4P2XA

Swapped dimer of mycobacterial adenylyl cyclase rv1625c: form 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
186
structure length
167
Chain Sequence
b'RNIIADKYDEASVLFADIVPALVRFLDRLYSAFDELVDQHGLEKIKGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRNPVPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVMRTWYLIGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase
publication title New structural forms of a mycobacterial adenylyl cyclase Rv1625c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 39
structure length 167
sequence length 186
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 4p2xA00
1U0HB 5D0HA 3C14B 1WC0A 1AB8A 4OZ2A 4CLZA 2GVDB 4CM2A 1FX4A 4CLWA 3MAAA 4OYBA 2WZ1A 1AZSA 4CLTA 1WC5A 4P2XA 4OYWA 4USTA 1WC1A 3MAAB 1WC4A 2W01A 1AZSB 4NI2A 3ET6A 3C15A 3UVJA 1FX2A 1CULA 5D0RA 4USVA 5D0GA 3ET6B 3C15B 4OYOA 1CULB 4WP9A 1CJVB 5D0EA 4CLYA 4CLLA 3C16A 1CJUA 4OYZA 3MR7A 1CS4A 4CLUA 1WC6A 4WP3A 1TL7A 1CJKA 4OYAA 4NI2B 4USWA 3G82A 3UVJB 4CLFA 5IV3A 4USUA 4WPAA 1U0HA 1Y11A 1WC3A 1YK9A 2GVDA 2GVZA 4P2MA 3C16B 2QV6A 3R5GA 4OZ3A 1CJUB 4CLSA 2GVZB 1Y10A 2BW7A 1CJTA 1CS4B 4P2FA 1TL7B 4WP8A 1CJKB 4OYIA 5D15A 3G82B 1CJTB 1YBUA 1YBTA 4OYPA 4CM0A 3C14A 4CLKA 4OYXA 1CJVA 4OYMA 4CLPA 5IV4A
chains in the Genus database with same CATH superfamily
1YWXA 1H7XA 2W2OP 2YNFB 4LRAA 5A8WA 2H9ZA 1FRMA 4F8RA 1UA1A 2YKOA 2FVSA 3DXBA 5DLFA 2W2PP 1O5JA 2KRRA 2KVIA 1NB2A 1TAUA 2HGNA 3DMJA 3BSNA 1RAIB 3PCOB 4OJHA 1HNVB 2C28A 2ZBRA 1ZZFA 1GXLA 4KGXB 2QA1A 1U8SA 2UUCJ 4ZCLA 1R6VA 2FYXA 2AT1B 1AUDA 1R8AA 4F50A 2QZ8A 4OZ5A 2CZ9A 3PKYA 1T9WA 3H20A 4DL4A 1B0VA 3OV7A 4WXOA 2RUGA 4A48A 5GADU 3VQSA 2MPUA 1JLFB 2RKIA 1SC4B 1FXRA 3BSOA 5ADZA 3CCLS 4D3HA 3UDEA 3CO0P 4LBPA 5KT3A 3MM7B 1IBKJ 5M2RA 3KNGA 4N56A 3DXSX 1Y00A 2XGPA 1TKDA 2AEFA 1XK8A 1RCXB 5JUMA 1VIXA 1RTJA 1HHTP 5D0HA 1L3SA 4IUFA 1IKVA 4ZVOB 3R5CA 2YTCA 2YKMA 1R0CB 4O0IA 4KHPJ 4ECWA 3SCIE 4ZVPB 2UVUA 2FTRA 2QMXA 1X4AA 4ETXA 4P2SA 5EGYA 2G2ZA 2O67A 3ET6B 1VQPS 2RF2B 3KK2A 2GIFA 3SEOA 4DQSA 1VBYA 4DJBA 2YWFA 2FZGB 2KXFA 1WHYA 4LF6F 4NLQA 3BH6B 4TYBA 5KFQA 2DTJA 3T5HA 3NWGA 1X4CA 4HACA 2JEGA 2HHSA 2C2RA 1KQFB 5HAOA 2RU9A 4QWCA 2ZE2B 3U1MA 2XI3A 3RBZA 2YH0A 2F3JA 5KG6A 4URQU 1OY8A 1W7WA 4FF3A 3QT6A 3KG4A 2HNYB 4UW2A 3NGKA 1SV5B 3OLBA 4DV6F 4A4JA 1NH7A 1NUEA 2HBQB 2OD6A 4K4ZA 4F4YA 4EFAC 3TZYA 2F5GA 3F73A 4YUDA 1OWXA 3SSSA 5EDWA 2VHGA 3TYTA 2ROPA 4DBQA 5ITHA 1HHQA 1WKJA 2WVCA 2Z2LA 4DPOA 1FVSA 2VG7B 2IJNA 3PACA 1N34J 1FXLA 1SC3B 1HWJA 2M7SA 1SUQA 4JI5J 4PABA 4Y2MA 2DNQA 5IOLA 4J9UE 2KFNA 1CJUB 2DNZA 1EETA 3EDQB 3M6UA 2R7OA 1ZM4A 2GAHC 1SQEA 3PHTA 3K17A 3VF0B 2EWHA 2FJWA 4AL6A 3KXDA 3PYDA 1G2EA 4AYBD 2BEFA 3L7PA 2VBXA 4NL5A 1EKRA 2JLGA 4L3NA 3EZUA 4P2XA 1DTQB 5DM6Q 4KJIA 1BY9A 4NXMJ 4LF1A 4F02A 2OPRA 3TJ9A 3R2DJ 4ZLPA 4DSKA 2UUTA 2QFIA 3G96A 4TU7A 2R8KA 4PR6A 3G4SS 4QU7A 1NJYA 5D0EA 3R3TA 1D9DA 1NPKA 4WZQA 3JQKA 4FKXA 1QSSA 3OUYB 4DG1A 4PUOA 1FRIA 1RDRA 1B0TA 4YP3A 1D1UA 2YNIA 3OLAA 2ZKTA 1Q79A 3JSRA 3N5BA 1T95A 3WDOA 5C2GA 4BHQA 4M5KA 4J9KA 1KLMA 4J9LA 1DQ8A 4A8QA 2DNYA 5KAKA 4ZJOA 2B9EA 2GJ2A 1HNWF 1LNQA 3RJMB 3T9ZA 3T6JA 4FNIA 5KG4A 5KOXA 5HP1B 3FSXA 2IMWP 1TKXB 4RUCA 1CQMA 1V9OA 4NRUA 3DGPB 3R7BB 2VV5A 3BH7B 5KT2A 3MF5A 3EDRB 3MUVP 2DH9A 3J7YI 1RT6B 2IYGA 1H2UX 4RUBA 4X66F 4PPDA 1C0TB 1FD8A 2Y1IA 1HW9A 2MLYA 4ES3A 2CNLB 3NS7B 4TQRA 5A0YB 4ZVEA 3M8PA 3O1LA 2CNOB 1JB0C 5F41A 5D0RA 4ANCA 3EMTA 3TX0A 3FDSA 1WG1A 4J37A 4M5DB 1QTMA 2PA8D 2ZM6F 4K5RA 2GHVC 3N6LA 1RT3B 4J5OA 1NO8A 2DPJA 1T8EA 1UVIA 2R4FA 4TY8A 2HVZA 2W1BA 3S01A 1C1CA 3P4UB 4Y00A 1DTTA 2KDOA 3CNQP 2HS0A 1LV5A 1X9WA 2C2MB 3D3BJ 1QVFR 5IXUA 2JVOA 2VH7A 3Q86A 2ZH4A 5JVGQ 2W9BA 3R5GA 4I7FB 3AODA 1N5TA 1QJHA 3B4DA 3M9OB 3K8VA 4ZLLA 3SQGB 4DWIA 3Q2TC 2BVZA 4N77A 2GV1A 3GP9A 5T7LA 1YGYA 2CPHA 1FNOA 3A8JA 4GMKA 2P9CA 1DHMA 2ZBPA 1A7GE 2FD2A 2UXBJ 4AFFA 3CC4S 1SXLA 3A8IA 3QLHB 3X3UA 3OTEA 1NXIA 2HK2A 4DN9A 3RBEA 3OL9A 5EN1A 1CULA 3KLEB 3THTA 4DSIA 2V8HA 4ELTA 1UETA 2VFVA 3NG8A 4RW6B 1KTQA 1AW0A 1F0XA 4PG8A 5F3TA 1GMUA 2AYGA 4HHHA 3MM8B 2I2YA 2EFOA 5FLXY 4C11A 4YR2A 2H65B 5KFPA 3KWMA 3VQTA 4QYZJ 3VAIA 5KFEA 3CD7A 4NLOA 2VOPA 3QRRA 1B0PA 2BA9A 4OHXA 2DGWA 1RT1B 2XWXA 1Q16B 4KRWA 5CA5A 1VQKS 3V6DA 3JS9A 4IG3B 3V4IA 2HHUA 1NDCA 1S77D 2HAFA 1S1VA 3BGLA 6FDRA 2GW8A 2K3IA 4UQGA 3FBEA 4WFYA 1JNZB 1VLOA 5HMXA 2QLJB 5DJBA 5A6PA 3NKYA 4ZPAA 3OJSA 4B3SF 2F9JA 5C25B 3C6UA 4QPTA 6AT1B 4X4PA 4TY9A 4P75A 3JSBA 3POTB 3DYAB 2N82B 2HVHA 3G6XA 2ZBCA 5B09A 3D6TB 1V5VA 2ZBIA 4CLYA 2FUG9 3PRVA 2EG1A 2VBZA 4ZLJA 3UDVA 3CJ3A 3JXOA 3BPSP 2F7VA 3DOKB 4CNZA 3NGDA 1REGX 2GCFA 3QJLA 1MW7A 2K3KA 1WELA 3R8YA 2HZVA 4YN3B 2W25A 4C8YA 1QSLA 3OR1B 5GADI 3DLJA 1H73A 5B0FA 4IKAA 5ETVA 4JBCA 4R8UA 2IM2A 1RUSA 2CQ2A 2R8IA 4E0DA 4CLSA 5IC4B 3N28A 4WP8A 1NLKL 1Q8IA 1QY7A 1RK8A 1OPIA 3DLHA 4LFBJ 3MMJA 2ERRA 2VQFF 2RDDA 1RWPB 3K5NA 3CIZA 3W8PA 4UZBA 2C3UA 2L9WA 4IH5A 2FIUA 2WZ1A 4LR9A 3SFGA 4NXNJ 5A8RA 1S0NA 2KFZA 3PTWA 3UR0A 4J9QA 1RT5B 3NCQA 5AJ3F 4F4ZA 3OSNA 3GJRB 1XR6A 1OYEA 2MLXA 4QYZK 2K06A 5A8KB 4X64J 1NKEA 4H4MA 3RG6A 2E9RX 4G1QB 2E5LJ 3W9JA 1IKWB 3QYYA 4D3GA 4I2PB 2DGXA 3FZBA 3QPIA 3V2UC 4QIGA 1F2GA 1R31A 3TUZC 4WU3A 4P74A 2GHWA 2EKYA 3TX8A 1SJ3P 3KUGA 4N5SA 1L5UA 1IBMF 2IVYA 3V6HA 4Y2AA 1EB0A 4DR2J 2XEXA 1S1TA 1CPZA 2NXUA 4NCAA 4DR4J 1IR2A 2QL5B 2JC1A 1PBAA 1WTFA 4EI2A 4PYAA 4ANEA 4OJ1A 1U6FA 2A3JA 1UW4A 2W2MP 3BPDA 5L1IA 4DUTA 5C24A 4NZ0A 1HQEA 1YDLA 3BBCA 3GCXP 3D6MB 2ZD1A 3IA0A 3KKFA 5L39A 1R3NA 1U02A 3IP0A 2KL8A 1RTDA 3W66A 3PIOQ 1JNRB 2I0XA 3L7OA 2YNHB 4IO1A 1U25A 2KTQA 1RAEB 3IM8A 1EARA 1K1SA 3QAEA 2AYEA 4EBCA 1N5SA 2Z57B 3ZTRA 2MXYA 3DRRB 1RZMA 2HFUA 5B0DA 1Y3JA 1ZAWA 1JJ4A 1XMOJ 3JAMY 1U7LA 3PVXA 3FNNA 1S10A 1S6QA 2YNGA 2RNEA 4DV1F 4AQYF 2Q43A 1RT2B 1HNIA 3FBBA 2VDIA 3NOGA 2GMJA 4ID5A 4MFBB 4N8OA 3RB4A 1F6TA 3NBPA 4BC7A 2JNJA 5HSPA 4MK8A 2OTLS 4FXWA 4QWAA 4DV7J 4F3QA 3C46A 2QLXA 3BR9A 3CE8A 3QNWB 4GKKJ 1RTHA 4Z37A 4JI4F 3SXLA 5JMNA 3VAMA 2GAGC 4LFAF 3MEEA 2FHKA 3M8SA 4J9VA 3ETOA 5DDQC 1F9HA 2H54B 2K1RA 2H5EA 2B3TB 2X3DA 1TL7A 3AB2B 1VRTA 4USWA 4X4RA 2BJ9A 1YJWS 4ECRA 2M8DB 4DR7J 2W7PA 2GVDA 3FQKA 3N01A 3TA1A 3ITHA 3TJAA 1O6XA 3AJ2A 3P45B 2NPFA 2XB2D 4HI2A 2XC9A 3KUEA 3JYTA 4RL1A 3VZHA 2CQIA 3BGRA 2HZCA 3G71S 3AXKA 4P71A 1LWEA 4U95A 4FYDA 5IM0B 1KDNA 4DX8H 4PG7A 2ZBQA 3SCKE 4I0WA 3QBCA 3KFWX 1CJVB 2PMHA 5ETKA 3VAKA 3HI9A 3KMQA 1HI0P 2JZ5A 4RWXA 1P8GA 1TTHB 2ZZNA 4O4GB 3I0SB 3HJVA 3G82A 2VG5A 2HFSA 5JVHQ 1MMDA 4DX6A 2WBMA 3OTOJ 1X4EA 4FN5A 2XTJP 3QJPA 1OYDA 4LBIA 4UZCA 2CVIA 1EZZB 1NSPA 5J2PB 4QR1A 5AE2A 5FLXU 3BB5A 4RNOA 4U67Q 4U7CA 3DRPA 5K8OA 2BW7A 5B0GA 1CS4B 3MTJA 5K8NA 3H2LA 5F8HA 1EP4A 4XO0A 1FKOA 3QIPA 1R8CA 3C14A 2GHPA 3CJKA 1X5SA 3LGHA 4KV8A 4TVAB 1VRUB 3VAGA 1ACMB 3N6NA 3QZ7A 2BKPA 1S76D 4DCJB 4A8XA 3KTQA 4B9LA 4NOHA 3KLFB 1KQKA 1CSJA 3SZ2A 2R2SA 3W61A 4CQ1A 1U26A 3VWSA 2KYZA 1EHWA 3RB3A 1L3KA 4ZK7M 3TVKA 1JQGA 2UUBJ 2KVQE 2RHQB 3E01B 4TYAA 1PYOB 4Q44A 3KDOA 3KLGB 5KG2A 3M4XA 4NLPA 2MHNA 4IRKA 4DUYF 4FYVB 1UEKA 3AD9C 1P9QC 2RQCA 2LXFA 3FCWA 4ED5A 4P6QA 2DO4A 2HBYB 3JSMB 2X1AA 1F3VA 1FF2A 3ZZTA 1UJ5A 1XMBA 3KK3A 2PO4A 1TUGB 3HVTA 3CJ8A 4IDKB 2RJZA 2LXIA 4NEYA 4ZJQA 5DETA 3E2EA 4ZP7A 4A8SA 2QA4G 4QR2A 5J1NA 3KLVA 3GFZA 2IC3B 2X7IA 4RW9B 4IG0B 1YLXA 3S7RA 2OEJA 3LW5C 4RW8A 1MWZA 3RB0A 1T3NA 1L3TA 1J2VA 1MNEA 3OVBA 1M1HA 3M2VB 2N7YA 3I5BA 2QYGA 2HVDA 2Z4PA 3JQMA 2ACMA 3QGGA 3SBMA 2N3LA 3CUNA 2H48B 2MQMA 3IS9B 4U8YA 4PYDA 3IN5A 1DARA 5D6GA 5JJBA 3W60A 1XNRJ 3QFHA 1FK9A 2QIFA 1SL0A 3TI0A 3M6VA 4IH7A 1WKLA 1ZA1B 3RW6A 4NLDA 4B3TF 5C7PA 2V50A 1KKHA 1U6BA 3C8YA 3DOLA 4ERDA 4O3RA 4PQUB 1YJNS 2D3ZA 8ATCB 4RZRA 5EWEA 3H8YA 2R7QA 1ROFA 2ABYA 2IPOB 3P96A 2ZOGA 1CC8A 1ZM3A 3L9ZA 2C3MA 4WF9Q 3UNGC 1NBEB 4OZJA 4LT6A 1YRXA 2MZ1A 3BO4A 3ET6A 3TP2A 2DIVA 1TK5A 3FEYB 3TVYA 1QLNA 1X5OA 2R7UA 1S99A 3KMSA 4YB5A 2FHMA 4ED7A 1IKXB 3OJUA 2DIUA 3WHIA 5IQQA 1RLDA 4O4RA 1YVFA 4ILLA 2UU9F 4OYAA 2KT5A 4Q45A 3J7A1 4N8NA 3M9MB 2GMHA 2ZH9A 2RVJA 2BJ8A 4FBUA 5L1LA 2ZE2A 1MLAA 1MMLA 2XYPB 1G3OA 1JLEA 4XK8C 1CQNA 5GMKa 3GPAA 3WX8A 3MD3A 3NNHA 2O1PA 1TUWA 2PEBA 3DNCA 1REVB 4BCAA 3P8BB 5F8GA 3VAFA 2CZ4A 4CLKA 3GV8B 3JAMU 1ZTTA 2CPJA 4W4MA 4WFZA 5IT9U 1I1GA 4USKA 4GO5X 3BO3A 2ZHOA 2Q6BA 4EO6A 3BKUA 2HRUA 3IMQJ 2EG2A 2UUAF 4W98A 2B5JA 2G1DA 3RAMA 5HO4A 3CJSA 1VOMA 3KJNB 3RZAA 5K14B 2ATLA 4JI6F 4FF4A 4KQZA 4CTAB 2DPIA 3UR3C 3MR7A 4MKYA 4WP3A 4O3OA 3FBCA 8RUCA 1Q81T 1H2VZ 1FTCA 1UAWA 2XSJA 4IRDA 5DZ6A 3Q8YA 1N48A 3TO8A 3WIVA 4F0MA 5CD4A 2Z56B 2AD9A 2V8DA 4P2MA 1IKYA 3CDWA 5J2MA 2QMWA 4YDDB 3QO9B 4GC6A 2OPSA 3SQOP 1TMJA 4CT9A 2UUCF 3AB4B 1TL3B 1NJWA 4QBUA 3HKWA 2P9EA 2HFVA 3NMRA 3FC9A 1DTQA 1FX4A 2C3OA 3NP5A 4RNFA 3RRHA 1JLGA 1YG0A 3C2PA 2JX2A 1PC5A 4WE1B 3MOJB 2RS2A 3GYNA 1C1BB 3M6XA 2HEKA 5B7WA 1C0UB 2E1RA 1UA0A 4HT5A 4EBDA 1LW2B 4IOBA 2XCPA 2KO1A 4DQIA 5FDLB 2YQ0A 4QJVA 3BZQA 3GIRA 1HLWA 3M1VB 4Y2IA 3D5MA 1X4GA 4DFKA 3CMQA 2H1YA 4CH0S 2QO3A 3C3LA 2IBOA 2UUWA 4F4WA 4PZVA 1BQNB 3KHRA 4Y3CA 3QGPA 1U1NA 4J9RA 2Q1LA 2V8VA 3W8GA 1BMQB 3DLEA 2OPQB 2QJ3A 2ASDA 5C5JA 3BDPA 4A8WA 3U7JA 1IN0A 3LOUA 5D8HB 2B9XA 1TELA 4DXLA 4ZHRB 2J9CA 1HFEL 1C0TA 3Q83A 1RT7A 4JV0A 3NAHA 1Y5NB 3EYZA 5B0EA 5A0YA 1TL4A 1DBDA 5E3PA 1DZ5A 5HI7A 2Y3YA 4IFVA 3BEGB 4LSNB 1D8YA 2XMUA 4X66J 4HKQA 2MJNA 3W2WB 3FFIB 4Y34A 1NNDA 1VQMS 3PYEA 1RLCL 2POKA 4B9NA 2B51A 4F04B 2GQ2A 1RT3A 1ZH5A 3UFCX 2HGMA 2DNNA 3BSAA 4QR0A 1NK5A 2G0CA 3N0VA 1JXEA 2IJRA 3TZXA 4GRSA 4KKOA 1UVMA 5SZTA 4M8LA 2J9EA 1TAQA 4NI2B 2HZAA 4ZCMA 2ZM6J 1SKSA 3M8WA 3H5UA 3T5KA 4TU8A 1DURA 2LA4A 3UDLA 1HIYA 3IBWA 5LM7E 2OUGA 4XDDA 1S7HA 4TU9A 1KLNA 2ZWPA 2ZHAA 3HHNB 2XMJA 4ALZA 1HBMB 5CAAA 1S1XA 4U8VA 2M2BA 4NLYA 2IM3A 5ETLA 1WG5A 3LP1B 4EMDA 5J1EA 3HFKA 2GO8A 1LFPA 5KFXA 1U0HB 3I0RB 2IDLA 5IT4A 5HK4A 3HCXA 3E51A 2YWGA 3IBCB 4LR7A 2CNNB 2J6UA 3OBIA 2F63A 1XQIA 1WNEA 4ZP9A 2I9SA 4HYKA 3HD2A 1N34F 2W01A 2DNMA 2H5IB 3MMAB 3UN3A 4JI5F 1Z4UA 4DHVA 4AT1B 4DF4A 4JV2A 2RQ4A 1E6YA 2F4VJ 1GMWA 3I31A 4F4XA 4NLTA 1TR0A 4OYZA 1WD6A 3Q8VA 2JC0A 3NMAA 2W8KA 1Y7PA 3CMAS 4LF9F 4YHHF 4WU2A 1JWWA 4J9SA 4C6AA 4NXMF 3BDEA 5BJRA 3FSYA 1S97A 5I3PA 5D4NA 4L72B 5AXMA 3DU6A 3OR2B 5LMNF 4DZ6A 3VAHA 2I1RA 3UN2A 1EAYC 2B4PA 2PI4A 4WYWA 1UPPA 2EVZA 2HIYA 5F8IA 5D4OA 3BV8A 3HO1A 3TA0A 3PZPA 4QWBA 5HLFB 3EXYA 4JI3F 1UVNA 1K47A 3IWXA 4ICLA 3ISZA 2NS1B 3J80Y 1ZA2B 3CCMS 3MAQA 1NDPA 2K8GA 1R43A 1WC4A 2AX1A 4ZIVA 2Z2ZA 5I3UB 1S12A 1Q95G 2FHJA 1S6OA 4ZPCA 2B0GA 3DLGA 4DSEA 5CABA 2HHVA 4QPXA 3HX9A 3GWCA 3PW5A 2KFYA 1N56A 1R6YA 2VQEJ 1M5HA 4ZOSA 1ZPWX 3CCUS 3TVZA 2DHXA 1PIEA 2FC9A 1S0VA 1A9NB 1B7YB 3GMGA 3MEDB 2FQQB 3R27A 3UCUP 1GAOA 4JI0J 1UVJA 5E0OA 5I42B 4Q0BA 3BYRA 2UP1A 1RWWB 3ZC4A 4LRFA 2XQCA 3EM1A 3Q89A 4K2XA 4WYLA 1OIAA 1UMJA 3K2YA 4KBIA 1NEEA 1JJCB 5LMUJ 3JB9k 3UN5A 3SMZA 4NCGA 1LWCB 1RABB 4NWBA 1QAJA 1JLQB 2C1EB 5KT5A 1B7FA 2HNZA 2MHEA 3KK1A 5A8KA 1GK8A 2WVFA 1HYSB 2CPDA 2CQPA 3HT3A 1B70B 2HBZB 3DU5A 1VCTA 1IKWA 3K89A 3I56S 2CJXB 4UF4A 5HBMA 4U6PA 5AJ3J 1LXJA 2IM1A 1D09B 2A6MA 1X7VA 3SCJE 2UXBF 5G0RA 1UEVA 1SJ1A 1U47A 5ETMA 5F8MA 3PXGa 2XNRA 2XWYA 2QGFB 2G0JA 1HBNA 4OHWA 1GX6A 2GGPB 1CJTB 2Y0BB 3RR7A 2VG6B 5DQGA 3CCES 1RQ0A 4KO0B 4AD6A 3QIDA 3BGOP 1BLUA 1GH8A 4ILMA 5D78A 1S79A 1URNA 3I87A 2K7JA 3CCWA 4B3MJ 2CRLA 2KI2A 5KFCA 1WC1A 1BGXT 1FCAA 3MR2A 2BV3A 4DFPA 4RBUA 5K20B 3R2CJ 1XWLA 2JWNA 1FDNA 2VOOA 1TUVA 4DX7A 2P5VA 3CCQS 2V2KA 2VDHA 2MKCA 2M0GB 3B8HA 2J8SA 4X4OA 5KFIA 4MIAA 2CIMA 4HT7A 3DM2B 2X51A 5D3GB 3HHDA 2IVMA 1QE1B 2RT3A 5A76A 1CJKA 4F3MA 1YRTA 1SVDA 3W9IA 1RHMB 3BR8A 1WEZA 3TEGA 2EI5A 2IDEA 4FKYA 4B9VA 2E5GA 3I96A 3HPOA 1F60B 1T9TA 1PSDA 2M5YA 3AJDA 4WKYA 5KG1A 4ZVTB 4A47A 4NA3A 1L3VA 4USJC 2BE9B 3KJFB 4C3LA 1D9FA 5EWGA 4Y28C 4DDFA 2UVWA 2CKWA 3CDUA 2DR8A 2QYCA 4U96A 3KG1A 4DV1J 1HMVA 3N79A 3CT9A 2DD8S 2CWXA 5K9FA 2IRXA 2XYHB 3DI6B 4F4KA 3QRPA 3W64A 1KFSA 4NEZA 2WCXA 4FYWB 2XBPA 4BLGA 4JI2F 2XMMA 4N7TA 2WW4A 3NY0A 4HDHA 4DV2J 3B82A 1RHJB 1QDUB 2IA6A 3NGRA 1S6PA 4ES1A 4V19X 1HBUB 1S9FA 4Z2XA 3A1YG 2DGSA 1J5EF 3EJMA 3RGIA 2MY7A 2W4PA 5ETNA 2YY3A 4JI4J 3J81j 4LFBF 3T1YJ 1PYTA 1SQGA 3MI7X 2ZZTA 3IBFB 1MN7A 4UT4A 4QWEA 3TQEA 2IMOA 1YJTA 4WPAA 4NXNF 2VA2A 4M1KA 3DOMA 1X4BA 1K44A 1TFWA 2E1PA 1LWFB 2LEPA 2PE8A 2Q6CA 3MEGA 1D8ZA 4OYIA 2AZ1A 3TA2A 1Q0NA 1H74A 4WBFA 3U02A 2BQUA 2GNKA 4GVBB 1U1RA 1E6VB 5MAOA 2F4FA 3X1LB 1ZAVA 3DRYA 2ZZMA 2ZJPQ 4JI7J 3NS5A 2W24A 2VONA 2VICA 1WC5A 5I3QA 3MAAB 2D3O1 4KPYA 3H0PA 1DLOA 1CBKA 3LP2A 3KHHA 3NGSA 1S9GA 2WW8A 1RTIA 2MKIA 3MFHA 3LWLA 4AL5A 2HHWA 1K8AT 4DR2F 3I0SA 1RHQB 2YWHA 4DR4F 1Y3KA 2VC0A 3WQPA 5EX3A 4Q43A 1ZYQA 4ED6A 4V19J 1DQ9A 4NX9A 3C16B 4RX6A 2ZOFA 1HA1A 4UY8T 4C3MA 4DL0C 2OHDA 1ZAXA 5J2NA 1RU2A 3FZ2A 3K5MA 1VQ8S 2KHCA 2BQ3A 3D54A 4RNHA 1YBTA 4OYPA 4B9UA 2G2OA 2XG8A 2CQGA 2QRRA 2GQQA 1CVJA 3RW7A 3R5DA 1EIYB 3LGMA 4HDGA 3KLIA 3AHPA 2XHCA 4ECXA 3THPA 1Q8BA 4KFBA 4ZVHA 2OKQA 1XMOF 4TKTA 1WG4A 3GIKA 1SIWB 2A1BA 3TOQA 3E01A 3G8QA 4M5MA 1BQMB 2VF3A 3J80U 1TKTB 1FTRA 1TL1B 2DNRA 2HQIA 3NNAA 2C22A 4IO9Q 1KR4A 4IR9A 4TNOA 1MROA 2AHOB 2AJQA 1Y0HA 1JKHA 2QL7B 1Y5LB 2W2NP 1ULRA 4GKKF 1GX5A 2CAJA 3DHWC 4XDCA 2NLWA 3AAWB 2CQHA 4FXVA 1T05A 2JEJA 4LSLB 3DGVA 3DDKA 1BXNA 4LF4J 3HHLC 3RBXA 3OHAA 1B4SA 5CQGA 2LA6A 1Y5IB 1IJFB 3TZZA 4ECYA 4ED1A 4L73A 3A8KA 1BWVA 2PDAA 1VQLS 2ADCA 3DKDA 4ZDNA 5HVHA 3M2VA 3FBFA 3UVJA 4DR7F 2B8QA 3IR6B 3W5ZA 1X4DA 1RB0A 3ENVA 2HQ3A 3GTYX 5E3RA 2XM3A 2DHSA 1F5CA 5IQ6A 1ZPVA 4AUKA 2XMAA 2PMWA 1SC1B 5HQ8A 1JLBA 3CCTA 3OFEA 3M8RA 5E41A 1GXTA 3ENQA 2DNKA 2W9CB 4ITSA 2FLLA 2MSTA 3PEJA 1U2FA 4KT0C 4PQUA 4NCBA 4Y0FA 4QOTA 1PAUB 1WDDA 1VYAA 1YJ9S 4ECTA 3FEXB 5J1PA 2J5AA 3NXZA 4H4KC 4B3TJ 3QWUA 3MTKA 4AE5A 1FESA 5KFFA 1MU2B 4CM2A 3ZTPA 1BWEA 3T5JA 3OTOF 2YWWA 4LJMA 1YITS 3WC2A 2A2CA 4RW4B 1Q53A 1K0VA 2NREA 3IXQA 3CJ5A 1QSYA 1VK3A 2OLWA 3KOAA 4CZCA 3C6TB 1U0SA 1PBUA 2HKEA 4K4WA 4XPCA 5A8WB 1WOPA 3FEZA 4ECSA 3Q2SC 4F7VA 2VODA 2OPPA 2V68A 3J7ZT 4DFMA 2R3VA 2JLFA 3PRBA 1R0AB 1KQSR 3H4BA 1KBRA 2ZH1A 3DMJB 3OXGA 4FXDA 3GB0A 1GT8A 4E98A 3P5TL 5A6WA 2A6OA 4OL8A 2BX6A 4DL3A 1NKBA 2FVPA 3ZTQA 5K5MA 1VI7A 1REVA 4PWDB 1FNMA 4K5SA 4B08A 2OGUA 1RISA 2P2CB 3TUIC 5IWAJ 2P6SA 1P6TA 2R2TA 2XS2A 2OD4A 4DL2A 4EGLA 4CLPA 2HSEB 5EHHA 3ZFVA 2V8PA 1VJWA 1Q7LB 4UOHA 4KAIA 3UD3P 2MYFA 1YRUA 3MGJA 1NPRA 1TVRA 3EWGA 4LIWA 4GO7X 4CH7A 4NLVA 2V4RA 1X8DA 2Y8WA 1S1UA 1U8WA 4DPXA 1HI1A 4RNMA 2MQLA 3JQJA 3M2RA 3HVWA 1TV6A 2DY1A 4I2QB 4P9SA 3H2VE 1RTJB 2IAJB 3CGIA 1GNKA 1S9EA 1N4LA 1IKVB 2MQNA 2CPZA 2YKMB 2JDJA 2CA9A 1RT4A 2X3GA 4MKAA 1OJ4A 2MDAA 2DISA 2UUAJ 4XTTA 3AA9A 2D41A 4JB8B 5CZVA 3DRXA 3EGNA 4DV3F 2BMBA 3FJ2A 4JI6J 4MMOA 1UZDA 4YB1P 5F9NA 3KK2B 2I8EA 4Q8EA 4RU2A 2J0WA 5KFYA 3LGNA 4OHZA 2OJ3A 2BANA 3QFWA 3QO9A 3S1TA 2XYGB 5AE3A 3BGFA 1X9SA 1UWBA 5HMYA 3Q8PB 2V0NA 1N88A 2LYVA 2IYIA 3IRXA 2B7BB 1XERA 3THVA 2V4QA 1VIOA 3PR4A 2NR0A 1WEXA 1QAYA 3EVMA 2X1BA 4WE1A 5H9FJ 4CLTA 1FKAF 3JSYA 2FJAB 2RILA 4P73A 3AJ1A 2BKNA 1AZSB 3HSZA 4N41A 1XNRF 3OVAA 1FKPA 2VIHA 2OSRA 5E2QA 1RWNB 1QTNB 5FDLA 4ZJLA 5IS2A 2VB6A 3VALA 3H5XA 3I5CA 3GCWP 4OX8A 2K2PA 4B02A 3UPFA 4FPRA 2E29A 2B8PA 1FA0A 3VVTA 3D0GE 4B9MA 4PXCA 3MM5B 1H2TZ 3PX6A 3R7NB 2XY7A 2IJFA 3TQ1A 4NRTA 5KFBA 4W92B 4HH0A 4GKJF 2DKOB 1RWUA 3FCVA 2OPQA 3FUYA 1UPMB 2W2QP 1FE0A 3CCRS 2F65A 1WF2A 1M5VC 1N33F 3IO1A 1RBAA 2DNLA 1YHQS 1FE4A 1S49A 4ED8A 1Q82T 4M95A 3A13A 4NZ7A 1SUQB 3VHQA 1FRKA 3OVSA 2DVIA 5KG5A 1FRLA 3KDNA 1H6KX 4NZ6A 4Y65A 2CWKA 2CUYA 3Q8UA 2YBVA 4RKUC 2RRAA 1A6LA 2MGZA 3ZZZA 1X4HA 3D9BA 3OFGA 2OPRB 2FJVA 3F56A 1LQ9A 1S6UA 2NSCA 1U1KA 2KYXA 4DG1B 4PUOB 4OFZA 4ZVRB 3OW2R 2D9OA 2YNIB 2CADA 4F2SA 3LP1A 2FHJD 4UTGA 1S72S 1N0UA 3ETMA 2P8IA 3V81A 1TFYA 1KLMB 1DFDA 4B17A 2QLWA 4OYXA 4USMA 1HR0F 3RU0A 4OYBA 4QCLA 4RW7B 1N5VA 1LW0A 3IC1A 4F26A 4DR5F 1K1QA 4CI0B 2R8HA 3R5AA 2PFFB 1N5YA 2QG9B 2PSZA 4KY3A 4OX7A 1H7WA 3FMBA 3M8PB 3CW2C 3IR7B 1VC0A 3OPKA 3GIJA 2ZWOA 1HQUA 2HS4A 4IFYA 3A3PB 4MJKA 2MZTA 2QLBB 3MMCA 4I64A 3OR2A 4M5GA 5L8RC 3PKMA 4HR2A 4BBYA 3D68A 2CJQA 4LF9J 4YHHJ 4TY8B 4WZMA 1H98A 2JEFA 1FRHA 1C1CB 4X4UA 4QYRA 2NXEA 4CO5A 1DTTB 1O8BA 2FZCB 3M8QB 3HD1A 4OYMA 3F41A 5LMNJ 5C42A 2BJ1A 3MM9B 2Q3PA 2W9BB 5I3UA 3Q24A 2V9KA 2VFSA 3V4MA 1N32J 4JI3J 5GAGU 4DUZJ 5T7LB 3RRGA 5LT5A 4M94A 1PAEX 4C3KA 1SPBP 3TAMB 3PX0A 1U24A 1LXNA 1AT1B 2AJFE 5HANA 4CLFA 1WHXA 2ZNZA 5LSRA 2CPFA 2Q79A 4OQJA 3PEHA 4B9SA 2DNHA 1B99A 3I9V9 1PJ7A 3D2WA 3NL0A 4CO4A 4JV5J 2FVRA 6FD1A 4RLEA 2LU2A 4C11B 5DM7Q 3J81Y 1G6BA 2YH1A 4K2JA 4DF8A 2ZC4A 1WORA 4NMXA 2KM8B 4FYXB 5DO2A 2APOA 3CCSS 2MKSA 3LUYA 4OV6A 4Q2MA 2LQBA 4EO8A 3V6DB 2EK6A 3RAXA 2ZJRQ 5GMDA 2GA7A 2VJUA 3HFZB 1S1VB 4MTPA 4OHVA 2WVEA 2D7SA 2NCKL 1FJEB 2KJWA 5KFRA 2U2FA 1FJ7A 3T1HJ 2QMUB 3EPIA 2PT0A 2J76E 3W2VB 3AOCA 5BYSA 4RJVA 3G6YA 3C6UB 1U1OA 3GFYA 3PM9A 2DXEA 3D7SB 5HL7Q 2RDJA 4B3RJ 5CYQA 3S6EA 4ECZA 2LEBA 1UFKA 1S4FA 1J27A 3IAS9 3NWRA 1YK9A 1T3OA 1YZ7A 1RKIA 2D3UA 1T9UA 4O0NA 1CJTA 3F0NA 7FD1A 4F67A 1U4BA 2F4VF 2NYHA 3TZWA 2HGLA 2ADBA 4YY3J 2IIHA 2AMCB 4LRBA 5GAHU 2XZDB 2P9GA 4LF7J 2DR5A 5DDOC 1MWQA 2BYCA 1IXKA 3ELHA 3U1NA 2CJAA 4YMEA 3G8TA 2LP4A 2ZC3A 1FX2A 3M2UA 2OEMA 2V9WA 3LAMA 1R0BG 2YX1A 3D3CJ 1KD1T 3C15B 3KHGA 4Q8FA 5KFAA 5F8JA 2W7AA 2AYMA 3UWTA 4I56A 1K0TA 1SJRA 5A8RB 3DLLQ 5HROB 3FCHA 4IQMA 4H4MB 4K59A 2OEKA 2V2QA 3MM6A 2R7WA 4GVLA 4LF2A 1NH8A 4TQSA 1Q7YT 1W2IA 2GS8A 2HW3A 1MWYA 2VPXB 3I9ZA 2DR9A 2NPIA 1YBAA 2RSQA 1TL5A 4PRFA 1U6ZA 1WKKA 2J0SD 2EFNA 3AD7C 5KFWA 2O3DA 2DR6A 2VFRA 2DXFA 2EBGA 1NDKA 1MSWD 2YQ3A 2VQEF 3OD2A 2W9AA 1RGVA 3P6YC 2DB1A 5H9EJ 4N47A 2HVEA 3R1HA 3PRDA 2R7VA 4JI0F 1NK6A 3HSGA 1RWVB 4DFJA 2WVBA 3EX7B 2CQ1A 3ONQA 2N4CA 1S1TB 1WUUA 2CZVC 2ZH2A 1VQOS 4J9MA 1KC8T 3BKFA 4WP9A 1XBWA 3PNIA 2ASLA 4DX5A 2XHWA 3A4TA 4JI2J 4DV0J 3DFEA 4QWDA 1XR5A 2YQ1A 4PQAA 5LMUF 3SI8A 2PN6A 2GX8A 1J5EJ 2CPIA 3PIPQ 4Q7AA 1XR7A 5C24B 4LF5F 1HQEB 4MAKA 2GJFA 2DK2A 3CVKA 2WSFC 2ZD1B 1OPZA 1FFWB 2VJVA 4K4VA 3HZEA 3L95X 1PC4A 2H51B 2BBEA 1FERA 4EYIB 3MECA 2VPYB 3D4JA 3Q22A 2DEJA 5HATA 2DGTA 1S48A 3DRSA 1WC0A 2EBEA 2XMWA 3G87A 3MAAA 2KT2A 2B9YA 1KSPA 2FC8A 1JLCB 1S6QB 2YNGB 1T9XA 5KFHA 1UZHA 1O51A 3MDFA 3R5BA 1NAQA 3WC0A 3LQVA 2ZUGA 4ID5B 3TWZA 3UCGA 2RDIA 2MZQA 1BD6A 3NBPB 5EUHA 1R8PA 2PA3A 3CTRA 1BC6A 4OJ3A 1VRQC 2JL9A 1RAHB 2ZUAA 4NE9C 4R5PA 1PJ6A 2AJ1A 3W9HA 4CO0A 1RTHB 4QU6A 2BABA 1SBRA 2OSQA 5CYJA 1VC6A 3H4DA 4B3MF 3JTPA 3MEEB 1Y11A 3CMES 5H9EK 2ZVIA 3MPVA 2R7RA 4I1TA 2K1RB 3JTOA 4X4QA 4CCHA 1V3RA 1Y10A 2BE2A 2FVCA 2NZ4A 5BR8J 1S7IA 2HPUA 1TL7B 4LSZB 5T14A 5ETPA 3OXFA 3A12A 4ZPVR 4I6WA 1VBZA 2AU0A 2OFHX 4DS5A 1RTZA 4C98A 3EPGA 2JHEA 2GVDB 3ITHB 3BGUA 3UW1A 1TZ0A 2KHDA 2XLIA 3BKTA 2FZKB 1H3DA 5IZHA 2KZZA 2WSEC 2CQBA 3RBDA 1NSKL 1TKTA 4ZMMA 5EX0A 1XNQJ 4TLQA 2UXCF 3BS9A 3KJVA 1JXLA 3JYTB 4DSJA 3AD8C 4PG5A 2DGVA 3BGRB 4I6AA 1PKUA 4FS2A 3GIIA 2J0QD 1LWEB 3MHYA 2XI2A 4NYOA 5DG8A 2AW0A 2XO6A 3OT9A 1HI8A 1FEEA 3KJQB 1LOUA 4WK3A 1VBKA 3LTOA 3GV7B 4CO2A 2CJKA 2DNOA 2R7SA 4DV2F 1AYEA 4URGA 2Y1LB 1NMEB 1JJ2R 5G4DA 5CYMA 3G82B 2VG5B 5K8MA 3SDEA 3A8EA 4F3OA 3T1YF 2E9ZA 3CD5A 4M5JA 1Q8LA 2GO9A 3DRPB 4NASA 3J81U 3L09A 2AGPA 5KT4A 1TP7A 4WTYA 2LEAA 4WFAQ 3MR3A 2GFFA 2ZVSA 5GAGI 1FKOB 3QIPB 3CJKB 5L46A 4KHRA 4KV8B 2VUGA 3UCZP 1UTAA 2NYIA 2DGOA 2DCLA 4MKBA 2N4DA 4USIA 4X4NA 1NK0A 1WACA 2NXJA 1WF1A 5IFMA 1RAFB 3FRZA 4DR1F 2X1FA 4JI7F 2ZH5A 2MJUA 3O6QA 2LQ8A 1TKZB 3O44A 1Z2LA 3ZZ0A 2FDNA 1Q8KA 1QAIA 5KFLA 1TMMA 2GIRA 1NU4A 1JMTA 2IRYA 2HMIA 2R7TA 1FI4A 4A8YA 3QT5A 4DS4A 3HKZD 3AOBA 1IUJA 5BYQA 1OMSA 2LVWA 3CJ0A 5HMWA 3KK3B 4FP9A 3HVTB 4ANDA 3GZ7A 2HS3A 3HHLA 5DQIA 3M30B 2HHHJ 5LOQA 2EKNA 2J8AA 3M05A 3FQLA 4ECUA 2Y9HA 4K0KJ 3AT1B 2PIIA 2CQ4A 3ILOA 3H5SA 2Z0GA 4RW8B 2ZEJA 1OSCA 1R0AA 2VC1A 1UJ6A 1LWXA 3D67A 2D3OR 2HHQA 3AA8A 3BQ1A 1PG5B 2ACYA 4HTJA 4O44A 1UWAA 2HWHA 3IG1A 5KFNA 2BM1A 1NM2A 2HHTA 4PWDA 1Q4RA 4DI6A 2Z2MA 1KVKA 1T7PA 4XIUA 5HQLA 4J9PA 4WFNQ 3I82A 1BQXA 2CDRB 4NLRA 1HD1A 4I68A 3IM9A 2ZH7A 1W26A 5GAHI 2WB1D 1T03B 3DLBA 2ZNYA 3BREA 3OHBA 1AB8A 2MB0B 1FK9B 3CCJS 2BW2A 5I4MA 3IWLA 3QQCD 1SJ4P 4UY85 2UZAA 3DOLB 4DPYA 4JOUA 4OMFG 1P9YA 4I2QA 1L3UA 1J5OA 4H4KA 1H0HB 2IAJA 1TQLA 3VVUA 3DLKA 4C4WA 3BSCA 3ISNC 3CC2S 1CG2A 1WHWA 2ZKUA 2VASA 2Q66A 5KFMA 4LF4F 4C8ZA 1UP1A 3PO5A 4KE5A 2MEWA 3WZ0A 1N54B 3NGTA 2PEHA 2MY8A 1SKRA 2HRYA 3SSQA 2DT9A 2MKJA 1SI9A 2FHOB 4RU9A 2YNFA 4DL5A 4J9OA 1M5OC 1Q78A 3W5YA 1IWGA 2MQQA 1JIHA 1K73T 4DV3J 2QN6B 2AEJA 2V8GA 4P2FA 2J7UA 3CJQA 1HNVA 2G13A 3VV2B 3TEHB 2DHAA 2OMOA 1JLEB 5F8NA 1Y4ZB 3T3FA 1AZSA 2IHR1 1X5TA 3SSRA 3MCSA 3HFVA 2IY5B 2MZSA 1SQFA 5HJYA 1FRJA 3Q0AA 1YJUA 4AXJA 1NZ8A 9RUBA 5E7OB 1VFJA 1JLFA 3M8ZA 5B0CA 5M2UA 1ZS6A 1OS5A 3MM5A 3MM7A 2WHOA 1VS3A 1RWMB 3GJQB 2HWTA 4WIIA 3ZNUA 5JXSA 4KH0B 2V4JB 2QFJA 2YX7A 4G65A 2JFDA 2B5JB 2AGOA 1NSAA 2ILZA 2O5DA 2RIJA 3MFIA 1OQ3A 3SV3A 1KHWA 1X9MA 3CWJA 3NOCA 1RBLA 2JRSA 3G86A 2HVIA 4CIOA 4GKJJ 3D1HA 2QT7A 1NZAA 2HAIA 1WOOA 2B4OA 4PCQA 4LF8F 2ALZA 2XSJB 2RF2A 4NPOA 2QEXS 1KHVA 2DR7A 2LQ5A 2E5IA 1N33J 3D0HE 4KGZB 3W65A 4R25A 1IKYB 3MR5A 5J2MB 2YKNB 1C4CA 2RMLA 2QLFB 2OPSB 3T41A 3ZZOA 3SCLE 5KFSA 2VPWB 5AXKA 2V5HG 1XEZA 4KSEB 5T41A 4YR3A 5DZ7A 4EYHB 2I5JB 4OLPA 4CO1A 2IRUA 1NK7A 1JLGB 5IWAF 2IA0A 4UOCA 1VBXA 4DLEA 4NLUA 5SUHA 2F8EX 3W7BA 2E66A 3RYLA 4ECVA 2NUUG 4K8RA 2F8MA 2HNYA 3MUTP 3BBBA 3CDAA 3D66A 4Z7YA 4ILRA 1SV5A 4K4YA 5LSOA 1SJQA 3PY8A 2KB2A 1GQEA 1FJCA 2AJ0A 3J7Z5 5GAEU 4FDFA 2KG1A 1I94J 2JFKA 2CQDA 4PEOA 2OAUA 1Q86T 1UFWA 4RW7A 4OX9F 2OMLA 2MMYA 2C2ZB 1RP5A 5MLCV 5LXYA 1NHUA 3CIMA 2XMTA 2KZMA 2DY9A 3DLEB 3PG9A 4PPZA 2VKRA 2C2NA 2CXEA 2VG7A 1HR0J 2XULA 3LA0A 1RT7B 4KGKA 1R89A 1RI7A 4DR5J 4TN2A 1HNXJ 2MSSA 4CYUB 4MYUA 1NSQA 4RBVA 5DDRC 1CJUA 3CSKA 2J7KA 1YKWA 1YSJA 4IFVB 3GIMA 1QM9A 4DU8A 3PFEA 3MR6A 5E3QA 1Y9OA 4C48A 2EFQA 4X2BA 2FJBB 4MIBA 3L4BC 2LFVA 2XS5A 5LXRA 4FVCA 1BUXA 4DV4J 1V6HA 2XY6A 4JUZA 1R7IA 4NLXA 3AOAA 4P7TA 2GVZB 2XZTB 3DC2A 4KKOB 3M8QA 1FWPA 3HJFA 3VTIA 2L41A 1FDDA 2O66A 2BOPA 1G1XA 4WXWA 3N6MA 1RXOB 3OSPA 3MM9A 2V67A 3TRGA 3M32B 2F40A 3M6WA 3OUYA 2EXUA 2B6AB 2GMLA 4RR5A 1YJ7A 5FIIA 1HWUA 2F8HA 1S1XB 3EICA 3GR1A 4HHJA 4PAAA 5AXLA 4M63A 3K5LA 5AE1A 1SIZA 4KPCA 5J1EB 1RYRA 3PYGA 3T1AA 7AT1B 3TAMA 3CD6S 1LFWA 4RUHA 5HP1A 1TKXA 2L08A 2NZCA 3DGPA 2ZDPA 1OY9A 3ZO7A 3TAQA 3MZIA 1PCAA 1RT6A 3PV8A 3ZZRA 2FJXA 4UUXA 1E6YB 4JP8A 2A10A 1RAAB 4QZVB 2OELA 1FWKA 1I51B 3UI3A 4DL6A 1ZTWA 1RBOB 4M5DA 2YKPA 3BN4A 4J7CA 2ZH8A 3E8OA 1IBLF 4UQTA 3H42A 1VC5A 4YFUA 1X31C 2DYAA 2HHPA 2DNGA 2CG4A 3OFFA 1RHKB 3HF5A 4C0HA 4C0OC 5CHCB 1AXQA 1HL6A 4G1IA 2K7KA 5LJ5Y 4B9TA 2V2ZA 3HULA 3W2VA 3AQOA 3OFHA 4ICLB 3OQ2A 4I7FA 3ZZYA 2B4VA 1V5IB 4DOZA 3QSYB 2L48A 2R8JA 3HLUA 3ZNJ1 3SQGA 3UD5A 3UD4P 4YQWA 4LQ9A 1HNZJ 1WDTA 3I5AA 2C2DA 3PW0A 3DLGB 4K4UA 2KT3A 3BN7A 2V6AA 2GJIA 1X0FA 4O3PA 3QLHA 1ZM2A 3NCPA 1NJZA 2SXLA 1SL1A 3O8WA 3BQ2A 3KLEA 4NLGA 4EK2A 4MIWA 2WB4A 1XMQF 5ETQA 1HARA 2VU5A 5B08A 4X4SA 3ADAC 4RW6A 4Q0BB 3RB6A 1RU1A 4OIXA 5KFJA 1O0PA 3DDNA 4IOAQ 2E1MC 2MKKA 4BC9A 3MM8A 2BJ7A 2IM0A 4NMLA 2MKYA 3C15A 2ZFHA 4CWBA 3EUNA 2E1CA 1P27B 1VDHA 4USVA 4PKDB 3SIPB 3UDCA 3OL7A 1JLAB 3R5JB 4I67A 2XMVA 4NCGB 2BJDA 5HROA 1RT1A 4PXDA 1VQ5S 2FVQA 1IQTA 2D9PA 3K57A 4IG3A 5A2QY 1IR0A 1U1QA 4OI0A 2HNZB 2UXDF 1RAGB 5KFUA 2YX4A 4IH6A 2BJ3A 4ZCKA 3KK1B 2DEIA 5IV3A 1I6JA 1DAXA 2OH2A 4JI1F 2BE7D 4Q2LA 3ENAA 4ZA1A 2WRMA 5C25A 1N32F 1Z2ZA 5AXNA 4X65J 5HBMB 4ZP6A 1VISA 1FJGJ 1YX2A 4DUZF 4H4OB 2U1AA 4JI8F 4V1Ak 1FT8A 1JXVA 3POTA 3DYAA 5G0RB 2B4UA 4TLRA 4ES2A 1U2CA 2VA3A 4USHA 2C2EA 5KG0A 1IQZA 1WSRA 3GILA 2RB7A 5HN0A 4ZITA 1EJ7L 1HBNB 1ZOTA 5F0WA 3DOKA 3CB4A 1NB7A 4P72A 1HBOB 2A2DA 3DN9A 1W2BR 3OR1A 2R42A 2X1GA 4JV5F 3MEKA 3NRBA 3G2XA 1RAOA 3IR5B 3O5TB 5DGAA 3HHEA 4HHUA 5C2CA 5DDPC 1MN9A 3CEDA 1X5PA 1LK7A 1K9MT 3CO9A 2RS8A 4PG6A 3OXLA 1Q5VA 2ROGA 1GMVA 1HD0A 3TANA 4OZ0A 1SC6A 4LF5J 4DEZA 1RT5A 1CJKB 3T1HF 2PGCA 2AV5A 2EFGA 4RUAA 1VQ6S 3W1YC 5IT9Y 4OI4A 1JLCA 2BKOA 4G1QA 4B3RF 1WHVA 4OZ1A 5E33A 2HK3A 3EE3A 4I2PA 2FJDB 3A3NB 3BO2A 2DHHA 3CCVS 4S0MA 3FKBA 3TJ8A 1HMVB 3CPWR 4ID8A 1F5BA 4C8LA 1N6QB 4YY3F 1D3WA 4EZ9A 4LF7F 4DV5F 1KRPA 1HHSA 3ZTSA 1N36F 5F9LA 1VHFA 3FK4A 5E3AA 1M90T 4CH1A 1QVGR 1G4CA 4USUA 1RYSA 4G6VB 2VFTA 1S6PB 4Z7CA 2LXUA 2BACA 1WC3A 3K8WA 2J0XA 1JJHA 4FS1A 3HSJA 5F3ZA 5GAEI 2HLUA 3QT7A 5D15A 4KHMA 2A18A 2EFVA 3VGSA 4ED3A 3DOMB 2GQCA 1R27B 2QSWA 3IWNC 4X62F 3MPYA 3BQ0A 3EXCX 3KUHA 2R2RA 2CVEA 5J2QB 2UVVA 3MUMP 1HPZB 3MEGB 2YNHA 4DR6F 3J7AN 4DR3F 2OFGX 2AKWB 3V5RA 2LQJA 2RRNA 3OL8A 3DRRA 1XIQA 4X84A 2OTJS 4B3OB 4HI1A 3H59A 3M9NB 4OHYA 1U09A 4P10A 1RT2A 4CO3A 1Q5YA 2UXCJ 1DLOB 4EU0A 3LP2B 4MFBA 1RWKB 1S9GB 2Z58B 4Q5VA 3ZTOA 1RTIB 1I5OB 4PXBA 5BYRA 1WI8A 3QGHA 2FY1A 3LP0B 4ZS6A 3HHLD 2WVDA 4KYZA 3CC7S 1UFLA 2G9OA 2H4WB 1F5AA 2C2OB 2YKAA 3LO3A 2ASYA 4DV0F 2CQ0A 4CM0A 3GU0A 1NJIT 1APSA 4C8OA 1F9FA 2BQRA 3IFEA 3NLCA 4ENOA 2JLEA 4C8MA 2KJVA 5J2NB 3R97A 3H2UB 3PFOA 1HWKA 4LFCJ 3K5OA 2AJ4A 3ILJA 3EZOA 3JTNA 5D4PA 3US5A 3L3CA 1HQ2A 2DRDA 1OSDA 3KLIB 2WK4A 4OJGA 4R0JA 3SFUA 4LBHA 2DHGA 4MYTA 3I55S 4KFBB 4QIWD 1TKZA 1T0TV 3G8SA 2XGQA 2NUHA 2FB0A 1ZETA 2NSBA 1KN6A 1FFGB 3GQCA 4DR1J 1EQ0A 3MPWA 3S8SA 5E3CA 5IM0A 2WOMB 1X0PA 1MROB 3VGVA 4QW8A 4FF2A 4CNYA 1CJVA 1JKHB 4OI1A 2EC2A 3AY0A 3GYXB 3M30A 4QW9A 2HFOA 1N0VC 4O4GA 1T05B 5L9XA 1LK5A 4WK1A 3F44A 3GR0A 2CPYA 3BBFA 2V2VA 3D1QA 3ZZPA 1NHKL 1U1LA 3VGTA 3D28A 3D6HB 3CD0A 4JYAJ 1RSCA 5J2PA 5BR8F 3MCNA 3RR8A 1T9YA 1IM4A 1AROP 3SV4A 2L9DA 4QIVA 4QIEA 1CS4A 3FSIA 4FF1A 4UUWA 5F0UA 2DRAA 4J90A 1WI6A 3UVJB 1HWLA 3I32A 1VQYA 2W4DA 3TUJC 4EEYA 2HQDA 2AP6A 3TNVA 1VRUA 3GYGA 1OY6A 5LL6d 4QIFA 2XNQA 1JLBB 5A2QU 3OTDA 1S0MA 2HWIA 1XNQF 3HMJG 3KLFA 2AYBA 5B0AA 1T03A 1SKUB 5KTQA 5KFKA 2H4YB 1YJVA 1VQNS 3K58A 2HQCA 3CJ2A 1UW9A 3R6LB 4PG4A 2HG4A 3KLGA 2C42A 2ZH6A 3MURP 2LCWA 4ATNA 4YDXA 3W5XA 3MCMA 3U27A 2UVRA 3JSMA 4J9NA 4EBEA 2FY8A 4IDKA 4DCPB 2ZDOA 1DJ0A 3U1LA 2HNDB 3G6VA 5IT0A 4LUBA 4KIAA 2Y0SD 3OL6A 3TUPA 1KQGB 1B64A 4AXIA 2JOQA 2IC3A 4MKVA 4FYYB 4RW9A 4IG0A 3ILLA 3RTVA 1XJWB 4X4VA 2OPPB 2KH9A 4MK7A 4OZLA 4KGVB 3K5PA 3SYZA 4KR0B 1OO0B 3ULHA 1S1WB 4F0HA 5B0BA 3KG0A 4LF6J 3IGVA 4YR0A 3GG1A 1D0EA 1A0OB 2BOAA 3KLHB 3MPDA 4ELUA 4RO0A 3K0JA 2YWEA 2RUSA 1C4AA 2DH7A 3B54A 2E1AA 3IS9A 3UNYA 1EKSA 4Y2CA 1FDAA 4F4AA 2YPZA 1V3SA 4ZPBA 3PO4A 2WBRA 5EWFA 4X4TA 3EGVA 2HBRB 4XAKA 2JH3A 3K7RA 2WONB 5BXIA 1U2RA 1TVRB 2XLJA 2DNPA 3RAQA 2CPEA 2J6TA 4DV6J 1UJ4A 2V4JA 2LMIA 1S1UB 1NCLA 2C2KB 2JJ4D 3M2RB 1SH2A 3GFHA 3LALA 1TV6B 2CYYA 4C7QA 1NK9A 2LDYA 2J6SA 3GE9A 1NDLA 1FDBA 1S9EB 3MMBB 4DSLA 4WKRA 2HHHF 4YB6A 2H5JB 1G7CB 2QA2A 4OZ3A 2E9TA 3EGWB 1RT4B 1GEHA 2ILYA 4K0KF 5GVQA 3DCAA 4A46A 3HZGA 1CLFA 2G2YA 3AFGA 4CT8A 2AQ4A 1KWMA 1XN9A 2LECA 2XCAA 1IKXA 1AA1B 4OZ2A 4ZPWR 2QL9B 2FLNA 2YKNA 4F25A 2BANB 2BDPA 4LF8J 1RE1B 4DPWA 1UWBB 2O01C 1S59A 1R8HA 2KXHA 3IRXB 2BR0A 2CPXA 1SCJB 1GFWB 2I5JA 3GSIA 1ICEB 2MZJA 1XC9A 3FMWA 2FLPA 1P1TA 3R7SB 5L1JA 1ELOA 4C9DA 2DBBA 4U7UD 2XSFA 3MAHA 2V94A 1FKPB 4Y2KA 1IBKF 2COLA 3NAIA 3NS6A 3RUBL 5HQMA 3ILIA 1UCNA 1U1MA 3MOZA 2PFDA 5KT6A 3UO0A 2XY5A 2IFXA 2Z30B 2HIQA 4LMZA 5KG7A 1WJ9A 1MG7A 2RKIB 4L3KA 5KFTA 5FJ4A 1CEZA 4P7VA 3GV5B 2RD5C 2CDQA 2OIHA 1YBUA 4KHPF 4DQPA 1H38A 1N8RT 4FBTA 3QWPA 4ZVFA 1NPPA 3WBZA 1VK8A 3RRKA 5K14A 5KT7A 3K59A 2HFZA 4K4XA 4ZN1A 4CTAA 4F36A 2XLKA 4G3IA 3PR5B 1HNWJ 4DU7A 1RJJA 4O3NA 4OX9J 3W62A 3UE2A 2L9NA 1S57A 4OX6A 1R8BA 2EK1A 4DQRA 1VQ4S 3HSDA 2MZRA 4CYUA 2CJ9A 4U9RA 1W25A 2HYIB 1KOOA 1IWAA 5DG7A 5L38A 5K8PA 2WSCC 1GTHA 1LEOA 1U48A 4KB7A 3PX4A 2M9KA 2NXNA 2DCUB 2D69A 1TL3A 4E2FB 1AFJA 2JSXA 5ETTA 4LRDA 2MGZB 4HACB 3QSIA 1ZZNA 2GVZA 1BHNA 3W63A 5KOWA 2PC6A 3N4WA 4NLSA 1C1BA 4RBTA 4C97A 1C0UA 2BRLA 3EGZA 2XS7A 2DGQA 2RQMA 2E7VA 2MTLA 1FRXA 3PDNA 3M32A 4IQXA 3GG0A 1FHTA 5CZXA 1LW2A 5IV4A 2GZOA 4BS2A 2B6AA 2MQOA 3PW7A 2VZ9A 3M1VA 4C0BA 2V63A 2HURA 4TXSA 1TU0B 5HVGA 4E8UA 1UVLA 3V81B 4OYOA 1BQNA 3QRQA 3TR5A 1TK0A 3V6JA 3R6GB 2CG8A 3GJSB 1LW0B 3N9UC 1F2HA 4ZHRA 4KGMA 4IRCA 4WIQA 3R9LA 1N5YB 5DG9A 3GLJA 2I6WA 2VFUA 1FVQA 4A8OA 4XPEA 1UKUA 1FNXH 2EEYA 1RKJA 1GMWD 1ITPA 3M8YA 2DJWA 4LSNA 1U45A 4ER8A 3HK2A 1ZBTA 5E5NA 2YWKA 3W2WA 3FFIA 4I69A 4ZVUB 2HQFA 1EETB 1URRA 1HQUB 4ED0A 1FO1A 5CCMA 4IFYB 4NA2A 3MMCB 5ETOA 2VKZG 4M5LA 3VCDA 4L76A 4ED2A 5CD4H 4NI2A 1IBLJ 4CP5A 1HKAA 3NNCA 4DZDA 2E5JA 5C42B 1MMNA 1ZM9A 4ZPTR 1KP6A 1I94F 2D1CA 1QD1A 4FNHA 1HBMA 3HP6A 1UL3A 7FDRA 5H9FK 5DLGA 3BJYA 3FGVA 4B3SJ 3G9CA 4ETZA 1F9EB 4OLOA 2OI2A 4WJBA 2HQGA 2ZITA 1SH0A 1U0HA 3I0RA 3PJWA 2BZ2A 1GTEA 4HTIA 1KTVA 4L74A 1D9AA 3E3XA 9ATCB 5KFZA 4DPUA 2Y8YA 1SL2A 1KOHA 5H1SV 3MMAA 1VJQA 4P52A 1IM6A 4ED4A 2CQ3A 2AJ2A 1HNXF 2RU3A 2CJYB 1CC7A 1AFIA 2DH8A 2HFNA 1RWXB 1IVZA 1XMQJ 4OYWA 3VGUA 4USTA 1B3TA 2EFPA 1M5PC 4IR1A 2RQKA 3BM7A 4DV4F 2ATCB 1JLAA 2E7XA 2FLOA 3ICLA 4DN0A 3H98A 3CJTA 2KG0A 2RH3A 4ZVQB 5IC6B 1V3ZA 2AX0A 2JVRA 2KM8C 5HVFA 2UV8G 2VQFJ 4F2RA 3MXHP 5M2PA 1WSVA 1M5KC 3L7UA 2HLTA 2OP5A 3CDEA 1RADB 2KRBA 1QUVA 2BM0A 3MPUB 5HLFA 2LQ9A 4KC5A 3FVYA 3T5LA 4DL7A 4LRCA 5F8LA 3QJJA 1XTZA 1WOSA 2H3EB 1M0SA 4W90B 2UXDJ 4H4OA 5DRKA 3H5YA 1NK8A 3LWMA 2GIQA 1NJXA 2ZHBA 2MQ8A 4JI1J 4HL9A 3EVOA 3LF0A 2ROEA 3HXMA 4AL7A 4RWWA 5CYQB 3OTCA 1PO6A 4CLZA 4JI8J 3H25A 5KFOA 2BXJA 5DS7A 3NEKA 3G6ES 3TARA 3AQPA 5LJ3Y 1HBOA 4C8KA 1IBMJ 3GFXA 1VLYA 4A8KA 2ALYB 3CJ4A 1SKWA 4L75A 5D0GA 1QAXA 1KS2A 5GMEA 3Q8SB 2R8GA 1IR1A 3MEDA 1CULB 1YTYA 2EC0A 2ZOMA 2XZWA 2AWZA 1WTBA 2LKZA 1RA6A 3BYPA 5I42A 4M5IA 2QSFA 4FVMA 4OI3A 1UEUA 4ZP8A 4J91A 4ZVGA 4C2MA 2V69A 3M2UB 3QAUA 3IAM9 2MKHA 3KNAA 1LWCA 3PYFA 1LKZA 3KYLA 1JLQA 1NK4A 2ZJQQ 3HVAA 3R1LA 2Y1JA 2F9DA 4ELVA 1DQAA 1HYSA 5AT1B 2D74B 2NQPA 3V4IB 3P3DA 3Q23A 1JX4A 2A0FB 2LU1A 2N3OA 4WCEQ 1S4EA 3MM6B 3ZZUA 2G4BA 1UVKA 4ZLNA 1DY3A 1HNZF 3QMQA 2M70A 2HHXA 2I38A 1M1GA 1SJFA 1PJ5A 4O3QA 2OO4A 4AQYJ 4GC7A 2AF6A 4O3SA 2DGUA 1N6QA 5DQHA 1TK8A 5KFVA 5HJXA 3HVRA 4HH1A 3LPYA 2GGPA 3GJTB 4UOGA 2UV8A 5HMZA 1RA7A 1F3FA 2QC3A 2AIRB 4K50A 2G1HA 1IBCB 3Q8QB 3V6KA 2VG6A 2F1FA 1H72C 4KO0A 4ZVSB 2R2UA 4OZNA 2L3MA 1U1PA 3PHEA 4DV5J 2CQCA 2C3PA 1RAJA 5FD1A 3GSDA 1N36J 1VQ9S 4LFAJ 2R7XA 1T94A 2KKHA 4R8UB 4WWSA 2BUNA 1KEKA 4PWUA 1RACB 1VHIA 1PYSB 1WF0A 4K7QA 1WWHA 2KU7A 1T9VA 3HM9A 4JV1A 2VBWA 2EW9A 1AUSL 3T19A 5J2QA 1HPZA 4CLWA 3DM2A 2M3DA 5D3GA 4X64F 1QE1A 2B56A 2NXCA 4WFBQ 1IJEB 1PGZA 3N5FA 5ETSA 2Z8QA 1S0OA 2J9DE 3O2IA 3VZIA 2E5LF 4X62J 3MECB 4X65F 4B3OA 2E5HA 1FJGF 2KN4A 4DR6J 3DRSB 4DR3J 4Y6IA 3QGIA 3H40A 4IOCQ 4CDIA 4DCOB 4MK9A 5U47A 2ZH3A 5DGBA 2CFXA 5CCLA 4I4BA 3LP0A 4YOEA 4UOFA 4EZ6A 3DI6A 1U49A 1SH3A 2QV6A 4HVZA 2QX0A 3D1OA 4HLBA 3EZ5A 5L9NA 4F0KA 4R5PB 2DITA 4WTOB 3AH6A 3D0IE 5ETRA 1HBUA 2VBYA 5CXTA 3PJXA 4RPFA 1KVIA 5D4LA 2CNKB 4YB7A 3CCZA 4KH1B 2WAQD 1P1LA 1FFSB 3H7HB 3I4HX 2QA4S 3I6PA 1T02A 4NYPA 4EUVA 2BE2B 1QUPA 4DLGA 2G0IA 3C66A 4CRJA 2AEMA 2M88A 4BDPA 5KG3A 4DSFA 1VQSA 4LREA 1KVJA 1LWFA 2PMZD 4HEA9 2B43A 4QQBA 1RTDB 4FZVA 2YVSA 1WC6A 4G1PA 4DMZA 2YPYA 1RHUB 2W4CA 1Z1ZA 1VGYA 3W3SA 4ZPDA 2Y1RI 2RAQA 1HW8A 4GVBA 3H90A 1E6VA 2RRBA 3O3LA 3NCRA 1EQMA 3KJVB 2FJEB 3B78A 2J9DA 4M5NA 4ZIWA 1NHVA 4M5HA 2WOMA 2PD1A 2M8HA 2FGOA 4K4TA 1KFDA 2EPIA 3CJRA 2JEIA 4DV7F 5KFDA 1KONA 1HNIB 4ZN3A 2E7WA 1VR6A 2E44A 2BRKA 3QT8A 3TAPA 1FXDA 4DUYJ 3AXMA 4KTQA 4LR8A 4U7UK 2B7CB 4MT1A 1T11A 3HHKA 2R9LA 2HRTA 3MWBA 5CYMB 1OQ6A 4BWJA 5L1KA 3T9NA 1GXUA 3SDEB 1YIJS 2C3YA 1VMBA 3M7VA 3CDBA 2W7OA 3C16A 3HT0A 1F1BB 2YXLA 5KFGA 4DQQA 4CLUA 5RUBA 3KHLA 2PI5A 4LQ3A 2VD3A 2IBKA 3Q8RB 2RHSB 1VRTB 1Q1KA 3OTBA 1JK9B 5CH7B 2FGCA 2Z2YB 4K4SA 1KNZA 4EWTA 3QATA 2V34A 2AGQA 3DDIA 1RHRB 1FD2A 1VQ7S 3J7YU 4YS2A 1NKCA 1BE4A 1DRZA 1SB6A 3P5BP 3T6BA 3I4PA 1X60A 4LVNP 3CXCR 4A8MP 1BQMA 2MLZA 2CJBA 1TL1A 3EVWA 5D77A 3FRYA 3P49B 4OI6A 2YKQA 2XO7A 8AT1B 2HMIB 1YJRA 3A3OB 4NYZA 3ISND 4I6YA 4ZCIA 3HDSA 4DPTA 3PJ9A 3TW0A 1C2PA 2BJEA 2MQPA 2HNDA 1WEYA 3IRWP 3ZXWA 1YI2S 2N7CA 3CULA 4LIRA 3LANA 1YQHA 4WFXA 4LSLA 3CF5Q 2J7WA 3HHLB 3VR1A 4YEAA 1HWIA 1N52B 3D6FB 3LAKA 3NGUA 4ZKAA 3MD1A 2GC8A 5THWA 1FEHA 4OI2A 2M52A 4LFCF 2B9WA 2DXDA 1S1WA 1N5QA 4O23A 2QE5A 4PWWA 3KLHA 4MH8A 4ECQA 1RCOB 3DHXA 3WIUA 3UQSA 2UU9J 1EP4B 4O44B 2XMKA 2M4MA 3IG1B 4URSA 4RNNA 3C14B 1M1KT 2AZ3A 4H54A 2DO0A 3BF4A 4A8FA 2FPHX 2VPZB 4FPIA 2UUBF 1X4FA 3QZ8A 3ENWA 2VL1A 2LDIA 1PILA 2W9CA 2W8LA 2RE1A 1M5SA 3MCOA 3LH2S 2WONA 4CLLA 2IVFB 1S5ZA 4R0EA 3VAJA 4NLWA 3B6BA 3IGNA 4N76A 1RWOB 2QTWA 2ASJA 3PW4A 3LPEA 1J5OB 1I3OB 4BWMA 3MMBA 3DLKB 2DRBA 4PXEA 4C8NA 3C19A 1MU2A 2WTFA 3PW2A 2P6TA 4L6V3 2LLZA 5LSLA 1EX8A 3WX4A 2KXNB 4LVOP 4IYQA 1NRKA 3B4MA 4NA1A 4OV1A 4JYAF 4RW4A 1YZ6A 3GONA 1FWLA 3C6TA
chains in the Genus database with same CATH topology
1U0HB 5D0HA 3C14B 1WC0A 1AB8A 4OZ2A 4CLZA 2GVDB 4CM2A 1FX4A 4CLWA 3MAAA 4OYBA 2WZ1A 1AZSA 4CLTA 1WC5A 4P2XA 4OYWA 4USTA 1WC1A 3MAAB 1WC4A 2W01A 1AZSB 4NI2A 3ET6A 3C15A 3UVJA 1FX2A 1CULA 5D0RA 4USVA 5D0GA 3ET6B 3C15B 4OYOA 1CULB 4WP9A 1CJVB 5D0EA 4CLYA 4CLLA 3C16A 1CJUA 4OYZA 3MR7A 1CS4A 4CLUA 1WC6A 4WP3A 1TL7A 1CJKA 4OYAA 4NI2B 4USWA 3G82A 3UVJB 4CLFA 5IV3A 4USUA 4WPAA 1U0HA 1Y11A 1WC3A 1YK9A 2GVDA 2GVZA 4P2MA 3C16B 2QV6A 3R5GA 4OZ3A 1CJUB 4CLSA 2GVZB 1Y10A 2BW7A 1CJTA 1CS4B 4P2FA 1TL7B 4WP8A 1CJKB 4OYIA 5D15A 3G82B 1CJTB 1YBUA 1YBTA 4OYPA 4CM0A 3C14A 4CLKA 4OYXA 1CJVA 4OYMA 4CLPA 5IV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0H B;  5D0H A;  3C14 B;  1WC0 A;  1AB8 A;  4OZ2 A;  4CLZ A;  2GVD B;  4CM2 A;  1FX4 A;  4CLW A;  3MAA A;  4OYB A;  2WZ1 A;  1AZS A;  4CLT A;  1WC5 A;  4P2X A;  4OYW A;  4UST A;  1WC1 A;  3MAA B;  1WC4 A;  2W01 A;  1AZS B;  4NI2 A;  3ET6 A;  3C15 A;  3UVJ A;  1FX2 A;  1CUL A;  5D0R A;  4USV A;  5D0G A;  3ET6 B;  3C15 B;  4OYO A;  1CUL B;  4WP9 A;  1CJV B;  5D0E A;  4CLY A;  4CLL A;  3C16 A;  1CJU A;  4OYZ A;  3MR7 A;  1CS4 A;  4CLU A;  1WC6 A;  4WP3 A;  1TL7 A;  1CJK A;  4OYA A;  4NI2 B;  4USW A;  3G82 A;  3UVJ B;  4CLF A;  5IV3 A;  4USU A;  4WPA A;  1U0H A;  1Y11 A;  1WC3 A;  1YK9 A;  2GVD A;  2GVZ A;  4P2M A;  3C16 B;  2QV6 A;  3R5G A;  4OZ3 A;  1CJU B;  4CLS A;  2GVZ B;  1Y10 A;  2BW7 A;  1CJT A;  1CS4 B;  4P2F A;  1TL7 B;  4WP8 A;  1CJK B;  4OYI A;  5D15 A;  3G82 B;  1CJT B;  1YBU A;  1YBT A;  4OYP A;  4CM0 A;  3C14 A;  4CLK A;  4OYX A;  1CJV A;  4OYM A;  4CLP A;  5IV4 A; 
#chains in the Genus database with same CATH topology
 1YWX A;  1H7X A;  2W2O P;  2YNF B;  4LRA A;  5A8W A;  2H9Z A;  1FRM A;  4F8R A;  1UA1 A;  2YKO A;  2FVS A;  3DXB A;  5DLF A;  2W2P P;  1O5J A;  2KRR A;  2KVI A;  1NB2 A;  1TAU A;  2HGN A;  3DMJ A;  3BSN A;  1RAI B;  3PCO B;  4OJH A;  1HNV B;  2C28 A;  2ZBR A;  1ZZF A;  1GXL A;  4KGX B;  2QA1 A;  1U8S A;  2UUC J;  4ZCL A;  1R6V A;  2FYX A;  2AT1 B;  1AUD A;  1R8A A;  4F50 A;  2QZ8 A;  4OZ5 A;  2CZ9 A;  3PKY A;  1T9W A;  3H20 A;  4DL4 A;  1B0V A;  3OV7 A;  4WXO A;  2RUG A;  4A48 A;  5GAD U;  3VQS A;  2MPU A;  1JLF B;  2RKI A;  1SC4 B;  1FXR A;  3BSO A;  5ADZ A;  3CCL S;  4D3H A;  3UDE A;  3CO0 P;  4LBP A;  5KT3 A;  3MM7 B;  1IBK J;  5M2R A;  3KNG A;  4N56 A;  3DXS X;  1Y00 A;  2XGP A;  1TKD A;  2AEF A;  1XK8 A;  1RCX B;  5JUM A;  1VIX A;  1RTJ A;  1HHT P;  5D0H A;  1L3S A;  4IUF A;  1IKV A;  4ZVO B;  3R5C A;  2YTC A;  2YKM A;  1R0C B;  4O0I A;  4KHP J;  4ECW A;  3SCI E;  4ZVP B;  2UVU A;  2FTR A;  2QMX A;  1X4A A;  4ETX A;  4P2S A;  5EGY A;  2G2Z A;  2O67 A;  3ET6 B;  1VQP S;  2RF2 B;  3KK2 A;  2GIF A;  3SEO A;  4DQS A;  1VBY A;  4DJB A;  2YWF A;  2FZG B;  2KXF A;  1WHY A;  4LF6 F;  4NLQ A;  3BH6 B;  4TYB A;  5KFQ A;  2DTJ A;  3T5H A;  3NWG A;  1X4C A;  4HAC A;  2JEG A;  2HHS A;  2C2R A;  1KQF B;  5HAO A;  2RU9 A;  4QWC A;  2ZE2 B;  3U1M A;  2XI3 A;  3RBZ A;  2YH0 A;  2F3J A;  5KG6 A;  4URQ U;  1OY8 A;  1W7W A;  4FF3 A;  3QT6 A;  3KG4 A;  2HNY B;  4UW2 A;  3NGK A;  1SV5 B;  3OLB A;  4DV6 F;  4A4J A;  1NH7 A;  1NUE A;  2HBQ B;  2OD6 A;  4K4Z A;  4F4Y A;  4EFA C;  3TZY A;  2F5G A;  3F73 A;  4YUD A;  1OWX A;  3SSS A;  5EDW A;  2VHG A;  3TYT A;  2ROP A;  4DBQ A;  5ITH A;  1HHQ A;  1WKJ A;  2WVC A;  2Z2L A;  4DPO A;  1FVS A;  2VG7 B;  2IJN A;  3PAC A;  1N34 J;  1FXL A;  1SC3 B;  1HWJ A;  2M7S A;  1SUQ A;  4JI5 J;  4PAB A;  4Y2M A;  2DNQ A;  5IOL A;  4J9U E;  2KFN A;  1CJU B;  2DNZ A;  1EET A;  3EDQ B;  3M6U A;  2R7O A;  1ZM4 A;  2GAH C;  1SQE A;  3PHT A;  3K17 A;  3VF0 B;  2EWH A;  2FJW A;  4AL6 A;  3KXD A;  3PYD A;  1G2E A;  4AYB D;  2BEF A;  3L7P A;  2VBX A;  4NL5 A;  1EKR A;  2JLG A;  4L3N A;  3EZU A;  4P2X A;  1DTQ B;  5DM6 Q;  4KJI A;  1BY9 A;  4NXM J;  4LF1 A;  4F02 A;  2OPR A;  3TJ9 A;  3R2D J;  4ZLP A;  4DSK A;  2UUT A;  2QFI A;  3G96 A;  4TU7 A;  2R8K A;  4PR6 A;  3G4S S;  4QU7 A;  1NJY A;  5D0E A;  3R3T A;  1D9D A;  1NPK A;  4WZQ A;  3JQK A;  4FKX A;  1QSS A;  3OUY B;  4DG1 A;  4PUO A;  1FRI A;  1RDR A;  1B0T A;  4YP3 A;  1D1U A;  2YNI A;  3OLA A;  2ZKT A;  1Q79 A;  3JSR A;  3N5B A;  1T95 A;  3WDO A;  5C2G A;  4BHQ A;  4M5K A;  4J9K A;  1KLM A;  4J9L A;  1DQ8 A;  4A8Q A;  2DNY A;  5KAK A;  4ZJO A;  2B9E A;  2GJ2 A;  1HNW F;  1LNQ A;  3RJM B;  3T9Z A;  3T6J A;  4FNI A;  5KG4 A;  5KOX A;  5HP1 B;  3FSX A;  2IMW P;  1TKX B;  4RUC A;  1CQM A;  1V9O A;  4NRU A;  3DGP B;  3R7B B;  2VV5 A;  3BH7 B;  5KT2 A;  3MF5 A;  3EDR B;  3MUV P;  2DH9 A;  3J7Y I;  1RT6 B;  2IYG A;  1H2U X;  4RUB A;  4X66 F;  4PPD A;  1C0T B;  1FD8 A;  2Y1I A;  1HW9 A;  2MLY A;  4ES3 A;  2CNL B;  3NS7 B;  4TQR A;  5A0Y B;  4ZVE A;  3M8P A;  3O1L A;  2CNO B;  1JB0 C;  5F41 A;  5D0R A;  4ANC A;  3EMT A;  3TX0 A;  3FDS A;  1WG1 A;  4J37 A;  4M5D B;  1QTM A;  2PA8 D;  2ZM6 F;  4K5R A;  2GHV C;  3N6L A;  1RT3 B;  4J5O A;  1NO8 A;  2DPJ A;  1T8E A;  1UVI A;  2R4F A;  4TY8 A;  2HVZ A;  2W1B A;  3S01 A;  1C1C A;  3P4U B;  4Y00 A;  1DTT A;  2KDO A;  3CNQ P;  2HS0 A;  1LV5 A;  1X9W A;  2C2M B;  3D3B J;  1QVF R;  5IXU A;  2JVO A;  2VH7 A;  3Q86 A;  2ZH4 A;  5JVG Q;  2W9B A;  3R5G A;  4I7F B;  3AOD A;  1N5T A;  1QJH A;  3B4D A;  3M9O B;  3K8V A;  4ZLL A;  3SQG B;  4DWI A;  3Q2T C;  2BVZ A;  4N77 A;  2GV1 A;  3GP9 A;  5T7L A;  1YGY A;  2CPH A;  1FNO A;  3A8J A;  4GMK A;  2P9C A;  1DHM A;  2ZBP A;  1A7G E;  2FD2 A;  2UXB J;  4AFF A;  3CC4 S;  1SXL A;  3A8I A;  3QLH B;  3X3U A;  3OTE A;  1NXI A;  2HK2 A;  4DN9 A;  3RBE A;  3OL9 A;  5EN1 A;  1CUL A;  3KLE B;  3THT A;  4DSI A;  2V8H A;  4ELT A;  1UET A;  2VFV A;  3NG8 A;  4RW6 B;  1KTQ A;  1AW0 A;  1F0X A;  4PG8 A;  5F3T A;  1GMU A;  2AYG A;  4HHH A;  3MM8 B;  2I2Y A;  2EFO A;  5FLX Y;  4C11 A;  4YR2 A;  2H65 B;  5KFP A;  3KWM A;  3VQT A;  4QYZ J;  3VAI A;  5KFE A;  3CD7 A;  4NLO A;  2VOP A;  3QRR A;  1B0P A;  2BA9 A;  4OHX A;  2DGW A;  1RT1 B;  2XWX A;  1Q16 B;  4KRW A;  5CA5 A;  1VQK S;  3V6D A;  3JS9 A;  4IG3 B;  3V4I A;  2HHU A;  1NDC A;  1S77 D;  2HAF A;  1S1V A;  3BGL A;  6FDR A;  2GW8 A;  2K3I A;  4UQG A;  3FBE A;  4WFY A;  1JNZ B;  1VLO A;  5HMX A;  2QLJ B;  5DJB A;  5A6P A;  3NKY A;  4ZPA A;  3OJS A;  4B3S F;  2F9J A;  5C25 B;  3C6U A;  4QPT A;  6AT1 B;  4X4P A;  4TY9 A;  4P75 A;  3JSB A;  3POT B;  3DYA B;  2N82 B;  2HVH A;  3G6X A;  2ZBC A;  5B09 A;  3D6T B;  1V5V A;  2ZBI A;  4CLY A;  2FUG 9;  3PRV A;  2EG1 A;  2VBZ A;  4ZLJ A;  3UDV A;  3CJ3 A;  3JXO A;  3BPS P;  2F7V A;  3DOK B;  4CNZ A;  3NGD A;  1REG X;  2GCF A;  3QJL A;  1MW7 A;  2K3K A;  1WEL A;  3R8Y A;  2HZV A;  4YN3 B;  2W25 A;  4C8Y A;  1QSL A;  3OR1 B;  5GAD I;  3DLJ A;  1H73 A;  5B0F A;  4IKA A;  5ETV A;  4JBC A;  4R8U A;  2IM2 A;  1RUS A;  2CQ2 A;  2R8I A;  4E0D A;  4CLS A;  5IC4 B;  3N28 A;  4WP8 A;  1NLK L;  1Q8I A;  1QY7 A;  1RK8 A;  1OPI A;  3DLH A;  4LFB J;  3MMJ A;  2ERR A;  2VQF F;  2RDD A;  1RWP B;  3K5N A;  3CIZ A;  3W8P A;  4UZB A;  2C3U A;  2L9W A;  4IH5 A;  2FIU A;  2WZ1 A;  4LR9 A;  3SFG A;  4NXN J;  5A8R A;  1S0N A;  2KFZ A;  3PTW A;  3UR0 A;  4J9Q A;  1RT5 B;  3NCQ A;  5AJ3 F;  4F4Z A;  3OSN A;  3GJR B;  1XR6 A;  1OYE A;  2MLX A;  4QYZ K;  2K06 A;  5A8K B;  4X64 J;  1NKE A;  4H4M A;  3RG6 A;  2E9R X;  4G1Q B;  2E5L J;  3W9J A;  1IKW B;  3QYY A;  4D3G A;  4I2P B;  2DGX A;  3FZB A;  3QPI A;  3V2U C;  4QIG A;  1F2G A;  1R31 A;  3TUZ C;  4WU3 A;  4P74 A;  2GHW A;  2EKY A;  3TX8 A;  1SJ3 P;  3KUG A;  4N5S A;  1L5U A;  1IBM F;  2IVY A;  3V6H A;  4Y2A A;  1EB0 A;  4DR2 J;  2XEX A;  1S1T A;  1CPZ A;  2NXU A;  4NCA A;  4DR4 J;  1IR2 A;  2QL5 B;  2JC1 A;  1PBA A;  1WTF A;  4EI2 A;  4PYA A;  4ANE A;  4OJ1 A;  1U6F A;  2A3J A;  1UW4 A;  2W2M P;  3BPD A;  5L1I A;  4DUT A;  5C24 A;  4NZ0 A;  1HQE A;  1YDL A;  3BBC A;  3GCX P;  3D6M B;  2ZD1 A;  3IA0 A;  3KKF A;  5L39 A;  1R3N A;  1U02 A;  3IP0 A;  2KL8 A;  1RTD A;  3W66 A;  3PIO Q;  1JNR B;  2I0X A;  3L7O A;  2YNH B;  4IO1 A;  1U25 A;  2KTQ A;  1RAE B;  3IM8 A;  1EAR A;  1K1S A;  3QAE A;  2AYE A;  4EBC A;  1N5S A;  2Z57 B;  3ZTR A;  2MXY A;  3DRR B;  1RZM A;  2HFU A;  5B0D A;  1Y3J A;  1ZAW A;  1JJ4 A;  1XMO J;  3JAM Y;  1U7L A;  3PVX A;  3FNN A;  1S10 A;  1S6Q A;  2YNG A;  2RNE A;  4DV1 F;  4AQY F;  2Q43 A;  1RT2 B;  1HNI A;  3FBB A;  2VDI A;  3NOG A;  2GMJ A;  4ID5 A;  4MFB B;  4N8O A;  3RB4 A;  1F6T A;  3NBP A;  4BC7 A;  2JNJ A;  5HSP A;  4MK8 A;  2OTL S;  4FXW A;  4QWA A;  4DV7 J;  4F3Q A;  3C46 A;  2QLX A;  3BR9 A;  3CE8 A;  3QNW B;  4GKK J;  1RTH A;  4Z37 A;  4JI4 F;  3SXL A;  5JMN A;  3VAM A;  2GAG C;  4LFA F;  3MEE A;  2FHK A;  3M8S A;  4J9V A;  3ETO A;  5DDQ C;  1F9H A;  2H54 B;  2K1R A;  2H5E A;  2B3T B;  2X3D A;  1TL7 A;  3AB2 B;  1VRT A;  4USW A;  4X4R A;  2BJ9 A;  1YJW S;  4ECR A;  2M8D B;  4DR7 J;  2W7P A;  2GVD A;  3FQK A;  3N01 A;  3TA1 A;  3ITH A;  3TJA A;  1O6X A;  3AJ2 A;  3P45 B;  2NPF A;  2XB2 D;  4HI2 A;  2XC9 A;  3KUE A;  3JYT A;  4RL1 A;  3VZH A;  2CQI A;  3BGR A;  2HZC A;  3G71 S;  3AXK A;  4P71 A;  1LWE A;  4U95 A;  4FYD A;  5IM0 B;  1KDN A;  4DX8 H;  4PG7 A;  2ZBQ A;  3SCK E;  4I0W A;  3QBC A;  3KFW X;  1CJV B;  2PMH A;  5ETK A;  3VAK A;  3HI9 A;  3KMQ A;  1HI0 P;  2JZ5 A;  4RWX A;  1P8G A;  1TTH B;  2ZZN A;  4O4G B;  3I0S B;  3HJV A;  3G82 A;  2VG5 A;  2HFS A;  5JVH Q;  1MMD A;  4DX6 A;  2WBM A;  3OTO J;  1X4E A;  4FN5 A;  2XTJ P;  3QJP A;  1OYD A;  4LBI A;  4UZC A;  2CVI A;  1EZZ B;  1NSP A;  5J2P B;  4QR1 A;  5AE2 A;  5FLX U;  3BB5 A;  4RNO A;  4U67 Q;  4U7C A;  3DRP A;  5K8O A;  2BW7 A;  5B0G A;  1CS4 B;  3MTJ A;  5K8N A;  3H2L A;  5F8H A;  1EP4 A;  4XO0 A;  1FKO A;  3QIP A;  1R8C A;  3C14 A;  2GHP A;  3CJK A;  1X5S A;  3LGH A;  4KV8 A;  4TVA B;  1VRU B;  3VAG A;  1ACM B;  3N6N A;  3QZ7 A;  2BKP A;  1S76 D;  4DCJ B;  4A8X A;  3KTQ A;  4B9L A;  4NOH A;  3KLF B;  1KQK A;  1CSJ A;  3SZ2 A;  2R2S A;  3W61 A;  4CQ1 A;  1U26 A;  3VWS A;  2KYZ A;  1EHW A;  3RB3 A;  1L3K A;  4ZK7 M;  3TVK A;  1JQG A;  2UUB J;  2KVQ E;  2RHQ B;  3E01 B;  4TYA A;  1PYO B;  4Q44 A;  3KDO A;  3KLG B;  5KG2 A;  3M4X A;  4NLP A;  2MHN A;  4IRK A;  4DUY F;  4FYV B;  1UEK A;  3AD9 C;  1P9Q C;  2RQC A;  2LXF A;  3FCW A;  4ED5 A;  4P6Q A;  2DO4 A;  2HBY B;  3JSM B;  2X1A A;  1F3V A;  1FF2 A;  3ZZT A;  1UJ5 A;  1XMB A;  3KK3 A;  2PO4 A;  1TUG B;  3HVT A;  3CJ8 A;  4IDK B;  2RJZ A;  2LXI A;  4NEY A;  4ZJQ A;  5DET A;  3E2E A;  4ZP7 A;  4A8S A;  2QA4 G;  4QR2 A;  5J1N A;  3KLV A;  3GFZ A;  2IC3 B;  2X7I A;  4RW9 B;  4IG0 B;  1YLX A;  3S7R A;  2OEJ A;  3LW5 C;  4RW8 A;  1MWZ A;  3RB0 A;  1T3N A;  1L3T A;  1J2V A;  1MNE A;  3OVB A;  1M1H A;  3M2V B;  2N7Y A;  3I5B A;  2QYG A;  2HVD A;  2Z4P A;  3JQM A;  2ACM A;  3QGG A;  3SBM A;  2N3L A;  3CUN A;  2H48 B;  2MQM A;  3IS9 B;  4U8Y A;  4PYD A;  3IN5 A;  1DAR A;  5D6G A;  5JJB A;  3W60 A;  1XNR J;  3QFH A;  1FK9 A;  2QIF A;  1SL0 A;  3TI0 A;  3M6V A;  4IH7 A;  1WKL A;  1ZA1 B;  3RW6 A;  4NLD A;  4B3T F;  5C7P A;  2V50 A;  1KKH A;  1U6B A;  3C8Y A;  3DOL A;  4ERD A;  4O3R A;  4PQU B;  1YJN S;  2D3Z A;  8ATC B;  4RZR A;  5EWE A;  3H8Y A;  2R7Q A;  1ROF A;  2ABY A;  2IPO B;  3P96 A;  2ZOG A;  1CC8 A;  1ZM3 A;  3L9Z A;  2C3M A;  4WF9 Q;  3UNG C;  1NBE B;  4OZJ A;  4LT6 A;  1YRX A;  2MZ1 A;  3BO4 A;  3ET6 A;  3TP2 A;  2DIV A;  1TK5 A;  3FEY B;  3TVY A;  1QLN A;  1X5O A;  2R7U A;  1S99 A;  3KMS A;  4YB5 A;  2FHM A;  4ED7 A;  1IKX B;  3OJU A;  2DIU A;  3WHI A;  5IQQ A;  1RLD A;  4O4R A;  1YVF A;  4ILL A;  2UU9 F;  4OYA A;  2KT5 A;  4Q45 A;  3J7A 1;  4N8N A;  3M9M B;  2GMH A;  2ZH9 A;  2RVJ A;  2BJ8 A;  4FBU A;  5L1L A;  2ZE2 A;  1MLA A;  1MML A;  2XYP B;  1G3O A;  1JLE A;  4XK8 C;  1CQN A;  5GMK a;  3GPA A;  3WX8 A;  3MD3 A;  3NNH A;  2O1P A;  1TUW A;  2PEB A;  3DNC A;  1REV B;  4BCA A;  3P8B B;  5F8G A;  3VAF A;  2CZ4 A;  4CLK A;  3GV8 B;  3JAM U;  1ZTT A;  2CPJ A;  4W4M A;  4WFZ A;  5IT9 U;  1I1G A;  4USK A;  4GO5 X;  3BO3 A;  2ZHO A;  2Q6B A;  4EO6 A;  3BKU A;  2HRU A;  3IMQ J;  2EG2 A;  2UUA F;  4W98 A;  2B5J A;  2G1D A;  3RAM A;  5HO4 A;  3CJS A;  1VOM A;  3KJN B;  3RZA A;  5K14 B;  2ATL A;  4JI6 F;  4FF4 A;  4KQZ A;  4CTA B;  2DPI A;  3UR3 C;  3MR7 A;  4MKY A;  4WP3 A;  4O3O A;  3FBC A;  8RUC A;  1Q81 T;  1H2V Z;  1FTC A;  1UAW A;  2XSJ A;  4IRD A;  5DZ6 A;  3Q8Y A;  1N48 A;  3TO8 A;  3WIV A;  4F0M A;  5CD4 A;  2Z56 B;  2AD9 A;  2V8D A;  4P2M A;  1IKY A;  3CDW A;  5J2M A;  2QMW A;  4YDD B;  3QO9 B;  4GC6 A;  2OPS A;  3SQO P;  1TMJ A;  4CT9 A;  2UUC F;  3AB4 B;  1TL3 B;  1NJW A;  4QBU A;  3HKW A;  2P9E A;  2HFV A;  3NMR A;  3FC9 A;  1DTQ A;  1FX4 A;  2C3O A;  3NP5 A;  4RNF A;  3RRH A;  1JLG A;  1YG0 A;  3C2P A;  2JX2 A;  1PC5 A;  4WE1 B;  3MOJ B;  2RS2 A;  3GYN A;  1C1B B;  3M6X A;  2HEK A;  5B7W A;  1C0U B;  2E1R A;  1UA0 A;  4HT5 A;  4EBD A;  1LW2 B;  4IOB A;  2XCP A;  2KO1 A;  4DQI A;  5FDL B;  2YQ0 A;  4QJV A;  3BZQ A;  3GIR A;  1HLW A;  3M1V B;  4Y2I A;  3D5M A;  1X4G A;  4DFK A;  3CMQ A;  2H1Y A;  4CH0 S;  2QO3 A;  3C3L A;  2IBO A;  2UUW A;  4F4W A;  4PZV A;  1BQN B;  3KHR A;  4Y3C A;  3QGP A;  1U1N A;  4J9R A;  2Q1L A;  2V8V A;  3W8G A;  1BMQ B;  3DLE A;  2OPQ B;  2QJ3 A;  2ASD A;  5C5J A;  3BDP A;  4A8W A;  3U7J A;  1IN0 A;  3LOU A;  5D8H B;  2B9X A;  1TEL A;  4DXL A;  4ZHR B;  2J9C A;  1HFE L;  1C0T A;  3Q83 A;  1RT7 A;  4JV0 A;  3NAH A;  1Y5N B;  3EYZ A;  5B0E A;  5A0Y A;  1TL4 A;  1DBD A;  5E3P A;  1DZ5 A;  5HI7 A;  2Y3Y A;  4IFV A;  3BEG B;  4LSN B;  1D8Y A;  2XMU A;  4X66 J;  4HKQ A;  2MJN A;  3W2W B;  3FFI B;  4Y34 A;  1NND A;  1VQM S;  3PYE A;  1RLC L;  2POK A;  4B9N A;  2B51 A;  4F04 B;  2GQ2 A;  1RT3 A;  1ZH5 A;  3UFC X;  2HGM A;  2DNN A;  3BSA A;  4QR0 A;  1NK5 A;  2G0C A;  3N0V A;  1JXE A;  2IJR A;  3TZX A;  4GRS A;  4KKO A;  1UVM A;  5SZT A;  4M8L A;  2J9E A;  1TAQ A;  4NI2 B;  2HZA A;  4ZCM A;  2ZM6 J;  1SKS A;  3M8W A;  3H5U A;  3T5K A;  4TU8 A;  1DUR A;  2LA4 A;  3UDL A;  1HIY A;  3IBW A;  5LM7 E;  2OUG A;  4XDD A;  1S7H A;  4TU9 A;  1KLN A;  2ZWP A;  2ZHA A;  3HHN B;  2XMJ A;  4ALZ A;  1HBM B;  5CAA A;  1S1X A;  4U8V A;  2M2B A;  4NLY A;  2IM3 A;  5ETL A;  1WG5 A;  3LP1 B;  4EMD A;  5J1E A;  3HFK A;  2GO8 A;  1LFP A;  5KFX A;  1U0H B;  3I0R B;  2IDL A;  5IT4 A;  5HK4 A;  3HCX A;  3E51 A;  2YWG A;  3IBC B;  4LR7 A;  2CNN B;  2J6U A;  3OBI A;  2F63 A;  1XQI A;  1WNE A;  4ZP9 A;  2I9S A;  4HYK A;  3HD2 A;  1N34 F;  2W01 A;  2DNM A;  2H5I B;  3MMA B;  3UN3 A;  4JI5 F;  1Z4U A;  4DHV A;  4AT1 B;  4DF4 A;  4JV2 A;  2RQ4 A;  1E6Y A;  2F4V J;  1GMW A;  3I31 A;  4F4X A;  4NLT A;  1TR0 A;  4OYZ A;  1WD6 A;  3Q8V A;  2JC0 A;  3NMA A;  2W8K A;  1Y7P A;  3CMA S;  4LF9 F;  4YHH F;  4WU2 A;  1JWW A;  4J9S A;  4C6A A;  4NXM F;  3BDE A;  5BJR A;  3FSY A;  1S97 A;  5I3P A;  5D4N A;  4L72 B;  5AXM A;  3DU6 A;  3OR2 B;  5LMN F;  4DZ6 A;  3VAH A;  2I1R A;  3UN2 A;  1EAY C;  2B4P A;  2PI4 A;  4WYW A;  1UPP A;  2EVZ A;  2HIY A;  5F8I A;  5D4O A;  3BV8 A;  3HO1 A;  3TA0 A;  3PZP A;  4QWB A;  5HLF B;  3EXY A;  4JI3 F;  1UVN A;  1K47 A;  3IWX A;  4ICL A;  3ISZ A;  2NS1 B;  3J80 Y;  1ZA2 B;  3CCM S;  3MAQ A;  1NDP A;  2K8G A;  1R43 A;  1WC4 A;  2AX1 A;  4ZIV A;  2Z2Z A;  5I3U B;  1S12 A;  1Q95 G;  2FHJ A;  1S6O A;  4ZPC A;  2B0G A;  3DLG A;  4DSE A;  5CAB A;  2HHV A;  4QPX A;  3HX9 A;  3GWC A;  3PW5 A;  2KFY A;  1N56 A;  1R6Y A;  2VQE J;  1M5H A;  4ZOS A;  1ZPW X;  3CCU S;  3TVZ A;  2DHX A;  1PIE A;  2FC9 A;  1S0V A;  1A9N B;  1B7Y B;  3GMG A;  3MED B;  2FQQ B;  3R27 A;  3UCU P;  1GAO A;  4JI0 J;  1UVJ A;  5E0O A;  5I42 B;  4Q0B A;  3BYR A;  2UP1 A;  1RWW B;  3ZC4 A;  4LRF A;  2XQC A;  3EM1 A;  3Q89 A;  4K2X A;  4WYL A;  1OIA A;  1UMJ A;  3K2Y A;  4KBI A;  1NEE A;  1JJC B;  5LMU J;  3JB9 k;  3UN5 A;  3SMZ A;  4NCG A;  1LWC B;  1RAB B;  4NWB A;  1QAJ A;  1JLQ B;  2C1E B;  5KT5 A;  1B7F A;  2HNZ A;  2MHE A;  3KK1 A;  5A8K A;  1GK8 A;  2WVF A;  1HYS B;  2CPD A;  2CQP A;  3HT3 A;  1B70 B;  2HBZ B;  3DU5 A;  1VCT A;  1IKW A;  3K89 A;  3I56 S;  2CJX B;  4UF4 A;  5HBM A;  4U6P A;  5AJ3 J;  1LXJ A;  2IM1 A;  1D09 B;  2A6M A;  1X7V A;  3SCJ E;  2UXB F;  5G0R A;  1UEV A;  1SJ1 A;  1U47 A;  5ETM A;  5F8M A;  3PXG a;  2XNR A;  2XWY A;  2QGF B;  2G0J A;  1HBN A;  4OHW A;  1GX6 A;  2GGP B;  1CJT B;  2Y0B B;  3RR7 A;  2VG6 B;  5DQG A;  3CCE S;  1RQ0 A;  4KO0 B;  4AD6 A;  3QID A;  3BGO P;  1BLU A;  1GH8 A;  4ILM A;  5D78 A;  1S79 A;  1URN A;  3I87 A;  2K7J A;  3CCW A;  4B3M J;  2CRL A;  2KI2 A;  5KFC A;  1WC1 A;  1BGX T;  1FCA A;  3MR2 A;  2BV3 A;  4DFP A;  4RBU A;  5K20 B;  3R2C J;  1XWL A;  2JWN A;  1FDN A;  2VOO A;  1TUV A;  4DX7 A;  2P5V A;  3CCQ S;  2V2K A;  2VDH A;  2MKC A;  2M0G B;  3B8H A;  2J8S A;  4X4O A;  5KFI A;  4MIA A;  2CIM A;  4HT7 A;  3DM2 B;  2X51 A;  5D3G B;  3HHD A;  2IVM A;  1QE1 B;  2RT3 A;  5A76 A;  1CJK A;  4F3M A;  1YRT A;  1SVD A;  3W9I A;  1RHM B;  3BR8 A;  1WEZ A;  3TEG A;  2EI5 A;  2IDE A;  4FKY A;  4B9V A;  2E5G A;  3I96 A;  3HPO A;  1F60 B;  1T9T A;  1PSD A;  2M5Y A;  3AJD A;  4WKY A;  5KG1 A;  4ZVT B;  4A47 A;  4NA3 A;  1L3V A;  4USJ C;  2BE9 B;  3KJF B;  4C3L A;  1D9F A;  5EWG A;  4Y28 C;  4DDF A;  2UVW A;  2CKW A;  3CDU A;  2DR8 A;  2QYC A;  4U96 A;  3KG1 A;  4DV1 J;  1HMV A;  3N79 A;  3CT9 A;  2DD8 S;  2CWX A;  5K9F A;  2IRX A;  2XYH B;  3DI6 B;  4F4K A;  3QRP A;  3W64 A;  1KFS A;  4NEZ A;  2WCX A;  4FYW B;  2XBP A;  4BLG A;  4JI2 F;  2XMM A;  4N7T A;  2WW4 A;  3NY0 A;  4HDH A;  4DV2 J;  3B82 A;  1RHJ B;  1QDU B;  2IA6 A;  3NGR A;  1S6P A;  4ES1 A;  4V19 X;  1HBU B;  1S9F A;  4Z2X A;  3A1Y G;  2DGS A;  1J5E F;  3EJM A;  3RGI A;  2MY7 A;  2W4P A;  5ETN A;  2YY3 A;  4JI4 J;  3J81 j;  4LFB F;  3T1Y J;  1PYT A;  1SQG A;  3MI7 X;  2ZZT A;  3IBF B;  1MN7 A;  4UT4 A;  4QWE A;  3TQE A;  2IMO A;  1YJT A;  4WPA A;  4NXN F;  2VA2 A;  4M1K A;  3DOM A;  1X4B A;  1K44 A;  1TFW A;  2E1P A;  1LWF B;  2LEP A;  2PE8 A;  2Q6C A;  3MEG A;  1D8Z A;  4OYI A;  2AZ1 A;  3TA2 A;  1Q0N A;  1H74 A;  4WBF A;  3U02 A;  2BQU A;  2GNK A;  4GVB B;  1U1R A;  1E6V B;  5MAO A;  2F4F A;  3X1L B;  1ZAV A;  3DRY A;  2ZZM A;  2ZJP Q;  4JI7 J;  3NS5 A;  2W24 A;  2VON A;  2VIC A;  1WC5 A;  5I3Q A;  3MAA B;  2D3O 1;  4KPY A;  3H0P A;  1DLO A;  1CBK A;  3LP2 A;  3KHH A;  3NGS A;  1S9G A;  2WW8 A;  1RTI A;  2MKI A;  3MFH A;  3LWL A;  4AL5 A;  2HHW A;  1K8A T;  4DR2 F;  3I0S A;  1RHQ B;  2YWH A;  4DR4 F;  1Y3K A;  2VC0 A;  3WQP A;  5EX3 A;  4Q43 A;  1ZYQ A;  4ED6 A;  4V19 J;  1DQ9 A;  4NX9 A;  3C16 B;  4RX6 A;  2ZOF A;  1HA1 A;  4UY8 T;  4C3M A;  4DL0 C;  2OHD A;  1ZAX A;  5J2N A;  1RU2 A;  3FZ2 A;  3K5M A;  1VQ8 S;  2KHC A;  2BQ3 A;  3D54 A;  4RNH A;  1YBT A;  4OYP A;  4B9U A;  2G2O A;  2XG8 A;  2CQG A;  2QRR A;  2GQQ A;  1CVJ A;  3RW7 A;  3R5D A;  1EIY B;  3LGM A;  4HDG A;  3KLI A;  3AHP A;  2XHC A;  4ECX A;  3THP A;  1Q8B A;  4KFB A;  4ZVH A;  2OKQ A;  1XMO F;  4TKT A;  1WG4 A;  3GIK A;  1SIW B;  2A1B A;  3TOQ A;  3E01 A;  3G8Q A;  4M5M A;  1BQM B;  2VF3 A;  3J80 U;  1TKT B;  1FTR A;  1TL1 B;  2DNR A;  2HQI A;  3NNA A;  2C22 A;  4IO9 Q;  1KR4 A;  4IR9 A;  4TNO A;  1MRO A;  2AHO B;  2AJQ A;  1Y0H A;  1JKH A;  2QL7 B;  1Y5L B;  2W2N P;  1ULR A;  4GKK F;  1GX5 A;  2CAJ A;  3DHW C;  4XDC A;  2NLW A;  3AAW B;  2CQH A;  4FXV A;  1T05 A;  2JEJ A;  4LSL B;  3DGV A;  3DDK A;  1BXN A;  4LF4 J;  3HHL C;  3RBX A;  3OHA A;  1B4S A;  5CQG A;  2LA6 A;  1Y5I B;  1IJF B;  3TZZ A;  4ECY A;  4ED1 A;  4L73 A;  3A8K A;  1BWV A;  2PDA A;  1VQL S;  2ADC A;  3DKD A;  4ZDN A;  5HVH A;  3M2V A;  3FBF A;  3UVJ A;  4DR7 F;  2B8Q A;  3IR6 B;  3W5Z A;  1X4D A;  1RB0 A;  3ENV A;  2HQ3 A;  3GTY X;  5E3R A;  2XM3 A;  2DHS A;  1F5C A;  5IQ6 A;  1ZPV A;  4AUK A;  2XMA A;  2PMW A;  1SC1 B;  5HQ8 A;  1JLB A;  3CCT A;  3OFE A;  3M8R A;  5E41 A;  1GXT A;  3ENQ A;  2DNK A;  2W9C B;  4ITS A;  2FLL A;  2MST A;  3PEJ A;  1U2F A;  4KT0 C;  4PQU A;  4NCB A;  4Y0F A;  4QOT A;  1PAU B;  1WDD A;  1VYA A;  1YJ9 S;  4ECT A;  3FEX B;  5J1P A;  2J5A A;  3NXZ A;  4H4K C;  4B3T J;  3QWU A;  3MTK A;  4AE5 A;  1FES A;  5KFF A;  1MU2 B;  4CM2 A;  3ZTP A;  1BWE A;  3T5J A;  3OTO F;  2YWW A;  4LJM A;  1YIT S;  3WC2 A;  2A2C A;  4RW4 B;  1Q53 A;  1K0V A;  2NRE A;  3IXQ A;  3CJ5 A;  1QSY A;  1VK3 A;  2OLW A;  3KOA A;  4CZC A;  3C6T B;  1U0S A;  1PBU A;  2HKE A;  4K4W A;  4XPC A;  5A8W B;  1WOP A;  3FEZ A;  4ECS A;  3Q2S C;  4F7V A;  2VOD A;  2OPP A;  2V68 A;  3J7Z T;  4DFM A;  2R3V A;  2JLF A;  3PRB A;  1R0A B;  1KQS R;  3H4B A;  1KBR A;  2ZH1 A;  3DMJ B;  3OXG A;  4FXD A;  3GB0 A;  1GT8 A;  4E98 A;  3P5T L;  5A6W A;  2A6O A;  4OL8 A;  2BX6 A;  4DL3 A;  1NKB A;  2FVP A;  3ZTQ A;  5K5M A;  1VI7 A;  1REV A;  4PWD B;  1FNM A;  4K5S A;  4B08 A;  2OGU A;  1RIS A;  2P2C B;  3TUI C;  5IWA J;  2P6S A;  1P6T A;  2R2T A;  2XS2 A;  2OD4 A;  4DL2 A;  4EGL A;  4CLP A;  2HSE B;  5EHH A;  3ZFV A;  2V8P A;  1VJW A;  1Q7L B;  4UOH A;  4KAI A;  3UD3 P;  2MYF A;  1YRU A;  3MGJ A;  1NPR A;  1TVR A;  3EWG A;  4LIW A;  4GO7 X;  4CH7 A;  4NLV A;  2V4R A;  1X8D A;  2Y8W A;  1S1U A;  1U8W A;  4DPX A;  1HI1 A;  4RNM A;  2MQL A;  3JQJ A;  3M2R A;  3HVW A;  1TV6 A;  2DY1 A;  4I2Q B;  4P9S A;  3H2V E;  1RTJ B;  2IAJ B;  3CGI A;  1GNK A;  1S9E A;  1N4L A;  1IKV B;  2MQN A;  2CPZ A;  2YKM B;  2JDJ A;  2CA9 A;  1RT4 A;  2X3G A;  4MKA A;  1OJ4 A;  2MDA A;  2DIS A;  2UUA J;  4XTT A;  3AA9 A;  2D41 A;  4JB8 B;  5CZV A;  3DRX A;  3EGN A;  4DV3 F;  2BMB A;  3FJ2 A;  4JI6 J;  4MMO A;  1UZD A;  4YB1 P;  5F9N A;  3KK2 B;  2I8E A;  4Q8E A;  4RU2 A;  2J0W A;  5KFY A;  3LGN A;  4OHZ A;  2OJ3 A;  2BAN A;  3QFW A;  3QO9 A;  3S1T A;  2XYG B;  5AE3 A;  3BGF A;  1X9S A;  1UWB A;  5HMY A;  3Q8P B;  2V0N A;  1N88 A;  2LYV A;  2IYI A;  3IRX A;  2B7B B;  1XER A;  3THV A;  2V4Q A;  1VIO A;  3PR4 A;  2NR0 A;  1WEX A;  1QAY A;  3EVM A;  2X1B A;  4WE1 A;  5H9F J;  4CLT A;  1FKA F;  3JSY A;  2FJA B;  2RIL A;  4P73 A;  3AJ1 A;  2BKN A;  1AZS B;  3HSZ A;  4N41 A;  1XNR F;  3OVA A;  1FKP A;  2VIH A;  2OSR A;  5E2Q A;  1RWN B;  1QTN B;  5FDL A;  4ZJL A;  5IS2 A;  2VB6 A;  3VAL A;  3H5X A;  3I5C A;  3GCW P;  4OX8 A;  2K2P A;  4B02 A;  3UPF A;  4FPR A;  2E29 A;  2B8P A;  1FA0 A;  3VVT A;  3D0G E;  4B9M A;  4PXC A;  3MM5 B;  1H2T Z;  3PX6 A;  3R7N B;  2XY7 A;  2IJF A;  3TQ1 A;  4NRT A;  5KFB A;  4W92 B;  4HH0 A;  4GKJ F;  2DKO B;  1RWU A;  3FCV A;  2OPQ A;  3FUY A;  1UPM B;  2W2Q P;  1FE0 A;  3CCR S;  2F65 A;  1WF2 A;  1M5V C;  1N33 F;  3IO1 A;  1RBA A;  2DNL A;  1YHQ S;  1FE4 A;  1S49 A;  4ED8 A;  1Q82 T;  4M95 A;  3A13 A;  4NZ7 A;  1SUQ B;  3VHQ A;  1FRK A;  3OVS A;  2DVI A;  5KG5 A;  1FRL A;  3KDN A;  1H6K X;  4NZ6 A;  4Y65 A;  2CWK A;  2CUY A;  3Q8U A;  2YBV A;  4RKU C;  2RRA A;  1A6L A;  2MGZ A;  3ZZZ A;  1X4H A;  3D9B A;  3OFG A;  2OPR B;  2FJV A;  3F56 A;  1LQ9 A;  1S6U A;  2NSC A;  1U1K A;  2KYX A;  4DG1 B;  4PUO B;  4OFZ A;  4ZVR B;  3OW2 R;  2D9O A;  2YNI B;  2CAD A;  4F2S A;  3LP1 A;  2FHJ D;  4UTG A;  1S72 S;  1N0U A;  3ETM A;  2P8I A;  3V81 A;  1TFY A;  1KLM B;  1DFD A;  4B17 A;  2QLW A;  4OYX A;  4USM A;  1HR0 F;  3RU0 A;  4OYB A;  4QCL A;  4RW7 B;  1N5V A;  1LW0 A;  3IC1 A;  4F26 A;  4DR5 F;  1K1Q A;  4CI0 B;  2R8H A;  3R5A A;  2PFF B;  1N5Y A;  2QG9 B;  2PSZ A;  4KY3 A;  4OX7 A;  1H7W A;  3FMB A;  3M8P B;  3CW2 C;  3IR7 B;  1VC0 A;  3OPK A;  3GIJ A;  2ZWO A;  1HQU A;  2HS4 A;  4IFY A;  3A3P B;  4MJK A;  2MZT A;  2QLB B;  3MMC A;  4I64 A;  3OR2 A;  4M5G A;  5L8R C;  3PKM A;  4HR2 A;  4BBY A;  3D68 A;  2CJQ A;  4LF9 J;  4YHH J;  4TY8 B;  4WZM A;  1H98 A;  2JEF A;  1FRH A;  1C1C B;  4X4U A;  4QYR A;  2NXE A;  4CO5 A;  1DTT B;  1O8B A;  2FZC B;  3M8Q B;  3HD1 A;  4OYM A;  3F41 A;  5LMN J;  5C42 A;  2BJ1 A;  3MM9 B;  2Q3P A;  2W9B B;  5I3U A;  3Q24 A;  2V9K A;  2VFS A;  3V4M A;  1N32 J;  4JI3 J;  5GAG U;  4DUZ J;  5T7L B;  3RRG A;  5LT5 A;  4M94 A;  1PAE X;  4C3K A;  1SPB P;  3TAM B;  3PX0 A;  1U24 A;  1LXN A;  1AT1 B;  2AJF E;  5HAN A;  4CLF A;  1WHX A;  2ZNZ A;  5LSR A;  2CPF A;  2Q79 A;  4OQJ A;  3PEH A;  4B9S A;  2DNH A;  1B99 A;  3I9V 9;  1PJ7 A;  3D2W A;  3NL0 A;  4CO4 A;  4JV5 J;  2FVR A;  6FD1 A;  4RLE A;  2LU2 A;  4C11 B;  5DM7 Q;  3J81 Y;  1G6B A;  2YH1 A;  4K2J A;  4DF8 A;  2ZC4 A;  1WOR A;  4NMX A;  2KM8 B;  4FYX B;  5DO2 A;  2APO A;  3CCS S;  2MKS A;  3LUY A;  4OV6 A;  4Q2M A;  2LQB A;  4EO8 A;  3V6D B;  2EK6 A;  3RAX A;  2ZJR Q;  5GMD A;  2GA7 A;  2VJU A;  3HFZ B;  1S1V B;  4MTP A;  4OHV A;  2WVE A;  2D7S A;  2NCK L;  1FJE B;  2KJW A;  5KFR A;  2U2F A;  1FJ7 A;  3T1H J;  2QMU B;  3EPI A;  2PT0 A;  2J76 E;  3W2V B;  3AOC A;  5BYS A;  4RJV A;  3G6Y A;  3C6U B;  1U1O A;  3GFY A;  3PM9 A;  2DXE A;  3D7S B;  5HL7 Q;  2RDJ A;  4B3R J;  5CYQ A;  3S6E A;  4ECZ A;  2LEB A;  1UFK A;  1S4F A;  1J27 A;  3IAS 9;  3NWR A;  1YK9 A;  1T3O A;  1YZ7 A;  1RKI A;  2D3U A;  1T9U A;  4O0N A;  1CJT A;  3F0N A;  7FD1 A;  4F67 A;  1U4B A;  2F4V F;  2NYH A;  3TZW A;  2HGL A;  2ADB A;  4YY3 J;  2IIH A;  2AMC B;  4LRB A;  5GAH U;  2XZD B;  2P9G A;  4LF7 J;  2DR5 A;  5DDO C;  1MWQ A;  2BYC A;  1IXK A;  3ELH A;  3U1N A;  2CJA A;  4YME A;  3G8T A;  2LP4 A;  2ZC3 A;  1FX2 A;  3M2U A;  2OEM A;  2V9W A;  3LAM A;  1R0B G;  2YX1 A;  3D3C J;  1KD1 T;  3C15 B;  3KHG A;  4Q8F A;  5KFA A;  5F8J A;  2W7A A;  2AYM A;  3UWT A;  4I56 A;  1K0T A;  1SJR A;  5A8R B;  3DLL Q;  5HRO B;  3FCH A;  4IQM A;  4H4M B;  4K59 A;  2OEK A;  2V2Q A;  3MM6 A;  2R7W A;  4GVL A;  4LF2 A;  1NH8 A;  4TQS A;  1Q7Y T;  1W2I A;  2GS8 A;  2HW3 A;  1MWY A;  2VPX B;  3I9Z A;  2DR9 A;  2NPI A;  1YBA A;  2RSQ A;  1TL5 A;  4PRF A;  1U6Z A;  1WKK A;  2J0S D;  2EFN A;  3AD7 C;  5KFW A;  2O3D A;  2DR6 A;  2VFR A;  2DXF A;  2EBG A;  1NDK A;  1MSW D;  2YQ3 A;  2VQE F;  3OD2 A;  2W9A A;  1RGV A;  3P6Y C;  2DB1 A;  5H9E J;  4N47 A;  2HVE A;  3R1H A;  3PRD A;  2R7V A;  4JI0 F;  1NK6 A;  3HSG A;  1RWV B;  4DFJ A;  2WVB A;  3EX7 B;  2CQ1 A;  3ONQ A;  2N4C A;  1S1T B;  1WUU A;  2CZV C;  2ZH2 A;  1VQO S;  4J9M A;  1KC8 T;  3BKF A;  4WP9 A;  1XBW A;  3PNI A;  2ASL A;  4DX5 A;  2XHW A;  3A4T A;  4JI2 J;  4DV0 J;  3DFE A;  4QWD A;  1XR5 A;  2YQ1 A;  4PQA A;  5LMU F;  3SI8 A;  2PN6 A;  2GX8 A;  1J5E J;  2CPI A;  3PIP Q;  4Q7A A;  1XR7 A;  5C24 B;  4LF5 F;  1HQE B;  4MAK A;  2GJF A;  2DK2 A;  3CVK A;  2WSF C;  2ZD1 B;  1OPZ A;  1FFW B;  2VJV A;  4K4V A;  3HZE A;  3L95 X;  1PC4 A;  2H51 B;  2BBE A;  1FER A;  4EYI B;  3MEC A;  2VPY B;  3D4J A;  3Q22 A;  2DEJ A;  5HAT A;  2DGT A;  1S48 A;  3DRS A;  1WC0 A;  2EBE A;  2XMW A;  3G87 A;  3MAA A;  2KT2 A;  2B9Y A;  1KSP A;  2FC8 A;  1JLC B;  1S6Q B;  2YNG B;  1T9X A;  5KFH A;  1UZH A;  1O51 A;  3MDF A;  3R5B A;  1NAQ A;  3WC0 A;  3LQV A;  2ZUG A;  4ID5 B;  3TWZ A;  3UCG A;  2RDI A;  2MZQ A;  1BD6 A;  3NBP B;  5EUH A;  1R8P A;  2PA3 A;  3CTR A;  1BC6 A;  4OJ3 A;  1VRQ C;  2JL9 A;  1RAH B;  2ZUA A;  4NE9 C;  4R5P A;  1PJ6 A;  2AJ1 A;  3W9H A;  4CO0 A;  1RTH B;  4QU6 A;  2BAB A;  1SBR A;  2OSQ A;  5CYJ A;  1VC6 A;  3H4D A;  4B3M F;  3JTP A;  3MEE B;  1Y11 A;  3CME S;  5H9E K;  2ZVI A;  3MPV A;  2R7R A;  4I1T A;  2K1R B;  3JTO A;  4X4Q A;  4CCH A;  1V3R A;  1Y10 A;  2BE2 A;  2FVC A;  2NZ4 A;  5BR8 J;  1S7I A;  2HPU A;  1TL7 B;  4LSZ B;  5T14 A;  5ETP A;  3OXF A;  3A12 A;  4ZPV R;  4I6W A;  1VBZ A;  2AU0 A;  2OFH X;  4DS5 A;  1RTZ A;  4C98 A;  3EPG A;  2JHE A;  2GVD B;  3ITH B;  3BGU A;  3UW1 A;  1TZ0 A;  2KHD A;  2XLI A;  3BKT A;  2FZK B;  1H3D A;  5IZH A;  2KZZ A;  2WSE C;  2CQB A;  3RBD A;  1NSK L;  1TKT A;  4ZMM A;  5EX0 A;  1XNQ J;  4TLQ A;  2UXC F;  3BS9 A;  3KJV A;  1JXL A;  3JYT B;  4DSJ A;  3AD8 C;  4PG5 A;  2DGV A;  3BGR B;  4I6A A;  1PKU A;  4FS2 A;  3GII A;  2J0Q D;  1LWE B;  3MHY A;  2XI2 A;  4NYO A;  5DG8 A;  2AW0 A;  2XO6 A;  3OT9 A;  1HI8 A;  1FEE A;  3KJQ B;  1LOU A;  4WK3 A;  1VBK A;  3LTO A;  3GV7 B;  4CO2 A;  2CJK A;  2DNO A;  2R7S A;  4DV2 F;  1AYE A;  4URG A;  2Y1L B;  1NME B;  1JJ2 R;  5G4D A;  5CYM A;  3G82 B;  2VG5 B;  5K8M A;  3SDE A;  3A8E A;  4F3O A;  3T1Y F;  2E9Z A;  3CD5 A;  4M5J A;  1Q8L A;  2GO9 A;  3DRP B;  4NAS A;  3J81 U;  3L09 A;  2AGP A;  5KT4 A;  1TP7 A;  4WTY A;  2LEA A;  4WFA Q;  3MR3 A;  2GFF A;  2ZVS A;  5GAG I;  1FKO B;  3QIP B;  3CJK B;  5L46 A;  4KHR A;  4KV8 B;  2VUG A;  3UCZ P;  1UTA A;  2NYI A;  2DGO A;  2DCL A;  4MKB A;  2N4D A;  4USI A;  4X4N A;  1NK0 A;  1WAC A;  2NXJ A;  1WF1 A;  5IFM A;  1RAF B;  3FRZ A;  4DR1 F;  2X1F A;  4JI7 F;  2ZH5 A;  2MJU A;  3O6Q A;  2LQ8 A;  1TKZ B;  3O44 A;  1Z2L A;  3ZZ0 A;  2FDN A;  1Q8K A;  1QAI A;  5KFL A;  1TMM A;  2GIR A;  1NU4 A;  1JMT A;  2IRY A;  2HMI A;  2R7T A;  1FI4 A;  4A8Y A;  3QT5 A;  4DS4 A;  3HKZ D;  3AOB A;  1IUJ A;  5BYQ A;  1OMS A;  2LVW A;  3CJ0 A;  5HMW A;  3KK3 B;  4FP9 A;  3HVT B;  4AND A;  3GZ7 A;  2HS3 A;  3HHL A;  5DQI A;  3M30 B;  2HHH J;  5LOQ A;  2EKN A;  2J8A A;  3M05 A;  3FQL A;  4ECU A;  2Y9H A;  4K0K J;  3AT1 B;  2PII A;  2CQ4 A;  3ILO A;  3H5S A;  2Z0G A;  4RW8 B;  2ZEJ A;  1OSC A;  1R0A A;  2VC1 A;  1UJ6 A;  1LWX A;  3D67 A;  2D3O R;  2HHQ A;  3AA8 A;  3BQ1 A;  1PG5 B;  2ACY A;  4HTJ A;  4O44 A;  1UWA A;  2HWH A;  3IG1 A;  5KFN A;  2BM1 A;  1NM2 A;  2HHT A;  4PWD A;  1Q4R A;  4DI6 A;  2Z2M A;  1KVK A;  1T7P A;  4XIU A;  5HQL A;  4J9P A;  4WFN Q;  3I82 A;  1BQX A;  2CDR B;  4NLR A;  1HD1 A;  4I68 A;  3IM9 A;  2ZH7 A;  1W26 A;  5GAH I;  2WB1 D;  1T03 B;  3DLB A;  2ZNY A;  3BRE A;  3OHB A;  1AB8 A;  2MB0 B;  1FK9 B;  3CCJ S;  2BW2 A;  5I4M A;  3IWL A;  3QQC D;  1SJ4 P;  4UY8 5;  2UZA A;  3DOL B;  4DPY A;  4JOU A;  4OMF G;  1P9Y A;  4I2Q A;  1L3U A;  1J5O A;  4H4K A;  1H0H B;  2IAJ A;  1TQL A;  3VVU A;  3DLK A;  4C4W A;  3BSC A;  3ISN C;  3CC2 S;  1CG2 A;  1WHW A;  2ZKU A;  2VAS A;  2Q66 A;  5KFM A;  4LF4 F;  4C8Z A;  1UP1 A;  3PO5 A;  4KE5 A;  2MEW A;  3WZ0 A;  1N54 B;  3NGT A;  2PEH A;  2MY8 A;  1SKR A;  2HRY A;  3SSQ A;  2DT9 A;  2MKJ A;  1SI9 A;  2FHO B;  4RU9 A;  2YNF A;  4DL5 A;  4J9O A;  1M5O C;  1Q78 A;  3W5Y A;  1IWG A;  2MQQ A;  1JIH A;  1K73 T;  4DV3 J;  2QN6 B;  2AEJ A;  2V8G A;  4P2F A;  2J7U A;  3CJQ A;  1HNV A;  2G13 A;  3VV2 B;  3TEH B;  2DHA A;  2OMO A;  1JLE B;  5F8N A;  1Y4Z B;  3T3F A;  1AZS A;  2IHR 1;  1X5T A;  3SSR A;  3MCS A;  3HFV A;  2IY5 B;  2MZS A;  1SQF A;  5HJY A;  1FRJ A;  3Q0A A;  1YJU A;  4AXJ A;  1NZ8 A;  9RUB A;  5E7O B;  1VFJ A;  1JLF A;  3M8Z A;  5B0C A;  5M2U A;  1ZS6 A;  1OS5 A;  3MM5 A;  3MM7 A;  2WHO A;  1VS3 A;  1RWM B;  3GJQ B;  2HWT A;  4WII A;  3ZNU A;  5JXS A;  4KH0 B;  2V4J B;  2QFJ A;  2YX7 A;  4G65 A;  2JFD A;  2B5J B;  2AGO A;  1NSA A;  2ILZ A;  2O5D A;  2RIJ A;  3MFI A;  1OQ3 A;  3SV3 A;  1KHW A;  1X9M A;  3CWJ A;  3NOC A;  1RBL A;  2JRS A;  3G86 A;  2HVI A;  4CIO A;  4GKJ J;  3D1H A;  2QT7 A;  1NZA A;  2HAI A;  1WOO A;  2B4O A;  4PCQ A;  4LF8 F;  2ALZ A;  2XSJ B;  2RF2 A;  4NPO A;  2QEX S;  1KHV A;  2DR7 A;  2LQ5 A;  2E5I A;  1N33 J;  3D0H E;  4KGZ B;  3W65 A;  4R25 A;  1IKY B;  3MR5 A;  5J2M B;  2YKN B;  1C4C A;  2RML A;  2QLF B;  2OPS B;  3T41 A;  3ZZO A;  3SCL E;  5KFS A;  2VPW B;  5AXK A;  2V5H G;  1XEZ A;  4KSE B;  5T41 A;  4YR3 A;  5DZ7 A;  4EYH B;  2I5J B;  4OLP A;  4CO1 A;  2IRU A;  1NK7 A;  1JLG B;  5IWA F;  2IA0 A;  4UOC A;  1VBX A;  4DLE A;  4NLU A;  5SUH A;  2F8E X;  3W7B A;  2E66 A;  3RYL A;  4ECV A;  2NUU G;  4K8R A;  2F8M A;  2HNY A;  3MUT P;  3BBB A;  3CDA A;  3D66 A;  4Z7Y A;  4ILR A;  1SV5 A;  4K4Y A;  5LSO A;  1SJQ A;  3PY8 A;  2KB2 A;  1GQE A;  1FJC A;  2AJ0 A;  3J7Z 5;  5GAE U;  4FDF A;  2KG1 A;  1I94 J;  2JFK A;  2CQD A;  4PEO A;  2OAU A;  1Q86 T;  1UFW A;  4RW7 A;  4OX9 F;  2OML A;  2MMY A;  2C2Z B;  1RP5 A;  5MLC V;  5LXY A;  1NHU A;  3CIM A;  2XMT A;  2KZM A;  2DY9 A;  3DLE B;  3PG9 A;  4PPZ A;  2VKR A;  2C2N A;  2CXE A;  2VG7 A;  1HR0 J;  2XUL A;  3LA0 A;  1RT7 B;  4KGK A;  1R89 A;  1RI7 A;  4DR5 J;  4TN2 A;  1HNX J;  2MSS A;  4CYU B;  4MYU A;  1NSQ A;  4RBV A;  5DDR C;  1CJU A;  3CSK A;  2J7K A;  1YKW A;  1YSJ A;  4IFV B;  3GIM A;  1QM9 A;  4DU8 A;  3PFE A;  3MR6 A;  5E3Q A;  1Y9O A;  4C48 A;  2EFQ A;  4X2B A;  2FJB B;  4MIB A;  3L4B C;  2LFV A;  2XS5 A;  5LXR A;  4FVC A;  1BUX A;  4DV4 J;  1V6H A;  2XY6 A;  4JUZ A;  1R7I A;  4NLX A;  3AOA A;  4P7T A;  2GVZ B;  2XZT B;  3DC2 A;  4KKO B;  3M8Q A;  1FWP A;  3HJF A;  3VTI A;  2L41 A;  1FDD A;  2O66 A;  2BOP A;  1G1X A;  4WXW A;  3N6M A;  1RXO B;  3OSP A;  3MM9 A;  2V67 A;  3TRG A;  3M32 B;  2F40 A;  3M6W A;  3OUY A;  2EXU A;  2B6A B;  2GML A;  4RR5 A;  1YJ7 A;  5FII A;  1HWU A;  2F8H A;  1S1X B;  3EIC A;  3GR1 A;  4HHJ A;  4PAA A;  5AXL A;  4M63 A;  3K5L A;  5AE1 A;  1SIZ A;  4KPC A;  5J1E B;  1RYR A;  3PYG A;  3T1A A;  7AT1 B;  3TAM A;  3CD6 S;  1LFW A;  4RUH A;  5HP1 A;  1TKX A;  2L08 A;  2NZC A;  3DGP A;  2ZDP A;  1OY9 A;  3ZO7 A;  3TAQ A;  3MZI A;  1PCA A;  1RT6 A;  3PV8 A;  3ZZR A;  2FJX A;  4UUX A;  1E6Y B;  4JP8 A;  2A10 A;  1RAA B;  4QZV B;  2OEL A;  1FWK A;  1I51 B;  3UI3 A;  4DL6 A;  1ZTW A;  1RBO B;  4M5D A;  2YKP A;  3BN4 A;  4J7C A;  2ZH8 A;  3E8O A;  1IBL F;  4UQT A;  3H42 A;  1VC5 A;  4YFU A;  1X31 C;  2DYA A;  2HHP A;  2DNG A;  2CG4 A;  3OFF A;  1RHK B;  3HF5 A;  4C0H A;  4C0O C;  5CHC B;  1AXQ A;  1HL6 A;  4G1I A;  2K7K A;  5LJ5 Y;  4B9T A;  2V2Z A;  3HUL A;  3W2V A;  3AQO A;  3OFH A;  4ICL B;  3OQ2 A;  4I7F A;  3ZZY A;  2B4V A;  1V5I B;  4DOZ A;  3QSY B;  2L48 A;  2R8J A;  3HLU A;  3ZNJ 1;  3SQG A;  3UD5 A;  3UD4 P;  4YQW A;  4LQ9 A;  1HNZ J;  1WDT A;  3I5A A;  2C2D A;  3PW0 A;  3DLG B;  4K4U A;  2KT3 A;  3BN7 A;  2V6A A;  2GJI A;  1X0F A;  4O3P A;  3QLH A;  1ZM2 A;  3NCP A;  1NJZ A;  2SXL A;  1SL1 A;  3O8W A;  3BQ2 A;  3KLE A;  4NLG A;  4EK2 A;  4MIW A;  2WB4 A;  1XMQ F;  5ETQ A;  1HAR A;  2VU5 A;  5B08 A;  4X4S A;  3ADA C;  4RW6 A;  4Q0B B;  3RB6 A;  1RU1 A;  4OIX A;  5KFJ A;  1O0P A;  3DDN A;  4IOA Q;  2E1M C;  2MKK A;  4BC9 A;  3MM8 A;  2BJ7 A;  2IM0 A;  4NML A;  2MKY A;  3C15 A;  2ZFH A;  4CWB A;  3EUN A;  2E1C A;  1P27 B;  1VDH A;  4USV A;  4PKD B;  3SIP B;  3UDC A;  3OL7 A;  1JLA B;  3R5J B;  4I67 A;  2XMV A;  4NCG B;  2BJD A;  5HRO A;  1RT1 A;  4PXD A;  1VQ5 S;  2FVQ A;  1IQT A;  2D9P A;  3K57 A;  4IG3 A;  5A2Q Y;  1IR0 A;  1U1Q A;  4OI0 A;  2HNZ B;  2UXD F;  1RAG B;  5KFU A;  2YX4 A;  4IH6 A;  2BJ3 A;  4ZCK A;  3KK1 B;  2DEI A;  5IV3 A;  1I6J A;  1DAX A;  2OH2 A;  4JI1 F;  2BE7 D;  4Q2L A;  3ENA A;  4ZA1 A;  2WRM A;  5C25 A;  1N32 F;  1Z2Z A;  5AXN A;  4X65 J;  5HBM B;  4ZP6 A;  1VIS A;  1FJG J;  1YX2 A;  4DUZ F;  4H4O B;  2U1A A;  4JI8 F;  4V1A k;  1FT8 A;  1JXV A;  3POT A;  3DYA A;  5G0R B;  2B4U A;  4TLR A;  4ES2 A;  1U2C A;  2VA3 A;  4USH A;  2C2E A;  5KG0 A;  1IQZ A;  1WSR A;  3GIL A;  2RB7 A;  5HN0 A;  4ZIT A;  1EJ7 L;  1HBN B;  1ZOT A;  5F0W A;  3DOK A;  3CB4 A;  1NB7 A;  4P72 A;  1HBO B;  2A2D A;  3DN9 A;  1W2B R;  3OR1 A;  2R42 A;  2X1G A;  4JV5 F;  3MEK A;  3NRB A;  3G2X A;  1RAO A;  3IR5 B;  3O5T B;  5DGA A;  3HHE A;  4HHU A;  5C2C A;  5DDP C;  1MN9 A;  3CED A;  1X5P A;  1LK7 A;  1K9M T;  3CO9 A;  2RS8 A;  4PG6 A;  3OXL A;  1Q5V A;  2ROG A;  1GMV A;  1HD0 A;  3TAN A;  4OZ0 A;  1SC6 A;  4LF5 J;  4DEZ A;  1RT5 A;  1CJK B;  3T1H F;  2PGC A;  2AV5 A;  2EFG A;  4RUA A;  1VQ6 S;  3W1Y C;  5IT9 Y;  4OI4 A;  1JLC A;  2BKO A;  4G1Q A;  4B3R F;  1WHV A;  4OZ1 A;  5E33 A;  2HK3 A;  3EE3 A;  4I2P A;  2FJD B;  3A3N B;  3BO2 A;  2DHH A;  3CCV S;  4S0M A;  3FKB A;  3TJ8 A;  1HMV B;  3CPW R;  4ID8 A;  1F5B A;  4C8L A;  1N6Q B;  4YY3 F;  1D3W A;  4EZ9 A;  4LF7 F;  4DV5 F;  1KRP A;  1HHS A;  3ZTS A;  1N36 F;  5F9L A;  1VHF A;  3FK4 A;  5E3A A;  1M90 T;  4CH1 A;  1QVG R;  1G4C A;  4USU A;  1RYS A;  4G6V B;  2VFT A;  1S6P B;  4Z7C A;  2LXU A;  2BAC A;  1WC3 A;  3K8W A;  2J0X A;  1JJH A;  4FS1 A;  3HSJ A;  5F3Z A;  5GAE I;  2HLU A;  3QT7 A;  5D15 A;  4KHM A;  2A18 A;  2EFV A;  3VGS A;  4ED3 A;  3DOM B;  2GQC A;  1R27 B;  2QSW A;  3IWN C;  4X62 F;  3MPY A;  3BQ0 A;  3EXC X;  3KUH A;  2R2R A;  2CVE A;  5J2Q B;  2UVV A;  3MUM P;  1HPZ B;  3MEG B;  2YNH A;  4DR6 F;  3J7A N;  4DR3 F;  2OFG X;  2AKW B;  3V5R A;  2LQJ A;  2RRN A;  3OL8 A;  3DRR A;  1XIQ A;  4X84 A;  2OTJ S;  4B3O B;  4HI1 A;  3H59 A;  3M9N B;  4OHY A;  1U09 A;  4P10 A;  1RT2 A;  4CO3 A;  1Q5Y A;  2UXC J;  1DLO B;  4EU0 A;  3LP2 B;  4MFB A;  1RWK B;  1S9G B;  2Z58 B;  4Q5V A;  3ZTO A;  1RTI B;  1I5O B;  4PXB A;  5BYR A;  1WI8 A;  3QGH A;  2FY1 A;  3LP0 B;  4ZS6 A;  3HHL D;  2WVD A;  4KYZ A;  3CC7 S;  1UFL A;  2G9O A;  2H4W B;  1F5A A;  2C2O B;  2YKA A;  3LO3 A;  2ASY A;  4DV0 F;  2CQ0 A;  4CM0 A;  3GU0 A;  1NJI T;  1APS A;  4C8O A;  1F9F A;  2BQR A;  3IFE A;  3NLC A;  4ENO A;  2JLE A;  4C8M A;  2KJV A;  5J2N B;  3R97 A;  3H2U B;  3PFO A;  1HWK A;  4LFC J;  3K5O A;  2AJ4 A;  3ILJ A;  3EZO A;  3JTN A;  5D4P A;  3US5 A;  3L3C A;  1HQ2 A;  2DRD A;  1OSD A;  3KLI B;  2WK4 A;  4OJG A;  4R0J A;  3SFU A;  4LBH A;  2DHG A;  4MYT A;  3I55 S;  4KFB B;  4QIW D;  1TKZ A;  1T0T V;  3G8S A;  2XGQ A;  2NUH A;  2FB0 A;  1ZET A;  2NSB A;  1KN6 A;  1FFG B;  3GQC A;  4DR1 J;  1EQ0 A;  3MPW A;  3S8S A;  5E3C A;  5IM0 A;  2WOM B;  1X0P A;  1MRO B;  3VGV A;  4QW8 A;  4FF2 A;  4CNY A;  1CJV A;  1JKH B;  4OI1 A;  2EC2 A;  3AY0 A;  3GYX B;  3M30 A;  4QW9 A;  2HFO A;  1N0V C;  4O4G A;  1T05 B;  5L9X A;  1LK5 A;  4WK1 A;  3F44 A;  3GR0 A;  2CPY A;  3BBF A;  2V2V A;  3D1Q A;  3ZZP A;  1NHK L;  1U1L A;  3VGT A;  3D28 A;  3D6H B;  3CD0 A;  4JYA J;  1RSC A;  5J2P A;  5BR8 F;  3MCN A;  3RR8 A;  1T9Y A;  1IM4 A;  1ARO P;  3SV4 A;  2L9D A;  4QIV A;  4QIE A;  1CS4 A;  3FSI A;  4FF1 A;  4UUW A;  5F0U A;  2DRA A;  4J90 A;  1WI6 A;  3UVJ B;  1HWL A;  3I32 A;  1VQY A;  2W4D A;  3TUJ C;  4EEY A;  2HQD A;  2AP6 A;  3TNV A;  1VRU A;  3GYG A;  1OY6 A;  5LL6 d;  4QIF A;  2XNQ A;  1JLB B;  5A2Q U;  3OTD A;  1S0M A;  2HWI A;  1XNQ F;  3HMJ G;  3KLF A;  2AYB A;  5B0A A;  1T03 A;  1SKU B;  5KTQ A;  5KFK A;  2H4Y B;  1YJV A;  1VQN S;  3K58 A;  2HQC A;  3CJ2 A;  1UW9 A;  3R6L B;  4PG4 A;  2HG4 A;  3KLG A;  2C42 A;  2ZH6 A;  3MUR P;  2LCW A;  4ATN A;  4YDX A;  3W5X A;  3MCM A;  3U27 A;  2UVR A;  3JSM A;  4J9N A;  4EBE A;  2FY8 A;  4IDK A;  4DCP B;  2ZDO A;  1DJ0 A;  3U1L A;  2HND B;  3G6V A;  5IT0 A;  4LUB A;  4KIA A;  2Y0S D;  3OL6 A;  3TUP A;  1KQG B;  1B64 A;  4AXI A;  2JOQ A;  2IC3 A;  4MKV A;  4FYY B;  4RW9 A;  4IG0 A;  3ILL A;  3RTV A;  1XJW B;  4X4V A;  2OPP B;  2KH9 A;  4MK7 A;  4OZL A;  4KGV B;  3K5P A;  3SYZ A;  4KR0 B;  1OO0 B;  3ULH A;  1S1W B;  4F0H A;  5B0B A;  3KG0 A;  4LF6 J;  3IGV A;  4YR0 A;  3GG1 A;  1D0E A;  1A0O B;  2BOA A;  3KLH B;  3MPD A;  4ELU A;  4RO0 A;  3K0J A;  2YWE A;  2RUS A;  1C4A A;  2DH7 A;  3B54 A;  2E1A A;  3IS9 A;  3UNY A;  1EKS A;  4Y2C A;  1FDA A;  4F4A A;  2YPZ A;  1V3S A;  4ZPB A;  3PO4 A;  2WBR A;  5EWF A;  4X4T A;  3EGV A;  2HBR B;  4XAK A;  2JH3 A;  3K7R A;  2WON B;  5BXI A;  1U2R A;  1TVR B;  2XLJ A;  2DNP A;  3RAQ A;  2CPE A;  2J6T A;  4DV6 J;  1UJ4 A;  2V4J A;  2LMI A;  1S1U B;  1NCL A;  2C2K B;  2JJ4 D;  3M2R B;  1SH2 A;  3GFH A;  3LAL A;  1TV6 B;  2CYY A;  4C7Q A;  1NK9 A;  2LDY A;  2J6S A;  3GE9 A;  1NDL A;  1FDB A;  1S9E B;  3MMB B;  4DSL A;  4WKR A;  2HHH F;  4YB6 A;  2H5J B;  1G7C B;  2QA2 A;  4OZ3 A;  2E9T A;  3EGW B;  1RT4 B;  1GEH A;  2ILY A;  4K0K F;  5GVQ A;  3DCA A;  4A46 A;  3HZG A;  1CLF A;  2G2Y A;  3AFG A;  4CT8 A;  2AQ4 A;  1KWM A;  1XN9 A;  2LEC A;  2XCA A;  1IKX A;  1AA1 B;  4OZ2 A;  4ZPW R;  2QL9 B;  2FLN A;  2YKN A;  4F25 A;  2BAN B;  2BDP A;  4LF8 J;  1RE1 B;  4DPW A;  1UWB B;  2O01 C;  1S59 A;  1R8H A;  2KXH A;  3IRX B;  2BR0 A;  2CPX A;  1SCJ B;  1GFW B;  2I5J A;  3GSI A;  1ICE B;  2MZJ A;  1XC9 A;  3FMW A;  2FLP A;  1P1T A;  3R7S B;  5L1J A;  1ELO A;  4C9D A;  2DBB A;  4U7U D;  2XSF A;  3MAH A;  2V94 A;  1FKP B;  4Y2K A;  1IBK F;  2COL A;  3NAI A;  3NS6 A;  3RUB L;  5HQM A;  3ILI A;  1UCN A;  1U1M A;  3MOZ A;  2PFD A;  5KT6 A;  3UO0 A;  2XY5 A;  2IFX A;  2Z30 B;  2HIQ A;  4LMZ A;  5KG7 A;  1WJ9 A;  1MG7 A;  2RKI B;  4L3K A;  5KFT A;  5FJ4 A;  1CEZ A;  4P7V A;  3GV5 B;  2RD5 C;  2CDQ A;  2OIH A;  1YBU A;  4KHP F;  4DQP A;  1H38 A;  1N8R T;  4FBT A;  3QWP A;  4ZVF A;  1NPP A;  3WBZ A;  1VK8 A;  3RRK A;  5K14 A;  5KT7 A;  3K59 A;  2HFZ A;  4K4X A;  4ZN1 A;  4CTA A;  4F36 A;  2XLK A;  4G3I A;  3PR5 B;  1HNW J;  4DU7 A;  1RJJ A;  4O3N A;  4OX9 J;  3W62 A;  3UE2 A;  2L9N A;  1S57 A;  4OX6 A;  1R8B A;  2EK1 A;  4DQR A;  1VQ4 S;  3HSD A;  2MZR A;  4CYU A;  2CJ9 A;  4U9R A;  1W25 A;  2HYI B;  1KOO A;  1IWA A;  5DG7 A;  5L38 A;  5K8P A;  2WSC C;  1GTH A;  1LEO A;  1U48 A;  4KB7 A;  3PX4 A;  2M9K A;  2NXN A;  2DCU B;  2D69 A;  1TL3 A;  4E2F B;  1AFJ A;  2JSX A;  5ETT A;  4LRD A;  2MGZ B;  4HAC B;  3QSI A;  1ZZN A;  2GVZ A;  1BHN A;  3W63 A;  5KOW A;  2PC6 A;  3N4W A;  4NLS A;  1C1B A;  4RBT A;  4C97 A;  1C0U A;  2BRL A;  3EGZ A;  2XS7 A;  2DGQ A;  2RQM A;  2E7V A;  2MTL A;  1FRX A;  3PDN A;  3M32 A;  4IQX A;  3GG0 A;  1FHT A;  5CZX A;  1LW2 A;  5IV4 A;  2GZO A;  4BS2 A;  2B6A A;  2MQO A;  3PW7 A;  2VZ9 A;  3M1V A;  4C0B A;  2V63 A;  2HUR A;  4TXS A;  1TU0 B;  5HVG A;  4E8U A;  1UVL A;  3V81 B;  4OYO A;  1BQN A;  3QRQ A;  3TR5 A;  1TK0 A;  3V6J A;  3R6G B;  2CG8 A;  3GJS B;  1LW0 B;  3N9U C;  1F2H A;  4ZHR A;  4KGM A;  4IRC A;  4WIQ A;  3R9L A;  1N5Y B;  5DG9 A;  3GLJ A;  2I6W A;  2VFU A;  1FVQ A;  4A8O A;  4XPE A;  1UKU A;  1FNX H;  2EEY A;  1RKJ A;  1GMW D;  1ITP A;  3M8Y A;  2DJW A;  4LSN A;  1U45 A;  4ER8 A;  3HK2 A;  1ZBT A;  5E5N A;  2YWK A;  3W2W A;  3FFI A;  4I69 A;  4ZVU B;  2HQF A;  1EET B;  1URR A;  1HQU B;  4ED0 A;  1FO1 A;  5CCM A;  4IFY B;  4NA2 A;  3MMC B;  5ETO A;  2VKZ G;  4M5L A;  3VCD A;  4L76 A;  4ED2 A;  5CD4 H;  4NI2 A;  1IBL J;  4CP5 A;  1HKA A;  3NNC A;  4DZD A;  2E5J A;  5C42 B;  1MMN A;  1ZM9 A;  4ZPT R;  1KP6 A;  1I94 F;  2D1C A;  1QD1 A;  4FNH A;  1HBM A;  3HP6 A;  1UL3 A;  7FDR A;  5H9F K;  5DLG A;  3BJY A;  3FGV A;  4B3S J;  3G9C A;  4ETZ A;  1F9E B;  4OLO A;  2OI2 A;  4WJB A;  2HQG A;  2ZIT A;  1SH0 A;  1U0H A;  3I0R A;  3PJW A;  2BZ2 A;  1GTE A;  4HTI A;  1KTV A;  4L74 A;  1D9A A;  3E3X A;  9ATC B;  5KFZ A;  4DPU A;  2Y8Y A;  1SL2 A;  1KOH A;  5H1S V;  3MMA A;  1VJQ A;  4P52 A;  1IM6 A;  4ED4 A;  2CQ3 A;  2AJ2 A;  1HNX F;  2RU3 A;  2CJY B;  1CC7 A;  1AFI A;  2DH8 A;  2HFN A;  1RWX B;  1IVZ A;  1XMQ J;  4OYW A;  3VGU A;  4UST A;  1B3T A;  2EFP A;  1M5P C;  4IR1 A;  2RQK A;  3BM7 A;  4DV4 F;  2ATC B;  1JLA A;  2E7X A;  2FLO A;  3ICL A;  4DN0 A;  3H98 A;  3CJT A;  2KG0 A;  2RH3 A;  4ZVQ B;  5IC6 B;  1V3Z A;  2AX0 A;  2JVR A;  2KM8 C;  5HVF A;  2UV8 G;  2VQF J;  4F2R A;  3MXH P;  5M2P A;  1WSV A;  1M5K C;  3L7U A;  2HLT A;  2OP5 A;  3CDE A;  1RAD B;  2KRB A;  1QUV A;  2BM0 A;  3MPU B;  5HLF A;  2LQ9 A;  4KC5 A;  3FVY A;  3T5L A;  4DL7 A;  4LRC A;  5F8L A;  3QJJ A;  1XTZ A;  1WOS A;  2H3E B;  1M0S A;  4W90 B;  2UXD J;  4H4O A;  5DRK A;  3H5Y A;  1NK8 A;  3LWM A;  2GIQ A;  1NJX A;  2ZHB A;  2MQ8 A;  4JI1 J;  4HL9 A;  3EVO A;  3LF0 A;  2ROE A;  3HXM A;  4AL7 A;  4RWW A;  5CYQ B;  3OTC A;  1PO6 A;  4CLZ A;  4JI8 J;  3H25 A;  5KFO A;  2BXJ A;  5DS7 A;  3NEK A;  3G6E S;  3TAR A;  3AQP A;  5LJ3 Y;  1HBO A;  4C8K A;  1IBM J;  3GFX A;  1VLY A;  4A8K A;  2ALY B;  3CJ4 A;  1SKW A;  4L75 A;  5D0G A;  1QAX A;  1KS2 A;  5GME A;  3Q8S B;  2R8G A;  1IR1 A;  3MED A;  1CUL B;  1YTY A;  2EC0 A;  2ZOM A;  2XZW A;  2AWZ A;  1WTB A;  2LKZ A;  1RA6 A;  3BYP A;  5I42 A;  4M5I A;  2QSF A;  4FVM A;  4OI3 A;  1UEU A;  4ZP8 A;  4J91 A;  4ZVG A;  4C2M A;  2V69 A;  3M2U B;  3QAU A;  3IAM 9;  2MKH A;  3KNA A;  1LWC A;  3PYF A;  1LKZ A;  3KYL A;  1JLQ A;  1NK4 A;  2ZJQ Q;  3HVA A;  3R1L A;  2Y1J A;  2F9D A;  4ELV A;  1DQA A;  1HYS A;  5AT1 B;  2D74 B;  2NQP A;  3V4I B;  3P3D A;  3Q23 A;  1JX4 A;  2A0F B;  2LU1 A;  2N3O A;  4WCE Q;  1S4E A;  3MM6 B;  3ZZU A;  2G4B A;  1UVK A;  4ZLN A;  1DY3 A;  1HNZ F;  3QMQ A;  2M70 A;  2HHX A;  2I38 A;  1M1G A;  1SJF A;  1PJ5 A;  4O3Q A;  2OO4 A;  4AQY J;  4GC7 A;  2AF6 A;  4O3S A;  2DGU A;  1N6Q A;  5DQH A;  1TK8 A;  5KFV A;  5HJX A;  3HVR A;  4HH1 A;  3LPY A;  2GGP A;  3GJT B;  4UOG A;  2UV8 A;  5HMZ A;  1RA7 A;  1F3F A;  2QC3 A;  2AIR B;  4K50 A;  2G1H A;  1IBC B;  3Q8Q B;  3V6K A;  2VG6 A;  2F1F A;  1H72 C;  4KO0 A;  4ZVS B;  2R2U A;  4OZN A;  2L3M A;  1U1P A;  3PHE A;  4DV5 J;  2CQC A;  2C3P A;  1RAJ A;  5FD1 A;  3GSD A;  1N36 J;  1VQ9 S;  4LFA J;  2R7X A;  1T94 A;  2KKH A;  4R8U B;  4WWS A;  2BUN A;  1KEK A;  4PWU A;  1RAC B;  1VHI A;  1PYS B;  1WF0 A;  4K7Q A;  1WWH A;  2KU7 A;  1T9V A;  3HM9 A;  4JV1 A;  2VBW A;  2EW9 A;  1AUS L;  3T19 A;  5J2Q A;  1HPZ A;  4CLW A;  3DM2 A;  2M3D A;  5D3G A;  4X64 F;  1QE1 A;  2B56 A;  2NXC A;  4WFB Q;  1IJE B;  1PGZ A;  3N5F A;  5ETS A;  2Z8Q A;  1S0O A;  2J9D E;  3O2I A;  3VZI A;  2E5L F;  4X62 J;  3MEC B;  4X65 F;  4B3O A;  2E5H A;  1FJG F;  2KN4 A;  4DR6 J;  3DRS B;  4DR3 J;  4Y6I A;  3QGI A;  3H40 A;  4IOC Q;  4CDI A;  4DCO B;  4MK9 A;  5U47 A;  2ZH3 A;  5DGB A;  2CFX A;  5CCL A;  4I4B A;  3LP0 A;  4YOE A;  4UOF A;  4EZ6 A;  3DI6 A;  1U49 A;  1SH3 A;  2QV6 A;  4HVZ A;  2QX0 A;  3D1O A;  4HLB A;  3EZ5 A;  5L9N A;  4F0K A;  4R5P B;  2DIT A;  4WTO B;  3AH6 A;  3D0I E;  5ETR A;  1HBU A;  2VBY A;  5CXT A;  3PJX A;  4RPF A;  1KVI A;  5D4L A;  2CNK B;  4YB7 A;  3CCZ A;  4KH1 B;  2WAQ D;  1P1L A;  1FFS B;  3H7H B;  3I4H X;  2QA4 S;  3I6P A;  1T02 A;  4NYP A;  4EUV A;  2BE2 B;  1QUP A;  4DLG A;  2G0I A;  3C66 A;  4CRJ A;  2AEM A;  2M88 A;  4BDP A;  5KG3 A;  4DSF A;  1VQS A;  4LRE A;  1KVJ A;  1LWF A;  2PMZ D;  4HEA 9;  2B43 A;  4QQB A;  1RTD B;  4FZV A;  2YVS A;  1WC6 A;  4G1P A;  4DMZ A;  2YPY A;  1RHU B;  2W4C A;  1Z1Z A;  1VGY A;  3W3S A;  4ZPD A;  2Y1R I;  2RAQ A;  1HW8 A;  4GVB A;  3H90 A;  1E6V A;  2RRB A;  3O3L A;  3NCR A;  1EQM A;  3KJV B;  2FJE B;  3B78 A;  2J9D A;  4M5N A;  4ZIW A;  1NHV A;  4M5H A;  2WOM A;  2PD1 A;  2M8H A;  2FGO A;  4K4T A;  1KFD A;  2EPI A;  3CJR A;  2JEI A;  4DV7 F;  5KFD A;  1KON A;  1HNI B;  4ZN3 A;  2E7W A;  1VR6 A;  2E44 A;  2BRK A;  3QT8 A;  3TAP A;  1FXD A;  4DUY J;  3AXM A;  4KTQ A;  4LR8 A;  4U7U K;  2B7C B;  4MT1 A;  1T11 A;  3HHK A;  2R9L A;  2HRT A;  3MWB A;  5CYM B;  1OQ6 A;  4BWJ A;  5L1K A;  3T9N A;  1GXU A;  3SDE B;  1YIJ S;  2C3Y A;  1VMB A;  3M7V A;  3CDB A;  2W7O A;  3C16 A;  3HT0 A;  1F1B B;  2YXL A;  5KFG A;  4DQQ A;  4CLU A;  5RUB A;  3KHL A;  2PI5 A;  4LQ3 A;  2VD3 A;  2IBK A;  3Q8R B;  2RHS B;  1VRT B;  1Q1K A;  3OTB A;  1JK9 B;  5CH7 B;  2FGC A;  2Z2Y B;  4K4S A;  1KNZ A;  4EWT A;  3QAT A;  2V34 A;  2AGQ A;  3DDI A;  1RHR B;  1FD2 A;  1VQ7 S;  3J7Y U;  4YS2 A;  1NKC A;  1BE4 A;  1DRZ A;  1SB6 A;  3P5B P;  3T6B A;  3I4P A;  1X60 A;  4LVN P;  3CXC R;  4A8M P;  1BQM A;  2MLZ A;  2CJB A;  1TL1 A;  3EVW A;  5D77 A;  3FRY A;  3P49 B;  4OI6 A;  2YKQ A;  2XO7 A;  8AT1 B;  2HMI B;  1YJR A;  3A3O B;  4NYZ A;  3ISN D;  4I6Y A;  4ZCI A;  3HDS A;  4DPT A;  3PJ9 A;  3TW0 A;  1C2P A;  2BJE A;  2MQP A;  2HND A;  1WEY A;  3IRW P;  3ZXW A;  1YI2 S;  2N7C A;  3CUL A;  4LIR A;  3LAN A;  1YQH A;  4WFX A;  4LSL A;  3CF5 Q;  2J7W A;  3HHL B;  3VR1 A;  4YEA A;  1HWI A;  1N52 B;  3D6F B;  3LAK A;  3NGU A;  4ZKA A;  3MD1 A;  2GC8 A;  5THW A;  1FEH A;  4OI2 A;  2M52 A;  4LFC F;  2B9W A;  2DXD A;  1S1W A;  1N5Q A;  4O23 A;  2QE5 A;  4PWW A;  3KLH A;  4MH8 A;  4ECQ A;  1RCO B;  3DHX A;  3WIU A;  3UQS A;  2UU9 J;  1EP4 B;  4O44 B;  2XMK A;  2M4M A;  3IG1 B;  4URS A;  4RNN A;  3C14 B;  1M1K T;  2AZ3 A;  4H54 A;  2DO0 A;  3BF4 A;  4A8F A;  2FPH X;  2VPZ B;  4FPI A;  2UUB F;  1X4F A;  3QZ8 A;  3ENW A;  2VL1 A;  2LDI A;  1PIL A;  2W9C A;  2W8L A;  2RE1 A;  1M5S A;  3MCO A;  3LH2 S;  2WON A;  4CLL A;  2IVF B;  1S5Z A;  4R0E A;  3VAJ A;  4NLW A;  3B6B A;  3IGN A;  4N76 A;  1RWO B;  2QTW A;  2ASJ A;  3PW4 A;  3LPE A;  1J5O B;  1I3O B;  4BWM A;  3MMB A;  3DLK B;  2DRB A;  4PXE A;  4C8N A;  3C19 A;  1MU2 A;  2WTF A;  3PW2 A;  2P6T A;  4L6V 3;  2LLZ A;  5LSL A;  1EX8 A;  3WX4 A;  2KXN B;  4LVO P;  4IYQ A;  1NRK A;  3B4M A;  4NA1 A;  4OV1 A;  4JYA F;  4RW4 A;  1YZ6 A;  3GON A;  1FWL A;  3C6T A; 
#chains in the Genus database with same CATH homology
 1U0H B;  5D0H A;  3C14 B;  1WC0 A;  1AB8 A;  4OZ2 A;  4CLZ A;  2GVD B;  4CM2 A;  1FX4 A;  4CLW A;  3MAA A;  4OYB A;  2WZ1 A;  1AZS A;  4CLT A;  1WC5 A;  4P2X A;  4OYW A;  4UST A;  1WC1 A;  3MAA B;  1WC4 A;  2W01 A;  1AZS B;  4NI2 A;  3ET6 A;  3C15 A;  3UVJ A;  1FX2 A;  1CUL A;  5D0R A;  4USV A;  5D0G A;  3ET6 B;  3C15 B;  4OYO A;  1CUL B;  4WP9 A;  1CJV B;  5D0E A;  4CLY A;  4CLL A;  3C16 A;  1CJU A;  4OYZ A;  3MR7 A;  1CS4 A;  4CLU A;  1WC6 A;  4WP3 A;  1TL7 A;  1CJK A;  4OYA A;  4NI2 B;  4USW A;  3G82 A;  3UVJ B;  4CLF A;  5IV3 A;  4USU A;  4WPA A;  1U0H A;  1Y11 A;  1WC3 A;  1YK9 A;  2GVD A;  2GVZ A;  4P2M A;  3C16 B;  2QV6 A;  3R5G A;  4OZ3 A;  1CJU B;  4CLS A;  2GVZ B;  1Y10 A;  2BW7 A;  1CJT A;  1CS4 B;  4P2F A;  1TL7 B;  4WP8 A;  1CJK B;  4OYI A;  5D15 A;  3G82 B;  1CJT B;  1YBU A;  1YBT A;  4OYP A;  4CM0 A;  3C14 A;  4CLK A;  4OYX A;  1CJV A;  4OYM A;  4CLP A;  5IV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...