2GV1A

Nmr solution structure of the acylphosphatase from eschaerichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the acylphosphatase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
total genus 15
structure length 92
sequence length 92
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2gv1A00
2BUNA 2K1RB 1QUPA 2K2PA 5K9FA 2IYGA 2ASYA 1VQSA 1S6OA 2GA7A 2GCFA 3HHLD 3LGMA 1RJJA 1YJVA 1YJRA 2ROEA 3QGPA 2AJ1A 3BF4A 3DCAA 1X8DA 1YJUA 4HI2A 2K7KA 3UDCA 1CC7A 2OFGX 5A6PA 4ZOSA 2HFOA 1N5SA 5A6WA 4HH0A 2JDJA 2K1RA 3TOQA 4OJHA 4Q2MA 3BB5A 1W2IA 2OFHX 2K7JA 2XMUA 3FMBA 2EW9A 4A47A 2LQBA 2ROPA 3HFKA 2IFXA 3HHLA 2RU9A 4ZA1A 2VV5A 1KVJA 1Y0HA 2KYZA 2AW0A 5T7LB 2QLWA 1FESA 3GZ7A 3HHLC 1GXTA 2ZDOA 1P6TA 2AP6A 1IUJA 1TR0A 1OQ6A 2CRLA 2G9OA 3BDEA 3T9NA 5B09A 3QMQA 1KVIA 1K0VA 4DPOA 3BGUA 1N5QA 3HDSA 2XMKA 1ULRA 4A46A 1URRA 1FEEA 1X7VA 1CC8A 1MWZA 2W4DA 2OKQA 2QIFA 5B08A 2FTRA 2IYIA 4A48A 1AFJA 1TL4A 2QYCA 4HL9A 4FNHA 1Q8BA 3KG0A 1FD8A 2VH7A 2LDIA 3HHLB 1TZ0A 2BJDA 3IWLA 5B0GA 1SB6A 1LQ9A 2HFNA 2RSQA 3FGVA 2XMWA 2HLTA 2N4DA 3VTIA 2GO8A 1N5TA 3BN7A 3E8OA 3WDOA 3MCSA 1P8GA 2BBEA 2HLUA 1YRXA 5B0FA 2HIQA 1Y3JA 3KG1A 2Q3PA 1FVSA 3HX9A 2GV1A 1GXUA 5B0BA 1OPZA 2KT3A 1WD6A 2XMVA 4Y2MA 1Y3KA 1VQYA 4HI1A 2PGCA 4DN9A 1SQEA 3HF5A 1U7LA 5B0EA 5B0CA 1YG0A 3K7RA 4DL0C 3IWXA 3DXSX 1N5VA 4OJ3A 3BM7A 4HH1A 2BYCA 1AFIA 4OJ1A 2GGPB 3CJKA 2HQIA 2W4CA 1FVQA 1AW0A 2L3MA 2GFFA 2ACYA 2N7YA 2RMLA 2BJEA 2LQ9A 3TRGA 4NL5A 5F0WA 2AJ0A 1Q53A 2N4CA 1OSDA 2RILA 2XMJA 3LO3A 4FNIA 4NPOA 4EFAC 4A4JA 4F67A 1Q4RA 1KQKA 1X0PA 4QOTA 5KAKA 2ROGA 2FIUA 1TL5A 2KT2A 3FRYA 5IXUA 1Q8LA 1FE0A 3F44A 3MZIA 4Y2IA 4Y2KA 1XBWA 2OP5A 1MWYA 1Y9OA 1FE4A 2LXFA 2OMOA 2OD4A 5B0AA 4Q2LA 3BR8A 5F0UA 1JK9B 1TUVA 3LGNA 1OQ3A 3KKFA 2W4PA 1JWWA 4YDXA 4OJGA 2FHMA 2QLXA 4YEAA 2KKHA 2OD6A 3KNGA 2OAUA 3TNVA 1APSA 1YJTA 2ZDPA 1S6UA 1V3ZA 1R6YA 1SI9A 2FB0A 2GGPA 2PD1A 5T7LA 3CJKB 5B0DA 1CPZA 3I9ZA 4OIXA 2XMMA 2XMTA 4U9RA
chains in the Genus database with same CATH superfamily
2ZBIA 1TL3B 3ILOA 3SCLE 1RTJA 4QYZJ 4A8YA 3E2EA 1F2HA 3G6ES 3VHQA 5HVHA 5KT7A 1L3SA 1OYDA 2AYGA 2RF2B 1Y4ZB 1RYRA 4RUCA 1BC6A 2DPIA 2HMIB 2OEKA 4ZJQA 1ZM2A 3QJLA 3HHLD 4FBUA 4IG3A 4OHWA 5AXNA 1W2BR 1SUQA 4JI6J 5HO4A 1ZM9A 2KHDA 2GVDA 1FTCA 1WF2A 4C98A 5ETPA 1MROA 5I4MA 2RS2A 4WTYA 1Q82T 4CLUA 1QJHA 3V5RA 1S6QA 1N5YB 2H54B 3EPGA 4ZOSA 3G82A 5AXMA 1N6QA 1H2TZ 2FVQA 2HK2A 5IC4B 2EFPA 3BYRA 5HI7A 3F41A 3GLJA 2B0GA 2CIMA 3CDBA 2JC1A 3OFFA 4B9MA 5GAEI 1HMVA 2AGQA 4USWA 5SUHA 4YB6A 4DV0F 1RT4A 2RU3A 3R1HA 2IFXA 2HNYB 4OLPA 4AXJA 2VV5A 3TX0A 2IIHA 3UN2A 2UXCJ 4PUOA 2E44A 2Y1RI 3I0RB 4EO8A 1N54B 5HQ8A 3P8BB 2HKEA 1MG7A 1TV6B 5D6GA 3MR5A 3GQCA 2LDYA 3A4TA 5JXSA 1D1UA 3OR1A 4DU7A 5K20B 1UAWA 3M7VA 5THWA 1VQMS 2VG7B 4CLKA 2X7IA 3CMAS 1SL1A 1HFEL 5BYSA 4O3PA 1NDLA 2VG7A 3HDSA 1MLAA 4R0JA 2XMAA 5CZXA 2HQ3A 2H48B 1ZAXA 4PQUB 2GVZB 1RQ0A 2I6WA 3SIPB 1SKRA 3GFXA 4ETXA 1KD1T 4ZS6A 2OGUA 4LSZB 4K4XA 3UD3P 4RNOA 2BJDA 1J27A 3GIMA 4K4TA 2MJNA 1SV5B 5KT6A 3IGNA 5KFFA 3HCXA 1C2PA 4IG0B 3FGVA 4DR4F 3NS7B 1S48A 4A8SA 3MEGB 3AT1B 4Y00A 8ATCB 5E41A 4NI2B 5ETNA 1HWJA 2RE1A 4CT9A 2OHDA 3OHAA 3H40A 3M9NB 4ZVSB 2YKPA 4ER8A 5LSOA 1D8YA 4K4ZA 2W2PP 4WU2A 1VRUB 4RL1A 2AEFA 3UNYA 2VONA 3T1HF 1R7IA 8AT1B 4LF5F 1U7LA 3A12A 3HVTB 1S1UA 1JMTA 4USJC 2HHSA 1U26A 5KG4A 1RT4B 4OJ1A 4F4YA 3OW2R 1FRHA 3BBBA 2VL1A 5D0HA 4NLWA 3K58A 4FS1A 1PILA 1EKRA 1WC5A 2CQPA 2RILA 2NXUA 2HBYB 5H1SV 3ZC4A 4CTAB 3G82B 3DRYA 3C6TA 4ED0A 2H51B 2O01C 8RUCA 4BDPA 1S6QB 1ZTWA 3TJ8A 5MLCV 3HLUA 3FRZA 3FZBA 4CH0S 1WKJA 2C22A 1HLWA 1RB0A 5DDQC 1F9FA 2JX2A 3TA1A 4P72A 1GTHA 2OD4A 1TKZB 2KG1A 1NDPA 4LF9F 1UETA 1KHVA 2F5GA 3DN9A 4RW4B 4ZDNA 3LPEA 3M8ZA 4CLLA 1VQ8S 2OD6A 1APSA 2GO9A 5HJXA 3BH7B 3R3TA 3UFCX 1SIWB 1RTJB 4TU9A 1RWOB 2QSWA 3CCWA 1F0XA 2I9SA 4ZN3A 2Y9HA 1GEHA 2ZC3A 2RIJA 3AHPA 3IG1B 1EKSA 2ABYA 2EKNA 3R8YA 1H2UX 3M2RA 3RAQA 3AXKA 2IJNA 4DL4A 5DLFA 4RU9A 1RISA 3NG8A 1NHKL 1RT5B 2QLBB 3O6QA 5LMNF 1I94J 4WFYA 1SH0A 4FDFA 3RBXA 3ISZA 4QZVB 2MQPA 4DQRA 1J5EF 3RW6A 1K9MT 1S77D 4FPRA 2BMBA 4LSLB 1RT6B 2IAJA 2ZKTA 2P8IA 2YKOA 5I3PA 1LW2B 2QE5A 4FYDA 2HBQB 4ECWA 3Q8QB 1FA0A 3T5JA 1RWVB 5EUHA 4QCLA 1IVZA 3TAMA 3GSDA 4KB7A 1RTHB 1Q5VA 1X4EA 3HKZD 3BYPA 3DLEB 3PHEA 4AXIA 4Q43A 3C14A 4Q2MA 1JLCA 1N52B 1H38A 2R8KA 1B0TA 2A2CA 3OR2B 3DLBA 2YNFB 2YNIA 1FTRA 1C4CA 2C1EB 2DR9A 4B9NA 1QD1A 2B43A 2OPSB 2RHQB 3HFKA 4F26A 3VAHA 2CYYA 2VUGA 3NCQA 2R8GA 2G2ZA 1N48A 2YWKA 3KHGA 2O3DA 4IO9Q 1T9VA 1TUWA 1OQ6A 2G9OA 1KEKA 2CUYA 5DGAA 4PRFA 3C16B 5H9EK 3DRRA 2OTLS 4PG8A 5E0OA 1O8BA 4J5OA 2QX0A 5IFMA 2AD9A 4NXMF 1NKCA 1RU2A 2FJAB 2EXUA 2BJ3A 1S1VA 3CD5A 3NGRA 2V8HA 4O23A 4OZLA 3GFHA 3UW1A 4CP5A 3TZYA 5DDPC 1X9WA 1BWEA 3CWJA 2DR5A 3DRXA 4A8OA 3IM8A 1RT2A 2CQBA 2XMWA 3K5PA 2DGUA 4P7TA 4Y65A 3T6JA 2G0JA 3U1MA 1SJ3P 2NCKL 4WFZA 4YY3J 1H73A 4QPXA 3CJTA 1RK8A 1KONA 4FPIA 1HWUA 5DGBA 4BCAA 3MPWA 4OYZA 3DLGA 4MYTA 2E1AA 3FFIA 1F5CA 1Q8KA 3OUYA 1WWHA 3KJVA 1QAJA 1FJGJ 1RYSA 2JNJA 4Q8EA 2C2KB 3G9CA 3B54A 3AD7C 1R8PA 1U1NA 3V4IB 1YG0A 1VRUA 5GADU 4N76A 1TKDA 2CVEA 2VPYB 5E3PA 3OQ2A 1JLBA 1R3NA 3FC9A 3KLGA 4O44B 1GMVA 4OI3A 2AIRB 2XO7A 1VQKS 2ILYA 5KFRA 5C42A 3NMAA 4X4UA 4HHUA 4DUYJ 1BGXT 2YQ3A 3C16A 3PR4A 2J7KA 4G1PA 3H4DA 1QVGR 4LJMA 2Y8WA 2YKQA 2ALZA 2P9GA 3I87A 5IXUA 1M1GA 1OSDA 4G1QA 1FJCA 2WVBA 1ZPWX 4EFAC 3W62A 5JMNA 2AX0A 4QQBA 1HNXJ 3IGVA 2CXEA 4GVBA 2HQCA 4ZP9A 2BANB 5J2QA 1RHUB 2EKYA 1HQEB 2UZAA 2HGLA 3BJYA 3LAKA 2GVZA 2YNIB 4LF8F 1J2VA 1CJVA 1WC1A 3OR2A 5KFGA 2X1AA 1CJUB 1GT8A 1Q78A 1UA0A 4BC9A 2JL9A 2CG4A 5B0AA 2VFRA 3GMGA 5L1JA 4NXMJ 3E01A 3RAXA 3CMQA 3D5MA 5B7WA 2QLXA 4KGMA 4NZ6A 2CADA 2CQCA 1R8AA 3EM1A 3PJWA 3ZXWA 4G65A 3DOLB 5KG7A 1RT6A 2IAJB 1UZDA 5I42A 1LWFB 2XWYA 5IQ6A 3A3PB 1IM6A 3I9ZA 2XMMA 1MW7A 4GO5X 3J7A1 3TZWA 4E98A 5IM0A 2F4VJ 3NY0A 3TEGA 4UOCA 3MCMA 3EZOA 2BUNA 1FKOB 3NCPA 3P96A 4OYOA 4QWDA 5KT2A 1EETA 3D54A 4ID8A 3AXMA 2GMHA 5KG1A 4UUXA 4C0HA 2E29A 4QU7A 3M2RB 1XNQJ 3EMTA 2ZH9A 2HURA 1ZM3A 1IKYB 2B5JA 2GCFA 5FIIA 1PYOB 4RW9A 2GJIA 2MTLA 5BJRA 1N5YA 1HI0P 5J2MA 2NR0A 1YJRA 3CCMS 3N9UC 4DR6F 3VGVA 1IBKF 2JWNA 1NPPA 1RWKB 4ZVFA 2ZH8A 3S8SA 5CCLA 3F73A 1FWLA 1HQ2A 4OI1A 1H74A 2L48A 2N3OA 2ZJQQ 4A8KA 3W60A 2V63A 1HBNA 4RW4A 4ECSA 2J6TA 2JVRA 1RI7A 1R0AB 1U1QA 4OV6A 4C9DA 4M5JA 2G2OA 4X84A 5E3CA 3UR3C 3I82A 3N5FA 3HPOA 2EC0A 1L3KA 4LBHA 3M32B 4J9KA 5IT9U 3R6LB 4ICLB 1B64A 3H7HB 2E1MC 4ED7A 2JLFA 1IKYA 2B5JB 3D68A 1RT3B 2LMIA 5J1EB 1G4CA 5HMZA 2G13A 4Z7CA 3M8QB 1U2RA 3Q23A 2YWHA 1WC4A 3TA0A 1FWKA 4UOHA 4WFNQ 3GYXB 4XPCA 4DN0A 3W64A 3VQTA 5HBMA 3LP2B 3DKDA 1NUEA 2HHHF 4DSIA 5J2PA 2EK1A 3MM5B 4O3QA 3SFGA 1NKBA 2HHWA 2CDQA 1REVB 4Q0BB 2GNKA 4D3GA 2VB6A 2FVCA 1S1UB 3JAMU 3PYGA 2LDIA 4I68A 1KS2A 5DZ6A 4ILRA 5ETRA 4MIWA 4NZ7A 4DX8H 3BEGB 2V9WA 3NMRA 2MKYA 3HSZA 4LRAA 4RW9B 1MMNA 2W9CA 3IR5B 5D0EA 5KT5A 4JI7J 3PX0A 3AQOA 3CDAA 4MIBA 4NLPA 4ED1A 2VD3A 2BRKA 4KGKA 3HHKA 2HIQA 3DU6A 1TUGB 2J9CA 1FVSA 4PYAA 4ZP6A 3IWNC 3B78A 1P1LA 4Q44A 3U1NA 4JI1F 2DHGA 3J7YU 1J5OB 3PIPQ 3PRDA 2BA9A 4M8LA 2OPQA 1KHWA 2YH1A 4OZ0A 3ZZYA 5T14A 2CNOB 1CG2A 2CQ3A 2IJFA 4QR0A 2FY8A 1NH8A 2DCLA 3DXSX 4OJ3A 4ZLLA 2DGXA 4DPWA 1K0TA 1AROP 1KOHA 1Y10A 4A8MP 4PCQA 3CJKA 3E01B 3N6MA 4O44A 5IC6B 1HD0A 4ELUA 3IAM9 1CS4B 1C0TA 3T5KA 5IOLA 2FLOA 4IFYB 1Q53A 2X1FA 1TK8A 1U8SA 2IM0A 4KFBB 4YP3A 4LT6A 4EGLA 1PCAA 3TWZA 5J2QB 3KMSA 4DV6J 4Y6IA 3R9LA 2KVQE 2WB1D 4OLOA 2G1HA 1BXNA 2OP5A 5CABA 6FDRA 2UUAJ 4TY8A 4DL2A 3ZZ0A 2V2KA 2VG5B 4K7QA 5LL6d 3SMZA 4NA1A 3UQSA 3I31A 1FKPA 2QZ8A 5F8LA 2HVEA 3GJRB 1F9EB 1PJ5A 1SBRA 5C25A 5DQGA 3NNAA 4DR6J 1YWXA 1QY7A 2HK3A 2MZJA 1CS4A 2JRSA 4I6YA 2XY7A 3RB6A 1R31A 4WKRA 1F2GA 3QIDA 1UWBB 3CJKB 3BBFA 3HSDA 1OY6A 4CZCA 1JNZB 1FJGF 3MUVP 2YKMA 3GPAA 2ZHBA 3O2IA 4TY8B 3C66A 2OPQB 2W9BA 1FJEB 2VBXA 1YGYA 1FK9A 4LF1A 1VC0A 4UY85 2VDHA 1HBUA 4JI8F 1UVLA 2NZ4A 4DQIA 1H72C 3CDEA 1O6XA 3RW7A 1WC6A 2E5LJ 1VFJA 2FGCA 5F9LA 2JEGA 1BQMB 1JXVA 2AJ1A 3CDUA 4B17A 4OYIA 1C0TB 1Q1KA 2IDEA 3THVA 1RAHB 1YRTA 4M5GA 9RUBA 2WK4A 3EGVA 5LXRA 4OHYA 2A0FB 5DJBA 4DI6A 1HD1A 2V2VA 4QWCA 2KJVA 4TQRA 2DH7A 2JDJA 2M70A 1R0CB 2PC6A 2FUG9 3CJ8A 2K1RA 5K8OA 4ZLJA 1WTFA 3FUYA 3CB4A 1TELA 3ONQA 4DU8A 2G4BA 4P7VA 4KV8B 4TYAA 3MPUB 2F9DA 1QSYA 2D3OR 1D9FA 3CC7S 3TAQA 1J5OA 3ITHB 1N33F 5DO2A 4AE5A 3KNAA 1O0PA 4C8OA 5F8NA 4RZRA 3GZ7A 3HHLC 1D0EA 1IUJA 4C0BA 1A7GE 4O4GB 2CPEA 2XZWA 2B8QA 3BDEA 3T41A 2HHPA 1VJWA 1WC3A 2YXLA 4C48A 1Z1ZA 3AH6A 4WIQA 2GS8A 4YS2A 1L3TA 1ZBTA 3CDWA 1Y7PA 2HFUA 1CC8A 1TU0B 2ZBPA 2ZUAA 4MT1A 4P2SA 4RUHA 5CAAA 1Q81T 1YQHA 3L7UA 3H25A 2NXEA 2Y0SD 2YKAA 1JIHA 4NZ0A 2BEFA 1S9GB 2V68A 4NLXA 3Q8VA 2E9RX 5KFTA 2ZC4A 2OMLA 3PRBA 1UPPA 3ZTOA 5L38A 3PJ9A 4DV7J 2KXFA 3QO9A 2D1CA 4L3KA 4QW9A 1U0HA 3H90A 4ZIWA 2KT5A 3OL6A 3G71S 1HYSA 5KFKA 5IWAF 1JXEA 4KR0B 1RT3A 5GMEA 2JEFA 4B3TF 3R2CJ 1YZ7A 2K3IA 1DY3A 1S79A 4IO1A 4Q45A 4NCBA 1OPZA 2G0IA 2HFZA 1BE4A 2VBZA 3LOUA 3EGNA 4FN5A 1JB0C 1EETB 2DK2A 4DV5J 5ETSA 1I6JA 1HR0F 1B99A 2F8MA 4OYBA 5CQGA 5HAOA 2M8DB 5L1KA 2W1BA 2HNDB 2XSFA 4L76A 4EI2A 2OLWA 1YZ6A 3HHEA 1S1TA 3JSBA 3JAMY 3CCSS 3EGZA 1U25A 1WOOA 3B4DA 3DOKA 3ZZOA 1LWFA 2W4CA 4OMFG 3FEXB 2BVZA 3H0PA 2CNLB 2L3MA 2ZOGA 3MECB 4PWWA 3T19A 3VAMA 4LBIA 1VI7A 2R7TA 1HHQA 3R5JB 2ZHAA 2PI5A 3K59A 1T94A 2C2MB 1LK7A 3QGIA 1UCNA 1XN9A 5J2MB 2VHGA 2WVDA 2XLKA 3AOAA 1FFSB 2EFVA 1CJUA 1N0VC 2U1AA 1LXNA 4PABA 1UP1A 1CJVB 3UN3A 4CTAA 1X5OA 4Y2KA 4WPAA 1RACB 2CPZA 1WEYA 1M1HA 1HQEA 2EC2A 3BGRA 3ULHA 4J9MA 5I3QA 1X9MA 4X4NA 1FE4A 3KFWX 2AEMA 2YWFA 4P52A 4RBTA 1PG5B 2IC3A 2WVCA 3DXBA 2JHEA 4GMKA 5D4LA 1JK9B 3HZGA 4M5LA 3HSJA 5F0UA 9ATCB 1OQ3A 2W25A 1JNRB 2G2YA 1IR0A 3TW0A 3W5XA 3H5YA 2NUHA 1X4GA 2DEJA 2ZNZA 4TNOA 2YH0A 3KNGA 1OWXA 5A2QU 1M0SA 4PEOA 4OYPA 2V5HG 4CLZA 4Z7YA 2CA9A 5T7LA 1XMOJ 5E2QA 3ET6A 3W9HA 2V9KA 2V8DA 4OYMA 1Z2ZA 1ZPVA 7FD1A 1L5UA 2P6SA 4KGVB 3OHBA 2RS8A 4JOUA 1X5PA 1T9WA 4JI2J 4V19X 1R89A 3OTCA 4DPUA 4X4OA 4ANDA 4L74A 1S6OA 1FFGB 3TUPA 3R5BA 2RVJA 2RDDA 3T5LA 3I5CA 4CO2A 2VG6B 1E6VA 2D3ZA 2AJ2A 2C2OB 3DOMB 4DL3A 2ZEJA 3IMQJ 5FDLB 2PMZD 4UQGA 2UVVA 1EP4A 1S6PB 3RAMA 3ZZPA 5K8NA 2BW2A 4AYBD 4DS4A 1MU2A 4DX6A 2X51A 3GYGA 3C3LA 4J9RA 3GFZA 4NEZA 4OZ5A 5J1NA 2QGFB 1D9AA 3M8WA 4ECQA 3CCLS 1XC9A 2DNYA 2FJWA 4DR2J 3PO5A 3V4IA 1JJHA 1S59A 1Q7YT 4LFBJ 3O44A 2HRUA 3PACA 2DGQA 3SV3A 3D7SB 3R5GA 3ZZRA 2QL9B 2V67A 1W25A 2MZTA 2QEXS 2QG9B 2KM8B 4IG3B 1FDNA 3FSYA 3I0RA 3M8PA 1UVIA 2MB0B 2NYIA 2HG4A 2FD2A 4NA3A 3W7BA 3V6KA 3VGTA 1U4BA 3QAUA 3UCGA 1P6TA 3WBZA 2Y0BB 2VU5A 4C3MA 3RRHA 1HNVA 1IKVB 3PYDA 2AJ4A 4LSNB 2F3JA 2ATCB 1GXLA 4XDCA 1S97A 4OQJA 4NRTA 4B3MF 4URSA 3FKBA 4P71A 3DI6A 1Y5LB 1ULRA 3H4BA 3AODA 2W9AA 2JLGA 4DV0J 4E8UA 4ELTA 4WCEQ 4YR2A 4USIA 1AFJA 4NLTA 4JI8J 2QYCA 1GX5A 4M5DB 4HL9A 3VAIA 4JI5F 4ECRA 4LR7A 4JP8A 1HNIB 3DNCA 1H7XA 1NDKA 1TMMA 2KVIA 3WC0A 1DTTA 3NBPA 3NGTA 3L7OA 3N79A 4CO3A 4NASA 1S9EB 3POTB 1DZ5A 2DGOA 4HACA 1SC1B 2L9WA 2MKHA 3HSGA 5CH7B 4YB7A 3SDEA 2KRBA 3R27A 3OTEA 4HLBA 3TEHB 4QBUA 4GC7A 2V0NA 2VA3A 2GIQA 1Y3JA 3KG1A 5AJ3F 2Z2ZA 4BWJA 3GSIA 5E3RA 4WTOB 4KHPF 1KWMA 2P9CA 3PW2A 3A8KA 1TL3A 1VCTA 1WF0A 2ZE2B 2OUGA 3W5YA 2UUCJ 2CPXA 4NYPA 2PGCA 4H54A 3OFGA 4K4SA 2HS0A 4NLSA 1JLCB 3QPIA 5B0CA 3S1TA 2R8JA 2PSZA 3DLEA 3MFIA 2LFVA 4LMZA 4YR3A 2D41A 1G2EA 1KN6A 4ZITA 1PAUB 3NL0A 3MM9A 3MTJA 3VZIA 1RWUA 1RBOB 3BQ0A 1UFLA 3BDPA 2N7YA 1LW2A 5L1IA 2ATLA 2V94A 2M88A 2HEKA 4N47A 4NL5A 3J80U 2AJ0A 5J2PB 2GJ2A 2WBRA 3AY0A 1GK8A 2WB4A 4A4JA 2AGPA 1DAXA 1M5SA 3LH2S 4R0EA 1PSDA 1FE0A 3WX8A 1XBWA 3MF5A 4BLGA 3NKYA 1S12A 2RQKA 2CQ1A 4NX9A 2D3UA 2FHOB 1S5ZA 2AX1A 2HZCA 2XG8A 4Y2AA 4UT4A 1Q5YA 3V6DB 1R43A 4PXEA 1X4BA 2GQ2A 5KFOA 1TUVA 3GIKA 3RB3A 3HULA 1IJFB 4J9VA 1NAQA 4XO0A 4IUFA 3M32A 2FZKB 3F0NA 3OFHA 3DGVA 1IKVA 4WE1B 1NJIT 3E51A 3T1YF 1YVFA 4NRUA 3EDRB 1VGYA 2EEYA 3K5OA 2GZOA 1RAEB 1VR6A 2KU7A 1RA7A 2MHNA 3OSPA 2XMTA 4DV1F 3H8YA 3ETOA 3FDSA 3BREA 3GJQB 3I4PA 4ZVGA 4FKXA 2LVWA 4MK8A 2CQIA 2AQ4A 3ENAA 2ZFHA 1XMQJ 2PI4A 2RB7A 3RBEA 2J7WA 2IYGA 1P27B 2DD8S 4LREA 1U48A 4ZPVR 3US5A 1SJFA 2QTWA 2U2FA 4WYLA 1RJJA 1ZAWA 4NI2A 5E3AA 3MEGA 3MR7A 4MKAA 2JFKA 5L8RC 4ZLPA 5EX0A 5GAEU 2KB2A 4ZLNA 5AE3A 1WHXA 3Q8YA 1E6VB 5KFCA 2CJQA 3LWMA 3QZ7A 3ILIA 3ZZUA 2F7VA 3D6TB 3OTDA 4YDDB 3GCWP 1TFWA 1HBMB 3UVJA 1G7CB 2CPDA 3O8WA 5LMNJ 1TKTB 1XNRJ 5F3ZA 2CFXA 2DPJA 4LF6J 4LFAF 4NCAA 2YWGA 2UUBJ 4F3MA 4A47A 2YWWA 4FF4A 4GKKF 3KLIA 3AFGA 4JBCA 4XK8C 3A8IA 3IP0A 3AD8C 5HATA 5T7LB 1KFDA 3GV8B 1VBZA 3K5NA 4FXDA 2HW3A 1OO0B 4HVZA 3CCJS 1S0MA 2HIYA 3M6XA 4NCGA 2XWXA 5ETKA 5A8KA 4LVOP 7AT1B 4NA2A 3M8SA 2VODA 2WSEC 2ZHOA 4JV5J 2KDOA 2GMJA 3MMCB 4X2BA 1MWZA 3IBCB 2R2SA 3LUYA 2QIFA 1TL4A 3BGRB 3I96A 4J9OA 1VQ5S 5G0RB 3KK1B 1GMWA 1QTNB 2W2NP 2LA4A 3WQPA 2DNQA 2NS1B 4URGA 5GAHI 2UUAF 4H4KA 1JLBB 2RKIB 4FYYB 2Y1LB 3KLGB 3KLHA 2HLTA 5AE2A 4J9QA 1LEOA 5ADZA 2DNRA 3CD6S 1RAOA 1PKUA 3OR1B 4I1TA 2W7OA 2YX4A 1WSVA 4M5HA 4F02A 4RBVA 4XAKA 3DC2A 2RJZA 4J9NA 3W9IA 3DU5A 1RKIA 2OH2A 4YMEA 4ZVRB 3HM9A 4UF4A 2JEJA 4ETZA 1EHWA 1HNWF 3GE9A 1S1TB 4HI1A 3VGSA 2E7VA 1FXDA 5IZHA 3FBBA 3CIZA 2MSTA 2E1RA 2F9JA 3JS9A 3LPYA 3QIPB 4HH1A 1HI8A 1HPZA 4B9UA 1IQTA 3GONA 1U45A 2HQIA 2DJWA 3T1AA 5DZ7A 4DFMA 5AXKA 4JI3F 2MKJA 4J91A 1UPMB 2FPHX 4ZHRB 4R8UB 2HWIA 2WZ1A 2NPFA 4V1Ak 1QDUB 2N4CA 3C8YA 2BACA 3FEYB 5BYRA 5LOQA 3P5BP 3NGSA 4X4PA 2UXDF 4YUDA 2DHXA 2QJ3A 5HP1B 4DR5F 1MSWD 1XR7A 4PWDB 1TL5A 2AYBA 3MM6B 3EX7B 1ZTTA 4C4WA 1CJKB 1KLMB 3VZHA 2DY9A 4ZCMA 2MXYA 2OJ3A 4F2SA 3MEEA 2YX7A 5CA5A 2W7PA 3CNQP 3D66A 1Z4UA 4P2MA 3EE3A 3KXDA 5I3UB 3NGUA 3N5BA 3G8QA 3DDKA 4DV5F 4CCHA 1NPRA 3MMBB 1KLNA 2EFOA 2V34A 4DFPA 2DBBA 3H2LA 4P74A 4YR0A 3RTVA 3GG1A 2R7SA 2R2TA 1KQSR 2HVIA 1YJTA 2ZDPA 3RBZA 3N28A 1KRPA 3BSAA 4M1KA 2QA2A 2H5IB 4CQ1A 1R8CA 5KFIA 4ECZA 4CLPA 3B6BA 2CZ9A 2QO3A 5FLXU 3Q24A 4O3SA 2CQHA 2LXUA 4CIOA 2WHOA 1CEZA 2PEBA 1NDCA 2FHJA 4YN3B 2UUBF 3MEDA 4I2PA 3R2DJ 3M6WA 4ZVQB 1DTTB 3NBPB 3WHIA 1EARA 5IV3A 4ATNA 1YJVA 5HANA 4IFVA 1RKJA 4ITSA 1X9SA 1YJUA 4BS2A 4ID5B 1G1XA 3WC2A 2QL5B 4JI2F 2CNNB 1HI1A 5GMKa 3KLFB 5KFPA 1H7WA 2HFOA 3MPDA 1MMLA 1FXRA 4KO0A 3TOQA 4M5KA 3G6YA 1LWXA 2MY8A 5BYQA 4HYKA 1FK9B 3JTOA 2MQMA 4J90A 2OFHX 4JYAF 2Y1IA 2K7JA 2QL7B 3A3NB 3CTRA 1XMOF 2WCXA 2CQ0A 5C24B 2EW9A 4DR5J 3N6NA 3IBFB 2VPWB 3QAEA 3SXLA 2VQFF 1FDDA 5DS7A 1K8AT 2Z2LA 4IOCQ 4HDGA 3K5LA 1FNMA 1WEXA 2ZNYA 1JLEA 3CCVS 2MJUA 1ICEB 3QMQA 3WZ0A 4EU0A 3MD1A 1AUSL 3CGIA 2M7SA 2JVOA 2Z0GA 3FEZA 3IR6B 1M5OC 3GU0A 4OL8A 4X62J 3C15A 1S6PA 2N7CA 2E7WA 2VG5A 3TQ1A 4JI5J 2JZ5A 2IM3A 2WONA 3ENWA 5HVFA 1C1CA 1DQ8A 1Q8BA 3G87A 4FNHA 4FYXB 2IVFB 4I2QB 5KFYA 4DSKA 3HHLB 4EYHB 2DR7A 2MHEA 2HFNA 3M8PB 2HZAA 2J8AA 2V6AA 1NB2A 2K06A 2GMLA 3CD7A 4C8YA 3IXQA 1P8GA 2HS4A 2IVYA 4PXBA 3AA9A 3LQVA 5AJ3J 2HBRB 4KSEB 2Q3PA 2YBVA 3D3CJ 1SXLA 5LMUJ 1YJ7A 2V8GA 4P10A 1QLNA 3BH6B 5B0BA 2B4UA 3M1VA 1B70B 4NE9C 4CLTA 3HFVA 5LSLA 2YWEA 3IN5A 2KJWA 4EK2A 1RT1A 3QYYA 1H0HB 3HF5A 2R4FA 3FQKA 2E5IA 3M2VB 3PIOQ 2V4JB 3QSYB 2HNZB 1WHVA 1NJZA 3GYNA 2YPZA 2BYCA 4LQ9A 2HVZA 2QFJA 4B9TA 3M05A 2IC3B 4ALZA 3BO4A 4JI0J 5IQQA 4X4VA 1NMEB 4RX6A 1UJ5A 4RW8A 1RA6A 2M4MA 1CULB 1SIZA 4KHRA 4FNIA 1PBAA 3JTNA 4I56A 5LT5A 1X0PA 3Q83A 1S76D 1XQIA 2QMWA 4WFXA 4B3RJ 4X65J 3ET6B 2C3OA 1WG5A 5D4NA 4FXVA 1XMBA 1SKWA 3MZIA 3F44A 4K59A 1C0UB 2IDLA 3K2YA 2ZWPA 3SSRA 4F4AA 2W8KA 2ZH7A 1CBKA 3X1LB 4DG1A 3KHHA 1Y9OA 1T05A 1ZZNA 4Q0BA 3IR7B 1VRTB 4I6AA 3R7SB 4ZPBA 2CPIA 3KLEB 3L09A 5JVHQ 1U1RA 1SKSA 3RR8A 2HHHJ 1TL7B 2W4PA 1F3VA 4XDDA 2J9DE 1RBLA 2DR6A 3M2UA 4OHZA 1M5PC 4PUOB 4MK9A 3T1YJ 3SQGB 2FVRA 1P9QC 2OAUA 3DYAA 3T9ZA 4DPXA 4RU2A 3MUTP 3KYLA 4ECUA 5H9EJ 2E5GA 2C2RA 1CJTA 1MN7A 3KK3B 2G0CA 2DHSA 3R7BB 1X5TA 3O5TB 3FSXA 2XYHB 4DL7A 5A76A 2VA2A 2I5JA 2IA6A 4IRDA 1TFYA 2IY5B 1IWAA 3KG4A 4KH0B 1M5HA 4MFBA 2OTJS 1P9YA 1TKXB 3EUNA 3HVWA 1D9DA 2B6AB 4WBFA 5KFJA 4FF3A 3OXFA 2K2PA 2D74B 3P3DA 1TTHB 2M52A 3UDEA 1DURA 1FRMA 4S0MA 5KFMA 2E9TA 3H5XA 1WUUA 3QGHA 4BWMA 4AUKA 5L39A 1OPIA 1IBCB 2RF2A 4DOZA 2VJUA 1X0FA 3DRSA 1QE1A 4M5MA 1RHMB 3HKWA 4MK7A 2UU9J 3A8EA 5HSPA 2XCPA 2PIIA 4HR2A 4HKQA 2AJFE 2HQGA 1VHIA 4NYOA 1JLQA 4UTGA 4X4SA 2KFYA 1U2CA 4DR3J 2CPJA 4ED6A 2DIVA 3M4XA 4C11A 1N0UA 3K17A 4ED2A 2FJVA 3C6UA 4LR8A 1T9YA 4Z37A 3HD2A 2YKNB 3GCXP 5M2UA 2HQDA 4LFAJ 4LF8J 1CVJA 3M30B 4W92B 1IJEB 2KXHA 1U0HB 4LRBA 2OPPA 5KT3A 3S6EA 2ZJPQ 3DM2B 2KM8C 2E66A 4J9PA 3BSOA 2QV6A 1KVJA 2W2MP 3W61A 2KYZA 2LQ8A 3GR1A 3VVUA 2AKWB 1HQUB 4QIEA 3KLEA 2E9ZA 3MAAB 3TA2A 4WK3A 4EZ6A 1BQNA 3IM9A 2QA4S 2MLZA 1TR0A 5AXLA 5DQHA 1RSCA 2MPUA 3J7ZT 3TZZA 5J2NA 1RWPB 4ED8A 2CZVC 1UZHA 1H2VZ 3EDQB 4DV4F 1URRA 4ZP7A 4ED5A 4KHMA 4N77A 2GX8A 3LP0B 1RAJA 3N4WA 3TUZC 2B8PA 1MNEA 1VIXA 4FYVB 3JYTB 3SEOA 2J9DA 4IH7A 4QIWD 4ZVHA 2JC0A 4F4XA 4TN2A 1FEHA 1FWPA 2XI2A 3CJQA 3JSMB 2E1CA 1YRXA 3QGGA 4LBPA 1WORA 3V2UC 4H4MB 4F4KA 3IS9A 5A0YA 4K0KF 3SSSA 1Q7LB 3M1VB 1FXLA 3HMJG 1LKZA 2MGZA 5GVQA 1VJQA 3DLKA 4LF4F 4JI7F 4DV1J 2OPRA 3FCVA 3BQ2A 2W8LA 3H2VE 4M5DA 4CO1A 2XY6A 5D3GB 4DN9A 4U96A 3ZNUA 2XNRA 1IN0A 3K0JA 2V69A 1GQEA 3TVYA 3QNWB 2ZD1A 1FKPB 4ZVUB 4R5PA 2D69A 2VF3A 4LSNA 5JUMA 2UUWA 4DUYF 1V3RA 4NYZA 5KFNA 4DR7J 2ACYA 2KHCA 3MM8B 1TAQA 2H5EA 3MTKA 4QIGA 3CF5Q 1YBUA 2QFIA 4HHJA 1HBOA 4H4KC 2IBOA 4F67A 4LQ3A 2X1BA 3CUNA 2J6SA 3EXYA 2FLLA 3DMJB 2FHKA 3FVYA 4FKYA 1WG1A 4QJVA 2ZH5A 3FRYA 3H5UA 1Q8LA 4U7UD 3CVKA 3MMAB 1S9FA 5K14B 4ES1A 3EJMA 1JJ4A 2XSJB 3RU0A 3DGPB 2OMOA 2R9LA 2NXJA 2MGZB 3ENVA 2ADCA 3THTA 3BBCA 2JJ4D 2W2QP 1MU2B 4GRSA 4J37A 2NLWA 2HVDA 4I7FB 3R5DA 4OJGA 2EFQA 1U1LA 5FDLA 1HBOB 2YVSA 4QU6A 3MM7B 2JFDA 1FD2A 1MN9A 1S6UA 2R3VA 2YQ0A 1D09B 3FBFA 2CWKA 4J9SA 2BM0A 1NK8A 3UDLA 4F4ZA 4NLUA 5EWGA 1SH3A 4RNMA 2CJAA 2XNQA 1WELA 2OPSA 4NMXA 4DR1J 1IKWB 1QUVA 4KE5A 3TI0A 1H98A 3GJTB 4DXLA 3HHNB 2NREA 3DHWC 2OSQA 1C4AA 1KDNA 1S57A 3KTQA 4NXNF 2DNKA 5D3GA 2KG0A 1PYSB 3FCWA 4USKA 5A8WA 2YNHB 2VIHA 4F25A 3MCNA 4H4MA 3RUBL 3DLLQ 4YFUA 4TU8A 4IRCA 5F9NA 1TMJA 1U24A 2ERRA 1LK5A 4DPTA 2Q6CA 3PG9A 3B4MA 5A6PA 3LWLA 1QSSA 2OO4A 2IMWP 1NXIA 4FS2A 1S0OA 3TVZA 1N8RT 1N5SA 2ZZNA 2B4OA 2E5LF 2P5VA 4ED4A 3RGIA 1VBYA 1F5AA 2PFFB 3BB5A 5KFUA 1HNWJ 2ALYB 2XYGB 4KKOA 2XMUA 3LP0A 2CWXA 2YY3A 3C6UB 2LQJA 3K8VA 5D4PA 5HJYA 1QTMA 4Y3CA 2ZH4A 2DHAA 3ZFVA 2R7WA 2LEBA 4I67A 1GNKA 3GR0A 1TAUA 4A8FA 2MMYA 2IMOA 1FESA 3SSQA 2R7UA 3SCJE 2AP6A 5CHCB 5HROA 1KTVA 1M5VC 3WIUA 2RHSB 1LNQA 3MAAA 4KY3A 2DGSA 2CPFA 1IWGA 1RADB 2CZ4A 5A8RB 4QYZK 1NSQA 4XPEA 2NXCA 2ZBRA 2ZH6A 4C8MA 1AB8A 2XTJP 2L9NA 4PQAA 3THPA 3M30A 2YTCA 1NPKA 3KDOA 4C0OC 4D3HA 4R8UA 1ZOTA 2VH7A 1EIYB 3CJ2A 3IO1A 4ECXA 1XTZA 3TJ9A 5J1EA 2I2YA 3HXMA 1LQ9A 3BV8A 4OHVA 3TUIC 4G3IA 2DISA 2E7XA 2MZSA 2POKA 3JSYA 4Q7AA 1Y11A 1HYSB 3H2UB 5KG6A 4U6PA 2HZVA 2JH3A 3WDOA 4RUAA 2BV3A 1W26A 3AJ1A 2BM1A 2ASJA 1XERA 5D0RA 4ZPTR 1RHRB 1RT7A 1WI6A 2Q1LA 4DL6A 4LR9A 3S01A 3W65A 4HDHA 3SI8A 4RJVA 3Q2TC 3HVAA 3D28A 1IQZA 1FDBA 4ZPCA 4ECTA 4DFKA 1Y00A 3DOLA 1YK9A 4WIIA 1Q8IA 2RUGA 4B08A 2B56A 5I42B 1T3NA 3V4MA 3TARA 4PR6A 2XGQA 4PZVA 4B9SA 2RAQA 3M8YA 4CH1A 1DLOB 1RCXB 3MURP 2NXNA 4RW6A 4MFBB 1Q16B 3PHTA 5EGYA 3PZPA 1AFIA 2DNLA 1E6YB 3KLHB 2R8HA 2VPXB 2MLXA 1K73T 3OLAA 1KSPA 2VICA 5GMDA 2LA6A 1VYAA 4LFCJ 3DFEA 2YNGA 1IXKA 1QVFR 1IBKJ 3HFZB 3DYAB 4GVBB 1Q4RA 3LF0A 1F9HA 2DNMA 3NGDA 1IBLF 4NLGA 3W8GA 3QT5A 3TANA 4G1QB 4B02A 4L75A 1VRTA 2WOMB 2DEIA 4ILLA 2W2OP 2Y3YA 4USVA 1VQ6S 1YJ9S 2WSFC 3CCUS 4C8LA 4QW8A 2KFZA 1C0UA 2O5DA 3P4UB 1L3UA 2IM1A 4YOEA 1BD6A 3H59A 2CJBA 1VC5A 3QLHB 3PFOA 3EYZA 3NCRA 3H20A 3LAMA 3QATA 4JI4J 2HHQA 2EFNA 1BQMA 4URQU 1CULA 3OV7A 6AT1B 1U1PA 3MI7X 2GGPA 3RRKA 4JI0F 4RR5A 4AQYF 2PE8A 2LKZA 2J0WA 3WX4A 1ITPA 4QPTA 4H4OA 1DBDA 1NCLA 4DV2J 1NJWA 1LV5A 3OBIA 4MIAA 5G4DA 2M0GB 2WONB 4N7TA 4ZK7M 5D4OA 5IT9Y 2QC3A 2YKMB 1NU4A 4PXDA 1T9UA 3VR1A 4DZDA 3PR5B 2GA7A 4DQSA 3MEKA 3J7AN 1PYTA 1RU1A 2JSXA 3PYEA 4ZCLA 4USHA 2PEHA 3CC2S 3SYZA 1XIQA 1KKHA 4ECVA 1T0TV 1BY9A 1X4DA 2BJ9A 4UZCA 2HBZB 5KFVA 4CLFA 4ZN1A 2MZRA 2GHVC 3MAQA 1WKKA 2RH3A 3OXLA 2GVDB 2MZQA 4FYWB 1S1XB 5C25B 4B9VA 3KJVB 3DRRB 2DCUB 4IKAA 4B3SJ 3FFIB 3D0HE 3IBWA 2XM3A 3JSMA 1VS3A 1F3FA 1DFDA 4U95A 1YX2A 1UEVA 2YPYA 5EHHA 2KL8A 1N36F 1C1CB 3MAHA 3OPKA 3VVTA 3PFEA 4EO6A 1YJNS 3MMJA 4WE1A 3R7NB 1GTEA 2MEWA 5HMXA 2UXBJ 5EDWA 3G8SA 2EPIA 4WU3A 2YNFA 1TVRB 3VV2B 4F0KA 2BE2B 5ETVA 3LTOA 3WIVA 4ID5A 2ZDOA 3AA8A 3DRPB 4CYUB 1M5KC 2BQRA 1N36J 2CNKB 3I32A 4G1IA 2UVUA 3OTOF 2UV8G 2PA8D 5B09A 5KFWA 5LJ5Y 4LF6F 3CULA 3BGUA 5F3TA 1SL0A 4ZPDA 1VDHA 1RWXB 1T02A 4ZCKA 1X7VA 2UXBF 3H5SA 1CSJA 2ZZTA 4DV3F 1NJXA 2Q79A 3GB0A 4OHXA 3HI9A 3UD5A 5B08A 1N56A 2FC8A 4DUZF 1JJ2R 4EBCA 1RHJB 3KG0A 2X3DA 3JTPA 4NEYA 3IFEA 1TL1A 1NZAA 4PG7A 4B3MJ 2LEPA 2ZOFA 3UCUP 2CJKA 1SB6A 2RRNA 2V8VA 3X3UA 2N4DA 3KUHA 3MOZA 1U1OA 1N5TA 5DM7Q 3PEHA 3J81Y 1NEEA 1C1BB 2CJ9A 2OEMA 3ETMA 1BUXA 1RAGB 2WAQD 3GG0A 2B9EA 1C1BA 4U7UK 3MMBA 1UVMA 1YKWA 1F60B 2M8HA 1UVKA 1FERA 4K4UA 1V9OA 1Y3KA 2ADBA 4DR4J 4YB5A 2I38A 2VKRA 3VAJA 1OYEA 3C19A 3K7RA 4KYZA 1FF2A 1S0VA 1TK5A 1HQUA 2HHVA 2C28A 1I3OB 4G6VB 3ELHA 1YLXA 2Q6BA 2E1PA 3H98A 1WF1A 2V2QA 2DO4A 1VHFA 1SC6A 1JLGA 2LU1A 2XZDB 4IDKB 1OIAA 2XI3A 3BKTA 3ISNC 1RE1B 1NHUA 1VBKA 2UU9F 1RTZA 3DHXA 4E0DA 2EK6A 4LF7J 3C6TB 1EB0A 2CJYB 2XZTB 4QOTA 2C3MA 4NOHA 1CJTB 5GAGU 3KLVA 3KK3A 4ZPWR 1N4LA 6FD1A 4EEYA 1IBMF 2RD5C 2OELA 3J81j 3L3CA 2QSFA 2C2EA 4B9LA 1XMQF 3CJ4A 1B0VA 4N5SA 1WHYA 2W7AA 3OT9A 5T41A 4V19J 1HWLA 3NGKA 1RBAA 3MEEB 1OMSA 1U0SA 1RCOB 2VASA 2DHHA 4AFFA 2ZM6F 3V81A 1R0AA 3VQSA 3J7Z5 3VALA 1TKZA 4GC6A 2BDPA 1LOUA 5HROB 1NSAA 1UEUA 4YEAA 5JJBA 2XS7A 4DCOB 2ZVSA 4F04B 3GWCA 3M9MB 1SJQA 2WBMA 4TXSA 2DNGA 5IT4A 3IRXA 2I5JB 4LF2A 1N32J 1UVNA 3PV8A 2MZ1A 2ZM6J 2C3PA 4U9RA 1NK6A 2WTFA 4QR2A 3G8TA 1HARA 1DJ0A 1HPZB 3MPVA 3NXZA 2MKSA 4B3OB 1X4AA 2RQMA 4K50A 1HW9A 3FBCA 3NOCA 3HJFA 2ASYA 2PA3A 3QBCA 4WJBA 4IG0A 2WRMA 4O3OA 2VG6A 4C6AA 1TL7A 1SV5A 1UVJA 1FNOA 3LGMA 2C3YA 1OY9A 1N34F 2COLA 1EX8A 4JI6F 4MKYA 3QRRA 1BWVA 5HQMA 1X8DA 2AF6A 2FZGB 3E3XA 4JB8B 4UOFA 4PQUA 2C3UA 4FZVA 1EQMA 4RNHA 1T9XA 4U8VA 4OX9F 4QYRA 3O1LA 3W8PA 4OYAA 4OFZA 2H1YA 1M1KT 5D15A 1O51A 5A6WA 1NLKL 5F8MA 3CCQS 4HH0A 1GMUA 1PBUA 4BC7A 2XY5A 5EWFA 3CEDA 1RTDB 3MGJA 3Q2SC 2R7XA 3LA0A 5G0RA 1KQGB 3KK1A 3U7JA 5K8MA 3K5MA 3PVXA 1S72S 4UW2A 4P9SA 1SC4B 1FRXA 1IBMJ 3HHLA 2V4QA 2XULA 1R27B 2IA0A 5GADI 4RW7B 5CD4A 2J0SD 3BSCA 1NH7A 3R5CA 4KTQA 1S4EA 2GIRA 3J81U 4NCGB 4OZNA 4CO4A 5A8KB 3L95X 3Q8SB 1NK7A 4W90B 5ITHA 1FT8A 3RZAA 1PO6A 1BMQB 3T9NA 5CCMA 2HAFA 2R2RA 1N6QB 4QR1A 4WYWA 4QWBA 4IQXA 4M63A 1K0VA 3PJXA 5M2RA 2XMKA 1YSJA 1WC0A 2A18A 2R7QA 3IRXB 3Q86A 4OX7A 1WDTA 3D4JA 5BXIA 3K57A 2OKQA 1PAEX 2IHR1 4E2FB 5E3QA 2HHTA 1KQFB 2JOQA 4X64J 2R7OA 3TZXA 3JSRA 1DQ9A 3IWLA 4K5RA 2K3KA 3N0VA 2HMIA 2RSQA 2Y8YA 2HNYA 3HJVA 1RLCL 1X4CA 3VTIA 2GO8A 4FVMA 3CO0P 3R97A 4DR2F 3V81B 5HL7Q 3E8OA 1B0PA 3SQOP 1RT7B 2HLUA 4YHHF 2FGOA 5F41A 5L46A 4Q5VA 1YTYA 1NBEB 1ZETA 2I1RA 4I0WA 1B7FA 3I56S 2DGVA 3D3BJ 3HX9A 2X3GA 1UTAA 4X64F 4C2MA 3KLFA 1N34J 3VAGA 4Q8FA 4DSEA 1U8WA 1KVKA 2XMVA 2I8EA 5E5NA 3ZTSA 1V3SA 4K4WA 2C2DA 2OPRB 2KZZA 3DLKB 2XYPB 2E5JA 1AZSA 4IR9A 1D8ZA 4PPDA 2Z4PA 3BM7A 4WFAQ 2ZVIA 5FLXY 5LMUF 2R8IA 2VC1A 1EAYC 3VAKA 3QO9B 5KG3A 3Q8UA 1AW0A 2FY1A 3MEDB 4I2PB 1DHMA 3TQEA 5KFDA 4UZBA 4CLSA 3M9OB 4N41A 4F3QA 1RUSA 2HFVA 2J9EA 4ZJLA 4PYDA 1FX4A 3MUMP 3LO3A 1VK8A 3OD2A 1B4SA 4X4QA 3CXCR 4KO0B 3GIIA 5KG0A 4I69A 1KQKA 1X4HA 4O0IA 2VQFJ 4IR1A 3D6FB 1LW0A 4OX6A 2KT2A 1Q95G 1WEZA 4KIAA 1AT1B 4Y2IA 4F0HA 4Y0FA 4LFBF 3V6DA 3EPIA 5MAOA 4MH8A 3SCKE 2FC9A 2ZE2A 3LP1A 5H9FJ 5KFAA 1JXLA 2UUCF 5BR8J 2R2UA 1HNXF 4RUBA 1DRZA 1MMDA 5M2PA 2B7CB 2EI5A 2DXEA 4USMA 2F8EX 2KXNB 5ETOA 4DSFA 4OX9J 3W5ZA 3ZO7A 2FB0A 3PKYA 2NPIA 5KFLA 3RRGA 4ANEA 2OPPB 1RP5A 2AHOB 1T8EA 1R8HA 2MDAA 5ETLA 3BQ1A 4RNNA 2AWZA 2YKNA 4UY8T 2NZCA 4ZVTB 4U67Q 2KO1A 1QUPA 3I5AA 5K9FA 4K4YA 3CPWR 2VQEJ 1RABB 4PKDB 1IBLJ 4CLYA 4OI0A 2P9EA 3OSNA 3Q0AA 1F1BB 1I51B 2KI2A 2F4VF 1U1MA 2ROEA 4OZ3A 5ETTA 1QE1B 1NSKL 3K89A 3MM7A 2HSEB 4HI2A 3NAHA 2R7RA 4XIUA 4LF7F 1JLFB 3FK4A 2OFGX 2GAHC 4X4RA 3Q8PB 1YIJS 2XS5A 1ROFA 5HP1A 3HK2A 4EMDA 2FDNA 3D1QA 4OI6A 7FDRA 5F8GA 3D2WA 1AZSB 3W66A 4IYQA 4O3NA 3T1HJ 4LF5J 2MQOA 3MOJB 1R6VA 2YQ1A 3D0IE 4WP9A 3DDIA 1GMWD 1FDAA 2PT0A 5K14A 1PJ7A 4DZ6A 4B3RF 1WSRA 2WVEA 3OJSA 2VC0A 4J7CA 4ZA1A 3ENQA 3UE2A 2Q66A 1BLUA 2IJRA 4NLQA 3RJMB 2QLWA 3CD0A 4TLRA 2CVIA 3I5BA 1EP4B 1RXOB 4DLEA 4ECYA 1HNVB 3VAFA 2UUTA 4LFCF 3M2UB 1S1WB 2BJ8A 4P75A 4RW7A 2NSCA 5H9FK 2F40A 3QSIA 3JQKA 2CQ4A 2IRXA 1ZH5A 1XR5A 4F0MA 1NRKA 2QRRA 2DB1A 4PG6A 5CYMA 3VF0B 4CM0A 3KUEA 2QMUB 3UR0A 3QT7A 4UUWA 1LFWA 3LANA 3Q89A 2AGOA 1NK9A 2XQCA 2IYIA 4LVNP 4KH1B 3CJRA 4A48A 4DCJB 4HT7A 1U6FA 2MQLA 1FD8A 3MDFA 3JXOA 1L3VA 4NWBA 5JVGQ 2KZMA 4WXOA 3QLHA 4MJKA 4C3LA 2BJ1A 4WWSA 4F36A 3QQCD 2CJXB 1HIYA 5CD4H 5A0YB 1V5IB 3G6XA 3HZEA 1I1GA 3FCHA 4IH6A 4U7CA 2WW8A 4W4MA 2A10A 2WOMA 4MKBA 3BPDA 3DOMA 2FLNA 3MMCA 2Z58B 1QSLA 4EBDA 2J76E 4H4OB 1IR1A 2JLEA 1SJ1A 2KT3A 1WD6A 2QA4G 4NMLA 5F8IA 3G96A 4DF4A 1X5SA 2N3LA 2PMHA 2QA1A 4B3OA 1LXJA 4DX5A 1NM2A 1Q79A 2G1DA 1RTDA 3OL9A 1N88A 4ED3A 2MKIA 2MYFA 1NK0A 2AEJA 1OSCA 2OEJA 5J1PA 2W9CB 4J9LA 2KTQA 1SH2A 2KN4A 4RW6B 4CRJA 2IM2A 3EWGA 2ILZA 3F56A 4O3RA 1TV6A 3I55S 3PTWA 1D3WA 1HL6A 1VMBA 3UI3A 3ZZZA 4NPOA 5DQIA 1UJ4A 3MECA 1FNXH 1REVA 2BW7A 2CKWA 3QT6A 3MPYA 3UD4P 4KRWA 5HLFA 3M6UA 4RKUC 4DLGA 1XR6A 4LF9J 1XNQF 2VFUA 4MKVA 5FJ4A 2Z2MA 2DR8A 5DDRC 3PCOB 5FD1A 5C7PA 5HBMB 3CMES 2LYVA 4TYBA 2X1GA 3R5AA 4EZ9A 2BE9B 2OIHA 3UWTA 1LWCB 3QWUA 3I6PA 4FP9A 3CE8A 2ZBCA 2B9YA 2RRBA 3NAIA 4DV4J 3TX8A 2LCWA 1E6YA 2AT1B 2IRUA 2W24A 3TAPA 5KFQA 3GFYA 4ICLA 1JLGB 2DT9A 4QWEA 1V3ZA 1R6YA 2DO0A 2LECA 4LRFA 1LFPA 3W2VB 5A8RA 3KMQA 2XBPA 2F4FA 3EXCX 3UN5A 3CJSA 5HN0A 1HBNB 2KYXA 4JI1J 1NNDA 2EG2A 4UOGA 4M95A 4PWUA 2GC8A 3D0GE 3P45B 4MTPA 4EYIB 4K8RA 3MM9B 2D7SA 4F3OA 3W63A 1FJ7A 1YBTA 4CH7A 4LIRA 5LXYA 1TKXA 4KT0C 1SQGA 3TVKA 4NLRA 2VBYA 4N8NA 3U02A 1T03A 4AL5A 1HNZF 5D8HB 1NHVA 3DCAA 1JLAB 4IFVB 3OTBA 4USUA 1K1QA 2MLYA 2DRDA 2DKOB 4IDKA 5L9XA 5KFHA 2O67A 2UXCF 2DGWA 1Q0NA 3D6MB 2BKOA 4DCPB 2J7UA 1VOMA 3JQJA 3PYFA 5CYQA 5E7OB 1KP6A 2AZ1A 5KFEA 4HTJA 1NB7A 4KV8A 3KJNB 1VQ4S 4JYAJ 4PPZA 1S9EA 1W2IA 3POTA 5L9NA 4WFBQ 4DG1B 2ACMA 3GP9A 1MWQA 2BJ7A 2Z57B 4J9UE 3D67A 4CDIA 2FJXA 4PG4A 1U02A 4ZVEA 5A8WB 3KHRA 1NK5A 2PDAA 4ELVA 3GILA 4AL7A 1VQOS 3KK2B 3PKMA 2H9ZA 1GXTA 4GO7X 2AV5A 2Z2YB 1TVRA 3RB4A 4KAIA 4N56A 1V6HA 1SPBP 2E5HA 2XHWA 3ZTRA 1YJWS 1ZS6A 4RW8B 2BANA 2HGMA 3BO2A 1QAYA 2HFSA 4JUZA 5HK4A 3R1LA 1N33J 1PIEA 4Z2XA 3J7YI 2UVWA 2C2ZB 1FRLA 5KG5A 3L9ZA 3V6HA 2BZ2A 3G6VA 2VQEF 2AJQA 2V4JA 3LGHA 3TJAA 3I9V9 2KRRA 4I7FA 2RNEA 4XTTA 2UVRA 4FF2A 2VKZG 5C42B 2HHXA 1HNIA 2Z8QA 2XSJA 2V2ZA 4IH5A 3ICLA 1IM4A 4ZHRA 4F2RA 3DRPA 3T6BA 1YBAA 5ETQA 1TP7A 5B0FA 4CYUA 5IT0A 3A1YG 3MR3A 3SFUA 5DG7A 3P6YC 3KUGA 4TY9A 3ZTQA 2DXDA 1IKWA 1CQMA 3OUYB 4OYXA 3DLGB 3KWMA 2CQ2A 4Y28C 3BN4A 5EX3A 1GFWB 1J5EJ 1HBUB 3LW5C 1XWLA 1SQEA 2ZITA 2M3DA 3PDNA 5B0EA 1XEZA 3SBMA 4OI4A 5D0GA 4DL0C 3IWXA 4F4WA 1P1TA 2FVPA 1U47A 2CG8A 1WNEA 3HT0A 2BRLA 1B3TA 2DRBA 2UP1A 2FVSA 3I0SB 2IVMA 1T3OA 2GGPB 4FXWA 4IOAQ 2ZD1B 1S0NA 2BOAA 1YITS 3AQPA 4IFYA 1A0OB 3BGOP 2DVIA 5ETMA 3KHLA 1T9TA 2XMJA 4M5IA 2RKIA 2YX1A 2L08A 1UEKA 3MMAA 5KG2A 2OI2A 2FIUA 3T5HA 3OXGA 2H4YB 3QJPA 3BS9A 5DDOC 3P5TL 1H6KX 3DMJA 3BZQA 2XLJA 3IA0A 3UNGC 1HWKA 4DV6F 2D9OA 1U6BA 1X60A 1ZA2B 2VFVA 3VGUA 4OZ2A 3G86A 1FRKA 2F1FA 2LXFA 4KPYA 1ZA1B 5SZTA 2EVZA 2H3EB 3SCIE 2DNHA 2RUSA 4Y2CA 4KC5A 4IRKA 1SVDA 1JKHA 3KKFA 4CNYA 2QLJB 4R5PB 1RDRA 4YDXA 2DH8A 3QWPA 5KFBA 2YNGB 3TNVA 1U49A 2VZ9A 2IBKA 2H65B 2BQ3A 4OX8A 3C14B 2PD1A 3UO0A 4ZPAA 4TVAB 1ACMB 5K5MA 3NLCA 4OIXA 2ZJRQ 1DLOA 4DEZA 3W2WB 4X62F 1HA1A 1VLYA 1X4FA 2ZWOA 1PC4A 1RWWB 4LIWA 4QIVA 2WVFA 1NZ8A 3B8HA 4U8YA 1BHNA 2ZBQA 1VQSA 2Y1JA 4OZ1A 3A3OB 2XEXA 3B82A 3CJ5A 1F5BA 2RQ4A 2CPHA 3IC1A 2NUUG 2B4VA 3AJDA 3QGPA 4KPCA 3BF4A 3HT3A 2VJVA 3JQMA 4ZMMA 2D9PA 2PO4A 3EICA 2LQ5A 5KT4A 1T03B 2QYGA 5EWEA 4NXNJ 1OJ4A 5AE1A 4DMZA 3PX6A 2F8HA 2H5JB 1GAOA 4FF1A 1A6LA 3BGFA 5HMYA 1AXQA 1VQ7S 1JX4A 4OJHA 1WI8A 3CCES 5DM6Q 4DX7A 2AYMA 5HVGA 3W1YC 3KJQB 3D6HB 3CCTA 1CLFA 1UFWA 2APOA 2ROPA 3BKUA 4K5SA 5IWAJ 2RU9A 1RWNB 2DXFA 1Y0HA 3KDNA 3NNCA 4B3SF 4PAAA 2KFNA 3DM2A 3GV7B 3CJ0A 4IOBA 3TP2A 3SV4A 1UL3A 2R42A 2GW8A 4RNFA 3OFEA 2CAJA 2I0XA 2RQCA 4DPOA 1RWMB 2LU2A 1N5QA 4WKYA 3RR7A 2K8GA 2WW4A 4DUTA 1FEEA 1HWIA 2B4PA 2DTJA 1FRJA 1K47A 2M5YA 1FKOA 2HRTA 4DS5A 2EBEA 5AT1B 1VIOA 2QN6B 3AOCA 3OL8A 2L9DA 4KBIA 4ES3A 1TZ0A 4RO0A 5C2GA 1ZZFA 4F8RA 3ITHA 1SJ4P 1HHSA 4DV2F 5HLFB 1S9GA 3MFHA 1SCJB 4DQPA 2F63A 4F50A 4KQZA 1Z2LA 4LUBA 4ZIVA 3MCSA 3QFHA 2BBEA 3J80Y 2BR0A 4OV1A 2HRYA 4ZJOA 1S10A 3SZ2A 5F8JA 3HP6A 3QFWA 3HVRA 2BKNA 3NP5A 5IS2A 1GXUA 4NLYA 4WK1A 5L1LA 1G6BA 2FJBB 4Y2MA 2W01A 1EQ0A 3CIMA 1UW9A 4O4GA 3PW7A 1EZZB 4FVCA 4X66F 2P6TA 2EWHA 3RBDA 2QMXA 4UQTA 1YI2S 2Z30B 4QIFA 2HS3A 1FKAF 2DITA 4X65F 1FRIA 2VFSA 3ILLA 1AUDA 2RMLA 3AAWB 3CJ3A 4L73A 4O4RA 3SDEB 4CO0A 2HQFA 1AYEA 2GJFA 2HAIA 3AB2B 3CT9A 5F0WA 1FCAA 1XK8A 2BE7D 3BR9A 4X66J 4WP8A 1UWBA 2HHUA 2V8PA 1B7YB 2ZH1A 3BKFA 1KTQA 1UKUA 3NOGA 1GX6A 2BQUA 1ZAVA 4Y34A 1MWYA 2J6UA 1RAIB 3MR2A 1GH8A 2DNPA 2Z56B 1TKTA 1JKHB 1VRQC 5C2CA 4DF8A 3DLJA 5C5JA 2V4RA 2VBWA 3NS6A 2XS2A 3FQLA 1TQLA 4LRCA 1T95A 2FHMA 4DFJA 2ASLA 1AA1B 2GIFA 3ZZTA 1S1WA 3N6LA 3GTYX 3GJSB 1JJCB 4I4BA 5B0DA 1FO1A 1RT1B 1VC6A 1Q86T 1S99A 1OY8A 2WSCC 4DR7F 1PJ6A 1S1XA 4KJIA 4CI0B 2J0XA 2VOPA 2FHJD 2GHPA 2GHWA 4OYWA 4USTA 3VCDA 1QAIA 3R6GB 1JQGA 1S1VB 3PO4A 1VQLS 2FZCB 2DYAA 1O5JA 4L3NA 4DR3F 2RDJA 3QRQA 1WOPA 2ZH3A 1SUQB 4K4VA 5KTQA 2XC9A 1RAFB 3I0SA 3PY8A 3Q8RB 2DRAA 3OVBA 3PW5A 1JLFA 4DQQA 2HPUA 4MYUA 3G2XA 3OTOJ 1SQFA 2ZUGA 5LSRA 3M8RA 4CNZA 5A2QY 3MM8A 4F7VA 3UDCA 1CC7A 2B7BB 2MKCA 2UV8A 4K0KJ 1SC3B 1KR4A 3MWBA 5HQLA 3BPSP 3BSNA 2ZH2A 5CZVA 4KFBA 1S49A 1CQNA 4HHHA 1YRUA 2HWHA 3ADAC 3MD3A 3TR5A 1URNA 3D1HA 4O0NA 2CQGA 2BABA 2EG1A 3OVAA 3TYTA 3ZTPA 3A8JA 3FMBA 3PX4A 2P2CB 2BXJA 3HO1A 1U6ZA 3I4HX 3CW2C 1SJRA 2J8SA 2PMWA 3PEJA 5IV4A 4DR1F 4DSJA 4LF4J 2FJDB 2NSBA 4N8OA 1UFKA 2XB2D 1WHWA 5E33A 4MAKA 3ILJA 1KOOA 4JV1A 1V5VA 2DNZA 3PW4A 4ZP8A 1KVIA 4P2XA 4DJBA 1NO8A 1WTBA 4ILMA 3PRVA 4DSLA 3NNHA 3CCZA 3H42A 4P6QA 3EVMA 1UWAA 1FX2A 2XGPA 3L7PA 3FSIA 2Q43A 2FTRA 4P73A 5F8HA 4CWBA 3QT8A 4CO5A 3RB0A 1T7PA 4GVLA 1NJYA 4B3TJ 1R8BA 3UPFA 1U2FA 3CCRS 5DRKA 3QRPA 2C2NA 1EJ7L 1RTIA 3DLHA 1ZM4A 1YHQS 3MCOA 4ENOA 5I3UA 4WZMA 2B9XA 5KOXA 1WJ9A 1IR2A 1BQNB 4CLWA 3DRSB 1VLOA 1VISA 3HD1A 3CO9A 4BHQA 3GV5B 4LSLA 5LJ3Y 4C3KA 2DNNA 1H3DA 3CSKA 2GV1A 1DTQB 2MQNA 3LP2A 1PC5A 3U27A 4TQSA 4YB1P 3N01A 3PW0A 2DIUA 3AB4B 2XCAA 2BOPA 3CC4S 2A6MA 4GKJF 3LALA 4L72B 2A6OA 5K8PA 1RT5A 4A8WA 4R25A 4WP3A 3M6VA 3Q22A 3W3SA 1VK3A 3FBEA 2HVHA 1N5VA 1S4FA 1WACA 1UW4A 2MQ8A 3C46A 4NLDA 4JV2A 2VDIA 3GIRA 4L6V3 4YQWA 1FVQA 5KFSA 1VBXA 3QIPA 4ZVPB 3BGLA 1NK4A 1JLQB 3EGWB 3SQGA 4DDFA 1ZYQA 3G4SS 2LQ9A 3TRGA 3UCZP 1HNZJ 2GAGC 3O3LA 4M94A 4C7QA 1DQAA 2QT7A 2RRAA 3MM6A 2AU0A 2FQQB 3MR6A 3TO8A 3W2VA 4QWAA 1T05B 4PWDA 4DV3J 1PGZA 2CQDA 3OJUA 3HVTA 1SKUB 2B6AA 3NRBA 2GQCA 1RLDA 1QAXA 2M2BA 4PG5A 3JB9k 1M90T 2LEAA 3BR8A 4JI3J 3A13A 2RDIA 4AT1B 4KKOB 3QJJA 1LWCA 3W9JA 2BX6A 1I5OB 4DWIA 2LXIA 2KKHA 2RT3A 5CXTA 1WKLA 2HYIB 5IM0B 1SI9A 1YDLA 1G3OA 3S7RA 4PXCA 1NSPA 2HNZA 1IKXA 1K1SA 2VPZB 1REGX 4AL6A 2HGNA 2LP4A 2EFGA 3QZ8A 1FHTA 2D3O1 2K1RB 3PNIA 1KC8T 3OVSA 2J0QD 4K2JA 3HHDA 4EBEA 3W2WA 2YNHA 1ELOA 5DG8A 2ZZMA 1N32F 1FI4A 1LWEA 4GKJJ 1K44A 2BKPA 1RHKB 4JV5F 1RHQB 3FJ2A 1LWEB 4ZVOB 3IRWP 1SL2A 2MSSA 1DARA 1Y5IB 4W98A 3AD9C 1WG4A 5CYJA 4C8NA 4I64A 2K7KA 3RYLA 1BQXA 4LRDA 4M5NA 1VQNS 1HBMA 3UVJB 4GKKJ 1IKXB 1Y5NB 2AZ3A 2PFDA 4RWXA 4C97A 4HT5A 4EWTA 1RZMA 3L4BC 1HMVB 3NWRA 2W9BB 4WZQA 2GQQA 3M2VA 1KBRA 2DY1A 4WXWA 2QLFB 4DPYA 1U1KA 3EVOA 1UA1A 5GAHU 5LM7E 2LQBA 5KFZA 4A8XA 3KOAA 3DGPA 1TK0A 1I94F 3KLIB 2AW0A 2AMCB 1X31C 3NWGA 4RBUA 1KNZA 3RG6A 5GAGI 5D78A 4EUVA 3EZUA 2CDRB 3PM9A 2CRLA 2DNOA 3K8WA 3D9BA 4RLEA 2A1BA 4DV7F 3IAS9 5U47A 4BBYA 2N82B 2FYXA 4A46A 5CYMB 2OSRA 2W4DA 1T11A 3DOKB 4I2QA 4DUZJ 2ASDA 3ISND 4TKTA 2AYEA 1HHTP 1S7IA 2HNDA 2B9WA 3EZ5A 2XLIA 2MQQA 1A9NB 5RUBA 3C15B 4KHPJ 2PN6A 5B0GA 1RT2B 2V50A 2IPOB 5DLGA 3ZNJ1 3FMWA 3BO3A 2UXDJ 5EN1A 3NS5A 1HR0J 2M9KA 4K2XA 3KJFB 3VWSA 4A8QA 3BN7A 2O66A 3TUJC 1FFWB 1JLEB 4YY3F 3U1LA 3AJ2A 1RTHA 2A2DA 4MMOA 4OZJA 4C8ZA 1MROB 1UJ6A 4FBTA 1RGVA 2B51A 4CT8A 2LLZA 3T3FA 4C8KA 3FNNA 5KFXA 2DH9A 3IS9B 4JV0A 2VOOA 2C42A 1DTQA 5C24A 2ZKUA 1VQYA 1NKEA 4AD6A 1XJWB 2IRYA 4RWWA 2CPYA 1OS5A 2SXLA 4DL5A 1VQPS 4KGZB 3P49B 2XO6A 4HTIA 1WOSA 2L41A 1KFSA 4ZKAA 2KH9A 3JYTA 3UDVA 1RTIB 2XHCA 4ZCIA 3LP1B 3DDNA 3V6JA 1W7WA 1HW8A 2GFFA 4TU7A 4WF9Q 2BJEA 4ANCA 1RAAB 4NLVA 2H4WB 4TLQA 3MHYA 1HKAA 3KK2A 3FZ2A 1VQ9S 2NQPA 4X4TA 4RPFA 5KAKA 1WDDA 5DETA 1UMJA 2FJEB 2ROGA 2HWTA 5J2NB 3TAMB 4DHVA 3GIJA 1S7HA 2NYHA 4CM2A 4ES2A 2MKKA 1TL1B 2O1PA 4NLOA 3OL7A 4JI4F 1XNRF 2JEIA 3PXGa 1QM9A 1CJKA 1KLMA 3D1OA 3MM5A 2DGTA 3EVWA 4HACB 5CYQB 3MXHP 4KGXB 4IQMA 4AQYJ 4HEA9 2A3JA 4Q2LA 5KOWA 2FLPA 5HMWA 3C2PA 4ERDA 3LGNA 1R0BG 3AOBA 1JWWA 4P2FA 5DG9A 2VFTA 3M8QA 3OLBA 2R7VA 1JLAA 2F65A 2ZOMA 4YHHJ 4I6WA 2J5AA 1F6TA 2MY7A 3NEKA 4OI2A 5D77A 2EBGA 3IG1A 4DBQA 2BE2A 1CPZA 4C11B 1LW0B 3DI6B 5BR8F 1U09A 2B3TB
chains in the Genus database with same CATH topology
2ZBIA 1TL3B 4QYZJ 3SCLE 1RTJA 4A8YA 3E2EA 3G6ES 5KT7A 1L3SA 2AYGA 2RF2B 1Y4ZB 1RYRA 4RUCA 1BC6A 2DPIA 2HMIB 1ZM2A 3QJLA 3HHLD 4FBUA 4IG3A 4OHWA 5AXNA 1W2BR 1SUQA 5HO4A 1ZM9A 2KHDA 5I4MA 1FTCA 1WF2A 4C98A 2RS2A 1MROA 3H5XA 4WTYA 1Q82T 1N5YB 1QJHA 3V5RA 1S6QA 3EPGA 4ZOSA 5AXMA 1N6QA 1H2TZ 2FVQA 2EFPA 5HI7A 3F41A 2B0GA 2CIMA 3CDBA 2JC1A 3OFFA 5GAEI 1HMVA 2AGQA 5SUHA 4YB6A 4DV0F 1RT4A 2RU3A 3R1HA 2IFXA 2HNYB 4OLPA 4AXJA 2VV5A 2HHWA 4PUOA 2E44A 2Y1RI 3I0RB 4EO8A 1N54B 5HQ8A 5D6GA 3MR5A 1TV6B 3GQCA 2LDYA 5JXSA 1D1UA 3OR1A 1UAWA 5THWA 1VQMS 2VG7B 3CMAS 1SL1A 1HFEL 5BYSA 4O3PA 2VG7A 3HDSA 4R0JA 5CZXA 2HQ3A 1ZAXA 4PQUB 1RQ0A 1SKRA 3GFXA 4ETXA 1KD1T 4ZS6A 4K4XA 3UD3P 4RNOA 2BJDA 3GIMA 4K4TA 2MJNA 1SV5B 5KT6A 3IGNA 5KFFA 1C2PA 4IG0B 3FGVA 4DR4F 1S48A 4A8SA 3MEGB 4Y00A 5E41A 1HWJA 2RE1A 4CT9A 3OHAA 3H40A 3M9NB 2YKPA 5LSOA 1D8YA 4K4ZA 4WU2A 1VRUB 3T1HF 1R7IA 4LF5F 1U7LA 3HVTB 1S1UA 1JMTA 4USJC 2HHSA 1U26A 5KG4A 1RT4B 4OJ1A 4F4YA 3OW2R 1FRHA 2VL1A 4NLWA 3K58A 4FS1A 1PILA 2CQPA 2RILA 2NXUA 5H1SV 3ZC4A 4CTAB 3DRYA 3C6TA 4ED0A 2O01C 4BDPA 1S6QB 1ZTWA 5MLCV 3HLUA 3FRZA 3FZBA 4CH0S 2C22A 5DDQC 1F9FA 2JX2A 3TA1A 1GTHA 2OD4A 1TKZB 2KG1A 4LF9F 1UETA 1KHVA 3DN9A 4RW4B 4ZDNA 1VQ8S 2OD6A 1APSA 2GO9A 3R3TA 3UFCX 1SIWB 1RTJB 4TU9A 2QSWA 3CCWA 1F0XA 2I9SA 2ZC3A 2RIJA 3AHPA 3IG1B 2ABYA 1H2UX 3M2RA 3RAQA 2IJNA 4DL4A 5DLFA 4RU9A 1RISA 3NG8A 1RT5B 3O6QA 5LMNF 4WFYA 1SH0A 4DQRA 3RW6A 3ISZA 4QZVB 2MQPA 1J5EF 1K9MT 1S77D 4FPRA 4LSLB 1RT6B 2IAJA 2ZKTA 2YKOA 5I3PA 1LW2B 2QE5A 4FYDA 4ECWA 3Q8QB 1FA0A 3T5JA 5EUHA 4QCLA 3TAMA 3GSDA 4KB7A 1RTHB 1X4EA 3HKZD 4AXIA 3DLEB 3PHEA 2VONA 4Q43A 2R8KA 4Q2MA 1JLCA 1N52B 1B0TA 2A2CA 3OR2B 3DLBA 2YNFB 2YNIA 1FTRA 1C4CA 2DR9A 4B9NA 2OPSB 2B43A 4F26A 3HFKA 3VAHA 2CYYA 2VUGA 3NCQA 2R8GA 1N48A 2YWKA 3KHGA 2O3DA 4IO9Q 1OQ6A 2G9OA 1KEKA 5DGAA 4PRFA 3DRRA 2OTLS 4PG8A 5E0OA 1O8BA 4J5OA 5IFMA 4NXMF 2AD9A 1NKCA 3CD5A 2FJAB 4OZLA 1S1VA 4O23A 2V8HA 3UW1A 1X9WA 3GFHA 5DDPC 1BWEA 3CWJA 2DR5A 3DRXA 4A8OA 1RT2A 2CQBA 2XMWA 3K5PA 2DGUA 4P7TA 4Y65A 3T6JA 3U1MA 1SJ3P 4WFZA 4QPXA 1RK8A 1KONA 5DGBA 1HWUA 4BCAA 3MPWA 3DLGA 4MYTA 2E1AA 3FFIA 1F5CA 3OUYA 1WWHA 3KJVA 1QAJA 1RYSA 4Q8EA 3G9CA 1R8PA 1U1NA 3V4IB 1YG0A 1VRUA 5GADU 4N76A 1TKDA 2CVEA 2VPYB 5E3PA 3OQ2A 1JLBA 1R3NA 3KLGA 2XO7A 4O44B 4OI3A 1VQKS 2ILYA 5KFRA 5C42A 3NMAA 1BGXT 2YQ3A 3PR4A 1QVGR 2J7KA 4G1PA 3H4DA 4LJMA 2YKQA 2ALZA 2P9GA 3I87A 5IXUA 1OSDA 4G1QA 1FJCA 1ZPWX 4EFAC 2AX0A 4QQBA 3IGVA 4ZP9A 2BANB 5J2QA 2UZAA 2EKYA 1HQEB 2HGLA 3BJYA 3LAKA 4LF8F 2YNIB 1J2VA 3OR2A 2X1AA 5KFGA 1UA0A 1GT8A 1Q78A 4BC9A 2JL9A 2CG4A 5B0AA 2VFRA 3GMGA 5L1JA 3E01A 3RAXA 3D5MA 5B7WA 2QLXA 4KGMA 4NZ6A 2CQCA 3PJWA 1R8AA 3DOLB 5KG7A 1RT6A 2IAJB 5I42A 1LWFB 2XWYA 5IQ6A 3I9ZA 4GO5X 2XMMA 1MW7A 3J7A1 4E98A 5IM0A 4UOCA 2BUNA 1FKOB 3NCPA 3P96A 4QWDA 5KT2A 1EETA 3D54A 4ID8A 2GMHA 5KG1A 4UUXA 4C0HA 2E29A 3M2RB 2ZH9A 1ZM3A 1IKYB 2B5JA 2GCFA 5FIIA 4RW9A 2GJIA 5BJRA 1N5YA 1HI0P 2NR0A 5J2MA 1YJRA 3CCMS 3N9UC 4DR6F 1IBKF 2JWNA 4ZVFA 2ZH8A 3S8SA 5CCLA 3F73A 2N3OA 2ZJQQ 4OI1A 2L48A 4A8KA 2J6TA 4RW4A 1HBNA 4ECSA 2JVRA 1RI7A 1R0AB 1U1QA 4C9DA 4X84A 5E3CA 3UR3C 3I82A 3N5FA 3HPOA 2EC0A 1L3KA 3M32B 4J9KA 4ICLB 1B64A 2E1MC 4ED7A 2JLFA 1IKYA 2B5JB 5J1EB 1RT3B 2LMIA 5HMZA 2G13A 3M8QB 1U2RA 3Q23A 2YWHA 4WFNQ 3TA0A 3GYXB 4XPCA 4DN0A 3VQTA 5HBMA 3LP2B 2HHHF 4DSIA 5J2PA 2EK1A 3MM5B 4O3QA 3SFGA 1NKBA 2CDQA 1REVB 4Q0BB 2GNKA 4D3GA 2VB6A 2FVCA 1S1UB 2LDIA 4I68A 1KS2A 4DX8H 4ILRA 4MIWA 4NZ7A 3BEGB 2V9WA 3NMRA 4RW9B 1MMNA 2W9CA 3IR5B 5KT5A 3PX0A 3AQOA 3CDAA 4MIBA 4NLPA 4ED1A 2VD3A 2BRKA 4KGKA 3HHKA 2HIQA 3DU6A 2J9CA 1FVSA 4ZP6A 3IWNC 3B78A 1P1LA 4Q44A 3U1NA 4JI1F 2DHGA 3J7YU 1J5OB 3PIPQ 3PRDA 2BA9A 4M8LA 2OPQA 1KHWA 2YH1A 4OZ0A 3ZZYA 5T14A 2CQ3A 1CG2A 2IJFA 4QR0A 1NH8A 3DXSX 2DCLA 4OJ3A 1K0TA 2DGXA 1AROP 1KOHA 4A8MP 4PCQA 3CJKA 3E01B 3N6MA 4O44A 1HD0A 4ELUA 3IAM9 1C0TA 3T5KA 2FLOA 4IFYB 1Q53A 2X1FA 1TK8A 1U8SA 2IM0A 4KFBB 4YP3A 4LT6A 4EGLA 5J2QB 3KMSA 4Y6IA 2WB1D 4OLOA 2OP5A 6FDRA 4TY8A 4DL2A 3ZZ0A 2V2KA 2VG5B 5LL6d 3SMZA 4NA1A 3UQSA 3I31A 1FKPA 2QZ8A 5F8LA 5C25A 5DQGA 1SBRA 3NNAA 1YWXA 1QY7A 2MZJA 4I6YA 2JRSA 2XY7A 3RB6A 1R31A 4WKRA 3QIDA 1UWBB 3CJKB 4CZCA 1JNZB 1FJGF 3MUVP 2YKMA 2ZHBA 3O2IA 4TY8B 3C66A 2OPQB 2W9BA 2VBXA 1YGYA 1FK9A 1UVLA 1VC0A 4UY85 4JI8F 1HBUA 2NZ4A 4DQIA 3CDEA 3RW7A 1VFJA 2FGCA 5F9LA 2JEGA 1BQMB 2AJ1A 3CDUA 4B17A 1C0TB 1Q1KA 3THVA 1YRTA 5LXRA 2WK4A 4OHYA 5DJBA 1HD1A 4QWCA 2KJVA 4TQRA 2DH7A 2JDJA 2M70A 2PC6A 2FUG9 5K8OA 2K1RA 1WTFA 3CB4A 3ONQA 2G4BA 4P7VA 4KV8B 4TYAA 2F9DA 1QSYA 2D3OR 1D9FA 3CC7S 3TAQA 1J5OA 3ITHB 1N33F 5DO2A 4AE5A 3KNAA 1O0PA 4C8OA 5F8NA 4RZRA 3GZ7A 3HHLC 1D0EA 1IUJA 4C0BA 1A7GE 4O4GB 2CPEA 2XZWA 3BDEA 1VJWA 2HHPA 1L3TA 1Z1ZA 3AH6A 1ZBTA 3CDWA 1Y7PA 4RUHA 1CC8A 4P2SA 1Q81T 1YQHA 3H25A 2Y0SD 2YKAA 1JIHA 4NZ0A 1S9GB 4NLXA 2E9RX 5KFTA 2ZC4A 2OMLA 3PRBA 5L38A 2KXFA 3QO9A 2D1CA 4QW9A 3OL6A 2KT5A 3G71S 1HYSA 5KFKA 5IWAF 1JXEA 4KR0B 1RT3A 2JEFA 4B3TF 4IO1A 2K3IA 1S79A 4Q45A 4NCBA 1OPZA 3CC2S 2HFZA 2VBZA 3LOUA 3EGNA 4FN5A 1JB0C 1EETB 2DK2A 1I6JA 1HR0F 3HK2A 2F8MA 5CQGA 2M8DB 5L1KA 4N56A 2HNDB 2XSFA 3JAMY 2OLWA 3HHEA 1S1TA 3JSBA 3CCSS 3EGZA 1U25A 3B4DA 3DOKA 3ZZOA 1LWFA 2W4CA 4OMFG 3FEXB 2BVZA 3T19A 3U02A 2L3MA 2ZOGA 3MECB 3VAMA 1VI7A 2ZHAA 2PI5A 3K59A 1T94A 3QGIA 1LK7A 1XN9A 5J2MB 2XLKA 2EFVA 1N0VC 2U1AA 1LXNA 1UP1A 4CTAA 1X5OA 4Y2KA 3ULHA 4J9MA 2CPZA 1WEYA 1HQEA 4X4NA 3BGRA 5I3QA 1X9MA 1FE4A 3KFWX 4RBTA 2YWFA 5JVGQ 2IC3A 3DXBA 4GMKA 5D4LA 2JHEA 5F0UA 1JK9B 3HZGA 1FXLA 1OQ3A 2W25A 1JNRB 3TW0A 1IR0A 3H5YA 2NUHA 1X4GA 2ZNZA 4TNOA 2YH0A 3KNGA 1OWXA 1M0SA 2V5HG 5T7LA 5E2QA 2V9KA 2V8DA 1Z2ZA 1ZPVA 7FD1A 1L5UA 2P6SA 3OHBA 2RS8A 4JOUA 1X5PA 4V19X 1R89A 3OTCA 4X4OA 1S6OA 3R5BA 2RVJA 3T5LA 3I5CA 4CO2A 2VG6B 1E6VA 2D3ZA 4DL3A 5FDLB 4UQGA 2PMZD 2UVVA 1EP4A 1S6PB 3RAMA 3ZZPA 5K8NA 2BW2A 4AYBD 4DS4A 1MU2A 2X51A 3C3LA 4J9RA 3GFZA 4OZ5A 5J1NA 1D9AA 3CCLS 1XC9A 2DNYA 2FJWA 3PO5A 4B9MA 3V4IA 1JJHA 1Q7YT 3O44A 2HRUA 3PACA 2DGQA 3SV3A 3ZZRA 2QEXS 1W25A 2MZTA 2KM8B 4IG3B 1FDNA 3FSYA 3I0RA 3M8PA 1UVIA 2MB0B 2NYIA 2HG4A 2FD2A 4NA3A 3W7BA 3V6KA 1U4BA 3QAUA 3UCGA 1P6TA 3WBZA 4C3MA 3RRHA 1HNVA 1IKVB 2AJ4A 4LSNB 2F3JA 1GXLA 4XDCA 1S97A 4OQJA 4NRTA 4B3MF 4URSA 2W9AA 3DI6A 1Y5LB 1ULRA 3H4BA 2JLGA 4E8UA 4ELTA 4WCEQ 4YR2A 4USIA 1AFJA 4NLTA 2QYCA 1GX5A 4M5DB 4HL9A 3VAIA 4JI5F 4ECRA 1HNIB 3DNCA 1H7XA 2KVIA 3WC0A 5L39A 1DTTA 3NBPA 3DLLQ 3L7OA 3N79A 4CO3A 1S9EB 3POTB 1DZ5A 2DGOA 5CH7B 2L9WA 2MKHA 4YB7A 3SDEA 4QBUA 2KRBA 3R27A 3OTEA 4HLBA 4GC7A 2VA3A 2V0NA 2GIQA 1Y3JA 3KG1A 5AJ3F 4BWJA 5E3RA 4KHPF 2P9CA 3PW2A 1TL3A 1WF0A 2ZE2B 2CPXA 4NYPA 2PGCA 4H54A 3OFGA 4K4SA 2HS0A 4NLSA 1JLCB 3QPIA 5B0CA 3S1TA 2R8JA 2PSZA 3DLEA 3MFIA 4LMZA 4YR3A 2D41A 1G2EA 1KN6A 3NL0A 3MM9A 3MTJA 3VZIA 1RWUA 3BQ0A 3BDPA 1UFLA 2N7YA 1LW2A 5L1IA 2ATLA 2V94A 2M88A 4N47A 4NL5A 2AJ0A 5J2PB 2GJ2A 2WBRA 3AY0A 2WB4A 4A4JA 2AGPA 1DAXA 1M5SA 3LH2S 4R0EA 1PSDA 1FE0A 1XBWA 3MF5A 3NKYA 2RQKA 4NX9A 2CQ1A 3SCJE 2D3UA 2FHOB