2GV1A

Nmr solution structure of the acylphosphatase from eschaerichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
b'MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acylphosphatase
publication title NMR solution structure of the acylphosphatase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 15
structure length 92
sequence length 92
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gv1A00
3HHLB 3HHLA 2W4PA 1FE4A 1YJVA 3TRGA 4NPOA 4YDXA 2XMMA 1X0PA 5B0AA 3WDOA 2OAUA 2JDJA 4HH1A 1N5QA 2GGPA 2LXFA 3BF4A 1R6YA 1X7VA 5F0UA 2GV1A 2IFXA 1YRXA 2XMTA 3I9ZA 5B0EA 2ZDOA 4ZA1A 2OMOA 3TOQA 2ROEA 5T7LB 4OJ3A 1CPZA 2N7YA 4Q2MA 1U7LA 1TR0A 3QGPA 2PD1A 4Y2KA 1SB6A 1W2IA 2RSQA 4A48A 1APSA 2BUNA 2W4CA 3FGVA 2LDIA 5A6WA 5B08A 1KVJA 1X8DA 1VQYA 1AFIA 2AP6A 3E8OA 1AW0A 2FB0A 1RJJA 3FRYA 3TNVA 1OQ6A 2RILA 3BB5A 4NL5A 1YJTA 2ASYA 4YEAA 1P8GA 3VTIA 2GA7A 3KKFA 2GO8A 1FESA 3HHLC 1Y0HA 2LQ9A 4OJGA 2K7KA 1K0VA 1VQSA 1TUVA 2QIFA 3GZ7A 3QMQA 2G9OA 5KAKA 1Y3JA 2KT2A 3BN7A 2FTRA 2QYCA 5B0GA 1P6TA 2K1RB 2ROPA 1S6OA 1TL5A 3BR8A 1Q4RA 4HI1A 4Y2IA 2ACYA 5B0BA 4EFAC 1V3ZA 2PGCA 2HLTA 5T7LA 5F0WA 4A47A 4F67A 2CRLA 4QOTA 2BBEA 1CC7A 2OKQA 3MCSA 2OD6A 3MZIA 2K2PA 1YJRA 3HFKA 4A46A 1FVQA 1N5VA 4OJHA 1URRA 1GXUA 1OSDA 4ZOSA 3K7RA 1SQEA 2AJ0A 1OPZA 5B0FA 2QLWA 5A6PA 1Q53A 2OD4A 1MWZA 2XMUA 2HLUA 2KKHA 1QUPA 3KG0A 1WD6A 2GCFA 2N4CA 4FNIA 3BGUA 3LO3A 2IYGA 1KVIA 2ROGA 1KQKA 3FMBA 3KNGA 3LGNA 2LQBA 3T9NA 2XMWA 1YG0A 3UDCA 2RMLA 4U9RA 1GXTA 1AFJA 2K1RA 2OP5A 3CJKB 4OIXA 2XMKA 2FIUA 2K7JA 2AW0A 3IWLA 3DCAA 4OJ1A 2RU9A 1FE0A 3F44A 1XBWA 4FNHA 1FVSA 2VH7A 1SI9A 2W4DA 1N5SA 2HQIA 3DXSX 2AJ1A 3KG1A 1LQ9A 1CC8A 1TZ0A 2XMVA 2KT3A 3BM7A 3HF5A 5B0DA 1Q8LA 1FEEA 1OQ3A 1Q8BA 2GGPB 5B09A 5K9FA 2BYCA 2FHMA 2VV5A 1JK9B 4DPOA 2XMJA 5B0CA 4HL9A 1IUJA 2GFFA 3LGMA 4DN9A 2IYIA 1MWYA 3BDEA 4HI2A 1N5TA 4DL0C 2ZDPA 3HX9A 1JWWA 2HIQA 5IXUA 1S6UA 1FD8A 1Y3KA 2KYZA 2N4DA 3IWXA 2HFOA 3CJKA 2Q3PA 1TL4A 2L3MA 4A4JA 1ULRA 2EW9A 4HH0A 2QLXA 4Q2LA 2BJEA 2HFNA 2OFGX 2BJDA 4Y2MA 3HHLD 3HDSA 1Y9OA 1YJUA 2OFHX
chains in the Genus database with same CATH superfamily
3K5PA 4KSEB 3OR2B 3PRBA 1CQMA 2HKEA 2VONA 3VAMA 2K3IA 1R8CA 3EE3A 2CG8A 4A48A 1NNDA 3PEJA 1YGYA 4J9SA 1JLAA 2A1BA 4WPAA 3KDNA 3D68A 2W9BA 1C1BB 3NG8A 3NNCA 3T19A 1FJCA 1L3VA 4FF1A 3M2VB 2CG4A 3NGTA 2VQFJ 3L7PA 4HDHA 4ECRA 3DM2A 5GAEU 4AL7A 2KZZA 2M2BA 4IRKA 4WU3A 4CH7A 2W8LA 4M5JA 4CLTA 1T9YA 4OYIA 1Y10A 4JYAJ 4B9TA 3I32A 3FEZA 3FUYA 1F2HA 2FIUA 3N79A 3G87A 2P6TA 4FP9A 3BO4A 4WFZA 2VASA 3FZBA 5D15A 4OFZA 2J8SA 2ZKUA 2DGTA 2HQGA 1PAUB 3RG6A 2UXCJ 2XY5A 1FRHA 2GGPB 2DH7A 3D28A 4JI6J 3HO1A 3MWBA 4PYDA 4DUYJ 1U09A 1HQUA 1YRTA 2HBRB 5KFDA 3OHBA 4K4UA 1HI1A 1NK7A 2V2KA 1SH2A 3TRGA 1FXDA 2J9CA 2YWHA 4MK9A 4DDFA 1IBLF 4DWIA 4Q2MA 2J5AA 4MFBA 1WEXA 3QGPA 3MEEB 3GU0A 1RT2A 3V4MA 4NL5A 3A13A 2R7SA 2EVZA 1P8GA 5DZ6A 1LWEA 1LFPA 4NLWA 4QWBA 2QYCA 3GG1A 1JLCA 3VAIA 2VKRA 4C6AA 1SJQA 2QN6B 4C0BA 5F8IA 4LF2A 2VQFF 3DI6B 2FJWA 1VQNS 2ZC4A 3HZEA 3ZZZA 5THWA 2H4YB 5M2UA 3EGNA 3X1LB 1U6FA 4JYAF 4NOHA 4W4MA 2WSCC 1Q79A 4OX7A 4KPCA 4HDGA 4DBQA 3M2UB 4KE5A 2UXCF 4NXNJ 1V9OA 4DL0C 3RTVA 1HYSA 1SL0A 2XG8A 4JI6F 1UEVA 3FRZA 1Y4ZB 3DHXA 3MUTP 4L3NA 4DUYF 2GIFA 3G82A 2PDAA 3SCJE 3G6ES 4KV8B 2XC9A 3H25A 1S1WA 4TQSA 1Q8KA 5T14A 5A2QU 2UUBJ 2NR0A 3ZC4A 1PJ5A 2GX8A 4NLXA 3QJPA 3AJ2A 2DKOB 3FK4A 3GR0A 3M2RA 2JEGA 1VQ9S 4XIUA 2I1RA 3IG1A 4O4GA 4NLUA 1G7CB 2A6MA 4ID5B 2YWFA 3FSIA 4PXCA 7FD1A 4FXWA 1T05A 4TU8A 2JLGA 3OVBA 4DFJA 3GYNA 1VJWA 3GWCA 1X9WA 3R2CJ 2LCWA 4K5SA 3MTJA 1JNRB 3HF5A 4LRAA 2CJKA 1WOOA 2ZE2B 1RAAB 4B3SJ 4NXNF 4F4AA 1VRUA 4C2MA 4Q8EA 3KLFA 1TAQA 1D09B 2C3OA 3M9MB 1UPPA 4JV2A 2ASLA 3EZ5A 3NWGA 1SH0A 4A8WA 2OEMA 1E6YB 3Q8UA 3FBFA 2QC3A 3KXDA 2M3DA 3M8QA 2UUBF 1FERA 2ZC3A 1TK5A 2BA9A 2JFDA 2OPSA 1OWXA 3CJQA 2AWZA 4ZVEA 3NKYA 3VVTA 2F8MA 3S1TA 3KJVB 4RNNA 1S0VA 3RB4A 2OELA 2EPIA 4F0KA 4J5OA 1EX8A 3D4JA 2GJ2A 1RT5A 2J6UA 4U6PA 4HEA9 2BQUA 3AQPA 1NSPA 5EN1A 2P9EA 5E0OA 3W1YC 3VAJA 2DHAA 2NXUA 2QV6A 2MQQA 4TLQA 3ZZUA 2V4JB 4NYPA 3G8QA 5DM6Q 3AJ1A 1WOPA 3PIPQ 4GKKF 2ZBCA 3HVWA 2IM2A 2JOQA 4NI2A 4YY3J 1RE1B 2L48A 4Q2LA 4B3SF 2JJ4D 3BSOA 5D0RA 2DNRA 4DSIA 4J9QA 3KLIB 3CCSS 2EFGA 2QEXS 1DAXA 2YWGA 5CH7B 1YBAA 1RT1A 2UV8G 1S6QB 5F8MA 3LP1B 2QTWA 2H1YA 5LSRA 1N36J 2YWWA 1CJVA 1WG5A 5GAGU 1AA1B 3V4IA 3E51A 5CYMA 2F8HA 2ZOFA 5HMXA 1DFDA 2MTLA 1YZ6A 1RT6B 3K8WA 3EDQB 2QL9B 1UPMB 2OSQA 2HFSA 1FJ7A 3R97A 2BW2A 2XEXA 1TFYA 3CJ5A 3Q83A 4Q43A 3G96A 5HLFA 2RU9A 1NJWA 5JXSA 1VMBA 4NA1A 5A8WB 2MY7A 5G4DA 4NCGB 4X4UA 2XZTB 4ED3A 3QFWA 4B17A 2FHJA 4J9VA 3QWPA 5K14A 1AZSA 1LXNA 1NSAA 1ZAWA 4ZVUB 4TXSA 2Q3PA 2XNRA 3PR4A 2F40A 1VK3A 2O1PA 2FYXA 2Z30B 4YY3F 2VHGA 3M1VB 3Q23A 2QLFB 3NAIA 1NKEA 4C0HA 2HWTA 3DLGA 1B70B 3CJ8A 1X7VA 3F73A 4QIVA 2VC0A 2D41A 1F9FA 1Z2ZA 3MD1A 3H5UA 2RS8A 1U1RA 4ES2A 2IBOA 5KTQA 3EUNA 3AB4B 1N36F 1U2RA 1TL1A 2YKPA 1HNXJ 2ZFHA 2C3PA 1S1VA 2JX2A 4JV5J 3BDPA 1NCLA 3WQPA 3EM1A 2BKOA 3K5NA 2MQ8A 2MLYA 4IDKB 3MZIA 4R5PB 2HEKA 2RDDA 3I5CA 3CSKA 5AE1A 4IO1A 3OJSA 3UI3A 4JBCA 5BJRA 1CS4B 1OYEA 2VBZA 1WC3A 1TKTA 1BWEA 3CT9A 5J2PA 2V0NA 3BSAA 3CXCR 1S9EA 4Q45A 1B0VA 2ZH1A 1IKXA 1HBNB 1TKZB 4OV1A 5J2NA 3DLLQ 3W65A 1SL2A 3DGVA 3VR1A 1T9XA 2OFGX 5IWAJ 2O66A 2CQ2A 1X4CA 2R2TA 4K7QA 5KG6A 3B6BA 3PJXA 1NZ8A 1WC4A 4YB7A 2YH1A 3HD2A 3CJ4A 4UY8T 2QSWA 3KLGB 2VG7B 2G0JA 3NAHA 3C6TB 4J9PA 4QU7A 2R7TA 2QSFA 2MKJA 5F8GA 3MM9A 1RI7A 5KAKA 2CJYB 4K4TA 3VAKA 4ZVQB 1HQ2A 4JV5F 1TKXA 3GFXA 5IC4B 3EVMA 2NXEA 4IOBA 2AX0A 1FA0A 4DQIA 1VJQA 1FK9B 2PIIA 2WBRA 3CDUA 2QMXA 5KFPA 1KQKA 3HXMA 1T03B 2HHQA 3IM8A 3K8VA 4RU2A 9ATCB 3W5XA 2J7UA 4P7VA 1ZOTA 2V8HA 4TY8B 2DNGA 2LQ8A 3PNIA 3IO1A 1WDDA 2WW4A 2K3KA 1KKHA 2VL1A 3V81B 4XDDA 1S49A 1L3TA 2UXBJ 1RWNB 1FD2A 1IBMF 4LFBJ 1NHKL 2W8KA 2BJ7A 3PG9A 3AA8A 4DL5A 2XY6A 3BS9A 4R0EA 2OPQB 2B8PA 4M8LA 1GXLA 5IWAF 3OXLA 4NPOA 3RBXA 4KGZB 3L09A 4OZLA 4WFYA 3GYGA 2V2QA 4B3TJ 1GFWB 2GIRA 4YEAA 1TVRA 1VLYA 5CA5A 2EFOA 2DVIA 2J0SD 3DKDA 3D54A 3EJMA 1SV5A 3MM5A 3CC7S 2B9YA 2GQ2A 5T41A 3RW7A 2W25A 5KT3A 1K1SA 1FVQA 1N5VA 1QLNA 3IRXB 4EBCA 4QW9A 2R2SA 3ZZRA 1FDBA 4Q0BB 2QA4S 1Q5VA 2HBZB 3T1AA 4QJVA 3NY0A 2BOAA 2RH3A 3SIPB 2DXEA 5EGYA 4TQRA 2R7WA 3R27A 2RRNA 2UXBF 3QWUA 1XNQJ 4LFBF 4CO4A 1Y5LB 3NGRA 4UW2A 1IKYA 3MMAB 5AXKA 2N3LA 1QUVA 3IR6B 3C16B 3M8WA 5AXMA 3BH7B 4B3TF 2Q66A 4KAIA 1RP5A 3AJDA 4B3OA 4CP5A 3R7SB 3RBEA 5KFJA 3IXQA 2H5EA 3U7JA 3MMCA 4DXLA 2I38A 3OTOJ 1KQSR 3R3TA 5MLCV 1JLFB 5ETSA 1NO8A 3K7RA 1C2PA 1WEYA 2UVRA 2DNYA 2BJ3A 4X4TA 3IM9A 1UWAA 3NMRA 1Y11A 3DRXA 3DRPA 5DDOC 4MIAA 4DEZA 4YUDA 1SL1A 4U96A 2VF3A 1CC8A 4ZPAA 2FLNA 4EGLA 4OI6A 3ICLA 2DH8A 3M6WA 3GB0A 2CWXA 2XBPA 4AE5A 4WFNQ 1REVA 2YNFB 1CJUA 4RNFA 2J0QD 3GIJA 1Y3KA 1SBRA 2DNNA 2C3MA 2HNZB 1FJGJ 2RKIA 4F2SA 1Q0NA 3W63A 2HG4A 4LSNB 1XNQF 3L7UA 4ZPTR 3HHLB 1IBCB 2W2PP 4QYRA 1H72C 3SMZA 2GVDB 3MTKA 4I0WA 3G4SS 2BE9B 2HYIB 3D0GE 4UUXA 2FPHX 3UPFA 4Y2KA 3LAMA 1RISA 2ZOGA 3NGDA 4ECXA 4WF9Q 3T5LA 3R7NB 5A0YB 2HURA 2CIMA 2XYPB 3KLEB 2E1MC 1V6HA 1QDUB 1R8AA 4E2FB 1ZTWA 2FVQA 1M5VC 2LXUA 3SSRA 3MECB 3NP5A 3OTOF 3QO9B 4HYKA 1LWXA 5BR8J 2LDYA 3HI9A 3E01A 2DR5A 4G1QA 3SQGA 5DRKA 3EXYA 2ZBRA 1F1BB 2AYMA 2B0GA 4ECWA 1VRTB 1WTBA 2CQ3A 3A8IA 3H5YA 3JSRA 4I2PB 1VR6A 3OT9A 2KXNB 4V19J 2NPIA 1BQMA 4Y2CA 5AT1B 1FJGF 4CT9A 4DV1J 1A9NB 2MZQA 4M5LA 3TX8A 5KFMA 1RCOB 3VVUA 1MU2B 1F6TA 1X5SA 1R0AA 1AYEA 1H3DA 3HCXA 3UO0A 5ETMA 1S57A 3QGIA 1SIWB 1HQEB 1UVJA 3KG4A 4CYUA 3CTRA 2AP6A 3HVTA 1RAEB 3W64A 3VALA 2B4UA 3NCQA 3FBEA 2K2PA 3F0NA 5LXYA 2YPYA 1RWVB 2XWYA 3P96A 4J9KA 3BSNA 2HQDA 2R42A 3D9BA 3G9CA 5EHHA 3GYXB 1CSJA 3CJKB 5CD4A 5BR8F 1SH3A 3ILLA 2SXLA 2VH7A 3N4WA 1TL7A 1WHWA 2YKMA 3HK2A 4DPYA 4EMDA 2NYIA 4L74A 2AEFA 3U27A 2HBYB 1NDCA 2DO4A 2IYIA 1VQ5S 3IRWP 3I4HX 1R43A 1S1TB 5HQ8A 2DGQA 5J1EA 2DEJA 4K4XA 1WF0A 3PW2A 1JXEA 2YY3A 5B0AA 4DV1F 4OYMA 2VA2A 6AT1B 1RWUA 4USUA 3IAM9 2R9LA 2JL9A 1EP4B 5KFYA 2DPJA 5B08A 3DXBA 5D4NA 2G2ZA 2JC0A 1UW9A 2DR9A 2KDOA 4LMZA 2WVEA 1FESA 2QIFA 1SKWA 4P2SA 1D8ZA 1YSJA 2CVEA 3NS7B 2QX0A 4FVCA 5KFSA 4I68A 3VQSA 3QSYB 1S76D 5I42B 4NZ6A 1M1GA 1H2TZ 3PRDA 3DM2B 1SQEA 1KTQA 5C42B 4NLSA 2V68A 1AT1B 3FMBA 3JAMY 3GR1A 2IBKA 4U9RA 5FLXY 2H9ZA 2YNGB 2R7RA 5DGBA 1HBUA 3CF5Q 3KJNB 4JV1A 4CM2A 4CZCA 3H2UB 5A8RA 2IMWP 2R8JA 4M95A 4CCHA 1XN9A 3IGVA 1ULRA 1H2UX 2C3YA 3BR9A 4PUOB 1A0OB 4WK1A 5CZVA 1KLMA 4C48A 2C42A 1QAJA 3G6VA 1T9WA 1NH7A 4NA3A 1NPRA 1Q7YT 1T7PA 2ZJQQ 3DRRA 4ILLA 3GCXP 1UW4A 3MCMA 2VFSA 4ECVA 4UY85 4JI0J 3KHLA 4CH0S 4ETXA 4USIA 4LF4J 2ADBA 4X65J 1PCAA 4DU7A 3D6MB 4RBUA 3K5MA 1N48A 5DDRC 2G2YA 4DQSA 3VGUA 4WKRA 4N77A 2LQBA 4KO0A 5RUBA 1WKKA 1A7GE 3HJVA 2WOMB 2W24A 4FYXB 3DXSX 3IA0A 4M63A 1X60A 1TAUA 2HHVA 1OY9A 3M30B 3ZTSA 1RWWB 1Y00A 2PMHA 2K8GA 2VDHA 1VC6A 2BJ1A 2C2DA 1JWWA 3P5TL 1HYSB 2UVVA 2HMIB 2IC3B 2L3MA 1KOHA 5J2MB 4DMZA 2EC0A 4YP3A 2IJNA 4G6VB 5IQ6A 2BANB 2AT1B 3CJSA 3OW2R 2YTCA 4AYBD 3LAKA 3FEXB 4O3OA 1YJ7A 1X4EA 3NRBA 3TOQA 2UP1A 2E44A 3L9ZA 3WIVA 1GMWD 2ZKTA 3WBZA 1RTDB 2CPDA 5IT4A 2MY8A 2Q6CA 2CNKB 3QRRA 1WHXA 4UOHA 4EU0A 2E7WA 1TMJA 4JI0F 2FUG9 3ENAA 2DR6A 4LF4F 1F5BA 3IG1B 4KT0C 2KVIA 4O4GB 4DFKA 3KYLA 3G8TA 5KFRA 1UJ5A 3ENQA 4BC7A 4X65F 4PQUA 3HFKA 3EGWB 2ZD1B 4XAKA 4BS2A 1S0OA 2QA1A 3ITHB 3H2LA 3NWRA 1KDNA 1V5IB 2WSFC 3AD7C 4O0IA 3UE2A 3I6PA 2RIJA 1NPPA 3IS9B 1YBUA 1MW7A 2DT9A 5B0CA 2BJ9A 2F1FA 3IBCB 4YR3A 2DTJA 2CQDA 4QIWD 3MM8B 2IMOA 2LEPA 3KLFB 3VCDA 2HHPA 4N8OA 2JDJA 3J80Y 2YNIA 2DISA 4KKOA 4R25A 4C98A 2BZ2A 4NX9A 3UDEA 4JV0A 4LVOP 1PAEX 3MAQA 3KKFA 4KB7A 3ZZ0A 5H9EK 4RW7B 2UUWA 3MR5A 2GIQA 4GVBB 1U25A 3H5SA 4OX6A 2BV3A 1RTJA 2DRBA 2QGFB 3D2WA 3M4XA 4ECQA 3ONQA 3DN9A 1ITPA 4PYAA 1CC7A 1TELA 3TYTA 3PRVA 2VG5A 3FCWA 2W1BA 4CNZA 2R8IA 1DURA 2A6OA 2Z2MA 4JI2J 1M5OC 4DG1A 4DQQA 3EZUA 1FO1A 2RQMA 5LMNJ 3RR8A 1S48A 3BKUA 1YBTA 2J9DA 4JOUA 4WK3A 5HI7A 1OYDA 3H8YA 4C7QA 1IQTA 2YWEA 2MKHA 2F9JA 1EKRA 1H73A 4OZ0A 5AE3A 4CTAA 3S01A 3HSJA 3UDVA 3TZZA 1RHKB 3DGPA 3HHDA 4AFFA 1RAGB 1RT4B 3WX4A 5F8NA 2OMOA 2E66A 2M5YA 1NM2A 4M5IA 3H40A 3A3PB 2W4CA 1G1XA 1M1HA 3ETOA 3TNVA 1UVKA 3GMGA 1E6VB 1FEHA 1RACB 3M32B 1G6BA 1S7IA 2R7VA 3V4IB 1RTZA 1T8EA 3CJ0A 2CZ4A 4N47A 2CQIA 3MCSA 1FDAA 1DQ8A 2HNDB 3UCGA 2OGUA 4LVNP 2UUAJ 1XWLA 2C2KB 1D0EA 3MPDA 1HL6A 1FFWB 4JI2F 1CJKA 4FNHA 5LMNF 3H42A 1MN7A 1PSDA 4ZPWR 2HS3A 3MEDA 2RQCA 1M90T 2ZZTA 2PI5A 2RAQA 4XDCA 3MR2A 4HHJA 1REGX 5K14B 2K06A 4KFBA 2PC6A 4HI2A 2NCKL 1X4HA 2VFTA 4DPXA 3FC9A 2ZHAA 2GJIA 3N9UC 3EMTA 4OYOA 1IJEB 2AJ2A 1VQ4S 3ENWA 4HH1A 3P5BP 3SZ2A 3NBPA 3VZIA 4OJ3A 4J9LA 2MJUA 2JSXA 1FKOA 1FRLA 3R5BA 4XO0A 2P6SA 1EB0A 1ZM3A 1TL1B 1Q82T 3VGSA 4P9SA 1S1VB 5J2QA 1ELOA 4HACB 3JYTB 1LW0A 2D1CA 2BW7A 4IRCA 3VGVA 3QZ7A 2W9CA 3P45B 2NXCA 1X4BA 3TJAA 2EFPA 3BGUA 1J2VA 3RRGA 6FDRA 2CJ9A 2UUAF 2Y1IA 3GFYA 3PHEA 4F4KA 1TKTB 3W66A 5DJBA 3OLBA 5J2PB 4OI0A 4CDIA 5GAHU 4PXBA 4O44B 1OS5A 1RTHB 4Y34A 1SKSA 2I8EA 4IG3A 2XMJA 3VAGA 1JXLA 3AHPA 1NJXA 2B6AA 5C2CA 2BE2A 5KG4A 4EBDA 3ENVA 3OL7A 4F4XA 3WDOA 1TV6B 3PW7A 2CPFA 5CD4H 3BF4A 5B0EA 1DTTA 2WAQD 4RW6A 3MOZA 1UEUA 2L41A 2DY9A 3GJSB 2AHOB 4I67A 4F4ZA 3MM9B 4O4RA 3FQLA 4MK7A 4IFVB 1UA1A 2MZSA 3TQEA 5EWGA 4HR2A 4C8OA 2FDNA 1HWKA 5SZTA 1NK6A 5D0HA 2L9DA 4WWSA 4ZPBA 1DZ5A 1HHSA 3SV3A 3W7BA 3LA0A 4DCPB 1U1OA 1KFDA 1VGYA 3KJQB 3W8GA 1DARA 2P9CA 4I7FB 3BBBA 4WYWA 1Q8LA 3BPSP 2A3JA 1S72S 4ZLLA 1IKVA 3I87A 2N4DA 1I51B 3OSPA 2CYYA 1NLKL 2QLXA 4OYZA 1WSRA 2HFZA 1O5JA 3QIPB 1MROA 4I6WA 1D3WA 1UFWA 3SDEA 2XYGB 1GMWA 4OLPA 2QO3A 5EWEA 3ILIA 2Z2ZA 1X9SA 1XTZA 3DLKA 2R2RA 3H4BA 3JB9k 2R8GA 1IKWA 2LQ9A 4IH5A 2IAJB 1NU4A 4I2QB 3LH2S 5JVGQ 4WKYA 4HI1A 1SV5B 2YH0A 1GQEA 2JEFA 3US5A 4PG8A 2I0XA 2IJRA 2F7VA 4JUZA 4LSLA 2GHPA 4ECTA 1XBWA 4ZP9A 2ILZA 3ELHA 2OPPB 2R7XA 3I55S 2PEBA 3ISND 2MYFA 3LP2A 5A76A 3I82A 4ZN3A 1S4FA 4ES3A 4LREA 4ZLJA 4S0MA 3KK3A 2YWKA 4PABA 2EXUA 2QE5A 4IG0B 4QW8A 2JLFA 4DZ6A 4PG4A 3QBCA 1G4CA 1VQOS 1RLCL 1H0HB 2XNQA 4ED6A 1R6YA 3GIMA 4A8QA 4K4WA 4B3MJ 1IKYB 3MMBB 4QU6A 2ZBQA 2QMUB 5C24B 4FVMA 4F3MA 4USTA 2VA3A 3VTIA 4KRWA 1Q78A 2K1RB 4KIAA 4PEOA 2MDAA 4HTJA 4WIIA 3OL8A 3LP0A 1EQ0A 2HQ3A 1XJWB 2ZBIA 3SQOP 5B0FA 1SUQA 1N6QB 5HJXA 1C4AA 3DRPB 5F9LA 2V8DA 1KBRA 1RU2A 1WTFA 2AIRB 2GHVC 3UVJB 5HK4A 1EQMA 3R7BB 2DNMA 3BKTA 1FKPB 3MFHA 1RGVA 2G1HA 4F25A 4RW9A 1QTMA 5ETVA 4ED5A 2RKIB 2PA8D 4H4OB 4ZPCA 4KBIA 1KSPA 3KK2A 4ZHRA 4W90B 1NZAA 2CPXA 2EG2A 4PPDA 4PWUA 3OUYB 1JLBA 4OZ1A 1JKHA 4I1TA 5T7LB 1RBOB 4B3MF 1RQ0A 1RHQB 1DTQA 5DG8A 4DX8H 1XERA 3OFEA 3N01A 2VJUA 1FNOA 1NJZA 2KT2A 1MSWD 3MM6A 2CQPA 3IFEA 2QZ8A 1HMVA 5DETA 3UN2A 4UUWA 1T02A 3BGOP 2Y3YA 4IH6A 4HVZA 3HMJG 3E01B 2AJQA 1RXOB 3GIKA 4XTTA 5AE2A 1LW2B 4CLUA 1FVSA 4LUBA 4H4MA 5KFNA 4MMOA 1YIJS 2UVWA 3AFGA 2VBWA 4LBIA 4YB5A 1XR6A 5DS7A 2IA0A 1AUSL 3PM9A 4DFPA 5MAOA 1RABB 4ICLA 3CEDA 5GAHI 4TYBA 1Q7LB 4DPUA 2EW9A 4M5GA 4DPWA 3W2VA 5HROB 1HHTP 1VBXA 5KFTA 4NLRA 8RUCA 1EARA 2DY1A 4ELVA 5KFXA 3S7RA 2KI2A 5KFLA 2P9GA 4OZJA 3NEKA 3OQ2A 4X4SA 5GMDA 4CYUB 3O3LA 2H4WB 2DYAA 1UEKA 1M5HA 1YLXA 3DNCA 3AXKA 4Q44A 2B9XA 1WHVA 1I5OB 2XLJA 5F0WA 2V9KA 3MF5A 1FX2A 1ZTTA 4YOEA 3NGKA 3CUNA 4YB1P 3ZTOA 2Z2LA 3R6GB 1S9GA 2V8VA 3N0VA 1BMQB 4BWJA 5HP1A 4PWWA 1FJEB 5G0RB 3CO0P 4U67Q 2OIHA 2FHOB 4BBYA 1VC0A 4DF4A 1UWBB 2YX4A 4Y28C 2LYVA 4CLYA 2NQPA 3HFZB 4LF5J 4ATNA 1IR0A 1VBZA 4LBHA 1NPKA 2B5JA 1CULB 3CCVS 2QFIA 2NXNA 4FYYB 1RAHB 2DGOA 1ZETA 4I56A 2W2NP 2AD9A 1NMEB 2J6TA 2P8IA 3OSNA 2CNNB 1KONA 3PVXA 2DHSA 4R8UA 5IFMA 1F5CA 2BKNA 3GSIA 4NLVA 2EKYA 2KJWA 4OJGA 2K7KA 1K0VA 1HNVB 1SKUB 1X5TA 1QSSA 1V3ZA 1ZAVA 1PJ7A 4ZP7A 3ULHA 1YX2A 2RU3A 1T11A 3TVZA 1RAFB 2ZH6A 3ZO7A 2C2EA 3CD7A 1NK4A 2HFUA 1BQNB 4OHVA 2XB2D 2F5GA 3TQ1A 2W9AA 4C8KA 1C0UB 4PZVA 5IC6B 3NGUA 4DLGA 1FRXA 1MWQA 1XC9A 1TQLA 4FF2A 2RRBA 5HVHA 1F0XA 3Q8VA 3ZTPA 4LF5F 3A8EA 4LRDA 5HANA 2FJXA 2XS5A 5CYQA 3IWLA 4YFUA 4AXJA 1BGXT 2Y1RI 4KH1B 1F9EB 4G65A 2G0CA 2LU2A 2AJ4A 1YKWA 3UD5A 3SFGA 2FC8A 4DSKA 4C11A 2OI2A 2HHSA 2RHQB 2DGSA 5CZXA 5HATA 3DHWC 3MPWA 2KJVA 2BMBA 2ZVIA 5I3QA 2HLTA 2CRLA 5HQMA 2PN6A 4OZ5A 4RU9A 1CEZA 2Z57B 4K59A 4MTPA 4UT4A 1FFGB 3D0IE 1XR5A 4KO0B 3DRSA 3JQJA 2YQ1A 1KQFB 4WU2A 4X4RA 3CD0A 4P7TA 5KFAA 1GTHA 1YZ7A 2MKSA 5KT5A 1RWKB 4QBUA 2F4VF 3NCPA 3QLHB 4QR1A 3TO8A 2GZOA 2XSFA 2MZJA 2W7AA 3G71S 3VZHA 2KT3A 5DQHA 2JHEA 2X1FA 3QRPA 3JTNA 4IH7A 1ZBTA 1R31A 4BHQA 3A8JA 5LMUF 1RKJA 1J5EJ 4F4WA 4ENOA 4LIWA 2GVZB 3C14A 3TWZA 3LANA 3CCRS 3I5BA 2E29A 2ROEA 1U7LA 2XM3A 3T5HA 1KS2A 1HA1A 1ZYQA 3E8OA 2UVUA 3CMQA 4NLGA 1WI6A 4MJKA 3DDKA 1NUEA 4ZK7M 3Q8PB 3ISZA 2F9DA 3ADAC 2OSRA 4YN3B 4EO6A 4FDFA 2UU9J 1ACMB 5AJ3J 4AXIA 2JNJA 1RHMB 1VQ6S 4MYTA 2VPXB 1NRKA 2O5DA 2V6AA 2J7KA 2AYEA 3R6LB 1YJNS 2E5LJ 4ZVFA 1MMDA 4NRTA 4IQMA 4LIRA 5L1LA 3SCKE 2X1GA 1HBOB 5E41A 1HR0J 1RHRB 3S6EA 5C7PA 2AZ1A 2RJZA 2FHKA 2BJDA 3HT3A 3ET6A 2OFHX 1J5EF 1FRMA 3QNWB 2Y0BB 4IFYA 2CPHA 3MUVP 4CM0A 2KN4A 4ZJLA 2HVIA 1HNIB 2E5IA 4ECYA 3GE9A 1TUGB 1TL3A 4ZJQA 2HHHJ 1FT8A 5ETRA 5IQQA 4FPIA 3RUBL 2HZAA 5B0GA 1VQ7S 4DZDA 4RX6A 1N0UA 1TK8A 4F2RA 5BYRA 2XGQA 1D9AA 4DL6A 2BRKA 2I9SA 4H4KC 1P9QC 1KHVA 2UU9F 1N88A 2ROGA 5AJ3F 3IMQJ 1U2CA 4V1Ak 2HRYA 2XSJA 1KOOA 2BJ8A 3JXOA 4O3SA 3ZZPA 4P75A 4V19X 2D3O1 2HVEA 2HHUA 3GJRB 1T9VA 3FBBA 2DNQA 3CVKA 2E5LF 5FDLA 1N0VC 3VQTA 1HPZB 3UW1A 3D3BJ 1WUUA 2EEYA 2WBMA 1I6JA 2ALZA 5HVGA 2MQNA 3W2WA 3CD6S 3M8PA 1HR0F 2C3UA 3DGPB 1V3RA 1RWMB 1YJVA 1HIYA 5DG7A 4MKVA 3QQCD 1BE4A 2ZH3A 4F04B 5H1SV 5KG0A 2V5HG 4IQXA 3D1QA 1FDDA 4RKUC 2KG0A 3Q2SC 2RSQA 4C0OC 2G4BA 3L95X 2Z2YB 2C2OB 1J5OB 1L5UA 3UD4P 4RW8B 4FKYA 1NK9A 2FJVA 2FY8A 1LK5A 3OR2A 2Y0SD 4O3QA 2BRLA 2HHHF 2HZCA 4LFCJ 1HBMA 3EGVA 1SJ4P 1S4EA 2WVCA 3R5JB 1WKJA 1RYSA 1U47A 3MAAB 4DLEA 3CD5A 1YQHA 1U6BA 1C1BA 2FHJD 3WHIA 4GO5X 3W3SA 3B82A 2OH2A 2KG1A 1ZZFA 1FRIA 2BEFA 2NUHA 1P1TA 4NLQA 3FFIB 4P6QA 4KQZA 4RUBA 2H65B 2HVDA 2D9PA 4USHA 1IBLJ 2OTJS 2MHNA 3C6UB 1JK9B 2FJAB 4M5DA 4F02A 5DDQC 2FGOA 5K20B 2V69A 4M1KA 5D8HB 2LKZA 1XNRF 1VIXA 2DGVA 1JB0C 2M8DB 2GGPA 3PYFA 5CABA 4NWBA 5KG3A 3NBPB 2B56A 3I9V9 1SB6A 1FKOB 3MAHA 4I69A 5KT6A 3UR0A 3R8YA 3T1YJ 1DLOA 3FNNA 1TP7A 5KFIA 2DHXA 1RT3B 2YKNB 2CPEA 1EIYB 1MN9A 4EWTA 3QJJA 2W9CB 4LFCF 3MEEA 3QRQA 2CDQA 3FVYA 2FZKB 3NOGA 4URQU 3T5JA 2RT3A 3C46A 2QL7B 1GXTA 2C1EB 3HHEA 2M52A 1L3KA 1FE0A 2GMLA 1WF2A 4WE1B 1L3UA 1N33J 3DI6A 3D0HE 2Z4PA 5LOQA 1X5PA 2CNOB 4CI0B 3M6VA 3JAMU 2BYCA 4IG3B 1ZM2A 2N7CA 4XPEA 5FLXU 3R1LA 1U1NA 1FNXH 4NLOA 5D4PA 2IVFB 1GAOA 4ZIWA 1C1CA 4DSLA 2BE2B 2XCAA 2EBEA 4OHYA 5GMEA 3R9LA 3M2UA 5EX3A 1IXKA 4B9VA 1VHIA 4P2FA 4IUFA 2MLXA 4PR6A 3HKZD 4FZVA 2J6SA 1HW8A 3QAUA 2HSEB 4DS4A 3CJ2A 3T1YF 2GQCA 3BR8A 5GVQA 3RAQA 1IQZA 2KFNA 2BVZA 1WC1A 1AXQA 5FIIA 2HWHA 3CNQP 1YK9A 4EZ6A 2J8AA 3UDCA 2V4QA 4NMXA 1NB7A 4WIQA 2DRDA 5KFVA 2HQCA 4RZRA 1C0TA 5KFOA 4ID5A 1N33F 2DNOA 2FLOA 1D1UA 1UL3A 4B02A 5K9FA 1T9UA 4DN9A 2CVIA 3OLAA 1HI0P 3IWXA 1SKRA 4DV5J 2BJEA 2HFNA 3T6JA 1JLGB 3EXCX 2X51A 3I0RA 1H7WA 3GPAA 2XS7A 1U02A 2YKAA 2YNHB 1Y5IB 2ZE2A 4WZMA 2ZDOA 1S9FA 1KVJA 4KR0B 1VBYA 4PXEA 3J81j 2XLKA 3DLKB 4UZCA 3WC2A 5HQLA 3BQ1A 1EETB 2DGXA 3N5FA 2NLWA 4MK8A 3AODA 1E6YA 2RD5C 2FJEB 2B43A 3M7VA 4X4NA 4NASA 4MIWA 4GKKJ 2DJWA 2A10A 1O6XA 3ILJA 9RUBA 4DL2A 1V5VA 2CQ1A 5ETLA 3HM9A 4IYQA 1NK0A 3KJVA 3EDRB 1JX4A 5DDPC 1MLAA 2XMVA 3NXZA 2ZITA 2E5JA 3KMSA 3KK1B 5DG9A 2HIQA 3VGTA 2MKKA 4F50A 2V4RA 3K0JA 2V4JA 3BZQA 3TANA 1Y9OA 4DV5F 4WZQA 3OFFA 3D6FB 1EKSA 2FZCB 2V8PA 2Z8QA 2QA4G 5HN0A 2DR8A 1RJJA 3FRYA 2RILA 1KEKA 3JSBA 4N41A 4R0JA 3J80U 1Y3JA 4OHWA 4GMKA 4PPZA 4ETZA 3LP1A 3GV7B 4A46A 2ZVSA 2IJFA 1BQXA 2AJ0A 4F4YA 2ERRA 2FJDB 2VIHA 2QRRA 1PILA 1HARA 4C3MA 3DMJB 5K8OA 3DDIA 4OMFG 2V63A 4NMLA 3T3FA 2AYBA 1RT6A 3KG1A 1GMUA 2H54B 2I6WA 4B9LA 4ZCMA 5C5JA 2Y1JA 2GO9A 3POTA 4RW9B 5L1KA 5I4MA 2MZTA 1LV5A 4ZHRB 5A8WA 1N5YB 3V6KA 2XMMA 1JLBB 2MQLA 4MIBA 3PFOA 4NXMJ 1HI8A 1U8SA 3MR7A 2AZ3A 5F3ZA 1JKHB 4LRCA 4PAAA 3CDAA 3PO4A 5E3QA 3P49B 4KJIA 1YRUA 4OV6A 1OSCA 3MM6B 4DHVA 4YMEA 2ZJPQ 2XO7A 1HMVB 3CCMS 3BREA 3RJMB 2KB2A 5D3GB 2BR0A 2KKHA 1URNA 2X1BA 3T9NA 1QAXA 5HBMB 2LVWA 2X7IA 2ZNZA 4IDKA 1JLEB 1K0TA 2BQRA 3EPGA 5CXTA 1UP1A 1K73T 1VFJA 1KD1T 1JJ2R 3PKYA 5D77A 3U1MA 3BDEA 4MKAA 1CS4A 1XEZA 3Q8SB 5E33A 3TJ9A 3BGRB 1FFSB 3W2VB 5KFCA 4DCOB 2LA4A 1VK8A 1HBNA 1TKZA 5KFUA 1NXIA 1TK0A 1RUSA 4ZVRB 3K89A 4NXMF 5ETQA 1GX6A 4ZCIA 2CFXA 2Y1LB 1KNZA 1A6LA 1AW0A 1N52B 2F65A 2PE8A 3GZ7A 4QWCA 3HPOA 3AQOA 5IT9Y 3CB4A 1SJ1A 1X4DA 3KLGA 3OHAA 1S59A 2VG7A 1VBKA 2IVMA 3BBFA 5HP1B 3C6TA 5JJBA 3OPKA 1HNZJ 2ZZNA 1IBMJ 2B7CB 4K4ZA 1KRPA 4USVA 4J9MA 2XMKA 2HVHA 2UUCJ 3ILOA 2XO6A 2ZHOA 3MFIA 2CQCA 2BABA 4HT7A 2VU5A 5A8KB 5C25B 1O8BA 2QT7A 3GQCA 1NK5A 3PYEA 1ROFA 1FK9A 1FEEA 2ZH8A 4EYIB 3PO5A 1T03A 4ZVHA 1F2GA 2WB1D 3MEGB 5DZ7A 3GTYX 3BEGB 5E3CA 4Y2MA 5D6GA 4RBTA 1X4AA 2E1AA 4E8UA 4TY9A 1VIOA 3AD9C 3VV2B 1RDRA 4PG7A 3V81A 2CPJA 3QYYA 3VF0B 1ZM4A 2W01A 3HZGA 3MPVA 2IA6A 2AX1A 3LWLA 2BXJA 1Q86T 1RWPB 2OPQA 4CQ1A 1K47A 3KLHB 3BKFA 5HMYA 2XGPA 1KC8T 4DV2J 4J9UE 3P8BB 3OR1B 1VISA 1GXUA 3PJWA 2ZEJA 3EVOA 4N8NA 3PX0A 3UNGC 5KFHA 2FZGB 2FVPA 4DV6J 3AY0A 1HNZF 2V2VA 4B08A 1FF2A 3UD3P 1WSVA 4E0DA 4ZPVR 2UUCF 4JI4J 3FSXA 2RQKA 2X3GA 1Q81T 4OYXA 4DFMA 2VG6B 3HSZA 4Q0BA 4X2BA 4JI3J 4PWDB 4LQ3A 2E5GA 2DNLA 5CYQB 4GRSA 2X3DA 4MAKA 1UVLA 2VJVA 2BDPA 5LSLA 3FCHA 2R4FA 4C9DA 1NBEB 3HVRA 4ZA1A 3PDNA 5LL6d 3Q24A 2MGZB 3GCWP 4ZIVA 1X8DA 3KNAA 4ZJOA 4DPTA 4QIGA 4L73A 2WB4A 5L1IA 2PFDA 5HL7Q 2R7OA 1U6ZA 2ADCA 4U8VA 4H54A 2VPYB 3DOLB 4U7UK 2XHWA 2OPRB 4DI6A 2CAJA 4A8MP 3MMAA 4DV2F 4OL8A 5IOLA 1K1QA 3DOKB 1OSDA 5FD1A 3WZ0A 3C16A 3V6DB 5J1NA 3GIRA 4LRBA 4PG5A 3TARA 1FDNA 1W2BR 1U49A 5CCMA 4DV6F 2IM1A 3O6QA 3CPWR 2W4DA 1DHMA 3Q8YA 2HFVA 1LQ9A 3UR3C 2I2YA 3N5BA 3B4MA 1QD1A 2DHGA 2XULA 4JI4F 4P52A 2QLJB 5HJYA 3OFHA 3MXHP 3KUHA 1D9DA 3CE8A 4JI3F 3BYRA 3GG0A 1BUXA 3EX7B 2J0XA 5KFEA 2KT5A 4WJBA 3TUPA 2PFFB 1U0HB 4PCQA 4ED0A 2YNFA 2M9KA 3K57A 1T3OA 3TAMB 2HNZA 3QGHA 3RZAA 1HHQA 5IT0A 4ID8A 3FEYB 4LSNA 2ZOMA 4KYZA 1Q5YA 1JIHA 3ZFVA 1UFKA 2CADA 1S6OA 2Z56B 5K8PA 3C3LA 1TU0B 1M1KT 1KN6A 3VAHA 1DRZA 4AL5A 2OKQA 2PMZD 2FGCA 4CO0A 2QLWA 1WJ9A 4RNMA 2HLUA 5A0YA 3BV8A 2R8HA 3KLEA 1AROP 1FXLA 3QFHA 3I5AA 1CJTB 2HQIA 2XI2A 4Z7CA 4C8MA 3QO9A 1B4SA 3O1LA 3ZXWA 1HFEL 5ETOA 2ZZMA 3TUIC 1VC5A 4AT1B 1WOSA 1FD8A 3EICA 1NDLA 1UZDA 1JJCB 1RAJA 4RLEA 1FE4A 1VRTA 4Y0FA 4I2PA 2GV1A 3W61A 3AAWB 3QATA 3H98A 4ZVTB 3N6NA 4DSJA 5KT7A 4MH8A 2AEJA 1OQ6A 2CPZA 3HSDA 3RB0A 3KHGA 4DV0J 1MU2A 3PXGa 4RUHA 5LJ5Y 5KOXA 2HQFA 1SC4B 4B9MA 2PEHA 5ETTA 4P71A 2C2RA 2RRAA 2EG1A 4X4PA 3DYAB 1O51A 4MYUA 4LJMA 2UZAA 4X62J 4LFAJ 4LF6J 3R5AA 3T41A 5ETPA 3CDWA 1FWKA 4QIEA 3DOMB 2Z58B 2Q1LA 4DR6J 3AXMA 3PKMA 3DDNA 2IRXA 1RT7B 4OYAA 5H9EJ 2HS4A 5BYQA 3QAEA 4O3RA 2J0WA 3CJKA 3CWJA 1WKLA 2DHHA 2EI5A 4W92B 1S6PA 3ZTRA 4DSFA 5L46A 3IBWA 4ILMA 2BOPA 5DQGA 1IWAA 1N5QA 5HSPA 1RA7A 2CQ0A 2XMTA 3GJQB 2NSCA 2VFUA 3DLBA 1WEZA 3PACA 2D3OR 1QAIA 2LU1A 2F3JA 3BO3A 1YJTA 4OZ2A 1P27B 2RF2B 2V94A 3LF0A 5D0GA 2WCXA 2ROPA 2BM0A 1HBMB 1TMMA 2KYXA 3OVAA 4DV0F 2IVYA 1EP4A 5E3PA 1H38A 3TX0A 2XY7A 1YDLA 2AGPA 3TZYA 2EBGA 3IWNC 3M9OB 4FXVA 2B8QA 4QZVB 3PR5B 3C66A 5HMWA 5F9NA 4OIXA 4KH0B 4FYWB 3I4PA 5H9FJ 4J90A 5I42A 1VQMS 3JQMA 4CT8A 4ITSA 5K8MA 4X62F 3G2XA 4LF6F 4LFAF 1J27A 3R1HA 5C42A 4NEYA 4Z2XA 4LF8J 4UOCA 1BHNA 3TW0A 4M5DB 4FPRA 5KFKA 4DR6F 5IXUA 2GC8A 2YNGA 4LF7F 3A3OB 4RW4A 4FS1A 2CUYA 3HVAA 3HFVA 1SQGA 1JLAB 2U2FA 4K2XA 2W9BB 3M9NB 2AGQA 2G1DA 2OMLA 4FKXA 2E5HA 3SCIE 2ZH5A 4RNOA 2BACA 2BUNA 1VQYA 3K5OA 1DLOB 1LXJA 5M2PA 4NLDA 4PUOA 3GSDA 4Y3CA 2HGMA 1PC5A 3FZ2A 3ISNC 2DNKA 4DR4J 2PI4A 1KTVA 3W60A 3PW0A 5B0BA 2KO1A 4PKDB 4ED2A 5DQIA 2ASDA 3KJFB 3JSYA 5IV3A 4HHUA 4KPYA 1YVFA 3D7SB 4GO7X 4EBEA 1T94A 4OHZA 1S99A 1JNZB 1HQUB 2Q43A 1S5ZA 3OFGA 2CJXB 4Z37A 2KM8B 3KTQA 2MSSA 3RBDA 2JVRA 1WC6A 1WACA 2FHMA 3I0SA 4HL9A 3QT6A 4LF8F 2BX6A 4MFBB 1HLWA 4QIFA 1C1CB 1TL4A 2WOMA 4HH0A 1RT2B 3IC1A 4C3LA 4F0MA 4OI2A 3M30A 1LWEB 2CPIA 1T3NA 2NPFA 3KMQA 1YWXA 3CCTA 1JLCB 2PT0A 2HMIA 3AB2B 2IC3A 5J2MA 2HGNA 2IRYA 2BANA 3SFUA 2ZUGA 4K4SA 3TZXA 1RU1A 3HHLC 2AV5A 3T5KA 3K17A 4NLTA 1U1KA 2H5JB 4DR4F 2CA9A 2QL5B 1RTDA 2ASJA 4ZP8A 2VQEJ 3E3XA 1WD6A 1I3OB 3KDOA 3BBCA 2NSBA 2CNLB 4B3RJ 3TI0A 4TVAB 3D3CJ 1KQGB 4K5RA 1NDPA 1GH8A 2HZVA 4KGVB 2WONA 1YJ9S 1N54B 2FLLA 1S12A 1RBLA 1WC5A 1U1MA 1C0TB 4USMA 2AU0A 3G82B 1G2EA 2ZD1A 3JSMA 1D9FA 2H5IB 1RTIA 1S1WB 4KC5A 4UOGA 2VBXA 3ITHA 3UCUP 3ETMA 2CWKA 2KYZA 3CCLS 3DLEA 4J9RA 5DLFA 3GILA 3EWGA 4K2JA 2C28A 2JEJA 3M2RB 3I96A 2R8KA 2AJFE 3I0RB 3IS9A 1VQPS 1S7HA 4F36A 4FF4A 3SBMA 7AT1B 2AEMA 1F3FA 4ELUA 2IIHA 2E7XA 3TEHB 3TZWA 3MM8A 4QYZK 2ASYA 1WI8A 3B8HA 4OLOA 1T05B 2MHEA 2M4MA 2RHSB 3UNYA 4LSZB 4Y2IA 4Y00A 3PTWA 1N4LA 3C2PA 3HKWA 1VHFA 1ZZNA 1R0BG 2VFVA 1R27B 1MG7A 4OQJA 4N7TA 4RW7A 2VQEF 4ZDNA 4GVBA 2XI3A 4B3RF 1VRUB 4NCBA 3W9JA 4URGA 1R7IA 4WP8A 4QWEA 4HKQA 2LQJA 3O44A 2N3OA 2LFVA 1SC1B 3M8QB 2BE7D 2HFOA 2LP4A 5BXIA 4AL6A 2MKIA 1RHUB 1MMLA 4Y6IA 2OPSB 4YDXA 4UF4A 1LEOA 4PQAA 3FKBA 1KLNA 2CJQA 4ZVOB 2DPIA 1SQFA 4ER8A 4CO3A 5A6WA 1RT5B 4JI5J 3ZNUA 1DJ0A 5KFBA 3QT5A 1RWXB 1Y0HA 1RT4A 1TKDA 2WW8A 5KFZA 1U1PA 2KL8A 1I94J 3CDBA 2RNEA 2DEIA 1OIAA 2KFZA 1U24A 2KTQA 1E6VA 1MWZA 5CQGA 3M32A 3UN3A 2IHR1 2O01C 3H20A 2YXLA 4J37A 3CCJS 4DL4A 1KWMA 4NI2B 1UFLA 4P74A 3F44A 4N5SA 2D3ZA 3QT8A 3PYDA 1IJFB 2HNDA 2DITA 3BJYA 1TUWA 3PCOB 3POTB 2V34A 4DPOA 1IUJA 2AYGA 1RT1B 1S6UA 2JZ5A 5GAEI 1B0TA 1VI7A 1VOMA 2YBVA 1CJVB 1OJ4A 2IFXA 4HT5A 5CYMB 1JLQA 1S77D 3T6BA 4DSEA 1TR0A 1T95A 3THTA 3GFZA 4JI5F 4HLBA 3HT0A 2GO8A 1UJ4A 3GONA 2KM8C 1P6TA 1V3SA 5HLFB 4O23A 4F3OA 1VQLS 2OUGA 4FN5A 1I94F 1SJ3P 2GQQA 1VCTA 5A6PA 2OD4A 1IM4A 1DY3A 2QJ3A 4ED7A 2E1PA 2VOOA 3R5GA 1W26A 1AZSB 4ZS6A 1U26A 2E9ZA 4KHPJ 4HACA 3JYTA 4CLFA 2CPYA 4Q5VA 4ED8A 4F0HA 1EAYC 4USKA 4TU9A 1CG2A 2V50A 3DLGB 4D3GA 2MLZA 3DU6A 3IN5A 1R89A 4C3KA 2V9WA 2CQHA 3HDSA 3D5MA 2MKCA 5E2QA 4O44A 1RTHA 5KFQA 2D74B 4ZVSB 4ZKAA 2KZMA 3RR7A 3Q22A 3G6YA 2HGLA 2GMHA 4A8FA 5F8HA 1TV6A 4LR9A 2CXEA 5F3TA 5IZHA 2V2ZA 3Q89A 5IM0A 1S9EB 2VOPA 1SPBP 1RAIB 1OPZA 1NEEA 2C2ZB 1IKXB 1WHYA 5J2NB 4YHHJ 4A8KA 2DGUA 4IFVA 2K7JA 2DIVA 1FRJA 1HNXF 2GS8A 3V5RA 4KHMA 4ANCA 3NLCA 4KHPF 1QAYA 2OTLS 2FVSA 3NGSA 3MM7A 3DU5A 5L9XA 3CC4S 3PJ9A 3AA9A 2IPOB 3A12A 3DC2A 4OZNA 3CCES 4ES1A 1W25A 4I7FA 4QR2A 4ZLNA 3ZTQA 3J7YU 4L6V3 4BWMA 2D69A 3LQVA 1TKXB 1JJHA 1WG4A 1IR2A 3P3DA 2IRUA 4AQYJ 1RBAA 1EZZB 4NLYA 4CH1A 2RDJA 3J81Y 1NJIT 1N8RT 3EPIA 1B7YB 4OYBA 3KHRA 4QPTA 4DV3J 4ED4A 3QIPA 4IO9Q 4F67A 1PG5B 3NOCA 2BBEA 1PBAA 1YJRA 2JH3A 1FWPA 2CQGA 2APOA 2LQ5A 3CW2C 2MQPA 5IS2A 4OYPA 2IAJA 4I2QA 1YHQS 4DX7A 4YHHF 3DRYA 1RAOA 4FBUA 2QYGA 2FC9A 1QE1A 1UVIA 3SI8A 3C15A 4X4VA 2NYHA 1LK7A 4WFAQ 4UQTA 2H51B 3RBZA 5K8NA 4DX6A 1Q16B 2NS1B 3BPDA 4EUVA 3TVYA 2EC2A 1U8WA 2ZWOA 4ANDA 3DFEA 2OPPA 1RB0A 3NS6A 1TTHB 1YJUA 1TVRB 2FD2A 3CCZA 1XR7A 1KFSA 3I9ZA 2QG9B 3MM5B 4USJC 5E5NA 2WVFA 1LWCA 1W2IA 4DS5A 3NS5A 4DR5J 2MJNA 4QWAA 4IG0A 4EEYA 2DGWA 2VKZG 2P5VA 4OHXA 4AQYF 2G9OA 3PHTA 3I56S 2HVZA 3MMBA 1VS3A 4DV3F 1Q1KA 2MZRA 5C24A 2O67A 3Q8QB 1F5AA 3NNHA 4DR7J 1Q53A 3A3NB 3CCWA 3PV8A 4TNOA 2FJBB 2K1RA 5EWFA 1RSCA 1JJ4A 4NEZA 4A8SA 2W2QP 2L08A 1DQAA 1IN0A 2VBYA 1XMOJ 5GAGI 2OHDA 4RBVA 2VICA 5B09A 4O3PA 1N6QA 4I6AA 5B7WA 3IR5B 3O8WA 4PXDA 2VPWB 5F41A 3UVJA 3HLUA 3CIMA 3CJ3A 3SXLA 1HD0A 1X4FA 3BO2A 3J7ZT 4B3OB 1FKPA 4U7CA 2J9DE 2GW8A 2M7SA 3MMCB 1OMSA 2ZH9A 4H4OA 2HNYA 5L9NA 4DR5F 4OX8A 4DL7A 1R6VA 1NHVA 3OUYA 3KUEA 2I5JA 2VFRA 2JRSA 4P2XA 1N34J 4EFAC 4PRFA 5T7LA 3TA1A 1UA0A 4DQRA 1P9YA 4AD6A 4N56A 1REVB 1CJUB 1FNMA 4DR7F 1Q8IA 4J91A 2EWHA 2XZWA 3DCAA 1WNEA 2CKWA 2Q6BA 1YI2S 1WWHA 2XLIA 1XK8A 4NYOA 2D7SA 2DCUB 2D3UA 4X84A 2H3EB 4USWA 4B9SA 3M8ZA 1XMOF 1QM9A 4KGXB 4DR2J 1L3SA 3IBFB 2FY1A 1LW2A 4KGKA 3UDLA 1DQ9A 2MXYA 1RA6A 1UAWA 4FF3A 3HHKA 3MR6A 2LXFA 1DBDA 4WXWA 2WZ1A 4X66J 1LFWA 5HROA 1ZPVA 2VODA 4ZVGA 4DN0A 2HPUA 5F8JA 5IV4A 5BYSA 4G1QB 4OX9J 3SQGB 3HJFA 3V2UC 2EK6A 1N34F 3CCQS 3OTEA 1LWFA 3IGNA 2JFKA 3G6XA 2AKWB 3FJ2A 5J1PA 2YVSA 1QSLA 5LT5A 1BQMB 2HS0A 2ZM6J 2F4FA 2R7QA 1B99A 4OI4A 4A8XA 5ADZA 3M6XA 4CO5A 3RRKA 3LW5C 3J7A1 5G0RA 1R0AB 2GNKA 5M2RA 4G3IA 2BM1A 2W7PA 1QY7A 1S1XA 4DR2F 4NA2A 3TR5A 4IR1A 1S6PB 3OJUA 3HVTB 2RDIA 1UWBA 1ZA1B 2KH9A 2HRUA 3AOBA 3AD8C 1U0SA 4FYDA 3DLJA 1FTCA 1CPZA 4URSA 4MKYA 3CULA 1I1GA 2W7OA 4H4KA 4X66F 3J7YI 1CULA 2D9OA 3QMQA 1Q4RA 3MR3A 4ZCLA 4DX5A 2PGCA 1TL7B 1YITS 4OX9F 2O3DA 1PBUA 4QOTA 2XS2A 2YKMB 1S79A 4NE9C 3UFCX 2N4CA 1HNVA 1CBKA 3KHHA 3K5LA 5JVHQ 1ZH5A 5IT9U 2YKQA 5J1EB 2OLWA 2ZM6F 2A2CA 2AGOA 2FVCA 1R8BA 3SSSA 5SUHA 4DV7J 3OTBA 2MEWA 4U7UD 2XCPA 4RW4B 3SYZA 1BQNA 4O0NA 2Y8YA 1C0UA 4Y65A 4D3HA 1H2VZ 4M5MA 3UWTA 4N76A 5JMNA 5DLGA 4QR0A 4G1PA 2JLEA 4P10A 4QWDA 4TKTA 3EVWA 3GIIA 4OYWA 3TP2A 1IM6A 5KT4A 3RGIA 4CLZA 3F56A 4TLRA 3C19A 1K44A 2E9RX 2J7WA 3OTCA 2F4VJ 4W98A 2R3VA 5KOWA 4IKAA 3D1HA 1HBUB 4WTYA 2OO4A 1VQKS 3OXGA 5A8RB 3SV4A 2GCFA 4TYAA 2MMYA 2MKYA 5LMUJ 2WSEC 4WTOB 5GADU 4RNHA 4KHRA 3LWMA 2MB0B 1H74A 2AF6A 2ALYB 1TZ0A 1KLMB 1VRQC 5L1JA 5DM7Q 3I0SB 2DXFA 5I3UA 4CLLA 3DRRB 3L4BC 1EHWA 5A2QY 2AQ4A 5C2GA 4DV7F 1S97A 4K0KJ 3H4DA 3JTPA 2QFJA 3QLHA 3CC2S 3QZ8A 4ZMMA 4FYVB 1SC6A 4OI3A 1PJ6A 1G3OA 4BLGA 3WX8A 2LDIA 6FD1A 2ILYA 1UCNA 2R7UA 2DIUA 1NAQA 2GA7A 1UTAA 2GVZA 3TVKA 4WYLA 3ZZTA 2YQ3A 1KR4A 1JMTA 3CGIA 4OZ3A 2ACYA 1K9MT 3TEGA 4ZVPB 2UXDJ 2WTFA 3PIOQ 4RL1A 1UETA 2WONB 5KG5A 1LKZA 2W2OP 3W9HA 1ZAXA 4DU8A 3JSMB 1PO6A 1RTIB 4K8RA 1T9TA 4WXOA 1KVKA 1W7WA 4CRJA 1N5TA 2GMJA 3CJRA 3HX9A 4BC9A 8ATCB 3DLEB 3KUGA 1X9MA 3OXFA 2CZ9A 1RZMA 2ZH7A 2EK1A 4YDDB 4K0KF 1HWIA 1CVJA 2LLZA 3M05A 3R2DJ 5EDWA 5KFGA 3FDSA 4RJVA 2A2DA 2RE1A 1HD1A 4M5KA 3GV8B 1HBOA 1D8YA 3IAS9 4CLSA 4PQUB 1UMJA 2LXIA 3BQ0A 2BQ3A 3M8SA 4OI1A 2POKA 5EX0A 1HNIA 3QT7A 3OL9A 3AT1B 2UXDF 4UZBA 3KNGA 2KRRA 1K8AT 2RB7A 2HWIA 2LMIA 3KLVA 2RS2A 4ERDA 1Q8BA 2NREA 1U2FA 2M0GB 2YNIB 3TA0A 3D6HB 3BN4A 4KKOB 4NCAA 3GFHA 2G2OA 1U1LA 2UUTA 3R5CA 3JTOA 2JWNA 2IY5B 1IBKJ 1HWUA 5F8LA 3J7Z5 1RTJB 2M88A 1HPZA 4RO0A 4I4BA 1FXRA 2VG5B 2PO4A 5L39A 5KG2A 4NZ7A 3MOJB 4DG1B 3MPYA 4C8NA 5H9FK 1HNWJ 1FWLA 1PYOB 2WVDA 3CO9A 5HVFA 2KHDA 2KU7A 1J5OA 2WHOA 4RW8A 4ZP6A 5D4OA 3BGLA 4B9UA 3ZZYA 3TUJC 2CZVC 4E98A 2KFYA 4CTAB 3BSCA 2CJBA 3CJTA 1RHJB 1XNRJ 1X31C 3TJ8A 5KG1A 1XQIA 2HAIA 1GT8A 1UZHA 3H90A 1S1UA 3O5TB 3MAAA 3BM7A 3GJTB 2VV5A 1B3TA 3X3UA 3C8YA 2B51A 3IP0A 3PX6A 3FFIA 2Q79A 1S0NA 3MGJA 1OY6A 2HW3A 3C6UA 4ZLPA 2DO0A 3RRHA 1IBKF 1JLQB 3KWMA 1Y7PA 5KT2A 2HK3A 2M70A 2L9WA 3RAMA 1WORA 3MPUB 3MHYA 4RPFA 1BXNA 2CQBA 2PA3A 3M2VA 1CJKB 1M5PC 5FJ4A 2MQMA 1Z1ZA 3W5YA 5E3RA 1HNWF 4DQPA 3NNAA 3MEDB 1BY9A 1RT3A 2YKNA 4KFBB 4ILRA 2JEIA 3RU0A 1IWGA 1R8PA 2B4PA 4DV4J 2IM0A 5ETKA 4L3KA 3KOAA 1F9HA 3W62A 4EYHB 5L38A 5B0DA 2XTJP 1OQ3A 2GAGC 5GADI 2L9NA 4UTGA 2E1CA 4U8YA 2GJFA 3QIDA 1NK8A 1F3VA 3H5XA 2ZUAA 3RW6A 4WE1A 2V67A 4ALZA 1LOUA 3FBCA 5F0UA 5J2QB 4XPCA 1LW0B 4L75A 4WFBQ 3M8YA 1APSA 2YKOA 1FRKA 2VDIA 2OJ3A 1TUVA 2C2NA 3BN7A 4KTQA 1TL5A 4ZITA 3AH6A 2E9TA 1YJWS 5IM0B 3SSQA 3AOAA 4JP8A 1KVIA 2IYGA 1ICEB 2RMLA 2B6AB 1ZS6A 3EYZA 3TAPA 4DV4F 2KHCA 2JC1A 1QVFR 3MM7B 1DTTB 3MI7X 4RW6B 2U1AA 1MWYA 2HBQB 4ECUA 2CQ4A 4C8ZA 5K5MA 4MT1A 2ATLA 4DR1J 4M94A 5CHCB 1GMVA 1UVNA 1HWJA 4KV8A 2DBBA 3SEOA 3RB3A 2VB6A 4DR3J 2NZ4A 1XIQA 3GV5B 3P4UB 2MQOA 2E1RA 4F8RA 1JLGA 2IDEA 1C4CA 4DUTA 3LOUA 1S0MA 4YR0A 1N32J 2P2CB 3E2EA 2YNHA 3H2VE 4LRFA 4J9NA 2WVBA 2ACMA 2KRBA 4HHHA 4PG6A 3OTDA 3A4TA 4MKBA 3SCLE 4GC6A 1N56A 2LECA 2EFNA 2AMCB 3N6MA 3OBIA 4Z7YA 1EETA 1WELA 1IKVB 3B54A 1QE1B 2DCLA 5U47A 2YQ0A 3C15B 4CLWA 3O2IA 3A8KA 2DNZA 4F3QA 2ZHBA 2DB1A 1MMNA 1MROB 2A0FB 3UN5A 1ZM9A 3SDEB 3EGZA 3WC0A 3J7AN 5AXNA 2B3TB 4DR1F 3GLJA 1IKWB 2XQCA 7FDRA 2ABYA 3KK1A 3CCUS 3IR7B 1PYTA 1LWCB 5CAAA 4DR3F 3FGVA 5E3AA 2PSZA 3MDFA 1U45A 1KHWA 3I31A 3MEKA 3M8RA 4I6YA 3NCRA 1FHTA 4RWXA 2DD8S 3FMWA 3QSIA 4LSLB 1N32F 2FQQB 1QVGR 3BYPA 3LP2B 3AOCA 4ANEA 2XMWA 1H6KX 1NH8A 3RB6A 1F60B 3KK3B 1SI9A 3TA2A 2YPZA 4X4QA 4JI8J 3ZNJ1 3S8SA 3D1OA 4J9OA 3OVSA 2B9EA 2ZJRQ 3MCNA 3DMJA 2GFFA 3LGMA 1UKUA 1SIZA 3MD3A 1U1QA 4A4JA 3THVA 4FXDA 5ETNA 3FSYA 3HHLD 2W4PA 1EJ7L 3LGHA 1AB8A 1X4GA 2OEJA 3H7HB 3KLIA 3HHNB 3CMES 3JS9A 2IM3A 5HMZA 1S6QA 4ZPDA 1XMQJ 3LP0B 3PX4A 1Y5NB 3N28A 2E7VA 2HNYB 1QSYA 4CLPA 5L8RC 1SUQB 3THPA 3JQKA 2KXHA 3BB5A 1N5YA 4NLPA 4A8OA 2I5JB 5D78A 1SC3B 1NB2A 3UCZP 1R8HA 5DGAA 2J9EA 1SJRA 1B7FA 1URRA 1PGZA 4K50A 1RADB 3NL0A 2OP5A 1RCXB 1BWVA 2LEBA 5EUHA 3KK2B 3PYGA 3PW5A 1RKIA 3OV7A 4C8YA 4UOFA 3Q86A 4NCGA 4IR9A 5D3GA 2NXJA 4CO1A 4JI8F 1MNEA 5HBMA 3FQKA 1VQ8S 5GMKa 3HD1A 1DTQB 4LBPA 1YTYA 4JI7J 3M1VA 1JLEA 3K58A 3L3CA 3EZOA 5LXRA 2LEAA 4ELTA 1WF1A 1ZA2B 2DH9A 1Q95G 1VDHA 3Q8RB 3LALA 3BGRA 1M5KC 2G13A 1O0PA 4GC7A 1XMQF 1HKAA 2XZDB 1NKBA 2HRTA 3GP9A 3G8SA 1KP6A 4P72A 4JB8B 5LM7E 3PFEA 5D0EA 2QLBB 1WDTA 5CYJA 4KGMA 4H4MB 4F26A 2OD6A 4R5PA 4LQ9A 3WIUA 1LWFB 1FKAF 3CIZA 4RUAA 4ICLB 4P2MA 3U1LA 4WBFA 4Y2AA 1N5SA 2XYHB 2DR7A 2FLPA 2G0IA 3B78A 3W5ZA 4ECSA 1OPIA 2ATCB 4WCEQ 1GX5A 3L7OA 1NDKA 2V8GA 3CDEA 3NMAA 2MSTA 2EKNA 2YX7A 3T1HJ 1S1XB 2DXDA 2Y8WA 5A8KA 5C25A 2RUGA 2VPZB 1U48A 4WP3A 4A8YA 4JI7F 1UJ6A 2OAUA 1RLDA 4YR2A 1B0PA 1AUDA 3MEGA 3D67A 4LR8A 2B9WA 1R3NA 2XWXA 1AFIA 4EI2A 2GAHC 1S9GB 1UVMA 2F8EX 5AXLA 1BC6A 1M5SA 3TAQA 4JI1J 4EK2A 3CMAS 2ZBPA 3FCVA 2RQ4A 3V6JA 4NYZA 4C4WA 2W2MP 2X1AA 1P1LA 1RWOB 2VZ9A 1GNKA 4LT6A 1WG1A 3KLHA 1SCJB 4X64J 2XHCA 4DL3A 3OR1A 4QPXA 1HWLA 5D4LA 2B5JB 3HP6A 4NRUA 4TY8A 1CQNA 4CIOA 4U95A 1PYSB 2ZDPA 4C97A 4DUZJ 3OD2A 1JXVA 1QTNB 1NKCA 2J76E 1GEHA 4YB6A 4R8UB 3T1HF 3LUYA 3A1YG 5KFFA 1PC4A 4YS2A 2COLA 5HAOA 1SVDA 1SXLA 1X5OA 2VG6A 4IOAQ 1YRXA 5HO4A 3LPEA 1CLFA 4WP9A 4PWDA 2KVQE 2BKPA 4ED1A 4J7CA 2JVOA 1GK8A 1FI4A 4NZ0A 3K59A 1NHUA 2HAFA 1VQSA 2F63A 2RVJA 4EZ9A 4A47A 4JI1F 2MGZA 4ECZA 5LSOA 3T9ZA 1SJFA 3J81U 5KG7A 3IRXA 1QJHA 4DF8A 4IRDA 1YG0A 2C2MB 2MZ1A 4X4OA 2YX1A 4ZN1A 3DOLA 2LA6A 2OPRA 4Q7AA 4X64F 2KXFA 4DOZA 1Z4UA 3DOKA 3W9IA 4LF1A 3V6DA 2QA2A 3MUMP 5I3UB 4B9NA 3UQSA 1BLUA 1TFWA 3M6UA 8AT1B 3DLHA 2C22A 3D6TB 4YQWA 4DUZF 4C11B 2Y9HA 3B4DA 2EFVA 3D66A 4GKJJ 3RYLA 1X0PA 5LJ3Y 3HSGA 2H48B 2B4OA 1R0CB 3ZZOA 4BDPA 2VUGA 2NZCA 2B7BB 3Q2TC 1OO0B 4KY3A 1H7XA 5JUMA 4P73A 4XK8C 4GVLA 3DRSB 1FCAA 3LPYA 4L76A 1U0HA 3LTOA 3N6LA 3VHQA 4M5HA 3TAMA 1WC0A 1JLFA 1IR1A 2DNPA 1PIEA 4CNYA 3QPIA 1ZPWX 1FTRA 1QUPA 4FNIA 3LO3A 2XMAA 3LGNA 3U1NA 2HIYA 2EFQA 4FBTA 4DCJB 5E7OB 4AUKA 4QQBA 1NJYA 1BD6A 1JQGA 1LNQA 2HHTA 3W8PA 3C14B 2CJAA 4EO8A 2WRMA 4Q8FA 4K4VA 2N82B 4M5NA 3H59A 1IVZA 1FX4A 3Q0AA 1CJTA 3R5DA 1Z2LA 3HHLA 1B64A 2M8HA 2VD3A 2UV8A 1X0FA 2GVDA 2R2UA 4GKJF 4WFXA 5DO2A 4RWWA 1M0SA 2N7YA 2PMWA 2PD1A 2NUUG 2ZNYA 2FB0A 3PW4A 1RYRA 3U02A 3MCOA 4LF9J 3H0PA 2VC1A 4BCAA 3MECA 4OJHA 4ZOSA 3OL6A 4QCLA 1XMBA 3VWSA 2XMUA 4G1IA 3KG0A 2HK2A 2DRAA 2A18A 1GTEA 2AW0A 2OEKA 4OJ1A 2B4VA 4UQGA 3ET6B 2AJ1A 4RUCA 4IFYB 4L72B 4QYZJ 3G86A 3K2YA 3DYAA 3VAFA 4K4YA 1PKUA 5ITHA 5CCLA 4HTIA 1TL3B 2Z0GA 2RUSA 3TUZC 3DOMA 3RAXA 1RT7A 4LR7A 1VLOA 3QGGA 2FVRA 1HQEA 1NSQA 4IOCQ 1OY8A 1HW9A 5I3PA 2DNHA 2GHWA 2FTRA 2XSJB 1H98A 1T0TV 4LF9F 3F41A 2IDLA 2MPUA 4RR5A 4I64A 2QMWA 3MMJA 3BH6B 3KFWX 5FDLB 4TN2A 3MURP 2RF2A 4CO2A 4LF7J 2ZH4A 1AFJA 2HHXA 1VYAA 4F7VA 3W2WB 4DJBA 3PY8A 3M8PB 3P6YC 2HHWA 1S1UB 3V6HA 4C8LA 3QJLA 3BQ2A 3HULA 4ZCKA 4CWBA 4O3NA 1RK8A 2DK2A 3PZPA 1NSKL 1U4BA 3BGFA 1S1TA 4FS2A 4TU7A 2ZH2A 1S10A 5KFWA 2WK4A 4CLKA 2CDRB 2ZWPA 3PEHA
chains in the Genus database with same CATH topology
3K5PA 4KSEB 1IJEB 2KH9A 2HRUA 3OR2B 1VQ4S 3ENWA 1HBNA 1TKZA 4HH1A 5KFUA 3PRBA 1TK0A 1CQMA 2VONA 4FYDA 3SZ2A 4NXMF 3DLJA 1FTCA 3NBPA 4OJ3A 2K3IA 1R8CA 3VZIA 3VAMA 4J9LA 4URSA 1GX6A 4MKYA 1CPZA 4ZCIA 4A48A 2MJUA 3CULA 2JSXA 1FKOA 1NNDA 2CFXA 1FRLA 3PEJA 1KNZA 1A6LA 1YGYA 4J9SA 3R5BA 1JLAA 1I1GA 1AW0A 2A1BA 2W7OA 1N52B 4H4KA 4X66F 4XO0A 2P6SA 3J7YI 2W9BA 1C1BB 1ZM3A 2D9OA 3NG8A 3NNCA 1TL1B 1Q82T 2PE8A 3T19A 1FJCA 3QMQA 3GZ7A 1S1VB 4QWCA 3HPOA 1L3VA 4FF1A 3M2VB 5J2QA 1Q4RA 2CG4A 1ELOA 3MR3A 3JYTB 3L7PA 1LW0A 3AQOA 2D1CA 2PGCA 3CB4A 4ZCLA 5IT9Y 1SJ1A 4IRCA 4HDHA 1YITS 4OX9F 2O3DA 4ECRA 2W9CA 3QZ7A 4QOTA 2XS2A 1X4DA 3KLGA 2YKMB 3OHAA 2VG7A 1S79A 3DM2A 5GAEU 2IVMA 1X4BA 4AL7A 2KZZA 5HP1B 3C6TA 2M2BA 5JJBA 4IRKA 3OPKA 4WU3A 3UFCX 4CH7A 2W8LA 2EFPA 2N4CA 3BGUA 2ZZNA 1J2VA 3RRGA 2B7CB 6FDRA 2CJ9A 4B9TA 3I32A 4K4ZA 1KRPA 1HNVA 3FEZA 2UUAF 3KHHA 2Y1IA 3K5LA 3GFYA 4J9MA 3PHEA 5JVHQ 1ZH5A 2XMKA 2FIUA 2HVHA 3N79A 4F4KA 1TKTB 2P6TA 2YKQA 5DJBA 2ZHOA 4FP9A 5J1EB 3BO4A 3MFIA 3OLBA 2CQCA 5J2PB 2BABA 4WFZA 4OI0A 5GAHU 2OLWA 4HT7A 5A8KB 2ZM6F 2A2CA 5C25B 1O8BA 2QT7A 2VASA 4PXBA 2AGOA 3GQCA 1NK5A 3FZBA 2FVCA 4O44B 1R8BA 4OFZA 3SSSA 1OS5A 1RTHB 2ZKUA 4Y34A 2DGTA 1SKSA 1ROFA 2XY5A 1FK9A 1FEEA 1FRHA 2GGPB 2DH7A 3D28A 5SUHA 2I8EA 4IG3A 2XMJA 2ZH8A 4EYIB 3PO5A 3VAGA 1T03A 3HO1A 3OTBA 4ZVHA 1F2GA 2WB1D 3MEGB 3MWBA 2XCPA 1JXLA 3AHPA 1NJXA 4RW4B 2B6AA 1U09A 3BEGB 1HQUA 1YRTA 3SYZA 5E3CA 5KFDA 3OHBA 1BQNA 2BE2A 4Y2MA 5KG4A 5D6GA 4RBTA 1X4AA 4K4UA 4EBDA 3ENVA 1HI1A 1NK7A 1C0UA 2E1AA 2V2KA 3OL7A 4Y65A 4D3HA 1SH2A 1H2VZ 3TRGA 4E8UA 4F4XA 4TY9A 3WDOA 1TV6B 3UWTA 1VIOA 2CPFA 3PW7A 5CD4H 1FXDA 2J9CA 2YWHA 4MK9A 3BF4A 4N76A 4DDFA 1RDRA 1IBLF 5B0EA 4PG7A 3V81A 1DTTA 2WAQD 4RW6A 4DWIA 2CPJA 3MOZA 3QYYA 1UEUA 4Q2MA 2J5AA 4MFBA 3VF0B 1WEXA 3QGPA 4QR0A 5DLGA 4G1PA 1ZM4A 3MEEB 2JLEA 4QWDA 3HZGA 3MPVA 2IA6A 4TKTA 2AX1A 3LWLA 1RT2A 3GIIA 3TP2A 2BXJA 1Q86T 3V4MA 4NL5A 4I67A 2OPQA 4CQ1A 5KT4A 2R7SA 2EVZA 4F4ZA 1P8GA 3MM9B 4O4RA 1LWEA 3KLHB 1LFPA 3FQLA 5HMYA 2XGPA 4MK7A 1KC8T 4IFVB 4NLWA 3F56A 2QYCA 3GG1A 4TLRA 4QWBA 1UA1A 2E9RX 2J7WA 3OTCA 2MZSA 1JLCA 3VAIA 2VKRA 3OR1B 1SJQA 4C0BA 5F8IA 2VQFF 5EWGA 5KOWA 3DI6B 4C8OA 4IKAA 2FJWA 2FDNA 3D1HA 1HWKA 1GXUA 1HBUB 3PJWA 1VQNS 5SZTA 2ZC4A 4WTYA 4N8NA 1NK6A 2OO4A 3HZEA 3ZZZA 1VQKS 3PX0A 3UNGC 3OXGA 5A8RB 3SV4A 5KFHA 2GCFA 5THWA 4TYAA 2L9DA 2MMYA 2FVPA 4ZPBA 3AY0A 1DZ5A 5M2UA 1HNZF 3EGNA 1HHSA 3SV3A 2WSEC 3X1LB 4B08A 1U6FA 4JYAF 1FF2A 4NOHA 3UD3P 5GADU 4RNHA 4E0DA 4KHRA 3W7BA 3LWMA 2WSCC 1U1OA 2MB0B 1KFDA 1Q79A 4ZPVR 1VGYA 2AF6A 2UUCF 1TZ0A 1DARA 4OX7A 3FSXA 2P9CA 1KLMB 2RQKA 4I7FB 4HDGA 2X3GA 4DBQA 4WYWA 1Q8LA 1Q81T 5L1JA 5DM7Q 2A3JA 3M2UB 4DFMA 1S72S 2VG6B 3I0SB 4KE5A 2UXCF 5I3UA 1V9OA 3DRRB 4DL0C 4Q0BA 1IKVA 3RTVA 5A2QY 2AQ4A 1HYSA 4X2BA 4DV7F 3I87A 1SL0A 2N4DA 2XG8A 4JI6F 3OSPA 1UEVA 2CYYA 3FRZA 1S97A 4LQ3A 4PWDB 1Y4ZB 3DHXA 3MUTP 2QLXA 4L3NA 2E5GA 2DNLA 4DUYF 5CYQB 3H4DA 3JTPA 2QFJA 3QLHA 4MAKA 3CC2S 3QZ8A 1UVLA 4ZMMA 2HFZA 2PDAA 3SCJE 3G6ES 4KV8B 2XC9A 3H25A 4OI3A 1S1WA 1SC6A 2BDPA 1O5JA 1G3OA 5LSLA 5T14A 4TQSA 3FCHA 1MROA 2R4FA 3QIPB 4C9DA 3HVRA 4I6WA 2NR0A 4ZA1A 3ZC4A 1D3WA 3PDNA 2GX8A 1UFWA 5LL6d 3SDEA 3Q24A 2MGZB 4NLXA 2LDIA 4OLPA 3QJPA 6FD1A 1X8DA 2QO3A 3AJ2A 3KNAA 5EWEA 2ILYA 2R7UA 4QIGA 1X9SA 2DIUA 1XTZA 3GR0A 3M2RA 3DLKA 2WB4A 2R2RA 2JEGA 5L1IA 1VQ9S 3H4BA 2L41A 3JB9k 1NAQA 2R8GA 2GA7A 4XIUA 5HL7Q 1IKWA 2LQ9A 4IH5A 2R7OA 1U6ZA 2IAJB 3TVKA 1NU4A 4I2QB 4WYLA 3ZZTA 2ADCA 3LH2S 4H54A 2YQ3A 2VPYB 5JVGQ 3DOLB 4U7UK 1KR4A 2XHWA 2OPRB 4WKYA 4HI1A 1JMTA 3CGIA 2I1RA 3IG1A 4O4GA 1SV5B 4A8MP 2ACYA 3MMAA 4NLUA 1K9MT 2YH0A 4DV2F 1G7CB 1GQEA 4OL8A 1K1QA 3DOKB 1OSDA 5FD1A 4ID5B 3WZ0A 2JEFA 2WTFA 2YWFA 3US5A 3V6DB 4PG8A 5J1NA 3PIOQ 3FSIA 2I0XA 4PXCA 4PG5A 3TARA 1FDNA 7FD1A 4FXWA 1UETA 1W2BR 1U49A 1T05A 5CCMA 2F7VA 4JUZA 4DV6F 4LSLA 4TU8A 2GHPA 4ECTA 2IM1A 1XBWA 3O6QA 2WONB 4ZP9A 2ILZA 2JLGA 3CPWR 3OVBA 4DFJA 2OPPB 5KG5A 3GYNA 2W4DA 1DHMA 1VJWA 1LKZA 3GWCA 2R7XA 3I55S 1X9WA 1LQ9A 1ZAXA 3UR3C 2I2YA 3N5BA 2LCWA 4K5SA 3MTJA 3B4MA 3JSMB 3ISND 1JNRB 2DHGA 1PO6A 2MYFA 2XULA 3HF5A 4JI4F 1RTIB 3LP2A 2CJKA 4WXOA 3I82A 2ZE2B 3OFHA 1S4FA 1N5TA 2GMJA 3HX9A 4ES3A 4BC9A 3MXHP 1D9DA 4NXNF 3CE8A 3DLEB 1VRUA 1X9MA 3OXFA 3KK3A 4C2MA 2YWKA 4Q8EA 2ZH7A 4JI3F 3GG0A 2EK1A 2QE5A 4IG0B 3KLFA 3EX7B 1TAQA 4QW8A 2JLFA 4PG4A 2J0XA 5KFEA 2C3OA 2KT5A 4WJBA 4YDDB 3M9MB 1VQOS 1H0HB 4JV2A 4K0KF 2ASLA 2PFFB 1HWIA 3EZ5A 1CVJA 2LLZA 2XNQA 3M05A 3NWGA 4ED6A 4PCQA 4ED0A 1R6YA 2YNFA 5EDWA 3GIMA 1SH0A 5KFGA 3FDSA 4K4WA 4A8QA 4A8WA 1IKYB 1E6YB 3MMBB 2M9KA 2A2DA 4QU6A 2RE1A 3K57A 1T3OA 2M3DA 3M8QA 1HD1A 3TAMB 1HBOA 3GV8B 3IAS9 2HNZA 3QGHA 5C24B 1D8YA 2UUBF 1FERA 4PQUB 1UMJA 2ZC3A 2LXIA 4FVMA 4F3MA 3BQ0A 3RZAA 2BQ3A 5IT0A 4ID8A 3FEYB 4LSNA 1TK5A 2BA9A 3M8SA 2VA3A 2ZOMA 3VTIA 2JFDA 2OPSA 1OWXA 1JIHA 3ZFVA 4ZVEA 2AWZA 3NKYA 4KRWA 2F8MA 4OI1A 1Q78A 2K1RB 2POKA 1S6OA 4KIAA 3S1TA 3KJVB 5K8PA 4RNNA 1S0VA 2MDAA 4HTJA 4WIIA 3C3LA 3OL8A 3RB4A 2EPIA 1M1KT 4J5OA 1KN6A 3LP0A 5EX0A 1HNIA 3VAHA 1DRZA 4AL5A 2GJ2A 2OKQA 1RT5A 2HQ3A 2J6UA 2ZBIA 2PMZD 2FGCA 4U6PA 3OL9A 4CO0A 5B0FA 1SUQA 2QLWA 4HEA9 4RNMA 2HLUA 5A0YA 1N6QB 2BQUA 2UXDF 3KNGA 3AQPA 2R8HA 3KLEA 1C4AA 2KRRA 5EN1A 2P9EA 3DRPB 5F9LA 1AROP 2V8DA 1K8AT 2RB7A 2HWIA 5E0OA 3VAJA 1FXLA 1WTFA 2DHAA 2GHVC 2NXUA 3I5AA 2LMIA 2QV6A 2MQQA 4TLQA 3KLVA 3ZZUA 2RS2A 2V4JB 4NYPA 2HQIA 2XI2A 3G8QA 4C8MA 5DM6Q 2DNMA 3AJ1A 3QO9A 4ERDA 3PIPQ 1Q8BA 3O1LA 1FKPB 3MFHA 1HFEL 2NREA 4GKKF 1RGVA 2ZZMA 1U2FA 2M0GB 2YNIB 2ZBCA 3HVWA 3TUIC 3TA0A 4F25A 4RW9A 1VC5A 3BN4A 2IM2A 1QTMA 4KKOB 4NCAA 4ED5A 2JOQA 1FD8A 2RKIB 2PA8D 3GFHA 4H4OB 4KBIA 4ZPCA 1KSPA 1U1LA 2L48A 4Q2LA 4B3SF 3KK2A 2UUTA 3R5CA 4ZHRA 4W90B 1NZAA 3JTOA 2JJ4D 2CPXA 2EG2A 1RAJA 4RLEA 2JWNA 4PPDA 3BSOA 2DNRA 1FE4A 4DSIA 4PWUA 4J9QA 1VRTA 3KLIB 1JLBA 2EFGA 3OUYB 3CCSS 1HWUA 4OZ1A 4Y0FA 5F8LA 2QEXS 4I2PA 1DAXA 2GV1A 2YWGA 5CH7B 3AAWB 3J7Z5 1YBAA 1RT1A 3H98A 1RTJB 1JKHA 2M88A 1HPZA 1S6QB 2UV8G 3N6NA 4I1TA 5T7LB 5F8MA 4I4BA 4DSJA 4B3MF 3LP1B 1RQ0A 5KT7A 1FXRA 4MH8A 2VG5B 2PO4A 5L39A 5LSRA 1DTQA 5DG8A 1OQ6A 5KG2A 4DX8H 1XERA 2CPZA 4NZ7A 3MOJB 1WG5A 3OFEA 5GAGU 3N01A 4DG1B 1FNOA 3MPYA 3V4IA 3RB0A 3E51A 2KT2A 3KHGA 1NJZA 1MU2A 3PXGa 4RUHA 5LJ5Y 5KOXA 1MSWD 3MM6A 4C8NA 5CYMA 2F8HA 2ZOFA 5HMXA 4B9MA 1DFDA 2CQPA 3IFEA 2QZ8A 2PEHA 1RT6B 3CO9A 3K8WA 1HMVA 5DETA 4UUWA 1T02A 2KHDA 2KU7A 1J5OA 2OSQA 2WHOA 2C2RA 4RW8A 4ZP6A 5D4OA 1FJ7A 3BGLA 4B9UA 2RRAA 2BW2A 2EG1A 2XEXA 3ZZYA 4IH6A 4HVZA 3TUJC 4X4PA 2CZVC 4E98A 1TFYA 3CJ5A 3HMJG 3DYAB 2KFYA 3E01B 2AJQA 4Q43A 3GIKA 3G96A 4CTAB 1O51A 3BSCA 4MYUA 4LJMA 2CJBA 2UZAA 5HLFA 2RU9A 1NJWA 5AE2A 1LW2B 3R5AA 5JXSA 1FVSA 1VMBA 4LUBA 4NA1A 5A8WB 4H4MA 5KG1A 5KFNA 2HAIA 4MMOA 1YIJS 2UVWA 1GT8A 2VBWA 2MY7A 5G4DA 1S1UA 4NCGB 1XR6A 3O5TB 3CDWA 4YB5A 4X4UA 5DS7A 2IA0A 3BM7A 4QIEA 4ED3A 2Q1LA 3PM9A 4DFPA 4B17A 3PKMA 2VV5A 3DDNA 2FHJA 5MAOA 2IRXA 3QWPA 5K14A 1RT7B 4ICLA 1LXNA 5H9EJ 2HS4A 1ZAWA 3CEDA 5BYQA 3QAEA 4TYBA