4A47A

Crosstalk between cu(i) and zn(ii) homeostasis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
TIQLTVPTMDCTSCAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SSR2857 PROTEIN
publication title Investigating the Role of Zinc and Copper Binding Motifs of Trafficking Sites in the Cyanobacterium Synechocystis Pcc 6803.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 18
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a47A00
3MCSA 3VTIA 2K1RB 1SB6A 3WDOA 1AFJA 3DXSX 4FNIA 4A46A 2XMKA 3HHLA 1N5VA 2ROGA 1IUJA 3HDSA 2QLWA 3MZIA 5B0DA 2OFGX 5B09A 1JK9B 1TR0A 2QYCA 3UDCA 3HHLC 1XBWA 2ZDPA 4YDXA 5B0FA 4ZA1A 2ASYA 2VH7A 2IYGA 1GXTA 1VQSA 2PGCA 2GGPA 4Q2MA 4Q2LA 2VV5A 3CJKA 2ACYA 2Q3PA 1KQKA 3KNGA 5B08A 2HIQA 4NPOA 2XMJA 2LQBA 4HH0A 2OAUA 1KVJA 5F0WA 2HFNA 2BBEA 2W4DA 2KKHA 1SQEA 2N4CA 2N7YA 4YEAA 2GA7A 4A4JA 2LQ9A 2BJEA 5B0BA 2PD1A 3HFKA 2K7JA 3BN7A 1FESA 1U7LA 2AJ0A 3FMBA 4A47A 5F0UA 1OQ6A 2GGPB 5B0AA 4F67A 3CJKB 2XMVA 5B0CA 1CC8A 1RJJA 5KAKA 1OSDA 3TNVA 1N5QA 4HL9A 4U9RA 2XMMA 4A48A 5IXUA 4OJHA 1Q8LA 1Y9OA 1Q53A 2HLTA 1N5TA 3T9NA 2EW9A 2K7KA 1LQ9A 1QUPA 1N5SA 2ROEA 3DCAA 4DPOA 1TZ0A 3TOQA 3I9ZA 4OJ3A 4DN9A 2ZDOA 3BR8A 2RU9A 1ULRA 3K7RA 4QOTA 3FRYA 2W4CA 1FEEA 1OQ3A 2RSQA 2AJ1A 3KKFA 3QGPA 4OIXA 1YJUA 2K2PA 4DL0C 2BJDA 2IYIA 3BDEA 2GO8A 2QIFA 2CRLA 3FGVA 3KG0A 5B0EA 3F44A 1APSA 1CC7A 1YJRA 2KT2A 1GXUA 1TL5A 4Y2KA 1SI9A 1AW0A 3E8OA 1MWZA 1TUVA 1AFIA 2XMWA 2W4PA 1Y0HA 2AW0A 3LGMA 2JDJA 1KVIA 4NL5A 5A6PA 1X0PA 1URRA 2HFOA 1TL4A 2OD4A 4OJ1A 2HLUA 3BF4A 4EFAC 3HX9A 2KT3A 2FIUA 4HI1A 3IWLA 4HI2A 2AP6A 2BUNA 1MWYA 1FE4A 2FHMA 1Q4RA 2N4DA 3HHLD 1JWWA 2OMOA 1Y3JA 1FD8A 2BYCA 1FE0A 4ZOSA 1X8DA 4Y2MA 3QMQA 2RMLA 3LGNA 3LO3A 3IWXA 2KYZA 3BGUA 1FVSA 1P8GA 2FB0A 2HQIA 2OKQA 1X7VA 1CPZA 2RILA 1YJTA 5T7LB 2XMUA 2GV1A 3BB5A 3HF5A 3TRGA 1OPZA 4FNHA 2LXFA 2IFXA 2K1RA 2OFHX 1P6TA 1R6YA 2G9OA 2QLXA 3GZ7A 3KG1A 4OJGA 5K9FA 5A6WA 2OD6A 1Y3KA 2FTRA 3HHLB 1VQYA 1S6OA 2LDIA 1S6UA 2XMTA 4Y2IA 2GCFA 1YJVA 2GFFA 1YRXA 1Q8BA 1W2IA 5T7LA 1K0VA 3BM7A 2ROPA 1YG0A 4HH1A 5B0GA 1FVQA 1WD6A 1V3ZA 2OP5A 2L3MA
chains in the Genus database with same CATH superfamily
4MAKA 4LF9F 2AJ4A 4IYQA 5CYQA 3EUNA 4Y3CA 5I4MA 4FF1A 4PXEA 3RYLA 4V1Ak 4RL1A 2OAUA 2W2PP 1T7PA 1R31A 4F67A 1NM2A 3AJDA 4YOEA 1WDTA 1RLCL 5HP1B 3HT3A 3D6TB 3UCZP 2XBPA 1CJVA 2KT2A 1RE1B 4EYIB 1X0PA 4JI8F 1UZDA 1WEYA 2PEHA 2R7UA 2RVJA 4USIA 2UXBF 2VFRA 2RKIB 3M6UA 4K0KJ 1H2TZ 3IM9A 1CBKA 3MCMA 4LFCF 3LW5C 2KZMA 1BQNA 1S6OA 4AQYF 1VLYA 2VUGA 2HBQB 3JQMA 2L3MA 1CJUB 2W24A 5KFGA 3CCJS 3RZAA 2H4WB 3MAHA 5K8MA 1JLEB 1X4CA 2ALZA 2CADA 4DCOB 2MGZB 2H1YA 2YNFA 1QTNB 1HNZJ 3JSMA 4PG5A 4B3TF 2NLWA 4A47A 3KK3A 3RB4A 2QX0A 2ZZMA 2AZ3A 1Q8LA 3OTDA 3H5SA 2QL5B 3KUEA 2FVRA 4Z37A 4LRBA 1F1BB 5HL7Q 2FGCA 4QW8A 4ZN3A 2V67A 4CLTA 3OL9A 1EARA 3B54A 3BO3A 3FMWA 1S1WA 1FF2A 2V2ZA 2IAJA 1Y0HA 3R5DA 4DV4F 4NX9A 3CGIA 2DH9A 1Q7YT 4MIAA 5GAGU 4KQZA 1MMLA 1RADB 4WZMA 4B3SJ 4KKOB 1JLFB 3B82A 4I6AA 3FSYA 3NGDA 2W2NP 2KH9A 1N56A 1DRZA 3CPWR 3V81B 4RNHA 2IJNA 2K3IA 4X4TA 1T9TA 5ETSA 1NB2A 4JI2J 2O1PA 3M30A 4EUVA 5G4DA 3OJSA 4FVCA 3BKTA 4C11B 2ZVSA 4NMLA 1AB8A 2FJAB 3HVTB 3M2RA 4CLPA 4BLGA 3MD1A 2HG4A 2DCLA 3I5BA 2YQ3A 1H38A 4PZVA 3ISNC 2RHQB 3A3OB 1SKWA 2YWHA 1HNVB 4WP9A 2QA1A 4X65J 3VV2B 1UW4A 3E3XA 3QYYA 3HHEA 2LXUA 1UETA 2WRMA 3JAMY 4DCPB 4EBCA 3MXHP 3KTQA 4HACA 2BW7A 1SL2A 7FD1A 3KLHB 3T5JA 1HHSA 5HN0A 3QLHA 1HWLA 4LSZB 4X62F 3QFWA 4AL6A 1X5OA 4XO0A 1GTHA 1I6JA 4YDDB 2IDEA 1M90T 2GX8A 1TK0A 4DPYA 3QJJA 1NK8A 2PC6A 4LF7F 2NZCA 4NLXA 2XWXA 1SIWB 1FJGF 1KOHA 1YRTA 1KQSR 2KXHA 4J9UE 1ITPA 3FJ2A 4PWDB 4FYWB 5KG2A 4DHVA 1F9HA 2CJKA 2ASYA 5LL6d 3DYAA 3ILIA 2Q3PA 2DBBA 3AD7C 1LW0B 1U6FA 4X64F 3PRVA 1Q95G 4LF4J 1DQ8A 2DO4A 4DR3J 3DRPB 2ZOFA 5HP1A 4W92B 4OJHA 4F0KA 4LFAF 2XSJB 1D9AA 5A76A 4N7TA 3R5CA 2RF2B 3TW0A 3CD0A 4YS2A 1F0XA 4KJIA 3R6LB 3AA8A 3W7BA 2IC3B 1U1KA 3LGMA 3RTVA 1S0VA 2RKIA 1RT3B 1V3RA 2HLUA 2CNOB 2AWZA 4IQMA 1MWQA 1Z4UA 5DJBA 1X8DA 2JRSA 4G65A 1WG5A 5F9LA 3LP2B 3ZZTA 2R2SA 2GV1A 3PY8A 1RHUB 1WKJA 5LOQA 1CJUA 4ZPBA 4WXWA 2OHDA 2F8EX 1JLEA 2IM3A 3ILLA 5E3PA 1SUQB 1WD6A 4DR6J 3UNYA 1T03B 1U6ZA 3PO5A 3MR5A 1HPZB 4ZCKA 2ZDPA 3FBFA 3HK2A 3H40A 5F41A 1WF2A 2ZKUA 3GIMA 3CD5A 1X31C 7FDRA 3D0GE 1Q7LB 1KLMB 2OEKA 5D78A 3LOUA 5J2QB 3W5YA 4LQ9A 3CMES 1AUDA 1V6HA 2WAQD 2EFGA 4MMOA 3BPSP 1YZ6A 4USWA 3Q8RB 4QWDA 3I6PA 1HIYA 1JJ2R 4TLRA 2E9RX 2LEBA 1KTQA 1PJ7A 1APSA 1R89A 3M6WA 4ZS6A 4KKOA 2ZOGA 1UJ6A 2GHWA 4C8LA 3TEHB 2GC8A 2DHXA 1DTQA 3PHTA 4DEZA 2CZ4A 5KFXA 1RAAB 4U96A 3R9LA 1X9WA 4KGKA 2X1BA 1IBLF 2DB1A 3V81A 1D9FA 3V2UC 1ZA2B 4ZITA 2CZVC 2IIHA 4ED6A 2N82B 3HVTA 2JFDA 5E33A 4WPAA 1VHIA 2DNHA 3DLLQ 2B9YA 2VB6A 3BQ0A 3M8YA 1HNVA 1MROB 1MG7A 1VQ4S 2CQGA 2F1FA 2AT1B 1LWFB 3PXGa 3IM8A 1FKOB 2OO4A 1NBEB 3IRXA 3KLHA 2APOA 3M4XA 3EICA 2VG6B 1ROFA 1YBAA 3ETMA 3NAHA 2CQIA 4WP3A 4URSA 2M70A 4ID8A 1RWPB 3Q8VA 2AQ4A 4NXMJ 1VS3A 4F4KA 5D77A 4F25A 3EGZA 2E1MC 2AP6A 4DN0A 1MWYA 2CWKA 1YI2S 4URGA 1DHMA 3D6HB 4PWDA 4RNFA 4AXJA 2BR0A 5BYRA 1GTEA 5K5MA 1L3TA 1RT7B 1PG5B 1PIEA 1EQMA 1FJCA 3RBEA 3VAMA 3NMRA 2QC3A 1Q86T 2HZAA 3LWLA 3DRPA 3MMJA 1HMVB 2ZH6A 1XWLA 4DDFA 5C5JA 4Q5VA 3M9OB 2IM0A 5IQQA 3Q2TC 2AX1A 2RF2A 3CJRA 5BYSA 1PYSB 4BBYA 5KTQA 3TJ8A 1F3VA 5BYQA 2I1RA 2BE2B 4K5SA 4ZLPA 2VF3A 2CVIA 3G71S 1MMNA 1TTHB 2YVSA 2NQPA 2UXDJ 1RT3A 3DOKB 5C24A 2BRLA 2FD2A 2MXYA 1AW0A 3OT9A 1U24A 1GX5A 3JTOA 2RJZA 3N9UC 3CF5Q 4EK2A 1HWKA 3LP2A 3LAMA 1JLQB 4PUOB 1N88A 2GQQA 3HVAA 2IMWP 3OXLA 2KI2A 2HNYB 1SUQA 3BB5A 3UPFA 4M63A 2C2KB 3OTBA 3JSRA 4L74A 1WG1A 1SL1A 1T03A 4G3IA 2EG2A 4J5OA 1HPZA 1K0VA 4OV1A 4I6WA 2MQLA 1XR6A 3EX7B 4IR9A 1KLMA 3LH2S 4M5NA 4RLEA 1NMEB 1VC5A 2W01A 3J81j 5BXIA 4LRFA 5J2QA 2RU3A 3F0NA 2FC9A 5CD4A 4O0IA 3GSDA 3EZOA 4RR5A 2ZWOA 4ZN1A 1KLNA 1EJ7L 1N5SA 4QWAA 2V4JB 1FDDA 1FEEA 2ZE2B 3T1YJ 2LQ8A 2VOOA 3J80U 3QT8A 5CZXA 1Q82T 1RWWB 1XIQA 1JMTA 5G0RB 1RA6A 1H7WA 4ECWA 1S9FA 4JBCA 1GT8A 3EM1A 2CJ9A 2OTJS 3PCOB 2BVZA 2LP4A 3QMQA 4ZVGA 3MGJA 5GVQA 2NXJA 4Y2AA 3THVA 4TKTA 1QM9A 1UW9A 1NJXA 3I4PA 4ECSA 3TANA 4NZ7A 5C25B 2J9DE 2DNPA 1UEVA 3MUVP 3D1QA 1V3ZA 1KBRA 2MTLA 4IOBA 4LBPA 3A3PB 3BH6B 1XBWA 1MROA 3ET6A 5LM7E 2IM1A 1PAUB 3FDSA 3I0SB 1LWFA 1OSCA 1TK8A 1FKOA 2RHSB 3QIPB 3RRGA 4RNMA 2VG6A 3MUMP 3BBBA 3MM9B 4NCGA 4P52A 2FLOA 2ASLA 3K5PA 4F02A 4CP5A 5KFNA 5ETNA 2BKOA 3F44A 3JS9A 3ZNUA 3N79A 1YDLA 4NL5A 2B9EA 4O44B 3FRZA 3BDPA 1FA0A 1WOPA 3H2UB 1JWWA 1MLAA 3NKYA 4FVMA 2PE8A 2FHOB 3CO0P 2QEXS 3MEGB 3A3NB 5KFEA 1RT7A 1KQGB 4WYLA 2R4FA 2R8IA 4DL2A 2XCAA 1VJQA 4YQWA 2NSCA 2QFJA 2BACA 2RS8A 1HMVA 4WE1A 4LR7A 3ZFVA 3FSXA 2QTWA 1M1KT 1GQEA 4ZPTR 3G8SA 4B9MA 4WTYA 3DRXA 3MUTP 4AL7A 1N33F 2M7SA 2BE2A 1SJQA 1UFWA 4JI1J 2DGOA 2GMHA 4A48A 2XI3A 2FJDB 5HROB 4JI3F 2HLTA 2AX0A 3DOKA 2GIRA 1IVZA 3ZTSA 3GMGA 2R7VA 4IRCA 4W4MA 4U7UK 3D7SB 3BKUA 4PUOA 1MWZA 1R3NA 2PMZD 4NXNF 1B0TA 1LKZA 1RWVB 2ZH5A 3TVKA 4MIBA 1KWMA 1RAJA 4D3GA 4RU9A 2HK2A 3QAEA 3AFGA 4L3KA 3I0RB 1CULB 4K4SA 1U2CA 3MEEA 5K8PA 4RWXA 1HHTP 3IFEA 3PX4A 4W90B 3H59A 3U27A 2FVPA 2KXFA 2Z4PA 1RHRB 3DLJA 1RSCA 3NGRA 4ZLNA 2OJ3A 2GJIA 4CCHA 5DQGA 3HCXA 1JQGA 2DVIA 4ZA1A 4P75A 1NSKL 2MKIA 4Q2MA 2B6AB 3R7SB 2DGTA 4OYAA 2GA7A 2F9DA 4J9MA 2O5DA 3NY0A 4DQSA 2V4JA 2A6MA 2I9SA 3TARA 2ZE2A 3IP0A 4HYKA 4FS1A 3ZTPA 1BQMB 5HMXA 2BV3A 2NPFA 2UUTA 3M2UB 3NGKA 3PR4A 1OQ3A 1HNZF 4FXVA 3HJVA 1T02A 1LFPA 2KHDA 3ADAC 4D3HA 4P2MA 3P3DA 1T9WA 2CPIA 1VQLS 2IDLA 1JLCB 3BEGB 4OX6A 4F36A 5ETLA 1NK6A 1XEZA 1S4EA 4JI6J 2E66A 3MM5B 5C25A 3CMQA 5IV3A 3DXBA 4LVOP 3D6MB 2WB1D 2AYMA 3HI9A 4B3SF 5AXLA 2DXEA 4FNIA 3OSPA 1WWHA 5B0DA 3I0SA 2BRKA 2D69A 3AJ2A 3LUYA 5DLFA 1GXTA 3QIPA 2J5AA 4OYPA 2ZM6J 2DRAA 3UCGA 1TAUA 4TU7A 3HFKA 3ZTQA 5JVGQ 5A8KB 4OZ3A 3MM9A 4DQIA 2J0SD 2GIFA 4KH0B 4JI2F 2DXDA 2DHHA 1C0TB 3VQTA 1RDRA 5IXUA 2M88A 1YBUA 4G1IA 2I2YA 2NXCA 1R8HA 4O44A 1N0UA 5GAEU 4P71A 1KR4A 3OL8A 1KFDA 4CT9A 2H48B 4PG4A 2HPUA 4N47A 2HAIA 4DUTA 2NSBA 3MEGA 4WFNQ 3IMQJ 1TKTB 4PQAA 3CWJA 2DT9A 4LF1A 2QA4G 5ETTA 1H2VZ 3W65A 1UVJA 3O8WA 1RYRA 3OTOF 3R2CJ 2E7WA 2YNIB 1MSWD 3GJQB 5E5NA 1I1GA 2ROPA 3HHKA 3CC2S 1HW9A 3N28A 4I2QB 1EETB 1GMWA 3SBMA 1RZMA 4ETXA 2KFYA 5LMNF 4ETZA 2WW8A 4YB6A 3QZ8A 1X5SA 5HROA 5KFBA 2A18A 2D74B 2HRUA 1FESA 5B0AA 2YWGA 4OLOA 2HHHJ 2V8GA 1RTIB 1L3UA 3BR8A 3SFGA 2GS8A 2YH0A 4EGLA 1KKHA 2DNMA 4LF4F 3R2DJ 4P2SA 1BD6A 4I7FB 3PW4A 3UD5A 3KDOA 3D1HA 3I0RA 1CULA 2BMBA 3DNCA 2KHCA 5EHHA 3QWUA 4KAIA 3T3FA 2HS0A 5DDPC 3RBDA 1CS4B 4K4VA 1M0SA 2FJBB 1FXDA 3TRGA 3IXQA 2OFHX 4Q43A 1S97A 1MN7A 4FYYB 2GZOA 3BV8A 2JC0A 2XI2A 5KT4A 2B6AA 4J7CA 4DSKA 3B4DA 4ZK7M 3HKWA 2Y0SD 2QT7A 2B4VA 1RT6B 4XDCA 2C28A 3JXOA 2QLBB 2IJFA 2QSWA 4Q44A 3UE2A 4R25A 1BQMA 1IKYB 3M2UA 2ZC3A 4DR6F 4DSIA 2WZ1A 3FQLA 2ZNZA 2CQHA 2H51B 5HMWA 3A12A 4QR1A 1RKJA 4B3MF 2ZDOA 4WXOA 3FRYA 4B08A 5DDQC 2BJ8A 2CQ0A 2CJAA 4H4OB 3ENWA 1JLCA 3KG0A 5A2QY 3V6KA 5KFZA 2D9OA 2QZ8A 2F5GA 4ZVPB 3MM5A 3D66A 3MMCB 1A7GE 3N5FA 1WHXA 4OZNA 2MYFA 3OFEA 4ZJLA 2LECA 4Q45A 4AE5A 2FB0A 4LIWA 5GMDA 1XNRJ 2FPHX 1PC4A 2CXEA 4K2XA 3PRBA 2IVYA 2DHSA 3BKFA 1H7XA 5ETRA 4NI2B 4DX6A 2O67A 4TLQA 1M5VC 5A8KA 4ZP9A 4QIFA 4U7CA 3IR7B 2EFVA 1C0TA 3KNGA 4NASA 1A6LA 5KOXA 2BBEA 2K8GA 2KKHA 2BJEA 2QN6B 2C2EA 3SSQA 3TQ1A 5KAKA 3EVWA 1N32J 2RDDA 2O66A 3G86A 2B9WA 5EGYA 2D1CA 4FKYA 2ROEA 1ZTWA 3I9ZA 3U1NA 2MLZA 3KKFA 3UN3A 3RG6A 4DOZA 5KFYA 4ANEA 3SCLE 2HFUA 2B5JB 2QO3A 1TKTA 1DURA 1RHJB 2CQ2A 3QNWB 1PCAA 2FHMA 1IBCB 4IRKA 3Q8SB 3DLBA 2YNIA 1PBUA 4FYXB 4JI7J 4ECZA 1FNOA 5A8WB 1VRUB 1UA0A 3PFEA 4ERDA 1JLAB 3GZ7A 1CQNA 4X4RA 3S8SA 4NXMF 1EETA 4B3OB 2NPIA 3DC2A 2R7TA 2Y1IA 4IFYA 2V6AA 4DS4A 1EAYC 5HBMB 2B8PA 4DV3J 3W2VB 2PMWA 4JB8B 3LGHA 1S72S 1VQ8S 2MSTA 2YNHB 2V4RA 2ZJRQ 3R5GA 2UU9F 2J7UA 2IPOB 2XMVA 8RUCA 3MFIA 2DHAA 3GCXP 3DDKA 3KLIA 2DGVA 1DZ5A 3R3TA 4B9NA 3DOLB 1LQ9A 1C1CB 4I7FA 1HA1A 4OIXA 3KK2B 2HHXA 4ZPCA 1HWIA 2E1AA 4BHQA 4LRDA 4DQQA 2AW0A 5JJBA 2POKA 3BF4A 2FIUA 3FK4A 1CS4A 4LIRA 1JNRB 5EUHA 3PW0A 1TL1A 2RDIA 1VIOA 3KG4A 3R5AA 2F4FA 2VG5B 4QQBA 2UXDF 2ZBIA 4NLUA 4OX9J 2BE9B 4IRDA 1YGYA 3TA1A 1TV6A 2BM1A 3DU5A 3I4HX 2VD3A 1D0EA 1RT6A 3VGVA 2C2OB 4M5GA 5KFAA 1SB6A 3RUBL 2LXIA 2D41A 4JV0A 1AFJA 2FY8A 1NJYA 1FXRA 4ZVSB 1IKYA 1TELA 1RB0A 3CCRS 1K0TA 1X5TA 4DFPA 5ETKA 2J6SA 3H20A 4YFUA 5KFLA 3U7JA 5EWEA 4H4OA 1D3WA 2XYPB 4N56A 5EN1A 3UI3A 2GO9A 4LQ3A 3MCNA 4FBTA 2AJQA 5KFVA 1XMOJ 1UPMB 3MMCA 1RWMB 1AT1B 3GYXB 2UUAJ 2YTCA 1KVKA 4F0HA 3H4DA 1S9EB 3J7YU 4LBHA 2LQ5A 3T1YF 4AUKA 2AYBA 3MOJB 2VPWB 1P8GA 2RT3A 1W2BR 1TQLA 1SL0A 3GIJA 5IT0A 2G4BA 4DUZF 4DWIA 4NI2A 3UD4P 2E5GA 3VGSA 2V2QA 5FLXY 2MZQA 3Q23A 4NYPA 4DUYJ 2COLA 4Q8FA 1VHFA 2QRRA 5DLGA 3CCMS 4RO0A 2UUBF 1Q5YA 2UVWA 2A10A 1X4BA 2YWEA 1VK8A 3Q86A 2CIMA 4G6VB 3MI7X 2BKNA 1XMBA 2DR8A 3ZC4A 3BSOA 3UR3C 3SEOA 3SQOP 3OTCA 4DPTA 3PYFA 1FD2A 3NXZA 1YJ9S 1R8AA 3BYPA 2EW9A 1SV5B 2ZUAA 1BXNA 1K1SA 2B5JA 4QOTA 3UCUP 4LF9J 3FEYB 4A8XA 4DXLA 2FJXA 1QAJA 1F5BA 2WCXA 1BUXA 2RUGA 1S10A 3QQCD 2C22A 1NU4A 2IY5B 4F3MA 1VYAA 5A8WA 4M5DB 1FD8A 1RWOB 5D3GB 1JLAA 3BGOP 6FDRA 3THTA 2YKNA 3J7ZT 2XS2A 5IC6B 4B3OA 4Y28C 4WKYA 4WTOB 1FNXH 2XLIA 2DNLA 4CO3A 5K8NA 2RQMA 3K0JA 4Y2IA 5DGBA 3LP1B 2YNHA 1ZM9A 2CG4A 3GV7B 3UDEA 4J9KA 2IYGA 3DHWC 3MR2A 4K5RA 2UXBJ 2IMOA 1VJWA 3MAAB 3QSYB 2FVCA 3DOLA 2CPEA 4F0MA 3Q8YA 2HVEA 1NHKL 1C1CA 2CWXA 3C8YA 5HQLA 2RIJA 4U9RA 3D3BJ 3CNQP 5KT6A 4ILMA 3KK2A 2EI5A 3KLGA 1VC0A 1EQ0A 1U48A 2J7KA 4KPYA 4GKKJ 4M5KA 4Y2KA 4DV2J 2VG5A 2KJWA 5CAAA 4B3TJ 2I8EA 2OMOA 3CMAS 3M6VA 1FE0A 3OW2R 3GSIA 5DZ7A 2CNNB 4R5PB 3R5BA 4DV1F 1I94J 4JI0F 1X4DA 4NLVA 5F8JA 2FZKB 1W25A 2QMXA 4ZVFA 2FDNA 2VIHA 3E8OA 1GNKA 2XLKA 3L7PA 4RUCA 3TUIC 2NZ4A 1NHVA 3KJFB 4C8OA 2UV8G 1R43A 2XMJA 1KVJA 2AU0A 3D54A 4O3OA 2X51A 3E51A 1LOUA 4QIWD 2OI2A 4ED0A 2QE5A 3TYTA 1J5EF 3H5UA 1HI1A 3TZXA 3QGPA 3JTNA 3BPDA 3VQSA 1LEOA 1S9EA 1GK8A 2LEPA 3Q22A 2W4PA 5E3RA 3GONA 4L6V3 4MJKA 5DZ6A 1RTJB 1CLFA 2H3EB 1FI4A 3BSAA 2CNKB 2J9EA 3A4TA 2F8HA 3CIMA 5AXMA 5L9XA 2J7WA 3GIKA 1K8AT 2AKWB 3NRBA 2IFXA 2QLXA 5LSLA 2L9DA 1S6UA 1HFEL 4O4RA 1A0OB 2LQJA 3GYGA 3ZZOA 2L9WA 2G2OA 4LR9A 4X62J 4YR3A 3CCQS 1ZOTA 3UD3P 3AHPA 3HZGA 4QW9A 3PG9A 1Z2LA 4Q2LA 3GR0A 1SBRA 2AEFA 2MZ1A 3BN7A 2GGPB 4F2SA 5J2MB 3R27A 4WIIA 1UEUA 2F63A 2MZRA 3CC7S 2ZM6F 3NL0A 4Z7YA 1F3FA 4M5DA 1TL5A 1UJ5A 2HGMA 5D3GA 3DM2B 3SZ2A 4CTAB 4X64J 1SH0A 4ECTA 1XR5A 3HT0A 4KGXB 2CDQA 3BGRB 4M5HA 3LGNA 5HJXA 3RAQA 4ZCMA 2OKQA 3M05A 2QSFA 4KGZB 4C48A 1RAEB 4RW4B 1ACMB 1YSJA 1FDBA 3VF0B 1MU2B 3PKMA 2MKJA 2B51A 1EP4B 5T7LA 4UOGA 3MTKA 4EFAC 1T94A 5I42A 1F5AA 3R6GB 3CT9A 2NXNA 1XN9A 2XGPA 3GU0A 2CPXA 2XTJP 2ZBQA 4B9LA 2MJNA 4UZBA 1LWEB 3WHIA 1FFSB 1O6XA 3T9NA 3VAFA 1SCJB 4KPCA 4L75A 1S4FA 3ITHB 1D09B 1VGYA 2JZ5A 1TUGB 1B4SA 2J6UA 1GXUA 2MKKA 4FXWA 3OL7A 3KYLA 2DGSA 2HIYA 2HHHF 1PKUA 2AGQA 2RB7A 4R5PA 3PYGA 4TQSA 4ZPWR 1HHQA 3SI8A 3OLAA 2KJVA 2ZD1B 2HHTA 4QYRA 1Q78A 4JYAJ 1R8BA 1R6VA 3OTEA 1LWCB 3AH6A 3LPEA 3NLCA 5GMEA 3H5XA 2CA9A 2LVWA 3L95X 1IWGA 4IO9Q 3ZZ0A 4WWSA 5E0OA 1WSRA 4ES3A 2QFIA 5LSOA 2OFGX 2AF6A 5H9EK 4KC5A 2BJ9A 1HI0P 4FF2A 1UVMA 5F8HA 2I0XA 2JC1A 1IBLJ 1C1BB 1QDUB 1FFWB 2YBVA 3PEJA 2JVRA 1YWXA 1U7LA 1H73A 3H2VE 1M5PC 1U6BA 1TFYA 1C4AA 1ZAWA 1PC5A 3Q89A 1VBXA 3KMSA 3ZZZA 4WU3A 5GAHU 2RSQA 5ITHA 1K44A 3SV3A 4DL0C 1BMQB 4ED5A 1RTJA 4I68A 2HWIA 4HHHA 1DQ9A 4DU7A 3R5JB 1RUSA 4OI6A 1NPKA 2V50A 1TL3B 2Y9HA 3IAS9 3OR1B 5D0EA 4ANCA 1FFGB 2GHVC 3IG1B 2C2DA 3LO3A 1TUWA 1FVSA 3N4WA 4X4SA 4QWBA 2YNGB 4KH1B 1WHWA 4FYVB 2XCPA 4YB1P 2GFFA 1TKDA 4HHUA 2QMWA 3HHNB 3IGVA 5AE3A 2X1FA 5THWA 3HHLA 1H0HB 3MZIA 3M32B 2C2MB 5SZTA 1XNRF 3KNAA 3EPIA 3MMAB 4ZLLA 1N5YB 1YIJS 2GGPA 1EHWA 3I32A 3IC1A 4GVBB 4OZJA 1RCOB 2J76E 3H7HB 3TQEA 3DGPB 2BQUA 3HXMA 3QRPA 1ZPVA 2D3ZA 4ZVUB 2V0NA 1GXLA 2LA4A 3KHHA 3BSCA 3DM2A 3PYEA 1KOOA 4CTAA 3I87A 3W9IA 2DH7A 5CZVA 3QBCA 1AUSL 3FCWA 4QPTA 2HGLA 1KHWA 2RE1A 1N32F 3BGRA 1HNIB 1WHYA 4B9UA 2BANB 3TAMA 1Q0NA 3FFIB 4RW4A 1U1RA 4NA1A 1MU2A 3L09A 1EP4A 1U45A 4YMEA 3KJVB 5KT5A 2G9OA 3JTPA 2BOAA 5E41A 2XEXA 4EEYA 3RU0A 2WVFA 3RB6A 3MOZA 3OFGA 3K2YA 1TR0A 1U0SA 2QYCA 2E5HA 3CC4S 2VH7A 5K8OA 1JLBB 1LWEA 3UWTA 1Y11A 1X5PA 1YBTA 1DBDA 1HLWA 3VAHA 4HT5A 2CAJA 4OZ0A 1RJJA 1JXLA 1N5QA 3ITHA 3LWMA 4CM0A 3THPA 2DNNA 1N36J 3AXMA 2PFFB 4UOHA 1J27A 2XMWA 2LLZA 2FHJA 2OD4A 2ZD1A 2R7QA 4OYOA 3A8EA 4H4MB 2WB4A 2MLXA 3WQPA 3BN4A 4ED1A 5HVHA 2HURA 3SXLA 3HHLD 1WC1A 5IOLA 4ECYA 4YHHF 1LWCA 3VZIA 1QAIA 4CLZA 2HNZB 2GHPA 4J90A 1BQNB 2VL1A 3HSJA 2XWYA 4X4QA 5F8MA 2YWKA 1RTHB 3KK1A 3SV4A 3MM8B 4K59A 4KB7A 4EMDA 2ZZTA 1FVQA 4NLWA 4U6PA 2ZJQQ 2XZWA 4KY3A 2NUHA 1SJRA 2P9GA 4IFVB 1XERA 2G1HA 4OX9F 1UVIA 1B0PA 4RW6B 2MJUA 1RISA 1CG2A 2YKMB 3H98A 1OS5A 1A9NB 4QYZJ 4UF4A 3RJMB 3WX8A 1WTBA 2OH2A 2B56A 3ETOA 4LUBA 1KNZA 2EEYA 2FQQB 1N4LA 2ABYA 1RBAA 3M8RA 3EZUA 5HMYA 1YJUA 1TL3A 4C8KA 2LYVA 3OR1A 1VQ9S 5J1PA 4UQTA 3SFUA 3PKYA 3GCWP 5C42B 3CCSS 2JJ4D 3IO1A 5LXRA 4N8NA 3JYTA 5DQHA 2N4DA 5DQIA 2BYCA 4NOHA 2M8DB 2JLGA 2DGUA 2HQIA 4DFMA 2UUCJ 1F9FA 1XMOF 1F60B 2KXNB 4P74A 2UUAF 1IXKA 3M30B 1VBYA 3M32A 2OPRA 3BM7A 2LCWA 1N5YA 5KFRA 2QV6A 2Z2ZA 4ECUA 5F3ZA 4X66J 2V9WA 4ZJQA 4DF8A 1JKHB 4GVBA 1M5OC 4RBUA 2F7VA 3DGPA 3SSRA 3GPAA 4OZ5A 4PYAA 5AJ3F 1SC4B 4A4JA 3BH7B 2MQQA 3F73A 2DJWA 4TY8B 4PCQA 1RAGB 1OQ6A 4GO7X 3GG0A 3HD2A 2VG7B 1SH2A 4HACB 1CVJA 2OGUA 2WBRA 3DGVA 1O51A 1LK7A 2OIHA 1PGZA 3QLHB 3DRYA 1HNIA 2BJDA 1RGVA 5L46A 1TL7B 2VDHA 3VVTA 3BREA 4YUDA 2BANA 2BX6A 4CDIA 1HQUB 3FFIA 1ZTTA 3HKZD 1N33J 3MPVA 4K2JA 4M5JA 3AODA 4CLUA 1S77D 3KJVA 3AQPA 3K5MA 1KEKA 4JI3J 1NDKA 3G6YA 2CFXA 1D8YA 2FUG9 2YX4A 2CPFA 4U7UD 2Y3YA 4DR7F 1L3SA 5ETVA 4OYIA 1T3NA 1JLBA 1G7CB 3DYAB 4NXNJ 5T41A 2KT5A 2JLFA 2VFTA 1NK9A 3G96A 2F9JA 5KFWA 3MHYA 4I2PB 5KFQA 3G82A 3M8PB 2J8AA 3OR2B 1IQTA 1D9DA 1OJ4A 3HVRA 3W8GA 4HDHA 2AMCB 5L1LA 5FJ4A 4FBUA 3NGUA 3VR1A 3T9ZA 1BWVA 2AJ1A 4JI4F 3JSYA 4H4MA 2LMIA 4E98A 1Z1ZA 1IBKF 2BXJA 4MK8A 2HNZA 4Q0BB 1T9VA 3RAMA 3CD6S 5AXNA 3QIDA 2ZWPA 4K4YA 1U4BA 1S48A 1RTHA 4GKKF 2P8IA 5E2QA 3MM8A 5DDOC 5GAGI 4DV2F 4ILLA 3NOCA 4IFVA 4RW6A 2C3YA 4JOUA 2ASJA 3N5BA 4FP9A 1ICEB 4P7TA 2A6OA 1WC6A 1NK5A 4BC7A 4EBDA 2YKMA 2LU2A 3BGLA 4ZP6A 4C8NA 3CCTA 3S1TA 5LMUF 1U26A 1I94F 3QRRA 3CDAA 1HBUB 2YKQA 1Q1KA 1NUEA 1WUUA 2WOMB 5KFDA 3EWGA 2AV5A 2E9TA 2K7JA 1Y00A 1YHQS 2DTJA 3W2WB 3C66A 2YKAA 2OEMA 1TP7A 5C42A 1IQZA 1QAXA 2GAGC 3W5ZA 1DTQB 1U2FA 5HQ8A 5DG9A 3W5XA 1Q8KA 2CQDA 4ED2A 1WEZA 2L41A 4CZCA 5DG7A 1U1MA 2MY8A 4I69A 3K8WA 1Y3KA 4F4ZA 5KG5A 3WIVA 3C19A 3H90A 1JKHA 4QU6A 1LK5A 4YN3B 3W66A 4CLFA 3MPWA 5JMNA 2HHQA 4A46A 2R9LA 1IJEB 3MR7A 4HTJA 5BJRA 1IBMJ 3I5AA 5F8GA 4TY8A 1VQSA 1ZH5A 2BEFA 4X4UA 1E6YB 3V6HA 2VG7A 2EBEA 4CH7A 2G2YA 3EXYA 1U1OA 9ATCB 1WI6A 2AZ1A 3IRXB 3OTOJ 4DX7A 3OPKA 2E7VA 3IS9B 3FZ2A 5DM6Q 1TL7A 2BKPA 4XK8C 3RW7A 3NS5A 2ZJPQ 4KR0B 3CDEA 3C15B 1EZZB 1HQUA 3ZZRA 5KT2A 1N6QB 2XMAA 4MYTA 3K57A 1BLUA 4RW8B 5LMNJ 4NLTA 2ZHAA 4P2FA 2BDPA 4G1QB 3TUJC 1XQIA 2JEJA 3HZEA 4O4GB 3IWLA 1ZAVA 3BBFA 2B3TB 2QJ3A 2DY1A 1S59A 1HR0F 3G8QA 2R7RA 4KHMA 4RJVA 1K9MT 1RQ0A 4N8OA 4USVA 4PPDA 1IJFB 2E29A 3AD9C 1U0HB 1REGX 3TVYA 4B3RF 3CVKA 3OHAA 4HT7A 4I2PA 2JEFA 3M8PA 3OR2A 4QYZK 2UUWA 4ITSA 4MKBA 2KG0A 4LBIA 1WJ9A 4E8UA 2MHNA 2CQCA 4DV0F 1F5CA 2EKYA 4I56A 3NEKA 3RAXA 2F65A 2MZJA 3D4JA 3T5LA 1NSQA 1RACB 2VFUA 1ZPWX 1TKZB 3KHRA 2ADBA 3CUNA 5C24B 1FDAA 2V8DA 1SC1B 4NRUA 4Q0BA 2KL8A 3JAMU 4CT8A 1NK0A 1X0FA 2EC0A 5D4OA 3HSGA 2YX7A 1ZAXA 1WNEA 2BQRA 1VQ5S 4C0BA 3SCKE 2KB2A 4ECVA 4B3MJ 4OI1A 4NLRA 2IVMA 1OPIA 1VDHA 1DY3A 3NS6A 2E5IA 3PDNA 4TU8A 1HBUA 1VLOA 3DXSX 2V34A 2Z58B 1M5HA 5B09A 2WOMA 4H4KA 5KFHA 4JYAF 3GIIA 2DH8A 1MMDA 3MEDB 3CIZA 4N5SA 3L4BC 3IA0A 3W2WA 3NGSA 3IBCB 3CJKB 5A0YB 3PX0A 2HZVA 1QJHA 1C4CA 3R7NB 1QUPA 5J1EB 5KFJA 2B4OA 1V9OA 2GVDB 1S6PB 3PRDA 1JXEA 5DETA 5DDRC 4C2MA 3KUGA 1V5VA 1TL4A 2F4VJ 1AZSB 1EIYB 2GVZB 2KFZA 2MQNA 1HL6A 2KRRA 4O0NA 2EK6A 3PIOQ 3G2XA 3IWXA 2AD9A 3R8YA 1S76D 2B7BB 5BR8F 2VC0A 3G8TA 2DEIA 2DGXA 1UKUA 2LU1A 1S0NA 4ZDNA 3CDWA 4NYOA 4I6YA 3TJAA 3TAPA 2M0GB 2MPUA 4PXDA 2LDYA 3W9JA 4WK3A 1E6YA 3ET6B 3NP5A 2UZAA 3N01A 3D0IE 5D0RA 5B0FA 1NH8A 4TVAB 4ZJOA 4YP3A 1F2GA 5IS2A 2W4DA 3IS9A 1RBOB 3FZBA 2PDAA 4FKXA 4ELVA 4NCGB 8ATCB 3C15A 3LPYA 5DRKA 1RKIA 5C2GA 1B0VA 3WC0A 1N6QA 2D7SA 4ZLJA 4YR2A 2V2VA 3I56S 4RW8A 4L73A 4G1QA 1VRTB 2HQFA 2QGFB 2Q6CA 1TVRB 2MSSA 2YPYA 2AYGA 4O4GA 1M1GA 2HS3A 2U2FA 1HARA 4A8FA 1TFWA 2NUUG 2Z57B 2BJ7A 3QRQA 1RHQB 1KC8T 2I5JB 4ILRA 4AL5A 2UU9J 1U0HA 2HW3A 3GB0A 1JNZB 2Z8QA 4K8RA 1O8BA 3K89A 3MPUB 4WE1B 1VFJA 2DNQA 4X4OA 3IBWA 2L08A 4LSLB 3AOBA 4UTGA 3QJLA 4DPUA 4ZKAA 4W98A 2V8HA 1S9GB 3EGWB 4HR2A 1F6TA 5JUMA 1XNQJ 5AXKA 2PT0A 2XS7A 2UP1A 2NYIA 1TKZA 3A1YG 4LREA 2MQ8A 1FX2A 1FCAA 3I31A 2VA3A 4NLGA 1G2EA 2AJ0A 3V5RA 2HSEB 4OHWA 2VU5A 2X3GA 4DX8H 1PO6A 4HVZA 2DGQA 1B64A 3KHGA 4FF4A 2ILZA 5GADU 3IRWP 3LQVA 3PW2A 1RLDA 4PPZA 1X9MA 1KVIA 4OI4A 2M3DA 3VZHA 3MEEB 5ETMA 1N36F 5IZHA 3P49B 2OPQB 2YH1A 3UN5A 1VK3A 4LF5F 4OMFG 3GLJA 2MMYA 3J81Y 2YKPA 4ENOA 1S99A 2R3VA 1X4GA 5DGAA 3MEDA 4XDDA 3QSIA 4O3QA 2YKOA 2PEBA 2H9ZA 3BR9A 4Y00A 3WIUA 3MEKA 3CJKA 5A0YA 3H42A 9RUBA 2XY6A 2P6SA 4PG8A 3K59A 5J1EA 2ADCA 2XLJA 4DBQA 2WVEA 2GVDA 1S6PA 4OX8A 4DUZJ 1P1LA 4I64A 3BQ2A 3KLFB 4UT4A 1U1LA 4GRSA 1GMUA 2UUBJ 2R8KA 1WEXA 4FDFA 1AZSA 2GVZA 2JHEA 3GP9A 1I5OB 3HX9A 1KTVA 5B7WA 2KG1A 4J9QA 3R97A 4NE9C 1UP1A 4IKAA 3HM9A 2DYAA 4WF9Q 3KOAA 4UY85 5HANA 3D9BA 3DI6B 3OUYA 1ZA1B 1CJTB 1YK9A 2XZDB 4QCLA 3Q8QB 4U8VA 1AROP 4DR4F 1WDDA 2VFVA 2W9BB 1AXQA 2HQ3A 3UDCA 3ILJA 1UFKA 2ZFHA 2UUCF 3T5HA 4ATNA 2BA9A 5B08A 3O6QA 1YVFA 4LR8A 2Y0BB 2RRAA 2QLJB 1VRTA 4NMXA 3RR7A 1TVRA 4X66F 4GMKA 4X4PA 2AGOA 4DPOA 3DCAA 4CNYA 1IKVB 1CQMA 5FIIA 3T6BA 1VCTA 2I5JA 4QR0A 1IKXB 2IYIA 2CRLA 1P1TA 2L48A 3HMJG 2G0JA 4ES2A 1T11A 1XTZA 1ELOA 3MCOA 3G6XA 1XK8A 5F8NA 4OL8A 1CJKB 5F3TA 2EK1A 1Y4ZB 1FJEB 2H5EA 3ZNJ1 3ZXWA 1NKCA 3FEXB 1JJHA 1S1VB 4NCBA 4KFBB 4AD6A 4LSLA 1N34F 1S9GA 4B9VA 1IR0A 1RABB 1TKXA 2OSRA 4RW9B 2B4UA 3PNIA 1VMBA 4L72B 4ZPAA 3RRHA 3GQCA 3DRRB 1QAYA 3A8IA 4CO1A 2HEKA 3I82A 4ZVQB 2DR9A 2VODA 5F0WA 3NCPA 2M8HA 4UZCA 4DV1J 2MDAA 2YY3A 4FXDA 1FRLA 1RT5B 3TX8A 4JI0J 1BY9A 2HQDA 1RAIB 4CQ1A 4DR2F 5KFCA 3MFHA 1B99A 5EWFA 3F56A 1JB0C 2HQGA 2ZBPA 1PSDA 1C0UB 2OPQA 3MPDA 1RYSA 4ZVRB 1X9SA 5C2CA 3MURP 3QGHA 4BWMA 2EFPA 4KIAA 2VFSA 1J5EJ 1M5KC 4YR0A 1P6TA 4DU8A 3FVYA 3P96A 3IR5B 4ZVOB 3TA2A 3W62A 1FJ7A 3GIRA 5KG6A 1FX4A 1KS2A 5I3UB 1SC3B 2AEJA 1R0AB 2ZHOA 1DFDA 2W2OP 4OI3A 3A8JA 4FPRA 3T41A 2B0GA 4C6AA 3KLFA 3L7OA 4PG7A 1XC9A 1DQAA 5HLFB 4PXCA 4HHJA 1E6VB 3T19A 1NNDA 4WFXA 1VQMS 3L3CA 2AJFE 3VAKA 4NLPA 1H74A 1T95A 1TMJA 1R0BG 4B02A 1KDNA 3CJ3A 4GC6A 2IA0A 1U8SA 1S49A 4IDKB 5GAEI 3Q0AA 3SCIE 3CJTA 4ECRA 3O5TB 4F8RA 2R2UA 1T9UA 2WHOA 3GG1A 1WC5A 2AHOB 3DI6A 4DMZA 1YJTA 2Z2MA 3OSNA 1CJTA 4RZRA 5D4PA 3I5CA 3MWBA 2B7CB 2BW2A 2W9BA 5CYJA 3C14B 2QA4S 2VQEF 3CJSA 1SXLA 3DU6A 2P9EA 2HMIB 1HQ2A 1RT1B 4BS2A 3CO9A 4LF8J 3NG8A 2V9KA 1FO1A 2P5VA 3C46A 2RNEA 1IKVA 1FKPB 2OELA 4I4BA 5IT4A 1S1XB 2UVRA 3GJRB 3RBZA 1IKXA 5DS7A 1MNEA 4UY8T 1IBMF 4CIOA 3TZWA 3Q24A 1J2VA 1FEHA 2GO8A 3EE3A 5KFTA 2CDRB 2JDJA 1CJKA 4M5IA 2WVDA 2CNLB 2K06A 1UAWA 4CLWA 1S1VA 4KFBA 4F4AA 4Y2MA 1IN0A 3TVZA 2OMLA 4WYWA 3UFCX 4ANDA 1RK8A 3TP2A 4RW9A 4HLBA 5CQGA 1U47A 4IFYB 3TUPA 3SYZA 1DAXA 2O3DA 1S0MA 2Y8YA 2RQKA 3M9MB 5M2RA 3DRRA 2EWHA 1T0TV 3CD7A 3EXCX 3HDSA 4KBIA 4CO0A 3V6DB 5HVFA 4DSLA 4DV6F 3VCDA 1RT5A 4MFBB 2JH3A 2YQ1A 1SQEA 3KLIB 5B0BA 1UWBB 2AYEA 2B9XA 4IH7A 2N7CA 4NA3A 2C42A 1N5TA 2V63A 2QA2A 2DIVA 1PJ5A 4OZ1A 5L38A 2K3KA 2W4CA 4FN5A 1NKEA 1C0UA 3S01A 1H98A 2EKNA 4HTIA 4ECQA 2FJEB 3ISZA 1TL1B 1XMQF 3AOAA 2PI4A 5L8RC 3KDNA 4HI2A 4QJVA 3FKBA 3OL6A 3AB4B 4ZOSA 4GO5X 1TV6B 5ETQA 4ED7A 2RILA 2G0CA 2VBWA 4OZ2A 3Q8PB 2X1AA 1WF1A 2GCFA 4OYMA 5I3UA 1R0AA 2ZEJA 3NWGA 2ZNYA 4K4TA 1V3SA 4DV5J 3O44A 2DNOA 3W64A 3QFHA 3RGIA 1S7HA 2J9CA 4P73A 4KE5A 3GJTB 3HO1A 4ZVEA 1VISA 5HLFA 3PTWA 4DX5A 3LA0A 3CW2C 1NAQA 3FMBA 5D0HA 5KFOA 1E6VA 1FWLA 4F4YA 3QT6A 3VHQA 3EDQB 5HAOA 1IWAA 3EVMA 2W7PA 3X3UA 3MTJA 3VGTA 1G1XA 3SCJE 4MKAA 4IDKA 3NAIA 4TXSA 3M7VA 2FVSA 1URRA 2FGOA 1Q8IA 4K4WA 1ZM2A 4RPFA 1NDCA 5EWGA 3W3SA 4UUXA 3KUHA 1YZ7A 3BGUA 3AXKA 3C14A 3IWNC 2DCUB 5AT1B 3AJ1A 2RS2A 1U8WA 4QPXA 1EX8A 2ATCB 2V8VA 2HMIA 3J7Z5 2F4VF 1RT1A 3D2WA 1FRXA 1QLNA 5CABA 4TY9A 2QMUB 1JK9B 4J9NA 2YPZA 4A8WA 5A8RB 2MHEA 5CA5A 1FKPA 1S1XA 3OV7A 2C3MA 2MGZA 4O3SA 1OY8A 1Y10A 2ERRA 1LWXA 1U25A 3KXDA 5CCLA 5CYMB 2Y1JA 3U1LA 5I3QA 2R2TA 3I55S 1ZBTA 1RWUA 2C2NA 3CSKA 3BDEA 2OLWA 3FGVA 3J7AN 4EO8A 1K73T 5LJ3Y 1Y5LB 5A2QU 4RNOA 2YKNB 2HFOA 2NXUA 3C16B 4OHYA 4RUHA 1FE4A 3SMZA 4J91A 4TN2A 1EKRA 2DNYA 2ZKTA 2KN4A 4IH5A 2JOQA 5JXSA 3ISND 1JLFA 2VPXB 2OD6A 4DR5F 2UVVA 2EC2A 2VBYA 3UDVA 2XMTA 3ILOA 4JV5J 5K14B 1AA1B 5H9FJ 1HNXF 2RUSA 3V6DA 3WC2A 3OVSA 4ZMMA 1RT4B 5HVGA 4MFBA 4NLOA 3HFVA 3ICLA 1UWBA 1DLOB 3PFOA 4GKJJ 1WTFA 3GE9A 2ACYA 4YHHJ 1UTAA 1Q16B 1LNQA 2W8LA 2FYXA 2N7YA 4C11A 1RXOB 3D68A 3KLGB 3W60A 4Y34A 3OFHA 1EKSA 4KGVB 1GFWB 2N3OA 2K7KA 1PYTA 4CO2A 1BC6A 2N3LA 1VQPS 3TA0A 4CO4A 1XNQF 4LF6F 2CJBA 2RU9A 3K7RA 3VWSA 5F8IA 5JVHQ 1P9YA 5HSPA 2BE7D 4C0OC 2Q79A 2XYGB 1BQXA 3PIPQ 2MZSA 2KYXA 5KG3A 4YB7A 1SVDA 1B3TA 3RB3A 5J2NB 3W61A 1HNWF 3E01B 3K5LA 5J2PB 2W9AA 3PW7A 4IR1A 2VASA 3H5YA 2P9CA 3SIPB 2VPZB 2IBOA 4BWJA 2EG1A 3CCZA 3J7YI 3T5KA 4A8KA 1YKWA 2DR7A 2DD8S 1DTTB 3GJSB 3ZZYA 2JVOA 4PR6A 4N76A 4X2BA 2XMKA 3PJXA 4OYBA 1TK5A 3GYNA 3IN5A 4LFBF 1NK7A 5FDLB 4PAAA 2V5HG 2OUGA 4AYBD 3BO4A 1UZHA 1OO0B 2JEIA 3UW1A 2E1RA 1LW0A 4ZVHA 4JV2A 4QR2A 4Z2XA 4RU2A 2G1DA 3HSZA 4DCJB 3HJFA 4DZDA 5KG1A 4XAKA 3J80Y 5EX0A 4ZCIA 2XSJA 2VICA 2HRTA 3CJ4A 2WSFC 3G6ES 2ILYA 1FRHA 3GFYA 5C7PA 2NCKL 4ELUA 5AJ3J 2IC3A 4F4XA 2GNKA 4ZIWA 4AT1B 2I6WA 1Q81T 1R6YA 2MKHA 2PA3A 4OI2A 5A8RA 5B0GA 3PVXA 4IG0B 1N5VA 1CSJA 2A0FB 4ZPDA 1NO8A 2HBRB 2KZZA 3CDBA 2Y1LB 2ZBRA 1UFLA 1KQKA 2W25A 2N4CA 4F26A 4K4ZA 2PMHA 5E7OB 4YB5A 4OYZA 3AOCA 5CYMA 3Q2SC 4EZ6A 3B78A 3FNNA 4DR7J 3CB4A 4CNZA 1V5IB 1FNMA 3PR5B 4A8MP 1I51B 3C16A 1CC7A 3EMTA 1L5UA 2I38A 2HZCA 1IM4A 1TUVA 3P8BB 2HHWA 1IR2A 4PQUB 4DSFA 1WELA 2R7WA 3AQOA 2P6TA 5HO4A 4YY3J 4LT6A 2IVFB 2HYIB 4WKRA 4Q7AA 3UNGC 4DSJA 1N0VC 5K14A 2DO0A 5T7LB 1YITS 3HF5A 1RT4A 5I42B 4JI4J 2FJWA 4WP8A 1DLOA 4I1TA 1IBKJ 3SQGB 3P6YC 3GV5B 5FLXU 3C6TB 1F9EB 3FEZA 4A8SA 4MYUA 4P2XA 3ENAA 3M8SA 4P10A 3QT5A 2M9KA 1KFSA 3EVOA 1RA7A 1J5OB 3GFXA 5IWAJ 1GH8A 2DNGA 3OVAA 3LANA 1OY6A 3CCUS 2EPIA 3MAQA 2VKRA 1RWKB 4JI5F 3EZ5A 2LA6A 3B8HA 3MR6A 1K1QA 5J2NA 5D15A 3E01A 3K58A 5LMUJ 5J2PA 1RTDB 5A6PA 1PAEX 4XPCA 1QSLA 1WC0A 1RAHB 1C2PA 1HQEB 2WSEC 1REVB 4Q8EA 1X7VA 1DTTA 2Q66A 2C2RA 3ZZUA 3VAIA 3IR6B 4E0DA 1HWUA 1T9XA 3QGIA 2HS4A 3P4UB 5FDLA 2CQPA 4WCEQ 1H2UX 3HVWA 4P9SA 4MKVA 3H2LA 2NXEA 3TZZA 2B43A 4KHPF 1WHVA 3OLBA 5LSRA 4JV1A 3D3CJ 1D1UA 1FRJA 1UEKA 4C8MA 1OSDA 1OYEA 3CTRA 2J0WA 1S5ZA 4USUA 4WFBQ 2R8HA 4LVNP 4OLPA 4BC9A 3T1HF 1ZZNA 2LKZA 2KDOA 2GQ2A 3HULA 2ZH9A 2K2PA 1HBOB 5KOWA 4OFZA 4PABA 1SJ4P 2HAFA 3LALA 1YJRA 3CCES 2VZ9A 3M2VB 2CQ1A 5M2UA 1M5SA 2RAQA 1UPPA 4CLYA 3D5MA 1BWEA 2HFZA 2V69A 2F8MA 5H9FK 5J1NA 4K4XA 1JLQA 3ZTOA 1OIAA 2W8KA 2E44A 1RAFB 1R8PA 2MY7A 5HJYA 2AIRB 4F3QA 4H54A 4IG0A 3HHLB 1NJIT 2HNYA 2XYHB 5L1JA 4P7VA 3JQJA 1IR1A 1U49A 3ZTRA 4LRCA 1U1QA 4NPOA 3JQKA 2LQBA 3DRSB 3FBCA 1HR0J 3K5NA 3CEDA 2X1GA 3TNVA 2XC9A 4USTA 4C97A 4F4WA 1YLXA 1WOOA 4ZP7A 2WBMA 4K0KF 1Q53A 5KG7A 4FS2A 4B3RJ 3LP0B 3RBXA 5HK4A 1I3OB 4OJ3A 3FQKA 3NWRA 4LF8F 4F04B 4PQUA 4RWWA 1JIHA 4F50A 2DRBA 4DL3A 2JWNA 3H4BA 2EFOA 2CPYA 2VJVA 2W7OA 4KHRA 2ALYB 3TAMB 3VVUA 2R7OA 4DV0J 1H6KX 4NWBA 4QIVA 5G0RA 7AT1B 2IJRA 4TU9A 3I96A 1KQFB 3D0HE 4M95A 3TR5A 4ELTA 2YWWA 1W7WA 2ZH1A 3SQGA 3C6TA 3F41A 4EWTA 1NJZA 3EDRB 3NMAA 1HD1A 4QWEA 2VC1A 4NLQA 4RUBA 5E3QA 1FKAF 1S57A 1VIXA 1J5OA 5E3CA 2FLPA 4B9SA 3RR8A 3N6NA 4OHXA 2DPJA 1YX2A 4DLGA 3V4MA 3J7A1 2HKEA 1WF0A 3T1AA 2KU7A 4DPXA 3DLGB 1RTDA 4DQRA 2JLEA 2VJUA 1HQEA 4KGMA 3D67A 1VRQC 5GAHI 1REVA 3BGFA 2RD5C 1NCLA 3TJ9A 2UXCJ 2DK2A 4AXIA 3CULA 3FUYA 1UWAA 3OFFA 3KK1B 2CVEA 1JX4A 1OWXA 4USHA 2FY1A 1FDNA 5L1KA 1QE1B 4RX6A 4X65F 1QVGR 4U8YA 2XNRA 6AT1B 5KFIA 2PFDA 2ZH8A 1NB7A 3HHLC 4YDXA 2OPSB 2XGQA 5F9NA 3HFZB 2CQ4A 3PO4A 2HWHA 4OQJA 5BR8J 1MW7A 1QSSA 3QATA 2VONA 2RQ4A 4DV5F 5E3AA 1GEHA 1HBOA 1S79A 1Y5IB 3M2VA 2XHCA 5CHCB 2AJ2A 2Z2YB 2C3OA 3JYTB 2W7AA 4CLLA 2XY5A 2QL9B 3Q83A 3W9HA 1W26A 2A3JA 4TNOA 1Q4RA 1BHNA 2R7XA 1QY7A 4UQGA 4F7VA 2BZ2A 2JL9A 4DR3F 2OPRB 2ZBCA 1WORA 3POTB 4V19J 1RI7A 4ALZA 3AA9A 2DITA 3NNAA 1KSPA 1YG0A 4DG1B 5LJ5Y 3MCSA 2K1RB 4PYDA 2DPIA 4N41A 3DLHA 3DRSA 3MR3A 2BQ3A 1PILA 1UA1A 2CQ3A 2FJVA 1DARA 1GAOA 1ZETA 3X1LB 1HD0A 2GMLA 3VALA 4Y6IA 2YWFA 4YEAA 3GTYX 3BO2A 1HYSB 2WW4A 2YXLA 4IQXA 3LP0A 1VQNS 4K7QA 1FTRA 4ICLB 1CC8A 2DRDA 2E1CA 2HVDA 4QBUA 4J9PA 2J8SA 3BSNA 2QYGA 1JJCB 2UV8A 4Y65A 4PG6A 2E9ZA 2PO4A 2HBZB 5KT3A 4DFKA 2VA2A 2G0IA 2V4QA 3AB2B 5KFKA 3R1LA 3WBZA 4DR1J 1N54B 2Z2LA 4KTQA 3DLKB 2QG9B 5IV4A 3A8KA 1OMSA 1PBAA 4LRAA 1NJWA 4V19X 3DOMB 3UO0A 2PSZA 2BABA 5ADZA 4USMA 1FRKA 2PN6A 4UUWA 4NLDA 4K50A 1VQ6S 4R0JA 1S6QB 1VQ7S 3SDEB 4PKDB 4M5MA 5A6WA 2YX1A 2CUYA 2W9CB 4DFJA 5MLCV 1GMWD 4HH1A 4FF3A 1T9YA 3G82B 2EFQA 1N48A 5EX3A 3PACA 5M2PA 1G6BA 1ZZFA 2DIUA 5F8LA 4HH0A 2HFNA 4Y2CA 4I0WA 2ZVIA 4JV5F 5DM7Q 4LF5J 3M6XA 4XPEA 4NCAA 3DLGA 1VBKA 2MLYA 1FERA 2RH3A 4O3PA 1WKKA 1YJNS 1ULRA 2XNQA 2JNJA 2CJQA 1Q79A 4GKJF 5HI7A 4EO6A 2GAHC 2A2CA 2RDJA 4XIUA 3OHBA 1YJWS 4S0MA 2KT3A 4L76A 2Q43A 2MQOA 1HKAA 4K4UA 4KT0C 5KFMA 4MKYA 1NKBA 2BM0A 1SJ3P 1KHVA 1QE1A 3UVJB 2B8QA 3LF0A 2H4YB 4NZ6A 3UN2A 3QJPA 5K9FA 2VBZA 3EGNA 3VGUA 4CI0B 2OSQA 3UQSA 2ZH7A 4ZHRB 1YRXA 1SKUB 2J0XA 4DL5A 1KP6A 1OYDA 1RP5A 5H1SV 2XB2D 2OPSA 1FHTA 1X4AA 2IBKA 2WK4A 5IT9Y 2ZOMA 3OBIA 4I2QA 2JSXA 2PGCA 2R42A 4RUAA 1NPRA 4NYZA 1EB0A 3EGVA 2FC8A 2OPPB 5HATA 1HWJA 1K47A 3GR1A 3BQ1A 3GFZA 1RTZA 3VAGA 1QD1A 4DR4J 1RTIA 5FD1A 3ENQA 3ZZPA 3B6BA 1WC4A 2Z0GA 3AT1B 3T6JA 1BE4A 2XM3A 1RBLA 5CXTA 3POTA 3NOGA 2CQBA 4DG1A 3OXFA 1NEEA 2DY9A 3FC9A 2ZH4A 2K1RA 3P45B 4XTTA 2HVHA 2VHGA 1FWKA 3M8ZA 4DLEA 2DKOB 3CJ0A 4DL7A 2F40A 1B70B 5KFSA 1NPPA 2OTLS 1HYSA 3ULHA 3LTOA 2DEJA 3M8WA 4ZCLA 4QU7A 4ICLA 3GILA 4O3RA 4OYWA 4J9OA 5D4LA 2PI5A 2R7SA 4C8ZA 4F3OA 3HPOA 2DGWA 2QL7B 1B7YB 2E5JA 1N34J 1SC6A 2H54B 1RU1A 1KRPA 4NEYA 4DZ6A 3DDNA 5IT9U 3MDFA 4DS5A 1SJ1A 1VR6A 1TU0B 3DLKA 4F2RA 3DOMA 1L3VA 1AFIA 4CH0S 2VKZG 1Q5VA 1NXIA 2ASDA 1S6QA 3R1HA 1VI7A 3SDEA 4C7QA 1LV5A 4CH1A 1FRMA 3KMQA 4UW2A 3OQ2A 3KJNB 1JLGB 2W9CA 4ID5B 2E5LJ 1CPZA 4LF2A 4C98A 2ACMA 3B4MA 3H25A 4DR2J 3K5OA 1NSAA 4OHZA 4M5LA 2VQFJ 3P5TL 1AYEA 4A8OA 3KJQB 1KONA 4YY3F 1QVFR 2HGNA 1SPBP 4GVLA 2QLWA 2XSFA 2ATLA 2ZHBA 4RW7B 3CJ2A 2G13A 5DG8A 2C3UA 5KT7A 2HIQA 4RBTA 3TWZA 1DJ0A 4IG3B 4DV7J 1VQKS 1Y5NB 3M9NB 1LFWA 4U67Q 3FBBA 5SUHA 4URQU 3SSSA 1G4CA 4OX7A 4U95A 2LFVA 1U09A 3LAKA 2QIFA 5H9EJ 2CG8A 1SI9A 5IWAF 3D28A 3UR0A 3BJYA 2JX2A 4CRJA 5IC4B 1NZAA 3FBEA 3UVJA 3AD8C 4MH8A 2A2DA 2IRUA 8AT1B 3DLEB 4DJBA 2F3JA 4ZHRA 3JB9k 2EXUA 4DF4A 2R2RA 2CPJA 3W1YC 4LSNB 2Q1LA 4QZVB 1RAOA 2UVUA 2HHSA 1VC6A 1RU2A 1VRUA 1W2IA 4NZ0A 1RWXB 3HHDA 3L7UA 3DFEA 3BBCA 4KO0B 3QT7A 1O5JA 5K20B 3MMBB 1ZM4A 4OI0A 3JSBA 3HD1A 5GMKa 2OPPA 4NLYA 2GMJA 2V94A 5HBMA 5RUBA 2ZH3A 1FXLA 2XHWA 3W2VA 5KG4A 4ED3A 1NRKA 4JI8J 3PEHA 1Y9OA 4TYBA 1QUVA 5KFFA 2NYHA 2VQEJ 4E2FB 3QWPA 3E2EA 2GJ2A 2HWTA 1R7IA 4X4VA 3S7RA 4LFCJ 1H72C 4LMZA 5ETOA 1GX6A 4OJ1A 5HQMA 2MEWA 5CD4H 4AQYJ 3MD3A 2KVQE 3NNCA 4FPIA 1KN6A 4DI6A 4WZQA 2KYZA 4C3MA 2BOPA 4J9RA 3MPYA 4JI1F 2Y1RI 4BDPA 3WZ0A 2LXFA 2DXFA 4NA2A 4TYAA 1OY9A 2MZTA 2IHR1 3PX6A 1YJ7A 4PRFA 1VOMA 3Q8UA 2HHVA 5EDWA 1LXNA 2M4MA 4G1PA 4ER8A 3PZPA 1WOSA 4DV4J 2C2ZB 3EJMA 1HI8A 4Y0FA 1VQOS 2MQMA 2CPDA 4CO5A 3A13A 1ZM3A 4RKUC 3IGNA 3TO8A 2IA6A 1WSVA 1S1TB 3K17A 1NH7A 1U2RA 3M1VB 4ED4A 4DV6J 2XS5A 5D4NA 1WKLA 1JLGA 4KSEB 4ID5A 3C6UB 4IH6A 4ECXA 4CYUB 2RMLA 3GWCA 1NLKL 4MK7A 1RCXB 2J6TA 4C3LA 1SKSA 3O2IA 2MKSA 2KRBA 3PYDA 3CJQA 2D3OR 4P72A 1FK9B 4A8YA 1FWPA 3C3LA 4RW7A 2X3DA 2KVIA 2OP5A 1F2HA 1WG4A 2FLLA 2FZCB 1XMQJ 2AGPA 3D6FB 4IG3A 2XY7A 2DNKA 2GIQA 4H4KC 5ETPA 3NS7B 2KFNA 4B17A 4CLKA 3BZQA 5B0CA 2D3O1 2FHKA 4JI6F 2ZC4A 2J0QD 2HHUA 1L3KA 4KRWA 1NK4A 2BJ1A 3MM6B 1SV5A 4LF7J 2MKCA 4UOFA 2NREA 1FTCA 1FJGJ 3HSDA 3DLEA 4L3NA 4C0HA 4HI1A 4M8LA 2M52A 4C3KA 1HBMB 3PHEA 3O3LA 4LSNA 3QGGA 4NEZA 3HLUA 1S7IA 1SIZA 2XQCA 1T8EA 4KO0A 2HFVA 4NRTA 1D8ZA 4TQRA 1SQFA 2FTRA 2EBGA 3MMBA 3MECB 1VQYA 3EPGA 2V2KA 1T3OA 4MK9A 1YTYA 3VTIA 4R8UB 2ZITA 3NBPB 2UXCF 4LFAJ 3TZYA 2X7IA 2L9NA 4WBFA 4MIWA 1Y7PA 2H65B 4DPWA 1RHKB 1WACA 3GV8B 4DL6A 3LP1A 4CWBA 3FSIA 3CJ5A 1LW2B 4FYDA 5D8HB 2PIIA 3D1OA 1N8RT 1MN9A 4A8QA 1R27B 4N77A 3NGTA 1UJ4A 2CPZA 3MAAA 4QIEA 3CCWA 2W2QP 3L9ZA 3N6MA 4DN9A 1UMJA 5KG0A 4C4WA 3M8QB 3FCHA 1HW8A 1UVKA 1BGXT 2VOPA 4CLSA 1IKWB 1T05B 1GMVA 3G6VA 2H5JB 2AEMA 4NLSA 4BCAA 2HVZA 5L39A 1NHUA 1KD1T 1R8CA 2CPHA 1B7FA 3OUYB 2EFNA 2O01C 2Z56B 1JXVA 4OJGA 2DR5A 4WK1A 4R0EA 1X4EA 5L1IA 1YJVA 1YRUA 1Q8BA 2PA8D 3RW6A 2HNDB 4MT1A 3TAQA 2XO6A 5IFMA 3KLEB 2JEGA 1HBNB 3CDUA 5U47A 3DKDA 4OV6A 2SXLA 1QSYA 2NS1B 2XULA 4WJBA 4QWCA 3KHLA 5T14A 3HP6A 1S1UB 2VBXA 3CCLS 3U02A 4J9SA 2HVIA 4DR5J 3TI0A 2WONB 2U1AA 4KV8B 3QO9B 1HNXJ 3C2PA 3WX4A 1S1TA 2HFSA 4USJC 4C9DA 3M1VA 4EYHB 2E7XA 2B4PA 4X84A 4HKQA 3AY0A 1RWNB 2YQ0A 2J9DA 3PV8A 3C6UA 2DHGA 4CYUA 5GADI 2BUNA 3DDIA 4O3NA 1P27B 4GC7A 1JJ4A 2M2BA 4WFZA 4ZP8A 2KM8B 1FK9A 2HBYB 1FT8A 3O1LA 1TKXB 3K8VA 4LF6J 1OPZA 4ZIVA 3KG1A 4DR1F 3PJ9A 4PWUA 2H5IB 3MM7B 3EYZA 3KLVA 5AE1A 1UCNA 4KYZA 2IRXA 4JP8A 2KO1A 4DL4A 2GJFA 2ROGA 2EVZA 2Y8WA 1TAQA 3U1MA 2W2MP 4WFAQ 4PEOA 1HNWJ 4UOCA 3DHXA 1UVNA 3S6EA 3OVBA 2JFKA 5D0GA 2CJYB 2LQ9A 1SH3A 1RT2B 3UDLA 1U02A 1X4FA 5F0UA 2FVQA 1XJWB 3MM6A 3RB0A 1TZ0A 1NDLA 3DMJB 5J2MA 2VPYB 1S0OA 1U1NA 5LT5A 5IM0B 4LJMA 4M94A 4LFBJ 1HBMA 4J37A 3N6LA 2ZUGA 1XR7A 3ZO7A 4EI2A 1YQHA 2MQPA 3P5BP 4RBVA 2CZ9A 3N0VA 4DSEA 4M1KA 3MECA 2OEJA 4USKA 3TUZC 3PW5A 2QLFB 4R8UA 1P9QC 3W8PA 3IAM9 3NBPA 4IO1A 2WTFA 1RHMB 2R8GA 4EZ9A 3W63A 2R8JA 4ES1A 3CXCR 4IUFA 1ZYQA 3H0PA 4EBEA 1LW2A 1U1PA 3V4IB 1NSPA 2VV5A 4IOAQ 4O23A 5CYQB 3H8YA 1X4HA 2IM2A 4PXBA 1R0CB 4HL9A 3M8QA 2GQCA 3IBFB 4JI7F 3PM9A 1CEZA 4C8YA 1S12A 2DR6A 5HMZA 1SJFA 5DO2A 1IKWA 3G4SS 3ENVA 3GFHA 3PJWA 4JUZA 2DNZA 1T05A 2W1BA 2Z30B 3OD2A 4FZVA 2XG8A 4DV3F 2MKYA 3TEGA 1CJVB 2M5YA 1N52B 1Y3JA 4ZVTB 1TMMA 1ZS6A 2HHPA 4CM2A 2G2ZA 3OJUA 5CCMA 2VDIA 4I67A 2A1BA 2HNDA 3BS9A 4OZLA 4QIGA 4FNHA 3NNHA 2DISA 3I9V9 2LDIA 3R7BB 2WVCA 3KLEA 2KM8C 1HBNA 1PJ6A 2C1EB 3J81U 1G3OA 3WDOA 1IUJA 2WSCC 3OXGA 5MAOA 3DN9A 2BJ3A 2V8PA 3KWMA 3CE8A 3NCQA 1S1UA 4WIQA 3FCVA 2WONA 3QPIA 2PD1A 4KV8A 3QO9A 2YNFB 4WFYA 1VBZA 1C1BA 4J9VA 2RRNA 4WU2A 2XMMA 3JSMB 1Z2ZA 1O0PA 1IM6A 5I3PA 3TOQA 1URNA 3KK3B 2CKWA 4MTPA 1X60A 2E1PA 5AE2A 5B0EA 2HQCA 2DNRA 3CCVS 2FZGB 3RRKA 3VAJA 3BYRA 2WVBA 4Z7CA 1S1WB 6FD1A 4P6QA 2IAJB 2LEAA 3CJ8A 2ZH2A 5IQ6A 5D6GA 1H3DA 5L9NA 4ED8A 3V6JA 1NZ8A 3IG1A 3MM7A 4EU0A 2NR0A 4IOCQ 2XMUA 4X4NA 4JI5J 2RRBA 3MF5A 2Q6BA 4DQPA 3G9CA 2YNGA 4PWWA 2V68A 4B9TA 1NDPA 3G87A 2CYYA 1RT2A 2E5LF 1UVLA 2KTQA 1LXJA 3ELHA 4OHVA 2VQFF 3MMAA 2XZTB 4HEA9 5CH7B 3KFWX 3DMJA 3M2RB 2D3UA 2C3PA 1SKRA 4OYXA 1M1HA 5IM0A 1PYOB 3QAUA 1WI8A 1QTMA 5KFPA 2P2CB 2FHJD 2HRYA 4ZPVR 4DUYF 1WC3A 4HDGA 4DV7F 4KHPJ 2ZZNA 4J9LA 3QZ7A 4AFFA 2CJXB 2D9PA 2IRYA 5KFUA 2RQCA 2FLNA 1SQGA 2HK3A 2XO7A 1FRIA 3ONQA 3AAWB 5LXYA 4RNNA 3T1HJ 2MB0B 3US5A 1UL3A 3TX0A 3NCRA 3V4IA 2GW8A
chains in the Genus database with same CATH topology
4MAKA 4QWEA 4LF9F 1SB6A 1AFJA 2LXIA 1E6YA 2D41A 4JV0A 2AJ4A 2VC1A 4IYQA 4NLQA 3NP5A 1NJYA 2UZAA 5E3QA 1FKAF 1FXRA 3N01A 3D0IE 5CYQA 1VIXA 3EUNA 1J5OA 5E3CA 5B0FA 1IKYA 1NH8A 3CCRS 1K0TA 4Y3CA 5I4MA 4FF1A 2FLPA 4PXEA 3RYLA 4YP3A 1X5TA 4B9SA 4DFPA 1F2GA 2OAUA 5IS2A 3RR8A 2W4DA 3IS9A 3FZBA 2PDAA 3N6NA 4OHXA 2DPJA 2J6SA 1T7PA 1R31A 3H20A 4NCGB 4ELVA 4F67A 4DLGA 4YFUA 3LPYA 4NXNF 5DRKA 1RKIA 1B0VA 5KFLA 3U7JA 3WC0A 1N6QA 2D7SA 3V4MA 5EWEA 4YR2A 3J7A1 4H4OA 1D3WA 4YOEA 3I56S 1WF0A 4RW8A 4N56A 3T1AA 5EN1A 4G1QA 3UI3A 2GO9A 1VRTB 5HP1B 2KU7A 3HT3A 4LQ3A 4FBTA 3DLGB 1RTDA 2Q6CA 2AJQA 1TVRB 2MSSA 3UCZP 2XBPA 2AYGA 5KFVA 4DQRA 4O4GA 2HS3A 2JLEA 2U2FA 2KT2A 3MMCA 1HARA 4EYIB 1HQEA 4KGMA 3GYXB 4A8FA 1TFWA 2YTCA 2NUUG 5GAHI 1X0PA 4JI8F 1WEYA 1REVA 1KC8T 2I5JB 4ILRA 2PEHA 3BGFA 3H4DA 1S9EB 2RD5C 2R7UA 3J7YU 4AL5A 2RVJA 4USIA 2UXBF 2LQ5A 2VFRA 2DK2A 3T1YF 4AXIA 2RKIB 4AUKA 3M6UA 3CULA 2AYBA 3MOJB 2VPWB 1P8GA 3OFFA 2HW3A 3KK1B 1H2TZ 3GB0A 2RT3A 1W2BR 1JNZB 2CVEA 2Z8QA 1TQLA 1JX4A 1OWXA 1SL0A 3GIJA 5IT0A 4LFCF 2G4BA 1O8BA 4USHA 2FY1A 3LW5C 2KZMA 4DUZF 1BQNA 4WE1B 1FDNA 1S6OA 1VFJA 4DWIA 2DNQA 4X4OA 5L1KA 3UD4P 3IBWA 1QE1B 2E5GA 4AQYF 2L08A 1VLYA 2VUGA 4RX6A 5FLXY 2MZQA 3Q23A 2L3MA 4NYPA 4X65F 2COLA 1QVGR 4LSLB 2W24A 5KFGA 4Q8FA 3CCJS 2XNRA 1VHFA 3RZAA 1VQ5S 2QRRA 3QJLA 5DLGA 3CCMS 3MAHA 5K8MA 2UUBF 4ZKAA 5KFIA 2V8HA 1JLEB 1S9GB 2UVWA 2A10A 3EGWB 1X4BA 2YWEA 1VK8A 1X4CA 2ZH8A 2CIMA 3HHLC 4G6VB 1NB7A 5JUMA 3MI7X 4YDXA 2ALZA 5AXKA 2PT0A 2MGZB 2YNFA 2XS7A 2OPSB 2UP1A 1XMBA 2XGQA 2NYIA 1TKZA 3A1YG 2DR8A 3JSMA 5F9NA 2CQ4A 4PG5A 3PO4A 2HWHA 4B3TF 4OQJA 2NLWA 3ZC4A 3BSOA 1MW7A 1QSSA 3UR3C 3SEOA 1FCAA 3I31A 2VA3A 4A47A 4NLGA 2AJ0A 1G2EA 3OTCA 3V5RA 3KK3A 3RB4A 4OHWA 2VONA 2ZZMA 1FD2A 2RQ4A 2X3GA 4DV5F 1Q8LA 1YJ9S 5E3AA 1HBOA 3OTDA 1R8AA 2EW9A 3H5SA 4DX8H 1SV5B 1PO6A 4HVZA 1S79A 1Y5IB 2DGQA 3M2VA 2FVRA 1K1SA 2B5JA 4QOTA 4Z37A 3UCUP 1B64A 3FEYB 4A8XA 3KHGA 4FF4A 2ILZA 5GADU 2FJXA 3IRWP 3LQVA 1QAJA 3PW2A 5CHCB 5HL7Q 2FGCA 4QW8A 1F5BA 4PPZA 2WCXA 3OL9A 2C3OA 3BO3A 3FMWA 3JYTB 1X9MA 1S1WA 2RUGA 2W7AA 1S10A 1FF2A 2C22A 2IAJA 1Y0HA 2XY5A 3R5DA 1KVIA 4OI4A 4DV4F 4NX9A 3CGIA 2DH9A 2M3DA 1NU4A 1Q7YT 4MIAA 4F3MA 5GAGU 2A3JA 3VZHA 4KQZA 4M5DB 1MMLA 3MEEB 4TNOA 5A8WA 4WZMA 1Q4RA 2R7XA 1QY7A 1FD8A 1N36F 5IZHA 4KKOB 4UQGA 5D3GB 1JLAA 6FDRA 3P49B 2OPQB 3THTA 2YKNA 2YH1A 1JLFB 3J7ZT 2XS2A 4W90B 1VK3A 4B3OA 4Y28C 2BZ2A 2JL9A 4WKYA 3B82A 4I6AA 4DR3F 2OPRB 2NREA 3FSYA 2ZBCA 1FNXH 4LF5F 2XLIA 4OMFG 2DNLA 3NGDA 2MMYA 3POTB 2KH9A 1N56A 1DRZA 4V19J 4CO3A 3J81Y 5K8NA 2RQMA 3K0JA 3CPWR 3V81B 4RNHA 1RI7A 2YKPA 4Y2IA 4ALZA 1S99A 2IJNA 2DITA 2K3IA 3AA9A 4X4TA 1KSPA 3NNAA 1YG0A 4DG1B 1X4GA 5LJ5Y 5DGBA 2O1PA 5DGAA 3MCSA 3MEDA 2K1RB 4XDDA 2DPIA 3M30A 3LP1B 5G4DA 4EUVA 3DLHA 4N41A 4O3QA 3DRSA 3OJSA 2YNHA 1ZM9A 3MR3A 2YKOA 4FVCA 2BQ3A 1PILA 2CG4A 3GV7B 4C11B 1UA1A 2ZVSA 2CQ3A 4NMLA 4J9KA 2FJVA 1DARA 1GAOA 1ZETA 2IYGA 3X1LB 2H9ZA 3DHWC 3BR9A 4Y00A 3MEKA 2FJAB 3HVTB 3CJKA 3M2RA 5A0YA 4K5RA 3MR2A 1HD0A 2GMLA 2IMOA 1VJWA 3VALA 2XY6A 4Y6IA 2P6SA 2YWFA 4YEAA 3BO2A 1HYSB 2FVCA 4IQXA 3DOLA 2CPEA 3MD1A 4PG8A 2HG4A 2DCLA 3I5BA 3LP0A 2YQ3A 5J1EA 3K59A 2ADCA 1H38A 1VQNS 2XLJA 3ISNC 1FTRA 4ICLB 4DBQA 1SKWA 1CC8A 1C1CA 3C8YA 2E1CA 2RIJA 4U9RA 1S6PA 4OX8A 5KT6A 4ILMA 1P1LA 3KK2A 4I64A 2EI5A 2YWHA 4QBUA 3KLGA 4J9PA 1HNVB 3BQ2A 1VC0A 3KLFB 2QA1A 3BSNA 1U48A 1U1LA 2J7KA 2UV8A 4Y65A 4KPYA 1UW4A 4PG6A 2E9ZA 2PO4A 3E3XA 3QYYA 3HHEA 2LXUA 5KT3A 1UETA 2WRMA 3JAMY 4DFKA 4EBCA 1WEXA 2VA2A 2R8KA 3MXHP 3KTQA 4Y2KA 2V4QA 1SL2A 3AB2B 5KFKA 3R1LA 7FD1A 3KLHB 3T5JA 1HHSA 2JHEA 5HN0A 3QLHA 3WBZA 2VG5A 2KJWA 1HWLA 1N54B 4X62F 2Z2LA 4AL6A 3HX9A 1KTVA 4KTQA 3DLKB 1X5OA 1NJWA 4V19X 5B7WA 4XO0A 2I8EA 2PSZA 1GTHA 2KG1A 1I6JA 2BABA 4J9QA 2OMOA 3CMAS 3M6VA 5ADZA 1FE0A 3OW2R 4YDDB 1FRKA 2PN6A 1UP1A 4IKAA 1M90T 2GX8A 3HM9A 4UUWA 1TK0A 3QJJA 4NLDA 4R5PB 4K50A 1VQ6S 4R0JA 4WF9Q 1S6QB 3KOAA 3R5BA 1NK8A 2PC6A 4DV1F 4UY85 4LF7F 4NLXA 1VQ7S 2XWXA 3SDEB 4PKDB 1SIWB 4JI0F 5A6WA 1X4DA 1FJGF 2YX1A 4NLVA 5F8JA 1KOHA 1W25A 2W9CB 4DFJA 3DI6B 1YRTA 3OUYA 5MLCV 2QMXA 1KQSR 2KXHA 4HH1A 4ZVFA 2FDNA 4FF3A 3E8OA 4QCLA 3Q8QB 1GNKA 3FJ2A 2XLKA 3L7PA 4PWDB 1AROP 2EFQA 1N48A 4DR4F 5EX3A 2VFVA 4RUCA 3TUIC 2W9BB 1AXQA 2HQ3A 1NHVA 2NZ4A 3UDCA 4C8OA 5KG2A 2ZFHA 2UV8G 4DHVA 2UUCF 2CJKA 2ASYA 5LL6d 3PACA 1R43A 3T5HA 3DYAA 4ATNA 2BA9A 5M2PA 2Q3PA 1G6BA 2DBBA 1ZZFA 5B08A 2DIUA 2XMJA 5F8LA 3O6QA 1YVFA 1LW0B 1U6FA 4HH0A 1KVJA 2HFNA 4Y2CA 4X64F 4I0WA 4JV5F 2AU0A 3D54A 4O3OA 1DQ8A 2DO4A 5DM7Q 2RRAA 3DRPB 3M6XA 2X51A 1VRTA 2ZOFA 3E51A 4XPEA 5HP1A 1LOUA 4W92B 4QIWD 4NCAA 3DLGA 4OJHA 3RR7A 1TVRA 4X66F 4LFAF 4ED0A 2XSJB 1D9AA 2QE5A 4GMKA 3TYTA 4X4PA 2AGOA 1FERA 1J5EF 2RH3A 3R5CA 4O3PA 4DPOA 3DCAA 1XNQF 3H5UA 1HI1A 1YJNS 2RF2B 3TW0A 1ULRA 2XNQA 4CNYA 2CJQA 1Q79A 1IKVB 1F0XA 3CD0A 4GKJF 5HI7A 3QGPA 1CQMA 4KJIA 3JTNA 5FIIA 3T6BA 3AA8A 4EO6A 3VQSA 2I5JA 4QR0A 1IKXB 2IYIA 3W7BA 2CRLA 1P1TA 1S9EA 2A2CA 2L48A 2LEPA 2IC3B 3Q22A 3HMJG 1U1KA 4ES2A 2W4PA 2RDJA 3LGMA 1XTZA 3RTVA 1S0VA 5E3RA 4XIUA 3OHBA 2RKIA 1YJWS 1RT3B 1V3RA 2HLUA 4L6V3 4MJKA 2KT3A 1RTJB 1CLFA 2Q43A 1ELOA 2MQOA 2AWZA 4IQMA 3G6XA 3BSAA 1XK8A 5F8NA 1Z4UA 2J9EA 5DJBA 4K4UA 4OL8A 4KT0C 1X8DA 2F8HA 3CIMA 5F3TA 5KFMA 2JRSA 4MKYA 2EK1A 5AXMA 5L9XA 1Y4ZB 2J7WA 1NKBA 1WG5A 2BM0A 5F9LA 1SJ3P 1FJEB 3LP2B 2H5EA 3GIKA 1K8AT 1KHVA 1NKCA 3ZZTA 1QE1A 3FEXB 1JJHA 1S1VB 3LF0A 2R2SA 4NCBA 4KFBB 2GV1A 4NZ6A 3PY8A 3QJPA 3NRBA 2IFXA 4LSLA 2QLXA 4ZPBA 5K9FA 2L9DA 2VBZA 5LSLA 4WXWA 3EGNA 1N34F 2F8EX 4CI0B 1JLEA 2IM3A 1S6UA 1S9GA 1HFEL 1IR0A 2OSQA 3UQSA 4O4RA 4B9VA 2ZH7A 4ZHRB 1YRXA 1TKXA 2J0XA 2OSRA 4RW9B 4DL5A 5E3PA 2LQJA 1SUQB 2B4UA 1WD6A 1RP5A 3PNIA 5H1SV 2XB2D 3ZZOA 1VMBA 2OPSA 1FHTA 4L72B 1T03B 2L9WA 1U6ZA 1X4AA 4ZPAA 3PO5A 2IBKA 3MR5A 3RRHA 4YR3A 1HPZB 4ZCKA 3CCQS 1ZOTA 3GQCA 2WK4A 2ZDPA 3HK2A 5IT9Y 3UD3P 3AHPA 5F41A 2ZOMA 3HZGA 3H40A 1WF2A 2ZKUA 3OBIA 2JSXA 4I2QA 3DRRB 2PGCA 4QW9A 3GIMA 1QAYA 1Z2LA 3CD5A 4Q2LA 4CO1A 3GR0A 7FDRA 1SBRA 3D0GE 3I82A 1Q7LB 2DR9A 1KLMB 2VODA 5F0WA 3NCPA 2MZ1A 2M8HA 4RUAA 4NYZA 3BN7A 5D78A 2GGPB 2MDAA 2FC8A 2OPPB 3LOUA 5J2QB 4LQ9A 2YY3A 4F2SA 4FXDA 3CMES 1AUDA 1HWJA 1FRLA 1RT5B 3TX8A 1V6HA 2WAQD 1BY9A 5J2MB 2EFGA 4MMOA 3Q8RB 3R27A 3GR1A 3BQ1A 3GFZA 4WIIA 4CQ1A 4QWDA 4DR2F 3VAGA 3I6PA 1UEUA 1JJ2R 4TLRA 5KFCA 2MZRA 3MFHA 3CC7S 2E9RX 1RTIA 2ZM6F 2LEBA 3NL0A 1KTQA 5FD1A 3ENQA 5EWFA 3ZZPA 1APSA 1R89A 3M6WA 3F56A 1JB0C 4ZS6A 4M5DA 1TL5A 1UJ5A 2HGMA 1PSDA 4KKOA 5D3GA 2ZOGA 1UJ6A 1C0UB 2GHWA 2OPQA 1RYSA 2Z0GA 3DM2B 4C8LA 3SZ2A 4CTAB 2GC8A 2DHXA 1DTQA 4DEZA 1X9SA 3T6JA 1SH0A 4ECTA 2CZ4A 5KFXA 1X9WA 1XR5A 4KGKA 3MURP 2X1BA 1IBLF 5CXTA 3QGHA 2CDQA 3BGRB 3LGNA 2DB1A 3POTA 4BWMA 2CQBA 3V81A 1D9FA 3RAQA 2EFPA 4ZCMA 2OKQA 3M05A 4KIAA 2QSFA 3V2UC 2VFSA 4DG1A 3OXFA 1NEEA 2ZH4A 1M5KC 2K1RA 4YR0A 1P6TA 4RW4B 2CZVC 3FVYA 1YSJA 3P96A 2HVHA 3IR5B 1FDBA 3VF0B 1MU2B 3PKMA 4DLEA 2MKJA 2B51A 1EP4B 5T7LA 3MTKA 3CJ0A 3TA2A 4DL7A 4ED6A 2F40A 4EFAC