3ENVA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
217
structure length
217
Chain Sequence
TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 61
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3envA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3envA01
1DEAA 1JT9A 1Y89A 2J0XA 1UJ4A 3ENQA 3BXFA 1PSDA 2RI1A 4L51A 4L4YA 3DDNA 1LK5A 2LQJA 3W7BA 3OBIA 2CDQA 2P9CA 2QSWA 4X84A 1KS2A 1FSFA 1LKZA 2LVWA 1O8BA 4GMKA 1FS5A 3S1TA 3OFFA 3NRBA 1CD5A 2P9EA 2J0WA 3AAWB 3MTJA 3OFGA 3CEDA 3AB2B 1RWUA 2KO1A 3OC6A 2QRRA 2W48A 1VL1A 2MDAA 3E15A 4LUBA 3HN6A 5IS2A 4L5IA 4M8LA 4GO7X 3MWBA 2BKVA 2GNPA 3DHWC 3BXHA 1XTZA 5IT0A 3L7OA 3NWPA 4IO1A 2JOQA 2F8MA 2R5FA 2QMXA 4L4ZA 3HHEA 1ZPVA 1HORA 4R9NA 2DTJA 3LUYA 1U8SA 3EB9A 2I9SA 1LK7A 1NE7A 2F1FA 3UW1A 3LWDA 1PBTA 3CSSA 3KWMA 2FGCA 3ENWA 1YBAA 3U7JA 1HOTA 1SC6A 3TUJC 3ICOA 4OQQA 5JJBA 3LHIA 3BXEA 4GO5X 1FS6A 2DT9A 2PC6A 2PA3A 3DHXA 2OKGA 1UJ5A 3BXGA 4OQPA 5HJ5A 2RQKA 3DC2A 3N0VA 2J0EA 3IBWA 3OFEA 1UJ6A 4TM8A 5T41A 2O0MA 2H9ZA 4L5JA 1FRZA 3P96A 4TM7A 1FQOA 4NMLA 2JHEA 3TX2A 2NYIA 3EFBA 2RI0A 5FIIA 4R7TA 3NZEA 3MAHA 5IT4A 4GO1A 4L50A 3ENVA 3TUZC 2RE1A 2ZHOA 2P9GA 1M0SA 3OFHA 3IXQA 3AB4B 3E7FA 3CH7A 4PWUA 2QMWA 2WU1A 3KV1A 1YGYA 2BKXA 2RQMA 3O1LA 1Y7PA 3TUIC 3LOUA 3K5PA
chains in the Genus database with same CATH superfamily
3RUDA 1BMFA 1MOQA 4RTMA 1FP4A 4HZUB 4NIMA 4FZJA 3K1YA 1BWSA 3VZCA 4LSMA 3ETCA 5JO0A 3OL6A 1WIWA 4G07A 1B43A 4TVKA 1F3FA 4DXAA 3IBTA 5JE8A 4CMIA 4Y6GB 2YV2A 4X90A 1F5CA 4XW2A 4Z7OB 1EDDA 2D7SA 4ND6A 3L09A 2NXJA 1S7IA 2B7CB 2H5IB 1NTOA 1L4BA 3UJHA 2Z2MA 2QKYA 2GJIA 4N0MA 2P4EA 4MS4A 3KKQA 1G3MA 5JWRA 4P2BA 1F0YA 2IYYA 3VFDA 2GZMA 1SL0A 1XCBA 4EMBA 4CLOB 1UOEA 4F72A 3H5YA 1KH3A 2UUAB 1HARA 4O02B 1LI5A 2R65A 4O4LF 4DLNA 1DQYA 2CNBA 1VMKA 3TJ8A 1M10A 2GO1A 3OZBA 1Q0TA 5DMHA 3KFVA 3E22B 2QLTA 1RT5A 3GIMA 3OETA 4ZHSA 1NSFA 2QORA 2VHGA 1QOQB 1TUVA 1CE8B 1NJGA 3K9LA 1JH8A 5FNVF 3IEPA 4WIQA 4JBIA 5I4BA 1DARA 3PR4A 1FW8A 1PLLA 4IOBA 1GG8A 1D0IA 3QA9A 1VIMA 4M76B 2FMXA 5HYVA 2GPYA 5LQRA 4XLLA 3TNJA 4ZQEA 1C0PA 2P5TB 1EB0A 1KQOA 4KIAA 1T8UA 3FZQA 4GOMD 1Y48E 2H6EA 4K0KF 3I82A 2REBA 1NYTA 1JLBB 3EUFA 1DZ5A 2DPIA 2J6CA 3RJTA 3GV8B 1NXIA 3LQRA 5IDQA 4BEBA 4FOSA 1K9SA 5DRTA 4JI0F 4CKBA 3H0PA 3P2YA 4OLOA 5ETJA 3WYDA 1HOTA 5ETRA 3UBMA 5A4FS 4RHXA 2HRYA 2GK4A 1ESMA 1HRDA 3HWSA 2RG7A 2JGAA 1DFDA 3L8YA 1PR0A 1ZIDA 2X5OA 4F2DA 1SG6A 2ZREA 1YUBA 1GG5A 1P7WA 1Q2XA 1TUGA 2X5JO 3KQPA 2FWMX 4GYYA 4QOEA 1SA0A 2JLBA 3MTDA 5IVHA 5ICGA 2YINC 4H3KB 1EUZA 3BBPA 2X8JA 2PE5A 4F5YA 1KAHA 5BV7A 2AWOA 5F8JA 3SFGA 1SU8A 2KM1A 4HAOA 2IIQA 4PO9A 4FXOA 3GZ7A 3HEBA 3S1TA 1O51A 4K4ZA 5NULA 2ID4A 4RVSA 3KHTA 4WKBA 1OFGA 5D6GA 2XDWA 4FM9A 3H2ZA 2IZ5A 4DUGD 5FUYA 3IJ5A 3EVDA 2WW4A 1SIWA 4N5SA 3EIWA 1A2BA 4KLZA 4WVLA 4DLBA 3IUNA 2X2FA 2EEYA 4LZNA 3TRFA 2FZCB 2Q6OA 1X8DA 1MU2B 3NGKA 1L1EA 1AKMA 2HRZA 2J6HA 3AJ1A 4CM5A 4MV6A 1RT2B 5CA0B 4WJLA 1TX4B 1PUJA 3UJCA 4ZVMA 2ASYA 1G0NA 1M8KA 3L1UA 1CY1A 3K0AA 1E6UA 2PT7A 1WSBA 5CURA 4KHPJ 4DTIA 3KVNA 1I13A 4C08A 4XUGB 3AJ9A 5F3RA 3GT7A 1IIBA 4LFAF 4L3KA 3P0HA 4RWEA 4RHTA 5AJUA 1C3VA 2XLKA 4YDDB 3VYTB 4J4TA 1GQOA 4L0QA 2VFTA 3G2JA 5C4IA 1WBJB 4M98A 3LC0A 3SICE 4U6QA 4CFYA 3D6FA 5EZ5A 2AQIA 1L5QA 3PKJA 3Q40A 1JI0A 2YOHA 1TOAA 1IDOA 1ZHOA 1JWBB 4PLPA 3UCFA 4E6PA 4P7TA 1E9CA 1XYYA 1MT0A 1P33A 4OQYA 2VTEA 1D1SA 3TTWA 2R2GA 2G04A 1O95C 1RT3A 3K72B 1XZDA 5FBKA 3D2CA 1JKJA 3IRXA 2KE5A 3MUNA 4HT3B 4PXBA 2PH5A 2QTVB 3CX4A 3T1VA 3AD8C 3MTBA 1R5OA 3VX3A 4EW2A 2NSYA 1IHUA 1NLZA 5CYPA 4JENA 4PTZA 1OS5A 2AKAB 1KDTA 3T99A 1V5VA 1R4NB 4BQSA 2JIMA 3I61A 4NCGB 1YB2A 1SXJD 2IHKA 4IMRA 4M9SA 5GJBA 3T61A 2YTCA 3LWLA 2P4QA 3SSAA 2HF2A 2Y05A 3VCDA 1OUMA 1K7CA 3DPUA 5FPHA 5JISA 1GKUB 1BLUA 4FOLA 1LFPA 1M90T 2O8FA 1DNPA 1A0OA 1RWNB 4QHTA 5DCWA 2N9UA 2GHRA 2PVCA 3EGCA 4MKFA 1UKYA 4DMZA 1FJGB 1Z07A 1RT2A 4LF5F 4BOYA 5KHAA 3AXMA 1RCFA 4R2MA 2E48A 4YN3B 1J90A 5DOZA 4X2BA 3H8WA 4LN1A 3U13A 4QJ4A 2Z8YA 3P0RA 4OQDA 2ZAIA 4XKJA 4TT3D 2I2BA 4QQBA 2AHOB 4DX5A 4CT4B 5DGIA 4OKNA 3OQ1A 4FR2A 4P58A 3PUWA 1NQAO 5KJ6A 2A9VA 1MJNA 1E9VA 1WSDA 3ZHTA 4KE8A 1FB5A 4ZA1A 3N5CA 1ILWA 4TZ0A 1N77A 4CHTA 2CFTA 3HZOA 2N82B 5J4VA 3LMKA 4ADSG 4OB7A 1NVFA 2G08A 3MUMP 4E7OA 2R00A 3MOGA 1E5XA 4IFVA 3OWOA 2IWRA 3W1YC 1E62A 2FG5A 1YKSA 3A1EA 1D9ZA 2WKWA 3VZSA 4RA6B 1Z4JA 1SBHA 3G6YA 1PZFA 4KXMA 4LXIA 3HLKA 3SSRA 2PMDA 3V32A 1KZ7B 1AKVA 1KK3A 3Q6NA 3TQRA 4K3VA 2XCPA 4DT1B 4FOTA 3VR4H 4IDGA 2ZIAA 3QQPA 1CFZA 2EBEA 2E4ZA 4RW4A 2ZI7A 3U7EB 4M7OA 2IUTA 2BYCA 3MB8A 2XWJI 5DLEA 2YIVX 4B3XA 1XHLA 1E9DA 4AU1A 3G02A 3VAKA 1WKVA 2JBAB 5C52B 2D3WA 3W2WA 4I81A 3DOUA 3VTAA 4JLOA 4ECSA 3R0IA 2NR0A 1X9SA 2F55A 2E7WA 2K87A 4ZV7A 4D4MA 2NYHA 3A3NB 4BQQA 3RC8A 2FIUA 3HT0A 5EE0A 4CF5A 3MCZA 1JTVA 3F2IA 1AUVA 3H65A 5J2TB 1DOZA 5LZ8A 1LWXA 3RAQA 4J9RA 4L6IA 4IFTA 2PT9A 3HM9A 3VDNB 4EO7A 5LL6P 5IJXA 1X4CA 1U9YA 3SYTA 2MKIA 1SVOA 1BKYA 3UD4P 2QO3A 3NWGA 2X40A 2HQGA 3SDSA 4UHBA 2ZRJA 6REQB 3FSRA 2I78A 4IHAA 3MCMA 4MH8A 4C4SA 4C8MA 3V4VB 1YAHA 5HF9A 4KV8B 1NF2A 1TZ2A 1OXXK 2O6LA 1DFGA 3ZX5A 5SZKB 3KT0A 1QLHA 2H5LA 2ISCA 3QVGB 4KSYA 2MSEB 2WK1A 1VLZA 2A14A 4DSJA 3V5NA 3WTCA 4DV6J 3AR4A 3GDGA 1E6KA 4AYXA 2GWHA 5F23A 4LKOA 5EEGA 5DP2A 4FYIA 4RE6A 1NLUA 4LHXA 5K3OA 3S2UA 1QTNA 3RVOA 1HQEB 1KU0A 3OE5A 5DNDA 5FJIA 4W1RA 3N4WA 4YV2A 1WSAA 2BMVA 1D0VA 5CD9A 1DKRA 1Z4OA 2FVYA 2VT3A 4C03A 2XRFA 5FWXA 3AKDA 2IM3A 4OSPA 3NBUA 3A6PC 3ZDCA 3UA4A 2IWHA 5JNVA 3G7SA 1ONOA 3AH6A 4OHPA 4RD6A 4M0CA 3KK1A 1Z4IA 1LVHA 4PYRA 3RADC 3PUXA 3AV3A 3U26A 3TEMA 3R7LA 3KYDB 4QJ3A 2BCGY 1HT2E 1DURA 3CUVA 2HCRA 1T2DA 2W8BB 1EQAA 3LP5A 1HT3A 2V50A 3OTDA 3HHLD 3MXHP 1O5JA 3KPWA 1UT6A 4NLVA 1RRCA 1VJ0A 2FEKA 3RV3A 3SYMA 3VH3A 2XCUA 3KU4A 1DC4A 4US1R 3V7NA 1ZA2B 1JFFB 2OYCA 1N6QB 5L1JA 2WUWE 1IATA 4IOJA 3SM9A 5IT5A 3R9WA 3FK4A 3E5NA 3SR0A 4WFQA 1LGYA 1TAHA 3FCXA 4TS4A 3AU8A 2RGCA 3AGPA 3W3AH 2XSZD 4RLHA 2WV9A 1EETA 3NYIA 2GZRA 4IKAA 4BIIA 4REOA 1B8PA 1KTVA 1ZA1B 5KJCA 1HDRA 3SC2B 3KKPA 1EHYA 2QVXX 3AKZA 4C3KA 4GKJB 2ASEA 4QWDA 2JIZD 2MKYA 4F04A 3KRTA 4OGGA 5FYQA 5COAA 3Q5GA 2FWNA 1JX4A 5I8ZA 5CFOA 3EXCX 2DC1A 4O2AA 5HQTA 3L0ZA 4CT9A 2GYUA 5I4CA 1BU5A 2GYVA 4FYXA 1E7QA 3ZN2A 2HG4A 4J7XA 1N7IA 4CF7A 3RAMA 3HP6A 2FW8A 4FD3A 1G42A 5ITZB 3QBJA 5IJ0B 1GNRA 3AZOA 1Y7HA 4KO2S 1MQAA 3G2NA 2Z6AA 3S44A 3FPBA 3HSZA 4ZU3A 5KO2A 5ALVA 1ZPWX 1Y5IB 3UMYA 3NWRA 3X2EA 1W9HA 1W88B 2N3OA 5ADVA 4JUFA 4HI1A 2HFKA 3SXUB 3BQNB 3H1AA 1ZGJA 1MB4A 3ZTWA 1XNQB 4D6YA 4YMTA 4HNGA 3PXGA 4BCCA 4IXWA 2AFHB 3VU9B 5HEKA 1VQOS 3ML1A 3RYHB 2E1RA 4KGVB 3E84A 1D8ZA 2B1JA 4NMMA 5CIWA 3MLBA 1VL5A 2BE2A 1XEWX 2HA6A 3UWSA 3EF3A 2HNKA 5EIBD 2HBRB 1KJWA 2NYAA 3K0KA 5KIAA 3IR5B 3HB4X 3G86A 1NI4A 4ZV9A 4BEVA 3ZWOA 1PYOA 3K0BA 1RAGB 3GN2A 1Z73A 1HLGA 5F4BA 5DM60 1YTYA 4JI8F 5L3RA 1EHCA 3HFZB 1TL7B 2VRBA 2AV5A 1L4YA 3SCKE 1QE0A 1Y5NB 3UN3A 1KKHA 5DCYA 4USJC 2JI8A 2IYVA 2KJVA 2C83A 3JR7A 1SKUA 3T1YJ 1ZU4A 2RK6A 1MNAA 1NJZA 1HTBA 3CURA 4EELA 5A0VA 4JSTA 3SBOA 4RCYA 4IH4A 3LYAA 4B6EA 2GA9A 3F47A 3IHKA 1AO0A 2RU3A 4WP3A 2IS4A 5IKPA 2A86A 1U94A 2PSEA 5ALWA 5ECGC 5DQIA 2HLPA 3DLPX 1U0SY 4M0LA 3CD5A 1NYLA 4ENRA 1T94A 1HNXF 4RK6A 1C8LA 3K0AB 2E7XA 4EPXA 2V9ZA 1EKXA 3E18A 3NJ8A 3GY0A 3LQKA 2A30A 5CT8A 2FR8C 1Y5IA 4N3AA 2P6NA 5A62A 4ZMBA 4WFIA 3K70C 5DTQA 2AG1A 3OTWA 2RU9A 4K4WA 3TXYA 5AE3A 3SQWA 1BQMB 1GH8A 4C6RA 5JI2E 1P4HA 3BCRA 3JQ9A 5BOVA 2VHUA 2VK1A 4YHHJ 2WPNA 1AFJA 2YIDA 2JFOA 4NG5A 5HUHA 1KHWA 5C18A 4P52A 1H8HA 1J5OB 4OHFA 4JFAA 4JV1A 4K9RA 1DLOA 4LZPA 2IUUA 1QANA 4IF4A 3B13B 4FYMA 1O03A 1FDTA 4PU0A 2W2PP 3FDIA 2DHGA 1KR2A 5EGSA 2CQ3A 5B1SA 4S35A 3ESDA 3KQLA 1ACMB 1QIJA 4LBWA 1Y7PA 1KI9A 5F21A 2B3TA 2ZDHA 1HW9A 4AF8A 3GZJA 3K8YA 1PGNA 3GP3A 1HYGA 1VK8A 2HD4A 2MGZB 2XI4A 2YPZA 2O5EA 3RYCB 2BGUA 5AM5A 3MQFA 4DR2J 1IM6A 3ULHA 1AU9A 2IEBA 1MPTA 2NU6B 1Q1ZA 4MOWA 2J5RA 4DV4J 4ZDKA 4YBRA 2C2YA 2C3PA 4A8HA 2UUBJ 4OHZA 4DU8A 3EFHA 2Q9UA 3OQMA 1QCYA 3GZ4A 4HTFB 4XQEA 2QLJB 5U47A 1RJ9B 2JIBA 3E0QA 5TT0A 4NFSA 1THGA 3DFKA 4E51A 1C30B 4BVFA 2PX8A 5LYJB 3IOCA 1YR3A 1MSWD 4ZCSA 1XCMA 1OWNA 2D1QA 5AW3A 4LFAJ 4Q7JB 4LFCF 1IRIA 4C8ZA 3ZZ1A 4MAKA 3B54A 4YJHB 3LUCA 2GEBA 2I8CA 2P9GA 5FPSA 4CEHA 4MUMA 2F1OA 1NM5A 2A4KA 2QM0A 1GNVA 4JJ4A 4KXFB 4F2WA 1WEYA 4IIHA 2OFWA 3NDPA 4DX6A 5L40A 4BQNA 4JJ7A 2VPXB 3NIFB 3KG0A 2A0UA 2JGDA 1RTIA 2FJEB 3LLCA 1V0JA 1U81A 3H5WA 2D6FA 4E2FB 3WGKA 1X1DA 3RBEA 2RMLA 1D09A 3HJGA 1P2UA 1RD4A 3RUHA 2OFHX 1FEHA 2GGPB 5IU6A 3WLFA 4JI7B 4FN4A 3KMQA 2IXFA 2I9SA 1FRKA 3VZRA 5HI7A 2EBUA 2ROQA 4IJMA 3L7LA 1X5SA 4W6ZA 4NI2B 4ZQCB 4EB6A 1P1CA 4FX2A 5G4LA 2FPUA 1P7PA 4K7QA 4JL8A 4PZZA 3V80A 3R9XB 3QSYB 1Y6GA 1R50A 4QE3A 1LJLA 1CLEA 4U6PA 1YCHA 4K2JA 1OBHA 3W5AA 1XZGA 4GO1A 1T9TA 2YNIA 4RD0A 1LLQA 5BR7A 4IXNA 3L82B 5I3PA 2MKJA 1EWTA 3ZWKA 4Y2MA 1F12A 1H93A 4R69A 2HU7A 2KJQA 2K3IA 1ECBA 1LQTA 3JARA 4BU1A 3DP9A 4C4ZA 1KNQA 4I4LA 3AI2A 1DMSA 5EP4A 1PTKA 2C9MA 2REXB 3AOBA 3WO1A 4FCWA 2ZSJA 3EEBA 1DGQA 4XWAA 4YC7A 2FWRA 4UUQA 4AN0A 2XCLA 1VPWA 2SECE 2H3HA 3WK6A 3O8OA 3GXOA 3IUMA 1K6MA 3ITDA 3HSGA 4XFJA 4KGDA 3V00A 1D2GA 2DCUA 1XQIA 4M95A 4MWGA 4Q19A 2UVRA 5FWNA 1M2OB 3R0QA 3SZMA 4KHPB 3F3MA 3QJ5A 1Y9AA 4B3SF 2HBRA 1A8IA 4M8KA 2I6SA 2JEGA 3HKZD 3R97A 4FSDA 2R8JA 1VCHA 2C1EB 1KE2A 3L7CA 1VMDA 5CHYA 1WL8A 3A1SA 3WLIA 5FV4A 2XNDD 4RK0A 3AB4B 4J9KA 1JFLA 4NK5A 2G6TA 5D5QA 3CLTC 1M1YE 1YZUA 4HDGA 2J67A 1U47A 1Y98A 1ZH6A 3NNCA 1EK2A 3QVKA 4BNLA 1OJ7A 2CQIA 3FRIA 3NTOA 3ZNUA 4DSNA 5KOJA 2X14A 1NNLA 4TMZA 2ZXFA 3PEHA 1UP7A 1SI9A 1U0LA 1QZXA 2QRNA 2ZJOA 4E0DA 3TXXA 1NDKA 4UNSA 1BZYA 2ZWPA 2JGJA 1J5PA 4K88A 3WOHA 3U3DA 4DQSA 2PTGA 4D56A 1B7GO 2DULA 5A06A 4IP0A 1ULHA 1V6HA 2HDHA 1WC1A 3OVAA 4WCVA 1FRMA 3A9TA 5FBZA 2DKNA 1CKEA 2DECA 3EDMA 3SIXA 3G6KA 4MKIA 2HGLA 4O63O 3VPSA 2H92A 4DIOA 3W5UA 2MY7A 1LW0A 1YV9A 4K6GA 1NAIA 4B2IA 2AN5A 1GX5A 3I2IA 1LTKA 1KR5A 2HF7A 1V4VA 4R2KA 4WTOB 4US2R 1RMQA 4IV0A 2H1FA 5FOUA 3ND8A 1JNXX 2P5YA 1Y7TA 2KFYA 1XZEA 2JC3A 3DQQA 3M8YA 2LVBA 4CQMA 3PRJA 3BQ1A 2O59A 1X8XA 1UBCA 2ZJ1A 3T3HA 1GGFA 1TV6A 4HYTA 3M8WA 4LFAB 2CXTA 5LQAA 3OPYI 3W90A 4X4QA 3FOBA 3C6XA 1F3VA 2IODA 2CLCX 4B02A 1KJQA 4MVJH 3IVGA 1URNA 3PJFA 5LD2B 2R47A 3UAGA 3Q2TC 1BQ4A 3VTIA 3FPSA 1W2IA 3ZCXA 1NMSA 1QUVA 3K8WA 3HJBA 1NGSA 3MFHA 1XXLA 3PJDA 2UUBB 4USUA 1YZNA 2LU2A 4IAOA 3EIQA 1FVQA 4RZUA 2X1HA 1IBMF 4UTVA 3NIDB 3K1AB 5E3CA 2YYAA 4TWJA 5IN5A 1PWXA 3T5DA 3Q2SC 4RACA 4PWUA 3V6JA 2VJCA 3SC6A 1JP7A 1CTQA 4ZJYA 3NDIA 3A6JA 4F67A 1ZXXA 3MUVP 3IBYA 3BE8A 3O92A 4WKOA 1H5QA 4DC1A 1RYDA 4G1MB 3FJ1A 1AQIA 2DT8A 1X1QA 3P7MA 4AQDA 2ZKIA 3A0UA 4A8JC 4WNAA 2WPDD 4MV9A 1EX1A 2GBFA 3DOHA 2WT8A 2QZZA 5HCIA 1W7AA 3CONA 3VR1A 5EZYA 4FF3A 1F3OA 2C7VA 1S2OA 1W0KA 3RG2A 3PY8A 3VVTA 3A1YG 4BWVA 3ER9A 1FTCA 2JFZA 1E58A 3CO5A 3DJFA 4C4TA 2ZB2A 3MSCA 3EM1A 2XMVA 3MAAB 1YVUA 5JMPA 3C6ZA 3UH1A 3IA2A 2PWPA 3OSUA 5HVFA 3BE5A 4MQFB 4AS3A 1WC5A 2MSSA 3QPVA 4COOA 4WE1B 1YUNA 2EJBA 2POQX 1RW4A 1PWEA 1KA9H 1T8YA 4DILA 1S2DA 3NAMA 3COVA 1Y80A 3LUBA 3S55A 5DO2A 4TXMA 1L4KA 3K0EA 1CUYA 5BQ3A 2D5CA 4KZPA 2P2DA 1N9KA 4JV2A 4F12A 4V3BA 2W5UA 3OF2A 4YRCA 1N7GA 2BE9B 2CVHA 5A3SA 4FFVA 2CMHA 1LC0A 3DYBA 3I8XA 4WKNA 1BFDA 2FDRA 3QOYA 2M70A 1X5TA 2AUMA 1X1TA 4HEA6 3CX7A 2GR9A 4MWCA 1AKQA 4F5EA 4MMYB 3QT7A 3GP5A 5BW8A 4EABA 4TVSA 3T7AA 4DB2A 5JUMA 3AFIA 4YCBA 1U4NA 4PWYA 1LFWA 4IR7A 3QU4A 4X1KB 3MAQA 3W6NA 5CLFA 3Q7IA 5HF8A 3SEAA 3GMIA 4GC9A 3VZIA 5KSPA 1Y1QA 1F2TB 3PK0A 1S5ZA 2PQ0A 3D4NA 1NKEA 1SZJG 3GLSA 1PFGA 4ZS6A 3IVAA 2C8KA 1H6KX 3V6KA 3OUYB 4U9HS 2DD8S 3DVAA 5EZYB 4IJQA 4RCZA 4FVTA 3QPDA 1KEWA 2AMFA 4DMKA 1BFKA 2NGRA 4RF5A 4DA0A 3RFFA 4RJVA 3B3FA 3QVWA 3VVUA 1MABB 1KFDA 3L0PA 3EH1A 2YXBA 1WG4A 4AY3A 4QPZA 3P2MA 4GBJA 1BQNB 4AG5A 5I51A 4R8KA 1FEEA 5CXQA 1IBLJ 4DLZA 1LWFB 4YT4A 2D2IA 4QOGA 2FMIA 3UCUP 3NPMA 1M2JA 1OHHA 2J5AA 2ZUCA 2GERA 3C14C 1XJCA 1YNSA 4M9RA 3H6HA 4YT8A 2GVZB 2AXPA 1CNMA 3KMSA 4I4BA 2OL4A 4F5ZA 3NOCA 4QPDA 4I1PA 4OI2A 1L9XA 4IIJA 1RQ0A 3OCJA 1IHYA 2QEQA 3OLYA 2WWTA 4L8FA 1TJNA 2XHEA 4YI3A 3QOXA 4TMYA 1CBKA 1XI2A 4J94A 2ZWOA 2QEXS 4FZ3A 4ZVUB 3O38A 2BVZA 2RJOA 1RU1A 1JX6A 1LH0A 2MYNA 5E9WA 2PNJA 3C70A 5FKJA 5KNCD 1O95A 2BBSA 4O3PA 4F1KA 2JH8A 4OAOA 2Z08A 2AXNA 2EQAA 3UOAB 2ZNYA 3DU5A 4LDAA 5CFZA 2DUWA 4B2LA 3ORSA 3L6UA 1B41A 5MN4A 1E0SA 3NOOA 2QI9F 3RODA 3H59A 1WSVA 2YXPX 4EUNA 2C5BA 1QCDA 2NYRA 1C29B 4CLUA 2GN6A 3WLPA 5CNKA 3TFOA 3E4CA 3H1BA 4I6EA 4CO0A 1MBZA 4H0CA 2QRUA 2DB3A 1U8TA 1YQ9A 1BD6A 2L0XA 4TZKA 2OOKA 2F4NA 5JZSA 1GSOA 2B9EA 3V9AA 1G1MA 2H1CA 3P3DA 4H4MB 1NQUA 3QWUA 4O4GB 3JSBA 3K6RA 2DGSA 1NY5A 3AHHA 3JD2A 2NTEA 2O1XA 2EEPA 1T9CA 2GPWA 1K5HA 3KP1A 5AI9A 1DV1A 1G8GA 1PDOA 2ZTVA 4UNPA 4CLKA 4HDMA 1IKWB 2HLUA 4CMGA 3P0IA 5K0JA 4DCGA 4ZCKA 4P54A 2A5JA 3RV4A 2JL9A 2ZZKA 2P65A 4X62B 3WYNA 3LNCA 1DBSA 1SEVA 1XEXA 2MHEA 1I3OB 2N4CA 4EUKA 2X0NA 2IRYA 1TCBA 4V1CB 3AUSA 5LQMA 3VYSB 1Y7IA 2A5FA 3KKNA 5IVPA 1NQOA 1QGZA 4DL4A 2LEAA 1KONA 4MYTA 3HYSA 1L5WA 3NG8A 3KNZA 4CPDA 3LP1B 4PYDA 2QTMA 1B4SA 3LVQE 3I28A 2ARKA 2O2YA 4WZZA 5DYNA 3KKZA 1KPIA 5HMWA 4D4KA 4BB5A 4QT4A 2YBDA 2FC8A 3WGMA 1EXVA 4TTRA 3NOXA 4LBZA 1I32A 4HSGA 4P9SA 1AA9A 3SHFA 2YWDA 4UC0A 1FF2A 4JVMA 5IULC 4Y1RA 3TZBA 1JEDA 1RHRB 3G68A 3ZBTA 3TD9A 5MGBA 2PT5A 4U9UA 2QLNA 3CMMA 2H7VA 1NJ6A 1C1YA 1GP2A 3R3ZA 5CNMA 3DBRB 4AX4A 2NZCA 2Y1LA 1K86A 2HHLA 3W2VB 3COJA 3A1TA 1LFAA 4C8KA 1BU8A 2HC9A 2JKVA 2HOQA 4CM8B 2R6DA 3M8QB 1PK7A 1JHQA 5B08A 3WWZA 4AD6A 1ZTWA 4E31A 2J0XA 4BMVA 2A1IA 4IHJB 1BE0A 3AJEA 1G0OA 3IELA 4IDNA 4LHWA 3LQQA 3P2EA 3RVQA 2Y68A 4F02A 4KI0A 3WVNA 4B9SA 4WNIA 3JVDA 1KL7A 1O54A 3NBXX 3TD6A 3U81A 3W5IA 4FXWA 4UAVA 1TNDA 1UWKA 3X44A 3T54A 5IBCA 2DO0A 2PO5A 3HB1A 4OXYA 2Z4TA 3AKCA 4DUTA 2CNOA 1DRZA 3B3AA 3I55S 4QUDA 1T3LA 3E2PA 4YJGA 4F21A 2Z5VA 3LPCA 4AKGA 4AB1A 4P4TA 1SUSA 1JLSA 3CMAS 4HGZA 1ORWA 1W59A 4CGZA 3FX2A 2FOLA 2QW0X 2VDOB 3K8VA 1B6GA 5IQQA 1ULUA 3BYZA 3HQ4O 1VS3A 3JRWA 1PZXA 4Z9YA 1O95D 1NIPA 3RKUA 3L07A 4MKXA 4OLFA 3W5VA 1VMAA 5EIXA 1NFQA 3EQ8A 2Y92A 2PMWB 1P17A 2FLPA 2J9CA 2FSVA 4ETXA 4KACA 3I2GA 3DI6B 4DG5A 3IPLA 3HWX1 2GEJA 1TLFA 1GGNA 3NS7A 4B32A 2HFVA 3KK3B 1VC6A 2PUEA 1E98A 4M9QA 4F3TA 2WINI 1DAXA 2Q3DA 4ZZIA 1FUUA 2G3YA 1E6YB 1GRQA 1WMBA 4JH0A 5HATA 3QM1A 5ARDA 3RIHA 3L7JA 2W8LA 1QNLA 4DFKA 2CFCA 4FCTA 1B8VA 1DHRA 1Y9ZA 3CLUC 2WHXA 3HV2A 5IXUA 1BC5A 3HHEA 2WJHA 1DAIA 5DZ6A 3V6LA 1QZZA 4USIA 3VNUA 4Q9HA 3NAGA 4PZPA 1UXKA 2E37A 4CRJA 3M8QA 3N2LA 4JBYA 1WB6A 3GROA 4R51A 1XLTA 2WUEA 4KXWA 4NZMA 2O8CA 2A78A 3Q9SA 5BQFA 3WLOA 4DIEA 3LW8A 3WC4A 1NSPA 1FRXA 2F1JA 1YH3A 4AZ3A 3LAWA 2QVYX 2JHPA 2V74B 2AD1A 2QRZA 1GAXA 2C2HA 3QFWA 3VKHA 4EG7A 3PDIB 2ZFUA 3K53A 2EFJA 4NLXA 1RWKA 4R1MA 1QH9A 2YY7A 3LLUA 2FSSA 1XKTA 4OMCA 2G07A 4EKIA 4FFRA 1E4OA 3G49A 2DRBA 1C9NA 2H3EA 2EIHA 2DBQA 2PI5A 5C5CA 3CVVA 4PZCA 1NLMA 2H16A 2VDPB 2YVLA 1X77A 2OGWA 3H7IA 1M1NB 2VBCA 3O3NB 4KXYA 1U1DA 4BTLA 3PFGA 1L5MA 1YLXA 1N34F 3BMNA 3IG1B 1ZNWA 2ZH1A 3PX4A 4RFSB 5DH9A 1SD1A 3T15A 2CUTA 1YQHA 4Q8FA 1HNZB 4XDYA 1E1CB 5B3JA 3ICLA 2M3DA 5HMYA 3IGNA 2ZB7A 2WKPA 2YKPA 4OFWA 2PT0A 3B3QA 3RIGA 3BMCA 2C94A 1JHZA 4E33A 2E1AA 4YBZA 4A23A 1XZHA 2YFHA 4LF6F 1H2BA 3PHBE 1USKA 1IXYA 4C8YA 2W0MA 1H4QA 3RVNA 2OFPA 2PMFA 2CWDA 2DHSA 3WDSA 4QGAA 2B36A 5LIRA 2ZR9A 3R40A 4ZO9A 4YUYA 1SCIA 3STWA 2DRIA 1PUXA 4YRAA 4DY4A 2OKCA 4IUBS 3PX6A 4ZO4A 2QXTA 3P71T 2Q6TA 1AW0A 4JROA 3RYIA 5CCEA 1YONA 4U6SA 1T8WA 2UXBB 3RVBA 5T6BA 4EG8A 1AN0A 2JJ1A 4UBMA 2HR1A 2OPBA 2C7PA 3L8EA 4AT1B 1E1QD 1JXEA 2NACA 3TAQA 1HYEA 2IIVA 4QA9A 2ZI6A 2MSWA 1C0LA 4O2LA 2J4DA 5JZBA 3ZR4B 4YRKA 3KD2A 4DBLC 2FJWA 4KV9A 4TSKA 3TAMB 2X19A 4W5OA 4ZIWA 2XY5A 3JVUA 3Q98A 3GJ5A 4E3WA 4C0XA 1UMJA 1KKLA 5J2QA 3M2TA 2LGJA 4PVDA 3DWIA 3NZEA 2C20A 2NVUA 2QNBA 1G4UR 4Q9DA 3SF8A 4FHDA 3CE6A 3DV0A 2MLYA 3MECB 5GMKa 2J48A 3WK7A 1GDDA 4LRFA 2ILTA 1PNQA 3CLSC 1FVOA 4M5HA 2MLZA 2LDYA 1Z2PX 2DM6A 4MA0A 2JFHA 4X84A 4P4LA 5GOTA 3DVLA 1T9GR 3MJTA 5AW6A 1KU6A 4B47A 1RWMB 1H69A 5TF0A 4NHOA 4IFBA 2MQNA 3OWXA 1KDRA 5J2UA 1P4JA 3DMJA 2ILZA 2PSJA 4WT7A 3D66A 2MQPA 4URXR 3SYKA 4V03A 1WB9A 1FDAA 4DRXA 1GCOA 2NWQA 4IYJA 5DN9A 1OFTA 2ZKUA 3G1WA 4BYMA 4OUKX 1Q21A 4KBFA 2W11A 5D3ZA 1ZJJA 2EXUA 4KPCA 4Q24A 2FY8A 5ADWA 3QVMA 3NCQA 4EVSA 4NBUA 4P0QB 5HKAA 1XJWB 1L5VA 2QQ5A 5HJ2A 3GQBA 4FKMA 1ZU5A 1NN0A 2BW0A 3ECCA 3TR6A 5F3ZA 4QASA 1HYBA 2FR8A 4CV0A 3EXHB 4HLUA 5FOWA 1AZWA 2PN1A 1U9IC 4M63A 3QEJA 4MZDA 1PGPA 5MDHA 1FP4B 4HZUA 4WZBB 2F1HA 3DE5X 4JI3J 1FU8A 3Q24A 4EF5A 1RM0A 2MEWA 1DDIA 2PS1A 1ST2A 2B51A 4TV9B 3TOCA 1GNSA 4AJNA 1J2JA 4B9AA 3LU1A 2EKNA 2F3PA 1U1LA 4ENOA 4S3MA 4LF7F 1ABEA 3NP9A 3AVOA 4KPGA 3HJNA 4GU5A 5B0FA 5ALJA 5DI3A 4A8XA 1KPHA 1SXQA 1T6BY 3FHTA 4JLVA 1V71A 1ZK4A 3NS7B 4EVIA 2KM8C 1C1DA 1OCEA 2XMUA 4C4AA 2HZVA 3I01A 1P9WA 2PS3A 1UJNA 2C7RA 4E09A 2GM3A 3E9YA 5LT5A 1ONBA 1SUAA 1N3BA 1NQTA 2Q6VA 1U4BA 1H66A 4EK2A 3SGLA 3VU0A 1V1RB 2NSJA 1FFGB 3GMTA 1BGWA 1HSOA 3BEDA 4PAMA 3DT6A 4JLAA 1PJ5A 1LSOA 3CCCA 2H1RA 3IDQA 5HMZA 4XWTA 1DJQA 1DAMA 3IGFA 5DT2A 3ST7A 1FFAA 2W4CA 1AF7A 5DTJA 4WUTA 4UVHA 2IJFA 1NHWA 4J3FA 4N0QA 2AGOA 5C51B 2H65A 2NZ8A 2FGOA 3FUXA 3RPEA 2LXIA 4KIGA 2A1UA 4LTDA 4ZJLA 4D02A 1G4HA 3I52A 3IBCA 2QSZA 1LVGA 1S6PB 3MJHA 1TKRA 5KOIA 2IHJA 1FDUA 4YPVA 1W36D 3D6MB 4LF9J 2QMZA 1NB7A 1IDN1 2I0XA 2F1IA 1F0XA 2Z3WA 4QEDA 3FKQA 4PNEA 3AGQA 5ALTA 1GPWB 3LDHA 4YHHF 3BCSA 5BUSA 1XZMA 3AM4A 3CPSA 2BGKA 2GZ2A 4NBLA 1JHDA 1PQWA 4DJJA 4CR7A 4WCFC 2O2ZA 3H5IA 4U7DA 1RVDA 2I29A 2Y0PA 1HMVA 3IP9A 4JB2A 2JFGA 1TF7A 3U37A 5DYWA 2I66A 4YS6A 4RV4A 5JLJA 3GUHA 1MDBA 2YNIB 1TUBA 5FLEX 4EW1A 4G0VA 2UXDJ 4NNPA 3CA8A 3DBRA 3ZZNA 5J4YA 4YAKA 5KAKA 4RTOA 3S2YA 3FRYA 4FS8A 3DOEA 4ZTUB 3UAWA 2J07A 3JWIA 1RKIA 1VYTA 4QYZK 2NXCA 2Q50A 2EGHA 2XT0A 5DM6Q 5GVRA 1L4GA 4X54A 3OTQA 4QJBA 4A2PA 3VO8A 3N6RA 1QDUB 3N2GB 1TR0A 2AEFA 3HPOA 1PNRA 1QVVA 4I9FA 4CLFA 3B6ZA 3PFWO 2CXSA 1UKCA 4M9CA 3V81A 4WJKB 2HS3A 1G20B 2ZJFA 1CR6A 4EIWA 3JZDA 1KEEB 3OFNA 3HO1A 4ZVSB 1RAAA 3EJWA 3STXA 2AJBA 4N12A 2W70A 2E5LB 1NBEA 2XLIA 1O0SA 4P81A 4K9QA 4UVGA 1K1EA 2KW5A 1DLJA 3R3SA 3ZXIA 2VDJA 3QVVA 2CPHA 1HFEL 4FYWA 3G8SA 3RS3A 3CZPA 3CRZA 1PJ2A 4DV2B 5F0UA 4W5TA 4NXNJ 1RTHA 2D41A 2BLNA 1K1SA 4NEHB 3HCXA 2GZOA 3PXDA 2Z4RA 1X7WA 3LOQA 2EDCA 3P9YA 4PNZA 4Q01A 3VPAA 2XTMA 5KTYA 1T9DA 5DGXA 3JYQA 1T5BA 3EC7A 1NDPA 3I5BA 1HEIA 1U2CA 1CDOA 1WPGA 1VKZA 1UPFA 4JIGA 5KOJB 1XR5A 3X1XA 2X51A 1R3UA 3PC8C 2FEMA 3U5ZB 1XAGA 3FDXA 2F1FA 3H8SA 2K6GA 1IQUA 4ARSA 1BD4A 1NVUQ 4BNIA 1C81A 5G1OA 3CVUA 4CG3A 2NOAA 3O4RA 3HUFA 1DINA 4DR5B 4ELUA 1POWA 4Y2HA 3BGOS 1MEJA 1I01A 1LA2A 3MRVA 4BKOA 1CR2A 5KTTA 2HQOA 1B0UA 4XGQA 5HA5A 3SI8A 2RC6A 1HZZA 3BAZA 4NARA 2IK8A 2XD9A 1EWYA 3DCYA 4ALIA 1Z5NA 4C7XA 3BRWA 4FSXA 2DGUA 2G1AA 5A7GA 4ZFNA 2Q0SA 3L05A 2OA0A 4ZCPA 2VF5X 4I4TB 5BSUA 3RSOA 4MVWA 3GR6A 3ZPXA 1GG9A 5JCZA 4KWCA 5K0FA 1TVRA 4XQGA 1F2DA 2Y3YA 3I6MA 5IRCD 4NABA 3TCNA 5ALEA 3LZDA 3D3WA 2EJCA 3LNTA 4RNHA 3HABA 2YIMA 1CYEA 5KQGA 1WWKA 1U0TA 3FE2A 1APSA 5HJXA 4G5RA 4RU1A 4NZZA 1GRCA 5BQXA 1E9FA 1UJBA 3QXGA 1PKUA 2YJ4A 3B9RA 2XJ9A 2J8SA 4DIDA 2H08A 1OSDA 3AWIA 3L46A 3IUSA 3VYUB 4UPEA 1MJ5A 2A0YA 3JQEA 4U63A 4FHEA 5E6RB 3MPYA 3AVTA 2O8EB 2CUZA 4LUCA 5BW5A 1Q20A 3HV0A 1L3SA 1NC1A 1N5TA 2HXGA 5BO5A 4I69A 2YR0A 4BMNA 1V6SA 4PIMA 5IABA 1JPVA 5DASA 3P94A 4TUYF 3FVVA 3M2UB 1XPRA 5I9IA 3LY9A 2OLKA 2FRVA 2X3DA 1AJEA 4MA4A 2XNRA 1VGYA 3SMVA 3KK0A 2HRRA 5HIJA 5L3QA 3EX7C 2OZLA 4HL6A 5KC9A 1F0KA 1WXDA 2JASA 2O3RA 3BQMB 2W01A 1L5HB 6FD1A 1ZGBA 1R5BA 3EEIA 3EGZA 4ILEA 4IIDA 2LXUA 4DA9A 1NKBA 4EMDA 1NRKA 1T43A 3PX0A 5EXEA 5KNBD 2XH8A 1RZRD 3OMWA 1AQUA 4MI6A 2XLJA 3M9LA 3O0TA 1KSGA 1Z16A 3UJPA 2XWXA 4Y2QA 4TVOA 1O94C 3AFHA 4CMHA 3G23A 3IESA 3EFBA 4DVGA 2EWWA 1P1RA 5IDXA 3L7YA 3C7AA 1PBUA 1U5CA 2ATEA 1XR7A 4IBOA 6NULA 4EY5A 1W4LA 3BPSA 4CKEA 4Q00A 3BXFA 3QVUA 1Q22A 3JQ9C 1R3DA 5CTAA 1R0BG 5K0ZA 4XM1A 4TMVA 4NL4H 4B9UA 1YRXA 4RHFA 3TZHA 4YJDA 1GRRA 2VF2A 2ANCA 3PUYA 1JFVA 4FEEA 3UE2A 3RZAA 3MVEA 1HW8A 2GEFA 2I1WA 5FIUA 5BV1A 4K4SA 3EIHA 4MQEB 1G2QA 2W2PA 2X0FA 1OT5A 1DTEA 1A9RA 2XMJA 3SIWA 4FGWA 1GPLA 3L18A 1FRFS 4IVQA 2O8EA 3SZ3A 1RRVA 3HD1A 2PFKA 4DRXB 1V48A 2VP5A 5AM3A 3HFVA 1DTQB 3F6RA 2C4WA 3H4IA 4FYYB 3TX2A 3CCES 3U0VA 4HS4A 2V8GA 1QGYA 3NBKA 4U2GA 2D62A 3F3KA 3GJTB 2BC9A 2HRBA 1PV1A 5JY6A 2MZJA 5BWLA 2B5OA 3C3DA 1F9EA 2FG7C 1VRUB 5IUNC 2KYRA 4NS1A 2XNJA 2FWPA 1R6TA 3FNEA 4BN4A 1USUA 4BLSA 4C30A 1C0IA 4JBLA 3MAAA 1IN8A 1L4FA 1NJ1A 3L6EA 2XULA 4EGCB 3PX7A 3JALB 4OXXA 2NO6A 5BSTA 1ACLA 4LR7A 2VPTA 3OSPA 1V3UA 1SUWA 5FO0A 2YVQA 2WAXA 1VK3A 4G5QA 1XRPA 4K9PA 1A97A 5FHRA 1KBRA 1Y3IA 1ETHA 3UVEA 4YRSA 2HF9A 4DLLA 4KE9A 4C7KA 4MAFA 3A31A 1FMTA 1EB8A 1OY9A 3H7HB 3QEMA 1K6IA 4EGFA 4UT4A 3PUKA 4PGGA 2HMUA 4F3QA 3ORYA 4Q7KA 3KPUA 4TSFA 1N0WA 1KBQA 5DSZA 3W8DA 3EUWA 1A77A 3WZ0A 3D6JA 2KG0A 3EJ6A 1WD7A 4DSKA 4BXOB 3NJRA 3CVYA 4LVNP 4NXMF 1Z37A 2QAGB 3KT3A 2YBVA 3PFEA 3FMBA 1LEOA 3DE4X 1VYAA 2G2OA 3BHNA 2Y1KA 3THOA 4ZN6A 3OXFA 3ONNA 3NBZC 4F8YA 3F7TA 3CTRA 3VV2A 1W4CA 1WEHA 3CY6A 1OASA 3T4PA 4MB2A 5HS6A 2FV8A 2JI9A 2MR6A 2OI2A 1LEHA 4QDXA 1VB3A 4C88A 2ZH9A 2BSXA 3EEQA 2CW5A 2VWQA 3KM0A 1MG7A 4C7JA 5BSWA 1DRWA 4LXYA 1ZM9A 1MJFA 3J7Z5 3PIOQ 1UQUA 2F3RA 4X66B 1NUSA 3HHKA 1T4MA 4B17A 3AIOA 2DLNA 3T1YF 2VKZG 1EZ4A 4D26A 2C0QA 5F1PA 2EARA 5DS7A 1ZICA 1CS4B 2H2AA 1IJEB 1MG0A 3DFFA 4ZQFA 1DX4A 1O9BA 2P6SA 2HS0A 3ROGA 5TJ9A 2JF0A 4NRUA 1XF9A 3CLTD 4Q4CA 2WYUA 4RDIA 3F9RA 3R5JB 2EV9A 3S1AB 5L46A 2B4PA 1BQNA 1KVQA 3TLGA 2ADBA 2ZRQA 1WZNA 1DJMA 3JATA 4BUJA 5I3UB 1QLNA 4TLCA 4NLDA 3R6GA 5C80A 4KHRA 4H1TA 5EMMA 4MW5A 3G6VA 3I04A 1PFQA 4W5QA 1EX7A 2WIDA 4GL4A 4TU7A 2FSFA 3KFXA 4PYIA 2CQ1A 3UWKA 5D5HA 3ZU6A 4DDWA 1T2NA 2HSWA 2WQ6A 1HDIA 5I7EA 1T3OA 1UWBB 1YE8A 5CLIA 5BPFA 3GD5A 3EDYA 2H1OA 2YN2A 2UXDB 4JI8B 3IMCA 1P1JA 2ODAA 4DJ5X 3UN2A 4HFRA 4MKZA 4J9VA 1AKTA 1N5LA 4MV3A 4ZK6A 1PBTA 1H94A 1LDBA 4JLUA 4WZBE 2X4IA 2HHXA 3G1TA 1TIBA 4GO5X 4MYSA 3DI6A 3ZCRA 1RHUB 2BEUB 3VGSA 5J59A 3OMLA 2H0AA 2QP3A 1LX6A 3THYA 4Q4JA 1VL8A 3WRWA 1ZM3A 4LOIA 4F56A 3R09A 2NXWA 4WGFA 5J2MA 3C24A 5LOVB 1HI8A 1E6YA 4BGVA 4RNOA 3RB4A 3H16A 2PH7A 3QV2A 4Z0PA 2BKXA 3U3OA 4UBJA 3DSRA 1EUYA 3TX8A 2EKPA 2DBRA 4ALKA 3TM4A 4BWMA 3KFWX 3AXSA 4UUBA 3SSOA 3R77A 4BP3A 1JAZA 1F5NA 2XDAA 3KR9A 4QGFA 3SIPB 3MXOA 2PWBA 5ULLA 4O5OA 1QYRA 3BJIC 2QGNA 4KL8S 3MWLA 1J0EA 1QRUA 1CJMA 2X6QA 3QLUA 1E94E 5K6AA 3VAGA 4OM7A 1TZ0A 3OCWA 3R3YA 4EZ9A 1UEIA 1KJ9A 3QY9A 2EF1A 4B4KA 1ZONA 1N9GB 1WF3A 3TZQA 1P75A 4HDRA 1KS9A 1Q6YA 1XJ0A 3UV7A 1RQNA 3NOVA 1CNEA 2HBQA 2NSCA 4QUKA 2E5WA 1YS4A 5HMLA 5CMLA 1J0XO 4JUAA 3H1FA 5CTJA 1OAOC 3SNHA 5ALZA 3CWZA 1NHKL 4UNNA 1T0HB 3WDMA 1TMKA 3RRHA 5HQ8A 4TN2A 5C5IA 1DO0A 2QN6A 5HCUA 2ZYRA 2R62A 3O0DA 5KFGA 3RTGA 3IIEA 2RDMA 4R54A 2HAFA 4G5YA 3BGSA 2MSCB 2NU6A 4URSA 5KUTA 1O4VA 3PNSA 1PFYA 2C54A 4ZPXA 4NSNA 1XXHA 2FJPA 3IR7A 2QD2A 1C2YA 4KUEA 3T3MB 3KSUA 1XEWY 3KTQA 2W58A 1GR1A 3P97A 1N54B 3NUZA 1RHRA 2E21A 1YL6A 2FSGA 3D5TA 4Q3CA 2QG9B 3K3PA 1N75A 4X65B 5LM7E 3QNWB 3SHOA 1XDGA 4BRSA 2AC4A 4AZ0B 1NKTA 4GE0A 4B3MF 1BCRA 4MYHA 5JMWA 2JEJA 2HLTA 4RVGA 4N5IX 2PCJA 3RAPR 3I12A 3FPLA 4DV0F 1IJBA 5B55A 3RT7A 1GQRA 1Q1BA 1JR3E 1B3BA 2AR0A 3L3BA 1LVUA 2PIDA 1RQ2A 2EW1A 1DTTB 3VNBA 3JQCA 3AD7C 4HH0A 2IIPA 3R2DJ 4A8FA 4E2XA 4ECXA 4Q82A 3TPFA 1PFWA 3GUCA 3OJWA 1T2VA 3HKWA 2R7UA 1ODLA 4PXAA 1FDDA 3DUWA 4RNNA 3BAFA 3WADA 3G2QA 5HCNA 1U28C 2UUPA 1H23A 3Q23A 2HREA 2FSVC 2HWTA 4E5VA 4LOHA 4ZLPA 1VRVA 3UTDA 2CBXA 3SJ7A 3R41A 2WSSA 3BICA 4PLFA 4TL6A 4ECYA 1UZAA 3OURA 1DRKA 1NG9A 3B6JA 3P9XA 5GINE 1G8YA 3AXKA 3PCTA 3RFUA 1FX0A 4MVXA 2CPXA 3KYLA 3PA6A 1ULRA 3JYHA 2V4JA 2A7XA 5IJWA 2VA9A 5ALRA 3J81A 3MWEA 1W4RA 5C3MA 2NQPA 4D79A 3S5UA 3H7AA 4DEZA 1H8EA 1VQSA 1IKXA 1VC0A 4ND2A 2YX1A 3BREA 3NKYA 3BWMA 4LDRA 4G0OA 3A28A 2H1VA 2JIQA 4E4RA 4NJMB 4CI0B 2PAAA 3RSHA 3V48A 2NU8A 4CFSA 2Y6VA 2HL6A 3U7QA 1Q17A 4ZVKA 1YK9A 2VZ9A 1PUIA 1WXWA 1Y0HA 1CUEA 3FLEA 4DKJA 5EP3A 3UWOA 5CBPA 5U1PA 5LMNB 1M8GA 1V5IA 2WBLC 3F97A 4YHBA 2GZDA 1VE9A 3IH5A 2AN9A 1XNRF 5AK5A 3ABZA 3UATA 4ATNA 2AOTA 2J3EA 4AMUA 1HLWA 2IXAA 3PF8A 5DNYB 5GJVC 2GNOA 3GU3A 4ZHRB 5KFZA 1U7PA 3G13A 4LQ9A 1TL5A 2ZVDA 4RA9B 3AHPA 2GTPA 3H42A 3ET4A 1SKBA 4XVCA 3EXIB 1E3WA 3TQIA 1Z25A 3HSJA 3LTEA 2V7GA 3UK7A 5J2UF 2XUZA 4OZ2A 1RAJA 2W24A 3TANA 1DAGA 3OCZA 1XHEA 2F1KA 3DH0A 3DE0X 2FG6C 3MSXA 3ADAC 2JEYA 5D8DA 4PSDA 1JMVA 1BMDA 5K4GA 3FN4A 1V6CA 3M30A 5I5GA 4AN1A 1KMIY 3G8AA 1JG2A 4PW0A 3GWZA 2LP4Y 3QE9Y 5ECDA 4W5WA 2IJNA 4L95C 2BELA 3CB4A 3O3LA 2ZUUA 3GG0A 1FS5A 3M2VB 2RGUA 3EIEA 1PIWA 1LJ8A 2QN7A 1GCGA 2EKLA 3QBTA 2I2YA 3LGNA 3PFKA 5F8IA 4E32A 3KLHB 5JY1A 2QOEA 3E01B 2GJ9A 1UBUS 2W6NA 1VPDA 2COUA 3U48A 5BNFA 2A10A 1GZHB 3EFEA 5TQ2B 5JVHQ 2RD2A 1ISPA 3BWCA 1VLYA 2FZKA 1NW4A 4OH1A 3R5SA 3SVZA 4FQ5A 3NTLA 1D3WA 4DL5A 2P5SA 2CJXA 3S27A 1FMCA 2MJNA 1EDEA 4ZVQA 1F6BA 4E5PA 4MYUA 2GHIA 5BUQA 2RI0A 2MKHA 2HRQA 3ZLBA 2FFAA 1FYVA 4LF9F 1F0NA 4RETA 2P6OA 3B53X 4GWLA 2BACA 2EYUA 2VRNA 4AJ1A 2BE2B 3T5PA 1GILA 1J0CA 3MHPA 5AVXA 1SH0A 1UMKA 2W2KA 5SY4A 1L5FA 1UEVA 2QX9A 3LK7A 2XT6A 4A6PA 1IK4A 2IYEA 3AVXA 2ZC3A 4XCXA 2IHZA 5GJCA 3WDLA 2AVDA 3MMAA 3AAWB 2GVZC 2O7SA 3PEFA 3R20A 4KH1B 3RSQA 1Y9OA 4REQA 2M0GB 4M7PA 3OXGA 4ZJOA 1VHLA 3A9RA 3OLXA 3HGMA 2WAQD 4YJGB 3VV3A 2XS7A 1TPYA 1FU4A 3U49A 5COQA 5HIMA 3S01A 3A4NA 5JXWA 2ZBEA 3WLSA 1JIVA 2E5GA 4Q15A 4K3UA 3M6IA 4LSZB 2WYIA 1W47A 4OHCA 5AKLA 3U7GA 4FYVA 3MUTP 4BPRA 2YJGA 3OZVA 3CJ2A 2VJLA 3MOSA 3AH8A 4I55A 3ZIAD 3DHXA 4DV3F 3OPYB 3VTFA 1TQ2A 3EPIA 4GZ5A 4N5NA 3WFJA 3N8NA 2EBFX 1KOFA 2RKIB 2IYPA 5CHEA 5FA6A 1RLTA 5B36A 4ID5B 2QGFB 4B5LA 1WMFA 5HDQA 1LPNA 4WKYA 3W63A 2CJYA 2A3RA 4WOKA 1CR4A 1C14A 2DGXA 1FE8A 5K6TA 1APBA 4X6XA 3FZYA 1NJIT 1IOZA 1GU0A 1YVFA 4DCOB 3EHEA 1OQ6A 1KDNA 1O08A 3LYLA 1YFJA 3K5OA 4GFDA 4IR9A 3KLEB 3RVJA 4EI2A 1UKEA 5IW8A 2H4XA 1FBTA 2O8FB 1RCTE 4CN8A 4R2XA 3RVKA 1Q0QA 4Q1DA 1BROA 4NFYA 4F38A 4BQRA 1RBMA 1X7YB 3P9SA 2WAYA 1V7QA 3KQYA 2GYYA 3ZV5A 1TM7E 4IDKA 4H1UA 3N8GA 2CXXA 2PVPA 1JVBA 5I7OA 5IC6B 1YL7A 1BX3A 4R1LA 1CULB 4G9BA 4Z4GA 4KC0A 3A1DA 4IWNA 4UMDA 2K2QB 3BB1A 5CUQA 1K5GA 1W36B 1XZFA 3F0NA 4QODA 4YYEA 1L7DA 3JAMY 2H2FA 4B1FA 4JK3A 3Q41A 3A3OB 4OQZA 1U28A 1KY2A 2PZAA 4X3PA 1S0MA 2V0GA 2EKYA 4FJ2A 2J7PD 3A9CA 3RAEC 2X1MA 4YOEA 1VLLA 1SBZA 1N6LA 1MXHA 3HUUA 3U56A 2RC5A 3WKAA 3QFFA 3CF6R 4EHBA 3E5MA 3MRTA 3DNCA 1GMUA 3OY2A 3DDOA 3BIXA 3FVWA 5JJIA 1P2TA 4LE2A 3I83A 2P68A 4PNPA 4R40A 4QIGA 3JU3A 1W2HA 4D4HA 1KMCA 4L6CA 4MHOA 4YV0A 3DDIA 3WSTA 2W7OA 1NH8A 2Z2IA 3RLFA 4GDMA 2IP1A 3GLRA 2QMEA 4MPJA 3D1HA 4UCXA 4F6CA 2FDXA 3W3ZB 1AFIA 1W52X 1QHSA 1GM5A 1YTLA 2Q5QA 4O4HA 3B78A 1DI0A 4RTJA 3ADOA 1YBAA 1ZS6A 1EFKA 4H60A 3PO4A 4PANA 3JQJA 1V1RA 3KVOA 2VFUA 1X86B 4AUMA 5I7HA 3ZHQA 1VHTA 1PR5A 2O4UX 3UT6A 3CH4B 1N3LA 3CG0A 3TI9A 3KJVB 4NMWA 4GT1A 2RNEA 2CQGA 3DEFA 1NQ5A 4B4DA 4LDQA 3RIXA 3BOSA 4H7IA 4F0MA 2VS1A 2I6WA 3O2NA 3TA2A 3UBTA 4FLMA 3CFYA 4P4GA 4WBSA 1M2VA 4A6XA 2ROEA 4UDYX 2Q46A 1WY7A 5DEOA 4HZGA 2RONA 1JB1A 4FB4A 3ASVA 4RU2A 3FHJA 1IZYA 3MD1A 3DQPA 3C74A 4BATA 4ZCMA 2O5DA 1HNXJ 4D3YA 4Q39A 2J6UA 3GPAA 2R6HA 1KVSA 5CK4A 5LVAA 4EA9A 4UDNA 4DCTA 2OTJS 3IXMA 1U8YA 3JSYA 3QF7A 4MS3B 1A8SA 2D3OR 4C6SA 3WLNA 1S2GA 2WICA 5K05A 3T0GA 3AB8A 1K27A 1N6HA 3B9QA 4B35A 2P2CB 3W3AD 4YP0A 3H86A 3W8GA 3WMWA 4LCBA 1TZJA 2GMWA 5CXXA 2YOFA 2Y0CA 5ALIA 2IXGA 1M1GA 1CJKA 1Q7BA 1AV7A 2HRDA 1TL3A 2Q2QA 4DIBA 4UFNA 3RT9A 3PUVA 4D3DA 2EYQA 5I01A 2I8LA 4QGHA 1KJNA 4M5NA 3I9V9 3TVTA 1JXAA 1RJEA 3PKZA 5KOXA 1U1IA 2FPPA 2HIHA 1WZCA 4LVOP 2V7QD 3PWTA 4LRAA 1CUFA 1FJGJ 1DEKA 1F2UA 4PC6A 3GRKA 3OE7A 3E9EA 1FFSA 3DMJB 5H3HA 4O4IA 2CDQA 1VGQA 4AJPA 1NQWA 2CHEA 4D9MA 1JJ2R 1YOVB 5KVVA 4FFPA 1EFVA 4KYVA 4M7RA 4BKRA 2OG2A 5AKZA 1REQB 1LWEA 1PD1A 1INLA 1LY1A 4FDUA 3BE6A 4NDZA 2CXPA 4HEA9 3HVKA 3JPYA 2OFXA 3CG4A 3N8KA 2NZ4A 2R6FA 3ASUA 5EQJB 3WG9A 1J1UA 4L8LA 1YZ3A 2FE4A 3H04A 3O8OB 2UZ1B 3DFMA 5ARBA 2FXVA 3TLMA 1REVB 1R8SA 3V4ZA 3IAAA 3SZ2A 5ETPA 5J40A 3WWYA 2Q9CA 5BVGB 2VNAA 5IF9A 4M1YA 3CZQA 1GEEA 5KFLA 1NUAA 1MG5A 2CMFA 4USWA 2HBZA 3CWJA 2Y66A 2YFYA 1XMQJ 4HQLA 3PI7A 4RZ2A 2X1FA 3O1JC 2ZYTX 4CLSA 2PH3A 1YQWA 2O50A 1E1RD 1A9OA 3PHCA 3SJAA 3FFAA 4PR3A 2JCSA 4XYLA 3HJFA 3P2JA 3PYDA 3MCOA 4GMKA 2G82A 4ED0A 4PSCA 3EIUA 2YNHB 1WY5A 3NS5A 2YWGA 3KSZO 3F71A 3GE9A 1YI0A 3L49A 3CJRA 3DDZX 5JSQA 1WQ3A 1ECPA 3SCJE 3QLJA 2P2NA 1EAYA 2PUAA 3ESZA 3R44A 3V42A 4LJ8A 3A6LA 1TAGA 5T64A 4DV0J 2LZ0A 2JA2A 4UE2A 3GEMA 3FIUA 2MSTA 3K0CC 1HT0A 1SOAA 2HK2A 3I6QA 4ZJPA 4CLLA 3C6UA 4AQYB 2CLLB 1A4XA 3C97A 3Q7PA 5AUQA 1R5JA 2OFOA 2NUTB 2O3DA 1Z18A 5CVEA 2LDBA 2XCTB 3WQQA 1UDBA 4KO0A 1JFSA 1SBNE 2DWPA 4R0JA 1UL1X 4A8SA 3T5GA 4DDTA 1G4CA 4CKZA 1FNSA 1KYYA 1VKRA 3TPZA 1BWQA 3F4KA 3ONFA 3BQ2A 3LXUX 3AEQA 2FEWB 3H0EA 1UDCA 4WTOA 1KP3A 1Q1EA 2IHBA 5L7TA 3QLHB 2IUFA 1UXHA 4R2LA 2QQGA 3DEKA 2GBPA 2VC0A 5IBQA 4CBVA 4B6SA 2HWIA 2VQEB 2JJ2D 4LXXA 4BMPB 1W87A 2ZYSA 1AT1A 1PW7A 3M1IA 2ZJQQ 1IM5A 3WFIA 4K0KB 2OV6A 4Q48A 3IC1A 1HQ2A 1F8XA 2VICA 5SICE 3L3CA 3ELWA 4DN0A 1GIAA 1M66A 3NHKA 1QZTA 3TLCA 1C1HA 3TW8B 4BL5A 2ETXA 1KVKA 2OPHA 3W0LB 2RILA 2C2ZB 3KZKA 4JN6B 2IITA 2XLBA 3OWHA 3SQDA 3LFUA 2FAXA 4Y00A 2ZK7A 4MGHA 1CQZA 1ANKA 4HB0A 4BRUA 3KKMA 1O97C 4F4WA 3HCRA 5ALYA 2OXTA 5IEBA 1BEZA 2BZ2A 2YKMA 2NUUG 2NADA 5K3CA 2M88A 5L3SA 3SHQA 1QS0B 3KFLA 1QO0A 3QU2A 1Z29A 4DR3B 1FX2A 1RQXA 1XTBA 2FJ0A 5LDDC 2O05A 3QNWA 3MEQA 2BMWA 2BP7A 5D86A 4QKQA 4WNAB 4HLQB 1ORHA 1E3LA 7GPBA 4Y3UA 2DY1A 2WTXA 3UG7A 4CLPA 4F36A 1TO1E 5A4DA 1WB4A 5JAQA 3PEWA 2BMEA 2KJWA 3RARA 1S6QB 3NEKA 5F35A 1PZHA 4YY3F 3VAYA 3IAS9 4C4XA 1RCUA 1JEYA 2DZDA 4RPLA 3IR5A 3OVSA 3D6NB 5LWQA 2ZR0A 2VK4A 3SX0A 5MF6A 1T8EA 2ZRLA 4L72A 4RVOA 1L7BA 3F90A 3VC1A 2PUGA 1ZZNA 4I1OA 1KYQA 1UKVY 2ZVPX 1ODCA 1XEXB 3HD2A 5IK2A 2XHWA 1MN9A 3W61A 5K8LA 3QYPA 4YK7A 2NTNA 5KTPA 3PX3A 5C25B 1HI0P 1HLPA 1NP7A 2RRAA 4RFLA 3E8OA 4JC8A 3WX8A 2WHQA 1MAUA 4MEJA 1JBQA 3ZVMA 2FWJA 4D0LB 4H7DA 1Z2EA 4IJVA 3NS6A 1JTFA 1KSHA 5JPCA 2D4HA 5L3SB 2XE4A 3GH1A 3OLQA 4R2IA 3BGIA 3ZE1B 4WYLA 3QVLA 2VFRA 2H1WA 3WGIA 1N34J 3MGGA 3EYAA 1TKTB 3OM0A 4GS5A 3QYAA 1RMYA 4EQ6A 1M6NA 1D1QA 4DL0C 1E64A 5G1PA 3SM3A 4LVOA 3U2QA 1CQNA 3LDAA 3PYMA 721PA 1SAYA 1JDPA 3VOSA 2WB1D 4RJLA 3LGSA 5EMJA 4B6OA 4IRDA 1G7SA 1U3VA 2Q79A 1YDMA 4IZ6A 1KDVA 4DLTA 2XY7A 1O8BA 3W6PA 3ICVA 1E0JA 4C3MA 2QTNA 3I9NA 4BS2A 1Y8CA 4TTSA 2ZSFA 5JH7F 1U1CA 1E9EA 2G6BA 1RJDA 5LZ4A 5LB4A 4D9EA 4KAJA 1U8SA 4MK7A 1S99A 3W66A 2Q1SA 4Y2XA 1EKRA 3HEAA 1AGNA 3LT5A 4P32A 5AO9A 3E9NA 3OZFA 2ZI3A 3KQVA 4DV1F 2C5GA 5CYOA 4FI3F 2B5JA 1JQDA 4I2PA 3NBYC 1E3DA 2CL7X 2DGQA 1CSEE 1IJFA 4C0BA 1RYYA 3R5CA 3N0RA 2F64A 4JJ8A 4DS4A 4DLPA 1L4NA 4LHYA 3FA2A 2O1WA 3ZJTA 3C6UB 4L85A 3MEEA 1HZZC 4AE5A 5M3BA 1JSXA 2I3BA 4IO9Q 2CEKA 2WIKA 2VL1A 4INAA 4KY3A 1YFZA 2C4VA 1XP5A 1ML4A 3VZDA 2Y1WA 1IONA 3TE6A 4B9EA 3NCPA 1BMFD 4NFHA 5HVGA 4DR7F 3V8BA 1XEFA 2Z5GA 4TSRA 4RK4A 1RA7A 3THSA 1QDEA 3ZHRA 1YXMA 2IF2A 4HB4A 4ZWNA 1I7PA 2O54A 1EGMB 1W0KD 3ZV6A 1PK8A 1B3RA 2W8ZA 5K3BA 1ILEA 3WQSB 6CHYA 3N58A 1A5AB 2GAGC 2DKOA 3GIKA 1ZCJA 3PGLA 2DNHA 3HR7A 3PDIA 5E7OB 5GPBA 3EARA 3HXPA 4F25A 4QR0A 3OI7A 1PJLA 5BSRA 2OC9A 2AD5A 1UBJS 4MQFA 1G7CB 5DT9A 3GHHA 2E1PA 4OMFG 5LA6F 3R3TA 4YONB 5D01A 2WZDA 2IH5A 2ZJ8A 4PG5A 1IBMB 1O57A 3CJ4A 2VYNA 3KOXA 4LTMA 3G6WA 4K87A 2ZBRA 5GONB 3QNMA 1LKZA 1GAEO 2V4MA 4G0WA 5FWYA 3BCUA 3LIPA 2PMEA 2VHXA 3FNNA 3E3LA 4KB7A 3FWYA 3LD9A 1GITA 4NXNB 1U49A 3UO0A 4WIAA 4LF7J 3PQEA 1E6VA 1WETA 4EBCA 2OGTA 2R7WA 3OTCA 3HC7A 3GPIA 2VPPA 4ZQHA 2E9RX 2FGCA 3R0VA 4GI1A 4HWKA 1AXRA 4LGVA 3BGFA 5J2MB 3MM9B 4N5MA 2H2GA 1EJ0A 2XXBA 1V2HE 3P8ZA 1PWHA 4J3JA 1EP1B 2PKYX 1Y82A 3PXUA 2VP2A 4GX5A 3T7IA 1Q5PA 4B81A 5KC8A 4HDSA 4M0DA 2Q8PA 3UK0A 1QFXA 1E5VA 3V34A 2MQ8A 2HMWA 3GRVA 3T5LA 1HL3A 1EQ0A 2C58A 4QIEA 2H00A 4M21A 2TSYB 4KRWA 3IAEA 2ECQA 4M9XA 4C2UA 3WMXA 2WOJA 1A2OA 4JA2A 1ODJA 5AI6A 1N2GA 4ZQIA 5E4JA 3GRRA 2AW5A 2CL0X 3PRVA 4AW9A 2M2IA 5JDCC 2WFLA 2G0IA 3NT4A 4ANEA 2V8BA 2GF0A 3CJSA 1QAIA 3HH8A 4LGCA 2Q43A 2MQOA 5DG8A 5AJVB 1UZNA 3EVCA 4DCNA 3BHIA 4I4IA 3R1LA 1P4GA 1HKUA 3ESCA 4JI4F 4M89A 3IPYA 4BVEA 2ZI4A 2Y0EA 4K9DA 4UVEA 2OE2A 4MVCA 2VOPA 3OTIA 1W5AA 3L1IA 4TKTA 3ONWA 2ACMA 1ULBA 1WXEA 2QLXA 5B3AA 1PZGA 3MUEA 2FLKA 4OYRA 1K3FA 4JITA 4Z53A 1NVGA 3NGMA 3EEYA 4IH1A 1NJ8A 3FHOA 4CUKA 4ALJA 2HO5A 1BH2A 2Z58B 1RYHA 2H2IA 4KC5A 1HBMB 3DQZA 1U0SA 1PL0A 2QM3A 4K0RA 5JRDS 2CVOA 4BWGA 2I7TA 5G3ZA 2C2EA 3VVCA 3IUPA 1JYFA 1PJBA 1YVDA 1DX9A 3W5SA 3BORA 5CAAA 2EEZA 2PN6A 1VQ1A 4IFYB 2ZUEA 3REGA 5EJ9A 1ZI8A 4ZJQA 1NQVA 2C2MB 3ZS8A 3I01M 3ZVNA 3RANA 4JAVC 2MKSA 3GQCA 2D54A 1QRTA 1HG1A 3OHMA 3OVMA 4D25A 1I5RA 1VL1A 2GJKA 1P1BA 2QSFA 4LJSA 3SQMA 3LM8A 2OVBA 1D04A 1CY6A 1X9WA 2EG5A 3TI7A 1A72A 2C2DA 2FK8A 2V03A 3CEMA 3SXJA 3ZG6A 4UAJA 1SU6A 1V43A 1Q8KA 3LTNC 1LRJA 1UPXA 3VVMA 1WC6A 3MMBB 5BW4A 4BV3A 1T6ZA 3F6PA 4A5SA 1QIKA 4HV4A 2OPQA 4A82A 1KHHA 4JP1A 3LVRE 2OO4A 1R8JA 2PLWA 1RTHB 5I3UA 1VIAA 1GXSA 4ND3A 2A88A 2NAPA 2E4VA 3AW9A 1NNSA 1DUIA 1B2RA 2NO4A 3HA5A 1BWVA 1NMYA 2VWHA 2QT9A 2FSHA 4P73A 3I2KA 4MV8A 1J8MF 4PZEA 4REQB 1RQ7A 5D51S 1JV2B 4AO7A 1PU2A 1EX8A 2A6PA 1NRJB 1Z4QA 4ARAA 2Q4RA 2B2XA 1I6JA 4M5KA 2VQ6A 5KG1A 1S2NA 5I8WA 5KQPA 3BH7A 3LPDA 2FNAA 5HM8A 2Q6KA 4B6QA 2WJVA 3J81U 3DMFA 4EUFA 4MS1A 3NHPA 2WB2A 4XR4A 1ZPVA 2CFXA 1NU8A 4W4TA 5REQA 1CHDA 1H65A 5K20B 4LSWA 4MAMA 4BCDA 2CKMA 4C0WA 2C2KA 3IYLW 2GXUA 4HD8A 3AESA 4BLOA 4WASA 4ZU1X 3AIIA 4YMSA 4IEEA 1X1RA 5DHRA 1UZHA 1WEKA 5AIBA 3HI4A 3QTTA 5HILA 2HVZA 1XWWA 4XDDA 2BDEA 1MT3A 4OV6A 2E44A 2O0JA 3ELUA 1OXSC 1UP1A 5IV4A 2CPYA 2J0VA 1GLGA 4R2HA 1XIQA 2YKNB 3IXQA 4D4LA 2CFSA 1ZMXA 2M1XA 4ZVTA 3O8WA 1TVRB 3DD5A 5LOQA 5A04A 3W62A 2GQCA 2W93A 3KT6A 3GGSA 3IAXA 2R0QC 1JG1A 2VSNA 1SKSA 1SFRA 1KZ6A 5IWAF 2XIJA 4BO8A 2CE2X 4CQLB 1EVLA 3LP2A 2DETA 1Y3JA 4M5JA 1W8DA 1NVVQ 2XNQA 3AM3A 2UYGA 1Z5UA 3MINB 1JE0A 1VJCA 2NXNA 4XTTA 1UOPA 4HDAA 3FXAA 2B0JA 1QFSA 4BTVA 4RVCA 3WJ1A 4HVZA 3EA4A 4DQPA 4U67Q 3TUJC 3VSAA 2GGPA 3QW2A 1A95A 3RTVA 4WK1A 1HE3A 3ZKWA 1OWXA 4ICLA 5K8CA 4X4SA 5H9EJ 4F9GA 3FFBA 4HI0E 4HR7A 1TUBB 4UZFA 4I1IA 3CUUA 2P0AA 2NW6A 5L1IA 3AESB 5LXRA 3VNQA 1YGYA 3CTMA 4O4JB 1UDXA 4MVJA 1E2DA 2VWGA 2RIJA 4NATA 2ZH3A 4HT7A 2HRCA 2PLFA 2UVPA 3PQ7A 2CMGA 2COEA 4C20A 4DYVA 4UBNA 2C0PA 1VL6A 1P1LA 2FMFA 2ZAYA 1RPNA 1RAIB 1YQDA 1QVRA 4WNCA 5EP2A 1U2FA 2QB5A 5C7LO 4CLHA 2Z83A 5ED4A 4PGMA 2O8DB 2JLWA 4Z8YA 4TV9F 2RGBA 3KK1B 1LPBB 1H22A 2LDXA 3EWGA 3G82C 3HJHA 1OH8A 2Z95A 3K2IA 2UZ4A 1BHO1 1SVNA 4QPPA 9LDTA 4TRMA 3UAYA 3ND6A 1LWFA 5U4QA 1S1MA 1Z47A 3AUXA 2WTNA 3QLUC 1RT9A 4EHIA 4F9EA 2XMPA 3ZY2A 4Z9FA 3S2SA 1HNXB 3OFEA 4DV5J 4QAQA 1SV5A 5FA5A 4P6QA 3J7AN 2J3HA 4CKEB 1IQPA 1Q5YA 1HV8A 3OF3A 3GQBB 4JEHA 4NYIQ 1YMUA 4TY8A 3TGWA 4FF4A 3BO4A 1G60A 1TT7A 3ZNPA 4ZT6A 1E2KA 4ZI7A 3FTEA 1T11A 2XKBA 2ZOFA 4Y9SA 4IZHA 3RSGA 3GT4A 4JQCA 2ON6A 1R15A 1FXWF 4O23A 4AY6A 6FDRA 3K9QO 3EVWA 3FTQA 3H1TA 4HY3A 3STUA 3ZCSA 3BFKA 4IOMA 3P9ZA 4DG1B 1OBCA 4MCHA 3V1NA 1U7DA 1OIVA 3BWDD 1G3UA 3OEHD 3HKBA 4R5MA 4DN9A 5L45A 1P72A 4CM3A 1HDEA 4IH6A 3OAAD 1TK9A 1RLDA 1M6HA 4CV2A 2VHWA 5ICMA 4NZ7A 2J0QA 3KWMA 5T7BA 2VDIA 4GLBA 1DDGA 3I1IA 4QTZA 4KFUA 5EWMA 2FRDC 2OKGA 3NVAA 1V25A 2GPSA 4DRYA 2RKIA 1G9SA 5LR6A 4DCPB 1TYZA 2FEPA 4FOOA 4HYYA 2D3TA 1AKRA 1GPH1 4MDFA 3ZLUA 3Q8UA 3EEOA 1JJCB 4U7WA 2V6MA 2AN4A 2JAQA 1MHTA 5FFMA 2VJMA 2WU0A 1R0WA 2QJRA 3LKBA 1DBRA 3BXZA 4QWCA 4MP6A 2R6R1 5I5EA 5ICFA 3AF2A 4LJYA 2V34A 5DDPC 2OTLS 4HGOA 3ED5A 1S6OA 4G63A 3HDSA 3OEYA 5BYAA 1V5IB 1PN3A 3INRA 2PYZA 2D5IA 1JPNA 5T67A 2GN9A 2A0FB 3QF4A 1CRZA 3PXBA 4HNVA 1DC7A 3EXG1 4ZRDA 3BPSP 3I9OA 3SU8A 1GL6A 3LKZA 1JLEA 2ZWVA 1D4ZA 1PK9A 1OJLA 3DTNA 4D9KA 5KNLA 5CH7B 5KSWB 5KYYB 1YA4A 4V0NA 1VSUA 2P9JA 1E3WB 2WLSA 4C48A 1EDZA 1YA6A 1HQCA 3T3NA 1OAOA 3LQ4A 3HVUA 4MIYA 1ZQ1A 4F0HA 3L0OA 4UVDA 1NZ8A 4I3GA 2I2XB 2JFYA 2P2CA 2R4UA 5CD4H 1UBFA 2ABWA 2WRMA 4M1KA 2VG8A 3PYFA 1CJKB 2ET6A 2FQ1A 4KBYA 4ED2A 4B75A 3H9EO 4KFSA 4I8XA 2AFIA 3GLFE 1NN5A 4HRYA 5TPZD 3UF0A 1J5XA 5JYBA 1ML3A 2C03A 4LY3A 1KO7A 3SNKA 4G0MA 2QVCA 2XQIA 1M73E 1UFKA 2VBXA 1VHDA 1MOZA 2EJWA 3SE7A 4TKUB 1SBIA 4KR3A 2WOOA 1J33A 1JU3A 3OC6A 4IV5A 2HYIC 5I8PA 4L5IA 4PINA 1RQRA 4M87A 2YKAA 2ZUWA 3ROZA 3K6JA 4F0KA 2DFVA 1N2BA 2FB0A 1YDWA 2D2XA 1KVUA 4X41A 1AURA 4RGQA 4WKRA 3SX4A 1N92A 3AHIA 3GLKA 1RGVA 1KHTA 2X9GA 4UMEA 4TLDA 3SI7A 5LUAA 2CUKA 1C8BA 3B2NA 4KDEA 4XFKA 1I3CA 3TBFA 2Q62A 1IXKA 3EGDB 2GO7A 2GJ8A 4JI7F 3TGPA 1SVWA 2CSUA 5FNZA 1YHZA 3E7FA 4EM6A 1GFWA 3BWBA 4XDHA 2V68A 3GLIB 4TUYB 4AZ3B 3C1OA 1N33J 3MYYA 1DT3A 1LW6E 3N1UA 1EBUA 3USES 3IQGX 3OKFA 4QU8A 1L3IA 4DKXA 4OLBA 2H85A 3N70A 3I6YA 3AJRA 4ARZA 2DFKB 2F9LA 3FI9A 4DBQA 1GTMA 4HATA 4C29A 2VPQA 1BQXA 4FFBA 1S2IA 2EX4A 2V8DA 4IPTA 1E0KA 1E3IA 2EC5A 4DLXA 4PYJA 3HVJA 4J0JA 3OQPA 5C8XA 1Y5NA 2XQKA 3FVYA 5EYPA 4L15A 4KYTA 2IYNA 4D3FA 3GFRA 2IA0A 1OWPA 1Y4SA 2CF5A 1RTDB 1N5YA 1RWWA 3WWPA 1UP6A 2NZWA 3LWZA 1TZCA 4OP3A 2V67A 5JTTA 1ZWLA 7REQB 3CZ5A 4IMPA 3TJZA 3THXA 2OPPB 2WSCC 1PFUA 2A3JA 2OECA 4D6XA 4QYZJ 1EFTA 1N2IA 1RLCL 4GKVA 1PO6A 4BQOA 4J0FA 2X1AA 1FNCA 4X9XA 4ZGBA 2PXHA 1NDLA 1HWIA 5K5MA 2P9FA 1VRUA 4OXQA 3RJMB 3QXHA 3BMCB 1VZ2A 2GBLC 4YPFA 1SIWB 3H98A 1G3RA 1S4MA 2GVDA 4ES3A 1PQPA 2YNGB 1XUOA 4LRXA 1XFDA 4J75A 3SQOA 1GZ5A 1LTHR 1U0GA 2JLZA 1T2CA 3DYIA 3EGDA 4PFSA 3ZHXA 3CLHA 4PX3A 1PV4A 4A5OA 1EBFA 5H1SV 1YBVA 5BUZA 4P0PB 4BNDB 3TR0A 4HADA 1HWJA 4L74A 1Z6AA 4HAIA 2UZ1A 2XF8A 4EECA 3WZLA 4W9NA 5KEIA 1CUDA 1TD1A 1U0NA 5G2OA 5KG6A 4LXUA 3V4MA 4ABYA 4P36A 2VJVA 4B3IA 4LYJA 3UWPA 1FIUA 4MUGA 1N5RA 2OORA 3ANSA 4IFVB 4MJLA 1T3SA 4A3SA 4H27A 2BW7A 1JHAA 3FPGA 5LJ5Y 2LIPA 5D3MA 3OPMA 2G63A 1XNQJ 1EFUA 2AFRA 4L2IB 4PAGA 4BZQA 2VPWB 1H2FA 4B7CA 5CLJA 5KNBA 5IXJA 2WM3A 4FBLA 4PICA 3RRJA 4G84A 2POCA 4AXJA 5A9SB 2D0PB 2WG2A 2FFJA 1RXOB 3KYIB 2BMBA 2WOMB 4DUYF 4ZP9A 2YXNA 2ZBPA 3ZXSA 3SBDA 2JC1A 3RC3A 1ODIA 2QSYA 1U8XX 4KJXA 1VQ9S 2LFVA 2PYDA 4Y28C 3DLBA 2OEPA 3JX9A 5LM3A 3VAZA 3WISA 2PUVA 1UPPA 1CJTC 1P9QC 4ZP1A 4KO1S 3VOAA 1MIHA 4B6PA 2MWMA 2I7VA 3E9DA 4M3NA 3HN2A 1ZP6A 4C0LA 1NI3A 4KO0B 4Y7CA 1II8B 2ZUAA 1L7OA 1CSJA 3CE9A 1FLNA 3X43A 3KLIB 2C04A 2LCWA 4O4GA 1CY7A 3DLGA 2IVZA 1S1XB 1UADA 4GKJJ 2C84A 5CDGA 5DLYA 2CCKA 3M7VA 1CUAA 3G2XA 1C1XA 2BGMA 2V59A 3IMFA 3OJ0A 2CLKB 2CT8A 1R3NA 3UUFA 4DUZB 2YCLA 4X4OA 2G88A 3FWKA 5B1DA 3MXTA 3I92A 4YRJA 3EZFA 1RZVA 2B7CA 2FTRA 4JOUA 3MTJA 3LDGA 1Z2ZA 2JFPA 2VT7A 5KOHB 4CIVA 3IERA 3GPLA 2W48A 2P6UA 2GNAA 3VQSA 2SCUB 3PXGa 2VDVE 3AYZB 3UQYS 2G8LA 4NK4A 3H5SA 3HI9A 1CRLA 2IYOA 4UNRA 3DBOB 4LZLA 3PVXA 1HDCA 4MFBA 3TRHA 3UIEA 3PC6A 3FTNA 4BO0A 1FTWA 3WKDA 4JOCA 1HQEA 2GAIA 3CNHA 4C14A 1E7YA 4EBBA 2Q29A 2OPSB 1RKBA 2R8PA 5A5VA 1Z2DA 2JHEA 2HN9A 3WK8A 1IAVA 4YP1A 3KJQA 5H5JA 3GCXA 1KO5A 2V0CA 1HQYE 4AWBA 2A6MA 1NXPA 3PGA1 2LQ9A 3BFJA 1QHHA 3L92A 5IJAA 3G7UA 4XX1A 2F8HA 1WA5A 1NUUA 1OE0A 2WJPA 2VOEA 5GM2A 1WDKA 3D0OA 3O73A 1FRQA 5DBFA 3BFVA 3ZHYA 3KQNA 4WVFA 3DMTC 1G2EA 1JILA 2Q3FA 4I6YA 1K4MA 4MVYA 2Y9HA 2D7CA 3AF4A 2BKAA 4DJFC 1PL8A 1K0FA 4E94A 2VYVD 2WM9B 3IUEA 1E1NA 3LKVA 1CY8A 2DR5A 4OQFA 4HH1A 4YP7A 3TZCA 1TK8A 2WTUA 3VYRB 3IDOA 3C7DB 3PP8A 2GKSA 3Q12A 2EG2A 3RVRA 1T6NA 1TM2A 3OHSX 1J09A 4FR5A 3WSVA 2P2SA 1P2DA 5LQNA 1WRBA 4LRCA 3U6KA 3AF3A 4JL6A 1FUIA 3DLHA 1UZUA 2QTZA 3D6TB 4OMUA 2BFNA 5KAMA 3KLGB 5CHCB 3QRRA 4W5NA 1X9IA 1OQAA 1E2EA 3HJVA 4RW7B 4QNNA 2ASLA 7ABPA 3OF5A 3A7DA 1QV6A 4DGSA 3AJDA 3WNDA 4CE6A 1HBUA 2PIIA 3Q11A 1P9RA 4PQAA 4WRRA 1X4HA 3CF2A 2D0DA 4Z4IA 5JXJA 1C3JA 4QUJA 3ESRA 5A2QY 3PDNA 3SJBA 2Z3VA 1MVLA 4Y7DA 1XMOF 1HDZA 4CM2A 4HWTA 1Z1ZA 1TPZA 3EF1A 1FUYB 4USMA 2FVPA 4JI6B 2YXLA 2IYRA 2JOQA 1G6BA 1X74A 3PFHA 4LQLA 4OI6A 3C7KA 2NP6A 3U9LA 2IDEA 2C9OA 3PYXA 3SXLA 3V4RA 1G5PA 5HJ7A 4JLNA 1W49A 3ETOA 4DIMA 4ICIA 1OI7A 4EVRA 4FOPA 2NUTA 2OK7A 2GBLA 5KTNA 1KWKA 5K09A 3GV5B 3T6BA 3KZVA 3PITA 3I1YA 4CKCB 2ZS7A 1LUAA 5T8KC 2DOKA 5D84A 3M32B 2FQQB 3W6OA 2F4VJ 3MUFA 2KI2A 2HHSA 4A8MP 1L7QA 4Z9BA 4Q1EA 5FI0B 4X1IA 1TCUA 5ALDA 4KHMA 2IAJA 1WUKS 2B25A 1Q15A 1L0BA 5KFHA 3AEXA 2OGSA 5BNWA 3OZWA 3Q7TA 2IP2A 4M46A 2RRBA 3X2FA 2QRVB 1K6XA 4J9OA 5DZSA 4FP9A 1FYEA 4ZIRB 3CX3A 2OO5A 3NCHA 3IP5A 3WMRA 3WIEA 5KYUB 4FBUA 2NS1B 1YQTA 3RUFA 1YZ6A 3WICA 2I2FA 3GJRA 3QELA 4KBIA 4XB2A 2VG7A 3C16C 2D1RA