5DS7A

2.0 a structure of cpii, a nitrogen regulatory pii-like protein from thiomonas intermedia k12, bound amp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
91
Chain Sequence
IKLYPLKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKGSHGMYEALIMIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVGRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.0 A Structure of CPII, a nitrogen regulatory PII-like protein from Thiomonas intermedia K12, bound AMP
rcsb
source organism Thiomonas intermedia (strain k12)
molecule tags Metal binding protein
molecule keywords Nitrogen regulatory protein P-II
total genus 17
structure length 91
sequence length 100
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ds7A00
5L9NA 4RLEA 2O66A 2O67A 4OZNA 4CO3A 3AH6A 4D3GA 4OZLA 3BZQA 2XULA 2NS1B 2XBPA 4YB5A 1O5JA 4YB7A 2J9DA 3O8WA 2ZOMA 4Y65A 1UL3A 1V9OA 3TA2A 1VHFA 1GNKA 1O51A 1QY7A 3NCPA 3L7PA 2CZ4A 4WK1A 3AA8A 4NYPA 5D4LA 4OZJA 4RX6A 3HLUA 4RWWA 1UFLA 4CO0A 2NUHA 4C3LA 1Q1KA 4RWXA 5D4NA 3TA0A 5DS7A 3N5BA 4C3MA 2ZFHA 3AA9A 2DCLA 5D4OA 4AFFA 1NH7A 1H3DA 2PIIA 3MHYA 4D3HA 4USHA 4CO2A 4USJC 2GW8A 1V3SA 2GX8A 4IYQA 2XZWA 1PILA 1VFJA 5D4PA 2E66A 1P1LA 3T9ZA 3TA1A 2JJ4D 3AHPA 4CO5A 2J9EA 3DFEA 4CO4A 3X3UA 3NCQA 3OPKA 5DRKA 3M05A 3LF0A 4ZK7M 3GSDA 2EG2A 1XK8A 1OSCA 4CNZA 4WK3A 4USIA 2J9DE 1KR4A 2Z0GA 4E98A 4CNYA 2VD3A 1NH8A 2V5HG 1J2VA 1UKUA 2RD5C 3CE8A 1UMJA 4R25A 2EG1A 4C3KA 4NYOA 4YB6A 2XG8A 1V6HA 1NAQA 3O5TB 4CO1A 3NCRA 2J9CA 2NUUG 1HWUA 1NZAA 2GNKA 1V3RA 4Y6IA
chains in the Genus database with same CATH superfamily
3RZAA 2W9CA 2GQQA 4WP3A 2EFQA 5H9FJ 2DNGA 4F04B 2WTFA 1K0VA 2VG7B 2C2OB 5IS2A 3RB3A 2G4BA 1FWPA 4U8YA 2HS4A 3BSAA 2W4DA 1FDBA 1TL3A 4ZKAA 1RT3A 3MM9A 3CCRS 2LQ5A 3GR0A 2YWKA 4Q5VA 2OH2A 1APSA 3AD9C 2ZH2A 2FD2A 1DQ9A 2JLFA 3ZZYA 1S1VB 2LQ9A 1N6QA 4H4KC 3WX4A 3E01B 1Z1ZA 4QYRA 4O4GA 3RBEA 1OO0B 3EWGA 3FCWA 3ILIA 1KFDA 1F2GA 3TVKA 1WF2A 2BKOA 1F5CA 2BJDA 4G1QB 3MEGA 3GFZA 4NL5A 5BYQA 3NS5A 3TA2A 5SZTA 2HVIA 4ZVSB 5I3PA 1BD6A 5BR8J 3RRHA 1CULB 1YJ7A 4NLVA 2XI3A 3UVJB 3QZ8A 1XNQF 4K7QA 1YX2A 1ZM9A 4K4YA 2YKOA 1N5SA 2VBZA 1Q8BA 2AJ0A 2V34A 4NASA 5BJRA 5HMWA 4QWAA 2BRLA 3OR1A 2HHHF 1WHVA 4K5RA 2WW8A 3EMTA 3GQCA 2VIHA 3NBPA 1UFLA 3AOAA 2OSQA 4K2XA 1VQSA 1VQYA 1FKAF 3SYZA 4B3TF 1HFEL 2GAGC 2PN6A 4TVAB 4AE5A 1W2BR 3GFYA 3NNAA 3PW7A 1I6JA 2BJ8A 5K9FA 3TW0A 1RU1A 5DGAA 2VOPA 3F73A 2IBKA 3T9NA 2VA3A 3HSJA 1R8AA 1HNZJ 3I55S 8RUCA 2QEXS 4IG0B 1FRJA 3MPUB 1C0TA 2K7JA 2FHJD 1XMOF 2B9YA 2UUCF 1FTCA 5ETRA 4IG3A 4G1PA 4U9RA 3T6BA 3D0HE 2QFJA 1HBOB 2DH7A 4KYZA 3PKMA 1KWMA 3GJTB 1YJ9S 2R7XA 2L9WA 4HACB 2B6AA 1VBXA 1X4DA 2RRBA 3HD1A 4ZVOB 2H5EA 5HLFB 4TU8A 2AQ4A 1RKJA 1SJ4P 1U47A 3W9HA 3DRSA 3GYNA 4I7FB 3BKTA 3DLHA 1VFJA 2HIQA 3EPGA 5HVFA 2KXHA 3BN4A 4TN2A 2HBQB 2EFNA 4NYZA 4OJHA 3BO2A 2I2YA 3MPVA 1MMLA 2DH9A 2CG8A 4ES1A 4PQUA 2ZC4A 1QAIA 2AKWB 2RRNA 2B8PA 2E7XA 1U02A 2XLJA 2XZDB 2E5IA 1LK7A 5HBMB 3DLJA 1WDTA 4ENOA 2R3VA 4F3MA 5JJBA 4LQ3A 1KHVA 3QWPA 2GA7A 2XSFA 5A8RB 5KFSA 4DUTA 1QD1A 2KDOA 3H5YA 4H4MA 2PT0A 3Q8PB 1RACB 2ZH7A 3KNAA 1TAUA 1HNIA 2WZ1A 2ZKTA 3CJRA 1IKWA 1S4FA 2XY7A 4B3RJ 2BV3A 1S1UA 2DGSA 5IFMA 4YB1P 1I3OB 3MR6A 2BJ7A 1RT4B 3GYXB 1O0PA 3THPA 4B3OB 1N5VA 1RTHA 3MAAA 4DDFA 1TUVA 4TY8A 4EEYA 1DAXA 3H5SA 5ITHA 4UZCA 3ZNUA 4B17A 2H4YB 2LFVA 4PEOA 2IC3B 3ADAC 3R7NB 2BJEA 3QYYA 3BB5A 3BYRA 3DGPB 4LF5F 2F1FA 2QLFB 4LT6A 4PYDA 2OEKA 3A3PB 1CSJA 3T5JA 2V4JA 2DNKA 3MR7A 4IDKA 4V1Ak 2FZCB 3FBCA 3FRYA 3R2DJ 1N32F 1RI7A 1Q8IA 3HVTA 4IFYB 1F9EB 3FMBA 3W2VA 5IV3A 3KK1B 2VV5A 3HHLB 3Q8YA 1HQUA 1HPZA 5CH7B 3VVUA 1NU4A 2R7TA 1UEVA 1OQ3A 3DOMB 5C25A 4ZP8A 1N0UA 1UP1A 2ZJQQ 1PC4A 4Y2AA 3NGKA 2C2RA 1VS3A 3A8IA 3MM6A 3Q24A 3BH7B 2F8HA 2JEGA 2D1CA 4MK8A 1ZM3A 3CJKA 3KLGA 1QTMA 1HD1A 4ZVTB 2V8DA 4DUYF 2OPPB 2KI2A 4BLGA 2DXEA 4RW8A 2XZTB 3PACA 2RAQA 5F8MA 1AXQA 7FDRA 1S6UA 2I8EA 3GE9A 2DNPA 3SSQA 2W9CB 1M5KC 2BOPA 3BR9A 3CDUA 2MQPA 1N34J 3BDPA 2PE8A 1JLQB 1SBRA 1LKZA 3L7PA 3H20A 3K59A 4LSNB 2H9ZA 2W1BA 3QZ7A 5CCLA 2VG6B 4M5DA 5AXMA 1KEKA 3MM8A 1HBMA 3VV2B 3ZNJ1 4ZITA 2FLPA 2PI4A 3OW2R 1YJUA 4USVA 3UQSA 1N56A 1SUQB 3R8YA 1Q1KA 3B78A 1U1MA 3LP2A 3NLCA 4GKKF 2FLNA 4P7VA 4PXBA 4DS5A 2VC0A 3S8SA 3MGJA 2W4CA 3ZTPA 1UEUA 2WCXA 2AZ1A 3N79A 4LQ9A 1ZA2B 3N0VA 4C3MA 4DX5A 1CJTB 1OY9A 2C1EB 2JNJA 2HAFA 2H4WB 4DV0F 3N28A 4I0WA 1FKPA 1SQGA 1PBUA 2C2ZB 4JBCA 2CPIA 3CTRA 3NKYA 2CPXA 4FKYA 4NPOA 2VKRA 4F0KA 5KG7A 5HMYA 4W92B 3KK3A 3CCES 4JP8A 2EW9A 3HDSA 4ICLA 5D0EA 4X4TA 2VG6A 3MTJA 2OMLA 3NGTA 2JLEA 3WBZA 1OJ4A 4LBPA 2Z58B 4MIWA 5JUMA 3K0JA 2AJFE 3EJMA 3MR3A 1HQ2A 1ZA1B 3I9V9 2RB7A 1MN9A 4YS2A 4ZLLA 4DV2F 4NLUA 2MDAA 4RPFA 3ISND 4IR1A 3GIIA 3TEGA 3QWUA 1WC6A 3BV8A 2ZHAA 3TA1A 1NUEA 4OYIA 1S1UB 2CQPA 3W1YC 1R8HA 1RAGB 3QJPA 4NWBA 2WVBA 3X3UA 3ZFVA 2V4RA 2NZCA 3PW0A 1RU2A 3IGNA 5E0OA 1GMWA 3TP2A 4R5PB 3RW7A 5GMKa 2KG1A 1Q86T 1TV6B 3I5BA 4WZQA 4DSIA 1LV5A 3MM6B 2W2QP 1IKVB 2FDNA 4HI1A 3U1MA 5ETNA 3QLHA 3GILA 4WE1B 1GTHA 3GSDA 3M7VA 2K2PA 1D8ZA 3I0SB 2KVIA 2M4MA 3TWZA 2XNRA 1RE1B 4B3OA 1PJ6A 4KE5A 3GV8B 2XO7A 5FD1A 2AJQA 1KQKA 1JLBB 1KVKA 3TUIC 3V5RA 1LNQA 1X7VA 1NO8A 1SV5B 2J8AA 2HAIA 1QAYA 2FHJA 3C16B 4ES3A 4ZHRB 5KFMA 1ZM2A 2N4CA 3HSDA 4XO0A 2G2OA 2UUBJ 4USTA 5J2PB 1SC3B 2UVRA 2MZQA 5GMDA 2ZBRA 1TELA 3HVWA 3D1HA 2ZM6F 4DF4A 2B7CB 4NLSA 2W4PA 3CPWR 4RUHA 4QWEA 2J0WA 2LCWA 1S1TA 3QIPA 5B0AA 5H9EJ 3NNHA 2CNKB 2PMZD 1U7LA 4OYWA 1WKLA 2V69A 2WK4A 2XMWA 1S6PA 3CD7A 3M8QA 7FD1A 3ILJA 4LF4J 2VDHA 3PX4A 5IWAJ 3H0PA 2CNNB 2D3ZA 4RLEA 5CYMA 4DL7A 3QJJA 1VIXA 1DQ8A 1GX6A 3L9ZA 1B0TA 3MCSA 4Q7AA 2RIJA 3D3BJ 3G87A 8AT1B 2LEBA 4EWTA 1N5QA 2MSTA 2DEJA 4FBTA 1FXLA 4D3GA 2A6MA 2Y1RI 4OZLA 2J5AA 2VFUA 2BQUA 4RW9A 1XMQJ 2BA9A 2XYGB 3G4SS 1NJXA 5GMEA 2XHCA 5J1EA 1RHJB 1XBWA 4Q0BA 3FC9A 4DU8A 3TUZC 3VWSA 2B0GA 3M30B 4WU3A 2BX6A 3OQ2A 4O3QA 4IOBA 3OR1B 3LANA 4J9QA 2YH0A 2DBBA 3RTVA 1HQEA 2M52A 1CC8A 1A6LA 4ECVA 1TKDA 4LF9J 5J2PA 1VLOA 1HHSA 3UPFA 5HK4A 3UNGC 2LQ8A 1OWXA 4M8LA 3GJQB 3ZTSA 2Z30B 3IFEA 2XMAA 1YKWA 2MZSA 3PJ9A 3QAUA 1K73T 2U2FA 2CZ4A 4K59A 2CAJA 4OLOA 5CZVA 1H7WA 2XNQA 3CGIA 4CLTA 3KHHA 1LWEA 2RDJA 2AYMA 2HVEA 2QMUB 2OEJA 3AT1B 1RCXB 1R0BG 3QT6A 3V4IA 1VQLS 1BHNA 2CVEA 1ACMB 4FS1A 1UVMA 3KLHA 3R3TA 1TV6A 2B3TB 1RTZA 3GCWP 3PVXA 4FYDA 1FXDA 5KFBA 3HD2A 2XC9A 4KPCA 4L74A 3HHEA 4I64A 3OSNA 3VAHA 4DL3A 5GAHI 3N5BA 3QGHA 2OELA 2MEWA 2RHQB 1U6ZA 4OMFG 1NPRA 3BGRA 3IR5B 4E8UA 4DV5F 1KVJA 1U6FA 2I9SA 2XCAA 1JKHA 4OX7A 2AGQA 1SJFA 5DM6Q 5KG2A 4KHPF 4DF8A 4ZPAA 5A6PA 1ICEB 1CQNA 2Z57B 4LR8A 2ASYA 1S72S 3KLVA 2JEFA 1GK8A 4J9NA 3D3CJ 1M1KT 1YRUA 2AEMA 5K8PA 1N36J 3H5XA 1FX4A 3MEEA 2YBVA 2QMXA 3PFEA 4E0DA 1UFKA 3B4DA 2E5GA 1QE1A 1UWBB 3MM5A 1WC1A 3FBEA 1NMEB 5CD4A 3IWXA 2VPZB 1SC4B 1G7CB 2JRSA 3K2YA 2ZWOA 4QIEA 3LAKA 1CC7A 2AF6A 3BGLA 4G1QA 2QYCA 4ID5B 5KG4A 1YJNS 2HFUA 4LF2A 5LSOA 3CT9A 4RO0A 4ZP6A 2VICA 3MPYA 2HZAA 3LUYA 1LXJA 4DN0A 1D3WA 3OVSA 3K57A 3AAWB 3SSSA 2CADA 2BMBA 2KU7A 2W2NP 4Y3CA 1JLAB 2VQFF 3FBBA 3DMJB 2WHOA 2CWXA 2E7VA 2PEHA 1QUVA 4PZVA 1H38A 1NK9A 5A8WA 1HWJA 4OQJA 3W8PA 5IC6B 4OI3A 3CJSA 3JSMB 4ED3A 2MKHA 4JI2F 1FJEB 4X4OA 2G0IA 1D8YA 2CPZA 5L9XA 4KKOB 3WIVA 1TR0A 3MAQA 1ITPA 1O8BA 1C2PA 2IVYA 2FVQA 1XK8A 1QVGR 1ZTTA 2E9TA 2VG7A 4OHWA 2W7OA 4K4XA 4LSNA 2KVQE 3MUMP 1RT1B 4AUKA 1CJVA 3MURP 2ZNZA 1H7XA 3RAXA 1HR0F 4PG6A 5AXLA 1GMWD 2G13A 3CWJA 3UCGA 4LJMA 5LMNJ 1LWFA 4EFAC 4Q43A 3Q0AA 4YUDA 1U1KA 2LQJA 3IBFB 4OX8A 2HQ3A 4NE9C 4WBFA 3KJVB 1PAEX 1BMQB 1TK5A 1XEZA 2NZ4A 3OTCA 2YNGA 4PWWA 4ECTA 3CJKB 3Q2SC 3KLGB 3K5MA 2R8KA 1UPPA 2BANA 5EX0A 2YNHA 2J7WA 2VFVA 3W62A 1SB6A 1MLAA 2DIUA 3KLFB 1R6VA 1U26A 4LBIA 4PCQA 2DHAA 2DD8S 2HHSA 4N5SA 2E5JA 2MKYA 3NG8A 1DTTB 1RWUA 1RT7B 1VYAA 3M6XA 4NLDA 3TQEA 1VJWA 3BN7A 4QYZK 4BBYA 3GIKA 4ZVHA 4O3SA 2V4JB 2XULA 2FHKA 3DDNA 2XYPB 3OTDA 2GVZA 1RWXB 1U2CA 4KFBA 5IT9U 2AW0A 1N4LA 5DQHA 2PO4A 4N77A 1URRA 2RT3A 4YFUA 5K8OA 5L39A 3DGPA 1IJEB 1VK8A 2DY9A 3IS9B 4NLRA 2CJYB 1TKXB 2DYAA 3ICLA 4DV7F 2BDPA 2X3DA 3GJRB 4X64F 3OUYA 5AJ3F 1TKTB 2VPYB 4X4PA 4O3NA 3KLIB 1P6TA 4DSLA 2YNIB 4MKAA 5I4MA 4NOHA 4ZP7A 5A76A 2HMIA 4UUWA 3QGIA 1SJ3P 4LF6J 3D1OA 3NL0A 3UN2A 3ZTOA 1PJ7A 4ZPWR 1KQGB 2Z56B 1IKWB 3CEDA 5D4LA 2GIRA 1NK0A 1X5OA 1WOOA 2YKMA 2HNYB 2XLKA 2C2MB 2HSEB 2DR8A 4NLWA 4DV1J 4MMOA 1TL1B 2EFGA 1E6YB 2RDDA 4NZ0A 4RBTA 3RJMB 3TO8A 3C19A 2DR9A 1NK8A 4DL0C 3PRBA 4MKVA 1FESA 4CWBA 1KRPA 1S7IA 2ZFHA 3HZEA 3M8RA 3LA0A 1UVIA 1KDNA 4RNNA 1NH7A 2ZBCA 3V81B 3T5HA 4N76A 4LFAJ 3QRPA 5E3AA 2DCUB 2GHVC 3A1YG 3DM2B 3HFVA 3VZIA 4N7TA 4D3HA 3D2WA 4AL6A 4JI7F 4CO2A 2IDLA 4CLUA 1P8GA 1KSPA 1XMOJ 1VQ5S 3TX8A 2YNFA 1LWEB 4G1IA 4EYHB 2K06A 2V8HA 2R9LA 2ILYA 4V19X 1FE4A 4DS4A 3A3OB 4JI6J 4UOGA 4JV5F 4ZP9A 2F9JA 2H48B 4IFVA 3HKZD 4LRBA 3Q8QB 4ELVA 3W9JA 4W4MA 1WG5A 3C15B 4ECRA 3OJUA 5K5MA 1AYEA 1KP6A 2ROGA 2V8PA 3AY0A 3DRYA 4QIGA 1X9MA 2DPJA 1F9HA 4OYZA 3UN5A 2GIQA 4L75A 1H72C 1FNMA 3G82A 2AHOB 2ADCA 1U1PA 1EETB 2AGPA 4KY3A 4PYAA 3I5CA 4J9MA 2D3O1 1TVRA 2WW4A 4NEZA 3M30A 4OZ3A 5HP1B 1N52B 2WBRA 4TU7A 3OTOF 1XNQJ 4GKJF 3RB6A 5DLFA 1OQ6A 3DGVA 3EZUA 5LSLA 4DQSA 4ZK7M 1SKRA 1KFSA 1W26A 2SXLA 4ILRA 2DNRA 5HANA 5F0UA 1XN9A 4KB7A 1J5EJ 2UUBF 2BE2A 1FE0A 4IRKA 1PG5B 1FXRA 3GU0A 4L6V3 4X62F 3I31A 3LP1B 3W66A 4DHVA 1IUJA 3FUYA 3N4WA 2QA4G 3CJTA 2L41A 1KR4A 1YRXA 4UTGA 2BE7D 2XMJA 2LYVA 4GO5X 1BGXT 1K1SA 2J0SD 2EBGA 2V5HG 3KJQB 4BC9A 4ZN3A 5F8LA 2MPUA 3SI8A 3UDCA 2HHTA 3QQCD 4WYWA 2XG8A 3EVOA 2W2OP 3UE2A 3J80U 3NAHA 2HHXA 2NREA 1RYRA 3IAS9 2ZUGA 2VASA 1F60B 1HMVB 3M2UA 1FERA 4YMEA 4X66F 4ILMA 1IVZA 4DV5J 3HSZA 2VHGA 4J9SA 5L9NA 1CJKB 4DWIA 4P52A 7AT1B 1VQ6S 1FDNA 2IBOA 4N56A 5B09A 3H5UA 4ZCLA 2JEIA 1JJHA 4DEZA 2PFFB 2OPRB 2HWIA 4KGKA 4A8OA 1EB0A 3IRXB 1N8RT 2G2ZA 2R7RA 4K4UA 4WFZA 2C3YA 4WTOB 3QJLA 3MF5A 1IR2A 1SL2A 5SUHA 3H90A 2FLOA 2OIHA 1U45A 3GCXP 3H7HB 3ILOA 2ZH6A 1YITS 4MAKA 1BWVA 2BW2A 1FEEA 3H4BA 5H1SV 1D09B 4ZPVR 3ZXWA 3TANA 3G6YA 1NKBA 4B9TA 2CPYA 2P8IA 1NLKL 1JWWA 2AWZA 6FD1A 3NGRA 2LXUA 1REVB 3BKUA 3NP5A 4KT0C 3SBMA 4GO7X 3U1NA 5HL7Q 2GAHC 4ELTA 2H1YA 1U0HA 3B8HA 1LWCA 3JQMA 1U48A 2B4PA 2QL7B 4DG1B 2DRAA 2W7PA 2IA6A 3KK3B 1M90T 2QL5B 5B0DA 2BRKA 1YBUA 3P5BP 2B4VA 4RNHA 2EI5A 3MEKA 4NX9A 4WFBQ 2UXCF 1AT1B 3W7BA 3AB2B 2NUHA 1Y0HA 4H4KA 4KH1B 5K14A 4C3LA 4ECQA 4WJBA 3LGHA 1UVLA 1YVFA 2ZVIA 2GGPA 4KO0B 5IM0B 2X1AA 2VOOA 2QA1A 3LP1A 1RZMA 2E1MC 4ZN1A 1SJRA 3AA9A 3DOMA 4LFBJ 2WVCA 2AGOA 4WZMA 2CJAA 1HPZB 1S99A 4O0IA 1Q82T 4GKKJ 2FVRA 5DQGA 1RWWB 4HI2A 4AD6A 1R0AB 4RZRA 2HGLA 2L48A 3E2EA 3VGSA 3K5OA 2DT9A 4NA1A 2VBWA 4L3KA 1HMVA 2O5DA 3M2UB 4USHA 4F4WA 2RKIA 2W25A 2C3MA 2QO3A 3DOLA 2EFVA 1LFPA 3IBCB 1FD8A 5ETLA 1YK9A 3AXMA 1F3FA 3MPDA 5DDPC 4CH0S 3CUNA 5LMUJ 4ECWA 1IBMJ 1FD2A 2IC3A 2WSFC 3F41A 5E3CA 3UD5A 2R8HA 4JI2J 2F8MA 3BBFA 3DHXA 1UVNA 1SKWA 4DR7J 3R6GB 4C8YA 1BC6A 5GADI 3BQ1A 3NMRA 2BJ1A 1B99A 2JJ4D 4O44A 4C0HA 5IOLA 4J9VA 4ZLJA 3TI0A 3KXDA 1G4CA 3M32B 5JXSA 3V6DB 3DCAA 3M8PA 4RUAA 3KTQA 4H4MB 2YWWA 3DI6B 4GC7A 1X60A 4ANCA 5L1IA 4P74A 3PM9A 1R8PA 2U1AA 3R5DA 2KT5A 2QA2A 2R8IA 1DQAA 4AQYF 2ALZA 3LALA 2M70A 3HFKA 4DL5A 1U49A 2QIFA 1TKZA 3TZZA 4DCJB 3CDBA 2CQGA 3HF5A 4CNZA 5KOXA 5KFWA 5M2PA 2R2RA 5KT3A 4YY3F 2HBRB 3RBXA 1SVDA 1UJ6A 4PUOB 4UF4A 1S1XB 3FBFA 4KIAA 2NSBA 5HN0A 2XS2A 1OYDA 1S0OA 2MQ8A 1FKOB 4MKBA 2BBEA 5ETTA 4ECYA 2RD5C 3JQJA 4FBUA 4ZLNA 5ETSA 4QQBA 4B3SJ 2BYCA 3OTEA 3SXLA 1YHQS 1URNA 2QJ3A 4I69A 4HT7A 3NS6A 1T03B 1L5UA 3FZBA 5K20B 5KOWA 2C22A 1JMTA 5HQMA 3UWTA 1XR6A 3VAMA 1PC5A 1YLXA 2RVJA 2V9WA 4NRUA 2V6AA 3OVAA 1RTDB 2RSQA 2VF3A 2M0GB 5IT9Y 1TKTA 3UCUP 2E9RX 1R3NA 1C0TB 1FWLA 1N33F 5D3GA 4CLZA 5LMNF 1TKXA 3D6TB 5ETPA 1HNIB 2Q6CA 4Z7CA 2HPUA 5C42A 4WPAA 4DR2J 4X4NA 3NGDA 2NXUA 4CP5A 4OZ5A 1VQPS 3CD0A 1VQNS 2CQHA 4OZ2A 1C0UA 1S6QB 4UOFA 1X0FA 3ET6A 1NB2A 1EARA 4NZ7A 1IN0A 4C0BA 1QUPA 2VU5A 4JI0F 2W9BB 3K58A 2CRLA 3QT8A 3THTA 4NLXA 3SCJE 2V2VA 2MMYA 4BWMA 2AMCB 2KB2A 1D9DA 2ROPA 1IXKA 3DRPB 4USMA 2AU0A 5B0EA 1CULA 2QG9B 1RWKB 4X65F 3N01A 4NA3A 1KOOA 4YHHF 4NI2A 2AX1A 1SV5A 2CQBA 4F4ZA 1U09A 4A47A 5KFLA 4DJBA 2MKIA 3OUYB 1DJ0A 3B6BA 1RT2A 1RT6B 4P10A 2IAJB 2GO9A 2KRBA 3AB4B 3IS9A 2DPIA 3H8YA 2KRRA 4FXWA 1C1CB 3MMAB 1YRTA 1TP7A 3IXQA 2ZDPA 3K5PA 1LWFB 4ECUA 2YQ3A 1IR0A 5HI7A 1KQFB 3TAQA 2OAUA 2X7IA 3CJ3A 2QSFA 2FJXA 4IG3B 3DLKA 3JTOA 5D4NA 3V6DA 2XMMA 4IG0A 1YSJA 2JHEA 2JVRA 4YEAA 3MFHA 1D0EA 2V8VA 2DHXA 4PXEA 3OSPA 3SZ2A 4B9VA 2A2CA 4J9UE 3WHIA 1RTIA 2HBYB 1R8CA 2B9XA 3O3LA 4FS2A 5H9EK 1Q95G 4RW6B 1NJWA 1M0SA 2XCPA 2XB2D 3G2XA 5IV4A 4CH7A 1KN6A 2RQCA 4Y34A 2N7CA 2KT2A 2XMKA 2WSEC 2XM3A 2C28A 2RU9A 4X2BA 2K3KA 2IDEA 2JWNA 2HQIA 2MQQA 2VJVA 3GZ7A 2M9KA 2YKPA 1SC6A 3VF0B 3L4BC 1AZSA 2RF2B 3BREA 5GAEI 5I42A 4DR7F 4P2XA 3M2VB 3VCDA 3VAJA 3M8SA 3G6VA 2HK2A 1EQMA 2GO8A 3PRDA 3D68A 3RR8A 1OY8A 3MEDA 1HA1A 4TNOA 4CDIA 4KPYA 1IBMF 4YP3A 1QAJA 3JAMY 3R5JB 2CQCA 2JVOA 1MWQA 5G4DA 2QC3A 3GB0A 3CO0P 3DC2A 1JK9B 2J9EA 4P6QA 3RU0A 2P9EA 1FHTA 4O4GB 2MQNA 2F63A 3LP2B 4OX9F 2YY3A 3HFZB 3EVMA 2VKZG 1NJYA 2XSJA 3ENAA 2HFVA 3LF0A 4NLYA 4RW6A 3E8OA 2BOAA 1TTHB 5FIIA 2MHEA 5KFNA 1RTIB 1F1BB 3JS9A 4CM2A 3ETMA 4DG1A 4ER8A 5DO2A 3C6UB 1JLQA 2EC2A 1NHVA 3QPIA 3W5XA 2ACMA 2X1GA 2Z0GA 4HLBA 4E98A 3RUBL 1QAXA 3VGTA 4C11B 3C66A 1RAEB 1VJQA 2RILA 5L8RC 4OHZA 3ZZZA 4U7UD 4C3KA 4DLEA 4YB6A 1T0TV 3MM5B 4LVOP 3FEYB 3C46A 3G9CA 1S9GA 1B0PA 2NLWA 3GV5B 1RTJB 3DLEA 3AXKA 1HHQA 4ILLA 2MLYA 4FPIA 3KWMA 1PCAA 4K4ZA 3MUTP 4DSJA 3Q8VA 3IM9A 3MD1A 4FYXB 3KK2B 2UUTA 2E5LF 4LSLB 4NCGB 3UD4P 1UA0A 4B3MJ 3QO9B 4KTQA 1WKKA 5KG5A 4ED2A 1X4HA 5IC4B 3ZZPA 4JI6F 5AXNA 2L9NA 2CA9A 1SH3A 5KFCA 4UQTA 4PG5A 1XNRJ 1Y00A 3FEXB 2HFNA 3P6YC 4ZVQB 3I82A 2M2BA 2K1RB 2RE1A 3OXLA 3TAMB 5LT5A 2OLWA 5DZ6A 3O8WA 1S1WA 5CXTA 3CF5Q 2RNEA 2HYIB 1UL3A 3O6QA 2IM3A 3T41A 2Y0BB 1U1OA 4J91A 2B4UA 1UFWA 2WOMA 4X65J 3VGVA 4GC6A 1FRLA 4E2FB 1NDKA 3R5CA 4FDFA 3AA8A 3SFGA 3S1TA 4C8OA 1PSDA 1RWMB 3OFGA 4FXVA 4FYYB 3ITHB 4Y28C 3ZZ0A 5GAGI 1WOSA 1OSDA 2MJUA 3BEGB 2R2UA 3OTBA 4FYWB 1KVIA 2R8JA 2MHNA 4KHMA 4X64J 3H2UB 1EAYC 2E5HA 4RWWA 1JLCA 1RA7A 2CPEA 4OJ1A 5D78A 1GQEA 3VQSA 3SCKE 2JC1A 2CNOB 2DNLA 4CO0A 2ZC3A 4F2SA 5LOQA 3OR2A 4IH5A 1JQGA 2C3PA 3W63A 2J6SA 3J7ZT 1VRTA 2V67A 2W01A 1MU2A 5E5NA 1TK0A 2KFYA 1GXUA 4MIBA 4NLTA 2BM0A 4EBCA 5D4OA 4ED6A 3CMAS 1Q8LA 2YKNA 4G65A 5KT5A 1FFSB 3VAGA 4DFMA 1Y5NB 4J7CA 4DUZF 1AFIA 4P9SA 3V6KA 2I1RA 4PR6A 1KOHA 3IMQJ 4QZVB 3Q86A 3UW1A 4A8XA 4QW9A 1IBKJ 3M8QB 2F40A 3D4JA 5C5JA 4P2FA 4HR2A 4RW4B 3VVTA 5C24B 5J2QB 1P9YA 1S1TB 3L7UA 2UXBF 1PIEA 3GIRA 3ISZA 3PFOA 1VCTA 2Q6BA 3C14A 4LF8F 1FJGF 2FC8A 4HHJA 1FFWB 3H40A 2RQMA 4CLLA 3TR5A 5LMUF 2K3IA 3JXOA 3SDEB 3BO4A 1P1LA 4NRTA 2KHDA 1IKXA 2HHPA 1C1BA 3GG0A 2OP5A 1HNVA 5E3PA 1VOMA 3CCSS 5IZHA 4DR5J 5J2MA 1EJ7L 2R7WA 2HWHA 1MU2B 1FRXA 2HLUA 3CJQA 5F0WA 3OPKA 3TAMA 4CO4A 5FDLB 1OS5A 6AT1B 4MT1A 4LMZA 3OR2B 2VBXA 1ZS6A 1T11A 3DOLB 4LREA 3K89A 3QLHB 1TL1A 2R42A 4LBHA 4MK7A 4UQGA 4Z37A 4DR3F 1VC5A 4EZ6A 2XMUA 3DLGA 3I4PA 3M05A 4F4YA 1S77D 2HNYA 3PYEA 4MK9A 1M5VC 2UV8A 5IQ6A 2PEBA 2EK1A 4BCAA 4F02A 1BQNA 2MSSA 2IVMA 3F0NA 1RWVB 2C2NA 3W8GA 1HW8A 3O44A 3ILLA 1XR7A 1FTRA 1Q7LB 2J9DE 3L09A 5GAEU 4Z2XA 2ADBA 3R27A 4F0HA 1IWAA 3ZTQA 4PWDB 4H4OB 4ECSA 2ZHBA 3KLIA 1SUQA 4IRDA 4CLYA 3M8ZA 1YZ6A 4A8WA 4TKTA 4C8ZA 5F8HA 1S9GB 2LEAA 4EZ9A 5D8HB 3Q2TC 1LWXA 1UJ5A 2DO4A 2VL1A 3MM8B 3TEHB 4DX8H 4AQYJ 1WTBA 3NGUA 4JI1J 2KZZA 2Z4PA 1OMSA 2Y8YA 5I42B 3MCMA 1RAOA 2Q3PA 4WFXA 3NCRA 1RBOB 2GCFA 3CMQA 5A0YA 2I38A 4GRSA 4RBUA 4QW8A 4ED1A 2QLJB 3T1YJ 2M8DB 4X62J 4Y00A 3OL9A 4OI1A 3C6UA 1FKPB 2FJVA 2MZRA 3ZZUA 2OEMA 4EBDA 1RHQB 4DL2A 4LF1A 1H98A 2C3OA 2RDIA 2V2ZA 3F56A 3QIDA 4RW8B 5E7OB 1DFDA 4CLWA 2X1FA 2OPPA 5D0GA 1V5VA 3WQPA 1K8AT 4A8QA 4F2RA 5A8KA 5KT6A 1NJIT 1S9EA 3DYAA 1NZ8A 2CFXA 4F67A 1HI1A 5KT4A 5ETQA 4YQWA 4OHYA 5KG1A 2G1DA 2UUAF 1JLGA 1H0HB 3FSXA 2DGTA 1IBCB 4PPZA 3SCIE 3UFCX 2CDQA 2K7KA 4K8RA 3CCWA 3HZGA 2NQPA 1WF0A 3OL6A 2ZOFA 1O51A 2QSWA 2RH3A 2YPZA 2KG0A 2AJ2A 1RUSA 2DNMA 2H3EB 2HNDB 2ILZA 3PRVA 5HROB 2JEJA 2YPYA 2XS5A 5A0YB 4NA2A 1LQ9A 4JB8B 4NYPA 4DL4A 2LQBA 3D66A 4I2QB 4RUBA 4FYVB 3ZZRA 3NOGA 3DOKA 4MTPA 9ATCB 3Q8SB 5DG7A 4ZPTR 4B9LA 1SC1B 2DNYA 4UW2A 5B0FA 3JB9k 1PAUB 1S79A 1RWNB 1VBYA 1CVJA 1QSLA 3R5GA 1FRMA 2GFFA 2UVUA 2OTLS 4Q45A 4HEA9 2PGCA 4L73A 5KFAA 1WEYA 2DHHA 3BF4A 5THWA 3V4MA 2DR5A 4AFFA 2ASDA 3R5BA 2L08A 2XGPA 4DR5F 1X5SA 4C0OC 4J90A 5T41A 1AA1B 2XO6A 1KD1T 1LFWA 3MDFA 4AXIA 2EBEA 4XPEA 2KYZA 4OX9J 3QRRA 4L3NA 2KFNA 2Y3YA 2HQGA 4M5HA 3CCQS 5I3UA 1NSKL 3CJ5A 4J9KA 4A48A 3Q23A 4WFAQ 2MLZA 4JV1A 4M95A 3I4HX 4RKUC 3VALA 2DXFA 1XMQF 1HNVB 4B3TJ 2WVDA 3TX0A 4QIWD 1QLNA 3G82B 2HHQA 1GFWB 3W64A 4U95A 1Q81T 2X3GA 1M1GA 3MAAB 3SFUA 3K8WA 1JKHB 2WB1D 4I7FA 3C15A 2G1HA 1C4AA 3DRPA 3VR1A 4C98A 5HQLA 2KM8B 1YG0A 3BGRB 3BO3A 1WSVA 2J7KA 2ZH4A 2VQEF 3MCNA 1KC8T 3BGUA 3POTB 2IJRA 2FVCA 4URGA 2ALYB 5C24A 3Q8UA 5J2QA 3IGVA 5DRKA 3JQKA 4KQZA 2WRMA 1Y3JA 4EU0A 2FVSA 3MECA 2B5JB 3DM2A 2POKA 2AYEA 2E44A 1QTNB 5A2QY 2Q79A 1C1CA 3MMAA 2NPFA 1S9FA 1DBDA 2EG2A 2ZHOA 4CQ1A 1RT6A 3R97A 4ECXA 3H2LA 1RAAB 4IRCA 1RWPB 1V5IB 3FFIB 4WIQA 1RTDA 1X5TA 3G6ES 2QYGA 5KFOA 4TXSA 3CULA 4UUXA 3CJ2A 1RA6A 1MG7A 1NSPA 2NSCA 5HMZA 1KS2A 3FCHA 3DRSB 1FCAA 2EG1A 1R27B 2QLBB 4EO6A 2BQRA 3J80Y 1V6HA 3I96A 4ZIWA 3HVAA 1AUSL 2L9DA 3VAKA 3KHGA 4HACA 4B3MF 2QLXA 2OHDA 3ET6B 1IM6A 5DZ7A 2MYFA 1FKOA 4C8NA 3RBZA 3G96A 2Y1LB 3M6VA 3BGOP 3SCLE 1V3RA 2LP4A 5J1EB 3Q89A 4C97A 4F8RA 5AE3A 1WI6A 2JLGA 3PW4A 1TMMA 2FJEB 2APOA 3MD3A 3HMJG 1S0MA 3PHEA 2F65A 5KFZA 4ALZA 4DV2J 3LO3A 4FVCA 5KT2A 2YH1A 4B9MA 2OKQA 4YR3A 4O3OA 1X31C 5B0CA 3LWLA 2DRDA 2B5JA 4O4RA 4YR0A 1S1VA 1UA1A 2KFZA 2XS7A 1RT5B 1LK5A 3KFWX 3DI6A 5HAOA 1FJGJ 3T1HF 2ZEJA 3B82A 1SKUB 2ZWPA 5F8IA 1NK5A 4KAIA 2MY8A 4LFCJ 4X4QA 2BUNA 3DOKB 2J0XA 1Y11A 3QO9A 2FJWA 4CLPA 1WC5A 2PMHA 2J9DA 1OIAA 1IBKF 1F5BA 2ZOMA 4LSLA 2KM8C 5HROA 3VQTA 1X4FA 5DDRC 3HULA 3I0RA 4LRAA 5ETVA 3KK2A 3FCVA 4OYMA 1IBLF 2R4FA 1HWLA 1Q79A 3LQVA 4PUOA 4C2MA 3RB4A 2Q43A 3RRKA 4FZVA 1TUGB 3M4XA 3MMBA 1TL5A 3M8WA 4JUZA 3PNIA 2ZKUA 4ZS6A 4DSEA 2V50A 2VG5B 1P1TA 1T7PA 1B7FA 3MOZA 2HFZA 3FSYA 3SV3A 2BW7A 1Q7YT 3IG1B 2W8LA 2CUYA 3M8PB 1CJVB 3IN5A 1UW4A 4OI6A 4IOAQ 3MMJA 5KT7A 2UUWA 5CHCB 4K4SA 5RUBA 1M1HA 1ZAVA 3HP6A 4RW7A 4ZCKA 4PWUA 5DJBA 3U27A 4FNHA 3CB4A 4C48A 5IM0A 2YX4A 1HBNA 1H3DA 3KG1A 4NMXA 2DITA 5EGYA 3KHLA 1L3UA 4X4UA 4CTAB 2WONA 1G3OA 3DRRB 3NXZA 1JXVA 4Y2MA 4EI2A 4ZLPA 1W2IA 4M5GA 4P2SA 3IC1A 3DMJA 4I6WA 3G86A 3T19A 1HW9A 4OI0A 4YR2A 4UZBA 4DR1J 2B51A 1VQ7S 2GX8A 2CQDA 3D5MA 2XZWA 2JFKA 3IP0A 2GMLA 1U0HB 2HK3A 3A8JA 3KJFB 3BJYA 2VJUA 4UY8T 2FIUA 2RS8A 3OD2A 3SQGA 2Z8QA 3IAM9 5C2GA 1JB0C 2FZGB 2GQCA 3KYLA 4EBEA 1CBKA 1WF1A 5B0BA 4DL6A 5K8NA 1FI4A 5B08A 1U6BA 2QMWA 2XWXA 3M2VA 4GVLA 5T7LA 3W3SA 2ZOGA 4JI8J 3DFEA 4KHPJ 2GJIA 3DKDA 2R7QA 1JLGB 3PEJA 3TOQA 3CDAA 5KFYA 3OHAA 3MEEB 1WC0A 3S6EA 2XMVA 1NKCA 4HDGA 1YWXA 2F5GA 4IH6A 2JDJA 4JI1F 5D0RA 4Y2KA 1UW9A 4EK2A 4CIOA 2VQEJ 2OSRA 3KKFA 3IRXA 1HYSB 5L1LA 4OHVA 5FDLA 3H59A 3WX8A 1WWHA 2DISA 3NOCA 1LXNA 4USIA 3FSIA 2VB6A 2GS8A 1XC9A 1SKSA 4K0KF 3EXCX 2HGMA 3DLKB 2ZUAA 3HX9A 2LECA 3VAIA 3I5AA 1G2EA 2PA3A 3OT9A 3DDIA 3GFXA 5KTQA 3KMSA 4GKJJ 2L3MA 1KHWA 4TYAA 2I6WA 4DMZA 3FQKA 2OGUA 4M5NA 2E1CA 1SJ1A 2IFXA 1WTFA 1KLMB 1NPPA 2AEFA 2IAJA 3OFHA 4DZ6A 2Y9HA 4B08A 3EGZA 3HJVA 4CO1A 3GSIA 3JSYA 1NDLA 4A8MP 4IUFA 1PKUA 3U7JA 4RU2A 4LFBF 1BWEA 2OFGX 4H4OA 4AT1B 4XIUA 3MCOA 4URSA 4P2MA 4RU9A 2HGNA 2V4QA 1MROA 4ZCMA 5E41A 1T95A 2OPRA 3WC0A 1NEEA 3M6WA 3HVRA 2O67A 4K4WA 1D9FA 3QMQA 1O6XA 4CZCA 3ZC4A 1RAIB 1JLFA 3GYGA 3V4IB 2V63A 2ROEA 3CIMA 3L3CA 3GP9A 3X1LB 1S6QA 2NYHA 1DURA 4G6VB 4U7CA 2GV1A 1JLCB 2YWHA 1WEXA 2NPIA 4C8LA 3VTIA 1VISA 1WACA 4LFAF 1T3OA 1U8SA 3OL8A 2VFTA 4Q8EA 3J7Z5 1NCLA 1HI0P 4U7UK 3N6MA 2UVWA 1UZHA 4Y65A 3EM1A 2RUSA 4USWA 3R9LA 4A8FA 1TFYA 2V2KA 2B56A 3QFWA 1NK4A 4NLOA 2HNZB 1S6OA 3L7OA 3A4TA 2CQ3A 1JX4A 4M5JA 4NEYA 2BE2B 4P71A 2EC0A 3HPOA 3ETOA 2IJNA 3BM7A 2KO1A 1BQMB 2HRUA 3OFEA 4RX6A 5A8RA 1F9FA 2DGQA 1CLFA 2M3DA 1M5OC 1AROP 3OVBA 2ASJA 3PO4A 5HBMA 1FRHA 4OJ3A 5DG9A 1S48A 4GVBB 4HVZA 2FYXA 4OZ0A 2HG4A 4RJVA 1HWKA 3FEZA 1ZZFA 1YJVA 2MZTA 3PYGA 5BR8F 1FO1A 3I6PA 3L95X 1TKZB 3DDKA 1VRTB 2J0QD 2C3UA 2IA0A 4PXCA 5IXUA 1UVJA 2GMJA 2VZ9A 3W65A 1VRUA 1F0XA 4OV1A 1REGX 4ZPDA 1NDPA 2E5LJ 3D54A 4TLQA 2Y8WA 2KT3A 2YXLA 3QT5A 4JI5F 1KBRA 1R0CB 2F4VF 5GVQA 3KJNB 5HJYA 4PG7A 2YKMB 1JLEB 4QJVA 5G0RB 4CLKA 1TU0B 3RAQA 1UZDA 2OFHX 2K8GA 5KFGA 1J27A 2V68A 4QBUA 1NKEA 3CCJS 2HNZA 4FP9A 1JJ2R 3PW5A 2HS3A 3NEKA 3DU6A 1R43A 1TL7A 4CI0B 5KFIA 2A18A 2E1PA 3M9OB 5DGBA 3V81A 1I51B 2RMLA 4JV5J 3C2PA 2KYXA 2DHSA 3SIPB 3R1HA 2HFSA 3HSGA 1VQ9S 2QX0A 4YOEA 4MIAA 1I94J 4OIXA 4XAKA 4PABA 1NXIA 1HYSA 2BE9B 5E3QA 2DB1A 5F8GA 3OFFA 2XSJB 5FLXY 4IH7A 4WYLA 1R0AA 2AP6A 5FJ4A 4DCPB 4ZPBA 2E7WA 1BXNA 1HR0J 2UXDF 1EZZB 4ZVFA 4ERDA 1RHMB 3IBWA 3TZYA 2D3OR 5D77A 2YKAA 2DNZA 2ZE2A 4LIRA 4W90B 2DEIA 1HIYA 1N54B 2XLIA 2E29A 2MKCA 3CIZA 5F8NA 4MYUA 4TYBA 4DR4J 2BM1A 2HEKA 2FHMA 2HBZB 4DI6A 2FPHX 4KGVB 2MQOA 1HNXF 1UMJA 1RAJA 2LU2A 3EUNA 3D0GE 3BQ2A 1FFGB 3FRZA 3P45B 5DDOC 2D74B 2RF2A 1PGZA 5JVGQ 2CQ1A 3BPDA 4M5DB 2J76E 4DBQA 1AFJA 3E01A 4DOZA 3HHNB 3T6JA 5C7PA 1IM4A 2DO0A 2HNDA 2NXNA 2NCKL 4F3OA 4ZVPB 5HATA 4HH0A 1T9YA 3PYDA 4QU7A 2IHR1 4F4XA 3D6MB 3H4DA 2VC1A 3W2WB 4CYUA 4WIIA 1H6KX 4CYUB 5AE1A 1VQ4S 4DV6J 3KUGA 1ZAWA 1WELA 1R89A 2V0NA 1SXLA 1CS4A 2CQ2A 1X9SA 3NWGA 4NLGA 3PDNA 3JSMA 1S0VA 3NWRA 1FEHA 3C8YA 2YNHB 2GVDA 2PSZA 5IQQA 1XMBA 2HKEA 1FRIA 1Y7PA 2A3JA 2D41A 4TY9A 3TJAA 1LW0A 4X66J 4O23A 3GIJA 3KOAA 5GADU 2CG4A 2CYYA 3T1YF 4M5MA 1RT2B 3H98A 1PJ5A 5GAGU 3M9MB 2UUAJ 1K9MT 3CCLS 1VGYA 3GPAA 2G0JA 1MN7A 4IFYA 2CIMA 4Q44A 3BSOA 5I3QA 1VBZA 4LF5J 3RW6A 3T5KA 2YVSA 1CEZA 3AD7C 1U24A 4QR2A 1N48A 3TZXA 3FNNA 3C3LA 1QE1B 1UWBA 5L38A 2WAQD 4A8YA 2DRBA 4DQPA 1XNRF 3RB0A 3HM9A 3TNVA 2RU3A 1LEOA 5F8JA 2W9BA 4KGZB 3OL7A 3QGGA 2GZOA 2NXJA 4FXDA 1RT5A 2EPIA 1W7WA 5A8WB 3NMAA 1M5HA 3R7BB 4ED4A 2DK2A 2YWGA 1RT4A 1Y4ZB 2AIRB 4RWXA 3BDEA 2EXUA 5F3ZA 1T3NA 2F7VA 1S5ZA 3OTOJ 3A12A 3OBIA 1NHKL 4ZJOA 4YHHJ 2IMWP 1RBLA 2AEJA 2B9WA 3OXGA 4K4TA 3K17A 2VA2A 5F9NA 3AQOA 2VONA 2ZZMA 2CPFA 1FVQA 5AXKA 3GIMA 1S97A 1X4EA 2UU9F 3A8EA 1MWZA 1S57A 1T8EA 4ANDA 1DHMA 1Q5YA 2KH9A 4JOUA 2Q1LA 1WOPA 4NXNF 2LLZA 2FTRA 1KONA 4USJC 1XTZA 2JL9A 2OJ3A 5HP1A 2XI2A 1JXLA 1Y9OA 2MTLA 4JI4J 4NCAA 3GFHA 2CQIA 2J6TA 4PQUB 3N9UC 5F41A 1SH2A 1HLWA 2B4OA 3CMES 3ENVA 4FPRA 4ELUA 4F50A 2BACA 1F5AA 2DGVA 4OI4A 4ZVRB 5HVGA 2Z2MA 2QA4S 2D9PA 3MM7A 4I56A 4LVNP 2FB0A 1U1NA 3ISNC 3UR0A 1B7YB 1EHWA 2COLA 2YQ0A 3FK4A 4CO5A 3H25A 1Q53A 3V6HA 1RHRB 4JI0J 2VDIA 2QV6A 3AOBA 3PG9A 2ZM6J 1S0NA 2IYIA 1UVKA 3AQPA 3PIPQ 3EX7B 3TARA 2CJKA 3C6TA 3KLHB 1HBOA 5D15A 1HNZF 1SPBP 1QVFR 3PO5A 4B3SF 2ZITA 1WJ9A 3UDLA 1QDUB 2CJQA 2DNOA 2OD6A 1JIHA 3M32A 3PYFA 5ETMA 5M2RA 3POTA 2MQLA 4NZ6A 1N5TA 1RISA 4WTYA 5KFPA 4B9SA 4RBVA 3VAFA 1N0VC 2D3UA 1RBAA 3MPWA 2VBYA 1QSYA 2LU1A 1YI2S 5FLXU 5KFEA 1WC4A 4DR1F 2Z2ZA 1J5OB 4IKAA 2DNHA 2P9GA 4B3RF 1NH8A 1KQSR 1UKUA 3NGSA 2HVZA 2A1BA 2B9EA 1U2RA 2F3JA 4F4KA 1B3TA 5KAKA 3J81j 3O5TB 3MMCA 2YWFA 1FX2A 2ZNYA 4ZJLA 4JI3J 3ENQA 4BDPA 4HHHA 5EX3A 3MFIA 3P3DA 1M5PC 4PG4A 2HMIB 1ZBTA 1S1XA 1OY6A 3GLJA 4RL1A 4RW9B 4LRFA 3T3FA 4KSEB 2D9OA 3PY8A 4ZMMA 1HNWJ 4Y2CA 5KFXA 3DHWC 3PCOB 4DR4F 3T1AA 1RHKB 4CO3A 4B9UA 1LOUA 3P49B 2XY5A 4QCLA 3HT0A 2HVDA 4Q2MA 4DPOA 1Z2ZA 4DV4F 3CD5A 4RNFA 2UV8G 4DFPA 1D1UA 3A8KA 4O3PA 1A9NB 4DV3F 3D67A 5HJXA 4XTTA 2RHSB 2PMWA 4M5KA 4ZJQA 1KLMA 4YB5A 1T05A 1H73A 2I5JB 3PX6A 3HK2A 5CYQA 4M1KA 4M5LA 2B8QA 1CJUA 2MKJA 4LSZB 2WBMA 3HHLC 3MM7B 3U02A 3PKYA 2HHUA 3EE3A 1IQZA 4ITSA 4LFCF 3BPSP 4XPCA 2EFPA 2MY7A 2IJFA 2A10A 3CJ8A 2GIFA 2DGUA 1ZH5A 4DR6J 2G0CA 1N5YA 4ZOSA 9RUBA 4HYKA 3I0SA 4OZJA 5ETOA 3M6UA 1ZM4A 1LW0B 3UN3A 2R2TA 2FUG9 4NCBA 3CC4S 1IKVA 4I68A 4ATNA 3EYZA 2IM1A 4C11A 2HZCA 2JH3A 2MZJA 1Q4RA 3K8VA 4OJGA 4RR5A 2FZKB 4DX6A 3CNQP 3BH6B 4P75A 2VFSA 2P2CB 5DS7A 3TA0A 5KFQA 3J81Y 1HARA 4JI5J 1RXOB 4BC7A 1SL0A 2ZDOA 1ULRA 5T7LB 4P7TA 4LF6F 2A6OA 2BVZA 2VFRA 4M94A 4DPWA 4KKOA 3CW2C 2KKHA 2MZ1A 4LF7F 1Q0NA 3B54A 1WHWA 5E2QA 4J5OA 4OYPA 1MSWD 4JI8F 1T9TA 2BKNA 2CJBA 1DLOB 4WWSA 3WZ0A 2KHCA 3DLLQ 5MAOA 2CXEA 5LXYA 4IQMA 3GONA 1RP5A 1IWGA 2CQ4A 2YX7A 3D0IE 3EVWA 2HLTA 2RJZA 4U96A 4DN9A 2XY6A 5J1NA 3QSIA 4DQIA 3O2IA 4IYQA 1LWCB 3US5A 4TLRA 2LDYA 1B0VA 1WSRA 4KH0B 4XDCA 1HNXJ 1WORA 2CQ0A 1FJ7A 2LXIA 3MR5A 3MOJB 2HW3A 2WONB 2LMIA 1WDDA 2VUGA 4EO8A 1WUUA 1X4GA 2V94A 2ZD1B 2KXNB 1SJQA 2ZE2B 2LXFA 3HHDA 1RAFB 3LW5C 1BQNB 3BYPA 1KNZA 1B70B 1X4AA 1IJFB 4JV2A 2GVDB 4LF7J 3IG1A 1FA0A 1RHUB 2IRXA 3DYAB 1S9EB 1MMNA 1WC3A 2JFDA 3G8SA 3CVKA 1EP4A 2RQKA 1HBMB 2ZH3A 2YKQA 5C25B 3W2WA 1OSCA 1WKJA 1I1GA 1HQUB 2OI2A 3D6HB 5LSRA 4C8MA 5BYSA 3W2VB 3KK1A 2QT7A 4B9NA 4ZA1A 5CZXA 1RJJA 4ED7A 2FJBB 1FRKA 1TL7B 2DH8A 3I0RB 5E3RA 3EGWB 4CNYA 3BS9A 3FZ2A 3IWLA 2N82B 3IA0A 5LJ3Y 1EX8A 1LW2A 3AODA 2GC8A 3CE8A 3WIUA 2MB0B 4IOCQ 4PRFA 4ZVGA 2HRTA 3FKBA 4HTIA 2VPXB 4QPTA 1RDRA 5KFFA 2CJXB 5L1JA 2R7UA 2JOQA 3PJXA 1RWOB 4F7VA 1HWUA 2GNKA 3TUJC 4NLPA 4P73A 2XMTA 3E3XA 1RTHB 5J1PA 1H2TZ 5T14A 2W7AA 4G3IA 3NAIA 3GMGA 3KNGA 4DQRA 2MXYA 1T94A 1L3SA 4MKYA 1A7GE 2HQDA 2IM2A 1P9QC 3AH6A 4PKDB 4X4RA 4DV3J 2ZVSA 3HHLA 2UXDJ 1R8BA 2EKYA 2W2PP 1RABB 1FVSA 2JX2A 4K5SA 5CQGA 2I0XA 3B4MA 3HVTB 4F26A 2BJ9A 1YBAA 3JYTA 4KJIA 2KTQA 4WF9Q 1HL6A 1U4BA 4ZDNA 2H51B 2NS1B 4LIWA 2HFOA 4LF4F 1I94F 2XBPA 1BQMA 2DNQA 3A3NB 3IR6B 3MMCB 3CCTA 4ED8A 4QR0A 5D3GB 1EETA 2UZAA 1IKXB 1VQMS 1HNWF 5L1KA 1RK8A 3CDWA 2XWYA 5CYMB 1V9OA 2IIHA 3AJ2A 4I6AA 1GAOA 4TY8B 3THVA 4TQSA 2KJVA 1ZPVA 5HSPA 2DGXA 4JI3F 1QY7A 4I1TA 3D6FB 3NCPA 2IPOB 3AD8C 2P6SA 4DR2F 1UJ4A 4DCOB 1UPMB 4UOCA 4USUA 4DV1F 4ZCIA 2ZBQA 1MMDA 3CO9A 4CT8A 3PV8A 4AL5A 4C9DA 3AOCA 1K47A 2A2DA 2K1RA 1ZYQA 1S76D 1S12A 3ZZTA 2GVZB 3TZWA 4V19J 4UT4A 3VZHA 2DGOA 4C6AA 1XIQA 1Y5IB 2RS2A 2HS0A 4I4BA 2CWKA 2HHWA 4MH8A 3QFHA 2XTJP 3KMQA 4GVBA 3EICA 4ED5A 1EP4B 1X5PA 4TU9A 4CLSA 3MHYA 1TAQA 3KLFA 3WDOA 2DTJA 4LF9F 5C2CA 2EK6A 4DPTA 4FF1A 2J7UA 2BANB 2OO4A 2A0FB 2RRAA 2KXFA 4R5PA 1QM9A 5KFHA 4DV0J 3PZPA 3U1LA 4S0MA 1FNOA 3CSKA 4FNIA 3M1VB 2CKWA 1M5SA 4HT5A 1LW2B 4F25A 3H42A 1F6TA 5D4PA 4NXMF 5KG3A 3UD3P 1GH8A 1P27B 5KFUA 1MNEA 3QAEA 2EFOA 4MJKA 3T9ZA 1RT1A 1S1WB 2PA8D 2LA6A 4CT9A 3OJSA 3HI9A 2X51A 1VC0A 3CJ0A 1NJZA 2NXCA 2PDAA 4ICLB 2JSXA 1UWAA 1WD6A 2B43A 1R31A 4R8UA 3UI3A 4EGLA 1N6QB 2VODA 1VI7A 1KKHA 1NRKA 2XQCA 4OL8A 4OYAA 1T9WA 4WU2A 2GMHA 2FY8A 2YWEA 3RAMA 4QR1A 4IQXA 4A8SA 3IR7B 1S4EA 4WXOA 2VQFJ 1U1QA 1CJTA 4I2QA 2ASLA 1VDHA 4OLPA 2FY1A 2ZH8A 2Q66A 5CCMA 2YQ1A 3HO1A 1TZ0A 1YJTA 2X1BA 4N8OA 1BE4A 5A2QU 2ZD1A 3RGIA 2CJ9A 4DU7A 3BQ0A 1V3ZA 2NXEA 1FNXH 2MKSA 3G8TA 2OMOA 3V6JA 3BBCA 1U1RA 4HL9A 1IKYA 4PAAA 5AJ3J 1VQOS 2ZH5A 1T9XA 2AT1B 4NYOA 3SEOA 3FJ2A 5KFTA 3JSBA 1NBEB 3TYTA 4YDDB 5DETA 1RQ0A 4OHXA 2QZ8A 3NS7B 1JXEA 1UTAA 4JI7J 4I6YA 1N36F 2EWHA 4X4SA 2FLLA 1GXLA 2DNNA 2GJFA 3F44A 2W24A 2IYGA 5A8KB 4CTAA 1Q78A 2R7SA 2LDIA 5EN1A 2HHVA 4WP9A 3EZ5A 1X4CA 2QTWA 2OUGA 1NK7A 5CYQB 4FKXA 5E33A 2WB4A 5EWFA 2NYIA 4DLGA 4HH1A 3LOUA 2O1PA 1YBTA 1VLYA 1S7HA 2ATLA 4C4WA 4ZVEA 3CC7S 4KC5A 3KG0A 2B7BB 2KJWA 1QSSA 1RLCL 3G71S 4X4VA 3J7AN 1JLAA 2V8GA 1PO6A 2N4DA 3LP0A 3QRQA 4AL7A 1EIYB 4YB7A 3Q8RB 4X84A 2G9OA 2DVIA 1UETA 3HHKA 3MMBB 2RQ4A 5KFRA 1N5YB 3A13A 1L3KA 3GJSB 3HKWA 1VMBA 3JTNA 1TK8A 1GNKA 1A0OB 1SIWB 1VHFA 3MEDB 3SQGB 3N6LA 3TRGA 3ZO7A 4DPXA 4PWDA 2BEFA 3H2VE 5DG8A 4DV7J 3ENWA 3MR2A 1CJUB 2JC0A 4WK1A 1AZSB 1JJ4A 2I5JA 4LUBA 1T05B 1CQMA 2DGWA 3FQLA 2P6TA 2JZ5A 3GR1A 2R7OA 3R5AA 1AUDA 1H2VZ 3BGFA 1VQ8S 2BJ3A 3M9NB 2GQ2A 3FMWA 3BR8A 1NB7A 4KV8A 4ES2A 4F3QA 2Y0SD 4F0MA 4CRJA 3KG4A 2M5YA 4LF8J 2WVFA 2BR0A 5C42B 2Z2LA 5J2MB 1U8WA 1SI9A 2DJWA 3P4UB 4PXDA 4AXJA 4C7QA 5EDWA 4DR6F 1E6VA 3J7A1 3KLEB 1F2HA 2PIIA 1PYTA 3RRGA 4DXLA 1C4CA 1L3VA 2OPSB 4U67Q 1FDAA 3C6TB 3FDSA 4USKA 4YN3B 4R0EA 3HXMA 2Y1JA 2F8EX 3ELHA 3M1VA 5KG0A 1GMUA 1V3SA 2PD1A 2EEYA 3IWNC 1FK9B 3QNWB 3LGMA 3OXFA 4DFJA 1TVRB 2O3DA 1GEHA 5EUHA 5LM7E 3UDVA 2Y1IA 1DZ5A 4QYZJ 4RW4A 2WSCC 4KBIA 1PILA 3EZOA 4AYBD 3OLBA 1TQLA 2OPQA 2OPQB 4ZVUB 3TVYA 1VBKA 1J5OA 2DY1A 1D9AA 1HBUB 5D0HA 3FFIA 1RADB 1HQEB 1TL4A 4IFVB 1OYEA 4F4AA 4WKRA 2AYGA 3D1QA 2J6UA 4MYTA 4WKYA 1T9UA 3DN9A 3NCQA 1NK6A 3OLAA 1BQXA 4QWCA 2MLXA 3LWMA 2IRUA 3MUVP 5LXRA 4JYAF 4ETZA 5LJ5Y 3AJ1A 1VHIA 1AB8A 1S49A 2XHWA 4L72B 4UOHA 4QWDA 5B7WA 2KZMA 1L3TA 3DLBA 2GHWA 4WCEQ 2BXJA 2VH7A 4MFBA 4WK3A 1DY3A 2DKOB 3MWBA 3HCXA 2FVPA 1GMVA 1OPZA 1WI8A 4OYOA 4PQAA 5DM7Q 2W2MP 1UEKA 1NHUA 3Q83A 3G8QA 2VD3A 3JSRA 4OI2A 3CXCR 1RYSA 3JTPA 3BKFA 1FWKA 3PR4A 2ZJPQ 3NBPB 3K7RA 2HURA 2HWTA 3QIPB 2R7VA 1XR5A 1FDDA 4HKQA 1NSAA 3W9IA 2NUUG 3RYLA 3T5LA 2HRYA 2OTJS 1Q8KA 2AJ4A 2V2QA 1YJRA 2CPDA 2UU9J 3JYTB 3TAPA 3S7RA 4O0NA 2O66A 3SSRA 1H74A 1WG4A 2AZ3A 3UR3C 3KDNA 1CG2A 4DPUA 3HHLD 4O3RA 1HWIA 5D6GA 2CPJA 3SMZA 5KG6A 5F9LA 3CCVS 4NCGA 3PEHA 2N7YA 2F4FA 4WE1A 2N3LA 3J81U 3BZQA 2QLWA 1XWLA 3I87A 3J7YI 1DTQB 2GJ2A 1XJWB 1RCOB 2FGOA 3DXBA 5GAHU 2FQQB 2H65B 3FVYA 1S59A 1AW0A 5MLCV 1U2FA 1K44A 1U0SA 5JVHQ 3GTYX 1RT7A 3TJ8A 1DTTA 2OD4A 4FVMA 2P5VA 3ZZOA 4OZ1A 3EDQB 1GT8A 2LA4A 3PHTA 4I67A 3QT7A 5EHHA 2AJ1A 5IT0A 2AYBA 4R0JA 1ROFA 4J9PA 4HTJA 2DIVA 3PTWA 4F36A 3DRXA 5J2NB 2ZZTA 4XDDA 3KDOA 3EPIA 2BQ3A 2UUCJ 4HDHA 2MGZA 3MAHA 4A8KA 2C42A 1CPZA 1SQEA 3DU5A 2GHPA 5KFVA 1N88A 3IM8A 2YTCA 3T1HJ 3NNCA 2IMOA 3GWCA 2RKIB 4DUYJ 1YIJS 1EQ0A 5I3UB 2QFIA 3GG1A 4J37A 3QATA 1NSQA 3KHRA 1X9WA 4WXWA 1S10A 2R8GA 2R2SA 2RUGA 4J9OA 1G6BA 1ZPWX 2C2KB 4LR9A 1WHYA 5F3TA 3W5ZA 5EWGA 4N47A 1WNEA 1RKIA 1HI8A 4QIFA 1IBLJ 2HHHJ 4KRWA 1CS4B 4OFZA 5AE2A 3AJDA 3QSYB 2MQMA 1Q5VA 2P9CA 5AT1B 1BUXA 1WEZA 2EKNA 3D7SB 1N34F 2E9ZA 1R7IA 3I32A 2ZJRQ 1XERA 1RSCA 4IO1A 1FF2A 4IO9Q 1U1LA 2F4VJ 4K50A 1BY9A 5HO4A 4M5IA 1CJKA 1JNZB 2CVIA 2PFDA 3QGPA 3M8YA 4PPDA 2E1RA 4RNOA 2FHOB 5A6WA 2M88A 4QOTA 2FJDB 5ETKA 3PJWA 3ZTRA 2F9DA 3LTOA 2VPWB 3I56S 1UAWA 1X0PA 2LVWA 3ULHA 4OV6A 4R8UB 3UNYA 3SV4A 4DFKA 1SL1A 2PI5A 4P72A 4PG8A 5CA5A 2IRYA 4DV4J 4BS2A 5EWEA 1DARA 3BSNA 3PW2A 1SQFA 4FF4A 1B4SA 3CD6S 5M2UA 1DLOA 5DQIA 2D7SA 2MJNA 1TUWA 4BHQA 3DRRA 3N5FA 2FC9A 3DXSX 5CABA 1K1QA 2ATCB 1RAHB 1HBNB 3LGNA 4LRCA 4ECZA 1VQKS 1HD0A 4I2PA 4RW7B 2IY5B 3AHPA 4UY85 2H54B 2H5IB 1VIOA 2DHGA 4XK8C 4FF2A 1JLEA 2M8HA 5G0RA 2BKPA 4ETXA 5CAAA 2FJAB 1DRZA 2ZZNA 2HZVA 3OV7A 4Y2IA 3DLGB 2W9AA 2CZ9A 2BZ2A 3R6LB 5KFKA 2J8SA 2VG5A 2AX0A 5LL6d 3ONQA 3V2UC 5HQ8A 4FF3A 1TFWA 4DSFA 4WFNQ 1GX5A 2QRRA 4KHRA 5IT4A 3R2CJ 1ZAXA 2DR6A 2V9KA 3LPYA 3RR7A 3RG6A 4N41A 2ZH1A 2D69A 2KN4A 4NI2B 1NPKA 5K8MA 2MGZB 1F3VA 3MZIA 4IDKB 4BWJA 2N3OA 3HT3A 5J2NA 2KL8A 3O1LA 3TUPA 1J2VA 2ABYA 2ZBPA 4K4VA 4R25A 3C14B 1Y3KA 1ZOTA 1WG1A 2Z2YB 3CJ4A 4WP8A 1JNRB 5HVHA 2ERRA 4Y0FA 3M2RB 3P5TL 2NR0A 5DLGA 2B6AB 3DNCA 3UDEA 4A4JA 2YNFB 1JJCB 3JAMU 3I9ZA 1ZZNA 2AD9A 3R7SB 1GXTA 1YQHA 3NY0A 1C0UB 3GV7B 4W98A 1TMJA 4ED0A 1DTQA 1FJCA 3BSCA 4N8NA 1VRUB 4DUZJ 2QE5A 4RUCA 4MFBB 4EYIB 1Q16B 4OZNA 2UXCJ 3EDRB 2C2DA 1OPIA 4NXMJ 1Z2LA 3MTKA 1NM2A 4JV0A 3G6XA 2UP1A 4IR9A 4Q0BB 3S01A 1FT8A 2IM0A 1YTYA 1E6YA 1X8DA 2HIYA 3MI7X 1RGVA 1N33J 4URQU 5H9FK 2M7SA 4LRDA 1T03A 4YY3J 2UVVA 1PYOB 4FN5A 1JLFB 4EUVA 2XYHB 1O5JA 3W60A 4ZIVA 1IQTA 3FGVA 5BXIA 1Z4UA 5JMNA 1KTQA 1C1BB 4TQRA 1YGYA 3W61A 2QN6B 4U8VA 2ACYA 1ZETA 3TQ1A 4GMKA 2WOMB 3SDEA 1SCJB 1HKAA 1PBAA 2YNIA 4QWBA 3TVZA 4OX6A 1XQIA 4QU6A 1G1XA 1S6PB 3MEGB 2HVHA 2CZVC 5KFJA 4K2JA 4Q2LA 3CDEA 3CCUS 5HLFA 4K0KJ 1IR1A 1MWYA 4KGMA 2EVZA 3P96A 3M2RA 1FK9A 1PYSB 5L46A 4KGXB 2W8KA 2ZH9A 4CCHA 3W5YA 3OHBA 2UXBJ 4CLFA 3HLUA 1W25A 1T02A 2OPSA 3MECB 4DZDA 1U25A 1YZ7A 1SIZA 2CDRB 4OYXA 3KUHA 3KLEA 2ZBIA 2AV5A 3C16A 2CPHA 4L76A 4QIVA 4YDXA 1VK3A 2YKNB 4ZHRA 3IRWP 1ZTWA 4LR7A 3MXHP 1JLBA 3D9BA 1YJWS 2QL9B 1I5OB 4EMDA 2DCLA 4O44B 3LPEA 3QBCA 1HBUA 2BABA 4J9LA 3CCZA 3WC2A 4KV8B 1MROB 1NDCA 5CD4H 1N32J 4CM0A 5KFDA 2DXDA 2H5JB 1ELOA 3K5LA 3IO1A 5ADZA 3DLEB 3K5NA 3SQOP 2GW8A 4OYBA 2HQFA 1NNDA 3ITHA 1VC6A 4RNMA 3KJVA 2LKZA 1BLUA 8ATCB 4I2PB 2XGQA 3PR5B 1X4BA 2E1AA 3UVJA 5DDQC 3RBDA 4DV6F 2WVEA 1Y5LB 3EGVA 4WFYA 1K0TA 2E66A 4M63A 4JI4F 4HHUA 4DPYA 1J5EF 4DSKA 1E6VB 1Y10A 1VR6A 1QJHA 4ZPCA 4A46A 4U6PA 3PX0A 2C2EA 4JYAJ 4ANEA 4NXNJ 3EGNA 1SH0A 3UO0A 3J7YU 3NRBA 4J9RA 3AFGA 3KUEA 2LEPA 1B64A 2GGPB 2HQCA 4KO0A 2DR7A 4KFBB 5CYJA 1WHXA 5B0GA 5K14B 1T9VA 4ID8A 2MKKA 1MW7A 2IVFB 1KLNA 5HMXA 1RT3B 3MM9B 1TL3B 3LAMA 3VHQA 4B02A 3BBBA 4QPXA 1KTVA 2QGFB 3PXGa 3CCMS 3UCZP 2O01C 1EKRA 4DQQA 6FDRA 4H54A 3PIOQ 3N6NA 2PC6A 1HHTP 3EXYA 4NMLA 4ID5A 5U47A 4KR0B 1YDLA 2G2YA 3D28A 1GTEA 1RTJA 1REVA 2CNLB 4DR3J 1VRQC 4NLQA 2YNGB 5BYRA 4CH1A 3E51A 1RLDA 2FGCA 2XEXA 1UCNA 3TJ9A 1NAQA 4C8KA 5IWAF 3LP0B 3VGUA 3HJFA 1EKSA 2YX1A 4DX7A 3CC2S 2J9CA 3R1LA 1H2UX 3Q22A 1IKYB 1NZAA 1R6YA 3LH2S 4Z7YA 1RB0A 4Q8FA 4Y6IA 3P8BB
chains in the Genus database with same CATH topology
3RZAA 2W9CA 2GQQA 2EFQA 5H9FJ 2DNGA 2WTFA 1K0VA 2VG7B 3RB3A 5IS2A 2G4BA 2HS4A 3BSAA 2W4DA 1FDBA 1TL3A 4ZKAA 1RT3A 3MM9A 3CCRS 2LQ5A 3GR0A 2YWKA 4Q5VA 2OH2A 1APSA 2ZH2A 2FD2A 1DQ9A 2JLFA 3ZZYA 1S1VB 2LQ9A 1N6QA 4H4KC 3WX4A 3E01B 1Z1ZA 4QYRA 4O4GA 3RBEA 1OO0B 1KFDA 3TVKA 1WF2A 2BJDA 1F5CA 4G1QB 3MEGA 3GFZA 4NL5A 5BYQA 3NS5A 3TA2A 5SZTA 2HVIA 5I3PA 1BD6A 4NLVA 2XI3A 1XNQF 3QZ8A 1ZM9A 4K4YA 2YKOA 1N5SA 2VBZA 1Q8BA 2AJ0A 5BJRA 5HMWA 4QWAA 3CC7S 3H5XA 2BRLA 3OR1A 2HHHF 1WHVA 4K5RA 2WW8A 3NBPA 1UFLA 2OSQA 4K2XA 1VQSA 1VQYA 1FKAF 3SYZA 4B3TF 1HFEL 4AE5A 2PN6A 1W2BR 3GFYA 3NNAA 3PW7A 1I6JA 5K9FA 3TW0A 5DGAA 2VOPA 3F73A 2IBKA 3T9NA 2VA3A 1R8AA 3I55S 2QEXS 4IG0B 1FRJA 1C0TA 2K7JA 2FHJD 1XMOF 2B9YA 2UUCF 1FTCA 4IG3A 4G1PA 4U9RA 3T6BA 3D0HE 2QFJA 1HBOB 2DH7A 3PKMA 1YJ9S 2R7XA 2L9WA 2B6AA 1VBXA 1X4DA 2RRBA 2H5EA 5HLFB 4TU8A 2AQ4A 1RKJA 1SJ4P 3DRSA 3GYNA 4I7FB 3DLHA 1VFJA 2HIQA 3EPGA 2KXHA 3BN4A 4TN2A 2EFNA 4NYZA 4OJHA 3BO2A 2I2YA 3MPVA 1MMLA 2DH9A 4ES1A 4PQUA 2ZC4A 1QAIA 2RRNA 2E7XA 2XLJA 2E5IA 1LK7A 5HBMB 3DLJA 4F3MA 5JJBA 4LQ3A 1KHVA 3QWPA 2GA7A 2XSFA 5A8RB 5KFSA 3H5YA 2KDOA 2ZH7A 4H4MA 2PT0A 3Q8PB 3KNAA 1TAUA 1HNIA 2ZKTA 1IKWA 1S4FA 2XY7A 2BV3A 1S1UA 2DGSA 5IFMA 4YB1P 3MR6A 1RT4B 3GYXB 1O0PA 3THPA 4B3OB 1N5VA 1RTHA 4DDFA 1TUVA 4TY8A 4EEYA 1DAXA 3H5SA 5ITHA 4B17A 2IC3B 2BJEA 3QYYA 3BB5A 4LF5F 2F1FA 4LT6A 3T5JA 1CSJA 2V4JA 2DNKA 4IDKA 3FRYA 1RI7A 1Q8IA 3HVTA 4IFYB 3W2VA 3FMBA 3KK1B 2VV5A 3HHLB 1HQUA 1HPZA 5CH7B 1NU4A 2R7TA 1UEVA 1OQ3A 5C25A 4ZP8A 1N0UA 1UP1A 2ZJQQ 1PC4A 4Y2AA 3NGKA 2C2RA 1VS3A 3MM6A 3Q24A 2F8HA 2JEGA 2D1CA 4MK8A 1ZM3A 3CJKA 3KLGA 1QTMA 4DUYF 2V8DA 2OPPB 2KI2A 4RW8A 3PACA 5F8MA 1AXQA 7FDRA 1S6UA 2I8EA 3GE9A 2DNPA 3SSQA 2W9CB 1M5KC 2BOPA 3BR9A 3CDUA 2MQPA 3BDPA 2PE8A 1JLQB 1SBRA 1LKZA 3L7PA 3H20A 3K59A 4LSNB 2H9ZA 3QZ7A 5CCLA 2VG6B 4M5DA 5AXMA 1KEKA 3MM8A 1HBMA 2FLPA 2PI4A 3OW2R 1YJUA 3UQSA 1N56A 1SUQB 1Q1KA 3B78A 1U1MA 3LP2A 3NLCA 4GKKF 2FLNA 4P7VA 4PXBA 4DS5A 2VC0A 3S8SA 3MGJA 2W4CA 4C3MA 1UEUA 2WCXA 3N79A 4LQ9A 3N0VA 4DV0F 3N28A 4I0WA 1FKPA 4JBCA 2CPIA 3CTRA 3NKYA 2CPXA 4NPOA 2VKRA 5KG7A 5HMYA 4W92B 3KK3A 3CCES 2EW9A 3HDSA 4ICLA 4X4TA 2VG6A 3MTJA 2OMLA 2JLEA 3WBZA 5JUMA 4MIWA 3K0JA 2AJFE 3MR3A 3I9V9 2RB7A 4DV2F 4NLUA 2MDAA 4IR1A 3ISND 3GIIA 3QWUA 2ZHAA 3TA1A 1S1UB 2CQPA 3QJPA 1R8HA 4NWBA 2V4RA 3X3UA 3ZFVA 1N32F 3PW0A 3IGNA 5E0OA 3TP2A 4R5PB 5GMKa 3RW7A 1Q86T 2KG1A 1TV6B 3I5BA 4WZQA 4DSIA 1LV5A 3MM6B 3U1MA 1IKVB 2FDNA 4HI1A 3GILA 3QLHA 4WE1B 1GTHA 3GSDA 3G9CA 2K2PA 1D8ZA 3I0SB 2KVIA 2M4MA 2XNRA 4KE5A 3GV8B 2XO7A 5FD1A 2AJQA 1KQKA 1JLBB 3TUIC 3V5RA 1X7VA 1NO8A 1SV5B 2HAIA 2J8AA 1QAYA 2FHJA 4ES3A 4ZHRB 5KFMA 1ZM2A 2N4CA 4XO0A 5J2PB 2UVRA 2MZQA 3HVWA 3D1HA 2ZM6F 4DF4A 2B7CB 4NLSA 2W4PA 3CPWR 4RUHA 4QWEA 2J0WA 2LCWA 1S1TA 3QIPA 5B0AA 3NNHA 2PMZD 1U7LA 2WK4A 2XMWA 1S6PA 3CD7A 3M8QA 7FD1A 3PX4A 2D3ZA 4RLEA 4DL7A 5CYMA 3QJJA 1VIXA 1DQ8A 1GX6A 3MCSA 1B0TA 4Q7AA 2RIJA 2LEBA 4EWTA 1N5QA 2MSTA 4FBTA 1FXLA 4D3GA 2Y1RI 4OZLA 2J5AA 2VFUA 2BQUA 4RW9A 2BA9A 3G4SS 1NJXA 5J1EA 1XBWA 4Q0BA 3TUZC 3VWSA 2B0GA 3M30B 4WU3A 4O3QA 3OQ2A 4IOBA 3OR1B 3LANA 4J9QA 2YH0A 2DBBA 3RTVA 1HQEA 2M52A 1CC8A 1A6LA 4ECVA 1TKDA 5J2PA 1HHSA 3UPFA 3UNGC 1OWXA 4M8LA 3IFEA 1K73T 2MZSA 3QAUA 2U2FA 2CZ4A 4K59A 4OLOA 5CZVA 1H7WA 2XNQA 3CGIA 3KHHA 1LWEA 2RDJA 2AYMA 3V4IA 1VQLS 2CVEA 4FS1A 1UVMA 3KLHA 3R3TA 1TV6A 2B3TB 3PVXA 4FYDA 1FXDA 5KFBA 2XC9A 3VAHA 3HHEA 4I64A 3OSNA 4DL3A 5GAHI 3N5BA 3QGHA 1U6ZA 4OMFG 3IR5B 3BGRA 4E8UA 4DV5F 1KVJA 1U6FA 2I9SA 2XCAA 1JKHA 4OX7A 2AGQA 1SJFA 5DM6Q 5KG2A 4KHPF 4DF8A 4ZPAA 5A6PA 1CQNA 2ASYA 1S72S 3KLVA 2JEFA 4J9NA 1M1KT 1YRUA 5K8PA 3MEEA 2QMXA 3PFEA 4E0DA 3B4DA 2E5GA 1QE1A 1UWBB 3MM5A 3IWXA 2VPZB 1G7CB 2JRSA 3K2YA 4QIEA 3LAKA 3BGLA 1CC7A 2AF6A 4G1QA 2QYCA 4ID5B 5KG4A 1YJNS 5LSOA 3CT9A 4ZP6A 3MPYA 4DN0A 3LUYA 1LXJA 3K57A 1D3WA 3OVSA 3AAWB 3SSSA 2KU7A 4Y3CA 1JLAB 2VQFF 3DMJB 2WHOA 1H38A 2PEHA 1QUVA 1NK9A 5A8WA 1HWJA 4OQJA 3JSMB 4OI3A 4ED3A 2MKHA 4JI2F 1FJEB 4X4OA 1D8YA 2CPZA 5L9XA 4KKOB 1TR0A 3MAQA 1O8BA 1C2PA 2IVYA 2FVQA 1XK8A 1QVGR 1ZTTA 2E9TA 2VG7A 4OHWA 2W7OA 4K4XA 4LSNA 3MUMP 1RT1B 4AUKA 3MURP 2ZNZA 1H7XA 3RAXA 1HR0F 4PG6A 5AXLA 2G13A 3CWJA 3UCGA 4LJMA 1LWFA 4EFAC 4Q43A 3Q0AA 4YUDA 1U1KA 2LQJA 1TK5A 4OX8A 2HQ3A 3KJVB 2NZ4A 1XEZA 3OTCA 2YNGA 4ECTA 3CJKB 3Q2SC 3KLGB 3K5MA 2R8KA 2BANA 5EX0A 2YNHA 2J7WA 2VFVA 1SB6A 2DIUA 3KLFB 1U26A 4PCQA 2DHAA 2DD8S 2HHSA 4N5SA 2E5JA 3NG8A 1DTTB 1RWUA 1RT7B 3M6XA 4NLDA 1VJWA 3BN7A 4BBYA 3GIKA 4ZVHA 4O3SA 2V4JB 2XULA 2FHKA 3DDNA 3OTDA 4KFBA 2AW0A 1N4LA 5DQHA 2PO4A 4N77A 1URRA 2RT3A 4YFUA 5K8OA 5L39A 3DGPA 1IJEB 1VK8A 3IS9B 4NLRA 4DV7F 5H9EJ 1TKXB 3ICLA 2BDPA 2UU9F 4LF7F 4X64F 3OUYA 5AJ3F 1TKTB 2VPYB 4X4PA 4O3NA 3KLIB 1P6TA 4DSLA 2YNIB 4MKAA 5I4MA 4NOHA 4ZP7A 2HMIA 4UUWA 3QGIA 1SJ3P 3NL0A 3D1OA 4ZPWR 1KQGB 1IKWB 3CEDA 5D4LA 2GIRA 1NK0A 1X5OA 2YKMA 2HNYB 2XLKA 2DR8A 4NLWA 4MMOA 1TL1B 2EFGA 1E6YB 4NZ0A 4RBTA 3TO8A 2DR9A 1NK8A 4DL0C 3PRBA 1KRPA 1FESA 1UVIA 3HZEA 2ZFHA 3M8RA 4RNNA 1NH7A 2ZBCA 3V81B 3T5HA 4N76A 5E3AA 2DCUB 2GHVC 3A1YG 3DM2B 3VZIA 3D2WA 4AL6A 4D3HA 4JI7F 4CO2A 1P8GA 1KSPA 1VQ5S 3TX8A 2YNFA 1LWEB 4G1IA 4EYHB 2V8HA 4V19X 2R9LA 2ILYA 1FE4A 4DS4A 4JV5F 4ZP9A 2F9JA 4IFVA 3Q8QB 3HKZD 4ELVA 1WG5A 4ECRA 3OJUA 5K5MA 2ROGA 3AY0A 4QIGA 3DRYA 1X9MA 2DPJA 2GIQA 2ADCA 1FNMA 1U1PA 1EETB 2AGPA 3I5CA 4J9MA 1TVRA 3M30A 5HP1B 1N52B 2WBRA 4TU7A 3OTOF 4GKJF 3RB6A 5DLFA 1OQ6A 3EZUA 5LSLA 4DQSA 4ZK7M 1SKRA 1KFSA 2SXLA 4ILRA 2DNRA 5F0UA 1XN9A 4KB7A 2UUBF 2BE2A 1FE0A 4IRKA 1FXRA 4L6V3 4X62F 3I31A 3LP1B 4DHVA 1IUJA 3N4WA 2QA4G 2L41A 1KR4A 1YRXA 4GO5X 2XMJA 2LYVA 1BGXT 1K1SA 2J0SD 2EBGA 2V5HG 4BC9A 5F8LA 3SI8A 2MPUA 3UDCA 2HHTA 4WYWA 2XG8A 3UE2A 3NAHA 2HHXA 2NREA 1RYRA 3IAS9 2ZUGA 2VASA 1F60B 1HMVB 3M2UA 1FERA 4YMEA 4X66F 4ILMA 4J9SA 5L9NA 4DWIA 1VQ6S 1FDNA 2IBOA 4N56A 5B09A 3H5UA 4ZCLA 2JEIA 1JJHA 4DEZA 2PFFB 2OPRB 2HWIA 4KGKA 4A8OA 3IRXB 1N8RT 4K4UA 2R7RA 4WFZA 2C3YA 3QJLA 3MF5A 1SL2A 5SUHA 2FLOA 2OIHA 1U45A 1YITS 2ZH6A 4MAKA 2BW2A 1FEEA 3H4BA 5H1SV 4ZPVR 3TANA 1NKBA 4B9TA 3G6YA 1JWWA 2CPYA 2AWZA 6FD1A 2LXUA 1REVB 4KT0C 3NP5A 4GO7X 3U1NA 5HL7Q 4ELTA 3B8HA 1LWCA 1U48A 2B4PA 4DG1B 2DRAA 2W7PA 2IA6A 3KK3B 1M90T 5B0DA 2BRKA 2B4VA 2EI5A 3MEKA 4NX9A 4WFBQ 2UXCF 3W7BA 3AB2B 2NUHA 1Y0HA 4H4KA 5K14A 4C3LA 4ECQA 4WJBA 1UVLA 1YVFA 2GGPA 4KO0B 5IM0B 2X1AA 2VOOA 2QA1A 3LP1A 2E1MC 1SJRA 3AA9A 3DOMA 2AGOA 4WZMA 2CJAA 1HPZB 1S99A 4O0IA 1Q82T 2FVRA 5DQGA 4HI2A 1R0AB 4RZRA 2HGLA 2L48A 3E2EA 4A46A 3K5OA 2DT9A 4NA1A 2VBWA 4USHA 1HMVA 2O5DA 3M2UB 3TQ1A 4F4WA 2RKIA 2W25A 2C3MA 2QO3A 3DOLA 2EFVA 1LFPA 1FD8A 5DDPC 3CUNA 4CH0S 4ECWA 1FD2A 2IC3A 2WSFC 3F41A 5E3CA 2R8HA 2F8MA 3DHXA 1UVNA 1SKWA 4C8YA 1BC6A 5GADI 3BQ1A 3NMRA 2JJ4D 4O44A 4C0HA 3TI0A 3M32B 5JXSA 3V6DB 3DCAA 3M8PA 4RUAA 3KTQA 4H4MB 3DI6B 4GC7A 5L1IA 3PM9A 1R8PA 2U1AA 3R5DA 2KT5A 2QA2A 2R8IA 1DQAA 4AQYF 2ALZA 3LALA 2M70A 3HFKA 4DL5A 1U49A 2QIFA 1TKZA 3CDBA 2CQGA 3HF5A 4CNZA 5KOXA 5KFWA 5M2PA 2R2RA 5KT3A 4YY3F 4PUOB 1UJ6A 1S1XB 4KIAA 2NSBA 5HN0A 1S0OA 1FKOB 4MKBA 2BBEA 4ECYA 2RD5C 4FBUA 4QQBA 2BYCA 3OTEA 3SXLA 1YHQS 1URNA 4I69A 4HT7A 3NS6A 1T03B 1L5UA 3FZBA 5KOWA 2C22A 1JMTA 3UWTA 1XR6A 3VAMA 1PC5A 2RVJA 2V9WA 4NRUA 1RTDB 3OVAA 2RSQA 2M0GB 1TKTA 3UCUP 2E9RX 1R3NA 1C0TB 1N33F 5D3GA 5LMNF 1TKXA 5C42A 1HNIB 2Q6CA 2HPUA 4X4NA 3NGDA 2NXUA 1VQPS 4OZ5A 3CD0A 1VQNS 2CQHA 1C0UA 1S6QB 1X0FA 4NZ7A 1IN0A 4C0BA 1QUPA 4JI0F 2W9BB 3K58A 2CRLA 3THTA 4NLXA 3SCJE 4BWMA 2MMYA 2KB2A 1D9DA 2ROPA 1IXKA 3DRPB 2AU0A 5B0EA 4X65F 3N01A 4NA3A 1KOOA 4YHHF 2AX1A 1SV5A 2CQBA 4F4ZA 1U09A 4A47A 5KFLA 4DJBA 2MKIA 3OUYB 1DJ0A 1RT2A 1RT6B 2IAJB 2GO9A 2KRBA 3AB4B 3IS9A 2DPIA 3H8YA 2KRRA 4FXWA 1C1CB 3MMAB 1YRTA 1TP7A 3IXQA 2ZDPA 3K5PA 1LWFB 4ECUA 2YQ3A 1IR0A 5HI7A 3TAQA 3PO4A 2OAUA 3CJ3A 2QSFA 2FJXA 4IG3B 3DLKA 3JTOA 5D4NA 3V6DA 2XMMA 4IG0A 1YSJA 2JHEA 2JVRA