2NUUG

Regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Escherichia coli AmtB-GlnK complex reveals how GlnK regulates the ammonia channel
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/signaling protein
molecule keywords Ammonia channel
total genus 26
structure length 112
sequence length 112
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nuuG00
2GX8A 2J9EA 2PIIA 4Y6IA 1V3RA 3LF0A 1PILA 2XBPA 4CO4A 3TA1A 2XULA 1NZAA 3TA0A 1QY7A 2EG2A 5DRKA 4CO0A 4CO3A 2GW8A 3OPKA 1GNKA 4OZJA 4R25A 4AFFA 2ZFHA 3M05A 2J9DE 3X3UA 3L7PA 3MHYA 4C3KA 2GNKA 3O8WA 1VFJA 1VHFA 3AH6A 3NCQA 2CZ4A 2O66A 4OZNA 2J9CA 1V6HA 4D3GA 1UFLA 4WK1A 3O5TB 1Q1KA 4USJC 4D3HA 4USIA 4C3LA 2NUHA 2NS1B 2Z0GA 3BZQA 3AHPA 1O5JA 2ZOMA 5D4NA 4RWWA 2VD3A 1P1LA 4IYQA 1UL3A 2NUUG 4RWXA 4Y65A 1J2VA 4NYOA 1HWUA 4CNYA 2DCLA 1NH8A 1OSCA 3GSDA 4CO2A 3NCPA 5L9NA 1UKUA 3HLUA 2O67A 2XG8A 1O51A 4NYPA 1NAQA 4E98A 4YB7A 5DS7A 4RLEA 3DFEA 2XZWA 3CE8A 1XK8A 4ZK7M 5D4LA 3TA2A 2EG1A 4CO1A 4USHA 3NCRA 2V5HG 4OZLA 1V9OA 2E66A 5D4PA 2JJ4D 2J9DA 5D4OA 4C3MA 2RD5C 4RX6A 4YB5A 4WK3A 3AA9A 4CO5A 1NH7A 1V3SA 1UMJA 3T9ZA 4YB6A 1H3DA 3AA8A 3N5BA 1KR4A 4CNZA
chains in the Genus database with same CATH superfamily
4CLZA 4EEYA 3KLVA 1G3OA 1RAJA 1U45A 4FDFA 4QWEA 3NWGA 5E3RA 4JI5J 2F8MA 2QYCA 1NMEB 2XSFA 3JSBA 4ANEA 2BW2A 4ES3A 5I4MA 1OPIA 4OJ1A 4PZVA 1SCJB 1OS5A 3FCVA 3JYTB 3KG1A 1HR0F 4U95A 2VOOA 1H2VZ 2PT0A 5ETMA 4FYYB 4WFXA 3MWBA 2DHSA 3D66A 2QL9B 1MMLA 3M2RB 4LR7A 1RTIB 2JLGA 4ECWA 2M8DB 4CO0A 3R97A 1N88A 2M70A 3QT5A 4K7QA 4ZVFA 1MG7A 1TFWA 3A8JA 1FE0A 2GAGC 4R25A 3J7A1 4O44B 1SI9A 1SJRA 3FKBA 4F4WA 5AE2A 4MKYA 2J9DE 1FRLA 5HJYA 2PD1A 3OQ2A 2JRSA 2R7QA 4NA1A 4AYBD 1S12A 4FXVA 4RNMA 1WC4A 3K8VA 2ASJA 3H7HB 1U49A 2ZWPA 4YMEA 4K50A 1URRA 4BS2A 1X5OA 3I5BA 1F1BB 3DLEB 2PDAA 4OZNA 1QD1A 4P7VA 1TP7A 2C3UA 1UWAA 1UW9A 4ZPAA 5CYJA 4EBEA 2XMWA 1S9GA 3N28A 3CCVS 3FBBA 2XS7A 2JWNA 5KFHA 1KOHA 2PE8A 4LJMA 2AYEA 2NYIA 4N47A 4EUVA 2YNGA 1F9FA 2W9AA 3SCKE 2ZZNA 1Q16B 4ZVTB 2DISA 1FXLA 3WX4A 1VRUB 2LU1A 4USJC 3A8EA 2WB1D 3S01A 1WTBA 1OQ6A 2VG7B 1RTHB 2DHGA 3MAAB 4ED8A 1N5QA 3IA0A 3T6JA 3MEEA 1FFSB 2EVZA 3W5ZA 1SUQB 2PGCA 1WUUA 3AQOA 3UW1A 1SC6A 3W2VB 4F0MA 5D4NA 1SUQA 4DR3J 3KLIB 1HMVB 2IA6A 3HT3A 5DQIA 4IRKA 4M1KA 4TLQA 4DR1F 1CULA 2FTRA 3ENWA 1HBMA 1FXDA 2G13A 4IH7A 3GFXA 2I5JA 1NH8A 2V2QA 1RJJA 2YNHA 3LGMA 2J0XA 4DCJB 4ED4A 5LXRA 4YOEA 2I5JB 2YNHB 4C8KA 4Q7AA 1PBUA 3JSMA 3KLGB 1UP1A 4ZHRA 5HP1A 3NY0A 1CPZA 3AAWB 1VJQA 3AOAA 4RW4A 3PV8A 1P9YA 5FDLA 3JSYA 4P72A 5D77A 2CJKA 1W7WA 1SJQA 4USTA 1FWKA 2UXDF 1EETA 2BJEA 4NMXA 4O3RA 2HFOA 3EZUA 5H1SV 4CH1A 3UVJB 2CQGA 3DXBA 2DKOB 4NRUA 4A8FA 4CWBA 3JQJA 4KHPJ 2I38A 4M95A 5ETNA 2AWZA 3DHWC 2HURA 3IWXA 2J8SA 4GKJJ 2XZWA 5DLFA 4U7CA 4OX7A 3RAMA 2B9XA 1RUSA 2W2QP 2K1RA 4I7FA 1AFIA 2EG1A 2DEJA 5CCMA 2DH9A 1BGXT 2OD6A 2ACYA 2C42A 4FKXA 3M8PB 1XMOF 3Q83A 4O3SA 1W2IA 2FJBB 5C25B 3MM9A 4PXBA 3ILIA 4N8OA 1IKVB 4DR7J 2A2CA 3VZIA 2WAQD 2AEJA 3D28A 1B0TA 3HX9A 4RX6A 5HJXA 3PO4A 1B7FA 3B54A 2D3ZA 4CO5A 5IT9Y 3FSXA 3VVTA 4J9SA 4CYUA 3PW5A 1A6LA 5L1LA 3Q8VA 2Z4PA 1S6PB 1T03B 2FIUA 4IDKA 1SQFA 2GO8A 2LP4A 4ZPCA 2W01A 5KFAA 5IM0A 5GMKa 2VODA 4PRFA 1RWNB 1EP4B 3H5XA 4B3RJ 1H7XA 2HKEA 3M6VA 1AROP 1VOMA 3TUJC 3BF4A 1JJHA 4DL4A 4C7QA 4QIEA 5K9FA 5KG2A 5DQGA 4EK2A 1K73T 2NQPA 3MFHA 3LW5C 3G86A 2WHOA 4GO5X 1S76D 3DGVA 3GU0A 1HNXF 1HNZF 1N5TA 3MOZA 3M8ZA 4JV2A 2QC3A 1NZ8A 3L3CA 1IBLJ 1HHQA 4ZKAA 1N4LA 4ETXA 3IR5B 1YX2A 4HTJA 3NLCA 2XCPA 3V6KA 4PUOB 4M5NA 3K5PA 3JQKA 1IKYA 3IWLA 5ETSA 3CJ0A 1WKJA 2XI2A 5A6PA 4OZJA 2C2ZB 1DTTB 2MQMA 5HMZA 4OI3A 1TU0B 5KT4A 1S0MA 1N6QB 4MIAA 1RAFB 4F67A 1HBUA 3ENQA 1WEYA 3OTOJ 1SB6A 1NU4A 2JFDA 5GADI 4J9KA 1VQ5S 5F9NA 4ZPBA 1RI7A 2GVDB 2H5IB 4RW8B 1RHJB 2KZZA 2U2FA 5FDLB 2COLA 4FS1A 3GE9A 2J0WA 5EWFA 5GVQA 1HNVA 1R7IA 2KT2A 4XPCA 4MFBB 4DFKA 1BWEA 3P96A 1ZOTA 2EK1A 2NZ4A 4NX9A 2VDIA 5HQLA 3CCES 2UVWA 5F3ZA 1F2GA 1CLFA 4CI0B 2ZKTA 5AJ3F 3PIOQ 4G1IA 1L5UA 3HM9A 3HHEA 2XY7A 1YIJS 2QMWA 5F8IA 3G4SS 2UXBF 3GJQB 1NHUA 4CLWA 2R9LA 1U24A 2WVFA 4X66J 3FBFA 2CDQA 5G0RA 2B7BB 3QJLA 3UCUP 3J7ZT 3GIMA 4WF9Q 1JLBA 2GIFA 1XMBA 2J7UA 3OTBA 5KFLA 4LR8A 4ZLLA 3GCWP 4RNNA 4L75A 2DNOA 5E7OB 3DRPA 3IR7B 4ZDNA 4MTPA 3PJ9A 1RAEB 1YBUA 2ZM6J 4IOAQ 1F5CA 3UNGC 4JI6F 1RAHB 3NG8A 2ILYA 3OVBA 1SKUB 1N34F 3NWRA 4DPXA 3D3CJ 2DR5A 1TKXB 3H5SA 3MMCB 1ZZFA 3FEXB 4RL1A 4WYLA 3V5RA 4P75A 1S0VA 5KFGA 3MMCA 4ELVA 4K0KF 2V8HA 3SSSA 1CJUB 1SIWB 2PA8D 4PG5A 3VWSA 1ZYQA 5EX3A 3HK2A 3C14A 2QSFA 5CYQA 2XG8A 3WC2A 1PAUB 3D1OA 2KKHA 3PYEA 2HHTA 1FNXH 3AJ1A 4QIFA 4YR3A 2GVZA 3H8YA 1YRXA 4RR5A 2ZH5A 3W64A 2KDOA 1QSYA 5CAAA 4L74A 1GXLA 3VHQA 4LF4F 4I4BA 5L46A 3W62A 3V6DB 1FJCA 3BN7A 2O1PA 1ZBTA 3DFEA 4O44A 1XTZA 1HARA 3EVMA 1RTIA 1BLUA 3NKYA 1X9WA 4C2MA 4MK7A 4Z2XA 1CG2A 2CZ9A 4FNIA 4L3NA 1EJ7L 1LFWA 2DT9A 5E3QA 1FF2A 2EFNA 3VCDA 3TAMB 2ZUGA 2F9DA 1ZTTA 1KFDA 3FJ2A 2ROGA 3BYRA 3J81U 4JI8J 4RW9A 5A8RB 3KLHA 1H2TZ 3CGIA 4WK3A 4RUCA 4DSJA 2CVIA 2G9OA 2VG5B 1W2BR 1YBAA 2C28A 3W8PA 3W9JA 4LIWA 1AUDA 4FBTA 2QTWA 4DV2J 2NYHA 1AZSB 4O4RA 1OYEA 1VLOA 2HSEB 4I1TA 3HZGA 1H3DA 2DCUB 3H2UB 5B09A 1YDLA 3CCZA 1PCAA 1CJVA 3UR0A 2FVPA 3TUZC 1NK9A 1FNOA 2C2OB 3BR9A 4ZP6A 3R7NB 5HSPA 2UUBJ 3NMRA 5KT5A 3HJVA 2DEIA 2KFZA 4KYZA 4CQ1A 2VH7A 1V3RA 2MTLA 3M2RA 4NEZA 3W61A 1QE1A 3AQPA 2AJ2A 2RB7A 1I94F 1F5BA 3BEGB 1BXNA 1E6YB 1GMUA 4ICLB 1HBMB 3IBWA 4ZMMA 1JX4A 4RBTA 1IBLF 3LWLA 4HL9A 5H9FJ 1LNQA 3MM7B 2ALZA 2AP6A 4JBCA 2EBEA 1X5SA 3OPKA 2CQPA 2GVDA 2IHR1 3N9UC 8RUCA 5GAEU 2KT3A 3OVSA 1U1KA 4Q8FA 2ILZA 2KZMA 1RT1B 3ZTQA 3AJDA 3OLBA 4RU2A 3G6YA 2HNDB 2ZC4A 2E7XA 3BKFA 2Q43A 4YDXA 5ETQA 3QPIA 3UDEA 1RBAA 4DSFA 1NK7A 4DSKA 2DD8S 3T1YF 3QO9B 4IOBA 2POKA 2CZ4A 4YEAA 1O0PA 3CUNA 2FJVA 3BSCA 1KKHA 3BDEA 3E01B 1PSDA 4ID8A 5KFKA 3HPOA 2F8HA 4MMOA 4F2RA 2VQFJ 2Y1JA 3MXHP 1RKJA 4ED2A 2XMJA 3NS6A 2D41A 2ZKUA 4RNOA 4X84A 4X4NA 2W7AA 2JEFA 3EGZA 3CEDA 3NS7B 3WDOA 5C42A 1Q4RA 2K1RB 3T1HF 3AXKA 3D6HB 4F0HA 2QA4S 3GTYX 4CP5A 3BM7A 2FHMA 3HULA 5J1NA 1B0PA 1Y3JA 3WZ0A 3FFIB 3PHTA 5HANA 2XLIA 2Y8WA 4LF6J 3E2EA 3OFEA 2DY9A 2KL8A 1ROFA 4PG6A 5HBMA 3AHPA 2XMMA 3CVKA 5ETRA 4NLRA 3W60A 2HYIB 3FBEA 1X4BA 2CQBA 3ISZA 4L73A 5IOLA 3GV8B 1H7WA 2YXLA 2YQ1A 4ZJLA 2MMYA 5A8RA 3QAEA 3A8KA 1VRTA 2VPYB 3JSMB 5HP1B 3M4XA 4I2PA 2WTFA 5F8LA 4KB7A 1NNDA 3C14B 1J2VA 4NYOA 1K0TA 2RE1A 3IP0A 4BWMA 3H98A 1S9EB 1S6QB 3K5NA 2DR9A 4UF4A 2HQIA 4NZ7A 4ELUA 1HNIA 4ZLPA 2CPEA 2HHUA 1VDHA 3MGJA 4FYDA 2F5GA 3NCPA 1LW2A 4QYRA 5HAOA 5T41A 2R7SA 3CMQA 3FZ2A 3CCSS 3DLEA 4DL3A 1HQUB 4JI7J 4DX6A 3CNQP 5HATA 3GJRB 4M5MA 5U47A 1JLBB 1VQMS 4MKAA 1DTTA 4DX5A 4IFVB 3OR2A 2KG1A 1EETB 4ENOA 5C42B 4ED0A 4C8YA 4QU6A 1FJGF 2O5DA 3T1YJ 4X65F 1VRUA 2FVRA 5B0DA 3RRGA 1TAQA 3ZTSA 5FLXY 4B3SJ 2IY5B 3CCJS 3A1YG 2VPXB 2VQEJ 2F3JA 2V5HG 3T1HJ 3J7YU 2ADBA 1TAUA 1KWMA 3QGPA 3QT7A 4RW7A 3X1LB 1RT6A 3IS9B 3QGIA 2Y0BB 2DNHA 1N0VC 4FN5A 2E7VA 2G0IA 3IAM9 2PMHA 2QX0A 2H48B 1VRTB 2EFQA 2GS8A 3FSYA 4P71A 4URSA 4FVCA 4NA2A 1TVRA 1U1RA 1N34J 1WHVA 5FLXU 1S72S 4RW6A 2ASLA 2X1FA 1S1VA 3G6VA 4FS2A 5KFQA 5KG3A 1KTQA 3UN3A 2WVDA 5KFXA 1PJ5A 4Y2AA 5KFBA 1U0SA 4NPOA 3NMAA 4RZRA 3T5JA 4B3RF 2MGZB 2LQ9A 4I6WA 2CQHA 2WSCC 5A6WA 5KFDA 1NHKL 4IUFA 2GX8A 1XNRJ 1M5SA 5J2MB 4WFAQ 1KDNA 1JLQA 4G6VB 4MYTA 4PUOA 1WHXA 4WE1A 2WOMA 3EVOA 2CWKA 1C1BB 4X64J 3D5MA 1RTJA 2VFSA 4X4PA 1RWKB 3KJVA 3M9OB 4K4YA 3CO0P 3GYNA 4NA3A 3D2WA 2FHOB 3OR1B 3EXCX 4DQQA 1N5VA 2H4YB 4ED1A 1H0HB 3CCWA 5EHHA 4J9NA 2OI2A 2KFNA 4UUXA 1UPMB 3ET6B 2C1EB 3I4HX 4F0KA 2V2KA 3ULHA 5GADU 3UNYA 4PPZA 5DG9A 2APOA 2DXFA 2BQRA 1NK8A 4X64F 4DV1F 3Q8YA 3US5A 1UEKA 3BGFA 4USWA 1WKLA 2CG4A 2GJIA 1VHFA 1SL0A 2C2NA 1TL7B 1S49A 4P73A 3MMJA 4DV2F 1BHNA 2KYZA 2HBQB 5LXYA 2LMIA 3M8YA 1ZA2B 4HHUA 1MU2A 5B0BA 9ATCB 1SL2A 5CD4H 4A8YA 3CCUS 2LA4A 3HHKA 3PFOA 2P8IA 4MT1A 4LQ9A 5DDPC 4JI3J 3C15A 4DUTA 1VHIA 4QZVB 3AB4B 2KJWA 2VUGA 4DL7A 4AL5A 2P6TA 3AXMA 4V1Ak 3MEEB 2M7SA 3HVTA 3QATA 3TZYA 4J91A 4PXEA 3T19A 5KFYA 1OWXA 5F8GA 2AJ4A 2CNKB 4R8UA 2UVUA 3MM6B 3BO4A 1NDKA 1HWKA 3QRRA 1FTRA 4M94A 2E9ZA 1AYEA 3MR7A 1Q7LB 1ZPVA 2ASYA 5AXNA 1CVJA 3BGUA 3ZNJ1 1SJ3P 2CJAA 2VG5A 4WXOA 1BE4A 3ET6A 3UDCA 3KNAA 2NUUG 2IM3A 4F25A 5J1EA 3M8WA 1TTHB 1UVNA 2W2OP 3QAUA 4LSZB 5L8RC 1ICEB 2NPFA 4W90B 1FKOB 1RCXB 4LUBA 3KK1B 1VQPS 2V4JB 3NGRA 2FJWA 4OZ0A 2KI2A 2XZTB 4G65A 4O4GB 2B5JA 1WDTA 2V63A 4X4UA 2ZBPA 4PKDB 1WEXA 3CULA 1CJTA 2C3OA 1Y3KA 3A3OB 3W8GA 5DG8A 5GAHU 4OJHA 1XC9A 2J6SA 1VQYA 2O67A 1D9DA 1DURA 1NDPA 5DG7A 2DO0A 3D7SB 2ZDPA 5HMWA 1I6JA 2M0GB 4PCQA 2MJUA 5HL7Q 4HYKA 2XC9A 2L48A 3I31A 1R0BG 4NLQA 4OI0A 1WF1A 4G3IA 1R3NA 4CYUB 3GYXB 1O6XA 1I1GA 3QLHB 4ZVQB 3ZNUA 1U8SA 3MF5A 1NK0A 2FVCA 2W7PA 1FWPA 1Q79A 5F0UA 4LF9J 2AJ1A 5GAEI 2MHNA 3M32B 5H9EK 1S5ZA 4LF6F 1WORA 2DHXA 2Y1LB 2R7VA 2GMHA 6AT1B 2GA7A 1CC7A 2BXJA 2IJRA 4KBIA 3PO5A 2UXBJ 1LXJA 2M2BA 2RF2B 3NOCA 4M63A 2GQ2A 4ZPVR 3MMAA 5T14A 3J81j 3JXOA 2GIRA 1TV6B 3QFHA 4OZ3A 1WNEA 1BC6A 1WG5A 1RK8A 1M5OC 3T9ZA 1VBXA 1S99A 5D0HA 2MZ1A 5J1PA 4LF2A 2ABYA 2XO6A 2G1HA 2HK3A 2CXEA 2HFVA 2KH9A 2CDRB 4QIGA 1S48A 4Y6IA 2R7OA 4ANDA 1Y0HA 2I0XA 5DQHA 1GFWB 3DKDA 2XBPA 1PC4A 1HHSA 3CB4A 3R3TA 2GJFA 4I2PB 5I3PA 3U7JA 3MR5A 2QEXS 3R7SB 3THVA 2NXEA 4NLPA 1HMVA 3C6TB 2KVQE 2AGPA 1NJWA 4OQJA 5J2NB 3HKWA 1I94J 5K8NA 4C9DA 2DGOA 2CAJA 3MUVP 4TU7A 1Q81T 3M05A 3H0PA 1T9WA 4JV0A 3L7PA 1YJ7A 2XYPB 2VBXA 4C0OC 4ID5A 4XTTA 4C3KA 2ZH1A 5CYMB 2CPDA 4GKKJ 4DX8H 4IH5A 2HHVA 5LJ3Y 3IWNC 2MKJA 4DF4A 3JAMY 1G4CA 1RTZA 2J7KA 4OLOA 2B56A 4DZ6A 4EO6A 1VBKA 1DARA 1EX8A 3EGWB 3MECA 4FF3A 4DN9A 2R7TA 1JLAA 4TLRA 1RB0A 1KS2A 2X1BA 4KGKA 4DFMA 5C5JA 5K14A 2H54B 2IIHA 4X62J 1JB0C 3EICA 2R2RA 1DFDA 2XMAA 3LAKA 2E44A 4I6YA 5KG0A 3NP5A 2QLXA 1R6VA 3WQPA 1P6TA 3R9LA 1N0UA 3LGNA 1IWGA 3KUHA 2OSRA 2RQ4A 4J9PA 4URGA 4DDFA 1XMQJ 1RHUB 3THPA 2LEBA 4Q0BB 1RA6A 5KFIA 1S10A 2OPPB 2ZHOA 1RHMB 1HI1A 2AU0A 2RKIA 4KSEB 1FFGB 2OPPA 1REGX 1XNRF 3CJKB 1IUJA 5IV3A 4YR2A 4NZ6A 4NXMJ 3SQGB 2RDIA 3PX6A 1WSVA 2GHVC 2P5VA 2DCLA 2NZCA 3BN4A 4CLKA 2NREA 3F0NA 1ACMB 1QVGR 1GAOA 3ZZPA 3WIVA 1GMWA 4CLSA 4QBUA 1QUPA 4RW8A 2UXDJ 1K44A 4F8RA 4TNOA 3U1LA 3O44A 1FWLA 3TVYA 4NYPA 4DUZJ 4DR1J 4L76A 3M2VA 4IO9Q 3D67A 2XLJA 3M2VB 2D3OR 2OIHA 2ATLA 4QQBA 2MQPA 4FXDA 3BO2A 1XK8A 2MZJA 1AZSA 1OMSA 2X3DA 1S7HA 4P74A 3FQKA 4DS5A 4Y2CA 4X4VA 1EQ0A 3NCRA 3GCXP 2QFIA 2BZ2A 3B78A 1GQEA 3R5GA 5L38A 2MQOA 2GQCA 3MTKA 4OHXA 3ZZYA 1NXIA 2KVIA 3DU6A 3H25A 1T05B 1TL1B 2P9GA 3G8QA 4YB5A 4B17A 4I67A 1T3OA 1QUVA 1YGYA 3CDAA 5KFTA 2K3KA 2EPIA 2XYHB 3LPEA 6FD1A 4QWCA 1VQ4S 1MW7A 1UPPA 4J9UE 4OX6A 5B0GA 3DLBA 5H9EJ 4IDKB 3RBEA 2DNYA 2ZE2B 3KLEA 4J9OA 1KTVA 4O3OA 4F3MA 1EKRA 1Q95G 1R8BA 2ZJPQ 4Q45A 1NJYA 5I3UB 3N5BA 2IYGA 3DN9A 3U1MA 1Q8LA 4Z7CA 2A6OA 1FVSA 4KFBB 1U6BA 2UUBF 4U8YA 1S1VB 4U67Q 3PVXA 4NCAA 3U1NA 3L09A 4BC7A 3ZC4A 4PQAA 4F02A 2WONA 2CNNB 2KT5A 2HQDA 4ECSA 4L72B 1NPRA 3C3LA 1R43A 4QU7A 3HKZD 2UUAF 2IRYA 3IC1A 1JLFB 1UEVA 2YTCA 4H54A 3KHRA 1CEZA 2V67A 4HH1A 2HWTA 2WCXA 4ERDA 3K17A 1ITPA 2RH3A 3DI6A 3I0SA 2GMJA 3HXMA 2FB0A 2R2UA 2HNYA 3N0VA 2CPYA 2ZJQQ 3N6NA 2K8GA 2HLUA 1HNXJ 3P3DA 4GO7X 2DY1A 3CW2C 1YRUA 4LBHA 1IBCB 1UZHA 2AYGA 1RWPB 2XNQA 4ZP9A 4ES2A 3ITHA 2DNZA 5HQMA 3KLFB 3BGOP 4UZBA 3Q8UA 4RW6B 2CPHA 5RUBA 2Z56B 4O0NA 2EFGA 2IYIA 2V34A 2MHEA 2YKMA 1T11A 3TNVA 2YKMB 2E5IA 4C4WA 3H40A 4MAKA 2G0CA 2QFJA 2AV5A 1M5PC 4B3SF 2GAHC 1VIXA 1SJ1A 4RW7B 3MUMP 5H9FK 2QJ3A 1D1UA 2IDLA 5KG6A 2HRYA 4WP9A 5L39A 2VJUA 1SH2A 4ZIWA 3FRYA 5KG7A 1PO6A 2KN4A 2FZGB 2IAJA 4PYAA 3CC4S 2YWGA 2E1MC 1TL5A 2EEYA 3OXLA 4C97A 4K2XA 4EO8A 2A1BA 2OAUA 5D8HB 2C3MA 3SXLA 3MI7X 5HK4A 5DGBA 3Q8QB 4IOCQ 3BGLA 5BXIA 1X4EA 1RAGB 3JB9k 4QCLA 1TL1A 2XQCA 3A4TA 4ALZA 1XIQA 2GHWA 2MZSA 2XZDB 1Q5VA 3DOKA 3G2XA 4DV4J 3V4IB 1K47A 1RT3B 1RZMA 3K89A 3TJ9A 2ASDA 4B9TA 3CJ4A 1BQMA 2RILA 5J2QB 4K8RA 2B7CB 2QGFB 1VK3A 1NO8A 2IVFB 4DU7A 4KHPF 2QA1A 2LXUA 3DM2A 3QZ7A 1PJ6A 3HHLD 3DLLQ 4JI7F 4H4MA 4DR5J 3BV8A 2ZUAA 2HIYA 2W7OA 1UJ5A 2PEBA 4E2FB 2UU9F 4J9VA 1HFEL 4DN0A 2HGMA 3QLHA 2MZQA 4J5OA 1HR0J 1CJKB 4HLBA 1KQFB 4OLPA 5I42B 3CT9A 1KBRA 3MR6A 3P4UB 3KYLA 3H5YA 4J9RA 4YP3A 2V9WA 2QLBB 3TEHB 3I5CA 2V2ZA 3TARA 3GIRA 4NASA 4OHZA 1WC5A 1XJWB 3EPIA 5HI7A 3CD5A 4DPYA 3ILJA 3TQEA 5IC4B 3CJ3A 1F3VA 3DMJB 3GB0A 3MM7A 1T05A 2DR7A 5J2PB 3W5XA 3BB5A 5T7LB 1IVZA 4MK8A 1S9FA 1SH3A 4P2MA 2J6UA 2RU3A 1JNRB 2VG6B 3LALA 4JV5F 1RT5B 2KXFA 3OHAA 2A6MA 1S1UB 1FK9A 3E51A 1JLAB 3IMQJ 4GKKF 2DNQA 2HAFA 3RRKA 4JYAJ 2KXHA 3AB2B 3DOKB 3K7RA 4WE1B 4ZOSA 4E0DA 5J1EB 3MR3A 1N32J 2D3UA 3VTIA 2E1AA 4OYOA 3UVJA 5IWAJ 3BKUA 3MFIA 2DITA 4YB6A 2WK4A 4BBYA 3PIPQ 2PO4A 4CLPA 4LFCF 4PXDA 2IM1A 4Z7YA 1KR4A 2H3EB 1NPKA 2CJBA 2J5AA 2FY1A 4FF4A 5EWEA 1CS4A 1HQUA 1B70B 2V69A 3T9NA 2F63A 1P8GA 3RJMB 4AL6A 1HPZB 1FFWB 1Q78A 1W26A 5G0RB 3VALA 1KP6A 1VQOS 1C1CA 2P6SA 4KGZB 1U6ZA 1U09A 2BOAA 3S6EA 4LF8J 4OI2A 1F9HA 2XULA 2XTJP 3P5BP 2MSTA 4DR6F 2GV1A 4LF1A 2E5LF 1FRKA 2MQNA 2KG0A 3QJPA 3RUBL 2LXFA 3GP9A 4ED6A 1U1OA 2GW8A 5DM6Q 3LO3A 4Y2IA 2AT1B 1YITS 1S7IA 4QR2A 1HWJA 2KJVA 4YHHF 1RSCA 2OPSA 5ETTA 1AA1B 2AHOB 2C22A 4U8VA 2DGWA 4KGMA 1UW4A 1XR7A 3HHNB 2G0JA 2VFUA 2YBVA 4FZVA 2BE7D 4QJVA 2LLZA 3O8WA 1RGVA 2ZH8A 2MPUA 1R0CB 4AXJA 1APSA 3FBCA 1M0SA 1RWXB 2IMOA 1UJ6A 2M9KA 3DOMA 3IGVA 5AE1A 5M2UA 3PR5B 3EGVA 3T5KA 1HA1A 2DR6A 2Z2ZA 4LF9F 1QJHA 2DTJA 3K5LA 4ED3A 2PEHA 1RWUA 1S1WB 3A8IA 4D3GA 2XWXA 1YJWS 1CS4B 2HS4A 3PX0A 3RBZA 4RBVA 4LFBF 4TY8A 1NM2A 2JVOA 5L1KA 5B08A 1JLQB 2MKIA 2DNNA 2F65A 3QMQA 2RRBA 2YWKA 2WVBA 3CJKA 2RUGA 2GFFA 2NUHA 3HHLA 3SZ2A 4HKQA 4UTGA 2V6AA 4LQ3A 3MAHA 5C24A 1FRMA 2HHHJ 2ZOMA 5KFCA 4HACA 2C3PA 1HKAA 2B4UA 3TJAA 3PHEA 2B3TB 3G96A 1FK9B 3C6TA 4DL5A 3K8WA 3KJFB 1HHTP 1KHWA 3P6YC 4RWXA 2OTLS 4B3MJ 2UUWA 4F4KA 3JYTA 2YKNB 1TVRB 4NI2A 3NGUA 4WWSA 3TYTA 4OZ5A 1NJXA 1NPPA 2LA6A 3V81A 4WJBA 2B5JB 4M5JA 4TKTA 4EBCA 1I3OB 2R2TA 4A48A 5BYRA 4J9QA 3WC0A 1EKSA 1QE1B 2DVIA 5L9NA 2QSWA 2FZKB 1K1SA 1WG1A 1WHYA 2AZ1A 2VFTA 3M8PA 4I69A 4MH8A 2X51A 3MURP 3PCOB 4M5LA 2E1RA 3M2UA 2RJZA 1YJVA 1FEEA 2ZH3A 3ISND 3Q89A 3GG0A 2HMIA 5F0WA 3CJSA 4KV8B 1ZETA 3CCRS 3OVAA 2LU2A 2HMIB 2J6TA 4RLEA 3IRXB 5E3CA 5CQGA 2B43A 3DC2A 2A3JA 4DOZA 4DL2A 2IVMA 4TY8B 1TV6A 3DDIA 3CJQA 3H42A 5E5NA 5AT1B 3V2UC 4YUDA 2DRBA 2W9CA 3KTQA 3BBBA 3IRWP 2YVSA 3KDNA 4B08A 1W25A 5JVGQ 1NKBA 1HQEA 3N5FA 4IG0B 3AT1B 3OFFA 4TQRA 2V2VA 2BR0A 1RDRA 2E66A 1V9OA 2VIHA 1TKZB 1N56A 1JWWA 4OX9F 3TO8A 3TZXA 3KMSA 3ENAA 3GZ7A 1HNIB 3CF5Q 2IC3B 1L3VA 4MKBA 4X62F 1SPBP 3KUEA 1B7YB 1LKZA 4UW2A 1GMVA 2IRXA 2MLXA 4X4OA 2ZC3A 2IA0A 2LCWA 3DRSA 3G9CA 3KMQA 4B3OA 5HLFA 1WG4A 1TL7A 3Q86A 4BCAA 1J5OB 1IXKA 1K9MT 3PEJA 1WF2A 3G87A 3W2WB 1VJWA 5AJ3J 4BDPA 3Q23A 1K0VA 3AODA 3AA8A 3AD8C 4PWUA 5CHCB 3W5YA 3V6DA 4DHVA 4DV7F 1S57A 2N4CA 2C2RA 3LP0A 1FTCA 1N6QA 4ZVPB 3H90A 1P1TA 3RGIA 2KU7A 3EXYA 1X4CA 5B0AA 2YKOA 1FXRA 1H38A 1PILA 3CDEA 4N56A 4LSNB 1PYOB 1R31A 1RT6B 1U2CA 2IVYA 1RT3A 2Q3PA 3RZAA 2RQMA 2HGNA 1TKXA 1QM9A 3MPYA 4DUYJ 2C2MB 3TA0A 2UVRA 3MECB 2O3DA 4A8XA 5F8HA 3HJFA 2FVQA 2N7YA 2FC9A 1PKUA 3CSKA 3SI8A 4NCGB 3K58A 3MEDA 2RHQB 1DLOB 1FDAA 2V68A 1DJ0A 3ZZRA 4QPXA 4O0IA 1B3TA 1KOOA 4JV5J 1BWVA 4DQRA 3SV3A 4RBUA 2X7IA 5KFWA 3D6FB 2UV8A 2ZDOA 3MHYA 4PWWA 4F7VA 4I64A 2JEGA 3MMAB 2GNKA 5BYQA 4FYXB 4OIXA 3SMZA 4DWIA 4LVOP 2PFFB 4PXCA 4KY3A 1H72C 3NGKA 3FMBA 2B9EA 3CCLS 2LXIA 1N8RT 4PEOA 4DUZF 1WC3A 2E29A 3A3PB 2BA9A 3AD7C 1VGYA 1LQ9A 2RS2A 2Y9HA 4P2SA 3DMJA 4O23A 3TP2A 2I2YA 1E6YA 1FCAA 3QBCA 5DETA 2ZM6F 3MM9B 1FE4A 2MY8A 3FGVA 2J7WA 5I3QA 3RW6A 3R2DJ 4ZPDA 2HQFA 2DIUA 2KRRA 3K5OA 4LFBJ 2IFXA 2CNOB 3VAGA 1WEZA 3MCNA 2E1CA 1R8HA 4Q0BA 3VAFA 2BACA 2JC1A 3PFEA 4GMKA 5BR8F 3KG0A 3NGDA 4Q44A 3NBPA 5E33A 1RXOB 4K4ZA 1ZM2A 3I5AA 2G2OA 4PPDA 4OYPA 3H5UA 1UA0A 3UD5A 2UP1A 1D9FA 2KHCA 3HDSA 4U7UD 2VD3A 1P1LA 5KT6A 1PJ7A 5KAKA 1LWFA 2W4CA 4J90A 1LW2B 3QGHA 2GZOA 3QGGA 3ZTPA 2MZTA 2BJ3A 5EUHA 3AOCA 3O2IA 4USKA 4N41A 2ROPA 3M8SA 1RAOA 2JNJA 4DR2F 1FJEB 4L3KA 1Z4UA 2V8VA 3LP1A 3PW0A 4JI2J 1OPZA 4PQUA 2G2YA 4PG4A 2HWIA 4YR0A 2CYYA 4MIBA 1LW0B 2HGLA 1QAYA 3DRPB 4OYBA 4R5PB 4PABA 3G8SA 4KHRA 1WHWA 1D8YA 4DCPB 2B51A 3PW4A 5IQQA 4LFAF 5GAGU 2ZBQA 3LP2A 4KPCA 5E3PA 4WCEQ 1J5EF 3EUNA 2CA9A 3BPSP 4CT9A 4DF8A 2FJEB 1HBUB 5KFEA 3DOLA 1EHWA 2KB2A 4GC6A 3T6BA 1EQMA 4CLYA 1YJNS 2P2CB 4H4KC 2F1FA 3J7YI 3IG1B 2L9WA 1NK6A 4KGVB 2DRAA 1KHVA 2R7XA 2HQ3A 1IKVA 4BWJA 5B7WA 3KK1A 1EIYB 3W3SA 3LAMA 2HVIA 3EYZA 4JI3F 1Q0NA 3ETOA 3BH6B 1WC1A 5KG4A 4QW8A 3E01A 1VC0A 1V5IB 3JS9A 4QWAA 1M1HA 1KONA 4M5GA 3GFZA 1O8BA 5IXUA 4WFNQ 1RTDA 3NL0A 1WTFA 5KG5A 4E8UA 2F4VJ 1PC5A 2SXLA 3NNCA 1JKHA 2HZAA 2L9DA 2VF3A 4J7CA 4S0MA 5DJBA 7AT1B 5KFNA 3KWMA 4K4UA 3C46A 2B4VA 1UFWA 3I4PA 2MY7A 2QL7B 3O3LA 1KEKA 3E3XA 1KC8T 1QLNA 2OJ3A 1S59A 4O3QA 2VA3A 2UVVA 3RB0A 1DTQB 1HLWA 3OSPA 1WOOA 2J76E 2HVZA 1NSPA 3CIZA 2ZH4A 1KLMB 3V6JA 1URNA 4LRFA 2PIIA 1OO0B 2LEPA 5A8KB 3DRYA 1NUEA 4EZ6A 4EYHB 3OFGA 1Q8KA 3LF0A 4KC5A 4QWBA 4WKRA 5IC6B 2VASA 4DV7J 2KHDA 1CSJA 2JVRA 3MD1A 4YHHJ 2YH1A 4ZVRB 1OYDA 5DDQC 3GPAA 3V81B 1HNVB 2QA4G 4GKJF 4KTQA 2X3GA 1HBNB 1ZAWA 3MMBB 3FCHA 2XHCA 4ILMA 3A3NB 3BR8A 4TQSA 1NRKA 1X4FA 1FRXA 2VC0A 3CJ2A 4ZCLA 3UD4P 4NXNF 3T1AA 2HIQA 4NLWA 5LOQA 2ZJRQ 4DV5J 1VQLS 3PEHA 2OMOA 4KH0B 1OY8A 3QFWA 3M8QA 2W2MP 2XGPA 4C8LA 2ATCB 3K0JA 2OGUA 4A8WA 2E9TA 3SCLE 3SSQA 4XK8C 3RTVA 2XMTA 3G82A 1BQXA 1MN9A 5L9XA 4CT8A 5A8WB 3T5HA 4WU2A 4KR0B 1Q5YA 4KQZA 4OYAA 4RW9B 3PRDA 4ZCIA 2FY8A 4IFYA 3KLHB 1ZAXA 2LQJA 2OLWA 3B4DA 3KLGA 1HL6A 4IFYB 1AB8A 1T95A 2DNLA 2LDIA 1YSJA 4ES1A 3Q8SB 4ANCA 1NDLA 2HBRB 3R2CJ 4KJIA 3DHXA 2DNPA 2Y8YA 1GTHA 3UN2A 4DR3F 2VBYA 2BEFA 2F4FA 4B9SA 1RU2A 2FJDB 1KLNA 1VK8A 2P9CA 2VONA 1RT2B 3BSOA 1T9TA 1Y9OA 5KFMA 3HVAA 4HVZA 2L9NA 2LEAA 4IO1A 2W2NP 1RABB 2OKQA 4NOHA 2V8DA 3OUYA 4X4TA 2C2DA 1XEZA 4F3OA 1Y5IB 1HBNA 2GVZB 2OO4A 3FDSA 3VV2B 3G6XA 4B3OB 4FXWA 1I51B 4EU0A 3R5AA 1KFSA 2F40A 1MU2B 4OHWA 5E3AA 2ZHBA 4V19X 1RE1B 2DGTA 2QZ8A 3C19A 1RWVB 3D0HE 3MEKA 4DL0C 5KFOA 2R42A 3UI3A 3V6HA 2BRKA 2JFKA 4IQMA 2A0FB 1KLMA 3IFEA 2VKZG 2YX1A 3IXQA 2UUTA 3ZZTA 3TVKA 1RBLA 1IM4A 4WP8A 2W9CB 4ECQA 3BDPA 3J81Y 1TZ0A 4DV0F 3FZBA 1RBOB 2R8JA 3NBPB 2B0GA 1TL3A 4ITSA 3UDVA 4ZCMA 2BOPA 5LL6d 2YPYA 3C66A 4M8LA 4TXSA 2JHEA 3TA2A 2E5GA 4ER8A 2YX4A 3POTB 4JUZA 2YQ3A 3BS9A 3W66A 3FSIA 3SSRA 1GX5A 1HI0P 2QA2A 1HQ2A 4UT4A 2DNGA 5K5MA 4JI0J 5D4PA 4A4JA 1IKXA 1U8WA 4NLDA 4K2JA 5KT7A 1X31C 1F60B 2JJ4D 2J9DA 1DY3A 1C0TB 2QO3A 2ZZTA 4CH0S 5KOXA 2V8PA 4FF2A 1RWWB 3LUYA 1N5SA 1C2PA 2OFHX 1UWBA 1X7VA 2YX7A 2NSCA 3M1VA 3TEGA 5DDOC 1KD1T 3FK4A 1D3WA 1NHVA 2CQIA 2N4DA 3I82A 4FVMA 4WU3A 1UTAA 4CTAA 3CTRA 4A8MP 3GFHA 4KRWA 3RB4A 4CCHA 2CQ3A 3DRXA 4C0HA 3G6ES 2QT7A 1S0OA 3KK2B 3CD0A 4WKYA 4K4TA 2F4VF 2Y3YA 2QV6A 2VFVA 3UQSA 2R8KA 3HSGA 2HHSA 2FLOA 3FFIA 4H4MB 3HHLB 2C2KB 3VVUA 4ZVSB 4DUYF 5C7PA 1TK5A 2ZD1A 2UUCF 1MMDA 1YBTA 1HNZJ 1XNQF 1TQLA 2YWWA 2HHHF 1U0HA 3GILA 3CCMS 4WXWA 1DBDA 5DGAA 1Q82T 1U26A 1TKTA 1TFYA 4LSLB 4K59A 3QO9A 4M5DA 1F3FA 1ZS6A 2J8AA 2NPIA 2W4DA 2ZVSA 3A13A 1Z2ZA 2XMVA 3EMTA 1KVKA 4CO3A 2ZWOA 3MM8A 4GVBB 2X1GA 4LFAJ 1RT4B 4NEYA 2CQCA 1RT1A 1FRHA 1YQHA 1RT4A 2HNDA 2DB1A 3I9ZA 3UCGA 4X2BA 1FRIA 1HW9A 2XLKA 2DXEA 2ZNYA 1ZH5A 1FJGJ 2UUAJ 2FHJD 1OIAA 3E8OA 4RKUC 2Y1RI 4CTAB 5A2QU 3BQ1A 4U7UK 1REVB 2HW3A 1RLDA 2YPZA 4JI0F 1LW0A 2O66A 4DPTA 2E7WA 3FRZA 3LANA 3N79A 2AQ4A 5GAGI 1DRZA 1SQEA 1HYSA 1EAYC 2V50A 1T02A 3DRRB 5F8JA 2CPJA 1UFLA 3F41A 4ZN3A 1JJ4A 1AFJA 5A0YA 1Q1KA 2CQDA 5G4DA 2YKNA 3ISNC 4NI2B 4OYXA 5C25A 4ECXA 3VGTA 1RCOB 1N36J 1B4SA 4RUAA 3NGSA 2JOQA 3B82A 5HQ8A 1FKPA 3POTA 4AQYJ 4FPIA 1XQIA 3PYGA 4BHQA 2NS1B 3CDWA 4DSLA 4OV6A 5LMUF 2U1AA 2RAQA 1DHMA 2CJQA 2CVEA 1RAAB 3KG4A 4I0WA 5ETPA 4QR0A 4LREA 3C6UA 4OJ3A 4XAKA 7FDRA 4DV6J 2DJWA 4OZ1A 1U02A 3P49B 1XR6A 2XHWA 1GEHA 1UL3A 1Q53A 3B6BA 3LP1B 4USMA 1LK7A 1U1LA 5CXTA 5JMNA 3C8YA 3KJQB 3IBFB 4NLUA 2GJ2A 4G1QA 4Y00A 5AXLA 3C16B 4WTYA 4ZN1A 4G1QB 3HFZB 3SYZA 2HHQA 2I8EA 3EDQB 2KO1A 3M7VA 2MQQA 1X4AA 2AYBA 3PKYA 2WSEC 3CJTA 3ZXWA 4WBFA 5C2CA 3BBCA 2WZ1A 3ICLA 4E98A 2KTQA 4CDIA 5EGYA 1NCLA 2CPZA 2FHKA 4PYDA 3ELHA 1N5YB 1SV5B 2HFSA 3QRQA 5HMYA 3Q2SC 4JP8A 5AXKA 1TK8A 5JVHQ 3CE8A 4LRDA 1J5OA 1X9MA 3PM9A 1JXVA 1RKIA 1QSLA 3D68A 2W8LA 2XCAA 1TL4A 2ZBRA 4FF1A 3PJWA 3CWJA 1YJUA 3IS9A 3PJXA 4OZLA 1S1TA 3BQ2A 1IBMF 1KVJA 3R7BB 1HWLA 2IC3A 2AEFA 2BE9B 2BV3A 4WIIA 2KXNB 1AT1B 2IM2A 5FD1A 4JOUA 4FNHA 1QAIA 2BABA 3RR7A 3QRPA 4JI4J 3HVWA 1Z1ZA 2LFVA 3K2YA 2WW4A 1B99A 2XYGB 3FC9A 3QWPA 4M5KA 4UQGA 3I96A 4I7FB 2EBGA 1VIOA 1GH8A 3LQVA 1TELA 2NCKL 2WBRA 2Z30B 1Y00A 4HT5A 4NL5A 4LRAA 3HVTB 3KHGA 1FDDA 4CNZA 4KHMA 4P10A 4K4VA 3J7Z5 2GC8A 4DV4F 3JQMA 5THWA 2UZAA 3EZOA 1TKTB 2EFOA 2J9EA 5DM7Q 4LSLA 1FHTA 3HZEA 1C1BA 2FDNA 4AL7A 4F26A 2VHGA 2NXJA 3TRGA 2FPHX 1K1QA 2CPXA 2P9EA 4ZHRB 4ZLNA 4JI5F 3ADAC 2O01C 2JL9A 3K57A 4KKOB 1HYSB 3KOAA 2H65B 1QY7A 4OL8A 1OQ3A 1IKWB 2BUNA 2BANB 5D0RA 4UOGA 1WSRA 1R8AA 1Z2LA 3D1QA 4DFJA 4B3TJ 2B9WA 4FKYA 2K3IA 2G2ZA 3UDLA 1HW8A 3I6PA 1DQ8A 3HHLC 1IR0A 1KQGB 3ITHB 3N4WA 1EB0A 4DR6J 3NXZA 1MLAA 3O1LA 2FZCB 3PYFA 4M5HA 4WIQA 5LMNJ 3BSNA 1PG5B 1PAEX 2AJQA 1Y4ZB 3D4JA 4TU8A 2ZH7A 1LWCB 2RSQA 3IGNA 5LMNF 2G4BA 2R4FA 2VG7A 2R8IA 2XWYA 1X0FA 1F0XA 2XY6A 3M6XA 1RU1A 6FDRA 2PA3A 3LOUA 2ZBCA 4PG8A 4RU9A 2A2DA 1IJEB 3HSJA 2L3MA 2YKAA 3NAHA 4DG1B 3JAMU 3QIPB 4F4YA 4LFCJ 2GMLA 2W2PP 1FVQA 2NXCA 4HT7A 3MUTP 1U2FA 1Y5NB 4DR7F 4IRCA 2XY5A 1LWFB 4X4QA 4F50A 1RA7A 1XN9A 2N82B 3VAMA 4FBUA 1LK5A 3D1HA 1R6YA 1SQGA 2RDDA 5IFMA 1KSPA 2VKRA 2I6WA 3QSYB 4ZPTR 1X60A 4URQU 2VBZA 3EDRB 3PRVA 1VCTA 4ECYA 2R7RA 1LOUA 4DV6F 3TANA 1S6PA 3D3BJ 5EX0A 1WJ9A 3R27A 2BJ8A 4YY3J 1KVIA 4A8SA 4Q8EA 1UWBB 3CJ5A 1YJTA 3UWTA 4DBQA 2ZHAA 1VBYA 2R7UA 2DXDA 1NLKL 2MZRA 1RISA 3CJRA 3HF5A 1HWUA 3I9V9 1KRPA 3SCIE 5EDWA 4LF5F 2YY3A 4G1PA 1YZ7A 1QDUB 1XBWA 2HLTA 2B8QA 3VGSA 4C8ZA 4CO2A 2ZH9A 2GIQA 5KTQA 1M5HA 3HP6A 2QLWA 2UU9J 2HK2A 2MKCA 4KPYA 2W9BA 1UVKA 3GIIA 3BKTA 4ZPWR 3I55S 2OHDA 4XO0A 2JX2A 1G7CB 2JZ5A 3HFKA 3QQCD 1BY9A 2VDHA 3IRXA 2V94A 1ZAVA 2BM1A 4Y34A 4WPAA 3P5TL 2E5LJ 4P2XA 1KQSR 2VFRA 1CJUA 4W4MA 2NR0A 4ILLA 2RS8A 4USHA 3OXFA 3CCTA 4ECUA 4WFZA 1F6TA 2C3YA 2VA2A 4EYIB 5FJ4A 1Y10A 2WOMB 2D1CA 1FNMA 4B3MF 1JLGB 1TUWA 4A46A 3FCWA 1WOPA 2OP5A 1GXUA 2Q6CA 1SVDA 5D4OA 5KT2A 1S97A 2IPOB 3OFHA 2WONB 4LF7J 5GMDA 1LWCA 1RYSA 1KN6A 3W65A 1JXEA 1D09B 1FI4A 1TKDA 2ZOFA 4K5SA 3RBXA 4ZLJA 4JI6J 3W2VA 5IWAF 3KLIA 3T41A 5F41A 4N8NA 5F9LA 3Q8PB 1N52B 3QT8A 1N5YA 1N32F 3LPYA 1VQ9S 2DGUA 3HD2A 1FDBA 1X0PA 4OI1A 3HD1A 3RAXA 1RT2A 1YTYA 2HFNA 1CBKA 1UVJA 3PRBA 2C2EA 5A0YB 4DZDA 1S1XB 1SKRA 2AJ0A 2HNYB 5E2QA 5M2RA 2EWHA 2ZBIA 3M8RA 2L08A 2VJVA 4WZQA 1T8EA 1GK8A 4A8QA 3QIDA 2BBEA 2D74B 3AJ2A 4XIUA 1VS3A 3OT9A 4N7TA 2XSJA 4C98A 4KIAA 4Q5VA 5A8WA 1BQMB 3RYLA 4B9VA 2BYCA 7FD1A 4ZCKA 3VQTA 1WKKA 4A8OA 1RHKB 3VAKA 1SJFA 1XMOJ 1CQNA 2RU9A 2BKOA 3MM5A 3HVRA 2CJXB 2EC2A 2Y0SD 1U1NA 1SXLA 4I56A 2KRBA 4FYVB 4LRBA 5BYSA 2V4RA 3OW2R 2ZVIA 2XM3A 3MDFA 4ID5B 4OYWA 4PAAA 3X3UA 2ZZMA 3BJYA 2ZITA 4K4WA 4DR5F 1NKEA 4CH7A 2HFUA 4DQIA 5HVGA 3GR1A 1RTDB 2BKNA 2AYMA 1I5OB 2HS3A 1VFJA 3AH6A 3PNIA 5A76A 2R8HA 3DRRA 1H73A 3KHHA 4GC7A 3PZPA 2VC1A 2HVDA 3SEOA 3VR1A 3IN5A 3TAQA 4CLUA 4DPUA 5ETOA 1GXTA 1V6HA 2WBMA 3FUYA 3GR0A 2BJ7A 5HVHA 2EFPA 3ZZZA 5ETKA 1UVLA 4OI4A 5J2PA 2BE2B 1REVA 1L3KA 2HWHA 2FD2A 3KKFA 3CD6S 3HMJG 3OL9A 1P9QC 4CRJA 3SQGA 3VZHA 1X4GA 3H2LA 2JEJA 2CRLA 1V5VA 2PSZA 3DOLB 3MCSA 4TY9A 2HS0A 1IM6A 2YNIA 4HACB 3GSIA 4YN3B 4ZVGA 4DV3J 3JTNA 3SV4A 3BSAA 2A18A 3N6MA 2HHPA 3D0GE 3OL7A 3LH2S 3BZQA 3TJ8A 4A47A 3OL8A 4HHHA 4K0KJ 2XMUA 3RAQA 1YKWA 4F4XA 2FGOA 2VL1A 4LVNP 1VQKS 2XEXA 5K8MA 3C2PA 1VQ6S 5KT3A 1VQ8S 2VBWA 3P8BB 5HVFA 5KFRA 1E6VB 4NLYA 2CG8A 1X5TA 3CCQS 2MKHA 2JEIA 2WB4A 4N5SA 1LWXA 2DRDA 2BQUA 2D9PA 2HZCA 5KFSA 4DG1A 1LV5A 1TMJA 1RACB 5JXSA 1PYTA 3L9ZA 5J2MA 2RF2A 1FESA 3AFGA 4JI2F 9RUBA 5B0FA 4ZVUB 3ZZ0A 4DR2J 3G82B 3HLUA 2RMLA 3HSDA 3OTEA 5IV4A 3SCJE 2OFGX 2DNKA 5DDRC 1L3SA 1H6KX 5C2GA 1WI8A 1CQMA 1RYRA 1H2UX 1T03A 1MMNA 3RW7A 3P45B 4CLTA 5IM0B 3CXCR 4PWDB 1BD6A 3M6UA 3TVZA 4AD6A 1U47A 1AXQA 3ILLA 2EK6A 1G1XA 4RNFA 2BJDA 4DL6A 4ZP7A 4NLSA 4LRCA 5CA5A 3H4BA 3MAQA 1U48A 5ETVA 1FERA 4NWBA 2MKKA 2UXCF 2MDAA 4OHYA 1UFKA 4CO1A 2V0NA 4NXNJ 2AEMA 3IBCB 2YH0A 3AOBA 1IKXB 2B6AA 3EVWA 3IR6B 4EZ9A 2MLZA 2YKPA 4LMZA 3DNCA 3SDEB 1A9NB 2BKPA 2ZH2A 1UJ4A 4TYBA 1UEUA 2MSSA 4ECTA 1B64A 3FQLA 3L7UA 1Y5LB 1DZ5A 4DR4F 2F7VA 3R5JB 3AA9A 1C0UB 1Q8BA 4IFVA 3O6QA 3ZFVA 3SBMA 1M1GA 1NH7A 3DLGB 4I2QA 5IQ6A 2V4QA 2E5HA 3OTDA 3Q0AA 4ELTA 3LP0B 1HI8A 2VV5A 2J0SD 1PBAA 4KFBA 1VLYA 1X5PA 2Z2YB 3NEKA 2IAJB 5D3GA 3QNWB 3DI6B 3I0SB 1JJ2R 2PN6A 2IBKA 2UUCJ 4OHVA 5D0EA 4EMDA 3OV7A 3EPGA 2VICA 2CPFA 1RWMB 2B4OA 4CM0A 2VOPA 3NAIA 4I68A 4ZIVA 4RJVA 2QMUB 3G8TA 1MNEA 4F4AA 1S9GB 2H4WB 3ETMA 3GJTB 3OXGA 3KHLA 2VU5A 1C4CA 1WC0A 2LQBA 1S6OA 4AE5A 2RT3A 2DO4A 4ZITA 4Z37A 1VI7A 1S6QA 1U2RA 2D7SA 4X4RA 3QSIA 3OJUA 1NJIT 1UAWA 4DFPA 1RT7A 2DBBA 2M3DA 2RQCA 4B3TF 2FLNA 2M5YA 3MTJA 3U02A 1D0EA 2FLPA 2RRNA 3H2VE 4AFFA 2CPIA 4PR6A 4XDCA 3W2WA 4UY85 1UVMA 4R5PA 1G6BA 1CJKA 2BRLA 5F8MA 1U25A 2G1DA 4Q2LA 3H20A 4KV8A 4IH6A 5FIIA 4EGLA 1JLEA 1JLCA 1VC6A 4JI1F 3NCQA 4LBPA 4RO0A 5D78A 4F04B 4Q43A 2WRMA 3HT0A 1ZM3A 2BW7A 2V9KA 3BH7B 3I32A 1QSSA 2GQQA 5DLGA 4DV0J 5E0OA 5EN1A 1S1UA 3GG1A 1EARA 1T9VA 1IWAA 2B4PA 2EC0A 3CDUA 3MR2A 1S4EA 2OSQA 3R5CA 2QLFB 4PG7A 4UZCA 3V4IA 1S79A 4JI4F 4DEZA 3MEGB 1LFPA 4X66F 1NB7A 2IMWP 5CABA 4V19J 3VAJA 2DPJA 1EP4A 4HTIA 4USIA 5DO2A 2WW8A 2QMXA 5B0EA 5MAOA 3PACA 2DGXA 3MPWA 4OI6A 1R0AA 4LF5J 4DSIA 1GTEA 3JTPA 5ITHA 1FO1A 3N01A 1S6UA 3KFWX 2YNFB 4RWWA 4TU9A 1R0AB 1IKWA 4WP3A 2HQGA 1Q7YT 4OZ2A 4B9UA 5E41A 1F9EB 4L6V3 4YDDB 4ICLA 5KFJA 4Y65A 3RB3A 3C15B 4KH1B 3GQCA 2FJAB 2QL5B 3M6WA 1CC8A 4JB8B 1JMTA 1MWZA 1OSCA 3GMGA 4WYWA 5AE3A 1HWIA 1U1QA 1VQNS 4HHJA 2ADCA 2BMBA 3J80Y 2AJFE 2DH8A 2J0QD 2AMCB 1UKUA 1HQEB 1F2HA 2WSFC 1WOSA 1WDDA 1NDCA 3TAPA 4USUA 2EW9A 3CJ8A 2E1PA 4TYAA 3QWUA 2HNZB 3TW0A 3BREA 1DLOA 2OEKA 4U6PA 1FD2A 1SC4B 2AX1A 2RVJA 3FEYB 3MEDB 4OX8A 3W1YC 3WX8A 3ZZOA 2VQFF 4HEA9 1L3UA 3DYAB 4IG3B 4UY8T 3ENVA 4UOCA 2VPZB 3R1HA 2DR8A 3BGRB 5IT4A 4X65J 3M9NB 2W24A 1S1WA 2AX0A 2CFXA 3D6TB 2QN6B 1LXNA 2MQLA 2DYAA 1YI2S 2FVSA 1U6FA 1TUGB 2GHPA 5LSOA 3AD9C 4ZP8A 1FJ7A 2DGSA 2XB2D 1T9XA 2Q6BA 4ETZA 1N36F 3PR4A 1YG0A 3D0IE 5D0GA 2RDJA 1C1CB 1JLEB 3PX4A 5AXMA 2CQ0A 2OPQA 4DXLA 3HCXA 3VAHA 3S7RA 3KK2A 5C24B 1UVIA 1TR0A 4IRDA 4R0JA 1YVFA 2VPWB 2Z58B 1VC5A 2CKWA 2BVZA 4GRSA 4P52A 1HNWF 4F3QA 4XDDA 1KQKA 5KG1A 1FDNA 1SIZA 2N3LA 4CLLA 1NK4A 4NCGA 3HO1A 4FYWB 4AT1B 4LR9A 5KFZA 2FC8A 2HPUA 2KYXA 4NLVA 3MEGA 2XS2A 5SUHA 1OJ4A 3OSNA 1YWXA 1B0VA 1DQAA 2ALYB 1CJTB 4ZVHA 2PMZD 2QE5A 2LQ5A 3UE2A 5LSRA 5IT0A 5M2PA 4AUKA 2MXYA 2W8KA 2JLFA 3SDEA 3CD7A 5DZ6A 2AGQA 2V4JA 4NCBA 2UXCJ 1HIYA 3DOMB 2HQCA 4MJKA 5DRKA 3VF0B 1SKSA 2D69A 2HRUA 2WVCA 3I0RB 3R5BA 1FT8A 1HBOA 1MN7A 1MWQA 2MEWA 2OELA 1MROA 4C8MA 2YQ0A 3TUIC 2XS5A 3UR3C 1JLCB 3OR2B 1JKHB 3UN5A 4ECZA 5CZVA 3ZO7A 3M2UB 4UOHA 4NLTA 2N7CA 3RRHA 2JC0A 2GO9A 1ZA1B 3HI9A 5I3UA 2D9OA 2AKWB 2MKYA 4PWDA 3H4DA 1SBRA 4K5RA 1M1KT 2LKZA 3BYPA 3MCMA 1T9YA 2EXUA 1M90T 4ZJQA 4WFBQ 2DK2A 2MB0B 2KM8C 1BMQB 4OV1A 1QTMA 2I1RA 3EWGA 1V3ZA 5K8OA 4IR9A 4MFBA 3BBFA 1SKWA 3B4MA 3IG1A 1MSWD 2CJ9A 4WFYA 1G2EA 3GYGA 2XI3A 1NEEA 2HZVA 2PI5A 1JLGA 2PFDA 2LQ8A 5KFUA 4CLFA 3R1LA 2CJYB 2GCFA 3EGNA 4JV1A 4HR2A 2ZEJA 2QIFA 3RG6A 4LF7F 1BQNB 2M88A 2YNFA 3NOGA 3EJMA 3BGRA 1NBEB 3KDOA 3CC7S 4C8NA 5I42A 2D3O1 3HSZA 4ECVA 5EWGA 5HLFB 1O5JA 4ED7A 3CDBA 2H51B 4GVBA 2Q1LA 1Q8IA 4DCOB 1U4BA 2HVHA 3MPDA 1IQZA 3F44A 5F8NA 2IJFA 1YJRA 1C0UA 3MM5B 4IYQA 5LSLA 1OY6A 3N6LA 4LSNA 1GMWD 5LMUJ 4CNYA 1VYAA 2NSBA 5KFVA 1FX4A 4QW9A 1X4DA 3OR1A 1RT5A 1PGZA 5K20B 3OL6A 2HHWA 2XO7A 3L7OA 1NB2A 3BO3A 3T3FA 2RUSA 4YB1P 3OBIA 1U0HB 3QT6A 2ZH6A 2BJ9A 2JH3A 3QYYA 3CMAS 4O3NA 1T7PA 4IKAA 4F2SA 2ZD1B 3EE3A 1T3NA 2FHJA 3Q2TC 2IBOA 1NSQA 5DS7A 3Q24A 5HN0A 1FKAF 3MMBA 3UO0A 4RUHA 4DMZA 2A10A 2CIMA 1TK0A 2GGPA 4KAIA 3DRSB 1YJ9S 2L41A 4IR1A 2HEKA 4HDGA 1IR1A 5D4LA 1A0OB 4ZK7M 4RUBA 2RIJA 4C11B 5LJ5Y 1RT7B 3TX8A 2DH7A 2BANA 5ETLA 2KFYA 4DLEA 4Y3CA 3OLAA 3AY0A 3D6MB 3DCAA 3M1VB 4M5IA 4OJGA 2CWXA 4P9SA 4TVAB 1NKCA 5KOWA 1RLCL 2H5EA 2Z2LA 4KGXB 3KJVB 1X8DA 1GX6A 2FLLA 1N33J 2QRRA 3K5MA 4J9MA 3DGPA 1BUXA 3F56A 4DI6A 3R6LB 4ZS6A 2K06A 1U1PA 4CM2A 5ADZA 5L1IA 1YRTA 2IJNA 3CIMA 1UETA 3M30B 3OHBA 1OY9A 4HDHA 1VISA 1V3SA 4OMFG 3GONA 4DV3F 4IQXA 2JLEA 3A12A 3NGTA 1XNQJ 1ULRA 1XERA 2HNZA 2R7WA 1WWHA 3BQ0A 2I9SA 2BDPA 5F3TA 2XNRA 3DLGA 4I2QB 4OYIA 2NLWA 5J2NA 3KK3A 3MD3A 4Y0FA 3R6GB 3DLJA 3PTWA 1R8CA 1R89A 2DNRA 1Y11A 5IZHA 1JNZB 2ACMA 2MJNA 4WTOB 3FEZA 5T7LA 2OUGA 3T5LA 4H4KA 4RW4B 5IT9U 4CO4A 3TA1A 5HO4A 4KKOA 1LEOA 2DHAA 2OEMA 2LYVA 2BQ3A 4C11A 4DS4A 2IDEA 3TZWA 1UA1A 2ERRA 3TWZA 1FA0A 2JDJA 3JSRA 3LP2B 2B9YA 2QLJB 1YHQS 1T94A 2OH2A 4NLGA 1ZM9A 4AXIA 1RWOB 2HVEA 3W9HA 5CCLA 3TI0A 3ILOA 2V8GA 4YQWA 5GAHI 2RRAA 3LA0A 2LECA 4QYZK 1PIEA 3EM1A 1QAJA 4I6AA 3IM9A 3TOQA 1S77D 3DLHA 3LTOA 1U1MA 3HFVA 5CYQB 1M5VC 4MYUA 4BC9A 2W9BB 2J9CA 4J9LA 5DZ7A 5BJRA 4K4SA 3D54A 2OD4A 3RB6A 2OMLA 4O4GA 5IS2A 3I87A 3RBDA 4GVLA 5JJBA 1VR6A 2M8HA 4LT6A 2B6AB 4QYZJ 1VQ7S 1S1TB 2H5JB 1RADB 2DGQA 1H74A 4IG3A 3M8QB 3DDNA 3TUPA 5CYMA 1UZDA 2M4MA 1TMMA 2ROEA 2H9ZA 1QAXA 2CQ2A 2EKYA 2R3VA 4C3LA 4NRTA 4C48A 3HHDA 4JI8F 2Z0GA 4X4SA 1WC6A 4OYMA 5JUMA 2MGZA 3M9MB 2E5JA 3PDNA 2R8GA 1WELA 1IBMJ 4EWTA 4KT0C 1SH0A 3ZTOA 3KLEB 5HBMB 4Y2KA 4DSEA 1K8AT 2BX6A 3NRBA 3RR8A 3W9IA 4H4OB 4P7TA 3KXDA 1D8ZA 3NNAA 4BLGA 3PKMA 2YWEA 4P2FA 3SFUA 2K7JA 3R5DA 2Q79A 5HROB 1Q86T 2RNEA 2DPIA 1TKZA 4OYZA 3Q22A 5HROA 1N54B 3ZTRA 5A8KA 4HH0A 1HPZA 1YLXA 2FQQB 3W63A 1ELOA 2DNMA 3KJNB 4R0EA 4USVA 3Q8RB 2E9RX 3DLKB 3JTOA 1UCNA 4DLGA 3KK3B 3J80U 2PC6A 2Q66A 2EFVA 3KUGA 1NAQA 8AT1B 4B02A 4YB7A 4NXMF 4ECRA 2HBZB 4J37A 5GMEA 4DU8A 1SC3B 3W7BA 2HHXA 5MLCV 1IQTA 5CH7B 1MROB 1ZZNA 4Y2MA 4MK9A 4ZVEA 3WIUA 4DPOA 2W4PA 3ONQA 4B9MA 3G71S 3PW7A 4NE9C 2XGQA 2K2PA 2XMKA 1S4FA 2YNIB 4RNHA 3UPFA 2NXNA 1IKYB 3PYDA 2CUYA 3DGPB 1J27A 5K14B 4DV5F 1T9UA 1XR5A 5BR8J 2FJXA 3FVYA 3KNGA 4LIRA 4QR1A 1JJCB 2Z57B 1WF0A 3MCOA 3WHIA 1RTJB 3TQ1A 1D9AA 1WI6A 3TAMA 1M5KC 4NLOA 2RD5C 2LVWA 3UD3P 1F5AA 3M32A 4DV1J 4H4OA 1FRJA 1XWLA 2RQKA 1RAIB 4NLXA 2M52A 4Q2MA 3IO1A 1CULB 1T0TV 4A8KA 1ZM4A 3U27A 2FGCA 2RKIB 3RU0A 4DX7A 3CC2S 4LF8F 3V4MA 2IM0A 2EKNA 2HRTA 4RPFA 2K7KA 4XPEA 3EX7B 1BQNA 3UCZP 1AUSL 5D3GB 1HD0A 1SV5A 2YWFA 3LGHA 3MM8B 4W98A 3K59A 1NJZA 2OPRA 4FPRA 2OEJA 4CIOA 2X1AA 1GT8A 1P27B 1AW0A 3TZZA 2BM0A 1DQ9A 5J2QA 3PG9A 1L3TA 2N3OA 3SIPB 1X4HA 2AGOA 4EBDA 4PQUB 3TR5A 2DHHA 2H1YA 2XSJB 1WD6A 2YNGB 4QOTA 1X9SA 3KLFA 3GJSB 3GLJA 1NZAA 2YKQA 3C16A 3DYAA 3LWMA 3L95X 4QIWD 2EG2A 4P6QA 1IR2A 3GIJA 2MLYA 4EFAC 3CPWR 3PY8A 1FD8A 1SL1A 4QWDA 1E6VA 1GNKA 4B9NA 3S1TA 4ATNA 4LF4J 1TUVA 1VRQC 1TL3B 4ED5A 2ZFHA 4C0BA 3ZZUA 2PI4A 2AF6A 2BJ1A 3MM6A 3VGUA 1R8PA 2WVEA 2VZ9A 1A7GE 2F8EX 1HBOB 1RHQB 3MPVA 3MZIA 3NS5A 3VGVA 5KFPA 4N77A 2HG4A 2Z2MA 1FKPB 3DLKA 4DJBA 2OPQB 2QYGA 3VQSA 1IBKJ 3MOJB 5D15A 2CNLB 2HBYB 2AZ3A 2VG6A 2Y1IA 1VMBA 4W92B 4NMLA 1EZZB 1H98A 3DDKA 3FNNA 4F36A 5A2QY 8ATCB 2VQEF 3PW2A 2BE2A 5LM7E 5SZTA 5CD4A 4KO0A 1YK9A 4TN2A 4C6AA 4DR4J 4QIVA 5LT5A 4LBIA 3DXSX 4KO0B 4WK1A 4YS2A 2KM8B 1N33F 2IRUA 3O5TB 3BPDA 2R2SA 2AW0A 2Z8QA 1U7LA 4FP9A 4OFZA 4DPWA 1VBZA 3UFCX 2HAIA 3DU5A 2VB6A 3L4BC 3QZ8A 1IJFB 1ZPWX 3GWCA 2DIVA 4D3HA 4O3PA 1DTQA 2OTJS 3OUYB 1JK9B 4NZ0A 2ZOGA 3EZ5A 2JSXA 4OX9J 1KNZA 2PMWA 4R8UB 1Y7PA 1N48A 4Y28C 1S0NA 1HNWJ 1RHRB 3THTA 3I0RA 1YZ6A 2EI5A 3GFYA 4ZJOA 1XMQF 2CZVC 3QJJA 2CQ4A 2MQ8A 3CO9A 1PYSB 1JLFA 3PXGa 4N76A 4UQTA 1OSDA 1IN0A 5KFFA 2MYFA 3GSDA 3QIPA 4HI2A 4M5DB 1FKOA 5CZXA 1SC1B 1RP5A 2UV8G 4MKVA 1S9EA 2YWHA 2FYXA 4YY3F 3OJSA 1MWYA 1JXLA 2HFZA 3NNHA 2OPRB 2MKSA 4MIWA 1FX2A 3IAS9 1O51A 3H59A 1DAXA 1NK5A 3C6UB 2GGPB 2OPSB 4HI1A 3OTOF 2AD9A 1C4AA 3IM8A 2ZE2A 3GIKA 3SQOP 4K4XA 1HD1A 4C8OA 1LWEB 3CMES 1NSKL 2FUG9 2W25A 4JI1J 2W1BA 1QVFR 5L1JA 1WACA 1LWEA 1IBKF 4ILRA 5D6GA 4YFUA 3GV7B 1SJ4P 1JQGA 4NYZA 4CZCA 1RTHA 3MAAA 1QTNB 2AIRB 3DM2B 4QPTA 4U9RA 2DGVA 3FMWA 3SFGA 1ZTWA 2F9JA 2NXUA 2RHSB 1J5EJ 4IG0A 4UUWA 3D9BA 3TX0A 1C0TA 3F73A 3J7AN 3R8YA 3OTCA 3WBZA 4C3MA 5B0CA 4WZMA 3OD2A 3I56S 4F4ZA 4ZVOB 1NSAA 1JIHA 4KE5A 4ZA1A 4JYAF 1R27B 1CJVB 4UOFA 4DQSA 5HMXA 2CADA 2ZNZA 4EI2A 2LDYA 1S1XA 3VAIA 1UMJA 1RQ0A 2CQ1A 2B8PA 3B8HA 4AQYF 3MPUB 1VQSA 3GV5B 5K8PA 3S8SA 3M30A 1FEHA 4U96A 4B9LA 4DQPA 2QG9B
chains in the Genus database with same CATH topology
4EEYA 3KLVA 1G3OA 1RAJA 1U45A 4QWEA 3NWGA 5E3RA 2F8MA 2QYCA 2XSFA 3JSBA 4ES3A 5I4MA 2BW2A 1OPIA 4OJ1A 1OS5A 3JYTB 3KG1A 1HR0F 2VOOA 1H2VZ 2PT0A 4WFXA 3MWBA 2DHSA 3M2RB 2JLGA 1MMLA 1RTIB 4ECWA 2M8DB 4CO0A 1N88A 2M70A 4ZVFA 1TFWA 1FE0A 4R25A 3J7A1 4O44B 1SI9A 1SJRA 4F4WA 5AE2A 4MKYA 2J9DE 1FRLA 2PD1A 3OQ2A 2JRSA 2R7QA 4NA1A 4AYBD 4RNMA 4FXVA 3K8VA 1U49A 2ASJA 4YMEA 4K50A 1URRA 4BS2A 1X5OA 3I5BA 3DLEB 4OZNA 2PDAA 4P7VA 4ZPAA 5CYJA 1TP7A 2C3UA 4DL4A 4EBEA 2XMWA 1S9GA 3N28A 3CCVS 2XS7A 2JWNA 5KFHA 1KOHA 2PE8A 4LJMA 2AYEA 2NYIA 4N47A 4EUVA 2YNGA 1F9FA 2W9AA 3SCKE 2ZZNA 1Q16B 1FXLA 2DISA 3WX4A 1VRUB 2LU1A 4USJC 3A8EA 2WB1D 3S01A 1WTBA 1OQ6A 2VG7B 1RTHB 2DHGA 4ED8A 1N5QA 3IA0A 3T6JA 3MEEA 2EVZA 1SUQB 2PGCA 3AQOA 3UW1A 1SC6A 3W2VB 5D4NA 1SUQA 3KLIB 1HMVB 2IA6A 3HT3A 5DQIA 4IRKA 4M1KA 4TLQA 4DR1F 2FTRA 3ENWA 1HBMA 1FXDA 2G13A 4IH7A 3GFXA 2I5JA 1NH8A 2YNHA 1RJJA 3LGMA 5F8IA 2J0XA 5LXRA 4WZMA 4YOEA 2I5JB 2YNHB 4C8KA 4Q7AA 3JSMA 5HP1A 3KLGB 1UP1A 4ZHRA 1CPZA 3AAWB 4RW4A 2CJKA 3PV8A 5FDLA 3JSYA 5D77A 1SJQA 2UXDF 1EETA 2BJEA 4O3RA 2HFOA 3EZUA 5H1SV 4CH1A 2CQGA 3DXBA 4NRUA 4A8FA 2I38A 4M95A 2AWZA 3DHWC 3IWXA 2XZWA 5DLFA 4U7CA 4OX7A 3RAMA 2B9XA 4I7FA 1AFIA 2K1RA 2EG1A 5CCMA 2DH9A 1BGXT 2OD6A 2ACYA 2C42A 3M8PB 1XMOF 4O3SA 1W2IA 2FJBB 5C25B 3MM9A 4PXBA 4N8OA 1IKVB 2A2CA 3VZIA 2WAQD 3PO4A 3D28A 1B0TA 3HX9A 4RX6A 1B7FA 1G2EA 2D3ZA 4CO5A 3FSXA 4J9SA 3PW5A 1A6LA 5L1LA 2Z4PA 1S6PB 1T03B 2FIUA 4IDKA 2GO8A 4ZPCA 5KFAA 5IM0A 5GMKa 2VODA 4PRFA 1EP4B 3H5XA 1H7XA 3M6VA 1AROP 1VOMA 3TUJC 3BF4A 1JJHA 1K73T 4C7QA 4QIEA 5K9FA 5KG2A 5DQGA 2NQPA 3MFHA 3LW5C 3G86A 2WHOA 4GO5X 1S76D 1HNXF 1HNZF 1N5TA 3MOZA 4JV2A 3L3CA 4ZKAA 1N4LA 4ETXA 3IR5B 4HTJA 3V6KA 3NLCA 2XCPA 4PUOB 3K5PA 1IKYA 3IWLA 3CJ0A 2XI2A 5A6PA 4OZJA 1DTTB 2MQMA 5HMZA 4OI3A 5KT4A 1N6QB 1S0MA 4MIAA 4F67A 1HBUA 3ENQA 1WEYA 4J9KA 1SB6A 1NU4A 2JFDA 5GADI 1VQ5S 5F9NA 4ZPBA 1RI7A 4RW8B 2KZZA 2U2FA 5FDLB 2COLA 4FS1A 3GE9A 2J0WA 5EWFA 5GVQA 1HNVA 1R7IA 2KT2A 4XPCA 4MFBB 4DFKA 1BWEA 3P96A 1ZOTA 2EK1A 2NZ4A 4NX9A 2UVWA 1F2GA 3CCES 5F3ZA 1CLFA 4CI0B 2ZKTA 5AJ3F 3PIOQ 4G1IA 1L5UA 3HM9A 3HHEA 2XY7A 1YIJS 2QMWA 3G4SS 2UXBF 2R9LA 1NHUA 1U24A 2CDQA 5G0RA 2B7BB 3QJLA 3UCUP 3J7ZT 3GIMA 4WF9Q 1JLBA 1XMBA 2J7UA 3OTBA 5KFLA 4RNNA 2DNOA 5E7OB 3DRPA 3IR7B 4ZDNA 4MTPA 4IOAQ 1F5CA 3UNGC 4JI6F 3NG8A 2ILYA 3OVBA 1N34F 2DR5A 1TKXB 3H5SA 3MMCB 1ZZFA 3FEXB 4WYLA 3V5RA 1S0VA 5KFGA 3MMCA 4ELVA 4K0KF 2V8HA 3SSSA 1SIWB 2PA8D 4PG5A 1ZYQA 3VWSA 5EX3A 3HK2A 2QSFA 5CYQA 2XG8A 3WC2A 3D1OA 2KKHA 1FNXH 3AJ1A 4QIFA 4YR3A 3H8YA 1YRXA 2ZH5A 2KDOA 1QSYA 4LF4F 1GXLA 4I4BA 1FJCA 3V6DB 3BN7A 2O1PA 1ZBTA 3DFEA 4O44A 1XTZA 1HARA 1X9WA 1RTIA 1BLUA 3NKYA 4C2MA 4MK7A 4Z2XA 1CG2A 4FNIA 4L3NA 5E3QA 1LFWA 2DT9A 1FF2A 2EFNA 3VCDA 3TAMB 2ZUGA 2F9DA 1ZTTA 1KFDA 3FJ2A 2ROGA 4RW9A 5A8RB 3KLHA 1H2TZ 3CGIA 4WK3A 4RUCA 4DSJA 2CVIA 2G9OA 2VG5B 1W2BR 1YBAA 2C28A 1AUDA 4LIWA 4FBTA 4O4RA 4I1TA 3HZGA 1H3DA 2DCUB 3H2UB 5B09A 3CCZA 3UR0A 2FVPA 3TUZC 1NK9A 1FNOA 3BR9A 4ZP6A 3NMRA 5KT5A 2KFZA 4CQ1A 2VH7A 1V3RA 3M2RA 1QE1A 3AQPA 2RB7A 1I94F 1F5BA 3BEGB 1E6YB 4ICLB 4ZMMA 1JX4A 1HBMB 3IBWA 4RBTA 1IBLF 3LWLA 4HL9A 5H9FJ 3MM7B 2ALZA 2AP6A 4JBCA 2EBEA 1X5SA 3OPKA 2CQPA 2IHR1 3N9UC 3OVSA 5GAEU 2KT3A 1U1KA 4Q8FA 2ILZA 2KZMA 1RT1B 3OLBA 4RU2A 3G6YA 2HNDB 2ZC4A 2E7XA 4YDXA 2Q43A 3QPIA 4DSFA 1NK7A 4DSKA 2DD8S 3T1YF 3QO9B 4IOBA 2POKA 2CZ4A 4YEAA 1O0PA 3CUNA 2FJVA 3BSCA 3BDEA 3E01B 1PSDA 4ID8A 5KFKA 3HPOA 2F8HA 4MMOA 4F2RA 2Y1JA 3MXHP 1RKJA 4ED2A 2XMJA 3NS6A 2D41A 2ZKUA 4RNOA 4X84A 4X4NA 2W7AA 2JEFA 3EGZA 3CEDA 3WDOA 5C42A 1Q4RA 2K1RB 3T1HF 2QA4S 3BM7A 2FHMA 5J1NA 1B0PA 1Y3JA 3WZ0A 3FFIB 2XLIA 3E2EA 3OFEA 4PG6A 1ROFA 5HBMA 4ELTA 3AHPA 2XMMA 3CVKA 4FBUA 4NLRA 2HYIB 1X4BA 2CQBA 3ISZA 3GV8B 1H7WA 2MMYA 5A8RA 3QAEA 1VRTA 2VPYB 3JSMB 5HP1B 3M4XA 4I2PA 2WTFA 5F8LA 4KB7A 1NNDA 1J2VA 4NYOA 1K0TA 2RE1A 4BWMA 3H98A 1S9EB 1S6QB 3K5NA 2DR9A 2HQIA 4NZ7A 1HNIA 4ZLPA 2CPEA 2HHUA 3MGJA 4FYDA 3NCPA 1LW2A 4QYRA 5T41A 2R7SA 3FZ2A 3CCSS 3DLEA 4DL3A 1HQUB 5U47A 1JLBB 1VQMS 4MKAA 1DTTA 4ED0A 4IFVB 3OR2A 2KG1A 1EETB 4C8YA 5C42B 4QU6A 1FJGF 2O5DA 2FVRA 4X65F 1VRUA 5B0DA 3RRGA 1TAQA 5FLXY 3CCJS 3A1YG 2VPXB 2F3JA 2V5HG 3J7YU 2ADBA 1TAUA 3QGPA 4RW7A 3X1LB 1RT6A 3IS9B 3QGIA 2DNHA 1N0VC 4FN5A 3IAM9 2PMHA 1VRTB 2EFQA 3FSYA 4URSA 4FVCA 4NA2A 1TVRA 1U1RA 1WHVA 1S72S 4RW6A 2ASLA 2X1FA 1S1VA 3G6VA 4FS2A 5KFQA 5KG3A 1KTQA 5KFXA 5KFBA 4Y2AA 4NPOA 3NMAA 4RZRA 3T5JA 4B3RF 2MGZB 2LQ9A 4I6WA 2CQHA 2WSCC 5A6WA 5KFDA 4IUFA 2GX8A 1M5SA 5J2MB 4WFAQ 1JLQA 4G6VB 4MYTA 4PUOA 1WHXA 4WE1A 2WOMA 1C1BB 3D5MA 1RTJA 2VFSA 4X4PA 3KJVA 3M9OB 4K4YA 3GYNA 4NA3A 3D2WA 2FHOB 3OR1B 3EXCX 4DQQA 1N5VA 4ED1A 1H0HB 3CCWA 5EHHA 4J9NA 2KFNA 4UUXA 3I4HX 2V2KA 3ULHA 5GADU 5DG9A 4PPZA 2BQRA 2APOA 1NK8A 4X64F 4DV1F 3US5A 3BGFA 2CG4A 2GJIA 1VHFA 1SL0A 1S49A 4DV2F 3MMJA 2KYZA 5LXYA 2LMIA 1MU2A 5B0BA 1SL2A 5CD4H 4A8YA 3CCUS 2LA4A 3HHKA 3PFOA 4LQ9A 5DDPC 4QZVB 3AB4B 2KJWA 2VUGA 4DL7A 4AL5A 2P6TA 3MEEB 2M7SA 3HVTA 5F8GA 4PXEA 3T19A 5KFYA 1OWXA 2AJ4A 4R8UA 2UVUA 3MM6B 3BO4A 1HWKA 1FTRA 4M94A 2E9ZA 1Q7LB 1ZPVA 2ASYA 5AXNA 1CVJA 3BGUA 1SJ3P 2CJAA 2VG5A 4WXOA 3UDCA 3KNAA 2NUUG 2IM3A 4F25A 5J1EA 1UVNA 4W90B 5F8JA 3QAUA 2NPFA 5L8RC 1FKOB 4LUBA 3KK1B 1VQPS 2V4JB 2FJWA 4OZ0A 2KI2A 4O4GB 2B5JA 4X4UA 4PKDB 1WEXA 3CULA 2C3OA 5GAHU 1Y3KA 5DG8A 1XC9A 2J6SA 4OJHA 1VQYA 2O67A 1D9DA 1DURA 5DG7A 2DO0A 2ZDPA 5HMWA 1I6JA 2M0GB 4PCQA 2MJUA 5HL7Q 4HYKA 2XC9A 2L48A 3I31A 4NLQA 4OI0A 1WF1A 1R3NA 3GYXB 3QLHB 1I1GA 1U8SA 3MF5A 1NK0A 2FVCA 2W7PA 1Q79A 5F0UA 1HYSB 2AJ1A 5GAEI 2MHNA 3M32B 4LF6F 2DHXA 2R7VA 2GMHA 2GA7A 1CC7A 2BXJA 4KBIA 3PO5A 1LXJA 2M2BA 2RF2B 4M63A 2GQ2A 4ZPVR 3MMAA 5T14A 1WNEA 2GIRA 1TV6B 1BC6A 1WG5A 1RK8A 1M5OC 3T9ZA 1VBXA 1S99A 2MZ1A 5J1PA 2ABYA 2KH9A 4QIGA 1S48A 4Y6IA 2R7OA 1Y0HA 2I0XA 5DQHA 2XBPA 1PC4A 1HHSA 3CB4A 3R3TA 4I2PB 3U7JA 5I3PA 3MR5A 2QEXS 3THVA 4NLPA 1HMVA 3C6TB 2AGPA 1NJWA 4OQJA 5J2NB 3HKWA 5K8NA 4C9DA 2DGOA 3MUVP 4TU7A 1Q81T 3M05A 4JV0A 3L7PA 2ZH1A 4C0OC 2VBXA 4C3KA 4ID5A 1M90T 5CYMB 2CPDA 4DX8H 4IH5A 2HHVA 5LJ3Y 3IWNC 2MKJA 4DF4A 3JAMY 2J7KA 4OLOA 2B56A 4EO6A 1DARA 3MECA 3EGWB 4FF3A 4DN9A 2R7TA 1JLAA 4TLRA 2X1BA 1KS2A 4KGKA 4DFMA 5C5JA 5K14A 2R2RA 1JB0C 1DFDA 3LAKA 2E44A 4I6YA 5KG0A 3NP5A 2QLXA 1P6TA 1N0UA 3LGNA 2OSRA 2RQ4A 4J9PA 4URGA 4DDFA 3THPA 2LEBA 4Q0BB 1RA6A 5KFIA 1S10A 2OPPB 2ZHOA 1HI1A 2AU0A 2RKIA 4KSEB 2OPPA 1XNRF 3CJKB 1IUJA 4YR2A 4NZ6A 3SQGB 2RDIA 3PX6A 2GHVC 2P5VA 2DCLA 3BN4A 2NREA 1QVGR 1GAOA 3ZZPA 4QBUA 1QUPA 4RW8A 4F8RA 4TNOA 3U1LA 3O44A 3TVYA 4NYPA 3M2VA 4IO9Q 2XLJA 3M2VB 2D3OR 2OIHA 2ATLA 4QQBA 2MQPA 4FXDA 3BO2A 1XK8A 2MZJA 1S7HA 3FQKA 4DS5A 4Y2CA 4X4VA 3NCRA 2BZ2A 3B78A 1GQEA 5L38A 2MQOA 2GQCA 3MTKA 4OHXA 3ZZYA 2KVIA 3DU6A 3H25A 1T05B 1TL1B 2P9GA 3G8QA 4YB5A 4B17A 4I67A 3CDAA 1T3OA 1QUVA 1YGYA 5KFTA 2K3KA 2EPIA 6FD1A 4QWCA 1VQ4S 1MW7A 4OX6A 5B0GA 3DLBA 5H9EJ 4IDKB 3RBEA 2DNYA 2ZE2B 3KLEA 4J9OA 1KTVA 4O3OA 4F3MA 1R8BA 2ZJPQ 4Q45A 1NJYA 5I3UB 3N5BA 2IYGA 3DN9A 3U1MA 1Q8LA 1U6BA 1FVSA 4KFBB 2UUBF 1S1VB 4U67Q 3PVXA 4NCAA 3U1NA 3L09A 4BC7A 3ZC4A 4PQAA 4F02A 2WONA 2KT5A 4ECSA 4L72B 3C3LA 1R43A 4QU7A 3HKZD 2UUAF 2IRYA 3IC1A 1JLFB 1UEVA 2YTCA 4H54A 3KHRA 1CEZA 4HH1A 2HWTA 2WCXA 4ERDA 2RH3A 3DI6A 3I0SA 2GMJA 3HXMA 2FB0A 2R2UA 2HNYA 3N0VA 2CPYA 2ZJQQ 3N6NA 2K8GA 2HLUA 3P3DA 4GO7X 1YRUA 2AYGA 2XNQA 4ZP9A 4ES2A 3ITHA 2DNZA 3KLFB 4RW6B 2CPHA 2EFGA 2IYIA 2MHEA 2YKMA 3TNVA 2YKMB 2E5IA 4C4WA 3H40A 4MAKA 2G0CA 2QFJA 2AV5A 1M5PC 4B3SF 4RW7B 1VIXA 1SJ1A 3MUMP 1D1UA 5KG6A 2HRYA 5L39A 1SH2A 3FRYA 5KG7A 1PO6A 2KN4A 3CC4S 2IAJA 2YWGA 2E1MC 1TL5A 3OXLA 4C97A 4EO8A 4K2XA 2A1BA 2OAUA 5D8HB 2C3MA 3SXLA 3MI7X 5DGBA 3Q8QB 4IOCQ 3BGLA 1X4EA 1TL1A 4ALZA 2GHWA 2MZSA 3V4IB 3DOKA 1RT3B 2ASDA 4B9TA 3CJ4A 1BQMA 2RILA 5J2QB 2B7CB 1VK3A 1NO8A 2IVFB 4KHPF 2QA1A 2LXUA 3DM2A 3QZ7A 3HHLD 3DLLQ