2RH3A

Crystal structure of plasmid ptic58 virc2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
Knots found
sequence length
121
structure length
121
Chain Sequence
IQVFLSARPPAPEVSKIYDNLILQYSPSKSLQMILRRALGDFENMLADGSFRAAPKSYPIPHTAFEKSIIVQTSRMFPVSLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKATNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein virC2
publication title Agrobacterium tumefaciens VirC2 enhances T-DNA transfer and virulence through its C-terminal ribbon-helix-helix DNA-binding fold
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Dna binding protein
total genus 36
structure length 121
sequence length 121
other databases KnotProt 2.0: K -31
ec nomenclature
pdb deposition date 2007-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1760 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rh3A00
2RH3A
chains in the Genus database with same CATH superfamily
3FSYA 3CDAA 3HMJG 4WKRA 1RYRA 1B7YB 1H38A 4K4TA 2CVIA 4HTIA 3PYFA 3D1HA 4KJIA 3M6WA 5IXUA 3MMCB 2DY1A 2IDEA 2G0JA 4AL7A 4Q8EA 3MPVA 1KBRA 3DN9A 1SKWA 4PEOA 2EC2A 1EKSA 1XMBA 1FWPA 2U2FA 2ILYA 3CCJS 5H9FJ 2DXFA 5KT3A 1F0XA 1EP4A 1X5SA 3PW0A 4R25A 2KI2A 5J2PB 2LDYA 4CLWA 1LXNA 2VONA 2VFVA 2OELA 2CWXA 1HWIA 5EN1A 5GMEA 4ZOSA 2H54B 5ITHA 1MMDA 2NXJA 3DLGB 3J81U 4FXDA 4IQMA 3QLHB 1NNDA 4C8NA 1HYSB 1K73T 3LP0B 4B9UA 3FZ2A 3D2WA 2AEFA 3AT1B 3IAM9 1FRXA 1S1VB 2WB4A 2GW8A 4DMZA 4CIOA 4JV5J 2D3O1 4J9PA 3PY8A 2RU9A 3OLAA 1NK9A 4IDKB 2IYGA 1JJ4A 1SC4B 4IFYA 2OMLA 1Q1KA 4X66F 1ZH5A 4EGLA 3A8EA 2CQBA 3MM8A 1U1PA 2ZHOA 1U48A 1IVZA 1OY8A 2ZWOA 1HI0P 2YNIA 2ZBIA 3FSIA 2DGQA 1UVKA 2FLLA 2K3KA 4LREA 3L7OA 1S6QA 2R2UA 4LMZA 4OLPA 3AFGA 4MYTA 1Q8IA 3HK2A 4DU8A 1WHWA 2KXNB 2JEIA 1RT7B 2H48B 2J9DE 4TY8A 2XYGB 4ZPCA 3IG1A 1VQKS 4TYAA 5I3UB 2B6AA 5JXSA 5D4PA 2MLYA 3EPIA 4CLYA 1WOOA 3QYYA 2DH8A 3LTOA 5KOWA 2IJNA 3CJKA 4RW4B 2LQ8A 1HBUA 1F5CA 1J5OB 3D1OA 5HSPA 3MR6A 5KT5A 4P2MA 3PHTA 2D7SA 1Y11A 3J81j 4CLSA 1OSCA 2IAJB 3M8PB 2FGCA 2MHEA 1H98A 4WZQA 2CPHA 2GVZA 1DLOA 4MK7A 2JC0A 1X60A 4IKAA 3BPSP 1CULA 2V34A 4LR8A 1QSSA 2NLWA 3ZZ0A 2NZCA 2DH7A 2EFQA 4DG1B 3FKBA 3DFEA 2VG5B 1Y0HA 5CH7B 5D4OA 3W62A 1X0FA 1SXLA 5HJXA 4F4WA 5BYRA 2I0XA 2CQHA 5GVQA 1HNZJ 2YPYA 4B3OB 1NDPA 4X64F 2XYHB 1Q8KA 2ZOGA 1EJ7L 1DQAA 4U7UK 5B0EA 1C1CA 5KT4A 4FS1A 5K8MA 1HQUA 2Q43A 4LBPA 2VQEJ 4NX9A 2J6SA 3HHKA 5H9EJ 3OR1A 2V63A 2YKQA 1TUGB 3GIJA 1B7FA 3MOJB 4YHHJ 1X9MA 3CXCR 4UOGA 1QDUB 4R0EA 5SZTA 2MQ8A 2XYPB 1QD1A 3DLEA 3ONQA 4RNFA 4TLRA 1WD6A 1VYAA 2FHMA 3BKFA 4UQTA 4BCAA 3W63A 1RCOB 3IR5B 2NYIA 3HZGA 1RT4A 3KG4A 1JLEB 4ANCA 1H7XA 4N7TA 3MM9B 2VOOA 2Z58B 3U1NA 5K8OA 2GJIA 1SBRA 4OZNA 2MKCA 4DV7F 4ZCMA 1C2PA 2HVEA 3EICA 1FD8A 2RQCA 4K7QA 3G82A 4Y2MA 3H0PA 2QMXA 4OQJA 1BQXA 5J2NB 3HXMA 3SFUA 1SJRA 5L1JA 1PYSB 4NLUA 5IWAF 3RB3A 3G71S 2DNNA 2F40A 4C8YA 2ZVIA 3HJFA 4KE5A 2K1RA 3QGPA 4NZ7A 3GU0A 5CQGA 3GV5B 2P6SA 3K5PA 2X3GA 4FBTA 3ZTSA 2L3MA 3NP5A 1N48A 4Q45A 1Q5YA 3MFHA 1A9NB 3ZTQA 1MU2A 1B64A 1U1RA 5AT1B 5KFPA 1PILA 3OSPA 1S48A 1FDDA 3US5A 2N82B 3EZOA 3ILIA 3M8YA 1BQMB 5F8GA 4YFUA 4OX8A 3O2IA 2JVRA 4C8KA 1LK5A 3GIIA 1XC9A 1UAWA 1EIYB 2OFGX 3G8TA 4ANEA 3MD1A 4X66J 3MMAA 3VQSA 1VGYA 5D77A 5KFQA 2B43A 1CC7A 4DF4A 2ZZTA 5DG9A 2DRAA 1NXIA 2R42A 1T9VA 4FVMA 4DUZF 1S49A 2D9OA 4OZJA 2FHJD 3PV8A 1S57A 3K5MA 1S4FA 3EXYA 4DFMA 2PFFB 3CJQA 1SH2A 1PBAA 1NO8A 2JOQA 4MKBA 4HHUA 2V8VA 4YS2A 6FD1A 1UKUA 1RT6A 1PYOB 4KC5A 4WP8A 3W1YC 5F3TA 4Y2CA 3MAQA 5LSOA 1A7GE 5KFOA 4PCQA 2A2DA 1ICEB 1H74A 5L1LA 1GXUA 3MM8B 5C2CA 3NWRA 5E3PA 1UWAA 4BDPA 3OTCA 3T1YF 3TAQA 1XJWB 4Z37A 4DU7A 3A3PB 2DGVA 1GFWB 3MM5A 1S1WA 4TY8B 3GG1A 2Y3YA 1P8GA 2IJFA 1WC5A 4LQ3A 2UXBJ 1XNQJ 1OSDA 4DR5F 2C22A 2BQ3A 1GXLA 1XR7A 1OJ4A 3PW5A 3G2XA 4N77A 4PZVA 1NJWA 3BSNA 3ILOA 4YB1P 3HDSA 5DGBA 1TKDA 2I8EA 4C0OC 2YKNB 1JWWA 4HKQA 2W8KA 2E9TA 5JVHQ 3NOCA 1R43A 1R8BA 1UJ4A 2R7UA 1NK0A 1VMBA 2X1BA 1KFSA 1DZ5A 4ZPDA 4FYYB 2RSQA 1XEZA 4TKTA 2WCXA 4M5GA 5HVGA 4IH5A 5C24A 2P9CA 3BPDA 3R5GA 4WPAA 5HMXA 3HVRA 1WTFA 2CPXA 1N34F 4PQAA 2OPRA 2RDJA 4EBDA 3CCMS 3OR1B 3QJJA 4WIIA 4NZ6A 1Q79A 1ZPVA 3Q8VA 1XN9A 3K5NA 4UY85 1DTQB 4ELUA 2B51A 2KN4A 3LWMA 2FC9A 5IWAJ 3Q8QB 2WONA 3DLEB 2MZ1A 1FFGB 4A46A 1TL1A 3M9MB 1ZA1B 1HNVA 2EW9A 1SQFA 2MHNA 3T9ZA 1RT4B 5AE2A 3OJSA 2BJDA 2HAIA 2JJ4D 1K9MT 4JI7F 2J6UA 3C3LA 5DDRC 1LW0B 2AEMA 3T9NA 1IR2A 3HSGA 2LQ5A 3E51A 3TUZC 2A2CA 2MZJA 2FD2A 5FJ4A 2P8IA 2ZH6A 2AMCB 2VD3A 4PWDA 3OFFA 4URGA 3HHNB 4NRUA 2FYXA 4WIQA 3J7AN 2CJQA 3WQPA 4FYVB 1YSJA 1R7IA 1U1OA 1SPBP 4OYMA 4RW8A 1C1BB 2HBQB 5K14B 5ETKA 1U2FA 3FRYA 5G0RB 4RBUA 2Z2YB 2BYCA 3JSMA 3DLJA 3DGPB 1CG2A 1PJ6A 2CWKA 4DUZJ 4LIRA 1ZA2B 4V1Ak 3NNCA 1CJUA 4MK8A 1E6VB 4F3QA 3NWGA 3OFEA 2JLFA 2CIMA 1TAUA 3K7RA 1YJRA 2FGOA 2FJEB 1RWVB 3QSYB 1K1SA 4KH1B 2X1GA 1VC6A 4AQYF 4P71A 2D41A 3DM2A 1WI6A 3OL8A 3RBZA 3IGVA 4K5SA 1I94F 4NLWA 1XNRJ 3DOMB 3AQOA 4QQBA 3MTKA 1NDLA 1JJHA 3W9HA 1G4CA 3Q22A 2DR8A 2RQMA 5A2QY 4U96A 4ELVA 1Q8LA 1JNZB 3ZZPA 4LRCA 2DNMA 1HWLA 1FE4A 2LDIA 4DL6A 5AJ3F 3IWXA 4JBCA 2CZ9A 5DGAA 3HF5A 3HFVA 3HSJA 3HKWA 4XDDA 5B0DA 4I6WA 2BANB 2XM3A 2FJBB 5GADU 3AXKA 2COLA 2HRUA 3CIZA 4IG3A 3NLCA 1WKKA 1RT1B 3GV7B 4IYQA 2QMUB 3M32A 5ETPA 2XQCA 4DSKA 1TK5A 2XHCA 1X0PA 4WU3A 5AXMA 3TYTA 4RX6A 2QLBB 1RQ0A 4RLEA 4CI0B 3BQ2A 3IBFB 1KLMA 5F9NA 3R7BB 2GFFA 1YTYA 4H4MB 2QLFB 3N9UC 5CCMA 3DCAA 4R8UB 1NMEB 2RB7A 3D0GE 4CZCA 2RNEA 2WRMA 2GZOA 3GTYX 3KK2A 5FLXY 1S7IA 2YVSA 2DGUA 2AV5A 1TKZA 1JB0C 2RIJA 4G3IA 3DLKA 5J2QB 4KGMA 4LF8F 5IV3A 4A8FA 4DL5A 5CD4A 1WG5A 2NQPA 2HFOA 2A10A 2RS2A 2UUCF 1U1QA 2MQNA 3G6XA 2J8AA 2O66A 4J7CA 1SJFA 3IS9B 3VVUA 2Z0GA 3T1AA 2XSFA 3J7YU 4NZ0A 3THTA 1REGX 1VR6A 1SV5A 3F0NA 3W60A 2QYCA 3FK4A 5BXIA 9RUBA 4CYUA 4GKJF 5D8HB 2E1RA 4JI7J 4BHQA 2Y9HA 3OV7A 4DSJA 4USMA 4JOUA 1X4HA 3QT7A 3LP1B 2HWIA 3Q83A 5KFCA 3KDNA 2M8DB 1OPIA 4DR4F 3GG0A 2VPZB 4FPIA 5A6WA 1SUQA 1VQYA 1TKXA 4ZS6A 4QIEA 2DNQA 4OYOA 4ZJOA 2BACA 2RS8A 4ED6A 4LFCJ 2AGOA 1CJTB 4OYZA 2C2NA 1S9EA 3VGSA 2V8HA 3B4DA 2KB2A 2DNHA 4YEAA 2QN6B 3MWBA 1FXRA 3H2VE 1NK6A 3CCZA 1SJQA 4M5DB 1FFWB 3GMGA 4JYAF 2B5JB 3NGTA 3VAFA 1YWXA 1YGYA 1DJ0A 1J5EF 4DFJA 3LGHA 1D9FA 1HNXJ 2YY3A 3JYTA 1SKSA 2CQ2A 4IR9A 2G4BA 4DPOA 4J91A 1S6OA 4CLTA 1Q7YT 1IKXA 2CNOB 4A47A 3BR9A 3TAPA 4KO0A 4PG7A 1M5PC 1MSWD 3KLHB 1RHJB 3CD5A 4FKYA 1FT8A 3O5TB 3CJ8A 3GCXP 1FTRA 4AQYJ 1V3RA 3KJVA 1JLAA 2H3EB 4ILMA 5F3ZA 3FBBA 1IQZA 4R0JA 1I94J 4WBFA 1FCAA 3BN4A 3NNAA 2KZZA 2ZE2A 2XGQA 4ZP6A 4DHVA 3ZC4A 1S0MA 2PT0A 5EGYA 4ZJLA 1X7VA 2HHQA 1G7CB 2JFKA 3JXOA 5AJ3J 5LMNJ 1VJQA 1W2IA 1PCAA 4G1QB 3M2RB 2V4QA 3DDNA 3OBIA 4A8XA 4RW6B 5KG2A 4PQUB 2BVZA 1O8BA 2I38A 2KHDA 1NHVA 2HHPA 2DNGA 1ACMB 2HNZA 2VODA 3KWMA 1CLFA 1FA0A 3FFIB 2Z56B 3I9ZA 2JSXA 4KHPJ 5KT7A 3UD5A 4WK1A 1JLFA 4D3HA 4F4YA 4F25A 3MTJA 4LFBF 4F2SA 4U67Q 3AA8A 4PXBA 2DNYA 3CJ0A 4MYUA 3FCHA 3WZ0A 3C16A 4M5MA 2PMWA 1X4CA 3IA0A 2ZH2A 2C3PA 4KV8A 4Y65A 4B9LA 3TAMB 2L48A 3SV4A 2IBKA 4OYIA 4DSIA 3WIVA 4DSFA 4K2XA 3KUEA 5SUHA 2GX8A 2UUCJ 1HBNA 4X62F 3K2YA 2J7UA 3DLHA 2HFNA 2QIFA 4ER8A 2NREA 4FNHA 1PJ7A 3ENAA 3EX7B 3V5RA 3M2UA 1YJWS 4ERDA 3PJXA 3QZ7A 3QT5A 1QAIA 5CZXA 3N6MA 2JC1A 3EDQB 4RR5A 3MPYA 4FXWA 3KK2B 4QW9A 4C3MA 1ZM2A 5DLGA 4FS2A 2F1FA 3TRGA 2FHKA 5FDLB 3DLKB 4FF2A 1T94A 3CCLS 2N3LA 3PJ9A 2VPYB 4PYAA 2QG9B 5E3CA 3MR5A 2PE8A 3EGWB 1IR0A 3LPEA 4ECWA 2QFIA 5C42B 3QO9A 5HMYA 3J81Y 4KGXB 3V81A 1JIHA 1DBDA 4DR4J 1X4DA 2KU7A 1EETA 4EBEA 2MQOA 3LGNA 3JB9k 2B9YA 2F8EX 2XULA 1W25A 4Y2IA 4UQGA 3M8SA 3P5TL 4X4RA 3QSIA 3K0JA 1HPZB 4QIGA 2XS5A 1IXKA 3ADAC 3UN3A 3QGIA 1OIAA 5HBMA 2F8HA 5A0YA 1RP5A 4AXIA 4W92B 4RO0A 1L3UA 1S1UB 2ZBCA 3MEEB 1N88A 4X4QA 3E3XA 2NXEA 2JL9A 5F9LA 4J9VA 3PG9A 2PC6A 3SBMA 3NBPA 3CJ5A 1J5EJ 2ZEJA 3HT0A 3ITHB 2HVHA 1V5VA 4I2QB 1WUUA 2DNOA 4ZVGA 2QL7B 1X8DA 1S6PB 5I42B 1TKXB 1YJTA 4DQQA 2OLWA 3CE8A 3P3DA 4QYZJ 4A8YA 4N41A 2QC3A 4NYOA 2DGTA 3ZZZA 2R7QA 2YQ0A 2CG8A 4OZ2A 4OJ3A 2OPSA 2VB6A 3TX0A 2BRLA 4NLGA 2KJVA 4O3PA 4F8RA 4RW9A 1BD6A 1NDCA 2E1AA 4ANDA 4DUTA 3MECA 1SIWB 3CTRA 2HHUA 4DR7J 4M5NA 4K4VA 3CCRS 4DQPA 1U0HB 4K4YA 3E01B 3KG1A 1HD0A 1RHRB 3DDIA 2N4CA 3VZIA 4UF4A 3H5UA 4AXJA 2OJ3A 1JLAB 2DEJA 4CP5A 1UFKA 3UNGC 2Q1LA 3AH6A 3MEGB 2J0SD 4F36A 3FMWA 1VRTB 5KFLA 1FKOB 2X1AA 1WF1A 1RSCA 1NH7A 3EM1A 1U6ZA 3HP6A 2SXLA 4WYWA 4OZ0A 2H65B 4LFBJ 1NEEA 2CPIA 2MTLA 2YKMA 1D9AA 3M9NB 4HR2A 2U1AA 2K06A 5T7LB 2D69A 2HLTA 4DX6A 1RWWB 1RT3B 4J5OA 4RUAA 3EE3A 3UR0A 4DL4A 1UTAA 5E7OB 4DR3F 3NS6A 2OPQA 1YBUA 3MFIA 2RAQA 4P74A 3KLEA 4FP9A 2R7TA 1N33F 1AFJA 2HNYA 4EO8A 1UWBB 2F7VA 3CDBA 4M63A 1D0EA 1UFLA 2OO4A 2AX0A 4F04B 3VF0B 1RTIA 2XZTB 1FEEA 2LU1A 3C14A 2MJUA 3OTEA 1S10A 1B99A 2CJ9A 3KOAA 1VCTA 1QVFR 4R5PB 1RTDB 2MKHA 3D7SB 1F9EB 1KC8T 2HQFA 3CO0P 2ASYA 1FXDA 3UD3P 5KFWA 2K3IA 2JZ5A 3FC9A 5GMDA 2DNZA 5G4DA 1JLBB 2M7SA 1DFDA 1NBEB 3JQMA 2XLIA 1X31C 1QM9A 1DURA 2WVBA 2HVZA 1IKYA 2O5DA 2KT3A 1LW2A 4HVZA 1Z2ZA 3R1HA 5J1EB 2FJDB 3OHAA 3D3CJ 2DXEA 2MDAA 4Z7CA 3TZYA 1KHVA 4LR7A 1JLQB 3T6BA 2BM0A 2ACMA 1YZ6A 2K2PA 3MR2A 5BYQA 4OHXA 5HK4A 5LMUF 2HHTA 3SQGA 2ZC4A 3QRQA 3PIOQ 1AUDA 2Z2ZA 1CS4B 2YWHA 2H1YA 1S0VA 2DJWA 5KFFA 4LQ9A 3ILLA 1EETB 4PYDA 2VBZA 4A8WA 2DR5A 1YLXA 3F44A 2ZJPQ 1HWJA 5E0OA 2C2OB 4F50A 2YH1A 3CUNA 1NU4A 4M94A 5KG7A 2WSFC 3DRYA 2CAJA 4LSNB 3PIPQ 1IJEB 1C0UB 3FUYA 3W2VB 5DDQC 5J2MB 4WXOA 1Q4RA 5B7WA 4ZDNA 2V94A 2HAFA 4NLYA 2LU2A 4ES2A 1L3SA 4FYDA 3TVYA 3W3SA 4DS5A 2IM2A 1A6LA 4B9SA 1LWFA 4QR0A 3IAS9 4J9OA 4DXLA 1WDTA 3GSIA 1WC6A 4IFVB 3BYPA 1NHUA 1X4BA 3VQTA 2XC9A 2AP6A 4LF7J 2D1CA 4NI2B 3OSNA 1TELA 3SDEB 1ZETA 2RHSB 2FJVA 2OGUA 1DTTA 1QTMA 4LUBA 4B17A 2RD5C 4HACB 4M5JA 2B7BB 4ED8A 3NRBA 1MWZA 1Y10A 3S7RA 5ETVA 4F0MA 5D3GA 2AF6A 3LP2A 3K58A 4C9DA 2FVPA 4DQSA 2ZH7A 1FEHA 1HNWF 3M4XA 1J2VA 1OY9A 2Q6BA 2W7OA 3THVA 3I0SB 1RTHA 4LT6A 1RISA 3MM6B 3VHQA 3HSDA 4CO1A 2XGPA 1F9HA 1N33J 1FK9B 4ZVTB 4J9UE 1RAFB 3CMAS 1O5JA 2IFXA 3IMQJ 2MKJA 5HP1A 1O0PA 1OMSA 2EVZA 2R8KA 2JHEA 5CA5A 2WVCA 3S01A 3WC0A 1NPRA 1CC8A 1XWLA 2QA4G 2RUSA 1URRA 4DPUA 5HQ8A 3F41A 3BBBA 2ZUAA 1WHYA 3SCJE 1RT2A 3IWLA 1L3VA 1VHIA 3LO3A 5I3QA 1FJ7A 3HD1A 4Y34A 3CT9A 4HT7A 3BBCA 2YWWA 1KDNA 2I9SA 3KLEB 4QWCA 1I6JA 3BKTA 3IXQA 1TUWA 5E3RA 3PHEA 2Y8WA 2YNGB 5F8JA 3ZFVA 3C8YA 3KDOA 2UXDF 1RJJA 4DV1J 4B3TF 2BJ1A 2DHSA 2ZOFA 4O4GB 2WVDA 3MXHP 4TYBA 4CRJA 2MQMA 3DOLA 2XZDB 2F3JA 1GT8A 2HZCA 3UN5A 1GMWA 3ZTRA 1NAQA 2PIIA 3RJMB 3RW7A 1T05A 1RT5A 4ILRA 3M1VB 3LPYA 3RB4A 3UCUP 1B4SA 4RZRA 2RKIA 3GONA 2XLKA 5LMUJ 2YNHA 4ZLNA 1KD1T 1RWXB 2WSEC 4QU6A 4DV3F 3I9V9 2XBPA 4J90A 1VC5A 1RYSA 4USUA 4DL0C 3PW7A 2MGZA 2OKQA 2FPHX 3VAGA 3ZZRA 3MUVP 1HMVA 4DQRA 4YY3F 2IYIA 1R89A 1U4BA 1UP1A 5JUMA 4FPRA 3R6LB 1H2TZ 4U7CA 3ELHA 1JXLA 3OUYA 4LR9A 4DCJB 2R2SA 4KSEB 1Q0NA 3PYDA 3PX0A 4DI6A 4L75A 4QWAA 2IY5B 1FD2A 3BGRB 4DV5F 2CPFA 4AT1B 3K8VA 3AB4B 2LLZA 2EKNA 2OD6A 3SIPB 3G4SS 1H73A 1WHXA 4DS4A 2GGPA 4A8OA 2DGWA 1RTZA 5D4NA 1VK3A 5HLFA 2YNFA 1S1XA 3ISNC 1TTHB 5F8LA 1E6YB 2YQ3A 2HURA 3AXMA 3CVKA 4DR2J 5GAEI 4G1PA 4C8MA 4ECYA 1YZ7A 1UZHA 2HQIA 1QSYA 3MF5A 2W7PA 8RUCA 2IVMA 1EZZB 2OIHA 4K0KF 1WELA 2AJ0A 5D4LA 4QR1A 4ZVEA 4UOFA 3HT3A 2JEFA 5HVFA 4FDFA 2IC3A 3MR3A 1HNWJ 5KFTA 3AB2B 3C6UA 5KT6A 2PD1A 1H7WA 5BJRA 4F0HA 5A8RA 3OJUA 1CSJA 3D6HB 3CC4S 4NCGA 3HHEA 5ETRA 2CNKB 4XO0A 4FZVA 5ETSA 1QTNB 4NLOA 2G9OA 4ZPTR 3QJLA 4ED4A 3OXGA 4EMDA 2AW0A 2ZVSA 2EFVA 4CLLA 3I4PA 3BO4A 5C7PA 5EHHA 2IIHA 3QMQA 2B4UA 1WEZA 1FJGF 3B54A 4WKYA 2BE2A 1TL3A 3J80U 5KG0A 1B0TA 3BSOA 3W61A 3D0IE 3V4MA 5D3GB 1FNMA 3KNGA 4L73A 2C2EA 1XIQA 1TL7A 5KFMA 4H4OA 4ECVA 4BWMA 3D4JA 3DRRB 1J27A 2J7KA 3OVSA 1ZTWA 4JI2J 3PRBA 2QMWA 4NPOA 3OTOJ 3HSZA 2CUYA 3V6DB 4EYIB 2EKYA 3HVWA 1Y3KA 2UXDJ 4WYLA 1M5VC 2HZAA 4LF4F 4B9MA 4ZVPB 5FIIA 2FY8A 5KOXA 1KQGB 1BC6A 4ID5B 1KQSR 4C0BA 2KRRA 3TVZA 3D67A 3OTBA 1KSPA 1TKTB 3J7ZT 1N5YA 2W4PA 4DV2J 1RT2B 4O0NA 1NKEA 3TUJC 2R3VA 3KK1B 4XAKA 4CLZA 2DY9A 4JV1A 3MCNA 4PABA 2Z8QA 4C4WA 3DOKA 4HLBA 4UOHA 3GZ7A 3CJ4A 3CGIA 3MMBB 2HNDA 2PEHA 1TV6A 4M5LA 2J0XA 2B8QA 4WK3A 3VGTA 2B0GA 4FKXA 4LJMA 1T03B 3RU0A 2XMVA 3PO4A 4FVCA 5IM0B 3BBFA 3M8WA 3ULHA 2G1DA 4IRCA 5KG5A 2I6WA 5GAGI 4OX6A 3TVKA 1PC5A 2A18A 3DOLB 2O01C 5HL7Q 4OMFG 2HHXA 1FKPA 2G13A 4YY3J 3VAJA 1RT5B 3MUTP 2Z57B 2EEYA 3BO2A 3RBEA 3BGLA 4WF9Q 1NPPA 4IR1A 3BDEA 1N0VC 1HNIB 2MKKA 1S0NA 5DZ6A 4ID8A 2UUBF 4X4NA 4NLPA 5IT9U 3BZQA 2KL8A 2FJXA 5LXRA 1UVMA 3MM7B 2BMBA 5DG8A 1BUXA 3M30B 4FXVA 2C3UA 4ED3A 5J2PA 2XMWA 2VQFF 3DRSA 4DCOB 3M05A 4CO0A 1HMVB 3NS5A 1FDAA 2Y1LB 2G2OA 1TL4A 3T5HA 3S1TA 3P49B 2N7YA 3M6XA 2MZTA 5RUBA 3DLGA 2C3OA 1UJ5A 3QLHA 1RWNB 4F26A 1NB2A 1HYSA 1GMUA 2VDIA 3LP0A 4MTPA 3CB4A 2DITA 2ASLA 4I64A 2GO8A 3UVJB 2GVDB 1KONA 1S1VA 3Q8YA 1S9GB 2LECA 2CA9A 2MY7A 1KP6A 3JSYA 2B9EA 8AT1B 4K0KJ 2MXYA 4NLQA 3SSSA 3BDPA 3M7VA 2B9WA 3UN2A 3TX8A 4IDKA 1H6KX 4DZ6A 2RQKA 1S79A 3U1MA 2G2ZA 3R5JB 5L8RC 4A8SA 1M90T 2XY5A 3N6NA 1D9DA 1OY6A 1SC1B 2AJ4A 2HYIB 2XSJB 1Z4UA 5HMWA 1RT7A 2PO4A 5CCLA 4EEYA 5I3UA 2K7JA 1Y9OA 4CTAB 1VQMS 1VQPS 2QSWA 2L41A 2DVIA 3I32A 4RW4A 4KHMA 2Z4PA 1J5OA 1RB0A 4GMKA 3KXDA 1Q95G 2IAJA 3M8PA 3ETOA 4KIAA 4ZVUB 2HG4A 5C2GA 2RQ4A 3GYGA 3RRHA 5IQQA 3GYXB 3PEHA 3KKFA 4NCBA 4JV2A 1DY3A 1IBLF 1YJVA 1UEKA 1VBKA 2PN6A 4XTTA 2V2ZA 1HHQA 4NXMF 4H4KA 4DG1A 4JI1J 5ADZA 4E2FB 2J9EA 3Q24A 3FSXA 4PXDA 4ETXA 2B9XA 4ETZA 3C46A 4ED5A 2M8HA 3QIPB 3D6TB 3B6BA 4Q44A 3CCUS 1W7WA 3GE9A 2W25A 5CAAA 4ZVFA 4JB8B 1M0SA 4QCLA 3DRPB 2LQJA 3OFGA 3QIDA 3HHDA 1M5HA 2ZBPA 3U1LA 1OYEA 3G87A 3NNHA 1UZDA 2KFZA 4BWJA 4WP3A 1BHNA 3SSQA 4B3RF 1VQ7S 4LVOP 1T9XA 2ZDPA 2F65A 1I51B 1D1UA 4JI3F 4F4KA 1ZM3A 4QYZK 2KVIA 3PYEA 2ZHAA 4HEA9 4A8MP 1XMQF 3CEDA 1AUSL 1N6QB 1JLGB 1LEOA 1JLEA 1MLAA 2YWEA 5B09A 1C0TB 1RABB 3RB0A 1ZAXA 4GC7A 4QWDA 1KR4A 3GCWP 4DEZA 2W24A 3N6LA 2R7WA 1B3TA 1RWMB 4PRFA 5HJYA 1VISA 2VICA 2DBBA 3T6JA 3R5BA 1MG7A 3TWZA 5J2NA 2ZM6F 4XPEA 2APOA 2UUBJ 1LFWA 5K5MA 5DO2A 3VTIA 2HK2A 2HIQA 2JWNA 1T95A 1ZOTA 3EJMA 2BKOA 4XPCA 1OQ3A 3OL9A 1P9YA 3KHLA 1JXVA 3TOQA 2VQFJ 5ETLA 2ZBRA 2VG7B 2HLUA 2ROEA 4K8RA 3NS7B 2G0CA 2CQ3A 3IFEA 1P1LA 2K8GA 2IBOA 4PUOB 1RWUA 5BR8F 2CQ4A 3PNIA 1LKZA 3UE2A 1X4GA 1FDNA 2EI5A 4LF9F 2CJKA 4LRAA 3BQ0A 4NEYA 2AT1B 2GQCA 1BQMA 4OZ1A 5GAHU 2FVQA 3EMTA 1TP7A 4YR2A 4OZLA 4MFBB 1M5KC 2BE7D 4DX5A 1HD1A 1Y7PA 1NZAA 1VLYA 3NEKA 4K5RA 4C3LA 2UUTA 3DRXA 3DRSB 2F8MA 1U6BA 4E8UA 2XWYA 2ZOMA 3GILA 1RHMB 1NUEA 3W66A 1VQOS 1VBXA 2KYXA 1GX6A 2VBYA 3HHLD 3X1LB 4OFZA 1VRUB 4Y00A 1WG1A 4L74A 2BABA 3MPDA 3TUIC 2CJBA 4Q43A 2ZNYA 3EYZA 2VUGA 1WEYA 2W4DA 2QE5A 4OX7A 2VH7A 4RKUC 4I1TA 3A12A 4DL7A 2QLJB 3ZZYA 4I68A 1RBLA 4UUWA 1NB7A 2BA9A 2FZGB 2W2QP 1KKHA 4NA1A 5EDWA 3JQJA 1N56A 2DO4A 4A48A 3H8YA 4OI1A 2LMIA 5J1NA 2W7AA 1FRIA 2HSEB 2V6AA 4V19X 2HWHA 1V3ZA 4OHYA 4Z7YA 1JKHB 3DDKA 1IBLJ 1U2CA 3BYRA 2ERRA 1R0BG 2Q79A 5HMZA 4OI2A 3R7NB 3TUPA 2ASJA 3OPKA 3L7UA 1S59A 2C2MB 5E41A 1RK8A 1NJZA 4RNMA 4LIWA 2DHXA 3CC7S 4S0MA 2MY8A 1F9FA 1SCJB 2CG4A 4HT5A 4I6AA 1QAYA 4ZVSB 5DJBA 1Y5LB 3GB0A 2IMWP 2FB0A 4LRBA 2OSRA 2YKNA 1IBKF 1UVJA 1RCXB 1K47A 3KLGB 3R5DA 4N8OA 1XMOF 5EX0A 1V6HA 4ICLB 4KGZB 2KM8C 4HI2A 4P52A 1EAYC 2E9RX 2UP1A 3PW2A 4I7FA 2QZ8A 1KEKA 2MJNA 1XMQJ 1SH3A 1HHTP 3FVYA 3LA0A 1LFPA 1EB0A 2GS8A 1PC4A 2CPEA 3NMRA 1FRJA 4B3SF 5L9NA 4OV6A 1HR0J 3D5MA 3S8SA 2VIHA 1VS3A 2L9DA 1RTJB 4LSLB 1DTQA 5KFIA 3IR7B 1NRKA 2F4FA 2KFNA 4CT9A 3VALA 4Y28C 1CJVB 2AWZA 2OPPA 2HFSA 2P5VA 3QT8A 1HHSA 2MKYA 3IM8A 3HM9A 4WE1B 3BS9A 4ZJQA 4ZHRB 2RU3A 1FJCA 2UU9J 5E5NA 4ZA1A 2FLPA 2JEJA 1T9UA 2DKOB 1LW0A 1KVKA 4JI5F 5BR8J 4FN5A 2GJ2A 2UXCJ 5D15A 3IP0A 4MIWA 3CW2C 1S5ZA 1PAUB 4LF9J 2QLXA 4DFKA 2JH3A 2MEWA 1JX4A 3L7PA 1P27B 2F4VF 3L95X 5L38A 1U1LA 4PWWA 1C1BA 1TVRB 4C8LA 3WX8A 2M52A 1EKRA 4C11B 4NMLA 5K14A 4M1KA 4F3OA 1PKUA 5A8WB 4PG8A 5G0RA 5AE1A 1KFDA 1IWAA 1MWQA 3NGKA 1WNEA 4USHA 2AKWB 3DGPA 1UETA 3GYNA 4HTJA 1R6VA 3LANA 2R7VA 3BM7A 2HHHF 3KYLA 3CJRA 2D3UA 2CVEA 3ICLA 3HFKA 4PXCA 1E6VA 1DRZA 3BGFA 3BKUA 4CNYA 3H5SA 1U26A 2LXIA 2WW4A 4YOEA 3RW6A 2C2ZB 2K7KA 3TARA 4CCHA 5E3AA 4HHHA 1U1KA 4NLRA 2DT9A 3LF0A 4K4SA 5BYSA 2C2RA 5E3QA 2PI5A 3DOMA 2Y0BB 2H5EA 2DCLA 2W9AA 1VQ4S 3M6UA 4ZP8A 1EARA 1XR6A 3H98A 3OXLA 3RBDA 5DM7Q 1WI8A 3OD2A 1REVB 4WXWA 4ZVQB 5ETNA 1HKAA 3W5XA 4U8VA 2JLEA 1IUJA 3AHPA 2E5IA 2AEJA 2FVRA 3B4MA 1LWEB 1U02A 4RW7B 3OQ2A 1MMLA 3GFHA 1WORA 1RAOA 2GNKA 1G2EA 2BANA 1FRKA 4PPZA 4TQRA 1B0PA 1FNOA 4TU8A 1UPPA 1M1HA 5KFDA 3HZEA 1RT1A 2YH0A 1RDRA 4KTQA 3HVTB 2KG1A 3OR2B 3HHLC 3SQOP 1IKWB 3HI9A 2I5JB 5T41A 1VQ5S 4ALZA 3QWPA 3K5LA 2E44A 3U02A 1IN0A 1XMOJ 4DV6F 4H4MA 4NA3A 2HS4A 3DC2A 2XWXA 4R8UA 2XMAA 4KQZA 2E9ZA 3WX4A 1KTQA 3EGVA 1H72C 3PYGA 2E7VA 4ZP7A 2LFVA 4X64J 4RWXA 2DNPA 5J2QA 2ZJRQ 5LOQA 1AZSB 3FCWA 4UZCA 4PKDB 4Q5VA 1WC4A 4YMEA 3I5BA 2FZKB 2XS2A 3A3OB 4QIFA 4EZ6A 2LEPA 2WBRA 3QNWB 2IRYA 3IS9A 4UW2A 2PI4A 1HLWA 4NXNF 2BW7A 3MEKA 1F2GA 3KG0A 2X3DA 3I96A 3C6TA 1AFIA 4I7FB 3GFZA 1TK8A 5CYMB 2DNRA 4YR3A 3LGMA 4CH0S 3A3NB 3BF4A 3TJ9A 1YJUA 4DPTA 4JI5J 3P4UB 3KHGA 4DV7J 2BOPA 4AE5A 4WP9A 3LP1A 2XMKA 6FDRA 2CQGA 2KT2A 1ZM4A 3VAMA 4B08A 3KK3B 2F4VJ 5B0GA 3LQVA 5A8KB 1PAEX 5ETQA 1CJTA 2OPPB 2KT5A 5DS7A 3T5LA 1XTZA 1QY7A 1WG4A 2BM1A 1NZ8A 2NPFA 3NCPA 4M5DA 5AXLA 3PEJA 4WFZA 2B5JA 3NL0A 4P2SA 3MEDB 2OP5A 3DYAB 1CJKB 2VOPA 3H5YA 1RWPB 4MKYA 2P6TA 3RUBL 3JTPA 2HVIA 4N5SA 3WHIA 1R8PA 1IWGA 2NR0A 4ZN1A 3KLHA 3AOCA 1TUVA 3T41A 3H40A 4JP8A 4QBUA 3SEOA 3J80Y 3V6KA 4FYXB 4ZCKA 2HBYB 1SL0A 2PEBA 4H4KC 2JLGA 1RGVA 1QUPA 4Q0BB 3CWJA 8ATCB 2XZWA 4P6QA 1EHWA 3TZZA 2BEFA 1SJ4P 1BXNA 1O6XA 5M2RA 2DGXA 4MJKA 1HIYA 1VHFA 3Q23A 2JEGA 3H20A 2C2DA 2VFTA 1P9QC 4F4XA 3AOBA 4M5IA 4G1QA 3BQ1A 1G3OA 4G6VB 4ILLA 7FDRA 2GIFA 1LXJA 3M2RA 4RW6A 4PQUA 1RWOB 2P9GA 4TXSA 7AT1B 2A6OA 2NUUG 1BGXT 2MB0B 4P7VA 4QU7A 2KG0A 5L1IA 3FFIA 3QZ8A 4KAIA 3D6MB 2B4PA 1SKUB 2RDIA 2R4FA 4C98A 4J9SA 3ILJA 3T1YJ 3PX4A 2WVEA 4YDDB 1YIJS 1GXTA 2JNJA 4DV6J 3JAMU 3RB6A 1PIEA 4YR0A 4J9NA 2V8PA 3FEYB 2FC8A 4ZCLA 3CCSS 2RUGA 2J0QD 4L72B 2EXUA 1FRMA 1FHTA 2J6TA 4F02A 3AOAA 5I3PA 4DR5J 1VLOA 4ECXA 3WBZA 1KHWA 2IJRA 2W2MP 1HW8A 3GFXA 4WCEQ 2IVYA 2UVVA 4JV5F 3TAMA 2ROPA 5CYJA 3MURP 2UVUA 3OXFA 4C97A 4N76A 2UVRA 4ZPWR 5D0GA 2NPIA 1VQNS 4NRTA 3OL6A 4IG0B 2QSFA 2WVFA 2F63A 2DXDA 3I0RB 4N56A 4ZN3A 1ROFA 4L76A 2W1BA 3D68A 2XO7A 5IT9Y 1YBTA 4N8NA 4ED0A 1V9OA 4DDFA 4MMOA 1LV5A 3FBCA 2DR9A 3OTDA 2AYEA 2GV1A 1U7LA 5FD1A 4I2PB 2XLJA 4KFBA 3G6VA 1IM4A 2AJQA 5L39A 4CO2A 5FDLA 2QV6A 3VAKA 2E66A 3KNAA 1N34J 3IM9A 2OFHX 1VQ8S 1JJ2R 5C42A 4NLVA 4RUCA 1NCLA 3CJSA 1R8AA 2ABYA 4UY8T 2F9DA 2YBVA 3LH2S 5E33A 4WTOB 4KGVB 4YB5A 1VQ9S 3C6TB 1N54B 2WW8A 2GIQA 4J9MA 3PW4A 1PO6A 1UVIA 1HPZA 1FF2A 4ZLLA 2M0GB 1WTBA 3IGNA 2CQIA 4I6YA 5B0FA 1JLCB 3B8HA 4FF4A 1QUVA 5F8HA 1S1UA 4DWIA 3MEEA 4OYWA 1HNZF 4QYRA 4QJVA 2DPJA 4FYWB 1TFYA 2R2TA 4CT8A 4EI2A 3ITHA 3MOZA 4I2QA 3RTVA 1Y4ZB 1S6PA 5I42A 2EC0A 4OIXA 2CNLB 5CXTA 1DHMA 4WTYA 1YI2S 1GK8A 2FTRA 4YHHF 2CPJA 3AY0A 1MN7A 3AJ2A 1H2UX 2E29A 3PKYA 4JUZA 3U27A 2LQBA 2X51A 3BGOP 1N0UA 3HHLB 2H4WB 2RMLA 1HQ2A 1FJEB 3K57A 2ROGA 2FHJA 1SL1A 4O44B 3TW0A 4URQU 5CD4H 4HYKA 1HBMB 2FIUA 1U0HA 3E01A 2XMMA 4AFFA 3NKYA 1RAEB 1S76D 4TQSA 4ES3A 5KG6A 1ZZFA 3DMJB 5IV4A 3RAXA 1NSAA 4CQ1A 2W9CB 3H7HB 1ZM9A 4B9TA 3UI3A 1MROB 1PJ5A 4M95A 2Y1JA 2HQGA 1LWXA 3K8WA 3MEGA 5B0BA 2E7WA 4EFAC 1U09A 4EZ9A 1VRTA 3AD9C 2DB1A 1FKOA 2AYGA 3VR1A 4H54A 2MYFA 2AGPA 5HROB 1ZBTA 3IRXB 2XY7A 5T7LA 4ECTA 1RT3A 5IT4A 5L46A 2CZVC 4DV4F 3Q86A 2EG1A 1D09B 2R7RA 2LKZA 2JFDA 4NYPA 3MDFA 2JRSA 1S7HA 4HH1A 3VAIA 3A8KA 3GWCA 2E5HA 1L3TA 5IFMA 3Q8UA 2CQDA 1UWBA 3V2UC 2RF2B 4TNOA 2V4JB 2QT7A 4PPDA 4TY9A 5HATA 3EGZA 5HAOA 3PX6A 3VV2B 5LSLA 1S9FA 2KRBA 2QJ3A 2NXCA 3V4IB 5C25B 4ZP9A 2DEIA 2PDAA 4R5PA 1RTDA 3DI6B 1HFEL 2FDNA 3POTB 4QPTA 1FX4A 4PWUA 3GIKA 3QAEA 1SJ3P 1HWKA 2KXHA 4IQXA 1T9WA 4OV1A 1VI7A 2E1MC 2WB1D 4KKOA 5D0HA 4LF8J 5F8IA 5D78A 3H25A 1JLBA 3CULA 3G8SA 2LCWA 2DD8S 3PKMA 2DIVA 4ZPAA 4B02A 2QL5B 4M5HA 2B4VA 2PMZD 2CQPA 2VJUA 2D3OR 4AYBD 5H9FK 5J1EA 4ZVRB 2Y8YA 3AA9A 1RKJA 1XK8A 3TO8A 3OL7A 4MH8A 4DBQA 1JLQA 2FHOB 1FKAF 3CF5Q 4KT0C 2UXBF 4KFBB 4Z2XA 3BV8A 1XNQF 1I5OB 1IKVB 4GKJJ 1ELOA 1DAXA 3MR7A 5GADI 1FWLA 2FQQB 2H9ZA 2GC8A 3CO9A 1T9YA 5DRKA 1RZMA 4M5KA 1KQFB 4ED7A 2XTJP 4DQIA 3H2UB 4MKAA 4UZBA 1CS4A 2O67A 3IRWP 3VWSA 2E5GA 3AQPA 4ZCIA 1M1GA 1CBKA 1SL2A 4KPCA 3W2WB 2QO3A 5AXNA 1M5OC 3GR0A 1QJHA 1WEXA 3I87A 2BUNA 3D0HE 3JS9A 2OTLS 4EBCA 2ZD1B 1T3NA 3Q8PB 3FQLA 2PMHA 3R97A 3ENWA 1SQGA 1Y5NB 2VC0A 2GQ2A 4LSNA 3S6EA 3KLIB 1RLCL 4JYAJ 4X2BA 1C0UA 3W2VA 5J2MA 2BZ2A 3H5XA 1RHUB 4B9VA 5IZHA 3RG6A 1U8SA 3SCIE 2E1CA 4GO5X 4PXEA 1UVLA 2BXJA 1TMJA 1BY9A 4CO5A 3RRGA 1WKJA 2ZKTA 3M8QB 4NA2A 4C3KA 3CJ3A 4GVLA 3J7YI 3SI8A 3UR3C 3ET6A 3PZPA 2OUGA 3UDVA 1FNXH 3EGNA 5JJBA 4RUHA 2RRNA 4IFVA 3KHHA 3W5YA 2OMOA 3P45B 1KLNA 5CYQB 5DDPC 4O3SA 4NI2A 3SDEA 1YRTA 4C0HA 1ZPWX 1T8EA 4F2RA 5KFJA 2BDPA 2V5HG 2ZITA 4HACA 3N4WA 4YP3A 3UW1A 3N0VA 3BJYA 4DV4J 4ECZA 3TQEA 3FGVA 2DNKA 3PCOB 3I0SA 1WOPA 5MAOA 2AD9A 4G1IA 2GQQA 3MM6A 2HQDA 3O8WA 4ES1A 5H9EK 1EP4B 1FK9A 2MQQA 2CDRB 1NDKA 3JSRA 2HRTA 3KLFA 3GIMA 3C66A 3H59A 2CNNB 3BSAA 3LW5C 4WFXA 1FTCA 4O3RA 4TVAB 2LXUA 2CFXA 3T5KA 3LUYA 4BBYA 1U6FA 4X4VA 2KYZA 4N47A 5DQGA 1FXLA 2MSTA 2VPWB 3D54A 3C19A 1CPZA 2Y1IA 5DZ7A 4DPWA 1L3KA 4X84A 4OL8A 2V50A 3O6QA 2AYBA 2R8JA 1IJFB 3WIUA 3ZZUA 2ZZNA 1H0HB 1TFWA 3SCLE 2BR0A 1ZAVA 4OI0A 3VGVA 4W4MA 1IBMF 5JVGQ 1BWEA 3FZBA 4IFYB 2YNGA 3H42A 3O3LA 3G86A 2GMHA 3W5ZA 1XNRF 3K5OA 1FDBA 2YNIB 2DIUA 1FVQA 4X62J 3NAIA 4O4GA 5KT2A 2VU5A 3TZWA 1SJ1A 3GV8B 1S6QB 1RUSA 2M5YA 1GH8A 2GHPA 4LRDA 3I6PA 2HEKA 3ZZTA 3NG8A 4KRWA 2F5GA 3TZXA 4K4UA 3QBCA 1R6YA 1IBCB 4DFPA 3IG1B 1FX2A 4A8KA 2B6AB 3M1VA 2J9DA 1NH8A 3GFYA 4KKOB 4ZPBA 1QAXA 2KTQA 1APSA 3CJKB 1HI8A 1HBUB 1VJWA 1BMQB 2L08A 3A1YG 4NLXA 4RBVA 4XIUA 2V67A 3D1QA 4DLGA 4O23A 3TEHB 3TJ8A 2OEMA 2E7XA 2KFYA 4IUFA 2GVZB 1DLOB 2LXFA 2LA4A 1ZYQA 4FBUA 5D6GA 1CULB 3HJVA 3PXGa 4ECRA 2NCKL 2QL9B 1U45A 2V69A 1VOMA 2RDDA 1RA6A 2AZ1A 4HH0A 2FJWA 2BJ8A 2R8HA 1S12A 3ISND 2YX1A 4RNNA 2AU0A 2XCAA 2FVSA 4KR0B 4USWA 3QQCD 1C1CB 1HQUB 5HN0A 3CSKA 1M1KT 2MLXA 5AXKA 5C5JA 3WDOA 1BWVA 3X3UA 3QAUA 1Q53A 2J7WA 4ED1A 5DM6Q 2XEXA 3BGRA 1KOOA 3CCWA 3GPAA 4NE9C 3O1LA 4KPYA 2QLWA 4IH6A 2OAUA 1K1QA 6AT1B 3Q2TC 2ZH8A 1V5IB 2GCFA 5EWEA 3IWNC 2Q66A 2CJYB 2YKOA 3BSCA 2W2PP 1QE1A 2GMLA 1E6YA 3AD8C 3VCDA 1U1NA 4OZ3A 2RT3A 2ZKUA 4RL1A 3E8OA 1KTVA 3CMQA 4MK9A 5F8MA 3PRDA 3SMZA 2YWKA 3CC2S 3G82B 1DQ8A 5LJ3Y 1UL3A 4O4RA 2POKA 3QGHA 2HPUA 3ET6B 4USKA 2OI2A 4LFCF 4AL6A 2K1RB 2V2QA 4U6PA 3G96A 1UW9A 3A8IA 1URNA 2HFVA 1PBUA 4B3MF 1PYTA 3AD7C 5IT0A 3VVTA 3GSDA 3N79A 1VQ6S 4UUXA 3HO1A 1WC0A 5LXYA 3WC2A 2VHGA 3ENVA 3NGDA 3L3CA 1MN9A 2W01A 2M4MA 3CIMA 4OX9F 2HS3A 5J1PA 3PACA 5H1SV 4IOAQ 2C28A 4EUVA 1MU2B 2P2CB 1HNXF 3GIRA 1JK9B 3RR7A 3R7SB 4HHJA 4DN0A 4DR3J 3M8ZA 3DRRA 4MIBA 1RBOB 4L3KA 1LNQA 4QPXA 1IBMJ 2HBZB 2OHDA 3V6DA 3HCXA 1X5PA 1YKWA 3MMAB 3KLFB 3UFCX 1NLKL 5F0WA 1KVIA 3EWGA 4ID5A 1D8ZA 2QA4S 2DTJA 3CDEA 4KY3A 4QWBA 2V8DA 4NLDA 1FVSA 3IC1A 2DH9A 3T3FA 2HQ3A 2HMIA 4GVBA 1TKTA 3TEGA 1Q86T 1XBWA 2XNQA 4L3NA 1RU2A 1TR0A 5LMNF 3LWLA 3Q8RB 3KK1A 2ZJQQ 2AJ1A 1N5TA 1RT6B 2DGOA 3N28A 3MMBA 2AJFE 2BE9B 3Q0AA 2VL1A 1T03A 2B56A 2KXFA 3M2VA 4P73A 5IM0A 4C7QA 1C4AA 4KHPF 1VDHA 3ENQA 2NS1B 4NYZA 4KBIA 1HBOA 3N01A 4P10A 4CLKA 1VBYA 2CPYA 1SC3B 3QPIA 2VPXB 1F5AA 3EUNA 1KQKA 3UD4P 2VFUA 4CM2A 3MM5B 1S1WB 3PFOA 3F73A 2PA8D 3SV3A 1X9WA 2HHWA 2YPZA 4X4OA 3KJQB 4DL2A 1ITPA 4MAKA 1N8RT 4DJBA 4K50A 2KDOA 1YVFA 1HNIA 2ZZMA 3T5JA 2IRXA 1NK8A 1K44A 2HK3A 4OJGA 1KS2A 4WJBA 3FBFA 3E2EA 4X4PA 3MM7A 3U7JA 1RXOB 1VRQC 2QFJA 2FJAB 5B08A 2DPIA 4DPYA 3M30A 4DZDA 5EWFA 3MCOA 4CM0A 2IM1A 3QWUA 3ZTPA 1GTEA 1NJYA 1WOSA 1X5OA 5C24B 3ZNJ1 1M5SA 2ASDA 5M2PA 2YWGA 3O44A 2MKIA 2CXEA 2VDHA 3FQKA 2UV8G 5DETA 1WKLA 3UVJA 2GVDA 1UPMB 3IN5A 1S9GA 2OPRB 3HFZB 3EPGA 1ULRA 2Z2MA 4O0IA 2QYGA 3JAMY 4U9RA 4DCPB 2YKPA 2V8GA 4AL5A 2BV3A 1VQSA 2M3DA 4NMXA 4U7UD 2HRYA 1I1GA 2WONB 4W90B 3PM9A 1NK5A 4GC6A 2DHHA 9ATCB 1AYEA 2V0NA 3ZNUA 2PSZA 1T9TA 1TL1B 4DSLA 3MPWA 4B3MJ 1HNVB 1QE1B 2C3MA 1N5SA 2J8SA 2XSJA 3RGIA 4JI4F 3JTNA 3N5BA 2JDJA 2EFGA 1NSPA 2AX1A 2CYYA 2M70A 3DLLQ 4QZVB 3W9IA 4CTAA 4OX9J 1PG5B 3SYZA 1IR1A 5A76A 2HQCA 4PWDB 1NHKL 2VC1A 2Q6CA 3RAMA 1NKCA 4ZITA 3ZXWA 3ISZA 4QIWD 1GTHA 1RBAA 2RRAA 5LM7E 4OLOA 4RW8B 4RUBA 1BE4A 3SSRA 4PR6A 3DNCA 2HGLA 1Q78A 4FF3A 5EWGA 2ILZA 4NEZA 2GMJA 3OFHA 2HZVA 2VASA 2DR7A 2DHGA 3JSMB 2FVCA 4KB7A 2N7CA 1G1XA 2D3ZA 3R9LA 1OPZA 3QIPA 4ED2A 3TI0A 3BEGB 3KJFB 2QA2A 5IC4B 2UUWA 2XS7A 3F56A 1TL5A 3LALA 4DR7F 1CJUB 1HI1A 3DRPA 4LRFA 3OW2R 1UFWA 4IO9Q 2XO6A 1S99A 3GJSB 3B82A 1N5VA 1R8CA 4BC9A 2CQ0A 3BGUA 5CZVA 3DM2B 1WDDA 3MAHA 4WFNQ 3PRVA 3RRKA 4ZPVR 3CD7A 3SCKE 3NMAA 2C2KB 2OEJA 1N32F 2IDLA 2W2OP 5IS2A 4B3TJ 1QAJA 2BW2A 2LYVA 5KG4A 4ECUA 1S6UA 2XNRA 3DKDA 3EVOA 1N6QA 2CADA 2HMIB 1JLGA 4I4BA 4GVBB 1C0TA 5L1KA 1Q5VA 3TA0A 4LF6F 1YRUA 3EDRB 3DLBA 4QR2A 1WF2A 2LVWA 2C3YA 1S77D 2D74B 3EZ5A 2DNLA 1QSLA 3HD2A 1U2RA 2VFSA 1FRHA 4IG3B 3LAKA 5B0AA 3MI7X 1GAOA 3DXSX 2GA7A 4DV3J 1NJIT 4OYXA 3M32B 2AIRB 2ZC3A 2GO9A 3TANA 1W26A 3M2VB 4ITSA 2VZ9A 3GQCA 1VFJA 4OI3A 1S4EA 1HBOB 4RNHA 1KLMB 3UDCA 2XI2A 2EBEA 3RAQA 2VG7A 2DR6A 2WZ1A 3CJ2A 2W8LA 2Y0SD 4B9NA 4PUOA 4WZMA 4JI6F 3CDWA 5K20B 4K59A 4OI6A 4ZIVA 2YX4A 3SFGA 5KFRA 3BO3A 1JNRB 2JX2A 2A0FB 4USVA 3FNNA 5CABA 1TKZB 1F2HA 3W9JA 4DLEA 1UVNA 2XG8A 4NASA 2D9PA 5KFHA 4WWSA 2MSSA 3K59A 4CH7A 4MFBA 1GX5A 5ETOA 2CJXB 2UZAA 4DV5J 4I69A 1XR5A 2IMOA 4OYPA 3VGUA 2ZNZA 1HW9A 2VBXA 1YITS 1WACA 3I56S 2UUAF 2R7OA 1RAJA 1U49A 3BH7B 2G0IA 1SV5B 2HFZA 4UT4A 2RILA 1VRUA 3MHYA 1FERA 4U8YA 3PFEA 2IVFB 1GMWD 1HWUA 3JTOA 3C2PA 4JI4J 2G2YA 1T3OA 4FF1A 2YQ1A 4CYUB 2CKWA 1VBZA 2MPUA 2NYHA 1UW4A 2GIRA 3PO5A 3RZAA 2FUG9 1H3DA 3KLVA 1T7PA 4V19J 4Y2AA 5KAKA 1Q16B 3NXZA 2HHVA 3R2CJ 2FLOA 3FJ2A 2WTFA 1WC1A 1SUQB 3TQ1A 2XY6A 4W98A 2VV5A 4ZLJA 4EWTA 4YN3B 4LFAF 3P8BB 1WF0A 1PGZA 1S9EB 3EZUA 3MMJA 1JKHA 1HQEA 1EX8A 4FNIA 2BKPA 4ECSA 4RBTA 2XHWA 3Q8SB 3KUGA 2EFOA 2FZCB 2ATLA 3K17A 5KG1A 1FJGJ 4P75A 1S0OA 3D9BA 3P5BP 2ZWPA 1MWYA 2DISA 3L4BC 2XB2D 2V68A 3JYTB 1IKXB 4DV0F 4KO0B 2X7IA 2R8IA 1VIOA 2OEKA 2AJ2A 1Y00A 3KJVB 3KLGA 4DSEA 3HX9A 4ICLA 3DHXA 3H2LA 1N32J 3D28A 4LF4J 1AROP 1LWCA 1ZS6A 2ADBA 4LF7F 4K2JA 1F6TA 4MKVA 2ZE2B 1SC6A 2LEAA 4C8ZA 3NGUA 1Q7LB 1KVJA 1H2VZ 5U47A 3OVAA 1CVJA 3CDUA 3C15A 5D0RA 3BREA 1JXEA 4LF6J 1UA0A 4CWBA 4ATNA 3NY0A 1SIZA 4LF1A 2WHOA 2VBWA 4E98A 1LK7A 3W8GA 1N4LA 4J9QA 3RYLA 2KHCA 2E1PA 1RTJA 4AD6A 4LSLA 4OJHA 1RACB 1X9SA 3AJ1A 2CPDA 3M6VA 3I5AA 3PVXA 2CDQA 2HNZB 4RU2A 1CJVA 1SB6A 4JI8F 2QTWA 1RAAB 2N3OA 3TR5A 1JLFB 5KFKA 4WE1A 5KFBA 2EWHA 2BRKA 4ZHRA 3CCVS 1AT1B 1CQNA 2KJWA 4XK8C 4WFYA 1R0CB 4JI6J 1R8HA 2EG2A 2W2NP 2VA3A 2EFNA 2KKHA 4DN9A 3C16B 2ALZA 2IM3A 4CLPA 2FLNA 2ZH1A 1N5QA 4KV8B 2QEXS 2WAQD 4PAAA 1F1BB 2QA1A 3UNYA 1TVRA 2XMTA 5K9FA 2Y1RI 1W2BR 4DV1F 4C11A 3A4TA 1HBNB 5KG3A 5A8WA 5L9XA 4EU0A 3LAMA 1NKBA 4YUDA 4Q2MA 1D8YA 2NXUA 2UUAJ 2W9BA 3KTQA 3MCSA 3M2UB 4O3QA 1WC3A 3MGJA 2KH9A 3BH6B 4ZMMA 3V6HA 3QFHA 3T1HF 1Z2LA 5GAEU 4X65F 4I0WA 4IOBA 4JV0A 1B70B 3VAHA 1HA1A 2B7CB 2M88A 4Y0FA 3CMES 4M8LA 3QO9B 4Q7AA 3V81B 4CLUA 4F7VA 1NSKL 5DG7A 1MNEA 4O3OA 4LFAJ 1MW7A 1CEZA 4KHRA 1AB8A 1PSDA 3UO0A 1KOHA 4NOHA 1SKRA 4A4JA 1IM6A 1REVA 2XMJA 3I4HX 5HBMB 2VF3A 3G8QA 5A0YB 1VK8A 1RAHB 2ALYB 2HS0A 1LWEA 2ACYA 5LT5A 1JJCB 4RW7A 5A6PA 2O3DA 3NBPB 2HWTA 4NLTA 4YB7A 3KMQA 3QRPA 1G6BA 1YJNS 3G6YA 5KFAA 2ZBQA 1F3FA 3R6GB 1NPKA 1RHQB 4DOZA 3SXLA 1X4AA 2A1BA 3M8RA 3HVTA 3W8PA 4DV0J 3OR2A 1U0SA 4TN2A 1IKWA 3SZ2A 2I5JA 2PGCA 2NSBA 1HQEB 1U1MA 4C48A 2C1EB 1RAGB 3FRZA 4NXMJ 3OHBA 4IOCQ 2OPSB 4IO1A 2W4CA 3PJWA 4DR2F 2A3JA 3R5AA 2YX7A 4RW9B 4ECQA 1Q82T 3CCES 3MECB 4KYZA 5K8NA 5T14A 3CD6S 2J5AA 1P1TA 3D66A 3LOUA 3B78A 1AZSA 3P96A 1R0AA 3W7BA 1T0TV 2VG6A 5MLCV 4WFBQ 1AW0A 2OD4A 4U95A 5IOLA 1SH0A 2CQ1A 4B3RJ 1KNZA 4DL3A 2XI3A 4JI8J 2H5IB 2M2BA 4CDIA 1LWCB 4JI3J 1RWKB 4NLSA 4Y3CA 1YJ7A 1RE1B 2LA6A 5CYMA 5GAGU 1MMNA 2ZFHA 1XERA 5ETTA 2ZH4A 2DRDA 3ZZOA 3C15B 2YKMB 3T19A 1NK4A 2Q3PA 1Y5IB 4UOCA 1YHQS 5IQ6A 3BB5A 2ZH3A 1S1TA 3TNVA 1RKIA 3QJPA 1RLDA 4X4UA 2OTJS 2OPQB 2BJ9A 2EK6A 3ZTOA 2MZSA 2ZM6J 3KK3A 2WSCC 2OSQA 3V6JA 4WU2A 4JI2F 4QOTA 4CLFA 4F67A 5A8KA 4DX7A 2HNYB 3OTOF 3OT9A 1F3VA 2J76E 3FBEA 5KFEA 1RADB 2WK4A 1VC0A 2E5JA 2VFRA 2YTCA 1RTIB 3UDLA 3C14B 2L9WA 3MAAA 1YX2A 4DR6F 4J37A 3J7Z5 2DCUB 5EUHA 4UTGA 4DUYF 3MEDA 3JQKA 1YQHA 1LOUA 3DYAA 4ZVOB 2GAHC 3KUHA 4DV2F 1CJKA 1YK9A 3I82A 1WSVA 2DO0A 3QATA 4RU9A 4P2FA 1U25A 2QX0A 3T1HJ 4X65J 2PA3A 3FDSA 3IBWA 4MT1A 5F41A 2C42A 3NGSA 2YWFA 3FMBA 4LVNP 2BBEA 1NM2A 2EK1A 5HQMA 3H4BA 1QLNA 1IKYB 4P7TA 1RU1A 1FESA 4P2XA 2DGSA 1KN6A 4Q0BA 4ZKAA 1LW2B 2FY1A 2RVJA 2HBRB 4F3MA 3Q89A 2W9BB 3NAHA 2WOMA 5LSRA 2BKNA 3UWTA 3MPUB 2DHAA 5HVHA 3MCMA 3ETMA 1YDLA 2CQCA 1UEUA 1TK0A 4OYAA 3G6ES 5HI7A 2R9LA 2P9EA 2V2VA 4G65A 1O51A 3D6FB 3VZHA 4GKKF 3SQGB 1UA1A 3TA1A 2NXNA 1U8WA 4JI0F 4F0KA 3UPFA 2HW3A 4Q8FA 2OH2A 4RPFA 3N5FA 2HGNA 4HL9A 2NUHA 2R7XA 3R8YA 2BJEA 2LEBA 2H51B 2V2KA 2AGQA 4OHZA 5KFUA 3MZIA 2ADCA 2KZMA 3I31A 3FCVA 5DLFA 2GAGC 2QRRA 2AZ3A 1L5UA 3NCQA 3EXCX 1N36F 1V3SA 1X4EA 3JSBA 3KHRA 2KO1A 1YG0A 5GAHI 5M2UA 2NZ4A 3Q2SC 5LL6d 5KFGA 1K8AT 1K0VA 4CNZA 2MZRA 3ZO7A 3KMSA 3THPA 3L9ZA 1Q8BA 1IBKJ 2NSCA 1Z1ZA 2I1RA 1LWFB 3OVBA 3CD0A 4IG0A 2VKRA 2N4DA 3HKZD 3I0RA 2RRBA 3GR1A 5KFXA 1OYDA 4RWWA 4LF5F 5F0UA 4USIA 3DU5A 5E2QA 3W65A 2IA6A 4PG4A 2AYMA 2AHOB 4OJ1A 5CHCB 5AE3A 4YQWA 4I2PA 1DTTB 4L6V3 4CO4A 3EVWA 1AA1B 4YB6A 4X4TA 3KFWX 4QIVA 2MQPA 3P6YC 3R3TA 4C2MA 2V9KA 1N52B 1OS5A 1A0OB 3LP2B 2MZQA 2HVDA 1IQTA 2CRLA 1F5BA 1R0AB 1BLUA 4B3SJ 3OLBA 3PR5B 1WHVA 1RHKB 2VG6B 3DHWC 4WFAQ 4ZVHA 1UEVA 1FFSB 2GJFA 3I55S 1RTHB 1DARA 4OI4A 2EPIA 4LF2A 1GNKA 3AAWB 2B8PA 1AXQA 2BJ3A 3BR8A 4C6AA 5HO4A 1FI4A 4E0DA 4ENOA 5HP1B 4DPXA 1WSRA 4JI1F 1SQEA 2BQUA 4J9KA 1JLCA 4DR6J 2MKSA 2RH3A 2DRBA 2HGMA 4DUYJ 3M9OB 1U24A 1S1TB 3AJDA 3L09A 1CQMA 2LP4A 4USTA 2VA2A 3RR8A 1SVDA 5DQIA 3UCGA 5KFVA 2QGFB 5A2QU 4IRDA 3HULA 2HKEA 3K89A 3IO1A 4NWBA 5F8NA 3NCRA 2UV8A 3R1LA 5B0CA 5K8PA 1BQNA 4I56A 5JMNA 2J9CA 4URSA 4C8OA 1QVGR 5KFYA 2E5LF 1K0TA 3QGGA 4K4WA 4RJVA 3UQSA 2R2RA 3MAAB 3HHLA 5THWA 4KH0B 4LBHA 4HDGA 1EQMA 2I2YA 3UCZP 1UMJA 2KVQE 1U47A 3TP2A 1Y3JA 3MUMP 1OWXA 4O44A 3DGVA 3QRRA 5EX3A 1T05B 2HHHJ 1HBMA 1B0VA 1R3NA 2CPZA 2DK2A 2V4RA 2RKIB 4QW8A 2YNHB 4GKKJ 3H4DA 3DMJA 5KFZA 2GHVC 1GEHA 1GMVA 3MMCA 4F4AA 2W9CA 4DX8H 4JI0J 4J9LA 2XCPA 1MROA 1KRPA 4YDXA 2M9KA 1NJXA 1P6TA 1T02A 2VJVA 2MGZB 5FLXU 2B4OA 2BJ7A 2IM0A 1YJ9S 4X4SA 4DR1F 4GO7X 2WOMB 4KGKA 1DQ9A 5IC6B 2HHSA 1RA7A 4OZ5A 2KM8B 5HROA 4P72A 5HQLA 3CNQP 1Q81T 3QT6A 3IRXA 2ZH5A 2YKAA 3GJTB 1N36J 2BOAA 2Z2LA 3PR4A 2IA0A 3HLUA 1EQ0A 3A13A 2V9WA 3OUYB 4TLQA 2EBGA 5DDOC 2X1FA 3PDNA 3BN7A 2WBMA 4PG5A 5D0EA 1XQIA 4OHWA 4OYBA 4IH7A 2RHQB 2A6MA 3IR6B 4IRKA 2VKZG 2RF2A 1S72S 2V4JA 2EFPA 2O1PA 3J7A1 3W64A 2CZ4A 1R27B 2HFUA 2GGPB 2RJZA 4HI1A 2ZDOA 4K4ZA 4HDHA 2BX6A 2MQLA 4K4XA 5HLFB 4PG6A 2HIYA 4O3NA 2YNFB 3V4IA 1S1XB 5C25A 7FD1A 3KJNB 3CPWR 2ATCB 3DI6A 2DYAA 4LF5J 1OQ6A 4ZIWA 3PTWA 4Y2KA 1HARA 3POTA 5GMKa 1KWMA 3IBCB 2B3TB 3UDEA 1TZ0A 2LQ9A 4BC7A 1ZTTA 3HVAA 2BQRA 1F60B 4J9RA 4P9SA 3DU6A 4BLGA 2IC3B 3C6UB 5KFSA 1HL6A 4EO6A 5A8RB 3EVMA 4NCGB 4NXNJ 5DQHA 2ZUGA 2AQ4A 1RAIB 3DXBA 1VIXA 2IRUA 2L9NA 4BS2A 1T11A 3TA2A 2Z30B 1TU0B 3GP9A 4I67A 1WJ9A 2VG5A 3NOGA 1I3OB 1NK7A 2CJAA 3R2DJ 4QWEA 1IKVA 4RNOA 2BE2B 1YRXA 1TL3B 3CCQS 2ZH9A 2H4YB 1TAQA 1FWKA 2GHWA 5KFNA 3CJTA 4B3OA 2ZHBA 4TU9A 1X4FA 3G9CA 1RI7A 1TL7B 4H4OB 5ETMA 3I5CA 4A8QA 2IHR1 4Y6IA 2R8GA 4ZK7M 2IPOB 2MLZA 3A8JA 3W2WA 4Q2LA 5LJ5Y 3FEZA 1FE0A 1JQGA 2UVWA 2R7SA 1C4CA 1TQLA 2J0WA 4OHVA 4USJC 3D3BJ 1NSQA 2E5LJ 2H5JB 1GQEA 4D3GA 3HPOA 2ZD1A 4EK2A 2RE1A 2G1HA 3FEXB 4F4ZA 3NGRA 1UCNA 4EYHB 3KLIA 1SI9A 3MD3A 2F9JA 3GJRB 4LSZB 1N5YB 1R31A 3QFWA 2PFDA 3MM9A 4NL5A 4ZLPA 4GRSA 1OO0B 3H90A 2VQEF 4TU7A 1JMTA 4NCAA 1ZAWA 4XDCA 1HR0F 2XMUA 3R5CA 3DOKB 4ELTA 3TJAA 3AODA 3R27A 3M8QA 2HNDB 1TV6B 4MIAA 1D3WA 1FRLA 3GLJA 1BQNB 1TMMA 1VQLS 2MMYA 3GJQB 5I4MA 1YBAA 1FO1A 2JVOA 3CCTA 5KTQA 1WWHA 1S97A 5CYQA 1ZZNA 4DR1J 4LBIA 2UU9F 1FKPB 4CO3A 1UJ6A 5HANA 4DF8A 1LQ9A 4CH1A 3RBXA 1X5TA 2YXLA 2UXCF 4AUKA
chains in the Genus database with same CATH topology
4RWXA 4FF3A 2KT3A 3FSYA 3CDAA 1LW2A 5EWGA 4HVZA 1Z2ZA 2DNPA 2ILZA 5J2QA 3HMJG 4WKRA 2ZJRQ 1RYRA 2GMJA 1H38A 3OFHA 3R1HA 4K4TA 2CVIA 4HTIA 5J1EB 4KJIA 3D1HA 2FJDB 2VASA 3M6WA 5IXUA 4PKDB 4Q5VA 3MMCB 2DR7A 3OHAA 2DHGA 3JSMB 2FVCA 4KB7A 4YMEA 3I5BA 2N7CA 2MDAA 4AL7A 2XS2A 1G1XA 4Q8EA 3MPVA 2D3ZA 4QIFA 1KHVA 3DN9A 1SKWA 1OPZA 1XMBA 2U2FA 4EZ6A 2LEPA 2ILYA 2WBRA 3QIPA 4ED2A 3TI0A 3BEGB 1JLQB 3CCJS 3T6BA 5H9FJ 5KT3A 2QA2A 1F0XA 2IRYA 2UUWA 2XS7A 3F56A 1EP4A 2BM0A 1TL5A 1X5SA 3LALA 3PW0A 4R25A 4DR7F 2K2PA 2KI2A 3MR2A 5J2PB 5BYQA 2LDYA 3IS9A 4OHXA 4UW2A 2PI4A 1HI1A 1LXNA 2VONA 2VFVA 3DRPA 4NXNF 5LMUF 3OW2R 3MEKA 1F2GA 1UFWA 2HHTA 4IO9Q 3SQGA 2ZC4A 3KG0A 3PIOQ 1S99A 3I96A 3C6TA 1AUDA 1AFIA 4I7FB 3B82A 2YWHA 1N5VA 3GFZA 1R8CA 5CYMB 2DNRA 1HWIA 4YR3A 1TK8A 1S0VA 5EN1A 4ZOSA 3LGMA 4BC9A 2DJWA 2CQ0A 4CH0S 5KFFA 5ITHA 3BGUA 1MMDA 4LQ9A 1EETB 3DLGB 4FXDA 3BF4A 4IQMA 3QLHB 1NNDA 5CZVA 4C8NA 3DM2B 1HYSB 3MAHA 4WFNQ 1YJUA 1K73T 2VBZA 3RRKA 4ZPVR 3CD7A 4A8WA 3LP0B 4B9UA 2DR5A 3FZ2A 3SCKE 3NMAA 3F44A 3D2WA 2ZJPQ 3KHGA 1N32F 1HWJA 2BOPA 4AE5A 5E0OA 5IS2A 1QAJA 3LP1A 2BW2A 2LYVA 3IAM9 1FRXA 5KG4A 4F50A 1S1VB 2WB4A 2XMKA 4ECUA 2GW8A 6FDRA 1S6UA 2CQGA 2YH1A 4DMZA 3CUNA 2XNRA 1N6QA 4CIOA 2KT2A 2HMIB 1JLGA 4I4BA 1ZM4A 3VAMA 1NU4A 4M94A 4B08A 4J9PA 3KK3B 3PY8A 5KG7A 2RU9A 2WSFC 3DRYA 3OLAA 1C0TA 1NK9A 4IDKB 2IYGA 1JJ4A 5B0GA 4LSNB 5L1KA 3PIPQ 1IJEB 4IFYA 3LQVA 2OMLA 1Q1KA 4X66F 3TA0A 5A8KB 1ZH5A 4LF6F 4EGLA 1YRUA 1C0UB 3A8EA 2CQBA 3DLBA 4QR2A 3MM8A 3W2VB 5DDQC 5J2MB 2OPPB 1U1PA 2ZHOA 1U48A 2KT5A 4WXOA 1WF2A 2LVWA 5DS7A 1HI0P 2YNIA 2ZBIA 3FSIA 1Q4RA 5B7WA 4ZDNA 3T5LA 2DGQA 2C3YA 2V94A 1S77D 1UVKA 2D74B 1XTZA 2FLLA 4NLYA 3EZ5A 1QY7A 2DNLA 2LU2A 2K3KA 4ES2A 1QSLA 1WG4A 3L7OA 1L3SA 1U2RA 1S6QA 2BM1A 2R2UA 4LMZA 2VFSA 1FRHA 4IG3B 4OLPA 3LAKA 4FYDA 4MYTA 3HK2A 1Q8IA 5B0AA 3MI7X 3NCPA 2NPFA 1WHWA 3TVYA 1GAOA 3DXSX 2KXNB 3W3SA 2GA7A 4M5DA 2JEIA 1RT7B 2J9DE 5AXLA 3PEJA 4TY8A 1NJIT 4WFZA 3M32B 4ZPCA 2B5JA 3IG1A 4DS5A 3NL0A 2ZC3A 4P2SA 2GO9A 3TANA 2IM2A 1VQKS 3MEDB 4TYAA 3M2VB 2OP5A 1A6LA 2B6AA 5JXSA 5I3UB 3DYAB 4B9SA 1LWFA 4ITSA 4QR0A 5D4PA 3IAS9 3H5YA 2VZ9A 4J9OA 3GQCA 2VOPA 3EPIA 1VFJA 4OI3A 3QYYA 4MKYA 2DH8A 1HBOB 5KOWA 2IJNA 4IFVB 2P6TA 3JTPA 4RNHA 1KLMB 3UDCA 1NHUA 1X4BA 2XI2A 4RW4B 2EBEA 3CJKA 3RAQA 2VG7A 4N5SA 2HVIA 1HBUA 3VQTA 1F5CA 1R8PA 2XC9A 2AP6A 1J5OB 3D1OA 2NR0A 3MR6A 5KT5A 3CJ2A 2D1CA 2D7SA 2W8LA 3OSNA 2Y0SD 3KLHA 4B9NA 1TUVA 3SDEB 4PUOA 1OSCA 4JI6F 2IAJB 3M8PB 3H40A 4WZMA 3CDWA 2FGCA 1ZETA 2MHEA 4K59A 4QBUA 1H98A 2FJVA 4OI6A 3SEOA 3J80Y 3V6KA 1DTTA 1QTMA 4WZQA 2CPHA 4ZCKA 1DLOA 2YX4A 4LUBA 3SFGA 5KFRA 4B17A 2RD5C 4MK7A 1JNRB 2JC0A 3BO3A 1SL0A 2B7BB 2JX2A 4ED8A 3NRBA 1MWZA 4H4KC 3S7RA 3FNNA 2JLGA 1RGVA 1QUPA 5D3GA 2AF6A 3LP2A 4Q0BB 1TKZB 3K58A 4C9DA 4IKAA 3CWJA 2FVPA 4DQSA 2XZWA 4P6QA 2ZH7A 1FEHA 4DLEA 1UVNA 1QSSA 1HNWF 2NLWA 3M4XA 2XG8A 1J2VA 2D9PA 3ZZ0A 5KFHA 1SJ4P 2DH7A 2EFQA 2MSSA 4DG1B 3DFEA 3K59A 2VG5B 2Q6BA 4CH7A 4MFBA 2W7OA 1Y0HA 5M2RA 2DGXA 1GX5A 5CH7B 3THVA 3I0SB 5D4OA 1RTHA 4MJKA 1X0FA 1SXLA 4LT6A 1RISA 2UZAA 3MM6B 4F4WA 1VHFA 4I69A 5BYRA 3Q23A 2I0XA 1XR5A 2IMOA 2CQHA 4CO1A 2XGPA 2JEGA 5GVQA 1FK9B 4B3OB 4X64F 3H20A 2C2DA 2VFTA 2ZOGA 3CMAS 2ZNZA 1P9QC 1DQAA 1HW9A 4U7UK 4F4XA 5B0EA 1O5JA 2VBXA 1YITS 1C1CA 2IFXA 5KT4A 1WACA 4G1QA 3BQ1A 5K8MA 1HQUA 2Q43A 3I56S 4FS1A 1G3OA 2R7OA 4G6VB 1RAJA 2MKJA 5HP1A 2UUAF 1O0PA 1U49A 4ILLA 2EVZA 7FDRA 2R8KA 4NX9A 1SV5B 2JHEA 2HFZA 3HHKA 2J6SA 1LXJA 5H9EJ 2RILA 5CA5A 1VRUA 3M2RA 1FERA 3MHYA 3OR1A 4RW6A 3S01A 2YKQA 3WC0A 4PQUA 3GIJA 3PFEA 2IVFB 1CC8A 1XWLA 2P9GA 2QA4G 4TXSA 1HWUA 3JTOA 3C2PA 1URRA 1T3OA 2NUUG 1BGXT 5HQ8A 4FF1A 3F41A 1B7FA 2MB0B 3MOJB 1X9MA 3CXCR 4P7VA 4QU7A 2CKWA 2KG0A 5L1IA 1VBZA 2MPUA 3FFIA 1WHYA 3QZ8A 3SCJE 4R0EA 4KAIA 5SZTA 2B4PA 2RDIA 2R4FA 1RT2A 4C98A 4J9SA 3IWLA 1L3VA 3DLEA 3ONQA 4RNFA 1UW4A 3LO3A 4TLRA 5I3QA 1FJ7A 3PX4A 1WD6A 4YDDB 1YIJS 2GIRA 3CT9A 4Y34A 3PO5A 2FHMA 3RZAA 2FUG9 1H3DA 4HT7A 1GXTA 4UQTA 4BCAA 3KLVA 3IR5B 1T7PA 4V19J 4Y2AA 5KAKA 3RB6A 1Q16B 2NYIA 2HHVA 2FLOA 3FJ2A 2WTFA 2I9SA 4YR0A 3HZGA 1SUQB 3KLEB 3TQ1A 2XY6A 1RT4A 3KG4A 4QWCA 1I6JA 1JLEB 2VV5A 4EWTA 4J9NA 3IXQA 4LFAF 3FEYB 1H7XA 5E3RA 3PHEA 2FC8A 3MM9B 4ZCLA 3CCSS 2YNGB 2RUGA 5F8JA 2J0QD 2VOOA 4L72B 3ZFVA 1FRMA 3U1NA 5K8OA 1FHTA 3C8YA 2UXDF 2GJIA 1SBRA 4OZNA 1RJJA 2J6TA 1WF0A 2MKCA 4F02A 5I3PA 4DV7F 4ZCMA 1C2PA 4B3TF 1PGZA 1FD8A 1S9EB 2RQCA 4ECXA 3EZUA 2DHSA 2ZOFA 3MMJA 3WBZA 1KHWA 1JKHA 1HQEA 4O4GB 4Y2MA 3MXHP 1HW8A 3GFXA 4TYBA 4FNIA 2QMXA 4ECSA 4WCEQ 4RBTA 2XHWA 4OQJA 2IVYA 2MQMA 3DOLA 1BQXA 2F3JA 1GT8A 3Q8SB 2UVVA 4JV5F 2HZCA 5J2NB 2ROPA 3TAMA 3HXMA 5CYJA 3MURP 3SFUA 2EFOA 1SJRA 5L1JA 2UVUA 3OXFA 4C97A 2ATLA 1NAQA 4NLUA 5KG1A 4N76A 2PIIA 2UVRA 5IWAF 3RW7A 3RB3A 4ZPWR 1T05A 1RT5A 2DNNA 2F40A 3G71S 4C8YA 2NPIA 4ILRA 3HJFA 4KE5A 1S0OA 1VQNS 2K1RA 3M1VB 3QGPA 4NZ7A 3LPYA 4NRTA 3OL6A 4IG0B 3RB4A 1MWYA 2DISA 5CQGA 2QSFA 2XB2D 3UCUP 4RZRA 2RKIA 3I0RB 4N56A 3GV5B 3JYTB 1ROFA 2XLKA 2YNHA 2P6SA 3K5PA 1IKXB 4DV0F 2XO7A 2X3GA 1KD1T 4FBTA 5IT9Y 4N8NA 4ED0A 1V9OA 4DDFA 4MMOA 2WSEC 4KO0B 1LV5A 4QU6A 2L3MA 2DR9A 3OTDA 3NP5A 2AYEA 4DV3F 3I9V9 2XBPA 2R8IA 1VIOA 1N48A 1VC5A 1RYSA 4Q45A 2GV1A 1U7LA 5FD1A 4DL0C 4I2PB 2XLJA 1Y00A 4KFBA 3KJVB 3PW7A 3KLGA 4DSEA 2MGZA 2OKQA 3MFHA 2FPHX 1A9NB 3G6VA 1IM4A 2AJQA 1MU2A 3VAGA 5L39A 1B64A 4CO2A 3ZZRA 5FDLA 1U1RA 2QV6A 3HX9A 5KFPA 3VAKA 1PILA 2E66A 4ICLA 3KNAA 3MUVP 3OSPA 1S48A 1FDDA 3DHXA 2OFHX 3H2LA 3US5A 3D28A 2N82B 1VQ8S 1JJ2R 1AROP 1LWCA 1HMVA 1BQMB 5F8GA 2ADBA 4LF7F 4YFUA 4OX8A 4DQRA 4YY3F 3O2IA 2IYIA 2JVRA 5C42A 2ZE2B 1R89A 4NLVA 1SC6A 4C8KA 1LK5A 4RUCA 2LEAA 3GIIA 4C8ZA 1Q7LB 1KVJA 1U4BA 1XC9A 1H2VZ 5U47A 1R8AA 3OVAA 1UP1A 1UAWA 5JUMA 1CVJA 3CDUA 2ABYA 4FPRA 4UY8T 2OFGX 3G8TA 1H2TZ 2F9DA 3BREA 4U7CA 1JXEA 3MD1A 3MMAA 3LH2S 5E33A 3VQSA 1UA0A 1VGYA 5D77A 4YB5A 5KFQA 4ATNA 1JXLA 1VQ9S 1SIZA 2WHOA 3C6TB 3OUYA 1N54B 2VBWA 2B43A 2WW8A 2GIQA 4J9MA 3PW4A 1PO6A 4E98A 2R2SA 1UVIA 1CC7A 4KSEB 1HPZA 1LK7A 1N4LA 1FF2A 4J9QA 3RYLA 2KHCA 2M0GB 1WTBA 4DF4A 1RTJA 5DG9A 2DRAA 3IGNA 4LSLA 4FVMA 2CQIA 4I6YA 5B0FA 4DUZF 3PX0A 1S49A 4OJHA 1JLCB 2D9OA 3B8HA 2FHJD 4OZJA 4QWAA 3PV8A 4FF4A 1X9SA 1FD2A 1QUVA 5F8HA 1S1UA 3AJ1A 2CPDA 3BGRB 3M6VA 3K5MA 4DWIA 4DV5F 1S4FA 2CPFA 3MEEA 3K8VA 3AB4B 2LLZA 3I5AA 3EXYA 3PVXA 4DFMA 2CDQA 1HNZF 4QYRA 2HNZB 2OD6A 4RU2A 1SB6A 4QJVA 4JI8F 2DPJA 2PFFB 1SH2A 3G4SS 1TFYA 2R2TA 4CT8A 1NO8A 2JOQA 1WHXA 4DS4A 2N3OA 2GGPA 4A8OA 3TR5A 2DGWA 4MKBA 3ITHA 3MOZA 5D4NA 1JLFB 4I2QA 1VK3A 2V8VA 5KFKA 6FD1A 4WE1A 1UKUA 3RTVA 4Q0BA 1RT6A 1Y4ZB 5KFBA 4KC5A 5HLFA 2EWHA 2YNFA 1S1XA 2BRKA 5F3TA 4ZHRA 1S6PA 5I42A 3ISNC 4Y2CA 3CCVS 3MAQA 5LSOA 2EC0A 1A7GE 5F8LA 1E6YB 2YQ3A 4OIXA 3CVKA 1CQNA 5KFOA 4PCQA 5GAEI 2A2DA 2KJWA 4XK8C 1DHMA 4WTYA 1YI2S 5CXTA 4WFYA 2FTRA 1GXUA 3MM8B 4YHHF 5L1LA 4G1PA 2CPJA 1R8HA 3AY0A 2EG2A 4C8MA 3AJ2A 5E3PA 4ECYA 2VA3A 1H2UX 2EFNA 2HQIA 4BDPA 2KKHA 4DN9A 2E29A 3OTCA 1QSYA 3MF5A 3T1YF 2W7PA 3PKYA 4JUZA 3TAQA 2IVMA 3U27A 2LQBA 4Z37A 2ALZA 2X51A 2OIHA 1N0UA 3HHLB 4K0KF 2IM3A 2FLNA 1WELA 2AJ0A 5D4LA 4QR1A 4ZVEA 3HT3A 2ZH1A 2JEFA 1N5QA 4KV8B 2QEXS 2DGVA 2RMLA 1FJEB 3K57A 2IC3A 3MR3A 2ROGA 5KFTA 3MM5A 1S1WA 4TY8B 3AB2B 2FHJA 3C6UA 2WAQD 3GG1A 5KT6A 2PD1A 1H7WA 5BJRA 1SL1A 1P8GA 5A8RA 4O44B 2IJFA 2QA1A 4URQU 3TW0A 3OJUA 1CSJA 4LQ3A 5CD4H 1TVRA 4HYKA 1HBMB 1OSDA 2XMTA 5K9FA 2FIUA 3CC4S 2Y1RI 4NCGA 1W2BR 4DV1F 4DR5F 4C11A 3HHEA 3E01A 4XO0A 1HBNB 4FZVA 5KG3A 4NLOA 2XMMA 2C22A 5A8WA 2G9OA 4ZPTR 3QJLA 5L9XA 4AFFA 4EU0A 3NKYA 2BQ3A 3LAMA 3OXGA 1S76D 1GXLA 1XR7A 1NKBA 4YUDA 2AW0A 4TQSA 4Q2MA 4ES3A 3PW5A 4N77A 2ZVSA 5KG6A 1D8YA 1ZZFA 2NXUA 3DMJB 1NJWA 2W9BA 3BSNA 3KTQA 2EFVA 4YB1P 3MCSA 3HDSA 3M2UB 3I4PA 5DGBA 3BO4A 3RAXA 1TKDA 4CQ1A 5EHHA 3QMQA 2I8EA 2W9CB 2B4UA 4C0OC 4O3QA 1ZM9A 4B9TA 2YKNB 3UI3A 1MROB 1WEZA 4M95A 1FJGF 2Y1JA 1JWWA 4WKYA 3MGJA 2BE2A 2KH9A 2W8KA 2E9TA 4HKQA 5JVHQ 1TL3A 5KG0A 4ZMMA 1B0TA 3BSOA 3K8WA 3MEGA 3V6HA 5B0BA 1R43A 2E7WA 4EFAC 3T1HF 1R8BA 1Z2LA 1U09A 3D0IE 3V4MA 4X65F 5GAEU 5D3GB 4EZ9A 4I0WA 1VRTA 1UJ4A 2DB1A 4IOBA 1FNMA 3KNGA 2R7UA 1NK0A 1VMBA 1FKOA 2C2EA 4JV0A 3VAHA 2X1BA 1HA1A 5KFMA 2AYGA 1KFSA 1DZ5A 3VR1A 4H4OA 2B7CB 4ECVA 4ZPDA 4BWMA 2M88A 4Y0FA 4H54A 2MYFA 2RSQA 1XEZA 4TKTA 2WCXA 2AGPA 3CMES 4M8LA 3QO9B 3DRRB 5HROB 4Q7AA 3V81B 4IH5A 1ZBTA 5C24A 3IRXB 2J7KA 2P9CA 3OVSA 1ZTWA 2XY7A 3PRBA 5T7LA 5DG7A 2QMWA 1MNEA 4O3OA 4ECTA 4NPOA 1RT3A 1MW7A 5IT4A 1CEZA 3V6DB 5HMXA 4EYIB 2EKYA 3HVRA 1WTFA 3HVWA 2CPXA 2CZVC 4DV4F 1N34F 4KHRA 1Y3KA 2EG1A 4PQAA 4WYLA 1M5VC 2OPRA 2RDJA 4LF4F 4B9MA 4EBDA 1PSDA 2R7RA 5FIIA 2LKZA 3CCMS