2RH3A

Crystal structure of plasmid ptic58 virc2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
Knots found
sequence length
121
structure length
121
Chain Sequence
IQVFLSARPPAPEVSKIYDNLILQYSPSKSLQMILRRALGDFENMLADGSFRAAPKSYPIPHTAFEKSIIVQTSRMFPVSLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKATNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protein virC2
publication title Agrobacterium tumefaciens VirC2 enhances T-DNA transfer and virulence through its C-terminal ribbon-helix-helix DNA-binding fold
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 36
structure length 121
sequence length 121
other databases KnotProt 2.0: K -31
ec nomenclature
pdb deposition date 2007-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1760 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rh3A00
2RH3A
chains in the Genus database with same CATH superfamily
1F3VA 4I7FB 4TLQA 2FYXA 5ETKA 4NWBA 4DS4A 3M8PB 3PW2A 4B9LA 4LF6F 2W2OP 5CZVA 4XIUA 1RK8A 3K7RA 3QRQA 1VRUB 3UCZP 3W2VA 4QIEA 2HRTA 3GCWP 1BQMA 2YWFA 2YKAA 1H3DA 2EW9A 3SIPB 1HNZJ 1FFWB 3CXCR 3NLCA 4EWTA 3MM5B 2VKRA 4OI2A 4RWXA 3ULHA 1P6TA 1F1BB 1J27A 3MHYA 1F0XA 3HXMA 2VFRA 2RHQB 1U2CA 4J7CA 3WBZA 1T7PA 1NH8A 1RT6A 3CMES 4K2JA 4CH7A 1AROP 3VTIA 2YNGB 2LCWA 2P9GA 3BGRB 3QFHA 5E3QA 2HNDA 1WI6A 4JI7F 1RCXB 2EWHA 1WKJA 2AU0A 1WDTA 5F8JA 3POTA 1LWCA 3W7BA 1UP1A 3HVWA 1HBOB 3ZZUA 1CS4A 4J9OA 3CJSA 1NK5A 4KGKA 2OD6A 4DL2A 2DISA 2YH1A 4Q8EA 2UUWA 4M8LA 4OFZA 2OUGA 3LP0A 4MTPA 5HQMA 3R7NB 1S9GA 1X60A 4LF4J 1JLQB 1JLGB 1TMMA 2IRXA 3VV2B 1N5VA 2DT9A 2IJRA 2KRRA 4B08A 4ES2A 2MEWA 4ZOSA 3N5FA 3MGJA 4WWSA 5EUHA 1SJQA 2ZH8A 1B7FA 3ZTOA 2UVVA 2V9KA 2HVHA 3CSKA 3M8SA 3P49B 2V0NA 1M1KT 3C3LA 3FQKA 1HFEL 4U9RA 4Q0BB 4DV0F 3M8YA 2YKOA 3PW4A 2IY5B 4FYWB 4MKAA 2CKWA 1T05B 2HHHF 3NAHA 4ZP6A 2AZ3A 1JLCA 2J7WA 1S1VA 1UFLA 4D3GA 1U2FA 5K20B 1HNXF 4M5KA 4J9NA 5DDQC 4DV6F 2AX1A 3T5HA 1T8EA 1JLFB 2XWYA 4C98A 5A8KA 3D5MA 2I6WA 1TKDA 1FJGJ 1TL7A 3GMGA 2W4DA 1J5EJ 1EB0A 2HBRB 3H20A 3VF0B 2LQ8A 1YG0A 2P2CB 3BN7A 1IR0A 3MM8A 2DH7A 4NA2A 2C2ZB 4PYDA 4ZIVA 4KGXB 1SL0A 5B7WA 2H5IB 1F6TA 2E44A 4J9QA 1KQFB 3M30B 3BM7A 2HVDA 2R4FA 5F0UA 2O1PA 2P8IA 1GNKA 5T41A 2YH0A 1HW9A 3ICLA 2DPJA 4WP3A 3PXGa 5KFBA 1WHVA 3SV4A 1WEZA 3FDSA 1SI9A 5JJBA 4UUWA 3HD2A 4GO5X 3DXSX 3V81A 2AQ4A 3I9V9 5AXLA 3DDIA 2CRLA 3M7VA 3MUTP 3VWSA 2KXHA 1S9EA 1Z2LA 3KLVA 1O6XA 2LA4A 2EFQA 2HHPA 3RBDA 4USHA 1UEUA 2U2FA 5CYMB 2Y0BB 4F50A 3HPOA 1OMSA 2ZE2A 1FK9A 2Q1LA 3TEGA 3BKUA 5F41A 4P2MA 1SKSA 4DFJA 2B7CB 2YKQA 4ICLA 3U02A 1NXIA 2PI5A 1H6KX 4DR3F 2MQ8A 4Y2KA 5F8HA 1TQLA 5I4MA 3BGLA 2L9NA 4TXSA 4UOFA 1N5TA 4IFYB 2V8PA 1MROB 3GJQB 1X31C 3DOKB 4QYZJ 1K1SA 2VPZB 1GK8A 1JLBA 1RADB 1P8GA 2B0GA 1VMBA 2LKZA 5B0EA 1S5ZA 3GQCA 4RUCA 2B5JA 2EK1A 1RTDA 4QBUA 4KGZB 5KFFA 5EWFA 1WJ9A 1FTCA 1U1MA 4OYXA 2F65A 1RB0A 1H2VZ 2W7AA 4ZVRB 1M90T 1N5QA 2MHEA 4DLEA 2MQPA 4ERDA 3FEYB 1MMNA 3CT9A 2H1YA 2HQGA 2PT0A 3WC0A 5DM6Q 2U1AA 4C9DA 5KFCA 1URRA 2CJKA 1VQYA 1WOOA 1AZSB 1HIYA 4X4TA 2B7BB 2OEKA 4RJVA 1JXVA 3PO5A 3J7AN 4FN5A 4DL6A 1KFSA 4HVZA 3D2WA 4PWDB 3MEEB 1O8BA 5ETPA 2HMIB 4M95A 2BE2B 5A8WB 2B43A 3KLEB 3QAUA 1FI4A 1AYEA 2VL1A 1VJQA 2ALZA 2RDDA 4TYBA 1KLMA 2C2DA 3H25A 5A0YA 1GMWD 4RNFA 2HNZB 3DGPB 2DH8A 1M0SA 1X4EA 4KHPJ 1YQHA 4CP5A 3Q8RB 2VUGA 1S6PB 1SKRA 4J9UE 2BJ3A 2QIFA 1UTAA 2DD8S 2YWKA 2ILZA 4USIA 2NYIA 1TVRB 3M2UB 4A8FA 5KFKA 2EEYA 1M1GA 2B4OA 4HT5A 3W5YA 2KFYA 2LU1A 2QA2A 3DU6A 2IM1A 4CLFA 1IKVA 1C0TA 2GJ2A 5FJ4A 1N0VC 1F5CA 3BREA 3H59A 4IR1A 3GIMA 1UFKA 3F41A 1RISA 1VR6A 1FDNA 3FSIA 3HO1A 4JI1F 4ZCIA 4DQQA 2RQMA 4LF8F 3RB4A 5AE1A 3BV8A 1MWYA 4U6PA 2Y8WA 3D6FB 1RCOB 2DIVA 3EX7B 3UCGA 4G65A 1RT2A 1BY9A 2EFOA 1RWWB 3CULA 3V4IA 2W8LA 1YBAA 3ENWA 3NWGA 1S0VA 5E3CA 4EBEA 4WKRA 1YRUA 4DV5F 2ZH9A 4JI4F 3DFEA 3G8QA 3TJ9A 3R5GA 3MM7A 1U1QA 1XIQA 3W63A 3MAAB 3DOLA 4WPAA 1NLKL 3DLBA 2ZBIA 2EBGA 1VBKA 3B4DA 3JTOA 3T19A 1S1WB 3D67A 3OR1B 2RQ4A 2OPRA 2VH7A 4OYAA 1VQ4S 3EZOA 1N52B 5DDOC 4KGVB 4YP3A 4EO6A 4MK9A 2AYGA 3WIVA 1KVJA 5B09A 1TKXA 4P9SA 3D6MB 3L7UA 4KT0C 5KT6A 1I94F 2QLJB 3KLFB 3UVJA 7AT1B 1UCNA 4X4RA 3LANA 4AYBD 4E2FB 3SFUA 3JAMU 4NEZA 1LW0A 3CJQA 4YN3B 3QPIA 5ADZA 1IBKJ 4NLXA 1RT3B 3PM9A 1HYSB 2GO9A 4O3OA 4CT8A 2AJFE 3M8QB 4I1TA 3PYEA 4K4XA 4QYZK 3DDKA 2XZDB 3I0RA 2H5EA 4ZVFA 5HQLA 3KLHA 3FQLA 3RRKA 4GO7X 4G1QA 1GTEA 1Y11A 4MKYA 4YR0A 4NLPA 2HWIA 4NLWA 1R31A 3EUNA 4IG3B 2KJWA 2ZNYA 4PCQA 1WC5A 4OJGA 4OYPA 4LF2A 1KBRA 4TYAA 2AT1B 3D28A 4CO5A 1FNXH 1XMQJ 1QSLA 3ZZ0A 3OFFA 3NY0A 1HI8A 2NXEA 3QO9B 5KFAA 1UJ5A 1JKHB 1BHNA 1RHKB 3TJ8A 1CBKA 1VYAA 5DGBA 1MG7A 4F2SA 2UXBJ 3GPAA 4JI6F 2EK6A 4YHHF 2LEAA 3KG0A 3CD5A 4OYZA 4P74A 2OSQA 3AY0A 5L1JA 3TNVA 2XS5A 3QGPA 3BGOP 5IT0A 3BBBA 4M5JA 4DV7J 2JEFA 1YJTA 1VQNS 1NZAA 1Q81T 4GKKJ 3A3NB 4CH0S 1DTTB 5D4PA 3HMJG 2QO3A 2GMJA 4RU2A 1B0VA 2ZC4A 4RZRA 1PKUA 1HNIB 4BS2A 3BSNA 2HKEA 3FEZA 2OKQA 3HKZD 3NNAA 4ZPAA 5E0OA 2QT7A 3NGKA 4USUA 2BBEA 2R7OA 1R8PA 3M8ZA 2IBKA 4UT4A 3I0SA 1HPZA 4H4MA 3L3CA 3SDEA 4YB7A 2K2PA 2ZH2A 3HFVA 4M5LA 1HQ2A 4YB5A 4JI0F 3UWTA 5K8OA 1A6LA 2RUGA 1BQXA 2V63A 3EPIA 1XWLA 2VIHA 3QAEA 4HYKA 1FJ7A 1U02A 3D9BA 5CYJA 3I9ZA 3QT5A 1PJ5A 2OPQA 3IR6B 2YKMB 1JJ2R 4K0KJ 4P6QA 5L39A 1NJXA 3MI7X 3JXOA 5B0CA 1CQNA 3HVTB 1S97A 4QR1A 2V2QA 3K2YA 2M8DB 1AFIA 3DHXA 1QAJA 2JC1A 3MFIA 5KFHA 2GJFA 4JOUA 3US5A 4I2QB 2MPUA 4QW8A 3SQOP 3TEHB 4U7CA 2FY8A 3OFEA 1YJVA 4YR2A 1RWKB 4MKBA 1RP5A 1F9FA 3W2VB 4FKXA 1LXNA 1BQMB 2AHOB 2EFVA 3CMQA 1L3KA 3J81U 1RAGB 4HL9A 4WFYA 3KHGA 4DV1J 4BLGA 1SH0A 1VGYA 4CLWA 4C8YA 3D68A 1IKWA 4IDKA 5HO4A 1EKRA 1XQIA 3W9JA 2G2ZA 1DLOA 2M7SA 3TA2A 1PILA 1N33J 3UD5A 4WFBQ 3PX4A 3UDVA 3PEJA 2E9RX 3B8HA 1RWVB 1XC9A 2OPPA 2FDNA 1TELA 4A4JA 3OD2A 1WTBA 4LRAA 2CJ9A 3BPDA 4YFUA 4JP8A 3RGIA 4B3RJ 3POTB 4RW7B 4TLRA 1Q8IA 4B3MF 2QLXA 3E51A 2XHCA 4DSEA 1M5OC 3CCMS 2GMLA 4DFMA 3GG1A 2WVCA 5M2UA 3T9ZA 4DN9A 1CJUB 3F0NA 4Z7CA 4CH1A 3T1YJ 1WG4A 4PUOA 4M1KA 4LFAJ 2A18A 1S1TB 3R27A 4X65F 1TTHB 2IVFB 4CM0A 4DR2F 3A8JA 1FTRA 2HZAA 5D0GA 3FEXB 2VG6B 1F2GA 3DYAA 2V8VA 3BS9A 1TAUA 2ZM6F 2RNEA 5FLXU 3GJTB 5CD4A 2GS8A 4HHUA 3ET6A 1UA0A 1VHIA 2QMWA 3FBBA 3LF0A 1Y3JA 5IV4A 1MWZA 2RSQA 3OL6A 1RBLA 2CPEA 2MHNA 2BA9A 2FVSA 3IC1A 2PMZD 2DCUB 3KK3A 2MQLA 1GX5A 5HLFA 5B0FA 3G96A 1TL3A 3CCES 4CO0A 4AUKA 2WCXA 2CNNB 1YBTA 1OPZA 1WC4A 1KSPA 2J76E 4GC7A 2BUNA 2ZBCA 2HEKA 3W66A 1MN7A 3SMZA 5FDLA 3VR1A 2FLOA 1IKYB 3TZXA 2MKJA 4XAKA 2F40A 2DH9A 3VAMA 4OZNA 4ELVA 1HNVA 4ANCA 4I69A 1HBMA 5GMKa 2V34A 3BGFA 4B9VA 3A8EA 3FSYA 1CC8A 3P5BP 3C16A 5C25A 2KFNA 4JV2A 2WB1D 1DURA 2PMHA 3G87A 3ZFVA 5L9XA 1Y00A 3QMQA 2VG5A 3TW0A 1VK3A 2XTJP 5I3UB 1Y5NB 2WSCC 1U48A 1C1BA 1DZ5A 2Y1LB 2J9EA 4UY8T 3TR5A 1Q1KA 1D9AA 3MTKA 1SH3A 2MSTA 3KNGA 4DMZA 3D1OA 2ZKUA 4ZLJA 1X0FA 3D6TB 5F0WA 3BN4A 2DNKA 1XNRF 2KHDA 1SB6A 1XNQJ 2VA3A 1U0HA 1EX8A 2VQFF 3BSOA 3Q23A 3KLGA 3EM1A 1F60B 4C8LA 2VFVA 1SCJB 5BR8J 2ZE2B 2XMWA 1S7IA 4KO0A 3FNNA 4HTJA 2I5JB 2E7XA 2VHGA 3QRPA 3DLHA 4LR7A 5IT4A 2A2CA 3VZHA 3OJUA 5EGYA 1JQGA 3T6BA 4CTAB 1HBUA 2UXCF 1UL3A 2XC9A 1QY7A 4CCHA 2IYGA 4NYOA 1VBZA 4C11A 1GTHA 4NXNJ 3GE9A 3QGIA 4G3IA 2R2RA 2IMWP 3UDLA 1Q8KA 5K9FA 2FVQA 1IBMF 3FZBA 4IO9Q 1VIXA 3SFGA 1VQPS 1FDDA 2E1AA 3UDCA 1RTDB 1FXDA 3X1LB 1UJ6A 1LXJA 1WELA 3MMJA 1T03A 2YQ3A 2DVIA 2B9YA 5J2NB 3EDRB 4KHRA 4FPRA 4EYIB 4F25A 4J9LA 3HHLC 4PPDA 1Y0HA 5CHCB 3FMWA 5I3PA 3NCPA 2QX0A 2LDIA 3LP2B 2RDJA 2DBBA 2XQCA 3LPEA 2ZKTA 3IWLA 4F0HA 4YDDB 4QPTA 2ZHOA 1RGVA 1RSCA 2H5JB 1TV6B 1OSDA 1X9SA 2DY1A 2DNZA 5KT7A 4IOCQ 5DETA 5KFWA 1CJVA 4J9MA 3RG6A 2MB0B 1N0UA 2V4QA 3PV8A 2QL7B 3MR2A 1W26A 2QTWA 2R2SA 3AHPA 1SVDA 1HQUB 1VQLS 5GMDA 3FUYA 2HAIA 2EFNA 2C1EB 5LMNJ 1YJNS 2R7QA 4BC9A 2CJYB 1SJRA 3MEGB 1HLWA 3K8VA 2QLBB 2M52A 4I64A 3UE2A 3K57A 2HRUA 4ZN1A 1DQ8A 2PO4A 2K1RA 1F5AA 2AMCB 3RZAA 4WTOB 1UVJA 3IFEA 4NPOA 5L46A 2ACMA 2QLFB 1H7XA 1X4AA 3V6DA 2HFZA 2PDAA 1HNZF 1S59A 2V50A 4ZPCA 1TKTB 3IRXA 3K5PA 4C3MA 2MDAA 4JB8B 1T3OA 3TAQA 2Q6CA 3GSDA 1RWMB 4WFAQ 1U1KA 4USTA 3NP5A 4M5HA 4JI3F 2BANB 2V8DA 5GAEU 3IBCB 1SIZA 3VVTA 1Z2ZA 1FWPA 1H73A 1TFWA 4A47A 2UU9J 4LSLB 5EDWA 1QAXA 4NOHA 1K44A 1UJ4A 4L6V3 2RQKA 4FDFA 4PQUA 3GU0A 2QA4G 2D1CA 1X9WA 2BX6A 2CPDA 4O44A 4ZMMA 2AZ1A 3CWJA 4LVOP 1X5SA 3LWLA 2CFXA 1U7LA 2Y1RI 1HNWJ 1FE4A 4ED7A 2F9JA 4JI2F 1YHQS 5K14B 5C7PA 2MSSA 4N7TA 2ZNZA 2HBYB 1CEZA 3SQGB 5IC4B 1NPKA 3CVKA 5JXSA 3EMTA 2E9TA 2IA0A 2GQQA 3RAMA 3KMQA 5FIIA 1KRPA 2WOMB 4KE5A 1A0OB 3OL7A 3MR7A 5J2QA 4K4ZA 2IBOA 1FE0A 2FB0A 2IM0A 3DMJB 3PRVA 2ROEA 3R7SB 1IM6A 4RR5A 4DPXA 1HR0J 4NLYA 2NUHA 4ANEA 1AW0A 3I5AA 3ILLA 2VPWB 1E6VA 4ID5A 4USJC 3T6JA 2HNYB 1WG5A 2D3OR 2DGUA 2PFFB 1K9MT 5HROA 3BQ0A 1VS3A 4B3SF 3U7JA 4P2SA 4WK3A 1VFJA 1RT7A 3CEDA 3B6BA 1FJGF 2OELA 3NMAA 3FCWA 4RPFA 1C1CB 3H5YA 2DHXA 1O0PA 2BJ7A 1HW8A 4NCGB 1UETA 2JEGA 4NA1A 4ALZA 3PW0A 4H4OA 3MD3A 5H9FJ 2Z2YB 4ZCLA 3ENAA 1SC1B 2CG4A 1NK6A 2CPHA 1RTHA 2LLZA 2V69A 3S6EA 2CQIA 4ZITA 5HBMA 4ECTA 1S99A 5J2MA 4B9TA 4K4UA 4RU9A 3W65A 3DM2A 3MPVA 3ZZZA 3W3SA 4C3KA 4RL1A 3RR7A 3SSRA 1SV5B 1WEXA 4QIGA 3CDBA 2PEBA 2Q3PA 2RKIA 2PGCA 2QL9B 1EHWA 1RHJB 4PG4A 3JSMB 2UV8A 3RR8A 3QJLA 2WVFA 2MZTA 2UUBF 3W2WA 2LQ9A 2VONA 3MF5A 4TU9A 1FA0A 2NZ4A 2YX7A 4LFCF 1T95A 1C0UA 3AJ1A 1GQEA 3AQPA 5KT4A 3VGUA 4RBTA 5ETOA 1NCLA 4TQSA 3CJKA 1UZHA 3I87A 3NGUA 2XY6A 3SXLA 3ONQA 1RBAA 4DV4F 3WDOA 4CO4A 1SIWB 5G0RA 4E98A 3N28A 1N36J 1UZDA 1OQ3A 3DI6A 1NB7A 3ADAC 4RUHA 4LF9J 2R2UA 1U45A 2AD9A 3G9CA 1BLUA 2ZJRQ 1CJTA 1RWNB 1S7HA 2NSCA 4CNYA 3DRSB 3M32B 2W4PA 3H2VE 3W8GA 2BW7A 2IYIA 4QCLA 4UZBA 3DKDA 1MN9A 3DXBA 2YWHA 5L8RC 1UVMA 4PXCA 3R1HA 2FJWA 3VHQA 2CJQA 1VBYA 1KHVA 2AWZA 4X64F 1OS5A 3C6TA 1X4BA 3NOCA 4TN2A 1FKPA 5F8LA 2GVZB 4RNOA 4PQAA 3QWUA 3KJNB 4EBCA 4DZDA 1K0VA 2KFZA 3LALA 1IR2A 2AEFA 3CJ3A 3J81j 2VPYB 3IAM9 4DI6A 2ZH3A 1RAOA 1S1XB 1U6ZA 1CJKB 2OD4A 4O4RA 1NHVA 2HRYA 3A3PB 4PWUA 4ED1A 3U1MA 1RT1B 3D1QA 3OHAA 4RUAA 3T3FA 4DR5F 1PC5A 1IKXB 1LKZA 2OPQB 4NYZA 5K8MA 2RH3A 2C3UA 4F67A 2W9CA 5D3GA 2ZFHA 3PHTA 5U47A 3GIKA 4RWWA 1JB0C 3AD8C 1WNEA 5KAKA 4CNZA 2MLYA 4OHZA 3KTQA 4LSNB 4DHVA 2A2DA 3H2LA 1A9NB 1RA7A 2B4UA 3DLEA 1JLEA 2DGVA 4LF5J 3OTBA 1HWKA 4KHPF 1X4GA 4UZCA 1ICEB 4DV2J 4OHWA 4DG1A 3VQSA 4OX9J 3CO0P 4RW9B 4WYWA 4TY8A 3IS9B 3QLHB 1ZOTA 1GXLA 2QYCA 1RT5A 4D3HA 2B8QA 1EARA 4WF9Q 4QWDA 2P9EA 1TKZA 3V4MA 2VQEF 3TP2A 2FHJA 3F44A 2HQ3A 2MQQA 2O01C 4N5SA 2ZBRA 1D3WA 1QAIA 3FMBA 2DEIA 4B3OA 4F3OA 2R8HA 2F8HA 3OVAA 5I3QA 3AODA 2OPPB 2ASJA 1NH7A 4KPCA 3A1YG 3MPYA 2MJUA 3H98A 5J1EB 5H9FK 3F56A 4PZVA 2OI2A 4FF3A 2H3EB 2HPUA 4ED6A 1U09A 3SZ2A 4OZ5A 4FBTA 3UW1A 5T7LA 1PG5B 4XTTA 5CYQB 1WC6A 4N56A 3IMQJ 5MAOA 5E3RA 3TVKA 4TU7A 2WSFC 1OY8A 2DR5A 4F04B 2YX4A 2J9DE 3Q8YA 2QLWA 4DSJA 4PR6A 2BJDA 3CCWA 2NCKL 4LBIA 3H0PA 1NJZA 4PAAA 3CMAS 2WK4A 2LFVA 3OHBA 2KXFA 1RWOB 3A4TA 4O4GA 2SXLA 1U6BA 2ZOMA 3S8SA 1WACA 2E5LJ 1REVA 2X3DA 5SUHA 2WZ1A 3NGTA 3CTRA 5H9EJ 4ECVA 4FPIA 5DJBA 2QG9B 2DNOA 1HA1A 1HQEA 3TO8A 3IGVA 3HVRA 5A6WA 3NBPA 1GMUA 2BMBA 1IBKF 2HHTA 4TU8A 2BV3A 1Q4RA 3L95X 2JOQA 2YKNA 2GAGC 4WXOA 3R1LA 3HM9A 2IJNA 2DHAA 2V2VA 2RF2A 2KVIA 3DRRA 4UOHA 2MTLA 2VV5A 2RS2A 4O0NA 4JUZA 3TZWA 3JAMY 1HBMB 1U8SA 1RYSA 5K8PA 1RDRA 3ZZTA 1H2TZ 2XNRA 3HHLB 4F0MA 1QSSA 4OHYA 1JXEA 1LWFA 2BJ9A 4B9UA 5KT3A 2FJVA 4DSLA 2A3JA 3RAXA 1W7WA 1N5YA 2FHJD 1NJIT 1XMQF 5LSLA 4P2XA 4RNNA 1BXNA 3Q89A 2Q66A 2MQOA 1D0EA 1APSA 1S10A 2MKIA 2W9BB 2V6AA 1MLAA 2CDRB 4WZQA 2WHOA 3MEKA 2GHWA 3CB4A 4MK8A 1DTQA 3HI9A 5FD1A 4CLUA 2DPIA 2L3MA 3T5LA 4ELUA 2CDQA 1I6JA 1RHMB 2MGZA 4DV7F 5HP1A 1YSJA 4FXWA 1B99A 3Q8UA 2I9SA 3MM9B 1WC0A 2V4JB 1R8BA 5AXNA 2NUUG 2E5IA 4I6YA 2IJFA 5GAGU 1SC4B 2RT3A 3DOMA 4KFBA 4FS2A 3CJTA 2BW2A 3Q0AA 2LDYA 1WSRA 1TUGB 1L3TA 4X4QA 5KFUA 4LIRA 4WFZA 2ZH1A 4C11B 3QBCA 3G82A 5KG6A 4ZVQB 2KI2A 4G1PA 1N32J 3N79A 1S76D 4WU2A 4I0WA 4P72A 4F4KA 2DO4A 2JL9A 3OW2R 4CO1A 1VQ8S 4ZVTB 1RKIA 1NO8A 4YY3J 3HHDA 5AXKA 1EETB 1HBNB 2HVIA 2XGQA 1RTZA 1R0AA 5HMZA 3ZTQA 3NNHA 2IDLA 3DRXA 3AA9A 2CZ4A 5A76A 4N8OA 4P10A 2GIRA 1L3SA 2CQHA 1KDNA 3TWZA 3VAIA 3CJ4A 4LF6J 4DLGA 2HQDA 2A10A 2G13A 2YBVA 1OY9A 3HDSA 1U49A 4CT9A 1WOPA 3I5BA 4CLKA 3IGNA 2RD5C 4K0KF 2FGOA 3P5TL 5IWAF 2AJQA 1WSVA 4CIOA 3J7Z5 2W01A 3CJRA 1LWXA 1UVLA 4WIQA 4Q44A 4A8YA 4CYUA 2MYFA 5AE2A 3MM6B 1M1HA 2A6OA 4HKQA 2CQ0A 2V2KA 2KH9A 4FYXB 2FJAB 3TVYA 1R0BG 4JI7J 4R5PB 4B3TJ 2IA6A 2YNHA 2IM2A 3CDUA 2GIFA 3PX0A 3PTWA 1H7WA 5HVHA 5DDRC 5AJ3F 3TRGA 4L75A 4XPEA 4DV1F 4C8OA 1EJ7L 5D4NA 3KK2A 2MZ1A 4V19X 1FNOA 1FJEB 2J0WA 4ATNA 5BYSA 5C5JA 2ATCB 4MYTA 3SV3A 3W5ZA 3CD6S 2MQMA 1N33F 1T9XA 2P6TA 4IFVA 3J81Y 3TUZC 3CJ0A 4DX6A 2J0XA 2GVDB 2VFTA 2BJ8A 5K8NA 3KFWX 2H65B 1IQZA 1FRKA 8ATCB 1RI7A 2EC2A 2XI3A 2ZZTA 3OJSA 4FBUA 4LFBJ 2QSWA 1EP4B 1SL1A 1XN9A 4OQJA 4DV0J 3EDQB 1UWBB 5F8MA 3MPUB 3DRPA 3T1YF 1V3SA 4DPYA 4O3QA 2VBYA 4FVMA 4DOZA 3L7PA 3BSAA 3PG9A 2HYIB 1H38A 2PEHA 3CCJS 2CQ4A 2OIHA 2XEXA 4GVLA 1FESA 3IA0A 2C42A 4HH1A 4K5SA 3JYTB 1WHYA 1S4EA 3R3TA 1NDKA 4PKDB 1KQKA 3ETMA 3CCUS 2KT5A 2VKZG 2FIUA 2J8SA 4DU7A 4JV1A 3RU0A 3AD9C 2K7KA 3EVOA 2R8IA 4PG7A 3FRZA 4MAKA 5HMXA 2FJBB 1JLAA 3RRGA 2XLJA 3FFIA 1GXUA 2RVJA 1NK7A 2JVRA 1WKKA 2W1BA 2D3O1 4MK7A 3BJYA 4KV8B 3LW5C 3CW2C 5E7OB 1NU4A 5B0GA 3MR5A 3MEDB 1FRIA 2VG7A 1RT4A 3G6VA 4OYIA 1D9DA 2MKKA 4CDIA 1SUQB 1RTHB 3NRBA 1N56A 2I38A 4QR2A 1U25A 3Q83A 3GCXP 2QN6B 3M9OB 1KNZA 5IT9U 2M0GB 2ZHBA 3FK4A 1D8YA 3VCDA 4KHMA 4LRDA 1RWPB 3PFEA 3QYYA 5E5NA 4DR3J 3DLKB 2HS4A 2CYYA 1HWUA 5DDPC 3DGVA 1I1GA 1KEKA 1ULRA 4N77A 2FJDB 3TAMA 2W24A 2HIQA 3C6UA 1T02A 3R6GB 4P7VA 2NZCA 4Y6IA 4BDPA 3HULA 1AFJA 2QMXA 4X4SA 2GW8A 4Q7AA 3AJ2A 4F8RA 1R8CA 5D4OA 2WTFA 1K47A 2R42A 4P7TA 5D0HA 3OLAA 3MMCB 1RAJA 2FLLA 3G71S 3UNYA 4OV1A 3KUHA 5EWGA 2DY9A 2W25A 3ZZPA 4X66J 4XDDA 1BD6A 3DLGB 2HSEB 1RTJB 4LF1A 2KXNB 1KVIA 4PWWA 1U24A 5DS7A 2OEJA 4LRCA 3EPGA 1BC6A 4IQXA 4ECSA 4ZHRB 2E1PA 3ISNC 2AEMA 1KS2A 1QDUB 1CULA 1XK8A 5IM0A 1XR5A 5LT5A 1QE1B 3KLIB 2YNFB 1SC6A 5IZHA 2IHR1 1NDLA 4I2PA 2VC0A 2B3TB 3FBCA 4P52A 2E5JA 2R7WA 2JDJA 1D9FA 2KG1A 4OHVA 3LGMA 3EGWB 3OR2B 1R6VA 4I7FA 1YBUA 4PG6A 3ISND 4Y2IA 1ZM3A 4NEYA 1TL4A 2J5AA 3J80U 3M8PA 2G4BA 2ZBPA 4X2BA 4NLDA 4R0JA 4DEZA 2E5HA 1RTIB 4DQPA 2HURA 3HF5A 4F4AA 1VRUA 4X4VA 2ZD1A 2DK2A 3MDFA 4LR9A 3W61A 4URGA 1W25A 2LVWA 5IC6B 2VC1A 3ZNUA 1FFGB 5ETVA 2OSRA 2OO4A 3MM5A 3R97A 3NGSA 2GFFA 1VRQC 2FVCA 2V9WA 4ZLLA 3NL0A 2XMUA 3TQEA 1BGXT 2C3YA 4YR3A 2J0SD 5J2PB 2OP5A 3CIMA 1U1LA 1N34F 2HAFA 3WHIA 3M6XA 4J9VA 4DN0A 3MURP 2DGTA 3PR4A 2JH3A 2DNRA 1PJ6A 1XBWA 5KT2A 5GVQA 5GADU 2CJAA 2YNGA 1TMJA 2RDIA 1FNMA 3BGRA 2OAUA 3THTA 2QL5B 3EXCX 3UD3P 1KONA 4DQIA 1FRHA 2FD2A 4JI1J 1T9UA 5IQ6A 3PHEA 2AYEA 2D69A 2CPZA 5L1LA 2BM1A 4C8ZA 2M8HA 1HBOA 3QJPA 4WFXA 1AA1B 5HANA 3BBCA 1WC3A 4ZVGA 3E8OA 4GKJF 4RBUA 4ED0A 3BBFA 2Z58B 2X1FA 3S01A 4MMOA 4RW6B 1VCTA 3LGNA 3MUMP 1JLQA 1JLGA 1XR7A 5CAAA 4N8NA 1PC4A 3MPDA 3UCUP 3NGRA 1LV5A 2UU9F 4DL5A 2KVQE 2N3OA 2IDEA 4EO8A 4U67Q 3H42A 4ZPWR 1P1LA 5CABA 3FVYA 2QMUB 4MIAA 2N7YA 1NHUA 3LQVA 1WDDA 4WCEQ 5A2QU 2R7UA 2RB7A 4LF7F 4Q0BA 1GMWA 1MMLA 4RW4B 5T7LB 2DR9A 1T05A 1UVNA 1HNWF 4NE9C 3T41A 1UPPA 2DXEA 3K5LA 4FZVA 5ETRA 3C14B 4DF8A 2DXDA 4E0DA 2XBPA 1TK0A 3QJJA 2C2KB 3MOZA 4MIWA 3OTCA 4A8SA 1OWXA 4KC5A 3PKYA 1SXLA 2GHVC 3MECB 1JLFA 3ZC4A 3G6XA 4F02A 1I94J 1Y7PA 4KPYA 4M5NA 5L38A 4N76A 2E29A 2KG0A 3M9NB 3O3LA 1K73T 2FVPA 2BJ1A 4NI2B 2BE9B 4ED4A 4OX8A 3KOAA 5F9LA 3DRYA 2KTQA 1HR0F 2IVYA 5I42B 4G1IA 3T1HF 1YJWS 1VQ5S 3C15B 3QT8A 1RZMA 1BE4A 2C2OB 3VVUA 2ERRA 3M2RB 2ZJPQ 1XERA 3PJ9A 2FHMA 3VAFA 1VQKS 1NK0A 4FXVA 4RNMA 2ZHAA 2YQ0A 4C0OC 3HK2A 1R27B 2KYZA 3GWCA 4DR4F 4DPOA 4K59A 2N82B 5JMNA 4ZLNA 1N6QB 1Q16B 3LH2S 1KTQA 3UI3A 3C2PA 1RABB 2XY7A 1TL1B 2XS2A 3R2DJ 1U8WA 2ZUAA 4NLVA 1G4CA 3SCIE 2X1GA 1IM4A 1PAUB 4JI6J 4YHHJ 2XSJB 3TQ1A 3MMBB 3RW6A 3PVXA 4A48A 2F4VF 2VJUA 1FD2A 2JJ4D 3IG1B 4NCAA 5IFMA 3G4SS 4JI8F 1GX6A 3KJQB 2CPXA 5CYMA 1DHMA 5HSPA 3QRRA 3TUIC 1OQ6A 2FHKA 3OXLA 2F1FA 3SSSA 2WONB 1QLNA 1K1QA 2QV6A 3GJRB 2X51A 2ZH4A 3BO2A 1MNEA 5DGAA 1TAQA 1SJ1A 1HMVB 1TR0A 1S1UB 1H2UX 1YLXA 5D78A 2W2NP 2V68A 2C2RA 3FGVA 4IFYA 2KHCA 1RACB 3W62A 5DLFA 4DBQA 4LJMA 2XMMA 3DOKA 2ADCA 5ETTA 1KOHA 1NKEA 3GLJA 3TAPA 4IO1A 3MAQA 4QJVA 2OMLA 2VASA 3TA0A 3MMAB 4ZCMA 4RX6A 2AF6A 4IYQA 4AQYF 4LT6A 2B6AB 1LNQA 3HJFA 4I6WA 2CPIA 2WB4A 2JVOA 3DOMB 4KFBB 2IC3B 1O51A 1NJWA 3G6ES 3UN2A 2CNLB 2X1AA 4EU0A 3HSZA 4FNHA 3D7SB 1AZSA 3HT0A 4PG8A 2JEIA 3K5OA 3WX4A 4DL3A 4KB7A 1ZA2B 4KQZA 3P8BB 3WQPA 2HZCA 2BE7D 2JNJA 1I51B 4PWDA 2OMOA 3MEEA 2GC8A 5JVHQ 5LMUJ 2HMIA 3EZ5A 1ZAVA 3FBEA 2DNNA 3NG8A 3SCJE 2BE2A 5A8WA 1FWKA 1LQ9A 5C24B 3AOCA 1OSCA 3PNIA 4EFAC 1FERA 4NLUA 1QVGR 3ELHA 2GX8A 1CLFA 4ES1A 5G4DA 1VRTB 2PD1A 1AUSL 3DGPA 4ILMA 2ZOFA 1KQSR 1FKOB 4K4WA 3IM9A 2VICA 3CGIA 4C97A 2HHQA 1CG2A 1OYEA 2YWWA 1U1OA 2V67A 4USVA 1ZM9A 3OLBA 1S6PA 4UOCA 2JLFA 2NYHA 3LP1B 3X3UA 3S1TA 5ETMA 2X3GA 4DPTA 4XK8C 2W8KA 1NSAA 4DR7F 2LA6A 1TVRA 3M2UA 5HVGA 2GMHA 4DUZF 1MSWD 1IBLF 1JWWA 2NPIA 4IH7A 4FF2A 3GP9A 4CYUB 1M5KC 4LF5F 1SJFA 1HKAA 2G1HA 1G6BA 3LOUA 4C0HA 3HKWA 2QFIA 3FZ2A 1T3NA 4IRKA 2VBXA 4ECUA 3H8YA 1NHKL 1LW2A 3WX8A 2AIRB 3KK1A 4FS1A 3NNCA 5DM7Q 1RWXB 1J2VA 3SEOA 1RU1A 2IMOA 3ZTPA 2GJIA 3CCSS 2HHSA 4B3MJ 3RW7A 3PDNA 1H0HB 4ZJLA 1FDBA 1QTMA 2XULA 1I5OB 1XMOF 3AB4B 3G8SA 3JSRA 2CPFA 2KDOA 3GONA 1RYRA 4JI5F 3I31A 4CO3A 3OTEA 4X65J 1V3RA 3ITHB 3I6PA 1JJ4A 5LXRA 4M5DB 2J7KA 1A7GE 2HZVA 3K59A 5KG7A 9ATCB 1KN6A 2ZM6J 2MMYA 1XTZA 3AFGA 3OVSA 3M4XA 5K5MA 3MAAA 8AT1B 3PW5A 3CCLS 1FJCA 4IOBA 2HFOA 4V1Ak 2F7VA 4ZCKA 4YUDA 1S1WA 1ZPWX 2K7JA 3AXKA 5HN0A 2VDIA 3OR1A 2RAQA 2HFSA 3HZEA 3TZZA 4OI1A 1XMBA 1PBUA 3E01B 5LOQA 3AT1B 1SC3B 1S6QB 1LWEB 2RE1A 2BKOA 4I68A 4Y2AA 1CC7A 2LQJA 5C42A 5KG4A 4ECWA 3D0IE 4DR1F 4ZP9A 3UO0A 1RT3A 1VI7A 1HYSA 4OYWA 4DV3F 2ZZNA 3DLJA 2BQRA 4NMXA 1V3ZA 3M8QA 2HS0A 2R7RA 4C6AA 1S57A 1KHWA 4M5GA 4KKOB 4ECZA 4DS5A 1UMJA 1WUUA 3MCSA 2ZZMA 4IG3A 1JLAB 2YQ1A 1BQNB 2XMJA 4DZ6A 2YNIB 4O23A 1VQ9S 1R7IA 2GZOA 5D4LA 2N4DA 4OX7A 2JC0A 3AA8A 3JS9A 4JYAF 1HD1A 2LXIA 2MQNA 1EKSA 1ZBTA 2XCPA 3P6YC 4JV0A 3QO9A 3EXYA 1V6HA 1JKHA 5A8RB 2NR0A 5EWEA 1H98A 2OHDA 3BQ2A 4NA3A 4OYOA 2IPOB 1XNRJ 1FCAA 3M1VB 3BYPA 2VQFJ 2BZ2A 2GGPB 4J91A 1L3VA 4KR0B 4KBIA 4URSA 3MPWA 5KFZA 3PEHA 3ETOA 4K8RA 3EJMA 3GV8B 3SCLE 2G0JA 2ZJQQ 4UY85 3HHKA 2BACA 4HACB 4NLOA 3VQTA 3NS5A 3QATA 2XLKA 1TK8A 1DTTA 3Q8PB 4DDFA 3UPFA 2DR8A 2FJXA 2UZAA 3MCNA 4HH0A 3U1NA 3IR5B 2G9OA 2JFDA 4FYVB 1RE1B 2RIJA 3PIPQ 4ZDNA 1HNIA 2EXUA 5GAGI 2AX0A 1OPIA 2NXUA 4TY9A 5JUMA 2XI2A 3UN3A 3P4UB 3CF5Q 3FCHA 4Z37A 5L1KA 2HG4A 4HHJA 1P9YA 2Z4PA 1LOUA 2XS7A 5F8NA 1ITPA 3OL9A 2WVEA 2IRUA 2CXEA 2WVDA 2ASDA 3CC4S 2CQ2A 2YWGA 2PE8A 4Q8FA 4OLOA 4J9KA 2FC8A 4OJ1A 1Q95G 1N32F 4UOGA 3HVAA 1S77D 2AGQA 3Q86A 4P73A 5D15A 3CCQS 2BQ3A 1SBRA 1LFWA 3GYNA 2HGNA 4ZVSB 1NDPA 3WIUA 4YY3F 3KG4A 1RT6B 4Y2CA 3OQ2A 2YKMA 1YVFA 1FFSB 3CC7S 3P3DA 4EI2A 3BH7B 2HNDB 3HVTA 3N0VA 2FUG9 3N6LA 4N41A 4ED8A 3IAS9 2RILA 1SJ3P 1LWCB 3PJWA 4HI1A 3B54A 2D7SA 1CS4B 4I2QA 2HQCA 4J90A 2ZWPA 1X4DA 3T1AA 3OT9A 4NLRA 2VZ9A 1R8HA 3KHLA 1X5PA 3GFZA 3LP0B 1S9GB 3JQMA 2ZD1B 1U1PA 5THWA 4WP9A 2IRYA 2XGPA 2DGOA 2B4VA 2D41A 3EYZA 4Y65A 4QIFA 3M6WA 3LAMA 4ZLPA 1SL2A 4M5MA 3BR9A 1NRKA 2M88A 2QZ8A 4USKA 3IR7B 4LR8A 4QU7A 2LU2A 3I82A 3SSQA 2HW3A 4JI3J 1ROFA 5LSRA 5KG0A 3EWGA 4B9SA 1JLCB 1S1VB 1ZTTA 1RAFB 2PI4A 4DUYF 4ECRA 3E3XA 2Q43A 2EBEA 4B3TF 3MOJB 4IUFA 4HHHA 4EUVA 4ILRA 5A8KB 3MXHP 1TU0B 4QOTA 4RW7A 4J9SA 3BYRA 4IG0A 2XMKA 1X0PA 1TL7B 1ZS6A 4DX8H 3PO4A 4ITSA 4MKVA 1M5HA 1CJUA 3FJ2A 4ZP8A 3KJFB 3BH6B 3MM8B 1S1TA 4R0EA 5E2QA 4JI2J 1YZ6A 3IWXA 1V9OA 4FKYA 5KFEA 2D74B 3O8WA 5EX0A 3JTNA 2CPYA 2C28A 2UUCF 4YS2A 5LL6d 1YJ7A 3OUYA 4O3NA 2YXLA 3IRWP 3EGZA 2BRKA 2VG6A 2UXDJ 4WU3A 2VU5A 1QD1A 2K8GA 2BYCA 2BKNA 3ZZRA 3CDEA 3U1LA 2JEJA 2WVBA 2CWKA 4LFBF 2CQBA 4UUXA 3P96A 4K2XA 2B9XA 2PMWA 5B0AA 3M05A 3CCRS 4RKUC 4A8KA 3FKBA 5H1SV 1DFDA 3J7YU 3V81B 1U0SA 3VAGA 2C3PA 5KFSA 3GZ7A 3V2UC 4XO0A 1LEOA 1S9EB 3PCOB 1KR4A 2BJEA 4B3SJ 3H4DA 3D6HB 3L9ZA 2O67A 4JV5F 4ETXA 4M94A 4O3SA 4AFFA 1UFWA 3PZPA 1SJ4P 1HD0A 1FK9B 4I4BA 2MXYA 3D3CJ 3GSIA 1Y4ZB 1IKYA 4N47A 1UEVA 1WORA 4ICLB 2HFUA 1VLYA 1G2EA 5IV3A 3G6YA 4MYUA 3OL8A 3TZYA 3UFCX 1REGX 1Q5VA 2UUAF 3B4MA 4DQRA 3RTVA 5CZXA 2IVMA 1R6YA 3M6UA 1BUXA 1NZ8A 2Z30B 2K3IA 3GB0A 5I3UA 4BWJA 1JLBB 3DCAA 3SCKE 2GNKA 4F4WA 2B5JB 2BRLA 2MLXA 1MU2A 5KG3A 3NXZA 4O3RA 1NPPA 3N9UC 4BWMA 5F8GA 3OTOF 1URNA 2GIQA 5B0DA 2KB2A 2UUBJ 2V8HA 2QYGA 1IN0A 4ECXA 4CLPA 5HATA 1VC0A 1RHRB 1T9YA 4LFCJ 2OGUA 1VHFA 4CM2A 2Z57B 1VIOA 3IBWA 2QSFA 2DITA 3W9IA 3KJVA 4QIWD 5SZTA 2ACYA 1X4HA 4DCPB 4DPWA 2XZWA 4DV4J 1M5VC 4WE1A 2EVZA 2I5JA 3O44A 3CJ8A 1X5TA 2MLZA 4ZPVR 2YPZA 4ZVOB 2AGPA 1DY3A 3EZUA 2BQUA 4CTAA 2CNOB 1JK9B 5IT9Y 1DJ0A 3WC2A 2VODA 7FD1A 5D0EA 5DG8A 1QJHA 2KYXA 2RS8A 2YKPA 4GC6A 4I6AA 1FO1A 2JSXA 3MR3A 4LQ9A 5GMEA 5DZ7A 4HDGA 1KLMB 3I5CA 5EN1A 1EIYB 5A0YB 3AQOA 2RQCA 3NEKA 4Y3CA 1UW4A 2WBMA 4X66F 4X62J 2LQBA 3K5NA 1QM9A 1RAAB 4X64J 5B08A 5J2NA 3PACA 4U95A 1BWVA 1VQ6S 3NOGA 3RRHA 5CCMA 4FYYB 2LXFA 2DGWA 1DQAA 3PJXA 4L74A 3QGHA 3LP2A 1SPBP 3FBFA 3RBEA 3H5XA 2MJNA 4YOEA 2F3JA 1S6OA 2AJ2A 3T5KA 4YMEA 1TV6A 4KYZA 3G8TA 1LK5A 2W7PA 2DGQA 1RLDA 4EGLA 1IKVB 1C0TB 4WBFA 2G2OA 4DR5J 1F3FA 2WBRA 2EG2A 1IBCB 3HSJA 1WG1A 2RRAA 1HQUA 4OZ0A 3V6HA 3RUBL 3KUEA 3MEGA 4DSKA 4NZ7A 2HBQB 4PPZA 3I4PA 2CPJA 2H51B 2MY8A 5HI7A 4I67A 1RT2B 4IOAQ 2MKHA 1U26A 3V4IB 2L08A 2OPSA 4F0KA 4LF4F 5B0BA 3H90A 1TP7A 3KHHA 3QIDA 4QYRA 1HI1A 4PEOA 2KN4A 4CLTA 4PG5A 3GIIA 2VA2A 2D3UA 3MM7B 1OIAA 3J80Y 1TKTA 3UR0A 3KDOA 2FHOB 5GADI 3DOLB 2JRSA 1DQ9A 5EHHA 4A8MP 2VQEJ 4IKAA 2IAJA 4FNIA 1VQOS 4P75A 1NJYA 3HZGA 2A1BA 2BANA 3CUNA 1KP6A 4L72B 2KT2A 1Q82T 4TNOA 4K4YA 2OPRB 3ZNJ1 1GH8A 1HWJA 5ETNA 2BDPA 2DNHA 1VOMA 4F2RA 1HARA 2QRRA 2DTJA 3KDNA 3PRBA 4LSLA 1TKXB 4ZKAA 5DZ6A 1UVKA 4Z2XA 1LW2B 3PFOA 3KK1B 3BB5A 1RAEB 1AB8A 1O5JA 4LBPA 4PYAA 3UVJB 3KWMA 4K4VA 1J5EF 4DJBA 1LW0B 1HWIA 2Y0SD 2WAQD 4B17A 4DFPA 2HLUA 2Z0GA 1X4FA 2ZC3A 2ZUGA 2CZ9A 1FX2A 2OTJS 3EGVA 5K14A 3RB0A 4FXDA 1NSQA 5HK4A 4NCBA 2ADBA 1PO6A 1L3UA 3I0RB 3KLHB 4G1QB 1ZETA 3PRDA 2BKPA 1YRXA 3K8WA 3SQGA 3A8KA 1S6UA 4X4UA 2WOMA 4KTQA 5IOLA 2XCAA 5DRKA 5BJRA 3EICA 3HFZB 1JXLA 3N01A 4W92B 2ZDOA 3DMJA 3OFGA 3SBMA 3W5XA 1ZM2A 4KH0B 1NSKL 2AJ4A 3A8IA 2C2MB 4AE5A 4ER8A 3TARA 1FVSA 4QQBA 2CQ1A 2HNYA 1F5BA 4O3PA 5MLCV 4DL4A 5LJ3Y 3H5UA 3CCZA 4J5OA 3BZQA 5A2QY 5C42B 3NCQA 4OIXA 4U8VA 5F3ZA 2XO6A 4NZ6A 3K0JA 1X4CA 1T9VA 2Y9HA 1C1CA 4K7QA 4NCGA 2PIIA 5CXTA 4DL7A 3GTYX 1WI8A 4PABA 2ZOGA 3H40A 2EG1A 4DR6J 4V19J 1F2HA 2HQFA 1PJ7A 1RU2A 2VJVA 3ILIA 1G1XA 1LFPA 2LP4A 3WZ0A 4IQMA 5C2CA 1SV5A 4OJHA 3LAKA 4ES3A 2L41A 3THPA 5HL7Q 4F7VA 1B0TA 2PC6A 5KFYA 2WW8A 1WEYA 2J8AA 3JSMA 4CQ1A 1FRJA 1B4SA 3ZO7A 1PGZA 1S12A 2DNLA 1HHTP 4OZ1A 1FVQA 4A8XA 4J37A 3I0SB 4AXJA 1HPZB 5D6GA 1JIHA 3QT6A 4H4MB 3SDEB 5LM7E 4OI6A 1FEHA 6AT1B 2W9AA 2RUSA 1NAQA 5M2RA 2OFGX 1T9WA 4XPCA 2G0CA 2D3ZA 4F3QA 5KFRA 3AOAA 2MZSA 4M63A 3R5JB 1KQGB 1JNZB 3D66A 4K4SA 3MCOA 4H54A 3AAWB 2VBWA 1JX4A 3R5AA 3UD4P 4Q5VA 1YJ9S 2FTRA 1HL6A 2UUTA 3KMSA 2APOA 1YI2S 3UQSA 1X5OA 4CLLA 2NREA 1NEEA 3HSDA 1Q7LB 5HJXA 3I96A 3DRSA 2G1DA 3M32A 3GJSB 2BXJA 3NWRA 3ENQA 1RXOB 2QC3A 5F8IA 2ASLA 1TK5A 4ZK7M 3AB2B 4HDHA 5HQ8A 4ED3A 1RHQB 3HHEA 1N48A 3QGGA 3MD1A 1S0OA 3HJVA 1QUVA 1RHUB 5GAHU 2FVRA 2GVZA 2CUYA 1Q7YT 3Q22A 3LA0A 1GT8A 1ZAXA 2Z2ZA 3GV5B 2AYMA 2UVRA 2JZ5A 2ZH5A 1S1XA 4NZ0A 1UPMB 2DGSA 5ETLA 1IKWB 4IDKB 1CJKA 3LO3A 1FRXA 4WFNQ 4OYBA 1DLOB 3G2XA 3VGTA 1RT1A 2DNYA 5LMUF 2J6SA 1IKXA 1DAXA 2L48A 4KGMA 4QWCA 2HIYA 3N6MA 4BBYA 4EBDA 1B0PA 5IWAJ 3RAQA 1NM2A 4NXMJ 1TUVA 3UN5A 4LRBA 2AP6A 3BDPA 4FYDA 2R8JA 4LSNA 3K5MA 3GYGA 1N54B 4G6VB 2UVUA 3QZ7A 2DO0A 3D0GE 4PUOB 4QWAA 2JFKA 2KT3A 2M9KA 1UVIA 4LIWA 2RU9A 1SKUB 4RW9A 3HD1A 3RYLA 3DYAB 4YB1P 2R7VA 1CQMA 2YTCA 2MKCA 3IS9A 3QLHA 3BR8A 3PX6A 1FD8A 5AJ3J 3AH6A 1XJWB 1U2RA 3N4WA 1FKAF 3ET6B 4YDXA 3THVA 1H74A 2GCFA 3N6NA 1FRLA 1KLNA 2CZVC 1X8DA 2MZRA 3SYZA 2LEPA 4PRFA 2QEXS 3JTPA 3O2IA 2ZEJA 4K4TA 3GFXA 2P9CA 2DXFA 4ZVUB 2AJ0A 2XO7A 4QIVA 2Q6BA 4DCOB 2PFDA 2K06A 3KK3B 1B64A 4C4WA 1VK8A 2VPXB 4MFBA 2DIUA 1VQMS 5J1EA 5HLFB 1TL3B 3DHWC 1YZ7A 4IG0B 4KRWA 2HWHA 5ETSA 3EVWA 4W4MA 5CYQA 3BPSP 2CA9A 4CLYA 5AE3A 2J7UA 3CDAA 2I0XA 1N4LA 5FDLB 4C2MA 2M5YA 5KFQA 5KOWA 1RWUA 4ENOA 1RJJA 1EAYC 2DNGA 4QPXA 1EZZB 5AXMA 1F9HA 2JLGA 3OXFA 5AT1B 3OUYB 4MT1A 2B9WA 3KNAA 1HNVB 2WSEC 2C2NA 2DHHA 4ZVEA 2DGXA 3ZZYA 4P2FA 2LMIA 3C16B 5DQHA 3M8RA 5C25B 1TUWA 2HHUA 2DB1A 3GILA 4ZN3A 5KFOA 3IN5A 4WIIA 1MW7A 2VG5B 4C8MA 2E1CA 1PCAA 1C1BB 2F9DA 3R9LA 2GO8A 4EZ9A 1VDHA 2RJZA 3ILOA 2UXBF 1HWLA 4EZ6A 4USMA 3Q8VA 1S9FA 4Y28C 2BR0A 4HLBA 2CVEA 1U0HB 7FDRA 1ZZNA 3H5SA 1S48A 2HGMA 1WD6A 2DRAA 2HWTA 3KLGB 2CJXB 4J9PA 1IVZA 3DU5A 4KO0B 4GKKF 3VGSA 1XR6A 3MFHA 1V5IB 4NMLA 4PXBA 3TUJC 4A8WA 4HTIA 1IXKA 3QQCD 2IFXA 1GEHA 1GFWB 5DQIA 3V6JA 3L09A 2FZKB 2QA4S 1QSYA 1HBUB 4OZLA 1IJEB 3HHLA 4CO2A 4MJKA 4WKYA 3GG0A 6FD1A 1ZA1B 1CVJA 5LJ5Y 4RW8A 2UV8G 3V5RA 4HEA9 4W98A 5DQGA 1MU2B 2F5GA 3JSBA 2W9BA 3W1YC 1T03B 4QWEA 1Q53A 4F3MA 4B02A 4YEAA 5CQGA 1Q79A 4DSIA 1IWAA 3JQKA 2R8KA 1S0MA 1IUJA 1WWHA 3QFWA 2DRBA 3D3BJ 4WYLA 3JB9k 3KJVB 2YWEA 5CD4H 4BCAA 1AUDA 3KYLA 3N5BA 1VISA 3LUYA 3MM9A 1B3TA 2V4JA 2R8GA 4WE1B 3C8YA 3O6QA 3DN9A 4R25A 3BF4A 3BO4A 1CJVB 2FQQB 4GMKA 3P45B 3BEGB 2DHSA 1HHQA 1IWGA 2HVZA 3CPWR 4NYPA 4ED2A 4UQGA 3I56S 4HR2A 2XNQA 3DLLQ 3R5BA 1JJHA 1KVKA 2V4RA 3ISZA 4CLSA 1NK8A 3GR0A 3CD0A 2K1RB 2HVEA 2ZH7A 1EETA 1HBNA 3U27A 2DR6A 3F73A 4QW9A 2BM0A 5C2GA 1U47A 1EQMA 3M8WA 3V6DB 3BSCA 2XSFA 3OTDA 3IRXB 3Q2TC 1YJUA 3VALA 2LECA 2E7VA 1FRMA 1T0TV 3QSYB 2NSBA 1ZAWA 5HJYA 4K50A 4Q43A 3QIPA 2C3OA 3E2EA 1VQ7S 4UTGA 1FXLA 5DLGA 2VFUA 4LREA 2CQ3A 3QNWB 2FC9A 3PYDA 4ANDA 4JBCA 2MZQA 2FY1A 4ZJOA 4CI0B 3A12A 3HHLD 4DX5A 4PQUB 5A6PA 2M3DA 4B3RF 2DYAA 4EK2A 1IR1A 3HCXA 3L7OA 1RAIB 1CSJA 4O44B 5HVFA 4C48A 2FPHX 2COLA 1YITS 1N34J 2ATLA 2I8EA 2HHHJ 2VB6A 4OZ3A 4LFAF 3MM6A 4OV6A 2CQCA 4YQWA 4FF4A 3C46A 2J6UA 2DJWA 9RUBA 4ETZA 2OPSB 4QU6A 1HNXJ 1U6FA 2NXNA 4KJIA 4X84A 4CLZA 3PW7A 4R5PA 1FDAA 4F4XA 5CCLA 4DV6J 4KSEB 1KFDA 2EFGA 1X9MA 3O5TB 3S7RA 3TA1A 3TX0A 1WHXA 3NGDA 2GAHC 2HLTA 2XZTB 5J2QB 4GKJJ 2B4PA 1P1TA 2IAJB 3IXQA 2K3KA 2HHVA 4DSFA 4OI4A 4WTYA 4AL7A 3Q8SB 1E6VB 4ID5B 1NBEB 5FLXY 2HQIA 2N7CA 2GVDA 1B7YB 4WP8A 4IRCA 2Y3YA 3HSGA 3IO1A 4UQTA 5HROB 5JVGQ 1UW9A 1GAOA 1J5OA 4RUBA 1W2IA 3K89A 2NLWA 5E33A 3CCVS 2KKHA 4OZJA 1RT7B 1WF0A 1E6YA 1EP4A 2F8MA 4LF7J 4LVNP 4I56A 1RUSA 4ZA1A 4DL0C 2X7IA 2BOPA 1UWBA 4X4OA 5KTQA 1BMQB 2FZGB 1SQGA 1FT8A 3GV7B 3IP0A 1IQTA 1HI0P 3W8PA 5KFGA 4H4OB 5LXYA 3LWMA 5J1NA 2NS1B 1V5VA 1G3OA 2XMTA 3JYTA 2UXDF 4F26A 4J9RA 2JHEA 3QWPA 5HBMB 5J2MB 4ZPBA 5KFJA 4R8UA 3MTJA 2R9LA 4ZVHA 3DM2B 1NDCA 3J7YI 2AKWB 4UF4A 3SI8A 5KOXA 3Q8QB 1YTYA 4NLTA 1Q5YA 4CWBA 2RKIB 4S0MA 5IQQA 4LBHA 3NCRA 3R2CJ 2KL8A 1VC6A 3KHRA 3T1HJ 2M4MA 5L1IA 1ZH5A 2H4YB 2JX2A 2YVSA 3DDNA 3W2WB 2HGLA 3DC2A 3MZIA 4BC7A 1GXTA 4KY3A 4Y34A 3IWNC 4F36A 2VOPA 2G2YA 2E66A 1XNQF 1C0UB 2O5DA 4C3LA 4DR4J 4X4PA 2YY3A 2F63A 1UEKA 3J7A1 4KV8A 1PBAA 2FLPA 2NPFA 1P9QC 2KU7A 3CJKB 5BR8F 1KOOA 2CQGA 3QZ8A 2KM8C 1Q8LA 2KJVA 3MEDA 4KH1B 1D09B 2DNQA 2C22A 1N8RT 5G0RB 1SUQA 3PR5B 2ASYA 3I4HX 2F4VJ 3DI6B 3B78A 2OEMA 4JI8J 2WW4A 2L9DA 4OYMA 4NXNF 5DG9A 1CJTB 4RBVA 3RB3A 2XM3A 1ZTWA 1ZPVA 2R3VA 3PYFA 4K5RA 5KFNA 4U7UK 2Q79A 4GVBA 3M2VA 3H4BA 3G86A 2DNMA 1QVFR 1S4FA 3DLKA 4U8YA 3TOQA 5KG5A 4HI2A 5F9NA 2CAJA 5ITHA 3C6TB 3CE8A 3A13A 4DPUA 2ZVSA 2D9OA 3VAKA 1FKPB 2QFJA 4LSZB 1AXQA 1QUPA 5E3PA 4ECQA 4FP9A 1FX4A 5BYQA 1PAEX 3MMCA 1ZM4A 1UKUA 4URQU 3NAIA 4B9MA 1YGYA 5D0RA 2HHWA 2B51A 1VLOA 3M9MB 1VQSA 4L73A 4LQ3A 5D77A 3DLGA 4AQYJ 3OFHA 5KFPA 2P6SA 1RTJA 3BGUA 4P71A 2PN6A 2XMAA 1M5SA 1H72C 4MH8A 3CDWA 2R7TA 4ZPTR 3ENVA 2W9CB 2QA1A 5D3GB 1T9TA 5DO2A 4ZHRA 5LMNF 1UA1A 1N5SA 3L4BC 2Y1JA 3DLEB 1QE1A 3KLIA 2RU3A 2YNFA 4DQSA 4IRDA 1JLEB 4X62F 1S79A 2HK2A 2HK3A 4YB6A 5KFIA 4AL5A 1NB2A 1YK9A 4DWIA 4DG1B 4CZCA 3TYTA 5GAEI 4LF8J 4TY8B 4M5IA 4BHQA 3OR2A 2EPIA 1SKWA 1RT5B 1YDLA 2V94A 1TKZB 2XYGB 1Q0NA 1I3OB 4AL6A 1RTIA 3TI0A 1D1UA 3D0HE 1PYOB 3CJ2A 3PY8A 1FEEA 2AYBA 1KC8T 4B3OB 1ELOA 4OHXA 4DV5J 2GV1A 4JI4J 3LPYA 1NKBA 4DUTA 1C4CA 2UVWA 4DR7J 3TUPA 2NXCA 4Z7YA 4Q2LA 2I1RA 3Q2SC 2BABA 1FXRA 1RAHB 4H4KA 4RNHA 2B9EA 1VBXA 3OSPA 4DUZJ 2VOOA 5J2PA 3I55S 2KZMA 1RA6A 1IBLJ 2B8PA 2POKA 6FDRA 1R0CB 1JJCB 5BXIA 2Y8YA 1G7CB 1U4BA 3W60A 1WF1A 1K0TA 2N4CA 2CJBA 2N3LA 2QGFB 1KD1T 3VZIA 2CVIA 1W2BR 4NRTA 1CPZA 5KG2A 1MMDA 4A46A 3CD7A 4OX6A 1YX2A 4AXIA 5RUBA 4L76A 1Q78A 2XLIA 3FRYA 1XMOJ 2H54B 1UWAA 2XB2D 2H4WB 1NSPA 4O4GB 4RW6A 1TFYA 4JI5J 4XDCA 2DHGA 3M30A 4C8KA 1REVB 3ZTSA 2J9DA 2ZVIA 1VJWA 4OI0A 2R2TA 3KXDA 2XG8A 2F4FA 3FCVA 2XWXA 4MFBB 1Q86T 2FJEB 2CNKB 2RMLA 3T5JA 4F4YA 1HQEB 1NK9A 3NBPB 4RW4A 2R7XA 3HLUA 1T94A 2YKNB 2W4CA 4PXDA 2DCLA 2J9CA 5EX3A 3C14A 1M5PC 3LTOA 2RF2B 1UAWA 3DRRB 5E41A 2V8GA 1FHTA 3MECA 2W2QP 2JWNA 3NS7B 1PYSB 2H48B 5T14A 4EEYA 1EQ0A 4DR1J 3LGHA 2LXUA 4H4KC 2LEBA 3JSYA 2ABYA 4NI2A 1KTVA 3HP6A 1LWFB 4EYHB 3R5CA 4DV3J 5D8HB 3GIRA 1N5YB 2OTLS 3R6LB 5I42A 3C15A 5ETQA 2HFVA 4RO0A 1WOSA 1U1RA 1Y5IB 3M2RA 1PIEA 1Y10A 2NQPA 4ZJQA 3UDEA 5BYRA 3AXMA 3TX8A 5KFDA 2J0QD 2O66A 2E1MC 2GQ2A 2ROPA 1MROA 4A8OA 1OJ4A 1DTQB 1OO0B 5HMYA 2W2PP 1WTFA 2MKSA 2R7SA 1NKCA 1F9EB 3MWBA 1RBOB 1N6QA 1RLCL 4WZMA 2LQ5A 3TVZA 4JYAJ 2MGZB 4KAIA 2XMVA 1KWMA 5HP1B 2CQPA 1WC1A 1TL1A 4OZ2A 2EC0A 1KKHA 1NUEA 3C66A 4HT7A 2EKNA 3BKTA 1L5UA 1N36F 2XSJA 4DR6F 3MMBA 2V5HG 2ALYB 2RRNA 2Z56B 1MWQA 4LF9F 3IG1A 4FVCA 4JI0J 3K58A 4DCJB 4ECYA 2VDHA 2V2ZA 4A8QA 2Z2LA 4DXLA 3IM8A 3G82B 3NS6A 4C8NA 1SQFA 2ILYA 2CIMA 5KT5A 1OY6A 2W7OA 4RW8B 4WK1A 2WONA 3RB6A 3B82A 3FC9A 2EFPA 1WKLA 2HBZB 2QJ3A 1WHWA 3C19A 1Z1ZA 3CO9A 2OJ3A 3OV7A 1HMVA 2XYPB 3KLEA 5KFLA 4ZIWA 1S1UA 3BQ1A 1R0AB 1T11A 4OLPA 2P5VA 4L3NA 3MUVP 3Q24A 2I2YA 3HFKA 5IXUA 3OSNA 4OMFG 4UW2A 1QAYA 4U96A 2UP1A 2GA7A 1S0NA 2EI5A 4ID8A 2HNZA 4IH6A 3MMAA 2AW0A 4IR9A 2E5GA 4ED5A 2B6AA 4ELTA 3HT3A 3VAHA 2CG8A 4ZPDA 1NMEB 1VC5A 2A6MA 1N88A 5J1PA 2IC3A 4U7UD 2HS3A 3OXGA 2A0FB 3MR6A 3GYXB 1NPRA 2OH2A 3R8YA 2KZZA 5M2PA 2Z2MA 3W9HA 1Y5LB 2IIHA 2YPYA 1NNDA 3V6KA 2BEFA 3VGVA 1FWLA 5GAHI 4F4ZA 2XY5A 1YKWA 3HX9A 2GQCA 4TQRA 3CNQP 2MKYA 5KFTA 3O1LA 2FGCA 5HMWA 2VF3A 3KG1A 2PSZA 2WRMA 5C24A 4DV2F 4WJBA 4OX9F 4C7QA 5KFMA 2YNHB 3OVBA 2VD3A 1ZYQA 2VBZA 5LSOA 2C3MA 2DNPA 4OJ3A 1TZ0A 2PA8D 4TVAB 5F3TA 3KK2B 1VRTA 1YRTA 3BDEA 1FKOA 3EVMA 3TJAA 4EMDA 1R89A 3UR3C 2E9ZA 3QIPB 3ZTRA 2OFHX 4DR2J 4L3KA 4IFVB 4AD6A 4E8UA 3LP1A 3ZXWA 8RUCA 1ZZFA 4CRJA 4Q2MA 2D9PA 5CA5A 3OBIA 2BOAA 3W64A 1LK7A 4NXMF 3MAHA 1P27B 4NL5A 2C2EA 1U1NA 2Y1IA 3RBXA 3TANA 3AD7C 4NLGA 2G0IA 1RKJA 5DG7A 3CC2S 1WF2A 3DRPB 1B70B 3IBFB 1X7VA 2QE5A 2MZJA 4RLEA 3OPKA 2M70A 1HHSA 2PA3A 4QZVB 1XEZA 2ROGA 3VAJA 3MCMA 4DUYJ 1DRZA 2E1RA 3RBZA 2HFNA 1S72S 2M2BA 3KLFA 4LMZA 1OYDA 4USWA 3PKMA 1AT1B 2FLNA 1FF2A 2B56A 4IH5A 1Q8BA 1R43A 5CH7B 4Y2MA 1RQ0A 2IM3A 4Y00A 3I32A 5H9EK 3GFYA 4MIBA 1GMVA 1Z4UA 2KM8B 4TKTA 4B9NA 4PXEA 3ITHA 4WXWA 2UUCJ 1QTNB 4ZVPB 1SQEA 2E5LF 4DU8A 3NKYA 4M5DA 4NX9A 2GHPA 2ZWOA 2J6TA 4DF4A 3GFHA 3H2UB 1BWEA 3FFIB 3BKFA 1J5OB 2L9WA 3QSIA 3R7BB 3KUGA 2XHWA 4ILLA 4ZS6A 1E6YB 1R8AA 3K17A 2CADA 3KKFA 4C0BA 4O0IA 3CIZA 3CCTA 4NLSA 4KIAA 2YX1A 4OI3A 2JLEA 2CQDA 1YIJS 2O3DA 3E01A 3A3OB 1ACMB 2VG7B 1RT4B 2KRBA 1S6QA 4DX7A 1LWEA 2CWXA 1D8ZA 3AOBA 4QWBA 2AGOA 1PYTA 3QT7A 4NRUA 4Q45A 4R8UB 3BO3A 1YWXA 2RRBA 3FSXA 4JV5J 3T9NA 1SH2A 2ZITA 2DRDA 2NXJA 3PIOQ 3D4JA 3EGNA 3RJMB 2W2MP 4KKOA 2Z8QA 4FF1A 2AJ1A 2F8EX 4QR0A 2UUAJ 4Y0FA 2LYVA 3TAMB 4X4NA 2UXCJ 1JNRB 3C6UB 1BQNA 2H9ZA 3DNCA 4W90B 2YNIA 3D1HA 2OLWA 3JQJA 2AEJA 3GIJA 1DARA 2XYHB 5KFXA 3D54A 3CJ5A 4LUBA 3UNGC 3ZZOA 1Y3KA 1IBMJ 4AT1B 1JMTA 1C4AA 2BVZA 2E7WA 2MY7A 5A8RA 4NASA 3OTOJ 1YJRA 2DKOB 2ZBQA 4LRFA 1C2PA 2DR7A 5L9NA 1TL5A 2X1BA 2KO1A 3M6VA 3M1VA 1S49A 2GGPA 3EE3A 1NK4A 3NMRA 5HAOA 1CULB 5IM0B 2HHXA 2VFSA 5E3AA 4OL8A 1PSDA 4GVBB 3M2VB 2EKYA 4HACA 2AV5A 1Y9OA 2ZH6A 4ZP7A 3ILJA 4I2PB 1DBDA 4DFKA 2RHSB 2ZDPA 1K8AT 3GR1A 5KG1A 3HHNB 3PYGA 4GRSA 2FZCB 1R3NA 3R5DA 4NLQA 1IJFB 5KFVA 3AJDA 3J7ZT 5IS2A 3H7HB 2DEJA
chains in the Genus database with same CATH topology
2JEIA 3K5OA 3WX4A 2DNGA 4I7FB 4TLQA 4QPXA 5AXMA 4DL3A 4KB7A 3T6JA 2HNYB 4KQZA 2JLGA 1WG5A 3OXFA 4NWBA 3OUYB 2D3OR 2DGUA 4DS4A 2B9WA 2HZCA 3M8PB 2PFFB 3KNAA 1HNVB 2WSEC 3PW2A 1K9MT 4ZVEA 2DGXA 4B9LA 4LF6F 3ZZYA 5HROA 5CZVA 4XIUA 3BQ0A 1RK8A 2OMOA 4PWDA 3K7RA 1VS3A 3MEEA 4B3SF 2GC8A 2LMIA 5JVHQ 1VRUB 3U7JA 5DQHA 4P2SA 4WK3A 3M8RA 3EZ5A 1ZAVA 5C25B 3UCZP 2HMIA 2HHUA 1VFJA 2DB1A 3W2VA 4QIEA 1RT7A 3GILA 2DNNA 3NG8A 3SCJE 3CEDA 2BE2A 5KFOA 3IN5A 1FJGF 5A8WA 3NMAA 4WIIA 1BQMA 2YWFA 1MW7A 1LQ9A 2YKAA 1H3DA 5C24B 1C1CB 2EW9A 2VG5B 3H5YA 2DHXA 4C8MA 1O0PA 1OSCA 3PNIA 2E1CA 1HW8A 4NCGB 1UETA 4EFAC 2JEGA 3CXCR 3NLCA 4NA1A 4EWTA 1C1BB 4ALZA 2F9DA 3MM5B 2VKRA 3PW0A 2GO8A 1FERA 4NLUA 4H4OA 3MD3A 4OI2A 5H9FJ 1QVGR 4EZ9A 4ZCLA 4RWXA 3ULHA 2CG4A 1NK6A 1P6TA 2RJZA 2CPHA 2GX8A 1RTHA 2LLZA 3MHYA 1CLFA 2UXBF 4ES1A 5G4DA 1HWLA 3S6EA 4EZ6A 1F0XA 1VRTB 2CQIA 3HXMA 2PD1A 2VFRA 1S9FA 4Y28C 2BR0A 3DGPA 4ILMA 2ZOFA 5HBMA 4ECTA 1S99A 4HLBA 5J2MA 1FKOB 1KQSR 4B9TA 4K4UA 4K4WA 4RU9A 3WBZA 3DM2A 2CVEA 1ZZNA 7FDRA 3MPVA 3ZZZA 1T7PA 3W3SA 3H5SA 4C3KA 1NH8A 1S48A 2HGMA 3CGIA 1RT6A 1WD6A 3SSRA 1SV5B 4C97A 1CG2A 3RR7A 2DRAA 2HHQA 1U1OA 3CMES 1WEXA 4CH7A 1AROP 3VTIA 2YNGB 2LCWA 4QIGA 2P9GA 1ZM9A 3CDBA 3OLBA 1S6PA 4UOCA 3BGRB 2Q3PA 2JLFA 2RKIA 2HNDA 1WI6A 2HWTA 3LP1B 5E3QA 3X3UA 3KLGB 4JI7F 3S1TA 2PGCA 2X3GA 2EWHA 4J9PA 3DU5A 4XK8C 2W8KA 4KO0B 2AU0A 4PG4A 4DR7F 3JSMB 2UV8A 4GKKF 5F8JA 2LA6A 1LWCA 3POTA 3W7BA 1TVRA 1XR6A 1UP1A 3MFHA 3HVWA 3M2UA 3RR8A 4NMLA 4PXBA 1HBOB 3TUJC 3ZZUA 3QJLA 4A8WA 2MZTA 4HTIA 4J9OA 2UUBF 1IXKA 2IFXA 3W2WA 2LQ9A 2VONA 3MF5A 2GMHA 5DQIA 1NK5A 4KGKA 3V6JA 2OD6A 4DUZF 4DL2A 3L09A 4TU9A 1MSWD 2QA4S 1FA0A 1IBLF 2DISA 2NZ4A 2YH1A 1JWWA 4Q8EA 2NPIA 1QSYA 4IH7A 2YX7A 4LFCF 1T95A 2UUWA 1HBUB 4FF2A 4OZLA 1C0UA 4M8LA 4OFZA 1IJEB 3LP0A 4MTPA 3HHLA 3AJ1A 1GQEA 1M5KC 3AQPA 5KT4A 1S9GA 1SJFA 4LF5F 4CO2A 4MJKA 1JLQB 4RBTA 1JLGB 4WKYA 1G6BA 3GG0A 6FD1A 3LOUA 2IRXA 3JB9k 4C0HA 3HKWA 4TQSA 3FZ2A 1T3NA 1CVJA 4IRKA 5LJ5Y 4RW8A 1N5VA 2VBXA 2DT9A 2UV8G 3V5RA 3CJKA 4ECUA 4B08A 2KRRA 4ES2A 3H8YA 2XY6A 3I87A 4ZOSA 4HEA9 3SXLA 1LW2A 3ONQA 3N5FA 3MGJA 3KK1A 4FS1A 3NNCA 4DV4F 5DM7Q 1J2VA 3SEOA 5DQGA 2IMOA 5EUHA 1MU2B 1SJQA 3JSBA 2ZH8A 1B7FA 2UVVA 2V9KA 3WDOA 2HVHA 4CO4A 2GJIA 2W9BA 3CSKA 1SIWB 3CCSS 2HHSA 3RW7A 3PDNA 1H0HB 5G0RA 3M8SA 1FDBA 1T03B 3P49B 4E98A 3N28A 2V0NA 1QTMA 4QWEA 2XULA 1M1KT 1Q53A 3C3LA 3FQKA 1HFEL 4U9RA 1XMOF 4F3MA 4Q0BB 4B02A 4DV0F 2YKOA 4YEAA 5CQGA 3PW4A 1Q79A 3AB4B 3G8SA 1OQ3A 4MKAA 3JSRA 4DSIA 2CPFA 2CKWA 1T05B 3DI6A 1NB7A 2R8KA 4RUHA 2KDOA 2HHHF 2R2UA 1U45A 3NAHA 2AD9A 1S0MA 1RYRA 4JI5F 1IUJA 3I31A 4ZP6A 3G9CA 1JLCA 4CO3A 1BLUA 1WWHA 2J7WA 2ZJRQ 3OTEA 1S1VA 1UFLA 1S7HA 2NSCA 1V3RA 4D3GA 3ITHB 2DRBA 4CNYA 1U2FA 3DRSB 3M32B 3I6PA 2W4PA 1HNXF 1JJ4A 3H2VE 5LXRA 4WYLA 2IYIA 4M5DB 4QCLA 2J7KA 1A7GE 3K59A 3KJVB 3DXBA 5DDQC 2YWEA 2YWHA 4BCAA 5KG7A 5CD4H 4J9NA 1AUDA 1KN6A 5L8RC 4DV6F 2MMYA 2AX1A 1XTZA 3KYLA 3N5BA 3LUYA 3OVSA 1UVMA 3T5HA 3MM9A 4PXCA 1JLFB 2XWYA 3M4XA 5K5MA 4C98A 1T8EA 2V4JA 5A8KA 3R1HA 2FJWA 3D5MA 3PW5A 3CCLS 2CJQA 1FJCA 1TKDA 2R8GA 4WE1B 1VBYA 3GMGA 2W4DA 3C8YA 1KHVA 3O6QA 4IOBA 2AWZA 2HFOA 4X64F 3DN9A 1OS5A 4R25A 3C6TA 3H20A 3VF0B 2F7VA 3BF4A 3BO4A 4ZCKA 4YUDA 1YG0A 1S1WA 4GMKA 1X4BA 3BEGB 2DHSA 1ZPWX 2K7JA 3BN7A 5HN0A 2HVZA 3CPWR 3OR1A 4NYPA 4TN2A 4ED2A 1IR0A 3MM8A 1FKPA 5F8LA 2DH7A 4UQGA 4NA2A 3I56S 3HZEA 2XNQA 3DLLQ 4OI1A 1XMBA 4RNOA 3E01B 4PQAA 5B7WA 1SL0A 3R5BA 3QWUA 1JJHA 2V4RA 4EBCA 1K0VA 2KFZA 2E44A 3LALA 4J9QA 1S6QB 2RE1A 1LWEB 3CJ3A 3ISZA 1KQFB 2VPYB 3M30B 3IAM9 2ZH3A 1S1XB 3BM7A 4I68A 4Y2AA 1CC7A 2LQJA 1U6ZA 1NK8A 2OD4A 3GR0A 5C42A 5KG4A 4ECWA 4O4RA 3CD0A 2R4FA 1NHVA 2HRYA 2K1RB 3D0IE 4PWUA 5F0UA 4ED1A 3U1MA 1RT1B 4DR1F 2O1PA 3D1QA 4ZP9A 2ZH7A 1GNKA 3OHAA 4RUAA 1EETA 1HBNA 3T3FA 5T41A 3U27A 4DR5F 2YH0A 1PC5A 1HW9A 1IKXB 3F73A 4QW9A 3ICLA 1LKZA 2OPQB 4NYZA 5K8MA 1RT3A 2DPJA 1VI7A 2BM0A 2RH3A 1HYSA 2C3UA 1U47A 4DV3F 4F67A 2ZZNA 2W9CA 5D3GA 3DLJA 2ZFHA 5U47A 3V6DB 2BQRA 3GIKA 4RWWA 3PXGa 1WHVA 1V3ZA 5KFBA 3M8QA 3SV4A 3BSCA 1WEZA 3FDSA 1SI9A 2HS0A 2XSFA 5JJBA 2R7RA 3OTDA 4UUWA 1JB0C 3IRXB 3Q2TC 1YJUA 1WNEA 4GO5X 3VALA 5KAKA 3DXSX 2LECA 4CNZA 3V81A 1KHWA 4OHZA 2AQ4A 1FRMA 3KTQA 3I9V9 5AXLA 2NSBA 4LSNB 1ZAWA 4KKOB 4ECZA 4DHVA 4DS5A 2CRLA 2A2DA 3MUTP 3H2LA 1A9NB 3VWSA 1RA7A 2B4UA 2KXHA 1UMJA 3MCSA 4K50A 3DLEA 1S9EA 1Z2LA 3KLVA 2ZZMA 4IG3A 1JLAB 1BQNB 4Q43A 2XMJA 2LA4A 1JLEA 2EFQA 2DGVA 2YNIB 2HHPA 4O23A 3RBDA 3QIPA 3OTBA 1HWKA 2C3OA 3E2EA 1VQ9S 1VQ7S 4USHA 1UEUA 1FXLA 5DLGA 4KHPF 1X4GA 2U2FA 1R7IA 2VFUA 5CYMB 5D4LA 4F50A 3HPOA 2N4DA 4OX7A 2JC0A 2CQ3A 2FC9A 4OHWA 3AA8A 2ZE2A 4DG1A 1FK9A 2Q1LA 3VQSA 4JYAF 4JBCA 1HD1A 2LXIA 2MQNA 2MZQA 5F41A 2FY1A 4RW9B 4WYWA 1ZBTA 2XCPA 3P6YC 4CI0B 4JV0A 1SKSA 3QO9A 4DFJA 4TY8A 2B7CB 2YKQA 3EXYA 3HHLD 3IS9B 3QLHB 5A6PA 1V6HA 1JKHA 2M3DA 1ZOTA 4B3RF 5A8RB 2NR0A 4ICLA 3U02A 1GXLA 2QYCA 2PI5A 1RT5A 1H6KX 3L7OA 4D3HA 5EWEA 1H98A 1CSJA 4DR3F 4O44B 4WF9Q 4QWDA 2P9EA 1TKZA 3V4MA 4Y2KA 3BQ2A 2FPHX 5F8HA 1TQLA 2VQEF 4NA3A 5I4MA 3BGLA 2L9NA 2COLA 3TP2A 2FHJA 4TXSA 3F44A 1YITS 2ATLA 2I8EA 2VB6A 1N5TA 4LFAF 3MM6A 4IFYB 2CQCA 2HQ3A 2MQQA 4YQWA 2O01C 1MROB 4FF4A 1FCAA 3C46A 3M1VB 2J6UA 4N5SA 2DJWA 1D3WA 2BZ2A 2GGPB 4ETZA 1QAIA 2OPSB 3DOKB 3FMBA 4QU6A 1L3VA 1K1SA 2VPZB 4QYZJ 4KR0B 4B3OA 1U6FA 4F3OA 2R8HA 4X84A 4KJIA 4KBIA 3PW7A 2F8HA 4R5PA 1JLBA 1FDAA 3OVAA 5I3QA 4URSA 4F4XA 2OPPB 1P8GA 2B0GA 3MPWA 1VMBA 2LKZA 1NH7A 5B0EA 5KFZA 5CCLA 2ASJA 4KSEB 3PEHA 1KFDA 3ETOA 2EFGA 3GQCA 4RUCA 1X9MA 2B5JA 3O5TB 3A1YG 2EK1A 3S7RA 1RTDA 3MPYA 3TA1A 2MJUA 3GV8B 3SCLE 4QBUA 3H98A 5J1EB 2ZJQQ 5KFFA 5EWFA 1WHXA 3F56A 3NGDA 4UY85 1FTCA 4FF3A 3HHKA 2HLTA 2BACA 1U1MA 4NLOA 2HPUA 3VQTA 3NS5A 4ED6A 1U09A 3SZ2A 2XLKA 1TK8A 1H2VZ 2W7AA 5J2QB 1DTTA 3Q8PB 4OZ5A 4DDFA 4FBTA 1M90T 1N5QA 3UW1A 2MHEA 5T7LA 3UPFA 4DLEA 2B4PA 2MQPA 2DR8A 4ERDA 3FEYB 2FJXA 1P1TA 2UZAA 2IAJB 3IXQA 1MMNA 5CYQB 2K3KA 3CT9A 4HH0A 3U1NA 4N56A 5MAOA 2PT0A 3IR5B 3WC0A 5DM6Q 2U1AA 2G9OA 5E3RA 5KFCA 4OI4A 2JFDA 4DSFA 4C9DA 2HHVA 3TVKA 1URRA 4TU7A 2WSFC 2CJKA 4WTYA 4AL7A 2RIJA 1VQYA 3Q8SB 3PIPQ 4ZDNA 1E6VB 1HNIA 4ID5B 5GAGI 2DR5A 2AX0A 4X4TA 1OPIA 5FLXY 2YX4A 2HQIA 2J9DE 2N7CA 2B7BB 2NXUA 4TY9A 5JUMA 2XI2A 2QLWA 4DSJA 4IRCA 4PR6A 3CF5Q 4PQUB 2BJDA 3PO5A 3CCWA 4FN5A 3FCHA 4Z37A 4DL6A 3IO1A 4UQTA 5L1KA 5HROB 5JVGQ 1KFSA 1GAOA 1J5OA 4HVZA 3D2WA 4PWDB 1W2IA 2NLWA 5E33A 2HG4A 3MEEB 1O8BA 1NJZA 3CCVS 4HHJA 2KKHA 3CMAS 2HMIB 2Z4PA 1LOUA 2WK4A 2XS7A 4OZJA 3OHBA 1RT7B 2KXFA 5F8NA 4M95A 1WF0A 1E6YA 1EP4A 2F8MA 2BE2B 3OL9A 5A8WB 4LVNP 4I56A 4ZA1A 4DL0C 2B43A 2BOPA 1UWBA 4O4GA 3KLEB 2IRUA 4X4OA 3QAUA 5KTQA 2SXLA 1FT8A 1U6BA 2VL1A 3GV7B 2ZOMA 2ASDA 2ALZA 3CC4S 1IQTA 1HI0P 3S8SA 5KFGA 4TYBA 4H4OB 2CQ2A 2YWGA 2PE8A 4Q8FA 4OLOA 5LXYA 1WACA 4J9KA 3LWMA 1REVA 2FC8A 4OJ1A 5J1NA 1N32F 1KLMA 5SUHA 2C2DA 3H25A 2NS1B 3HVAA 1S77D 1G3OA 2AGQA 2XMTA 5A0YA 3JYTA 2UXDF 4F26A 4RNFA 4J9RA 3CTRA 3CCQS 5H9EJ 2BQ3A 2HNZB 1SBRA 4ECVA 2JHEA 3QWPA 2DH8A 5HBMB 1M0SA 1LFWA 3GYNA 4ZPBA 2HGNA 3MTJA 4R8UA 5J2MB 5KFJA 2R9LA 5DJBA 1X4EA 4ZVHA 2DNOA 3DM2B 1HA1A 3J7YI 1HQEA 4YY3F 3TO8A 3SI8A 3KG4A 1RT6B 3IGVA 5KOXA 3HVRA 1YQHA 4Y2CA 3OQ2A 3Q8RB 5A6WA 2VUGA 2YKMA 3NBPA 3Q8QB 1YVFA 3P3DA 1YTYA 3CC7S 1IBKF 2HHTA 4TU8A 1S6PB 4NLTA 2BV3A 1SKRA 1Q4RA 2RKIB 2HNDB 3HVTA 3L95X 2QIFA 3N0VA 2FUG9 2JOQA 2YKNA 5IQQA 3NCRA 3N6LA 2DD8S 4N41A 1VC6A 4WXOA 3R1LA 4ED8A 2YWKA 3KHRA 3HM9A 2ILZA 3IAS9 4USIA 2M4MA 2IJNA 2NYIA 5L1IA 2RILA 1SJ3P 1LWCB 2DHAA 1TVRB 3M2UB 1ZH5A 4A8FA 2JX2A 3PJWA 4HI1A 2RF2A 5KFKA 2KVIA 3DRRA 2D7SA 2YVSA 2B4OA 4I2QA 4HT5A 3DDNA 3W2WB 2HGLA 1X4DA 3DC2A 2KFYA 3MZIA 4BC7A 3T1AA 2VV5A 2LU1A 2RS2A 4JUZA 1GXTA 2QA2A 4NLRA 4Y34A 3JAMY 3IWNC 2VOPA 1HBMB 1U8SA 2VZ9A 1R8HA 3KHLA 3DU6A 1RYSA 5K8PA 1RDRA 3ZZTA 1H2TZ 2IM1A 1X5PA 2E66A 1XNQF 3GFZA 1C0UB 2XNRA 1IKVA 1C0TA 2GJ2A 3LP0B 3HHLB 5FJ4A 1N0VC 1F5CA 2O5DA 3BREA 1QSSA 4OHYA 1JXEA 1S9GB 4C3LA 2ZD1B 1U1PA 4X4PA 2YY3A 5THWA 3H59A 4IR1A 2IRYA 3GIMA 2XGPA 1LWFA 2DGOA 2B4VA 3J7A1 4KV8A 4B9UA 3F41A 5KT3A 2FJVA 2A3JA 3RAXA 4DSLA 2D41A 1RISA 3EYZA 2NPFA 1P9QC 2KU7A 2FLPA 3CJKB 4Y65A 1N5YA 4QIFA 1FDNA 3M6WA 3FSIA 2FHJD 3LAMA 1NJIT 5BR8F 1KOOA 2CQGA 4ZLPA 1XMQF 3QZ8A 5LSLA 3HO1A 2KM8C 4JI1F 4ZCIA 1SL2A 4RNNA 4DQQA 2Q66A 1Q8LA 1NRKA 2KJVA 2M88A 3BR9A 2MQOA 3MEDA 2QZ8A 2RQMA 1D0EA 4LF8F 1APSA 3RB4A 3IR7B 5AE1A 1S10A 2MKIA 2DNQA 2C22A 2W9BB 1MWYA 4U6PA 1N8RT 4QU7A 5G0RB 2DIVA 1SUQA 3EX7B 4WZQA 3UCGA 2WHOA 2LU2A 3MEKA 3I82A 2GHWA 1RT2A 3SSQA 3CB4A 3PR5B 1BY9A 2EFOA 4MK8A 2HW3A 3CULA 2ASYA 3I4HX 3V4IA 2W8LA 1DTQA 3DI6B 3B78A 1YBAA 1ROFA