4P2XA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
186
structure length
167
Chain Sequence
RNIIADKYDEASVLFADIVPALVRFLDRLYSAFDELVDQHGLEKIKGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRNPVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVMRTWYLIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Adenylate cyclase
publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 39
structure length 167
sequence length 186
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2xA00
2BW7A 4USUA 3G82B 4CM0A 1AZSA 4WP9A 2GVZB 1CJUB 4USTA 4OYBA 1CJTA 1Y10A 3C15B 4NI2A 3R5GA 1TL7A 1CJUA 1WC3A 4OYAA 1CS4A 2WZ1A 4CM2A 5D0GA 1WC4A 5IV3A 4OYWA 1WC1A 1CJKB 4P2XA 2GVDA 4CLYA 4WPAA 4OYMA 1YBUA 3G82A 2QV6A 1WC5A 2GVZA 4OZ3A 4P2FA 1CULB 5IV4A 4OYPA 3MAAB 3C16B 1WC0A 3C15A 4OZ2A 3ET6B 2W01A 1Y11A 3ET6A 1U0HB 3UVJB 1FX2A 1WC6A 4OYIA 4CLUA 4CLKA 5D15A 1CJVB 3C14B 1CJKA 4USWA 5D0EA 4OYZA 4CLZA 1AB8A 5D0RA 4CLLA 1CULA 4CLSA 3MAAA 5D0HA 3C16A 4USVA 1CJTB 1YBTA 4NI2B 1TL7B 4CLWA 4WP8A 4WP3A 4P2MA 1FX4A 3MR7A 1CS4B 1U0HA 3UVJA 4CLPA 1CJVA 3C14A 4OYXA 4CLTA 4OYOA 1YK9A 1AZSB 2GVDB 4CLFA
chains in the Genus database with same CATH superfamily
2VBXA 3ZTPA 2E44A 1KRPA 3TUJC 3TA2A 4DS5A 3DU6A 5ETTA 2GGPA 3NBPA 4RJVA 5K8OA 1S1UA 2CXEA 4DV5J 1JXVA 1BHNA 4DLEA 4B3OB 2GVZA 1S0OA 2M8HA 1JMTA 2I6WA 3IO1A 4I69A 5DG8A 4I68A 2F9DA 4EZ9A 2F3JA 3DMJA 3CO0P 2FC8A 2WOMB 3SCIE 3N4WA 3KXDA 2VUGA 4N47A 4G65A 3CF5Q 3M7VA 4I6AA 3M2RB 3RAXA 2FHMA 3CJ4A 5KFJA 1X4DA 2G0CA 4O3OA 1T94A 3M6XA 3UD4P 1EP4B 4NRUA 3QJLA 4HDGA 1FHTA 3PXGa 3TAMA 4CO0A 3KLFB 4V19J 4UZCA 3KLGB 2DNMA 3PR4A 4KC5A 1KP6A 1EKRA 4A47A 2UUBJ 4ECZA 2UXDF 4WKRA 4F0MA 4DUYJ 2BE7D 3NAIA 3J7AN 4ZS6A 1RHRB 4CO4A 3D1OA 1PGZA 2GNKA 3I5BA 1FNOA 3NGRA 5DZ7A 4CH0S 2PDAA 1Y3JA 3UD3P 3CEDA 4NXMJ 2GO9A 4OZLA 2WB4A 4TVAB 3U1MA 2BZ2A 1H2UX 4JI0F 1SJ3P 1EETA 3PRDA 4PZVA 4I64A 2HHTA 7FDRA 4EK2A 1FKPA 3H2UB 3N9UC 3MMBA 3WC2A 3TAPA 4LRCA 3PKMA 4OHWA 1MLAA 3MEDB 3HFZB 4N77A 3OR2A 2JLFA 4YDDB 2WBRA 3WZ0A 3NCQA 4RNMA 3BN7A 4N56A 3QO9B 2HHWA 5KFBA 3EXCX 4CO5A 3V6DA 4WFNQ 3HJFA 2CDQA 3AJDA 5DETA 4JI6F 1RT3A 1S4EA 4NCAA 3EVWA 1Y5IB 2MTLA 2D3ZA 3OR1A 4QBUA 4RR5A 1NB2A 2KZZA 3LO3A 1SB6A 1DURA 3MWBA 2UUCF 1XMQJ 3DLLQ 2Y8WA 4ZP8A 2XBPA 2FY8A 3H25A 5AE1A 4ZN1A 2YX7A 3UR0A 1RT1B 1XERA 3G4SS 3OSPA 5HP1B 1N36J 1WHWA 3DRSB 2UU9J 1VQSA 1R8BA 1HKAA 1XNRJ 1S0VA 3ZZZA 4NZ6A 3MFIA 4UY85 1XQIA 3ENVA 4K4UA 2RS8A 5A6PA 3OFEA 1HBNB 4MKBA 1PSDA 3OD2A 1SJFA 2VBYA 4ER8A 5CH7B 2B43A 4A8YA 1V6HA 1K9MT 4LBIA 1CVJA 1X5TA 5IM0A 1R6VA 1TKZA 2ZE2B 3C16A 2LYVA 4IOAQ 4QU6A 1R0AA 2X1GA 3IRWP 4FBTA 2FLLA 4DV3F 1FESA 1JLGB 4KTQA 3M30A 1I1GA 2CQ4A 4QR2A 4ZVSB 1R27B 1MU2B 4O4GA 2WVEA 4M5JA 4IFVB 3PM9A 1YRUA 1R0CB 4HH1A 4RUAA 3KJQB 2CQ1A 1Q1KA 3NL0A 2JVRA 1KC8T 2KU7A 1N0VC 3AT1B 1LK5A 2XG8A 2AEJA 4K5SA 2O01C 3A3NB 2ZM6J 2YY3A 2GC8A 2CA9A 3IAS9 3LANA 1RT2B 4PQAA 3F0NA 3TYTA 3M32B 1PIEA 4YB1P 4RBTA 2C2EA 2B0GA 2HQFA 3UNYA 4YEAA 1NKCA 4ZPVR 1VOMA 3G8SA 3MEGB 2KYXA 2AZ3A 3PO4A 3Q8YA 4ZVFA 3SDEA 1LXJA 3D7SB 4CT8A 3BDEA 4QWBA 4U6PA 4H4OA 3SQGB 1CC8A 2OPPB 5A2QY 2C2RA 1XMOF 1S9EB 4MK9A 3VZHA 2B8QA 4RNHA 4K4WA 1VQ7S 3ZZOA 1OWXA 4K5RA 1UFWA 4PPDA 1V5VA 1E6VB 3DRYA 4JB8B 4LF4J 2GJIA 2QL5B 3IMQJ 5ITHA 1VQMS 1T11A 1NJXA 4O3SA 2RRBA 1K0VA 3PX6A 3SXLA 2JL9A 1LK7A 2W2QP 3IA0A 2V2ZA 3DGPB 3T9NA 5DM7Q 3GSIA 2B4PA 1LW0B 2LXUA 4B9TA 1WWHA 2VASA 2AZ1A 3DHXA 5D77A 1CJKA 2ZITA 3M6WA 2YWWA 2VHGA 1FO1A 1IBMF 2BKNA 2HQGA 2Y1JA 3W5ZA 3L4BC 5KT3A 2MMYA 5KFYA 4Z7YA 3TW0A 3H20A 5C42B 2XLKA 3H5YA 2QA4G 1BQMB 5JVGQ 5C25A 3J7YU 3FEXB 3CC7S 3TZXA 4A48A 3H5SA 1SQEA 4C8MA 4NASA 2F63A 2CNKB 2KI2A 5JMNA 3N01A 3FBEA 3H40A 2MXYA 1VQNS 4XDDA 3OTOJ 4M5MA 2HHVA 1XIQA 2IMWP 4XPCA 3GSDA 4JV2A 2V8PA 2K3IA 2FJEB 3US5A 1EIYB 4O44B 1IBCB 2VQEJ 3MM8B 2HPUA 1SQFA 2XWYA 3OHAA 2ZBPA 5J2PB 5E2QA 3LP2B 4RNNA 1T0TV 2D3OR 4WIQA 2H3EB 3CJTA 1Q8KA 2JLEA 2DH8A 2QIFA 1DQAA 2HFNA 5IC6B 4PWDA 4WZQA 2WVFA 1RTIB 5GAHU 4A8KA 3KHHA 4E2FB 4ITSA 2F8MA 1GK8A 3BGUA 3T5JA 4ES1A 1GQEA 2L48A 4R5PB 1JLEB 1VQ8S 3N28A 2ZBIA 2DCUB 3UCGA 1HNWJ 2CQIA 4KV8A 3C6UA 3KFWX 1TL7A 2FJWA 4DR7J 5CAAA 1VGYA 3RB3A 4DDFA 1SC3B 3B6BA 2E9ZA 1B4SA 2P6TA 4TY8A 1H0HB 4X64J 2IC3B 5E5NA 3RYLA 3QWUA 4MH8A 4YMEA 1RAGB 4RWXA 3JSBA 4KYZA 3VV2B 2MKCA 2BKPA 2ZKTA 1VLYA 4HHHA 3PW5A 3VAGA 2HYIB 2GFFA 4I7FB 2XC9A 1NSPA 1RHMB 2OTLS 1BC6A 3R8YA 1ZA1B 2DJWA 4C8OA 4EEYA 1S72S 3V5RA 1XC9A 2DY1A 3JQMA 2I2YA 3CDUA 2F4FA 3GFXA 3S8SA 4J9OA 3TVZA 2QN6B 5U47A 2J0WA 2IAJA 4AXJA 2QMWA 2MQLA 4AD6A 1M1GA 4WFAQ 3HD2A 4ZP7A 3QRRA 3PX0A 3QQCD 2HNZB 1R3NA 4B3RJ 3FQLA 5D0GA 3RG6A 2KVIA 2RQCA 3I0SB 1WJ9A 1MROA 1P9YA 5KFSA 3MPYA 1QM9A 1RWWB 1JJHA 3MEEA 3CCMS 1ZOTA 5LMNF 2SXLA 2DHXA 3NGSA 2OD6A 4KO0A 1FX2A 3IR6B 1PJ5A 3OTCA 5HMXA 1WF1A 3I55S 1YLXA 5A0YA 3CWJA 3M9OB 3H7HB 2BW2A 3SV4A 1X4FA 4TU9A 1H6KX 4H4KA 3IC1A 1P1LA 4O4RA 1ZS6A 2KKHA 1NB7A 1NSKL 4I2QB 4RW8B 3W61A 4QOTA 4IQMA 2AKWB 1NO8A 5KT6A 3EE3A 4OZNA 4DR6F 3MM6A 3I96A 1TL1B 5D4OA 4ILMA 3LGNA 1D8YA 3OL7A 1X9WA 4A4JA 3FBBA 2DR7A 5DO2A 2D3UA 4IRCA 1RE1B 1WDTA 3IBCB 3P5TL 5B09A 3R2DJ 1KBRA 1TL3B 4DXLA 2IBKA 2HHPA 2FLNA 2ACMA 4LRBA 5DQIA 1R31A 2QX0A 4AE5A 4DV4J 1S76D 2ZOGA 2RHQB 2M52A 4RUCA 3SIPB 1FRXA 3CC2S 2JHEA 1U48A 2BABA 1EZZB 3AH6A 1YITS 1PC4A 3HSZA 4DL2A 3AXKA 2CQ2A 2ZH6A 1IKWA 4I56A 4DQSA 4ZHRB 4RU2A 4GVLA 2AYGA 4NX9A 3ISNC 1RT7B 5AT1B 2A3JA 4DX6A 1U1OA 4KAIA 1R6YA 2XO6A 2EG2A 3FSXA 1Q79A 3VAFA 4DR4F 3D67A 4DHVA 1RSCA 2DNZA 4WK3A 2YPZA 2LEPA 1REVB 4DF8A 3K5LA 2VODA 3CD5A 1HYSB 2HLUA 2JC1A 4X4PA 3FVYA 4OYIA 2V4JA 4C0HA 3TWZA 4JBCA 1S10A 2RDJA 4DL4A 2BE2B 3PY8A 1G6BA 1MMNA 3GQCA 2W24A 3J7A1 3AQPA 2U1AA 1S6QB 2ZZNA 4IRKA 1CG2A 1RT4B 4CLTA 1FFGB 1WDDA 5HBMB 1I5OB 4DI6A 3TVYA 4IFYA 3RZAA 5G0RB 3AXMA 4QR0A 4K4YA 5B0FA 3ZZPA 1F3FA 5HAOA 4HHUA 2BR0A 2RQMA 4UOGA 2YQ0A 4QPXA 1GTEA 5H1SV 1HR0J 4C9DA 5AE2A 4DL5A 4Y2IA 1U1KA 1RUSA 3BGRA 3MUTP 2GHWA 1F5AA 1SUQA 5HROA 2C2ZB 2HBZB 2FYXA 4H4MB 2XYHB 2OEJA 4C11A 4G3IA 4GRSA 5CCLA 5F41A 4EYHB 5D0EA 2V9KA 2ALYB 4LF5F 4G6VB 4WFZA 4LFCJ 2R7VA 1VQ5S 5J2NB 3HT0A 4DFJA 5B0CA 3DOKB 2G4BA 2M70A 2IRXA 1FTRA 1S7HA 3MECB 1T9XA 4NMXA 3CJ3A 3CNQP 3LTOA 1VRUA 2LDYA 4OJ3A 2IA6A 3QT5A 4OI0A 2OPSA 4RBUA 3M9MB 2H4YB 2ZNZA 2G0JA 4FYYB 2HS0A 1HNZF 1VRQC 2W7OA 3GLJA 5ETRA 3KG1A 1GH8A 3Q22A 2BM1A 3EVOA 1WTFA 2FHKA 3WDOA 1WKLA 1UTAA 4P7VA 1Y00A 2NPFA 2ZUAA 3IS9A 2UVUA 4Y3CA 2XMAA 1N5SA 4DR5J 3EZOA 3GU0A 2EI5A 3FC9A 1Z2LA 5FDLA 3HMJG 5KFRA 2QSWA 3LWLA 2DGQA 1EARA 3RW6A 4AYBD 4EYIB 1NSQA 4GO5X 5A8WB 4DN9A 3C14B 3D4JA 3K7RA 4ZPWR 1B7YB 2K2PA 1HNIA 2H4WB 3CCWA 1X5PA 1Q4RA 1S4FA 1SVDA 5DZ6A 4FDFA 4ZKAA 3RAMA 4USVA 4DUYF 1RKIA 3KOAA 2AYEA 2CPHA 1SJ4P 2QLFB 2HMIB 3CD7A 4LVNP 4ED6A 4DR2J 3AD8C 3MTKA 4DSLA 5C25B 1S1WA 4NXMF 3HVTB 1Y7PA 2HHUA 1OO0B 3A4TA 3KWMA 3RB6A 3ITHB 2PA3A 5AXMA 2XULA 1T03B 2KXHA 1G1XA 2E7WA 3V4MA 5F8MA 5B0GA 3GIKA 2FZCB 4E98A 2DR8A 4DPYA 4DF4A 1UJ6A 2E1PA 1F6TA 2Q79A 4C48A 3TZYA 2GZOA 4CO1A 2MKIA 3H0PA 2AQ4A 3MDFA 4LF8J 5SUHA 3T1AA 2QC3A 4YDXA 1U25A 3VAKA 2CDRB 1IR2A 2IA0A 2QGFB 4K4XA 2KHDA 1ZM4A 3VAHA 1FRKA 4KGVB 3PW7A 3BZQA 4EBDA 2XYPB 3I31A 3BF4A 3EMTA 4QIEA 1XMQF 3EGNA 2IYIA 2W2NP 1RXOB 2EVZA 4HTJA 3V4IA 1KSPA 1N36F 1FJEB 1IBLF 1QE1B 2UU9F 1D8ZA 2I5JB 4HI2A 4JI5F 3CCUS 1T3OA 4J9LA 2GIFA 2EPIA 4QYZJ 1RK8A 3CCES 1U6FA 1UVIA 4HT7A 3VGTA 4ENOA 4DSKA 3GONA 1ZZNA 2CQBA 3KDNA 1XR6A 2V2QA 2LQBA 3WC0A 2B6AB 2XY5A 3PYGA 1YBAA 1JIHA 3J7ZT 1YG0A 2YKAA 4JI7J 3OHBA 5F8LA 2DXDA 2FHOB 2GIQA 4PXCA 1LOUA 2J0SD 1RISA 1F60B 5KOWA 4OJHA 3CE8A 2WONA 3RW7A 5IFMA 3GR1A 2CG4A 2B56A 5F0WA 1J27A 3G86A 5KFOA 2APOA 4L74A 2QMXA 3FFIA 1N33J 5K9FA 5T7LA 3LALA 2YNFB 5J2QA 5D0HA 2R8HA 1N6QA 1FDBA 2K1RA 1X4CA 5FLXY 3BBBA 3FCHA 2MHNA 2ZM6F 2J6UA 2I9SA 1BWVA 1S1XA 2DEIA 1RZMA 1X4HA 4ICLB 1ZZFA 4DFKA 2R2UA 5LT5A 3DRPB 3MPUB 4HACB 1OYDA 4ZVOB 4W90B 2C2NA 2NXUA 4O0NA 3E01A 2RE1A 1T05A 4CZCA 2WSFC 2JC0A 2MZ1A 2KG0A 3T5KA 1AUDA 3VGVA 3RGIA 1WORA 3OVBA 5E33A 3NWGA 2FUG9 4F4XA 4ZP6A 3H4BA 1WUUA 2GHPA 3B82A 3UNGC 1FCAA 1RWOB 1T7PA 3HKZD 4DFPA 2OH2A 4X65J 1RA7A 1V9OA 4O3PA 2DNGA 1NK5A 4A8SA 1WOPA 1PYSB 2OEMA 2M2BA 3C3LA 4B3SJ 1QVGR 3KG0A 3KJFB 5A0YB 3ZZYA 2QRRA 1JJ2R 3QIPA 2C2KB 5A76A 5D8HB 4IO1A 4ZVRB 3X1LB 2OAUA 2W9BA 3CUNA 2J9EA 2BV3A 5KFMA 4LF4F 4YB7A 3UVJA 1UL3A 5T41A 3P96A 4MKAA 1C1BA 1RWXB 4CLFA 3W62A 3U1LA 1G2EA 1X4AA 3IRXA 1HBMB 3R3TA 5CYMB 1HFEL 2KTQA 2KT3A 4X4NA 1PC5A 3TX0A 2QJ3A 1UW9A 1NHKL 3PX4A 4YR3A 5GAGU 1HWKA 2OPRB 2VF3A 5HQ8A 2B8PA 4OX6A 2DNPA 2RD5C 2K8GA 5LSRA 2FVQA 2ZD1B 4GVBB 3CGIA 4KQZA 2VG7B 1S9FA 2HQ3A 1C4AA 3M1VB 3W2WA 3DRRB 5A2QU 1QVFR 4OHXA 4KY3A 2KXNB 2Q66A 3EZUA 2B7CB 3QZ7A 1T8EA 2ZHAA 1TKTB 3OTOF 3Q8RB 3ISND 4KT0C 2QL9B 5EDWA 3NY0A 2BA9A 4FS2A 2V8GA 3DLKA 4OX8A 3GTYX 2VKZG 4DPWA 5ETKA 3O1LA 3C6TB 4Q0BA 1CSJA 1KHWA 1FRLA 5FIIA 2GMLA 1RADB 2Q6CA 3T1HJ 1FI4A 3LP1B 4O3RA 3GIRA 2B4VA 3M8QA 1SH0A 4KH1B 1CJUA 1S97A 1HBOB 5ETNA 4L76A 1FE4A 2CZ9A 3KYLA 3B4DA 1TTHB 3TO8A 2ZZMA 1UETA 2BDPA 1XMBA 1XJWB 3CD0A 2JOQA 4FP9A 3BSNA 1HNXJ 4QWDA 3VAIA 1DTQA 1RTJB 2KJWA 1TMJA 1EJ7L 3QGHA 3LUYA 3TANA 1LQ9A 3VVUA 4DUZJ 2ZUGA 4QYRA 4W4MA 1RTDA 3L3CA 2OMLA 1S9GA 4KR0B 3SCJE 2FZGB 1RWUA 3FEZA 1X9MA 2BACA 4USMA 1UJ4A 2R7QA 2FGOA 3DLHA 3CCSS 2C3PA 4RW7B 4S0MA 2JRSA 3BS9A 5BYSA 5F8JA 3MMCA 4URQU 3DLEA 3GV8B 2YWGA 1RAHB 4OJGA 4JI8F 4J9UE 2HWTA 2WVCA 1XTZA 3UO0A 3QSIA 2OFHX 2EKYA 2VQFJ 2HWHA 4UF4A 5HLFA 3V81B 1JB0C 1W7WA 2ABYA 3OLBA 2E5JA 3JAMY 2B3TB 1TKXB 1ZM2A 5THWA 1RA6A 2UUAJ 2MSTA 2VFSA 2NPIA 4J37A 4BWMA 4CYUB 2ZWOA 4XTTA 1BQNB 1BWEA 3CTRA 3CJKA 2K7JA 2ZH3A 1SV5B 4HLBA 4Y2KA 3BQ2A 1B70B 3W63A 4FF2A 1H7WA 2R7RA 4B3RF 1S1VB 1S7IA 2N3LA 4LIRA 4X2BA 2DIVA 1CJVA 1WHVA 5L1IA 3N6MA 1T9UA 4WKYA 3IBFB 3Q2TC 1KS2A 4J9MA 1NSAA 1SL0A 1RYRA 4YB6A 4GKKJ 2MPUA 4OZ5A 3P49B 1DRZA 2P9GA 3J80Y 1Q7LB 1JLFA 3KLIA 1KKHA 3EXYA 3ELHA 3DLGB 1U1PA 3T3FA 2H5JB 1RWKB 2GVDA 3MMJA 2ZHOA 4LSNB 3MPDA 4ED5A 1JLQA 2COLA 2YKMA 3VAJA 1NKBA 4CT9A 4X4OA 1IM4A 3BYRA 1N5YB 4MAKA 5KG3A 2IBOA 1C0TA 4Y2AA 2QYGA 1VQOS 3T1YF 2QSFA 5HI7A 4TYAA 1N34F 1ZTWA 3N0VA 2H48B 4CLLA 5KFTA 1NBEB 4IKAA 1RKJA 4FNIA 2B9YA 4PQUA 2XLIA 2BANA 4RW9A 2E7VA 3PW0A 3PG9A 5DDPC 2HNDA 5LMUF 2Z57B 1HQEA 4LSLA 3C19A 1HW9A 4CM0A 2B9XA 4C2MA 1NK0A 2CJXB 1WKKA 4NI2A 2J8AA 2ATCB 1VS3A 2F40A 1NXIA 4ZVUB 3PYDA 2LQJA 2HNYA 3GR0A 4Q7AA 1RHQB 1DQ9A 2VPXB 2X3DA 4ZVHA 4DSIA 2ASYA 4OZ3A 2QE5A 2DRBA 4B3TJ 2ZH8A 2PMWA 2CWXA 1RT6B 5LL6d 5AJ3F 4PUOA 4YR0A 3C46A 1N4LA 2AWZA 1H2VZ 2G9OA 3D6FB 4LJMA 2EFQA 2RRAA 2Z58B 3OXLA 3KJVB 1UA1A 1QJHA 2FVSA 4ZK7M 2BUNA 2V0NA 2XTJP 2OMOA 3RBZA 4F36A 4CWBA 4LBHA 4EMDA 4PPZA 2W2OP 1DLOB 1L3UA 4MYUA 3MOZA 3V4IB 4JI3J 5GADU 1JKHB 1LWCB 2W2MP 3W1YC 1CLFA 4TU8A 3O3LA 3SFUA 5LJ5Y 1RU2A 3VQTA 2GV1A 2KJVA 4DV7J 2ZBRA 2MZQA 1YJ9S 3OJUA 3BPSP 4NLYA 2YNHA 1Q82T 5KG2A 2L41A 1GAOA 2FHJA 3I56S 3GYXB 3B54A 3CMAS 4WJBA 3M8RA 1I94J 1NH8A 3OXGA 4KBIA 2V5HG 2LU2A 2PE8A 1FKOA 1Y3KA 2OD4A 3GCXP 4MFBB 4OYPA 5C2CA 2H54B 2AJ2A 2WSCC 3O6QA 3DOMB 3G87A 2ILZA 2Q3PA 5K20B 5A8RB 4JI4F 2VG5A 4AQYF 2A18A 3NGKA 3ENAA 1JXEA 2EK1A 2D69A 4DG1B 3R1HA 1GMWD 4LFBJ 3CULA 4DCOB 2YPYA 3K2YA 1FVQA 1WTBA 3KUGA 3MMAB 3UN3A 1YIJS 5E3QA 1QAYA 4F67A 1EKSA 2NXNA 3DM2A 4O3QA 2MKHA 5JJBA 2BJDA 2C1EB 4LR7A 3UFCX 3MM7B 1Q81T 1WOOA 1ZAXA 4QIWD 2FVRA 1C1CA 1WEYA 3OVSA 1U02A 1XBWA 2Q43A 1QSLA 1CULB 3KLHB 2LECA 3MI7X 1TUWA 2O67A 1HHTP 1S6OA 4ZIVA 1LXNA 3HPOA 4HKQA 4ILLA 2X3GA 3NGDA 3RRGA 3LW5C 3W7BA 4C0OC 1J5EJ 1VRTA 1TV6A 2W9BB 3F44A 3QLHA 2HWIA 2UXCJ 3LPYA 3QT6A 4M5HA 1SC6A 1TMMA 4ZCMA 1KEKA 2BKOA 2XMJA 1FA0A 2ZJPQ 1LWFA 4F3MA 1QAIA 1OIAA 2BBEA 1L5UA 2FLPA 4DR5F 3NRBA 2ZOMA 1IKYA 2XZWA 4A46A 4Y00A 3CMQA 5KFNA 2BQ3A 1TVRB 1LEOA 3MM5A 3JTNA 3QWPA 3CJSA 1RT5B 3S7RA 3OQ2A 4Q44A 2PEBA 5J2MB 7AT1B 2MSSA 2W7AA 3KLVA 1NUEA 1TL5A 1S1TB 1X4BA 4MIAA 4XDCA 4ZA1A 5E3RA 1DTTA 1YJRA 1Y0HA 1JLBA 3ISZA 2XMMA 1Q5YA 3GIMA 5D3GB 1S12A 2GS8A 3TZZA 3QMQA 2VDIA 3R5AA 2CPXA 2RMLA 4ECQA 3D6MB 1YRXA 1F9FA 3DLKB 3RAQA 1SKWA 3VVTA 2Y8YA 5E41A 2R2TA 3AA8A 1F2HA 3AD9C 2DH9A 4GKJF 2AX1A 2MB0B 2VZ9A 5A8KB 4MKVA 1SXLA 2B5JB 5C2GA 3HI9A 1CJUB 4A8FA 4AUKA 2ZJQQ 3EYZA 3DOLA 2W9CA 4BC9A 5GAEU 4FYDA 4LF7J 3HD1A 3POTB 3MFHA 4ES3A 3FRYA 3RR7A 2BRKA 1DTQB 4PKDB 1KLMB 3PRBA 5LSLA 3G82A 5AXLA 4NLPA 2KN4A 2EC2A 2GW8A 4NLWA 2Z8QA 3HHLA 3UCUP 1FVSA 2EFOA 4K7QA 2HQIA 3GYNA 2LA6A 5F8GA 2XWXA 1QDUB 1HPZB 2LP4A 3PEJA 1RBLA 4OX7A 1J5OB 4OV6A 1VQKS 5M2PA 4DV0J 2G2ZA 4C98A 2NXEA 2YKNA 1P27B 2DKOB 2X1AA 3SFGA 2DEJA 5DGBA 2H1YA 1IKXA 1SKRA 4E8UA 2BEFA 2BJ9A 1HMVB 1YVFA 3VTIA 3M6UA 1CS4B 1JLAB 4DX5A 4RW4B 4X4RA 3PNIA 2GJFA 4L72B 3W2VA 2DIUA 3OLAA 2HHSA 4JI7F 1SC1B 3GG0A 4LF6F 3THTA 1AZSA 2ASDA 3RTVA 3A3OB 2DO4A 3CCQS 4NEYA 3H42A 4NMLA 1N32J 4DBQA 4RPFA 2DISA 4YP3A 4DR1J 3NP5A 2CG8A 4PG5A 1FRJA 4YHHJ 4J7CA 4TXSA 1TP7A 5D6GA 2O66A 4GC6A 3VGUA 1RAEB 3PCOB 3S6EA 1M0SA 1EQ0A 1CQMA 1V3SA 2LQ5A 4LFAJ 4USJC 4CTAB 3MOJB 1FJGF 3H90A 2YNIB 2J7KA 1FRMA 4C8ZA 4Q43A 4DSFA 1HWIA 2DHGA 2VBZA 4OX9J 1X0FA 4CH7A 5IWAJ 4DSJA 5IZHA 3TUIC 2H5IB 2XS2A 1YDLA 3UI3A 3MUVP 4X62J 4RW6A 4RX6A 2HVDA 4CLWA 2GAGC 4JP8A 5DLFA 1IJFB 2AX0A 3QATA 1IBKJ 1AROP 2W8KA 4TLQA 3UDEA 3K17A 3GZ7A 4R8UB 5DDRC 1JK9B 5IXUA 5K14B 3NAHA 2OO4A 3KUHA 4DV2J 4H4KC 4F3OA 2VDHA 1OS5A 4TQSA 5K5MA 4B3MJ 2WVDA 1M1KT 4NLDA 2DGUA 3OXFA 2P9CA 4PWWA 5D4PA 2FD2A 1IQTA 4LRFA 2V67A 1SCJB 4MMOA 1F9EB 2J6SA 3CDAA 4UW2A 5L1JA 2E9TA 1M90T 1KFSA 4KGZB 5KFHA 5L46A 5E3AA 3MR2A 4I1TA 5CYQB 5EHHA 2CWKA 3R27A 5B0BA 1WEXA 4Y2CA 4K50A 5FLXU 3N6LA 2ADBA 3HO1A 1U1QA 3IFEA 3MAHA 1NDCA 2W8LA 1IKVB 3LA0A 4YY3J 1IM6A 1WOSA 3HZGA 1OSDA 3KK3B 3W9JA 4PQUB 1OSCA 1RHUB 4I2PB 1JNRB 5HL7Q 2XY7A 3UE2A 5C24B 2CJAA 1FDDA 1IN0A 3D0HE 3D6HB 1QD1A 5I3UB 5EGYA 5K8NA 1PJ6A 1U0SA 1X5SA 4DUTA 4ETZA 2NQPA 2GHVC 2QLXA 3CJ2A 1RDRA 4K4VA 2KFNA 3HVWA 2QMUB 3GJSB 3TVKA 1AXQA 2V6AA 2UVWA 1DBDA 3HULA 2RF2A 4RKUC 1TKDA 4X4VA 2CQHA 3B8HA 3ILJA 3LQVA 1JLCA 2D3O1 3J81j 1QAXA 4OI2A 1S48A 4Y28C 3BH7B 2IVFB 4OYMA 1YBUA 1K73T 1MNEA 4G1QA 1XNQF 5JXSA 3WQPA 3OUYA 2XI2A 2ZH2A 4R0EA 3T19A 2G13A 2MGZB 2E5LJ 4X66J 1BY9A 1OJ4A 3CD6S 4ZLPA 5CA5A 3CMES 3EPIA 1Z1ZA 3JQKA 5CD4A 1VIOA 5M2RA 2W7PA 4O0IA 2J76E 3L9ZA 5IT9Y 3KHGA 2V8VA 2CJKA 5DDOC 2A1BA 2MZJA 4PWUA 3ZXWA 4BCAA 4FKXA 4DJBA 2I1RA 1YJTA 2IJRA 1YK9A 5HATA 3D1QA 5L1KA 3QGIA 3KK1B 2YX1A 4DV6J 1W2IA 3R6GB 1NM2A 3BBFA 1BMQB 5D78A 4O23A 1UMJA 2MLXA 1HQ2A 3FMWA 5BR8J 3ILOA 3K5NA 3AJ2A 2XNRA 1PAUB 3Q89A 3RR8A 2KM8B 3A8JA 1KQSR 2JJ4D 1I6JA 4F2SA 4NL5A 1UA0A 1KQGB 5IV4A 2WRMA 3BO3A 1MMLA 3GIIA 4KH0B 2JEFA 2ACYA 3HJVA 4I0WA 3PHTA 1G3OA 2W4CA 3K5MA 4ID5A 3IG1A 3EUNA 3OT9A 2V94A 3G96A 2ADCA 2OFGX 3MD1A 1TK0A 5E0OA 3NNHA 2W4PA 4IH5A 2VOOA 1ZPVA 1LWEA 2VQFF 1BD6A 5AE3A 5KFIA 2PEHA 4WXOA 1FXLA 1KN6A 3FZBA 3R5BA 4BBYA 2CZ4A 5AXNA 1U09A 4JI0J 1M5HA 5GMKa 5B08A 3D1HA 3DM2B 2IVYA 2AJ1A 2M5YA 1U8SA 1BLUA 3VWSA 3ULHA 1CJTA 3M4XA 4UTGA 4WF9Q 4EUVA 4UT4A 1VI7A 3MPWA 3NXZA 3TAQA 1YJWS 4JI1J 1C1CB 2IDEA 3UDLA 1LW2B 4NA1A 4Z37A 4UUWA 2OJ3A 3MM9A 1E6YB 2BQRA 1VIXA 2ILYA 4ZPCA 2ROGA 3E8OA 4WXWA 2IM2A 4XPEA 1VR6A 1R8PA 1RP5A 4KFBB 1OY9A 1V3ZA 4UOCA 2V2KA 3JTPA 1TU0B 3Q24A 4YR2A 4BLGA 1B0PA 1F2GA 2G2YA 4WE1A 1AFJA 4F2RA 4PEOA 3UW1A 4CP5A 1JXLA 4CI0B 4UOHA 1UPPA 2ZJRQ 2FC9A 2UVRA 4USUA 1TK8A 1VC5A 4IDKB 3M8PB 3H8YA 2ZBCA 2YNGA 3C15B 3JSMA 5LOQA 1FK9B 3HSGA 2A6OA 2F5GA 3JYTA 4AL6A 2CUYA 2DR5A 4IOBA 2KT2A 3LP0A 4DL0C 4IG3A 4DPOA 2H51B 2E29A 3T6BA 1VK3A 1UWBA 1K1SA 4DV3J 1VQPS 1U0HB 1WHYA 1S79A 2VG6B 5KFUA 3HHNB 4P9SA 5HQLA 1SKSA 4ELTA 2OSRA 4R25A 3N79A 1Y9OA 3R5DA 2X51A 2LCWA 4DPUA 1RTHB 1R8HA 2HIYA 2QFJA 1FJ7A 1VLOA 3KK2B 3J80U 1R8AA 2R8GA 2VV5A 4DSEA 1RBAA 2GMJA 2H9ZA 2V4RA 1UKUA 4KKOB 2CIMA 3Q2SC 1U1RA 5HJXA 2RH3A 1PYTA 5CCMA 4U8VA 2GA7A 3OW2R 4P73A 2AF6A 2DTJA 4Y65A 3DI6B 2DR9A 5M2UA 2F4VF 4AT1B 3M2UB 5HMWA 2VJVA 2R4FA 4BC7A 4LR8A 4HYKA 3Q8QB 4ECSA 4OQJA 4QIVA 1NHUA 3DXBA 1WF2A 2HVHA 2OI2A 2WK4A 4ZVPB 2G0IA 4UZBA 3W3SA 4DV7F 2KL8A 3D0IE 4PXBA 4B3OA 3I6PA 5D0RA 5J1EB 4ELVA 4LVOP 2ATLA 5DS7A 1UEUA 5DDQC 1I51B 1UPMB 2MLYA 5KFWA 4J91A 3SSRA 1RLDA 1N54B 3JS9A 3GFHA 2JEIA 2CQ0A 3S1TA 1YTYA 1AZSB 1DJ0A 2WOMA 2L08A 3I5AA 3M2RA 4F25A 3KNAA 4FF1A 2UP1A 4PG8A 3QBCA 3MGJA 3K58A 1EP4A 1VJQA 5HVFA 3IWLA 2IRYA 3MURP 1SL1A 1KFDA 2JZ5A 4I6WA 1IBMJ 4LFBF 1FRIA 4C8LA 4DS4A 2ZH9A 4B9NA 3MAAB 2XMUA 1NK9A 4YOEA 1SI9A 1PCAA 1SJQA 3Q8SB 1HBUB 4ZCIA 1RCXB 4URGA 3HFKA 2HHHF 3BR8A 1YKWA 4A8XA 4L3KA 1L3SA 2CNNB 3GPAA 2YWKA 4EBCA 2VPYB 3FUYA 1ZPWX 1NJWA 1YBTA 3TR5A 4P72A 3MEDA 1NCLA 4N5SA 2PT0A 5CXTA 2EBEA 2NR0A 4ZCKA 5GMDA 2DK2A 3HX9A 4OMFG 1W25A 2UUWA 3LF0A 3RBDA 3QO9A 1N8RT 5HJYA 2J6TA 4TQRA 2UXBJ 3A8EA 3BSAA 1U7LA 2LA4A 2CPEA 2MDAA 3IR5B 4LQ3A 3GFYA 5EWFA 3AHPA 5HQMA 4K0KF 4P52A 1ROFA 3HFVA 3EPGA 1J5EF 1WC5A 2VICA 2LEBA 2RILA 4QIGA 3G6ES 2DY9A 3KNGA 3CO9A 3LWMA 4MT1A 3CDBA 4FYWB 1RT1A 2QA2A 1M5OC 4HHJA 4CLUA 3I9ZA 4UY8T 4OLPA 1FJCA 2A10A 3IR7B 2F8EX 3DRSA 2R9LA 2E1MC 3U1NA 2NCKL 2DXFA 2KFYA 3DFEA 1T3NA 4FXWA 3SYZA 3A1YG 3H4DA 2EEYA 1H38A 1VHFA 3IGVA 2V69A 2IM1A 4QQBA 1T9WA 3FBCA 3H2LA 1S6PB 4OYXA 3GG1A 4FN5A 4KHMA 1XR5A 2HVIA 2ALZA 2RAQA 2VA2A 1MG7A 4K4TA 2Z2ZA 4KB7A 2B51A 2FLOA 1B3TA 4ILRA 1JLGA 3FEYB 4OHYA 3BO4A 2KDOA 2KVQE 1MU2A 3PW4A 1WC1A 1LFWA 4IFVA 2IY5B 4M5DB 1HNVB 4F4AA 2OP5A 4LRDA 1CBKA 2WTFA 1L3TA 1BE4A 5KT5A 2W01A 1WACA 4IG0B 4M8LA 4NCGB 1RQ0A 5LSOA 1D9AA 2VPZB 3E51A 4JYAF 3DXSX 3KJNB 3R5CA 1PILA 3ETOA 3CT9A 2B4UA 5DLGA 3M32A 1NKEA 5KG6A 2PMHA 3CCLS 3BSCA 3EX7B 4JV5F 5EUHA 2AEFA 2E5GA 1RLCL 3L95X 4N41A 3CPWR 1K47A 3OL9A 1NPKA 2EFNA 4U7UD 3MEGA 4LF7F 2JEJA 2GGPB 2HEKA 4IRDA 3CVKA 2AU0A 4NEZA 3NBPB 2UV8A 2MZRA 4FF3A 3KG4A 3IBWA 2Y3YA 2E66A 4C0BA 4B9VA 1S1UB 4ZP9A 2E7XA 5LMNJ 2GVZB 1TK5A 3OV7A 2HZCA 2RKIA 2L3MA 3SQGA 2OPPA 1RAFB 3WX4A 3G8TA 2R7XA 4YB5A 3CJQA 1S9EA 4Q5VA 3DMJB 1K8AT 4DMZA 5CABA 5MAOA 2IJFA 2CPZA 5DJBA 1JWWA 4DV0F 3GV5B 3IAM9 2BJ8A 4NA2A 4NYPA 1WKJA 1AT1B 1Q53A 4LT6A 4RO0A 2DVIA 4MIWA 2F65A 1E6VA 5T14A 2VFRA 2YWEA 4TY9A 3IG1B 1HWUA 4Q8EA 3GJTB 3TAMB 1HL6A 3V2UC 1QAJA 1NHVA 2NSBA 4DR6J 3DGPA 2J8SA 2ZFHA 2NYIA 4YHHF 5HSPA 1LW0A 2HIQA 5BYQA 5BXIA 2ZHBA 2AEMA 4NLRA 2AT1B 2VFTA 1EETB 1SIZA 4J9PA 2K7KA 1H74A 1FKPB 3MCOA 2NXJA 3P45B 3MMBB 1FEHA 2LDIA 5C42A 4OX9F 1NK7A 5B0DA 5IWAF 3VZIA 2HHXA 4M5IA 1AFIA 2PGCA 4KPCA 3OR2B 1BQMA 1VBKA 2HRUA 3MM9B 2JSXA 4X4TA 5B0AA 3FJ2A 3L7OA 5CZXA 2V4QA 2CJYB 3QIDA 3DLBA 2F9JA 3GV7B 2F7VA 4LSZB 4P74A 1H72C 3V6DB 1REGX 3PYFA 1RT3B 1Q95G 4O44A 1PG5B 1B0VA 3MM8A 3OR1B 4ANCA 4OL8A 4ZJOA 3M8WA 2I0XA 5EX0A 4V19X 3LP2A 3CCJS 1PYOB 2LEAA 1FNMA 4J9RA 2ZC3A 4DR4J 2R7OA 2J0XA 2WCXA 4CO2A 3NOGA 1C4CA 3ICLA 4D3GA 2XMKA 3IWNC 1RTIA 3M9NB 2AGQA 2KRRA 3TUZC 1LNQA 1DFDA 1U1LA 4DWIA 3HSJA 5KFPA 4QW9A 3OL8A 3R1LA 4R5PA 2Z30B 1FE0A 9ATCB 3LP0B 3HHKA 2XCPA 1QLNA 3VQSA 3SMZA 5IM0B 1TKZB 3PO5A 3C16B 4W92B 2CAJA 2BJ3A 5LM7E 1R0AB 3QJJA 1C0UA 4L3NA 4DPXA 2YH0A 2Z2LA 4J9NA 1HI0P 4CRJA 1KVJA 3M30B 2IC3A 5F3TA 3QT8A 4O4GB 3CJRA 2D7SA 3TRGA 3UWTA 1GX5A 5HMZA 2DHAA 1UW4A 4DX7A 1YQHA 4IH6A 3OFGA 4U95A 1YWXA 3GYGA 1YX2A 3I32A 3BN4A 4Q2MA 4LR9A 1H3DA 1RWNB 3WIVA 4WTOB 1ELOA 1NJYA 5DG9A 3A13A 2WBMA 2DNRA 2CPJA 1M1HA 1O51A 2GIRA 1Q5VA 2EFPA 4ES2A 2MQQA 4FS1A 3SSQA 3HKWA 3T41A 2E5LF 4X66F 4RL1A 4KJIA 3VCDA 2QZ8A 5DGAA 5KG4A 4LF5J 2LU1A 4WPAA 2YX4A 3HXMA 3SDEB 1HARA 4A8MP 1U6BA 3DRXA 1URNA 4C3MA 3TJAA 4H4OB 3BJYA 1HLWA 2HNZA 2LQ9A 2H65B 3I0SA 2VJUA 5ETOA 3R7BB 2A2DA 1T9YA 3ZTOA 2D74B 4DV6F 4DV5F 2G1HA 1F9HA 1U45A 1GT8A 3NOCA 2J5AA 1MN7A 3CCVS 1HNZJ 1XK8A 3EJMA 3J81U 1IWAA 5BR8F 4CLPA 4PABA 1F5BA 2A2CA 2B4OA 3U27A 3QAEA 1OYEA 1QUPA 4NCBA 2RSQA 2B7BB 4X4UA 2WW4A 3F41A 4OI1A 3MXHP 3CDWA 4ZDNA 3UPFA 1KVIA 4F8RA 2Y0BB 1KLNA 3BR9A 2PA8D 4JUZA 2HK2A 2DGSA 1DAXA 3T5HA 2E1RA 4L75A 4I2QA 5H9EK 4RW8A 1CJKB 1VBXA 1TR0A 4CLYA 4U96A 1S6UA 2E9RX 4ECWA 2EXUA 1FTCA 3UD5A 5KFVA 2AJFE 2HFUA 2UUBF 4Q2LA 1W26A 4OZ2A 1FDAA 1TL1A 4WCEQ 6FD1A 4WIIA 2RJZA 2XMVA 2HQDA 4J9KA 1RAIB 5IT9U 1UAWA 4F7VA 1KR4A 1KWMA 2X7IA 2CPDA 2R42A 5CHCB 3D3BJ 2YKPA 2Q6BA 4FBUA 3PHEA 1Q8LA 1TL3A 2A6MA 3MF5A 1S77D 4JI1F 4KGKA 4USKA 3FCVA 3EGWB 2BW7A 1JNZB 4GC7A 2VONA 5CYJA 3PR5B 2QO3A 1ZTTA 1H73A 4L73A 2XMWA 2C28A 4FPRA 5L39A 3OL6A 4WFBQ 3PEHA 5IS2A 1NAQA 2AJ0A 4PWDB 3G2XA 4ZHRA 4IR1A 2AYBA 4HH0A 1FERA 4A8QA 3VAMA 2B9WA 1RT7A 2V34A 3FGVA 4LF1A 1QSSA 1H7XA 3NLCA 3TP2A 1IBLJ 4TLRA 3R7NB 3R9LA 4JI5J 3H5XA 2V8DA 2RDDA 1REVA 2MYFA 3K8VA 3FDSA 4KV8B 3G6YA 5L9NA 4FYXB 2CYYA 3W64A 1HYSA 2HAIA 3FKBA 2D41A 1XNRF 3C6UB 1FNXH 1TL7B 3P5BP 1RCOB 3QAUA 1ACMB 4P2MA 1LV5A 4YS2A 1PKUA 2EK6A 6AT1B 1VJWA 4DPTA 4TY8B 2JFKA 4C8KA 2BE2A 1OPIA 1GFWB 2L9DA 2ROEA 4O3NA 2F1FA 5AXKA 1S6QA 5D4NA 4EWTA 2MLZA 2N7YA 1UCNA 3P4UB 1OPZA 3RB0A 3W8PA 1RI7A 2A0FB 1RT4A 2E5IA 3BREA 3L7PA 5HBMA 5I4MA 1WG4A 5G0RA 1O5JA 2POKA 2YBVA 1WG1A 2I8EA 2RUGA 5F9LA 2CPYA 1CC7A 2C2OB 3Q86A 1VDHA 2MKJA 5DRKA 2ZH7A 1ULRA 2WW8A 2GQCA 4ZLJA 2AV5A 4HEA9 3HHLC 1HIYA 1SH3A 2NZCA 3J7YI 1SKUB 2IAJB 2FJBB 3QYYA 2C3OA 1UEKA 3UCZP 2BXJA 1EHWA 2E5HA 4L6V3 4IR9A 3QFHA 2BMBA 4H4MA 2PN6A 2H5EA 2BX6A 1T95A 4DCPB 3KHRA 4N8OA 1MROB 4BDPA 3AODA 2RKIB 3MEEB 3PVXA 1EX8A 5KTQA 4DZDA 1K44A 4ZVEA 5J2NA 2DNOA 3TQEA 1LFPA 3DOKA 5KFZA 4ZVGA 2X1FA 4KO0B 4WZMA 3K0JA 1M5PC 4MTPA 1WSRA 1KONA 3MECA 1CPZA 4J90A 2OIHA 2PSZA 1KOOA 2E1AA 4P2FA 3B78A 3AOBA 4OI3A 2XSJA 5GAHI 4M95A 4XIUA 3A3PB 4JI2J 4PYAA 2W1BA 2HSEB 4EFAC 2Y1IA 3KKFA 1P8GA 1Y5LB 3GE9A 4J5OA 2XCAA 1WEZA 4NXNJ 4WTYA 4ECVA 2XNQA 3QJPA 1IUJA 4ZPDA 4DX8H 3N6NA 3D5MA 4N7TA 1FDNA 3PRVA 5ETQA 1KTQA 4ZLLA 1RHKB 3IM9A 3MM6B 1WF0A 4HL9A 4QW8A 3QRQA 4B9MA 1RAAB 3MR7A 3ZNUA 4F50A 4NLQA 1ZAVA 2HW3A 2CQ3A 1DQ8A 5A8WA 2DGOA 3C14A 4D3HA 3MD3A 2YKQA 2IIHA 2LXIA 3T6JA 2HLTA 4ZOSA 1SQGA 1NPPA 2ROPA 4R0JA 1V3RA 4FKYA 3LGHA 2R8KA 2HMIA 3GWCA 1IJEB 2XSFA 1VBYA 4CM2A 2D9OA 4I67A 4F26A 3HVTA 1BUXA 2ZDOA 2W4DA 2MQMA 3ITHA 1X5OA 3IN5A 1T03A 4YUDA 3H5UA 3G6VA 3AD7C 4RWWA 3P6YC 5LXYA 4DL7A 2KG1A 1IR0A 2V9WA 2PO4A 4K8RA 1N48A 4X4QA 1U47A 1KHVA 2W9AA 4XK8C 4BS2A 3G71S 3O8WA 3BSOA 2PI4A 2MQNA 1IKWB 4WFXA 3LOUA 2QA4S 2VQEF 2HBQB 2UXBF 1X31C 3PACA 4M5KA 4IYQA 2FIUA 3OVAA 1IXKA 4P71A 4Y34A 1TZ0A 2N4DA 3HF5A 3ENQA 2XY6A 3EGVA 2QEXS 4NYOA 2QFIA 3L09A 2V4JB 1QE1A 2I5JA 3SV3A 1HNWF 2R7WA 3H2VE 4U9RA 5KFFA 1VQ4S 1C0UB 4IQXA 4ZPTR 1YZ7A 2HVZA 3OTEA 2LFVA 3HT3A 3TEGA 2CKWA 4DR7F 2FJXA 2B6AA 3LAMA 2BJ1A 4ED7A 2HRTA 1A0OB 1FXDA 1YJ7A 4X64F 2C22A 4JI8J 3M6VA 4FXVA 4IFYB 1MSWD 4KGMA 2HK3A 3QGGA 2DPJA 3PJ9A 4IH7A 1S5ZA 4Y2MA 3TJ9A 4MK7A 4DV1J 2HZVA 1N52B 3IM8A 3V6KA 2WB1D 4C3KA 2DGWA 3AJ1A 2RHSB 5BYRA 4F04B 1B99A 1N5VA 2FHJD 3N5BA 3M8SA 2YNFA 1X9SA 3TQ1A 3QFWA 2JX2A 3BGRB 3X3UA 2XM3A 2QL7B 1SUQB 4ZJLA 5HROB 2OHDA 4J9VA 4ID8A 3MCSA 2CVIA 4C11B 2N82B 3DLJA 3DN9A 5KFDA 2IRUA 2M9KA 4ICLA 2BQUA 1VHIA 4NOHA 2UUTA 2RUSA 3DRPA 4HACA 4B17A 1ZM3A 3EWGA 4GMKA 2CJ9A 1T02A 4MK8A 4C3LA 1SH2A 2XHWA 4LRAA 4YN3B 1Y4ZB 1FD2A 1GEHA 1MWYA 1RAJA 2Y1LB 4NA3A 2VFUA 2RNEA 3QRPA 1VRUB 2J9CA 4DR3J 4EO8A 4K4ZA 2OPSB 1KOHA 5KFQA 4WP8A 2OEKA 4AFFA 4DQRA 4PXEA 3TARA 2HGMA 1ITPA 3G9CA 3AAWB 3DDNA 3V6JA 4B08A 3KLEA 3TX8A 3K57A 3IS9B 2NUHA 3Q0AA 2QA1A 2Y1RI 2YWHA 1Z2ZA 1RU1A 1FWPA 5FDLB 2R8IA 5L38A 1Q0NA 5JVHQ 4RLEA 1N56A 1APSA 2MHEA 3LAKA 3T1YJ 4HTIA 3W60A 2RDIA 1N34J 1HNIB 2L9WA 4CH1A 3PFEA 3DDIA 1HBMA 3C2PA 1B64A 4KGXB 5CYMA 6FDRA 3QGPA 2VPWB 3BV8A 1RABB 5F8IA 2DNHA 4HT5A 1Q78A 3ET6A 3THPA 1U4BA 1S1WB 5LMUJ 2HHQA 3VF0B 3NCPA 2ERRA 4KHPJ 2OPRA 2DBBA 1V5IB 4FNHA 4KIAA 3UQSA 4NZ0A 4KSEB 4QCLA 4P7TA 2ZD1A 4GVBA 2YVSA 5F8NA 1FXRA 2XO7A 1EAYC 3THVA 2XGPA 3HVRA 2VG7A 5KFCA 3M1VA 3DRRA 2N3OA 3DC2A 5CQGA 4ZVTB 3FSYA 1QTMA 3BBCA 4A8OA 1TKTA 1NJIT 4DV4F 1XN9A 2PI5A 2O5DA 4M63A 4W98A 2QLWA 2L9NA 1IVZA 1H2TZ 2HFZA 4C8YA 5AJ3J 3SZ2A 5KFXA 2IHR1 4ECXA 3O44A 4OI6A 2X1BA 4ZIWA 1WC4A 5IV3A 1N5QA 1X0PA 1R8CA 3RBXA 3C6TA 4B9SA 5IC4B 2JDJA 1ZH5A 3Q8PB 3NWRA 3RBEA 3LP1A 4C8NA 4BWJA 1F5CA 3M2VA 3O5TB 2KRBA 2J9DA 2DHHA 1DARA 1HBOA 5ETPA 1R89A 4A8WA 2GO8A 3FNNA 3I5CA 1W2BR 3WX8A 3HZEA 3I82A 2JVOA 4ALZA 1HI8A 4EU0A 1T9VA 1RTJA 1TFWA 4P75A 3JXOA 5L9XA 2CZVC 2AGOA 2HFVA 2YXLA 2KHCA 4ETXA 2DGTA 3FK4A 4UQGA 1GNKA 2N7CA 4ERDA 1YZ6A 2G1DA 1Y5NB 3EVMA 4QR1A 1U2RA 3RB4A 2M88A 4YQWA 1G7CB 4KRWA 4CO3A 4USTA 1VISA 9RUBA 2OGUA 2VU5A 2FB0A 1KVKA 2WONB 3J7Z5 4JI4J 2NUUG 4AQYJ 2EW9A 3I4HX 4RW7A 2PMZD 2ZH4A 2NREA 1F3VA 3HHLD 3W9IA 3FFIB 1B0TA 2HGNA 2HBYB 5T7LB 2UVVA 1UJ5A 5J2QB 1UVNA 1U6ZA 1N6QB 2K1RB 3ZTSA 3K5OA 1D0EA 3BB5A 3V81A 4FF4A 2DGXA 1SPBP 1KDNA 1FD8A 4DL6A 4ED2A 3OFFA 4NLSA 1S1XB 4PXDA 5F9NA 2DGVA 3ZZ0A 4EBEA 7FD1A 4KE5A 2HGLA 4CQ1A 1PBUA 1TKXA 1HR0F 2D9PA 3I9V9 3E01B 4DN0A 3NGUA 1T05B 4CYUA 3EDQB 1KTVA 1BQNA 2RU3A 4LF2A 2BOPA 1I3OB 5A6WA 4OZ0A 3CIZA 3GFZA 1SV5A 4PAAA 1CQNA 2QYCA 4LFCF 1BGXT 2CQPA 2KM8C 3I0RA 3RU0A 1NPRA 1S1VA 1L3VA 1MN9A 2EBGA 5IQQA 3CSKA 4RBVA 3SQOP 1NDKA 3RRHA 5E3PA 4DL3A 2QV6A 3TNVA 2XSJB 2AJ4A 3QIPB 1GTHA 4ED8A 5KG1A 5KFGA 1Q86T 2RQ4A 3UVJB 3ZC4A 2C2MB 2C2DA 3DLGA 4NLOA 3VGSA 1C1BB 2AIRB 5J1PA 4WYLA 3W8GA 4LSNA 1A9NB 1O0PA 4ZCLA 5HANA 3Q23A 3IRXB 1ICEB 5I42A 2CQDA 4PR6A 2E1CA 1UZHA 1N5YA 4B9LA 5F8HA 2DO0A 4N76A 1U2CA 1JJCB 3VALA 1KD1T 3NMRA 2BVZA 2P6SA 3TOQA 2XI3A 1JJ4A 1R0BG 2MQ8A 3TI0A 3BDPA 4AL5A 1WG5A 2I38A 2PFFB 5KFEA 1MWZA 4C4WA 1RTZA 1N88A 3H98A 1TQLA 4DR2F 2HS4A 4M5GA 3DYAA 3W2WB 1UVKA 2MJNA 2ZVIA 3MZIA 2AP6A 2JEGA 4CNYA 3A8IA 3ZTQA 4U7CA 1DZ5A 3BGLA 1CEZA 4GKJJ 2FJAB 1FFWB 1BXNA 4ECRA 4CLKA 1S59A 3BH6B 4Q0BB 3BM7A 3M8YA 2BJ7A 3FZ2A 3W66A 2M3DA 2VKRA 1UZDA 2DNKA 3DCAA 4LF8F 3Q8VA 1KQFB 4DOZA 2CPFA 3M8QB 1RT6A 2C3YA 3BYPA 3CCZA 3NMAA 4DEZA 2Z2YB 2ZZTA 5KG0A 2O3DA 1RHJB 2DYAA 3IGNA 4IO9Q 3D3CJ 3KJVA 3DGVA 2FZKB 4OIXA 3O2IA 5HVHA 2IFXA 4CNZA 3AQOA 1UVMA 1ZA2B 3AA9A 1DLOA 1WC3A 4OI4A 3K89A 1YI2S 1JKHA 1LWCA 4WU2A 2GQQA 3LH2S 4F4WA 3NNCA 4ANEA 1RTDB 1S9GB 2AMCB 4ANDA 4LF9J 4MYTA 2B9EA 2R7TA 3MTJA 1YJNS 5KT4A 3ZZUA 1NH7A 3EM1A 4Q45A 3L7UA 3OJSA 4I6YA 3PIPQ 1VQ9S 4LF6J 2KT5A 3MMCB 1GXTA 3RUBL 3DLEB 3UR3C 2FQQB 2MKSA 4MIBA 4CDIA 5H9FJ 1P1TA 1AA1B 4MFBA 4LIWA 3U7JA 2JNJA 2EFGA 3CCRS 4G1IA 2BM0A 1OQ6A 1U26A 3DOMA 3HLUA 3D68A 3MPVA 5HLFB 4USHA 5A8RA 1OQ3A 2C42A 2OPQA 3HCXA 2FJVA 4DG1A 3AOCA 3BGFA 1FJGJ 4DQIA 5GAGI 1N33F 1OMSA 2DPIA 3PYEA 1UEVA 3I87A 4M94A 3NS5A 2OELA 3PTWA 3I4PA 4NYZA 4PG7A 2J0QD 3Q8UA 3F56A 3MMAA 3CJKB 5C5JA 3UDVA 1PBAA 4Z7CA 2C3MA 2CADA 4ED4A 3MM7A 5DM6Q 3KHLA 2CJBA 3ADAC 4OHZA 1CJVB 4USWA 1ZBTA 1F0XA 4HVZA 1GXUA 1BQXA 2HRYA 1S0MA 2KYZA 3TEHB 1CULA 4PYDA 1NDLA 3KLHA 2IJNA 4H54A 2WAQD 4XO0A 4OFZA 2NLWA 2AW0A 1JLFB 3KLIB 3ILLA 1Q8BA 4X65F 3KLEB 4RUBA 8RUCA 2GVDB 4B3SF 4DQQA 1QSYA 4WBFA 4X84A 1JLQB 2YKMB 2DB1A 1Y10A 2ZEJA 3RRKA 3CJ5A 4JI2F 1U1NA 3HK2A 4QWEA 3DNCA 2VBWA 3BPDA 4CCHA 1AUSL 2RT3A 4NXNF 4FVCA 2VL1A 1FEEA 5D4LA 2K06A 2ZC4A 1C0TB 4DFMA 5JUMA 3GB0A 2KXFA 1D09B 3ET6B 4HI1A 5KG5A 4C97A 5FJ4A 1Y11A 2BANB 2RRNA 4RW9B 1TVRA 2YTCA 4N8NA 2CQGA 5KT7A 1RT5A 2HNDB 1UFKA 1HQEB 1JQGA 5J2MA 4LSLB 3D66A 2HKEA 4GO7X 4UOFA 1S1TA 4CLSA 3GJQB 1WSVA 3PZPA 4NI2B 2F8HA 1TAUA 3OPKA 3KMQA 3CDEA 5EN1A 3SI8A 3SCKE 4ECUA 5D3GA 1S57A 4Z2XA 2HNYB 3CJ8A 3TJ8A 4Y6IA 2CNLB 5HK4A 2DHSA 3AB4B 2AYMA 3AB2B 2Y9HA 1XNQJ 4QWAA 4HR2A 4FPIA 3BGOP 1MMDA 3S01A 3W65A 1NMEB 4PUOB 2RVJA 2CJQA 3HDSA 3FRZA 1QTNB 3ZZTA 2XGQA 3OBIA 5A8KA 1WELA 2YWFA 1VFJA 2B5JA 2ZWPA 2R2SA 3M2VB 2ASJA 5KAKA 3UN2A 3T1HF 3JQJA 3GP9A 3R5JB 2JFDA 4DZ6A 2IPOB 4P10A 3PIOQ 2WSEC 1HD1A 3POTA 3QZ8A 4WWSA 2CFXA 1KLMA 2IMOA 3HHDA 4DQPA 1VQ6S 1HNXF 4WU3A 2YNHB 3IP0A 2YQ3A 4ZITA 4Q8FA 3NGTA 1YSJA 3TZWA 2QLJB 1SJRA 2RQKA 1HQUA 2KO1A 2MKYA 1NZ8A 3QPIA 3D0GE 1QY7A 4LQ9A 4DUZF 1HPZA 1IQZA 1RB0A 2QG9B 1HHSA 2M7SA 1J5OA 2GMHA 5H9EJ 2DITA 3FBFA 1FKOB 1RJJA 2P8IA 4OYBA 3ILIA 2OTJS 1HMVA 2XZDB 1CS4A 1JLAA 3EICA 4RW4A 3EDRB 2VG5B 2V68A 2Z0GA 5GVQA 1TL4A 1FRHA 1LKZA 2KZMA 1Q16B 3SBMA 1DHMA 2VB6A 4DV1F 4RU9A 3E2EA 4I4BA 2UXDJ 4IUFA 1A7GE 3HVAA 3VHQA 1WC6A 4OLOA 4QJVA 2ZDPA 4PCQA 1UWAA 4DU7A 2OUGA 1TFYA 1NRKA 4QPTA 3NS6A 4CTAA 2PFDA 3MR5A 1MW7A 1NNDA 1K1QA 2YNIA 3G6XA 3OTDA 3PFOA 4C6AA 2O1PA 1LWXA 2UUAF 4QWCA 4JOUA 3CCTA 5CD4H 3LGMA 1PJ7A 3GIJA 4BHQA 1XWLA 1OY6A 2NS1B 3ENWA 2IM3A 3TUPA 1KQKA 3K59A 4RNFA 3I0RB 3CC4S 1NK8A 2Y0SD 3B4MA 2DNLA 4PG4A 2YKOA 4FXDA 4JI6J 3UDCA 4R8UA 4USIA 1TUGB 3A12A 1HW8A 5K14A 5LJ3Y 3R97A 4DR3F 1VRTB 2K3KA 1TV6B 4GKKF 3BQ0A 3QLHB 2UUCJ 2HVEA 1NJZA 1Z4UA 3WBZA 1YRTA 1GMVA 2BJEA 5HVGA 5GADI 2V63A 3FQKA 1LWFB 1IWGA 3D6TB 5DQHA 4TKTA 5I42B 3KMSA 2AHOB 3QNWB 2KFZA 2FJDB 1IKYB 2FTRA 3KTQA 3JAMU 5CYQA 3LPEA 3WIUA 3FMBA 1VMBA 4ED0A 3MM5B 2VIHA 4TN2A 2PD1A 3MCNA 4ZPBA 4F4ZA 1IKVA 1MWQA 2R7SA 4NE9C 4QIFA 5EX3A 3KK3A 4I2PA 4PRFA 4J9QA 4JV1A 3R5GA 1DTTB 5C24A 5RUBA 1UVLA 1JLBB 2AD9A 4KHRA 2WZ1A 4FYVB 3DYAB 1M5VC 4WYWA 5DQGA 5I3UA 2R7UA 3ZO7A 2QTWA 4KHPF 3ETMA 3HM9A 3V6HA 1X4EA 3MUMP 1JX4A 4E0DA 4ECYA 2P9EA 1NDPA 2LXFA 2DNYA 4F4YA 2LVWA 4U67Q 1R7IA 1S0NA 3IXQA 2MQPA 1AW0A 3WHIA 2MQOA 3ONQA 4M5LA 4DU8A 2GAHC 1VBZA 3HSDA 2CVEA 3ZFVA 5HO4A 2NZ4A 3EZ5A 4CIOA 1VC6A 2W25A 5BJRA 1AYEA 5DG7A 3AY0A 1YHQS 2CNOB 1VQYA 1U24A 2D1CA 2HS3A 1U1MA 4B3TF 3NG8A 4ATNA 1YJVA 3DOLB 2RB7A 2MGZA 2W9CB 4LUBA 3K8WA 5KFAA 3BKUA 2F4VJ 2YH1A 3CW2C 4ZMMA 2HFSA 3SCLE 2MZTA 1YGYA 1X60A 1RBOB 5ETLA 3G82B 4RNOA 2RU9A 3FSIA 3GMGA 3QT7A 3KDOA 3HHLB 2RS2A 4WK1A 5B7WA 2QLBB 4FZVA 4JI3F 3KUEA 1XMOJ 4NPOA 2ZOFA 5L1LA 3KK1A 5ETSA 2VA3A 2YKNB 1FF2A 2MY8A 1SL2A 4NLXA 3PW2A 1H98A 1IKXB 3BO2A 1TELA 1ZM9A 2KB2A 3U02A 2C3UA 3FCWA 4ED3A 5KT2A 3W2VB 1XR7A 1EB0A 1TAQA 1I94F 5EWGA 3CB4A 2LLZA 5KFLA 1HA1A 2BOAA 4OZJA 2DR6A 2FVPA 3AOAA 1UVJA 2OPQB 2ZKUA 1RWMB 5G4DA 1VC0A 2NSCA 2NYHA 3KLFA 1FKAF 2EG1A 3KLGA 5HN0A 3CXCR 1R43A 4K2XA 2W2PP 3BKFA 3SEOA 2XEXA 5F3ZA 4OYWA 2HHHJ 2M8DB 4P2XA 4IOCQ 5IT4A 4J9SA 5FD1A 1ZYQA 2RIJA 1G4CA 4M1KA 2ZNYA 2OKQA 1N0UA 1WC0A 4RW6B 4K2JA 4B9UA 4RUHA 3OTBA 2IYGA 2ZH5A 2VC0A 1LW2A 4F0HA 2Z2MA 3PV8A 1DY3A 1SBRA 2AJQA 4CLZA 1AB8A 1X8DA 1E6YA 3CJ0A 1GMUA 3JTOA 4AXIA 1SIWB 1N5TA 1F1BB 1VQLS 4KFBA 1NEEA 4K0KJ 5GAEI 1WHXA 4LMZA 2EWHA 2OSQA 2JH3A 5L8RC 1QUVA 4U7UK 1NK4A 1U8WA 5K8PA 1U2FA 2UXCF 2R2RA 4OJ1A 5F0UA 1O8BA 1S99A 3D54A 2FDNA 2ZVSA 5HP1A 4NZ7A 2DH7A 4ZLNA 1PO6A 1ZAWA 4IDKA 4ZN3A 3M8PA 3DDKA 3C15A 3OFHA 1X7VA 1FK9A 1HWLA 1M5SA 1J2VA 1HBNA 4EO6A 4AL7A 1FWKA 1OY8A 5ADZA 1Q7YT 4ZPAA 2DD8S 4TYBA 8AT1B 1NU4A 5B0EA 2BYCA 4MKYA 4MJKA 4K59A 3C66A 3DKDA 2RF2B 2ZE2A 1FX4A 1U0HA 3EGZA 2U2FA 2VG6A 2JWNA 1JLCB 3PJWA 2ASLA 3M05A 2VD3A 3JB9k 4K4SA 2R3VA 4TNOA 1A6LA 2BRLA 4G1QB 1D3WA 2G2OA 3ZNJ1 2EKNA 5KG7A 3PKYA 3NKYA 3CIMA 3OUYB 4ELUA 1ZETA 3PDNA 2DNNA 1HD0A 1RTHA 4JYAJ 3KK2A 1X4GA 3BKTA 1NLKL 2J7WA 2VH7A 1NZAA 4OZ1A 1SJ1A 5E3CA 2FGCA 3N5FA 4C7QA 1RT2A 5ETVA 4KKOA 4JV5J 2VFVA 3BEGB 2HQCA 2GJ2A 3D2WA 2HURA 3C8YA 4FVMA 2J7UA 3DI6A 3PJXA 1UFLA 1L3KA 4U8YA 4NRTA 2Z4PA 5I3QA 4P6QA 5GMEA 3GJRB 4P2SA 3M2UA 2LMIA 1VK8A 1RYSA 2PC6A 3DU5A 4ZJQA 4LBPA 4DCJB 1HQUB 1XEZA 1GMWA 2ZH1A 2KH9A 2DNQA 2V8HA 2WVBA 2OLWA 2DT9A 4B02A 3TA1A 3A8KA 3TA0A 1C2PA 4URSA 3D28A 3Q83A 3MR3A 2IDLA 1Q8IA 1WI6A 2HG4A 2V2VA 4LF9F 1WI8A 4WP9A 3DHWC 5J1EA 1HWJA 4NLVA 2Z56B 2AGPA 2DCLA 3D9BA 3K5PA 4KPYA 4OYAA 1K0TA 2FPHX 4YFUA 5J1NA 2UV8G 4ID5B 2PIIA 4QYZK 4NWBA 2IM0A 4ED1A 2VOPA 2ZBQA 5KOXA 1FFSB 3W5XA 2IVMA 2XS7A 1LWEB 3T5LA 4F4KA 4RZRA 2FVCA 1VCTA 1IR1A 2QT7A 1N32F 2MJUA 2V50A 5IT0A 3RJMB 5E7OB 4DR1F 1UP1A 4JV0A 5D15A 1D9FA 1GXLA 4OYZA 2NXCA 3HP6A 3W9HA 3NNAA 4F0KA 2XYGB 4LFAF 2HZAA 5H9FK 3MAAA 1CJTB 1SC4B 3P3DA 1D9DA 3IWXA 3MHYA 1HBUA 5SZTA 4NLTA 3VR1A 4NLUA 2GCFA 3SSSA 3R6LB 4EZ6A 1M5KC 4F3QA 4Y0FA 4X62F 2M4MA 2EC0A 4HDHA 3R7SB 1P6TA 5I3PA 2XB2D 1IBKF 3G8QA 3GCWP 1RACB 2P2CB 2UZAA 3NEKA 4UQTA 4WE1B 1EQMA 1D1UA 4DV2F 4WFYA 3JSRA 2N4CA 5J2PA 3MCMA 2DRDA 5HMYA 5EWEA 4B3MF 4UUXA 1WD6A 1P9QC 2CRLA 2XHCA 3OSNA 4NLGA 3NCRA 4G1PA 1YJUA 1RWVB 2CQCA 1RAOA 1WNEA 2YQ1A 4M5NA 2HBRB 2YNGB 1TUVA 3JSMB 4WP3A 2BE9B 1PAEX 2FY1A 3JSYA 4V1Ak 1S49A 3JYTB 2XS5A 1RGVA 3ZZRA 5LXRA 4OYOA 3HHEA 1HI1A 1JLEA 2GX8A 3MEKA 1NK6A 4OV1A 2HAFA 3F73A 4IG3B 2VC1A 2J9DE 1T9TA 4YY3F 1VYAA 1FT8A 1UWBB 3AFGA 4F02A 1U49A 5ETMA 4DLGA 2P5VA 2M0GB 3H59A 2LKZA 4EGLA 1S6PA 5IQ6A 5KFKA 2MZSA 2R8JA 2Q1LA 3BQ1A 2HFOA 2WHOA 2XZTB 4QZVB 3ZTRA 8ATCB 3E3XA 1O6XA 4LREA 3J81Y 3M8ZA 2CPIA 4QU7A 3UN5A 2XMTA 5CZVA 2MY7A 3NS7B 2MKKA 5C7PA 3MAQA 1URRA 1HHQA 1FWLA 3MR6A 4PG6A 2DRAA 3T9ZA 1RWPB 4M5DA 1HNVA 1KNZA 5IOLA 1B7FA 3W5YA 4XAKA 3P8BB 3R2CJ 2MEWA 1GX6A 2DXEA 2XQCA 2LQ8A 2JLGA 4I7FA 2GQ2A 5K8MA 4TU7A 4X4SA 4OHVA 2XLJA 4IG0A 5MLCV 3GILA 4NCGA 4ZVQB 2EFVA 4ECTA 4EI2A 3QSYB
chains in the Genus database with same CATH topology
2BW7A 4USUA 3G82B 4CM0A 1AZSA 4WP9A 2GVZB 1CJUB 4USTA 4OYBA 1CJTA 1Y10A 3C15B 4NI2A 3R5GA 1TL7A 1CJUA 1WC3A 4OYAA 1CS4A 2WZ1A 4CM2A 5D0GA 1WC4A 5IV3A 4OYWA 1WC1A 1CJKB 4P2XA 2GVDA 4CLYA 4WPAA 4OYMA 1YBUA 3G82A 2QV6A 1WC5A 2GVZA 4OZ3A 4P2FA 1CULB 5IV4A 4OYPA 3MAAB 3C16B 1WC0A 3C15A 4OZ2A 3ET6B 2W01A 1Y11A 3ET6A 1U0HB 3UVJB 1FX2A 1WC6A 4OYIA 4CLUA 4CLKA 5D15A 1CJVB 3C14B 1CJKA 4USWA 5D0EA 4OYZA 4CLZA 1AB8A 5D0RA 4CLLA 1CULA 4CLSA 3MAAA 5D0HA 3C16A 4USVA 1CJTB 1YBTA 4NI2B 1TL7B 4CLWA 4WP8A 4WP3A 4P2MA 1FX4A 3MR7A 1CS4B 1U0HA 3UVJA 4CLPA 1CJVA 3C14A 4OYXA 4CLTA 4OYOA 1YK9A 1AZSB 2GVDB 4CLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BW7 A;  4USU A;  3G82 B;  4CM0 A;  1AZS A;  4WP9 A;  2GVZ B;  1CJU B;  4UST A;  4OYB A;  1CJT A;  1Y10 A;  3C15 B;  4NI2 A;  3R5G A;  1TL7 A;  1CJU A;  1WC3 A;  4OYA A;  1CS4 A;  2WZ1 A;  4CM2 A;  5D0G A;  1WC4 A;  5IV3 A;  4OYW A;  1WC1 A;  1CJK B;  4P2X A;  2GVD A;  4CLY A;  4WPA A;  4OYM A;  1YBU A;  3G82 A;  2QV6 A;  1WC5 A;  2GVZ A;  4OZ3 A;  4P2F A;  1CUL B;  5IV4 A;  4OYP A;  3MAA B;  3C16 B;  1WC0 A;  3C15 A;  4OZ2 A;  3ET6 B;  2W01 A;  1Y11 A;  3ET6 A;  1U0H B;  3UVJ B;  1FX2 A;  1WC6 A;  4OYI A;  4CLU A;  4CLK A;  5D15 A;  1CJV B;  3C14 B;  1CJK A;  4USW A;  5D0E A;  4OYZ A;  4CLZ A;  1AB8 A;  5D0R A;  4CLL A;  1CUL A;  4CLS A;  3MAA A;  5D0H A;  3C16 A;  4USV A;  1CJT B;  1YBT A;  4NI2 B;  1TL7 B;  4CLW A;  4WP8 A;  4WP3 A;  4P2M A;  1FX4 A;  3MR7 A;  1CS4 B;  1U0H A;  3UVJ A;  4CLP A;  1CJV A;  3C14 A;  4OYX A;  4CLT A;  4OYO A;  1YK9 A;  1AZS B;  2GVD B;  4CLF A; 
#chains in the Genus database with same CATH topology
 2VBX A;  3ZTP A;  2E44 A;  1KRP A;  3TUJ C;  3TA2 A;  4DS5 A;  3DU6 A;  5ETT A;  2GGP A;  3NBP A;  4RJV A;  5K8O A;  1S1U A;  2CXE A;  4DV5 J;  1JXV A;  1BHN A;  4DLE A;  4B3O B;  2GVZ A;  1S0O A;  2M8H A;  1JMT A;  2I6W A;  3IO1 A;  4I69 A;  5DG8 A;  4I68 A;  2F9D A;  4EZ9 A;  2F3J A;  3DMJ A;  3CO0 P;  2FC8 A;  2WOM B;  3SCI E;  3N4W A;  3KXD A;  2VUG A;  4N47 A;  4G65 A;  3CF5 Q;  3M7V A;  4I6A A;  3M2R B;  3RAX A;  2FHM A;  3CJ4 A;  5KFJ A;  1X4D A;  2G0C A;  4O3O A;  1T94 A;  3M6X A;  3UD4 P;  1EP4 B;  4NRU A;  3QJL A;  4HDG A;  1FHT A;  3PXG a;  3TAM A;  4CO0 A;  3KLF B;  4V19 J;  4UZC A;  3KLG B;  2DNM A;  3PR4 A;  4KC5 A;  1KP6 A;  1EKR A;  4A47 A;  2UUB J;  4ECZ A;  2UXD F;  4WKR A;  4F0M A;  4DUY J;  2BE7 D;  3NAI A;  3J7A N;  4ZS6 A;  1RHR B;  4CO4 A;  3D1O A;  1PGZ A;  2GNK A;  3I5B A;  1FNO A;  3NGR A;  5DZ7 A;  4CH0 S;  2PDA A;  1Y3J A;  3UD3 P;  3CED A;  4NXM J;  2GO9 A;  4OZL A;  2WB4 A;  4TVA B;  3U1M A;  2BZ2 A;  1H2U X;  4JI0 F;  1SJ3 P;  1EET A;  3PRD A;  4PZV A;  4I64 A;  2HHT A;  7FDR A;  4EK2 A;  1FKP A;  3H2U B;  3N9U C;  3MMB A;  3WC2 A;  3TAP A;  4LRC A;  3PKM A;  4OHW A;  1MLA A;  3MED B;  3HFZ B;  4N77 A;  3OR2 A;  2JLF A;  4YDD B;  2WBR A;  3WZ0 A;  3NCQ A;  4RNM A;  3BN7 A;  4N56 A;  3QO9 B;  2HHW A;  5KFB A;  3EXC X;  4CO5 A;  3V6D A;  4WFN Q;  3HJF A;  2CDQ A;  3AJD A;  5DET A;  4JI6 F;  1RT3 A;  1S4E A;  4NCA A;  3EVW A;  1Y5I B;  2MTL A;  2D3Z A;  3OR1 A;  4QBU A;  4RR5 A;  1NB2 A;  2KZZ A;  3LO3 A;  1SB6 A;  1DUR A;  3MWB A;  2UUC F;  1XMQ J;  3DLL Q;  2Y8W A;  4ZP8 A;  2XBP A;  2FY8 A;  3H25 A;  5AE1 A;  4ZN1 A;  2YX7 A;  3UR0 A;  1RT1 B;  1XER A;  3G4S S;  3OSP A;  5HP1 B;  1N36 J;  1WHW A;  3DRS B;  2UU9 J;  1VQS A;  1R8B A;  1HKA A;  1XNR J;  1S0V A;  3ZZZ A;  4NZ6 A;  3MFI A;  4UY8 5;  1XQI A;  3ENV A;  4K4U A;  2RS8 A;  5A6P A;  3OFE A;  1HBN B;  4MKB A;  1PSD A;  3OD2 A;  1SJF A;  2VBY A;  4ER8 A;  5CH7 B;  2B43 A;  4A8Y A;  1V6H A;  1K9M T;  4LBI A;  1CVJ A;  1X5T A;  5IM0 A;  1R6V A;  1TKZ A;  2ZE2 B;  3C16 A;  2LYV A;  4IOA Q;  4QU6 A;  1R0A A;  2X1G A;  3IRW P;  4FBT A;  2FLL A;  4DV3 F;  1FES A;  1JLG B;  4KTQ A;  3M30 A;  1I1G A;  2CQ4 A;  4QR2 A;  4ZVS B;  1R27 B;  1MU2 B;  4O4G A;  2WVE A;  4M5J A;  4IFV B;  3PM9 A;  1YRU A;  1R0C B;  4HH1 A;  4RUA A;  3KJQ B;  2CQ1 A;  1Q1K A;  3NL0 A;  2JVR A;  1KC8 T;  2KU7 A;  1N0V C;  3AT1 B;  1LK5 A;  2XG8 A;  2AEJ A;  4K5S A;  2O01 C;  3A3N B;  2ZM6 J;  2YY3 A;  2GC8 A;  2CA9 A;  3IAS 9;  3LAN A;  1RT2 B;  4PQA A;  3F0N A;  3TYT A;  3M32 B;  1PIE A;  4YB1 P;  4RBT A;  2C2E A;  2B0G A;  2HQF A;  3UNY A;  4YEA A;  1NKC A;  4ZPV R;  1VOM A;  3G8S A;  3MEG B;  2KYX A;  2AZ3 A;  3PO4 A;  3Q8Y A;  4ZVF A;  3SDE A;  1LXJ A;  3D7S B;  4CT8 A;  3BDE A;  4QWB A;  4U6P A;  4H4O A;  3SQG B;  1CC8 A;  2OPP B;  5A2Q Y;  2C2R A;  1XMO F;  1S9E B;  4MK9 A;  3VZH A;  2B8Q A;  4RNH A;  4K4W A;  1VQ7 S;  3ZZO A;  1OWX A;  4K5R A;  1UFW A;  4PPD A;  1V5V A;  1E6V B;  3DRY A;  4JB8 B;  4LF4 J;  2GJI A;  2QL5 B;  3IMQ J;  5ITH A;  1VQM S;  1T11 A;  1NJX A;  4O3S A;  2RRB A;  1K0V A;  3PX6 A;  3SXL A;  2JL9 A;  1LK7 A;  2W2Q P;  3IA0 A;  2V2Z A;  3DGP B;  3T9N A;  5DM7 Q;  3GSI A;  2B4P A;  1LW0 B;  2LXU A;  4B9T A;  1WWH A;  2VAS A;  2AZ1 A;  3DHX A;  5D77 A;  1CJK A;  2ZIT A;  3M6W A;  2YWW A;  2VHG A;  1FO1 A;  1IBM F;  2BKN A;  2HQG A;  2Y1J A;  3W5Z A;  3L4B C;  5KT3 A;  2MMY A;  5KFY A;  4Z7Y A;  3TW0 A;  3H20 A;  5C42 B;  2XLK A;  3H5Y A;  2QA4 G;  1BQM B;  5JVG Q;  5C25 A;  3J7Y U;  3FEX B;  3CC7 S;  3TZX A;  4A48 A;  3H5S A;  1SQE A;  4C8M A;  4NAS A;  2F63 A;  2CNK B;  2KI2 A;  5JMN A;  3N01 A;  3FBE A;  3H40 A;  2MXY A;  1VQN S;  4XDD A;  3OTO J;  4M5M A;  2HHV A;  1XIQ A;  2IMW P;  4XPC A;  3GSD A;  4JV2 A;  2V8P A;  2K3I A;  2FJE B;  3US5 A;  1EIY B;  4O44 B;  1IBC B;  2VQE J;  3MM8 B;  2HPU A;  1SQF A;  2XWY A;  3OHA A;  2ZBP A;  5J2P B;  5E2Q A;  3LP2 B;  4RNN A;  1T0T V;  2D3O R;  4WIQ A;  2H3E B;  3CJT A;  1Q8K A;  2JLE A;  2DH8 A;  2QIF A;  1DQA A;  2HFN A;  5IC6 B;  4PWD A;  4WZQ A;  2WVF A;  1RTI B;  5GAH U;  4A8K A;  3KHH A;  4E2F B;  4ITS A;  2F8M A;  1GK8 A;  3BGU A;  3T5J A;  4ES1 A;  1GQE A;  2L48 A;  4R5P B;  1JLE B;  1VQ8 S;  3N28 A;  2ZBI A;  2DCU B;  3UCG A;  1HNW J;  2CQI A;  4KV8 A;  3C6U A;  3KFW X;  1TL7 A;  2FJW A;  4DR7 J;  5CAA A;  1VGY A;  3RB3 A;  4DDF A;  1SC3 B;  3B6B A;  2E9Z A;  1B4S A;  2P6T A;  4TY8 A;  1H0H B;  4X64 J;  2IC3 B;  5E5N A;  3RYL A;  3QWU A;  4MH8 A;  4YME A;  1RAG B;  4RWX A;  3JSB A;  4KYZ A;  3VV2 B;  2MKC A;  2BKP A;  2ZKT A;  1VLY A;  4HHH A;  3PW5 A;  3VAG A;  2HYI B;  2GFF A;  4I7F B;  2XC9 A;  1NSP A;  1RHM B;  2OTL S;  1BC6 A;  3R8Y A;  1ZA1 B;  2DJW A;  4C8O A;  4EEY A;  1S72 S;  3V5R A;  1XC9 A;  2DY1 A;  3JQM A;  2I2Y A;  3CDU A;  2F4F A;  3GFX A;  3S8S A;  4J9O A;  3TVZ A;  2QN6 B;  5U47 A;  2J0W A;  2IAJ A;  4AXJ A;  2QMW A;  2MQL A;  4AD6 A;  1M1G A;  4WFA Q;  3HD2 A;  4ZP7 A;  3QRR A;  3PX0 A;  3QQC D;  2HNZ B;  1R3N A;  4B3R J;  3FQL A;  5D0G A;  3RG6 A;  2KVI A;  2RQC A;  3I0S B;  1WJ9 A;  1MRO A;  1P9Y A;  5KFS A;  3MPY A;  1QM9 A;  1RWW B;  1JJH A;  3MEE A;  3CCM S;  1ZOT A;  5LMN F;  2SXL A;  2DHX A;  3NGS A;  2OD6 A;  4KO0 A;  1FX2 A;  3IR6 B;  1PJ5 A;  3OTC A;  5HMX A;  1WF1 A;  3I55 S;  1YLX A;  5A0Y A;  3CWJ A;  3M9O B;  3H7H B;  2BW2 A;  3SV4 A;  1X4F A;  4TU9 A;  1H6K X;  4H4K A;  3IC1 A;  1P1L A;  4O4R A;  1ZS6 A;  2KKH A;  1NB7 A;  1NSK L;  4I2Q B;  4RW8 B;  3W61 A;  4QOT A;  4IQM A;  2AKW B;  1NO8 A;  5KT6 A;  3EE3 A;  4OZN A;  4DR6 F;  3MM6 A;  3I96 A;  1TL1 B;  5D4O A;  4ILM A;  3LGN A;  1D8Y A;  3OL7 A;  1X9W A;  4A4J A;  3FBB A;  2DR7 A;  5DO2 A;  2D3U A;  4IRC A;  1RE1 B;  1WDT A;  3IBC B;  3P5T L;  5B09 A;  3R2D J;  1KBR A;  1TL3 B;  4DXL A;  2IBK A;  2HHP A;  2FLN A;  2ACM A;  4LRB A;  5DQI A;  1R31 A;  2QX0 A;  4AE5 A;  4DV4 J;  1S76 D;  2ZOG A;  2RHQ B;  2M52 A;  4RUC A;  3SIP B;  1FRX A;  3CC2 S;  2JHE A;  1U48 A;  2BAB A;  1EZZ B;  3AH6 A;  1YIT S;  1PC4 A;  3HSZ A;  4DL2 A;  3AXK A;  2CQ2 A;  2ZH6 A;  1IKW A;  4I56 A;  4DQS A;  4ZHR B;  4RU2 A;  4GVL A;  2AYG A;  4NX9 A;  3ISN C;  1RT7 B;  5AT1 B;  2A3J A;  4DX6 A;  1U1O A;  4KAI A;  1R6Y A;  2XO6 A;  2EG2 A;  3FSX A;  1Q79 A;  3VAF A;  4DR4 F;  3D67 A;  4DHV A;  1RSC A;  2DNZ A;  4WK3 A;  2YPZ A;  2LEP A;  1REV B;  4DF8 A;  3K5L A;  2VOD A;  3CD5 A;  1HYS B;  2HLU A;  2JC1 A;  4X4P A;  3FVY A;  4OYI A;  2V4J A;  4C0H A;  3TWZ A;  4JBC A;  1S10 A;  2RDJ A;  4DL4 A;  2BE2 B;  3PY8 A;  1G6B A;  1MMN A;  3GQC A;  2W24 A;  3J7A 1;  3AQP A;  2U1A A;  1S6Q B;  2ZZN A;  4IRK A;  1CG2 A;  1RT4 B;  4CLT A;  1FFG B;  1WDD A;  5HBM B;  1I5O B;  4DI6 A;  3TVY A;  4IFY A;  3RZA A;  5G0R B;  3AXM A;  4QR0 A;  4K4Y A;  5B0F A;  3ZZP A;  1F3F A;  5HAO A;  4HHU A;  2BR0 A;  2RQM A;  4UOG A;  2YQ0 A;  4QPX A;  1GTE A;  5H1S V;  1HR0 J;  4C9D A;  5AE2 A;  4DL5 A;  4Y2I A;  1U1K A;  1RUS A;  3BGR A;  3MUT P;  2GHW A;  1F5A A;  1SUQ A;  5HRO A;  2C2Z B;  2HBZ B;  2FYX A;  4H4M B;  2XYH B;  2OEJ A;  4C11 A;  4G3I A;  4GRS A;  5CCL A;  5F41 A;  4EYH B;  5D0E A;  2V9K A;  2ALY B;  4LF5 F;  4G6V B;  4WFZ A;  4LFC J;  2R7V A;  1VQ5 S;  5J2N B;  3HT0 A;  4DFJ A;  5B0C A;  3DOK B;  2G4B A;  2M70 A;  2IRX A;  1FTR A;  1S7H A;  3MEC B;  1T9X A;  4NMX A;  3CJ3 A;  3CNQ P;  3LTO A;  1VRU A;  2LDY A;  4OJ3 A;  2IA6 A;  3QT5 A;  4OI0 A;  2OPS A;  4RBU A;  3M9M B;  2H4Y B;  2ZNZ A;  2G0J A;  4FYY B;  2HS0 A;  1HNZ F;  1VRQ C;  2W7O A;  3GLJ A;  5ETR A;  3KG1 A;  1GH8 A;  3Q22 A;  2BM1 A;  3EVO A;  1WTF A;  2FHK A;  3WDO A;  1WKL A;  1UTA A;  4P7V A;  1Y00 A;  2NPF A;  2ZUA A;  3IS9 A;  2UVU A;  4Y3C A;  2XMA A;  1N5S A;  4DR5 J;  3EZO A;  3GU0 A;  2EI5 A;  3FC9 A;  1Z2L A;  5FDL A;  3HMJ G;  5KFR A;  2QSW A;  3LWL A;  2DGQ A;  1EAR A;  3RW6 A;  4AYB D;  4EYI B;  1NSQ A;  4GO5 X;  5A8W B;  4DN9 A;  3C14 B;  3D4J A;  3K7R A;  4ZPW R;  1B7Y B;  2K2P A;  1HNI A;  2H4W B;  3CCW A;  1X5P A;  1Q4R A;  1S4F A;  1SVD A;  5DZ6 A;  4FDF A;  4ZKA A;  3RAM A;  4USV A;  4DUY F;  1RKI A;  3KOA A;  2AYE A;  2CPH A;  1SJ4 P;  2QLF B;  2HMI B;  3CD7 A;  4LVN P;  4ED6 A;  4DR2 J;  3AD8 C;  3MTK A;  4DSL A;  5C25 B;  1S1W A;  4NXM F;  3HVT B;  1Y7P A;  2HHU A;  1OO0 B;  3A4T A;  3KWM A;  3RB6 A;  3ITH B;  2PA3 A;  5AXM A;  2XUL A;  1T03 B;  2KXH A;  1G1X A;  2E7W A;  3V4M A;  5F8M A;  5B0G A;  3GIK A;  2FZC B;  4E98 A;  2DR8 A;  4DPY A;  4DF4 A;  1UJ6 A;  2E1P A;  1F6T A;  2Q79 A;  4C48 A;  3TZY A;  2GZO A;  4CO1 A;  2MKI A;  3H0P A;  2AQ4 A;  3MDF A;  4LF8 J;  5SUH A;  3T1A A;  2QC3 A;  4YDX A;  1U25 A;  3VAK A;  2CDR B;  1IR2 A;  2IA0 A;  2QGF B;  4K4X A;  2KHD A;  1ZM4 A;  3VAH A;  1FRK A;  4KGV B;  3PW7 A;  3BZQ A;  4EBD A;  2XYP B;  3I31 A;  3BF4 A;  3EMT A;  4QIE A;  1XMQ F;  3EGN A;  2IYI A;  2W2N P;  1RXO B;  2EVZ A;  4HTJ A;  3V4I A;  1KSP A;  1N36 F;  1FJE B;  1IBL F;  1QE1 B;  2UU9 F;  1D8Z A;  2I5J B;  4HI2 A;  4JI5 F;  3CCU S;  1T3O A;  4J9L A;  2GIF A;  2EPI A;  4QYZ J;  1RK8 A;  3CCE S;  1U6F A;  1UVI A;  4HT7 A;  3VGT A;  4ENO A;  4DSK A;  3GON A;  1ZZN A;  2CQB A;  3KDN A;  1XR6 A;  2V2Q A;  2LQB A;  3WC0 A;  2B6A B;  2XY5 A;  3PYG A;  1YBA A;  1JIH A;  3J7Z T;  1YG0 A;  2YKA A;  4JI7 J;  3OHB A;  5F8L A;  2DXD A;  2FHO B;  2GIQ A;  4PXC A;  1LOU A;  2J0S D;  1RIS A;  1F60 B;  5KOW A;  4OJH A;  3CE8 A;  2WON A;  3RW7 A;  5IFM A;  3GR1 A;  2CG4 A;  2B56 A;  5F0W A;  1J27 A;  3G86 A;  5KFO A;  2APO A;  4L74 A;  2QMX A;  3FFI A;  1N33 J;  5K9F A;  5T7L A;  3LAL A;  2YNF B;  5J2Q A;  5D0H A;  2R8H A;  1N6Q A;  1FDB A;  2K1R A;  1X4C A;  5FLX Y;  3BBB A;  3FCH A;  2MHN A;  2ZM6 F;  2J6U A;  2I9S A;  1BWV A;  1S1X A;  2DEI A;  1RZM A;  1X4H A;  4ICL B;  1ZZF A;  4DFK A;  2R2U A;  5LT5 A;  3DRP B;  3MPU B;  4HAC B;  1OYD A;  4ZVO B;  4W90 B;  2C2N A;  2NXU A;  4O0N A;  3E01 A;  2RE1 A;  1T05 A;  4CZC A;  2WSF C;  2JC0 A;  2MZ1 A;  2KG0 A;  3T5K A;  1AUD A;  3VGV A;  3RGI A;  1WOR A;  3OVB A;  5E33 A;  3NWG A;  2FUG 9;  4F4X A;  4ZP6 A;  3H4B A;  1WUU A;  2GHP A;  3B82 A;  3UNG C;  1FCA A;  1RWO B;  1T7P A;  3HKZ D;  4DFP A;  2OH2 A;  4X65 J;  1RA7 A;  1V9O A;  4O3P A;  2DNG A;  1NK5 A;  4A8S A;  1WOP A;  1PYS B;  2OEM A;  2M2B A;  3C3L A;  4B3S J;  1QVG R;  3KG0 A;  3KJF B;  5A0Y B;  3ZZY A;  2QRR A;  1JJ2 R;  3QIP A;  2C2K B;  5A76 A;  5D8H B;  4IO1 A;  4ZVR B;  3X1L B;  2OAU A;  2W9B A;  3CUN A;  2J9E A;  2BV3 A;  5KFM A;  4LF4 F;  4YB7 A;  3UVJ A;  1UL3 A;  5T41 A;  3P96 A;  4MKA A;  1C1B A;  1RWX B;  4CLF A;  3W62 A;  3U1L A;  1G2E A;  1X4A A;  3IRX A;  1HBM B;  3R3T A;  5CYM B;  1HFE L;  2KTQ A;  2KT3 A;  4X4N A;  1PC5 A;  3TX0 A;  2QJ3 A;  1UW9 A;  1NHK L;  3PX4 A;  4YR3 A;  5GAG U;  1HWK A;  2OPR B;  2VF3 A;  5HQ8 A;  2B8P A;  4OX6 A;  2DNP A;  2RD5 C;  2K8G A;  5LSR A;  2FVQ A;  2ZD1 B;  4GVB B;  3CGI A;  4KQZ A;  2VG7 B;  1S9F A;  2HQ3 A;  1C4A A;  3M1V B;  3W2W A;  3DRR B;  5A2Q U;  1QVF R;  4OHX A;  4KY3 A;  2KXN B;  2Q66 A;  3EZU A;  2B7C B;  3QZ7 A;  1T8E A;  2ZHA A;  1TKT B;  3OTO F;  3Q8R B;  3ISN D;  4KT0 C;  2QL9 B;  5EDW A;  3NY0 A;  2BA9 A;  4FS2 A;  2V8G A;  3DLK A;  4OX8 A;  3GTY X;  2VKZ G;  4DPW A;  5ETK A;  3O1L A;  3C6T B;  4Q0B A;  1CSJ A;  1KHW A;  1FRL A;  5FII A;  2GML A;  1RAD B;  2Q6C A;  3T1H J;  1FI4 A;  3LP1 B;  4O3R A;  3GIR A;  2B4V A;  3M8Q A;  1SH0 A;  4KH1 B;  1CJU A;  1S97 A;  1HBO B;  5ETN A;  4L76 A;  1FE4 A;  2CZ9 A;  3KYL A;  3B4D A;  1TTH B;  3TO8 A;  2ZZM A;  1UET A;  2BDP A;  1XMB A;  1XJW B;  3CD0 A;  2JOQ A;  4FP9 A;  3BSN A;  1HNX J;  4QWD A;  3VAI A;  1DTQ A;  1RTJ B;  2KJW A;  1TMJ A;  1EJ7 L;  3QGH A;  3LUY A;  3TAN A;  1LQ9 A;  3VVU A;  4DUZ J;  2ZUG A;  4QYR A;  4W4M A;  1RTD A;  3L3C A;  2OML A;  1S9G A;  4KR0 B;  3SCJ E;  2FZG B;  1RWU A;  3FEZ A;  1X9M A;  2BAC A;  4USM A;  1UJ4 A;  2R7Q A;  2FGO A;  3DLH A;  3CCS S;  2C3P A;  4RW7 B;  4S0M A;  2JRS A;  3BS9 A;  5BYS A;  5F8J A;  3MMC A;  4URQ U;  3DLE A;  3GV8 B;  2YWG A;  1RAH B;  4OJG A;  4JI8 F;  4J9U E;  2HWT A;  2WVC A;  1XTZ A;  3UO0 A;  3QSI A;  2OFH X;  2EKY A;  2VQF J;  2HWH A;  4UF4 A;  5HLF A;  3V81 B;  1JB0 C;  1W7W A;  2ABY A;  3OLB A;  2E5J A;  3JAM Y;  2B3T B;  1TKX B;  1ZM2 A;  5THW A;  1RA6 A;  2UUA J;  2MST A;  2VFS A;  2NPI A;  4J37 A;  4BWM A;  4CYU B;  2ZWO A;  4XTT A;  1BQN B;  1BWE A;  3CTR A;  3CJK A;  2K7J A;  2ZH3 A;  1SV5 B;  4HLB A;  4Y2K A;  3BQ2 A;  1B70 B;  3W63 A;  4FF2 A;  1H7W A;  2R7R A;  4B3R F;  1S1V B;  1S7I A;  2N3L A;  4LIR A;  4X2B A;  2DIV A;  1CJV A;  1WHV A;  5L1I A;  3N6M A;  1T9U A;  4WKY A;  3IBF B;  3Q2T C;  1KS2 A;  4J9M A;  1NSA A;  1SL0 A;  1RYR A;  4YB6 A;  4GKK J;  2MPU A;  4OZ5 A;  3P49 B;  1DRZ A;  2P9G A;  3J80 Y;  1Q7L B;  1JLF A;  3KLI A;  1KKH A;  3EXY A;  3ELH A;  3DLG B;  1U1P A;  3T3F A;  2H5J B;  1RWK B;  2GVD A;  3MMJ A;  2ZHO A;  4LSN B;  3MPD A;  4ED5 A;  1JLQ A;  2COL A;  2YKM A;  3VAJ A;  1NKB A;  4CT9 A;  4X4O A;  1IM4 A;  3BYR A;  1N5Y B;  4MAK A;  5KG3 A;  2IBO A;  1C0T A;  4Y2A A;  2QYG A;  1VQO S;  3T1Y F;  2QSF A;  5HI7 A;  4TYA A;  1N34 F;  1ZTW A;  3N0V A;  2H48 B;  4CLL A;  5KFT A;  1NBE B;  4IKA A;  1RKJ A;  4FNI A;  2B9Y A;  4PQU A;  2XLI A;  2BAN A;  4RW9 A;  2E7V A;  3PW0 A;  3PG9 A;  5DDP C;  2HND A;  5LMU F;  2Z57 B;  1HQE A;  4LSL A;  3C19 A;  1HW9 A;  4CM0 A;  2B9X A;  4C2M A;  1NK0 A;  2CJX B;  1WKK A;  4NI2 A;  2J8A A;  2ATC B;  1VS3 A;  2F40 A;  1NXI A;  4ZVU B;  3PYD A;  2LQJ A;  2HNY A;  3GR0 A;  4Q7A A;  1RHQ B;  1DQ9 A;  2VPX B;  2X3D A;  4ZVH A;  4DSI A;  2ASY A;  4OZ3 A;  2QE5 A;  2DRB A;  4B3T J;  2ZH8 A;  2PMW A;  2CWX A;  1RT6 B;  5LL6 d;  5AJ3 F;  4PUO A;  4YR0 A;  3C46 A;  1N4L A;  2AWZ A;  1H2V Z;  2G9O A;  3D6F B;  4LJM A;  2EFQ A;  2RRA A;  2Z58 B;  3OXL A;  3KJV B;  1UA1 A;  1QJH A;  2FVS A;  4ZK7 M;  2BUN A;  2V0N A;  2XTJ P;  2OMO A;  3RBZ A;  4F36 A;  4CWB A;  4LBH A;  4EMD A;  4PPZ A;  2W2O P;  1DLO B;  1L3U A;  4MYU A;  3MOZ A;  3V4I B;  4JI3 J;  5GAD U;  1JKH B;  1LWC B;  2W2M P;  3W1Y C;  1CLF A;  4TU8 A;  3O3L A;  3SFU A;  5LJ5 Y;  1RU2 A;  3VQT A;  2GV1 A;  2KJV A;  4DV7 J;  2ZBR A;  2MZQ A;  1YJ9 S;  3OJU A;  3BPS P;  4NLY A;  2YNH A;  1Q82 T;  5KG2 A;  2L41 A;  1GAO A;  2FHJ A;  3I56 S;  3GYX B;  3B54 A;  3CMA S;  4WJB A;  3M8R A;  1I94 J;  1NH8 A;  3OXG A;  4KBI A;  2V5H G;  2LU2 A;  2PE8 A;  1FKO A;  1Y3K A;  2OD4 A;  3GCX P;  4MFB B;  4OYP A;  5C2C A;  2H54 B;  2AJ2 A;  2WSC C;  3O6Q A;  3DOM B;  3G87 A;  2ILZ A;  2Q3P A;  5K20 B;  5A8R B;  4JI4 F;  2VG5 A;  4AQY F;  2A18 A;  3NGK A;  3ENA A;  1JXE A;  2EK1 A;  2D69 A;  4DG1 B;  3R1H A;  1GMW D;  4LFB J;  3CUL A;  4DCO B;  2YPY A;  3K2Y A;  1FVQ A;  1WTB A;  3KUG A;  3MMA B;  3UN3 A;  1YIJ S;  5E3Q A;  1QAY A;  4F67 A;  1EKS A;  2NXN A;  3DM2 A;  4O3Q A;  2MKH A;  5JJB A;  2BJD A;  2C1E B;  4LR7 A;  3UFC X;  3MM7 B;  1Q81 T;  1WOO A;  1ZAX A;  4QIW D;  2FVR A;  1C1C A;  1WEY A;  3OVS A;  1U02 A;  1XBW A;  2Q43 A;  1QSL A;  1CUL B;  3KLH B;  2LEC A;  3MI7 X;  1TUW A;  2O67 A;  1HHT P;  1S6O A;  4ZIV A;  1LXN A;  3HPO A;  4HKQ A;  4ILL A;  2X3G A;  3NGD A;  3RRG A;  3LW5 C;  3W7B A;  4C0O C;  1J5E J;  1VRT A;  1TV6 A;  2W9B B;  3F44 A;  3QLH A;  2HWI A;  2UXC J;  3LPY A;  3QT6 A;  4M5H A;  1SC6 A;  1TMM A;  4ZCM A;  1KEK A;  2BKO A;  2XMJ A;  1FA0 A;  2ZJP Q;  1LWF A;  4F3M A;  1QAI A;  1OIA A;  2BBE A;  1L5U A;  2FLP A;  4DR5 F;  3NRB A;  2ZOM A;  1IKY A;  2XZW A;  4A46 A;  4Y00 A;  3CMQ A;  5KFN A;  2BQ3 A;  1TVR B;  1LEO A;  3MM5 A;  3JTN A;  3QWP A;  3CJS A;  1RT5 B;  3S7R A;  3OQ2 A;  4Q44 A;  2PEB A;  5J2M B;  7AT1 B;  2MSS A;  2W7A A;  3KLV A;  1NUE A;  1TL5 A;  1S1T B;  1X4B A;  4MIA A;  4XDC A;  4ZA1 A;  5E3R A;  1DTT A;  1YJR A;  1Y0H A;  1JLB A;  3ISZ A;  2XMM A;  1Q5Y A;  3GIM A;  5D3G B;  1S12 A;  2GS8 A;  3TZZ A;  3QMQ A;  2VDI A;  3R5A A;  2CPX A;  2RML A;  4ECQ A;  3D6M B;  1YRX A;  1F9F A;  3DLK B;  3RAQ A;  1SKW A;  3VVT A;  2Y8Y A;  5E41 A;  2R2T A;  3AA8 A;  1F2H A;  3AD9 C;  2DH9 A;  4GKJ F;  2AX1 A;  2MB0 B;  2VZ9 A;  5A8K B;  4MKV A;  1SXL A;  2B5J B;  5C2G A;  3HI9 A;  1CJU B;  4A8F A;  4AUK A;  2ZJQ Q;  3EYZ A;  3DOL A;  2W9C A;  4BC9 A;  5GAE U;  4FYD A;  4LF7 J;  3HD1 A;  3POT B;  3MFH A;  4ES3 A;  3FRY A;  3RR7 A;  2BRK A;  1DTQ B;  4PKD B;  1KLM B;  3PRB A;  5LSL A;  3G82 A;  5AXL A;  4NLP A;  2KN4 A;  2EC2 A;  2GW8 A;  4NLW A;  2Z8Q A;  3HHL A;  3UCU P;  1FVS A;  2EFO A;  4K7Q A;  2HQI A;  3GYN A;  2LA6 A;  5F8G A;  2XWX A;  1QDU B;  1HPZ B;  2LP4 A;  3PEJ A;  1RBL A;  4OX7 A;  1J5O B;  4OV6 A;  1VQK S;  5M2P A;  4DV0 J;  2G2Z A;  4C98 A;  2NXE A;  2YKN A;  1P27 B;  2DKO B;  2X1A A;  3SFG A;  2DEJ A;  5DGB A;  2H1Y A;  1IKX A;  1SKR A;  4E8U A;  2BEF A;  2BJ9 A;  1HMV B;  1YVF A;  3VTI A;  3M6U A;  1CS4 B;  1JLA B;  4DX5 A;  4RW4 B;  4X4R A;  3PNI A;  2GJF A;  4L72 B;  3W2V A;  2DIU A;  3OLA A;  2HHS A;  4JI7 F;  1SC1 B;  3GG0 A;  4LF6 F;  3THT A;  1AZS A;  2ASD A;  3RTV A;  3A3O B;  2DO4 A;  3CCQ S;  4NEY A;  3H42 A;  4NML A;  1N32 J;  4DBQ A;  4RPF A;  2DIS A;  4YP3 A;  4DR1 J;  3NP5 A;  2CG8 A;  4PG5 A;  1FRJ A;  4YHH J;  4J7C A;  4TXS A;  1TP7 A;  5D6G A;  2O66 A;  4GC6 A;  3VGU A;  1RAE B;  3PCO B;  3S6E A;  1M0S A;  1EQ0 A;  1CQM A;  1V3S A;  2LQ5 A;  4LFA J;  4USJ C;  4CTA B;  3MOJ B;  1FJG F;  3H90 A;  2YNI B;  2J7K A;  1FRM A;  4C8Z A;  4Q43 A;  4DSF A;  1HWI A;  2DHG A;  2VBZ A;  4OX9 J;  1X0F A;  4CH7 A;  5IWA J;  4DSJ A;  5IZH A;  3TUI C;  2H5I B;  2XS2 A;  1YDL A;  3UI3 A;  3MUV P;  4X62 J;  4RW6 A;  4RX6 A;  2HVD A;  4CLW A;  2GAG C;  4JP8 A;  5DLF A;  1IJF B;  2AX0 A;  3QAT A;  1IBK J;  1ARO P;  2W8K A;  4TLQ A;  3UDE A;  3K17 A;  3GZ7 A;  4R8U B;  5DDR C;  1JK9 B;  5IXU A;  5K14 B;  3NAH A;  2OO4 A;  3KUH A;  4DV2 J;  4H4K C;  4F3O A;  2VDH A;  1OS5 A;  4TQS A;  5K5M A;  4B3M J;  2WVD A;  1M1K T;  4NLD A;  2DGU A;  3OXF A;  2P9C A;  4PWW A;  5D4P A;  2FD2 A;  1IQT A;  4LRF A;  2V67 A;  1SCJ B;  4MMO A;  1F9E B;  2J6S A;  3CDA A;  4UW2 A;  5L1J A;  2E9T A;  1M90 T;  1KFS A;  4KGZ B;  5KFH A;  5L46 A;  5E3A A;  3MR2 A;  4I1T A;  5CYQ B;  5EHH A;  2CWK A;  3R27 A;  5B0B A;  1WEX A;  4Y2C A;  4K50 A;  5FLX U;  3N6L A;  2ADB A;  3HO1 A;  1U1Q A;  3IFE A;  3MAH A;  1NDC A;  2W8L A;  1IKV B;  3LA0 A;  4YY3 J;  1IM6 A;  1WOS A;  3HZG A;  1OSD A;  3KK3 B;  3W9J A;  4PQU B;  1OSC A;  1RHU B;  4I2P B;  1JNR B;  5HL7 Q;  2XY7 A;  3UE2 A;  5C24 B;  2CJA A;  1FDD A;  1IN0 A;  3D0H E;  3D6H B;  1QD1 A;  5I3U B;  5EGY A;  5K8N A;  1PJ6 A;  1U0S A;  1X5S A;  4DUT A;  4ETZ A;  2NQP A;  2GHV C;  2QLX A;  3CJ2 A;  1RDR A;  4K4V A;  2KFN A;  3HVW A;  2QMU B;  3GJS B;  3TVK A;  1AXQ A;  2V6A A;  2UVW A;  1DBD A;  3HUL A;  2RF2 A;  4RKU C;  1TKD A;  4X4V A;  2CQH A;  3B8H A;  3ILJ A;  3LQV A;  1JLC A;  2D3O 1;  3J81 j;  1QAX A;  4OI2 A;  1S48 A;  4Y28 C;  3BH7 B;  2IVF B;  4OYM A;  1YBU A;  1K73 T;  1MNE A;  4G1Q A;  1XNQ F;  5JXS A;  3WQP A;  3OUY A;  2XI2 A;  2ZH2 A;  4R0E A;  3T19 A;  2G13 A;  2MGZ B;  2E5L J;  4X66 J;  1BY9 A;  1OJ4 A;  3CD6 S;  4ZLP A;  5CA5 A;  3CME S;  3EPI A;  1Z1Z A;  3JQK A;  5CD4 A;  1VIO A;  5M2R A;  2W7P A;  4O0I A;  2J76 E;  3L9Z A;  5IT9 Y;  3KHG A;  2V8V A;  2CJK A;  5DDO C;  2A1B A;  2MZJ A;  4PWU A;  3ZXW A;  4BCA A;  4FKX A;  4DJB A;  2I1R A;  1YJT A;  2IJR A;  1YK9 A;  5HAT A;  3D1Q A;  5L1K A;  3QGI A;  3KK1 B;  2YX1 A;  4DV6 J;  1W2I A;  3R6G B;  1NM2 A;  3BBF A;  1BMQ B;  5D78 A;  4O23 A;  1UMJ A;  2MLX A;  1HQ2 A;  3FMW A;  5BR8 J;  3ILO A;  3K5N A;  3AJ2 A;  2XNR A;  1PAU B;  3Q89 A;  3RR8 A;  2KM8 B;  3A8J A;  1KQS R;  2JJ4 D;  1I6J A;  4F2S A;  4NL5 A;  1UA0 A;  1KQG B;  5IV4 A;  2WRM A;  3BO3 A;  1MML A;  3GII A;  4KH0 B;  2JEF A;  2ACY A;  3HJV A;  4I0W A;  3PHT A;  1G3O A;  2W4C A;  3K5M A;  4ID5 A;  3IG1 A;  3EUN A;  3OT9 A;  2V94 A;  3G96 A;  2ADC A;  2OFG X;  3MD1 A;  1TK0 A;  5E0O A;  3NNH A;  2W4P A;  4IH5 A;  2VOO A;  1ZPV A;  1LWE A;  2VQF F;  1BD6 A;  5AE3 A;  5KFI A;  2PEH A;  4WXO A;  1FXL A;  1KN6 A;  3FZB A;  3R5B A;  4BBY A;  2CZ4 A;  5AXN A;  1U09 A;  4JI0 J;  1M5H A;  5GMK a;  5B08 A;  3D1H A;  3DM2 B;  2IVY A;  2AJ1 A;  2M5Y A;  1U8S A;  1BLU A;  3VWS A;  3ULH A;  1CJT A;  3M4X A;  4UTG A;  4WF9 Q;  4EUV A;  4UT4 A;  1VI7 A;  3MPW A;  3NXZ A;  3TAQ A;  1YJW S;  4JI1 J;  1C1C B;  2IDE A;  3UDL A;  1LW2 B;  4NA1 A;  4Z37 A;  4UUW A;  2OJ3 A;  3MM9 A;  1E6Y B;  2BQR A;  1VIX A;  2ILY A;  4ZPC A;  2ROG A;  3E8O A;  4WXW A;  2IM2 A;  4XPE A;  1VR6 A;  1R8P A;  1RP5 A;  4KFB B;  1OY9 A;  1V3Z A;  4UOC A;  2V2K A;  3JTP A;  1TU0 B;  3Q24 A;  4YR2 A;  4BLG A;  1B0P A;  1F2G A;  2G2Y A;  4WE1 A;  1AFJ A;  4F2R A;  4PEO A;  3UW1 A;  4CP5 A;  1JXL A;  4CI0 B;  4UOH A;  1UPP A;  2ZJR Q;  2FC9 A;  2UVR A;  4USU A;  1TK8 A;  1VC5 A;  4IDK B;  3M8P B;  3H8Y A;  2ZBC A;  2YNG A;  3C15 B;  3JSM A;  5LOQ A;  1FK9 B;  3HSG A;  2A6O A;  2F5G A;  3JYT A;  4AL6 A;  2CUY A;  2DR5 A;  4IOB A;  2KT2 A;  3LP0 A;  4DL0 C;  4IG3 A;  4DPO A;  2H51 B;  2E29 A;  3T6B A;  1VK3 A;  1UWB A;  1K1S A;  4DV3 J;  1VQP S;  1U0H B;  1WHY A;  1S79 A;  2VG6 B;  5KFU A;  3HHN B;  4P9S A;  5HQL A;  1SKS A;  4ELT A;  2OSR A;  4R25 A;  3N79 A;  1Y9O A;  3R5D A;  2X51 A;  2LCW A;  4DPU A;  1RTH B;  1R8H A;  2HIY A;  2QFJ A;  1FJ7 A;  1VLO A;  3KK2 B;  3J80 U;  1R8A A;  2R8G A;  2VV5 A;  4DSE A;  1RBA A;  2GMJ A;  2H9Z A;  2V4R A;  1UKU A;  4KKO B;  2CIM A;  3Q2S C;  1U1R A;  5HJX A;  2RH3 A;  1PYT A;  5CCM A;  4U8V A;  2GA7 A;  3OW2 R;  4P73 A;  2AF6 A;  2DTJ A;  4Y65 A;  3DI6 B;  2DR9 A;  5M2U A;  2F4V F;  4AT1 B;  3M2U B;  5HMW A;  2VJV A;  2R4F A;  4BC7 A;  4LR8 A;  4HYK A;  3Q8Q B;  4ECS A;  4OQJ A;  4QIV A;  1NHU A;  3DXB A;  1WF2 A;  2HVH A;  2OI2 A;  2WK4 A;  4ZVP B;  2G0I A;  4UZB A;  3W3S A;  4DV7 F;  2KL8 A;  3D0I E;  4PXB A;  4B3O A;  3I6P A;  5D0R A;  5J1E B;  4ELV A;  4LVO P;  2ATL A;  5DS7 A;  1UEU A;  5DDQ C;  1I51 B;  1UPM B;  2MLY A;  5KFW A;  4J91 A;  3SSR A;  1RLD A;  1N54 B;  3JS9 A;  3GFH A;  2JEI A;  2CQ0 A;  3S1T A;  1YTY A;  1AZS B;  1DJ0 A;  2WOM A;  2L08 A;  3I5A A;  3M2R A;  4F25 A;  3KNA A;  4FF1 A;  2UP1 A;  4PG8 A;  3QBC A;  3MGJ A;  3K58 A;  1EP4 A;  1VJQ A;  5HVF A;  3IWL A;  2IRY A;  3MUR P;  1SL1 A;  1KFD A;  2JZ5 A;  4I6W A;  1IBM J;  4LFB F;  1FRI A;  4C8L A;  4DS4 A;  2ZH9 A;  4B9N A;  3MAA B;  2XMU A;  1NK9 A;  4YOE A;  1SI9 A;  1PCA A;  1SJQ A;  3Q8S B;  1HBU B;  4ZCI A;  1RCX B;  4URG A;  3HFK A;  2HHH F;  3BR8 A;  1YKW A;  4A8X A;  4L3K A;  1L3S A;  2CNN B;  3GPA A;  2YWK A;  4EBC A;  2VPY B;  3FUY A;  1ZPW X;  1NJW A;  1YBT A;  3TR5 A;  4P72 A;  3MED A;  1NCL A;  4N5S A;  2PT0 A;  5CXT A;  2EBE A;  2NR0 A;  4ZCK A;  5GMD A;  2DK2 A;  3HX9 A;  4OMF G;  1W25 A;  2UUW A;  3LF0 A;  3RBD A;  3QO9 A;  1N8R T;  5HJY A;  2J6T A;  4TQR A;  2UXB J;  3A8E A;  3BSA A;  1U7L A;  2LA4 A;  2CPE A;  2MDA A;  3IR5 B;  4LQ3 A;  3GFY A;  5EWF A;  3AHP A;  5HQM A;  4K0K F;  4P52 A;  1ROF A;  3HFV A;  3EPG A;  1J5E F;  1WC5 A;  2VIC A;  2LEB A;  2RIL A;  4QIG A;  3G6E S;  2DY9 A;  3KNG A;  3CO9 A;  3LWM A;  4MT1 A;  3CDB A;  4FYW B;  1RT1 A;  2QA2 A;  1M5O C;  4HHJ A;  4CLU A;  3I9Z A;  4UY8 T;  4OLP A;  1FJC A;  2A10 A;  3IR7 B;  2F8E X;  3DRS A;  2R9L A;  2E1M C;  3U1N A;  2NCK L;  2DXF A;  2KFY A;  3DFE A;  1T3N A;  4FXW A;  3SYZ A;  3A1Y G;  3H4D A;  2EEY A;  1H38 A;  1VHF A;  3IGV A;  2V69 A;  2IM1 A;  4QQB A;  1T9W A;  3FBC A;  3H2L A;  1S6P B;  4OYX A;  3GG1 A;  4FN5 A;  4KHM A;  1XR5 A;  2HVI A;  2ALZ A;  2RAQ A;  2VA2 A;  1MG7 A;  4K4T A;  2Z2Z A;  4KB7 A;  2B51 A;  2FLO A;  1B3T A;  4ILR A;  1JLG A;  3FEY B;  4OHY A;  3BO4 A;  2KDO A;  2KVQ E;  1MU2 A;  3PW4 A;  1WC1 A;  1LFW A;  4IFV A;  2IY5 B;  4M5D B;  1HNV B;  4F4A A;  2OP5 A;  4LRD A;  1CBK A;  2WTF A;  1L3T A;  1BE4 A;  5KT5 A;  2W01 A;  1WAC A;  4IG0 B;  4M8L A;  4NCG B;  1RQ0 A;  5LSO A;  1D9A A;  2VPZ B;  3E51 A;  4JYA F;  3DXS X;  3KJN B;  3R5C A;  1PIL A;  3ETO A;  3CT9 A;  2B4U A;  5DLG A;  3M32 A;  1NKE A;  5KG6 A;  2PMH A;  3CCL S;  3BSC A;  3EX7 B;  4JV5 F;  5EUH A;  2AEF A;  2E5G A;  1RLC L;  3L95 X;  4N41 A;  3CPW R;  1K47 A;  3OL9 A;  1NPK A;  2EFN A;  4U7U D;  3MEG A;  4LF7 F;  2JEJ A;  2GGP B;  2HEK A;  4IRD A;  3CVK A;  2AU0 A;  4NEZ A;  3NBP B;  2UV8 A;  2MZR A;  4FF3 A;  3KG4 A;  3IBW A;  2Y3Y A;  2E66 A;  4C0B A;  4B9V A;  1S1U B;  4ZP9 A;  2E7X A;  5LMN J;  2GVZ B;  1TK5 A;  3OV7 A;  2HZC A;  2RKI A;  2L3M A;  3SQG A;  2OPP A;  1RAF B;  3WX4 A;  3G8T A;  2R7X A;  4YB5 A;  3CJQ A;  1S9E A;  4Q5V A;  3DMJ B;  1K8A T;  4DMZ A;  5CAB A;  5MAO A;  2IJF A;  2CPZ A;  5DJB A;  1JWW A;  4DV0 F;  3GV5 B;  3IAM 9;  2BJ8 A;  4NA2 A;  4NYP A;  1WKJ A;  1AT1 B;  1Q53 A;  4LT6 A;  4RO0 A;  2DVI A;  4MIW A;  2F65 A;  1E6V A;  5T14 A;  2VFR A;  2YWE A;  4TY9 A;  3IG1 B;  1HWU A;  4Q8E A;  3GJT B;  3TAM B;  1HL6 A;  3V2U C;  1QAJ A;  1NHV A;  2NSB A;  4DR6 J;  3DGP A;  2J8S A;  2ZFH A;  2NYI A;  4YHH F;  5HSP A;  1LW0 A;  2HIQ A;  5BYQ A;  5BXI A;  2ZHB A;  2AEM A;  4NLR A;  2AT1 B;  2VFT A;  1EET B;  1SIZ A;  4J9P A;  2K7K A;  1H74 A;  1FKP B;  3MCO A;  2NXJ A;  3P45 B;  3MMB B;  1FEH A;  2LDI A;  5C42 A;  4OX9 F;  1NK7 A;  5B0D A;  5IWA F;  3VZI A;  2HHX A;  4M5I A;  1AFI A;  2PGC A;  4KPC A;  3OR2 B;  1BQM A;  1VBK A;  2HRU A;  3MM9 B;  2JSX A;  4X4T A;  5B0A A;  3FJ2 A;  3L7O A;  5CZX A;  2V4Q A;  2CJY B;  3QID A;  3DLB A;  2F9J A;  3GV7 B;  2F7V A;  4LSZ B;  4P74 A;  1H72 C;  3V6D B;  1REG X;  3PYF A;  1RT3 B;  1Q95 G;  4O44 A;  1PG5 B;  1B0V A;  3MM8 A;  3OR1 B;  4ANC A;  4OL8 A;  4ZJO A;  3M8W A;  2I0X A;  5EX0 A;  4V19 X;  3LP2 A;  3CCJ S;  1PYO B;  2LEA A;  1FNM A;  4J9R A;  2ZC3 A;  4DR4 J;  2R7O A;  2J0X A;  2WCX A;  4CO2 A;  3NOG A;  1C4C A;  3ICL A;  4D3G A;  2XMK A;  3IWN C;  1RTI A;  3M9N B;  2AGQ A;  2KRR A;  3TUZ C;  1LNQ A;  1DFD A;  1U1L A;  4DWI A;  3HSJ A;  5KFP A;  4QW9 A;  3OL8 A;  3R1L A;  4R5P A;  2Z30 B;  1FE0 A;  9ATC B;  3LP0 B;  3HHK A;  2XCP A;  1QLN A;  3VQS A;  3SMZ A;  5IM0 B;  1TKZ B;  3PO5 A;  3C16 B;  4W92 B;  2CAJ A;  2BJ3 A;  5LM7 E;  1R0A B;  3QJJ A;  1C0U A;  4L3N A;  4DPX A;  2YH0 A;  2Z2L A;  4J9N A;  1HI0 P;  4CRJ A;  1KVJ A;  3M30 B;  2IC3 A;  5F3T A;  3QT8 A;  4O4G B;  3CJR A;  2D7S A;  3TRG A;  3UWT A;  1GX5 A;  5HMZ A;  2DHA A;  1UW4 A;  4DX7 A;  1YQH A;  4IH6 A;  3OFG A;  4U95 A;  1YWX A;  3GYG A;  1YX2 A;  3I32 A;  3BN4 A;  4Q2M A;  4LR9 A;  1H3D A;  1RWN B;  3WIV A;  4WTO B;  1ELO A;  1NJY A;  5DG9 A;  3A13 A;  2WBM A;  2DNR A;  2CPJ A;  1M1H A;  1O51 A;  2GIR A;  1Q5V A;  2EFP A;  4ES2 A;  2MQQ A;  4FS1 A;  3SSQ A;  3HKW A;  3T41 A;  2E5L F;  4X66 F;  4RL1 A;  4KJI A;  3VCD A;  2QZ8 A;  5DGA A;  5KG4 A;  4LF5 J;  2LU1 A;  4WPA A;  2YX4 A;  3HXM A;  3SDE B;  1HAR A;  4A8M P;  1U6B A;  3DRX A;  1URN A;  4C3M A;  3TJA A;  4H4O B;  3BJY A;  1HLW A;  2HNZ A;  2LQ9 A;  2H65 B;  3I0S A;  2VJU A;  5ETO A;  3R7B B;  2A2D A;  1T9Y A;  3ZTO A;  2D74 B;  4DV6 F;  4DV5 F;  2G1H A;  1F9H A;  1U45 A;  1GT8 A;  3NOC A;  2J5A A;  1MN7 A;  3CCV S;  1HNZ J;  1XK8 A;  3EJM A;  3J81 U;  1IWA A;  5BR8 F;  4CLP A;  4PAB A;  1F5B A;  2A2C A;  2B4O A;  3U27 A;  3QAE A;  1OYE A;  1QUP A;  4NCB A;  2RSQ A;  2B7B B;  4X4U A;  2WW4 A;  3F41 A;  4OI1 A;  3MXH P;  3CDW A;  4ZDN A;  3UPF A;  1KVI A;  4F8R A;  2Y0B B;  1KLN A;  3BR9 A;  2PA8 D;  4JUZ A;  2HK2 A;  2DGS A;  1DAX A;  3T5H A;  2E1R A;  4L75 A;  4I2Q A;  5H9E K;  4RW8 A;  1CJK B;  1VBX A;  1TR0 A;  4CLY A;  4U96 A;  1S6U A;  2E9R X;  4ECW A;  2EXU A;  1FTC A;  3UD5 A;  5KFV A;  2AJF E;  2HFU A;  2UUB F;  4Q2L A;  1W26 A;  4OZ2 A;  1FDA A;  1TL1 A;  4WCE Q;  6FD1 A;  4WII A;  2RJZ A;  2XMV A;  2HQD A;  4J9K A;  1RAI B;  5IT9 U;  1UAW A;  4F7V A;  1KR4 A;  1KWM A;  2X7I A;  2CPD A;  2R42 A;  5CHC B;  3D3B J;  2YKP A;  2Q6B A;  4FBU A;  3PHE A;  1Q8L A;  1TL3 A;  2A6M A;  3MF5 A;  1S77 D;  4JI1 F;  4KGK A;  4USK A;  3FCV A;  3EGW B;  2BW7 A;  1JNZ B;  4GC7 A;  2VON A;  5CYJ A;  3PR5 B;  2QO3 A;  1ZTT A;  1H73 A;  4L73 A;  2XMW A;  2C28 A;  4FPR A;  5L39 A;  3OL6 A;  4WFB Q;  3PEH A;  5IS2 A;  1NAQ A;  2AJ0 A;  4PWD B;  3G2X A;  4ZHR A;  4IR1 A;  2AYB A;  4HH0 A;  1FER A;  4A8Q A;  3VAM A;  2B9W A;  1RT7 A;  2V34 A;  3FGV A;  4LF1 A;  1QSS A;  1H7X A;  3NLC A;  3TP2 A;  1IBL J;  4TLR A;  3R7N B;  3R9L A;  4JI5 J;  3H5X A;  2V8D A;  2RDD A;  1REV A;  2MYF A;  3K8V A;  3FDS A;  4KV8 B;  3G6Y A;  5L9N A;  4FYX B;  2CYY A;  3W64 A;  1HYS A;  2HAI A;  3FKB A;  2D41 A;  1XNR F;  3C6U B;  1FNX H;  1TL7 B;  3P5B P;  1RCO B;  3QAU A;  1ACM B;  4P2M A;  1LV5 A;  4YS2 A;  1PKU A;  2EK6 A;  6AT1 B;  1VJW A;  4DPT A;  4TY8 B;  2JFK A;  4C8K A;  2BE2 A;  1OPI A;  1GFW B;  2L9D A;  2ROE A;  4O3N A;  2F1F A;  5AXK A;  1S6Q A;  5D4N A;  4EWT A;  2MLZ A;  2N7Y A;  1UCN A;  3P4U B;  1OPZ A;  3RB0 A;  3W8P A;  1RI7 A;  2A0F B;  1RT4 A;  2E5I A;  3BRE A;  3L7P A;  5HBM A;  5I4M A;  1WG4 A;  5G0R A;  1O5J A;  2POK A;  2YBV A;  1WG1 A;  2I8E A;  2RUG A;  5F9L A;  2CPY A;  1CC7 A;  2C2O B;  3Q86 A;  1VDH A;  2MKJ A;  5DRK A;  2ZH7 A;  1ULR A;  2WW8 A;  2GQC A;  4ZLJ A;  2AV5 A;  4HEA 9;  3HHL C;  1HIY A;  1SH3 A;  2NZC A;  3J7Y I;  1SKU B;  2IAJ B;  2FJB B;  3QYY A;  2C3O A;  1UEK A;  3UCZ P;  2BXJ A;  1EHW A;  2E5H A;  4L6V 3;  4IR9 A;  3QFH A;  2BMB A;  4H4M A;  2PN6 A;  2H5E A;  2BX6 A;  1T95 A;  4DCP B;  3KHR A;  4N8O A;  1MRO B;  4BDP A;  3AOD A;  2RKI B;  3MEE B;  3PVX A;  1EX8 A;  5KTQ A;  4DZD A;  1K44 A;  4ZVE A;  5J2N A;  2DNO A;  3TQE A;  1LFP A;  3DOK A;  5KFZ A;  4ZVG A;  2X1F A;  4KO0 B;  4WZM A;  3K0J A;  1M5P C;  4MTP A;  1WSR A;  1KON A;  3MEC A;  1CPZ A;  4J90 A;  2OIH A;  2PSZ A;  1KOO A;  2E1A A;  4P2F A;  3B78 A;  3AOB A;  4OI3 A;  2XSJ A;  5GAH I;  4M95 A;  4XIU A;  3A3P B;  4JI2 J;  4PYA A;  2W1B A;  2HSE B;  4EFA C;  2Y1I A;  3KKF A;  1P8G A;  1Y5L B;  3GE9 A;  4J5O A;  2XCA A;  1WEZ A;  4NXN J;  4WTY A;  4ECV A;  2XNQ A;  3QJP A;  1IUJ A;  4ZPD A;  4DX8 H;  3N6N A;  3D5M A;  4N7T A;  1FDN A;  3PRV A;  5ETQ A;  1KTQ A;  4ZLL A;  1RHK B;  3IM9 A;  3MM6 B;  1WF0 A;  4HL9 A;  4QW8 A;  3QRQ A;  4B9M A;  1RAA B;  3MR7 A;  3ZNU A;  4F50 A;  4NLQ A;  1ZAV A;  2HW3 A;  2CQ3 A;  1DQ8 A;  5A8W A;  2DGO A;  3C14 A;  4D3H A;  3MD3 A;  2YKQ A;  2IIH A;  2LXI A;  3T6J A;  2HLT A;  4ZOS A;  1SQG A;  1NPP A;  2ROP A;  4R0J A;  1V3R A;  4FKY A;  3LGH A;  2R8K A;  2HMI A;  3GWC A;  1IJE B;  2XSF A;  1VBY A;  4CM2 A;  2D9O A;  4I67 A;  4F26 A;  3HVT A;  1BUX A;  2ZDO A;  2W4D A;  2MQM A;  3ITH A;  1X5O A;  3IN5 A;  1T03 A;  4YUD A;  3H5U A;  3G6V A;  3AD7 C;  4RWW A;  3P6Y C;  5LXY A;  4DL7 A;  2KG1 A;  1IR0 A;  2V9W A;  2PO4 A;  4K8R A;  1N48 A;  4X4Q A;  1U47 A;  1KHV A;  2W9A A;  4XK8 C;  4BS2 A;  3G71 S;  3O8W A;  3BSO A;  2PI4 A;  2MQN A;  1IKW B;  4WFX A;  3LOU A;  2QA4 S;  2VQE F;  2HBQ B;  2UXB F;  1X31 C;  3PAC A;  4M5K A;  4IYQ A;  2FIU A;  3OVA A;  1IXK A;  4P71 A;  4Y34 A;  1TZ0 A;  2N4D A;  3HF5 A;  3ENQ A;  2XY6 A;  3EGV A;  2QEX S;  4NYO A;  2QFI A;  3L09 A;  2V4J B;  1QE1 A;  2I5J A;  3SV3 A;  1HNW F;  2R7W A;  3H2V E;  4U9R A;  5KFF A;  1VQ4 S;  1C0U B;  4IQX A;  4ZPT R;  1YZ7 A;  2HVZ A;  3OTE A;  2LFV A;  3HT3 A;  3TEG A;  2CKW A;  4DR7 F;  2FJX A;  2B6A A;  3LAM A;  2BJ1 A;  4ED7 A;  2HRT A;  1A0O B;  1FXD A;  1YJ7 A;  4X64 F;  2C22 A;  4JI8 J;  3M6V A;  4FXV A;  4IFY B;  1MSW D;  4KGM A;  2HK3 A;  3QGG A;  2DPJ A;  3PJ9 A;  4IH7 A;  1S5Z A;  4Y2M A;  3TJ9 A;  4MK7 A;  4DV1 J;  2HZV A;  1N52 B;  3IM8 A;  3V6K A;  2WB1 D;  4C3K A;  2DGW A;  3AJ1 A;  2RHS B;  5BYR A;  4F04 B;  1B99 A;  1N5V A;  2FHJ D;  3N5B A;  3M8S A;  2YNF A;  1X9S A;  3TQ1 A;  3QFW A;  2JX2 A;  3BGR B;  3X3U A;  2XM3 A;  2QL7 B;  1SUQ B;  4ZJL A;  5HRO B;  2OHD A;  4J9V A;  4ID8 A;  3MCS A;  2CVI A;  4C11 B;  2N82 B;  3DLJ A;  3DN9 A;  5KFD A;  2IRU A;  2M9K A;  4ICL A;  2BQU A;  1VHI A;  4NOH A;  2UUT A;  2RUS A;  3DRP A;  4HAC A;  4B17 A;  1ZM3 A;  3EWG A;  4GMK A;  2CJ9 A;  1T02 A;  4MK8 A;  4C3L A;  1SH2 A;  2XHW A;  4LRA A;  4YN3 B;  1Y4Z B;  1FD2 A;  1GEH A;  1MWY A;  1RAJ A;  2Y1L B;  4NA3 A;  2VFU A;  2RNE A;  3QRP A;  1VRU B;  2J9C A;  4DR3 J;  4EO8 A;  4K4Z A;  2OPS B;  1KOH A;  5KFQ A;  4WP8 A;  2OEK A;  4AFF A;  4DQR A;  4PXE A;  3TAR A;  2HGM A;  1ITP A;  3G9C A;  3AAW B;  3DDN A;  3V6J A;  4B08 A;  3KLE A;  3TX8 A;  3K57 A;  3IS9 B;  2NUH A;  3Q0A A;  2QA1 A;  2Y1R I;  2YWH A;  1Z2Z A;  1RU1 A;  1FWP A;  5FDL B;  2R8I A;  5L38 A;  1Q0N A;  5JVH Q;  4RLE A;  1N56 A;  1APS A;  2MHE A;  3LAK A;  3T1Y J;  4HTI A;  3W60 A;  2RDI A;  1N34 J;  1HNI B;  2L9W A;  4CH1 A;  3PFE A;  3DDI A;  1HBM A;  3C2P A;  1B64 A;  4KGX B;  5CYM A;  6FDR A;  3QGP A;  2VPW B;  3BV8 A;  1RAB B;  5F8I A;  2DNH A;  4HT5 A;  1Q78 A;  3ET6 A;  3THP A;  1U4B A;  1S1W B;  5LMU J;  2HHQ A;  3VF0 B;  3NCP A;  2ERR A;  4KHP J;  2OPR A;  2DBB A;  1V5I B;  4FNH A;  4KIA A;  3UQS A;  4NZ0 A;  4KSE B;  4QCL A;  4P7T A;  2ZD1 A;  4GVB A;  2YVS A;  5F8N A;  1FXR A;  2XO7 A;  1EAY C;  3THV A;  2XGP A;  3HVR A;  2VG7 A;  5KFC A;  3M1V A;  3DRR A;  2N3O A;  3DC2 A;  5CQG A;  4ZVT B;  3FSY A;  1QTM A;  3BBC A;  4A8O A;  1TKT A;  1NJI T;  4DV4 F;  1XN9 A;  2PI5 A;  2O5D A;  4M63 A;  4W98 A;  2QLW A;  2L9N A;  1IVZ A;  1H2T Z;  2HFZ A;  4C8Y A;  5AJ3 J;  3SZ2 A;  5KFX A;  2IHR 1;  4ECX A;  3O44 A;  4OI6 A;  2X1B A;  4ZIW A;  1WC4 A;  5IV3 A;  1N5Q A;  1X0P A;  1R8C A;  3RBX A;  3C6T A;  4B9S A;  5IC4 B;  2JDJ A;  1ZH5 A;  3Q8P B;  3NWR A;  3RBE A;  3LP1 A;  4C8N A;  4BWJ A;  1F5C A;  3M2V A;  3O5T B;  2KRB A;  2J9D A;  2DHH A;  1DAR A;  1HBO A;  5ETP A;  1R89 A;  4A8W A;  2GO8 A;  3FNN A;  3I5C A;  1W2B R;  3WX8 A;  3HZE A;  3I82 A;  2JVO A;  4ALZ A;  1HI8 A;  4EU0 A;  1T9V A;  1RTJ A;  1TFW A;  4P75 A;  3JXO A;  5L9X A;  2CZV C;  2AGO A;  2HFV A;  2YXL A;  2KHC A;  4ETX A;  2DGT A;  3FK4 A;  4UQG A;  1GNK A;  2N7C A;  4ERD A;  1YZ6 A;  2G1D A;  1Y5N B;  3EVM A;  4QR1 A;  1U2R A;  3RB4 A;  2M88 A;  4YQW A;  1G7C B;  4KRW A;  4CO3 A;  4UST A;  1VIS A;  9RUB A;  2OGU A;  2VU5 A;  2FB0 A;  1KVK A;  2WON B;  3J7Z 5;  4JI4 J;  2NUU G;  4AQY J;  2EW9 A;  3I4H X;  4RW7 A;  2PMZ D;  2ZH4 A;  2NRE A;  1F3V A;  3HHL D;  3W9I A;  3FFI B;  1B0T A;  2HGN A;  2HBY B;  5T7L B;  2UVV A;  1UJ5 A;  5J2Q B;  1UVN A;  1U6Z A;  1N6Q B;  2K1R B;  3ZTS A;  3K5O A;  1D0E A;  3BB5 A;  3V81 A;  4FF4 A;  2DGX A;  1SPB P;  1KDN A;  1FD8 A;  4DL6 A;  4ED2 A;  3OFF A;  4NLS A;  1S1X B;  4PXD A;  5F9N A;  2DGV A;  3ZZ0 A;  4EBE A;  7FD1 A;  4KE5 A;  2HGL A;  4CQ1 A;  1PBU A;  1TKX A;  1HR0 F;  2D9P A;  3I9V 9;  3E01 B;  4DN0 A;  3NGU A;  1T05 B;  4CYU A;  3EDQ B;  1KTV A;  1BQN A;  2RU3 A;  4LF2 A;  2BOP A;  1I3O B;  5A6W A;  4OZ0 A;  3CIZ A;  3GFZ A;  1SV5 A;  4PAA A;  1CQN A;  2QYC A;  4LFC F;  1BGX T;  2CQP A;  2KM8 C;  3I0R A;  3RU0 A;  1NPR A;  1S1V A;  1L3V A;  1MN9 A;  2EBG A;  5IQQ A;  3CSK A;  4RBV A;  3SQO P;  1NDK A;  3RRH A;  5E3P A;  4DL3 A;  2QV6 A;  3TNV A;  2XSJ B;  2AJ4 A;  3QIP B;  1GTH A;  4ED8 A;  5KG1 A;  5KFG A;  1Q86 T;  2RQ4 A;  3UVJ B;  3ZC4 A;  2C2M B;  2C2D A;  3DLG A;  4NLO A;  3VGS A;  1C1B B;  2AIR B;  5J1P A;  4WYL A;  3W8G A;  4LSN A;  1A9N B;  1O0P A;  4ZCL A;  5HAN A;  3Q23 A;  3IRX B;  1ICE B;  5I42 A;  2CQD A;  4PR6 A;  2E1C A;  1UZH A;  1N5Y A;  4B9L A;  5F8H A;  2DO0 A;  4N76 A;  1U2C A;  1JJC B;  3VAL A;  1KD1 T;  3NMR A;  2BVZ A;  2P6S A;  3TOQ A;  2XI3 A;  1JJ4 A;  1R0B G;  2MQ8 A;  3TI0 A;  3BDP A;  4AL5 A;  1WG5 A;  2I38 A;  2PFF B;  5KFE A;  1MWZ A;  4C4W A;  1RTZ A;  1N88 A;  3H98 A;  1TQL A;  4DR2 F;  2HS4 A;  4M5G A;  3DYA A;  3W2W B;  1UVK A;  2MJN A;  2ZVI A;  3MZI A;  2AP6 A;  2JEG A;  4CNY A;  3A8I A;  3ZTQ A;  4U7C A;  1DZ5 A;  3BGL A;  1CEZ A;  4GKJ J;  2FJA B;  1FFW B;  1BXN A;  4ECR A;  4CLK A;  1S59 A;  3BH6 B;  4Q0B B;  3BM7 A;  3M8Y A;  2BJ7 A;  3FZ2 A;  3W66 A;  2M3D A;  2VKR A;  1UZD A;  2DNK A;  3DCA A;  4LF8 F;  3Q8V A;  1KQF B;  4DOZ A;  2CPF A;  3M8Q B;  1RT6 A;  2C3Y A;  3BYP A;  3CCZ A;  3NMA A;  4DEZ A;  2Z2Y B;  2ZZT A;  5KG0 A;  2O3D A;  1RHJ B;  2DYA A;  3IGN A;  4IO9 Q;  3D3C J;  3KJV A;  3DGV A;  2FZK B;  4OIX A;  3O2I A;  5HVH A;  2IFX A;  4CNZ A;  3AQO A;  1UVM A;  1ZA2 B;  3AA9 A;  1DLO A;  1WC3 A;  4OI4 A;  3K89 A;  1YI2 S;  1JKH A;  1LWC A;  4WU2 A;  2GQQ A;  3LH2 S;  4F4W A;  3NNC A;  4ANE A;  1RTD B;  1S9G B;  2AMC B;  4AND A;  4LF9 J;  4MYT A;  2B9E A;  2R7T A;  3MTJ A;  1YJN S;  5KT4 A;  3ZZU A;  1NH7 A;  3EM1 A;  4Q45 A;  3L7U A;  3OJS A;  4I6Y A;  3PIP Q;  1VQ9 S;  4LF6 J;  2KT5 A;  3MMC B;  1GXT A;  3RUB L;  3DLE B;  3UR3 C;  2FQQ B;  2MKS A;  4MIB A;  4CDI A;  5H9F J;  1P1T A;  1AA1 B;  4MFB A;  4LIW A;  3U7J A;  2JNJ A;  2EFG A;  3CCR S;  4G1I A;  2BM0 A;  1OQ6 A;  1U26 A;  3DOM A;  3HLU A;  3D68 A;  3MPV A;  5HLF B;  4USH A;  5A8R A;  1OQ3 A;  2C42 A;  2OPQ A;  3HCX A;  2FJV A;  4DG1 A;  3AOC A;  3BGF A;  1FJG J;  4DQI A;  5GAG I;  1N33 F;  1OMS A;  2DPI A;  3PYE A;  1UEV A;  3I87 A;  4M94 A;  3NS5 A;  2OEL A;  3PTW A;  3I4P A;  4NYZ A;  4PG7 A;  2J0Q D;  3Q8U A;  3F56 A;  3MMA A;  3CJK B;  5C5J A;  3UDV A;  1PBA A;  4Z7C A;  2C3M A;  2CAD A;  4ED4 A;  3MM7 A;  5DM6 Q;  3KHL A;  2CJB A;  3ADA C;  4OHZ A;  1CJV B;  4USW A;  1ZBT A;  1F0X A;  4HVZ A;  1GXU A;  1BQX A;  2HRY A;  1S0M A;  2KYZ A;  3TEH B;  1CUL A;  4PYD A;  1NDL A;  3KLH A;  2IJN A;  4H54 A;  2WAQ D;  4XO0 A;  4OFZ A;  2NLW A;  2AW0 A;  1JLF B;  3KLI B;  3ILL A;  1Q8B A;  4X65 F;  3KLE B;  4RUB A;  8RUC A;  2GVD B;  4B3S F;  4DQQ A;  1QSY A;  4WBF A;  4X84 A;  1JLQ B;  2YKM B;  2DB1 A;  1Y10 A;  2ZEJ A;  3RRK A;  3CJ5 A;  4JI2 F;  1U1N A;  3HK2 A;  4QWE A;  3DNC A;  2VBW A;  3BPD A;  4CCH A;  1AUS L;  2RT3 A;  4NXN F;  4FVC A;  2VL1 A;  1FEE A;  5D4L A;  2K06 A;  2ZC4 A;  1C0T B;  4DFM A;  5JUM A;  3GB0 A;  2KXF A;  1D09 B;  3ET6 B;  4HI1 A;  5KG5 A;  4C97 A;  5FJ4 A;  1Y11 A;  2BAN B;  2RRN A;  4RW9 B;  1TVR A;  2YTC A;  4N8N A;  2CQG A;  5KT7 A;  1RT5 A;  2HND B;  1UFK A;  1HQE B;  1JQG A;  5J2M A;  4LSL B;  3D66 A;  2HKE A;  4GO7 X;  4UOF A;  1S1T A;  4CLS A;  3GJQ B;  1WSV A;  3PZP A;  4NI2 B;  2F8H A;  1TAU A;  3OPK A;  3KMQ A;  3CDE A;  5EN1 A;  3SI8 A;  3SCK E;  4ECU A;  5D3G A;  1S57 A;  4Z2X A;  2HNY B;  3CJ8 A;  3TJ8 A;  4Y6I A;  2CNL B;  5HK4 A;  2DHS A;  3AB4 B;  2AYM A;  3AB2 B;  2Y9H A;  1XNQ J;  4QWA A;  4HR2 A;  4FPI A;  3BGO P;  1MMD A;  3S01 A;  3W65 A;  1NME B;  4PUO B;  2RVJ A;  2CJQ A;  3HDS A;  3FRZ A;  1QTN B;  3ZZT A;  2XGQ A;  3OBI A;  5A8K A;  1WEL A;  2YWF A;  1VFJ A;  2B5J A;  2ZWP A;  2R2S A;  3M2V B;  2ASJ A;  5KAK A;  3UN2 A;  3T1H F;  3JQJ A;  3GP9 A;  3R5J B;  2JFD A;  4DZ6 A;  2IPO B;  4P10 A;  3PIO Q;  2WSE C;  1HD1 A;  3POT A;  3QZ8 A;  4WWS A;  2CFX A;  1KLM A;  2IMO A;  3HHD A;  4DQP A;  1VQ6 S;  1HNX F;  4WU3 A;  2YNH B;  3IP0 A;  2YQ3 A;  4ZIT A;  4Q8F A;  3NGT A;  1YSJ A;  3TZW A;  2QLJ B;  1SJR A;  2RQK A;  1HQU A;  2KO1 A;  2MKY A;  1NZ8 A;  3QPI A;  3D0G E;  1QY7 A;  4LQ9 A;  4DUZ F;  1HPZ A;  1IQZ A;  1RB0 A;  2QG9 B;  1HHS A;  2M7S A;  1J5O A;  2GMH A;  5H9E J;  2DIT A;  3FBF A;  1FKO B;  1RJJ A;  2P8I A;  4OYB A;  3ILI A;  2OTJ S;  1HMV A;  2XZD B;  1CS4 A;  1JLA A;  3EIC A;  4RW4 A;  3EDR B;  2VG5 B;  2V68 A;  2Z0G A;  5GVQ A;  1TL4 A;  1FRH A;  1LKZ A;  2KZM A;  1Q16 B;  3SBM A;  1DHM A;  2VB6 A;  4DV1 F;  4RU9 A;  3E2E A;  4I4B A;  2UXD J;  4IUF A;  1A7G E;  3HVA A;  3VHQ A;  1WC6 A;  4OLO A;  4QJV A;  2ZDP A;  4PCQ A;  1UWA A;  4DU7 A;  2OUG A;  1TFY A;  1NRK A;  4QPT A;  3NS6 A;  4CTA A;  2PFD A;  3MR5 A;  1MW7 A;  1NND A;  1K1Q A;  2YNI A;  3G6X A;  3OTD A;  3PFO A;  4C6A A;  2O1P A;  1LWX A;  2UUA F;  4QWC A;  4JOU A;  3CCT A;  5CD4 H;  3LGM A;  1PJ7 A;  3GIJ A;  4BHQ A;  1XWL A;  1OY6 A;  2NS1 B;  3ENW A;  2IM3 A;  3TUP A;  1KQK A;  3K59 A;  4RNF A;  3I0R B;  3CC4 S;  1NK8 A;  2Y0S D;  3B4M A;  2DNL A;  4PG4 A;  2YKO A;  4FXD A;  4JI6 J;  3UDC A;  4R8U A;  4USI A;  1TUG B;  3A12 A;  1HW8 A;  5K14 A;  5LJ3 Y;  3R97 A;  4DR3 F;  1VRT B;  2K3K A;  1TV6 B;  4GKK F;  3BQ0 A;  3QLH B;  2UUC J;  2HVE A;  1NJZ A;  1Z4U A;  3WBZ A;  1YRT A;  1GMV A;  2BJE A;  5HVG A;  5GAD I;  2V63 A;  3FQK A;  1LWF B;  1IWG A;  3D6T B;  5DQH A;  4TKT A;  5I42 B;  3KMS A;  2AHO B;  3QNW B;  2KFZ A;  2FJD B;  1IKY B;  2FTR A;  3KTQ A;  3JAM U;  5CYQ A;  3LPE A;  3WIU A;  3FMB A;  1VMB A;  4ED0 A;  3MM5 B;  2VIH A;  4TN2 A;  2PD1 A;  3MCN A;  4ZPB A;  4F4Z A;  1IKV A;  1MWQ A;  2R7S A;  4NE9 C;  4QIF A;  5EX3 A;  3KK3 A;  4I2P A;  4PRF A;  4J9Q A;  4JV1 A;  3R5G A;  1DTT B;  5C24 A;  5RUB A;  1UVL A;  1JLB B;  2AD9 A;  4KHR A;  2WZ1 A;  4FYV B;  3DYA B;  1M5V C;  4WYW A;  5DQG A;  5I3U A;  2R7U A;  3ZO7 A;  2QTW A;  4KHP F;  3ETM A;  3HM9 A;  3V6H A;  1X4E A;  3MUM P;  1JX4 A;  4E0D A;  4ECY A;  2P9E A;  1NDP A;  2LXF A;  2DNY A;  4F4Y A;  2LVW A;  4U67 Q;  1R7I A;  1S0N A;  3IXQ A;  2MQP A;  1AW0 A;  3WHI A;  2MQO A;  3ONQ A;  4M5L A;  4DU8 A;  2GAH C;  1VBZ A;  3HSD A;  2CVE A;  3ZFV A;  5HO4 A;  2NZ4 A;  3EZ5 A;  4CIO A;  1VC6 A;  2W25 A;  5BJR A;  1AYE A;  5DG7 A;  3AY0 A;  1YHQ S;  2CNO B;  1VQY A;  1U24 A;  2D1C A;  2HS3 A;  1U1M A;  4B3T F;  3NG8 A;  4ATN A;  1YJV A;  3DOL B;  2RB7 A;  2MGZ A;  2W9C B;  4LUB A;  3K8W A;  5KFA A;  3BKU A;  2F4V J;  2YH1 A;  3CW2 C;  4ZMM A;  2HFS A;  3SCL E;  2MZT A;  1YGY A;  1X60 A;  1RBO B;  5ETL A;  3G82 B;  4RNO A;  2RU9 A;  3FSI A;  3GMG A;  3QT7 A;  3KDO A;  3HHL B;  2RS2 A;  4WK1 A;  5B7W A;  2QLB B;  4FZV A;  4JI3 F;  3KUE A;  1XMO J;  4NPO A;  2ZOF A;  5L1L A;  3KK1 A;  5ETS A;  2VA3 A;  2YKN B;  1FF2 A;  2MY8 A;  1SL2 A;  4NLX A;  3PW2 A;  1H98 A;  1IKX B;  3BO2 A;  1TEL A;  1ZM9 A;  2KB2 A;  3U02 A;  2C3U A;  3FCW A;  4ED3 A;  5KT2 A;  3W2V B;  1XR7 A;  1EB0 A;  1TAQ A;  1I94 F;  5EWG A;  3CB4 A;  2LLZ A;  5KFL A;  1HA1 A;  2BOA A;  4OZJ A;  2DR6 A;  2FVP A;  3AOA A;  1UVJ A;  2OPQ B;  2ZKU A;  1RWM B;  5G4D A;  1VC0 A;  2NSC A;  2NYH A;  3KLF A;  1FKA F;  2EG1 A;  3KLG A;  5HN0 A;  3CXC R;  1R43 A;  4K2X A;  2W2P P;  3BKF A;  3SEO A;  2XEX A;  5F3Z A;  4OYW A;  2HHH J;  2M8D B;  4P2X A;  4IOC Q;  5IT4 A;  4J9S A;  5FD1 A;  1ZYQ A;  2RIJ A;  1G4C A;  4M1K A;  2ZNY A;  2OKQ A;  1N0U A;  1WC0 A;  4RW6 B;  4K2J A;  4B9U A;  4RUH A;  3OTB A;  2IYG A;  2ZH5 A;  2VC0 A;  1LW2 A;  4F0H A;  2Z2M A;  3PV8 A;  1DY3 A;  1SBR A;  2AJQ A;  4CLZ A;  1AB8 A;  1X8D A;  1E6Y A;  3CJ0 A;  1GMU A;  3JTO A;  4AXI A;  1SIW B;  1N5T A;  1F1B B;  1VQL S;  4KFB A;  1NEE A;  4K0K J;  5GAE I;  1WHX A;  4LMZ A;  2EWH A;  2OSQ A;  2JH3 A;  5L8R C;  1QUV A;  4U7U K;  1NK4 A;  1U8W A;  5K8P A;  1U2F A;  2UXC F;  2R2R A;  4OJ1 A;  5F0U A;  1O8B A;  1S99 A;  3D54 A;  2FDN A;  2ZVS A;  5HP1 A;  4NZ7 A;  2DH7 A;  4ZLN A;  1PO6 A;  1ZAW A;  4IDK A;  4ZN3 A;  3M8P A;  3DDK A;  3C15 A;  3OFH A;  1X7V A;  1FK9 A;  1HWL A;  1M5S A;  1J2V A;  1HBN A;  4EO6 A;  4AL7 A;  1FWK A;  1OY8 A;  5ADZ A;  1Q7Y T;  4ZPA A;  2DD8 S;  4TYB A;  8AT1 B;  1NU4 A;  5B0E A;  2BYC A;  4MKY A;  4MJK A;  4K59 A;  3C66 A;  3DKD A;  2RF2 B;  2ZE2 A;  1FX4 A;  1U0H A;  3EGZ A;  2U2F A;  2VG6 A;  2JWN A;  1JLC B;  3PJW A;  2ASL A;  3M05 A;  2VD3 A;  3JB9 k;  4K4S A;  2R3V A;  4TNO A;  1A6L A;  2BRL A;  4G1Q B;  1D3W A;  2G2O A;  3ZNJ 1;  2EKN A;  5KG7 A;  3PKY A;  3NKY A;  3CIM A;  3OUY B;  4ELU A;  1ZET A;  3PDN A;  2DNN A;  1HD0 A;  1RTH A;  4JYA J;  3KK2 A;  1X4G A;  3BKT A;  1NLK L;  2J7W A;  2VH7 A;  1NZA A;  4OZ1 A;  1SJ1 A;  5E3C A;  2FGC A;  3N5F A;  4C7Q A;  1RT2 A;  5ETV A;  4KKO A;  4JV5 J;  2VFV A;  3BEG B;  2HQC A;  2GJ2 A;  3D2W A;  2HUR A;  3C8Y A;  4FVM A;  2J7U A;  3DI6 A;  3PJX A;  1UFL A;  1L3K A;  4U8Y A;  4NRT A;  2Z4P A;  5I3Q A;  4P6Q A;  5GME A;  3GJR B;  4P2S A;  3M2U A;  2LMI A;  1VK8 A;  1RYS A;  2PC6 A;  3DU5 A;  4ZJQ A;  4LBP A;  4DCJ B;  1HQU B;  1XEZ A;  1GMW A;  2ZH1 A;  2KH9 A;  2DNQ A;  2V8H A;  2WVB A;  2OLW A;  2DT9 A;  4B02 A;  3TA1 A;  3A8K A;  3TA0 A;  1C2P A;  4URS A;  3D28 A;  3Q83 A;  3MR3 A;  2IDL A;  1Q8I A;  1WI6 A;  2HG4 A;  2V2V A;  4LF9 F;  1WI8 A;  4WP9 A;  3DHW C;  5J1E A;  1HWJ A;  4NLV A;  2Z56 B;  2AGP A;  2DCL A;  3D9B A;  3K5P A;  4KPY A;  4OYA A;  1K0T A;  2FPH X;  4YFU A;  5J1N A;  2UV8 G;  4ID5 B;  2PII A;  4QYZ K;  4NWB A;  2IM0 A;  4ED1 A;  2VOP A;  2ZBQ A;  5KOX A;  1FFS B;  3W5X A;  2IVM A;  2XS7 A;  1LWE B;  3T5L A;  4F4K A;  4RZR A;  2FVC A;  1VCT A;  1IR1 A;  2QT7 A;  1N32 F;  2MJU A;  2V50 A;  5IT0 A;  3RJM B;  5E7O B;  4DR1 F;  1UP1 A;  4JV0 A;  5D15 A;  1D9F A;  1GXL A;  4OYZ A;  2NXC A;  3HP6 A;  3W9H A;  3NNA A;  4F0K A;  2XYG B;  4LFA F;  2HZA A;  5H9F K;  3MAA A;  1CJT B;  1SC4 B;  3P3D A;  1D9D A;  3IWX A;  3MHY A;  1HBU A;  5SZT A;  4NLT A;  3VR1 A;  4NLU A;  2GCF A;  3SSS A;  3R6L B;  4EZ6 A;  1M5K C;  4F3Q A;  4Y0F A;  4X62 F;  2M4M A;  2EC0 A;  4HDH A;  3R7S B;  1P6T A;  5I3P A;  2XB2 D;  1IBK F;  3G8Q A;  3GCW P;  1RAC B;  2P2C B;  2UZA A;  3NEK A;  4UQT A;  4WE1 B;  1EQM A;  1D1U A;  4DV2 F;  4WFY A;  3JSR A;  2N4C A;  5J2P A;  3MCM A;  2DRD A;  5HMY A;  5EWE A;  4B3M F;  4UUX A;  1WD6 A;  1P9Q C;  2CRL A;  2XHC A;  3OSN A;  4NLG A;  3NCR A;  4G1P A;  1YJU A;  1RWV B;  2CQC A;  1RAO A;  1WNE A;  2YQ1 A;  4M5N A;  2HBR B;  2YNG B;  1TUV A;  3JSM B;  4WP3 A;  2BE9 B;  1PAE X;  2FY1 A;  3JSY A;  4V1A k;  1S49 A;  3JYT B;  2XS5 A;  1RGV A;  3ZZR A;  5LXR A;  4OYO A;  3HHE A;  1HI1 A;  1JLE A;  2GX8 A;  3MEK A;  1NK6 A;  4OV1 A;  2HAF A;  3F73 A;  4IG3 B;  2VC1 A;  2J9D E;  1T9T A;  4YY3 F;  1VYA A;  1FT8 A;  1UWB B;  3AFG A;  4F02 A;  1U49 A;  5ETM A;  4DLG A;  2P5V A;  2M0G B;  3H59 A;  2LKZ A;  4EGL A;  1S6P A;  5IQ6 A;  5KFK A;  2MZS A;  2R8J A;  2Q1L A;  3BQ1 A;  2HFO A;  2WHO A;  2XZT B;  4QZV B;  3ZTR A;  8ATC B;  3E3X A;  1O6X A;  4LRE A;  3J81 Y;  3M8Z A;  2CPI A;  4QU7 A;  3UN5 A;  2XMT A;  5CZV A;  2MY7 A;  3NS7 B;  2MKK A;  5C7P A;  3MAQ A;  1URR A;  1HHQ A;  1FWL A;  3MR6 A;  4PG6 A;  2DRA A;  3T9Z A;  1RWP B;  4M5D A;  1HNV A;  1KNZ A;  5IOL A;  1B7F A;  3W5Y A;  4XAK A;  3P8B B;  3R2C J;  2MEW A;  1GX6 A;  2DXE A;  2XQC A;  2LQ8 A;  2JLG A;  4I7F A;  2GQ2 A;  5K8M A;  4TU7 A;  4X4S A;  4OHV A;  2XLJ A;  4IG0 A;  5MLC V;  3GIL A;  4NCG A;  4ZVQ B;  2EFV A;  4ECT A;  4EI2 A;  3QSY B; 
#chains in the Genus database with same CATH homology
 2BW7 A;  4USU A;  3G82 B;  4CM0 A;  1AZS A;  4WP9 A;  2GVZ B;  1CJU B;  4UST A;  4OYB A;  1CJT A;  1Y10 A;  3C15 B;  4NI2 A;  3R5G A;  1TL7 A;  1CJU A;  1WC3 A;  4OYA A;  1CS4 A;  2WZ1 A;  4CM2 A;  5D0G A;  1WC4 A;  5IV3 A;  4OYW A;  1WC1 A;  1CJK B;  4P2X A;  2GVD A;  4CLY A;  4WPA A;  4OYM A;  1YBU A;  3G82 A;  2QV6 A;  1WC5 A;  2GVZ A;  4OZ3 A;  4P2F A;  1CUL B;  5IV4 A;  4OYP A;  3MAA B;  3C16 B;  1WC0 A;  3C15 A;  4OZ2 A;  3ET6 B;  2W01 A;  1Y11 A;  3ET6 A;  1U0H B;  3UVJ B;  1FX2 A;  1WC6 A;  4OYI A;  4CLU A;  4CLK A;  5D15 A;  1CJV B;  3C14 B;  1CJK A;  4USW A;  5D0E A;  4OYZ A;  4CLZ A;  1AB8 A;  5D0R A;  4CLL A;  1CUL A;  4CLS A;  3MAA A;  5D0H A;  3C16 A;  4USV A;  1CJT B;  1YBT A;  4NI2 B;  1TL7 B;  4CLW A;  4WP8 A;  4WP3 A;  4P2M A;  1FX4 A;  3MR7 A;  1CS4 B;  1U0H A;  3UVJ A;  4CLP A;  1CJV A;  3C14 A;  4OYX A;  4CLT A;  4OYO A;  1YK9 A;  1AZS B;  2GVD B;  4CLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...