3ENVA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
217
structure length
217
Chain Sequence
TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Isomerase
total genus 61
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3envA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3envA01
2QSWA 5HJ5A 3IBWA 3DC2A 4GMKA 2P9GA 3O1LA 4NMLA 3AB4B 1NE7A 3EB9A 3E7FA 4R7TA 2JOQA 3K5PA 2DT9A 1CD5A 3P96A 3LOUA 3ENWA 2F1FA 3KV1A 2MDAA 3OBIA 3TUIC 3NZEA 1ZPVA 1HOTA 3W7BA 1VL1A 4L50A 4TM7A 1LK5A 4IO1A 3MAHA 3EFBA 4M8LA 3CEDA 2P9EA 3KWMA 4TM8A 5T41A 1HORA 3IXQA 4L4ZA 1UJ5A 2QMWA 5FIIA 4PWUA 3OFHA 2RE1A 3MTJA 1SC6A 2RQKA 2WU1A 2BKVA 3ICOA 2CDQA 2W48A 3TUJC 3LWDA 5IT0A 1LKZA 2H9ZA 2P9CA 3CSSA 1KS2A 2NYIA 1FSFA 1DEAA 3LUYA 2KO1A 1M0SA 3TX2A 2RI1A 3OFFA 4OQPA 1YGYA 1O8BA 4LUBA 2J0WA 3DHWC 4GO5X 4GO7X 2QRRA 2PC6A 3E15A 3OFGA 2F8MA 3NWPA 2LVWA 4GO1A 2JHEA 5JJBA 2O0MA 1YBAA 2GNPA 2RQMA 1UJ6A 2I9SA 3N0VA 4X84A 1PSDA 2R5FA 2LQJA 2DTJA 2ZHOA 2PA3A 1JT9A 1RWUA 2RI0A 3NRBA 3OFEA 3LHIA 4R9NA 1Y89A 2BKXA 3BXHA 4L4YA 2OKGA 1FRZA 3ENVA 3CH7A 2J0XA 3BXFA 3AAWB 4L5IA 3HHEA 1FQOA 1FS6A 3TUZC 3S1TA 1FS5A 3BXEA 1Y7PA 3OC6A 3L7OA 2J0EA 1U8SA 4L51A 3HN6A 1XTZA 2FGCA 4L5JA 3BXGA 3U7JA 1UJ4A 5IS2A 3DDNA 3MWBA 2QMXA 1PBTA 3ENQA 5IT4A 1LK7A 3AB2B 3UW1A 3DHXA 4OQQA
chains in the Genus database with same CATH superfamily
3OH8A 4KO8A 5A62A 5C1DA 2UYHA 4REMA 4BZXA 3MSCA 2ZQZA 3LSTA 3I0RA 3QBDA 1T35A 1NBMA 3MM6B 2CNKA 2GILA 5TIIA 1FL9A 2GVZC 3EXG2 4C20A 1V0JA 3HDVA 2C2HA 5TQ2B 3AM1A 2UZ3A 4D0RA 4B3OA 5AHOA 5IV3A 3PGA1 4ZT2A 2B5JB 2AL7A 2Q99A 1T9GR 3TKAA 1NR1A 2ZYRA 1HYQA 2GXAA 3KTFA 1LLCA 1EXDA 4HAXA 1DC7A 1UMDA 4W8HA 1T9ZA 4PX2A 2ZH1A 1GQEA 4RNMA 3CUWA 4XB6B 1NQTA 1U7DA 3SYZA 4ZVGA 3IFSA 2CD7A 2Q1UA 4B08A 1PILA 3FYUB 3WLKX 2QRMA 4K4TA 3CHYA 5J2MB 3FOCA 4J9PA 4BJ1A 4RHUA 4PLCA 1XNQF 4DQRA 3L7UA 2E37A 1RYDA 2VNAA 2CDCA 4FLEA 4FMDF 3R3ZA 2DKFA 1MGOA 2RGCA 3K4PA 4FFPA 4OHKA 3SEZA 1LCIA 4DR3F 3TBKA 1ZP6A 3WV4A 3T9ZA 4YJ2F 2IVZA 3FFAA 5T6BA 1F5AA 3KZVA 2O2JA 4AZWA 4HDHA 1QJCA 2UVUA 1SURA 2D3ZA 3BSYA 4RW0A 1IHOA 1NI3A 1QQ5A 3QP9A 2X8WA 5HGJA 3LG2A 1RQ2A 3SFUA 5DM70 4BUCA 3E1KA 1GCIA 4WLOA 4ZI3A 1OYDA 1YL5A 3D0QA 1ULTA 3R97A 1MB0A 3FY4A 4R81A 5JZMA 1IBKJ 1R9MA 1KVTA 2E9SA 1Q95G 3PT5A 3NMAA 3KKEA 4A36A 4UAVA 4MICA 2OA0A 4OI6A 1H42A 3LYHA 4FBLA 1F14A 1ZC3A 4FMCF 4WKCA 4MB0A 1X7DA 2FPIB 1QHNA 3CNHA 2X0KA 4C48A 4X1KB 1I7QB 4G5HA 3EA4A 1E2GA 1TO2E 4IIDA 1NK8A 3SHTA 5KPDA 1O08A 5DGCA 4GXNA 2JI7A 2CJQA 1TJPB 3S29A 2IVFB 3H13A 3ZWOA 4D26A 1KMHA 3CCUS 5FBKA 5KNBH 2Z2JA 4IF6A 1YVDA 3C8UA 4TQSA 3KL2A 3QZ7A 2CDAA 2RF2A 1U1EA 4A8KA 1RJDA 3PA8A 4DFKA 4M0LA 1QF9A 3AW8A 1R0CA 1N0IA 2QPAA 4IJUA 1Z5WA 4Q4DA 1MFPA 3F49S 2D3O1 3MFYA 2XMTA 1GL6A 1Q86T 3R23A 3QKSA 3BSWA 3WL6A 3BMOA 1WXIA 3BWEA 5D5PA 2O6HA 4DE5A 4ONEA 2CVPA 3CC2S 3J7AN 1SXIA 1CY8A 3OJEA 1NN1A 4RJTA 1IXSB 1XN4A 4LQ4A 1ZDMA 1DHMA 3UWKA 1PV4A 2J9GA 2H1LA 1RTDA 1DIOB 1HQKA 3PFFA 3AILA 1F9EA 5B7QA 3JSYA 4INAA 2DTXA 3UHJA 3KQPA 3BH0A 3BL5A 3N0XA 4N0PA 1DJOA 4ZO9A 4DQDA 4JJ7A 2AQKA 2OCIA 2GIFA 3VZPA 2VNHA 3D7MA 4Z2YA 1TA9A 1N2GA 5JCOA 5E2QA 4R69A 5K4GA 2YNHA 1IJBA 1N2CA 1J06A 3G4SS 2GCNA 2KM8C 3ABRB 3VSCA 1FRKA 1R27A 3TZXA 4RL1A 4FKXA 2HH9A 3BQ9A 3PNVA 3C1AA 2RH8A 2YWWA 2OECA 4JI0F 2Z56B 2A33A 4H3SA 3Q0IA 1C9DB 3QOYA 3LW5C 1DURA 4PCAA 3GJQA 1A9SA 1JILA 2V2VA 4V0OA 4KE6A 3SIXA 2TMDA 2Q3FA 1EVYA 2FK8A 2HBQB 4C3VA 1XQYA 1G18A 3SOPA 3FPBA 3CVVA 4FMBB 2B6AB 2UUWA 4J5OA 2QMQA 4KTVE 1RKBA 4J75A 2O1EA 2XSZD 4QXRA 4Q02A 3KHUA 4Q44A 2PXAA 2YKMB 2BE2B 3FSIA 4F72A 4EHHA 3F4BA 3TOVA 3INGA 5ETOA 2EK6A 3NHFA 5B1HA 2CPJA 4WXYB 4R1PA 3G68A 3TAUA 3FCOA 4HVCA 2HRCA 5IBCA 4BGEA 1W4BA 2NU9A 1KOOA 1HWIA 2QPLA 2PBLA 1LBHA 4P4GA 4H4DA 2BF7A 3FPKA 3IOBA 5EI5A 1KNQA 5C37A 3BZBA 2O8BB 1BWVA 4KTTE 9ABPA 1UKUA 1PK7A 3ZLVA 4BU0A 1CTQA 1URRA 3Q8SB 3PFHA 1Y8RA 2VJUA 1E7SA 4UC0A 3WJAA 5AJHA 5F9FA 2C1XA 3WMEA 1LDGA 3A4MA 3K15A 1KS2A 4KIJA 2LA6A 4OX7A 1SU8A 4MT1A 3AY0A 2V4MA 3QK7A 1J2JA 4NYPA 4JSTA 4RFSB 4NBVA 4ZKEA 1S5ZA 3N07A 4U7DA 2KL8A 3MCZA 4RCYA 3CH6A 1E94E 1EQ2A 3FF4A 4U7GA 3UANA 3AOEC 1YBUA 3PXAA 5SY6A 1A76A 4TLAA 2XZLA 3A3OB 4JZYA 3R1IA 1SOUA 2V1XA 3PPYA 4UHJA 1JLCA 1EQMA 4MUNA 2QTRA 4P73A 5JFOA 4QASA 1NRJB 5LDHA 1JLFA 4YRAA 5ER9A 3HV0A 2JD2A 1JLBB 1S9GA 4UHEA 2C2MB 4IH9A 3JS5A 3KZKA 1NBWB 4U3JB 4JJAA 1M6EX 4MUKA 3U3OA 4LMBA 3T38A 3Q4GA 1HT1E 2CUTA 1H69A 1J23A 2Q3MA 3H2GA 3UGTA 5ALXA 4ES2A 2HB6A 3RVOA 3W9UA 2P4HX 1W59A 3ZHQA 5LQRA 3MM5A 4AE5A 4YFYA 5FUQA 5TF0A 4XLTA 5KG5A 3AC0A 2DBRA 3ZD6A 4BEJA 2A1TR 1A1VA 5JCZA 2P41A 2QRLA 3IXLA 3L05A 4QQNA 3C8MA 3BH6B 2VG5A 1LRKA 4E07A 3R3TA 1E6CA 4BE4A 4ELUA 4HWGA 4LVUA 5E6SA 1U0HA 4PFQA 2FUEA 3OUZA 3RAQA 2AMYA 3AV3A 5DQIA 3PR1A 3IJPA 1RJ9A 2DPYA 3V6DA 3ABQB 1T91A 5P21A 2D1YA 2W24A 3O8RA 5K0FA 1ICIA 3TNFA 3EN0A 3W34A 4P10A 5FBQB 4Q93A 3EY4A 4UTOA 4ENPA 3FHOA 2FETA 3KB6A 4CLRA 3PHGA 5JDIA 1JA9A 3N05A 1A5BB 1VA4A 3RJMB 4NK5A 3CR8A 4CYUB 3BRWD 4B80A 3THXA 4Y1EA 3K71B 2OVFA 2CXSA 2Z2MA 1LV7A 2Q3CA 4JI2B 5CK4A 3VGSA 3KQWA 2ZJ7A 4NZOA 3D4JA 4Y2HA 1C9EA 4INPA 3OWXA 4JEUA 3DAFA 4DSUA 1EHIA 3ESDA 2HSEA 2AOXA 5E41A 4XIFA 2G5PA 1PJ8A 3L93A 4QUGA 1VRQC 1SCBA 1SJRA 3HRHA 2IFTA 4YRIA 4BNLA 2ZJRQ 5G41A 3QX7A 2PEHA 2IHBA 3R6DA 2RRAA 7MDHA 1HNZJ 1GAJA 1QGZA 4O0LA 2QD2A 2GGSA 2Q9UA 4WMLA 3T41A 2QP4A 2X7JA 4RIEA 1ZEJA 3A1CA 2CVFA 1C1BB 3NOVA 3SBDA 1S72S 3DCIA 5HQ3A 5DBGA 1N54B 5BMVF 1S96A 4XUDA 1QO7A 5BSMA 4I9FA 3QVTA 1UEIA 3NBZC 5EY5B 5FWXA 4I68A 1YA8A 1TYAE 3EG9A 2KMLA 1GLNA 1CZNA 1N0HA 2N75A 1M74A 2WYHA 2ZULA 3MAQA 2Q0XA 3IMFA 1Q0NA 5LDDC 1Z2EA 2KB2A 1XU9A 1PWZA 3Q1LA 4H59A 2Y0EA 4UULA 1OYEA 3G9TA 5C7LO 1L7AA 2LNDA 4BLUA 1QYCA 1CUSA 2YMMA 1WF3A 2HCTA 5NLLA 3A11A 5LNK1 3KQOA 1N7JA 4F1JA 1YQXA 3LQ2A 3J80U 2YCBA 4BAUA 4BPRA 1UJBA 5T7BA 5H3HA 2RKIA 3U39A 1LPMA 7ABPA 3D2CA 5DIFA 4FR2A 5HE9A 4HQ0A 2EK1A 4I5GA 4IHAA 2WD9A 1A50B 2G28A 2XDQB 1K08A 3J7Z5 3B2NA 1QGUB 2O3JA 2P4QA 1ZAWA 3LPCA 4MGZR 2A58A 5D84A 3VDMA 1PL0A 5KT4A 5A2GA 1G1AA 1FOEB 3JTEA 4MMXB 4UBNA 1S01A 3M49A 5FBZA 3VNQA 3K7EA 3F6CA 2BGNA 5IRCD 4Q6BA 3GYBA 5B3LA 1UH5A 5JMWA 5FA5A 3X3UA 4AS2A 1YB5A 3L06A 4ZQIA 4OV6A 3PV8A 2CPZA 1R3NA 3P0HA 3IVCA 4JDUA 2Y0DA 5IWAJ 5FBRB 4KREA 3B53X 2Q27A 2A7QA 3MI7X 2WVGA 2XO6A 4DLWA 4RVHA 1DO8A 4LF8B 3G0BA 2O0HA 4NICA 5KYWB 4KWIA 2Y9MB 4J9QA 5AVRA 3QKUA 2GEUA 1W25A 1FFGB 1HE1C 1LW6E 3EAQA 4CIWA 1YRAA 2BLNA 3ETNA 3ZCQA 4BBZA 3DL4A 2XUDA 4RXTA 2IHKA 3A1TA 4JJKA 4QR2A 4LY6A 4PTLA 4DW8A 2FPSA 1JHPA 4C29A 1T05B 1KL7A 3ITHA 4K1XA 1EFDN 4YRRA 5U47A 3U61B 1G38A 3UR0A 2Z08A 4A5SA 2OD2A 2FY8A 4UHBA 3KSUA 3KJNB 4DIDA 5I3PA 4H1WA 1Z6AA 3G8BA 3RF7A 2G9NA 3G96A 2WD7A 4IJWA 5H7XA 3RPEA 4I50B 1PVVA 4F8EA 2ACWA 4CUZA 3DTYA 3WYFA 2FVSA 2LU2A 3F2VA 1TQDA 2M6RA 1AW0A 3WICA 2CJPA 5KOXA 1WRBA 1ULHA 2QT0A 3UN1A 5M34A 3RU3A 5TS3A 2Q3HA 2UKDA 1Q1BA 4P81A 5LUBA 3A7DA 3IQXA 1JDJA 2PUEA 1HTBA 1TUBA 1DG1G 2OZLA 3CLSC 3RIGA 3QVWA 3JAMY 4FZ5A 5J5VA 5JJLA 2R7KA 4BNYA 3K57A 3CUEF 1EAMA 3EJWA 1CJSA 3JVIA 1G4UR 1A0OB 2BR4A 1QIEA 3TOXA 1UBUS 2KYZA 4UQGA 4PTYA 2V9CA 1FA0A 2DNGA 4K0RA 1DUSA 5COAA 2ZG6A 5KFPA 1VBMA 5J2NB 3W5CA 4AXBA 2CJAA 1N3BA 1N0WA 4XJVA 3HP4A 2C2WA 2GZRA 5AK0A 5BRJA 4BV2A 3FEYB 4EHBA 3IE2A 1MN9A 3FKSA 2XTJA 2UYCA 1R0AB 3O26A 4IDQA 1ODLA 1KDPA 1PO7A 1VSQA 3GFFA 2XY7A 3T3HA 1RLTA 2ZSAA 2RARA 3ODPA 1O87A 3AVUA 1SUDA 1MV8A 4B3CA 2VZ9A 5F2EA 1MVNA 2Z8YM 4MVJE 2ERYA 4MS1B 5CHYA 2L9DA 4BO6A 2H5IA 4UPVA 1S8OA 3R2DJ 3P0EA 4UXJA 3KWJA 3L6OO 2MY7A 1XD9A 5GOTA 2YPZA 2O8NA 1Q0HA 3ZEIA 1TL5A 2GM9A 1VQSA 1K1QA 4DS3A 5BN5B 1Y3IA 1VE3A 3UVEA 3CSUA 1Q7BA 1QX4A 3KHHA 1KDOA 2UYGA 4JB2A 4NBLA 2WFAA 3ZQUA 4K88A 2WVFA 4GU5A 4FBMA 1UP7A 3KQHA 1I4LD 4CQJA 3IO1A 2XCPA 4YNBA 4NRTA 1M0WA 2ZJ0A 2LEAA 2YKOA 5JHGB 3FDJA 2WDPA 1USIA 3RROA 1ARZA 2R1UA 5CFNA 4EG4A 3BJRA 3T5CA 1I0IA 3IUMA 3ZOZA 5LOVB 2P1ZA 3ZZTA 5A4FS 1A9TA 4MIBA 3MPYA 1FTYA 3U09A 1JB0C 2EFOA 2FQYA 3JYNA 5BORA 3GZ7A 3UOWA 5DHFA 1FWKA 4LDPA 5EFZA 1IN1A 3BWYA 1EP3B 5AKYA 4QPJC 5CFMA 4ZQBA 2F90A 1A27A 1Z6GA 3P19A 4YHHJ 1G9XA 1NEEA 4X62F 3S8YA 2YQZA 4F86A 2DHXA 1J2UA 4L4UA 3PJFA 2HMYB 4EPVA 4LHEA 4XVQA 1R4ZA 2QENA 3OTDA 3WWCA 5CTAA 1YVEI 2BM0A 3V81A 2Z2ZA 3I12A 4FNOA 3BRQA 4FYXA 2J33A 4BDPA 4G0UA 1QIKA 1N88A 4MV5A 4CEHB 5DRYA 1L8XA 1B8OA 5JSZB 4UEJA 3QPUA 3AHGA 4N6NA 4B48A 4OGGA 2AEJA 1ZUNA 5F9LA 1VQ4S 3KNAA 3ISNC 5DN6A 4ZO8A 5M7EA 4D0NA 4GRAA 2I22A 4RNOA 4B9LA 1TZ0A 4OZ3A 3EWNA 1DAGA 4NQRA 3R7DA 3NATA 1GUDA 1E2BA 2EXXA 5GMDA 3SLGA 4FSXA 4DCVA 3I28A 5DK6A 3RRKA 1ZGCA 1Q20A 2B4YA 4G24A 4DMUB 4WTYA 1S2GA 2GFFA 1H2BA 3A8EA 3OVMA 2JGAA 5GJWC 4Y1RA 1OKKA 5ALLA 1RKJA 2XB9A 1FQJA 4UTZA 4R0MA 4M8KA 4M60A 1V9OA 4P3NA 1SBQA 2VPWA 5JTTA 2UUPA 4P34A 1LI5A 3DPSA 1XU7A 3HL0A 4Q2LA 2REQA 5CNKA 1XMOF 3VJRA 1EP4A 4UZSA 2O4CA 3TJ8A 5IC4B 1ZUIA 4KMRA 4C9DA 1QQ6A 3U5TA 5I9SA 4NF2A 2C2EA 2YJTD 1D2RA 3BD6A 1NE7A 1YZTA 2JOQA 3O3MB 2Z8QA 4F9GA 4PAAA 2B8QA 3GW8A 4HDCA 3IWNC 3C4JA 1KVSA 4LYDA 3HB9A 5EKSA 4YEDA 2Y1GA 1FX0B 2ZYGA 4BP1A 1E3IA 3GEGA 1AUXA 1BWQA 3V6MA 3LWDA 4KODA 2H1SA 2GYYA 3MWDB 4LF9B 1YH3A 2VFSA 5HYVA 3V2HA 1HBMA 1HNIB 2JCGA 4P93A 1IBMJ 2XNSA 3CRQA 3PENA 3ITNA 4X4SA 1UXOA 4NBWA 2MSEB 1Y4UA 4H3VA 4PFSA 1DFGA 4CFYA 3IAHA 2JCSA 3CN7A 4EVIA 1OBOA 4BLGA 4LNHA 4Q8EA 2H4ZA 3VTKA 4ZVQA 2LEBA 3BFXA 4ZYUA 5GJCA 5KYNA 4PGHA 4YDHB 1YR2A 5CDFA 2YQ5A 4ZKAA 1NB7A 3J81Y 1M66A 1BJTA 4CU5A 2OMOA 3EVOA 4PSVA 3DLGB 1S48A 4LJLA 4I6GA 4N3GA 5IAJA 4F2HA 4QO7A 4Q9IA 1GG2A 2V4ZA 3H7AA 1U0RA 3QJGA 5CB0A 6Q21A 4EA6A 4RUAA 4KE9A 5KINB 2PSZA 3F2IA 4KNWA 1WMDA 1J2TA 3A6GA 3IOCA 2GYUA 3TRJA 3MF4A 1D6JA 4KV8B 2J09A 3J7TA 4TWIA 4ZYTA 1V41E 2YOGA 3VSAA 5JCOC 2W37A 3BGWA 2PXHA 2RH9B 4P9SA 3V1UA 1JRLA 3GA7A 3VO1A 4LSLB 4AY4A 1X5PA 2RH3A 2FHKA 2QVZX 3WDMA 3VGTA 1NONA 1J0XO 4OJYA 2XOKA 3VO2A 1O5IA 3QSGA 2D59A 3LUJA 3H42B 5DNUA 5I7VA 4X45A 4LV8B 4KHPB 2RHRA 4X93A 3ISVA 4FDTA 3PJDA 1JXOA 4MLDA 3GA5A 3O4GA 2P9JA 2NX2A 3WYEA 3NEAA 3MD1A 4IOCQ 4WVLA 2ORED 1DTEA 1PJ7A 1ZK3A 1KLMA 1CHDA 4WKPA 4D99A 2Q5CA 3SDSA 3W1YC 1EUQA 3QWHA 3U49A 3QGGA 3I42A 1MXHA 4W98A 2WUVA 2ZT6A 2PMWA 4N3AA 2BA9A 1BXZA 2W43A 5T4HA 3F8SA 3BMQA 3I72A 3I5BA 3FXAA 2PD6A 4YMLA 4JYAF 5FOQA 4XZ3A 1QIJA 3W3ZB 3LPYA 3NWOA 4RZIA 3DVAA 1CNMA 2DTEA 1PLLA 1UVNA 5KFIA 3Q72A 5FRDA 4OKSA 1J5EB 2FQQB 1T3NA 4G5RA 4COOA 4I3HA 3O92A 3DP9A 3RRMA 4N1AA 1Y7IA 2QI9C 1JLEB 2DPJA 4DDUA 1P91A 2PCJA 2FSUA 5BSFA 1V16A 3NL0A 4G36A 2IDEA 1NXIA 2D1CA 3BWCA 1RI7A 4B3TJ 1NZDA 4BP9A 4MAMA 3KJQB 5E3IA 4LYEA 1K3TA 1B4SA 4IKPA 4HYEA 3ZE1B 3C6UB 2N82B 1TLFA 4Q19A 4JX9A 1F1BA 5A9RA 4LHXA 1HWJA 1GZVA 4AU1A 1L4KA 2HYDA 5HE8A 3BS9A 1B0UA 3FD8A 3C7KA 4PC3A 2HWUA 5L51A 2OV3A 2R7OA 1JHDA 3HMKA 2C07A 2BELA 3JSMB 4QDXA 2CDQA 1TL3A 4PYIA 3CNNA 3O4VA 1P0FA 2OUIA 3H4MA 3KB1A 4HJRA 4FNIA 3MMNA 6LDHA 1P2TA 4DUYJ 4DSFA 1MJGA 3KK3A 2DH8A 2UDPA 3VTFA 3RR7A 2F8TA 3ROMA 1N32B 3S8EA 4NBUA 4BX9A 1EB8A 2NCKL 2AEMA 4DV5J 5CAEB 4XD2A 4WLFA 1BY9A 3FDIA 1YZ7A 3TXYA 3ZTOA 4MUIA 3K73O 3UMCA 3B48A 1CT9A 1UF9A 5D01A 2WTEA 1N34J 2LQBA 4OZLA 1PG0A 2WSMA 3F3SA 2QJ3A 4RO0A 2UUBJ 2RB5A 3O84A 1E2IA 1KO5A 1CY6A 4F2DA 1U0HC 5FOUA 3ADPA 3R5BA 2R00A 4X3CA 2AK2A 1A9QA 2PJRA 5M29A 2DM6A 4Q7AA 4KXFB 1T36B 2ZB4A 1HE2A 4UNSA 2GZ2A 4BNTA 2WSCC 3HVIA 3GCXP 5AVSA 3WADA 2JSXA 5I9MA 1LVUA 4ERXA 1USUA 5B08A 1L5OA 5JDIC 2OMLA 1ZXBA 3A25A 4JLVA 1GPWB 3OJCA 3FCYA 1Q1AA 4XX0A 2FCAA 1TVKB 3DDCA 5BT8A 2O52A 1EG7A 1UMCA 1DQRA 3ZCUA 3OLYA 3P9NA 4XWKA 2M8HA 2G36A 5KG2A 1I9CA 4TL9A 1HBJA 4QGGA 3AO0B 3D0RA 3W5SA 2BBTA 3OF3A 3H8SA 3Q85A 5CCXA 2B61A 4BC9A 4WD3A 3EQ8A 3CX3A 3C24A 4CO2A 1GDTA 1KK0A 3Q3HA 4I9GA 4H7DA 1USKA 1TELA 1US8B 2PYZA 5JZBA 2VL1A 3HN7A 4PXSA 4OUDB 3AETA 1T3HA 4R83A 5BXQC 3B89A 4UHKA 4ZHSA 4BCDA 1GTMA 2FJAB 3EODA 1EVIA 1M75A 3ZYZA 2YJGA 1CJCA 1CG6A 4MQEA 3ZGYA 5HMZA 3U0VA 3QQ5A 4ENTA 2W6ZA 2B94A 3G6WA 3VOSA 3RUAA 4B3IA 2HHHJ 4CLOA 3ZV7A 5DDOC 3EX7B 3TN7A 4YUDA 3FB1A 1Z39A 2AF4C 2R4UA 4JOBA 2WHPA 3T95A 2JX2A 3IG1A 4OLFA 1UCNA 5IDQA 2KXFA 1Y3DE 3SS8A 1Z0FA 5FBVB 3VPDA 4DG1A 2EFQA 2GAJA 1N5LA 1FRLA 2W7TA 4OHZA 3V5NA 1YKFA 1PS0A 1EFHA 4OSPA 5A6PA 4F3KA 4KGKA 3IGFA 1WHSB 4O2AB 3MWEA 2HFUA 2NADA 2EZTA 5BV1A 1PGZA 4QFBA 3KG4A 3L0SA 2FSVA 2YQ0A 4ARZB 2NU7B 5DYIA 1BFUA 3MBIA 3L1JA 1PEDA 3C14B 1L3CA 4UMFA 3WHKA 3OT9A 4NTZA 3O4JA 3CD6S 1EUCA 1Q50A 3LUGA 3W8FA 3DDHA 1HDYA 1FMFA 2VRWA 1HEUA 2FTKE 3I83A 3K6RA 3QU7A 3TNDA 1KDYA 5HW0A 2WU1A 2WB4A 1NF8A 3NO4A 4WXHA 2DKNA 4LVOP 1GX6A 2VJNA 3F71A 1QCYA 3HP6A 1P2BA 4LSZA 1KKLA 1YQUA 2U1AA 3W2IA 5KNBD 5H9FK 1UKVY 5CT9A 1XC9A 2QF7A 3HSGA 4ZYXA 4QDJA 4J1TA 1LI7A 2QD4A 2OKGA 2ZATA 4DBVO 8ADHA 2K8GA 4F4YA 2CPIA 4PXYA 2WU3A 5HO4A 1AX9A 4MYHA 5SZTA 4OJ3A 1D6NA 3N2LA 1AB8A 4IWNA 3GG1A 4INJA 5EAIA 4JI1F 1RW4A 2WD8A 2BEKA 1KU6A 4RVNA 1UODA 1JEQB 1Z13A 4OFWA 4FKMA 5B1IA 2AJ2A 1GAEO 5KCZA 1RZRA 5B6JA 5KFUA 3ZXSA 2P0EA 2VASA 5EE1A 3ZNOA 3DE7X 3WZMA 2CHGA 4TLCA 2VA2A 2W48A 1TP7A 5JC1A 1THZA 4B2YA 3VCDA 1WCWA 2NYAA 4YJGA 4PCUA 5LDGA 5F76A 3KB2A 1RIIA 3LXMA 4R2LA 1ITZA 1E61A 2VFVA 2DVIA 1GG5A 1W8IA 2AG8A 4FR0A 1K1EA 1N5OX 4PRFA 2ZOGA 5C42B 3EW9A 5M3BA 2VL7A 3BM7A 3H4IA 3EIXA 1Z5OA 3S1AB 4H4MB 1AS3A 1D07A 1R7RA 4AY3A 4IYJA 3N2IA 1CJKA 1ESZA 1TU3A 4EY4A 5D77A 4GWLA 2EBHX 1NLUA 2QRUA 1BQEA 5BOVA 4A8QA 1K89A 2DQKA 3ZWDA 3A1NA 5HOQA 1MOSA 4JV1A 2CPHA 1JYFA 4X6YA 1BOOA 1C9YA 4RTSA 3BPDA 4UFNA 4D25A 1TRHA 4GP7A 1G6OA 1PTJA 4MRAA 3OWHA 4AJ4A 2QT7A 3DOLA 4E8UA 3RC2A 4XDCA 3UKJA 3EBPA 4Q3NA 4PLTA 1IG0A 1RMYA 2YXBA 3WIVA 1PNQA 4IICA 2A8YA 3ICOA 3D31A 3UHAA 5K05A 3NM4A 5EDWA 3QUQA 1XZAA 4RPGA 1R15A 2QQ5A 1QIGA 1MR3F 2Z4TA 3TZEA 4URHA 4JFAA 1BQ3A 1K5DA 2XLIA 3QYAA 4PWYA 4KI7A 2GQ2A 2R6DA 1GAOA 4W82A 5L3VA 5DNEA 5DW0A 1JXLA 4JQOA 2RS8A 3OIVA 2BSAA 4CCAA 1C3OB 4JDPA 4G2TA 1NDLA 1SPBS 2XNCA 4CKWA 3I32A 1K8QA 4JD5A 3RIXA 3X2FA 1ZVVA 4JBLA 3WKDA 4CKCB 3EH2A 5CT5A 3IALA 3PFGA 1ZU4A 5GVRA 4JBXA 3O7MA 1DU4A 2HLDA 5LB4A 2DGSA 4CTJA 4DBLE 1VYHA 3VH4A 2Z83A 3CUNA 4G4GA 1YQGA 3W2VA 2H57A 2MYNA 2PWAA 3OTIA 5K3FB 1BE1A 1X1CA 2G6BA 4PR3A 1IDOA 4QRDA 1ND5A 3KLPX 2VP2A 1G7CA 1UKYA 4LN1A 1XKLA 2XY6A 1GNVA 2FWPA 3ETGA 3RYFB 4USMA 4X00A 5HPYB 3I4HX 2BMJA 3CF0A 2M1ZA 3R44A 1R8QA 4XDHA 4MR8A 4G4SO 2OESA 2V98A 1AK1A 1OV4A 3MGCA 3CRNA 4CLWA 1NUTA 5THKA 1IAQA 2AR0A 3WFZA 2H1OA 2IUTA 2EX4A 3DOFA 3RRJA 4O3SA 1AQIA 1I14A 4DUGA 4O2BF 4AZ0A 1VE5A 1LSUA 4C0AC 1ORRA 2G7ZA 3ORSA 3SBEA 4X1OA 3ZI0A 2QTWA 1QC5A 5E7MA 3AA9A 1ZLYA 4U7HA 1ZHOA 1KI7A 1V25A 2O7VA 3DCAA 4FMPA 4Q82A 4UMDA 2WMYA 4JC8A 4KBYA 1RABB 4K6KA 2J41A 3TPZA 1SULA 1EUZA 1RADB 5ALTA 3T52A 4TLRA 2LE0A 2ZYWX 5LQDA 1HMVB 1KYIA 3GN2A 2F3UA 1YQHA 3BIFA 1BGWA 2FQXA 1U1MA 1G3OA 4UU8A 5C8XA 3LGSA 5IH3A 4DMFA 3GJ8A 3AHJA 1DQNA 4ZT3A 4PG5A 3GSDA 2I4MA 5KVCA 3L7BA 4MGHA 1PR0A 3AZOA 1GGNA 1P1FA 3IODA 4YMHA 3TX0A 2R8EA 1U2EA 1NPYA 3EXYA 1G8PA 4RF4A 2HJ9A 3O3OB 3ICVA 3HI4A 4W7HA 2XQCA 4OO3A 3OT1A 4LXUA 2BQRA 5LFAA 2V7TA 4PG8A 2OV8A 2KKHA 1JUDA 2VRCA 4TY8B 2GFQA 5J5CA 4Q8FA 5BN3A 1RBAA 1GEHA 2ZI5A 5HG0A 4LS3A 1CG2A 4GT1A 3NRCA 3RREA 3OCZA 1D2CA 4URZR 4HX9A 4X7BA 2OXCA 1ADFA 5EJ8A 3OURA 2QGZA 4UUXA 3CCLS 5D4OA 4X66F 5AK4A 1NVBA 3L46A 4W5WA 4PRYA 2JD0A 4DPXA 3Q3VA 4IOKA 2IPXA 4KV7A 1TEHA 2VRBA 1C50A 1MCZA 4IXTA 3A4TA 2XCSB 3AIIA 5ERYA 5CBPA 3PEFA 2UV8G 1TVEA 5ALKA 2NYUA 2RB7A 4UVHA 1B43A 2QIOA 4DS5A 4GC9A 4ARSA 3L8HA 4HVZA 1RI3A 2BFDA 3K70B 4ZK6A 1U8ZA 2G82A 5KNLA 1XNRJ 1NMYA 4G1QB 3OFJA 2VKZG 1WVGA 1TUIA 4BMYA 4DNQA 5DO2A 3HYLA 1B0ZA 2HFKA 5LMUJ 2ZFHA 3ESQA 3V4SA 2EW8A 2QDXA 2I67A 4JGBA 2PN1A 3WMXA 1TF5A 4DMGA 2X6RA 2UXDB 4KQZA 1FRNA 3MT0A 3O91A 1UWBB 1V8OA 2X8BA 3RK4A 1E18A 1HLWA 3D8SA 1H3NA 3VSEA 3IL2A 2WRMA 2YZ7A 2O2SA 3ECSA 4ZV9A 2IDJA 1WTBA 2B3TB 2ZVIA 4FD2A 1R50A 1Z8NA 1U1FA 2HQSA 4ZC1A 3RDPA 4HGQA 4ZKDA 1ID8A 1OY1A 4R25A 4QWWA 3FEZA 3VR4A 3INYA 1JSRA 3TTWA 2PL5A 1VJRA 1NE2A 3ET5A 3PNIA 4O3PA 4BVFA 2AJFE 3U81A 2D62A 5THQA 3A9WA 3ZK8A 4Z3KA 5FJJA 3R8FA 3MG9A 3UMBA 4HC4A 1X7WB 2QJRA 2RHCA 3LX8A 3JTOA 4OHMA 3WWOA 1TT5B 2FMIA 3FHCB 3I73A 3ST7A 1JHQA 5DGAA 4D81A 1SKSA 2CMGA 4EU0A 2C28A 1OASA 3LX6A 1QLWA 3NWRA 1T2UA 5E33A 3H1EA 1NO8A 1OLSA 2OPBA 4OHFA 5B0DA 3WFJA 1GV0A 2CLOB 3D6NB 1TQ4A 2W93A 4TQUS 3TPFA 3NNNA 5AVVA 3LZDA 1JG1A 2BJEA 3TS1A 1Z63A 3QPDA 4JLNA 1ID1A 1HTTA 2B8WA 3O4FA 3BCHA 4E5SA 1VMBA 2MYFA 4K0KJ 4HDSA 1SCJB 1D2MA 3OLWA 3IDOA 5EOVA 1SKUB 3W78A 4FTWA 2P6OA 3WY9A 2QMOA 4O2LA 3AFMA 5KFAA 1BVUA 1A9RA 5FEUA 4M5DA 4UEQA 4FINA 4LWPA 1XZHA 4NI2B 3OZVA 2ZSJA 1NXWA 2JHGA 3SPXA 1CY0A 3FDSA 5I45A 5EIAA 3R24A 3K0AA 2BGIA 4CM5A 1U45A 1ZJYA 3CSDA 1HOTA 5G4KB 3QX8A 3OJ0A 1PR5A 2X7XA 3BVPA 4J94A 1NZ8A 3L9WA 1WXHA 1ZBTA 1I3LA 5JMOA 3F7MA 5IXYA 4HADA 3Q9LA 1XK7A 4CI0B 1OR8A 2C7OA 4KGMA 1XCMA 3GZNB 2MSSA 3I30X 5LP1A 2Q6VA 4TKUB 3B6JA 4JC5A 1FBNA 3OICA 1IUNA 1RRMA 1ES9A 2AN9A 5BYRA 4X3OA 4AWBA 4B4OA 3PR3A 3OO0A 4P84A 1BWRA 4NK4A 4DIUA 5CQGA 3LANA 2VH2A 3AVQA 2PXCA 4G5OA 3OZEA 1QG4A 4Y6OA 2DNRA 1EVKA 5AIBA 4IUBS 4F04B 4EY3A 3SFVA 2GJIA 1V7ZA 1RAGB 1GPH1 1DAFA 4DR2J 4XTCS 2A5LA 4EB8A 5AKXA 2FHMA 2Q2NA 2PKQO 3LPMA 5GAEI 5TVGA 4OKNA 4QOEA 4DR4J 2AB0A 1PC4A 3F7TA 4MFBB 1N9GB 3KKKA 4KQIA 3OF5A 1BCSA 4HVTA 5CDGA 1KQOA 2J5BA 1Q83A 2DTDA 1U5CA 1NC1A 2FW8A 5K51A 4GRDA 3SOZA 4LJRA 2OV6A 3EQ2A 4DR7B 3RFVA 2P6RA 2JF0A 4CCYA 3N5BA 1H4QA 5JYCA 2AEEA 4OQXA 3FLEA 3H87A 3L9XA 3VZHA 4IG9A 3DRYA 2YY3A 4UAJA 3BWDD 4KWCA 2GNPA 5JPIA 4DOZA 3OOWA 1YRXA 3VU0A 1NP6A 4TMFA 1PT5A 4JT9A 1WABA 1SOAA 2VNIA 1WZNA 2HYIC 4UMVA 4G0ZA 1MA0A 1QDUA 1AK9A 2MT9A 2R00C 1RHUB 4M8IA 4DN6A 8AT1A 2YKAA 2WYOA 3LF2A 4HJXA 2ZRAA 4OJKA 2E5LJ 4ENOA 1RHQA 1ICEB 4OM7A 2FPMA 3U3XA 4AZ3A 1JLAA 3FGOA 3KM0A 4D4IA 1VIDA 1KEPA 4Y0NA 1QV7A 2JGLA 4IG3A 1THMA 3WBKA 3FUWA 2JFNA 3ANLA 2H85A 4UKDA 4HQOA 4TL7A 1PHRA 4ILLA 2QL5B 1JLMA 2Z57B 1FDBA 2H31A 3QEOA 3GT0A 1SKBA 4GE0A 5IDYA 2JEGA 3G9UA 4Q9AA 4EK9A 1RJGA 3IFEA 1G6KA 1NKTA 2DUJA 4PHHA 3CLSD 1UWLA 1KORA 1I2MA 3DHWC 3QUBA 3F6BX 3EE6A 3ZTQA 4Y1GA 1T5LA 1FLNA 1XN1A 3JQ7A 3L0ZA 4B6JA 3HJTA 2X15A 1IMOA 2DHRA 3W5ZA 3PC8A 1WUHS 4P1ZA 3M1AA 1XA4A 3VZIA 3USCS 3RU9A 1M6HA 1WNEA 3UPFA 2YX1A 3SCKE 1RQGA 2XUQA 4E70A 3DO5A 1U3GA 3VFDA 1NX9A 1MOQA 4OY3A 5SYAA 2DNMA 4OQJA 2ZUDA 2ZM6F 3UCZP 1L4LA 1YUNA 4LJYA 4CM8A 5LM7E 1CUGA 2WWYA 4WFZA 2HT6A 3L92A 2PL9A 1T3LA 5KX5A 4C3UA 1FTQA 1L5ZA 3ONWA 2DCLA 2AH5A 3PVZA 3L5OA 2Q4TA 1OVGA 4KAIA 1H1LB 1LS6A 4DVJA 3D28A 1V26A 5KTOA 1KFDA 1I7PA 4JR1A 2C4UA 3T9CA 1VE7A 4NA1A 3Q6NA 2CVIA 1EA7A 4WH0A 3II6X 2WUWE 1TTPB 3KQVA 3P97A 3B6ZA 2ZRPA 3ZLUA 3L4KA 1FDUA 1AZSA 3FPHA 3FPAA 2QY6A 2G76A 4Q4HB 4BN5A 5HJYA 2FG6C 3UBMA 3ELWA 1OSCA 4E2ZA 1JKJB 2FSVC 2HW8A 4MEJA 7REQB 2AWOA 1OI3A 2WIBA 2KTQA 3CWZA 4HAVA 1SBRA 1WG8A 3LE8A 3ZCXA 3EE3A 4X64B 2X14A 3SQGA 4W1QA 4GOND 2C9ZA 1Y7PA 4QIFA 2R6FA 3CBQA 1IL0A 1B7YB 4JI5F 3BGLA 1WHTB 2XODA 1WDLA 2C2XA 2AD1A 5C5JA 5FUWA 2HVIA 4HP8A 4NX9A 1ZN7A 4PNZA 4ZC8A 3ZYCA 3GXBA 3OLAA 1C3XA 4ZZ0A 1N5SA 3ZI7A 2X3YA 3HJHA 3HCDA 4DTCA 4M49A 2HZVA 4EG3A 2PGAA 1IBCA 1ESEA 2WSLA 2FSPA 3ZD9A 1OW3B 4M1WA 1NBMD 1SXJA 3GMDA 3Q6MA 2WJ3A 3BXXA 5KNDA 4TV9B 1XCPA 2Z2XA 4M5HA 3VO8A 3AB8A 3OFGA 4S1NA 5CA0F 5JRZA 2HEKA 3G1WA 1KKUA 5IC6B 3Q7TA 3SBXA 2C4WA 1F0XA 3T3IA 1M5SA 3H1FA 1J1ZA 3LBFA 1RWWB 3SZUA 4LOJA 2BKEA 1VOTA 2BOPA 4I56A 3ISND 2FZEA 2HNZA 2C77A 4RKYA 5DBHX 1O89A 4BNZA 1T3OA 1X3LA 2C83A 1XQ1A 5BWMA 2X1LA 4UTNA 4GP6A 4E08A 4C9BA 5JS6A 1V2HE 3JRXA 1WVMA 4DSZA 3JARB 4RW8A 3J80A 3HFRA 5BYJA 2LECA 2IW1A 5CLFA 4MVXA 3C7TA 1X80B 6REQB 2Y0BB 4YJHA 3ZUGA 2OKCA 2OO5A 7YASA 4TYBA 3VPAA 1T5IA 3ZZ0A 1N5YA 1GXUA 5BR8J 4U7PB 2OCYC 1ULZA 1WC4A 1OX4A 1TD1A 1V7PC 1QLHA 1R0YA 3MWJA 1U4OA 4KN9S 4YMUA 4C03A 4LYGA 2B7BA 4CRJA 4EJ6A 5D1HA 1J0EA 2Q5IA 3DC7A 2VWQA 1ESNA 1S4FA 1CJKC 3JTNA 1NJIT 4U95A 3SJ7A 4L8LA 5FWNA 3NI2A 3PYMA 2O3DA 5FT9A 5F8MA 2YNFA 4RZ2A 4K7QA 1SG9A 2NVUB 2D00A 4ER8A 1ZZNA 1NN0A 3QU5A 1S99A 4QUBA 1PTJC 2ZJ2A 3JQ8B 1OZ0A 1NVGA 3H5NA 5FCDA 3B51X 1HYSA 3KR9A 10MHA 5CYQA 2X19A 3QF4A 4NYMQ 2JVRA 2XQJA 4UUWA 5HLFB 2XA2A 4C0BA 3VAIA 3UTDA 3Q2SC 2OLWA 1OLXA 1G3IA 4D02A 2G6TA 2PS9A 3NP9A 2WYWA 1Q2UA 4PXAA 1IULA 3SK0A 2Z6AA 3CGIA 3TQTA 1C7RA 1L5HB 2AG5A 4EM6A 2OGZA 1KI9A 2PZ8A 4I2PA 5EVCA 5JVDB 5AM1A 3GIKA 1A4IA 3DE4X 1GFIA 3NBUA 3KDSE 3AEYA 4ZRNA 1W4ZA 2NT4A 3T5BA 3PGLA 4MVJI 1V3TA 2NZCA 1VIYA 3AFIA 4NENA 3KAJA 5C0OE 1YI1A 3IE1A 3AA8A 5F73A 2F40A 1JPNA 2FLKA 3QFSA 1LW2A 4J7UA 2AQIA 5CYJA 3CLUC 4Y6SA 1CUWA 3FRJA 4F2RA 4WNAB 3K1AA 2BMFA 4URVR 2BM1A 1UP4A 1JR3E 1RAFA 4WK0B 3DO8A 5JFTA 5IHXA 3GV8B 3RW7A 1ONSA 3ZDDA 1JG4A 3QVOA 2DR3A 4Z7CA 3NHRA 4V0SA 3WWPA 4RNFA 4DV3B 5D1NA 3QKWA 4ZJOA 4RNHA 4UNQA 4A6EA 4ED8A 1YRUA 4CR6A 2WVBA 3R3JA 2EG2A 3IEPA 5CG1A 3UHFA 2K7ZA 4P33A 3C43A 1ZA1B 2BV3A 4L3KA 2WK1A 4MCAA 5TGZA 2DBQA 2RHQB 1O77A 1LSJA 4PLHA 4BLWA 2HUNA 5BN4B 4MULA 2EQAA 4RIIA 5G0RA 3HL4A 3CW9A 1FSFA 2RDJA 1P77A 2H9IA 3AODA 1IKVA 4DUZJ 2W0SA 4K6OA 1AUVA 2CCGA 4O4IA 2Y4OA 5B7NA 5SYMA 3D3EA 3KKMA 3CPEA 3SU8A 4OHWA 1B16A 4DLUA 2ZAYA 1N4DA 4HEA1 2ZWMA 4OXNA 2VQFB 3ESCA 1C1CA 4FWIB 1ZD5A 4Q66C 2UUCJ 4RVDA 5KFTA 1CERA 3CZQA 4K9DA 4K9PA 4F2GA 3BQ1A 2VG7B 1SHUX 2HBRA 3WLPA 1FNOA 2GEJA 1J9GA 3FLMA 5DB4A 2CB9A 1ZCJA 2HI0A 5DNCA 1XYGA 3C3KA 1PO6A 5E7OB 3DJFA 3PEUA 5IX8A 4DCCA 4ZDNA 3RYCA 4QPTA 4C4PA 2XSJB 2G3YA 4HWKA 5HSGA 4DKXA 2DK2A 1J49A 1VKHA 1S9HA 4X1YB 3MEQA 3N3AC 5EZQA 3L4BA 3E58A 3QOWA 5FA6A 5L3QA 1FFCA 3R2JA 3IILA 3ZY2A 2Q6BA 3ENAA 3QLUA 1RTHA 3RYIA 4I81A 3O8NA 3TQIA 4ISBA 3CEPB 3B3AA 3W2TA 2D7JA 1PR6A 2HA3A 5D3ZA 2D5CA 1CFJA 5DE3A 5IT5A 3Q15C 4EUNA 4YR7A 3UN3A 1JBKA 1RC0A 4D3XA 1Z0ZA 2H7CA 4LXTA 1EETB 3D1JA 2VATA 1JJ7A 2ZAIA 1VG1A 2MOKA 9ATCA 3BEDA 1Z7BA 2VJMA 4I6JA 2V9PA 3MEKA 3HCFA 3X1KA 1IH8A 1ZKMA 3A37A 4LDNA 4J0HA 1ZSVA 3R5JA 3I3OA 3BKUA 1Y9DA 1YRHA 2YNIA 3E3AA 4FZVA 4WJLA 1WKLA 2FSSA 3BXOA 4MKFA 4MK4A 2A9PA 4UDXX 3PUIA 4CLDA 3LXRA 4DADA 1TVMA 4I2QA 4I19A 2R8GA 2DXEA 2BQUA 1NLMA 1CY4A 5CH8A 2JRLA 2HSDA 5ALYA 1P6TA 4DREA 2K4MA 2VJYA 2FEAA 5LZ4A 3MAHA 1O57A 2XCUA 1NRXA 5EUMA 5HKLA 3P4XA 2LR0A 1SUCA 4LFBJ 1YBVA 4QOGA 5I3UA 4GWKA 2VFAA 4G8DA 2VAWA 4HS4A 5DGBA 1VHJA 1EJ2A 4YRNA 4TRRA 4CV0A 4WZBB 1X8LA 3E01A 4LVNA 3KDAA 5C34B 721PA 2NUBA 3JWHA 1E6VA 3D8UA 3I9MA 2UXBJ 4S1VA 3FTNA 3PGJA 4EHFA 2RBGA 4CLSA 4YB5A 2F4NA 2WWHA 1VIAA 3ZI4A 1B99A 2WM9B 1RT5A 1V11B 4YDXA 4KH0A 3BGOP 1T9DA 2IC3A 4GZ6A 2OILA 4RZSA 1XMXA 5KYXB 2BONA 3L5KA 3C4VA 1N9KA 4K4ZA 1PSWA 2RJ3A 1P75A 3DC2A 5C35A 1BX1A 4ECRA 5TR9A 4RVGA 1E3JA 1MIHA 4V1CA 4HQFA 2IP1A 1CUIA 4CEJA 4RF2A 2ZH7A 5IZCA 4AT1A 2DNQA 4QXMA 1XIVA 4F4ZA 2J7UA 1VPVA 3GXOA 3V3TA 2E1CA 2H07A 2ZR9A 5J1NA 3DGVA 4P7TA 4MYUA 3I4CA 3G49A 1AO0A 3V34A 2D54A 4QWAA 2QP9X 3KTAB 3KEOA 5IXJA 4RLQA 5B7GA 4PR6A 1T0JB 1ZTTA 2A9OA 4F91B 1WAMA 4L4YA 2CZCA 1WBDA 4YY3B 3UAXA 1H2XA 5HP1B 4XRGA 3M2VA 5K0NA 3R5FA 5ADWA 4EBBA 4M1TA 3RK1A 2CZGA 2W2KA 1ZVMA 2DH9A 5G40A 1VZ3A 4RQAA 2LYVA 4RV5A 3H6HA 4X8MA 3WHLA 2P4EA 4CT5A 4I1IA 4PZDA 4AM8A 4UDOA 5ANRB 1AGNA 4F0JA 4MUEA 2G0IA 3CJQA 2QSUA 1B3BA 2LLZA 4F50A 2ORYA 4EHLA 2GRJA 4GSLA 4IO1A 2PFFB 2LU1A 3IQWA 4OU5A 4M1KA 3A6FA 2XLJA 5DM2A 1MIOB 1AKUA 4RU1A 4R1MA 4MKZA 1DCFA 4TVSA 2XI3A 3AHPA 1FP6A 4FKYA 2VT2A 4BBJA 2ATEA 1AROP 2IITA 1T4DA 3GJYA 2O1XA 3PGVA 4MPDA 3PLRA 1USWA 1ISHA 5L53A 3AH6A 1T5TA 1Q2XA 3VR4H 2R6JA 2LKDA 2HDNB 2A5FA 4LZPA 1LTQA 4LJSA 2UUAF 3PFWO 4LMAA 1U8EA 3TQEA 1ESDA 1A8QA 4B3RB 4MJXA 1V9LA 1BD4A 1HW8A 5JW6A 3U4HA 5JSYA 1ZWKA 1FJCA 2V7VA 3UJ7A 1FESA 1MB4A 4QU7A 3P9QA 1M7HA 4MRPA 4RK1A 4LXHA 1GXLA 3OEEA 1KZ9A 2XWJI 3Q22A 3LFHA 3DT6A 3IDAA 3O0DA 5DYWA 4YXWA 5AVQA 1EFUA 4L3WA 2B5VA 2YASA 5LR6A 2QTMA 3IAM6 4J6EA 2C97A 3NWJA 5LXTB 3GLHA 2UXCF 1FS4A 1VFPA 3IUJA 4ZP7A 1MAWA 4BIIA 5FTNA 5JDCA 1WKJA 3PM9A 2G9OA 5CFPA 5DNWA 3H9UA 5HFAA 5SZJA 2C4NA 3ZZZA 3EGWA 4LREA 4ML3A 3ZHOA 5E8RA 3M6IA 3GBSA 1LC3A 3JSXA 3OAAA 3QNMA 4PO9A 2E18A 2D74A 2UZ0A 1BW9A 5DG8A 3C15B 2HGNA 4G1IA 1RWPA 4G26A 3L6RA 3U7HB 3OECA 2JFXA 3SEFA 3G23A 4KK4A 2UVWA 1FKPA 3NC1C 5LPNA 3ZQ6A 2J9DE 3DLEB 1T13A 3A31A 4LSGA 2OB1A 3FVYA 1G64A 2GF9A 4IIVA 4GM0A 2LKCA 1KYYA 2OOSA 5GGXA 4B4WA 1ULUA 4UCQA 1X1BA 4OHCA 1UDRA 2K3KA 1D09B 3M33A 5KYVA 4OJMX 2V2QA 2DGWA 1GKIA 4GYYA 1T3ZA 1RT6B 3Q88A 3B1WA 4ZVFA 1YNSA 1UDXA 4PC1A 3U9SA 4BKOA 4WESB 3KMSA 3V4RA 2M52A 4DIEA 4JV5J 3MIZA 3PC8C 3J81j 3NIWA 1ZVQA 3ET6B 1UBJS 1WL8A 3R0JA 1EFPB 5KAMA 4EUFA 2PV0A 1JHYA 1W88A 5JQGB 1Z26A 3M3HA 2QRRA 2C4TA 4O3MA 3FKSD 1G2IA 2V8DA 3I34X 4KBIA 4D8WA 1PSDA 4BB9A 3LLSA 1WF6A 4YWHA 4FS8A 4GD3Q 4MPTA 5I7UA 1U8AA 5FBLB 1Z35A 3EEYA 4L8VA 4HX5A 4POAA 3GEDA 1D1UA 1J22A 5DFAA 3OXLA 2D0IA 4XTTA 4N5NA 3QE9Y 3MYRA 4ZLNA 1JVNA 1RHRB 4QT0A 4LAFA 2XECA 5AM0A 3M32B 5FLXU 4JEHA 5CEFA 2WP0A 4Q4JB 3CJ8A 4EKNB 4A8XA 3WLOA 5FDLB 4EL0A 3UCEA 4DMLA 1TGVA 2DIUA 1AZSC 1OFVA 5C5CA 3IIIA 2A4KA 3KE8A 5IXSA 5IOLA 3L09A 3AZQA 4NLWA 4NXNF 4HLQB 2FWIA 2H2DA 1G6Q1 2LZ0A 3TTYA 2OFXA 4EUHA 1LQ9A 3TW8A 1HDZA 1T8WA 4H4CA 3TYTA 3ED5A 4QYZJ 1KR2A 1FZTA 1JR4A 1Y4AE 2RJOA 3T19A 4L0DA 3K9LA 3KYLA 2P6TA 3KZNA 1Z7YA 2SKDA 1LS1A 4UM9B 5E4TA 4FMDB 3IC1A 1LWEA 4GXRA 2J5XA 5F0UA 1UPCA 3VHQA 3PEWA 3F5QA 4TV8A 4QVIA 4IWXA 2XQKA 3P2JA 4YJ2B 4ZDKA 1N1GA 3MCTA 3RC8A 4I08A 1BXNA 2J9FB 3EFEA 5KOJA 3F9RA 1PJLA 4JLOA 5HCIA 4H4EA 3ND5A 3OCVA 4D8VA 1M73E 1W5BA 3KUKA 1VBZA 5JSKA 1QHEA 4TKVA 1WUUA 3IJEB 5CBKA 3TQ1A 4AD8A 4BO4A 4R05A 3SR0A 4NBSA 1BG6A 1SXJC 4MWCA 1PR1A 2I78A 4D6XA 1HWLA 4LE1A 2VK1A 1U2GA 2QIFA 5EJMA 3FOFC 5MFPA 3ILXA 4FMCB 2JATA 3L0YA 4ETWA 1L3TA 2GPJA 1LXCA 3NKFA 4ZV4A 1HKAA 3MAAB 5DN6D 3F3KA 2HW3A 3FWKA 4UW9A 3K9WA 2F5GA 2G06A 4BVJA 3RUDA 3LQQA 4DLTA 2JBAA 3DEYX 5C5IA 1DKPA 3KFVA 5FB3A 4Z4FA 4RYDA 3EWIA 2E66A 1UWKA 4O8ZA 4NIMA 3PDCA 5EHQA 5IM0A 5TXGA 3RS3A 1ORTA 3UAWA 4YAEA 1V1MB 2CA9A 2YV1A 1FUYB 1OKKD 1R0XA 2HADA 4EFMA 2OO5C 4ALIA 2Q8NA 3UD3P 3ZTYA 3VVUA 3N0TA 3OSPA 3G5LA 4IQGA 2DUUA 4RGQA 2BMEA 3HE3A 5ADZA 3CPJB 5KI6A 1U9YA 1Z2OX 3P45B 2BFCB 2IYFA 4MRMB 3C7DB 3UTCA 4YMIA 2R66A 1H72C 4B32A 5AR1A 2OZVA 2FE4A 4JLSA 1R8SA 4P9NA 1PYTA 1H9AA 4MW1A 3VPHA 3N5FA 1O94A 3H25A 2YHBA 4DNPA 1U31A 1ESCA 2I71A 4LF4B 3NHAA 2CVEA 4ZT6A 2N7YA 2ZSHA 1P6QA 1Z4QA 3IP5A 3AEQA 2DR2A 3EXCX 2XWYA 1N1EA 4NE2A 1PDWA 2BUCA 3RT7A 5GAHU 2YNGB 3PW5A 4UW2A 1QG2A 3G2HA 1OWMA 2HFZA 4JI0B 2L69A 1Z0JA 4KO4S 2VDRB 4N0EA 3MJEA 4OP1A 3VM6A 1K68A 3DHNA 1IJEA 4GE3A 4CL8A 3GRYA 2AXNA 4HI0E 1W26A 4B71A 2W6PA 2INGX 1PHPA 4B7XA 1UP6A 2B36A 1KAQA 5KVSA 4LBVA 3SM9A 4A48A 1T5BA 1XHLA 2PIDA 3U4DA 1RWQA 1BH2A 4MW6A 4HO1X 2Z6UA 1AQJA 1QPBA 1KJ8A 1I1GA 1J6UA 3DOKB 5E5NA 3NHWA 3FMVA 4RPHA 4ARIA 4AAYA 5KNDH 1VXOA 4Q9HA 1UK9A 2BGJA 4EI2A 2ATVA 4AUNA 3KRTA 2DWQA 1RYSA 4MITA 1WX1A 4W92B 1HNWJ 5F77A 4B43A 4BFXA 1VGYA 3LXXA 1E6KA 3VYSB 5CB4F 3VR0A 3VR1A 4NCBA 3G9ZA 3EWGA 1Z5GA 4AJHA 1KEEB 2MSNA 4IUCS 2ZHBA 4Y0AA 4DFPA 4NS4A 2DJIA 2VZLA 2AQHA 1F8XA 4C0KA 2OHFA 4QHSA 4NLQA 5DBIA 5ALFA 5H9EK 4CYMA 1T9WA 3NHKA 2CV2A 3LYUA 4F1WA 1H22A 1UZAA 1P2FA 1FIUA 4MV0A 4NYOA 3U4CA 5CIWA 1O6XA 5I8ZA 1M2OA 2XOKD 5GMEA 2FQWA 3K2EA 3CCVS 1GEEA 3KJVB 1TKBA 2XGQA 4ZODA 2PL3A 4L85A 5LC1A 1J5PA 1HRDA 4HB4A 1XR7A 2FPHX 4X2BA 1JXEA 2KLHA 1ELOA 3U17A 3MUTP 1V5WA 4Y6GB 2FLLA 2MKIA 5AW0A 3CMES 1FCJA 3G2LA 3FQKA 1A9PA 3PR5B 5MAOA 1FFBA 2E48A 3E35A 3ZTTA 1U0SA 4NXMF 1LDNA 1OBCA 2J3KA 1RMTA 4KFRA 1M34E 4NCHA 1GZDA 2NLOA 4GBGA 4NRUA 3G2KA 2NLWA 1BSVA 4FWTA 1TZ2A 3WQSB 1SBCA 1QE1B 2WICA 3LY7A 1B23P 2BAGA 2W8BB 2PGIA 1ZBQA 3BGIA 4YRQA 5EJGA 2H7YA 4IO0A 4RGYA 1W49A 2PI4A 2GRAA 2VF2A 2MSKA 4IFVB 4ELVA 1ZH5A 3CJKB 4YQZA 1LBQA 3L0CA 1YVUA 2GTPA 3GRAA 3O4IA 3Q89A 3ZHYA 8OHMA 2X76A 1CQNA 3TQCA 1TVCA 1W1IA 4DQKA 4TYQA 4NA2A 3IR6B 4IIUA 3L4BC 1YK0A 3EDQB 1T5HX 4YRLA 5DRTA 4HB0A 3QAUA 1X3SA 4YALA 1GZ3A 2ANBA 3QLUC 2NTJA 5F2KA 4KOEC 1R8JA 4B3BA 1NJFA 1TX4B 1Z29A 1KDNA 3E48A 3DMGA 4KWEA 4IEIA 3MTBA 3W4IA 1BCRA 3R76A 4F12A 4C7OB 2VHWA 4Y2IA 4O5OA 3P9KA 2W0MA 1RTZA 3LX4A 3ASUA 2QX0A 5JJIA 2ATCB 3TAMB 3IJRA 5KYKA 3IELA 4L76A 1JVBA 1D5WA 2H1VA 4F9EA 4CN9A 1S4MA 3QY0A 3RR8A 3DOHA 1VIOA 3M8PB 4XGNA 4OYYA 1TKTA 1F4LA 3RVJA 4FE7A 2C42A 3CU5A 3H6GA 4II2A 1TUGB 1RYYA 2R6AA 1TTHB 2OBFA 1SH2A 5KYGA 3MT9A 2Q07A 4IZ6A 1GSOA 4WBNB 4NDAA 3TVZA 2ZUCA 1KE2A 4ARUA 4QU8A 5JYBA 4MVCA 4PPZA 2ENUA 1G4CA 3EARA 3Q5GA 3I2IA 1E3MA 1S1VB 1EA5A 2QUBA 3NIGB 1OY8A 1UVIA 2P6SA 4EAQA 4KR7A 4PGMA 3D6MA 1EKSA 1OWOA 5BMVB 3RRBA 3ZV5A 3IBSA 2OZKA 4ETZA 1S5PA 1RXEA 1WCIB 2WFZA 4AYWA 2H00A 5DM1A 3UNGC 2D5BA 3M1IA 1T0BA 1MV5A 4C6TA 3SJAA 1KYZA 5K3SA 1AQLA 1LBSA 4ZLJA 4JITA 4NMMA 1YLXA 3B54A 5TV2A 2QHXA 2NXCA 5E2AA 2KHCA 4K7JA 1KJIA 2NPIA 3RJTA 2EGUA 3TXXA 4KI0A 2ZVPX 5IKXA 1WZEA 2FJ0A 1RHMB 3OHAA 1XNJA 2A78A 2WUEA 3K1TA 1BWPA 4Q3OA 1ZD4A 1UEVA 1GTRA 2X4LA 4N56A 5FWYA 3OKFA 1UEUA 3ZFVA 2F9JA 3R77A 5DGIA 3OJSA 3AB3A 3E5NA 3U13A 4R5PA 5KVQA 4ZIVA 1L5FA 1P62B 2XAAA 5IZCC 1JZSA 3RVRA 1G55A 5WRFA 1SKWA 1YJNS 5C24B 3OTOB 4OYAA 1R4MA 2PBZA 2IM1A 1ZH0A 4EGFA 5CDHA 2GHPA 1LBEA 3ASYA 5CJPA 3DOEA 2WC1A 3O9ZA 4BS2A 3PNKA 3W7BA 3PFIA 5KVAA 4RY8A 4ZTZB 4BX2A 4L72A 2GUWA 2Q28A 1RHKB 3HG7A 3B60A 4EP1A 1WD7A 1EEHA 4TVAB 4IR9A 3SEQA 1VPEA 3K2YA 1SJ3P 1IJFA 3HSYA 3OQJA 1RJJA 4CIDA 2SCUA 4YO7A 1RLDA 3H98A 4ZOEA 3OLCX 4X1IA 4G09A 3UJCA 4KH1A 2CMDA 5J4VA 3UCXA 3C5CA 4Z8YA 2BTEA 4D9FA 4G8CA 2RG1A 3QWAA 3OEHA 3SC2A 3KJZA 2FN3A 4JVNA 1UZMA 3NDPA 4AG3A 1XRRA 2QLXA 1P1RA 1SUQA 1XCBA 1R0RE 1W5FA 1HFWA 1CJUB 3EWSA 4LYFA 4OFXA 4PZLA 2JIZA 3K8ZA 3HWSA 1D4AA 4BTVA 1XXLA 5K6AA 3R0QA 4G1MB 1MMLA 4WN9B 3FCUB 1NU8A 1G6HA 4B6EA 3H84A 3PRJA 3KAKA 4K03A 3ZQKA 3RU7A 3QPAA 3WAGA 3NH6A 1UA1A 1Y8ZA 1GKKA 2JLYA 3PC4A 5CPBA 2ODAA 3FMBA 1P27B 3FYHA 3U3ZA 2ZOMA 4LDQA 4I66A 2TECE 1RT7A 2JFGA 1EP9A 5ITHA 1JLGA 2X8LA 3UPDA 4LF7F 1JT2A 2PUTA 5EE3A 2C61A 3RG2A 5I4IA 2QGFA 3K6KA 3MUVP 5I01A 1Z07A 1ZMXA 4URYR 2AVDA 1XZCA 3RS8A 1LV8A 5JAIA 3T7AA 3UPTA 2BHNA 1E6YA 4ME6A 3VPCA 4RVUA 3N2NA 1AD2A 1RT4B 4ZQHA 1V8DA 1LVHA 2ASDA 3FTQA 2B4QA 4O08A 3JPWA 3VI3B 3UCUP 4HRYA 1PW5A 4K9LA 4N82A 4R98A 2NR0A 1DAEA 3L8MA 1QRRA 4X97A 1BDBA 3EG5A 4OYXA 2HF8A 2GT1A 2RSQA 1EDOA 4KGDA 3WQHA 1Q7YT 2QMEA 2HU8A 2C5FA 3N5CA 3WLFA 4OI2A 2MJNA 4B9SA 3C16A 5K2OA 4DL9A 3OM8A 2ERCA 4GLBA 5LN1A 1NR5A 1RYZA 1QTRA 2ZJ4A 3ESYA 3D4BA 5JDCC 5L3ZA 4JQYA 2OO7A 4ZI7F 4PGGA 2B6HA 3GRKA 1IVZA 1F6TA 4WFQA 2W90A 1HNXF 3NAIA 4IDDA 3DGPA 2QRNA 2ZNZA 2XWBF 4H2DA 2ZJYA 5CDUA 3GMSA 4BLPA 3PGMA 5I5GA 4P71A 1OX5A 4K28A 4J0JA 3EXHA 2X40A 3D2AA 1RZRD 2CHEA 1VMKA 3WNZA 3KL4A 1HBNB 2B4OA 4JV0A 4KG7A 1OFGA 1S7HA 3F4KA 4E7OA 2W4CA 4KQHA 2OV1A 1UK7A 2JKZA 4RW4B 1SK9A 1I3NA 1XQIA 1J8DA 5GJVC 2NOAA 1OSDA 2IODA 3HT3A 1X70A 1WOYA 3HN2A 3HDGA 3F98A 2PYDA 3M1VB 5JPCA 2FPRA 2DMRA 3VJLA 1SUWA 5JISA 2I3GA 5K8LA 2CUNA 3UFBA 1GZ4A 3GQVA 3P3DA 3MZIA 1TPYA 5C8YB 1SHZA 2YPYA 3D1VA 2M98A 4GH5A 1FP4B 4J43A 1WP4A 2VF8A 2B35A 3FF1A 2PGJA 2V58A 1GUZA 3OZIA 3PQ2A 2GM3A 1WSWA 4EYQA 4FGZA 1UBMS 4X62B 3T6JA 1L5KA 1A8PA 1VFJA 5CURA 2CKWA 1A2BA 2GASA 3V42A 4PU0A 1A3CA 2AU0A 1Y5NA 2CSUA 1R6AA 4DIKA 2R6HA 2OGSA 1WUTA 4A46A 1Z6QA 1UXGA 1IHUA 4OSOA 3VNUA 1KYVA 2V54A 4GO5X 3ISJA 4E7PA 4HPXB 2PRSA 5IJ0B 2OO3A 3KHGA 2C2NA 1IHYA 3PRKE 1ZBDA 5L1LA 2O8EA 4DF8A 3ZNUA 2IYUA 2QW1A 2ZBQA 1LJLA 3JWPA 2AYXA 3SN6A 5AVXA 1OTYA 1C1YA 2CNOA 1CQZA 1ZESA 2X1VA 1WXGA 5DLFA 1AUPA 3T5AA 2FUNB 4X95A 4D9BA 5BRNA 4M0MA 1WCV1 4KN6A 1T6XA 3GLUA 5HKBA 1U7LA 4HR2A 1PZXA 3ND7A 4CGYA 1AHHA 2GQQA 2LP4A 5EZYF 3R5GA 2VUSA 1PI3A 3HY6A 3EICA 3M4YA 3OETA 5A6VA 3PHJA 4S2EA 2XQGA 4CMBA 1PN3A 4BMDA 1WG1A 3DEHA 3OMWA 1IM4A 2HLDD 3QEMB 2QLJB 3CLUD 3D4NA 1GM5A 5KT2A 2DPIA 3OZGA 4OQ4A 4PQAA 3TWOA 5CVVA 3COYA 3GFTA 4UD6A 2P2LA 3C41J 2CLIB 4FGUA 5E3JA 4ZAVA 5CVEA 3GZJA 3OTEA 4DL3A 2HC9A 3PPIA 2DR8A 1AIPA 3U44A 4BFSA 2R7TA 3UJPA 4NECA 3AI7A 3AT1B 1M6VA 1GGJA 1FE0A 4RK7A 2FXIA 4MTPA 2IDKA 2HPAA 4TTJA 4OIFA 4AJ2A 2QLBB 2C3UA 4K6MA 3T94A 1YR1A 4C8LA 2C94A 2J0XA 1Q0UA 1D03A 2I65A 1FTSA 4D4JA 1E4EB 4DUGD 5K0CA 4UOCA 1U2GC 3FGVA 1OE0A 3IQHX 1KDTA 2GUGA 3LP2B 3PDJA 2OPSA 4UM7A 1J5XA 3RFUA 2HGLA 4B44A 3CZMA 2JLVA 4LIRA 5GMKa 5K8VA 4MUJA 1VS3A 1UMKA 2H5EA 2RUSA 3HVTB 2XZTB 4LTDA 4EWTA 4IILA 2Y2UA 3NTQA 4MV4A 3GOQA 1XMQB 3JQFA 3IR5B 3TZQA 4TMKA 4FPXA 2HNBA 4C4XA 5C1IA 3W2WB 4Q37A 2ZAMA 3B3FA 4TRMA 4DMHA 1OXVA 1IWAA 3R75A 1B1AA 3NCPA 1FO1A 4BBPA 3T99A 1AZLA 1M34B 3LPLA 2JA2A 4J0KA 2O7RA 2IHYA 2WQZA 3DZKA 3DOCA 3HD1A 2EW2A 2YFHA 4FC7A 1KYWA 3LRPA 3QWFA 4GL4A 3HA3A 1SQ6A 1EK2A 2X41A 1I4OA 4JJ6A 2Y1LB 5C8VA 4W5TA 2VRCD 1XPUA 4B0OA 1RFGE 4NLVA 1Y3BE 1P9QC 3HEAA 4NJMB 5TVKA 3BQ0A 4QWBA 4WYWA 2J0SA 3AESA 3QXJA 1O94C 3ZLTA 3WQPA 2Z95A 1SHTX 2I76A 2NIPA 2ZOSA 3QLTA 2NZVG 4TZKA 1CDOA 3WGLA 2ZCUA 4ZJUA 2CD9A 2OG1A 1GN9A 1HM5A 3OVSA 4X90A 1IATA 4G1CA 2C7VA 4P2SA 1HEYA 4JLUA 4ID9A 2IIQA 4DC0A 3TOQA 2HPZA 2VNSA 3TZCA 4FN5A 4LDRA 4TUYF 4BKPA 1N36F 3AJ9A 2D4HA 1KOLA 5E3PA 3UA4A 3SQWA 5CYMB 3PXBA 2CBXA 5F9MA 1ZOPA 2AS0A 2ILTA 1GCGA 4X65J 2Q9BA 4EEKA 3SZRA 2PUCA 1X6VA 4YQFA 2HQRA 4Y9UA 4OAOA 4O4LA 2O0KA 4K6HA 2W83A 2Q5FA 2VTEA 2R1VB 2IBOA 4KZPA 3VHXB 1D2GA 4BYGA 4HNAB 4ID5A 3RAJA 3T1OA 2RGUA 3MJCA 4PGFA 4YQYA 2I7XA 1JR2A 3X1JA 1C0KA 4FHZA 3R6GB 2B56A 1Z75A 3AHCA 3CB4A 3WNBA 4KFBB 4OYIA 2HREA 4I9UA 1IEXA 2E49A 3C3PA 3PCXA 3WB9A 1QTNB 2ZD1A 3AIMA 4J9RA 5EZ6B 3L82B 4WZBE 1SIOA 1RLMA 5ITSA 7FDRA 2H9YA 4XGKA 3AR3A 4ITRC 4LHSA 1CF4A 2AOWA 5COBA 3VR4D 4TVOA 4MJLA 3DEJA 5FI3A 1MB2A 1ZY2A 5H59A 4ZMSA 1DUVG 4KK3A 4G1BA 4HACB 4QBTA 1ZR2A 2P2NA 5B3JA 1XMBA 4EMBA 2GBCA 3BD9A 4LRAA 1KD1T 2MINA 3VMMA 3MQ2A 4QOSA 3EFOA 2ZXFA 4DMRA 3LUKA 5K4HA 1WKBA 4M1OA 4CL3A 5ESRA 4HEHA 3L7LA 2WUFA 3AI1A 1B6RA 1QOQB 4R68A 2XUKA 1YZGA 1PS8A 3IP8A 1EXMA 4Y0FA 3ETJA 1H38A 1YSJA 1GA6A 3KDNA 1JE0A 1EFKA 4Y2KA 4FYJA 4HPJB 2I4LA 5T64A 4TZ6A 4O29A 1TM2A 4ECAA 3LC1O 3UJHA 1WI8A 5GVQA 2JC0A 4ZVPA 2OORA 4B6PA 4USHA 3QVLA 5KJ1A 2ZS7A 3O5AA 2BPOA 2D1RA 2WF5A 4CQLB 4DKJA 3AIOA 3QY9A 2W2OA 1DC5A 2LMIA 4WZAA 4NU8X 1K63A 5J2UB 2FSGA 1EYZA 2ZS8A 3VI4B 1AFIA 2M88A 3ZKWB 1UK6A 2BJDA 1LU9A 1J2YA 3Q9SA 3FKQA 2R65A 4X71A 3CCWA 3G8TA 5B1YA 3A4VA 1RS0A 5KZMB 1FSGA 4AI6A 5DQGA 2C2OB 4BVBA 4YDSA 3DMJA 3OFFA 3LZ6A 4P5EA 3I0SB 2XMWA 3WMFA 4D46A 5JBIA 1X31C 2JDIA 1AF7A 1JAZA 3RJ5A 2V7QA 5KTSA 3V4OA 4QM6A 1N0VC 4LW8A 2X1AA 3N8NA 3HB5X 3NRBA 1DEXA 1CZUA 5JLJA 4WGFA 2I5PO 1HE3A 3BSCA 4D9IA 4KPCA 4D0SA 3WVNA 3ZWXA 3QSYA 5L1JA 3JAWA 5FPSA 5LYJF 1FRQA 3CEJA 1B6TA 4M1MA 2B7LA 2OCXA 3M34A 4TKMA 1FTRA 1WXEA 4F92B 1GQ2A 1QDEA 3I82A 1U5AA 2FEWB 4V0MA 2CE7A 4N18A 3M0EA 3LBHA 1WBBA 4QWCA 3ZY3A 4E09A 4H27A 1FLVA 1NW3A 1HGXA 2C0PA 5JHHB 4CIYA 2C99A 4AO6A 3WP0A 4G25A 1DX6A 1KOJA 2BFOA 2RMLA 4EKGA 4WA7A 3OX2A 4RKFA 1ZJ4A 4HTFB 1DFDA 2X5XA 3BT7A 4D2IA 4ZICA 7AT1A 3DRXA 1TA4A 4LSMA 5BOSA 2FRVA 2FA9A 4OYHA 1GDDA 4J0CA 3V8NA 4JYZA 4FYVA 4MQLA 3Q87B 1N6NA 2PK3A 4HI1A 3BEGB 2XGPA 2PZGA 2ZVDA 3NOXA 4MB2A 4WPAA 1EVQA 1DC3A 2Y1WA 2C8KA 1W1UA 2EARA 2WKPA 4OOEA 2OAP1 3INRA 2JH3A 1RCXB 2ASVA 4ACBA 4B45A 2CF6A 4C0HA 2JLZA 5CD4A 3DV0A 5EP2A 1XTIA 3UUEA 2TYSB 5IAAA 3L4JA 3QEKA 3GA0A 4J1TC 1KAHA 2OGWA 2ZJOA 5AM3A 4OQYA 3HHNB 3H2SA 1AB6A 3F1KA 3WRWA 1T2NA 3WB2A 4QO8A 3H5XA 3E27A 2RRNA 4CTNA 2UYQA 3M8RA 3L8CA 1RJEA 1NJWA 3TLBA 3VKWA 2BZGA 5A7FA 3LFUA 5ARCA 1HPZA 4MROA 4DQXA 2AX3A 2LIVA 1TK2A 5FI0B 1D3WA 2Y68A 3EYWA 3UJNA 3U4AA 4KDFA 1TM5E 1S6PA 1MC1A 4LY3A 1WF0A 3BMNA 1YFKA 2UVPB 4Q34A 2FU5C 1HLPA 1OI7A 3GPLA 2R4TA 1MJNA 3FFIB 5A6WA 5BQXA 3NGUA 5ILQA 3NHZA 3ZGZA 5CT8A 1V4BA 1FS5A 4A8JA 4DXAA 3ZJTA 1CEZA 3ZVRA 3LH5A 2Z5GA 1UM9B 1NHUA 3WK7A 4ZYZA 3UYKA 4OL0A 1JW9B 5JAQA 1N33J 3FBTA 1YQTA 1XF1A 4JKYA 3BH7B 4F38A 3O8QA 1Z0UA 4E0DA 3JAKA 4B3MJ 2COEA 1LXJA 4L9RA 2ZSIA 3CJ4A 1KQGA 2DPMA 3JQGB 1MWZA 3DLPX 5JBNA 4BO8A 4YX9A 1E2EA 1FYVA 3IOMA 1YTLA 1HSOA 1I94J 3O47A 4JL8A 5BY2A 1F60A 1JIKA 3DTVA 1VLMA 2H1HA 1DS6A 2WVHA 3LVFO 3OCUA 5I47A 3B7WA 2DKOB 1IZ8A 2Z9CA 2B2XA 3UMVA 4K2JA 4K26A 2BZ2A 1U8TA 4C0LA 3H2LA 2BDUA 3N58A 5DF1A 4MGKR 3BFJA 1YV9A 4EG1A 3KLHB 1KKHA 3FVQA 1X77A 4JT4A 3JAMU 1K9VF 1XD8A 4EMSA 3OC6A 4UCFA 4MKIA 5BSKA 5ETTA 4AN0A 5GQSA 2CHUA 3G5MA 3K4HA 3GTYX 1QV9A 1NOKA 2BANA 3LDHA 3D0HE 4F4HA 2H65B 1CB0A 2WVAA 5GZ3A 4P4SB 3IP7A 1VJ0A 3EF1A 5IJ9B 1C30A 1YCDA 5GONB 5LXYA 1I6JA 5B1DA 5KVVA 1HY3A 2POCA 5KDLA 3VKHA 2J9RA 3M2UA 2N3LA 3KYJB 3PC6A 4BDSA 3R9IA 4A10A 1Q77A 5IJAA 2YJ6A 4DL5A 4HPWA 1UDBA 2RC6A 5KFJA 4DL0C 3K32A 4HZGA 3EDRA 2C2BA 1KO4A 3DCYA 4QDOA 1L7VC 3PVSA 1EDEA 2WBLC 1M0SA 4IHJA 1ZA2B 3GV5B 1M0EA 3C16C 2WWWA 3V1LA 4K8RA 1PZEA 4AYBD 4BLOA 3QLHB 2ZYTX 3IMCA 1MSWD 1SXJD 3FLBA 3O9VA 2PM8A 3IESA 4UNRA 2Q1WA 4XSGA 5U4QA 1OFUA 5KNDD 1Y00A 1A4UA 1S10A 2IE0A 1RB0A 3SC6A 4P74A 1E4YA 4F5EA 1ZK0A 5L3SB 4L5IA 1Q92A 4Q7JB 1GOTA 1T24A 3EGDB 3NV9A 5BR7A 5EHGA 3ILLA 1RRVA 4NOLA 1E4OA 1L4HA 3WGMA 4QFCA 5A6SA 4QGAA 1MG5A 2IZZA 1G3QA 2OPQB 2FB0A 5HROA 4NBTA 1CUJA 3IBFA 3EXHC 1Z4NA 2ZSUA 4ZZIA 4KVAA 1VLJA 1QF6A 3D8TA 3DZIA 4HRVA 1IEWA 3SP1A 2BMWA 4AW9A 4ND8A 1D9ZA 3OJWA 4RBTA 4ZU1X 2WLSA 3TQRA 1X7YA 3RG6A 1OU0A 4BO9A 9GPBA 4DA7A 5DG7A 4A8YA 2PUBA 1N2JA 1NSFA 4LX8A 2EF1A 3K9QO 3IR7B 1MRNA 3DQZA 1X9HA 4K4WA 3H90A 5AIAA 4H0NA 5EHNA 1U26A 4IKOA 5L1IA 5SY9A 1O6FA 3G87A 4NR0A 2UZ1A 5BV2P 4BZWA 1HDIA 2CNBA 3NHYA 2XA9A 3ADDA 2AJDA 1OS5A 4GVPA 5KTYA 1JQBA 3UUGA 1A5TA 3PC7A 3QGMA 5CGZA 2FPGA 2W6MA 1ZOSA 4G81A 3FFXA 1DBSA 4GMDA 2AUNA 4DV7F 5HRUA 2GNKA 4OOFA 3TBHA 1O54A 2WZBA 4LBHA 1FZQA 1OYVA 2WB1D 1NMEB 1NWCA 5EGYA 5C2GA 5ER6A 1DMRA 1W2IA 2FCRA 3VKVA 2DUMA 2VHEA 4O2BB 2H4WB 1FNDA 5KFDA 2R8BA 2IXEA 1K73T 2KN4A 3GDHA 1ILEA 3W1WA 4CO5A 1GA4A 1X5TA 1RXOB 2X7HA 3BE5A 3OR2B 4U00A 2XHWA 3IDFA 4D3ZA 2NU6B 5FPPA 2UU9F 1CZOA 4PBSA 2YV2A 4ETXA 1W1WA 3T5HA 3LP0B 3RUCA 4KNVA 3W1EA 1R8BA 3K30A 5EKXA 4XUCA 4ZRMA 4CMGA 5DI3A 4KE5A 2REXB 4C3OB 3L7DA 3DKVA 4JMLA 3N0WA 4G0YA 4QQBA 3SX4A 5K8MA 2CHVA 1HI9A 3FAKA 3VZBA 4UEOA 1B41A 4NCGB 5DETA 2SHKA 3W5YA 4OX9J 2VPPA 2DE0X 3BB1A 2AIRA 3Q23A 3H83A 3IOYA 5AP9A 1WOSA 2BHLA 1JQGA 1VRTA 1I4DD 4F3QA 5HNKA 3LTNC 2X0JA 2IMWP 2EX0A 4M0UA 1GZ5A 1ONOA 1AY0A 4ZOLF 4EEZA 3IB6A 3IQDB 4FBGA 4ECTA 2OPRB 2YIMA 1LK7A 3DMPA 3RS0A 1RMQA 3O8LA 4ZIRA 3DE2X 5AKZA 1C8BA 3HB0A 3G0GA 4OXRA 2DH6A 2HMIB 3DCNA 1U2CA 4OL8A 1ZSYA 4MV3A 1P33A 3TSAA 1M72A 4ZOQI 4JSRA 4CMAA 3M5DA 4Z6KA 4RHYA 3IBCB 4ES6A 3SQOP 2BKOA 2QG4A 2CQ3A 3DTTA 5ALGA 4JC4A 1AGPA 2JLBA 1P5FA 3KYCA 2QYSA 4RZHA 1KMQA 1VC6A 3MMZA 2R84A 1QMGA 4RYLA 1NU6A 3JD2A 2ZYHA 3SY8A 2PRJA 1R8CA 5FLXA 3VQSA 4DIMA 2CQIA 2XYHA 5ED0A 1F2DA 1BMQA 3ND6A 3PD7A 2GLTA 4EJSB 3KK2B 1JIHA 1EX8A 2JJ4D 4A3SA 3OA0A 2IFXA 1G291 3IEKA 3KLIA 4PEOA 1AS0A 1SC4B 1U8SA 4KCGA 1XVLA 1C0TB 3OMXA 2D1FA 4WOJA 2CY0A 2OK7A 2ORIA 3IEUA 3JQFC 2P9YA 2IS2A 3J81U 5IDWA 4LGCA 3RIHA 4R8UA 4Y2CA 4BNVA 3C2PA 4FXDA 3CF5Q 1ZNYA 1V6SA 5D5QA 2I6WA 1K27A 3COZA 1X15A 3IQIX 1QO9A 3OEWA 1GVNB 2UVVA 2IXFA 1YJWS 1C41A 2C9OA 3PQ5A 1MAVA 2B7CB 3BXZA 1THGA 1OBVA 4LFCJ 4M0CA 5FI5A 1BXKA 2H17A 4KP7A 4KYVA 1T02A 4U2EA 3MN1A 4C4RA 3ADOA 3ESBA 2O8CB 4LYJA 1T3TA 2OENG 3VALA 4OMCA 3E4CA 1EM8B 2LD4A 3LPAA 2QX8A 2DFNA 4WT7A 2CDRB 4V0RA 4Z7QB 3KJFB 3AF6A 4HMOA 2IIVA 3KK0A 2RS2A 1NDQA 1P44A 1E9VA 2ERRA 2HSWA 1J7KA 1YRLA 4F6RB 4GYJA 2NUUG 4RANA 3KETA 1N2ZA 2FGOA 3SZ2A 2VDOB 1DCTA 2F17A 3H8JA 3C66A 3IAFA 3AL0C 1X7VA 5HIKA 1N52B 3M83A 3D3WA 4OLJA 3OQMA 4DCOB 1FRFS 4REQA 2C88A 4RLHA 4YLEA 5J2PA 3W6OA 3BE8A 1I9GA 2RE8A 4GPEA 3S40A 3RU2A 3HO6A 4JGGA 1M2GA 5FV7A 1DKOA 4L4SA 2WV9A 2BI8A 4AURA 4UTVA 1VJDA 1UVKA 3NIFB 1JHRA 1NK5A 1HC7A 1ZI8A 3DW3X 1OCEA 5CW2A 4LF6F 1JEYB 3NCTA 1CUZA 1GN8A 1Z5VA 3F6YA 3K96A 2LXIA 4JP1A 3IT0A 3STUA 2O05A 3SJCA 3GLQA 1HE8B 1Q81T 2XV1A 2VSFA 4M5KA 3QOXA 5AK3A 3PSAA 4PZ9A 2CFOA 4ADSG 5C51B 1FPQA 3OFEA 1NF3A 5AUNB 2P2ZA 1AT1A 1XV5A 3G85A 3MUOA 2HHUA 3H59A 1GLVA 4KSYA 1MC5A 2HQ3A 5D0RA 1VFNA 4AJ1A 1ZZGA 4E30A 3LBYA 3ZVNA 5B3JC 2ZJZA 3NDRA 4EBEA 3AYXB 3COVA 4C4SA 1FFWB 3OBBA 3BE6A 2DRAA 2J4DA 4TVKA 4EUSA 1YA6A 5JY6A 2PDAA 4WXWA 1UJMA 1CLUA 1H0HB 3EM1A 1I3OB 3FJOA 3R09A 2EHJA 3K16A 4PAWA 2M8DB 4DLRA 2CQDA 3AL3A 1Y8QA 1ZQ9A 5DYNA 4Q3AA 3B38A 5C1BA 2ZVJA 4TSFA 1JYEA 2DR7A 4BFWA 1CNFA 3W5DA 5DOVA 3EPGA 4BJHB 1K3FA 1VECA 1MMNA 3C19A 2VEOA 1QYVA 1KU0A 5F3WB 2PQ2A 4JELA 2IZ6A 2OORC 1P3JA 3ACDA 3DM5A 4N7MA 4WKRA 4JSYA 4ETIA 4HBGA 2VG6A 3IO3A 2IOFK 4CEIB 3MD3A 2FMTA 4FYPA 3V4FA 1QX3A 4LRDA 2R2SA 5MF6A 4TTIA 2XNQA 1QWOA 4UVDA 3OJOA 1G8GA 4MO2A 4V2IA 5L8VA 1YBMA 3U7JA 2XMCA 2WT8A 4WCFB 4EO4A 2VSOA 2H0RA 3X43A 4AQ7A 2FDCA 3ZLBA 3I5CA 2AG1A 3MT8A 4EATA 4NNJA 4UQTA 3RAXA 3IWXA 3BKWA 3IUBA 3MMPA 4XLZA 2D2VA 2O8FA 2NUAA 2XRZA