3RJMB

Caspase2 in complex with chdi ligand 33c
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-2
publication title Exploiting differences in caspase-2 and -3 S(2) subsites for selectivity: Structure-based design, solid-phase synthesis and in vitro activity of novel substrate-based caspase-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3rjmB00
1ICEB 1RHKB 2CJXB 3QNWB 5K20B 4ZVOB 2QL9B 1RWNB 3EDRB 1I3OB 2XYPB 3R7SB 2C2KB 2H54B 4LSZB 2XYHB 3R6GB 1RWPB 3GJSB 1IBCB 1PAUB 1NMEB 1QDUB 2HBZB 4JB8B 2H65B 2H51B 4ZVTB 2XYGB 2XZTB 1F9EB 2HBQB 1SC3B 4DCJB 3P4UB 2CJYB 2QL5B 3D6MB 3IBFB 1BMQB 2QLFB 4ZVPB 3NS7B 2H48B 5IC4B 1QTNB 1RWMB 1RHUB 3GJQB 2QL7B 4ZVSB 2Y0BB 2HBYB 4ZVRB 2H4YB 2C2MB 3IBCB 2CNNB 1SC4B 2C2ZB 2DKOB 4ZVQB 1SC1B 1I51B 1RWWB 1RE1B 1RHRB 2H5JB 4ZVUB 4DCOB 2QLBB 3RJMB 2FQQB 3GJTB 3R6LB 2H5IB 2Y1LB 2C1EB 1RWOB 2XZDB 3R7NB 1RWVB 3KJNB 3R5JB 2CNOB 1RWKB 2QLJB 3R7BB 2C2OB 3D6HB 3D6FB 1RHQB 3P45B 3SIPB 1RHMB 1PYOB 2CNLB 4DCPB 1GFWB 3KJQB 3GJRB 2CDRB 2P2CB 3EDQB 2H4WB 5IC6B 1RWXB 2HBRB 1RHJB 2CNKB 3KJFB
chains in the Genus database with same CATH superfamily
4PG4A 4LSNA 3H4BA 3I4PA 2QL9B 4G65A 5A76A 3S7RA 4M1KA 3KLHB 3PX0A 1U2RA 4X4TA 3W3SA 2MKYA 5A0YB 1DLOB 3K0JA 4DR6F 2W7OA 2JLEA 1SUQB 3EZOA 3HULA 4P2FA 1CPZA 3DRSB 4C2MA 4O44B 3CIZA 4LF4J 4K5RA 3T1YF 4QPXA 4B3OB 2XBPA 2HQCA 2L48A 2F4VJ 2R7XA 2DH7A 1HI8A 2VFRA 3FUYA 1U4BA 1X8DA 2LDIA 4KHPJ 1JKHB 3R6LB 4WU2A 1UVNA 1M90T 5HATA 2J0SD 1JLEB 3Q8UA 4EZ9A 5CZVA 3CB4A 3PYFA 2G1HA 2POKA 4G6VB 4HVZA 5ETRA 1DARA 3P45B 1S7IA 1M5HA 5HI7A 3UVJA 3DOMB 1FNXH 5IV4A 2YWFA 1XR5A 4G1QA 2RHSB 3Q24A 3QFWA 4HTIA 1UVLA 5H1SV 1VQ4S 3DXSX 4OLOA 5HMWA 3HZEA 3NBPA 3GIRA 3MHYA 2B51A 3BDEA 1KOOA 4FYYB 3MMJA 3HI9A 4NPOA 3VQSA 2OSRA 2XMUA 2L9WA 2XGPA 3RBXA 4I2PA 3ISND 8AT1B 1YJRA 3W2WA 2NREA 3T5HA 1WWHA 4PRFA 2W8LA 4CO1A 2NR0A 4DZ6A 3CJ8A 3RBEA 1S1TB 4RLEA 2BABA 2KKHA 4TY9A 3N6LA 3OTBA 2G2YA 2VBWA 5B0CA 3SFUA 3MCSA 4F0HA 2NPFA 2EWHA 4PABA 2R7RA 3U27A 1ZM4A 3CDBA 1A7GE 5AXLA 3OW2R 2GIFA 2LFVA 2QT7A 2ZDOA 5DQIA 3UN3A 1XR6A 4OX6A 1KD1T 2QFIA 3OT9A 4LF7F 2HK3A 4O23A 3MTJA 5JUMA 2G1DA 3P96A 2HS0A 2KFNA 4DL5A 3MM8B 3VVUA 1BY9A 5J1EA 3TNVA 2PC6A 1R0BG 3ET6B 1K8AT 4B3MF 5L1JA 3B54A 2DH8A 3AD7C 3G8TA 2ZNYA 1VK3A 2FZGB 1VBZA 3DLHA 4R8UA 1O8BA 4DV6F 1VQYA 4LR8A 2ZFHA 5HP1A 1JWWA 2DGOA 4B9SA 1FKOB 3NEKA 4K4SA 5HO4A 1J5EF 5AXNA 2H5IB 3NWGA 2RUSA 4JV5J 1FXRA 2OKQA 3D3BJ 1VYAA 5CYQA 1R8AA 2DRBA 4JOUA 4J91A 3M30B 4GVBB 2V6AA 2XSJB 2F3JA 1YJUA 2B8PA 4DX8H 4DFPA 2O01C 1KP6A 3ZTPA 1VBKA 2ZH5A 3BGFA 3D7SB 2VONA 3DYAB 2WHOA 2X3GA 5DM6Q 4QYZJ 1CS4A 3ETMA 2BBEA 4NCGB 4DV5J 3DHWC 4OHWA 2E5GA 2HHSA 2CQGA 4BHQA 2FB0A 3MR2A 4USUA 3V4IB 2ZH2A 4CM0A 2PMHA 3IO1A 1UEUA 1UW4A 4PXBA 1WHVA 1YX2A 3NRBA 1SVDA 4IRCA 4F4XA 4Q7AA 3FRZA 4M5LA 1BQMA 1HBUB 4AQYJ 1UVKA 2GHPA 3NGTA 5HVGA 4QYZK 5HJXA 1V3SA 2JLFA 1RT1B 1HFEL 1OSDA 4DQIA 1TL1A 5A8WA 5ETPA 2HAFA 2IDLA 3CCWA 2L08A 5ETOA 2ASYA 2X1BA 4N77A 4NX9A 4KBIA 3ZFVA 1RKIA 3VGVA 2D3O1 3FEXB 1CLFA 4EMDA 4DR2J 4U67Q 4CH7A 4LF5F 4OV1A 2GFFA 4DFMA 2ASDA 2NXCA 1Q53A 2F8HA 3AD8C 4TU8A 5J2QA 2OO4A 3VR1A 1ELOA 2LDYA 2UUBF 4MFBB 1R8BA 3N4WA 2RU3A 2KZZA 4M63A 2KYXA 3BSAA 2KVQE 2DD8S 3MPYA 2B4UA 2ROGA 3CCTA 2IYIA 1H2VZ 3QZ7A 3SCLE 4TU9A 4ZVSB 2Y0BB 4LFCJ 5DDRC 3FK4A 3KFWX 1KHVA 3PJWA 1R8PA 3I4HX 3DLKB 1FKPA 3MEDB 3CJ5A 4RW8B 2RVJA 4YQWA 4CNZA 4MT1A 2QC3A 5I3PA 3SSQA 2M52A 1NXIA 1S0OA 2BKNA 3T6JA 3LP0A 4HDHA 4A8WA 4C8ZA 4MIWA 3KK1A 3GFYA 3JYTA 3DI6A 2HWIA 4LF6F 4LFBJ 3H7HB 3N0VA 2DGVA 4ZLNA 1RKJA 4NE9C 4YEAA 5KT5A 3BYPA 3K5MA 1S0VA 2EW9A 1X7VA 1N48A 4PZVA 3PW7A 1OWXA 4DSLA 3M8RA 4CLYA 3DLLQ 2ZHAA 2W2QP 2N7CA 1IQTA 2C2EA 1Q81T 3D1OA 4ED6A 2AWZA 1HI1A 2W24A 2AJ0A 4ZVFA 2HZCA 4Y2CA 3CMES 3KHGA 2MLXA 3DLBA 2CQ1A 4X4VA 3DMJB 1S9GA 2YKNA 4NL5A 4F02A 1BXNA 3HLUA 1D8YA 3H59A 1S57A 2BJ3A 1S0MA 1K1SA 2EG1A 4U8YA 4DPOA 5ETNA 4EBEA 2UU9J 4RL1A 2ALYB 3KDNA 5GAHU 3I56S 3ZZZA 1Y3JA 5BXIA 5AJ3F 1FX4A 3L3CA 1ZBTA 4YR0A 1VBXA 2FJVA 4K0KF 5IC6B 3FEYB 4C8NA 4ZJQA 2ACYA 2J5AA 4RNFA 2CNKB 2K7KA 3QGHA 1RU2A 5A8RA 1HNIB 5C42B 2XNRA 2I9SA 5E3RA 4A8QA 1DURA 1MWYA 2F8EX 2ZH8A 2V94A 5T41A 2AP6A 2HBZB 1GX5A 4IQXA 2UVRA 1HPZA 4KO0A 2FPHX 2WZ1A 4OYPA 4DCJB 4QW9A 2YX1A 1H98A 2CJKA 2MSTA 1FVQA 2LKZA 1OQ3A 3R5CA 5LMUF 5BYQA 3MECA 4MH8A 3JAMY 4WP9A 3SYZA 5HQ8A 4TQRA 2CJ9A 3TJ9A 1NKEA 3RUBL 2IBOA 4KAIA 3OPKA 3PHEA 1F60B 4N56A 4OI3A 1IWGA 3W61A 4WFAQ 2O3DA 2QLJB 3W2VA 3GSIA 1VQ6S 4IH6A 3RAMA 4U7UD 1VC5A 1A9NB 5ETVA 3R5BA 4RBUA 5B0EA 3BN4A 1NUEA 5KFEA 4X4OA 2G13A 4C11A 3DU6A 1ZAVA 4ZJOA 1R43A 2PA8D 4MAKA 5DDQC 1IVZA 3ONQA 3AB2B 1KLMB 1NK9A 3OFFA 2B6AA 3FFIB 3M6WA 3THTA 2AF6A 2VQEF 2OFHX 3KJVA 1F9EB 2PMZD 1FDDA 3QRQA 3H5XA 3IP0A 5C25B 4V19J 5ETMA 4L73A 1LFPA 1GMUA 1RAEB 3BBBA 1URNA 1S6PA 1S1VB 1U1NA 4EFAC 1TUVA 1JXEA 3PTWA 4TKTA 5HROA 4I4BA 2VG6A 2RIJA 3C14B 1NHUA 5CD4A 3J7AN 3ZZYA 2ACMA 3SQGB 2IYGA 2ZJPQ 3AOBA 1LV5A 4RNMA 2Z2YB 3VGSA 4C0BA 1Q1KA 4WYLA 4OHYA 3GJRB 1OPZA 3DC2A 3KLGB 5KFTA 5I42A 1NDCA 4NMXA 1SQEA 3BGOP 1UEKA 1TKTB 3VZHA 1C1BB 1KQFB 2NCKL 2WB1D 4FF4A 4CNYA 4CI0B 3EDRB 4W98A 2YNHB 5GAEU 2B9WA 2YH0A 3LGNA 3EJMA 3JSRA 1Q8KA 5RUBA 6FD1A 4F67A 1K44A 1BGXT 2B0GA 3W9IA 2BW2A 2XWYA 4YY3J 4M5MA 2DR6A 3NOCA 2E44A 2JVOA 3FMWA 2EPIA 1S72S 1YWXA 1VRUB 1JLFB 2N3LA 3N79A 3G8SA 5CCLA 4Y00A 1U2FA 2VOPA 3WBZA 2I1RA 1FFSB 2MHNA 1VGYA 2DNQA 3D67A 1CJVA 4OJGA 1C0TB 2AIRB 2ZUGA 2BE9B 3C6TA 3DNCA 4DV4F 4HHUA 4Y2KA 1IKXB 3O44A 4B3TJ 4GO5X 1FTRA 3PCOB 3BQ0A 2KT3A 3CJSA 4CO0A 4L6V3 4YR2A 2APOA 1O5JA 4TN2A 3TA1A 1FESA 2LEAA 1OJ4A 4P2MA 3NKYA 4Q43A 3A8IA 1X4GA 2B3TB 4ZPWR 3I96A 2CQCA 4QPTA 2BVZA 2ZVIA 1QTNB 2F7VA 2ZH4A 2UXCF 2F4VF 3PW2A 3KK2A 3MR7A 2OEMA 1Y5NB 5I3UB 3MEEA 4CTAA 2IA6A 3I82A 1HBMB 2E5LJ 3VAKA 4DX7A 5SZTA 2MMYA 4ZVUB 3OR1A 3PYDA 4BCAA 1NRKA 3T1AA 1TU0B 2YKMB 2CZ9A 1NAQA 3KJNB 4UY8T 2HNYA 3L7OA 5DGAA 4OYMA 2AYMA 3N01A 1M1GA 2NXNA 2YNIA 1CJTA 3LP1A 2IAJA 3OUYB 2HW3A 4ZA1A 2JDJA 3ENWA 2MZJA 5E0OA 5KFSA 3HVTA 3KHHA 4NLVA 1ZTWA 3QSYB 1N33F 4DDFA 3MM6A 3IR5B 4M5IA 3MGJA 3LALA 3NGDA 1RTHB 1RAJA 3LO3A 2H51B 5CAAA 2VBXA 4GKKF 2XZTB 1RT3A 4KTQA 3CDWA 2XGQA 3RGIA 2NZ4A 1RT6B 2M2BA 4KH1B 4A8XA 4LBIA 1ULRA 1UA1A 3G82B 1WC3A 4GMKA 4AL7A 1SC6A 4AXIA 5HAOA 3GCXP 1BQNA 1WC4A 3OTOJ 3SDEA 2GIRA 3ZC4A 2DHAA 4FPIA 2NS1B 4ZVHA 2XWXA 1Q4RA 4OHVA 4FBTA 2SXLA 4JI4J 1FEHA 4KYZA 2Q66A 1TK5A 1N34J 3GQCA 5CA5A 2E7XA 2RS8A 4OYOA 4Q8EA 4C3MA 1R0AA 2CPXA 2PGCA 2H4WB 3BSNA 1YIJS 3BDPA 2PEBA 5KFFA 2VC1A 2JSXA 4CDIA 4DV3F 2OD4A 2XY5A 1B70B 4LIRA 1QVFR 2MDAA 1MROB 2Z57B 5HQLA 3QSIA 3MEKA 5KFBA 2NQPA 1DY3A 1OS5A 1SC3B 1YZ7A 1EP4A 5AE3A 2KO1A 2AT1B 4BC9A 3AOAA 3NOGA 2IM0A 2ADCA 2R8HA 3PHTA 2XMTA 4H54A 3JQMA 4QIWD 3A3OB 4X2BA 2EFOA 5HBMB 3M8ZA 2RH3A 2EFPA 2LEBA 3TAMA 1FK9A 3AD9C 1OIAA 1F5BA 4OHZA 4DUYJ 3GU0A 3VAFA 4Q8FA 1FO1A 1Y3KA 3CWJA 3EZUA 1Y9OA 2LXIA 4N5SA 2X1GA 4A8KA 1XC9A 2ZM6F 3Q2SC 2IMWP 4YR3A 5ETTA 1T7PA 1AUDA 1HL6A 3CSKA 5DM7Q 1ZZFA 2X3DA 4Y3CA 5F8NA 2WBMA 3CJQA 3JSBA 1FVSA 3KLVA 1PO6A 2WVEA 3OFHA 1N32F 4AL6A 4F0MA 1WOOA 2HZAA 4IG0A 1IKVA 2O5DA 5GADI 4ECTA 3TA2A 3G6YA 2H3EB 2AGOA 1F6TA 3N9UC 3CCQS 4J9UE 4ZIWA 2E9TA 5J2PB 3BGRA 5FD1A 1HNXJ 4DR7J 4CYUB 4ED4A 5HLFB 1QAYA 3M2VB 1JK9B 3DLEB 3M7VA 3PIPQ 2EBEA 2NXEA 2I5JA 4CZCA 4A8SA 1PJ7A 1EB0A 2XB2D 4DJBA 3TJ8A 4OFZA 3BR9A 3CO0P 1FCAA 1T94A 3HVRA 3DOLA 2HHXA 1C1CB 2GMHA 5D78A 3NGSA 5L1KA 2HSEB 5G4DA 1PC4A 1V5IB 2MQ8A 2QYGA 4F04B 1HHSA 2KJVA 3CJKB 3MEGB 4NEZA 1RBLA 5IS2A 3F44A 2UUCF 1C0UA 5JJBA 3ILJA 3BH7B 2AGPA 3H8YA 2ASJA 1F3FA 1Q8IA 4KGKA 2F9JA 2V5HG 1MMDA 2CKWA 1HYSA 2IRYA 1W2BR 2QYCA 3AY0A 2FHOB 3L7UA 4UQTA 4I68A 3MFIA 1P27B 3LAKA 1F3VA 3FZ2A 3R2DJ 3GYGA 3DLGA 2IRXA 5CYJA 5DGBA 3E01B 2GC8A 2IM1A 1ZTTA 4EEYA 5A6PA 2UV8A 1FRLA 3CF5Q 1HBNA 3ILLA 1RU1A 4P2XA 3BQ1A 2PN6A 3KG0A 5CZXA 2ZE2B 1QE1A 2U1AA 2ZD1A 1MU2B 2DISA 2LVWA 3ZZTA 2FZCB 3FCVA 5KFCA 1PKUA 5LT5A 2ZNZA 4IYQA 3UPFA 4TQSA 3HPOA 1S1UB 4KQZA 3P5BP 2RKIA 2MYFA 1T95A 2EFVA 3KJQB 2BDPA 1U1RA 2CDRB 3KUGA 1VQSA 2MLYA 1N8RT 2KT5A 3RRGA 3CD7A 4A4JA 5K20B 4B9UA 1FDBA 1HW9A 5KG6A 3DM2B 2JHEA 4MYUA 3GZ7A 3QT8A 1K9MT 3BKUA 2RMLA 4KB7A 1NMEB 2IY5B 5LJ3Y 2VDHA 1DQAA 2HVHA 5F8IA 4YHHJ 4Y2AA 1B7FA 4FS1A 4JV1A 2CJBA 2F4FA 2FVCA 2ZOMA 3IXQA 2E7WA 4CLWA 1N52B 1TUGB 2R3VA 2LEPA 4ANDA 4IDKB 5DJBA 1RTIB 2DNPA 1KDNA 2I6WA 4DSKA 3QIPB 4DQRA 4XPEA 4WXOA 1UP1A 3P5TL 2GGPA 4AE5A 1RTJB 2HG4A 3FBFA 3TO8A 1D3WA 3SI8A 3W62A 2AYEA 5IT9Y 4OLPA 1FX2A 1FRXA 3I0RB 2F40A 1ZA2B 2DNLA 1VRTA 2WRMA 1E6VA 3BSOA 5L8RC 1P8GA 3FJ2A 4ES3A 2DGXA 3CCSS 4HL9A 3BO3A 1J5OA 1TKZB 1T9WA 3AA9A 4DL2A 3US5A 2CQ4A 1SKWA 1N54B 1SL2A 3RTVA 1N6QB 1Q78A 4O3QA 4NA2A 4JI0F 2DTJA 4TY8B 1YRTA 2FD2A 2QRRA 5LMNF 4O0IA 1TKDA 4ZP6A 2FJWA 3HHLA 1LXNA 1RAHB 4OZNA 4NZ0A 2YNFA 4NEYA 2HHUA 3QFHA 4X64F 4K2XA 4NLUA 2V2VA 4OQJA 1S12A 2K3KA 2Z56B 3B4MA 1S79A 4FXVA 3PRBA 4ICLB 3KUHA 2RRBA 3JTOA 1GXLA 4Q44A 2PFFB 1U48A 3OFEA 4JI8J 1DTQB 2CVIA 2N82B 2PSZA 3DGPA 3SIPB 3WHIA 5D8HB 4JI5F 5F8MA 1CULB 2B56A 2DITA 1PSDA 2BE2A 2KRBA 1TP7A 2Q79A 1TUWA 3KWMA 3F73A 3H2UB 2V4QA 4M5NA 1B0TA 1E6YA 4XTTA 2UXDF 2FZKB 4B9VA 4TLRA 1ZA1B 4ID5A 4DFJA 4B3RJ 1S77D 4QWDA 1RLCL 2G4BA 4KGXB 3HHKA 1MNEA 2ZC4A 1J2VA 2M3DA 3B82A 4Y65A 5J2MB 1SCJB 2VQFF 5K5MA 5G0RB 1IJEB 1IKWA 1PGZA 1RBAA 3UFCX 3KLFB 2KB2A 2EC2A 5L1LA 4J9LA 1XQIA 1QSSA 1XNQJ 1QTMA 2LA4A 2VFVA 1FNOA 3PNIA 1JX4A 1RT4B 2LP4A 2EKNA 1S1XA 2I2YA 1I94J 3J7YI 1KKHA 4PWUA 2HNDA 4UOHA 4MKAA 3D6HB 4FVMA 4BBYA 4WU3A 4KRWA 1IUJA 3G86A 4DUZF 2VHGA 4BC7A 5GAGU 4IOAQ 1RISA 4H4MB 5D0RA 1U1PA 1SJ4P 3PW4A 1RT5B 2MKIA 3C19A 4USVA 4LQ3A 4NXNJ 3K8WA 3ZTQA 1WG1A 2OPSA 1N36F 4DZDA 3KMSA 2YNGB 2HQGA 4P7VA 1X9SA 1HBOA 2HNZA 3LWMA 1UZDA 2DNYA 3H2VE 3NG8A 2GMJA 3OJUA 3H98A 3TEGA 3GFHA 1WI6A 5L39A 3M2RB 3M8QB 5KFNA 2AJQA 4LF8F 3LA0A 1TL7A 2D69A 3W64A 1HR0F 5KG3A 1IBLF 3RR8A 1FKAF 2DGWA 2CZVC 3GWCA 4F4AA 2E9ZA 2HQIA 2CPJA 3W66A 3OL7A 1M5OC 4LF9F 4X62F 4OV6A 4JI7F 1YJVA 3ZTRA 3G96A 1XMOF 2B4PA 3R5JB 3ETOA 3HSZA 4B9MA 3LUYA 4LFAF 4I1TA 2BRKA 4X65J 3TAQA 2MZSA 3CDEA 2FC9A 3LOUA 3VZIA 2B8QA 2KTQA 3CC4S 4JP8A 4OX9F 5KT3A 2BR0A 2O66A 2PA3A 6FDRA 2XMKA 2VA3A 3FSXA 1EKRA 2GVDA 1SL0A 1VQKS 1AZSA 1Y10A 2N7YA 2LXUA 3C46A 5HANA 2CIMA 5IWAJ 3NNCA 1IR0A 3M1VA 2AGQA 2WSFC 4NA3A 4NYOA 2RJZA 2Q1LA 1JLGB 4IG3B 3KMQA 5D0EA 4YB1P 3KLHA 2NPIA 5DO2A 5AXMA 2K1RA 3W8GA 5BYSA 1SXLA 3MMAB 3MPWA 2D9PA 1RWWB 2H5JB 3I31A 2MKCA 4ID8A 2L9DA 4Q2LA 3POTA 2W2NP 4ECYA 2OJ3A 2HHVA 4IO1A 1RI7A 1IKYB 1HNVA 2C3YA 4URQU 1OYDA 1AW0A 2R7WA 2V0NA 1HW8A 2JH3A 2Z30B 2YH1A 1WKKA 5D4OA 5F8LA 1T03A 2XLKA 3JXOA 2EBGA 1SKUB 1GAOA 1KS2A 3TARA 2W9CA 2FY1A 4KFBB 4I6WA 2GVZA 4LSNB 2HFOA 4KGVB 2CJXB 3QNWB 1S99A 3CJ2A 2WVBA 1QSYA 2B5JA 3NMAA 1RAOA 2DJWA 1JJ4A 1WD6A 5LOQA 1X5TA 2IM3A 1PAUB 5HMYA 3TR5A 1XNRJ 2W2OP 2MGZA 5DDPC 2FIUA 2C42A 2NXUA 1UJ4A 3OXGA 5CYMA 3OLAA 4IR9A 2FJBB 2QL7B 1H3DA 4RR5A 4NLGA 2R8KA 2LMIA 3J7ZT 3BN7A 1YKWA 3ZNJ1 3BREA 3DDIA 3DXBA 3RBZA 4Z7CA 5F3TA 2VD3A 3BBFA 1EJ7L 3GJTB 2VG7A 1IBKJ 1HI0P 3DU5A 2M7SA 3NWRA 4QW8A 2VODA 3GSDA 1YJ9S 1IQZA 3HO1A 1FDNA 4IFYA 2J9DA 3J80Y 1GQEA 2FHJA 1WEZA 4HTJA 4PUOA 3UVJB 1FE0A 2WTFA 4G1QB 2VF3A 5D77A 4M5JA 4DN9A 3MAHA 1WELA 1FWKA 1HARA 3AH6A 4DV1J 1G6BA 3BSCA 3IWNC 2EC0A 3TEHB 3NBPB 2P5VA 3W8PA 4PYAA 2HMIA 3M8SA 1B99A 2DB1A 2OSQA 3OXLA 2E1MC 2Q6CA 4I2PB 2HHHJ 3QIDA 1DTTA 3W2WB 3THVA 1UFLA 2IIHA 3LP2A 2CG4A 3GJQB 1SPBP 1R8HA 3UCGA 4BLGA 3H5SA 2HYIB 3I5BA 3D6TB 3QGGA 4IUFA 2HWHA 3JQJA 2GZOA 4X66F 3UR0A 3S8SA 3PY8A 1IBMF 1HNWJ 4MKBA 3K5OA 3NP5A 4CLZA 5IOLA 1FE4A 2DR9A 1AXQA 2FVRA 3QGPA 2UVUA 3AXMA 4LRFA 4MK9A 2VA2A 3VQTA 3TUIC 2YKPA 1F0XA 4ED8A 1V9OA 4B08A 4K4ZA 4AXJA 1EKSA 3NL0A 2E9RX 8RUCA 5F9LA 4CIOA 3QT7A 2WK4A 4K7QA 4PG5A 3VAHA 5KFDA 1YJNS 1KONA 3FKBA 2OTLS 1AT1B 2B7CB 2EFGA 5J1EB 3TZXA 1B4SA 2CJYB 4WZMA 1WDDA 4JYAJ 2G2ZA 2QJ3A 3UN5A 1RAFB 3E3XA 6AT1B 2BJ7A 4DX5A 5D4LA 3DOKA 1MSWD 4R8UB 2QSFA 5HP1B 4WYWA 3K5LA 2XC9A 1SC1B 2V8GA 2C2DA 4ZVGA 3GFXA 4P2SA 3TZZA 5HMZA 3Q2TC 3RAXA 3PR5B 1R3NA 4K4TA 5CYQB 5EX0A 5F0WA 5B0FA 4DR4F 3ELHA 1WKLA 4DV0F 2G2OA 1W2IA 1MMLA 2YKQA 4WFNQ 4KV8A 2CA9A 1U6ZA 2BZ2A 1S10A 2UVVA 1IWAA 5K9FA 1SJ3P 5KG4A 2V8PA 1HNZJ 1CS4B 3Q83A 1I3OB 1TK8A 1WORA 1PJ5A 2BKPA 2CRLA 3GJSB 4ZPCA 3BZQA 1KTVA 1APSA 1KVIA 4CT8A 2N4CA 3ITHA 3I0SA 3Q8YA 1I6JA 2GS8A 4AYBD 2R2RA 5BR8J 1BQMB 4OI1A 2HZVA 3M6XA 3W9HA 1T3OA 1Q16B 1TL1B 4QU7A 5A8WB 2HGLA 2VFTA 1KFDA 4DR1J 1SB6A 2B7BB 4USTA 5A2QY 3H2LA 1V5VA 2JVRA 2KRRA 1JXVA 4B3SJ 1UVIA 1D0EA 4Y2MA 3MAAA 3D5MA 2HS4A 1G4CA 1LKZA 2FVQA 2ZBRA 1UWBA 2O67A 1QVGR 2IDEA 1IR1A 4K4YA 2OPRA 2XO7A 3CCUS 3HKZD 5IT0A 2KG1A 5J2QB 2KJWA 2AU0A 4QQBA 1BUXA 3GG1A 5DLGA 1S7HA 1FFGB 2DH9A 4P74A 1YLXA 2NUHA 5KAKA 3TW0A 3CJTA 4NI2A 1Q79A 1Q8LA 3H5UA 3C6UA 3CULA 4PG6A 3ENQA 2OMOA 3Q8RB 1W26A 4ZDNA 3W5XA 3GYXB 2IM2A 4JI2F 2KHDA 3GPAA 2YWHA 4G1PA 4MTPA 1UKUA 1FKPB 2DKOB 2QIFA 2V34A 1PJ6A 3IAM9 2D1CA 1HQUA 1YHQS 3W63A 3ZZRA 3RB3A 3R7NB 4R0JA 3LP0B 3MDFA 3JQKA 3KK1B 4UOCA 3JYTB 3DI6B 1XIQA 2GW8A 2FGOA 1KSPA 1WC6A 2MLZA 4PEOA 4P52A 4K5SA 3NMRA 2L3MA 2GV1A 3D4JA 1ICEB 2CWXA 1SI9A 2ZH1A 1FJGJ 1X0FA 1IN0A 1Y11A 3PXGa 2X51A 3M6UA 4NZ6A 5KFLA 2VDIA 1CVJA 1IM4A 4LRDA 2YX4A 4QU6A 3AJDA 4JI6F 3NLCA 3WX4A 2MQMA 4RW6A 2HBQB 1TKXA 3MAQA 2Y1IA 4FXWA 3T5KA 1RT7A 1S9GB 3AXKA 3HSJA 2XTJP 4LQ9A 1Q5VA 1P1TA 2YKNB 3HT3A 2Z2MA 3O8WA 4ERDA 1GEHA 4ALZA 4ZVQB 1PAEX 4TXSA 1VCTA 2VG5A 3MM9A 3MM5A 1H2UX 2FTRA 1M5PC 1OQ6A 3SFGA 1VISA 2IMOA 2HFZA 1T05A 3W1YC 5KT6A 3A8JA 4WWSA 2HHTA 3T19A 2V4JA 4MIBA 4ELTA 4FBUA 2QFJA 1NH7A 2LQ8A 3MUTP 3HXMA 4QIEA 4DMZA 3LAMA 4GKJJ 1NDLA 2M5YA 3I9ZA 2CUYA 4NZ7A 3B8HA 5A8RB 3H20A 3SSRA 5LM7E 4XDCA 4KC5A 1R8CA 5L46A 4QWCA 4KGMA 1VI7A 2YXLA 5E7OB 4C8OA 3L4BC 1HPZB 4KO0B 1LWCA 5B09A 3PX4A 2QMXA 3MXHP 3IR6B 1S59A 3FC9A 2P9CA 4DV2J 5DZ7A 2FHJD 3P3DA 1RHUB 1TZ0A 2AEJA 3EE3A 4DS5A 2A2DA 3MECB 1Y4ZB 4OZJA 3K17A 1DQ9A 1SC4B 5B08A 2UUAJ 1LK5A 3HHEA 1HQEA 4CP5A 1WEXA 4BWJA 3W2VB 4J9NA 3PKMA 3FEZA 3CCRS 4I2QA 2Y1RI 2GA7A 2YTCA 1FRIA 2BYCA 1N5YA 1H74A 1YI2S 3D9BA 4C11B 4WK1A 1TL4A 2AYBA 4FYXB 1HD0A 3IS9A 4FKYA 1JJ2R 3HKWA 1SQGA 1F5AA 1FDAA 1JMTA 1U6BA 4DV7F 1LWEA 4DS4A 1RTZA 2B6AB 2I0XA 3UD4P 5D0GA 1BD6A 5DG7A 1AROP 4QIGA 3KJVB 3KTQA 4ZVTB 3WIVA 2FJDB 2MKKA 1S4EA 3NS7B 4C8KA 2QMUB 3I55S 2F8MA 4JI1F 1LXJA 5K14A 2ILZA 1S6PB 2ZITA 3VVTA 1T02A 2LU2A 2M70A 3OR2A 3SV3A 1U26A 4ETXA 1SJRA 3HK2A 2CAJA 2DEIA 5HROB 1UPPA 4L72B 4LR7A 2VG6B 4C8MA 4PQUA 3JAMU 3ZO7A 5KTQA 1EETA 2B9EA 1VDHA 1VHFA 4ZVEA 2IC3A 1KQGB 2XLJA 3R9LA 5HQMA 1CG2A 2JC0A 3QJJA 1PBUA 5GAEI 4YUDA 5D6GA 1N0UA 2OPQA 5I42B 1S4FA 2LA6A 4KY3A 2PE8A 2PEHA 4CO2A 2QG9B 4YDXA 1KOHA 1MWQA 3DGVA 4LSZB 3QRRA 1SIZA 4ZHRA 4EWTA 3IM9A 3GV7B 4NXMJ 4DR5F 1FTCA 3OSNA 1S6QA 1GXUA 2KM8C 4Y2IA 3QO9A 4R0EA 4FF2A 1XMQF 2K7JA 2XS2A 4DSEA 3MPDA 2K8GA 4M8LA 5KFQA 3EM1A 1U1KA 3D28A 5KFUA 5B0GA 9ATCB 3FQKA 4PR6A 2HFVA 2CPYA 2GQCA 1CJVB 2MZQA 2ZKUA 3IC1A 2KYZA 2P6TA 3JS9A 2Z0GA 1RSCA 2MPUA 3C6TB 3QLHA 5C7PA 3P8BB 2QLWA 1OO0B 2F63A 1RTDA 1SH3A 4L74A 1GTHA 2KHCA 1CJUA 3OBIA 1Y0HA 5C2GA 3AAWB 1WC1A 3LGHA 4ES1A 3IMQJ 3QAUA 4R25A 5E3CA 3HDSA 4F3MA 2UXBJ 4DXLA 1MLAA 2AW0A 1VQ5S 3HT0A 1UETA 1U8SA 1GMWA 4C8LA 3FCWA 1EHWA 4RX6A 4H4KC 3KK2B 2D41A 2K06A 4DR3F 3CT9A 4DG1A 2J9EA 3MEEB 4LT6A 4DOZA 4OZ5A 5D4NA 4OYIA 3T1HF 2VASA 4DR6J 3TYTA 3OR1B 5HL7Q 3KG4A 4WP3A 3UE2A 1D09B 1QY7A 2DNGA 2ZC3A 2ZWPA 1N5SA 4O4GA 3T1YJ 3AJ1A 1U24A 2F1FA 2BM0A 3M8WA 4LUBA 4ZS6A 1JNRB 4B9LA 1BQXA 1QD1A 4OZLA 4OI0A 1S49A 1JLAA 1URRA 2YNIB 1CJTB 4ZCKA 2JWNA 2HBRB 3LP1B 3MTKA 2IAJB 2XZWA 1NJWA 5A8KA 3IRXA 2XLIA 2R7UA 3R7SB 3HVTB 4GC7A 3SSSA 4Y28C 1NB2A 1WI8A 1CQNA 4WIIA 1FFWB 1F9HA 2XO6A 1RT3B 2Z8QA 4WP8A 3K59A 4MYTA 5DETA 3DRPA 3G2XA 2DRDA 4R5PA 5HJYA 2XI2A 1L3TA 1MROA 2OELA 3RW6A 1BQNB 1VOMA 1SV5A 2H4YB 1FA0A 2J9DE 4ZN3A 3PFOA 2E1CA 3SDEB 1CC8A 1NPRA 1VQPS 4OX8A 3HJFA 1QAJA 4F4YA 2BA9A 1NM2A 2C3PA 2W4PA 2HAIA 3X1LB 1F2GA 3ZZPA 3EMTA 2AV5A 4ECWA 3C3LA 4DL6A 5CCMA 3WX8A 3F41A 4YMEA 5LJ5Y 1XEZA 2GJFA 1R0AB 1X4AA 4I7FA 4CO5A 1UWAA 2BJEA 2V8VA 4DF8A 2P6SA 3KKFA 4F25A 4WZQA 4GVLA 4XAKA 2C3UA 1B0PA 1HWJA 1YJTA 1MG7A 3D1QA 3PX6A 4KH0B 2FGCA 3QBCA 2AJ1A 4QIVA 2NUUG 1EP4B 2BEFA 4I64A 4C3KA 3K58A 3AJ2A 3A3PB 4O0NA 4JI3F 2FHKA 4LF7J 2OFGX 4DPYA 4ZVRB 2Y9HA 4C48A 4IR1A 3OTCA 3TAMB 1FK9B 3IG1A 1M0SA 1BWVA 2BJ9A 4B3MJ 2J8SA 2YWWA 1GTEA 4ZK7M 1S1WA 1RDRA 2W9BA 1M5KC 1TL3A 4MKYA 3UD5A 4DV6J 2QA4G 1WACA 2YQ1A 3GCWP 3UDVA 5KOXA 3EYZA 4NLPA 2XS7A 2IVYA 1ZETA 1P6TA 1AA1B 4K8RA 1RYRA 3KJFB 3UDCA 1J5EJ 4OYBA 3PIOQ 2N3OA 4CLUA 2YKOA 1KFSA 2M9KA 1VQ8S 4IG0B 2HHPA 2QA4S 1IKVB 4F26A 1SKSA 2ZH6A 2E1AA 1WDTA 3SEOA 2RNEA 3WQPA 4ZLJA 4DL4A 3BGRB 1BLUA 3VAIA 3M6VA 2ERRA 1RQ0A 2XHWA 4RU2A 2W01A 3CDUA 2J6TA 4OI2A 3V81A 4J9MA 2CNNB 2I5JB 3C16A 4HH1A 1XBWA 1ITPA 1L3SA 3RU0A 1NJYA 2HKEA 3FRYA 2D9OA 1WUUA 3O3LA 1O6XA 4RW9A 3PKYA 1RWKB 4LRCA 3DOLB 1NZ8A 2DY9A 4OL8A 5K8MA 3EVMA 2CPFA 1PBAA 5F9NA 3ICLA 3CD0A 4CCHA 3R5GA 2XULA 2XMWA 2JL9A 1C2PA 3U7JA 4WTOB 4GRSA 5H9EK 1C0UB 3VGUA 1AFJA 2UUTA 3BEGB 2U2FA 1HYSB 2LQ9A 2E1PA 4KSEB 3S1TA 2GQQA 2B9YA 1CSJA 3V6HA 4Z37A 3L09A 3C66A 4LF5J 5B0AA 3DLGB 1VHIA 3HM9A 3OL9A 1P1LA 1H38A 1VQOS 1HBNB 2IVFB 2UUBJ 1AUSL 1U1QA 3VTIA 2G0JA 1QE1B 3I87A 3W9JA 2CQHA 2ZD1B 1U0HA 1T9VA 4PAAA 4YB6A 2DXDA 2M8DB 3K8VA 2YWEA 3MR5A 2VKRA 2VJVA 4X4RA 4YB5A 2RKIB 2VZ9A 3ENVA 2WVCA 1R0CB 3D3CJ 1U2CA 3EVWA 4IH5A 2DY1A 1WC5A 2NYHA 3NS6A 2K2PA 4LF6J 3NAIA 3FBEA 2VPWB 3PR4A 4IH7A 3FCHA 4FVCA 3ZTSA 1NSKL 4U96A 2RT3A 4CLKA 3KLIA 4RW4A 2VV5A 2R7SA 3W65A 1NLKL 2IJRA 2P8IA 2GIQA 2DYAA 1Z1ZA 5ETKA 2MKHA 4XDDA 5IQQA 1LOUA 1MMNA 3GG0A 2GGPB 4E0DA 4FP9A 1XJWB 4QWBA 2V2QA 3R7BB 5BYRA 3KXDA 2VFUA 3M05A 4KHMA 1Q0NA 2GX8A 2HRUA 3CTRA 1GMWD 3EX7B 1JLBA 3D0IE 1A0OB 3BJYA 1VRTB 2OPPA 1E6VB 4OIXA 1HA1A 3OTEA 2PDAA 2HS3A 3MWBA 2AQ4A 4DSIA 3QWUA 3DCAA 1J5OB 2DGSA 3LGMA 2PI4A 1R6VA 3SZ2A 5AJ3J 3TJAA 2YBVA 3J81j 1DQ8A 2AX1A 5HK4A 4P72A 4K0KJ 3G87A 2D74B 4NLDA 4V1Ak 2OLWA 5EGYA 3HHLB 4J9KA 4J9PA 4M5KA 1MN9A 4CO4A 1NO8A 5MLCV 2YNFB 5IM0A 2V50A 4ILMA 4L76A 4ITSA 4C6AA 3CJ3A 2B4VA 3B6BA 5I4MA 3M4XA 4HHJA 1FD2A 1UTAA 4ECQA 3KDOA 2FLOA 2W25A 3KYLA 3RB6A 1T8EA 2B4OA 5LMUJ 3NNHA 1UZHA 1S0NA 3DGPB 2RQ4A 2LQ5A 4Z7YA 1T3NA 4UOGA 4P73A 1TV6A 1UFKA 5J1PA 3UQSA 2BE2B 2XSFA 2AJFE 4O3RA 3VAGA 1JXLA 4KR0B 2JJ4D 5IT9U 2BM1A 2CQ0A 3GTYX 1E6YB 1JB0C 3CCZA 1YRUA 2M0GB 3M9OB 4ECRA 5KFKA 5FDLA 1U25A 4FXDA 3HZGA 4ID5B 4YDDB 2DIUA 4WFXA 1DZ5A 1RABB 3IGVA 2MQNA 1UJ5A 2HRYA 5E2QA 4W4MA 5AT1B 2ZBCA 2OHDA 5ETQA 5CQGA 1GK8A 1G7CB 1IKWB 4P71A 2JFKA 3FBCA 3HCXA 3HFVA 1RE1B 1Y7PA 4KKOA 2VQEJ 3PACA 1OYEA 2UVWA 1S1XB 4F2RA 2J9CA 2HNDB 3THPA 3M8PA 1X5SA 2QTWA 3H5YA 2HIYA 3K2YA 4LSLA 1EQ0A 3T41A 2ZJRQ 2D3ZA 3HSDA 4LRBA 3OSPA 4XPCA 5EHHA 3G6ES 2C2NA 4LF4F 5K8PA 1SJ1A 2ZBQA 3WDOA 2HGMA 3QZ8A 2HHQA 2DXFA 2OPSB 4WKRA 9RUBA 4EBDA 4KHPF 1HBOB 2HNZB 3WC0A 2UV8G 2QLFB 1UMJA 5KG1A 4PKDB 1L3UA 1U02A 2DGTA 4X84A 1KHWA 1TL7B 4MK8A 4P75A 2R8JA 3QYYA 2FQQB 1RZMA 2XZDB 1I5OB 4UZCA 3M32A 3PJ9A 1NH8A 4NWBA 1UAWA 3B78A 4OX7A 4G1IA 4WPAA 3CCMS 4OI6A 3PVXA 3MR6A 5F8JA 1R6YA 3MF5A 4DI6A 2GVDB 2QO3A 2ATLA 1YJ7A 1NK6A 4WE1A 2GJ2A 5IFMA 2FJXA 2OUGA 1AZSB 4C7QA 4J5OA 2DO0A 3CD5A 4YFUA 5KFOA 2AHOB 5ETSA 2AD9A 2AZ3A 4NYPA 1VLYA 2M4MA 5D15A 1IBCB 4DV4J 4C8YA 4JB8B 3M1VB 4UT4A 1YQHA 1IR2A 2F5GA 3BF4A 3ZZUA 3A4TA 1SKRA 3T3FA 2MSSA 3IBWA 1X5OA 5E5NA 5FLXY 4EUVA 5JVGQ 2P9EA 2K1RB 4FN5A 3BBCA 1FRMA 4NLYA 3G71S 2HLTA 1R7IA 4NLXA 4K4XA 3VV2B 4A8MP 4W92B 1SBRA 1U0SA 1VQ7S 2LXFA 1PC5A 3OL8A 3RZAA 4M94A 3POTB 2I38A 2AJ2A 1HNVB 2HVZA 5HN0A 1S9FA 1NNDA 2UXCJ 3R5DA 1Y00A 1RT2A 1VIXA 5MAOA 1QUVA 1T03B 3DRRA 3CO9A 1RAAB 2UUWA 3EDQB 3A3NB 4IOBA 1S9EA 3BO4A 1WSRA 2W9CB 1X4CA 2GVZB 2OI2A 2YWGA 4LREA 4F7VA 3GV8B 2AEMA 1NPKA 2B5JB 3Q86A 3QMQA 2H54B 2ZH7A 2OGUA 3D54A 4FDFA 5SUHA 4B17A 1Q86T 4ANEA 3MPUB 2MQOA 4DHVA 2FLLA 2WVFA 2RE1A 3O1LA 2MGZB 3TP2A 2W7AA 4JV5F 5CYMB 3MI7X 3MFHA 1NK0A 1XERA 1Q8BA 5C24A 4ED5A 1D9FA 4ZIVA 1D8ZA 2ATCB 4B02A 4M5DA 3IM8A 3V2UC 1N33J 4ED3A 4QZVB 4O3SA 1PYSB 5AXKA 5B0DA 4ZCLA 2R8IA 4MJKA 3KG1A 3JSMA 2LU1A 3LPEA 2VG7B 4GKKJ 4CLPA 3MMCA 1FJEB 1UJ6A 3P6YC 2XEXA 2KFYA 1UEVA 1AYEA 3TOQA 4IFYB 4DV5F 3EGWB 2R2SA 1VQLS 1UW9A 1UVMA 3UNGC 5GMEA 2ZVSA 3AFGA 4PUOB 2G0IA 5GMDA 4JV2A 3PDNA 1RWXB 2I8EA 3KK3A 2XY6A 2PD1A 3UW1A 3CIMA 1WJ9A 2MZ1A 3HD2A 4ED7A 2NSBA 4DUTA 3D0GE 2H1YA 4AQYF 3BQ2A 4URSA 4RZRA 3F56A 2FY8A 3D2WA 1D9DA 2AX0A 3D0HE 2HMIB 4NOHA 3PEHA 3VWSA 1MWZA 1WOPA 2JC1A 1DTTB 4HI1A 1ZYQA 3LP2B 2H48B 2HHWA 2Z2LA 4OHXA 4Q5VA 4DV3J 4UF4A 1H0HB 1TELA 4BWMA 3CCJS 2OEJA 4QOTA 3CCES 3ILOA 2GAHC 4DR2F 1ZM9A 1X4EA 3Q89A 2HFUA 3PW5A 2C1EB 4UW2A 1VR6A 3RAQA 5LSRA 3SQOP 1U1MA 2BQ3A 2CPIA 4ZPVR 1RCOB 1LW2A 2E29A 3A8KA 1WTFA 4AL5A 3FVYA 1RHJB 2ROPA 3PFEA 3NAHA 3J80U 4MKVA 2EVZA 4IO9Q 1F5CA 1LNQA 4XO0A 2RQKA 2HLUA 2GNKA 3EGVA 4LFCF 4WCEQ 1J27A 1RWPB 5KFMA 1Q7LB 2ZM6J 1L3VA 4FZVA 3C15A 2XQCA 3NY0A 3AA8A 1FERA 3R27A 2CPHA 1S48A 1NSAA 2KH9A 3DOKB 2DBBA 1XK8A 4DWIA 1NBEB 1N32J 4NLRA 2G0CA 4K50A 1VIOA 4LFBF 4DLEA 1NSQA 2QZ8A 2ZJQQ 3HVAA 2A6MA 1VLOA 1YTYA 4O4RA 2VFSA 3GR1A 2XS5A 4ELVA 5LXRA 1V6HA 1KEKA 2Y1LB 1A6LA 3I32A 4DU8A 3MMBA 5KG7A 4CO3A 2COLA 3M2UB 4WKYA 3D6FB 3LW5C 1RHMB 4YN3B 2QEXS 4KV8B 1CJKA 5DRKA 5F8HA 2BANA 1O0PA 2VB6A 2BOPA 5L9XA 1LWFA 2DXEA 3CNQP 1WHYA 4ER8A 5M2UA 1JLCA 3UCUP 4E98A 2YPZA 3GIKA 2Q3PA 5LL6d 2MKJA 3EWGA 1DAXA 4KPYA 3HMJG 1U09A 1T9TA 2H65B 4TNOA 3I9V9 2VBYA 5D0HA 5L1IA 1KQSR 4DU7A 3ITHB 2RUGA 3J81Y 3I0SB 2KXFA 2XY7A 2JEFA 3QGIA 4ZITA 5CH7B 2UU9F 2UUCJ 1CEZA 1K0VA 1HWKA 2RRAA 3TAPA 1U1OA 2GMLA 7FD1A 2WONA 1KVKA 5DDOC 1RUSA 2V9WA 3R97A 2YPYA 1GXTA 2YVSA 3AT1B 3RJMB 4LMZA 3QT5A 5AE2A 2R2TA 2D3UA 4EGLA 1NK5A 2R8GA 2KXHA 3VCDA 4UY85 4IFVA 2J76E 2K3IA 4ZP7A 3MAAB 3GV5B 5D3GA 2QA2A 4XIUA 3EPGA 1GT8A 1UWBB 3KLEA 4N47A 4AFFA 2E5IA 4NA1A 7AT1B 4DSJA 4OYZA 3KNAA 4BDPA 5IT4A 2VPZB 2OPRB 4DPXA 3RRHA 1IM6A 7FDRA 3PO5A 1RGVA 1Z4UA 2HEKA 1TVRA 4PWDA 2RF2A 1VBYA 2W8KA 4QIFA 1FJ7A 5J2NA 4IRDA 2R42A 4B9NA 3DRXA 4C0HA 1U47A 4NI2B 1RA6A 1T0TV 2BACA 2WOMA 2W1BA 3C6UB 1VC6A 4HHHA 2MTLA 2WVDA 3IWLA 2UZAA 4H4OA 3EICA 3MCMA 2A10A 1R89A 4RUCA 2IFXA 2UP1A 1SJFA 2DNZA 4CLLA 1NKCA 2A18A 1NK8A 1L3KA 1HQUB 4ZPBA 2F65A 4I6YA 4HACA 2J6SA 4A47A 5K8NA 1FHTA 3SCKE 5T7LA 2Y1JA 3LPYA 5KG0A 2FJEB 3C2PA 2OTJS 1F9FA 4WIQA 1SH2A 1NDKA 1U7LA 3NGUA 1Q82T 4OJ3A 5LSOA 2W2PP 3HF5A 5A2QU 3PO4A 3FBBA 3SMZA 4Z2XA 3HP6A 3CCLS 2V9KA 1RP5A 3MM7A 4UUXA 1GH8A 2PO4A 4AD6A 1LW0A 2OP5A 2ZHBA 4DBQA 2WB4A 3U1NA 2X7IA 4HDGA 3ISZA 1NB7A 5LSLA 1DHMA 1Q5YA 4RW6B 4ILLA 1TKXB 4IOCQ 3DDNA 4DF4A 1X4FA 2Z58B 1H72C 1WC0A 2Y0SD 1FXLA 1RT7B 1WOSA 3GIJA 4C98A 2HRTA 3W5YA 2V63A 1U45A 1HD1A 2JZ5A 4F4WA 1F2HA 3V6DA 2CQBA 2HFNA 5BJRA 3PYGA 2VG5B 4JI0J 1RHRB 2ZWOA 5IXUA 3MM9B 3MM5B 3PV8A 1ZH5A 5LMNJ 1T05B 3KHRA 3BS9A 2DK2A 3UCZP 5EN1A 2RU9A 1FD8A 2V4JB 4DCPB 4X64J 3B4DA 4HI2A 3DN9A 4J90A 5LXYA 4NYZA 3K7RA 1X60A 3OV7A 4DQSA 2J7KA 4NLTA 1FEEA 4YY3F 5HVFA 2C2KB 1XR7A 1V3RA 2GHVC 2HGNA 2KM8B 1QUPA 2KT2A 1Z2ZA 1LWCB 3T5LA 4JI5J 5H9FJ 2XCAA 4RNHA 1VMBA 2CVEA 1N0VC 4BS2A 2CZ4A 1REVA 3ULHA 3CDAA 1K1QA 2ZBPA 5DLFA 4DLGA 3G8QA 2WW8A 1UFWA 3OD2A 4RW7A 2UXDJ 3VGTA 4J9QA 4B3TF 2R2UA 5HMXA 2MQPA 3BKTA 3NXZA 2DIVA 5JMNA 2NZCA 4ZP8A 1HQEB 5EWGA 2J7UA 4Q0BB 1Q7YT 5H9FK 2XMMA 4DQQA 2VQFJ 1TFWA 4C97A 4I2QB 2DHHA 4XK8C 3MPVA 4GO7X 3U1MA 2J0XA 1JLQA 1HMVA 1SL1A 1N5YB 2ZKTA 4KGZB 4PQAA 5KFGA 3UDEA 4RUHA 1XTZA 3IS9B 1NHKL 1JNZB 1JIHA 1WTBA 1KWMA 2E5LF 1LWEB 2KG0A 4OI4A 5A0YA 3QT6A 1DLOA 2ALZA 1SUQA 2MY7A 4DUZJ 3H4DA 4P10A 5EUHA 5KFRA 3DRSA 3CJ0A 3HFKA 2DCUB 1DRZA 1BWEA 3PYEA 4O44A 1KVJA 4HLBA 5K14B 4CWBA 5ITHA 4B3OA 3PRDA 3OR2B 2MJUA 1TTHB 1NHVA 1ZOTA 2JOQA 4I6AA 1N36J 3RR7A 2Q43A 4OYWA 1N88A 4PQUB 5KFWA 1JKHA 1EETB 5KFYA 1JLEA 2N4DA 3LF0A 2ZZTA 4JUZA 4FS2A 4LF8J 2E5HA 2IC3B 3DRYA 1RK8A 2FHMA 2QA1A 3MURP 1HR0J 1IBLJ 3LH2S 1TR0A 2DR7A 2YKAA 1REGX 2OAUA 3TWZA 2OPQB 3DOMA 2YX7A 3Q8QB 4LF9J 4X62J 4JI7J 1XMOJ 2DVIA 1TQLA 3PM9A 3OJSA 4X4QA 4LFAJ 2JEIA 4ZHRB 3OTOF 2DR8A 3A13A 2XHCA 3AHPA 1S6QB 1V3ZA 4J37A 1HQ2A 4PWWA 3HFZB 4OX9J 4DSFA 2LECA 1UA0A 3W7BA 3QO9B 3OL6A 1K47A 3R2CJ 2XG8A 3IWXA 4AT1B 2HBYB 4WF9Q 4JI4F 2G9OA 4NASA 4HYKA 1N34F 1S1TA 2C2MB 2LCWA 2FVPA 1RLDA 5KOWA 4ZLPA 4FYDA 2R7TA 1KRPA 1C4AA 2KDOA 3WIUA 1HWIA 2MZTA 3MD3A 2MQLA 1NKBA 3N5FA 3GILA 1YK9A 4CH1A 4EU0A 2GHWA 2JEJA 3QLHB 4P6QA 3NS5A 4OYXA 2CQDA 3OVAA 1RTDB 4X4UA 1CJUB 5KFAA 2OD6A 3N5BA 3OLBA 2BJ8A 3S6EA 4LBHA 4UTGA 5HVHA 5K8OA 2ZOGA 1NDPA 1QJHA 2BQUA 1TMMA 4ILRA 4HR2A 4DUYF 3E51A 3MM8A 4CT9A 4ZP9A 3D6MB 3ET6A 4KIAA 2BQRA 1RWMB 2ZZMA 2PFDA 4Q2MA 4V19X 3PRVA 4DG1B 4UOFA 2C28A 2NYIA 1FKOA 2BMBA 4ZJLA 2NXJA 1RWOB 1K0TA 4O4GB 3MOZA 1FJCA 1QSLA 5L38A 1GMVA 5F41A 2QSWA 3RB4A 3M30A 4GVBA 4KE5A 4M5HA 3GR0A 1JLAB 3BGUA 3ZXWA 4YOEA 2XSJA 3UNYA 2AKWB 4ZKAA 3TUJC 5A8KB 3IRXB 3LANA 2O1PA 1HNXF 4DR7F 2J0WA 3DYAA 2GAGC 4NCGA 4I67A 3KOAA 3IN5A 2PI5A 3V4IA 5GVQA 3DRPB 3MD1A 4X4NA 2D7SA 5IV3A 2IRUA 4A8FA 4R5PB 1G1XA 4N41A 2W9AA 3AQOA 4D3GA 2LQBA 2DPJA 1SV5B 1HBUA 5EWFA 1Y5IB 3CE8A 3TVYA 5E3PA 1OY8A 1RT1A 4ECZA 3TUPA 2RD5C 2GQ2A 4F0KA 2PT0A 1L5UA 2J6UA 2FYXA 2BV3A 4FYWB 1R31A 2XMVA 3UWTA 1DBDA 2NLWA 1RHQB 2W4DA 2X1FA 5J1NA 4RNNA 1KBRA 4QCLA 4I7FB 5E33A 1NPPA 1X4BA 4X66J 4GC6A 1RXOB 1IBMJ 3L7PA 2OH2A 3RW7A 5B7WA 1G2EA 1LK7A 3R8YA 3G9CA 3MR3A 3TQEA 1VJWA 4MFBA 5KFVA 2DNRA 1UVJA 4RUAA 3NGRA 4UUWA 2LLZA 2DGQA 2EXUA 4ECVA 1HWUA 4PCQA 2BJDA 1BC6A 1Y5LB 1WG4A 2EK6A 4URGA 3OXFA 4CLTA 4USHA 1QAXA 3AQPA 1C4CA 4PXEA 2V8DA 3O6QA 4OZ3A 3Q8PB 1HWLA 2HPUA 3BYRA 4ZLLA 1FI4A 3DLKA 2XNQA 3MEDA 3IG1B 4RW8A 2KU7A 1MW7A 4ANCA 2FLPA 4QWAA 4FF1A 1FRJA 2DRAA 1RWUA 2FLNA 3BPSP 4J9VA 1S1WB 2RQCA 1RADB 1CC7A 2W9BB 1TL3B 4K4VA 3EXCX 4CQ1A 2ZH3A 1NSPA 2CPZA 1YRXA 4EO8A 4YHHF 3Q23A 4WBFA 2RHQB 3GONA 3T9NA 3LWLA 5EDWA 2XYPB 2DPIA 4PXDA 4DR4J 4DV0J 1T11A 4YS2A 4RKUC 2DNMA 1N5QA 1G3OA 2ZH9A 1EQMA 3QATA 3CD6S 1RA7A 3CMAS 4F2SA 4J7CA 2D3OR 3MOJB 4USWA 1WF1A 3L9ZA 2R4FA 3J7A1 2HQ3A 2IVMA 4OMFG 3DMJA 1WSVA 3V81B 5A6WA 1N5TA 3C16B 1YZ6A 4ENOA 1I51B 2VPXB 1TAUA 1B64A 2CWKA 3FDSA 2Y8WA 5M2RA 1EZZB 2WSEC 4S0MA 3QRPA 4DL7A 4RW9B 4RWWA 2EK1A 2ZBIA 4E8UA 1VJQA 5FJ4A 1YBUA 1KN6A 3M9MB 3H40A 2VPYB 2MXYA 1M5SA 3I5CA 1T9XA 3TANA 2MHEA 3DFEA 1M1HA 4J9RA 2JRSA 1HNIA 5C42A 4C0OC 4DN0A 2AZ1A 2KVIA 2CQPA 4L3NA 2VICA 3MUVP 1X31C 3TI0A 1XWLA 4ZPAA 3Q8VA 1IXKA 3OQ2A 1ZM2A 1SH0A 3EXYA 5GAHI 4JI8F 1VRQC 2HWTA 4JV0A 3G6XA 1TFYA 2Y3YA 3LQVA 3J7Z5 8ATCB 2VH7A 1DFDA 2CXEA 3PJXA 1U0HB 3VALA 4QWEA 4HEA9 4ED1A 5KT7A 4P7TA 3K57A 4A48A 1EX8A 2QX0A 3OFGA 2C2RA 4OZ1A 5T14A 1YBTA 4K4UA 3U1LA 3GMGA 3IA0A 4JI2J 3M9NB 1WNEA 2MY8A 4B3RF 3ENAA 4ZN1A 4A8OA 2DR5A 5M2PA 3PG9A 3T5JA 1Q95G 2KI2A 3DDKA 1OPIA 1U1LA 3ZTOA 5KFPA 4IRKA 1QAIA 2JEGA 1U6FA 1B0VA 2Q6BA 3BKFA 4RO0A 1VQ9S 2MZRA 4M5GA 4QYRA 1UCNA 3TUZC 1WKJA 1KLMA 4MIAA 4M95A 1M1KT 2V4RA 3FFIA 4TYBA 1XNQF 2WAQD 2ZDPA 4QJVA 3P49B 2V8HA 3KLIB 1I94F 5C25A 2J0QD 4RW4B 4QBUA 2JLGA 2RDIA 2MJNA 1PIEA 1NJXA 4I69A 4TYAA 3GB0A 3G6VA 3BPDA 4J9SA 3QJLA 1S1VA 2DHGA 2YQ3A 3CGIA 3GFZA 4JI6J 3TZWA 2QLBB 3FSYA 2BJ1A 1SIWB 4G3IA 4WTYA 4CLFA 3C14A 3S01A 3K5NA 4NXNF 5E41A 3TVKA 3QQCD 5C5JA 1UPMB 3SQGA 4PYDA 1SQFA 3HJVA 1PG5B 1JLBB 2DNKA 2OPPB 2V69A 1I1GA 3KLGA 2WSCC 3UDLA 4Y0FA 4H4KA 5F0UA 2VL1A 1T9UA 2E1RA 3OTDA 3QJPA 1TKTA 1U8WA 1C1BA 5E3QA 1P9YA 2X1AA 3M8YA 4ZOSA 2YNHA 3EVOA 5FIIA 4RNOA 3D1HA 2A2CA 2BOAA 1RJJA 2BW7A 3EPIA 4DL0C 1VK8A 3CJ4A 4ELUA 3VAMA 3IAS9 3VAJA 5CD4H 4USMA 4UZBA 3KHLA 5IM0B 3UN2A 4X65F 1VRUA 1JLFA 4DCOB 2ABYA 3BB5A 4EO6A 3TX0A 3SV4A 4KPCA 2M8HA 1OMSA 1PYTA 5THWA 2CNOB 4O3PA 2FDNA 1C0TA 1AFIA 4F8RA 5DG8A 2XMAA 4DL3A 1PYOB 2L9NA 4WK3A 5IWAF 4LJMA 1VQMS 1TV6B 1IKXA 1NCLA 2KN4A 2IJFA 4NLOA 1TL5A 3D68A 2XI3A 2DCLA 3CEDA 2HFSA 1H73A 4ED0A 3OVSA 1RWNB 4DQPA 5FDLB 2EI5A 3E8OA 3NNAA 3V5RA 1QDUB 2FJAB 2LQJA 2BE7D 5JXSA 3GIMA 4N8NA 5KT2A 4F36A 1NJIT 2CQIA 2J8AA 2L41A 3MZIA 5I3UA 3PEJA 2H9ZA 1HBMA 4DV7J 1H7XA 3QAEA 1NEEA 4KKOB 4C9DA 4YB7A 1S97A 2DNOA 2YKMA 3EUNA 1RWVB 3M8PB 4K4WA 2DT9A 1KTQA 4JI1J 4FYVB 2EFQA 3HHLC 4LSLB 1RAIB 4QR0A 2CQ2A 1IJFB 3I5AA 4C3LA 4A46A 2P2CB 1XNRF 2YWKA 4LR9A 4F50A 2BX6A 4ECXA 3V6JA 1KLNA 3OUYA 2KFZA 3EZ5A 1VS3A 3FMBA 2XYHB 4PXCA 2AMCB 5U47A 4CTAB 2FC8A 2RB7A 4I0WA 5DZ6A 1RTHA 1YJWS 4J9OA 1IBKF 2OEKA 2DNNA 1RT6A 3IBFB 4F4ZA 4LRAA 1RCXB 3Q0AA 2IJNA 3RRKA 3GIIA 3G82A 4USIA 4NCAA 2HVIA 4D3HA 3R1LA 2HNYB 4NLSA 2FVSA 2BKOA 1NK4A 1H2TZ 2BUNA 4RBVA 2DNHA 4DR5J 4OYAA 1FF2A 1SJQA 4Y6IA 4FF3A 3M32B 1XN9A 2CJQA 1YGYA 4OJ1A 4DV1F 4N7TA 1RAGB 3CPWR 1WEYA 4DPWA 3FGVA 1XMQJ 5KG2A 3MM6B 2PIIA 3SXLA 3OHAA 1N4LA 2KXNB 3R1HA 1X4HA 1BE4A 2HHHF 2F9DA 1B7YB 3FZBA 2R7QA 4WE1B 4HT7A 4MK7A 1NK7A 1HKAA 4CRJA 4L3KA 2EKYA 2HVEA 2NSCA 4U6PA 1RBOB 2RDDA 4EI2A 4HT5A 1HHQA 2MKSA 3N28A 5E3AA 4AUKA 4ZCIA 2VC0A 3DKDA 4ZCMA 3H90A 1HNWF 5KT4A 4L75A 3CCVS 4TLQA 3K89A 4X4PA 1ZS6A 4X4SA 2XCPA 3IBCB 3TVZA 5HBMA 5KG5A 2J7WA 3GLJA 1T9YA 1FWPA 4NCBA 2MEWA 4OZ0A 2PMWA 3T6BA 5DQGA 1RT2B 4DR3J 3DRRB 1H7WA 1HLWA 1YSJA 4DPUA 1WG5A 3T1HJ 1KR4A 1S9EB 2B9XA 3ZNUA 4JYAF 1ZAWA 1FT8A 2A1BA 3BV8A 1X4DA 5DS7A 1YG0A 3HHDA 4LIWA 2HK2A 2MB0B 3Q8SB 2VJUA 4W90B 1S5ZA 4QR1A 4E2FB 4IKAA 4USJC 2BRLA 4ATNA 1NU4A 3MCOA 4Y34A 4F3OA 3SBMA 5IC4B 4EK2A 5J2PA 5C24B 3RB0A 5CHCB 4CYUA 1D9AA 5GADU 4ZPDA 5HLFA 2CQ3A 2VKZG 4M5DB 1QLNA 3WZ0A 3M2VA 3C8YA 3DLEA 1X9MA 2A0FB 2HIQA 5FLXU 3JSMB 2XMJA 2GO9A 2E5JA 3BGLA 1ZAXA 2DHSA 4RU9A 3CC7S 3TX8A 3MMCB 2CG8A 4PG8A 1N5VA 1HNZF 3JTNA 2M88A 1WHXA 3SCIE 1GNKA 1C1CA 5CXTA 1ZPVA 4LF1A 4ED2A 1ZM3A 1ZPWX 2V2ZA 1PCAA 2ADBA 3KK3B 3CJKA 4F4KA 2RAQA 4LVOP 4O3OA 3MEGA 3OVBA 3HD1A 3UO0A 1LWXA 3W60A 1RB0A 5BR8F 4ECSA 3TQ1A 2QGFB 2A3JA 4ES2A 3HHLD 4TVAB 4B9TA 3AOCA 2WBRA 1CQMA 2CPEA 4ETZA 1TAQA 2AEFA 1ACMB 4YP3A 4DR1F 3SCJE 1TK0A 1TMJA 5H9EJ 1BMQB 3HX9A 5EX3A 4PPZA 3E01A 3DLJA 5D4PA 1KNZA 1M5VC 4C4WA 2CFXA 4B3SF 2JFDA 2GCFA 3QPIA 3CVKA 3UR3C 2RQMA 1VC0A 2HQDA 4USKA 3FQLA 5F3ZA 2VIHA 5B0BA 2GO8A 4IQMA 2ZE2A 2VU5A 1MU2A 5ETLA 1ZZNA 4K2JA 1B3TA 2A6OA 2W7PA 3Q22A 5ADZA 4U8VA 5KFHA 1EIYB 2V2KA 3IFEA 2HURA 4JI3J 3NCRA 1LW2B 4LF2A 5JVHQ 1BHNA 1S1UA 2R9LA 2V67A 3CJRA 3G4SS 1X9WA 3H0PA 3V6KA 1O51A 2ROEA 3R5AA 2E7VA 4CH0S 1QM9A 3PZPA 1S6OA 1RHKB 1HIYA 4ZVOB 3A12A 3M2UA 1F1BB 3DM2A 3R6GB 2CJAA 2ZZNA 3K5PA 4LVNP 3C15B 2R7OA 3IRWP 5HSPA 2XYGB 2JNJA 4RJVA 5KFJA 3CMQA 4N8OA 2CYYA 4K59A 1MN7A 3CXCR 4FNHA 1H6KX 2RSQA 1OSCA 2DHXA 4EZ6A 2C2ZB 4DFKA 2AJ4A 4IDKA 1RTIA 2LYVA 3QIPA 4FNIA 1X0PA 1RTJA 1FJGF 3MMBB 1OY9A 2IPOB 4N76A 2WCXA 4JBCA 1JQGA 3UD3P 5I3QA 4FKXA 3A1YG 1HHTP 4DEZA 3X3UA 1CJKB 2BANB 2Z2ZA 4DPTA 2FUG9 2OIHA 1LWFB 4PPDA 3I0RA 2HVDA 3BO2A 1JLCB 2Z4PA 4PG7A 3L95X 4CM2A 5IZHA 2JX2A 2VBZA 1TKZA 1FXDA 2EFNA 3H42A 3NGKA 4QR2A 3GE9A 4LBPA 1N6QA 1S6UA 4TY8A 4OZ2A 4RBTA 3P4UB 3MCNA 4ZVPB 2GJIA 4WFZA 1WHWA 1R27B 2V68A 4EYHB 3JTPA 1UL3A 2WONB 3TA0A 2XM3A 2BXJA 3W5ZA 4EBCA 4MMOA 2YY3A 3A8EA 3FSIA 1LEOA 1EARA 5CABA 2AYGA 4GKJF 3ILIA 4ICLA 1VQNS 1D1UA 1FRKA 3LTOA 1ROFA 1DTQA 2C3OA 4IFVB 4I56A 2IA0A 1KQKA 4ZPTR 4WFBQ 3JB9k 5D3GB 1JJHA 2P9GA 2CNLB 3KLEB 4NRTA 1GX6A 3GYNA 1FRHA 4KJIA 4WJBA 3CC2S 1CULA 3WC2A 2IHR1 2DEJA 4DV2F 4TU7A 2H5EA 2RILA 2W2MP 3D66A 3RG6A 4ECUA 2EEYA 1EAYC 3AODA 1TVRB 4PWDB 2RF2B 1DJ0A 3NCQA 5J2NB 4OJHA 3CW2C 2UUAF 3PW0A 2WOMB 2QL5B 1NJZA 2OMLA 3KNGA 5IQ6A 4KHRA 1FNMA 5J2MA 3ZZ0A 2C3MA 3BH6B 4H4OB 4EYIB 5G0RA 3J81U 4U7CA 1FWLA 3R3TA 3DHXA 5GMKa 3KLFA 4HACB 1LQ9A 1YITS 1S76D 3OHBA 2ZHOA 2QLXA 5T7LB 4WFYA 2QN6B 1RT4A 3V4MA 3GP9A 4NLWA 2CPDA 3AB4B 4DX6A 2ZEJA 3N6NA 5KFZA 3TRGA 2C22A 3IR7B 2C2OB 3EGNA 3J7YU 2VUGA 4RPFA 1K73T 3HSGA 3ISNC 4H4MA 3HVWA 3NCPA 2KZMA 1RT5A 3MM7B 1YVFA 3T9ZA 1OY6A 4O3NA 1LW0B 3KUEA 1N56A 4WXWA 2QMWA 4HKQA 2DO4A 2RDJA 5F8GA 3BM7A 2ZUAA 2DGUA 4NRUA 2CADA 2YNGA 3CUNA 1LFWA 4U7UK 1P9QC 4HH0A 3U02A 2YQ0A 3HHNB 2HQFA 4Q45A 1YDLA 3M2RA 3M8QA 2RRNA 5GAGI 2ASLA 1XMBA 4U95A 3V6DB 2CDQA 4RUBA 1RYSA 3VHQA 2ILYA 5DG9A 3EGZA 3ZZOA 1PILA 2KL8A 3RBDA 3O2IA 3ADAC 3JSYA 4U9RA 5C2CA 3UI3A 1YBAA 1NZAA 1GFWB 4ZMMA 4NXMF 3FNNA 1W25A 4Q0BA 1VFJA 4F3QA 4RWXA 3QWPA 2EG2A 2Y8YA 3MUMP 2QE5A 2ZOFA 1WF0A 1RACB 2VOOA 1W7WA 2MQQA 5DQHA 1AB8A 3TZYA 5EWEA 4NLQA 1REVB 1CBKA 1JLGA 4IG3A 3VF0B 3IGNA 4A8YA 4P9SA 5KFXA 4RW7B 2QV6A 2B43A 1JJCB 3F0NA 5L9NA 5KFIA 2IBKA 2WW4A 2W4CA 3MMAA 1Z2LA 4NMLA 1WF2A 4KT0C 4UQGA 1IKYA 2E66A 3H25A 1KC8T 3N6MA 3E2EA 2RS2A 4CLSA 3BR8A 1JLQB 1HMVB 3RYLA 2R7VA 2UXBF 1U49A 1X5PA 5AE1A 3O5TB 4FPRA 4KFBA 3I6PA
chains in the Genus database with same CATH topology
1ICEB 1RHKB 2CJXB 3QNWB 5K20B 4ZVOB 2QL9B 1RWNB 3EDRB 1I3OB 2XYPB 3R7SB 2C2KB 2H54B 4LSZB 2XYHB 3R6GB 1RWPB 3GJSB 1IBCB 1PAUB 1NMEB 1QDUB 2HBZB 4JB8B 2H65B 2H51B 4ZVTB 2XYGB 2XZTB 1F9EB 2HBQB 1SC3B 4DCJB 3P4UB 2CJYB 2QL5B 3D6MB 3IBFB 1BMQB 2QLFB 4ZVPB 3NS7B 2H48B 5IC4B 1QTNB 1RWMB 1RHUB 3GJQB 2QL7B 4ZVSB 2Y0BB 2HBYB 4ZVRB 2H4YB 2C2MB 3IBCB 2CNNB 1SC4B 2C2ZB 2DKOB 4ZVQB 1SC1B 1I51B 1RWWB 1RE1B 1RHRB 2H5JB 4ZVUB 4DCOB 2QLBB 3RJMB 2FQQB 3GJTB 3R6LB 2H5IB 2Y1LB 2C1EB 1RWOB 2XZDB 3R7NB 1RWVB 3KJNB 3R5JB 2CNOB 1RWKB 2QLJB 3R7BB 2C2OB 3D6HB 3D6FB 1RHQB 3P45B 3SIPB 1RHMB 1PYOB 2CNLB 4DCPB 1GFWB 3KJQB 3GJRB 2CDRB 2P2CB 3EDQB 2H4WB 5IC6B 1RWXB 2HBRB 1RHJB 2CNKB 3KJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICE B;  1RHK B;  2CJX B;  3QNW B;  5K20 B;  4ZVO B;  2QL9 B;  1RWN B;  3EDR B;  1I3O B;  2XYP B;  3R7S B;  2C2K B;  2H54 B;  4LSZ B;  2XYH B;  3R6G B;  1RWP B;  3GJS B;  1IBC B;  1PAU B;  1NME B;  1QDU B;  2HBZ B;  4JB8 B;  2H65 B;  2H51 B;  4ZVT B;  2XYG B;  2XZT B;  1F9E B;  2HBQ B;  1SC3 B;  4DCJ B;  3P4U B;  2CJY B;  2QL5 B;  3D6M B;  3IBF B;  1BMQ B;  2QLF B;  4ZVP B;  3NS7 B;  2H48 B;  5IC4 B;  1QTN B;  1RWM B;  1RHU B;  3GJQ B;  2QL7 B;  4ZVS B;  2Y0B B;  2HBY B;  4ZVR B;  2H4Y B;  2C2M B;  3IBC B;  2CNN B;  1SC4 B;  2C2Z B;  2DKO B;  4ZVQ B;  1SC1 B;  1I51 B;  1RWW B;  1RE1 B;  1RHR B;  2H5J B;  4ZVU B;  4DCO B;  2QLB B;  3RJM B;  2FQQ B;  3GJT B;  3R6L B;  2H5I B;  2Y1L B;  2C1E B;  1RWO B;  2XZD B;  3R7N B;  1RWV B;  3KJN B;  3R5J B;  2CNO B;  1RWK B;  2QLJ B;  3R7B B;  2C2O B;  3D6H B;  3D6F B;  1RHQ B;  3P45 B;  3SIP B;  1RHM B;  1PYO B;  2CNL B;  4DCP B;  1GFW B;  3KJQ B;  3GJR B;  2CDR B;  2P2C B;  3EDQ B;  2H4W B;  5IC6 B;  1RWX B;  2HBR B;  1RHJ B;  2CNK B;  3KJF B; 
#chains in the Genus database with same CATH topology
 4PG4 A;  4LSN A;  3H4B A;  3I4P A;  2QL9 B;  4G65 A;  5A76 A;  3S7R A;  4M1K A;  3KLH B;  3PX0 A;  1U2R A;  4X4T A;  3W3S A;  2MKY A;  5A0Y B;  1DLO B;  3K0J A;  4DR6 F;  2W7O A;  2JLE A;  1SUQ B;  3EZO A;  3HUL A;  4P2F A;  1CPZ A;  3DRS B;  4C2M A;  4O44 B;  3CIZ A;  4LF4 J;  4K5R A;  3T1Y F;  4QPX A;  4B3O B;  2XBP A;  2HQC A;  2L48 A;  2F4V J;  2R7X A;  2DH7 A;  1HI8 A;  2VFR A;  3FUY A;  1U4B A;  1X8D A;  2LDI A;  4KHP J;  1JKH B;  3R6L B;  4WU2 A;  1UVN A;  1M90 T;  5HAT A;  2J0S D;  1JLE B;  3Q8U A;  4EZ9 A;  5CZV A;  3CB4 A;  3PYF A;  2G1H A;  2POK A;  4G6V B;  4HVZ A;  5ETR A;  1DAR A;  3P45 B;  1S7I A;  1M5H A;  5HI7 A;  3UVJ A;  3DOM B;  1FNX H;  5IV4 A;  2YWF A;  1XR5 A;  4G1Q A;  2RHS B;  3Q24 A;  3QFW A;  4HTI A;  1UVL A;  5H1S V;  1VQ4 S;  3DXS X;  4OLO A;  5HMW A;  3HZE A;  3NBP A;  3GIR A;  3MHY A;  2B51 A;  3BDE A;  1KOO A;  4FYY B;  3MMJ A;  3HI9 A;  4NPO A;  3VQS A;  2OSR A;  2XMU A;  2L9W A;  2XGP A;  3RBX A;  4I2P A;  3ISN D;  8AT1 B;  1YJR A;  3W2W A;  2NRE A;  3T5H A;  1WWH A;  4PRF A;  2W8L A;  4CO1 A;  2NR0 A;  4DZ6 A;  3CJ8 A;  3RBE A;  1S1T B;  4RLE A;  2BAB A;  2KKH A;  4TY9 A;  3N6L A;  3OTB A;  2G2Y A;  2VBW A;  5B0C A;  3SFU A;  3MCS A;  4F0H A;  2NPF A;  2EWH A;  4PAB A;  2R7R A;  3U27 A;  1ZM4 A;  3CDB A;  1A7G E;  5AXL A;  3OW2 R;  2GIF A;  2LFV A;  2QT7 A;  2ZDO A;  5DQI A;  3UN3 A;  1XR6 A;  4OX6 A;  1KD1 T;  2QFI A;  3OT9 A;  4LF7 F;  2HK3 A;  4O23 A;  3MTJ A;  5JUM A;  2G1D A;  3P96 A;  2HS0 A;  2KFN A;  4DL5 A;  3MM8 B;  3VVU A;  1BY9 A;  5J1E A;  3TNV A;  2PC6 A;  1R0B G;  3ET6 B;  1K8A T;  4B3M F;  5L1J A;  3B54 A;  2DH8 A;  3AD7 C;  3G8T A;  2ZNY A;  1VK3 A;  2FZG B;  1VBZ A;  3DLH A;  4R8U A;  1O8B A;  4DV6 F;  1VQY A;  4LR8 A;  2ZFH A;  5HP1 A;  1JWW A;  2DGO A;  4B9S A;  1FKO B;  3NEK A;  4K4S A;  5HO4 A;  1J5E F;  5AXN A;  2H5I B;  3NWG A;  2RUS A;  4JV5 J;  1FXR A;  2OKQ A;  3D3B J;  1VYA A;  5CYQ A;  1R8A A;  2DRB A;  4JOU A;  4J91 A;  3M30 B;  4GVB B;  2V6A A;  2XSJ B;  2F3J A;  1YJU A;  2B8P A;  4DX8 H;  4DFP A;  2O01 C;  1KP6 A;  3ZTP A;  1VBK A;  2ZH5 A;  3BGF A;  3D7S B;  2VON A;  3DYA B;  2WHO A;  2X3G A;  5DM6 Q;  4QYZ J;  1CS4 A;  3ETM A;  2BBE A;  4NCG B;  4DV5 J;  3DHW C;  4OHW A;  2E5G A;  2HHS A;  2CQG A;  4BHQ A;  2FB0 A;  3MR2 A;  4USU A;  3V4I B;  2ZH2 A;  4CM0 A;  2PMH A;  3IO1 A;  1UEU A;  1UW4 A;  4PXB A;  1WHV A;  1YX2 A;  3NRB A;  1SVD A;  4IRC A;  4F4X A;  4Q7A A;  3FRZ A;  4M5L A;  1BQM A;  1HBU B;  4AQY J;  1UVK A;  2GHP A;  3NGT A;  5HVG A;  4QYZ K;  5HJX A;  1V3S A;  2JLF A;  1RT1 B;  1HFE L;  1OSD A;  4DQI A;  1TL1 A;  5A8W A;  5ETP A;  2HAF A;  2IDL A;  3CCW A;  2L08 A;  5ETO A;  2ASY A;  2X1B A;  4N77 A;  4NX9 A;  4KBI A;  3ZFV A;  1RKI A;  3VGV A;  2D3O 1;  3FEX B;  1CLF A;  4EMD A;  4DR2 J;  4U67 Q;  4CH7 A;  4LF5 F;  4OV1 A;  2GFF A;  4DFM A;  2ASD A;  2NXC A;  1Q53 A;  2F8H A;  3AD8 C;  4TU8 A;  5J2Q A;  2OO4 A;  3VR1 A;  1ELO A;  2LDY A;  2UUB F;  4MFB B;  1R8B A;  3N4W A;  2RU3 A;  2KZZ A;  4M63 A;  2KYX A;  3BSA A;  2KVQ E;  2DD8 S;  3MPY A;  2B4U A;  2ROG A;  3CCT A;  2IYI A;  1H2V Z;  3QZ7 A;  3SCL E;  4TU9 A;  4ZVS B;  2Y0B B;  4LFC J;  5DDR C;  3FK4 A;  3KFW X;  1KHV A;  3PJW A;  1R8P A;  3I4H X;  3DLK B;  1FKP A;  3MED B;  3CJ5 A;  4RW8 B;  2RVJ A;  4YQW A;  4CNZ A;  4MT1 A;  2QC3 A;  5I3P A;  3SSQ A;  2M52 A;  1NXI A;  1S0O A;  2BKN A;  3T6J A;  3LP0 A;  4HDH A;  4A8W A;  4C8Z A;  4MIW A;  3KK1 A;  3GFY A;  3JYT A;  3DI6 A;  2HWI A;  4LF6 F;  4LFB J;  3H7H B;  3N0V A;  2DGV A;  4ZLN A;  1RKJ A;  4NE9 C;  4YEA A;  5KT5 A;  3BYP A;  3K5M A;  1S0V A;  2EW9 A;  1X7V A;  1N48 A;  4PZV A;  3PW7 A;  1OWX A;  4DSL A;  3M8R A;  4CLY A;  3DLL Q;  2ZHA A;  2W2Q P;  2N7C A;  1IQT A;  2C2E A;  1Q81 T;  3D1O A;  4ED6 A;  2AWZ A;  1HI1 A;  2W24 A;  2AJ0 A;  4ZVF A;  2HZC A;  4Y2C A;  3CME S;  3KHG A;  2MLX A;  3DLB A;  2CQ1 A;  4X4V A;  3DMJ B;  1S9G A;  2YKN A;  4NL5 A;  4F02 A;  1BXN A;  3HLU A;  1D8Y A;  3H59 A;  1S57 A;  2BJ3 A;  1S0M A;  1K1S A;  2EG1 A;  4U8Y A;  4DPO A;  5ETN A;  4EBE A;  2UU9 J;  4RL1 A;  2ALY B;  3KDN A;  5GAH U;  3I56 S;  3ZZZ A;  1Y3J A;  5BXI A;  5AJ3 F;  1FX4 A;  3L3C A;  1ZBT A;  4YR0 A;  1VBX A;  2FJV A;  4K0K F;  5IC6 B;  3FEY B;  4C8N A;  4ZJQ A;  2ACY A;  2J5A A;  4RNF A;  2CNK B;  2K7K A;  3QGH A;  1RU2 A;  5A8R A;  1HNI B;  5C42 B;  2XNR A;  2I9S A;  5E3R A;  4A8Q A;  1DUR A;  1MWY A;  2F8E X;  2ZH8 A;  2V94 A;  5T41 A;  2AP6 A;  2HBZ B;  1GX5 A;  4IQX A;  2UVR A;  1HPZ A;  4KO0 A;  2FPH X;  2WZ1 A;  4OYP A;  4DCJ B;  4QW9 A;  2YX1 A;  1H98 A;  2CJK A;  2MST A;  1FVQ A;  2LKZ A;  1OQ3 A;  3R5C A;  5LMU F;  5BYQ A;  3MEC A;  4MH8 A;  3JAM Y;  4WP9 A;  3SYZ A;  5HQ8 A;  4TQR A;  2CJ9 A;  3TJ9 A;  1NKE A;  3RUB L;  2IBO A;  4KAI A;  3OPK A;  3PHE A;  1F60 B;  4N56 A;  4OI3 A;  1IWG A;  3W61 A;  4WFA Q;  2O3D A;  2QLJ B;  3W2V A;  3GSI A;  1VQ6 S;  4IH6 A;  3RAM A;  4U7U D;  1VC5 A;  1A9N B;  5ETV A;  3R5B A;  4RBU A;  5B0E A;  3BN4 A;  1NUE A;  5KFE A;  4X4O A;  2G13 A;  4C11 A;  3DU6 A;  1ZAV A;  4ZJO A;  1R43 A;  2PA8 D;  4MAK A;  5DDQ C;  1IVZ A;  3ONQ A;  3AB2 B;  1KLM B;  1NK9 A;  3OFF A;  2B6A A;  3FFI B;  3M6W A;  3THT A;  2AF6 A;  2VQE F;  2OFH X;  3KJV A;  1F9E B;  2PMZ D;  1FDD A;  3QRQ A;  3H5X A;  3IP0 A;  5C25 B;  4V19 J;  5ETM A;  4L73 A;  1LFP A;  1GMU A;  1RAE B;  3BBB A;  1URN A;  1S6P A;  1S1V B;  1U1N A;  4EFA C;  1TUV A;  1JXE A;  3PTW A;  4TKT A;  5HRO A;  4I4B A;  2VG6 A;  2RIJ A;  3C14 B;  1NHU A;  5CD4 A;  3J7A N;  3ZZY A;  2ACM A;  3SQG B;  2IYG A;  2ZJP Q;  3AOB A;  1LV5 A;  4RNM A;  2Z2Y B;  3VGS A;  4C0B A;  1Q1K A;  4WYL A;  4OHY A;  3GJR B;  1OPZ A;  3DC2 A;  3KLG B;  5KFT A;  5I42 A;  1NDC A;  4NMX A;  1SQE A;  3BGO P;  1UEK A;  1TKT B;  3VZH A;  1C1B B;  1KQF B;  2NCK L;  2WB1 D;  4FF4 A;  4CNY A;  4CI0 B;  3EDR B;  4W98 A;  2YNH B;  5GAE U;  2B9W A;  2YH0 A;  3LGN A;  3EJM A;  3JSR A;  1Q8K A;  5RUB A;  6FD1 A;  4F67 A;  1K44 A;  1BGX T;  2B0G A;  3W9I A;  2BW2 A;  2XWY A;  4YY3 J;  4M5M A;  2DR6 A;  3NOC A;  2E44 A;  2JVO A;  3FMW A;  2EPI A;  1S72 S;  1YWX A;  1VRU B;  1JLF B;  2N3L A;  3N79 A;  3G8S A;  5CCL A;  4Y00 A;  1U2F A;  2VOP A;  3WBZ A;  2I1R A;  1FFS B;  2MHN A;  1VGY A;  2DNQ A;  3D67 A;  1CJV A;  4OJG A;  1C0T B;  2AIR B;  2ZUG A;  2BE9 B;  3C6T A;  3DNC A;  4DV4 F;  4HHU A;  4Y2K A;  1IKX B;  3O44 A;  4B3T J;  4GO5 X;  1FTR A;  3PCO B;  3BQ0 A;  2KT3 A;  3CJS A;  4CO0 A;  4L6V 3;  4YR2 A;  2APO A;  1O5J A;  4TN2 A;  3TA1 A;  1FES A;  2LEA A;  1OJ4 A;  4P2M A;  3NKY A;  4Q43 A;  3A8I A;  1X4G A;  2B3T B;  4ZPW R;  3I96 A;  2CQC A;  4QPT A;  2BVZ A;  2ZVI A;  1QTN B;  2F7V A;  2ZH4 A;  2UXC F;  2F4V F;  3PW2 A;  3KK2 A;  3MR7 A;  2OEM A;  1Y5N B;  5I3U B;  3MEE A;  4CTA A;  2IA6 A;  3I82 A;  1HBM B;  2E5L J;  3VAK A;  4DX7 A;  5SZT A;  2MMY A;  4ZVU B;  3OR1 A;  3PYD A;  4BCA A;  1NRK A;  3T1A A;  1TU0 B;  2YKM B;  2CZ9 A;  1NAQ A;  3KJN B;  4UY8 T;  2HNY A;  3L7O A;  5DGA A;  4OYM A;  2AYM A;  3N01 A;  1M1G A;  2NXN A;  2YNI A;  1CJT A;  3LP1 A;  2IAJ A;  3OUY B;  2HW3 A;  4ZA1 A;  2JDJ A;  3ENW A;  2MZJ A;  5E0O A;  5KFS A;  3HVT A;  3KHH A;  4NLV A;  1ZTW A;  3QSY B;  1N33 F;  4DDF A;  3MM6 A;  3IR5 B;  4M5I A;  3MGJ A;  3LAL A;  3NGD A;  1RTH B;  1RAJ A;  3LO3 A;  2H51 B;  5CAA A;  2VBX A;  4GKK F;  2XZT B;  1RT3 A;  4KTQ A;  3CDW A;  2XGQ A;  3RGI A;  2NZ4 A;  1RT6 B;  2M2B A;  4KH1 B;  4A8X A;  4LBI A;  1ULR A;  1UA1 A;  3G82 B;  1WC3 A;  4GMK A;  4AL7 A;  1SC6 A;  4AXI A;  5HAO A;  3GCX P;  1BQN A;  1WC4 A;  3OTO J;  3SDE A;  2GIR A;  3ZC4 A;  2DHA A;  4FPI A;  2NS1 B;  4ZVH A;  2XWX A;  1Q4R A;  4OHV A;  4FBT A;  2SXL A;  4JI4 J;  1FEH A;  4KYZ A;  2Q66 A;  1TK5 A;  1N34 J;  3GQC A;  5CA5 A;  2E7X A;  2RS8 A;  4OYO A;  4Q8E A;  4C3M A;  1R0A A;  2CPX A;  2PGC A;  2H4W B;  3BSN A;  1YIJ S;  3BDP A;  2PEB A;  5KFF A;  2VC1 A;  2JSX A;  4CDI A;  4DV3 F;  2OD4 A;  2XY5 A;  1B70 B;  4LIR A;  1QVF R;  2MDA A;  1MRO B;  2Z57 B;  5HQL A;  3QSI A;  3MEK A;  5KFB A;  2NQP A;  1DY3 A;  1OS5 A;  1SC3 B;  1YZ7 A;  1EP4 A;  5AE3 A;  2KO1 A;  2AT1 B;  4BC9 A;  3AOA A;  3NOG A;  2IM0 A;  2ADC A;  2R8H A;  3PHT A;  2XMT A;  4H54 A;  3JQM A;  4QIW D;  3A3O B;  4X2B A;  2EFO A;  5HBM B;  3M8Z A;  2RH3 A;  2EFP A;  2LEB A;  3TAM A;  1FK9 A;  3AD9 C;  1OIA A;  1F5B A;  4OHZ A;  4DUY J;  3GU0 A;  3VAF A;  4Q8F A;  1FO1 A;  1Y3K A;  3CWJ A;  3EZU A;  1Y9O A;  2LXI A;  4N5S A;  2X1G A;  4A8K A;  1XC9 A;  2ZM6 F;  3Q2S C;  2IMW P;  4YR3 A;  5ETT A;  1T7P A;  1AUD A;  1HL6 A;  3CSK A;  5DM7 Q;  1ZZF A;  2X3D A;  4Y3C A;  5F8N A;  2WBM A;  3CJQ A;  3JSB A;  1FVS A;  3KLV A;  1PO6 A;  2WVE A;  3OFH A;  1N32 F;  4AL6 A;  4F0M A;  1WOO A;  2HZA A;  4IG0 A;  1IKV A;  2O5D A;  5GAD I;  4ECT A;  3TA2 A;  3G6Y A;  2H3E B;  2AGO A;  1F6T A;  3N9U C;  3CCQ S;  4J9U E;  4ZIW A;  2E9T A;  5J2P B;  3BGR A;  5FD1 A;  1HNX J;  4DR7 J;  4CYU B;  4ED4 A;  5HLF B;  1QAY A;  3M2V B;  1JK9 B;  3DLE B;  3M7V A;  3PIP Q;  2EBE A;  2NXE A;  2I5J A;  4CZC A;  4A8S A;  1PJ7 A;  1EB0 A;  2XB2 D;  4DJB A;  3TJ8 A;  4OFZ A;  3BR9 A;  3CO0 P;  1FCA A;  1T94 A;  3HVR A;  3DOL A;  2HHX A;  1C1C B;  2GMH A;  5D78 A;  3NGS A;  5L1K A;  2HSE B;  5G4D A;  1PC4 A;  1V5I B;  2MQ8 A;  2QYG A;  4F04 B;  1HHS A;  2KJV A;  3CJK B;  3MEG B;  4NEZ A;  1RBL A;  5IS2 A;  3F44 A;  2UUC F;  1C0U A;  5JJB A;  3ILJ A;  3BH7 B;  2AGP A;  3H8Y A;  2ASJ A;  1F3F A;  1Q8I A;  4KGK A;  2F9J A;  2V5H G;  1MMD A;  2CKW A;  1HYS A;  2IRY A;  1W2B R;  2QYC A;  3AY0 A;  2FHO B;  3L7U A;  4UQT A;  4I68 A;  3MFI A;  1P27 B;  3LAK A;  1F3V A;  3FZ2 A;  3R2D J;  3GYG A;  3DLG A;  2IRX A;  5CYJ A;  5DGB A;  3E01 B;  2GC8 A;  2IM1 A;  1ZTT A;  4EEY A;  5A6P A;  2UV8 A;  1FRL A;  3CF5 Q;  1HBN A;  3ILL A;  1RU1 A;  4P2X A;  3BQ1 A;  2PN6 A;  3KG0 A;  5CZX A;  2ZE2 B;  1QE1 A;  2U1A A;  2ZD1 A;  1MU2 B;  2DIS A;  2LVW A;  3ZZT A;  2FZC B;  3FCV A;  5KFC A;  1PKU A;  5LT5 A;  2ZNZ A;  4IYQ A;  3UPF A;  4TQS A;  3HPO A;  1S1U B;  4KQZ A;  3P5B P;  2RKI A;  2MYF A;  1T95 A;  2EFV A;  3KJQ B;  2BDP A;  1U1R A;  2CDR B;  3KUG A;  1VQS A;  2MLY A;  1N8R T;  2KT5 A;  3RRG A;  3CD7 A;  4A4J A;  5K20 B;  4B9U A;  1FDB A;  1HW9 A;  5KG6 A;  3DM2 B;  2JHE A;  4MYU A;  3GZ7 A;  3QT8 A;  1K9M T;  3BKU A;  2RML A;  4KB7 A;  1NME B;  2IY5 B;  5LJ3 Y;  2VDH A;  1DQA A;  2HVH A;  5F8I A;  4YHH J;  4Y2A A;  1B7F A;  4FS1 A;  4JV1 A;  2CJB A;  2F4F A;  2FVC A;  2ZOM A;  3IXQ A;  2E7W A;  4CLW A;  1N52 B;  1TUG B;  2R3V A;  2LEP A;  4AND A;  4IDK B;  5DJB A;  1RTI B;  2DNP A;  1KDN A;  2I6W A;  4DSK A;  3QIP B;  4DQR A;  4XPE A;  4WXO A;  1UP1 A;  3P5T L;  2GGP A;  4AE5 A;  1RTJ B;  2HG4 A;  3FBF A;  3TO8 A;  1D3W A;  3SI8 A;  3W62 A;  2AYE A;  5IT9 Y;  4OLP A;  1FX2 A;  1FRX A;  3I0R B;  2F40 A;  1ZA2 B;  2DNL A;  1VRT A;  2WRM A;  1E6V A;  3BSO A;  5L8R C;  1P8G A;  3FJ2 A;  4ES3 A;  2DGX A;  3CCS S;  4HL9 A;  3BO3 A;  1J5O A;  1TKZ B;  1T9W A;  3AA9 A;  4DL2 A;  3US5 A;  2CQ4 A;  1SKW A;  1N54 B;  1SL2 A;  3RTV A;  1N6Q B;  1Q78 A;  4O3Q A;  4NA2 A;  4JI0 F;  2DTJ A;  4TY8 B;  1YRT A;  2FD2 A;  2QRR A;  5LMN F;  4O0I A;  1TKD A;  4ZP6 A;  2FJW A;  3HHL A;  1LXN A;  1RAH B;  4OZN A;  4NZ0 A;  2YNF A;  4NEY A;  2HHU A;  3QFH A;  4X64 F;  4K2X A;  4NLU A;  2V2V A;  4OQJ A;  1S12 A;  2K3K A;  2Z56 B;  3B4M A;  1S79 A;  4FXV A;  3PRB A;  4ICL B;  3KUH A;  2RRB A;  3JTO A;  1GXL A;  4Q44 A;  2PFF B;  1U48 A;  3OFE A;  4JI8 J;  1DTQ B;  2CVI A;  2N82 B;  2PSZ A;  3DGP A;  3SIP B;  3WHI A;  5D8H B;  4JI5 F;  5F8M A;  1CUL B;  2B56 A;  2DIT A;  1PSD A;  2BE2 A;  2KRB A;  1TP7 A;  2Q79 A;  1TUW A;  3KWM A;  3F73 A;  3H2U B;  2V4Q A;  4M5N A;  1B0T A;  1E6Y A;  4XTT A;  2UXD F;  2FZK B;  4B9V A;  4TLR A;  1ZA1 B;  4ID5 A;  4DFJ A;  4B3R J;  1S77 D;  4QWD A;  1RLC L;  2G4B A;  4KGX B;  3HHK A;  1MNE A;  2ZC4 A;  1J2V A;  2M3D A;  3B82 A;  4Y65 A;  5J2M B;  1SCJ B;  2VQF F;  5K5M A;  5G0R B;  1IJE B;  1IKW A;  1PGZ A;  1RBA A;  3UFC X;  3KLF B;  2KB2 A;  2EC2 A;  5L1L A;  4J9L A;  1XQI A;  1QSS A;  1XNQ J;  1QTM A;  2LA4 A;  2VFV A;  1FNO A;  3PNI A;  1JX4 A;  1RT4 B;  2LP4 A;  2EKN A;  1S1X A;  2I2Y A;  1I94 J;  3J7Y I;  1KKH A;  4PWU A;  2HND A;  4UOH A;  4MKA A;  3D6H B;  4FVM A;  4BBY A;  4WU3 A;  4KRW A;  1IUJ A;  3G86 A;  4DUZ F;  2VHG A;  4BC7 A;  5GAG U;  4IOA Q;  1RIS A;  4H4M B;  5D0R A;  1U1P A;  1SJ4 P;  3PW4 A;  1RT5 B;  2MKI A;  3C19 A;  4USV A;  4LQ3 A;  4NXN J;  3K8W A;  3ZTQ A;  1WG1 A;  2OPS A;  1N36 F;  4DZD A;  3KMS A;  2YNG B;  2HQG A;  4P7V A;  1X9S A;  1HBO A;  2HNZ A;  3LWM A;  1UZD A;  2DNY A;  3H2V E;  3NG8 A;  2GMJ A;  3OJU A;  3H98 A;  3TEG A;  3GFH A;  1WI6 A;  5L39 A;  3M2R B;  3M8Q B;  5KFN A;  2AJQ A;  4LF8 F;  3LA0 A;  1TL7 A;  2D69 A;  3W64 A;  1HR0 F;  5KG3 A;  1IBL F;  3RR8 A;  1FKA F;  2DGW A;  2CZV C;  3GWC A;  4F4A A;  2E9Z A;  2HQI A;  2CPJ A;  3W66 A;  3OL7 A;  1M5O C;  4LF9 F;  4X62 F;  4OV6 A;  4JI7 F;  1YJV A;  3ZTR A;  3G96 A;  1XMO F;  2B4P A;  3R5J B;  3ETO A;  3HSZ A;  4B9M A;  3LUY A;  4LFA F;  4I1T A;  2BRK A;  4X65 J;  3TAQ A;  2MZS A;  3CDE A;  2FC9 A;  3LOU A;  3VZI A;  2B8Q A;  2KTQ A;  3CC4 S;  4JP8 A;  4OX9 F;  5KT3 A;  2BR0 A;  2O66 A;  2PA3 A;  6FDR A;  2XMK A;  2VA3 A;  3FSX A;  1EKR A;  2GVD A;  1SL0 A;  1VQK S;  1AZS A;  1Y10 A;  2N7Y A;  2LXU A;  3C46 A;  5HAN A;  2CIM A;  5IWA J;  3NNC A;  1IR0 A;  3M1V A;  2AGQ A;  2WSF C;  4NA3 A;  4NYO A;  2RJZ A;  2Q1L A;  1JLG B;  4IG3 B;  3KMQ A;  5D0E A;  4YB1 P;  3KLH A;  2NPI A;  5DO2 A;  5AXM A;  2K1R A;  3W8G A;  5BYS A;  1SXL A;  3MMA B;  3MPW A;  2D9P A;  1RWW B;  2H5J B;  3I31 A;  2MKC A;  4ID8 A;  2L9D A;  4Q2L A;  3POT A;  2W2N P;  4ECY A;  2OJ3 A;  2HHV A;  4IO1 A;  1RI7 A;  1IKY B;  1HNV A;  2C3Y A;  4URQ U;  1OYD A;  1AW0 A;  2R7W A;  2V0N A;  1HW8 A;  2JH3 A;  2Z30 B;  2YH1 A;  1WKK A;  5D4O A;  5F8L A;  1T03 A;  2XLK A;  3JXO A;  2EBG A;  1SKU B;  1GAO A;  1KS2 A;  3TAR A;  2W9C A;  2FY1 A;  4KFB B;  4I6W A;  2GVZ A;  4LSN B;  2HFO A;  4KGV B;  2CJX B;  3QNW B;  1S99 A;  3CJ2 A;  2WVB A;  1QSY A;  2B5J A;  3NMA A;  1RAO A;  2DJW A;  1JJ4 A;  1WD6 A;  5LOQ A;  1X5T A;  2IM3 A;  1PAU B;  5HMY A;  3TR5 A;  1XNR J;  2W2O P;  2MGZ A;  5DDP C;  2FIU A;  2C42 A;  2NXU A;  1UJ4 A;  3OXG A;  5CYM A;  3OLA A;  4IR9 A;  2FJB B;  2QL7 B;  1H3D A;  4RR5 A;  4NLG A;  2R8K A;  2LMI A;  3J7Z T;  3BN7 A;  1YKW A;  3ZNJ 1;  3BRE A;  3DDI A;  3DXB A;  3RBZ A;  4Z7C A;  5F3T A;  2VD3 A;  3BBF A;  1EJ7 L;  3GJT B;  2VG7 A;  1IBK J;  1HI0 P;  3DU5 A;  2M7S A;  3NWR A;  4QW8 A;  2VOD A;  3GSD A;  1YJ9 S;  1IQZ A;  3HO1 A;  1FDN A;  4IFY A;  2J9D A;  3J80 Y;  1GQE A;  2FHJ A;  1WEZ A;  4HTJ A;  4PUO A;  3UVJ B;  1FE0 A;  2WTF A;  4G1Q B;  2VF3 A;  5D77 A;  4M5J A;  4DN9 A;  3MAH A;  1WEL A;  1FWK A;  1HAR A;  3AH6 A;  4DV1 J;  1G6B A;  3BSC A;  3IWN C;  2EC0 A;  3TEH B;  3NBP B;  2P5V A;  3W8P A;  4PYA A;  2HMI A;  3M8S A;  1B99 A;  2DB1 A;  2OSQ A;  3OXL A;  2E1M C;  2Q6C A;  4I2P B;  2HHH J;  3QID A;  1DTT A;  3W2W B;  3THV A;  1UFL A;  2IIH A;  3LP2 A;  2CG4 A;  3GJQ B;  1SPB P;  1R8H A;  3UCG A;  4BLG A;  3H5S A;  2HYI B;  3I5B A;  3D6T B;  3QGG A;  4IUF A;  2HWH A;  3JQJ A;  2GZO A;  4X66 F;  3UR0 A;  3S8S A;  3PY8 A;  1IBM F;  1HNW J;  4MKB A;  3K5O A;  3NP5 A;  4CLZ A;  5IOL A;  1FE4 A;  2DR9 A;  1AXQ A;  2FVR A;  3QGP A;  2UVU A;  3AXM A;  4LRF A;  4MK9 A;  2VA2 A;  3VQT A;  3TUI C;  2YKP A;  1F0X A;  4ED8 A;  1V9O A;  4B08 A;  4K4Z A;  4AXJ A;  1EKS A;  3NL0 A;  2E9R X;  8RUC A;  5F9L A;  4CIO A;  3QT7 A;  2WK4 A;  4K7Q A;  4PG5 A;  3VAH A;  5KFD A;  1YJN S;  1KON A;  3FKB A;  2OTL S;  1AT1 B;  2B7C B;  2EFG A;  5J1E B;  3TZX A;  1B4S A;  2CJY B;  4WZM A;  1WDD A;  4JYA J;  2G2Z A;  2QJ3 A;  3UN5 A;  1RAF B;  3E3X A;  6AT1 B;  2BJ7 A;  4DX5 A;  5D4L A;  3DOK A;  1MSW D;  4R8U B;  2QSF A;  5HP1 B;  4WYW A;  3K5L A;  2XC9 A;  1SC1 B;  2V8G A;  2C2D A;  4ZVG A;  3GFX A;  4P2S A;  3TZZ A;  5HMZ A;  3Q2T C;  3RAX A;  3PR5 B;  1R3N A;  4K4T A;  5CYQ B;  5EX0 A;  5F0W A;  5B0F A;  4DR4 F;  3ELH A;  1WKL A;  4DV0 F;  2G2O A;  1W2I A;  1MML A;  2YKQ A;  4WFN Q;  4KV8 A;  2CA9 A;  1U6Z A;  2BZ2 A;  1S10 A;  2UVV A;  1IWA A;  5K9F A;  1SJ3 P;  5KG4 A;  2V8P A;  1HNZ J;  1CS4 B;  3Q83 A;  1I3O B;  1TK8 A;  1WOR A;  1PJ5 A;  2BKP A;  2CRL A;  3GJS B;  4ZPC A;  3BZQ A;  1KTV A;  1APS A;  1KVI A;  4CT8 A;  2N4C A;  3ITH A;  3I0S A;  3Q8Y A;  1I6J A;  2GS8 A;  4AYB D;  2R2R A;  5BR8 J;  1BQM B;  4OI1 A;  2HZV A;  3M6X A;  3W9H A;  1T3O A;  1Q16 B;  1TL1 B;  4QU7 A;  5A8W B;  2HGL A;  2VFT A;  1KFD A;  4DR1 J;  1SB6 A;  2B7B B;  4UST A;  5A2Q Y;  3H2L A;  1V5V A;  2JVR A;  2KRR A;  1JXV A;  4B3S J;  1UVI A;  1D0E A;  4Y2M A;  3MAA A;  3D5M A;  2HS4 A;  1G4C A;  1LKZ A;  2FVQ A;  2ZBR A;  1UWB A;  2O67 A;  1QVG R;  2IDE A;  1IR1 A;  4K4Y A;  2OPR A;  2XO7 A;  3CCU S;  3HKZ D;  5IT0 A;  2KG1 A;  5J2Q B;  2KJW A;  2AU0 A;  4QQB A;  1BUX A;  3GG1 A;  5DLG A;  1S7H A;  1FFG B;  2DH9 A;  4P74 A;  1YLX A;  2NUH A;  5KAK A;  3TW0 A;  3CJT A;  4NI2 A;  1Q79 A;  1Q8L A;  3H5U A;  3C6U A;  3CUL A;  4PG6 A;  3ENQ A;  2OMO A;  3Q8R B;  1W26 A;  4ZDN A;  3W5X A;  3GYX B;  2IM2 A;  4JI2 F;  2KHD A;  3GPA A;  2YWH A;  4G1P A;  4MTP A;  1UKU A;  1FKP B;  2DKO B;  2QIF A;  2V34 A;  1PJ6 A;  3IAM 9;  2D1C A;  1HQU A;  1YHQ S;  3W63 A;  3ZZR A;  3RB3 A;  3R7N B;  4R0J A;  3LP0 B;  3MDF A;  3JQK A;  3KK1 B;  4UOC A;  3JYT B;  3DI6 B;  1XIQ A;  2GW8 A;  2FGO A;  1KSP A;  1WC6 A;  2MLZ A;  4PEO A;  4P52 A;  4K5S A;  3NMR A;  2L3M A;  2GV1 A;  3D4J A;  1ICE B;  2CWX A;  1SI9 A;  2ZH1 A;  1FJG J;  1X0F A;  1IN0 A;  1Y11 A;  3PXG a;  2X51 A;  3M6U A;  4NZ6 A;  5KFL A;  2VDI A;  1CVJ A;  1IM4 A;  4LRD A;  2YX4 A;  4QU6 A;  3AJD A;  4JI6 F;  3NLC A;  3WX4 A;  2MQM A;  4RW6 A;  2HBQ B;  1TKX A;  3MAQ A;  2Y1I A;  4FXW A;  3T5K A;  1RT7 A;  1S9G B;  3AXK A;  3HSJ A;  2XTJ P;  4LQ9 A;  1Q5V A;  1P1T A;  2YKN B;  3HT3 A;  2Z2M A;  3O8W A;  4ERD A;  1GEH A;  4ALZ A;  4ZVQ B;  1PAE X;  4TXS A;  1VCT A;  2VG5 A;  3MM9 A;  3MM5 A;  1H2U X;  2FTR A;  1M5P C;  1OQ6 A;  3SFG A;  1VIS A;  2IMO A;  2HFZ A;  1T05 A;  3W1Y C;  5KT6 A;  3A8J A;  4WWS A;  2HHT A;  3T19 A;  2V4J A;  4MIB A;  4ELT A;  4FBU A;  2QFJ A;  1NH7 A;  2LQ8 A;  3MUT P;  3HXM A;  4QIE A;  4DMZ A;  3LAM A;  4GKJ J;  1NDL A;  2M5Y A;  3I9Z A;  2CUY A;  4NZ7 A;  3B8H A;  5A8R B;  3H20 A;  3SSR A;  5LM7 E;  4XDC A;  4KC5 A;  1R8C A;  5L46 A;  4QWC A;  4KGM A;  1VI7 A;  2YXL A;  5E7O B;  4C8O A;  3L4B C;  1HPZ B;  4KO0 B;  1LWC A;  5B09 A;  3PX4 A;  2QMX A;  3MXH P;  3IR6 B;  1S59 A;  3FC9 A;  2P9C A;  4DV2 J;  5DZ7 A;  2FHJ D;  3P3D A;  1RHU B;  1TZ0 A;  2AEJ A;  3EE3 A;  4DS5 A;  2A2D A;  3MEC B;  1Y4Z B;  4OZJ A;  3K17 A;  1DQ9 A;  1SC4 B;  5B08 A;  2UUA J;  1LK5 A;  3HHE A;  1HQE A;  4CP5 A;  1WEX A;  4BWJ A;  3W2V B;  4J9N A;  3PKM A;  3FEZ A;  3CCR S;  4I2Q A;  2Y1R I;  2GA7 A;  2YTC A;  1FRI A;  2BYC A;  1N5Y A;  1H74 A;  1YI2 S;  3D9B A;  4C11 B;  4WK1 A;  1TL4 A;  2AYB A;  4FYX B;  1HD0 A;  3IS9 A;  4FKY A;  1JJ2 R;  3HKW A;  1SQG A;  1F5A A;  1FDA A;  1JMT A;  1U6B A;  4DV7 F;  1LWE A;  4DS4 A;  1RTZ A;  2B6A B;  2I0X A;  3UD4 P;  5D0G A;  1BD6 A;  5DG7 A;  1ARO P;  4QIG A;  3KJV B;  3KTQ A;  4ZVT B;  3WIV A;  2FJD B;  2MKK A;  1S4E A;  3NS7 B;  4C8K A;  2QMU B;  3I55 S;  2F8M A;  4JI1 F;  1LXJ A;  5K14 A;  2ILZ A;  1S6P B;  2ZIT A;  3VVT A;  1T02 A;  2LU2 A;  2M70 A;  3OR2 A;  3SV3 A;  1U26 A;  4ETX A;  1SJR A;  3HK2 A;  2CAJ A;  2DEI A;  5HRO B;  1UPP A;  4L72 B;  4LR7 A;  2VG6 B;  4C8M A;  4PQU A;  3JAM U;  3ZO7 A;  5KTQ A;  1EET A;  2B9E A;  1VDH A;  1VHF A;  4ZVE A;  2IC3 A;  1KQG B;  2XLJ A;  3R9L A;  5HQM A;  1CG2 A;  2JC0 A;  3QJJ A;  1PBU A;  5GAE I;  4YUD A;  5D6G A;  1N0U A;  2OPQ A;  5I42 B;  1S4F A;  2LA6 A;  4KY3 A;  2PE8 A;  2PEH A;  4CO2 A;  2QG9 B;  4YDX A;  1KOH A;  1MWQ A;  3DGV A;  4LSZ B;  3QRR A;  1SIZ A;  4ZHR A;  4EWT A;  3IM9 A;  3GV7 B;  4NXM J;  4DR5 F;  1FTC A;  3OSN A;  1S6Q A;  1GXU A;  2KM8 C;  4Y2I A;  3QO9 A;  4R0E A;  4FF2 A;  1XMQ F;  2K7J A;  2XS2 A;  4DSE A;  3MPD A;  2K8G A;  4M8L A;  5KFQ A;  3EM1 A;  1U1K A;  3D28 A;  5KFU A;  5B0G A;  9ATC B;  3FQK A;  4PR6 A;  2HFV A;  2CPY A;  2GQC A;  1CJV B;  2MZQ A;  2ZKU A;  3IC1 A;  2KYZ A;  2P6T A;  3JS9 A;  2Z0G A;  1RSC A;  2MPU A;  3C6T B;  3QLH A;  5C7P A;  3P8B B;  2QLW A;  1OO0 B;  2F63 A;  1RTD A;  1SH3 A;  4L74 A;  1GTH A;  2KHC A;  1CJU A;  3OBI A;  1Y0H A;  5C2G A;  3AAW B;  1WC1 A;  3LGH A;  4ES1 A;  3IMQ J;  3QAU A;  4R25 A;  5E3C A;  3HDS A;  4F3M A;  2UXB J;  4DXL A;  1MLA A;  2AW0 A;  1VQ5 S;  3HT0 A;  1UET A;  1U8S A;  1GMW A;  4C8L A;  3FCW A;  1EHW A;  4RX6 A;  4H4K C;  3KK2 B;  2D41 A;  2K06 A;  4DR3 F;  3CT9 A;  4DG1 A;  2J9E A;  3MEE B;  4LT6 A;  4DOZ A;  4OZ5 A;  5D4N A;  4OYI A;  3T1H F;  2VAS A;  4DR6 J;  3TYT A;  3OR1 B;  5HL7 Q;  3KG4 A;  4WP3 A;  3UE2 A;  1D09 B;  1QY7 A;  2DNG A;  2ZC3 A;  2ZWP A;  1N5S A;  4O4G A;  3T1Y J;  3AJ1 A;  1U24 A;  2F1F A;  2BM0 A;  3M8W A;  4LUB A;  4ZS6 A;  1JNR B;  4B9L A;  1BQX A;  1QD1 A;  4OZL A;  4OI0 A;  1S49 A;  1JLA A;  1URR A;  2YNI B;  1CJT B;  4ZCK A;  2JWN A;  2HBR B;  3LP1 B;  3MTK A;  2IAJ B;  2XZW A;  1NJW A;  5A8K A;  3IRX A;  2XLI A;  2R7U A;  3R7S B;  3HVT B;  4GC7 A;  3SSS A;  4Y28 C;  1NB2 A;  1WI8 A;  1CQN A;  4WII A;  1FFW B;  1F9H A;  2XO6 A;  1RT3 B;  2Z8Q A;  4WP8 A;  3K59 A;  4MYT A;  5DET A;  3DRP A;  3G2X A;  2DRD A;  4R5P A;  5HJY A;  2XI2 A;  1L3T A;  1MRO A;  2OEL A;  3RW6 A;  1BQN B;  1VOM A;  1SV5 A;  2H4Y B;  1FA0 A;  2J9D E;  4ZN3 A;  3PFO A;  2E1C A;  3SDE B;  1CC8 A;  1NPR A;  1VQP S;  4OX8 A;  3HJF A;  1QAJ A;  4F4Y A;  2BA9 A;  1NM2 A;  2C3P A;  2W4P A;  2HAI A;  3X1L B;  1F2G A;  3ZZP A;  3EMT A;  2AV5 A;  4ECW A;  3C3L A;  4DL6 A;  5CCM A;  3WX8 A;  3F41 A;  4YME A;  5LJ5 Y;  1XEZ A;  2GJF A;  1R0A B;  1X4A A;  4I7F A;  4CO5 A;  1UWA A;  2BJE A;  2V8V A;  4DF8 A;  2P6S A;  3KKF A;  4F25 A;  4WZQ A;  4GVL A;  4XAK A;  2C3U A;  1B0P A;  1HWJ A;  1YJT A;  1MG7 A;  3D1Q A;  3PX6 A;  4KH0 B;  2FGC A;  3QBC A;  2AJ1 A;  4QIV A;  2NUU G;  1EP4 B;  2BEF A;  4I64 A;  4C3K A;  3K58 A;  3AJ2 A;  3A3P B;  4O0N A;  4JI3 F;  2FHK A;  4LF7 J;  2OFG X;  4DPY A;  4ZVR B;  2Y9H A;  4C48 A;  4IR1 A;  3OTC A;  3TAM B;  1FK9 B;  3IG1 A;  1M0S A;  1BWV A;  2BJ9 A;  4B3M J;  2J8S A;  2YWW A;  1GTE A;  4ZK7 M;  1S1W A;  1RDR A;  2W9B A;  1M5K C;  1TL3 A;  4MKY A;  3UD5 A;  4DV6 J;  2QA4 G;  1WAC A;  2YQ1 A;  3GCW P;  3UDV A;  5KOX A;  3EYZ A;  4NLP A;  2XS7 A;  2IVY A;  1ZET A;  1P6T A;  1AA1 B;  4K8R A;  1RYR A;  3KJF B;  3UDC A;  1J5E J;  4OYB A;  3PIO Q;  2N3O A;  4CLU A;  2YKO A;  1KFS A;  2M9K A;  1VQ8 S;  4IG0 B;  2HHP A;  2QA4 S;  1IKV B;  4F26 A;  1SKS A;  2ZH6 A;  2E1A A;  1WDT A;  3SEO A;  2RNE A;  3WQP A;  4ZLJ A;  4DL4 A;  3BGR B;  1BLU A;  3VAI A;  3M6V A;  2ERR A;  1RQ0 A;  2XHW A;  4RU2 A;  2W01 A;  3CDU A;  2J6T A;  4OI2 A;  3V81 A;  4J9M A;  2CNN B;  2I5J B;  3C16 A;  4HH1 A;  1XBW A;  1ITP A;  1L3S A;  3RU0 A;  1NJY A;  2HKE A;  3FRY A;  2D9O A;  1WUU A;  3O3L A;  1O6X A;  4RW9 A;  3PKY A;  1RWK B;  4LRC A;  3DOL B;  1NZ8 A;  2DY9 A;  4OL8 A;  5K8M A;  3EVM A;  2CPF A;  1PBA A;  5F9N A;  3ICL A;  3CD0 A;  4CCH A;  3R5G A;  2XUL A;  2XMW A;  2JL9 A;  1C2P A;  3U7J A;  4WTO B;  4GRS A;  5H9E K;  1C0U B;  3VGU A;  1AFJ A;  2UUT A;  3BEG B;  2U2F A;  1HYS B;  2LQ9 A;  2E1P A;  4KSE B;  3S1T A;  2GQQ A;  2B9Y A;  1CSJ A;  3V6H A;  4Z37 A;  3L09 A;  3C66 A;  4LF5 J;  5B0A A;  3DLG B;  1VHI A;  3HM9 A;  3OL9 A;  1P1L A;  1H38 A;  1VQO S;  1HBN B;  2IVF B;  2UUB J;  1AUS L;  1U1Q A;  3VTI A;  2G0J A;  1QE1 B;  3I87 A;  3W9J A;  2CQH A;  2ZD1 B;  1U0H A;  1T9V A;  4PAA A;  4YB6 A;  2DXD A;  2M8D B;  3K8V A;  2YWE A;  3MR5 A;  2VKR A;  2VJV A;  4X4R A;  4YB5 A;  2RKI B;  2VZ9 A;  3ENV A;  2WVC A;  1R0C B;  3D3C J;  1U2C A;  3EVW A;  4IH5 A;  2DY1 A;  1WC5 A;  2NYH A;  3NS6 A;  2K2P A;  4LF6 J;  3NAI A;  3FBE A;  2VPW B;  3PR4 A;  4IH7 A;  3FCH A;  4FVC A;  3ZTS A;  1NSK L;  4U96 A;  2RT3 A;  4CLK A;  3KLI A;  4RW4 A;  2VV5 A;  2R7S A;  3W65 A;  1NLK L;  2IJR A;  2P8I A;  2GIQ A;  2DYA A;  1Z1Z A;  5ETK A;  2MKH A;  4XDD A;  5IQQ A;  1LOU A;  1MMN A;  3GG0 A;  2GGP B;  4E0D A;  4FP9 A;  1XJW B;  4QWB A;  2V2Q A;  3R7B B;  5BYR A;  3KXD A;  2VFU A;  3M05 A;  4KHM A;  1Q0N A;  2GX8 A;  2HRU A;  3CTR A;  1GMW D;  3EX7 B;  1JLB A;  3D0I E;  1A0O B;  3BJY A;  1VRT B;  2OPP A;  1E6V B;  4OIX A;  1HA1 A;  3OTE A;  2PDA A;  2HS3 A;  3MWB A;  2AQ4 A;  4DSI A;  3QWU A;  3DCA A;  1J5O B;  2DGS A;  3LGM A;  2PI4 A;  1R6V A;  3SZ2 A;  5AJ3 J;  3TJA A;  2YBV A;  3J81 j;  1DQ8 A;  2AX1 A;  5HK4 A;  4P72 A;  4K0K J;  3G87 A;  2D74 B;  4NLD A;  4V1A k;  2OLW A;  5EGY A;  3HHL B;  4J9K A;  4J9P A;  4M5K A;  1MN9 A;  4CO4 A;  1NO8 A;  5MLC V;  2YNF B;  5IM0 A;  2V50 A;  4ILM A;  4L76 A;  4ITS A;  4C6A A;  3CJ3 A;  2B4V A;  3B6B A;  5I4M A;  3M4X A;  4HHJ A;  1FD2 A;  1UTA A;  4ECQ A;  3KDO A;  2FLO A;  2W25 A;  3KYL A;  3RB6 A;  1T8E A;  2B4O A;  5LMU J;  3NNH A;  1UZH A;  1S0N A;  3DGP B;  2RQ4 A;  2LQ5 A;  4Z7Y A;  1T3N A;  4UOG A;  4P73 A;  1TV6 A;  1UFK A;  5J1P A;  3UQS A;  2BE2 B;  2XSF A;  2AJF E;  4O3R A;  3VAG A;  1JXL A;  4KR0 B;  2JJ4 D;  5IT9 U;  2BM1 A;  2CQ0 A;  3GTY X;  1E6Y B;  1JB0 C;  3CCZ A;  1YRU A;  2M0G B;  3M9O B;  4ECR A;  5KFK A;  5FDL A;  1U25 A;  4FXD A;  3HZG A;  4ID5 B;  4YDD B;  2DIU A;  4WFX A;  1DZ5 A;  1RAB B;  3IGV A;  2MQN A;  1UJ5 A;  2HRY A;  5E2Q A;  4W4M A;  5AT1 B;  2ZBC A;  2OHD A;  5ETQ A;  5CQG A;  1GK8 A;  1G7C B;  1IKW B;  4P71 A;  2JFK A;  3FBC A;  3HCX A;  3HFV A;  1RE1 B;  1Y7P A;  4KKO A;  2VQE J;  3PAC A;  1OYE A;  2UVW A;  1S1X B;  4F2R A;  2J9C A;  2HND B;  3THP A;  3M8P A;  1X5S A;  2QTW A;  3H5Y A;  2HIY A;  3K2Y A;  4LSL A;  1EQ0 A;  3T41 A;  2ZJR Q;  2D3Z A;  3HSD A;  4LRB A;  3OSP A;  4XPC A;  5EHH A;  3G6E S;  2C2N A;  4LF4 F;  5K8P A;  1SJ1 A;  2ZBQ A;  3WDO A;  2HGM A;  3QZ8 A;  2HHQ A;  2DXF A;  2OPS B;  4WKR A;  9RUB A;  4EBD A;  4KHP F;  1HBO B;  2HNZ B;  3WC0 A;  2UV8 G;  2QLF B;  1UMJ A;  5KG1 A;  4PKD B;  1L3U A;  1U02 A;  2DGT A;  4X84 A;  1KHW A;  1TL7 B;  4MK8 A;  4P75 A;  2R8J A;  3QYY A;  2FQQ B;  1RZM A;  2XZD B;  1I5O B;  4UZC A;  3M32 A;  3PJ9 A;  1NH8 A;  4NWB A;  1UAW A;  3B78 A;  4OX7 A;  4G1I A;  4WPA A;  3CCM S;  4OI6 A;  3PVX A;  3MR6 A;  5F8J A;  1R6Y A;  3MF5 A;  4DI6 A;  2GVD B;  2QO3 A;  2ATL A;  1YJ7 A;  1NK6 A;  4WE1 A;  2GJ2 A;  5IFM A;  2FJX A;  2OUG A;  1AZS B;  4C7Q A;  4J5O A;  2DO0 A;  3CD5 A;  4YFU A;  5KFO A;  2AHO B;  5ETS A;  2AD9 A;  2AZ3 A;  4NYP A;  1VLY A;  2M4M A;  5D15 A;  1IBC B;  4DV4 J;  4C8Y A;  4JB8 B;  3M1V B;  4UT4 A;  1YQH A;  1IR2 A;  2F5G A;  3BF4 A;  3ZZU A;  3A4T A;  1SKR A;  3T3F A;  2MSS A;  3IBW A;  1X5O A;  5E5N A;  5FLX Y;  4EUV A;  5JVG Q;  2P9E A;  2K1R B;  4FN5 A;  3BBC A;  1FRM A;  4NLY A;  3G71 S;  2HLT A;  1R7I A;  4NLX A;  4K4X A;  3VV2 B;  4A8M P;  4W92 B;  1SBR A;  1U0S A;  1VQ7 S;  2LXF A;  1PC5 A;  3OL8 A;  3RZA A;  4M94 A;  3POT B;  2I38 A;  2AJ2 A;  1HNV B;  2HVZ A;  5HN0 A;  1S9F A;  1NND A;  2UXC J;  3R5D A;  1Y00 A;  1RT2 A;  1VIX A;  5MAO A;  1QUV A;  1T03 B;  3DRR A;  3CO9 A;  1RAA B;  2UUW A;  3EDQ B;  3A3N B;  4IOB A;  1S9E A;  3BO4 A;  1WSR A;  2W9C B;  1X4C A;  2GVZ B;  2OI2 A;  2YWG A;  4LRE A;  4F7V A;  3GV8 B;  2AEM A;  1NPK A;  2B5J B;  3Q86 A;  3QMQ A;  2H54 B;  2ZH7 A;  2OGU A;  3D54 A;  4FDF A;  5SUH A;  4B17 A;  1Q86 T;  4ANE A;  3MPU B;  2MQO A;  4DHV A;  2FLL A;  2WVF A;  2RE1 A;  3O1L A;  2MGZ B;  3TP2 A;  2W7A A;  4JV5 F;  5CYM B;  3MI7 X;  3MFH A;  1NK0 A;  1XER A;  1Q8B A;  5C24 A;  4ED5 A;  1D9F A;  4ZIV A;  1D8Z A;  2ATC B;  4B02 A;  4M5D A;  3IM8 A;  3V2U C;  1N33 J;  4ED3 A;  4QZV B;  4O3S A;  1PYS B;  5AXK A;  5B0D A;  4ZCL A;  2R8I A;  4MJK A;  3KG1 A;  3JSM A;  2LU1 A;  3LPE A;  2VG7 B;  4GKK J;  4CLP A;  3MMC A;  1FJE B;  1UJ6 A;  3P6Y C;  2XEX A;  2KFY A;  1UEV A;  1AYE A;  3TOQ A;  4IFY B;  4DV5 F;  3EGW B;  2R2S A;  1VQL S;  1UW9 A;  1UVM A;  3UNG C;  5GME A;  2ZVS A;  3AFG A;  4PUO B;  2G0I A;  5GMD A;  4JV2 A;  3PDN A;  1RWX B;  2I8E A;  3KK3 A;  2XY6 A;  2PD1 A;  3UW1 A;  3CIM A;  1WJ9 A;  2MZ1 A;  3HD2 A;  4ED7 A;  2NSB A;  4DUT A;  3D0G E;  2H1Y A;  4AQY F;  3BQ2 A;  4URS A;  4RZR A;  3F56 A;  2FY8 A;  3D2W A;  1D9D A;  2AX0 A;  3D0H E;  2HMI B;  4NOH A;  3PEH A;  3VWS A;  1MWZ A;  1WOP A;  2JC1 A;  1DTT B;  4HI1 A;  1ZYQ A;  3LP2 B;  2H48 B;  2HHW A;  2Z2L A;  4OHX A;  4Q5V A;  4DV3 J;  4UF4 A;  1H0H B;  1TEL A;  4BWM A;  3CCJ S;  2OEJ A;  4QOT A;  3CCE S;  3ILO A;  2GAH C;  4DR2 F;  1ZM9 A;  1X4E A;  3Q89 A;  2HFU A;  3PW5 A;  2C1E B;  4UW2 A;  1VR6 A;  3RAQ A;  5LSR A;  3SQO P;  1U1M A;  2BQ3 A;  2CPI A;  4ZPV R;  1RCO B;  1LW2 A;  2E29 A;  3A8K A;  1WTF A;  4AL5 A;  3FVY A;  1RHJ B;  2ROP A;  3PFE A;  3NAH A;  3J80 U;  4MKV A;  2EVZ A;  4IO9 Q;  1F5C A;  1LNQ A;  4XO0 A;  2RQK A;  2HLU A;  2GNK A;  3EGV A;  4LFC F;  4WCE Q;  1J27 A;  1RWP B;  5KFM A;  1Q7L B;  2ZM6 J;  1L3V A;  4FZV A;  3C15 A;  2XQC A;  3NY0 A;  3AA8 A;  1FER A;  3R27 A;  2CPH A;  1S48 A;  1NSA A;  2KH9 A;  3DOK B;  2DBB A;  1XK8 A;  4DWI A;  1NBE B;  1N32 J;  4NLR A;  2G0C A;  4K50 A;  1VIO A;  4LFB F;  4DLE A;  1NSQ A;  2QZ8 A;  2ZJQ Q;  3HVA A;  2A6M A;  1VLO A;  1YTY A;  4O4R A;  2VFS A;  3GR1 A;  2XS5 A;  4ELV A;  5LXR A;  1V6H A;  1KEK A;  2Y1L B;  1A6L A;  3I32 A;  4DU8 A;  3MMB A;  5KG7 A;  4CO3 A;  2COL A;  3M2U B;  4WKY A;  3D6F B;  3LW5 C;  1RHM B;  4YN3 B;  2QEX S;  4KV8 B;  1CJK A;  5DRK A;  5F8H A;  2BAN A;  1O0P A;  2VB6 A;  2BOP A;  5L9X A;  1LWF A;  2DXE A;  3CNQ P;  1WHY A;  4ER8 A;  5M2U A;  1JLC A;  3UCU P;  4E98 A;  2YPZ A;  3GIK A;  2Q3P A;  5LL6 d;  2MKJ A;  3EWG A;  1DAX A;  4KPY A;  3HMJ G;  1U09 A;  1T9T A;  2H65 B;  4TNO A;  3I9V 9;  2VBY A;  5D0H A;  5L1I A;  1KQS R;  4DU7 A;  3ITH B;  2RUG A;  3J81 Y;  3I0S B;  2KXF A;  2XY7 A;  2JEF A;  3QGI A;  4ZIT A;  5CH7 B;  2UU9 F;  2UUC J;  1CEZ A;  1K0V A;  1HWK A;  2RRA A;  3TAP A;  1U1O A;  2GML A;  7FD1 A;  2WON A;  1KVK A;  5DDO C;  1RUS A;  2V9W A;  3R97 A;  2YPY A;  1GXT A;  2YVS A;  3AT1 B;  3RJM B;  4LMZ A;  3QT5 A;  5AE2 A;  2R2T A;  2D3U A;  4EGL A;  1NK5 A;  2R8G A;  2KXH A;  3VCD A;  4UY8 5;  4IFV A;  2J76 E;  2K3I A;  4ZP7 A;  3MAA B;  3GV5 B;  5D3G A;  2QA2 A;  4XIU A;  3EPG A;  1GT8 A;  1UWB B;  3KLE A;  4N47 A;  4AFF A;  2E5I A;  4NA1 A;  7AT1 B;  4DSJ A;  4OYZ A;  3KNA A;  4BDP A;  5IT4 A;  2VPZ B;  2OPR B;  4DPX A;  3RRH A;  1IM6 A;  7FDR A;  3PO5 A;  1RGV A;  1Z4U A;  2HEK A;  1TVR A;  4PWD A;  2RF2 A;  1VBY A;  2W8K A;  4QIF A;  1FJ7 A;  5J2N A;  4IRD A;  2R42 A;  4B9N A;  3DRX A;  4C0H A;  1U47 A;  4NI2 B;  1RA6 A;  1T0T V;  2BAC A;  2WOM A;  2W1B A;  3C6U B;  1VC6 A;  4HHH A;  2MTL A;  2WVD A;  3IWL A;  2UZA A;  4H4O A;  3EIC A;  3MCM A;  2A10 A;  1R89 A;  4RUC A;  2IFX A;  2UP1 A;  1SJF A;  2DNZ A;  4CLL A;  1NKC A;  2A18 A;  1NK8 A;  1L3K A;  1HQU B;  4ZPB A;  2F65 A;  4I6Y A;  4HAC A;  2J6S A;  4A47 A;  5K8N A;  1FHT A;  3SCK E;  5T7L A;  2Y1J A;  3LPY A;  5KG0 A;  2FJE B;  3C2P A;  2OTJ S;  1F9F A;  4WIQ A;  1SH2 A;  1NDK A;  1U7L A;  3NGU A;  1Q82 T;  4OJ3 A;  5LSO A;  2W2P P;  3HF5 A;  5A2Q U;  3PO4 A;  3FBB A;  3SMZ A;  4Z2X A;  3HP6 A;  3CCL S;  2V9K A;  1RP5 A;  3MM7 A;  4UUX A;  1GH8 A;  2PO4 A;  4AD6 A;  1LW0 A;  2OP5 A;  2ZHB A;  4DBQ A;  2WB4 A;  3U1N A;  2X7I A;  4HDG A;  3ISZ A;  1NB7 A;  5LSL A;  1DHM A;  1Q5Y A;  4RW6 B;  4ILL A;  1TKX B;  4IOC Q;  3DDN A;  4DF4 A;  1X4F A;  2Z58 B;  1H72 C;  1WC0 A;  2Y0S D;  1FXL A;  1RT7 B;  1WOS A;  3GIJ A;  4C98 A;  2HRT A;  3W5Y A;  2V63 A;  1U45 A;  1HD1 A;  2JZ5 A;  4F4W A;  1F2H A;  3V6D A;  2CQB A;  2HFN A;  5BJR A;  3PYG A;  2VG5 B;  4JI0 J;  1RHR B;  2ZWO A;  5IXU A;  3MM9 B;  3MM5 B;  3PV8 A;  1ZH5 A;  5LMN J;  1T05 B;  3KHR A;  3BS9 A;  2DK2 A;  3UCZ P;  5EN1 A;  2RU9 A;  1FD8 A;  2V4J B;  4DCP B;  4X64 J;  3B4D A;  4HI2 A;  3DN9 A;  4J90 A;  5LXY A;  4NYZ A;  3K7R A;  1X60 A;  3OV7 A;  4DQS A;  2J7K A;  4NLT A;  1FEE A;  4YY3 F;  5HVF A;  2C2K B;  1XR7 A;  1V3R A;  2GHV C;  2HGN A;  2KM8 B;  1QUP A;  2KT2 A;  1Z2Z A;  1LWC B;  3T5L A;  4JI5 J;  5H9F J;  2XCA A;  4RNH A;  1VMB A;  2CVE A;  1N0V C;  4BS2 A;  2CZ4 A;  1REV A;  3ULH A;  3CDA A;  1K1Q A;  2ZBP A;  5DLF A;  4DLG A;  3G8Q A;  2WW8 A;  1UFW A;  3OD2 A;  4RW7 A;  2UXD J;  3VGT A;  4J9Q A;  4B3T F;  2R2U A;  5HMX A;  2MQP A;  3BKT A;  3NXZ A;  2DIV A;  5JMN A;  2NZC A;  4ZP8 A;  1HQE B;  5EWG A;  2J7U A;  4Q0B B;  1Q7Y T;  5H9F K;  2XMM A;  4DQQ A;  2VQF J;  1TFW A;  4C97 A;  4I2Q B;  2DHH A;  4XK8 C;  3MPV A;  4GO7 X;  3U1M A;  2J0X A;  1JLQ A;  1HMV A;  1SL1 A;  1N5Y B;  2ZKT A;  4KGZ B;  4PQA A;  5KFG A;  3UDE A;  4RUH A;  1XTZ A;  3IS9 B;  1NHK L;  1JNZ B;  1JIH A;  1WTB A;  1KWM A;  2E5L F;  1LWE B;  2KG0 A;  4OI4 A;  5A0Y A;  3QT6 A;  1DLO A;  2ALZ A;  1SUQ A;  2MY7 A;  4DUZ J;  3H4D A;  4P10 A;  5EUH A;  5KFR A;  3DRS A;  3CJ0 A;  3HFK A;  2DCU B;  1DRZ A;  1BWE A;  3PYE A;  4O44 A;  1KVJ A;  4HLB A;  5K14 B;  4CWB A;  5ITH A;  4B3O A;  3PRD A;  3OR2 B;  2MJU A;  1TTH B;  1NHV A;  1ZOT A;  2JOQ A;  4I6A A;  1N36 J;  3RR7 A;  2Q43 A;  4OYW A;  1N88 A;  4PQU B;  5KFW A;  1JKH A;  1EET B;  5KFY A;  1JLE A;  2N4D A;  3LF0 A;  2ZZT A;  4JUZ A;  4FS2 A;  4LF8 J;  2E5H A;  2IC3 B;  3DRY A;  1RK8 A;  2FHM A;  2QA1 A;  3MUR P;  1HR0 J;  1IBL J;  3LH2 S;  1TR0 A;  2DR7 A;  2YKA A;  1REG X;  2OAU A;  3TWZ A;  2OPQ B;  3DOM A;  2YX7 A;  3Q8Q B;  4LF9 J;  4X62 J;  4JI7 J;  1XMO J;  2DVI A;  1TQL A;  3PM9 A;  3OJS A;  4X4Q A;  4LFA J;  2JEI A;  4ZHR B;  3OTO F;  2DR8 A;  3A13 A;  2XHC A;  3AHP A;  1S6Q B;  1V3Z A;  4J37 A;  1HQ2 A;  4PWW A;  3HFZ B;  4OX9 J;  4DSF A;  2LEC A;  1UA0 A;  3W7B A;  3QO9 B;  3OL6 A;  1K47 A;  3R2C J;  2XG8 A;  3IWX A;  4AT1 B;  2HBY B;  4WF9 Q;  4JI4 F;  2G9O A;  4NAS A;  4HYK A;  1N34 F;  1S1T A;  2C2M B;  2LCW A;  2FVP A;  1RLD A;  5KOW A;  4ZLP A;  4FYD A;  2R7T A;  1KRP A;  1C4A A;  2KDO A;  3WIU A;  1HWI A;  2MZT A;  3MD3 A;  2MQL A;  1NKB A;  3N5F A;  3GIL A;  1YK9 A;  4CH1 A;  4EU0 A;  2GHW A;  2JEJ A;  3QLH B;  4P6Q A;  3NS5 A;  4OYX A;  2CQD A;  3OVA A;  1RTD B;  4X4U A;  1CJU B;  5KFA A;  2OD6 A;  3N5B A;  3OLB A;  2BJ8 A;  3S6E A;  4LBH A;  4UTG A;  5HVH A;  5K8O A;  2ZOG A;  1NDP A;  1QJH A;  2BQU A;  1TMM A;  4ILR A;  4HR2 A;  4DUY F;  3E51 A;  3MM8 A;  4CT9 A;  4ZP9 A;  3D6M B;  3ET6 A;  4KIA A;  2BQR A;  1RWM B;  2ZZM A;  2PFD A;  4Q2M A;  4V19 X;  3PRV A;  4DG1 B;  4UOF A;  2C28 A;  2NYI A;  1FKO A;  2BMB A;  4ZJL A;  2NXJ A;  1RWO B;  1K0T A;  4O4G B;  3MOZ A;  1FJC A;  1QSL A;  5L38 A;  1GMV A;  5F41 A;  2QSW A;  3RB4 A;  3M30 A;  4GVB A;  4KE5 A;  4M5H A;  3GR0 A;  1JLA B;  3BGU A;  3ZXW A;  4YOE A;  2XSJ A;  3UNY A;  2AKW B;  4ZKA A;  3TUJ C;  5A8K B;  3IRX B;  3LAN A;  2O1P A;  1HNX F;  4DR7 F;  2J0W A;  3DYA A;  2GAG C;  4NCG A;  4I67 A;  3KOA A;  3IN5 A;  2PI5 A;  3V4I A;  5GVQ A;  3DRP B;  3MD1 A;  4X4N A;  2D7S A;  5IV3 A;  2IRU A;  4A8F A;  4R5P B;  1G1X A;  4N41 A;  2W9A A;  3AQO A;  4D3G A;  2LQB A;  2DPJ A;  1SV5 B;  1HBU A;  5EWF A;  1Y5I B;  3CE8 A;  3TVY A;  5E3P A;  1OY8 A;  1RT1 A;  4ECZ A;  3TUP A;  2RD5 C;  2GQ2 A;  4F0K A;  2PT0 A;  1L5U A;  2J6U A;  2FYX A;  2BV3 A;  4FYW B;  1R31 A;  2XMV A;  3UWT A;  1DBD A;  2NLW A;  1RHQ B;  2W4D A;  2X1F A;  5J1N A;  4RNN A;  1KBR A;  4QCL A;  4I7F B;  5E33 A;  1NPP A;  1X4B A;  4X66 J;  4GC6 A;  1RXO B;  1IBM J;  3L7P A;  2OH2 A;  3RW7 A;  5B7W A;  1G2E A;  1LK7 A;  3R8Y A;  3G9C A;  3MR3 A;  3TQE A;  1VJW A;  4MFB A;  5KFV A;  2DNR A;  1UVJ A;  4RUA A;  3NGR A;  4UUW A;  2LLZ A;  2DGQ A;  2EXU A;  4ECV A;  1HWU A;  4PCQ A;  2BJD A;  1BC6 A;  1Y5L B;  1WG4 A;  2EK6 A;  4URG A;  3OXF A;  4CLT A;  4USH A;  1QAX A;  3AQP A;  1C4C A;  4PXE A;  2V8D A;  3O6Q A;  4OZ3 A;  3Q8P B;  1HWL A;  2HPU A;  3BYR A;  4ZLL A;  1FI4 A;  3DLK A;  2XNQ A;  3MED A;  3IG1 B;  4RW8 A;  2KU7 A;  1MW7 A;  4ANC A;  2FLP A;  4QWA A;  4FF1 A;  1FRJ A;  2DRA A;  1RWU A;  2FLN A;  3BPS P;  4J9V A;  1S1W B;  2RQC A;  1RAD B;  1CC7 A;  2W9B B;  1TL3 B;  4K4V A;  3EXC X;  4CQ1 A;  2ZH3 A;  1NSP A;  2CPZ A;  1YRX A;  4EO8 A;  4YHH F;  3Q23 A;  4WBF A;  2RHQ B;  3GON A;  3T9N A;  3LWL A;  5EDW A;  2XYP B;  2DPI A;  4PXD A;  4DR4 J;  4DV0 J;  1T11 A;  4YS2 A;  4RKU C;  2DNM A;  1N5Q A;  1G3O A;  2ZH9 A;  1EQM A;  3QAT A;  3CD6 S;  1RA7 A;  3CMA S;  4F2S A;  4J7C A;  2D3O R;  3MOJ B;  4USW A;  1WF1 A;  3L9Z A;  2R4F A;  3J7A 1;  2HQ3 A;  2IVM A;  4OMF G;  3DMJ A;  1WSV A;  3V81 B;  5A6W A;  1N5T A;  3C16 B;  1YZ6 A;  4ENO A;  1I51 B;  2VPX B;  1TAU A;  1B64 A;  2CWK A;  3FDS A;  2Y8W A;  5M2R A;  1EZZ B;  2WSE C;  4S0M A;  3QRP A;  4DL7 A;  4RW9 B;  4RWW A;  2EK1 A;  2ZBI A;  4E8U A;  1VJQ A;  5FJ4 A;  1YBU A;  1KN6 A;  3M9M B;  3H40 A;  2VPY B;  2MXY A;  1M5S A;  3I5C A;  1T9X A;  3TAN A;  2MHE A;  3DFE A;  1M1H A;  4J9R A;  2JRS A;  1HNI A;  5C42 A;  4C0O C;  4DN0 A;  2AZ1 A;  2KVI A;  2CQP A;  4L3N A;  2VIC A;  3MUV P;  1X31 C;  3TI0 A;  1XWL A;  4ZPA A;  3Q8V A;  1IXK A;  3OQ2 A;  1ZM2 A;  1SH0 A;  3EXY A;  5GAH I;  4JI8 F;  1VRQ C;  2HWT A;  4JV0 A;  3G6X A;  1TFY A;  2Y3Y A;  3LQV A;  3J7Z 5;  8ATC B;  2VH7 A;  1DFD A;  2CXE A;  3PJX A;  1U0H B;  3VAL A;  4QWE A;  4HEA 9;  4ED1 A;  5KT7 A;  4P7T A;  3K57 A;  4A48 A;  1EX8 A;  2QX0 A;  3OFG A;  2C2R A;  4OZ1 A;  5T14 A;  1YBT A;  4K4U A;  3U1L A;  3GMG A;  3IA0 A;  4JI2 J;  3M9N B;  1WNE A;  2MY8 A;  4B3R F;  3ENA A;  4ZN1 A;  4A8O A;  2DR5 A;  5M2P A;  3PG9 A;  3T5J A;  1Q95 G;  2KI2 A;  3DDK A;  1OPI A;  1U1L A;  3ZTO A;  5KFP A;  4IRK A;  1QAI A;  2JEG A;  1U6F A;  1B0V A;  2Q6B A;  3BKF A;  4RO0 A;  1VQ9 S;  2MZR A;  4M5G A;  4QYR A;  1UCN A;  3TUZ C;  1WKJ A;  1KLM A;  4MIA A;  4M95 A;  1M1K T;  2V4R A;  3FFI A;  4TYB A;  1XNQ F;  2WAQ D;  2ZDP A;  4QJV A;  3P49 B;  2V8H A;  3KLI B;  1I94 F;  5C25 A;  2J0Q D;  4RW4 B;  4QBU A;  2JLG A;  2RDI A;  2MJN A;  1PIE A;  1NJX A;  4I69 A;  4TYA A;  3GB0 A;  3G6V A;  3BPD A;  4J9S A;  3QJL A;  1S1V A;  2DHG A;  2YQ3 A;  3CGI A;  3GFZ A;  4JI6 J;  3TZW A;  2QLB B;  3FSY A;  2BJ1 A;  1SIW B;  4G3I A;  4WTY A;  4CLF A;  3C14 A;  3S01 A;  3K5N A;  4NXN F;  5E41 A;  3TVK A;  3QQC D;  5C5J A;  1UPM B;  3SQG A;  4PYD A;  1SQF A;  3HJV A;  1PG5 B;  1JLB B;  2DNK A;  2OPP B;  2V69 A;  1I1G A;  3KLG A;  2WSC C;  3UDL A;  4Y0F A;  4H4K A;  5F0U A;  2VL1 A;  1T9U A;  2E1R A;  3OTD A;  3QJP A;  1TKT A;  1U8W A;  1C1B A;  5E3Q A;  1P9Y A;  2X1A A;  3M8Y A;  4ZOS A;  2YNH A;  3EVO A;  5FII A;  4RNO A;  3D1H A;  2A2C A;  2BOA A;  1RJJ A;  2BW7 A;  3EPI A;  4DL0 C;  1VK8 A;  3CJ4 A;  4ELU A;  3VAM A;  3IAS 9;  3VAJ A;  5CD4 H;  4USM A;  4UZB A;  3KHL A;  5IM0 B;  3UN2 A;  4X65 F;  1VRU A;  1JLF A;  4DCO B;  2ABY A;  3BB5 A;  4EO6 A;  3TX0 A;  3SV4 A;  4KPC A;  2M8H A;  1OMS A;  1PYT A;  5THW A;  2CNO B;  4O3P A;  2FDN A;  1C0T A;  1AFI A;  4F8R A;  5DG8 A;  2XMA A;  4DL3 A;  1PYO B;  2L9N A;  4WK3 A;  5IWA F;  4LJM A;  1VQM S;  1TV6 B;  1IKX A;  1NCL A;  2KN4 A;  2IJF A;  4NLO A;  1TL5 A;  3D68 A;  2XI3 A;  2DCL A;  3CED A;  2HFS A;  1H73 A;  4ED0 A;  3OVS A;  1RWN B;  4DQP A;  5FDL B;  2EI5 A;  3E8O A;  3NNA A;  3V5R A;  1QDU B;  2FJA B;  2LQJ A;  2BE7 D;  5JXS A;  3GIM A;  4N8N A;  5KT2 A;  4F36 A;  1NJI T;  2CQI A;  2J8A A;  2L41 A;  3MZI A;  5I3U A;  3PEJ A;  2H9Z A;  1HBM A;  4DV7 J;  1H7X A;  3QAE A;  1NEE A;  4KKO B;  4C9D A;  4YB7 A;  1S97 A;  2DNO A;  2YKM A;  3EUN A;  1RWV B;  3M8P B;  4K4W A;  2DT9 A;  1KTQ A;  4JI1 J;  4FYV B;  2EFQ A;  3HHL C;  4LSL B;  1RAI B;  4QR0 A;  2CQ2 A;  1IJF B;  3I5A A;  4C3L A;  4A46 A;  2P2C B;  1XNR F;  2YWK A;  4LR9 A;  4F50 A;  2BX6 A;  4ECX A;  3V6J A;  1KLN A;  3OUY A;  2KFZ A;  3EZ5 A;  1VS3 A;  3FMB A;  2XYH B;  4PXC A;  2AMC B;  5U47 A;  4CTA B;  2FC8 A;  2RB7 A;  4I0W A;  5DZ6 A;  1RTH A;  1YJW S;  4J9O A;  1IBK F;  2OEK A;  2DNN A;  1RT6 A;  3IBF B;  4F4Z A;  4LRA A;  1RCX B;  3Q0A A;  2IJN A;  3RRK A;  3GII A;  3G82 A;  4USI A;  4NCA A;  2HVI A;  4D3H A;  3R1L A;  2HNY B;  4NLS A;  2FVS A;  2BKO A;  1NK4 A;  1H2T Z;  2BUN A;  4RBV A;  2DNH A;  4DR5 J;  4OYA A;  1FF2 A;  1SJQ A;  4Y6I A;  4FF3 A;  3M32 B;  1XN9 A;  2CJQ A;  1YGY A;  4OJ1 A;  4DV1 F;  4N7T A;  1RAG B;  3CPW R;  1WEY A;  4DPW A;  3FGV A;  1XMQ J;  5KG2 A;  3MM6 B;  2PII A;  3SXL A;  3OHA A;  1N4L A;  2KXN B;  3R1H A;  1X4H A;  1BE4 A;  2HHH F;  2F9D A;  1B7Y B;  3FZB A;  2R7Q A;  4WE1 B;  4HT7 A;  4MK7 A;  1NK7 A;  1HKA A;  4CRJ A;  4L3K A;  2EKY A;  2HVE A;  2NSC A;  4U6P A;  1RBO B;  2RDD A;  4EI2 A;  4HT5 A;  1HHQ A;  2MKS A;  3N28 A;  5E3A A;  4AUK A;  4ZCI A;  2VC0 A;  3DKD A;  4ZCM A;  3H90 A;  1HNW F;  5KT4 A;  4L75 A;  3CCV S;  4TLQ A;  3K89 A;  4X4P A;  1ZS6 A;  4X4S A;  2XCP A;  3IBC B;  3TVZ A;  5HBM A;  5KG5 A;  2J7W A;  3GLJ A;  1T9Y A;  1FWP A;  4NCB A;  2MEW A;  4OZ0 A;  2PMW A;  3T6B A;  5DQG A;  1RT2 B;  4DR3 J;  3DRR B;  1H7W A;  1HLW A;  1YSJ A;  4DPU A;  1WG5 A;  3T1H J;  1KR4 A;  1S9E B;  2B9X A;  3ZNU A;  4JYA F;  1ZAW A;  1FT8 A;  2A1B A;  3BV8 A;  1X4D A;  5DS7 A;  1YG0 A;  3HHD A;  4LIW A;  2HK2 A;  2MB0 B;  3Q8S B;  2VJU A;  4W90 B;  1S5Z A;  4QR1 A;  4E2F B;  4IKA A;  4USJ C;  2BRL A;  4ATN A;  1NU4 A;  3MCO A;  4Y34 A;  4F3O A;  3SBM A;  5IC4 B;  4EK2 A;  5J2P A;  5C24 B;  3RB0 A;  5CHC B;  4CYU A;  1D9A A;  5GAD U;  4ZPD A;  5HLF A;  2CQ3 A;  2VKZ G;  4M5D B;  1QLN A;  3WZ0 A;  3M2V A;  3C8Y A;  3DLE A;  1X9M A;  2A0F B;  2HIQ A;  5FLX U;  3JSM B;  2XMJ A;  2GO9 A;  2E5J A;  3BGL A;  1ZAX A;  2DHS A;  4RU9 A;  3CC7 S;  3TX8 A;  3MMC B;  2CG8 A;  4PG8 A;  1N5V A;  1HNZ F;  3JTN A;  2M88 A;  1WHX A;  3SCI E;  1GNK A;  1C1C A;  5CXT A;  1ZPV A;  4LF1 A;  4ED2 A;  1ZM3 A;  1ZPW X;  2V2Z A;  1PCA A;  2ADB A;  3KK3 B;  3CJK A;  4F4K A;  2RAQ A;  4LVO P;  4O3O A;  3MEG A;  3OVB A;  3HD1 A;  3UO0 A;  1LWX A;  3W60 A;  1RB0 A;  5BR8 F;  4ECS A;  3TQ1 A;  2QGF B;  2A3J A;  4ES2 A;  3HHL D;  4TVA B;  4B9T A;  3AOC A;  2WBR A;  1CQM A;  2CPE A;  4ETZ A;  1TAQ A;  2AEF A;  1ACM B;  4YP3 A;  4DR1 F;  3SCJ E;  1TK0 A;  1TMJ A;  5H9E J;  1BMQ B;  3HX9 A;  5EX3 A;  4PPZ A;  3E01 A;  3DLJ A;  5D4P A;  1KNZ A;  1M5V C;  4C4W A;  2CFX A;  4B3S F;  2JFD A;  2GCF A;  3QPI A;  3CVK A;  3UR3 C;  2RQM A;  1VC0 A;  2HQD A;  4USK A;  3FQL A;  5F3Z A;  2VIH A;  5B0B A;  2GO8 A;  4IQM A;  2ZE2 A;  2VU5 A;  1MU2 A;  5ETL A;  1ZZN A;  4K2J A;  1B3T A;  2A6O A;  2W7P A;  3Q22 A;  5ADZ A;  4U8V A;  5KFH A;  1EIY B;  2V2K A;  3IFE A;  2HUR A;  4JI3 J;  3NCR A;  1LW2 B;  4LF2 A;  5JVH Q;  1BHN A;  1S1U A;  2R9L A;  2V67 A;  3CJR A;  3G4S S;  1X9W A;  3H0P A;  3V6K A;  1O51 A;  2ROE A;  3R5A A;  2E7V A;  4CH0 S;  1QM9 A;  3PZP A;  1S6O A;  1RHK B;  1HIY A;  4ZVO B;  3A12 A;  3M2U A;  1F1B B;  3DM2 A;  3R6G B;  2CJA A;  2ZZN A;  3K5P A;  4LVN P;  3C15 B;  2R7O A;  3IRW P;  5HSP A;  2XYG B;  2JNJ A;  4RJV A;  5KFJ A;  3CMQ A;  4N8O A;  2CYY A;  4K59 A;  1MN7 A;  3CXC R;  4FNH A;  1H6K X;  2RSQ A;  1OSC A;  2DHX A;  4EZ6 A;  2C2Z B;  4DFK A;  2AJ4 A;  4IDK A;  1RTI A;  2LYV A;  3QIP A;  4FNI A;  1X0P A;  1RTJ A;  1FJG F;  3MMB B;  1OY9 A;  2IPO B;  4N76 A;  2WCX A;  4JBC A;  1JQG A;  3UD3 P;  5I3Q A;  4FKX A;  3A1Y G;  1HHT P;  4DEZ A;  3X3U A;  1CJK B;  2BAN B;  2Z2Z A;  4DPT A;  2FUG 9;  2OIH A;  1LWF B;  4PPD A;  3I0R A;  2HVD A;  3BO2 A;  1JLC B;  2Z4P A;  4PG7 A;  3L95 X;  4CM2 A;  5IZH A;  2JX2 A;  2VBZ A;  1TKZ A;  1FXD A;  2EFN A;  3H42 A;  3NGK A;  4QR2 A;  3GE9 A;  4LBP A;  1N6Q A;  1S6U A;  4TY8 A;  4OZ2 A;  4RBT A;  3P4U B;  3MCN A;  4ZVP B;  2GJI A;  4WFZ A;  1WHW A;  1R27 B;  2V68 A;  4EYH B;  3JTP A;  1UL3 A;  2WON B;  3TA0 A;  2XM3 A;  2BXJ A;  3W5Z A;  4EBC A;  4MMO A;  2YY3 A;  3A8E A;  3FSI A;  1LEO A;  1EAR A;  5CAB A;  2AYG A;  4GKJ F;  3ILI A;  4ICL A;  1VQN S;  1D1U A;  1FRK A;  3LTO A;  1ROF A;  1DTQ A;  2C3O A;  4IFV B;  4I56 A;  2IA0 A;  1KQK A;  4ZPT R;  4WFB Q;  3JB9 k;  5D3G B;  1JJH A;  2P9G A;  2CNL B;  3KLE B;  4NRT A;  1GX6 A;  3GYN A;  1FRH A;  4KJI A;  4WJB A;  3CC2 S;  1CUL A;  3WC2 A;  2IHR 1;  2DEJ A;  4DV2 F;  4TU7 A;  2H5E A;  2RIL A;  2W2M P;  3D66 A;  3RG6 A;  4ECU A;  2EEY A;  1EAY C;  3AOD A;  1TVR B;  4PWD B;  2RF2 B;  1DJ0 A;  3NCQ A;  5J2N B;  4OJH A;  3CW2 C;  2UUA F;  3PW0 A;  2WOM B;  2QL5 B;  1NJZ A;  2OML A;  3KNG A;  5IQ6 A;  4KHR A;  1FNM A;  5J2M A;  3ZZ0 A;  2C3M A;  3BH6 B;  4H4O B;  4EYI B;  5G0R A;  3J81 U;  4U7C A;  1FWL A;  3R3T A;  3DHX A;  5GMK a;  3KLF A;  4HAC B;  1LQ9 A;  1YIT S;  1S76 D;  3OHB A;  2ZHO A;  2QLX A;  5T7L B;  4WFY A;  2QN6 B;  1RT4 A;  3V4M A;  3GP9 A;  4NLW A;  2CPD A;  3AB4 B;  4DX6 A;  2ZEJ A;  3N6N A;  5KFZ A;  3TRG A;  2C22 A;  3IR7 B;  2C2O B;  3EGN A;  3J7Y U;  2VUG A;  4RPF A;  1K73 T;  3HSG A;  3ISN C;  4H4M A;  3HVW A;  3NCP A;  2KZM A;  1RT5 A;  3MM7 B;  1YVF A;  3T9Z A;  1OY6 A;  4O3N A;  1LW0 B;  3KUE A;  1N56 A;  4WXW A;  2QMW A;  4HKQ A;  2DO4 A;  2RDJ A;  5F8G A;  3BM7 A;  2ZUA A;  2DGU A;  4NRU A;  2CAD A;  2YNG A;  3CUN A;  1LFW A;  4U7U K;  1P9Q C;  4HH0 A;  3U02 A;  2YQ0 A;  3HHN B;  2HQF A;  4Q45 A;  1YDL A;  3M2R A;  3M8Q A;  2RRN A;  5GAG I;  2ASL A;  1XMB A;  4U95 A;  3V6D B;  2CDQ A;  4RUB A;  1RYS A;  3VHQ A;  2ILY A;  5DG9 A;  3EGZ A;  3ZZO A;  1PIL A;  2KL8 A;  3RBD A;  3O2I A;  3ADA C;  3JSY A;  4U9R A;  5C2C A;  3UI3 A;  1YBA A;  1NZA A;  1GFW B;  4ZMM A;  4NXM F;  3FNN A;  1W25 A;  4Q0B A;  1VFJ A;  4F3Q A;  4RWX A;  3QWP A;  2EG2 A;  2Y8Y A;  3MUM P;  2QE5 A;  2ZOF A;  1WF0 A;  1RAC B;  2VOO A;  1W7W A;  2MQQ A;  5DQH A;  1AB8 A;  3TZY A;  5EWE A;  4NLQ A;  1REV B;  1CBK A;  1JLG A;  4IG3 A;  3VF0 B;  3IGN A;  4A8Y A;  4P9S A;  5KFX A;  4RW7 B;  2QV6 A;  2B43 A;  1JJC B;  3F0N A;  5L9N A;  5KFI A;  2IBK A;  2WW4 A;  2W4C A;  3MMA A;  1Z2L A;  4NML A;  1WF2 A;  4KT0 C;  4UQG A;  1IKY A;  2E66 A;  3H25 A;  1KC8 T;  3N6M A;  3E2E A;  2RS2 A;  4CLS A;  3BR8 A;  1JLQ B;  1HMV B;  3RYL A;  2R7V A;  2UXB F;  1U49 A;  1X5P A;  5AE1 A;  3O5T B;  4FPR A;  4KFB A;  3I6P A; 
#chains in the Genus database with same CATH homology
 1ICE B;  1RHK B;  2CJX B;  3QNW B;  5K20 B;  4ZVO B;  2QL9 B;  1RWN B;  3EDR B;  1I3O B;  2XYP B;  3R7S B;  2C2K B;  2H54 B;  4LSZ B;  2XYH B;  3R6G B;  1RWP B;  3GJS B;  1IBC B;  1PAU B;  1NME B;  1QDU B;  2HBZ B;  4JB8 B;  2H65 B;  2H51 B;  4ZVT B;  2XYG B;  2XZT B;  1F9E B;  2HBQ B;  1SC3 B;  4DCJ B;  3P4U B;  2CJY B;  2QL5 B;  3D6M B;  3IBF B;  1BMQ B;  2QLF B;  4ZVP B;  3NS7 B;  2H48 B;  5IC4 B;  1QTN B;  1RWM B;  1RHU B;  3GJQ B;  2QL7 B;  4ZVS B;  2Y0B B;  2HBY B;  4ZVR B;  2H4Y B;  2C2M B;  3IBC B;  2CNN B;  1SC4 B;  2C2Z B;  2DKO B;  4ZVQ B;  1SC1 B;  1I51 B;  1RWW B;  1RE1 B;  1RHR B;  2H5J B;  4ZVU B;  4DCO B;  2QLB B;  3RJM B;  2FQQ B;  3GJT B;  3R6L B;  2H5I B;  2Y1L B;  2C1E B;  1RWO B;  2XZD B;  3R7N B;  1RWV B;  3KJN B;  3R5J B;  2CNO B;  1RWK B;  2QLJ B;  3R7B B;  2C2O B;  3D6H B;  3D6F B;  1RHQ B;  3P45 B;  3SIP B;  1RHM B;  1PYO B;  2CNL B;  4DCP B;  1GFW B;  3KJQ B;  3GJR B;  2CDR B;  2P2C B;  3EDQ B;  2H4W B;  5IC6 B;  1RWX B;  2HBR B;  1RHJ B;  2CNK B;  3KJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...