4YR2A 4USIA 3E01B 2XEXA 4YHHF 1RT2B 1PJ7A 4DFKA 1FFGB 1C2PA 2YXLA 3FCWA 4DN0A 2W01A 2RKIA 4K0KJ 5J2NA 3HHNB 3TZXA 4RO0A 1HQUA 2LLZA 1LW0B 4J5OA 2H4WB 3K5MA 4JI6J 5CAAA 3GWCA 4HH0A 4EYIB 1QVFR 3O1LA 4ES1A 1RUSA 2ZOMA 3KK1A 1KHWA 3MUTP 2IVYA 3QGIA 3J80U 2KJVA 3C15B 3CCES 1C1CB 3QJPA 3N5FA 2BXJA 3PFEA 4K7QA 1RU1A 3VAKA 1M5VC 4DR6F 4LRAA 3OL7A 3M2UA 2O1PA 1ICEB 3AODA 3PHTA 4DDFA 5FD1A 1N36F 3BN4A 3C6UB 1Q5YA 2JFKA 4DPUA 4TU7A 3HHEA 2RILA 4YMEA 2K7JA 5HBMB 3RB0A
chains in the Genus database with same CATH topology
2R7TA 1TP7A 1EP4A 1S0MA 2FGCA 5I42A 1MW7A 2WHOA 2D74B 3IGVA 2ZH6A 2B0GA 1KLMA 4ILMA 2FJDB 1WACA 1YWXA 3PR4A 3HHKA 1Q79A 2BOPA 1M5SA 2VFTA 3K5NA 3N6MA 3IR5B 2ZDOA 3HVTB 4CQ1A 2SXLA 2HVHA 1NZAA 1VRTB 2HNDB 1J2VA 1S1XB 4B17A 2HRUA 4EBDA 2BANA 5G0RA 1T03B 1B0TA 1TKXA 4Y28C 2JJ4D 4HEA9 4DV2F 5BR8F 2ZOGA 1VRUA 3QPIA 1Y9OA 1WF1A 4M5DB 5J1EA 4MKYA 4OHVA 1SIZA 5CCLA 1X9WA 1NKCA 2QA1A 2LMIA 4I6AA 3FFIB 1WI8A 4C0HA 1MSWD 2MGZA 1QM9A 2CQHA 2Z4PA 4F3MA 4C11A 1N32F 3N28A 3B82A 5BYRA 3EPIA 3DC2A 3A1YG 2D3ZA 1VQMS 1JXLA 4IH7A 2GNKA 2UV8A 4KPYA 3HDSA 2HFZA 3TQ1A 4Q7AA 1S0NA 1FERA 1TL3A 3DM2B 2HMIA 4I2PB 2VL1A 1VQSA 4YY3F 5KOXA 2MQPA 3MPVA 4GMKA 2CQ4A 3NCPA 5F8MA 4OL8A 1Y3JA 3AB4B 3KJVA 4M95A 2DGSA 1H38A 3UPFA 1QVGR 2D9PA 3OR2A 5KFTA 4RW7B 4WK1A 3FNNA 1RTIB 3HZEA 2ZHAA 1YJNS 2VG6B 1UVKA 2POKA 2WB1D 1HPZA 2ZD1A 2JOQA 1S6QB 1CC8A 1S6OA 3H20A 4MFBA 4OHYA 3QJLA 3VAIA 3FCHA 4NA3A 2MQQA 3C2PA 2QT7A 2OD4A 5EN1A 1KD1T 3QIPB 1NJZA 2UVUA 3CD5A 2XLKA 2Q79A 2OFHX 2OMLA 2VONA 2DHSA 1E6VB 1JLGA 2ZH5A 3T1HF 5A8RA 2EFGA 3UR0A 2V2KA 2X1GA 5K8NA 1VMBA 3HVAA 4U7CA 4NWBA 2X1FA 4B3SF 1HNVA 2GHPA 3BZQA 3LWLA 4I68A 1FKPA 1YJUA 3OV7A 2MQMA 2KHCA 4LQ3A 5CCMA 1URNA 2R2UA 1LWCA 2NSBA 3TA2A 2XSFA 2YKNA 1S79A 3DDKA 3MR2A 1JJ4A 2NR0A 4WFBQ 4TQSA 1W2IA 4E8UA 3MM6A 1T3OA 5KT4A 2XO7A 4EBCA 4GC7A 4F4YA 1HQEA 1XN9A 1P6TA 2NSCA 2IHR1 2QIFA 2Q3PA 1DAXA 2AGQA 2HVIA 3OFHA 1TL5A 2IMOA 2PEHA 4AQYF 3MM7A 2YKMA 2PE8A 2RF2A 2RJZA 3TUJC 1Y5IB 3FSYA 2C22A 2OPRA 3LPYA 1WHYA 1TV6B 4Q0BB 5BYQA 3KNAA 3UD4P 4X66F 2Q6CA 4OHZA 5AE2A 2LVWA 4ID5B 1P1LA 2RQ4A 3K8VA 1VI7A 3CUNA 2O67A 1JNRB 3LP2B 4I56A 1FK9B 4KT0C 1M5KC 3UWTA 2RB7A 3DOLA 3FRZA 1TVRA 3LW5C 5GAEI 3CMES 1QSLA 3MM5A 5F8JA 2DNZA 1Q53A 2XMJA 3VF0B 2APOA 2EFPA 4O3OA 3C6TB 4O4RA 3GIJA 2HFOA 2CPHA 4YP3A 1VQOS 2ZH3A 2AP6A 3G6VA 4IFYA 1X5OA 3NG8A 3DDNA 1KLNA 5KFHA 1LFWA 1TZ0A 3HPOA 2P6SA 1M5HA 2QRRA 2X3GA 2A1BA 2XCAA 1REVA 4OX7A 2BZ2A 3RRKA 3LF0A 3KHGA 1XR5A 1HWJA 2E5GA 3KLFB 3KHLA 3CD6S 1S6UA 5L1IA 2DCUB 1DTQB 4KQZA 5KG3A 1O0PA 1UJ6A 3O5TB 2OKQA 4KV8A 4ZMMA 4XK8C 1YVFA 5D3GA 1S6PA 3NCRA 1SKSA 4F4ZA 4DQIA 3MAHA 4O3PA 1N34F 3DMJA 4DR4F 5DS7A 2YQ3A 1ZTWA 2FJBB 2GQCA 2KRRA 2MHNA 5JXSA 2DO0A 3FZBA 3QZ7A 2BQUA 2HIQA 3FEXB 5KTQA 3OW2R 3PX6A 1MMNA 4IFVB 3OBIA 2B9WA 1IKWB 4RZRA 3N6LA 4CO1A 4ETZA 5A0YB 2QZ8A 4KB7A 4X2BA 3W2VA 4QBUA 4DUZF 4ECVA 3MFHA 3R5DA 2XMUA 1C1BB 2LU2A 5FDLB 1QUVA 2N3LA 5IT4A 3R1HA 4PQUA 4DOZA 1KHVA 4WTYA 1GX5A 5AXMA 4BC7A 1Q8IA 5L39A 2L41A 4CNZA 5IQQA 4A8YA 3LALA 4CT9A 2VBYA 5KFVA 4B9LA 1S76D 4K4SA 2PO4A 1K1SA 1H2TZ 3M9OB 2X1AA 3GIKA 1FRXA 1N6QB 3T5JA 3QWUA 1VBYA 2XB2D 2B4UA 2LEAA 4TY8B 2BBEA 3RAXA 2FJEB 3VZIA 1E6YB 3ZC4A 2XC9A 4IG3B 2VG5A 2UUBF 1XWLA 1ULRA 5DGAA 4A8OA 1ZH5A 5M2UA 2D7SA 1NAQA 1RA6A 4RNMA 3JSMA 2N4DA 2ZVSA 5CYMB 2M70A 3G8TA 3GZ7A 1X5TA 4ZOSA 2HNYB 4QQBA 5KAKA 1DLOA 3MMCA 5B0AA 3FSIA 2GO9A 2A2DA 2B9YA 3BGRA 2PA8D 3DRRB 3P96A 2KT3A 4ZHRB 4ZP6A 2OD6A 3SI8A 2ZDPA 5C24A 1UP1A 2Q1LA 5IS2A 4R5PA 1XK8A 2MQNA 3S7RA 4Y00A 4I7FB 2DITA 2BVZA 2DNRA 2WBMA 3MGJA 1K8AT 3MZIA 1HD1A 4UW2A 3L7PA 3DXBA 1UVIA 2RT3A 4JI5F 4PCQA 4LQ9A 4BWJA 5DM7Q 1S1VB 2R7SA 2ROPA 3IR7B 4UUXA 3RB3A 4LF5F 2VKRA 1HNIB 5B0EA 3DLLQ 3LUYA 4ZS6A 3DOMA 3POTA 3V6KA 4X4OA 5CYJA 5HN0A 2C3MA 3W3SA 3MM8A 3NMAA 2C3OA 2JVOA 3DU5A 4EU0A 4QW9A 2IA0A 2ZNYA 3FSXA 2J6TA 4NRTA 4C7QA 2KI2A 5HROA 3ZZ0A 5SZTA 5FLXY 3R5BA 3MEGA 1HBUA 2MZTA 2CYYA 2Z0GA 1U1LA 2R2SA 2XGPA 3CJ4A 3NNHA 4AL6A 4LF4F 2C3UA 3OQ2A 4B02A 2OP5A 4IO9Q 4IR1A 3I5AA 3VQSA 3DNCA 4CH1A 4FPRA 1HMVA 2FDNA 3M1VA 2RIJA 4WFZA 3KYLA 1U25A 2KFZA 4ZKAA 4UY8T 4NRUA 1JJHA 4RBVA 4JI8F 2VBWA 2ZJQQ 1QE1B 1ELOA 4DF8A 2X51A 2WB4A 2G9OA 1FTRA 1S1UB 2MY8A 4M94A 4JV0A 4H4OB 5J2NB 1XERA 2ROGA 4LSNA 4EGLA 4I6WA 2DBBA 2V8HA 2W9CA 1HA1A 3GFHA 1N8RT 4DSLA 3VWSA 2FD2A 2UU9F 1JLEB 1RK8A 2LXIA 1OSCA 2OPQA 3N4WA 4ZP7A 2PI4A 2ZE2A 3PY8A 1WEZA 2WTFA 4KE5A 3SQGA 4PWDB 2ASJA 1DJ0A 3TAPA 1MU2B 3MFIA 1CC7A 4TLQA 4ED1A 3CJ2A 2HGLA 1KNZA 1U4BA 1T7PA 2OIHA 1TL1B 4FVCA 1VQ8S 4O44B 2XSJB 5GAHU 2FVSA 1SV5B 1U48A 4WFNQ 2C3YA 5KFWA 1SI9A 5HLFA 2XI3A 2I9SA 3TW0A 2LXUA 3IS9B 4USJC 1UWBB 4MYTA 1R7IA 5BJRA 3OLAA 1V6HA 3CCMS 4K4ZA 3O8WA 5LXRA 5KFDA 2RQKA 1JLCB 5B0FA 1HBOA 1IQTA 2VPXB 3CDEA 1WG1A 2DTJA 1HWKA 1NHVA 1BLUA 3DLEB 3M2RB 2DT9A 2DGUA 5T7LA 2ZC3A 4QR2A 5CHCB 5CYQA 4IDKA 2IJNA 4WE1B 4NCGA 3KWMA 2EI5A 5C5JA 2VQFF 2ZITA 2JLFA 5KT3A 2B9XA 1WG4A 3PACA 3T5KA 4Y0FA 4WCEQ 4HLBA 1X5PA 3Q8SB 2YNHB 1R8HA 2VFVA 3CEDA 3J81Y 3HHLA 4DLGA 3CJ5A 2ACYA 1JXEA 3ULHA 3QGHA 3CC4S 3E8OA 3TVKA 4I2QB 2AJFE 3VZHA 5E3AA 5LMNF 2AWZA 1L3VA 1H2UX 1WELA 4FXWA 1M1KT 2XULA 2HHHF 4O3RA 2MKSA 1FXRA 2YWEA 1H7XA 4ED8A 5F8LA 1F2GA 3A8EA 5DO2A 5A8WB 5DGBA 3GSDA 4WXWA 2MZRA 5THWA 5KFXA 4ECQA 3V4MA 3OUYB 3BGFA 1SB6A 4Y65A 5DQHA