4P2XA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
186
structure length
167
Chain Sequence
RNIIADKYDEASVLFADIVPALVRFLDRLYSAFDELVDQHGLEKIKGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRNPVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVMRTWYLIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase
publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 39
structure length 167
sequence length 186
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2xA00
4CLKA 2GVDB 5D0RA 1CJKA 1CULA 1CJTB 4OZ2A 4USTA 1U0HB 4USWA 1U0HA 4NI2B 3UVJB 1YBUA 5D15A 4CLYA 4OYPA 3R5GA 4CM0A 1CJVB 4NI2A 3UVJA 2WZ1A 4OYZA 5IV4A 4OYMA 1CJKB 1Y10A 3C15B 1AZSB 4CLZA 3G82A 4OYIA 1YK9A 3C15A 4CLLA 1AZSA 4P2XA 4OYBA 1WC0A 4OYAA 4OYOA 4CLFA 1WC1A 3C14A 4OZ3A 4USVA 4CLTA 3ET6B 4OYXA 4CLWA 4CLPA 1TL7B 3ET6A 4WP9A 1FX2A 3MR7A 1AB8A 1TL7A 5D0GA 2QV6A 3G82B 4P2MA 2GVZB 4CLUA 4WP3A 2GVZA 5D0EA 4CLSA 3C14B 1YBTA 3MAAB 4CM2A 4P2FA 1WC5A 4WP8A 3MAAA 5IV3A 5D0HA 3C16B 1CJUB 1FX4A 2GVDA 2BW7A 3C16A 1CJUA 1WC4A 1CJTA 4USUA 1Y11A 1WC6A 1CS4B 1CJVA 4WPAA 1CS4A 2W01A 4OYWA 1WC3A 1CULB
chains in the Genus database with same CATH superfamily
3EXYA 1CULA 1L3VA 3UD3P 4URQU 3ZZUA 4YB7A 4WKYA 2IMWP 3K58A 1UJ4A 3TUJC 3IMQJ 4OHZA 3Q8UA 4C98A 1NM2A 1W26A 1TL1A 2V0NA 5B0GA 2YY3A 2CWKA 1MNEA 1UPMB 1R0AB 5KG4A 2HS3A 4MKYA 2FGOA 3TRGA 3MM5A 2OPQB 2OSQA 2L9WA 3H25A 4B3OA 2HWHA 1LWXA 3H7HB 4ZP8A 4N8NA 4O3OA 4HL9A 1U8WA 4LF5J 5CYQA 4DS5A 2LMIA 4BS2A 2YQ1A 5G4DA 3R7BB 3BBFA 1SV5A 1BUXA 1M5SA 2VL1A 1PBAA 1SBRA 1RYRA 3QNWB 2UXCJ 3ADAC 1DQ9A 3C3LA 2ZD1A 2X3GA 3IXQA 2BRKA 2NUHA 3BR9A 3MECA 4LUBA 1CLFA 4I6YA 1VBXA 4I64A 1WC3A 3TX0A 4LBHA 1N8RT 2JHEA 3OFEA 1S59A 2C3UA 4U7CA 2Q66A 1LWFA 2AV5A 1WEXA 2MGZA 1FDDA 3T1HF 1X0PA 2QSWA 3RAXA 3QJLA 4J9RA 3I82A 4F4YA 5FLXU 3BQ0A 2WONB 1BQMA 4X4QA 2EFQA 4B9NA 3UN5A 2ZBQA 4TQRA 3G4SS 2EI5A 1JLCB 3OHAA 4DMZA 3MR7A 2BR0A 1QAJA 2Y8YA 2FY8A 4ZPTR 4K0KJ 1RT1B 2LQ9A 2HVHA 4LR8A 1RZMA 4KO0B 4ZVUB 2IDLA 3N6LA 4I4BA 4JV5F 4P52A 3IM8A 4PQUA 2J7KA 1R8PA 1W7WA 1P1TA 4KPCA 5KT6A 2AJ2A 4M5HA 2K06A 5KFEA 1LV5A 1RTZA 3FQKA 2EFPA 2VBXA 4ICLB 1KOHA 3VVTA 3ZZPA 3DDNA 3M8WA 3FZ2A 3QIDA 4CLKA 1JK9B 4LSNB 2OH2A 5DG9A 3VQSA 5D6GA 4C8LA 3A8EA 5I42B 4USWA 4N7TA 4ED6A 4DUZJ 2WBRA 1VGYA 2J5AA 4TQSA 5CYMB 5D8HB 4K4WA 1LKZA 4C8ZA 3T1YJ 3EDQB 4QR2A 3SQGA 2Z4PA 1NJYA 3HP6A 4OZ1A 2VIHA 1WOSA 4N56A 1RT6A 3M6WA 1IM4A 4WK1A 4EFAC 4NA1A 2CPEA 3W9JA 1UFKA 1G1XA 5DGBA 1N4LA 5U47A 3C14B 3GILA 4JI2F 4FP9A 5FDLB 2UUWA 1MMNA 3QGHA 5F8MA 2X1GA 2LDYA 2K7KA 3RTVA 3PYEA 4YB6A 4ZPBA 2KG0A 2R4FA 4ECSA 3OR2B 3CDBA 3X3UA 3KK1A 2HW3A 3FBBA 2DO4A 3M2UA 4F02A 2Y9HA 1GXTA 1N88A 1S9FA 5D3GB 3OTBA 3GFYA 2DO0A 2K2PA 2DXEA 2KL8A 2YKMA 4RKUC 1XQIA 4DR6F 5JMNA 4OYIA 5D4NA 3IWLA 3UWTA 4XAKA 3NLCA 3CUNA 1NSPA 5T14A 4KGZB 4UW2A 2R8KA 3U1NA 2CRLA 4ZHRB 2KJWA 2DXDA 1Q86T 4DR3F 2NSBA 3FEXB 4DG1B 3B78A 2UXCF 1VJWA 1U09A 1QJHA 3LGMA 3IWNC 2ZDOA 2VKRA 3AD7C 1T9WA 1FT8A 1B4SA 3PFEA 3BO3A 1KD1T 3LP1A 4OZLA 1FTCA 5IOLA 1F9HA 4RNOA 4AQYJ 2BKNA 3G8SA 1NHUA 1NPKA 4PWUA 1H73A 3FCVA 1MMDA 5SUHA 3HLUA 2FLLA 1RHUB 2IYIA 3DU6A 4U67Q 2BXJA 1X5PA 2HBRB 5KFKA 2PN6A 3Q8SB 3VV2B 2O01C 2WBMA 5KFJA 2HHVA 1NEEA 5HN0A 3H5SA 1X4DA 4A8MP 1E6VB 4K0KF 1G6BA 4WZMA 2KU7A 2V4JA 3ZC4A 2DR5A 1RT5B 1WI6A 4DQSA 1V9OA 1HQUA 4PWDB 3JXOA 1NK5A 1UCNA 1F3VA 3FK4A 2HURA 2IJRA 4QYRA 4JI5F 2JDJA 1BC6A 2QLXA 1S6PB 2XM3A 2CIMA 1WOPA 1L3KA 2V5HG 3CD5A 3PNIA 2WOMB 4XPCA 3CJKB 1HMVB 2FVSA 4GC6A 1U6FA 3OR1B 1YZ7A 4DUZF 3QRPA 2FZCB 2RUSA 4U9RA 4NL5A 3W9IA 1QVFR 3SFGA 2HHTA 2NPFA 5D0RA 3WQPA 5J2MA 4DSIA 2NXUA 2HBQB 4Y3CA 2R2RA 2QL9B 4J5OA 4KH1B 3T1YF 3GONA 2BVZA 1S1WB 1DY3A 2YNHB 3NGTA 3U27A 3H4BA 1BD6A 3E3XA 3HK2A 2PEBA 3I0SA 2CJAA 2XCPA 4GKKF 2VFTA 4JI0F 2HRTA 2PMZD 4WK3A 2MJNA 1WTFA 4QYZJ 4HT5A 3D0GE 1RAJA 4ZDNA 4EZ6A 3HFVA 1EKSA 4J90A 5A8WB 2BUNA 1JKHB 3T5KA 1FX2A 1S1VB 1S99A 1UEUA 2RNEA 2COLA 3NAIA 1NAQA 3TYTA 1JLQB 4F3MA 4ZVGA 2Z58B 8RUCA 4YHHJ 5DLFA 2ZEJA 3VAGA 9ATCB 4M5IA 2JRSA 4HR2A 5LT5A 1H2UX 3Q86A 2CAJA 1EP4A 3I0RA 1U1RA 2I38A 4R5PB 1V5VA 1PAEX 1N56A 5KOXA 3M8ZA 2GC8A 5L1LA 1X9SA 3EZOA 3CJ4A 2XQCA 3S01A 2EK1A 4CIOA 4OHYA 4P75A 4BDPA 1F5AA 3OUYB 1VQKS 3Q8YA 4WIQA 3A3NB 1YJTA 3GYXB 1HNIA 3GLJA 3CJRA 3MEGB 4CLYA 4R8UA 3EE3A 4LBIA 4GVBB 4BWJA 4DV2F 4JOUA 3BQ2A 2J0XA 1VRQC 2W9BA 4C8KA 1F2GA 1RA7A 2MKKA 3HT0A 2CPIA 1PG5B 2PSZA 4F25A 3UCGA 2FVQA 2Y3YA 1EARA 1UEVA 4X4PA 4NMXA 3BO2A 1YX2A 1RTDB 4RUBA 4UY8T 1FXRA 4DPYA 2BX6A 4XDCA 5DGAA 2E7VA 4AQYF 2ZOFA 2H4YB 2W9CA 4DFMA 4M5MA 4A8YA 2R7WA 4PWWA 4OJHA 3UD5A 4MFBA 5LMNF 4K4TA 3K5MA 3M7VA 1RWVB 1CS4A 1HNZJ 1KRPA 3QGPA 2HHSA 3R2CJ 3DGVA 1C4AA 1CJTB 2VG7A 1LWEB 2DGSA 3E2EA 1VRUA 1Y3KA 3RU0A 1SPBP 3CWJA 3R2DJ 4F4AA 1FK9A 1GFWB 2YQ3A 3DCAA 2IBOA 3M9MB 2DR9A 3HHLC 4WE1A 4F0MA 4TVAB 4KFBB 3MFHA 4J9VA 1FEHA 2EPIA 1WKKA 3NS6A 4BC9A 4X84A 3NGDA 3BGUA 3EZUA 1ITPA 2IVMA 2RE1A 1S48A 1JLGB 2F5GA 2DRAA 3W2VB 4HYKA 3MM5B 1S1XA 4HDGA 1D1UA 4JYAJ 4IFYA 4X64F 5CYQB 4LF1A 2B4OA 2IVYA 4ITSA 2BQRA 5C42B 4NXNJ 2RMLA 1VHFA 4MK9A 2YWKA 3DDKA 4OI3A 2GGPB 1N5TA 4IFVB 2YKPA 2BV3A 3IWXA 1JQGA 4L76A 1SB6A 4FF2A 5B0DA 3GSIA 1CJVA 3DOLA 3H98A 4PRFA 1F1BB 2X1FA 1FO1A 4LF6J 3OTOJ 4QWEA 2DITA 3OT9A 3CVKA 2RILA 3PW0A 3K5LA 1NJWA 3ILLA 3KDOA 2V50A 5D15A 3MECB 5DDRC 1EQMA 3CNQP 1NK8A 2RKIB 1EETA 3P8BB 4KAIA 5KOWA 4NZ0A 1YLXA 2POKA 1I5OB 1R8BA 2JLGA 3ISNC 3HT3A 4RU9A 4EK2A 2MGZB 3NCPA 4NLDA 1WC0A 1S9GB 1WKLA 5DJBA 4Y6IA 4USVA 4NWBA 1CQNA 2DGUA 5HATA 1ULRA 4UUWA 1X31C 4BBYA 2XYGB 4IO9Q 1TUWA 1T9VA 5IM0B 3QO9B 2I5JA 2B4VA 4DV4F 3AA9A 4HH0A 2OEJA 2HHQA 4PXCA 4OJ1A 1Q8LA 3M1VA 4OMFG 4F7VA 3DLGB 2C3YA 3CB4A 2CPDA 4A4JA 9RUBA 4CO2A 4X66F 3DOKA 1TTHB 4ATNA 1OY6A 1L3TA 3J7ZT 3WX8A 3KLIA 2G2OA 2AX1A 2HVIA 3SDEA 2GJFA 3GG1A 2D3OR 1HNXF 2FJWA 1WSRA 4HACA 2EC0A 3KLEA 4P71A 2HNDB 2HQIA 2WHOA 3UO0A 4FBUA 1M5HA 4HHHA 5BXIA 5E41A 3CIMA 1N0UA 3IP0A 2UVWA 3BKUA 1GMUA 3WIVA 5HROB 2XTJP 4ZN3A 3ET6A 4KBIA 1HQ2A 3SQGB 4QBUA 3CGIA 4DU7A 4DV6J 2PDAA 3L7PA 3MAAB 4TXSA 2NQPA 3IM9A 2FJXA 2YWHA 4DU8A 2AMCB 1AROP 4MIBA 1HNZF 2EFNA 1KKHA 3D3CJ 4ZK7M 4USUA 1D3WA 2XI3A 3BSNA 1ZOTA 4MJKA 4LF7J 3B54A 3OV7A 2DNZA 1NDLA 2W2OP 2H9ZA 2CPXA 1T9TA 2XY7A 5H1SV 3D7SB 4QIEA 1J27A 4C3MA 1S6QB 3CEDA 3PIPQ 1MN9A 4ES2A 2IJFA 4UQTA 2RDJA 1UZHA 1VQMS 3KK1B 3PYFA 1EAYC 2FVRA 3W3SA 2LU2A 4RW8A 4IH6A 4M1KA 1TAUA 1R6VA 4J9MA 1UVIA 4ZPCA 3OFHA 4IRDA 2EEYA 2DTJA 3BN4A 2MZ1A 2KVQE 3AAWB 4UOGA 3EJMA 4YB1P 1SJ1A 3AHPA 1NZ8A 2MJUA 4W90B 5KFZA 4DZDA 3WX4A 3VQTA 2J9DA 4NLPA 2G9OA 2Q6CA 3K17A 1WSVA 2LECA 1VYAA 5KG5A 3GCWP 1TUGB 4CO3A 1F9FA 5C25A 1U1NA 4G1PA 2VC0A 3R3TA 3JYTB 4KYZA 3CCVS 1X7VA 5J1EB 1SKRA 3QSIA 3MR2A 2LU1A 4C3LA 2IM2A 1VR6A 4DHVA 4F04B 2HHPA 3KK3A 2E5LJ 2MLXA 3KDNA 3A3PB 4LVNP 1XK8A 1YRUA 1SJRA 4C4WA 4RBVA 4CTAA 3JTPA 2MKIA 1ZTWA 4O4GB 4GRSA 3P6YC 3MF5A 3TARA 4RL1A 2AYGA 1VIOA 1GXLA 1RE1B 4OZ0A 4UUXA 2AD9A 1HQEB 1UA0A 1XR5A 3IS9B 5GAEI 2HVZA 5F8NA 2RD5C 3LH2S 4ELUA 4X62F 3CF5Q 3US5A 2Z2MA 4K4SA 3A8JA 3H90A 1WEZA 1JWWA 1U4BA 5J1PA 1IBKF 3VAJA 4LIWA 2G0JA 3IBWA 3DM2A 4DCJB 3BDEA 3MM9A 2XI2A 4OJGA 2NSCA 2WTFA 1PYTA 4LF4J 1D8YA 1YSJA 4RUAA 4ZVSB 3G9CA 2IHR1 2V2QA 3TO8A 4NXMF 2AF6A 2HS0A 3CCTA 5L1IA 1QLNA 2KRBA 4Q45A 4FDFA 1O6XA 2IAJB 4Y2MA 1FWLA 1TL4A 3CJSA 4KT0C 1K8AT 4DEZA 3HDSA 4IUFA 1P27B 1FXDA 3H20A 4CCHA 2E66A 2AYEA 3NS5A 1KFDA 1HNWF 1TK0A 1ZPWX 2RQMA 4ZITA 5M2UA 1Q8IA 3ISZA 4OX8A 3GFZA 3KLHB 4USHA 4EU0A 3IRXB 4QQBA 1KLMA 4X2BA 5DG7A 1IKYB 3QWUA 1WHXA 2M52A 3KYLA 2Y1RI 3TA1A 1W25A 5A0YB 3MUVP 1U1MA 4GO7X 2JLEA 2M5YA 3A1YG 4J9KA 1H7XA 3IG1B 2JJ4D 2B4PA 4JI6J 4LSLA 2M4MA 1VISA 1FRMA 2RS8A 3THPA 5E3PA 4I2PA 1N6QA 5HMZA 1EP4B 1EKRA 3KK2A 3I0RB 4TN2A 1JLAA 2NLWA 4NMLA 5ETSA 4KH0B 1TKTA 1XR7A 1UVJA 5M2PA 3RBEA 1XIQA 3PRDA 2YNIA 1RYSA 3AFGA 1VHIA 2O66A 2GQCA 3NEKA 1VQ7S 1WG4A 1UVKA 2UUAJ 3PJXA 1U2RA 1OIAA 4V19X 1ZETA 2QRRA 2HNYA 2ZKTA 2DH7A 4R8UB 1DHMA 2Z56B 5DETA 4FYDA 4K8RA 2AU0A 2DNOA 2AYBA 2MSSA 3BZQA 4OLPA 3ZTRA 5H9FK 4DR2J 4K5SA 2QLJB 1TKZA 1XWLA 2MZRA 1CBKA 1KQGB 4Z7YA 1HBMA 2F4FA 1UZDA 3W63A 1YKWA 5IT9Y 1I51B 3BGLA 4E8UA 1IKVB 3CCUS 1F9EB 5KFYA 2AJ4A 1RHJB 2N4DA 5J2QB 1NH8A 5HVHA 3T19A 3GJTB 1S77D 2RQCA 4ERDA 3Q8VA 2M88A 2H54B 3DLEB 5A2QY 4C8MA 5F0WA 4CH0S 1XNQJ 2ZBCA 1VQ9S 3VGSA 2VFVA 1RTHB 3HKWA 2CXEA 1RAAB 3MPVA 3RG6A 3T3FA 4FS2A 3M8PA 1OO0B 5DM7Q 2Z2LA 1H3DA 4YY3F 3KHGA 3B4DA 5A6WA 4CQ1A 3SCLE 3J81U 2RT3A 1M1KT 4FXVA 2GFFA 2HNZA 2N4CA 3VZHA 3TJ8A 5ETPA 4YMEA 2FLNA 2BYCA 3TP2A 2HAFA 2A18A 4IOBA 2Q79A 2LQ5A 4QWAA 3FSIA 5DRKA 5LJ3Y 2APOA 2MQLA 4NLGA 1RU2A 3MCOA 4K5RA 1TK8A 4J9UE 2OAUA 2JOQA 3ZZZA 1PJ6A 4YOEA 3PKYA 2N3LA 2OPSA 1U6BA 2YKNB 3K59A 3EPGA 3KFWX 5JXSA 2UXBF 3T9ZA 1QE1B 2W4CA 2OGUA 1CJVB 3ZZTA 2CQ0A 4Q8FA 4WF9Q 2PT0A 5GADU 4LFCF 1RXOB 1YK9A 2GHVC 4O23A 2KG1A 2EXUA 2B6AA 5K8PA 2HHHJ 4E0DA 1R0CB 1Q4RA 3MM7B 4CH7A 5C7PA 1WI8A 3VGVA 1TL7B 1SL1A 1HI1A 2MKSA 3BV8A 1RT2B 4KHPJ 1TL3A 1IM6A 1U48A 5CQGA 2VJUA 3AOAA 4DWIA 1IWAA 5DDOC 1RLCL 3P4UB 4CWBA 2DNMA 2CQ1A 2OFGX 3A13A 1K1QA 3JS9A 2D3UA 4CZCA 3GCXP 5IFMA 3NG8A 1PAUB 1LFPA 3SSQA 3NWRA 1XR6A 3DHWC 1M5OC 3VAKA 3DU5A 1KC8T 4ECQA 4A8SA 2CJ9A 2QA2A 4LREA 3WC0A 2C2RA 3G6ES 4UQGA 1XMOJ 4I69A 2NXCA 2EW9A 4LRDA 1LOUA 3UDLA 3QAEA 1FJEB 3FUYA 4NLSA 2HPUA 3S1TA 3SDEB 4LF2A 5GAHU 3TZZA 4M94A 2X7IA 2LCWA 5G0RA 3JAMU 3CJ8A 4DR2F 1V6HA 1BWVA 3LANA 2QL5B 2DJWA 3CXCR 2RS2A 2ZJPQ 2M8DB 1YG0A 4O0IA 4HH1A 1EIYB 1D9DA 2GVZB 2ZHOA 4AE5A 1H6KX 1T9UA 4HT7A 1U24A 4YR3A 4JI3J 3GB0A 4ED4A 4IQXA 2CZ9A 2WVBA 1LXJA 1VRTA 3KLGB 2HLUA 2V8GA 1TKDA 1TELA 3BGFA 1T3NA 2ZH3A 1S0VA 2FZKB 1XNQF 5KG3A 1TKXA 1OSDA 1T03A 3J7AN 1Y5IB 1RADB 1ZAXA 3VZIA 3DLJA 3HFKA 4F3QA 4RJVA 3IN5A 1M1GA 4KKOA 1NB2A 2HK3A 1RTJB 3CJ3A 1GQEA 2VBZA 4A8XA 3CJ0A 1ZAVA 4W92B 2MZQA 4RWXA 2XMVA 2R42A 1HW8A 4YS2A 4QR1A 1MLAA 4ECZA 4LR9A 2WK4A 3NCRA 5L46A 4C8OA 2RAQA 1X5SA 1DQ8A 1N0VC 4B3MJ 4ID8A 4I6AA 2MTLA 5IXUA 2KFZA 3OXFA 1ZM9A 2HBYB 2H5JB 3BBCA 3DLKA 1LW0A 1HPZB 1HHSA 4K2JA 1S49A 1PKUA 4HDHA 5L39A 2NCKL 3AJDA 5A8KA 3C6TA 1MN7A 4NLOA 2C2DA 2DPJA 1J5EJ 5GVQA 1FE0A 1NUEA 1YWXA 1R43A 1DARA 4M5GA 3I32A 2LDIA 3RRHA 3I9ZA 2HKEA 2UUCF 3KG4A 3TA2A 1PC5A 2O3DA 1KVIA 2PD1A 4O3NA 3FRYA 2R7TA 4LRAA 2GHPA 4OHXA 3J80Y 4L6V3 1V3RA 3OVAA 3JTNA 1DLOB 3V81B 4IG0A 4PZVA 2DIVA 1VC0A 5LXRA 3O1LA 2DNHA 3BR8A 3UVJB 2RU3A 2AGOA 3R5GA 4YUDA 4NE9C 4Z2XA 3RRGA 4M63A 4DI6A 2QYCA 5KFPA 4ZS6A 1RWNB 1VQ8S 2BQ3A 1RT7B 1UVNA 2F63A 1WDTA 3ZZYA 3QLHA 3R9LA 1WF0A 4EBCA 4RLEA 4KE5A 2B0GA 4NCAA 5KFSA 4WTOB 3W66A 4DL0C 2IRXA 4ETXA 4WP9A 4LF8J 2XMJA 2IRUA 2HZVA 4L73A 2ATCB 3FJ2A 4J9QA 1QTMA 1PYOB 1U6ZA 4QOTA 2VPXB 4DR1J 4ECUA 1R3NA 5ETLA 2ZH9A 5B0FA 1Q16B 4WP8A 1REVB 3VTIA 2GVDA 2H4WB 4FBTA 2VDHA 1RP5A 3W62A 3LF0A 2HS4A 1RAIB 3IAS9 2CDRB 2CJYB 1NKBA 1WC6A 2ZM6F 2PMWA 4DV5F 4AL5A 4E2FB 4EGLA 1ZA1B 2EK6A 2Z2YB 4X65F 3DLBA 2FJAB 5HVGA 1O5JA 3CMAS 4O0NA 4WJBA 2MZSA 4IRCA 1RT3B 3AB2B 3TAMB 3SV4A 4QWBA 1AZSB 1F5CA 2Y1IA 1R31A 3DLLQ 1FFSB 4DX8H 3FSYA 4BWMA 1SJ3P 4JI3F 1FJGF 1YDLA 3B4MA 3ILOA 5J2PB 2DR6A 5IT4A 2VDIA 4PG5A 2VG6A 5CABA 4GKJJ 3HVTA 2E5HA 2GMJA 2WCXA 1YBAA 2MEWA 2XNRA 3IO1A 1N52B 2KH9A 3SV3A 2M9KA 4JI1F 1B0VA 3ZZ0A 2XSFA 1Q81T 1NXIA 4DV1F 2E9ZA 4JV1A 2IC3B 1IBMJ 1U8SA 2W01A 2DNYA 1IWGA 2V69A 5GMKa 2FTRA 3PO5A 3CSKA 4OZ2A 4NASA 1IKWB 3E01B 4B3MF 1U0HA 2RDIA 3D1QA 2HQGA 4F4ZA 2RF2B 6FDRA 3OPKA 3KJNB 4YFUA 3FEYB 3KK2B 2BABA 4ETZA 4H4OA 4LJMA 1XJWB 2VD3A 3MM8B 4LQ9A 2FHMA 1FVQA 2P6SA 5L1KA 1ACMB 2AW0A 2A6OA 3Q2SC 2CVIA 3D9BA 3CJQA 1VJQA 4OZ3A 3GIMA 3MMAA 2DT9A 1AUDA 3EGVA 2HGLA 2LXFA 4ES3A 3DRPA 3QRQA 4ZVOB 5K14B 2HNYB 2VG5A 3KLVA 5HP1A 2E44A 3W65A 4K7QA 4DZ6A 5SZTA 3RR8A 1H98A 2PEHA 2ZWOA 3BS9A 1RWMB 2BJ1A 1RK8A 1HBMB 4LFAJ 1SIWB 4DL4A 3KHRA 4C11A 2DR8A 1S1UB 2U1AA 2Y1JA 3MEDA 1ZA2B 3VAFA 3ONQA 1DTQA 4DS4A 3HULA 2FIUA 4ZOSA 3MPWA 3TWZA 2IIHA 1JLEA 1H2VZ 1Q5YA 3CJ5A 2N82B 1VQ5S 1FXLA 1TR0A 2QTWA 3CC7S 5KG7A 5AE3A 4MKVA 4ECYA 5BR8J 5F8IA 4ZCLA 3TANA 5IZHA 3IGNA 2KM8C 4DR1F 3HHKA 3M30B 1Z2LA 3OLAA 3K2YA 4K4UA 2B3TB 4P2SA 4FS1A 4H4MA 2J8AA 4RW7B 1REGX 2XLJA 3IFEA 2ZVSA 3HKZD 2CNNB 2CQ3A 1T95A 1RHRB 4WFZA 2VPZB 1O51A 5L9NA 2DR7A 3HFZB 2HFVA 5FLXY 4P74A 2UU9J 2RRNA 4JI4J 3DRSB 3OL6A 3WHIA 3GFHA 2XMAA 2CYYA 5IC6B 1CJKA 1UWBB 1V3SA 4C0HA 3KLFA 2IM3A 3SZ2A 3ITHB 3BF4A 1K9MT 4M8LA 3TOQA 2DEIA 5LM7E 3BO4A 2HFUA 3LOUA 5I3PA 3Q89A 1C4CA 3H8YA 2KJVA 3OXLA 3H42A 3CD6S 4MIAA 2X51A 1LEOA 3MXHP 1LQ9A 3MR3A 2H5EA 2CWXA 2ZBRA 2QA4S 4G1QA 1GTEA 3W5YA 3D28A 2BW2A 4DR7F 3RB4A 4CI0B 4J9SA 2PIIA 3PZPA 1IBMF 1MU2B 3C16B 1GH8A 1C1CA 2VKZG 4ED8A 4PEOA 2D9OA 1HBUB 1U2CA 4B02A 1YQHA 4F2SA 2BE2A 2QZ8A 4CYUA 1N34J 1N32J 4YN3B 1LW2B 1NH7A 3POTB 1Z4UA 4DV7F 3HCXA 3ZTQA 5HAOA 3JSRA 4ZLLA 4DL3A 4QIFA 3PO4A 3G6VA 5K8NA 5KFHA 4NCGA 2KYXA 3F73A 4W98A 1NCLA 5T7LB 3H4DA 2ZHBA 4FPRA 4WFBQ 1U2FA 1OQ3A 1KQKA 4WXOA 2EFVA 2BMBA 2E1PA 3BSAA 5JVHQ 1L5UA 3PTWA 4NPOA 4TLQA 5DZ7A 5D0GA 2EBEA 3CCSS 3R7SB 2E1CA 1Y00A 4IO1A 5KFNA 3QZ7A 1T05B 4A8WA 3HD2A 3OTDA 5LL6d 5KT3A 4NLRA 1UEKA 2XYHB 1RT4A 1PJ5A 4NLUA 4A48A 1KLNA 2ZUGA 4AFFA 6FD1A 2K1RB 4DR5J 3DOMB 4TY8A 3F44A 1P8GA 4YDDB 3MEEB 1FD2A 3ZTPA 1GT8A 3NGRA 2HRYA 1IKXB 4AL6A 2R8GA 1J5OA 2JEJA 4WYLA 1Q7LB 1T03B 3Q8QB 5F9NA 4OX6A 5IWAF 1U1LA 2DYAA 1QSYA 3LAMA 5F8GA 4ZIVA 2IY5B 3NGUA 2ASJA 3SFUA 2MY7A 4IQMA 5ETRA 5KG2A 3JTOA 1QUPA 3O44A 2ZNYA 1T9YA 3I9V9 4A8OA 1UL3A 3OL7A 4X4VA 3TR5A 4OYXA 4RW6A 5GAGU 3CCMS 1UVLA 2D41A 4QWDA 2I6WA 1VBKA 4C97A 5DM6Q 2UU9F 5D78A 1F6TA 3DI6B 4CT8A 1XTZA 2L48A 4ANEA 2ZH1A 2GMLA 2DHGA 2KT2A 3A4TA 1RBAA 3M2VB 1C1BB 1QTNB 1KR4A 4IDKA 1SUQB 1YJ9S 1SKSA 1TVRA 4KJIA 2DXFA 4AUKA 4J9NA 3GIKA 4USIA 3UCZP 1C0TB 4FNHA 3VWSA 2W7OA 1N5YB 3UQSA 3T1HJ 4LRCA 3TUIC 1XMQJ 2CNOB 3CC2S 3M4XA 1GEHA 3LW5C 4DQRA 2BANB 4IG0B 1FNMA 1RHKB 2IPOB 2MB0B 1A7GE 3UW1A 2MYFA 2KVIA 1LWCA 3N79A 2H1YA 1S12A 2HVDA 4C2MA 3MMCA 1S57A 4ED7A 4QCLA 3N9UC 4PPDA 4JV5J 1O8BA 2FHOB 3P45B 2M7SA 2F8HA 1NSQA 4KPYA 2MKYA 5LMUF 1RKJA 5F3TA 4KY3A 3PX0A 1Y9OA 4NEYA 2V8DA 2C3MA 2CKWA 2NR0A 2E1RA 2FVPA 2J9EA 2WVFA 3PM9A 4WFYA 4JBCA 2KXNB 3T5JA 2IA0A 3GPAA 5LXYA 2YBVA 5HBMA 3GU0A 2GVDB 3V6HA 4DXLA 2CPHA 5BYSA 1WTBA 2ZE2B 1KN6A 2HZAA 3TEGA 4RNFA 2N7CA 1VIXA 2B9EA 1HBNB 4UZBA 3NNCA 4FF4A 1YVFA 1DTTA 4OYBA 1UP1A 1WOOA 1RWXB 2CQCA 2R7XA 3DGPA 2RRBA 1NDKA 2Q3PA 1QM9A 1RHMB 3KG1A 4CLUA 2RDDA 1RWUA 2ASDA 1RACB 2ILYA 4DR5F 3H59A 3V6KA 3RRKA 4DBQA 4I7FB 1QSSA 1R7IA 2L3MA 1N48A 1FRXA 4R25A 2B7CB 2RQKA 1KTQA 3PG9A 1HWUA 2JNJA 3DYAA 5KFTA 4EI2A 2ADBA 4PXDA 2XO7A 3EWGA 4QZVB 4Y34A 4WFAQ 2V8VA 1NMEB 4MYTA 2JVOA 1S1TB 3B82A 3U1LA 5E3CA 7FD1A 2F4VF 4K4YA 2KB2A 4KR0B 4ZCKA 1SQFA 2LP4A 1SI9A 4DR6J 2YKQA 4DCOB 2KTQA 2MKCA 1URRA 8ATCB 1IXKA 1GK8A 4M5DB 2L41A 1Q5VA 3OTEA 4I56A 2NYIA 2PFFB 1BQNA 4DR3J 1SXLA 3TJ9A 4KGKA 5C24A 2XMMA 1SJFA 4PPZA 1LK5A 1IJFB 2AJQA 3LP0B 1WJ9A 1X60A 3L95X 4IG3A 1ZTTA 2GO9A 4N77A 2A0FB 1FRHA 4UOCA 1HI8A 1EZZB 1FJCA 4DQQA 1RTIA 2XNQA 4K2XA 4L74A 1XMQF 4D3GA 3PW2A 2DISA 3W8GA 1WHYA 3FVYA 3FSXA 4KGXB 3JSMA 5KFFA 5I3UA 5CHCB 1J2VA 2EG1A 4XO0A 2ZNZA 5ETNA 4DSKA 1YJUA 1X0FA 3TI0A 1XN9A 1IR1A 3K5OA 1FKPB 2IBKA 3C2PA 3FFIB 2V9KA 3CE8A 2B43A 1WUUA 3X1LB 5F9LA 4M5LA 1F3FA 4ED5A 2YWEA 2N3OA 1FKOA 5LOQA 2HRUA 3OQ2A 4UTGA 1KVJA 2M8HA 4MKBA 1FRJA 1PBUA 5KG6A 2YNGA 1NHKL 2QG9B 3QBCA 1CQMA 4O3SA 4JI5J 2QLWA 3KJFB 1LK7A 2ACYA 2K7JA 2L9NA 2W4DA 4DN9A 4I2QA 3Q8RB 1JLFA 2RUGA 1YHQS 1HBOA 3CPWR 1DURA 1URNA 1JXEA 1NJIT 2CJKA 1EJ7L 4M5NA 2FLOA 3G87A 1CC7A 1APSA 2W7PA 1TZ0A 1BGXT 2X1BA 5EUHA 2R7SA 5IT0A 2DNKA 5B0AA 2V67A 4ILRA 1Q8BA 5H9EK 5HQLA 3HD1A 3M2RA 2PA3A 3OFGA 2WZ1A 2VHGA 3LP2A 3CULA 1N5SA 4ZJOA 3OL8A 3C6UA 3MOZA 3ENWA 3I87A 1CJKB 4RUCA 4GKKJ 4JI0J 3KLFB 2R7RA 3C15B 4DSEA 1IJEB 2EC2A 2PGCA 2DPIA 2CG8A 2R2SA 2MQ8A 2DGXA 4B3RJ 2XMWA 2XHWA 1KFSA 4JUZA 5F0UA 2YNFA 4MIWA 4NCBA 1QAXA 5DQIA 2V68A 4KQZA 1WG1A 3L7UA 5DO2A 3SBMA 1WELA 4CRJA 2WVDA 4O3QA 1B3TA 2C3PA 3GV7B 4L3NA 1CC8A 1MROB 1CJUB 2A2CA 3RR7A 5J2NB 1JB0C 2MSTA 1RSCA 2AGPA 5C5JA 1GX5A 3FMWA 4N8OA 3GSDA 2VC1A 3M8QA 2MQPA 5D77A 2UVVA 2O1PA 2DHHA 2JZ5A 4QIVA 4DV2J 3DC2A 4XIUA 4L72B 1U1PA 5KFUA 4DFJA 5KFIA 4NA3A 3BKFA 2QYGA 1NKEA 1R0AA 4QW9A 2CNKB 2ZBPA 3GTYX 2V6AA 2XSJA 4DN0A 1S0OA 1B0TA 2OPQA 3W2WB 3SMZA 2B9WA 3MEKA 4KV8B 4PXBA 4U8YA 2HQDA 3KKFA 2GAHC 5HQMA 1B7YB 2B8PA 4YP3A 1S9EB 5AXMA 4FXWA 2WW8A 3M32A 3NS7B 5CH7B 2AGQA 1FJ7A 1FRIA 3ZTOA 3PRVA 1SC6A 2YWGA 4P72A 3ULHA 5LMNJ 5E5NA 4RX6A 3IAM9 4IR9A 1Y4ZB 3EX7B 5B0CA 1OPIA 3V4IB 2M2BA 1RBOB 3A3OB 4PABA 2XO6A 3H5YA 1ZS6A 2ZZNA 2HMIB 3KTQA 3H5UA 4NX9A 2ZJQQ 4NI2B 4J91A 2M70A 1HFEL 5CZVA 4ED0A 5BJRA 4E98A 3BGRB 2KRRA 1D9AA 2WONA 1VBZA 4CNYA 3PHEA 3RW6A 4B9UA 2W7AA 1YGYA 3W61A 1DAXA 4RNHA 5KFWA 1JLCA 1FDAA 1WACA 5KFGA 3V5RA 3CJTA 1PYSB 4WP3A 4UOFA 2F3JA 3A8KA 3JSYA 3MM6B 4X64J 2YWFA 5T41A 4KO0A 5KFDA 2ZC3A 4ZLPA 4BHQA 2F65A 3UI3A 2C2EA 5A8RB 2DKOB 1WC4A 4TLRA 2JLFA 2KFNA 4ZVPB 2CG4A 3QMQA 3VAMA 1SIZA 3PYGA 4LBPA 3W5ZA 4Z7CA 1GTHA 3TVYA 2BJ8A 4O3PA 5DDQC 2P5VA 2PE8A 4LSNA 5KFXA 1AFJA 4P7VA 4O44A 4FZVA 4YEAA 4TU8A 5HVFA 4RBUA 1Z2ZA 3GV8B 2QFIA 1YJ7A 3VGTA 2HQFA 5CYMA 2IJNA 3HHLB 4B3RF 4USJC 2Y8WA 2FVCA 3PHTA 1E6YA 3BKTA 5MLCV 2ZC4A 1UTAA 4YR2A 3UR0A 1SL0A 2AEFA 1KDNA 4NLYA 4DR4F 2CPJA 5CZXA 3F56A 4S0MA 2CJXB 4DV4J 3FMBA 3VR1A 1MWQA 2LEPA 4YQWA 2FHJA 1U1KA 2VV5A 4DPXA 2OHDA 2O5DA 1WC5A 2C2MB 3T9NA 5FDLA 2HFSA 4USMA 5DQGA 5BYQA 2MDAA 2CVEA 4IH5A 1HWLA 2BE9B 3NBPB 2LXUA 2QLBB 4X66J 3PW4A 4F67A 2XZWA 4Y2AA 3U1MA 2QIFA 2DBBA 2JFDA 2I9SA 3W9HA 2J0SD 1RLDA 1R8AA 1HNXJ 3CCJS 4USTA 2DY1A 4RW9B 1ZM2A 4YB5A 2B51A 3EPIA 5D3GA 3VAIA 3KJVB 4B17A 2AYMA 3EXCX 3J81j 5F41A 1FEEA 5HLFA 3EVWA 5HJXA 5IQQA 3T1AA 4UF4A 1BXNA 1N54B 4D3HA 4Q0BB 4ZHRA 2JEIA 3HVWA 3AODA 1V3ZA 5K8OA 3GIIA 4B9MA 1DTTB 3Q22A 3DGPB 1U1OA 3HJVA 2GJIA 4PUOB 2ACMA 2OPRB 3TUZC 3MHYA 5FD1A 3OXGA 2H3EB 3ETOA 2N7YA 1PCAA 3LO3A 4ED1A 1IVZA 2R3VA 1HNVB 2M0GB 4RUHA 3U02A 2QA1A 2VQEF 2DY9A 1HLWA 2CQDA 1CULB 2HEKA 4R0JA 3FBEA 2XY5A 2CA9A 5CD4A 2FPHX 2YX1A 5A76A 5AJ3F 3R5AA 2OIHA 1MW7A 5ETMA 1KSPA 1TL1B 1S7IA 3K5PA 2HQCA 2KN4A 3DRXA 2MZJA 1HHQA 4LSZB 1YIJS 4B3OB 3JQJA 3LWLA 3BYPA 1S6OA 1E6VA 4EO8A 4TNOA 5HANA 2MPUA 2KDOA 5LSLA 2XGQA 3Q24A 2HFNA 1RT5A 2AX0A 5LJ5Y 3RB6A 1FRLA 3L4BC 2MHEA 3GQCA 2OMLA 3DKDA 3ICLA 1JJCB 1SV5B 2AJFE 3MGJA 2PFDA 4GVLA 3A12A 2ZH5A 1HARA 4OHVA 2ZD1B 4YR0A 1S6PA 1X8DA 4CNZA 4FXDA 1EB0A 2HIYA 3MR6A 1S10A 3TZWA 1HWJA 4DF4A 3UDEA 1Y0HA 3CJKA 3D6FB 1T11A 1HMVA 3J81Y 4IYQA 4V1Ak 2E9RX 1NB7A 4J37A 3DLHA 4OX9F 1AW0A 2CQPA 1TFYA 1LWFB 3DMJA 1SJQA 3G2XA 1TFWA 3SSRA 1X4CA 4FN5A 3THVA 1X4HA 2ALYB 4B9TA 2QJ3A 3LQVA 1IBCB 1S1WA 1UVMA 2AEMA 2YNHA 1HA1A 3TNVA 1BQXA 1BQMB 4MAKA 5I3UB 2CNLB 2XB2D 2HBZB 2AZ1A 2G0CA 3JB9k 3R1LA 4OYOA 3BB5A 3K57A 5KFVA 1RDRA 3T5HA 4QPXA 2UXDF 2CDQA 5A8WA 1JKHA 3FC9A 4P2MA 5GADI 1S1VA 2G1DA 2BJEA 1JJ4A 4NYOA 4X62J 2HGNA 1JLQA 2BM1A 2BJ9A 3OVSA 2PI5A 4PQUB 1IBKJ 4CM2A 4DV0F 1H7WA 4I1TA 3H5XA 2KFYA 2GO8A 2ZH6A 2UUBF 4OL8A 2DD8S 3HHLD 2R7VA 2VBWA 1OPZA 3MTJA 4I2QB 2YPYA 3K8VA 2HSEB 4NXMJ 1A9NB 1TUVA 4ELTA 5KAKA 4N47A 2FB0A 2R7UA 4OV6A 2LYVA 3OUYA 1RWWB 3I5AA 2IFXA 4DUYJ 5EWFA 3M05A 1H74A 1U26A 4PG8A 1C0UA 4DJBA 5CAAA 1IUJA 4GVBA 4LRFA 4O3RA 1HNWJ 4O4RA 2GQQA 2CZ4A 2V94A 1HKAA 2K8GA 3M2RB 2ZH2A 2OSRA 3HSGA 1RT6B 1VS3A 2E9TA 3SYZA 2UV8A 4NLXA 4XK8C 2QMUB 5E33A 1CG2A 3UCUP 1FI4A 2AP6A 2WVEA 2ZJRQ 1VI7A 5ETTA 3J7YI 4K4VA 2R8JA 3MAHA 3P5BP 2DNPA 3OHBA 2OELA 1NZAA 2VZ9A 3R5DA 4HVZA 5AT1B 2QGFB 3ZXWA 3JAMY 3VCDA 4QWCA 3WZ0A 1UJ6A 1S5ZA 4GMKA 2V8HA 4WKRA 3M2UB 2IRYA 4DPTA 2HHWA 4B3TF 2KXFA 2LQ8A 1GMWD 1I94J 1LWEA 5L9XA 4LVOP 4L3KA 2JH3A 1U1QA 2WB4A 2YKMB 2GCFA 2G4BA 2BOAA 1NU4A 2BOPA 3VF0B 8AT1B 2LQJA 2MY8A 1QVGR 1BE4A 3HSDA 3N0VA 3K8WA 3BH6B 3QIPA 3J7A1 1X9WA 1RAFB 4KFBA 1QD1A 2CJBA 1D09B 4RU2A 2XEXA 4DF8A 1VFJA 3MPDA 3FBFA 2DNNA 3RW7A 1ZAWA 1G2EA 1JLGA 2XSJB 3W2VA 1OJ4A 1XC9A 3RGIA 2K3KA 1RHQB 3N6NA 4ZPWR 2F9JA 1SQEA 3LP1B 5CXTA 5C42A 5DLGA 1WHVA 3HF5A 2FC9A 2W2MP 3P49B 4IRKA 2AWZA 2GGPA 4IFVA 3M32B 2KKHA 2BZ2A 2ZZMA 4FYVB 3EM1A 2GMHA 4WPAA 2AIRB 3QWPA 1T3OA 1ICEB 4DOZA 3L7OA 2MHNA 3R7NB 2XG8A 3CCQS 2FUG9 2H51B 4LF9F 4ER8A 3C8YA 4URSA 2NZCA 2GIFA 2G2YA 5IV4A 2CFXA 2RKIA 4YY3J 4JI8J 3CDWA 4WYWA 3ZO7A 1IN0A 2DGWA 4DPUA 2HFOA 2V4JB 4ZPDA 3AD9C 2H48B 4LR7A 5K20B 4NA2A 3GJRB 1S9GA 2VFRA 4WU3A 1JLBA 2OEMA 4ZJLA 1HQUB 2QA4G 3Q23A 2B5JA 3Q0AA 3AXKA 1RU1A 3K7RA 4IH7A 3MOJB 1UW4A 4X4UA 4ECVA 1VBYA 3UR3C 2FQQB 3RJMB 5IM0A 3QO9A 4A47A 4H4KA 2Z0GA 3MMJA 1PIEA 3K0JA 2V8PA 1Y7PA 4ZLNA 3TZYA 3DLGA 4HLBA 4ID5A 4WFXA 4DUYF 2P9GA 3HVAA 1MSWD 5B08A 3M8RA 5J2MB 3TJAA 3Q8PB 1Q95G 2QC3A 1SVDA 3UFCX 4MK7A 2UXBJ 2F9DA 3MAQA 4LMZA 2DNRA 2J8SA 2VH7A 1PILA 2LA4A 5H9FJ 1QUVA 5FIIA 4CM0A 2A10A 3EGNA 2ROEA 3T6JA 2J7WA 3BGOP 4LFCJ 1F2HA 3HSJA 4LQ3A 2CPZA 4NLQA 2P6TA 3NL0A 3I0SB 4PAAA 2HNDA 1Y10A 1KONA 1KQSR 2SXLA 2JFKA 4B3SF 4O44B 5ETOA 5EWGA 4F4XA 3BQ1A 1FWKA 5CYJA 5HROA 5DZ6A 3P3DA 4DQIA 3LA0A 5GMEA 2BM0A 3ENQA 3I56S 1E6YB 1D8ZA 4QW8A 3V2UC 3PKMA 3WBZA 2UVRA 3MAAA 2JEGA 3ZZOA 4NRUA 1FF2A 1HWIA 2NUUG 1UPPA 2FYXA 4A46A 1XNRF 4FPIA 2QL7B 4MYUA 1I94F 1XMBA 2H5IB 1IBLF 2E1MC 5DS7A 2FJVA 5ETVA 1HNIB 1OY8A 3O5TB 3O2IA 3CCWA 1Y5NB 1R8HA 3CDUA 1S6QA 5F3ZA 4OYPA 3PV8A 3RBZA 3RAMA 3HI9A 2LKZA 3VGUA 3EZ5A 4DV3J 2AEJA 3FQLA 3RBXA 1VK8A 4NYPA 2W9BB 3SCIE 1UFWA 4WIIA 3TVZA 4M5KA 2FHKA 3KNAA 4OYAA 4HHUA 2E29A 3NOCA 4ZP9A 3HHNB 2XBPA 1M5VC 4J9PA 5HLFB 4LF5F 3GMGA 4KC5A 1DFDA 4C48A 4ZJQA 1DZ5A 3D3BJ 4UT4A 4RPFA 1S4EA 4CO5A 4HKQA 4KHRA 2W9CB 1KQFB 1VOMA 1W2IA 2WSFC 4RBTA 2YQ0A 4DX7A 4MFBB 3JYTA 5KFMA 3EVMA 1KBRA 3D2WA 4V19J 2CQIA 2WW4A 2BJ7A 5J1EA 3KG0A 1T9XA 1CS4B 4X4RA 2VG7B 1TQLA 3HZEA 4JI8F 1VRUB 2OUGA 2ROGA 4RR5A 4EYIB 1K1SA 1YBUA 1SC4B 3S6EA 1FK9B 1QSLA 3MUTP 3GFXA 5J1NA 3AXMA 3NRBA 4WE1B 1FKAF 1H2TZ 3WDOA 4O4GA 2ASYA 4ZVEA 1BWEA 2ZHAA 2UP1A 4Q2MA 3FZBA 2JL9A 4JI7J 5E0OA 4PQAA 2DHXA 1HQEA 3UN3A 2B56A 3IS9A 1S1XB 2NZ4A 3NMRA 4F26A 2CQ4A 1NJZA 4IFYB 4EUVA 3V4MA 3EYZA 2OP5A 1PO6A 2CPYA 2FZGB 4WZQA 2UUCJ 1FERA 3SCKE 1JIHA 2NXEA 2EFOA 3DOLB 3VALA 3U7JA 3R5BA 2BJDA 1WKJA 3GYGA 2FDNA 3GR0A 4J9OA 4PR6A 1EETB 1SCJB 2B8QA 3KHHA 3LPEA 2IAJA 4AYBD 1HD1A 1YZ6A 2J76E 3DMJB 1WNEA 2DK2A 3KUHA 1UJ5A 3CCES 4WBFA 1MG7A 3PCOB 5CD4H 3PIOQ 3CMES 3KLHA 1DQAA 1KS2A 2I1RA 2HFZA 1Q78A 1RWOB 3CMQA 3ENAA 3IRXA 4X4NA 3FKBA 2I5JB 1IKYA 3LALA 3I96A 3QFWA 2XY6A 3QZ8A 4XTTA 3HHDA 5A0YA 3M1VB 3IG1A 4Q5VA 3V6DA 1TMMA 1RCOB 1YTYA 2ZM6J 3DXSX 4DV5J 3N01A 2QX0A 4DL6A 1VQOS 1FHTA 2ATLA 3DOKB 3SSSA 3KLIB 4DV3F 4DSLA 2XYPB 2GAGC 4X65J 3G6YA 3EMTA 4ZN1A 1RWPB 3M9NB 4HACB 3D66A 3FDSA 3KLEB 2ROPA 1JJHA 2UVUA 4F4WA 1HR0J 4C9DA 2X3DA 3THTA 2OKQA 2FLPA 1YJNS 3WIUA 1QY7A 4DX5A 4GO5X 4DSJA 2FHJD 1FJGJ 1L3SA 1C0UB 3GJQB 2G1HA 1SC1B 4ZVQB 1T94A 3ET6B 3UD4P 2IM1A 3DFEA 1ROFA 1OS5A 3NGKA 1JNRB 5HMYA 3GZ7A 2RJZA 3DRYA 3ELHA 4CLSA 5HK4A 3GG0A 3EDRB 4EMDA 2YH0A 4JI1J 5MAOA 1UETA 4F2RA 3W60A 4M5JA 1FESA 2BQUA 1FFGB 1IKVA 4DV1J 3PW7A 4QYZK 5J2QA 1P9QC 3KHLA 3UPFA 5B0BA 3DLEA 1I3OB 5GMDA 3PR4A 2LEAA 1HYSA 3HPOA 1RTHA 4RW8B 1Q1KA 4NZ6A 4B9LA 4JI7F 3ETMA 2KXHA 1U0SA 4ZVTB 3G82A 4QIWD 4FF3A 3OVBA 1NHVA 1SH2A 3GIJA 4C7QA 5RUBA 3G8QA 4B9SA 3HM9A 2XGPA 5F8LA 2C2ZB 4DPOA 1FNOA 3QIPB 4BCAA 1NRKA 5LSOA 1FNXH 3PFOA 3DNCA 2KI2A 3NAHA 3D1HA 5C25B 1H72C 1KWMA 5GAGI 3IR7B 3HX9A 2WAQD 1VQ6S 4TYAA 3SI8A 2OD4A 1JMTA 4NOHA 5FJ4A 2G13A 1OSCA 4OI1A 4CO4A 2J0QD 4ZVHA 3DN9A 1NK0A 3KK3B 3H40A 2YKNA 4NEZA 2GW8A 2GZOA 4ELVA 1X4FA 1NSAA 2D7SA 1YITS 1QE1A 2RH3A 3UN2A 1CSJA 4WXWA 4CTAB 5KFAA 3BJYA 2YH1A 3AB4B 3R5CA 2DCLA 3NOGA 4A8FA 3OBIA 1XEZA 2YPZA 3MCNA 1O0PA 1GX6A 4DQPA 1Q7YT 3KMQA 3MM7A 2W25A 5LSRA 4MT1A 1BHNA 1TL7A 2FGCA 2YWWA 4G3IA 1Q0NA 1RT2A 4I68A 3W64A 1UMJA 4X4OA 1B70B 2BKOA 4AXJA 4YHHF 1JLBB 2QN6B 3ZTSA 4DFPA 3F41A 3DM2B 2B5JB 3NKYA 3CCRS 3MM9B 2QMXA 5C2CA 2MLYA 3QT8A 3P5TL 4K4XA 2EKYA 3GIRA 2D1CA 1PJ7A 4Y2KA 2OJ3A 3BEGB 2CZVC 4Y2CA 3UE2A 3PJ9A 3ZZRA 3SEOA 2A2DA 1HR0F 1HWKA 2ALZA 2AJ1A 4ID5B 2E5GA 5DDPC 2E7WA 3K5NA 3AQPA 3D67A 1A6LA 1VLYA 4C6AA 4TYBA 4QU7A 2HK2A 4CO0A 1TV6A 1D0EA 3PDNA 2KM8B 2PA8D 5ETKA 2R2TA 1M1HA 1KLMB 4DX6A 4DR7J 3GJSB 2A3JA 1S79A 2WSEC 3I6PA 1ZPVA 2FJBB 1X4EA 2GVZA 2VASA 2DHAA 2O67A 1S6UA 3D68A 3W5XA 2CQBA 3WC2A 4P2FA 3KLGA 2W4PA 3OFFA 4LSLB 3QYYA 3R8YA 1YI2S 1PSDA 2CQ2A 3PVXA 1WORA 4JV0A 4XPEA 3HJFA 4I2PB 4P10A 1N6QB 1JLAB 4L75A 2XLIA 4DV7J 3T5LA 3I5BA 2LA6A 3W8PA 3NCQA 1RTJA 1TKTB 4JV2A 1TAQA 2YNIB 1B99A 2Z30B 2MKHA 2K3IA 1X5OA 3IR5B 4R0EA 2VJVA 1A0OB 3TX8A 2KZZA 2CQHA 2DVIA 2RB7A 1SQGA 5E3AA 5HI7A 5L8RC 3PX4A 1I1GA 1X4GA 2J6SA 1HPZA 2Y1LB 1FE4A 2F8MA 2HIQA 2M3DA 2VOPA 1AXQA 5ADZA 2F7VA 4PG7A 1TKZB 1NDCA 4KB7A 1SL2A 2IMOA 4H4KC 2V34A 2R7QA 3BM7A 4UOHA 2XS5A 4JYAF 2NPIA 3TQ1A 4RW4A 2BW7A 4NXNF 4I0WA 2XWXA 1VLOA 4F36A 4U8VA 2B7BB 5CCMA 2V4RA 3MTKA 3BBBA 1LNQA 4QIGA 4FVMA 1VCTA 1VDHA 1RQ0A 3FNNA 1JNZB 2A6MA 4LF6F 3OTOF 3HMJG 1DLOA 5IWAJ 3V81A 2YXLA 4U7UD 2EKNA 3UVJA 3M8PB 1RGVA 4FVCA 5HJYA 2NREA 4ILLA 3E8OA 1LXNA 1RT7A 2ZOGA 4OFZA 1WF1A 2HNZB 3V6JA 5L1JA 2RHSB 4PYAA 4ZVRB 1HHTP 1VK3A 4Y28C 1RCXB 4OLOA 1HI0P 4ZMMA 4IKAA 3KXDA 2LXIA 2VPYB 2D3O1 2AT1B 2HWTA 1M90T 1U45A 2A1BA 2VFSA 1NPPA 2BRLA 2DRDA 1REVA 2DH8A 3UNGC 4C0OC 3GV5B 2F8EX 4USKA 2DB1A 2OPSB 5E7OB 4QJVA 2MMYA 2C28A 4KIAA 3NNHA 3TEHB 3BSCA 3PY8A 3CD0A 3DDIA 3VAHA 2YVSA 1KVKA 3MR5A 3IBCB 3GE9A 3CD7A 4B9VA 2VBYA 1AUSL 2PO4A 2ZH8A 2RSQA 1RAGB 4OI2A 5KFCA 1RT3A 1IR2A 3TAMA 2BE7D 2Q43A 2B6AB 2R7OA 1AZSA 3B8HA 2OO4A 5M2RA 1G7CB 3L09A 2RRAA 5E2QA 1SKUB 3NNAA 4PYDA 2QV6A 5J2PA 1TL3B 2Z2ZA 5KFLA 5LMUJ 5K5MA 1TL5A 4U95A 2J6TA 5AXLA 2EWHA 1ZBTA 3OTCA 4OI0A 2GS8A 3O6QA 4DV6F 1HW9A 5KFOA 5IV3A 1RUSA 4OI4A 2VA3A 2XLKA 5IS2A 2XS7A 3AY0A 4U96A 3N5FA 5D4OA 3M9OB 2ILZA 1Y3JA 1CVJA 1JX4A 2IC3A 4LF7F 4H54A 3UNYA 2KT3A 5F8JA 3N4WA 2GX8A 3V6DB 2ZVIA 4FKYA 3W7BA 1IKWA 4ED2A 3E01A 1ZZNA 3CT9A 2RF2A 3AA8A 2QMWA 1NLKL 4FYXB 4C3KA 2BKPA 4IOAQ 1U47A 3Q2TC 3MM8A 2IVFB 5G0RB 2XMKA 1YRXA 1VC6A 3EVOA 2LQBA 1S72S 3BN7A 2GJ2A 2QO3A 4P9SA 2V9WA 1KP6A 3G86A 4WWSA 3PJWA 4ENOA 1BLUA 2Y0SD 5K14A 4CH1A 3QT6A 4M95A 1ZYQA 1YBTA 1VRTB 4FF1A 3I4PA 2ZZTA 1KTVA 1TKXB 3QQCD 1IQZA 2HG4A 3AT1B 3ILIA 4XDDA 2JWNA 4KKOB 2DEJA 3R27A 3BYRA 3R6GB 1S1UA 4DSFA 3HVRA 1UKUA 3MDFA 2VF3A 4B08A 2F4VJ 1RKIA 3DXBA 1L3UA 2QT7A 1FVSA 3EGWB 1RBLA 1N5VA 2E5LF 2PMHA 4F8RA 3R97A 5JJBA 1HD0A 4YDXA 1F0XA 1Q82T 1FA0A 3MCSA 1HYSB 3NMAA 1KHVA 2OI2A 3PX6A 3DLKB 3MI7X 1LW0B 2AHOB 2WSCC 4CLTA 2I0XA 5AXKA 2QFJA 3M30A 3O8WA 3IBFB 3M8SA 3EGZA 1K0TA 3G82B 4BC7A 5A8KB 3C6TB 4DUTA 3HZGA 3MWBA 1P9YA 2D9PA 1YJWS 2HZCA 4RW7A 3PACA 2BDPA 4UZCA 2CUYA 2GV1A 4OZNA 3TQEA 2MQMA 1GNKA 1FX4A 3IR6B 5EHHA 4AD6A 2QEXS 3AOCA 1WWHA 3PEHA 1K73T 1FFWB 3GWCA 1YRTA 3DRSA 4LF4F 3ZNUA 3AH6A 4OV1A 2E1AA 1U25A 4AL7A 2XC9A 3I5CA 4KSEB 3D6HB 3PW5A 1I6JA 2ZITA 1OYDA 1UWBA 3H2LA 2OPPA 1CEZA 5KFQA 3LGHA 1U7LA 3ITHA 1QAIA 1RAHB 1C2PA 4NYZA 3KJQB 2KT5A 5EWEA 3QLHB 5KFRA 2VFUA 3D5MA 3CDEA 3MPYA 4ANDA 1DBDA 1R27B 2GIRA 1DJ0A 2DNLA 2XMTA 3H2UB 3GP9A 2P8IA 2QSFA 1S4FA 1D9FA 2W2QP 2FD2A 1B0PA 4C0BA 4X4SA 1N5QA 2HHUA 1HIYA 1ZZFA 4ZA1A 3KNGA 1JJ2R 1MU2A 3C16A 1BY9A 5K8MA 4JI6F 2JX2A 2KHCA 4FKXA 4G65A 2GHWA 1AYEA 1HBUA 5AE1A 4OYWA 3QGGA 4G6VB 3KUEA 3EICA 4UY85 1DRZA 1G4CA 1LW2A 3POTA 1S97A 3IA0A 4ZCMA 3MFIA 1SH3A 1R89A 3PYDA 2W8KA 1AA1B 4TU7A 4HTIA 5T7LA 1KEKA 2VQFJ 4DPWA 1FDBA 5KT2A 1KOOA 2UUAF 2D69A 1ZM3A 4F0KA 2DGOA 4WTYA 1QDUB 2VG6B 2HQ3A 5L38A 2EBGA 2W2PP 3HVTB 1TV6B 3J7YU 4F3OA 3DRRA 3KOAA 1T05A 2DNGA 5C2GA 4QPTA 5ITHA 3PRBA 3D0IE 2HWIA 4K59A 1ZH5A 2JSXA 3L9ZA 3NXZA 3D0HE 2K1RA 2C2OB 4TU9A 3DOMA 3HO1A 3TUPA 3MEEA 2DGVA 5KT7A 2YTCA 4CP5A 3AD8C 1M5KC 1U0HB 1IKXA 2PC6A 5HO4A 4Y0FA 4ECXA 3FCWA 4H4OB 2JC0A 3QT5A 3I55S 4X4TA 3L3CA 2F40A 1BMQB 3FEZA 1NKCA 2L08A 3W1YC 4ED3A 4P2XA 3LWMA 4CLFA 1P6TA 3MMAB 2FJEB 2RQ4A 2QLFB 3DRPB 4DDFA 2VG5B 5HP1B 5KG1A 1VQNS 3R6LB 2OEKA 5H9EJ 3MUMP 2U2FA 3OW2R 3F0NA 4ZPVR 2VU5A 3DI6A 2FY1A 3QGIA 1TK5A 3SXLA 1AFIA 1VMBA 1JXLA 5E3QA 2V2KA 3M2VA 1C1BA 2XS2A 2OTJS 3G6XA 2B9XA 1SC3B 2C22A 3D1OA 1SH0A 1GXUA 1SUQA 4C11B 3MEDB 1VQPS 3BREA 3PR5B 1XERA 2E5IA 3LTOA 1Q8KA 1DTQB 2H65B 1NBEB 1C0TA 4RW4B 3BPDA 2W1BA 4DLGA 1N5YA 4N5SA 2ZOMA 5AE2A 2IYGA 1K44A 1JLEB 2P9EA 4WFNQ 4RO0A 2DHSA 3LPYA 4ZCIA 3HSZA 2DIUA 4OYMA 5GAEU 2KHDA 2BANA 1WDDA 2Q6BA 3NWGA 2QE5A 1YJVA 3IC1A 4LRBA 4RWWA 2B9YA 1RB0A 3I31A 4G1IA 5HQ8A 3J7Z5 2HHHF 3MMBA 3RBDA 1EQ0A 4KHMA 2W8LA 4F4KA 4H4MB 2ZDPA 2CADA 1T02A 3S8SA 3BPSP 2XMUA 4F0HA 4KHPF 4P7TA 3M6VA 4Q8EA 3RYLA 1WD6A 4ECRA 5I3QA 3DHXA 2ASLA 2Z57B 4OHWA 2J6UA 1X9MA 4GC7A 2VA2A 4DFKA 1GAOA 2C2NA 1VQLS 2HHXA 2GIQA 1B64A 2Q1LA 5KTQA 4IR1A 3C46A 5B7WA 3H2VE 2JVRA 2XWYA 2VQFF 3OD2A 2I2YA 3TA0A 4K4ZA 5A6PA 1XMOF 2IM0A 3FBCA 2ZE2A 3TZXA 2Z8QA 4K50A 3R5JB 1HBNA 1PGZA 3NP5A 3IGVA 1NO8A 1EX8A 4FYYB 3TAPA 2YKOA 2GNKA 3Q83A 4G1QB 1M0SA 4DR4J 3AJ2A 2NYHA 4ZLJA 3LAKA 2ZWPA 1WF2A 1MMLA 1NDPA 2ZBIA 4Z37A 2MQNA 3CTRA 5HMWA 2UZAA 3ENVA 3GYNA 4MMOA 1C1CB 2MXYA 2W24A 4I7FA 2HYIB 2F1FA 3G71S 4ECTA 4CT9A 4Q44A 1RAOA 3AJ1A 1T8EA 3BH7B 2C3OA 4RNNA 2BE2B 2G0IA 4WCEQ 1H38A 4CYUB 3NGSA 3RAQA 2J0WA 3VVUA 1HL6A 4ILMA 1RA6A 1K0VA 6AT1B 4NZ7A 2CPFA 1UAWA 1S7HA 3N6MA 5AXNA 5JVGQ 3TVKA 4EWTA 1S1TA 2KYZA 1VC5A 4NCGB 3RB3A 3LUYA 5IT9U 3MCMA 3D4JA 2VOOA 2BJ3A 4N41A 2J9CA 1FWPA 1ELOA 2VICA 4ZIWA 1RI7A 1UW9A 4M5DA 5THWA 2ZFHA 5A2QU 1EHWA 2Y0BB 4DL5A 3QFHA 4PXEA 4EZ9A 1VQ4S 2B4UA 5IQ6A 3AQOA 2CJQA 4PG6A 4ZP7A 5EGYA 1RT4B 4TKTA 1J5EF 2BACA 3LP0A 1S76D 4TY9A 3N5BA 2PI4A 3MZIA 3P96A 2HGMA 4EEYA 3ZNJ1 4OQJA 2MQQA 1Z1ZA 2EFGA 4TY8B 3CJ2A 2OFHX 2VQEJ 3QAUA 1KNZA 3C66A 3CO9A 5AJ3J 2YKAA 4HHJA 1J5OB 3TAQA 2DNQA 1GMVA 1Q53A 3M8YA 1SKWA 2ZH7A 2AQ4A 3QPIA 4LFBJ 3CW2C 2V63A 1UFLA 1FKPA 1IR0A 1F5BA 1RT1A 3FFIA 1N33J 1X4AA 4URGA 4RW6B 1V5IB 1NK6A 2VPWB 3AOBA 5KT4A 2R9LA 1Q79A 3KWMA 2VB6A 4LF8F 2BBEA 2RIJA 3ILJA 4Q7AA 1MWZA 3K89A 2AKWB 3MD1A 4ICLA 3FRZA 5BYRA 3PXGa 3OL9A 2P2CB 4DL7A 2MLZA 4KRWA 4IDKB 2OD6A 2RHQB 1TVRB 1OYEA 5I42A 4ZKAA 1G3OA 1W2BR 5EX0A 2HVEA 4IOCQ 4OIXA 4OX9J 3JSBA 3ZFVA 2ZH4A 4I6WA 4ALZA 3JQKA 2VODA 4MKAA 4Y65A 4C8YA 1NK4A 1NPRA 1FTRA 3A8IA 4KGVB 2C42A 1H0HB 4DLEA 2E5JA 5KG0A 2OTLS 1UA1A 2OPPB 3UDVA 3C15A 4Y2IA 2RU9A 2IDEA 2NXNA 1CPZA 1LWCB 4J7CA 1RABB 3C14A 2UXDJ 5I4MA 2L9DA 3MD3A 1WG5A 4CLWA 1LFWA 4C8NA 3OLBA 3MMCB 5K9FA 5CCLA 2NXJA 4ANCA 2EG2A 5DQHA 3CDAA 4DV0J 3LGNA 4GKJF 1B7FA 2VONA 2P9CA 3RB0A 3OR2A 3S7RA 2WRMA 2OLWA 2UUBJ 1Y5LB 4OX7A 1KHWA 2J7UA 3QRRA 1MROA 1CJUA 4QR0A 5DG8A 4A8QA 5J2NA 1X5TA 2XHCA 4RZRA 2W2NP 3G96A 1T0TV 5HBMB 1T7PA 3E51A 2NS1B 4DL2A 3T6BA 1N36J 4OZ5A 4P6QA 2DGTA 2FJDB 4KTQA 4PG4A 4P73A 1K47A 4HEA9 3FGVA 1R6YA 3QSYB 3EUNA 4CLZA 4DG1A 1NSKL 1OQ6A 4AT1B 2V2VA 2ZUAA 4ECWA 3MURP 1WC1A 2LFVA 2MZTA 3W2WA 4CLPA 4MK8A 3OSNA 1TP7A 2XULA 2R8IA 2D3ZA 3VHQA 2LVWA 4KV8A 4BLGA 2BA9A 5EDWA 2DRBA 1S9EA 2MQOA 7AT1B 5D4PA 2FC8A 1OY9A 2DGQA 3DRRB 2KO1A 3DYAB 3QJJA 4B3TJ 3D6MB 5KT5A 3CC4S 3PEJA 3V4IA 4NLVA 4LFAF 2BEFA 2E7XA 1M5PC 2DH9A 4LFBF 4HI2A 2LEBA 2I8EA 5F8HA 3N28A 2HMIA 3MPUB 4LIRA 1N33F 4NI2A 4QU6A 2ABYA 4HTJA 1OMSA 1OWXA 2ADCA 4PWDA 1IQTA 3BGRA 2VUGA 1BQNB 2AZ3A 1RAEB 1RISA 5BR8F 1XBWA 3C19A 5C24B 2WB1D 1WEYA 1S0NA 3QATA 5E3RA 5IC4B 3J80U 2UUTA 7FDRA 1AB8A 4W4MA 4FNIA 4N76A 4WU2A 2WOMA 3MM6A 4IG3B 2W9AA 3OR1A 2X1AA 3QJPA 1FCAA 1NK7A 2J9DE 3O3LA 4HI1A 3CCLS 1RTIB 5A8RA 1U49A 4J9LA 4LT6A 2WVCA 4OJ3A 2V4QA 1UWAA 4CDIA 2G2ZA 1F60B 4RNMA 3FCHA 3D54A 4JI4F 1AT1B 5JUMA 5EX3A 3JSMB 4Q43A 2V2ZA 2EVZA 4LF9J 3SIPB 5HL7Q 3I4HX 5EN1A 1R0BG 2XZDB 3CCZA 5B0EA 1MWYA 2ZKUA 2IA6A 4I67A 3OSPA 3IRWP 4KGMA 3B6BA 2UV8G 4PCQA 4FYWB 2CQGA 3H0PA 4CLLA 5B09A 1FKOB 2GA7A 4DCPB 5D4LA 3HHLA 4JB8B 2D74B 2YX7A 4ZP6A 3KUGA 4ES1A 3HHEA 3TW0A 1ZM4A 2YNGB 2OMOA 1FD8A 4EBEA 3SCJE 4R5PA 4EYHB 3OJUA 4OZJA 4OI6A 1TMJA 1JLFB 3BSOA 1HBOB 3MMBB 3RUBL 2MKJA 1X4BA 3OJSA 2JEFA 1TU0B 4A8KA 3MEGA 1Y11A 4Y00A 1FDNA 1N36F 3NBPA 3R1HA 4ZVFA 1RWKB 4U6PA 1VQYA 1RJJA 2ERRA 2KZMA 4EO6A 2HAIA 1P1LA 1N34F 1N32F 1QAYA 4CO1A 3M6XA 4RW9A 2R8HA 2C2KB 3LP2B 2YX4A 4MH8A 1NJXA 4AXIA 3C6UB 1NNDA 3GR1A 3KMSA 4OYZA 4Q2LA 2XZTB 1YJRA 3KJVA 4B3SJ 5KFBA 5GAHI 1VQSA 1U02A 3RZAA 1RTDA 4F50A 2JC1A 1NK9A 2HLTA 3M6UA 4JP8A 3G8TA 4Q0BA 3SQOP 3HXMA 2GQ2A 3ISND 3CO0P 2YNFB 5HSPA 4NLTA 3JQMA 1JXVA 1GMWA 2C1EB 5D0EA 1S0MA 1PC4A 5ETQA 1SJ4P 4PUOA 3NY0A 4NLWA 2OPRA 3BDPA 4MTPA 5D0HA 4ZPAA 2XCAA 1XNRJ 3QT7A 4PKDB 4NRTA 1CJTA 3UDCA 4U7UK 5HMXA 4EBDA 2LLZA 4JI2J 2R2UA 1IBLJ 5CA5A 1HNVA 3CIZA 2RVJA 1R8CA 2AJ0A 3D6TB 3M8QB 1FRKA 2DCUB 1WHWA 3T41A
chains in the Genus database with same CATH topology
4CLKA 2GVDB 5D0RA 1CJKA 1CULA 1CJTB 4OZ2A 4USTA 1U0HB 4USWA 1U0HA 4NI2B 3UVJB 1YBUA 5D15A 4CLYA 4OYPA 3R5GA 4CM0A 1CJVB 4NI2A 3UVJA 2WZ1A 4OYZA 5IV4A 4OYMA 1CJKB 1Y10A 3C15B 1AZSB 4CLZA 3G82A 4OYIA 1YK9A 3C15A 4CLLA 1AZSA 4P2XA 4OYBA 1WC0A 4OYAA 4OYOA 4CLFA 1WC1A 3C14A 4OZ3A 4USVA 4CLTA 3ET6B 4OYXA 4CLWA 4CLPA 1TL7B 3ET6A 4WP9A 1FX2A 3MR7A 1AB8A 1TL7A 5D0GA 2QV6A 3G82B 4P2MA 2GVZB 4CLUA 4WP3A 2GVZA 5D0EA 4CLSA 3C14B 1YBTA 3MAAB 4CM2A 4P2FA 1WC5A 4WP8A 3MAAA 5IV3A 5D0HA 3C16B 1CJUB 1FX4A 2GVDA 2BW7A 3C16A 1CJUA 1WC4A 1CJTA 4USUA 1Y11A 1WC6A 1CS4B 1CJVA 4WPAA 1CS4A 2W01A 4OYWA 1WC3A 1CULB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLK A;  2GVD B;  5D0R A;  1CJK A;  1CUL A;  1CJT B;  4OZ2 A;  4UST A;  1U0H B;  4USW A;  1U0H A;  4NI2 B;  3UVJ B;  1YBU A;  5D15 A;  4CLY A;  4OYP A;  3R5G A;  4CM0 A;  1CJV B;  4NI2 A;  3UVJ A;  2WZ1 A;  4OYZ A;  5IV4 A;  4OYM A;  1CJK B;  1Y10 A;  3C15 B;  1AZS B;  4CLZ A;  3G82 A;  4OYI A;  1YK9 A;  3C15 A;  4CLL A;  1AZS A;  4P2X A;  4OYB A;  1WC0 A;  4OYA A;  4OYO A;  4CLF A;  1WC1 A;  3C14 A;  4OZ3 A;  4USV A;  4CLT A;  3ET6 B;  4OYX A;  4CLW A;  4CLP A;  1TL7 B;  3ET6 A;  4WP9 A;  1FX2 A;  3MR7 A;  1AB8 A;  1TL7 A;  5D0G A;  2QV6 A;  3G82 B;  4P2M A;  2GVZ B;  4CLU A;  4WP3 A;  2GVZ A;  5D0E A;  4CLS A;  3C14 B;  1YBT A;  3MAA B;  4CM2 A;  4P2F A;  1WC5 A;  4WP8 A;  3MAA A;  5IV3 A;  5D0H A;  3C16 B;  1CJU B;  1FX4 A;  2GVD A;  2BW7 A;  3C16 A;  1CJU A;  1WC4 A;  1CJT A;  4USU A;  1Y11 A;  1WC6 A;  1CS4 B;  1CJV A;  4WPA A;  1CS4 A;  2W01 A;  4OYW A;  1WC3 A;  1CUL B; 
#chains in the Genus database with same CATH topology
 3EXY A;  1CUL A;  1L3V A;  3UD3 P;  4URQ U;  3ZZU A;  4YB7 A;  4WKY A;  2IMW P;  3K58 A;  1UJ4 A;  3TUJ C;  3IMQ J;  4OHZ A;  3Q8U A;  4C98 A;  1NM2 A;  1W26 A;  1TL1 A;  2V0N A;  5B0G A;  2YY3 A;  2CWK A;  1MNE A;  1UPM B;  1R0A B;  5KG4 A;  2HS3 A;  4MKY A;  2FGO A;  3TRG A;  3MM5 A;  2OPQ B;  2OSQ A;  2L9W A;  3H25 A;  4B3O A;  2HWH A;  1LWX A;  3H7H B;  4ZP8 A;  4N8N A;  4O3O A;  4HL9 A;  1U8W A;  4LF5 J;  5CYQ A;  4DS5 A;  2LMI A;  4BS2 A;  2YQ1 A;  5G4D A;  3R7B B;  3BBF A;  1SV5 A;  1BUX A;  1M5S A;  2VL1 A;  1PBA A;  1SBR A;  1RYR A;  3QNW B;  2UXC J;  3ADA C;  1DQ9 A;  3C3L A;  2ZD1 A;  2X3G A;  3IXQ A;  2BRK A;  2NUH A;  3BR9 A;  3MEC A;  4LUB A;  1CLF A;  4I6Y A;  1VBX A;  4I64 A;  1WC3 A;  3TX0 A;  4LBH A;  1N8R T;  2JHE A;  3OFE A;  1S59 A;  2C3U A;  4U7C A;  2Q66 A;  1LWF A;  2AV5 A;  1WEX A;  2MGZ A;  1FDD A;  3T1H F;  1X0P A;  2QSW A;  3RAX A;  3QJL A;  4J9R A;  3I82 A;  4F4Y A;  5FLX U;  3BQ0 A;  2WON B;  1BQM A;  4X4Q A;  2EFQ A;  4B9N A;  3UN5 A;  2ZBQ A;  4TQR A;  3G4S S;  2EI5 A;  1JLC B;  3OHA A;  4DMZ A;  3MR7 A;  2BR0 A;  1QAJ A;  2Y8Y A;  2FY8 A;  4ZPT R;  4K0K J;  1RT1 B;  2LQ9 A;  2HVH A;  4LR8 A;  1RZM A;  4KO0 B;  4ZVU B;  2IDL A;  3N6L A;  4I4B A;  4JV5 F;  4P52 A;  3IM8 A;  4PQU A;  2J7K A;  1R8P A;  1W7W A;  1P1T A;  4KPC A;  5KT6 A;  2AJ2 A;  4M5H A;  2K06 A;  5KFE A;  1LV5 A;  1RTZ A;  3FQK A;  2EFP A;  2VBX A;  4ICL B;  1KOH A;  3VVT A;  3ZZP A;  3DDN A;  3M8W A;  3FZ2 A;  3QID A;  4CLK A;  1JK9 B;  4LSN B;  2OH2 A;  5DG9 A;  3VQS A;  5D6G A;  4C8L A;  3A8E A;  5I42 B;  4USW A;  4N7T A;  4ED6 A;  4DUZ J;  2WBR A;  1VGY A;  2J5A A;  4TQS A;  5CYM B;  5D8H B;  4K4W A;  1LKZ A;  4C8Z A;  3T1Y J;  3EDQ B;  4QR2 A;  3SQG A;  2Z4P A;  1NJY A;  3HP6 A;  4OZ1 A;  2VIH A;  1WOS A;  4N56 A;  1RT6 A;  3M6W A;  1IM4 A;  4WK1 A;  4EFA C;  4NA1 A;  2CPE A;  3W9J A;  1UFK A;  1G1X A;  5DGB A;  1N4L A;  5U47 A;  3C14 B;  3GIL A;  4JI2 F;  4FP9 A;  5FDL B;  2UUW A;  1MMN A;  3QGH A;  5F8M A;  2X1G A;  2LDY A;  2K7K A;  3RTV A;  3PYE A;  4YB6 A;  4ZPB A;  2KG0 A;  2R4F A;  4ECS A;  3OR2 B;  3CDB A;  3X3U A;  3KK1 A;  2HW3 A;  3FBB A;  2DO4 A;  3M2U A;  4F02 A;  2Y9H A;  1GXT A;  1N88 A;  1S9F A;  5D3G B;  3OTB A;  3GFY A;  2DO0 A;  2K2P A;  2DXE A;  2KL8 A;  2YKM A;  4RKU C;  1XQI A;  4DR6 F;  5JMN A;  4OYI A;  5D4N A;  3IWL A;  3UWT A;  4XAK A;  3NLC A;  3CUN A;  1NSP A;  5T14 A;  4KGZ B;  4UW2 A;  2R8K A;  3U1N A;  2CRL A;  4ZHR B;  2KJW A;  2DXD A;  1Q86 T;  4DR3 F;  2NSB A;  3FEX B;  4DG1 B;  3B78 A;  2UXC F;  1VJW A;  1U09 A;  1QJH A;  3LGM A;  3IWN C;  2ZDO A;  2VKR A;  3AD7 C;  1T9W A;  1FT8 A;  1B4S A;  3PFE A;  3BO3 A;  1KD1 T;  3LP1 A;  4OZL A;  1FTC A;  5IOL A;  1F9H A;  4RNO A;  4AQY J;  2BKN A;  3G8S A;  1NHU A;  1NPK A;  4PWU A;  1H73 A;  3FCV A;  1MMD A;  5SUH A;  3HLU A;  2FLL A;  1RHU B;  2IYI A;  3DU6 A;  4U67 Q;  2BXJ A;  1X5P A;  2HBR B;  5KFK A;  2PN6 A;  3Q8S B;  3VV2 B;  2O01 C;  2WBM A;  5KFJ A;  2HHV A;  1NEE A;  5HN0 A;  3H5S A;  1X4D A;  4A8M P;  1E6V B;  4K0K F;  1G6B A;  4WZM A;  2KU7 A;  2V4J A;  3ZC4 A;  2DR5 A;  1RT5 B;  1WI6 A;  4DQS A;  1V9O A;  1HQU A;  4PWD B;  3JXO A;  1NK5 A;  1UCN A;  1F3V A;  3FK4 A;  2HUR A;  2IJR A;  4QYR A;  4JI5 F;  2JDJ A;  1BC6 A;  2QLX A;  1S6P B;  2XM3 A;  2CIM A;  1WOP A;  1L3K A;  2V5H G;  3CD5 A;  3PNI A;  2WOM B;  4XPC A;  3CJK B;  1HMV B;  2FVS A;  4GC6 A;  1U6F A;  3OR1 B;  1YZ7 A;  4DUZ F;  3QRP A;  2FZC B;  2RUS A;  4U9R A;  4NL5 A;  3W9I A;  1QVF R;  3SFG A;  2HHT A;  2NPF A;  5D0R A;  3WQP A;  5J2M A;  4DSI A;  2NXU A;  2HBQ B;  4Y3C A;  2R2R A;  2QL9 B;  4J5O A;  4KH1 B;  3T1Y F;  3GON A;  2BVZ A;  1S1W B;  1DY3 A;  2YNH B;  3NGT A;  3U27 A;  3H4B A;  1BD6 A;  3E3X A;  3HK2 A;  2PEB A;  3I0S A;  2CJA A;  2XCP A;  4GKK F;  2VFT A;  4JI0 F;  2HRT A;  2PMZ D;  4WK3 A;  2MJN A;  1WTF A;  4QYZ J;  4HT5 A;  3D0G E;  1RAJ A;  4ZDN A;  4EZ6 A;  3HFV A;  1EKS A;  4J90 A;  5A8W B;  2BUN A;  1JKH B;  3T5K A;  1FX2 A;  1S1V B;  1S99 A;  1UEU A;  2RNE A;  2COL A;  3NAI A;  1NAQ A;  3TYT A;  1JLQ B;  4F3M A;  4ZVG A;  2Z58 B;  8RUC A;  4YHH J;  5DLF A;  2ZEJ A;  3VAG A;  9ATC B;  4M5I A;  2JRS A;  4HR2 A;  5LT5 A;  1H2U X;  3Q86 A;  2CAJ A;  1EP4 A;  3I0R A;  1U1R A;  2I38 A;  4R5P B;  1V5V A;  1PAE X;  1N56 A;  5KOX A;  3M8Z A;  2GC8 A;  5L1L A;  1X9S A;  3EZO A;  3CJ4 A;  2XQC A;  3S01 A;  2EK1 A;  4CIO A;  4OHY A;  4P75 A;  4BDP A;  1F5A A;  3OUY B;  1VQK S;  3Q8Y A;  4WIQ A;  3A3N B;  1YJT A;  3GYX B;  1HNI A;  3GLJ A;  3CJR A;  3MEG B;  4CLY A;  4R8U A;  3EE3 A;  4LBI A;  4GVB B;  4BWJ A;  4DV2 F;  4JOU A;  3BQ2 A;  2J0X A;  1VRQ C;  2W9B A;  4C8K A;  1F2G A;  1RA7 A;  2MKK A;  3HT0 A;  2CPI A;  1PG5 B;  2PSZ A;  4F25 A;  3UCG A;  2FVQ A;  2Y3Y A;  1EAR A;  1UEV A;  4X4P A;  4NMX A;  3BO2 A;  1YX2 A;  1RTD B;  4RUB A;  4UY8 T;  1FXR A;  4DPY A;  2BX6 A;  4XDC A;  5DGA A;  2E7V A;  4AQY F;  2ZOF A;  2H4Y B;  2W9C A;  4DFM A;  4M5M A;  4A8Y A;  2R7W A;  4PWW A;  4OJH A;  3UD5 A;  4MFB A;  5LMN F;  4K4T A;  3K5M A;  3M7V A;  1RWV B;  1CS4 A;  1HNZ J;  1KRP A;  3QGP A;  2HHS A;  3R2C J;  3DGV A;  1C4A A;  1CJT B;  2VG7 A;  1LWE B;  2DGS A;  3E2E A;  1VRU A;  1Y3K A;  3RU0 A;  1SPB P;  3CWJ A;  3R2D J;  4F4A A;  1FK9 A;  1GFW B;  2YQ3 A;  3DCA A;  2IBO A;  3M9M B;  2DR9 A;  3HHL C;  4WE1 A;  4F0M A;  4TVA B;  4KFB B;  3MFH A;  4J9V A;  1FEH A;  2EPI A;  1WKK A;  3NS6 A;  4BC9 A;  4X84 A;  3NGD A;  3BGU A;  3EZU A;  1ITP A;  2IVM A;  2RE1 A;  1S48 A;  1JLG B;  2F5G A;  2DRA A;  3W2V B;  4HYK A;  3MM5 B;  1S1X A;  4HDG A;  1D1U A;  4JYA J;  4IFY A;  4X64 F;  5CYQ B;  4LF1 A;  2B4O A;  2IVY A;  4ITS A;  2BQR A;  5C42 B;  4NXN J;  2RML A;  1VHF A;  4MK9 A;  2YWK A;  3DDK A;  4OI3 A;  2GGP B;  1N5T A;  4IFV B;  2YKP A;  2BV3 A;  3IWX A;  1JQG A;  4L76 A;  1SB6 A;  4FF2 A;  5B0D A;  3GSI A;  1CJV A;  3DOL A;  3H98 A;  4PRF A;  1F1B B;  2X1F A;  1FO1 A;  4LF6 J;  3OTO J;  4QWE A;  2DIT A;  3OT9 A;  3CVK A;  2RIL A;  3PW0 A;  3K5L A;  1NJW A;  3ILL A;  3KDO A;  2V50 A;  5D15 A;  3MEC B;  5DDR C;  1EQM A;  3CNQ P;  1NK8 A;  2RKI B;  1EET A;  3P8B B;  4KAI A;  5KOW A;  4NZ0 A;  1YLX A;  2POK A;  1I5O B;  1R8B A;  2JLG A;  3ISN C;  3HT3 A;  4RU9 A;  4EK2 A;  2MGZ B;  3NCP A;  4NLD A;  1WC0 A;  1S9G B;  1WKL A;  5DJB A;  4Y6I A;  4USV A;  4NWB A;  1CQN A;  2DGU A;  5HAT A;  1ULR A;  4UUW A;  1X31 C;  4BBY A;  2XYG B;  4IO9 Q;  1TUW A;  1T9V A;  5IM0 B;  3QO9 B;  2I5J A;  2B4V A;  4DV4 F;  3AA9 A;  4HH0 A;  2OEJ A;  2HHQ A;  4PXC A;  4OJ1 A;  1Q8L A;  3M1V A;  4OMF G;  4F7V A;  3DLG B;  2C3Y A;  3CB4 A;  2CPD A;  4A4J A;  9RUB A;  4CO2 A;  4X66 F;  3DOK A;  1TTH B;  4ATN A;  1OY6 A;  1L3T A;  3J7Z T;  3WX8 A;  3KLI A;  2G2O A;  2AX1 A;  2HVI A;  3SDE A;  2GJF A;  3GG1 A;  2D3O R;  1HNX F;  2FJW A;  1WSR A;  4HAC A;  2EC0 A;  3KLE A;  4P71 A;  2HND B;  2HQI A;  2WHO A;  3UO0 A;  4FBU A;  1M5H A;  4HHH A;  5BXI A;  5E41 A;  3CIM A;  1N0U A;  3IP0 A;  2UVW A;  3BKU A;  1GMU A;  3WIV A;  5HRO B;  2XTJ P;  4ZN3 A;  3ET6 A;  4KBI A;  1HQ2 A;  3SQG B;  4QBU A;  3CGI A;  4DU7 A;  4DV6 J;  2PDA A;  3L7P A;  3MAA B;  4TXS A;  2NQP A;  3IM9 A;  2FJX A;  2YWH A;  4DU8 A;  2AMC B;  1ARO P;  4MIB A;  1HNZ F;  2EFN A;  1KKH A;  3D3C J;  4ZK7 M;  4USU A;  1D3W A;  2XI3 A;  3BSN A;  1ZOT A;  4MJK A;  4LF7 J;  3B54 A;  3OV7 A;  2DNZ A;  1NDL A;  2W2O P;  2H9Z A;  2CPX A;  1T9T A;  2XY7 A;  5H1S V;  3D7S B;  4QIE A;  1J27 A;  4C3M A;  1S6Q B;  3CED A;  3PIP Q;  1MN9 A;  4ES2 A;  2IJF A;  4UQT A;  2RDJ A;  1UZH A;  1VQM S;  3KK1 B;  3PYF A;  1EAY C;  2FVR A;  3W3S A;  2LU2 A;  4RW8 A;  4IH6 A;  4M1K A;  1TAU A;  1R6V A;  4J9M A;  1UVI A;  4ZPC A;  3OFH A;  4IRD A;  2EEY A;  2DTJ A;  3BN4 A;  2MZ1 A;  2KVQ E;  3AAW B;  4UOG A;  3EJM A;  4YB1 P;  1SJ1 A;  3AHP A;  1NZ8 A;  2MJU A;  4W90 B;  5KFZ A;  4DZD A;  3WX4 A;  3VQT A;  2J9D A;  4NLP A;  2G9O A;  2Q6C A;  3K17 A;  1WSV A;  2LEC A;  1VYA A;  5KG5 A;  3GCW P;  1TUG B;  4CO3 A;  1F9F A;  5C25 A;  1U1N A;  4G1P A;  2VC0 A;  3R3T A;  3JYT B;  4KYZ A;  3CCV S;  1X7V A;  5J1E B;  1SKR A;  3QSI A;  3MR2 A;  2LU1 A;  4C3L A;  2IM2 A;  1VR6 A;  4DHV A;  4F04 B;  2HHP A;  3KK3 A;  2E5L J;  2MLX A;  3KDN A;  3A3P B;  4LVN P;  1XK8 A;  1YRU A;  1SJR A;  4C4W A;  4RBV A;  4CTA A;  3JTP A;  2MKI A;  1ZTW A;  4O4G B;  4GRS A;  3P6Y C;  3MF5 A;  3TAR A;  4RL1 A;  2AYG A;  1VIO A;  1GXL A;  1RE1 B;  4OZ0 A;  4UUX A;  2AD9 A;  1HQE B;  1UA0 A;  1XR5 A;  3IS9 B;  5GAE I;  2HVZ A;  5F8N A;  2RD5 C;  3LH2 S;  4ELU A;  4X62 F;  3CF5 Q;  3US5 A;  2Z2M A;  4K4S A;  3A8J A;  3H90 A;  1WEZ A;  1JWW A;  1U4B A;  5J1P A;  1IBK F;  3VAJ A;  4LIW A;  2G0J A;  3IBW A;  3DM2 A;  4DCJ B;  3BDE A;  3MM9 A;  2XI2 A;  4OJG A;  2NSC A;  2WTF A;  1PYT A;  4LF4 J;  1D8Y A;  1YSJ A;  4RUA A;  4ZVS B;  3G9C A;  2IHR 1;  2V2Q A;  3TO8 A;  4NXM F;  2AF6 A;  2HS0 A;  3CCT A;  5L1I A;  1QLN A;  2KRB A;  4Q45 A;  4FDF A;  1O6X A;  2IAJ B;  4Y2M A;  1FWL A;  1TL4 A;  3CJS A;  4KT0 C;  1K8A T;  4DEZ A;  3HDS A;  4IUF A;  1P27 B;  1FXD A;  3H20 A;  4CCH A;  2E66 A;  2AYE A;  3NS5 A;  1KFD A;  1HNW F;  1TK0 A;  1ZPW X;  2RQM A;  4ZIT A;  5M2U A;  1Q8I A;  3ISZ A;  4OX8 A;  3GFZ A;  3KLH B;  4USH A;  4EU0 A;  3IRX B;  4QQB A;  1KLM A;  4X2B A;  5DG7 A;  1IKY B;  3QWU A;  1WHX A;  2M52 A;  3KYL A;  2Y1R I;  3TA1 A;  1W25 A;  5A0Y B;  3MUV P;  1U1M A;  4GO7 X;  2JLE A;  2M5Y A;  3A1Y G;  4J9K A;  1H7X A;  3IG1 B;  2JJ4 D;  2B4P A;  4JI6 J;  4LSL A;  2M4M A;  1VIS A;  1FRM A;  2RS8 A;  3THP A;  5E3P A;  4I2P A;  1N6Q A;  5HMZ A;  1EP4 B;  1EKR A;  3KK2 A;  3I0R B;  4TN2 A;  1JLA A;  2NLW A;  4NML A;  5ETS A;  4KH0 B;  1TKT A;  1XR7 A;  1UVJ A;  5M2P A;  3RBE A;  1XIQ A;  3PRD A;  2YNI A;  1RYS A;  3AFG A;  1VHI A;  2O66 A;  2GQC A;  3NEK A;  1VQ7 S;  1WG4 A;  1UVK A;  2UUA J;  3PJX A;  1U2R A;  1OIA A;  4V19 X;  1ZET A;  2QRR A;  2HNY A;  2ZKT A;  2DH7 A;  4R8U B;  1DHM A;  2Z56 B;  5DET A;  4FYD A;  4K8R A;  2AU0 A;  2DNO A;  2AYB A;  2MSS A;  3BZQ A;  4OLP A;  3ZTR A;  5H9F K;  4DR2 J;  4K5S A;  2QLJ B;  1TKZ A;  1XWL A;  2MZR A;  1CBK A;  1KQG B;  4Z7Y A;  1HBM A;  2F4F A;  1UZD A;  3W63 A;  1YKW A;  5IT9 Y;  1I51 B;  3BGL A;  4E8U A;  1IKV B;  3CCU S;  1F9E B;  5KFY A;  2AJ4 A;  1RHJ B;  2N4D A;  5J2Q B;  1NH8 A;  5HVH A;  3T19 A;  3GJT B;  1S77 D;  2RQC A;  4ERD A;  3Q8V A;  2M88 A;  2H54 B;  3DLE B;  5A2Q Y;  4C8M A;  5F0W A;  4CH0 S;  1XNQ J;  2ZBC A;  1VQ9 S;  3VGS A;  2VFV A;  1RTH B;  3HKW A;  2CXE A;  1RAA B;  3MPV A;  3RG6 A;  3T3F A;  4FS2 A;  3M8P A;  1OO0 B;  5DM7 Q;  2Z2L A;  1H3D A;  4YY3 F;  3KHG A;  3B4D A;  5A6W A;  4CQ1 A;  3SCL E;  3J81 U;  2RT3 A;  1M1K T;  4FXV A;  2GFF A;  2HNZ A;  2N4C A;  3VZH A;  3TJ8 A;  5ETP A;  4YME A;  2FLN A;  2BYC A;  3TP2 A;  2HAF A;  2A18 A;  4IOB A;  2Q79 A;  2LQ5 A;  4QWA A;  3FSI A;  5DRK A;  5LJ3 Y;  2APO A;  2MQL A;  4NLG A;  1RU2 A;  3MCO A;  4K5R A;  1TK8 A;  4J9U E;  2OAU A;  2JOQ A;  3ZZZ A;  1PJ6 A;  4YOE A;  3PKY A;  2N3L A;  2OPS A;  1U6B A;  2YKN B;  3K59 A;  3EPG A;  3KFW X;  5JXS A;  2UXB F;  3T9Z A;  1QE1 B;  2W4C A;  2OGU A;  1CJV B;  3ZZT A;  2CQ0 A;  4Q8F A;  4WF9 Q;  2PT0 A;  5GAD U;  4LFC F;  1RXO B;  1YK9 A;  2GHV C;  4O23 A;  2KG1 A;  2EXU A;  2B6A A;  5K8P A;  2HHH J;  4E0D A;  1R0C B;  1Q4R A;  3MM7 B;  4CH7 A;  5C7P A;  1WI8 A;  3VGV A;  1TL7 B;  1SL1 A;  1HI1 A;  2MKS A;  3BV8 A;  1RT2 B;  4KHP J;  1TL3 A;  1IM6 A;  1U48 A;  5CQG A;  2VJU A;  3AOA A;  4DWI A;  1IWA A;  5DDO C;  1RLC L;  3P4U B;  4CWB A;  2DNM A;  2CQ1 A;  2OFG X;  3A13 A;  1K1Q A;  3JS9 A;  2D3U A;  4CZC A;  3GCX P;  5IFM A;  3NG8 A;  1PAU B;  1LFP A;  3SSQ A;  3NWR A;  1XR6 A;  3DHW C;  1M5O C;  3VAK A;  3DU5 A;  1KC8 T;  4ECQ A;  4A8S A;  2CJ9 A;  2QA2 A;  4LRE A;  3WC0 A;  2C2R A;  3G6E S;  4UQG A;  1XMO J;  4I69 A;  2NXC A;  2EW9 A;  4LRD A;  1LOU A;  3UDL A;  3QAE A;  1FJE B;  3FUY A;  4NLS A;  2HPU A;  3S1T A;  3SDE B;  4LF2 A;  5GAH U;  3TZZ A;  4M94 A;  2X7I A;  2LCW A;  5G0R A;  3JAM U;  3CJ8 A;  4DR2 F;  1V6H A;  1BWV A;  3LAN A;  2QL5 B;  2DJW A;  3CXC R;  2RS2 A;  2ZJP Q;  2M8D B;  1YG0 A;  4O0I A;  4HH1 A;  1EIY B;  1D9D A;  2GVZ B;  2ZHO A;  4AE5 A;  1H6K X;  1T9U A;  4HT7 A;  1U24 A;  4YR3 A;  4JI3 J;  3GB0 A;  4ED4 A;  4IQX A;  2CZ9 A;  2WVB A;  1LXJ A;  1VRT A;  3KLG B;  2HLU A;  2V8G A;  1TKD A;  1TEL A;  3BGF A;  1T3N A;  2ZH3 A;  1S0V A;  2FZK B;  1XNQ F;  5KG3 A;  1TKX A;  1OSD A;  1T03 A;  3J7A N;  1Y5I B;  1RAD B;  1ZAX A;  3VZI A;  3DLJ A;  3HFK A;  4F3Q A;  4RJV A;  3IN5 A;  1M1G A;  4KKO A;  1NB2 A;  2HK3 A;  1RTJ B;  3CJ3 A;  1GQE A;  2VBZ A;  4A8X A;  3CJ0 A;  1ZAV A;  4W92 B;  2MZQ A;  4RWX A;  2XMV A;  2R42 A;  1HW8 A;  4YS2 A;  4QR1 A;  1MLA A;  4ECZ A;  4LR9 A;  2WK4 A;  3NCR A;  5L46 A;  4C8O A;  2RAQ A;  1X5S A;  1DQ8 A;  1N0V C;  4B3M J;  4ID8 A;  4I6A A;  2MTL A;  5IXU A;  2KFZ A;  3OXF A;  1ZM9 A;  2HBY B;  2H5J B;  3BBC A;  3DLK A;  1LW0 A;  1HPZ B;  1HHS A;  4K2J A;  1S49 A;  1PKU A;  4HDH A;  5L39 A;  2NCK L;  3AJD A;  5A8K A;  3C6T A;  1MN7 A;  4NLO A;  2C2D A;  2DPJ A;  1J5E J;  5GVQ A;  1FE0 A;  1NUE A;  1YWX A;  1R43 A;  1DAR A;  4M5G A;  3I32 A;  2LDI A;  3RRH A;  3I9Z A;  2HKE A;  2UUC F;  3KG4 A;  3TA2 A;  1PC5 A;  2O3D A;  1KVI A;  2PD1 A;  4O3N A;  3FRY A;  2R7T A;  4LRA A;  2GHP A;  4OHX A;  3J80 Y;  4L6V 3;  1V3R A;  3OVA A;  3JTN A;  1DLO B;  3V81 B;  4IG0 A;  4PZV A;  2DIV A;  1VC0 A;  5LXR A;  3O1L A;  2DNH A;  3BR8 A;  3UVJ B;  2RU3 A;  2AGO A;  3R5G A;  4YUD A;  4NE9 C;  4Z2X A;  3RRG A;  4M63 A;  4DI6 A;  2QYC A;  5KFP A;  4ZS6 A;  1RWN B;  1VQ8 S;  2BQ3 A;  1RT7 B;  1UVN A;  2F63 A;  1WDT A;  3ZZY A;  3QLH A;  3R9L A;  1WF0 A;  4EBC A;  4RLE A;  4KE5 A;  2B0G A;  4NCA A;  5KFS A;  4WTO B;  3W66 A;  4DL0 C;  2IRX A;  4ETX A;  4WP9 A;  4LF8 J;  2XMJ A;  2IRU A;  2HZV A;  4L73 A;  2ATC B;  3FJ2 A;  4J9Q A;  1QTM A;  1PYO B;  1U6Z A;  4QOT A;  2VPX B;  4DR1 J;  4ECU A;  1R3N A;  5ETL A;  2ZH9 A;  5B0F A;  1Q16 B;  4WP8 A;  1REV B;  3VTI A;  2GVD A;  2H4W B;  4FBT A;  2VDH A;  1RP5 A;  3W62 A;  3LF0 A;  2HS4 A;  1RAI B;  3IAS 9;  2CDR B;  2CJY B;  1NKB A;  1WC6 A;  2ZM6 F;  2PMW A;  4DV5 F;  4AL5 A;  4E2F B;  4EGL A;  1ZA1 B;  2EK6 A;  2Z2Y B;  4X65 F;  3DLB A;  2FJA B;  5HVG A;  1O5J A;  3CMA S;  4O0N A;  4WJB A;  2MZS A;  4IRC A;  1RT3 B;  3AB2 B;  3TAM B;  3SV4 A;  4QWB A;  1AZS B;  1F5C A;  2Y1I A;  1R31 A;  3DLL Q;  1FFS B;  4DX8 H;  3FSY A;  4BWM A;  1SJ3 P;  4JI3 F;  1FJG F;  1YDL A;  3B4M A;  3ILO A;  5J2P B;  2DR6 A;  5IT4 A;  2VDI A;  4PG5 A;  2VG6 A;  5CAB A;  4GKJ J;  3HVT A;  2E5H A;  2GMJ A;  2WCX A;  1YBA A;  2MEW A;  2XNR A;  3IO1 A;  1N52 B;  2KH9 A;  3SV3 A;  2M9K A;  4JI1 F;  1B0V A;  3ZZ0 A;  2XSF A;  1Q81 T;  1NXI A;  4DV1 F;  2E9Z A;  4JV1 A;  2IC3 B;  1IBM J;  1U8S A;  2W01 A;  2DNY A;  1IWG A;  2V69 A;  5GMK a;  2FTR A;  3PO5 A;  3CSK A;  4OZ2 A;  4NAS A;  1IKW B;  3E01 B;  4B3M F;  1U0H A;  2RDI A;  3D1Q A;  2HQG A;  4F4Z A;  2RF2 B;  6FDR A;  3OPK A;  3KJN B;  4YFU A;  3FEY B;  3KK2 B;  2BAB A;  4ETZ A;  4H4O A;  4LJM A;  1XJW B;  2VD3 A;  3MM8 B;  4LQ9 A;  2FHM A;  1FVQ A;  2P6S A;  5L1K A;  1ACM B;  2AW0 A;  2A6O A;  3Q2S C;  2CVI A;  3D9B A;  3CJQ A;  1VJQ A;  4OZ3 A;  3GIM A;  3MMA A;  2DT9 A;  1AUD A;  3EGV A;  2HGL A;  2LXF A;  4ES3 A;  3DRP A;  3QRQ A;  4ZVO B;  5K14 B;  2HNY B;  2VG5 A;  3KLV A;  5HP1 A;  2E44 A;  3W65 A;  4K7Q A;  4DZ6 A;  5SZT A;  3RR8 A;  1H98 A;  2PEH A;  2ZWO A;  3BS9 A;  1RWM B;  2BJ1 A;  1RK8 A;  1HBM B;  4LFA J;  1SIW B;  4DL4 A;  3KHR A;  4C11 A;  2DR8 A;  1S1U B;  2U1A A;  2Y1J A;  3MED A;  1ZA2 B;  3VAF A;  3ONQ A;  1DTQ A;  4DS4 A;  3HUL A;  2FIU A;  4ZOS A;  3MPW A;  3TWZ A;  2IIH A;  1JLE A;  1H2V Z;  1Q5Y A;  3CJ5 A;  2N82 B;  1VQ5 S;  1FXL A;  1TR0 A;  2QTW A;  3CC7 S;  5KG7 A;  5AE3 A;  4MKV A;  4ECY A;  5BR8 J;  5F8I A;  4ZCL A;  3TAN A;  5IZH A;  3IGN A;  2KM8 C;  4DR1 F;  3HHK A;  3M30 B;  1Z2L A;  3OLA A;  3K2Y A;  4K4U A;  2B3T B;  4P2S A;  4FS1 A;  4H4M A;  2J8A A;  4RW7 B;  1REG X;  2XLJ A;  3IFE A;  2ZVS A;  3HKZ D;  2CNN B;  2CQ3 A;  1T95 A;  1RHR B;  4WFZ A;  2VPZ B;  1O51 A;  5L9N A;  2DR7 A;  3HFZ B;  2HFV A;  5FLX Y;  4P74 A;  2UU9 J;  2RRN A;  4JI4 J;  3DRS B;  3OL6 A;  3WHI A;  3GFH A;  2XMA A;  2CYY A;  5IC6 B;  1CJK A;  1UWB B;  1V3S A;  4C0H A;  3KLF A;  2IM3 A;  3SZ2 A;  3ITH B;  3BF4 A;  1K9M T;  4M8L A;  3TOQ A;  2DEI A;  5LM7 E;  3BO4 A;  2HFU A;  3LOU A;  5I3P A;  3Q89 A;  1C4C A;  3H8Y A;  2KJV A;  3OXL A;  3H42 A;  3CD6 S;  4MIA A;  2X51 A;  1LEO A;  3MXH P;  1LQ9 A;  3MR3 A;  2H5E A;  2CWX A;  2ZBR A;  2QA4 S;  4G1Q A;  1GTE A;  3W5Y A;  3D28 A;  2BW2 A;  4DR7 F;  3RB4 A;  4CI0 B;  4J9S A;  2PII A;  3PZP A;  1IBM F;  1MU2 B;  3C16 B;  1GH8 A;  1C1C A;  2VKZ G;  4ED8 A;  4PEO A;  2D9O A;  1HBU B;  1U2C A;  4B02 A;  1YQH A;  4F2S A;  2BE2 A;  2QZ8 A;  4CYU A;  1N34 J;  1N32 J;  4YN3 B;  1LW2 B;  1NH7 A;  3POT B;  1Z4U A;  4DV7 F;  3HCX A;  3ZTQ A;  5HAO A;  3JSR A;  4ZLL A;  4DL3 A;  4QIF A;  3PO4 A;  3G6V A;  5K8N A;  5KFH A;  4NCG A;  2KYX A;  3F73 A;  4W98 A;  1NCL A;  5T7L B;  3H4D A;  2ZHB A;  4FPR A;  4WFB Q;  1U2F A;  1OQ3 A;  1KQK A;  4WXO A;  2EFV A;  2BMB A;  2E1P A;  3BSA A;  5JVH Q;  1L5U A;  3PTW A;  4NPO A;  4TLQ A;  5DZ7 A;  5D0G A;  2EBE A;  3CCS S;  3R7S B;  2E1C A;  1Y00 A;  4IO1 A;  5KFN A;  3QZ7 A;  1T05 B;  4A8W A;  3HD2 A;  3OTD A;  5LL6 d;  5KT3 A;  4NLR A;  1UEK A;  2XYH B;  1RT4 A;  1PJ5 A;  4NLU A;  4A48 A;  1KLN A;  2ZUG A;  4AFF A;  6FD1 A;  2K1R B;  4DR5 J;  3DOM B;  4TY8 A;  3F44 A;  1P8G A;  4YDD B;  3MEE B;  1FD2 A;  3ZTP A;  1GT8 A;  3NGR A;  2HRY A;  1IKX B;  4AL6 A;  2R8G A;  1J5O A;  2JEJ A;  4WYL A;  1Q7L B;  1T03 B;  3Q8Q B;  5F9N A;  4OX6 A;  5IWA F;  1U1L A;  2DYA A;  1QSY A;  3LAM A;  5F8G A;  4ZIV A;  2IY5 B;  3NGU A;  2ASJ A;  3SFU A;  2MY7 A;  4IQM A;  5ETR A;  5KG2 A;  3JTO A;  1QUP A;  3O44 A;  2ZNY A;  1T9Y A;  3I9V 9;  4A8O A;  1UL3 A;  3OL7 A;  4X4V A;  3TR5 A;  4OYX A;  4RW6 A;  5GAG U;  3CCM S;  1UVL A;  2D41 A;  4QWD A;  2I6W A;  1VBK A;  4C97 A;  5DM6 Q;  2UU9 F;  5D78 A;  1F6T A;  3DI6 B;  4CT8 A;  1XTZ A;  2L48 A;  4ANE A;  2ZH1 A;  2GML A;  2DHG A;  2KT2 A;  3A4T A;  1RBA A;  3M2V B;  1C1B B;  1QTN B;  1KR4 A;  4IDK A;  1SUQ B;  1YJ9 S;  1SKS A;  1TVR A;  4KJI A;  2DXF A;  4AUK A;  4J9N A;  3GIK A;  4USI A;  3UCZ P;  1C0T B;  4FNH A;  3VWS A;  2W7O A;  1N5Y B;  3UQS A;  3T1H J;  4LRC A;  3TUI C;  1XMQ J;  2CNO B;  3CC2 S;  3M4X A;  1GEH A;  3LW5 C;  4DQR A;  2BAN B;  4IG0 B;  1FNM A;  1RHK B;  2IPO B;  2MB0 B;  1A7G E;  3UW1 A;  2MYF A;  2KVI A;  1LWC A;  3N79 A;  2H1Y A;  1S12 A;  2HVD A;  4C2M A;  3MMC A;  1S57 A;  4ED7 A;  4QCL A;  3N9U C;  4PPD A;  4JV5 J;  1O8B A;  2FHO B;  3P45 B;  2M7S A;  2F8H A;  1NSQ A;  4KPY A;  2MKY A;  5LMU F;  1RKJ A;  5F3T A;  4KY3 A;  3PX0 A;  1Y9O A;  4NEY A;  2V8D A;  2C3M A;  2CKW A;  2NR0 A;  2E1R A;  2FVP A;  2J9E A;  2WVF A;  3PM9 A;  4WFY A;  4JBC A;  2KXN B;  3T5J A;  2IA0 A;  3GPA A;  5LXY A;  2YBV A;  5HBM A;  3GU0 A;  2GVD B;  3V6H A;  4DXL A;  2CPH A;  5BYS A;  1WTB A;  2ZE2 B;  1KN6 A;  2HZA A;  3TEG A;  4RNF A;  2N7C A;  1VIX A;  2B9E A;  1HBN B;  4UZB A;  3NNC A;  4FF4 A;  1YVF A;  1DTT A;  4OYB A;  1UP1 A;  1WOO A;  1RWX B;  2CQC A;  2R7X A;  3DGP A;  2RRB A;  1NDK A;  2Q3P A;  1QM9 A;  1RHM B;  3KG1 A;  4CLU A;  2RDD A;  1RWU A;  2ASD A;  1RAC B;  2ILY A;  4DR5 F;  3H59 A;  3V6K A;  3RRK A;  4DBQ A;  4I7F B;  1QSS A;  1R7I A;  2L3M A;  1N48 A;  1FRX A;  4R25 A;  2B7C B;  2RQK A;  1KTQ A;  3PG9 A;  1HWU A;  2JNJ A;  3DYA A;  5KFT A;  4EI2 A;  2ADB A;  4PXD A;  2XO7 A;  3EWG A;  4QZV B;  4Y34 A;  4WFA Q;  2V8V A;  1NME B;  4MYT A;  2JVO A;  1S1T B;  3B82 A;  3U1L A;  5E3C A;  7FD1 A;  2F4V F;  4K4Y A;  2KB2 A;  4KR0 B;  4ZCK A;  1SQF A;  2LP4 A;  1SI9 A;  4DR6 J;  2YKQ A;  4DCO B;  2KTQ A;  2MKC A;  1URR A;  8ATC B;  1IXK A;  1GK8 A;  4M5D B;  2L41 A;  1Q5V A;  3OTE A;  4I56 A;  2NYI A;  2PFF B;  1BQN A;  4DR3 J;  1SXL A;  3TJ9 A;  4KGK A;  5C24 A;  2XMM A;  1SJF A;  4PPZ A;  1LK5 A;  1IJF B;  2AJQ A;  3LP0 B;  1WJ9 A;  1X60 A;  3L95 X;  4IG3 A;  1ZTT A;  2GO9 A;  4N77 A;  2A0F B;  1FRH A;  4UOC A;  1HI8 A;  1EZZ B;  1FJC A;  4DQQ A;  1RTI A;  2XNQ A;  4K2X A;  4L74 A;  1XMQ F;  4D3G A;  3PW2 A;  2DIS A;  3W8G A;  1WHY A;  3FVY A;  3FSX A;  4KGX B;  3JSM A;  5KFF A;  5I3U A;  5CHC B;  1J2V A;  2EG1 A;  4XO0 A;  2ZNZ A;  5ETN A;  4DSK A;  1YJU A;  1X0F A;  3TI0 A;  1XN9 A;  1IR1 A;  3K5O A;  1FKP B;  2IBK A;  3C2P A;  3FFI B;  2V9K A;  3CE8 A;  2B43 A;  1WUU A;  3X1L B;  5F9L A;  4M5L A;  1F3F A;  4ED5 A;  2YWE A;  2N3O A;  1FKO A;  5LOQ A;  2HRU A;  3OQ2 A;  4UTG A;  1KVJ A;  2M8H A;  4MKB A;  1FRJ A;  1PBU A;  5KG6 A;  2YNG A;  1NHK L;  2QG9 B;  3QBC A;  1CQM A;  4O3S A;  4JI5 J;  2QLW A;  3KJF B;  1LK7 A;  2ACY A;  2K7J A;  2L9N A;  2W4D A;  4DN9 A;  4I2Q A;  3Q8R B;  1JLF A;  2RUG A;  1YHQ S;  1HBO A;  3CPW R;  1DUR A;  1URN A;  1JXE A;  1NJI T;  2CJK A;  1EJ7 L;  4M5N A;  2FLO A;  3G87 A;  1CC7 A;  1APS A;  2W7P A;  1TZ0 A;  1BGX T;  2X1B A;  5EUH A;  2R7S A;  5IT0 A;  2DNK A;  5B0A A;  2V67 A;  4ILR A;  1Q8B A;  5H9E K;  5HQL A;  3HD1 A;  3M2R A;  2PA3 A;  3OFG A;  2WZ1 A;  2VHG A;  3LP2 A;  3CUL A;  1N5S A;  4ZJO A;  3OL8 A;  3C6U A;  3MOZ A;  3ENW A;  3I87 A;  1CJK B;  4RUC A;  4GKK J;  4JI0 J;  3KLF B;  2R7R A;  3C15 B;  4DSE A;  1IJE B;  2EC2 A;  2PGC A;  2DPI A;  2CG8 A;  2R2S A;  2MQ8 A;  2DGX A;  4B3R J;  2XMW A;  2XHW A;  1KFS A;  4JUZ A;  5F0U A;  2YNF A;  4MIW A;  4NCB A;  1QAX A;  5DQI A;  2V68 A;  4KQZ A;  1WG1 A;  3L7U A;  5DO2 A;  3SBM A;  1WEL A;  4CRJ A;  2WVD A;  4O3Q A;  1B3T A;  2C3P A;  3GV7 B;  4L3N A;  1CC8 A;  1MRO B;  1CJU B;  2A2C A;  3RR7 A;  5J2N B;  1JB0 C;  2MST A;  1RSC A;  2AGP A;  5C5J A;  1GX5 A;  3FMW A;  4N8O A;  3GSD A;  2VC1 A;  3M8Q A;  2MQP A;  5D77 A;  2UVV A;  2O1P A;  2DHH A;  2JZ5 A;  4QIV A;  4DV2 J;  3DC2 A;  4XIU A;  4L72 B;  1U1P A;  5KFU A;  4DFJ A;  5KFI A;  4NA3 A;  3BKF A;  2QYG A;  1NKE A;  1R0A A;  4QW9 A;  2CNK B;  2ZBP A;  3GTY X;  2V6A A;  2XSJ A;  4DN0 A;  1S0O A;  1B0T A;  2OPQ A;  3W2W B;  3SMZ A;  2B9W A;  3MEK A;  4KV8 B;  4PXB A;  4U8Y A;  2HQD A;  3KKF A;  2GAH C;  5HQM A;  1B7Y B;  2B8P A;  4YP3 A;  1S9E B;  5AXM A;  4FXW A;  2WW8 A;  3M32 A;  3NS7 B;  5CH7 B;  2AGQ A;  1FJ7 A;  1FRI A;  3ZTO A;  3PRV A;  1SC6 A;  2YWG A;  4P72 A;  3ULH A;  5LMN J;  5E5N A;  4RX6 A;  3IAM 9;  4IR9 A;  1Y4Z B;  3EX7 B;  5B0C A;  1OPI A;  3V4I B;  2M2B A;  1RBO B;  3A3O B;  4PAB A;  2XO6 A;  3H5Y A;  1ZS6 A;  2ZZN A;  2HMI B;  3KTQ A;  3H5U A;  4NX9 A;  2ZJQ Q;  4NI2 B;  4J91 A;  2M70 A;  1HFE L;  5CZV A;  4ED0 A;  5BJR A;  4E98 A;  3BGR B;  2KRR A;  1D9A A;  2WON A;  1VBZ A;  4CNY A;  3PHE A;  3RW6 A;  4B9U A;  2W7A A;  1YGY A;  3W61 A;  1DAX A;  4RNH A;  5KFW A;  1JLC A;  1FDA A;  1WAC A;  5KFG A;  3V5R A;  3CJT A;  1PYS B;  4WP3 A;  4UOF A;  2F3J A;  3A8K A;  3JSY A;  3MM6 B;  4X64 J;  2YWF A;  5T41 A;  4KO0 A;  5KFD A;  2ZC3 A;  4ZLP A;  4BHQ A;  2F65 A;  3UI3 A;  2C2E A;  5A8R B;  2DKO B;  1WC4 A;  4TLR A;  2JLF A;  2KFN A;  4ZVP B;  2CG4 A;  3QMQ A;  3VAM A;  1SIZ A;  3PYG A;  4LBP A;  3W5Z A;  4Z7C A;  1GTH A;  3TVY A;  2BJ8 A;  4O3P A;  5DDQ C;  2P5V A;  2PE8 A;  4LSN A;  5KFX A;  1AFJ A;  4P7V A;  4O44 A;  4FZV A;  4YEA A;  4TU8 A;  5HVF A;  4RBU A;  1Z2Z A;  3GV8 B;  2QFI A;  1YJ7 A;  3VGT A;  2HQF A;  5CYM A;  2IJN A;  3HHL B;  4B3R F;  4USJ C;  2Y8W A;  2FVC A;  3PHT A;  1E6Y A;  3BKT A;  5MLC V;  2ZC4 A;  1UTA A;  4YR2 A;  3UR0 A;  1SL0 A;  2AEF A;  1KDN A;  4NLY A;  4DR4 F;  2CPJ A;  5CZX A;  3F56 A;  4S0M A;  2CJX B;  4DV4 J;  3FMB A;  3VR1 A;  1MWQ A;  2LEP A;  4YQW A;  2FHJ A;  1U1K A;  2VV5 A;  4DPX A;  2OHD A;  2O5D A;  1WC5 A;  2C2M B;  3T9N A;  5FDL A;  2HFS A;  4USM A;  5DQG A;  5BYQ A;  2MDA A;  2CVE A;  4IH5 A;  1HWL A;  2BE9 B;  3NBP B;  2LXU A;  2QLB B;  4X66 J;  3PW4 A;  4F67 A;  2XZW A;  4Y2A A;  3U1M A;  2QIF A;  2DBB A;  2JFD A;  2I9S A;  3W9H A;  2J0S D;  1RLD A;  1R8A A;  1HNX J;  3CCJ S;  4UST A;  2DY1 A;  4RW9 B;  1ZM2 A;  4YB5 A;  2B51 A;  3EPI A;  5D3G A;  3VAI A;  3KJV B;  4B17 A;  2AYM A;  3EXC X;  3J81 j;  5F41 A;  1FEE A;  5HLF A;  3EVW A;  5HJX A;  5IQQ A;  3T1A A;  4UF4 A;  1BXN A;  1N54 B;  4D3H A;  4Q0B B;  4ZHR A;  2JEI A;  3HVW A;  3AOD A;  1V3Z A;  5K8O A;  3GII A;  4B9M A;  1DTT B;  3Q22 A;  3DGP B;  1U1O A;  3HJV A;  2GJI A;  4PUO B;  2ACM A;  2OPR B;  3TUZ C;  3MHY A;  5FD1 A;  3OXG A;  2H3E B;  3ETO A;  2N7Y A;  1PCA A;  3LO3 A;  4ED1 A;  1IVZ A;  2R3V A;  1HNV B;  2M0G B;  4RUH A;  3U02 A;  2QA1 A;  2VQE F;  2DY9 A;  1HLW A;  2CQD A;  1CUL B;  2HEK A;  4R0J A;  3FBE A;  2XY5 A;  2CA9 A;  5CD4 A;  2FPH X;  2YX1 A;  5A76 A;  5AJ3 F;  3R5A A;  2OIH A;  1MW7 A;  5ETM A;  1KSP A;  1TL1 B;  1S7I A;  3K5P A;  2HQC A;  2KN4 A;  3DRX A;  2MZJ A;  1HHQ A;  4LSZ B;  1YIJ S;  4B3O B;  3JQJ A;  3LWL A;  3BYP A;  1S6O A;  1E6V A;  4EO8 A;  4TNO A;  5HAN A;  2MPU A;  2KDO A;  5LSL A;  2XGQ A;  3Q24 A;  2HFN A;  1RT5 A;  2AX0 A;  5LJ5 Y;  3RB6 A;  1FRL A;  3L4B C;  2MHE A;  3GQC A;  2OML A;  3DKD A;  3ICL A;  1JJC B;  1SV5 B;  2AJF E;  3MGJ A;  2PFD A;  4GVL A;  3A12 A;  2ZH5 A;  1HAR A;  4OHV A;  2ZD1 B;  4YR0 A;  1S6P A;  1X8D A;  4CNZ A;  4FXD A;  1EB0 A;  2HIY A;  3MR6 A;  1S10 A;  3TZW A;  1HWJ A;  4DF4 A;  3UDE A;  1Y0H A;  3CJK A;  3D6F B;  1T11 A;  1HMV A;  3J81 Y;  4IYQ A;  4V1A k;  2E9R X;  1NB7 A;  4J37 A;  3DLH A;  4OX9 F;  1AW0 A;  2CQP A;  1TFY A;  1LWF B;  3DMJ A;  1SJQ A;  3G2X A;  1TFW A;  3SSR A;  1X4C A;  4FN5 A;  3THV A;  1X4H A;  2ALY B;  4B9T A;  2QJ3 A;  3LQV A;  1IBC B;  1S1W A;  1UVM A;  2AEM A;  2YNH A;  1HA1 A;  3TNV A;  1BQX A;  1BQM B;  4MAK A;  5I3U B;  2CNL B;  2XB2 D;  2HBZ B;  2AZ1 A;  2G0C A;  3JB9 k;  3R1L A;  4OYO A;  3BB5 A;  3K57 A;  5KFV A;  1RDR A;  3T5H A;  4QPX A;  2UXD F;  2CDQ A;  5A8W A;  1JKH A;  3FC9 A;  4P2M A;  5GAD I;  1S1V A;  2G1D A;  2BJE A;  1JJ4 A;  4NYO A;  4X62 J;  2HGN A;  1JLQ A;  2BM1 A;  2BJ9 A;  3OVS A;  2PI5 A;  4PQU B;  1IBK J;  4CM2 A;  4DV0 F;  1H7W A;  4I1T A;  3H5X A;  2KFY A;  2GO8 A;  2ZH6 A;  2UUB F;  4OL8 A;  2DD8 S;  3HHL D;  2R7V A;  2VBW A;  1OPZ A;  3MTJ A;  4I2Q B;  2YPY A;  3K8V A;  2HSE B;  4NXM J;  1A9N B;  1TUV A;  4ELT A;  5KAK A;  4N47 A;  2FB0 A;  2R7U A;  4OV6 A;  2LYV A;  3OUY A;  1RWW B;  3I5A A;  2IFX A;  4DUY J;  5EWF A;  3M05 A;  1H74 A;  1U26 A;  4PG8 A;  1C0U A;  4DJB A;  5CAA A;  1IUJ A;  4GVB A;  4LRF A;  4O3R A;  1HNW J;  4O4R A;  2GQQ A;  2CZ4 A;  2V94 A;  1HKA A;  2K8G A;  3M2R B;  2ZH2 A;  2OSR A;  3HSG A;  1RT6 B;  1VS3 A;  2E9T A;  3SYZ A;  2UV8 A;  4NLX A;  4XK8 C;  2QMU B;  5E33 A;  1CG2 A;  3UCU P;  1FI4 A;  2AP6 A;  2WVE A;  2ZJR Q;  1VI7 A;  5ETT A;  3J7Y I;  4K4V A;  2R8J A;  3MAH A;  3P5B P;  2DNP A;  3OHB A;  2OEL A;  1NZA A;  2VZ9 A;  3R5D A;  4HVZ A;  5AT1 B;  2QGF B;  3ZXW A;  3JAM Y;  3VCD A;  4QWC A;  3WZ0 A;  1UJ6 A;  1S5Z A;  4GMK A;  2V8H A;  4WKR A;  3M2U B;  2IRY A;  4DPT A;  2HHW A;  4B3T F;  2KXF A;  2LQ8 A;  1GMW D;  1I94 J;  1LWE A;  5L9X A;  4LVO P;  4L3K A;  2JH3 A;  1U1Q A;  2WB4 A;  2YKM B;  2GCF A;  2G4B A;  2BOA A;  1NU4 A;  2BOP A;  3VF0 B;  8AT1 B;  2LQJ A;  2MY8 A;  1QVG R;  1BE4 A;  3HSD A;  3N0V A;  3K8W A;  3BH6 B;  3QIP A;  3J7A 1;  1X9W A;  1RAF B;  4KFB A;  1QD1 A;  2CJB A;  1D09 B;  4RU2 A;  2XEX A;  4DF8 A;  1VFJ A;  3MPD A;  3FBF A;  2DNN A;  3RW7 A;  1ZAW A;  1G2E A;  1JLG A;  2XSJ B;  3W2V A;  1OJ4 A;  1XC9 A;  3RGI A;  2K3K A;  1RHQ B;  3N6N A;  4ZPW R;  2F9J A;  1SQE A;  3LP1 B;  5CXT A;  5C42 A;  5DLG A;  1WHV A;  3HF5 A;  2FC9 A;  2W2M P;  3P49 B;  4IRK A;  2AWZ A;  2GGP A;  4IFV A;  3M32 B;  2KKH A;  2BZ2 A;  2ZZM A;  4FYV B;  3EM1 A;  2GMH A;  4WPA A;  2AIR B;  3QWP A;  1T3O A;  1ICE B;  4DOZ A;  3L7O A;  2MHN A;  3R7N B;  2XG8 A;  3CCQ S;  2FUG 9;  2H51 B;  4LF9 F;  4ER8 A;  3C8Y A;  4URS A;  2NZC A;  2GIF A;  2G2Y A;  5IV4 A;  2CFX A;  2RKI A;  4YY3 J;  4JI8 J;  3CDW A;  4WYW A;  3ZO7 A;  1IN0 A;  2DGW A;  4DPU A;  2HFO A;  2V4J B;  4ZPD A;  3AD9 C;  2H48 B;  4LR7 A;  5K20 B;  4NA2 A;  3GJR B;  1S9G A;  2VFR A;  4WU3 A;  1JLB A;  2OEM A;  4ZJL A;  1HQU B;  2QA4 G;  3Q23 A;  2B5J A;  3Q0A A;  3AXK A;  1RU1 A;  3K7R A;  4IH7 A;  3MOJ B;  1UW4 A;  4X4U A;  4ECV A;  1VBY A;  3UR3 C;  2FQQ B;  3RJM B;  5IM0 A;  3QO9 A;  4A47 A;  4H4K A;  2Z0G A;  3MMJ A;  1PIE A;  3K0J A;  2V8P A;  1Y7P A;  4ZLN A;  3TZY A;  3DLG A;  4HLB A;  4ID5 A;  4WFX A;  4DUY F;  2P9G A;  3HVA A;  1MSW D;  5B08 A;  3M8R A;  5J2M B;  3TJA A;  3Q8P B;  1Q95 G;  2QC3 A;  1SVD A;  3UFC X;  4MK7 A;  2UXB J;  2F9D A;  3MAQ A;  4LMZ A;  2DNR A;  2J8S A;  2VH7 A;  1PIL A;  2LA4 A;  5H9F J;  1QUV A;  5FII A;  4CM0 A;  2A10 A;  3EGN A;  2ROE A;  3T6J A;  2J7W A;  3BGO P;  4LFC J;  1F2H A;  3HSJ A;  4LQ3 A;  2CPZ A;  4NLQ A;  2P6T A;  3NL0 A;  3I0S B;  4PAA A;  2HND A;  1Y10 A;  1KON A;  1KQS R;  2SXL A;  2JFK A;  4B3S F;  4O44 B;  5ETO A;  5EWG A;  4F4X A;  3BQ1 A;  1FWK A;  5CYJ A;  5HRO A;  5DZ6 A;  3P3D A;  4DQI A;  3LA0 A;  5GME A;  2BM0 A;  3ENQ A;  3I56 S;  1E6Y B;  1D8Z A;  4QW8 A;  3V2U C;  3PKM A;  3WBZ A;  2UVR A;  3MAA A;  2JEG A;  3ZZO A;  4NRU A;  1FF2 A;  1HWI A;  2NUU G;  1UPP A;  2FYX A;  4A46 A;  1XNR F;  4FPI A;  2QL7 B;  4MYU A;  1I94 F;  1XMB A;  2H5I B;  1IBL F;  2E1M C;  5DS7 A;  2FJV A;  5ETV A;  1HNI B;  1OY8 A;  3O5T B;  3O2I A;  3CCW A;  1Y5N B;  1R8H A;  3CDU A;  1S6Q A;  5F3Z A;  4OYP A;  3PV8 A;  3RBZ A;  3RAM A;  3HI9 A;  2LKZ A;  3VGU A;  3EZ5 A;  4DV3 J;  2AEJ A;  3FQL A;  3RBX A;  1VK8 A;  4NYP A;  2W9B B;  3SCI E;  1UFW A;  4WII A;  3TVZ A;  4M5K A;  2FHK A;  3KNA A;  4OYA A;  4HHU A;  2E29 A;  3NOC A;  4ZP9 A;  3HHN B;  2XBP A;  1M5V C;  4J9P A;  5HLF B;  4LF5 F;  3GMG A;  4KC5 A;  1DFD A;  4C48 A;  4ZJQ A;  1DZ5 A;  3D3B J;  4UT4 A;  4RPF A;  1S4E A;  4CO5 A;  4HKQ A;  4KHR A;  2W9C B;  1KQF B;  1VOM A;  1W2I A;  2WSF C;  4RBT A;  2YQ0 A;  4DX7 A;  4MFB B;  3JYT A;  5KFM A;  3EVM A;  1KBR A;  3D2W A;  4V19 J;  2CQI A;  2WW4 A;  2BJ7 A;  5J1E A;  3KG0 A;  1T9X A;  1CS4 B;  4X4R A;  2VG7 B;  1TQL A;  3HZE A;  4JI8 F;  1VRU B;  2OUG A;  2ROG A;  4RR5 A;  4EYI B;  1K1S A;  1YBU A;  1SC4 B;  3S6E A;  1FK9 B;  1QSL A;  3MUT P;  3GFX A;  5J1N A;  3AXM A;  3NRB A;  4WE1 B;  1FKA F;  1H2T Z;  3WDO A;  4O4G A;  2ASY A;  4ZVE A;  1BWE A;  2ZHA A;  2UP1 A;  4Q2M A;  3FZB A;  2JL9 A;  4JI7 J;  5E0O A;  4PQA A;  2DHX A;  1HQE A;  3UN3 A;  2B56 A;  3IS9 A;  1S1X B;  2NZ4 A;  3NMR A;  4F26 A;  2CQ4 A;  1NJZ A;  4IFY B;  4EUV A;  3V4M A;  3EYZ A;  2OP5 A;  1PO6 A;  2CPY A;  2FZG B;  4WZQ A;  2UUC J;  1FER A;  3SCK E;  1JIH A;  2NXE A;  2EFO A;  3DOL B;  3VAL A;  3U7J A;  3R5B A;  2BJD A;  1WKJ A;  3GYG A;  2FDN A;  3GR0 A;  4J9O A;  4PR6 A;  1EET B;  1SCJ B;  2B8Q A;  3KHH A;  3LPE A;  2IAJ A;  4AYB D;  1HD1 A;  1YZ6 A;  2J76 E;  3DMJ B;  1WNE A;  2DK2 A;  3KUH A;  1UJ5 A;  3CCE S;  4WBF A;  1MG7 A;  3PCO B;  5CD4 H;  3PIO Q;  3CME S;  3KLH A;  1DQA A;  1KS2 A;  2I1R A;  2HFZ A;  1Q78 A;  1RWO B;  3CMQ A;  3ENA A;  3IRX A;  4X4N A;  3FKB A;  2I5J B;  1IKY A;  3LAL A;  3I96 A;  3QFW A;  2XY6 A;  3QZ8 A;  4XTT A;  3HHD A;  5A0Y A;  3M1V B;  3IG1 A;  4Q5V A;  3V6D A;  1TMM A;  1RCO B;  1YTY A;  2ZM6 J;  3DXS X;  4DV5 J;  3N01 A;  2QX0 A;  4DL6 A;  1VQO S;  1FHT A;  2ATL A;  3DOK B;  3SSS A;  3KLI B;  4DV3 F;  4DSL A;  2XYP B;  2GAG C;  4X65 J;  3G6Y A;  3EMT A;  4ZN1 A;  1RWP B;  3M9N B;  4HAC B;  3D66 A;  3FDS A;  3KLE B;  2ROP A;  1JJH A;  2UVU A;  4F4W A;  1HR0 J;  4C9D A;  2X3D A;  3THT A;  2OKQ A;  2FLP A;  1YJN S;  3WIU A;  1QY7 A;  4DX5 A;  4GO5 X;  4DSJ A;  2FHJ D;  1FJG J;  1L3S A;  1C0U B;  3GJQ B;  2G1H A;  1SC1 B;  4ZVQ B;  1T94 A;  3ET6 B;  3UD4 P;  2IM1 A;  3DFE A;  1ROF A;  1OS5 A;  3NGK A;  1JNR B;  5HMY A;  3GZ7 A;  2RJZ A;  3DRY A;  3ELH A;  4CLS A;  5HK4 A;  3GG0 A;  3EDR B;  4EMD A;  2YH0 A;  4JI1 J;  5MAO A;  1UET A;  4F2R A;  3W60 A;  4M5J A;  1FES A;  2BQU A;  1FFG B;  1IKV A;  4DV1 J;  3PW7 A;  4QYZ K;  5J2Q A;  1P9Q C;  3KHL A;  3UPF A;  5B0B A;  3DLE A;  1I3O B;  5GMD A;  3PR4 A;  2LEA A;  1HYS A;  3HPO A;  1RTH A;  4RW8 B;  1Q1K A;  4NZ6 A;  4B9L A;  4JI7 F;  3ETM A;  2KXH A;  1U0S A;  4ZVT B;  3G82 A;  4QIW D;  4FF3 A;  3OVB A;  1NHV A;  1SH2 A;  3GIJ A;  4C7Q A;  5RUB A;  3G8Q A;  4B9S A;  3HM9 A;  2XGP A;  5F8L A;  2C2Z B;  4DPO A;  1FNO A;  3QIP B;  4BCA A;  1NRK A;  5LSO A;  1FNX H;  3PFO A;  3DNC A;  2KI2 A;  3NAH A;  3D1H A;  5C25 B;  1H72 C;  1KWM A;  5GAG I;  3IR7 B;  3HX9 A;  2WAQ D;  1VQ6 S;  4TYA A;  3SI8 A;  2OD4 A;  1JMT A;  4NOH A;  5FJ4 A;  2G13 A;  1OSC A;  4OI1 A;  4CO4 A;  2J0Q D;  4ZVH A;  3DN9 A;  1NK0 A;  3KK3 B;  3H40 A;  2YKN A;  4NEZ A;  2GW8 A;  2GZO A;  4ELV A;  1X4F A;  1NSA A;  2D7S A;  1YIT S;  1QE1 A;  2RH3 A;  3UN2 A;  1CSJ A;  4WXW A;  4CTA B;  5KFA A;  3BJY A;  2YH1 A;  3AB4 B;  3R5C A;  2DCL A;  3NOG A;  4A8F A;  3OBI A;  1XEZ A;  2YPZ A;  3MCN A;  1O0P A;  1GX6 A;  4DQP A;  1Q7Y T;  3KMQ A;  3MM7 A;  2W25 A;  5LSR A;  4MT1 A;  1BHN A;  1TL7 A;  2FGC A;  2YWW A;  4G3I A;  1Q0N A;  1RT2 A;  4I68 A;  3W64 A;  1UMJ A;  4X4O A;  1B70 B;  2BKO A;  4AXJ A;  4YHH F;  1JLB B;  2QN6 B;  3ZTS A;  4DFP A;  3F41 A;  3DM2 B;  2B5J B;  3NKY A;  3CCR S;  3MM9 B;  2QMX A;  5C2C A;  2MLY A;  3QT8 A;  3P5T L;  4K4X A;  2EKY A;  3GIR A;  2D1C A;  1PJ7 A;  4Y2K A;  2OJ3 A;  3BEG B;  2CZV C;  4Y2C A;  3UE2 A;  3PJ9 A;  3ZZR A;  3SEO A;  2A2D A;  1HR0 F;  1HWK A;  2ALZ A;  2AJ1 A;  4ID5 B;  2E5G A;  5DDP C;  2E7W A;  3K5N A;  3AQP A;  3D67 A;  1A6L A;  1VLY A;  4C6A A;  4TYB A;  4QU7 A;  2HK2 A;  4CO0 A;  1TV6 A;  1D0E A;  3PDN A;  2KM8 B;  2PA8 D;  5ETK A;  2R2T A;  1M1H A;  1KLM B;  4DX6 A;  4DR7 J;  3GJS B;  2A3J A;  1S79 A;  2WSE C;  3I6P A;  1ZPV A;  2FJB B;  1X4E A;  2GVZ A;  2VAS A;  2DHA A;  2O67 A;  1S6U A;  3D68 A;  3W5X A;  2CQB A;  3WC2 A;  4P2F A;  3KLG A;  2W4P A;  3OFF A;  4LSL B;  3QYY A;  3R8Y A;  1YI2 S;  1PSD A;  2CQ2 A;  3PVX A;  1WOR A;  4JV0 A;  4XPE A;  3HJF A;  4I2P B;  4P10 A;  1N6Q B;  1JLA B;  4L75 A;  2XLI A;  4DV7 J;  3T5L A;  3I5B A;  2LA6 A;  3W8P A;  3NCQ A;  1RTJ A;  1TKT B;  4JV2 A;  1TAQ A;  2YNI B;  1B99 A;  2Z30 B;  2MKH A;  2K3I A;  1X5O A;  3IR5 B;  4R0E A;  2VJV A;  1A0O B;  3TX8 A;  2KZZ A;  2CQH A;  2DVI A;  2RB7 A;  1SQG A;  5E3A A;  5HI7 A;  5L8R C;  3PX4 A;  1I1G A;  1X4G A;  2J6S A;  1HPZ A;  2Y1L B;  1FE4 A;  2F8M A;  2HIQ A;  2M3D A;  2VOP A;  1AXQ A;  5ADZ A;  2F7V A;  4PG7 A;  1TKZ B;  1NDC A;  4KB7 A;  1SL2 A;  2IMO A;  4H4K C;  2V34 A;  2R7Q A;  3BM7 A;  4UOH A;  2XS5 A;  4JYA F;  2NPI A;  3TQ1 A;  4RW4 A;  2BW7 A;  4NXN F;  4I0W A;  2XWX A;  1VLO A;  4F36 A;  4U8V A;  2B7B B;  5CCM A;  2V4R A;  3MTK A;  3BBB A;  1LNQ A;  4QIG A;  4FVM A;  1VCT A;  1VDH A;  1RQ0 A;  3FNN A;  1JNZ B;  2A6M A;  4LF6 F;  3OTO F;  3HMJ G;  1DLO A;  5IWA J;  3V81 A;  2YXL A;  4U7U D;  2EKN A;  3UVJ A;  3M8P B;  1RGV A;  4FVC A;  5HJY A;  2NRE A;  4ILL A;  3E8O A;  1LXN A;  1RT7 A;  2ZOG A;  4OFZ A;  1WF1 A;  2HNZ B;  3V6J A;  5L1J A;  2RHS B;  4PYA A;  4ZVR B;  1HHT P;  1VK3 A;  4Y28 C;  1RCX B;  4OLO A;  1HI0 P;  4ZMM A;  4IKA A;  3KXD A;  2LXI A;  2VPY B;  2D3O 1;  2AT1 B;  2HWT A;  1M90 T;  1U45 A;  2A1B A;  2VFS A;  1NPP A;  2BRL A;  2DRD A;  1REV A;  2DH8 A;  3UNG C;  4C0O C;  3GV5 B;  2F8E X;  4USK A;  2DB1 A;  2OPS B;  5E7O B;  4QJV A;  2MMY A;  2C28 A;  4KIA A;  3NNH A;  3TEH B;  3BSC A;  3PY8 A;  3CD0 A;  3DDI A;  3VAH A;  2YVS A;  1KVK A;  3MR5 A;  3IBC B;  3GE9 A;  3CD7 A;  4B9V A;  2VBY A;  1AUS L;  2PO4 A;  2ZH8 A;  2RSQ A;  1RAG B;  4OI2 A;  5KFC A;  1RT3 A;  1IR2 A;  3TAM A;  2BE7 D;  2Q43 A;  2B6A B;  2R7O A;  1AZS A;  3B8H A;  2OO4 A;  5M2R A;  1G7C B;  3L09 A;  2RRA A;  5E2Q A;  1SKU B;  3NNA A;  4PYD A;  2QV6 A;  5J2P A;  1TL3 B;  2Z2Z A;  5KFL A;  5LMU J;  5K5M A;  1TL5 A;  4U95 A;  2J6T A;  5AXL A;  2EWH A;  1ZBT A;  3OTC A;  4OI0 A;  2GS8 A;  3O6Q A;  4DV6 F;  1HW9 A;  5KFO A;  5IV3 A;  1RUS A;  4OI4 A;  2VA3 A;  2XLK A;  5IS2 A;  2XS7 A;  3AY0 A;  4U96 A;  3N5F A;  5D4O A;  3M9O B;  2ILZ A;  1Y3J A;  1CVJ A;  1JX4 A;  2IC3 A;  4LF7 F;  4H54 A;  3UNY A;  2KT3 A;  5F8J A;  3N4W A;  2GX8 A;  3V6D B;  2ZVI A;  4FKY A;  3W7B A;  1IKW A;  4ED2 A;  3E01 A;  1ZZN A;  3CT9 A;  2RF2 A;  3AA8 A;  2QMW A;  1NLK L;  4FYX B;  4C3K A;  2BKP A;  4IOA Q;  1U47 A;  3Q2T C;  3MM8 A;  2IVF B;  5G0R B;  2XMK A;  1YRX A;  1VC6 A;  3EVO A;  2LQB A;  1S72 S;  3BN7 A;  2GJ2 A;  2QO3 A;  4P9S A;  2V9W A;  1KP6 A;  3G86 A;  4WWS A;  3PJW A;  4ENO A;  1BLU A;  2Y0S D;  5K14 A;  4CH1 A;  3QT6 A;  4M95 A;  1ZYQ A;  1YBT A;  1VRT B;  4FF1 A;  3I4P A;  2ZZT A;  1KTV A;  1TKX B;  3QQC D;  1IQZ A;  2HG4 A;  3AT1 B;  3ILI A;  4XDD A;  2JWN A;  4KKO B;  2DEJ A;  3R27 A;  3BYR A;  3R6G B;  1S1U A;  4DSF A;  3HVR A;  1UKU A;  3MDF A;  2VF3 A;  4B08 A;  2F4V J;  1RKI A;  3DXB A;  1L3U A;  2QT7 A;  1FVS A;  3EGW B;  1RBL A;  1N5V A;  2E5L F;  2PMH A;  4F8R A;  3R97 A;  5JJB A;  1HD0 A;  4YDX A;  1F0X A;  1Q82 T;  1FA0 A;  3MCS A;  1HYS B;  3NMA A;  1KHV A;  2OI2 A;  3PX6 A;  3DLK B;  3MI7 X;  1LW0 B;  2AHO B;  2WSC C;  4CLT A;  2I0X A;  5AXK A;  2QFJ A;  3M30 A;  3O8W A;  3IBF B;  3M8S A;  3EGZ A;  1K0T A;  3G82 B;  4BC7 A;  5A8K B;  3C6T B;  4DUT A;  3HZG A;  3MWB A;  1P9Y A;  2D9P A;  1YJW S;  2HZC A;  4RW7 A;  3PAC A;  2BDP A;  4UZC A;  2CUY A;  2GV1 A;  4OZN A;  3TQE A;  2MQM A;  1GNK A;  1FX4 A;  3IR6 B;  5EHH A;  4AD6 A;  2QEX S;  3AOC A;  1WWH A;  3PEH A;  1K73 T;  1FFW B;  3GWC A;  1YRT A;  3DRS A;  4LF4 F;  3ZNU A;  3AH6 A;  4OV1 A;  2E1A A;  1U25 A;  4AL7 A;  2XC9 A;  3I5C A;  4KSE B;  3D6H B;  3PW5 A;  1I6J A;  2ZIT A;  1OYD A;  1UWB A;  3H2L A;  2OPP A;  1CEZ A;  5KFQ A;  3LGH A;  1U7L A;  3ITH A;  1QAI A;  1RAH B;  1C2P A;  4NYZ A;  3KJQ B;  2KT5 A;  5EWE A;  3QLH B;  5KFR A;  2VFU A;  3D5M A;  3CDE A;  3MPY A;  4AND A;  1DBD A;  1R27 B;  2GIR A;  1DJ0 A;  2DNL A;  2XMT A;  3H2U B;  3GP9 A;  2P8I A;  2QSF A;  1S4F A;  1D9F A;  2W2Q P;  2FD2 A;  1B0P A;  4C0B A;  4X4S A;  1N5Q A;  2HHU A;  1HIY A;  1ZZF A;  4ZA1 A;  3KNG A;  1JJ2 R;  1MU2 A;  3C16 A;  1BY9 A;  5K8M A;  4JI6 F;  2JX2 A;  2KHC A;  4FKX A;  4G65 A;  2GHW A;  1AYE A;  1HBU A;  5AE1 A;  4OYW A;  3QGG A;  4G6V B;  3KUE A;  3EIC A;  4UY8 5;  1DRZ A;  1G4C A;  1LW2 A;  3POT A;  1S97 A;  3IA0 A;  4ZCM A;  3MFI A;  1SH3 A;  1R89 A;  3PYD A;  2W8K A;  1AA1 B;  4TU7 A;  4HTI A;  5T7L A;  1KEK A;  2VQF J;  4DPW A;  1FDB A;  5KT2 A;  1KOO A;  2UUA F;  2D69 A;  1ZM3 A;  4F0K A;  2DGO A;  4WTY A;  1QDU B;  2VG6 B;  2HQ3 A;  5L38 A;  2EBG A;  2W2P P;  3HVT B;  1TV6 B;  3J7Y U;  4F3O A;  3DRR A;  3KOA A;  1T05 A;  2DNG A;  5C2G A;  4QPT A;  5ITH A;  3PRB A;  3D0I E;  2HWI A;  4K59 A;  1ZH5 A;  2JSX A;  3L9Z A;  3NXZ A;  3D0H E;  2K1R A;  2C2O B;  4TU9 A;  3DOM A;  3HO1 A;  3TUP A;  3MEE A;  2DGV A;  5KT7 A;  2YTC A;  4CP5 A;  3AD8 C;  1M5K C;  1U0H B;  1IKX A;  2PC6 A;  5HO4 A;  4Y0F A;  4ECX A;  3FCW A;  4H4O B;  2JC0 A;  3QT5 A;  3I55 S;  4X4T A;  3L3C A;  2F40 A;  1BMQ B;  3FEZ A;  1NKC A;  2L08 A;  3W1Y C;  4ED3 A;  4P2X A;  3LWM A;  4CLF A;  1P6T A;  3MMA B;  2FJE B;  2RQ4 A;  2QLF B;  3DRP B;  4DDF A;  2VG5 B;  5HP1 B;  5KG1 A;  1VQN S;  3R6L B;  2OEK A;  5H9E J;  3MUM P;  2U2F A;  3OW2 R;  3F0N A;  4ZPV R;  2VU5 A;  3DI6 A;  2FY1 A;  3QGI A;  1TK5 A;  3SXL A;  1AFI A;  1VMB A;  1JXL A;  5E3Q A;  2V2K A;  3M2V A;  1C1B A;  2XS2 A;  2OTJ S;  3G6X A;  2B9X A;  1SC3 B;  2C22 A;  3D1O A;  1SH0 A;  1GXU A;  1SUQ A;  4C11 B;  3MED B;  1VQP S;  3BRE A;  3PR5 B;  1XER A;  2E5I A;  3LTO A;  1Q8K A;  1DTQ B;  2H65 B;  1NBE B;  1C0T A;  4RW4 B;  3BPD A;  2W1B A;  4DLG A;  1N5Y A;  4N5S A;  2ZOM A;  5AE2 A;  2IYG A;  1K44 A;  1JLE B;  2P9E A;  4WFN Q;  4RO0 A;  2DHS A;  3LPY A;  4ZCI A;  3HSZ A;  2DIU A;  4OYM A;  5GAE U;  2KHD A;  2BAN A;  1WDD A;  2Q6B A;  3NWG A;  2QE5 A;  1YJV A;  3IC1 A;  4LRB A;  4RWW A;  2B9Y A;  1RB0 A;  3I31 A;  4G1I A;  5HQ8 A;  3J7Z 5;  2HHH F;  3MMB A;  3RBD A;  1EQ0 A;  4KHM A;  2W8L A;  4F4K A;  4H4M B;  2ZDP A;  2CAD A;  1T02 A;  3S8S A;  3BPS P;  2XMU A;  4F0H A;  4KHP F;  4P7T A;  3M6V A;  4Q8E A;  3RYL A;  1WD6 A;  4ECR A;  5I3Q A;  3DHX A;  2ASL A;  2Z57 B;  4OHW A;  2J6U A;  1X9M A;  4GC7 A;  2VA2 A;  4DFK A;  1GAO A;  2C2N A;  1VQL S;  2HHX A;  2GIQ A;  1B64 A;  2Q1L A;  5KTQ A;  4IR1 A;  3C46 A;  5B7W A;  3H2V E;  2JVR A;  2XWY A;  2VQF F;  3OD2 A;  2I2Y A;  3TA0 A;  4K4Z A;  5A6P A;  1XMO F;  2IM0 A;  3FBC A;  2ZE2 A;  3TZX A;  2Z8Q A;  4K50 A;  3R5J B;  1HBN A;  1PGZ A;  3NP5 A;  3IGV A;  1NO8 A;  1EX8 A;  4FYY B;  3TAP A;  2YKO A;  2GNK A;  3Q83 A;  4G1Q B;  1M0S A;  4DR4 J;  3AJ2 A;  2NYH A;  4ZLJ A;  3LAK A;  2ZWP A;  1WF2 A;  1MML A;  1NDP A;  2ZBI A;  4Z37 A;  2MQN A;  3CTR A;  5HMW A;  2UZA A;  3ENV A;  3GYN A;  4MMO A;  1C1C B;  2MXY A;  2W24 A;  4I7F A;  2HYI B;  2F1F A;  3G71 S;  4ECT A;  4CT9 A;  4Q44 A;  1RAO A;  3AJ1 A;  1T8E A;  3BH7 B;  2C3O A;  4RNN A;  2BE2 B;  2G0I A;  4WCE Q;  1H38 A;  4CYU B;  3NGS A;  3RAQ A;  2J0W A;  3VVU A;  1HL6 A;  4ILM A;  1RA6 A;  1K0V A;  6AT1 B;  4NZ7 A;  2CPF A;  1UAW A;  1S7H A;  3N6M A;  5AXN A;  5JVG Q;  3TVK A;  4EWT A;  1S1T A;  2KYZ A;  1VC5 A;  4NCG B;  3RB3 A;  3LUY A;  5IT9 U;  3MCM A;  3D4J A;  2VOO A;  2BJ3 A;  4N41 A;  2J9C A;  1FWP A;  1ELO A;  2VIC A;  4ZIW A;  1RI7 A;  1UW9 A;  4M5D A;  5THW A;  2ZFH A;  5A2Q U;  1EHW A;  2Y0B B;  4DL5 A;  3QFH A;  4PXE A;  4EZ9 A;  1VQ4 S;  2B4U A;  5IQ6 A;  3AQO A;  2CJQ A;  4PG6 A;  4ZP7 A;  5EGY A;  1RT4 B;  4TKT A;  1J5E F;  2BAC A;  3LP0 A;  1S76 D;  4TY9 A;  3N5B A;  2PI4 A;  3MZI A;  3P96 A;  2HGM A;  4EEY A;  3ZNJ 1;  4OQJ A;  2MQQ A;  1Z1Z A;  2EFG A;  4TY8 B;  3CJ2 A;  2OFH X;  2VQE J;  3QAU A;  1KNZ A;  3C66 A;  3CO9 A;  5AJ3 J;  2YKA A;  4HHJ A;  1J5O B;  3TAQ A;  2DNQ A;  1GMV A;  1Q53 A;  3M8Y A;  1SKW A;  2ZH7 A;  2AQ4 A;  3QPI A;  4LFB J;  3CW2 C;  2V63 A;  1UFL A;  1FKP A;  1IR0 A;  1F5B A;  1RT1 A;  3FFI A;  1N33 J;  1X4A A;  4URG A;  4RW6 B;  1V5I B;  1NK6 A;  2VPW B;  3AOB A;  5KT4 A;  2R9L A;  1Q79 A;  3KWM A;  2VB6 A;  4LF8 F;  2BBE A;  2RIJ A;  3ILJ A;  4Q7A A;  1MWZ A;  3K89 A;  2AKW B;  3MD1 A;  4ICL A;  3FRZ A;  5BYR A;  3PXG a;  3OL9 A;  2P2C B;  4DL7 A;  2MLZ A;  4KRW A;  4IDK B;  2OD6 A;  2RHQ B;  1TVR B;  1OYE A;  5I42 A;  4ZKA A;  1G3O A;  1W2B R;  5EX0 A;  2HVE A;  4IOC Q;  4OIX A;  4OX9 J;  3JSB A;  3ZFV A;  2ZH4 A;  4I6W A;  4ALZ A;  3JQK A;  2VOD A;  4MKA A;  4Y65 A;  4C8Y A;  1NK4 A;  1NPR A;  1FTR A;  3A8I A;  4KGV B;  2C42 A;  1H0H B;  4DLE A;  2E5J A;  5KG0 A;  2OTL S;  1UA1 A;  2OPP B;  3UDV A;  3C15 A;  4Y2I A;  2RU9 A;  2IDE A;  2NXN A;  1CPZ A;  1LWC B;  4J7C A;  1RAB B;  3C14 A;  2UXD J;  5I4M A;  2L9D A;  3MD3 A;  1WG5 A;  4CLW A;  1LFW A;  4C8N A;  3OLB A;  3MMC B;  5K9F A;  5CCL A;  2NXJ A;  4ANC A;  2EG2 A;  5DQH A;  3CDA A;  4DV0 J;  3LGN A;  4GKJ F;  1B7F A;  2VON A;  2P9C A;  3RB0 A;  3OR2 A;  3S7R A;  2WRM A;  2OLW A;  2UUB J;  1Y5L B;  4OX7 A;  1KHW A;  2J7U A;  3QRR A;  1MRO A;  1CJU A;  4QR0 A;  5DG8 A;  4A8Q A;  5J2N A;  1X5T A;  2XHC A;  4RZR A;  2W2N P;  3G96 A;  1T0T V;  5HBM B;  1T7P A;  3E51 A;  2NS1 B;  4DL2 A;  3T6B A;  1N36 J;  4OZ5 A;  4P6Q A;  2DGT A;  2FJD B;  4KTQ A;  4PG4 A;  4P73 A;  1K47 A;  4HEA 9;  3FGV A;  1R6Y A;  3QSY B;  3EUN A;  4CLZ A;  4DG1 A;  1NSK L;  1OQ6 A;  4AT1 B;  2V2V A;  2ZUA A;  4ECW A;  3MUR P;  1WC1 A;  2LFV A;  2MZT A;  3W2W A;  4CLP A;  4MK8 A;  3OSN A;  1TP7 A;  2XUL A;  2R8I A;  2D3Z A;  3VHQ A;  2LVW A;  4KV8 A;  4BLG A;  2BA9 A;  5EDW A;  2DRB A;  1S9E A;  2MQO A;  7AT1 B;  5D4P A;  2FC8 A;  1OY9 A;  2DGQ A;  3DRR B;  2KO1 A;  3DYA B;  3QJJ A;  4B3T J;  3D6M B;  5KT5 A;  3CC4 S;  3PEJ A;  3V4I A;  4NLV A;  4LFA F;  2BEF A;  2E7X A;  1M5P C;  2DH9 A;  4LFB F;  4HI2 A;  2LEB A;  2I8E A;  5F8H A;  3N28 A;  2HMI A;  3MPU B;  4LIR A;  1N33 F;  4NI2 A;  4QU6 A;  2ABY A;  4HTJ A;  1OMS A;  1OWX A;  2ADC A;  4PWD A;  1IQT A;  3BGR A;  2VUG A;  1BQN B;  2AZ3 A;  1RAE B;  1RIS A;  5BR8 F;  1XBW A;  3C19 A;  5C24 B;  2WB1 D;  1WEY A;  1S0N A;  3QAT A;  5E3R A;  5IC4 B;  3J80 U;  2UUT A;  7FDR A;  1AB8 A;  4W4M A;  4FNI A;  4N76 A;  4WU2 A;  2WOM A;  3MM6 A;  4IG3 B;  2W9A A;  3OR1 A;  2X1A A;  3QJP A;  1FCA A;  1NK7 A;  2J9D E;  3O3L A;  4HI1 A;  3CCL S;  1RTI B;  5A8R A;  1U49 A;  4J9L A;  4LT6 A;  2WVC A;  4OJ3 A;  2V4Q A;  1UWA A;  4CDI A;  2G2Z A;  1F60 B;  4RNM A;  3FCH A;  3D54 A;  4JI4 F;  1AT1 B;  5JUM A;  5EX3 A;  3JSM B;  4Q43 A;  2V2Z A;  2EVZ A;  4LF9 J;  3SIP B;  5HL7 Q;  3I4H X;  5EN1 A;  1R0B G;  2XZD B;  3CCZ A;  5B0E A;  1MWY A;  2ZKU A;  2IA6 A;  4I67 A;  3OSP A;  3IRW P;  4KGM A;  3B6B A;  2UV8 G;  4PCQ A;  4FYW B;  2CQG A;  3H0P A;  4CLL A;  5B09 A;  1FKO B;  2GA7 A;  4DCP B;  5D4L A;  3HHL A;  4JB8 B;  2D74 B;  2YX7 A;  4ZP6 A;  3KUG A;  4ES1 A;  3HHE A;  3TW0 A;  1ZM4 A;  2YNG B;  2OMO A;  1FD8 A;  4EBE A;  3SCJ E;  4R5P A;  4EYH B;  3OJU A;  4OZJ A;  4OI6 A;  1TMJ A;  1JLF B;  3BSO A;  1HBO B;  3MMB B;  3RUB L;  2MKJ A;  1X4B A;  3OJS A;  2JEF A;  1TU0 B;  4A8K A;  3MEG A;  1Y11 A;  4Y00 A;  1FDN A;  1N36 F;  3NBP A;  3R1H A;  4ZVF A;  1RWK B;  4U6P A;  1VQY A;  1RJJ A;  2ERR A;  2KZM A;  4EO6 A;  2HAI A;  1P1L A;  1N34 F;  1N32 F;  1QAY A;  4CO1 A;  3M6X A;  4RW9 A;  2R8H A;  2C2K B;  3LP2 B;  2YX4 A;  4MH8 A;  1NJX A;  4AXI A;  3C6U B;  1NND A;  3GR1 A;  3KMS A;  4OYZ A;  4Q2L A;  2XZT B;  1YJR A;  3KJV A;  4B3S J;  5KFB A;  5GAH I;  1VQS A;  1U02 A;  3RZA A;  1RTD A;  4F50 A;  2JC1 A;  1NK9 A;  2HLT A;  3M6U A;  4JP8 A;  3G8T A;  4Q0B A;  3SQO P;  3HXM A;  2GQ2 A;  3ISN D;  3CO0 P;  2YNF B;  5HSP A;  4NLT A;  3JQM A;  1JXV A;  1GMW A;  2C1E B;  5D0E A;  1S0M A;  1PC4 A;  5ETQ A;  1SJ4 P;  4PUO A;  3NY0 A;  4NLW A;  2OPR A;  3BDP A;  4MTP A;  5D0H A;  4ZPA A;  2XCA A;  1XNR J;  3QT7 A;  4PKD B;  4NRT A;  1CJT A;  3UDC A;  4U7U K;  5HMX A;  4EBD A;  2LLZ A;  4JI2 J;  2R2U A;  1IBL J;  5CA5 A;  1HNV A;  3CIZ A;  2RVJ A;  1R8C A;  2AJ0 A;  3D6T B;  3M8Q B;  1FRK A;  2DCU B;  1WHW A;  3T41 A; 
#chains in the Genus database with same CATH homology
 4CLK A;  2GVD B;  5D0R A;  1CJK A;  1CUL A;  1CJT B;  4OZ2 A;  4UST A;  1U0H B;  4USW A;  1U0H A;  4NI2 B;  3UVJ B;  1YBU A;  5D15 A;  4CLY A;  4OYP A;  3R5G A;  4CM0 A;  1CJV B;  4NI2 A;  3UVJ A;  2WZ1 A;  4OYZ A;  5IV4 A;  4OYM A;  1CJK B;  1Y10 A;  3C15 B;  1AZS B;  4CLZ A;  3G82 A;  4OYI A;  1YK9 A;  3C15 A;  4CLL A;  1AZS A;  4P2X A;  4OYB A;  1WC0 A;  4OYA A;  4OYO A;  4CLF A;  1WC1 A;  3C14 A;  4OZ3 A;  4USV A;  4CLT A;  3ET6 B;  4OYX A;  4CLW A;  4CLP A;  1TL7 B;  3ET6 A;  4WP9 A;  1FX2 A;  3MR7 A;  1AB8 A;  1TL7 A;  5D0G A;  2QV6 A;  3G82 B;  4P2M A;  2GVZ B;  4CLU A;  4WP3 A;  2GVZ A;  5D0E A;  4CLS A;  3C14 B;  1YBT A;  3MAA B;  4CM2 A;  4P2F A;  1WC5 A;  4WP8 A;  3MAA A;  5IV3 A;  5D0H A;  3C16 B;  1CJU B;  1FX4 A;  2GVD A;  2BW7 A;  3C16 A;  1CJU A;  1WC4 A;  1CJT A;  4USU A;  1Y11 A;  1WC6 A;  1CS4 B;  1CJV A;  4WPA A;  1CS4 A;  2W01 A;  4OYW A;  1WC3 A;  1CUL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...