2GV1A

Nmr solution structure of the acylphosphatase from eschaerichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
publication title NMR solution structure of the acylphosphatase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 92
sequence length 92
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gv1A00
4NL5A 3FRYA 1URRA 2G9OA 3E8OA 4Q2LA 1JWWA 3LO3A 3MCSA 2GGPB 1U7LA 1FE0A 3KKFA 4OJ1A 1X7VA 3TRGA 2K1RB 5B09A 2GV1A 1FD8A 1K0VA 4EFAC 4QOTA 1V3ZA 2GA7A 2RU9A 3HDSA 3KG0A 4HL9A 3T9NA 1SI9A 3CJKB 4YEAA 3HX9A 2KYZA 3KNGA 1ULRA 2ROPA 2ASYA 2K7KA 1YG0A 3BM7A 2AJ0A 1YJVA 3GZ7A 1Y9OA 3HHLD 3I9ZA 1MWYA 4A4JA 1X0PA 5K9FA 5T7LB 2K7JA 2N4CA 1GXUA 1SB6A 1OQ6A 2BJEA 2HLUA 4ZOSA 3TNVA 2AW0A 1KVJA 2OAUA 3BF4A 3K7RA 1FESA 2K1RA 1TR0A 3DCAA 1YJUA 3TOQA 5B0EA 4A47A 1N5VA 2AP6A 3WDOA 1YRXA 2ROGA 5B0DA 2XMTA 2QLXA 2GO8A 2BUNA 3BDEA 4HI1A 3CJKA 1FE4A 1R6YA 3IWLA 1TUVA 1Y3JA 1TL5A 2AJ1A 2OD4A 4OJ3A 2KKHA 2VV5A 4OJGA 5IXUA 2FIUA 4Y2IA 5F0WA 5B0BA 3IWXA 3UDCA 1VQSA 3HHLA 4FNHA 1AFIA 3BN7A 2IYIA 2IFXA 4U9RA 2CRLA 5F0UA 2ROEA 4A48A 1APSA 3DXSX 4Y2KA 1YJTA 2GFFA 5B08A 4DL0C 1FVSA 2HFOA 1OPZA 1FVQA 1JK9B 1LQ9A 1QUPA 1X8DA 2BJDA 4HI2A 1MWZA 4F67A 4OJHA 2W4CA 3BB5A 1N5TA 2GGPA 1KQKA 4YDXA 5A6WA 1XBWA 2BYCA 2QLWA 2W4DA 2XMVA 2FTRA 2OD6A 2XMUA 2W4PA 2QYCA 1N5QA 1WD6A 1S6UA 2EW9A 4ZA1A 3HF5A 3BGUA 2PGCA 4HH1A 2HLTA 3LGNA 2FHMA 2BBEA 2RMLA 5B0AA 5T7LA 4HH0A 2IYGA 4NPOA 2FB0A 2RSQA 3KG1A 2LQBA 5B0CA 2HQIA 1FEEA 2ZDOA 1S6OA 5B0GA 2PD1A 1OSDA 2HIQA 2ZDPA 4DPOA 3QGPA 1AFJA 2LXFA 2RILA 1Q53A 1Y3KA 1VQYA 2OFHX 2HFNA 2L3MA 2XMWA 1AW0A 1P8GA 3LGMA 2LDIA 4Q2MA 3HHLC 1SQEA 4FNIA 3F44A 1CC8A 1IUJA 2QIFA 1N5SA 5B0FA 2KT2A 2OMOA 2ACYA 1Q8LA 2KT3A 5A6PA 4Y2MA 2JDJA 2N7YA 2OP5A 2XMKA 2K2PA 3FGVA 2LQ9A 2N4DA 2OFGX 3QMQA 5KAKA 1W2IA 1Q4RA 2OKQA 1YJRA 2GCFA 3MZIA 2XMJA 1CC7A 1TZ0A 3VTIA 1Q8BA 3HHLB 1TL4A 2XMMA 4DN9A 1GXTA 1P6TA 4A46A 1OQ3A 3BR8A 1RJJA 3FMBA 3HFKA 1Y0HA 4OIXA 2VH7A 2Q3PA 1KVIA 1CPZA
chains in the Genus database with same CATH superfamily
1VQPS 3OW2R 5C25A 2J8AA 1C1CB 4X4QA 2FVSA 4QU6A 1UETA 1MLAA 3P3DA 1FI4A 5GAHI 2ROPA 3M9MB 4B9VA 5J2MB 1NZ8A 4YB6A 1PJ6A 1RKIA 1YZ7A 3SQOP 2IMOA 3O1LA 2BJ7A 3IRWP 4UOHA 2UVWA 2DK2A 4CLPA 1WTBA 2ZJPQ 4O3RA 2MGZB 3DXSX 5ETTA 1FJGJ 2NUUG 2E66A 3TA0A 2BV3A 1QAJA 4JI6F 2IA6A 4FF3A 2WONA 4OLPA 1DQAA 3BSCA 4GVBB 4LIRA 3OQ2A 1RTHA 4USHA 3M8QA 2DD8S 2NCKL 2CPXA 2B6AA 1D9FA 3OL8A 1L3SA 4FBTA 4JOUA 4LF8J 1N34F 3CCQS 2V69A 1R0CB 1S97A 2QA4S 3CJ0A 2HAIA 1NAQA 3MMBB 4AT1B 2QC3A 3B4DA 4NA3A 1RTJB 2CA9A 3HULA 2ZM6J 2W8LA 1LWCB 3BR8A 1JLEB 3FQLA 3M32B 1WC5A 2JVRA 2VFVA 2QT7A 1RT4A 1IKWA 4C9DA 1SI9A 2M3DA 5A2QU 3HX9A 3JXOA 1AUSL 3RZAA 5K9FA 5KFEA 3F0NA 4GKKF 4FXWA 2AZ3A 3BDEA 4OJ3A 3G9CA 3EJMA 1WDTA 5CYMB 5LMUJ 3MHYA 4ITSA 4OYOA 4FF1A 3ZXWA 5DETA 2HW3A 5KTQA 3ZTSA 3HVAA 2MY7A 3H42A 2DCLA 4IFVB 2HSEB 5EWFA 3G6VA 1WHVA 2WW8A 2G2ZA 3H25A 1PC4A 1RHQB 3JAMU 3EDRB 2FLLA 2W7PA 2J5AA 4E8UA 2CJ9A 2H5JB 3TUJC 4E98A 1PBAA 5E3RA 2EPIA 1UTAA 2FDNA 3U1LA 1W2IA 4ETZA 2HQ3A 2QG9B 2G13A 2H5IB 2D3ZA 3JTOA 2W2OP 3U7JA 3A13A 4XPEA 3T1HF 2E5HA 5KT5A 2C3YA 2HK3A 2Z2MA 2OH2A 4XTTA 4U96A 3DC2A 3EZ5A 3OFHA 2XM3A 1S72S 4NEYA 4O4RA 2N4CA 1SBRA 1A9NB 2HBZB 1XTZA 4WWSA 5L39A 4OYXA 4JI4F 1P9YA 3SCJE 3B6BA 5FDLA 3LP2A 3GIRA 4ID8A 4NCGA 3W64A 1HWLA 2CG4A 2OSRA 4YMEA 4LMZA 4MT1A 1YZ6A 1RAEB 3T1YF 3CJTA 2CNLB 2BYCA 4KE5A 3NEKA 2F65A 1WD6A 1KEKA 3CC2S 2LQ5A 1DZ5A 1I5OB 3KLEB 2CQ1A 2Z30B 4WP9A 2J6SA 2QZ8A 3O44A 3OR2A 2PA3A 2XHCA 3SCLE 3HJVA 2XMAA 3C2PA 1JQGA 3FZ2A 5A8KA 1UVNA 3AA8A 1YVFA 3KJFB 3Q0AA 4ZP6A 2FJVA 3J81j 1WUUA 2YNGB 4ZVPB 3KFWX 1L3KA 5ETNA 2OI2A 4KR0B 3FDSA 3M8PB 4ANCA 2PN6A 3X3UA 1MU2B 4K5RA 3M8SA 2HYIB 3GR0A 4O0NA 2JHEA 2VHGA 4DBQA 3OD2A 3OTDA 1QM9A 4JYAF 3FBFA 2MLYA 1BUXA 2OELA 1O0PA 3PHTA 4ZLNA 1OQ6A 2GVDB 2AW0A 4UOGA 1PO6A 1TL5A 2ZHBA 3EGZA 2QL7B 1VQ6S 4DR2J 2MY8A 4W98A 5KG1A 3FFIA 4F4KA 3PG9A 2C3PA 3MGJA 1VHFA 3KUEA 1SIWB 2MZQA 1XMQF 2V2ZA 2V8DA 4ES3A 4IOBA 2HK2A 4QYRA 1XC9A 4ZN3A 4WE1B 4DR4J 3MMAB 2F40A 5KG4A 1PAUB 4WFYA 4U95A 5IM0B 2MSTA 1IR2A 1VJWA 1VR6A 3MEGB 1I3OB 4X64F 3Q8PB 8ATCB 2AU0A 3UWTA 5D0GA 3R5GA 2F8MA 3ZZUA 4JV5F 2C3MA 3H2LA 4AUKA 4ALZA 3K58A 2DY1A 5C42B 3QT5A 1LW2A 1TR0A 3TAQA 5DLFA 3VGVA 3SQGB 2VC0A 3D3BJ 2OPQA 4LF9J 5DQGA 4K4UA 3M7VA 1MN7A 5KFPA 5ETVA 2GJIA 3MCNA 4IH6A 2ZH8A 2W2PP 4DLGA 1LQ9A 2H54B 4DX6A 5IT0A 1R3NA 2IRYA 2VBWA 1PSDA 4A8FA 2BBEA 5HVHA 1WORA 3DM2B 2HBQB 3TR5A 2ZOFA 3V2UC 2N3OA 2ZE2A 3QLHB 1LK7A 1NH7A 1Q5YA 3J7YI 2UXCJ 2JLFA 1MNEA 2DRDA 2CUYA 3NXZA 1NB7A 3DLLQ 3KLIA 4OX8A 1YJRA 4BS2A 3K8VA 1BC6A 4NWBA 2R7QA 2M2BA 5DLGA 4AFFA 3VR1A 3TVZA 2HNZA 5HSPA 3QIPA 4DU7A 1HNXF 3CD7A 3D67A 4HKQA 2HVIA 2Z56B 3GCWP 3LAMA 1TVRA 3GJTB 5KT3A 2AYBA 4HLBA 2VFRA 1IBLF 4WFXA 3I96A 4LQ3A 5CH7B 4DFMA 1HQUB 3MOZA 1N88A 2VC1A 4Y2KA 3KDNA 4IRDA 3R5BA 4P2XA 4JBCA 4YDXA 4K4VA 2JNJA 1F2HA 3UPFA 1Q1KA 2BABA 4JI8F 1S48A 5J2PB 2CJAA 3ELHA 4DL6A 2FB0A 3EE3A 4ZITA 2XGQA 5JVGQ 3PR4A 5B7WA 3TUZC 3MR5A 4KGZB 1NPPA 2A3JA 3MUVP 3KMQA 4J5OA 1Z2ZA 1UJ4A 1RU1A 3R9LA 2XY5A 3OHAA 2WHOA 4ZJLA 4FYDA 2CJKA 1EJ7L 3L09A 2K2PA 1HQ2A 1JB0C 3T6JA 4K7QA 3T9ZA 4U6PA 1HNVA 4I69A 4LBPA 3L95X 4ES1A 3JYTA 1WHXA 3OVBA 1U8WA 3GWCA 5JMNA 4KBIA 4FS2A 4ZJOA 5L46A 3L7OA 5E2QA 1CJKA 2RU9A 5A8RA 2NZ4A 4DFJA 2DGWA 1NEEA 4PWWA 3DDNA 1NRKA 3IR5B 3VAHA 5EHHA 5HQ8A 2MDAA 2XLKA 4O3PA 2ROGA 1SUQA 2BUNA 2DGUA 2DNMA 3RJMB 2R8JA 4PWDB 1RT2A 4DEZA 1APSA 3C14B 2NSCA 3I56S 3SCIE 3CCLS 4C97A 2R8HA 2V4QA 1X60A 3AQOA 2V9WA 1DLOA 2M4MA 2XS2A 1DQ9A 2UVUA 3D7SB 2YKNB 2HWHA 4ZDNA 3NGUA 2XZDB 1S9GB 1DURA 4ER8A 5KFGA 4YR2A 4X65J 2FLPA 2F8EX 2XG8A 3AQPA 4DV0F 3HHLC 4HTIA 1FNXH 2GHWA 4DHVA 2XS5A 3FGVA 1U2RA 4ZPVR 3EICA 2V8PA 4IYQA 3C46A 4LT6A 4DPUA 2FZKB 3FRYA 4M1KA 2RS2A 4RW6B 1ICEB 4NYOA 2YVSA 3CJKB 2VG7B 3EGVA 1NDCA 2XLIA 3VALA 2NXJA 3AH6A 1KQFB 3UR0A 2KM8C 4JI5J 2N82B 2RD5C 4WCEQ 4UY85 1VQSA 2DH7A 2FC9A 4DWIA 1H38A 2UUAF 2PDAA 4BWJA 2VPYB 3D3CJ 3KUHA 2NREA 1IBKF 4ED7A 5KFAA 3CB4A 1N5QA 1PYSB 1N5YB 2O01C 5F8HA 3V4MA 1QE1A 4RBVA 4EK2A 2X1AA 5CYJA 1KBRA 3IRXB 1U49A 1DAXA 3VGSA 2F4VF 2BKPA 1NSAA 4KQZA 4X66J 3HI9A 1JLGB 1VHIA 1M1GA 4CM2A 1GXLA 3X1LB 2GMHA 2ZEJA 4WYLA 3BR9A 4GKJJ 2OEKA 2DGSA 2BA9A 2FJAB 3BEGB 5GAGU 3DLGB 3DOLB 4KHRA 2P6TA 2DNQA 4QYZJ 1UP1A 3K57A 3GIMA 4L72B 2KFYA 3BGRB 3UN3A 3PKMA 4PPDA 1YK9A 2XHWA 1VBZA 3TZYA 1PCAA 2EC2A 1SJFA 4Z2XA 4K4ZA 1NB2A 1V9OA 1QTMA 4PZVA 3MPWA 4EUVA 2Y0SD 1RISA 4AXJA 4DV2F 1CJUA 1H98A 3BO2A 3W2WB 4F2SA 1NU4A 2B7CB 1WDDA 3F56A 1NBEB 3MWBA 2HBYB 4C8OA 3D54A 4OYMA 2B43A 2R8GA 2LXFA 5M2PA 3CSKA 4WFZA 2W9CA 5KFMA 3IP0A 2HHXA 1IR1A 3G4SS 4OQJA 3SZ2A 3GJSB 4JI7J 2KT2A 5L9XA 1EAYC 3DRRB 4OX9J 2E29A 1BY9A 2CJQA 3VHQA 2LQ9A 1UAWA 1UL3A 1RXOB 4J90A 1NJXA 2VKZG 1U0SA 3MR2A 2X1GA 4PR6A 1H0HB 1F2GA 4Z7YA 3HFVA 1VQ7S 1X9WA 3CVKA 1UFLA 3K7RA 3BBCA 1TUVA 3D1HA 5GAEU 1TELA 4YS2A 3I87A 4DJBA 4ZVEA 1GQEA 4ECUA 2RHQB 5BXIA 2B4PA 4CLTA 4LF4F 3QWPA 3KLHA 2RAQA 2HWIA 2W4DA 5C5JA 4K5SA 2C2RA 5GMDA 1JLBB 4KB7A 4M5NA 1RT7A 3M6WA 2WVBA 4I68A 4X4TA 3RB3A 1PJ7A 1ZETA 4GVBA 1OSCA 1VQYA 1N34J 1BQXA 2HGNA 4P2FA 2E5LF 2ZH2A 1NK0A 2VFTA 2I9SA 2QL5B 1T03B 4NCBA 2ATCB 2CNOB 3CNQP 3TAMB 3AB4B 2JOQA 4DSFA 3D28A 3G8TA 5J2NA 3OTBA 1RAOA 1RT1A 2YNHB 2XGPA 4I56A 2GZOA 4DPTA 4OHXA 5H9EJ 2GC8A 1LWCA 3CULA 4GO7X 2AV5A 1R27B 4UQTA 2GHVC 3M32A 1KD1T 3US5A 4I6AA 1VRQC 2M8DB 2ZD1B 4AQYJ 4ZVRB 2GMLA 4ZIVA 3NCQA 1SV5A 1RT3A 2WRMA 2ROEA 3MM9A 1Q7YT 4GMKA 2E5JA 2UV8A 2FHOB 5E3QA 2CPZA 2GIQA 5KFKA 3OLAA 4X2BA 3OSPA 2ZBQA 4FDFA 4NA2A 3R1HA 1G7CB 3A1YG 4NASA 1RYRA 1MWQA 1QAIA 2E9RX 1N5SA 3QT7A 5CCMA 3QMQA 3P49B 2JLGA 2GQCA 3H59A 3V6HA 3OFEA 3Q2TC 2H4WB 2L48A 2BW7A 4ZVFA 3QT8A 2WZ1A 4OIXA 2M7SA 5KFYA 3SBMA 1YJNS 5LSLA 2KXHA 3R6LB 2IIHA 1Q8KA 3ZFVA 2HHPA 3HJFA 1WOPA 4YFUA 4JI4J 5LJ5Y 4E0DA 4PQAA 5LXRA 5J1EA 4C98A 3RAQA 1PG5B 2IHR1 1X4EA 1HBUA 3Q22A 2YWGA 2IMWP 1JKHB 2OPRA 4F0MA 5B08A 1UVIA 2MZJA 3H7HB 1QUPA 5HROA 3MM7B 5LJ3Y 5C2CA 2FVPA 2KN4A 3TUPA 2DRAA 4PEOA 4OI1A 2ZWPA 1V5VA 1NO8A 3MI7X 2Y1RI 2VG6A 1RTZA 2YQ3A 5M2RA 2CPDA 2RQKA 4DX8H 2HMIB 2MXYA 1XNRF 4DR7J 1PIEA 1FRKA 1PKUA 2U1AA 4V19J 4RUCA 4DV4J 3GG1A 2PEBA 1UWAA 3TZWA 3L7UA 3R8YA 1IBCB 1IKYA 4TLQA 1D3WA 1HNWF 2XMMA 2ABYA 5CZVA 2KH9A 4CH1A 1S1XB 3TJ8A 4JV0A 1NZAA 2ZH5A 1T05A 1OY6A 4CH0S 2K7KA 2A2CA 5IT4A 3VAGA 2QTWA 1FJCA 2R7TA 3TVYA 4A47A 4XAKA 5IV3A 2MQQA 3BQ1A 2J8SA 4A48A 1S0MA 1UA1A 4F67A 2ZOGA 2ZNYA 4KRWA 1S59A 2FTRA 2OD6A 1YHQS 2HHSA 3TA1A 3QRRA 2B9YA 3KK2B 3SSSA 3HSGA 4NPOA 2GO9A 2HQIA 4HEA9 2MLXA 3IGNA 3ET6B 2NXCA 1AFJA 1D8ZA 3PX6A 4B3OB 3V81B 3NGKA 3EMTA 1DTTA 5A0YA 2R8KA 2F9JA 1S12A 4IDKA 4ZHRA 1CC8A 1Q8LA 3CF5Q 2CQ4A 3MR7A 2RUSA 2R2RA 2CFXA 3GYXB 2VJVA 1U6ZA 3LGHA 4ED4A 2W24A 3DXBA 4KHPJ 4JV5J 4KV8B 2ZZNA 2GGPB 3O2IA 2VU5A 1F0XA 1JLAB 4N76A 1HBMA 2UUTA 1EQ0A 1UZDA 4X84A 3M2VB 4CI0B 2M70A 3K17A 2IPOB 3SV4A 2WOMB 4IO9Q 3UD3P 2F63A 4J9QA 2OD4A 4Q44A 4RL1A 2JRSA 5C42A 3E2EA 5LMNJ 1GNKA 1TMJA 5E41A 2IDEA 3G71S 5HVGA 5K8NA 3PXGa 1F5AA 4F26A 1CG2A 1BWEA 2VBYA 3T19A 3MFIA 3NOCA 4DG1B 1TL7A 2ZDOA 3IC1A 4WU3A 3KK1B 5HMZA 1KNZA 1WACA 3W1YC 3UCUP 2BR0A 4ICLB 4Q45A 4Y2CA 1RCXB 2DHXA 2MQ8A 1Y7PA 3TQ1A 2Y8YA 4U7UD 3PIOQ 3ISZA 2F8HA 1TL4A 3IG1A 3M30A 5K8PA 3W65A 1Q82T 1K1SA 3IBCB 2CJBA 3T5KA 1RLDA 4MIWA 1JLQB 2XO6A 3SXLA 4DR3J 4OJ1A 3GFYA 1ACMB 1GK8A 4KGXB 1HNXJ 5HO4A 3TANA 3TI0A 1NNDA 3AFGA 4J9KA 1GXUA 1HPZB 4IG3B 1TTHB 3RTVA 1DTQA 4DSKA 5BYRA 3GILA 2JH3A 1SJQA 1YRXA 1G1XA 3ZZTA 1VIOA 1U4BA 3AOAA 3CUNA 2VG5B 1VRTA 1ZA2B 2ZH4A 3CJ5A 5CA5A 4ZVQB 3M1VB 3TZXA 3V6DB 3D9BA 4UOFA 3MDFA 4R8UB 3PJWA 2XMUA 1KLNA 4JI8J 1S6UA 1XMBA 3MURP 4PG5A 1S1VA 1KS2A 2B3TB 2MHEA 1UVMA 3B82A 4P10A 1JLCB 3P45B 4N7TA 4O44B 3H20A 2DIUA 4NLUA 3PIPQ 4CLZA 4AE5A 3ZTRA 1U1RA 2YTCA 4XPCA 4GRSA 4PQUA 2Z2ZA 3PYDA 1TL1B 5LL6d 3EPGA 3PRBA 1LOUA 4FKYA 5FIIA 2YKAA 1Q0NA 3FZBA 2ADCA 2LECA 3W60A 4PYAA 3HK2A 2QV6A 5F9NA 4O0IA 3G96A 1QVGR 4TLRA 5A76A 2P8IA 5HK4A 1UWBB 2C2KB 2OAUA 1HWIA 1U1PA 4EYIB 3RBXA 5LT5A 1H6KX 3BSAA 3FEZA 1D0EA 3IWXA 2RDIA 1F1BB 3O6QA 4MKBA 3ILLA 4KY3A 4QW9A 2GIFA 3GIIA 5D3GA 3C14A 2O67A 4CT9A 2E1RA 2HLTA 3W8PA 4GO5X 1N36F 5B0CA 1S57A 1S6OA 3KLGB 2CPIA 2HIQA 4B3MF 1N32J 2K3KA 1KRPA 4NXMJ 2QRRA 2XI2A 4DV0J 4DL3A 1TL3B 5DG8A 1NDPA 3LUYA 4OZ1A 4WIQA 2H4YB 3MMCB 4J9SA 3DLBA 1ZS6A 4LRBA 1NKEA 2MQOA 4C0OC 5KFXA 3I0RA 2EK6A 3E8OA 2Q6CA 1WI6A 2PC6A 4OL8A 2XQCA 3EZUA 2VBZA 4JI0F 1M90T 3C8YA 4RW6A 4HYKA 1HLWA 2XNQA 3CJKA 1ZM2A 3C15A 1YDLA 4IR9A 4F3MA 1M1HA 1FCAA 1KOHA 5RUBA 1KQKA 2QLWA 2W9BA 2CADA 2ATLA 3W2VB 1VISA 2OTLS 3DDKA 1X5TA 1TV6B 1WC0A 3GMGA 3K5PA 1IBMJ 4XIUA 4O3NA 3J7AN 4CLFA 4DV3J 5B0FA 2WCXA 3FJ2A 3U1NA 2C22A 3RW7A 5AXKA 3CJQA 1RGVA 1EX8A 3CIZA 2CPYA 3T5LA 2XEXA 2PMHA 4YQWA 2F9DA 4O4GA 4CNYA 3JSBA 1NHUA 1RWWB 1WJ9A 2V8HA 2AGPA 1PC5A 2YBVA 1JJ2R 2K7JA 1TUWA 1ZH5A 3HKZD 4R0JA 1L3TA 2UUCJ 1Y5NB 2E7XA 1HNZF 3H40A 1IQTA 4FF2A 2YNIA 3N4WA 2BRLA 3PJXA 5EX0A 4OHVA 1C0TA 1K47A 3OR1B 3LP1A 3Q8UA 2YX7A 3O3LA 3GFZA 4DPWA 4IKAA 2M5YA 2DNZA 5C25B 2EKNA 4NLVA 3NL0A 3W2WA 1SKWA 3AOCA 1XEZA 1H7WA 4DX7A 3VAJA 2CQ0A 4P72A 5GMKa 5KAKA 1N4LA 2DGVA 1NCLA 2YKMA 2GCFA 4CIOA 4CO5A 3I5CA 4F7VA 1TKZA 3DRRA 5F3ZA 2A2DA 4F3QA 5HJYA 4OZJA 4ZPBA 2WONB 2BXJA 2CQPA 1VRUA 2GA7A 4QWEA 2DH9A 3NP5A 2DNOA 2EI5A 3P96A 3HHLD 4OYAA 1RTHB 1RA7A 3M8QB 3EZOA 3MF5A 5KFOA 4PAAA 2NS1B 2B6AB 3BO3A 4RX6A 2M52A 2QLXA 3V5RA 1X4HA 3AD7C 2D9OA 4IH7A 1WEXA 2VONA 2J0QD 2F5GA 1BWVA 2XYHB 3L4BC 2AF6A 3FBBA 2APOA 4LF5F 3W66A 2AGQA 4OFZA 1B99A 4CYUA 3FNNA 4F4XA 4DV6J 4M5DA 5DJBA 4DCJB 2B9XA 1RT4B 3EM1A 4P74A 2I38A 1RAIB 2HFZA 3FUYA 1OO0B 4D3HA 2LVWA 2DISA 4RNHA 3R27A 1NDLA 5F8GA 2FYXA 3IAM9 1S1UA 2DH8A 3BJYA 5EDWA 2CPHA 2N7YA 2A6MA 4N47A 3W8GA 1M0SA 2AYEA 1F5CA 2D7SA 2LXIA 3CMQA 1T03A 1VFJA 3PNIA 3FVYA 1TKDA 3EUNA 3TAMA 4P2SA 4Y28C 1JNZB 1XJWB 2YNHA 3R5JB 3DLJA 4NCAA 4Y2AA 2R7UA 2GAHC 3E3XA 2RDJA 2WVEA 3TOQA 3SSQA 5DDQC 4LFBF 2B4VA 3QO9A 5T41A 3I4HX 3DHWC 2DHGA 4F4AA 2B51A 1RABB 2WSCC 3TX0A 4HHJA 1J2VA 1IR0A 2HHHF 4B9UA 3MTJA 4TYAA 4LR9A 4PXEA 1VGYA 3KTQA 4J9UE 3CJ3A 1QUVA 2VKRA 4CP5A 2FHKA 2L08A 2NUHA 4B3SF 1YLXA 2LDIA 4WP3A 4C8ZA 4F4YA 5E3CA 2BE7D 2ZHAA 3TJ9A 2OUGA 1AT1B 1WC3A 3E51A 2AEFA 5FDLB 1UCNA 4NCGB 4UOCA 4LJMA 4AL6A 3NCPA 2W8KA 1S4FA 3PJ9A 4EFAC 4QOTA 4P73A 3I0SA 2MMYA 1WNEA 1YBTA 3M8WA 4DI6A 1FJEB 4DDFA 2XY7A 3SFGA 3KDOA 5D4OA 1N54B 1OJ4A 3TVKA 4AL5A 2MKYA 3WC0A 2WB1D 5A8KB 4ZLJA 2BM1A 3Q24A 1GEHA 1Q16B 3T5JA 2V67A 1HD1A 2LA6A 3FRZA 2D1CA 1FA0A 4F4WA 2F7VA 4DV5J 2H1YA 5HAOA 2SXLA 4C3KA 2RDDA 4DUYF 1XNRJ 5E0OA 2B9EA 2FJEB 4DQPA 3PRVA 2E7WA 4BBYA 3ENAA 1KVKA 2DNHA 4G1QA 2DT9A 1S79A 5DDRC 3UQSA 1ZM3A 3FFIB 4NI2A 2GJFA 1ZM4A 3ETOA 2V68A 4RNNA 3EXCX 2OSQA 1QD1A 2IC3A 3PFOA 3RBEA 1F6TA 3IN5A 1XMOF 2YNFA 2RKIA 2UUBF 1RB0A 1B7YB 1R6VA 1W2BR 4DL0C 2JLEA 3KK3A 1JK9B 2BJDA 4TU8A 1X4DA 3I32A 4USVA 2XSFA 4RWXA 4WTOB 4DSLA 2RRBA 2HWTA 3PYGA 5KFTA 4ZMMA 2HHTA 4XDCA 4H4MA 3I5AA 2W25A 4C7QA 5HN0A 2Q1LA 2XWXA 3CCTA 3E01A 4M5IA 3KK2A 3R5CA 4WF9Q 3QPIA 5AE1A 2GVZB 5CYQA 1T3NA 4N56A 6AT1B 1U09A 2CQ3A 3CC4S 4Y2MA 3JTPA 2MZRA 1RWKB 5SUHA 2OPQB 1CC7A 4ZIWA 2EG2A 4I1TA 1GXTA 2DHAA 2COLA 1SVDA 4AD6A 5HJXA 4LRCA 4KGKA 2FHJD 2E1CA 4RBUA 4LVOP 2YY3A 3M9OB 4ZCIA 5EN1A 2IBKA 2FUG9 3CD0A 4DUZF 2XB2D 3OUYA 2ZE2B 2YXLA 3ISNC 2W7OA 4F8RA 1R89A 5KG0A 1HL6A 2KFZA 3RW6A 1J5EF 4RWWA 4A8KA 2WVDA 3HMJG 2BVZA 2C2DA 3QSYB 4PG6A 1X8DA 4HI2A 1EIYB 3KLIB 4DQQA 4MKVA 4BCAA 4YHHJ 4IO1A 2FJBB 4B9SA 3IS9B 4C3MA 2HNZB 2RSQA 1WHWA 4ED6A 3QIPB 4OMFG 4NZ6A 3G82A 2IA0A 1F3FA 2NQPA 4CT8A 1VQ5S 4ZLPA 1TVRB 2HPUA 5H9FK 2UU9F 2CQ2A 1R8HA 1IQZA 1H72C 4JI2F 1I51B 4N77A 3PO4A 4C2MA 1JJHA 3I55S 1Y00A 2VH7A 2CZVC 4NYPA 3TJAA 4I2PA 3PR5B 4IQXA 3QAEA 2DY9A 5C2GA 1ULRA 4A4JA 1OYEA 3EPIA 3LAKA 1EARA 2W9AA 3NWGA 3TNVA 3BF4A 2ZJRQ 3MM6A 1NM2A 4I6WA 5EX3A 3QATA 2JZ5A 1CULA 3QNWB 3UFCX 3C6TA 1C2PA 4IG3A 5HMYA 1TFYA 5CD4H 4GC6A 1IN0A 4EZ6A 2WTFA 3MPVA 3H98A 2ASDA 2VG5A 1FFSB 4OHYA 3PEJA 3MCOA 1QTNB 4WP8A 2BOPA 4B3RF 4QU7A 1HNVB 4IRKA 2EFPA 1N56A 1S7IA 3MPDA 2Y1IA 2ZC4A 4R8UA 3BKUA 1UEVA 5A8RB 2EEYA 2VQEJ 2BE2A 4MIAA 4RW8B 5IWAF 3W5YA 3KUGA 4IQMA 1KDNA 1ZTWA 3A8KA 4O44A 3PW5A 1XQIA 3NGTA 4MJKA 5D78A 1SUQB 2WBMA 1SC6A 2KB2A 2YKQA 3AD8C 5ETRA 2RH3A 1KFSA 4QR0A 4JV2A 3DRYA 1DLOB 5U47A 5L1LA 3TUIC 1FHTA 3ZZYA 1SJ3P 2BW2A 5J1NA 4B9LA 4TKTA 1K8AT 4JP8A 2AJ1A 3D6FB 5KFQA 2RUGA 3CC7S 1S99A 2HNDA 1NJIT 1TK5A 1S9EB 4Z37A 4CWBA 4QR1A 1HIYA 3HZGA 5DG9A 5GVQA 2OMLA 4ZS6A 3R97A 2KDOA 4YB7A 2B5JA 2YWEA 4USJC 5D15A 1FKOA 2R7SA 3KHHA 1WTFA 4NLDA 8RUCA 4USIA 2I2YA 3DKDA 1T9YA 4KFBA 5F41A 2XMWA 4WJBA 1X9MA 1CLFA 4TU9A 4ELVA 1A0OB 3SV3A 1UA0A 5CXTA 3SI8A 2E9ZA 2OHDA 3SFUA 4DF4A 4LF2A 4Q2MA 4MAKA 4Q2LA 5KFSA 4DV1F 3HXMA 3W63A 5L9NA 4LF6J 2K1RB 1G3OA 2ALZA 1MMLA 1NLKL 1VC5A 3HFZB 1KSPA 2C2EA 2E9TA 5M2UA 1M5OC 2RQMA 2J9DA 5AXLA 1QE1B 3FBCA 4WFNQ 1HW9A 3Q23A 1X4AA 2V5HG 3EYZA 4N5SA 1TFWA 1F5BA 2YQ1A 1R8AA 4EMDA 2W2MP 2CQDA 3GFXA 2HVHA 5C24A 1WF2A 1HBOA 2VL1A 4FYXB 1FXLA 3HF5A 4EBCA 3OV7A 2C3UA 4R5PA 4HT7A 4W90B 2NXEA 1H3DA 4L6V3 1W26A 4NLTA 1TMMA 2HFNA 5LSOA 1QDUB 2JC1A 2UVVA 4RZRA 1YJ9S 4PG7A 1AROP 3N01A 4EGLA 3MM8A 2MZSA 1NPRA 4RNMA 5DG7A 2ZUGA 2HVZA 3S6EA 1RP5A 1OWXA 2FVCA 1CJUB 4NL5A 2UXDJ 3K8WA 1NSQA 3ZNJ1 1IKVA 3TRGA 3QQCD 1BQNA 2CJYB 4HL9A 2V63A 2BRKA 4MMOA 4QWCA 3POTA 3NMRA 4HT5A 5KFVA 2MLZA 1H2UX 1HHQA 5H9EK 1XNQJ 2Z2LA 1KWMA 1B0TA 2AKWB 3QGGA 2W9CB 4O23A 2O1PA 5DM6Q 1U26A 4ZPDA 4DCPB 1KP6A 4F2RA 2HNYA 5JJBA 1VMBA 4FYYB 2LFVA 1D9DA 3CMES 3RB0A 2QSWA 1NPKA 3OR1A 1WELA 4K0KJ 1RBLA 2FPHX 4L74A 5IV4A 2Y1LB 4KGMA 1RE1B 1T9UA 2C2OB 3RB4A 2AWZA 1T0TV 4FF4A 5E5NA 5KFUA 4TQSA 1SH3A 1BQMA 2D69A 3NS6A 3KLHB 4FPIA 3RBZA 2ZH3A 3SSRA 4OZ5A 1T3OA 4DR5J 2KYXA 1RT7B 3DOMA 1SL2A 1S49A 2XMTA 4MKAA 4DV7F 5L1JA 3HHLA 4X62F 1AFIA 1SKRA 4CH7A 1CJVA 3RGIA 1OPZA 3KLVA 1ZBTA 2VODA 2HAFA 2FGOA 2KJVA 4LF5J 4JI3F 1KQSR 1RAAB 1D9AA 5J2NB 3BN4A 1RT1B 2R42A 2YPYA 5DQIA 4B9MA 3MECA 4OYWA 4PG4A 1GX6A 4BLGA 4I7FB 3RUBL 2KRRA 1Q53A 3GV7B 2YWFA 3N0VA 4ECXA 4C8NA 2DNKA 3VV2B 3ICLA 1XWLA 3S8SA 4S0MA 1SV5B 3RYLA 1RT3B 3N28A 4Q7AA 4K4SA 3MM9B 4N8NA 2RNEA 4DF8A 2YX4A 2UZAA 3H5UA 4M5GA 3W5XA 3M2UB 3MR3A 1DY3A 4ZP7A 4URSA 1H73A 4Y2IA 4ECRA 3PYFA 2LLZA 2J76E 3KHRA 2J9CA 2HKEA 1FNMA 2LDYA 3GONA 3K0JA 3Q89A 3V6JA 3F73A 1SH0A 4NLQA 4DU8A 4LIWA 2ZH1A 3NWRA 2XZWA 3OBIA 2ZBPA 3KXDA 1FJGF 2QEXS 2J7KA 4B3SJ 2H48B 2B7BB 3OJSA 1RYSA 2W2QP 2J6TA 4KH1B 5J1EB 4YB5A 1RU2A 4CLLA 2UXBJ 1HBUB 1NJZA 1R7IA 1NK5A 2OPRB 4LF8F 1RWVB 4F04B 3FEXB 4MH8A 1EB0A 3ZC4A 3TEGA 5HROB 4UZBA 1TU0B 1VBXA 1U0HA 1FD8A 5K14A 2Z57B 3VF0B 4QPXA 3OL7A 3DLHA 2EWHA 4ZOSA 2ZM6F 4DPXA 4I2QA 2LEPA 4U67Q 4DUTA 2VG6B 1HHTP 3VAKA 1Q8IA 1RDRA 4ED5A 2HGMA 2V8GA 3EXYA 3NRBA 3MEEA 4U9RA 5BYQA 4JI1J 3FEYB 2KVQE 1IKYB 3ZNUA 2IY5B 3M6UA 4J9PA 3FQKA 4H4OA 2HFUA 3KG1A 1WEZA 3B78A 5IT9Y 1T05B 4TY8A 3CCSS 4H4KC 2PI4A 2G2OA 2EK1A 3ETMA 1AZSA 4EBEA 3IR7B 1PYTA 1AB8A 2OP5A 3ZO7A 4ENOA 2EG1A 1SJ1A 3V4IA 1E6VB 1FTCA 1UW9A 1YQHA 3NBPA 3CJ2A 4NEZA 3DLEA 3DMJB 1IWGA 4FP9A 1L5UA 4QWDA 2PMZD 4PXDA 1AYEA 2BJ8A 4QIWD 1N5VA 4LRAA 3KLFA 1DTTB 4K59A 5ETSA 5A0YB 3RRHA 4OI0A 4ECWA 4Q5VA 2IYIA 4IDKB 4ZHRB 2FY8A 1I94J 5I4MA 3CDBA 2H65B 1MWZA 4ECQA 4A8XA 1RWMB 4TU7A 4M95A 1JXEA 2D9PA 4QJVA 1BXNA 2P9EA 4P9SA 2QGFB 2BANA 3NKYA 2JVOA 5B0AA 3DRSB 4NRTA 3L7PA 2C28A 5F3TA 2KHDA 2UV8G 2CQIA 4K8RA 4ZVUB 2DNGA 4B3TJ 2PD1A 3Q83A 1YSJA 1HBMB 3GYGA 3S7RA 1RT6A 3DGVA 2HQFA 5F8NA 2YQ0A 4L73A 2PIIA 3T6BA 1S0VA 1RAGB 4LFAJ 5ETLA 3UVJA 4ERDA 2Q66A 2GVZA 4I67A 4J7CA 2LP4A 3AY0A 2VQFJ 2G9OA 2QLBB 4CCHA 2WSEC 5KOWA 2NPFA 2MHNA 4DFKA 1PJ5A 2CQHA 2VD3A 4UTGA 4ZN1A 4M5KA 1AA1B 3LWLA 2J6UA 1SCJB 1LV5A 1U1MA 1TL7B 4DUZJ 2RRNA 2PMWA 3WDOA 2FHJA 6FDRA 3S01A 1J5EJ 4NLOA 2KO1A 3PZPA 5DZ6A 3W9JA 3PTWA 3A8IA 4B17A 2W4CA 5J1PA 3CJ8A 3IG1B 3M30B 3W5ZA 3LGNA 3IFEA 5T7LA 3CCRS 4G1PA 4DR2F 4A8QA 3D6HB 1RLCL 4C3LA 2R2TA 2ZJQQ 3HT0A 3IS9A 1M5SA 2XULA 1QSYA 4I6YA 2WB4A 1ROFA 1DTQB 3VCDA 3D6MB 4KSEB 2R7RA 4C11A 3VAIA 3AJ1A 4DSJA 3PDNA 4DR4F 2CZ9A 1WKKA 4E2FB 4V1Ak 5E33A 1VRTB 2RVJA 1EP4A 2ZH6A 1X5SA 1T9TA 2XYGB 1F60B 1FRLA 2E5IA 4RBTA 2DXDA 1S1VB 3WX4A 3TZZA 4KKOA 2MEWA 4MYUA 4PXCA 4OYPA 3T41A 5DRKA 3HD1A 2BQRA 1D1UA 4WK3A 2J9EA 4PQUB 4AXIA 2LKZA 4DN0A 3IM8A 4OJHA 2FC8A 2DPJA 3OHBA 3KJQB 2MKJA 3M2RB 4NRUA 2PGCA 4LF9F 3R7NB 3N6MA 1H2VZ 2QMUB 4UW2A 3FCHA 1REGX 5AJ3J 4Y3CA 1A6LA 4ZP9A 4U7CA 1X4FA 2NYHA 3MXHP 1XERA 4G3IA 5IWAJ 1REVA 1FT8A 2V2QA 1R8PA 3MAAA 3CCZA 4B08A 4RW8A 1Q8BA 1UPPA 2RS8A 2UXCF 1U2CA 1K44A 1UPMB 3BH6B 1UJ5A 3QIDA 4ELUA 2LQ8A 2BM0A 1RTDA 3TO8A 5D3GB 5IT9U 4ED2A 4OZ0A 2E5GA 1RKJA 8AT1B 2QLFB 2NXNA 3QAUA 1TP7A 4M5JA 1NSKL 2RHSB 2P6SA 4IG0B 1HNIA 4C8KA 2JEFA 4FYWB 1QY7A 1B4SA 2ZVSA 2ILYA 4FKXA 4ETXA 1R0BG 2MQPA 1H2TZ 2Z0GA 3RB6A 2HVDA 3VQTA 1PGZA 5SZTA 1ZAWA 3ZZOA 1C1BB 3ITHA 1S9EA 1EQMA 3VWSA 1RBAA 3I0RB 5JXSA 2YH1A 3NGDA 1HR0J 1SJ4P 1FX2A 1RACB 1BLUA 3ISND 5HATA 2XLJA 3QGPA 3PM9A 2BJ3A 2MZTA 2B0GA 1JLFA 2BJ1A 4NLSA 2KXNB 1ZM9A 3BPSP 4CZCA 3C15B 4CQ1A 3DU6A 1NJYA 1N33F 1YGYA 3GE9A 5KT4A 4AL7A 4LSLA 1TKTA 3JSMA 2DITA 2VPWB 2W9BB 2GV1A 3CO9A 4OI3A 4WYWA 4HTJA 2MYFA 7FD1A 2R7OA 4UUWA 4OZ3A 4YB1P 2K1RA 2IJFA 4J9VA 4RUBA 5ITHA 4J91A 1DRZA 2MB0B 4IOCQ 2HZVA 4M8LA 3GJRB 3HKWA 3UD5A 1LWFA 1D09B 1XIQA 1ZAXA 2Y3YA 4O4GB 5FJ4A 1R31A 5K8OA 1IJFB 1FWKA 2WBRA 1SJRA 3H8YA 4OYZA 1HKAA 2YKPA 3D5MA 4WIIA 3TYTA 2J7UA 4QIFA 1TZ0A 4NXNJ 1IKXA 4X65F 4DXLA 3CJ4A 3N9UC 1P6TA 3GV8B 2YNIB 3IM9A 2A6OA 2PEHA 2OIHA 3H0PA 1OPIA 2H3EB 1X7VA 1C0TB 4EBDA 4YY3J 1FFWB 3LP1B 3HHKA 3RRKA 3DRPA 3GZ7A 5J2QA 1X0PA 4Y65A 4LFCJ 1SQGA 3CTRA 1SL1A 3HZEA 1JXLA 2HHWA 2BDPA 2DO0A 3AJ2A 1HWUA 3FK4A 1ZYQA 2KG1A 4OHZA 2V2KA 1M5KC 2HRUA 4HACA 2YKMB 5G0RA 2QSFA 3M8ZA 1U1QA 1T95A 3THTA 4IFYA 5KFJA 3BKFA 3G87A 1TKZB 3TARA 2ASJA 4OZ2A 3ZZ0A 2FJDB 2BX6A 4CLYA 1VRUB 2XWYA 3BGOP 2DB1A 1PYOB 4ELTA 3PW7A 4M63A 3NGRA 3BZQA 2F3JA 4ZKAA 1SKUB 4U8YA 2RRAA 1ELOA 1E6YA 1H74A 3KOAA 2V8VA 4X66F 2MQLA 3LALA 4MFBA 2X3GA 2XY6A 3MCSA 3PCOB 2ASYA 2G0IA 1MWYA 2QA4G 4CYUB 1X0FA 4GKJF 3HD2A 4JI6J 3O5TB 1RHMB 2JEGA 2FVRA 4M5DB 2WVFA 1NHKL 3W3SA 1YRTA 1GMWD 2G4BA 3BBBA 3MM5B 2P9GA 1S1UB 4F3OA 1NXIA 1MROA 3VZHA 2W7AA 4IRCA 4L76A 3UW1A 4JI3J 3JTNA 5C7PA 2YWWA 4Z7CA 1B7FA 2CPFA 3MOJB 4DS5A 3C16A 5A8WB 1X9SA 4Q0BA 2CKWA 1P8GA 3FCWA 2IAJA 3F44A 4ED1A 4OZNA 1C0UA 4RW4A 1RHUB 4I7FA 3PACA 4OX6A 2FY1A 1VBKA 1RWOB 3QO9B 3NOGA 3CDWA 4RJVA 2XSJB 1TQLA 4BC7A 4GKKJ 1OQ3A 3KHLA 4Y00A 3VVUA 4UF4A 2ALYB 4JI7F 3VZIA 1S4EA 2HIYA 4OX9F 3P6YC 5HLFA 1SPBP 2BJ9A 4HDGA 3LF0A 1KLMB 1G2EA 2IM2A 2KKHA 1EKRA 3RRGA 1WOOA 1DBDA 3D0GE 1WG1A 4HHHA 3M2UA 2JEIA 2JJ4D 5KT7A 1U6BA 2CDQA 2VASA 1RCOB 3BYRA 2DGQA 3AJDA 3PKYA 2DR9A 2C42A 3UI3A 4EZ9A 3Q8YA 3GQCA 1F9FA 2C2ZB 3CDUA 2BACA 5ETQA 5HP1A 4WTYA 2ZNZA 2M9KA 2E1PA 4ECSA 3K5LA 3UN2A 4PPZA 3T1HJ 3I0SB 5E7OB 3IR6B 1HBNB 1VC0A 4DS4A 1RAFB 3BYPA 2VUGA 1NH8A 1RADB 4J9OA 2VZ9A 3A3NB 3OL9A 2LEBA 5KG7A 4Y34A 1URRA 3DOKA 3FCVA 4PG8A 2XO7A 1VQ9S 1S1WA 4OHWA 4LF7F 3ILJA 1O8BA 4DMZA 1RZMA 3UNGC 2CQGA 3T1YJ 2ZITA 4W4MA 2HVEA 3H90A 1FERA 4PXBA 1XK8A 2LCWA 4ZPWR 3UDCA 4HHUA 1LXNA 3LTOA 3PO5A 5KFDA 4G1QB 2EFGA 3SEOA 5KG5A 2U2FA 4IR1A 4AQYF 3THVA 2HZAA 4B02A 2AD9A 4NI2B 1QSLA 1S1TA 4RW7B 3MUTP 4BWMA 3HPOA 2DPIA 3LPEA 2DEJA 4ANEA 2ZKTA 3RR7A 2Q43A 3BO4A 2IC3B 4ED0A 4R25A 2IVFB 2YNFB 4JYAJ 4ZPAA 2RKIB 3DLKA 2DJWA 1VCTA 2G0CA 5KG3A 1FDNA 5G4DA 1J27A 2OEMA 1YI2S 3KK3B 4OX7A 2DHSA 2R7VA 4HDHA 4ILLA 1E6VA 3BQ2A 2BQUA 3HDSA 4RO0A 3BM7A 3D2WA 2LU2A 5KFZA 4H4MB 4U8VA 4Q8FA 3DMJA 3DCAA 2UP1A 3E01B 1XMQJ 4NLGA 3SDEA 1P27B 5CYQB 4USMA 2JFDA 1NK7A 2DNPA 4NLYA 2WK4A 2DHHA 1DQ8A 5KG6A 3GIKA 1S6QA 3LA0A 4X64J 3D1QA 2IYGA 3DI6A 3I9V9 4NE9C 2ILZA 3NS5A 3MAHA 3DRSA 2KRBA 4PUOA 2POKA 2QE5A 3DDIA 3ADAC 1NUEA 4NOHA 3TEHB 3OUYB 4JUZA 3FKBA 2NYIA 2QMWA 1J5OA 3FMBA 4ZVOB 4DR7F 4KC5A 3R5AA 4DV4F 4D3GA 2KFNA 1CJTA 4ZVTB 2PFFB 5D0HA 1YX2A 2B9WA 2EFVA 1N6QA 1CPZA 3A8JA 1YG0A 1YJVA 3EWGA 1EZZB 2KVIA 3KHGA 2B8PA 3G82B 3OT9A 2CWXA 1ZZFA 3FSYA 2CDRB 1RA6A 4MK7A 4ZVGA 1B0VA 2FJWA 3BV8A 1VQ4S 3TWZA 2XS7A 1GH8A 2OTJS 2W4PA 1OYDA 3GV5B 2RMLA 3J80U 2ZZMA 4DR6F 4I2PB 5ETOA 2AJQA 2NLWA 3G2XA 2C2MB 5ETPA 2FJXA 3G8SA 4ZCLA 4URQU 3OL6A 3J7ZT 1AXQA 4EYHB 3NY0A 3MM6B 1L3UA 3JQJA 1CULB 3C6TB 2FLNA 2N7CA 4MKYA 3A3PB 3LOUA 4B9NA 1OY9A 4OV6A 1IBLJ 3OXLA 3K5NA 4QZVB 3LO3A 1R8BA 3GJQB 1HQEA 2KU7A 4EU0A 1ZOTA 2FZCB 3W9HA 2QMXA 1N52B 5IZHA 4C8LA 3G6ES 4LBHA 5B0EA 3W61A 1U8SA 3H5XA 4KHPF 4DPYA 4C8MA 2BE2B 2VA3A 1FDBA 2PO4A 3T1AA 4YP3A 3AHPA 3PW2A 1HFEL 4C8YA 3AT1B 3C19A 4C4WA 1WKJA 5L1IA 2IDLA 4YOEA 4K4YA 2N3LA 1XR7A 4Y6IA 5AE2A 1VS3A 4PKDB 4PYDA 5DS7A 1QAYA 5LMNF 2QX0A 1A7GE 3N5BA 3LP0A 3M2RA 2K3IA 3PV8A 5DM7Q 2RF2A 2BOAA 2NZCA 2OGUA 1EETA 1RT5A 2EFNA 2ZVIA 4K4WA 2HNDB 2FLOA 3THPA 3GSIA 1K9MT 3TW0A 4A46A 3QZ8A 1OS5A 2HFVA 2R8IA 3AB2B 2R7XA 1RK8A 3ZZRA 2EC0A 1ITPA 1TKXA 4V19X 3Q8RB 2B5JB 3CD5A 1SH2A 3UD4P 3BGFA 5DGAA 3PY8A 1FKOB 5I42A 4O3QA 1QLNA 3QZ7A 4KFBB 4DR3F 1UVLA 1FKPA 1KTQA 5KFCA 1WC4A 1URNA 2A1BA 1FVSA 3ILIA 2DEIA 4DQSA 4IG0A 5D77A 5GADU 4X4PA 1FK9B 2DXFA 3KJNB 4UUXA 3BQ0A 4CRJA 2CNNB 1GAOA 3PW0A 1X5OA 1CQMA 1C1BA 1JNRB 1RWXB 1UKUA 3BPDA 2CIMA 3VVTA 3HT3A 2GS8A 4KO0B 3TAPA 4KYZA 2ACYA 2OO4A 2ZFHA 1RI7A 1LWXA 2ZBCA 3H5YA 4FPRA 1HW8A 5AE3A 1N33J 3NS7B 3UO0A 3PVXA 1B70B 4PWUA 3HFKA 2GHPA 2B4UA 1HI8A 5D8HB 5C24B 3GU0A 1HBOB 2LQJA 3A4TA 2PA8D 3QT6A 1K0VA 2CVEA 1EHWA 4ID5A 3CCVS 2PFDA 3KNGA 4G1IA 5IQQA 2UUAJ 3GG0A 4X4UA 4KPYA 4R5PB 1IBKJ 1U1OA 2UVRA 1Y5IB 4LSNA 4NX9A 2KXFA 2FIUA 3ZTOA 3IWNC 1LXJA 2RJZA 2CRLA 2BEFA 1UW4A 2F4VJ 3MM8B 3NAHA 2HHVA 3AAWB 5A6WA 3WC2A 2R3VA 2F1FA 5GMEA 1YBAA 3D0IE 3QWUA 2LQBA 1IKVB 2XI3A 2CQCA 4ECZA 2GJ2A 1K73T 1BQNB 1Y3KA 2D41A 2FD2A 1TK8A 3R2DJ 3POTB 5EUHA 5D4PA 4WBFA 3WBZA 1HD0A 3C3LA 5HMXA 1WEYA 5A6PA 4ZPTR 2OFGX 3LW5C 3TP2A 4WXWA 5H9FJ 2ZHOA 1KHWA 1N32F 2DIVA 3CJSA 3T5HA 4NXMF 2QL9B 3P5BP 1S77D 2HNYB 3R5DA 4OV1A 3KKFA 3IA0A 4CO2A 1LWEA 4DV2J 2KYZA 2QFJA 1I6JA 2VDIA 4DX5A 1LKZA 1SB6A 4QR2A 4OYIA 4A8SA 3CDEA 3UR3C 2KHCA 3QSIA 5IXUA 4A8MP 3G86A 5F0WA 2MQMA 1HMVA 2J0SD 1P9QC 2GFFA 3NLCA 4RU2A 4LREA 1WOSA 3A8EA 3CT9A 3H4DA 3NAIA 5KFRA 2A0FB 3L9ZA 3D0HE 1BQMB 1R8CA 2AZ1A 3OSNA 5HL7Q 1MMDA 2A10A 2I5JA 3SMZA 5D0RA 3QGHA 2J0WA 5K20B 1HYSB 4OI4A 4K2XA 1M5HA 3DOMB 5CCLA 3R1LA 4N8OA 2N4DA 1Q4RA 1M5VC 3MZIA 4TNOA 1S0OA 3HHLB 1TK0A 2FZGB 1YJWS 2FQQB 3QRPA 1CJVB 1IBMF 3LPYA 2X1FA 3HVTA 4DV3F 2UUWA 1B64A 4RNFA 5F8LA 4LF4J 2VOPA 4CLUA 3AOBA 3MECB 4FXVA 4A8WA 3QRQA 4CM0A 3I31A 1S6PA 2KM8B 2W2NP 2ACMA 4JB8B 3TA2A 1VOMA 1TAUA 4ILMA 3HHDA 1GMWA 1P1TA 2E5LJ 4ECTA 3MM5A 3JB9k 2UUCF 1WHYA 3G8QA 3AXMA 4DQRA 2DNLA 4YUDA 4F02A 3DGPA 1G4CA 5EGYA 4Y0FA 9ATCB 4NLWA 4YR0A 1VQNS 3WHIA 1H7XA 3MR6A 3IGVA 3NNCA 3MAQA 2WVCA 2IJNA 2OMOA 5A8WA 3VGUA 2XMKA 4USTA 3C6UA 3IXQA 4BDPA 2I1RA 1LFPA 4M5HA 2R4FA 4TN2A 2VPXB 2AEJA 2OPSA 5I3PA 2XSJA 2RB7A 2Q79A 3P8BB 4J9RA 2HS3A 2YH0A 5BJRA 4J9LA 1X4BA 2MTLA 1TUGB 1T8EA 1FWPA 5I3UA 4C48A 2AMCB 5HBMA 1WF0A 1KLMA 2EFOA 3PEHA 4F50A 4ILRA 4ES2A 1S5ZA 4XK8C 5L8RC 1C1CA 4LQ9A 2VF3A 3CD6S 1SC4B 1HA1A 3RU0A 2P9CA 3CO0P 4OZLA 5FD1A 3QJJA 1NJWA 4WZQA 2RQ4A 5J2MA 5D0EA 2Y8WA 1GTEA 1U0HB 5K14B 1MSWD 3FSIA 4F0HA 2Q6BA 3OVSA 3K5OA 2E1MC 3CIMA 3G6YA 2MGZA 4I2QB 3CGIA 4DV6F 2QFIA 2MKKA 3BREA 4OYBA 3HVRA 4KH0B 3MEEB 3CE8A 1HBNA 1CSJA 4RKUC 4NLPA 2L9DA 5CZXA 4LF7J 3ZTQA 2IM0A 4XO0A 4FYVB 4TY9A 1Q95G 3CWJA 2DRBA 4H4OB 4Q8EA 3DFEA 5D4LA 3MMBA 3GPAA 1UVJA 4TY8B 4RW9B 5D4NA 5D6GA 1RTJA 3OXGA 4WKYA 1AZSB 3HSDA 3BN7A 3D4JA 3N6NA 3PFEA 1FF2A 4QBUA 1ZZNA 1JLEA 1OIAA 2HURA 2KL8A 1G6BA 4LRDA 1Y11A 5E3AA 2MKHA 3V4IB 1SKSA 2G2YA 4RLEA 3IAS9 1O6XA 1FXDA 3NBPB 4X4SA 1U2FA 1U47A 3CJRA 3DLEB 2M8HA 5IC6B 3F41A 1HNWJ 3QJLA 2OFHX 2O5DA 1ZPVA 1U6FA 5CYMA 2VFUA 4IUFA 1DFDA 1WC6A 3HSJA 4RW7A 2DXEA 3KLFB 3DYAB 1OMSA 2ZZTA 4IFVA 3Q2SC 2MZ1A 1S9FA 1FE0A 1DHMA 1UZHA 3M05A 2I8EA 3KG0A 2BANB 1Z2LA 3I9ZA 1XN9A 3HLUA 4LR7A 3UCZP 1GTHA 2W1BA 4LR8A 2AYGA 2Y1JA 4QW8A 1RT6B 1SC3B 1OY8A 2PI5A 7AT1B 4LRFA 3B54A 4AYBD 1FVQA 2DTJA 3MEKA 3UVJB 2CYYA 2VDHA 4A8YA 3GIJA 1U25A 1QVFR 4QIVA 1T7PA 2CZ4A 3WIVA 3I82A 3Q8SB 4USKA 4F4ZA 3IBWA 4FN5A 4CLKA 3KMSA 1QSSA 2VIHA 4DV5F 2RU3A 4WFBQ 4L75A 1R0AB 1RBOB 4MK8A 4CLSA 5LSRA 1WG5A 1X5PA 1FWLA 5HI7A 1IWAA 3KLEA 3CW2C 3CXCR 5KT2A 1N48A 5IQ6A 1FTRA 1GX5A 2JL9A 5T7LB 2HZCA 2ZBIA 3ENWA 1GMUA 3ZZPA 2E44A 1JJ4A 1HI1A 1YWXA 4BC9A 2YNGA 4OI2A 1FO1A 4P7VA 1RUSA 9RUBA 2ZWOA 3M8PA 2X7IA 1MU2A 4C11B 4WKRA 3VQSA 2V9KA 3BB5A 3GLJA 2M0GB 1IM6A 1YIJS 2OJ3A 1EP4B 1LW0B 1RQ0A 3KG4A 4FVCA 2DNNA 2X3DA 4DR6J 1ZA1B 2GVDA 4DLEA 1U24A 2ZBRA 4K2JA 3RG6A 2XBPA 3FSXA 4DFPA 4KKOB 5F9LA 1IUJA 2MKCA 2DYAA 2AQ4A 3ENVA 3CCWA 5KFIA 5KFBA 3VAFA 3GCXP 2D74B 4WE1A 3MMAA 1T9WA 4CO1A 4UY8T 5IM0A 4K4TA 1MG7A 4QCLA 5CD4A 3MEGA 3EVMA 2CG8A 1T9XA 4HI1A 2DR5A 2I6WA 4H4KA 3BSOA 2MKSA 2AT1B 1T11A 3K89A 1VJQA 4KPCA 1REVB 2V2VA 3OTEA 4XDDA 2VA2A 3NNAA 2CAJA 1HWJA 3MAAB 4K4XA 1FJ7A 4CO0A 5F8JA 1XBWA 3PRDA 1VQOS 1WSVA 1HWKA 4HH0A 4DSEA 3OTOF 2AHOB 5KFHA 1HHSA 4DPOA 1RTDB 1X4CA 2CPJA 4FVMA 3SQGA 2J0XA 1V3SA 2QLJB 3D66A 4KIAA 4YHHF 2NR0A 4CTAB 1KKHA 1RWUA 4X4VA 3QFHA 4QYZK 4DOZA 2A18A 1U1KA 1C4CA 1HNIB 2V4JB 4P71A 4M5MA 3DM2A 2ZH9A 3Q8QB 3QLHA 3ITHB 2WSFC 3GB0A 4CO3A 1KHVA 3FMWA 3EVOA 3ENQA 1Q81T 3NGSA 4MIBA 5JVHQ 4PABA 2LMIA 1U45A 1B3TA 4OJGA 2VV5A 4OI6A 3QGIA 1N36J 2OEJA 1JLFB 1RTIB 4B3MJ 3KJVB 3PX0A 3UE2A 1Y10A 2YKOA 1FRJA 3M6VA 3RBDA 2P2CB 2EW9A 3BGUA 3P4UB 5MLCV 4LSLB 1TKTB 3JSMB 1YRUA 2BZ2A 3C66A 1FK9A 4ED3A 1HQUA 1Y5LB 2QA1A 3B4MA 1T02A 2EVZA 1W7WA 1ZTTA 2OKQA 3GP9A 5HQLA 4JI0J 4L3KA 2GNKA 1XR5A 2YPZA 3IO1A 4KO0A 4L3NA 2VQEF 4DR1F 1RJJA 5J2PA 3BGLA 3MPYA 1FD2A 1S7HA 2FGCA 3HM9A 1VC6A 5GAHU 1YBUA 1NSPA 3U1MA 1JX4A 4W92B 2QN6B 1LWFB 2AGOA 2LA4A 4BHQA 2EBGA 4WXOA 3LWMA 2V94A 1IM4A 4KHMA 4P7TA 4X4OA 3MEDB 1WC1A 4NZ0A 1NK9A 5H1SV 2DR6A 1YITS 2JWNA 1AUDA 4C6AA 1IKXB 4KJIA 1SC1B 4LVNP 2XCAA 1L3VA 2DGXA 3VAMA 1NK4A 4EO8A 3GR1A 2CPEA 1NKCA 3JQMA 2XCPA 2HQGA 2Z2YB 1IJEB 2OPPB 3CPWR 4PWDA 3DRPB 5J2QB 4NYZA 4WZMA 3NCRA 5EWEA 2XNRA 5LOQA 3UDVA 2K06A 4ZLLA 4P6QA 4F0KA 2DGOA 2YKNA 4TXSA 1EKSA 2R9LA 2DO4A 4HACB 5L38A 1HNZJ 1S9GA 3BDPA 3NNHA 4I64A 2AJ4A 3DU5A 5G0RB 4IFYB 3T9NA 2GAGC 4YEAA 2HLUA 4FZVA 1DJ0A 4EEYA 3MFHA 2P5VA 4G65A 1FESA 3BH7B 2QJ3A 3UDLA 4LF6F 1CVJA 4HR2A 2F4FA 5KFNA 4USWA 1UFKA 3WIUA 1CS4B 3K5MA 2RE1A 4RPFA 3K59A 4ANDA 2QYGA 1E6YB 2VG7A 3A12A 3RAXA 1S76D 1VDHA 4MFBB 2AIRB 4DL2A 4NMXA 2G1DA 1AW0A 4YN3B 2IRXA 2IJRA 3LH2S 5EWGA 3R2CJ 4F36A 1WG4A 2JDJA 2ADBA 3J81Y 2VOOA 5IFMA 1HYSA 1N5YA 1JMTA 1MROB 4ZJQA 1U7LA 3IRXA 2IVYA 3MD1A 5BR8F 2DGTA 5HANA 4TVAB 1JLGA 2HS4A 3C16B 1F9HA 2HG4A 2HRTA 4Q0BB 2UXDF 1Y4ZB 5BYSA 4ZCMA 4FNHA 2IAJB 1M1KT 2AJ2A 2H51B 3BSNA 1C0UB 3DLGA 3SIPB 4RW4B 3DOLA 3ULHA 4WK1A 3ZZZA 1JXVA 1N0VC 2KI2A 1I1GA 3R3TA 1PILA 2CWKA 4R0EA 5GADI 3BGRA 2EKYA 1XNQF 2LXUA 1Q78A 1VIXA 2AYMA 1KTVA 2BKOA 4RUAA 2HFSA 1SQFA 2JX2A 2VB6A 3H2UB 1VYAA 1T9VA 4U7UK 2XTJP 5HLFB 4TYBA 1FRHA 3NMAA 5IC4B 1KN6A 2RQCA 6FD1A 2R7WA 1BGXT 2GQQA 2V50A 3M4XA 1JJCB 2KZZA 1Q79A 3WX8A 2GX8A 3SCKE 2B56A 1UJ6A 4K0KF 3A3OB 1KVIA 3HVWA 2J7WA 2L41A 4LFBJ 3K2YA 1V5IB 2KG0A 4QQBA 3AODA 2AX1A 2CQBA 4QWAA 3PHEA 1V3RA 1V3ZA 4I4BA 2FVQA 4JV1A 1LEOA 2G1HA 5HP1B 2ERRA 2HHHJ 2C2NA 4KT0C 4P75A 1R6YA 1Y3JA 1O51A 1BD6A 2VICA 3D68A 3N5FA 3HHEA 4DR5F 4DSIA 1N5TA 3MCMA 1Q7LB 3QYYA 1GT8A 2XC9A 5LXYA 4RR5A 2CXEA 3R7BB 5KOXA 3DOKB 4UZCA 1FXRA 1M5PC 1S1WB 1BMQB 2KJWA 4KAIA 3EDQB 4WPAA 3HCXA 2IM3A 2DNRA 3D6TB 3TX8A 1LNQA 1O5JA 4WFAQ 5FLXY 2LYVA 2DBBA 1IKWB 1K1QA 4QWBA 4O3SA 1JIHA 1Y0HA 1JLBA 1P1LA 2NPIA 2QO3A 4WU2A 2XYPB 1UMJA 2D3O1 2ZKUA 4ZCKA 3MPUB 3CCUS 3O8WA 4CO4A 1NDKA 1MW7A 2HQDA 2MKIA 1S1TB 2ZH7A 2HBRB 5LMUF 5F0UA 4QIGA 1XR6A 3CCES 4RW9A 5F8MA 4DUYJ 3DLKB 4DL5A 2IRUA 1U48A 3M6XA 4ECYA 1RAHB 3UDEA 1Q5VA 2ZD1A 4CNZA 3J7YU 2DKOB 1SXLA 1KC8T 4ZK7M 2M88A 1RHJB 1VK3A 4LF1A 3SDEB 2IM1A 3UCGA 4DN9A 2NSBA 4O3OA 4RNOA 2WW4A 2GQ2A 1XMOJ 3DYAA 1WWHA 2UUBJ 5DQHA 4LBIA 4LUBA 3PYEA 2J9DE 4J37A 4RU9A 4X4RA 3PX4A 1UEKA 3JS9A 1S6QB 4LSZB 3LP2B 1GMVA 1VI7A 2D3UA 2UXBF 3HSZA 5GAGI 1SL0A 5ADZA 1QAXA 3DI6B 2AP6A 4H54A 3J81U 1FRIA 4PUOB 3DNCA 1PAEX 2QA2A 2DR7A 2YWHA 3GFHA 3OXFA 5HVFA 1VQ8S 2ASLA 1VQMS 3OR2B 2XMVA 2AJFE 1YKWA 1J5OB 2HEKA 1RHKB 2FHMA 3N6LA 1Z1ZA 1LK5A 4JI1F 1UVKA 3WQPA 3QJPA 1CJTB 2LEAA 1OSDA 2ZDPA 2RILA 4MYTA 1N6QB 2CJXB 1JKHA 1QJHA 2KZMA 3KWMA 3MM7A 4J9MA 2PT0A 2R2SA 3KNAA 2Z8QA 2JEJA 2EFQA 2VFSA 2Q3PA 1U1LA 4N41A 1JWWA 1X4GA 1KQGB 3M8RA 1R0AA 4EI2A 2O3DA 3GYNA 1HARA 1K0TA 2HMIA 3OPKA 2EBEA 1KVJA 1FRMA 2ZC3A 2GO8A 1UEUA 3ONQA 3Q86A 3RAMA 2V0NA 4TQRA 2BKNA 2MPUA 4GVLA 2HFOA 1NK6A 1S1XA 2MSSA 5KFFA 4USUA 2V4RA 2UU9J 2QYCA 1VQKS 2K8GA 2JC0A 4P52A 5GAEI 4ED8A 3RR8A 4JI2J 3JSRA 4DZ6A 3P5TL 1I94F 1YJ7A 5CQGA 1LW0A 3N79A 2L9NA 1D8YA 1HQEB 3EVWA 1ZPWX 1SQEA 1FEHA 1FKAF 1NMEB 3GSDA 2MQNA 2DVIA 3OFFA 4B3TF 2NXUA 2DR8A 4KTQA 1FDDA 2E1AA 1R43A 2AX0A 1LW2B 1Z4UA 3ET6A 4DQIA 4NLXA 4LFAF 4B3OA 3V81A 1RHRB 2XZTB 3S1TA 1IXKA 1Y9OA 3PW4A 2BJEA 3DRXA 2YWKA 2HRYA 3QFWA 3EX7B 1NKBA 5DDPC 5FLXU 2R2UA 3LP0B 1RWNB 3V6KA 2VQFF 3G6XA 2JFKA 5AXMA 4B3RJ 2E7VA 2H9ZA 1WI8A 4NLRA 2RF2B 4URGA 2HQCA 5K8MA 4GC7A 4QPTA 3VGTA 1EETB 3WZ0A 1RT5B 4KV8A 2GGPA 1JLAA 5KFWA 5HQMA 3CDAA 3M2VA 3BKTA 4A8OA 3H5SA 7FDRA 3FBEA 3OTOJ 1TKXB 2B8QA 2WOMA 3W7BA 3TQEA 2X51A 1N8RT 3ILOA 3LQVA 4C0BA 1WKLA 1U1NA 4NMLA 3FC9A 5I42B 3MMJA 5I3QA 2DCUB 1FKPB 5CHCB 1VQLS 1NHVA 3HO1A 3CCMS 2YX1A 4CTAA 4M5LA 2V34A 4DG1A 3I5BA 1MMNA 3KK1A 2V4JA 4RUHA 3EGWB 2GMJA 1F9EB 2VPZB 2RIJA 2CVIA 4ICLA 1FX4A 5B0DA 1FE4A 4IOAQ 4ECVA 2PE8A 4MTPA 2W01A 4C0HA 2OLWA 1JLQA 4CLWA 2ZUAA 4FS1A 5MAOA 2BE9B 3H2VE 1BE4A 1VLYA 4K50A 1C4AA 1RTIA 3KJVA 3CEDA 1HPZA 3BBFA 4F25A 1VBYA 3OVAA 2IBOA 4ID5B 1SIZA 2HS0A 4FNIA 3ZTPA 4DV1J 2G0JA 2QIFA 4HVZA 3M1VA 4LSNB 3V6DA 2KT3A 3JYTB 3H4BA 2H5EA 3OTCA 1F3VA 1S10A 5IS2A 2D3OR 4ATNA 3IBFB 1CBKA 1TAQA 5THWA 1CJKB 5AJ3F 4DR1J 2C3OA 2HHUA 5IOLA 3IMQJ 1JLCA 5B09A 4DL4A 1KR4A 4YDDB 2AJ0A 2AEMA 2RT3A 3OJUA 3UNYA 1RT2B 2Z4PA 3HP6A 4X4NA 1RWPB 2VBXA 1YJUA 1WSRA 1TL1A 2C1EB 3IWLA 2LU1A 1IVZA 1VK8A 5LM7E 3OLBA 2HHQA 3D1OA 2EXUA 1Q86T 4ZPCA 3B8HA 4M94A 3SYZA 3U27A 4UQGA 3MEDA 3M8YA 1KOOA 1X31C 4ZA1A 1NK8A 1UWBA 2Y9HA 2BQ3A 2MJUA 3W9IA 5A2QY 1FNOA 1W25A 1LWEB 4MK9A 3W62A 5CAAA 4Q43A 3I6PA 2L3MA 5AT1B 4CDIA 4QIEA 1DARA 5DO2A 3BS9A 2OPPA 1HR0F 4DCOB 2XMJA 2IVMA 1HMVB 2BMBA 5L1KA 4UT4A 2ZOMA 3JSYA 4PCQA 3J7Z5 4IH5A 5DGBA 3KLGA 4DZDA 1FFGB 2DNYA 4ZVSB 1S0NA 1U02A 4NA1A 3AA9A 1TL3A 5CABA 4ZVHA 3JAMY 2GW8A 4JI5F 3MMCA 2V6AA 3UN5A 2CNKB 2I5JB 2HGLA 5B0BA 5KG2A 3HHNB 2IFXA 1YJTA 3EGNA 3CCJS 2MJNA 1V6HA 2GIRA 1CQNA 5AXNA 3MD3A 5T14A 3GTYX 1ZAVA 3J7A1 1RSCA 4G6VB 5ETMA 1CS4A 3I4PA 3HVTB 1FEEA 5HMWA 5KT6A 2KT5A 5B0GA 3OFGA 5DDOC 3CMAS 5JUMA 1N0UA 1B0PA 2L9WA 3L3CA 4B9TA 4YR3A 1UFWA 3VTIA 3AXKA 2WAQD 3W2VA 3DHXA 1FDAA 2O66A 5F8IA 3LANA 3M9NB 4EO6A 3Q8VA 1S6PB 2JSXA 4DV7J 1CEZA 1TV6A 5E3PA 4X62J 3JQKA 5BR8J 3DN9A 1GFWB 4FXDA 4NXNF 1VLOA 3DGPB 4FBUA 4EWTA 3QBCA 3U02A 1YTYA 1KONA 4I0WA 1BHNA 1KFDA 2KTQA 2Y0BB 1T94A 2X1BA 4YY3F 3R6GB 4DL7A 1LFWA 4PRFA 2Z58B 4LFCF 1FRXA 4OLOA 3T3FA 3C6UB 3KYLA 4NZ7A 1WF1A 4J9NA 5ETKA 4HH1A 2OPSB 1PBUA 3AD9C 4KGVB 3LGMA 5K5MA 5KFLA 5DZ7A 2VJUA 3MTKA 2I0XA 3R7SB 1HI0P 3J80Y 3NG8A 2PSZA 1MN9A 5I3UB 1RAJA 5HBMB 4P2MA 4ZP8A 3MUMP 2B4OA
chains in the Genus database with same CATH topology
2MQOA 4C0OC 5KFXA 3I0RA 2EK6A 3E8OA 3OW2R 1VQPS 2MZ1A 5C25A 2J8AA 1X5SA 1C1CB 1S9FA 2Q6CA 1FE0A 4X4QA 1F60B 1WI6A 2FVSA 1DHMA 2PC6A 2I8EA 1FRLA 2E5IA 3M05A 4OL8A 4QU6A 3KG0A 1UETA 2BANB 3P3DA 3EZUA 4RBTA 5GAHI 1Z2LA 2ROPA 3M9MB 2VBZA 1S1VB 3I9ZA 3WX4A 4JI0F 4KKOA 1M90T 4B9VA 3C8YA 5J2MB 1XN9A 3HLUA 4MYUA 4RW6A 3UCZP 4HYKA 4YB6A 1GTHA 4PXCA 2XNQA 2AYGA 5DRKA 3CJKA 2Y1JA 1ZM2A 4QW8A 1RT6B 1RKIA 2BQRA 1D1UA 2IMOA 3O1LA 3IRWP 2UVWA 4IR9A 2DK2A 2PI5A 1WTBA 2ZJPQ 4O3RA 2MGZB 4WK3A 2J9EA 3DXSX 4F3MA 4PQUB 4AXIA 2NUUG 1FCAA 2LKZA 4AYBD 1FVQA 2E66A 1KOHA 3TA0A 4DN0A 2BV3A 1QAJA 4JI6F 4OJHA 2IA6A 2FC8A 4FF3A 2DPJA 2DTJA 3OHBA 1KQKA 3MEKA 2WONA 4OLPA 2QLWA 2W9BA 2ATLA 1DQAA 2MKJA 3BSCA 2CYYA 3M2RB 3W2VB 4LIRA 4NRUA 2PGCA 4A8YA 4LF9F 3GIJA 3N6MA 1H2VZ 1RTHA 3OQ2A 1U25A 3DDKA 4QIVA 1X5TA 3M8QA 1TV6B 2DD8S 3FCHA 4USHA 2CZ4A 4UW2A 1T7PA 2CPXA 3GMGA 2B6AA 1D9FA 3OL8A 1L3SA 4FBTA 4JOUA 3I82A 4Y3CA 3Q8SB 3K5PA 1A6LA 1N34F 4ZP9A 4U7CA 1X4FA 4XIUA 3CCQS 3MXHP 1XERA 4G3IA 4O3NA 1S97A 4F4ZA 1REVA 2QA4S 3CJ0A 3IBWA 2HAIA 1FT8A 4FN5A 5B0FA 1NAQA 3KMSA 3MMBB 2WCXA 3FJ2A 1QSSA 1R8PA 3U1NA 2C22A 3RW7A 4DV5F 2RU3A 4WFBQ 4B08A 3CCZA 3B4DA 5AXKA 4RW8A 1RGVA 4NA3A 1RTJB 1R0AB 4MK8A 1Q8BA 3CIZA 5LSRA 1WG5A 2CPYA 2W8LA 1X5PA 2RS8A 2UXCF 3T5LA 5HI7A 2XEXA 1LWCB 3BR8A 2PMHA 1UJ5A 1JLEB 3KLEA 3FQLA 3CXCR 4YQWA 2F9DA 3M32B 3QIDA 4O4GA 4CNYA 3JSBA 5KT2A 1N48A 2JVRA 4ELUA 1NHUA 2VFVA 2QT7A 1RT4A 5IQ6A 1IKWA 2V8HA 4C9DA 2BM0A 1RTDA 3TO8A 1FTRA 5D3GB 1PC5A 2AGPA 1SI9A 2M3DA 1GX5A 2JL9A 3HX9A 4ED2A 4OZ0A 3RZAA 1JJ2R 2E5GA 5K9FA 5T7LB 2HZCA 5KFEA 1RKJA 2K7JA 2ZBIA 1ZH5A 3HKZD 3ENWA 4GKKF 3ZZPA 2E44A 4FXWA 1JJ4A 4R0JA 3BDEA 3QAUA 1L3TA 1TP7A 4OJ3A 1HI1A 1Y5NB 1YWXA 2E7XA 1HNZF 4BC9A 2YNGA 4OI2A 1FO1A 2P6SA 4P7VA 4IG0B 3H40A 3G9CA 5CYMB 1IQTA 1HNIA 3MHYA 4C8KA 2JEFA 4FF2A 3M8PA 4ITSA 1QY7A 2YNIA 2ZVSA 3N4WA 2ILYA 1MU2A 4ETXA 4FF1A 4C11B 5DETA 2HW3A 2MQPA 4WKRA 1H2TZ 3VQSA 2BRLA 2Z0GA 5KTQA 3RB6A 3VQTA 2V9KA 3PJXA 3BB5A 5EX0A 1PGZA 2M0GB 1YIJS 4OHVA 5SZTA 1ZAWA 1C0TA 2OJ3A 3HVAA 1EP4B 3ZZOA 1C1BB 2MY7A 3ITHA 1LW0B 1S9EA 3OR1B 1RQ0A 3KG4A 2DCLA 4IFVB 3LP1A 2YX7A 3O3LA 3GFZA 4FVCA 5EWFA 3VWSA 3G6VA 1WHVA 3I0RB 2DNNA 4IKAA 2M5YA 2DNZA 5JXSA 5C25B 2WW8A 2YH1A 3NGDA 1SJ4P 3H25A 4NLVA 3NL0A 3W2WA 1PC4A 4DLEA 1SKWA 1BLUA 3ISND 2XLJA 3QGPA 1XEZA 3PM9A 1U24A 2FLLA 2XBPA 1H7WA 3FSXA 2W7PA 2J5AA 4E8UA 3VAJA 4DFPA 2CJ9A 4KKOB 2MZTA 5F9LA 2B0GA 1JLFA 1IUJA 3TUJC 4NLSA 2MKCA 4E98A 5E3RA 2CQ0A 2EPIA 2AQ4A 5GMKa 2KXNB 1ZM9A 2FDNA 3ENVA 4CZCA 3U1LA 5KAKA 3CCWA 1N4LA 2DGVA 1W2IA 2YKMA 4ETZA 2HQ3A 4CQ1A 2GCFA 4CIOA 3DU6A 5KFIA 2G13A 4CO5A 1NJYA 3I5CA 1N33F 2D3ZA 3JTOA 5KFBA 3VAFA 3U7JA 1YGYA 1TKZA 3DRRA 4XPEA 3T1HF 5F3ZA 2E5HA 3GE9A 5KT4A 5KT5A 4AL7A 2C3YA 2Z2MA 4LSLA 2D74B 2A2DA 3MMAA 4WE1A 1TKTA 4F3QA 4OZJA 2OH2A 4ZPBA 3JSMA 2WONB 2BXJA 2DITA 2CQPA 2VPWB 3DC2A 4CO1A 2W9BB 1VRUA 4UY8T 2GV1A 3EZ5A 3OFHA 2GA7A 4QWEA 2DH9A 5IM0A 1S72S 3CO9A 3NP5A 4OI3A 4WYWA 2DNOA 4HTJA 2EI5A 2MYFA 4K4TA 3P96A 3HHLD 4O4RA 7FD1A 2R7OA 2N4CA 1RTHB 1SBRA 4UUWA 1RA7A 4QCLA 3M8QB 1A9NB 3MF5A 5KFOA 1XTZA 3MEGA 5L39A 4YB1P 2NS1B 4JI4F 2B6AB 2K1RA 3BO3A 4RX6A 2M52A 2QLXA 4HI1A 3V5RA 2IJFA 2DR5A 5ITHA 1X4HA 3SCJE 5FDLA 3LP2A 1DRZA 4H4KA 3BSOA 2MKSA 4ID8A 2MB0B 4NCGA 2D9OA 1REVB 4IH7A 1HWLA 2CG4A 2OSRA 3OTEA 1WEXA 4YMEA 2VONA 4XDDA 4IOCQ 2VA2A 2J0QD 3NNAA 4LMZA 4M8LA 2AF6A 1HWJA 4K4XA 3T1YF 1FJ7A 4CO0A 2APOA 5F8JA 1XBWA 2BYCA 4KE5A 4LF5F 3PRDA 2AGQA 4OFZA 3HKWA 1WD6A 1KEKA 3CC2S 1VQOS 2LQ5A 1DZ5A 1HWKA 4HH0A 2CQ1A 3FNNA 3KLEB 4F4XA 1LWFA 1ZAXA 2J6SA 2QZ8A 3O44A 4O4GB 3OR2A 4DSEA 4M5DA 5DJBA 2PA3A 3OTOF 2B9XA 5KFHA 1RT4B 1HHSA 3SCLE 5FJ4A 4DPOA 1RTDB 1X4CA 2CPJA 1R31A 4FVMA 2I38A 3SQGA 3C2PA 2HFZA 5K8OA 2J0XA 1IJFB 3FZ2A 1OO0B 5A8KA 1V3SA 4D3HA 2WBRA 1SJRA 2LVWA 1UVNA 2DISA 3AA8A 4RNHA 3H8YA 3R27A 5F8GA 1YVFA 4KIAA 4YHHF 3IAM9 1S1UA 3Q0AA 4CTAB 2NR0A 2DH8A 3BJYA 1RWUA 5EDWA 4X4VA 2YKPA 3D5MA 4ZP6A 2FJVA 2CPHA 2N7YA 4WIIA 4N47A 3TYTA 2J7UA 2YNGB 3KFWX 4QIFA 4DOZA 1M0SA 1TZ0A 1L3KA 2AYEA 1F5CA 2A18A 1IKXA 4KR0B 4X65F 1U1KA 2D7SA 1C4CA 1HNIB 3CJ4A 3FDSA 2V4JB 1P6TA 3M8PB 3N9UC 3GV8B 2LXIA 2YNIB 1T03A 2PN6A 1VFJA 3X3UA 1MU2B 4K5RA 3PNIA 2PEHA 3M8SA 2HYIB 3DM2A 2OIHA 3FVYA 3GR0A 1OPIA 1TKDA 2ZH9A 3EUNA 3Q8QB 3TAMA 1X7VA 4P2SA 2JHEA 3QLHA 1C0TB 4DBQA 4EBDA 4Y28C 3ITHB 2WSFC 3OTDA 1JNZB 1QM9A 3GB0A 3LP1B 3HHKA 4CO3A 1KHVA 3FMWA 4JYAF 3RRKA 2YNHA 3DRPA 3GZ7A 1O0PA 5J2QA 1X0PA 3DLJA 4Y65A 4NCAA 1OQ6A 3ENQA 4Y2AA 2R7UA 3E3XA 2AW0A 3CTRA 1SL1A 3HZEA 2RDJA 1Q81T 1JXLA 2HHWA 3TOQA 4MIBA 5JVHQ 3SSQA 2DO0A 2LMIA 5DDQC 2BDPA 1PO6A 1TL5A 1HWUA 3AJ2A 2ZHBA 1U45A 4OJGA 2VV5A 3EGZA 1ZYQA 2KG1A 2B4VA 3QO9A 4OI6A 5T41A 3QGIA 3I4HX 1VQ6S 3DHWC 2DHGA 4OHZA 2V2KA 2MY8A 1M5KC 1JLFB 2B51A 2WSCC 2HRUA 5KG1A 3FFIA 4F4KA 4HHJA 1J2VA 1RTIB 3KJVB 3PX0A 2C3PA 1IR0A 3UE2A 3MGJA 1VHFA 2HHHF 2YKMB 2YKOA 3MTJA 4TYAA 4B9UA 4PXEA 1VGYA 5G0RA 2QSFA 1U1QA 1FRJA 1T95A 3THTA 1SIWB 2MZQA 3M6VA 4IFYA 5KFJA 3RBDA 1XMQF 3KTQA 2EW9A 3BGUA 2V8DA 1TKZB 4ES3A 5MLCV 3TARA 4IOBA 4QYRA 2ASJA 3ZZ0A 1XC9A 3CJ3A 1QUVA 4LSLB 2FJDB 4WE1B 3MMAB 1TKTB 2F40A 5KG4A 3JSMB 2VKRA 4WFYA 1VRUB 1YRUA 2BZ2A 2XWYA 3C66A 5IM0B 2FHKA 1FK9A 2L08A 2NUHA 1HQUA 4ED3A 4B3SF 2LDIA 2MSTA 1Y5LB 2DB1A 2QA1A 1VJWA 3B4MA 3MEGB 4C8ZA 1T02A 3PW7A 4ELTA 4F4YA 5E3CA 4M63A 4X64F 3Q8PB 2EVZA 2ZHAA 3E51A 3BZQA 1ZTTA 2OKQA 2AU0A 5FDLB 3UWTA 2GNKA 1XR5A 2F3JA 4ZKAA 3IO1A 4NCGB 4KO0A 4UOCA 2RRAA 1ELOA 1E6YA 4L3NA 2F8MA 2VQEF 4DR1F 3KOAA 1RJJA 3ZZUA 5J2PA 2V8VA 3BGLA 4LJMA 4X66F 3MPYA 2MQLA 4AL6A 3LALA 1FD2A 4JV5F 3NCPA 4MFBA 1S7HA 2X3GA 2W8KA 2XY6A 2FGCA 2C3MA 3MCSA 3H2LA 1S4FA 4EFAC 4QOTA 3HM9A 1VC6A 5GAHU 2ASYA 3I0SA 3U1MA 1JX4A 4AUKA 2MMYA 1MWYA 4ALZA 2QA4G 3K58A 1X0FA 4GKJF 1WNEA 4W92B 3O5TB 1LWFB 2AGOA 2FVRA 5C42B 2JEGA 4M5DB 2LA4A 1FJEB 1LW2A 1TR0A 4BHQA 4DDFA 2XY7A 3SFGA 3TAQA 3W3SA 5DLFA 5D4OA 1N54B 3TVKA 2EBGA 3SQGB 2VC0A 4WXOA 2V94A 3LWMA 1IM4A 2OPQA 1YRTA 4KHMA 5DQGA 4AL5A 3WC0A 4P7TA 4X4OA 2WB1D 3MEDB 5A8KB 4K4UA 4NZ0A 2G4BA 5KFPA 2GJIA 2BM1A 1NK9A 5H1SV 3MM5B 2P9GA 4IH6A 3Q24A 1S1UB 2ZH8A 4F3OA 1Q16B 4DLGA 1YITS 1LQ9A 1MROA 3VZHA 3T5JA 2W7AA 4IRCA 2JWNA 1AUDA 1HD1A 2LA6A 3FRZA 2D1CA 1FA0A 3UW1A 5IT0A 1IKXB 1R3NA 3JTNA 4KJIA 2IRYA 2VBWA 4F4WA 1PSDA 4A8FA 1QVFR 4LVNP 1B7FA 2F7VA 2BBEA 2XCAA 1L3VA 2DGXA 2CPFA 3DM2B 3VAMA 4DS5A 1NK4A 3MOJB 3TR5A 4EO8A 3GR1A 2CPEA 2ZOFA 1NKCA 3V2UC 2N3OA 2ZE2A 3QLHB 5A8WB 2XCPA 2SXLA 1X9SA 1LK7A 4Q0BA 1NH7A 3J7YI 4C3KA 1IJEB 2CKWA 4DUYF 2JLFA 2OPPB 3CPWR 4PWDA 1P8GA 3DRPB 1MNEA 5J2QB 4NYZA 5E0OA 4WZMA 2IAJA 2FJEB 3F44A 4ED1A 4DQPA 4OZNA 2E7WA 1C0UA 4RW4A 4BBYA 4I7FA 3PACA 3NCRA 4OX6A 5EWEA 2FY1A 1NB7A 3DLLQ 3KLIA 4OX8A 2DNHA 4G1QA 1YJRA 2XNRA 3QO9B 4BS2A 3K8VA 3CDWA 1BC6A 2DT9A 2XSJB 1S79A 4NWBA 2R7QA 1TQLA 2M2BA 5DDRC 4BC7A 1OQ3A 3UQSA 5DLGA 1ZM3A 3KHLA 4AFFA 4P6QA 2DGOA 2YKNA 3FFIB 4TXSA 2R9LA 2DO4A 3VR1A 4Y00A 2HNZA 3TVZA 5L38A 1S9GA 3QIPA 3BDPA 3NNHA 4I64A 4JI7F 3VZIA 2AJ4A 3DU5A 5G0RB 1HNXF