2NUUG

Regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
b'MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ammonia channel
molecule tags Transport protein/signaling protein
source organism Escherichia coli
publication title The crystal structure of the Escherichia coli AmtB-GlnK complex reveals how GlnK regulates the ammonia channel
pubmed doi rcsb
total genus 26
structure length 112
sequence length 112
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2006-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2nuuG00
1V3SA 5D4OA 2E66A 5L9NA 1OSCA 4CO3A 3CE8A 3N5BA 2ZFHA 3BZQA 4YB5A 1O51A 2XG8A 2GX8A 4OZJA 1V9OA 3L7PA 4Y6IA 3O5TB 4C3LA 4CNZA 3TA1A 1GNKA 4OZLA 2NUHA 2EG1A 1NAQA 4CNYA 3T9ZA 4YB6A 4RLEA 2VD3A 1H3DA 3AA9A 1P1LA 4E98A 3HLUA 5DS7A 4OZNA 4R25A 1O5JA 1V3RA 4CO4A 1NH8A 2J9DA 4CO5A 3NCRA 2J9DE 1V6HA 2V5HG 1Q1KA 4C3MA 4D3GA 1VHFA 3TA0A 1NZAA 1XK8A 1HWUA 1UKUA 3O8WA 4IYQA 4RX6A 1NH7A 4USIA 4WK1A 4ZK7M 1J2VA 5D4NA 2RD5C 3NCQA 4NYPA 2CZ4A 4CO0A 3M05A 4Y65A 2EG2A 4D3HA 2NUUG 4CO2A 2JJ4D 2XBPA 4NYOA 1UMJA 1PILA 2NS1B 3AHPA 2PIIA 3LF0A 1UL3A 4AFFA 3TA2A 1QY7A 5D4PA 2J9EA 4CO1A 2GW8A 3AA8A 3DFEA 2DCLA 4USHA 3GSDA 4RWXA 3X3UA 1VFJA 4RWWA 3NCPA 2ZOMA 3AH6A 3MHYA 5DRKA 4WK3A 2J9CA 2GNKA 5D4LA 2O66A 2XULA 4USJC 2O67A 2Z0GA 4C3KA 3OPKA 2XZWA 1UFLA 4YB7A 1KR4A
chains in the Genus database with same CATH superfamily
1FT8A 4KKOA 2MKSA 3VGSA 2ALZA 2XB2D 2CIMA 1HBNA 1M1GA 2MHNA 4MH8A 2MY8A 4EBEA 1VLYA 4JBCA 2KVIA 1RA6A 2BJ8A 2CAJA 1XBWA 4P7TA 3T5JA 1VQSA 2QL5B 4B3TF 3IMQJ 2DTJA 4F0KA 2FVQA 1FTRA 3BR9A 2DD8S 3I87A 4LUBA 2CZVC 1NSAA 2KVQE 2HYIB 2YKNA 2GX8A 2UUWA 4F8RA 1ZYQA 3DDKA 1B0PA 1R8AA 4QIFA 4DL2A 2E5LJ 4FF2A 2BBEA 2YKAA 1SUQA 4NLWA 5IC6B 2FJBB 3V5RA 5KFOA 5L1IA 1VC6A 1T05B 1L5UA 1L3UA 5ETNA 2WONB 3ZZUA 4AQYJ 1KBRA 2R7QA 1JXLA 4USUA 1YGYA 2VD3A 2HZCA 4LFAF 2W9CB 3FC9A 3ADAC 4Y2AA 1W26A 3POTA 4H4OB 4NWBA 5KFSA 5C42A 5L46A 4O3OA 4RNOA 1VOMA 1UWAA 2A6OA 3TAMB 3K0JA 1EQ0A 3QT6A 1U1RA 2HGMA 1H0HB 1GEHA 3ZZZA 4HACA 1HQUA 4E8UA 4EYHB 1OMSA 4RNFA 1DAXA 4ZPCA 1BGXT 2FZKB 3CJKB 3UVJB 4DX6A 1S1VA 1R27B 4ETZA 1OWXA 1Q1KA 1RBAA 2YY3A 2HLUA 2N82B 3OL8A 2ZBRA 2Z2YB 4CLTA 1RTIA 2P9CA 3UR0A 2OH2A 4AT1B 2G0JA 3MPUB 5KT4A 2B3TB 3TJ9A 3FBFA 1R7IA 2H3EB 2DIUA 2ZH4A 4XO0A 1HWUA 1RWNB 1X4CA 3PW7A 5C5JA 3ZZOA 1RUSA 1X4EA 3O8WA 2MJUA 4WTYA 2LEBA 1TR0A 2IA0A 5EWGA 3NMRA 1DJ0A 1Q95G 4OYAA 1S1XA 1RHKB 2HURA 3HHLC 3IO1A 5C24A 3C66A 3MMBB 3GIMA 2Y3YA 2FY1A 2E1PA 2BUNA 2VBWA 2MEWA 3H59A 4N47A 2UUCJ 1FRLA 2VFRA 3HHDA 5HLFA 1RHMB 1U26A 3NCQA 4JI5F 3KYLA 4XDCA 1NDKA 2K1RB 1WTFA 5ADZA 3ENWA 2KXNB 1TK8A 3NGUA 4A8WA 2EC2A 4AQYF 2GHVC 1AW0A 2C3MA 4ZKAA 3HI9A 2PI5A 1NJYA 4OHYA 2E7VA 2EK1A 1NHUA 3MTJA 1IKYA 5DETA 3WC0A 2A10A 4OHVA 2HNDB 2J76E 5D6GA 2QLXA 2A0FB 2DO4A 5HN0A 1TL1A 5EGYA 2M9KA 3AXKA 4LQ9A 3AOAA 4F50A 4KFBA 4QQBA 3D28A 4A8MP 4KGXB 3DOMB 2K3IA 4IO1A 2VDHA 4A8XA 3L3CA 1LOUA 2FB0A 1X60A 1CULB 3QO9B 3H8YA 2DGOA 4WBFA 4MK8A 2RMLA 4Y0FA 1IXKA 1GXLA 3I4HX 1K1SA 4NPOA 4UY85 1KS2A 1P6TA 2H65B 5IV4A 1B7YB 1F3FA 2E7WA 1SJ4P 1QAYA 3W2WB 5CA5A 4KHRA 1VRUA 5LL6d 1SC4B 4ELVA 4K4YA 1UPPA 2J9CA 1TV6B 4LIRA 5CCMA 5LJ3Y 4DLEA 1Q8LA 5L39A 4L73A 4NEZA 3I4PA 1ZA1B 3ZC4A 5JUMA 4ILRA 2IM1A 4ZIWA 4ED4A 3OPKA 3DRSA 2CQGA 3MM8A 1TUVA 5C24B 1FK9B 2WBMA 3V6DA 3GU0A 3K58A 2EFVA 1SC1B 1TKDA 1ZAVA 1KNZA 2NZ4A 3ENQA 2ZC4A 2ROPA 1XN9A 1QTMA 2HQCA 2HFVA 2JLGA 4A8KA 3JQJA 2IMWP 2YXLA 5KFJA 2APOA 2FD2A 5AE1A 3D67A 4OZ5A 4GKJF 4CYUA 1VQ4S 2G1HA 3H5XA 3FCVA 1U49A 5DZ7A 2ASJA 3W8PA 4DR4J 1BQXA 2D3UA 4A4JA 2DNZA 1F9EB 2XG8A 4M1KA 4DR5F 4B9TA 2EFNA 3G96A 2X3DA 3VVTA 3K17A 3RR8A 3P8BB 4J9RA 1KWMA 1V9OA 3SCIE 3W5YA 3KK1A 1TL1B 3ITHB 3MEEA 3N6NA 4RUHA 2W9BB 2AZ1A 3W7BA 4O3SA 5KG1A 2V2ZA 2XC9A 3HHLB 4NRTA 1X4BA 2VBYA 3EVWA 3QO9A 1FWPA 4B3OA 3T41A 1RBLA 2AYMA 4WXOA 4MKYA 1P9YA 2EK6A 2CPZA 2R8JA 3CMES 1HNXJ 1VDHA 4C0BA 3FZBA 5A8RB 3CCMS 4NLUA 4O0NA 3FKBA 1RWWB 4FVMA 3UD5A 2YWKA 1UCNA 4DZDA 1VGYA 3ZZTA 5LSRA 5AJ3J 3I56S 4OX9J 4U95A 1KONA 3GJTB 4PG5A 2QC3A 4UZCA 3RB6A 1EB0A 2D7SA 5DQGA 2HHQA 4M5HA 4PXBA 3MAQA 1U47A 3E2EA 1SQGA 2B9XA 2OPPB 3KJFB 3MEKA 3O44A 1JLAB 5T7LA 3EWGA 3HVRA 4B3SJ 1KLMB 2HIYA 2MPUA 2A3JA 3A8KA 1HWLA 2QL9B 1S99A 3DM2B 4RPFA 4URSA 3QNWB 5FDLB 5A8WA 4Q45A 1IQZA 1VRTA 2W9CA 3E51A 3KHHA 2LU1A 4AL7A 4BWMA 2VUGA 1KOOA 1RTHA 3K7RA 3VWSA 5DGBA 4I69A 5SZTA 2N7CA 3GMGA 3FRZA 2R2SA 4WZQA 4USTA 3VF0B 4NMXA 3GILA 3ILOA 5KG2A 2VFVA 3I0RA 1S57A 2IDLA 3HDSA 2W25A 1RT7B 3NBPB 3QATA 2HQDA 4L3KA 5BYRA 4CLKA 3R2DJ 1YRTA 2F5GA 4Y2MA 4KPCA 5JMNA 1VQ7S 4F0HA 2QLFB 1OS5A 1U0HB 1WC0A 2H5JB 3HD1A 5KFCA 2D3O1 4FBUA 4QBUA 3MUMP 4I2QB 2UVWA 4JI8J 5DG7A 3DLKB 3A13A 2W9BA 4FKXA 5KFLA 4LSNB 3UN5A 3PYEA 4QR0A 2VQFJ 4LF5F 3KG1A 4F3OA 1YJNS 3IXQA 3TUPA 4RR5A 3VGUA 1NM2A 1NDLA 1C1BA 4NMLA 2DITA 2DY9A 4OX8A 4TY8A 2XCAA 1VQ5S 2VA2A 4K4UA 5AXNA 1TFYA 4L75A 4FYDA 2IYIA 1FRKA 2PD1A 1S72S 4X65F 1Y5IB 4Y2CA 3TEHB 5I4MA 2EBGA 3R3TA 4NASA 2W8KA 1P1TA 5E3PA 3ILLA 5HMWA 3I9V9 4CO1A 1TKTA 1TAQA 2F9DA 3Q22A 2ZBCA 4BC7A 4KH0B 4M5IA 1WDDA 1S9EB 4GC7A 5E3RA 1DZ5A 2LFVA 5KFVA 2KG1A 2C28A 2OPPA 1UFKA 5EX0A 1OQ3A 3PIOQ 1REVB 4UY8T 3TZWA 5J2NA 1SI9A 3PCOB 4I1TA 2EWHA 2LXFA 2AJ1A 4DFMA 2DNOA 3FNNA 5KT5A 4X62J 3UDEA 4X4VA 1KTVA 3QRQA 4DCOB 1VR6A 2K3KA 3P3DA 1RLCL 2XULA 2BKNA 2CPJA 2HAIA 3NLCA 5HATA 1N33J 4K2JA 2FIUA 4KGMA 3NY0A 2U2FA 2IVMA 1QAXA 1NSPA 2GCFA 2V50A 3UCGA 1KR4A 3GIJA 2ADCA 1DQ8A 1HMVB 2YVSA 4PKDB 3CD7A 3QPIA 3PYGA 1ZM2A 3VR1A 2ZH9A 5T14A 1UA0A 1F5CA 1IVZA 1WHXA 3PJ9A 3DC2A 3I32A 4FYWB 4P74A 2ZZNA 3EX7B 1WEZA 2IC3A 1NJWA 1WF0A 1C2PA 1PKUA 3BEGB 3QIPA 4RW4B 4C8ZA 2AJQA 3DHWC 1SJRA 4L6V3 4OJHA 3CCVS 1FRXA 1T8EA 4OFZA 2JNJA 5LJ5Y 2G2YA 5F8GA 2MZ1A 2X1BA 4OYBA 4CM0A 3KLGB 3VGVA 2XLJA 3F41A 3EXYA 4AD6A 4EUVA 4QPXA 2UVUA 1ITPA 3PX6A 4LF6J 2XYGB 1FDDA 4CDIA 4DQPA 4B08A 2HFZA 3QZ7A 1TAUA 4NLVA 1Q0NA 2JC1A 5E3AA 4ECVA 3CULA 2FVRA 2GIQA 4NCBA 1RWOB 1VI7A 1SV5B 1CJTA 3DN9A 1N8RT 7FDRA 4J9MA 3EM1A 3LUYA 3W9IA 2FLNA 2CJXB 5HJXA 3LANA 2M8HA 4BLGA 3OR2B 1X0FA 1R89A 3EZOA 3GYXB 2QZ8A 3U7JA 2A2DA 2WCXA 1ELOA 3DRPA 4R5PA 4IOAQ 3HK2A 1T3OA 4YQWA 1FERA 4PCQA 1WKKA 4IQXA 2XO6A 1VYAA 1X0PA 2J0QD 2V69A 3HPOA 1S1UA 3TZZA 4DR2F 5GAEI 1RT6A 4DPUA 2UUBF 4Y2KA 2J6SA 4EFAC 3L95X 3PW4A 1I3OB 1FFSB 2D69A 3H20A 3RAMA 4D3GA 4DI6A 4DL6A 2AGOA 1RAAB 1ZPVA 4HHUA 3Q8PB 4TVAB 4M94A 2ZHOA 1ZETA 1FE0A 5H9EJ 1YBUA 3TZYA 2DR9A 2Q66A 1A6LA 1LWCA 3SV4A 2GFFA 2PMHA 4J9NA 4RW4A 1BXNA 3ETMA 2KRBA 4RW6B 4WIQA 3P45B 3Q8RB 2DHAA 2KRRA 1SL2A 3VAGA 4K0KF 2OPQB 5IXUA 2MLZA 4JI4F 2E5LF 1JX4A 1FX4A 1JKHB 4LF2A 2HHWA 3RBZA 2VFSA 1R0CB 5G0RB 1KFSA 3BS9A 3D5MA 2B51A 3QT8A 4J90A 4D3HA 4ECZA 1HPZB 1TKXA 4JI2J 1QVFR 3HSGA 2NUUG 3HXMA 2XEXA 3QGHA 4PWWA 2MMYA 1VBYA 1RT1B 3EPGA 4DFPA 2QG9B 2VKRA 4KBIA 1H7WA 1YG0A 4DV4F 2KT2A 1H7XA 1QM9A 1QE1B 3V4IA 3QWUA 3KXDA 3D1OA 1UJ6A 2XS7A 1LWXA 2YWEA 3DDIA 4Q7AA 5D4PA 4R5PB 3SYZA 1U1MA 1RHRB 2VU5A 3AAWB 4U8YA 1U0HA 3PACA 2XLIA 3RB3A 2W7AA 3FRYA 1MMLA 4DPTA 2FLPA 6FDRA 1NLKL 2WOMA 2IVYA 1KHWA 5LSOA 1L3SA 1RT4A 1NPRA 1HFEL 3G86A 3MI7X 3MM6B 3X3UA 4A8SA 3W3SA 2UXCJ 3R5GA 3UN3A 4O44B 1RXOB 3TUIC 1LFPA 3FBCA 1YJWS 3H7HB 3W60A 1NK6A 2FJWA 3PJXA 2VPXB 3MHYA 2DT9A 4NL5A 1WKLA 2VDIA 3MAAA 4OJ1A 4WK3A 2GGPA 1O8BA 2C2NA 2GJIA 4ZVRB 5D4LA 4OX7A 4F26A 2GJ2A 2E1AA 3S8SA 1EHWA 1U8SA 5J1EB 5GAGI 4NLXA 4CLSA 3QZ8A 1UZHA 2GQCA 3MM5B 4ZVOB 5SUHA 2I6WA 3RAQA 1UVNA 4J9SA 2M88A 3Q89A 2HK3A 4CI0B 4QOTA 3M2UB 4TY9A 4CO3A 5AE3A 3H5YA 1VISA 4GO7X 1RWMB 5G0RA 1B0VA 4ECRA 4KGVB 1HNVA 3L7UA 3ET6A 3HVWA 4PR6A 3OUYB 1RJJA 2DGVA 4ZHRB 3G4SS 3C6TA 3HSDA 3J81Y 2R7OA 4ICLA 4P2XA 2CPFA 1HW9A 1XMBA 3Q2TC 1ZAXA 2LQBA 2AJFE 2W2NP 1VIXA 4I4BA 4EZ6A 2L48A 3KK2A 1FX2A 2W7PA 3HKZD 1RWKB 2DEIA 3FEYB 3SFUA 1TUWA 4XPEA 1UVIA 1YBAA 2X1AA 2LU2A 4A8QA 1YITS 2Y9HA 1WNEA 4ILMA 4EEYA 3TUZC 2G1DA 4J91A 1FA0A 3CDWA 3HHLD 1MWZA 5CHCB 4ZN1A 4J9OA 3AA9A 1DTQB 2CWKA 3H2VE 3Q23A 1X8DA 2YTCA 3J7ZT 1JJHA 1OYEA 2ZKUA 1X5PA 1RAGB 1O6XA 2FZGB 4ELTA 4LF6F 3HHNB 1HHSA 1GMUA 2DXEA 2J7KA 1BLUA 2BW2A 3JS9A 4C97A 4PWUA 4F36A 4C4WA 1OSDA 2C2MB 3TNVA 4ZITA 2V5HG 4TLQA 4M5GA 4A8FA 4IFYB 3T1YF 3A3PB 4HDHA 1KQSR 2OHDA 2DIVA 2HQFA 2RDJA 1YTYA 4C8YA 2B5JB 4DV6F 1B0TA 1J27A 1Q16B 4USKA 1J5EF 1J5OB 3OR2A 4P10A 3PW0A 2C2EA 1PBUA 2W2OP 2YX7A 3GSIA 2YNGB 3QSYB 3ET6B 3OUYA 2DR7A 2I8EA 4DL0C 4CTAA 3OT9A 4IYQA 4NEYA 4OZ1A 4NE9C 1B70B 2QGFB 4Q43A 4EBCA 2DK2A 4ED6A 4C9DA 3BB5A 1X7VA 1E6YA 3BSCA 1FKOB 4RW7B 1XNQF 4O3PA 5E7OB 2MZJA 4DG1A 5M2RA 3BKTA 4KIAA 4NLGA 4NLYA 2AKWB 2XWXA 4DV0J 1OJ4A 3ZZYA 3KG0A 3MXHP 4NYOA 2PEBA 3P4UB 3R6GB 5HAOA 4O3NA 4WXWA 4DV7J 4C6AA 1DQ9A 2BE2A 3M30B 4A48A 4L3NA 5MLCV 1PG5B 5CD4H 3Q8YA 1NMEB 4K4ZA 5E41A 4DSFA 1DTQA 1HNZJ 3WC2A 3NNCA 1HI8A 2DGXA 4E0DA 2DHXA 3UDLA 4ES2A 1R0BG 1UJ5A 3QBCA 2YWWA 3IBFB 4KT0C 4X65J 5ETTA 5DDRC 4Q0BA 1SBRA 1S1VB 3JTOA 1S6UA 1T95A 3DGPA 4G6VB 4Q5VA 3I6PA 1N5YA 2ZWOA 3G9CA 4PRFA 1FKPB 3MFHA 4FYVB 5LOQA 2JVOA 3T5LA 1IBKJ 1UVMA 3IWNC 3V6JA 4OL8A 3LPEA 4IKAA 4PG4A 4M5LA 3R5BA 2MQPA 1QE1A 4ECXA 1JLFB 3Q8UA 4QWDA 1I1GA 2MKCA 1RT2A 4ZPAA 3D6MB 3W2VA 1X4DA 2XMVA 1F6TA 1JXVA 3KK1B 3IRWP 4OV6A 1UFLA 3D0GE 3KUGA 4NZ6A 4J9PA 2QEXS 2GV1A 2FC8A 2QX0A 2ZOGA 2CPEA 3AD7C 4F67A 2HGNA 2Z8QA 2HBYB 4B9UA 3ILJA 1NJIT 1H6KX 4DL4A 3N5BA 2WVFA 5IV3A 1GX6A 3GCWP 2ZBIA 3NOCA 1YBTA 2DNMA 4F0MA 2EKYA 4K4VA 3EE3A 3JSMA 2R42A 3A8EA 1NU4A 3CO0P 5A76A 4RUAA 2BV3A 3K5MA 5CYJA 3UD4P 3QJJA 4RJVA 4BWJA 3HT0A 5HANA 1XERA 2F4FA 2B6AB 4I6YA 4FXVA 4BCAA 4N77A 4ZOSA 2IBKA 3KJNB 3CCTA 3OXFA 3IR5B 3CJKA 1FDBA 1IBKF 1QLNA 1DLOB 2WVDA 2BRLA 2M8DB 2KXFA 2QYGA 4PQUA 3BM7A 2D1CA 3MCOA 1SH0A 1ZM9A 3TP2A 2C3YA 1FKPA 1YWXA 5AE2A 1CVJA 1ZZFA 2HEKA 4EGLA 4O3QA 4M5DB 3UWTA 2XO7A 1VJQA 3D3CJ 3KJQB 2GVZB 4AUKA 3PIPQ 2BE7D 5CABA 1RAOA 2G0IA 2ZD1B 3ZXWA 3JTPA 4ANDA 3Q8QB 1FDAA 1D9FA 3W2VB 2XM3A 3M8SA 3MOJB 1R43A 1WC4A 3ENVA 3NKYA 4Y28C 3D66A 4HKQA 5D77A 2XSFA 3KJVB 3NNAA 1JMTA 2O5DA 2YNFA 3BBCA 4HT7A 1FK9A 3SMZA 2B56A 5KFEA 2F1FA 2DRDA 5KFQA 1WOOA 3CD5A 3ZZ0A 2WSCC 1FFWB 4P2SA 4LT6A 3GJSB 1GQEA 4QIEA 1LEOA 1BQNA 2DPJA 2OPSA 2YH0A 3KNGA 3MR7A 4YDDB 4O23A 4ECTA 2XHWA 1AFIA 2JL9A 3ETOA 3TRGA 1DTTB 1YHQS 4QIGA 3KHGA 2FJEB 1RTDB 2K7KA 2AMCB 2FPHX 1BE4A 1P27B 3UVJA 1FJ7A 2DNHA 1MROB 1OPIA 4KFBB 3GIRA 1XNRF 2MQOA 3KK3A 1JLCA 5CQGA 2NXCA 3I9ZA 4QWEA 5KFIA 4DV6J 4K2XA 1W2BR 3JSRA 3CCSS 1RAIB 2HPUA 4K4SA 3DRRB 3HO1A 1UETA 1NK4A 5J2PA 2E9RX 2HHXA 3MR6A 2YKQA 4FS1A 4J9VA 1QY7A 5A8RA 2OMOA 5KFYA 3I31A 3T6BA 5KT2A 3CCLS 2J9EA 1WI6A 2RU3A 5HLFB 4LF8F 4C11B 2HS3A 3RRKA 4JI3F 2PFDA 2GMJA 3BBBA 3DRSB 3MM8B 1QUPA 4MFBA 4OZ0A 4CLLA 4N76A 4MKVA 3OR1A 4HTIA 3MD1A 3QLHA 3JQMA 5FJ4A 1URRA 3UW1A 3R7NB 1U6BA 4WKRA 1S59A 4DX7A 3TQEA 4ECQA 1H2TZ 4HHHA 4LSZB 1JJCB 4RL1A 2BE2B 8AT1B 4IRDA 1SJFA 4BDPA 2VOOA 4DPYA 4CYUB 4LRBA 4L76A 3MZIA 3DOKB 2MYFA 3MFIA 2MDAA 1IM6A 2EFQA 2FVSA 1UFWA 1F2HA 1S5ZA 2Z0GA 4USJC 1EQMA 1E6VB 1S12A 4IUFA 3OW2R 3DU5A 3HZEA 3JYTB 3RAXA 3H90A 4UOHA 1N6QB 1HNIA 2MQMA 2UXBF 1G7CB 2YPZA 1CJUB 1S7HA 2HNZA 1G4CA 4FNIA 4EO6A 3JB9k 1U2FA 1RDRA 1MROA 2AIRB 2BVZA 1YJ7A 4NA2A 1T9UA 1PCAA 3MR2A 1WJ9A 3HHLA 1U6FA 2BW7A 3TANA 2V0NA 1CLFA 3I0SA 4A47A 4GO5X 3NMAA 1YX2A 2HHHF 1RGVA 4NLRA 2XI2A 2KL8A 5ETRA 5G4DA 5AXLA 4F4AA 4U9RA 2XYHB 3MMBA 3P49B 2VB6A 4FP9A 2FZCB 5E2QA 3OTCA 3M8QA 4TY8B 3PYDA 1SPBP 2PC6A 2LA4A 2HWHA 2DR8A 1H2UX 1G6BA 5A0YB 1TKZA 3BGFA 2VG7A 4DL5A 2DR5A 1MMNA 1RT3B 2XHCA 3KKFA 5J1NA 2VJUA 2VASA 1RAEB 2PDAA 1JLAA 4WU3A 1FO1A 2C3OA 3PRVA 4A8OA 2CNNB 3RB4A 2FUG9 3QRRA 1NKCA 1D3WA 4F3QA 5GADI 4RLEA 2A18A 3LAMA 2AEJA 2CQCA 2RB7A 1VRTB 2MQLA 4NCGB 3T1AA 3W9JA 4LMZA 5F8NA 4QZVB 2B9EA 1RLDA 2V8GA 3R5DA 2B6AA 1U1NA 1N33F 1RB0A 2CNKB 3DOMA 3W9HA 1WSVA 2IRYA 5CXTA 2IM3A 1KVKA 2IDEA 4QWAA 1U25A 3CD0A 3HD2A 3JTNA 2DR6A 3PHTA 3ZTQA 1YK9A 4Z7CA 2GJFA 2ABYA 2K8GA 2P2CB 3DYAA 4IG0B 3D3BJ 2LEPA 4EI2A 4ES3A 4EO8A 1RKIA 3RW7A 3TYTA 5M2UA 1HMVA 4QYZK 2JC0A 5EX3A 5HVFA 4LF7J 4O4GB 2YNIA 2C3PA 1UAWA 1T02A 3AB2B 3K5NA 3I96A 4USVA 1HBUB 2XMJA 4KO0B 1KVJA 1T0TV 3GFHA 2E9TA 3D1HA 2V8PA 1C1BB 2ZZTA 4P75A 2OPRA 2AYBA 4NLTA 2M4MA 2MZQA 4ZDNA 1FEHA 3DGVA 2XMUA 5DDQC 3T5KA 1X9MA 1Q5YA 4DU8A 4B3MJ 3MCNA 1OYDA 1GH8A 3KJVA 3J7YI 3PRBA 2R2RA 5A0YA 5CZXA 3LAKA 3G87A 3PKMA 4YUDA 1Y5LB 2JDJA 3QQCD 1SKSA 2M5YA 1N52B 2BKOA 3DMJA 1VC0A 1N5TA 4J9KA 2GS8A 1WDTA 2J8SA 4KR0B 1QTNB 4OYMA 2ASDA 5J2NB 1PILA 1G2EA 5A2QY 3AHPA 2ATCB 5JVGQ 3QGGA 1C0UA 2CJBA 2IAJB 4LFAJ 3VGTA 2V2VA 2O1PA 2W4DA 4J7CA 1KHVA 4DV5J 1X9SA 3TAQA 3GG0A 4NX9A 2XY5A 2JOQA 1FD2A 2EFOA 2OMLA 2V4RA 1JJ2R 3DFEA 4I2QA 4OLOA 3MEDB 2BABA 2QJ3A 5KFGA 4EZ9A 4RWXA 1SKRA 2G2OA 1LWEA 3VAMA 2MB0B 2VZ9A 2ROGA 3TWZA 5GMKa 4RNNA 3N4WA 1GX5A 2IC3B 2A2CA 3EXCX 1KEKA 2UXDF 2V34A 3FDSA 2B8QA 3HCXA 5T41A 3CMAS 3QT7A 3PV8A 4OI4A 1FFGB 4HHJA 4ZLLA 4JYAF 2QA4S 2F63A 3G6ES 4B3TJ 2IY5B 4K5RA 3EZUA 4DUZJ 4ZJQA 4YEAA 5T7LB 2N3LA 4DR4F 4MFBB 2ILYA 4OYZA 1UVJA 4UT4A 5HMYA 2AW0A 2QA2A 4WPAA 4GKJJ 5KTQA 4DQIA 3NWRA 4UOCA 1NDCA 1HR0J 3QJPA 2XSJB 3LOUA 2ZH3A 1YRXA 4KGKA 5RUBA 3HJVA 3IGNA 3EDQB 3KLFB 2B9YA 2ADBA 1XNRJ 1ZZNA 3ELHA 1TKXB 2ZUAA 1N0VC 3D6HB 3O2IA 2L41A 3K8VA 2I38A 2CADA 4KV8A 1JLBA 2MZSA 4U7UK 3M2VA 4X64F 3U02A 4OZ3A 3VAJA 3UCZP 1KOHA 3OL6A 3M8ZA 4I67A 4C8KA 1E6VA 1M5SA 3PHEA 4FDFA 4WWSA 3MDFA 2WAQD 4MMOA 3K5LA 3J80U 1LKZA 1CJUA 1UTAA 4LF4J 3H4BA 4K4TA 3VAFA 4R0EA 1MG7A 2E5GA 4QYZJ 4Y6IA 1B99A 1X4AA 1Q53A 2L9NA 3O5TB 2MQQA 2YX1A 2ZJQQ 2H48B 1R8HA 1A0OB 3OJSA 1NAQA 1VCTA 4FPIA 1TL3B 4OI1A 1VMBA 3EUNA 3QGIA 5L38A 4IDKA 3QGPA 3LW5C 4M8LA 1VBZA 4LVOP 4C98A 2NREA 1FKAF 2VG7B 5B0DA 4ED5A 2GIRA 2KJWA 3ENAA 3N5FA 2RRNA 5KFXA 3U1LA 1HHTP 4DX8H 3CCES 4NZ7A 3M1VB 4DOZA 4QCLA 2VPWB 3LQVA 4K5SA 1T9YA 2J7UA 1TELA 3BH6B 1HD0A 2N7YA 4U96A 2B7CB 1MWQA 2I0XA 1S4FA 4AYBD 3BDPA 2CQ3A 3FZ2A 3N79A 5HQMA 2XY7A 2QIFA 3BO3A 2DPIA 2ZVIA 2H5EA 5IZHA 2R7WA 5LMNJ 4DS5A 1VBXA 1M90T 2G9OA 1U1KA 1QSLA 4KV8B 3AB4B 3TW0A 4OQJA 3Q0AA 2Y8YA 4RX6A 2VC1A 4WK1A 1NK7A 4LQ3A 5F8MA 4H4KC 1Q8IA 3B82A 3RU0A 2VJVA 4ZVPB 1S9GB 5K8NA 5I3UA 2CZ4A 4UOGA 1H98A 4ZJOA 1S10A 1IQTA 3M05A 4RW9A 2NSCA 4X4QA 3KLVA 3QIPB 2V9WA 4CO2A 4B3RJ 4O44A 4GKKJ 2XBPA 2FJDB 2W1BA 4OI0A 3GONA 4G1QB 1WOPA 1UW9A 2B4OA 2F7VA 2DO0A 2DXDA 3MMCA 3TQ1A 1N5SA 3IM8A 3HFZB 3BGRA 2GGPB 2LA6A 5AXKA 2OPQA 3KWMA 4F7VA 5FLXU 4OX6A 1NZ8A 2ZDPA 4GC6A 2KTQA 5J1EA 1IBMJ 4I6AA 2CDRB 1QVGR 2P5VA 1RWVB 1DBDA 4B9NA 4CLYA 4PPDA 2UUAF 3NOGA 1MU2B 2HQ3A 4TQRA 1ZTWA 3OFGA 2BE9B 4RWWA 1IR0A 3NCPA 4NYZA 4IR1A 3MR3A 2HBZB 1I51B 3LH2S 3SQGB 3RG6A 4OYPA 3CJQA 4PXCA 1W7WA 5B09A 2HAFA 4ZP8A 3CCUS 1WC5A 4TKTA 2FTRA 5KFAA 4DUTA 1T9XA 5IS2A 3TVYA 1HNZF 3WHIA 4JI3J 3M9NB 4QR1A 3PFOA 4YY3F 1YJ9S 1IR1A 2DRBA 4JI1J 2V4JB 1WTBA 1RT5B 1F3VA 2HNYB 5KOWA 3TZXA 3EGZA 1HQEA 1FNXH 3PW5A 1SJQA 4KQZA 4YB7A 2WHOA 3A3NB 1VIOA 2ZNYA 3MM6A 5EN1A 1FNMA 5DG8A 5LXRA 4N5SA 3KK2B 4WIIA 4C0HA 3CE8A 2C2DA 2PA8D 4MYTA 1JB0C 1CEZA 5KT7A 2VA3A 4QU7A 4P72A 1ACMB 3BZQA 4GVLA 4UZBA 4FKYA 5JJBA 1MNEA 5DO2A 2CQBA 2XQCA 1FXDA 2RDDA 1JJ4A 2BOPA 2WK4A 2M70A 2RQMA 4RKUC 4OV1A 3C2PA 1V5IB 2UV8A 1VQLS 3LPYA 2OEJA 2D9PA 2BZ2A 1S6QA 3LGHA 2BEFA 1RAJA 2PA3A 1HQUB 1WSRA 2F8MA 3GIKA 3SSQA 2VG5B 3D0HE 4K59A 5I3QA 4FXDA 3PX0A 5BR8F 1LXNA 2QO3A 4TXSA 4FBTA 2BACA 3G82A 4LBHA 2NUHA 2WB4A 4I2PB 4QIVA 4K0KJ 3M8PB 4HTJA 1BWEA 3T9ZA 3CJSA 4K8RA 3SQGA 4ED3A 1FWKA 1M5OC 3BPSP 4AL5A 4S0MA 4K4WA 4FS2A 2DGWA 1RE1B 3BN7A 4ZHRA 5AXMA 2EEYA 3W63A 3BYRA 2BQUA 1XQIA 3FBEA 2XY6A 3MMAA 4KSEB 5HBMA 1NH8A 5LT5A 1UEVA 5IOLA 2ROEA 4LVNP 5M2PA 2C2RA 3H2UB 2OTLS 1BY9A 4ALZA 3M6UA 3FQKA 2ZJRQ 3NXZA 1YJTA 2DNRA 1Z1ZA 4YR3A 2GC8A 4ER8A 1U8WA 1FF2A 1Q79A 2K7JA 1SIZA 1Z2LA 2LDYA 2ZE2A 1R0AB 1RHJB 3KG4A 3IAM9 1CS4A 1F5BA 3DLEB 3R7BB 4J9UE 1PBAA 4WU2A 4DPOA 4EMDA 2EFPA 3GV5B 2LP4A 3QT5A 5BJRA 1VBKA 1TP7A 5CAAA 2Q43A 5DM7Q 2VG6B 3CGIA 3KLEB 3V81B 2IA6A 1LV5A 2QMWA 2PT0A 4Q44A 3DU6A 1LW0A 2XWYA 5J2QA 2WB1D 3EJMA 4P73A 2R7VA 2NXJA 2WSFC 2MKHA 3PZPA 2FGOA 3M1VA 3AJDA 3PM9A 2RD5C 1HBNB 1S6QB 5IQ6A 3RYLA 1M5PC 2MQ8A 2E9ZA 1NCLA 4DR6F 1LW2B 4CO0A 1UWBA 5H9FJ 2MZTA 5DDPC 2FGCA 1FCAA 1N34F 2AWZA 2DISA 3CDBA 3UD3P 1Q7LB 1V5VA 1N5YB 1ZOTA 3MPWA 2RSQA 2QLBB 3G82B 4RBTA 1UMJA 2HKEA 1RSCA 2JZ5A 2B0GA 3W65A 4HI1A 2H4WB 4DR6J 1MW7A 5KFWA 4OJ3A 3OL7A 3PEHA 1TV6A 3D6FB 4CH0S 4QWCA 4JI7J 3R1HA 4MKBA 1WG5A 3DRYA 4PAAA 1ZM3A 4X62F 3ZO7A 4LFBF 2KI2A 3GJRB 4YHHJ 3I5BA 1U1QA 1K47A 1CG2A 4KYZA 1LWFB 2CPXA 1KQFB 5F0UA 5IT0A 4DSKA 1RZMA 5HK4A 3KHLA 1AB8A 3KMSA 2YKMB 3THTA 1WF2A 2FVCA 1WEYA 2NR0A 5L8RC 3R2CJ 3CC7S 1IBLJ 2LDIA 2MJNA 1YIJS 4C8LA 1TL4A 4W92B 5D8HB 2LXUA 4X4UA 3MAHA 4PG7A 4IFVA 3TJ8A 2GAGC 1Q81T 1YSJA 1JNRB 1WORA 1DY3A 2F3JA 3J7Z5 2VODA 1RISA 2CQ1A 3W1YC 1XEZA 3MCMA 1YI2S 4WFYA 1OY9A 1SC3B 2XS5A 3EVMA 1SB6A 1HBMA 3AXMA 2E66A 3VZIA 1OSCA 1CPZA 3C46A 2R7UA 4DHVA 1JLCB 2QV6A 3BR8A 3ULHA 4WJBA 1YVFA 1LW2A 3S01A 2ZFHA 2WW4A 3WDOA 3CF5Q 5H9FK 5ETOA 3AJ2A 3G8TA 3DXBA 2KU7A 2WW8A 3IRXB 4OI3A 4XPCA 1NPKA 2DKOB 3CDAA 1LXJA 3LA0A 3NGRA 3AQPA 3S6EA 3BQ1A 4ZCLA 4IOCQ 1O51A 5J2PB 2AGPA 4I6WA 2V4JA 1FTCA 1RT5A 2DNNA 2LCWA 4RUBA 1PC4A 4DR1J 3RW6A 1RWPB 3M9MB 1AA1B 1REGX 4OZJA 4GMKA 1D9AA 1F9HA 1F5AA 2QE5A 5GVQA 1XMOF 2HVDA 1HNWJ 2V8HA 1BD6A 1KQKA 3KLHA 4DR3J 2KZMA 2CDQA 5KFDA 4OJGA 3TA1A 2QSFA 4OZLA 4ZCMA 2VBXA 4F04B 2BJ1A 3D6TB 4EU0A 3PW2A 2V8DA 1SQEA 3QAUA 1PAEX 3LP0A 4CNYA 2ATLA 4JV0A 3F73A 2OEKA 3LP1B 1MSWD 4QYRA 5DQHA 3TR5A 4DSJA 4KJIA 3C16A 4NA1A 1MWYA 2JLEA 3CJ2A 1FRMA 4ZMMA 2XCPA 1KTQA 2OPSB 4Q8EA 1K0TA 2B4VA 1CQMA 2Z2MA 2IM0A 3PDNA 4DR2J 1D1UA 2C2KB 2HWIA 2OSQA 3CDEA 5CYMB 5F9LA 4A8YA 2CQ2A 2RQKA 4R0JA 5ETVA 3L4BC 2FJAB 3JYTA 1NK9A 3GIIA 4JOUA 2HFNA 4X66J 2HMIB 2W7OA 4KKOB 2W2PP 5GAEU 3MUVP 4C8NA 1WUUA 2ACYA 4MIBA 3QFHA 3RRGA 2R3VA 1DARA 1RT2B 3BREA 3BPDA 4IRKA 1H2VZ 1I94J 2H4YB 2XYPB 4EBDA 4NXNJ 4UTGA 1N56A 1JNZB 2B43A 2N4CA 2QLWA 4USIA 1RHUB 4OIXA 3JQKA 2BR0A 3LWMA 2JWNA 4CP5A 5J2MA 1N54B 4OHZA 1IKVB 5D4NA 2RH3A 5HQ8A 1FJCA 1Y5NB 2P8IA 6AT1B 2ZC3A 2KM8C 1VQYA 3LGNA 2ALYB 4ZA1A 2Q79A 2D3OR 3KLIA 4H4MB 1X4GA 2V67A 2KJVA 2X7IA 3LP0B 4MAKA 1FNOA 3PY8A 4C8OA 3X1LB 1NHKL 4RBUA 3FSXA 5GAGU 2RF2B 3RTVA 1XMOJ 1YLXA 5J2QB 1C1CB 3C16B 4CH1A 2ASLA 1Y4ZB 2ZUGA 1KSPA 3FEXB 4MIWA 2J0WA 2MQNA 3B78A 4M5MA 4DS4A 2VIHA 3IN5A 3D54A 1M1KT 3W8GA 1BC6A 2AV5A 1JIHA 2HWTA 1U7LA 2VPYB 2HNZB 3GSDA 4YDXA 2ZOFA 1S0MA 8RUCA 1TQLA 2VFTA 3IP0A 4YB1P 1N5VA 2Z2ZA 3EMTA 3W62A 3N9UC 3MURP 3M32B 1UP1A 3CUNA 3R1LA 1UA1A 4N8NA 2C42A 2MLYA 1ICEB 1WKJA 1WG1A 3IR6B 1R6YA 1OY8A 3GZ7A 2PMZD 2GNKA 3CJ0A 1RYRA 3SV3A 4DWIA 1WC3A 1HWJA 4ZVUB 1D9DA 4DQSA 3EDRB 4CLPA 2OPRB 2JEIA 3OVBA 2J5AA 2PMWA 1FXRA 2O3DA 3I5AA 1BWVA 1WF1A 1GK8A 3FQLA 4DSEA 1N4LA 1KLMA 2FHOB 2R8IA 2KT3A 1I6JA 4DR7F 2M52A 4WFAQ 1S1WA 2MSTA 1HHQA 2ZBQA 3CJ4A 1YZ7A 3EGNA 2CPIA 3UO0A 3AQOA 4DF4A 1CC8A 4PQAA 4ID5A 2VQFF 3T1YJ 1F9FA 2Y8WA 1RTHB 2JX2A 3KLIB 2HLTA 4KB7A 4I56A 5D0EA 5ETQA 4X4OA 3MF5A 1DTTA 2E5JA 2YQ0A 2E1MC 4KGZB 2JFKA 4TYBA 5B08A 2BJ9A 4LFBJ 4ECWA 2ACMA 3CC2S 2JFDA 3CCQS 2RF2A 1L3TA 3NG8A 1CC7A 1Y9OA 2IAJA 1FE4A 3RJMB 2ZH6A 3U1MA 1NJZA 5IQQA 5HMXA 4L72B 4PG6A 3DLJA 5D0RA 5K14B 4FZVA 2NYIA 3DYAB 1PJ7A 3H42A 3I0SB 2ZH7A 3PX4A 4H4KA 4TQSA 5BYQA 3KMQA 1OPZA 3TI0A 3TJAA 2VBZA 2CNLB 1CJVB 2PFFB 1Z4UA 2QA1A 2N4DA 3W2WA 3CVKA 1R3NA 4PUOA 1O5JA 4RW6A 4CO4A 3A1YG 1NKBA 4NXMF 1TKZB 2ZNZA 1M1HA 1OIAA 3SQOP 4PZVA 2XNRA 1NEEA 3GYGA 5EDWA 2ERRA 3PKYA 3DLBA 3QLHB 4JV1A 4JYAJ 4HDGA 1HW8A 5KFZA 1SUQB 1RTJA 3NP5A 4PXDA 2DGSA 5HP1B 5U47A 2WONA 1VS3A 3OQ2A 1DURA 3J80Y 1AUDA 2GMLA 1YJRA 2QSWA 2XSJA 5HJYA 3C6UA 4YMEA 2W01A 4NCGA 3DI6B 2HRTA 4WE1B 4EWTA 2KM8B 3RBDA 1XK8A 4PWDA 3GCXP 3PFEA 2VKZG 4DR5J 3VHQA 4DJBA 2HK2A 2V68A 3BV8A 5A6WA 4B9MA 1EX8A 3ZTOA 2FY8A 4ED1A 1C0UB 3P5TL 5CYMA 4TLRA 1V3ZA 4RNMA 2OD6A 4CWBA 1CSJA 1N6QA 2ZHBA 2DHHA 3DLHA 4DV5F 1HQ2A 2RJZA 1F0XA 2V94A 4Z2XA 2OIHA 2F4VJ 3LP2B 1MN9A 1JLGA 3SDEA 4NYPA 7AT1B 1NUEA 2KHDA 2AJ4A 2OD4A 2J6TA 1T3NA 3MEDA 4G3IA 5FIIA 1TK0A 4ITSA 2IFXA 2WVBA 1GT8A 3UQSA 3NGKA 2BM0A 3IFEA 3BN4A 1U1PA 4FF4A 5L1LA 3BGLA 4KH1B 4DV2F 1Q8KA 3GWCA 3SXLA 5F8IA 3WZ0A 2QN6B 4NI2A 3UCUP 2Y1IA 1NPPA 1ZTTA 3RUBL 2C2OB 3I5CA 2FQQB 1VQ9S 1FRHA 3D68A 4X4NA 5DLGA 2CPYA 1S1XB 2HIQA 3TA2A 2HRYA 4B02A 3G71S 1XMQJ 4F4ZA 5JXSA 3OVSA 1VQNS 1WWHA 1WOSA 4DV1F 4LSLA 3JSBA 1N0UA 4NA3A 2HVHA 3NAHA 2D9OA 1SQFA 2HS0A 3H98A 5ITHA 2RVJA 4DV2J 1Y11A 5FLXY 2QA4G 4YR0A 4ENOA 2SXLA 1NXIA 2BYCA 3DMJB 3MWBA 3SEOA 3AT1B 2XGPA 2MXYA 1FD8A 1Y7PA 2H9ZA 3EGVA 3FCWA 1N5QA 3Q83A 4I7FA 2KB2A 3HFKA 4KTQA 1IKYB 2DNQA 5A8WB 3A12A 5FDLA 2C22A 3E01B 1C1CA 4R8UB 4MKAA 2NSBA 4IH6A 4HLBA 2AZ3A 4PWDB 1MLAA 3SIPB 3UE2A 4CH7A 2BQRA 3ISNC 1NBEB 2IHR1 5CYQA 1S1TA 4HH1A 3UNGC 4DCJB 2QMXA 4Z37A 5IT4A 1RT7A 3GR0A 1WHYA 2R4FA 4HL9A 3D0IE 1HIYA 4LRFA 3THVA 2UVVA 5L9NA 4J9QA 4QW9A 2XNQA 1IBLF 4CCHA 3C3LA 1VQ6S 2RT3A 4O4GA 3MGJA 2F65A 4ZCKA 3EPIA 4KHPJ 2BANB 2KKHA 4ZPDA 4DF8A 2GQ2A 2D3ZA 2G2ZA 3IG1A 1S6OA 3TX8A 1TL3A 1YKWA 4YB5A 2BQ3A 1K73T 2FJVA 3IM9A 3MPYA 3OSPA 1AUSL 1SCJB 2BMBA 2DNYA 2PEHA 2UP1A 3H25A 3DLLQ 4ZCIA 3EICA 5D0GA 4JI7F 2VV5A 3DXSX 2I9SA 1IBMF 3CSKA 1HYSA 3ZZPA 1R6VA 3AJ1A 3CWJA 1WC6A 3TARA 4DDFA 2R7SA 4P7VA 3UDVA 4DX5A 2IBOA 3HZGA 4Y00A 2R8KA 1S1WB 1SKUB 4AE5A 2HSEB 3CMQA 2DYAA 3F0NA 5CCLA 4CNZA 1EARA 5KFHA 1YZ6A 3NGDA 2GAHC 1GNKA 1RT1A 2W4CA 1S9EA 3GB0A 3MOZA 3BBFA 4HEA9 4WFXA 3K57A 4GKKF 1G1XA 2RAQA 3RB0A 1IJFB 3BGUA 4YN3B 2R2UA 4ZVQB 2I2YA 5K8MA 1FJEB 2JSXA 3M2VB 5E0OA 3KTQA 3GFZA 3MPVA 2AGQA 3CPWR 3R8YA 1RAFB 2L9DA 4QPTA 4UF4A 4R8UA 3MM7A 3NGSA 1GAOA 1PYSB 1U09A 3NCRA 3VALA 2HHTA 5KG3A 2BJDA 2LVWA 2X51A 4ECYA 2B8PA 4DZ6A 1SJ3P 1E6YB 1RHQB 1TU0B 3SBMA 4C3MA 1IWAA 2M2BA 5I3UB 4B3OB 1N88A 1HKAA 3AD8C 5ETPA 1RADB 1HLWA 2CKWA 4K7QA 4PG8A 1WHVA 4DR7J 1X9WA 3D7SB 2QT7A 4NLPA 1NK0A 2NYHA 2QTWA 3FGVA 4N8OA 1M5KC 2Z4PA 4KRWA 4PXEA 4ZLNA 2KXHA 3CNQP 4X2BA 4L74A 1NH7A 2WTFA 2ZM6F 3R27A 2R9LA 3FK4A 5E33A 5LXYA 1UZDA 1RTJB 3J81U 2L9WA 2GZOA 5FD1A 4ANCA 3TO8A 4QU6A 3MPDA 4DV0F 2E44A 4UQGA 2AHOB 4Y65A 5C25B 2CQ0A 4UW2A 3DKDA 1DHMA 1TMJA 2W2MP 2X3GA 2EPIA 3DI6A 3ONQA 4KE5A 1CJTB 1YJVA 4Y3CA 1JLBB 1FWLA 1HWIA 2OP5A 4N7TA 2FLLA 2HZVA 3M8PA 4Q8FA 4LRAA 3PVXA 2Z2LA 5IWAF 2RQCA 2UUTA 5KT6A 2Z57B 1AZSB 4Y34A 3I0RB 1JLFA 5E3QA 3KFWX 3G8QA 4JI4J 3NEKA 2R8GA 2HHHJ 2NXEA 3OTBA 3CCZA 3J7AN 3CEDA 2ZWPA 3SDEB 1A9NB 3A3OB 4CQ1A 5KG6A 3TAPA 1D09B 3F56A 4W4MA 1QAIA 4ZVHA 2DCLA 4RW9B 2AU0A 1J5EJ 2ZDOA 5MAOA 1U1OA 3HHKA 4JI0F 5I42B 3AOBA 2UXBJ 4FF3A 1IJEB 2IRUA 2WVCA 4WF9Q 4USWA 1YRUA 3HHEA 5DRKA 2HFSA 5F0WA 2NPFA 2W4PA 1GMWD 1OO0B 3OXLA 1XR5A 1FXLA 1URNA 3K89A 2RUSA 2KH9A 4DFJA 1HARA 1F60B 4Q2LA 1N48A 1N36F 3IBWA 4LF9J 3WX4A 2ZH8A 3EVOA 4BS2A 3NL0A 3QMQA 4UQTA 2RKIB 3OBIA 1ZS6A 2H51B 4K50A 3CCRS 2ZVSA 1EKSA 5KFNA 3MEGA 5KG7A 2P9GA 2Y0BB 3H5UA 3LWLA 2R8HA 5L1JA 1KLNA 2JEGA 1DLOA 3GQCA 4LBIA 2YKOA 1PAUB 3H4DA 2PO4A 4B9LA 1WEXA 2IJFA 4YFUA 2HHSA 4DU7A 3HM9A 2HRUA 2QRRA 4DPXA 3OHAA 4PPZA 4M5DA 6FD1A 1JK9B 2AX1A 2HGLA 2K06A 4XAKA 2OUGA 3SSSA 5F8HA 3FSIA 3OFEA 3FMBA 3ILIA 1HQEB 3IC1A 2CXEA 3OXGA 1LFWA 5KAKA 5DG9A 2EBEA 2ZH2A 3PO5A 5F8JA 2HFUA 1EIYB 2DH9A 4DSIA 2DHSA 4OMFG 3HVAA 4LR9A 2LYVA 4USMA 1Z2ZA 1S0OA 1S97A 4G1QA 4LRDA 1TZ0A 3M4XA 3ZNUA 5K8OA 3MMCB 3VTIA 1FJGJ 3DOLB 1CS4B 1RK8A 3IG1B 4KY3A 4YP3A 2Q3PA 2UU9F 3HKWA 1S6PB 3PG9A 1HNWF 2E1CA 2EC0A 1Y10A 3TOQA 5HL7Q 1EP4A 3KLGA 3IS9A 3NS7B 4FN5A 5EUHA 1P1LA 1FRJA 3BO2A 1IKWB 1BQNB 3IBCB 4E98A 2Y0SD 4TU9A 2Y1JA 1B7FA 4FF1A 3JAMY 3V81A 1HYSB 1KD1T 3FUYA 4B9VA 2ZJPQ 3WBZA 1LW0B 1TL7B 2A1BA 2RHQB 3VAIA 4H54A 1S4EA 5LMNF 3V6HA 3BSOA 3ISZA 2MGZB 2OLWA 2A6MA 3DGPB 1U24A 1C0TA 2PE8A 1T03A 4DEZA 3G6XA 4NLDA 3T5HA 4KPYA 3BH7B 2ASYA 4LR8A 2UXCF 2XMWA 1SL0A 2LEAA 3IWXA 3OFFA 3W66A 4BHQA 1TK5A 5EWEA 2FHJA 2BM1A 4TU7A 4ID8A 4DQRA 1RAHB 3H2LA 1HNVB 5DZ6A 1NNDA 1HI0P 4AXIA 3CJTA 5GMDA 4ED2A 3N6LA 3SCKE 1NK5A 2KG0A 2OEMA 4LJMA 5ETLA 1SIWB 1QSSA 5IT9Y 4KAIA 4ZLJA 2YKNB 1B4SA 7FD1A 4C11A 5B0CA 3ISND 2GA7A 2B9WA 4N56A 4IH7A 1LWFA 1OY6A 2HHPA 9RUBA 2MSSA 1S76D 1APSA 3M8WA 1SL1A 2EG2A 3DLEA 2RDIA 3OR1B 3OD2A 5A6PA 4JV5F 4JV2A 3V6KA 2YKMA 2DEJA 3OL9A 2KFZA 2JJ4D 4RNHA 4JI8F 2X1FA 3DHXA 4OYOA 2GVDB 2E5HA 3KDNA 2BJ7A 3DOLA 3OJUA 4U67Q 4F4WA 2LLZA 4ILLA 3BGOP 3JSYA 2XZTB 3IS9B 1R8PA 3PEJA 4MK9A 1PJ6A 1BQMB 1W25A 1B64A 2YQ3A 4A46A 2MLXA 1IWGA 2HBRB 2ZHAA 1VQOS 4RU2A 4I68A 1KN6A 1RBOB 1VQMS 4U6PA 3HFVA 1UWBB 2IRXA 5C25A 1VFJA 2KDOA 1HWKA 2B7BB 2MGZA 3BSNA 4XDDA 1N34J 3RR7A 3M8RA 1TVRB 3G2XA 2KN4A 2AYGA 3KNAA 1RI7A 2COLA 2MY7A 2KFNA 1P9QC 1UW4A 3IRXA 1NB2A 3K5OA 4X4PA 3V4IB 1NDPA 2J7WA 3C15B 4LBPA 4LREA 4C2MA 2CJKA 4LFCF 1YJUA 2CJ9A 4XK8C 4WFNQ 1TFWA 3IGVA 2G4BA 2XMTA 2KYXA 2DB1A 2DNKA 4M5KA 5KFUA 3VV2B 2ZITA 2AX0A 3BKUA 1Q82T 5F41A 3W5ZA 1FESA 3NNHA 2GIFA 5CZVA 4NOHA 1T11A 4MIAA 5J2MB 1KP6A 3QIDA 3KUHA 4NLOA 1BUXA 4YR2A 4M5NA 3GV8B 1KVIA 3HSZA 3CIMA 3TX0A 2VG6A 3KLEA 1X5TA 2YH1A 3EGWB 2CQPA 4WYWA 4V19J 1VQKS 4B9SA 2BKPA 4E2FB 2M7SA 1X5OA 2JVRA 1N36J 1NKEA 1IM4A 4LF8J 4LF9F 4ANEA 4DV7F 1RU2A 5KG4A 5IC4B 1P8GA 2CQIA 4OLPA 2QLJB 2OGUA 2RNEA 3KK3B 4F4YA 1D0EA 1HBMB 2KYZA 2JLFA 4DSLA 1JQGA 2MHEA 3M2UA 1RU1A 3OLAA 1JLEA 1GXUA 1OQ6A 4CM2A 1TMMA 4RBVA 2LXIA 1U02A 2GQQA 1HBOB 1VK8A 1EETA 1HL6A 2EG1A 5BR8J 3L7OA 1SH2A 2E5IA 3M2RB 5E3CA 3T6JA 5C2GA 1NJXA 1WG4A 4ZVGA 5KFMA 3RZAA 2DY1A 4C0OC 3MCSA 4KO0A 4J9LA 1C4CA 1PSDA 2DBBA 3VQSA 4DR1F 2WZ1A 1CBKA 1VRUB 2GHWA 2BJ3A 3M8YA 4ICLB 1Q8BA 4J37A 4XTTA 4ZP9A 2FDNA 3QYYA 4I0WA 3PR5B 1UEKA 4K4XA 1WI8A 5K8PA 1K44A 2CNOB 3IWLA 3G6VA 4ES1A 2J9DE 8ATCB 3PYFA 5IWAJ 3KLHB 2VQEJ 1V6HA 3ZZRA 1Y0HA 3MUTP 1RP5A 1S49A 3AD9C 5D15A 4WTOB 2P9EA 3OSNA 1IUJA 3FBBA 2K2PA 4U8VA 3SSRA 2ZKTA 5KT3A 2QMUB 2F4VF 5DJBA 2LQ9A 2Z30B 4OYIA 4CT9A 2AYEA 4WP9A 3POTB 2NPIA 5C42B 4JI6J 2DH7A 2RRBA 2CQDA 3O6QA 5F3ZA 3PNIA 4DV3J 3J7A1 3MM9B 3R7SB 1ZBTA 2Q1LA 4KHMA 3K59A 4JP8A 1MMDA 3JSMB 2RS8A 4HACB 1XIQA 1VRQC 1HNIB 4DLGA 1VC5A 3KUEA 4ZK7M 4F4XA 1S77D 2ZBPA 2RHSB 4CLFA 2VC0A 3HF5A 3GPAA 5B7WA 2QL7B 3OVAA 4IFYA 2RS2A 2XLKA 4NCAA 1RTIB 1HD1A 4X4TA 3ITHA 1FVQA 2KO1A 3MEEB 3R5CA 5HVGA 2B4PA 2RE1A 5I3PA 4NLSA 1L3KA 5K14A 3SCLE 3S1TA 2CRLA 2Q6BA 3UDCA 4DPWA 4G65A 1RKJA 1HBOA 4O4RA 1ZA2B 2YWHA 3VQTA 2D74B 4LRCA 4ZN3A 4JI2F 5HSPA 4BC9A 4YHHF 4F02A 3R6LB 2XGQA 2DGQA 2ZEJA 2LQJA 2PIIA 3QFWA 5LM7E 1NK8A 4N41A 5HBMB 2E1RA 3QRPA 3B6BA 1UL3A 1VHIA 3WIVA 1HA1A 2AEFA 3O3LA 3T9NA 2OFHX 2LQ8A 5GADU 1CQNA 4NXMJ 5HROB 1T94A 2GVZA 1H73A 3BSAA 5C2CA 2GW8A 1XR7A 2X1GA 3QJLA 1AXQA 5B0AA 5C7PA 3KDOA 3FSYA 4DXLA 3MECB 1S9FA 2U1AA 2YKPA 3UR3C 4ATNA 2K1RA 2P6SA 2BA9A 1ZM4A 4DG1B 3V6DB 3P96A 2BX6A 4ZVEA 1XTZA 2OELA 5AT1B 4OHXA 4B3SF 1AT1B 3K2YA 1ZPWX 1C4AA 2DGTA 4Y2IA 4FYXB 3C19A 2W2QP 4IQMA 1VQ8S 3HVTB 2VOPA 4ID5B 4O3RA 3M30A 4M5JA 4URGA 3GFXA 1LQ9A 2CWXA 1T7PA 3C6UB 3CW2C 2HNDA 4WZMA 5H9EK 2RQ4A 3R9LA 5D3GB 3GE9A 4OYWA 5D0HA 2UUBJ 3W61A 1FDNA 1QJHA 4C7QA 3P5BP 3GV7B 5IM0A 3H5SA 1WHWA 3W5XA 4ZP7A 1X31C 2HMIA 2FYXA 1VK3A 3OLBA 1RCXB 3K5PA 1NHVA 2CUYA 4G1IA 4UUXA 2EXUA 3PXGa 5ETSA 2CJYB 2XTJP 2L08A 2RRAA 3C8YA 2YNIB 1FVSA 3CT9A 3J81j 1VLOA 1TVRA 4DL3A 4B3RF 2C1EB 4ZVFA 5GAHU 1WC1A 1W2IA 3D4JA 4FVCA 4LSNA 1XWLA 2FHKA 3M7VA 1H72C 9ATCB 3DRRA 4O0IA 2P6TA 2R2TA 2DVIA 2MKJA 4IDKB 1WELA 2PSZA 1R8CA 2WSEC 4DV4J 4ELUA 4X4RA 5KFPA 3M6WA 4DV3F 4XIUA 3Q8SB 3N01A 3T1HF 2R7XA 2HBQB 3HT3A 2DNLA 3CXCR 1S0NA 2OFGX 3OFHA 1TKTB 4C8MA 4H4MA 3SZ2A 1VQPS 3D9BA 2PN6A 3DDNA 4JUZA 4DBQA 3A8IA 4PYDA 2YPYA 3AY0A 2IVFB 1U2CA 1UEUA 4PABA 3NGTA 5GAHI 5DLFA 4IR9A 1H3DA 3HULA 1XNQJ 4WE1A 4ECUA 3SCJE 2XS2A 3HVTA 3P6YC 1X5SA 3CJRA 5DS7A 3UFCX 4DFKA 1FRIA 1RABB 2YNHA 3A8JA 4R25A 1V3RA 2HFOA 2LQ5A 2W9AA 2AEMA 5D3GA 2CYYA 1WD6A 5LSLA 5KFBA 1CULA 2Q6CA 1O0PA 3TEGA 3OV7A 1FEEA 1LWEB 2ILZA 5IM0B 2OKQA 2IIHA 2NLWA 2DRAA 1D8ZA 1EETB 3ZTRA 1A7GE 1X4FA 2DNPA 2UU9J 1Y3KA 4ZPVR 3Q2SC 3FFIA 4MTPA 2AJ2A 3A4TA 1CJVA 3T1HJ 3NS5A 4ZP6A 1UVLA 2BANA 4NXNF 4P2MA 4DUZF 2GHPA 4ZVTB 4PUOB 2CQHA 3B8HA 3R5JB 4YY3J 3CDUA 3BGRB 5B0EA 2V2QA 1KFDA 3M8QB 2UXDJ 2XZDB 3NRBA 5F3TA 3RBXA 4NLQA 3AOCA 3WIUA 5H1SV 1ZH5A 2WVEA 4X66F 2DXFA 3KOAA 4FYYB 4ZPWR 4W90B 2H54B 2HHUA 2HVEA 2NQPA 4J5OA 1UJ4A 1D8YA 1RT3A 2DCUB 3IAS9 4V1Ak 4JI5J 3FVYA 3IA0A 2UUAJ 2L3MA 5HI7A 2Y1RI 2BOAA 1PGZA 2CPHA 2HVIA 3MM9A 2VL1A 2WBRA 4OYXA 4F2SA 1LNQA 2AJ0A 3Q8VA 3RGIA 1XC9A 4HH0A 4TN2A 5K9FA 1U4BA 3QSIA 2FHMA 2E7XA 2YNHB 2XMKA 2LMIA 3LP2A 4MJKA 4WP8A 2F9JA 2VH7A 3MM7B 2R7RA 5CYQB 2W8LA 3RBEA 5KG0A 3M6VA 1S1UB 1K0VA 2Z58B 4USHA 4IRCA 1RWXB 1AROP 1RACB 4JB8B 5K20B 2UZAA 4X84A 4DUYF 1DFDA 4NI2B 4Z7YA 5IT9U 2D41A 2VFUA 3B4DA 3FFIB 3U1NA 4B3MF 4P2FA 2EFGA 1RA7A 1HBUA 5BXIA 3BJYA 2LKZA 4B17A 3ZFVA 4OI2A 2YX4A 4WYLA 4ZJLA 4CLWA 1U0SA 4IH5A 4C3KA 4RU9A 1QSYA 1LK7A 1T9TA 4ZS6A 4FNHA 4DCPB 2AP6A 2NXUA 3MECA 4OX9F 3ZTPA 3OTOJ 5HP1A 1F1BB 2OSRA 1V3SA 1KQGB 2Y1LB 3ICLA 5EHHA 3PR4A 2OAUA 3V4MA 2JEJA 4F2RA 2M3DA 2NZCA 3DM2A 1PC5A 2FC9A 3QWPA 5J1PA 4HT5A 5CD4A 2BDPA 4AXJA 3LTOA 1UVKA 1IR2A 3DCAA 4TNOA 1NB7A 5EWFA 4I2PA 1U48A 3FEZA 2FVPA 3E01A 2CPDA 3I82A 1H38A 2B4UA 1WACA 3AFGA 3PRDA 1GMVA 4EK2A 3DOKA 5KFFA 3J7YU 2HVZA 2V4QA 3NBPA 2RIJA 1Q5VA 4V19X 5B0GA 3CCJS 1S1TB 3B54A 2NCKL 3MD3A 3MMAB 1JLGB 4JI6F 1S9GA 1G3OA 3R97A 5KFRA 4U7CA 4FXWA 4RUCA 3CD6S 2DNGA 3DLKA 3OTDA 4OHWA 1YDLA 4C3LA 3CB4A 5A8KB 5IFMA 4ED0A 2HHVA 3UN2A 3Q24A 3VAHA 2WOMB 1N32F 1NO8A 1PIEA 2H1YA 2W24A 2ZE2B 3N0VA 2VQEF 1R0AA 1VJWA 2V63A 4WFZA 4DQQA 4I64A 4QIWD 4MK7A 4LF4F 4CRJA 3U27A 5KG5A 3CTRA 4HYKA 1S79A 4PEOA 3SFGA 3PJWA 1Q86T 4IG3B 3PO4A 1BMQB 2V8VA 3MAAB 2BJEA 2V6AA 4WKYA 5LMUF 1T9WA 1Q4RA 4LSLB 1TL5A 1YQHA 3NAIA 4CO5A 5F9NA 3O1LA 2XMMA 5HQLA 1MU2A 3OTEA 1U1LA 1KRPA 1EZZB 4RW8A 1RTZA 1SH3A 2VF3A 1FJGF 2RUGA 1PYOB 1R31A 4QWBA 2HQGA 4G1PA 1REVA 2F8HA 4RZRA 1KDNA 1JWWA 2RKIA 1RCOB 5GMEA 1HR0F 3TA0A 3VVUA 2YWFA 4I7FB 3BF4A 2EKNA 1HPZA 1NZAA 1Q7YT 3NWGA 3RRHA 2BXJA 3DNCA 3FMWA 2HW3A 2HZAA 4QR2A 4P9SA 4GVBB 3US5A 4DL7A 5AJ3F 2UVRA 3CIZA 1ZAWA 2IM2A 3UPFA 2EI5A 2ZH1A 1TTHB 3MTKA 3CC4S 1GTEA 3EZ5A 2JRSA 1RT6B 1J2VA 4OZ2A 3BYPA 2CJQA 4IG0A 3ZNJ1 2CFXA 3GTYX 4FPRA 4MYUA 2XMAA 2IMOA 2I1RA 4LR7A 2FJXA 1RWUA 3S7RA 1EJ7L 2AT1B 3DRXA 2MKKA 1IN0A 1T9VA 2VPZB 2R7TA 2CA9A 5A8KA 2DJWA 5D78A 1UPMB 4NZ0A 1DQAA 3UI3A 1U45A 2MTLA 5HO4A 1LWCB 2HG4A 3AODA 1QUVA 3LGMA 1PO6A 1M0SA 4EYIB 4F4KA 1HI1A 1F2GA 2OTJS 1S6PA 1JXEA 1SJ1A 5DQIA 1SC6A 4UUWA 4DN0A 1U6ZA 3GP9A 3MR5A 4NRUA 4HR2A 4ETXA 1CJKB 1JKHA 2JEFA 2RILA 2AQ4A 4MT1A 1GTHA 2YBVA 3AA8A 3HMJG 2KHCA 1SV5A 5B0FA 4DN9A 3G8SA 4ERDA 1GFWB 3E8OA 3LO3A 2M0GB 1PJ5A 2ZOMA 3THPA 1C0TB 4YS2A 3D1QA 1T03B 3AH6A 4DMZA 1QD1A 5CH7B 2B5JA 1IKXA 2QFJA 1M5HA 1IBCB 4DR3F 4ZLPA 3DRPB 1AYEA 4P6QA 2C2ZB 3OHBA 1SKWA 3CJ8A 5F8LA 3CJ5A 1FI4A 4KC5A 1K9MT 1S0VA 1H74A 3MMJA 3N28A 4F25A 2EW9A 1NRKA 4TYAA 2XZWA 3E3XA 1ROFA 3Q86A 1RT4B 3HJFA 2KT5A 4LF7F 3CJ3A 3FCHA 5D4OA 3JAMU 3T19A 5KFKA 5I42A 5KFTA 1FKOA 5ETKA 4RW7A 1XMQF 1T05A 4LIWA 2DGUA 4M95A 1N32J 2DHGA 4RO0A 4QW8A 1X4HA 3HP6A 2PI4A 1KKHA 2GO9A 2F40A 1PYTA 3VZHA 4JI1F 2VONA 4JV5J 3LP1A 2ZM6J 3N6MA 4UOFA 2J0XA 1EKRA 2CQ4A 3R5AA 3HX9A 1GMWA 3IR7B 2G0CA 4H4OA 3KHRA 1IKWA 2HS4A 2AD9A 4ZPBA 3B4MA 1S7IA 2KFYA 3TAMA 1SXLA 4WFBQ 1GXTA 1ULRA 2XI3A 3L09A 1M5VC 2YWGA 4CLUA 3MEGB 5ETMA 3L7PA 2IJRA 3G6YA 3FJ2A 3KLFA 2BRKA 5JVHQ 4F3MA 4LF5J 2CVIA 3F44A 4ED7A 2UUCF 4YB6A 3W64A 5DM6Q 1AZSA 3TVKA 3V2UC 3OTOF 3H40A 1S48A 4ED8A 4IOBA 1IKXB 4U7UD 2C3UA 4P71A 2OJ3A 3C6TB 2YNGA 2MZRA 3HLUA 3T3FA 1JLQB 4OZNA 2MKYA 2J9DA 3C15A 2ZZMA 1R8BA 5B0BA 4W98A 4AL6A 4TU8A 4CIOA 3GFYA 4PYAA 2IPOB 3GR1A 1RQ0A 3BKFA 2HNYA 1NSKL 1U2RA 1IKVA 3GJQB 3JXOA 4ZVSB 5K5MA 1QDUB 2DH8A 2IJNA 3DLGA 3K8WA 2OI2A 3M6XA 4CZCA 4ECSA 4DUYJ 1VHFA 3PTWA 3GYNA 3VCDA 3CCWA 4HI2A 2I5JB 2V2KA 5DGAA 4X4SA 1EP4B 1Y3JA 4IFVB 4IO9Q 2RU9A 1UKUA 4IG3A 3HSJA 2MKIA 3UNYA 4WCEQ 4P52A 5HROA 3BQ2A 4M63A 3C14A 3MM5A 2O01C 1MN7A 1TL7A 2GO8A 2POKA 2V9KA 1TUGB 3VAKA 3H0PA 1KC8T 1I94F 4RW8B 2GMHA 3BQ0A 4GRSA 1Y00A 2EVZA 3NS6A 3GLJA 3M9OB 2H5IB 2VHGA 1XJWB 4KHPF 2Z56B 1XR6A 5HMZA 1HNXF 1BHNA 2FLOA 2HQIA 2VG5A 2JHEA 1RYSA 3WX8A 1JLEB 5DDOC 3LALA 5KOXA 1LK5A 3TUJC 3D2WA 1Q78A 4PQUB 3M32A 2LECA 4OI6A 4GVBA 2FHJD 2OO4A 3M2RA 1K8AT 2NS1B 4CTAB 1K1QA 2KZZA 3LF0A 3ZTSA 2CZ9A 3WQPA 4YOEA 2F8EX 2ZH5A 1I5OB 4LF1A 4AFFA 5L1KA 1B3TA 2JH3A 5L9XA 1SVDA 5A2QU 2G13A 3I55S 5HVHA 2J6UA 1JLQA 2ZD1A 4LFCJ 2AF6A 2CG4A 5THWA 3GG1A 4C48A 2IYGA 2CJAA 4QJVA 2E29A 1J5OA 2CVEA 3BDEA 3CO9A 2YNFB 1NSQA 3DLGB 2CG8A 1QAJA 2GVDA 3EYZA 4HVZA 4DV1J 1DRZA 2J0SD 4JI0J 2QYCA 3QAEA 2I5JA 4CT8A 4URQU 3TVZA 4ZPTR 4WP3A 4X64J 4Q2MA 4CLZA 1EAYC 1BQMA 2QFIA 2NXNA 2O66A 2N3OA 5LMUJ 5E5NA 2O67A 4ZIVA 1CJKA 3SI8A 1L3VA 3L9ZA 3C14B 1RTDA 5BYSA 2YQ1A 3BO4A 4BBYA 1FHTA 2UV8G 1AFJA 2WRMA 2PGCA 2J8AA 4Q0BB 2VICA
chains in the Genus database with same CATH topology
1FT8A 4KKOA 2MKSA 2ALZA 2XB2D 2CIMA 1HBNA 2MHNA 4MH8A 2MY8A 4EBEA 1VLYA 4JBCA 2KVIA 1RA6A 4P7TA 1XBWA 3T5JA 1VQSA 4B3TF 2DTJA 2FVQA 1FTRA 3BR9A 2DD8S 3I87A 4LUBA 2CZVC 2HYIB 2YKNA 2GX8A 2UUWA 4F8RA 1ZYQA 3DDKA 1B0PA 1R8AA 4QIFA 4DL2A 4FF2A 2BBEA 2YKAA 1SUQA 4NLWA 3V5RA 2FJBB 5KFOA 5L1IA 1VC6A 1T05B 1L5UA 1L3UA 3ZZUA 2WONB 2R7QA 1JXLA 1YGYA 2VD3A 2HZCA 4LFAF 2W9CB 4Y2AA 3POTA 4H4OB 5KFSA 4NWBA 5C42A 4O3OA 4RNOA 1VOMA 3TAMB 3K0JA 1U1RA 2HGMA 1H0HB 3ZZZA 4E8UA 1HQUA 4EYHB 4RNFA 1DAXA 4ZPCA 1BGXT 3CJKB 1S1VA 1R27B 4ETZA 1OWXA 1Q1KA 2YY3A 2HLUA 2N82B 3OL8A 1RTIA 2P9CA 3UR0A 2OH2A 5KT4A 2B3TB 2ZH4A 1R7IA 2DIUA 4XO0A 1HWUA 3PW7A 1X4CA 5C5JA 3ZZOA 1X4EA 3O8WA 4WTYA 2MJUA 2LEBA 1TR0A 2IA0A 5EWGA 3NMRA 1DJ0A 1S1XA 3HHLC 3IO1A 5C24A 3C66A 3MMBB 3GIMA 2FY1A 2VBWA 2BUNA 4N47A 3H59A 1FRLA 2VFRA 3HHDA 5HLFA 1U26A 3NCQA 4JI5F 3KYLA 4XDCA 2K1RB 1WTFA 5ADZA 3ENWA 2KXNB 1TK8A 4A8WA 4AQYF 2GHVC 1AW0A 2C3MA 4ZKAA 3HI9A 2PI5A 1NJYA 4OHYA 2EK1A 5DETA 1NHUA 3MTJA 1IKYA 3WC0A 2A10A 4OHVA 2HNDB 2J76E 5D6GA 2QLXA 5HN0A 2DO4A 1TL1A 5EGYA 2M9KA 4LQ9A 4ECUA 4F50A 4KFBA 4QQBA 3D28A 4A8MP 2K3IA 4IO1A 4A8XA 3L3CA 1LOUA 2FB0A 3QO9B 3H8YA 2DGOA 4MK8A 2RMLA 4Y0FA 1IXKA 1GXLA 3I4HX 1K1SA 4NPOA 4UY85 1KS2A 1P6TA 2E7WA 1SJ4P 1QAYA 3W2WB 5CA5A 4KHRA 1VRUA 5LL6d 4ELVA 4K4YA 2J9CA 4DLEA 1TV6B 4LIRA 5CCMA 5LJ3Y 1Q8LA 5L39A 3I4PA 3ZC4A 5JUMA 4ILRA 2IM1A 3OPKA 3DRSA 2CQGA 3MM8A 1TUVA 5C24B 1FK9B 2WBMA 3V6DA 3K58A 2EFVA 1TKDA 1KNZA 1ZAVA 2NZ4A 3ENQA 2ZC4A 2ROPA 1XN9A 1QTMA 4A8KA 2IMWP 5KFJA 2APOA 2FD2A 5AE1A 4OZ5A 4GKJF 1VQ4S 3H5XA 1U49A 2ASJA 1BQXA 2D3UA 4A4JA 2DNZA 2XG8A 4M1KA 4DR5F 4B9TA 2EFNA 3G96A 3RR8A 4J9RA 3SCIE 1V9OA 3KK1A 1TL1B 3ITHB 3MEEA 3N6NA 4RUHA 2W9BB 3W7BA 4O3SA 5KG1A 2XC9A 3HHLB 4NRTA 1X4BA 2VBYA 3QO9A 4B3OA 4MKYA 4WXOA 2AYMA 2EK6A 2CPZA 2R8JA 3CMES 4C0BA 3FZBA 5A8RB 3CCMS 4NLUA 4FVMA 2YWKA 3I56S 1VGYA 3ZZTA 5LSRA 1KONA 4PG5A 3RB6A 2D7SA 5DQGA 4PXBA 3MAQA 1U47A 3E2EA 5T7LA 2B9XA 2OPPB 3MEKA 3O44A 3HVRA 1JLAB 1KLMB 2MPUA 2A3JA 1HWLA 3DM2B 1S99A 4URSA 5FDLB 5A8WA 2W9CA 4Q45A 4AL7A 1U1LA 1IQZA 1VRTA 3KHHA 3E51A 2LU1A 4BWMA 2VUGA 1KOOA 1RTHA 3K7RA 3VWSA 5DGBA 4I69A 5SZTA 2N7CA 3GMGA 3FRZA 2R2SA 4WZQA 3VF0B 3GILA 1S0OA 5KG2A 2VFVA 3I0RA 3HDSA 2W25A 1RT7B 3NBPB 5BYRA 1YRTA 4Y2MA 1VQ7S 1OS5A 4FBUA 5KFCA 4QBUA 3MUMP 4I2QB 2UVWA 5DG7A 3DLKB 2W9BA 5KFLA 4LSNB 4QR0A 4LF5F 3KG1A 4F3OA 1YJNS 3IXQA 4OX8A 1C1BA 4NMLA 2DITA 1VQ5S 2VA2A 4TY8A 2XCAA 4K4UA 4FYDA 5AXNA 1TFYA 2IYIA 1FRKA 2PD1A 1S72S 4X65F 1Y5IB 4Y2CA 5I4MA 2EBGA 3R3TA 2W8KA 1P1TA 5E3PA 5HMWA 3I9V9 4CO1A 1TKTA 1TAQA 2F9DA 3Q22A 2ZBCA 4BC7A 4GC7A 1S9EB 1DZ5A 5E3RA 5KFVA 2KG1A 2C28A 2OPPA 5EX0A 1OQ3A 3PIOQ 1REVB 4UY8T 5J2NA 1SI9A 4I1TA 2EWHA 2LXFA 2AJ1A 4DFMA 2DNOA 3FNNA 5KT5A 4X4VA 1KTVA 2K3KA 3P3DA 2XULA 2CPJA 3NLCA 2HAIA 2FIUA 4KGMA 2U2FA 2IVMA 1QAXA 2GCFA 3UCGA 1KR4A 3GIJA 2ADCA 1DQ8A 1HMVB 2YVSA 4PKDB 3CD7A 3QPIA 3VR1A 1ZM2A 2ZH9A 1UA0A 5T14A 1F5CA 1WHXA 3DC2A 3I32A 2ZZNA 3EX7B 1WEZA 2IC3A 1NJWA 1WF0A 1C2PA 4C8ZA 3BEGB 3QIPA 4RW4B 2AJQA 3DHWC 1SJRA 4L6V3 4OJHA 3CCVS 1FRXA 1T8EA 4OFZA 5LJ5Y 5F8GA 2MZ1A 2X1BA 3KLGB 2XLJA 3F41A 3EXYA 4EUVA 2UVUA 4QPXA 3PX6A 1FDDA 4DQPA 4B08A 2HFZA 3QZ7A 1TAUA 4NLVA 2JC1A 5E3AA 4ECVA 2FVRA 2GIQA 4NCBA 1VI7A 1SV5B 3DN9A 1N8RT 7FDRA 4J9MA 3LUYA 2FLNA 3LANA 2M8HA 3OR2B 1X0FA 1R89A 3GYXB 2QZ8A 3U7JA 2A2DA 2WCXA 1ELOA 3DRPA 4R5PA 4IOAQ 3HK2A 1T3OA 4YQWA 1FERA 4PCQA 4IQXA 1X0PA 2J0QD 3HPOA 1S1UA 4DR2F 5GAEI 1RT6A 2UUBF 4Y2KA 2J6SA 4EFAC 3L95X 3PW4A 4DL6A 3H20A 4D3GA 3RAMA 2AGOA 3Q8PB 1ZPVA 4M94A 2ZHOA 1ZETA 1FE0A 5H9EJ 2DR9A 2Q66A 1A6LA 1LWCA 3SV4A 2GFFA 2PMHA 4RW4A 2KRBA 4RW6B 3Q8RB 2DHAA 2KRRA 1SL2A 3VAGA 4K0KF 2OPQB 5IXUA 4JI4F 1JX4A 1JKHB 2HHWA 2VFSA 5G0RB 1KFSA 3BS9A 3D5MA 2B51A 4D3HA 4ECZA 1QVFR 1HPZB 1TKXA 2NUUG 3HXMA 2XEXA 3QGHA 1VBYA 2MMYA 1RT1B 3EPGA 4DFPA 2VKRA 4KBIA 1H7WA 1YG0A 4DV4F 2KT2A 1H7XA 1QM9A 1QE1B 3V4IA 3QWUA 3D1OA 1UJ6A 2XS7A 2YWEA 4Q7AA 5D4PA 4R5PB 3SYZA 1U1MA 3AAWB 3RB3A 2XLIA 3PACA 2W7AA 3FRYA 1MMLA 2FLPA 6FDRA 2WOMA 2IVYA 1KHWA 5LSOA 1L3SA 1RT4A 3G86A 1HFEL 3MI7X 3MM6B 3X3UA 3W3SA 4O44B 3TUIC 1LFPA 1YJWS 1NK6A 2FJWA 3PJXA 2VPXB 3MHYA 2DT9A 4NL5A 4OJ1A 4WK3A 1O8BA 2GGPA 2GJIA 4F26A 3S8SA 5D4LA 4OX7A 2GJ2A 2E1AA 1U8SA 5J1EB 5GAGI 4NLXA 3QZ8A 2GQCA 3MM5B 5SUHA 1UVNA 3RAQA 4J9SA 2M88A 4CI0B 4QOTA 3M2UB 4TY9A 4CO3A 5AE3A 3H5YA 4GO7X 5G0RA 1B0VA 4ECRA 1HNVA 3HVWA 3OUYB 4PR6A 1RJJA 2DGVA 4ZHRB 3G4SS 3C6TA 3J81Y 2R7OA 4ICLA 2CPFA 1HW9A 1XMBA 1ZAXA 2LQBA 2AJFE 1VIXA 4I4BA 4EZ6A 2L48A 3KK2A 2W7PA 3HKZD 3FEYB 3SFUA 4XPEA 1UVIA 1YBAA 2X1AA 2LU2A 4A8QA 1YITS 4ILMA 1WNEA 4EEYA 3TUZC 2G1DA 1FA0A 3CDWA 3HHLD 1MWZA 5CHCB 4J9OA 3AA9A 1DTQB 3H2VE 3Q23A 1X8DA 2YTCA 3J7ZT 1JJHA 2ZKUA 1X5PA 4LF6F 4ELTA 3HHNB 1HHSA 2J7KA 1BLUA 2BW2A 4C97A 4PWUA 4C4WA 1OSDA 3TNVA 2V5HG 4TLQA 4A8FA 4IFYB 3T1YF 4HDHA 1KQSR 2DIVA 1YTYA 2RDJA 4C8YA 2B5JB 4DV6F 1B0TA 1Q16B 1J5EF 3OR2A 3PW0A 2C2EA 2YX7A 2YNGB 3OUYA 2DR7A 2I8EA 4DL0C 4CTAA 4IYQA 4OZ1A 4Q43A 4EBCA 2DK2A 4ED6A 4C9DA 3BB5A 1X7VA 1E6YA 3BSCA 1FKOB 4RW7B 1XNQF 4O3PA 5E7OB 2MZJA 4DG1A 5M2RA 4KIAA 4NLGA 4NLYA 2XWXA 3ZZYA 3KG0A 3MXHP 4NYOA 4O3NA 4WXWA 1DQ9A 2BE2A 3M30B 4A48A 4L3NA 5MLCV 4K4ZA 5E41A 4DSFA 1DTQA 3WC2A 3NNCA 1HI8A 2DGXA 4E0DA 2DHXA 3UDLA 4ES2A 1UJ5A 4KT0C 5DDRC 4Q0BA 1SBRA 1S1VB 3JTOA 1S6UA 1T95A 3DGPA 4G6VB 4Q5VA 3I6PA 1N5YA 3G9CA 4PRFA 1FKPB 3MFHA 2JVOA 3T5LA 4OL8A 1UVMA 3IWNC 3V6JA 4IKAA 4PG4A 3R5BA 2MQPA 1QE1A 4ECXA 1JLFB 4QWDA 1I1GA 2MKCA 1RT2A 4ZPAA 3W2VA 1X4DA 2XMVA 3KK1B 3IRWP 1UFLA 3D0GE 4J9PA 4NZ6A 2QEXS 2GV1A 2ZOGA 2FC8A 4F67A 2CPEA 2HGNA 2Z8QA 4B9UA 1NJIT 1H6KX 4DL4A 3N5BA 1GX6A 2ZBIA 2DNMA 2EKYA 4K4VA 3JSMA 3A8EA 1NU4A 4RUAA 3K5MA 3QJJA 2BV3A 3UD4P 5CYJA 4BWJA 1XERA 2B6AB 4I6YA 4FXVA 4BCAA 4N77A 4ZOSA 2IBKA 3CCTA 3OXFA 3IR5B 3CJKA 1FDBA 1IBKF 1QLNA 1DLOB 2M8DB 2BRLA 2KXFA 4PQUA 3BM7A 2D1CA 1SH0A 1ZM9A 3TP2A 2C3YA 1FKPA 1YWXA 5AE2A 1CVJA 1ZZFA 4EGLA 4O3QA 4M5DB 3UWTA 2XO7A 3PIPQ 4AUKA 2ZD1B 3JTPA 3Q8QB 1FDAA 1D9FA 3W2VB 3M8SA 3MOJB 1R43A 3ENVA 3NKYA 4Y28C 4HKQA 5D77A 2XSFA 3KJVB 3NNAA 1JMTA 2O5DA 2YNFA 4HT7A 3SMZA 1FK9A 2B56A 5KFEA 2F1FA 5KFQA 3CD5A 3ZZ0A 2WSCC 4P2SA 4LT6A 1GQEA 4QIEA 1BQNA 2DPJA 2OPSA 2YH0A 3KNGA 4YDDB 4ECTA 4O23A 1AFIA 2XHWA 2JL9A 3ETOA 3TRGA 1DTTB 1YHQS 4QIGA 3KHGA 2FJEB 1RTDB 2K7KA 2FPHX 1P27B 1FJ7A 2DNHA 1MROB 1OPIA 4KFBB 1XNRF 2MQOA 3KK3A 1JLCA 5CQGA 3I9ZA 4QWEA 5KFIA 1W2BR 4K2XA 3JSRA 3CCSS 2HPUA 4K4SA 3DRRB 3HO1A 1UETA 1NK4A 5J2PA 2E9RX 2HHXA 3MR6A 2YKQA 4FS1A 1QY7A 5A8RA 2OMOA 5KFYA 3I31A 3T6BA 5KT2A 3CCLS 2J9EA 1WI6A 2RU3A 5HLFB 4LF8F 4C11B 2HS3A 3RRKA 4JI3F 4QU7A 2GMJA 3DRSB 3MM8B 4N76A 1QUPA 4MFBA 4OZ0A 3OR1A 4HTIA 3MD1A 3QLHA 5FJ4A 1URRA 3UW1A 1U6BA 4WKRA 4ECQA 1H2TZ 4IRDA 2BE2B 4BDPA 2VOOA 3MZIA 3DOKB 2MYFA 3MFIA 2MDAA 2EFQA 2FVSA 1UFWA 4USJC 2Z0GA 4IUFA 2XNRA 2HHQA 1E6VB 3OW2R 3DU5A 3HZEA 3JYTB 3RAXA 1N6QB 1HNIA 2MQMA 2UXBF 1G7CB 4FNIA 1S7HA 2HNZA 4EO6A 3JB9k 1U2FA 1RDRA 1MROA 2BVZA 4NA2A 3MR2A 3HHLA 1U6FA 3TANA 2V0NA 1CLFA 3I0SA 4A47A 4GO5X 3NMAA 2HHHF 1RGVA 4NLRA 2XI2A 5AXLA 5G4DA 4U9RA 3MMBA 3P49B 2VB6A 4FP9A 5E2QA 1N33F 3OTCA 3M8QA 4TY8B 2PC6A 2LA4A 2HWHA 2DR8A 1H2UX 1G6BA 5A0YB 1TKZA 3BGFA 2VG7A 4DL5A 1MMNA 1RT3B 3KKFA 5J1NA 2VASA 2PDAA 1JLAA 4WU3A 1FO1A 2C3OA 4A8OA 3RB4A 2FUG9 1NKCA 1D3WA 4F3QA 5GADI 4RLEA 2A18A 3LAMA 2CQCA 2RB7A 1VRTB 2MQLA 4NCGB 3T1AA 5F8NA 4LMZA 4QZVB 2V8GA 3R5DA 2B6AA 1U1NA 3DOMA 2IRYA 5CXTA 2IM3A 4QWAA 1U25A 3CD0A 3JTNA 4C8OA 1IQTA 3Q8SB 3UCUP 4IG0B 2ABYA 2K8GA 3DYAA 4ES3A 3CULA 2LEPA 4EO8A 1RKIA 3RW7A 3TYTA 5M2UA 1HMVA 2JC0A 5EX3A 4O4GB 2YNIA 2C3PA 1UAWA 1T02A 3AB2B 3K5NA 3I96A 1HBUB 2XMJA 4KO0B 1KVJA 3GFHA 3D1HA 1C1BB 2OPRA 2AYBA 4NLTA 2M4MA 2MZQA 4ZDNA 1FEHA 2XMUA 5DDQC 3T5KA 1X9MA 1GH8A 3KJVA 3J7YI 3PRBA 2R2RA 5A0YA 5CZXA 3LAKA 3PKMA 4YUDA 1Y5LB 2JDJA 1SKSA 2M5YA 1N52B 3DMJA