2GV1A

Nmr solution structure of the acylphosphatase from eschaerichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the acylphosphatase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
total genus 15
structure length 92
sequence length 92
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gv1A00
3FRYA 5F0UA 1Y3JA 2N7YA 3WDOA 2OD6A 2K1RB 4YDXA 3UDCA 1CC8A 2XMVA 2K2PA 1TR0A 5B0DA 2OFGX 1Q8BA 3CJKB 2FIUA 2AJ0A 2HLTA 5T7LB 1JWWA 2N4DA 5KAKA 5B0AA 1KVJA 1K0VA 4FNIA 4NPOA 3MCSA 1JK9B 1R6YA 2VH7A 2IFXA 3HX9A 4HI1A 2KT2A 1XBWA 4Q2MA 2ACYA 1Y9OA 5IXUA 2GGPB 1N5SA 1IUJA 3GZ7A 2OAUA 3LO3A 1VQSA 2G9OA 5B0GA 2FHMA 3HHLB 5B08A 1FE0A 2BYCA 2K7KA 5F0WA 3IWLA 2OKQA 4HL9A 4FNHA 4YEAA 1W2IA 5K9FA 3TOQA 2QIFA 2XMTA 1KQKA 4OJGA 2HLUA 3DCAA 2XMMA 3KKFA 4A48A 1AFJA 2HFNA 2QYCA 2JDJA 2IYIA 2LDIA 2ROGA 2XMKA 2ROEA 3LGMA 1S6OA 1X7VA 1Q4RA 2KKHA 5B0FA 4ZA1A 3QMQA 1Q53A 1MWYA 1Y3KA 2AJ1A 4A4JA 3KNGA 2HQIA 4DPOA 2FB0A 1V3ZA 2VV5A 3F44A 2XMWA 3FGVA 1OPZA 2K7JA 2OP5A 1OSDA 1YJTA 2GA7A 2XMUA 3BR8A 3HFKA 5B0CA 3IWXA 1FE4A 4Y2IA 2AW0A 2HFOA 4ZOSA 4A46A 4F67A 1TL5A 2W4PA 1AFIA 1CPZA 1N5QA 4Y2KA 3BB5A 1AW0A 1TL4A 2ZDOA 3HHLD 3MZIA 2GCFA 1APSA 3FMBA 2RSQA 1WD6A 1GXUA 1Q8LA 2QLXA 4OJ1A 1N5TA 2N4CA 4DL0C 1KVIA 1YRXA 4U9RA 2GV1A 4EFAC 2QLWA 2BJDA 2BJEA 1FESA 3BN7A 2OMOA 3BGUA 5T7LA 2BUNA 4NL5A 2OFHX 1FVQA 2W4CA 2CRLA 1N5VA 1P8GA 4QOTA 2K1RA 1OQ3A 2LQ9A 2XMJA 3BDEA 3T9NA 2EW9A 5B09A 1FD8A 1YJRA 2ZDPA 3LGNA 1YJVA 3QGPA 3CJKA 2GGPA 3VTIA 2GO8A 2RMLA 2ROPA 2RU9A 2IYGA 2LQBA 4OJHA 2AP6A 1QUPA 1FVSA 2GFFA 3BF4A 3KG0A 2PD1A 1U7LA 1MWZA 2L3MA 3TNVA 4DN9A 1SI9A 3I9ZA 2KT3A 1YJUA 3HHLC 2RILA 5B0EA 5B0BA 1RJJA 1Y0HA 3BM7A 1TUVA 3HDSA 1YG0A 1P6TA 3HHLA 2PGCA 1X0PA 1GXTA 1SB6A 2FTRA 1URRA 2BBEA 2LXFA 4HH0A 3TRGA 2ASYA 3KG1A 2KYZA 4HH1A 2HIQA 1X8DA 3K7RA 3DXSX 3HF5A 4OJ3A 2OD4A 1CC7A 4Q2LA 2W4DA 5A6WA 2Q3PA 1S6UA 1TZ0A 1VQYA 1FEEA 1LQ9A 4OIXA 4Y2MA 1ULRA 3E8OA 4A47A 4HI2A 5A6PA 1SQEA 1OQ6A
chains in the Genus database with same CATH superfamily
5KFCA 1UVJA 4DV4J 2F8EX 1NK8A 1U25A 4O4GB 3I9V9 4IRCA 2DNQA 1CC8A 1P27B 4NLXA 1U2FA 2MZSA 2OFGX 1YK9A 3H5UA 1BQMB 4ID5B 2D3ZA 2BOAA 5C25A 1S9FA 4DR2F 1Q95G 2R2SA 2YNGA 2R42A 3ENVA 3K5OA 4JYAF 4OI4A 1RADB 2XTJP 1H2TZ 2GW8A 2D9OA 1IVZA 5GMEA 1MROA 3PACA 2KG1A 4DV5J 1S1XB 2GGPB 1IUJA 4LJMA 2D3O1 2DT9A 1HW9A 4IFVB 5J2MA 1RAIB 4JI0F 4DR6F 4OI3A 5L9XA 2ZBRA 4DUYJ 5GAHI 3PVXA 1AB8A 1FK9A 1W26A 3IWLA 4TY9A 3N6MA 1NBEB 2OKQA 2GO9A 3G8SA 1U1LA 3HJVA 4M5LA 4NYZA 4QJVA 3SXLA 4DEZA 2LU2A 1QE1B 1YLXA 4IH7A 4R0JA 2VQEF 5IM0B 3N28A 3CVKA 4WP8A 3MHYA 2JDJA 4ZCMA 1XTZA 5AE2A 3DLGA 3A4TA 4MKBA 2MKIA 4Z7CA 3BO3A 3QJPA 4I2PB 1TKZB 1UL3A 2QG9B 4P74A 3OPKA 3UW1A 1PILA 2BW2A 3W62A 4X66F 4G1QA 4KKOA 1NNDA 2PDAA 3P3DA 5ADZA 1V9OA 2FB0A 5KFSA 4X64F 3HXMA 4M95A 3A8JA 1T05A 3WC0A 4DX5A 3CMQA 2K7JA 2KXFA 3HFKA 4JB8B 3SFUA 3CJ5A 5JVGQ 4O3OA 1RU2A 3NMRA 2PI4A 2VBXA 1YJ7A 4EI2A 2NUUG 3LP1B 3M9NB 3Q83A 3UN5A 3CCLS 4NCAA 1DRZA 3R6GB 3T5LA 1VIOA 4MK7A 4YR0A 2MSTA 3OL6A 2R2TA 4IQMA 2RF2A 1C1CA 2NS1B 3FCWA 4C8YA 4NXNF 2FD2A 3EVMA 5EWEA 3G82A 5J2QB 1TU0B 4R8UA 1FKAF 2W2MP 2R7QA 3FFIB 3NAIA 5GMDA 7FD1A 2ABYA 2X7IA 4UY8T 1G2EA 2DTJA 3JAMY 3CT9A 1EB0A 3B6BA 3POTB 3QT5A 1LWXA 2CRLA 2GHPA 4URSA 1XJWB 3BKFA 2LQ9A 2AJ4A 4O0NA 4DV1F 1NJIT 4F36A 2VA3A 3ZZZA 2ZH3A 3QGPA 2Q6CA 1VISA 3CJKA 3W7BA 3BQ1A 2IVMA 1CVJA 3R7BB 4L74A 4Q7AA 4DJBA 1RQ0A 2Y1JA 2FDNA 1HQUA 3RU0A 3T41A 2IAJB 4XDCA 4GVLA 3NNAA 2CPIA 3TNVA 4GKJF 4OZ1A 3DYAA 2WVEA 2ZC4A 3QBCA 3SDEB 2ZH4A 3KXDA 2MGZA 1SKSA 4GKJJ 4OL8A 1A9NB 1ZAXA 4H4MA 5HANA 3AA8A 4ZPTR 4KT0C 3IN5A 3W65A 4ED7A 2YQ0A 1KTQA 4OI6A 2J9DA 1RTDA 1KONA 2BJ3A 2RIJA 5IQ6A 2GQQA 5FLXU 2JLGA 2FJXA 4DSFA 2V8VA 5L46A 2GX8A 4LSLB 4MJKA 4FF3A 1HBUB 1IWGA 3DXSX 3TZXA 1WEZA 4XK8C 3OR1A 4P6QA 4C0BA 2CPXA 1JLEB 2W2OP 1ZTWA 2OPRA 3GJRB 1N8RT 1N33J 1TZ0A 2IC3A 2BE2B 3K58A 1PYTA 2HIYA 3GG0A 4EBCA 1X5SA 2HK2A 3E8OA 3FBFA 1NK4A 5L1JA 2BRLA 1RHRB 4DCOB 2KJWA 2BABA 3MAAA 3JB9k 5EX3A 5EDWA 2K3IA 3M4XA 4F7VA 3C6UA 5D4OA 4WU2A 1KOOA 3ISND 4WKYA 4EYIB 3H4DA 2EG1A 4OX7A 4ELUA 2Y8YA 1RCOB 3CDBA 1CS4B 2AJ0A 2VU5A 4I2QA 4P7TA 5CYMB 8ATCB 1DY3A 4FYYB 1FKPA 3IS9B 2PA3A 1S9GA 1L3UA 2PN6A 3NLCA 4DG1B 1NJXA 1K9MT 4X62J 1I6JA 1WTBA 4HI1A 3JTOA 2HHSA 1ZYQA 2ACYA 1V5VA 2ZNZA 2J7UA 2VG6B 4G3IA 3R5GA 1RK8A 1SV5A 2ATLA 5D3GB 2P2CB 2XZTB 4USVA 3G9CA 1SKWA 4ZITA 2CPFA 2OI2A 2MQ8A 2VG7B 3S7RA 4CO0A 3MURP 5B08A 4NCGA 1N4LA 1KVKA 1RWNB 2YKPA 2E9RX 3PKMA 1UETA 3LWLA 3PCOB 3SSSA 1TKXA 1TTHB 4H4MB 1NDPA 1S1XA 3AQPA 4NRTA 4I6AA 2GC8A 5BYQA 2CJ9A 3JSMB 4ECTA 5ETLA 1X4DA 2JZ5A 3SI8A 1RWKB 3MTKA 3C14A 3QWPA 5G4DA 1FEHA 3QMQA 4D3HA 2MYFA 2C2EA 4X65J 3VV2B 1FNXH 3HT0A 2H54B 5A8WA 2HNYB 1FWKA 1HL6A 1RHQB 1S6PB 4PPZA 3VHQA 1C4CA 1CBKA 1HI8A 1X4GA 2HNDB 4RR5A 2DH9A 2ZM6F 3FBCA 3MM9B 3UR0A 1FRKA 2B5JB 4KBIA 1X4EA 3ENWA 3B82A 2HAFA 2QGFB 4H54A 2RS8A 2C3UA 2ZUGA 1FRHA 2GVDA 1X4CA 3BB5A 3IR5B 4OLOA 5LSOA 2XMAA 5EWGA 2XGQA 3HPOA 3C6UB 2I38A 4MTPA 1VRQC 4E0DA 1SKUB 1P1TA 3J7Z5 2XCAA 3K17A 3NXZA 2F63A 2AZ1A 4OJ1A 4WE1B 5A76A 4NLWA 2LA6A 5LXYA 3KJFB 4KFBA 4Q44A 4ECZA 4DFMA 1Q82T 1KVIA 1FESA 4IQXA 4HT5A 5T7LA 4LRAA 1VFJA 2H51B 1R8HA 3BSOA 1JLGB 4EBDA 2DK2A 2CQ0A 2KVQE 2W9BB 2BANB 2W4CA 4GC6A 3HLUA 2DEJA 1S0OA 1P8GA 1UA1A 2HSEB 3I5AA 1GTEA 1RWPB 3LGHA 4JI3J 4TLRA 1YJVA 3OTOF 4KJIA 1NDCA 3ELHA 3W2WA 2UVWA 1EKRA 3KK2B 1RT6B 4MFBB 3RW7A 3IO1A 5F9NA 2XG8A 3CCTA 1H2UX 3KLFB 3BF4A 1N5YB 1RHKB 2M7SA 3VQTA 3UVJB 1EX8A 2KT3A 2NPFA 3SCJE 4IO9Q 2BXJA 4ZPAA 1MU2B 1BWVA 5KFMA 3GMGA 3MM7B 1RJJA 2A6OA 3VVUA 1U1MA 1VBZA 3UN2A 3DXBA 2JFDA 3CIZA 3JQJA 4QQBA 3TRGA 1QAXA 1NPRA 4IDKA 3TAPA 4RO0A 2XC9A 3CCRS 1S77D 4MKYA 3KDOA 1PKUA 4ZVOB 3R8YA 3N6LA 4A8WA 2HNDA 3V6DA 3AHPA 9RUBA 3MMBA 4RW8B 2X3GA 4CLKA 2DGXA 1TKTA 1S0MA 3VAMA 3TAMA 2FJAB 4X4SA 5IV4A 5CHCB 4CLTA 4AD6A 4CYUB 3CUNA 1KBRA 3PDNA 3M9OB 1Y3JA 1VQOS 3JSRA 3MPUB 1QD1A 3E01A 5D8HB 3D5MA 3PG9A 4UUWA 4H4KC 2APOA 1X5OA 1O5JA 3RGIA 3I4HX 2CPEA 3TEHB 4B3TJ 2CNKB 4RUCA 3N4WA 5D77A 4RJVA 1N33F 4BBYA 3BKUA 4CNZA 1VJWA 1ZS6A 1X4AA 1KVJA 1FTRA 1QUVA 3NNCA 3CJTA 2XS5A 2PT0A 2VQFF 4OYIA 3DDKA 4ES3A 2XI2A 3DRPA 3KJQB 5A8KB 1YJWS 4QW8A 1FDNA 1YI2S 3U02A 1M5VC 2IBKA 4DQPA 1WKJA 4WZMA 3OXGA 1GX5A 2YQ3A 2HMIA 5B0GA 2WONA 1WELA 2QMUB 3J7ZT 4F4YA 2V5HG 3IFEA 1MW7A 2V9WA 1HPZA 2WHOA 3Q89A 2JH3A 4QW9A 1FRJA 2ZZTA 1KD1T 1ZA2B 2QIFA 2KM8B 2J6TA 3J81U 2XMMA 2HHXA 3R7SB 4NASA 1U6BA 2DGWA 2IM2A 4NEYA 3MECA 2PI5A 4L75A 3FEXB 1J5OA 1YRUA 4HKQA 2HHWA 5L38A 2DIVA 1M5PC 3PJ9A 3OT9A 4TN2A 5DQGA 2UV8A 2NQPA 2DGOA 3FGVA 2EBGA 3ZZRA 1KTVA 1ZTTA 4YN3B 3GJTB 2QL9B 2B5JA 2FY1A 1BQMA 1RT5B 3MPWA 1T9YA 4FKYA 1RB0A 2B7BB 1FWPA 3CD6S 4DF4A 4ZPVR 1E6VB 3EZ5A 4TYAA 2IBOA 2CNLB 3FEZA 3MEEA 2D3UA 4FYDA 2WBMA 2U1AA 3M2RA 3EGNA 3NEKA 4LR8A 4ZVTB 1KR4A 3SV3A 1NH7A 1K73T 3CJQA 4C8LA 3QRRA 3QATA 4F3OA 1F6TA 3WC2A 2IRUA 4QIFA 4X64J 1OWXA 2BUNA 4OZ0A 3UDVA 2C1EB 5ETMA 3HMJG 3T1AA 2CPJA 4DV0F 1VQKS 1WSRA 5F8IA 3RBZA 4NLTA 3MD3A 2RQKA 4FYXB 3MEDA 5DS7A 3JQKA 4EK2A 5B09A 4QPTA 5CD4H 3M7VA 3G96A 2XSJB 3M8QA 4Y2AA 4J9SA 2VG5B 2ROPA 3KJVB 3ZZOA 4Q5VA 1O51A 4CM0A 5H1SV 1ZM4A 5KG1A 4LR7A 3CCUS 4WU3A 1LK7A 4LF6F 4LFCF 3KG0A 3W66A 2L9DA 1NEEA 2I2YA 5ETKA 1VGYA 2F1FA 1SJQA 1WDDA 2MMYA 2QLFB 2RILA 3ISNC 3MMCA 3NY0A 4QR1A 3TO8A 3ILLA 1UJ5A 1RTJB 2CADA 2WVDA 5KFNA 3BGLA 1NK0A 4DX8H 5IM0A 3E51A 4DU7A 1HHQA 3HDSA 1AROP 1C0TB 1X5PA 2UUBF 1U26A 1X0PA 2PGCA 1DARA 4J9OA 1D8YA 4MIAA 1IWAA 2V8HA 2E5LJ 2ASYA 4IDKB 1C1BB 1GMUA 2KN4A 3MD1A 4FXWA 4WFXA 4J9MA 1UZHA 2R3VA 3KLIA 3HF5A 3DRSB 4JV0A 3DGVA 3O6QA 4CH0S 2YPZA 3P45B 2HRUA 2OELA 1G3OA 2U2FA 2D1CA 5IQQA 1H73A 2Q66A 2BE9B 5J2NA 2JEJA 2LEBA 4LF8F 2HYIB 3OXLA 4F4XA 2DKOB 1VCTA 3NG8A 3L7OA 3LANA 4KGMA 1T11A 5ETOA 5K8NA 3PKYA 4K5SA 2D3OR 1R31A 2ZEJA 2IIHA 2P9GA 2YWKA 1JLAA 2VFUA 2B3TB 3SEOA 4NLGA 5HATA 3D1OA 2CG8A 2V8GA 3LP2A 2MQLA 4X4TA 4WP9A 3FZ2A 2GIQA 2DR9A 2IM1A 4UQGA 3I5BA 2C2ZB 5ETSA 4N56A 2R8GA 4ED5A 2DITA 4A8YA 5BJRA 1JLQA 4UY85 4Y65A 5LXRA 3KLEB 1DTTA 2E5HA 4C11A 5KFQA 1EZZB 2BM1A 2DCLA 3KJVA 4DV7J 1TL3A 2LXIA 2MQNA 3KMSA 1G4CA 1VQSA 2G9OA 2FHKA 3OL9A 2WSCC 3DLKA 2XHCA 1B99A 4WFZA 4ZK7M 3T5JA 4K2XA 1VQ4S 3ISZA 2XY7A 1YWXA 1MSWD 3VGUA 5F0WA 4U95A 2H3EB 1VYAA 4YEAA 3OL7A 1PBAA 4B17A 5F8MA 2AJFE 3GIJA 3R1LA 1I1GA 3PW2A 4ZDNA 2RD5C 2CIMA 3NGRA 4K7QA 3KHHA 2F7VA 3EVWA 4TU9A 2AEJA 4O0IA 1U45A 3MPDA 2FLLA 4DQIA 4NLYA 2F4VF 5LM7E 2DGSA 3ONQA 4PAAA 1Q53A 3H4BA 2MEWA 2MKCA 5H9EJ 2E1CA 4DR5F 1DFDA 2E29A 2YNIA 4F4AA 1S72S 3QWUA 2MKYA 1DQ8A 2B4UA 3OSNA 1RABB 2ZJQQ 5KT6A 3L7PA 4OX9F 1R7IA 3LAMA 3QLHA 3KJNB 3O8WA 4GVBA 1WHYA 2HFOA 3EMTA 1Q1KA 3N79A 4E2FB 4OI1A 4N47A 3ZZUA 1U1PA 2EWHA 3QO9B 3MEGA 1TL4A 4OYBA 5M2UA 1H3DA 3ZTRA 2V4QA 3AAWB 2AU0A 2QFJA 5U47A 3MEEB 3BDPA 5I42A 4WE1A 2JEIA 2OPRB 4TYBA 3SSQA 3KFWX 4F4ZA 2I8EA 4ZVFA 1YSJA 4CP5A 2VBYA 2M70A 5CYMA 4RX6A 3D9BA 4QBUA 3IR7B 2HKEA 3CJ0A 2HS3A 1RLDA 3AJ1A 4ZPBA 1N6QA 2B7CB 1KLNA 3U1MA 3JXOA 1VLYA 4ANCA 1UVNA 2G0IA 3AJDA 1H6KX 4M5JA 5DGBA 1TVRB 3OTOJ 1FD8A 4EUVA 2QLBB 1TL3B 3VTIA 2BEFA 2GO8A 3FSXA 4QIGA 2Y1RI 3D6TB 1S9GB 2E7WA 5SUHA 2OTJS 4ZPWR 3CJ4A 2YBVA 4LT6A 4FDFA 1VJQA 3MCOA 3C16B 3DN9A 4GC7A 2NPIA 2ZBIA 2YPYA 3UPFA 4L3KA 3CCQS 3MOJB 4ZN3A 2PEHA 3BS9A 3QFHA 4USJC 4DV4F 3QRQA 4HHUA 3K59A 4K0KJ 4CDIA 3K5MA 4DFKA 3UCZP 4CZCA 1QSSA 3AY0A 2KO1A 2KYZA 4HH1A 3VALA 3PZPA 3ULHA 3UO0A 3GYNA 3QT8A 2D74B 2DVIA 1VIXA 2OIHA 3IMQJ 4B3OA 3IRXA 3K7RA 4JI7F 3D0GE 3HSZA 1UEUA 2FY8A 3AD7C 2YVSA 1TKTB 1L3KA 2MZRA 2ZZNA 2D7SA 2YNFB 3C14B 2KB2A 5L1KA 1FFSB 1LQ9A 1TV6B 1WORA 3AQOA 4CLPA 1IJEB 4F0HA 3KK3B 1FJGJ 3A3OB 1Q5VA 4I7FB 1YIJS 2Y3YA 3HVTA 4DV2J 3RRGA 2E7VA 2CVIA 2MKSA 2VFSA 1RKIA 4IH6A 1DTQB 2BV3A 1RWWB 2AX0A 3TUZC 2KT5A 2B8PA 3TWZA 1F2HA 4ES2A 3GSIA 3GV7B 2EK6A 4K4XA 4LFAF 2VASA 2NZCA 5KAKA 4JI5J 1V3RA 3OUYA 1ZOTA 4ICLA 3EZUA 4BWMA 1HYSA 2CFXA 1M90T 3ETMA 1F9EB 2X1GA 3BQ2A 4YFUA 3DI6B 4ED4A 5FJ4A 3DU5A 4NEZA 3VZHA 2BZ2A 3VAKA 2XHWA 1RYSA 2AHOB 2DEIA 3QIPA 3U1NA 4F0KA 3RB3A 3QJJA 2MB0B 2Z4PA 2FVSA 4RL1A 3NCRA 2ZHAA 2VICA 2LQJA 4W4MA 2QA4S 5ITHA 3RB4A 4LRBA 2DYAA 1WC3A 3TR5A 3M8PB 3CMAS 3D6HB 3TOQA 2PMHA 4C11B 2L9NA 2XLIA 4BCAA 4BC9A 2E5IA 4HT7A 3TA2A 2FYXA 2XMKA 1LWCB 2JVRA 3NS5A 5DETA 2QE5A 1T03A 2V68A 2RB7A 4WK1A 1B7FA 1J5OB 2KFYA 1JJ4A 3OTBA 4F4WA 3EGVA 2NLWA 2HZAA 3MEKA 1T94A 5E3QA 5J1PA 2CZVC 1QE1A 1NMEB 1N0UA 4F3QA 4ANDA 2J9CA 2KDOA 4S0MA 3SZ2A 1RBLA 3HHDA 1N32F 4RW8A 4RW9B 1REGX 3X1LB 2CWKA 2OPSA 2YWWA 1DLOB 3M1VA 3QLHB 4Y2IA 5K20B 1GMWD 4F3MA 4J9PA 4Y2KA 4ELVA 3V5RA 3W9IA 1VQ5S 4WIIA 2LLZA 3H59A 3NP5A 3BPSP 3MZIA 4R0EA 4XIUA 2UUAF 2J6SA 2UXBJ 1FHTA 4O3SA 5KFRA 2G1DA 2ZWOA 2CXEA 4FPIA 3CJRA 5E2QA 2BOPA 2MHEA 2OMOA 2HHQA 3NMAA 4J90A 4FXVA 3JAMU 3DKDA 1M1KT 2PSZA 4M94A 3MUMP 3DOLA 4RW6B 4L76A 3OVSA 2E5LF 3SMZA 4QWAA 1OY9A 1RT7A 2EW9A 1HHSA 2ZC3A 5D4LA 3DMJB 4JI3F 1FX2A 4LF2A 1D1UA 3H90A 4C48A 4OZ3A 3HSGA 4U7UK 3PW0A 3THVA 3RR7A 2XLJA 2AP6A 3D0IE 1FJCA 3GSDA 3MPYA 3AFGA 1B64A 1RI7A 2DNKA 5L8RC 3AD9C 3V81B 3W2VA 2HNZB 4LQ9A 4LRFA 3OJSA 1YJUA 3HHLC 4CTAA 5GAEI 3PY8A 2JFKA 2MKKA 3T1HJ 2MSSA 3VAIA 1FXRA 4H4OB 3LALA 2XS2A 1S48A 1TUWA 1TMMA 1FDAA 1OYEA 1Q79A 2BBEA 3C19A 1LOUA 4JI1J 4M5DA 5KG3A 1J5EJ 2H48B 3GFXA 4BWJA 1LW2A 4PQAA 2RJZA 3UD4P 4F8RA 3UN3A 4C0OC 3KLVA 2AKWB 2RDIA 3IRXB 2WBRA 3PTWA 1RWUA 4UF4A 4CI0B 4EBEA 3GIKA 1CC7A 3AT1B 2FJDB 2Q3PA 4O4RA 3R5DA 4PWWA 4NWBA 5E3PA 5J2NB 5KFFA 4JV5J 3CTRA 3KHLA 1EETA 1RT5A 4ZP9A 1QDUB 1UFKA 2C2KB 1SQEA 2XZDB 4LSLA 3TVKA 2WK4A 3Q2TC 2W9CA 3CCSS 3PNIA 2YNFA 1WWHA 1J27A 4HTIA 1R6VA 2OHDA 3ICLA 3PR4A 3P5BP 5E5NA 3CC2S 1J2VA 4AXJA 1JWWA 2AT1B 1FDDA 1JLCA 1W2BR 5BR8F 3HVTB 4YOEA 3MM5B 4CLLA 1NKEA 3EGWB 1S10A 1FRXA 4WJBA 6FD1A 1F60B 4X62F 2AGPA 1TAQA 3MFIA 4DR4J 1R8BA 3K8WA 4NLOA 2OAUA 3GQCA 1NJYA 1HQ2A 1RT1B 1H72C 3L4BC 2MY7A 2CQ2A 1RTIA 3LO3A 2VG5A 3S1TA 2ZM6J 1C0TA 2UUTA 4C2MA 1CJTA 2C2MB 4DR3J 2B6AA 3O1LA 1IR1A 3H2LA 3OLAA 5I3UA 2YH1A 1IKWA 1GTHA 2YH0A 1UZDA 4B3RJ 1T9UA 5K9FA 5GVQA 4USMA 2VA2A 2XMTA 5A8WB 1AFJA 3DCAA 3UWTA 5MLCV 4FZVA 3UCUP 4M5NA 2HZVA 1PAUB 5FDLB 2EFQA 3NL0A 4F0MA 2HHHF 1LFPA 1JKHA 4Y2CA 4JP8A 5F3TA 1M5OC 5IWAF 5AT1B 1A6LA 4WKRA 1VC0A 2BW7A 1IKXB 2E1PA 2GVDB 2POKA 2WB1D 3D4JA 3QNWB 3UE2A 1JLBA 2HQIA 1HHTP 4DR5J 4DV0J 4C9DA 4KHPJ 1NU4A 3HULA 2M9KA 2Y9HA 1HNIB 1VDHA 2KI2A 2MLZA 1YZ7A 3HSDA 3IA0A 4X4RA 3GPAA 1FF2A 4FS1A 2KU7A 3L9ZA 2FGCA 2YWEA 4TVAB 5K8MA 5LOQA 4OYZA 4RW7A 2HS0A 3BH7B 4QYZK 2HVHA 1N5QA 1AFIA 4N8OA 2OSRA 1CPZA 3HI9A 1SIWB 1DJ0A 1ROFA 2QMWA 1RWOB 1NK9A 3R5JB 1NCLA 1ACMB 3FMWA 4IG0A 5HQLA 1HBNA 1Y5NB 4DR1F 1XNQJ 5DM6Q 3KLEA 2V2VA 3AXMA 4NXNJ 3RW6A 5DDRC 2ALZA 2GV1A 5IC6B 1JLCB 2GIFA 4Y00A 1AA1B 1YBAA 1B4SA 1NO8A 3Q86A 5CH7B 5C24B 2OJ3A 1QM9A 2E5GA 2EPIA 2JWNA 2Z2YB 3OHAA 1TVRA 3A3PB 2OEKA 3M32B 4GKKJ 4YDDB 4QWCA 1KQSR 4NLDA 4RBTA 4ZJOA 3UVJA 1JLQB 1GAOA 1NK6A 4PRFA 3CJ2A 3FUYA 3DMJA 1D3WA 4QU7A 4NLUA 2E7XA 3GWCA 3Q2SC 1ZM9A 2N82B 1M5KC 4YMEA 1I94J 1Q7YT 4LF6J 1CSJA 3CD0A 3PR5B 1SI9A 1QAIA 2JC0A 2QSWA 2C42A 4IRKA 2AGQA 1LNQA 1RT2B 4LRCA 1FKOA 2M88A 1XERA 1CJUB 4F50A 1T05B 3KHGA 1B70B 2R9LA 2B51A 2FTRA 1FK9B 1URRA 2A0FB 2WW8A 4H4OA 3ZNUA 1FXDA 3TVZA 2GHWA 2M2BA 4I6YA 4IOCQ 3T5KA 4IRDA 3PYGA 4KKOB 4LFAJ 2W8LA 1JLBB 3H8YA 5HI7A 5KG2A 3ZFVA 3RJMB 1BHNA 1X8DA 2ILZA 1MN7A 4WIQA 5HROB 3AH6A 1WC6A 2YNIB 3J80U 2UXCJ 1SKRA 4LF9J 2F4FA 5I42B 1JJHA 4JI6F 3MFHA 2NYIA 1HBOB 1VQLS 5E3RA 4Q45A 2XULA 4GVBB 1XMOF 4LF5J 2DHHA 1ULRA 5IFMA 4GRSA 4A8KA 1OQ6A 1TL1A 1N6QB 1RLCL 2N3LA 2HQGA 3PEJA 5E3AA 3WZ0A 3CNQP 3BGRA 3I0RB 2LA4A 5KG4A 2K2PA 3ILOA 1PO6A 1IBLF 3NNHA 2QA4G 2QA2A 1K8AT 1WI6A 2B4VA 3N5FA 5D6GA 2UXDJ 2N7CA 2C3YA 1NUEA 3DGPB 2RQ4A 4LR9A 4NRUA 5KT5A 3G6ES 2VL1A 1PG5B 1BQXA 1X4FA 3M30A 4HEA9 4UT4A 2LQ8A 3MCSA 2KZMA 2B4OA 5I4MA 4X4OA 3C16A 2AX1A 3K5PA 2V4JB 4M5MA 4ED8A 1UA0A 4JV5F 2H5EA 3DNCA 2E9ZA 1RHJB 4YB1P 2WVFA 2YWFA 3SYZA 1WTFA 1YJ9S 4Z2XA 3DC2A 2DCUB 1RYRA 5A8RB 3BGOP 2ZE2A 3I5CA 2Q1LA 4WCEQ 1SH2A 4FKXA 1RCXB 4NX9A 5I3UB 2R2RA 4BHQA 1M1GA 1VQNS 2PA8D 2NXCA 3RB6A 3J81Y 3HKWA 4OJGA 2WAQD 3J7A1 4Y28C 4M63A 4CLZA 1F2GA 1VRUA 5BR8J 4J9QA 4DL7A 1KLMB 2ROEA 2V0NA 3PRBA 4KGZB 4NLRA 1I5OB 1HNXJ 4Z37A 4DV3F 1NHVA 5SZTA 4C8ZA 1ICEB 3A13A 1I3OB 3DOMA 2CPDA 3ZNJ1 1GFWB 1N36F 2JJ4D 1NSQA 2FLNA 3W5YA 2BJ7A 2OH2A 1JXEA 2B8QA 5IZHA 4K4VA 1PC5A 3AOBA 2NR0A 4ZJQA 5HVGA 1UFLA 4TXSA 3KUGA 1QTMA 1QLNA 3CCMS 2AYEA 1BD6A 1S59A 1RT3A 1VI7A 2B9WA 4I7FA 2ASJA 3HHLD 1YTYA 4N76A 5CCLA 3V6KA 5HLFB 3DI6A 4OX8A 3TQ1A 4JV2A 4IYQA 1YHQS 2WCXA 2UUCJ 3RB0A 4DV7F 2N4CA 1SV5B 1OIAA 1S5ZA 2CJYB 3G82B 3I31A 4ZVEA 2QLWA 3VCDA 5D4PA 1V3SA 2IJNA 2QA1A 2XGPA 2J0WA 1JX4A 1RP5A 2CPZA 2OFHX 3R3TA 2KXNB 3HZGA 3QQCD 2FHJD 3VAFA 5F41A 1LW0A 1N5VA 2XCPA 2DR7A 3QSIA 1DTQA 1OQ3A 2GS8A 4JUZA 4YB5A 1FNOA 3JSBA 3T9NA 1TKXB 2WW4A 2EXUA 4GO7X 4O3QA 5KFWA 1Q8IA 4X84A 1PC4A 2MLYA 3UCGA 1RTJA 1P9YA 3QIPB 2RMLA 4OJHA 4RLEA 5KFEA 2F5GA 1S1UA 1QSLA 2EFOA 1DURA 2KL8A 4LF1A 5GAHU 5HMYA 4ECSA 4DR4F 3V81A 1I51B 1HQUB 3M8YA 4DS5A 2LECA 3H2UB 3WQPA 1MWZA 1LFWA 5DZ7A 1C1BA 3TZZA 2EK1A 2HFSA 2JC1A 3I9ZA 4DL3A 3PV8A 2XLKA 1BWEA 2PFFB 5EX0A 3GCXP 5KOWA 1GMWA 1IBMJ 1NPPA 2UZAA 3ZTQA 4DSIA 3F56A 3HFZB 3R5BA 3NGTA 4UUXA 5KT2A 4J9NA 3T1HF 4RBUA 4RW9A 3LQVA 3T5HA 4ZVHA 4OHZA 3WIVA 1DLOA 3KTQA 4TY8A 1ZM2A 1HD0A 2IA6A 3GE9A 4NYPA 2RNEA 2YNHB 2HIQA 2KXHA 3J7AN 4IO1A 4WZQA 2K06A 3MAHA 4EZ9A 1X9WA 3BV8A 4PEOA 5D0HA 3K2YA 3CJSA 3TA1A 4ALZA 2UVUA 3DLEA 2MQMA 4IOBA 1C0UA 5A6WA 1R27B 3M8WA 1IKYA 3EPGA 1VQYA 1EETB 3VWSA 3O3LA 4Y2MA 3Q24A 2BE2A 3HKZD 4AL7A 4YB7A 1IBMF 1ZBTA 4HI2A 1NHKL 2HQFA 2Z2MA 3FRYA 3HZEA 1H98A 2N7YA 1R43A 4O44A 2W9CB 2L9WA 4LBIA 3RBXA 4NCBA 1U8WA 3BSAA 5ETNA 3ZTOA 5KFOA 2ZJPQ 1IBKF 1HNZF 2VOOA 3AXKA 1XMBA 2AJ2A 3TX8A 2FIUA 3BYPA 1UP1A 4OYXA 5J2MB 1F1BB 4C3MA 3L7UA 1HMVB 3VGVA 3GIMA 2O01C 4XO0A 3BJYA 2NYHA 2F4VJ 5DZ6A 4HHJA 3CULA 2R7WA 3LOUA 2KT2A 2ZOGA 4NI2A 5E33A 3RUBL 4EO6A 5J2PB 2IPOB 2DPJA 4UTGA 2GAHC 1NXIA 1N34F 1Y4ZB 2HBZB 3FDSA 2G0JA 3GZ7A 2OO4A 2MY8A 4ZVSB 3BZQA 3MUVP 4ZVRB 1YJNS 3NWGA 4NA1A 3ZTSA 1JNRB 4DV2F 2ZE2B 4UOCA 1QJHA 3PIOQ 2DO4A 4V1Ak 3CSKA 2DH7A 4C8MA 4LREA 4CO5A 3ZC4A 4DR7J 4HL9A 4KHRA 1ITPA 2GJIA 4G1PA 4USIA 1RA6A 4JI8J 4HR2A 2HLUA 3KKFA 4O3RA 1KS2A 3MR7A 3U7JA 4QYZJ 2AEMA 5L39A 2L41A 4OYAA 3KK2A 1NKBA 1IM4A 1KHVA 3MM6B 4RNOA 4K50A 1HA1A 3VR1A 1SJ4P 4E98A 4NZ7A 2BVZA 1TK8A 4I56A 3TAMB 2DHSA 1U48A 2X1FA 1RAEB 1FRIA 2MPUA 1ZZFA 4X65F 4FS2A 1NSPA 3VAHA 3V6DB 1NJZA 3IP0A 4DPOA 1NPKA 3AD8C 3FZBA 5KOXA 4JI0J 5JXSA 1V3ZA 1WG4A 3EDRB 4WTYA 4A8XA 4WYLA 5AXNA 4LBHA 4P72A 3Q8RB 3VAJA 1SJFA 2PO4A 2V67A 5B0CA 3NBPB 2W8KA 2XWXA 3BH6B 3FFIA 4OYOA 1D8ZA 5M2RA 4F67A 1TL5A 3NAHA 4M5IA 3S6EA 3MR5A 1JNZB 4TLQA 3VQSA 5CAAA 1FA0A 4QU6A 3WX8A 2BE7D 2HVDA 1S97A 3EWGA 2UUCF 2JX2A 1WEXA 2JRSA 3DHWC 1GXUA 2FC9A 4RUBA 2DHXA 3OR2A 4DL0C 4DPUA 1YRXA 2KFZA 1HMVA 4ED2A 4AQYF 4DSJA 3ZTPA 2V50A 1PYOB 3MPVA 2DNRA 2IMWP 3ZXWA 2AJQA 4DDFA 4U67Q 4IR1A 1RAJA 2RHSB 3VZIA 1URNA 1ELOA 4KH0B 1VC5A 1REVA 3US5A 2HMIB 1XIQA 3H5SA 2MQPA 4F26A 2RU9A 3OHBA 4IKAA 3KMQA 2IYGA 3ADAC 4OHYA 1CQMA 4USTA 2E1MC 2GFFA 1FVSA 2RT3A 4A8OA 1WOSA 4C3KA 1HKAA 3I87A 4LFCJ 2UU9J 5IT9Y 3DYAB 2H9ZA 2JLFA 2JOQA 2MZQA 3JS9A 4ETZA 2B9YA 3MM6A 5HAOA 1CJUA 2ZKTA 4UQTA 2OPQB 4K0KF 3EICA 3TZWA 3W9HA 3PO4A 4AFFA 3GJSB 4EO8A 2R7SA 1KN6A 3D67A 1UW4A 1RTDB 1HPZB 4ITSA 5LSRA 1X0FA 4U7UD 4WFBQ 3HHKA 2FUG9 2KH9A 1R3NA 5KFUA 4P52A 3OR1B 1T9TA 3TJ8A 3L09A 3CCJS 1H7WA 4L3NA 2W4DA 3JSYA 3MUTP 4LF8J 2EC0A 1LXJA 2Y0SD 3C15A 4L73A 2C2OB 3C2PA 3E2EA 1H0HB 3R5AA 4DL6A 2DXFA 3VGTA 4TQSA 3VF0B 4MAKA 2DNMA 4ZPCA 2BKOA 3B4MA 5CZXA 1AUDA 1RA7A 2M5YA 3TANA 1HNIA 3MEDB 2HPUA 3B8HA 3E01B 2RRBA 2XYGB 1S7HA 3EE3A 3OR2B 1F5AA 1FERA 1IKYB 2VKRA 1TR0A 1UJ6A 2WB4A 4JI1F 1IQTA 4DF8A 2ZH7A 3MI7X 1VQMS 4PWUA 2X3DA 3AB2B 3KK3A 2ADBA 1SIZA 4P2XA 2GAGC 1WC0A 2VG7A 3TEGA 4O44B 2CA9A 2VQFJ 3BO4A 4PXBA 5F8GA 1T3NA 1MG7A 4ZPDA 3DRYA 5HBMA 4RNMA 2DGTA 3HX9A 4OX6A 3M2RB 3G8TA 3EPIA 5DQHA 1Q8KA 4DL5A 1HI0P 4KTQA 5F8JA 2QO3A 5DG9A 1SL1A 1RWVB 3DDNA 1UPMB 3UQSA 1NB2A 1LWCA 2FHMA 4ZCIA 2ADCA 1SH0A 1T03B 4DQRA 4FBTA 4RPFA 5HL7Q 2YX7A 4MIBA 3A8KA 4C4WA 1U1QA 4HDHA 2WOMB 1W2IA 2FJBB 3X3UA 4DU8A 5DO2A 1VHFA 5KFDA 1OY8A 3QSYB 1NZAA 2AF6A 3NS6A 3MGJA 5KFJA 2FVRA 2IYIA 2AMCB 4NLSA 4WPAA 2CVEA 3ET6A 2LQ5A 2RUSA 5DRKA 4LMZA 1U2CA 1X9MA 3P8BB 1Q4RA 2KKHA 3CDEA 3MECB 3RZAA 4WK3A 2W1BA 2QT7A 4CO3A 2V8PA 1HNZJ 2XM3A 2CAJA 5G0RB 3WBZA 3KLIB 1XQIA 3EVOA 1NSAA 2KHCA 1HBUA 2NUHA 2VC0A 3N6NA 4KRWA 3C66A 1R0AA 1OPZA 2HS4A 3NCQA 2WSEC 3BR8A 3FCHA 1FE4A 2E44A 2AW0A 3IWXA 2E1AA 1WI8A 4CH7A 2GJFA 5J1EA 1NKCA 2O5DA 4QR2A 1DHMA 1U4BA 3G6YA 2QEXS 2RRNA 1TL1B 1R0BG 3NGKA 5C2CA 4KV8B 3R6LB 2RRAA 1HNVA 2HRYA 2MQQA 4RBVA 3D1HA 5KFAA 1Y11A 2CNNB 1VK8A 2ZITA 4ZP8A 1HBOA 4DR1J 1XNQF 2V63A 3PFEA 5DLFA 4X66J 2YNGB 3MMAB 3OTCA 3RBEA 2DGUA 1F3FA 4CO2A 1N36J 3HD2A 1U6ZA 4K4UA 5K8PA 3DRRB 3I0RA 4KPCA 1NRKA 3D6MB 3LGNA 3TJ9A 3TI0A 5LMNF 4B9NA 4NA2A 1VC6A 1VQPS 2ZH8A 1M1HA 4ED6A 5EGYA 2ATCB 5KFTA 1KDNA 3JTNA 2L3MA 5D0EA 3QIDA 1LXNA 2QL5B 4FPRA 2RS2A 1B7YB 4YY3J 1RT4A 5B0EA 4CM2A 4ED0A 4LSNA 2FZCB 1XK8A 5A8RA 3D3BJ 3BEGB 3MTJA 2FVCA 3GG1A 2L48A 4HH0A 2JVOA 3OTDA 2V4RA 1S1TB 1MMNA 1WHWA 3VVTA 3P5TL 3CCWA 3Q8YA 2A18A 5C7PA 4TU8A 2A6MA 5AJ3J 3DOMB 1T3OA 1KWMA 2DPIA 4NZ0A 1S1WB 2M0GB 2QN6B 2M3DA 2ZVSA 3HVAA 1SH3A 4DLGA 1KSPA 2AGOA 2HFZA 3LP1A 1BE4A 3GV8B 2C22A 5K14A 5F3ZA 2XY6A 2RE1A 1CJVB 2DRDA 3W8PA 4A47A 4K4YA 2BKNA 3CGIA 2NXEA 4V19X 3IRWP 3FRZA 1Y5LB 3I32A 4F2SA 2HZCA 3BBCA 1AYEA 3D0HE 4PKDB 1NDLA 4ECWA 2MJNA 2V6AA 2X51A 4B3TF 1K1SA 1YZ6A 2O3DA 3OD2A 1HNWJ 2HHVA 2N4DA 3LP0B 5IC4B 2XB2D 1XN9A 3D2WA 4WYWA 3QZ8A 1KEKA 1RT3B 1MMLA 1Z1ZA 2PEBA 2ZVIA 1T7PA 4AL5A 4FNIA 1JK9B 3QT6A 2WVBA 4Q2MA 4OHWA 3CIMA 1GQEA 4CT9A 4DQSA 1IN0A 4PQUB 2CYYA 4L6V3 1XR5A 2ZBQA 5C25B 5HO4A 1JMTA 2BJ1A 4FVCA 2A2CA 2F8MA 3IGVA 3QZ7A 1FRLA 3QFWA 4A8SA 2BYCA 4AXIA 1K47A 5H9FJ 1ZM3A 1LW0B 3BGFA 5LL6d 3UFCX 2PC6A 4URGA 1O0PA 5GADU 4I64A 5E41A 2CG4A 2IRYA 2Y1LB 5C2GA 4FBUA 3D68A 1D09B 2R7XA 3EDQB 4ZP7A 2CQGA 2BKPA 4RNHA 1VBXA 2JHEA 2C3PA 3LGMA 3DM2B 1NH8A 1S7IA 2KHDA 1XR7A 2Z8QA 3G71S 3OW2R 3GB0A 1X4BA 4P71A 2DNYA 1M0SA 1Y3KA 3F73A 2ZOMA 3W63A 1TKDA 1N34J 2HFUA 4MMOA 4YS2A 5JVHQ 2RDDA 1EIYB 2VFVA 4NMXA 5KFGA 2RDJA 3KOAA 3ET6B 1UJ4A 3NRBA 1WF2A 5T14A 4PPDA 2Z2LA 5CQGA 1OSDA 5J1NA 3IG1B 4LIWA 1WF0A 3Q8SB 2Q6BA 4WFAQ 3PX4A 3VGSA 4USHA 1RISA 4B3SF 3G87A 3R1HA 4DZ6A 4K4WA 1Q86T 1AW0A 3ZZ0A 2VODA 5C24A 2RAQA 1UCNA 2ZJRQ 1DQAA 3NS7B 3HO1A 4URQU 1F0XA 3E3XA 4YR3A 1RTHA 3CD5A 4JBCA 4KY3A 2QLXA 3OFHA 3ZZYA 5DM7Q 2D9PA 2UXBF 1U8SA 1OYDA 3FEYB 4C97A 1RBOB 3F41A 5J1EB 1VBYA 1WEYA 3BGUA 1ZAWA 4KQZA 4GKKF 2V9KA 2V2KA 4DUZJ 1B0TA 1IQZA 4N7TA 3EM1A 3QGHA 1JJCB 3BDEA 3I0SA 4OYMA 3H42A 3S01A 2ACMA 1HBMA 1C2PA 4GO5X 5LMNJ 2GMHA 1W7WA 4K59A 2XWYA 1ZZNA 2DR8A 2UVVA 1RZMA 2LXUA 2YKMB 3OFFA 2YY3A 5F8LA 5KT4A 5KFZA 4DUTA 2WONB 4ECUA 4P2SA 2DO0A 3H25A 3POTA 2PD1A 4B9TA 2YXLA 4KH1B 1S1VB 3LAKA 3KLHA 3MMCB 3PIPQ 5GAGU 4Q0BB 1U6FA 4CQ1A 2ZWPA 4WF9Q 4TKTA 2E9TA 1JIHA 4IR9A 2HVEA 1VK3A 4LVOP 4AQYJ 2I5JA 8RUCA 3UNGC 2P9CA 1E6YA 1T9WA 3OFGA 3QPIA 4PG5A 1GNKA 3D28A 2E66A 4XDDA 2YWGA 1CEZA 1SB6A 4ZJLA 3TA0A 2DHAA 1IJFB 3N0VA 4YUDA 2RQCA 1JB0C 5IS2A 4PZVA 2Z58B 1RT4B 4KYZA 4AT1B 2LVWA 2IDLA 1PJ7A 4PCQA 3DOKA 3SCKE 3T6BA 5BYRA 3CXCR 3QRPA 2VOPA 5I3QA 3TARA 4Q2LA 1U47A 1VRTB 2OLWA 2W7AA 1S6UA 2K3KA 3V2UC 4OIXA 1RHUB 1OS5A 2ILYA 4MK9A 2IRXA 2KM8C 2VIHA 3M2UA 2CQPA 5M2PA 1HWIA 2CUYA 3TYTA 3UD3P 3D7SB 2O1PA 1E6VA 1X5TA 1CJKB 4ELTA 1TUGB 2OD6A 4DQQA 5CABA 1L5UA 1RT7B 3UDEA 4EZ6A 1OMSA 3N5BA 2H1YA 1REVB 2G2OA 5HQMA 3H5XA 2H5IB 2ZNYA 2EBEA 1HI1A 4FN5A 3I6PA 1IXKA 1TL7A 2IDEA 4B9MA 3RAMA 4ICLB 4NZ6A 4O23A 4C8OA 1M5HA 5ETRA 1R6YA 4NA3A 2F9DA 1XNRF 2J7WA 3H20A 4USUA 4DG1A 3CDUA 3A1YG 4IFVA 1N5SA 2BACA 2P5VA 2AWZA 1VRUB 3GFYA 3HT3A 3OBIA 3LP0A 1FKPB 3IS9A 5AE3A 1N5YA 4R5PA 1WHVA 4KE5A 3JYTB 3P49B 4M5DB 4JI8F 2CZ4A 1Z2LA 3OSPA 5THWA 1TK5A 2XBPA 1R89A 1S4EA 2A10A 2W2PP 4U96A 5LSLA 1BXNA 3LUYA 3P6YC 5KT7A 3SV4A 1X7VA 2CQIA 1IR2A 2ZH5A 4J5OA 4ZN1A 4P73A 5KFIA 2AJ1A 4A4JA 1QAYA 3OLBA 3KNGA 2E1RA 3PHTA 4RW4A 1Z2ZA 4P10A 4DCPB 2OPQA 5KG5A 3W5ZA 1SJRA 3IAS9 1T95A 3BSCA 1N54B 1NK7A 5HVHA 3CC4S 1Q7LB 3GP9A 3M6VA 2XSFA 4N77A 4RKUC 2R7OA 2Z0GA 1MMDA 4H4KA 4X4QA 4A8QA 3ITHB 1JXLA 3KHRA 2HNYA 4B3SJ 4KAIA 3MM5A 1JLEA 2AD9A 2AZ3A 1BUXA 1BQNA 2GCFA 5GAEU 2CJXB 1WOPA 5D15A 3FMBA 3T1YJ 4XPCA 3DFEA 4CWBA 4LF7J 1DQ9A 3T1YF 2AQ4A 3IWNC 3DHXA 3V4MA 1NHUA 3DU6A 1TL7B 1JJ2R 1OO0B 4MT1A 3HM9A 2HGMA 1YRTA 3FQLA 3HVWA 1SQFA 3GIIA 1N32J 4QYRA 4N5SA 3SBMA 1S4FA 4K4ZA 3FC9A 2RVJA 3MAQA 2GGPA 1SJ3P 2MKHA 3M8ZA 1SVDA 2LQBA 4OI2A 4RZRA 1HQEB 2OEJA 1KFSA 2IAJA 1S6QB 1K1QA 3DLKB 1WHXA 2HVZA 3LPYA 3NOGA 4WXWA 3M6UA 2W9BA 3GILA 2V34A 2W9AA 1NJWA 4X4NA 2FGOA 3LA0A 3AOAA 3CF5Q 2VBWA 4LRDA 5DLGA 3DDIA 3QGGA 1HFEL 2W2NP 2V2ZA 3DLEB 3KLGA 4ZVUB 2AIRB 4C98A 3KLFA 1GXTA 5FD1A 1CJTB 1H7XA 1TV6A 3KG1A 3UD5A 2HVIA 1QVGR 2BR0A 2WOMA 3PXGa 4CO1A 3T19A 2OSQA 3DLJA 4U6PA 1XEZA 4JI4J 4J91A 2NXJA 3AODA 3I96A 2DR6A 3FJ2A 1IBLJ 4DN0A 4QWBA 2RF2B 2YQ1A 3WIUA 3R7NB 2BJ9A 4TNOA 1A7GE 1G1XA 2C2NA 1AZSA 4I2PA 3QGIA 2GJ2A 1FJ7A 3EYZA 5E7OB 3FVYA 1HYSB 2PMWA 4ED1A 5F0UA 4DUYF 1FT8A 3S8SA 1UEKA 2R2UA 2UP1A 4ERDA 1HD1A 2E5JA 2J8AA 1K0TA 4E8UA 4YQWA 3I82A 5LMUF 4CLYA 2NREA 4ZLJA 3K0JA 3CJKB 2CJQA 2FLOA 2HLTA 1PIEA 1KHWA 3M8SA 2DH8A 2HW3A 2B43A 3C46A 2YX4A 3HHNB 3A3NB 4OYWA 2UUWA 2FQQB 4U8VA 4DS4A 3DLLQ 4WXOA 3JTPA 2Z56B 1HLWA 4NPOA 3N01A 2NCKL 3PFOA 4UW2A 1HBNB 3PHEA 5A6PA 3PO5A 3HJFA 2H5JB 1U0HB 5IXUA 3SDEA 5GMKa 5A8KA 4ZKAA 5D3GA 1U02A 2CQDA 4XPEA 2KTQA 2GQ2A 1IBCB 4KGVB 2IHR1 1BGXT 2PIIA 4J37A 3CCES 2AYGA 3EXYA 5KFXA 4I4BA 4KB7A 4DOZA 3J7YI 5A2QY 2K7KA 4F25A 1S1TA 5LMUJ 4EEYA 4XTTA 1B3TA 3THPA 3CJ3A 4FNHA 2W25A 1N88A 5CZVA 4A48A 3MCNA 1AXQA 2BX6A 1QVFR 5HJYA 4LSNB 3QAEA 3AOCA 4DR2J 3QT7A 4KR0B 2FHJA 4QCLA 3IBCB 2VPXB 5CYJA 5RUBA 3H40A 2J6UA 3RG6A 1LWFB 3I55S 4ZA1A 4Z7YA 4YR2A 2ZFHA 4DX6A 4DV3J 3OL8A 4RUAA 1V6HA 2I1RA 1FWLA 3KK1B 5CXTA 2VBZA 4B9SA 4MYUA 2GQCA 4B3OB 3MM9A 3F44A 4OX9J 3J7YU 2J9DE 4ANEA 1HIYA 2CQBA 2OPSB 3FSIA 2R7RA 2DY9A 4J7CA 4JI2F 2BMBA 2XMUA 1YJTA 2GA7A 3H7HB 4AE5A 3IGNA 1UVMA 4LF4F 4DR7F 4A46A 4I2QB 2XYPB 4WP3A 2W4PA 5DDQC 4FF1A 3FCVA 1NDKA 2ZD1A 4IFYB 5KTQA 2P6TA 1PJ6A 2UUAJ 1CJVA 3HSJA 1IR0A 2ZDOA 3MAAB 5LJ5Y 5H9FK 2WSFC 4X4VA 1BQNB 4P75A 4LF7F 1EP4A 1WD6A 3L95X 4KFBB 2FPHX 2ZH1A 1GMVA 2R4FA 1EKSA 2VDIA 1VBKA 3BN7A 3WX4A 2W7PA 1T0TV 2DNNA 4EYHB 4HYKA 3PM9A 4DSKA 1EHWA 2O66A 5EHHA 3G4SS 4FF4A 2HK3A 4M1KA 3I0SB 1PAEX 1B0VA 4OHXA 3OVAA 1B0PA 3MR6A 2NZ4A 3Q8UA 4PR6A 3THTA 2VG6A 1RDRA 4I69A 3VAGA 4DL4A 4EU0A 1F3VA 1FI4A 4CH1A 2XO6A 4PQUA 1KFDA 3G6VA 1R8AA 2LFVA 1JXVA 2MXYA 2JEFA 2DJWA 4KIAA 3W2VB 2AEFA 2RKIB 1U7LA 4OV1A 2P6SA 1IM6A 3D1QA 4I68A 1NAQA 3OFEA 1VHIA 4CTAB 4RU9A 3EZOA 3IBFB 2B9EA 2VFRA 3TQEA 4PG7A 4USWA 5IV3A 4BS2A 4F4KA 5DDPC 3IC1A 2M52A 4F02A 4KPYA 2GVZA 2JLEA 4AUKA 4MKVA 3KLGB 1Y5IB 3IG1A 3CD7A 2CWXA 1QY7A 5HP1A 1TK0A 1TMJA 4ZVQB 4LVNP 1BY9A 2EFPA 4ECXA 5D0RA 4MIWA 1OPIA 4DPYA 4Y3CA 2DNZA 2MZ1A 2RU3A 2C2RA 2IMOA 2YX1A 1KLMA 1SJ1A 4I0WA 1P9QC 1RAAB 2OGUA 2F8HA 3CE8A 1FEEA 2CQ1A 1N52B 1UVKA 4ID5A 4K8RA 2HURA 3QO9A 1S49A 4ZCLA 2CQ3A 4P2FA 1WKLA 3D3CJ 3AB4B 1V5IB 3T9ZA 4RNFA 1NB7A 2K1RB 4CLWA 3C6TB 2V8DA 4FYVB 5CA5A 2KYXA 3G8QA 3SCIE 5AXLA 4I67A 3R9LA 1HNWF 2JNJA 2QZ8A 2HQDA 4IG3B 1K44A 2HWIA 2J5AA 5KFPA 4RU2A 3CC7S 1S1UB 5DGAA 1A0OB 3W8GA 1XMQJ 4C8NA 4JI5F 2HFVA 3DGPA 2MZJA 5D78A 1S1VA 3KLHB 4LQ3A 2DBBA 4C8KA 2KRRA 1EJ7L 1FX4A 4RWXA 1UEVA 1UKUA 3GV5B 1XNRJ 1TP7A 2A3JA 5KFBA 1SUQA 4I1TA 4W90B 4PG4A 1X9SA 4OV6A 4CIOA 3DLGB 5E3CA 4CO4A 4FXDA 1UAWA 2B6AB 2DHGA 2COLA 3FKBA 4NXMJ 4G1IA 4ECYA 2HGLA 2KRBA 3GR1A 3MR3A 2NXUA 2YNHA 3BN4A 4G1QB 2BJ8A 3K8VA 2VUGA 1Q16B 1MU2A 3R2CJ 3UI3A 3MMBB 5DDOC 1Q81T 1G7CB 4M8LA 1VQ8S 2FVPA 1UMJA 4AYBD 2QLJB 4ID8A 1DBDA 4OFZA 4G6VB 5D0GA 4ZP6A 4ZS6A 2ZH2A 2LEAA 3PYEA 3EGZA 3HK2A 1MWYA 1UW9A 2BRKA 2CKWA 2VD3A 2ZBCA 3M2UB 2EFGA 1UVIA 3MXHP 2SXLA 3W1YC 1FCAA 1LW2B 3CDWA 4Y6IA 1ZH5A 5A0YB 1U1OA 4AL6A 4DR6J 1RWXB 1RAGB 5CYQA 2EI5A 2EVZA 2G13A 2R7TA 4HDGA 5JUMA 4YDXA 2DXEA 2OP5A 1S0VA 2R8KA 4RW7B 2LCWA 1RBAA 1ZPWX 5HSPA 3GU0A 1Y00A 2H65B 4DPXA 4OZLA 4QIVA 4J9LA 1BMQB 3MMAA 3EXCX 2CPYA 2O67A 4IG0B 3R97A 1QAJA 2A2DA 3H2VE 3DRPB 3KUEA 5KG6A 2QFIA 1HNXF 1EAYC 3ETOA 4RUHA 1GX6A 5EUHA 4J9RA 1S0NA 4XAKA 4DHVA 4ZLPA 3GR0A 3Q8QB 4N8NA 1KRPA 2LU1A 2R7VA 1XWLA 2QYGA 3RAQA 5ETTA 1SCJB 1Q78A 4PABA 4Y34A 5I3PA 3JYTA 3SCLE 2GZOA 1U2RA 1D9AA 1FO1A 3KDNA 4M5GA 3JQMA 4BDPA 1HWLA 3V4IA 1U24A 3ZZTA 5BXIA 2KG0A 4MH8A 2Z57B 2IVYA 3MWBA 1S6QA 3DLBA 5L1LA 5HMWA 4DPTA 3PX0A 2QX0A 1L3VA 4ZCKA 1SC4B 4K5RA 4A8FA 4NE9C 1U09A 4NI2B 1S9EB 5GADI 2P9EA 4FF2A 2MKJA 3RTVA 2FVQA 5JJBA 4OYPA 2DISA 4J9KA 1TFWA 1RWMB 3NKYA 1N56A 2BDPA 3BM7A 2CQHA 3HHLA 2HGNA 2HWHA 3M05A 1HWJA 2MLXA 3A8EA 3LTOA 2HQ3A 1WUUA 3EJMA 2PMZD 3M6XA 1MNEA 1HR0F 5MAOA 2J7KA 2HEKA 3NGUA 5A0YA 4ZIWA 3BREA 3ENAA 2FJWA 3R27A 4RW4B 5KFYA 3FBBA 1JLFB 3BBBA 3EUNA 4OZJA 1VS3A 1I94F 1FJEB 1VR6A 4B9LA 1FFGB 3CCZA 3I4PA 3PJXA 4CLUA 1CS4A 5HROA 1S12A 2UV8G 2QJ3A 4DZDA 4ETXA 3J80Y 4HACB 1D9DA 4DFJA 4PG8A 3CMES 1UPPA 1YGYA 2QMXA 5C5JA 1WNEA 1LWEB 2VC1A 4Y0FA 3G2XA 2HWTA 3KUHA 2D69A 5B0DA 1MN9A 1HW8A 2HG4A 1Q8BA 1RAHB 2VDHA 1HR0J 2B4PA 5K14B 1M5SA 2UVRA 2VF3A 1K0VA 3DOLB 4RW6A 4EMDA 1RUSA 2H4YB 2LYVA 5CCMA 3G6XA 2YKNB 1X60A 2VH7A 2V4JA 3GONA 2FJEB 5DG8A 4ZVGA 2FC8A 2J0QD 2KZZA 2WRMA 2DRBA 4TU7A 1RTZA 1QTNB 1WKKA 3PW4A 5GAGI 4DV5F 2EKNA 1HWKA 2XSJA 3M8QB 4Q8EA 3BR9A 5IOLA 3DM2A 4MKAA 4B3RF 1FE0A 2MQOA 2ZOFA 2EC2A 4DR3F 1FNMA 1UWBA 4PWDA 2D41A 4HVZA 3LW5C 1JQGA 4OQJA 1RSCA 4QIEA 1S6PA 4BLGA 1SUQB 2F40A 1EQMA 2XNQA 3HP6A 1FKOB 2LDIA 2ROGA 2IY5B 2C3MA 2I6WA 4OMFG 5IWAJ 1EQ0A 2Y0BB 3H0PA 4KHMA 3P4UB 1L3TA 2XZWA 3KYLA 3NGDA 1YBUA 2DR5A 4ILMA 4PXCA 1DAXA 2QRRA 1WC5A 2F3JA 2V94A 1YX2A 2DB1A 2VV5A 1VQ9S 1SQGA 4IH5A 4LBPA 4O4GA 4ZLNA 5DQIA 4ED3A 2RH3A 4O3PA 4DV1J 3RBDA 2BQ3A 1S76D 3V4IB 3O2IA 1PBUA 4RNNA 4JV1A 2Y8WA 4B08A 3WHIA 2IM0A 4HACA 2MZTA 1JLGA 2QC3A 3KWMA 3TVYA 2GNKA 4GMKA 5ETPA 3TUIC 3UDLA 2ZH6A 2OPPA 3RR8A 5EWFA 2CNOB 3BPDA 4EGLA 5ETVA 3GCWP 1U0HA 2RSQA 4QZVB 3T3FA 1AZSB 4DCJB 1Q0NA 4KGKA 1FTCA 1IKVB 4MYTA 2ZH9A 2CQ4A 3M8RA 4HLBA 3KNAA 2BJEA 1RT6A 4MFBA 1UVLA 2WVCA 4NLPA 5KFVA 3I56S 1Q5YA 1KQGB 2EG2A 4PYDA 1CULB 4FP9A 5HJXA 3UR3C 2FZGB 1FVQA 2CPHA 1CG2A 2DXDA 3GIRA 4G65A 4NOHA 4QIWD 4QOTA 1JLAB 4UZCA 3ILJA 2XMJA 2VJVA 4RWWA 1FRMA 2LMIA 4DUZF 2QV6A 2ZDPA 3CJ8A 4KSEB 2HAIA 5JMNA 2ZHOA 1YQHA 3MM7A 1RAOA 5HVFA 4X4PA 7AT1B 3FBEA 1QUPA 3B4DA 4P2MA 3PRVA 3SQGA 4BC7A 2R7UA 1C4AA 1F5CA 2LEPA 3OTEA 1UWBB 5HBMB 4YY3F 4PUOA 1SPBP 5D4NA 1MROB 2NSBA 3IAM9 1TQLA 1T02A 1WF1A 1WG1A 2G0CA 2J76E 4UOHA 4ZLLA 4QPXA 1PJ5A 1HBMB 2BQRA 1VQ6S 4LFBF 5AXKA 2ZHBA 3Q0AA 2EFNA 4ES1A 3AJ2A 1LV5A 2F65A 2J9EA 2QTWA 2N3OA 1PGZA 4TY8B 4DSLA 2CZ9A 1J5EF 3PRDA 4DL2A 1Z4UA 2J0XA 1VMBA 4CCHA 1KOHA 5G0RA 4TQRA 4OHVA 4JI4F 2ASLA 4CYUA 5B7WA 3GLJA 1SC6A 1OY6A 2G2ZA 2XI3A 1CJKA 1NM2A 5K8OA 1FD2A 3KK1A 3H5YA 3PW5A 1RXOB 2I9SA 2OD4A 3F0NA 1UFWA 1YKWA 1R0AB 4JI6J 1JLFA 5J2QA 3TJAA 3OUYB 4LF9F 1LWFA 4R8UB 1TFYA 2VB6A 1O6XA 3M9MB 1RACB 3PYFA 5ETQA 3PJWA 2R8HA 4F2RA 3TZYA 3Q22A 3U1LA 2OEMA 4ECRA 3RRHA 2C2DA 4UZBA 4LF5F 2ZZMA 4ER8A 4KV8A 3C6TA 4NLQA 1WSVA 3WDOA 3UDCA 3M6WA 4C0HA 3OQ2A 2XMVA 3GYXB 2Z30B 3KG4A 1EP4B 3K5NA 1UWAA 1NLKL 4CLFA 2UXDF 2IM3A 3B78A 2CJBA 5B0AA 5FIIA 1NSKL 4LIRA 1GT8A 1X4HA 5DJBA 2RKIA 5J2PA 1XMQF 1C1CB 1HNVB 2H4WB 1XBWA 2V69A 1Y9OA 3O5TB 2FJVA 3OXFA 3ILIA 4CNYA 3PYDA 3HVRA 3MM8A 4ZIVA 3DLHA 1R8CA 3IM9A 2DNLA 4QWEA 1XMOJ 3W9JA 5KG7A 3TX0A 1YVFA 3SQGB 3D66A 1RTIB 3GTYX 4DMZA 1G6BA 4LSZB 1SL2A 1WG5A 3BYRA 1S99A 2A1BA 4I6WA 5HP1B 4NXMF 1T9VA 4NYOA 4O3NA 2DD8S 1T8EA 2IA0A 2OMLA 4ATNA 3NOCA 2OUGA 3R5CA 1KQKA 4C6AA 4KGXB 1GH8A 2HFNA 3FK4A 3LF0A 4ZHRA 5F9LA 4U8YA 4Q8FA 3HHEA 4QR0A 1VLOA 3OV7A 2GHVC 1S6OA 3V6HA 1D0EA 2HHTA 2IC3B 1BLUA 5AE1A 1TKZA 2QSFA 4X4UA 2R8JA 3MMJA 5FLXY 4B3MF 2PFDA 3MDFA 3BO2A 3HCXA 1N0VC 1WC1A 2BM0A 2RUGA 5C42B 5IT4A 1TELA 4K4TA 1WDTA 3NBPA 2VPYB 2JEGA 4A8MP 2CQCA 2DNGA 4M5KA 4NLVA 4WBFA 1DZ5A 2CJKA 3CCVS 1TAUA 4C3LA 2M8DB 2RQMA 5E0OA 4KC5A 1GXLA 2X1AA 2JL9A 3DRXA 3N9UC 2HHHJ 5T41A 2K8GA 3A12A 2JSXA 4KO0B 3K89A 3RYLA 4ZMMA 2KJVA 4DLEA 3SQOP 1OJ4A 4U9RA 1RGVA 5HLFA 4ILLA 3IR6B 5HMXA 2ZKUA 1FDBA 1HQEA 4P7VA 3W61A 4M5HA 4YP3A 1QSYA 3CB4A 5DG7A 1PYSB 1CULA 2IJRA 2K1RA 4ZVPB 4CRJA 3MM8B 4K2JA 3DRRA 1SC1B 1BC6A 2X1BA 4J9VA 4F04B 3PW7A 3TUJC 3QAUA 4DPWA 1D9FA 5HMZA 3SIPB 2HQCA 2OTLS 4DWIA 1FFWB 2EFVA 3HD1A 3M2VA 1GK8A 2YKAA 4P9SA 2DNOA 4DN9A 3TW0A 2ASDA 2G4BA 3FNNA 4PUOB 5EN1A 3JSMA 1HARA 3C8YA 2F9JA 1SL0A 3GFHA 2VPZB 3B54A 2IVFB 2DY1A 1TUVA 1WACA 2XEXA 1U1RA 4LFBJ 1YG0A 3R2DJ 4ILRA 2LXFA 3MOZA 2YKOA 4NCGB 7FDRA 2W7OA 2ALYB 3M8PA 3BBFA 4UOGA 3MF5A 3U27A 5AJ3F 2DIUA 1LK5A 3K5LA 1RT2A 2CJAA 2BQUA 3FQKA 5C42A 3L3CA 3IBWA 5IT0A 2M8HA 2VKZG 4OJ3A 1SXLA 4N41A 2UXCF 3SSRA 3G86A 2MDAA 1O8BA 4DI6A 2AV5A 3GJQB 5CD4A 2VPWB 5L1IA 4OZNA 3LP2B 3M1VB 2W2QP 3TP2A 4DBQA 2XNRA 2Z2ZA 3HFVA 3QYYA 1FJGF 2HHUA 3TUPA 1YITS 1W25A 1RKJA 1F9FA 3DRSA 1LWEA 5H9EK 5CYQB 2ZUAA 3LH2S 3P96A 4WWSA 2FHOB 1XR6A 3FSYA 3D54A 1LEOA 5KG0A 1H38A 1DTTB 3BGRB 1IBKJ 2BA9A 3BQ0A 2V2QA 1L3SA 4V19J 1PCAA 5T7LB 1F5BA 2VQEJ 2I0XA 2DRAA 4B9VA 2L08A 3W3SA 1RAFB 1N48A 3GYGA 4WFYA 1CQNA 4UOFA 3ZZPA 2NXNA 2YTCA 2IFXA 3M30B 5LJ3Y 2HNZA 5IT9U 1MWQA 2MHNA 2LDYA 2B0GA 4YB6A 3MR2A 1X31C 3W2WB 2QL7B 4HHHA 1AT1B 3RRKA 4PG6A 2C28A 4LUBA 2Y1IA 3SFGA 1H74A 3CO0P 2VZ9A 2VJUA 3TAQA 4K4SA 3HHLB 5F8NA 5A2QU 4X2BA 4OLPA 1HWUA 3NCPA 3ZO7A 4B02A 2EEYA 1CLFA 3O44A 3ENQA 4L72B 4FVMA 1EARA 4W98A 5KFKA 1SC3B 1S9EA 1Y10A 1KP6A 4OZ2A 2XO7A 2R8IA 3BSNA 2AYBA 1E6YB 2QYCA 1UTAA 3Q23A 2VONA 1AUSL 2YKMA 2Q79A 3MCMA 8AT1B 4ZHRB 3GFZA 2GIRA 5LT5A 4U7CA 3CPWR 2DGQA 3PX6A 5B0FA 1R8PA 5HN0A 2J0SD 4Q0BA 1WJ9A 2HBRB 5KFLA 1KC8T 4B3MJ 1NZ8A 2ZD1B 4IFYA 3W64A 4EWTA 6FDRA 3OJUA 2HHPA 2XS7A 2PE8A 2WZ1A 4JYAJ 1C0UB 1P1LA 2LKZA 4HTJA 4OZ5A 4D3GA 4DV6F 3W60A 2FLPA 4IUFA 4LF4J 4USKA 9ATCB 2RHQB 4ZOSA 4JI2J 4CT8A 1S79A 3C15B 1U1KA 2LP4A 4ENOA 2J8SA 4WTOB 3CW2C 1ZAVA 2MJUA 5F8HA 3K57A 4DFPA 4NMLA 3T6JA 4YHHJ 3EX7B 3DOKB 2ERRA 2YKNA 2DNHA 1U49A 4YHHF 1APSA 3PEHA 2UU9F 3OVBA 1LKZA 1Y7PA 3W5XA 1F9HA 2GMJA 1GEHA 4JOUA 4KO0A 1Q8LA 1IKVA 3UNYA 1RTHB 1N5TA 3A8IA 3CEDA 3Q8PB 3C3LA 1OSCA 2NSCA 4EFAC 2G2YA 2BJDA 5HQ8A 2KVIA 1VOMA 2P8IA 4CLSA 1ZPVA 3LPEA 3MEGB 3NWRA 4NL5A 5AXMA 1KKHA 5KT3A 3V6JA 1NK5A 3M32A 1FXLA 4DXLA 4MK8A 3Q8VA 4DV6J 2BANA 1ZETA 2HBYB 2CDQA 1KNZA 2AYMA 4KHPF 1YJRA 2FZKB 3H98A 3QJLA 4R5PB 5FDLA 1WC4A 3NGSA 1YBTA 2W01A 1KQFB 4PXDA 4W92B 4J9UE 6AT1B 3AA9A 1XC9A 2W24A 2XYHB 4R25A 4QWDA 4DSEA 2KFNA 5HK4A 4C7QA 4ECQA 1VQ7S 3M2VB 3CO9A 2MGZB 1R0CB 2HBQB 4ECVA 1RU1A 2M4MA 5B0BA 2B9XA 4DX7A 1RT1A 1WOOA 1PSDA 1Y0HA 2DGVA 2I5JB 1P6TA 4PYAA 3LWMA 2VFTA 2VHGA 2UUBJ 3BKTA 4WFNQ 4PXEA 1YDLA 1IKWB 2CDRB 5L9NA 3J81j 2WTFA 2XQCA 3D6FB 4B9UA 3CDAA 3ITHA 1RE1B 4PWDB 2ZBPA 3RAXA 1IKXA 2C3OA 2DNPA 1S1WA 2YKQA 4FYWB 5K5MA 3IXQA 1S57A 2OPPB 2MTLA 3CWJA 4IOAQ 1U0SA 2GVZB 4JI7J 5KFHA 5BYSA 1RHMB 1JKHB 2GMLA 2HRTA 1U1NA 3IM8A 2G1HA 4Q43A 2EKYA 1ZA1B 1VRTA 2YWHA 4OI0A 2B56A 2Q43A 1SBRA 4IG3A 1H2VZ 2XMWA 2IJFA 1T9XA 1MLAA 2XY5A
chains in the Genus database with same CATH topology
5KFCA 1UVJA 1NK8A 2F8EX 1U25A 4O4GB 3I9V9 4IRCA 2DNQA 1CC8A 1P27B 4NLXA 1U2FA 2MZSA 2OFGX 3H5UA 1BQMB 4ID5B 2D3ZA 5C25A 1S9FA 4DR2F 2R2SA 2YNGA 3K5OA 3ENVA 4OI4A 1H2TZ 2GW8A 2D9OA 1MROA 3PACA 2KG1A 1S1XB 2GGPB 1IUJA 4LJMA 2DT9A 1HW9A 4IFVB 5J2MA 4JI0F 4DR6F 4OI3A 5L9XA 5GAHI 3PVXA 1FK9A 3IWLA 4TY9A 3N6MA 2OKQA 2GO9A 3G8SA 1U1LA 4NYZA 4QJVA 4DEZA 3SXLA 2LU2A 1QE1B 4IH7A 4R0JA 2VQEF 1JXLA 5IM0B 3N28A 3CVKA 4ZCMA 3MHYA 2JDJA 2MKIA 1XTZA 5AE2A 3DLGA 4MKBA 3QJPA 3BO3A 4I2PB 1TKZB 1UL3A 3OPKA 3UW1A 1PILA 2BW2A 4X66F 4G1QA 4KKOA 1NNDA 2PDAA 3P3DA 5ADZA 1V9OA 2FB0A 5KFSA 4X64F 3HXMA 4M95A 1T05A 3WC0A 2K7JA 2KXFA 3HFKA 3SFUA 5JVGQ 3CJ5A 4O3OA 3NMRA 2PI4A 2VBXA 3CCLS 4NCAA 2NUUG 3LP1B 3M9NB 1DRZA 1VIOA 4MK7A 4YR0A 2MSTA 3OL6A 2R2TA 4IQMA 2RF2A 1C1CA 2NS1B 4C8YA 4NXNF 2FD2A 5EWEA 5J2QB 1FKAF 4R8UA 2R7QA 3FFIB 3NAIA 7FD1A 2ABYA 4UY8T 1G2EA 2DTJA 3JAMY 3CT9A 3POTB 4URSA 4DG1A 2CRLA 2GHPA 2LQ9A 2AJ4A 4DV1F 1NJIT 2VA3A 3ZZZA 2ZH3A 3QGPA 2Q6CA 3CJKA 3W7BA 1CVJA 3BQ1A 2IVMA 4Q7AA 4DJBA 1RQ0A 2Y1JA 2FDNA 1HQUA 3RU0A 2IAJB 4XDCA 3NNAA 2CPIA 3TNVA 4GKJF 4OZ1A 3DYAA 2ZC4A 3SDEB 1SKSA 4OL8A 2ZH4A 1A9NB 2MGZA 1ZAXA 4H4MA 3AA8A 4ZPTR 4KT0C 3IN5A 4ED7A 1KTQA 4OI6A 2J9DA 1RTDA 1KONA 2FJXA 2RIJA 5IQ6A 2GQQA 2JLGA 4DSFA 2V8VA 2GX8A 4LSLB 4MJKA 4FF3A 1HBUB 3DXSX 1WEZA 4XK8C 3OR1A 4P6QA 4C0BA 2CPXA 1JLEB 1ZTWA 1N8RT 2OPRA 1TZ0A 2IC3A 2BE2B 3K58A 3GG0A 4EBCA 1X5SA 3E8OA 5L1JA 2BRLA 2KJWA 2BABA 3JB9k 5EX3A 5EDWA 2K3IA 3M4XA 3C6UA 5D4OA 4WU2A 1KOOA 3ISND 4WKYA 4EYIB 3H4DA 2EG1A 4OX7A 4ELUA 3CDBA 2AJ0A 4I2QA 4P7TA 5HROB 5CYMB 1FKPA 3IS9B 2PA3A 1S9GA 1L3UA 2PN6A 3NLCA 4DG1B 1NJXA 1WTBA 4HI1A 3JTOA 2HHSA 1ZYQA 2ACYA 2ZNZA 2J7UA 2VG6B 4G3IA 1RK8A 1SV5A 2ATLA 5D3GB 3G9CA 1SKWA 2CPFA 4CO0A 3MURP 2VG7B 3S7RA 5B08A 4NCGA 1N4LA 3PKMA 2YKPA 2E9RX 1UETA 3LWLA 3SSSA 1TKXA 4H4MB 1S1XA 3AQPA 4ECTA 4NRTA 4I6AA 2GC8A 5BYQA 2CJ9A 3JSMB 1X4DA 2JZ5A 3SI8A 3MTKA 3QWPA 5G4DA 4D3HA 1FEHA 3QMQA 2MYFA 2C2EA 1FNXH 5A8WA 2HNYB 1HL6A 1S6PB 4PPZA 1C4CA 2ZM6F 1HI8A 1X4GA 2HNDB 2DH9A 3MM9B 3UR0A 1FRKA 2B5JB 4KBIA 1X4EA 3ENWA 3B82A 5DQIA 4H54A 2RS8A 2C3UA 2ZUGA 1FRHA 3BB5A 1X4CA 3IR5B 4OLOA 2XGQA 5LSOA 3HPOA 5EWGA 3C6UB 2I38A 4MTPA 4E0DA 3J7Z5 1P1TA 2XCAA 4DSIA 4OJ1A 4WE1B 5LXYA 4ECZA 4NLWA 2LA6A 4Q44A 4KFBA 4DFMA 1KVIA 1Q82T 1FESA 4IQXA 4HT5A 5T7LA 1VFJA 1R8HA 4EBDA 3BSOA 1JLGB 2DK2A 2CQ0A 2W9BB 2BANB 2W4CA 4GC6A 3HLUA 1S0OA 1P8GA 1UA1A 3I5AA 1GTEA 4TLRA 1YJVA 3OTOF 4KJIA 3W2WA 2UVWA 3KK2B 1RT6B 4MFBB 3RW7A 3IO1A 5F9NA 2XG8A 3CCTA 1H2UX 3KLFB 3BF4A 1N5YB 2M7SA 3VQTA 2KT3A 2NPFA 3SCJE 4IO9Q 2BXJA 4ZPAA 1MU2B 5KFMA 3GMGA 3MM7B 1RJJA 1U1MA 1VBZA 3DXBA 2JFDA 3CIZA 4QQBA 3TRGA 1QAXA 4IDKA 3TAPA 2XC9A 3CCRS 1S77D 4MKYA 3N6LA 4A8WA 2HNDA 3V6DA 3AHPA 3MMBA 4RW8B 2X3GA 2DGXA 1TKTA 1S0MA 3VAMA 3TAMA 2FJAB 4X4SA 5CHCB 3CUNA 3M9OB 3PDNA 1Y3JA 1VQOS 3JSRA 3E01A 5D8HB 3D5MA 4UUWA 4H4KC 2APOA 1X5OA 1O5JA 3I4HX 2CPEA 4RUCA 3N4WA 5D77A 1N33F 4BBYA 4CNZA 1VJWA 1X4AA 1KVJA 1FTRA 1QUVA 3NNCA 2XS5A 2PT0A 2VQFF 3DDKA 4ES3A 2XI2A 3DRPA 5A8KB 1YJWS 4QW8A 1FDNA 1YI2S 3U02A 1M5VC 2IBKA 4DQPA 4WZMA 3OXGA 1GX5A 2YQ3A 2HMIA 5B0GA 2WONA 1WELA 3J7ZT 4F4YA 2V5HG 3IFEA 1MW7A 2V9WA 1HPZA 2WHOA 2JH3A 4QW9A 1FRJA 1KD1T 2QIFA 2KM8B 2J6TA 2XMMA 2HHXA 1U6BA 2DGWA 2IM2A 3MECA 2PI5A 3FEXB 1J5OA 1YRUA 4HKQA 2HHWA 5L38A 2DIVA 1M5PC 4TN2A 5DQGA 2UV8A 2NQPA 2DGOA 3FGVA 2EBGA 3ZZRA 1KTVA 1ZTTA 2FY1A 2B5JA 1BQMA 1RT5B 3MPWA 2B7BB 3CD6S 4DF4A 4ZPVR 1E6VB 3EZ5A 4TYAA 2IBOA 3FEZA 3MEEA 2D3UA 4FYDA 2WBMA 2U1AA 3M2RA 3EGNA 1L3VA 1KR4A 3SV3A 1NH7A 1K73T 4C8LA 4F3OA 3WC2A 2IRUA 4QIFA 1OWXA 2BUNA 4OZ0A 3HMJG 4DV0F 3T1AA 2CPJA 1VQKS 5F8IA 4NLTA 3MD3A 2RQKA 3MEDA 5DS7A 5B09A 4QPTA 5CD4H 3G96A 2XSJB 3M8QA 4Y2AA 4J9SA 2VG5B 2ROPA 3KJVB 3ZZOA 4Q5VA 1O51A 5H1SV 4JYAF 1ZM4A 5KG1A 3CCUS 4LF6F 4WU3A 1LK7A 4LFCF 3KG0A 2L9DA 1NEEA 2I2YA 1VGYA 2F1FA 1SJQA 2MMYA 3MMCA 4QR1A 2RILA 3ISNC 4ALZA 5KFNA 3TO8A 1UJ5A 1RTJB 3BGLA 1NK0A 4DX8H 5IM0A 3E51A 1K9MT 3HDSA 2UUBF 1AROP 1C0TB 1X5PA 1U26A 1X0PA 2PGCA 1DARA 4J9OA 1D8YA 4MIAA 2V8HA 2ASYA 4IDKB 1C1BB 2KN4A 3MD1A 4J9MA 4FXWA 4WFXA 3KLIA 3HF5A 3DRSB 4JV0A 3O6QA 4CH0S 2HRUA 1G3OA 2U2FA 2D1CA 5IQQA 2Q66A 2JEJA 5J2NA 4LF8F 2LEBA 2HYIB 3OXLA 4F4XA 3NG8A 4KGMA 3L7OA 3LANA 5K8NA 3PKYA 4K5SA 2D3OR 1R31A 2P9GA 2YWKA 1JLAA 2VFUA 2B3TB 3SEOA 4NLGA 3D1OA 2V8GA 3LP2A 2MQLA 4X4TA 2DR9A 3FZ2A 2GIQA 2IM1A 4UQGA 3I5BA 4N56A 2R8GA 4ED5A 2DITA 4A8YA 5BJRA 1JLQA 4UY85 4Y65A 5LXRA 3KLEB 1DTTA 2E5HA 4C11A 5KFQA 2BM1A 2DCLA 3KJVA 2ERRA 1TL3A 2LXIA 2MQNA 3KMSA 1VQSA 3OL9A 2G9OA 2FHKA 2WSCC 3DLKA 4WFZA 4ZK7M 3T5JA 1VQ4S 4C8OA 4K2XA 1MSWD 3ISZA 2XY7A 1YWXA 5F0WA 3R1LA 4YEAA 3OL7A 4B17A 5F8MA 3GIJA 2AJFE 1I1GA 3PW2A 4ZDNA 2RD5C 2CIMA 3KHHA 2F7VA 4O0IA 4TU9A 1U45A 2FLLA 4DQIA 4NLYA 2F4VF 2DGSA 3ONQA 1Q53A 3H4BA 5H9EJ 2MKCA 1DFDA 2E1CA 4DR5F 2E29A 2YNIA 1S72S 3QWUA 1DQ8A 2B4UA 3OSNA 2ZJQQ 5KT6A 3L7PA 4OX9F 1R7IA 3LAMA 3QLHA 3O8WA 1WHYA 2HFOA 1Q1KA 3N79A 4OI1A 4N47A 3ZZUA 1U1PA 2EWHA 3QO9B 3MEGA 1TL4A 5M2UA 1H3DA 2V4QA 3AAWB 2AU0A 2QFJA 5U47A 3MEEB 3BDPA 5I42A 4WE1A 2JEIA 2OPRB 4TYBA 3SSQA 3KFWX 4F4ZA 2I8EA 4ZVFA 1YSJA 2VBYA 2M70A 5CYMA 4RX6A 4QBUA 3QZ8A 3IR7B 3CJ0A 2HS3A 4ZPBA 3AJ1A 1N6QA 2B7CB 1KLNA 3U1MA 1VLYA 1UVNA 5DGBA 1H6KX 1TVRB 1FD8A 4EUVA 1TL3B 3VTIA 2GO8A 3FSXA 4QIGA 2Y1RI 5SUHA 1S9GB 2E7WA 2OTJS 4ZPWR 3CJ4A 4LT6A 3DN9A 4GC7A 2NPIA 2ZBIA 3UPFA 3CCQS 3MOJB 2PEHA 3BS9A 4USJC 4DV4F 3K59A 3K5MA 4DFKA 3UCZP 4CZCA 1QSSA 3AY0A 2KO1A 2KYZA 4HH1A 3VALA 3PZPA 3ULHA 2DVIA 3GYNA 2OIHA 2D74B 4B3OA 1VIXA 3IRXA 3K7RA 4JI7F 3D0GE 1UEUA 2YVSA 1TKTB 1L3KA 2MZRA 2ZZNA 2YNFB 2D7SA 2KB2A 5L1KA 1LQ9A 1TV6B 3AQOA 1IJEB 3KK3B 4I7FB 1YIJS 3HVTA 3RRGA 2CVIA 2MKSA 2VFSA 1RKIA 4IH6A 1DTQB 2BV3A 2AX0A 3TUZC 2KT5A 4ES2A 4K4XA 3GV7B 2EK6A 4LFAF 2VASA 5KAKA 1V3RA 3OUYA 1ZOTA 4ICLA 3EZUA 4BWMA 1HYSA 2CFXA 1M90T 2X1GA 3BQ2A 3DI6B 5FJ4A 3DU5A 3VZHA 1RYSA 2BZ2A 3VAKA 2XHWA 3QIPA 3U1NA 3RB3A 3QJJA 2MB0B 2Z4PA 2FVSA 3NCRA 2ZHAA 2LQJA 2QA4S 5ITHA 3RB4A 3TR5A 3M8PB 3CMAS 3TOQA 2PMHA 4C11B 2L9NA 2XLIA 4BCAA 4BC9A 2E5IA 4HT7A 3TA2A 2XMKA 1LWCB 2JVRA 3NS5A 5DETA 2QE5A 1T03A 2RB7A 4WK1A 1B7FA 1J5OB 2KFYA 1JJ4A 3OTBA 4F4WA 2NLWA 3MEKA 1T94A 5E3QA 5J1PA 2CZVC 1QE1A 1N0UA 4F3QA 2J9CA 2KDOA 3SZ2A 3HHDA 1N32F 4RW8A 4RW9B 3X1LB 2OPSA 1DLOB 3M1VA 3QLHB 4Y2IA 4F3MA 4J9PA 4Y2KA 4ELVA 3V5RA 1VQ5S 4WIIA 2LLZA 3H59A 3NP5A 3MZIA 4R0EA 4XIUA 2UUAF 2J6SA 1FHTA 4O3SA 5KFRA 2G1DA 5E2QA 2BOPA 2MHEA 2OMOA 2HHQA 3NMAA 4FXVA 1M1KT 4M94A 2PSZA 3MUMP 3DOLA 4RW6B 3OVSA 2E5LF 3SMZA 4QWAA 1RT7A 2EW9A 2ZC3A 1HHSA 5D4LA 3DMJB 4JI3F 1D1UA 4U7UK 3THVA 3RR7A 2XLJA 2AP6A 3D0IE 1FJCA 3GSDA 3MPYA 1B64A 1RI7A 2DNKA 5L8RC 3V81B 3W2VA 2HNZB 4LQ9A 3OJSA 1YJUA 3HHLC 4CTAA 5GAEI 3PY8A 2JFKA 2MKKA 2MSSA 3VAIA 1FXRA 4H4OB 3LALA 1S48A 1FDAA 2BBEA 1Q79A 1LOUA 4M5DA 5KG3A 3GFXA 4BWJA 1LW2A 4PQAA 2RJZA 3UD4P 4F8RA 4C0OC 3KLVA 4EBEA 2RDIA 3IRXB 2WBRA 4CI0B 1RWUA 3GIKA 1CC7A 5KFFA 2FJDB 2Q3PA 4O4RA 3R5DA 5E3PA 4NWBA 5J2NB 2XS2A 3CTRA 3KHLA 1EETA