3RJMB

Caspase2 in complex with chdi ligand 33c
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-2
publication title Exploiting differences in caspase-2 and -3 S(2) subsites for selectivity: Structure-based design, solid-phase synthesis and in vitro activity of novel substrate-based caspase-2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 20
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3rjmB00
1SC4B 3KJQB 2H4WB 1I3OB 2DKOB 3R7SB 1QDUB 5K20B 3GJSB 4DCJB 1F9EB 1PAUB 1IBCB 3SIPB 2CJXB 1NMEB 1SC3B 2QLBB 1BMQB 2XZDB 1I51B 4DCOB 1SC1B 3GJRB 2H51B 1RHMB 2Y1LB 2QLFB 1RWPB 1RWXB 3GJTB 2H5IB 1ICEB 3KJFB 2XYHB 3R7BB 2HBRB 4JB8B 3IBFB 4ZVSB 2FQQB 2H4YB 2XZTB 2QL5B 3RJMB 1RE1B 3R7NB 1RWNB 4ZVQB 2C2KB 3D6FB 2CJYB 1RWKB 3D6MB 1QTNB 3P45B 3QNWB 1RHUB 2XYPB 1GFWB 3EDQB 4ZVTB 1RHRB 2C2OB 3P4UB 2C1EB 1RWMB 3NS7B 2QL9B 3D6HB 2HBQB 2C2ZB 2QL7B 2CNKB 5IC4B 3R5JB 2CDRB 2P2CB 1RHJB 3KJNB 2C2MB 2HBYB 1RWOB 3GJQB 3R6GB 4ZVOB 4ZVPB 1PYOB 1RWVB 2HBZB 1RWWB 3IBCB 4ZVRB 2QLJB 1RHKB 2CNNB 2CNOB 2CNLB 2H54B 2H5JB 2Y0BB 2H48B 4LSZB 5IC6B 4ZVUB 2XYGB 3EDRB 1RHQB 4DCPB 2H65B 3R6LB
chains in the Genus database with same CATH superfamily
5DGBA 1U02A 1CPZA 4NYPA 1SUQA 3M8PA 5ETOA 3MDFA 5AE1A 4QWBA 3SV3A 1F3VA 5E2QA 2QFIA 1RHMB 4P71A 5DZ6A 3QGPA 2EG2A 4O3OA 5H9FJ 3M05A 3CD5A 2V8DA 1X4DA 1KVJA 4DV3F 2ZH8A 3GV8B 1TMJA 4A8MP 1D8ZA 1WI8A 3BQ2A 5J1EA 2BJDA 2UP1A 4MIAA 4O44A 3RRHA 5HQMA 1UVNA 4P74A 3ADAC 1HNZF 1KQSR 3D6HB 1PKUA 3SQGB 3OVBA 2V6AA 4O23A 3OVSA 3HSGA 4JI3F 1LW0B 4NL5A 4F2RA 4DHVA 2QYGA 3HT3A 2OEJA 4K5RA 1RA7A 3BQ0A 1X9WA 1RWOB 2W4CA 1IKXA 2V8GA 1PO6A 3RW7A 1OY8A 5SUHA 1M5VC 3IRXA 2Y1RI 4ZA1A 3DLLQ 3WQPA 1TAUA 1FVQA 4H4KA 5C24A 4B3MF 4JI2F 2MZRA 3PW4A 3U1MA 1SB6A 3N79A 3AB2B 4IO9Q 4J9KA 4C97A 1CBKA 5LT5A 2KN4A 4B9UA 1SL1A 1FJCA 4Z37A 3I32A 1NKEA 2ATCB 3LQVA 4WXOA 2VQEF 3V4IB 4U7UD 3TYTA 4Q45A 1SH3A 3DLEB 5F8HA 1L3KA 4YDDB 1W26A 4IG3B 3Q86A 1GFWB 1PG5B 2BANA 1HYSA 2YNFB 2HFNA 4ECUA 2E5LJ 3CTRA 2QL7B 2DCLA 3FEXB 2DVIA 3TEHB 4P6QA 3K2YA 1OIAA 1HWIA 3AA8A 2BACA 3TX0A 4KAIA 1X8DA 4TLRA 3AOBA 5L8RC 1NJIT 4JI8J 4KJIA 1WDDA 1LWEB 1H7WA 2LVWA 5GMKa 2ADCA 4X2BA 4X66F 3NS6A 4F4YA 3HKWA 1HBNB 1XMQF 2J6TA 2UU9J 3G96A 4DV6J 2OPRA 3B4MA 1UJ4A 3KK2A 1AYEA 1SIWB 3RR7A 3C16B 4J91A 1YZ6A 4ECTA 1RCOB 4ED4A 1HQEA 2MDAA 1QAYA 2QE5A 1NSPA 3WZ0A 1BC6A 1OQ3A 3DGPB 3CJKA 2R2RA 3M2RA 5AE2A 3CCJS 5KFRA 3KYLA 3OUYB 2W1BA 4L72B 5E3QA 5KFSA 5HROA 1W7WA 5KFJA 4MT1A 3TVKA 4IDKB 1LWFA 2CZVC 3LP1A 3PHEA 1AT1B 4WTOB 1RTJA 1ELOA 4KSEB 2HMIA 1X4AA 1SJFA 2AEJA 2YKNB 3MCNA 4FXVA 3R9LA 3PV8A 2FPHX 3DHXA 4FXDA 5KFOA 1EKSA 2EI5A 8ATCB 1F9FA 1MWQA 3M4XA 1IUJA 1S6PA 5HI7A 1VBYA 2Y8WA 4QJVA 5HMWA 2VV5A 4LSLA 2BJ8A 3M6XA 5J2MA 3W64A 1DRZA 2FC9A 4RKUC 2MQPA 3FQLA 2X3GA 4DCOB 1JJCB 4J9OA 2OIHA 1JK9B 1TL7B 1WTBA 2IMOA 2XMWA 3CJ8A 2L9DA 3BGLA 4WBFA 1U1MA 4X4QA 1Q82T 4KGVB 4A8WA 2GW8A 3NCRA 2XCPA 2EFQA 1FD8A 1ZM2A 3KNGA 4Y0FA 2V2KA 2W7AA 5IC4B 5EWGA 1KLMA 1BHNA 4JV5F 5A0YA 4P75A 2G9OA 4CTAB 1S7HA 1X4CA 3DLGA 3SI8A 2FYXA 3HHKA 2G1DA 4F36A 1J2VA 4ED2A 2OPSB 5I3QA 2C3UA 3NWGA 5THWA 3FEZA 3QWUA 4B9LA 4HEA9 1SH2A 3BF4A 1YJVA 2MXYA 3I56S 2UXDF 3AFGA 5JMNA 2DGOA 2CQ3A 4LRCA 1UL3A 2KFZA 4AT1B 3I4HX 2XHCA 1RWXB 4N47A 3M8RA 2DNQA 4F50A 1S0NA 3MM5B 4AD6A 2XWYA 2PFDA 1VI7A 1EAYC 1U47A 5CYQA 3JTOA 4BDPA 4XAKA 5D0HA 4OI6A 2VU5A 3AJDA 3CCZA 4MYTA 1TKZB 5KFQA 3WX4A 4P2MA 1IKWA 4OX6A 3LWMA 1U1QA 4C3MA 3TA1A 2POKA 2XLKA 4NCGA 3C14B 1J5OB 2MQOA 1APSA 3QATA 2Z30B 3NNHA 3EWGA 3GIJA 5FIIA 2HRUA 2BRLA 4I67A 3DOKB 1RJJA 4KB7A 3UN2A 4KR0B 2H54B 3QFHA 3KXDA 3RB0A 5C25A 2BDPA 1JXVA 3KUHA 2DH7A 4K59A 4TVAB 3QJPA 3MEDA 4QZVB 3W66A 2QRRA 1RXOB 2AQ4A 2HHXA 3CO9A 3DLHA 1HNVB 3T9NA 1URNA 3AJ2A 3F56A 3LP2B 5KG3A 2COLA 4GO5X 5E7OB 3GJRB 1F2GA 5LSOA 1X5PA 3BKUA 3BGRA 1BUXA 2DIVA 1TL5A 3MCMA 2H4YB 2JVOA 3DRSA 3M6UA 3MXHP 4YHHJ 2B9XA 2KM8C 3E01A 3TA0A 1YSJA 2C2OB 4LF8F 2C1EB 4MK7A 4KKOB 2CQBA 4B9MA 5HBMB 2HIQA 3R5BA 1JJ4A 2JWNA 3TEGA 3HM9A 4CLTA 4HACA 4PR6A 5T41A 3D4JA 2W2MP 3NRBA 4Q0BA 5CA5A 2LECA 1N6QA 4PEOA 3ILIA 3MR2A 2LYVA 5H9FK 3A8KA 1VISA 3TR5A 2KFNA 1FKPA 2YTCA 2GV1A 2DNMA 2HW3A 3GWCA 5IM0A 1YJUA 3H7HB 3U1NA 2BM0A 3V81B 4JV2A 3I0SB 4RU2A 2WTFA 3D9BA 4OJ3A 2QMWA 4P10A 2VG6B 3HPOA 4AE5A 2NLWA 1FKOB 2D7SA 3CDEA 4KH0B 1OPIA 1RP5A 2FLNA 3PIOQ 2J9CA 3S6EA 2HG4A 3M2VA 4A48A 5L1KA 1PAEX 3G87A 4DR6F 1S6UA 3QFWA 3EPGA 2XBPA 3W3SA 2XMJA 1MMLA 2CDRB 4C0OC 3F41A 2R7TA 2KJWA 4N76A 1JLAB 2GVZB 3T6JA 5KFFA 1EETB 3H42A 5HLFB 2HRYA 4ZVOB 4OFZA 4DUYF 3HHEA 2B5JA 2M7SA 4DX6A 4MK9A 2VG7A 4FVCA 2HYIB 4YN3B 4OX9F 3VVTA 5D0EA 3J7A1 4B3OA 1KS2A 1YVFA 4TNOA 1FJEB 2YH1A 2DKOB 2MSSA 3HX9A 2APOA 3US5A 5HVHA 1ZZFA 4ETZA 5F8LA 4IR9A 3FFIA 1HQ2A 3AD7C 3VGTA 4LRBA 3CJ0A 3VAJA 4DV4F 4ID5A 1NNDA 1WC5A 3MECA 3N9UC 5GADU 3EX7B 1QSSA 2ASDA 3KLVA 3KLFB 4DV3J 2QT7A 2FVSA 2W25A 1L3VA 2W4DA 1ZYQA 2N82B 3QIPB 3SSSA 3ZTOA 1AFIA 4QR1A 2UXBF 1HNZJ 1N54B 1NUEA 3OLAA 2JEFA 2HZCA 3RBDA 1VHFA 5HK4A 1VQ9S 4DLGA 3FRZA 4JI3J 3M30B 2OELA 3RRGA 4ZP6A 3MM7A 2UXCF 3O3LA 2AYEA 4OYZA 4Y00A 3G4SS 3EGZA 5EN1A 2V4JB 2VD3A 3OVAA 4KY3A 2QZ8A 2JLFA 4PWUA 3U1LA 2XQCA 5I3UB 5LMNF 4Z7YA 5KFIA 2GMJA 2H65B 3PX0A 2HQGA 4B3MJ 3TZZA 2KH9A 4JI2J 1M5KC 5KFTA 2LQ9A 1KDNA 4TY8B 3ZZUA 1HI1A 4WCEQ 1U0HA 4X4SA 1FRXA 3WIUA 3SCJE 4S0MA 1SXLA 2RHQB 2AYBA 3IM8A 4IUFA 1U48A 2DHGA 3FDSA 5HANA 4IQMA 3Q83A 3R3TA 1RT6B 4ZPWR 3QT8A 2VQEJ 4LF6F 2UV8G 1QTNB 2LQ8A 4DX8H 4OI4A 4K4UA 1U6ZA 3NKYA 1SUQB 3OL8A 3KOAA 2AX1A 1FD2A 4WZQA 4WYLA 2ZH5A 3GJQB 1S79A 2ROPA 3D3CJ 2M2BA 2MJNA 5J1EB 1RT4A 3HDSA 4RNMA 5E0OA 4O44B 2ZOGA 4AXJA 4X66J 2Y1JA 5L46A 2ZWOA 1XMQJ 3JXOA 3J7Z5 1GNKA 5ETRA 3KUGA 1CJVB 4IOAQ 1NAQA 3W9IA 5KFKA 3FRYA 3JSMB 1LFWA 1RLCL 1RYRA 3IRXB 3M8SA 2DNOA 3BDEA 1Q8KA 2PSZA 4CO3A 2KXHA 3UN5A 4K4ZA 3O8WA 1Z2LA 5RUBA 1Q1KA 4B9NA 5J2NA 2CQIA 4ZKAA 3L3CA 5F0WA 2ZUAA 3CCRS 2M5YA 3X3UA 2PE8A 1V9OA 3GFYA 3HT0A 2E1RA 1Y7PA 1PGZA 5HP1B 3LAKA 4WE1B 2MZ1A 1GMWD 4DQIA 1SQGA 5HATA 2RDDA 4UY85 1E6VB 4DS5A 2BV3A 1UTAA 5KG5A 3M2UB 3ZZZA 1KWMA 2QX0A 3I5CA 4GMKA 3DXBA 5LL6d 1R8PA 2BANB 2DRAA 3CDAA 4KH1B 5F41A 3D28A 5IC6B 4X4RA 2LDYA 4HH0A 4ED3A 3BO2A 3LH2S 3BV8A 1FT8A 3H40A 4DZ6A 2XMAA 3KG0A 5BXIA 4NMXA 3OHBA 1IBCB 4F4AA 1VS3A 3D67A 3ZO7A 2NXJA 3NBPB 2W2NP 1G2EA 4OYMA 1KFDA 5LM7E 2W9CA 3I5BA 2DTJA 2M4MA 4A8QA 2ZC3A 4DR5F 1IBMF 3LUYA 2WHOA 5D15A 2RF2B 2UUCF 4IOBA 4CLUA 4H4MA 3ZFVA 1VIXA 2V68A 3PYFA 4M5DB 2FJBB 2D1CA 2ZFHA 1TV6A 2M88A 5KG6A 4DOZA 4ZLLA 2P2CB 2JEJA 4IRKA 3KWMA 2HLUA 4JV5J 5I42A 4F3MA 1SBRA 1Q81T 3TOQA 1C2PA 4UOFA 8RUCA 3GONA 1MN9A 2O5DA 1E6YA 1YRUA 2QA1A 3DLJA 3I96A 5KFVA 2BE2A 2JSXA 2DK2A 3JQMA 4F3QA 1Q95G 1CC8A 3PTWA 4P72A 4C98A 3SCLE 5CABA 1WACA 2X7IA 1RTJB 5DQHA 4P7TA 2XCAA 2IIHA 4DSFA 1FRKA 2VHGA 1L3TA 2UXDJ 1DHMA 1RT3B 3P8BB 1JLQB 2W9BB 1HWJA 3T1HF 2FY1A 5MLCV 4G1PA 4ERDA 1GMWA 1V5VA 2J0SD 2DB1A 2EC2A 1FA0A 2RRNA 3W1YC 2VPWB 5CZVA 2CQ2A 3ZZ0A 1R8HA 3M9OB 2ZVIA 5KFEA 2EBEA 5IT9Y 3UDCA 2IBOA 1EARA 1S99A 3FSIA 3SQOP 1Q5YA 4OZJA 4MFBA 1G6BA 3D54A 1D9AA 3DI6A 2R8IA 3C66A 2AYGA 5CD4H 2IRUA 3MMJA 1SC6A 5HQLA 2BKNA 4RUAA 1F1BB 1ZAVA 4PQAA 2BQ3A 3P3DA 3B78A 3E3XA 2BKOA 2PMZD 4E8UA 3LOUA 3DU5A 3V4MA 3RUBL 3HXMA 1NDCA 4WIIA 1OQ6A 4YFUA 4JUZA 5E5NA 2AJ2A 5LJ5Y 2IAJA 3NLCA 1NHUA 1SI9A 1Q5VA 3DLGB 1VK8A 4CLKA 1YIJS 1CJTB 1QVGR 5C2CA 4L75A 4DWIA 2ZJPQ 3ZNUA 2OSRA 4ZVSB 3TWZA 1QSLA 1RT5B 1TP7A 2R9LA 3AHPA 1MWYA 1U0SA 5CD4A 3MAAB 2DNHA 4TU9A 3MD1A 4JI7F 2FJDB 1NBEB 4LF8J 1Q0NA 4I4BA 4RW4B 5FDLB 1K0VA 2C2ZB 3MMBA 3B4DA 4AUKA 4ZCMA 4DDFA 2OMOA 3MR3A 2DBBA 3DDNA 1N52B 1TKXA 2IFXA 3RAMA 4KGMA 2HS0A 2A2CA 5JXSA 2YPZA 1RSCA 1S10A 5AXLA 1S9GA 2A1BA 2IC3B 2CQ4A 4OYAA 4IO1A 2XMVA 4C8ZA 4OYWA 1IKWB 2GVDA 1VHIA 5HAOA 1J27A 3OFGA 3ISZA 1MMNA 1WG5A 2RKIB 4O0NA 1TAQA 4CRJA 3BS9A 2YKMB 1O0PA 1RTHB 3O2IA 3CDBA 4JV1A 2VQFF 2BYCA 5ETLA 3CC7S 3VAMA 1FVSA 2DPIA 3TAMB 3M8QB 3CF5Q 2F9DA 4QR0A 3NAIA 1SPBP 4CLLA 2N7YA 5DM6Q 1BQNA 3CDWA 4OX8A 2J9DA 3R7NB 3L7PA 1H3DA 4XDDA 2VFVA 1IQTA 1U1LA 3MEDB 1VQ5S 5GVQA 4F02A 3V6HA 2CIMA 1B7YB 1FDNA 2QL9B 1HD1A 3MUMP 4DR6J 2MSTA 1UWAA 5E3AA 3OR1A 2E7XA 4NZ7A 4FBTA 4ZN3A 2B3TB 1FESA 1SJRA 4NLGA 2V2QA 4DUYJ 3GIIA 3RBEA 3W2WA 3W9JA 2CNLB 3T5HA 4OX9J 4LSNB 3H25A 1S1VB 1WG1A 3AAWB 1TL3B 1C4AA 3GSDA 4PUOB 3W5ZA 4U8YA 2XHWA 5EGYA 1VOMA 3QT7A 5IT0A 3T1YF 4EZ9A 4DV4J 3GIMA 1Q86T 1VQKS 2EK6A 2HBRB 3UWTA 3IBFB 1FKPB 1OWXA 2YQ0A 2CJAA 3HCXA 3LP0A 3GB0A 2CPYA 2YKPA 1BQMB 3ZC4A 1H6KX 3DLKA 2UXBJ 2Y9HA 1JLCA 5GMEA 4CT9A 5CH7B 1DTQA 4QW9A 2XI2A 4XDCA 2MB0B 1QE1B 3UFCX 3NAHA 3CXCR 1VFJA 2UXCJ 2A6OA 4HHJA 2HQDA 2PGCA 3M2VB 2DO0A 4ID8A 3NY0A 1B70B 4YDXA 2R8JA 3D0IE 2JC1A 1DAXA 4JI5F 5LMNJ 4U95A 3KFWX 1YTYA 4DN9A 1VQMS 4DPWA 3T19A 3BGOP 3GJSB 3MR7A 4QOTA 2E9TA 1UA0A 2RQ4A 3CVKA 3K5PA 2IM3A 5B0FA 4DR4F 2ZBRA 4KIAA 1VK3A 2XMUA 1N33F 2LA4A 2YX1A 1K9MT 2WVFA 2EFPA 2VB6A 3VAGA 2KFYA 3R2DJ 4LF6J 4OZ3A 2I8EA 2ZM6F 4OI2A 1HA1A 3FFIB 2RB7A 2DCUB 3C15A 3UR0A 2M8DB 1Y5NB 2R8GA 2B8QA 1UW9A 2KM8B 4OV1A 2CDQA 4MKYA 3AQOA 2MEWA 5C42A 4PQUB 3CCVS 2HS4A 1B0TA 4QPXA 4YR2A 1UJ6A 4KO0A 3BYRA 2XM3A 2BJ1A 5DLGA 2L9WA 1K44A 3BM7A 4CLZA 4ZVUB 4C48A 4OZ5A 4ED7A 2RRBA 2CWKA 1HIYA 1VC6A 1HBMB 2EKNA 3CCTA 4P73A 4DCJB 1CJUB 3MEEB 1XNQF 4P9SA 4LUBA 1HW8A 2AJ0A 4USTA 2CUYA 1NHVA 3L7UA 3G8TA 2VOOA 2D69A 4P2FA 2FLLA 2V9WA 1RACB 2VICA 4LR8A 4FF4A 2XZTB 2AZ3A 1U7LA 4U7CA 4ECWA 2V0NA 3NCQA 7FD1A 2XYPB 2HHPA 1YHQS 3WIVA 1S97A 1GEHA 1MU2A 4PRFA 1HMVB 5EHHA 3T5KA 1OSCA 3HO1A 2XSFA 1J5EF 1UMJA 4YS2A 2CJQA 2AGPA 5KFWA 2Z2YB 1ZM3A 4I69A 3BSNA 2BW2A 2ASLA 3I4PA 1FRLA 2E9RX 2FVQA 5J1PA 1UWBA 4I2QA 2OPQB 4I0WA 4KGZB 4C11A 1FFWB 3FEYB 1BWEA 3U02A 4WPAA 1FDDA 1X4FA 1FDBA 1WG4A 3R6LB 1NRKA 3S7RA 2Z0GA 4A8XA 4NLWA 4KPYA 2AX0A 3CD6S 1F5AA 2FZCB 1VBXA 1PYSB 2GCFA 3OQ2A 2VJVA 2DR5A 1REGX 1CS4A 3R7BB 5A8RB 1SQFA 3CD7A 4DR5J 1NXIA 1IBMJ 5KT3A 1Y5LB 4GC6A 4N7TA 5IS2A 5F8JA 2RQCA 3GCXP 5GADI 4OLOA 2Y8YA 2UUCJ 1JNRB 5HMXA 1RADB 2HK3A 2FLOA 3NS7B 4YY3F 2DY1A 4HYKA 2B9WA 2P6SA 1S1XA 1HR0F 4FYVB 4UQTA 3KJNB 3FQKA 4EBEA 3I9V9 2CRLA 1EIYB 5F0UA 2IVYA 3MM8B 3HHDA 1WHVA 1VQOS 5CYMB 4UTGA 5G0RA 4F0MA 4Q2LA 3GV5B 4Q5VA 2FB0A 3HSDA 4IG0A 2AJ4A 3IMQJ 2IDLA 2ZD1A 4AQYF 2XTJP 3NGDA 3JYTB 2EXUA 1PBAA 3SMZA 1K0TA 1SV5A 4L3KA 2DGWA 1Y11A 1RYSA 3HFZB 3T1HJ 3SXLA 4DF8A 1H98A 1R0AB 2KZZA 4DSIA 1IR1A 2KT3A 4UOCA 3MPDA 3D6FB 1FRIA 2XULA 2AT1B 4DQRA 4X4NA 5D6GA 1RAFB 2I2YA 4J37A 4V19J 3CJQA 3S8SA 2Z8QA 1U24A 4HVZA 4NMLA 2K3IA 3IR6B 1XIQA 1YJWS 1YJTA 3BPSP 2PN6A 3UDVA 1HQUB 3HVTB 2OFHX 2HLTA 4LR9A 3SQGA 2WVDA 3JB9k 1G3OA 1KVKA 4OZ0A 2XYGB 4UOHA 3MI7X 1LW0A 1WC6A 3V5RA 1SC4B 4KFBB 3KDOA 2V50A 3KG1A 1O8BA 1N0VC 4EO8A 3HMJG 3CE8A 2NZCA 2BMBA 2H9ZA 1PIEA 2BE2B 3MOZA 2HVDA 2XYHB 5ETVA 3BYPA 3QGIA 2AHOB 2PMWA 2I9SA 1X7VA 3CT9A 5AXNA 2CQDA 1FO1A 1IR0A 1HBOB 4NLQA 4JI7J 2CPJA 3FBEA 3QGGA 5DZ7A 4ZHRA 2BBEA 2QMXA 2V69A 4I7FA 4LBPA 2B0GA 3FMBA 3V4IA 2N3LA 5A2QY 4LIWA 2VFSA 2IM2A 3DLEA 1RK8A 1S4FA 2GJFA 2CWXA 3LA0A 2YNFA 1YJ7A 2JEIA 3GTYX 4LSZB 3MF5A 2B6AA 4F4ZA 4N41A 3RR8A 4YB6A 2DXEA 2Z2ZA 1M5HA 1UVJA 2JL9A 3ETOA 2MGZB 2QG9B 2ZC4A 4RBVA 4R0JA 2VQFJ 1M5SA 2MKHA 4MIWA 1MROB 2YWEA 3DOLB 2QLFB 1HI0P 3VZHA 1U2RA 1SJ1A 2Q43A 4EUVA 5AXMA 2ZE2B 3BKTA 3ENQA 1RCXB 1VRUB 2KG0A 3C16A 1UVKA 2IAJB 1D0EA 1M0SA 2BR0A 4J9UE 2RMLA 1QY7A 3OR2A 3PR5B 3DGPA 1DJ0A 1NK9A 2KZMA 3KG4A 2AJFE 2J0QD 2IHR1 3OTDA 4TY9A 3T9ZA 5A8KB 3M8YA 2DNPA 2QLJB 2E44A 2YWGA 4C8YA 4IDKA 2IYGA 3GLJA 4Y34A 5B0AA 3E2EA 3A8JA 4PABA 1G4CA 3BPDA 2RILA 2HSEB 3A8EA 2YKNA 3QZ8A 4LFCF 3T1YJ 2GO9A 5D4LA 2O01C 1FWLA 2WW8A 4FPIA 1HWLA 2YNGA 5HN0A 3M9MB 4JB8B 2OUGA 2UUBF 1NU4A 1TK8A 4IH7A 3LGHA 2GNKA 5JUMA 1FTCA 3MR6A 2ZBPA 4KHRA 1WOPA 4F0HA 4ECZA 1VCTA 3C2PA 1MN7A 1R8AA 5ETQA 4NXNF 3TW0A 2J9EA 1BQNB 5KFMA 3GYXB 3SCIE 3G6YA 3J80U 1T03B 2HBZB 5IQQA 2LDIA 3D3BJ 3PYEA 3HVRA 4NEYA 4WU3A 2E5HA 5D4OA 5KFAA 4QWCA 5K8NA 4G1IA 4JI5J 4A4JA 5A76A 3KJQB 4CLPA 2DJWA 1WSVA 4OHYA 4NOHA 3H2VE 2NS1B 2R7RA 5L39A 3SYZA 4CTAA 4OJHA 3D0HE 2J7UA 2LXFA 2G1HA 4FXWA 3O6QA 1DBDA 2MZSA 3KMSA 4LRAA 4DPYA 2VONA 2LKZA 1HARA 2B56A 4DR4J 3W2WB 3D1HA 2Q6BA 2OPSA 2OP5A 1N33J 1C1CB 3CCSS 3OBIA 1JKHA 2D9PA 4M5GA 1JB0C 2CVIA 2ZM6J 3D1QA 3W7BA 1Z2ZA 3POTB 1N5YB 4YB7A 3P5TL 3KK3B 3MM5A 3PKYA 4FS2A 5FD1A 5D78A 2P8IA 1ACMB 1FXLA 4DUTA 3NOGA 3NEKA 3DXSX 4CLFA 1ZZNA 3IS9B 2KTQA 2XEXA 6FD1A 3MM9B 4H54A 4LF7F 2ROEA 1TKZA 4WKRA 2CXEA 3AA9A 2DRDA 4ZDNA 3UDEA 3BBFA 5ETTA 3C14A 3VZIA 2ZH2A 1J5OA 1RKIA 1AW0A 2BE9B 1XNQJ 2I0XA 2HURA 1MNEA 5DDQC 1H7XA 5LSLA 1JLEA 1RT2A 2HVHA 1AUDA 1LKZA 5KOWA 5EWEA 2R7SA 5IFMA 1RDRA 3TZWA 2FJXA 4RJVA 1LFPA 3TA2A 3EVMA 1FJ7A 1S49A 4DQPA 4UZBA 3ZTSA 2DNZA 3LP2A 5KFHA 3RG6A 1X0PA 4TYAA 1H0HB 4Y2IA 1G1XA 4F8RA 1TUVA 3QT6A 1J5EJ 2LU2A 2ZHAA 2GC8A 3AD9C 4O4GA 1KR4A 2RDJA 1Q79A 2I5JB 3M8WA 2VUGA 2J9DE 4FKXA 3I87A 4KKOA 5C5JA 5HBMA 2F63A 3TQ1A 3RAQA 2HHSA 3MEGA 4R8UB 3B8HA 2P9CA 3HZGA 1S9EB 4ELUA 4ICLB 3TJAA 3Q8QB 4OHXA 2Z4PA 1XNRF 1M1HA 4ZK7M 2DIUA 4CIOA 5J2PB 2XG8A 1JNZB 5DRKA 3G9CA 4XPEA 4RBTA 3GYNA 3SFUA 1RWPB 5DQGA 1OJ4A 1RU2A 2ROGA 1PJ6A 1WF0A 3RJMB 4LT6A 1T9WA 2VBWA 4EFAC 3N6NA 4QIGA 2XSJB 2KXNB 1NJXA 2Z57B 3V81A 4IH5A 2Z2MA 3J7ZT 1X4HA 1BE4A 3I0SA 4YY3J 2C42A 5KFCA 3Q24A 2UVUA 1PYTA 4ZN1A 4WFNQ 4PG6A 2VG6A 2R7OA 2QIFA 3TAQA 1VJQA 3OTOF 5F3ZA 1FKOA 4QPTA 2FHMA 1HR0J 3C6TB 3UCUP 4L76A 4FPRA 1JXEA 1RI7A 4IRDA 5E3RA 1YK9A 2WVBA 1PC5A 4AYBD 4ZVRB 1M90T 2BOAA 2M9KA 4HTJA 3KJVB 2HAIA 1DQAA 4Z7CA 1JLAA 2GVZA 1M1GA 2HVZA 1X5TA 1EETA 2R7VA 3A4TA 4AQYJ 4NASA 5HLFA 2HQFA 3W2VB 4ZIWA 4ELTA 1UCNA 3PEJA 4WK1A 2Y1LB 4UY8T 3ZTRA 2PC6A 3UD4P 2W9AA 3RB4A 3MCSA 1Y9OA 4DEZA 4ZIVA 3V2UC 5CQGA 1T05B 2MQNA 1KN6A 1RAHB 3SZ2A 1TTHB 5IT9U 2FHJA 3KLFA 2F4VF 1GK8A 2AKWB 2WSEC 3DRPA 2LXUA 3TAPA 2UUWA 2AZ1A 1WELA 3PACA 1LXNA 5KAKA 3QIPA 2PI5A 2AGQA 4LF5F 4DG1A 2KYXA 4QYZJ 3O5TB 1JQGA 2MTLA 4OYOA 1U49A 5DDOC 4R5PB 3WX8A 2YPYA 3DKDA 3UE2A 4C0BA 4USJC 5ETMA 3FKBA 2Q3PA 2UZAA 2U2FA 1I3OB 2J5AA 1S1XB 1RBLA 4DV7F 2YWWA 1S5ZA 1YI2S 1KLNA 1GMUA 4NZ0A 2LQBA 2V4JA 2WCXA 3T5LA 2CAJA 3FCVA 2XLIA 2ZKTA 4OQJA 3N5FA 1T0TV 2DR7A 5G0RB 5I3UA 2WK4A 2VF3A 1UZDA 4NX9A 1RWNB 1WKJA 3RGIA 3K17A 2DGSA 4IG0B 3GYGA 1WTFA 3QNWB 3NMAA 3H90A 1RHUB 4XK8C 1T8EA 4ZP8A 1RU1A 2MZJA 3KMQA 5KT5A 2DGQA 3PY8A 1IVZA 3C6UA 1LV5A 4RO0A 1SV5B 5E33A 3Q8PB 1XEZA 3PX6A 3VCDA 1FKAF 1IKVA 1YBAA 1RT6A 1BY9A 4U96A 1QUPA 4ZJOA 1UEUA 2E29A 1XTZA 4M5KA 4LFAF 2QA4S 1KTQA 2LEPA 4B17A 4IFVB 2LMIA 2BKPA 1RT7B 2MLYA 1VRQC 1QDUB 2R2TA 3TUZC 4L6V3 3AQPA 2DO4A 2FHOB 1XN9A 1WKLA 4QWDA 2OMLA 2FZKB 1ICEB 1X60A 3J81Y 3H98A 3F73A 3TZXA 3R5DA 4X65F 1Q8IA 1SKSA 3L9ZA 4FF3A 1CJVA 3ZTPA 4QYRA 1FI4A 1NPRA 1KSPA 3SFGA 2K7JA 1TK5A 3EDQB 4Q2MA 2R8HA 2ZJQQ 3JSMA 1ZTTA 4NCBA 4PG5A 2MKCA 4WFYA 2HBQB 3VALA 4ES3A 3PYDA 1RT1B 3V6KA 1JXLA 4AL7A 1OSDA 2CQGA 1WHYA 4N77A 1N0UA 4DL6A 2XS5A 1NEEA 1U1KA 3TJ8A 3PX4A 4DL3A 1RISA 3K58A 2IA6A 3R5GA 2MQMA 3RRKA 3I0RA 2ILZA 5B0DA 4IQXA 1FJGF 3GG0A 2Q79A 2EKYA 5A6PA 2L41A 4C9DA 3AOAA 3RTVA 5HP1A 4WE1A 2RJZA 1IM6A 3DM2B 2NUUG 1B0PA 4MTPA 2HKEA 3P6YC 4ZHRB 1E6VA 4X84A 4I7FB 5SZTA 1F9EB 2PFFB 2K8GA 2DNYA 2V5HG 2IM0A 2OLWA 4UW2A 3M2UA 1NMEB 1AB8A 4LFCJ 4WFBQ 2ZOMA 2QFJA 3UDLA 2JLGA 2MHNA 4DSLA 1DZ5A 4RW6B 4ZCLA 4ZVQB 2B6AB 2UUBJ 3G8QA 3AXMA 4V1Ak 4HHUA 2MY7A 2N3OA 1M1KT 4CO5A 2A0FB 2YNIB 1S0OA 3NBPA 3JSRA 3AXKA 2C28A 1TL1A 1VGYA 1F0XA 2XMKA 2RU9A 1HBUA 2OFGX 3K59A 1AA1B 4NXNJ 4J9LA 3W8PA 3N6MA 4MH8A 5L1LA 2IA0A 2RF2A 1H2UX 1FTRA 4J9NA 3GQCA 4N8OA 1GT8A 4M5DA 1WNEA 1P1TA 2ZHBA 2YWKA 3KLIA 3R97A 3EGWB 3TVYA 5B0GA 3OR2B 3FCHA 1F2HA 3BDPA 3HHLC 1QSYA 4CO0A 2E1PA 3T41A 4A8YA 1KEKA 1DY3A 3IC1A 2MZQA 2F1FA 3HHLD 4N56A 5GAEU 4LVOP 2CZ9A 3PJWA 4DPXA 2W4PA 4BWMA 4K5SA 3ZZPA 2D74B 2RE1A 2DNNA 2XMTA 3GJTB 3K5OA 1SKUB 2JEGA 4K7QA 3CMQA 4MK8A 8AT1B 5ADZA 3M8ZA 3IG1A 4ZVFA 4ZVTB 5D3GB 2KO1A 3RU0A 1RT3A 3H5XA 2A3JA 1JLQA 1SQEA 2W9BA 1SH0A 2QMUB 3W65A 3VAFA 3UR3C 2W8LA 2NSBA 4GO7X 2VKRA 2W7OA 4JYAJ 4WFXA 2YNGB 1Q53A 2VDHA 1EHWA 2FIUA 3HSZA 3G8SA 1VLOA 1C0TB 1WHWA 2BEFA 3DHWC 2JFKA 4KV8B 1BQXA 4LF7J 2HEKA 3HSJA 3VAKA 2HHQA 2B9YA 3MPVA 3W8GA 2LLZA 1D9DA 1C1BA 3R7SB 4RNNA 4DX5A 4KTQA 4ILLA 5B0BA 2CQ1A 1RBOB 3N4WA 2ZH1A 1IJEB 5CCLA 2G2ZA 2BQUA 1NPKA 3C8YA 1N5VA 4U7UK 4EEYA 1U8SA 4Q8EA 1S1UB 3KLGB 5CAAA 2IJRA 2OEKA 5KFLA 2FHKA 2KRRA 1RHRB 2PI4A 2DNRA 4TKTA 3JTPA 2IM1A 1CJTA 3R5JB 3DCAA 3ZZYA 1VQNS 2A10A 3KK1B 1LK7A 1K73T 3GE9A 4O3SA 1RT5A 3Q2TC 1PBUA 3MAAA 1FWKA 2W01A 2PEHA 1JKHB 1N8RT 3KLHA 3ET6A 2CNNB 1AFJA 4RW4A 5FDLA 1GXUA 4TLQA 4G65A 2RQMA 1F5CA 2N4CA 4RLEA 4ZVEA 3PVXA 5LSRA 4DV5F 2MQQA 6AT1B 5F3TA 3NXZA 3Q8SB 1F5BA 1XNRJ 4NLRA 2CJXB 1AZSA 3PJ9A 1OY9A 4DFJA 1BMQB 4MYUA 4ANDA 2DHSA 2L3MA 1VBKA 4EYHB 2VPXB 4MIBA 2IC3A 4XPCA 2ZH7A 1VC0A 3ICLA 2K3KA 5KFUA 1MSWD 4C6AA 2RUSA 3CCMS 2ACMA 1ULRA 2RKIA 3BSOA 1RWKB 4IKAA 2NQPA 2YKMA 3OFEA 4QYZK 1LOUA 1RTHA 3VAHA 4AL6A 2QLXA 2G13A 4HT7A 3PFEA 1JLFB 2ERRA 1RZMA 1NDPA 1LQ9A 3BB5A 3OXFA 4R0EA 3TAMA 5L9NA 1MMDA 1N88A 3M8QA 2BXJA 1XMOF 1JLEB 3THVA 1RT2B 3NL0A 2OD6A 3N28A 2CPEA 1S12A 3OTOJ 4OI3A 2VIHA 3G6XA 1EX8A 4IFYA 1HWKA 4BCAA 4EMDA 3MTJA 4RW7B 4C4WA 5KOXA 2IY5B 1HW9A 4K50A 4UF4A 1VDHA 4GKKF 1JIHA 4PAAA 4CH1A 1RHKB 5FLXY 2XS2A 3ZZRA 1TELA 1LEOA 1U1OA 2H48B 1EQMA 4WP9A 2HNYB 4PPZA 2C2EA 2RQKA 3UVJB 3DFEA 3HF5A 4JBCA 2JX2A 1NSAA 2OKQA 5L1IA 2LQ5A 3OD2A 4Q43A 4O4GB 1S59A 1FXDA 2CA9A 2K7KA 2H51B 1S0MA 1T11A 4LSNA 1S1VA 3OXLA 4OZ2A 1U8WA 1TL3A 3MEGB 3BZQA 3RBZA 4PUOA 3S01A 4UT4A 4QIWD 2ZZTA 3QYYA 2AGOA 1B7FA 2J8AA 1S6QA 1RWMB 2MY8A 3TQEA 3CIZA 3NGUA 4WFZA 2GS8A 1KD1T 4DU7A 3QQCD 1UKUA 3HVWA 4RPFA 2F4VJ 2CQPA 3DLBA 3OJUA 1V5IB 4OV6A 5HMYA 1BQMA 2WVEA 4LF5J 4CI0B 5KFBA 4DFPA 2AJ1A 1P1LA 2PD1A 2MZTA 2KHDA 3NG8A 5D4NA 5C2GA 4M8LA 4K4YA 3Q8YA 2IYIA 3Q0AA 2RIJA 1QE1A 3CGIA 2Y3YA 3PZPA 4F26A 4UOGA 1KP6A 4DV7J 4DUZF 2IMWP 5KFZA 3M1VB 2GJIA 1FX4A 3HHNB 4QU6A 4JV0A 1CJKB 2XB2D 2R2SA 1XC9A 3I5AA 2HWHA 1HNWF 5CYJA 4M1KA 3I82A 1SKRA 1DARA 2EBGA 2EG1A 2A6MA 4DL7A 2FJVA 1MLAA 2DNLA 3GFHA 2HHHF 2HFUA 4USIA 1CQNA 3K57A 5F8MA 4AXIA 3MZIA 2DH8A 5A2QU 2MLXA 5B08A 2HNDB 4LFAJ 4YP3A 4W4MA 3PR4A 1P9YA 3DYAB 1VJWA 4NLDA 2HQCA 1TVRB 3DOMB 1YJ9S 4PQUA 2OHDA 2PIIA 3DRPB 1EJ7L 4Y6IA 4HKQA 1VRTB 4URGA 2FJAB 4DG1B 1N4LA 1T3OA 3ENVA 1JLBB 2FQQB 1X4BA 4X65J 1RE1B 1HBMA 1CJUA 1X31C 3MEEA 4DX7A 5EWFA 2R3VA 3TZYA 2ZZNA 3GFXA 5DS7A 5DDRC 2AIRB 2XO7A 5DJBA 2NYHA 4OZNA 2C3YA 2HBYB 2ABYA 3HD1A 2KB2A 2HZAA 4TYBA 2F65A 1SCJB 3G86A 4FF2A 3VWSA 2B4OA 2E7VA 3QPIA 1HMVA 1FJGJ 1NJZA 3V6JA 1RB0A 4WK3A 3PIPQ 3AH6A 4DQSA 3C6UB 2Y1IA 4RWXA 2JHEA 4RW9B 3PRDA 1O5JA 5D0GA 3CJ2A 1JWWA 4RWWA 1IKVB 2OPQA 2DISA 2HWTA 5DQIA 4NA2A 2UVVA 4NYZA 3FBBA 1UW4A 4WKYA 2ZNYA 3BN4A 3CC4S 4YEAA 4WFAQ 3TO8A 2L9NA 2DHXA 2XNRA 3UCZP 1ITPA 4FP9A 3NGTA 4ATNA 3IGVA 3P45B 1UAWA 4K8RA 2ZOFA 2ATLA 4FN5A 2GJ2A 4FYXB 4RUBA 3M7VA 1DLOA 4DMZA 1WI6A 1IBLF 2K1RB 2R42A 4LRFA 1R0BG 3MMCA 4TQRA 1KBRA 5A8RA 3K5NA 4CYUB 2BRKA 1T94A 3THTA 1NKCA 4B08A 2V34A 1KC8T 1FRHA 4Y2AA 2B9EA 2E9ZA 1UVMA 5D8HB 1T9VA 4KHMA 3VGSA 4PG4A 2BJ9A 3C3LA 4ZP9A 2IVFB 1X4GA 4NA3A 3IRWP 5IXUA 4ILRA 4A8KA 1S72S 2NR0A 1SKWA 2FZGB 1FHTA 2CQ0A 3MM8A 3D1OA 3MM6B 1I51B 5CYMA 2CPXA 1G7CB 3WC2A 5HJYA 3HFKA 3I0RB 1HFEL 4WTYA 5T14A 2AP6A 4NWBA 2WONA 1UVIA 2BA9A 1JLGB 3LALA 4LBHA 3QGHA 2KVQE 3K8WA 4PYAA 2LU1A 4H4KC 5HL7Q 2RT3A 3OW2R 1U26A 3JYTA 3IAS9 3Q8RB 1HHQA 1TFYA 5GAHI 1F9HA 1R0AA 2FGCA 3T5JA 3ZNJ1 1DTTA 1REVB 2CFXA 1F6TA 3R6GB 1QVFR 1RWVB 3QO9A 4IOCQ 2CQHA 2D3UA 1S1WB 4UQGA 1YG0A 2VFUA 3MOJB 1HD0A 3ELHA 2KI2A 4YUDA 4CLWA 1TL1B 2NXUA 2CJ9A 1HBUB 1Q78A 4JI1F 4WWSA 5F8NA 1HQUA 3HVTA 1SC1B 1W25A 1M5PC 1ZH5A 4NLTA 2MKJA 2GIRA 1IKYA 3NP5A 3KLIB 5HVFA 1FERA 4KBIA 4HH1A 3I55S 4CO1A 4KFBA 1TR0A 4KC5A 2C2RA 4D3GA 2B4UA 3D6MB 2JVRA 3QJJA 4MKVA 3MMAB 1U6FA 4DPOA 5LXYA 2DEJA 3V6DB 2FD2A 1TMMA 2HFOA 3CNQP 1WUUA 2NUHA 2W7PA 4QWEA 2R8KA 3G2XA 3MWBA 4KGKA 2XGQA 3OFHA 4J9SA 2J7KA 4NA1A 3IP0A 1HBOA 3IG1B 3IBCB 3D66A 1NDLA 3CMES 4DPTA 2XI3A 2R7XA 1RTIB 4BC7A 4DV5J 3QLHA 5FJ4A 1YJRA 5B0CA 4RBUA 2JC0A 5J2QB 4U67Q 4Y2MA 4X62F 2VG5A 2XZDB 3H5UA 3CD0A 2AW0A 1D1UA 4LMZA 2HGNA 1VR6A 4X64F 3ISNC 3OXGA 5B0EA 4RNFA 1Q4RA 1F3FA 2BVZA 5KFXA 3ISND 1Y10A 3IXQA 4DFMA 1Y3JA 1C1BB 2MGZA 2AD9A 2O3DA 4Z2XA 4M95A 1MROA 2LQJA 4JI4F 1PC4A 3C19A 3DOLA 2BQRA 1XMOJ 4BWJA 2RSQA 1FNMA 1YLXA 1UFWA 2ZE2A 2PA8D 4ENOA 3GIKA 3DGVA 2IJFA 1RTDB 1VRUA 3NMRA 1AXQA 5KT2A 1A7GE 1GXTA 3OTEA 4GKKJ 2GHWA 3EM1A 4QW8A 2RS2A 1KHVA 2NYIA 4JI0F 5BYSA 1URRA 3P49B 4PG7A 5BR8F 3LF0A 3G6ES 2VBYA 5A8KA 2I1RA 4PPDA 7FDRA 3H20A 1VQ6S 3D5MA 1U2FA 4O3RA 1RAOA 2BE7D 3HHLB 4EU0A 2C2DA 1WOSA 3KLHB 2D3O1 3ET6B 2V4QA 5GAEI 3AY0A 1U25A 2YY3A 4BC9A 3TNVA 4DN0A 4C7QA 5G4DA 4C8MA 5IV3A 1AZSB 3TUPA 4ECQA 2M70A 2FGOA 5HMZA 2HGMA 1NPPA 2ZVSA 2BJEA 4QBUA 4G1QB 1EP4B 2RS8A 3CCUS 1BXNA 3NGRA 5KT7A 3L7OA 4OHWA 1B4SA 3AD8C 4ED1A 2AEMA 2AJQA 4LFBF 3JSYA 2MQ8A 4HL9A 1T9TA 1S1TA 5LJ3Y 4ECXA 1GQEA 3HFVA 4E98A 3Q22A 3ENWA 1T03A 1N32F 5JJBA 4C3KA 1N5QA 1RTZA 4OYBA 4Q44A 2DYAA 4IFYB 1RA6A 2HHUA 4DUZJ 3FVYA 3TVZA 2ZH6A 4YOEA 3KTQA 4ANEA 5K14B 3KJFB 2MHEA 3OV7A 4ED5A 4FYWB 3CWJA 2V8PA 1BGXT 4I6AA 1HPZB 3G82A 5LMUF 1PSDA 1MG7A 1HNWJ 3GR1A 3CMAS 1LXJA 2U1AA 4X4TA 5DDPC 4LR7A 3HVAA 1ZM4A 2HHHJ 4RL1A 4M5IA 1C1CA 4PWWA 1W2BR 5L1JA 1YGYA 3FC9A 1SJQA 2D3ZA 2WOMB 1WSRA 4LRDA 2B7BB 3POTA 3H0PA 3KHGA 1S6QB 1N5YA 3H8YA 4OI0A 3KK3A 2E5JA 4CWBA 4DF4A 1H2VZ 2GFFA 1R8BA 2HFVA 2QC3A 4L74A 2B7CB 4L73A 4M5NA 4HT5A 1HNXF 2J6SA 4K4WA 1FEHA 2FY8A 2CYYA 3MPUB 3IS9A 2GAHC 3MM9A 3BREA 3R2CJ 4NLVA 1OPZA 2DRBA 1WEYA 4BLGA 4K4XA 4Y2KA 1OY6A 2QN6B 1FDAA 3J81U 4QWAA 2X3DA 4DSEA 2Z56B 2ZDOA 3BKFA 4ZCIA 3D2WA 4ES1A 2JDJA 1LW2A 4MAKA 2HFSA 5KFDA 2W2PP 3CJSA 4J5OA 3Q8VA 4GKJF 3J81j 3K89A 2C22A 3QRQA 4M5JA 3GPAA 2RUGA 2DPJA 4FNHA 4TU7A 4J90A 1TQLA 4ITSA 2YKQA 1OYEA 2DGXA 3EXYA 2WSCC 4XTTA 2KHCA 2AF6A 4I56A 4FDFA 2RHSB 4Y65A 4JI6F 3PW2A 4C2MA 9ATCB 4M63A 2I5JA 4AFFA 3GR0A 4PKDB 2P5VA 2LEBA 2CKWA 1RGVA 1RABB 2PO4A 2BJ7A 1Z4UA 4R8UA 3JAMY 4YQWA 1S9EA 2WB4A 5KG2A 3IN5A 2BW7A 4ICLA 2FC8A 2X1AA 4DV0F 4KGXB 1QD1A 4ZVGA 3RYLA 5J2PA 1NK5A 3A13A 1I1GA 1CULB 3MUTP 5IT4A 2VOPA 1WDTA 2KT5A 5DM7Q 2CNKB 3WC0A 3IFEA 3PCOB 1IBLJ 3HK2A 2XNQA 3OL6A 4RNHA 4K4SA 4F4XA 1FCAA 2M8HA 1RUSA 4A8FA 4YB1P 5DETA 2LP4A 4OJGA 2XSJA 2KT2A 5JVHQ 3ZZOA 3CO0P 3RB3A 3KDNA 2FTRA 5KT4A 4USKA 2FUG9 5HO4A 1UFLA 5ITHA 2V2ZA 1B0VA 3CJRA 4H4OB 1VQ4S 3UN3A 4CNZA 4I6WA 3B82A 1GAOA 3IR7B 2IRXA 3MAHA 5AJ3F 3GIRA 3C6TA 1SL0A 5KFPA 2FDNA 2NCKL 2HGLA 2O67A 2HQ3A 3MPYA 1SC3B 2FLPA 3Q89A 2YKAA 3KJVA 2HZVA 3A3PB 1RAAB 1QTMA 4B02A 1LWCB 3RAXA 3KUEA 3O1LA 3ITHB 3I9ZA 3W2VA 4W90B 1KRPA 3QAUA 3JS9A 4CT8A 4YMEA 3CJTA 3DDIA 2R7WA 5KG7A 1NB2A 4CZCA 3LO3A 4RW8B 5K9FA 3ILLA 2PMHA 1LWXA 2BM1A 3DMJB 1V6HA 4EI2A 2B8PA 2WW4A 4GRSA 1T05A 4WZMA 4KRWA 4USUA 2OPPA 2JNJA 2EFVA 1TK0A 5DG7A 3BO4A 4USMA 3FK4A 1DLOB 1EB0A 2IRYA 4C3LA 5KFGA 3MMCB 2OO4A 2CPDA 1Q7YT 4JI1J 3IWXA 3MR5A 2GIFA 3NCPA 4F25A 2G2YA 3FZBA 3NNAA 5E3PA 2R7QA 1ZAWA 1XMBA 4LQ3A 4R5PA 5GMDA 1UPMB 3QSYB 3EGNA 2QEXS 5A8WA 1X5SA 5T7LB 5LXRA 4J9MA 5ETPA 1R89A 2W2OP 2B4VA 4GVBB 4UUWA 3QIDA 1PJ7A 3ONQA 1KHWA 2GX8A 1GMVA 2ZWPA 2HHVA 4DL4A 1TKDA 3OFFA 2WB1D 4HR2A 2YQ3A 2GGPB 3E51A 3CCLS 1GTEA 4CM0A 4FVMA 5C7PA 2D3OR 4ANCA 1WOOA 2WONB 3BN7A 3Q2SC 1B3TA 4BBYA 4OHZA 2W2QP 4F67A 1U45A 3VGUA 3L09A 3J80Y 3VV2B 3NGKA 4WIQA 4HLBA 1V3RA 4QQBA 3KLEA 3P96A 3R5CA 3L4BC 4WXWA 4EWTA 3EVWA 4M5HA 3LPYA 2I38A 2NXEA 1RAGB 1FNOA 1NM2A 1DTTB 3QO9B 4X62J 4TQSA 4ZPVR 3GZ7A 3W9HA 4IFVA 4IR1A 1FFSB 4X64J 1RT7A 1OO0B 2FJEB 3BBBA 3LGNA 3P5BP 3PO4A 1WC3A 3OTCA 1KQFB 3CUNA 3N0VA 3UO0A 4JI4J 1KTVA 3HI9A 4TU8A 3AODA 1Q8LA 1T95A 3U27A 2QJ3A 1M5OC 3WBZA 2DITA 2W24A 1IKYB 3FSXA 2FVPA 1EKRA 5M2RA 5KTQA 4ALZA 3ULHA 3NNCA 4RU9A 4OI1A 3M8PB 4KQZA 1NK6A 5ETKA 2HK2A 3TX8A 2QTWA 4LF2A 2G2OA 1AUSL 1RT1A 3JTNA 2DNGA 2QA4G 2BJ3A 5IWAF 2WRMA 4JI0J 5FLXU 4NLXA 1YJNS 2HWIA 4ZJQA 5BR8J 3QWPA 4AL5A 3SV4A 3W62A 2PEBA 1C4CA 4F7VA 3H5YA 5GAGU 5CZXA 2XZWA 3UQSA 3EZUA 3DM2A 2YWHA 4OYXA 1UPPA 1Y3KA 1IKXB 3QLHB 1FF2A 2AEFA 1GTHA 2VBXA 5HVGA 2GQ2A 5CXTA 2Z2LA 3EGVA 1RAEB 2QV6A 3IWNC 5I3PA 2BUNA 2VG5B 4NLSA 4HTIA 3HJVA 4P7VA 5C24B 1GH8A 1W2IA 2DH9A 2HFZA 4CDIA 3JSBA 2BZ2A 4RW6A 4NRUA 1XJWB 3UD5A 1GXLA 4C8NA 4CNYA 3QRPA 3D7SB 4ZOSA 2V8VA 2YNIA 2GMHA 1WD6A 1T9UA 1NK4A 4E0DA 3CPWR 2ASJA 4LF4F 1S76D 4LFBJ 2VDIA 3CIMA 4ZPBA 3FSYA 3QSIA 2DHAA 4PYDA 2EWHA 4EZ6A 1N32J 2QGFB 3SIPB 1YRTA 1HYSB 3PFOA 3J7AN 2C3OA 3NGSA 2D9OA 4O3NA 4I2PA 3D68A 4YB5A 4G6VB 5HQ8A 5H1SV 2PA3A 2EPIA 3LAMA 4TXSA 4KYZA 5LMUJ 1K47A 4M5MA 4B3SF 1TZ0A 4UZCA 2KU7A 3LW5C 1HNIA 3QMQA 4DLEA 2N7CA 4DL2A 2OPRB 1RHJB 2DR6A 1XR6A 2HNZA 3KK2B 3F0NA 3SEOA 2XC9A 1NK0A 5D3GA 4ED6A 4OLPA 1HQEB 2YNHA 3HP6A 2WVCA 4F4KA 1HL6A 3CJKB 3NOCA 3TUIC 2ZH3A 1CSJA 3S1TA 3SDEA 4G3IA 3M2RB 4KHPF 4ZMMA 4RX6A 2DT9A 1CG2A 4USHA 1WC4A 1VLYA 3W5XA 3W63A 4PWDA 3PG9A 1HNXJ 2DY9A 2F3JA 1C0TA 3NWRA 4NI2A 4UUXA 5HROB 4K0KF 4ECSA 2LA6A 3KHLA 1P9QC 4J9RA 2VL1A 4KV8A 3LPEA 2QLWA 2L08A 1LWFB 3G71S 4WP8A 1P6TA 3LP1B 2UVRA 4YR0A 3TP2A 3L95X 4W92B 1S1TB 3QT5A 3HZEA 2HMIB 4QIVA 2KDOA 5K8OA 2QSFA 2VFRA 5LOQA 3T3FA 2IBKA 1WHXA 2KXFA 2RD5C 1HWUA 1YBUA 4WU2A 1S6PB 1K1SA 3DRXA 2XMMA 3I6PA 3EZOA 1S1UA 4LSLB 4GKJJ 3KLGA 1TFWA 1TUWA 1PYOB 3IO1A 4J9PA 2RH3A 5J2MB 2HPUA 3G82B 3W5YA 4N8NA 2E1AA 4DQQA 2E1CA 1Z1ZA 2G0JA 3KK1A 3R5AA 2DNKA 4C8KA 4DSJA 1N36F 4JI6J 3PW0A 1PAUB 2B51A 2V67A 1R31A 2V2VA 5D77A 3T6BA 4LBIA 2MJUA 2FVCA 3IBWA 3VHQA 3VQTA 5AT1B 1TU0B 3PRBA 2HVIA 4IH6A 2CPZA 2YH0A 2H5IB 1KLMB 1T9XA 5CCMA 2GHPA 2QA2A 5A0YB 1FX2A 4JYAF 4YR3A 4DV0J 2V9KA 1RAIB 2A2DA 1A0OB 1ZTWA 1I94F 1V3ZA 3J7YU 3VVUA 3CCWA 5DLFA 1D9FA 2HAFA 4NLOA 2G0IA 4DI6A 4RUCA 1QUVA 2VFTA 3LGMA 3PKMA 3UNGC 2H1YA 2MMYA 3HLUA 4NLPA 4ZVPB 4MKAA 1U4BA 4USWA 1JLFA 4QIFA 3VTIA 1WEXA 2WBMA 3DNCA 1LW2B 1VQ7S 2H4WB 4NLUA 3CJ5A 5AJ3J 1UJ5A 5CYQB 4EBDA 4RW7A 1I5OB 2KRBA 5BJRA 2O1PA 1HHTP 1HLWA 4ZLJA 5AXKA 4K2XA 5DO2A 4FZVA 2HNYA 2LFVA 3UVJA 4DJBA 1LK5A 4NCGB 3IGNA 3VQSA 1ZA2B 1CC7A 2I6WA 2MKIA 4PXEA 3G6VA 3F44A 1NKBA 1WWHA 4DR7F 4WP3A 2A18A 4ZPDA 3UI3A 5KG4A 5C25B 3ZZTA 5D4PA 1R6YA 2ALZA 9RUBA 4U9RA 4A46A 1YQHA 2E7WA 3MAQA 1X4EA 2UV8A 3AOCA 1NZ8A 4QR2A 1RQ0A 4CQ1A 1Q8BA 1FFGB 2GMLA 3A3OB 1S0VA 2J6UA 5H9EJ 4DR2F 3BGRB 3CULA 4A47A 2K06A 1H74A 1UZHA 1EZZB 1V3SA 2XO6A 3E8OA 3DRSB 3MPWA 3TI0A 5F8GA 2Z58B 1DQ8A 3E01B 2OGUA 4WJBA 3DRRA 2OTLS 1AROP 2GIQA 4BS2A 4HACB 1S9FA 4ECVA 4LIRA 3AJ1A 1Y4ZB 4F0KA 4Q0BB 2V63A 4ETXA 4ZVHA 1JJ2R 1N48A 1N6QB 1U1RA 5EUHA 2ILYA 2MKYA 1KQGB 3M1VA 3ENAA 2G4BA 2HS3A 4NCAA 1R27B 4CP5A 2IDEA 3QBCA 1CJKA 5IM0B 2RRAA 1NH7A 1WC1A 4HDGA 1XQIA 1CVJA 2B4PA 4F3OA 1WC0A 1Y5IB 3LANA 3MFHA 4ZLPA 2CNOB 4ED8A 2Y0BB 3OL7A 3VR1A 3BQ1A 5B7WA 4OMFG 1XR5A 2RDIA 3DN9A 3SBMA 1VQSA 4X4VA 4HI1A 1F60B 2WZ1A 4RUHA 3R27A 2KVIA 2HNDA 4BHQA 3UNYA 4NXMF 2OPPB 1QAIA 2E5GA 3DYAA 4OZ1A 3TANA 1TVRA 3DOMA 3EE3A 1SJ3P 4K4TA 1XWLA 2OJ3A 1VRTA 3IA0A 2KYZA 2B5JB 1RBAA 2WBRA 3RW6A 2VG7B 2AMCB 4X4PA 1H38A 3M32A 5F8IA 2JOQA 4DBQA 4DV2F 1FK9A 4B3OB 1JLBA 1X5OA 4E2FB 1RAJA 4NE9C 5A8WB 3GV7B 1ZA1B 2GAGC 1X0FA 3UW1A 1TL4A 2UVWA 3BR8A 2IJNA 2R7UA 2Q6CA 4ID5B 4XIUA 1YITS 2AV5A 2LEAA 3MECB 4NZ6A 1VBZA 1CQMA 3H2UB 1PCAA 5IWAJ 3BSAA 4U8VA 4FYDA 4CO2A 1XERA 2H3EB 1FRMA 3N01A 4KT0C 4ZP7A 4DV1F 5AE3A 2V4RA 1IBKF 1KVIA 1NK7A 2OH2A 2P6TA 4LVNP 3B6BA 4B3RF 4NEZA 3GG1A 1L5UA 1R3NA 2V8HA 1K1QA 2KJVA 3MTKA 3R8YA 3KLEB 4RW9A 3MM7B 2M52A 2C2KB 4EBCA 5BYQA 4B3TF 2ZZMA 4LQ9A 4NLYA 2EC0A 4DZDA 4C8LA 1D09B 1NSKL 1TKTA 4RNOA 2OI2A 2ALYB 3BGFA 2C2MB 1D8YA 1YX2A 2OAUA 5D0RA 3FBCA 1U0HB 4N5SA 4DS4A 4B9SA 2K1RA 4ZPCA 4FBUA 4U6PA 4LF4J 1QAXA 4XO0A 4P52A 1C0UA 3W60A 4A8OA 2W8KA 4DR1F 3MCOA 5E41A 5K8MA 4CYUA 3D0GE 1QM9A 2UUAF 2MYFA 4KPCA 2F5GA 3MURP 3MHYA 4K4VA 1DQ9A 3X1LB 3AB4B 1U1PA 3GU0A 2VPZB 2NREA 4C8OA 1H73A 4P2SA 2E5IA 4MKBA 2DR9A 3VF0B 2ZH4A 1N34F 4DSKA 2P9EA 2EEYA 3ILJA 4WF9Q 1RT4B 4EK2A 4B3SJ 5L9XA 3MM6A 2DXDA 1R6VA 2RU3A 2JLEA 3Q23A 3DC2A 2EFOA 4P2XA 1U1NA 3CJ4A 2J76E 1JLGA 1NH8A 1SIZA 1A6LA 2OTJS 1U6BA 2R4FA 1KOHA 3M9NB 1FNXH 3A1YG 4D3HA 2OD4A 1U2CA 5DGAA 2CG8A 3K8VA 3EDRB 4I6YA 2EFNA 2AWZA 3N5BA 1P8GA 4M5LA 4MJKA 2VC1A 4DXLA 4KHPJ 1REVA 4I68A 4ZCKA 5J2NB 1NDKA 1S1WA 2QLBB 4PXBA 3CEDA 4K0KJ 4JP8A 3IR5B 1KONA 4PXDA 3HJFA 5E3CA 3QJLA 1CLFA 4O3PA 4ZPTR 3MFIA 5EX0A 1FWPA 6FDRA 1BWVA 1WEZA 2YBVA 4LREA 1S77D 5CHCB 4URQU 2ZHOA 1R0CB 2X1FA 3CSKA 3EYZA 1DFDA 4LF9F 4DR3F 3R1LA 4NPOA 3KKFA 4OJ1A 1PJ5A 2YQ1A 3W61A 4I2PB 1T7PA 3AT1B 1ZBTA 1OYDA 2DHHA 4J9QA 2VKZG 2X1GA 2ZUGA 2F40A 3MMAA 3M6VA 5K8PA 4FYYB 2ASYA 1VMBA 3PHTA 3V6DA 2DXFA 2W9CB 1HNIB 1IWGA 3LWLA 2JJ4D 5BYRA 1O51A 1L3UA 3BEGB 1VQYA 3IAM9 2CPIA 1BD6A 1N36J 2HNZB 4H4MB 4OZLA 5ETNA 1B99A 4OHVA 4A8SA 3FJ2A 1R8CA 2UUTA 1UVLA 2ZKUA 2VZ9A 1HI8A 1TV6B 1ZOTA 1VYAA 4HDHA 2YNHB 3QAEA 1RTIA 5J1NA 4DFKA 3DRYA 3MUVP 2PT0A 1H2TZ 5I42B 3FUYA 5F9LA 3SDEB 4L3NA 3JAMU 1NSQA 3U7JA 5GAGI 1KFSA 5J2QA 3P4UB 5H9EK 4PWDB 1E6YB 4CLSA 1R7IA 1I94J 5DG9A 5JVGQ 4NI2B 3WHIA 3H59A 3PXGa 2HVEA 3BGUA 3RZAA 3GCWP 1HHSA 2ZDPA 1XBWA 2GA7A 3GMGA 1FE4A 1VQLS 1ZM9A 5M2UA 2WSFC 1IR2A 3LTOA 3PO5A 2J0WA 4PG8A 2EVZA 2B43A 5MAOA 2DGUA 2CZ4A 2C3PA 4IG3A 5ETSA 1XK8A 1DURA 1RTDA 4OIXA 5EDWA 3PM9A 3RBXA 5HSPA 3M6WA 1HKAA 4O3QA 1O6XA 1S57A 1R43A 4MFBB 4B9TA 2Y0SD 3O44A 4CLYA 3DI6B 4QU7A 4CO4A 3RB6A 1IJFB 4ECYA 2ZBCA 2ZITA 1LWEA 4QIEA 2YX7A 2VJUA 1LNQA 3TUJC 2NXCA 3GP9A 1HBNA 2VBZA 3KHHA 4DR7J 1MW7A 3HHLA 1GX5A 4ZITA 2DEIA 3PW7A 4F2SA 1SL2A 1NB7A 1KKHA 1GX6A 3THPA 1RWWB 1X9SA 4Y28C 3OTBA 2ZH9A 2RNEA 2GQQA 2HIYA 1L3SA 1K8AT 4DR2J 2CJBA 4DCPB 3OUYA 1S7IA 4G1QA 1EP4A 2IPOB 4F4WA 1YDLA 2VA3A 4X4UA 3PYGA 2GO8A 4ZLNA 2LCWA 2DR8A 1NJWA 2OEMA 3Q8UA 2ACYA 3WDOA 3EJMA 3BJYA 3MMBB 4MMOA 4ZS6A 3PEHA 1FRJA 4X4OA 2G0CA 3IM9A 1TKXB 4JOUA 1ZS6A 1WF1A 5KG1A 2BOPA 1Y0HA 1NO8A 2E5LF 2Q1LA 2N4DA 1S9GB 2NZ4A 5K14A 3BSCA 4M94A 3KNAA 1FXRA 4OX7A 2GVDB 5K5MA 4OL8A 4Y3CA 4JI8F 2M0GB 4DL0C 1HPZA 3H5SA 4PCQA 2MKKA 3SCKE 3OHAA 2J8SA 2F8MA 1TL7A 3A8IA 3T1AA 2UU9F 4DV6F 1IQZA 1RHQB 3VAIA 4ECRA 5DG8A 2F4FA 2D41A 2AU0A 2HHTA 2L48A 1WORA 2XGPA 2XWXA 2K2PA 3EZ5A 3K0JA 2J0XA 2WOMA 3ILOA 2EFGA 2VA2A 3OR1B 3MEKA 4NXMJ 1ROFA 2SXLA 3EUNA 1RWUA 3BH6B 4Y2CA 3BO3A 2QL5B 4EGLA 3EICA 2ZJRQ 2NXNA 2XY5A 3DU6A 1IN0A 1T02A 3JQJA 2VH7A 3NS5A 1TUGB 3H4DA 4DU8A 4FNIA 4Q8FA 1ZETA 2DGTA 3TJ9A 4ELVA 1OMSA 4OYIA 3K5MA 3DRRB 4ILMA 1VC5A 4ZJLA 1B64A 2CG4A 4PZVA 3QZ7A 4OYPA 4ED0A 4DV2J 1JJHA 2IVMA 3J7YI 1JMTA 4EO6A 3GFZA 1IM4A 4I1TA 5HJXA 1YKWA 2ADBA 1WKKA 1S4EA 2MKSA 4FKYA 2XY7A 2QSWA 2H5JB 5KFNA 4W98A 2YXLA 2NPIA 4CCHA 3EVOA 1OS5A 2EK1A 3OT9A 1I6JA 3LP0B 4DV1J 1KNZA 3UD3P 2F8EX 3OJSA 1IBKJ 2NSCA 1ZPVA 3ZTQA 3DLKB 1VIOA 1JLCB 3PJXA 4B3RJ 4NYOA 1VQ8S 3FMWA 1DTQB 2VASA 3H2LA 2R2UA 2PDAA 4DPUA 3VGVA 2CPHA 2DGVA 3BBCA 4HI2A 4DL5A 2YWFA 2GHVC 1UEKA 4B3TJ 3A3NB 3DOKA 1KQKA 2X1BA 3D6TB 3HD2A 3SSQA 3QRRA 1P27B 3FNNA 3MGJA 3GILA 3TRGA 2MLZA 4CH7A 3EMTA 4O0IA 4URSA 1HNVA 1FEEA 2ZBQA 1PILA 1IWAA 2FVRA 2GQCA 3C46A 1NCLA 1ZAXA 3A12A 4PXCA 1WF2A 1CEZA 1FE0A 2F7VA 3OL9A 1CULA 2KL8A 4NRTA 5A6WA 2F8HA 3PNIA 2CPFA 4QCLA 3M32B 2JH3A 4ES2A 1S48A 2E66A 4DR1J 2X51A 3H4BA 2OSQA 1FK9B 1EQ0A 4I64A 5K20B 2UUAJ 3PRVA 5B09A 3B54A 2QO3A 2GZOA 1Y00A 2V94A 2CADA 5F9NA 1NK8A 2FHJD 3C15B 2JFDA 2ZEJA 3OLBA 3I31A 2VC0A 1VQPS 2VPYB 4H4OA 2CVEA 2WAQD 2HHWA 5C42B 3FCWA 2F9JA 1N34J 1QJHA 1XR7A 4LJMA 4KO0B 4FF1A 2RAQA 5IZHA 3ZXWA 2C2NA 2MQLA 3JQKA 2J7WA 1NJYA 1LWCA 3K7RA 1A9NB 5U47A 3OSPA 2XLJA 1UETA 3ITHA 3CJ3A 5I4MA 4GC7A 2LXIA 1N5TA 1UA1A 3DDKA 1T9YA 3K5LA 4RZRA 2ZNZA 4USVA 2NPFA 3R1HA 2DD8S 2HRTA 4RW8A 4K2JA 1TKTB 3CC2S 1BLUA 1T3NA 3DMJA 1SVDA 2O66A 3BH7B 3MD3A 1MU2B 1RLDA 4IYQA 1YZ7A 2C3MA 4O4RA 3SSRA 1D3WA 3UCGA 2BX6A 1ZPWX 3PW5A 1C0UB 3FGVA 4YHHF 1NLKL 1UWBB 4I2QB 2E1MC 4HHHA 4C11B 1H72C 1QAJA 2FJWA 5KG0A 3TARA 1SJ4P 4ZPAA 1Q7LB 2JZ5A 1YBTA 1MWZA 2RVJA 2KG1A 4LF9J 3ETMA 2CJKA 4DR3J 5T7LA 3FBFA 4GVLA 3GSIA 3CB4A 1UEVA 2P9GA 4F04B 4GVBA 3HULA 4ER8A 4EYIB 2JRSA 2YKOA 3UPFA 2H5EA 2YX4A 2GGPA 1CS4B 1X9MA 2EW9A 2ZBIA 4B9VA 1UP1A 4TN2A 1N5SA 1NZAA 1KOOA 1WJ9A 2QYCA 1IXKA 1UFKA 3CW2C 4J9VA 3CCQS 3HKZD 3FZ2A 2BABA 3CCES 3EPIA 1NHKL 2CQCA 5KFYA 5KT6A 5IV4A 3M30A 2MPUA 4R25A 3KHRA 1U09A 1QLNA 5IOLA 1YWXA 7AT1B 3OSNA 2CJYB 2YVSA 3PDNA 4J7CA 3CDUA 1YRXA 5IQ6A 1Q16B 5EX3A 4WYWA 2M3DA 1JX4A 4C0HA 4IRCA 4KE5A 4RR5A 4CM2A 4TY8A 2XS7A 2ZD1B 5GAHU 4FS1A 2VODA 3EXCX 3IWLA 5L38A 2KKHA 3N6LA 4Q7AA 4V19X 2XY6A 2HQIA 3BR9A 1N56A 2Q66A 5M2PA 1RKJA 4LF1A 2AYMA 4CH0S 3OPKA 1S6OA
chains in the Genus database with same CATH topology
1SC4B 3KJQB 2H4WB 1I3OB 2DKOB 3R7SB 1QDUB 5K20B 3GJSB 4DCJB 1F9EB 1PAUB 1IBCB 3SIPB 2CJXB 1NMEB 1SC3B 2QLBB 1BMQB 2XZDB 1I51B 4DCOB 1SC1B 3GJRB 2H51B 1RHMB 2Y1LB 2QLFB 1RWPB 1RWXB 3GJTB 2H5IB 1ICEB 3KJFB 2XYHB 3R7BB 2HBRB 4JB8B 3IBFB 4ZVSB 2FQQB 2H4YB 2XZTB 2QL5B 3RJMB 1RE1B 3R7NB 1RWNB 4ZVQB 2C2KB 3D6FB 2CJYB 1RWKB 3D6MB 1QTNB 3P45B 3QNWB 1RHUB 2XYPB 1GFWB 3EDQB 4ZVTB 1RHRB 2C2OB 3P4UB 2C1EB 1RWMB 3NS7B 2QL9B 3D6HB 2HBQB 2C2ZB 2QL7B 2CNKB 5IC4B 3R5JB 2CDRB 2P2CB 1RHJB 3KJNB 2C2MB 2HBYB 1RWOB 3GJQB 3R6GB 4ZVOB 4ZVPB 1PYOB 1RWVB 2HBZB 1RWWB 3IBCB 4ZVRB 2QLJB 1RHKB 2CNNB 2CNOB 2CNLB 2H54B 2H5JB 2Y0BB 2H48B 4LSZB 5IC6B 4ZVUB 2XYGB 3EDRB 1RHQB 4DCPB 2H65B 3R6LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC4 B;  3KJQ B;  2H4W B;  1I3O B;  2DKO B;  3R7S B;  1QDU B;  5K20 B;  3GJS B;  4DCJ B;  1F9E B;  1PAU B;  1IBC B;  3SIP B;  2CJX B;  1NME B;  1SC3 B;  2QLB B;  1BMQ B;  2XZD B;  1I51 B;  4DCO B;  1SC1 B;  3GJR B;  2H51 B;  1RHM B;  2Y1L B;  2QLF B;  1RWP B;  1RWX B;  3GJT B;  2H5I B;  1ICE B;  3KJF B;  2XYH B;  3R7B B;  2HBR B;  4JB8 B;  3IBF B;  4ZVS B;  2FQQ B;  2H4Y B;  2XZT B;  2QL5 B;  3RJM B;  1RE1 B;  3R7N B;  1RWN B;  4ZVQ B;  2C2K B;  3D6F B;  2CJY B;  1RWK B;  3D6M B;  1QTN B;  3P45 B;  3QNW B;  1RHU B;  2XYP B;  1GFW B;  3EDQ B;  4ZVT B;  1RHR B;  2C2O B;  3P4U B;  2C1E B;  1RWM B;  3NS7 B;  2QL9 B;  3D6H B;  2HBQ B;  2C2Z B;  2QL7 B;  2CNK B;  5IC4 B;  3R5J B;  2CDR B;  2P2C B;  1RHJ B;  3KJN B;  2C2M B;  2HBY B;  1RWO B;  3GJQ B;  3R6G B;  4ZVO B;  4ZVP B;  1PYO B;  1RWV B;  2HBZ B;  1RWW B;  3IBC B;  4ZVR B;  2QLJ B;  1RHK B;  2CNN B;  2CNO B;  2CNL B;  2H54 B;  2H5J B;  2Y0B B;  2H48 B;  4LSZ B;  5IC6 B;  4ZVU B;  2XYG B;  3EDR B;  1RHQ B;  4DCP B;  2H65 B;  3R6L B; 
#chains in the Genus database with same CATH topology
 5DGB A;  1U02 A;  1CPZ A;  4NYP A;  1SUQ A;  3M8P A;  5ETO A;  3MDF A;  5AE1 A;  4QWB A;  3SV3 A;  1F3V A;  5E2Q A;  2QFI A;  1RHM B;  4P71 A;  5DZ6 A;  3QGP A;  2EG2 A;  4O3O A;  5H9F J;  3M05 A;  3CD5 A;  2V8D A;  1X4D A;  1KVJ A;  4DV3 F;  2ZH8 A;  3GV8 B;  1TMJ A;  4A8M P;  1D8Z A;  1WI8 A;  3BQ2 A;  5J1E A;  2BJD A;  2UP1 A;  4MIA A;  4O44 A;  3RRH A;  5HQM A;  1UVN A;  4P74 A;  3ADA C;  1HNZ F;  1KQS R;  3D6H B;  1PKU A;  3SQG B;  3OVB A;  2V6A A;  4O23 A;  3OVS A;  3HSG A;  4JI3 F;  1LW0 B;  4NL5 A;  4F2R A;  4DHV A;  2QYG A;  3HT3 A;  2OEJ A;  4K5R A;  1RA7 A;  3BQ0 A;  1X9W A;  1RWO B;  2W4C A;  1IKX A;  2V8G A;  1PO6 A;  3RW7 A;  1OY8 A;  5SUH A;  1M5V C;  3IRX A;  2Y1R I;  4ZA1 A;  3DLL Q;  3WQP A;  1TAU A;  1FVQ A;  4H4K A;  5C24 A;  4B3M F;  4JI2 F;  2MZR A;  3PW4 A;  3U1M A;  1SB6 A;  3N79 A;  3AB2 B;  4IO9 Q;  4J9K A;  4C97 A;  1CBK A;  5LT5 A;  2KN4 A;  4B9U A;  1SL1 A;  1FJC A;  4Z37 A;  3I32 A;  1NKE A;  2ATC B;  3LQV A;  4WXO A;  2VQE F;  3V4I B;  4U7U D;  3TYT A;  4Q45 A;  1SH3 A;  3DLE B;  5F8H A;  1L3K A;  4YDD B;  1W26 A;  4IG3 B;  3Q86 A;  1GFW B;  1PG5 B;  2BAN A;  1HYS A;  2YNF B;  2HFN A;  4ECU A;  2E5L J;  3CTR A;  2QL7 B;  2DCL A;  3FEX B;  2DVI A;  3TEH B;  4P6Q A;  3K2Y A;  1OIA A;  1HWI A;  3AA8 A;  2BAC A;  3TX0 A;  4KAI A;  1X8D A;  4TLR A;  3AOB A;  5L8R C;  1NJI T;  4JI8 J;  4KJI A;  1WDD A;  1LWE B;  1H7W A;  2LVW A;  5GMK a;  2ADC A;  4X2B A;  4X66 F;  3NS6 A;  4F4Y A;  3HKW A;  1HBN B;  1XMQ F;  2J6T A;  2UU9 J;  3G96 A;  4DV6 J;  2OPR A;  3B4M A;  1UJ4 A;  3KK2 A;  1AYE A;  1SIW B;  3RR7 A;  3C16 B;  4J91 A;  1YZ6 A;  4ECT A;  1RCO B;  4ED4 A;  1HQE A;  2MDA A;  1QAY A;  2QE5 A;  1NSP A;  3WZ0 A;  1BC6 A;  1OQ3 A;  3DGP B;  3CJK A;  2R2R A;  3M2R A;  5AE2 A;  3CCJ S;  5KFR A;  3KYL A;  3OUY B;  2W1B A;  4L72 B;  5E3Q A;  5KFS A;  5HRO A;  1W7W A;  5KFJ A;  4MT1 A;  3TVK A;  4IDK B;  1LWF A;  2CZV C;  3LP1 A;  3PHE A;  1AT1 B;  4WTO B;  1RTJ A;  1ELO A;  4KSE B;  2HMI A;  1X4A A;  1SJF A;  2AEJ A;  2YKN B;  3MCN A;  4FXV A;  3R9L A;  3PV8 A;  2FPH X;  3DHX A;  4FXD A;  5KFO A;  1EKS A;  2EI5 A;  8ATC B;  1F9F A;  1MWQ A;  3M4X A;  1IUJ A;  1S6P A;  5HI7 A;  1VBY A;  2Y8W A;  4QJV A;  5HMW A;  2VV5 A;  4LSL A;  2BJ8 A;  3M6X A;  5J2M A;  3W64 A;  1DRZ A;  2FC9 A;  4RKU C;  2MQP A;  3FQL A;  2X3G A;  4DCO B;  1JJC B;  4J9O A;  2OIH A;  1JK9 B;  1TL7 B;  1WTB A;  2IMO A;  2XMW A;  3CJ8 A;  2L9D A;  3BGL A;  4WBF A;  1U1M A;  4X4Q A;  1Q82 T;  4KGV B;  4A8W A;  2GW8 A;  3NCR A;  2XCP A;  2EFQ A;  1FD8 A;  1ZM2 A;  3KNG A;  4Y0F A;  2V2K A;  2W7A A;  5IC4 B;  5EWG A;  1KLM A;  1BHN A;  4JV5 F;  5A0Y A;  4P75 A;  2G9O A;  4CTA B;  1S7H A;  1X4C A;  3DLG A;  3SI8 A;  2FYX A;  3HHK A;  2G1D A;  4F36 A;  1J2V A;  4ED2 A;  2OPS B;  5I3Q A;  2C3U A;  3NWG A;  5THW A;  3FEZ A;  3QWU A;  4B9L A;  4HEA 9;  1SH2 A;  3BF4 A;  1YJV A;  2MXY A;  3I56 S;  2UXD F;  3AFG A;  5JMN A;  2DGO A;  2CQ3 A;  4LRC A;  1UL3 A;  2KFZ A;  4AT1 B;  3I4H X;  2XHC A;  1RWX B;  4N47 A;  3M8R A;  2DNQ A;  4F50 A;  1S0N A;  3MM5 B;  4AD6 A;  2XWY A;  2PFD A;  1VI7 A;  1EAY C;  1U47 A;  5CYQ A;  3JTO A;  4BDP A;  4XAK A;  5D0H A;  4OI6 A;  2VU5 A;  3AJD A;  3CCZ A;  4MYT A;  1TKZ B;  5KFQ A;  3WX4 A;  4P2M A;  1IKW A;  4OX6 A;  3LWM A;  1U1Q A;  4C3M A;  3TA1 A;  2POK A;  2XLK A;  4NCG A;  3C14 B;  1J5O B;  2MQO A;  1APS A;  3QAT A;  2Z30 B;  3NNH A;  3EWG A;  3GIJ A;  5FII A;  2HRU A;  2BRL A;  4I67 A;  3DOK B;  1RJJ A;  4KB7 A;  3UN2 A;  4KR0 B;  2H54 B;  3QFH A;  3KXD A;  3RB0 A;  5C25 A;  2BDP A;  1JXV A;  3KUH A;  2DH7 A;  4K59 A;  4TVA B;  3QJP A;  3MED A;  4QZV B;  3W66 A;  2QRR A;  1RXO B;  2AQ4 A;  2HHX A;  3CO9 A;  3DLH A;  1HNV B;  3T9N A;  1URN A;  3AJ2 A;  3F56 A;  3LP2 B;  5KG3 A;  2COL A;  4GO5 X;  5E7O B;  3GJR B;  1F2G A;  5LSO A;  1X5P A;  3BKU A;  3BGR A;  1BUX A;  2DIV A;  1TL5 A;  3MCM A;  2H4Y B;  2JVO A;  3DRS A;  3M6U A;  3MXH P;  4YHH J;  2B9X A;  2KM8 C;  3E01 A;  3TA0 A;  1YSJ A;  2C2O B;  4LF8 F;  2C1E B;  4MK7 A;  4KKO B;  2CQB A;  4B9M A;  5HBM B;  2HIQ A;  3R5B A;  1JJ4 A;  2JWN A;  3TEG A;  3HM9 A;  4CLT A;  4HAC A;  4PR6 A;  5T41 A;  3D4J A;  2W2M P;  3NRB A;  4Q0B A;  5CA5 A;  2LEC A;  1N6Q A;  4PEO A;  3ILI A;  3MR2 A;  2LYV A;  5H9F K;  3A8K A;  1VIS A;  3TR5 A;  2KFN A;  1FKP A;  2YTC A;  2GV1 A;  2DNM A;  2HW3 A;  3GWC A;  5IM0 A;  1YJU A;  3H7H B;  3U1N A;  2BM0 A;  3V81 B;  4JV2 A;  3I0S B;  4RU2 A;  2WTF A;  3D9B A;  4OJ3 A;  2QMW A;  4P10 A;  2VG6 B;  3HPO A;  4AE5 A;  2NLW A;  1FKO B;  2D7S A;  3CDE A;  4KH0 B;  1OPI A;  1RP5 A;  2FLN A;  3PIO Q;  2J9C A;  3S6E A;  2HG4 A;  3M2V A;  4A48 A;  5L1K A;  1PAE X;  3G87 A;  4DR6 F;  1S6U A;  3QFW A;  3EPG A;  2XBP A;  3W3S A;  2XMJ A;  1MML A;  2CDR B;  4C0O C;  3F41 A;  2R7T A;  2KJW A;  4N76 A;  1JLA B;  2GVZ B;  3T6J A;  5KFF A;  1EET B;  3H42 A;  5HLF B;  2HRY A;  4ZVO B;  4OFZ A;  4DUY F;  3HHE A;  2B5J A;  2M7S A;  4DX6 A;  4MK9 A;  2VG7 A;  4FVC A;  2HYI B;  4YN3 B;  4OX9 F;  3VVT A;  5D0E A;  3J7A 1;  4B3O A;  1KS2 A;  1YVF A;  4TNO A;  1FJE B;  2YH1 A;  2DKO B;  2MSS A;  3HX9 A;  2APO A;  3US5 A;  5HVH A;  1ZZF A;  4ETZ A;  5F8L A;  4IR9 A;  3FFI A;  1HQ2 A;  3AD7 C;  3VGT A;  4LRB A;  3CJ0 A;  3VAJ A;  4DV4 F;  4ID5 A;  1NND A;  1WC5 A;  3MEC A;  3N9U C;  5GAD U;  3EX7 B;  1QSS A;  2ASD A;  3KLV A;  3KLF B;  4DV3 J;  2QT7 A;  2FVS A;  2W25 A;  1L3V A;  2W4D A;  1ZYQ A;  2N82 B;  3QIP B;  3SSS A;  3ZTO A;  1AFI A;  4QR1 A;  2UXB F;  1HNZ J;  1N54 B;  1NUE A;  3OLA A;  2JEF A;  2HZC A;  3RBD A;  1VHF A;  5HK4 A;  1VQ9 S;  4DLG A;  3FRZ A;  4JI3 J;  3M30 B;  2OEL A;  3RRG A;  4ZP6 A;  3MM7 A;  2UXC F;  3O3L A;  2AYE A;  4OYZ A;  4Y00 A;  3G4S S;  3EGZ A;  5EN1 A;  2V4J B;  2VD3 A;  3OVA A;  4KY3 A;  2QZ8 A;  2JLF A;  4PWU A;  3U1L A;  2XQC A;  5I3U B;  5LMN F;  4Z7Y A;  5KFI A;  2GMJ A;  2H65 B;  3PX0 A;  2HQG A;  4B3M J;  3TZZ A;  2KH9 A;  4JI2 J;  1M5K C;  5KFT A;  2LQ9 A;  1KDN A;  4TY8 B;  3ZZU A;  1HI1 A;  4WCE Q;  1U0H A;  4X4S A;  1FRX A;  3WIU A;  3SCJ E;  4S0M A;  1SXL A;  2RHQ B;  2AYB A;  3IM8 A;  4IUF A;  1U48 A;  2DHG A;  3FDS A;  5HAN A;  4IQM A;  3Q83 A;  3R3T A;  1RT6 B;  4ZPW R;  3QT8 A;  2VQE J;  4LF6 F;  2UV8 G;  1QTN B;  2LQ8 A;  4DX8 H;  4OI4 A;  4K4U A;  1U6Z A;  3NKY A;  1SUQ B;  3OL8 A;  3KOA A;  2AX1 A;  1FD2 A;  4WZQ A;  4WYL A;  2ZH5 A;  3GJQ B;  1S79 A;  2ROP A;  3D3C J;  2M2B A;  2MJN A;  5J1E B;  1RT4 A;  3HDS A;  4RNM A;  5E0O A;  4O44 B;  2ZOG A;  4AXJ A;  4X66 J;  2Y1J A;  5L46 A;  2ZWO A;  1XMQ J;  3JXO A;  3J7Z 5;  1GNK A;  5ETR A;  3KUG A;  1CJV B;  4IOA Q;  1NAQ A;  3W9I A;  5KFK A;  3FRY A;  3JSM B;  1LFW A;  1RLC L;  1RYR A;  3IRX B;  3M8S A;  2DNO A;  3BDE A;  1Q8K A;  2PSZ A;  4CO3 A;  2KXH A;  3UN5 A;  4K4Z A;  3O8W A;  1Z2L A;  5RUB A;  1Q1K A;  4B9N A;  5J2N A;  2CQI A;  4ZKA A;  3L3C A;  5F0W A;  2ZUA A;  3CCR S;  2M5Y A;  3X3U A;  2PE8 A;  1V9O A;  3GFY A;  3HT0 A;  2E1R A;  1Y7P A;  1PGZ A;  5HP1 B;  3LAK A;  4WE1 B;  2MZ1 A;  1GMW D;  4DQI A;  1SQG A;  5HAT A;  2RDD A;  4UY8 5;  1E6V B;  4DS5 A;  2BV3 A;  1UTA A;  5KG5 A;  3M2U B;  3ZZZ A;  1KWM A;  2QX0 A;  3I5C A;  4GMK A;  3DXB A;  5LL6 d;  1R8P A;  2BAN B;  2DRA A;  3CDA A;  4KH1 B;  5F41 A;  3D28 A;  5IC6 B;  4X4R A;  2LDY A;  4HH0 A;  4ED3 A;  3BO2 A;  3LH2 S;  3BV8 A;  1FT8 A;  3H40 A;  4DZ6 A;  2XMA A;  3KG0 A;  5BXI A;  4NMX A;  3OHB A;  1IBC B;  4F4A A;  1VS3 A;  3D67 A;  3ZO7 A;  2NXJ A;  3NBP B;  2W2N P;  1G2E A;  4OYM A;  1KFD A;  5LM7 E;  2W9C A;  3I5B A;  2DTJ A;  2M4M A;  4A8Q A;  2ZC3 A;  4DR5 F;  1IBM F;  3LUY A;  2WHO A;  5D15 A;  2RF2 B;  2UUC F;  4IOB A;  4CLU A;  4H4M A;  3ZFV A;  1VIX A;  2V68 A;  3PYF A;  4M5D B;  2FJB B;  2D1C A;  2ZFH A;  1TV6 A;  2M88 A;  5KG6 A;  4DOZ A;  4ZLL A;  2P2C B;  2JEJ A;  4IRK A;  3KWM A;  2HLU A;  4JV5 J;  5I42 A;  4F3M A;  1SBR A;  1Q81 T;  3TOQ A;  1C2P A;  4UOF A;  8RUC A;  3GON A;  1MN9 A;  2O5D A;  1E6Y A;  1YRU A;  2QA1 A;  3DLJ A;  3I96 A;  5KFV A;  2BE2 A;  2JSX A;  2DK2 A;  3JQM A;  4F3Q A;  1Q95 G;  1CC8 A;  3PTW A;  4P72 A;  4C98 A;  3SCL E;  5CAB A;  1WAC A;  2X7I A;  1RTJ B;  5DQH A;  4P7T A;  2XCA A;  2IIH A;  4DSF A;  1FRK A;  2VHG A;  1L3T A;  2UXD J;  1DHM A;  1RT3 B;  3P8B B;  1JLQ B;  2W9B B;  1HWJ A;  3T1H F;  2FY1 A;  5MLC V;  4G1P A;  4ERD A;  1GMW A;  1V5V A;  2J0S D;  2DB1 A;  2EC2 A;  1FA0 A;  2RRN A;  3W1Y C;  2VPW B;  5CZV A;  2CQ2 A;  3ZZ0 A;  1R8H A;  3M9O B;  2ZVI A;  5KFE A;  2EBE A;  5IT9 Y;  3UDC A;  2IBO A;  1EAR A;  1S99 A;  3FSI A;  3SQO P;  1Q5Y A;  4OZJ A;  4MFB A;  1G6B A;  3D54 A;  1D9A A;  3DI6 A;  2R8I A;  3C66 A;  2AYG A;  5CD4 H;  2IRU A;  3MMJ A;  1SC6 A;  5HQL A;  2BKN A;  4RUA A;  1F1B B;  1ZAV A;  4PQA A;  2BQ3 A;  3P3D A;  3B78 A;  3E3X A;  2BKO A;  2PMZ D;  4E8U A;  3LOU A;  3DU5 A;  3V4M A;  3RUB L;  3HXM A;  1NDC A;  4WII A;  1OQ6 A;  4YFU A;  4JUZ A;  5E5N A;  2AJ2 A;  5LJ5 Y;  2IAJ A;  3NLC A;  1NHU A;  1SI9 A;  1Q5V A;  3DLG B;  1VK8 A;  4CLK A;  1YIJ S;  1CJT B;  1QVG R;  5C2C A;  4L75 A;  4DWI A;  2ZJP Q;  3ZNU A;  2OSR A;  4ZVS B;  3TWZ A;  1QSL A;  1RT5 B;  1TP7 A;  2R9L A;  3AHP A;  1MWY A;  1U0S A;  5CD4 A;  3MAA B;  2DNH A;  4TU9 A;  3MD1 A;  4JI7 F;  2FJD B;  1NBE B;  4LF8 J;  1Q0N A;  4I4B A;  4RW4 B;  5FDL B;  1K0V A;  2C2Z B;  3MMB A;  3B4D A;  4AUK A;  4ZCM A;  4DDF A;  2OMO A;  3MR3 A;  2DBB A;  3DDN A;  1N52 B;  1TKX A;  2IFX A;  3RAM A;  4KGM A;  2HS0 A;  2A2C A;  5JXS A;  2YPZ A;  1RSC A;  1S10 A;  5AXL A;  1S9G A;  2A1B A;  2IC3 B;  2CQ4 A;  4OYA A;  4IO1 A;  2XMV A;  4C8Z A;  4OYW A;  1IKW B;  2GVD A;  1VHI A;  5HAO A;  1J27 A;  3OFG A;  3ISZ A;  1MMN A;  1WG5 A;  2RKI B;  4O0N A;  1TAQ A;  4CRJ A;  3BS9 A;  2YKM B;  1O0P A;  1RTH B;  3O2I A;  3CDB A;  4JV1 A;  2VQF F;  2BYC A;  5ETL A;  3CC7 S;  3VAM A;  1FVS A;  2DPI A;  3TAM B;  3M8Q B;  3CF5 Q;  2F9D A;  4QR0 A;  3NAI A;  1SPB P;  4CLL A;  2N7Y A;  5DM6 Q;  1BQN A;  3CDW A;  4OX8 A;  2J9D A;  3R7N B;  3L7P A;  1H3D A;  4XDD A;  2VFV A;  1IQT A;  1U1L A;  3MED B;  1VQ5 S;  5GVQ A;  4F02 A;  3V6H A;  2CIM A;  1B7Y B;  1FDN A;  2QL9 B;  1HD1 A;  3MUM P;  4DR6 J;  2MST A;  1UWA A;  5E3A A;  3OR1 A;  2E7X A;  4NZ7 A;  4FBT A;  4ZN3 A;  2B3T B;  1FES A;  1SJR A;  4NLG A;  2V2Q A;  4DUY J;  3GII A;  3RBE A;  3W2W A;  3W9J A;  2CNL B;  3T5H A;  4OX9 J;  4LSN B;  3H25 A;  1S1V B;  1WG1 A;  3AAW B;  1TL3 B;  1C4A A;  3GSD A;  4PUO B;  3W5Z A;  4U8Y A;  2XHW A;  5EGY A;  1VOM A;  3QT7 A;  5IT0 A;  3T1Y F;  4EZ9 A;  4DV4 J;  3GIM A;  1Q86 T;  1VQK S;  2EK6 A;  2HBR B;  3UWT A;  3IBF B;  1FKP B;  1OWX A;  2YQ0 A;  2CJA A;  3HCX A;  3LP0 A;  3GB0 A;  2CPY A;  2YKP A;  1BQM B;  3ZC4 A;  1H6K X;  3DLK A;  2UXB J;  2Y9H A;  1JLC A;  5GME A;  4CT9 A;  5CH7 B;  1DTQ A;  4QW9 A;  2XI2 A;  4XDC A;  2MB0 B;  1QE1 B;  3UFC X;  3NAH A;  3CXC R;  1VFJ A;  2UXC J;  2A6O A;  4HHJ A;  2HQD A;  2PGC A;  3M2V B;  2DO0 A;  4ID8 A;  3NY0 A;  1B70 B;  4YDX A;  2R8J A;  3D0I E;  2JC1 A;  1DAX A;  4JI5 F;  5LMN J;  4U95 A;  3KFW X;  1YTY A;  4DN9 A;  1VQM S;  4DPW A;  3T19 A;  3BGO P;  3GJS B;  3MR7 A;  4QOT A;  2E9T A;  1UA0 A;  2RQ4 A;  3CVK A;  3K5P A;  2IM3 A;  5B0F A;  4DR4 F;  2ZBR A;  4KIA A;  1VK3 A;  2XMU A;  1N33 F;  2LA4 A;  2YX1 A;  1K9M T;  2WVF A;  2EFP A;  2VB6 A;  3VAG A;  2KFY A;  3R2D J;  4LF6 J;  4OZ3 A;  2I8E A;  2ZM6 F;  4OI2 A;  1HA1 A;  3FFI B;  2RB7 A;  2DCU B;  3C15 A;  3UR0 A;  2M8D B;  1Y5N B;  2R8G A;  2B8Q A;  1UW9 A;  2KM8 B;  4OV1 A;  2CDQ A;  4MKY A;  3AQO A;  2MEW A;  5C42 A;  4PQU B;  3CCV S;  2HS4 A;  1B0T A;  4QPX A;  4YR2 A;  1UJ6 A;  4KO0 A;  3BYR A;  2XM3 A;  2BJ1 A;  5DLG A;  2L9W A;  1K44 A;  3BM7 A;  4CLZ A;  4ZVU B;  4C48 A;  4OZ5 A;  4ED7 A;  2RRB A;  2CWK A;  1HIY A;  1VC6 A;  1HBM B;  2EKN A;  3CCT A;  4P73 A;  4DCJ B;  1CJU B;  3MEE B;  1XNQ F;  4P9S A;  4LUB A;  1HW8 A;  2AJ0 A;  4UST A;  2CUY A;  1NHV A;  3L7U A;  3G8T A;  2VOO A;  2D69 A;  4P2F A;  2FLL A;  2V9W A;  1RAC B;  2VIC A;  4LR8 A;  4FF4 A;  2XZT B;  2AZ3 A;  1U7L A;  4U7C A;  4ECW A;  2V0N A;  3NCQ A;  7FD1 A;  2XYP B;  2HHP A;  1YHQ S;  3WIV A;  1S97 A;  1GEH A;  1MU2 A;  4PRF A;  1HMV B;  5EHH A;  3T5K A;  1OSC A;  3HO1 A;  2XSF A;  1J5E F;  1UMJ A;  4YS2 A;  2CJQ A;  2AGP A;  5KFW A;  2Z2Y B;  1ZM3 A;  4I69 A;  3BSN A;  2BW2 A;  2ASL A;  3I4P A;  1FRL A;  2E9R X;  2FVQ A;  5J1P A;  1UWB A;  4I2Q A;  2OPQ B;  4I0W A;  4KGZ B;  4C11 A;  1FFW B;  3FEY B;  1BWE A;  3U02 A;  4WPA A;  1FDD A;  1X4F A;  1FDB A;  1WG4 A;  3R6L B;  1NRK A;  3S7R A;  2Z0G A;  4A8X A;  4NLW A;  4KPY A;  2AX0 A;  3CD6 S;  1F5A A;  2FZC B;  1VBX A;  1PYS B;  2GCF A;  3OQ2 A;  2VJV A;  2DR5 A;  1REG X;  1CS4 A;  3R7B B;  5A8R B;  1SQF A;  3CD7 A;  4DR5 J;  1NXI A;  1IBM J;  5KT3 A;  1Y5L B;  4GC6 A;  4N7T A;  5IS2 A;  5F8J A;  2RQC A;  3GCX P;  5GAD I;  4OLO A;  2Y8Y A;  2UUC J;  1JNR B;  5HMX A;  1RAD B;  2HK3 A;  2FLO A;  3NS7 B;  4YY3 F;  2DY1 A;  4HYK A;  2B9W A;  2P6S A;  1S1X A;  1HR0 F;  4FYV B;  4UQT A;  3KJN B;  3FQK A;  4EBE A;  3I9V 9;  2CRL A;  1EIY B;  5F0U A;  2IVY A;  3MM8 B;  3HHD A;  1WHV A;  1VQO S;  5CYM B;  4UTG A;  5G0R A;  4F0M A;  4Q2L A;  3GV5 B;  4Q5V A;  2FB0 A;  3HSD A;  4IG0 A;  2AJ4 A;  3IMQ J;  2IDL A;  2ZD1 A;  4AQY F;  2XTJ P;  3NGD A;  3JYT B;  2EXU A;  1PBA A;  3SMZ A;  1K0T A;  1SV5 A;  4L3K A;  2DGW A;  1Y11 A;  1RYS A;  3HFZ B;  3T1H J;  3SXL A;  4DF8 A;  1H98 A;  1R0A B;  2KZZ A;  4DSI A;  1IR1 A;  2KT3 A;  4UOC A;  3MPD A;  3D6F B;  1FRI A;  2XUL A;  2AT1 B;  4DQR A;  4X4N A;  5D6G A;  1RAF B;  2I2Y A;  4J37 A;  4V19 J;  3CJQ A;  3S8S A;  2Z8Q A;  1U24 A;  4HVZ A;  4NML A;  2K3I A;  3IR6 B;  1XIQ A;  1YJW S;  1YJT A;  3BPS P;  2PN6 A;  3UDV A;  1HQU B;  3HVT B;  2OFH X;  2HLT A;  4LR9 A;  3SQG A;  2WVD A;  3JB9 k;  1G3O A;  1KVK A;  4OZ0 A;  2XYG B;  4UOH A;  3MI7 X;  1LW0 A;  1WC6 A;  3V5R A;  1SC4 B;  4KFB B;  3KDO A;  2V50 A;  3KG1 A;  1O8B A;  1N0V C;  4EO8 A;  3HMJ G;  3CE8 A;  2NZC A;  2BMB A;  2H9Z A;  1PIE A;  2BE2 B;  3MOZ A;  2HVD A;  2XYH B;  5ETV A;  3BYP A;  3QGI A;  2AHO B;  2PMW A;  2I9S A;  1X7V A;  3CT9 A;  5AXN A;  2CQD A;  1FO1 A;  1IR0 A;  1HBO B;  4NLQ A;  4JI7 J;  2CPJ A;  3FBE A;  3QGG A;  5DZ7 A;  4ZHR A;  2BBE A;  2QMX A;  2V69 A;  4I7F A;  4LBP A;  2B0G A;  3FMB A;  3V4I A;  2N3L A;  5A2Q Y;  4LIW A;  2VFS A;  2IM2 A;  3DLE A;  1RK8 A;  1S4F A;  2GJF A;  2CWX A;  3LA0 A;  2YNF A;  1YJ7 A;  2JEI A;  3GTY X;  4LSZ B;  3MF5 A;  2B6A A;  4F4Z A;  4N41 A;  3RR8 A;  4YB6 A;  2DXE A;  2Z2Z A;  1M5H A;  1UVJ A;  2JL9 A;  3ETO A;  2MGZ B;  2QG9 B;  2ZC4 A;  4RBV A;  4R0J A;  2VQF J;  1M5S A;  2MKH A;  4MIW A;  1MRO B;  2YWE A;  3DOL B;  2QLF B;  1HI0 P;  3VZH A;  1U2R A;  1SJ1 A;  2Q43 A;  4EUV A;  5AXM A;  2ZE2 B;  3BKT A;  3ENQ A;  1RCX B;  1VRU B;  2KG0 A;  3C16 A;  1UVK A;  2IAJ B;  1D0E A;  1M0S A;  2BR0 A;  4J9U E;  2RML A;  1QY7 A;  3OR2 A;  3PR5 B;  3DGP A;  1DJ0 A;  1NK9 A;  2KZM A;  3KG4 A;  2AJF E;  2J0Q D;  2IHR 1;  3OTD A;  4TY9 A;  3T9Z A;  5A8K B;  3M8Y A;  2DNP A;  2QLJ B;  2E44 A;  2YWG A;  4C8Y A;  4IDK A;  2IYG A;  3GLJ A;  4Y34 A;  5B0A A;  3E2E A;  3A8J A;  4PAB A;  1G4C A;  3BPD A;  2RIL A;  2HSE B;  3A8E A;  2YKN A;  3QZ8 A;  4LFC F;  3T1Y J;  2GO9 A;  5D4L A;  2O01 C;  1FWL A;  2WW8 A;  4FPI A;  1HWL A;  2YNG A;  5HN0 A;  3M9M B;  4JB8 B;  2OUG A;  2UUB F;  1NU4 A;  1TK8 A;  4IH7 A;  3LGH A;  2GNK A;  5JUM A;  1FTC A;  3MR6 A;  2ZBP A;  4KHR A;  1WOP A;  4F0H A;  4ECZ A;  1VCT A;  3C2P A;  1MN7 A;  1R8A A;  5ETQ A;  4NXN F;  3TW0 A;  2J9E A;  1BQN B;  5KFM A;  3GYX B;  3SCI E;  3G6Y A;  3J80 U;  1T03 B;  2HBZ B;  5IQQ A;  2LDI A;  3D3B J;  3PYE A;  3HVR A;  4NEY A;  4WU3 A;  2E5H A;  5D4O A;  5KFA A;  4QWC A;  5K8N A;  4G1I A;  4JI5 J;  4A4J A;  5A76 A;  3KJQ B;  4CLP A;  2DJW A;  1WSV A;  4OHY A;  4NOH A;  3H2V E;  2NS1 B;  2R7R A;  5L39 A;  3SYZ A;  4CTA A;  4OJH A;  3D0H E;  2J7U A;  2LXF A;  2G1H A;  4FXW A;  3O6Q A;  1DBD A;  2MZS A;  3KMS A;  4LRA A;  4DPY A;  2VON A;  2LKZ A;  1HAR A;  2B56 A;  4DR4 J;  3W2W B;  3D1H A;  2Q6B A;  2OPS A;  2OP5 A;  1N33 J;  1C1C B;  3CCS S;  3OBI A;  1JKH A;  2D9P A;  4M5G A;  1JB0 C;  2CVI A;  2ZM6 J;  3D1Q A;  3W7B A;  1Z2Z A;  3POT B;  1N5Y B;  4YB7 A;  3P5T L;  3KK3 B;  3MM5 A;  3PKY A;  4FS2 A;  5FD1 A;  5D78 A;  2P8I A;  1ACM B;  1FXL A;  4DUT A;  3NOG A;  3NEK A;  3DXS X;  4CLF A;  1ZZN A;  3IS9 B;  2KTQ A;  2XEX A;  6FD1 A;  3MM9 B;  4H54 A;  4LF7 F;  2ROE A;  1TKZ A;  4WKR A;  2CXE A;  3AA9 A;  2DRD A;  4ZDN A;  3UDE A;  3BBF A;  5ETT A;  3C14 A;  3VZI A;  2ZH2 A;  1J5O A;  1RKI A;  1AW0 A;  2BE9 B;  1XNQ J;  2I0X A;  2HUR A;  1MNE A;  5DDQ C;  1H7X A;  5LSL A;  1JLE A;  1RT2 A;  2HVH A;  1AUD A;  1LKZ A;  5KOW A;  5EWE A;  2R7S A;  5IFM A;  1RDR A;  3TZW A;  2FJX A;  4RJV A;  1LFP A;  3TA2 A;  3EVM A;  1FJ7 A;  1S49 A;  4DQP A;  4UZB A;  3ZTS A;  2DNZ A;  3LP2 A;  5KFH A;  3RG6 A;  1X0P A;  4TYA A;  1H0H B;  4Y2I A;  1G1X A;  4F8R A;  1TUV A;  3QT6 A;  1J5E J;  2LU2 A;  2ZHA A;  2GC8 A;  3AD9 C;  4O4G A;  1KR4 A;  2RDJ A;  1Q79 A;  2I5J B;  3M8W A;  2VUG A;  2J9D E;  4FKX A;  3I87 A;  4KKO A;  5C5J A;  5HBM A;  2F63 A;  3TQ1 A;  3RAQ A;  2HHS A;  3MEG A;  4R8U B;  3B8H A;  2P9C A;  3HZG A;  1S9E B;  4ELU A;  4ICL B;  3TJA A;  3Q8Q B;  4OHX A;  2Z4P A;  1XNR F;  1M1H A;  4ZK7 M;  2DIU A;  4CIO A;  5J2P B;  2XG8 A;  1JNZ B;  5DRK A;  3G9C A;  4XPE A;  4RBT A;  3GYN A;  3SFU A;  1RWP B;  5DQG A;  1OJ4 A;  1RU2 A;  2ROG A;  1PJ6 A;  1WF0 A;  3RJM B;  4LT6 A;  1T9W A;  2VBW A;  4EFA C;  3N6N A;  4QIG A;  2XSJ B;  2KXN B;  1NJX A;  2Z57 B;  3V81 A;  4IH5 A;  2Z2M A;  3J7Z T;  1X4H A;  1BE4 A;  3I0S A;  4YY3 J;  2C42 A;  5KFC A;  3Q24 A;  2UVU A;  1PYT A;  4ZN1 A;  4WFN Q;  4PG6 A;  2VG6 A;  2R7O A;  2QIF A;  3TAQ A;  1VJQ A;  3OTO F;  5F3Z A;  1FKO A;  4QPT A;  2FHM A;  1HR0 J;  3C6T B;  3UCU P;  4L76 A;  4FPR A;  1JXE A;  1RI7 A;  4IRD A;  5E3R A;  1YK9 A;  2WVB A;  1PC5 A;  4AYB D;  4ZVR B;  1M90 T;  2BOA A;  2M9K A;  4HTJ A;  3KJV B;  2HAI A;  1DQA A;  4Z7C A;  1JLA A;  2GVZ A;  1M1G A;  2HVZ A;  1X5T A;  1EET A;  2R7V A;  3A4T A;  4AQY J;  4NAS A;  5HLF A;  2HQF A;  3W2V B;  4ZIW A;  4ELT A;  1UCN A;  3PEJ A;  4WK1 A;  2Y1L B;  4UY8 T;  3ZTR A;  2PC6 A;  3UD4 P;  2W9A A;  3RB4 A;  3MCS A;  1Y9O A;  4DEZ A;  4ZIV A;  3V2U C;  5CQG A;  1T05 B;  2MQN A;  1KN6 A;  1RAH B;  3SZ2 A;  1TTH B;  5IT9 U;  2FHJ A;  3KLF A;  2F4V F;  1GK8 A;  2AKW B;  2WSE C;  3DRP A;  2LXU A;  3TAP A;  2UUW A;  2AZ1 A;  1WEL A;  3PAC A;  1LXN A;  5KAK A;  3QIP A;  2PI5 A;  2AGQ A;  4LF5 F;  4DG1 A;  2KYX A;  4QYZ J;  3O5T B;  1JQG A;  2MTL A;  4OYO A;  1U49 A;  5DDO C;  4R5P B;  3WX8 A;  2YPY A;  3DKD A;  3UE2 A;  4C0B A;  4USJ C;  5ETM A;  3FKB A;  2Q3P A;  2UZA A;  2U2F A;  1I3O B;  2J5A A;  1S1X B;  1RBL A;  4DV7 F;  2YWW A;  1S5Z A;  1YI2 S;  1KLN A;  1GMU A;  4NZ0 A;  2LQB A;  2V4J A;  2WCX A;  3T5L A;  2CAJ A;  3FCV A;  2XLI A;  2ZKT A;  4OQJ A;  3N5F A;  1T0T V;  2DR7 A;  5G0R B;  5I3U A;  2WK4 A;  2VF3 A;  1UZD A;  4NX9 A;  1RWN B;  1WKJ A;  3RGI A;  3K17 A;  2DGS A;  4IG0 B;  3GYG A;  1WTF A;  3QNW B;  3NMA A;  3H90 A;  1RHU B;  4XK8 C;  1T8E A;  4ZP8 A;  1RU1 A;  2MZJ A;  3KMQ A;  5KT5 A;  2DGQ A;  3PY8 A;  1IVZ A;  3C6U A;  1LV5 A;  4RO0 A;  1SV5 B;  5E33 A;  3Q8P B;  1XEZ A;  3PX6 A;  3VCD A;  1FKA F;  1IKV A;  1YBA A;  1RT6 A;  1BY9 A;  4U96 A;  1QUP A;  4ZJO A;  1UEU A;  2E29 A;  1XTZ A;  4M5K A;  4LFA F;  2QA4 S;  1KTQ A;  2LEP A;  4B17 A;  4IFV B;  2LMI A;  2BKP A;  1RT7 B;  2MLY A;  1VRQ C;  1QDU B;  2R2T A;  3TUZ C;  4L6V 3;  3AQP A;  2DO4 A;  2FHO B;  1XN9 A;  1WKL A;  4QWD A;  2OML A;  2FZK B;  1ICE B;  1X60 A;  3J81 Y;  3H98 A;  3F73 A;  3TZX A;  3R5D A;  4X65 F;  1Q8I A;  1SKS A;  3L9Z A;  4FF3 A;  1CJV A;  3ZTP A;  4QYR A;  1FI4 A;  1NPR A;  1KSP A;  3SFG A;  2K7J A;  1TK5 A;  3EDQ B;  4Q2M A;  2R8H A;  2ZJQ Q;  3JSM A;  1ZTT A;  4NCB A;  4PG5 A;  2MKC A;  4WFY A;  2HBQ B;  3VAL A;  4ES3 A;  3PYD A;  1RT1 B;  3V6K A;  1JXL A;  4AL7 A;  1OSD A;  2CQG A;  1WHY A;  4N77 A;  1N0U A;  4DL6 A;  2XS5 A;  1NEE A;  1U1K A;  3TJ8 A;  3PX4 A;  4DL3 A;  1RIS A;  3K58 A;  2IA6 A;  3R5G A;  2MQM A;  3RRK A;  3I0R A;  2ILZ A;  5B0D A;  4IQX A;  1FJG F;  3GG0 A;  2Q79 A;  2EKY A;  5A6P A;  2L41 A;  4C9D A;  3AOA A;  3RTV A;  5HP1 A;  4WE1 A;  2RJZ A;  1IM6 A;  3DM2 B;  2NUU G;  1B0P A;  4MTP A;  2HKE A;  3P6Y C;  4ZHR B;  1E6V A;  4X84 A;  4I7F B;  5SZT A;  1F9E B;  2PFF B;  2K8G A;  2DNY A;  2V5H G;  2IM0 A;  2OLW A;  4UW2 A;  3M2U A;  1NME B;  1AB8 A;  4LFC J;  4WFB Q;  2ZOM A;  2QFJ A;  3UDL A;  2JLG A;  2MHN A;  4DSL A;  1DZ5 A;  4RW6 B;  4ZCL A;  4ZVQ B;  2B6A B;  2UUB J;  3G8Q A;  3AXM A;  4V1A k;  4HHU A;  2MY7 A;  2N3O A;  1M1K T;  4CO5 A;  2A0F B;  2YNI B;  1S0O A;  3NBP A;  3JSR A;  3AXK A;  2C28 A;  1TL1 A;  1VGY A;  1F0X A;  2XMK A;  2RU9 A;  1HBU A;  2OFG X;  3K59 A;  1AA1 B;  4NXN J;  4J9L A;  3W8P A;  3N6M A;  4MH8 A;  5L1L A;  2IA0 A;  2RF2 A;  1H2U X;  1FTR A;  4J9N A;  3GQC A;  4N8O A;  1GT8 A;  4M5D A;  1WNE A;  1P1T A;  2ZHB A;  2YWK A;  3KLI A;  3R97 A;  3EGW B;  3TVY A;  5B0G A;  3OR2 B;  3FCH A;  1F2H A;  3BDP A;  3HHL C;  1QSY A;  4CO0 A;  2E1P A;  3T41 A;  4A8Y A;  1KEK A;  1DY3 A;  3IC1 A;  2MZQ A;  2F1F A;  3HHL D;  4N56 A;  5GAE U;  4LVO P;  2CZ9 A;  3PJW A;  4DPX A;  2W4P A;  4BWM A;  4K5S A;  3ZZP A;  2D74 B;  2RE1 A;  2DNN A;  2XMT A;  3GJT B;  3K5O A;  1SKU B;  2JEG A;  4K7Q A;  3CMQ A;  4MK8 A;  8AT1 B;  5ADZ A;  3M8Z A;  3IG1 A;  4ZVF A;  4ZVT B;  5D3G B;  2KO1 A;  3RU0 A;  1RT3 A;  3H5X A;  2A3J A;  1JLQ A;  1SQE A;  2W9B A;  1SH0 A;  2QMU B;  3W65 A;  3VAF A;  3UR3 C;  2W8L A;  2NSB A;  4GO7 X;  2VKR A;  2W7O A;  4JYA J;  4WFX A;  2YNG B;  1Q53 A;  2VDH A;  1EHW A;  2FIU A;  3HSZ A;  3G8S A;  1VLO A;  1C0T B;  1WHW A;  2BEF A;  3DHW C;  2JFK A;  4KV8 B;  1BQX A;  4LF7 J;  2HEK A;  3HSJ A;  3VAK A;  2HHQ A;  2B9Y A;  3MPV A;  3W8G A;  2LLZ A;  1D9D A;  1C1B A;  3R7S B;  4RNN A;  4DX5 A;  4KTQ A;  4ILL A;  5B0B A;  2CQ1 A;  1RBO B;  3N4W A;  2ZH1 A;  1IJE B;  5CCL A;  2G2Z A;  2BQU A;  1NPK A;  3C8Y A;  1N5V A;  4U7U K;  4EEY A;  1U8S A;  4Q8E A;  1S1U B;  3KLG B;  5CAA A;  2IJR A;  2OEK A;  5KFL A;  2FHK A;  2KRR A;  1RHR B;  2PI4 A;  2DNR A;  4TKT A;  3JTP A;  2IM1 A;  1CJT A;  3R5J B;  3DCA A;  3ZZY A;  1VQN S;  2A10 A;  3KK1 B;  1LK7 A;  1K73 T;  3GE9 A;  4O3S A;  1RT5 A;  3Q2T C;  1PBU A;  3MAA A;  1FWK A;  2W01 A;  2PEH A;  1JKH B;  1N8R T;  3KLH A;  3ET6 A;  2CNN B;  1AFJ A;  4RW4 A;  5FDL A;  1GXU A;  4TLQ A;  4G65 A;  2RQM A;  1F5C A;  2N4C A;  4RLE A;  4ZVE A;  3PVX A;  5LSR A;  4DV5 F;  2MQQ A;  6AT1 B;  5F3T A;  3NXZ A;  3Q8S B;  1F5B A;  1XNR J;  4NLR A;  2CJX B;  1AZS A;  3PJ9 A;  1OY9 A;  4DFJ A;  1BMQ B;  4MYU A;  4AND A;  2DHS A;  2L3M A;  1VBK A;  4EYH B;  2VPX B;  4MIB A;  2IC3 A;  4XPC A;  2ZH7 A;  1VC0 A;  3ICL A;  2K3K A;  5KFU A;  1MSW D;  4C6A A;  2RUS A;  3CCM S;  2ACM A;  1ULR A;  2RKI A;  3BSO A;  1RWK B;  4IKA A;  2NQP A;  2YKM A;  3OFE A;  4QYZ K;  1LOU A;  1RTH A;  3VAH A;  4AL6 A;  2QLX A;  2G13 A;  4HT7 A;  3PFE A;  1JLF B;  2ERR A;  1RZM A;  1NDP A;  1LQ9 A;  3BB5 A;  3OXF A;  4R0E A;  3TAM A;  5L9N A;  1MMD A;  1N88 A;  3M8Q A;  2BXJ A;  1XMO F;  1JLE B;  3THV A;  1RT2 B;  3NL0 A;  2OD6 A;  3N28 A;  2CPE A;  1S12 A;  3OTO J;  4OI3 A;  2VIH A;  3G6X A;  1EX8 A;  4IFY A;  1HWK A;  4BCA A;  4EMD A;  3MTJ A;  4RW7 B;  4C4W A;  5KOX A;  2IY5 B;  1HW9 A;  4K50 A;  4UF4 A;  1VDH A;  4GKK F;  1JIH A;  4PAA A;  4CH1 A;  1RHK B;  5FLX Y;  2XS2 A;  3ZZR A;  1TEL A;  1LEO A;  1U1O A;  2H48 B;  1EQM A;  4WP9 A;  2HNY B;  4PPZ A;  2C2E A;  2RQK A;  3UVJ B;  3DFE A;  3HF5 A;  4JBC A;  2JX2 A;  1NSA A;  2OKQ A;  5L1I A;  2LQ5 A;  3OD2 A;  4Q43 A;  4O4G B;  1S59 A;  1FXD A;  2CA9 A;  2K7K A;  2H51 B;  1S0M A;  1T11 A;  4LSN A;  1S1V A;  3OXL A;  4OZ2 A;  1U8W A;  1TL3 A;  3MEG B;  3BZQ A;  3RBZ A;  4PUO A;  3S01 A;  4UT4 A;  4QIW D;  2ZZT A;  3QYY A;  2AGO A;  1B7F A;  2J8A A;  1S6Q A;  1RWM B;  2MY8 A;  3TQE A;  3CIZ A;  3NGU A;  4WFZ A;  2GS8 A;  1KD1 T;  4DU7 A;  3QQC D;  1UKU A;  3HVW A;  4RPF A;  2F4V J;  2CQP A;  3DLB A;  3OJU A;  1V5I B;  4OV6 A;  5HMY A;  1BQM A;  2WVE A;  4LF5 J;  4CI0 B;  5KFB A;  4DFP A;  2AJ1 A;  1P1L A;  2PD1 A;  2MZT A;  2KHD A;  3NG8 A;  5D4N A;  5C2G A;  4M8L A;  4K4Y A;  3Q8Y A;  2IYI A;  3Q0A A;  2RIJ A;  1QE1 A;  3CGI A;  2Y3Y A;  3PZP A;  4F26 A;  4UOG A;  1KP6 A;  4DV7 J;  4DUZ F;  2IMW P;  5KFZ A;  3M1V B;  2GJI A;  1FX4 A;  3HHN B;  4QU6 A;  4JV0 A;  1CJK B;  2XB2 D;  2R2S A;  1XC9 A;  3I5A A;  2HWH A;  1HNW F;  5CYJ A;  4M1K A;  3I82 A;  1SKR A;  1DAR A;  2EBG A;  2EG1 A;  2A6M A;  4DL7 A;  2FJV A;  1MLA A;  2DNL A;  3GFH A;  2HHH F;  2HFU A;  4USI A;  1CQN A;  3K57 A;  5F8M A;  4AXI A;  3MZI A;  2DH8 A;  5A2Q U;  2MLX A;  5B08 A;  2HND B;  4LFA J;  4YP3 A;  4W4M A;  3PR4 A;  1P9Y A;  3DYA B;  1VJW A;  4NLD A;  2HQC A;  1TVR B;  3DOM B;  1YJ9 S;  4PQU A;  2OHD A;  2PII A;  3DRP B;  1EJ7 L;  4Y6I A;  4HKQ A;  1VRT B;  4URG A;  2FJA B;  4DG1 B;  1N4L A;  1T3O A;  3ENV A;  1JLB B;  2FQQ B;  1X4B A;  4X65 J;  1RE1 B;  1HBM A;  1CJU A;  1X31 C;  3MEE A;  4DX7 A;  5EWF A;  2R3V A;  3TZY A;  2ZZN A;  3GFX A;  5DS7 A;  5DDR C;  2AIR B;  2XO7 A;  5DJB A;  2NYH A;  4OZN A;  2C3Y A;  2HBY B;  2ABY A;  3HD1 A;  2KB2 A;  2HZA A;  4TYB A;  2F65 A;  1SCJ B;  3G86 A;  4FF2 A;  3VWS A;  2B4O A;  2E7V A;  3QPI A;  1HMV A;  1FJG J;  1NJZ A;  3V6J A;  1RB0 A;  4WK3 A;  3PIP Q;  3AH6 A;  4DQS A;  3C6U B;  2Y1I A;  4RWX A;  2JHE A;  4RW9 B;  3PRD A;  1O5J A;  5D0G A;  3CJ2 A;  1JWW A;  4RWW A;  1IKV B;  2OPQ A;  2DIS A;  2HWT A;  5DQI A;  4NA2 A;  2UVV A;  4NYZ A;  3FBB A;  1UW4 A;  4WKY A;  2ZNY A;  3BN4 A;  3CC4 S;  4YEA A;  4WFA Q;  3TO8 A;  2L9N A;  2DHX A;  2XNR A;  3UCZ P;  1ITP A;  4FP9 A;  3NGT A;  4ATN A;  3IGV A;  3P45 B;  1UAW A;  4K8R A;  2ZOF A;  2ATL A;  4FN5 A;  2GJ2 A;  4FYX B;  4RUB A;  3M7V A;  1DLO A;  4DMZ A;  1WI6 A;  1IBL F;  2K1R B;  2R42 A;  4LRF A;  1R0B G;  3MMC A;  4TQR A;  1KBR A;  5A8R A;  3K5N A;  4CYU B;  2BRK A;  1T94 A;  3THT A;  1NKC A;  4B08 A;  2V34 A;  1KC8 T;  1FRH A;  4Y2A A;  2B9E A;  2E9Z A;  1UVM A;  5D8H B;  1T9V A;  4KHM A;  3VGS A;  4PG4 A;  2BJ9 A;  3C3L A;  4ZP9 A;  2IVF B;  1X4G A;  4NA3 A;  3IRW P;  5IXU A;  4ILR A;  4A8K A;  1S72 S;  2NR0 A;  1SKW A;  2FZG B;  1FHT A;  2CQ0 A;  3MM8 A;  3D1O A;  3MM6 B;  1I51 B;  5CYM A;  2CPX A;  1G7C B;  3WC2 A;  5HJY A;  3HFK A;  3I0R B;  1HFE L;  4WTY A;  5T14 A;  2AP6 A;  4NWB A;  2WON A;  1UVI A;  2BA9 A;  1JLG B;  3LAL A;  4LBH A;  3QGH A;  2KVQ E;  3K8W A;  4PYA A;  2LU1 A;  4H4K C;  5HL7 Q;  2RT3 A;  3OW2 R;  1U26 A;  3JYT A;  3IAS 9;  3Q8R B;  1HHQ A;  1TFY A;  5GAH I;  1F9H A;  1R0A A;  2FGC A;  3T5J A;  3ZNJ 1;  1DTT A;  1REV B;  2CFX A;  1F6T A;  3R6G B;  1QVF R;  1RWV B;  3QO9 A;  4IOC Q;  2CQH A;  2D3U A;  1S1W B;  4UQG A;  1YG0 A;  2VFU A;  3MOJ B;  1HD0 A;  3ELH A;  2KI2 A;  4YUD A;  4CLW A;  1TL1 B;  2NXU A;  2CJ9 A;  1HBU B;  1Q78 A;  4JI1 F;  4WWS A;  5F8N A;  1HQU A;  3HVT A;  1SC1 B;  1W25 A;  1M5P C;  1ZH5 A;  4NLT A;  2MKJ A;  2GIR A;  1IKY A;  3NP5 A;  3KLI B;  5HVF A;  1FER A;  4KBI A;  4HH1 A;  3I55 S;  4CO1 A;  4KFB A;  1TR0 A;  4KC5 A;  2C2R A;  4D3G A;  2B4U A;  3D6M B;  2JVR A;  3QJJ A;  4MKV A;  3MMA B;  1U6F A;  4DPO A;  5LXY A;  2DEJ A;  3V6D B;  2FD2 A;  1TMM A;  2HFO A;  3CNQ P;  1WUU A;  2NUH A;  2W7P A;  4QWE A;  2R8K A;  3G2X A;  3MWB A;  4KGK A;  2XGQ A;  3OFH A;  4J9S A;  2J7K A;  4NA1 A;  3IP0 A;  1HBO A;  3IG1 B;  3IBC B;  3D66 A;  1NDL A;  3CME S;  4DPT A;  2XI3 A;  2R7X A;  1RTI B;  4BC7 A;  4DV5 J;  3QLH A;  5FJ4 A;  1YJR A;  5B0C A;  4RBU A;  2JC0 A;  5J2Q B;  4U67 Q;  4Y2M A;  4X62 F;  2VG5 A;  2XZD B;  3H5U A;  3CD0 A;  2AW0 A;  1D1U A;  4LMZ A;  2HGN A;  1VR6 A;  4X64 F;  3ISN C;  3OXG A;  5B0E A;  4RNF A;  1Q4R A;  1F3F A;  2BVZ A;  5KFX A;  3ISN D;  1Y10 A;  3IXQ A;  4DFM A;  1Y3J A;  1C1B B;  2MGZ A;  2AD9 A;  2O3D A;  4Z2X A;  4M95 A;  1MRO A;  2LQJ A;  4JI4 F;  1PC4 A;  3C19 A;  3DOL A;  2BQR A;  1XMO J;  4BWJ A;  2RSQ A;  1FNM A;  1YLX A;  1UFW A;  2ZE2 A;  2PA8 D;  4ENO A;  3GIK A;  3DGV A;  2IJF A;  1RTD B;  1VRU A;  3NMR A;  1AXQ A;  5KT2 A;  1A7G E;  1GXT A;  3OTE A;  4GKK J;  2GHW A;  3EM1 A;  4QW8 A;  2RS2 A;  1KHV A;  2NYI A;  4JI0 F;  5BYS A;  1URR A;  3P49 B;  4PG7 A;  5BR8 F;  3LF0 A;  3G6E S;  2VBY A;  5A8K A;  2I1R A;  4PPD A;  7FDR A;  3H20 A;  1VQ6 S;  3D5M A;  1U2F A;  4O3R A;  1RAO A;  2BE7 D;  3HHL B;  4EU0 A;  2C2D A;  1WOS A;  3KLH B;  2D3O 1;  3ET6 B;  2V4Q A;  5GAE I;  3AY0 A;  1U25 A;  2YY3 A;  4BC9 A;  3TNV A;  4DN0 A;  4C7Q A;  5G4D A;  4C8M A;  5IV3 A;  1AZS B;  3TUP A;  4ECQ A;  2M70 A;  2FGO A;  5HMZ A;  2HGM A;  1NPP A;  2ZVS A;  2BJE A;  4QBU A;  4G1Q B;  1EP4 B;  2RS8 A;  3CCU S;  1BXN A;  3NGR A;  5KT7 A;  3L7O A;  4OHW A;  1B4S A;  3AD8 C;  4ED1 A;  2AEM A;  2AJQ A;  4LFB F;  3JSY A;  2MQ8 A;  4HL9 A;  1T9T A;  1S1T A;  5LJ3 Y;  4ECX A;  1GQE A;  3HFV A;  4E98 A;  3Q22 A;  3ENW A;  1T03 A;  1N32 F;  5JJB A;  4C3K A;  1N5Q A;  1RTZ A;  4OYB A;  4Q44 A;  2DYA A;  4IFY B;  1RA6 A;  2HHU A;  4DUZ J;  3FVY A;  3TVZ A;  2ZH6 A;  4YOE A;  3KTQ A;  4ANE A;  5K14 B;  3KJF B;  2MHE A;  3OV7 A;  4ED5 A;  4FYW B;  3CWJ A;  2V8P A;  1BGX T;  4I6A A;  1HPZ B;  3G82 A;  5LMU F;  1PSD A;  1MG7 A;  1HNW J;  3GR1 A;  3CMA S;  1LXJ A;  2U1A A;  4X4T A;  5DDP C;  4LR7 A;  3HVA A;  1ZM4 A;  2HHH J;  4RL1 A;  4M5I A;  1C1C A;  4PWW A;  1W2B R;  5L1J A;  1YGY A;  3FC9 A;  1SJQ A;  2D3Z A;  2WOM B;  1WSR A;  4LRD A;  2B7B B;  3POT A;  3H0P A;  3KHG A;  1S6Q B;  1N5Y A;  3H8Y A;  4OI0 A;  3KK3 A;  2E5J A;  4CWB A;  4DF4 A;  1H2V Z;  2GFF A;  1R8B A;  2HFV A;  2QC3 A;  4L74 A;  2B7C B;  4L73 A;  4M5N A;  4HT5 A;  1HNX F;  2J6S A;  4K4W A;  1FEH A;  2FY8 A;  2CYY A;  3MPU B;  3IS9 A;  2GAH C;  3MM9 A;  3BRE A;  3R2C J;  4NLV A;  1OPZ A;  2DRB A;  1WEY A;  4BLG A;  4K4X A;  4Y2K A;  1OY6 A;  2QN6 B;  1FDA A;  3J81 U;  4QWA A;  2X3D A;  4DSE A;  2Z56 B;  2ZDO A;  3BKF A;  4ZCI A;  3D2W A;  4ES1 A;  2JDJ A;  1LW2 A;  4MAK A;  2HFS A;  5KFD A;  2W2P P;  3CJS A;  4J5O A;  3Q8V A;  4GKJ F;  3J81 j;  3K89 A;  2C22 A;  3QRQ A;  4M5J A;  3GPA A;  2RUG A;  2DPJ A;  4FNH A;  4TU7 A;  4J90 A;  1TQL A;  4ITS A;  2YKQ A;  1OYE A;  2DGX A;  3EXY A;  2WSC C;  4XTT A;  2KHC A;  2AF6 A;  4I56 A;  4FDF A;  2RHS B;  4Y65 A;  4JI6 F;  3PW2 A;  4C2M A;  9ATC B;  4M63 A;  2I5J A;  4AFF A;  3GR0 A;  4PKD B;  2P5V A;  2LEB A;  2CKW A;  1RGV A;  1RAB B;  2PO4 A;  2BJ7 A;  1Z4U A;  4R8U A;  3JAM Y;  4YQW A;  1S9E A;  2WB4 A;  5KG2 A;  3IN5 A;  2BW7 A;  4ICL A;  2FC8 A;  2X1A A;  4DV0 F;  4KGX B;  1QD1 A;  4ZVG A;  3RYL A;  5J2P A;  1NK5 A;  3A13 A;  1I1G A;  1CUL B;  3MUT P;  5IT4 A;  2VOP A;  1WDT A;  2KT5 A;  5DM7 Q;  2CNK B;  3WC0 A;  3IFE A;  3PCO B;  1IBL J;  3HK2 A;  2XNQ A;  3OL6 A;  4RNH A;  4K4S A;  4F4X A;  1FCA A;  2M8H A;  1RUS A;  4A8F A;  4YB1 P;  5DET A;  2LP4 A;  4OJG A;  2XSJ A;  2KT2 A;  5JVH Q;  3ZZO A;  3CO0 P;  3RB3 A;  3KDN A;  2FTR A;  5KT4 A;  4USK A;  2FUG 9;  5HO4 A;  1UFL A;  5ITH A;  2V2Z A;  1B0V A;  3CJR A;  4H4O B;  1VQ4 S;  3UN3 A;  4CNZ A;  4I6W A;  3B82 A;  1GAO A;  3IR7 B;  2IRX A;  3MAH A;  5AJ3 F;  3GIR A;  3C6T A;  1SL0 A;  5KFP A;  2FDN A;  2NCK L;  2HGL A;  2O67 A;  2HQ3 A;  3MPY A;  1SC3 B;  2FLP A;  3Q89 A;  2YKA A;  3KJV A;  2HZV A;  3A3P B;  1RAA B;  1QTM A;  4B02 A;  1LWC B;  3RAX A;  3KUE A;  3O1L A;  3ITH B;  3I9Z A;  3W2V A;  4W90 B;  1KRP A;  3QAU A;  3JS9 A;  4CT8 A;  4YME A;  3CJT A;  3DDI A;  2R7W A;  5KG7 A;  1NB2 A;  4CZC A;  3LO3 A;  4RW8 B;  5K9F A;  3ILL A;  2PMH A;  1LWX A;  2BM1 A;  3DMJ B;  1V6H A;  4EI2 A;  2B8P A;  2WW4 A;  4GRS A;  1T05 A;  4WZM A;  4KRW A;  4USU A;  2OPP A;  2JNJ A;  2EFV A;  1TK0 A;  5DG7 A;  3BO4 A;  4USM A;  3FK4 A;  1DLO B;  1EB0 A;  2IRY A;  4C3L A;  5KFG A;  3MMC B;  2OO4 A;  2CPD A;  1Q7Y T;  4JI1 J;  3IWX A;  3MR5 A;  2GIF A;  3NCP A;  4F25 A;  2G2Y A;  3FZB A;  3NNA A;  5E3P A;  2R7Q A;  1ZAW A;  1XMB A;  4LQ3 A;  4R5P A;  5GMD A;  1UPM B;  3QSY B;  3EGN A;  2QEX S;  5A8W A;  1X5S A;  5T7L B;  5LXR A;  4J9M A;  5ETP A;  1R89 A;  2W2O P;  2B4V A;  4GVB B;  4UUW A;  3QID A;  1PJ7 A;  3ONQ A;  1KHW A;  2GX8 A;  1GMV A;  2ZWP A;  2HHV A;  4DL4 A;  1TKD A;  3OFF A;  2WB1 D;  4HR2 A;  2YQ3 A;  2GGP B;  3E51 A;  3CCL S;  1GTE A;  4CM0 A;  4FVM A;  5C7P A;  2D3O R;  4ANC A;  1WOO A;  2WON B;  3BN7 A;  3Q2S C;  1B3T A;  4BBY A;  4OHZ A;  2W2Q P;  4F67 A;  1U45 A;  3VGU A;  3L09 A;  3J80 Y;  3VV2 B;  3NGK A;  4WIQ A;  4HLB A;  1V3R A;  4QQB A;  3KLE A;  3P96 A;  3R5C A;  3L4B C;  4WXW A;  4EWT A;  3EVW A;  4M5H A;  3LPY A;  2I38 A;  2NXE A;  1RAG B;  1FNO A;  1NM2 A;  1DTT B;  3QO9 B;  4X62 J;  4TQS A;  4ZPV R;  3GZ7 A;  3W9H A;  4IFV A;  4IR1 A;  1FFS B;  4X64 J;  1RT7 A;  1OO0 B;  2FJE B;  3BBB A;  3LGN A;  3P5B P;  3PO4 A;  1WC3 A;  3OTC A;  1KQF B;  3CUN A;  3N0V A;  3UO0 A;  4JI4 J;  1KTV A;  3HI9 A;  4TU8 A;  3AOD A;  1Q8L A;  1T95 A;  3U27 A;  2QJ3 A;  1M5O C;  3WBZ A;  2DIT A;  2W24 A;  1IKY B;  3FSX A;  2FVP A;  1EKR A;  5M2R A;  5KTQ A;  4ALZ A;  3ULH A;  3NNC A;  4RU9 A;  4OI1 A;  3M8P B;  4KQZ A;  1NK6 A;  5ETK A;  2HK2 A;  3TX8 A;  2QTW A;  4LF2 A;  2G2O A;  1AUS L;  1RT1 A;  3JTN A;  2DNG A;  2QA4 G;  2BJ3 A;  5IWA F;  2WRM A;  4JI0 J;  5FLX U;  4NLX A;  1YJN S;  2HWI A;  4ZJQ A;  5BR8 J;  3QWP A;  4AL5 A;  3SV4 A;  3W62 A;  2PEB A;  1C4C A;  4F7V A;  3H5Y A;  5GAG U;  5CZX A;  2XZW A;  3UQS A;  3EZU A;  3DM2 A;  2YWH A;  4OYX A;  1UPP A;  1Y3K A;  1IKX B;  3QLH B;  1FF2 A;  2AEF A;  1GTH A;  2VBX A;  5HVG A;  2GQ2 A;  5CXT A;  2Z2L A;  3EGV A;  1RAE B;  2QV6 A;  3IWN C;  5I3P A;  2BUN A;  2VG5 B;  4NLS A;  4HTI A;  3HJV A;  4P7V A;  5C24 B;  1GH8 A;  1W2I A;  2DH9 A;  2HFZ A;  4CDI A;  3JSB A;  2BZ2 A;  4RW6 A;  4NRU A;  1XJW B;  3UD5 A;  1GXL A;  4C8N A;  4CNY A;  3QRP A;  3D7S B;  4ZOS A;  2V8V A;  2YNI A;  2GMH A;  1WD6 A;  1T9U A;  1NK4 A;  4E0D A;  3CPW R;  2ASJ A;  4LF4 F;  1S76 D;  4LFB J;  2VDI A;  3CIM A;  4ZPB A;  3FSY A;  3QSI A;  2DHA A;  4PYD A;  2EWH A;  4EZ6 A;  1N32 J;  2QGF B;  3SIP B;  1YRT A;  1HYS B;  3PFO A;  3J7A N;  2C3O A;  3NGS A;  2D9O A;  4O3N A;  4I2P A;  3D68 A;  4YB5 A;  4G6V B;  5HQ8 A;  5H1S V;  2PA3 A;  2EPI A;  3LAM A;  4TXS A;  4KYZ A;  5LMU J;  1K47 A;  4M5M A;  4B3S F;  1TZ0 A;  4UZC A;  2KU7 A;  3LW5 C;  1HNI A;  3QMQ A;  4DLE A;  2N7C A;  4DL2 A;  2OPR B;  1RHJ B;  2DR6 A;  1XR6 A;  2HNZ A;  3KK2 B;  3F0N A;  3SEO A;  2XC9 A;  1NK0 A;  5D3G A;  4ED6 A;  4OLP A;  1HQE B;  2YNH A;  3HP6 A;  2WVC A;  4F4K A;  1HL6 A;  3CJK B;  3NOC A;  3TUI C;  2ZH3 A;  1CSJ A;  3S1T A;  3SDE A;  4G3I A;  3M2R B;  4KHP F;  4ZMM A;  4RX6 A;  2DT9 A;  1CG2 A;  4USH A;  1WC4 A;  1VLY A;  3W5X A;  3W63 A;  4PWD A;  3PG9 A;  1HNX J;  2DY9 A;  2F3J A;  1C0T A;  3NWR A;  4NI2 A;  4UUX A;  5HRO B;  4K0K F;  4ECS A;  2LA6 A;  3KHL A;  1P9Q C;  4J9R A;  2VL1 A;  4KV8 A;  3LPE A;  2QLW A;  2L08 A;  1LWF B;  3G71 S;  4WP8 A;  1P6T A;  3LP1 B;  2UVR A;  4YR0 A;  3TP2 A;  3L95 X;  4W92 B;  1S1T B;  3QT5 A;  3HZE A;  2HMI B;  4QIV A;  2KDO A;  5K8O A;  2QSF A;  2VFR A;  5LOQ A;  3T3F A;  2IBK A;  1WHX A;  2KXF A;  2RD5 C;  1HWU A;  1YBU A;  4WU2 A;  1S6P B;  1K1S A;  3DRX A;  2XMM A;  3I6P A;  3EZO A;  1S1U A;  4LSL B;  4GKJ J;  3KLG A;  1TFW A;  1TUW A;  1PYO B;  3IO1 A;  4J9P A;  2RH3 A;  5J2M B;  2HPU A;  3G82 B;  3W5Y A;  4N8N A;  2E1A A;  4DQQ A;  2E1C A;  1Z1Z A;  2G0J A;  3KK1 A;  3R5A A;  2DNK A;  4C8K A;  4DSJ A;  1N36 F;  4JI6 J;  3PW0 A;  1PAU B;  2B51 A;  2V67 A;  1R31 A;  2V2V A;  5D77 A;  3T6B A;  4LBI A;  2MJU A;  2FVC A;  3IBW A;  3VHQ A;  3VQT A;  5AT1 B;  1TU0 B;  3PRB A;  2HVI A;  4IH6 A;  2CPZ A;  2YH0 A;  2H5I B;  1KLM B;  1T9X A;  5CCM A;  2GHP A;  2QA2 A;  5A0Y B;  1FX2 A;  4JYA F;  4YR3 A;  4DV0 J;  2V9K A;  1RAI B;  2A2D A;  1A0O B;  1ZTW A;  1I94 F;  1V3Z A;  3J7Y U;  3VVU A;  3CCW A;  5DLF A;  1D9F A;  2HAF A;  4NLO A;  2G0I A;  4DI6 A;  4RUC A;  1QUV A;  2VFT A;  3LGM A;  3PKM A;  3UNG C;  2H1Y A;  2MMY A;  3HLU A;  4NLP A;  4ZVP B;  4MKA A;  1U4B A;  4USW A;  1JLF A;  4QIF A;  3VTI A;  1WEX A;  2WBM A;  3DNC A;  1LW2 B;  1VQ7 S;  2H4W B;  4NLU A;  3CJ5 A;  5AJ3 J;  1UJ5 A;  5CYQ B;  4EBD A;  4RW7 A;  1I5O B;  2KRB A;  5BJR A;  2O1P A;  1HHT P;  1HLW A;  4ZLJ A;  5AXK A;  4K2X A;  5DO2 A;  4FZV A;  2HNY A;  2LFV A;  3UVJ A;  4DJB A;  1LK5 A;  4NCG B;  3IGN A;  3VQS A;  1ZA2 B;  1CC7 A;  2I6W A;  2MKI A;  4PXE A;  3G6V A;  3F44 A;  1NKB A;  1WWH A;  4DR7 F;  4WP3 A;  2A18 A;  4ZPD A;  3UI3 A;  5KG4 A;  5C25 B;  3ZZT A;  5D4P A;  1R6Y A;  2ALZ A;  9RUB A;  4U9R A;  4A46 A;  1YQH A;  2E7W A;  3MAQ A;  1X4E A;  2UV8 A;  3AOC A;  1NZ8 A;  4QR2 A;  1RQ0 A;  4CQ1 A;  1Q8B A;  1FFG B;  2GML A;  3A3O B;  1S0V A;  2J6U A;  5H9E J;  4DR2 F;  3BGR B;  3CUL A;  4A47 A;  2K06 A;  1H74 A;  1UZH A;  1EZZ B;  1V3S A;  2XO6 A;  3E8O A;  3DRS B;  3MPW A;  3TI0 A;  5F8G A;  2Z58 B;  1DQ8 A;  3E01 B;  2OGU A;  4WJB A;  3DRR A;  2OTL S;  1ARO P;  2GIQ A;  4BS2 A;  4HAC B;  1S9F A;  4ECV A;  4LIR A;  3AJ1 A;  1Y4Z B;  4F0K A;  4Q0B B;  2V63 A;  4ETX A;  4ZVH A;  1JJ2 R;  1N48 A;  1N6Q B;  1U1R A;  5EUH A;  2ILY A;  2MKY A;  1KQG B;  3M1V A;  3ENA A;  2G4B A;  2HS3 A;  4NCA A;  1R27 B;  4CP5 A;  2IDE A;  3QBC A;  1CJK A;  5IM0 B;  2RRA A;  1NH7 A;  1WC1 A;  4HDG A;  1XQI A;  1CVJ A;  2B4P A;  4F3O A;  1WC0 A;  1Y5I B;  3LAN A;  3MFH A;  4ZLP A;  2CNO B;  4ED8 A;  2Y0B B;  3OL7 A;  3VR1 A;  3BQ1 A;  5B7W A;  4OMF G;  1XR5 A;  2RDI A;  3DN9 A;  3SBM A;  1VQS A;  4X4V A;  4HI1 A;  1F60 B;  2WZ1 A;  4RUH A;  3R27 A;  2KVI A;  2HND A;  4BHQ A;  3UNY A;  4NXM F;  2OPP B;  1QAI A;  2E5G A;  3DYA A;  4OZ1 A;  3TAN A;  1TVR A;  3DOM A;  3EE3 A;  1SJ3 P;  4K4T A;  1XWL A;  2OJ3 A;  1VRT A;  3IA0 A;  2KYZ A;  2B5J B;  1RBA A;  2WBR A;  3RW6 A;  2VG7 B;  2AMC B;  4X4P A;  1H38 A;  3M32 A;  5F8I A;  2JOQ A;  4DBQ A;  4DV2 F;  1FK9 A;  4B3O B;  1JLB A;  1X5O A;  4E2F B;  1RAJ A;  4NE9 C;  5A8W B;  3GV7 B;  1ZA1 B;  2GAG C;  1X0F A;  3UW1 A;  1TL4 A;  2UVW A;  3BR8 A;  2IJN A;  2R7U A;  2Q6C A;  4ID5 B;  4XIU A;  1YIT S;  2AV5 A;  2LEA A;  3MEC B;  4NZ6 A;  1VBZ A;  1CQM A;  3H2U B;  1PCA A;  5IWA J;  3BSA A;  4U8V A;  4FYD A;  4CO2 A;  1XER A;  2H3E B;  1FRM A;  3N01 A;  4KT0 C;  4ZP7 A;  4DV1 F;  5AE3 A;  2V4R A;  1IBK F;  1KVI A;  1NK7 A;  2OH2 A;  2P6T A;  4LVN P;  3B6B A;  4B3R F;  4NEZ A;  3GG1 A;  1L5U A;  1R3N A;  2V8H A;  1K1Q A;  2KJV A;  3MTK A;  3R8Y A;  3KLE B;  4RW9 A;  3MM7 B;  2M52 A;  2C2K B;  4EBC A;  5BYQ A;  4B3T F;  2ZZM A;  4LQ9 A;  4NLY A;  2EC0 A;  4DZD A;  4C8L A;  1D09 B;  1NSK L;  1TKT A;  4RNO A;  2OI2 A;  2ALY B;  3BGF A;  2C2M B;  1D8Y A;  1YX2 A;  2OAU A;  5D0R A;  3FBC A;  1U0H B;  4N5S A;  4DS4 A;  4B9S A;  2K1R A;  4ZPC A;  4FBU A;  4U6P A;  4LF4 J;  1QAX A;  4XO0 A;  4P52 A;  1C0U A;  3W60 A;  4A8O A;  2W8K A;  4DR1 F;  3MCO A;  5E41 A;  5K8M A;  4CYU A;  3D0G E;  1QM9 A;  2UUA F;  2MYF A;  4KPC A;  2F5G A;  3MUR P;  3MHY A;  4K4V A;  1DQ9 A;  3X1L B;  3AB4 B;  1U1P A;  3GU0 A;  2VPZ B;  2NRE A;  4C8O A;  1H73 A;  4P2S A;  2E5I A;  4MKB A;  2DR9 A;  3VF0 B;  2ZH4 A;  1N34 F;  4DSK A;  2P9E A;  2EEY A;  3ILJ A;  4WF9 Q;  1RT4 B;  4EK2 A;  4B3S J;  5L9X A;  3MM6 A;  2DXD A;  1R6V A;  2RU3 A;  2JLE A;  3Q23 A;  3DC2 A;  2EFO A;  4P2X A;  1U1N A;  3CJ4 A;  2J76 E;  1JLG A;  1NH8 A;  1SIZ A;  1A6L A;  2OTJ S;  1U6B A;  2R4F A;  1KOH A;  3M9N B;  1FNX H;  3A1Y G;  4D3H A;  2OD4 A;  1U2C A;  5DGA A;  2CG8 A;  3K8V A;  3EDR B;  4I6Y A;  2EFN A;  2AWZ A;  3N5B A;  1P8G A;  4M5L A;  4MJK A;  2VC1 A;  4DXL A;  4KHP J;  1REV A;  4I68 A;  4ZCK A;  5J2N B;  1NDK A;  1S1W A;  2QLB B;  4PXB A;  3CED A;  4K0K J;  4JP8 A;  3IR5 B;  1KON A;  4PXD A;  3HJF A;  5E3C A;  3QJL A;  1CLF A;  4O3P A;  4ZPT R;  3MFI A;  5EX0 A;  1FWP A;  6FDR A;  1BWV A;  1WEZ A;  2YBV A;  4LRE A;  1S77 D;  5CHC B;  4URQ U;  2ZHO A;  1R0C B;  2X1F A;  3CSK A;  3EYZ A;  1DFD A;  4LF9 F;  4DR3 F;  3R1L A;  4NPO A;  3KKF A;  4OJ1 A;  1PJ5 A;  2YQ1 A;  3W61 A;  4I2P B;  1T7P A;  3AT1 B;  1ZBT A;  1OYD A;  2DHH A;  4J9Q A;  2VKZ G;  2X1G A;  2ZUG A;  2F40 A;  3MMA A;  3M6V A;  5K8P A;  4FYY B;  2ASY A;  1VMB A;  3PHT A;  3V6D A;  2DXF A;  2W9C B;  1HNI B;  1IWG A;  3LWL A;  2JJ4 D;  5BYR A;  1O51 A;  1L3U A;  3BEG B;  1VQY A;  3IAM 9;  2CPI A;  1BD6 A;  1N36 J;  2HNZ B;  4H4M B;  4OZL A;  5ETN A;  1B99 A;  4OHV A;  4A8S A;  3FJ2 A;  1R8C A;  2UUT A;  1UVL A;  2ZKU A;  2VZ9 A;  1HI8 A;  1TV6 B;  1ZOT A;  1VYA A;  4HDH A;  2YNH B;  3QAE A;  1RTI A;  5J1N A;  4DFK A;  3DRY A;  3MUV P;  2PT0 A;  1H2T Z;  5I42 B;  3FUY A;  5F9L A;  3SDE B;  4L3N A;  3JAM U;  1NSQ A;  3U7J A;  5GAG I;  1KFS A;  5J2Q A;  3P4U B;  5H9E K;  4PWD B;  1E6Y B;  4CLS A;  1R7I A;  1I94 J;  5DG9 A;  5JVG Q;  4NI2 B;  3WHI A;  3H59 A;  3PXG a;  2HVE A;  3BGU A;  3RZA A;  3GCW P;  1HHS A;  2ZDP A;  1XBW A;  2GA7 A;  3GMG A;  1FE4 A;  1VQL S;  1ZM9 A;  5M2U A;  2WSF C;  1IR2 A;  3LTO A;  3PO5 A;  2J0W A;  4PG8 A;  2EVZ A;  2B43 A;  5MAO A;  2DGU A;  2CZ4 A;  2C3P A;  4IG3 A;  5ETS A;  1XK8 A;  1DUR A;  1RTD A;  4OIX A;  5EDW A;  3PM9 A;  3RBX A;  5HSP A;  3M6W A;  1HKA A;  4O3Q A;  1O6X A;  1S57 A;  1R43 A;  4MFB B;  4B9T A;  2Y0S D;  3O44 A;  4CLY A;  3DI6 B;  4QU7 A;  4CO4 A;  3RB6 A;  1IJF B;  4ECY A;  2ZBC A;  2ZIT A;  1LWE A;  4QIE A;  2YX7 A;  2VJU A;  1LNQ A;  3TUJ C;  2NXC A;  3GP9 A;  1HBN A;  2VBZ A;  3KHH A;  4DR7 J;  1MW7 A;  3HHL A;  1GX5 A;  4ZIT A;  2DEI A;  3PW7 A;  4F2S A;  1SL2 A;  1NB7 A;  1KKH A;  1GX6 A;  3THP A;  1RWW B;  1X9S A;  4Y28 C;  3OTB A;  2ZH9 A;  2RNE A;  2GQQ A;  2HIY A;  1L3S A;  1K8A T;  4DR2 J;  2CJB A;  4DCP B;  3OUY A;  1S7I A;  4G1Q A;  1EP4 A;  2IPO B;  4F4W A;  1YDL A;  2VA3 A;  4X4U A;  3PYG A;  2GO8 A;  4ZLN A;  2LCW A;  2DR8 A;  1NJW A;  2OEM A;  3Q8U A;  2ACY A;  3WDO A;  3EJM A;  3BJY A;  3MMB B;  4MMO A;  4ZS6 A;  3PEH A;  1FRJ A;  4X4O A;  2G0C A;  3IM9 A;  1TKX B;  4JOU A;  1ZS6 A;  1WF1 A;  5KG1 A;  2BOP A;  1Y0H A;  1NO8 A;  2E5L F;  2Q1L A;  2N4D A;  1S9G B;  2NZ4 A;  5K14 A;  3BSC A;  4M94 A;  3KNA A;  1FXR A;  4OX7 A;  2GVD B;  5K5M A;  4OL8 A;  4Y3C A;  4JI8 F;  2M0G B;  4DL0 C;  1HPZ A;  3H5S A;  4PCQ A;  2MKK A;  3SCK E;  3OHA A;  2J8S A;  2F8M A;  1TL7 A;  3A8I A;  3T1A A;  2UU9 F;  4DV6 F;  1IQZ A;  1RHQ B;  3VAI A;  4ECR A;  5DG8 A;  2F4F A;  2D41 A;  2AU0 A;  2HHT A;  2L48 A;  1WOR A;  2XGP A;  2XWX A;  2K2P A;  3EZ5 A;  3K0J A;  2J0X A;  2WOM A;  3ILO A;  2EFG A;  2VA2 A;  3OR1 B;  3MEK A;  4NXM J;  1ROF A;  2SXL A;  3EUN A;  1RWU A;  3BH6 B;  4Y2C A;  3BO3 A;  2QL5 B;  4EGL A;  3EIC A;  2ZJR Q;  2NXN A;  2XY5 A;  3DU6 A;  1IN0 A;  1T02 A;  3JQJ A;  2VH7 A;  3NS5 A;  1TUG B;  3H4D A;  4DU8 A;  4FNI A;  4Q8F A;  1ZET A;  2DGT A;  3TJ9 A;  4ELV A;  1OMS A;  4OYI A;  3K5M A;  3DRR B;  4ILM A;  1VC5 A;  4ZJL A;  1B64 A;  2CG4 A;  4PZV A;  3QZ7 A;  4OYP A;  4ED0 A;  4DV2 J;  1JJH A;  2IVM A;  3J7Y I;  1JMT A;  4EO6 A;  3GFZ A;  1IM4 A;  4I1T A;  5HJX A;  1YKW A;  2ADB A;  1WKK A;  1S4E A;  2MKS A;  4FKY A;  2XY7 A;  2QSW A;  2H5J B;  5KFN A;  4W98 A;  2YXL A;  2NPI A;  4CCH A;  3EVO A;  1OS5 A;  2EK1 A;  3OT9 A;  1I6J A;  3LP0 B;  4DV1 J;  1KNZ A;  3UD3 P;  2F8E X;  3OJS A;  1IBK J;  2NSC A;  1ZPV A;  3ZTQ A;  3DLK B;  1VIO A;  1JLC B;  3PJX A;  4B3R J;  4NYO A;  1VQ8 S;  3FMW A;  1DTQ B;  2VAS A;  3H2L A;  2R2U A;  2PDA A;  4DPU A;  3VGV A;  2CPH A;  2DGV A;  3BBC A;  4HI2 A;  4DL5 A;  2YWF A;  2GHV C;  1UEK A;  4B3T J;  3A3N B;  3DOK A;  1KQK A;  2X1B A;  3D6T B;  3HD2 A;  3SSQ A;  3QRR A;  1P27 B;  3FNN A;  3MGJ A;  3GIL A;  3TRG A;  2MLZ A;  4CH7 A;  3EMT A;  4O0I A;  4URS A;  1HNV A;  1FEE A;  2ZBQ A;  1PIL A;  1IWA A;  2FVR A;  2GQC A;  3C46 A;  1NCL A;  1ZAX A;  3A12 A;  4PXC A;  1WF2 A;  1CEZ A;  1FE0 A;  2F7V A;  3OL9 A;  1CUL A;  2KL8 A;  4NRT A;  5A6W A;  2F8H A;  3PNI A;  2CPF A;  4QCL A;  3M32 B;  2JH3 A;  4ES2 A;  1S48 A;  2E66 A;  4DR1 J;  2X51 A;  3H4B A;  2OSQ A;  1FK9 B;  1EQ0 A;  4I64 A;  5K20 B;  2UUA J;  3PRV A;  5B09 A;  3B54 A;  2QO3 A;  2GZO A;  1Y00 A;  2V94 A;  2CAD A;  5F9N A;  1NK8 A;  2FHJ D;  3C15 B;  2JFD A;  2ZEJ A;  3OLB A;  3I31 A;  2VC0 A;  1VQP S;  2VPY B;  4H4O A;  2CVE A;  2WAQ D;  2HHW A;  5C42 B;  3FCW A;  2F9J A;  1N34 J;  1QJH A;  1XR7 A;  4LJM A;  4KO0 B;  4FF1 A;  2RAQ A;  5IZH A;  3ZXW A;  2C2N A;  2MQL A;  3JQK A;  2J7W A;  1NJY A;  1LWC A;  3K7R A;  1A9N B;  5U47 A;  3OSP A;  2XLJ A;  1UET A;  3ITH A;  3CJ3 A;  5I4M A;  4GC7 A;  2LXI A;  1N5T A;  1UA1 A;  3DDK A;  1T9Y A;  3K5L A;  4RZR A;  2ZNZ A;  4USV A;  2NPF A;  3R1H A;  2DD8 S;  2HRT A;  4RW8 A;  4K2J A;  1TKT B;  3CC2 S;  1BLU A;  1T3N A;  3DMJ A;  1SVD A;  2O66 A;  3BH7 B;  3MD3 A;  1MU2 B;  1RLD A;  4IYQ A;  1YZ7 A;  2C3M A;  4O4R A;  3SSR A;  1D3W A;  3UCG A;  2BX6 A;  1ZPW X;  3PW5 A;  1C0U B;  3FGV A;  4YHH F;  1NLK L;  1UWB B;  4I2Q B;  2E1M C;  4HHH A;  4C11 B;  1H72 C;  1QAJ A;  2FJW A;  5KG0 A;  3TAR A;  1SJ4 P;  4ZPA A;  1Q7L B;  2JZ5 A;  1YBT A;  1MWZ A;  2RVJ A;  2KG1 A;  4LF9 J;  3ETM A;  2CJK A;  4DR3 J;  5T7L A;  3FBF A;  4GVL A;  3GSI A;  3CB4 A;  1UEV A;  2P9G A;  4F04 B;  4GVB A;  3HUL A;  4ER8 A;  4EYI B;  2JRS A;  2YKO A;  3UPF A;  2H5E A;  2YX4 A;  2GGP A;  1CS4 B;  1X9M A;  2EW9 A;  2ZBI A;  4B9V A;  1UP1 A;  4TN2 A;  1N5S A;  1NZA A;  1KOO A;  1WJ9 A;  2QYC A;  1IXK A;  1UFK A;  3CW2 C;  4J9V A;  3CCQ S;  3HKZ D;  3FZ2 A;  2BAB A;  3CCE S;  3EPI A;  1NHK L;  2CQC A;  5KFY A;  5KT6 A;  5IV4 A;  3M30 A;  2MPU A;  4R25 A;  3KHR A;  1U09 A;  1QLN A;  5IOL A;  1YWX A;  7AT1 B;  3OSN A;  2CJY B;  2YVS A;  3PDN A;  4J7C A;  3CDU A;  1YRX A;  5IQ6 A;  1Q16 B;  5EX3 A;  4WYW A;  2M3D A;  1JX4 A;  4C0H A;  4IRC A;  4KE5 A;  4RR5 A;  4CM2 A;  4TY8 A;  2XS7 A;  2ZD1 B;  5GAH U;  4FS1 A;  2VOD A;  3EXC X;  3IWL A;  5L38 A;  2KKH A;  3N6L A;  4Q7A A;  4V19 X;  2XY6 A;  2HQI A;  3BR9 A;  1N56 A;  2Q66 A;  5M2P A;  1RKJ A;  4LF1 A;  2AYM A;  4CH0 S;  3OPK A;  1S6O A; 
#chains in the Genus database with same CATH homology
 1SC4 B;  3KJQ B;  2H4W B;  1I3O B;  2DKO B;  3R7S B;  1QDU B;  5K20 B;  3GJS B;  4DCJ B;  1F9E B;  1PAU B;  1IBC B;  3SIP B;  2CJX B;  1NME B;  1SC3 B;  2QLB B;  1BMQ B;  2XZD B;  1I51 B;  4DCO B;  1SC1 B;  3GJR B;  2H51 B;  1RHM B;  2Y1L B;  2QLF B;  1RWP B;  1RWX B;  3GJT B;  2H5I B;  1ICE B;  3KJF B;  2XYH B;  3R7B B;  2HBR B;  4JB8 B;  3IBF B;  4ZVS B;  2FQQ B;  2H4Y B;  2XZT B;  2QL5 B;  3RJM B;  1RE1 B;  3R7N B;  1RWN B;  4ZVQ B;  2C2K B;  3D6F B;  2CJY B;  1RWK B;  3D6M B;  1QTN B;  3P45 B;  3QNW B;  1RHU B;  2XYP B;  1GFW B;  3EDQ B;  4ZVT B;  1RHR B;  2C2O B;  3P4U B;  2C1E B;  1RWM B;  3NS7 B;  2QL9 B;  3D6H B;  2HBQ B;  2C2Z B;  2QL7 B;  2CNK B;  5IC4 B;  3R5J B;  2CDR B;  2P2C B;  1RHJ B;  3KJN B;  2C2M B;  2HBY B;  1RWO B;  3GJQ B;  3R6G B;  4ZVO B;  4ZVP B;  1PYO B;  1RWV B;  2HBZ B;  1RWW B;  3IBC B;  4ZVR B;  2QLJ B;  1RHK B;  2CNN B;  2CNO B;  2CNL B;  2H54 B;  2H5J B;  2Y0B B;  2H48 B;  4LSZ B;  5IC6 B;  4ZVU B;  2XYG B;  3EDR B;  1RHQ B;  4DCP B;  2H65 B;  3R6L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...