2K8GA

Solution structure of rrm2 domain of pabp1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
GADPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Polyadenylate-binding protein 1
publication title Solution structure of RRM2 domain of PABP1
rcsb
source organism Homo sapiens
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k8gA00
3JB9k 4Y00A 1KD1T 2OIHA 2KHCA 2X1GA 2QA4S 2BZ2A 2DHXA 3CC2S 1VQOS 1VQ8S 2JVRA 1U1NA 2MZJA 1FHTA 4BS2A 5GAHU 3THTA 2AYGA 1O0PA 3R1LA 5GAGU 5DDOC 1OO0B 2CPJA 3J7YU 2RRAA 3K0JA 2DNOA 2MJUA 3TP2A 2RQ4A 1CVJA 4YOEA 1WG1A 4CIOA 1WTBA 1RK8A 1SJFA 2E5GA 3J7ZT 1YITS 2DHAA 5LXRA 2YH0A 3Q2TC 5IM0A 1SJQA 4IOAQ 2N7CA 2LXUA 3CPWR 3UD4P 4FXVA 1ZZNA 1NO8A 1WG4A 1JJHA 3BEGB 2UP1A 3NNHA 1M90T 2I38A 2HZCA 2KRRA 2YWKA 2M0GB 1U1MA 4TLQA 3G71S 1HA1A 1L3KA 3H2VE 2J8AA 2MZ1A 2G1DA 2KT5A 2ZJPQ 5GMKa 3NMRA 2DIVA 4LMZA 1PO6A 3B4DA 2LA4A 3MI7X 5LJ3Y 3FEXB 3G8SA 1R8PA 2CPXA 3R27A 1N8RT 1A9NB 2AYBA 1M5KC 1UW4A 2E5JA 3UD3P 2D3OR 2HGMA 4WFNQ 1X5OA 1HD1A 3US5A 1YJ9S 1KQSR 3MOJB 3S6EA 2CQBA 2MSTA 4OZ1A 1WHYA 2CQ3A 1WI6A 1Q7YT 5GADU 4IO9Q 2MKSA 1N54B 2KM8B 2RT3A 2HGNA 3CCES 3HHNB 1ZH5A 1KOHA 3I56S 1WWHA 2DGSA 4QQBA 2M7SA 2YH1A 2JX2A 2KI2A 1X4AA 2KG1A 3MD3A 4F26A 1KOOA 2DH8A 3TYTA 1H2TZ 1ZZFA 1VQ7S 1X5SA 1VQ6S 2AYMA 2MGZA 1VC6A 4RU2A 5DDPC 1VC5A 5FJ4A 3P3DA 2JVOA 2CQCA 2L41A 2M70A 2MKJA 4QU7A 2J0SD 2DNNA 1F9FA 1VQ4S 3G9CA 2KYXA 3VF0B 1X4FA 1WHVA 2M9KA 3P49B 3MUVP 1SJRA 2LEBA 5D78A 2F9JA 1U1OA 1IQTA 1UP1A 5D77A 1SJ4P 1RKJA 2CPEA 2RS2A 2JRSA 2RRBA 1X4BA 3THPA 4YB1P 2KM8C 1WG5A 5DDQC 4WCEQ 4EGLA 3V4MA 5EN1A 1U1QA 2G4BA 2LKZA 2CPZA 4U67Q 1YJNS 1SJ3P 2DISA 3NS6A 5IFMA 2MKHA 2CJKA 3EGZA 2MYFA 1R8HA 3SMZA 2CPYA 2DGUA 2E5IA 2RU3A 2F3JA 4C4WA 1X0FA 4OZ0A 3BO4A 3DXBA 4TU8A 3VAIA 2MB0B 2E5HA 3S01A 1FNXH 1S79A 2M4MA 2M8DB 1YWXA 1WELA 4ED5A 4W90B 3MUTP 2LQ5A 1D9AA 3SDEA 2CPHA 5JVGQ 3VAKA 2DNGA 2NLWA 2CQIA 2CQGA 4PR6A 3UWTA 3CD6S 2KXFA 2DNZA 4J5OA 2J0QD 3VAHA 1X4EA 3CCSS 3CC7S 2JWNA 5DM6Q 2KN4A 2VOPA 2MXYA 2DGXA 4IOCQ 2FC9A 3I55S 1PGZA 4WF9Q 2DO4A 4Y0FA 2KXHA 4WFBQ 2MY7A 1VBXA 3SXLA 1SXLA 4LJMA 3NS5A 3G8TA 3UCZP 2HGLA 1OWXA 2V94A 1K8AT 2CQ4A 2XNQA 2CQ2A 2MQOA 2KH9A 2ZJRQ 1YI2S 3RW7A 3IWNC 1FJ7A 2NZ4A 4C7QA 4QPTA 2AD9A 3P6YC 2RQCA 1UAWA 5LXYA 1VQKS 5HO4A 5DETA 2MQQA 2LA6A 5CA5A 1DHMA 3U1LA 4TU7A 2MSSA 1QVFR 1BY9A 1N52B 2MZSA 4CH0S 1JMTA 4P6QA 2MJNA 1NU4A 2AYEA 1QM9A 5IM0B 3MXHP 1VQ5S 3BS9A 1OPIA 1KC8T 2L9WA 2MZQA 2ZJQQ 2MZTA 1M5OC 2B0GA 1M5PC 2CQ1A 3VAMA 5LJ5Y 2XS2A 1U1RA 2DNHA 2MQNA 1A7GE 1XN9A 3CMES 2MKCA 4FXWA 2MQPA 1VQPS 1X5TA 2SXLA 2A3JA 2KRBA 2DNKA 2CQ0A 4CQ1A 2M2BA 3CUNA 2FPHX 1YTYA 1FXLA 1P27B 2OSQA 2FHOB 2N82B 1W2BR 4CH1A 2YKAA 2DHGA 1FO1A 2ADCA 4IUFA 4UY8T 2LECA 2EK1A 2DH9A 1DBDA 1Q81T 3CCVS 4WFAQ 2M88A 3CF5Q 3R1HA 1X5PA 4TU9A 2CPFA 2U2FA 3TO8A 4YUDA 1JJ2R 2DK2A 3P5TL 5HL7Q 2RS8A 2N3LA 1VBYA 1D8ZA 2M8HA 1YJWS 1P1TA 2J76E 3CCRS 2LYVA 3NNAA 1WF0A 5CYJA 4ERDA 2OSRA 2DGVA 5MLCV 1VQNS 2OTLS 2K3KA 2XNRA 1WF2A 2MPUA 4M5DB 1G2EA 2FC8A 2RVJA 4A8XA 2MGZB 1X4GA 2ADBA 1HD0A 2G0CA 5LSOA 2DNRA 2LEAA 2DNPA 1Q82T 3BO3A 3CCQS 5GAEU 3VAGA 2QFJA 1WHXA 3VAFA 2LMIA 2X1AA 3G6ES 4W92B 2DGQA 2RNEA 2DGWA 2CQPA 2MY8A 3MUMP 1K9MT 1AUDA 2MHNA 1N88A 2XSFA 5JVHQ 3U1MA 5ITHA 1JJ4A 2XB2D 4WKRA 1U6BA 2KXNB 3Q2SC 4C0OC 1QVGR 1FJCA 3H2UB 1YIJS 2CQDA 2DH7A 2DGTA 1X4DA 2VODA 1U1PA 1X4HA 1WEXA 3S7RA 2VONA 3HI9A 1H2UX 2MKKA 2KU7A 2KFYA 1VQLS 2LCWA 4PRFA 4WIIA 3SDEB 3FEYB 4Z2XA 3EX7B 3VAJA 2X1BA 2GHPA 2PEHA 1M5VC 1WI8A 3OW2R 3S8SA 1WF1A 1NJIT 1UFWA 3MURP 3CCMS 1U2FA 3CTRA 2GO9A 2DHSA 3UCUP 1DZ5A 2FY1A 3EGNA 3DLLQ 5LSLA 2X1FA 1U1KA 2EK6A 1YHQS 3BO2A 2D9OA 3G96A 2I2YA 3LQVA 2L08A 3PIOQ 4LIRA 3ULHA 2N3OA 1WHWA 2DNYA 1K73T 2HYIB 1HL6A 3VALA 3ZZZA 2OTJS 1VBZA 1Q86T 4V19X 3MDFA 3PIPQ 2VOOA 2F9DA 1VQMS 2MKIA 1VC0A 1U1LA 2XS7A 2CPDA 3G4SS 2ERRA 1WEZA 1WEYA 1B7FA 2DNQA 2DB1A 3UE2A 2RUGA 5CXTA 2XS5A 2O3DA 3RW6A 1U6FA 2EVZA 2KG0A 1H2VZ 2D9PA 3CC4S 3D2WA 2YTCA 1M1KT 3NNCA 3B4MA 2DIUA 2Q79A 5H1SV 1S72S 2M52A 3CCJS 3CCLS 1OIAA 4F25A 3CMAS 1DRZA 2BOPA 5BJRA 4QU6A 4UQTA 3MD1A 3CULA 2DNMA 2DGOA 2CPIA 5IQQA 2KVIA 2MQMA 2K8GA 3L3CA 2OJ3A 2WBRA 2HVZA 1FT8A 3CCUS 2E44A 5GVQA 1FJEB 4PKDB 2MMYA 1VQ9S 3IRWP 3UCGA 2DITA 5DM7Q 2QEXS 1URNA 2LXIA 4F02A 2CQHA 2MZRA 5DDRC 3LPYA 3CXCR 1X4CA 2U1AA 4ZKAA 3ZZYA 3N9UC 2PE8A 2MQLA 2DNLA 1H6KX 2DO0A
chains in the Genus database with same CATH superfamily
3JB9k 3WHIA 1KD1T 4XIUA 3K8WA 4CTAA 5DQHA 3HVTB 1E6YA 1LQ9A 2DNOA 5C25B 2HHSA 4K2JA 1FEHA 3DOLA 1REVA 3NAIA 1AA1B 2LQBA 2B9EA 2Z2ZA 4P2XA 5FDLA 1PG5B 3PO5A 1U1MA 3NLCA 1S49A 2GO8A 2YWHA 2G1DA 4F0HA 5IWAJ 5D4OA 2YX7A 3SSQA 1W7WA 3MR2A 4LSNA 1PO6A 4B9UA 4R8UB 2CPXA 2AYBA 3I32A 5A8WA 1UZHA 3UD3P 3KMSA 3HK2A 4RNFA 1ZYQA 3MR7A 4K4XA 2CQ3A 1HBUA 2NR0A 4FVMA 5GADU 4IO9Q 3ILJA 7FDRA 4PQAA 1ZH5A 4W98A 5LT5A 4IH7A 1UJ6A 4IYQA 4EZ6A 3UNGC 1RT6A 4LR7A 3MMAA 3FCHA 1HWIA 3L7OA 2KKHA 1R0BG 4N8OA 2VUGA 5F8IA 4QU7A 2ZITA 2M9KA 2CJXB 2C2KB 2OPPA 3J81U 3QFWA 1GXUA 1E6VB 5CCLA 3UR3C 1FEEA 1FTCA 2A2CA 1U1QA 2XZWA 2MKHA 2XULA 1VIOA 1U0HB 4WP9A 2KZMA 4L74A 3JSMA 2HWTA 1IM4A 1S9EA 4MMOA 1I94F 4QCLA 3MUTP 4AE5A 3AB2B 2QLJB 1Y10A 2DNZA 1CJKB 5KT5A 3EZUA 2C2ZB 1NMEB 4C9DA 3JQMA 1RBLA 2PDAA 3G8TA 4USMA 1UEKA 2Q3PA 4YR3A 2CJAA 3HFVA 1JNZB 4QYZK 4D3HA 3OR1A 1IUJA 3TJ8A 2NPFA 3BS9A 4J37A 4YY3J 2Y3YA 2L9WA 4FF4A 1K0VA 1CS4B 2CQ1A 2D3UA 2JDJA 5LJ5Y 3DOKB 3MMBB 2DNHA 3QZ7A 1ZAWA 3CUNA 1EQMA 2IVFB 5KFDA 1H73A 1HBNA 1PIEA 1X5PA 4PEOA 2V2QA 2LQ8A 3HF5A 1C0UB 2OELA 2W9BB 2V6AA 2K7KA 1S57A 5CYJA 2IA6A 5KFOA 5L1JA 2MPUA 4KT0C 2FJAB 2FC8A 2FLLA 1X4GA 5DG8A 4O3PA 2CRLA 2DNRA 4EFAC 4UOGA 4DV6J 1Q82T 3VAFA 3R7BB 2M3DA 2MHNA 1OQ3A 5JJBA 2DRBA 1I51B 2WCXA 3H2UB 1RAAB 3MZIA 1KKHA 1U4BA 4I69A 4MK9A 3CDBA 9ATCB 4GKJF 2HK2A 3V2UC 4DL3A 2RF2A 2VFRA 4DG1A 1PYTA 1HWKA 3BQ1A 5G0RA 2VFVA 2LDYA 1Q8LA 2ZOMA 4UZBA 2DCLA 4NLUA 2B9YA 4PQUA 3N4WA 3T3FA 3PX0A 5F8JA 5H9FK 2E9RX 3TUIC 4ECSA 3BGUA 1HPZB 5AT1B 3HHLA 1BQXA 2QRRA 1AT1B 2DNQA 3CJ2A 3Q8UA 3HVAA 4EO8A 4USTA 2FGOA 4RW4A 2ZZNA 4DPYA 5KFHA 2QA2A 1R89A 3SIPB 4PXCA 4MIWA 1Q53A 1YJUA 4DN0A 4QU6A 1XNQJ 4K4ZA 5B0CA 1HNVB 2B9WA 4GKKJ 2XG8A 3KHLA 2VL1A 3MR6A 2EBEA 5HQLA 2EFNA 5KFTA 3GWCA 2ZBCA 3JAMY 3DGPB 3HD1A 1H6KX 4UF4A 4C8MA 1EP4A 5SZTA 3THTA 1DQAA 3I9V9 2MJUA 3TP2A 1Z1ZA 1S0OA 2D69A 1SJFA 2HRTA 1YITS 3QJPA 4AXIA 5JXSA 2XY7A 2ILZA 1EQ0A 1M90T 4DV0J 5DGAA 5LOQA 2JLFA 2ZJPQ 5CD4A 1RU1A 2RDDA 2KDOA 4IQMA 3GTYX 3M6VA 2QA1A 2QMUB 1YX2A 3PRVA 5D15A 1R0AB 3T1YF 4ED0A 1BD6A 3V81B 3W7BA 4Y2CA 1X5OA 1W2IA 1YJ9S 1KQSR 1NK4A 2GVDA 2BA9A 5IV3A 1GTHA 4DUZF 4WZQA 3RBXA 4KV8B 3NAHA 4KH0B 4Y2KA 1ZTWA 1SQGA 2J9EA 1VHFA 2AYMA 3ET6A 4U95A 4JV5J 2CQCA 4H54A 1HHSA 1RJJA 2Q66A 1MROB 1IQZA 3MCSA 4NCBA 3DLKA 4KQZA 2PA8D 2RRBA 3DRRA 4LSZB 3MM8B 3K5OA 1CG2A 2GNKA 5J2PB 1RWVB 2ZD1B 1YJ7A 4OMFG 2KO1A 3EGZA 2AHOB 2BJ1A 3TQEA 1S9GB 4QBUA 5E3PA 4C4WA 3SV4A 3BO4A 1S79A 3LAKA 2G2YA 2IJNA 2YVSA 3NGRA 3M4XA 3FBCA 3VAKA 2PFDA 2HHWA 2JFKA 2KXFA 1XMQJ 3M2UB 4X2BA 1PCAA 4RL1A 2ZVIA 2B7BB 2B5JB 1K8AT 3FQKA 1QUVA 1RA7A 5K14A 3IWNC 3NL0A 4MJKA 2GAGC 3PZPA 5DETA 2AQ4A 4LR9A 3OBIA 3ZTPA 4LF1A 3UR0A 3BDPA 4A8SA 2HFUA 5J1EB 4DX5A 5IM0B 1NKEA 4K59A 2WAQD 2HBRB 4DV3F 2AV5A 1M5OC 4Q44A 2R8HA 2XS2A 2IA0A 2XZTB 3CMES 1X5TA 2KRBA 4DX8H 2ZBQA 2WVFA 2HVIA 5KFXA 1VDHA 2CWXA 3F44A 3CWJA 4RBVA 5CQGA 3VHQA 3Q8RB 2XMMA 1XK8A 1TP7A 2J76E 4MT1A 3AOAA 2N7YA 3ZZUA 3OD2A 3LGNA 2W8KA 1JLEA 2V8GA 2XTJP 5EHHA 3LW5C 5BYSA 1N48A 2K3KA 2XHWA 5J1PA 5K20B 5AJ3F 5LSOA 5I4MA 3CCQS 5GAEU 3QRRA 2C22A 4EO6A 3HT3A 4ECVA 2RNEA 4C11B 3LH2S 4X4SA 1S59A 3M8PA 4X62J 4C0OC 1U24A 2N4DA 3BGOP 4J9RA 4GMKA 1M1GA 3OFEA 4Q5VA 2ROEA 2VONA 4IDKB 2AMCB 4OHVA 4WIIA 3JQKA 4PPDA 3VAJA 2GHPA 4KHMA 1F1BB 4Q43A 2BBEA 3DI6A 3DYAA 3SYZA 4KGXB 4WK3A 2XO6A 3UDCA 5HATA 4QW9A 2HRUA 3AD7C 2LXFA 1FJGF 3KNAA 3FCVA 2BW2A 1ZETA 1RAOA 1VK3A 3BO2A 2D74B 3IG1B 3MM7B 5U47A 3VGUA 1Q86T 3CD7A 1JX4A 3TAMB 1H3DA 1B7FA 3THVA 1W26A 3PY8A 4LFCJ 1HQUB 2W2PP 3DLBA 2FVPA 3EMTA 1M1KT 3FBBA 4JI3J 2IVYA 4QIFA 2ZH2A 1T9YA 1KLNA 4F25A 4NA2A 1F0XA 2C2OB 1LK7A 2DGOA 2V4JB 4DR5F 1O5JA 1DURA 1JXVA 1N0VC 2WBRA 1FJEB 3UCGA 4JI4J 3GONA 2FLOA 3I5BA 2XGPA 1FKPA 4HTIA 1EB0A 4YFUA 4LF5F 1KNZA 3FEZA 1U1NA 3R1LA 2BR0A 3GE9A 1OO0B 4N47A 4X66J 4ED8A 1LXNA 3M8RA 2RQ4A 4HYKA 1CVJA 3HPOA 1ZM2A 2WSEC 4LSLB 3KHHA 2F8EX 3IBWA 4AUKA 2BKPA 3IGNA 1X9SA 2VDIA 2YPZA 3BN7A 1C2PA 3FSXA 1C0TA 4NXNJ 4ZVSB 3HKZD 3AAWB 1MWQA 2F65A 1GX6A 2BQ3A 3W60A 1WSVA 3ZTOA 1KQGB 2RHSB 3JSBA 2YKOA 2FJDB 2GZOA 2N4CA 1NDPA 1VQYA 1WI6A 1UVKA 1Q7YT 3HFKA 4KO0B 3GJSB 2HNDB 5I42A 2YH1A 3N5BA 4FF1A 3MD3A 3DM2A 4CLUA 2OUGA 2I5JB 1RAFB 2VQFF 1RWNB 3QBCA 3JQJA 4A8YA 3THPA 2AGPA 2KM8C 1P1LA 4NX9A 2X3GA 2YKNA 3HHDA 4DWIA 3P45B 4M94A 5HMYA 2W24A 2F3JA 2WONA 4TY8A 3DGVA 2MB0B 1SIZA 1RHUB 1RLDA 4B3MF 1CC7A 2O1PA 3W63A 4NYPA 2GQCA 5J1NA 4PG8A 3SSSA 3QIPA 2CQGA 4OJ3A 3DXSX 2UVWA 1NSKL 1CC8A 3R7SB 1X4EA 2D3O1 3H4BA 3HFZB 2IFXA 2W2NP 1PJ6A 1UVIA 4LFAF 2CADA 5I3QA 1XERA 2C2RA 5CH7B 1L5UA 4K7QA 4CTAB 3DRXA 3RW7A 1A0OB 5AXKA 4C7QA 1E6YB 3NXZA 1F5BA 3RR8A 2LLZA 2ZHBA 4QR2A 3DOLB 1QM9A 1REVB 1QSSA 3KTQA 5L8RC 5FDLB 3VCDA 3H5SA 1Y00A 5IC4B 3DCAA 4CQ1A 5DGBA 3GFXA 4LSNB 2FZGB 1PSDA 1P27B 2XCAA 3OFGA 2DHGA 3LPEA 4IH6A 5A8WB 4WFAQ 4ZP8A 2CPFA 2BE9B 1HBUB 2P9GA 1VBYA 5L39A 1YJWS 1SKRA 3U7JA 3V6HA 4Y3CA 3ICLA 3W9IA 3D3CJ 4OZLA 1KWMA 4I6WA 4ERDA 4DR7F 4A8KA 3KLGA 5HVFA 2GQ2A 2OTLS 1RT6B 4W4MA 3MMAB 4DFPA 2RVJA 3L95X 2OD6A 3A4TA 4QYZJ 2VHGA 1N33F 3QZ8A 3RTVA 5KFQA 2BW7A 2OPPB 1SC4B 1RU2A 4JP8A 2CNNB 1AFIA 3Q8VA 5ITHA 2NSCA 4RWWA 1U6BA 4K0KJ 3DLJA 2XWXA 1QVGR 4HEA9 3PW2A 1DLOA 5IOLA 1FRMA 3U02A 3D6TB 1T02A 5F3TA 3S7RA 8RUCA 3JSMB 3FFIA 1S9EB 2RQKA 1JLQA 4CLLA 3PTWA 4ECZA 1WI8A 2PI4A 3S8SA 2HQ3A 2V5HG 4ZA1A 4OYZA 3D4JA 2P2CB 1S1XA 1SPBP 4DXLA 4KKOA 1L3UA 4Y2AA 1VFJA 1WHWA 3D1QA 4OX9J 1HL6A 2WB1D 3PIPQ 3R7NB 2BJ3A 4HACA 2F9DA 4P75A 4DR6J 1IXKA 2QSFA 2BJ7A 4NOHA 4CO1A 3TW0A 3RW6A 1U6FA 3OR1B 4HR2A 3T19A 3W5YA 3HULA 3RAXA 4KGKA 5E41A 4A48A 4PYAA 4TLRA 4AQYJ 2XLKA 1FA0A 5IQQA 1T7PA 4ED3A 2UXDJ 3JAMU 3RUBL 4L6V3 4X4NA 3BYPA 2HVZA 4EZ9A 3N0VA 3GIKA 2DY9A 3TA2A 4MAKA 2BJ8A 1HBNB 4F02A 1GMWA 3ELHA 1S99A 4ANDA 3MCNA 1NK9A 4XPEA 2DEIA 4CM0A 2ZZTA 1S6OA 1U26A 5H9FJ 2BYCA 3ZNJ1 1EHWA 3J7YU 2AJQA 5EWFA 3A8JA 2XY5A 3BDEA 1NB7A 2AJ2A 2KJWA 1T3OA 5L1LA 2I38A 1RTZA 1UPPA 4USWA 5KFJA 4DV1F 2JC1A 2AZ3A 2WVEA 3ZZ0A 5M2RA 2CG4A 3F56A 2RU9A 1B3TA 4TN2A 1HR0J 5GADI 3PVXA 4RNOA 1DTTA 5F8LA 1EX8A 3VGTA 2R8GA 4DFMA 4DG1B 3TX8A 4ZIVA 1WWHA 2DGSA 4EBCA 5G0RB 1GMVA 2JX2A 2OEJA 4RR5A 5L9NA 4NLRA 5IV4A 4F2RA 1HNXF 1CJTB 1IR0A 1FERA 5CYMA 1FDNA 4ZLLA 4PQUB 1XMBA 1UL3A 2J0SD 2ZHAA 2NPIA 4USUA 1RHQB 5B0DA 3HVRA 2F9JA 3KDNA 4N76A 4UY85 3HHLB 2AJFE 2ZH4A 1SUQA 3IA0A 5KT4A 2XMAA 5DDQC 3G8QA 3EVOA 4RW4B 4ZP6A 2VICA 3O8WA 2C3UA 2GX8A 3NS6A 2BM0A 3RG6A 2MYFA 3FCWA 2CPYA 1MWZA 3K5PA 2E1PA 1RA6A 4JI7J 3S01A 4NWBA 2LP4A 1P8GA 4H4KA 2E29A 2W1BA 3J80Y 5B0BA 2J0QD 3VAHA 5ETNA 1U2CA 5KFFA 2C28A 4RO0A 1DQ8A 4WFBQ 3KYLA 4DMZA 1EP4B 3ISND 1AROP 1X0PA 4B9SA 3UDEA 2NREA 1VQKS 3ISZA 4DQPA 1SI9A 1QVFR 3UI3A 5E33A 2BM1A 2R7WA 3AOCA 2RIJA 4JBCA 3FRYA 1TL5A 3VAMA 2FTRA 1U1RA 3ZNUA 4ZCLA 3NS7B 2MQPA 1XTZA 2OLWA 3UDLA 5IXUA 3M8QA 2AIRB 3O5TB 4IUFA 3A8EA 2EK1A 1OSCA 2E1MC 3QYYA 5AE2A 2ZBRA 1IWAA 3FZBA 3M8SA 2GVDB 2M8HA 4J9NA 2HNYA 1YQHA 2H4WB 4JV0A 4NLTA 1JK9B 4EI2A 3K5MA 2XNRA 3PEJA 4C8LA 2BDPA 3HSGA 3RB0A 2F4VJ 3ET6B 1WACA 2R8KA 5KFIA 3VAGA 4DL4A 4TY9A 1CBKA 1Y5IB 4QWAA 2DGQA 5GAHI 3GFHA 1ICEB 3SQGA 1S77D 3DLKB 3DRRB 1R8BA 4OHYA 1UVNA 5ETPA 3FSYA 1KS2A 1FJCA 2VIHA 3PHEA 1XEZA 2R7OA 3AXMA 1NJXA 2HFSA 1H2UX 2JFDA 2H5IB 4IR9A 4P52A 3EX7B 1M5VC 1YKWA 3K5LA 2QGFB 4ZPBA 2GHWA 4DR3F 1Q16B 3MURP 1ZA1B 4M5KA 4OHZA 1U2FA 2BANA 3KHGA 3LALA 1D0EA 2BX6A 2ZNYA 5LSLA 2HRYA 4OYOA 2K06A 3PIOQ 2JC0A 2PSZA 4DX6A 4HHHA 4E0DA 5LMNF 1HI8A 5K14B 5HQ8A 4X4OA 3NGKA 1TMMA 1SQFA 4USIA 3TZZA 4X64J 1B7YB 5CXTA 3M8ZA 1H38A 4ATNA 1FE4A 2PEBA 1G3OA 2J7UA 4F4YA 3K2YA 2DIUA 2E7XA 2UZAA 1K0TA 4KIAA 4YHHJ 2EEYA 3P8BB 1DRZA 5BJRA 1NK8A 1Y9OA 2OO4A 1NRKA 4RW9A 2E5LJ 4NI2A 5DO2A 4DF8A 4J9MA 3POTA 3T5KA 1HQEA 2KFZA 4G1QA 3ZZYA 4WE1A 2FVRA 3GCXP 2XYPB 4DZDA 3NCRA 4DV5J 1VQOS 4B02A 2GQQA 3RRKA 5GAGU 4ID5A 1JLEB 2FGCA 5DZ7A 3UO0A 5KFVA 3OJUA 2KHDA 3AA9A 3EVWA 3W2WA 3QT5A 3M6XA 3M32B 2FLPA 4YP3A 3EZ5A 3MR5A 4ITSA 2GW8A 3MPUB 1RE1B 2WW4A 1NKBA 1IKWA 3TVYA 1VRUA 3M8PB 2NQPA 2HS0A 2LU2A 2QL7B 3QSIA 1XC9A 1T3NA 1KN6A 3P4UB 3I82A 2R9LA 1HWJA 3US5A 2CQBA 4F4KA 5GMEA 4G65A 3NG8A 3CCTA 3BPSP 1J5OA 5KAKA 1X9MA 4ENOA 3DYAB 2W01A 1XMOF 3U1NA 1HBOA 1TL7B 3MR3A 1OQ6A 1RXOB 1N5SA 4OIXA 1F9FA 2JZ5A 3NWRA 1SV5B 3I0SA 5KFRA 3N6MA 1CJUA 1FXRA 4M5NA 2HLTA 2KJVA 4TKTA 3HVTA 5EWEA 5KT2A 1M5SA 2DTJA 1GX5A 2G4BA 1DFDA 3TUJC 2RU3A 1H72C 4F4XA 4DR4J 3CMQA 5IWAF 2PI5A 1D9AA 3SDEA 4L72B 3CO0P 2CJ9A 5D4NA 2ZH8A 2CG8A 3CT9A 4YR0A 2I8EA 4OV1A 1FKPB 4ECYA 4CYUA 3JSRA 2KXHA 1VBXA 1FRLA 1Q8IA 1AB8A 4LBIA 1RHKB 1JWWA 5LMUJ 3QNWB 2RQCA 1QSYA 4X4TA 1S12A 2PMWA 1FKAF 2YWGA 3MAQA 1OPIA 1M5PC 1AZSA 4E8UA 3HM9A 1UZDA 2UUBJ 4S0MA 1C0TB 4N77A 1KFSA 2ZBIA 1YTYA 2QMXA 3TEHB 3T6BA 2OSQA 1TUGB 3LGHA 2D1CA 4EMDA 4IG3A 2D3ZA 3RAQA 2WSCC 2VJUA 2HIQA 3W1YC 4BDPA 2NXEA 1IBCB 2RMLA 5I42B 3T9NA 1MMDA 4NE9C 1B99A 3EGWB 4UOHA 5GAEI 2PGCA 1T9TA 1G2EA 1HARA 2ATCB 3D7SB 4TYBA 2NXJA 1U02A 2IHR1 1WHXA 4A8WA 4O0NA 4CWBA 4X65J 2UUAJ 1HFEL 1NK7A 2P9EA 3MPYA 1HNWF 1LKZA 1JJ4A 4LF8J 5HANA 4WKRA 3TZWA 2YKNB 3T1HF 1C4AA 2XBPA 3QAEA 3CJKA 2YNHA 2KB2A 2W2MP 2WONB 3CJSA 4USHA 2Z8QA 1NBEB 3EDQB 3FEYB 1KVJA 3OW2R 2EFQA 3MMBA 1WF1A 4FXDA 4ER8A 1D3WA 1H0HB 1WORA 3C6TA 3EJMA 3VALA 4ED2A 3D28A 4PG5A 2VOOA 1GK8A 1LEOA 4FPIA 3B8HA 1UW9A 2B4UA 2WRMA 2DB1A 4ZVPB 4BCAA 4JI0J 2O3DA 4DV6F 3UFCX 4I1TA 4DPXA 3HT0A 3FGVA 5EX3A 1F9HA 4G6VB 5F0UA 1PBAA 3GG1A 4OYAA 2CPIA 4WFXA 3JXOA 3CJQA 4RW8A 1RT2A 1RWOB 4OJHA 5KOWA 2K8GA 3JSYA 5KFCA 3CCUS 2HQFA 5E3RA 3RRHA 2LXIA 4M1KA 3BV8A 1TQLA 1U7LA 2EFPA 3MEGA 1IM6A 2U1AA 5KG2A 2MQLA 3G8SA 4DSJA 4Y00A 2DHXA 1VYAA 5SUHA 4BS2A 1VISA 3KLGB 5KOXA 2ZKTA 1KHWA 2C3YA 2ROGA 2XMKA 3BSAA 3EICA 5HMWA 4WP3A 5D0GA 1I3OB 3PKYA 5E7OB 1QAYA 3BZQA 3OVBA 3H2VE 1QE1A 4X84A 5GMKa 3NMAA 1SL1A 3QRPA 2DIVA 1DLOB 1DTQA 2WSFC 1Q78A 1XNQF 3CCZA 2QT7A 3FFIB 2EW9A 3AHPA 3D1OA 3KWMA 1JLQB 5D0RA 2KM8B 3JTNA 2KT2A 3C19A 1KOHA 1EZZB 2O5DA 2XYGB 4OX6A 4I64A 1YZ7A 1EJ7L 4BHQA 2AEJA 1S1XB 4R0EA 4KKOB 4ZJLA 3FBFA 2VA2A 2XWYA 2GIQA 3RBZA 3G9CA 2FD2A 4HACB 3SSRA 1LFPA 3DGPA 1HNIA 3I31A 5D77A 3N6NA 4EUVA 1RYSA 2BVZA 4I67A 3CDEA 3V4MA 1B0PA 2ZHOA 2H1YA 1SJ3P 2DXEA 6FD1A 1J2VA 3SMZA 2Z2YB 3TZYA 1RHRB 1L3SA 3J80U 2IDEA 1D09B 1FNXH 3DRSA 2M8DB 3R5GA 4B17A 5JUMA 3WX4A 2CPHA 4PXDA 4URSA 3Q8YA 5CAAA 4O3QA 3DLGB 2W7AA 4I7FA 3SZ2A 2Y1LB 1MNEA 4DCJB 1MU2A 1HW8A 2QTWA 4DPTA 4AFFA 4F3MA 1HI0P 2DR8A 3KLEA 2EWHA 2MXYA 2GMHA 4IOCQ 3NGTA 1KP6A 1FCAA 1JQGA 2EFGA 2MLXA 2HGLA 4FP9A 4PCQA 4URGA 5C24A 2AF6A 1T11A 1GEHA 3GPAA 3QGIA 4LBPA 4ETZA 3H5XA 3U1LA 4K4WA 4HHJA 4JV5F 1I5OB 4CH0S 1NK6A 3C14A 1A6LA 5F9LA 4YS2A 1KC8T 2DR5A 3PM9A 1S1UA 2VD3A 4ED6A 2DNKA 2OKQA 4CLKA 1CULA 3GZ7A 2R7TA 1FRIA 5AE1A 3E51A 1KTQA 1DTTB 2U2FA 5EGYA 5A8RA 2WTFA 3MHYA 4B9LA 1IKVA 4QIVA 1XQIA 3QSYB 1XMQF 2OPSA 4B3SJ 2OSRA 1RAIB 3PFOA 3H4DA 2HQIA 4DSEA 5CYMB 1S76D 4Z7YA 4EWTA 2DNPA 3BO3A 1RT4A 3MPDA 4W92B 5IS2A 2ZBPA 1J27A 4KBIA 3OL8A 1AUDA 3AB4B 1SUQB 2Z58B 4LVOP 4ZVGA 4DBQA 5D3GA 3Q8QB 3W65A 2EKNA 3DMJA 3HZGA 3CEDA 3ILLA 2FDNA 3R5AA 1KDNA 4K4YA 2MKKA 3LOUA 1TKTA 2J9DA 3RB6A 2QC3A 2GIFA 2CDQA 5E2QA 1RABB 2H65B 3CCMS 2J8SA 3UCUP 4K5RA 3KJFB 1ZOTA 1U1KA 1LOUA 2I2YA 2OAUA 4LIRA 2UXBF 1SH2A 2R4FA 3B78A 4O0IA 2B51A 4RZRA 5B0FA 1ITPA 1VBZA 4ZHRA 2WOMA 4J9QA 4KE5A 4GKJJ 3QT6A 2XS7A 1FD2A 4RNHA 4Q8EA 5A0YA 1H7WA 2R3VA 4F50A 4PWWA 3TX0A 2LEPA 1WD6A 2FJWA 3DHXA 4P2SA 3D6MB 3K58A 4X62F 2ZE2A 3D9BA 4NLGA 4K8RA 4FBTA 2I9SA 3M8QB 2I1RA 3L3CA 3H90A 4ZPAA 2E44A 1BGXT 2VU5A 1NZ8A 3LTOA 2L9NA 3BB5A 2PE8A 4B9NA 3ZTQA 2DNLA 5ETLA 1DARA 2UXCJ 2HNYB 3P96A 3R3TA 2HSEB 2QFIA 2AYGA 4DS5A 1F2HA 5DRKA 3M30A 4M5IA 5KT6A 4H4OA 2WW8A 1Y7PA 1FKOA 4TVAB 1WG1A 1HI1A 2B8QA 1R43A 1OPZA 2PFFB 3GYGA 3R9LA 2C2EA 2NCKL 2E9TA 1GQEA 3SQGB 2M0GB 2HHVA 4LFCF 3NEKA 4OI0A 2HAFA 4PUOA 3DRPA 3FEXB 1T9XA 1N8RT 2E5JA 1VHIA 4CP5A 4KTQA 3IR6B 3GFYA 4ZVQB 4WK1A 1WHYA 3ISNC 4J9OA 4B3RJ 3KLVA 4PG7A 4LF6J 3GYXB 2H3EB 3IRXA 4RX6A 4D3GA 3HHNB 3VV2B 3CO9A 4QQBA 1U2RA 4JI4F 5D0EA 1BQNA 1CSJA 2UUCJ 2BANB 3TYTA 5E3AA 1RLCL 3A8IA 4RU2A 1VC5A 4UT4A 5B0AA 2RSQA 1PAEX 3BYRA 2NUUG 1WHVA 4A8OA 1CQNA 5D78A 1YBUA 3HJVA 1RKJA 2CPEA 2JRSA 5KG3A 1T95A 1GFWB 2QN6B 2J5AA 5ETTA 5HMXA 2Y1JA 1U6ZA 4KHRA 5J2MA 1X0FA 4J90A 4NXNF 4ZP7A 2RE1A 4DR2F 1F6TA 5D0HA 5KTQA 3IR7B 4RW9B 4NI2B 4TNOA 2XMVA 3POTB 1ELOA 3LANA 2X51A 4J5OA 1HQEB 3GV8B 1TVRA 2ASYA 1PGZA 4G1QB 4J9SA 4WE1B 1YZ6A 5BR8J 1MW7A 2V69A 3UCZP 2WVDA 2A6OA 2XNQA 2KH9A 3PV8A 2ZJRQ 5B0EA 4DL5A 2YY3A 2NZ4A 1NUEA 4ID5B 4WXOA 3Q89A 1FI4A 2ZWOA 3I5AA 3W2WB 3LP0A 3OLBA 3V5RA 2IRYA 1YJRA 4I4BA 3NKYA 3TWZA 2D7SA 2YX4A 3H0PA 3KUHA 4Q2MA 1IKWB 1VRUB 3BH7B 2EBGA 1TR0A 3I0RA 1FXLA 4HTJA 3FK4A 1BQMA 2B3TB 4OX7A 3GCWP 4RJVA 4C3KA 2C2NA 4UY8T 3G86A 4ZCKA 1LW2A 2HHTA 4HT5A 2BABA 3IO1A 3KNGA 3TRGA 4HL9A 1NXIA 1D8ZA 1ZPVA 1IR1A 4WYLA 3ZO7A 1J5OB 1YG0A 3PYDA 1S10A 1F5AA 4C8NA 1D8YA 4YB7A 1TZ0A 2MLYA 3VQSA 2EPIA 3J7A1 1HBOB 1T94A 4ZP9A 4ECQA 2QE5A 3MPVA 4XDDA 4F36A 1FD8A 2FJBB 2DKOB 4DUTA 1X8DA 2X1AA 3MM6A 5H9EJ 2KTQA 3I0SB 2MY8A 1CJUB 1U8WA 4FNHA 2J7WA 3HX9A 3A3PB 1MWYA 1NDLA 2VG5A 4NCAA 4M5MA 1U45A 1OS5A 1HMVA 5C7PA 3NWGA 2LCWA 3SDEB 4DQIA 2G0JA 3ILOA 2ASDA 3ZC4A 3HP6A 4PPZA 1NJIT 5KFPA 3DLLQ 4CYUB 2D9OA 4IRCA 3LQVA 2A1BA 3A13A 2YBVA 3O2IA 4LRFA 4XK8C 4XAKA 4TYAA 4HLBA 4PWUA 1U1LA 1WEZA 2UVVA 4B9VA 2Q6CA 4A4JA 3OHBA 3ITHA 1LFWA 3M6WA 3TNVA 2R8IA 1FJGJ 1RGVA 4CRJA 1N5YB 2HHHJ 1AZSB 2JOQA 4LF4J 1F3FA 1F5CA 4ETXA 1VRTA 3HHLD 4K0KF 4DLGA 2KVIA 4Q7AA 2MHEA 3PJWA 4G1PA 3AFGA 3LA0A 1WOPA 3QRQA 2BJEA 1EIYB 3F0NA 2MZRA 4IG3B 4HH0A 1AYEA 3T6JA 1VIXA 3I87A 2IM0A 4ANCA 4DCOB 3D66A 1BHNA 2QA4S 3FQLA 4IG0A 4N8NA 1JLAA 3R5DA 1HIYA 2GHVC 4I68A 4TQRA 1QLNA 2E5GA 4TXSA 4IRDA 4OX9F 1JLGA 4QZVB 4FS1A 1V9OA 2ZVSA 1EKSA 3BPDA 4DR6F 1ZZNA 3EWGA 4ED7A 3W5XA 2ZKUA 4TLQA 5T14A 2J8AA 4KHPJ 1X60A 2DBBA 3H8YA 1QUPA 3NMRA 1WDDA 5F8GA 4LMZA 3M1VA 2PMHA 4IFYA 5KFBA 4WTOB 2W8LA 3CJKB 2YNHB 1ZM4A 3JS9A 3K5NA 4AQYF 2MSTA 3OL9A 3IXQA 4JI6J 4DV7J 2UXDF 3DC2A 3VQTA 5FLXY 3CGIA 2AKWB 4HDGA 4X4QA 4P73A 2B7CB 4F26A 4WPAA 2FY8A 3C6TB 2MGZA 2RRNA 4EYHB 3H59A 2JVOA 4OI3A 3CE8A 1GNKA 4OYPA 4CLFA 3IGVA 2HW3A 1JXEA 1S5ZA 2Y9HA 3L09A 2LKZA 2NZCA 1RT5A 2CJKA 2Z57B 1R8HA 4ZVFA 3E8OA 2ALZA 1URRA 2FUG9 2YXLA 2VKZG 1YWXA 1WELA 4ED5A 4GVLA 3NBPA 2DPJA 4RW8B 4ED1A 1RT2B 5C5JA 3Q86A 1R27B 4XPCA 2OH2A 1K47A 1TL1A 2EXUA 4NPOA 4Y65A 5JMNA 3FKBA 2KN4A 2NSBA 2JL9A 3MEGB 1RAHB 3X1LB 1NSQA 4Y0FA 3BR9A 1SXLA 5F3ZA 2ZFHA 3OTOF 2ZH1A 3TANA 4B3MJ 1SJ1A 1FJ7A 1FESA 4MIBA 1UAWA 4WXWA 2MQQA 2AGOA 1N5TA 4CLYA 2MSSA 3C8YA 2Z56B 4PZVA 1JLBA 2MJNA 2AYEA 3I6PA 4NYOA 3MFIA 4BC9A 1NPPA 1CJTA 5B7WA 4Y2IA 2IM2A 1JB0C 5BYRA 1DAXA 1QE1B 2SXLA 3UDVA 3QLHA 4J9LA 1YLXA 4X4RA 4DV2J 1T03A 4JI2J 4LRCA 2FHOB 2N82B 2W25A 3AQOA 1DTQB 3MAAA 5E3QA 4JI7F 3SFUA 1Q81T 1FX2A 5DS7A 1BE4A 4U9RA 5KFNA 2W9AA 3D6FB 3G2XA 4RUHA 4F0KA 3PYGA 2R7RA 3NRBA 3SCJE 3AOBA 5M2UA 4DCPB 3J81Y 2AW0A 3OFFA 3TARA 3QPIA 2Y8YA 8ATCB 1TK8A 4F4WA 1NDKA 1HNIB 2COLA 2B4VA 1WOOA 2CQPA 4J91A 1FRHA 1N88A 1Q8BA 2RJZA 5JVHQ 3U1MA 3H5YA 2VFUA 3RB3A 3IS9A 3HSJA 3WX8A 1T05A 3RYLA 1N4LA 2Y1RI 1WEXA 1N33J 4ED4A 4AL7A 2YWEA 3DRSB 4OJGA 5K8OA 1SCJB 5EUHA 4R5PA 4I7FB 1CQMA 1VRQC 1MU2B 4C0BA 3CW2C 1BXNA 1RWMB 4E98A 2CAJA 4FDFA 4ELUA 3KLEB 4HHUA 4JI5J 4NEYA 2OI2A 4MYUA 4J9UE 1SIWB 5C24B 4OI1A 3R6LB 4RW7B 4NL5A 2F4VF 2GAHC 1R3NA 2KG0A 3VWSA 3D2WA 3C14B 2K7JA 4NXMJ 2DCUB 3FRZA 5H1SV 4ZOSA 2XYHB 5C42A 3H42A 1S1UB 3F41A 3HSDA 1RBAA 6AT1B 4UUWA 4ELTA 1CULB 5ETVA 2CQHA 2Q6BA 1NJYA 1FF2A 3CJRA 1X4CA 3ENQA 4CLPA 1SC6A 1CEZA 2OEKA 3L7UA 5A8RB 4DUYJ 3BM7A 1FDAA 4PXEA 4RWXA 2KHCA 1IKVB 1K44A 2V50A 2MZJA 3FZ2A 4I6AA 2W9CB 2OPSB 1H7XA 3IWLA 3K57A 1FE0A 2YH0A 3T9ZA 4C97A 2F1FA 3KLFA 1RT4B 2FYXA 2YKPA 3CPWR 4P71A 3RR7A 3R5BA 4AL6A 3BEGB 3PEHA 5ETKA 2F8HA 3G71S 3KOAA 2MZ1A 2JLGA 5D3GB 3QJLA 3DMJB 1L3TA 4I56A 3PRDA 2XI2A 2MDAA 1WC4A 4YHHF 2HGMA 3VGSA 4WFNQ 7FD1A 4KYZA 3PNIA 1TKTB 1VJWA 1V3RA 4M95A 2E5LF 2JEJA 2ALYB 4DN9A 5KG5A 5HP1A 3K8VA 2QLWA 4JYAF 3M6UA 4LFBF 2E66A 2OPRA 1P9YA 2KG1A 3C2PA 1ZZFA 2X3DA 1X5SA 1VQ6S 2C42A 3SCKE 4DDFA 3QT8A 2HFOA 1KVIA 2IDLA 6FDRA 4DV5F 4XDCA 4FYDA 1VQ4S 3BR8A 7AT1B 5THWA 4ZHRB 2WOMB 1IQTA 4O4GA 2BQUA 2BXJA 4EGLA 4DZ6A 5A8KA 3EYZA 5A0YB 2CXEA 1GMUA 2NYIA 2DISA 1HNXJ 2Y1IA 2DGUA 2C2MB 2DVIA 2DXFA 3WBZA 3NCQA 3M32A 3EM1A 4W90B 2ZE2B 2HK3A 2FQQB 3QJJA 1GTEA 4FNIA 3R97A 2IYGA 2CA9A 3JTOA 3SV3A 2HIYA 4KSEB 3CC7S 3T5LA 1GH8A 2HQDA 3PXGa 2B6AA 4Q8FA 2NXCA 1UWBA 3KDOA 2CKWA 4ZITA 3SXLA 4LJMA 3EXYA 1UVMA 5HAOA 2NUHA 4F7VA 2V94A 4ECRA 1UEVA 3BBFA 4YR2A 1YI2S 2ZDPA 2RILA 2HWIA 3M30B 5HO4A 3H40A 2E7WA 4H4OB 1FKOB 2C3MA 3KG0A 1BY9A 2CDRB 3BGFA 3W5ZA 4NLYA 4I0WA 1XNRJ 2BRKA 1TL7A 1M5HA 2R2SA 2V8VA 4PABA 2YX1A 3DU5A 2MZQA 2ZJQQ 4OV6A 4X4VA 3HJFA 3OSPA 2BJ9A 2VFSA 1SV5A 4FXWA 2AP6A 2A3JA 3Q8PB 2C3OA 5A2QU 2RH3A 3GJQB 4PUOB 1JKHA 3DRPB 4OLOA 2QL5B 3IWXA 1RCXB 4DR4F 3MGJA 3ZZOA 4L3NA 2YWWA 4K4SA 3GP9A 4KAIA 2ZH3A 2QG9B 1TL3A 3IRXB 1RYRA 4MH8A 3I9ZA 1BQNB 1OYDA 2ADBA 3K7RA 4WIQA 4UTGA 1V5IB 3PYFA 1Z2ZA 2J0XA 2XSFA 4J7CA 2XI3A 3EDRB 2JH3A 5ETRA 2GJFA 1YRUA 5J2MB 5CZVA 2VFTA 4C48A 1U49A 5AXLA 1JIHA 3VZIA 1FK9A 1RZMA 5F41A 3CCWA 4ZVHA 4EU0A 4Z2XA 1NK0A 1SC1B 1RWPB 4R25A 3SFGA 1UFWA 4DPUA 2CNOB 2F4FA 3RZAA 1TVRB 3ZFVA 2ZUGA 2X1FA 3EE3A 2ZDOA 3G96A 4WFYA 2N3OA 4ANEA 5HQMA 3MDFA 3C16A 1LK5A 4JI1J 3GU0A 4LIWA 3DFEA 3MEKA 2V9KA 2ZUAA 1SB6A 2RUGA 4OLPA 1KR4A 2EVZA 3BSCA 4P10A 3LP0B 3NNCA 4X65F 2HFZA 2IJFA 3CULA 4LF8F 3VZHA 2G2ZA 1S6QA 3I0RB 1FWLA 1BQMB 4PKDB 2VJVA 4Q45A 4IQXA 3KFWX 3W64A 2YQ3A 1Q5YA 1LW2B 1TL4A 1JLCA 2DRDA 4A47A 3CJTA 1U1OA 2B43A 2MEWA 3H25A 3VR1A 3TVZA 3NOCA 4F04B 2Y8WA 5ETOA 4WTYA 5CCMA 2IAJA 2VV5A 2K3IA 3W9HA 4P9SA 1RAEB 4FF2A 3R8YA 3TAPA 2LU1A 4ICLA 1GMWD 3TJ9A 3DN9A 2Z30B 3MECA 1XWLA 2OHDA 4IOAQ 1QY7A 1Q79A 3FMBA 3MM6B 3NNHA 2UP1A 2B4OA 2YNIA 4ZVRB 2Z2MA 2AEMA 1HA1A 2AJ1A 3EVMA 1IKYA 4ALZA 1TK5A 1VR6A 4UQGA 1KHVA 1C1CA 2A0FB 3PCOB 1I6JA 5FLXU 2YNFA 1M5KC 1ACMB 2VG5B 2GJ2A 2QO3A 1TV6A 3S6EA 1HMVB 4CM2A 4ZJOA 4GVBA 1UJ4A 5HBMA 2RUSA 2DH8A 3OFHA 1KLMA 3RAMA 1FFWB 3RJMB 3SBMA 2FB0A 3P3DA 2EFOA 3DOMA 3VF0B 1WC3A 5KFEA 2HMIA 1SJRA 1UP1A 5HJYA 2QA4G 2QX0A 4ILMA 3ITHB 3BKUA 1OMSA 5C2GA 4F3QA 3HCXA 4UOCA 2IBOA 1V6HA 3TOQA 2VBXA 1D9DA 2E5IA 3HVWA 4OZ0A 5CD4H 2VC0A 4BC7A 2LQ5A 1F60B 3V6DA 1VRTB 4PR6A 1Z4UA 2CQIA 5FD1A 2Z4PA 3W2VA 5G4DA 1JXLA 2DR6A 1F9EB 1KTVA 3IFEA 3CCSS 3TEGA 2FHJD 2DGXA 1VLOA 4ZVUB 3I55S 2IIHA 2R2UA 1WKLA 2IMWP 4FYXB 2V68A 2XLIA 3QFHA 1IBMJ 4IG0B 1JLAB 1FDBA 5LXYA 2XGQA 3EGVA 2VPWB 3RU0A 1RUSA 2H5EA 3N28A 3OPKA 4Y28C 4P6QA 1JLGB 2PO4A 2IC3A 1EKRA 1VQ5S 2ZOGA 4MKVA 3SEOA 4H4MA 3HXMA 3D67A 4EEYA 2MQNA 1VQPS 3WIUA 3E01A 3KXDA 3R6GB 1R7IA 1LW0B 1DY3A 2GIRA 3M1VB 4IFYB 4DFJA 2ZH5A 3MMCA 3OXLA 2JLEA 1HBMA 1GT8A 4B3TJ 4OI6A 4QW8A 2B8PA 1RTHA 3TO8A 2DK2A 1SQEA 1UA0A 2LYVA 4ZVEA 4ZPVR 3N6LA 4JI8J 2HVEA 4ECWA 1MLAA 3DLGA 1V3SA 2EI5A 2MGZB 1U48A 4OI2A 4M5GA 4OYMA 4QYRA 1PJ7A 4FPRA 5F8MA 3OV7A 2RD5C 2BMBA 3HHLC 3CVKA 3DDKA 5CABA 2VG7A 4RW6A 4P74A 1TU0B 4ILLA 1HHQA 5F8HA 1ZTTA 2LDIA 1RT3A 9RUBA 1YIJS 2CQDA 1RT5B 5MAOA 2DGTA 2HNZA 1X4HA 2EG2A 2L3MA 1VQLS 2VQEJ 2DY1A 3MTJA 3NBPB 2ZNZA 4C8ZA 4EBEA 1HNWJ 4LREA 4CO5A 3AJ1A 3CTRA 4U8VA 4DU7A 1TL1B 4X4PA 2XMJA 4OYWA 4DSLA 3PW0A 3T1HJ 3D54A 2EK6A 1IBKF 3NOGA 1YJVA 1K73T 1N32J 3SCLE 2C2DA 4B3SF 1QDUB 3W66A 2VPXB 4U6PA 1VC0A 2HS4A 2XMUA 3DLEA 4KH1B 3KJVA 1H2VZ 1ZS6A 1JLBB 3TAQA 2P5VA 2PD1A 2VC1A 3GV7B 1T8EA 1HNZF 3CCJS 1TFWA 4DPWA 4LF9J 1VGYA 3LWLA 1SVDA 3MD1A 3K89A 4KGZB 1S48A 3QLHB 3JYTA 1T03B 4NEZA 3MM9A 5T41A 5EDWA 3LO3A 1UWAA 4FYYB 1B70B 1NHVA 3MAAB 3W8PA 3LPYA 1PYOB 4UUXA 3TVKA 3GSDA 3N9UC 2GV1A 2YNGA 3MF5A 4EBDA 5GAHU 1KQKA 1RKIA 2EC2A 2F5GA 2OPQA 5KFYA 2CZ4A 1TKDA 1FWKA 4BWJA 1CJVA 1LWFA 3R2CJ 2HHUA 2LXUA 4ZLJA 1Y5LB 4PG6A 3E2EA 2MKYA 2B4PA 4NLVA 1HW9A 1S6PA 1YK9A 2HFNA 4ELVA 3IS9B 3KMQA 2LA4A 2H48B 1MMLA 5LJ3Y 1T05B 1J5EJ 1A9NB 4UOFA 4ZVTB 3T41A 4M5HA 1YBTA 1HD1A 2C1EB 4O23A 4N7TA 3CJ5A 3ONQA 2ZM6F 4R5PB 1RT7A 1UTAA 4HH1A 2DT9A 3VVUA 3G87A 1S4FA 4DU8A 4C8KA 4DV4F 4OL8A 3PW7A 2HURA 4MIAA 2GS8A 1VC6A 1U09A 5KFWA 2UXCF 2M70A 2DNNA 3QWPA 2FJXA 2XSJA 5EWGA 2R7UA 1WG5A 1NH7A 3TUPA 1NJZA 4WFZA 3DU6A 1C4CA 2HZVA 5EN1A 4NASA 3M2VA 3PX4A 2UU9J 3GQCA 3BKFA 1RCOB 1UJ5A 4RNMA 1YSJA 3VAIA 4OZ5A 1UVJA 2W4DA 3MMJA 5C42B 5ETMA 5B08A 3TUZC 2E1CA 2DNGA 4LF7J 3DHWC 4HVZA 3ENWA 3D0HE 4Z7CA 1B0TA 2MLZA 3I5CA 2BACA 4NZ0A 4CNYA 5T7LA 4USKA 4B3RF 2JEGA 4LF6F 5CZXA 1O6XA 1N34J 5HVHA 1K1QA 1HHTP 4IR1A 3BF4A 1GXLA 1MN9A 1SKSA 4DSFA 2UUCF 2AD9A 3EPGA 3L7PA 4TU7A 1T0TV 1JMTA 1NHKL 2XMWA 3KLFB 3JTPA 3AD8C 3TR5A 4MTPA 1NSPA 4ZIWA 2CJBA 2AU0A 2OFHX 3SI8A 2XLJA 2EFVA 2P6TA 1TAUA 2CQ0A 5AE3A 2RQMA 2RKIA 4OZNA 3H98A 2ADCA 5D6GA 3OXFA 5HVGA 5LM7E 3OTDA 4L3KA 4CLSA 1Q5VA 4C3LA 1JJ2R 2DHHA 3VVTA 3P5TL 5HP1B 3CCRS 2ILYA 4YMEA 2W4CA 3QO9A 3LGMA 1IKXB 1CPZA 4I6YA 2OPRB 4F67A 2G2OA 2IM1A 2WHOA 1OY9A 1PBUA 4CO4A 2HG4A 5BR8F 4O4RA 1ROFA 3ZZPA 2V34A 3QQCD 1FFSB 2CZVC 2LEAA 4K4UA 3GLJA 4L76A 3G6ES 3MEDA 4O4GB 3ENVA 2AEFA 3GG0A 4M8LA 2HVHA 4OJ1A 5A8KB 3RB4A 1B64A 4RUBA 3AA8A 2E1RA 1NJWA 3QAUA 4CH7A 4JUZA 1G7CB 3IN5A 3TA0A 1RTDA 2EKYA 4LQ9A 3WQPA 2PEHA 3J7Z5 4CI0B 3C6UA 4PWDA 4ZLNA 1S1VA 2A10A 3CIZA 2HQCA 5L1KA 2FY1A 3EGNA 2B6AB 1T9UA 1UWBB 4CLWA 2HHPA 2HYIB 2HWHA 2GVZA 3M9OB 3EZOA 2JNJA 4GO7X 2ERRA 5J2QA 2LVWA 1KFDA 3CB4A 2HEKA 1XBWA 1UCNA 2KT3A 2K1RA 2UXBJ 3HSZA 2VZ9A 3CCLS 1UPMB 3HO1A 2XCPA 1FWPA 4U8YA 4KC5A 4Y34A 4DHVA 4G1IA 1JKHB 5GVQA 2HHQA 4DL7A 2XM3A 4C2MA 3CXCR 2BJDA 1RACB 2IBKA 2VPZB 1TL3B 5FIIA 2JVRA 4IRKA 5AXMA 4NYZA 2UV8A 2RRAA 4ZJQA 2H4YB 3OL6A 1IWGA 3V6JA 1YGYA 4CIOA 1WTBA 1Q95G 4KJIA 4LBHA 3GMGA 4FXVA 5DLFA 1JJHA 3OUYA 3O6QA 1S97A 5EX0A 2GMLA 4IFVA 3MTKA 3FJ2A 3A3OB 1UVLA 5KT7A 1S1WA 3C15A 3MI7X 1R8PA 3RGIA 2HHHF 1UW4A 1N5QA 2UUTA 3DKDA 4LF4F 4AD6A 2HFVA 1FK9B 2ACYA 2V2VA 5IT4A 1N5YA 2MKSA 3PACA 4HI1A 1QAXA 4ZPWR 3P5BP 4LQ3A 2KI2A 1U25A 3F73A 1UKUA 5I3UB 4UZCA 4O3OA 5DDPC 2DR9A 1WDTA 1XR5A 2MKJA 4QJVA 2AX1A 3C16B 3UVJA 4LUBA 2LEBA 3D68A 4FS2A 2C3PA 1SJ4P 4MKBA 4AXJA 2CJYB 4WCEQ 1I1GA 4NZ7A 4O3NA 3Q0AA 4U67Q 1NDCA 3OL7A 5KFAA 1NKCA 2FIUA 2M4MA 4DS4A 4I2PA 4KHPF 3PHTA 2HQGA 3C66A 4LRAA 1HYSA 3GIIA 3Q24A 2FVCA 1NK5A 4G3IA 3AY0A 1Y3JA 1S6QB 5IT0A 2JJ4D 4ECXA 2JWNA 1JLCB 4JI6F 1N36J 5DZ6A 4DV7F 4WF9Q 2DO4A 3OVAA 4YY3F 1IBLJ 2CQ4A 2MQOA 3FC9A 2K2PA 4ZCMA 4DR2J 4RKUC 4DEZA 3ZZTA 2IAJB 3KLIA 1OY6A 1DHMA 1FXDA 4ICLB 4KR0B 1WNEA 1BMQB 2J6TA 1NU4A 3QMQA 3MECB 2QJ3A 2OP5A 1V5VA 4RLEA 5KFGA 5KG4A 2NXUA 4K50A 1SL2A 4RNNA 2B0GA 1RP5A 2YNIB 4WKYA 3GFZA 4K5SA 3AODA 1UA1A 1IKYB 8AT1B 4FKYA 3TJAA 1C1CB 1SKWA 4J9VA 3GIMA 4MK7A 1AXQA 1BLUA 2YNFB 3KJNB 4RPFA 2DH9A 3MWBA 1DBDA 5DQGA 1TV6B 3CF5Q 2H54B 2WBMA 4WJBA 3W8GA 5HROA 2F7VA 5F0WA 2V8HA 2YPYA 1WF0A 1N0UA 4GVBB 3NCPA 5HBMB 1RBOB 3RRGA 1BUXA 2IVMA 5J2NA 1NH8A 4DLEA 1KLMB 3UN2A 1APSA 1HD0A 1PILA 2CNKB 2BEFA 3R5CA 4JV2A 2BUNA 3WZ0A 3DOMB 2HBZB 2IRXA 2HMIB 1C1BA 4Q0BA 4L73A 4DFKA 2V63A 3HMJG 3T1AA 3HKWA 1NEEA 4O44A 5IZHA 2W4PA 3H5UA 1EETA 2P8IA 3HZEA 1U1PA 4ILRA 1U8SA 3HI9A 4WWSA 4CZCA 2KU7A 1FRKA 2KFYA 1VI7A 2LFVA 4DR1J 3BBCA 2GC8A 3AD9C 3V6DB 1G6BA 2X1BA 4DV2F 3K17A 3HD2A 4JI2F 2ZZMA 3W2VB 5KFKA 2DHSA 2WB4A 2XQCA 4OZ3A 3PFEA 2QIFA 5HLFA 2DNYA 4E2FB 2V4RA 2QYGA 1UFKA 2VKRA 2W2QP 3LP2A 1D1UA 2CPDA 1WEYA 4ID8A 4GKKF 1B0VA 5L9XA 3HHEA 1VLYA 2JHEA 4QIGA 5HK4A 4V1Ak 3IM8A 2EC0A 2IC3B 1S7IA 4H4MB 5IT9Y 3CDUA 4KB7A 2BOPA 5L1IA 4KGMA 4ZS6A 3QWUA 4MKAA 2AT1B 4ES3A 3KK2A 3E01B 2CIMA 2L9DA 2MQMA 1RSCA 1FT8A 3MMCB 1VQ9S 3G82A 1NAQA 3GR0A 3HLUA 3OLAA 4TQSA 2JEFA 2OMOA 1HBMB 2ZEJA 2HPUA 1GAOA 2FJVA 2VASA 3PDNA 1RTHB 4ZKAA 4RUCA 2DR7A 3D0IE 1SKUB 2BZ2A 1VQ8S 4DV0F 1LXJA 3NP5A 2RAQA 3GB0A 4JI5F 4ZPCA 4ECUA 1RK8A 1LWEA 4QWEA 4Y6IA 3QGGA 2A6MA 4U7UD 2N7CA 4MFBA 2ZH9A 2KVQE 1RT1A 2HZCA 5L46A 1D9FA 1L3KA 2VG7B 3MPWA 4RW6B 1I94J 1TFYA 4HDHA 4MKYA 2YKMA 4NXMF 4CLTA 1RT3B 4RW7A 2HLUA 2OGUA 2HNZB 3G6YA 4QWDA 4ZLPA 2VF3A 2FZKB 3I96A 4H4KC 5ETSA 4DQRA 1N6QA 1NSAA 2M7SA 1X4AA 1S0VA 1VQ7S 3BQ0A 4P7VA 2R7SA 1RTJA 5K8NA 4DUYF 5FJ4A 1QTMA 1CLFA 2PC6A 4NLOA 3CJ8A 4B08A 4YDDB 3MUVP 4J9KA 1SL0A 3RBDA 3BN4A 2VBYA 4CO3A 1X4BA 3DLEB 1G1XA 3KJVB 1X7VA 2W9CA 4B9TA 2O66A 1VOMA 3GYNA 2VBWA 2J0WA 3CJ4A 2YQ1A 3BGLA 3MEEA 4ZN1A 4ZMMA 2NLWA 3UWTA 3JYTB 1TMJA 3ZXWA 2F8MA 3MM9B 3BSOA 4NMXA 2FC9A 3A1YG 4BWMA 3NS5A 2MQ8A 2ASJA 2YNGB 4KY3A 2GGPA 2A18A 2AWZA 2M5YA 2OPQB 4ZDNA 2O67A 1CJVB 1LWFB 4IKAA 1O8BA 2V2ZA 1U47A 4DX7A 1K1SA 2UVUA 4HT7A 2KFNA 2R7VA 1QTNB 4KPYA 2RF2B 5LL6d 3OTOJ 1S6PB 2QYCA 1P6TA 2WVCA 3IAM9 2IJRA 3GJTB 2MKCA 1S1TA 5K5MA 2M2BA 1KEKA 4KGVB 3NGSA 4GC7A 4CH1A 2LECA 2CUYA 2F63A 5IQ6A 3FNNA 4OQJA 3KKFA 5HL7Q 4YDXA 2RS8A 2OMLA 3Q83A 1RWXB 4KFBA 3UNYA 1VJQA 4FBUA 1RT7B 5CYQA 3LF0A 1NNDA 4CLZA 4NCGA 3KUGA 3LAMA 3EXCX 2FHJA 3PW5A 2CNLB 4U7CA 1N5VA 1M1HA 2JEIA 1VK8A 1Y5NB 2DXDA 3ZZRA 2GCFA 2P9CA 1FFGB 1NPRA 2XZDB 2QFJA 5KFMA 3O3LA 2XSJB 3U27A 3V4IA 2V4QA 3MUMP 3J7YI 2Z0GA 3H7HB 1JLFA 1XNRF 4PXBA 3Q2SC 1OY8A 3M2VB 3KK1A 3D5MA 2KZZA 3CD0A 2NXNA 1R31A 5GMDA 1B4SA 2ZOFA 3OR2A 3EPIA 3HHKA 2BKNA 1DZ5A 1YJTA 3KK3A 5T7LB 4JI3F 5BXIA 3ULHA 3OT9A 2LQJA 2VG6A 3ZZZA 4DQSA 2B9XA 4V19X 1UMJA 3G6VA 1PC5A 5C2CA 3PO4A 3PRBA 3UE2A 4B3OA 2PMZD 4NRUA 2XS5A 3N01A 4M63A 2RB7A 5A6WA 3NGDA 2YTCA 5ADZA 3MM5A 3IMQJ 3B4MA 1RB0A 1S0NA 3GIRA 2Q79A 4IH5A 3T1YJ 4UW2A 1OIAA 3CMAS 3G6XA 3AXKA 4OZ2A 4NLXA 2MTLA 1XIQA 2BE2A 3OHAA 3M05A 4X66F 5D8HB 4DUZJ 2RKIB 2MMYA 3BGRA 3CDAA 4FN5A 3PJXA 4URQU 1RISA 5B09A 3R2DJ 5AXNA 2D9PA 3CC4S 1OSDA 1FHTA 3QO9B 3Q22A 3QGPA 3W62A 3DRYA 3KG1A 3S1TA 2JSXA 3W9JA 1NCLA 2ABYA 1SJQA 2QMWA 3DDNA 4JI1F 3FMWA 2DRAA 4ES1A 3MEDB 2YWKA 2R42A 2V8DA 2Z2LA 5K9FA 2CVIA 4PAAA 2D3OR 2HS3A 4FZVA 1BWVA 4RUAA 4DF4A 3MOJB 4OZ1A 1RTDB 1WJ9A 4P7TA 4F4ZA 4Z37A 1PJ5A 1U0SA 1VMBA 4K4TA 1VBKA 1X31C 1PYSB 2NS1B 3C6UB 4ZPDA 2RT3A 4PWDB 1S1VB 1YVFA 2GJIA 1RWWB 1Y3KA 4M5DA 2R7XA 3M8WA 3LP1A 4N56A 3X3UA 2BKOA 1YRXA 1R6YA 2POKA 2KYXA 2GVZB 4DV3J 4JYAJ 4LFBJ 1UEUA 5J2QB 5DG7A 2YQ0A 3WC2A 1NHUA 4FKXA 5B0GA 2CPZA 4R0JA 5IFMA 3DNCA 2QLFB 2AX0A 2QSWA 3BH6B 2K1RB 5LSRA 3T5JA 3DXBA 4TU8A 3D6HB 3Q23A 2E5HA 3LWMA 3KLHA 3CSKA 4OYBA 1SH3A 1REGX 1SBRA 2R8JA 4I2QA 3CD6S 3KJQB 3IR5B 2AZ1A 5E0OA 4HI2A 5DM6Q 4YN3B 5KG6A 2VOPA 1LWCA 3MOZA 3UN5A 1IR2A 1R8AA 5AJ3J 1V3ZA 5DLGA 2W2OP 3PR4A 1MN7A 2J6SA 1F2GA 1OWXA 5CHCB 4M5JA 3CJ3A 4QPTA 3V6KA 4LT6A 4NA3A 4DL0C 3PX6A 1RTIA 1Q8KA 3M2RA 5IC6B 1SC3B 2MZSA 1QAJA 2VB6A 1ZM9A 1R6VA 2MZTA 1JNRB 4WYWA 3OUYB 3DI6B 1TKZA 3GILA 2BV3A 1TKXA 1RAJA 4IFVB 2L48A 2CVEA 1OYEA 1IJEB 2FPHX 1S1WB 3C15B 3H2LA 1W2BR 5KFLA 1QJHA 4P2MA 4CT8A 2DD8S 2ACMA 1MMNA 1EAYC 1H98A 1TTHB 1JJCB 3R1HA 4QWBA 4TU9A 2XO7A 1HWLA 4YUDA 4CT9A 2AJ0A 3I4HX 5KG1A 3NNAA 3IP0A 4QIEA 1QSLA 3L4BC 2DGVA 2GFFA 4LRDA 3AH6A 5C25A 5KFSA 1YBAA 4DOZA 2G0CA 4WBFA 1IBMF 4QR0A 3ADAC 3UVJB 2DGWA 5GAGI 1FTRA 4K2XA 5I3PA 2AJ4A 4DR5J 1WC0A 2QV6A 5ETQA 3PR5B 1DQ9A 4R8UA 2DH7A 3CNQP 2VBZA 3AQPA 1NLKL 3IC1A 3H20A 4PYDA 4YQWA 2HAIA 4I2PB 4NLSA 1FNOA 1KRPA 4QR1A 1HYSB 4LF5J 1FX4A 2XHCA 4EK2A 2UV8G 4B3TF 2FHMA 4C6AA 1Q4RA 3O44A 5H9EK 1LW0A 2P6SA 3OSNA 4NZ6A 5HN0A 2L08A 5KG7A 1BWEA 2VPYB 1Y0HA 2OTJS 4JI8F 3FUYA 3OTCA 2ZH7A 1VQMS 3GV5B 3G4SS 3KHRA 1RQ0A 3KLIB 1E6VA 2F40A 5IT9U 3CD5A 1TK0A 2APOA 1U0HA 1IN0A 2ZC3A 4JOUA 1WC6A 4DL2A 1W25A 1FDDA 2IM3A 3DM2B 1YRTA 3I4PA 5DQIA 1VQSA 5L38A 1N56A 2OJ3A 1RI7A 3FVYA 1CJKA 3IRWP 2RDJA 2QEXS 3QATA 3B6BA 2VQEF 2IRUA 3ZTRA 4OX8A 5HROB 1VS3A 2OIHA 2VQFJ 3CC2S 1O0PA 2IYIA 1NPKA 5DDOC 2CPJA 2V67A 3K0JA 4X4UA 3C3LA 5J2NB 2NYHA 4YOEA 1BC6A 4NMLA 3PJ9A 3J7ZT 3A3NB 4TY8B 1HR0F 2DHAA 2G13A 1N32F 5LXRA 1FRJA 1LWXA 5A76A 1TELA 3K59A 1NO8A 1WG4A 5HI7A 1C1BB 3QIPB 1CS4A 4Y2MA 4L75A 4P72A 1FRXA 3DOKA 3IAS9 4Q0BB 3AJ2A 1Q1KA 4AYBD 4FYVB 4O44B 1KVKA 3M8YA 3WIVA 2XEXA 3TI0A 2FJEB 1RDRA 3B4DA 1EETB 3HDSA 2BE7D 4A8QA 3N5FA 3R27A 1HWUA 1LV5A 3UQSA 4LF9F 2HKEA 1WUUA 3FBEA 4BLGA 2XC9A 4LFAJ 1C0UA 4WP8A 2W9BA 1NB2A 2KYZA 4IO1A 1XR6A 4ZPTR 3I56S 1HQ2A 1KOOA 4A46A 5E3CA 1H2TZ 4DSIA 2YKQA 5HSPA 5HLFB 1XJWB 2WVBA 4OZJA 3UW1A 2L41A 3A12A 3MCMA 3RBEA 1WC1A 2ZH6A 4LR8A 1RHMB 4AT1B 3LP2B 1RAGB 2RS2A 2W7PA 4YB1P 2CFXA 4M5LA 3OTBA 2VA3A 5A6PA 1AUSL 1WKJA 1S6UA 4MYTA 5M2PA 5BYQA 3J7AN 5KFZA 3VGVA 4AL5A 2E9ZA 4IOBA 2I6WA 1GXTA 3QGHA 5JVGQ 3KK2B 4WU3A 1J5EF 4NLWA 3DDIA 3FSIA 4LVNP 4DR7J 3G82B 1PKUA 1ZAVA 3N79A 2FVQA 2CQ2A 2VDHA 4YB5A 1KQFB 1HPZA 2W7OA 4USVA 3P6YC 3B82A 4O3RA 4NA1A 2LA6A 1LWEB 3OTEA 4QOTA 4USJC 4NLQA 3Q8SB 4RU9A 2UVRA 1WSRA 4MFBB 1ZA2B 1QD1A 1Y11A 4DQQA 4GO5X 1RT1B 2QL9B 3ETMA 1A7GE 1HNVA 3MCOA 1XN9A 3C46A 1O51A 1KSPA 2ROPA 2UU9F 2YKMB 4BBYA 5DG9A 2BRLA 3ZTSA 4QPXA 4JV1A 4ECTA 1PAUB 4C0HA 3CCVS 5DJBA 1WC5A 4LF7F 1P1TA 4CCHA 3BJYA 1ZPWX 1ULRA 1N6QB 2QLBB 1T9WA 2HZAA 1VQNS 4WZMA 1WF2A 4F3OA 2ZWPA 1RTJB 2HBYB 1N34F 4F4AA 4C98A 2LMIA 4K4VA 1OJ4A 1K9MT 2CWKA 4C8YA 2Q43A 4V19J 1R8CA 1L3VA 2KXNB 2ZC4A 1R0AA 3V81A 4RBTA 2VODA 3GSIA 2YWFA 2CZ9A 2WK4A 3MEEB 2OD4A 1RWKB 4OI4A 2ATLA 4KV8A 4YB6A 4X64F 1S4EA 2GO9A 5D4PA 4CDIA 2BQRA 1YHQS 4HKQA 4CNZA 3A8KA 4DSKA 4OHXA 2ASLA 4FYWB 4EYIB 1X9WA 3CIMA 5HMZA 2V8PA 1MROA 2GGPB 2MKIA 4ZK7M 1RWUA 1R0CB 3NY0A 3OQ2A 3UD5A 4LF2A 3TZXA 3MM8A 4F2SA 4PG4A 4DV1J 1IKXA 2KL8A 2H51B 4QWCA 5J2PA 3GJRB 2ZD1A 2OFGX 4ES2A 4A8FA 1IBKJ 1S9GA 3D0GE 3CJ0A 1HKAA 5K8PA 1NM2A 4DJBA 4UQTA 3FDSA 1S1TB 3T5HA 3TQ1A 2OEMA 3M2UA 1WKKA 4DPOA 3OVSA 3GR1A 3AT1B 5DDRC 1HNZJ 3DLHA 4NRTA 3PG9A 4KFBB 2DO0A 2Y0SD 2B5JA 2X1GA 2V0NA 2CJQA 5CYQB 2HBQB 1F3VA 1Z2LA 2DYAA 4NCGB 2I0XA 2LQ9A 1EARA 4QIWD 2J9DE 5J1EA 3Q2TC 5IM0A 1IJFB 2J7KA 3UD4P 4OYIA 4NLPA 2XMTA 3V4IB 2A2DA 2DEJA 2KRRA 3GIJA 3LUYA 1HLWA 2KT5A 4XTTA 3UPFA 1JLFB 3WC0A 1WTFA 3AJDA 3D3BJ 4DI6A 3BQ2A 3MAHA 1KONA 2HHXA 1MG7A 4JB8B 1AFJA 1S9FA 3KK1B 3IBCB 2H9ZA 1ZM3A 2CYYA 1S7HA 4N5SA 3B54A 4FVCA 2O01C 1N54B 2DPIA 2HGNA 3KG4A 3CCES 3OR2B 1RADB 2PIIA 5KT3A 2AGQA 2B56A 3KK3B 3CDWA 2D41A 1QAIA 2VH7A 2VG6B 1X4FA 4YEAA 3P49B 2ZM6J 4B9MA 4C11A 3M9MB 1TUVA 1P9QC 4B3OB 4OHWA 4DV4J 2GMJA 1VCTA 4C3MA 1YJNS 1ZAXA 4RBUA 3MM5B 3PYEA 2G9OA 4A8MP 1AW0A 3ILIA 5F8NA 4IDKA 1TAQA 3R5JB 4KPCA 2DJWA 1TUWA 3W61A 5LMUF 3EUNA 1ZBTA 3IM9A 4GRSA 2BE2B 3TA1A 4P2FA 2IY5B 3BGRB 4DL6A 3D1HA 3SQOP 2MY7A 3IG1A 3MM7A 2UUWA 2UUBF 2V2KA 3TAMA 4C8OA 3MFHA 1HQUA 5CA5A 5KG0A 1N52B 4KRWA 5I3UA 4WU2A 3MXHP 4CO2A 2EG1A 1IVZA 1T9VA 3O1LA 1UFLA 3BREA 2V4JA 1XR7A 2V9WA 3KUEA 2IMOA 4OFZA 4OYXA 3OXGA 2YKAA 4DR3J 1FO1A 2BOAA 3VTIA 4CO0A 4ZVOB 2J9CA 2M88A 2QZ8A 2Y0BB 2XY6A 1YDLA 1Y4ZB 5HJXA 2N3LA 2H5JB 2UUAF 5E5NA 2FVSA 5LMNJ 4O3SA 3M9NB 2G1HA 3NGUA 5MLCV 2Q1LA 1N36F 4M5DB 2FLNA 4LSLA 4A8XA 2RDIA 3LP1B 4ZCIA 1M0SA 1IBLF 2X7IA 4ZN3A 4NLDA 4U96A 3ENAA 4F8RA 4J9PA 3J81j 3BBBA 3IBFB 2XB2D 2E1AA 4F0MA 5F9NA 5D4LA 2R7QA 1X4DA 4FF3A 1UETA 3E3XA 1MSWD 4N41A 2PT0A 3M7VA 2GA7A 1H74A 1RHJB 2HVDA 4GC6A 3KLHB 4PRFA 2G0IA 3SCIE 3OJSA 1FVSA 3BKTA 4KO0A 2HNDA 4I2QB 2J6UA 2IPOB 1DJ0A 4JI0F 5RUBA 3ETOA 1LWCB 2R2RA 3QIDA 2I5JA 3UN3A 2QLXA 5KFUA 2FZCB 1PC4A 2RHQB 3QT7A 2WZ1A 1S0MA 1Q7LB 1WOSA 2R2TA 1SH0A 1Q0NA 1RTIB 1FVQA 3M2RB 4U7UK 3PKMA 3BSNA 4LRBA 5K8MA 5A2QY 1S72S 1G4CA 2PN6A 2M52A 2FHKA 1NZAA 4XO0A 2DNMA 1TKZB 3WDOA 1TKXB 2E7VA 3W3SA 4MK8A 2PA3A 4Q2LA 5DM7Q 2DITA 1URNA 1XMOJ 1LNQA 1FNMA 3L9ZA 4DR1F 3PW4A 1KBRA
chains in the Genus database with same CATH topology
5A8RB 3JB9k 3BM7A 1KD1T 1FDAA 3D0IE 4PXEA 2KHCA 4RWXA 4XIUA 1IKVB 3NCRA 3K8WA 4CTAA 2BZ2A 1VQOS 4DV0F 1VQ8S 4B02A 5DQHA 2GQQA 2MZJA 3HVTB 3RRKA 3FZ2A 4I6AA 2W9CB 2OPSB 5GAGU 1LXJA 1E6YA 3NP5A 4ID5A 1JLEB 2FGCA 1LQ9A 1H7XA 3GB0A 2DNOA 4JI5F 3IWLA 5C25B 3K57A 5KFVA 2HHSA 3OJUA 2KHDA 3AA9A 1FE0A 4ZPCA 3W2WA 4ECUA 1RK8A 1LWEA 3M6XA 4QWEA 4Y6IA 1FEHA 3QGGA 2YH0A 3DOLA 1REVA 3T9ZA 3M32B 3NAIA 4C97A 2F1FA 2LQBA 3KLFA 2FLPA 1RT4B 2N7CA 2YKPA 4YP3A 3EZ5A 3CPWR 3MR5A 3RR7A 3R5BA 4ITSA 4MFBA 3BEGB 4AL6A 2GW8A 3PEHA 2ZH9A 5FDLA 1RT1A 2HZCA 3PO5A 2F8HA 1U1MA 3NLCA 3G71S 1D9FA 1S49A 1NKBA 1L3KA 2GO8A 1IKWA 2YWHA 2VG7B 3TVYA 3KOAA 2MZ1A 3MPWA 1VRUA 2G1DA 3M8PB 2JLGA 4RW6B 5D4OA 2NQPA 1TFYA 4HDHA 2HS0A 2YX7A 2LU2A 4MKYA 5D3GB 3QJLA 3SSQA 3DMJB 3MR2A 4LSNA 1PO6A 1L3TA 4B9UA 2YKMA 4I56A 4NXMF 3PRDA 1RT3B 4RW7A 4R8UB 2CPXA 2XI2A 1XC9A 2MDAA 2HLUA 2AYBA 3I32A 5A8WA 1T3NA 4YHHF 1KN6A 2HNZB 3I82A 3KMSA 3UD3P 3HK2A 2HGMA 4RNFA 4WFNQ 3G6YA 2R9LA 7FD1A 4QWDA 1HWJA 3PNIA 3US5A 4ZLPA 2CQBA 1ZYQA 1TKTB 4K4XA 4F4KA 1VJWA 1V3RA 2CQ3A 1HBUA 4M95A 2E5LF 2JEJA 2NR0A 4DN9A 3NG8A 5KG5A 5HP1A 3I96A 3CCTA 4FVMA 4H4KC 5GADU 4IO9Q 3K8VA 7FDRA 1J5OA 5KAKA 2QLWA 1X9MA 3M6UA 4JYAF 4LFBF 4DQRA 1N6QA 4PQAA 1ZH5A 5LT5A 2E66A 3DYAB 4IH7A 2M7SA 1UJ6A 4IYQA 1XMOF 2OPRA 3U1NA 4EZ6A 1X4AA 2KG1A 1S0VA 1HBOA 3MR3A 3UNGC 1RT6A 3C2PA 1OQ6A 1ZZFA 1VQ7S 3BQ0A 3MMAA 1X5SA 3FCHA 1HWIA 4P7VA 1VQ6S 2R7SA 2C42A 1RTJA 3SCKE 4DDFA 3L7OA 5K8NA 2KKHA 4N8OA 4DUYF 5FJ4A 2HFOA 1QTMA 1KVIA 2VUGA 1N5SA 4OIXA 6FDRA 1CLFA 4DV5F 4XDCA 2PC6A 5F8IA 4QU7A 4NLOA 4FYDA 1F9FA 3BR8A 2ZITA 4B08A 1VQ4S 2JZ5A 4YDDB 1SV5B 2M9KA 5THWA 4ZHRB 2WOMB 3MUVP 3I0SA 5KFRA 4J9KA 1IQTA 4O4GA 2BQUA 1SL0A 2OPPA 3RBDA 3N6MA 3BN4A 1FXRA 2VBYA 2HLTA 4CO3A 1X4BA 2BXJA 3DLEB 2KJVA 4TKTA 1G1XA 1GXUA 1E6VB 5CCLA 3UR3C 3HVTA 1FEEA 1FTCA 4EGLA 5A8KA 5EWEA 3KJVB 5KT2A 1M5SA 5A0YB 3EYZA 2DTJA 1GX5A 1X7VA 2A2CA 2W9CA 1U1QA 2G4BA 4B9TA 1DFDA 2NYIA 2DISA 2O66A 2XZWA 1VOMA 2MKHA 2XULA 1VIOA 3GYNA 2VBWA 2J0WA 3CJ4A 2KZMA 2Y1IA 3TUJC 2DGUA 2RU3A 2DVIA 3JSMA 3WBZA 2HWTA 4F4XA 1IM4A 1S9EA 3NCQA 3BGLA 4MMOA 3M32A 1I94F 5IWAF 2PI5A 3MUTP 4QCLA 4W90B 1D9AA 3MEEA 3SDEA 2ZE2B 4AE5A 4L72B 3AB2B 4ZMMA 3QJJA 2NLWA 1GTEA 4FNIA 2CJ9A 3UWTA 3JYTB 2DNZA 5D4NA 2IYGA 2ZH8A 2F8MA 3MM9B 3BSOA 3JTOA 3SV3A 3CT9A 5KT5A 3EZUA 4YR0A 2I8EA 4KSEB 3CC7S 3T5LA 1GH8A 4OV1A 1FKPB 4ECYA 3PXGa 2FC9A 2B6AA 3JSRA 2KXHA 4Q8FA 1UWBA 3A1YG 4BWMA 4C9DA 1VBXA 2CKWA 3SXLA 4LJMA 3NS5A 2PDAA 3G8TA 3EXYA 1UVMA 2NUHA 2ASJA 1FRLA 2YNGB 2V94A 1Q8IA 4ECRA 1UEVA 2GGPA 1JWWA 4YR2A 1YI2S 2ZDPA 2A18A 2Q3PA 4YR3A 2AWZA 2RILA 2HWIA 2RQCA 2CJAA 1QSYA 3M30B 5HO4A 2M5YA 4X4TA 3H40A 2OPQB 2E7WA 4H4OB 1JNZB 1FKOB 2C3MA 3KG0A 4ZDNA 2O67A 1BY9A 1LWFB 3BGFA 4NLYA 4IKAA 1FKAF 1O8BA 4I0WA 4D3HA 3OR1A 2BRKA 1IUJA 1M5HA 1U47A 2R2SA 2YWGA 2NPFA 1K1SA 3BS9A 3MAQA 4J37A 2UVUA 1OPIA 4HT7A 2V8VA 2KFNA 2L9WA 2YX1A 3DU5A 2MZQA 4FF4A 2ZJQQ 2R7VA 4KPYA 2RF2B 4X4VA 1K0VA 1M5PC 5LL6d 4E8UA 3HM9A 2CQ1A 2D3UA 2JDJA 3HJFA 5LJ5Y 3DOKB 3OSPA 3MMBB 1C0TB 2VFSA 4N77A 1S6PB 2DNHA 2QYCA 1P6TA 1KFSA 1SV5A 3IAM9 2MKCA 4FXWA 2AP6A 1S1TA 2A3JA 2ZBIA 3Q8PB 5K5MA 3QZ7A 2M2BA 2C3OA 1KEKA 1ZAWA 3CUNA 2QMXA 1YTYA 2RH3A 3T6BA 4PUOB 1JKHA 3DRPB 2OSQA 4OLOA 2IVFB 4GC7A 4CH1A 5KFDA 2LECA 1HBNA 3IWXA 2D1CA 4DR4F 4IG3A 5IQ6A 2D3ZA 3RAQA 3MGJA 3ZZOA 4L3NA 3FNNA 4OQJA 1X5PA 4K4SA 3KKFA 2WSCC 2HIQA 4KAIA 5HL7Q 4YDXA 2ZH3A 2RS8A 2OMLA 4KFBA 4BDPA 3HF5A 1C0UB 2W9BB 1RT7B 1TL3A 4FBUA 2RMLA 5CYQA 2K7KA 3IRXB 5CYJA 2IA6A 1RYRA 3LF0A 4MH8A 5I42B 5KFOA 3T9NA 1MMDA 1NNDA 5L1JA 3I9ZA 1BQNB 4NCGA 3EGWB 3LAMA 3EXCX 2FHJA 5GAEI 3PW5A 2PGCA 2MPUA 1G2EA 4KT0C 2FJAB 2FC8A 4U7CA 2FLLA 1N5VA 2JEIA 1X4GA 1VK8A 2ADBA 1Y5NB 3ZZRA 2GCFA 5DG8A 4O3PA 1HARA 2CRLA 2DNRA 4EFAC 2P9CA 4TYBA 1Q82T 2IHR1 2QFJA 5KFMA 3K7RA 1WHXA 4A8WA 3VAFA 3O3LA 2M3DA 2XSJB 3U27A 3V4IA 1HFEL 2V4QA 1NK7A 3MUMP 2P9EA 3MPYA 2MHNA 1Z2ZA 2J0XA 1HNWF 3J7YI 1OQ3A 2Z0GA 2XSFA 1JLFA 1LKZA 2XI3A 1JJ4A 1XNRF 4PXBA 4WKRA 5JJBA 2JH3A 3Q2SC 2DRBA 2YKNB 3T1HF 2WCXA 1C4AA 3H2UB 3M2VB 2XBPA 1YRUA 3QAEA 3CJKA 2YNHA 3MZIA 3KK1A 2KB2A 5J2MB 5CZVA 3D5MA 2KZZA 2VFTA 1U4BA 4I69A 1U49A 5AXLA 3CD0A 4MK9A 2WONB 1JIHA 3CDBA 3VZIA 4USHA 1FK9A 2Z8QA 5F41A 1R31A 3CCWA 4GKJF 4ZVHA 3FEYB 4EU0A 4Z2XA 1NK0A 3V2UC 1KVJA 4DL3A 2RF2A 3OW2R 2ZOFA 2VFRA 4DG1A 1HWKA 3OR2A 2EFQA 3MMBA 4R25A 3EPIA 3HHKA 1WF1A 5G0RA 3SFGA 1UFWA 3BQ1A 4FXDA 1D3WA 2VFVA 1DZ5A 1YJTA 2LDYA 3KK3A 1Q8LA 3RZAA 1TVRB 1H0HB 2ZOMA 5T7LB 2DCLA 3ZFVA 3C6TA 2ZUGA 4JI3F 2X1FA 4NLUA 2ZDOA 2B9YA 3G96A 4WFYA 4PQUA 3ULHA 3N4WA 3T3FA 3PX0A 2N3OA 5F8JA 2LQJA 3VALA 2VG6A 3ZZZA 4ED2A 4DQSA 2B9XA 4V19X 3D28A 3MDFA 1UMJA 4PG5A