3ENVA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
217
structure length
217
Chain Sequence
TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 61
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3envA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3envA01
3O1LA 1CD5A 3OFGA 3BXEA 3AAWB 1HOTA 1U8SA 1RWUA 3DHXA 4GO7X 2PA3A 2RI1A 2J0EA 2QRRA 1ZPVA 5FIIA 2DT9A 2JOQA 5IT4A 5IT0A 3EFBA 2NYIA 1LK5A 2QMWA 3IBWA 2RE1A 3MAHA 3NRBA 5HJ5A 2I9SA 3DDNA 4GMKA 1FS6A 3OFHA 1M0SA 3MTJA 3NZEA 2R5FA 3CEDA 5IS2A 2RQMA 1JT9A 2O0MA 2RQKA 3HHEA 2H9ZA 1FRZA 2QMXA 3AB2B 3LUYA 2FGCA 3E15A 1UJ6A 4LUBA 4TM8A 4L4YA 3DC2A 2F1FA 4NMLA 3OFFA 1FS5A 3BXGA 3BXFA 2J0WA 2KO1A 1PSDA 1UJ4A 3ENVA 3UW1A 4GO1A 1LK7A 4L51A 3MWBA 2ZHOA 2P9CA 1VL1A 4L5IA 3HN6A 4L4ZA 3OFEA 4X84A 4M8LA 1DEAA 1XTZA 2J0XA 3OC6A 3IXQA 2RI0A 2QSWA 4GO5X 1SC6A 1LKZA 2CDQA 3AB4B 2WU1A 3CSSA 4R7TA 3S1TA 1NE7A 1HORA 3TUJC 3K5PA 3W7BA 5JJBA 1FQOA 3KV1A 3U7JA 3LWDA 1UJ5A 2P9EA 3TUZC 1O8BA 1KS2A 2LVWA 3TX2A 2GNPA 4L50A 4IO1A 2BKXA 3ICOA 3KWMA 2MDAA 4OQQA 1Y7PA 1Y89A 3BXHA 2DTJA 4L5JA 3ENWA 4PWUA 4R9NA 3OBIA 3EB9A 4OQPA 5T41A 2PC6A 1FSFA 3N0VA 2F8MA 3LOUA 1YBAA 3LHIA 3NWPA 2OKGA 3P96A 2BKVA 4TM7A 3CH7A 3L7OA 2P9GA 3ENQA 1PBTA 3E7FA 2JHEA 3TUIC 1YGYA 3DHWC 2W48A 2LQJA
chains in the Genus database with same CATH superfamily
2VHTA 4X8LA 4QUHA 4XVCA 4LNHA 5JNSA 5ITVA 3HC7A 1JEQB 2ADBA 3U6BA 1DJPA 2XWSA 1ZC3A 2VFUA 3T1OA 2I7VA 1XEWY 5DHAA 1F2DA 1TGYA 3ZY6A 1XBTA 2Q2OA 1CDZA 3K31A 1RTJB 2BQRA 3Q4GA 5LZ2A 4LPSA 1V6HA 4MP3A 5D77A 3RB8A 3KHUA 4G5SA 1UT8A 1VA5A 1KY4A 2J3QA 5ER6A 5AHOA 3Q2OA 1KEZA 2LV8A 3OKPA 1N6QA 3D3NA 3LECA 3RUIA 4PAAA 2O8FA 1P2UA 4OBEA 1U28C 2E9ZA 3AHFA 1HQKA 1QF9A 1M2WA 4I1UA 1S6UA 2PH1A 3KKPA 3WQRA 2CQGA 1QK5A 1VYHA 2V3WA 5BWLA 4FMBB 2R8PA 4U95A 2IUSA 2IU4A 2GPAA 4Z99A 4OQQA 3B5IA 2NN3C 3E48A 4CRWB 3GLKA 4R9NA 5JS8A 2NVBA 1GEHA 2IHUA 4Q4AB 3OT5A 3SSOA 4F60A 3KKFA 5DMXA 1P17A 2VPZB 1DIOB 4RVNA 5JJIA 2O8CA 1ZUWA 4K4VA 8ATCB 3NHZA 1FCJA 3R6TA 4BU1A 5BN5A 4DJBA 4OGFA 3SXLA 3P9PA 3IP6A 3FFWA 3G0OA 3LP2B 4Z1OA 1PTKA 1IQRA 1Y5IA 2P9HA 3WGVA 5ERXA 1I4DD 1WKLA 3IGNA 1JNXX 2GZOA 2YUTA 1EIYB 2OMOA 1MSWD 3LH5A 2PZJA 1J06A 2XVZA 5KYTA 1KETA 1XG5A 1KQFB 3UFBA 3JQRA 4BFTA 3ICVA 4OAQA 4D2IA 2IITA 2Q2VA 3PYXA 2X1MA 4IKOA 5ADVA 2R3SA 4RACA 3ZDCA 4ZYWA 2B4QA 4HDHA 3T5KA 3ZU3A 2IBTA 3R8XA 4GC5A 3ZDFA 3KYIB 2REQA 3TNFA 4EJ0A 3TOSA 3ZWMA 3CC4S 1GZDA 3TEFA 3EF1A 4JGBA 1FJ2A 5LL6d 3MD0A 4QIFA 2PVPA 2FSGA 4KYTA 4GOND 2WIGA 1L7RA 3MD9A 1AYEA 4YV2A 1X5SA 3W8EA 4KLRA 2G9RA 3KKMA 3JYPA 2OGTA 4HWOA 3T3DA 3D64A 4K9LA 3MAGA 1H6KX 2O8EB 3W34A 5A03A 4B1FA 3LCRA 3T1HB 3MHTA 4FF4A 4Y0VA 4W4MA 4TYAA 4M94A 2VSQA 3EG9B 2N3LA 4TTQA 1DQYA 5FQNA 2V5VA 3QO9B 5LMZA 1GG2A 3OTBA 4DL5A 1RWWA 5FBWB 4W92B 4C0KA 3R9IA 3L0BA 1WKVA 2VC0A 2I7CA 3PR5B 3E5RA 2HIYA 2QTVA 1YDLA 1VC0A 1ZOPA 1MOSA 1TM1E 3RUCA 1D04A 2AJ8A 3IQIX 2IAJB 2VEDA 4K8OA 4UDOA 4J2HA 4LFCJ 2MYUA 5EKDA 1SJRA 5T4BA 4AUKA 1NBAA 2RJ3A 1YRAA 2VG8A 1R0XA 1R0AA 2DHCA 4GKVA 3IC1A 3UCXA 3BIWA 2P1ZA 3G7NA 1H3FA 4ZMRA 2RB4A 1NOJA 1VQ7S 3WL7A 1OIVA 3CLUD 2JJ1A 1JAZA 3RGWS 1LDEA 2XSJB 2KT5A 2HPHA 1FJEB 3I6MA 4U9HS 2N3ZA 2BA9A 1LPSA 3SYNA 4DM4A 4COKA 4RHEA 3PJ9A 1MC8A 1ODKA 1IEVA 4FZVA 3LT4A 3A6FA 3CJQA 4I2QB 4FZRA 1B2RA 3SQMA 1YONA 5B4UA 2NO6A 2W2MA 3TLEA 5THXA 4A2CA 1PEYA 3DOMB 1ZIOA 4EVRA 5B1HA 3BBPA 1UEIA 4FFWA 3QX3A 4GXQA 5M5BA 2IXAA 5E9AA 3ZNOA 1GUBA 3K53A 2O52A 3NKYA 4X62F 3SBDA 4CIBA 5I7FA 1RBYA 2Q3JA 1FMJA 2WTXA 1RYDA 1RP5A 3RG6A 1TAGA 3KB6A 2BOVA 3PEHA 2QLFB 5BR8F 2HGZA 2JH3A 4P1ZA 4M87A 3IRVA 3IEMA 1IBLF 1WG8A 3AOEC 5CVJA 1ZA1A 3H5NA 3HU2A 4B85A 3GLFE 4D57A 1T9BA 3C16A 1IBKJ 4WL0A 1VMIA 1G1AA 1ZD8A 2W24A 4R9RA 5KFBA 2XYGA 3VTZA 2DH9A 4BVEA 1W93A 1YZFA 3DGPA 3GNSA 1SUQB 3CC7S 4FHFA 4ELUA 3BA1A 1J2RA 1AKQA 2PO4A 4KGXB 1YR3A 4JC0A 3KHKA 1RMTA 2RHDA 5TF0A 2F4NA 4K9QA 3GCWA 3VOTA 3KSZO 4IS2A 4XIUA 5D3KA 4X94A 4D02A 5DB4A 1D8ZA 1V6CA 2CJXB 4C7XA 1JX6A 3QE0A 3TDNA 2WPDD 5G0UA 4MYTA 3NT4A 2UUAF 4PS1A 1W4LA 3W6PA 5B6JA 1NJ6A 2JHGA 1FX4A 3MJSA 1PAUA 5GVSA 2JATA 2VJKA 3F4KA 1U3DA 1SIWA 2MQNA 1GPYA 4NE9A 2F8HA 2IS6A 3MCTA 5BMOA 2UU9B 1WCV1 1JEQA 2F00A 5EP1A 2P6OA 4C7KA 4IZOA 4P7GA 2V6BA 4D9BA 1YVPA 5FDLB 1GV0A 1HBMA 1RCOB 1NA5A 4G2NA 4ZMBA 1U4BA 4FW9A 1T8PA 4C3VA 3QF4A 4TS1A 4DCGA 1LBHA 2Q8QA 3GC6A 3BSSA 2PT7A 2R96A 5C8DA 3OCYA 5KFEA 4Z7NB 3OZRA 2GYVA 1BX0A 2YNHB 4EGQA 2B7BB 3OOHA 1TEVA 3FMOB 1SKAA 2HNYB 2VDRB 3EMVA 13PKA 4BP8A 1U1EA 3E9YA 2Z30B 1Y9ZA 1VJ0A 3A3PA 4JODA 1RYZA 5DYTA 2ZE5A 5KO2A 3G23A 2H1WA 4NE7A 5D6GA 4V02A 3PX6A 3H05A 1CKEA 1U4OA 1KO4A 2AWNA 3V8BA 4PG7A 3JD2A 1N54B 3RFUA 3PUXA 2J4FA 2JLEA 3GYNA 3ZK8A 3UAZA 4ENUA 1LSOA 4ZLLA 4CR8A 3DO8A 3QNWB 3BMQA 5I47A 4X7RA 1YJWS 1TI7A 3TJ8A 2QWXA 3RRBA 1Y6RA 3RSLA 1M6VB 1LLQA 4D3DA 4U5XA 4BQOA 3IE1A 4PTLA 2AXEA 2JRSA 3IIIA 1O6BA 1E2EA 1ZUIA 2WUEA 1R8XA 2D74A 4H4DA 5K6RA 2EFDB 1WSVA 3IP1A 2QGFA 1E69A 3DHVA 4CXMA 2DR8A 1S4EA 1DAGA 2VQDA 4LECA 1JNRB 1U0HC 4FNGA 1ULBA 4IEIA 3DZIA 3DXXA 1NVBA 821PA 2EXUA 3QT6A 5FHRA 1KSGA 1QF6A 3VSCA 2HSEB 2VFRA 1QTIA 4UBNA 4CEHA 4R8MA 2J76E 1ZCZA 3V5NA 1ZJJA 4V1Ak 2FAXA 1Q1EA 2P3SA 3OPYA 1YRTA 4CN9A 4CN8A 3D1HA 5J4HA 1M1GA 1W76A 4HAYA 5KG2A 1RLCL 2FSFA 5D51S 4P22A 5FUYA 5JI2E 3OO1A 1H5QA 1NRKA 1NZAA 2W2OP 2XOXA 1H1TA 2QTCA 1Q6YA 2V8PA 1U8WA 2YW9A 2AMLA 2CKDA 1HWJA 3EQ2A 1X42A 4O4IB 4CMHA 4QDZA 2H6EA 4Q7LA 1JZSA 3AHJA 1U1RA 2ZJZA 3SXJA 4C6RA 1OCEA 4ITVA 2R7KA 4OZJA 3QYJA 3HU1A 1CG2A 5I9TA 1T5LA 4DX7A 3CYFA 1CY4A 4KN6A 1YZNA 4MUGA 4JV0A 1SCUA 2NVOA 3Q8SB 2GHQA 4W6ZA 5TGZA 1R74A 1LVUA 3W64A 2BUAA 1E6KA 2FSSA 4LMRA 3KG1A 3TA0A 2LEBA 4WVFA 4WTYA 3LQ2A 2W4MA 1RR6A 2PWZA 3G2PA 5CVEA 1DB3A 2Q5CA 4BMNA 5IM4A 2HT1A 4K28A 3TQTA 1GSIA 3FSGA 3PDNA 3P45B 3HB7A 1GZUA 1VLMA 4QATA 3DI6A 3QG1A 5AI5A 1Y63A 2R7QA 4QUAA 1B0ZA 1UFVA 1B3TA 2Q5HA 2KM1A 3CH4B 4RV4A 2C31A 1ZZNA 1LWNA 1Z37A 2QD4A 5K9FA 4O44A 1XR7A 4RFSB 1HW9A 4P73A 2YWJA 4JI3J 4DR6B 3QVWA 4YEAA 4EQZA 3TI7A 1TZMA 5EVCA 4LYEA 4Y6SA 3U60B 5JMTA 4B3OB 1VQLS 4CEIA 3K9BA 1C4KA 3W5CA 1THMA 2FGCA 1NKEA 2Q9UA 5CHYA 3T9ZA 1EDBA 1AKTA 1S2NA 4B6EA 4DN9A 5DJBA 3GLHE 2Z9DA 3IDAA 5MF6A 3Q3CA 3TRKA 3OOSA 1PBNA 5I4CA 3K1JA 2RMLA 2VF7A 4A5OA 1WMEA 1SK8A 1N5QA 4MUMA 1M10A 4M5NA 2PZEA 4CM7A 4F4AA 3WSVA 1S2MA 1XQXA 3E82A 3KFXA 3ETDA 3Q8KA 3ANSA 1VLOA 1R0YA 3QIPB 2FFQA 4RZ2A 5DW0A 2XX3A 4IDOA 3CCTA 3SM9A 2XM3A 4HNVA 2JGDB 1LC3A 1GR1A 1W1IA 4B2IA 4RTOA 4A7PA 4AUMA 3S28A 2OFWA 3QVUA 1ZRMA 2QGFB 5JAPA 3S2GA 3HJHA 2A2DA 2ZFHA 2CSXA 4RHXA 1KDTA 1WI8A 3DBIA 4OHBA 1ZCJA 4PEOA 4KHMA 2QA1A 3DDCA 3LCMA 4NBLA 3GLGB 2GNOA 3SX2A 4J2OA 4I6WA 2P8SA 3AMVA 4F71A 2CLHB 3UQZA 1KQNA 2YS7A 1UJ6A 4Q7QA 4TYYA 3DO5A 1XTBA 2J9FB 1G20B 4C0BA 4A8JA 4GT1A 1JA0A 2WF5A 4MH8A 4S0MA 5JRZA 2QKYA 4UU0A 1W0JD 2OOSA 2YHBA 3EAGA 2R8KA 4M83A 1B0AA 2AJTA 3TRFA 2OQ2A 4TLAA 2CQ4A 2HGNA 1PX0A 3G9XA 3PHBE 4KLNA 2HYIB 3A1FA 5B4TA 2WSBA 2P6NA 4DEYA 4E5DA 3Q3VA 3BGOS 4WA8A 4MUFA 4XGQA 4IO1A 3L7JA 2LE0A 4H7KA 4CKYA 1JIJA 5IOLA 4MFBA 5K3EA 3W3AA 3BDPA 1K6XA 1C3OB 3BJEA 2XZTA 3T34A 1RWXA 1TAUA 4BJHB 2QA2A 3DRXA 1DV1A 3K8YA 4S24A 2GC8A 2N9UA 4ITRC 1G8JA 1XZQA 4MKGA 3RBAA 5CYJA 4MRSA 1K9MT 1NULA 4HGOA 4NMWA 5LYJF 3SICE 4KWHA 4G37A 3L7CA 5GQSA 4OHCA 2HD4A 3LVRE 4ECUA 1U1PA 4KAFA 3K2EA 5KOHA 1V3QE 4ZC1A 5HJ5A 1C0EA 1P0FA 1NMXA 2BQ3A 2OV6A 3FG9A 5KYVA 3HL4A 3MM5B 1ZM7A 4MQBA 2J09A 2J9CA 1UMCA 2QN9A 5KYXB 2BR3A 2PL9A 1G7SA 5LDGA 4F4WA 2A30A 2HTEA 3R5AA 1XLVA 4WOBA 2WJZB 3TW8B 2HLDD 2Z8YM 4DR5B 2Q0XA 3W61A 4X84A 2QRMA 4GBJA 1QUPA 5JZ9A 4AL6A 2ASEA 3O8BA 3KG0A 2IE0A 1DG3A 1HPZA 1AA6A 1KJZA 4WH0A 1U1CA 4F38A 5B57C 5AO9A 1WC0A 3PUHA 1FLVA 3QUSA 1YUBA 1UWLA 4C6HA 1QSSA 2IA6A 7REQA 4HLBA 4D9HA 4C4XA 4E6EA 4USIA 3BK7A 1AY0A 2EC5A 1N36J 2QUZA 3NVAA 2J0UB 3ZHBA 2EGGA 2BTQB 3AF6A 2FG7C 4ZKDA 4DCVA 2E1PA 3MTKA 1E8NA 1S4FA 4B3RJ 3H5SA 4LIRA 1DBIA 2K5UA 1QIHA 1CZOA 4HQ0A 1G6OA 4COOA 1E89A 4IOMA 4BWFB 1FEZA 3K0AB 4BRUA 1P1FA 4PLVA 2XOKD 3CVJA 1H2AS 3W6NA 5DNYB 1G1XA 2NCKL 5MFZA 1JIVA 1YJRA 3IUSA 4HG2A 4Q0MA 3GFVA 1UIMA 2ZRHA 3DV0A 1KMCA 1IAVA 1SRRA 2XECA 4YFVA 3NH6A 4C14A 1HNZB 2F1IA 1AUPA 3WBKA 4FR0A 2RILA 1ZD3A 1ZK1A 2E5WA 3CLRC 3DOKA 1J0CA 1RKUA 4FDAA 2VP4A 3V8VA 3DLEA 1L2TA 3C6BA 3L7IA 1J9EA 1RT6B 3UMYA 1I4TD 1DU4A 2YH0A 4OLFA 1T36A 4IOKA 2OBMA 4Y3UA 2VG7A 5DOVA 2IYPA 2FP4B 3PW0A 4R4JA 4V3CA 4IIJA 3RQIA 2VC1A 3DE7X 1UK6A 2WSSA 1T7PA 4C0QC 3L0DA 1YHNA 2VQEJ 3LRTA 4XXHA 3QQPA 1ZJ4A 2UUBF 3KHSA 1SJFA 2CHEA 4Y0AA 1OREA 3DJYA 4HR2A 3CVXA 5AKZA 3ZJ4A 4LN1A 2EWVA 3W9UA 3WQHA 1ILEA 5IDVA 5ETRA 1SXQA 2HAIA 1UVKA 1GGNA 1BMQA 4MRVA 1EFPA 4C5AA 4LUBA 2HZCA 2GDJA 3D9BA 1NSPA 3GYBA 4ZZIA 2ZDQA 3AI3A 4UKDA 3C66A 2QUHA 1RBMA 3EC2A 4BAGA 4OKSA 3T19A 1OXKB 2Z95A 5IN4A 1IEXA 4U3JA 5LQMA 1ZHOA 3FQKA 1F3OA 3KJQA 4UPDA 4TMFA 3KTDA 4Y2SA 1XXLA 5JQGA 3Q3EA 5L1JA 5FV7A 3TD2A 4Y1RB 2FN3A 2H51B 2FR1A 4AX4A 4QW9A 5AHKA 4DBLE 3C3JA 2C1XA 4ZT3A 1VP9A 3RAQA 1XJ5A 4YJKA 4OQLA 2H7VA 4DR3J 3F74A 4B7ZA 3KNZA 1XU9A 4XIJA 3PV0A 1E3SA 1DG9A 1EP4B 2H2IA 4LF4B 3W5ZA 4ED2A 4ZN3A 3TXXA 5F8GA 2BMFA 1DWUA 1GZ5A 1WOPA 3SF8A 4XCXA 4OBWA 3ORFA 3E23A 1DBVO 1CRLA 2RIJA 4S05A 1RAHB 1EDEA 1A8HA 1T9GR 3OZVA 5KBYA 4QIGA 1FMTA 2QTGA 2I5PO 3OXFA 3ROFA 4WCDA 3HCAA 3OETA 1R9GA 4ZJLA 3NQ41 4R68A 5KX5B 2WABA 1ZMBA 5L1KA 4N7BA 1JEOA 4IVQA 3PHGA 1MU0A 4FZ5A 2HAEA 1DRJA 2BABA 1RHQB 3KLNA 5CLLA 2C29D 2ZUEA 4C3KA 1EEHA 4Q4HB 5FOTA 3DLGA 2OGWA 3FZNA 4O2AF 1YQWA 2YFYA 4J9MA 1YRXA 4CTAB 2ORIA 4HS4A 2QJRA 3LT5A 3EN0A 4KQMA 2XWQA 1YZHA 3LU1A 4G8DA 4M9CA 4HXEB 2X1GA 5KSOA 2OCPA 3ROZA 4I9NA 2BFNA 1RHKB 1Q2UA 1O95D 1TA4A 1FYXA 3M4NA 2OXIA 4JC5A 4AQ7A 2EHDA 4FIZA 5KHOC 1RXWA 3X3HA 2ZE6A 3VSAA 4E12A 5L38A 1E7WA 2WW8A 3UXYA 5DXJA 2XI2A 4EB6A 3MOIA 1QZ3A 3MWGA 4PUOA 1F2UA 1T3SA 1JKJB 3QXCA 3OEHA 2ZJOA 2WU1A 3SZOA 3VMFA 5HZMA 1XLTA 1V35A 2ZH7A 1IL0A 4X24A 2A9QA 1IQ0A 2N7YA 2VKQA 1MRNA 2BJWA 3G5TA 5TY0A 2BRUC 3DYAB 4P7KA 3BX1A 4D79A 2V7UA 5HMXA 3RD5A 3ZLVA 1NRXA 4Q82A 2CVQA 4AIRA 3IAUA 4B3SB 5J4VA 4DV2J 4YRGA 4IFYA 3ZE7A 1RWOA 3W5JA 3O94A 3L7YA 4YREA 4FI3C 1HSZA 3IAEA 2ROEA 2B61A 3EDOA 5ETTA 3L7DA 3F9CA 2WM3A 2YTCA 3JTPA 4MAMA 1HFJA 1NZFA 3V8QA 2SKEA 3S29A 1AVTA 3DBLA 4UZEA 3FCHA 1VR6A 3PJWA 1OU4A 3EW7A 5JQGF 2H06A 1G60A 2PV7A 4OD0A 2NV6A 4DWOA 2ZH3A 4QJ4A 1I2DA 1HNWF 1NNUA 1DAKA 3MFHA 1GPJA 2IIVA 3JQKA 2AB0A 2A5GA 2QYOA 1YBTA 5CT4A 4QA9A 2HK8A 2ZREA 3W4KA 4GI2A 4ZOLF 4ZO9A 3VKUA 3A4NA 1Q6ZA 2BHSA 4FCWA 1XEZA 4RJJA 4PXAA 4OQPA 1E3DA 4TN1A 4F1WA 3U56A 4JLNA 3BO2A 4M21A 2QRLA 4DUPA 3EXHB 3MCAA 4E2ZA 5CLGA 3GCXA 4F0MA 1YJUA 3OL8A 3L0PA 2MB0B 4RTMA 2H1SA 1D0SA 3BMOB 3CDAA 1WHSB 5CCBA 2VJQA 1EHWA 3U62A 3W9HA 2W43A 2PGLA 4QPPA 5BQPA 1EK1A 3M2RB 3EMTA 2KB2A 1WEXA 3AXKA 2X8JB 5IT9U 3CC8A 2H4WB 4YMSA 1A5AB 2DQYA 4XB6B 1E4EB 4HX2A 2DRBA 1RKQA 3KQQA 5DVZA 1RLOA 4QAJA 2BSQA 1U1KA 1NJWA 3HKEA 2ENWA 1ORDA 4QJBA 3IT3A 4ARUA 5HCNA 3RRJA 3H16A 4AL4A 2VT2A 2Q79A 4ZVPA 1CQJA 4LR9A 1YQ9A 4JHXA 5AW0A 2BW0A 2D8AA 2A5LA 2FR0A 4KNWA 1CR1A 2CHQA 4X4UA 3U9TA 1YF3A 4Q1CA 5I4MA 1T94A 2GN1A 3OZUA 2X3YA 4WCFC 1C9KA 4TSFA 1BCRA 5L3QA 2HFNA 1N36B 1PR4A 3V4VB 5E3AA 1S6PB 1RT5A 2B3TB 1V7ZA 4Y9UA 2W93A 1F7UA 421PA 3QZUA 1UMDB 3WGKA 3O31A 3MK31 5AVUA 1WELA 2AG8A 4DR5J 1IEWA 4US0R 1ISHA 2P0AA 2R6AA 2XS5A 3PGKA 4JWTA 4B3MB 1COWD 4PPGA 5D0EA 2J3JA 4YJHB 3DOKB 5RUBA 2IXBA 3BZUA 3ZGVA 4ZS6A 3OPNA 3A4LA 5IDXA 1R0WA 2J9FA 2V7PA 2SKDA 1ZBTA 3I1JA 4Z53A 4RNFA 5B7WA 3VNRA 2EWMA 4Z7JA 1SCJB 4U8VA 2ZRIA 1MLDA 3IT1A 1L8OA 4WKGA 2BJDA 1KXZA 4GZ3A 1ZKMA 2HJHA 1SL0A 1LPNA 3ECAA 4ZCTA 3M82A 5AVXA 4L78A 4DC0A 3OVMA 1CIPA 3CS3A 2WF8A 3H5AA 4ODIA 4XJTA 6FDRA 3VHLB 3B70A 2XDQA 4JI6F 1JMTA 1JGTA 5K3BA 2BFOA 3I9V6 1U3VA 4B83A 3P26A 4TVOA 2H31A 3R3YA 4DZTA 2VHUA 1V7PC 1G5TA 2P0YA 1JXEA 1XBWA 2QORA 4UCFA 3FCVA 3U3RA 5IDWA 4RZXA 3IM8A 1UQUA 3VR0A 3UXEA 3WV4A 3B6JA 3JQPA 4Q8FA 1XR3A 4AS1A 5I5EA 4EKNB 3SCZA 1T2FA 4U2GA 3KALA 3H90A 3KSMA 5LMNB 3Q40A 4U5QA 1I3MA 2J9XB 5CTAA 2KXFA 4OJKA 2AOTA 1PZMA 1SBTA 2G6TA 3PC8A 1Q53A 3COJA 4DM3A 3WKBA 2EQBA 5ADZA 1T0PA 2PWAA 1BS1A 3VOAA 1CS4C 4NS1A 3RADC 1KP9A 1N2SA 3AXTA 4YY3B 3MEGA 1RBOB 5KYXA 4OV1A 2CF6A 5EE9A 1TGVA 1YQXA 5EMLA 3UWTA 2VJVA 3QUAA 5EP3A 4X4TA 5H1YA 3KTQA 3B7WA 2OMEA 2PS0A 3A3NA 4N5MA 5KU1A 1GYQA 2V7QD 1USIA 3D8NA 5DBEX 3WTBA 4JA0A 4O3FA 3F5QA 3C3WA 1CJVB 2XF8A 1KMQA 2SICE 4ZU3A 4A4DA 3BEGB 2ET6A 2F2TA 1PQWA 2IF0A 1X7XB 4O4GB 1CEEA 4MUNA 1GQYA 1YS9A 1TC2A 4ZEVA 2PKQP 2AUMA 1HL3A 3B13B 3KQVA 2XRMA 4U8YA 3A4YA 1KTVA 3S2IA 4R0MA 2FSPA 4EL0A 4F8RA 2V7QA 4P80A 5BR1A 1VIOA 2C4NA 3ZOKA 3JQ9C 4ZVRB 1EKRA 2ACYA 2DJ5A 2ZU0C 3SDEA 5L46A 2PMFA 4D82A 4ANEA 3EIXA 521PA 5GONB 3OL9A 1CUWA 3GRCA 1SD1A 3OFEA 2O7NA 1FUYB 3JCZA 4A8YA 2FW6A 1VDMA 4TY8A 4MKIA 1YWGO 2DLDA 4PYIA 1LPMA 1AO3A 2DQ4A 2YN4A 3L8HA 2WHRA 4RPHA 2NSJA 3E51A 1ZNWA 4X4OA 2UP1A 3CISA 4W9RA 3V8RA 4ZV4A 3HDJA 3DLKB 3HX9A 2NUUG 1YDFA 1ZD2P 2HNDB 1NKVA 4Z54A 2BGWA 2FJDB 5ED4A 1HLWA 5CFZA 4NXNJ 5BYBA 2B6HA 1OX4A 3H5IA 3R6LA 4MYDA 1J90A 4DV1J 2HMAA 4DL9A 2AW5A 4V0ME 3TJ9A 5IULC 4PF1A 1E1CA 1IN7A 1YJTA 3P9RA 5IMBA 2DCUA 3N4WA 3NDPA 1POXA 4EIWA 2POQX 4CM6A 3HMKA 1DTWB 2Y1CA 2R8ZA 1S97A 1UFQA 4IJMA 4CM1A 4B76A 4PY2A 4WW0A 2DHRA 3OUYB 1OI2A 2P41A 3N5BA 1G64A 5F12A 1EB8A 2WWHA 1JWLA 3EVOA 4U6SA 1PIEA 1OV4A 4RNMA 1P4RA 4H6WA 1TO6A 2M52A 1FY2A 5KTPA 1USKA 3IGVA 1I5RA 4XD7D 2NZ8A 3TIVA 1B6RA 5IYZA 1IZZA 2BEWA 3L05A 3TQFA 2XA9A 3RWBA 4HYKA 3FLMA 5DXAA 4IQ4A 1EHCA 1F7VA 3VZSA 5JVDB 4KPUB 3KLVA 2X77A 4NFHA 1IVSA 3H2ZA 4GM4A 1TQ4A 5K0LA 3UM9A 5ELMA 5SYMA 3OF2A 1A3CA 1FNBA 3C1TA 5HJ7A 2KJVA 1T9HA 1WD5A 2ZRFA 3ANLA 5LM3A 5D6OA 4KSBA 2K7KA 3N6NA 4TRJA 3SQWA 4PFJA 1H6DA 3LJKA 2VV5A 1RZVA 1RDRA 3MA0A 3D0OA 1QZUA 1VI5A 5CHEA 4HAVA 3RSFA 3BE4A 3O3OB 2X22A 1FNCA 3NGMA 4L6V3 2HK3A 4AYXA 1XWIA 1J9ZA 1MW8X 4KIUA 2PIIA 4PXDA 4FYPA 4L3VA 2PD3A 2LTAA 1KAHA 3L84A 4NCIA 5DGHA 4FDMA 1HPLA 2D0OB 1GQSA 1AX9A 2V2ZA 2VHCA 1WEZA 3ZW8A 1XNQJ 1ZM2A 1XMSA 3G0IA 2EPIA 2LCQA 1GT6A 4J0JA 4ADSG 5JASA 3H4MA 4XA8A 4RXTA 2C2ZA 1NK0A 2GF0A 1KO7A 1UK7A 2CQBA 4A8PA 1A98A 1NW6A 2D62A 2OILA 5FH9A 4HCJA 4X6YA 2CJQA 2Z2MA 4CMCA 4XOUA 2I2DA 2WT8A 1PKUA 4DV7F 3HA5A 2GBLA 3LUCA 2NLWA 5CA1A 3GX1A 1ONSA 1C5KA 4BZPA 1ZHFA 4QU8A 1AOXA 3NC1C 4H4OB 1WUYA 1VI7A 3C14A 4V3BA 3DMJB 5E6SB 2DUUA 1Q22A 1FSSA 1ML4A 3ZDAA 4URWR 4G5YA 4X66B 8OHMA 1FPQA 1OSNA 3JYHA 5G1PA 3V4PB 4M7PA 3GGDA 1K4KA 1OXBB 4LG1A 4BLPA 1UDCA 1YJVA 5D3QA 3K71B 3HYLA 2E5LF 4X8OA 3E58A 3OO0A 3GRZA 1C1BA 2PZKA 1A27A 2IEIA 3Q0TA 4MUHA 3PUIA 4JB8B 2AC4A 1XLUA 4PX5A 3H5LA 4OF4A 3DLAA 5CZVA 1KKUA 1T6ZA 2FZVA 4FF1A 2NU6B 3UT0A 1P74A 2ZUSA 3BF4A 2Q6TA 2HV9A 5E2AA 2DGDA 2LA4A 2OFOA 3MBIA 3MMXA 3PXCX 2BEKA 3AINA 3K9HA 4W1QA 3ERCA 3V3KA 2ZH1A 2WKSA 2CDAA 2GLXA 3BH0A 1HK7A 2ZT7A 1EX9A 4UCXA 3EF3A 2DITA 1NEEA 3PD7A 2E4UA 3B53X 3NHAA 5I4IA 1V4NA 3ZVLA 4X61A 3DA8A 3QP9A 2WUGA 1H0RA 2HX1A 1KPHA 1IKWB 3LP8A 4RANA 4S0ZA 1LVHA 5KG5A 1NPKA 4JI6B 3IPLA 3N2NA 3TOXA 5CIYA 1N3IA 4GPAA 2DQKA 4FOSA 4C9DA 2JS7A 3OQVA 2FPGA 3TUJC 1N5MA 1GU1A 3DKPA 2VCHA 4E7PA 4PFKA 1I7QB 3LA6A 3IPCA 4NDAA 5E3JA 1OBCA 4FPIA 4YS2A 1GXSB 3NGUA 4MWSA 5IAKA 4CKWA 4CHGA 4FLEA 4MR8A 3AOBA 1TNDA 1NQAO 4NLXA 1OW3B 3QLEA 1DQ9A 1VYTA 3N8GA 4QTZA 1RPTA 4QRDA 2HTFA 5ARBA 5CGQB 4R8UA 2XR1A 1E1CB 3TBKA 4W5TA 1Q50A 2W6ZA 3S1AB 2B6AA 1MAWA 2OHXA 2HOQA 3G6WA 5E8JA 1EVEA 3TG8A 2CYBA 3MINA 1MH1A 2BHTA 2NQ8A 1GITA 1PR2A 2IYZA 1Y5NA 1EWVA 3K70B 1U0HA 3FHJA 4IYQA 4EB6B 3BKUA 4WBXC 1M8GA 2GWRA 4LNUB 3RS0A 3G5LA 3M2UA 2X1HA 2VD3A 1OZGA 4CQMD 1MRSA 3A1SA 4BB0A 3UE2A 4UVGA 3Q87B 1KVIA 3RTVA 2PWPA 2OWEA 3PHJA 3CCUS 3AO0B 3HR8A 4ECZA 4BGVA 2WD7B 3QT5A 1VE7A 1WCWA 1UBRS 4ND8A 3O8RA 4WKYA 1QVAA 2CVOA 1YS2X 1JFSA 2DR2A 2BMDA 2PJRA 2FKNA 1EVIA 4YX9A 1A5BB 3TTWA 2Z57A 1X7DA 1JQGA 2P9BA 4OHVA 3L8MA 2ZJ4A 3GAAA 6AT1A 4X66F 1MCZA 2AZMA 5PGMA 3B6BA 3LW8A 1SC3A 2YXPX 4D6YA 3THWA 1PJZA 1IHPA 4Z49A 3OQPA 4YAJA 3H6HA 4X41A 1PJ5A 3KQSA 5CFPA 3G9ZA 1A9XA 2DGQA 4RM3A 3KJFA 2PJDA 3NM5A 4MINA 2RNEA 4HYQA 4MZXA 1JHPA 4ZCLA 1AC5A 5HI7A 5ALIA 4YJFB 4M1YA 4JXJA 3O82A 4ZGWA 3BERA 3BTSA 4PC6A 2WAXA 4Z4HA 2E6KA 1EM6A 2HQ3A 5AE3A 1DTSA 3CXUA 1VC2A 3VHQA 2RHCA 3B6ZA 2B9VA 2WKPA 2DGSA 2ZT6A 3T95A 3B6KA 4URZR 4EGSA 4N8DA 3V6MA 5IC6A 3CIOA 1JI3A 5FLEX 4FYVA 2J67A 5EJ8A 4DM7A 3LW7A 3U7JA 3OXLA 2GPBA 2UXBB 4Q8EA 3QX8A 1WF1A 3HTXA 3ZXUB 1XVAA 2AIRB 2X0IA 1P3Y1 2HLPA 2J85A 1ZW1A 2VDKB 2GGPA 4KOAA 4K4ZA 3IP8A 1W1WA 2FZLA 4M98A 5AK4A 1VZ3A 1E2IA 3CZPA 1MDFA 2DNGA 3ASVA 4Y6LA 3K2BA 5AK0A 5AICA 2GJSA 3ZJTA 1WEHA 3SX4A 1SVUA 1BXGB 5DGDA 1MC5A 3OMXA 1P73A 1PR6A 2C78A 1M5PC 3SOZA 3FKQA 2PKXA 1UOPA 4MVJH 3AESB 3SU8A 4JJIA 1K7FB 2JFXA 2P2NA 1GTEA 1IU9A 2NUTB 1C2PA 1E64A 3N9UC 1NXSA 2SCUB 5AVSA 3N1UA 1NHUA 1PSWA 1PAEX 5JMPA 3I04M 3W0LB 4WU3A 3HBNA 1V16B 3L04A 3O4GA 4FSHA 4Z4FA 4DRXB 4FEAA 2FV8A 3BL5A 4BMXA 4O2AA 4KIWA 4AY4A 4UC0A 5JNUA 4FONA 2RS8A 1P45A 4PO3X 3AH8A 2YHSA 1KHWA 3I0NA 3BIJA 1RXOB 4HDAA 4ASUA 3DUWA 2OO7A 2YPYA 3SVTA 3AL3A 3KHGA 1U24A 1VXOA 1WL8A 3JRNA 3T5HA 4EI9A 4FGLA 2BFPA 3BZWA 3DPSA 3SC2A 3S2UA 2EW8A 1V95A 4ZTBA 4YRBA 3H04A 4D4MA 1RLDA 2QOEA 4P4TA 4E32A 3IQHX 3QWAA 4DHVA 3IESA 5LUAA 4IH9A 4PICA 1SUPA 3NRBA 1RE0A 1SHUX 3AEUB 1PVVA 4FGUA 3F97A 4UHCA 3IC5A 1D9DA 2ZUBA 4V0NA 3SFTA 3M30B 1UP6A 3W5IA 2Y0DA 4PNHA 3CN9A 3ZD7A 4PW0A 5ENVA 4NZYA 4O3SA 4EITA 2CZVC 1FXUA 4YRZA 1TZJA 1ULUA 1FESA 3JWJA 1KDPA 1WD7A 4FC6A 1CRZA 1EXNA 4FP9A 3MURP 4WX2B 2ZUTA 2R47A 1PL0A 1Y0BA 1TK3A 1R5JA 4G8BA 1KNZA 2XQCA 1M66A 2VFTA 1M3SA 1V3VA 2QX4A 3ZZTA 2WICA 2NYRA 4WN9B 2PBFA 1TTHA 5EKSA 4H6XA 2MR5A 3MLEA 3OQBA 4KI0A 5T4FA 1YI8A 3P1JA 3COVA 3AY7A 3BT7A 5G2OA 2E9TA 1RHJB 2H1FA 1C0KA 1CQMA 2E82A 1PGOA 3NUQA 1WMBA 4P2GA 3AFIA 2FE1A 5IAAA 4FFRA 3SQGB 4IEFB 3K7RA 4U7PB 2R7UA 3ESZA 2IYEA 5IM0A 2Y1EA 1A2OA 5BMVA 5I9LA 4E31A 4MQEA 1TKXB 3FVWA 4AZ3B 1VE1A 4ZIVA 3PD0A 1I33A 4JOBA 4KCGA 5HF5A 3A3KA 3CEHA 2WCXA 2ZUCA 1EBFA 3E4DA 5C1PA 1QLWA 1F6TA 3NNCA 3VX4A 3O83A 2FLKA 3DZFA 4TUYA 4HL6A 5JCZA 3BM7A 4I6YA 3UMFA 4R1TA 3E5HA 1PUJA 1VJTA 4HAXA 1W19A 2Q0SA 4ZU6X 2GD6A 1CTQA 3BKFA 2OEJA 2WFLB 3AHGA 5HBMB 1SB6A 5TGDA 1FDUA 3MSCA 1JLQA 4C8YA 2FQYA 1L5LA 3UJHA 4PPZA 4C1BA 4BP1A 3BAZA 3Q8RB 3DU5A 2I8LA 3N8HA 2F43A 5AKXA 3OAAD 4NFLA 3FEZA 1AZTA 2X5OA 2DH7A 3M8QB 2H8GA 4YLGA 1AUOA 3TEGA 5I7AA 3LRPA 3DS8A 4YWJA 5F3ZA 2I1WA 4E1BA 4CQJA 1RXUA 2Q41A 1BZYA 2AI2A 1S96A 1A4RA 5DDIP 5KFLA 3O1IC 3CCBA 1U2DA 1VL8A 4JJ7A 2WJPA 3PCRB 1Z2DA 2RIRA 3T3HA 5BSVA 1T5DX 1SH3A 1QD1A 1SKUB 2XNCA 2CPDA 3I76A 2RHOA 3MEKA 1CYEA 1JR3A 3ZI4A 2QLJB 3FWZA 1G8GA 1Y7TA 3FOEC 1YRWA 2ZH9A 3Q8QB 1UVIA 4E70A 5DNDA 2IM3A 2ISSD 3K0HA 1GQQA 3CW8X 2VZ9A 2F4VJ 1T2DA 1NR7A 4ICIA 3I6PA 4GLLA 5I45A 2DP4E 4L50A 3SI8A 4KGMA 3SLRA 3SSMA 1KFSA 4DW8A 2REXB 4WGGA 3AL2A 1JG6A 1N6QB 3LP2A 5EPEA 2WZCA 4JI2F 4M2LA 1DZ5A 2JCGA 3LOPA 3AR7A 4BX9A 5AW2A 3I32A 3CH7A 4ZYLA 4IQMA 3S1LA 1KMHA 4A0RA 2XXAA 3NNSA 7ABPA 2G1KA 1T8RA 2J5BA 2BX6A 1O58A 2ZVSA 4C88A 2DUJA 4M63A 3I05A 5IAEA 4RLFA 2BGIA 3V2UA 2BMVA 4DT1B 4GC6A 5FRDA 3PFNA 4F0HA 4HUTA 3EDMA 1WUIS 3V9PA 1YR8A 2D7JA 3JSXA 1SKBA 5JFOA 4CDIA 2O4CA 1QVWA 4GI3A 3QGMA 3QMMA 4DIOA 5COQA 4RDCA 2D4AA 3NG8A 2RGCA 3DF7A 5EZYA 3C7KA 4RTLA 4TU9A 2NTVA 5AJ3F 3AFGA 3ZD9A 4ABTA 2C2DA 1R6XA 4MPJA 4LK3A 1Z15A 1A9SA 3UGQA 4Z7QB 3OMWA 4UE6A 3CO9A 3HLYA 2OXRA 4XUEA 2BJ7A 1GRNA 1JDSA 1M1KT 3CD5A 5DHRA 4XGNA 2J5KA 4XLTA 3T5BA 2DYKA 1SVLA 3KB8A 2ZKIA 1O87A 3CPJB 1L5MA 1XZGA 4RF4A 1Y5IB 2XY7A 4KG7A 3H9EO 4FNHA 2IHBA 1Z12A 2KRBA 1OC4A 4DBLC 1YHYA 1XEAA 4QARA 5KYYA 2FPUA 3EDQA 1NJ8A 1PQ4A 5E7QA 1P7PA 2OP1A 1CF9A 1GRVA 3HCPA 1WNEA 2GUGA 1KL7A 3EY4A 3O4HA 4DQDA 1LZKA 4ZCKA 4QYIA 2JIPA 1H9AA 1MUUA 2OD9A 3BEOA 2QLTA 4YRNA 3I52A 4Z37A 1BHQ1 3AODA 4U1RA 1TCVA 2HU8A 4RVDA 5J4KA 5A4IS 4L4SA 3UB2A 1Q0PA 1E20A 1T9UA 4DR1F 2CYYA 4LFBF 2OV4A 3EOBI 1N6PA 4DV5J 2D4HA 1XCGB 5GAGU 1P33A 1FDOA 2MYPA 5EESA 3VVTA 3ECSA 1TIBA 4Q45A 3LF1A 4MMYB 5IASA 1HWUA 2K2QB 5LP6F 3LW5C 3TX2A 3DYVA 1M5VC 5LBTA 2XG8A 3AILA 4DZDA 1SZJG 4G1VA 3LC2O 4G84A 1ONNA 5J2MB 2WZBA 2R8RA 5DM6Q 1DCFA 3GLIB 5KTSA 4QJVA 4LGCA 4OU4A 5E6UB 1RJ9B 4XK8C 4N5SA 1CC8A 3CWCA 2UZ0A 5AW7A 4F85A 1N88A 1ACLA 4TXMA 2EFOA 3SZMA 2DGOA 4JOQA 4N5IX 4ZVNA 2YIMA 1TMMA 3M8ZA 5J2TA 1EGQA 4BO3A 1NXPA 3AQOA 1DRUA 1ISIA 2AFHB 1P1JA 4FLMA 3PNMA 2YKGA 4IR9A 1HKAA 2VDMB 1P18A 3CFYA 1H5NA 4ZXFA 3CLKA 4RTPA 2FUEA 3GFYA 1MA3A 1M2VB 1JHQA 1JJVA 4Q1DA 4X4RA 1GHTA 2G7MC 4PQYA 4RFVA 3UKOA 1HQCA 1HQEB 4ECYA 3CT6A 4GG1A 2NPOA 3B89A 4JYBA 2OUIA 1VJWA 1DFDA 1P8GA 4Q37A 1JDJA 4H27A 4JUIA 1DY3A 1ZJWA 4CIXA 4NAHA 3N2ZB 4WFNQ 4R31A 5GAEI 1GKYA 4ZDIA 4E94A 4RQTA 2MHNA 1QZXA 1DDIA 1T24A 5FWDA 3DQZA 4FHCA 3N6MA 2Q3BA 4HTFB 1F2TA 3QHAA 2RE8A 1K3FA 2CBXA 4K2AA 5DG9A 4PYRA 5E7MA 3BAFA 2IPOA 5F7ZA 3ZJYA 4WESB 2GMHA 2RGEA 1IBCB 2HIAA 1IE3A 1KDRA 1D6JA 5CH7B 1UP7A 3FCSB 1GAOA 5IFLA 1UBGA 3CGIA 1T3GA 2Q1XA 5MGNA 2QY6A 1QG4A 1GARA 4OGKA 1YL6A 1SXJA 1HQDA 2FHKA 3ZIUA 1KBRA 3UCGA 2EFEB 4JELA 5ITWA 3F8SA 4L8YA 4O4HB 1PEKE 3SEZA 3Q7IA 4X65B 1Y80A 1E2UA 1NK4A 3DNCA 4RLQA 3VU3A 4ALMA 4J1SA 3WL8A 5JBQA 1QH1A 2JFZA 2IU3A 5LT5A 5TT1A 5LPNA 4MW7A 1HDZA 2MMGA 4C0AC 1L9KA 3I58A 1LW2B 5CLJA 1V1MA 3K5LA 1JG4A 1EQMA 2ID7A 1JEEA 1JTEA 2D13A 4M0CA 3PDIB 1NAHA 1YFKA 4B4DA 4CT0A 1XQYA 1UMBB 4L4RA 1OIWA 2Q3FA 1UBTS 4DCCA 1QG6A 1GRCA 4FLFA 1N1EA 4RGBA 2J9DA 1YIJS 1AK2A 4QR0A 3C24A 4W5NA 5P21A 4BO0A 5BV2P 2JFUA 1YA6A 1RT1A 3DDNA 2HHLA 1AHIA 4Q3LA 4NC9A 2RQKA 5LP6A 3G9UA 2H85A 2O1XA 4LHVA 3H2UB 2OKQA 3U48A 2IEBA 3ISNC 1TL5A 1UA0A 1MZPA 5AKKA 3NTOA 5HUQA 1KIMA 5DK4A 2W7PA 1YQHA 3IKVA 4JC4A 3DOLA 5HQJA 2AUNA 4KACA 3I42A 4EG6A 3MXOA 4JQZA 2PH7A 4OJHA 2EL9A 5HKBA 2G2OA 4DR7J 4K6HA 1EAYA 3AVXA 3Q83A 2RGNA 2P5TB 3FMIA 4TYMA 5KREA 4RMIA 5KFWA 2P8JA 3PVCA 3TX0A 5J2TF 3VKVA 4LV8B 1Q57A 4IDHA 5G0RB 3RSSA 3HA2A 2P2ZA 1P4GA 1JQ3A 4B3SF 5GAEU 2HH9A 3IDOA 1QPBA 4IDQA 4RENA 3RSOA 1E3MA 1J20A 5KQMA 3LPNA 3ZY4A 4RQAA 3SYRA 4W5HA 2ZCJA 4KDRA 5FLKA 2E49A 3WXMA 2PA3A 4EO6A 5KQPA 4O25A 3QWHA 3MM9A 1RE1B 2ZH6A 3AF4A 3UMMA 3B12A 3EPHA 1AXRA 1XOIA 2I2XB 1NXTA 4PV7A 5CNMA 5ELXA 3VQTA 2B7BA 1HOXA 1VC5A 1H8HD 4BWGA 2EFYA 2E5FA 3LO3A 1ABBA 1NR1A 2F8EX 3A1CA 2QAJA 4F56A 4QM7A 3VA7A 3POTA 2YIVX 1NVTA 5HQ3A 3TCXB 2CWXA 3EGVA 4JYZA 2G0IA 1O6FA 4L2IA 2UVRA 3O38A 4NLSA 2AA3A 2AFRA 2R2SA 1SUAA 3G82B 3TQOA 4AUEA 2ZUDA 2FUG9 1ILWA 1P8AA 4J0EA 3ZZYA 1ADCA 4BQSA 3H11B 1YJBA 1QVVA 2OA0A 3AB8A 1UMKA 1SVWA 3K5NA 5KNBH 3HMJG 2QRUA 2YFQA 2F8MA 3LOUA 5KZMB 1Y8RA 4QBTA 2OLJA 3GPBA 3UYKA 4R9UC 4POOA 1EQ0A 5H16A 1T02A 3NCRA 1TA9A 2JLWA 2JAQA 4NMHA 4REOA 3RJ5A 4MV8A 1U3CA 2YX1A 2I9PA 2OQVA 1W30A 2Q7XA 1KBZA 4II2A 2X5JO 5DNUA 1DMRA 3NGRA 1NQOA 2VQFJ 2XUGA 4GP9A 3NY0A 4LZPA 2XB2A 2FW8A 4K0RA 1OAKA 3P19A 4X44A 3RO7A 2ES4A 2YRWA 2GAHC 2ZBFA 2OLEA 4NBRA 1XRSB 4G3IA 3A2NA 4OP2A 4XAKA 1DQSA 3VTFA 2FFRA 2Y0PA 3U4GA 3A04A 4JEMA 5EUCA 3MB8A 4HLCA 4TSRA 4F4HA 1U1IA 3LXRA 1HR0F 1QFZA 5TPWB 1H2BA 1Z6PA 5TNXA 5AM5A 2RGBA 5HTKA 1ND5A 4P7BA 1L5NA 3CR8A 4EF4A 3BXHA 4HZUA 4G09A 3ENWA 4EHAA 2F9LA 1MLAA 4MT1A 2QA5A 1YBMA 4U7JA 3LY9A 3MM6A 1QGED 4LF9J 5LIRA 1H0SA 2LMIA 1JJ4A 2O59A 4LJMA 4EB8A 2C7BA 2MOKA 3OT1B 1ZJYA 5CVTA 3DWEX 3IAHA 3C8HA 2FJXA 1S12A 1DQZA 2DWPA 3SS9X 2VFSA 2JEGA 4N0DA 4HFRA 1PS9A 1YI0A 4WXMA 1O0SA 3IA0A 2AYYA 1FPMA 2WUFA 2XCIA 1NI4A 3FUTA 4CCHA 1V5IB 2L9NA 1W8IA 4LY3A 3EPKA 4O2LA 2O3TA 4P35A 3GJRB 1XJWB 2HSGA 2BM9A 3IAXA 1OBFO 4B02A 3ZWYA 1NJZA 1WV1A 1K9VF 2DHXA 3MJDA 3DMFA 3EZ9A 1A82A 3H87A 4NEZA 3MUNA 3ND6A 1TVEA 3GPLA 3BMCB 4ESOA 3N74A 1G7RA 1HT2E 3DXZA 2C07A 3UB4A 2YKMB 4RNOA 1K5HA 4WKPA 4NRUA 1SKSA 5AKJA 3R7BB 3HB1A 4BEBA 7REQB 2K06A 4CU2A 4P7VA 2BHLA 3EUFA 3WL4A 4ND7A 2HHAA 2ZBUA 4EYQA 3B1KA 2WONB 1BE1A 3F3YA 3CCQS 1ZPVA 4DR4J 4ID9A 3I23A 1PL6A 4NARA 2H2AA 2W2KB 1I4WA 5ALYA 3ZPXA 4LQCA 1IBLB 4PZ9A 4OYZA 4RL6A 1T35A 2HHJA 2JH9A 4K9MA 3IJ5A 3PNPA 5KFHA 3VUEA 3KQKA 1LLFA 3GLIE 3P4UA 4DFMA 2PLFA 1LJLA 5LDHA 2PV0A 1XDGA 3A3OA 4XDGA 2AX0A 4X63A 3NIWA 3LCCA 3AJ8A 4KR2A 2OG1A 4ZP1A 5SYNA 4DVJA 1VRUB 3BQ0A 1B8NA 4OYBA 5C4GB 5H1SV 2IPLA 2VDUE 1ZGAA 3JWEA 1UWKA 4IQFA 3P96A 3TNJA 3ZV4A 5KKNB 2GF9A 1LTHR 4NDNE 3LVQE 4AZSA 5DLGA 5HJYA 1JHZA 5KTOA 4DDMA 1X92A 5JFGA 1QE0A 3PLNA 5HO4A 3H3XA 1ZPDA 1T0IA 3AKDA 4LXGA 4OZLA 4R0NA 4EUEA 4J6EA 4YMWA 4UMVA 3HXKA 1A1SA 4BLRA 1Y7LA 5IV4A 4DLTA 3HN2A 4HXGA 1TVRB 1N8TA 4RFSA 2Q8NA 5AHXA 2IDEA 4YUYA 2I1LA 2YMQA 1JRLA 3OZWA 5LXTB 2HHHB 4ED1A 3FAKA 4JI4J 3KWJA 3H5WA 1PR1A 2P75A 1NBMA 1Z6GA 1NBEA 1LTQA 4DF4A 1NE7A 1XTKA 1KJ8A 1S1MA 4URFA 4HGQA 2F3TA 4HNGA 4IKPA 5KYWA 2OD7A 1WCXA 3ESCA 3E8XA 2IEGA 4ETNA 2XE7A 1O95A 1BRMA 1CQXA 4MB2A 3OLYA 5ICMA 4RW4B 4U7WA 2QT7A 2WJ3A 2JGDA 1X9MA 2PH3A 2HF7A 1DIHA 4LKRA 5KSZA 3KR1A 3HH8A 1AT1B 5A0VA 4KPCA 3C3BA 5DBGA 4F04A 3GOQA 1OWXA 1PJQA 2Z56A 1E6VA 3MFYA 1TB4A 5EWJA 4R0VA 1SH2A 4QZVA 2OYCA 1KNQA 3ZTYA 3UJDA 2RJOA 2YNIA 1KI3A 3EARA 4AULA 1R10A 1NW4A 3FRHA 2AFIA 1TVMA 2OV2A 1U1OA 3WGMA 3QVVA 2EQAA 3WX8A 1FLDA 2P5UA 3HXQA 3N2KB 3D8BA 3OR2B 3IVXA 3WZMA 2HHWA 4XQCA 4GIBA 1P1BA 2IVYA 2ASDA 3PIRA 1E9AA 3ANNA 4F3RA 1FFWB 2ASVA 3MPDA 4KXUA 1SVDA 3MUEA 3GYGA 3M1IA 4Y2RA 3E22B 2ZVQX 3EVZA 3OY7A 2ZNZA 1X5TA 2BE7D 2RD2A 5CDYA 4RPLA 3BXPA 1K6JA 1L7XA 2HNKA 4AWBA 4FYMA 1RKJA 1RWQA 2W48A 1NFFA 4MITA 2QMUA 2O3DA 4ENPA 5K8UA 4M0PA 3GROA 4WK0B 3ZX4A 5IVIA 4ZREA 3NWJA 1KOGA 3DCNA 4USHA 2XEDA 4DR7B 2VP2A 3ZH2A 3QV2A 1BO6A 1G38A 4G0OA 3T1YF 1PUXA 4CV0A 4K87A 4MJ7A 4IIEA 2WOMB 2GN9A 2XA2A 2CXOA 2J8AA 1XX6A 4K5RA 4QYZJ 1PGPA 1CUBA 3RSQA 3MMAA 1VMDA 3RYIA 3HULA 2JJYA 2JZNA 3ZHOA 3WMEA 5JROA 4BAZA 2XDQB 4DAOA 1KD1T 4IF4A 2XVAA 1X60A 3MWJA 4JQOA 2JANA 3NGXA 3QXHA 1EUYA 5CDFA 2MWMA 4U2DA 1YB5A 5CG1A 4BDSA 3LKDA 4EG3A 4E46A 2KVQE 2II6A 2OJ3A 4IRUB 1ORIA 3ROPA 4HWKA 1N2CB 1HDXA 4R8LA 1JDPA 4ZJQA 3U4QB 2J0SA 2WMNB 1CJTC 2ZBEA 3W2HA 3QMPA 3IWLA 1I36A 4H16A 1Y3JA 3MJFA 4Y30A 4CEHB 2Q6LA 1NB2A 3IJPA 1QE1A 3PQ2A 2TRSB 2PXXA 2CY0A 2QLMA 3ZE2B 3ZHCA 3G2QA 2C0CA 3PG9A 2NPFA 3PR3A 3V6HA 3ZK9A 3D5MA 1XSEA 5CT9A 1Z5GA 4LE1A 2CNBA 3Q0AA 2PUAA 4Y34A 2HREA 1OFUA 1NLKL 3EXG1 2WW4A 1HXHA 2V8BA 4CIDA 4BVHA 3SHQA 2QU7A 3ZHRA 4J37A 1Q0TA 1WORA 3R5KA 3CUNA 2E7XA 2JGLA 2EKBA 1FVQA 1YI1A 3EQZA 3UJNA 4FYWB 2ATEA 4GPBA 1LLUA 1UWBA 3SQXA 3I5YA 1KYZA 3LAKA 4IV5A 4LHXA 5KOWA 2Z1DA 4MUYA 3O1LA 5L6LB 3IEKA 2L41A 2QYCA 2ADMA 4PR3A 1QQTA 3O6QA 2JHFA 3WFZA 3PO4A 1KMIY 4G6VB 5EG5A 2PDAA 4YAIA 5K4AA 4M9ZA 2PYZA 4UMFA 5M2UA 5J58A 4F9FA 2CBGA 4JOSA 1MMNA 1TZ0A 3UO0A 3P0RA 4NZ9A 2AR9A 1DE0A 2VT7A 2XODA 1HNWB 3FPHA 1VSTA 3UGJA 3T1HF 4YFUA 4LGYA 3ICQB 1DWOA 3AF5A 2WV9A 4MDEA 2YNFB 2P4HX 4XZ3A 3ZH9B 4DV4J 2RDIA 3CE9A 4LFBB 2OQRA 4A8WA 3GAMA 3OA0A 1UBUS 2VXCA 1PYOA 2YVKA 3GCWP 5JAHA 4IPTA 1FLAA 1Q77A 4MHOA 5JW6A 3C5VA 2ZM6F 4BX8A 2EG5A 2V34A 3KYCB 3H4VA 4Z0TA 4HHHA 1F5AA 1UPCA 2L69A 4DBQA 3ZGOA 3NWPA 1SH7A 4U67Q 1KZ4A 3D7RA 4ZQBA 3IRUA 5ETQA 5KFUA 2BONA 2IPNA 4Y2QA 5LJLA 2I6TA 4D42A 5CYMA 1V8PA 4DR4B 5A0YB 5EJ2A 2J33A 1CQPA 4FN4A 2IA5A 2V1XA 1QDLB 1SC1A 5EJ6A 2CK3A 3MTAA 5LSOA 1V6SA 5F1PA 4F7WA 1ITPA 1N0VC 4YH1A 4FXDA 3KHLA 1O0PA 3NO4A 5DYIA 3AT1A 5CLHA 4DJEC 4HF7A 1A6LA 3HO8A 5ELLA 3MZIA 3NWBA 5KFJA 3C5WP 4RKRA 1JIQA 1KI7A 3M6WA 2F1HA 1G0NA 3D4IA 2O14A 3K70D 3AHHA 4E5NA 2CDRA 5BQ3A 3K8QA 3EE3A 1TF2A 3PHTA 3NG1A 4Z0HO 4QKQA 1Q3HA 3LFHA 5JQWA 4LOHA 1V8ZA 3GJ5A 2FK8A 4AN4A 3ILVA 2G88A 2VO1A 4M1EA 4D46A 1FU8A 4LOAA 4E21A 4KWIA 1Q7BA 2AG6A 4CRJA 3E5NA 3JSRA 3BC1A 1KQKA 1L5UA 4U8HA 1OV6A 5C53B 3E0XA 4G23A 3RVLA 4FU0A 5BWCA 4C89A 1RT2A 2MZ1A 1YK9A 5GIPE 1S9DA 4HR7A 5TT0A 2W4DA 2P65A 3NDIA 3KJQB 2VK8A 5IAJA 4QSHA 3SQLA 1W6UA 2ZS7A 2AD1A 4B46A 4TT3A 2C2ZB 1IN8A 2XKJE 1HO3A 1NKBA 3KDPA 3IHTA 2E55A 4RWWA 1NHKL 2EXXA 3WKDA 1S4QA 2P7IA 5JVDF 4R6WA 2RDDA 5BMVF 3MLBA 4ZKAA 3H4DA 3L02A 1TVKA 3OEHD 3VI3B 1BD4A 4AJKA 4C29A 2DPXA 3ZWXA 1W4ZA 4WF9Q 4NJMB 1QYIA 1QQBA 2CHVA 4QWEA 2YJZA 4BO5A 3MECA 4MQFB 1QFMA 4FCVA 4RDIA 1WDTA 5A0TA 4F3OA 3CULA 3LSYA 4LKOA 4G1PA 2NP6A 1X4EA 1LNSA 3FNQA 1PLJA 5EY5B 1XR5A 4CG0A 2A84A 3LDUA 4JI4B 3B3FA 4AQYB 4EPXA 2VOOA 1SJ9A 2QD5A 2FWBA 1ZNZA 3UNXA 3BD7A 5A4JA 3IVAA 4KZPA 2IC3A 3HNOA 3WLMA 3Q7SA 2R7NA 1WETA 2O7QA 3VXKA 5ES4B 3MT8A 4C6AA 4IGAA 3FETA 3JAKA 1UZLA 1E6CA 2HVHA 1EIZA 1R4AA 3AA9A 3W6OA 1B93A 5L3SA 1LA2A 3ADDA 4NMXA 1JBEA 3KUEA 5DASA 5SY6A 2IH5A 4CKEA 3SDZA 3LKBA 4C6TA 2XT0A 5LCXA 4DHWA 3OD5A 2NO5A 2OSBA 1Z88A 5DGCA 1KSPA 1HLFA 1G3MA 1Z6ZA 2PRIA 1XYGA 2GGSA 5C4MA 1SC1B 2YJ6A 3SHTA 3FY4A 2MYFA 1Y3AA 3EIEA 5IAGA 1WUTA 4FZ3A 2HEGA 1P1LA 1GPKA 1CRQA 1WG1A 2J0QA 4LF6B 1OFGA 2KHCA 1IR1A 2D0PB 5DKFA 3TVYA 1Y6FA 3LNTA 1MO2A 5BT9A 1LPOA 4FT2A 3HJAA 3EGXB 4URYR 1D4FA 1W85B 3N2GA 2HR1A 3O5AA 3WNVA 4JLBA 1ITZA 1PYDA 3SS8A 4GYWA 2NT3A 3K0SA 1P4SA 2G5PA 4EQ6A 5IK2D 3AY3A 1I4EB 1Z08A 1XJWA 3VZCA 3KOAA 1AHHA 4PCVA 2C2XA 2E5LB 1F06A 4UUPA 4MR9B 3W4JA 4XVQA 4EENA 3R9LA 1JAXA 5EOVA 4BZQA 4A8TA 1GLGA 1SVNA 3I62A 2VZLA 1PYOB 2GT1A 3LMKA 3KZMA 3SJAA 5H9EK 2AT1B 3MYRA 4HDRA 4WADA 1BA2A 2CHFA 3Q3IA 5KINB 1VBZA 5I7RA 1AN0A 3P2JA 5K2MA 4X1IA 3ZLUA 3HBFA 2Q4OA 2RCYA 2ZBDA 1TC1A 4EZEA 2GK4A 3QY9A 2H1CA 2CFOA 1M1HA 1RT5B 1YDHA 3QPDA 5CCDA 2GD0A 4DV3B 2OZVA 2P4UA 4NABA 2WYVA 1YDEA 6PFKA 3ITHB 5LC1A 4QX6A 4GM1A 4JDPA 1EK0A 1NPTO 4K7JA 4IRDA 3JAMY 1Z4PX 2HNZB 2J3DA 3FUCA 1W36B 5HM6A 3CBQA 3PC4A 4IBOA 2FZCA 4MRAA 3A0RB 3VU8A 3IEVA 4I8DA 1IJEB 4YOEA 2X14A 1PNRA 1V9LA 5BP7A 1OAAA 4FOLA 5DTQA 1U3WA 1KWGA 1INLA 2V68A 1CQNA 2MQOA 1Q3TA 4OZNA 4UDXX 2MSLA 3SQOP 1FK8A 4WFJA 3L4JA 1T5IA 5KWSA 4F12A 1Z5UA 3I5UA 2QLXA 2YZKA 3SK0A 4C0OC 3C4QA 2FPPB 5E4FA 1DO0A 3FCAA 4QYWA 4JI8B 1NF2A 1CT9A 2WTEA 1JLCB 4PBRA 2QVGA 4C9BA 4IG4A 4QTUB 5SZKB 5HMYA 3NS5A 3A36A 1X8JA 2YFKA 3R5CA 3A6LA 5K4GA 3V6DB 2PJUA 4Q21A 5KX5A 2G71A 3WHLA 2JJ2A 1OMOA 3HSYA 1L3BA 2E1AA 2PRZA 3KKQA 2A5YB 2NV0A 2YV3A 1O94D 1YITS 1FDVA 1Y8CA 3BVPA 4RORA 5D2CA 2QQ5A 1DC8A 5KAMA 3P9ZA 2P30A 2F3UA 4NA3A 3NVKI 1BOFA 1EHYA 4J3JA 3CNOA 4EBCA 4TTVA 1A2KC 5FBLB 1JLKA 4UXHA 1YA8A 1OBHA 3KEGA 5TQ0A 5AW5A 1PK9A 4BX2A 1YQEA 2B8WA 3C14B 2MZRA 1KMMA 1RD4A 3QJGA 1ZUD1 5JBIA 2ZYWX 4N82A 1WWKA 4Y2MA 1FX0B 1ECGA 4DL7A 1HWKA 1SIOA 1NXIA 4DQUA 5K3OA 1IZ0A 4KXVA 1ZSYA 2R8HA 3N5CA 5BXYA 5HAOA 3IO5A 3CURA 3DONA 2N3OA 4TTPA 3SJUA 1DS6A 4YMIA 2DLCX 4DEZA 3RM3A 1XRJA 2OSRA 2WDZA 4DBZA 1GAEO 2QL6A 1X94A 1TE2A 2XCLA 1F20A 5EPOA 3PLRA 2CLMB 4QQ8A 5CB4A 4HRAA 2PKWA 2CFRA 2IA0A 1OTHA 1NG9A 5REQA 4ALJA 3B3QA 3AI7A 5C8XA 1NJGA 3OIDA 4BJ6A 1XMQJ 2M1XA 2JA1A 2QX8A 4RKUC 1YE3A 3AD7C 4I2VA 1M1XB 3E2PA 2C5FA 4K4UA 5AIBA 3ZY5A 3KG4A 3I9NA 1RT7B 3LTNC 2R8YA 4EBBA 2GCFA 2X8AA 1SBQA 1U5AA 3MI7X 4X1KA 3NALA 3M5WA 1VG1A 2BFEB 2KHDA 1XTVA 3N8NA 1C1DA 4EY7A 2Z2ZA 4FD3A 2AZ3A 2PZAA 5KFOA 4J9SA 3UN3A 3QJ5A 4OJGA 1OFTA 4FWTA 2AE2A 1T43A 5KSYA 4ZVOB 3OVBA 3DEJA 3S1TA 4MPDA 5JMWA 2DBRA 5G4DA 4WKNA 1GQ2A 3DCIA 1RWPB 4TYPA 2BXJA 1ZS9A 4KT0C 3FN4A 1HQ2A 2FUG1 4Y8VA 3M1VA 4D74A 1G2EA 3PTWA 4DXDA 2Z5GA 3WLAA 5LLDA 2AYBA 2HBZB 1U9JA 4TS9A 3MC1A 2V7VA 1H98A 3WYEA 4GH5A 1NASA 3PK0A 1JPJA 3UAXA 2PHZA 3KXIA 3E1KA 1D2CA 2XUJA 4PAQA 2DECA 3K2YA 5JC8A 2HWWA 4GBGA 1NI5A 2IVMA 3I12A 4NEHB 1UFOA 1Z6QA 3RSZA 4QQFA 4MJXA 4TMZA 3NHRA 5DYGA 3W2WA 1ZD5A 1DKQA 3I37X 2V8VA 3O1JC 3NDBB 2A0WA 2F40A 3JSYA 3IAS1 4YB6A 1WVIA 1IXKA 2IMWP 5KFSA 2GILA 1WAMA 1HBOA 3V2GA 1KRPA 4FBLA 1QIDA 3ROKA 2F3JA 2VHYA 3NTXA 4J75A 2R7AA 2JG3A 3EX7B 2DGVA 1RU2A 4Z0NA 4P75A 3UW3A 2V1UA 5HATA 3LXXA 3FYCA 2OPSA 3TUPA 3BM5A 5B0DA 4FN5A 3MCWA 1ZH2A 2JBAA 4O2RA 3D3EA 4N3AA 4QOJA 4E1AA 1ICIA 1PD0A 3S70A 4DPOA 4XTCS 1WPQA 3QATA 3AVYA 1T05A 5KFKA 1OXMA 3HACA 1W8DA 1T9TA 3PICA 4KC0A 3WOVA 2B0JA 5JEEA 5GADl 1U6BA 4WNAB 5T7LA 4IV0A 4PYJA 2O3RA 4UM9B 1SWVA 1REGX 1KYWA 3NGLA 2Y1GA 2B1QA 5BN5B 2IRUA 1RA6A 3MQ2A 1WXWA 3AG6A 2PCJA 3VGSA 4EY4A 1YKWA 3R1LA 4L76A 1EJ7L 3TSWA 5JTTA 1RWMA 4C4YA 5CM2Z 2HBQB 1NTRA 4Q9LA 4O5OA 3RR8A 2XLKA 1GA4A 4MR9A 3BHMA 4MUEA 3P9KA 1U4SA 4V39A 5SZIA 4LOKA 4F2GA 4ZN1A 2BGJA 4C11B 5BV8A 3I5CA 1J0BA 2PE8A 4C0HA 1H2RS 2WLTA 4OYWA 4B3TF 3HWRA 1OROA 3CQ9A 1VCTA 4PG4A 2JCSA 1XXHB 2QRPA 1F9EB 1U6JA 4RU9A 4DL4A 4PYAA 4J9LA 3SHVA 1RJDA 1FBNA 2O05A 4BLWA 3S8YA 3SC4A 3GFRA 1EVYA 3M8PA 3CCLS 4OYPA 4G56A 4DR2B 3DHWC 3C3CA 3NR2A 2WNIA 1Y3DE 3KUHA 5FL3A 2PRYA 2XY6A 2IW3A 2RKOA 5JYEA 4ZAGA 1HNXF 1NDKA 3TA1A 3ACBA 2CVZA 1IULA 2BE9B 2G8LA 3CEMA 4NBUA 1EQAA 2DHHA 3GE9A 4MGZR 7AT1B 4OYMA 2MKYA 4GKKJ 2XE4A 1ID8A 2JEYA 4GL4A 3ZCUA 3DAGA 4K3UA 1Q92A 2F1KA 3MD1A 2VHGA 1VJCA 3BQ1A 1PFYA 5KTQA 3ZTTA 3UPDA 3CRZA 3WK5A 1UFLA 3JD4A 4NF2A 3E9QA 5AVWA 2VHJA 2RGUA 5AE1A 1FTNA 1USUA 2YINC 3C7TA 2PT0A 1AROP 3D8UA 5CB0A 4KPEC 2XNQA 2AYGA 1SJ3P 4YUAA 1U2QA 2PI5A 1EMDA 4GOOD 5GY7A 3GG2A 3ECCA 2ZETA 5GMDA 4U7HA 2FCAA 2ABYA 2KPOA 3ITHA 3ZD8A 1RPJA 4C2BA 3UWSA 4UUOA 1HFWA 3EXFB 4ED5A 2Q5QA 2R5WA 1JE0A 3Q1LA 4CFYA 2R79A 3KHTA 5AQ1A 5JSHA 3M2VB 2UU9F 4WTOB 4BV2A 4NPOA 3HKCB 3BREA 3WWYA 1YR1A 2G9VA 1YMVA 1QKJA 1QX3A 3F6RA 4S04A 3DEIA 1EFRD 1Z0IA 3WQPA 1V25A 3NWEA 2HW3A 1EHIA 4Y9RA 1RFLA 3OJSA 4KNVA 1KMNA 5HXAA 4DNXA 5EI5A 4EECA 3V1UA 4C0LA 3BXFA 4ND8B 4TTAA 3MR6A 1YZ6A 4OX6A 1CZRA 1ZOIA 3LIPA 5KJEA 3VALA 1H7WA 4A27A 3P5BA 4RMHA 1UBJS 1G55A 4QFBA 3LP1A 1HUQA 5FA6A 3LS2A 4PLCA 2XHWA 3MAQA 2MJUA 1FVHA 4K8RA 2E29A 3ZBQA 5L4SA 5GVQA 4AYBD 1UEKA 2QL7A 1YCDA 4O02B 1TJ4A 3HZZA 1MG5A 1WOOA 4LSZA 3N2YA 4BC1A 2EKNA 2IOQA 2QM7A 3T0IA 4MSUA 3R9XA 3HJCA 3PX7A 3HKBB 3RYCA 3CY6A 4H4MB 3IVGA 2QAGB 1I0IA 1KF0A 1RWNA 1YAJA 3PWTA 1C0UA 2IHR1 4I4LA 2E1CA 4I14A 1M34E 2QZSA 4X20B 3ZU5A 1FE0A 4N6OA 3EIFA 3BFPA 1VPWA 2JKZA 2MSTA 4UUXA 3VYTB 5DI3B 2EFCB 1NW7A 4LDJA 3HI4A 4C7MA 4RETA 2OUKA 5IFKA 3JXOA 4ECEA 5IEBA 1KKLA 3EYAA 1N25A 2P9CA 1OTXA 1KGDA 2YV1A 3JQ7A 4O4JF 1X2EA 3TMAA 3TLGA 4FMPA 3KPUA 3OVAA 2J9EA 2WIAA 4DUYB 2PFDA 4DLXA 1RWVB 1WB4A 1RIFA 5K8PA 3OCXA 1QP4A 2BF7A 4JJGA 4JI5B 1YB1A 4NBWA 3SS7X 5IJWA 1W5EA 2VTEA 2Z09A 3H8YA 2BM8A 4H3HB 1XCOA 4E6PA 1PCAA 3RS5A 2C77A 2WVHA 4LW8A 4DX8H 2VKTA 4JUCA 2FHOB 4TTJA 2HHHJ 3L8YA 1ACMB 2D06A 4P3YA 2D1FA 2IWRA 5EJFA 3RHTA 2BW7A 4ZOSA 3EICA 4EPYA 2EBHX 5LJIA 5KJFA 2ZJ3A 1N1GA 1VJ1A 5KC9A 1GUFA 3VPDA 3EXIB 2OP5A 1R4MA 3QENA 4HP8A 4HRVA 2PBRA 3TZCA 3PYDA 1ACJA 3KZOA 2ZJ2A 3NAZA 5ERGB 4DCNA 4MO9A 3UIEA 1JB1A 3C6TA 3QUQA 4TLRA 2A3JA 3Q41A 5E95A 5JR3A 2IFTA 4FYHA 2TMKA 3RJTA 4GXNA 5TEVA 2H4YB 3U4DA 1SA0B 2J46A 4R69A 2X3DA 3FOFC 1WOMA 1FX1A 4XX0B 5DZ6A 1X1AA 1JFVA 1HDOA 2H17A 2Z04A 3RHFA 1Z9BA 4MI3A 2QD2A 2NU9A 3S40A 5KS2A 3MJTA 2I6SA 5M29A 4QDKA 4DLGA 1EP1B 3HBLA 1E5QA 3ZV3A 2FP4A 2X1LA 1XYVA 3R9KA 3IP0A 3ZTPA 3QWIA 1R0RE 3CF4G 4UTGA 4UTZA 3NP9A 1TKXA 1A95A 4I1OA 4A6XA 3D2LA 1UVNA 4RR5A 4OMDA 3PKMA 4B3GA 1WLSA 3B38A 3D0GE 1FFXB 4FHDA 5G0VA 2AQKA 4MMOA 2YMMA 3A8TA 3GJTA 1YVFA 3BGOP 3CJTA 1KVQA 1R0BG 4LJKA 2BFEA 1U8CB 2ALZA 1XMOB 1K8AT 4DQIA 3PU6A 3GRUA 5JS2A 1QSGA 4YR3A 3BE5A 1RRCA 4QELA 3T3OA 1LRLA 4Y9SA 1BWVA 2R6JA 2OCAA 3KJXA 2H57A 1J0EA 3NHPA 2WR8A 4QHYA 1QR6A 3KKNA 4ETWA 4ZOLA 4FNIA 4RGYA 1XD2B 1NPPA 1LBIA 1DUVG 2LZ0A 1D6MA 3JV7A 3T6KA 2IQIA 3MTBA 1TECE 3H20A 5ALJA 5AHWA 5CDTA 2PSZA 3LHSA 3S0JA 4JI1J 3HRHA 2NO9A 5G02A 1QQ5A 5FQOA 5HDQA 4INZA 4D0GA 2EEZA 3T7IA 2R8EA 3CLVA 1FJGF 1QO0A 4TNOA 4AKTA 3LCUA 4KRFA 4KMSA 2PEHA 5KSPA 5EHNA 1CERA 1EUDA 1ZK4A 3V1LA 4DARA 3K6SB 1FDIA 3EEBA 2X8JA 2Z4PA 2G09A 2OI2A 4PCAA 3ELYA 1PWZA 5IANA 2MDTA 2L18A 2W7TA 4LXUA 4JV2A 4WJLA 2AG1A 5CNKA 4LI0A 3V4MA 1X1BA 3A9RA 2DBYA 3V55A 4TWZA 3H75A 1NT2A 1ZNXA 4GO1A 1QNLA 2A5JA 1KSJA 1KHTA 4HNAA 4I64A 4OZ0A 4H3VA 3SYMA 3GXBA 2NZXA 4JNCA 4RSGA 1ZUNA 2G83A 2H4XA 2Q6KA 2AJFE 1G5IA 3D4JA 4YP7A 3NCPA 4W99A 1RP7A 3L6CA 5IQ6A 1PL8A 3NAGA 3ZQJA 4NU0A 4HI2A 4NLYA 1VQ4S 4FEGA 4RABA 5EE0A 4RGQA 3PDUA 1DJLA 4ZQIA 4HLQB 2CL6X 3N0RA 1FWLA 5CNIA 4YCLA 3UG6A 3B9QA 2KSQA 1CJSA 3GJSA 1OGIA 4P3NA 2PGJA 1RAEA 3KVRA 1MA0A 4ZO8A 4DZRA 1RI2A 4BUCA 3HU5A 3MTJA 2FFJA 3GMSA 1SKRA 2QL5B 3KYLA 1JIUA 4MKAA 4WJZA 3JAMU 3AV3A 3RC3A 4X60A 1JQKA 5TR9A 2ZSKA 5K8MA 3EZ5A 4L51A 2IWHA 3VU9A 3FSYA 2P2LA 4IDGA 5LQRA 3KLMX 1GA6A 5J59A 3V6KA 3HLKA 1UJNA 4B3CA 4GKJJ 4OHUA 4YTEA 5BYSA 3CNLA 5CX4A 4CQLB 4BL5A 1XUOA 2FWPA 1M0WA 4FE7A 4BMVA 3V4OA 3M32B 2APOA 4L4XA 1E0SA 2AYMA 4C0WA 2XSZD 1U2PA 3GVHA 5EUQB 2VQ6A 4AJ9A 3TZEA 3DAOA 4RVUA 3M2PA 2GXUA 1FI4A 3KAJA 1OZ0A 4PXBA 1NYRA 4JT4A 1UPMB 4ZPCA 4F5EA 1Z47A 2WNHA 3WRXA 3TSAA 3V32A 4ISBA 3Q72A 3D67A 3ES9A 3HF5A 4DY6A 1U25A 3KNGA 3FAZA 2C84A 1NVMB 3KQWA 3KXLA 4Y6QA 4TLBA 3IH5A 2HU5A 2QQ0A 5J2NA 4JUAA 2V45A 2YXNA 3KOMA 2J0WA 1CZLA 5H9WA 1WZEA 4P0PB 2I33A 2H08A 2OXFA 4RDHA 1B4DA 4ARBA 1IN1A 1GN9A 1QXSA 1QWSA 4L0MA 1XNQB 2A1UA 3AL0C 4GVBA 3VYVA 5JSYA 5KOIA 3J81Y 3K0CC 2DJWA 1X5OA 4LX0A 3FGZA 1FP4B 2HF8A 2HRZA 3QA3E 1L3IA 1X5PA 1P44A 3KM0A 2DG2A 2HHUA 1BC5A 1K5DA 2IVFA 1MVOA 1W5FA 4KH1A 2J3EA 2CHGA 3TAMB 2CVPA 5AUPB 2ZTUA 1OC2A 3F6PA 3LH2S 1KMHB 4ACAA 1I2AA 4QOSA 4CLFA 4DR1B 4GGMX 2FJWA 4OUDA 3C5HA 4UEOA 3QITA 3G5UA 4IDKA 2ZSIA 2YX7A 4D9NA 1Q83A 3TLGB 3UJ7A 5JZSA 4DV0J 1EB0A 2WI8A 1MEJA 4A15A 4A1FA 2QBYB 1UDXA 5D8DA 1YJNS 4A91A 5DCLA 4DC9A 1BVRA 1BEZA 3I56S 1N7GA 1TQ2A 4G1QA 2RKIB 3K1AB 5G40A 4BN4A 4BCAA 2ISQA 5EZQA 1CG6A 3FTDA 3QKRB 1E79A 1EIWA 1S9EB 2FLNA 2O1SA 3JXEA 3EOZA 1JLGB 4Y2GA 4YNBA 2WMYA 4DBVO 4CG3A 3HRKA 3PYEA 2B4RO 1GOTA 3K1ZA 3UCUP 4DG1A 1B00A 2GCIA 2ZZTA 3GJSB 2IEAA 1TM3E 4WJBA 1SKUA 4U7FA 2C1EA 1YUNA 2HFKA 3IMCA 5U4QA 3Q22A 1MWYA 1PGQA 5TS3A 2HB6A 4Y2UA 3GCDA 2EERA 4IYRA 2VBCA 4MKXA 2HDNB 2BKNA 1OH8A 1U8SA 1KYYA 1JLBA 4FFVA 1KOLA 3CM0A 3U3XA 3DZBA 2GZMA 1J1ZA 1OPRA 2LDIA 3PB3A 4YDSA 2I67A 3AU9A 4QO8A 1SBCA 3ZXXA 2PX8A 2Q1SA 3NT5A 5DE3A 1CK4A 3HCFA 3HHNB 5EQTA 2C9OA 3V8NA 4C5BA 5K45A 4BKUA 2P9QA 4OQ4A 4TKLA 4F3TA 3C2QA 1PJ3A 4MKHA 3V2HA 1UT5A 1KI6A 2R1VA 4Q1AA 2AF6A 3DFMA 4I1VA 4UXJA 3JVEA 1SB9A 2NSCA 3CE8A 1GGKA 1Y4UA 1SVIA 2BEWB 3WGTA 3CLTC 1WTBA 3EVTA 1B70B 5T14A 4L5YA 1U2FA 3F7MA 2EWWA 4YUXA 3GJXC 1RYRA 3W3ZB 5IN5A 1O4VA 3ZHTA 1JSLA 4DA7A 2QMZA 3T9AA 3EB9A 4J0GA 1RAAA 2R6ZA 1XWLA 3DDKA 4LF5B 4TS3A 3C4JA 4KXQA 3PNQA 1CUGA 4FBUA 4K03A 1SCDA 3LHDA 1D2AA 4IJKA 1NC1A 4ND2A 5EMNA 3PEVA 1FS6A 1VZ2A 1I1OA 1M0SA 4CR7A 3I6BA 1U26A 2DBVO 4H1WA 1XD2A 4L5BA 5G4LA 2HK2A 2B20A 3F49S 4RH1A 5C80A 3E7XA 5K8VA 3I4HX 1NY6A 2G40A 2QG9A 4NXMF 2YMLA 5BYRA 1QONA 2EBFX 3OJWA 3HWWA 3AK4A 4UZSA 4AMUA 5JD6A 1THGA 4OYOA 2GFIA 1NUAA 1NR5A 1N2JA 4JV5F 5JE8A 3I9MA 1SQFA 1R8BA 4JYAB 4FCTA 2OR3A 1N2OA 5GZ6A 4WXYB 2VP5A 2WYWA 4NK5A 1HMVA 2NSDA 3KLPX 5TV2A 8GPBA 3U3MA 1T25A 3U40A 1O97D 1E1DA 3E9CA 3Q9LA 4C2TA 3OOWA 1TUGA 2Q1TA 3MN1A 2WLSA 3IDFA 5HVHA 2H1VA 1BEUB 4QOTA 3OTWA 4RTRA 3T1TA 4AF7A 1JSZA 3ZE6A 4OL9A 2JFWA 4O2BF 4ZT7A 5J63A 3KTAB 1URPA 4B3MF 1UT6A 3BBFA 2COUA 2I6UA 3EGZA 4U2CA 1JDBC 1Y33E 1FVOA 4Q3DA 3FOZA 3WK4A 2P5YA 3L09A 3HJBA 2B30A 1A71A 2WFMA 3I2FA 2D3WA 5J23A 4GWGA 4RPFA 5EIXA 1VJDA 4RW7A 3CSDA 4JCOA 1EZZA 2QTRA 1XK6A 3KJNA 4WDQA 2W2QP 3MUVP 3OU6A 1M2NA 3CB2A 2O5VA 3AKYA 2DGXA 4IHJB 3DDUA 1ZPWX 3POTB 1KR4A 1SCIA 4AN0A 3HA3A 4K86A 4ZPVR 3A4MA 3KPWA 1N34B 3EDRB 3ONNA 2G04A 3S1SA 1NKTA 4YHBA 2QRGA 3HMQA 1G4CA 2I9KA 5F8LA 3X2FA 4LJ7A 3X1MA 2X9QA 5FOVA 2YVQA 4TYQA 3CDUA 4NZPA 4LS3A 1YZ7A 4DV0B 3DEFA 4Y1FA 2GSDA 2QG6A 1OH7A 4TUYF 4TTSA 4JI8J 1Y6JA 1X7VA 3VC3A 2AMFA 2OEKA 4LY6A 3H42B 4E2XA 4L85A 2L9DA 1YR7A 3NNHA 1FFSA 4K40A 3F6YA 3B6EA 1SJQA 3EWAA 3L7UA 1NPDA 3EGDA 2CJWA 1UPXA 2A3RA 4TROA 4MV5A 2HHTA 2KN4A 2EFHB 4B6FA 3PDCA 4AJNA 4HNAB 3R5GA 4YRDA 1PFKA 1D0IA 1X77A 2GA8A 2ZS8A 5F9HA 3PG5A 4JR2A 3VGUA 5F78A 3W5XA 4LJ9A 1XL0A 3NHLA 1C1CB 2MKSA 3HE3A 3ISND 1QPZA 4AVYA 2REBA 1OF1A 2V98A 4B9NA 3ZX5A 5F2NA 1JIKA 4KC5A 4GDMA 4JBNA 3HYTA 1SULA 1WCIA 2GZ3A 1GN8A 2JF0A 4P53A 2LXIA 2FW1A 2LD4A 2C9ZA 1P72A 5DHUA 3S5UA 3SKVA 4XWWA 1D1TA 2DY1A 2CEKA 1K75A 4F2SA 1LW6E 2VT6A 3BIXA 3LXUX 4X4VA 2UVVA 3SKXA 1EK6A 1TKTA 1T2AA 3DMTA 4I3FA 5F98A 5JCXA 3VNVA 2H1YA 3ZY2A 3B51X 1EQ2A 1NOIA 1X1QA 3PDHA 2BI7A 5EJGA 3ROXA 1HNIA 3INRA 5F21A 3TBHA 4ER3A 5J2PA 3C6MA 1FX2A 4XM1A 1PG2A 3EE6A 3R0JA 4P98A 1Q84A 3P2KA 1Q82T 1E3IA 3K6SA 5SYAA 4BO2A 5CP8A 1HBNB 3AUTA 4EWTA 2A86A 3FKSA 3JQAD 4J1NA 4CH7A 2OB2A 4FFBA 4F4FA 2FMIA 2JA2A 2QFJA 5A8KB 2VA9A 4LV5B 1VKRA 5C9ZA 5JNWA 1IKYB 2B0GA 2H3EA 3D1JA 2QMHA 3MF4A 3DRRB 2WRMA 4H4KC 1QV9A 3BPSA 4J90A 3QNWA 4I4TB 3T9NA 4IH1A 2YKPA 2RFLA 3FFAA 2B8EA 2O54A 3CTPA 5T41A 4A8OA 2ZE2B 2IUTA 2PX4A 2FTKE 3B3AA 2FWNA 3NYQA 2QZ9A 4J5OA 2G17A 1CQIA 1RXSA 3JS5A 3THVA 3J7YU 2WEKA 4LA4A 4BO7A 2N75A 3DDOA 5CH5A 4GWLA 3CDBA 2G9OA 4C3OB