2GV1A

Nmr solution structure of the acylphosphatase from eschaerichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the acylphosphatase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
total genus 15
structure length 92
sequence length 92
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gv1A00
1AW0A 2LQBA 3VTIA 1JWWA 2N4CA 1TL4A 2BUNA 1N5SA 2Q3PA 3K7RA 5A6PA 5T7LA 2GA7A 5A6WA 1KQKA 4HH1A 1S6UA 1V3ZA 3HHLB 5F0WA 2IYIA 1TL5A 2XMKA 4YDXA 3TRGA 2JDJA 2FTRA 2N7YA 4A47A 2G9OA 3HHLC 3TNVA 1WD6A 3GZ7A 4A48A 3I9ZA 4DN9A 2GO8A 2K2PA 1Y9OA 2AJ0A 1IUJA 2W4DA 1U7LA 2AW0A 2EW9A 3HFKA 5B0FA 3IWXA 4A46A 5B08A 5KAKA 3BGUA 2CRLA 1FE4A 3QMQA 3KNGA 2XMTA 4OJHA 2BYCA 1CC8A 1AFIA 1YJRA 2W4CA 3BR8A 1FD8A 4Y2KA 1Q4RA 2ROEA 3T9NA 1S6OA 3QGPA 1OQ6A 4HI1A 4NPOA 1URRA 4ZOSA 3CJKA 1KVIA 2ZDOA 2AJ1A 3BM7A 1MWYA 1KVJA 4FNIA 1SI9A 4Y2IA 3CJKB 1N5VA 1X0PA 1Y3JA 2N4DA 1JK9B 3FGVA 2BJEA 2XMWA 2FB0A 3FRYA 5B0BA 1TUVA 2ROGA 2LDIA 3MCSA 1R6YA 1CC7A 1SB6A 2GGPA 3KG1A 3UDCA 1GXUA 1W2IA 4A4JA 4DPOA 1YJVA 1RJJA 2HLTA 2RMLA 4QOTA 1MWZA 2KYZA 4DL0C 1XBWA 1Q53A 2GGPB 2BBEA 1FVQA 1N5TA 1X8DA 5K9FA 2OKQA 2IYGA 3HX9A 2OFHX 4HH0A 5B09A 4Q2MA 3BB5A 1FEEA 2RU9A 3IWLA 1OQ3A 2OMOA 3DCAA 5B0AA 2KT2A 2QLWA 4ZA1A 1YG0A 3BDEA 2HFOA 1N5QA 2OP5A 3LO3A 2VH7A 4F67A 2GV1A 3BN7A 2QIFA 3WDOA 2OD4A 1Y0HA 3FMBA 3KG0A 2FIUA 2ACYA 2W4PA 2GFFA 2K1RB 1X7VA 1Q8LA 3HDSA 2ROPA 1Y3KA 1Q8BA 2ZDPA 1K0VA 2LXFA 5B0DA 3HF5A 1YJTA 2L3MA 2BJDA 5T7LB 4OJ3A 1SQEA 2HFNA 2K1RA 2AP6A 1OSDA 2KT3A 2QYCA 2RSQA 3LGNA 2KKHA 5F0UA 2FHMA 2K7KA 1QUPA 2IFXA 2PGCA 1FVSA 4OJ1A 5IXUA 3DXSX 3F44A 3MZIA 2OD6A 4FNHA 2GCFA 1FE0A 2HLUA 1VQYA 1P6TA 4Q2LA 1GXTA 1TZ0A 2LQ9A 1VQSA 2QLXA 2XMJA 1AFJA 1OPZA 1YRXA 1YJUA 2XMUA 1ULRA 3E8OA 2PD1A 3HHLD 4HL9A 1CPZA 5B0EA 2HIQA 3KKFA 2K7JA 5B0GA 1P8GA 4OJGA 4YEAA 3TOQA 2XMVA 4HI2A 2ASYA 4NL5A 3LGMA 4EFAC 5B0CA 4U9RA 1FESA 2HQIA 2XMMA 2OAUA 4OIXA 1TR0A 4Y2MA 1LQ9A 2RILA 3BF4A 1APSA 2OFGX 3HHLA 2VV5A
chains in the Genus database with same CATH superfamily
3POTA 2DIVA 2H48B 2NXNA 5M2PA 3D6MB 3K7RA 2COLA 4L3KA 4C7QA 2MQOA 1TKDA 1RWWB 3QT8A 5ETVA 2B4UA 3IBWA 3O8WA 4ENOA 4NA3A 4C8OA 3ENVA 1ZETA 2UU9F 2VFVA 1AT1B 5KG4A 1Y4ZB 2B7BB 1LFPA 3NOCA 2HURA 3OV7A 2HFZA 1GNKA 1K1SA 1X5OA 3PX6A 2DO4A 4WK1A 3MAQA 3OXLA 1WEXA 2ERRA 4IQXA 3M4XA 4B9LA 4MKVA 1U49A 2KJVA 3IFEA 1TL7A 4EBCA 4ZN3A 3FNNA 2CQCA 1T0TV 1RT3B 3NGTA 4FS2A 4WIQA 1RK8A 1UVIA 1P1LA 4JV0A 1BQXA 4I7FA 5M2RA 1S4FA 4ITSA 1U2RA 3AXMA 5J2PB 1RUSA 3GV5B 1Y10A 3D6HB 3R5BA 2ATLA 3V6DA 2YKPA 4IH7A 4PYDA 4IQMA 2JEGA 1KP6A 3R97A 1HBMB 1JLBB 1MN7A 4TYBA 2RUGA 5F8HA 2GC8A 2MMYA 3DRYA 3ZZUA 5SZTA 2PA8D 1EJ7L 2R2RA 2QSWA 4DR1F 1VBXA 2ZZNA 1KSPA 4OYZA 3K17A 4X4PA 2DRBA 2ZVIA 3GR0A 4CLWA 3MAAA 2NUHA 3SEOA 2M7SA 2CQ3A 5L8RC 3M1VA 3ZZPA 2XMWA 2PIIA 3VAMA 4I6AA 3L3CA 1TUVA 1JLFB 3VAGA 2EVZA 4A4JA 2AGQA 1UZDA 2GJFA 3F41A 4DPOA 2CA9A 3CVKA 3GSIA 2HLTA 4KH1B 1WC6A 3O3LA 3O5TB 4QOTA 1LOUA 1FX4A 5HQLA 3V81B 1NSAA 1UWBB 2RRBA 4WKRA 4IO1A 4O3OA 2FJVA 1S59A 1HNZJ 2AWZA 1H38A 1NKBA 3SSRA 1SKRA 2C2NA 2YPYA 5KFAA 4YDDB 1U0HB 4RU2A 4PXBA 3GJSB 4LFAF 1ACMB 2NYIA 4LBIA 4ZDNA 1UFWA 4XPCA 2HQDA 3C6TB 3RB0A 2E5LJ 2YWWA 2ZD1A 3A8KA 2L9NA 2E5LF 4NOHA 2SXLA 3TP2A 4M94A 1ZBTA 2AIRB 3LO3A 3HP6A 2ZJPQ 3T19A 4KHPJ 1TTHB 2XG8A 3PYGA 2GQ2A 4H4MB 3VQSA 3ZTSA 1UVJA 1M1HA 1OWXA 3MM5B 1RAEB 3CJQA 5C2GA 1EHWA 3JXOA 4LVOP 4B08A 2CJKA 5IS2A 4O3QA 4YB1P 3HDSA 1G7CB 1H7WA 2ROPA 1Q8BA 2XSJB 2X1BA 3GYGA 4OV6A 4YMEA 1QAXA 3KK1A 4LQ3A 1JXEA 4F4YA 1BC6A 1L3VA 1H7XA 1YJTA 4USHA 4X62J 4FDFA 4OJ3A 1S9GB 3A4TA 2IM3A 1OSDA 2YNHA 3DNCA 4P9SA 4BWJA 4CYUA 2KKHA 5H9FJ 5IZHA 4C11B 3RBEA 2WSEC 1U1QA 1IKXA 3QIPB 2JJ4D 4CLKA 3S1TA 1VQ6S 2Z58B 3M9MB 3MFHA 1JJ4A 1XR5A 4ED1A 1WC3A 4WPAA 4QWEA 3V6HA 2XI3A 2AQ4A 4Q2LA 4NZ7A 4ZPAA 2C2ZB 2BR0A 1XNQJ 3I4PA 4K4VA 1OPZA 1XTZA 2HGLA 3GFYA 4DPTA 4DFJA 2QYGA 5D4PA 3NWGA 4U7CA 2Q6CA 2GJIA 3IM9A 4TLRA 3JAMU 4U67Q 2PI4A 2R7TA 2XMVA 1KRPA 5E0OA 2F7VA 3TZWA 3SQGB 3EYZA 1JKHB 3LGMA 4RUCA 1ZM3A 4U9RA 2BANA 5T41A 4MK8A 1PJ7A 2OO4A 1C2PA 2W2QP 1RTDB 2IIHA 3PXGa 3SV3A 2RS8A 4ECXA 3HHLA 1J5EF 4KKOA 4ECQA 1HBUA 1UW9A 2BQ3A 3TA2A 2GW8A 1VBZA 1RT7A 2YX4A 4UTGA 1YGYA 2BVZA 3Q2SC 4OYIA 4NLVA 2I2YA 3M05A 1X4EA 3CDAA 4NXMJ 1A7GE 2V4JB 3DRRB 2CQIA 1YBAA 2FDNA 3ZTPA 1FNXH 1NB7A 4B9NA 1FA0A 3MM7B 3PDNA 3D28A 4IH5A 4A48A 4USMA 2HS0A 4NLDA 3H98A 1SL0A 1FCAA 3BH7B 2AJQA 3KK3B 1R31A 1YDLA 4OZ5A 4LF4F 2HNDA 2MDAA 3GONA 1REVB 1UVKA 3TZXA 4C48A 4GKJJ 3MCNA 4QCLA 2VG7A 1AYEA 4DR2F 2I8EA 2R8JA 3X3UA 1FE4A 4YFUA 4P74A 1U2CA 2DY1A 1S1TB 4RL1A 2E9TA 4RNOA 1LW0A 1RTJA 4DX7A 3DOKB 2BJ3A 1EIYB 2DR8A 1T8EA 2Z2MA 4BC7A 5KFJA 4N76A 5KFWA 2QMUB 3M8SA 3PW5A 2IY5B 1S72S 3HHDA 1TK0A 2H54B 3UDLA 5KFPA 5ETKA 2XMAA 2DYAA 4EEYA 1JLEB 4RO0A 1UEUA 1RP5A 1IBMF 3GP9A 4DHVA 1IR1A 1BGXT 3N9UC 2HW3A 1GX5A 3BKTA 1H3DA 2DH8A 5DG9A 4CH0S 2AGPA 1FRIA 1C4CA 3UDCA 2IAJA 4DL3A 1GTEA 1D9AA 1U0SA 2QZ8A 3I5CA 1TL7B 1HQUB 1HFEL 2CXEA 1UVLA 4ILMA 2IJNA 3HPOA 2M9KA 3OFGA 3LANA 3SMZA 4D3GA 1KC8T 2YKMB 2HNZA 4I7FB 4QPXA 4JV5F 1GX6A 3JSMB 1HW9A 2EG1A 4HHHA 4P6QA 2IYGA 2GQCA 2L9WA 2IVMA 2LA6A 2OPRB 2VBYA 4TVAB 1X9SA 4LF8J 2FLOA 4PUOB 3MTJA 3H8YA 3IBFB 4KIAA 4RBVA 3CCJS 4DR4F 4YR3A 3WQPA 5CZXA 1MMLA 1VK3A 4QIVA 3UNGC 3ZZYA 1YJ7A 2B56A 3BZQA 2X7IA 4ZPTR 5HK4A 4F04B 4PRFA 2QIFA 3G87A 4YB5A 1W26A 4F0MA 4ANCA 2EG2A 4ALZA 4RNMA 5CHCB 2AX1A 2QEXS 1U2FA 4DV1J 2PA3A 3R6GB 3CWJA 4DQPA 5DG7A 4B9TA 2DHHA 5KFLA 1W2BR 3MAAB 3T6JA 1IJFB 1LKZA 2LXFA 4ZVRB 4ZJOA 2AZ3A 3LF0A 5E3CA 2XGQA 1HHQA 5T7LB 5JJBA 3G4SS 1J2VA 2G1HA 4X4TA 2KT3A 1SIWB 3OTBA 2JLEA 2UUBJ 4PEOA 1FRLA 1XNQF 2RT3A 3NMRA 3BBCA 4KJIA 1T9XA 3GTYX 1YZ7A 2OD6A 4JI1J 4FNHA 4ZCLA 4RPFA 1VQYA 1VQ4S 5D0RA 3I32A 2HPUA 2C1EB 4QJVA 1RABB 1TK8A 1X9WA 2VOOA 1NJWA 1RT1B 3AODA 3OJUA 4YS2A 3T5HA 3M30A 5K14B 3HVRA 3R2DJ 1HARA 1R3NA 2B4VA 1F60B 2UU9J 2WOMA 2YKQA 1FRJA 1Y7PA 4NI2B 3AD7C 1UJ5A 2LMIA 4RBUA 3A1YG 4F8RA 3T9ZA 2R8IA 1RTIA 3UQSA 5E3AA 1GK8A 5BR8J 3ZTRA 3BF4A 4XK8C 1BHNA 5LXYA 3AA9A 1S9FA 2VV5A 1Q78A 4HEA9 1U1RA 2I6WA 3VF0B 1WC0A 4C0OC 1VQOS 5A6PA 2ZFHA 3KXDA 2JNJA 3TR5A 2YNHB 2XY7A 2E1PA 2AU0A 4ZP9A 3VGTA 4OYPA 3PO4A 4ANDA 3RW6A 1B7FA 4B9SA 2YQ3A 1Z2LA 2OPQB 1LW2B 4KH0B 1S0MA 2IYIA 3UD5A 2BQUA 4JI1F 1Q5YA 2YBVA 3IRXA 2BOPA 2WSFC 2UV8G 4I68A 2KHDA 2MTLA 3CTRA 3ISND 2WVCA 3GIJA 3M6UA 2B9EA 3MM6B 1T03A 4EZ9A 1RWVB 1VGYA 2CPZA 5CA5A 3B4DA 4QW9A 4GKJF 3KLVA 2HK3A 4QIGA 2E9RX 3BGFA 1BY9A 3ONQA 2XS7A 2BX6A 2JFDA 3EDQB 3QFWA 1N0UA 2P9CA 1ZAWA 3KLEA 4E0DA 2RRAA 1M5VC 2EXUA 3QGIA 2MKYA 4Y2CA 3R3TA 5H1SV 1RWNB 4LRCA 1PCAA 2HAIA 1CULB 2QGFB 4NYZA 4QIFA 4BDPA 4AL7A 3CCZA 4C4WA 4U7UD 1FKOA 2DR6A 1KONA 4RW7B 4JI0J 3HKWA 5LMNJ 1OO0B 3KHRA 4DCJB 3VZHA 2WB1D 5EDWA 4O23A 4Y2IA 3S01A 4BCAA 3ZZZA 5LJ5Y 4UY8T 3H5YA 5IT9U 1R8BA 4X65F 3PEHA 5HATA 3H5UA 4CCHA 3CJ8A 4JI2J 4CP5A 1TP7A 1V3SA 4NLOA 3OTOF 4O4GA 3DLEA 3EGNA 1PO6A 3I6PA 3A13A 4FYDA 3U1NA 4DL2A 2NQPA 2MZRA 3LTOA 2A6MA 1TMMA 4EK2A 4OZ2A 3CPWR 4YR0A 3SYZA 2BBEA 4IYQA 1UFKA 2RF2A 5DZ6A 4GRSA 4TY9A 3A3PB 3HX9A 3MTKA 2J5AA 2KDOA 3D4JA 2QRRA 1LWFB 4OZNA 1TKTB 3DRSB 4DEZA 5CABA 1U4BA 4IRDA 1BQNA 3P45B 2BRLA 2L9DA 4ZA1A 2YKOA 3KK3A 2O66A 3GU0A 4P72A 3OL9A 4PWDB 5B7WA 5EUHA 1ZS6A 3G8TA 2IPOB 1PILA 2P5VA 4ZPDA 2BE9B 3VAIA 2QLBB 5E5NA 4ZLPA 1XMQJ 2XM3A 3BKUA 3DLBA 4FF2A 3DGPA 4P2FA 4OX9F 2BXJA 2HHHF 1X7VA 4IOBA 4BWMA 2V2ZA 3WX8A 2ZH1A 5E3PA 1ELOA 4L72B 4OI6A 5LSLA 4R8UA 1X9MA 2NLWA 1NJIT 4DG1B 2V34A 4I64A 3FZBA 1SJ3P 5LXRA 4LF4J 2XB2D 3AOAA 5KFYA 3K5NA 2MKCA 4RU9A 4ELUA 1RACB 2QYCA 2RNEA 4Y6IA 4USWA 4A8WA 1RHRB 4CM2A 3MWBA 3N4WA 2XO6A 4K4WA 4WZQA 4P71A 5E7OB 3EICA 4KFBA 2NSCA 4C0HA 3DXSX 5KT3A 3G8SA 3F44A 3GG0A 4DUYF 1TUWA 5DJBA 1ZH5A 1NUEA 3NL0A 1OYDA 4DPUA 2J6UA 2J76E 4PUOA 1NK8A 1IR2A 1R0AB 2QJ3A 1F6TA 4J9PA 1EQMA 1XR6A 3D66A 4ID5B 5B0EA 2J8SA 1REGX 3DHXA 3RB6A 5CYMA 1VJQA 1SV5B 5LM7E 3PYFA 4IDKA 1S1UA 2VG5A 4AXIA 3W8PA 1OMSA 4ZVTB 2HHWA 1R0CB 4EUVA 4I2QA 3W5ZA 5DLFA 2EFPA 1N48A 1EETA 3R1LA 4DSJA 2A1BA 3TWZA 3B6BA 4CO5A 1HD0A 3AD9C 3M32B 3VAFA 3VAJA 3QRQA 4G3IA 1F9HA 2BUNA 2CKWA 3H20A 3HVWA 3DDKA 3KLIA 1KTQA 3MXHP 4HH1A 3BO3A 3ILIA 1Y5NB 3CSKA 1O51A 3BYRA 1GFWB 2I0XA 1RADB 2B8PA 5FDLB 1RT5B 2L48A 2U1AA 2H51B 4A47A 1CEZA 2CVIA 2JEFA 3CJRA 3TNVA 2FGOA 1MN9A 1S0OA 2VB6A 3RR7A 1RT2B 2DNQA 4RW9B 2W9BB 3JQKA 2AD9A 1TKXA 5IC6B 5KG6A 3W3SA 1XR7A 4KT0C 2HVEA 1C0TB 5F41A 2R7WA 3NRBA 2J9CA 1FTCA 4ZJLA 1GT8A 3UNYA 4TN2A 3M2VA 5DDRC 4PG6A 1G4CA 4ED2A 2R7VA 2MQ8A 2I5JA 1JLCB 2F8HA 2V8VA 4Q45A 1VS3A 3DOMB 4I69A 3DRPA 3FQKA 2POKA 5HMYA 2J0QD 3QAUA 1PJ6A 1OIAA 4ZVGA 4CH7A 2UVRA 3TX8A 1HQ2A 2AJ1A 2ZH7A 3SCJE 5LOQA 2CNOB 3DMJA 4ED6A 2FJWA 1GH8A 1HHSA 5GAEU 4J9MA 2F63A 2R3VA 3QQCD 2OHDA 3S8SA 2W9CA 4DV5F 3DLHA 1RU1A 1N5VA 2DRAA 1JK9B 4QW8A 3TJAA 4FF3A 1T94A 3CDUA 5B0BA 2OLWA 2FJDB 2FJBB 2ROGA 5A0YA 2D7SA 3MURP 3CXCR 1PJ5A 5A8RA 4QPTA 1WTBA 2DHSA 2F8MA 1SKUB 4CLFA 3TARA 1NHKL 2UXDJ 3MF5A 4PPZA 5IQQA 3QYYA 1S97A 2ZWPA 3Q8YA 3CCTA 4V1Ak 3RUBL 5EWEA 3GQCA 2FVSA 4FF1A 1XBWA 1Q7LB 5AE2A 4KTQA 5KG7A 2IA0A 2VC1A 4RWWA 3I5AA 1NPRA 2YNIA 2B8QA 3BSCA 4KC5A 4M5HA 1Y11A 1WHWA 2EWHA 5J2QA 2D41A 3K0JA 4DL4A 2BW7A 1FEEA 2Z8QA 4G65A 3DCAA 5D3GA 2PFDA 4WFBQ 3W5YA 5F8NA 1HQEA 2OP5A 1VLOA 1X5TA 1F5AA 1GEHA 1S99A 4QR2A 5AXKA 2ALZA 4DV0F 4DV7F 5HP1A 2DHGA 2OPSA 3QGGA 4RUAA 4FZVA 4A8OA 2ZM6J 2UXDF 2FIUA 2BM0A 2AEFA 1FFSB 5LSOA 2ZH4A 3K8VA 1KS2A 2HEKA 2CZ9A 2IMOA 1VHIA 3DDIA 3FC9A 1SJRA 3OR2B 2G0CA 4FXVA 5ETRA 3VR1A 2CDRB 1WJ9A 2UUAJ 1PYTA 1YBUA 2ZDPA 3ADAC 5IV3A 1B3TA 2VBWA 2GMHA 4ZN1A 2LEAA 4JI7F 1IBKF 2HBYB 1BWVA 4F4ZA 3DLEB 1TVRA 2DY9A 3DOLA 2Z2LA 3HZGA 1NDCA 3LOUA 4UT4A 3OFFA 2DNNA 1J5EJ 3D0HE 3L95X 4M5JA 4KPYA 4GMKA 4N8OA 3MMAA 4N8NA 3B82A 3FSYA 2UP1A 4B3RJ 3KNAA 3R7BB 4LRAA 3BGRA 2G13A 4QQBA 2VIHA 5KFBA 3OTEA 1JLQB 4CT9A 1SL1A 4I0WA 1IKWA 1HPZB 5DQIA 2OH2A 1S1XB 4IKAA 3KKFA 3JAMY 4AQYJ 3TOQA 5HQ8A 4HTIA 4TLQA 2KRBA 2IM0A 2JLFA 1ZZNA 3PFOA 1UEKA 2HQIA 1GXLA 4OX7A 3OTOJ 1FDDA 1PBAA 2W2PP 1YJ9S 3MPVA 3EDRB 3MR5A 1N54B 3HULA 2PN6A 1H2VZ 5F3ZA 2E5JA 1FFWB 1JLGA 2EK6A 1N5SA 1RHJB 2ZVSA 1I1GA 1YRUA 3UR0A 2LEBA 4IRKA 2KG1A 1WHYA 3EZUA 2V6AA 4OMFG 3Q8SB 4DFKA 1HBOB 1OS5A 3NCQA 2VPZB 1IM4A 2N7YA 4LF2A 3W61A 3N6NA 4WCEQ 1JJHA 3BREA 5DQHA 2WVEA 1MMDA 2XTJP 5F8MA 1NK7A 3MMCA 1Q95G 2JVOA 4WYLA 1VQ8S 4USUA 1UPPA 2J7WA 2WONA 3LUYA 4I6YA 5GVQA 1U7LA 4X64F 4PG5A 4X65J 4XPEA 4B3MF 1FRXA 1LK5A 1WACA 2RE1A 4Z7YA 4E2FB 1S1UB 2VG5B 3AB4B 3AD8C 3KLGB 3L7UA 1NAQA 5ETLA 2BYCA 3KUEA 3OSNA 1ZTTA 4X84A 4ZVPB 2ZJRQ 1D9DA 3PW0A 2LYVA 4Y2KA 3GFHA 3RAMA 4DR6F 3AQOA 4C98A 2NXCA 1FTRA 2DH7A 3RBDA 2FY8A 4ATNA 2ZNZA 4H4OA 4DR2J 1DFDA 3HSGA 4F7VA 2XLKA 3W2WA 2DGSA 3D68A 1HMVB 2C3PA 1BE4A 4GO5X 1HBNA 4MIWA 3TEGA 2M8DB 2BJEA 2IVFB 1VISA 3FRYA 1MWQA 1HA1A 2V67A 3MMBA 4X4RA 3MCSA 1NSQA 3HHNB 2Z2YB 4NX9A 2HSEB 1XMOF 5KG2A 3O2IA 2WRMA 4I1TA 5L1IA 4FBTA 4KGVB 5H9EK 4A8FA 2IHR1 2R7SA 1RT3A 2VONA 4QWCA 4OYAA 1Y5IB 5J1EA 5KFKA 3OHBA 2DBBA 4F0HA 3BR9A 4HH0A 4N5SA 4MKBA 3CD5A 4N7TA 1VIOA 1WI8A 2Z0GA 3GJQB 4LUBA 4OHYA 3RAXA 4KB7A 3GJTB 5I3PA 4QWAA 2VICA 1HWJA 1N5QA 3CW2C 3KG4A 5C25B 4OZLA 5EHHA 3JQJA 1HHTP 4MKYA 2WVFA 3A3OB 4FYWB 4ECYA 2GS8A 3H5XA 3PRBA 4M1KA 2HQ3A 3KG0A 2DGQA 5IT4A 2XLJA 4ANEA 4DV4F 1CLFA 2PMWA 4IR1A 2ZH6A 1NJZA 1VMBA 1ZAXA 3ZZOA 2W24A 3LW5C 2IMWP 4B3SJ 4V19J 4NWBA 4MFBB 1NPKA 2VF3A 3D1QA 2LU1A 2L3MA 1QE1B 4UZCA 2HAFA 1SKSA 2K1RA 3IGVA 1FK9B 4OFZA 3QSYB 4ZLLA 1NNDA 4KHRA 3KYLA 2C3UA 1GQEA 1HNIB 1O8BA 1VIXA 4F50A 1HNVB 3V4MA 2YKNB 3V4IA 2ZH9A 3ILLA 5J2QB 2C2DA 4LF6J 3KLHB 3UD4P 3E2EA 5A8KA 3MECA 4OX9J 4YB7A 3L4BC 5HLFB 1E6YB 4CT8A 3MPUB 2G2ZA 4O0IA 3I0SA 4A8YA 3HFVA 5ADZA 1LXNA 3KHHA 4JI5F 1N34F 1FDNA 4BBYA 5LMUJ 1G6BA 3SI8A 2BQRA 3PHEA 3JYTB 3TO8A 4OIXA 1FKAF 3UDEA 1ZA2B 1A0OB 4KBIA 2ZH8A 3DC2A 4ZVEA 8AT1B 4RUHA 2RHQB 3B54A 2IC3A 1DTTB 4LRFA 2K3IA 2LQBA 3N01A 4NYOA 3F56A 2VBZA 5GMEA 3UN2A 5F8JA 2YWHA 2M70A 2W1BA 3GPAA 1IBMJ 3PG9A 2FJAB 3V6KA 2V8DA 2M2BA 2UXBF 1U24A 2FQQB 3ENWA 3FCVA 3AB2B 1GMWD 3B8HA 3BQ0A 4J9NA 4GC7A 4DMZA 5F0WA 4DBQA 3BBFA 2A10A 3Q8VA 3BN4A 5LL6d 3EWGA 1B70B 3CE8A 3N6MA 3UWTA 2MGZB 3MD1A 1N4LA 4DFPA 2DXFA 3G9CA 1N6QB 2LXUA 1WORA 5L46A 1IKWB 1HLWA 1HPZA 3JS9A 4OYMA 4B3MJ 2HHHJ 3I4HX 5E2QA 1VQPS 3G6XA 5K8PA 2IJRA 2ASLA 3W60A 3H2LA 4A8XA 4B02A 3G6VA 2E5GA 4PWWA 2HFVA 3NS7B 4ECRA 3BGUA 4I67A 2E7WA 4MAKA 1NSKL 2LEPA 1YJRA 4FBUA 4WFYA 1QM9A 3DYAB 4DR1J 2ROEA 3H7HB 5KFSA 3T9NA 1WOOA 2M5YA 2K3KA 2AT1B 3KJQB 1T3OA 4TNOA 4B3RF 4I56A 5CD4A 4USVA 4ZPVR 2E5IA 5G4DA 3M8QB 5KFEA 3BBBA 2GVZA 4WXOA 1AZSA 5K5MA 3DI6A 3PIPQ 1HBOA 5K8OA 1RHMB 3CJKB 3BEGB 4X4UA 2YXLA 3SV4A 4DUZJ 2V4JA 1IKVB 3JSRA 3V81A 4Y00A 3NKYA 3WZ0A 4ERDA 1JMTA 3W1YC 4WJBA 3GCWP 1CC7A 4IFYB 3PR5B 4ED3A 3KFWX 1GXUA 1K44A 2HS4A 1U6FA 2DO0A 4GKKF 1JNRB 4F3QA 5FJ4A 3QO9B 1AA1B 3D9BA 2PMZD 2X1GA 3R5JB 1U1NA 1CJUA 3FKBA 4P7TA 3H0PA 5KFRA 3IA0A 1VRQC 2ZKTA 4NYPA 4OHZA 5J2MB 1L3TA 2Y8YA 4OYOA 2GO9A 1YHQS 2P2CB 5CZVA 2ZHBA 4O3RA 2GQQA 3BB5A 3IWLA 3M8PA 1WI6A 1OQ3A 1LW0B 1RTJB 1NEEA 3IP0A 5DLGA 4EBDA 3X1LB 1SXLA 2VG6B 4DV4J 3OD2A 3VGVA 2KM8C 4YN3B 2UUTA 3WDOA 3CCUS 4ZPWR 2VQEJ 1GMUA 1E6VA 2D3ZA 5KFOA 4PPDA 4IR9A 1IWAA 4DR7F 5JMNA 4X4QA 1WG1A 4QWDA 2ZBQA 1C4AA 2DITA 3NEKA 1QSYA 4FN5A 3H42A 3R8YA 2MXYA 1EX8A 5BXIA 2C2KB 5JVGQ 2IDEA 1F5CA 2KI2A 3BSOA 4ED8A 2DPIA 5D4OA 3VCDA 4Q8FA 1OYEA 3IS9B 3GR1A 2YPZA 5HBMA 2UUBF 3UFCX 5F9NA 2IFXA 1EB0A 4NZ6A 3OPKA 3ZNJ1 2DNYA 3TUIC 2ASJA 5HANA 2RIJA 1NKCA 4CO2A 3OFHA 2ZWOA 3LPEA 4R0JA 2HNZB 4EO6A 2G1DA 3TANA 4IG0A 3W5XA 2V0NA 4OYXA 4CTAA 2KL8A 1KNZA 3FZ2A 1V3RA 4U96A 2MKKA 1N33J 5B0GA 2BANB 3PKYA 4A8KA 1Q82T 2HVDA 1G2EA 5L38A 4PG4A 2B0GA 3VWSA 2B6AA 2ASYA 2RKIA 2CNLB 4ZITA 3TZZA 3RG6A 1HYSA 2RQKA 3KOAA 3OW2R 3JTPA 4CNYA 1VQ5S 1HBUB 2CWKA 2K06A 3T5LA 1D1UA 2D74B 2HVZA 4HVZA 1RYSA 1B0TA 4J9VA 2QA4S 1V9OA 4MFBA 4DV6J 2M88A 4BHQA 2Z4PA 4X64J 2CPEA 3DRRA 2VPYB 5T7LA 1YITS 4F4KA 1V5IB 2QL9B 4HACB 4LR9A 4USTA 1S6UA 2DGOA 4CQ1A 2KJWA 4G1PA 4H4KC 2AF6A 5AT1B 1N32J 3CC4S 3CDEA 2ADBA 4L3NA 4IG3A 4LFCF 5GADU 2AV5A 5HN0A 3KLHA 2X3GA 2RS2A 1WWHA 3MECB 3PM9A 1VQMS 1A9NB 3SQOP 4HTJA 4EO8A 1HWKA 4PWUA 1M5OC 3IG1A 4N47A 1NJYA 1WEYA 3H2VE 5KOXA 3MUMP 2XHWA 3K5LA 2MQPA 4K59A 2F4VJ 2CQPA 2VFTA 5KAKA 3GB0A 2EFQA 4C0BA 1RCXB 2R9LA 4DSKA 1RB0A 4DL6A 3MR6A 2OTLS 2H1YA 3Q8QB 1QY7A 1FD8A 2ZOFA 2OSRA 4HR2A 3K8WA 3G86A 2CQ0A 5F8GA 2FYXA 4HHUA 1BQMB 2VD3A 4JI4J 3EVOA 2V2VA 2ZC3A 4M5IA 4LFAJ 4CLUA 4AQYF 5ITHA 1KOOA 1SH2A 3DXBA 4ICLA 1TAQA 3MM8A 1NZ8A 2ZITA 3QLHA 1KTVA 1W7WA 2E66A 3A3NB 2ZBCA 4J9UE 2BV3A 2CPIA 3FGVA 3DLLQ 2DGVA 1CJKA 3SBMA 2F9DA 2GAHC 3EGVA 2LDIA 3D5MA 3MEKA 3PRDA 3SCKE 1SB6A 2KZMA 2R7UA 4PQUA 4Y65A 2VPWB 2KVQE 3UCZP 1S79A 4LREA 1JXLA 2KYZA 5KFCA 1EP4A 4Y3CA 1OJ4A 2RUSA 4JBCA 1IBKJ 3AAWB 2PE8A 2WBRA 1N5TA 3MR2A 2V9WA 2Y1LB 5K8MA 3AFGA 4R5PA 2IA6A 3H90A 4NLWA 4DU7A 3M2RA 1U48A 3T1HF 4NLYA 3FFIA 2J9EA 5HMZA 1R43A 5I3UA 1S10A 1ZM4A 1CJTB 3VGSA 3ET6B 5KG3A 3KK2B 2F9JA 3BN7A 4NRUA 4FF4A 4ETZA 4OHWA 2RD5C 1U1LA 1TKZB 4DF4A 1RT6A 4YHHF 2FD2A 2MQMA 5EWGA 3Q22A 1R8PA 2MSSA 4DQSA 5KFXA 4YUDA 3Q8UA 1MW7A 3C66A 2XGPA 3BSNA 3OJSA 2CZVC 3PJXA 4AD6A 4Q0BA 3EZOA 1H0HB 2BJDA 1FNMA 1ZM2A 3BQ1A 2RSQA 1D3WA 2PGCA 1VQNS 2AJ2A 1FJGF 1RAFB 4HT5A 1YRTA 1M5HA 2BOAA 2HNYA 1EKSA 2QG9B 5KT5A 4DUYJ 1VQKS 2MQQA 4FS1A 5J2MA 1FE0A 2HLUA 2MPUA 4KRWA 5A76A 1GXTA 1VK8A 2FZKB 5ETMA 2Z30B 4ZPBA 5GAHU 3GSDA 3OR1B 5DDOC 3GV8B 3RTVA 1TKTA 3VQTA 3SDEA 3N28A 3TUJC 4NLPA 3CUNA 4OJGA 4DZDA 3KUGA 2QFIA 4M5DA 4UUXA 2M52A 3EGWB 3U1LA 2FC8A 4Q5VA 3M9NB 1S7IA 1U25A 2MZ1A 1HL6A 4EFAC 1E6VB 1N5YA 2JZ5A 2RQMA 3PCOB 4WYWA 1TR0A 2A3JA 1YLXA 1MU2B 5HMWA 1EQ0A 4P75A 2C22A 4R8UB 3NCRA 3OUYB 2X3DA 3LWLA 1QVGR 4WE1A 4NZ0A 2KFZA 3D2WA 1TL4A 2OI2A 3ICLA 4FYXB 4IFVB 2XQCA 2HFSA 1TUGB 3M8WA 3AJ1A 2QC3A 5CAAA 1YKWA 2Z2ZA 5I4MA 1T03B 4O44A 1FJGJ 1CSJA 2HHXA 2B4OA 3NGDA 1C1BB 1FO1A 1TL5A 3TYTA 2I1RA 3DLKA 2XMKA 4LIRA 5I3QA 3RBZA 1FXLA 1JJCB 5D8HB 3W9IA 1ZM9A 1VJWA 1YVFA 1QSLA 2BDPA 1RTZA 1VC0A 2HZAA 1RZMA 2EFOA 2Y9HA 1ZYQA 1KR4A 4A8MP 3H4BA 2E9ZA 4DSEA 3HT0A 2AEMA 3CT9A 4ECZA 1U47A 1IVZA 4ECTA 3QT6A 4BLGA 3NAHA 4DSLA 3AOBA 3C6UA 3QNWB 4MH8A 3A8IA 2Y0BB 2HRUA 1WDTA 3PRVA 3QMQA 5D0GA 4DR3J 2CIMA 1PC4A 1HWLA 2JHEA 1CC8A 4XDDA 2G2OA 3I0RA 2RDDA 3I9V9 1F1BB 3GMGA 3IO1A 5AE3A 2XC9A 3TW0A 2D3OR 1O6XA 2HFUA 3B4MA 3HJVA 1FKPA 3SCIE 3VVUA 4OZJA 2N82B 1KVJA 3LAMA 4KE5A 4C6AA 4ZIVA 1RT4A 3FUYA 2HHTA 4ZVFA 1X0PA 2KRRA 3VAKA 3PZPA 1FHTA 1FRMA 1RAOA 4ES2A 3THVA 3D3BJ 4UQGA 4KV8A 3N6LA 2F40A 2DNOA 3I31A 1VC5A 1B64A 4LSLB 2B7CB 1V6HA 1MWZA 4JOUA 4RLEA 4RW9A 1B0VA 2PMHA 3JTOA 3CC2S 1QLNA 3QJPA 1UJ6A 1Q53A 2BKOA 2GGPB 3CJTA 2EBGA 5K9FA 4USKA 3FRZA 4GVBA 4OYWA 2OKQA 2KZZA 3CDWA 1QAIA 2ZZMA 3K2YA 3N79A 3DOMA 3ITHA 2QTWA 2KT5A 3DN9A 4F4XA 3BQ2A 1IKYB 2VH7A 1XN9A 1CS4B 5KFZA 5IV4A 3W63A 3NP5A 3PNIA 4C3MA 2E5HA 4DU8A 4AL6A 1K9MT 4DG1A 3C2PA 2CNNB 2CWXA 2JL9A 3GFXA 3PYDA 4CLTA 2N3OA 3CCES 3OT9A 4LF9F 3A12A 2W7AA 4ELVA 1KLMB 2R8GA 2BE2A 2W7OA 1L3KA 2D9PA 2YNFB 1CJKB 2W7PA 4B3SF 2DXEA 2KXNB 2GIRA 1MNEA 1SQGA 1R6VA 2DD8S 5A8RB 1SVDA 1XMBA 1MROB 2QT7A 3NBPA 1HI1A 1RHUB 1WF0A 3BH6B 3C19A 4NEYA 4Y28C 1NKEA 2QX0A 2CQBA 4C8NA 3TVYA 5AXNA 5A2QY 2DK2A 4AUKA 2KXHA 1GAOA 4ID5A 2O1PA 3Q83A 1RXOB 4EI2A 3CD0A 2XCPA 2DGWA 4JI4F 4QYZJ 1AFJA 4RW6B 1LWEA 3HKZD 1R27B 4Z37A 3RBXA 5D3GB 4GO7X 2DVIA 2DXDA 1R0BG 2MY8A 2VBXA 4DV0J 1HQEB 4DV7J 1UWAA 2DJWA 1IM6A 4R0EA 1CQNA 3I5BA 5ETQA 2BE7D 2HWHA 3OTDA 4RW8B 1HNXJ 3KJVB 1NK4A 2I38A 1XJWB 3HSJA 5AJ3F 3POTB 1U45A 3DLGA 4M5MA 3M32A 2XMMA 1KDNA 1NU4A 4M5GA 5KT2A 1DBDA 2C42A 3UD3P 5IWAF 2C2RA 1RCOB 2C28A 3KLIB 2DNKA 1YIJS 2PI5A 4XTTA 5IM0B 4CIOA 4ZVUB 1RAHB 4B3OB 1AW0A 3NNAA 2XZDB 3PX0A 4WTOB 1S77D 1RT5A 2EFNA 4EZ6A 3HJFA 3LP2B 4JUZA 5J2NB 1C1CB 1KD1T 2KB2A 2LQJA 4KPCA 4N56A 1NK5A 3KMQA 1TV6A 2NCKL 1EZZB 1JX4A 5AXLA 2JVRA 3D7SB 2UVWA 2E29A 3FJ2A 2XYHB 1GMVA 4WFAQ 4ZK7M 2W9BA 2FVPA 4YDXA 4A8QA 1QVFR 1N36J 1YWXA 1K1QA 3OXGA 1L5UA 4DFMA 3IAM9 3W66A 2Q1LA 5KFUA 3C16B 1LV5A 1S0VA 1JLCA 1WTFA 1QTMA 1KEKA 4CRJA 2ILZA 4F2RA 3CCLS 2FJXA 4NXNJ 3QT5A 2CRLA 4UQTA 3TJ9A 4K4UA 1T9UA 2DTJA 4YY3J 2VA3A 3E3XA 1S9EA 3EPIA 4HKQA 2DR5A 1SCJB 2KYXA 1MU2A 3DMJB 3CNQP 4TY8A 5E3RA 3RZAA 3R1HA 2ZKUA 1H6KX 4LF8F 2OPPB 3R7SB 3EVMA 3O1LA 3UVJB 1PBUA 3BPSP 1NLKL 1RHKB 1SH0A 5T14A 4WZMA 2XWXA 3IR5B 3V6DB 4K4ZA 1JQGA 1TL1B 2YWGA 3OQ2A 4ZLJA 1HBMA 1JLBA 2MKJA 2C2EA 1T11A 2MB0B 1C1BA 1DHMA 2CNKB 4CLLA 3D0GE 2Z57B 3LAKA 1R6YA 3EVWA 3FCHA 2DKOB 4YR2A 1HR0J 1X4DA 4CI0B 1WOSA 2F1FA 5DS7A 3M7VA 1U0HA 4LMZA 3HD2A 3HO1A 3LGHA 1FWPA 2R7XA 1AXQA 5HJYA 3HVAA 3R9LA 5L1KA 4DS4A 2ATCB 3W2VB 2RDIA 1S1VA 1YI2S 3R5CA 4FKXA 5B09A 1PG5B 1V5VA 4NLQA 4U7UK 2BZ2A 2FPHX 3TAMB 4NLXA 4DR6J 1FXRA 1NZAA 2A0FB 1B7YB 2QLWA 3CEDA 1I3OB 3C14B 3I82A 3ZXWA 2MQNA 3EGZA 3IMQJ 1S0NA 2D3UA 1WC4A 4H4OB 3ZZRA 3PIOQ 1ICEB 2BEFA 2P6TA 4WP8A 3WBZA 3W2WB 2AYEA 3MAHA 3K58A 4X2BA 1Y3KA 2KTQA 3J7AN 4P2MA 1HR0F 3E51A 3M8RA 2XZWA 1D0EA 1CJVA 3T41A 4DS5A 4DSIA 5BYQA 2QMXA 4DPWA 2MJUA 2GIFA 3CIMA 2G2YA 3E01A 2ZHOA 2J9DA 1Z1ZA 3R2CJ 5CXTA 5IXUA 4QZVB 5SUHA 3PW7A 1YTYA 4IOAQ 3ZZ0A 4WU2A 1Z2ZA 4F25A 5J1EB 1UPMB 2DB1A 2CUYA 1M90T 3G2XA 1GMWA 3ETMA 4OZ1A 2VU5A 4WXWA 1IKXB 5THWA 3SQGA 4KGZB 2M4MA 4NCGB 1MSWD 1XEZA 2HRYA 2J0XA 4OI2A 3UCGA 3OL6A 3D1OA 3AJDA 1VC6A 3SIPB 2OSQA 4YEAA 5KFHA 2JEIA 5HVHA 3PO5A 2HG4A 3BGLA 2F3JA 3G71S 1BWEA 3QFHA 3QZ8A 2JX2A 1IWGA 1HI8A 2ZNYA 1KLNA 2YNGB 4Y34A 4Q8EA 2ZUGA 3QATA 1Y00A 2V4QA 1APSA 2Y1RI 2EPIA 3FBBA 5GMDA 1UAWA 1JKHA 1L3SA 1KKHA 2CQ2A 3DRXA 3DU5A 1JWWA 1S48A 3K59A 2Q3PA 4O3SA 5A6WA 1WKLA 2UXCJ 3JTNA 3HHLB 2HBRB 4QR0A 1QTNB 4DUZF 4KKOB 2F65A 1WHXA 4L74A 3Q2TC 1NO8A 3Q86A 3ISNC 2X1AA 2ZM6F 5LSRA 4RW6A 3RW7A 4MK9A 3OSPA 1XK8A 3R5GA 3NOGA 4DN9A 5L39A 4LF7J 3N5BA 3I0SB 4LFBJ 4NMLA 5GAEI 4TU8A 5IWAJ 2YX1A 1Q0NA 3F73A 4RNFA 2ZBRA 3HFKA 3MDFA 3MM7A 1J27A 2F5GA 3QZ7A 4CO0A 3KJVA 4PABA 2AJFE 2C3MA 3AA8A 3JYTA 2DHAA 3M2UB 3GYNA 4DX8H 2XY6A 1LWXA 3VGUA 1UW4A 3CD7A 5G0RB 3TAPA 5IM0A 2GVDB 2MKSA 1S6OA 4ZOSA 1KWMA 2BM1A 2YWFA 1HBNB 1S12A 2ZC4A 3N0VA 4OQJA 1S1TA 1VI7A 5HSPA 2XO7A 3MMBB 3VVTA 2XSFA 1TELA 1BUXA 1TV6B 2IAJB 1LEOA 2MY7A 5IC4B 5HROB 1HQUA 4ED5A 2ZHAA 5KFQA 3EXYA 4LIWA 1NK9A 2MGZA 1MG7A 1RAJA 1RE1B 1W2IA 3JSBA 5GAGU 2OPRA 2QL5B 2VKRA 4AFFA 3TA0A 2BJ9A 2CJBA 2HRTA 4K2JA 4KR0B 2AZ1A 2RQCA 4LBPA 1ROFA 1TQLA 2U2FA 4YB6A 3AXKA 4K4XA 2YX7A 3RU0A 2I9SA 1X4AA 4DLGA 2HQCA 4EBEA 4G1IA 1NB2A 2MYFA 5B0AA 3JQMA 1JLAA 3UR3C 2XY5A 4QU6A 4F3OA 2APOA 1IJEB 5CQGA 2OPPA 2KVIA 3W62A 3OL7A 3FMBA 1KHWA 4ECSA 1BMQB 3LPYA 2KM8B 4ECVA 1U1KA 3M8QA 3QRPA 4C8KA 3H59A 3ZC4A 2HHQA 1AZSB 2VOPA 2K1RB 4FP9A 2HQFA 3IBCB 3US5A 4TU9A 4MJKA 2BJ1A 3SZ2A 4OZ3A 2CPXA 5KFTA 2B3TB 5B0DA 3ENAA 4YHHJ 4JI8J 3A8JA 3MEEB 4G1QA 4KQZA 4MMOA 3CJ2A 2LDYA 3MI7X 1X4FA 5CYQB 3SCLE 4CO3A 4ZHRA 1HNVA 1U6ZA 4YY3F 3V4IB 4KO0B 1OSCA 4UY85 2ZH2A 5HLFA 1S1WA 3GLJA 2YQ1A 4U8YA 1K8AT 1RT1A 3BO2A 4RR5A 3K5PA 3MCOA 5HAOA 5JVHQ 1LWCB 1WHVA 3HVTA 3HZEA 1UVNA 2RDJA 2LQ9A 1NPPA 1NRKA 2JLGA 4NLRA 3HHLD 3CMES 2H4WB 4HL9A 5LJ3Y 1N33F 3D1HA 5F3TA 3TUZC 2AYBA 2VG6A 3CJSA 1RTHA 1NJXA 3CC7S 2W2MP 2DNHA 3FMWA 4Y2AA 3EZ5A 4QU7A 4TQRA 3IRWP 4ILRA 3RYLA 3P96A 4I4BA 1VQLS 3RRGA 2WOMB 5E41A 4F3MA 6AT1B 2B43A 4NI2A 1LW2A 1D9FA 2CQGA 5ETPA 3VTIA 2ACMA 4FPRA 3W9HA 1T9WA 4U95A 4NA1A 2NREA 5DQGA 2A2CA 2H65B 3L9ZA 5HI7A 4C3LA 3MM6A 3UN5A 1V3ZA 2MKHA 2LQ8A 2V2QA 3E01B 4I2PA 3RR8A 3H2UB 2UVUA 3TRGA 1F2GA 4DV5J 2OPQA 1SC3B 1X5SA 3PJ9A 4NCGA 2GO8A 5KFIA 2LLZA 2K2PA 2DIUA 3NGSA 4P10A 1Y9OA 1IUJA 5FLXU 3VV2B 4C8YA 2AW0A 4KGMA 4KHMA 4P2SA 2B6AB 2KG0A 2NZ4A 5L1JA 1VRTB 2EKNA 4ETXA 2WSCC 1X4CA 4EU0A 3HK2A 3KNGA 2HBQB 4ZS6A 2NPFA 1PAEX 2C2OB 4EYIB 3P49B 2YNGA 3EM1A 5DDPC 3T1HJ 3DI6B 4WKYA 3CULA 1URRA 1RLCL 1KVIA 1FXDA 5C7PA 3MR7A 5IT0A 5KG5A 3HSDA 3GIMA 2YQ0A 3FBEA 5K20B 4OI1A 4ED7A 4IFYA 1OY6A 4J9SA 2V69A 2DNRA 1TL3B 2R2SA 4O4GB 1KBRA 4K0KF 4K4TA 2XWYA 6FD1A 2FZGB 3MPYA 2Q6BA 1R8CA 1FKOB 5D0EA 4LSNB 4GKKJ 3CCVS 2WB4A 4AL5A 1CJUB 4JI2F 1SKWA 3R6LB 4ES1A 4EWTA 2O5DA 4FYVB 1RJJA 4P52A 4WP9A 4CDIA 1VOMA 2BJ8A 3H4DA 1RHQB 2C3YA 1U26A 2E44A 2M3DA 2ZUAA 1JB0C 3M8PB 3Q89A 4NASA 3WHIA 1LNQA 3MUVP 2G4BA 2WVBA 1HNWF 3ISZA 1X8DA 3P8BB 1S5ZA 3Q24A 5H9FK 1FJ7A 3KHGA 3LP0B 4DQQA 2OFHX 4L73A 1R8HA 1ZPVA 2F8EX 2RU9A 3DDNA 3FBCA 3G8QA 4MIAA 5C24B 3OHAA 2NZCA 1RBOB 2GVDA 5A2QU 2JRSA 3NGUA 3FDSA 1NK6A 5CCMA 3FQLA 5JUMA 1UMJA 2OIHA 2E1AA 1NH7A 1VFJA 4E98A 4J9RA 5KFVA 3ZZTA 1SUQA 1I94J 2O01C 1U1OA 4PWDA 2NS1B 7FD1A 3J80Y 3HT3A 1YJNS 1Q8LA 3OFEA 1K0VA 2VZ9A 4PYAA 8RUCA 2DNPA 2WBMA 3QT7A 1O0PA 4ZP7A 2E1CA 4NLSA 3OVSA 2AP6A 3LP1B 4ZVHA 5F0UA 1RA6A 2NSBA 3U02A 2YH1A 1VRUB 4OX8A 1IQZA 2WZ1A 4ELTA 1DLOB 5A8WB 2MHEA 1XNRF 1T9TA 1XWLA 2MQLA 2V8PA 3P4UB 3NS5A 3WX4A 1FRKA 2GHWA 3HSZA 3ULHA 1FD2A 2B5JB 3VHQA 3TJ8A 4TXSA 1SV5A 2A18A 4IDKB 2PC6A 1YRXA 4C8LA 1UVMA 1SQFA 2PD1A 1T9YA 4NRTA 3FFIB 3ZFVA 3J7Z5 2KH9A 4UOFA 4ZCMA 3CCRS 5I3UB 1H98A 2H5EA 4NXMF 1EETB 4CH1A 4NEZA 4OLPA 3TZYA 1TFWA 3CJ4A 2VL1A 2V5HG 3IM8A 4OYBA 1S6PB 3CCSS 2Y8WA 2EBEA 2PSZA 2OAUA 3CJ3A 5DGAA 1RT6B 4HACA 4JI6F 2V94A 4MIBA 2OFGX 3K89A 3J81Y 2CYYA 4JB8B 5D78A 3IR7B 4YOEA 2GX8A 2CDQA 4IG3B 4ZHRB 7FDRA 4CLPA 1HW8A 1RI7A 4KO0A 4D3HA 2HHVA 1IQTA 1Z4UA 3V2UC 2WTFA 1RT2A 3MMJA 4DLEA 1U09A 3HHEA 2M8HA 3TQ1A 1FDBA 2RHSB 1QAYA 3GJRB 3IG1B 2FTRA 3SXLA 4P73A 1AROP 4HYKA 4QR1A 2AJ4A 1C0TA 1KFSA 1WKKA 3GG1A 2XNQA 3KHLA 3CD6S 2MEWA 3GYXB 1T02A 4WWSA 3WC0A 1RAIB 1VLYA 1ITPA 1RTHB 2XZTB 4N77A 5F8IA 4RZRA 2EW9A 3Q8PB 4IRCA 4M5DB 5B0FA 4DR7J 4K50A 2H3EB 3AY0A 2GAGC 4IOCQ 1RWXB 4XAKA 1H2UX 3HFZB 4J9KA 1NCLA 4UUWA 2ZZTA 5ETSA 4JI6J 4PKDB 3G96A 4OV1A 5C2CA 2QL7B 2J6TA 3EXCX 3MUTP 4NPOA 2CG4A 2JFKA 2R4FA 3S6EA 3M2VB 4ZKAA 3EX7B 1M5PC 2NR0A 2I5JB 4KGKA 3K5OA 2CJXB 5HJXA 1NBEB 3VZIA 2HHUA 5KFNA 2B51A 4LFCJ 3RB4A 3PYEA 1M1KT 1HNXF 4KAIA 4LFBF 2ZBIA 3BDPA 1QSSA 5IT9Y 1FT8A 3GFZA 4HDHA 3DLKB 3LQVA 4ZLNA 3PACA 4KYZA 5H9EJ 3UW1A 3J81U 2IJFA 1S6QA 4FPIA 4URSA 2GNKA 3T5KA 3MEGA 8ATCB 1TAUA 2AYMA 2E1RA 2DEIA 2W9CB 3HHKA 2BKNA 1RBAA 2W9AA 1NHUA 5KT6A 3DM2A 1XIQA 4M8LA 4WP3A 3MOJB 2WAQD 1F9FA 2J0WA 1NHVA 1AB8A 5I42B 4X62F 4FXWA 3NGKA 1VRTA 2ZEJA 1M0SA 5HP1B 1RWOB 1UWBA 2MLXA 2VQFJ 3I0RB 1C0UA 1TKZA 4DWIA 2D69A 3U27A 2UUCJ 1KHVA 3SFUA 2VDHA 2YNIB 2UVVA 4RX6A 4ZVQB 3SSQA 3CCMS 3H40A 1FKPB 1W25A 4F2SA 3DLJA 5U47A 5EX0A 1HI0P 1L3UA 2ZD1B 4F26A 9RUBA 2DR7A 2XI2A 2R8KA 2UXBJ 2JSXA 4K4YA 4O3NA 5LMUF 2DNLA 3NNCA 4NLTA 4WK3A 2J7KA 2OPSB 1ZZFA 4LSNA 4USIA 3CJ0A 4O0NA 1N8RT 2HNYB 3TEHB 3HF5A 3QPIA 4Q7AA 5DO2A 2KFNA 5JXSA 1H72C 4K8RA 4LSZB 5F8LA 1DAXA 4PQAA 1S1XA 3SDEB 4WFZA 3MZIA 4CO4A 2HIYA 1I6JA 2IRYA 3UN3A 1DTQB 1TVRB 2KN4A 2NXJA 2QLXA 3DOLB 3LP0A 4QYZK 2VFUA 2XMJA 5C42A 2DCUB 2ZBPA 5EN1A 2R7OA 2HGNA 2WHOA 1SC4B 5IQ6A 2FHOB 5KT7A 3MGJA 3BGRB 4ECWA 4IO9Q 1CVJA 1T05B 2LU2A 4CLZA 1JLQA 1U1PA 1F9EB 3C15B 3HMJG 4WE1B 5EGYA 1DY3A 3FSXA 3O6QA 5GADI 4IFVA 2KHCA 2PT0A 4QIEA 4RBTA 5DG8A 1H73A 3K57A 2VJVA 3EUNA 2XLIA 4LF9J 2DCLA 2ABYA 4Z2XA 2JC1A 1X4GA 2LVWA 3Q23A 2GMLA 2XS5A 4M5LA 4DCOB 4Q43A 4TU7A 2N4CA 3PKMA 1DZ5A 4JI7J 4MYTA 2IBOA 3LP1A 5K8NA 1R89A 2VUGA 2BKPA 3UI3A 1VRUA 4KY3A 5HVGA 2VODA 3MMCB 2QA1A 3QSIA 9ATCB 5LMNF 1Q8IA 2OEMA 4F02A 5KFDA 3M1VB 3TI0A 1N36F 3KJFB 3S7RA 3D3CJ 1RT7B 1JLFA 2L41A 3G6ES 4EYHB 1WD6A 2VQEF 2Y1JA 1Q86T 3JSYA 3GV7B 2JOQA 2GHPA 1SJQA 3TAQA 1UA1A 4JI0F 5KT4A 3BO4A 4LRDA 1VBYA 2AJ0A 3AH6A 2J0SD 2W4DA 7AT1B 4HHJA 2D1CA 1SIZA 4AE5A 1KOHA 4IH6A 2IVYA 4RW8A 5F9LA 5L1LA 1I94F 3IWXA 2AYGA 1S7HA 3OXFA 1HWIA 1YQHA 2V2KA 3EJMA 4J37A 2DGTA 2G0IA 1OY8A 3GWCA 4UW2A 2AMCB 2PDAA 2PEHA 1FEHA 2WONB 3IXQA 3L7OA 4PXDA 4RNHA 2HNDB 2AX0A 5DZ7A 3C6TA 3BR8A 1RAAB 2Q43A 4ZJQA 4KHPF 1UFLA 4X4NA 4FKYA 1U8SA 4Q44A 4OI0A 2R2UA 2R42A 4HI1A 4BC9A 3MOZA 4XDCA 2CPFA 3LALA 1MWYA 4LJMA 1QD1A 3MM5A 1SI9A 3LP2A 3D0IE 5J2NA 4KV8B 1SH3A 2CPJA 4W92B 3FSIA 3NMAA 1UKUA 3KK1B 2N4DA 4DDFA 4NCBA 2F4VF 2VFRA 2L08A 2FB0A 3MHYA 5ETTA 2W8LA 4DSFA 1HWUA 2P6SA 1JLEA 2GGPA 4NLGA 1WDDA 2FHJA 1PYOB 3MEDA 4CYUB 3LA0A 1G3OA 1HMVA 2Y3YA 4S0MA 5GAHI 2FY1A 4NE9C 4NLUA 4DPXA 1VCTA 3C16A 2XYGB 3AJ2A 3QIPA 3C3LA 4LRBA 4AYBD 1DQ8A 1RKIA 3I96A 2VKZG 3THTA 3ITHB 1A6LA 2UUWA 2YWEA 1XMOJ 2MZQA 1VBKA 4YP3A 4ILLA 2QFJA 4RW4A 2QN6B 2HZCA 2QSFA 3DKDA 4DV2F 3OVBA 5D0HA 1R7IA 1WF1A 4K7QA 4NXNF 1K0TA 2FHKA 3Q8RB 3THPA 2FLPA 1QJHA 5IOLA 3ZTQA 2E1MC 2YKMA 5M2UA 2ADCA 1UETA 3BDEA 3JSMA 4CLSA 5RUBA 4RNNA 5EWFA 4A8SA 6FDRA 2H9ZA 2FUG9 5BYSA 2YNFA 4O3PA 2XS2A 2FLNA 4HDGA 1ZA1B 4UZBA 1RTDA 1MROA 3NBPB 5C25A 1FK9A 1DJ0A 1FX2A 4JP8A 2O3DA 2H5IB 2OTJS 2M0GB 3FEXB 2V4RA 5CCLA 2R7RA 3CF5Q 4ED0A 2IRXA 4PR6A 1RQ0A 4DL7A 1RWKB 2HFNA 2V8HA 3D6TB 5HVFA 2RH3A 3LGNA 4WFXA 4C97A 2MZSA 2WVDA 4DV6F 4I6WA 4PZVA 3TA1A 5A8KB 1N56A 1P27B 4M95A 2VC0A 4EGLA 2EFGA 2JEJA 4B3TF 4PG7A 1KQSR 2GIQA 4B3TJ 1DARA 2UV8A 1S1VB 4CZCA 1NMEB 2HS3A 3DHWC 2EKYA 2AKWB 2P9GA 1BD6A 2XNRA 1VQSA 3J7A1 4K0KJ 3DLGB 1U8WA 3TAMA 3FVYA 4B9UA 1RISA 2HIQA 1UA0A 2K7JA 1HNIA 3C14A 3R27A 1REVA 2CQHA 2YKNA 2AGOA 1ZOTA 4HI2A 3RJMB 4PG8A 2GMJA 1Q1KA 2IC3B 2X51A 2ZOGA 1CQMA 5KFFA 4N41A 5B0CA 2MSTA 1FESA 3NG8A 5D4NA 1JXVA 1U1MA 3M30B 4M5KA 5K14A 3UDVA 2DR9A 2NXEA 3FBFA 4Y2MA 1C1CA 4AXJA 3RB3A 4OHVA 1Q5VA 1WG4A 2DISA 2YVSA 4ZCKA 5MAOA 1HNWJ 3IAS9 5HMXA 1D09B 1RTIB 2O67A 2RAQA 2OGUA 2R7QA 5D4LA 4E8UA 4LF5F 1RA7A 1SJ1A 4M63A 1KQKA 5DGBA 1T3NA 2HMIA 4JYAF 3PFEA 1KN6A 1DTTA 1RDRA 2CAJA 1RU2A 4LVNP 5KG0A 1IXKA 4G6VB 4OHXA 4H4KA 3W65A 4QBUA 2JDJA 3CIZA 1XMQF 1IBLF 3J81j 2G9OA 2XYPB 3HHLC 1DTQA 1IBLJ 3GZ7A 3HXMA 1N32F 2B4PA 5C42B 4JI3J 2DEJA 2WK4A 3I9ZA 4LF6F 3ILOA 2W2OP 1S9EB 4ZVOB 3BSAA 3VALA 1J5OB 3FCWA 4F4WA 4TY8B 2QA4G 3T1YF 1TK5A 1JIHA 5B08A 1RBLA 1T05A 1N34J 2MZJA 2QV6A 3DFEA 1N6QA 3C15A 4FVMA 4QYRA 2DH9A 3C8YA 4F4AA 2DHXA 1PIEA 1UJ4A 2RQ4A 3UVJA 3EPGA 4DQRA 1AFIA 2GZOA 3PY8A 2QMWA 2GVZB 1Q4RA 3P6YC 2EFVA 2ZOMA 3J7YI 1TL1A 3P3DA 4DXLA 1OQ6A 2V68A 3CJKA 4R25A 3BM7A 2UXCF 1IKVA 4FVCA 2LCWA 3GE9A 4DV1F 2FVQA 4OI4A 1D8ZA 2YY3A 3DYAA 1YX2A 5GAGI 1JNZB 5BYRA 1Y3JA 2HBZB 5GMKa 3OLAA 2HWIA 3MM9A 3QWPA 3UO0A 3AHPA 4J91A 5CH7B 3NGRA 1DQ9A 4H54A 3W2VA 1F2HA 2VDIA 3HD1A 1YJVA 2CQ4A 1FJCA 3CO9A 5C5JA 3G82B 2DPJA 1PYSB 1RSCA 2H4YB 1VQ7S 3L09A 1VDHA 2JH3A 1X5PA 1LXJA 5AE1A 4K5SA 2HVIA 1WG5A 2WW8A 1K47A 4PXCA 4Z7CA 4X4VA 1BXNA 1N88A 1P1TA 2CADA 3B78A 3KUHA 3M2UA 3QO9A 3W8GA 4C8MA 1H2TZ 1ZPWX 2OMOA 3M8YA 3RGIA 5D6GA 4CO1A 4OLOA 4DR4J 2BACA 5G0RA 2YTCA 1WELA 3UE2A 4F67A 2GV1A 1YSJA 5FD1A 1OY9A 2OD4A 1Y0HA 4ZVSB 3PW2A 1LWFA 4WFNQ 2J9DE 3M8ZA 1BQNB 2W4PA 1CJVB 1DQAA 2OUGA 3MCMA 2GFFA 3RRKA 3F0NA 1R8AA 2BW2A 3IS9A 2Q79A 4ZMMA 2RRNA 4L6V3 5HROA 2LXIA 3NAIA 5CYJA 1TFYA 4ED4A 3I55S 2ZH5A 2KO1A 4OX6A 3W64A 3RRHA 4DF8A 3V5RA 4DOZA 3MEDB 4DR3F 1VHFA 3QAEA 2N7CA 2HYIB 3JB9k 3QRRA 1X60A 5KFGA 5HQMA 2AEJA 2ASDA 4KSEB 3MFIA 4B9MA 1HKAA 1M5KC 4C2MA 1UP1A 3LWMA 3IRXB 2HVHA 3KDNA 4DX6A 4RW4B 2D3O1 2FVRA 1XNRJ 5HBMB 3MR3A 2CVEA 2RKIB 1RWUA 3IGNA 1HYSB 1FFGB 1FF2A 1N0VC 4JI5J 2CZ4A 1PKUA 1ULRA 3E8OA 3P5BP 4ZP6A 2RJZA 2P8IA 1P8GA 1WUUA 4MYUA 4IG0B 1VR6A 4B17A 3ELHA 2JC0A 3QIDA 4J5OA 5DETA 2HQGA 4CTAB 1ZAVA 1SPBP 1R0AA 2HHSA 1CG2A 1XERA 2QA2A 1UEVA 3KLEB 3KLFA 2EC0A 4OI3A 5CYMB 4ZIWA 2PEBA 1YZ6A 1WC1A 2K8GA 3MD3A 1CULA 3TQEA 3J7YU 1JJ2R 1HNZF 2WW4A 3U7JA 2HWTA 2FLLA 3C46A 2DGUA 3BS9A 1P9YA 3MEEA 2LFVA 1EARA 3HI9A 1UCNA 4G1QB 1F3FA 1CBKA 2GA7A 4I2QB 2A2DA 4RW7A 5CYQA 4DL5A 4OZ0A 2VJUA 2FHJD 3PJWA 3AQPA 4FYYB 1HIYA 1YBTA 1NH8A 5J2PA 5KG1A 3HVTB 4J9LA 3ENQA 3OBIA 1NDLA 2MHNA 2QLJB 2PO4A 5DRKA 5L9NA 3GIIA 4WTYA 2OELA 4W4MA 1T9VA 3TUPA 5FDLA 5BJRA 4DR5F 4CLYA 1Y5LB 1PGZA 3PW4A 5DDQC 1RAGB 1FJEB 2ZE2A 2RF2B 5ETOA 5EX3A 4A46A 3CCQS 4WIIA 2ZH3A 2XULA 1BQMA 4OJHA 4X4SA 3TX0A 1B99A 2MJNA 2W4CA 3DRSA 3D67A 1PC5A 3CCWA 1FNOA 4HLBA 1RWMB 2CJYB 5AXMA 3DGVA 3ILJA 3QGPA 1FWLA 3QLHB 4P2XA 1WOPA 4JV1A 1KVKA 2ZDOA 3P5TL 2B9YA 1KFDA 1FDAA 4U8VA 1F5BA 1ZTWA 4MK7A 4KGXB 4FNIA 3DRPB 4UOCA 2W8KA 1M5SA 2CFXA 2CQ1A 2W25A 2V50A 3BGOP 3DGPB 3FEZA 2MLYA 4ZP8A 4K2XA 2RU3A 4J9OA 2HMIB 2MKIA 3CMQA 2FZCB 2MZTA 2B9WA 3BPDA 1M1GA 2C3OA 3KWMA 4USJC 1NDPA 2YKAA 4ICLB 4PCQA 5E33A 3KTQA 4ZPCA 2LA4A 3MM8B 3PHTA 2R2TA 2NUUG 2B9XA 2Y0SD 4GVLA 4DPYA 2E7XA 2RMLA 1WSRA 3NWRA 2CPDA 3GIKA 4ER8A 1AUDA 2V63A 2XEXA 4UF4A 3W7BA 4KFBB 4TKTA 4DN0A 3QJLA 4LQ9A 4QWBA 1JLAB 4PQUB 1FVQA 4NA2A 1KQFB 4Y0FA 2ILYA 2F4FA 1S57A 4M5NA 1CJTA 3EMTA 4RJVA 1SJ4P 3TVZA 2V8GA 2OEKA 1Q79A 3NXZA 1EP4B 3G6YA 3PV8A 4MT1A 1OPIA 1SBRA 2AHOB 4Q2MA 5KFMA 3OLBA 3D54A 3PVXA 4OL8A 2CJ9A 3ZNUA 4DJBA 1YG0A 1NM2A 3GCXP 4CWBA 1O5JA 1UTAA 2HFOA 3T6BA 1G1XA 4R5PB 2KXFA 1N52B 3MPWA 3KDOA 3M2RB 2OJ3A 1IBCB 2EEYA 3T5JA 1VQ9S 3J7ZT 2IBKA 2D9OA 4J9QA 1Q81T 1B4SA 3OTCA 4NCAA 4TYAA 2EI5A 1WEZA 3ET6A 3KK2A 2BRKA 1WKJA 2BJ7A 2VPXB 3MM9B 1S1WB 2FC9A 3AOCA 5ETNA 3CB4A 3IC1A 1PAUB 4URQU 3TVKA 1LWCA 4EMDA 2QO3A 1SQEA 3AT1B 2CPYA 3HLUA 5D77A 2K7KA 1QUPA 3G82A 1T95A 4W98A 2R8HA 2PFFB 4OJ1A 2HGMA 3QBCA 1DRZA 2YH0A 3H25A 5CD4H 1SL2A 1S49A 3KJNB 4WU3A 5KTQA 1U6BA 1S76D 1P6TA 2QE5A 1TZ0A 5D15A 4AT1B 2A6OA 1RGVA 1N5YB 1FI4A 1VYAA 1KQGB 2XMUA 4HT7A 1CPZA 4YQWA 4PXEA 3IN5A 3MMAB 4DUTA 1TKXB 3NCPA 2LP4A 3LH2S 1LK7A 4NL5A 4DV3F 3DU6A 4WBFA 4IUFA 4C3KA 3OR1A 5FIIA 5BR8F 5FLXY 1MMNA 3UPFA 3OUYA 2FJEB 3IWNC 3BJYA 3QGHA 2HZVA 3W9JA 4X4OA 5AJ3J 1PSDA 4URGA 3T3FA 2RILA 4DV2J 1FRHA 4LF7F 4Q0BB 2HK2A 4LR7A 4WF9Q 1NSPA 2J8AA 4I2PB 4GC6A 2W2NP 3NS6A 4V19X 3GILA 3T1YJ 3RAQA 3BV8A 2XBPA 3CDBA 1URNA 2ALYB 2Z56B 3M9OB 4C8ZA 3ZTOA 2H5JB 5HL7Q 5J1PA 3OVAA 1Q8KA 3L7PA 3ETOA 5J1NA 5A0YB 2B5JA 1HD1A 3A8EA 4W90B 4RUBA 5IFMA 3V6JA 3QJJA 1B0PA 4O44B 2OMLA 3CJ5A 3SFGA 4K5RA 2CJQA 4ECUA 4L76A 3BYPA 3T1AA 1D8YA 2BMBA 4ID8A 2IRUA 2HKEA 1F0XA 1WC5A 4P7VA 4LR8A 3I56S 2J7UA 2VHGA 1X4BA 3KMSA 4K4SA 2XMTA 3KLFB 1SC6A 4MTPA 2NYHA 3UCUP 3M6WA 1U02A 3MPDA 2P9EA 2NPIA 3C6UB 3NLCA 2CJAA 1TL3A 5HO4A 2IDLA 3D6FB 4MKAA 1WNEA 4H4MA 2DT9A 3U1MA 2GJ2A 2W01A 4XO0A 1IN0A 3N5FA 4DR5J 1QAJA 4JV5J 3EE3A 3BKFA 2V9KA 3NY0A 1WSVA 3OR2A 3I87A 3M6XA 5L9XA 2JWNA 1WF2A 2GHVC 4NMXA 1SC1B 2FVCA 5LT5A 2XSJA 4JV2A 4DCPB 2RB7A 4RKUC 1RT4B 3KG1A 2CQDA 1RWPB 1S9GA 3FK4A 4J7CA 1X4HA 4J90A 4GVBB 4DZ6A 4TQSA 1NXIA 4RWXA 3WC2A 4C11A 4LF5J 3PX4A 1RLDA 4DL0C 1SJFA 2MLZA 1LFWA 5DM7Q 4FXDA 5C24A 3PTWA 4LBHA 1K73T 2ZE2B 2XCAA 1GTHA 1CS4A 4LSLA 2E7VA 1QUVA 2X1FA 2DNZA 2DRDA 2N3LA 3PR4A 5E3QA 2DNGA 2J6SA 2CPHA 4DI6A 3K5MA 2VQFF 2YWKA 1SUQB 2KT2A 3WIVA 1EKRA 1KLMA 3OL8A 3R7NB 4JI3F 2Q66A 3VAHA 1EAYC 4F36A 3QWUA 2VA2A 3WIUA 2G0JA 1X0FA 4C9DA 3Q0AA 2FGCA 1F3VA 2ACYA 2EC2A 1MLAA 2BA9A 2ZJQQ 2QLFB 4X66J 1IKYA 2RVJA 1S4EA 3SSSA 4ES3A 4U6PA 3R5AA 2LQ5A 5MLCV 1DURA 2UUAF 3HCXA 1DLOA 5A8WA 2LKZA 2NXUA 3CO0P 4XIUA 1JLGB 2WCXA 1RKJA 2KFYA 4QIWD 1S6QB 2IM1A 4CM0A 1X31C 1FWKA 3MEGB 4O4RA 1NK0A 4CNZA 1J5OA 2BE2B 2FHMA 3H5SA 3HM9A 1LWEB 3DM2B 5DM6Q 1FVSA 1TU0B 2VASA 4LF1A 1XC9A 2C2MB 4DQIA 1XQIA 5I42A 4BS2A 1AUSL 2HHPA 1QE1A 1H74A 2DGXA 2IM2A 2GCFA 2OEJA 1Q7YT 4ZCIA 3O44A 1I5OB 5KOWA 1P9QC 2Y1IA 2UZAA 1S6PA 1YJUA 1Q16B 2DNMA 4PAAA 4UOHA 3CMAS 4DV3J 1C0UB 4JYAJ 1QDUB 2KU7A 1YK9A 3R5DA 3M6VA 2XHCA 4JI8F 1RYRA 3NNHA 1BLUA 2UUCF 2VFSA 2VG7B 2LECA 4B3OA 2BABA 1YJWS 1E6YA 1UZHA 3PEJA 1IR0A 4X66F 3J80U 3KLGA 3IR6B 3GIRA 4DX5A 4B9VA 1NDKA 1FERA 4UOGA 2EK1A 3DOKA 3CGIA 1I51B 1LQ9A 2CG8A 3FEYB 4L75A 4F0KA 1UL3A 4LT6A 1TMJA 1T7PA 3ZO7A
chains in the Genus database with same CATH topology
3POTA 2DIVA 5M2PA 3K7RA 2COLA 4C7QA 2MQOA 1TKDA 2B4UA 3IBWA 3O8WA 4NA3A 4C8OA 3ENVA 1ZETA 2UU9F 2VFVA 5KG4A 1Y4ZB 2B7BB 1LFPA 3OV7A 2HFZA 1GNKA 1K1SA 1X5OA 3PX6A 2DO4A 4WK1A 3MAQA 3OXLA 1WEXA 2ERRA 4IQXA 3M4XA 4B9LA 1U49A 2KJVA 3IFEA 4EBCA 3FNNA 2CQCA 4FS2A 1RT3B 1RK8A 1UVIA 1P1LA 4JV0A 1BQXA 4I7FA 5M2RA 1S4FA 4ITSA 1U2RA 5J2PB 3GV5B 3R5BA 2ATLA 3V6DA 2YKPA 4IH7A 4IQMA 2JEGA 1HBMB 1JLBB 4TYBA 2RUGA 5F8HA 2GC8A 2MMYA 3DRYA 3ZZUA 5SZTA 2PA8D 2R2RA 4DR1F 2QSWA 1VBXA 2ZZNA 1KSPA 4X4PA 2DRBA 3GR0A 2NUHA 3SEOA 2M7SA 2CQ3A 5L8RC 3M1VA 3ZZPA 2XMWA 2PIIA 3VAMA 4I6AA 3L3CA 1TUVA 1JLFB 3VAGA 2EVZA 4A4JA 2AGQA 4DPOA 3F41A 3CVKA 2HLTA 3O5TB 3O3LA 4QOTA 1LOUA 3V81B 4WKRA 1UWBB 2RRBA 4IO1A 4O3OA 2FJVA 2AWZA 1H38A 1NKBA 3SSRA 1SKRA 4YDDB 4RU2A 5KFAA 4LFAF 2HHVA 4PXBA 2NYIA 4ZDNA 1UFWA 5EN1A 3C6TB 3RB0A 2E5LF 4M94A 2ZD1A 2L9NA 4NOHA 2SXLA 3TP2A 1ZBTA 3LO3A 3HP6A 2ZJPQ 3T19A 2XG8A 4H4MB 2GQ2A 3VQSA 1UVJA 1OWXA 3MM5B 4LVOP 4B08A 2CJKA 5IS2A 4O3QA 4YB1P 3HDSA 1G7CB 1H7WA 2ROPA 1Q8BA 2XSJB 2X1BA 4YMEA 3KK1A 4LQ3A 1QAXA 1BC6A 1JXEA 4F4YA 1L3VA 1H7XA 1YJTA 4USHA 4OJ3A 1S9GB 3DNCA 2IM3A 1OSDA 2YNHA 2W7PA 4ECTA 4BWJA 3RBEA 2KKHA 5H9FJ 5IZHA 4C11B 1U1QA 2WSEC 1IKXA 3QIPB 2JJ4D 1VQ6S 3S1TA 3M9MB 3MFHA 1JJ4A 1XR5A 4ED1A 4QWEA 3V6HA 2XI3A 2AQ4A 4Q2LA 4NZ7A 4ZPAA 2BR0A 4K4VA 3I4PA 1OPZA 1XTZA 2HGLA 3GFYA 4DFJA 5D4PA 3NWGA 4U7CA 2Q6CA 2GJIA 4TLRA 4U67Q 2PI4A 2R7TA 2XMVA 1KRPA 5E0OA 2F7VA 3EYZA 3SQGB 1JKHB 3LGMA 4RUCA 1ZM3A 4U9RA 2BANA 5T41A 4MK8A 1RTDB 2OO4A 1C2PA 3PXGa 3SV3A 2RS8A 4ECXA 3HHLA 1J5EF 4KKOA 4ECQA 1HBUA 2BQ3A 3TA2A 2GW8A 1VBZA 1RT7A 2YX4A 1YGYA 2BVZA 3Q2SC 2I2YA 4NLVA 3M05A 1X4EA 3CDAA 1A7GE 2V4JB 3DRRB 2CQIA 1YBAA 2FDNA 1FNXH 4B9NA 1FA0A 3MM7B 3PDNA 3D28A 4IH5A 4A48A 2HS0A 4NLDA 3H98A 1SL0A 1FCAA 2AJQA 4LF4F 1R31A 4OZ5A 2HNDA 2MDAA 1REVB 1UVKA 4QCLA 2VG7A 4DR2F 2I8EA 1FE4A 4YFUA 1S1TB 2E9TA 4RNOA 1LW0A 1RTJA 3DOKB 2DR8A 1T8EA 2Z2MA 4BC7A 5KFJA 4N76A 5KFWA 3M8SA 3PW5A 1S72S 3HHDA 1TK0A 3UDLA 5KFPA 1IBMF 4EEYA 1JLEB 1UEUA 1RP5A 4DHVA 3N9UC 1BGXT 2HW3A 1GX5A 1H3DA 2DH8A 5DG9A 4CH0S 2AGPA 1FRIA 1C4CA 3UDCA 2IAJA 4DL3A 1GTEA 1D9AA 2QZ8A 3I5CA 1UVLA 1HQUB 1HFEL 4ILMA 2IJNA 3HPOA 2M9KA 3OFGA 3LANA 3SMZA 4D3GA 1KC8T 2YKMB 2HNZA 4I7FB 4QPXA 4JV5F 1GX6A 3JSMB 1HW9A 2EG1A 4P6QA 2IYGA 2OPRB 2VBYA 2GQCA 2IVMA 2L9WA 2LA6A 4PUOB 2FLOA 3MTJA 3H8YA 4DR4F 4KIAA 4RBVA 3CCJS 4YR3A 5CZXA 1MMLA 1VK3A 4QIVA 3UNGC 3ZZYA 4ZPTR 2B56A 3BZQA 4PRFA 2QIFA 4YB5A 4RNMA 4ALZA 2EG2A 5CHCB 2AX1A 2QEXS 1U2FA 2PA3A 3CWJA 4DQPA 5DG7A 4B9TA 5KFLA 1W2BR 3T6JA 1IJFB 1LKZA 2LXFA 3LF0A 5E3CA 2XGQA 3G4SS 5T7LB 5JJBA 1J2VA 4X4TA 2KT3A 1SIWB 3OTBA 2JLEA 1FRLA 1XNQF 2RT3A 3NMRA 4KJIA 2OD6A 4FNHA 4ZCLA 1VQYA 1VQ4S 3I32A 2HPUA 4QJVA 1TK8A 2VOOA 1X9WA 1NJWA 1RT1B 3OJUA 3T5HA 3M30A 5K14B 3HVRA 1HARA 1R3NA 2B4VA 1F60B 2WOMA 2YKQA 1FRJA 1Y7PA 4RBUA 1UJ5A 2LMIA 4F8RA 3A1YG 3T9ZA 2R8IA 1RTIA 3UQSA 5E3AA 3BF4A 4XK8C 5LXYA 3AA9A 1S9FA 2VV5A 1Q78A 4HEA9 1U1RA 3VF0B 4C0OC 1VQOS 5A6PA 2ZFHA 3TR5A 2YNHB 2XY7A 2AU0A 4ZP9A 3PO4A 1B7FA 3RW6A 4B9SA 2YQ3A 1Z2LA 2OPQB 1LW2B 4JI1F 1S0MA 2IYIA 2BQUA 3IRXA 2BOPA 2WSFC 2UV8G 4I68A 2KHDA 3CTRA 3ISND 3GIJA 1T03A 1D8YA 3M6UA 3MM6B 4EZ9A 1VGYA 2CPZA 5CA5A 3B4DA 4QW9A 4GKJF 3KLVA 4QIGA 2E9RX 3BGFA 1BY9A 3ONQA 2XS7A 2JFDA 1N0UA 2P9CA 1ZAWA 3KLEA 4E0DA 2RRAA 1M5VC 3QGIA 4Y2CA 3R3TA 5H1SV 2HAIA 4NYZA 4QIFA 4BDPA 4AL7A 3CCZA 4C4WA 1FKOA 1KONA 4RW7B 3HKWA 1OO0B 3KHRA 3VZHA 2WB1D 5EDWA 4O23A 4Y2IA 3S01A 4BCAA 3ZZZA 5LJ5Y 4UY8T 3H5YA 1R8BA 4X65F 3PEHA 3H5UA 4CCHA 1TP7A 1V3SA 4NLOA 3OTOF 4O4GA 3DLEA 3EGNA 1PO6A 3I6PA 4FYDA 3U1NA 4DL2A 2NQPA 2MZRA 3CPWR 4YR0A 3SYZA 2BBEA 4IYQA 2RF2A 4TY9A 3HX9A 3MTKA 2J5AA 2KDOA 2QRRA 1LWFB 4OZNA 1TKTB 3DRSB 4DEZA 1U4BA 4IRDA 1BQNA 4ZA1A 2BRLA 2L9DA 3KK3A 2YKOA 3OL9A 2O66A 4PWDB 5B7WA 5EUHA 3G8TA 4ZPDA 1PILA 2P5VA 3VAIA 4ZLPA 5E5NA 4FF2A 3DLBA 3DGPA 4OX9F 2BXJA 2HHHF 1X7VA 4IOBA 4BWMA 1X9MA 2ZH1A 5E3PA 1ELOA 4L72B 4OI6A 5LSLA 4R8UA 1NJIT 2NLWA 4DG1B 4I64A 3FZBA 1SJ3P 5LXRA 2XB2D 5KFYA 3K5NA 2MKCA 4RU9A 4ELUA 2QYCA 2RNEA 4Y6IA 4A8WA 4K4WA 3MWBA 3N4WA 4WZQA 5E7OB 4KFBA 5KT3A 2NSCA 4C0HA 3DXSX 3G8SA 3F44A 3GG0A 4DUYF 5DJBA 1ZH5A 3NL0A 2J6UA 2J76E 4PUOA 1NK8A 1R0AB 4J9PA 1XR6A 4ID5B 5B0EA 3RB6A 3DHXA 5CYMA 1SV5B 4IDKA 1S1UA 2VG5A 4AXIA 2HHWA 4EUVA 4I2QA 5DLFA 1N48A 2EFPA 1EETA 3R1LA 4DSJA 2A1BA 4CO5A 3VAFA 1HD0A 3M32B 3VAJA 4G3IA 2BUNA 2CKWA 3H20A 3HVWA 3DDKA 3KLIA 1KTQA 3MXHP 4HH1A 3BO3A 1Y5NB 3CSKA 1O51A 2I0XA 5FDLB 1RT5B 2L48A 2U1AA 1CEZA 4A47A 2CVIA 2JEFA 3TNVA 2FGOA 1S0OA 2VB6A 3RR7A 1RT2B 2DNQA 4RW9B 2W9BB 2AD9A 1TKXA 5KG6A 3W3SA 1XR7A 4KT0C 2R7WA 1C0TB 5F41A 3NRBA 2J9CA 1FTCA 5DDRC 1GT8A 4TN2A 3M2VA 4PG6A 4ED2A 2R7VA 2I5JA 1JLCB 2F8HA 2V8VA 4Q45A 1VS3A 4I69A 3DRPA 3FQKA 2POKA 5HMYA 2J0QD 3QAUA 1OIAA 4ZVGA 4CH7A 2UVRA 3TX8A 2ZH7A 2AJ1A 3SCJE 4ED6A 3DMJA 1GH8A 2FJWA 1HHSA 5GAEU 4J9MA 3S8SA 2W9CA 4DV5F 3DLHA 1N5VA 2DRAA 1JK9B 4QW8A 4FF3A 1T94A 3CDUA 5B0BA 2OLWA 2FJDB 2FJBB 2ROGA 5A0YA 2D7SA 3MURP 3CXCR 5A8RA 4QPTA 1WTBA 2DHSA 2F8MA 3TARA 3MF5A 4PPZA 5IQQA 3QYYA 1S97A 3GQCA 3CCTA 5EWEA 2FVSA 4FF1A 1XBWA 1Q7LB 5AE2A 4KTQA 5KG7A 2IA0A 2VC1A 4RWWA 3I5AA 2YNIA 3BSCA 5J2QA 4KC5A 2EWHA 1WHWA 3K0JA 2D41A 4DL4A 1FEEA 2Z8QA 5D3GA 3DCAA 4WFBQ 5F8NA 1HQEA 2OP5A 1X5TA 1F5AA 1S99A 4QR2A 5AXKA 2ALZA 4DV0F 4DV7F 5HP1A 2DHGA 2OPSA 3QGGA 4RUAA 4FZVA 4A8OA 2BM0A 2FIUA 5LSOA 2ZH4A 3K8VA 1KS2A 2IMOA 3OR2B 1SJRA 2G0CA 4FXVA 3VR1A 2ZDPA 2VBWA 2GMHA 2LEAA 4JI7F 1IBKF 4F4ZA 3DLEB 1TVRA 3DOLA 2Z2LA 3HZGA 3LOUA 3OFFA 2DNNA 3D0HE 3L95X 4KPYA 4GMKA 4N8OA 3MMAA 4N8NA 3B82A 3FSYA 2UP1A 3KNAA 4QQBA 3BGRA 2G13A 5KFBA 3OTEA 1JLQB 4CT9A 1SL1A 4I0WA 1IKWA 1HPZB 5DQIA 2OH2A 1S1XB 4IKAA 3KKFA 3JAMY 3TOQA 5HQ8A 4HTIA 4TLQA 2KRBA 2IM0A 2JLFA 1ZZNA 3PFOA 2HQIA 1GXLA 4OX7A 1FDDA 1YJ9S 3MPVA 3MR5A 1N54B 2PN6A 1H2VZ 5F3ZA 2E5JA 2EK6A 1JLGA 1N5SA 2ZVSA 1I1GA 1YRUA 2LEBA 4IRKA 2KG1A 1WHYA 3EZUA 4OMFG 3Q8SB 4DFKA 1HBOB 1OS5A 3NCQA 2VPZB 1IM4A 2N7YA 4WCEQ 3N6NA 1JJHA 3BREA 5DQHA 1MMDA 5F8MA 1NK7A 3MMCA 2JVOA 4WYLA 1VQ8S 2J7WA 2WONA 3LUYA 4I6YA 5GVQA 1U7LA 4X64F 4PG5A 4XPEA 4B3MF 1FRXA 1LK5A 1WACA 2RE1A 1HNXF 1S1UB 3AB4B 2VG5B 3KLGB 1QAJA 1NAQA 1ZTTA 2BYCA 3OSNA 4X84A 2ZJRQ 1D9DA 3PW0A 2LYVA 4Y2KA 3GFHA 3RAMA 4DR6F 3AQOA 4C98A 1FTRA 2DH7A 3RBDA 4ATNA 2ZNZA 4H4OA 1DFDA 2XLKA 3W2WA 2DGSA 1HMVB 2C3PA 4GO5X 1HBNA 4MIWA 2M8DB 2BJEA 2IVFB 2UXDF 3FRYA 3MMBA 1HA1A 4X4RA 3HHNB 3MCSA 4NX9A 1XMOF 5KG2A 3O2IA 2WRMA 4I1TA 5L1IA 4FBTA 2IHR1 2R7SA 1RT3A 2VONA 4QWCA 1Y5IB 5J1EA 5KFKA 3OHBA 2DBBA 3BR9A 4HH0A 4N5SA 4MKBA 3CD5A 1VIOA 1WI8A 2Z0GA 4LUBA 4OHYA 3RAXA 4KB7A 5I3PA 4QWAA 1HWJA 1N5QA 3KG4A 5C25B 4OZLA 5EHHA 1HHTP 4MKYA 4ECYA 3H5XA 3PRBA 4M1KA 2HQ3A 3KG0A 2DGQA 5IT4A 2XLJA 4DV4F 1CLFA 4IR1A 2ZH6A 1NJZA 1VMBA 1ZAXA 3ZZOA 2W24A 3LW5C 2IMWP 4V19J 4NWBA 4MFBB 3D1QA 2LU1A 2L3MA 1QE1B 1SKSA 2K1RA 3IGVA 1FK9B 4OFZA 1NNDA 4KHRA 3KYLA 2C3UA 1GQEA 1HNIB 1O8BA 1VIXA 4F50A 1HNVB 3V4MA 2YKNB 3V4IA 2ZH9A 2C2DA 5J2QB 3E2EA 3KLHB 3UD4P 5A8KA