5DS7A

2.0 a structure of cpii, a nitrogen regulatory pii-like protein from thiomonas intermedia k12, bound amp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
91
Chain Sequence
IKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.0 A Structure of CPII, a nitrogen regulatory PII-like protein from Thiomonas intermedia K12, bound AMP
rcsb
source organism Thiomonas intermedia (strain k12)
molecule tags Metal binding protein
molecule keywords Nitrogen regulatory protein P-II
total genus 17
structure length 91
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ds7A00
3NCRA 2O67A 1NH8A 3L7PA 1J2VA 4WK1A 4NYOA 3GSDA 3O5TB 1V3SA 1PILA 3BZQA 2NUHA 1NZAA 3O8WA 4RWWA 1HWUA 1NAQA 5D4PA 1GNKA 4Y65A 4C3MA 2GNKA 2O66A 2GW8A 4C3KA 4WK3A 5DS7A 4CO4A 3T9ZA 4OZLA 2JJ4D 2GX8A 4C3LA 4OZJA 2J9CA 1P1LA 3AA9A 2XBPA 4E98A 2Z0GA 4YB6A 3NCQA 4RLEA 4CNYA 4CO5A 4USJC 3TA0A 4D3HA 2ZOMA 2V5HG 2J9DE 3LF0A 2E66A 4NYPA 1OSCA 1UMJA 3AH6A 1V3RA 3CE8A 2DCLA 1Q1KA 4IYQA 1NH7A 4YB5A 2XZWA 1V9OA 3HLUA 3DFEA 4USHA 3OPKA 1V6HA 2RD5C 4OZNA 1VFJA 2VD3A 1H3DA 2XG8A 4Y6IA 2EG2A 5DRKA 5D4OA 4CO2A 4CNZA 4CO0A 4D3GA 3NCPA 5D4LA 4RX6A 1KR4A 4CO3A 3X3UA 3AA8A 1UFLA 2XULA 4AFFA 3M05A 4YB7A 5L9NA 4RWXA 3AHPA 3MHYA 2EG1A 1VHFA 1O51A 4ZK7M 1QY7A 2ZFHA 5D4NA 1XK8A 3N5BA 2CZ4A 2PIIA 2J9EA 1UKUA 2J9DA 4USIA 4R25A 3TA2A 2NS1B 2NUUG 4CO1A 3TA1A 1O5JA 1UL3A
chains in the Genus database with same CATH superfamily
2Y3YA 2DHGA 2E5HA 3OFHA 4F7VA 4ZMMA 5B0BA 1NH8A 4B17A 4F25A 3TUPA 4U8YA 1RADB 2HZAA 4WFXA 2IRUA 3OVAA 2JC0A 4DXLA 1V3SA 2WONA 3IS9B 1HW9A 2XMMA 1TL4A 1TZ0A 3DYAA 2NZ4A 1ZPWX 2CNLB 3BQ0A 1TFYA 2EKNA 3FBBA 4Q44A 4DFMA 2HFUA 1R6YA 4P75A 3R5JB 2N7CA 2AIRB 3I32A 1RT2A 2B9EA 4RW6A 2V2QA 4X65F 1SH0A 5HANA 3PW2A 2AP6A 3UDLA 3P45B 3LWLA 2IMWP 3RR7A 4NXNJ 3GR1A 3QLHA 3VGSA 2XS5A 5A76A 4C3KA 1G3OA 3ZO7A 2P8IA 1RWWB 4B9SA 2AX0A 2HNDA 2J0WA 4FXWA 4DQQA 5LMUF 3K5MA 2GJFA 2JJ4D 3TEGA 4C11A 5B0CA 5AXNA 1RA7A 3QLHB 4MKVA 1FERA 3NY0A 5F3TA 1TVRA 1UJ5A 1QAXA 3M1VA 1Y5NB 4HTJA 3MR5A 2VA2A 2J9CA 4LF6J 1C0UA 3AA9A 1FESA 2OPRB 3BYRA 3O1LA 4USMA 4NCGB 1BQNB 1YDLA 1IKXB 1OQ3A 3F56A 1YJNS 1BY9A 1VQPS 3GFYA 3C46A 2FC8A 3AQPA 2HHUA 3BDPA 1YKWA 1WF2A 2OPSB 3LPEA 4W90B 4TKTA 2LA4A 1SKRA 5KG1A 1ZM9A 1JJHA 2YNGA 2HFOA 3K5PA 3L95X 4HACA 4OLOA 3ZTSA 5C7PA 1V3RA 4JV2A 2M3DA 1RAJA 3FFIA 1UWAA 1XMBA 3DOMB 1B99A 4DX8H 4F50A 1U1PA 2XNQA 4V19J 2IFXA 6FD1A 1OMSA 2FHOB 1T8EA 2MB0B 2CZVC 2R9LA 1HMVB 2UXDJ 3R2DJ 4FNIA 4NMXA 3AD7C 3IAM9 2LYVA 2WVBA 3BBCA 3JAMU 2VFUA 2JFKA 4UQTA 1HPZA 4I64A 5T7LA 3U1NA 5IV4A 2ZC3A 3G8TA 4AL5A 2C28A 1KWMA 2E29A 1KRPA 1U0HA 3T1YJ 9RUBA 3A8JA 5D77A 4Y2IA 1AZSA 2GS8A 2OD6A 4ID5B 3D54A 2RVJA 4ZLPA 4KRWA 3H25A 2JSXA 2HBRB 1H3DA 1ZS6A 3WX8A 1UW9A 4BCAA 2YQ0A 2B51A 3KOAA 3W64A 2MKYA 3EXCX 1BQMA 4DV4J 1M5VC 4O3RA 2EFNA 5JJBA 4FBTA 4AYBD 1OPZA 1SJ1A 2E1AA 1O8BA 1Q8IA 1L3TA 2HZVA 3PKMA 3K17A 3OTEA 3W8PA 3MUMP 1CLFA 1FO1A 4CLYA 2CG4A 3AA8A 3UD4P 2W25A 2EK6A 1X4FA 2J0SD 2Q66A 1TK5A 1AFJA 1JXEA 4ELTA 1ACMB 2EVZA 1YRUA 2IHR1 4TU7A 4PG6A 2FJEB 2MHNA 4X66F 2DPIA 1LFWA 3RB4A 2F8MA 1T05B 1KOOA 1N34F 2IAJB 1SVDA 4ZP9A 2HHXA 4WFYA 2BW7A 2I5JA 4ZK7M 5EWEA 4JI6J 4JV5F 1KVJA 1VRTB 3CDBA 3ZZRA 1S9FA 2OH2A 4P7VA 2HYIB 2KFZA 2BKOA 3S7RA 2AGPA 2V9KA 4U7CA 3CCZA 1XMOF 2E1CA 3TQ1A 3CJKB 1KHVA 4R25A 1RWXB 2MQLA 3KJQB 4B3RJ 1HYSA 4CO1A 3AAWB 3M8ZA 5EX3A 5LT5A 1M5PC 4GMKA 2HZCA 3QGHA 3A12A 3AXKA 2OMOA 3R9LA 3W8GA 3V6KA 4NOHA 3FEZA 5HLFA 1RJJA 2KI2A 5DJBA 4WK1A 1RT6A 4AE5A 2QA1A 2LU1A 5CAAA 1HQEB 1YZ6A 4EFAC 3HHLA 4KKOA 1S6UA 4QJVA 4ZCIA 2HVIA 1PILA 3M2UA 2HURA 2N4DA 4M63A 1K73T 4KO0B 4ZVPB 1NK7A 5A8KA 2RKIB 5LMNJ 1NAQA 3CCMS 3ILLA 4I69A 4YUDA 1DHMA 1VIXA 3IBCB 1PKUA 2KM8B 1YZ7A 1NBEB 5D4PA 2DHSA 4Y65A 5GMEA 2JLGA 1FXLA 4I7FB 1VBKA 2CXEA 3GFXA 2OSRA 2KRBA 4WFNQ 1U24A 1XR7A 2IM3A 3OFFA 4NLQA 4NLPA 2W8KA 2ZH5A 3MM8A 5EWGA 5KT2A 2AJFE 4DG1B 2PI4A 5BJRA 2JZ5A 1I51B 2MJNA 4ZJQA 1UCNA 2Q1LA 5IFMA 1FE4A 3PJ9A 3FFIB 3PRBA 4LVOP 1HQEA 2I9SA 1AT1B 2KJVA 3TX0A 4LR9A 5LL6d 5HVFA 2KT2A 2XLKA 1HMVA 1W25A 2ZVIA 1VQMS 3BN4A 1XNRJ 4RLEA 3A1YG 3TUJC 3V81A 2KG0A 2BACA 1AYEA 2MQMA 4QWDA 5ETVA 1KNZA 2E9ZA 2JC1A 1GTHA 2R7RA 4ZP8A 3NAIA 1VGYA 1YJWS 2J9DE 4L74A 1WC6A 5HN0A 4AQYF 2HNYB 3DRXA 1XQIA 2CPIA 4PYAA 4J9QA 3W2WB 1FRLA 2H51B 1WF0A 2NQPA 2YKNA 1MROB 2RDJA 1F5CA 1KLMB 4LF2A 4ZVSB 2V4JB 3ZZ0A 4DSFA 1URRA 2IRYA 2J5AA 3JSRA 4OYOA 5F3ZA 5HP1B 4J7CA 2NCKL 2E1RA 2XWYA 3BB5A 4IQXA 2DRAA 1EP4B 1HA1A 1H6KX 2A10A 2DEJA 2L3MA 3J7YI 2GQ2A 2KN4A 3QJJA 1LQ9A 1OSDA 2HHVA 1KVKA 2IDEA 2K06A 3CNQP 5FIIA 3OPKA 3DNCA 1F3FA 4J37A 2FJDB 2LLZA 3NWGA 4I6WA 1QVFR 1L3KA 1KQSR 3DC2A 2CWXA 2LA6A 5BYQA 4J9LA 3MCMA 1UPMB 1QTMA 2UXCF 3LPYA 3M8QA 3JSYA 1TR0A 3BR8A 3EGWB 4DV4F 3N01A 4CNZA 3CW2C 3ITHB 1R27B 3CCTA 1S77D 4OMFG 2RRBA 3FBFA 5D0GA 4Y34A 4QIFA 3QGPA 4ECXA 1U02A 2DRBA 3AOAA 4F67A 2C3MA 3HD1A 5DZ6A 3DDIA 3OSPA 1OJ4A 4TLRA 4U96A 3EPGA 4R0EA 1C4CA 1N0VC 1YJRA 1AXQA 1C1CA 2KL8A 2V0NA 3LP1B 3OXFA 4XIUA 2R8KA 1CJUB 3Q8RB 1X7VA 3DOKA 2AD9A 1DFDA 2DR9A 4TU9A 4EBDA 2LDIA 3I9V9 1RWPB 1TAQA 3ENQA 3P96A 3LP1A 2BE7D 3GYXB 2OSQA 2H65B 3DRSA 4OHYA 4LVNP 2Q6CA 3SZ2A 4O0IA 4LBHA 3UD3P 1HBOA 1NHVA 6AT1B 5T14A 4MKYA 2MLYA 3GIRA 5KOXA 3N5BA 2N3OA 1PAEX 3W9IA 3RRGA 3CJ8A 4WTYA 2W9AA 1FJCA 1Y0HA 3L4BC 2ASDA 2VFSA 5KFVA 4FBUA 4RKUC 2NS1B 3TOQA 3DM2A 4ZP6A 2XS2A 3A3OB 1R0AB 5LMNF 2LFVA 3J7AN 2MPUA 4DUZF 1U09A 3DOKB 4UOHA 5F8IA 3ILIA 5L1IA 4JI8J 2XS7A 5MAOA 2FC9A 2XQCA 3QT5A 2HHHJ 4FP9A 4Q5VA 3KJVB 5DETA 3DOLA 3JYTB 1S79A 2CQHA 2QIFA 1IM4A 3NLCA 2BJ8A 2B8PA 4ANDA 3HVAA 4IKAA 5KFCA 4B3TF 3EZOA 1UVMA 2Q3PA 2H5IB 2HMIB 4PQAA 2YQ3A 3C19A 4C6AA 4UF4A 3GPAA 3HZGA 1QTNB 2DITA 3V5RA 3MR7A 2B56A 3J80Y 1KC8T 1YBTA 1IBCB 1TUWA 3IBFB 1MWYA 2XMAA 5ETLA 9ATCB 3D6MB 2DXFA 2OEJA 3UCUP 4C0OC 1TTHB 2VPZB 3KLGA 3SXLA 4DV5J 2VOOA 2XNRA 2ZH9A 2GIQA 3FQKA 5HMWA 2HNYA 3BREA 3T9ZA 3ISND 5KFKA 4NZ6A 4XO0A 3AD9C 2XO7A 1D9AA 1KFSA 2VG5B 1HWIA 4OL8A 2AX1A 5EHHA 4QYZJ 2VKRA 4L72B 3D67A 4OJ3A 2ZM6J 2HQ3A 3FZ2A 2B43A 4C11B 2ZH6A 3H42A 1W2IA 2HWHA 2Z0GA 3BO3A 4C2MA 4N8OA 2CJXB 5KFIA 1VJQA 1QDUB 1MMNA 2R7OA 2BE9B 4IG3A 4DZ6A 2V8GA 4QWBA 3FRZA 2PA8D 3GU0A 1PBUA 1OIAA 4HLBA 4KB7A 4NXMJ 3D1HA 2HEKA 2AW0A 3TVZA 1MWZA 3TZZA 2BJDA 4D3HA 3UW1A 3CCSS 1HI1A 4TY8A 5KFLA 3M9MB 4ZHRB 4LF4J 2D3O1 3NGUA 3VAFA 3G9CA 1PC5A 1YK9A 1BC6A 2W2QP 1RHQB 1H74A 4DCPB 4DR4J 3LANA 4Y00A 2A6MA 5J2MA 4HDHA 4IYQA 1Q1KA 3VAKA 1AROP 3MEEA 2LXUA 3TJ9A 4AUKA 1I94F 4RU2A 2V8DA 5E2QA 3PW7A 3EUNA 5HO4A 4OX9J 4F4XA 3KNAA 4KHPF 3HSZA 3QATA 1KQGB 3A8KA 3R7SB 1IVZA 3UVJB 3K59A 1U49A 3H4BA 2V4RA 2Z57B 4LRCA 4EO6A 4G1PA 4UW2A 1KFDA 1RQ0A 3I96A 5L39A 1NRKA 3J7A1 1ZAVA 2DR6A 3D1QA 4KV8B 1RP5A 2CPJA 2XTJP 3K2YA 1H72C 5A0YA 3H4DA 4OZNA 1OYDA 2UUCF 1F9HA 2YKOA 5DRKA 3NNCA 2MQNA 1GFWB 3BPDA 4IOBA 1MN7A 2A18A 5E7OB 7FDRA 5HQMA 2C2RA 3CTRA 1NK5A 4DR4F 2DNPA 1S7HA 4FYDA 3PW4A 3A8IA 1IN0A 3UCGA 3VZHA 3DLKA 2WW4A 2OMLA 1U1QA 1JLFA 5KT7A 3JXOA 2WTFA 2OFGX 3C16B 1NU4A 4Y2KA 4Z7YA 1NB7A 1S9GB 1T9TA 1MMDA 2OKQA 4MJKA 2HQDA 4KBIA 4JUZA 3JB9k 4IRKA 4WTOB 1MG7A 3LAKA 2QE5A 4DSKA 4ED4A 1HHTP 4JB8B 4RW7A 1Q16B 3UCZP 4CT8A 2KYXA 4A8XA 4F4YA 2M5YA 2ZBPA 1R43A 1IWGA 1FTRA 2ZHOA 4PXBA 4UOGA 4F8RA 2X1FA 3NNHA 2RRNA 1HQUA 1RWUA 1SH3A 2J7KA 2MQPA 2V68A 3TAQA 1JMTA 4GVLA 2HHWA 4USIA 2W7AA 5DG8A 1MNEA 4BS2A 3BS9A 1S97A 2YKPA 3DRRA 1FFGB 4MTPA 5AXLA 2XLIA 2MSSA 1RA6A 3TA1A 1NJXA 1H38A 1H2UX 4ZVHA 3FBCA 1B70B 4PABA 2R7WA 4DCOB 3TUIC 3W5YA 4CT9A 2DR5A 1FFWB 2GGPA 3BKUA 2ZHAA 1XERA 1XMQJ 2VQEJ 4O4RA 4LF7J 3JSMA 4Q8FA 1K0VA 3MECA 2OGUA 1FXRA 3KHHA 3KUGA 1FKPA 2NXEA 2VHGA 1U6BA 4K4ZA 4FF1A 3P8BB 4QU7A 2MEWA 3GV8B 3CDUA 3I0SB 1B64A 1IKWA 2NXUA 1XWLA 4ZJLA 1U0HB 2CQ2A 4UZCA 4WP3A 4QQBA 5MLCV 2W7PA 3LH2S 1KONA 3KWMA 2F7VA 4P2FA 2QLBB 3UN5A 4LF9F 3TO8A 3CMQA 2I6WA 1YJVA 1C1CB 4CCHA 1LXNA 4OYMA 1S12A 2DXEA 1R7IA 4I2PB 3DXSX 2ZJRQ 3T5KA 2HPUA 3R1HA 1RWKB 4N7TA 4ED1A 1NKBA 1NK9A 1DQ9A 4USTA 1YSJA 1UPPA 4NLVA 3I4PA 3ISNC 5HQ8A 5E3QA 3NGDA 2V4QA 4ED3A 3V6DA 3QRQA 3TX8A 3C66A 1JLBA 2QLFB 3AY0A 3W65A 3P3DA 4DR2F 4N8NA 2C3OA 2VDIA 2V8HA 3CSKA 3BF4A 5KFHA 2MJUA 3BV8A 4AD6A 4NLUA 3HDSA 2HVHA 4IFYB 2CJ9A 2KU7A 3U27A 3C3LA 1FX2A 4BC7A 1I6JA 2B3TB 1TQLA 2GJ2A 2HBYB 2DGQA 3C8YA 5KFNA 3AH6A 1CS4A 4OJHA 3KLFA 3FBEA 4BBYA 2X7IA 5HL7Q 3NNAA 2E1PA 3VF0B 1RT2B 4RW6B 2VPWB 3SCKE 3KLEA 2EKYA 4C9DA 1BQNA 2HLUA 4OIXA 1AUSL 2PDAA 2E9RX 1RTIA 2XM3A 2MZRA 2WONB 3IS9A 5KFEA 3DFEA 3AJ1A 3BO4A 4O3PA 4ED6A 4DL3A 3NOGA 4NRTA 5GADU 4ICLB 3R5AA 2ZH3A 1N48A 4PWDB 1T3NA 1LK7A 1M5HA 2G0CA 3MECB 1EB0A 2IJNA 2IYGA 4HI2A 3S8SA 5I42B 1HBMA 3D0IE 2CQIA 1YBUA 2LP4A 2VL1A 5D4OA 4ICLA 3U7JA 3LWMA 4CO0A 3HVWA 2DJWA 1ULRA 2VH7A 3MURP 4ZHRA 4YP3A 4KSEB 3BGRB 2QFIA 4CZCA 1HQ2A 2YNHB 1C1BA 1SC4B 2RQKA 2J7WA 1PYTA 5IT9Y 2GVDA 2BJ7A 2W4CA 4X4VA 3ZZTA 3DXBA 4TYAA 4RO0A 2QFJA 2B5JB 4H54A 4UTGA 1D09B 2HW3A 2K2PA 1LWCB 1DBDA 4KH0B 3ZZPA 4L75A 2K1RB 1WDTA 3QAEA 4ZCLA 1SJRA 2VV5A 4XDCA 5GADI 4TQSA 1S76D 2AJQA 2UXCJ 4LSNB 3FKBA 1FA0A 5I3PA 1J27A 3PFOA 5L9XA 3MM6A 2VG7B 4DV5F 3FMWA 3TUZC 4WFBQ 3OT9A 1V5VA 5L38A 1L3SA 1Y3KA 2C2OB 2OPPB 2OPQA 3GJQB 3IRXA 4LSNA 3M8PB 4IR1A 3M30A 1RT1B 2IM2A 4I2QA 5LXYA 3R97A 1FX4A 2QTWA 5HMZA 4Q43A 4ZVQB 4JYAJ 1SUQB 1P8GA 1IUJA 3IG1B 1XR5A 3LP2A 4N41A 3HFZB 3M30B 2VQEF 2MY7A 4RPFA 2QA4G 4LF7F 4ZVOB 2EW9A 1UWBB 4O4GB 4ERDA 4NYOA 1WC4A 2GHVC 4J9VA 3T1AA 1D1UA 1X0PA 4NE9C 3M9OB 5K8PA 4DR7J 1JLAA 1SI9A 2HIQA 3AXMA 4MIBA 4O3QA 1JX4A 3ILJA 1RWNB 2JLFA 4U6PA 5KFMA 3AT1B 2IJFA 4F4AA 1H2VZ 2F1FA 4DV1F 1RU1A 1U48A 1RK8A 3AD8C 1GNKA 4EGLA 3EPIA 2BJEA 3N9UC 2O66A 2K8GA 5CYMA 2X3GA 3CCES 5BR8F 2QL7B 3MMCA 4MKAA 2ZVSA 1CULB 3GLJA 4ZPBA 4V19X 4KHPJ 3P6YC 1XTZA 1UA0A 3C6TB 3Q23A 4RW8A 1J5OB 2CUYA 2WB1D 4C3LA 1WHVA 1IQZA 2F9DA 4DR7F 1R8AA 1S5ZA 2IC3A 3POTB 3VCDA 3NBPB 3SSRA 4KE5A 3W5XA 1N5QA 4K5SA 3E01A 4DR5J 2FIUA 3KLEB 1X4HA 2VPYB 2I0XA 3FNNA 4NX9A 4LJMA 5HSPA 3OHAA 1KVIA 3AB2B 4LF4F 2ZDPA 4DV6F 1Q8BA 3PACA 3CJSA 1Q8LA 1FDDA 3QWPA 2FGOA 4IG3B 3WC0A 5HVHA 4QIWD 4LIRA 3JSMB 2ADBA 2N7YA 1AZSB 1FDNA 2NXNA 3VQSA 3IR5B 4W98A 2GQQA 3H5SA 3O2IA 5DGBA 3BGOP 4TY8B 3T5HA 2BM1A 1X4CA 3FCHA 3N6NA 3ISZA 5SZTA 4JI0J 2BRKA 5D15A 1XC9A 2H54B 1SQEA 1VK3A 4RUBA 2FUG9 3IXQA 5ETPA 1GMWA 3CMES 4G65A 2ZEJA 3SFGA 2F3JA 2M7SA 2OPRA 5E3AA 2MGZB 3PXGa 2FLNA 4HHJA 3W2VA 5KFSA 1ROFA 4I56A 3TR5A 3OJSA 4JI3F 1YRTA 3TYTA 4UT4A 2DO0A 1M5OC 2UZAA 4DLEA 4F4ZA 2VU5A 3G86A 4I1TA 2MHEA 4HT7A 4USHA 4NCBA 1TP7A 2LQ9A 4LF1A 3PHEA 2Y9HA 4M95A 3KHRA 3EZ5A 3CCJS 1TK8A 2RUGA 1A7GE 1MROA 1G4CA 1SC6A 3CD5A 3EVOA 1LKZA 3TZYA 3RZAA 2MXYA 2KFNA 3M32A 3KHLA 3GTYX 1FNXH 5D0HA 1S1VB 2JRSA 3K7RA 4K4WA 3JS9A 2PFFB 4AQYJ 3LW5C 3QT7A 4J5OA 4OZ1A 5EGYA 1AFIA 1FXDA 4QWCA 4LF5F 3TJAA 5KFGA 1QAYA 2RUSA 2W2NP 3HCXA 1FDAA 1TAUA 4G1IA 1C0TB 1S1TB 1F9FA 1UZDA 1VS3A 1LWFA 2E5IA 4C8ZA 4WIIA 4CP5A 2DISA 5KG6A 2VDHA 3A13A 2P9CA 4FKYA 3OVBA 2BRLA 4TU8A 3CIMA 2CADA 1IKVA 4NLYA 1O51A 3BQ1A 1WC0A 4DL5A 2DNMA 1FRHA 2B4VA 3O6QA 4LQ9A 4PKDB 4KH1B 4FYWB 5B09A 2E5LF 2G1HA 2XMUA 2G4BA 2OO4A 4DPUA 2Z58B 2FLPA 4HHUA 4RW8B 2G13A 2MZQA 3MPVA 5J1EB 5ETQA 1VLOA 2R8JA 4B3MF 1S59A 1NSAA 1DARA 2C2ZB 1NPPA 1SQGA 2IJRA 3N4WA 4WYWA 4TVAB 4DF8A 4I7FA 3I87A 2D69A 2GHWA 1HD0A 3W66A 1RBOB 3FVYA 5FLXY 3IRWP 1LWFB 5KFXA 2FZGB 3PCOB 4X4TA 1FE0A 2DNHA 2HNZA 2J76E 2NSBA 1RLCL 3MAAB 4P2XA 4QYRA 1J2VA 3GCXP 4K8RA 4DG1A 3Q22A 3HSDA 4ES2A 5KG7A 2AYGA 4UY8T 3MEKA 2RIJA 1T95A 2MKIA 3AOBA 1PG5B 2H1YA 1BUXA 4DPYA 1RBAA 1LEOA 4YN3B 2BANB 3WIVA 2FD2A 2IA0A 5CYQA 5JUMA 1Q82T 3HKWA 2BA9A 3GYGA 5KTQA 3F73A 4FVCA 4C7QA 5B08A 3FSXA 1AUDA 3PJXA 4C4WA 2A1BA 1HNVA 1X5TA 3H2LA 5LSRA 3KK1A 1Y9OA 4WK3A 3VTIA 4GKKJ 2MYFA 2GAHC 1PCAA 1IR1A 1FDBA 1TMMA 2BVZA 2OPQB 3PW5A 3CJ2A 5LMUJ 2F4VJ 3ZZOA 1Y3JA 1MLAA 3KK1B 3M2RB 3GV7B 2UUTA 1HNIA 3CF5Q 2ZD1A 4H4MA 3OUYA 3DLKB 4L3NA 1IJEB 3PYFA 3I9ZA 3KUEA 1HBNA 4YHHJ 3QJLA 2CJYB 4URGA 3H8YA 4F3OA 4KGKA 4M5GA 2GA7A 4NXMF 3N28A 2RSQA 2CQ0A 4DQIA 3TA0A 4WXWA 2MKSA 3KK2A 4P10A 4USVA 4A8MP 2XY5A 2OEMA 2VKZG 2CDQA 2CA9A 2JDJA 2Y0BB 3NRBA 4I4BA 3QGGA 4YHHF 3RAQA 1VBXA 2JEIA 4I6AA 2EPIA 2UU9F 3KLIB 4ZVEA 2QYCA 3UDVA 5E41A 2Z8QA 1EETA 3H59A 4KAIA 1S1TA 4M5NA 3OFGA 4WU3A 2UV8A 4C0HA 1KLNA 5KOWA 2CWKA 1IBMF 4L73A 3MMCB 3I5BA 3HVRA 1FWKA 5CXTA 1BQXA 2CJKA 4N47A 1JLGB 5F8LA 2BQ3A 1OY6A 2O5DA 2JX2A 5E3RA 3UN2A 1RAIB 3GYNA 3UDEA 4LT6A 1RT4B 2PSZA 2ZE2A 1JJCB 2YH1A 4BWMA 4ENOA 4R8UB 3HSJA 5F8HA 1KS2A 4DR1F 3PFEA 1ZPVA 2HKEA 3HHLB 2W8LA 2R8IA 5AE1A 4DR3F 3Q83A 2RAQA 2FJAB 2VBWA 3OTOJ 4C8OA 4ILLA 3P5BP 3C6TA 3UI3A 3GE9A 4TLQA 3SV3A 1S6QA 2QX0A 2F65A 2WZ1A 1N36F 3RG6A 2DGWA 4JI5F 4ZN3A 4HYKA 5HI7A 4JI1J 4EZ9A 2CQGA 4HVZA 5FLXU 1SKUB 3D1OA 4IR9A 2YNIA 1S99A 4X64J 5I3UA 1VRUA 3NMAA 2ZUGA 1W26A 3FZBA 4PEOA 3CJKA 1X31C 3VVTA 4O3OA 3EMTA 1MU2A 4IOAQ 5C2CA 1FEEA 2DYAA 4MAKA 1YGYA 2GVZA 3ET6A 2CNKB 2QO3A 1CJKB 4EUVA 3HXMA 4RNNA 1RHRB 4ZPAA 1HHQA 2RB7A 3DLGB 2BUNA 2R3VA 3BH6B 3NEKA 4ZVUB 1EJ7L 2NXJA 2M8HA 3GSIA 1FNMA 4O44B 4DU8A 2WK4A 1YX2A 1RB0A 1RHJB 2K1RA 1S0MA 2YBVA 3KJFB 5D3GB 4YR2A 2HFSA 3RB0A 2GQCA 3CD6S 1W7WA 2CZ4A 4J9NA 4GKJJ 4JI7F 2RMLA 2XWXA 3L7OA 1VQ5S 4KT0C 5IT9U 4J9KA 2BQUA 2AJ2A 1GMWD 5I4MA 3IN5A 4FXVA 3B82A 4B3RF 4KY3A 1NJIT 2ATCB 2FPHX 2YKNB 1CJUA 2DHHA 1FJEB 1LWXA 3PO5A 3R5CA 4KYZA 1JLQA 1FRXA 3DM2B 2R4FA 4H4OA 4QIEA 3CWJA 4NLRA 4DSLA 2NREA 4MK7A 4ALZA 4FPRA 3BSNA 3DYAB 1G7CB 3LAMA 2Q6BA 5DQIA 2PC6A 4GVBB 2GCFA 4M5JA 2QL9B 2YWFA 3BN7A 4QCLA 5H9FJ 4E2FB 1HWUA 2JEJA 1WELA 2VQFF 4ZP7A 1L5UA 3I55S 4UUWA 1JWWA 1PBAA 4ETZA 1VLYA 1PC4A 2YH0A 1JLCA 4I68A 3PR4A 2A0FB 2DIVA 2RJZA 4DFKA 2BQRA 4ELVA 3D66A 1D8ZA 1DTQB 3QO9A 2G0IA 1RUSA 4DL2A 2R42A 3FGVA 3EGNA 3M8RA 2R7XA 1S6OA 1XN9A 2LU2A 4OLPA 4S0MA 1K8AT 4FDFA 3RRHA 4OZJA 4PXDA 3S1TA 3MM5A 2XMKA 3DI6A 4M5HA 3MUTP 4PR6A 3BJYA 1HNZJ 1KEKA 1N4LA 4X2BA 4WPAA 4XPCA 5BYSA 3PR5B 1L3VA 1X4EA 3ONQA 2WRMA 4EBEA 1C0UB 3E2EA 4ZIVA 3ET6B 2K7KA 4RU9A 4ECZA 1GX5A 1LK5A 1LWEB 4OX6A 5GMKa 5DLGA 2A3JA 2IRXA 1IKXA 5B7WA 2E5JA 1WKJA 2HVEA 3LF0A 4C48A 4NYPA 1IBLF 1P6TA 4ZITA 4NYZA 1WOSA 3T19A 3E3XA 7AT1B 1OPIA 3N6LA 1OWXA 2LQ8A 4AXIA 4C98A 4EI2A 5KFPA 3Q8PB 2W9BB 2HHPA 1TK0A 4G1QB 2ACYA 4RBTA 4QYZK 3KMQA 1CQMA 2BX6A 3W2VB 3CJQA 2Y8WA 3NS6A 2FJXA 1NCLA 2X1BA 3HO1A 1Q0NA 1Q95G 3DLGA 1UP1A 1SC3B 3VAGA 4KIAA 4M5LA 4GC6A 4TQRA 2BW2A 1FTCA 1JNZB 4K50A 1FJ7A 2FHKA 1T02A 3BSCA 3OR2A 3PIOQ 4X64F 3TARA 2Z2LA 5DDOC 1NZ8A 1NK4A 2F40A 5H9FK 4IG0B 2EFVA 5IV3A 2KFYA 2VD3A 3Q8YA 4K4VA 2DGUA 2E1MC 2EG2A 1ZZFA 4AL6A 4H4KC 3DHWC 1N36J 4LFBF 5FJ4A 1P27B 1WI6A 1FRJA 5DG9A 4QW9A 5IM0A 1WI8A 1ZAXA 3RBEA 1R0CB 3KDOA 4ZCMA 4NI2A 2VC1A 1FD8A 3PDNA 1S1XB 4L6V3 5FDLB 2E44A 3VGVA 3MAQA 3VAIA 1X9MA 4DPXA 4QBUA 5JXSA 4FXDA 2M9KA 5EUHA 2IBOA 2D3OR 2R7VA 2BKPA 2YPYA 2JH3A 2IM0A 3I31A 4RW9B 2MKHA 2GV1A 2JEFA 2COLA 2GAGC 3JQJA 4HH0A 4BC9A 2VB6A 3ETMA 3HPOA 3D2WA 4K0KF 2YXLA 2VBZA 1BWEA 2OHDA 5AXKA 4CLPA 1N5TA 5IT4A 3NKYA 2XB2D 3CULA 3C15A 5L1JA 1C0TA 5GAGU 3KMSA 1HWJA 4LREA 1XEZA 1Q78A 1RBLA 4PCQA 4F0KA 1YITS 3DRYA 4DUTA 3P4UB 4Y2MA 3E01B 4CH7A 1RABB 2PN6A 1FKOB 2MKCA 1Z1ZA 3C6UA 2UXBJ 2ABYA 5JVHQ 3RB3A 1U1LA 2NSCA 4YR0A 2AJ4A 2GIRA 1E6YB 1ZH5A 2ASLA 3NXZA 1F60B 3C16A 2W9CA 4Q0BB 1IKYB 1OYEA 1Y5IB 4CH0S 1WOOA 3PRVA 2NPIA 5K8MA 5J2PB 1SXLA 2HG4A 4ECVA 4U8VA 3PRDA 4B3SF 3FSIA 1HYSB 3G96A 5THWA 2W9CB 3HFKA 2EC0A 1O0PA 4ZVGA 1XNQJ 1HBUA 1CJTB 1PAUB 1IR2A 1RE1B 2DY9A 3DHXA 3M8QB 2ZUAA 3O5TB 4ID8A 3MM6B 2XC9A 3WC2A 2CPXA 2PD1A 3K5LA 1QE1A 4DS5A 4DR1J 3OTBA 1B0TA 1RHUB 5IWAJ 3DDNA 3AB4B 4F2RA 2JWNA 1FWLA 3EVMA 4M5DB 8ATCB 5HMXA 2CJBA 2GFFA 5D0EA 2X51A 3SIPB 2GNKA 2D1CA 1HBOB 2V8VA 5BXIA 5F0WA 1YRXA 1ITPA 3DRPB 4HEA9 2JOQA 1RISA 3H5XA 2ZWOA 5HROB 4IRCA 1BGXT 2W01A 1NB2A 2OPPA 2PA3A 3GONA 3IRXB 4DL0C 5K8OA 8AT1B 4WZQA 4B3OA 2QMWA 3ENAA 2RHQB 2V94A 4K4UA 1DLOB 3FC9A 3V81B 1U1MA 1RYSA 1Z2LA 1I1GA 2POKA 3DRSB 1NDCA 5HATA 4ECWA 1SJ3P 2O1PA 2CQCA 2KT5A 3GFHA 4KGXB 3NCQA 3D5MA 3UNYA 2ZKTA 3SQGB 4DV6J 2LECA 1WHYA 4DR6J 4EK2A 2WAQD 3M8SA 5GVQA 2BZ2A 4CLUA 1OS5A 1RI7A 3PKYA 1EHWA 5JMNA 3CIZA 4FN5A 1YIJS 2ZH4A 1GXUA 5KFDA 1NSQA 3OR2B 2KTQA 3PX4A 1F5BA 2EFGA 2P9EA 3IMQJ 2VICA 3KK2B 3SEOA 3TRGA 4LF6F 2IPOB 4C8NA 2EFOA 3HHDA 3KLVA 1NH7A 2LEPA 4K59A 2C22A 1RAGB 1R8HA 1U1RA 1GT8A 4WP8A 1SIWB 3GIIA 3CO9A 2RRAA 1V9OA 1JLAB 4Q2LA 2D9PA 1S9EB 3TW0A 1N5YA 5CD4A 1HNXJ 4EEYA 3L7UA 2WVFA 3F0NA 4NEYA 3UR0A 1TUGB 2WOMB 5B0GA 4X4SA 3OV7A 1HNWJ 1OQ6A 2NR0A 5G4DA 5AE3A 3MPYA 3CB4A 3GJSB 1H7XA 3MD3A 1SBRA 2HFZA 2QLXA 2MSTA 4FVMA 3UDCA 5DM6Q 3KLGB 3T1HF 1FKAF 1N33J 4Y6IA 1Y7PA 2AJ0A 4RNHA 2FYXA 4K5RA 2VODA 3HFVA 3IAS9 4D3GA 2CJAA 3BR9A 1K47A 1T9VA 3EZUA 4NA2A 2XLJA 3BBFA 2BANA 2DGTA 4LSLA 5K14A 5I3UB 3OJUA 5L1KA 1D9DA 2OTJS 4YDDB 4CLSA 3X3UA 1CQNA 1TVRB 3M1VB 2BOAA 4PG8A 3FUYA 2B5JA 3QT8A 1SJQA 3K58A 5EWFA 2WB4A 2CG8A 2PMZD 2E7VA 3M4XA 2V9WA 1TFWA 2R7UA 2F9JA 3OR1B 1Q86T 2PGCA 4HHHA 1FRIA 2APOA 2YNHA 3CCWA 3GJTB 1QSLA 1EKRA 1RLDA 1RYRA 4F0MA 4ZDNA 2QEXS 2F8EX 3GCWP 2JEGA 1TL1A 2IIHA 1KOHA 4NASA 2N4CA 2UUBF 1PIEA 1RCXB 4E8UA 4ZOSA 1CJVB 1GXLA 1RT5A 3G2XA 3N6MA 3R5DA 2UVRA 1FT8A 4ID5A 2R2SA 5L1LA 2CQ4A 3MM8B 3DLEB 3Q24A 1F1BB 2DNZA 5IOLA 2RQCA 5DM7Q 2VJVA 3EWGA 4LFCJ 1EKSA 3QZ8A 2LDYA 3DU5A 4PRFA 3MCNA 3QSIA 4L3KA 2WBMA 1E6VA 3LGHA 3T3FA 4RUAA 2Q43A 4FYYB 5CCLA 1IKVB 2AJ1A 4RW9A 2KXNB 3KK3B 5DZ7A 3MM9B 1U1NA 2R7SA 1SL2A 1NDLA 3J80U 1E6VB 1R6VA 4YQWA 3PW0A 2UP1A 4B3OB 1NPKA 1BXNA 1JLGA 4ZPCA 4O4GA 2JNJA 3BKTA 3DLLQ 1R8PA 1HL6A 1WG1A 4RW7B 3DLEA 1RWVB 4XAKA 1U25A 3ETOA 4LFAF 1EETB 2XI2A 3MFIA 2HRTA 3ZFVA 1VIOA 4DX6A 1SH2A 3EDRB 1VQKS 2CNOB 2BEFA 2B9YA 3D9BA 4OX8A 1EAYC 5DQHA 1FD2A 3TAMB 1GX6A 5HQLA 2J7UA 3D6FB 4ZPDA 1A6LA 4WWSA 1FNOA 3MEGA 3Q89A 3DMJB 2DNQA 2BXJA 2WHOA 3FSYA 4FZVA 2HSEB 4R0JA 5AJ3F 3UE2A 1UEKA 4UQGA 5J2PA 3QIPB 4DMZA 4Q45A 4HT5A 1HIYA 2IAJA 2MGZA 3QRRA 1VBZA 3JQKA 5EN1A 3MM5B 5B0FA 1JB0C 1B0VA 1SV5B 2D74B 2LEAA 2KZZA 2XEXA 4DSEA 3PEJA 1TU0B 2ZOFA 5G0RB 1HW8A 5DO2A 2RS2A 1RTJB 2OFHX 2BMBA 4B9MA 4Q0BA 2HGNA 1PO6A 4J9UE 3KXDA 3BH7B 1UMJA 3KKFA 4RNMA 4QPXA 2DXDA 5KFOA 1UVJA 3CCVS 3K5OA 2B6AB 2HQGA 4J90A 2HVZA 2M8DB 1EARA 2RH3A 3Q8UA 3T1HJ 1YQHA 3R5GA 5HJYA 2FVPA 2BABA 2VUGA 1VQ8S 3HSGA 3CCRS 2FB0A 3UR3C 4AL7A 3SBMA 1D0EA 2J0QD 4GKKF 3MEEB 5F8NA 1WD6A 3G6XA 1VQOS 1SJFA 1SQFA 4K7QA 1HNWF 3IWNC 2CFXA 1ICEB 2PEBA 3NS5A 1TKXA 4WU2A 4A8WA 1DTTB 3B6BA 4OYZA 2FVQA 1UVNA 3W9JA 2ERRA 4P52A 4WBFA 2RD5C 5C5JA 2AHOB 2VZ9A 2MLXA 2R8HA 5T7LB 3CCUS 3R8YA 3BSOA 3MMBA 4OYWA 2D7SA 2XG8A 4CLTA 3MFHA 4OYBA 3N0VA 2KDOA 3DKDA 1S1XA 4GVBA 4NLSA 5FD1A 4CO2A 4YR3A 4OHZA 2BE2B 5HROA 2P9GA 2PMWA 2C3YA 4RX6A 4QWAA 1SCJB 2ADCA 1M0SA 2A2DA 3LP2B 2FGCA 4WCEQ 1UAWA 2HK2A 4WF9Q 3CJRA 1IR0A 3B78A 2CQ3A 2YPZA 3Q8VA 3KDNA 3QIDA 3TJ8A 3CC2S 1U2FA 3SFUA 1QVGR 2LCWA 3M6WA 3UFCX 1GQEA 2G9OA 1T9YA 4M5IA 1XNRF 4IFVB 3M2VA 5F9LA 2DO4A 1RTIB 2W4DA 4RWXA 2E5LJ 4DU7A 1RT6B 2E7WA 5KT4A 2XCAA 3C14B 1I94J 2WOMA 4U7UK 2ZH2A 1PJ5A 5ETKA 4IO9Q 3ZTQA 4MT1A 3ZZYA 2CVIA 5LSLA 2DPJA 5BR8J 1NDPA 5G0RA 1N88A 1QJHA 2RNEA 3CDWA 5K8NA 3KLHB 2DGXA 1PYOB 1RKIA 2C42A 2GJIA 4N77A 2XMJA 2K7JA 2UVUA 3M6XA 1S4EA 4OZ2A 4FF3A 1S6PA 2NUUG 4DV7J 5AXMA 1X0FA 4DSIA 3V6JA 4E0DA 4LR8A 4FF2A 2Y1RI 3D7SB 4ZA1A 1M90T 1HBUB 1X9WA 1RZMA 1FK9B 2Y0SD 3L09A 3R27A 3G8SA 1U1KA 3TZXA 1LFPA 1T05A 3HX9A 2C2EA 1QUPA 4ZLJA 1T11A 4Y2AA 1PJ6A 1NKCA 3CJ5A 1B3TA 2HLTA 4I0WA 2V69A 3O8WA 2V2KA 2B4PA 1FRKA 3GFZA 3BGLA 5LM7E 3U02A 4B9LA 1Q79A 4IH7A 2XY7A 5M2RA 1YJTA 4DV2J 2HAIA 1YWXA 2BOPA 4YS2A 3X1LB 1G1XA 4PG5A 4ATNA 2Z30B 2GW8A 3SSQA 1HLWA 3GZ7A 2W7OA 1GAOA 1VRQC 2C1EB 4CTAB 2DH8A 1TV6A 1DTTA 1Q4RA 2FQQB 1NKEA 2GX8A 1VR6A 3ICLA 1SIZA 4JI0F 2DVIA 2LQBA 3N5FA 4CYUA 4JV1A 2G2OA 1P1LA 2EFQA 2LQJA 2RQMA 4WJBA 3VWSA 4YMEA 5D8HB 2GMJA 4LIWA 4O44A 4IH6A 2XGQA 3I56S 3R7NB 2IM1A 2VASA 2EFPA 4EYHB 3PIPQ 5KFQA 4YFUA 2IMOA 2ZD1B 1CJVA 2QA2A 3OBIA 4H4MB 1TL7A 1S0OA 5DG7A 5T41A 2VA3A 4ITSA 1CS4B 5HBMA 4NI2B 2OP5A 3ELHA 5FDLA 3KJNB 5F0UA 4DPOA 4B9VA 2ZH1A 2C3UA 1DZ5A 4NZ0A 1JLFB 3LGNA 2UUWA 4X62F 2W2PP 2HBZB 1U2CA 3HZEA 4N5SA 1WC3A 1H2TZ 3M2RA 4P72A 2DH7A 4PXEA 2FVRA 2KRRA 3TNVA 4F36A 5CYJA 4HR2A 3RGIA 4J9RA 1S1VA 3HHLC 2ZZNA 5B0AA 5KFYA 4RBUA 3K5NA 4ECQA 4MFBA 3BO2A 4NA1A 2XZWA 4IUFA 1KLMA 2YNIB 3BQ2A 4C8LA 1X8DA 2R7TA 1T94A 6FDRA 4P6QA 4Q2MA 1N33F 3I5CA 3OL8A 2I5JB 1S1UB 1ZZNA 1UFKA 2IBKA 3D0GE 2B9XA 2IVFB 4DV3J 1U6ZA 1MN9A 1NM2A 3UN3A 2GO9A 1FF2A 5H9EJ 3CO0P 1D3WA 3EICA 4USUA 4G1QA 2G1DA 5CABA 3KNGA 1N56A 5HJXA 2FZKB 3NGRA 4PWWA 4X62J 3G8QA 4O3NA 1RTDB 4R8UA 3H5YA 1LNQA 1N5SA 1U2RA 5CYQB 3NL0A 4HDGA 1KR4A 4DR3J 1C1BB 1X9SA 1IBLJ 2J8AA 4DBQA 4ED7A 1RSCA 2RF2A 2HQIA 1VDHA 3QT6A 2Y1IA 1HKAA 1RAHB 3BGRA 3M9NB 2QLWA 3DLHA 2Y8YA 3DGPB 5E5NA 2GGPB 5U47A 5EDWA 2AQ4A 3FJ2A 4F4WA 3MOZA 1XMOJ 1HNXF 1FKPB 1CVJA 1WKLA 2JHEA 3HF5A 4CYUB 5L9NA 2V8PA 3KFWX 2AEFA 2MY8A 1U8SA 4HACB 4TXSA 5SUHA 1U7LA 1FK9A 5DLFA 2QLJB 1RTZA 2X3DA 3T6BA 5AE2A 2QJ3A 2ZFHA 3TVYA 5ETOA 3OSNA 1YVFA 2XYPB 3V4IB 3HT0A 1RHMB 2RF2B 4UUXA 1REGX 5C25A 3A4TA 5KFRA 2UVWA 2YWHA 3W60A 1GH8A 2LXIA 3M32B 2HHQA 1FWPA 1YJ7A 2D3UA 2WSFC 3IG1A 3RRKA 2B0GA 1TKXB 2AKWB 1QSSA 1K1SA 2U2FA 3IO1A 2C2MB 2KO1A 4KQZA 3L7PA 1OY9A 1EX8A 2ILYA 3H20A 4C97A 1RTHB 2Z2MA 3GMGA 1UTAA 4LBPA 3NGKA 2DHAA 2VBYA 3PTWA 1QAJA 4OZ0A 3MM7B 2DR7A 3MTJA 3BZQA 2GC8A 1M1KT 4RJVA 3KJVA 5GAEI 1YBAA 3W3SA 2L9DA 3CD0A 1XJWB 3DLJA 2MQ8A 3VGTA 4WKYA 3OD2A 4K4YA 1Z4UA 4DV3F 2V4JA 1ZM4A 4DL4A 3H2UB 3G6VA 4H4KA 2JFDA 2NXCA 3MM7A 1PGZA 4NLDA 3FRYA 4IO1A 2FY1A 1R0AA 2VQFJ 3MPWA 2B4UA 2RU3A 2QRRA 2QN6B 5J1EA 3PO4A 2Y1JA 1S7IA 2IYIA 4OHXA 3VAJA 2UXDF 4P2SA 3J7Z5 2M4MA 4B9NA 4P7TA 2MKKA 4Q8EA 4KGMA 2HS3A 3E8OA 4E98A 3CUNA 3BYPA 2ZC4A 3OLAA 2E9TA 4A8YA 4NWBA 2HNZB 4ZPVR 4B3SJ 3POTA 3GWCA 4CNYA 1T7PA 2DNOA 4DR6F 3C6UB 2WBRA 3M8WA 2XHCA 4YOEA 1RAFB 3PVXA 2X1GA 3Q2TC 3K57A 4X4OA 2ZJQQ 1APSA 1T03A 2L48A 4P74A 3JTPA 3MZIA 4TYBA 4JI4J 4EMDA 5KFBA 1TKZB 4QIVA 4YY3J 3TQEA 3W61A 2GO8A 3OQ2A 2UUBJ 4OYXA 2QYGA 3THVA 2OJ3A 3RBZA 5K20B 3QQCD 5ETRA 2WCXA 2KKHA 4L76A 3OL7A 1WORA 2LKZA 3RYLA 2V50A 2RDDA 3LGMA 4ZLNA 3CJTA 1V3ZA 4X4PA 4CLLA 2W1BA 4WZMA 2ZDOA 3AJ2A 1WG4A 3GIKA 2FJBB 4WKRA 5E3PA 3U1LA 1ZA1B 5LOQA 3TWZA 4JV5J 4OZ5A 4JBCA 3ZZZA 2BJ9A 2DBBA 4WXOA 1VFJA 1RT5B 3HKZD 4LRFA 2AYBA 1NSPA 1M5KC 3MCSA 4IDKA 1B7FA 3TEHB 2BM0A 2AMCB 2N3LA 1AA1B 3KTQA 3OL6A 2DR8A 2XY6A 2MZ1A 5A8RA 1SKWA 3GP9A 1HQUB 1NUEA 3PY8A 2HVDA 3FCVA 1F2GA 1Q53A 2B4OA 3GIJA 1UWBA 7FD1A 1IKYA 4QR0A 1HHSA 3IFEA 2H5JB 4DDFA 5IQ6A 3RTVA 1FVQA 4ECYA 5HP1A 2H4WB 3THTA 1S1WA 4JI3J 3BEGB 2ZM6F 3VALA 1EP4A 3MEGB 1C4AA 1FKOA 3H5UA 1F9EB 4HH1A 2FLLA 2BYCA 1VHFA 3W2WA 3ZNUA 4ZN1A 2QT7A 4QWEA 4ED5A 1PYSB 1YHQS 4C8YA 1YJUA 4IH5A 4NLTA 3OVSA 5GAGI 3ZTRA 4LUBA 1VQ9S 3RUBL 1VQLS 2AF6A 1VQYA 5BYRA 1F3VA 1QSYA 2Z2ZA 4JI4F 2CPYA 1UKUA 3TA2A 5GAEU 4DUYF 1HBMB 3BKFA 1KN6A 2L08A 2RDIA 1T3OA 2IC3B 3R7BB 1S9EA 3R6LB 1FCAA 1WUUA 1CSJA 5J2NB 4DEZA 5B0DA 5KG5A 1JJ4A 4OI2A 5LJ3Y 2HQFA 2I2YA 1RAAB 3FEYB 1TL3B 3MI7X 1DJ0A 3BDEA 3I0SA 3NAHA 3PG9A 4MIAA 3GQCA 3CCLS 4DPTA 1RTDA 4ES1A 3RJMB 1KTQA 2G0JA 2ROGA 5KFFA 3LA0A 1TL3A 4DWIA 4WE1B 5DGAA 1KSPA 4NPOA 2ZWPA 1DAXA 2J6UA 3QRPA 2EBGA 5CCMA 2EK1A 1NSKL 1XBWA 1Y00A 2MZSA 2VC0A 3DOMA 4LFAJ 2G2YA 1B7YB 3DDKA 4K4TA 5J1NA 2DT9A 2VIHA 4DV1J 3MMBB 4JI2F 1TL1B 2CPEA 1KHWA 2KJWA 2W2OP 2D41A 4KGZB 5DS7A 1X60A 3SCJE 4DS4A 1ZTTA 1S72S 4RBVA 3QJPA 4PWUA 4OI4A 3R2CJ 3BGUA 1VQ7S 3V6HA 1XMQF 1B4SA 2GMLA 1KQKA 5ETNA 3ULHA 2XBPA 2AV5A 2R2RA 1VMBA 2RHSB 4MK8A 4UOFA 1EQMA 1TKTA 1VQ6S 4M5KA 3LP0A 1S1WB 2F5GA 2M88A 2PFDA 3D6HB 4EWTA 3KLFB 1N52B 4P9SA 3OHBA 3PV8A 1R8CA 2ZOMA 1DRZA 2VONA 1G6BA 2CNNB 2HK3A 3HI9A 2DGSA 4ELUA 2QZ8A 1UZHA 1WOPA 3TAMA 1LV5A 3PM9A 4FPIA 1W2BR 2LMIA 4IFYA 4JI6F 3WIUA 3DMJA 3D68A 3NGSA 2RILA 4IDKB 1GMUA 5KG0A 3UPFA 2DCLA 3RAMA 4LFBJ 1H73A 3VHQA 1YLXA 2R2UA 3MMAA 4PG4A 3SDEB 2Z2YB 1DTQA 2DY1A 2KYZA 2KM8C 5CQGA 3HHLD 2ZZMA 1BD6A 1QUVA 3IBWA 3IWLA 3ZXWA 4ECUA 4A48A 1HFEL 2DCUB 4UZBA 3RBDA 1UETA 3D0HE 4GKJF 4OFZA 1N54B 1LXJA 1V6HA 4RW4B 3RW6A 2IY5B 2I8EA 2XI3A 3QFWA 2YKMA 2DGOA 2AYMA 2MDAA 3G87A 3JTNA 2MTLA 5KG2A 2J0XA 3HHEA 5F41A 1A0OB 4IRDA 1EZZB 4I67A 4RW4A 5CH7B 2Y1LB 3I4HX 1IKWB 5IXUA 4HKQA 4DJBA 5E33A 1TMJA 2FZCB 1UVKA 2Q79A 3ENVA 4DUZJ 3SSSA 2FHJA 2PE8A 1HWKA 3B8HA 1LOUA 2QMXA 5F8MA 3Q0AA 3OFEA 2CRLA 2XYGB 4BDPA 4X4NA 4B9TA 3R5BA 4NZ7A 4BLGA 1EQ0A 3GILA 4AXJA 3J7YU 2PEHA 5E0OA 2FTRA 4U7UD 3BSAA 4ZVTB 4Y2CA 3HM9A 3KYLA 1WTFA 5KFTA 3MOJB 1CPZA 3CJ0A 2YKMB 5HK4A 4N56A 1MU2B 2EC2A 4OV6A 5D3GA 2XSJB 4PAAA 4URSA 1CBKA 1NJYA 4LF8J 1G2EA 2P6TA 4GO7X 4DN0A 1HBNB 5EX0A 4ANEA 3SCIE 3DRPA 3KUHA 1LW0A 1K1QA 3I0RA 1RT7A 1VJWA 3CCQS 4YY3F 3G71S 4I2QB 4IG0A 1JXLA 1DURA 4U9RA 2X1AA 2KXHA 3R3TA 2BJ1A 3G6ES 4C8KA 4MYTA 5A2QY 2CVEA 1X5OA 2J9EA 3E51A 1Q81T 3IM9A 3H2VE 1VISA 2DD8S 2F4FA 3K8VA 4MIWA 2IA6A 3OUYB 3M2VB 3B4MA 1K44A 3NS7B 4KC5A 4OYPA 3UQSA 5A2QU 1UL3A 3WDOA 3SV4A 3CC4S 2O67A 1JLEB 1PJ7A 5IS2A 4ZS6A 4A8FA 4NLXA 3OTOF 3I82A 2AEMA 5AT1B 1IM6A 4OI3A 4XPEA 2HMIA 2BV3A 4OI6A 1N32J 1XNQF 4OZ3A 3KLHA 1TKDA 1N5YB 4F4KA 2HHTA 1CC7A 2CPDA 1RTHA 2PT0A 3IC1A 3QYYA 4ED0A 5RUBA 4JOUA 3KK3A 2QSWA 2JVOA 3UNGC 3J81j 2XSFA 2YKQA 4M1KA 4LF9J 1X4AA 4WIQA 1TL5A 4DR2J 1BWVA 4RUCA 3ZTOA 3TI0A 1Q5VA 2YWKA 3B4DA 2N82B 3G6YA 4MKBA 1UEVA 4A46A 4DHVA 5IZHA 3M8YA 2MQOA 2ZKUA 2RE1A 3MAAA 5CZXA 3P49B 3SI8A 2E7XA 3L9ZA 4OZLA 4ZJOA 1TELA 1XR6A 2KT3A 3DI6B 3J81Y 2AYEA 3C15B 4CWBA 2RT3A 2CQDA 3TANA 3C2PA 3LQVA 1WKKA 2CQ1A 1CEZA 5C42A 1YI2S 3HHNB 2RKIA 2GVDB 2V63A 3NGTA 2MLZA 5LSOA 1UVIA 4K4SA 4XTTA 1VC5A 2YX1A 4QU6A 3VV2B 1CC8A 3MUVP 2NLWA 3F41A 4RR5A 4CO5A 3G4SS 4F2SA 1P9QC 3MWBA 4A8KA 2UUAJ 3W7BA 2E66A 2GMHA 3PYGA 1OSCA 2OELA 3ZTPA 4M94A 4Y0FA 2YNFA 1CULA 1DQ8A 1PSDA 1T03B 1FHTA 5J2NA 3CE8A 4OI0A 4R5PB 5CD4H 5C24A 3SYZA 1OY8A 3OR1A 2FHJD 2WSEC 2CPFA 3A3PB 4OX7A 3SQOP 3Q86A 3QIPA 2XO6A 2ZH8A 3T1YF 2FDNA 2ATLA 1QE1B 3G82A 4WFAQ 3BPSP 2UV8G 4KKOB 2P5VA 2DNGA 4KHRA 5IC6B 2HHSA 2WVCA 2YWWA 5KG3A 2C2DA 1Y10A 1JLEA 2FY8A 2ZBIA 3PNIA 2DRDA 1JLBB 3RBXA 3A8EA 2B9WA 2H9ZA 1HI0P 3O3LA 2H48B 2HAFA 5F8JA 3L3CA 1HD1A 1RT1A 1S49A 3VVUA 5KT5A 5D4LA 1UJ4A 1H0HB 2OLWA 4B08A 4RL1A 2CZ9A 4CO3A 1P1TA 1RT7B 5GAHU 4DFPA 2VG7A 2Z56B 4DSJA 1Y4ZB 3G82B 3OXGA 4QR2A 5A8RB 2U1AA 3UWTA 1NK6A 4LFCF 1UFLA 2ZE2B 5L8RC 4BWJA 4A8SA 3FDSA 3HK2A 3N79A 4DLGA 1WJ9A 3CMAS 1M1GA 1NMEB 1IXKA 2HWIA 1NJZA 3DU6A 2UVVA 4Y28C 2EG1A 2KHDA 5K9FA 4DPWA 1ZM3A 2KHCA 1S6QB 2O01C 1UEUA 2AGQA 4NA3A 2BE2A 5DDPC 4WYLA 4DQRA 3TVKA 4DL7A 4KTQA 3GG0A 3M2UB 1JLCB 3S01A 4CM2A 1Q8KA 3EJMA 2J6SA 2UU9J 1T9UA 2YY3A 2XZDB 4JI2J 4ILRA 4ZVRB 2IDLA 3W1YC 2PMHA 2HRUA 1M5SA 2J8SA 5D0RA 4X4RA 5HLFB 4CI0B 2XMTA 5GAHI 2RQ4A 2YQ1A 3IM8A 5IC4B 1O5JA 1HR0F 2I1RA 2R7QA 4HTIA 4DF4A 2ZHBA 2V2VA 1SV5A 2ZZTA 3MD1A 1UJ6A 5IQQA 1TV6B 2PO4A 3EVWA 1KP6A 2DEIA 2K3IA 3DLBA 4DN9A 4KO0A 4XK8C 3GSDA 4GRSA 2ASJA 2FLOA 4OYAA 4DCJB 1KD1T 2P2CB 3UO0A 3KG1A 3ENWA 4ZCKA 1HPZB 4EBCA 1VRTA 2WW8A 3AFGA 1JKHB 1FI4A 4FKXA 4M5DA 1CJTA 1HR0J 1SL1A 2VPXB 1NK0A 3MR6A 3NOCA 1X4BA 4QIGA 1Z2ZA 3HVTA 1GEHA 4B3MJ 3O44A 4DFJA 4C3MA 2ILZA 1N6QA 4JI7J 3HULA 3OW2R 1NDKA 3I0RB 1H98A 2UXBF 3W5ZA 4CLFA 1UW4A 2QMUB 1NK8A 4ED2A 1WSRA 1VOMA 1X4GA 2JL9A 2YNGB 3D6TB 4M8LA 4CO4A 2MQQA 5KFJA 5ADZA 2DK2A 3ILOA 3HT3A 4C0BA 1NLKL 3VAHA 2LVWA 3U1MA 3MCOA 4JV0A 5M2UA 3MPDA 4R5PA 4NLGA 2ZOGA 2M70A 3EE3A 5ETSA 4ZLLA 4B9UA 2HQCA 3WHIA 5A0YB 3M6VA 1WNEA 1KTVA 2DNYA 2WVDA 1S48A 2OEKA 2RS8A 5HBMB 1UA1A 1H7WA 2VG6A 1RWOB 4PZVA 1EIYB 2UUAF 4LMZA 1I5OB 5ETTA 1SB6A 4IFVA 1WACA 4CLZA 2GZOA 2M2BA 4NLWA 4USJC 4BHQA 4MK9A 3P5TL 4LRDA 1TKTB 1LW2A 2V5HG 4LSZB 4F3QA 4B3TJ 1S10A 4K2XA 2B7BB 3C14A 3QFHA 3BBBA 3OXLA 3MR3A 3GIMA 4O3SA 2AU0A 1FRMA 3AODA 3Q8SB 1RU2A 1K9MT 3CGIA 3GJRB 1N5VA 3FCWA 1SKSA 1RT3A 2KXFA 3H98A 2CPZA 1K0TA 5HAOA 4JYAF 1P9YA 3IR7B 2M0GB 4PQUB 3F44A 2CAJA 4NCAA 1RT4A 2QC3A 3WBZA 3ZC4A 2EBEA 4OHWA 4KFBA 1RT3B 5KFAA 4EO8A 4W92B 4M5MA 4USKA 2ZJPQ 2OAUA 3Q2SC 4F26A 1JXVA 4PWDA 1RCOB 3K8WA 5KFWA 2KZMA 1R8BA 2IVMA 2QSFA 4Z7CA 5H1SV 3EDQB 2A6OA 5JVGQ 1IBMJ 2OI2A 4LF5J 3IA0A 2AT1B 3LOUA 2ZBCA 1WEXA 5J2MB 1AW0A 3BM7A 2P6SA 4PYDA 2EI5A 4HL9A 4LSLB 5K14B 2V6AA 4ZPTR 1N32F 2AGOA 2AEJA 5A8KB 1HWLA 1QD1A 4QR1A 3AQOA 3T41A 5HVGA 3DGPA 4RNOA 3SCLE 2YWGA 1VC6A 1IQTA 3CT9A 4LBIA 2DB1A 5CZVA 1FVSA 1AB8A 2EWHA 1HNVB 2RU9A 1U47A 5KFUA 1MSWD 1SPBP 1YG0A 1RAOA 2LQ5A 4LR7A 2K3KA 3A3NB 2W9BA 4DL6A 2EEYA 4KJIA 1F6TA 4Z2XA 2XULA 2AZ1A 3RAXA 3M05A 5J2QA 4YB7A 3EGZA 4LRBA 2OTLS 1UVLA 1HNIB 2YX7A 4OJGA 3JTOA 1WC5A 2YKAA 5L46A 5CA5A 3PX6A 3DOLB 3TP2A 1WDDA 4EZ6A 1N8RT 1CG2A 2MZJA 1N34J 1GK8A 1WHXA 2I38A 4PPZA 4Q7AA 5KT6A 2FVCA 4K4XA 2ALZA 1JJ2R 3VGUA 3DGVA 2CQBA 2D9OA 3CDAA 2CQPA 3HJVA 1M1HA 3QGIA 3LP0B 4K2JA 4YEAA 1F2HA 2PIIA 1LW0B 3PEHA 3T5JA 4K0KJ 4WP9A 4J9OA 2DIUA 2J9DA 4OHVA 1OO0B 4DV2F 4YDXA 2L9NA 4ECSA 3WX4A 4ER8A 3DCAA 1REVB 3J81U 3V6DB 2J6TA 1N6QB 2F63A 1QM9A 3CPWR 2GVZB 2OD4A 4DR5F 3R1LA 1V5IB 4I6YA 4O23A 2DNKA 3I6PA 2QG9B 3HMJG 2FJWA 1U1OA 1NHKL 3W62A 2MZTA 3Q8QB 4LF8F 3MM9A 3H90A 2CKWA 2NUHA 1BQMB 1ZA2B 4RWWA 3DN9A 5KG4A 5I3QA 5IM0B 3HP6A 1NJWA 4RUHA 1VCTA 3OL9A 4KPCA 2QA4S 1DY3A 1L3UA 2FHMA 1Q7YT 4OV1A 4KGVB 1REVA 2V2ZA 2VG5A 2HBQB 2DH9A 4FYVB 1KDNA 1U45A 3SDEA 2YVSA 2GHPA 3ITHA 4G6VB 1BE4A 1JLQB 4H4OB 4ZPWR 3V2UC 4JI1F 3NBPA 3VR1A 3NP5A 4W4MA 2DNLA 2SXLA 4DX5A 3DRRB 4J9MA 4PPDA 4QPTA 1J5OA 1FJGJ 2ZITA 3FK4A 2ZBQA 5A8WB 1SL0A 2KG1A 2B7CB 4ECRA 2BDPA 4UY85 1U8WA 2MMYA 2OPSA 3MAHA 2GIFA 4NLOA 4QW8A 3GV5B 1QLNA 5A6PA 2ZNZA 5F9NA 1CJKA 3LALA 1T9WA 2HS4A 3WQPA 2VFRA 1S4FA 2HGLA 4P73A 1S0NA 4ED8A 2YX4A 1VHIA 3ADAC 4LRAA 2G2ZA 3W63A 1E6YA 1I3OB 1NNDA 2CPHA 3EYZA 2XSJA 3VAMA 4IOCQ 2LEBA 1ELOA 3AJDA 2BJ3A 3PYEA 5CHCB 3NWRA 1T9XA 4OX9F 4DX7A 1S0VA 1RWMB 1URNA 1ZAWA 3PJWA 4F04B 2HIYA 4TN2A 2NZCA 3ZZUA 4YB5A 3QNWB 3R6GB 3QBCA 2OUGA 3T6JA 2DKOB 2XMWA 2JLEA 2NPFA 2R8GA 8RUCA 1JNRB 2MKJA 1LWCA 3KHGA 1WG5A 4G3IA 2WSCC 2DNRA 2DTJA 2L9WA 3CJ3A 4F3MA 4X65J 1WEYA 2PI5A 3QAUA 2F8HA 4MMOA 2AZ3A 3GB0A 1U26A 3JYTA 4QZVB 4DV0F 1XIQA 2CJQA 1MWQA 4EU0A 4X4QA 4F02A 1Q7LB 3QMQA 4PUOB 1WSVA 2FJVA 3KG0A 1NPRA 2O3DA 3TAPA 3M6UA 1WEZA 4ZVFA 2VJUA 3D4JA 1KQFB 1VK8A 1VQNS 1JIHA 1R3NA 3CEDA 3LUYA 4X4UA 4KR0B 3MPUB 1R0BG 3IP0A 3GG1A 3V4IA 4ECTA 3EM1A 4NEZA 2BBEA 1ZM2A 3FQLA 3KLIA 2XYHB 3H40A 4DV7F 4X84A 1R89A 4DQSA 2HWTA 4B02A 1J5EJ 2NYHA 3QO9B 2C3PA 4PQUA 4UOCA 5D6GA 2R2TA 3RR8A 2V67A 3H0PA 1S57A 2ROPA 2XZTB 4KHMA 4FF4A 1HARA 4KFBB 4PUOA 3MXHP 3MHYA 1YTYA 2XGPA 3OLBA 4DI6A 4USWA 2F4VF 1GXTA 2M52A 1BMQB 2NYIA 2HFVA 1ZETA 2CDRB 5C2GA 3CC7S 1SC1B 1RACB 2D3ZA 5C42B 1WC1A 3NG8A 1Y5LB 3LO3A 5D4NA 4ES3A 3I5AA 3D28A 4FNHA 4A8QA 1JK9B 2YTCA 3HHKA 4ILMA 4JP8A 3JSBA 1JQGA 2HNDB 4MH8A 5LJ5Y 4CIOA 3IGNA 3MMAB 2EXUA 2H3EB 2QV6A 3SMZA 2KVQE 5IT0A 1SJ4P 4CM0A 4OYIA 1VQSA 2QGFB 2XHWA 4ZIWA 2B6AA 3W9HA 1S6PB 3NCRA 3CD7A 5DDQC 2C2KB 1FJGF 3PYDA 3MF5A 1JKHA 1Q5YA 1ZOTA 5K5MA 2VOPA 1RTJA 1RXOB 3EGVA 4URQU 3FEXB 2ASYA 4IQMA 3UVJA 3MTKA 4TY9A 4A4JA 4J9PA 4FS2A 1U4BA 5H9EK 4PXCA 1KBRA 4CQ1A 2FVSA 1NZAA 2JVRA 4X66J 2YNFB 3CVKA 5D78A 2ZBRA 1IWAA 5A8WA 4U67Q 4KV8A 4DV0J 2UUCJ 1R31A 2KB2A 2E5GA 4V1Ak 2XMVA 2XCPA 5C24B 3ZNJ1 2AWZA 3RB6A 1UFWA 2ACMA 3EX7B 1VYAA 3K0JA 3OTCA 5KT3A 4YB1P 3MR2A 1U0SA 3HVTB 1HI8A 2CIMA 3IGVA 2ZH7A 3FMBA 4ETXA 3QPIA 4XDDA 4PG7A 1T0TV 4CDIA 2CYYA 1FEHA 1BLUA 3SQGA 3HD2A 1NHUA 3D3BJ 2HFNA 3BGFA 4I2PA 3JQMA 1GTEA 4NXNF 4YB6A 4OQJA 3D3CJ 4WE1A 3CJ4A 4GC7A 2H5EA 2VFVA 3PZPA 1DLOA 5ETMA 2H4YB 3US5A 1B0PA 2VBXA 1WHWA 1ZBTA 1X5PA 2VG6B 1TUVA 1RKJA 1C2PA 3THPA 5E3CA 3MEDB 4JI5J 1D8YA 2KH9A 4O0NA 4C8MA 2VFTA 4MYUA 1N0UA 3TZWA 1LW2B 3LTOA 2HRYA 4P71A 5AJ3J 5I42A 1F5AA 3QWUA 4GO5X 4QOTA 2HS0A 4JI8F 3UD5A 4ANCA 4Z37A 4DQPA 1BHNA 4WFZA 4EYIB 3VZIA 5GMDA 1RAEB 5CYMB 4RNFA 3J7ZT 1S1UA 5DDRC 2IVYA 3PHTA 2L41A 2A2CA 3OTDA 3HLUA 2V34A 1X4DA 4A8OA 4LQ3A 1KKHA 3MMJA 4MFBB 2DGVA 1RHKB 4P2MA 4A47A 1QAIA 3VQTA 2ROEA 1S9GA 4TNOA 4KPYA 3MGJA 2Z4PA 4U95A 2ZNYA 3B54A 4Y3CA 5LXRA 1IBKF 3K89A 5B0EA 3QZ7A 3CXCR 2OIHA 3KG4A 1GMVA 2DNNA 1WWHA 3NCPA 2HHHF 2VF3A 1RGVA 1YJ9S 2W24A 1ZYQA 1MMLA 4DZDA 2DHXA 3T5LA 4CH1A 1F0XA 3M7VA 1ZTWA 1IBKJ 1FFSB 3PX0A 1J5EF 2WVEA 3EXYA 1VBYA 1A9NB 4NRUA 2KVIA 2BKNA 3M8PA 4NL5A 4DUYJ 4NCGA 3NMRA 4AFFA 4HI1A 5DQGA 1VRUB 4NMLA 1HNZF 1LWEA 1D9FA 2C2NA 5M2PA 1SUQA 1NEEA 5KAKA 1U6FA 2QL5B 5J1PA 3MDFA 3AHPA 3H7HB 3CDEA 5J2QB 1DQAA 1TKZA 2HGMA 5ITHA 4CLWA 1X5SA 4J91A 1MW7A 5A6WA 5F8GA 3T9NA 3S6EA 1NXIA 1QY7A 4OI1A 4CRJA 4RZRA 2BR0A 1VC0A 4FS1A 1Y11A 1IJFB 1NO8A 1XK8A 3IWXA 2ALYB 1VQ4S 1RDRA 5KFZA 4F0HA 1TL7B 3V4MA 4FYXB 3QSYB 2W4PA 1WTBA 3HJFA 4CTAA 4AT1B 3AOCA 3WZ0A 2LXFA 3MEDA 3IR6B 3GR0A 3JAMY 4CLKA 3RU0A 1WF1A 4ZKAA 5C25B 2B8QA 5IWAF 4DOZA 4OJ1A 4N76A 1VI7A 1O6XA 4J9SA 2YWEA 5HMYA 2W2MP 3RW7A
chains in the Genus database with same CATH topology
4ZMMA 2DHGA 2E5HA 3OFHA 5B0BA 1NH8A 4B17A 4F25A 4WFXA 2IRUA 3OVAA 2JC0A 1V3SA 2WONA 3IS9B 1HW9A 2XMMA 1TL4A 1TZ0A 3DYAA 2NZ4A 1ZPWX 3BQ0A 1TFYA 4Q44A 4DFMA 1R6YA 2N7CA 3I32A 1RT2A 4RW6A 4X65F 2IMWP 3PW2A 1SH0A 3RR7A 2AP6A 3UDLA 3LWLA 3GR1A 3QLHA 2XS5A 4C3KA 1G3OA 4B9SA 2AX0A 2HNDA 2J0WA 4FXWA 4DQQA 5LMUF 3K5MA 2JJ4D 5AXNA 4C11A 5B0CA 1RTDA 1RA7A 3QLHB 1FERA 5F3TA 1TVRA 1UJ5A 1QAXA 3M1VA 1Y5NB 4HTJA 3MR5A 2VA2A 2J9CA 1C0UA 3AA9A 1FESA 2OPRB 3O1LA 4NCGB 1BQNB 1IKXB 1OQ3A 3F56A 1YJNS 1BY9A 1VQPS 3GFYA 3C46A 2FC8A 3AQPA 3BDPA 4W90B 1WF2A 2OPSB 4TKTA 2LA4A 1SKRA 5KG1A 1ZM9A 1JJHA 2YNGA 2HFOA 3K5PA 3L95X 4OLOA 1V3RA 4JV2A 2M3DA 1RAJA 3FFIA 4F50A 1XMBA 4DX8H 1U1PA 4V19J 2XNQA 2IFXA 6FD1A 1T8EA 2FHOB 2MB0B 2CZVC 2R9LA 1HMVB 4FNIA 3IAM9 2LYVA 2VFUA 2JFKA 4UQTA 1HPZA 4I64A 5T7LA 3U1NA 2ZC3A 3G8TA 4AL5A 2C28A 2E29A 1KRPA 5D77A 4Y2IA 2OD6A 4ID5B 3D54A 2RVJA 4ZLPA 4KRWA 3H25A 2JSXA 1H3DA 4BCAA 3KOAA 2B51A 3EXCX 1BQMA 1M5VC 4O3RA 2EFNA 5JJBA 2HHWA 4AYBD 1OPZA 1SJ1A 2E1AA 1O8BA 1Q8IA 1L3TA 3PKMA 3OTEA 3MUMP 1CLFA 1FO1A 3UD4P 2CG4A 3AA8A 2W25A 2EK6A 1X4FA 2J0SD 2Q66A 1TK5A 1AFJA 1JXEA 4ELTA 2EVZA 1YRUA 2IHR1 4TU7A 4PG6A 2FJEB 2MHNA 4X66F 2DPIA 1LFWA 3RB4A 2F8MA 1T05B 1KOOA 1N34F 2IAJB 4ZP9A 2HHXA 4WFYA 4ZK7M 2I5JA 5EWEA 1KVJA 4JV5F 1VRTB 3CDBA 3ZZRA 1S9FA 2OH2A 4P7VA 2HYIB 2KFZA 3S7RA 2AGPA 2V9KA 4U7CA 3CCZA 1XMOF 2E1CA 3TQ1A 3CJKB 1KHVA 4R25A 2MQLA 1HYSA 4CO1A 3AAWB 5EX3A 5LT5A 1M5PC 4GMKA 2HZCA 3QGHA 2OMOA 3V6KA 4NOHA 3FEZA 5HLFA 1RJJA 2KI2A 5DJBA 4WK1A 1RT6A 4AE5A 2QA1A 2LU1A 1HQEB 4EFAC 3HHLA 4KKOA 1S6UA 4QJVA 4ZCIA 2HVIA 1PILA 3M2UA 2N4DA 4M63A 1K73T 4KO0B 1NK7A 5A8KA 2RKIB 1NAQA 3CCMS 4I69A 4YUDA 1DHMA 1VIXA 2KM8B 5D4PA 2DHSA 4Y65A 2JLGA 1FXLA 4I7FB 3GFXA 2OSRA 2KRBA 4WFNQ 1U24A 1XR7A 2IM3A 3OFFA 4NLQA 4NLPA 2W8KA 2ZH5A 3MM8A 5EWGA 5KT2A 2AJFE 4DG1B 2PI4A 5BJRA 2JZ5A 2MJNA 5IFMA 2Q1LA 1FE4A 4LVOP 3FFIB 3PRBA 4YMEA 1HQEA 2I9SA 2KJVA 1BWEA 5LL6d 2KT2A 2XLKA 1HMVA 1W25A 1VQMS 3BN4A 4RLEA 3A1YG 3TUJC 3V81A 2KG0A 2BACA 2MQMA 4QWDA 1KNZA 2E9ZA 2JC1A 1GTHA 2R7RA 4ZP8A 3NAIA 1VGYA 1YJWS 2J9DE 5HN0A 4AQYF 2HNYB 3DRXA 2CPIA 4J9QA 3W2WB 1FRLA 2NQPA 1WF0A 2YKNA 1MROB 2RDJA 1F5CA 1KLMB 3ZZ0A 2V4JB 1URRA 2IRYA 2J5AA 3JSRA 5F3ZA 5HP1B 3BB5A 2E1RA 2XWYA 4IQXA 1EP4B 1HA1A 1H6KX 2A10A 3J7YI 2L3MA 2GQ2A 2KN4A 3QJJA 1LQ9A 1OSDA 2HHVA 5FIIA 3OPKA 3DNCA 4J37A 2FJDB 2LLZA 3NWGA 4I6WA 1QVFR 1L3KA 1KQSR 3DC2A 2LA6A 5BYQA 4J9LA 2UXCF 1QTMA 3LPYA 3M8QA 3JSYA 1TR0A 3BR8A 3EGWB 4DV4F 3N01A 4CNZA 3ITHB 1R27B 3CCTA 1S77D 4OMFG 2RRBA 4Y34A 4QIFA 3QGPA 4ECXA 2DRBA 4F67A 2C3MA 3OSPA 4TLRA 3EPGA 4R0EA 1C4CA 1N0VC 1YJRA 1AXQA 1C1CA 2V0NA 3LP1B 3OXFA 4XIUA 2R8KA 3Q8RB 1X7VA 3DOKA 2AD9A 1DFDA 2DR9A 4TU9A 4EBDA 2LDIA 3I9V9 1TAQA 3P96A 3ENQA 3LP1A 3GYXB 2OSQA 4OHYA 3DRSA 4LVNP 2Q6CA 3SZ2A 4O0IA 3UD3P 1HBOA 1NHVA 5T14A 4MKYA 5KOXA 3RRGA 2N3OA 3N5BA 1FJCA 4WTYA 2W9AA 1Y0HA 2ASDA 2VFSA 5KFVA 4FBUA 4RKUC 2NS1B 3TOQA 3DM2A 4ZP6A 2XS2A 1R0AB 5LMNF 2MPUA 4DUZF 1U09A 3DOKB 5F8IA 5L1IA 2XS7A 5MAOA 2FC9A 4FP9A 4Q5VA 3KJVB 5DETA 3DOLA 3JYTB 1S79A 2CQHA 2QIFA 1IM4A 3NLCA 3HVAA 4IKAA 5KFCA 4B3TF 1UVMA 2Q3PA 2HMIB 4PQAA 2YQ3A 3HZGA 2DITA 3V5RA 2B56A 3J80Y 1KC8T 1MWYA 3UCUP 4C0OC 2VPZB 3KLGA 3SXLA 2VOOA 2XNRA 2ZH9A 2GIQA 3FQKA 5HMWA 2HNYA 3BREA 3T9ZA 3ISND 5KFKA 4NZ6A 4XO0A 2XO7A 1D9AA 1KFSA 2VG5B 1HWIA 4OL8A 2AX1A 5EHHA 4QYZJ 2VKRA 4L72B 4OJ3A 2HQ3A 3FZ2A 2B43A 4C11B 2ZH6A 3BO3A 1W2IA 2HWHA 2Z0GA 4C2MA 4N8OA 5KFIA 1MMNA 2R7OA 4IG3A 2V8GA 4QWBA 3FRZA 2PA8D 1OIAA 4HLBA 4KB7A 3D1HA 2AW0A 3TVZA 1MWZA 2BJDA 4D3HA 3UW1A 3CCSS 1HI1A 4TY8A 5KFLA 3M9MB 4ZHRB 3G9CA 3VAFA 1PC5A 1BC6A 3LANA 4Y00A 5J2MA 4HDHA 4IYQA 1Q1KA 3VAKA 1AROP 3MEEA 2LXUA 4AUKA 1I94F 4RU2A 2V8DA 5E2QA 3PW7A 3EUNA 5HO4A 4F4XA 3KNAA 4KHPF 1KQGB 1U49A 3K59A 3H4BA 2V4RA 4EO6A 4G1PA 4UW2A 1KFDA 1RQ0A 3I96A 5L39A 1NRKA 3J7A1 1ZAVA 3D1QA 4KV8B 1RP5A 2CPJA 3K2YA 5A0YA 3H4DA 4OZNA 2UUCF 2YKOA 5DRKA 3NNCA 2MQNA 5E7OB 4IOBA 7FDRA 2A18A 2C2RA 1NK5A 4DR4F 3CTRA 2DNPA 1S7HA 4FYDA 3PW4A 1IN0A 3UCGA 3VZHA 3DLKA 2OMLA 1U1QA 1JLFA 5KT7A 2WTFA 2OFGX 1NU4A 4Y2KA 1NB7A 1S9GB 1MMDA 2OKQA 4MJKA 4KBIA 4JUZA 3JB9k 4IRKA 3LAKA 2QE5A 4DSKA 1HHTP 4RW7A 1Q16B 3UCZP 4CT8A 2KYXA 4A8XA 4F4YA 2M5YA 4F8RA 1R43A 4PXBA 1FTRA 2ZHOA 2X1FA 3NNHA 2RRNA 1HQUA 1RWUA 1SH3A 2J7KA 2MQPA 3TAQA 1JMTA 4USIA 2W7AA 5DG8A 1MNEA 4BS2A 3BS9A 1S97A 2YKPA 3DRRA 4MTPA 5AXLA 2XLIA 2MSSA 1RA6A 3TA1A 1NJXA 1H38A 1H2UX 4ZVHA 2R7WA 3TUIC 4CT9A 2DR5A 2GGPA 2ZHAA 1XERA 4O4RA 1K0VA 3JSMA 4Q8FA 3MECA 1FXRA 3KHHA 1FKPA 1U6BA 4K4ZA 4FF1A 4QU7A 3GV8B 3CDUA 3I0SB 1B64A 1IKWA 2NXUA 1XWLA 2CQ2A 5MLCV 4QQBA 2W7PA 3LH2S 1KONA 3KWMA 2F7VA 4LF9F 3TO8A 1YJVA 1C1CB 4CCHA 1LXNA 1R7IA 4I2PB 3DXSX 2ZJRQ 3T5KA 2HPUA 1NK9A 4ED1A 1NKBA 4FBTA 1DQ9A 1YSJA 4NLVA 5HQ8A 3I4PA 3ISNC 3NGDA 5E3QA 2V4QA 4ED3A 3V6DA 3TX8A 3C66A 1JLBA 3AY0A 3P3DA 4DR2F 4N8NA 2C3OA 2V8HA 3CSKA 3BF4A 5KFHA 2MJUA 4NLUA 3HDSA 2HVHA 4IFYB 2CJ9A 2KU7A 3U27A 3C3LA 4BC7A 2B3TB 1TQLA 2GJ2A 3C8YA 2DGQA 5KFNA 3AH6A 4OJHA 3KLFA 4BBYA 5HL7Q 3NNAA 3VF0B 1RT2B 4RW6B 2VPWB 3SCKE 3KLEA 2EKYA 4C9DA 1BQNA 2HLUA 4OIXA 2PDAA 2E9RX 1RTIA 2MZRA 2WONB 3IS9A 5KFEA 3DFEA 3AJ1A 3BO4A 4O3PA 4ED6A 4DL3A 4NRTA 5GADU 4ICLB 3R5AA 2ZH3A 1N48A 4PWDB 1T3NA 1LK7A 1M5HA 2G0CA 3MECB 2IJNA 2IYGA 4HI2A 3S8SA 5I42B 1HBMA 3D0IE 2CQIA 5D4OA 2VL1A 3U7JA 3LWMA 4ICLA 4CO0A 3HVWA 2DJWA 1ULRA 2VH7A 3MURP 4ZHRA 4YP3A 4KSEB 3BGRB 4CZCA 2YNHB 1C1BA 2RQKA 2J7WA 5IT9Y 2W4CA 4X4VA 3ZZTA 3DXBA 4TYAA 2QFJA 2B5JB 4H54A 2HW3A 2K2PA 1LWCB 1DBDA 3ZZPA 2K1RB 3QAEA 4ZCLA 1SJRA 2VV5A 4XDCA 5GADI 4TQSA 1S76D 2AJQA 4LSNB 1FA0A 5I3PA 3PFOA 5L9XA 3MM6A 2VG7B 4DV5F 3FMWA 3TUZC 4WFBQ 5L38A 1L3SA 1Y3KA 2OPPB 3IRXA 2OPQA 4LSNA 3M8PB 4IR1A 3M30A 1RT1B 2IM2A 4I2QA 5LXYA 5HMZA 4Q43A 1SUQB 1P8GA 1IUJA 3IG1B 1XR5A 3LP2A 4N41A 3M30B 2VQEF 2MY7A 2QA4G 4LF7F 2EW9A 1UWBB 4O4GB 4ERDA 4NYOA 2GHVC 3T1AA 1D1UA 1X0PA 3M9OB 5K8PA 1JLAA 1SI9A 2HIQA 4O3QA 4MIBA 1JX4A 2JLFA 4U6PA 5KFMA 2IJFA 1H2VZ 2F1FA 4DV1F 1U48A 1RK8A 1GNKA 4EGLA 3EPIA 2BJEA 3N9UC 2O66A 2K8GA 5CYMA 2X3GA 3CCES 5BR8F 3MMCA 4MKAA 2ZVSA 4ZPBA 4V19X 3P6YC 1XTZA 1UA0A 3C6TB 4RW8A 1J5OB 2WB1D 4C3LA 1WHVA 1IQZA 2F9DA 4DR7F 1R8AA 2IC3A 3POTB 3VCDA 3NBPB 3SSRA 4KE5A 1N5QA 4K5SA 3E01A 2FIUA 3KLEB 1X4HA 2VPYB 2I0XA 3FNNA 4NX9A 4LJMA 3OHAA 1KVIA 3AB2B 2ZDPA 4DV6F 1Q8BA 3PACA 3QWPA 1Q8LA 1FDDA 3WC0A 2FGOA 4IG3B 3JSMB 2ADBA 4QIWD 4LIRA 2N7YA 1FDNA 3VQSA 3IR5B 2GQQA 3H5SA 3O2IA 5DGBA 4TY8B 3T5HA 2BM1A 1X4CA 3FCHA 3N6NA 3ISZA 5SZTA 2BRKA 1XC9A 1SQEA 1VK3A 2FUG9 3IXQA 3CMES 3SFGA 2F3JA 2M7SA 2OPRA 5E3AA 2MGZB 3PXGa 2FLNA 4HHJA 3W2VA 5KFSA 1ROFA 4I56A 3TR5A 3OJSA 4JI3F 1YRTA 3TYTA 2DO0A 1M5OC 2UZAA 4DLEA 4F4ZA 4I1TA 3G86A 4NCBA 2MHEA 4HT7A 4USHA 1TP7A 2LQ9A 3PHEA 4M95A 3KHRA 3EZ5A 3CCJS 1TK8A 2RUGA 1A7GE 1MROA 1SC6A 3CD5A 1LKZA 3RZAA 2MXYA 2KFNA 3M32A 3KHLA 1FNXH 1S1VB 2JRSA 3K7RA 4K4WA 2PFFB 3LW5C 4J5OA 4OZ1A 5EGYA 1AFIA 1FXDA 4QWCA 4LF5F 5KFGA 1QAYA 1FDAA 4G1IA 1C0TB 1S1TB 1F9FA 1VS3A 1LWFA 2E5IA 4C8ZA 4WIIA 2DISA 5KG6A 2P9CA 3OVBA 2BRLA 4TU8A 3CIMA 4NLYA 1IKVA 3BQ1A 1O51A 4DL5A 2DNMA 1FRHA 2B4VA 3O6QA 4LQ9A 4PKDB 5B09A 2E5LF 2XMUA 2G4BA 2OO4A 2FLPA 4RW8B 2G13A 2MZQA 3MPVA 5J1EB 2R8JA 4B3MF 3N4WA 1DARA 4DF8A 4I7FA 3I87A 2GHWA 1HD0A 3FVYA 5FLXY 3IRWP 1LWFB 5KFXA 4X4TA 1FE0A 2DNHA 2HNZA 2J76E 2NSBA 4QYRA 5E33A 4DG1A 4DQSA 1J2VA 3R1HA 3Q22A 4ES2A 5KG7A 2AYGA 4UY8T 3MEKA 2RIJA 1T95A 2MKIA 2BANB 5JUMA 2FD2A 2IA0A 5CYQA 1Q82T 3HKWA 2BA9A 5KTQA 3F73A 4C4WA 4FVCA 4C7QA 5B08A 3FSXA 1AUDA 3PJXA 2A1BA 1HNVA 1X5TA 3H2LA 5LSRA 3KK1A 1Y9OA 4WK3A 3VTIA 2MYFA 1FDBA 3PW5A 2BVZA 2OPQB 3CJ2A 3ZZOA 1Y3JA 3KK1B 3M2RB 3GV7B 2UUTA 1HNIA 3CF5Q 2ZD1A 4H4MA 3OUYA 3DLKB 4L3NA 1IJEB 3I9ZA 1HBNA 3QJLA 4URGA 3H8YA 4F3OA 4KGKA 2GA7A 4NXMF 3N28A 2RSQA 2CQ0A 4DQIA 3TA0A 4WXWA 2MKSA 3KK2A 4A8MP 2XY5A 2VKZG 2CDQA 2JDJA 4YHHF 3NRBA 4I4BA 3RAQA