2K8GA

Solution structure of rrm2 domain of pabp1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
GADPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyadenylate-binding protein 1
publication title Solution structure of RRM2 domain of PABP1
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k8gA00
2LXIA 2MKIA 5LSOA 2HGMA 1VQ5S 3UCUP 3HI9A 1VQ7S 3MI7X 3B4DA 3CCRS 1U1MA 5LJ3Y 2KN4A 1X4BA 2CPXA 1U1LA 2DHGA 5DDRC 1JMTA 1VBYA 2AYMA 2CPDA 2KXFA 3BEGB 2LECA 2MQPA 2ADBA 1KQSR 3D2WA 2LYVA 3Q2TC 2YKAA 2NZ4A 1U1PA 3G96A 3MURP 1JJHA 2DGWA 1R8HA 4FXVA 2DITA 2DHSA 4P6QA 4Y0FA 2UP1A 2RS2A 3NNAA 5GVQA 4ED5A 3CF5Q 3ZZZA 1VQNS 1DBDA 1SJ4P 3SMZA 2ADCA 1U1RA 1X4HA 1YTYA 1VQMS 4TLQA 2KXHA 2FPHX 2DHAA 2HVZA 2DGTA 1X4DA 2RRAA 2CQCA 4TU9A 1PO6A 4F02A 5DM7Q 3UD4P 1K73T 3BO4A 3VAHA 2DH9A 2CPHA 3P5TL 2I38A 1WHYA 2CPIA 2DIUA 2DNQA 2XSFA 3CXCR 3CPWR 1YJ9S 2CPJA 2PE8A 4EGLA 4ZKAA 4WKRA 3OW2R 2OTLS 2LKZA 2D9PA 2DGVA 2CQBA 2KT5A 2KG1A 2MYFA 2L41A 1K8AT 3SDEA 5EN1A 2LA6A 2LMIA 1UW4A 1X5SA 1WEZA 2MY7A 1X5OA 2GO9A 2OSRA 3PIPQ 2G1DA 2DGOA 2DB1A 1FO1A 5DDQC 2AD9A 4YUDA 2OIHA 2PEHA 2RRBA 1FJEB 3N9UC 2MGZA 1OPIA 2XNRA 3PIOQ 4ERDA 2WBRA 3CUNA 2KFYA 2E5IA 4TU7A 2G4BA 2DNNA 1N54B 3VAKA 1VQ4S 1WF1A 1SJRA 1FT8A 2MB0B 1X4CA 3MD1A 5GAHU 1VQKS 4CH0S 2EK6A 5HL7Q 3P6YC 2DNGA 1KC8T 2D9OA 1NU4A 5D77A 1HA1A 5IFMA 4QQBA 4YB1P 2HYIB 1Q82T 2FC8A 2FC9A 4PR6A 3R1LA 3H2UB 1NJIT 2YH0A 2MKCA 1WHVA 2BZ2A 5H1SV 3IRWP 3G71S 5FJ4A 2D3OR 1UAWA 2YH1A 2N3LA 2M70A 1U1KA 2YTCA 2HGNA 1S79A 3IWNC 1M5OC 2X1AA 2N7CA 5JVHQ 1Q7YT 2RVJA 3JB9k 4W90B 1SXLA 5GAEU 2LQ5A 1X4FA 1AUDA 5IM0B 2FHOB 3RW6A 1OWXA 3VAMA 3FEYB 2MMYA 1X4GA 4QPTA 1FJ7A 3CULA 2HZCA 1JJ4A 4LMZA 2RUGA 3MUTP 4YOEA 2OJ3A 2G0CA 1HD0A 3R1HA 4M5DB 3THPA 1M5KC 2CQ1A 1JJ2R 3CCLS 1XN9A 2KVIA 2DISA 2J8AA 2YWKA 3BO3A 2Q79A 2MZTA 3CC2S 3NNHA 2MZQA 3S7RA 2DNLA 1RK8A 3CCUS 5DDPC 2MXYA 5DDOC 1PGZA 5JVGQ 5DETA 2MY8A 1DHMA 3U1MA 2MHNA 3THTA 5HO4A 1DZ5A 1X0FA 1SJ3P 2DNZA 1Q81T 1KOOA 5DM6Q 2ZJRQ 3VALA 4IOAQ 1FXLA 4CH1A 1R8PA 1WG4A 1D9AA 3CCES 2QA4S 1WHWA 3MDFA 1SJQA 2RQCA 2J0QD 3U1LA 1NO8A 2M52A 2DHXA 3UWTA 2RT3A 2LEBA 2DNHA 2FY1A 2KI2A 2MJUA 2MSSA 2AYEA 2RNEA 1IQTA 1U1NA 1WI8A 2MPUA 3VAFA 1SJFA 2CQIA 2MJNA 1A7GE 2JRSA 4WFAQ 3TP2A 1FHTA 4WFNQ 3G4SS 2VONA 1K9MT 3DLLQ 1G2EA 2XB2D 2ERRA 4C0OC 2MKHA 1VBZA 2DGUA 2LXUA 3EGNA 2MQQA 1UFWA 1WEYA 4CQ1A 3BO2A 1P27B 1WF0A 1WF2A 3SXLA 1ZH5A 1VQLS 5MLCV 1UP1A 4OZ0A 2RU3A 2E5JA 2MSTA 3G6ES 4C4WA 3ZZYA 1U2FA 1D8ZA 2B0GA 2HGLA 2CQHA 1ZZNA 1HD1A 2DH8A 2RQ4A 1YITS 1OIAA 2MQNA 1YWXA 5LXYA 4UY8T 5IM0A 3MD3A 2DNOA 2KYXA 2CPZA 3P3DA 3S01A 1WG5A 4U67Q 2M2BA 5CYJA 5GADU 2DNRA 2MKKA 3CC7S 3MXHP 1FNXH 3R27A 2M4MA 4RU2A 2KH9A 2GHPA 3CCSS 3CMAS 2X1GA 1N88A 3EGZA 4TU8A 3G8TA 2LEAA 3CCVS 2DGQA 2M88A 4J5OA 3CC4S 2O3DA 2CPEA 2F3JA 4CIOA 2CQ2A 1VQ9S 3VAJA 2KRRA 1BY9A 5D78A 3CCJS 2MKSA 2CJKA 5LSLA 4WCEQ 3VAGA 2XNQA 3I56S 1KD1T 1M1KT 5ITHA 3S8SA 4PRFA 2DGSA 3UD3P 3MOJB 2RS8A 2E44A 3LQVA 1U6BA 2E5GA 2CPYA 1YIJS 1VC5A 3NMRA 3MUVP 1WEXA 2KG0A 1W2BR 1VC6A 1DRZA 1H2UX 5CXTA 3BS9A 3K0JA 2N3OA 1YHQS 2CQPA 2A3JA 1YJWS 2CQDA 1U1QA 4IO9Q 4Y00A 2OSQA 5IQQA 2LA4A 2JWNA 1VC0A 3ULHA 2VOOA 2QFJA 1X5TA 2DNKA 2OTJS 2DIVA 2LCWA 2U2FA 2SXLA 5GMKa 2ZJQQ 3CCMS 2DO0A 1M5VC 3CTRA 2KHCA 1QVFR 1F9FA 3J7YU 4WF9Q 1VQ8S 2CQ3A 4F25A 5LJ5Y 3V4MA 3Q2SC 1U1OA 3G9CA 3NNCA 5CA5A 1ZZFA 2NLWA 2CQGA 2F9JA 1YI2S 1Q86T 1H6KX 1WHXA 2MQMA 4IUFA 2AYGA 2XS5A 2JVOA 3US5A 4WIIA 4F26A 2DNMA 2EK1A 1HL6A 2M9KA 4WFBQ 2V94A 2KRBA 1WTBA 5GAGU 2MQOA 3LPYA 4A8XA 4LIRA 1A9NB 1RKJA 1M90T 2L08A 2M8HA 3UCGA 3NS6A 4QU7A 1KOHA 3H2VE 2MQLA 5BJRA 5LXRA 2VOPA 1L3KA 1B7FA 3VAIA 2E5HA 2N82B 3I55S 2MZRA 2EVZA 2JVRA 2CPFA 1WWHA 3DXBA 1WI6A 3CCQS 4UQTA 2KXNB 2J76E 1QM9A 3TYTA 1OO0B 2MZSA 3S6EA 2JX2A 1X4AA 1QVGR 1VQOS 2M7SA 3MUMP 1WG1A 3EX7B 4Z2XA 3HHNB 3L3CA 1WELA 2F9DA 2DO4A 3UE2A 3VF0B 3B4MA 3FEXB 3J7ZT 2XS2A 2L9WA 3UCZP 1URNA 1N52B 2X1FA 2DK2A 2M8DB 1VQ6S 2DGXA 1VBXA 4IOCQ 2CQ0A 2I2YA 2X1BA 4V19X 3CMES 2XS7A 2K3KA 2J0SD 4W92B 1S72S 2M0GB 2KM8C 3G8SA 4BS2A 2AYBA 1X4EA 4PKDB 2ZJPQ 3P49B 3SDEB 2MKJA 2VODA 3CD6S 1P1TA 1M5PC 1X5PA 1YJNS 2KM8B 1FJCA 2K8GA 1VQPS 2MZ1A 1H2VZ 1O0PA 2MZJA 4C7QA 3TO8A 4QU6A 2KU7A 2MGZB 2DNYA 2U1AA 4OZ1A 2DH7A 4FXWA 2QEXS 3NS5A 2BOPA 1CVJA 1H2TZ 2DNPA 4LJMA 1U6FA 2CQ4A 1N8RT 3RW7A
chains in the Genus database with same CATH superfamily
2W25A 3P96A 3FCWA 4O3PA 2XMTA 2CNOB 2KN4A 4LREA 1NHUA 4CO3A 1LW2B 3CIMA 3Q2TC 4NI2A 2XO6A 3OTCA 4YR2A 1W26A 5I3PA 1IBLF 1EARA 4P6QA 3K5MA 3NNAA 1RT4B 4RWWA 3V6DB 2CIMA 3BH7B 4DG1B 4C11B 2VDHA 3KTQA 4MK8A 1XNQF 2OPRA 1WC5A 4UUXA 2V8PA 2Q3PA 2X3GA 4DUZJ 3MPUB 3J7A1 1GTHA 1WDTA 5F0UA 5ETTA 2E5LJ 4DZ6A 4HEA9 1N48A 4HACB 3DLGB 3L7UA 3BBBA 4LFBF 3N9UC 2NQPA 3CUNA 1VI7A 1HI8A 3W8GA 1KN6A 1NM2A 2Z2LA 3GR0A 3A1YG 5BR8J 4PYDA 5KT5A 5B08A 2NS1B 1F0XA 5D77A 4JI3J 2W4DA 3BGOP 5D3GB 3A4TA 2HHXA 4DEZA 3IS9B 2MKCA 2BZ2A 3CD7A 3A13A 1CJVB 4ELUA 3N79A 2BM0A 4K2XA 3POTB 1RKIA 1XR7A 2JJ4D 4ZVPB 4DLEA 1RSCA 1GEHA 1VK8A 3TA2A 3FEYB 1RTZA 3MUTP 1HD0A 2COLA 2F7VA 3ZC4A 3PFOA 4ZHRB 3R6GB 1IR0A 3QSYB 1S12A 1PGZA 3FSIA 3QBCA 4J9MA 4M5KA 1Y11A 4WP8A 3WIUA 3HKWA 3H5YA 1GX5A 4DV3J 5B09A 1KVJA 1KKHA 2G2ZA 4IO1A 5HN0A 3MM7B 2F8MA 3FCHA 5HI7A 3ZNJ1 1F5CA 5K8NA 3G6YA 3HD1A 4QIVA 3DLLQ 1OPZA 4W4MA 2DGUA 2R2RA 3RU0A 4MK9A 3FEZA 5HMWA 4UUWA 2FJAB 4OZ0A 4WYLA 1VK3A 1RT1B 4DQQA 4ZA1A 4NA1A 2HRUA 1CSJA 2WK4A 3EPGA 1RTJB 2UXBF 2C3OA 3P3DA 4GO7X 3LAKA 3VVTA 1JKHA 2CAJA 4Y3CA 1CJKA 4PUOB 2DYAA 1SQFA 4M5DA 3MM5B 3CCSS 4I56A 5K8MA 1UWAA 4DHVA 2OMOA 2DGQA 3T6BA 4P72A 4RNMA 3SCIE 4EWTA 5CZXA 4NL5A 4ECSA 2NUHA 5LOQA 2E5GA 3PZPA 1HWUA 1O51A 4IG3B 4DR2J 1RAEB 2UUAJ 3EGVA 3QFWA 2C3YA 1CEZA 3MOZA 3LP2B 4K4XA 5ETRA 3RR8A 4DPTA 2MDAA 2DIVA 3PYEA 4QYRA 4DN9A 3HX9A 3CDEA 2B4OA 1SC4B 1U8SA 3FK4A 2HHHJ 3KLVA 1T9TA 2UUBJ 3TAMB 4Y6IA 1UTAA 4MAKA 5KFPA 3M30B 4A48A 1XMBA 2E29A 3HFVA 1FDAA 3Q24A 2HFSA 1VQSA 5D4LA 4X4VA 2J9DE 2ALYB 3OFFA 3VGTA 1S7IA 1VFJA 2BQ3A 1JJCB 4V19J 1JLQB 1U6ZA 3BB5A 4P2XA 4CO5A 3N6LA 2MZSA 3V4IB 3TEHB 2R7TA 2GVDA 3Q8YA 4L72B 1TR0A 2QA4G 2BANA 3Q8RB 4CLYA 2DGXA 3IC1A 3NRBA 5L1KA 4R25A 2W1BA 2AYBA 4ZPCA 3MEGA 2LEPA 3SDEB 4KSEB 2VODA 5F8MA 1YJNS 2G2YA 3HF5A 4NLUA 4QR0A 1O0PA 2EFNA 1PBUA 4J9KA 3TO8A 4B3OA 2J6SA 3GSDA 1L3UA 4DV5J 4UOCA 3EZUA 3BBCA 2XZWA 1NUEA 2VPXB 2CPDA 4LQ9A 1I51B 1S6UA 1SI9A 3PW4A 2WSEC 1JQGA 1HNXF 4U7UD 2VASA 3QATA 3LP0A 3DDIA 3K5NA 2UVUA 4I6WA 5CZVA 3QGIA 2ZD1A 2ZH3A 4Q43A 1TK5A 3HM9A 4RX6A 5KAKA 4B3MF 1GH8A 4RU9A 2ZBCA 3W5ZA 1N6QB 5CD4A 4OHWA 1IM6A 2YKQA 2L41A 2QLJB 1K8AT 1R6VA 2G1HA 2HS3A 5B0DA 4X66J 4ZPDA 2G1DA 5DLFA 1SQEA 2VD3A 2DJWA 4K4ZA 5D0EA 5KT4A 4FF2A 1VQ4S 2ZDPA 3IAS9 3VTIA 1HI0P 1OYDA 4K59A 2NZCA 5CYQA 4FNIA 1GXTA 4QWBA 3O8WA 4BC7A 4CLKA 2OPPB 3OVAA 2AJFE 1GQEA 3GP9A 3WZ0A 2H4WB 4DR7J 3BZQA 2ZVIA 2E9TA 2BJDA 2X1AA 4F4WA 1XBWA 5GAEU 1UWBA 3R5CA 3RW6A 1FERA 5KFTA 4ICLA 3VAMA 1FA0A 2WCXA 2FIUA 3R1HA 1JLBA 3W5XA 2RRNA 2YWKA 2Q79A 2HWIA 1RK8A 4IFYA 4HHHA 4WFZA 1N33F 2PFDA 4GVLA 1ZAXA 2B6AA 3KG0A 3U1MA 4G3IA 4RW7B 2IRXA 1U0HB 3QLHA 5CAAA 2C2KB 1VBKA 3GZ7A 5KFDA 2DHXA 3DRSA 3FC9A 2HHQA 3EDQB 2HNDA 2KI2A 3OSPA 4IH7A 1UFLA 4NLTA 4HR2A 2C2RA 1SKSA 2KVQE 3LP1B 4HH0A 1K9MT 2F4FA 1KLMB 3DU5A 3D9BA 1SIZA 4QWDA 3F41A 1HMVA 1NKCA 3DMJA 2Z8QA 2RU3A 3HVTA 4ZVEA 1MN7A 3DLKB 3AOCA 2A10A 4EZ9A 4EBDA 1RHJB 4IQMA 1VISA 2BACA 4X64J 4WK3A 1NSAA 2WHOA 4OX9J 1Q8KA 3B6BA 3OR1B 5IT0A 1RABB 2FVCA 4FPRA 3OUYB 5JXSA 4WYWA 2MTLA 3PRVA 2PSZA 1VGYA 4J9QA 4DL3A 1RT2B 3F0NA 2Z2MA 3CCJS 4WCEQ 1IN0A 5F41A 3S8SA 2ZOFA 3KLEA 2BJ1A 5ETPA 1RGVA 2BV3A 1IKVA 3UN5A 1H2UX 1X9MA 5ETKA 4KV8B 3ULHA 5I3UB 2E1RA 3SSQA 1TKXB 1IUJA 1M5VC 4WE1B 2IIHA 1QVFR 4ZJOA 4KT0C 4WF9Q 3EZOA 2UUWA 5ADZA 2JDJA 2XMMA 1RZMA 3HD2A 2CQGA 3AH6A 4M5GA 5C5JA 1U49A 4DL5A 4KIAA 1UEUA 1UVMA 3I0SB 1YRTA 5L8RC 3A8IA 2I6WA 3PFEA 1A9NB 3MCNA 1YRUA 2L08A 5BJRA 2VQFJ 2LVWA 2VBZA 4Q45A 4J91A 3M6WA 5J2MA 2PIIA 2HVIA 3DXBA 5EWEA 3HPOA 5FD1A 3CGIA 2GMHA 3MEEB 5KT3A 4PWWA 4Z2XA 3SFUA 3TZXA 4NXMJ 2JFKA 1NK8A 3NS7B 4IOCQ 3TVKA 3KHLA 1WC0A 2QSFA 3ILJA 2ZDOA 3DCAA 4W92B 2PMHA 2NXNA 3H4DA 5DJBA 2H9ZA 2WOMA 2Z57B 1XNRJ 2UUCJ 2AX0A 1X5PA 3VGUA 3IO1A 5HBMB 3DXSX 3MMBB 2K1RB 3RTVA 2XHWA 5ETMA 3D6TB 3KJVB 1IKWA 1JB0C 3RW7A 1RU1A 1D3WA 1CULA 4Q8FA 2CPXA 2EW9A 4NLSA 4PG4A 2FVPA 2CJXB 2FQQB 3KJNB 4C8NA 1FWLA 2XC9A 1AZSB 4J9UE 1FK9A 1I5OB 3P5BP 2AEMA 4XAKA 1N32J 2DT9A 1FD8A 1MWZA 2JLEA 4R0EA 3CF5Q 1DBDA 4I6AA 2OFGX 5IC4B 5DLGA 3ILIA 1T9YA 2DGTA 3BQ1A 3FBFA 2R8HA 2WSCC 2IM0A 2Q66A 2I38A 5HQMA 4HI2A 4U9RA 3GU0A 3TANA 1TKZB 1PCAA 4I2PB 4JV5F 1KHVA 5GMDA 1PAEX 4IRCA 2DEJA 1HR0F 5HVHA 4B9VA 2QE5A 3R7BB 3OXFA 4PXDA 3PIOQ 4CLUA 4TU7A 3J80Y 1ZBTA 4DCOB 1RTHA 1SL2A 2QIFA 5J2PB 4NRUA 9RUBA 1HA1A 5K5MA 3DGVA 3I31A 2BQRA 1B64A 2KTQA 3R1LA 3M8PB 3NLCA 1JK9B 1UAWA 5E5NA 2JH3A 3M2VA 2GMLA 1TUWA 1I94F 2R4FA 2GJFA 2HBQB 2J0WA 2AGOA 3PR4A 1FRLA 3JAMU 3FDSA 4ATNA 1OWXA 2EBGA 4NLRA 4LRBA 4RNFA 1EB0A 4QIEA 1S9EB 4QWCA 2QV6A 2BDPA 1NHVA 2J8AA 3C6UA 2OHDA 3NNHA 2F1FA 1ZPWX 5HMYA 5K14A 4X65F 3WQPA 2HNYA 2VG7A 4R8UB 1Y0HA 2KL8A 3RBDA 1REVA 2AP6A 2YNGB 3M8QB 3VAFA 4MFBA 2FJBB 2MJNA 1A7GE 2JRSA 2QLXA 3OLBA 2ZH6A 1RHUB 4GKJF 3UFCX 4FS1A 2CKWA 1IM4A 1VQLS 3L09A 4NMXA 1CC8A 4FYXB 4HTJA 1O8BA 4JI8F 3E2EA 1IWGA 3X1LB 5IM0A 4JI2J 4ZPAA 1DTTA 2VFSA 5ETQA 3CC7S 1YVFA 4DV7F 3PRBA 4EUVA 1HYSA 2XBPA 4GRSA 3G8TA 2B5JB 5HQ8A 4ZCMA 3UPFA 3T5JA 3ITHB 4DZDA 2B51A 4ETXA 2FTRA 1XMQJ 2HRTA 1FFGB 2Y8WA 5EDWA 2AKWB 4UTGA 3T6JA 3V81B 2JWNA 1VC0A 3L9ZA 3SSSA 3T3FA 1X5TA 4FVCA 1RE1B 1BMQB 1HHSA 3WIVA 2X51A 4P7TA 3HVRA 3CCMS 3HO1A 3GG0A 4RR5A 2DRAA 3FJ2A 4ZPWR 3R5DA 4NEZA 3KK2B 2F9JA 3FMBA 5E2QA 5A2QY 3QT6A 3PKMA 2HIQA 2CJBA 2MQMA 4BLGA 4L74A 5HANA 4QYZK 1GK8A 1RAGB 2K3IA 1NBEB 2RH3A 4WFBQ 3BGLA 2V2ZA 3FZ2A 2FGOA 1ZS6A 4MTPA 1S77D 3AJDA 4BDPA 4Q7AA 1S6PB 4XDDA 5KFVA 7AT1B 3QNWB 2J76E 2IAJB 1H7WA 3S6EA 1RT7B 2OUGA 3LGNA 4FF1A 2DVIA 4QW9A 3QT7A 1VBXA 2LP4A 1R8CA 3RJMB 4B9SA 2XCPA 2V8GA 3I0RB 3GV7B 2C2NA 3W9HA 4F3MA 2QX0A 3B82A 4DU7A 4IR1A 1U2CA 2ZJPQ 4G1QB 3RB4A 3KUGA 1JLGB 2NYHA 4KY3A 3CD6S 2FD2A 3QQCD 4KBIA 1JLEA 2U1AA 1FDNA 2DH7A 1C1BB 1WORA 4DL6A 2CQ4A 4O4GA 2ZM6F 1QE1B 2BR0A 1TKDA 4PXEA 4NASA 2GVZA 1LWEB 2ZOGA 5F8JA 1BHNA 2MQPA 4X62F 2A2DA 2JZ5A 4Q44A 3OQ2A 2OO4A 4HI1A 1HI1A 1LFWA 4ED5A 2GS8A 2A6MA 1SV5B 1U1RA 1S7HA 3EVWA 4DV0F 2E66A 1TL3A 3P45B 2QL5B 3JXOA 3G2XA 4B08A 3PG9A 4KKOA 1F6TA 1Y4ZB 4F4XA 4FN5A 4OYMA 2CPHA 3MEDA 1XJWB 2V8VA 2DNQA 2AQ4A 2UXDF 5HAOA 1SB6A 2CPJA 2VG5A 3SCLE 3D7SB 3IP0A 1WUUA 4WTYA 2ABYA 3HVAA 1NEEA 2LA6A 2H5IB 1UW4A 1XEZA 3W62A 4MK7A 2P8IA 3CSKA 4HL9A 2ZBQA 3QJPA 1RHMB 1T0TV 4PG7A 4RW4A 1HWIA 1K47A 2KFYA 2ATCB 1RQ0A 2L9NA 1WF1A 1SJRA 2RQMA 3NL0A 1R6YA 6FD1A 4HT7A 2AZ1A 1ULRA 2FC8A 4J9LA 1VLYA 2O5DA 3T5LA 2RDIA 1Y10A 3VGVA 4KH1B 2I0XA 5DGAA 3THVA 1UMJA 4JBCA 3EZ5A 2GMJA 4DL2A 2HGNA 3ISZA 3IWNC 3MTKA 5JVHQ 3AT1B 5B0AA 4IRKA 3I87A 3HHLD 4WPAA 3M8ZA 2I8EA 1AA1B 3I9V9 5HSPA 4LMZA 2RKIB 3CJ4A 4A8OA 2ZKTA 4KO0A 1Y7PA 4M8LA 2NXJA 1YQHA 1DZ5A 3LWLA 3EE3A 5G0RB 2QC3A 1BWEA 5B0BA 3HXMA 4JI0J 1NO8A 1RHQB 4JI1J 1QAYA 2VFTA 2YNIB 1NSPA 1B0PA 3G6VA 3HLUA 1NZ8A 3H4BA 1D9DA 4PWUA 3MEKA 2NREA 2C2MB 1S0NA 2FGCA 1T95A 2XB2D 3NGDA 2LXUA 3KDOA 3QIPB 4QIGA 2CNNB 1WF0A 2DR6A 4JI6F 1QD1A 1S1VB 3CJKB 5F3ZA 2W2NP 3ZZYA 1RJJA 4UY8T 2QMWA 3AODA 3M9OB 2CPZA 1HNVB 4IDKA 3GIJA 3W9IA 4B9NA 2F4VJ 1VHFA 2GQQA 3H5UA 3TI0A 1GMUA 4ZJLA 2CPEA 2CQ2A 3AFGA 4LIWA 3N0VA 3Q23A 4FYYB 1AUSL 5KFNA 1N36J 1M1KT 5ITHA 3HK2A 2VBXA 2B4VA 3UN3A 4ID5B 1K1QA 2FJDB 1RA6A 5G4DA 2CQDA 5DGBA 2NXEA 2VFUA 2QFJA 1RT5A 3KLFB 1DLOB 2FJEB 4ZLPA 5LMNJ 2SXLA 4LFAF 1RYRA 2LFVA 2YPZA 2O01C 3LPEA 3RAXA 2XGQA 4QIFA 1HW8A 4P74A 1T9UA 4L3NA 2L9DA 4ZP9A 4RBVA 4B3SF 4IOBA 2GJIA 2XMAA 4QBUA 1EKRA 3HHDA 1HL6A 4LIRA 4RNOA 2M8HA 4QU7A 2V2QA 4RZRA 2VOPA 1U8WA 3I55S 2BOAA 1QM9A 5FDLB 4F4ZA 3KHRA 3FVYA 2YKPA 3DRYA 3TJ8A 4Y2KA 3DFEA 3UE2A 1LW0A 1N34F 2VFVA 2L9WA 1BQMB 2I2YA 2ZZNA 4QR1A 4YY3J 4DS4A 2ZBIA 1NAQA 3G8SA 2AIRB 1XWLA 3HZEA 4KFBA 1RLCL 4EBCA 1UVNA 3W2VA 3FFIA 3G6XA 3DRRA 3NBPA 1BD6A 2MGZB 2ZH8A 2OFHX 2FJWA 4TQSA 1X4DA 1PJ6A 2YWEA 1GXLA 2APOA 1FFSB 4DUYF 2YWGA 5KFXA 3D5MA 3VQTA 3UR3C 5FLXU 2DHGA 2XI2A 3UVJA 3C16B 2YKAA 3PW0A 2C3PA 5KT7A 1YJUA 4KGMA 5F8HA 2DITA 2LQBA 3NCPA 4X4OA 1W25A 2NPFA 5J1EB 2CA9A 3MAHA 1YTYA 3MR6A 4P2SA 4C9DA 3UDVA 2DHAA 2RF2B 4TU9A 1HKAA 3BH6B 1YJVA 2UZAA 1WKLA 4RW6B 2CPIA 1QTMA 5LMUJ 3GCWP 4DR5F 2CQBA 3P4UB 3HDSA 4KC5A 1Q4RA 3W2WA 1FO1A 5DDQC 3CMQA 2GX8A 2RRBA 3VVUA 3K8VA 5DO2A 3BDEA 1B0VA 1AROP 2IA6A 2PD1A 2Z0GA 1U48A 4H4MB 1TK0A 1DQAA 1JXVA 4YB1P 2HYIB 1EHWA 1HPZB 3IM9A 4CLPA 3SQGB 3H2UB 2QLFB 1S1UB 2PA8D 1HNIB 1S10A 4X4TA 4ILMA 1RAOA 4CLSA 4ZP8A 4YHHJ 2J9EA 5DZ6A 5M2UA 2MKYA 1XMOJ 5KFUA 1RBOB 1F3FA 4USIA 2N4DA 5IV4A 2WONA 1T7PA 4MKBA 2HQ3A 4QPXA 1RUSA 3BO3A 3KJFB 1PIEA 1KONA 2BYCA 2Y3YA 2IBKA 2WVEA 5IQ6A 5D4PA 4CTAB 2W2MP 2FHKA 3CCES 3MDFA 3LF0A 4RUCA 4O4RA 1NH7A 3M9MB 4NLOA 5EX0A 2LEBA 1O6XA 4ZP7A 3W1YC 1IQTA 4CCHA 3M6UA 1R3NA 5AE2A 2W01A 3WDOA 4YB7A 2PMWA 2Z4PA 2FHJA 1T9WA 1NXIA 2B7CB 4P75A 4CQ1A 3EYZA 1Q95G 5E3CA 3MM6A 1VMBA 3W8PA 2IVYA 1SC1B 2C42A 3KLHB 2POKA 1KQFB 1FX4A 3I82A 4ITSA 1RAIB 2PN6A 1V3SA 1JLCB 1JLFA 1TL4A 4A8KA 3MMAA 2MKKA 1Q79A 1Z2LA 4ZLJA 2OPQB 4UZBA 3CCVS 4XPCA 3FGVA 1V3RA 3FNNA 2NXUA 3VAJA 2PI4A 4QYZJ 1UCNA 3UD3P 2MLXA 2E44A 2YQ1A 4GVBB 3IGVA 1YIJS 2LDIA 1IBMF 3HHLC 3U1NA 3IGNA 1GXUA 1KTQA 3LTOA 1EKSA 4IR9A 2VKZG 1B3TA 1VJWA 4DUZF 1FEHA 4DX8H 3DYAA 4ZCIA 1KTVA 3ILOA 2GIFA 3CTRA 2RE1A 4CLZA 2E5LF 3PYGA 4EZ6A 4C3MA 3FQLA 1X31C 1T05A 4DV6J 1SKUB 2XLKA 1K1SA 2AJ2A 1MROA 1WC6A 3US5A 1RWMB 4F26A 5BR8F 4AFFA 1F2HA 3AD7C 3LPYA 4ILRA 2CVEA 3F44A 3ONQA 5C24A 4JI3F 2I9SA 4DU8A 1HBOB 2MQLA 2HBRB 3KMSA 3O3LA 2DCLA 4USJC 1FKPA 2Z56B 2JX2A 2RU9A 1QVGR 2EC2A 5AJ3J 1FJGJ 3EX7B 1UEKA 1NJYA 2F8EX 3U7JA 1QJHA 2IVMA 3OV7A 2CXEA 2IYIA 2YQ3A 3DRPB 2XMUA 3JTPA 4DCPB 1Y5NB 1IBKJ 4OZ3A 2AT1B 4Q2LA 1WKJA 4OQJA 2V67A 4NCGA 3SEOA 4LVNP 2AEFA 4K2JA 1YSJA 3N28A 4WP9A 1I3OB 4O3NA 4DV3F 4FXWA 3OPKA 1DTQB 4WBFA 1U6FA 1N8RT 3G82A 3FSYA 3CCRS 2OGUA 1KDNA 4KGXB 1X4BA 4V1Ak 3SZ2A 1KWMA 3TUZC 4LFCJ 1O5JA 1K44A 2KXFA 4Y28C 4WP3A 5HMXA 1KQSR 1UW9A 4ED0A 1EZZB 2GAGC 3W9JA 3MURP 1SUQB 1X9WA 1C0TB 3NGKA 2CFXA 4RO0A 4RNHA 1FKOA 3SMZA 3KKFA 1LXNA 5BYQA 4ZVFA 4FBUA 1S97A 4D3GA 2HMIA 4C8LA 3AOBA 1R8BA 2WVDA 3W3SA 2P5VA 2Y1IA 4H4OB 4KJIA 1G4CA 5I42B 3KK3B 3M2RA 4DI6A 2GGPB 1X5OA 1FTRA 5JMNA 2CJAA 2BJ3A 1OY8A 4AT1B 3C3LA 3HMJG 3EICA 4ERDA 4A8YA 3VAKA 5BYRA 3IXQA 4ILLA 2ASLA 3P6YC 4DR2F 2UUAF 2IDEA 4DF4A 3HSDA 4EYHB 4X84A 3OL6A 4F8RA 1LW2A 2OPSB 3DLEB 1MU2B 5H1SV 3G71S 4ECTA 3T9ZA 5AXNA 2N3LA 3D3BJ 2IM1A 4ZVTB 1S9FA 2HHHF 1RT4A 1GAOA 3V6DA 5JJBA 4A8FA 2RSQA 4DG1A 2IYGA 2RVJA 4C11A 1RHRB 2UXBJ 1KQGB 2KDOA 3GYXB 3K7RA 1MWQA 3AOAA 4KAIA 4C48A 2IM3A 2C2EA 1HWJA 4ZMMA 3GSIA 3OFGA 4NE9C 4YDXA 2HG4A 1M5KC 2BUNA 4IH6A 3IAM9 4DFPA 3AD9C 2MZTA 1MN9A 4ID8A 1Q5VA 2ACYA 4ENOA 1X0FA 2FUG9 1ZTWA 4IOAQ 4HACA 3DLGA 2NYIA 4LRCA 4EO8A 2KFZA 5GAHI 1LWFB 3M8WA 5CCLA 4CM0A 1ZA2B 5E3QA 4WXWA 4WFAQ 3DOKB 2OKQA 3BPDA 1FHTA 3K5LA 4FF4A 5D3GA 4Y2AA 5EHHA 2ZOMA 3IS9A 2XWXA 2DXDA 1WEYA 3EVOA 1WF2A 1CJVA 3QPIA 3KLGB 4B9TA 1TV6B 1PSDA 1MW7A 3SFGA 4KE5A 2XYGB 2UVWA 1YWXA 4DV5F 1WNEA 3S01A 4DBQA 5CYMB 3K89A 1TU0B 1Q5YA 2HBZB 1GMWA 2YQ0A 2R7SA 4DFMA 4CT9A 3GFXA 5IS2A 3NG8A 1CLFA 4UOHA 4ZHRA 3V2UC 1IR2A 2P9GA 2LEAA 1SC6A 1YBUA 2PFFB 2CJKA 5LSLA 1C1CB 1Y3KA 3VAGA 2XNQA 2HQFA 1C4CA 2GIQA 1HNZJ 4MIBA 3MM7A 1S0OA 4CDIA 4DWIA 4C8ZA 4OJGA 1FD2A 2LCWA 3AQPA 5GMKa 3BREA 4LR8A 1MG7A 3BSOA 4I4BA 3UDLA 4X66F 2QLWA 3H40A 4ECRA 2NLWA 1RCXB 5D0GA 1RT1A 3RAMA 1T03B 1YJRA 2FLLA 3TA1A 1RTJA 2HKEA 2BE7D 2HWTA 3S1TA 3D6HB 2RAQA 4DL0C 5LT5A 5D15A 4PUOA 2E5HA 3MM5A 2ALZA 1DJ0A 4NZ6A 2OH2A 3M1VB 5KG7A 1J5OB 2P9EA 4DR7F 5AT1B 4JYAJ 1S1TB 3NOCA 1WC4A 3SYZA 2VPWB 3PW5A 3VWSA 4HLBA 4URGA 2XS2A 2HS4A 3M4XA 5CABA 4PPZA 4NLYA 4DR1F 3BR8A 1M5HA 3Q86A 4IG3A 4V19X 1WDDA 2JC1A 4P2MA 3QJLA 1S72S 4ZVUB 4OZLA 3LUYA 2HS0A 2VG6B 1FRMA 5HP1B 3LP2A 2BVZA 3Q8PB 1DFDA 1DAXA 2G9OA 2PGCA 4DV2J 1T3OA 1NK5A 3A3PB 2OEJA 2C1EB 3I96A 3TAMA 1ITPA 4F2SA 1YLXA 3KG4A 3M30A 4IRDA 2RMLA 5DDRC 2HK2A 2HFZA 2LECA 1RCOB 4OX7A 3FSXA 5E7OB 3R2DJ 4QZVB 1LK5A 1VCTA 1BWVA 2Z2ZA 2EFQA 2DXEA 3PR5B 1N0VC 4DV4J 1RBLA 3QO9B 3UDEA 3SBMA 4OZJA 1JLQA 3TAPA 1HHTP 2NCKL 3V4IA 1S9GB 3CJ0A 4RWXA 1KQKA 4F02A 4F36A 2A6OA 3OXLA 5E3PA 2VHGA 3UW1A 2XMJA 2GAHC 2XSFA 3CVKA 1KRPA 1MSWD 4X64F 3SIPB 4PG8A 3HSJA 4NLDA 4CNZA 2FVQA 2VV5A 2VICA 4ZN3A 3IWXA 3NGUA 3SDEA 2LMIA 4LF6J 4PQUB 2GO9A 3NCQA 1NHKL 3PIPQ 2IDLA 2E1PA 3D3CJ 3GMGA 1VRQC 2DY9A 3FKBA 3BQ0A 1B4SA 1D0EA 1N5VA 3AJ2A 1KC8T 5BXIA 4X4UA 5CQGA 2EEYA 4DPYA 4DQRA 1DQ9A 1YKWA 2GQ2A 2D74B 4NXNJ 4ECYA 2IMWP 2YPYA 3L7PA 1FRJA 1SXLA 5IT9U 2FHOB 4DR4J 2WB4A 2IRUA 1IKXB 4F3QA 1HARA 4YOEA 5L39A 1N6QA 2BJEA 2CQ1A 2B4UA 4I2QB 4KQZA 2VQFF 2DR5A 1YJTA 1U4BA 1H7XA 4J9NA 1TUVA 5T7LB 2ZJRQ 1F3VA 3J81Y 4A4JA 2HHSA 4K7QA 1R0AB 2M52A 3KLIB 4NXMF 3OTOJ 3MAAB 1IJFB 3BQ2A 1W2IA 5HATA 3R7SB 3DHXA 4CT8A 1ZAVA 4R5PB 1UVJA 3G4SS 4C0OC 1XNRF 2UUCF 3IR5B 2XYHB 3AB2B 2OPPA 1P27B 2EXUA 4DV1J 4GMKA 4F7VA 4A8QA 1D8ZA 5DG9A 1LFPA 5KFZA 2JL9A 4NX9A 1OIAA 5KFIA 2O67A 4URSA 1Q7LB 2GJ2A 4X4QA 4EYIB 2FZCB 2M2BA 4P7VA 1OYEA 4NA3A 4ALZA 3MXHP 3BM7A 3GFHA 3R97A 1P1LA 1T9VA 1KVKA 2AJ4A 3GV8B 1N32F 2ZH9A 4I67A 1HLWA 2M88A 3I4PA 5CHCB 5D78A 2ASYA 4O3SA 4RW7A 4ZK7M 1U0HA 5AXKA 5KFJA 2ZC4A 1S99A 2QO3A 3B78A 2IJRA 4KHRA 1ZOTA 3RRHA 5HVGA 1Z4UA 2JC0A 2V69A 5A6PA 4C3KA 3K0JA 2V50A 2CQPA 2A3JA 3EJMA 1ZAWA 2F40A 3PACA 3QFHA 2OSQA 5IQQA 2LA4A 2VOOA 2J7UA 3IBCB 3LP1A 4Z7YA 5EX3A 4N76A 4C8KA 1KLMA 2NXCA 2E1MC 2BQUA 3V4MA 1WC1A 1YDLA 1PILA 2XG8A 3QSIA 3TZWA 4ZPVR 3D67A 3NOGA 3DLKA 2XS5A 5IT4A 1XR6A 4IG0B 5GADI 4YQWA 3OR2B 1WTBA 3D28A 1SVDA 4ECVA 4USKA 3OR1A 4KGVB 3M32B 5KFSA 3M7VA 3OUYA 3K17A 2ZC3A 2XY6A 5AXLA 4ZVRB 4HDHA 1RT2A 3L3CA 2F9DA 4NZ7A 3M9NB 4OFZA 2IJFA 4HDGA 1VQ6S 1TK8A 9ATCB 4RW8B 2HFOA 2JSXA 1N4LA 4RPFA 4YB6A 1OJ4A 3GCXP 4KV8A 3P49B 2ILZA 5I3UA 1HR0J 1P6TA 2R7XA 1TKXA 3G86A 3BV8A 2MZ1A 4WE1A 1BUXA 4M5LA 3FCVA 4WJBA 1ZA1B 3NS5A 3GONA 4LJMA 2BE2B 2N4CA 2LXIA 4DR3J 1XERA 3GB0A 4OI3A 5KFHA 2J9DA 3SV3A 2EBEA 3I0SA 3HHKA 2Y8YA 2LYVA 3UR0A 2HURA 3M2UB 4IH5A 2R42A 1VQNS 1FRHA 5C42B 2DPJA 4X4NA 4HHUA 5C7PA 4MMOA 3MEEA 4JOUA 3A8KA 4DPXA 1NLKL 4FF3A 5KG4A 4NLWA 3BO4A 3VAHA 2C2OB 4DPUA 4JI2F 2FDNA 3CXCR 4QR2A 4NOHA 3Q89A 1SL1A 4OZ5A 3OHAA 2VPYB 5HBMA 3KDNA 4DXLA 2OAUA 3MMBA 4WXOA 2K1RA 3KJVA 1CS4B 1E6YB 2H65B 3FUYA 2YBVA 2V4RA 5HL7Q 5J2NB 4FBTA 3ZZOA 1KP6A 5KFAA 3BYRA 4ANCA 2FC9A 4C8YA 1IJEB 3BGUA 2V5HG 1AZSA 2C3UA 1UPMB 2GC8A 2WBMA 1H3DA 4TLRA 4LQ3A 1FKAF 1R43A 2M70A 2DD8S 2W9CB 4TY8B 1ZYQA 1S79A 4JI8J 3PJXA 3JB9k 3TX0A 2LQ5A 4DQPA 1X4FA 4RJVA 1TVRB 1A0OB 3CULA 4K8RA 4ETZA 3KHHA 5KFQA 3THPA 3X3UA 4KHPJ 2ZE2B 3MCMA 5C25B 4DCJB 1TKZA 3CCUS 1IKYB 4I2PA 5DETA 2K2PA 1WSRA 2DNZA 2A2CA 1FXLA 3H8YA 3TRGA 1D9AA 2IC3B 2RQCA 2DNHA 1T02A 4JB8B 3SV4A 1JWWA 2O1PA 1EJ7L 2RNEA 4NPOA 2MPUA 1EIYB 5J2PA 2HQDA 1PYOB 1AT1B 1VYAA 2GW8A 1SH3A 2IHR1 4ZPBA 4JP8A 5KTQA 1GT8A 3OTEA 3EGNA 2XM3A 1LNQA 3M8PA 3OL8A 2B9XA 2CJ9A 2V68A 2XO7A 2R7WA 3BO2A 4AXJA 2E7WA 4XPEA 2W7PA 2E9ZA 3SQOP 3ZTQA 3VV2B 4C4WA 2J6TA 3ET6B 4HKQA 2CZ9A 1LV5A 2HGLA 4U7UK 3BKFA 1YITS 2B43A 2MQNA 2V0NA 3GTYX 2IVFB 4DJBA 4L73A 2DNRA 4CRJA 2R3VA 1S9EA 1DARA 1HIYA 2D69A 1TQLA 1PAUB 4LR9A 3MFIA 2D3ZA 1NSQA 1JIHA 5H9EK 3WBZA 4C0BA 1LQ9A 1FRXA 3A12A 1FCAA 3PVXA 5M2PA 4R8UA 4LF2A 1U6BA 3ADAC 3LH2S 3KXDA 2KG0A 1X8DA 1TAQA 1NDKA 3T1YJ 6FDRA 2YNGA 3M8QA 4I7FB 1VIXA 1C2PA 3JQJA 2U2FA 4ES3A 5T14A 4TXSA 5HK4A 1K0VA 3ZTPA 2IRYA 3Q8VA 1RHKB 4G65A 1U1OA 2RB7A 2MLYA 4OX6A 1H6KX 3NEKA 4RW9B 4C0HA 5DG8A 3Q22A 4UQGA 3MM8B 5GMEA 1NB2A 1S1WB 2HRYA 4A8XA 1UFKA 5J2QB 1EETB 4C8MA 1SH2A 2PC6A 3R5GA 1LWCB 1RAHB 1H98A 4EO6A 4Q8EA 4ZVSB 2MZRA 4DV0J 2EVZA 1KHWA 1Q8LA 1WD6A 2B5JA 7FD1A 1KEKA 4OI4A 4NRTA 2R2UA 3ITHA 3TA0A 1L3TA 2WRMA 3EGWB 4N77A 3J7Z5 1URNA 1N52B 2DK2A 4WZMA 2KM8C 1X4EA 3V81A 1IXKA 4ES1A 1FJCA 4PWDB 1H2VZ 1U02A 3KUHA 3JYTB 4UOGA 3AY0A 4X4PA 1I6JA 2BE9B 2LLZA 3H42A 5D8HB 1DURA 4OHYA 1U2RA 2DNPA 4JI0F 3KK2A 4JI1F 4B3RJ 2E7VA 5GAGI 1RTIB 4K4SA 4ZIWA 3TW0A 1HFEL 3GIRA 2KZZA 1RWOB 3D2WA 4WFXA 3G96A 1JJHA 4OV6A 3RB3A 1VJQA 4M1KA 2F5GA 1S6PA 1FFWB 3CDWA 2ADCA 2H4YB 1VQMS 1OMSA 2HEKA 3RBXA 2IAJA 3B54A 3TJ9A 8ATCB 3V6JA 1RT7A 5DM7Q 2J5AA 1YZ6A 1VS3A 1NDPA 1Y5LB 3IBWA 1QLNA 3D6MB 2AJ1A 1RISA 3CJ5A 4CO1A 4OI6A 1WHYA 4IYQA 1HQUB 4FNHA 4ZJQA 2VPZB 4Q0BB 4A8WA 1NB7A 4ZKAA 3I0RA 5C2GA 3QRPA 3V6HA 3QRRA 2KT5A 2JHEA 3D68A 1UVLA 2F4VF 4JI5F 4G1QA 5EN1A 1JLGA 2YWWA 2YX4A 2OIHA 1NDLA 2W9AA 1C1BA 1N36F 2DNNA 2WVFA 1QE1A 2N7YA 1FT8A 1X4CA 5GAHU 1GMVA 1CJUB 2BM1A 1TZ0A 1LWEA 4LRAA 1J5EJ 1C0UB 3MPWA 3R5JB 4C98A 3O1LA 4BHQA 1SKWA 5LMNF 1JXEA 3OL7A 4LF1A 4O3QA 4G6VB 1SV5A 1VRTB 4FDFA 3QAUA 3LWMA 3RRGA 1AUDA 4DL4A 1TELA 3GYGA 4OHVA 1X4GA 5HLFB 4KPYA 1BGXT 4JV0A 1Q8BA 4JI4J 3E01B 3K5PA 1JJ2R 1XN9A 3OFEA 3ZTSA 3KNGA 3MGJA 4OI2A 1NK4A 5DDPC 2UVVA 1RT6B 5M2RA 2NSBA 3QAEA 2J6UA 4LSNB 3NKYA 1KOOA 3TOQA 3RB0A 1R8PA 2HNZB 4K4VA 2HLTA 3HSGA 3UWTA 3TARA 4ECQA 4LBIA 2MSSA 4FPIA 1ZM9A 3ISND 3PKYA 2CQIA 3O5TB 4LFAJ 3MMCB 3DRXA 3BR9A 2VA3A 4AL6A 3NGTA 1RTDB 2V4JB 1GNKA 4C97A 3GIIA 4C2MA 4KYZA 1S57A 1REGX 3RG6A 2UXCJ 1M1GA 1SPBP 3M6XA 2JEGA 2XGPA 2XQCA 4CI0B 3IN5A 2KHDA 2BABA 4AE5A 4IFVB 2YVSA 2VFRA 4RU2A 2KH9A 2RKIA 1SBRA 1YRXA 1CJTB 1RAJA 4NA2A 4Z37A 3L7OA 3ZZ0A 1KFDA 2CJYB 3M8SA 4ZCKA 2E7XA 5G0RA 2YX1A 2R9LA 2YKMB 3C15B 5IZHA 2V8DA 3O2IA 4LF8J 3Q8SB 3T1AA 1WEXA 3ETMA 1BQNB 2YNIA 2BRKA 1VC6A 1ACMB 3HJVA 4ED1A 4ED3A 1MMNA 3BS9A 4USWA 5LMUF 1GTEA 1URRA 4O3RA 2B8QA 1S6QB 3NGRA 3CCZA 2UV8G 4DR6J 2AX1A 3QIPA 3NNCA 2HHUA 3VZHA 4JUZA 1T9XA 4TYBA 3LANA 3I32A 4HYKA 1S1VA 5KFOA 3CJKA 3GJTB 2HQCA 2VDIA 4CYUB 3DOLB 4U95A 5A8RB 1HNVA 4O44B 1M90T 5DZ7A 4NLQA 1KOHA 2QZ8A 1YK9A 1RI7A 1BQXA 2BXJA 3PYFA 3BGRB 2B9YA 4YHHF 3DU6A 1AB8A 2R8KA 3NGSA 3H2LA 4FKXA 2HHPA 3FEXB 2CWXA 8AT1B 4DPOA 2X1FA 4ID5A 1D9FA 4NMLA 1ELOA 3VGSA 2XS7A 2K3KA 5KT2A 4A47A 4ECXA 2ZVSA 2ZNYA 3KLFA 1DLOA 2K8GA 4CNYA 4I1TA 2I5JB 5F8GA 4ECZA 3H5SA 1D1UA 4WU3A 2QEXS 4GKKJ 2DY1A 1SIWB 2B7BB 2YXLA 5LSOA 1KLNA 3HI9A 3K5OA 1RT3B 3MI7X 1N5SA 1U1MA 3K58A 1TKTB 2BJ9A 3CEDA 3D1QA 3GFYA 2FVRA 1JMTA 1S49A 2AYMA 4ED6A 3CJQA 1RYSA 4ZCLA 1WJ9A 2NZ4A 2FLOA 1NJZA 5L46A 2GHWA 2O66A 4F3OA 1SJ1A 4YMEA 1R0CB 5ETOA 2HPUA 3BYPA 4M5MA 3TQ1A 2B9EA 5FDLA 1RACB 1IWAA 2YKNB 2D41A 1PO6A 2WVBA 3RYLA 1CPZA 3HKZD 2DH9A 1IR1A 2AU0A 1BQMA 3CJ2A 3AA8A 4KRWA 1GX6A 3UDCA 2OTLS 2C28A 1N5YB 3NAHA 2ROGA 3CJRA 2MYFA 1F9HA 2FLNA 3OD2A 1WEZA 2MLZA 3P8BB 4LF4J 4K0KJ 2MGZA 2XNRA 3HP6A 2VF3A 3H5XA 2JOQA 4BWJA 4ZVHA 1VQKS 4CH0S 3MR3A 4TY9A 3PO4A 5L38A 4ED4A 3C16A 4ECUA 3IRWP 2QN6B 1BXNA 5J1EA 3PM9A 1PC4A 4J9OA 1HBUB 4LF7J 2CVIA 4LSLB 4OYOA 4DV6F 3MPYA 2EFPA 3T41A 2R7VA 2RF2A 1GFWB 1C4AA 2MMYA 1FJ7A 4L6V3 1FESA 1EP4B 4GC6A 4RW6A 2BRLA 2G0CA 3D66A 5KOWA 1NKBA 2VC1A 4X4RA 3S7RA 5IWAJ 3HJFA 1EQ0A 1NK6A 5HO4A 2XI3A 4NLPA 3WX8A 2CG4A 1FWKA 2DKOB 1JNRB 2QA4S 2W2OP 1WHWA 4E0DA 1NPPA 1IBMJ 3U1LA 5AJ3F 1FJGF 3W65A 4KGKA 2QYGA 2WW4A 1P9YA 2YNFB 3JAMY 1FVSA 3G8QA 1WI8A 1SJFA 1IBKF 4CH7A 3OHBA 2QA2A 4H4MA 2LQJA 5H9EJ 1Q0NA 1HPZA 1VBZA 4B3TJ 3SQGA 5ETVA 3LAMA 3SXLA 1S1UA 3QRQA 4WU2A 3MM9B 1HNIA 2KT3A 5KFBA 3TVZA 3ZO7A 3MZIA 2R7RA 4J37A 4YDDB 4NYOA 4NLXA 4DQSA 2UVRA 4E2FB 5B0EA 4I68A 1HBMB 4U67Q 4LFCF 2WZ1A 5GADU 3WHIA 1FNMA 3VR1A 1UA1A 5D6GA 3BN7A 1IBCB 4P10A 4JI7J 2JEIA 4MT1A 5D0HA 3EGZA 4TU8A 2AW0A 2O3DA 1VLOA 1QUPA 2HFNA 4CTAA 5IV3A 3I56S 1KD1T 1TL7B 3R6LB 4LF5J 3LQVA 1TL1B 4E8UA 1VC5A 4QWAA 1DRZA 3M05A 1KVIA 3C2PA 2ZKUA 2B9WA 3AXKA 3DM2B 2P9CA 5KFGA 1U1QA 2D3O1 4Y00A 1CQNA 3AD8C 1QUVA 1HNWJ 3GV5B 3HHLB 2H5EA 3HFZB 4E98A 2IJNA 3QT5A 2CQ3A 4F25A 2G0IA 1NMEB 1YI2S 2OEMA 1U25A 3KLHA 2AYGA 1Y00A 3H90A 3IRXB 5L9XA 2DNMA 1JLCA 4ZVQB 3HULA 4RKUC 3AA9A 3MECB 3ISNC 4I69A 4ZN1A 4PCQA 3AJ1A 1RWWB 5IOLA 1F5AA 3TZYA 2OPQA 3PRDA 1KSPA 3AXMA 3GIKA 1VQOS 4LUBA 2A18A 1XQIA 4WFYA 3CJSA 1LXJA 2RHQB 3QGGA 2FZGB 4GVBA 5B7WA 2GFFA 3JTOA 4OI1A 1VOMA 1CQMA 5SZTA 2W8LA 4OLPA 4EU0A 1VQPS 5KFLA 3PW7A 4C7QA 4QU6A 3JSBA 2KU7A 1GMWD 2AEJA 2BOPA 4J9RA 4JV1A 2V8HA 2HGMA 1LWXA 1UETA 1YG0A 1U1LA 2MHEA 3JSMB 3MR7A 4RLEA 5A8WB 3EXYA 4Y2CA 4OL8A 4ECWA 1HBOA 5EWFA 2UP1A 2IA0A 2GV1A 2IY5B 4J7CA 2H48B 1HBNB 5E0OA 3AB4B 2Q43A 3HCXA 3DRPA 4P9SA 3R8YA 3QWPA 3CPWR 4LRFA 3OW2R 2DGVA 3WC0A 2KJWA 4PAAA 2BJ8A 3FRYA 4KB7A 4PG6A 2OSRA 5K8PA 2PI5A 5BYSA 3TX8A 2W8KA 4G1IA 2ZHBA 2AD9A 4YUDA 1NCLA 1YX2A 5KOXA 2EWHA 2G4BA 1DTQA 2QRRA 4CLTA 4JV2A 1HQEB 3DOMB 1X0PA 4QWEA 3W66A 5A8KB 1HNZF 2WAQD 2ZEJA 4XDCA 1E6VB 2PO4A 2ROPA 1NRKA 1X60A 4X2BA 1NJIT 1ZM3A 2V2VA 1SUQA 3PEHA 3QZ7A 3DDNA 2IPOB 1C0TA 1Z1ZA 1G6BA 2DCUB 3C6TB 3IWLA 2DRDA 2F63A 3VZIA 1M5OC 5I4MA 3GFZA 2CNKB 2XSJB 4S0MA 2VUGA 2HZAA 2W9BB 1BC6A 3T1HJ 5IXUA 2BX6A 4H4OA 2KKHA 2CNLB 3BKUA 2QL9B 3NMAA 5I42A 5DDOC 4ZP6A 5AXMA 1DHMA 1FX2A 3KK3A 1VRUB 2B56A 2GGPA 1SJ3P 3R2CJ 2ASJA 4RUAA 4CH1A 2K7JA 4PG5A 3DLBA 4JYAF 2DRBA 2CYYA 2J0QD 3DGPB 4TN2A 1W7WA 1M5SA 2FY1A 1BE4A 4F0HA 2AYEA 1NJWA 1UL3A 1U1NA 4LRDA 4LSZB 3TP2A 1LOUA 4WFNQ 3QGPA 2HFVA 1G2EA 3C14B 2OPSA 3DLEA 2OEKA 1JXLA 1MU2A 3KK1B 2VU5A 5F0WA 3RUBL 5HJYA 2CDRB 4DV2F 4HT5A 3MWBA 2R8GA 4Q5VA 3QIDA 3ZTRA 1RA7A 5J1PA 3WX4A 4PEOA 2C2DA 1P9QC 1UJ4A 1R7IA 2DR9A 4RUHA 3Q8UA 2GNKA 1WSVA 3UQSA 3LOUA 2QT7A 4C6AA 2YNHB 3R9LA 2YKOA 4YB5A 4DV4F 2Q1LA 3NWGA 4J5OA 5KFYA 3W64A 5CCMA 2MKSA 4NCBA 1N5TA 2BBEA 2QLBB 3PY8A 4J9VA 4WWSA 4DR1J 3TEGA 1S1XB 3O6QA 2DHHA 5MAOA 1LWFA 2HZVA 1JLAB 1G7CB 5K8OA 1R8AA 4IO9Q 5A0YB 2KYZA 3MTJA 3DOKA 4DFJA 5EWGA 1A6LA 4FS2A 3CD0A 4I64A 3UNGC 3IG1B 2J9CA 3CDBA 2UU9J 1F9FA 4FYVB 3RR7A 4LF6F 4K4TA 1VQ8S 4RL1A 4QW8A 4D3HA 4A8SA 5CA5A 1ZZFA 1YJ7A 2ZNZA 3KLGA 1X7VA 2ZH7A 1TV6A 4B02A 3VQSA 2PT0A 3F73A 3BKTA 2HHWA 5LL6d 1S5ZA 1R27B 3UO0A 5GAGU 4NI2B 3KWMA 1S59A 1RWVB 5CYMA 3PHEA 5LXRA 1H38A 3TZZA 1TUGB 1MNEA 2H1YA 2F8HA 2R8IA 5E41A 4HHJA 4NXNF 4USUA 2EKNA 5CH7B 5J1NA 2A1BA 2XEXA 3MMJA 1RBAA 1C1CA 4K50A 3Q83A 4PXBA 3K57A 3CDAA 1TAUA 2ZWOA 2ZITA 2OPRB 4DR4F 3GIMA 4O23A 4MYTA 1WACA 1FXRA 4OX8A 4LR7A 4KHMA 3V5RA 1TL5A 4LBPA 2DNYA 3IM8A 1Q53A 2V2KA 3LO3A 3MPDA 5AE3A 5F9NA 4AQYF 2KT2A 2MKIA 2W2QP 3R3TA 5B0GA 3OTOF 1T03A 2GQCA 1VQYA 3QMQA 2KJVA 4GC7A 4USTA 1UVIA 2FVSA 5RUBA 4N41A 2DGWA 2Y9HA 4AYBD 2DHSA 4Y0FA 2KO1A 2HHVA 2XLJA 4M5NA 1VIOA 5GVQA 4YEAA 5LM7E 1Q8IA 3J80U 3M1VA 4DV1F 1J5OA 3BSNA 1X9SA 4X4SA 3PX6A 2CQCA 4XO0A 1S1TA 2B8PA 4OJHA 1LK7A 3FZBA 3N6NA 1OQ6A 2BEFA 5FLXY 4DLGA 4P73A 8RUCA 3PXGa 2LU2A 4YP3A 2VG6A 5HP1A 3RAQA 3ILLA 1FJEB 3N5FA 3JTNA 2WBRA 1IQZA 3T9NA 4OHZA 4HTIA 3J81j 4EFAC 4PYAA 1R31A 2D9OA 3OVBA 4QQBA 3BBFA 5KG3A 3KMQA 2YH0A 4XIUA 1OY9A 2VQEJ 2ILYA 2JLFA 2GIRA 1V6HA 3QO9A 1IVZA 4CM2A 5HQLA 3OL9A 4ZITA 1V3ZA 4OJ1A 1S9GA 4DSFA 3O44A 4TKTA 2NSCA 2OLWA 3Q8QB 5HROA 4QPTA 3GYNA 3D1HA 1FNOA 2Q6CA 1JKHB 1FDBA 1CJKB 4M5DB 4LF9J 4MH8A 3CCLS 2DISA 4URQU 5F8IA 4DS5A 4M5IA 3GWCA 4EBEA 2QYCA 2YWHA 2MHNA 4H4KC 3D0GE 2W4PA 4UT4A 4PQUA 5DM6Q 3VALA 3CO9A 1B99A 1QY7A 3EXCX 3PNIA 1PKUA 4YS2A 2WTFA 4HH1A 3U27A 3DLJA 2GA7A 3CT9A 3IMQJ 4AL5A 2CADA 3MAQA 2ZH5A 1S48A 3FBBA 4MKAA 1FRIA 1IBLJ 4M5HA 4M5JA 4USMA 3CNQP 1UFWA 1L3VA 2UV8A 3D6FB 3AHPA 1OY6A 1I1GA 4FYDA 4USVA 3CIZA 3QGHA 3MFHA 1HWKA 4ZVGA 3W60A 4DR3F 3HHEA 1XNQJ 3MD3A 1LKZA 2DNOA 3OLAA 1IKXA 3SCJE 4UZCA 3BF4A 3CMAS 4I2QA 1EAYC 2EFOA 5EUHA 3CWJA 5A2QU 2F3JA 5KG2A 2QFIA 4CIOA 4DF8A 4LFBJ 1BY9A 4EI2A 2GVDB 1UKUA 3A3OB 5T7LA 3N5BA 5H9FK 2BANB 1NNDA 1R0AA 4YN3B 1U7LA 1B70B 3KLIA 1WOSA 3MUVP 1W2BR 2KFNA 3MAAA 2N3OA 2J7WA 4KR0B 3MEGB 5KFKA 4R5PA 2Y1RI 4DFKA 2ZFHA 2OD4A 2EFVA 3N6MA 2KHCA 4B3OB 1RWXB 2ZUGA 5L9NA 2ZZTA 4CP5A 4TQRA 4CO0A 4P71A 2VJUA 1PYTA 3TQEA 1F1BB 2HSEB 4DL7A 1N5QA 2NR0A 4O0IA 2EK1A 1SQGA 1RKJA 3HFKA 3H2VE 2MQ8A 1ZETA 3LW5C 3LP0B 3VAIA 3C8YA 1WWHA 2ZD1B 3CCQS 3TYTA 2ATLA 1YBTA 1OO0B 3NWRA 4AD6A 4DQIA 3GE9A 2DO4A 4ED7A 2R8JA 2V9KA 4B9UA 4QOTA 1RWUA 3TR5A 1CG2A 3W61A 2HW3A 2ZZMA 2J0XA 2RILA 4BS2A 4KHPF 1F60B 3C66A 3D0HE 3J7YI 3A3NB 2C3MA 1P1TA 1M5PC 1RXOB 1T11A 2CG8A 3I6PA 1HWLA 3IFEA 1R0BG 1M1HA 4OZ1A 1CVJA 1H2TZ 2CRLA 4Z7CA 3GG1A 2UUBF 1Q1KA 1L3SA 5LJ3Y 4EMDA 4OZNA 5CYQB 4IG0A 3BEGB 3OR2A 2QL7B 1XR5A 3PCOB 2XZDB 4DDFA 2RS2A 3CE8A 1R89A 3AQOA 3M32A 1HQ2A 1SJ4P 4DMZA 1NJXA 1XIQA 5L1JA 5E3AA 2VZ9A 3GJQB 5KFEA 1UWBB 2RRAA 2XHCA 3ZZPA 2V63A 2PMZD 4ICLB 2FJXA 1K73T 2HAFA 3QT8A 2H54B 3L4BC 1JLBB 1YJ9S 1VR6A 5L1LA 4RW8A 4WKRA 1H72C 3PV8A 4IFYB 4M63A 1FEEA 1HHQA 5K20B 1KNZA 3OJUA 1N0UA 2B6AB 2DR7A 3BN4A 3ICLA 3QLHB 1UJ6A 2Q6BA 2DB1A 3PX0A 4PPDA 3DRSB 4OV1A 3GLJA 4ELVA 1NK9A 5F9LA 1N54B 2BW7A 2HNDB 2BE2A 2A0FB 2OMLA 3WC2A 2G0JA 3MD1A 4NEYA 2EK6A 5D4OA 2UUTA 2C22A 5HMZA 2P6TA 5F8LA 3T1YF 3HVWA 3CO0P 1AFIA 2BKOA 2HQGA 1UZHA 4WK1A 2RIJA 2AHOB 3EVMA 3M2UA 2ZUAA 1SKRA 1HMVB 1TFWA 3DMJB 1U1KA 3HVTB 2X3DA 2VC0A 2P2CB 3CJ3A 4DSIA 2N7CA 4CLLA 5C42A 4W90B 5K9FA 3GR1A 4KPCA 3PTWA 2RUGA 2WB1D 2BKPA 4IQXA 2ZH1A 4XK8C 3CC2S 2MZQA 5KG0A 3DNCA 1OSDA 3EMTA 4TNOA 2QMXA 5JUMA 3GILA 1Q81T 1FE0A 1WG4A 3KLEB 1JX4A 3D1OA 2AMCB 3T5KA 1ZM2A 7FDRA 1IKVB 1JNZB 2ZHAA 1FE4A 4WZQA 3ZXWA 2ROEA 1CS4A 1E6YA 4DX6A 4NYPA 5J2NA 2F65A 4MIWA 4OLOA 1HNXJ 3HT0A 3RGIA 1ZH5A 4TVAB 4Y34A 2XLIA 5C2CA 3RBEA 2W9CA 4TY8A 3PO5A 1U24A 3TWZA 4KTQA 2H3EB 2DH8A 4B3RF 4B3MJ 1SL0A 2Z2YB 2EPIA 5LXYA 2XY5A 1TVRA 1WG5A 2E1CA 1FNXH 4P52A 4P2FA 2ZE2A 5J2MB 2XZTB 5C25A 1FXDA 2ZBRA 1IKYA 5KG6A 4CO2A 3TUPA 2BMBA 2KRRA 1L5UA 4YFUA 4PRFA 2DGSA 3MOJB 2IC3A 2W24A 2RS8A 4F0KA 1RADB 5CXTA 2EKYA 3VHQA 4DSKA 1YJWS 3IR7B 2WOMB 4O0NA 4MKVA 2DNKA 2DO0A 2H51B 3R5BA 5LJ5Y 1RWNB 3Q2SC 4KGZB 5DS7A 1EQMA 1IKWB 5E33A 2OI2A 3GJSB 1RAFB 1V9OA 4OZ2A 1WHXA 1CULB 3ET6A 3GJRB 4Y2IA 2B4PA 3UN2A 4WIIA 2VL1A 2V4QA 5HROB 2V94A 2MQOA 4MIAA 3C19A 1FK9B 1J5EF 3E8OA 1TFYA 5FIIA 1APSA 1N33J 1L3KA 1B7FA 5ETNA 3RZAA 4OX9F 4N5SA 2BJ7A 2KXNB 1D09B 3D54A 1X4AA 1MWYA 4OI0A 3HHNB 1WELA 3VF0B 4FZVA 1HW9A 4MKYA 2AV5A 2CQ0A 2ZHOA 2X1BA 3MR5A 4JI4F 4JI5J 3CMES 3QWUA 2AWZA 4PKDB 4I7FA 3JS9A 3ENWA 3DN9A 2V34A 2KM8B 2VA2A 5F3TA 3LALA 1PJ5A 4CZCA 3LA0A 1B0TA 3UNYA 3E3XA 2Y0SD 5KFMA 1RTHB 1VQ5S 2PA3A 2VIHA 4C8OA 1FVQA 5KT6A 2DR8A 1WKKA 4RW9A 2W7AA 5EGYA 1K0TA 1NPRA 3MM8A 1S1WA 1VBYA 3FBEA 1VHIA 4DX5A 5J2QA 1U1PA 4ZPTR 1EETA 3I4HX 1LWCA 3M2VB 2RUSA 4CO4A 4LBHA 2LU1A 1TP7A 3ZZZA 1S6OA 2KXHA 2HVZA 2UXCF 3KJQB 2R7QA 2QG9B 4J9SA 3G87A 2XMVA 1ZPVA 2PE8A 3C6UB 4EGLA 3N01A 2XULA 2KG1A 3FRZA 2LDYA 3N4WA 2XMKA 3MPVA 5D4NA 5K14B 2MY7A 3AAWB 2HNYB 2VG7B 4L75A 5DQHA 4PWDA 2IMOA 3JYTA 3I9ZA 1REVB 3ENVA 2E5IA 3HSZA 4F4YA 1V5VA 4I6YA 4N56A 4LF8F 4MFBB 3H20A 1RTIA 2DNGA 1NU4A 4ZLNA 4PR6A 3K8WA 1LEOA 2AGPA 3CW2C 5FJ4A 2D3OR 2R7OA 1SH0A 2YH1A 4DR6F 1NPKA 1T3NA 1ROFA 3JSYA 5IM0B 4DPWA 2CWKA 4ER8A 2JLGA 1DTTB 3ZNUA 4ZS6A 4N47A 2OJ3A 1HQUA 5D0RA 1HYSB 2KVIA 4Q0BA 1H74A 3M6VA 2DNLA 3FBCA 4B9LA 2RHSB 3CCTA 3JQKA 4ED8A 3GQCA 5F8NA 3UD5A 4ELTA 3KUEA 4KH0B 1SJQA 1NK0A 4O3OA 1FDDA 1NSKL 1NK7A 1QAIA 1PBAA 2MJUA 3L95X 5IT9Y 3U02A 1CJUA 4I0WA 2ZWPA 1PG5B 4DSLA 1C0UA 1DY3A 2QGFB 3BDPA 2KZMA 2NUUG 2MKHA 2DTJA 2MQQA 4DN0A 5U47A 3IA0A 5H9FJ 4BCAA 1WC3A 4U7CA 4N7TA 3PEJA 3KG1A 4R0JA 1SCJB 4GKKF 2GZOA 2BW2A 3I5AA 2MEWA 1VRTA 4K5RA 1HD1A 2M3DA 1KR4A 2E1AA 1G1XA 2R7UA 4MJKA 4UY85 1QSSA 2HLUA 2VBWA 2W4CA 1MMLA 2K06A 5HLFA 4B9MA 3BSCA 3E01A 4G1PA 3R27A 1RLDA 2XYPB 4WTOB 2EG1A 4JV5J 5HJXA 2NPIA 1TMMA 2X1GA 3MF5A 1RT6A 3ENQA 3MHYA 4OMFG 2FYXA 4K4UA 4LSNA 4W98A 3EPIA 3SSRA 1Q16B 2HNZA 5T41A 2IBOA 1DQ8A 3NMRA 1WTFA 1NDCA 2L3MA 1YHQS 3EWGA 4ES2A 4QIWD 3DKDA 2JEJA 3MMCA 4Y65A 3OJSA 1BLUA 2ZJQQ 1JLEB 1RTDA 1I94J 2V4JA 4F2RA 4FVMA 4LF4F 3UI3A 4O4GB 4K0KF 3OXGA 1Q86T 4DSEA 2GVZB 1VDHA 2RJZA 1FWPA 3FMWA 1U09A 3Q0AA 3ETOA 2KRBA 3MCSA 4UF4A 4U8VA 3NY0A 3NS6A 3R7NB 4IFVA 1CJTA 2N82B 2HK3A 2CZVC 4IKAA 3SCKE 2Y0BB 4X65J 1TL3B 1QAJA 2M7SA 4FKYA 1UPPA 4OJ3A 4LF7F 2XCAA 4KKOB 3SI8A 3DDKA 4RBUA 2AF6A 2YKMA 3C15A 3MEDB 3J7ZT 1QAXA 2M8DB 2VG5B 1BQNA 1S4EA 4ZVOB 1XMQF 2J0SD 1H0HB 2M0GB 3RB6A 3B8HA 4GKJJ 4GO5X 2HVHA 1S6QA 5IWAF 2I1RA 2DPIA 3KHGA 4DSJA 2MZJA 3OSNA 4EK2A 4CWBA 2EFGA 3M8YA 4RW4B 5AE1A 4RUBA 4OHXA 2B3TB 3UCUP 1VQ7S 3DLHA 3QJJA 1S76D 2XY7A 4CLFA 3PHTA 4CYUA 2D7SA 2ZBPA 3DOLA 5A8RA 4DV7J 4O44A 2DXFA 1QTNB 2VBYA 4B3TF 5THWA 5KFCA 3BGFA 2WVCA 3QZ8A 1X4HA 3BGRA 4NWBA 2HBYB 1F9EB 4NCAA 3DI6A 2DBBA 2HFUA 1AYEA 3H98A 4M94A 1CBKA 2EC0A 4XTTA 1S4FA 3H0PA 4YR0A 2LQ9A 2LKZA 2D9PA 4N8NA 1OQ3A 4KO0B 4AL7A 4U8YA 1UA0A 3OTBA 4OIXA 4JI7F 4C3LA 2DGOA 3PJWA 3OTDA 2I5JA 2PEHA 5ETLA 1OPIA 1AW0A 4BC9A 4NZ0A 2M5YA 3CB4A 2RD5C 4H54A 4LF5F 3CD5A 2MB0B 1XC9A 2BA9A 1MLAA 1RT3A 2RDJA 2R2SA 1TKTA 5L1IA 3M8RA 1Q82T 3KNAA 3ZFVA 3T5HA 1Q78A 2CUYA 1HNWF 1NKEA 1KS2A 3I5CA 1XK8A 4DX7A 2J7KA 2YTCA 4DOZA 2KB2A 2IFXA 3ZTOA 2YKNA 4F04B 4IDKB 1ICEB 4M95A 1JJ4A 3LGMA 4YR3A 4A8MP 1N5YA 2MXYA 1RAAB 3THTA 1UZDA 3E51A 3EDRB 1WOOA 2ZM6J 5CD4H 4LVOP 1ZM4A 3CJTA 4WKYA 3HZGA 4X62J 1RT5B 4L3KA 4L76A 1P8GA 2ACMA 2ASDA 4B17A 3BJYA 3ZZTA 1FF2A 3PDNA 5GAEI 4F4KA 4FYWB 2E5JA 2Y1JA 4ZDNA 1U2FA 2CQHA 1HBUA 4UW2A 2RQ4A 4LSLA 1AFJA 2CJQA 6AT1B 1RWPB 2KYXA 2UXDJ 3H25A 3D0IE 1NZAA 4USHA 1EP4A 1U47A 3RBZA 4J9PA 2HHTA 3CDUA 2EI5A 2QSWA 2VH7A 2K7KA 1N88A 3KFWX 2EG2A 1VQ9S 4K5SA 4LT6A 1YZ7A 4OYBA 5KG1A 4PZVA 3PJ9A 1LW0B 1N56A 3HT3A 2XMWA 2CZ4A 2CPYA 4PQAA 3FQKA 2YNFA 1CC7A 3A8EA 3JQMA 3NXZA 4KFBB 3DHWC 4K4YA 4CLWA 3W2VB 3FFIB 2FY8A 3DRRB 4AUKA 2W7OA 3NBPB 1RB0A 3J7YU 4F0MA 4A46A 3CJ8A 3R5AA 3MM9A 4OYPA 1Y9OA 1U0SA 4IUFA 3OVSA 3PW2A 2JVOA 3UVJB 3OFHA 1HBMA 3UCGA 4RNNA 2D1CA 1YGYA 5KFWA 2FLPA 2VJVA 3POTA 2YWFA 1WI6A 4UQTA 2ZH2A 3VCDA 3K59A 3JSRA 2W2PP 2QJ3A 1QSLA 3B4MA 1TL7A 2G2OA 3UCZP 1TL1A 3IBFB 5KFRA 2Z58B 5ETSA 3W5YA 3T1HF 3EM1A 4AXIA 1PC5A 3DM2A 4ZOSA 3HHLA 1KFSA 2Y1LB 3W2WB 4JI6J 4U96A 3NCRA 1FI4A 2IM2A 1FTCA 4H4KA 2BKNA 1J2VA 1TTHB 5KFFA 2X7IA 3I5BA 3B4DA 2VKRA 1UEVA 2HIYA 3IRXA 1PYSB 2ADBA 4BBYA 1MMDA 4NYZA 3MECA 1R8HA 4FXVA 4OYXA 4TLQA 4Y2MA 2FPHX 1NH8A 3UD4P 3P5TL 4EEYA 4U6PA 2WONB 2DIUA 3F56A 3D4JA 5HVFA 3W7BA 4RBTA 3PYDA 4F50A 2L48A 3H59A 4YY3F 2OD6A 1J27A 1X5SA 1Z2ZA 5A6WA 3GPAA 1H73A 2VB6A 3TUJC 3ZZRA 3TNVA 5DRKA 2C2ZB 2AGQA 4PXCA 2ZH4A 2XWYA 4B3SJ 3V6KA 2GCFA 2PEBA 4FXDA 4TYAA 4N8OA 5IFMA 5LSRA 3JSMA 2FJVA 4QJVA 5A8WA 3KYLA 3T19A 1WHVA 3J81U 4OYWA 2HQIA 3MM6B 2UU9F 3PX4A 1WOPA 2P6SA 5DQGA 1RWKB 1Y5IB 3MR2A 1UVKA 2XTJP 1Q7YT 4UOFA 1N34J 2YY3A 1JLFB 1HBNA 2HZCA 3MMAB 3TJAA 4BWMA 4ANEA 2QTWA 4WIQA 2OELA 1TMJA 3CCWA 1S0VA 4NLGA 5JVGQ 1RDRA 2MY8A 1B7YB 4OYZA 3BSAA 2RDDA 4K4WA 1FRKA 4DUYJ 3OBIA 2RT3A 4F4AA 2AJQA 1HQEA 3DOMA 2G13A 3EUNA 2HVEA 5A8KA 1ZTTA 5B0FA 4QCLA 1E6VA 3DYAB 2VONA 5SUHA 5E3RA 2ERRA 2GO8A 1OS5A 1M0SA 5KG5A 1YBAA 3ZZUA 2R2TA 1RU2A 1T05B 5MLCV 1UP1A 2V6AA 1EX8A 2MSTA 3G6ES 4NLVA 1MROB 3C6TA 5B0CA 2B0GA 1ZZNA 3IR6B 3ELHA 1U26A 3DI6B 2GHVC 2XSJA 2FHJD 1XMOF 3KOAA 5C24B 2WW8A 5CYJA 4DR5J 2W9BA 2M4MA 2DEIA 2GHPA 2FB0A 2D3UA 3A8JA 1FKPB 4ZLLA 3CC4S 3QYYA 1VRUA 1T94A 3J7AN 3NP5A 2H5JB 2HWHA 4Q2MA 3DGPA 3LGHA 1G3OA 2AJ0A 1UJ5A 5I3QA 1OSCA 4NCGB 4DUTA 3MCOA 2QMUB 4J90A 2AZ3A 2Z30B 2RQKA 1D8YA 2OTJS 3TVYA 2FHMA 4F67A 3W63A 2HVDA 3C14A 1SC3B 1V5IB 1QSYA 1Y3JA 4AQYJ 2JFDA 3KK1A 3G9CA 3OT9A 4OYIA 1QDUB 3G82B 2FZKB 3DC2A 2WSFC 4PABA 2JEFA 3RRKA 2LXFA 2JNJA 2M9KA 4HVZA 2YX7A 2E9RX 1XTZA 1PJ7A 4ZIVA 1AXQA 1S0MA 3K2YA 2V9WA 5DG7A 1U45A 4OYAA 1FKOB 2JVRA 2YNHA 2CPFA 2VQEF 3TUIC 4MYUA 2QA1A 3MUMP 1WG1A 2HAIA 2HMIB 3H7HB 3TAQA 1RP5A 3NAIA 1T8EA 4FP9A 5A76A 1S1XA 3ENAA 3BPSP 3C46A 1JLAA 5DQIA 4LF9F 1F2GA 2CDQA 3M2RB 5A0YA 2MKJA 1KBRA 4ANDA 2LQ8A 3IG1A 2OP5A 2J8SA 4ED2A 1F5BA 2PDAA 5IC6B
chains in the Genus database with same CATH topology
2YWEA 4JI0F 1GXLA 3KK2A 2W25A 2APOA 3P96A 4JI1F 4O3PA 2XMTA 4DUYF 3GG1A 2UUBF 1Q1KA 1L3SA 5GAGI 2YWGA 5LJ3Y 5KFXA 3D5MA 1RTIB 3VQTA 2KN4A 3UR3C 4K4SA 2DHGA 2XI2A 4OZNA 3TW0A 5CYQB 4IG0A 1NHUA 4CO3A 1HFEL 2KZZA 3BEGB 1LW2B 3OR2A 3CIMA 3D2WA 3Q2TC 2YKAA 3OTCA 4WFXA 3G96A 3PW0A 1XR5A 1JJHA 4YR2A 2C3PA 5I3PA 5KT7A 1YJUA 4KGMA 3RB3A 1IBLF 5F8HA 4DDFA 2DITA 4P6QA 2RS2A 2LQBA 3NCPA 4M1KA 4X4OA 1W25A 2NPFA 3K5MA 5J1EB 3NNAA 3CE8A 3MAHA 1R89A 3AQOA 1S6PA 1RT4B 4RWWA 3M32A 3CDWA 3V6DB 1SJ4P 4DMZA 2ADCA 1NJXA 2CIMA 5L1JA 1YTYA 1VQMS 5E3AA 4DG1B 3MR6A 4P2SA 4C11B 2VZ9A 5KFEA 2IAJA 4C9DA 1UWBB 2DHAA 2RRAA 2RF2B 3ZZPA 3V6JA 3KTQA 4TU9A 1RT7A 4MK8A 2PMZD 5DM7Q 4ICLB 2FJXA 2J5AA 1QLNA 1VS3A 1Y5LB 3IBWA 1K73T 1YJVA 2AJ1A 2UZAA 1XNQF 1RISA 3CJ5A 4CO1A 4OI6A 2OPRA 4RW6B 1WHYA 4IYQA 4UUXA 1HQUB 2CPIA 1QTMA 1JLBB 4FNHA 1YJ9S 2Q3PA 5L1LA 2VPZB 4Q0BB 4A8WA 2X3GA 4RW8A 4ZKAA 1NB7A 3I0RA 4WKRA 4DR5F 3V6HA 3PV8A 4IFYB 4M63A 1FEEA 2CQBA 2KT5A 2JHEA 3J7A1 1KNZA 1UVLA 1GTHA 3OJUA 4JI5F 2F4VF 1N0UA 2B6AB 5F0UA 2DR7A 4G1QA 3HDSA 5EN1A 1JLGA 3BN4A 4HEA9 3ICLA 1N48A 4KC5A 3QLHB 1UJ6A 3DLGB 2Q6BA 2YX4A 1Q4RA 2DB1A 3W2WA 1FO1A 5DDQC 4LFBF 3PX0A 4PPDA 2OIHA 2GX8A 2RRBA 2W9AA 3N9UC 2NQPA 3DRSB 3K8VA 4OV1A 5DO2A 1VI7A 3CUNA 1HI8A 1C1BA 1N36F 4ELVA 1NK9A 5F9LA 2DNNA 1N54B 1KN6A 2HNDB 3BDEA 1B0VA 1AROP 2BE2A 1QE1A 2IA6A 2N7YA 1FT8A 2PD1A 2Z0GA 2Z2LA 1U48A 2OMLA 3GR0A 3WC2A 1X4CA 3MD1A 3A1YG 5GAHU 2EK6A 5D4OA 5KT5A 2UUTA 5B08A 2C22A 2BM1A 1TZ0A 1LWEA 4H4MB 5HMZA 1TK0A 2NS1B 2P6TA 5F8LA 3T1YF 1F0XA 5D77A 1DQAA 3HVWA 1C0UB 2W4DA 3MPWA 4YB1P 5D3GB 2HYIB 2HHXA 1AFIA 1HPZB 4C98A 3O1LA 4BHQA 3IS9B 4DEZA 4WK1A 3H2UB 2RIJA 3SQGB 2MKCA 2BZ2A 1SKWA 3CD7A 5LMNF 1S1UB 1JXEA 3OL7A 2PA8D 3M2UA 4ELUA 4O3QA 1SKRA 1HNIB 1HMVB 3N79A 2BM0A 4K2XA 1TFWA 3POTB 1S10A 4X4TA 1RKIA 4ILMA 3DMJB 1U1KA 3HVTB 1XR7A 4G6VB 2VC0A 4ZP8A 2JJ4D 1SV5A 1VRTB 2J9EA 3CJ3A 4DSIA 5M2UA 2N7CA 5C42A 4W90B 4DLEA 5K9FA 3QAUA 3LWMA 3RRGA 1AUDA 5KFUA 3GR1A 4DL4A 1VK8A 3TA2A 4OHVA 3FEYB 4USIA 1X4GA 5HLFB 4KPYA 1BGXT 4JV0A 2N4DA 1Q8BA 2RUGA 3MUTP 3E01B 3K5PA 1HD0A 2WONA 2COLA 2F7VA 1T7PA 4MKBA 2WB1D 2HQ3A 4IQXA 1JJ2R 1XN9A 2ZH1A 4QPXA 3OFEA 3ZC4A 4XK8C 3BO3A 3KNGA 3PFOA 3CC2S 4ZHRB 2MZQA 3MGJA 5KG0A 4OI2A 1NK4A 1IR0A 1KONA 1OSDA 3DNCA 5DDPC 2BYCA 1PGZA 4TNOA 3FSIA 2UVVA 2IBKA 5IQ6A 5D4PA 1RT6B 2QMXA 5M2RA 4J9MA 2NSBA 4CTAB 5JUMA 3HKWA 3GILA 3H5YA 3QAEA 2J6UA 4LSNB 3NKYA 1KOOA 3TOQA 1Q81T 1GX5A 1FE0A 2FHKA 3RB0A 1R8PA 1WG4A 2HNZB 3CCES 4K4VA 3MDFA 3KLEB 5B09A 1JX4A 1KVJA 3LF0A 3D1OA 4RUCA 3T5KA 1ZM2A 2HLTA 4O4RA 1NH7A 7FDRA 1IKVB 1JNZB 3M9MB 4NLOA 5EX0A 3UWTA 2ZHAA 3TARA 4IO1A 5HN0A 2LEBA 1FE4A 4WZQA 3MM7B 4ECQA 2ROEA 2F8MA 1E6YA 3FCHA 5HI7A 2MSSA 4ZP7A 1ZM9A 1F5CA 1IQTA 3ISND 4NYPA 5K8NA 3PKYA 3G6YA 2CQIA 4CCHA 5J2NA 3O5TB 3M6UA 1R3NA 3MMCB 3DRXA 3BR9A 4MIWA 2VA3A 5AE2A 3WDOA 4QIVA 4YB7A 3DLLQ 4AL6A 4OLOA 1OPZA 2DGUA 2R2RA 2Z4PA 2FHJA 2B7CB 1RTDB 2V4JB 3RU0A 4CQ1A 3EYZA 4MK9A 1GNKA 3FEZA 4C97A 5HMWA 3GIIA 1ZH5A 4C2MA 5E3CA 3MM6A 4Y34A 4UUWA 2XLIA 1VMBA 2FJAB 4OZ0A 4WYLA 2IVYA 1VK3A 3RBEA 1RT1B 2W9CA 4TY8A 4DQQA 2C42A 3M6XA 2JEGA 4ZA1A 3KLHB 3PO5A 1U24A 4NA1A 2XGPA 2HRUA 4KTQA 2POKA 1CSJA 1KQFB 2DH8A 3I82A 4ITSA 2WK4A 4B3RF 4CI0B 1SL0A 2PN6A 1V3SA 3EPGA 1RTJB 1JLCB 2EPIA 5LXYA 2XY5A 3IN5A 2KHDA 2UXBF 2C3OA 1TVRA 1JLFA 2BABA 3P3DA 1TL4A 1WG5A 4AE5A 4GO7X 3LAKA 4A8KA 2E1CA 3MMAA 2MKKA 1Q79A 4IFVB 2YVSA 1FNXH 1JKHA 4Y3CA 2VFRA 4RU2A 1Z2LA 2KH9A 2RKIA 1SBRA 1YRXA 4M5DA 4PUOB 3MM5B 1RAJA 3CCSS 2ZE2A 4I56A 5J2MB 5K8MA 4NA2A 5C25A 2OPQB 4Z37A 1FXDA 4DHVA 1IKYA 2OMOA 2DGQA 3L7OA 4XPCA 3FGVA 3CCVS 1V3RA 3ZZ0A 5KG6A 3FNNA 4CO2A 1KFDA 2NXUA 3T6BA 2KRRA 3VAJA 2PI4A 4RNMA 3M8SA 3SCIE 4QYZJ 4ZCKA 4EWTA 2E7XA 5G0RA 5CZXA 1L5UA 4NL5A 4ECSA 4YFUA 2YX1A 4PRFA 2NUHA 2DGSA 2R9LA 3UD3P 3MOJB 2YKMB 2IC3A 2W24A 2RS8A 2E44A 5IZHA 2V8DA 3O2IA 2E5GA 3PZPA 3IGVA 1HWUA 3Q8SB 1YIJS 2LDIA 3T1AA 1IBMF 1O51A 1WEXA 1BQNB 2YNIA 4IG3B 2BRKA 1VC6A 5CXTA 4ED1A 4ED3A 3HHLC 3U1NA 3IGNA 1MMNA 3BS9A 2EKYA 1GXUA 1KTQA 4DSKA 5LMUF 1YJWS 4IR9A 2C3YA 1CEZA 3IR7B 1GTEA 2VKZG 1URRA 2WOMB 1VJWA 3MOZA 4DUZF 4O3RA 3LP2B 4K4XA 1S6QB 3RR8A 1FEHA 4DX8H 2DNKA 2MDAA 2DIVA 3DYAA 4ZCIA 1KTVA 3CCZA 4QYRA 4DN9A 3HX9A 2DO0A 3CDEA 2UV8G 3CTRA 2B4OA 2RE1A 2AX1A 2E5LF 1U8SA 3QIPA 3R5BA 5LJ5Y 3Q2SC 5DS7A 3KLVA 4EZ6A 4C3MA 3FQLA 3NNCA 2HHUA 1IKWB 5E33A 3VZHA 4JUZA 1T05A 1V9OA 4TYBA 3LANA 3I32A 4HYKA 2XLKA 1K1SA 1S1VA 3TAMB 3CJKA 5KFOA 1WHXA 4Y6IA 1MROA 4MAKA 5KFPA 3M30B 4A48A 1XMBA 2E29A 4Y2IA 3US5A 2B4PA 1FDAA 3Q24A 4WIIA 4F26A 2VL1A 2V4QA 5BR8F 5HROB 2V94A 4AFFA 1VQSA 3DOLB 5D4LA 2MQOA 5A8RB 3LPYA 4ILRA 1HNVA 2CVEA 4MIAA 4X4VA 4O44B 3F44A 1FK9