2GV1A

Nmr solution structure of the acylphosphatase from eschaerichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the acylphosphatase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
total genus 15
structure length 92
sequence length 92
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gv1A00
1MWYA 2LQBA 5B0EA 4A4JA 1Y3KA 1YG0A 2ASYA 1Q4RA 2GGPA 4OJ1A 3T9NA 1KVJA 2OD4A 1OPZA 1VQYA 2RILA 1N5SA 2RMLA 2VH7A 1SI9A 2XMKA 3DXSX 3HHLB 4Y2KA 3FRYA 2IYIA 3MZIA 2FHMA 2GO8A 4DL0C 5B0DA 2KKHA 2ROGA 2GFFA 1Y0HA 3BM7A 4HL9A 4U9RA 2RSQA 5B09A 4OJGA 1FVSA 5B0FA 2BYCA 4EFAC 1W2IA 2LQ9A 2OD6A 3UDCA 2QIFA 2HLTA 3LO3A 2BJEA 4QOTA 2K1RA 5T7LB 2XMTA 4F67A 1IUJA 1VQSA 3BR8A 3WDOA 4Q2MA 1KVIA 3FMBA 3LGMA 2W4DA 2RU9A 4FNIA 1FVQA 1TL5A 2ACYA 1N5QA 3KKFA 3FGVA 1Q53A 2HLUA 1KQKA 2ROEA 1AFIA 1ULRA 3DCAA 5B0GA 4HH1A 2K7JA 5B0AA 4HI2A 2GGPB 4A47A 2EW9A 4Y2MA 1R6YA 3BF4A 1X7VA 4HH0A 1AW0A 3BDEA 2N7YA 1YJRA 3I9ZA 4Q2LA 1P6TA 3HFKA 3KG0A 4NPOA 2K1RB 1OQ3A 1V3ZA 2AJ0A 1Q8LA 2N4DA 3K7RA 2OAUA 2QLXA 2AP6A 3LGNA 2KT2A 1AFJA 3F44A 5F0UA 1FE0A 1GXUA 2HFOA 4FNHA 4ZA1A 3BB5A 4OIXA 1YRXA 2XMMA 1S6UA 3HHLC 4OJ3A 2FTRA 2K2PA 4ZOSA 2Q3PA 1TUVA 2BBEA 4YDXA 1K0VA 5B0BA 5B0CA 1TR0A 1Y3JA 2AJ1A 1YJVA 2W4CA 2AW0A 2OP5A 1CPZA 2LDIA 2QYCA 2FB0A 3KG1A 5A6PA 2G9OA 3HF5A 2N4CA 5IXUA 2OKQA 4HI1A 2IFXA 2GA7A 3VTIA 2ZDPA 3CJKA 1YJTA 5B08A 1FD8A 1RJJA 3IWXA 3MCSA 3HDSA 3IWLA 2KYZA 1FEEA 2LXFA 2HFNA 4NL5A 4DPOA 4OJHA 1TZ0A 3BN7A 1Q8BA 5KAKA 2BJDA 2VV5A 2L3MA 1X8DA 2XMJA 2OFGX 4A48A 5A6WA 1URRA 2KT3A 2PD1A 2XMVA 1JWWA 2FIUA 2HQIA 2HIQA 2IYGA 1CC7A 2W4PA 3HHLA 1FE4A 5F0WA 1QUPA 1XBWA 1OSDA 2ROPA 3TNVA 4DN9A 2QLWA 3CJKB 1X0PA 3BGUA 1FESA 1OQ6A 1P8GA 2JDJA 3QGPA 2BUNA 2K7KA 2OMOA 3KNGA 3HX9A 1S6OA 1SQEA 2XMWA 2OFHX 1JK9B 1WD6A 3TOQA 2GCFA 3GZ7A 2XMUA 5T7LA 1APSA 1GXTA 1Y9OA 1U7LA 1MWZA 1CC8A 2CRLA 1YJUA 3HHLD 2GV1A 3QMQA 1TL4A 2ZDOA 3E8OA 4YEAA 5K9FA 2PGCA 4A46A 1N5VA 1N5TA 4Y2IA 1SB6A 1LQ9A 3TRGA
chains in the Genus database with same CATH superfamily
4LF6F 2QTWA 2V4JB 4DL4A 3SDEA 1NBEB 1P9QC 3MM5A 4B3RJ 5HLFA 1Q4RA 1U1MA 4WTYA 1B99A 3EGZA 3LPYA 4LFCJ 2LP4A 2IIHA 2XMKA 3IRXA 5J1EA 3OL8A 1KR4A 4FYVB 2CPHA 4Y2KA 2AHOB 1LNQA 2IYIA 2ZHBA 3S01A 3W9JA 3H4DA 5C42A 3SZ2A 3RZAA 1U0HB 2MTLA 2LFVA 1AXQA 3FJ2A 2RVJA 3IC1A 2RDJA 4KPYA 1JJCB 3SMZA 4TQRA 3KHLA 4NXNF 1RLCL 3TAPA 2ZEJA 2WW4A 4NLOA 3UO0A 4B9UA 4Z7CA 2C3YA 4RW4A 4ZPCA 1JJ2R 3WDOA 1EIYB 4LFBF 4OQJA 2HRUA 3PVXA 2RU9A 4FNIA 4IFYA 3VAGA 2UU9F 4ZVPB 3TA0A 3P49B 5DG7A 2A3JA 3HSZA 4CLSA 1OSCA 1E6VA 5T14A 3TAQA 2B4VA 5HBMB 2FLNA 2GHWA 4FF3A 2XO6A 2AWZA 3M8WA 1IQTA 3WX8A 1U02A 2QSWA 1AUSL 5ETRA 2DGQA 2JOQA 3OL9A 3GR0A 5JVGQ 2LVWA 5CYMA 4ZPTR 1NKBA 2PFFB 3K8WA 4PXBA 4P10A 4IDKB 1X7VA 3GFYA 1RA7A 5KOWA 1QE1B 1O6XA 4YY3F 3J7A1 1UW4A 3MCNA 1VCTA 1TVRB 3KNAA 4RX6A 4EYIB 4CO5A 4LUBA 4K4WA 1URNA 1XTZA 2XZDB 1ZBTA 2RF2A 3M9NB 4J7CA 3MCMA 1WC6A 4PWDA 2RH3A 1WELA 3CJ4A 3LP0B 2JLGA 1YJ9S 1F2HA 4KR0B 4LJMA 4PYDA 4URQU 1X4GA 3GQCA 3DGPA 1S6UA 1YJWS 3ENVA 2VG6B 1AA1B 5DLFA 3I0RA 9RUBA 1RZMA 2XHCA 4MK7A 4QWBA 4ED8A 2DIVA 2M4MA 2X3GA 3PYGA 5GAHU 5K8OA 2WOMB 2K06A 1HWKA 1MG7A 1QD1A 2Z0GA 5D77A 5HN0A 1J5OB 1WEXA 3OR2B 1NDLA 1Q5VA 1DHMA 2F4FA 5DRKA 5ADZA 4HDHA 4X64J 1RTIB 3QFWA 2PN6A 2QE5A 3IWXA 1RJJA 2V8GA 3D68A 4P6QA 3VGVA 3PKMA 3VZIA 3KMQA 1L3KA 5CZXA 4H4KA 1FD2A 2YWEA 2PMZD 3S8SA 1SL1A 1KFDA 4F4WA 4ZPBA 2RDIA 2Y8WA 4QPTA 4ZMMA 1T7PA 1X9MA 3BH7B 3DDNA 2XI3A 5CABA 2H65B 3S6EA 2F1FA 4UY8T 1U1OA 4RW7A 1N88A 1TKTB 1K47A 3TUJC 4XPCA 1U47A 2HIQA 4M5LA 4WFZA 2C22A 4K8RA 2LXUA 1XIQA 1NB2A 2QFIA 1N5YA 3QPIA 3FBCA 4EI2A 3MM8A 1CS4A 3NKYA 2DITA 3OTDA 4Y34A 3EZ5A 4LQ3A 1S1VA 3PJ9A 2QYGA 3RYLA 4QPXA 8RUCA 3TARA 3DOLA 2HS4A 1PSDA 2HAIA 3FCWA 3T5KA 2UVVA 2AJ2A 4ELUA 5C2GA 4ICLA 2OFHX 2L41A 3G6XA 3DRXA 1HIYA 3RRKA 3JYTB 1GH8A 1Y9OA 4NRUA 4PUOA 3LA0A 2FJAB 1QAIA 1IKXB 4ECTA 1F3VA 3CCUS 1IKXA 4C8OA 2HWHA 4JOUA 1H2TZ 3FKBA 3SXLA 5KFYA 3EZUA 2IC3A 4U7CA 4TQSA 4IFYB 3QIPA 3ZZZA 1FF2A 4F7VA 5IS2A 1QY7A 1X9SA 1YRTA 1M5KC 1IM6A 3LP0A 3N6NA 2UVRA 5DQIA 1IQZA 3KLGB 3ILLA 1YJ7A 1JKHB 1P1TA 3OUYB 2DH7A 2GQQA 1YG0A 4RR5A 3EDRB 2GGPA 3T9NA 1ZZFA 2MZRA 4JI8J 4RNMA 4C11A 2VG7B 1NSQA 2V94A 4DXLA 4LF8F 1RWUA 1Y7PA 3W7BA 2CPFA 1FERA 5KG6A 1EJ7L 4X4OA 3NGRA 3H5XA 2UXBF 3AA8A 2YY3A 2BJ8A 1HI1A 2W7AA 4OHZA 5B09A 5IM0B 3GV7B 2QA4G 3GG0A 2B8QA 2NXJA 1MROB 4OYBA 5HMZA 2RE1A 1W2IA 4UY85 2B8PA 3MPVA 3KDOA 2AEMA 2KRBA 2XQCA 3V6DB 1IBMJ 3WIVA 3QRRA 1S9GA 1FFGB 2GJ2A 3I5CA 2W4DA 5C2CA 2X1FA 1U24A 1N5QA 2W25A 3AXKA 1Q53A 3AOCA 4USHA 1BC6A 1DFDA 3OQ2A 2V4RA 4J5OA 3N79A 2N82B 3G4SS 2MKIA 2YWHA 3PX4A 1ITPA 4URSA 1X9WA 2GVZA 1CJTA 3HP6A 4OZ2A 1UVIA 3VGSA 3AD7C 4KH1B 3QLHB 5KG4A 1KQGB 2DY1A 2AKWB 4QR2A 1M0SA 1V3ZA 1HNVA 4EU0A 3HHNB 1YRUA 1I94F 1KDNA 3Q22A 4J9NA 1HQ2A 2HVDA 3MGJA 2ACMA 1GQEA 4RW9A 2DK2A 3MHYA 2BM0A 3NG8A 4OX7A 3F44A 2MJUA 1NEEA 3LP1B 1SJRA 5KT3A 2OTLS 4WZMA 3T1YJ 4WYWA 1EETA 4K59A 3JB9k 2FHJA 2AMCB 4WU3A 3OTOF 2R2TA 1VLYA 4F50A 8AT1B 2NLWA 1N8RT 1X5TA 3MPDA 2XHWA 1M5PC 2R7SA 2ZNYA 3BN4A 2FUG9 1PJ6A 2DHAA 2Q6CA 3GFZA 4ZPDA 4P73A 2HNZA 3PO5A 2AW0A 2ILYA 3GIKA 5D0HA 4X4UA 2CJXB 2GQCA 4K4XA 4ZLJA 2R8GA 4NOHA 2IFXA 3T3FA 3VTIA 3KJQB 1S0MA 2D74B 2DNGA 4B17A 2BOAA 5JXSA 2OPQA 2Q1LA 3CIMA 3TX8A 2F65A 3A8KA 5B08A 1EB0A 2ZH6A 3K8VA 4OYMA 2UVWA 3IWNC 2BJ7A 3H5UA 4ZHRA 1NXIA 1TVRA 5H9EK 2IJFA 3DU6A 3MEGB 4OZ0A 5E3PA 1FTCA 1WG4A 2AYMA 3KTQA 4HKQA 4IRDA 1HNZJ 1Q16B 2L3MA 2XMJA 2PO4A 3OTBA 4WKYA 2DHXA 2NXCA 3KHHA 3A13A 3CJ8A 3IM9A 2XMVA 3QIDA 4XTTA 5CCMA 4J9LA 2RKIB 3SQGA 1B0TA 2HBRB 3AT1B 4ZJQA 4NCGA 4CO4A 3QAUA 3DLKA 1OSDA 4NI2B 3V6JA 2RS8A 4FXWA 1RTJA 1LW2A 1JLQB 3UDVA 2EKYA 2F8EX 2V4JA 1NPPA 1KOOA 2OMOA 3I82A 3PHTA 4UQTA 4F25A 2N3LA 5GADI 4ED3A 1ACMB 4NMXA 4KBIA 3W2WA 2YH1A 2FLLA 3WC2A 2H9ZA 1U6BA 1S9FA 4I4BA 4CM0A 1REGX 1BQNA 3POTA 2CG4A 5DDPC 3A12A 3R6GB 5L46A 1RAOA 3TVKA 4UOHA 4DLEA 4FF2A 8ATCB 1RUSA 3HZGA 5KFXA 3M2VA 1E6YA 2H4WB 3PFEA 3W1YC 4Y6IA 5A8WA 3G8TA 2F4VJ 4X4VA 3ILOA 3UVJB 1SV5B 2C3OA 2LEPA 2WB1D 4CP5A 2GVDA 3A8JA 3C6UA 2KU7A 2W9BB 4YP3A 1HNVB 2CQBA 1VC5A 1TUWA 1TFWA 1RHRB 3EVMA 1KC8T 1UVKA 2HHQA 2M9KA 3G6ES 1YWXA 3RB3A 5CA5A 4U7UK 3FMWA 1KP6A 3M6XA 3WQPA 1DAXA 2GNKA 2QL9B 5J2NB 4CLLA 7FDRA 1ZPWX 4P7TA 2E5HA 1R3NA 2R2SA 4ED7A 4DV3F 1NK6A 2K8GA 3IR6B 1GK8A 1RWNB 1A7GE 1H98A 2CQ3A 2QG9B 2MQPA 1BQMA 2KJVA 5T7LB 2XMTA 4RWXA 2J0SD 2YH0A 2Y1RI 3QO9A 5LT5A 4QYZK 4YMEA 2BQUA 4ZK7M 2D1CA 4NLTA 2Z2LA 3HSJA 3T9ZA 3E2EA 2BRKA 1FVQA 2OEKA 2ACYA 2KFYA 3FEXB 1FJ7A 4IOAQ 2DNOA 3CDBA 5I42B 4NLXA 4RJVA 3WX4A 3M30A 5KFUA 4FVMA 1CBKA 4JV5F 1KS2A 2CQDA 1LWXA 2CPEA 3M8PA 4Y2AA 4RNFA 2VG6A 4JI4J 2HFUA 1YVFA 1R6VA 2ZC4A 4KT0C 4LVOP 2LQ5A 2G0JA 1WC4A 2HNYA 2DNRA 2ZE2A 3GPAA 3X3UA 1VQLS 2AEJA 3NGUA 3I9ZA 4QIVA 2VG5A 2F3JA 2VG7A 2VPYB 5EWEA 1U49A 3G9CA 1R43A 2GHPA 3U7JA 4C7QA 4OX9F 3AXMA 1TUGB 2DHSA 5J2QB 1QSYA 4ZVUB 2HQGA 4JYAF 4ZPVR 3OHAA 5CYQB 1GTHA 1WTBA 4WWSA 3QYYA 2J7UA 4NCGB 2R7WA 4XK8C 1IKVA 2X1BA 2VOOA 1YLXA 1VQKS 4FBUA 1EX8A 1WG5A 3K89A 1XWLA 3UCZP 4NLQA 2MPUA 4ZPWR 1V5VA 3ITHA 3HHLC 2AD9A 4LSNA 5HQLA 3H2UB 3MAQA 2G2ZA 1LK5A 1HFEL 2ABYA 4GVLA 4RLEA 5DZ6A 5C24B 1AYEA 1M1KT 2VL1A 1UFLA 3DLKB 3EGNA 1O51A 4YDXA 3R97A 1PC4A 1B64A 1HPZB 4JUZA 4PG6A 5E33A 2YWWA 1SJFA 2CFXA 2ATCB 3OTEA 1UZDA 3V2UC 3CJ5A 1F9HA 3OHBA 3TW0A 2OEMA 2G1HA 4CO1A 3ICLA 4ZN1A 2LXFA 3D9BA 1L5UA 4OJHA 1XMQJ 1CJKB 2HQDA 3DYAA 1TKDA 4ZLNA 4YB5A 2GMLA 5KAKA 3UN2A 1N36J 4WXOA 3DRYA 5C25B 4A48A 1VRUB 3EICA 2J0QD 4B3TF 2RB7A 3UNGC 1NMEB 3BGFA 4CTAB 3TQEA 1S0VA 1VQ7S 2I5JB 1TKZA 3R6LB 1KHVA 1HHQA 2ASJA 5KG7A 2RUGA 5ETKA 5I42A 2FJBB 1P1LA 2DEIA 2XG8A 1HR0F 3O44A 3BGUA 5CCLA 1TL3B 3NGDA 1U26A 3DI6A 2J0XA 4B3SF 3OVSA 2VFSA 3A3OB 4RUCA 3H4BA 1H74A 2D3O1 4C2MA 1VHFA 3WIUA 2ZOMA 3TYTA 1GXTA 2FVCA 3EZOA 4ITSA 3VV2B 4CNYA 5DDRC 1WHWA 1WJ9A 3L09A 1FJEB 2LA6A 3HVTA 3C14B 2CRLA 1IWAA 1DTQA 1YJUA 2KVQE 5LSOA 1CVJA 3DGPB 1DZ5A 3CJ3A 1LFWA 1GMWA 9ATCB 5GAHI 4B9TA 4K5RA 2HHXA 1JLEB 4OYOA 1FKOB 3AB4B 3B78A 5HJXA 3QWUA 1N5TA 4MAKA 4YN3B 4KGZB 4QCLA 4PWDB 1VIOA 4QQBA 3TRGA 1WC3A 3ZZ0A 4A8SA 1K0VA 1DQ9A 2DCUB 2M3DA 3I6PA 1S4FA 4OJ1A 4PKDB 1VHIA 3R7BB 3THTA 3TOQA 2HEKA 1PJ7A 2PFDA 4DV0F 3EE3A 1SKWA 1VS3A 1N0UA 5IV4A 2NYIA 1Z4UA 3AQPA 2DPJA 4O4RA 2X3DA 5ETOA 5AXNA 1S9EA 4ED5A 1TAUA 2QA4S 2XSJB 1UTAA 2RRAA 1MN7A 1HMVA 4K2JA 2ZJQQ 2LECA 4M5IA 2K1RA 2D9PA 3EPGA 4Z7YA 1CQNA 4PQUA 3LF0A 4R8UA 1HWLA 5J1PA 1ZA2B 3FMBA 4RW7B 2Z57B 4CYUB 4UZBA 3R7SB 4N76A 2UXDJ 1N52B 1R27B 4KKOB 4LQ9A 4NMLA 2DYAA 3Q86A 2MXYA 2YNIA 1RT4B 2D7SA 2M7SA 2Z8QA 4PR6A 2K7JA 2NCKL 3IBFB 3O1LA 1JXEA 3R5CA 4L73A 1TMMA 3HSGA 2XGQA 4OZ5A 3IO1A 2MDAA 4ZS6A 3WBZA 3V6HA 3RB6A 3OFFA 4DSFA 2AJQA 3ET6A 4NLUA 5CQGA 3P4UB 4TLQA 3DMJA 3D1HA 2J6UA 4NPOA 4OI2A 5ETQA 4J9MA 3R5AA 4MKVA 1RQ0A 5HK4A 2OAUA 1VGYA 3GFXA 2PE8A 2MMYA 2J8SA 2CJAA 2C2NA 3M8RA 4XIUA 3OT9A 4RU9A 1FHTA 1FRHA 1U1NA 3RR7A 1X4AA 4N77A 2RQKA 3PJWA 1FWKA 1VQ5S 1L3SA 1YITS 2UXCF 4DLGA 3P5BP 2DR5A 4QYRA 2BANA 2F8HA 3V4IA 3BGRB 1HYSB 1HARA 2IVFB 2EI5A 3NS6A 1LKZA 2ZFHA 2BBEA 5IC6B 1DLOB 4ZN3A 2ZH1A 5CD4A 1X0FA 1CSJA 1YJVA 4EZ6A 3RBDA 2QYCA 3R2CJ 4L75A 5KFSA 1J5OA 1V3RA 1WI6A 2EG1A 3MPUB 1TMJA 3A3PB 2H3EB 3DRRB 1YJTA 4Y3CA 5CD4H 3CJTA 1KNZA 2VBZA 4NWBA 3HDSA 3TA1A 2A1BA 1S1UA 2AF6A 4F02A 1HBMA 2V5HG 2KYXA 5J2QA 4TY8B 3S7RA 3T6JA 2DJWA 4CLFA 5I4MA 3GILA 1VJQA 5JVHQ 3NAHA 4G3IA 4JV2A 2WVDA 1RYRA 2B7CB 3AH6A 3DM2A 4ZVQB 4DQIA 2KT3A 4MYTA 1U48A 3T6BA 1RTZA 2UP1A 3JXOA 3D54A 5L1LA 3CCQS 4NE9C 2HK3A 3NS7B 3Q2TC 4OYZA 1RLDA 3CEDA 3NAIA 4DX7A 2HGLA 2FJEB 2ROPA 4IQXA 4F0KA 4V19J 3QT6A 3SEOA 4GMKA 3O5TB 5E41A 2IRYA 1FFSB 4IUFA 1P8GA 2OO4A 4L3NA 3PFOA 4B9VA 1PYTA 4QU6A 4P9SA 3HMJG 4O3RA 1SVDA 3MM9A 2CPXA 3NRBA 4F36A 2FGCA 3BO3A 5T7LA 3D3CJ 5IT9U 2WVFA 4QWDA 4K4VA 5AXLA 3W65A 4AL5A 2XI2A 1H6KX 2CNKB 5D0GA 2FVPA 2GV1A 1L3TA 3Q8UA 1NZAA 4LF9F 2NREA 3EXCX 3HFVA 1N5VA 4F2SA 1T0TV 1K1SA 2DH8A 1DRZA 1UVJA 3M2UB 2VODA 1DURA 2DGVA 3ZTSA 2W2MP 3M6WA 4C0BA 3DLEA 4ZHRB 1TK0A 2BKOA 3DLEB 3MEGA 4PXCA 2KG0A 4GKJJ 4ILMA 3ZC4A 1KVJA 4NX9A 2RILA 1V9OA 2GS8A 2R7QA 4L74A 4Z2XA 2AYGA 2ZBCA 1KONA 2KT5A 3BO2A 4NXNJ 2CWXA 2OPQB 1TAQA 1GX6A 2QSFA 4DPUA 1JX4A 1KRPA 2VA2A 1UA0A 1T9XA 2BE7D 1U2RA 3MF5A 2HNZB 4NXMF 1C1CB 4OYXA 1GMVA 3PNIA 2E5JA 2WBRA 1KWMA 2W9CB 1S1XA 1JLAA 2VC1A 3M2RA 4JV1A 2DNKA 4ATNA 4YOEA 5FJ4A 2R4FA 3IBWA 3L7OA 2IA0A 3FSXA 3M1VA 1LWFB 3UCGA 4CI0B 4EK2A 3MUTP 2MQNA 3AJDA 2Z2MA 1TQLA 3D6MB 1VQNS 4B3OA 1TL5A 4NYPA 4EO6A 3ZNJ1 4CO0A 1M90T 2ROEA 1NB7A 4FPRA 4J9KA 1G6BA 1KFSA 1K0TA 5DETA 2IMWP 5KG0A 1R7IA 3MAAA 4HI2A 1DLOA 5DGAA 1X31C 4B08A 2HHVA 2CUYA 3CDEA 4CH1A 1SQFA 3H20A 3NWRA 2HW3A 3GCWP 4A8FA 4M5KA 3QLHA 4CNZA 2GW8A 1U25A 2L9NA 1UEVA 3NLCA 4MK9A 5IWAF 4QWAA 4DL2A 2E9RX 2AEFA 3PYEA 1CJKA 3QQCD 4HT7A 2BRLA 2NSCA 1S1UB 2ZOFA 5KFIA 1FDNA 1HQEA 2F8MA 1MW7A 4LBPA 4N5SA 2CWKA 2DT9A 1RAAB 4DV4J 1SUQB 1B4SA 3OD2A 1RU1A 2BEFA 2DGWA 2XWXA 4PQAA 5LSLA 1S0OA 2MQOA 5JMNA 4IG3A 1Q81T 4JI5F 3K57A 4X4PA 1S6PB 4O3OA 4RZRA 4USVA 4DV4F 1G2EA 3PM9A 4QIWD 2R7XA 1FK9A 1FJGJ 3ZZTA 4KSEB 3G71S 4CO2A 2VBXA 1XNQF 2AJ1A 3HHEA 3QT8A 1CPZA 4X4RA 3T1AA 2ZOGA 2O1PA 1PILA 1V3SA 4MT1A 1QSSA 2IM2A 3DRPB 4HTIA 2RRBA 1YK9A 4ZVRB 1HQUB 2YNGB 1S12A 3HVTB 1DARA 1TV6A 1W25A 4Y65A 5T41A 2ADBA 1T9VA 4UQGA 4YFUA 2QZ8A 2YWFA 3HT3A 1VQMS 3CNQP 2I8EA 3QAEA 2IVYA 3LOUA 1YJNS 2A10A 4OI6A 2CYYA 1FO1A 2CQ1A 4RW6A 4MMOA 1O0PA 2OFGX 3DLJA 1UFKA 5K8NA 1S99A 2MY7A 4UZCA 2ZH3A 1UWAA 1NHUA 3OXLA 4OYWA 3EYZA 5I3UB 2MGZA 1NHVA 1Y4ZB 3FK4A 2G2OA 1UCNA 3D6TB 1QUPA 2YKMB 3D67A 4HT5A 2HZVA 5F8GA 3KJVA 4KH0B 4LRFA 1GAOA 3SYZA 4J90A 1M5OC 3Q8QB 2FVQA 3TX0A 3TWZA 2IPOB 3MEKA 2MHEA 3HZEA 3MMBB 1SQEA 5EX3A 2XB2D 1NJIT 3VQTA 3UNYA 2VONA 2KHDA 1K9MT 4R5PB 3SDEB 1FWPA 3NGSA 3IAS9 3CSKA 1XMQF 2ZBPA 1BQXA 3OTCA 4CRJA 4MIBA 3TUIC 4TNOA 2E7XA 4ZVTB 3SIPB 5DQGA 3PR5B 2GAGC 4DUTA 2FGOA 4W4MA 5KFFA 2CKWA 4B9MA 2O01C 3KUGA 5KG5A 5A2QY 1AT1B 2EFQA 3GJQB 4HHUA 2X7IA 5KG2A 4XO0A 2W9BA 2K3KA 2UZAA 1S49A 2YPZA 3V81A 2HHWA 4I2QB 2PI4A 3VZHA 3DXSX 5GAGI 5J2PA 1UWBA 3RJMB 2W1BA 3PYDA 3ZO7A 1IN0A 3B4DA 4YB7A 3KLHA 5J2NA 3JTPA 1KQSR 3D0GE 4V19X 4U9RA 2H5EA 4IH5A 1HBOB 4FN5A 3PIPQ 3L7UA 2MYFA 2R7OA 2HFZA 1H38A 1H7WA 1X5OA 3DYAB 4PXEA 3W8PA 4DV7J 4FP9A 2QJ3A 1PJ5A 1ZM4A 3BGOP 3CIZA 4ETZA 3U02A 3Q2SC 1RHUB 1X4CA 4I56A 3R8YA 2V9WA 4Q2MA 2V2ZA 1PAUB 1KVIA 5BYQA 2HK2A 2C3UA 3RTVA 4ZCLA 4FS1A 2WSEC 3PKYA 3CXCR 1H3DA 1REVA 3EX7B 2QC3A 5B0GA 2DB1A 2P6SA 3HM9A 5F8HA 3O2IA 1T05A 1Q0NA 5K14B 4U7UD 1U2FA 2V8PA 2OSQA 2VB6A 4ID5B 4UOCA 4CTAA 2COLA 2DPIA 2BANB 2HBQB 5BXIA 4P7VA 1FKPA 2BA9A 1FX4A 2BZ2A 3CD7A 1T9YA 4ED1A 3DLBA 4NLVA 3UD3P 3OW2R 3JSRA 3QJLA 1OIAA 1YJRA 4ZVOB 3KG0A 5F8IA 4FYYB 4M1KA 1TL3A 4I0WA 2YQ3A 3MD3A 2CIMA 2ZVIA 4P71A 3K7RA 1Q8IA 4AXIA 2XM3A 2PC6A 1YBAA 2XC9A 3MMJA 1CJVB 4ELTA 1VMBA 4C48A 1RK8A 4O3SA 4I69A 3BYPA 4FF4A 2MZSA 1N0VC 3LH2S 1BY9A 4PG7A 2C28A 1QSLA 4NA1A 2AYEA 1PKUA 2B9YA 1LWFA 3Q8VA 2FLPA 3G8SA 4RBTA 1UKUA 4F4XA 3I5BA 1SCJB 2K2PA 1FA0A 1TELA 1WWHA 4HACA 3UI3A 4K4YA 1SC4B 4GRSA 4C8LA 1XNQJ 4NLYA 2ZD1A 5F3ZA 4I7FA 3SCLE 2POKA 2BVZA 4DR7J 5A6PA 5KFCA 3BYRA 3J81j 1S5ZA 3M4XA 2J6TA 2QFJA 2PIIA 3D4JA 2HAFA 1LXNA 4ZP6A 2CQ0A 2NPIA 2M88A 2JHEA 1PIEA 3IRXB 4ZP9A 5HMWA 5J1EB 3BQ1A 1D09B 4DQQA 3RR8A 4C8KA 3MCSA 1S97A 4DR7F 2H51B 2LEBA 2GAHC 2B0GA 4NL5A 2J5AA 2I1RA 4DR5J 3BPDA 2B6AA 5GAEU 1SKUB 3I5AA 1KKHA 1TZ0A 3K5MA 4PG5A 4IKAA 2PA8D 2VZ9A 3MOZA 2DH9A 4KKOA 4LR8A 2IY5B 2CQ4A 3DOLB 5KFOA 1UA1A 2BABA 2KL8A 4JYAJ 4KQZA 3FUYA 1UETA 4I2PA 2ZZNA 1P9YA 3L95X 1SJ1A 5KT7A 1GXLA 1JLGB 1XBWA 2B5JA 3MURP 3CC7S 3W60A 4TU8A 4ECYA 4YHHJ 1JXVA 2UV8G 1NZ8A 2Q79A 2EFPA 2JLEA 3G82B 3JQKA 5KFEA 3B8HA 2E1RA 4K2XA 5KFTA 5DGBA 3W64A 1ZAWA 5LM7E 4B02A 1B7FA 1RT1B 1RAFB 1HW8A 3QWPA 2GMHA 3E01A 2IAJB 1ZS6A 4KYZA 2EXUA 2QL7B 1JLGA 3KUEA 3RW7A 3T19A 1NJXA 1UJ5A 2LLZA 1VRQC 1MWZA 1ZM9A 1OY6A 1CULA 3MUVP 1Y10A 1QTNB 4PPDA 4ED4A 3V5RA 3EJMA 3L7PA 2YKOA 3H7HB 4G1QA 1U1QA 4PG8A 2CADA 2R7UA 4CZCA 2C1EB 4DR2F 4EBDA 1LWCB 3BSNA 4JI3F 3T5LA 2HBZB 3Q8YA 2VJUA 3IR5B 1A0OB 3N4WA 3RBXA 4A46A 4GKJF 2GMJA 3NY0A 4ED6A 1PG5B 3DRRA 2QV6A 3KLFB 3DKDA 4A8YA 3CPWR 1PGZA 3NOGA 1WOPA 1CJTB 2RSQA 3E3XA 2I0XA 2DXDA 5A8KB 3FFIA 5F9LA 2HNDA 2E9ZA 4ZP8A 1SIWB 1KLMA 4HACB 4JB8B 4QOTA 3PHEA 1RT6B 1NM2A 3KUHA 5IC4B 4X4TA 2YKNA 1UJ4A 4LR7A 2VU5A 2B56A 3CF5Q 4DSEA 2PT0A 2QA1A 1NO8A 2Y3YA 1AFIA 1OMSA 1S7IA 1UZHA 3MCOA 2WVCA 1S59A 2OH2A 2APOA 2QMUB 1SL0A 4DSIA 3I96A 4OMFG 1VOMA 5CH7B 2W2QP 2HQCA 1HBUB 2J8AA 2HQ3A 5KFZA 1EKSA 4ETXA 3OTOJ 2L48A 4DU7A 1O8BA 2LXIA 3CCVS 1S1TA 4ECXA 1NH7A 3V6KA 2I6WA 1EZZB 4L76A 5D6GA 4DFMA 5L1KA 2ZM6F 1C0UA 2K1RB 2YTCA 2G0IA 6FD1A 3G6VA 3RB4A 4JI7J 3QGGA 4PQUB 5EWFA 1OPIA 3D3BJ 3CTRA 1H7XA 3AD9C 3GTYX 1FRLA 3SBMA 3OXGA 1N5YB 3EXYA 2VICA 4MK8A 2XTJP 2DO0A 1AFJA 2E7WA 3KLGA 1MLAA 4M95A 1S10A 3OR1B 3D2WA 4B3TJ 1NSAA 1GFWB 2MZQA 2YNFA 3GV8B 2ZZTA 2Y9HA 4G1QB 2CNNB 2XMMA 5L9XA 4H4MA 3D7SB 3P6YC 3B82A 2YX4A 1S48A 1N33J 1W2BR 3M30B 2Q43A 1JKHA 1Q82T 3RAQA 4TYAA 2R8JA 5KFNA 3G6YA 1D9AA 1JQGA 2NXUA 3GR1A 5DJBA 3VWSA 5KFPA 3QSIA 4M5HA 1IVZA 3R27A 2AZ1A 3QJPA 2KFZA 2QMWA 4AUKA 4BDPA 4AL7A 4F4YA 2DXEA 2W24A 2OPRB 3M7VA 3KFWX 1S9GB 1WHXA 4H54A 1VJWA 5BYRA 3DNCA 3R1LA 3B54A 4O23A 2NPFA 4DS5A 2IM3A 2HHHJ 4QR0A 4TXSA 1MROA 2FQQB 3R5BA 2EC2A 1JJ4A 2ZBRA 4TLRA 3UQSA 5AE1A 5KOXA 3UN3A 3BKFA 3IN5A 4FBTA 3C2PA 3BREA 2X1AA 4QIGA 3Q0AA 2CQHA 1HQEB 1H2VZ 3EVWA 4KY3A 5HROA 5J2PB 1S77D 4PRFA 1P27B 1L3VA 4P74A 2H4YB 3D1QA 5HO4A 4ID8A 4FYWB 3KXDA 1NU4A 1SJ4P 3W9HA 1T94A 3QGPA 1Z2ZA 5E3RA 3D5MA 1RWXB 2YXLA 4DPXA 1HNIB 2HVEA 3KNGA 4I1TA 3QZ8A 1HBUA 5CAAA 2QO3A 3PTWA 3PXGa 1N4LA 4OYPA 3GZ7A 1R89A 4KHMA 3FQLA 3VVTA 1TL1A 3GIMA 1AZSA 1B3TA 1JLBA 2BMBA 1BQNB 2D41A 2MJNA 3C6UB 3POTB 2RD5C 1VISA 4DFKA 1BGXT 4M5MA 2HWTA 1VIXA 2ZDOA 3R2DJ 2M0GB 3IGNA 4YEAA 3J80U 3GV5B 5K9FA 4Q0BA 3VAJA 2E1MC 2YWKA 2UUTA 5A8WB 4X65J 4Y2IA 4OYAA 1QVGR 2CDQA 4JV0A 1XMOJ 1MWYA 1NUEA 2U2FA 2LA4A 2XCAA 2HRTA 4DQPA 1FXDA 1T9UA 4WK1A 2GC8A 3FCVA 3LANA 1VQYA 3DRSA 4ZCMA 2OGUA 4NLSA 3H42A 3NCRA 3JTOA 3CC4S 2ZH4A 3FBBA 5D78A 5D4LA 4ZJOA 2ZHAA 4B3MF 1RT7A 4DCPB 2VFVA 2E5GA 3HCXA 4WP3A 1FKPB 4WU2A 2AJ4A 2W2NP 1U8SA 1QAJA 3TP2A 4LRCA 2KZZA 2BYCA 3KLIA 3DRSB 2ASDA 1PCAA 2QMXA 4NYOA 4F0HA 4QW8A 1BQMB 1UPPA 1YHQS 1XNRF 1YI2S 4WF9Q 1I3OB 3GJSB 3TO8A 4F67A 4M63A 3RW6A 4MIAA 4NLPA 1IKYB 2BXJA 4FZVA 5GADU 4CLTA 3UWTA 4EBEA 4HR2A 3AJ1A 4HLBA 3RBZA 4DSJA 3QIPB 4DJBA 4DU8A 4WTOB 3BDPA 4DL6A 2I9SA 4YB6A 2ZH5A 5HVFA 5L38A 4DZ6A 5KFLA 2HHPA 2P5VA 1WOOA 4YR2A 2XZWA 3W62A 1RTIA 2E5IA 3BF4A 4HH0A 5AXKA 3HK2A 1D3WA 2VDHA 2ZM6J 1ICEB 5HP1A 4ZVEA 1HWUA 1ZA1B 2M52A 3CD5A 4JI7F 2UXBJ 4F4AA 5KFQA 1OQ3A 1JLFA 3U1LA 4I2QA 1HBMB 1Q8LA 3GCXP 2H5JB 5KFWA 1VC0A 3MEDA 1TL1B 2RU3A 2FZGB 5F0UA 1U1KA 4O3NA 1S6QB 2IMOA 2LMIA 5THWA 2HFOA 4ZA1A 4HHJA 2C3MA 2H48B 2Y1LB 4M5NA 2DKOB 4OIXA 3SQOP 2W7PA 2GIRA 4DV6F 3MM7A 2IA6A 2DNHA 3HVWA 3LPEA 2GVZB 1DQ8A 3DC2A 1N36F 2MZ1A 3ISNC 4DL3A 3DHWC 4L72B 5DDQC 1B70B 5B0BA 1OWXA 1SV5A 1TR0A 1Y3JA 4ZIVA 3EGVA 2I5JA 2Z2ZA 4ECWA 1XR5A 2AT1B 1RT1A 2E5LF 2HFSA 3HHDA 2N4CA 4K5SA 1TK8A 1AROP 4HI1A 3US5A 2DNMA 2WB4A 4EO8A 1EHWA 4ZVSB 4M5DA 2MZJA 1UFWA 4USWA 4K4TA 2IBKA 3IFEA 4FDFA 4RW4B 1S76D 5E5NA 4LREA 4RPFA 3ZZUA 5F8MA 3PW5A 3H2LA 4DPOA 4F3MA 3NP5A 2C3PA 3E01B 2CPDA 1RT3B 2AGOA 3MEEA 4OLPA 3KMSA 1NKCA 3EDQB 1E6VB 3K5LA 1N32J 2JSXA 2MKSA 1UEUA 2FD2A 4M5DB 1TTHB 3TA2A 4O3QA 2XBPA 3TJ9A 2QLJB 3CCWA 3FRZA 4R0EA 5MAOA 5LOQA 1NJWA 3DFEA 1N6QB 4LF7J 2CQIA 5KFBA 2VASA 3MMAA 4QIEA 2JC0A 3PO4A 1H73A 1UAWA 4OZJA 2J9EA 2C2EA 3W63A 5D3GA 1SC1B 2JL9A 2QLWA 4NZ6A 3ETMA 1SQGA 3GIRA 3UR3C 4DQSA 7AT1B 5A8KA 1RT7B 1VRTB 2DIUA 2XMWA 3LW5C 2ADCA 1WD6A 4HVZA 2ZE2B 1S7HA 2EFOA 1IKVB 5FLXU 4OHYA 1U09A 1S1XB 3T41A 4R5PA 1T9TA 1Q95G 2NYHA 3PY8A 2IJNA 2L9DA 3KK3A 1M1GA 3F41A 1S9EB 1SBRA 4UUWA 1RE1B 4DX8H 4B9NA 4MIWA 2XLKA 2YWGA 3G86A 2KDOA 1RP5A 1LXJA 2BM1A 2HGMA 4YQWA 3JSMA 2HNYB 3DLHA 3SCKE 4L3KA 1RAGB 3KJVB 3BO4A 3C16B 3PJXA 4LSLA 5HLFB 2FDNA 4IQMA 1NPKA 2IDLA 3ADAC 3MM5B 4HDGA 4OZ3A 3MM8B 3C6TB 5AJ3F 2L08A 2XLJA 2I2YA 4NXMJ 5HROB 2FY8A 2HRYA 3P5TL 4WE1B 3OLBA 5B0DA 5DM6Q 3R3TA 5E3AA 3N5BA 4R0JA 4P72A 1U0HA 4TYBA 2AGPA 2AU0A 6FDRA 2XY7A 1FVSA 3T5HA 1BWVA 2XWYA 2LQ8A 3OJSA 4QBUA 4E98A 2VQEJ 4QWCA 2XNQA 1VR6A 5LL6d 4AXJA 1VQSA 3BR8A 3P8BB 4A8QA 2B51A 1ZZNA 4KO0A 3FSYA 3SFGA 1C2PA 5KFMA 3BSAA 1HBOA 2UXDF 3VVUA 2WBMA 4IDKA 1WF2A 3VR1A 4IH6A 5A0YA 2NUUG 5KT6A 2F4VF 3C15A 2O67A 4IOBA 4BLGA 1RCXB 3IS9A 3NNAA 3TQ1A 2RIJA 4DMZA 3SI8A 5D8HB 3HPOA 4JI3J 2GGPB 1IJEB 1TKZB 2VOPA 3G87A 2EK1A 1U6FA 3W9IA 2FJVA 1F5BA 1R8HA 1UMJA 4IOCQ 2ILZA 3EUNA 3CDWA 3JS9A 3N01A 2IAJA 4J9RA 3ET6B 2YKQA 4UUXA 2LU1A 2CJBA 4DF8A 3RB0A 1SL2A 2NXNA 3AQOA 4Q2LA 1AUDA 2ZHOA 3VQSA 1KSPA 2G2YA 2Y8YA 2AJ0A 1RWWB 1TU0B 3THPA 2W9CA 1WC0A 3I0RB 4AT1B 3A4TA 1RTHB 2UXCJ 4Y00A 2PEHA 4F4ZA 4DV6J 3MR6A 3A1YG 2BW7A 2ZNZA 3OPKA 1JMTA 1WC1A 3Q8RB 2R2RA 3V4MA 4DL5A 4ZOSA 1RTJB 1N56A 4W90B 2FJXA 2CA9A 2FC8A 1CQMA 2YKMA 4DV1J 4IR1A 3SCJE 3TI0A 2OP5A 1I94J 4JI1F 3MMBA 2FPHX 5LMNJ 3BPSP 1BHNA 3MI7X 4P2MA 4ES3A 2E1CA 1FD8A 2E1AA 4F8RA 3FZ2A 3J7ZT 4I7FB 2XY6A 4DN0A 3LALA 5HANA 5LMNF 5EUHA 4B9LA 2EFGA 4NLRA 3FFIB 3M8SA 5F8LA 2B4OA 2V67A 1R8AA 3NBPA 4LFAF 1SPBP 4ZVFA 3GIJA 2WVBA 4OL8A 3PW7A 3DM2B 1I51B 3AHPA 1EETB 3B6BA 4LF7F 2Z30B 4Q7AA 2ZC3A 2R7VA 1VQ4S 4QWEA 2ZWOA 1UPMB 3HHLA 1U4BA 4JI6J 2NSBA 1IBLF 3HJFA 3JYTA 3CE8A 1G7CB 1HHSA 3IS9B 3X1LB 1C1BB 2XULA 2ERRA 1F60B 1VBKA 4DSKA 3CULA 2BE2B 3DXBA 2F5GA 2FZCB 3H25A 5M2UA 4ECRA 3HX9A 1FTRA 1ROFA 1S6OA 4KE5A 1Q1KA 4KO0B 4YB1P 4DR1J 3IG1B 4GC7A 4GVBB 4CLUA 1WEYA 1NRKA 4OX8A 4A8MP 3CDUA 4PZVA 4ES1A 2C2ZB 5FDLB 2CJ9A 3CW2C 2CNOB 4ALZA 1HD1A 2Y1JA 2MZTA 2VBYA 4PXDA 2EVZA 4C0OC 1VYAA 2M8DB 5D4OA 1FRXA 4MH8A 3Q8SB 4WPAA 4F26A 3PG9A 5B0EA 1CULB 4DX6A 5G4DA 3IRWP 5H9FJ 4KHRA 4IFVB 2OD4A 2NZCA 3M8QA 2WONA 4OFZA 4PABA 3PX0A 1SI9A 5D15A 3UDEA 2C2DA 4DSLA 3FRYA 4QU7A 3N6LA 4LRDA 1NCLA 2ROGA 3ZTRA 4B3SJ 4AYBD 3QRPA 4QIFA 2VPZB 3HULA 4QZVB 1Z1ZA 3TAMB 4WFBQ 3LUYA 3GYNA 1RT2A 1XR6A 2QT7A 3NS5A 5L1JA 3M2RB 4NEYA 2IJRA 1RAIB 3MECB 5A8RB 4YY3J 5C5JA 4IH7A 3PW4A 2JFDA 1U6ZA 4CO3A 1QTMA 3PEJA 2IDEA 4X65F 2A2DA 3NBPB 1LWEB 1NSKL 4M94A 5KFRA 1WI8A 3TUZC 3KJFB 3NXZA 3FQKA 3PEHA 4MFBB 4X2BA 4CCHA 5D0RA 2EKNA 4NLDA 3W2WB 3VHQA 2RQCA 1OYDA 4ER8A 1S1TB 4DV0J 2DGUA 4OX6A 1YIJS 3H98A 2V34A 4OZLA 3J81Y 4K0KJ 4X4SA 1RBAA 4CLYA 4DR6J 4KV8B 4DQRA 2KVIA 1Q78A 1HNWF 4WFNQ 1XQIA 1K8AT 1Y00A 2XSJA 2DY9A 4TVAB 1WSRA 5GAGU 4LRBA 4UT4A 2GX8A 5LXYA 4PUOB 4U95A 3NNCA 4IO1A 1TP7A 2GIQA 2HFVA 4M5JA 3BV8A 1WHVA 1HKAA 3H5SA 4KC5A 1KEKA 3GIIA 2G0CA 1S57A 3KG4A 4DV1F 1T9WA 1FJGF 4CIOA 1YZ6A 3ENWA 3HXMA 1YTYA 3LAMA 5K14A 3NWGA 4K50A 4ZDNA 1RADB 4F3OA 1RT4A 1FXLA 3KLEA 4OZNA 4CT9A 2V2KA 5D4PA 3FZBA 1V5IB 3KOAA 4I6AA 2DEJA 1MMNA 4ECQA 2RT3A 4DR4F 5EDWA 1FKAF 2DVIA 4OYIA 3M32B 4RWWA 3C14A 1HI8A 1YBTA 3CT9A 3IWLA 4HTJA 5FDLA 4GC6A 3I0SB 3J7YI 3NNHA 4GKKJ 1MMLA 3NL0A 1RISA 4EWTA 4H4OA 2GQ2A 1KD1T 1J5EJ 4C4WA 2HZAA 1X5SA 1NDPA 2LEAA 3D6FB 2GJFA 3QNWB 5LJ3Y 4NRTA 4YHHF 1RHQB 3SSQA 2HYIB 4EUVA 1JXLA 4GKKF 2PDAA 4OHXA 2VFUA 1R8CA 1J5EF 1HHTP 2P9CA 2DRDA 3U1MA 2Y0SD 4URGA 3HD2A 4IFVA 2KXHA 3RRHA 1WACA 1NK0A 3U27A 4DPYA 3RBEA 2HHTA 5IOLA 5HP1B 3C16A 4LSLB 3W3SA 1SXLA 3H90A 3OFEA 2M5YA 4LF4F 4NA2A 5DDOC 1VK8A 4C3MA 2XS7A 1E6YB 1GNKA 1UWBB 2FJDB 3OBIA 2GCFA 1HLWA 1QAXA 2XMUA 1APSA 4J9UE 1RTDB 3LWMA 3IBCB 3JSBA 3AD8C 3TVZA 2SXLA 4FYDA 5E2QA 3O8WA 3MAAB 4X66F 4KV8A 3MM7B 3ZFVA 3PR4A 3OJUA 4WYLA 1NK7A 3ITHB 5C7PA 4USKA 4FKYA 1N32F 1FDDA 5ETTA 4LF5J 1G1XA 4HEA9 1LQ9A 1NSPA 1HPZA 3J81U 4LMZA 3JQJA 1IR2A 1S4EA 3KK1B 5L1IA 1BMQB 5KT2A 2JJ4D 1OPZA 5HQMA 3HHLB 1NHKL 3K17A 1F2GA 5JJBA 4BWMA 4E8UA 2DBBA 3D1OA 3J7Z5 2JEGA 4PG4A 1R0AB 3BM7A 1U8WA 4UOFA 2UUCF 4DI6A 5HATA 1VQPS 4DHVA 4N41A 2G13A 4DFPA 4N7TA 4CDIA 4DV2F 5DS7A 3MEEB 3SSSA 1NLKL 4AFFA 2V8DA 4BC9A 1IUJA 2C42A 3K58A 3AOAA 2XY5A 4MKBA 1N6QA 1YKWA 4LF9J 4FYXB 5F8NA 2V69A 3CO0P 2KTQA 2IC3B 3CUNA 4RUAA 3TR5A 3PW2A 3TZXA 3MFHA 4KB7A 2HG4A 5DO2A 5CXTA 4Y2CA 2BJ9A 5IV3A 2YX1A 3CWJA 5AE2A 3H59A 5IZHA 2JEFA 4ZIWA 5LMUF 1M1HA 1HBNB 2FZKB 1ZH5A 2XYGB 4BHQA 4WFAQ 3B4MA 1WHYA 4E0DA 5A2QU 1MWQA 4IG0B 1X60A 3W5YA 1G3OA 1NK4A 3CGIA 2JFKA 1R31A 4H4KC 1HMVB 2N7CA 4O0IA 1R8PA 2DNZA 3TAMA 5IFMA 1SH3A 4NA3A 1RTDA 2E9TA 1DY3A 3D6HB 1N33F 2VG5B 1NPRA 2CG8A 1PBUA 4JP8A 5K8MA 2MKCA 1IKWB 4A8WA 2HIYA 2FVRA 3K0JA 3QRQA 1KLNA 2D9OA 3KWMA 2R42A 4PEOA 2V2VA 4S0MA 2ZZMA 3KHGA 3QT5A 4JI2J 2GVDB 3F0NA 3M6VA 1RDRA 4KGVB 2LDYA 2IHR1 2W4CA 4OHWA 3WC0A 4ANDA 2A0FB 3KG1A 2OTJS 2P9EA 2V8HA 2X51A 3HF5A 1WG1A 5L8RC 1HNIA 5KFHA 4K7QA 2BV3A 2OKQA 3IP0A 5BR8F 3MEDB 4JI2F 4OI1A 2Z2YB 3OLAA 1EP4A 3PRDA 4ECZA 2KO1A 1T3OA 3BSCA 4WIQA 3Q23A 3IG1A 4DPTA 1WTFA 4W92B 3W61A 1HA1A 1F5CA 2KN4A 3C15B 5KTQA 5A0YB 1QE1A 4U67Q 1VBXA 3TZYA 3OR1A 1UVMA 5C25A 5U47A 5SZTA 2JC1A 2LYVA 1U1PA 3F56A 4JI5J 2PD1A 1RWOB 4AQYJ 2XMAA 3ZTOA 2D69A 2E7VA 1D9DA 1W7WA 2EG2A 2KXNB 3CCLS 1NK8A 5E7OB 1FX2A 3K5NA 1HWJA 1YX2A 3DLGA 1R0CB 3CJKB 4RNNA 1YZ7A 2W2PP 1OQ6A 1RABB 1VRUA 3TJ8A 1FRMA 3Q24A 2RS2A 1NJZA 2R8HA 4NCBA 2ZITA 4LF4J 3IM8A 2CPZA 3O3LA 1TL7A 4DOZA 2JVOA 4ZLPA 4JI1J 3NMAA 1FKOA 1NDKA 5HQ8A 2B9EA 1RT3A 1SH0A 2QLFB 4HHHA 1FRJA 2L9WA 1UJ6A 1JNRB 2DNYA 2M70A 4PWUA 3GE9A 1IBMF 1D8YA 3SSRA 3HHLD 3MWBA 3W5XA 1XMOF 2KZMA 2BR0A 4KGKA 5B7WA 3E8OA 2J6SA 2PGCA 2CZ9A 5BYSA 3CD0A 4KHPJ 2W01A 3QBCA 4OV6A 3I87A 4DR2J 3HVRA 2FVSA 1BE4A 1RHJB 1RSCA 2LQBA 3GB0A 1WDDA 2IVMA 4WCEQ 2ASYA 3R5GA 1SIZA 3QGIA 3LP2A 1LWCA 5ETLA 3UD5A 4RL1A 1DJ0A 1H0HB 2E44A 4LSNB 4C6AA 1I5OB 2QLBB 3M9MB 2VH7A 4C3LA 1I6JA 5KFAA 4LFCF 1QLNA 1EARA 1RHKB 4DL0C 1CJUA 4Z37A 5C42B 1JNZB 3ENAA 3OL7A 3EMTA 1GMWD 2WOMA 1RWMB 3GYXB 4CYUA 3UDLA 1SKSA 4I6WA 4F4KA 2AGQA 2UUBJ 1AZSB 4KAIA 2EFNA 2QIFA 2HLTA 3KJNB 2BJEA 2QRRA 4J9SA 1ZTTA 3IR7B 2B7BB 5F3TA 1FDAA 5AE3A 4D3HA 4B3RF 2GJIA 3GJRB 5EGYA 1TKXB 2Z4PA 2YKNB 1IKWA 2CJQA 3CCES 2UU9J 2DHGA 1UL3A 2VPWB 3FGVA 2OLWA 3MAHA 2BQ3A 5EWGA 2DNPA 3DCAA 2HVZA 5HAOA 2MSTA 4MKAA 4ILRA 4DWIA 3MD1A 1D8ZA 1WEZA 3M8YA 1RBOB 2KHCA 1TKTA 2EK6A 3HO1A 4I2PB 4WZQA 2J0WA 2ZJPQ 2CPIA 3HJVA 3IA0A 4FPIA 3K5PA 1QUVA 4LT6A 3KK2B 2GIFA 2MB0B 4YUDA 2OJ3A 2B4UA 2VJVA 3R9LA 4CLWA 3KLHB 4H4OB 2B4PA 2OPSB 4DFJA 4XDCA 2OI2A 3CCTA 2D3UA 2PMHA 4G1IA 2FC9A 3KLIB 4DV7F 3BGRA 4DS4A 2QLXA 1ZAVA 1HYSA 4K4UA 1DBDA 3M32A 4O0NA 1C0TA 4C8YA 2Z56B 4P2SA 2YNHB 3CJ0A 2LU2A 3L9ZA 5M2PA 2EEYA 2N3OA 3KLVA 2Y1IA 5EN1A 2YNFB 1F3FA 3MFIA 4B3OB 3DI6B 1RYSA 4OJ3A 3TUPA 3MDFA 2MSSA 2P6TA 1RAEB 1RI7A 1ZAXA 4A8OA 1VBZA 1RCOB 4DPWA 5DM7Q 1NKEA 1TUVA 2NR0A 3CCSS 3GP9A 3OFGA 4ZVGA 5B0CA 2HHSA 4LRAA 5GVQA 1IBCB 1UW9A 2FB0A 4DR3J 1R0BG 3BSOA 1C1CA 2HKEA 1VRTA 2M8HA 2PEBA 1TL7B 2DGSA 3IAM9 3LTOA 3NGKA 4TY9A 4ZP7A 2W9AA 2FJWA 2HVHA 4X64F 1JLQA 4QR1A 1CJVA 2HHHF 4Q8FA 4DBQA 1RT6A 1GMUA 1KHWA 4MFBA 4DL7A 4DR3F 3V6DA 1F5AA 1D9FA 4TY8A 1WUUA 2JX2A 3GFHA 2G1DA 5L9NA 4AL6A 1C4AA 3FSIA 1IWGA 4Q5VA 4N8NA 5FD1A 2G4BA 3DOKA 3L4BC 2J9DA 3W5ZA 3CCMS 1NJYA 3PACA 2EC0A 2ZH2A 3CVKA 2KXFA 5M2RA 2FIUA 2FYXA 4BCAA 4QJVA 4J9QA 2A6OA 5ETMA 2QX0A 3UN5A 1CS4B 4CLZA 1FK9B 3K2YA 3TNVA 3VCDA 1IBKJ 5RUBA 4DN9A 2WSFC 4AD6A 3RGIA 2CDRB 4MJKA 3S1TA 1U2CA 1TKXA 1Y5LB 4Q0BB 4N56A 1CLFA 3EVOA 5HJYA 1IBKF 4DR4J 4J37A 3E51A 3MTJA 2V4QA 3PYFA 1GEHA 2HSEB 2O66A 1FT8A 1RBLA 3HVAA 3N9UC 1CC8A 1MNEA 2BQRA 3FNNA 1EQ0A 4KRWA 2J7KA 4ICLB 4DCOB 1FWLA 1RWKB 2RDDA 5IT4A 2YNHA 5HVGA 4ZJLA 1SC6A 2EPIA 1XNRJ 3ISND 1S1VB 1BUXA 2C2RA 2HQFA 2W8LA 2KB2A 3JTNA 1RKJA 1F0XA 4JV5J 3AFGA 1F9EB 2MKKA 1S0NA 2Z58B 2M2BA 3KYLA 4FF1A 4H4MB 2RMLA 3D0IE 4IRCA 3RUBL 1XERA 2NQPA 3HT0A 4B3MJ 3QT7A 4IO9Q 5K20B 3KHRA 4ZPAA 4LF6J 3RAMA 3BR9A 5J2MB 2GFFA 4TU7A 3THVA 1DQAA 2R7RA 5KFGA 2XS2A 2WAQD 3BBFA 3KLEB 2HHUA 1NNDA 3DGVA 3VAMA 3IMQJ 4LBIA 1LW0B 3C3LA 2R7TA 3V4IB 3UDCA 3VGTA 4EZ9A 3FBFA 4CLPA 2OPRA 4G65A 4WIIA 2V6AA 2BACA 3N0VA 3HFZB 4NYZA 3ILJA 1NAQA 2AYBA 2BDPA 2GZOA 2ZBQA 3KKFA 4W98A 2ALYB 3NCPA 1XJWB 3GU0A 4DV5F 5CHCB 5ETNA 4ZVHA 5B0AA 1B0VA 2J7WA 3GJTB 2LCWA 1X5PA 3UE2A 3G96A 4J9PA 2JWNA 2EW9A 3I9V9 3TZWA 1TK5A 5IM0A 1VQ8S 2WHOA 5KT5A 4DV5J 4PYAA 3ULHA 3DOKB 3BDEA 2N7YA 4E2FB 3I4HX 1D1UA 4KTQA 3EM1A 2AQ4A 5E0OA 2CJKA 4GO5X 3BH6B 2XYHB 2N4DA 4USUA 2E66A 4YR0A 4DV2J 4DUYJ 2HWIA 1RXOB 3GONA 4O3PA 3MUMP 1LV5A 1FEHA 1GT8A 4RO0A 4U8VA 2RHSB 1WDTA 3C66A 3QFHA 1VBYA 1HI0P 3D66A 4R8UB 1PYSB 4WFXA 3C8YA 1CG2A 4FKXA 2CQPA 3TEHB 3LGHA 2V9KA 2ZUGA 1IM4A 1KVKA 2VUGA 4IYQA 4RW9B 4U96A 3H0PA 4ENOA 2BKNA 5KG1A 2YPYA 4OI0A 1C0UB 3AODA 5IXUA 1VDHA 4C3KA 1HNXJ 3IGVA 2AX0A 3A3NB 2VFTA 3CJKA 1U1RA 2B43A 4PPZA 4LFAJ 3H5YA 1LFPA 3T1YF 3N28A 3HHKA 3PDNA 3CJ2A 2KM8C 4LFBJ 4KIAA 3ZXWA 1RGVA 1ZPVA 1R8BA 1XEZA 4MTPA 1HNXF 1PC5A 2ZBIA 1Q8BA 2CNLB 1IBLJ 3M05A 4KJIA 5H9FK 1X8DA 1N48A 2F9JA 2Q66A 4F2RA 1URRA 2X1GA 5KFJA 2CVEA 1IKYA 1MMDA 1Q5YA 3P45B 3I56S 2KRRA 4ID5A 2IYGA 4CH0S 1QAYA 2W4PA 5J1NA 5I3QA 1FE4A 2XO7A 3M9OB 2DRBA 3UPFA 2CJYB 2P2CB 2MKHA 4J9VA 4DEZA 2DRAA 1LW0A 2AV5A 4ILLA 2WSCC 3BKUA 4ECSA 1I1GA 1X0PA 2QGFB 2DR9A 2MQ8A 1JLFB 2F9DA 5J2MA 2BUNA 1Y5NB 2IBOA 4C98A 3Q89A 2NUHA 2BJ1A 2YKPA 1YQHA 4X84A 1JK9B 1F9FA 4ZCKA 4Q8EA 4C8NA 4N47A 4ANCA 2ZD1B 1JLAB 1XC9A 3G8QA 5EX0A 1N54B 2QL5B 5CYJA 1YGYA 4RUHA 5KT4A 3ELHA 2DTJA 5BJRA 4WKRA 3VGUA 3FBEA 4AE5A 3ZNUA 3RG6A 5AT1B 2O3DA 1Q8KA 3BEGB 1IR0A 1SB6A 2PMWA 3CDAA 3CO9A 3OXFA 3GLJA 4WFYA 4TU9A 3RAXA 3KDNA 1LW2B 1S72S 1X4EA 1Y3KA 4DX5A 1XN9A 1Y11A 3VF0B 5DG9A 4X62F 3QJJA 4R25A 2JVRA 4KPCA 3R1HA 2DGXA 1PAEX 5B0FA 4KFBA 2YNIB 4DUZJ 3N5FA 3MZIA 3I31A 2KKHA 1T8EA 2OEJA 3TANA 2YX7A 3CJQA 2IRUA 4HL9A 2QA2A 4NLWA 2F7VA 4JI8F 2MKJA 4QYZJ 3HSDA 4Q43A 4DV3J 4CQ1A 4OI4A 2VQEF 2B9XA 1Q79A 2A18A 2DNQA 3LAKA 4NASA 3U1NA 2UUAF 1WOSA 2ASLA 1T05B 4NEZA 2YQ0A 5D0EA 5IWAJ 3ZZPA 1X4FA 3VAFA 2NZ4A 2PA3A 2RNEA 3OFHA 1EAYC 3PIOQ 2XS5A 1GTEA 1SH2A 2DNLA 2MLYA 4UTGA 4RW6B 2DR7A 1KQKA 2IM0A 3HKWA 5D3GB 2EWHA 4WBFA 2MEWA 4KGMA 5FIIA 4RBVA 1KQFB 4HH1A 5IT0A 4I68A 4ED2A 2RJZA 5KFDA 1K73T 2KG1A 4ZCIA 1UVNA 2J9DE 1ELOA 2JEJA 2MLZA 2R3VA 3WHIA 1FNMA 3T1HJ 4DR6F 1R6YA 3QSYB 1UVLA 3I55S 3AB2B 1A6LA 4N8OA 5IQ6A 2CPYA 4UF4A 3FVYA 3JSYA 5SUHA 6AT1B 3BGLA 3CJSA 3GSDA 1XK8A 5CZVA 3AJ2A 3BZQA 1NH8A 1DTQB 4FVCA 4EBCA 4U8YA 3T1HF 3ZZOA 3M8PB 4RKUC 4DUYF 3PW0A 2UUBF 2MY8A 4OX9J 2HBYB 2RF2B 2E29A 2V63A 1M5VC 3DOMA 4RW8A 1DTTA 3P3DA 2B9WA 1GXUA 5HMXA 3KLFA 4KGXB 4NCAA 4FNHA 2H54B 1ZOTA 2FHJD 3BB5A 2FY1A 4JI4F 5F9NA 4X4NA 3OL6A 2OELA 3M6UA 4DDFA 5IQQA 2RQ4A 4F04B 4Y0FA 4USTA 1Q7LB 1TFYA 1RT5B 1HBNA 1S1WB 3W2VA 7FD1A 2ZWPA 1S1WA 2H5IB 3R5DA 4NI2A 3W2VB 3ZTPA 4ZITA 2VQFF 2A2CA 2BKPA 1H72C 2W7OA 2J9CA 1M5HA 2C2OB 2IM1A 2LDIA 2NXEA 4MYUA 5ETSA 4CT8A 2LKZA 2YVSA 3ZTQA 1FCAA 4OI3A 1ZETA 2DR8A 1M5SA 2GA7A 3OR2A 3BQ0A 3FCHA 4P2XA 4WE1A 2VQFJ 1BD6A 1HD0A 1X4BA 3TEGA 4X4QA 4EYHB 2V0NA 4PCQA 5LXRA 1KN6A 1FEEA 5HVHA 5D4NA 2B6AB 3UD4P 1PYOB 4BS2A 4WJBA 3BN7A 2NS1B 4DR1F 5HBMA 4L6V3 3DMJB 1G4CA 3M2VB 3VAHA 3JAMU 2VHGA 1FNOA 2BE2A 1J27A 1RU2A 3OV7A 3W8GA 1JWWA 4M5GA 1FNXH 1L3UA 2AIRB 4JBCA 2D3OR 5A76A 3V81B 1HNZF 3OSNA 1WKLA 4RNHA 5DZ7A 3PV8A 5GMDA 1WKKA 2EBEA 1WSVA 4OLOA 4EEYA 3OVAA 4LVNP 4Q44A 1T95A 1OY8A 1BLUA 1S79A 3DU5A 2DR6A 1OS5A 1U1LA 2HMIB 2HMIA 4XDDA 2CQGA 2VKZG 4ED0A 1QDUB 1U0SA 2R8KA 1C0TB 1U7LA 1QM9A 3MPWA 1BXNA 3TJAA 1WF1A 1ZM2A 1TV6B 3ETOA 3BQ2A 2HVIA 2KFNA 2W8KA 2HS3A 2OPSA 2XEXA 1FRKA 2XSFA 3WZ0A 2BOPA 1IJFB 4P2FA 2JLFA 5ETVA 2R9LA 5H9EJ 3MECA 5A8RA 3RRGA 3P96A 1U45A 1RWVB 4A4JA 5GMEA 4F3QA 4X62J 1Z2LA 2FHKA 1EKRA 1X4DA 2DCLA 1QVFR 2H1YA 3J7AN 2MGZB 5I3UA 2WVEA 4J91A 3R7NB 1IXKA 2FHMA 4XPEA 3H40A 2YKAA 3EPIA 2RQMA 1H2UX 1QJHA 4BWJA 5L39A 2OHDA 3TZZA 2IRXA 4UW2A 3I32A 4EMDA 2MLXA 2KI2A 5ITHA 2E1PA 4U6PA 3K59A 2VF3A 4WP8A 1T02A 1F6TA 1RACB 1RT5A 2OD6A 3CCRS 3VAKA 2UUAJ 3LO3A 2XNRA 4K4ZA 2D3ZA 2JZ5A 4LF2A 3SV4A 4CWBA 3T5JA 3HLUA 4K0KF 5IT9Y 3TVYA 4TN2A 2ZJRQ 2HZCA 2P9GA 2RUSA 1WC5A 2V68A 2HLUA 2CAJA 2XYPB 4YS2A 2WTFA 3UCUP 4V1Ak 1OY9A 3LP1A 3D0HE 1ULRA 3ISZA 4C8MA 3UR0A 3OSPA 3NOCA 3MR7A 4C0HA 2CZ4A 2OPPA 4A47A 3H2VE 4Y2MA 5AJ3J 1Q86T 4I64A 2VD3A 1S6PA 2JEIA 3L3CA 2QN6B 1HQUA 2YNGA 3DDIA 1X4HA 3DN9A 1YDLA 3D28A 3O6QA 2EFVA 3KK2A 3SFUA 3CD6S 3NMRA 2W2OP 4NZ0A 1P6TA 1C1BA 3HFKA 3PRBA 3M8ZA 4BBYA 1BWEA 3AAWB 5E3CA 1HNWJ 3ZZYA 2CQ2A 5AXMA 1ZYQA 2ZUAA 2UUWA 2AP6A 4CLKA 1WNEA 5MLCV 2VC0A 3M2UA 3NEKA 4O4GA 4DG1A 3PX6A 1VQ9S 3QGHA 5KFKA 1J2VA 2V50A 3GG1A 1HW9A 1ZM3A 5DLGA 4DR5F 3M8QB 4I6YA 1LEOA 5HSPA 2FTRA 5CYMB 2PSZA 2GO9A 2DISA 2B5JB 4HYKA 1SKRA 3DLGB 4I67A 5BR8J 1PO6A 3HD1A 3UW1A 3I0SA 2RKIA 3SQGB 2XCPA 3MR3A 2G9OA 2DHHA 2AJFE 1NK5A 3QATA 3H8YA 4C11B 4WK3A 2ZDPA 4LIWA 5EHHA 3AA9A 2HURA 3NCQA 3M1VB 4CH7A 2KYZA 4XAKA 3BBCA 2F40A 1N34F 2QEXS 3OUYA 1Q7YT 5G0RB 3FC9A 3HKZD 2VKRA 2R2UA 2V2QA 1RT2B 2P8IA 2VV5A 5KFVA 3GWCA 4ECUA 1KBRA 4PWWA 2E5LJ 1WKJA 3ONQA 1HL6A 3BS9A 3LQVA 4ELVA 1CC7A 2CZVC 5G0RA 5GAEI 4KFBB 1MSWD 1LOUA 5F0WA 2HPUA 2HNDB 4LF1A 5K8PA 1LWEA 4LSZB 4LF8J 1EQMA 1FESA 2JDJA 5F41A 3DHXA 4ZLLA 1MU2A 2YBVA 1KTVA 2F63A 2K7KA 1FXRA 3Q8PB 4RNOA 2MQQA 3HI9A 4USIA 2DNNA 2MKYA 1KTQA 5HMYA 2B3TB 1T03A 1HR0J 2RHQB 3PZPA 1KLMB 1EP4B 1VC6A 4X66J 2VA3A 4OZ1A 1FI4A 2BE9B 1UEKA 2K3IA 1TL4A 4QW9A 2UUCJ 4NLGA 1RHMB 2YQ1A 3DRPA 1F1BB 2RAQA 2J76E 2U1AA 2WCXA 3MM9B 4G6VB 4LR9A 4LF5F 3MMCA 4OV1A 3MMCB 2HS0A 1FRIA 5LSRA 1SUQA 3C19A 1B0PA 3MR2A 2MHNA 2PI5A 2VPXB 4LBHA 3FEYB 2AZ3A 5FLXY 1GX5A 2OPPB 4ANEA 4A8KA 1A9NB 2XLIA 2C2KB 1N5SA 2FHOB 4G1PA 5A6WA 3J80Y 4DF4A 1D0EA 2ALZA 1PBAA 3BBBA 2GO8A 2AX1A 3W66A 2ZKTA 1K44A 1B7YB 1RAJA 1Y0HA 3AY0A 4C9DA 3G82A 4ERDA 2OIHA 4OJGA 4WP9A 5LMUJ 3MOJB 3OVBA 4FXDA 4NZ7A 1V6HA 1YBUA 2WRMA 5K5MA 2XZTB 2ZVSA 2LQ9A 4EFAC 5JUMA 2OSRA 4GVBA 1WF0A 2RRNA 1VQ6S 4IG0A 4DZDA 4FS2A 3CMQA 3JQMA 3JAMY 3MM6B 4B9SA 3LGMA 1WORA 2ZH9A 4ECVA 2V8VA 3A8IA 3BKTA 2BJ3A 3BJYA 1NK9A 4CM2A 3GSIA 1JB0C 1Y5IB 2BW2A 4P75A 5I3PA 2CPJA 5GMKa 2LQJA 2ZH8A 3VALA 5E3QA 3MPYA 4D3GA 4YDDB 3LP2B 3J7YU 4MKYA 1R0AA 5DG8A 4LIRA 1OYEA 4DUZF 4C8ZA 2KH9A 2ATLA 1AW0A 2R8IA 2OUGA 2JNJA 3A8EA 4O44A 1OO0B 3C6TA 3DLLQ 4USMA 3N6MA 2VDIA 5CYQA 5C24A 1NDCA 3LGNA 1T03B 2KT2A 2Y0BB 1JJHA 2MQLA 2C2MB 1FE0A 4FXVA 3UVJA 2WW8A 4RU2A 5F8JA 1JIHA 4PAAA 4O44B 1VI7A 2XGPA 3VAIA 3K5OA 4IG3B 4RUBA 1T11A 1MU2B 3EWGA 3G2XA 3MR5A 3C46A 1YRXA 2VBWA 1FDBA 1W26A 4K4SA 3NGTA 2CXEA 2O5DA 3GMGA 2Q3PA 1UP1A 3LWLA 1RKIA 4BC7A 3CCJS 4IRKA 1JLBB 3CB4A 2VIHA 2ZKUA 2UV8A 3CC2S 1YSJA 3F73A 3SV3A 4AQYF 3FEZA 2BX6A 3SCIE 1VFJA 4P52A 5DQHA 4YR3A 1O5JA 4Y28C 2FLOA 1JLCA 1RAHB 2DXFA 1VQOS 4IR9A 3QZ7A 1RWPB 1N34J 3QO9B 5LJ5Y 3ZZRA 3DDKA 1VK3A 3ENQA 3PCOB 2HFNA 5HL7Q 1FJCA 3MMAB 3RU0A 3Q83A 3PRVA 2ZH7A 4J9OA 3KK1A 1REVB 1SC3B 4DCJB 2BJDA 3EGWB 1XMBA 4JI0J 2JRSA 1JLCB 3CMAS 1ZTWA 1LK7A 3UFCX 1FFWB 2KJWA 3MM6A 5KG3A 2CQCA 1SJQA 2DO4A 4O4GB 2HQIA 4DG1B 3CMES 2MQMA 4TKTA 3MXHP 2WONB 3I4PA 4M8LA 4UOGA 1RTHA 4JI0F 4EGLA 1KOHA 2A6MA 4GO7X 2DGTA 1CEZA 1C4CA 2UVUA 2EBGA 2WZ1A 2WK4A 3CCZA 3FDSA 1RA6A 4RBUA 1HWIA 4WXWA 4A8XA 4Q45A 2GHVC 1K1QA 2VFRA 1XR7A 3AOBA 5HI7A 2DGOA 1JLEA 1OJ4A 2DD8S 3IXQA 1SJ3P 1RB0A 3GYGA 4C97A 1T3NA 1VLOA 1DTTB 2CVIA 1AB8A 1MN9A 3DOMB 2KM8B 3KK3B 4ZKAA 3MTKA 5H1SV 2OMLA 3QMQA 3ILIA 2I38A 2HGNA 3CJRA 4JI6F 4F0MA 4KHPF 4OHVA 3R5JB 4ES2A 3JSMB 4USJC 1CJUB 5ETPA 2Q6BA 1S6QA 1IR1A 4RW8B 2JH3A
chains in the Genus database with same CATH topology
4LF6F 4DL4A 2V4JB 3SDEA 1P9QC 3MM5A 5HLFA 1Q4RA 1U1MA 4WTYA 3EGZA 3LPYA 2XMKA 3IRXA 5J1EA 3OL8A 1KR4A 2CPHA 4Y2KA 2IYIA 2ZHBA 3S01A 3H4DA 5C42A 3SZ2A 3RZAA 1AXQA 3FJ2A 2RVJA 3IC1A 2RDJA 4KPYA 3SMZA 4TQRA 3KHLA 4NXNF 3TAPA 4NLOA 4B9UA 2C3YA 4RW4A 4ZPCA 1JJ2R 3WDOA 4OQJA 2HRUA 3PVXA 2RU9A 4FNIA 4IFYA 3VAGA 2UU9F 3TA0A 3P49B 2A3JA 5T14A 1OSCA 1E6VA 3TAQA 2B4VA 5HBMB 2FLNA 2GHWA 4FF3A 2AWZA 1IQTA 2QSWA 3OL9A 2DGQA 2JOQA 3GR0A 5JVGQ 2LVWA 5CYMA 4ZPTR 1NKBA 2PFFB 3K8WA 4PXBA 4IDKB 1X7VA 3GFYA 1RA7A 5KOWA 1QE1B 4YY3F 3J7A1 1UW4A 1TVRB 3KNAA 4RX6A 4EYIB 4CO5A 4LUBA 4K4WA 1URNA 1XTZA 1ZBTA 2RF2A 3M9NB 4PWDA 2RH3A 1WELA 3CJ4A 3LP0B 2JLGA 1YJ9S 4KR0B 4LJMA 4URQU 1X4GA 3GQCA 3DGPA 1S6UA 1YJWS 3ENVA 2VG6B 5DLFA 3I0RA 4ED8A 4MK7A 4QWBA 2DIVA 2M4MA 2X3GA 5GAHU 5K8OA 2WOMB 5HN0A 1HWKA 2Z0GA 5D77A 1J5OB 1WEXA 3OR2B 5ADZA 2IA6A 1DHMA 5DRKA 4HDHA 1RTIB 2PN6A 2QE5A 3IWXA 1RJJA 2V8GA 3PKMA 4P6QA 3VZIA 3KMQA 1L3KA 5CZXA 4H4KA 1FD2A 2YWEA 2PMZD 3S8SA 1SL1A 1KFDA 4F4WA 4ZPBA 2RDIA 4QPTA 4ZMMA 1T7PA 1X9MA 3DDNA 2XI3A 3S6EA 2F1FA 4UY8T 1U1OA 4RW7A 1N88A 1TKTB 3TUJC 4XPCA 1U47A 2HIQA 4WFZA 2C22A 1N5YA 2LXUA 4E0DA 3QPIA 3MM8A 4Y34A 3NKYA 2DITA 3OTDA 3EZ5A 4LQ3A 1S1VA 3RYLA 4QPXA 3TARA 3DOLA 2HS4A 1PSDA 2HAIA 3T5KA 2UVVA 4ELUA 4ICLA 2OFHX 2L41A 3G6XA 3DRXA 3RRKA 3JYTB 1GH8A 1Y9OA 4NRUA 4PUOA 2FJAB 1QAIA 1IKXB 4ECTA 3CCUS 4C8OA 1IKXA 2HWHA 4JOUA 1H2TZ 3SXLA 5KFYA 3EZUA 2IC3A 4U7CA 4TQSA 4IFYB 3QIPA 3ZZZA 1FF2A 5IS2A 1X9SA 1QY7A 1YRTA 1M5KC 3N6NA 3LP0A 2UVRA 5DQIA 1IQZA 3KLGB 1JKHB 1P1TA 3OUYB 2DH7A 2GQQA 1YG0A 2GGPA 3T9NA 1ZZFA 2MZRA 4RNMA 4C11A 2VG7B 2V94A 4LF8F 1RWUA 1Y7PA 3W7BA 2CPFA 1FERA 5KG6A 4X4OA 3H5XA 2UXBF 3AA8A 2YY3A 2W7AA 1HI1A 5B09A 4OHZA 5IM0B 3GV7B 2QA4G 3GG0A 1MROB 5HMZA 2RE1A 1W2IA 4UY85 3MPVA 2KRBA 3V6DB 1S9GA 2GJ2A 3I5CA 2W4DA 2X1FA 1U24A 1N5QA 2W25A 1BC6A 1Q53A 1DFDA 4USHA 3OQ2A 2V4RA 4J5OA 3N79A 2N82B 3G4SS 2MKIA 2YWHA 3PX4A 4URSA 1X9WA 3HP6A 1UVIA 3QLHB 5KG4A 1KQGB 4QR2A 1M0SA 1V3ZA 1HNVA 4EU0A 3HHNB 1YRUA 1I94F 3Q22A 4J9NA 3MGJA 1GQEA 4RW9A 2DK2A 3MHYA 2BM0A 3NG8A 4OX7A 3F44A 2MJUA 1NEEA 3LP1B 1SJRA 5KT3A 2OTLS 4WZMA 4WYWA 1EETA 4K59A 3JB9k 2FHJA 4F50A 4WU3A 3OTOF 2R2TA 1VLYA 1N8RT 2NLWA 1X5TA 2XHWA 1M5PC 2R7SA 2ZNYA 3BN4A 2FUG9 2DHAA 2Q6CA 3GFZA 4ZPDA 2HNZA 3PO5A 2AW0A 2ILYA 3GIKA 4X4UA 2GQCA 4K4XA 2R8GA 4NOHA 2IFXA 3T3FA 3VTIA 1S0MA 2D74B 2DNGA 4B17A 5JXSA 2OPQA 2Q1LA 3CIMA 3TX8A 5B08A 2ZH6A 2UVWA 3IWNC 4LFBF 3K8VA 3H5UA 4ZHRA 1TVRA 2IJFA 3DU6A 3MEGB 4OZ0A 5E3PA 1FTCA 1WG4A 2AYMA 3KTQA 4HKQA 4IRDA 1Q16B 2L3MA 2XMJA 2PO4A 3OTBA 4WKYA 2DHXA 3KHHA 2XMVA 3QIDA 5CCMA 4J9LA 2RKIB 3SQGA 1B0TA 4NCGA 4CO4A 3QAUA 3DLKA 1OSDA 3V6JA 2RS8A 4FXWA 1RTJA 1LW2A 1JLQB 2EKYA 2F8EX 2V4JA 1KOOA 2OMOA 3I82A 4UQTA 4F25A 5GADI 2N3LA 4ED3A 2YH1A 3W2WA 4KBIA 3WC2A 2FLLA 1U6BA 2H9ZA 1S9FA 4I4BA 1BQNA 3POTA 2CG4A 5DDPC 3TVKA 4DLEA 4FF2A 5KFXA 3HZGA 5A8WA 3M2VA 1E6YA 3PFEA 3G8TA 4Y6IA 4X4VA 1SV5B 2C3OA 2LEPA 2WB1D 3C6UA 2KU7A 2W9BB 4YP3A 1HNVB 2CQBA 1VC5A 1TFWA 1KC8T 1UVKA 2HHQA 2M9KA 3G6ES 1YWXA 3RB3A 5CA5A 4U7UK 3FMWA 3M6XA 1DAXA 2GNKA 5J2NB 7FDRA 1ZPWX 4P7TA 2E5HA 1R3NA 2R2SA 4ED7A 4DV3F 1NK6A 2K8GA 3IR6B 1A7GE 1H98A 2CQ3A 2MQPA 1BQMA 2KJVA 5T7LB 2XMTA 4RWXA 2J0SD 2YH0A 2Y1RI 3QO9A 5LT5A 4YMEA 2BQUA 4ZK7M 2D1CA 4NLTA 2Z2LA 3T9ZA 3E2EA 2BRKA 1FVQA 2KFYA 2ACYA 1FJ7A 3FEXB 4IOAQ 2DNOA 3CDBA 5I42B 4NLXA 3WX4A 3M30A 5KFUA 4FVMA 4JV5F 1KS2A 2CQDA 2CPEA 3M8PA 4Y2AA 4RNFA 2VG6A 1YVFA 2ZC4A 4KT0C 4LVOP 2LQ5A 2ZE2A 2HNYA 3X3UA 2DNRA 1VQLS 5EWEA 3I9ZA 4QIVA 2VG5A 2F3JA 2VG7A 2VPYB 1U49A 3G9CA 1R43A 2GHPA 3U7JA 4C7QA 4OX9F 5J2QB 4K4UA 2DHSA 4JYAF 4ZPVR 3OHAA 5CYQB 1GTHA 1WTBA 3QYYA 2J7UA 4NCGB 2R7WA 4XK8C 1IKVA 2X1BA 2VOOA 1VQKS 4FBUA 1WG5A 3UCZP 1XWLA 4NLQA 2MPUA 4ZPWR 3ITHA 3HHLC 2AD9A 4LSNA 3MAQA 3H2UB 4RLEA 1LK5A 1HFEL 2ABYA 5C24B 1M1KT 2VL1A 1UFLA 3DLKB 3EGNA 1O51A 4YDXA 1B64A 1PC4A 1HPZB 4JUZA 4PG6A 5E33A 1SJFA 2CFXA 3OTEA 3V2UC 3CJ5A 3OHBA 3TW0A 4CO1A 3ICLA 2LXFA 1L5UA 4OJHA 3DYAA 1TKDA 4YB5A 2GMLA 5KAKA 4WXOA 3DRYA 5C25B 4A48A 1VRUB 2J0QD 4B3TF 2RB7A 3UNGC 3BGFA 4CTAB 1S0VA 1VQ7S 2I5JB 1TKZA 1KHVA 2ASJA 5KG7A 2RUGA 5I42A 2FJBB 1P1LA 2XG8A 1HR0F 3O44A 3BGUA 5CCLA 1TL3B 3NGDA 1U26A 3DI6A 2J0XA 4B3SF 3OVSA 2VFSA 3H4BA 4RUCA 4C2MA 1VHFA 2ZOMA 3TYTA 1GXTA 2FVCA 4ITSA 4CNYA 5DDRC 1WHWA 1FJEB 3L09A 2LA6A 3HVTA 2CRLA 1YJUA 1DTQA 5LSOA 1CVJA 1DZ5A 3CJ3A 1LFWA 4B9TA 5GAHI 4K5RA 2HHXA 1JLEB 1FKOB 3AB4B 3B78A 3QWUA 1N5TA 4MAKA 4QCLA 4PWDB 1VIOA 4QQBA 3TRGA 3ZZ0A 4A8SA 1K0VA 1DQ9A 2DCUB 2M3DA 3I6PA 1S4FA 4OJ1A 4PKDB 3THTA 3TOQA 4DV0F 1SKWA 1VS3A 1N0UA 2NYIA 1Z4UA 3AQPA 2DPJA 4O4RA 5AXNA 1S9EA 4ED5A 1TAUA 2QA4S 2XSJB 2RRAA 1HMVA 2ZJQQ 2LECA 2K1RA 2D9PA 3EPGA 4PQUA 1CQNA 3LF0A 4R8UA 1HWLA 5J1PA 4RW7B 3FMBA 4N76A 1N52B 1R27B 4KKOB 4LQ9A 4NMLA 2MXYA 2YNIA 1RT4B 2D7SA 2M7SA 2Z8QA 4PR6A 2K7JA 3R5CA 3O1LA 1JXEA 2XGQA 4OZ5A 3IO1A 2MDAA 4ZS6A 3WBZA 3V6HA 3RB6A 3OFFA 4DSFA 2AJQA 4NLUA 5CQGA 4TLQA 3DMJA 3D1HA 2J6UA 4NPOA 4OI2A 4J9MA 3R5AA 1RQ0A 2OAUA 1VGYA 3GFXA 2PE8A 2MMYA 3M8RA 2CJAA 4XIUA 4RU9A 1FHTA 1FRHA 1U1NA 3RR7A 1X4AA 4N77A 2RQKA 3PJWA 1VQ5S 1L3SA 1YITS 4DLGA 2DR5A 4QYRA 2BANA 2F8HA 3V4IA 3BGRB 1HYSB 1HARA 2IVFB 2EI5A 3NS6A 1LKZA 2ZFHA 2BBEA 1DLOB 2ZH1A 1X0FA 1CSJA 1YJVA 4EZ6A 3RBDA 2QYCA 5KFSA 1V3RA 1WI6A 2EG1A 3DRRB 1YJTA 4Y3CA 5CD4H 1KNZA 2VBZA 4NWBA 3HDSA 3TA1A 2A1BA 1S1UA 2AF6A 4F02A 1HBMA 2V5HG 2KYXA 5J2QA 4TY8B 3S7RA 3T6JA 2DJWA 5I4MA 3GILA 5JVHQ 3NAHA 4G3IA 4JV2A 1RYRA 2B7CB 3AH6A 3DM2A 4DQIA 2KT3A 4MYTA 1U48A 3T6BA 2UP1A 3D54A 5L1LA 3CCQS 3Q2TC 3NAIA 3CEDA 2HGLA 2FJEB 2ROPA 4IQXA 4V19J 3SEOA 5E41A 4GMKA 3O5TB 2IRYA 4IUFA 1P8GA 2OO4A 4L3NA 3PFOA 4B9VA 4QU6A 3HMJG 4O3RA 3MM9A 2CPXA 3NRBA 2FGCA 3BO3A 5T7LA 4QWDA 4K4VA 5AXLA 2XI2A 1H6KX 2FVPA 2GV1A 1L3TA 1NZAA 4LF9F 2NREA 3EXCX 1N5VA 4F2SA 1K1SA 2DH8A 1DRZA 1UVJA 3M2UB 2VODA 1DURA 2DGVA 4ZHRB 1TK0A 3M6WA 4C0BA 3DLEA 3DLEB 3MEGA 4PXCA 2KG0A 4ILMA 3ZC4A 1KVJA 4NX9A 2RILA 1V9OA 4Z2XA 2R7QA 2AYGA 2ZBCA 1KONA 2KT5A 3BO2A 2OPQB 1TAQA 1GX6A 2QSFA 1JX4A 1KRPA 2VA2A 1UA0A 1U2RA 3MF5A 2HNZB 4NXMF 1C1CB 3PNIA 2E5JA 2WBRA 2W9CB 1S1XA 1JLAA 2VC1A 3M2RA 4JV1A 2DNKA 4ATNA 4YOEA 5FJ4A 2R4FA 3IBWA 3L7OA 2IA0A 3FSXA 3M1VA 1LWFB 3UCGA 4CI0B 3MUTP 2MQNA 2Z2MA 1TQLA 1VQNS 4B3OA 1TL5A 4NYPA 4EO6A 4CO0A 1M90T 2ROEA 1NB7A 4FPRA 4J9KA 1G6BA 1KFSA 1K0TA 5DETA 2IMWP 5KG0A 1R7IA 4HI2A 1DLOA 5DGAA 4B08A 2HHVA 3CDEA 4CH1A 3H20A 2HW3A 4A8FA 3QLHA 4CNZA 2GW8A 1U25A 2L9NA 1UEVA 3NLCA 4MK9A 5IWAF 4QWAA 4DL2A 2E9RX 4HT7A 2BRLA 2NSCA 1S1UB 2ZOFA 5KFIA 1FDNA 1HQEA 2F8MA 1MW7A 4N5SA 2DT9A 1SUQB 1S0OA 5LSLA 2DGWA 2XWXA 4PQAA 2MQOA 4IG3A 1Q81T 4JI5F 3K57A 4X4PA 1S6PB 4O3OA 4RZRA 4DV4F 1G2EA 3PM9A 4QIWD 2R7XA 1FK9A 3ZZTA 4KSEB 3G71S 4CO2A 2VBXA 1XNQF 2AJ1A 3HHEA 1CPZA 4X4RA 3T1AA 2ZOGA 2O1PA 1PILA 1V3SA 1QSSA 2IM2A 3DRPB 4HTIA 2RRBA 1HQUB 2YNGB 3HVTB 1DARA 1TV6A 1W25A 4Y65A 5T41A 2ADBA 4UQGA 4YFUA 2QZ8A 2YWFA 3HT3A 1VQMS 2I8EA 3QAEA 2IVYA 3LOUA 1YJNS 2A10A 4OI6A 2CYYA 1FO1A 2CQ1A 4RW6A