2NUUG

Regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/signaling protein
molecule keywords Ammonia channel
publication title The crystal structure of the Escherichia coli AmtB-GlnK complex reveals how GlnK regulates the ammonia channel
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 112
sequence length 112
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nuuG00
2Z0GA 2GNKA 4RWWA 4CO4A 3L7PA 3TA1A 5D4NA 3GSDA 3DFEA 1UMJA 2XBPA 1GNKA 4CNZA 3NCQA 1NAQA 1V3SA 4RWXA 2NS1B 4RLEA 5D4PA 1J2VA 4RX6A 4Y6IA 4D3GA 3M05A 2ZFHA 4IYQA 4WK3A 1PILA 4CO1A 4USJC 4ZK7M 4OZLA 4CO3A 1Q1KA 1HWUA 1VHFA 3O8WA 2EG1A 2E66A 1UFLA 2XULA 2PIIA 4OZJA 1UL3A 1NH7A 2V5HG 1V9OA 3NCPA 4R25A 1KR4A 1V6HA 3TA0A 2J9DE 3AHPA 3TA2A 1P1LA 4YB5A 1O51A 3AA9A 3HLUA 3LF0A 2VD3A 3AH6A 2NUUG 4CO0A 1VFJA 4NYPA 4YB7A 2J9CA 2EG2A 2J9EA 2CZ4A 4NYOA 3OPKA 3O5TB 4C3MA 1XK8A 4OZNA 2DCLA 2JJ4D 4AFFA 4D3HA 4USIA 2XG8A 5D4OA 2J9DA 4CO5A 4USHA 2RD5C 1NH8A 3NCRA 1QY7A 2O66A 1V3RA 3T9ZA 2O67A 1OSCA 1O5JA 2XZWA 1H3DA 2ZOMA 4YB6A 5D4LA 4Y65A 1UKUA 4C3KA 5DRKA 3MHYA 3AA8A 3CE8A 4CO2A 2NUHA 4WK1A 1NZAA 2GW8A 4CNYA 4E98A 4C3LA 3N5BA 5DS7A 2GX8A 3BZQA 3X3UA 5L9NA
chains in the Genus database with same CATH superfamily
1T11A 2DO4A 4LR8A 4X4QA 3MFHA 3ZZRA 4PEOA 4GC6A 2W9BB 5T7LA 2QLBB 3DFEA 4CRJA 2J0QD 3BGUA 1FJGJ 2G13A 3C6UA 1FX2A 2YX7A 4ZK7M 4HKQA 1SL2A 3CCJS 5DQHA 1R6YA 2RRNA 3U1LA 2D3UA 3V4MA 3FFIB 3SZ2A 3Q8YA 1X0PA 3FRYA 5IWAJ 1YTYA 2BRKA 3N28A 2W4DA 3OL8A 3M6VA 1T7PA 3AA9A 4NXNJ 4Q0BB 2PGCA 4FS2A 1YVFA 2CQPA 3E3XA 4NYOA 4M5MA 5HAOA 4HLBA 3SCJE 2BW7A 3W9HA 1RP5A 2W7PA 4ZCIA 5H9EK 2HHUA 1M1KT 2BQ3A 2IM2A 3MM8B 5KG6A 4LF7F 4DV2J 3QZ8A 4C11B 1DY3A 3D1OA 4C3LA 5KFZA 4HEA9 3EICA 1Q8KA 4CP5A 2HHPA 3W5ZA 2XM3A 2E1CA 4B9LA 2MZRA 4UTGA 2NCKL 1VIXA 2QLWA 3CDEA 4IYQA 1X0FA 5DDRC 3TUJC 2Y0BB 4DX5A 2PMWA 4U7CA 4N47A 1EZZB 3QGIA 2DH8A 1LK5A 3NLCA 2CQHA 5EN1A 3KUGA 2K7KA 1FF2A 5DQIA 3FSXA 2DNZA 1N8RT 1XNRJ 4KT0C 1N6QB 4YN3B 2G2YA 3NNHA 4PRFA 1C1CA 1TV6A 4R0EA 1VFJA 2MKIA 2AX1A 2ZWOA 3MM7A 3OUYA 5M2PA 1S1XA 5A8WB 3CJ2A 2VPXB 4BBYA 2VA2A 3N6MA 1Q82T 4FNHA 4Y34A 2DKOB 4DR7F 2DEJA 4ECXA 5IOLA 3KMSA 2AYBA 4NEYA 4ES2A 3PX6A 4F3MA 5SZTA 1FWLA 3IRXB 4NLVA 3FZ2A 4EU0A 3FZBA 3M32B 1VC6A 4N8NA 5FDLB 2BW2A 1K73T 2R7OA 1Q16B 3QGHA 2VIHA 1QUPA 3JXOA 3KYLA 2KM8C 1IBKJ 4NCGA 1IKYA 2ZWPA 2EVZA 4DPYA 3LTOA 1JJ2R 5A8RB 1VHFA 1TL3B 2DH9A 3I31A 4RNNA 4N77A 3PFOA 3PXGa 2C2ZB 2FIUA 3L7OA 3S8SA 2BBEA 1A0OB 4LR9A 2DD8S 5E33A 2GQCA 4CQ1A 1ZAXA 5FLXU 4MJKA 1RAHB 2CG4A 4RNHA 3IBCB 2AWZA 2Y1RI 1NM2A 4NPOA 2F4VF 3W1YC 5HLFA 5HROB 1NKCA 2VBYA 5HVFA 1URNA 1XTZA 3UW1A 4MKYA 1SH0A 5I42B 2XS7A 1RHMB 4ECUA 4IG0A 1RABB 2VQFF 3BYPA 4KKOB 5AXLA 1TKDA 4RWWA 2V8DA 4KFBA 3VVUA 3QATA 1UA0A 1T05A 4Q2MA 4I56A 3KDOA 5KFNA 2CQ4A 1J2VA 3M05A 3CGIA 2R4FA 3GCWP 1N34F 3G82A 5HQMA 1UZHA 4NRUA 5THWA 1IKWB 2ERRA 3MMCB 1VRUB 4N56A 1RTDA 3PJXA 5I4MA 2EFQA 1D9FA 2IRYA 2QV6A 1UVNA 2LA6A 1C0UA 1EP4A 3LGMA 3UDVA 1F3FA 2ALYB 3V2UC 4I7FB 3D68A 4JV2A 3Q2TC 4FYYB 4PAAA 1A9NB 2OPQB 4FF1A 4WIQA 2GIFA 4Y00A 4ES3A 1FRMA 2UVVA 2L9DA 3KLFB 4RNFA 3TI0A 2GJIA 5DS7A 3I4PA 2YX4A 1FKPA 3OD2A 1L3UA 1WSRA 3K2YA 3DOMA 3KUHA 5ETMA 1GNKA 2CFXA 4LF4J 1H7WA 4O4GA 1NB7A 2W7AA 3DOLA 2FC9A 4KGMA 2YNGA 3QFHA 2QC3A 3PY8A 1BWVA 4DL4A 1KVKA 4P2MA 1PYOB 1NUEA 3A4TA 2ROEA 4KC5A 4YB5A 4KHMA 5CYMB 2FHOB 3BGFA 2HFOA 1HNZJ 3G96A 4IR1A 1U2RA 3V4IA 1VMBA 2EFOA 2B6AB 4DU7A 3HT3A 2UVWA 1VK8A 1UFWA 3TUZC 4ZPWR 4LFBF 2W8LA 4KGKA 4PYDA 1N0UA 3M8QB 2IVYA 1SC4B 4K5RA 2VOOA 2YNIA 2XY7A 2ZOFA 3KHHA 4Y2MA 2CPFA 2CZVC 1WEXA 4QIWD 2DBBA 2ZD1B 2FZKB 3O1LA 1B0PA 1NSQA 5IT9Y 4ANEA 4RLEA 1UFKA 3BDPA 1HYSA 3Q22A 2C2DA 4EBDA 2XC9A 3M2RA 2QL9B 1NO8A 3AB4B 2YWFA 3QMQA 4J9LA 1V5IB 3JS9A 2YXLA 3F56A 2C2MB 3GJQB 1GFWB 1RTHB 2VG5A 2PDAA 1YHQS 2ZJPQ 2AW0A 4CH0S 1RWOB 2XHCA 4WFYA 1Q5VA 1SQGA 1S49A 2HRYA 2EW9A 3I5CA 2F63A 1TP7A 1FRKA 3LP0A 6AT1B 2MKCA 3QO9A 1UP1A 4DL5A 1FX4A 4WYWA 1N32F 1TVRB 4CT8A 2KKHA 3SMZA 4P52A 3QQCD 2PEBA 2HNZB 4M5IA 5F8LA 5J2PA 5AXMA 4DR1F 3QPIA 2CPDA 1VQ7S 3CO0P 2ZH6A 3DN9A 3WQPA 4OJ3A 2IJNA 2P6SA 1V3ZA 1ZYQA 1YJWS 4CNZA 4UQGA 1JJHA 4ED5A 2KH9A 1VQ9S 2HVIA 2H5EA 5DJBA 5EDWA 3MWBA 2LEBA 4GVBA 2Z2YB 4J37A 5KFEA 1WEYA 4DR3J 2MLYA 4I2QA 3KHRA 3W3SA 4TU7A 1SKSA 2UUCF 2GGPA 4PUOA 2DJWA 2YKPA 4B9TA 1DZ5A 1F9HA 5M2UA 4MK9A 5ETQA 1EETB 4A8YA 1T9WA 4EEYA 4Z37A 3M8WA 1T9TA 3FVYA 3US5A 4JI5J 3FEZA 4LFAF 2R2TA 4QOTA 2RKIB 4QIFA 4ETZA 3MCOA 4O3OA 2C28A 4OQJA 3HM9A 4X65J 1L3TA 1R7IA 4DZDA 4JI1F 2C2KB 2I8EA 1NK0A 1C1BB 3VAIA 4UZBA 2E7VA 2GHVC 3TJAA 3P4UB 2B5JA 2W9AA 1RAEB 4MKAA 4P72A 2H4WB 1Q4RA 4ZJOA 1VQSA 4KH0B 4WTYA 4RW6B 1EQ0A 1UVKA 4W92B 2XBPA 1UEVA 4K2XA 1W26A 3VHQA 4DSKA 2VV5A 2OPPB 1ACMB 3FEYB 4M5KA 1JB0C 2WVEA 5LT5A 2HHWA 1NDCA 1PBUA 4DR5J 1B64A 3Q2SC 3D3CJ 1RT3B 1UJ4A 3NCPA 1CQNA 4XPEA 3G6ES 1FERA 4J7CA 4DFPA 2BACA 1FE0A 2IVFB 2J9EA 2CZ4A 3R2DJ 4LIWA 4HHJA 1P6TA 3OFFA 3R2CJ 4OV6A 5E3CA 5KFRA 2Z2MA 4E0DA 1RT6A 4DLEA 3AD9C 4YS2A 1CLFA 1O5JA 1QAIA 3PZPA 3DI6B 4QYZK 4BWJA 5J1NA 1G3OA 3UCGA 4DWIA 2M7SA 1I94F 1NJIT 4ZPAA 1KFDA 3KDNA 4B9MA 2W9CA 2HNDA 3M8PB 3CC4S 1TL7B 1VS3A 3VGVA 4JI4J 4C8NA 1AFJA 4CLYA 2YKAA 3CIZA 1PYTA 4CYUA 3POTA 3PKYA 1NK5A 3DLLQ 4LQ3A 1BMQB 3MMAB 3HSGA 4K7QA 5B0BA 1L3SA 3RR7A 2WVDA 3EGNA 2V5HG 3G71S 3TVKA 4C6AA 2R2SA 4A8KA 1P1LA 2V9WA 3VQSA 3KMQA 3C2PA 4CWBA 1KQFB 2IIHA 5D15A 2CNLB 2EK6A 3I6PA 2ZHBA 3KK3A 3K8VA 3M1VB 3H2UB 2XSJA 4DV5F 3QJJA 1Q53A 5D0HA 5IT9U 3F41A 2CADA 3GWCA 3DDIA 1YK9A 3ZXWA 2CQDA 2DGVA 3B6BA 2GMHA 3ZC4A 2XNRA 5K8MA 1YKWA 1SV5B 3CSKA 2EFVA 5D3GA 2GIRA 3A8EA 4OZ2A 3UO0A 3NY0A 2HFUA 3EMTA 2AJ0A 4N5SA 4O0IA 3UN5A 1HNVB 4F4YA 4M63A 1X9SA 2MKYA 1YJUA 5ETKA 1SVDA 2PFFB 4F26A 2J6TA 2RF2A 3K5MA 4KSEB 3CWJA 4LF6F 3ET6B 4JI6F 4ECVA 5GADI 4WFXA 2DHGA 4MYTA 3TA0A 4ZLJA 3W2WA 1HR0F 3GG0A 4QU7A 5CYJA 4PXBA 4RUCA 4OMFG 1FRLA 4M5HA 1XK8A 4K50A 1RTJB 3R7NB 3MEDA 1DTTA 1V3RA 2GJFA 2CAJA 2BANA 3IO1A 3JTNA 2NXJA 1T94A 3OR2B 4OZ5A 2OPRA 3BM7A 1R8HA 2I6WA 5GVQA 4PWDA 1WUUA 4MKVA 3BYRA 4ZCMA 3W66A 1HNWF 2DHHA 5KFYA 4YQWA 1MROA 3MMJA 1IUJA 1FE4A 3P5BP 1NJWA 2B8PA 1KHVA 3TVZA 3NCQA 2B4VA 2MSTA 1GTEA 2F8HA 1CJVB 3EGVA 1NHKL 4TXSA 3VCDA 3H7HB 1TUWA 3TVYA 2F9JA 4X4PA 2QL5B 2QLFB 5E3RA 1PAEX 2AZ3A 5GMDA 2P9CA 2EK1A 2VPYB 3DLEB 1N5QA 3DXBA 4ZPTR 3JTPA 2V34A 2HHTA 3RB0A 4DR7J 2YKNB 4PXDA 4NE9C 5KFMA 4X4OA 1WDTA 2QJ3A 4GKJF 4EGLA 4DSFA 4MMOA 2JLFA 5KG2A 1M90T 4QR1A 1G6BA 1J5OB 3MMBA 3N4WA 1S1VB 1MU2A 5K14A 2HWIA 4NXMF 3N5BA 3UCUP 2UUBF 2I5JA 3Q86A 3PO4A 3HPOA 3KLIA 5KFJA 4ED2A 3DLJA 2KDOA 5ETLA 2AGPA 1X4HA 1FDBA 4ANCA 4LREA 2F8EX 2CDRB 3M4XA 5G0RB 5B08A 4WP9A 2H9ZA 1HWIA 2D9OA 2HQGA 4HH0A 1I5OB 3T1AA 5HBMB 2LQ8A 2F4VJ 3HHLD 2FVPA 1FJCA 2C2OB 4C0OC 1WG5A 1HMVA 2NZ4A 4RW7A 4A8QA 2PMHA 2CZ9A 3BSAA 1VQ8S 1FXLA 2DISA 3ILIA 2FVRA 4DL3A 1I3OB 3QRRA 2JNJA 1QY7A 4KJIA 1H3DA 5KFTA 4BS2A 4YY3F 5KFVA 3D66A 4NCBA 2H65B 3WIVA 3IA0A 1LWFA 1YGYA 1N34J 1ZA1B 1Q81T 1ULRA 4OZ3A 1T3OA 3IMQJ 2OFHX 2ZH1A 2OLWA 4ILMA 2HGNA 5KT5A 2BA9A 3KKFA 3BN4A 3L95X 3K8WA 2XMJA 3BQ1A 5L8RC 5J1PA 3W9JA 5C2GA 1HBMA 5JVGQ 4ZLPA 2XMAA 3CDBA 3LP2A 3PNIA 2YKQA 4WCEQ 4DSIA 1RDRA 2OEKA 5CYQB 1M5VC 4F0HA 2RS2A 2RAQA 3HI9A 3NBPA 2KG1A 3GSIA 3MR7A 1RT1A 5HVHA 3CDUA 3TUIC 4RU9A 3UVJB 3T6JA 3B82A 1S9EB 4M1KA 3QWPA 3KG4A 1SJ4P 1S6PA 4LF8F 1H2VZ 1NH8A 2J0SD 5J2NA 2K8GA 4EBCA 2ZUAA 4NLSA 5LM7E 3G2XA 4YFUA 5A0YB 2VBXA 1S1UB 1JKHB 2D69A 4Q8EA 4MFBB 3MPUB 5GAGI 1X4AA 2AD9A 2LQBA 3O2IA 4EUVA 2AJFE 2HNYA 2ZFHA 3QRPA 2M0GB 2HS3A 2OTLS 4DV1F 3UPFA 4UY8T 4OYOA 1NHUA 4HYKA 4P75A 3K17A 3PX0A 4MIWA 2FJAB 4S0MA 5CZVA 4ER8A 3NL0A 4C0BA 3GIRA 4QCLA 1UWBA 4AUKA 3EYZA 1QSLA 1FRXA 5LJ3Y 4ZVOB 3AJ2A 3ZNJ1 2AGOA 1XNQJ 4DPUA 4USUA 3SCKE 3PDNA 2FQQB 1BE4A 3BBCA 3V6JA 3FK4A 1RU2A 5IM0B 2QEXS 3MF5A 1FEHA 2JRSA 5IV4A 3CEDA 4FXDA 4UOFA 4DX6A 4YB6A 2MKHA 3SCIE 5IV3A 1KEKA 1RWVB 1S6UA 3HKZD 2Y1IA 4NMXA 2RILA 2A6MA 1HD1A 3ISNC 1HKAA 1C0TA 2J7WA 4KRWA 2KVQE 1KS2A 1KLNA 2VBZA 2HHHF 5HP1A 2FB0A 1R6VA 2OPSB 5IC4B 5C24B 4LBIA 1FK9B 5J2QB 3Q8VA 4OYPA 3V5RA 1F5CA 1KONA 3M8ZA 1YITS 1FESA 2KB2A 4O3SA 3BPSP 3QT7A 1N32J 4WZMA 2V2VA 3J80Y 4F4WA 2LCWA 2YKMB 4AT1B 5HQLA 1WF0A 5M2RA 4CT9A 2HAFA 1HBOB 2IBOA 2P6TA 1MMDA 1R0BG 2Y8YA 1FFWB 2GIQA 4DR1J 4KKOA 4IG3A 2QSWA 2X1BA 2DB1A 3KG1A 2ZOMA 4ENOA 5A76A 2DRBA 4IDKB 5T14A 2E5HA 1R27B 1S4FA 1HBUA 2HBRB 3TX0A 2K1RA 1IWAA 1U1LA 2D3ZA 2UUCJ 1SCJB 4C8YA 1NPPA 1RBLA 5L1IA 5AE2A 4DL2A 3NS6A 5AE3A 5T7LB 2PI4A 2I38A 1K0VA 4OHYA 2BJ8A 3C6UB 2VZ9A 2H5JB 2N7YA 1SJ1A 3J81Y 4LFAJ 3IR6B 4HHHA 2O1PA 2MZJA 2PIIA 2HK2A 4O23A 3NS7B 4DZ6A 4JI1J 3OLBA 4OHXA 3W5XA 2FZGB 2UXBF 2KRRA 4M95A 3OVBA 5LMNF 1U2FA 2XZTB 4LFCF 3O5TB 5DG8A 2Y8WA 4NLXA 2B9YA 4I67A 2YNFA 3TX8A 2VH7A 5KFLA 2RT3A 2XMUA 3LANA 1GMVA 3NWGA 2QTWA 5CCLA 1RHKB 3MEKA 3TOQA 4AL7A 1VGYA 1SB6A 1S97A 1WC1A 3KG0A 4R5PA 3AJ1A 2IYGA 1NSAA 4CO4A 2Z2LA 5EWFA 3GSDA 1VR6A 3EXCX 3ILOA 3SIPB 3IXQA 1RT7A 1FCAA 3W63A 3TEGA 2Z8QA 4ZVUB 2QE5A 5KG0A 4ECWA 4QR2A 4LF1A 2M52A 1RTIA 1U8WA 3P8BB 3H2VE 2UZAA 3VGSA 1IBLF 1K1SA 3V6KA 1U25A 1SKRA 5B0GA 1VOMA 1N52B 4F2SA 1XBWA 1U1KA 3HVTA 2N4CA 2J9CA 1NDPA 2IAJA 3MPDA 1C1CB 1TV6B 3RUBL 2Q1LA 4JB8B 1K9MT 2J76E 5CZXA 4N8OA 2XS5A 3MM7B 1MN7A 1UPPA 3OUYB 4P7TA 2KO1A 2MQLA 1S1XB 2B3TB 4HT7A 5F3ZA 2V2QA 3C8YA 1UKUA 3SXLA 4DR4J 4OLOA 5K8OA 1FKOA 2ZJRQ 2GZOA 4K4SA 1CQMA 1FEEA 4YEAA 4KIAA 3GTYX 3BN7A 3RBXA 4JOUA 2B0GA 2DR5A 2YX1A 5KFWA 1PJ5A 2IRUA 2KHCA 2UUWA 3C46A 4FYXB 4FXVA 1IJFB 1ZAWA 4M5DA 2HURA 3TRGA 2F4FA 1HA1A 4NCGB 1IKYB 3MUMP 2JX2A 3IR7B 3PYGA 3DM2A 2ACYA 4IRKA 4B3MJ 1SH3A 2CWXA 4UOCA 4DUZJ 2XS2A 3D6TB 5HI7A 1BY9A 2CJKA 1GXLA 2HZVA 1WG1A 4DV5J 2ILYA 4WWSA 1NZ8A 4XAKA 1Q86T 3G9CA 3QWUA 4QQBA 4QWBA 1WEZA 4E8UA 3B4MA 2A1BA 5LJ5Y 4PXEA 4ETXA 5B0EA 4JI7F 4DS5A 2DNNA 3TW0A 2GMJA 2YQ3A 3MD3A 1CJUA 4LF2A 2YQ0A 4UOHA 4Y65A 3I9ZA 5HLFB 1FRJA 2LU2A 3SDEA 3PHTA 2KXHA 1RWPB 2BE2A 4IG0B 1HFEL 4RZRA 1EX8A 3VAKA 3ISZA 1Q95G 4J9OA 2JLEA 2XSFA 3I0RA 4JI6J 2C3PA 4O3RA 4KFBB 2B9XA 3ICLA 2KN4A 1T05B 4HTJA 1HR0J 3MUVP 4JYAF 1FJGF 1ZM4A 1EAYC 3UN2A 2J5AA 4USVA 2AJQA 3J80U 2MKJA 1ZPWX 3R7BB 1GMUA 3R97A 4AE5A 4J9PA 3G82B 3EPIA 1NKBA 1F5AA 4BLGA 1EQMA 3HSZA 4B3OA 4ZKAA 2YWEA 5IWAF 3GFXA 1R8AA 5LSOA 1RTDB 3FQLA 1RT5A 4OI1A 3J7YI 2P5VA 2GHWA 2N7CA 1ICEB 1C0UB 1EP4B 1IN0A 1HNWJ 3JSRA 3DLKA 3ILLA 4WU3A 2DHAA 2QYCA 1REVA 2YH1A 2XO6A 4LSNA 1NK8A 1SJFA 4DQQA 2HPUA 1S1TA 4H4KC 2XCAA 1T9YA 1QM9A 3FKBA 3GJRB 1WWHA 4WPAA 1JQGA 3K89A 4ATNA 1NBEB 3QRQA 2FYXA 1B70B 1FKPB 5IC6B 2A6OA 3CD7A 2KT3A 1JLFA 3KHGA 4XPCA 4JUZA 3DOMB 4DPXA 2J8AA 3ZZZA 4P6QA 1MMLA 4WFNQ 1VRQC 4CCHA 3IRWP 1VQKS 4O4GB 5BYSA 1PILA 2FHKA 1CJTA 1GXTA 3KWMA 2FJDB 3DOLB 4P2FA 3PCOB 3JSMA 4A8MP 4GKJJ 2YNGB 4O3QA 1UVIA 1E6VA 1N36J 1OPIA 1KD1T 4AL5A 5J2MA 3DC2A 4NXMJ 4K4XA 1DJ0A 1T8EA 2IA0A 2A3JA 2ASYA 3OTEA 4BHQA 2UUBJ 2QA4G 2DEIA 4HVZA 1LXJA 1Y3JA 2V8PA 3MHYA 3KK2A 1NB2A 4J9MA 4WK1A 2ZC3A 4FS1A 2YNIB 1PYSB 3MMAA 2UVRA 3M9MB 1H0HB 1VQ4S 2VOPA 3QIPA 3OFHA 3QAUA 2WOMA 3G6YA 5ETSA 2VG7A 4G1IA 2IC3A 1IM6A 2XWYA 4DSJA 4I6AA 1S5ZA 4MIBA 4CLWA 3GILA 2Q3PA 1HYSB 4KQZA 1MW7A 1AT1B 1B99A 4ZLLA 3M2RB 4TY8A 2CVIA 4Y2KA 2G1HA 3CJ3A 2QA2A 4X84A 5F0UA 4C9DA 4OZ1A 2E9ZA 3GE9A 4DFMA 4DV3J 1OJ4A 4LRCA 4GC7A 3UDCA 4YY3J 2VG5B 1N48A 2F8MA 1LEOA 4ERDA 1F6TA 5HSPA 3HZGA 2RRBA 4DPOA 1B7YB 3LP0B 3RB4A 4EYIB 5C42A 1RTZA 2CXEA 4TYAA 4A48A 3C6TA 2LMIA 1FD8A 3M2UA 4K4UA 3S7RA 1NPRA 5HATA 4Q8FA 3HX9A 4HDGA 4ZMMA 5J2PB 1YQHA 1H7XA 4NL5A 3QLHA 2VFUA 4FPIA 3BO3A 2FJWA 4XDDA 4HI2A 2C22A 5KFHA 1SJ3P 2QA1A 1V3SA 4NLPA 4IQXA 2XMWA 4ZJQA 3PR4A 3WC2A 4ED0A 1RT2A 5CABA 2I1RA 4ZITA 1RADB 3SI8A 4GVBB 4X4UA 4I2QB 2CWKA 1PJ7A 1EJ7L 3BH6B 4LF8J 1UL3A 3R6LB 2V4QA 2CPYA 2ROGA 3O6QA 1U6ZA 2GGPB 4PUOB 1FDNA 2RDIA 1ZZNA 4ZPVR 4H54A 4Y0FA 3NGSA 3OL9A 3THTA 1GXUA 1XR6A 4KGZB 1T03A 1S7HA 2IM0A 4CM2A 5LMUJ 3AD8C 3EVMA 4KPCA 4X66F 3CJ0A 1M5SA 3H25A 2MLZA 3G6VA 4DV1J 2B5JB 5IZHA 2ZITA 3H5UA 2MMYA 2Z30B 5FJ4A 4AXIA 4L6V3 4E2FB 3OHAA 4DV0J 4A46A 1LWEA 1K8AT 3RAXA 1IR1A 1D09B 1VJQA 4ZP9A 1QAJA 3I5BA 1RXOB 4DV7F 1Z2LA 2W7OA 2E66A 2R8GA 3QZ7A 4FKYA 4O3NA 1U02A 3MM5A 2B51A 1H2TZ 1A6LA 4QWAA 1B3TA 2P8IA 1WC3A 4H4OA 4Q43A 2YWWA 3CJQA 1UPMB 1HNZF 3TAPA 3P49B 5KFQA 4BC7A 2HHHJ 1ZZFA 3OSNA 3KJVA 4UF4A 3FMWA 2L9WA 1RLCL 4C8LA 1JLQA 1RT6B 4U9RA 5HMXA 3BKTA 2KYXA 2VHGA 2N3OA 3PX4A 4PG8A 2GS8A 2ZVSA 4Z7YA 4K4YA 3G6XA 2C2EA 3IG1A 3FBCA 1TKXA 5IQ6A 1S59A 1X4BA 1SXLA 2W9CB 2R9LA 2HNDB 2D74B 1MLAA 4OJ1A 2FGOA 2F3JA 4YHHJ 3R5JB 3CJSA 1VJWA 3AXMA 2FUG9 4MK7A 2BOPA 3WIUA 2Q66A 2ZBQA 4O0NA 3POTB 5CXTA 2HHXA 3PEHA 5JMNA 1UFLA 3IWNC 1PJ6A 5KFBA 4LIRA 4I64A 4J9UE 3OSPA 4B9UA 2JLGA 5AXNA 1LOUA 3Q89A 2XTJP 1MSWD 2B4OA 4B08A 1JLBA 2RDDA 3AH6A 4JBCA 8RUCA 3TR5A 3VQTA 1G7CB 1NK4A 1MWYA 3KK3B 2IMOA 2RRAA 3I87A 4FF2A 4NZ7A 2XSJB 1TU0B 2HVHA 3GIIA 1X8DA 5J1EA 2MJUA 1IQTA 2XYHB 3DU5A 4F02A 3EGWB 3ETOA 1RKJA 2A10A 4ZPBA 3RYLA 4CLLA 3W62A 2DH7A 1Y0HA 1JLEA 4JP8A 2EBEA 1BXNA 3D6HB 1X4DA 1WOSA 3GJSB 3RJMB 1OY9A 2OEMA 5D3GB 2AEFA 1HD0A 2E5GA 2UXBJ 4XO0A 1VQMS 4YP3A 2RU3A 5LMNJ 4DN0A 4MTPA 2KM8B 3AOCA 4WF9Q 1PC5A 4LFCJ 4IUFA 1AUSL 1D3WA 2RF2B 3MAAA 2OMLA 4IFYA 2FJVA 3GYXB 3TYTA 4OZJA 4DEZA 4B3SF 3IFEA 1YJNS 1FTCA 3D1HA 1N88A 1TK5A 4WZQA 2APOA 4XIUA 2KG0A 3OPKA 3G86A 1S1UA 2CJQA 5HQ8A 3WX4A 1TFWA 2ABYA 3KTQA 2MSSA 3W9IA 2X3DA 1X7VA 2KJVA 2BXJA 1RWNB 3D5MA 1BGXT 2BANB 2BJDA 3OJSA 1X4FA 2DPJA 1SJRA 2OPRB 5GAEI 4PWDB 2U2FA 1S10A 1T0TV 2DNKA 2OAUA 4CIOA 4LSLA 2VFRA 4X62F 1MROB 1IBLJ 4WIIA 3KUEA 2MY8A 4URQU 2XNQA 5ITHA 2HKEA 5I3QA 2NXNA 3TUPA 3PW7A 3JYTA 2G2OA 5E5NA 4ITSA 3QGGA 2DRAA 2DY9A 3RGIA 2JFDA 3B4DA 3TQ1A 2BYCA 1E6YA 5KFXA 1F60B 2VUGA 4O44A 3DRRA 2LVWA 5KG7A 3D54A 1JWWA 2ACMA 4HR2A 1VBYA 4OZNA 1X9MA 4ELVA 3FBBA 4GKKF 1WG4A 4PWUA 4PZVA 2A2DA 3MAHA 4F25A 4F67A 1FHTA 1GH8A 1JNRB 2PFDA 1DQ9A 3F73A 1G4CA 3SSRA 2A0FB 3MMBB 4H4KA 3I82A 1KFSA 1CULA 4F8RA 2HMIA 1MU2B 1NK6A 3N5FA 5K14B 3MPWA 4DBQA 2D3O1 1ZBTA 1O0PA 3IR5B 3BV8A 1RHQB 2I5JB 1PAUB 3HDSA 4RW9A 3KLIB 4NLQA 1WHWA 4JI0F 4JI2F 3VAFA 1Y5NB 4LBPA 4PYAA 3TARA 1X5PA 2FJBB 2HQDA 3CJ5A 2H4YB 2DNHA 2BOAA 1FD2A 3IS9A 3IWXA 3D2WA 1WC0A 4DSLA 2KFYA 2RH3A 2XMMA 1P8GA 4U6PA 1QVFR 1TAUA 2ATCB 3MR2A 2RSQA 1UJ5A 2FVSA 1HMVB 3D9BA 4RW7B 3UWTA 2EG2A 3GR1A 3R5BA 5BYRA 2Y0SD 2XEXA 1O8BA 4PQAA 1ELOA 1RYRA 5AXKA 1OWXA 2ZZTA 2O66A 2OTJS 3E51A 1GEHA 3FJ2A 4TLRA 3RG6A 4OHZA 1I1GA 1J27A 4ED6A 2CG8A 4JYAJ 1WF2A 3KNAA 5K8PA 3SYZA 4U67Q 2R7WA 5EWGA 5CA5A 1LWFB 2KXNB 4ZVSB 3RAQA 3NGRA 2NZCA 4IRCA 3K57A 2VJUA 3BR8A 2DR9A 1NXIA 3EUNA 1RHUB 1ZETA 2R8JA 4DQRA 2LU1A 2XYGB 3DCAA 2AJ2A 1HBMB 2KFNA 4ZLNA 2RQMA 5KT2A 3LP2B 2JEFA 3KLVA 1RYSA 2E9TA 2H48B 4DOZA 2MZTA 2ZBCA 1GX5A 3NBPB 3J7AN 3PRBA 2VD3A 4G6VB 1RT1B 4C4WA 3UR0A 2E7XA 4AFFA 1U26A 1OMSA 5D4OA 4G3IA 2W01A 7FDRA 1FNMA 1S6PB 4F3QA 3DGVA 2O67A 5J2NB 2W1BA 4OYMA 2PEHA 2GW8A 4RNMA 4P7VA 2HBZB 2F7VA 2GNKA 3R1HA 1Z4UA 5KTQA 2QL7B 3QAEA 3DYAA 3FC9A 5B7WA 1DFDA 4TKTA 5ETPA 2V50A 1RAAB 1FRIA 3N9UC 1QLNA 4OYAA 2AU0A 1KC8T 3KLEA 4IH5A 2ZC4A 4K4ZA 2HNYB 2ILZA 5D0GA 3IGNA 3ZTSA 2XY5A 5EX3A 4DDFA 4FXWA 1KVJA 4LR7A 5ETNA 2HYIB 2K06A 4ZP7A 1UWBB 1JIHA 2W24A 1CEZA 3UCZP 1HPZB 1BHNA 1XMQF 2CYYA 3CJKA 3BH7B 1X4EA 1SUQA 3IAM9 1FVQA 2Q6CA 2RUSA 5GMKa 4UQTA 3CJ8A 2MQOA 1FNOA 3GIJA 1WC5A 1HQUA 3UDLA 4J5OA 3M7VA 2RS8A 2BQUA 3TZWA 3VR1A 2V6AA 4CLUA 2HLTA 8AT1B 2YNHA 2CQ1A 1C0TB 3UD5A 4RBVA 4DG1B 2X7IA 5HP1B 3D7SB 4A8OA 4M5LA 2C3UA 1TUVA 3W8PA 1RUSA 4I2PA 3VZHA 2E5LF 2R42A 4QIGA 4KR0B 1PSDA 4F4AA 2CNKB 2F40A 2MEWA 1SKUB 1JLGA 4RUAA 2HQ3A 3S6EA 2UXCJ 4YDXA 3VZIA 2JEIA 1PG5B 4GO5X 1KWMA 4R25A 2GQQA 3RRHA 1YRTA 3TA2A 4CLTA 3GYGA 4TYBA 1W2BR 3T9NA 4JI8F 3JAMY 4YB7A 2UVUA 3V6HA 2W2PP 1MN9A 1YG0A 2KU7A 2FLOA 2UUAF 2JDJA 2E1PA 4U95A 3Q0AA 4NLWA 4DV4J 1U1RA 2DR7A 5D78A 4IG3B 1LWCA 4C8KA 3FBEA 4W4MA 3GV5B 4HACA 3W8GA 1HBUB 4C8MA 3AD7C 3WC0A 2LEPA 2FPHX 2K1RB 3MEGA 1VC0A 1NJZA 1L3KA 3VGTA 4WFAQ 1DBDA 2HLUA 3PYFA 4CTAA 3ENQA 4TQRA 3GLJA 5L46A 4EZ9A 1AZSA 2ASDA 4PCQA 2CNNB 2G9OA 4KY3A 2BABA 2C3YA 2IHR1 3CJTA 1WC4A 2AYGA 3K5NA 2ZM6F 3QBCA 2D3OR 1NCLA 1AUDA 1W7WA 2NSCA 1U48A 4H4MA 3PV8A 2MDAA 2VFTA 3CT9A 4X66J 2WB1D 1NNDA 2G1DA 5KFUA 4KGVB 3CD6S 1RISA 3OR1A 4TY9A 4YDDB 5K5MA 4HHUA 2YNFB 1KDNA 3GU0A 4K4TA 2QYGA 4AXJA 4DV7J 3O44A 3BEGB 1FO1A 2C3MA 4ZP6A 4USMA 4KGXB 4R5PB 2O3DA 2KRBA 4DUTA 4W90B 3CIMA 1XWLA 3CDWA 1GK8A 5KFCA 3CCZA 5D4PA 1RT7B 4ZVTB 3ETMA 1AW0A 4C8ZA 3GFZA 2UV8G 4ANDA 3SV3A 2B8QA 5GADU 2JEJA 3C3LA 2DITA 4ICLA 2QIFA 2WTFA 3GIMA 2MQQA 1AA1B 2KFZA 1RTIB 3NGKA 5KOXA 4NCAA 2W2NP 2RJZA 4ED3A 1V6HA 1QDUB 1NSKL 3AOAA 3PIPQ 4Q7AA 4WKYA 4DI6A 3Q24A 3HVTB 1RHRB 2B56A 1XNQF 2IAJB 1R0AA 2OSQA 2XLKA 2VC1A 1ITPA 3RB6A 3ELHA 3CCLS 3JB9k 2AZ1A 4FYWB 3HP6A 4USKA 3NP5A 1FKOB 4KAIA 5KT3A 3JTOA 4KV8A 3ZZ0A 1XMOF 2MPUA 3WZ0A 2N82B 4F04B 4X64F 2JC0A 4DCOB 1X9WA 1Q8BA 4WBFA 1AXQA 5EWEA 4M5DB 2YY3A 5D6GA 1HLWA 3ZTRA 1URRA 3G8TA 3DM2B 4NRTA 3DDNA 4OX7A 1FWKA 4QIVA 4F7VA 4NMLA 2M2BA 2B9EA 2AT1B 1X31C 2E29A 5IS2A 4FVCA 3RRKA 3MM9A 4Z2XA 2WB4A 2E9RX 4TLQA 3GZ7A 2CRLA 1KQKA 1C4AA 2QFJA 2I2YA 3UD4P 4P74A 3NXZA 1X4GA 4OYZA 3EVOA 2XZDB 1U09A 3NNAA 2CJXB 1CJUB 1FJ7A 1AROP 1S99A 4K5SA 1NSPA 1T95A 3SDEB 5GAHI 2LEAA 3PW2A 2BJ1A 5KFKA 2BE2B 4AL6A 2MZSA 3FSIA 4ID8A 2CQ3A 2PN6A 1RSCA 3I0RB 5E3PA 1BWEA 2AHOB 4B3SJ 2EKYA 2OKQA 5AT1B 4DXLA 2A18A 1LK7A 4LF9F 4CO1A 1TK0A 3CMAS 3CO9A 2OMOA 1S6QA 2M88A 3JAMU 3FNNA 3CC7S 1S79A 5ETRA 5L1JA 1C4CA 3J81j 4IOAQ 4QYRA 3BB5A 3ADAC 3H98A 2GO9A 4PXCA 1A7GE 1EKSA 3CJRA 2KXFA 4QWCA 4B3OB 3DRSA 4C7QA 1RACB 2AEMA 2WONA 1RT5B 2VA3A 1F9EB 3K5OA 3HJVA 4ZCLA 4QYZJ 3VAGA 3H42A 3DLKB 4EO6A 4X62J 1XN9A 1REVB 3KJFB 1YZ6A 4LSNB 3A8JA 4NZ6A 4F50A 1S1TB 3J7A1 2DNPA 1Y10A 2LQ9A 2RHSB 2V2ZA 1IKVA 2O01C 2DGSA 1W25A 3IBWA 3C19A 1IQZA 4CLSA 5LXYA 2VDHA 5CQGA 1JLFB 1T9UA 3BO2A 4DQSA 3QT8A 2YWGA 2CPZA 4B9SA 2L41A 3LUYA 4M5JA 1CJTB 3T41A 2CJBA 4GKKJ 4KTQA 3JSMB 1RLDA 1Y5LB 1E6VB 2E7WA 4KHRA 4Q45A 2MKSA 2WSCC 1WI6A 2OD6A 1KNZA 4QWEA 5IT4A 5J2MB 3M8RA 2EC0A 4ECSA 4CLKA 2HFSA 4FF4A 3BKFA 2FZCB 4DN9A 2KZZA 3LGNA 2RE1A 1RI7A 5HL7Q 1YRXA 4EMDA 2XI3A 4R0JA 3CD0A 3OW2R 1R3NA 1KN6A 1EHWA 4JI0J 2HEKA 4JI2J 5GAGU 2Y9HA 3MOZA 3KK2B 2QRRA 4DR4F 2MTLA 3J7ZT 4L76A 2XWXA 2Z0GA 1B7FA 1HHSA 2DIUA 4WP8A 2BV3A 4QW8A 2I9SA 3C16A 3QIPB 3CF5Q 1OIAA 2WOMB 2VU5A 2VG7B 3DRPA 3W2VA 2NS1B 1HHTP 2IC3B 2M8HA 5B0DA 3HXMA 3OTBA 3RBDA 4UOGA 2HBYB 3ZO7A 4TU9A 2XLJA 2FY1A 4CLPA 1TL1A 4TY8B 4ZVGA 4B3MF 1O6XA 4DUZF 2P9GA 3M9NB 1QJHA 1RJJA 1S57A 1FFSB 5F0WA 5E3AA 1FNXH 2DXFA 2WVFA 2GC8A 2XCPA 2XY6A 3A12A 4USHA 5A6WA 3QSYB 4KO0A 2VG6A 3G87A 1FXRA 5E41A 5C42B 2DHXA 2MQPA 2RHQB 3C6TB 3M2UB 2W4CA 4ZCKA 4FBUA 1Y9OA 4P2SA 2B4PA 2M4MA 3RZAA 1DARA 2GJ2A 1OS5A 4WFBQ 1VBXA 1YJ7A 1FDDA 3QLHB 3I9V9 2H1YA 1FT8A 2RQCA 2JZ5A 4JV0A 3CPWR 2B7BB 2AIRB 1RT2B 4QW9A 2H51B 4NYZA 2WCXA 1MMNA 3BJYA 5EUHA 4M5NA 1XIQA 3PO5A 2DK2A 2Y3YA 1KLMA 3M2VA 2R7VA 1RAJA 3OLAA 4OJGA 2X1GA 3P5TL 3N0VA 1O51A 1C2PA 3H4BA 2UU9J 5B0AA 3R9LA 4OX9F 1MWZA 3JQKA 2QT7A 4G1QA 4CI0B 5RUBA 2ADCA 3SQGA 2XG8A 1U47A 3ZNUA 2XMVA 2JVRA 4ZVFA 1GMWA 1B4SA 1T03B 4FPRA 4LMZA 1VI7A 1Y00A 2HBQB 2BUNA 2EBGA 1PIEA 2ZH3A 7AT1B 3TEHB 5DLFA 3BDEA 4V19X 1QUVA 3GCXP 2OGUA 2JH3A 1RAFB 1U49A 2JWNA 3X1LB 3EE3A 1UTAA 1UEUA 1YDLA 4DUYF 2DR8A 1XR5A 4WXWA 1GAOA 4EBEA 2XGQA 3BREA 4NLRA 5FIIA 1LXNA 2K2PA 3JQJA 4ES1A 1BUXA 1GMWD 1LWEB 4M8LA 1NPKA 4WK3A 4KH1B 1FFGB 1XMQJ 3OXGA 3KLGA 5ETTA 2DVIA 4K2JA 3W61A 2MZQA 3IWLA 2DNRA 3EWGA 3MM5B 1N36F 4ZP8A 1SKWA 4PQUA 2HAIA 3IGVA 1M5KC 1XJWB 1YBUA 1HHQA 4FYVB 2YTCA 4YOEA 3CCUS 4OFZA 4J9KA 4H4OB 1WTFA 4OYXA 3T19A 4X4SA 2X1AA 3PTWA 2AQ4A 2CQ2A 3MGJA 4UZCA 1S12A 1NMEB 2JL9A 3KJVB 2MB0B 2OSRA 2EFPA 1JLQB 2FY8A 3M30A 4DCJB 2VPZB 3NWRA 1U1QA 3G8SA 3CXCR 2E5LJ 3IG1B 1NKEA 2LYVA 1U0HA 1TKXB 5LL6d 1RQ0A 5HJYA 3R5DA 1T9VA 3MZIA 5H1SV 2OIHA 3T6BA 3H5YA 4JI8J 2V8GA 3HHKA 3VAHA 3PR5B 1YJ9S 3DMJA 2UUAJ 3MECA 4YR3A 4ILLA 5FD1A 4IFVA 3QJPA 2HQFA 2FC8A 2RUGA 3OFGA 4DX8H 3BO4A 4DV3F 2MQMA 4JV5F 5JUMA 2LXFA 3UI3A 1JLBB 4GVLA 4FDFA 5LOQA 3A1YG 2N4DA 2PSZA 1HIYA 4Q5VA 3RBEA 5F8GA 4A8WA 4NZ0A 1U8SA 5J1EB 3OHBA 1WELA 2OHDA 1YWXA 4U96A 1JK9B 5KFPA 1ZA2B 2RMLA 3KNGA 3HFVA 1R8CA 1VHIA 1NK9A 4MKBA 2J8SA 1HQ2A 1JLEB 2HQCA 4L3NA 1DHMA 2ZM6J 1VQ6S 2OP5A 5KT7A 1F3VA 3VWSA 2VPWB 4CH1A 4AD6A 4F4XA 3HVWA 3OTCA 4Y2CA 3CDAA 3M9OB 1HQEA 4I1TA 2KZMA 1P9YA 2I0XA 2DXEA 5KT4A 3MAAB 4IFYB 2QX0A 1TFYA 3D4JA 2RNEA 4C0HA 4P73A 2RQKA 3GG1A 1H6KX 2C1EB 3A8KA 3EDRB 3NOCA 5K9FA 3GQCA 2HGLA 2UUTA 2AEJA 2MGZA 3WX8A 3MR3A 2NQPA 2HG4A 3CCVS 1VQLS 1T3NA 2G0IA 2IDLA 3EZ5A 1Q78A 1B0VA 4OZ0A 2GA7A 4DV6J 2M8DB 4FF3A 2FLLA 1IR2A 1HWKA 5LMUF 1RK8A 1WHVA 2AYMA 3M6WA 4IOCQ 2WK4A 4OYWA 2AV5A 3NKYA 4LSLB 3MTKA 4RW4A 3HD2A 4LQ9A 2ZBPA 4B17A 4DS4A 4YR0A 3PW5A 4ZOSA 4DV0F 4UUWA 1VRTA 1HPZA 9ATCB 3DLHA 1SIZA 3NNCA 5JJBA 1HWUA 1U1NA 1GTHA 2R7TA 4CM0A 3JYTB 2DYAA 1P27B 3QGPA 1PBAA 2HIYA 1R0CB 1HWJA 1XERA 4MK8A 3LP1A 3J7YU 1E6YB 1APSA 3TZYA 1ZOTA 4O44B 3DRRB 4GMKA 1Y3KA 3CMQA 1IKXA 1PO6A 1F0XA 4OI2A 2BR0A 2R7SA 1D0EA 1U6BA 1L5UA 1XMOJ 4LT6A 4QR0A 4X64J 3DLBA 4DG1A 1TMJA 1D8ZA 4X4VA 5KFFA 4Y3CA 1K1QA 1IBMF 1S9GA 2HWTA 2W4PA 4J91A 4MIAA 4V1Ak 1N0VC 5C25A 1OO0B 2OEJA 1CULB 1X5TA 2HMIB 2IJFA 2DNYA 3FEXB 2R7UA 1H98A 2CJYB 2Y1LB 4RUHA 1RGVA 5KT6A 3OL6A 1Y11A 4ED1A 1UMJA 1RBOB 3V81A 4RW9B 3THVA 3TAMA 1RCOB 3W7BA 3HHLC 4YHHF 1VYAA 2ZNYA 2ZOGA 4ZPDA 4WJBA 1YLXA 3DU6A 1ZTTA 1FVSA 5DG9A 2ZJQQ 2DGWA 3CTRA 3ZTQA 3H8YA 5KG5A 2R3VA 3IS9B 2HIQA 2CPHA 5DGAA 3AT1B 3I96A 3UNYA 4EWTA 2R7QA 2NPIA 4DQIA 2OI2A 2EPIA 4L75A 4URSA 3FMBA 2L08A 4ECQA 3A8IA 4I68A 3AODA 3B54A 3T5HA 2WVBA 2RIJA 4DX7A 2G0CA 3K5LA 3WBZA 5F8HA 4KHPF 3QYYA 2UP1A 3LA0A 1PC4A 4DJBA 4J9QA 4LF9J 4E98A 1RWKB 4RW8B 1RWWB 2GX8A 3CCWA 1G1XA 4EFAC 2CQBA 1EKRA 2ZDPA 5KAKA 3HK2A 4RU2A 1KVIA 4QIEA 2MY7A 1F2GA 3KOAA 4RWXA 4W98A 2AX0A 1S9FA 2KT2A 3Q23A 2PT0A 1OYEA 2CA9A 2BVZA 2BE7D 2M5YA 4K59A 5HMWA 3D0HE 3VAJA 2YPYA 1JLAA 5DDOC 5DM6Q 6FDRA 3CCSS 2ROPA 2DHSA 3BBFA 2IM1A 1TKZA 3C66A 3MFIA 2B4UA 1XC9A 5AJ3F 2N3LA 3MOJB 3I4HX 2NXUA 1HL6A 3M6UA 4J9VA 3N6LA 3KJQB 2V8HA 3JQMA 5BYQA 2ZH8A 1LNQA 3X3UA 2Z58B 3NMAA 2LXIA 3DHXA 3E01A 1K0TA 2V69A 2VF3A 3F44A 4TU8A 5D4NA 3DYAB 2V4JA 3H40A 1BQNA 2F5GA 3KJNB 2H3EB 4J9SA 3CVKA 2NREA 3GB0A 3D67A 1EB0A 2R8HA 3KLEB 4Y28C 3TJ8A 4C97A 1LW0A 1N5YA 3E2EA 1N54B 1U7LA 3MXHP 1SC6A 3UR3C 3EDQB 2LKZA 2FHJA 1QE1A 3DKDA 4G65A 1NRKA 3IM9A 1VISA 1LKZA 4EI2A 3OQ2A 4CLZA 1QTMA 3RTVA 4LF5J 3UNGC 1H2UX 3UD3P 3A3NB 2ATLA 2HW3A 5D8HB 3K0JA 3MEEA 1VQOS 3LOUA 2DCLA 3CJKB 5DZ7A 1SUQB 4OLPA 1DTQA 1JLCA 5HJXA 2XZWA 2FJEB 3HCXA 3HT0A 3OBIA 1HQUB 3VF0B 2RDJA 5KOWA 2FHJD 3PVXA 4AQYJ 4O3PA 1K47A 4HTIA 2YNHB 1OQ6A 3TWZA 3TA1A 1WJ9A 1WF1A 3RU0A 4K4VA 2R2RA 2GCFA 3THPA 2ZH5A 1TMMA 2ZH9A 5CD4H 5F41A 1HWLA 3H2LA 2IJRA 1KTVA 4I2PB 1HARA 1TUGB 2GVDA 1NEEA 1JLGB 3TO8A 1TKTA 4WE1A 5IFMA 1S0VA 1S7IA 1HNXF 1NHVA 2WZ1A 4DPTA 2WRMA 5JVHQ 3U1MA 1M0SA 2R2UA 3ITHA 4B9NA 5E0OA 7FD1A 2CQ0A 2ADBA 3R5AA 2GO8A 3ENAA 5F3TA 3T1HF 1FA0A 4IQMA 1LWCB 3L4BC 4C3KA 5DRKA 5A8KA 3AA8A 1UZDA 1NZAA 4ED7A 4ZDNA 2DGXA 2ZKTA 3WHIA 2DNLA 4IOBA 3VVTA 4HACB 2JOQA 4IO1A 3BR9A 3BF4A 4X4RA 3MEGB 2LDYA 2JFKA 4DR2F 3MR6A 5DGBA 4KB7A 3I56S 2P2CB 1RB0A 4CTAB 5JXSA 1HNIA 5MLCV 1LW2A 4J90A 1CC8A 4PPDA 3AFGA 2BDPA 2POKA 5CCMA 5I3UA 1AZSB 3NGTA 4OX9J 4Q44A 5KG4A 4TN2A 2V9KA 1FWPA 4WFZA 4TNOA 2ZBRA 1CJKA 2Q79A 1QSYA 1FRHA 1JJ4A 4R8UA 1RA7A 3KK1A 3RBZA 4DL0C 2LA4A 4H4MB 2XMTA 2UXDF 3AY0A 3ZZUA 3S01A 1BQMA 4HT5A 3Q8PB 4D3HA 5HK4A 2V8VA 1KBRA 3Q8UA 3OR1B 2YQ1A 3QFWA 4DUYJ 4CZCA 4JV1A 3EGZA 2IPOB 1XMBA 4F0KA 2ZNZA 4NA3A 4I6WA 4ZVHA 1SC3B 3A3OB 3M8YA 2GFFA 3FUYA 2AP6A 2BMBA 4HI1A 2HSEB 3KLHA 4RL1A 3DOKA 2ZDOA 4L73A 4PR6A 1IJEB 4J9RA 1UAWA 2LP4A 2ZUGA 1YBAA 2BJ9A 3EX7B 3FBFA 1X5OA 3I55S 3VAMA 4ZHRA 3OJUA 1JXLA 2VKZG 3UQSA 2HWHA 1WNEA 3PRDA 2GV1A 4CO3A 5D77A 2PE8A 1Q1KA 1SH2A 5KFSA 3H20A 4ICLB 2YWKA 4OV1A 3IC1A 3V6DA 1H73A 2MXYA 2BJ3A 4KYZA 2ZE2A 3BGRB 3R5GA 2U1AA 4I6YA 1OSDA 2GVZA 3G8QA 2HK3A 4OIXA 2F1FA 5AE1A 2VJVA 2J6SA 3HJFA 1R0AB 2Y1JA 1HBNA 1KRPA 4LVNP 4FYDA 1OSCA 2OELA 4LF7J 4FBTA 1SJQA 2QSFA 3CCRS 1L3VA 2QA4S 5GAEU 5F9NA 2AGQA 3FCVA 2FLPA 1KKHA 4CNYA 3AB2B 1SIWB 1Q8IA 2R7XA 2MJNA 4OYBA 4IRDA 2JHEA 4KV8B 3PJ9A 3LWMA 4N76A 5HANA 1KP6A 3G4SS 2J7UA 3DDKA 4F2RA 1BQXA 3MR5A 4JV5J 4NOHA 1NK7A 2HZAA 1VIOA 5IT0A 4ID5A 2ZHOA 4USJC 3CJ4A 2PD1A 1U24A 1RT4A 4PG4A 4K8RA 2BM0A 4EYHB 2NR0A 2UXCF 1K44A 2PO4A 2QLXA 1JXVA 2J9DE 3IAS9 5K20B 1M1HA 2NYIA 2XLIA 1H72C 4MYUA 2C42A 5G4DA 2E1RA 2WAQD 3RR8A 5L1LA 1IWGA 5SUHA 3Q8QB 3MM9B 5HO4A 1S1WA 3C15A 1WORA 1WKKA 4DV4F 2DGQA 3DXSX 3MURP 2AJ4A 3CNQP 1VQPS 3SEOA 4Y2AA 1R8BA 2VFVA 3MM6B 4C2MA 1TTHB 3GFHA 1YZ7A 2F9DA 3VALA 2BKNA 1NU4A 1IXKA 3MDFA 4DF4A 4NI2A 1NAQA 3Q8SB 3FCWA 2IMWP 4ZPCA 2BKPA 4RX6A 5DETA 3QNWB 3HHLA 3ISND 4DQPA 1DLOA 1Q7LB 1S6QB 1UJ6A 3D1QA 2HRUA 3DLGA 3HKWA 1D9DA 4RKUC 2W25A 3DGPA 1VQYA 5DZ6A 3L9ZA 3M6XA 4JI3F 2D1CA 3QT5A 3DRSB 2IYIA 5LXRA 2WONB 1VBKA 2MQ8A 2DPIA 4USIA 3DRYA 1CS4A 3C14A 3MTJA 4J9NA 3H90A 1TL4A 2E44A 2FGCA 4NLOA 4IH7A 2FD2A 3PM9A 1ZAVA 2WSEC 3ILJA 3CULA 2HHSA 2VC0A 2VQFJ 3IM8A 1PCAA 1RHJB 2DGUA 1HI8A 1IKVB 2W9BA 3I32A 1CVJA 1Z2ZA 4KE5A 1ROFA 3R27A 2Z4PA 4IKAA 2IBKA 4MT1A 1WOPA 3PYEA 5L38A 1P1TA 1WACA 6FD1A 1YRUA 2J7KA 1AB8A 2VQEF 5ADZA 3BPDA 3TJ9A 2EEYA 1J5EF 1B0TA 3FFIA 1SL1A 3ULHA 2M9KA 2GAGC 1HI0P 3HULA 3CCQS 3PKMA 3OVSA 4Q0BA 5KFAA 1IBMJ 2L9NA 5C5JA 4EO8A 1N5SA 2ZEJA 4NX9A 4OI6A 2D41A 1UVMA 1RA6A 4DLGA 1H74A 1KTQA 2JJ4D 3PG9A 2VICA 2W2OP 2FLNA 3I0SB 2CJAA 3AAWB 3SSSA 3CCMS 2EXUA 4L74A 1VDHA 1RAGB 3MM8A 2CNOB 2EKNA 1DQ8A 4C11A 2NLWA 1ZM9A 2VL1A 4C8OA 3ZZTA 1MNEA 4CDIA 2P9EA 1WC6A 4ED8A 1N5VA 1F5BA 2XQCA 2NSBA 2WBMA 3EJMA 3C16B 1GT8A 1IBCB 2HHQA 1Q5YA 2FVCA 3D6MB 3DRPB 3W2VB 4IR9A 4F3OA 4M5GA 2E1MC 3RRGA 4DU8A 1X5SA 1TL1B 3QJLA 3A13A 1OYDA 1VLYA 1N6QA 4DMZA 1U0SA 4KHPJ 1SC1B 2V68A 4K4WA 2F65A 3PIOQ 2Z57B 1IM4A 3J7Z5 3T5JA 1VQ5S 2MHNA 5A8WA 1SL0A 1R31A 4ZN1A 1QVGR 1NDLA 3QIDA 1YI2S 4ECZA 3NCRA 4LFBJ 3PW4A 2WSFC 1SBRA 1ZM2A 4KO0B 3HSJA 2HFNA 2VG6B 2CPJA 4OX6A 3R6GB 1Q7YT 3CB4A 1CG2A 4A8SA 3IRXA 2ZH2A 1N33F 4NEZA 3OT9A 3P6YC 3M32A 5FDLA 2CVEA 2WW8A 2CPIA 3FRZA 5CHCB 4ALZA 3SFUA 1MWQA 4RPFA 3BSNA 5A8RA 2KVIA 1TL3A 3N79A 3H0PA 1VLOA 4EK2A 3FDSA 4I4BA 3HMJG 2LQJA 5AJ3J 1D1UA 4K0KF 3EPGA 3SBMA 1R89A 1YX2A 2V67A 1KLMB 1TR0A 2OUGA 3M2VB 4ZA1A 9RUBA 3DHWC 2GAHC 2K7JA 3QSIA 4ZJLA 4LRAA 2MHEA 2QZ8A 2IFXA 3GV8B 1U2CA 4NA2A 2DGOA 4G1QB 2ZZNA 3SQGB 4P10A 2YPZA 5HROA 3ZZOA 4NLUA 3CD5A 4NLGA 1VQNS 5I42A 3GV7B 3U1NA 5F8NA 2GQ2A 1I51B 1X4CA 2DXDA 1FI4A 1RCXB 1XEZA 2HS0A 1ZS6A 2LLZA 2NXEA 2DGTA 3OTOF 2W2QP 2O5DA 5DO2A 2YWHA 2ZH4A 3RW7A 2LFVA 3L09A 3LAMA 2LQ5A 3HVRA 2JSXA 3LW5C 4OL8A 5BR8F 3E8OA 3K5PA 5EGYA 2BRLA 3EM1A 4A4JA 5EX0A 4Q2LA 3KLGB 1IKWA 3U02A 3MMCA 4X4TA 2CQIA 1VRUA 1R8PA 3PW0A 2HGMA 1KSPA 4DL6A 1RWMB 2BJEA 4PQUB 2PA8D 5B0CA 1LV5A 4L72B 4I7FA 3GMGA 3BBBA 5IXUA 2G2ZA 2LDIA 3PEJA 2OPQA 3T1YF 3K59A 3FCHA 3PHEA 3B78A 3T9ZA 4HH1A 2R8IA 3KLFA 1YJRA 3BSOA 3CE8A 1DQAA 2K3IA 3M30B 4XDCA 1RE1B 4ECRA 1P9QC 4OI4A 4PG5A 1HI1A 1U0HB 2L3MA 1H38A 2IRXA 3JSBA 2VKRA 5L39A 5L1KA 1KQSR 2IY5B 3NGDA 5KFDA 1HNXJ 3NRBA 4XK8C 2IA6A 4PWWA 2H5IB 2BKOA 1YBTA 1G2EA 3MUTP 1RWUA 1BC6A 1UWAA 5C2CA 2CPEA 2HQIA 2PI5A 1S0NA 1S48A 3DMJB 3MECB 5F8IA 2DNQA 1KR4A 3T1HJ 1PKUA 4IFVB 5CYMA 5CAAA 1OQ3A 3SV4A 2VFSA 2IM3A 4RJVA 1RBAA 2OO4A 4ZVRB 2NUUG 4F36A 2B6AA 2DTJA 4RW8A 4B3RF 2WHOA 3P96A 1I6JA 4QBUA 4DFKA 2PA3A 2OD4A 4DR2J 3VGUA 4DF8A 3M8QA 1QTNB 5DDPC 1I94J 4IH6A 4LRFA 2DY1A 2M3DA 3P3DA 4DR6F 3F0NA 3UFCX 2FDNA 2ZD1A 3TQEA 4QPXA 2ZBIA 1XR7A 4ELTA 4NA1A 2V4RA 4ECYA 2VDIA 3NAHA 4F4KA 1N5TA 1VK3A 3FQKA 4Z7CA 1S77D 2UXDJ 4FN5A 2RB7A 4QPTA 3HHEA 3BGOP 1HQEB 2QGFB 2XULA 4X4NA 2Q6BA 2GMLA 1RTHA 4ELUA 5I3PA 2K3KA 4RUBA 4PKDB 5KFGA 3LO3A 2HRTA 2YH0A 3LF0A 1WSVA 1FTRA 2VODA 4B3TF 3T5LA 5B09A 2UU9F 1KQGB 4C3MA 2R8KA 2MGZB 1Z1ZA 1QSSA 2JVOA 2RD5C 2HFVA 1TVRA 3H5XA 4TQSA 5GAHU 4U8VA 1TQLA 1Q79A 2ASLA 2HNZA 4ZS6A 4F0MA 4OI3A 2L48A 1U1OA 3PACA 2RQ4A 3R8YA 3Q8RB 2AMCB 3RW6A 4FZVA 2MYFA 5DM7Q 3T5KA 2UV8A 1PGZA 2EFNA 4RW4B 2DR6A 3HHNB 2YVSA 5F9LA 2EI5A 3U7JA 3AQPA 1Q8LA 3MCSA 4LF6J 1Y7PA 2D9PA 2QLJB 1VRTB 1XQIA 4AYBD 3MCNA 3I5AA 3AHPA 2VASA 3LP1B 2XI2A 1OY6A 1EETA 3CC2S 3HLUA 1S0OA 1CBKA 2J0WA 1BD6A 2KYZA 2RVJA 3TANA 5U47A 1WI8A 2RKIA 4UY85 1IKXB 3LAKA 2QN6B 1RAIB 3EVWA 1Y5IB 3BS9A 4KPYA 1C1BA 4FVMA 4LBHA 4OJHA 4NXNF 1UVJA 1TZ0A 3CMES 1S9GB 2XHWA 4BWMA 3U27A 4C48A 3BZQA 5C25B 1BLUA 4LVOP 3LQVA 3MI7X 3LWLA 1U4BA 4RW6A 1DAXA 4EZ6A 3R5CA 3BQ2A 3L7PA 2JC1A 3MPYA 3GONA 2Q43A 5HVGA 4OYIA 1YJVA 4PG7A 4DV2F 2ZZMA 2R7RA 4UW2A 3V81B 2OPPA 2CPXA 3TAMB 3ENWA 2XB2D 2WVCA 1M5PC 3J81U 1RT3A 2A2CA 1KOHA 2KT5A 1GQEA 3UDEA 2IVMA 4NLTA 1REGX 4A8XA 2HS4A 3L7UA 1QD1A 4KBIA 1JMTA 5A6PA 5DQGA 1JX4A 4DL7A 2RU9A 3OFEA 2CQGA 1JJCB 3OXLA 3W5YA 5D0EA 4M94A 3DI6A 3NS5A 1GX6A 4A47A 1XNRF 3TZXA 3SSQA 2V2KA 4PPZA 2IDEA 2V0NA 3FGVA 3V4IB 3M8PA 1NJXA 4U7UD 2FTRA 1TL7A 4RBUA 1SQFA 2SXLA 3H59A 3HHDA 5L9XA 3BSCA 5KG3A 5E7OB 5A2QY 4TVAB 2DRDA 4JI3J 4F4ZA 2G4BA 4NLYA 4YUDA 1D9AA 2NXCA 3O3LA 2PMZD 1Q0NA 1VC5A 2X1FA 4DCPB 3GFYA 1JLAB 3CCTA 2HZCA 3HD1A 3TZZA 5E3QA 1UW9A 2XGPA 1IBKF 1NLKL 1LFPA 2G0JA 1NDKA 1KOOA 4URGA 1M1GA 3M1VA 1TKZB 2XYPB 8ATCB 4A8FA 1S72S 1UVLA 4QU6A 2QMWA 5LSLA 3AOBA 1ZH5A 4DV6F 4GO7X 5ETOA 2ASJA 1FJEB 4FKXA 2CKWA 1U1MA 2ZVIA 4MAKA 1WHYA 4RBTA 4QWDA 2QMXA 1LFWA 3W65A 2ZH7A 2B9WA 2VQEJ 4YR2A 1R43A 1SV5A 3ZTOA 1WKLA 3QO9B 4ZN3A 3W64A 1J5EJ 1UETA 3AJDA 3KXDA 3E01B 2CIMA 1UW4A 3NAIA 1HNVA 1VBZA 2V4JB 1BQNB 2XMKA 3T3FA 3OTDA 4Y6IA 3BGRA 4PABA 3K7RA 3ET6A 1D8YA 3OL7A 3EXYA 1LW0B 1N5YB 4NLDA 3GR0A 3SFGA 2KJWA 5K8NA 2V94A 4RR5A 1QE1B 4OI0A 2BZ2A 3K58A 1IR0A 1QAXA 3LPEA 2MQNA 4XTTA 4P71A 2WBRA 1F1BB 2MKKA 2J6UA 3D3BJ 1IVZA 1RTJA 1AFIA 1WDDA 1S0MA 4B02A 2HVEA 3MEEB 2HHVA 2W2MP 3HF5A 5BJRA 3SCLE 1DTQB 3NEKA 1JLCB 3OR2A 5BXIA 5H9FJ 2B43A 5HN0A 5HMYA 2HVDA 2KI2A 3KFWX 3Q83A 2QMUB 3GP9A 3HZEA 3P45B 4LJMA 3LGHA 1HW8A 2NPFA 4ZIWA 3AQOA 1N56A 2QO3A 1CJVA 5IQQA 3GJTB 4QJVA 4BCAA 2JEGA 1CC7A 5D0RA 5HMZA 4RNOA 5KG1A 5LSRA 5KFIA 3W60A 3DLEA 3PFEA 4WU2A 2GVDB 3OXFA 5ETVA 2OJ3A 4LF4F 1TKTB 2CDQA 4WE1B 2YKNA 2VB6A 2DNGA 5CH7B 2BJ7A 3MM6A 2EC2A 3M8SA 3BKUA 4BC9A 1N33J 3R3TA 2ZKUA 2DCUB 3TNVA 5CD4A 2E5JA 3ITHB 1J5OA 3B8HA 1S1VA 3HO1A 5H9FK 4P9SA 4ED4A 4V19J 5A8KB 4IO9Q 3IBFB 2KL8A 2E5IA 2XO7A 2CJ9A 2MZ1A 2C2RA 1UA1A 2X51A 4K0KJ 2EWHA 1ZPVA 4L3KA 2BX6A 1CSJA 1KHWA 1DRZA 5G0RA 1EARA 4C98A 2W8KA 1HNIB 4QZVB 4WYLA 1S6OA 4OZLA 1LW2B 2DNMA 3O8WA 2EG1A 3D0GE 5I3UB 3HSDA 5HBMA 3QT6A 2ALZA 1NH7A 1V9OA 1CJKB 4ZVPB 3R1LA 2OFGX 1WTBA 3HFZB 4X2BA 1TK8A 4R8UB 2B7CB 1YSJA 3KK1B 4CYUB 2HVZA 4NYPA 3GIKA 3EZOA 3NOGA 4MH8A 1F9FA 2KHDA 3OTOJ 1BQMB 2NYHA 3HVAA 5GMEA 4N7TA 5MAOA 3UE2A 3IP0A 3MAQA 1F2HA 3DNCA 3ENVA 2CUYA 4PG6A 4UUXA 4WXOA 2QFIA 1ZTWA 5BR8J 4LRDA 1DURA 4DHVA 2FJXA 2M70A 5A2QU 5E2QA 2VONA 4ZIVA 3KLHB 3DOKB 2X3GA 2J0XA 3MCMA 2DO0A 4LUBA 1FDAA 2C3OA 1T9XA 3L3CA 3H4DA 1U45A 3UN3A 4ZHRB 3EZUA 2BM1A 2GHPA 3BQ0A 4G1PA 1WHXA 5CYQA 4CH7A 2FVQA 5EHHA 2Z56B 3T1YJ 1MG7A 1RAOA 2BEFA 3AXKA 3I0SA 3V6DB 1U1PA 3SQOP 2PC6A 3LALA 3UVJA 3RAMA 1S9EA 3ZZPA 1WKJA 4WTOB 2DNOA 4USTA 4GRSA 2ZE2B 4DR3F 4HL9A 1JNZB 2GVZB 1HW9A 4LF5F 3ZFVA 2COLA 5F8JA 3NG8A 1LWXA 2QG9B 3GPAA 1HBNB 1T02A 3S1TA 1SI9A 3VTIA 3W2WB 2DT9A 3DRXA 1W2IA 4DPWA 3FSYA 5A0YA 3BGLA 1TELA 1QAYA 1JKHA 4JI5F 1TL5A 4MFBA 3D28A 1S76D 5L9NA 1OY8A 1SPBP 4DFJA 2LECA 4AQYF 1X60A 1AYEA 1WOOA 3MEDB 1DTTB 4N41A 4X65F 2H54B 4NWBA 4B9VA 2BQRA 5B0FA 4WKRA 4D3GA 1ZM3A 2DIVA 1S4EA 1N4LA 4ZVEA 1U6FA 2Z2ZA 1OPZA 4ID5B 1RWXB 1SQEA 2ZHAA 3KHLA 1JXEA 5C7PA 4ILRA 1M5OC 4B3RJ 3PYDA 1RT4B 3LH2S 4LRBA 4O4RA 3MD1A 1RZMA 1NJYA 1V5VA 3H5SA 4YMEA 4YB1P 1M5HA 3HFKA 4I0WA 3LPYA 5IM0A 4DR6J 1FKAF 4DR5F 4U8YA 4WP3A 2V63A 1EIYB 1S1WB 1VCTA 2YKOA 3C15B 4RO0A 5DG7A 2AJ1A 4ECTA 4BDPA 3JSYA 3IN5A 5FLXY 3TP2A 3N6NA 2AKWB 2NUHA 3CUNA 4U7UK 3NMRA 2AF6A 4OHWA 1WD6A 4CLFA 3ZTPA 5DLGA 3CCES 4P2XA 3N01A 1YIJS 3OVAA 3OV7A 1UEKA 2OPSA 5T41A 5C24A 3A3PB 3ONQA 1CPZA 4I69A 3ZZYA 2D7SA 1FK9A 3D0IE 5J2QA 4NI2B 4DSEA 1TAQA 3MPVA 2EFGA 2FHMA 3WDOA 3VV2B 2WW4A 4UT4A 3CW2C 4NASA 3GYNA 2E1AA 4B3TJ 2HFZA 3HHLB 1DLOB 2OH2A 4JI4F 4USWA 2YBVA 1UCNA 3DLGB 2LXUA 2YKMA 3DGPB 4OX8A 1HBOA 4CO0A 1RU1A 2BE9B 2MLXA 4Y2IA 5F8MA 4FP9A 4OHVA 3D6FB 4JI7J 5KFOA 1Y4ZB 2J9DA 3PRVA 3RB3A 4CO5A 4LSZB 1RKIA 3NGUA 1YJTA 2CQCA 1CS4B 1LQ9A 3C14B 5D4LA 4IDKA 5H9EJ 5DDQC 3R7SB 1FXDA 2KTQA 4FNIA 4HDHA 2AYEA 4CO2A 3TAQA 2C2NA 3PJWA 4ZVQB 2VBWA
chains in the Genus database with same CATH topology
3AJ1A 3VALA 2IYGA 3JTOA 2DO4A 4KV8A 3ZZ0A 4X4QA 4CO4A 3MFHA 1XMOF 2MPUA 2Z2LA 3WZ0A 3ZZRA 2N82B 1NU4A 5EWFA 4X64F 4GC6A 2JC0A 3GSDA 2W9BB 1IXKA 5T7LA 3EXCX 3MDFA 4DF4A 3DFEA 3IXQA 2J0QD 1NAQA 1RT7A 3BGUA 2G13A 1X9WA 3Q8SB 2IMWP 3C6UA 4ZPCA 1FCAA 4RX6A 5DETA 2Z8QA 1Q8BA 3HHLA 1AXQA 3ISND 2YX7A 4ZK7M 2QE5A 5EWEA 5KG0A 4HKQA 4M5DB 4DQPA 4ECWA 1SL2A 3CCJS 2YY3A 4QR2A 5D6GA 1DLOA 2M52A 1RTIA 5DQHA 1URRA 1Q7LB 1R6YA 2RRNA 3G8TA 1S6QB 3U1LA 3H2VE 1UJ6A 2UZAA 3DM2B 3D1QA 2D3UA 2HRUA 4NRTA 3DLGA 3DDNA 3HKWA 3V4MA 1IBLF 1D9DA 4OX7A 1K1SA 4RKUC 3FFIB 3SZ2A 3V6KA 1U25A 1SKRA 2W25A 4QIVA 5B0GA 1X0PA 1VOMA 3FRYA 1YTYA 2BRKA 3DGPA 3N28A 4NMLA 1N52B 4F2SA 2M2BA 1VQYA 2W4DA 1XBWA 3M6VA 3OL8A 1T7PA 3AA9A 1U1KA 3HVTA 3M6XA 4Q0BB 2E29A 4JI3F 2N4CA 5IS2A 4FVCA 2PGCA 3RRKA 2D1CA 2J9CA 2IAJA 3DRSB 1C1CB 4FS2A 1YVFA 1TV6B 2CQPA 2IYIA 3MM9A 2WB4A 4Z2XA 5LXRA 2Q1LA 3E3XA 4TLQA 1K9MT 4NYOA 2E9RX 2WONB 2CRLA 3GZ7A 1KQKA 2J76E 5CZXA 1C4AA 4N8OA 2XS5A 4HLBA 2QFJA 3MM7B 2DPIA 4USIA 3OUYB 3SCJE 2I2YA 4P7TA 3UD4P 2KO1A 2MQLA 1S1XB 3DRYA 1RP5A 2W7PA 4ZCIA 2HHUA 3MTJA 2B3TB 4J9NA 4HT7A 1TL4A 1X4GA 1M1KT 2E44A 5F3ZA 2FGCA 4NLOA 2BQ3A 3C8YA 1U09A 4IH7A 3NNAA 2IM2A 1UKUA 3MM8B 2FD2A 3PM9A 3SXLA 1ZAVA 2WSEC 5KG6A 4LF7F 1AROP 3CULA 3QZ8A 4C11B 1S99A 4OLOA 4K5SA 3D1OA 1T95A 5K8OA 1FKOA 3SDEB 2HHSA 2VC0A 4C3LA 5GAHI 2ZJRQ 2LEAA 5KFZA 4HEA9 4K4SA 1CQMA 3PW2A 1FEEA 5KFKA 2BE2B 4AL6A 4YEAA 4KIAA 2MZSA 2DGUA 2HHPA 3FSIA 1HI8A 3BN7A 4ID8A 1IKVB 2E1CA 2W9BA 4B9LA 3I32A 2CQ3A 4JOUA 2PN6A 3I0RB 1CVJA 1Z2ZA 2B0GA 5E3PA 2YX1A 5KFWA 4KE5A 2DR5A 1BWEA 1ROFA 2EKYA 3R27A 2IRUA 2KHCA 2MZRA 2UUWA 2Z4PA 4IKAA 3C46A 2IBKA 2OKQA 4FXVA 5L38A 1IJFB 1VIXA 2QLWA 1P1TA 1WACA 6FD1A 1YRUA 2A18A 1ZAWA 1LK7A 4LF9F 3CDEA 4M5DA 4IYQA 3TRGA 4CO1A 2J7KA 1X0FA 1TK0A 3CMAS 3CO9A 5DDRC 1HA1A 3TUJC 4NCGB 1IKYB 3MUMP 2VQEF 2JX2A 2OMOA 1S6QA 3IR7B 2M88A 4U7CA 5ADZA 3DM2A 2ACYA 3FNNA 4N47A 4IRKA 1SH3A 3CC7S 1S79A 1J5EF 5L1JA 4UOCA 2XS2A 1B0TA 3QGIA 2DH8A 1C4CA 1LK5A 3FFIA 2CQHA 3NLCA 5EN1A 5HI7A 1SL1A 4IOAQ 1BY9A 3BB5A 4QYRA 2CJKA 1GXLA 3ULHA 2K7KA 2M9KA 1FF2A 5DQIA 3FSXA 3H98A 2GO9A 1WG1A 2DNZA 1HI0P 2ILYA 4PXCA 3CCQS 3PKMA 1N8RT 4KT0C 4XAKA 3OVSA 1N6QB 4Q0BA 1A7GE 1Q86T 2KXFA 4QWCA 5KFAA 3G9CA 3QWUA 3NNHA 4B3OB 3DRSA 4PRFA 4C7QA 1C1CA 2L9NA 1TV6A 4QQBA 4R0EA 1VFJA 4QWBA 4EO8A 1N5SA 1WEZA 5C5JA 2WONA 4NX9A 4E8UA 2MKIA 2AX1A 4OI6A 2D41A 3MM7A 1UVMA 1RT5B 3B4MA 2A1BA 3OUYA 1RA6A 5LJ5Y 4DLGA 2VA3A 4PXEA 1KTQA 2JJ4D 5M2PA 1S1XA 4ETXA 3K5OA 4ZCLA 4QYZJ 5A8WB 3CJ2A 2VPXB 3VAGA 2FLNA 5B0EA 4JI7F 3I0SB 4BBYA 2CJAA 3AAWB 3SSSA 4DS5A 2DNNA 3DLKB 2GMJA 3TW0A 4EO6A 3CCMS 1XN9A 1REVB 2YQ3A 2VA2A 3MD3A 3MM8A 3N6MA 1Q82T 1DQ8A 4FNHA 4Y34A 4Y65A 3I9ZA 5HLFB 1FRJA 4C11A 4LSNB 2NLWA 4DR7F 1ZM9A 2LU2A 4ECXA 2VL1A 3SDEA 4NZ6A 2KXHA 4F50A 3KMSA 2AYBA 1S1TB 4C8OA 2DNPA 3J7A1 2BE2A 3ZZTA 1MNEA 1HFEL 2LQ9A 4IG0B 4ES2A 3PX6A 4RZRA 1IKVA 4F3MA 5SZTA 2P9EA 3ISZA 3VAKA 4J9OA 3IRXB 2O01C 2DGSA 2JLEA 4NLVA 4ED8A 2XSFA 3FZ2A 3I0RA 1N5VA 1W25A 4EU0A 1F5BA 3FZBA 2C3PA 3IBWA 3M32B 4N8NA 5FDLB 1VC6A 4O3RA 2NSBA 1IQZA 2WBMA 5LXYA 4KFBB 2BW2A 2B9XA 5CQGA 1JLFB 3ICLA 2KN4A 1GT8A 1K73T 3BO2A 4DQSA 2R7OA 1Q16B 3QGHA 1T05B 2HHQA 4HTJA 1QUPA 3MUVP 3KYLA 2FVCA 3DRPB 4JYAF 2YWGA 2KM8C 1FJGF 3W2VB 2CPZA 1ZM4A 4NCGA 4B9SA 1IKYA 2EVZA 2J5AA 4IR9A 2AJQA 4F3OA 2MKJA 1JJ2R 1ZPWX 5A8RB 2L41A 1VHFA 3LUYA 1TL3B 2DH9A 2E1MC 4AE5A 4J9PA 3RRGA 3I31A 4RNNA 1X5SA 2CJBA 4N77A 3EPIA 3PFOA 3PXGa 1NKBA 1TL1B 4KTQA 1F5AA 3JSMB 3QJLA 1Y5LB 2FIUA 1VLYA 1N6QA 3L7OA 3S8SA 1E6VB 2E7WA 4DMZA 4KHRA 2BBEA 4B3OA 4ZKAA 4Q45A 2YWEA 5IWAF 3GFXA 2DD8S 4K4WA 1R8AA 5LSOA 1RTDB 3PIOQ 3FQLA 2MKSA 5E33A 2WSCC 1WI6A 1RT5A 2OD6A 2GQCA 4OI1A 4CQ1A 2P5VA 1IM4A 1ZAXA 5IT4A 2GHWA 3J7YI 4QWEA 1KNZA 3J7Z5 5J2MB 2N7CA 3M8RA 2EC0A 4MJKA 3T5JA 2CG4A 1VQ5S 4ECSA 1C0UB 2MHNA 1EP4B 5A8WA 1IN0A 1SL0A 4FF4A 4DN9A 2KZZA 1R31A 3LGNA 2RE1A 3JSRA 3DLKA 1RI7A 4RNHA 1QVGR 2AWZA 4WU3A 2DHAA 2QYCA 2Y1RI 3QIDA 1REVA 5HL7Q 2YH1A 1YI2S 4ECZA 1YRXA 3NCRA 2XI3A 4NPOA 4R0JA 3PW4A 2WSFC 3CD0A 2F4VF 5HLFA 5HROB 1NKCA 3OW2R 2VBYA 1R3NA 1SBRA 4LSNA 1KN6A 1ZM2A 4KO0B 1URNA 1XTZA 1NK8A 2HFNA 2VG6B 3UW1A 4MKYA 2CPJA 1SH0A 4OX6A 1SJFA 4DQQA 2HPUA 1S1TA 4H4KC 5I42B 2XCAA 2XS7A 5GAGU 4ECUA 4IG0A 1QM9A 1Q7YT 3MOZA 3KK2B 3CB4A 1WWHA 1CG2A 2QRRA 4A8SA 3IRXA 4DR4F 3J7ZT 2ZH2A 1N33F 2VQFF 4KKOB 2XWXA 2Z0GA 3P6YC 3M32A 5FDLA 4ATNA 5AXLA 1B7FA 1HHSA 2DIUA 1TKDA 2BV3A 4RWWA 2CVEA 1FKPB 2WW8A 2CPIA 2V8DA 4KFBA 4QW8A 3CD7A 1UA0A 2KT3A 2I9SA 3QIPB 1JLFA 3CF5Q 3FRZA 3KHGA 4XPCA 1OIAA 1T05A 4JUZA 2WOMB 2J8AA 4Q2MA 4I56A 2VG7B 5CHCB 3DRPA 3ZZZA 5KFNA 4P6QA 4ALZA 3W2VA 1MMLA 2NS1B 2CQ4A 1HHTP 4WFNQ 4CCHA 3IRWP 2IC3B 1J2VA 2M8HA 3SFUA 1VQKS 5B0DA 3M05A 3CGIA 3BSNA 3HXMA 2R4FA 5A8RA 2KVIA 3OTBA 4O4GB 1PILA 5BYSA 3RBDA 1N34F 1TL3A 2FHKA 4TU9A 3N79A 2XLJA 1GXTA 3KWMA 2FY1A 2FJDB 3DOLB 3FDSA 4I4BA 3HMJG 1TL1A 3JSMA 4A8MP 2LQJA 4TY8B 4ZVGA 2YNGB 4NRUA 4O3QA 1D1UA 4K0KF 4B3MF 1UVIA 3EPGA 5THWA 1E6VA 1R89A 4DUZF 2P9GA 3M9NB 1QJHA 1OPIA 1IKWB 2ERRA 3MMCB 1KLMB 1TR0A 3M2VB 4ZA1A 1VRUB 4N56A 1RJJA 1KD1T 1RTDA 3PJXA 3DHWC 2K7JA 5I4MA 2EFQA 1D9FA 5F0WA 2IRYA 4AL5A 2QV6A 5E3AA 5J2MA 1FNXH 2MHEA 3DC2A 2QZ8A 1UVNA 2LA6A 1C0UA 2IFXA 1EP4A 4K4XA 3GV8B 3LGMA 4NA2A 1DJ0A 3V2UC 2DGOA 4I7FB 1T8EA 4JV2A 4G1QB 2IA0A 2ZZNA 2A3JA 2GC8A 3SQGB 2XCPA 2ASYA 2XY6A 3Q2TC 3OTEA 4BHQA 4USHA 1A9NB 5A6WA 2QA4G 5HROA 3ZZOA 4NLUA 2OPQB 3CD5A 4KO0A 4FF1A 4NLGA 4HVZA 4Y00A 1LXJA 2VG6A 1VQNS 4ES3A 1FXRA 1Y3JA 5E41A 1FRMA 5C42B 5I42A 2UVVA 2DHXA 2MQPA 3GV7B 3U1NA 3MHYA 5F8NA 3KK2A 4J9MA 2GQ2A 2L9DA 1X4CA 4WK1A 3C6TB 3KLFB 4RNFA 1XEZA 2HS0A 3TI0A 3M2UB 2GJIA 2W4CA 2ZC3A 2LLZA 5DS7A 4ZCKA 3I4PA 4FBUA 1Y9OA 4P2SA 2B4PA 4FS1A 2YNIB 2YX4A 2DGTA 3OTOF 2M4MA 1FKPA 3MMAA 2UVRA 3RZAA 3M9MB 1H0HB 2O5DA 1DARA 1L3UA 2GJ2A 1VQ4S 1OS5A 4WFBQ 5DO2A 1VBXA 2VOPA 2YWHA 3QIPA 3OFHA 3QAUA 3K2YA 2WOMA 3DOMA 3G6YA 1FDDA 2ZH4A 2VG7A 3QLHB 3RW7A 3I9V9 1GNKA 4G1IA 2CFXA 2IC3A 2XWYA 1FT8A 3L09A 3LAMA 2LQ5A 2RQCA 2JZ5A 3HVRA 1H7WA 4DSJA 4O4GA 4JV0A 3CPWR 4I6AA 2B7BB 2JSXA 3LW5C 1NB7A 4OL8A 2W7AA 4MIBA 5BR8F 1RT2B 3E8OA 3GILA 2Q3PA 4QW9A 1HYSB 4KQZA 1MW7A 3DOLA 2FC9A 3K5PA 5EGYA 4KGMA 4NYZA 2WCXA 3M2RB 2BRLA 4TY8A 2CVIA 2YNGA 4Y2KA 3CJ3A 4A4JA 1MMNA 3PY8A 2QA2A 4Q2LA 4X84A 5EX0A 5F0UA 3KLGB 4C9DA 3BJYA 4OZ1A 5EUHA 4DL4A 2E9ZA 1IKWA 2DK2A 3MMCA 1KLMA 3M2VA 3U02A 3PO5A 4X4TA 2R7VA 2CQIA 1VRUA 1RAJA 1R8PA 3OLAA 3GE9A 4OJGA 4DFMA 3PW0A 2HGMA 1KSPA 2X1GA 4GC7A 3UDCA 3P5TL 2ROEA 4KC5A 4YB5A 4KHMA 2VG5B 3N0VA 4DL6A 1O51A 1C2PA 5CYMB 2FHOB 3H4BA 4PQUB 2BJEA 2PA8D 5B0AA 3BGFA 5B0CA 1N48A 1LV5A 2HFOA 2F8MA 4OX9F 1MWZA 4ERDA 4L72B 4I7FA 3GMGA 2QT7A 4G1QA 4CI0B 5IXUA 3G96A 2ADCA 3SQGA 2LDIA 3HZGA 1U2RA 3V4IA 4IR1A 2RRBA 1VMBA 2EFOA 3PEJA 2B6AB 2XG8A 4DPOA 1U47A 2OPQA 2JVRA 2XMVA 3HT3A 4ZVFA 3T1YF 3K59A 2UVWA 1VK8A 3LP0B 1UFWA 3FCHA 3RB4A 3TUZC 1T03B 3PHEA 3B78A 4FPRA 3T9ZA 4ZPWR 4EYIB 5C42A 4HH1A 2R8IA 4LMZA 1VI7A 1Y00A 4LFBF 4TYAA 2W8LA 4A48A 3C6TA 4KGKA 2BUNA 3KLFA 2LMIA 2EBGA 1YJRA 1N0UA 2ZH3A 3BSOA 3CE8A 1FD8A 3M8QB 3M2UA 2IVYA 1DQAA 4K4UA 2K3IA 3M30B 3S7RA 5DLFA 4K5RA 3BDEA 4V19X 2VOOA 2YNIA 4Q8FA 3HX9A 1QUVA 2XY7A 4XDCA 4HDGA 2JH3A 4ZMMA 2ZOFA 5J2PB 3KHHA 4ECRA 1P9QC 4Y2MA 1YQHA 2CPFA 2CZVC 4OI4A 4PG5A 1U49A 1HI1A 2JWNA 1WEXA 3X1LB 2L3MA 4QIWD 1H7XA 4NL5A 2DBBA 1UEUA 2ZD1B 2VFUA 3QLHA 1H38A 2IRXA 3JSBA 3BO3A 2FJWA 4DUYF 2VKRA 5L39A 5L1KA 3O1LA 4XDDA 1B0PA 2DR8A 1KQSR 1XR5A 4HI2A 4WXWA 2C22A 5KFHA 1GAOA 4EBEA 2QA1A 1V3SA 4NLPA 2XGQA 3BREA 4NLRA 1SJ3P 2XMWA 4IQXA 5FIIA 1LXNA 3NGDA 2K2PA 5KFDA 4RLEA 4ES1A 3PR4A 3WC2A 4ED0A 3BDPA 1RT2A 3NRBA 4XK8C 2IA6A 1HYSA 3Q22A 2I1RA 1LWEB 4M8LA 2C2DA 4WK3A 4EBDA 2XC9A 3SI8A 3M2RA 1NO8A 3AB4B 3OXGA 2YWFA 3QMQA 3KLGA 4X4UA 1G2EA 3MUTP 1RWUA 4J9LA 1BC6A 4I2QB 2CPEA 2HQIA 2DVIA 2PI5A 3F56A 1S0NA 1S48A