3ENVA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
217
structure length
217
Chain Sequence
b'TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Isomerase
total genus 61
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3envA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3envA01
3BXEA 4OQQA 4GMKA 1PSDA 3MAHA 3P96A 1UJ5A 1KS2A 1FSFA 3CEDA 3MWBA 3TUZC 3N0VA 3LUYA 3AAWB 3ICOA 1YGYA 4LUBA 3CSSA 4OQPA 2GNPA 1U8SA 3E15A 1FQOA 3NZEA 4L5IA 2BKVA 3OFHA 1LKZA 3HN6A 2F1FA 2LQJA 2RQKA 2NYIA 4IO1A 2RI0A 2FGCA 1CD5A 2RI1A 4NMLA 1PBTA 2DTJA 3IXQA 3ENVA 4GO5X 1JT9A 2DT9A 3TUIC 2J0XA 2MDAA 4L50A 3OFEA 3CH7A 5IT4A 1FS5A 2O0MA 4L51A 2JHEA 3BXHA 5T41A 1LK5A 1RWUA 4GO7X 3EB9A 1ZPVA 4L5JA 3UW1A 3DHXA 1LK7A 3KV1A 1HORA 2PA3A 2LVWA 2I9SA 1Y7PA 3EFBA 4L4ZA 3AB4B 2J0EA 2P9CA 2H9ZA 2W48A 3HHEA 4R9NA 2F8MA 2QMXA 3NWPA 2P9GA 3ENWA 3KWMA 1NE7A 3OC6A 5IS2A 2OKGA 2P9EA 2R5FA 2QMWA 2KO1A 1FRZA 3K5PA 5IT0A 3MTJA 2QRRA 1Y89A 3DC2A 3AB2B 3U7JA 3OFFA 5HJ5A 1VL1A 2RE1A 2ZHOA 3DHWC 1SC6A 3OBIA 4PWUA 2WU1A 3LHIA 3BXFA 1YBAA 3LWDA 3NRBA 1DEAA 2CDQA 1M0SA 2PC6A 1FS6A 3S1TA 3E7FA 3W7BA 4M8LA 1XTZA 3O1LA 3DDNA 2QSWA 4L4YA 3BXGA 1HOTA 4TM7A 2J0WA 2RQMA 3TUJC 1UJ6A 5FIIA 2BKXA 4X84A 5JJBA 3IBWA 3LOUA 2JOQA 3OFGA 4R7TA 3ENQA 3TX2A 1O8BA 4TM8A 1UJ4A 4GO1A 3L7OA
chains in the Genus database with same CATH superfamily
3SEZA 1OD6A 4B44A 3UBTA 1TECE 1EZ4A 5I42B 3HPOA 4JI5B 3RSSA 3DOHA 3W1WA 4C9DA 2RK4A 4KX3A 2M0GB 4RPHA 1JJHA 5ALQA 4R51A 1M90T 2WFZA 2E9RX 3QA9A 2DNYA 1A2OA 4GVBA 5T7LB 2MHEA 4MPRA 3OT1A 1OB5A 5CZVA 4BNHA 1Y3AA 1KHHA 4CDRA 1MTZA 4CP5A 2P67A 1TADA 1RVDA 2A7QA 4E2ZA 1GRVA 3NXKA 4J1TA 2YFKA 2VUGA 4UD6A 3K1TA 4XE5A 3UT0A 3ICLA 1R10A 4AL7A 1GG9A 2XB9A 3S2EA 5AWFC 4FNHA 1Q7LB 4GYYA 1U28A 2VZ0A 4O1HA 1BU8A 1XE3A 3NORA 5D8HB 1QV9A 2BBSA 1E5LA 3N0XA 4PZZA 1MHTA 1MVNA 3GU0A 5JPDA 4BVBA 4FPIA 2A86A 3ANYB 4LDPA 1JDSA 1N3IA 1DIAA 3GFGA 5K0EA 3V81B 1GR1A 2OZEA 3E23A 1I24A 5B30A 1I7LA 5L40A 4CGZA 5AJWA 4HG2A 3UOGA 2OEKA 2RJZA 2WVAA 3EZ9A 3NH9A 3ZWYA 2QN2A 2R7RA 2R6ZA 2AR0A 4YHHB 4ZQGA 4ZOAA 5F8MA 4FJ2A 2L41A 3H9GA 4OMCA 2FE4A 3ANSA 4F84A 4OSPA 4TMYA 4D8TA 1W1IA 3TZKA 3V8MA 4BQEA 5EUMA 3H2SA 4IF4A 1GGNA 4M53A 1LBHA 4NYIQ 2BJDA 4GI2A 3OL7A 2W4IA 4HS4A 3PDWA 2PTHA 3AHCA 2Y9MB 2GQ2A 4ZP7A 3FCUB 5B09A 1A95A 3DRYA 4KACA 2AGQA 3IWLA 4HX5A 4IUCS 1KBRA 1KKHA 2HURA 3VYUB 2EQBA 3Q8WA 4GKKB 1UZDA 4RW7A 5DW3A 3UJ6A 2R44A 2BMBA 3C7DB 2DPGA 1Q50A 1VP3A 3M05A 4IDNA 1UKUA 3D6AA 4CIWA 3PCXA 1TL3B 4U7PB 1N6PA 2OBXA 3HY3A 3BF7A 4YBZA 5FL7D 5KDOA 1G5IA 3IPCA 3GYNA 3PNLA 1EK2A 3ZQKA 1TX4B 4JJGA 3CZPA 3WA6A 5HMYA 2R79A 1AHNA 1I1GA 4DIMA 3O4RA 3TXAA 3MMCB 1HDIA 4P3PA 1COWA 2HRTA 4Z49A 4IFYA 3ZZNA 2GIQA 3BCRA 2I3GA 1TZMA 3LHKA 4UCQA 5J1EB 3AUJB 3Q6NA 4EKYA 1EUDB 3FRJA 3ETEA 3WIDA 3KHHA 4N5LA 3QH4A 1D1UA 3HVJA 4TQ9A 1U9IC 5F3WB 5CH8A 2EKDA 2QGFB 1QBGA 1ML3A 3FYUB 3B38A 3JRNA 2QZPA 1Z8HA 3OQIB 4ESHA 4PFJA 5AVRA 1GLNA 4DY4A 2XSJA 1UKEA 3KHLA 3HA7A 1TW3A 3DW1X 3GA5A 5KAMA 2F1IA 2ZUGA 3A37A 4B79A 5JS1A 2EP5A 4YP3A 1ZMTA 4JYAB 3S2YA 3QJJA 4OKSA 4XAQA 1Q14A 2QTBA 4U67Q 3AKYA 4L6AA 5DJBA 5CYPA 3GRKA 2W2LA 4JI6J 3PJGA 4KXYA 1DZ3A 1MJGM 3QMWA 3L07A 4F45A 5HROA 4PEVA 1KY3A 2Z8ZA 5E7MA 2DAPA 3O38A 3FZYA 4DV1J 1YK0A 4MAFA 3OEEA 1RP7A 2O2DA 4C4YA 3WC0A 4DR4B 4MAKA 2ZRMA 4D44A 1EQUA 2FN8A 4IZOA 4QSHA 9LDBA 3G1TA 5DM7Q 3NXZA 5LL6P 2P90A 2BANB 2EJUA 1BMFA 1CJTA 4KE7A 2CB9A 2WM2A 3RARA 2AJ0A 3T41A 4USMA 3HRKA 4BV2A 3CC4S 2OLKA 2FAXA 5FWYB 4JZYA 3PCTA 3QEJA 1MEOA 2JBAB 1V9OA 3AL3A 1KO8A 5A0YA 3L1JA 1H0RA 2D3UA 2LLZA 4GPBA 2JKVA 2Q9AA 2WJGA 3RRMA 3MRTA 3QZ8A 3R41A 4EL0A 2PPLA 3P0JA 1M2JA 4XLLA 4W5JA 1OT3A 1UK8A 3VRHA 2BQ3A 3FCCA 4Y6LA 5FR1A 3LRTA 1K8QA 2YVQA 2HDNB 2HSWA 4DADA 1USVA 4IMJB 4WFKA 3EXIA 2ZSDA 2IA0A 4IICA 1VBKA 3WMFA 3N0VA 4A82A 1RDFA 1X9GA 2VP2A 1HBOB 1F60B 4EHKA 1PO7A 4NR0A 1U2QA 3AR9A 2BFFB 3AW9A 5BYAA 1KJIA 1ZZGA 3R5AA 3WK4A 1X3LA 5LMNF 1PO6A 1J5EB 3PC4A 4QQ8A 2P5VA 1Y3HA 4ZYXA 1P2BA 5KDDA 2WILA 1S1UA 2FUG6 1RJFA 1L6IA 4BX9A 4HI0E 3DOOA 3C39A 4F4UA 4UY8T 2K7ZA 1ZYUA 3KJVB 2LD4A 1T05A 4DR3F 1B4DA 1SKYE 1AUQA 4UHHA 1P5ZB 1R8SA 4WKGA 1XJ5A 1FXRA 1TZ2A 3ZQ6A 3L8CA 1L7PA 2EWWA 3JD3A 5C5IA 1X86B 2FF5A 1P1LA 1JDVA 2OXEA 2XX3A 3DR3A 5B3JC 4BJ1A 1B6GA 3K0HA 4JLBA 1E9AA 4O2BF 2JLEA 3M8WA 4Y9UA 2HV8A 4TTTS 1A6LA 3UA4A 1L3UA 4C2BA 4CW7A 4KO0A 3KHSA 1C9DB 1NK5A 3BZWA 3GPDG 1EGHA 521PA 4D56A 3O4GA 1ADCA 2DLNA 4J2HA 4Y6SA 4OX7A 2D54A 3QXSA 1J5PA 4CI9A 1MN9A 1K68A 2PKXA 1PJ5A 3DEIA 1ZOSA 3OR1A 1JPNA 3QVOA 1Y34E 3B3JA 1FPQA 3E4DA 5JYEA 1M6VA 2CFCA 3PCRB 3I0NA 3ABQB 1GWNA 2Q9BA 4KV8A 2H48A 5JECA 1SWVA 2C54A 2CLSA 2QPLA 3A2MA 4DV4J 3BKUA 2QDXA 1BD4A 3OJ0A 3PUYA 2HNAA 3RYIB 5DM4A 4FF2A 1TD9A 5AHOA 4C29A 4UUMA 3O91A 1GIAA 2EX1A 3BFVA 3SMVA 4L9SA 2YWEA 5BXYA 1SCJA 2GOYA 1GZ7A 3NGSA 4EGJA 1YRTA 2GPYA 4RMJA 3RUDA 3IEIA 2M32A 3DOUA 2EXUA 1H69A 1IQPA 4D9JA 1WVGA 2Z3WA 3ZCSA 5HZKA 1H2FA 2WTUA 1AKQA 3NLCA 4R7ZA 1SRRA 4CF3A 1Y0BA 2V5UA 3EXEB 1FSSA 1Q5PA 3RFUA 1R6TA 1JEQA 1HD0A 2Q5QA 5B2ZA 3BK1A 5JWRA 4RPIA 1VZ2A 4CKBB 4HGOA 1MQ8B 3ON5A 1SBIA 3GEIA 1Y6JA 2FGCA 5K03A 1JJ2R 3WYDA 1RM0A 4WLVA 1XTTA 3FMGA 4WFNQ 4J1TC 3LPDA 1P2DA 1UOQA 4Z7QB 1TIPA 2YWHA 3VSDA 2EF0A 3NRCA 4B80A 4UHFA 1SUQB 4TMWA 1DBRA 4AXBA 4W6ZA 1BMQB 1U28C 2XMRA 3Q11A 3ZQJA 1ONPA 4QWMA 2J4DA 2VBXA 2XUZA 1MRNA 1GGJA 3X1XA 4KO1S 4EYHB 2FX2A 2VYCA 5G02A 1AHPA 1WF6A 1QHEA 2OILA 4R83A 1KO1A 1NTOA 2YV1A 1EKSA 2RKWA 1RKVA 1USGA 2J3KA 1EXVA 1R18A 4AL4A 3IOMA 1YR3A 5KVSA 1YZ6A 1X15A 2PQMA 1D5CA 1E2EA 4NU6A 3R97A 1FZTA 2JC3A 2WCXA 4LX0A 3ZKAA 1Z75A 4LC9A 3NZEA 5KMGA 1ZJ6A 2FYTA 1P7ZA 3BL6A 2HFKA 1R12A 3QBDA 4HUJA 1U25A 2CUZA 4YMTA 3OE7D 1P4RA 4M8IA 4NCXA 5JJCA 2HK3A 1JKHA 4Z51A 4BVEA 3SYNA 5THQA 1E4OA 1XQ9A 5J2UF 3O8QA 16PKA 1RWKA 4EW3A 4NI5A 1QFXA 3L1VA 4F12A 4HNTA 1FDIA 4RBTA 4YMLA 5JASA 1E1RD 5K05A 1CUAA 1CUFA 4D57A 2W48A 4REQA 5KYUA 4FMCF 1NJ5A 1R0LA 3QOFA 1S3FA 3E1KA 5EQFA 3M8ZA 3CZ4A 3EISA 5CX1A 1GARA 5IX8A 1EM6A 1UPAA 3QLHA 4BE9A 3AI7A 4JWTA 2HWTA 3AEXA 2ZJQQ 5AKGA 4CWAA 3R1LA 4RWZA 4N8DA 2DTDA 2ZRKA 2Z5VA 1H73A 3UMRA 4OYAA 3ZIAA 4LHVA 3WXMA 4D4MA 1RBOB 4FIDA 1Y37A 2O7SA 2GJ8A 4MW7A 2E5JA 3GBVA 1ZA2B 3RR2A 4Q3CA 5BN5A 2AJ8A 4PX5A 1RHKB 4TXNA 5A5EA 4R0MA 3S2FA 1U2TA 3OUUA 4RE6A 5C81A 4GGPA 5D01A 3P2JA 2L69A 4HLNA 4ZXFA 1U5CA 3QPBA 4OX9F 1KP3A 2YXNA 3MR5A 3IDQA 1VBMA 3CUKA 2OZVA 3F2VA 3AXTA 1LZKA 1ZJZA 1OZGA 3DGEC 4IX1A 4FR5A 3TLKA 4IIJF 1NK0A 1ODIA 4CCWA 1WHXA 2XZDA 2BJ8A 1GXSB 4X7RA 4CCHA 4B3JA 1W5FA 5E6RB 2J6CA 1UDRA 3TQHA 3OE1A 1VRWA 1SQFA 3N6LA 1K08A 3ZE0B 5IK2D 4WV3A 4WE1B 1Z73A 4CM2A 3TOSA 4QPCA 4LWPA 3OSUA 1R8JA 1JRLA 1QAYA 5JAPA 1ZCAA 5IN5A 2B98A 3LKBA 1OI7A 2R6AA 3FCOA 1FSFA 3NBZC 4LOHA 2Q7XA 3H1EA 4N5SA 2B4RO 1UBFA 1YQWA 3RAQA 2R7KA 4X64J 2ZJ5A 4CQLA 2Y1LA 3VV2A 2U1AA 3KG4A 3CRZA 4WGFA 4NMLA 4JS0A 3RJTA 5KYYA 2NYRA 1TIBA 2J0XA 4XIJA 3LPLA 13PKA 4QNMA 1HSZA 2QTLA 2KHZA 1HEYA 2P7HA 1XF9A 1XU4A 1J8DA 2VIHA 1RRPA 2LVWA 2PR2A 3I61A 2EIHA 1Z8DA 4YRLA 4YQWA 4GM0A 1B7FA 1CFJA 1HI1A 1R0BG 4ZOEA 1RZVA 5BN3B 1XB2A 3M8RA 3EMVA 3EVOA 4DMFA 2V4ZA 4G3IA 2L0XA 3A9RA 2VB6A 1ZVJA 4QOFA 3S1TA 4CM8A 1YJRA 1I0LA 4ROTA 1JLLA 2VOEA 3A3NA 3B2NA 3D5EA 2A1BA 3QPAA 4P3OA 5DN9A 3QKTA 3AFMA 1CDOA 3OFGA 5F1PA 1RHUB 1YFZA 1L1RA 1IBKJ 1DQZA 4DV3B 4DUPA 5FCDA 3PEWA 2JAUA 4Q15A 5EJ8A 3PD0A 4MVJG 1TQ4A 1HETA 2UUAB 3SXPA 5BR8B 4ED3A 2WMYA 3Q41A 2XY5A 5CGZA 4C1NA 1ILEA 4E4RA 3TJRA 3L4JA 5D2CA 5FWAA 2E6UX 1RQ0A 1TUWA 5INTA 3S8YA 5HIMA 3ABIA 5KJ6A 3O4IA 2YBDA 4KL8S 4BLTA 3VR6D 1DQPA 2R5NA 4EHFA 3DHEA 4Q4HB 4JK3A 5A6PA 5CK5A 2ZSFA 2FX5A 5IXUA 1ESNA 4KAFA 5C1IA 1FKOB 1RJDA 3UKOA 3V1YA 2FC8A 4OYZA 5GVSA 3GGJA 2CPEA 2ZSIA 5C5EA 3L5KA 4JMLA 4GUAA 3ANLA 3L6RA 2MQPA 2Q4OA 3HS3A 3MJEA 2JD0A 4X1IB 1RIIA 3IPYA 5L1IA 4IL5A 5C4IA 2YJ5A 2H4JA 3RIYA 1M73E 2Z0MA 4LOIA 4X3CA 3E9EA 4YWHA 2IYRA 1U7DA 2J5BA 4KKVA 1TUBA 4KGMA 1MA0A 4JI2B 5LYJA 4CM9D 3HJAA 4F9TA 3FMPB 4BATA 3DZDA 4ZTUB 2ZR8A 1MB3A 2XYGA 2VP3A 1XJQA 3FTQA 3REQB 4DAEA 4WBFA 3AR7A 4LZPA 4FYVA 1KRWA 4N65A 3RADC 2WD7B 5SYMA 2KG0A 3H5VA 1WHSB 3VTFA 3LI2A 3U3ZA 4O4IB 3VR4A 3QUQA 3RFXA 3FWPA 1V3ZA 2YV4A 3GXOA 1HTTA 3BWBA 3MUOA 1RAHB 4MLDA 4FSDA 4LRUA 1VQ9S 4F1WA 1PQYA 4L3WA 4I6AA 1BWSA 3K4HA 4NPOA 3W06A 4MTLA 4TY9A 5K0SA 5EZYF 5ADHA 3CF5Q 2WT9A 3OMLA 5BQOA 1EUYA 1ZBQA 1IVYA 3W2TA 1PHRA 4YLEA 2AN3A 3A8JA 3D1OA 4U3JB 2XNKA 5IDVA 3TTSA 1ISRA 1QQTA 5FR2A 3TG2A 1IOLA 3UO0A 4MLCA 4M9ZA 2CJPA 2VKTA 3PT5A 1BXKA 3RYFA 3WL3A 3MMNA 1O08A 2GK6A 4NL5A 4PLCA 3EYZA 2FNAA 4BGUA 1O5JA 1HW8A 2AEMA 4ZI7F 1H9BA 3HKDA 2O8FA 3DB1A 1KYXA 2QD1A 2R8ZA 2P2LA 4K4WA 4U96A 3ZDRA 2VL7A 3IBSA 1PJLA 2ZE7A 1Q0PA 1TUEA 1GNTA 1BHSA 3L40A 4WJKB 1S4EA 4DQPA 3VPCA 1ZRHA 4ED4A 1W34A 2EBWA 2HSEA 1IN6A 4AUNA 4U2EA 1RLCL 3DBHB 4ECAA 2AJBA 1CJVB 2Q49A 4YPOA 2RAQA 1OY1A 2V0GA 4DG5A 1RA6A 3K35A 4P86A 1FK9B 1DC7A 2YH1A 8AT1B 3ZHCA 3CLTD 1S6PA 2D3TA 4MT1A 1I2ZA 3CTRA 4RFSA 3C8DA 1A69A 5EEGA 4MO9A 1MB4A 2BM9A 1U31A 1UBNA 4JV1A 1ZK2A 2RDMA 1ZIPA 4UT4A 1US8B 4EPYA 2PMKA 4X1YA 2FVSA 5F5XA 3KKPA 3HYCA 4OIFA 3ZJ5A 1TJNA 4D45A 3D9QX 1PX0A 1NAIA 3LTOA 4ZODA 2RQ4A 3ENAA 3V4MA 2EW9A 4PN7A 2PUJA 1NKTA 4EUHA 1JWWA 4B3MF 1OX4B 3WIOA 2Q3PA 4U8YA 4RACA 4K0KB 4ON9A 3T5MA 2DK2A 4DBLE 4C8MA 3TZ6A 5IXJA 4U6SA 3IP6A 4F3TA 1XC9A 3W3ZB 1UBMS 2W22A 4ENTA 4XWOA 3NOOA 5DXFA 2GVDB 2OE2A 4Q1FA 5FAKA 1TELA 3F0TA 1X9MA 1X0PA 2J5RA 4BIIA 1AMUA 2LIVA 5ALMA 3BPDA 3NAMA 4MVJM 4IJ5A 4D9IA 3GLTA 2FMFA 3A1EA 3UCZP 1XZGA 3FJ2A 2IH2A 2XCPA 5EE0A 2OZLA 3K0EA 3BT7A 1U8AA 1Z6QA 2BTEA 1OXBB 2IZOA 1VLHA 2ETVA 1JSZA 3H2IA 5LJLA 1Q1NA 2ODEA 3O9ZA 3CPHA 4NKRA 2ZCVA 4F3KA 4ML3A 3KJHA 3CSSA 4QPXA 2H2WA 4OQJA 1M2OB 1ENYA 3MPOA 5DZ7A 4FP9A 4ZCQA 2WJPA 3AJEA 4PYAA 4IRCA 3MSCA 3QT7A 1KMHA 2Q6IA 5K0LA 4DR7B 1DRJA 1QB7A 4L3NA 4B47A 2AZDA 3RBAA 3Q6IA 2AD5A 1QIGA 3GROA 5TMEA 1U1CA 5EEHA 1TFRA 2Q1WA 1QIDA 1EVIA 3CRRA 2ZOSA 5F77A 1G38A 4YWJA 1XA0A 1Z68A 4EEXA 3PIPQ 1OHHD 1HPZA 1RWNB 1FRZA 2CPZA 3ZIDA 1KWGA 1ADJA 4LSNA 2XCSB 4B9SA 4UW2A 1TCAA 3WKAA 2Q2WA 3OTWA 5A8KB 2PJUA 2D3ZA 1EFPA 1HDOA 5C24A 5K8MA 1CJUB 3RUBL 3BSWA 2O6HA 3ZCQA 2N75A 4PAWA 4EPTA 4GVXA 1U0TA 2NSDA 1LCIA 2FLKA 2VC0A 3L82B 1MQ9A 2I1RA 5HQ3A 2I6FA 1C14A 3NAQA 1ZNZA 3H5RA 2N3OA 2GPAA 5C35A 1RZMA 5A3VA 3D1VA 4F6CA 3QGGA 3VZCA 3TZWA 3KR0A 1RMYA 1XYVA 4P93A 1JJAA 3ZE8A 3T9DA 5FDLA 3V33A 4Q8EA 2CHEA 2HMAA 1Y11A 3FNQA 3THXA 3WL4A 2X8WA 3DBRB 2ZRLA 2ZRFA 1WSAA 3H0CA 3VDQA 1A5ZA 4UKDA 2LRHA 2VNSA 1JXLA 4GXRA 4FU0A 4BKPA 4ZK6A 4AG3A 4HDSB 4YJ2A 1Q3KA 1SZJG 3HI6A 4RV9A 1XMJA 2ZQZA 5FFMA 3QELA 4YR9A 1NMZA 4NYJR 5KFOA 2VDKB 2AZXA 4S04A 1REGX 3GONA 4A47A 1PGJA 2CPHA 1N54B 1V35A 1TM5E 4ZN6A 5HLFB 1IEQA 3UZUA 4O3FA 4BNYA 2ZAYA 5AXAA 4DZRA 4EABA 1T9BA 3CN7A 1XKLA 4LOKA 4F5WA 3OX3A 4QFCA 2XC9A 4ZHQA 2X9VA 2Q1LA 5BVHA 1HE2A 2I87A 3NGRA 2V67A 2Z8QA 1N5LA 2FF7A 3H8YA 1RTDB 2J9CA 1K1QA 2Q5EA 1KJYA 1OZHA 3MN1A 1M1YE 2BT4A 2HMSA 2H29A 5DETA 4OQPA 3UFBA 4AY3A 3GR6A 5LM7E 2IEYA 4OZJA 3TR0A 5TLSA 1TQ6A 4KXMA 3V8PA 3BO2A 4RS3A 3R4CA 3Q0EA 2AXNA 1XZFA 2AX1A 3N2GA 1Y5MA 3IJ5A 4ZVLA 3KSZO 4ESOA 1Y42X 1HK7A 3QNMA 1G6Q1 2W9BA 1TU4A 2VA8A 5JISA 5ITZA 1SGWA 3OM8A 1JNYA 1VCOA 1MAAA 1QG0A 1R0RE 4M37A 5B0FA 4FN4A 3IEUA 3P8ZA 1ZKDA 3DTYA 3MHPA 4KTQA 1CP3A 1IDN1 5ALJA 3RDPA 3VR6H 3ZWKA 4EYSA 1J5XA 4D97A 4EWLA 3O2NA 3UWMA 2XGQA 1S97A 5I7AA 1SJ4P 3WBJA 4AY6A 1V8BA 3VGJA 2XGPA 4QU7A 2J85A 1I6KA 1LWNA 2J9YB 2O6LA 4JEMA 2XCUA 3IAXA 2CHVA 4RTMA 3SYKA 3DUWA 4DL9A 4FF1A 8ADHA 1OXVA 3NASA 3IR6B 5AW7A 4O3NA 1WRBA 2FZCA 1NDUA 3WJ1A 4F4KA 3HFRA 1CY7A 3AONB 2WD9A 2ALYB 5BV1A 1Y63A 2I6UA 3I6YA 1UQRA 2GPSA 3AU8A 2P6PA 1O95A 2BBWA 2GEFA 1E2LA 5BY2A 2VYND 4US2R 1HEUA 4KR0A 1F9EB 1V0JA 4I3GA 3JSRA 4AROA 5IN4A 4EL5A 2Y93A 4IIGA 2HMTA 1SD2A 2IDJA 4PO3X 2G4BA 3CLKA 3BN7A 3BMCA 2VRCA 4ZEMA 5BWLA 2Q0HA 3W60A 2XMSA 1VI6A 2V3CC 4RU1A 5B37A 4MVJP 4CL2A 2WABA 5JWHA 1ZOTA 2YWRA 5F1KA 4UAGA 3IAS1 4F97A 1VKZA 3HHDA 4O0NA 5GAEU 4AULA 3RFVA 4IHJB 3J7AN 5C2GA 1NVVR 2ZR0A 3RUAA 3H98A 4E5PA 1KP6A 3KDOA 4MVYA 1K5DA 5D4OA 2EW1A 4TZ0A 1HE4A 4BNDB 3DH0A 5ADWA 4NCJA 3TW8A 3VX4A 1RHJB 1D2EA 2WZCA 1KK2A 4XPIB 3AOBA 3ZDFA 1KWMA 1M10A 2I6SA 5AM2A 2I38A 2HBZB 5ERGB 2B4QA 3EZOA 2F8EX 2GEJA 2GBCA 3BIOA 4KMOA 2VJCA 5TNXA 4NV0A 4MRNA 3TJMA 1VB3A 2D3O1 2WQ6A 3SQMA 3ZCUA 1AB6A 1JVNA 4DV2F 1BHO1 1JX6A 3L92A 2CJXA 1T9TA 4DNQA 3HD1A 1DWUA 4EY3A 4URVR 3O1IC 1EQ2A 3NTUA 2HIAA 4D2IA 2Y8EA 1PR4A 3LL7A 3EY4A 2BKAA 1CDDA 4KLCA 4M5LA 3QO9B 2X58A 4W5QA 2KM8B 4O3RA 1ITZA 2GNAA 4ZAZA 5TPWA 3H97A 2NQ8A 4KPGA 1JDZA 2XHEA 1SQ0A 3J81Y 4TY8A 3OHAA 2ZATA 3K5OA 4CM4A 2G2OA 4B3RJ 4F3MA 2VCHA 5JH7B 5KZMB 1SXJE 2ADFA 4O4RA 2ZYSA 2GCOA 3PICA 2XWJI 2H54A 1JEYB 1B8UA 1VBFA 3QKIA 4MIYA 2P75A 2IZZA 1T8UA 1NRWA 3K0FA 3CUYA 1RI3A 2SKCA 3FWZA 1H65A 2B3TB 1IZ8A 3ZUGA 1S2DA 3ZTRA 4NRTA 1WDKA 5KCZA 1IKVB 3PSHA 3G8BA 2GFFA 4ZVHA 2OO7A 3KLIB 4FYWB 1DX9A 1FFHA 1NURA 1UOPA 3QBCA 4HMQA 4K40A 2CNOB 3ZWVA 2XRFA 3SKYA 2PIIA 4GX5A 1RBYA 4ZVQA 2C2MA 2G9UA 1G2OA 4C04A 1ILWA 2HHQA 1EA7A 5DNYB 3AF3A 5HZGA 1UC9A 3PYDA 2CDRB 2ZRAA 5E4JA 2WYIA 3FGVA 3HJBA 3C3WA 3W6NA 3OKPA 3H2YA 4P72A 1E5XA 1E1QD 1N2ZA 1ZNYA 2VYVA 4V38A 5BT8A 3KJGA 2ZCUA 1MZPA 4CCAA 4OJNA 4ILLA 2WPDA 1NKCA 2HVZA 1SUFA 5KTOA 3P96A 5EGSA 1P6XA 1J7KA 4RVOA 4GWKA 3EPGA 4A1FA 2HHCA 3ZW9A 5IAAA 1PDVA 2HGLA 1RYYA 2B0JA 1LW2A 2FEXA 3IUMA 3HGQA 1RABB 3LZDA 1I94F 3DKKA 4LVNP 1RAGB 5IFKA 1WC1A 4RIFA 4N82A 1VJQA 2VPYA 4BMNA 1NFQA 4X4VA 5HBGA 2IYSA 2P9BA 3OECA 1SD5A 4C8ZA 1PFKA 2OPRA 1JHDA 4M5DB 4HAVA 2CL5A 4E6PA 6GPBA 3S5JA 3GJZA 3AVTA 2WM8A 3G7SA 4D82A 4K9PA 2H5JA 5EE1A 1XOIA 5C5JA 3NEJA 3ELUA 4GECA 2HHVA 4FYHA 4B75A 1CRQA 2DNZA 1B6TA 1XZKA 3QT8A 5KNBD 5C7OO 4KWCA 1XEZA 1SV5A 2CFTA 4NU8X 4NLXA 1IM4A 2P6RA 5DQIA 4D6YA 3E5MA 4DV0J 3EVEA 4CEJB 5C25A 2QE6A 3Q87B 3OZIA 3WDSA 2IRUA 1Y81A 2PKCA 3GFXA 3OMXA 4OZLA 4AF7A 3AFIA 2PH7A 3RAGA 1Y5LA 1KC1A 2A5DA 1BYUA 1UZHA 3IG1B 2X7JA 4DR2J 1PTJC 3NWRA 3MZIA 4K5RA 4WPAA 3I4CA 2Z5FA 2CNWA 4GX0A 4W7HA 2GQCA 5LA6A 1PHPA 4MUHA 2PUFA 221PA 5FLXU 2OXIA 1ZI9A 2WSLA 3QUBA 4FR2A 1RXUA 4EFNA 2QAGA 3QTLA 5BVGB 4MDFA 1X74A 3FTNA 1IZ7A 2EEPA 2L08A 5IAOA 1RT7A 4KK4A 2JEZA 1I6JA 3LK6A 1UZNA 2ODAA 1SC9A 3G7NA 3W4IA 2DHQA 3L8EA 3L0OA 2IIPA 5KX5F 4DUGD 2A6PA 4P6QA 1Y1QA 2V7UA 4RA9A 3QVGB 4EZIA 4ZV4A 5JJBA 1P39A 4D4IA 2ILVA 4X7PA 10MHA 1D2RA 2M98A 5HTKA 3CJRA 1UXHA 4J91A 3I05A 5C8ZA 4WLUA 3KT6A 1KKUA 3G2KA 4PGGA 4OYLA 5EAIA 1SOAA 1NVWQ 1SH2A 4GS5A 1VKNA 2IZ6A 3WB9A 4EG1A 5TQ2A 4EG8A 1EK0A 3L8ZA 4H60A 4PZYA 1T02A 1K9VF 2D62A 2Q2QA 2HQ3A 4G0UA 2E4UA 4R2JA 3UDVA 1UDWA 4EHLA 2FPGB 4Q47A 2O5VA 4P3KA 2DFPA 1SN7A 4BHTA 3GYXB 1TMOA 1ZZNA 3HYTA 2PE5A 4XQ0A 2ZULA 4G0XA 1N0IA 2NTJA 1AKYA 3VOTA 4ENWA 3QKWA 2ZJOA 1X4HA 4Y0FA 2ZPAA 1PL8A 4PR0A 3RIMA 1LK0A 1ZZFA 4PABA 5KQLA 1AQUA 1RBLA 1MPXA 2V7WA 2QL9B 5M2UA 1NI3A 5JR3A 1N5MA 2H85A 3L7AA 3L93A 4I9FA 4C0OC 3MEGA 2OBMA 2QA2A 2B35A 2PZJA 1JP7A 2J6SA 1T7PA 3OPMA 5IV3A 1GFWA 4DPTA 1H1LB 3AY0A 1SKBA 4G24A 4ODIA 2HHWA 4OXKA 1XTVA 1OU4A 3KK2B 4DX5A 3FAKA 3O90A 1HEIA 3GH3A 1ZJJA 4LJ8A 3RW7A 3INGA 4P84A 1OU0A 4ARAA 4ZQEA 2GFQA 3LUYA 3HY6A 2KLBA 2GBIA 1I3KA 3FPCA 1M7GA 2BUAA 3P19A 5KYGA 2YC4C 1O95C 3BSYA 4HH4A 5BSFA 3C45A 4NOKA 2KL8A 5FV4A 4E5MA 2DTJA 4E3WA 3EZ2A 4BWMA 4C3LA 2RH9B 2DGTA 5GADI 2JGDB 4GYKA 1G8GA 1K8XB 5I7SA 3DZJA 2IEGA 5IYZF 3DWFA 3M8PA 4L57A 3ZNUA 2XUFA 3MOSA 1V2HE 1NMEB 2VNIA 3OZEA 4K9LA 1YFLA 3EGXA 1T2UA 5ER9A 4MDHA 2C03A 5B55A 2FWAA 1IXYA 5A3SA 4MYCA 3IRWP 3ADCA 3V4IB 1P73A 5BWCA 1U81A 1KVRA 4E07A 5A8WA 2AFVA 2WIAA 3TIXB 3WAKA 3FBFA 3EQZA 3V32A 4PLGA 2DFDA 1HTBA 4N54A 2QTWB 4UUWA 1MJFA 3AUYA 1D4FA 2WLSA 1XPOA 2W2NA 4L5IA 1HQEA 1EBFA 2R7TA 4PANA 3UPDA 1ITPA 1HDRA 4UZCA 4FLFA 5FFNA 2ECOA 4IF6A 4TN5A 1SJQA 2PO4A 2UUCJ 3TYTA 3QQPA 4KLAA 1W36C 4B0OA 4Y1EA 4GMGA 3L4KA 1LDGA 2DCUB 3F74A 4QEZA 4HYTA 1LFAA 1WM1A 2YKGA 3C16A 1IQTA 4ZYTA 5KHOC 2YKMB 1EBUA 3NNCA 3L7JA 3ZLVA 3T34A 5J23A 2JCYA 1B3RA 1YK9A 4QGGA 1MQSA 1NVBA 2Q9CA 5CVJA 2G1KA 3G8SA 1UIRA 4YMUA 4RDHA 1YASA 3G9TA 2VT6A 1TKXB 3GB0A 1RTZA 4I46A 3KEMA 1ZW6A 5A3QA 5AI0A 1RFLA 1RTHB 3NKYA 4BAGA 3SE7A 4OJ1A 3J7A1 3AH6A 3I72A 4H7PA 3T7DA 3CRQA 1OV6A 3EEQA 1ZAXA 2IYZA 2GWRA 3AV3A 2C7OA 2CXNA 3MILA 3FOWA 5DV9A 3EGNA 4OHZA 1I2DA 2H51B 3HBLA 2XY6A 2JGNA 3ETOA 2AU0A 1EJ2A 3EVGA 3NX4A 2HHXA 3EXHA 4XAKA 2PV0A 2IIQA 1Y3KA 4HEJA 3HKEB 4JSRA 4X65B 1XMOF 4TMVA 1ZM2A 2JLXA 2K2QB 3AP3A 3PTZA 1OBOA 2WSSD 3ZEIA 4PYIA 3QU9A 3MMAB 1T25A 4XWWA 4MGZR 1N2IA 3HSJA 3ZY4A 1DRKA 1SQSA 4M60A 4XYLA 4CODB 5ES4B 1M66A 3JYNA 3HFZB 5D7NA 3H05A 1GTVA 4M1OA 2XA1A 1NBEB 1ZAWA 3CPJB 3OJLA 2XMMA 4CNBA 3KUHA 2ODQA 3TX0A 1U5BB 2W2QP 3EG9A 3P4UA 5IKOA 1QTQA 4CEIB 5E8RA 4GWGA 3DM5A 1GTRA 1YQUA 1YJ5A 4RM2A 2LIPA 2VG6A 2R8YA 4F2SA 1WEZA 1I51B 4IV8A 2JLZA 3IBCB 2DHHA 2AEEA 3JY6A 4AQYF 2Z2JA 1GEGA 2RH8A 2P8IA 2ZDPA 1S6QB 2QYOA 1Z0ZA 2F48A 3GFQA 3UHFA 3H3FA 4LREA 2WIJA 3SQLA 5F2KA 2HF8A 4G41A 4B32A 4BC0A 3VAFA 4B31A 1SXJA 3AUTA 3WE7A 4JODA 3IUSA 2E29A 3ZZMA 2ZM6J 3TKAA 1VJGA 2VZ8A 2IYOA 2QMWA 4LDAA 1G3IA 3RS8A 1FVHA 4M4SA 4P75A 1DSSG 3ICPA 4DBLC 3F1KA 2X3FA 2W2PA 4U7HA 1IEVA 1BGVA 5G4LA 1QDUB 2CHFA 3LT4A 2C82A 1PWEA 4DV6J 4HAYA 1L3SA 3NVMB 5HO4A 2AG8A 3KOUA 1T4CB 2X5KO 2NN3C 1LY1A 2DWQA 4AJJA 3VVLA 4BB5A 3V4RA 4R0NA 1XDSA 2HMVA 4IH1A 5K3FB 5KNBH 1Q57A 3OFKA 1YB2A 2VTBB 4ZDIA 2WJIA 3AG5A 3V1UA 2PXXA 4QDZA 2X9NA 3ZGLA 3DT9A 2LDXA 4NV1A 4G5FA 1JQLB 2XE7A 4G1IA 3MMXA 5JUWA 4MYHA 2XMQA 3KXDA 1G3QA 4ZVSB 2HZAA 3G8YA 2OK8A 2B7BA 1XT6A 3KNGA 2P9QA 3LGMA 1UL1X 1KI7A 4BYMA 3JQKA 2HNYB 2CE7A 4G8BA 1IHUA 1E3SA 1P3DA 3GJRA 3WGMA 2C5EA 4NLGA 2BFAA 4MZDA 3S68A 1B41A 2BGKA 4K8OA 2HQSA 5HMZA 4MR9B 3I92A 1SUPA 2NU9A 3TKYA 1F6TA 2HHTA 4CTKA 2A9FA 1BRMA 2HVIA 1YC5A 1AZSA 2H8KA 4OSOA 3IVMA 1UEVA 3IODA 1ULTA 5BOSA 5A6SB 3PPIA 4FFNA 2KYRA 2XF2A 4KI0A 1EP3B 4OYWA 1NLFA 3KQTA 5KTNA 5KI6A 3N8NA 2HQOA 1MMDA 5JRJA 1NHUA 5AKEA 1XK7A 2O3DA 5EWFA 1W6UA 3ISJA 2CMHA 4X4TA 2OFGX 2G77B 1GD1O 3FRHA 3KAQA 3QMPA 1DO8A 5D6OA 2QFJA 3S8MA 4OKNA 2CJKA 5FBRB 3BORA 2UU9B 3MJHA 4IIUA 1RS0A 2ZVSA 2B94A 1E9RA 2R85A 1YH3A 4J8PA 1HHSA 4CT4B 4EPXA 1P44A 2DPIA 2ZYTX 1XCGB 1H85A 2VHQA 5DGTA 5LZ2A 3Q88A 1Z36A 3AT1B 3LJKA 1TQ8A 2H1SA 4ECWA 1DAKA 1QLWA 3PWTA 4KPFC 4EGFA 4C98A 4XYBA 1LBIA 4EHIA 4AO6A 2VP0A 5KIAA 1HNVA 2QV6A 4DMRA 1PCXA 3T6KA 4FHCA 1SCUB 1J2YA 4BJHB 1O5OA 4Y00A 3P5BA 4QLOA 5F1YA 2ZB4A 3PC8A 4P7KA 3M8QB 4L2IB 4NBKA 4ED5A 4K26A 2GASA 3INTA 5ALFA 2Q6TA 2LU1A 2CLMB 3FVYA 3VHRA 1VC6A 3OXGA 4UBMA 1L8XA 2H11A 2PL1A 1BN6A 1G5TA 2IWHA 5TY0A 2Y1IA 4Z4EA 3P2YA 1N5DA 1R74A 2VHCA 4Q16A 3WISA 3DLHA 4NU5A 4AURA 4KR9A 4S24A 2VHUA 3QEBZ 4J6EA 1OWOA 5TT0A 1VQ4S 4CQMB 5M04A 2B6AB 5LZ9A 4EOGA 1F2TB 2J41A 3IOBA 1J7JA 1A9YA 1AIPA 1RCOB 5M5BA 1MW8X 4ZALA 2PCJA 3NHUA 3HABA 1XMBA 4LK2A 4RK5A 3H8VA 5GGYA 3DEFA 5F21A 1S9DA 1TU0B 3FZBA 2WU1A 2IM3A 1E6YA 2GS9A 1OGIA 4BMPB 4WCFA 3U39A 2G6BA 2HA2A 2OBLA 5AK6A 4F1JA 2JLCA 5ALKA 1NH7A 3H0EA 3UWOA 3ONFA 1QVVA 4JI1F 3BDIA 3I5CA 3PR1A 5IQ6A 1UZMA 2OD7A 3FC9A 2WTFA 5DTMA 1ZNWA 3AHHA 3AEKA 4Y2PA 3DOIA 1Z9BA 1KO4A 1IDOA 2C4MA 4DY6A 2BHLA 4G5YA 1W2WB 1W4ZA 4OYHA 5AVKA 4AKEA 2NO1A 1JFSA 3AVUA 3TMKA 2FMKA 1JKIA 2PMCA 3J7AC 5ALOA 4OQYA 3FN4A 2C2XA 2WW8A 2HBRB 4DN9A 2YOFA 3C16C 3NYIA 1L3CA 2FQYA 2J0UB 2AX4A 1ZXBA 5TQ0A 3R5GA 2P2CA 3T7RA 2OHJA 2N4CA 5L3VA 2EFQA 4MGKR 2JFFA 1A8PA 2DJIA 4MP8A 5B4VA 2Q4EA 4AFFA 4RVNA 4G85A 5K6AC 4WNAA 3H90A 4FINA 4TKLA 1QYWA 4PQFA 1FO1A 5B0GA 3E61A 3L77A 4ZEOA 5REQB 4JCCA 3LXMA 5F78A 3OUTA 5FWXA 2PKRA 4QU6A 1VJ1A 5L8RC 2V4RA 3DT8A 2L42A 2VDMB 1AKUA 1TK2A 2HC9A 4HLUA 4RZSA 2W9CB 4UEWA 4HQNA 2AX0A 3AEQB 4S05A 5FOXA 1W4BA 1RXIA 3W9JA 3DCYA 1BVYF 3DFZA 3SYTA 1YRBA 4FPXA 2JLAA 4MGYR 1XX6A 1G0OA 3ZXUB 3EXHC 1PQWA 1AN0A 2YKAA 3OFHA 4GH5A 1EFVA 2Q9UA 3GUZA 2FR0A 2ZYUX 3F2IA 1TVRB 4RIIA 1F3VA 4BP1A 2C7BA 2XEDA 1A4IA 3OLQA 5CAEB 2CFOA 2F3SA 2FVXA 3OC0A 2FGOA 3EOZA 2YVLA 2CWKA 1KOOA 1XPUA 1FXWF 4GOND 4AZWA 3DM2A 4M5NA 1UAAA 3W64A 1JDNA 2N4DA 2C0CA 1QU3A 1I7DA 1UKCA 4LF8B 3K5MA 3GIMA 3KV3O 4IFTA 4B48A 5E3JA 4D9GA 3N3AC 2IEAA 3WAGA 3R77A 4DUZJ 3WOHA 4BDPA 2D41A 2B9YA 1PR6A 3WBBA 4RW4B 1HZZC 3IFEA 1NF2A 3O2SB 4G25A 1EEHA 4ARCA 4I19A 5HG0A 1GX5A 4LKRA 8ATCA 2V2QA 3AOEA 5HGJA 3TI9A 2VJAA 1OO0B 4UM5A 3ESCA 2H31A 3MINA 3CSUA 4N7RA 3M4JA 5I9TA 5KFUA 1EP1B 2ODPA 4ZPXA 3L09A 2QTZA 3M7VA 3NDIA 1RWOB 1ZH6A 2GVZC 2FR8C 1SXJC 4DPWA 2FETA 1QORA 1T9UA 2X0EA 2PRJA 4AT1B 2XAUA 3IIMA 3RVKA 2BJ1A 1QC5A 3PVZA 4MKIA 1SC3A 3TQ1A 2J5KA 3DF7A 3G6ES 4RCYA 4TKZA 1FDUA 4HR7A 3OE4A 3NATA 1TO1E 4I55F 1YSCA 2IHTA 4M38A 3K53A 2BYTA 1OYYA 3HADA 1E59A 5F64A 5K2MA 3JWIA 1NRJB 4KHPJ 3UMMA 2AXEA 4OM7A 1NXTA 2YNMA 2VA2A 5E4FA 3C6QA 3NFYA 3EPKA 4N40A 4NYPA 3UG6A 4B8YA 2EVZA 2QBYA 5KFAA 2ZIGA 1NBMA 1YB1A 2HPAA 3Q7QA 4FHZA 4MYUA 2C98A 4ZZ1A 3PQ7A 1AGPA 3H4TA 2CNNA 5DHTA 1UL3A 1DXYA 4MVJF 2M9KA 1X9WA 1AQ6A 4LHWA 1KZ4A 3CTMA 2O3TA 4R8KA 1IPEA 1YL6A 4MYDA 3SIXA 4AB1A 4LF5J 4MRPA 3VI4B 4U9IS 5DNUA 5CXXA 4E7OA 1A0OB 1GGMA 2FZKB 3MWLA 2H63A 4YO7A 4ZMBA 1IBSA 4MI1A 2GN0A 3WJAA 3L01A 2G7MC 3AVQA 1ACMA 1KYZA 1RWVB 2IEIA 4CT5A 2G1PA 4ATNA 1AZSC 5LB4A 1D0EA 3DFIA 3E7XA 3CIMA 3GQBA 1DKNA 2W7PA 1A5SB 3U4AA 1JQJC 5T57A 5E9AA 3T7IA 3OT9A 2UAGA 5AJ3F 4TMFA 3S8SA 1P18A 2X2EA 1TL5A 2A0FA 4KLZA 2EG1A 3DUFB 3GHHA 4ZEVA 2FVYA 4PNPA 3PDCA 1KHTA 4RJVA 5JZBA 2RGGA 5C7YA 1ODFA 1D0VA 5E6SB 3RRBA 3R6LB 4PZCA 1PJ8A 4ZPJA 1Q21A 4LQ9A 4FBLA 3ZGYA 3INNA 5FH9A 2OTLS 3KL2A 1RYMA 1NM2A 4C0QC 1JF8A 1POXA 3EPLA 1ENZA 4PIMA 4MV9A 5JZVA 4E70A 2PRZA 4DLBA 2WIBA 3TE6A 1TGVA 1V16A 3EODA 3MMSA 4B83A 2CGEA 2XV1A 3PQ2A 4M49A 1DAIA 3NNHA 3BWMA 4Q7AA 2MKIA 3C97A 4MW9A 2ZVJA 1QTNA 3RS7A 2EERA 2R751 4NH0A 4XOUA 1UCFA 3UC9A 2G6TA 4MWBA 3F8SA 2NVUB 3I2YX 3R3TA 1U1MA 3OG9A 3OQHA 2XVAA 1NJ8A 1HPLA 4JT4A 1CVRA 2NLWA 2WV7A 1UAWA 3MM4A 3RVSA 3BYZA 1N2JA 2PO7A 4C5CA 3EXG1 3A4LA 4ICLB 3A8TA 2A2ZA 4DHWA 1VDMA 3G9CA 2BIFA 4Q4AA 3QX8A 3K7EA 3C6UB 4F2GA 2WTMA 1HBNB 4M95A 3B1KA 2UXBJ 4X1KA 1C4OA 3AM5A 3WMEA 3KUEA 3CW9A 1AE1A 1GU7A 2PEZA 3HHLA 4X9XA 3CTPA 3EC1A 4PG6A 3ISND 3ZV7A 3UJ3X 1OSDA 3W5XA 5A2QU 5KTPA 3HVIA 4MQUA 4DQIA 3PJ9A 4DBQA 3QE0A 5TQJA 1DUSA 4TTSA 5HQMA 2PA0A 4Q1VA 4KGXB 2IUUA 2ZH2A 2HWKA 1QVWA 1KFBB 4U5XA 3FGPA 4PONA 4XGQA 3DRSA 4L5BA 1LWCA 3M2VA 4UXIA 1QQ6A 1BD3A 3GZ7A 3HXKA 3AB2B 1UKBA 4OHYA 2LDBA 2A67A 4ILEA 4XQ9A 1UT8A 4O4HB 4YN3B 4DPXA 2VC2B 2JCSA 3FTCA 4L8FA 5ENVA 2B92A 3WK9A 1JR6A 5DU2A 1RHRA 1CVLA 1CJTC 3T5DA 1SM4A 4QC2A 4M0EA 1LWFB 3HZGA 3SXJA 5E2IA 4KVGA 5CXTA 4HTFA 4OXNA 1A3CA 4OX8A 1DG1G 4ZCIA 1O51A 4PWZA 3PI7A 1AA1B 1XA4A 3ROGA 4RABA 3SHOA 4U00A 3PNSA 2PZBA 2RMKA 4N03A 3EDCA 2C1EB 5C1PA 3C7TA 1SU6A 4FQ8A 3JWHA 4FDTA 4N7JA 3RB8A 5EMLA 3AINA 5G0UA 3WC4A 4YAIA 1QAXA 4FK8A 4JYMA 2PRYA 4PEOA 3T6JA 4G63A 4ZQFA 5JD4A 1SJ1A 1CUYA 4FUQA 2EBHX 3PU6A 2HFOA 2AW0A 3Q15C 2XHCA 2CW5A 4YV7A 1M2GA 5A4KA 1E2UA 1V1MA 4KC5A 4QT0A 5LOVA 5JEDA 1A9OA 3CZAA 4JI7B 4F0HA 2X51A 2HYIB 4HQRA 4N4AA 3ZCPA 3F7NA 3IEXA 1Z56C 4HLUC 2X8BA 4IG4A 5ES3A 3DN9A 1YO6A 4PZ9A 3A31A 1QIJA 1Y8ZA 3KU1A 4M21A 5DRTA 4ZHSA 2HK7A 2C8KA 4CEHB 1GKUB 4OI4A 5J2UB 4DLWA 2NWQA 1S7CA 1YBMA 1WG4A 2Y3YA 4XFKA 1LRJA 1FPMA 3VFDA 4XDCA 4B6PA 4R2HA 4FCCA 3BMNA 1ZUD1 1E3QA 1D9DA 1A2QA 4QIWD 1O9BA 2RKBA 2WJHA 2QU8A 3G9XA 2RHDA 4LYYA 4XQEA 2G04A 3FFAA 3KHRA 2H17A 2YZNA 2HK6A 3IT2A 2I22A 2IX9A 1OGYA 1UBLS 4CIDA 3LW8A 1K3FA 1DQ9A 1Y9DA 1XHLA 2IHNA 3VZQA 2CKWA 1DX6A 3E18A 2JFZA 5EQTA 1CEEA 2X5NA 5GVRA 5JSFA 1U1DA 2GZDA 4HACA 4M1ZA 2MLYA 3EZ6A 2JCGA 3U1LA 1IJEA 2GCPA 1SAYA 4AZTA 3U49A 1Q0UA 2AIRA 4YP7A 1FQWA 4EBFA 1VSQA 1SUBA 3ZUPA 1OTXA 5FNVA 3FPFA 4MITA 2I7XA 4YDXA 4FHDA 3AOEC 3UHJA 3FUTA 2VT2A 3QIPA 3PQ6A 3K0AB 4JV0A 4OX9B 3P45A 2JCBA 2Z9CA 5CNMA 1WMFA 4MFBA 4WKCA 3G5UA 3DI6A 3QG1A 1K92A 4AC9A 3MD3A 4P98A 1XEXA 2GWHA 5SZHB 3OPKA 3GJ5A 4XOIA 4OXXA 5L95A 4OYOA 3UMYA 2A0YA 4TXSA 1JB0C 2COUA 4MRMB 3KUGA 2RGRA 3HA2A 2W4QA 1JG6A 2XMZA 3ET6A 3M9MB 3AZOA 2IJFA 4JLVA 1R4NA 4JLWA 1LSOA 4RSRA 4CLXA 2DLCX 4Z4IA 3AB8A 1PWZA 3HB1A 3Q9LA 4XUEA 3DYBA 4G5HA 3W8PA 3B6KA 3FBTA 3IC5A 4XRRA 2XG8A 5EXXA 4J4BA 3BRQA 5KJ1A 1MF7A 3PLRA 1SB9A 3I9KA 3F3KA 1GH8A 3AF1A 3AERA 2DXFA 3T5AA 3UD3P 4UBJA 4OREX 1OSNA 2WYUA 3PUWA 2GCIA 3EGWB 1M2WA 4GYWA 3EUEA 3TRIA 2YASA 4C7OA 1SC4B 3NJ4A 3DEJA 2O8BB 2JK0A 3DXXA 1AKEA 3VO1A 2Q4RA 1J9ZA 3K72B 5HKKD 4CMIB 3PGMA 3CISA 1L5VA 2E1CA 1IKXA 4OK6A 3PDHA 3CZMA 1QANA 3EJMA 3JPWA 1YS6A 2B30A 2EWMA 2QJTA 2ZVIA 5P8WA 1YQ9A 2YHIB 1Q7YT 2ZDHA 5EMKA 3R2JA 4WN3A 3JQGA 4G9EA 4UNSA 2ZXUA 4YY3B 1B6SA 1UPTA 4CO5A 5EHHA 3ED1A 4BEBA 2R8PA 4PNEA 2ZUTA 3ILSA 4NCHA 4UTZA 2A0KA 3GG9A 2DNHA 3A0RB 1WD7A 3MTJA 2YWKA 3KLVA 1EGQA 4P4SB 2HBQB 2GEKA 2AQHA 5AE2A 4TTJA 1UFQA 1IKWB 3D6TB 4LMRA 5C42A 1Q16A 5KAPA 5EUCA 2XTJP 3PZRA 4DB4A 2TSYB 1S7IA 4BDSA 3P9PA 4EB6A 4RLSA 3KKFA 3R5CA 2VP5A 4BO4A 5A05A 2JLVA 4I5GA 1CBUA 3V1MA 4DR5J 4KAIA 4HGNA 3CBGA 5CUQA 2E4AA 2B8NA 5E3RA 2MJUA 1HC7A 4AIRA 3FLAA 1Z2AA 3AB7A 2Y1CA 1GITA 1LNQA 1S2MA 3GSIA 4BVHA 1QYCA 5MLCV 2X7HA 1IH8A 5BN1A 3HZZA 4OHRA 5HUHA 1ORIA 2BLNA 4UREA 1JLQA 1X9SA 2WUFA 5F76A 4FKBA 4X62F 2BR3A 3TEFA 3LRPA 1R8QA 4QZVA 4Y6RA 3A12A 2Z6QA 4TMKA 4E98A 4UFPA 2PQ2A 5SY6A 2HIMA 4HADA 4ND5A 3EH2A 3N3BC 3CU5A 2QD5A 1CIPA 2F5GA 3EK2A 1C7RA 1HBMA 1D9AA 1SU4A 2AMVA 1HI8A 2ZJ7A 4PRKA 3R9LA 1DOHA 1HNZJ 1OVMA 4C03A 2P6SA 1S2IA 3IL2A 2B7LA 2P9JA 2KQUA 2WHEA 4NCKA 3H2JA 4B81A 4RNNA 3QFRA 1S9GB 1AK2A 3EIFA 3HHLC 4G5OA 4MB2A 2QN6A 5H7XA 2FFHA 4MVXA 3IMEA 3HN6A 3FJOA 4FQ5A 2JIZA 4UZFA 1AGYA 4TS9A 2PEHA 4KB5A 4NXNF 3HU5A 8GPBA 2MR5A 2PGDA 3DOLA 4IPTA 2V6BA 1RTJA 5B2EA 1IK4A 4ZIVA 1H6DA 2O14A 2ILTA 4UM9B 1P74A 1GCUA 1R31A 4BFZA 2P78A 3GTYX 3GIDA 1GRRA 6REQB 2P4EA 2FKNA 2J07A 2BFEA 3QBEA 5KC9A 2DPJA 3O74A 2INGX 1KLNA 2FN7A 1JAHA 1TB4A 1U6ZA 1GGKA 4TSRA 4XR9A 3Q8PB 1VXOA 1MO5A 3WX0A 1KEKA 5FORA 1ULSA 5KYNA 5KFPA 1KDZA 1UVKA 1E0KA 4NS1A 2REQA 1FMLA 4LNUB 4NYJQ 1YUNA 4K9QA 4TU8A 4DIUA 3UJDA 2RQMA 2KS6A 5HF6A 5E9JA 1FD8A 4RUCA 3JASB 1E1LA 4BNJA 4C7KA 5T14A 2AT1A 1O9GA 4FE7A 3BBCA 1DB3A 2FPHX 2Y0DA 3MUVP 1L7EA 3A28A 2YW2A 3BILA 4HDCA 2VH1A 2YNHB 2QVCA 4WVFA 5K0JA 3TVDA 1IU9A 4KIWA 1E8MA 3CMCO 3IAS6 2QYGA 1ZVVA 3PA6A 2H5EA 5DKFA 2HW8A 1EK6A 1XVUA 2XIJA 3TOVA 3T1YF 4UQGA 4UQTA 3A9UA 3ZWOA 1BU5A 1WWKA 3K89A 1H2ZA 2X0IA 3T4XA 5KT6A 2ZDQA 1HX7A 2BONA 3MM9B 4R40A 2ATCA 2OXCA 4H6WA 5C80A 2YVAA 5A4AA 2O5CA 3MCSA 1SBNE 4OZ3A 2G1UA 4R1PA 5F35A 3QK7A 2QRUA 2D2FA 2NIPA 4UU7A 2ACMA 5JSZA 5AW2A 2V9KA 5IJ9A 1FFSA 3UK6A 2WWVD 4EQ6B 2BEWB 4UUAA 3UMSA 4WBNB 1C4AA 3KWFA 5L3SB 3OT5A 3HWX1 1DBDA 5KFJA 5LDHA 1E7RA 1EB9A 3DP9A 3O82A 1T03A 2EFOA 2A5LA 4HUQB 4MS1A 2GHTA 4P5DA 2RGCA 1PGOA 1UP1A 1HSOA 3P2IA 4L3KA 1QSSA 4H4EA 5F8IA 1FU4A 1WTBA 3V8NA 4TYMA 1JHOA 1FC0A 3I83A 2QVXX 3D6HA 2O2HA 4KFSA 1Y80A 2B0CA 2WM3A 2ZRHA 3RG2A 3KUDA 1RA7A 1CC7A 1S0MA 2CXXA 2I0FA 3ZDAA 3T4UA 1H8HA 5GGXA 3ZU6A 4DX7A 3C6BA 1Q19A 2PBRA 3ZGOA 3HCCA 2V6FA 3JD2A 2RQCA 4YCSA 3USES 4CZCA 5H4HA 5DTEA 1MOSA 4F1KA 4OI3A 1JIJA 2ADBA 2R65A 3B9BA 1V26A 1V3QE 3UXHA 5DK6A 2VJQA 4HQ6A 4QBIA 1L5UA 1M2FA 4AKHA 1EFCA 4JBNA 1NUTA 1D8ZA 2VSXA 2IE0A 3KK3B 2OC4A 2M52A 4HCJA 3DMHA 3L5OA 1JKFA 3M2RA 3GJQB 3CCLS 1RPZA 1JQBA 2TMKA 3PQ3A 2I7TA 2C88A 2DRIA 4RY0A 2YNIB 2DFVA 4KR7A 4GOJA 3IAUA 4IEFB 4XIIA 3ZGVA 1GPBA 2D8MA 3W2IA 3ZDYB 4CM1A 2GS8A 2YN0A 3OH8A 2VG8A 1J00A 1PR2A 2PBLA 3IXQA 1B3TA 3RTVA 4TKVB 1NVVQ 5JQGF 4GW3A 3N28A 1FJHA 4TUYB 1KJNA 3GIIA 2GNOA 3NV7A 1RQ2A 4ECVA 3R3ZA 4YV0A 3ZWXA 4LF4J 3FZ2A 2WHOA 3UDEA 4JENA 1ZVQA 1KZ7B 4LT6A 1U0EA 3EFOA 1Y8RA 3MWKA 1Z15A 3B5IA 3H13A 5EERA 3OCYA 2C58A 1KJZA 4A6DA 3RJMA 4R3UC 2Y1DA 2BV3A 5AIAA 1F3LA 4Y1FA 1DO0A 3ZU3A 1AOXA 2WHXA 2AV5A 2BOAA 1RT3B 4ZLJA 2B78A 3GZNA 3OEWA 1H42A 3DOEA 1JECA 1CBKA 3D2CA 5F3TA 2X1FA 1PW5A 4EO8A 5LMUF 3EBLA 2FSVA 3CCWA 4R7TA 4KUHA 4IUDS 1IEWA 4CNZA 2Z5LA 3LGSA 3VAYA 1UVNA 1X2EA 1KGDA 2W2XA 2X3YA 3G5TA 3PFCA 1QO0A 3UJ8A 4QW9A 3V4VB 1VQLS 3MURP 1P4AA 4DV7B 1DRWA 4GP6A 3JB9k 4H7KA 3DBVO 2RGDA 3PR3A 3N7AA 3SJZA 2GA8A 2RHOA 4NULA 1X7XA 2PE8A 4YP0A 4GHWA 4IXWA 1Q95A 4PR3A 1PILA 1V5IA 1B2LA 5E1BA 1YZQA 2HVEA 3CCCA 4O4LF 3H9JA 2I78A 2NV6A 2IXAA 3HX9A 1RC1A 5E0OA 4BQQA 1CZKA 1JQ3A 3BF4A 1YJUA 2NP6A 4JGGA 4CLWA 1F8UA 3S0JA 1GAEO 5ALTA 5F33A 3DRRA 3V8QA 1QYXA 3KHUA 1TMYA 4IEIA 4PQRA 1PR1A 3DLEA 1NSQA 3EXFA 2ADOA 4FKYA 5K0TA 1KQSR 3U9LA 3EDQA 4LFAJ 4CQMD 1KSFX 4TSKA 1TTQB 4KYUA 5KSWB 3EA4A 1I0IA 4UMFA 3D3QA 5KG6A 2IHZA 3Q3HA 1GGVA 2XGMA 2WA1A 4F6RB 4OP3A 5D5QA 1NN3A 1GFSA 3DLTA 3C66A 5IFMA 3TB6A 3QG5A 5AVZA 1AUPA 4YRKA 2D0PB 2ZS9A 1GK8A 2GM9A 5LVAA 4EDFA 4J2TA 4B73A 4ZHRA 2BP7B 2AF3C 1QZ3A 5AYVA 3K9NA 3CB2A 2K7KA 1B0UA 1W47A 2XGOA 4EFAC 4EK2A 3D6MA 5HRAA 2G2YA 3LP1B 3KQMA 2MDTA 2OGZA 3AVYA 3FLBA 3ZX4A 4ES3A 1CNFA 5A3RA 1KFKB 1OWNA 4LQLA 1EJ0A 5JHGB 3WTBA 2NPFA 2IVFA 2IPMA 3C3PA 2EW2A 3R7BA 2DEJA 4QQFA 1WTCA 1ZIXA 1YAJA 1X1BA 5B1EA 1G3OA 1I3NA 1LBQA 2FKAA 2ALZA 4MHOA 3RW6A 5LLDA 3DVQX 1A7GE 2DNMA 3AIOA 1P19A 3WQPA 3LX5A 4M0FA 3PL5A 4WIIA 3W9IA 2IP4A 2RCNA 3G79A 4KUGA 3S2GA 2UUBF 2FHOB 2QUHA 2AL7A 4POAA 1V6HA 1T6BY 4YROA 2XAAA 1E7MA 1JHMA 4I50F 1JMTA 1V43A 3UK7A 4GOXA 4AJHA 1ORHA 5AQ1A 3TQSA 4B76A 1RC8A 4JH0A 3G82A 2PEBA 1NC3A 1D8YA 1V8ZA 4QVGA 3FLEA 3WGZA 2WUGA 4V1CA 1QYRA 4F7WA 2ERRA 1MN7A 1H3EA 4YDDB 1R8XA 5KFSA 3HCPA 2YYSA 3F5DA 4GSYA 4CF4A 2J0SA 5L4NA 3CDBA 3US5A 2I4NA 1H72C 2W6MA 2IXTA 4CLHA 5D3KA 3DVSX 4QM6A 4D4JA 1QD1A 4LBPA 4MJ7A 3WQQA 2J8ZA 2G9RA 1KQFA 5KFVA 5ECGC 5LP6F 4ZTZB 3Q7EA 4KIJA 4P0QB 1LWEA 3U1MA 1RHMB 1YGPA 4JROA 3ID6C 3R4VA 4URGA 1L7AA 1UT5A 1JHPA 2JGAA 4Y2CA 3GJXC 5GONF 2C3MA 1ZD2P 4ZYLA 2YDXA 2QX6A 2VNKA 1KI9A 4JX8A 2YVSA 3FGOA 1FERA 1FYDA 5HR5A 5E5NA 1PFGA 4G1QB 1T4BA 4G5GA 1SK9A 4HDMA 4BVKA 1AHHA 4K4ZA 1NH8A 1YUBA 3MOIA 2B9VA 4YJFB 5DYIA 4RTJA 1GL3A 3O84A 3LAMA 4Y2RA 2J7PD 4CR7A 3UYLA 1VMIA 2Q5OA 3ZZUA 2GCEA 1VIMA 2YNGA 3PWSA 1CJKB 4FXVA 4MROA 2R8IA 4GT1A 5G1PA 5JVDA 2HRBA 5IM4A 3KQOA 1JJIA 4KFCA 2W71A 1L3IA 4AMUA 4NU0A 1HBJA 3ESXA 3FH0A 4N56A 3C6KA 1QTRA 2ZH3A 2CPDA 1W76A 1EFHA 3COSA 5FEMA 1IY8A 3KQKA 4UNQA 2C7RA 1U1RA 3F4LA 1N1DA 3KYJB 4P7FA 3GI1A 1Y5RA 1XEFA 2XUKA 1JBEA 2JGIA 3FPEA 1U1QA 4MPDA 4A8JB 3EXYA 1VHWA 2R25B 4F06A 1CS0B 1BO6A 3FMFA 4CMBA 2VQFF 3WO1A 4ECSA 2XE4A 3ZHVA 5ICCA 2B83A 4Q00A 5J5CA 4CHGA 4UBLA 2AQ4A 4PQAA 2ZAIA 1XVIA 3HP7A 4DF8A 4JVSB 2C9ZA 5KTKA 4IRDA 3PHCA 2IAJA 5BSMA 1DURA 3GRRA 2ZYDA 1CSJA 3AP2A 3H1AA 3VTKA 3NCQA 1QMPA 1YR7A 2CQ3A 3BGRA 4MXDA 3ADBA 2WBRA 3G2NA 1ZPWX 4W7SA 2GEUA 3UJ9A 4R5PB 2GHQA 4PAAA 2XE6A 3H5OA 1MWYA 1Z8FA 2D69A 3QW2A 4FNMA 4MTPA 4K9MA 1Z4IA 1UA0A 1M5UA 3K6RA 5CPBA 3MK31 5L3ZA 1JLCA 1NKSA 4HEQA 5L8VA 4E12A 1FXDA 4GM1A 3PXXA 3V2UA 2CXOA 5FX2A 4UHJA 1FCAA 2SHKA 2XLBA 1XLWA 1RYRA 3W5JA 2CK3A 2DY0A 1M34B 2ECQA 3LPAA 3K31A 1WXWA 3IJRA 2PUWA 4QDOA 1T36B 5B0BA 1ZGZA 4PWUA 2Y1JA 3SM9A 5CB4A 4UF4A 1G3MA 3GAMA 4IGIA 1FHTA 4V0KA 2DY1A 4IUFA 5K8LA 2F8SA 2VDRB 1SK8A 3PKIA 5KTRA 4BGVA 1Q0QA 3AQOA 2BBTA 3WLKX 3NWJA 1WXQA 1U2GA 3IEPA 1PU2A 3T9CA 1UODA 2PX4A 4PLWA 1NP7A 4R0JA 2KB0A 3LDHA 5EPEA 3IKVA 4AKIA 3G6XA 1VCIA 3BO3A 5AVUA 2DSNA 3T5PA 3L1HA 4JI8F 4M2LA 2JKZA 4AG6A 4UVHA 4NASA 4E2FB 1GTJ1 1JPUA 3WIBA 4YMHA 4YS2A 3VDRA 4FFVA 1DEHA 3QKUA 3L7IA 4CL0A 1T0UA 3EARA 4ZPAA 4LE0A 4CF5A 1EX1A 1L9KA 2WTAA 1XP8A 4DDWA 1E3MA 3JWGA 2B43A 5IZHA 1P1HA 5EDWA 1C9YA 2VQDA 2GTIA 2JJ4D 1Z17A 2VDOB 5ALIA 1T8TA 4XD7A 3G0BA 4Q1EA 2AB0A 3A1TA 2RHGB 1H0KA 1QR2A 4TL8A 2J0QA 3T7AA 1FRVA 2FEWB 5F51A 1OUMA 1PIWA 4HWKA 5IC4B 4C6TA 2H4FA 2I7CA 3DPSA 1FE0A 2QAIA 2MZJA 4WESA 3GEHA 4HWRA 1IAQA 1KR4A 1ZIOA 4IW3B 5J47A 1WMDA 5F2EA 4AW9A 4MQFB 5DTQA 5GJVC 4R81A 2O4UX 1KOJA 1NW9B 1MAVA 3LVFO 3AMVA 5COAA 2XQFA 1ZD8A 2L9NA 2GILA 2WF5A 5TJHA 5DHAA 2XCOA 1M6EX 3FFTA 4LXUA 3JQ8A 1U3UA 5ALEA 2XMCA 1MFZA 3W6UA 3HJNA 5EOVA 3H40A 2V58A 3MAAA 4QWAA 1SG6A 2V4QA 5K0CA 2PR7A 1YOVA 1KOGA 3F46A 3WRWA 3ZWNA 4Z3OA 3VNVA 4JLAA 1C4CA 3SD7A 2X0FA 1FFYA 3M32A 4Y6IA 5AKJA 4HAIA 4LRDA 5KX5B 3KJZA 2YX7A 4U7UK 4ENRA 1N8SA 4P9SA 3GAZA 2YWBA 3CLRD 2X41A 4RDCA 2J7KA 3MQ4A 1GY8A 1DMSA 4NZ0A 5A2GA 1DFDA 1AB5A 4C3UA 1G63A 2JZCA 1H74A 3S3TA 2C3OA 5KNLA 1RYDA 3I1JA 1U7ZA 4E6EA 1SCNE 2J9FB 1NPPA 4DXDA 4BO1A 2W83A 1ULUA 3VC1A 5JAZA 2JSXA 4X84A 4IQFA 4YMSA 4F96A 2C3YA 1CZRA 1UPFA 4YV1A 2PUGA 2GGPA 1WA5A 1TA0A 3A6PC 4K4SA 2MYUA 4Z7JA 2NPIA 2N3ZA 1AFJA 5HJ2A 4R54A 1LKZA 2W0MA 2CYBA 3LO3A 1Z2NX 1OFTA 3D2AA 3FTDA 4XLZA 3ROFA 1JTFA 5C8DA 5AVOA 3LY7A 4DQRA 2AVNA 1PZGA 3FWKA 3N76A 1XNQB 3RRFA 1NBME 3KVOA 5E3PA 1MQAA 2BSAA 1X94A 5AM1A 5D0EA 4FYKA 1IZ0A 2WKSA 1I36A 1IUOA 2P9CA 3GDFA 4MS4A 5FYDA 4US1R 3CJ8A 2P3SA 2BFDA 2GN6A 1COZA 2OELA 1UW9A 1K6JA 1RE1B 5L3QA 1KI3A 5CYFA 1PJSA 2RNEA 1C3VA 2D2IA 1L5LA 3JWEA 3UT6A 5ICMA 4UE2A 2C2ZB 4PYRA 3C4JA 4W5NA 4J1NA 4RTRA 5B3LA 2QRKA 2HLHA 1U5AA 2B8TA 5J59A 1XRNA 2W8KA 1BX0A 1J6UA 5DMXA 1GRQA 3KFVA 3VNSA 4LBZA 5FUWA 3CD0A 3D8RA 3KUKA 5B4UA 2ZVPX 1H2VZ 4ESVA 5J2PA 3SYZA 2NV0A 2XMUA 2FUKA 1G60A 3DVAA 5IYZB 3CZ9A 1BVUA 2ZYAA 4Z9XA 1ZZEA 4CV2A 5FJ4A 1N9ZA 1RQXA 1JT9A 4MW5A 5GV7A 1JG2A 4NLWA 4WU2A 2HNDB 4MWSA 2RIRA 3K2QA 3OW2R 4QTXA 2CRLA 3HJHA 4KSCA 3HT0A 2JLBA 2Q62A 5AK5A 2YN4A 1USUA 1SA0B 2NXUA 5IUKC 2VPXB 3GV7B 3P1JA 4RSHA 5A9TA 4WZBE 3ZD9A 4BVGA 1JPVA 2CBGA 2HLDD 1N5IA 1AFIA 3EYAA 3CNHA 1JH9A 1QOQB 3JYTB 3EWNA 5DT2A 2XZTA 5F3DA 1Y1TA 4NAHA 3ADDA 2OL4A 1CY4A 2WWTA 3IBTA 3EDMA 4CMEA 3SIPA 4Y6GB 2QPTA 4AZ0A 1V7QA 1USKA 5D3QA 3UF0A 5KQRA 4ENVA 1HR0B 4N7TA 2C97A 2N47A 4HEHA 3BFPA 5EUBA 3V5RA 4A27A 2CUYA 1GYQA 4NI2B 5D84A 1FKAF 4YNBA 4MQLA 1REQB 1P1RA 5EJ7A 2QAGC 2R97A 2F1KA 5KNDA 1RJJA 3E82A 2LE0A 2B9EA 2QM7A 4BMYA 3JQMA 3EX7B 1WC5A 4TS4A 2HU2A 1WVIA 5ALZA 2FB9A 4DCVA 3AD9C 3BAZA 3KJNA 1EDDA 3O8WA 2VBWA 2NTYC 4TT3D 1OS5A 1I4WA 2DTEA 3PFFA 4AFNA 1QKKA 4XM1A 4HNGA 2FQWA 3HFVA 3IUEA 2HK9A 2OZPA 2NUBA 2VUSA 3OJUA 4IFVB 1TPYA 3JSMB 5JT1A 3L46A 3NDJA 1EYZA 4ABTA 5CA0A 4IXNA 2HADA 1XK6A 3UVJB 1CQPA 2DRAA 1TDJA 3VAMA 1CQWA 2JD1A 2DH9A 4W5OA 4D4LA 3NL0A 2O2XA 5DDQC 4W1PA 3G3EA 1W94A 3PXDA 4FNAA 4BO3A 3R5FA 4HVCA 4F21A 3FFIB 3W2VA 3D6VA 4YCLA 1WZEA 4Q93A 2RQKA 1VI2A 2ZJ1A 1E5QA 4HT5A 4ZO8A 2XYHB 2ACYA 3NH6A 1JQAA 1U11A 4N76A 3VU1A 2QUKA 1II0A 4UAJA 2E1AA 4Q82A 2BE7A 4WRRA 2N9UA 3GLGB 4E14A 1RAAA 1J2VA 2AFHB 3UJPA 1ZA1B 3VJMA 2XKBA 3V2UC 1QHGA 4NZZA 1RACA 3RM3A 3K9HA 3I2KA 3ZV3A 4DF4A 1Z4QA 4DHEA 1TV6B 1NXPA 4L02A 4FFRA 4K4UA 2JF0A 4QKQA 1IFXA 2MTBA 1KA9H 4W4MA 3U3KA 3K92A 1C1BB 5H80A 4USKA 2YICA 1G7CA 3GYGA 2PEYA 2QC3A 2ZRGA 1L4MA 1FA9A 3K2EA 4DWIA 2IE8A 2HMUA 1VFNA 3DD1A 1FMCA 2WNSA 1LBEA 1CUSA 4CKEB 1RFGE 3FOAA 4LSLA 2C2DA 2AFIB 1TL7A 3RSOA 1R88A 2CLFB 4MPTA 3J80Y 1ZGAA 5JNWA 3OQVA 1R5JA 4GI5A 4N39A 2M88A 1A77A 1BEZA 1H1TA 5KFNA 1Z6YA 3DTVA 1QOPB 1ORDA 2XVYA 3E7WA 3ASYA 1CE8B 2X9GA 1E6CA 3UCXA 1QKJA 2J45A 3D3WB 1HV8A 4DSTA 3V1LA 4UAVA 1RM4A 4OQFA 1G8YA 1T5HX 3FDZA 4DC9A 3UMVA 3JQQA 4GOKA 5I7OA 2M7SA 5LJ3Y 4ZVMA 1N5YB 4H7DA 1FFGA 2NU7A 4R1OA 3DLLQ 3ITHB 1FSGA 1NWHA 5EX0A 3GUCA 1SXIA 2ST1A 4QA9A 3PXGA 2HCFA 4PE5B 3QVLA 4X5OA 4JP8A 1ZLYA 4UHCA 1PC5A 4JOUA 2Z9DA 4R16A 2FGJA 4LF7J 5HK8A 4EIWA 1F2HA 1T2CA 2GZAA 3LUDA 1PBUA 5KOHB 2HFVA 1UEKA 2PD4A 1QE1A 2MGZB 1Z3IX 5BQ3A 1E1DA 3O8NA 4ZVPB 2YPZA 1AO3A 4M1TA 1ZI6A 4DL6A 4YHBA 1U8FO 2O19A 3R8CA 1IHDA 3PV8A 5CZXA 4FW8A 2YC2C 1AF7A 3BH6B 2ZJRQ 3UAGA 2ISSD 2P2SA 5BMOA 2TYSB 2GBLA 2MQOA 1S8NA 2YMLA 1VA4A 1G1AA 4RS4A 2B1GA 1BYIA 3DV0A 5JW6A 3DOMB 3FGNA 2BE9B 1G19A 5K2OA 4NBTA 4R8UA 3KV1A 2DG2A 4P3XA 4IVPA 5TEWA 1BFUA 4QQNA 1BY9A 2HVDA 1RYFA 4G1MB 2MLXA 2D8AA 2FGKA 1T43A 4OXYA 2ZRDA 3BFJA 1QLNA 1JL3A 2Z56B 1ODCA 2JLQA 4HNAB 2OLJA 2QTCA 3SDBA 1UQUA 5IJZA 3IMKA 1M5KC 3BZUA 4UM9D 2JRCA 2UP1A 4DIFA 2LCWA 5IXSA 4Q8FA 1B14A 5EZ5A 3DLGA 2EHJA 4IR1A 1N77A 2AD1A 3RB3A 2WFAA 3BTOA 2HJRA 5EJGA 1NX9A 4AF8A 1S1CA 4QUKA 1XJCA 1FDDA 4DNOA 3LYUA 4OGGA 3H2GA 3HSSA 7MHTA 2I4IA 4L07A 1WDTA 4GPZA 5K3OA 3RWBA 3ACBA 2W25A 3CE6A 4A6XA 1I3OB 2C95A 3WZMA 4RELA 5FOWA 3GSDA 3VNBA 4QOTA 4QUHA 3UANA 1PYSB 5JFOA 2WONB 5IBRA 1ZL2A 3ZWBA 2P69A 3IBFB 4J03A 2DQSA 5F5NA 1JZQA 4R6WA 3MZ0A 1YR6A 3RNLA 2ZRBA 1TAQA 1Q0LA 4FS1A 1ISIA 3R27A 3FMOB 1N78A 1UUFA 3WK5A 4C1BA 4UY85 2XTNA 1IWOA 1EWRA 4GR5A 3RVRA 1R4AA 1P9WA 2DD8S 1ZSYA 2J3IA 5FA5A 3UWSA 2C8VA 3RBXA 4TTVA 4F91B 3COJA 2AJTA 3GIWA 2APJA 2WTBA 2O0KA 5CYQA 3TCKA 2BJ3A 3P6YC 1SKSA 2CLHB 3RFTA 3MW8A 3RG6A 2FWIA 4J9SA 4RLEA 2VNHA 2NYAA 5JADA 4N12A 1IC6A 2RB4A 1DOAA 1RAFB 2HGZA 1BD6A 3S2SA 3T8YA 4UUBA 2AN5A 3WNVA 5JY6A 2JATA 4MCAA 5LNK1 4GYJA 1EFAA 2AJ1A 1W85A 4AYBD 2MDAA 1DEOA 3W6PA 4J9RA 3AHGA 2MQQA 1DKQA 4PC6A 1SUAA 1GZSA 5JSKA 1L2TA 1YF3A 1XQ1A 3FSJX 5JAIA 4BYGA 4C5BA 3BRWD 3KFWX 4TQSA 3KYLA 3Q8KA 3F8TA 2AOTA 3C70A 4WFYA 3JAMY 2V5HG 4KYTA 3TA0A 2BTQB 1JG3A 1XZCA 4I7FB 2VG5A 3NANA 5B64A 1MIOA 821PA 1P8AA 4K88A 1B70B 3VDMA 3C0KA 4X2BA 1VIYA 2JJ2D 3PSAA 3RI3A 3A1NA 2EKNA 3MF4A 4CMEC 3AQ4A 1W8DA 3RS3A 4NZ9A 1PT7A 5EIOA 5K3SA 2RG7A 1T8SA 5BW5A 3WQRA 2QRNA 3RSZA 1N0UA 4BQSA 1TLFA 5C5DA 3DEAA 2G7ZA 1OZFA 2J6IA 1D2CA 3NM5A 2DUUA 2UYCA 4IR9A 2Q27A 5K14B 3TLYA 2D6FA 4TKUB 3OOSA 2PGXA 5L45A 1BCRB 3NYRA 3QKSB 4IDHA 1FZQA 3VH4A 3JTPA 5JV5A 4HWSA 1KFJB 2MTLA 1E3DA 4OV6B 3P8BB 3FI9A 3C6TB 5SZTA 2J0VA 1Y8QA 3F5QA 4LN1A 3G9ZA 5CM8B 1FS5A 1NF8A 3G2QA 2JFHA 2CPYA 4G0VA 4IKAA 3HU3A 1U1OA 3H8JA 5KFMA 4OAOA 2Z2XA 4E0DA 1TZCA 2AMLA 1X1TA 5LMNB 1KE1A 2GYUA 4XJSA 4Z0HO 1NL3A 1SC6A 3CO5A 4LYFA 1F5AA 4BC9A 2FG5A 4W82A 2XSZA 2MSKA 4C30A 1KDRA 2QSWA 4DR3B 4JJAA 1R66A 3WZ0A 2LZ0A 2FEAA 4F56A 3WLRA 4Z8YA 3T7EA 5HQ8A 3QATA 4WZBA 1B4SA 4YI5A 2ZE8A 1S48A 3L7YA 5KVAA 4ZT3A 4GX2A 3I5XA 3I1FA 4CO1A 4J43A 1PBAA 4EY8A 4YAJA 1RJ9A 3GEBA 5LDDC 4O2BB 2RGAA 1NNUA 2XEXA 1CZUA 2F9JA 1YI1A 1RQNA 3HVRA 4H7IA 1KLMB 2SKDA 4JL5A 5DCYA 5K1ZA 2FQQA 1ZRMA 1TL1B 1GEHA 1YZ7A 3MECA 1SH3A 3A3OA 3D8UA 1BCSB 5TMDA 5IVKA 3L6UA 1WOYA 1OQ3A 1JLEB 1S1TB 1H7WA 1KN6A 1NMYA 4QJ5A 3RYHA 2EU8A 5CH5A 4LFBF 2E4WA 4TV8F 3D6NB 2QL7B 4JKYA 5HP4A 3L8MA 2JZNA 4MUEA 3E3MA 2FK7A 3K15A 4M63A 2E5LF 5D3GB 1TK0A 3PC8C 4OOEA 1UVJA 3N74A 5JYBA 1I3LA 2FJDB 1VTKA 2UUOA 4QUIA 3ODGA 4RH1A 3M1VB 1B1CA 4ID5B 4EZEA 4G84A 2PMWB 2C5LA 5BNFA 3MJDA 1P0IA 3TMYA 3GNLA 1FTWA 1FP1D 1ZJ5A 4IG0A 1HKUA 3PEEA 2D4AA 2CD9A 3CE8A 2B1RA 3AH8A 2QX7A 1TO6A 1IN7A 3PQFA 5EVCA 3EZ7A 4QOEA 3COYA 1AGXA 2VQEF 2ZBFA 1MVLA 1X9HA 4CLOB 3ROMA 3FHJA 2AKEA 1ECFA 3CKLA 2WOMA 5D3ZA 2E85A 3F49S 4AMBA 1ODJA 1TKRA 1ULZA 3F47A 4QR2A 3MB8A 3BGFA 1PYOB 2VJLA 2DXEA 3LY8A 4Q6BA 2MZ1A 1EVZA 3RJZA 5H3HA 5IRCD 3FSGA 1J49A 4WCFC 4NG4A 4A8PA 4DM4A 4PKDB 3L3BA 4JI0J 1KMNA 4QHSA 5F9NA 4JC4A 4HDNB 1LW0B 4YR3A 4MGIR 1NBOA 1ULBA 1U2EA 5DLEA 1ISMA 4JQSA 3UWTA 4XKJA 2R8GA 1U7TA 1I8TA 5A1TA 1PFUA 5FL3A 2I9PA 1PKXA 1XFDA 2WYWA 2XYPA 3NP9A 2QIFA 1I7QB 4NY1A 1RYHA 4AN4A 1YZFA 4OL0A 1CQXA 3KTDA 2IYFA 3JARB 2RF2B 4W98A 1VIXA 1EX6A 2OLEA 4IILA 1CUEA 1YCHA 3HNRA 4DEYA 4USTA 2RB5A 1PVVA 1WE2A 1FX0B 1XLUA 4H7JA 1TJ5A 4BECA 4DCOA 5IJ0A 4OJKA 2D5IA 1VQPS 4IINA 3U60B 3H1BA 3FNRA 4Y1GA 1SKMA 3U81A 2VI5A 5CDTA 1HNXJ 2AH5A 3IA0A 3LXXA 4RKWA 2CL0X 3QUSA 2FLOA 1UDCA 1RRFA 1HA1A 2EFCB 3CH6A 1Q2UA 2YCBA 2E5GA 3UG7A 5E38A 1QCZA 5LBUA 3F7MA 3QU7A 1NWCA 4CKCB 1B26A 1JLBB 5AM5A 2FLLA 5LBIA 5JG7A 2EZTA 1EE9A 2BL4A 3OP4A 4CV1A 4B3OA 5FKJA 5ALRA 2ADCA 4DBVO 1P9OA 1G6HA 4PHFA 3Q40A 5G4KA 3ROPA 1IUJA 2HAFA 3KB2A 3K94A 3O4FA 2WRZA 1S9EA 2IIVA 3CYFA 2FPIA 3BIXA 4R9UC 5FJJA 3IEVA 4BBYA 2FW9A 3Q89A 3HB9A 3D5TA 3X1YA 3RAFC 4WBSA 5BSWA 3OIVA 2HHHJ 4FMCB 3IX7A 3ABRB 3BPSA 3QPDA 1ND6A 4BS2A 4U63A 4Y65A 1R3NA 4F5DA 3WL8A 3V46A 3KJFA 4DLTA 2FP3A 1ZD5A 2H5IA 2QV0A 1XMQJ 1KEUA 4HFRA 2G9ZA 3CJKB 3UCGA 4HHJA 4XDHA 2NUPB 4ZVOB 2V7BA 3THWB 3WGTA 1J22A 4YJGB 4DFKA 3LSYA 4YBRA 2P2DA 3QNWB 1OCEA 1Y4ZB 3OZGA 2ATVA 3VR1A 3RYTC 2XWQA 1MAWA 1P9YA 2BRUA 5F73A 4XASA 5KFEA 1E3WA 2FWMX 2V97A 4FF3A 4YUXA 1X1RA 1BDJA 1IAVA 2R4FA 1IL0A 1O94A 2G0IA 2CVIA 3BMQB 2EATA 4BX8A 1C0UB 2O20A 4XFJA 2PN6A 2QLFA 3O8LA 4B2LA 3G1WA 2BFBB 3PX2A 4MUNA 1RT5A 1FFDA 1SOVA 2PZEA 4IIJB 3N6RA 2H92A 4O2LA 2FPPB 4LI3X 3VGPA 4PQGA 3UD4P 4IQXA 3LWZA 1KY4A 2VUIB 4N6OA 2VJOA 2DHAA 1AV7A 5JSUA 2B37A 3IV7A 4PO1A 4BCDA 1YI0A 2O1EA 3MWJA 2DHRA 1V9SA 2W2KB 1FSZA 3DE7X 3C5CA 1T6XA 4TSFD 4XI9A 2X8JA 2I2AA 2C5BA 4Y3UA 4M46A 5DBIA 4JJIA 4FR0A 2GFHA 4FE4A 3TW4A 2YNMC 3BWYA 2O2GA 4FC6A 3B8HA 1NR1A 1TA4A 4NFSA 4F9FA 4IQGA 2MMCA 3CCUS 4MDEA 3HCWA 5LSLA 1UK6A 1UC4B 1DTQB 3G6KA 4RO0A 2V6JA 2GPNA 5AVSA 2QL6A 1SCKA 3SFZA 4GKJJ 1W93A 4XVUA 1P6QA 2Q4DA 3JALA 3IMFA