4A47A

Crosstalk between cu(i) and zn(ii) homeostasis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
63
structure length
63
Chain Sequence
b'TIQLTVPTMDCTSCAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSR2857 PROTEIN
publication title Investigating the Role of Zinc and Copper Binding Motifs of Trafficking Sites in the Cyanobacterium Synechocystis Pcc 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Transport protein
total genus 18
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4a47A00
1URRA 1S6UA 2FTRA 2LQ9A 3QGPA 4HH1A 1CC7A 4HH0A 1FD8A 1TR0A 2KT2A 3VTIA 2XMVA 3MZIA 1SI9A 1OQ3A 1Y0HA 2ACYA 2ZDPA 5K9FA 2N4DA 2K2PA 5B08A 2Q3PA 1N5SA 1W2IA 1AFJA 2W4PA 1FEEA 2LQBA 2QYCA 4YDXA 1CPZA 3MCSA 1FVSA 1Y3KA 2XMUA 2ZDOA 3HHLC 1MWYA 3LGNA 2QLWA 3GZ7A 3QMQA 3BGUA 1U7LA 2ROPA 2AJ1A 3KG0A 3WDOA 5A6PA 1MWZA 1Y3JA 2XMKA 4OIXA 1TL4A 3LGMA 4HI1A 4Y2KA 1KQKA 1GXTA 1IUJA 2G9OA 5F0UA 2N7YA 3E8OA 4U9RA 2LXFA 3HHLB 2N4CA 1TL5A 3BM7A 2L3MA 4FNHA 2VV5A 2GCFA 1P8GA 5B0EA 1JWWA 2GA7A 2XMWA 4HL9A 1YJTA 1OPZA 2RSQA 1X8DA 5B0FA 3LO3A 1FE4A 2W4DA 5B0CA 1SB6A 3IWLA 1KVJA 2EW9A 3HFKA 4FNIA 4DPOA 2K7KA 3HF5A 2CRLA 2OAUA 3DCAA 3F44A 4ZOSA 1XBWA 3BB5A 1X0PA 1YRXA 3TRGA 2HFNA 2RILA 2AP6A 2GO8A 3CJKB 1QUPA 5B0BA 3BR8A 1APSA 1OQ6A 2BYCA 1X7VA 2OD4A 5A6WA 4F67A 1RJJA 4A47A 1KVIA 1OSDA 2QLXA 2HFOA 1N5QA 1LQ9A 2JDJA 2W4CA 3FMBA 3HHLD 3KKFA 4NPOA 5KAKA 3TNVA 1FESA 2BJDA 2ROGA 4Y2IA 2XMMA 4HI2A 4A48A 4EFAC 2BBEA 2HIQA 3BN7A 4DL0C 1Q53A 3IWXA 5T7LB 2OP5A 2K1RB 2GGPB 1Q8BA 5B0GA 2IYGA 2HQIA 2K7JA 1YG0A 1YJUA 2AW0A 3HHLA 3I9ZA 1YJRA 3BDEA 2OKQA 2VH7A 3HX9A 3FGVA 2FIUA 4NL5A 2OFHX 1Q8LA 1TZ0A 2XMTA 3BF4A 4Q2MA 2FHMA 2PGCA 3DXSX 3TOQA 3KNGA 1AFIA 5IXUA 2OMOA 2KKHA 2RU9A 4OJ3A 1K0VA 1Y9OA 2RMLA 2IYIA 1R6YA 2KYZA 2AJ0A 4Q2LA 1VQSA 4OJGA 4DN9A 1WD6A 3UDCA 1CC8A 1SQEA 2XMJA 5B0AA 3T9NA 2BUNA 2PD1A 1TUVA 3K7RA 4YEAA 4ZA1A 2KT3A 2OD6A 3CJKA 1AW0A 2ROEA 2QIFA 5B0DA 2HLTA 1JK9B 3KG1A 4Y2MA 1N5TA 1S6OA 5F0WA 4A4JA 3FRYA 1N5VA 1VQYA 2ASYA 1FE0A 1V3ZA 4QOTA 1YJVA 2BJEA 2IFXA 1GXUA 2HLUA 4OJ1A 1ULRA 4A46A 4OJHA 3HDSA 1P6TA 2GFFA 2FB0A 2GV1A 2OFGX 5B09A 5T7LA 2LDIA 1FVQA 2K1RA 2GGPA 1Q4RA
chains in the Genus database with same CATH superfamily
3LQVA 1LW2A 2E7WA 2XMVA 4Z37A 1S1VB 3DLJA 1GNKA 4ZKAA 2AWZA 2WVCA 2WVFA 4ES1A 2JL9A 1WF0A 1S9FA 2MDAA 4DPOA 3OFGA 2VBZA 3EYZA 3CF5Q 3OJUA 1RYRA 3KLGB 4C8KA 4OZ2A 4GO7X 3JTPA 2JEGA 2E44A 2C2ZB 2E9ZA 1R43A 3ENQA 3IWXA 1NPPA 5D0EA 1DLOB 2YWGA 3UNGC 1ROFA 3OUYA 4ALZA 2H51B 4BWMA 5CA5A 1T9YA 3UWTA 1VDHA 3OR1B 3UR0A 3QBCA 3T5HA 1RT2A 2AJFE 1PBAA 3QSIA 1GK8A 4RW4A 2PIIA 4UW2A 4MKAA 4QPTA 1M5PC 2WHOA 1KTQA 1YWXA 2BJEA 1RISA 4UZCA 5DLGA 4LF9F 3RW6A 3R7SB 3G8SA 2B6AB 4GC7A 1CJTB 5C24A 1RBOB 5KG6A 1Y5LB 3R9LA 3BSOA 1VBZA 3DOMB 2R7OA 4OZ0A 2ZWPA 1Y3JA 1TV6B 1M5VC 2ZZTA 2QG9B 1HI0P 1XJWB 2QGFB 1FNXH 3EVOA 3JQJA 3BO4A 2FJDB 4WYLA 2FD2A 1YI2S 3H2UB 3LP0A 1R7IA 2RILA 4YS2A 4CRJA 1TL7A 2QYGA 3EUNA 1PSDA 5DDOC 4TNOA 4A47A 2Z2LA 1OSDA 2HFOA 2GAHC 4NPOA 3VCDA 3GR0A 4DU7A 1K9MT 3DLHA 4X4UA 4KAIA 2ZH9A 1H72C 3T1HF 1KOOA 1RTDA 2Q6BA 3SSSA 1Q8LA 3GFZA 3I82A 2FHMA 3PRDA 1SL2A 2N3LA 1Q81T 1L3VA 4I7FA 2DNHA 1JLEB 4LF4J 2ZUGA 2L48A 2AYGA 2DPIA 4XPCA 1YVFA 3MM8A 3RRHA 3I5CA 5SUHA 1P1LA 1VHFA 4URGA 1UVLA 4HDGA 1C4AA 4Q7AA 5HSPA 1TP7A 1KQSR 3BKUA 4DG1A 2ZC3A 1O5JA 4PQUA 1YBAA 3ZFVA 3MR7A 3NGRA 2AT1B 5E3AA 4J5OA 1H0HB 3JYTA 5GAEU 3AA8A 4B3TF 4KH1B 4G6VB 2V34A 2W01A 1M1KT 3MEGB 1S1VA 1U0HA 4LF1A 5GAEI 5IOLA 4OI1A 4EBDA 2GGPB 3H40A 1A7GE 2JNJA 2WSEC 3KLGA 3JXOA 2OH2A 3ISZA 2V8VA 2EK1A 2KM8B 4Q8EA 4NI2B 4RLEA 4GRSA 3V6DB 2IMWP 1DLOA 3BGFA 5MLCV 4OYMA 2BZ2A 2KT2A 2FVQA 1SJ3P 4LFCJ 4UF4A 3OR1A 1SJRA 1AXQA 1NJZA 4BHQA 4DR7J 3A1YG 2EKYA 1QTNB 2HMIA 3AD9C 2G9OA 3SDEB 2D41A 4OZJA 3PXGa 1O51A 2F5GA 4QU6A 1RXOB 4F4XA 3FC9A 1CJTA 1SJ4P 2RRBA 3JTOA 2HVHA 3Q8RB 1XMBA 1PC4A 1KHWA 4ZDNA 5J2QB 2DIUA 5KFOA 2C42A 3VQSA 4FXDA 4FF1A 2UP1A 1TV6A 2F1FA 1B7FA 5KTQA 2QA1A 2MLXA 4KE5A 1YTYA 2Z0GA 3D66A 3PY8A 3DGVA 3PG9A 3CJ4A 1DY3A 5G4DA 4ZMMA 1F5CA 3D6FB 1RBLA 4WBFA 2VZ9A 2FHJA 1S76D 3ZXWA 1UJ5A 3W66A 2GV1A 5I3PA 3HHDA 2CPZA 4C8NA 5H1SV 4F4WA 3M6VA 2BE2B 3G8TA 1T95A 3M2RB 3L7PA 1UVNA 3BGUA 4DPYA 1Y7PA 1JLEA 3NAHA 4ZVQB 2HZAA 1N32F 3HJFA 2DH7A 1FJEB 3D0GE 4RU9A 3A8EA 1HHSA 3NOGA 1YITS 4WFBQ 1XQIA 4TKTA 2NREA 1IR2A 1RT1B 2PE8A 3CDBA 2UU9J 5E3QA 5KAKA 3VAMA 3BN7A 1RYSA 1FRJA 3J7ZT 1XIQA 1X60A 3W5YA 2YPZA 3RYLA 2CPDA 3UD5A 4LF2A 3CMQA 4OQJA 1VIOA 2PFDA 3T9NA 4GKKF 5I3QA 3HD1A 4QWBA 3WX8A 3KNAA 3MEGA 3V6HA 1ULRA 3RJMB 4K4VA 2GGPA 5F8MA 4B3MJ 1H3DA 3PFEA 1WC3A 3AOAA 4RR5A 3U1LA 2IBOA 2BJ1A 3LANA 2QA2A 3N5BA 1DTQB 4AD6A 2DTJA 2A2DA 1PGZA 4CM2A 2RIJA 4GC6A 5F8JA 4O3RA 4D3HA 2RHQB 2XO7A 1TK8A 2AD9A 3TW0A 1Y5NB 3J80U 1YRXA 2AYBA 3H0PA 3I5BA 5L9XA 3AXMA 5K20B 1HMVB 2IJRA 1GMUA 4OX9F 1U1OA 2IC3B 4LRFA 4B3RJ 2YH1A 1U2RA 4Y2CA 2LFVA 3SDEA 3OJSA 5LXRA 1B64A 3HLUA 5AE1A 1RQ0A 1SCJB 3G4SS 3OPKA 1NHVA 2D74B 5C7PA 4DFJA 2UUAF 3RB3A 3GQCA 1RGVA 1OIAA 3SQGB 3TQ1A 3BH7B 3ZTQA 3RRKA 5J2QA 1Z2LA 4PR6A 4UOGA 1WDTA 3KMSA 4I2PB 3K5NA 1SQFA 2M8HA 1AFJA 2UVVA 2ZM6F 2IJFA 2D7SA 2GO9A 4PXEA 2MZ1A 4HI1A 2ZH4A 4FYWB 3KTQA 4DV3F 2DXEA 5DG9A 2Y1IA 1KEKA 4LVNP 2GHPA 4JI1J 4NLQA 3TUJC 3CCUS 1KNZA 2C22A 1HNXF 2F4VF 2R7VA 4A8OA 4B17A 3M9MB 3QZ8A 5JMNA 3OXFA 4B9UA 3VAIA 3BO2A 3I87A 1SUQB 4YB6A 3LALA 3DRPB 3NG8A 3BBFA 2P8IA 3KG4A 3CE8A 2IRXA 3W3SA 2VC1A 1RT1A 1M90T 3CNQP 3G87A 2CJYB 1NUEA 4DZDA 2YKOA 4KPCA 3MOJB 3OXLA 5D4PA 1FDNA 4RUAA 5DZ6A 2ZDPA 3K5LA 2VA2A 4O3OA 3CULA 4HHUA 3LUYA 3MAAB 2OIHA 2GX8A 2DGSA 4TXSA 2ABYA 3BQ1A 2RSQA 4JI5J 2NPIA 2V4JB 3ZTOA 1IJEB 4LT6A 1DTQA 4B9MA 5BYQA 2DJWA 3TUIC 1FJGJ 4V1Ak 3HI9A 2E5LF 4RNMA 1H6KX 4ZVHA 3HP6A 2AMCB 4FYVB 4LMZA 4HI2A 4ZLPA 4NX9A 1MG7A 2XZDB 1ZAXA 3D6TB 3QGHA 1JIHA 2JLFA 2JLEA 4ES2A 3NEKA 4KGVB 3NBPB 4LF8F 4OZ5A 1IBMJ 4BS2A 1S6PB 1HMVA 3GSDA 4WKRA 5BR8J 3RBDA 5KG0A 1S0VA 5DDQC 2DNNA 3AJ2A 3VV2B 3OXGA 4F0HA 4NLRA 3BGRB 1ELOA 3ZNJ1 4Y00A 4O4GA 3CCQS 1VK8A 3PZPA 3H25A 1NK6A 2H9ZA 2BJ3A 4W90B 3SQGA 2YWEA 5LMNF 3KHHA 3QYYA 1NSQA 2R42A 2EC0A 5KG4A 2J7KA 4I2PA 3TRGA 2ZHBA 1IBLF 3DYAB 3JQMA 4TN2A 5F8NA 1Q16B 4U8VA 3ZC4A 1HW9A 2W25A 1T3OA 2CG4A 4C8YA 2ZNYA 1C1BA 2DEIA 3KDNA 1YQHA 4LBIA 4K4TA 3AJ1A 5CYQB 3C2PA 1HNWJ 3OBIA 3IBWA 2NXNA 1U6BA 3HD2A 2ALYB 1TUVA 1RT7B 2FLOA 4DQQA 4FBUA 2ZE2B 4DMZA 4JI0J 4F26A 3PDNA 2YX4A 1FRHA 2HNZB 4FF2A 5E5NA 4ZN3A 1S4FA 4Q8FA 3A8IA 2QFIA 4NEYA 3IR7B 3G96A 1IKWB 2HQFA 3UE2A 3R3TA 4M1KA 2AJ1A 1MWZA 2BQUA 5F0UA 1U1RA 1JLQB 1XNRF 4F2SA 2PFFB 4ZPTR 3GJQB 2IVYA 2HEKA 3QJPA 4FPIA 4ED3A 4ZITA 1EZZB 4CNYA 4USTA 1XTZA 3DDIA 2QZ8A 4P9SA 3NXZA 2HWTA 4ZPBA 4ZVOB 1GX6A 4IQXA 3MAAA 4UUWA 2OJ3A 4PQAA 2DRDA 3AA9A 3BGLA 4ZPAA 3M8YA 1TKXB 4Q44A 3C15A 3O6QA 2E66A 4PCQA 1KP6A 4A8FA 2PA8D 3MM7B 2KU7A 2KT3A 2QE5A 2BE7D 4UZBA 4K5RA 1RAAB 1L3UA 3S6EA 2WB1D 5RUBA 3NMRA 3CSKA 4XAKA 1NNDA 2GQCA 3M05A 3TVZA 2FJBB 4B3SF 3RG6A 3MR3A 1KQGB 4PXDA 2ZC4A 3UN2A 4KHPF 3NBPA 4OIXA 3NNCA 5KG3A 5A8WB 1PYTA 2F3JA 4P2SA 2HKEA 4Y65A 4R25A 1RA6A 4FVCA 2MKKA 4K0KJ 4QU7A 4WTYA 2OUGA 3BGRA 4DN0A 2J6TA 3FUYA 4WCEQ 2DCUB 4Z2XA 3G2XA 1X4EA 4DWIA 3CDUA 3HSDA 5E3CA 1TAUA 3UDLA 3TJAA 2IDEA 2DITA 4RW9B 3IG1B 2C3UA 4ECUA 2HVDA 2WVBA 2PGCA 1RT6B 1R8BA 3NCQA 2WSCC 2IAJB 1IKVB 1JJ2R 4MTPA 4A8XA 2OHDA 2VBXA 3DYAA 1F0XA 1PKUA 5CZVA 4JI6J 2H48B 1FHTA 1C1CB 4ZVPB 1OQ3A 1WC5A 2RD5C 2KTQA 3OTEA 5DG8A 2IIHA 5CYQA 3CD0A 4AE5A 4IUFA 1PAUB 3NNHA 3M8ZA 2Z57B 1RT7A 1SQGA 3CCJS 2WZ1A 1T8EA 2JRSA 2AYEA 1MNEA 2H5JB 2HNZA 1WC0A 4UT4A 1IKWA 2ILZA 4YR3A 3P96A 1MMLA 1UP1A 3T3FA 4JP8A 1JLQA 5AE2A 2N82B 2QMXA 4LSNB 3TOQA 3KNGA 2RVJA 5IXUA 4ECYA 2F9DA 3T5JA 2MQMA 2D3UA 3GJSB 3CCWA 2BANA 3I4PA 1HKAA 4YEAA 5LM7E 2Y1JA 1KFSA 4P2XA 4WXOA 2HLTA 3CUNA 1KVKA 4EMDA 5J2PB 2XNRA 3ISNC 1XMQF 5CXTA 1JLAB 1O8BA 3KJFB 3QPIA 3MEKA 4V19J 2K8GA 1UW4A 4F2RA 3EPGA 3GMGA 1BUXA 3TZXA 4OYBA 4IRDA 3MMCB 5A2QY 1TKXA 3UI3A 3CCES 3G8QA 5L1JA 3GZ7A 2MLZA 4PPZA 3MM7A 2H54B 2B4PA 2LQ8A 1R6VA 2Q43A 1U02A 4OYAA 1L5UA 5D4OA 2HW3A 4C8OA 2EEYA 4NRUA 1BD6A 4WFZA 1LWXA 4FNIA 1YX2A 3R5BA 4E98A 3DI6A 4LBPA 2VKZG 3JQKA 2JEIA 2WCXA 1QAIA 1S9GB 2FC8A 3GYNA 1VQNS 1FESA 2ZVIA 4ED5A 3X1LB 5KT7A 3LPEA 2FJAB 2P6SA 1L3TA 1ZS6A 1DTTB 2DY9A 1E6YB 5A8WA 4JV5F 1H2TZ 1M5HA 3BF4A 4DDFA 3PW4A 1Q8IA 3KJVB 1Q0NA 4MK9A 4H4MB 3UDCA 4C0HA 3X3UA 1SH3A 2JVOA 4NLGA 1V9OA 2AEFA 2KVQE 5KFMA 2HWHA 3B78A 1SJ1A 2JHEA 2ZFHA 3T5LA 3FCHA 3E3XA 2XYHB 4KHRA 1S72S 3OSPA 4KO0B 5KOXA 1RT6A 3HK2A 2R7QA 2IAJA 3GP9A 4IFYB 4QQBA 3THTA 2ATLA 1HNIA 4FS2A 2E5JA 3N0VA 3MUMP 4J9NA 3MM9B 5A8RB 1LEOA 3MCMA 4JI3J 3QLHB 1C1CA 4DR3F 5J2NB 4KGZB 3I0SB 3SQOP 2HHHJ 4NCBA 2HRYA 1Y11A 1KRPA 3FFIB 1GMWA 1TELA 2UZAA 2UXCF 1UPPA 2D69A 3SZ2A 1RHQB 3QNWB 2OFHX 4ETZA 4YP3A 1T03B 1HWLA 1RWOB 2E1PA 2KG0A 3R8YA 3SCKE 1X4FA 2FHJD 2C2RA 3ICLA 2Y9HA 1AT1B 3JSYA 3R5GA 4RNNA 2JC1A 4ZCIA 1XMOF 4ED8A 5HO4A 2E7VA 4CH0S 3NOCA 2FTRA 5CABA 2D9PA 4LSNA 4LRBA 9ATCB 4GO5X 3MI7X 3KK1B 2EFNA 1CQNA 4RNHA 3CJRA 1VQOS 3GFYA 4RBTA 3MR2A 1KLMB 3MM5B 3FEZA 1RACB 3VVTA 5J2PA 5FDLB 2OELA 1NKEA 2ZOGA 2EBGA 4MAKA 1QUPA 3BR8A 4FYYB 3F41A 1G3OA 2QLXA 1HBMB 1YJ7A 1HWUA 2KDOA 1WDDA 4XTTA 2KYXA 2XYGB 1N56A 2YY3A 3CIZA 2M52A 2UV8A 2HRUA 4K5SA 4DV2F 4L75A 4QIEA 4IR1A 1N34J 3C46A 4J9RA 2VBYA 4PZVA 1CC8A 1KC8T 2BXJA 3HCXA 1FXDA 1S9GA 2HBZB 4DUZJ 4KT0C 4K4ZA 5B09A 2OFGX 1RAEB 2QX0A 3HPOA 4NLSA 4HH0A 1DTTA 1E6YA 4MFBB 1U2FA 1JLCB 1NAQA 5CYMB 5DQIA 2Y1LB 2I2YA 3KJVA 1N36J 4H4MA 1GTEA 2ATCB 5L46A 3GSIA 1C2PA 5KFHA 2MJNA 3TYTA 3FEYB 1N33F 2AGQA 4BDPA 1NPKA 1PJ7A 1ZM2A 2NCKL 1HYSB 2H3EB 4BLGA 1SH0A 4KO0A 2QFJA 3NGUA 4IFYA 3NGKA 3OTDA 1LV5A 3MAQA 3CGIA 1U1MA 2A1BA 4H54A 1RBAA 3VALA 3PO5A 3VGVA 4LF6F 3MM9A 2PEBA 2XMTA 5A8RA 3EZOA 5LMUF 5IFMA 1SL1A 1PJ6A 2DNOA 2RMLA 2AQ4A 4DSIA 1DFDA 5J2NA 2L9NA 5B0AA 2OTLS 1F60B 2FJVA 5J2MB 1HNZJ 3I0SA 3C6TB 2KN4A 2EFOA 1FKAF 3PR5B 1HA1A 4CO3A 4QR0A 2IFXA 1GXUA 4KH0B 1EETB 5HQ8A 3FFIA 2A3JA 1PIEA 8AT1B 1BQMB 1C0TB 3LTOA 1JQGA 3NS5A 1T03A 3FCVA 2GHVC 4TQRA 4ZPDA 2ERRA 2UUWA 1FRMA 3KG0A 2FJEB 3A8JA 4J9UE 3Q8VA 2OSRA 4W98A 4URQU 4XO0A 4DUYF 2A6MA 4QW8A 3H90A 1NJYA 1YDLA 1XR6A 2WOMB 2NZCA 1DRZA 1MU2B 4W4MA 1GQEA 1WHWA 2CDRB 5EUHA 2HS3A 4FP9A 2B4VA 4K2XA 3HXMA 1OPIA 2QN6B 3KK1A 4DEZA 2RQCA 2VOOA 3IWNC 2HNYB 4C9DA 1VQ6S 1KLMA 3MM5A 4LVOP 3R5JB 5FDLA 2KH9A 5LT5A 2G0JA 3QT5A 3T1HJ 2DNYA 3TAMB 4DN9A 3GIKA 2R8JA 4IYQA 2FVRA 1RUSA 5IWAF 4I69A 1KQFB 1VQYA 2H5IB 1HBMA 2HHPA 1NMEB 1FVQA 2UV8G 3I9V9 2C3YA 2F8HA 2HQCA 1NPRA 3CDAA 1WG5A 3HT0A 2FQQB 2M88A 3PX6A 2O5DA 4UY8T 2HFVA 2WB4A 2V8GA 4C7QA 2BQRA 1Q1KA 4RUCA 1WUUA 1A0OB 3OD2A 3PJ9A 5LJ5Y 3PO4A 3Q0AA 1K47A 2YNFB 3OTOF 3M30B 5KFXA 1H2VZ 1OQ6A 2BYCA 4MFBA 4NLYA 1AROP 1JLCA 2JDJA 1N48A 2DGWA 3GB0A 3IRXB 1PYSB 3UDEA 4N8NA 2JFDA 4DU8A 2PEHA 2OKQA 2BVZA 2SXLA 3DRRB 4PYDA 1ICEB 3H2LA 1HD1A 3I5AA 1WEXA 4C11A 1WD6A 1WTBA 5HJXA 1HYSA 2ASJA 1KS2A 4ES3A 4NLOA 4DSLA 1XERA 3EGVA 3EWGA 4N8OA 4IRKA 2J0QD 2EWHA 1D9FA 1OY9A 2WVDA 1Y0HA 2BEFA 2V6AA 3CD6S 1FEEA 3KXDA 3OL8A 2F40A 2QYCA 4OYPA 1RB0A 5HVGA 3H7HB 3I96A 3L4BC 2J9DE 4ETXA 4ATNA 5J2MA 1NM2A 2AU0A 3C6TA 2ZH8A 1EARA 2WBRA 3M8WA 2W9AA 3FRZA 2L9DA 1EETA 3BN4A 1OJ4A 2OAUA 1BQMA 1C0TA 2BM0A 5J1PA 2Z58B 1K1QA 1WHVA 1X9SA 4C98A 2KO1A 2QMUB 2UUCJ 3EM1A 3EMTA 3IC1A 2VF3A 3FMBA 2M7SA 1TL3A 4A48A 1J2VA 2ZH6A 2JJ4D 2HBYB 3AQPA 4DJBA 2CVIA 5M2RA 1JLBB 2RJZA 3BPSP 3VR1A 3N28A 2YKMA 2J7UA 1BWEA 4NXNJ 1NCLA 2VQEJ 4MJKA 5KG7A 4MK7A 2K06A 3FVYA 1MU2A 1S7HA 5KFIA 1EAYC 2YWWA 5F9NA 5H9EK 1HARA 4NYOA 5DGBA 2HNYA 3R2DJ 1FRLA 4X65J 1X4BA 3PR4A 4NLUA 5DQHA 5K8NA 4RUBA 4DV4F 3G71S 3MMBB 1VR6A 4QYZJ 5EHHA 1Q82T 4EWTA 3MCSA 3BBCA 4C2MA 3KMQA 1EX8A 4P2MA 3WDOA 1RWPB 2XMKA 3TAMA 5AJ3J 1NJXA 4ELTA 1F9FA 2VV5A 3ETMA 4LR9A 3HVAA 4AQYF 3NP5A 1E6VB 3R5CA 2QSWA 1JKHA 1RHKB 2NUHA 3IAM9 1FTCA 1UWAA 2CZVC 3R1LA 3A3PB 4OV6A 4DX5A 2BKPA 1VK3A 4YQWA 4TU7A 4AL6A 1TFYA 3V2UC 2XHCA 1U49A 2OPPB 3PYDA 5G0RB 5KT3A 3RU0A 1SL0A 2AHOB 3LPYA 2W2NP 4CH1A 3KK2B 1IKYB 4GVLA 3H8YA 2YNFA 2O66A 7AT1B 3M30A 4F4YA 1UVKA 2RH3A 3FRYA 3D0HE 2Y1RI 3M8PB 2HLUA 1VBKA 1I6JA 3IRXA 3MEDA 4GKKJ 1MN9A 1KHVA 5FIIA 3WQPA 4X62F 3AY0A 4ZPCA 4ZVUB 2MXYA 3DRRA 1M5SA 1D0EA 1RCOB 2G2ZA 4L72B 1HWJA 2RS2A 4NMXA 2MHNA 4JI7F 2OPQB 4J9LA 1N8RT 4DR5J 2OPRA 4LSLB 1S4EA 5SZTA 1JNZB 3G86A 3SCIE 4WK3A 3BQ2A 4NASA 2CQBA 5KFKA 1EKRA 1KSPA 2ZEJA 3CCVS 3UCUP 1WKJA 1U26A 4OX9J 4FN5A 2RHSB 4P52A 3ENVA 1P27B 1H98A 1OMSA 3C16B 2XC9A 1VJWA 1YJWS 4K4YA 4MKBA 2VA3A 3AD7C 3IA0A 4OHVA 4KGMA 1X5PA 4ID5B 4DBQA 2UUAJ 4C97A 2LEPA 2MZTA 3THVA 2BA9A 1URRA 5HN0A 5IM0B 3KLHB 1JLBA 3E01B 3K2YA 1OYDA 2V63A 3AB2B 2XLIA 4P7VA 4B9LA 1LNQA 2QL7B 1J5OB 4LBHA 1WF1A 5HJYA 5D0HA 5AT1B 3IRWP 2CYYA 5ETSA 2W7PA 4DX7A 5MAOA 4DV1F 2E5HA 5A6WA 3MMBA 4G1IA 4QR2A 4OHWA 2W2QP 3P49B 5KFQA 2BX6A 3LP2B 3HHEA 4P7TA 1HNXJ 2F4VJ 4DR6J 2HRTA 5KT6A 1E6VA 3NNAA 4QBUA 4PWWA 1M0SA 1R6YA 4HR2A 5A2QU 1T02A 5F8IA 2V8DA 2OD6A 2XSFA 1CULB 3KLFB 1FE0A 1YGYA 1UVJA 3A3OB 3R6LB 1RHMB 2OPPA 5G0RA 4WP9A 1UA1A 1BXNA 2M4MA 3HVWA 3KK2A 1IKYA 2CQDA 4HHJA 4J9MA 1RA7A 2EXUA 3UR3C 2FVSA 1VIXA 2NLWA 1P8GA 4OX7A 1SIZA 4K4XA 3M8PA 2AX1A 3DOLB 1R8CA 2DVIA 1WG4A 4ILLA 1IQZA 3TR5A 4ECRA 3FJ2A 1QAYA 5F3ZA 1VISA 3QWUA 1Q7LB 1VQLS 2B3TB 2CWXA 2XZTB 1L3SA 5KT2A 2VQFJ 3IN5A 2R9LA 2EK6A 2ZJPQ 1YK9A 2VG5B 2OPQA 3QZ7A 4LSLA 1V3RA 5A0YB 3ZZZA 1U8WA 1DQAA 2FJWA 4CLUA 1CVJA 2XEXA 1DJ0A 3OVBA 2MLYA 5C2CA 3ZZ0A 3J7Z5 3R2CJ 3MMJA 1UFLA 2J5AA 4MT1A 1U6FA 2GFFA 1FK9B 1PCAA 1NSPA 4JI4F 3QGGA 1QSLA 2EFQA 4OV1A 1S6QB 1JXVA 3C16A 3ZO7A 4TYBA 4ZP7A 4ID5A 3OHBA 3D28A 1U1PA 4K4WA 3FDSA 3N6MA 2XYPB 2HHVA 1BQNB 1GMWD 3E01A 2GVDB 3A12A 5ETRA 3VAHA 4MYTA 3G82B 4H4OB 2QA4S 2HIQA 4LREA 2F4FA 1J5OA 4OX8A 1ZPVA 3G6ES 5KFJA 5CAAA 4IOCQ 2BMBA 1TZ0A 3PTWA 1AFIA 2IA6A 4RW8B 5L8RC 2X1BA 1UJ4A 1KD1T 4F3OA 1QSSA 4OYXA 2BW2A 4Z7YA 4D3GA 4LF4F 3S7RA 3NS7B 2DR7A 4I64A 2ZUAA 4ZVRB 4A8WA 2OLWA 1HWKA 3K58A 4DPUA 3HKWA 3FSYA 3MR6A 2ZH5A 4ANCA 4HTIA 3BZQA 1UKUA 1CULA 2AJQA 4X66J 3KLFA 1RDRA 2PI4A 1RT3A 1R8HA 1NDCA 4C6AA 3RTVA 1XNRJ 4OHXA 2IJNA 4WU3A 1TU0B 3DDNA 4XDDA 2VONA 2DHAA 4TU9A 3KKFA 1HL6A 4TYAA 3TQEA 2ZJRQ 3R5DA 4NRTA 4L74A 1VRUA 1YJUA 3SFGA 1D8YA 2FZGB 1BMQB 1KWMA 2Q6CA 3DOLA 4L6V3 2ZOFA 3Q24A 3RR8A 3MF5A 2HHXA 1ZA2B 4EGLA 2Q1LA 1YJVA 3WC0A 4USJC 2PDAA 2NQPA 3Q8SB 2AF6A 4OLPA 3M2UB 2HHUA 3TVYA 4OL8A 2VG5A 4ZVFA 2VJVA 4CZCA 3QIPB 5D0RA 3IBFB 3UCZP 3GYGA 4B3SJ 3PYGA 1REGX 4LFCF 4KHPJ 3ISND 4DR7F 5KFEA 2XGQA 3T5KA 1FK9A 2EW9A 3ONQA 1Y10A 3PYFA 4IH6A 3DCAA 3RB6A 4WKYA 3NWGA 3M6XA 4URSA 1UFKA 2HFNA 1REVB 3V4MA 5KFPA 2Y3YA 3OV7A 3CCMS 2VU5A 4U67Q 3I31A 1S6QA 5DRKA 5HVHA 4YHHF 3W61A 4W92B 1VQ7S 4ZN1A 1NK5A 1Q8BA 3I9ZA 4Y6IA 4F50A 4ZVTB 1N0VC 4ED2A 1SC4B 3HFZB 2QLFB 3MPDA 7FD1A 1W25A 2RUSA 3LP1B 4OJGA 1CJVB 2PD1A 1BQNA 1FX4A 2GVDA 4M5IA 5HANA 3KHRA 1EQMA 3G82A 4H4OA 3O44A 1W7WA 2VKRA 4CT9A 2XMJA 4PABA 1Q79A 4KRWA 3MECB 5B08A 5KFTA 1ACMB 2CQPA 3GV8B 2V50A 4AXJA 2GZOA 5C42B 3POTB 2B8PA 2XHWA 1I1GA 1RLCL 1UVMA 4LR7A 1C0UA 3W9IA 5B0CA 2DK2A 4KY3A 2OMLA 2YKPA 3T6BA 4NMLA 2V8PA 1XBWA 2VICA 4WYWA 1JLGA 2ZD1B 2MTLA 3D7SB 2H5EA 4JYAF 1JXLA 3DC2A 4AUKA 1VQMS 4FVMA 4DQIA 2CPEA 4CTAB 2BJDA 3OTCA 3PW2A 4RJVA 1VCTA 2XCAA 2CKWA 3HSJA 4ZVGA 4RBUA 2UU9F 3M2VB 4LIWA 1D3WA 3MXHP 3HHKA 2HVEA 4MKVA 3GONA 4OJ3A 1WEZA 1NK0A 3OW2R 3TJ8A 4QYZK 2YNIB 4TLRA 2Y0BB 4IO9Q 2XS7A 2VIHA 1FCAA 4JOUA 2ASYA 4O3SA 1FI4A 3MAHA 4BC7A 2CQ2A 2MY8A 5K5MA 2GQ2A 2CPJA 1U1QA 2Z4PA 1HHQA 5HMZA 5ADZA 2UVUA 1MMNA 2OEKA 4B3MF 3PKMA 2YWKA 4KYZA 1ZETA 3BQ0A 2EG2A 2VG6B 1X4GA 2LXIA 5DQGA 1NK8A 2EI5A 2I1RA 4X4PA 2MQOA 3M2UA 5D0GA 3QAEA 2E1CA 1SVDA 2YQ3A 2FVCA 4CCHA 3QJLA 2XY6A 2GIRA 4LRAA 3D1QA 1NB2A 4J7CA 1LQ9A 3QIPA 3R7NB 3TZZA 1RI7A 2HBRB 5B0GA 5IQQA 4I6WA 1ZTTA 3GILA 5IS2A 2XWYA 2YQ1A 3B8HA 5KFBA 1VS3A 1LWEA 2RU9A 2G2OA 1K73T 5HROB 2CADA 3MTKA 3F56A 2N3OA 2BDPA 5B7WA 4JV5J 5DGAA 3N6LA 1REVA 4HLBA 2A0FB 1IQTA 1MROB 1NDKA 4CP5A 1X4CA 2WAQD 4DCJB 1UZDA 4WFXA 3VTIA 4JI2J 2VD3A 2U1AA 1JB0C 4YDXA 2HVIA 4WP3A 1Y3KA 3W8GA 3LP1A 4ZLLA 3N9UC 5E7OB 2LKZA 2VPXB 4I2QB 4U9RA 5LOQA 4DCPB 2PMWA 5L38A 1FKOB 2WVEA 3HZGA 2P2CB 4RL1A 1Y00A 3GIRA 3KLEB 3BB5A 4DR2J 5AXMA 2KRRA 1GEHA 3MECA 1S10A 3J7A1 1RHJB 4QPXA 3PKYA 2MSSA 1N5QA 2KM8C 5JJBA 2DGTA 4N56A 2V9KA 1SBRA 5C42A 1FDDA 2HURA 3P6YC 3POTA 3MD3A 2PC6A 3IGNA 5KG1A 2UXCJ 2LECA 3PCOB 2VFUA 3L7OA 4I6AA 2ZD1A 3OQ2A 5THWA 4CTAA 4TVAB 2VJUA 4O0IA 1ZOTA 2LQ9A 2H65B 2CDQA 3M2VA 4UOCA 1O0PA 1NDPA 5GMKa 2OO4A 3P8BB 2ILYA 2DNRA 4C0OC 3EVMA 4GMKA 3D67A 2CXEA 2HK2A 1RSCA 3LGMA 4KQZA 4XDCA 3E8OA 3BSNA 4FNHA 1OS5A 1Z2ZA 4QIFA 1T0TV 4P71A 2H4WB 3FBBA 4ED0A 4X4NA 1RTIB 1Q5YA 1F1BB 3QT7A 4WZQA 4JI5F 2HK3A 2UXBF 2R7SA 2B4UA 1OY6A 1FJGF 3Q8YA 3Q23A 1NK9A 4FS1A 4IR9A 2R7UA 2LP4A 2MKHA 2HQ3A 1UTAA 4Q2LA 4DV2J 4PG8A 4YB5A 3RB0A 4K50A 5M2UA 1SJFA 3K5MA 1F2HA 4UQTA 1IBMF 4QIGA 3D5MA 3MUVP 2J9EA 3TAQA 3JB9k 3MZIA 3WX4A 2OTJS 2COLA 4ZLJA 3LF0A 2B6AA 2X1FA 3DHXA 2CQ0A 5HROA 2YH0A 5EGYA 1SKWA 1NHUA 3GWCA 4ILMA 3GFHA 5F41A 2ADBA 5D6GA 3RBEA 2LXFA 2N4CA 3ZTPA 1KBRA 3DOMA 1LK7A 4DI6A 3OVAA 3CCRS 5CZXA 1MROA 4CO0A 1RAHB 1R3NA 4ICLB 5HMXA 4ZLNA 3L7UA 1VQPS 2KHCA 2CFXA 4IH7A 2P9CA 1N33J 3CJ3A 1APSA 1D9AA 3T9ZA 2W4CA 4BC9A 4EUVA 1H7XA 2HGLA 2FDNA 4I2QA 3US5A 3HX9A 1QVGR 1FKOA 4CLTA 3M8SA 3VAFA 1AZSB 2V69A 1U4BA 3KHGA 3KLEA 1AW0A 3W5ZA 3GR1A 1S6OA 1HFEL 1Q5VA 1HNWF 3C14B 3VHQA 1AA1B 2J8AA 5EWEA 2M3DA 5BJRA 6AT1B 3GIJA 1DZ5A 2YNHB 3HVTB 3ILOA 4JI0F 4LF5J 2W4PA 4LR8A 2R3VA 3OL7A 3TX0A 2CNNB 1WJ9A 1LXJA 1UL3A 3TA2A 4CI0B 3TO8A 5JXSA 4MKYA 2IM3A 1S0OA 1DQ8A 1KVJA 2DHHA 2CRLA 4DUYJ 3MD1A 3BH6B 3OHAA 3CJQA 5I42B 3HULA 3TA0A 2BE9B 2ZWOA 4DV0J 1UA0A 1CJKB 1DBDA 1YSJA 5HMYA 1YG0A 4AT1B 4ECXA 3PW7A 4Y34A 4USIA 1D1UA 1HNVB 3A3NB 5KFWA 4P75A 1T9WA 2MZQA 4LFBJ 3UW1A 2ALZA 2VODA 2G1HA 5ETNA 2F9JA 4A46A 3HDSA 2KJVA 5KFAA 1WOSA 4WXWA 1JMTA 3RAQA 3CMES 4LUBA 2RUGA 3CCSS 5DJBA 4NI2A 3DRSB 4P73A 2PMHA 3CPWR 4JUZA 3V6DA 4ZVEA 3IS9B 4DCOB 1U1NA 2ZDOA 1Q86T 4A8YA 5CYJA 2RT3A 2VUGA 4KKOB 5L1IA 3CC4S 3HKZD 4J37A 2XI2A 4RNOA 3SEOA 2GC8A 2I6WA 2K3IA 3CC7S 3QT8A 1J5EJ 1HW8A 2CIMA 4NLPA 1WNEA 2GVZB 3M32B 1P9YA 4P74A 1S48A 4M95A 4AYBD 2R8HA 4DR4F 1LW0B 1F2GA 4KV8B 1I5OB 4O0NA 1Z1ZA 4K0KF 1Q8KA 3I56S 3NRBA 5H9FJ 4P6QA 4C3LA 3H5YA 2X51A 2WK4A 2KT5A 3OSNA 4ICLA 2XLJA 3PHTA 2GJ2A 2QJ3A 2CZ9A 1RWMB 1NSKL 2FY8A 3H5SA 2BQ3A 3J80Y 4O4RA 2XY7A 4WF9Q 3Q2TC 3PEJA 1N88A 3TAPA 2MQNA 4RUHA 4X4RA 4CWBA 1TAQA 5I3UB 3I32A 4WFYA 2LQBA 3ELHA 1UZHA 3EDRB 1AZSA 2QLJB 5LSRA 3FSXA 2BE2A 5KFVA 2ASLA 3M2RA 2VC0A 2RDJA 3R7BB 2A6OA 1YJ9S 3L3CA 5GAGU 2YX1A 3U1NA 5HQMA 5HLFB 1QUVA 2NZ4A 2YNHA 3HVTA 3SCJE 2I8EA 4CLSA 3HT3A 9RUBA 4EFAC 4DZ6A 2HIYA 2BBEA 1KDNA 5GAHU 3CD5A 2IYGA 2HQIA 1T3NA 4ERDA 3K8WA 2MQQA 5GAGI 3AT1B 2W1BA 3VGUA 4JI8F 1B7YB 2IVFB 2JLGA 5J1NA 1FFGB 2MQLA 1BHNA 5I42A 1GMVA 1VBXA 2DISA 2ROEA 2B5JB 3UFCX 4A4JA 3DM2B 4X4SA 4U8YA 1K0TA 5F8GA 3DOKB 2H4YB 1B70B 2DIVA 3THPA 3QGPA 3EZ5A 2UXDJ 1YZ6A 2G0CA 3U7JA 4HKQA 3NLCA 4NLWA 2R2SA 2RDIA 2AGOA 4EO6A 3BJYA 3T1YJ 4DSEA 1XN9A 4I67A 4Q5VA 2MKCA 4PEOA 4J9QA 1YZ7A 1H7WA 1NBEB 5D4LA 1VQ8S 2CZ4A 3LO3A 3CB4A 2GHWA 3BREA 3W60A 3LAKA 3V81B 3AH6A 2OD4A 1R0AB 4ED7A 3MFHA 4M5GA 3DU6A 3WBZA 4DFKA 2K1RB 4I68A 5HI7A 3JAMY 3IO1A 4X64J 3KUGA 4USMA 1TKDA 2AW0A 2B9XA 2IC3A 4PUOB 3PRBA 1B0PA 2W9BB 1FT8A 4F3MA 5KFCA 3Q86A 2OMOA 2GVZA 3M32A 2YQ0A 4ILRA 5GMEA 4OZLA 1IR1A 3W65A 3FQKA 2RQ4A 5IZHA 3VF0B 1AB8A 4DL2A 2BKOA 1LW0A 3BYRA 4KV8A 1QAXA 4ECVA 4GKJJ 1TMJA 1NJIT 1Q78A 2FB0A 2XG8A 3JSMB 5KOWA 1YHQS 1FF2A 2J0WA 2N4DA 2ZKUA 1XWLA 3LOUA 4OHZA 2LQ5A 4X62J 3AHPA 3ULHA 2LYVA 4ZVSB 3AQOA 4OZ1A 2ZITA 1XK8A 3MOZA 1BE4A 2AJ4A 4UY85 1ZYQA 1GTHA 4KGKA 2GO8A 5CD4H 2GNKA 5I3UA 4RW6B 4JI3F 2MB0B 4QCLA 1D9DA 3OUYB 1JLFB 1SXLA 3MUTP 2XMMA 2DGUA 4H4KA 3KUHA 3QAUA 4C8ZA 4N77A 4KFBB 1WG1A 4RW4B 2X3DA 1NEEA 4NXMF 2EFVA 2JH3A 5HLFA 2AJ0A 4ZIWA 4CQ1A 1SUQA 1X4AA 3I55S 2FZKB 3DRPA 1H74A 3GJRB 2OI2A 1IKXB 3Q8UA 2D3O1 3IBCB 4CNZA 2HG4A 1KFDA 1FFWB 3UO0A 4ANEA 4RKUC 1NZAA 2BJ8A 2B7CB 1WELA 1JXEA 4RX6A 3PW0A 1X4HA 1B0TA 3GV7B 3MPUB 2B5JA 3DM2A 3DOKA 2O1PA 3ITHB 1IVZA 3GIMA 4HT5A 3FBFA 3HFKA 2RKIB 4PG5A 3TARA 2DXDA 4DOZA 2Z56B 1VRTB 1FWPA 3RRGA 3RAMA 1KN6A 2MQPA 4KTQA 2V4JA 1RTDB 4DV1J 1J27A 3UPFA 2UUBJ 4ITSA 2GS8A 1T7PA 1WC4A 2VBWA 2R7TA 2HFSA 3IM9A 4PWDB 2Z8QA 4XIUA 3EDQB 3MPYA 3V81A 4C0BA 2RAQA 5BYSA 3IMQJ 3O1LA 1R0AA 1N5VA 3GE9A 2J8SA 2C1EB 1BLUA 1RLDA 2RB7A 4S0MA 1VOMA 2HS0A 4M5HA 2K1RA 1S6PA 4PQUB 3KOAA 2HSEB 4Y2KA 2B9EA 4PUOA 4DUZF 2W9BA 3DKDA 1S0NA 3NL0A 2ZOMA 4MYUA 3L09A 3PRVA 1ZM9A 4DS4A 3EZUA 2M9KA 1U48A 4R5PB 3EVWA 5KG2A 4HEA9 4YN3B 1RWVB 3PFOA 2NUUG 4Y2AA 1FO1A 1N36F 1XC9A 3JSMA 4DL6A 2ZBQA 5K8MA 1U0HB 4YB7A 2I5JB 2QO3A 3LWMA 4DL7A 2CPHA 2JOQA 1SV5B 4LQ3A 1SKSA 2HQDA 3SFUA 4DPTA 2QC3A 5HBMB 1F9EB 2MJUA 3T1AA 2UVRA 4IG3B 5T7LB 2M8DB 4Q45A 2CQ4A 1VC0A 3T6JA 3GV5B 4WTOB 2RF2B 3UN3A 1EKSA 5D8HB 4DXLA 3M9OB 5EDWA 2HZCA 2JZ5A 4RW6A 2QTWA 4FYDA 2MGZB 1JLFA 4X4VA 3H5UA 3E2EA 2JEFA 1BWVA 2J9DA 5H9EJ 2VOPA 1HNZF 1QAJA 5AXKA 2Z2ZA 1LXNA 4KFBA 2ZE2A 1VI7A 2HMIB 2NPFA 3C8YA 4JI4J 3P4UB 2V94A 5JUMA 1U0SA 3PEHA 1TL4A 2DNPA 1HD0A 2L08A 4DLEA 1GAOA 1BC6A 4DR1J 4P2FA 2GW8A 1IKXA 4YFUA 2QL9B 2X1GA 3F44A 5KG5A 4ECZA 2J7WA 4DQRA 3FKBA 5ETOA 1HPZB 5KFZA 3TI0A 4TQSA 3KK3B 1WSVA 2W8LA 1JJCB 3LA0A 2V0NA 1UEVA 2JSXA 2YXLA 4K59A 3PX4A 3ITHA 2F8MA 1K0VA 1MN7A 2QA4G 1ZAWA 3NKYA 2FY1A 2RKIA 1T9VA 3CJSA 3DXBA 1N54B 2DBBA 3TP2A 4J90A 1VRTA 3R97A 3K89A 1HR0J 1N6QB 4RU2A 4DQPA 2DHGA 2AEMA 3RZAA 4UQGA 2ACYA 3NGTA 8ATCB 3TEHB 2J76E 5IC4B 1YRUA 3GLJA 3ZNUA 4LJMA 1VLOA 3CWJA 4PWDA 4YR0A 5A6PA 4CO2A 2AJ2A 3JTNA 1FJCA 2P9GA 3W9JA 2IM0A 1SB6A 4ZPWR 5JVGQ 2XCPA 1S1TB 1R0BG 1NSAA 2J6UA 3C66A 3R27A 3W64A 1TMMA 4LF7J 1P1TA 4ZS6A 4V19X 4DF4A 3Q8PB 2IHR1 1RHRB 2LA6A 5LSLA 4R5PA 2V8HA 1B99A 5EN1A 3EGWB 4RZRA 4YY3J 2FGCA 1UFWA 2BABA 3M9NB 1G7CB 3KYLA 5DO2A 4RW9A 4HT7A 3AD8C 3IG1A 3MGJA 2I5JA 3QWPA 4WP8A 1SV5A 1XNQF 4KB7A 4QOTA 3EPIA 1IKVA 2IM1A 5HBMA 2W7OA 1S1UB 3IR6B 4IG3A 2FGOA 5T7LA 2XB2D 1TK0A 1LK5A 4Y3CA 4DV7F 2RF2A 5D78A 3VAJA 2OGUA 4RO0A 2YX7A 3B4MA 1O6XA 1CJUB 4C4WA 3BM7A 3CJ5A 5T41A 2MGZA 5L39A 5H9FK 1S12A 2VB6A 3P45B 2CQ1A 3DRXA 4F4ZA 4JV2A 2HHTA 3RBXA 4PRFA 3N4WA 1X5SA 2NSBA 2U2FA 3EXYA 1F3FA 2OP5A 3K57A 2IBKA 2UUCF 3SI8A 4LFAF 4YHHJ 4U7UD 3K5PA 3DHWC 4LRDA 1U24A 3C19A 2G0IA 1ZPWX 4OYWA 1SC3B 2C28A 2EVZA 4I1TA 2CNKB 1HPZA 4M5JA 1U47A 1V3ZA 2WW4A 1NJWA 4NXNF 1RP5A 3KK3A 2VQEF 3HJVA 2LXUA 5E3RA 1NKBA 4HH1A 3FQLA 1RADB 3PIOQ 4E0DA 1JLAA 3RAXA 4DV6J 1KLNA 2BOAA 1CPZA 3OFFA 2QRRA 5GMDA 3VZHA 2RS8A 4NZ7A 4X65F 4OI3A 1VFJA 3MMCA 4RWWA 4HHHA 1I94F 1N6QA 3M1VB 1VQ9S 1H38A 2XY5A 2QV6A 2YNGB 3H4BA 5AJ3F 3W62A 3FK4A 4GVBB 3TUZC 1D09B 4MK8A 1S79A 4TU8A 4QZVB 3TA1A 5ITHA 3U1MA 1FEHA 1G2EA 2CJ9A 4OZ3A 4CLKA 4RW7B 2Y0SD 1UEUA 4JYAJ 2X7IA 2R7WA 4WJBA 2KKHA 4QIVA 1U2CA 3C6UB 1S1TA 3D6MB 5IV4A 4L73A 3M7VA 1U09A 3ZTRA 3KUEA 2OEMA 2QEXS 1MSWD 2W9CB 2JWNA 1NRKA 2N7CA 1TK5A 4M8LA 2XI3A 3FNNA 1Q4RA 3B54A 3ZZTA 3TZYA 1LOUA 4OI4A 3DLLQ 3M6UA 3H2VE 2WONB 3E51A 4QWCA 3PIPQ 1JNRB 1RU2A 1JWWA 1S7IA 5FD1A 3ILLA 4WFNQ 4CYUB 1DAXA 1S1UA 4X4QA 4EBEA 5FLXY 4DR5F 2DRBA 4KC5A 1QDUB 1OY8A 3QLHA 5DG7A 2DHXA 1VQ4S 3IR5B 1Q95G 2XLKA 4Y2IA 2C3MA 4OZNA 2AZ3A 4CLLA 1CJUA 1CBKA 4P10A 5E2QA 4QR1A 1S49A 3CC2S 3LWLA 1FFSB 3DLBA 2POKA 1NB7A 2CAJA 2EPIA 4LF9J 4CDIA 3V6JA 1HQUB 5HK4A 3T41A 4ZPVR 4WK1A 4NA3A 2MZRA 1WWHA 5CH7B 5M2PA 4O4GB 2LLZA 1CC7A 3B4DA 5JVHQ 4F3QA 2KB2A 1UAWA 2BR0A 1F3VA 2DGXA 2AX0A 1SKRA 2CWKA 3HHLC 3DU5A 6FD1A 3QMQA 2VFVA 4IOBA 2L3MA 4OI0A 2QL5B 5IT0A 2G2YA 4OI6A 1N4LA 2GMJA 5IT9Y 2M5YA 1S5ZA 5K14B 2XNQA 4NA2A 3KJQB 1RAGB 3MMAB 5B0BA 3KHLA 4FKYA 1RU1A 2R2TA 4KBIA 2FVPA 1C1BB 1QLNA 1V5IB 2QLBB 5DETA 4EK2A 1PC5A 2AV5A 5ETPA 3Q83A 1Y5IB 2EFPA 3M1VA 2YNGA 1R8AA 2B51A 4GVBA 3ZZOA 4DR6F 3K7RA 2NYIA 2XQCA 3KLIB 2C2DA 1VRQC 4U96A 3TZWA 2HS4A 4RW7A 3HMJG 3UVJB 2V4RA 4C48A 2E5GA 3CXCR 4IG0B 3CJ0A 2V2KA 4PWUA 2C3OA 2ZH1A 1WHYA 3MDFA 1RT5B 3PACA 4B3TJ 2R8KA 4OFZA 2B8QA 1DHMA 3C6UA 4U7UK 3M6WA 4HDHA 4ZIVA 1FDBA 3HHLB 3IFEA 5CYMA 4F8RA 2LEAA 3HVRA 5DDRC 4X4OA 3DGPB 5B0FA 3JAMU 2W4DA 2W9CA 1HHTP 2CQCA 2JX2A 2NXUA 4PG7A 4KR0B 2X1AA 3IXQA 2GMHA 3QATA 3AXKA 1FRIA 2WONA 3C15B 4KGXB 4B02A 5BXIA 1IBKF 3ZTSA 2UXBJ 2VH7A 2ADCA 2VQFF 2CQGA 4NYPA 3NCPA 2MPUA 2PA3A 2C3PA 1LWCB 4CYUA 2CQHA 3ZZYA 1U1KA 5HVFA 2KFYA 2DH9A 1VGYA 3H98A 1AYEA 3KG1A 5LJ3Y 2E5IA 4NCGB 5F0WA 6FDRA 1IWGA 4USUA 2CG8A 1TR0A 3OVSA 4CLWA 1NHKL 1V3SA 4MIBA 5KFUA 2NS1B 3GTYX 1RE1B 3NCRA 2HQGA 4CLPA 1NO8A 2V5HG 4ZJOA 3HFVA 3H5XA 1HQUA 5A76A 1PYOB 1FTRA 3R5AA 2BRLA 5BYRA 2RRAA 4UOHA 3SIPB 3EGZA 4K8RA 4ZP9A 2WOMA 1UJ6A 3OFHA 2ROGA 4NEZA 4CLZA 3VGTA 5LL6d 1X0FA 2FIUA 2E1RA 2CJQA 4OX6A 3GCXP 1EB0A 2I0XA 3OLAA 3FSIA 5GADU 2W2PP 2HPUA 2ZJQQ 4P72A 3MEEB 1DURA 5K14A 2DKOB 2IM2A 4C8LA 4F4KA 3MMAA 2LMIA 1RAIB 5IT4A 2VPYB 3UD3P 3GJTB 4OYIA 5F8LA 2V68A 2FYXA 2KRBA 5GADI 1ZTWA 3DDKA 1D8ZA 3U02A 1N32J 3QIDA 4DV5F 3W2VB 3KLIA 4N47A 4CM0A 1H2UX 3UVJA 3K5OA 1HQEB 2B56A 3IM8A 4X66F 4CLYA 4IG0A 4FXVA 5D15A 1DQ9A 3LAMA 1RT5A 1B0VA 1ZA1B 5ETVA 1UCNA 2KZMA 4EO8A 3GYXB 3HHLA 1LFWA 3QFHA 2BANB 4I56A 3DGPA 3QSYB 3VAKA 2FPHX 2CJXB 2NXEA 5DM7Q 1NXIA 1MLAA 1SQEA 2EKNA 2PN6A 5KFLA 2MQ8A 5B0DA 1YKWA 4HYKA 3D2WA 3FZBA 1S9EB 3BKFA 4J9KA 2KI2A 3BKTA 2E29A 4A8SA 3ILJA 1T94A 1RCXB 2MY7A 5ETKA 3VVUA 2EFGA 1RTJB 2O3DA 1GT8A 1FVSA 1LWFB 1LWCA 4CH7A 1TKTB 2HGMA 2DNQA 3DI6B 4F0KA 4NCGA 3ZZUA 2GA7A 4WPAA 4X4TA 4DSFA 5T14A 2E9TA 2VASA 2ZH2A 2VG7B 2KZZA 4MH8A 2AP6A 4FKXA 4EEYA 5AE3A 1X7VA 3BDPA 1NZ8A 4NLVA 2DYAA 2ZVSA 3AAWB 3JSRA 4IRCA 1WOPA 2LU2A 4DR4J 3HO1A 4N7TA 3SBMA 1FKPB 5L9NA 3GG1A 3K0JA 3D0IE 4QWDA 1IBCB 2DGQA 4QYRA 2AKWB 3IAS9 2Q66A 3T19A 2C2OB 1N5TA 2DCLA 1HBNB 1WEYA 3DFEA 4I6YA 2ZM6J 5A8KB 3QO9B 1S6UA 1ZAVA 2IY5B 1KTVA 2CJBA 4TY8B 2PT0A 1HNIB 3D1OA 2FC9A 4DV3J 4TLQA 4YB1P 2HFUA 2M70A 1S59A 3OT9A 3UNYA 2QLWA 3MEEA 2ROPA 2ZNZA 3OLBA 4R8UB 2DY1A 3ADAC 3WIUA 2DT9A 4DX8H 4LQ9A 2W8KA 3HZEA 1FD2A 2VDIA 3G9CA 1ZH5A 2MKIA 3O5TB 2M0GB 2MKJA 4NCAA 1ZZNA 3HSZA 3V5RA 2Y8WA 4HTJA 3RGIA 3P3DA 3IP0A 3W2VA 2W2MP 2RRNA 3D3BJ 4NL5A 4PXBA 1RWKB 4UTGA 2IPOB 1S1XB 4HACB 4ZHRB 4EZ9A 1WTFA 4NOHA 1HQEA 4JI8J 4XK8C 2XSJB 1U45A 3FEXB 2IRUA 1WI6A 4ED6A 4OJ1A 4DX6A 2CPIA 3Q89A 3CEDA 3N6NA 2J9CA 1SC1B 4IO1A 3MURP 4ANDA 2W7AA 3I0RB 2JFKA 2AIRB 3LGNA 1U7LA 2C2KB 3I6PA 1WKKA 4R0JA 3W2WB 1S9EA 1EP4B 3HM9A 4CT8A 1NH8A 5C2GA 2E5LJ 1UVIA 1SJQA 5L1LA 3OFEA 3B6BA 4IOAQ 2E1MC 1RTJA 2C2MB 4DHVA 4I4BA 2LU1A 1LWFA 4J91A 1TKTA 2MHEA 3P5BP 4LF8J 3ET6B 4ZK7M 1YJRA 3OTBA 3M4XA 2P6TA 4Q2MA 3D1HA 4C3MA 3BYPA 4FZVA 2YWHA 3F73A 2VG7A 1JJ4A 5E3PA 1TUWA 2RQMA 2AGPA 2NR0A 1X5TA 4K4SA 5D3GB 1U8SA 3JS9A 5IQ6A 4WIQA 5HL7Q 3QQCD 2K2PA 1FKPA 5LMNJ 4ECQA 1S77D 5FJ4A 5IM0A 2ACMA 3KLHA 4JI2F 2HAFA 4MIWA 2FUG9 3PX0A 5CD4A 4F04B 2F63A 3NGDA 1IBLJ 2WW8A 1HBNA 1FDAA 2DRAA 4Y0FA 1OO0B 3C3LA 3RBZA 4EYHB 2F65A 5A8KA 4EZ6A 2V2VA 3QO9A 2HVZA 2GAGC 5DLFA 2JC0A 3CMAS 3VAGA 4TY8A 3S8SA 4AFFA 3W9HA 2WTFA 4DR2F 4JB8B 5D4NA 2XTJP 4Q0BB 4M5LA 1IM4A 2WSFC 4R8UA 4YDDB 4L3KA 5ETMA 2J0SD 2XS2A 1WSRA 4WFAQ 4FF3A 3LP2A 4O44B 4DUTA 4DS5A 4NXMJ 5J1EB 1UW9A 3EICA 3M8QB 2I9SA 4USHA 2HFZA 2PI5A 2A18A 2BW7A 1YLXA 1GX5A 3CCLS 3M8RA 2JEJA 4HVZA 1B3TA 4YUDA 1S1XA 3J81Y 4HACA 4ZHRA 5KT4A 1GH8A 3BS9A 2QSFA 2FLLA 3W1YC 2XSJA 2V9WA 2KFZA 1G4CA 4A8QA 3V4IB 2XMWA 3SYZA 4JBCA 2UVWA 4KIAA 5EWGA 4ZCMA 3SCLE 1VC5A 1I3OB 2Z30B 1EIYB 4AXIA 2LVWA 2CNLB 1HBOB 3BR9A 3I0RA 4ZJQA 3RUBL 1FA0A 3J81j 3W5XA 1F6TA 3FZ2A 4BCAA 4DL0C 3BBBA 1R27B 3KFWX 2BJ9A 3FGVA 1M1HA 3KLVA 4LRCA 3W2WA 1EP4A 1UETA 2DHSA 1PG5B 1TL1B 4O23A 4KJIA 2Z2MA 2BUNA 5A0YA 2B9WA 4G65A 2Y8YA 4DQSA 1HLWA 4N5SA 1NK7A 1ZM3A 3PM9A 4J9PA 3UD4P 1T9XA 2HHSA 1VQKS 3NS6A 2GQQA 3ET6A 3O8WA 3UDVA 5K9FA 2R8GA 3GG0A 3H4DA 2B7BB 2E7XA 1CSJA 2G1DA 1XEZA 5FLXU 1FXRA 1H73A 3CO0P 4RPFA 1QJHA 1UMJA 3SV3A 5EX0A 1OPZA 3H59A 4EU0A 1RWUA 3MPWA 1I51B 5D3GA 3S1TA 3GIIA 1G1XA 2KJWA 2NYHA 4EYIB 4NWBA 3D9BA 5CHCB 4IH5A 2GIQA 2HWIA 2X3GA 4DL5A 2EBEA 4C11B 2C2NA 4CO1A 2VFSA 3RR7A 2XGPA 4ECWA 1WC1A 1UWBB 3TANA 4RWXA 4ER8A 4PAAA 1VYAA 4RW8A 3W7BA 4F02A 1NU4A 3SSQA 2XO6A 3TJ9A 4Q0BA 3MCNA 2P5VA 2HZVA 2J0XA 2YWFA 3SXLA 3CDWA 5IT9U 3D4JA 3TUPA 2YKNB 4A8KA 1K1SA 2NXJA 2XMUA 1MWYA 2A2CA 3PJXA 4O44A 3CDEA 4LIRA 3CCTA 5J1EA 1M5OC 1IUJA 2K3KA 2MMYA 3M8QA 4LF5F 1WF2A 4M5DB 1X8DA 2DNMA 1WORA 4AL5A 3MWBA 1VHIA 1VJQA 3HSGA 1FERA 1A9NB 3W8PA 1X9MA 1RWWB 1TL3B 5IC6B 3CJTA 2YKAA 4CIOA 3AODA 4J9OA 1WKLA 3OR2B 2YKMB 5HATA 5KFYA 4ZP6A 2W2OP 2VHGA 5E41A 2UUTA 3V4IA 3BSCA 4DV0F 2HHQA 4TY9A 1XMQJ 1T05B 3KDOA 2GJIA 4FXWA 4KPYA 2A10A 1Y4ZB 1VC6A 2HAIA 1C4CA 3TEGA 3CVKA 3N01A 1HBOA 4Y2MA 4L3NA 3WHIA 3SMZA 1EJ7L 2DD8S 2ZBPA 3FBCA 2PSZA 2ZH3A 1V5VA 1NLKL 4ECTA 4LFBF 4JV1A 3MFIA 4B9SA 8RUCA 3G6XA 2HHWA 4WU2A 3AOCA 5ETLA 3A8KA 4DLGA 2M2BA 2HGNA 1TL1A 2CPXA 1N0UA 4B3OB 2FLPA 4K4UA 3DMJB 1JKHB 2MYFA 1SC6A 4CO4A 5KFGA 3CJ8A 4YMEA 1CQMA 3CD7A 5I4MA 3HF5A 4B3RF 1SKUB 1J5EF 1W2BR 2EG1A 2RDDA 4PYAA 2B43A 3Q2SC 1KVIA 3TVKA 3FMWA 4FPRA 2O01C 1R31A 2ZBRA 4Z7CA 1TQLA 4BBYA 4EBCA 3ETOA 2KXFA 2ZHOA 2K7JA 5HMWA 3OL6A 3CCZA 3QGIA 4USWA 1PO6A 4DL4A 3JSBA 3MEDB 4R0EA 1TTHB 3EX7B 2DO0A 1TKZB 1CJVA 5C25B 4CLFA 1XNQJ 1FD8A 1M5KC 4RNFA 5LSOA 1QD1A 1W2IA 3BSAA 1SH2A 3PHEA 2H1YA 3F0NA 3ZZRA 2OPRB 4DV7J 4F7VA 1XR5A 2VPZB 1UWBA 3PVXA 3CIMA 5E33A 3BV8A 4JI1F 1QSYA 4DL3A 1EQ0A 4DR3J 1TFWA 2KL8A 2BOPA 4UOFA 1BQXA 2RQKA 1FRXA 3N5FA 4ED1A 4PPDA 2DEJA 4ZP8A 2AZ1A 2DNLA 2DNKA 5AXLA 4WWSA 1IJFB 4O3QA 2YKNA 4ID8A 3WIVA 2RU3A 3QRQA 5LXYA 1M1GA 1Q53A 3K59A 4M5DA 2XWXA 4ZJLA 1RHUB 3AOBA 1XMOJ 4LFAJ 3PW5A 4ZA1A 3VQTA 2LCWA 2YNIA 3NGSA 4OJHA 4USKA 1P6TA 3VWSA 1T11A 5KFFA 3OR2A 4C8MA 1CG2A 4BWJA 3SV4A 5CQGA 2FZCB 1YBTA 2VDHA 2Q3PA 1FWKA 2E1AA 2FLNA 2BKNA 2KG1A 1T05A 1FXLA 5C5JA 5EWFA 2UXDF 1KQKA 2R2UA 2MKSA 1RAJA 3FCWA 4Y28C 4U7CA 4DF8A 1S99A 2GCFA 3KJNB 4HL9A 1CLFA 3T1YF 1Q7YT 2VG6A 1R89A 4YR2A 2KFNA 1I94J 3UQSA 4X2BA 3CJKB 4ZCKA 3Q8QB 3HHLD 2EC2A 5EX3A 1RAOA 3RW7A 4B3OA 3DMJA 4ELVA 4NYZA 3MTJA 4F36A 3CJ2A 3J7YU 4X84A 3CTRA 4G1QB 3Q22A 4X64F 5BR8F 1W26A 2NXCA 1PILA 1HBUB 4NLXA 1ZZFA 1ITPA 2BRKA 2GMLA 2CPFA 2YTCA 3D3CJ 5K8OA 2B9YA 2XMAA 1T9UA 3PYEA 3J7YI 1UEKA 4ELUA 2AEJA 4GKJF 2ZZNA 2BM1A 2CQ3A 1X5OA 1QVFR 2R4FA 4YOEA 2FHKA 5B0EA 1ZM4A 2ZBCA 1TKZA 2HNDB 2MSTA 5C25A 5DZ7A 2R2RA 4B08A 3HHNB 3QRRA 5HP1B 3DLKB 1MW7A 2JVRA 3A4TA 3MR5A 5AXNA 2CPYA 2L41A 4LF6J 3TNVA 2DNZA 2OPSB 5LMUJ 1JX4A 5E0OA 4QWEA 2KXHA 1IR0A 3BDEA 1IWAA 3DLEB 2CVEA 2D3OR 2B0GA 4J9SA 3EJMA 1QTMA 1HIYA 2R8IA 1U6ZA 3EGNA 2ZHAA 1N52B 1GXLA 5DM6Q 4N41A 2G4BA 2XBPA 4ENOA 4KSEB 1RKJA 2VL1A 2F8EX 1FRKA 3QT6A 1CS4B 1L3KA 2DPJA 1SI9A 2BV3A 3EXCX 2C2EA 1B4SA 3ENWA 2R7RA 3ILIA 4M5NA 5K8PA 5IV3A 3PV8A 1PJ5A 5KFNA 2MKYA 1YIJS 2KHDA 3UCGA 3VZIA 1RTHB 1GXTA 4MIAA 3MPVA 1LKZA 3I4HX 2YBVA 1FNOA 2DH8A 3IWLA 2K7KA 4ZOSA 3K17A 4WE1B 3O2IA 4IFVB 1S57A 4QJVA 4F67A 3WC2A 4G1PA 3ENAA 1RTIA 4DSJA 4EI2A 1QE1B 4L76A 2LA4A 1P9QC 1TVRB 5IWAJ 2HYIB 3DXSX 3R1HA 3AJDA 1Y9OA 2UUBF 1OYEA 1N5YB 2VFTA 4H4KC 1IM6A 3CJKA 4J9VA 1BGXT 3CW2C 4OMFG 2ZZMA 4KHMA 3SSRA 3MM6B 2W24A 2FHOB 3H42A 2D3ZA 4N76A 4DFPA 4A8MP 2IMOA 4G1QA 4PG6A 4FDFA 4M63A 1T9TA 1FWLA 1HWIA 1RT3B 1HBUA 3LH2S 3N79A 3S01A 4IQMA 1U25A 3OTOJ 2KVIA 1VMBA 1YJTA 3UN5A 3L9ZA 1FE4A 2DR5A 2XM3A 4IKAA 4DPXA 1JJHA 3D68A 2DR9A 5U47A 2L9WA 1HQ2A 1RK8A 3AB4B 1WHXA 1VRUB 2ASDA 5D77A 2G13A 3GU0A 1K8AT 4K2JA 4DSKA 2WRMA 2P9EA 2ZH7A 3DLGB 1YJNS 2HNDA 1IBKJ 1CEZA 1U1LA 4QWAA 5HP1A 4JI6F 3DLKA 3AFGA 5L1KA 4CO5A 1YRTA 4M94A 1NKCA 2YPYA 1Z4UA 2OPSA 3PJWA 1DARA 1NDLA 1S1WB 2BACA 5KT5A 3BO3A 3J7AN 2ZKTA 2DGOA 3K8VA 3P5TL 4B9NA 3C14A 3DLEA 2V67A 5KFSA 3QRPA 4G3IA 4OHYA 5HQLA 2XZWA 2CNOB 3DNCA 4C3KA 2YKQA 2O67A 3CO9A 4MMOA 1FNMA 1IN0A 2DR6A 3QJJA 3VGSA 1RT4B 1XR7A 1S0MA 1RWNB 1ZBTA 1CS4A 2FJXA 4NE9C 4DR1F 4NLTA 1PAEX 3QFWA 5DS7A 2IA0A 2NSCA 1F5AA 1YBUA 1FJ7A 1K44A 5F9LA 4M5KA 1RTHA 5GAHI 4NZ0A 2Q79A 3NY0A 3D54A 1WOOA 2AYMA 2QMWA 1CJKA 1WACA 2MEWA 2HBQB 1LFPA 3H20A 4WE1A 3J81U 1BY9A 4IFVA 4ECSA 1HNVA 2OEJA 2LQJA 3O3LA 4OI2A 3B82A 4PKDB 3BGOP 4DV4J 3GFXA 1KKHA 2IDLA 1QE1A 2DO4A 2Z2YB 4UUXA 2V2QA 1TVRA 1HR0F 1N5SA 4IDKB 4WIIA 4AQYJ 1RZMA 3BPDA 1C0UB 3DRSA 4O3NA 1N5YA 3KWMA 1RABB 2N7YA 2CA9A 3NWRA 1MWQA 3IS9A 1F9HA 4U95A 3TWZA 4KKOA 1RWXB 1JLGB 1NH7A 3MHYA 4B9VA 4DV5J 2LDYA 1A6LA 2QT7A 1AUSL 3MM6A 1X9WA 2YVSA 1GFWB 1RJJA 3R6GB 2GIFA 3NAIA 3OL9A 2CJAA 4ZCLA 2R7XA 2WBMA 1KOHA 4OYOA 3PNIA 3WZ0A 2OSQA 1LW2B 2MZSA 4Q43A 4PG4A 4USVA 4LF7F 1X4DA 4LSZB 1RAFB 4I0WA 5ETQA 5KFRA 4E8UA 1PBUA 4OLOA 1VQSA 4E2FB 1UPMB 4YY3F 2QIFA 2DR8A 1F5BA 4FYXB 2V4QA 5KFDA 1TUGB 2IVMA 3MCOA 4FF4A 2LDIA 1VLYA 7FDRA 2DB1A 5ETTA 5DDPC 1X31C 1NK4A 4JI7J 3W63A 3DLGA 3ZZPA 3DRYA 5F8HA 2GJFA 4ED4A 4NZ6A 1EHWA 3DN9A 1FX2A 3GPAA 1KONA 1S1WA 1RT2B 2PO4A 2HHHF 4OYZA 1X0PA 3L95X 2RE1A 2D1CA 1URNA 3G6YA 4F4AA 3D6HB 1V6HA 2E9RX 1LWEB 5C24B 3U27A 3A13A 2LEBA 4NA1A 3GCWP 1RTZA 1SPBP 2KXNB 1RT4A 4M5MA 4RBVA 1HI1A 2IRYA 1R0CB 1R8PA 3TX8A 1MMDA 1JK9B 1G6BA 1RKIA 4DFMA 4O3PA 4PXCA 4DPWA 3EE3A 5F3TA 2CJKA 2DXFA 2VFRA 3RB4A 3LP0B 4F0MA 2F7VA 2ZBIA 2MZJA 3LGHA 2APOA 4QW9A 1TL7B 1OSCA 3NMAA 2DGVA 2V2ZA 2D9OA 2PMZD 3FBEA 1QM9A 3V6KA 2XS5A 1OWXA 1TL5A 4DV6F 1WI8A 4K7QA 2VPWB 2B4OA 1SIWB 4XPEA 5CCMA 1KR4A 3G6VA 5HAOA 2XULA 4AL7A 4I7FB 4B9TA 2BJ7A 4FBTA 4U6PA 2I38A 3CT9A 4F25A 3MM8B 4IDKA 2CUYA 3LW5C 1VBYA 3BEGB 5CCLA 1VQ5S 2J6SA 1N34F 1WC6A 4DG1B 1AUDA 5GVQA 2IYIA 4WZMA 2KYZA 1S97A 4JV0A 1HI8A 3JYTB 2RNEA 1IXKA 4QIWD 2DNGA 2CQIA 4NLDA 3IGVA 1QY7A
chains in the Genus database with same CATH topology
2RUGA 1S6UA 1ZAVA 3LQVA 3CCSS 1LW2A 5DJBA 2E7WA 2XMVA 3DRSB 2PMHA 1KTVA 2CJBA 4TY8B 3NS5A 3CPWR 2PT0A 4JUZA 1T03A 4Z37A 1HNIB 3D1OA 2FC9A 2GHVC 4TLQA 4YB1P 4TQRA 3V6DA 4ZVEA 3IS9B 1S1VB 2M70A 3DLJA 4ZPDA 2ERRA 1U1NA 2ZDOA 1Q86T 4A8YA 1GNKA 2RT3A 2VUGA 2UUWA 4KKOB 5CYJA 2QLWA 5L1IA 3CC4S 3HKZD 3MEEA 1FRMA 4J37A 2ROPA 3KG0A 2XI2A 4RNOA 2FJEB 2ZNZA 4ZKAA 3OLBA 2AWZA 2OSRA 3SEOA 2GC8A 4URQU 2K3IA 4XO0A 4R8UB 3CC7S 4DUYF 2DT9A 1HW8A 4LQ9A 4DX8H 2W8KA 4ES1A 2JL9A 1WF0A 4QW8A 3HZEA 2CIMA 1FD2A 1S9FA 4NLPA 3G9CA 1ZH5A 2MKIA 2MDAA 1NJYA 1WNEA 3M32B 4DPOA 3OFGA 2VBZA 3EYZA 3CF5Q 3OJUA 3O5TB 3KLGB 1RYRA 1XR6A 2WOMB 4C8KA 2M0GB 1S48A 4M95A 2MKJA 4AYBD 1DRZA 1MU2B 4NCAA 1GQEA 1WHWA 4GO7X 5EUHA 2R8HA 2HS3A 1ZZNA 4FP9A 2B4VA 4DR4F 4K2XA 3HXMA 3JTPA 1LW0B 1OPIA 1F2GA 3V5RA 4KV8B 2JEGA 4HTJA 1Z1ZA 3KK1A 2E44A 2E9ZA 4DEZA 1R43A 3ENQA 2RQCA 2VOOA 3IWXA 3P3DA 4K0KF 1DLOB 2YWGA 3I56S 3NRBA 3UNGC 3IWNC 2HNYB 4C9DA 1ROFA 3W2VA 3OUYA 4ALZA 2RRNA 5H9FJ 1VQ6S 1KLMA 3MM5A 4P6QA 4NL5A 4LVOP 4PXBA 4BWMA 5CA5A 1S1XB 4C3LA 3UWTA 3H5YA 5FDLA 4ZHRB 3OR1B 2X51A 3UR0A 2KH9A 2WK4A 5LT5A 4EZ9A 3T5HA 1WTFA 1RT2A 2KT5A 2DNYA 3OSNA 2AJFE 4NOHA 4ICLA 1HQEA 4RW4A 3TAMB 4DN9A 3GIKA 4XK8C 2XLJA 2PIIA 2R8JA 4IYQA 4UW2A 4MKAA 4QPTA 2XSJB 2GJ2A 1M5PC 2WHOA 1U45A 5IWAF 2FVRA 1KTQA 3FEXB 4I69A 2IRUA 1KQFB 3H5SA 2BQ3A 1VQYA 3J80Y 1WI6A 4O4RA 1YWXA 2XY7A 4ED6A 2BJEA 1RISA 4OJ1A 4WF9Q 1HBMA 2HHPA 5DLGA 4LF9F 2CPIA 3RW6A 3CEDA 3Q2TC 3PEJA 3N6NA 1N88A 2B6AB 1FVQA 3G8SA 2UV8G 4GC7A 3I9V9 3TAPA 5C24A 2J9CA 2C3YA 3QJPA 2F8HA 2MQNA 4IO1A 4RUHA 4X4RA 3MURP 1TAQA 3CDAA 5I3UB 3I32A 1WG5A 2W7AA 5KG6A 3I0RB 1Y5LB 2M88A 4WFYA 2LQBA 3PX6A 3BSOA 1VBZA 2JFKA 2O5DA 2R7OA 3LGNA 1U7LA 5LSRA 4OZ0A 3FSXA 2BE2A 1Y3JA 1TV6B 1M5VC 4UY8T 1HI0P 5KFVA 2ASLA 3M2RA 2WB4A 3I6PA 1FNXH 2VC0A 2V8GA 4C7QA 2RDJA 4R0JA 3BO4A 3W2WB 2FJDB 2BQRA 1Q1KA 4RUCA 1YJ9S 1S9EA 4WYLA 1EP4B 2FD2A 3HM9A 4CT8A 3L3CA 1NH8A 2YX1A 5GAGU 1YI2S 3H2UB 3LP0A 1UVIA 5LJ5Y 3PO4A 1SJQA 3U1NA 1R7IA 5HLFB 1QUVA 3Q0AA 5L1LA 3OFEA 2YNFB 2NZ4A 2YNHA 2RILA 3M30B 3HVTA 5KFXA 3OTOF 3SCJE 1H2VZ 4IOAQ 2I8EA 1OQ6A 2BYCA 4MFBA 3HT3A 4NLYA 2E1MC 1AROP 3EUNA 1PSDA 5DDOC 4TNOA 1JLCA 2Z2LA 1OSDA 4A47A 1RTJA 4DHVA 2HFOA 2JDJA 4NPOA 4I4BA 3VCDA 2DGWA 3GB0A 3GR0A 3IRXB 1N48A 2LU1A 1LWFA 1K9MT 4EFAC 2BBEA 3DLHA 4X4UA 4KAIA 1TKTA 4N8NA 5GAHU 2MHEA 3CD5A 2ZH9A 2IYGA 2HQIA 2JFDA 4ZK7M 1T3NA 4ERDA 3K8WA 1YJRA 2PEHA 3T1HF 2OKQA 3OTBA 2MQQA 1KOOA 5GAGI 2BVZA 1RTDA 2SXLA 2Q6BA 3M4XA 3SSSA 2P6TA 1Q8LA 3DRRB 4JI8F 3GFZA 4Q2MA 3I82A 2IVFB 2FHMA 2JLGA 3D1HA 5J1NA 4C3MA 3PRDA 2MQLA 3H2LA 1SL2A 1HD1A 4FZVA 2YWHA 2N3LA 3I5AA 1Q81T 3F73A 1L3VA 2VG7A 4I7FA 1WEXA 4C11A 2DNHA 1JLEB 5I42A 1WD6A 1WTBA 2ZUGA 1JJ4A 2L48A 2AYGA 2DPIA 4XPCA 1VBXA 5E3PA 1HYSA 2DISA 2ROEA 2B5JB 3UFCX 2RQMA 1YVFA 4A4JA 3DM2B 4X4SA 2ASJA 1KS2A 3MM8A 2AGPA 4ES3A 3RRHA 5F8GA 1K0TA 3I5CA 3DOKB 2NR0A 5SUHA 1X5TA 4K4SA 4NLOA 1P1LA 4DSLA 1XERA 1VHFA 4URGA 4N8OA 1UVLA 2DIVA 4IRKA 5D3GB 2J0QD 1U8SA 4HDGA 2EWHA 1D9FA 5IQ6A 1C4AA 4Q7AA 3THPA 5HL7Q 3QGPA 3EZ5A 1TP7A 1Y0HA 1KQSR 2G0CA 2K2PA 3U7JA 3CD6S 4HKQA 1FKPA 3NLCA 1FEEA 4NLWA 2F40A 2QYCA 3OL8A 4DG1A 2R2SA 2ZC3A 1O5JA 2RDIA 4PQUA 4ECQA 1S77D 5FJ4A 5IM0A 1YBAA 3KLHA 3ZFVA 3I96A 2AGOA 4JI2F 4EO6A 3BJYA 4DSEA 4MIWA 2FUG9 3PX0A 2J9DE 5E3AA 4ATNA 1XN9A 4ETXA 5J2MA 4J5OA 1H0HB 2AU0A 4I67A 3C6TA 3JYTA 5GAEU 2ZH8A 4Q5VA 2MKCA 3AA8A 3NGDA 4J9QA 2WW8A 1HBNA 4B3TF 1FDAA 2WBRA 1H7WA 2DRAA 5D4LA 4Y0FA 1VQ8S 2W9AA 2CZ4A 1OO0B 3LO3A 3FRZA 4G6VB 3C3LA 2L9DA 1EETA 3BN4A 4EYHB 5A8KA 2OAUA 1BQMA 1C0TA 4EZ6A 3CB4A 2BM0A 5J1PA 3QO9A 2GHWA 2HVZA 3BREA 1K1QA 1WHVA 3LAKA 1X9SA 3V81B 5DLFA 2JC0A 4C98A 3CMAS 3VAGA 3AH6A 4TY8A 2KO1A 3S8SA 2OD4A 1R0AB 4ED7A 3MFHA 4AFFA 1M1KT 3DU6A 3IC1A 3MEGB 1S1VA 3FMBA 2M7SA 3WBZA 2WTFA 1TL3A 4DR2F 4A48A 5GAEI 4DFKA 5D4NA 1J2VA 2ZH6A 4OI1A 2JJ4D 2GGPB 2K1RB 4I68A 4EBDA 3AQPA 5HI7A 3JAMY 4Q0BB 3IO1A 4DJBA 1IM4A 2CVIA 2WSFC 5M2RA 3H40A 1TKDA 2AW0A 1A7GE 4R8UA 4YDDB 2B9XA 2IC3A 1JLBB 2RJZA 4PUOB 3VR1A 3PRBA 1B0PA 2W9BB 1FT8A 4F3MA 2J0SD 3N28A 5KFCA 2XS2A 2YKMA 2WSEC 2OMOA 4WFAQ 2J7UA 4FF3A 3LP2A 3M32A 1BWEA 4O44B 4ILRA 3KLGA 4OZLA 4MJKA 5KG7A 4MK7A 3FQKA 2RQ4A 4DS5A 3ISZA 3FVYA 2OH2A 5J1EB 2V8VA 2EK1A 1MU2A 1S7HA 5KFIA 3M8QB 2I9SA 5IZHA 3VF0B 4USHA 2HFZA 4DL2A 2KM8B 4Q8EA 5F9NA 1LW0A 4KV8A 1QAXA 4ECVA 2PI5A 2A18A 4RLEA 1HARA 1NJIT 1Q78A 2FB0A 1GX5A 3V6DB 4NYOA 2XG8A 3JSMB 5KOWA 3CCLS 2IMWP 5DGBA 1DLOA 3BGFA 5MLCV 3M8RA 2HNYA 2BZ2A 1YHQS 2JEJA 4HVZA 2KT2A 1FRLA 1FF2A 1SJ3P 1X4BA 3PR4A 2J0WA 2FVQA 2N4DA 4NLUA 5DQHA 2ZKUA 1XWLA 3LOUA 4YUDA 5K8NA 1S1XA 4DV4F 3G71S 3MMBB 3J81Y 4ZHRA 4QYZJ 3OR1A 5EHHA 1Q82T 4OHZA 1SJRA 2LQ5A 4EWTA 1AXQA 1NJZA 3MCSA 4BHQA 3A1YG 5KT4A 1GH8A 2EKYA 3BS9A 4C2MA 3KMQA 3WDOA 2XMKA 3TAMA 3AHPA 3ULHA 2LYVA 2QSFA 3SDEB 2G9OA 2HMIA 1NJXA 2FLLA 3AQOA 2XSJA 2V9WA 4ELTA 4OZ1A 2KFZA 1F9FA 2VV5A 4A8QA 2D41A 3HVAA 4AQYF 2ZITA 2XMWA 3V4IB 3NP5A 4JBCA 3SYZA 1XK8A 2UVWA 4OZJA 4KIAA 5EWGA 1E6VB 3R5CA 4ZCMA 2QSWA 3MOZA 3PXGa 1O51A 4QU6A 3SCLE 1JKHA 2AJ4A 3IAM9 2NUHA 1ZYQA 4UY85 4F4XA 1FTCA 1VC5A 1GTHA 4KGKA 2CZVC 3R1LA 1SJ4P 2RRBA 3JTOA 4AXIA 2HVHA 3Q8RB 1XMBA 2GO8A 2LVWA 5CD4H 2GNKA 5I3UA 1PC4A 4RW6B 1HBOB 4JI3F 3BR9A 2MB0B 1KHWA 3I0RA 4ZDNA 4QCLA 1D9DA 3OUYB 1FA0A 5J2QB 1JLFB 1SXLA 2DIUA 5KFOA 1VK3A 4YQWA 3MUTP 4TU7A 4AL6A 2XMMA 2C42A 2DGUA 3FZ2A 4H4KA 3VQSA 4BCAA 4DL0C 4FXDA 4FF1A 2UP1A 1TFYA 3V2UC 1TV6A 1R27B 3KFWX 3QAUA 4C8ZA 2F1FA 1B7FA 5KTQA 1U49A 2OPPB 2QA1A 4N77A 4KFBB 4KE5A 5G0RB 1WG1A 3FGVA 5KT3A 4RW4B 3RU0A 3KLVA 2Z0GA 1YTYA 1SL0A 3W2WA 3PY8A 3LPYA 4CH1A 1NEEA 4NXMF 2EFVA 1EP4A 3KK2B 1IKYB 2JH3A 3CJ4A 1UETA 2DHSA 3H8YA 5G4DA 5HLFA 2AJ0A 4CQ1A 1TL1B 4O23A 4KJIA 1SUQA 2YNFA 2O66A 2Z2MA 1X4AA 3M30A 4ZMMA 2BUNA 3I55S 4F4YA 1UVKA 5A0YA 1F5CA 2B9WA 2RH3A 3DRPA 2VZ9A 2FHJA 4DQSA 3FRYA 4N5SA 3D0HE 1NK7A 1ZM3A 1S76D 2Y1RI 3M8PB 2HLUA 1I6JA 3PM9A 1UJ5A 3IRXA 1IKXB 3MEDA 4J9PA 3UD4P 2GV1A 5I3PA 2HHSA 1KHVA 3HHDA 1VQKS 3NS6A 2GQQA 5FIIA 2CPZA 4C8NA 4X62F 5H1SV 4F4WA 4CNZA 3AY0A 3O8WA 4ZPCA 5K9FA 2R8GA 3M6VA 2BE2B 3GG0A 2MXYA 2HG4A 3G8TA 1KFDA 3H4DA 3DRRA 2B7BB 4RKUC 2E7XA 1CSJA 1NZAA 1T95A 2G1DA 1M5SA 3M2RB 1XEZA 3L7PA 1UVNA 2B7CB 1FXRA 1WELA 1JXEA 3BGUA 1D0EA 4L72B 1Y7PA 1JLEA 1HWJA 2RS2A 1QJHA 2MHNA 4RX6A 3PW0A 1X4HA 4JI7F 3WC2A 2OPQB 1B0TA 3GV7B 1UMJA 4J9LA 2B5JA 3SV3A 5EX0A 1N8RT 3DM2A 2OPRA 4LSLB 3NAHA 3DOKA 2O1PA 1OPZA 3ITHB 3GIMA 3H59A 4EU0A 1RWUA 1N32F 3HJFA 2DH7A 4HT5A 3MPWA 5SZTA 1JNZB 3HFKA 2RKIB 1FJEB 3D0GE 4PG5A 5D3GA 3S1TA 3G86A 3TARA 3SCIE 4RU9A 3GIIA 1G1XA 4DOZA 3A8EA 1HHSA 4WK3A 1VRTB 3BQ2A 4WFBQ 1YITS 3RRGA 4TKTA 2NREA 1RT1B 3RAMA 2KJWA 1KN6A 2PE8A 2MQPA 2CQBA 3CDBA 5KFKA 1KSPA 5E3QA 4EYIB 4KTQA 5KAKA 3CCVS 2V4JA 4NWBA 1RTDB 3UCUP 3VAMA 5CHCB 3BN7A 1U26A 4IH5A 2GIQA 2HWIA 3UPFA 1FRJA 2X3GA 4FN5A 1RYSA 4DL5A 3ENVA 2EBEA 4ITSA 4C11B 3J7ZT 1T7PA 1P27B 4CO1A 1H98A 3RYLA 2VFSA 3RR7A 2CPDA 2XGPA 2VBWA 2R7TA 2XC9A 1VJWA 1YJWS 4K4YA 4ECWA 4PWDB 4MKBA 4OQJA