5DS7A

2.0 a structure of cpii, a nitrogen regulatory pii-like protein from thiomonas intermedia k12, bound amp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
91
Chain Sequence
b'IKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title 2.0 A Structure of CPII, a nitrogen regulatory PII-like protein from Thiomonas intermedia K12, bound AMP
rcsb
source organism Thiomonas intermedia (strain k12)
molecule tags Metal binding protein
total genus 17
structure length 91
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ds7A00
3LF0A 1QY7A 1J2VA 3L7PA 3O8WA 2J9EA 4YB6A 1PILA 1O5JA 1UFLA 1Q1KA 4NYPA 1HWUA 3TA2A 4USJC 3MHYA 5D4PA 4CNYA 1UMJA 1V9OA 3AHPA 1NAQA 1P1LA 2JJ4D 3CE8A 4Y65A 4CO0A 1KR4A 1UKUA 3AA9A 3GSDA 1O51A 2J9DE 4WK1A 2O67A 2O66A 4OZNA 4ZK7M 2GX8A 4CO3A 2XG8A 4CO4A 3BZQA 3NCQA 1OSCA 2J9DA 4OZLA 1NH8A 4RWWA 4YB7A 2E66A 2VD3A 2J9CA 4WK3A 4CO2A 5DRKA 5D4OA 2Z0GA 2EG2A 4CO1A 2GW8A 3OPKA 2CZ4A 2NS1B 1NH7A 4C3KA 1NZAA 4RWXA 4USHA 2EG1A 3TA1A 3DFEA 3AA8A 3NCRA 2XULA 4NYOA 2DCLA 4C3LA 3O5TB 4CO5A 1VHFA 2PIIA 3HLUA 3N5BA 5L9NA 4USIA 4Y6IA 4OZJA 4RLEA 1XK8A 1V6HA 4D3HA 2ZOMA 4AFFA 2NUHA 4R25A 4E98A 5DS7A 3T9ZA 2NUUG 2XZWA 2RD5C 4IYQA 3AH6A 1UL3A 5D4LA 1V3SA 2V5HG 4CNZA 1GNKA 3TA0A 2ZFHA 3M05A 1VFJA 4YB5A 1V3RA 3X3UA 3NCPA 1H3DA 4D3GA 2XBPA 2GNKA 4C3MA 4RX6A 5D4NA
chains in the Genus database with same CATH superfamily
5AT1B 3DOLB 2HEKA 1S6QB 1IKVA 1DBDA 1CULB 2LCWA 4XIUA 3JYTB 4Y65A 1S1XA 5E3PA 2IVFB 1VIXA 3A8JA 3S01A 2KJVA 2EWHA 2GA7A 3HJFA 4HDGA 4KHRA 4TQSA 2KZMA 4CLYA 1U45A 1ZM3A 2EG2A 2H9ZA 2XWXA 5KAKA 5KOWA 4IRCA 5CA5A 4BC7A 3ZNUA 3W5YA 2C2ZB 2DJWA 2ZHAA 3RW6A 3WHIA 3BR8A 2MZTA 1X31C 2FZGB 3GR1A 1V6HA 4FBTA 4YY3J 4O0NA 3KG0A 2QGFB 1Q5YA 4OYWA 1H6KX 2CPXA 4UY8T 3FGVA 3MOZA 3I9V9 1HHQA 4RUAA 3J7YI 1HL6A 3OW2R 2AGPA 1A9NB 2DCUB 4RX6A 1JLCA 3MCMA 4NMLA 1GX5A 4IDKB 1HWLA 4EGLA 1HWIA 1F9FA 4PCQA 3QNWB 3PY8A 2OKQA 1WORA 3AD8C 3BJYA 1IKXB 1F0XA 2C22A 3Q2TC 4J9LA 1TUWA 2VKRA 1JKHB 4OHZA 1WJ9A 1NUEA 4DV4J 5KG6A 4CO4A 3HKZD 1KBRA 2HURA 2AEMA 3TUZC 4M8LA 3MEEB 1TKZA 1FWPA 2VASA 4DV6J 3FJ2A 4PG6A 4BWJA 4OJGA 1UWBB 4OZ2A 1IR0A 5KT7A 4HACB 2E9RX 4K0KF 2ALYB 4DUYJ 3BQ1A 1X4CA 4J9PA 2LQ8A 2X1BA 3IR6B 5HJYA 1AXQA 4ANCA 1SL2A 3QGHA 5F0WA 5EWEA 4FKXA 1AW0A 3RAXA 3T1HJ 4BWMA 1JLBA 1M5SA 1TU0B 3AY0A 1FDNA 2XHCA 3MECB 1SJQA 5GADI 1NHVA 3RGIA 1H3DA 5DG9A 3JAMY 3M8QA 3BV8A 1JLFA 2CKWA 1HWKA 1NPPA 1MSWD 5LJ3Y 1LWCB 1TL7B 3GTYX 2UUCF 2RUGA 4IG3B 1F3FA 4HH1A 1XJWB 2R2SA 2BACA 2AT1B 3HO1A 1XN9A 3PR4A 1WKKA 3P5BP 1CJTA 4X66F 2HVEA 1U24A 2IM0A 1OWXA 3TANA 3MMAA 1NSPA 3QRRA 2KU7A 3PTWA 1Y3KA 2XMTA 1B99A 1HMVB 2XULA 2CG4A 3JXOA 4LF8F 2Z2ZA 1T9UA 3FBEA 2DXEA 2J7WA 1GMUA 4ECQA 3QJPA 2EKYA 1Y7PA 2MHEA 3KLGA 5B0AA 3D67A 4LFCJ 1RGVA 2DNZA 3JSMB 4DS4A 1O6XA 1GTHA 2VB6A 4B3TF 4DV2J 4A8FA 2RHSB 1CQNA 3GIKA 3TARA 2ADCA 1S72S 4XDDA 1QTMA 5FJ4A 4X4OA 5F9LA 4DDFA 3BGRB 1TTHB 4PUOB 3V6HA 2BMBA 4A48A 1B4SA 3C6UB 1U1KA 4ILRA 2HK2A 4KFBB 1TP7A 3IC1A 4EBCA 2FLNA 4P10A 5KFUA 3EMTA 4LQ9A 2HBZB 4LSLB 2F1FA 5J1EA 1RAHB 1XERA 5BYQA 4I56A 1KLMB 4B3OB 5GAEU 2BE2A 2Y1JA 3Q8VA 2ZH6A 1SJ3P 2F9DA 3UR3C 3CO0P 1S0NA 4HTJA 3PYEA 2HIQA 2X1AA 3MZIA 4ECSA 3JQJA 3AB2B 1MNEA 3QZ8A 1CJUB 4BLGA 1W26A 3E51A 4M95A 1VRUB 1FXDA 4USUA 4NEZA 2V2QA 2ZOGA 4XAKA 2XI2A 3TA2A 4DLGA 2DNMA 2UVRA 4G3IA 1S0VA 1DTTA 5EWGA 2B8QA 2IA6A 4A8MP 2HFOA 1RBLA 2LXFA 5DQIA 1BLUA 3H4BA 1DLOB 5ETLA 1RSCA 3G8TA 1P6TA 4OYIA 4IOCQ 4UF4A 1I3OB 3EWGA 2IYGA 3CCQS 2Q3PA 3CDAA 1KN6A 5FD1A 1REGX 4WU2A 3HVTB 5C42B 2VA2A 2ZD1B 3PKMA 2V8GA 3OVBA 4UY85 1NK0A 3W8PA 3MM9B 2AGOA 5LXRA 5BJRA 2DO4A 2Q79A 2DIVA 2U2FA 3W5XA 2PE8A 4I7FB 4O3RA 4QYZK 3M30B 2DR8A 3D1QA 2DNQA 3IGVA 3QAEA 2XO6A 3GYGA 2GNKA 4ED8A 1G1XA 1RT2B 5AE2A 4CH0S 5DJBA 4FN5A 1C0UA 2RS2A 5G4DA 5HQ8A 1FWLA 1RAOA 3C6TA 4R5PA 2D9OA 1CJKA 2H51B 3BPDA 3AB4B 3H5YA 3CJ4A 2YWGA 2YNGA 2QFJA 2FJEB 1UPPA 3EZOA 2CQ4A 3CCTA 4GVBA 3T6JA 2J9DA 4OZLA 1BWEA 2M70A 3QMQA 1YJRA 2C1EB 4A8QA 3EVOA 4ZP6A 3P5TL 5GAGI 1ZA1B 2VKZG 2EBEA 1SC3B 4DSLA 1WC6A 3RB6A 5DQHA 4XO0A 1KC8T 2EFNA 3BREA 3W66A 4I0WA 1M5PC 2JL9A 4OYPA 4BHQA 1H74A 4OYZA 5HQMA 3MMBA 2JX2A 2VG7A 5D4LA 1XNQF 2UXBF 1Q79A 1B0TA 3TR5A 4C3MA 2N3OA 2BZ2A 4DL4A 1K47A 1JJHA 4PWDA 3BR9A 5KT4A 2DY9A 4OYAA 1SB6A 3AHPA 4KBIA 3ILLA 2GIFA 4L72B 5M2RA 1AB8A 1RAEB 1ROFA 2H1YA 3G6XA 1FDBA 4O4GB 5HMXA 2XWYA 4DR4F 4UZCA 3M2UA 2OO4A 1TMMA 2FY8A 1U6ZA 1X4HA 4QOTA 4KC5A 4LSZB 2I6WA 3NNHA 4N5SA 3FMWA 4X4RA 1IKXA 4ZP7A 4W90B 2GMLA 4DUZJ 1BD6A 3DRYA 2QC3A 2XY6A 3NRBA 3EX7B 3SCIE 4R8UA 5KFFA 1FKPA 3I6PA 4C0BA 2B5JA 5DDRC 4U67Q 3FQLA 5IM0A 2V4JA 4PR6A 1AUDA 1V3RA 4IRDA 2Y8WA 1KQGB 4NCGB 1T8EA 2H5EA 3VGVA 3IRWP 6AT1B 3RB4A 3IO1A 2B9EA 1FE0A 3RTVA 2DNNA 2RF2A 4PABA 4DOZA 2CYYA 4KPCA 2ZBRA 3EGVA 2BABA 4ZMMA 4DF4A 3IG1A 1ZM4A 4GRSA 4OZNA 1YZ6A 4LF9F 1WOOA 4EWTA 4NLRA 3KK2A 2Q6CA 3QFWA 3KK3B 3EPIA 3H90A 1DY3A 1S12A 2OEMA 3VTIA 2IC3B 2F4VJ 2FJBB 4FYWB 1NB7A 1RAJA 1GT8A 4FVMA 3MWBA 2VIHA 2VPZB 3J81U 2V9KA 2UXDJ 3HSJA 2YNHA 1R27B 5KFRA 1M5KC 2XY5A 4G1QB 1IBKJ 4C48A 1NCLA 4LSNB 2XMAA 1KQSR 3B78A 2R8JA 4DCJB 4A8WA 1CPZA 4TU9A 3M2RB 1PYSB 1AZSB 1XQIA 2FGOA 2IBKA 2ASDA 2HQ3A 2SXLA 4CLZA 1ZPWX 1JQGA 1TL5A 3J81j 2RJZA 1QSSA 3OTBA 5IT0A 2BA9A 2W7PA 1VC0A 2CQPA 2E29A 4S0MA 2HGMA 2HVDA 1EQ0A 4PZVA 4RU2A 3ZO7A 1AFJA 5ITHA 1XR6A 2BV3A 2WZ1A 3GR0A 2HVIA 2KYXA 2Z56B 3ENVA 5K14B 3Q83A 4H4MB 1TV6A 3LP0A 3NXZA 1S1VB 5U47A 1JLQA 1MU2A 5B0BA 4KAIA 1HIYA 1HR0F 1WHYA 3KTQA 4ZVQB 2R2TA 2OGUA 3KDNA 1JNRB 3L4BC 3WX4A 5CZVA 2VQFF 3T3FA 1H38A 3KLEB 1IN0A 1DTQA 2J5AA 2ZC4A 4MMOA 4RW4B 4FPRA 4OYBA 4DU7A 3IRXB 4TYAA 4E98A 1HLWA 2BKOA 2R7RA 1E6YA 4JI4J 5E0OA 4J91A 4Z7CA 4M5GA 3IA0A 3Q24A 3PX4A 1ITPA 3TAMA 1AUSL 1TFYA 2DKOB 3NLCA 3BH7B 4B3OA 3VQTA 2WCXA 1UJ4A 4DG1B 5F8LA 2APOA 2L48A 1JMTA 3CDBA 3CJ5A 1NSKL 2EK6A 3UNGC 2P9CA 4X4NA 4ITSA 4USMA 1JNZB 1RU1A 3LP1A 3J80U 4LR8A 2UU9J 2E7VA 1NKEA 5IV3A 2XYHB 4NLXA 3L3CA 3LP2A 3TZWA 3EE3A 3ZTSA 4LRAA 4YDDB 4ZLLA 3N28A 1S97A 2ATLA 3CTRA 3IXQA 1RTJA 4Q44A 1HNIB 2YX1A 2HRYA 2GC8A 1F9HA 1VQNS 2WAQD 5CCLA 5HVFA 5DZ7A 3O5TB 2R7OA 4RUBA 2VOPA 4KYZA 3N79A 3W60A 4Q0BB 2BQ3A 2R7WA 4EBDA 2BYCA 2XMUA 1ZZFA 1SH2A 1Y11A 1B64A 5AJ3J 4HI1A 2G1DA 2JFDA 2JLFA 4JB8B 2JC1A 2CJ9A 3EJMA 4ZPAA 2PT0A 1LWEB 2PGCA 4NYPA 2ZM6J 3M6WA 4WJBA 2J6UA 3SEOA 1TVRB 2R8IA 2BM1A 3FZ2A 1TL3A 3D3CJ 3CCZA 3NNAA 4K4WA 2DNOA 1RTHB 1RYSA 1IKWB 3M2VA 1WI8A 1YG0A 3BO4A 3UFCX 1FO1A 1XTZA 4O4RA 2E66A 5G0RB 2JOQA 3Q8UA 1RTIB 4RJVA 2HHPA 4B9VA 2HWTA 4AL6A 2ILYA 4FYVB 2QZ8A 2ROEA 1QUPA 3NCRA 1PJ5A 4YY3F 2KZZA 4KGVB 1EETA 2K8GA 3K7RA 3KG4A 2H3EB 5EDWA 3IR5B 1QAIA 1F5AA 2G9OA 1JJCB 1HD0A 2NZCA 2VG6A 5ETMA 1DZ5A 1YJ9S 2DPIA 2KDOA 2FB0A 4DR5J 5GAHU 1NJIT 3ZZ0A 5ETQA 1H2TZ 2ROPA 1SPBP 1Z2LA 3EPGA 3BH6B 3J7AN 1OY6A 3R5BA 3SSQA 1U8SA 1PJ7A 1J27A 4KRWA 2WVFA 1U1LA 3G4SS 1RYRA 3MUMP 3QWPA 1JLAB 1G3OA 2N3LA 4QR0A 3H42A 3BSNA 1BMQB 1WELA 1CS4B 1SKRA 1G7CB 3OFEA 5F8MA 2FHJA 3DLEB 8ATCB 1Q7LB 3MM8B 2DPJA 2YQ0A 1RK8A 4DV6F 3KLIB 3FCVA 4OX7A 2VQEJ 4LR7A 2DIUA 3DRPA 3KK1A 2ZBCA 1Y5LB 1Y9OA 1S9FA 3EUNA 1LK7A 1JX4A 2HZAA 3PRDA 3TJ8A 4DUYF 2HFSA 4ZITA 4JV2A 3CC4S 3NGKA 4LVNP 4HL9A 3SFGA 3HSGA 3HHLA 2EPIA 2VL1A 5ETKA 2D3ZA 2RB7A 2RIJA 1H0HB 2HAIA 1AFIA 2YKOA 2M2BA 4J5OA 3CIMA 3THVA 4A4JA 3H7HB 5IZHA 4KB7A 1S4EA 3MEGB 1HHTP 2YNFB 2MEWA 1NHKL 1T3OA 2LMIA 1QVGR 1YWXA 2PA3A 2W25A 3FSXA 3UCGA 4DCOB 5DDOC 2IAJB 4DPWA 2J8SA 2KJWA 2FVCA 1M5HA 4ZPVR 1MN9A 4QWDA 3MTJA 5LL6d 1RXOB 1HQUA 1JLGB 3SV3A 5B7WA 1C1BB 4O3SA 3GMGA 1FRIA 2V67A 3D66A 1U4BA 4NCGA 2LU2A 2ZBQA 5HLFB 4ZHRA 1RWMB 1N5SA 3M32A 3H8YA 5HSPA 8RUCA 3PNIA 4Y28C 4KGXB 3OBIA 1MG7A 2XHWA 3VVTA 3V6JA 4UOHA 3JB9k 3GJTB 1SBRA 3CMES 3PG9A 2AGQA 3AXMA 2NUHA 4LFCF 1YITS 2LXIA 1LFPA 3DLKB 4WYWA 3K0JA 3PZPA 3G71S 3H5XA 3H2LA 2OPQB 3IWLA 2DTJA 1D3WA 1JXVA 3SBMA 1U48A 2Y0SD 3W9JA 1QLNA 2IC3A 4C98A 4PYAA 3ZTOA 2PFFB 1WUUA 2POKA 4RW6A 3RBDA 3ZTQA 3OUYA 2A6OA 3B82A 2CPZA 4M1KA 4PXEA 1WSVA 2HBQB 5KFWA 3DLHA 2B3TB 3UDVA 3H98A 4LSNA 3BF4A 1U0HB 3A12A 2CQ3A 2M3DA 4O3QA 2MDAA 1T9YA 3N6MA 3HMJG 4C9DA 4QWCA 1RT5B 2YX4A 1Q0NA 2Z4PA 2A0FB 4CQ1A 1GXTA 3I0RB 2AP6A 1OY8A 3HULA 1WF0A 3W61A 4QJVA 2AJ4A 3M6XA 1T9XA 3CWJA 1HNZJ 1I51B 3DRXA 1T05A 3MMJA 4DWIA 2QT7A 5K8MA 1QVFR 1MMLA 3VHQA 3MM6B 2L9WA 3EDQB 4DMZA 1D0EA 3ZZZA 1GMWD 3MEDB 3GFZA 3C46A 4ETXA 2BOAA 2BW7A 1PGZA 1UL3A 1EP4A 1VCTA 2VODA 1U09A 2ZC3A 2CUYA 2DY1A 1VQ8S 4BDPA 4A47A 2KM8C 3U7JA 2HS4A 3OR1B 3C14B 3Q23A 2O1PA 2MQOA 5AE3A 1GX6A 3NMAA 2CPIA 1VBZA 4CWBA 1G6BA 5KT6A 3H5SA 3QYYA 3NGSA 1TFWA 4ENOA 3GCXP 2CZ4A 3ZZYA 4DV0J 2EG1A 3R2DJ 2O3DA 4K5SA 2D41A 4PPZA 1NKBA 5IQ6A 1C0TA 3MI7X 4I64A 1UWAA 3NNCA 2DBBA 4GVLA 5DS7A 1RCXB 2GIQA 2YWHA 1H98A 2K7JA 1X8DA 4GC7A 3G6YA 2X3GA 3QGGA 2XBPA 3RRKA 1KP6A 1UVLA 2Y1LB 4N8NA 1XNRJ 5ADZA 2EC2A 1HWUA 2W9BB 3AXKA 2KHDA 2PD1A 3QWUA 3CC7S 4CNYA 2VFRA 2FJVA 2VF3A 2FVSA 3X1LB 1P1LA 3ENWA 2HQIA 3D9BA 2C28A 1X0PA 3K58A 3IBWA 4RW7B 1BY9A 2YY3A 3HFKA 1S5ZA 4IO1A 2HNDB 2OTLS 4N56A 4DU8A 3V6KA 4EU0A 3CCVS 1CJVB 1RACB 1SQGA 4ZVFA 4ZVHA 2DRAA 3OPKA 2P5VA 2B8PA 4EZ9A 3DGVA 4O3OA 1S9GA 4FKYA 2OPPA 4R0EA 3A3PB 1TVRA 4DR6J 4J9RA 3DXSX 2QV6A 1R6YA 3FBBA 1FKOB 1HWJA 4V1Ak 3W1YC 3CC2S 4LFAJ 2HS0A 4PG4A 5K20B 4ZJQA 3PW5A 1GAOA 1VS3A 1T95A 3M05A 3A8EA 5C25B 4NRTA 1UTAA 3W3SA 5KG5A 1BGXT 2QJ3A 2JH3A 1DURA 1N33J 3W62A 2XY7A 3GONA 4NLOA 1SQEA 2XMJA 2D7SA 4IO9Q 4C0HA 2KHCA 2QG9B 4OX8A 1FRLA 2PFDA 2ASJA 3DI6A 2D74B 3CO9A 3G8QA 3RB0A 5MAOA 4ILMA 2HNYA 4EO8A 4YS2A 2RNEA 2BM0A 2YKMA 2QMXA 4M5LA 2CQDA 2ROGA 3FMBA 3TNVA 1X5PA 2B51A 1NPKA 3DOKB 2MQPA 2W8LA 3NOCA 1U25A 2NSBA 3KHHA 4DUZF 2DHXA 3AA8A 3W9IA 2DGSA 4HHJA 5CQGA 2ZH8A 5A8RB 1XMOF 1ZS6A 2ZH9A 2UUBJ 2EFOA 2YNIA 2V0NA 3N4WA 9RUBA 2Z8QA 3LWLA 2PEBA 1FI4A 1WD6A 3I0SA 1F2HA 1EHWA 3SQOP 4DI6A 5HQLA 5GAHI 2YVSA 5L38A 1WWHA 4ZDNA 3ENAA 5LSOA 3US5A 3GYNA 1YIJS 2IMWP 2QMWA 4DZDA 3MM5B 4WCEQ 2AF6A 4WP9A 1I94J 3LGNA 2UXCJ 5F3ZA 4J90A 5HATA 3QQCD 3K5NA 3PW4A 1YBTA 2NSCA 2F8HA 5C2CA 1TK0A 2ZWOA 1RT3A 4FXDA 5LMNJ 5C5JA 4TN2A 1W7WA 1Q4RA 1SIZA 2ASLA 3PX6A 1RBOB 3MEGA 3V4IA 2F4VF 3Q86A 2W4CA 2R9LA 1C4CA 4RO0A 3ZNJ1 1WTFA 2CFXA 2ZZMA 2UXDF 4AQYJ 1VQ7S 4PRFA 3LQVA 2V8PA 2QFIA 1SQFA 3FC9A 5F3TA 4NLVA 1IBKF 2O5DA 4OLOA 4KHPJ 1R8CA 1JLGA 4IFVB 2DNRA 2V63A 1S48A 1MWZA 3K17A 3FNNA 4NL5A 3NL0A 3OQ2A 1VRQC 4DX5A 3RB3A 4HLBA 2J0WA 1ACMB 2ZJRQ 4F8RA 4OJ3A 1X5SA 2AJ2A 2M4MA 4KV8B 4GO7X 4Z7YA 2J6TA 3HK2A 3R5JB 1ZOTA 4DX8H 4FP9A 3CGIA 2XYPB 1KR4A 1BQNA 4LBIA 2AZ1A 3BZQA 3G82B 3O44A 5T41A 2ZVIA 2BQUA 2LQBA 1ZBTA 1PC4A 1QD1A 2CDRB 3FKBA 3LUYA 2MZQA 4ELUA 1PO6A 3PEHA 1Q86T 4YQWA 4LUBA 1QUVA 5F8GA 3MFIA 3T9NA 3UDEA 3IGNA 3OTDA 3QLHA 1S1WB 4JI4F 5KFEA 2A3JA 1WHVA 3R1LA 1YJVA 3GILA 3JSBA 5CCMA 5E33A 2FGCA 3OSPA 3ADAC 2FJXA 5ETSA 4XPCA 3PW7A 2VA3A 5KG0A 5L1JA 1YJUA 4P74A 2G2OA 4DFKA 4CLUA 2YKNA 4L74A 2B4UA 2R2UA 5H9FJ 2QLBB 3TUPA 4DXLA 1LOUA 2V94A 2CZVC 1PG5B 1N6QB 2CQ2A 7AT1B 5KFXA 1FDAA 3CVKA 2N4CA 1BXNA 1MROA 3M8ZA 2MXYA 3UWTA 4O23A 4W98A 4AXJA 3KJVA 3OHBA 1N88A 3ET6B 2NZ4A 1D9DA 1VK3A 2L9NA 4P7VA 5DDPC 4CCHA 4PEOA 2W7OA 3A3NB 2H4WB 3OJSA 3HD2A 1ZTTA 3Q8QB 2LDYA 4P2MA 2GHVC 2XZWA 5AJ3F 1NMEB 2W24A 1UJ6A 3ITHA 2E1AA 3QJLA 2FD2A 2I9SA 4A46A 2UV8A 4C97A 3FEYB 2ZM6F 1SV5B 1VYAA 5BYRA 3I5CA 4XK8C 2NCKL 3FDSA 4ED4A 3FEXB 2RAQA 4PXCA 4NLGA 1CEZA 4C8LA 2KT3A 1R8PA 2MGZA 1YK9A 3L9ZA 3CJTA 4X65J 2W2QP 2V4QA 1OQ6A 1S7HA 3POTA 2DH7A 2OPSB 4Q2LA 2JZ5A 4MTPA 1TUGB 3PYGA 2IMOA 4MKVA 4O44A 4MIBA 4QIGA 2UUAF 4ALZA 4RNOA 3H20A 4QQBA 4MIWA 4DL6A 4F4KA 2VFVA 4C3LA 3PW0A 5J2NB 3JTPA 2PIIA 1J5OB 5EUHA 4URSA 3AJ1A 3WIVA 3Q8PB 3IM9A 1N48A 4NLWA 4DR5F 2CPYA 2MY8A 1EZZB 2D3OR 2JWNA 2XZDB 4DV3J 5H1SV 3CCES 3T5HA 4OHXA 3LF0A 1YJWS 4LR9A 2QL9B 4ED0A 2DNKA 1FKOA 3MHYA 2BXJA 4XTTA 1UW4A 1GMVA 4KKOB 2HIYA 4B08A 3WC2A 3CJKB 5KFLA 3OV7A 4I6AA 4RW8B 5T7LA 2VBWA 2VQEF 1JK9B 4L75A 4K59A 2XCPA 3M6VA 4ZVGA 1SKSA 4N7TA 4B9MA 3LA0A 3BYPA 2VZ9A 2XSJA 2CQ0A 4WKRA 2UVUA 2JC0A 4JI3J 4Q7AA 1FEHA 1SVDA 3DM2A 2HZVA 1VIOA 2FHKA 3DRRB 1RT4A 4YFUA 2MSTA 3EZ5A 1WG5A 2C3OA 5M2UA 3O6QA 4DSKA 3PXGa 5A8KA 5HBMA 1X5TA 4GMKA 2OHDA 1NLKL 1V3SA 2YX7A 4NPOA 1ZM9A 1R7IA 3GZ7A 2DRDA 1FERA 2OD6A 2ZJPQ 2MKSA 3MD3A 1IM6A 5HP1B 2HGNA 4ZJOA 4YB1P 2JEFA 1NJWA 2GVDB 2MSSA 5CXTA 2ZBPA 1IKYB 4MIAA 5A2QU 4M5KA 2GVZB 3UDCA 5I42B 1VBYA 1N5YB 4DQSA 5E41A 2AX1A 2NPFA 4WFZA 3R3TA 4U9RA 1O8BA 2E5LJ 3DGPB 4I2PB 3CDUA 4DFJA 5KFQA 2ZH7A 5DGBA 1FX4A 1H2VZ 2FZKB 2RQKA 3MPWA 3FSIA 1ZAWA 2KT5A 1QSYA 3I4HX 2MZJA 2R8KA 2AV5A 2UUTA 3I96A 4M5DA 5GADU 3SIPB 1HQEB 1N0VC 2FHJD 1U8WA 4KGZB 1DHMA 1LW0B 1JIHA 1UFKA 1FT8A 4K4SA 1K0VA 3MXHP 4C8KA 3DHWC 3H59A 2AD9A 1NJZA 2AYGA 1KOOA 2YXLA 2AWZA 1P1TA 3PVXA 1ELOA 4GKKJ 2DGVA 2KFYA 1HBMA 5LT5A 2MB0B 4JI1J 4ETZA 4ID5B 5JJBA 4P6QA 2P6TA 4DV1J 1RT7B 4DN9A 4OI0A 2FDNA 1LWFB 1Z2ZA 2XCAA 2W8KA 3GJQB 3NEKA 4WP3A 3IN5A 3K5MA 2XTJP 4ZIWA 1RP5A 3EM1A 5CD4H 3NKYA 2OH2A 3JS9A 4IRKA 5DG8A 3PYFA 2KVQE 2PA8D 2DH9A 1IXKA 3RW7A 1VMBA 1APSA 4UT4A 5F0UA 1RAGB 3M8PA 3CJSA 4FYDA 3UCUP 1SI9A 3W2VA 2N82B 2XGQA 4ZLPA 4FBUA 3BO2A 2FHOB 1RTDB 1T03B 3NBPB 2V8DA 1D8ZA 2ZH3A 1VOMA 1F60B 4LF9J 1VRTA 4ZCMA 2I5JB 2F65A 4Q45A 2MKHA 3QFHA 4F50A 4DQIA 1S1TB 3THTA 4NLDA 4ZIVA 4FF1A 1IQTA 3IFEA 2G4BA 1S0MA 3KXDA 4DFPA 2DR9A 2HVHA 5K8PA 4OI2A 3J81Y 4DV0F 4LRFA 2H54B 1OPIA 2GMHA 2OPRB 1NRKA 2WONB 4ZPCA 4DL0C 3ILIA 2EC0A 2YTCA 2O01C 1K1QA 1F2GA 4DX6A 1RA6A 3TZZA 1KVKA 2CQ1A 3CJQA 2VJUA 1XBWA 2CQGA 2CQIA 2PMHA 5FDLA 5A0YA 2QLXA 4DPUA 2V5HG 1GNKA 4F4YA 2V2KA 4LRDA 1U6BA 5ETOA 1XNRF 3HHDA 4I67A 3GPAA 4F3MA 5I3QA 3IS9A 5EWFA 4IFYB 4RR5A 2K1RA 1JLEB 4PXDA 2MZSA 4IOAQ 2KN4A 2NQPA 3OR2B 1YBAA 3M1VB 1J5EJ 4HYKA 4CI0B 1TL4A 2J0XA 1GXLA 4ES3A 1IWAA 3QO9B 5J2QA 2O66A 2E5IA 1R0AB 2AIRB 1FEEA 2N4DA 3AOBA 4DS5A 4CLLA 3D2WA 3V81A 3OXFA 2AEFA 4ES1A 2ZE2A 2XC9A 4DR6F 2VQFJ 3C16B 4X62J 1FX2A 1CG2A 3ZZUA 1K1SA 3JSYA 5F8IA 3SCJE 2ZHBA 1S6PB 4LFAF 3D68A 4HVZA 2E9TA 4PQUB 4OX6A 5KFKA 3PIPQ 4QBUA 3V6DA 1JWWA 2LA6A 4WPAA 2IPOB 1FJCA 1IR1A 4L3NA 1SC6A 4MFBA 1N33F 1IUJA 3RUBL 3CCWA 1BQMA 3DLGB 1FKAF 1RT6A 3N5FA 1SUQB 4IQXA 4LMZA 2FQQB 3J80Y 2IY5B 5D0HA 2HHXA 3M8YA 4OHVA 3FVYA 1NK8A 2LEAA 4DL3A 2XI3A 2I1RA 5DLGA 1WC3A 2R4FA 4X64J 1PSDA 5IT9U 1U1OA 4EEYA 1HQ2A 3DDKA 1URRA 4RNMA 2J8AA 3P45B 4TY8A 3RR7A 3GB0A 3DRSA 1FFWB 3W2WB 4AD6A 4BCAA 2VFTA 3D0IE 1FJGJ 4M94A 2CPDA 2GW8A 3H4DA 2F4FA 2HMIA 1HBNB 2LP4A 1IJEB 4ED5A 2P2CB 2UUBF 5D3GA 4AT1B 5KT3A 2MQNA 3D28A 4KHMA 2V4RA 2JRSA 2AYBA 5C24A 3FEZA 1Q5VA 3TVYA 2Z57B 1ZAXA 3CJKA 3D0GE 2DGUA 2CNKB 4QZVB 4TVAB 2QEXS 3RU0A 2QX0A 5EX0A 1U1MA 3OVAA 2ZEJA 3D1HA 3NAHA 5E3RA 5BYSA 1FK9B 4AXIA 3QIPA 1RAFB 2ZFHA 1I94F 3IWNC 2UXCF 4NE9C 1WTBA 5DETA 3CCJS 3MAAA 3LOUA 1T0TV 3MR3A 2PI5A 2DITA 1JXLA 1WG1A 2IM3A 2WK4A 5JMNA 4R0JA 5CYQB 3LW5C 1LW2A 5LMNF 3HI9A 2AEJA 3GFXA 2ZITA 4F36A 2CNOB 4JI6J 3CE8A 4C11B 3CCLS 1HPZB 2J0SD 3P96A 2HBRB 1QE1B 1M5VC 5HO4A 4K4YA 3C2PA 2DR6A 1IQZA 1X5OA 4CTAB 1HBOA 4I1TA 4EZ6A 4C8NA 4AQYF 2F3JA 1Q53A 4G65A 3DXBA 4CIOA 4ZCKA 5A76A 4ZVSB 4KHPF 3R9LA 5SUHA 1IVZA 4USIA 3MM7A 4RLEA 4C8YA 2KG0A 1X4EA 2HQFA 4JOUA 2RE1A 4P2FA 3EGWB 3PR5B 2PC6A 3UVJA 4B9UA 4YHHF 4M5NA 1RHRB 2M88A 1C1CB 3RBEA 2RKIA 4OJHA 5F41A 2ZBIA 3KLFB 5J1NA 3CJ2A 1L3KA 2UP1A 4OYXA 5AXKA 4OIXA 4F25A 4NZ6A 2AJQA 1QM9A 4K5RA 5J2MA 1KDNA 5JUMA 4JI5J 4HR2A 2WOMB 1RWXB 1UEKA 1IBCB 1HFEL 4RW9A 4ECZA 3R6GB 2CWKA 3QT7A 1HYSB 2KXHA 4E0DA 3TRGA 2WSFC 3DMJB 1GK8A 1XMQJ 4Y2CA 1JXEA 3DU5A 1UFWA 3TX8A 1QSLA 4NOHA 2JDJA 1GXUA 3DOMA 1TKXA 1T9WA 4ZKAA 1E6VA 3E01B 1S4FA 4ID5A 1IBLJ 4OV6A 3GJSB 3FRYA 3HLUA 4J9OA 4DEZA 5IS2A 4ICLA 4KGMA 2BVZA 1HBUB 3R5AA 3HSDA 3QT6A 1V5IB 4DHVA 3SDEB 1HKAA 5IFMA 2HYIB 4I6WA 3F73A 3OVSA 1VQSA 2XQCA 1FESA 1F1BB 1O5JA 3FFIB 4I4BA 1EKSA 5ETNA 1RWOB 2YKQA 5D4PA 4C0OC 3MR7A 1RT1A 1T02A 2YWKA 4FF3A 3NGRA 2CJKA 1NK7A 1TAQA 3TP2A 4OX9J 4DR2J 3RR8A 3CUNA 3M6UA 2Z2YB 3HX9A 2GGPB 1RTDA 3UE2A 4JBCA 4NEYA 1S0OA 3IAM9 3GV8B 1S9EB 3WZ0A 1ZM2A 4IQMA 4FYYB 3KLHA 3IAS9 1RAAB 1SKUB 1FF2A 5HVHA 1TUVA 2K7KA 4FYXB 2DCLA 4YR0A 5AXLA 1PBUA 1GFWB 1KOHA 5CABA 3TWZA 5A8WA 3BEGB 1B7FA 4K4XA 5F8JA 4CT9A 3MMCB 2RU9A 2DNPA 1Z4UA 3DYAB 3AQOA 2KO1A 2VONA 2J6SA 3FCHA 4D3GA 2OUGA 4WFXA 2QA4S 4FS2A 4CH1A 1R0CB 1SJFA 2VBZA 3C66A 5DM6Q 2W9CA 4LF6J 1T11A 1HNVA 2HZCA 3IR7B 5HROB 3CJ3A 1TKTA 1Q7YT 2OMOA 1T9VA 2QLJB 1T7PA 4C8ZA 1N8RT 2ACYA 4X65F 2M52A 3A4TA 3GE9A 1MW7A 3SCLE 1TR0A 1FWKA 3NMRA 2LVWA 3OL7A 4USWA 5SZTA 3CDEA 2W9AA 3OL9A 4CYUA 4J9VA 5DRKA 2ZUGA 5I3PA 4WXOA 2M5YA 4JV1A 3M1VA 3FSYA 4N8OA 4DV3F 3I31A 1VBKA 2HK3A 2ZDOA 3I5AA 3I5BA 4GC6A 4U7UK 4JYAJ 2ZZTA 1RHQB 5A6WA 1I6JA 4JI2J 2VPYB 1MN7A 1UETA 3Q89A 4N47A 1VLYA 3AFGA 1LFWA 4MJKA 3HSZA 2OFGX 1KHVA 3SQGA 4PXBA 4ED3A 3OFFA 3H25A 3K57A 3TVKA 4TQRA 4OV1A 2WVCA 4JV5J 5JVGQ 1QDUB 5A6PA 3MCOA 1CC8A 1RZMA 2AYMA 3C15B 5CYMA 3FBFA 3CD5A 3N01A 1RE1B 4W92B 1BUXA 4H4OA 3AA9A 2VG5A 2C3UA 4HT5A 4C2MA 2KFNA 4FF2A 1U26A 4LIRA 4QW9A 4JI3F 4DV5J 4IG0B 4O0IA 1PKUA 5D4OA 1XWLA 1YHQS 6FD1A 2XO7A 4PYDA 1ZETA 5I3UA 1FRXA 4QR2A 4AL7A 3QBCA 3CW2C 4OI6A 1FXRA 4LF7F 2E9ZA 4Z2XA 1RWVB 1IKVB 4DR7J 4USTA 3VZHA 2KL8A 2ZH4A 1NB2A 3ISND 1WC4A 5D8HB 1S1XB 2LEPA 1TAUA 2HBYB 1K73T 5EX3A 2CJYB 1JJ4A 3JTOA 4EBEA 3DOLA 1S6QA 4DLEA 3TUJC 1FRKA 1Q8IA 3FUYA 1CULA 2E5LF 1FK9A 2B4OA 4YEAA 2W2PP 2H48B 5D0RA 1VISA 2ZZNA 5HMZA 3JYTA 1ZA2B 1FRHA 4CO2A 5BXIA 1WC5A 4UOGA 3CDWA 2Z30B 2L9DA 3GV7B 3HFZB 5DO2A 1Q8BA 5L9NA 2IM2A 2GJFA 3IMQJ 5LXYA 1S99A 1JLCB 2PDAA 2YPYA 1B0PA 3M7VA 3TAPA 1KKHA 1IBMJ 4JI0J 4GKKF 3VAIA 4JI1F 1YI2S 2MTLA 2XS5A 2BR0A 5GMKa 3ETOA 4YB6A 2Z58B 3AD9C 4DV1F 3TEHB 2YWFA 1RWWB 1WNEA 4DUTA 1OIAA 3F41A 2HWHA 4NXNJ 4IDKA 2DGOA 3HHNB 1T94A 2PEHA 3NGDA 3BKFA 2C2MB 4ECXA 1JKHA 2KTQA 2F9JA 1XMOJ 4DQRA 4C8OA 1SJ1A 4H4KA 3LTOA 1KQFB 2ASYA 2NXEA 1FD8A 4OHYA 3D6FB 3DFEA 2WVDA 3MEEA 2XLIA 2XB2D 2HHUA 2E7XA 3RZAA 1JLBB 1UWBA 4F0KA 3M8QB 2NUUG 4HACA 2IHR1 1VR6A 2ZVSA 1S10A 2YH1A 2R2RA 3E01A 1HA1A 4DBQA 2G13A 4HI2A 5D6GA 3PM9A 1VQ6S 2CVEA 3MECA 4H4KC 3NS6A 1NDPA 3NP5A 2WW4A 1HBUA 1Y5IB 3SI8A 3D7SB 5AXNA 3ZZOA 3CD6S 4CM0A 2OELA 2GMJA 1P9YA 1M90T 1CJTB 2RU3A 3NGTA 1LWCA 1TL7A 3MMAB 3GIMA 4IG3A 1SJ4P 5FLXU 3CSKA 1X7VA 4ECWA 3JTNA 3BO3A 2DNLA 4FXWA 2E1RA 3B4DA 1RLDA 3CF5Q 3FZBA 1UAWA 2W7AA 3KWMA 1FDDA 1OSDA 2P6SA 1BE4A 2BKNA 3KLGB 1Y10A 4JI8J 2AX0A 4R25A 1HMVA 2LYVA 2DGQA 3GYXB 4A8KA 1S7IA 2PMWA 4CNZA 3HVRA 3NAIA 4Y00A 4CM2A 3X3UA 2AHOB 4EYHB 3DCAA 1N36F 4DR1J 2MKKA 4NCBA 5L1LA 3PX0A 1J5EF 2FZCB 3JSMA 4EMDA 1PCAA 2CA9A 4K8RA 2XGPA 1SC4B 1TK8A 3H5UA 1SL0A 3EVWA 1FJ7A 1KS2A 1UKUA 4DFMA 2GO9A 2QE5A 2C3MA 4ANDA 2IJFA 5J1EB 2WB1D 4L6V3 3BGRA 4HHHA 3MTKA 4LFBF 5H9FK 4X62F 4PUOA 3WBZA 4PG8A 5HROA 3C6UA 2YQ1A 1FFGB 4KFBA 4NA2A 4PWUA 3G6ES 5H9EK 2RHQB 2NXCA 4LSLA 1ZAVA 2H5IB 1NO8A 4AUKA 5J1PA 1Q78A 4KQZA 1KLMA 1DTTB 1M0SA 4DF8A 1Q81T 3NGUA 1VJQA 2DYAA 4J9SA 2C42A 3BBBA 2AU0A 2ZWPA 6FDRA 3VAKA 1HW9A 3MAQA 4DV7J 3VGUA 1CJUA 2RQ4A 4X64F 3H40A 3R8YA 1VQ9S 2NLWA 1VRUA 4FDFA 1U02A 3LGMA 1NAQA 2RUSA 1U0SA 4G6VB 1W2BR 2KVIA 2M8HA 3GU0A 3J7ZT 2CWXA 1FJGF 5F8HA 3NCQA 4ZCIA 1DLOA 1P9QC 2GS8A 1MWYA 1LKZA 2KI2A 3Q22A 5JXSA 1B7YB 2FJDB 2RDDA 3T5KA 4N41A 3R97A 4X2BA 4OYMA 3PW2A 3S7RA 2EI5A 3HVTA 4NLSA 2XMVA 4FVCA 5C42A 3ZZTA 4BC9A 2ZD1A 3ENQA 4AFFA 3MM9A 2M8DB 4WTYA 5HN0A 4B9NA 2OI2A 4I7FA 3E3XA 1C0UB 1H7XA 3M9MB 3OHAA 3TVZA 3C6TB 4R5PB 2EFVA 1CJKB 2FLPA 3P49B 2HPUA 3M30A 3HVWA 2NYHA 2BX6A 2DO0A 1JJ2R 2YNGB 4KSEB 4JI6F 2X1FA 4ZJLA 3RBZA 1NXIA 3PO4A 1I1GA 4QW8A 2DXFA 4GVBB 1UVJA 1X0FA 1RT2A 3QJJA 3HXMA 4DPTA 2WBMA 4URQU 2V8HA 4RNNA 4F26A 2BJEA 3CNQP 3RG6A 4NWBA 2ZKTA 4NA1A 2UUAJ 5L1KA 3GJRB 1VQOS 2VD3A 2J0QD 1OQ3A 3PRVA 1KQKA 2ZNYA 2XMWA 1NK4A 4EFAC 3LAMA 3MMBB 5L46A 2DGTA 2VG7B 3HM9A 3BN7A 3HCXA 1DFDA 2B7CB 2E1PA 3T5LA 2JLEA 1RAIB 3HDSA 1UW9A 2Q66A 3TJ9A 4PWDB 2VU5A 2VICA 4JI5F 4NMXA 4Q43A 1SXLA 2KFZA 3AOCA 1PIEA 4ECVA 2VHGA 2EVZA 3H2VE 4RNHA 3UD5A 2HQDA 3BQ2A 5F9NA 4MYUA 4OLPA 4UOCA 2VBYA 4U8YA 4CDIA 1WEYA 3M2UB 1XMQF 5KT2A 1RQ0A 3ISZA 3TZXA 3MGJA 4U8VA 4ELTA 2OD4A 2N7YA 1DQAA 3RAQA 4GO5X 3HZEA 3MDFA 2FUG9 1KNZA 1IBLF 2CVIA 4WFNQ 3OD2A 3AT1B 2D69A 1NK5A 1WF1A 4Y2KA 4ED6A 2A2DA 4O4GA 1RUSA 2HFVA 1WHXA 3G9CA 3QGPA 4R8UB 3OTCA 3BSCA 1WDTA 1FKPB 2B5JB 3GWCA 5IM0B 3W65A 2V6AA 2V4JB 4F0HA 2AJ0A 1FNXH 1R8BA 3DLLQ 4NI2B 2GCFA 3I87A 4KJIA 1V5VA 2G0CA 2EXUA 2JEIA 1URNA 3ULHA 2QTWA 2RF2B 3IWXA 4U7UD 3SZ2A 2F40A 3HHLC 5A2QY 4K4VA 1YTYA 3IG1B 2KT2A 2UZAA 4F3OA 1QTNB 4OX9F 2QL7B 1WEXA 3KK2B 4DR2F 4EO6A 4M63A 1TELA 2YQ3A 1HNWJ 3F44A 2MZ1A 5IWAJ 4LVOP 2CIMA 4N76A 3AD7C 1VHIA 2W1BA 3N9UC 3DHXA 2YNHB 4P72A 3MEKA 1PAEX 3KK3A 3MD1A 1X4FA 2V50A 3CJ8A 2XM3A 1GMWA 1YJ7A 4B9SA 2LQ9A 3KG1A 3VVUA 3IM8A 2A2CA 3VGTA 5HANA 1A6LA 4EYIB 3HHKA 4ECRA 4LF6F 4G1QA 1X4AA 1YSJA 2DR5A 2GFFA 2AQ4A 3IBCB 3J7Z5 3OTOJ 3U1LA 2HG4A 2VOOA 1D9AA 5HMWA 3M2RA 2V69A 1AZSA 3QATA 2B4PA 1TV6B 4J9QA 2HHSA 1YRUA 2HWIA 1T9TA 2DT9A 3LP0B 1RBAA 5L9XA 5KFVA 4QIWD 1JLQB 1AT1B 3U1NA 1MU2B 3T5JA 4J37A 3A13A 4QPXA 2BE7D 2HRUA 2FYXA 2GQ2A 1L3SA 5K14A 4DQQA 3EGNA 4H4MA 4RBTA 1FVSA 1DTQB 4WTOB 5B0GA 1YGYA 2R3VA 1S1VA 3F0NA 1S79A 4FPIA 4WXWA 3FRZA 4JYAF 2PI4A 4JI2F 3LH2S 4YUDA 3ELHA 1E6YB 2UV8G 1U1QA 1XEZA 3CEDA 3CCRS 3H2UB 5HL7Q 1U2FA 3TAMB 3KMSA 3KLEA 1VFJA 5DZ6A 4RW4A 5B0DA 4JV5F 4HH0A 3IRXA 2JSXA 2CG8A 3B8HA 1LEOA 4TLRA 1W25A 3LP1B 2XSFA 1S6UA 3D6TB 3Q8RB 4WYLA 4QWAA 2HS3A 4MAKA 2IA0A 3LP2B 1UEUA 4ZS6A 4AL5A 4CLFA 2KB2A 3UN5A 1VQYA 3KKFA 3DU6A 4FZVA 4XPEA 1RTJB 2I38A 1N4LA 2OAUA 4ZPBA 4DG1A 3BQ0A 4CO3A 4DV5F 3ZFVA 4QR1A 4BBYA 2CPFA 4LIWA 2D3UA 1YJTA 2W4DA 1RU2A 3TUIC 3D4JA 2QIFA 3UNYA 1ICEB 1X60A 3WQPA 4PG5A 1NZAA 1F6TA 2F63A 4XDCA 4GKJJ 1HNIA 3R7NB 2LECA 2VDHA 4A8SA 3CIZA 4DR7F 1OY9A 4JP8A 2ZUAA 2M9KA 1LWXA 4J9NA 1EAYC 2QN6B 1L5UA 4Q0BA 2X1GA 1FTRA 3G2XA 1EQMA 3PO5A 2BJ8A 2FJWA 3TX0A 5DGAA 3M9OB 1TL3B 3GIRA 2H65B 5KFYA 4FS1A 2IBOA 2V34A 2YKAA 2JHEA 5MLCV 5ETRA 4ZVRB 4JI7J 3M2VB 2B7BB 1LWEA 4ZVOB 3MOJB 1OO0B 4IH6A 2CPEA 2XS7A 3CCUS 2FIUA 5K5MA 2K06A 5KTQA 5DG7A 4Y3CA 3W9HA 5KFTA 1G4CA 2MPUA 3KHLA 1EETB 3BGFA 1R3NA 2HLTA 1RTHA 1IKWA 1YLXA 1CBKA 4NYZA 3RJMB 4DCPB 2N7CA 1WKLA 5L1IA 2VG6B 3KLVA 2BDPA 5G0RA 1VQ4S 1RTIA 1U2RA 5HMYA 2K3IA 4ECUA 2LA4A 1IBMF 4WWSA 4JI0F 2X7IA 4EUVA 2A1BA 2VBXA 3K5PA 1UCNA 2CPJA 1OMSA 5IT9Y 5L8RC 4TY9A 1N0UA 1PAUB 4IR9A 4NXNF 2B9XA 2HHVA 3FBCA 1UVNA 2ZNZA 1S1UB 1X4BA 1Y0HA 2DHSA 2GO8A 2WBRA 3DRPB 3KK1B 1JLAA 3P8BB 3MPYA 3ZC4A 2VDIA 3QT8A 4HKQA 1S59A 2J7KA 1CS4A 1YZ7A 2KXNB 3AOAA 3DLEA 3HHLB 3RRGA 2R7TA 1LXNA 4OHWA 2FVQA 3MM8A 2CDQA 1QAYA 3MPUB 3KLIA 2IVYA 2BJ9A 2CNLB 1IJFB 3MR5A 2YWWA 5JVHQ 1N34J 2WHOA 5EHHA 2IDEA 1FHTA 1RHMB 3LANA 3UQSA 1DJ0A 3UN2A 2RDIA 3TA0A 2LQ5A 1EB0A 1ZZNA 5B0CA 3BBCA 2DR7A 1YJNS 2PO4A 2IYIA 2HVZA 1UA1A 1J2VA 3N0VA 2H4YB 1HQUB 2HFZA 4CLWA 5KFCA 3RBXA 3TW0A 2YNFA 2IRUA 4ZLJA 2CJXB 1V9OA 3KUGA 4IKAA 4RL1A 1L3TA 5GMDA 5FIIA 3ZXWA 4NI2A 2IAJA 2WW8A 4ZHRB 4CLKA 3M32B 2HW3A 1FD2A 4JUZA 2BE9B 5KFNA 2AJFE 2MMYA 2C3YA 4B3MF 2R7VA 3T41A 1PYOB 3CCSS 1C1BA 1ZYQA 1AYEA 5B0EA 2HHWA 2WRMA 2HQGA 3N6NA 2F7VA 4JI8F 5HLFA 2MHNA 4YHHJ 3R7SB 2BANB 1WOPA 3KNAA 4QCLA 5IT4A 3WX8A 4YR2A 1B0VA 2OSRA 2C2EA 2XYGB 2EEYA 2CJQA 4IR1A 3MPDA 2DXDA 4RW6B 4KPYA 2J76E 1G2EA 1SH3A 3CULA 4NLYA 5IXUA 1Z1ZA 3OUYB 4DR1F 2VPXB 3KNGA 1HNXJ 3QIDA 4LF4J 2VH7A 5D4NA 5KG7A 3DLKA 2NXNA 2Y9HA 2ILZA 3WC0A 1NM2A 4DR3J 2DRBA 2J9EA 2GQCA 2OPQA 3Q8YA 1Q95G 1MWQA 3CJRA 3DKDA 3SV4A 4NASA 3UDLA 2HHHJ 4I69A 4WFYA 3D5MA 3GSIA 4WU3A 1D09B 2HKEA 2KM8B 1FFSB 2Y8YA 3BKTA 1T05B 1PC5A 2FHMA 4Q2MA 1U0HA 5ETTA 3NS7B 2GHWA 4ZPWR 4USKA 1BC6A 2RS8A 4K50A 1A7GE 3GG0A 3IP0A 1RT5A 3QPIA 4UTGA 3CJ0A 1Q16B 3I0RA 1EP4B 1SL1A 2RQCA 3Q0AA 4KTQA 3A1YG 2CQBA 2PMZD 1RLCL 3MM6A 1LK5A 2YPZA 4MH8A 4DV7F 2W01A 3GLJA 3MEDA 3DC2A 2VC1A 2B56A 2ZOFA 3L7PA 2AW0A 4IH7A 4ZP9A 1M5OC 4URGA 1N32F 3CD0A 2ZH1A 2M7SA 4TYBA 2XMKA 3T6BA 4ES2A 1V3ZA 1SCJB 1NDCA 2MJUA 3LO3A 4FNHA 3W8GA 3AJ2A 4ZN3A 4MKBA 3OR1A 3TEGA 1WF2A 2A6MA 5D0GA 3C14A 1ZH5A 1XR7A 2B9YA 5I4MA 1C0TB 1U6FA 4RBUA 1NPRA 2VJVA 4WKYA 1VHFA 3NOGA 4RUHA 2CRLA 3QT5A 1KWMA 4QIVA 4LBHA 1PJ6A 2OTJS 4DZ6A 3OSNA 3BS9A 3A8IA 4NLPA 3UD3P 4B3SJ 2HNZB 4UQGA 3M9NB 4C4WA 5GAEI 2ZHOA 3MF5A 1X4GA 2ADBA 4MK9A 3EDRB 1EARA 4PKDB 4WZMA 1H7WA 4ZVUB 1QAJA 2G0IA 2DISA 3OL8A 4E8UA 4NLTA 2F8EX 5E7OB 4USJC 2BQRA 1RWKB 2R7SA 3S6EA 1F9EB 2KH9A 2XNRA 1NKCA 3Q2SC 1N5TA 1MMDA 1W2IA 3GQCA 4O3NA 3E2EA 2W9BA 1GH8A 1TK5A 4OZ3A 4DX7A 3BM7A 2C3PA 3PACA 4OI1A 3VAFA 5KFBA 4B3RJ 1S9GB 3K59A 2OPPB 2J9CA 1B3TA 2MKCA 3G87A 3CCMS 4RW7A 1U1RA 3EVMA 1NSQA 2HNDA 1H72C 4IH5A 4USHA 1QJHA 1CJVA 2CJAA 2RSQA 1DARA 4EI2A 4F4XA 2CZ9A 3T1AA 4ELVA 2QA1A 2E7WA 2OJ3A 1NU4A 3M8RA 3K89A 2FTRA 1L3UA 3TQEA 2MZRA 1FNMA 4H54A 3CMQA 2WB4A 3QZ7A 1CVJA 2VUGA 5HK4A 4G1IA 4YB5A 1R0BG 4CRJA 3TOQA 2KG1A 3I4PA 2VC0A 3HPOA 4X4VA 3O8WA 5C25A 1LNQA 2JLGA 3DI6B 1C4AA 3OL6A 2HNYB 4OYOA 1FNOA 3FK4A 2YKMB 4CO0A 1VJWA 1KFDA 2IRYA 1VK8A 3PYDA 3SSRA 3JSRA 3TQ1A 3VAJA 1K44A 1A0OB 1OPZA 3F56A 5E3CA 5ETPA 2YBVA 1AA1B 2KXFA 4MYTA 3FQKA 2BRKA 4DV4F 2YNIB 3P6YC 2NS1B 4I68A 1DAXA 2DK2A 5D15A 1UVIA 3I0SB 3LAKA 1S1UA 4LF7J 3UPFA 1U2CA 2ZKUA 3DOKA 1HW8A 3SSSA 4KE5A 5CZXA 4YOEA 5A8RA 3EXYA 2KYZA 3HP6A 2ZJQQ 1B70B 1UZHA 3TAQA 2HSEB 1IWGA 2MJNA 3G86A 5HI7A 3NWGA 3RAMA 3T1HF 1HD1A 5L39A 1RT3B 4DL2A 3RYLA 1OS5A 4AYBD 2L08A 2AMCB 1BWVA 4LT6A 5KT5A 3A8KA 3JAMU 4DSEA 4B17A 2QA4G 3MM5A 2DHAA 2K2PA 3V4IB 2P8IA 1HNWF 2QMUB 5IWAF 3GCWP 2CADA 2C2KB 2XMMA 1LV5A 3MCNA 2Z0GA 4X4TA 2FVPA 4N77A 4NXMJ 3D6HB 1KRPA 3D3BJ 3OXLA 1YQHA 1H2UX 3R5DA 3OT9A 4ATNA 1WKJA 4TNOA 1HI1A 3EICA 3DN9A 4ZA1A 4X4SA 3AQPA 5RUBA 3T9ZA 2RD5C 3PFEA 4M5IA 3HHLD 4OMFG 2V68A 1RWPB 4KH0B 2V2VA 3OTOF 4IFVA 1RCOB 3MFHA 3B6BA 2IRXA 3VALA 1WSRA 5IOLA 1BQNB 1VBXA 2BANA 3VWSA 3VCDA 4DV2F 2PN6A 3ILOA 4DPXA 4KV8A 1XR5A 3VV2B 1X9MA 5DQGA 3D0HE 5GMEA 2MLYA 1R6VA 5KFPA 3HHEA 4YB7A 2COLA 5T14A 2WTFA 2AJ1A 5E5NA 1XIQA 1U47A 1FTCA 2RQMA 3G82A 3QLHB 1X9SA 2BJ7A 4P2SA 2IJRA 3SYZA 2A10A 2LQJA 2I0XA 4YR3A 1KONA 3TYTA 2C2DA 2OSQA 1RKJA 5CH7B 3KOAA 4UOFA 2BW2A 4CLPA 3KHGA 4WE1B 2JVOA 4KH1B 2B43A 2UUWA 4Y2MA 3W7BA 7FD1A 1Q82T 2NXJA 4A8OA 4IUFA 2BOPA 1S1WA 2YKNB 4RNFA 4RKUC 3UO0A 5KOXA 2G2YA 4ZPDA 3T1YJ 4X84A 2V8VA 3W5ZA 4K4ZA 3K5LA 4NZ7A 3KJQB 1VDHA 2VPWB 3O1LA 1UMJA 2E1CA 5LOQA 2JJ4D 4RPFA 5FLXY 1MROB 4HT7A 4J9KA 3MPVA 5AXMA 3KJVB 2UVWA 1UZDA 2QLWA 1X9WA 3MCSA 3A3OB 4OI3A 3K8WA 2XLJA 3HD1A 3OFHA 3UN3A 1N6QA 2EKNA 3J7A1 4GKJF 4L76A 4DPOA 4ECYA 2IJNA 3ITHB 5KG2A 1P8GA 2WVEA 4Y6IA 2UVVA 3QRQA 3ET6A 3ILJA 4HEA9 5IC6B 2G1HA 4NLQA 2RVJA 2WSEC 2IM1A 2JNJA 1EJ7L 2RRNA 1N36J 2IVMA 3K2YA 1FRMA 2MYFA 5KG4A 4WZQA 3H0PA 4B9TA 4TXSA 3KMQA 1QY7A 2MGZB 4JI7F 4F04B 4F02A 1LQ9A 4DN0A 1NSAA 3POTB 4NRUA 1Q8LA 1SV5A 1WACA 2RH3A 1O51A 5KFSA 4O44B 4LFBJ 3PJWA 2HNZA 1KHWA 2XG8A 2LLZA 4J7CA 2QLFB 3UD4P 1VQ5S 1RB0A 5LMUJ 2QYCA 1KFSA 2XNQA 2MQMA 2OPSA 4BS2A 3BYRA 3V5RA 3HVAA 1RTZA 4QYZJ 2Q1LA 3QGIA 4RWXA 1WC1A 4F7VA 2YH0A 4CO5A 3UI3A 1D9FA 5K8OA 1CLFA 3ZTRA 4MK7A 3SXLA 3OLAA 2HHTA 5AE1A 4DL7A 3B4MA 2FY1A 4WIIA 5J2NA 1WDDA 2AYEA 3GIJA 3PDNA 4F67A 1J5OA 4RZRA 3QAUA 1EX8A 5B09A 2DNGA 3HT0A 2D9PA 3BDPA 1KSPA 4QWBA 5T7LB 1NBEB 3VGSA 4FNIA 2FVRA 1S57A 1OJ4A 2BEFA 5BR8J 2XSJB 2QA2A 1D1UA 1S76D 2NXUA 4KKOA 2GIRA 1RHKB 2HAFA 4UQTA 4WK3A 1N54B 4RW8A 3DM2B 4CLSA 2DGWA 1OYDA 4I2QB 4C3KA 1RT4B 2LXUA 1YRTA 3C19A 1N34F 4KO0B 4W4MA 5A8KB 5HBMB 4CZCA 1RWNB 3UW1A 2ZOMA 4LF5J 2GZOA 4KIAA 3DLBA 2FPHX 3UR0A 3G6VA 3DRRA 1TMJA 4LJMA 2OMLA 1I5OB 3CT9A 4UZBA 3U27A 1N56A 5IQQA 1AROP 1TL1B 5M2PA 2HQCA 4QU6A 1Q1KA 3O2IA 2MKIA 3KYLA 5J2PB 2LFVA 2MQQA 2E5JA 4QWEA 5HP1A 2J9DE 5ETVA 5KFIA 4V19J 2GVDA 4K2JA 2GX8A 4J9UE 3KJFB 4A8YA 1SKWA 1VQMS 1IKYA 2DD8S 2NYIA 4M5MA 3SFUA 5C7PA 2GVZA 5I42A 1N5YA 4CO1A 5D77A 4M5DB 1HARA 2EK1A 2CXEA 3THPA 3W63A 3TA1A 5C2GA 1M1KT 4FXVA 3DGPA 1GTEA 4I2PA 3LWMA 3MR2A 4OZJA 1UVMA 3MR6A 3D54A 2L41A 1R43A 1MMNA 2FC9A 1NJXA 4ZVPB 1XC9A 4LREA 1HNXF 1NNDA 3AH6A 2RRAA 2DHHA 1VC5A 4LF4F 1HBMB 1HQEA 4DR3F 4F4AA 1R89A 3NWRA 2C2NA 1LW0A 4F4ZA 1VC6A 3PV8A 2X51A 1N52B 1NK9A 4Q8EA 2V2ZA 1BHNA 2HHHF 1P27B 1K8AT 2IIHA 3PFOA 3WIUA 3I56S 3M8WA 1C2PA 1F5CA 4LBPA 4G1PA 3TO8A 1M1GA 3D6MB 2Y1IA 5HAOA 2A18A 2G2ZA 1RJJA 4B02A 1RT7A 2B0GA 4MT1A 3U02A 4C6AA 4ANEA 1LWFA 2DGXA 2QRRA 2NR0A 2MQLA 2B4VA 1BQXA 5KFDA 3M8PB 1YX2A 2HFUA 2FLOA 2HFNA 4KY3A 3W2VB 1WI6A 4WFAQ 4D3HA 3UCZP 4P71A 1SC1B 3G8SA 2BKPA 4K0KJ 1PYTA 3KHRA 1RA7A 1REVB 3PJ9A 2QYGA 4TU7A 5GVQA 1H73A 2MY7A 1Q8KA 3VAHA 5DM7Q 4IOBA 3CPWR 4QIFA 1UP1A 7FDRA 1F5BA 3BGUA 2CNNB 1GEHA 1VRTB 1MLAA 4DPYA 4PAAA 4K7QA 2XZTB 9ATCB 1UPMB 4CLTA 2JEGA 4DSFA 3C3LA 3LPYA 4X4UA 4J9MA 8AT1B 1Y4ZB 1T03A 2NPIA 3NBPA 3KUEA 3L7UA 5KFMA 1IR2A 1KTQA 4NLUA 4Y2IA 3PKYA 2UUCJ 4WE1A 2QO3A 4FF4A 2I5JA 1OSCA 2UU9F 5E3QA 4P2XA 3ZTPA 2ABYA 4OQJA 1S1TA 5HVGA 2KRBA 4C8MA 3BKUA 3HKWA 4X66J 3GIIA 1NJYA 5H9EJ 5FDLB 5A0YB 2OPRA 4WP8A 2WONA 1LXJA 2QSWA 3HT3A 1D8YA 4B3SF 4LF8J 2RILA 4Y34A 4AE5A 4MKAA 2GJ2A 1PBAA 4HTIA 1NZ8A 4OZ0A 1X4DA 2JVRA 5KFHA 3IS9B 3EYZA 2K1RB 2BBEA 1RHUB 4F0MA 1RWUA 4OJ1A 1WC0A 3PIOQ 3LALA 2BRLA 5J2QB 4B3TJ 3ZZRA 1FE4A 5B0FA 2KKHA 3V81B 4I6YA 5CAAA 5KG3A 3OFGA 3NS5A 4ZP8A 4B3RF 4IFYA 1VI7A 1JLEA 2ZE2B 3DDIA 4M5JA 3VF0B 5KFJA 4K2XA 2Q43A 1RISA 3OR2A 4RWWA 2CQCA 1RADB 2H5JB 3QO9A 1R0AA 2DEJA 3KDOA 4M5HA 2C2RA 4ED2A 3D1OA 4NZ0A 1NDKA 3V6DB 3N5BA 1U49A 3BGLA 3JQMA 5CYJA 2IDLA 4MFBB 3C16A 4DL5A 4OI4A 3GFHA 5K8NA 1BQMB 3M4XA 2M0GB 1RT6B 3I82A 2QL5B 4E2FB 3K5OA 4DSIA 4Z37A 4KGKA 1S6PA 4ED7A 4X4PA 4PQUA 2Y3YA 2FC8A 2E1MC 4YN3B 1KD1T 5LJ5Y 1YDLA 5IV4A 2G0JA 2CAJA 1HHSA 4TY8B 2R8GA 4PPDA 3DRSB 2DNYA 3DLGA 2I2YA 2EW9A 1SUQA 5EN1A 3KUHA 2MLXA 3GSDA 3QSIA 4ED1A 1ZPVA 2B6AB 4ZK7M 2OIHA 1ZTWA 2HMIB 4P9SA 2VFUA 3W64A 5D3GB 1JB0C 1NH8A 4U96A 1UEVA 4OFZA 3LGHA 5C24B 4Y2AA 1WHWA 3ISNC 2DHGA 1CC7A 4LQ3A 4LF1A 2JFKA 1TZ0A 4CP5A 3BN4A 3W2WA 3FCWA 3ZZPA 1YRXA 1FXLA 3QIPB 3S1TA 3S8SA 2BJ1A 1XK8A 1HBNA 4RU9A 4A8XA 2EFPA 2AZ3A 3MAAB 3ONQA 2ZDPA 1KLNA 3GP9A 2MKJA 2HRTA 1FJEB 1U1NA 4ZVTB 5DLFA 1TKDA 3PCOB 3K8VA 1LW2B 2R7QA 4I2QA 3J7YU 2PSZA 3CB4A 4KO0A 4PQAA 3NY0A 1EKRA 2E44A 1T3NA 2L3MA 4JV0A 2RT3A 1HBOB 5F8NA 2P9GA 2LKZA 1UVKA 2Z2MA 3L7OA 4RUCA 1WOSA 4WK1A 3MURP 2MQ8A 5EGYA 2O67A 5CYQA 3QSYB 1DRZA 3VAMA 4P7TA 1KEKA 3SMZA 2DB1A 1YKWA 4NXMF 1GQEA 4C11A 1Y5NB 2OP5A 4F3QA 2LDIA 1HPZA 3PHTA 2XEXA 4QPTA 3EGZA 3MM7B 1QE1A 1N5QA 3P3DA 1TL1A 4U6PA 1VLOA 4HDHA 5THWA 1U1PA 2Z2LA 4CTAA 5KG1A 4CH7A 3UVJB 3BPSP 5J2PA 1WG4A 4QIEA 2RKIB 3TI0A 1K9MT 2LU1A 3P4UB 1R31A 3L09A 4TLQA 2NREA 2K3KA 1EIYB 3R7BB 3BDEA 4O3PA 2W2OP 4P75A 5J2MB 3VAGA 1S77D 3QRPA 3L95X 2FLLA 4OZ5A 4MK8A 3LPEA 1C1CA 1TKZB 3VQSA 1XNQJ 4QYRA 3U1MA 4RW9B 2UXBJ 2ZH2A 1HI0P 3BBFA 2D3O1 4ILLA 4DSJA 3R5GA 2P9EA 4K4TA 3KLFA 4QU7A 2GAGC 5CD4A 4ZVEA 4K4UA 3VZIA 1K0TA 4L73A 3GV5B 1O0PA 3BSAA 1L3VA 5D78A 3DOMB 3G96A 1TKXB 2WOMA 1E6VB 4UW2A 2WSCC 1HYSA 3EXCX 3PHEA 4ICLB 4DR4J 1KTVA 4ZLNA 3DMJA 1NH7A 3VR1A 1JLFB 4WFBQ 2Y1RI 3PEJA 1SIWB 3I9ZA 5K9FA 3OTEA 3GG1A 2OFHX 1VQKS 5B08A 1NDLA 3RRHA 3TJAA 1WEZA 1FVQA 4ZPTR 1HNZF 5HJXA 2R8HA 3NG8A 2OLWA 3O3LA 4F2SA 3MUTP 2QSFA 2EFQA 3TZYA 2E5GA 3T1YF 2R7XA 2CJBA 5KFZA 4Q5VA 2OEJA 2VFSA 5KFAA 3NCPA 1CQMA 2IFXA 3SDEA 1RT1B 1Y3JA 2RDJA 4U7CA 1OYEA 1DQ9A 4F2RA 1UFLA 4X4QA 2ACMA 1U7LA 3C8YA 1RABB 2LEBA 2CPHA 2RMLA 2FJAB 3Q8SB 4Q8FA 4LF2A 1REVA 1KVIA 3FFIA 4B3MJ 2XS2A 5KFGA 3KLHB 2XLKA 3N6LA 2WVBA 4MKYA 5A8WB 1NK6A 2W2MP 2BJ3A 4P73A 4UUXA 2GGPA 1QAXA 3R1HA 3R27A 1F3VA 2BUNA 2C2OB 1NHUA 1S9EA 1CSJA 1UJ5A 2V9WA 1S49A 2DNHA 3V2UC 1TQLA 1DQ8A 1S6OA 4V19X 1VQLS 2EBGA 2W9CB 1NEEA 1HNVB 3V4MA 1TKTB 4YMEA 1RI7A 1UA0A 3MMCA 5E3AA 2RRBA 5D0EA 3BGOP 3BSOA 2CQHA 2R7UA 2GV1A 2W4PA 1PILA 3DYAA 2MLZA 2I8EA 3PJXA 4ER8A 2ZH5A 4YDXA 4ID8A 3DNCA 3R5CA 1Y00A 3T19A 3AJDA 2BE2B 4F4WA 2HLUA 4CYUB 2DEIA 4WIQA 5KFOA 1RKIA 2GAHC 5LMUF 2DH8A 3R6LB 1FCAA 1SJRA 5IC4B 4ERDA 2DVIA 1FRJA 1R8AA 2HGLA 3AAWB 2U1AA 5LSLA 3I55S 4HHUA 3B54A 3M8SA 4CT8A 3HZGA 2AKWB 2OEKA 4NYOA 1HR0J 2YKPA 4PWWA 1KVJA 3AODA 3PRBA 1FA0A 2F8MA 2HHQA 3SQGB 4UUWA 1XMBA 3MUVP 1YVFA 2VV5A 3SCKE 1SH0A 3KJNB 3R2CJ 4LRBA 4DQPA 2ALZA 4U95A 4B9LA 3DDNA 4ECTA 2J7UA 3HJVA 4KR0B 2X3DA 4KT0C 5CYMB 3DLJA 4ZCLA 3IBFB 1N32J 4L3KA 1IM4A 4PG7A 4LRCA 4P52A 4H4OB 2VG5B 3MAHA 5LM7E 3GFYA 3ETMA 3E8OA 4TU8A 2ATCB 5BR8F 3HFVA 4YP3A 4WBFA 4OL8A 3CD7A 3CMAS 2Q6BA 3HF5A 4EK2A 3C15A 1M1HA 4TKTA 5DDQC 4C7QA 1VQPS 2F5GA 5LSRA 5E2QA 2MKYA 3CXCR 2Y0BB 3KFWX 3OLBA 1YBUA 5CHCB 3EZUA 3OXGA 5I3UB 4ZOSA 4DJBA 2E5HA 2JEJA 5GAGU 1RDRA 4WF9Q 2R42A 4OZ1A 4LF5F 3I32A 4IG0A 4USVA 4Y0FA 2GQQA 1VGYA 4RBVA 2KRRA 2BJDA 2GJIA 2YWEA 1ULRA 2B6AA 3BB5A 2GHPA 2D1CA 2EFGA 4ZN1A 4IYQA 4NX9A 1HI8A 1R8HA 4NA3A 1N5VA 1RHJB 3JQKA 2W2NP 2B9WA 2ERRA 4NCAA 3WDOA 3OJUA 3ICLA
chains in the Genus database with same CATH topology
2JH3A 2VC0A 2ZH4A 1DURA 3ISND 3HPOA 4X4VA 3O8WA 3DOLB 5D8HB 1S1XB 1S6QB 2LEPA 1IKVA 1TAUA 2XY7A 1DBDA 1K73T 5C25A 4NLOA 5EX3A 2JLGA 1SQEA 2LCWA 1JJ4A 3DI6B 1C4AA 3OL6A 2HNYB 2XMJA 3JTOA 4XIUA 4EBEA 2D7SA 1FNOA 3JYTB 2YKMB 4IO9Q 4C0HA 3DOLA 4Y65A 4CO0A 2KHCA 1S1XA 1S6QA 5E3PA 1VJWA 4DLEA 3TUJC 4OX8A 1FRKA 1FRLA 1Q8IA 2IVFB 1KFDA 1VIXA 2IRYA 1VK8A 3S01A 1FK9A 2E5LF 2KJVA 2EWHA 3SSRA 2ASJA 2GA7A 3JSRA 2B4OA 3TQ1A 3DI6A 2D74B 4YEAA 3CO9A 3G8QA 3HJFA 4HDGA 3RB0A 5MAOA 4KHRA 3VAJA 5HMZA 2HNYA 2ZZNA 4ILMA 4EO8A 1OPZA 3F56A 2RNEA 4TQSA 2BM0A 5E3CA 3JYTA 2YKMA 2KZMA 2KXFA 4MYTA 3FQKA 1U45A 2QMXA 1FRHA 2BRKA 1ZM3A 4CO2A 4DV4F 2CQDA 2ROGA 2EG2A 3FMBA 2YNIB 3TNVA 1X5PA 2H9ZA 2B51A 2XWXA 3P6YC 5KAKA 3DOKB 5KOWA 3CDWA 2NS1B 4I68A 2MQPA 2W8LA 4IRCA 1DAXA 1U25A 2L9DA 2NSBA 5CA5A 4BC7A 3KHHA 3GV7B 2DK2A 4DUZF 2DHXA 3AA8A 5DO2A 2DGSA 4HHJA 2DJWA 2ZHAA 3I0SB 5CQGA 2ZH8A 3LAKA 5A8RB 1XMOF 1UVIA 3RW6A 1Q8BA 1S1UA 5L9NA 2ZH9A 2EFOA 3BR8A 2IM2A 2YNIA 3UPFA 2ZKUA 2MZTA 3DOKA 3GR1A 1HW8A 1V6HA 3SSSA 4FBTA 4KE5A 2V0NA 5CZXA 3N4WA 4YOEA 2Z8QA 3LWLA 5LXYA 1WD6A 3I0SA 3KG0A 1S99A 1JLCB 2PDAA 3EXYA 5A8RA 2KYZA 3HP6A 1H6KX 1B0PA 5GAHI 2YVSA 2CPXA 3TAPA 5L38A 2ZJQQ 4UY8T 3FGVA 3TAQA 1WWHA 3MOZA 3I9V9 4ZDNA 4RUAA 2MJNA 3G86A 5LSOA 3US5A 3GYNA 3J7YI 1HL6A 4GKKF 3VAIA 3OW2R 5HI7A 2AGPA 4JI1F 1A9NB 1YIJS 1YI2S 2DCUB 3NWGA 4RX6A 2IMWP 1JLCA 2QMWA 3RAMA 3T1HF 3MM5B 4WCEQ 2XS5A 2AF6A 2BR0A 4NMLA 5GMKa 3ETOA 1GX5A 1HD1A 3LGNA 5L39A 4YB6A 5F3ZA 1RT3B 4IDKB 4DL2A 3RYLA 1OS5A 1HWLA 4AYBD 4EGLA 2L08A 1HWIA 1F9FA 4PCQA 4LT6A 3PY8A 3K5NA 3PW4A 5KT5A 4DV1F 2YWFA 2OKQA 2NSCA 4B17A 4DSEA 2QA4G 2F8HA 3BJYA 3MM5A 2DHAA 1IKXB 1F0XA 2K2PA 1WNEA 1TK0A 3V4IB 2C22A 1OIAA 3F41A 2HWHA 3Q2TC 1RT3A 4J9LA 4IDKA 1HNWF 4FXDA 5C5JA 2VKRA 5IWAF 2DGOA 4TN2A 1JKHB 4OHZA 3HHNB 1T94A 5KG6A 4CO4A 3HKZD 1Q4RA 1SIZA 2ASLA 2PEHA 3TUZC 3NGDA 2XMMA 3PX6A 3MEGA 3V4IA 1LV5A 2F4VF 3HT3A 4M8LA 2W4CA 3MEEB 1TKZA 2R9LA 4ECXA 1C4CA 1JKHA 2KTQA 2F9JA 2Z0GA 4DQRA 4C8OA 2VASA 1SJ1A 1WTFA 4H4KA 4X4TA 1KQFB 4N77A 2FVPA 2CFXA 3FJ2A 4PG6A 2ZZMA 4BWJA 4OJGA 2ASYA 1UWBB 2UXDF 1KRPA 3OXLA 1YQHA 1VQ7S 1H2UX 4PRFA 1FD8A 3LQVA 3R5DA 4OHYA 3DFEA 1IR0A 4ATNA 5KT7A 3MEEA 5F3TA 4TNOA 2XLIA 2XB2D 4NLVA 1IBKF 2HHUA 1HI1A 2E7XA 2E9RX 3RZAA 4K0KF 2O5DA 1JLBB 4OLOA 3BQ1A 3DN9A 1X4CA 4ZA1A 1R8CA 4J9PA 1JLGA 1UWBA 2X1BA 3IR6B 4IFVB 2DNRA 4X4SA 3AQPA 1AXQA 1S48A 1MWZA 1SL2A 3QGHA 3M8QB 2NUUG 3T9ZA 5F0WA 2RD5C 5EWEA 1AW0A 3RAXA 3PFEA 3HHLD 4OMFG 4BWMA 1JLBA 2IHR1 1M5SA 3FNNA 3AY0A 1FDNA 3OTOF 3MECB 4NL5A 3NL0A 4IFVA 2ZVSA 1SJQA 5GADI 1NHVA 3MFHA 3OQ2A 1S10A 1H3DA 5DG9A 2IRXA 3JAMY 2R2RA 2YH1A 3RB3A 3M8QA 4HLBA 3E01A 1JLFA 2J0WA 1HA1A 2ZJRQ 4F8RA 3VALA 4OJ3A 4DBQA 2CKWA 1X5SA 2G13A 4HI2A 2M4MA 5D6GA 1HWKA 3PM9A 1VQ6S 4KV8B 4GO7X 2CVEA 1BQNB 1MSWD 3MECA 4H4KC 2J6TA 3NS6A 5LJ3Y 1VBXA 1LWCB 3HK2A 3NP5A 1ZOTA 1HBUA 2BANA 4FP9A 4DX8H 3VWSA 3VCDA 4DV2F 2PN6A 1Y5IB 3CGIA 3SI8A 2UUCF 2RUGA 4IG3B 5AXNA 3ZZOA 1KR4A 3CD6S 4KV8A 1BQNA 1XR5A 2GMJA 1M90T 4HH1A 2RU3A 1X9MA 1LWCA 5DQGA 2R2SA 2BACA 3BZQA 3D0HE 3MMAB 3O44A 5T41A 3HO1A 2BQUA 3GIMA 4IG3A 1XN9A 2LQBA 5KFPA 1SJ4P 3CSKA 1X7VA 1ZBTA 3PR4A 1PC4A 4ECWA 3HHEA 4YB7A 3JTNA 3BO3A 2DNLA 2COLA 4FXWA 3LUYA 5T14A 2WTFA 2AJ1A 5E5NA 2E1RA 4X66F 3B4DA 2MZQA 1U47A 3CF5Q 1FTCA 2RQMA 1U24A 2IM0A 1OWXA 1UAWA 3FZBA 3TANA 3MMAA 4ELUA 2W7AA 3KWMA 1PO6A 3PEHA 3QLHB 2KU7A 1X9SA 1FDDA 1Q86T 1OSDA 1Y3KA 4YQWA 2XMTA 4LUBA 1HMVB 2P6SA 2CG4A 2XULA 4LF8F 4P2SA 3KLGB 3SYZA 2A10A 1QUVA 5F8GA 2LQJA 3MFIA 2I0XA 4YR3A 3T9NA 1KONA 2J7WA 3TYTA 2C2DA 3IGNA 2OSQA 3OTDA 4ECQA 1RKJA 3QLHA 2AX0A 3QJPA 1S1WB 4JI4F 5CH7B 2EKYA 4R25A 1HMVA 2LYVA 3KOAA 2DGQA 5KFEA 1Y7PA 3GYXB 2BW2A 2A3JA 4A8KA 2MHEA 3KLGA 5B0AA 1WHVA 3R1LA 1YJVA 3GILA 3KHGA 4WE1B 2JVOA 2B43A 3JSBA 2UUWA 4CNZA 1RGVA 5CCMA 5E33A 3HVRA 2DNZA 2FGCA 3JSMB 4Y2MA 3W7BA 7FD1A 1Q82T 3NAIA 4Y00A 4A8OA 3OSPA 3X3UA 2BOPA 4IUFA 1S1WA 2YKNB 4DS4A 4RNFA 4RKUC 2FJXA 5KOXA 4ZPDA 4XPCA 1GTHA 2VB6A 3PW7A 4X84A 2VA3A 4B3TF 2V8VA 5KG0A 5L1JA 1YJUA 4EYHB 4K4ZA 3DCAA 1N36F 4A8FA 2MKKA 4NCBA 3K5LA 1CQNA 5L1LA 3PX0A 3GIKA 4NZ7A 1J5EF 3JSMA 3TARA 2VPWB 2ADCA 1S72S 4XDDA 4DFKA 2YKNA 2XGPA 1QTMA 3O1LA 5FJ4A 2B4UA 1UMJA 4X4OA 3H5UA 2R2UA 1TK8A 1SL0A 5F9LA 5H9FJ 1FJ7A 4DDFA 2E1CA 3BGRB 1KS2A 5FLXY 2JJ4D 1LOUA 1MROB 1UKUA 2V94A 4PUOB 3V6HA 2CZVC 4HT7A 1N6QB 2CQ2A 4A48A 4J9KA 4DFMA 3MPVA 5KFXA 2GO9A 2QE5A 2C3MA 5AXMA 3C6UB 3KJVB 1U1KA 2UVWA 1FDAA 2IJFA 4ILRA 5J1EB 2WB1D 2QLWA 3CVKA 4KFBB 4L6V3 1X9WA 3MCSA 3BGRA 4OI3A 2N4CA 3K8WA 3MTKA 4LFBF 1MROA 2XLJA 1TP7A 3IC1A 4X62F 4EBCA 3OFHA 3WBZA 4PUOA 2FLNA 5KFUA 2MXYA 3UWTA 4LQ9A 4O23A 4PG8A 1N6QA 4AXJA 5HROA 4LSLB 3C6UA 3KJVA 3OHBA 1N88A 3J7A1 4GKJF 2F1FA 2NZ4A 5J1EA 1D9DA 4KFBA 4NA2A 1XERA 5BYQA 4I56A 4PWUA 3G6ES 1KLMB 1VK3A 4DPOA 2L9NA 4P7VA 5DDPC 4ECYA 4CCHA 2IJNA 3ITHB 4B3OB 5KG2A 2W7OA 5GAEU 2BE2A 1P8GA 4Y6IA 2Y1JA 4LSLA 2ZH6A 1ZAVA 1SJ3P 3OJSA 2UVVA 2F9DA 3UR3C 1S0NA 4HTJA 4HEA9 1NO8A 4AUKA 1ZTTA 4NLQA 3Q8QB 5J1PA 1Q78A 2LDYA 4KQZA 1KLMA 2HIQA 2RVJA 2GHVC 2XZWA 5AJ3F 2WSEC 2X1AA 2W24A 3MZIA 4ECSA 1UJ6A 3ITHA 2E1AA 2IM1A 3AB2B 2RRNA 1MNEA 3QZ8A 1DTTB 3QJLA 2FD2A 1M0SA 4DF8A 2I9SA 4A46A 1Q81T 4M95A 3E51A 2IVMA 1VRUB 4J9SA 1FXDA 3K2YA 2UV8A 2C42A 1FRMA 4C97A 2MYFA 5KG4A 2ZOGA 3FEYB 4XAKA 2XI2A 4WZQA 3TA2A 2ZM6F 2AU0A 1SV5B 4B9TA 4DLGA 2DNMA 4TXSA 2UVRA 4G3IA 6FDRA 1S0VA 3KMQA 3VAKA 1HW9A 1QY7A 5BYRA 2MGZB 3MAQA 4JI7F 1DTTA 3I5CA 5EWGA 4F02A 4XK8C 1LQ9A 2IA6A 4DN0A 2RQ4A 4X64F 3FDSA 3H40A 1VQ9S 4A8MP 2HFOA 2NLWA 3POTB 4NRUA 1VRUA 2LXFA 1Q8LA 5DQIA 3FEXB 4PXCA 1SV5A 1BLUA 3H4BA 4NLGA 1CEZA 1WACA 1DLOB 3LGMA 1NAQA 4C8LA 2KT3A 1R8PA 2MGZA 3G8TA 1P6TA 4G6VB 2RH3A 1W2BR 1O51A 5KFSA 2KVIA 4O44B 2M8HA 3PJWA 1OQ6A 1S7HA 1KHWA 2HNZA 3POTA 2DH7A 2OPSB 3J7ZT 2V4QA 4IOCQ 2XG8A 1FJGF 5F8HA 3NCQA 4Q2LA 2LLZA 2JZ5A 4ZCIA 3UD4P 1DLOA 4MTPA 1VQ5S 2IYGA 2QYCA 3CCQS 1KFSA 1P9QC 2Q3PA 2IMOA 3CDAA 1KN6A 5FD1A 4O44A 2XNQA 1MWYA 2MQMA 4WU2A 3HVTB 1LKZA 2OPSA 4BS2A 4MIBA 2KI2A 3V5RA 4QIGA 3Q22A 5JXSA 2UUAF 5C42B 3HVAA 2VA2A 4ALZA 2FJDB 2Q1LA 2ZD1B 3QGIA 4RNOA 3PKMA 2V8GA 3H20A 4QYZJ 4RWXA 3OVBA 3T5KA 4QQBA 4UY85 4MIWA 4N41A 4DL6A 1NK0A 3MM9B 4F4KA 4X2BA 2AGOA 5LXRA 5BJRA 2VFVA 4C3LA 2DO4A 2Q79A 2DIVA 2YH0A 3PW0A 5J2NB 2U2FA 3S7RA 4CO5A 3JTPA 2PIIA 5KFJA 3PW2A 2EI5A 3HVTA 5EUHA 2PE8A 4URSA 3UI3A 1J5OB 4I7FB 3AJ1A 4NLSA 3Q8PB 1D9FA 4O3RA 2XMVA 4FVCA 5C42A 3ZZTA 4BC9A 5K8OA 1N48A 4NLWA 2ZD1A 3ENQA 2CPYA 4MK7A 3SXLA 3OLAA 4DR5F 2HHTA 4AFFA 2MY8A 1CLFA 2D3OR 2JWNA 3MM9A 5AE1A 2M8DB 4WTYA 4DL7A 3B4MA 3M30B 2FY1A 5HN0A 4WIIA 4B9NA 5J2NA 2DR8A 2AYEA 3D1QA 3GIJA 3PDNA 4F67A 1J5OA 4I7FA 5H1SV 3E3XA 3CCES 2DNQA 3IGVA 4RZRA 3T5HA 1C0UB 1H7XA 3QAEA 3M9MB 3QAUA 3TVZA 3OHAA 3C6TB 4R5PB 2EFVA 5B09A 2FLPA 2DNGA 3P49B 4OHXA 2GNKA 2HPUA 3M30A 2D9PA 3HVWA 3LF0A 4ED8A 3BDPA 1G1XA 1RT2B 5AE2A 1KSPA 4CH0S 5DJBA 2DO0A 1YJWS 1JJ2R 2YNGB 4KSEB 4FN5A 4ED0A 1C0UA 2RS2A 4JI6F 2X1FA 4QWBA 5G4DA 5HQ8A 5T7LB 3C6TA 2DNKA 4R5PA 1FKOA 3PO4A 3MHYA 1I1GA 2D9OA 4QW8A 2BXJA 4FNIA 2FVRA 1UVJA 3AB4B 3H5YA 1UW4A 1X0FA 4KKOB 4B08A 1RT2A 3CJKB 5KFLA 3WC2A 3QJJA 3CJ4A 3HXMA 2YWGA 3OV7A 2YNGA 4I6AA 2QFJA 2FJEB 2WBMA 4URQU 2V8HA 4RW8B 4RNNA 2XSJB 5T7LA 2CQ4A 2QA2A 2VBWA 1D1UA 2VQEF 1JK9B 4F26A 3CCTA 2BJEA 4K59A 2XCPA 1S76D 4NWBA 2ZKTA 3T6JA 2NXUA 4NA1A 3M6VA 4KKOA 2J9DA 4ZVGA 4OZLA 2GIRA 1BWEA 2M70A 5L1KA 1SKSA 3QMQA 4B9MA 1VQOS 1YJRA 4UQTA 2VD3A 4WK3A 1N54B 4RW8A 3DM2B 4A8QA 2VZ9A 2XSJA 2CQ0A 4ZP6A 2J0QD 2UVUA 4WKRA 3P5TL 2DGWA 1OQ3A 4I2QB 2JC0A 1KQKA 5GAGI 2ZNYA 4C3KA 1RT4B 2LXUA 1YRTA 4Q7AA 2VKZG 1FEHA 1N34F 2EBEA 2XMWA 4KO0B 1NK4A 4DSLA 4EFAC 3LAMA 3RB6A 5DQHA 4XO0A 5A8KB 3DM2A 3MMBB 1KC8T 2DGTA 5HBMB 1VIOA 2EFNA 2VG7B 2FHKA 3BREA 3HM9A 3DRRB 3BN7A 4I0WA 4CZCA 1RT4A 4YFUA 3UW1A 2JL9A 1M5PC 2ZOMA 1DFDA 4BHQA 2MSTA 3EZ5A 1WG5A 2C3OA 4KIAA 2B7CB 3DLBA 5M2UA