2K8GA

Solution structure of rrm2 domain of pabp1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
GADPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RRM2 domain of PABP1
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Polyadenylate-binding protein 1
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k8gA00
1ZZNA 2DNYA 4BS2A 5DETA 2E5GA 2OSQA 2CQ4A 1K8AT 2CQ2A 1DHMA 2DNZA 2J76E 1G2EA 1U1LA 3MD3A 2MJUA 2E5JA 5BJRA 5ITHA 3LPYA 2KFYA 3NNAA 1WG5A 2L41A 2LXUA 3BO2A 1FJEB 2DIVA 2RT3A 2LEBA 2DGTA 3CPWR 2KN4A 2FHOB 3NNCA 5DM6Q 2DNPA 4F02A 3CMES 2JX2A 2MY7A 1FO1A 2DGSA 2HYIB 3N9UC 3G6ES 1YITS 1X4HA 1Q86T 4OZ0A 1B7FA 3HHNB 1FJCA 2LCWA 1X5SA 5CA5A 2MJNA 2U1AA 3G4SS 2E5IA 2EK6A 2MQLA 3PIPQ 3NMRA 1U1KA 1H6KX 5DDPC 2ERRA 1X4GA 2DNHA 3CD6S 1VQPS 3I56S 3VAHA 5IM0A 2CQIA 2HGNA 2GO9A 2O3DA 4IO9Q 4PRFA 3J7YU 3G8TA 1D8ZA 3UD4P 1Q82T 3S7RA 2CQDA 3P3DA 3MURP 2ZJPQ 1JJ2R 4QU7A 2SXLA 3DXBA 1VBZA 3NNHA 1YI2S 1KD1T 1U1PA 2LYVA 3THPA 1HD1A 1WG1A 2V94A 1SJQA 1H2UX 3B4DA 2GHPA 2F3JA 1ZZFA 3SMZA 1HL6A 2LA6A 3U1LA 5JVGQ 5LSOA 1U1RA 1QVGR 3MUMP 2CPJA 2DNGA 2RQ4A 2K3KA 2CPIA 3LQVA 5FJ4A 1VQOS 2KRBA 4Y00A 2FC9A 2QFJA 1UAWA 3VAIA 1UP1A 2MXYA 1JJ4A 2M70A 1K9MT 4YOEA 2QA4S 1N52B 2DISA 4UQTA 3MUTP 5GVQA 1Q81T 4QU6A 2F9JA 1SJRA 4FXVA 4P6QA 2OTJS 2M2BA 4F25A 2LEAA 1HD0A 1VQ8S 5H1SV 1KOHA 1UFWA 2MQMA 2I38A 1N54B 4LIRA 1UW4A 1WELA 2PEHA 2OIHA 1D9AA 3ZZZA 1SJ4P 2MKCA 2N3OA 3CCUS 2OTLS 3P6YC 1U1MA 2KG1A 1NU4A 2X1AA 2J8AA 1YHQS 2X1BA 2KU7A 3D2WA 2N82B 1FHTA 2I2YA 3R1HA 3UCZP 3EGNA 2DNOA 2JWNA 4A8XA 1Q7YT 4IOCQ 2YH1A 2N7CA 2YWKA 1VQ9S 1M5KC 3EGZA 2VONA 2VODA 1IQTA 3MXHP 2OSRA 1VQKS 4TU7A 4C7QA 2ADCA 1WI6A 2M52A 5CYJA 4ED5A 1KC8T 1S79A 3CTRA 2M8HA 2ZJQQ 2FY1A 2DH7A 3V4MA 3I55S 2NLWA 2D3OR 5DDOC 2M4MA 2DGQA 2DGWA 2CQ1A 3P5TL 2OJ3A 2CQHA 2DO4A 2DNNA 4EGLA 1VQ6S 2CPDA 3G9CA 4W92B 3IWNC 2DGOA 2RUGA 1YJNS 2DK2A 2RQCA 1X5OA 3G8SA 2DNQA 2VOPA 2BOPA 3CCRS 3HI9A 3P49B 1OO0B 2KXFA 1AUDA 1WF2A 1RKJA 2LMIA 1JJHA 2G0CA 1U6FA 3TP2A 4TU8A 2CPEA 1VQNS 2DGUA 2DB1A 1VQLS 4ERDA 4WFBQ 4WCEQ 2PE8A 4F26A 2FC8A 2DH8A 4UY8T 4Z2XA 3B4MA 5D77A 5DDQC 3BO3A 2CPZA 4QQBA 2DH9A 2M7SA 2RS8A 1SJ3P 4C4WA 2U2FA 1K73T 3MDFA 2X1FA 3VAFA 1YJ9S 2MYFA 1WWHA 2YKAA 4CIOA 2DNRA 3H2VE 5HL7Q 1YIJS 4FXWA 2CQGA 3R1LA 1VC0A 2HZCA 3UD3P 1S72S 2KYXA 2MZ1A 2CPHA 1DBDA 3ULHA 1WHVA 1VQMS 3R27A 5GAEU 2MQQA 1X4DA 2DO0A 1VQ7S 2X1GA 3MOJB 2J0SD 4TU9A 1ZH5A 2ADBA 2MMYA 4U67Q 3THTA 1X4FA 2VOOA 2LXIA 5LXRA 3CULA 2EK1A 4OZ1A 3H2UB 3Q2TC 1U1OA 2MZQA 3UWTA 1SXLA 2MQPA 2DNKA 1CVJA 1DRZA 4CH0S 2RRBA 2XS5A 3FEXB 5JVHQ 4YUDA 1WTBA 2MGZB 5D78A 1OWXA 2D9OA 2F9DA 3TYTA 2M88A 2DHXA 5LJ3Y 2MQOA 1H2VZ 3VAMA 2JVRA 2MZJA 3MUVP 2DHSA 3BO4A 3L3CA 3MD1A 4YB1P 1WEYA 4PR6A 2AYMA 5IFMA 2M8DB 1HA1A 3ZZYA 3CCQS 2HGLA 2ZJRQ 1NO8A 2MSSA 2KXHA 2MZSA 3PIOQ 1X4AA 2G1DA 4WKRA 2NZ4A 1F9FA 2DIUA 3US5A 3IRWP 3CCVS 3K0JA 1WF0A 3BS9A 2CPFA 2CPYA 1NJIT 1WEZA 1YTYA 1M5VC 4Y0FA 2DHAA 1A7GE 2XSFA 1U2FA 2LQ5A 1X5TA 3RW6A 2N3LA 4RU2A 1WF1A 2DNMA 5LSLA 2LECA 2KM8B 2HGMA 3SDEA 4W90B 2DNLA 2MKSA 2RS2A 4J5OA 3VAKA 2KI2A 3VALA 3NS6A 3CCES 1P27B 2CQCA 2DGXA 3TO8A 3CMAS 1A9NB 3S01A 3DLLQ 2XNQA 1WHYA 3EX7B 1M5OC 4ZKAA 1X5PA 3UE2A 3U1MA 3S8SA 2MB0B 1FJ7A 2A3JA 1W2BR 1VBXA 3CCLS 2LKZA 1P1TA 2L08A 5IM0B 1FNXH 1WHXA 5HO4A 4WFAQ 1U6BA 1VC5A 5GADU 3J7ZT 1H2TZ 3CC2S 3CUNA 1X4BA 3CCMS 5LXYA 1M90T 2MKIA 2MGZA 3Q2SC 1WI8A 2RNEA 2KH9A 3G71S 1QM9A 2FPHX 1FT8A 2MPUA 2MSTA 2MKKA 1KOOA 1X0FA 5EN1A 1VQ4S 3VF0B 1X4CA 3S6EA 2KG0A 3G96A 1WHWA 2JVOA 3OW2R 2YTCA 1WG4A 2YH0A 2AYGA 5CXTA 4WF9Q 2EVZA 3UCGA 2RU3A 1YJWS 1VQ5S 2MHNA 5MLCV 1BY9A 1PGZA 1X4EA 3CC4S 1O0PA 3BEGB 2XS7A 4CQ1A 2MKJA 3VAGA 2KHCA 1N88A 3SDEB 2MKHA 2WBRA 2AD9A 2K8GA 2MY8A 3JB9k 3CXCR 4WIIA 2CQPA 3CF5Q 3NS5A 3CC7S 5DM7Q 2XS2A 5LJ5Y 4TLQA 5GAHU 4LJMA 3SXLA 1RK8A 4QPTA 1OIAA 1FXLA 1VBYA 4V19X 1KQSR 2KT5A 1U1QA 2UP1A 2MZRA 4PKDB 4LMZA 2MZTA 4M5DB 3FEYB 2B0GA 2KVIA 4CH1A 1N8RT 2JRSA 1R8PA 2KRRA 2KXNB 2CQBA 2RRAA 1URNA 2M0GB 4IOAQ 2DITA 2CQ0A 2AYEA 2M9KA 5GAGU 3VAJA 2AYBA 3UCUP 2RVJA 5IQQA 2QEXS 1PO6A 1U1NA 3CCSS 2E44A 1QVFR 1SJFA 2J0QD 2XNRA 4C0OC 1JMTA 3CCJS 2LA4A 2CPXA 4IUFA 3MI7X 2Q79A 1VC6A 4WFNQ 2MQNA 2CJKA 1M1KT 1YWXA 2DHGA 2L9WA 2DGVA 5DDRC 1R8HA 1DZ5A 3RW7A 1XN9A 2BZ2A 2KM8C 2D9PA 2XB2D 1OPIA 1WEXA 5GMKa 2G4BA 1L3KA 2E5HA 2CQ3A 1M5PC 2HVZA
chains in the Genus database with same CATH superfamily
3IC1A 5JJBA 4OI2A 4J9VA 2HURA 4P73A 2ATCB 1N0VC 3GIKA 2ZH6A 3RAQA 2C2RA 4DSLA 2V2ZA 2OPPB 3IS9A 2OSQA 2HG4A 3UO0A 4M5IA 4CLYA 4C2MA 4ECUA 4W4MA 3QFWA 1IWGA 3K2YA 4M5MA 3GG1A 4TYBA 4YY3J 3PR5B 4FBTA 1FRXA 1TKTB 3J7YI 2OMOA 1RAGB 5HROA 1NUEA 4FYWB 4OJ3A 4I56A 2J76E 1TK5A 2C2MB 5D4NA 1WSVA 2B4VA 2YKNB 3U7JA 4YHHF 2ACMA 5ITHA 2RH3A 2VQFJ 1IVZA 5K9FA 1REGX 3N01A 2RT3A 2FJVA 2LEBA 2PD1A 2QJ3A 2KJVA 5ETVA 3OR2A 4NI2A 2KN4A 1RWWB 1KR4A 3PHEA 4OI4A 1UEVA 8ATCB 3MR6A 3AJ1A 4J9PA 5A6WA 4XPCA 3OTOJ 1TKXB 4K8RA 2ZZNA 2G9OA 4PWWA 1YKWA 5J1NA 3PEJA 4UZBA 2AJ0A 2JX2A 2MY7A 3PTWA 3A8IA 2LU2A 5J2MB 3HZEA 2XMAA 4JI0F 4K2JA 4IRDA 1MWZA 4GKKF 1EETB 2YQ1A 3K5LA 3W61A 1QSLA 1VRUA 3BGUA 4OZ0A 1Q86T 2YKOA 4DV3J 4URSA 2W9CA 1JKHA 4YB7A 4LSZB 1PC5A 2JFDA 1MROB 2CZ9A 3NKYA 1I51B 2HSEB 4NWBA 4F3MA 2F4FA 1SB6A 4N7TA 3PIPQ 1LWFB 3C15A 5I42B 1FNMA 3BSOA 1U1KA 3V4IA 5DDPC 1X4GA 2DNHA 3KG1A 4A8KA 2Z0GA 3T41A 5IM0A 1KBRA 1NEEA 2F4VJ 1W7WA 2GHWA 4FF2A 3CDAA 1D8ZA 2EXUA 3A4TA 4ZVOB 1Q82T 4NLRA 1Y7PA 4YQWA 1HNXF 3ZTOA 4WP8A 1WACA 2E1PA 3T5LA 5DG7A 2ZJPQ 1QUPA 3Q22A 4RPFA 3MEDB 4NLOA 2F40A 4PG6A 4X64J 1KONA 2XLIA 1A0OB 4GKJF 1IKVA 5ETPA 1VBZA 1N36F 2NXUA 2IM3A 2CJBA 3HSZA 1RA7A 4OZNA 3SV3A 5KG4A 1TQLA 2FD2A 2D3O1 5D0RA 1NK5A 2XGQA 3THPA 4MKAA 1K1QA 1LK7A 4DR7J 4ZVPB 4KC5A 1ZPWX 4QWEA 1H2UX 3DYAB 4M5KA 3BQ0A 4MT1A 4JI5J 2W2QP 2DR8A 2UXBJ 4LQ3A 2W7OA 1ZZFA 4QR0A 3BM7A 3SMZA 4AE5A 1IKXB 4B3MJ 3QT6A 3F44A 2LA6A 2I1RA 2QE5A 3CJKA 5GAGI 3KJVB 2ZM6J 4JI7J 1GH8A 2CPJA 4ED1A 1F5AA 2G13A 3W9HA 2PEBA 4OV6A 2HFNA 1J27A 3KJFB 2IA0A 4AXIA 1JNRB 5B7WA 4PUOA 3EGWB 3T1YF 3LQVA 1N5YA 5FJ4A 2BEFA 1HBUA 4FKXA 1BC6A 2OMLA 2DY9A 4DSIA 1UAWA 3W62A 4DPYA 2UU9J 2JC0A 2F65A 1PAEX 5A8KB 4ECTA 1HR0J 2UXDF 2HRUA 4WK3A 3MUTP 1T0TV 4Q2MA 2QGFB 2NXCA 2DT9A 3KWMA 5SUHA 1U49A 1PJ6A 3C16B 1SJRA 2MHEA 2J0WA 2HHPA 2HWTA 2PN6A 2VBWA 2LEAA 2PT0A 2FHJD 4RW9B 1VQ8S 4NLPA 1K47A 3NAIA 4LQ9A 2FGCA 3T1HJ 4R8UA 2MQMA 2RAQA 2HQGA 2ZEJA 1RHQB 4PPDA 3SQGB 3M9MB 3EPIA 1HBUB 1H7WA 2NSCA 2OIHA 2GW8A 3RRHA 5BR8J 1U8WA 2QN6B 4A8SA 4KPYA 1D9AA 1FA0A 2DCLA 1NB7A 3GCXP 3LP0A 2VBYA 1HMVB 3CJ3A 3E3XA 4P7TA 4PABA 4F7VA 3CCUS 2OTLS 2NQPA 1U1MA 3UVJB 2PGCA 3HMJG 4DSKA 2ZDOA 2X1BA 3OHAA 4FDFA 4U7UK 4DL3A 2YVSA 2QC3A 2Y8YA 3DDNA 1DTQA 1S57A 4PPZA 2I2YA 3R1HA 1MNEA 2YKQA 4OZ5A 3UCZP 4LF8J 4TQRA 1JLGA 2DNOA 1JLAA 2JWNA 2P2CB 2BM1A 2BQRA 1Q7YT 2HZAA 4KJIA 1HQEB 2YWKA 2ZWOA 4WE1A 3SCLE 3SSSA 3ZNJ1 3HSDA 1RDRA 4CO4A 2BKNA 2VONA 2YWWA 3RAXA 3Q89A 1QDUB 4U9RA 5C2CA 4NA1A 4DV1F 4IG3A 4LVNP 3SSRA 4TU7A 2ZWPA 4C7QA 5AXNA 3L9ZA 2Q3PA 1U45A 2R42A 1WI6A 1D8YA 1B64A 2C3PA 4J91A 1Q7LB 1Q5VA 3ENWA 4A8OA 1FD2A 2UVVA 1WC5A 4G3IA 3IM9A 1E6VA 2YNFB 2XO7A 4DI6A 2HWHA 1IQZA 2NLWA 3AJ2A 3FVYA 1TK0A 1RCOB 1HWUA 2M4MA 2RUSA 1RT1A 1F5BA 3O44A 5HVGA 2GVDB 2B51A 3H4DA 2BJ7A 3MEGA 5F9LA 3OUYA 3MGJA 3P5TL 4F4XA 4ZPBA 2HHHJ 2NXEA 3KDNA 1RTHA 2OEJA 2AQ4A 4EGLA 1VQ6S 1TUWA 3EVMA 3G9CA 1UMJA 3SQOP 4W92B 1NK4A 4M5GA 2RHQB 4EK2A 1W26A 4OZJA 4OYOA 4DPTA 4DMZA 1VS3A 2RUGA 3ENVA 2DK2A 2HLUA 3U27A 1HBOA 4ZCLA 3RB4A 3WZ0A 3C14A 3JQMA 4RL1A 5CD4H 1JJCB 2OFHX 3CB4A 3IFEA 3CCRS 2AJQA 3TEHB 2WOMB 4MYTA 2K1RA 3V6DB 3A8EA 2I9SA 1NK9A 1DFDA 3DMJB 1WF2A 3HX9A 3KUEA 4CH7A 3RTVA 1B7YB 1NHUA 2GAHC 3LA0A 3KHGA 4PWDA 4F4WA 1WD6A 1IBMF 1R0AA 4TU8A 3FEZA 4NYPA 1LWCA 4RJVA 2DGUA 2DHHA 1VQLS 4JI6F 3KK1B 1LW2B 3FK4A 1IBKF 4ELVA 1XMBA 2ZH2A 7FDRA 1S6UA 3NG8A 3R9LA 1D9DA 2IA6A 3KMSA 2VJVA 1U4BA 4UY8T 1EAYC 2FVPA 4ZJOA 4Z2XA 5DDQC 2CPZA 4HHJA 4NLSA 1HMVA 5I3PA 4Q0BB 2DKOB 2YNHA 2VBXA 1FDDA 2VPZB 2RS8A 1UJ5A 5LL6d 2R8HA 4C4WA 1K73T 1UL3A 2FYXA 1XMQF 1UA0A 3F41A 4OYBA 4ZVQB 3HVTB 3AQOA 2MYFA 1WWHA 5C25A 3UR0A 2ZH8A 3EZUA 4CIOA 3BSNA 1V3RA 2W2NP 5HL7Q 1YIJS 4QYZJ 1HNIB 1VJWA 2XY6A 1Y3JA 3NXZA 1S5ZA 2KT3A 3PYDA 3Q83A 1NSKL 4FXWA 5K5MA 1RT5A 4CLPA 4FF3A 4H4MA 3R1LA 5A8RA 2HZCA 5CD4A 5AXKA 3THVA 1FEHA 1UW9A 2KYXA 3CIMA 4LF1A 3NGSA 2VKZG 3Q8RB 1B0PA 1WC4A 5KFIA 3AT1B 3KLGB 3QZ8A 4NA2A 4X4NA 1F3FA 2D69A 2VH7A 2ZH4A 4FYXB 1RAAB 3R27A 3W2VB 4ES3A 1VISA 1X4DA 2AZ3A 1VQ7S 4TVAB 3GCWP 4RW7B 4O3SA 2QO3A 2VDIA 1C4AA 3ENAA 2XM3A 5E3CA 4OI0A 3MM5B 1R0CB 2ZNYA 3GONA 1ZH5A 1ACMB 1Q5YA 1CS4A 2MMYA 2ZBRA 3HVTA 1IM4A 5C25B 2EWHA 4O0NA 1UCNA 2R7QA 3LAKA 1VLYA 1AB8A 3OFFA 2IPOB 2HQ3A 4OYZA 3TJ8A 5DJBA 5M2UA 1NKEA 4O0IA 3VQTA 1PYSB 2RQKA 1SC1B 1N5YB 3UWTA 4P52A 1SXLA 4RNFA 3FRYA 1CVJA 2ZOGA 2GGPA 5U47A 4CH0S 1Y5LB 3MCMA 3QSIA 3V5RA 3LP1A 4DSEA 4EO8A 1WOSA 5A2QY 1M0SA 2MGZB 4ICLA 2ZDPA 1ZAXA 2D9OA 4ZVUB 4QWBA 2M88A 3BQ2A 3U02A 1YGYA 4NOHA 3ISNC 4OI6A 2MQOA 4EZ9A 3C14B 1H2VZ 3VAMA 2C2OB 2IYGA 1IR0A 4UOHA 3UN3A 3JYTB 3JSMB 4DV4J 5AE3A 4L72B 2GV1A 1OS5A 2ZBQA 3V6DA 2AYMA 4C11A 1N5TA 3CCQS 3UW1A 2AGOA 2R4FA 1NO8A 4WWSA 3J7AN 2KXHA 4ZVEA 5HBMA 1X7VA 3GFZA 2ZC3A 3ZZUA 4OYMA 4RWXA 2AIRB 2FLNA 3MEKA 4I1TA 2R7UA 4FBUA 2W2PP 2NZ4A 3KHRA 2ROPA 3CCVS 1T05A 2EI5A 3UR3C 2BJ8A 1NPPA 1FDAA 1WF0A 4KV8A 1T3NA 1NJIT 5CYMA 3K57A 3PXGa 4Y0FA 4N8OA 3OLAA 5BYQA 1RE1B 4L6V3 2J9EA 4TLRA 4GO5X 2HMIB 5J2QB 3J81Y 1IKXA 2N3LA 4LREA 1FKAF 2B8PA 3D6MB 3I9ZA 3RBEA 4RU2A 5LSLA 2C28A 2RS2A 1UZDA 3RYLA 3VAKA 3T1HF 1FE4A 1WC1A 2XI2A 4D3HA 3ZO7A 3CMAS 3MM8A 3LGHA 2AJ1A 1A9NB 4IG3B 4Y3CA 4X65J 1WHYA 3DI6B 1RP5A 1M5OC 5D4PA 1XWLA 3Q8SB 1KVKA 1IJFB 3UE2A 5AJ3F 3KLFB 4WBFA 5A8WA 3TJAA 2OD4A 3R5CA 5B0BA 2GX8A 2HQIA 3CCLS 2M3DA 4DCPB 1JXVA 3ET6A 2ZHAA 1LOUA 1R27B 1B99A 3NP5A 1WHXA 3CE8A 2GQCA 4MIBA 2IM1A 4RW6B 2R7TA 1PBUA 2Z4PA 3DGVA 3W8PA 2DPJA 1ZPVA 4RW4A 3M2UA 4WFAQ 5C5JA 2CJQA 3JTNA 3RBZA 3OVBA 2VC1A 4JOUA 3K58A 1PKUA 5B0FA 3MHYA 4WZMA 1FXRA 3L7OA 1X4BA 2GIFA 3SQGA 5DZ7A 4DU8A 3VWSA 3P4UB 5EX3A 3FUYA 2D1CA 2GGPB 4CLKA 3BBCA 4DXLA 2MKIA 3R2CJ 1S9FA 2XY7A 1NXIA 4G1QA 2BW2A 2J8SA 1Q1KA 4OJ1A 4EYHB 2V2KA 5JMNA 2RNEA 2LQ9A 3QLHA 4OZLA 2R8KA 4NXNF 3G71S 2J6TA 5ADZA 1UFLA 4PEOA 1S0OA 3KJQB 2N7YA 2WSCC 1HBMA 3KK3B 3BPSP 2MSTA 2MKKA 1HYSB 1RHKB 3FNNA 1DQAA 1WJ9A 1WTFA 1C1CB 1KKHA 2VG5A 2ZKUA 4HACA 3VF0B 1N34J 4LF5F 3DDIA 1FTCA 3RR7A 1TL1A 1WHWA 2JVOA 4G1PA 3MOZA 4OX9F 2XY5A 2DRDA 2YTCA 4N56A 3OW2R 4HH0A 1WG4A 3AD7C 5HBMB 2BE2A 3GV5B 1V9OA 2AYGA 1RBLA 2HK2A 1F0XA 2PSZA 4JV5F 4WF9Q 1BGXT 1MROA 3ISND 1OY9A 3Q8UA 2V9WA 3DHXA 1TUGB 1X9SA 1GNKA 2ZVIA 1VQ5S 2YNHB 1GMVA 2EFOA 2FJDB 2DXEA 2NXJA 1SH0A 3BKFA 1CJUB 1CJVB 3Q0AA 2XS7A 3PR4A 5KFNA 3PYEA 3QAUA 2HHUA 1UJ4A 2NPIA 4ZLLA 2H3EB 2OLWA 5KFVA 2X7IA 4X62J 3GIIA 1Y10A 4CTAB 1E6YB 4DX5A 1IBMJ 3QAEA 4JI7F 2VASA 1AZSA 3GP9A 3HT3A 3TEGA 1G4CA 5L46A 1Q4RA 2VF3A 1ZA1B 4O4GB 5EDWA 2JDJA 1NK8A 3PACA 4I6WA 5EWGA 3D28A 4WIIA 3W9JA 4DX7A 4R8UB 3PKYA 4KHMA 3MM8B 4LF6J 1EKRA 4C97A 3I5AA 1F6TA 4C8ZA 3NS5A 1NCLA 3CC7S 1SL0A 1MSWD 4YDXA 3KYLA 4KKOB 3W5YA 2KTQA 3I0SA 3POTA 4WXOA 5LJ5Y 4J9LA 1MN9A 3J7A1 5B0AA 1TFWA 1TKZB 4E8UA 1I1GA 4LJMA 3SXLA 3KLEA 1U2CA 3M8SA 5IC6B 1RK8A 1XJWB 2OPRA 1CS4B 2RF2A 3H25A 1BQMB 2K1RB 1HI0P 1FXLA 1RTJB 1VBYA 5F8GA 4URGA 2W2OP 4YS2A 4U6PA 1AUSL 2W2MP 3QRPA 2MZRA 4DUTA 3ELHA 5EGYA 1Q16B 4O3OA 2Y8WA 4DDFA 4YMEA 1HNZF 3CMQA 1CULA 2IVMA 1KNZA 1U0HA 4J7CA 3I0RA 3AD9C 2B0GA 1LV5A 2NR0A 4B9UA 4OJGA 4P9SA 3HHKA 4CT9A 5F0WA 1SQEA 1V3SA 1EQMA 2OPSB 1D0EA 2PC6A 4B02A 5F8LA 5L1IA 2CNLB 4KKOA 1KLMB 4LRFA 1NSAA 3OL6A 4WZQA 5E5NA 1AA1B 1TKZA 3KLEB 4DFMA 3FFIA 2RRAA 4A8WA 4ZPDA 4IOAQ 4C11B 4NLGA 2HKEA 1X31C 2DXFA 3M8PB 2HK3A 5I3QA 4OYIA 4PQUA 1NNDA 3D68A 5AE1A 1TP7A 2P6SA 5D0HA 5CAAA 4XTTA 1XMOJ 4U7UD 3EDRB 4C98A 4N8NA 4E98A 1UJ6A 4K4WA 4ZCMA 4C0OC 4O44B 1OPZA 3BKTA 2JNJA 1WKLA 4L76A 4QYRA 1RUSA 2XZTB 1N5SA 3W64A 5F8IA 5KFMA 3PW4A 3MI7X 1U02A 4PXEA 4K4TA 2GVZA 2ZOMA 3I4HX 4UW2A 4DV1J 2HNYA 3C19A 4DF4A 1Q8LA 1CJUA 3TRGA 4NXMF 4FS2A 3H2LA 2DHGA 2L9WA 4QW8A 4DR5J 3A1YG 3VTIA 1DZ5A 3RW7A 3NLCA 2F8MA 2WB4A 3HM9A 2GC8A 2V68A 3PG9A 4PQUB 3MTKA 1VQYA 4Y2KA 5IS2A 1WEXA 2WSFC 1Q8KA 3KK2B 4X4OA 3BN4A 3DFEA 3JQKA 4X66J 4I0WA 2HVZA 4LF8F 1W2IA 3RG6A 4CO5A 1YJTA 4K7QA 4JI3J 1T9VA 4BS2A 2AP6A 2H4WB 1EP4A 2CQ4A 1VGYA 4KGZB 4OQJA 2CKWA 2FVCA 5D3GB 2B5JA 5BYSA 1N4LA 1DHMA 2DNZA 4K4XA 3TA1A 1AT1B 1BQMA 1R0BG 1F3VA 4B3RF 4X4UA 3ILJA 2ZITA 4HDGA 3BQ1A 1U1LA 2I8EA 3K5NA 4ZN3A 4N47A 1ZTTA 2EFNA 3IBFB 4AUKA 5BJRA 4OX7A 4OMFG 2WK4A 3TA0A 4J9NA 4DL7A 1FX4A 2LXUA 4BBYA 3EVWA 4F2SA 4LF7F 2K06A 2ZVSA 4Q45A 5K8PA 1S1TA 1HLWA 2DGTA 3CO0P 1GTHA 5BR8F 5C24A 4UUWA 1MW7A 5E0OA 3D67A 3IRXB 2IAJB 2YWGA 4ZLJA 2ZD1B 3DLGB 3G87A 3PV8A 3UDVA 4UY85 2BANA 3K8WA 1U48A 2BVZA 3MAAA 2DNPA 4KIAA 1L3VA 5LM7E 3ZZRA 4XDDA 2R7OA 1GQEA 2FTRA 3JS9A 4YFUA 3AXMA 3PVXA 1S77D 2HYIB 2ACYA 3N9UC 2VA2A 3IBCB 3T5JA 4K50A 5DGAA 4XIUA 1XR5A 2IJNA 1X5SA 3MEDA 2QT7A 2CNOB 3OXLA 3ICLA 4TY9A 2MJNA 3IM8A 4FNHA 3BYRA 2FLLA 4WP3A 4V1Ak 5HQLA 1FRJA 4O44A 4IFVA 1S10A 3NMRA 4JI2F 3PKMA 4RWWA 1CJTB 3M1VB 1N5VA 1RB0A 1HPZB 2RB7A 3TZYA 5C42A 1TL3B 2HGNA 1RHMB 1Y3KA 4DSJA 4DEZA 4IO9Q 4JV1A 3VZHA 4F0MA 4I2QA 3HHEA 1NSPA 3UD4P 4DQPA 1I5OB 1V5IB 2WVDA 4KYZA 4OHWA 2QSWA 3KG0A 1XMQJ 1JK9B 3P3DA 4ZPWR 4C6AA 1XR6A 2WHOA 4GRSA 1QLNA 1RT5B 4OX8A 4XDCA 3UDLA 1VK3A 2VG7B 4FNIA 2AZ1A 2BA9A 3PRBA 1RWMB 3ETMA 4Q5VA 4OHVA 4IRKA 3UD5A 1H3DA 4ZMMA 2FJWA 1MN7A 4IFVB 1YI2S 4O3PA 4MFBA 2LYVA 4ZVSB 4DCOB 2V94A 3TX0A 2O01C 4D3GA 2GHPA 4WK1A 2F3JA 4H4OB 4K5RA 5G0RA 1O51A 2VJUA 1NHVA 1TL4A 2QA4G 4JI4J 2OH2A 2G2OA 2L3MA 2HW3A 4NCBA 1S9EA 1HI1A 2D74B 4DS5A 1P6TA 2P6TA 5DQIA 1TV6A 4A4JA 3OV7A 1FI4A 3MUMP 2WVCA 2FUG9 3N6MA 3IGVA 4GKKJ 2JEIA 1T9XA 2ZOFA 3K89A 2QTWA 3HHLD 2WZ1A 1DLOA 2BJ1A 5CABA 4GKJJ 3IWLA 3QIDA 2H54B 3IRXA 1SC6A 3GZ7A 3KLFA 1JJ4A 2K7JA 2OPQB 3CGIA 4DUYF 3MCNA 1HNVB 2B3TB 2CRLA 5A8WB 1N56A 4YOEA 1UPMB 1FK9A 3W60A 2IBKA 1UVIA 4KPCA 3HK2A 3PYGA 1Q81T 1I94F 4TKTA 3MM9B 4FXVA 4CYUA 1WORA 1HHSA 1SC4B 4USVA 4F25A 5KFXA 2B4OA 4RUCA 1HD0A 2GS8A 4CLFA 1H73A 1UFWA 3QGIA 2I38A 5CHCB 1I94J 4LIRA 1UW4A 1WELA 2PEHA 3TUJC 5KG2A 1HWJA 4OFZA 1SL2A 1S9GB 3ZZZA 3GE9A 4QZVB 2W8KA 1SJ4P 3GTYX 1TELA 1T05B 2UVUA 3I0SB 2UUWA 2B4UA 3POTB 5J2PA 2A0FB 1JNZB 2B9WA 1RT3B 4B3TF 1NU4A 4M5NA 1FK9B 2J8AA 1YHQS 3FCWA 4RBVA 2KU7A 1TL3A 3D4JA 4TN2A 1AYEA 2MTLA 3D2WA 4LFBF 5HATA 4OHXA 3M6UA 1WDDA 2BKOA 4NX9A 3ZXWA 1VMBA 2M5YA 1LWEB 3HXMA 4IG0B 4OYPA 3G82A 3IN5A 4IOCQ 2DPIA 2N7CA 5K14B 3WBZA 1M5KC 2CIMA 2E1RA 2B9YA 2Z2LA 3OJUA 1RT4B 5E33A 3EGZA 3D0IE 4X2BA 3M32A 2VODA 2B7CB 1HQ2A 1OMSA 1FRMA 4C3KA 3MXHP 2A1BA 5I3UA 4Y6IA 2UV8G 1HW9A 2P8IA 4I2PB 5KFFA 1FKOA 2M52A 4DLEA 4F2RA 1UVLA 3IO1A 1REVB 4KHPJ 5ETNA 2M8HA 3M2VB 2FY1A 2DRAA 1Z2ZA 3H90A 1TTHB 1R6VA 3V4MA 2X3DA 3I55S 5DDOC 4DFKA 4P2MA 2P9CA 1KTVA 2YKNA 3M8PA 3OFHA 4LBIA 4LF9J 1LWEA 2F1FA 1T03A 4OV1A 2JJ4D 3TAMB 1EKSA 4ANDA 1X60A 2C42A 2UUTA 3OTCA 1R43A 2DY1A 4HEA9 4DX8H 3KLHB 3R5DA 5CCLA 5L1KA 5D8HB 2DO4A 2DNNA 2PA8D 2UXCF 2HBRB 1O5JA 3ZTQA 3IWNC 4LF5J 4ALZA 2LDIA 4IFYA 4O3RA 2KZZA 3TAPA 2DGOA 2HFUA 1YQHA 1X5OA 3G8SA 3NEKA 2AV5A 3TQEA 2NYHA 3HSJA 3DC2A 3VVUA 4QJVA 1B3TA 3Q24A 2VOPA 1YBAA 1OQ6A 1HARA 1FNOA 4ECYA 1RTDB 3KK3A 2LVWA 2ASJA 3DKDA 1HYSA 2KXFA 2ZUAA 3DRPB 3PJWA 1CEZA 1VRUB 4C48A 3BDPA 3TAMA 5HN0A 4MKYA 1N33F 3WDOA 1CLFA 1S12A 2CPEA 4UT4A 3HFKA 1U25A 5GADI 3GFYA 3HD2A 3N0VA 2JL9A 4NEYA 5CZVA 3EE3A 2KVQE 2PE8A 4WFBQ 5KFSA 3HP6A 2J9DA 3IG1A 4F26A 3UPFA 1NLKL 4RUHA 1PIEA 2XGPA 2EG2A 2FB0A 2A18A 2JOQA 2YQ0A 3RRGA 3MTJA 5D77A 1BWEA 4RO0A 2YX1A 2ZH3A 4ZCKA 2DH9A 2E9RX 1IR2A 4ED3A 1N32J 4K0KJ 3TJ9A 2U2FA 2XSJB 1WC0A 3MM7B 4YN3B 1NPKA 3SSQA 5DZ6A 1RBOB 2J7KA 2WAQD 2NS1B 1RWUA 2E5LJ 1QUVA 1TZ0A 3CCWA 4K5SA 3VGSA 4P10A 4LF7J 3H2VE 2NYIA 2XMTA 3MPYA 3OSNA 1RWVB 3GV7B 4J9SA 1OY8A 4JI8J 2CQGA 2Z58B 3P45B 2CA9A 4HI2A 3QQCD 5ETRA 1LW0A 1RT4A 3TZZA 5F41A 4UTGA 3VGVA 5HK4A 3FZ2A 3NBPB 4XAKA 3ULHA 1VQMS 1JXEA 3BH7B 3CJ2A 2XULA 2YNGA 5GAEU 1EIYB 4DFPA 3H98A 2X1GA 3MMAB 2DR7A 2IM0A 3NCPA 3ZNUA 2W1BA 2B6AB 1VOMA 1FE0A 1RT6B 3AAWB 4C8YA 5KFBA 2OPRB 1LXNA 2RF2B 4FYDA 1LK5A 2VU5A 3THTA 5L1LA 3OBIA 3EICA 2CVEA 1RISA 2C3OA 3A12A 5KT6A 1RTZA 4DUZF 1S0NA 4M5LA 2ZC4A 2VOOA 1RT1B 3CULA 3FBBA 2EK1A 1T03B 4Q8FA 2VPXB 1OSDA 1M1GA 2MZQA 1JKHB 4G65A 3UNGC 4DBQA 4RNNA 1HNWF 2MQPA 5F8NA 3MEEA 2EBGA 2RRBA 3LPEA 3QT7A 4L74A 3FEXB 3NAHA 3R5AA 4PXBA 4AL5A 3OHBA 5IWAJ 5D78A 1OWXA 1KTQA 3HULA 5IT9Y 3DOKB 2F9DA 4K4UA 1HNVA 2YNGB 4Z37A 3M8RA 3GQCA 4ED0A 2BQUA 4Q2LA 2RILA 5LJ3Y 3B6BA 2WCXA 2VC0A 3MR5A 1FESA 2JVRA 2MZJA 3K7RA 7AT1B 3MUVP 3L3CA 3DGPA 3MAHA 4CO1A 4KR0B 3X1LB 3N5FA 2Z30B 2VIHA 1SUQA 5CYQA 2M8DB 2JLGA 1HA1A 4YY3F 3BBFA 2HGLA 3AOCA 3ZTRA 3ITHA 3OFEA 2EC0A 4Y28C 1X4AA 5F8HA 5HAOA 2G1DA 3W7BA 5HQ8A 4ECWA 4I69A 4WKRA 3DI6A 4DQSA 3LP1B 3IG1B 3QZ7A 4YR3A 2CWXA 1JB0C 4PRFA 3BS9A 4H54A 2CPFA 5J2PB 1YZ7A 3UVJA 4CO0A 1MG7A 2HIYA 3R7BB 1NDCA 1IUJA 3CCZA 3ILLA 4LF2A 3QJLA 2ABYA 2LQ5A 3TVYA 4R5PB 2KYZA 1M1HA 2DNMA 1GXTA 2LXFA 1LQ9A 4HR2A 3IMQJ 1SV5B 1DY3A 4J5OA 1GEHA 3L7UA 1PC4A 3CJ8A 4NXMJ 3NMAA 2HBYB 1ZAWA 2KI2A 3LO3A 4KH1B 5ETTA 4ZP8A 1P27B 2CQCA 3M8WA 4ZPAA 1X9MA 4Q44A 3K17A 4H4MB 3I6PA 3AB2B 3LH2S 4DPWA 2XNQA 4RBUA 4ECVA 1XIQA 3M7VA 1RU2A 4ZKAA 1X5PA 5AXMA 1UWAA 2UXDJ 3R5JB 1XBWA 3QLHB 1FJ7A 2A3JA 1G7CB 3MMAA 4ES1A 2E66A 4USTA 1SBRA 2LKZA 2LU1A 4WIQA 1HBMB 3RGIA 2VBZA 4DJBA 2HHSA 1RT6A 3A8KA 4OYWA 3PM9A 3MM9A 1WDTA 3HHLB 5B0GA 1NKCA 1RACB 3EYZA 1Q53A 3A3OB 2HFOA 5HLFA 2FJEB 2FY8A 4I7FA 1U6BA 1VC5A 2D3UA 4LSNB 4C0BA 3J7ZT 4DLGA 2CVIA 2DVIA 3QWPA 3VZIA 2HVHA 4KGXB 4PYAA 1QAIA 4RX6A 4DF8A 3CCMS 1FXDA 2ATLA 5LXYA 2RMLA 1NRKA 4B3MF 4OLPA 1S6QA 3FBFA 2VQEF 2DR9A 4CLUA 2MGZA 1HBOB 4ZK7M 2HVIA 4MFBB 1EHWA 5T41A 3TARA 1FJGF 2KH9A 2CDRB 2DJWA 2HFVA 1QM9A 4KBIA 4CLSA 4KAIA 5EN1A 5IC4B 2KT2A 2BJ3A 3L95X 1Q0NA 3QNWB 3GJSB 3HSGA 1DQ9A 1RWXB 1S4EA 2HPUA 4ZJQA 2KG0A 2YY3A 5FLXU 1NSQA 4NL5A 3S1TA 4NYOA 2CNKB 5HMZA 1RTIB 3H40A 4EBDA 3DLKA 1Z1ZA 2YH0A 2BOAA 3BR9A 4ZVRB 5CXTA 2E9TA 1DARA 3JSRA 4C3LA 3OT9A 1U6ZA 2RU3A 2ZE2A 3CDBA 2B9EA 3SCJE 2W9BB 1C1BB 2VKRA 3K5MA 5MLCV 3NGKA 3CC4S 5I42A 5CYMB 3Q8PB 5E3QA 3DXSX 2LQ8A 1OY6A 4CQ1A 4KRWA 3H5YA 1D1UA 1RBAA 3KG4A 3VAGA 1RTJA 4DFJA 1PJ7A 1XNQF 1YBUA 4I2QB 4F8RA 2COLA 4IQXA 2OKQA 2MKHA 1AROP 3SDEB 3OVSA 4B3TJ 1T3OA 2BUNA 4O23A 5DO2A 4ZN1A 2WONA 4O3NA 4ED2A 4DL6A 3D7SB 2W4PA 3EJMA 3O3LA 3JB9k 4DV6J 2D3ZA 3CXCR 4X66F 3ILIA 2EEYA 5KTQA 4KE5A 1U8SA 2CQPA 3CF5Q 1PAUB 1IKVB 3FGVA 2IFXA 2C3UA 2RKIB 3MPUB 4JV5J 3BSCA 2YKMA 4W98A 4NYZA 3I96A 1RAHB 2HHTA 3V6KA 3GLJA 2FLPA 4PG4A 4TLQA 1WUUA 1CJVA 3DRRA 1GK8A 3OTDA 3TOQA 5GAHU 1FFGB 4EYIB 2V4QA 1ZYQA 1HHTP 1Y5IB 2QV6A 2XG8A 3KNGA 2AT1B 2Z8QA 2BQ3A 3N6NA 4ZPCA 2Q6CA 1N48A 3DMJA 1S99A 1YBTA 4PXDA 1U1QA 4MIWA 4DUYJ 2VL1A 1Y11A 1R0AB 3CWJA 2X3GA 1BE4A 3SYZA 3W3SA 4DZ6A 1VI7A 3CCTA 3MEEB 5KT3A 2BXJA 3FEYB 2KVIA 4KQZA 1KP6A 2V8HA 4NLDA 5ETOA 5L1JA 1NK7A 2AHOB 2MLXA 4B3SF 2IDEA 1NZAA 1HQUB 3KKFA 1PG5B 4F4ZA 3AOAA 3DLEB 1IKYB 2KXNB 4JV2A 4CO2A 4QYZK 4HDHA 1KDNA 4DX6A 2J0XA 2XCPA 3RR8A 2V4JA 2UVRA 4FKYA 3QO9B 1EETA 1YZ6A 3CNQP 3W5XA 4J9MA 1IBLF 1U24A 3BGLA 2AYEA 2E1MC 4DPUA 4JI1J 1PBAA 5CCMA 2HQDA 3ZZTA 1XNQJ 2H51B 3KUHA 4TQSA 5A8RB 3EZOA 3LWMA 1LW0B 1LWXA 1U1NA 2E44A 1PILA 4DL0C 2BBEA 3ZTPA 5C2GA 1M5HA 3CCJS 3KJNB 1FD8A 1VFJA 2C3YA 4RW8A 4DN9A 5LMNF 1NK0A 3DN9A 5E2QA 5G4DA 4LBPA 3QRRA 1HQUA 3GU0A 3LWLA 5KFPA 2HAFA 1VJQA 1VC6A 4B08A 2MQNA 1N6QB 3C46A 3RRKA 2QYCA 1C0UB 3D3BJ 4F36A 2WOMA 3V81B 3D1QA 1S97A 3FRZA 1XNRJ 2A6MA 1SKWA 4C8NA 4FVMA 5DS7A 1HW8A 3SCIE 5A0YA 1TK8A 3J81j 1N34F 1GXUA 1XN9A 2BZ2A 1FCAA 3NY0A 2ZZMA 3OL9A 4PWDB 4ZCIA 2D9PA 5F3ZA 2BR0A 1N0UA 3PW2A 2FZGB 2D7SA 1FRKA 2FLOA 4ZVGA 5LT5A 3KK1A 1N33J 1M5PC 3AB4B 1W2BR 1OYDA 1HR0F 3SCKE 2OEMA 3OXFA 1ZZNA 1XEZA 3DOKA 4P72A 1Y0HA 5KG0A 1RHJB 1FF2A 2BANB 3TVKA 4QBUA 4X4RA 1T7PA 2YX7A 4UOGA 3BV8A 2BJDA 3BB5A 4LR7A 3TANA 1K8AT 4DOZA 3OJSA 1IM6A 4ZIWA 4DL5A 4ED8A 2QLBB 3DGPB 2VG6A 4ANEA 5KFDA 2FVRA 2VA3A 1F2GA 1R8CA 2QMWA 4XO0A 3MD3A 3FSIA 3MM6A 2PI4A 2MJUA 4P74A 1RCXB 2E5JA 2OFGX 3GFXA 3IA0A 4ECSA 1IBLJ 3OUYB 2C2NA 3CDWA 3LPYA 2KFYA 1WG5A 2L41A 4H4KC 3KK2A 2CJ9A 4S0MA 2AWZA 4ID5B 3MECA 2HFZA 3KLGA 4DSFA 1KVJA 2ILYA 4DR7F 2IDLA 1NH8A 4WU2A 4B9SA 2H5JB 2QIFA 2F4VF 3NNCA 3MCSA 4KHRA 4R25A 5DM6Q 4M1KA 3OTEA 2V2VA 2DEJA 4F02A 4NLWA 3PDNA 4GMKA 4NLTA 5E3PA 4KHPF 3BDEA 5HVFA 1FO1A 1V6HA 2DGSA 4FVCA 4ILRA 1IWAA 4CYUB 1P8GA 3QJPA 2HBQB 5D0EA 5KFCA 3LUYA 3TZXA 1UTAA 2RQMA 3G6ES 4WYWA 4FS1A 1YITS 4LRDA 1B7FA 3HHNB 1HHQA 3QGGA 1XERA 3FKBA 2IVFB 2IYIA 1SI9A 4MJKA 5CA5A 2BE7D 5KFHA 4OZ2A 3PX0A 1MWYA 2U1AA 4WFZA 4HYKA 1L3UA 2V63A 4NI2B 3LP0B 1H0HB 4K2XA 2E5IA 2EK6A 1PCAA 2MQLA 2PMZD 5ETKA 3EXCX 4ER8A 2EC2A 4IH7A 3CD5A 1VQPS 1P9QC 3VAHA 3ET6B 2CQIA 2P9GA 3KTQA 1H38A 3LAMA 5L9NA 2O3DA 3IAM9 4PG7A 4JI3F 4CTAA 2PIIA 1CJKB 1Q8BA 4QR2A 3J7YU 4CWBA 1ZETA 5GMDA 3PY8A 1PYTA 1MU2B 1DTTB 3G82B 4MAKA 3JQJA 5KFWA 2V69A 3C6UA 1MMLA 3BSAA 2AF6A 3M30A 2R2SA 3QRQA 2PI5A 2FGOA 2SXLA 4ZP9A 3NRBA 5E7OB 1SPBP 3V6JA 1QTMA 3BZQA 3WIVA 1KD1T 1GMWD 3CD0A 2WVFA 1RAJA 4USJC 3J80U 1WG1A 2FZCB 3M1VA 1SJQA 2QLJB 3CJSA 2BX6A 4QWAA 3B4DA 4H4KA 5D3GA 1TUVA 3L7PA 2B6AA 1S0VA 2FIUA 1RZMA 1HL6A 2V34A 2VG5B 4KFBA 3U1LA 5C7PA 4KGMA 5I4MA 3D6HB 3H59A 1MU2A 5KFOA 2DNGA 2A2DA 2JEJA 1RU1A 2RQ4A 2E7VA 3UFCX 5F8JA 4DQIA 2K3KA 1L3SA 3AJDA 3AY0A 2Y1IA 2I5JA 4J9QA 1RT2B 2ALYB 3D0HE 1QY7A 5J2NB 3M2RA 1VQOS 5HJXA 4FYYB 2FC9A 4Y00A 4HLBA 3VAIA 4GC7A 2YBVA 3CJ0A 2BE9B 4RNHA 1QE1A 4IR9A 3T1AA 2M70A 3VQSA 3LALA 1K44A 1K9MT 2BDPA 1N52B 1QD1A 3BGRB 2Y9HA 4EU0A 4H4OA 4Y2IA 2XI3A 5GVQA 1JQGA 4QU6A 1DTQB 4Y65A 2F9JA 4AL6A 4RW6A 1S9EB 4P6QA 2M2BA 4PYDA 4DR6J 2UUAF 1TV6B 1WKJA 4I7FB 3FQLA 1K0VA 2G2YA 2WONB 3PJXA 1LWCB 4WTOB 4DPOA 4YDDB 5KFAA 2FHKA 2CJXB 2RDJA 2IBOA 2V8GA 1KOHA 3WX8A 1QAYA 2APOA 2A10A 2B8QA 3BYPA 1S1VA 4QOTA 3KLVA 2RJZA 2JLFA 3GJRB 4Q7AA 4B17A 1NB2A 3T19A 1UVJA 1VYAA 4NASA 9RUBA 2N3OA 2LFVA 1KSPA 1IXKA 4KV8B 2KG1A 1FTRA 3DM2A 1K1SA 3LW5C 2IIHA 4LSLB 2X1AA 2B4PA 2W4DA 4KO0B 3PO5A 2G2ZA 1IKWB 2CYYA 3NGRA 2CJYB 3QIPB 4Y2CA 1FHTA 2GHVC 2Z2MA 4FP9A 4OYAA 3VV2B 3PX4A 4KGVB 1HNIA 2AJFE 1B0VA 1G3OA 2ROGA 3EGNA 2QL9B 5F8MA 3O5TB 4NZ7A 4GVBB 3GYNA 1GMUA 4OHZA 4A8MP 2C2KB 3I5CA 3KLHA 1VQ9S 3FBCA 4TYAA 3D66A 3I87A 4ANCA 4BHQA 5MAOA 3VALA 1TFYA 1IQTA 2OSRA 3CEDA 1TL7A 2NCKL 1JIHA 2WRMA 3NBPA 3OVAA 5H9EK 4OL8A 2LQJA 2KO1A 2MEWA 3ZZ0A 4ED5A 5KT5A 4B3OA 1KC8T 1S79A 2QL7B 3H5SA 2E1AA 2N4DA 3L09A 3MF5A 3C6TA 3DYAA 3EM1A 2EKNA 3IR5B 1TKTA 2DTJA 2HHWA 4USIA 2NSBA 1U7LA 3RAMA 4A48A 1NJWA 2VHGA 1VR6A 4P7VA 2DGQA 2VFTA 1E6YA 2KFZA 2ZBPA 1PSDA 2DD8S 2CQ1A 5KG7A 5IT4A 5KOXA 5FD1A 1WC3A 1VRQC 3N5BA 2AEJA 3VCDA 1T9YA 2CPDA 1G1XA 3UI3A 1ULRA 3TNVA 5DRKA 4DR2J 1TL7B 2BKPA 2IAJA 3M2RB 4HI1A 4OX6A 3D54A 2BJ9A 1UETA 4ECQA 1YJNS 5KT4A 2V6AA 2RDIA 1CSJA 2DNQA 3QT5A 2BOPA 1WNEA 1C2PA 2LLZA 1NKBA 3PFEA 1RA6A 4UQGA 4TNOA 3F73A 3GSIA 5J1EB 3CJ5A 4C9DA 1C1CA 4MKVA 4LBHA 1RKJA 2HNDA 1O6XA 2FJBB 1RQ0A 2ZFHA 4PXCA 4L73A 3T6BA 4CM0A 3MR3A 3MPWA 2IRXA 3N79A 3TP2A 3VVTA 1VQNS 3I5BA 3IXQA 2DB1A 4ERDA 4CRJA 3I0RB 3QMQA 4EZ6A 1VCTA 3AH6A 3ONQA 3O6QA 2CADA 3G8QA 4JV0A 4RUAA 2HHHF 5EX0A 5IT0A 5DLFA 2ZUGA 3W65A 2H1YA 3G86A 2XLKA 2XYHB 4QQBA 2GIRA 3UN5A 5B0DA 5C42B 5L39A 3J80Y 3M8ZA 2W9AA 2VPYB 1R8AA 3MDFA 4HT7A 4R5PA 2X1FA 3KFWX 5IXUA 1VIXA 1S6OA 4L75A 1YJ9S 4NLXA 4NLQA 3E01B 2EFGA 5B09A 1DTTA 3GIMA 1Y00A 2DNRA 1FFSB 3T5KA 3VHQA 6FDRA 4Q8EA 4C3MA 2GJFA 1LFPA 4JBCA 1Y4ZB 2XO6A 2KFNA 2QMUB 3DOLA 4ES2A 2Y3YA 2HS0A 4LT6A 2YWFA 3HLUA 1S72S 4EWTA 5HMXA 4OHYA 1S1TB 3M32B 3CO9A 3PNIA 3QT8A 3TUZC 2CPHA 2MZ1A 1CG2A 3NGDA 2K2PA 3R7NB 3C2PA 1WHVA 2QFIA 4RUBA 2RSQA 2R7WA 2AMCB 2ZD1A 2OEKA 3JAMU 1S7HA 3HJFA 1KLNA 2MQQA 5F3TA 2DO0A 3H5UA 1TKDA 3MOJB 2J0SD 3CIZA 2KZMA 4XK8C 4A46A 5G0RB 2XSJA 1S59A 2ZH1A 3QBCA 3MMBA 1WSRA 2KDOA 4KFBB 1SCJB 2CJAA 1T95A 2F7VA 4M63A 4NMLA 1X4FA 5L8RC 2CNNB 2Y1JA 4FYVB 2HNZB 4OZ3A 1Z2LA 1S6PB 2XWYA 2QLWA 3H2UB 5LOQA 3Q2TC 4IR1A 2IY5B 4EI2A 1APSA 1QSYA 1U1OA 2W9CB 4E2FB 4DR5F 2ZHBA 2C22A 1URRA 1RTHB 1JLQA 2NUUG 4LR9A 4LF4J 5KFEA 4RNMA 1MWQA 4YUDA 4G1QB 2QX0A 5B08A 3R2DJ 4F3OA 2BJEA 4WKYA 1OJ4A 3TYTA 4DV4F 3DRXA 3ZZOA 2XHCA 3A8JA 4AXJA 3E51A 4DN0A 5BXIA 1L3TA 1IKYA 3M6VA 3G2XA 4X84A 2XMUA 2FDNA 3MFIA 2JC1A 1R31A 2BW7A 2DHSA 4OI3A 4BC7A 5KG5A 3BO4A 1CJKA 4P71A 2GQQA 4YB1P 1UZHA 5E3AA 2R7RA 3IAS9 5M2RA 2ALZA 3AXKA 1R7IA 1WC6A 1T94A 2J6SA 4KY3A 4N41A 1GMWA 5E3RA 2MSSA 8RUCA 4DV6F 2GIQA 1Q8IA 4NPOA 2YNIB 3HFVA 3KDOA 2GJIA 2Z2ZA 4OI1A 4HKQA 5B0CA 1N5QA 4ZVFA 3OR1A 3T9NA 2Q66A 1F9FA 3K0JA 3IRWP 1SQGA 2CPYA 1WEZA 2Q1LA 4JI8F 4HVZA 4DR2F 3UN2A 4CDIA 1YTYA 4V19J 2ZM6F 2AJ2A 3M6XA 2EPIA 2NZCA 3HHLC 3GMGA 1A7GE 4P2SA 3JSMA 2E7XA 2J7UA 1X5TA 4O3QA 3W66A 3J7Z5 1RWKB 2FQQB 3CVKA 1V5VA 3C66A 2KM8B 2HGMA 3SDEA 2DNLA 2MKSA 5KFGA 1SVDA 1EZZB 2DCUB 2LEPA 1VBKA 3D5MA 2HIQA 3L4BC 4KT0C 3CCES 2DGXA 3KHHA 1AXQA 1HBNB 4USKA 4USHA 4CLZA 5A6PA 2IC3A 4YP3A 4K4YA 2WVBA 3BN7A 4ED7A 3OTBA 4JYAF 2RDDA 5E41A 1S1UA 2W4CA 2R8IA 1MMDA 3GILA 2X51A 4DV7J 4CP5A 4J9OA 3TWZA 3S8SA 2MB0B 1T9UA 2R7XA 2MLZA 1YX2A 1UEUA 1VBXA 5CZXA 1E6VB 2YNFA 3AD8C 3Q8VA 2R2RA 1P1TA 5IM0B 1QJHA 2V5HG 5DG8A 1ZM2A 4DWIA 3MM5A 3DLBA 1FNXH 3EUNA 4KSEB 3H5XA 5HO4A 3T3FA 1RHRB 4CLTA 4B3RJ 4ITSA 1SV5A 2XYGB 3MEGB 4LVOP 5GADU 2HVDA 3G6YA 3D0GE 1YJVA 4WTYA 1H2TZ 3PJ9A 3R6GB 1HBNA 4FZVA 3I32A 4GVLA 3CC2S 4CM2A 3E2EA 3P5BP 1U2RA 3HFZB 5CH7B 5KG1A 1M90T 1TMJA 2OGUA 4ECXA 5FIIA 2K3IA 2IHR1 2ILZA 4I4BA 3ENQA 1MLAA 1WI8A 2NPFA 4LF4F 1P9YA 4A47A 2W8LA 4A8QA 5D4OA 4ATNA 3JYTA 2MPUA 2XBPA 3W63A 1X0FA 2KHDA 4LR8A 1VQ4S 1T9WA 3CSKA 3QATA 1KVIA 1NBEB 3CJ4A 2UUBJ 1X9WA 1ITPA 1YJUA 2FHJA 2F5GA 3V6HA 4JI6J 3GWCA 2HHXA 4JI4F 4DHVA 2H4YB 4NMXA 4KGKA 2EFQA 2DR5A 4B9TA 4RLEA 5KFRA 4R0JA 4U7CA 4GC6A 4DR1F 5A2QU 2YQ3A 4ZVHA 3UCGA 2VQFF 4OX9J 4I2PA 2RKIA 3OFGA 3EVOA 3GJQB 1UWBA 4N77A 2MHNA 2FJXA 3C15B 1XK8A 1PGZA 4K4SA 3T9ZA 1KWMA 1O0PA 1T02A 1TVRB 4WFXA 4CZCA 5HSPA 1RAIB 5FLXY 4MIAA 1NM2A 3MMJA 4DCJB 1DURA 1ELOA 2AEFA 2AGPA 4OLOA 2UZAA 4L3NA 5DGBA 2WBRA 1F60B 4NLYA 1GAOA 4ZP6A 4J90A 2ZH7A 1JLEB 4AQYF 2AD9A 2MLYA 2XHWA 2XNRA 2W25A 2IRYA 4FF4A 1U0HB 1RYRA 2GZOA 1F9EB 4RBTA 1Y5NB 4I64A 4LFCF 5DM7Q 1S9GA 4QIEA 1GFWB 4RR5A 2FJAB 3W8GA 2XS2A 1RLCL 1RXOB 4I68A 4YB5A 2ZZTA 5IQ6A 3H8YA 2QL5B 1HKAA 4PG8A 5DLGA 1HNZJ 3QJJA 1QAJA 4K4ZA 4KO0A 1J5OB 3R97A 2F8HA 1OIAA 3W2WB 4ZHRA 2E1CA 1BQNB 3MPDA 5HP1A 1KFSA 3PRDA 2UXCJ 3DOMB 2H65B 2I6WA 1T11A 2KT5A 4M5HA 4YR0A 3TUPA 2UP1A 1JLGB 3NS7B 5LSRA 2FVSA 3R8YA 1R8BA 1GXLA 3C3LA 4O4GA 4U96A 3U1NA 5F9NA 5KG6A 2MZTA 4L3KA 4B9NA 2VUGA 4NEZA 5C24B 1B4SA 2EKYA 3VR1A 1LKZA 1C4CA 1RABB 3D9BA 3KUGA 1TKXA 4IKAA 4U95A 2OELA 3H20A 4LF6F 1REVA 3KXDA 2MDAA 1RHUB 4F50A 2CQBA 3GG0A 4N5SA 2YX4A 3LTOA 4C8LA 1AFJA 2WBMA 4BC9A 4CO3A 1S1XB 2UU9F 2V4RA 1BQNA 2B43A 1J5EJ 4ZS6A 3J81U 2DITA 2CQ0A 5KT7A 2UXBF 2P5VA 4MKBA 1I6JA 4HACB 1NDKA 2M9KA 3VGTA 5GAGU 3VAJA 2AYBA 3LP2A 3IR7B 5KFZA 3FZBA 3GSDA 3W1YC 4AL7A 4JI2J 2QEXS 5DQGA 1CULB 4Y2MA 1CQNA 2HVEA 2K7KA 4RU9A 4DV0F 2J0QD 4UOCA 1X0PA 1S76D 4DR4F 4IFYB 1GT8A 2CPXA 1CJTA 5HMYA 4WJBA 2GMLA 1FWKA 1KLMA 1HPZA 2ZE2B 1BQXA 4HTIA 1NPRA 4ZLNA 2W9BA 2JZ5A 4JI5F 3DM2B 3ZTSA 3CDEA 3EMTA 1M1KT 2DGVA 5KFJA 2C1EB 1R8HA 1IKWA 1S1XA 2BRLA 3CW2C 4X4PA 3M9NB 1YRUA 3C6UB 3FDSA 2KM8C 3AFGA 4PZVA 3DU5A 1JLCB 3A3NB 5EUHA 2G4BA 2CQ3A 1B70B 4MH8A 3TR5A 2YWHA 3NNAA 1SIZA 1XR7A 3MAQA 2R2UA 4CT8A 1S0MA 3I4PA 2BV3A 5I3UB 2C2DA 1YRTA 1XC9A 2DNYA 4F67A 2BRKA 2ZHOA 5T14A 5LMNJ 1HWIA 1Z4UA 2E5GA 3MAAB 5DETA 5IV3A 3OSPA 3A3PB 2CQ2A 2HQFA 3CD7A 1FRIA 3DHWC 3GJTB 2KKHA 2KL8A 1KHVA 4MYUA 4B3SJ 1HWKA 4USMA 3HHLA 3CT9A 4ZHRB 4PCQA 3ZC4A 5CQGA 3H42A 2YPYA 5HLFB 1N36J 1G2EA 2VB6A 1YJRA 5ETSA 1NZ8A 3HVWA 3BREA 2OI2A 4DQQA 3K5PA 1FVQA 3MR7A 4DV2F 1DQ8A 3BO2A 1FJEB 1U26A 3H7HB 2DIVA 1OYEA 4UF4A 2V9KA 3CPWR 3B82A 1U0SA 4YR2A 1KEKA 1GTEA 2CG4A 2FHOB 3WHIA 5A8KA 1TAQA 4PUOB 2IMOA 1BHNA 5H9FJ 3N4WA 3CMES 2B5JB 4ZJLA 1YLXA 4JB8B 3EWGA 1S48A 3BBBA 5J2QA 4QIVA 3D1HA 2V4JB 3JSYA 3HHDA 2QG9B 4PQAA 1WOOA 4ILMA 1BD6A 5A76A 2R2TA 3DRPA 3X3UA 1PYOB 1X4HA 4KTQA 1P1LA 4ZVTB 2DYAA 3GPAA 3M30B 4J37A 2V8DA 3K8VA 1FJCA 2LCWA 4OJHA 4EUVA 2NXNA 5H9EJ 3FMBA 2XZWA 1S1VB 3GIRA 3IBWA 4KB7A 2JH3A 2ZKTA 1S1UB 2V50A 2DXDA 3MMCA 1RWPB 5HVHA 1D3WA 1DJ0A 3G4SS 2HHVA 1F5CA 4ICLB 2AW0A 1YSJA 4LFAJ 4F4YA 4MK9A 4U8VA 1BMQB 3GFHA 4LFBJ 1UVMA 3LOUA 1H6KX 3PW0A 4ZLPA 2ERRA 3AA9A 3CD6S 3I56S 2UUAJ 1BXNA 1UA1A 1LEOA 3GB0A 2GO9A 2O66A 1RI7A 3G8TA 4RNOA 3Q8YA 1EARA 3CJKB 4IG0A 3KJVA 2AU0A 1JLAB 4B9MA 3S7RA 4MK8A 1RKIA 3B8HA 2CQDA 1NJYA 2IMWP 3DLHA 3LF0A 2PDAA 1UEKA 3EXYA 3MURP 2PFDA 1JJ2R 4QU7A 1JLCA 1CBKA 2GAGC 4IO1A 1RT2A 1U09A 2G0JA 5KG3A 1YDLA 3KHLA 3K59A 1FRHA 3DXBA 6AT1B 2CZVC 3NNHA 3Q86A 2VPWB 4F04B 1FKOB 4UZCA 3O1LA 1U1PA 1HD1A 1FX2A 2HS4A 1M5SA 2N4CA 3AOBA 3V4IB 1H74A 1J5OA 2E7WA 1HNWJ 4C8OA 4EFAC 1KHWA 3C16A 3QYYA 2Y1LB 4AT1B 1GX6A 3QSYB 4ED6A 2YPZA 5JVGQ 5LSOA 2GVDA 1U1RA 1QVGR 2H5EA 3MWBA 4DR3F 1VK8A 5IV4A 1H98A 4EMDA 2CPIA 2Y0BB 4Y2AA 3NL0A 3O2IA 4G6VB 5KT2A 1VIOA 3DLKB 3ISZA 3N28A 2LQBA 5IZHA 2BYCA 1JXLA 4ID5A 1MMNA 5D4LA 1R3NA 2KRBA 2ZH9A 2QFJA 3NCQA 2G1HA 4CLLA 4XPEA 4DV5F 1UP1A 2MXYA 1LXJA 4LFCJ 2JEGA 2WW4A 4OIXA 3DLEA 3PYFA 2H48B 1XQIA 1FDBA 1VHFA 4USWA 2PMWA 1SQFA 2QA4S 1HI8A 1NJXA 3PX6A 2HBZB 4FXDA 2DISA 4UQTA 4NE9C 2QYGA 5J2MA 4G1IA 2GNKA 3UDEA 2KJWA 2OAUA 4DQRA 5ETMA 4ILLA 2OTJS 2A6OA 4WFYA 3KMQA 2RU9A 1AZSB 5L9XA 2F8EX 5HJYA 3M2UB 1SUQB 1A6LA 2B56A 4MTPA 3CJRA 1HIYA 5CYQB 4DV0J 2L48A 2VFVA 3HD1A 5K14A 3SFGA 4I67A 1NDPA 4NLUA 2I0XA 5H1SV 3QGHA 2W7PA 4IH6A 1N54B 1UVKA 2I5JB 3HCXA 3HT0A 2CXEA 1HNXJ 4RW8B 1IBCB 4UUXA 2NREA 3D6FB 5HMWA 1CQMA 3ETOA 3NGUA 5AJ3J 2FHMA 2MKCA 4HHUA 5JXSA 3P6YC 2AX0A 3OQ2A 2UUCJ 3C6TB 1C0UA 1HWLA 3V81A 2XMKA 5KAKA 2C2EA 4BLGA 3PRVA 2AKWB 3SZ2A 3KLIA 2N82B 4A8YA 3OXGA 2L9NA 4NLVA 3RBXA 4BCAA 1D09B 1FKPB 4IH5A 4A8XA 2BACA 1UPPA 4IRCA 2YH1A 2ZH5A 5HANA 3TAQA 1QSSA 3WC2A 3EGVA 3PW5A 4WPAA 2J5AA 2BE2B 2VFSA 4JP8A 3DCAA 1ZAVA 2O5DA 2QLFB 4IOBA 4MK7A 3HPOA 1VQKS 2OHDA 2OUGA 4R0EA 4X4QA 3M6WA 2QA1A 3HVRA 1G6BA 2ADCA 2XYPB 1SIWB 2IM2A 5CYJA 1EP4B 2DBBA 1UWBB 3E8OA 2XMWA 3JSBA 4JI0J 4ZIVA 2YKPA 5KFTA 4X65F 3CTRA 2OO4A 3IGNA 3BJYA 4LSLA 4ZOSA 2VZ9A 1TVRA 2DH7A 2PO4A 4C0HA 2ZJQQ 2VG6B 3GR0A 3P96A 2FZKB 3IR6B 5J1EA 3KLIB 2D3OR 5SZTA 2DGWA 4UOFA 1S6PA 4NXNJ 1ZTWA 2BABA 1FKPA 1OSCA 1VRTA 5BYRA 2H5IB 2O67A 4I6AA 5FDLB 2PMHA 2XEXA 2ROEA 1VQSA 3D1OA 3JXOA 2R3VA 1HQEA 4LRCA 4WE1B 5EHHA 2OJ3A 2CQHA 2HQCA 3M8YA 1H72C 1BLUA 2RRNA 3RZAA 7FD1A 4NRTA 4AQYJ 1ICEB 3OR2B 3NOCA 5LMUF 3RBDA 1IJEB 1GX5A 3TVZA 3DLGA 3FSYA 3HKWA 2RQCA 1AW0A 4Q0BA 1QE1B 2GVZB 3FSXA 2RD5C 3NWRA 5EWEA 2CFXA 1XMOF 4LFAF 2HNYB 3AHPA 1F1BB 1FVSA 2XTJP 3HI9A 4GVBA 1WKKA 2CWKA 3FC9A 3M2VA 4QIFA 3WC0A 4DL4A 2WSEC 3P49B 4K4VA 1YVFA 3W2WA 2VFUA 3SBMA 5F0UA 1OO0B 2RE1A 4F4AA 5KFQA 4FF1A 1AUDA 5THWA 4NZ6A 2VDHA 3RB3A 5GAHI 3PO4A 2LMIA 1JJHA 5FDLA 2G0CA 3PHTA 1U6FA 3HKZD 3OPKA 4NRUA 1UFKA 4A8FA 3TX8A 4LRAA 1SKUB 2CUYA 4M5DA 3WIUA 4WCEQ 4X4TA 4F0HA 3B78A 1Q95G 2OP5A 4ZA1A 2FC8A 2DH8A 3FCHA 3SV4A 2E5LF 1LWFA 1NDLA 2DR6A 3B4MA 3D6TB 2IJRA 1JLFB 5HI7A 3SEOA 3OTOF 3BO3A 2R7VA 4CCHA 3I82A 1KQKA 5H9FK 1VLOA 2M7SA 3A13A 1SJ3P 1X8DA 2XCAA 3DLJA 2HMIA 2HEKA 4YEAA 3OLBA 3VAFA 4N76A 5IT9U 3TA2A 1TAUA 2YKAA 3HVAA 2W24A 3QIPA 1ZM4A 2QSFA 4CLWA 3ADAC 4MMOA 3MR2A 2UUBF 1YK9A 2AJ4A 3NOGA 2HFSA 4K59A 2IC3B 3K5OA 4DG1A 1S49A 1VC0A 3H0PA 1S1WA 1S4FA 4DZDA 4ENOA 3DNCA 3UD3P 2V0NA 1DBDA 2GO8A 4OYXA 3WQPA 5KFKA 1WOPA 2D41A 1C0TA 3FCVA 1JLBA 4TXSA 2XMJA 4FPIA 4DV5J 4BDPA 1AFIA 3R5GA 1Q78A 1ZM9A 3W9IA 1NAQA 3GYGA 4TU9A 2HZVA 2VFRA 2ZNZA 3BGOP 1FEEA 3BF4A 3DRRB 4Y34A 3GV8B 2ADBA 5KOWA 4DR3J 1RAEB 1SH3A 2Z56B 3E01A 2UUCF 3RJMB 2LXIA 5A0YB 3DOMA 1I3OB 2IVYA 3F56A 5LXRA 3T6JA 4LSNA 5DQHA 4JYAJ 4OZ1A 1VRTB 2IJFA 2RIJA 1B0TA 1QAXA 1ZS6A 2AGQA 2WB1D 4DG1B 3MZIA 1VDHA 2DNKA 2GCFA 3DRYA 4NCGA 1DRZA 5KFYA 3SFUA 1ROFA 1T9TA 2XS5A 2XMVA 4EBEA 5JVHQ 1WTBA 4P2FA 3UQSA 1KN6A 1RT7A 3HDSA 2DHXA 4RW7A 4DR6F 5ETLA 1BUXA 2RHSB 3FBEA 4X62F 5HROB 1ZA2B 5KFLA 2BM0A 2C2ZB 2ASYA 3MD1A 4ECZA 3RB0A 3LANA 1WEYA 4PR6A 2HLTA 3BKUA 3I31A 5IFMA 3TUIC 3CJQA 1TL1B 1F2HA 2B7BB 4LRBA 2Z57B 3UNYA 2HNDB 4I6YA 4P75A 3ZZYA 4YB6A 3M9OB 3GIJA 3JTPA 2ZJRQ 2MZSA 1RTIA 3JAMY 3PIOQ 3RB6A 1J5EF 1RAFB 3BH6B 3RUBL 2VQEJ 2EW9A 2XZDB 4JUZA 2J9CA 1IBKJ 3M8QA 4IDKA 5KFUA 5J1PA 3EDQB 3AODA 3US5A 1NHKL 2DIUA 4BWJA 5IOLA 2WTFA 4J9RA 1L5UA 4WP9A 1JWWA 1RT7B 1JLFA 2QLXA 1J2VA 2WVEA 3OD2A 4C8MA 4AFFA 1M5VC 3TZWA 4CNYA 2L9DA 4DV3F 1FDNA 2UVWA 2DHAA 2XSFA 3HZGA 3MM7A 1U2FA 3UDCA 1RWOB 3RW6A 3PFOA 3M4XA 3SI8A 5K20B 1WF1A 3CDUA 3EPGA 3DRSA 1UKUA 2AEMA 2LECA 1RYSA 4QWCA 4W90B 4RW4B 1SKSA 3HO1A 3KOAA 4DU7A 4M95A 1H7XA 4IYQA 3BGFA 4F3QA 3NS6A 1KQGB 1RLDA 4E0DA 3TO8A 1TU0B 4ZP7A 1NJZA 4B9LA 4AYBD 3S01A 4QW9A 3DLLQ 5J2NA 5B0EA 1DLOB 3EX7B 3R6LB 3QFHA 1KFDA 2A2CA 2MKYA 3QWUA 4DPXA 3U1MA 1FFWB 2IRUA 1YRXA 1C0TB 2E29A 2C3MA 5M2PA 2XC9A 2V8VA 2GA7A 4B3OB 4Q43A 2R8JA 1TMMA 1NH7A 1SH2A 2L08A 3ZZPA 4CNZA 1FERA 2LP4A 4ZPVR 2ASDA 5D0GA 4TY8A 3T5HA 2Q43A 3DRSB 3R3TA 1Y9OA 3SIPB 3Q23A 1FJGJ 2G0IA 4ZITA 2R9LA 2VV5A 4ELUA 2JHEA 3GR1A 4RW9A 3MCOA 9ATCB 4J9UE 5K8MA 2E9ZA 3FMWA 4P2XA 3CUNA 2R7SA 3D3CJ 2EFPA 2LDYA 1W25A 2QMXA 1JLQB 3O8WA 2FVQA 2OPSA 4URQU 3FJ2A 3MECB 1SJ1A 3NCRA 2YWEA 3Q2SC 2Y0SD 2EG1A 1C1BA 2P9EA 3VGUA 3KNAA 1Q79A 3WX4A 3RU0A 5HQMA 1NK6A 1R89A 2EBEA 1SKRA 3BPDA 3TQ1A 2QZ8A 2FPHX 4DR1J 1FT8A 2J7WA 1KOOA 5AE2A 2HRYA 1ZBTA 2POKA 1X4CA 4TY8B 2VICA 1RGVA 1YJ7A 4DS4A 3V2UC 1YG0A 2BMBA 3S6EA 4AD6A 2PA3A 3DU6A 3G96A 1UVNA 5DG9A 1IN0A 2PFFB 2GMHA 3DDKA 2CDQA 1ZM3A 1LW2A 2NUHA 4FPRA 5K8OA 2HWIA 4USUA 5IWAF 3LGMA 4X4VA 2EVZA 1T8EA 2GFFA 4M94A 4BWMA 4DV2J 4HHHA 1S6QB 2DEIA 4GO7X 5RUBA 1F9HA 1YJWS 2YKMB 1U47A 1EQ0A 1OQ3A 1JX4A 1BY9A 1X4EA 3H4BA 1N6QA 3BEGB 2J9DE 3QPIA 2MKJA 4M5JA 3W5ZA 1VHIA 2KHCA 2GMJA 3F0NA 5AXLA 4B9VA 2YXLA 3IP0A 1LNQA 5K8NA 3ZFVA 5HP1B 3EZ5A 4O4RA 4Z7CA 2JLEA 3HJVA 1N88A 1D9FA 2JFKA 3NWGA 5LMUJ 2DRBA 4WU3A 4FN5A 1R6YA 3G6XA 3DOLB 3FQKA 2K8GA 2JEFA 2UV8A 4EBCA 2MY8A 2CZ4A 3PZPA 4ID8A 2J6UA 1K0TA 5ETQA 3PCOB 4HH1A 1RSCA 2GJ2A 2VG7A 2HS3A 3AQPA 3CJTA 3W2VA 3G6VA 1XTZA 1O8BA 1CPZA 2OPPA 3IS9B 4CI0B 5JUMA 4J9KA 2Q6BA 1SL1A 3ILOA 4Z7YA 4DV7F 1EX8A 4F0KA 1EB0A 2ZBIA 3FFIB 4ZPTR 4ETZA 5D6GA 2F63A 3MMBB 4DUZJ 4LIWA 4QPTA 2R8GA 4NZ0A 1IR1A 8AT1B 3QO9A 1PJ5A 4PWUA 4KH0B 4V19X 1KS2A 2HNZA 2QA2A 3QGPA 4NA3A 4EEYA 1KQSR 3MM6B 4ED4A 2ZBCA 2V67A 3GYXB 3M05A 3LP2B 2HRTA 4PKDB 2KB2A 4LUBA 2Y1RI 1S7IA 3JTOA 3TW0A 4DR4J 4NCGB 1ZOTA 4LMZA 4RKUC 4M5DB 3OL7A 4WYLA 2HHQA 4QIGA 1DAXA 2ASLA 4QCLA 4U67Q 3NGTA 5T7LB 5L38A 3T1YJ 4C8KA 2WW8A 3C8YA 2Z2YB 4ETXA 1CC7A 4CH1A 1N8RT 2JRSA 1R8PA 1CC8A 5D15A 2KRRA 2MQ8A 1RAOA 2OPQA 2JSXA 5GMEA 2CG8A 1V3ZA 2H9ZA 2XMMA 2HAIA 1KRPA 1URNA 3BGRA 3HF5A 3R5BA 5AT1B 4RZRA 4F4KA 2M0GB 2AX1A 1SC3B 4DL2A 4NCAA 3BR8A 2V2QA 4YHHJ 1LFWA 3PW7A 4QIWD 1RADB 2CAJA 4K0KF 1BWVA 1N32F 3ITHB 1RJJA 5EWFA 1FRLA 3UCUP 3P8BB 4LF9F 2YNIA 2RVJA 4HL9A 5IQQA 5GAEI 1S1WB 1PO6A 1QVFR 2XLJA 3CCSS 3M8QB 3MPVA 4IDKB 3OR1B 3Q8QB 1SJFA 3MMCB 2O1PA 3AA8A 4X64F 1JMTA 3LGNA 1EJ7L 5T7LA 4ELTA 4ZDNA 6FD1A 4IQMA 2LA4A 2XWXA 4U8YA 4HT5A 1KQFB 1JLBB 1FWLA 4IUFA 4WXWA 1FWPA 2OD6A 2Q79A 1XNRF 2B9XA 3I9V9 3OL8A 4ECRA 2V8PA 4M8LA 4EO6A 4QWDA 1TR0A 1RT3A 4WFNQ 2CJKA 4PG5A 1YWXA 4HTJA 2XQCA 1QTNB 2W01A 5DDRC 1RTDA 4QPXA 1HFEL 2EFVA 3MFHA 1TL5A 1NMEB 2XB2D 1OPIA 3R7SB 1JLEA 2QRRA 5GMKa 1L3KA 3PEHA 2E5HA 4X4SA 3TI0A 2GQ2A 4PAAA 3B54A 4QR1A 4JI1F 3N6LA 1RWNB 2W7AA 3IWXA 2VD3A
chains in the Genus database with same CATH topology
3IC1A 5JJBA 4OI2A 2ZH6A 1N0VC 3GIKA 3RAQA 2C2RA 4DSLA 1HNWF 2OPPB 3IS9A 2OSQA 2HG4A 4C2MA 4ECUA 3K2YA 3GG1A 4TYBA 3PR5B 4FBTA 1FRXA 1TKTB 3J7YI 2OMOA 5HROA 4OJ3A 1TK5A 4I56A 2J76E 5D4NA 2B4VA 2YKNB 3U7JA 4YHHF 5ITHA 2RH3A 5K9FA 3N01A 2RT3A 2FJVA 2LEBA 2PD1A 2KJVA 3OR2A 4OI4A 2KN4A 3PHEA 1KR4A 3MR6A 1UEVA 3AJ1A 4J9PA 5A6WA 4XPCA 1TKXB 2ZZNA 2G9OA 5J1NA 3PEJA 2AJ0A 2JX2A 2MY7A 5J2MB 4IRDA 2LU2A 4LF8F 3HZEA 4JI0F 1MWZA 4GKKF 1EETB 3K5LA 1QSLA 1VRUA 3BGUA 4OZ0A 1Q86T 2YKOA 4URSA 2W9CA 1JKHA 4YB7A 1PC5A 2JFDA 1MROB 3NKYA 4NWBA 4F3MA 1SB6A 3PIPQ 1LWFB 5I42B 1FNMA 3BSOA 1U1KA 3V4IA 5DDPC 1X4GA 2DNHA 3KG1A 4A8KA 2Z0GA 5IM0A 1NEEA 2GHWA 4FF2A 3CDAA 1D8ZA 1Q82T 4NLRA 1Y7PA 4YQWA 1HNXF 1WACA 3T5LA 5DG7A 2ZJPQ 1QUPA 3Q22A 3MEDB 4NLOA 2F40A 4PG6A 4GKJF 1KONA 2XLIA 1IKVA 1VBZA 1N36F 2NXUA 2IM3A 2CJBA 4OZNA 1RA7A 3SV3A 5KG4A 1TQLA 2FD2A 1NK5A 2XGQA 3THPA 4MKAA 1K1QA 1LK7A 4KC5A 1ZPWX 4QWEA 1H2UX 3DYAB 3BQ0A 2DR8A 4LQ3A 2W7OA 1ZZFA 4QR0A 3BM7A 3SMZA 4AE5A 1IKXB 3F44A 2LA6A 2I1RA 2QE5A 3CJKA 5GAGI 3KJVB 1GH8A 2CPJA 4ED1A 1F5AA 2G13A 2HFNA 2IA0A 4AXIA 1JNRB 5B7WA 3EGWB 3T1YF 3LQVA 1N5YA 5FJ4A 1HBUA 1BC6A 2OMLA 4DSIA 1UAWA 2JC0A 5A8KB 4ECTA 2UXDF 2HRUA 4WK3A 3MUTP 4Q2MA 5SUHA 3KWMA 2DT9A 1U49A 1SJRA 2MHEA 2J0WA 2HHPA 2HWTA 2PN6A 2VBWA 2LEAA 2PT0A 2FHJD 4RW9B 1VQ8S 4NLPA 3NAIA 4LQ9A 2FGCA 4R8UA 2MQMA 4PPDA 4LF4F 3SQGB 2HHWA 3M9MB 3EPIA 1HBUB 1H7WA 2NSCA 2OIHA 2GW8A 3RRHA 4KPYA 4A8SA 1D9AA 1FA0A 2DCLA 1NB7A 3LP0A 2VBYA 1HMVB 3CJ3A 3E3XA 4P7TA 3CCUS 2OTLS 2NQPA 1U1MA 2PGCA 3HMJG 4DSKA 2ZDOA 2X1BA 3OHAA 4U7UK 4DL3A 2YVSA 3DDNA 1DTQA 4PPZA 2I2YA 3R1HA 1MNEA 2YKQA 4OZ5A 3UCZP 4TQRA 1JLGA 2DNOA 1JLAA 2JWNA 2BQRA 2BM1A 1Q7YT 4KJIA 1HQEB 2YWKA 4WE1A 3SCLE 3SSSA 4ZK7M 1RDRA 4CO4A 2VONA 3RAXA 4U9RA 4NA1A 4DV1F 4IG3A 4LVNP 3SSRA 4TU7A 4C7QA 5AXNA 2Q3PA 1U45A 1WI6A 1D8YA 1B64A 2C3PA 1Q7LB 3ENWA 4A8OA 1FD2A 2UVVA 4G3IA 1E6VA 2YNFB 2XO7A 2HWHA 1IQZA 2NLWA 3AJ2A 3FVYA 1TK0A 1HWUA 2M4MA 1RT1A 1F5BA 3O44A 2B51A 3H4DA 3MEGA 3OUYA 5F9LA 4F4XA 3MGJA 3P5TL 4ZPBA 1RTHA 2AQ4A 4EGLA 1VQ6S 3G9CA 1UMJA 4W92B 1NK4A 4OZJA 4DMZA 1VS3A 2RUGA 3ENVA 2DK2A 2HLUA 3U27A 1HBOA 4ZCLA 3RB4A 3WZ0A 5CD4H 3IFEA 2OFHX 3CB4A 3CCRS 2AJQA 2WOMB 4MYTA 2K1RA 3V6DB 3A8EA 2I9SA 1NK9A 1DFDA 3DMJB 1WF2A 3HX9A 4CH7A 3RTVA 1NHUA 3KHGA 4PWDA 4F4WA 1WD6A 1IBMF 1R0AA 4TU8A 3FEZA 4NYPA 1LWCA 2DGUA 1VQLS 4JI6F 3KK1B 1LW2B 1IBKF 4ELVA 1XMBA 2ZH2A 7FDRA 1S6UA 3NG8A 1D9DA 2IA6A 3KMSA 1U4BA 4UY8T 2FVPA 4Z2XA 5DDQC 2CPZA 4HHJA 4NLSA 1HMVA 5I3PA 4Q0BB 2YNHA 2VPZB 1FDDA 2VBXA 2RS8A 1UJ5A 5LL6d 2R8HA 4C4WA 1K73T 1UL3A 1XMQF 1UA0A 3F41A 3HVTB 3AQOA 2MYFA 1WWHA 5C25A 3UR0A 2ZH8A 3EZUA 4CIOA 3BSNA 1V3RA 5HL7Q 1YIJS 4QYZJ 1HNIB 1VJWA 2XY6A 1Y3JA 5K5MA 2KT3A 4FXWA 4FF3A 1RT5A 4H4MA 3R1LA 5A8RA 2HZCA 3THVA 5AXKA 1FEHA 2KYXA 3CIMA 2VKZG 3Q8RB 1B0PA 5KFIA 3KLGB 3QZ8A 4NA2A 4X4NA 2VH7A 2ZH4A 3R27A 3W2VB 4ES3A 1VQ7S 1X4DA 4O3SA 4RW7B 2QO3A 1C4AA 5E3CA 4OI0A 3MM5B 2ZNYA 1ZH5A 2MMYA 4U67Q 3HVTA 5C25B 1IM4A 2EWHA 5KG2A 2R7QA 3LAKA 3OFFA 1VLYA 5M2UA 1NKEA 2HQ3A 5DJBA 4O0IA 3VQTA 2RQKA 1N5YB 3UWTA 4RNFA 1SXLA 3FRYA 1CVJA 2ZOGA 2GGPA 5U47A 4CH0S 1Y5LB 3V5RA 3LP1A 4DSEA 4EO8A 5A2QY 2MGZB 1M0SA 4ICLA 2ZDPA 1ZAXA 2D9OA 4QWBA 2M88A 3BQ2A 3U02A 1YGYA 4NOHA 3ISNC 4OI6A 2MQOA 4EZ9A 1H2VZ 3VAMA 2IYGA 1IR0A 3JYTB 3JSMB 5AE3A 4L72B 2GV1A 1OS5A 3V6DA 2AYMA 4C11A 1N5TA 3CCQS 3UW1A 2AGOA 2R4FA 1NO8A 2KXHA 4ZVEA 5HBMA 1X7VA 3GFZA 2ZC3A 3ZZUA 4RWXA 2FLNA 3MEKA 4I1TA 2R7UA 4FBUA 2NZ4A 3KHRA 2ROPA 3CCVS 1T05A 2EI5A 3UR3C 1T3NA 1WF0A 1FDAA 4KV8A 1NJIT 5CYMA 3K57A 3PXGa 4Y0FA 4N8OA 3OLAA 5BYQA 4L6V3 2J9EA 4TLRA 4GO5X 2HMIB 5J2QB 3J81Y 1IKXA 2N3LA 1FKAF 4RU2A 3I9ZA 3RBEA 5LSLA 2C28A 2RS2A 3RYLA 3VAKA 3T1HF 1FE4A 2XI2A 4D3HA 3CMAS 3MM8A 1A9NB 2AJ1A 4IG3B 4Y3CA 1WHYA 3DI6B 1RP5A 1M5OC 5D4PA 1XWLA 3Q8SB 5AJ3F 1IJFB 3UE2A 3KLFB 5A8WA 5B0BA 2OD4A 3R5CA 2GX8A 2HQIA 3CCLS 2M3DA 2ZHAA 1LOUA 1R27B 3NP5A 1WHXA 3CE8A 2GQCA 4MIBA 2IM1A 4RW6B 2R7TA 2Z4PA 2DPJA 1ZPVA 4RW4A 3M2UA 4WFAQ 5C5JA 2CJQA 3JTNA 3OVBA 2VC1A 4JOUA 3K58A 5B0FA 3MHYA 1FXRA 3L7OA 1X4BA 3SQGA 3VWSA 5EX3A 2D1CA 2GGPB 2MKIA 1S9FA 2XY7A 4G1QA 2BW2A 1Q1KA 4OJ1A 4EYHB 2V2KA 2RNEA 2LQ9A 3QLHA 4OZLA 2R8KA 4NXNF 3G71S 2J6TA 5ADZA 1UFLA 1S0OA 2N7YA 2WSCC 1HBMA 3KK3B 2MKKA 2MSTA 1HYSB 3FNNA 1SKSA 1DQAA 1WTFA 2VG5A 1C1CB 2ZKUA 3VF0B 4LF5F 1FTCA 3RR7A 1TL1A 1WHWA 2JVOA 4G1PA 3MOZA 4OX9F 2XY5A 4N56A 2YTCA 3OW2R 4HH0A 1WG4A 5HBMB 2BE2A 3GV5B 1V9OA 2AYGA 4JV5F 1F0XA 2PSZA 4WF9Q 1BGXT 1MROA 3ISND 2V9WA 3DHXA 1X9SA 1GNKA 1VQ5S 2YNHB 2FJDB 2EFOA 1SH0A 3Q0AA 2XS7A 3PR4A 5KFNA 3QAUA 2HHUA 1UJ4A 2NPIA 2OLWA 5KFVA 3GIIA 4CTAB 1E6YB 3QAEA 4JI7F 2VASA 3HT3A 5EDWA 1Q4RA 4O4GB 2JDJA