5IWAJ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5iwaJ00
3J7AN 2UUAJ 2UXCJ 2UU9J 1N34J 4B3SJ 1N33J 4HHUA 4RJVA 4LFAJ 4DR1J 3J80U 4X66J 4GKJJ 4KYZA 3D3BJ 4DUYJ 3R2CJ 3R2DJ 2MQ8A 2UUCJ 2E5LJ 4AQYJ 4DV5J 5FLXU 4DR5J 4JV5J 2KL8A 4DR3J 4YHHJ 4JI6J 4LF7J 5LMNJ 4DV4J 4NEYA 4LF5J 4JI1J 4LF8J 2MEWA 4NEZA 1FJGJ 3OTOJ 1XMQJ 4JI7J 4LFBJ 2ZM6J 1HNXJ 4DV6J 1HNZJ 4DR2J 1IBKJ 4LFCJ 4YY3J 4X62J 5IT9U 5IWAJ 4KHPJ 4DR4J 4DUZJ 4NXMJ 4JI4J 5LM7E 1IBMJ 4GKKJ 4DV0J 2MTLA 1XNQJ 4B3TJ 3W1YC 1J5EJ 4JI5J 2UXBJ 1N36J 4NXNJ 4V1Ak 4LF9J 3D3CJ 4DV2J 1XMOJ 5A2QU 2UUBJ 4KY3A 2HHHJ 4DV1J 5AJ3J 4JI8J 2VQEJ 1HNWJ 3J81U 4PWWA 3T1HJ 4K0KJ 1I94J 4DV7J 5BR8J 1IBLJ 4LF4J 2VQFJ 2UXDJ 2KVQE 1XNRJ 4B3MJ 3IMQJ 4DV3J 2F4VJ 3JAMU 4B3RJ 4OX9J 4JI0J 4LF6J 4DR7J 4X65J 5LMUJ 4JYAJ 4JI2J 1N32J 4JI3J 4DR6J 3T1YJ 1HR0J 4X64J
chains in the Genus database with same CATH superfamily
3MHYA 5ETNA 3SDEA 3BSCA 4FKXA 4DFKA 3D6FB 3POTA 4NL5A 4CDIA 1VGYA 1WSVA 3T9NA 2KT5A 5KT6A 3GB0A 4Y2MA 4IYQA 1DQ8A 5J2QB 2XZDB 2F1FA 1RCXB 2XMVA 2IIHA 2RF2A 3E8OA 2V9WA 1TK0A 4F3MA 2UVVA 4CRJA 1JLFA 3O1LA 1C0TB 3AODA 3ZZUA 1OSCA 2FGOA 2VBYA 3CCZA 2XS5A 1NLKL 2CRLA 4WP9A 1F9HA 2ZD1A 3ENVA 1TL3A 1LWEA 4HT5A 5HMYA 2XY7A 4FVMA 2CFXA 4QPXA 4MKYA 4IDKA 4MTPA 3HSZA 4OI4A 2D7SA 2FJWA 4DPXA 5F0WA 3AB4B 4JV1A 2UUBF 4Q0BA 1X4BA 4DQIA 2NREA 1S57A 1T9XA 2ASYA 5DGAA 1FJEB 2BJ8A 1H3DA 2CWXA 4B17A 1I6JA 1U0HB 4AQYF 1MWQA 3W65A 3J80Y 2XSJB 1RGVA 2YQ0A 3UN5A 5F8GA 4FXVA 1IKWA 5FDLB 4C0OC 1GMUA 1N5VA 2XGPA 1N5SA 3PG9A 4DV6J 3CC2S 3KLEB 1RKJA 3UQSA 3TZXA 3VAHA 2KHCA 1VIXA 2OPPB 3D0HE 1CJUB 2BE2B 5HJXA 3L7PA 4ZVHA 1XMOJ 4I6WA 1YQHA 1CQMA 3DKDA 1A9NB 2DR7A 1RT1A 3VV2B 1KQKA 2I38A 1TMJA 3CB4A 5IS2A 1WC3A 2GS8A 1G4CA 5CABA 2E7WA 1TL7B 4OJGA 4X4NA 1RWVB 4J7CA 4YR0A 3IA0A 3GJRB 2BQ3A 1X9MA 1X4FA 3UO0A 3SFUA 2DNOA 4MK9A 3DLEA 3DDIA 2CYYA 3HHKA 3ILOA 1DQAA 2LEAA 4DS5A 1AYEA 4LSNA 3PVXA 2NYIA 3PTWA 2MKHA 2XB2D 2CJQA 2V68A 4XDCA 1IM6A 5J1PA 1TUVA 3S1TA 3SFGA 5LJ5Y 2DEJA 3V5RA 3JQMA 2W2MP 1CEZA 2YKNA 5F41A 1JQGA 4CWBA 2CQ1A 2ACYA 2V5HG 4WTOB 4LF7F 3TI0A 4ZPBA 4LBIA 4JV2A 2RJZA 1I5OB 2J6SA 2B5JB 3ZZZA 3CO0P 3ITHB 5KFGA 2C1EB 4A8YA 4UY85 2Y1RI 2AU0A 4FYDA 1RBAA 5J2MB 3PX6A 2MZSA 1F2HA 2XY5A 1JKHA 4L6V3 3D0GE 4Z7CA 2HBQB 3EUNA 4CH7A 2CWKA 2VPWB 3M8WA 1CJKB 3KDNA 5AXKA 2RDDA 2GAHC 4IG0A 5CYJA 1V5VA 4QIFA 2B56A 2VBXA 5HQMA 2ATCB 3DOMB 3KJQB 4OYMA 3F0NA 2DISA 3A13A 3AT1B 1C1BB 3Q22A 5JVHQ 4E2FB 3CDWA 3K0JA 3KNAA 4DFJA 3RBXA 1FRKA 2WOMA 2HBZB 5F3TA 5D8HB 4KT0C 1VBZA 5D4OA 4CP5A 1P27B 3Q83A 1HL6A 3IR6B 4L72B 3RUBL 4TU7A 5KOWA 4ZLNA 3PX0A 3AFGA 2R8HA 1W26A 5LOQA 2HMIB 4F25A 4DL4A 1R6VA 4WFBQ 3IM9A 3TUZC 2UP1A 3RGIA 4FXDA 3R3TA 4WXWA 1BQMB 3KUGA 4TQRA 1OO0B 4A46A 2PT0A 2R7VA 4PWWA 4ZPCA 4ZPTR 4HHHA 4NCGB 1IKVB 2JL9A 3ISZA 2KG0A 4JBCA 1S1VA 1Q0NA 2IM1A 3K57A 2OH2A 3A3PB 1L5UA 1FRMA 2IHR1 3MXHP 4F4AA 4TY9A 1HWJA 1NNDA 3QT5A 4QWDA 5E3CA 3Q89A 2ZKUA 1HFEL 1VHFA 4ETZA 3M2VA 1FHTA 2Y3YA 5GMDA 1NZ8A 1N6QA 1S1TB 2DVIA 3DYAB 4EYIB 2JEGA 4DX7A 4DV4F 1RWWB 2FPHX 3T1AA 5IC4B 1SKWA 5FLXY 2QSFA 2HGNA 2ZM6J 4CO3A 2VIHA 4ID8A 2AD9A 2VKZG 1TKZB 1FI4A 2YBVA 2VICA 3U1NA 1S0NA 2VG5A 4DHVA 3G82A 3LPYA 2I9SA 2UUBJ 3J81U 3KLIA 4L76A 3V81B 4NCAA 5K14B 1XNRF 4C6AA 4W90B 4TY8A 2P2CB 3WX8A 4CIOA 1CS4B 1WORA 4M5DB 4O4GA 4KTQA 3AY0A 1GXUA 3W9HA 3QRPA 3KJNB 2RMLA 2P9CA 1KLMB 3C66A 2KO1A 5KG5A 3W8GA 3NY0A 3GFYA 1MW7A 4RW4A 4FF1A 3MEEB 3Q24A 1HQEB 2NXEA 4DLGA 2AX0A 3WC0A 4P2SA 1AZSB 2V8GA 3C15B 5B08A 5CYMB 4N7TA 5D4NA 2FC8A 2BEFA 1IBMF 2HQGA 4PEOA 1TKTB 3DRPA 3IGVA 3P8BB 5A6PA 1JMTA 1S5ZA 4KV8B 3JB9k 4USJC 4USVA 3C46A 3CIMA 3N5BA 3N28A 2RDJA 2EK6A 3D0IE 4DL2A 3NAIA 4PXDA 2EC0A 5LMUJ 4QYZJ 2COLA 3BQ0A 4OJHA 2ZBIA 2J9EA 1L3VA 1YIJS 2AZ1A 4F3OA 3K5OA 2L3MA 4ID5A 4GKJF 1UVKA 3J81j 2C2KB 3TJ9A 4ZLLA 1ZM3A 3P5BP 1R27B 4P72A 5IOLA 2NUUG 1S48A 3CWJA 2NXCA 2HZCA 1T05A 4FBUA 4UT4A 4U96A 4LF7J 2HVZA 5B0GA 4PPZA 3HHEA 4CLUA 1ZZNA 2VONA 1RA7A 5K8NA 2B8QA 5CCMA 1YJ9S 1Z2LA 1TMMA 3MCMA 1F5AA 3W5ZA 3V4MA 4X2BA 3CD6S 3IBCB 2UVUA 2WZ1A 1FE4A 1J5EF 2BX6A 1O51A 4NA2A 4C8YA 4O3NA 1LWEB 2HS3A 2ZNYA 1F3VA 1HWUA 3J7YU 2A2DA 1VK8A 1RBLA 5I3QA 1XEZA 4Q0BB 2C3UA 4C0BA 4FNHA 2RB7A 3AJ2A 3OL8A 3MM9A 1SCJB 2VOOA 4HKQA 2GNKA 4DF4A 5KFTA 4UQGA 1U24A 1FTCA 2F9JA 4ED7A 3CMAS 1EARA 1WUUA 3MFHA 2FLOA 1Y9OA 1K73T 3AB2B 2WHOA 3R5DA 3VR1A 1HPZA 2F63A 2KB2A 3R5BA 1NKCA 3KJVA 1X4AA 4ED2A 2QLJB 1HNZJ 3DOLA 2E5LF 1Q53A 1SQFA 3WIUA 5A0YB 3NRBA 1T94A 1K44A 4X4RA 2NZCA 4V1Ak 2YX1A 4DI6A 4P71A 5I42A 2M2BA 3LWMA 3FCVA 2CPXA 2E29A 3H5SA 1KVIA 2DPIA 3PRBA 5SUHA 2FZCB 5IT0A 2MSTA 5J1EA 2Z57B 1MMDA 4KQZA 4G65A 2EWHA 1ZM4A 1XK8A 2HHVA 2VQFF 2ZBRA 3W60A 3VVTA 1YGYA 2JHEA 2MQLA 4LUBA 3EGZA 1RAJA 2AQ4A 3ELHA 1AXQA 3W5XA 3PJ9A 1RWUA 2FDNA 3KK1A 2AEJA 3TZWA 1VQ8S 3DXSX 2X3GA 3MD3A 4DR3F 3FBFA 1RT6B 2VF3A 4ZP9A 4DL7A 4NEZA 2Z30B 3MUTP 4L3NA 1A0OB 3I31A 4P73A 3C16B 2FJXA 2WVFA 4OV1A 3TVYA 1BMQB 2HNDB 1VQYA 1O5JA 4FPIA 1SJ1A 1GNKA 2KG1A 3RB3A 3I5AA 2OKQA 3OTOF 2IM2A 4QW9A 4CLLA 3SIPB 1DLOB 4BHQA 4O3RA 2N7CA 3IWNC 2WBMA 1XR7A 4PG6A 2W1BA 1UFKA 1I94J 1JWWA 1AB8A 4YOEA 1RT3B 4WFXA 4QPTA 3KMSA 1XERA 3NP5A 3M2UB 1S7IA 2VBZA 4DR6F 5C2GA 2CPEA 2DNHA 2O3DA 4C0HA 4CTAA 2HHSA 4PYDA 1XC9A 4NX9A 2FLLA 1RHJB 1XQIA 2DCLA 1ZS6A 3C6TB 3JSRA 2DIUA 4IG0B 2H51B 3QAUA 3RU0A 2W8LA 4F50A 3SCKE 2LCWA 4K4WA 2BJ1A 1I1GA 2J9DE 3EWGA 5KG4A 4CLTA 3OJSA 2ROEA 2WVCA 3QRRA 4P9SA 4DLEA 1SKUB 1M5PC 4NZ6A 3JYTA 4HI2A 3E51A 4LFBF 4KGVB 1IR1A 2AGQA 4QU6A 1FKPB 1IWAA 2E5HA 4J9SA 4B9NA 1UA0A 2ZC3A 2RE1A 4MK7A 1TVRA 5KFMA 2OMLA 3CD7A 4UF4A 4Y34A 4ERDA 1YJVA 4ZITA 2ZBQA 2F4FA 1N5YA 1RHMB 3S6EA 4ZOSA 3BR8A 3H40A 1V5IB 4GC6A 1S1VB 5KFXA 4CM0A 1OQ3A 3I87A 4KGMA 2CPZA 3CD0A 4CO0A 2XYHB 4O23A 5K5MA 3JTOA 1ITPA 5DO2A 2CZ4A 1NH8A 3D2WA 3UWTA 1OY8A 2FJEB 2UXCF 3H42A 4R8UA 3T6BA 3LA0A 2VDHA 3M8YA 4RNMA 1S9EA 2H5EA 4LVOP 1QTNB 3M2VB 4Y28C 1GT8A 2HPUA 1SC6A 2FJBB 3CJTA 1H7XA 1N6QB 2GX8A 2CPDA 2BM1A 1UZHA 3LUYA 5H9EK 2Z2YB 4B02A 1ACMB 2OI2A 4FN5A 3PW5A 5L1KA 2QEXS 2ZZNA 4V19X 3IR5B 2VASA 3V6DA 2YNHA 3SQGA 5AE1A 4DG1A 3QJLA 1N52B 1RJJA 4C97A 2ALYB 2BOPA 2CQ3A 1S59A 4I4BA 5E41A 3H98A 4LRDA 1HQ2A 5L1LA 3M6UA 3DM2A 4I67A 4DJBA 1SJ3P 4P2MA 4TY8B 3R5GA 3ETMA 3WHIA 2FJAB 2K7KA 3AOBA 5HMWA 4O4GB 4ZVOB 2PE8A 2IYGA 3I5CA 3NGDA 2HEKA 4Y65A 4UZCA 3MEDB 3DC2A 4X4OA 3K5NA 3QT8A 1UCNA 5E3QA 1RI7A 1RT2A 3H20A 4BC9A 2OFGX 3FNNA 2YXLA 4O44A 2C2ZB 2GO9A 2E5LJ 3LANA 3OVSA 4M5GA 1Q8IA 1UZDA 3M7VA 3SSSA 3CDUA 2FY8A 5DRKA 4ECRA 2V6AA 4KGKA 2DNRA 5C42A 3DLGA 1SVDA 3W9JA 3EX7B 1NB7A 4HACB 3H59A 3MCOA 1HNXJ 2YNFA 2Z56B 3P4UB 3IAS9 1UA1A 3KXDA 2O66A 2AGPA 3NLCA 3HHLD 3IWLA 2CPYA 1K1QA 4RNHA 2JVRA 1DTTA 2R7RA 4ZIVA 4OYOA 3D66A 4YB6A 1X0FA 4ILMA 1BC6A 4KY3A 4NI2A 1R3NA 2E5GA 2RRAA 4DV0F 2VQFJ 2J0QD 2HNZA 2W9CA 1FDNA 5CD4H 3NOGA 4LF6F 3M8PA 4C3LA 4JI3F 2DGWA 1XIQA 2ZDOA 1DURA 2J0XA 2VFVA 1X31C 1RBOB 4LMZA 1TQLA 1YRUA 1PILA 5KG1A 1U1NA 3LAMA 2W01A 4LRFA 2V4JA 3PYDA 5DDRC 1T05B 4I6YA 2POKA 5BYSA 1F5BA 5DZ7A 3ENQA 4IH6A 2I5JB 3VF0B 3OTOJ 2MQPA 4C98A 1D9FA 1PGZA 2F7VA 3LPEA 4X62F 1ZBTA 3PHTA 4W92B 2OIHA 4USIA 4RBVA 1C1CA 3EZUA 2QRRA 1S77D 1PBAA 3KK2B 5A76A 2A3JA 3IAM9 3KLFA 3GIRA 4OV6A 3CCSS 1BQXA 2IJNA 4EUVA 5DGBA 2AYEA 4RWXA 1KQSR 3AOAA 1NJWA 3EYZA 4B3OA 3MAHA 2Y8WA 2JH3A 2YKMB 3M32A 3TAMA 3QFWA 2XMAA 4MH8A 2VPZB 2XNQA 4IFYB 3KUHA 3ZZ0A 3JTPA 3NNCA 2ZH6A 4PCQA 1W2BR 1N8RT 4IR1A 2MQ8A 1EP4B 4RUHA 3T5HA 4CYUA 3O6QA 2HFZA 5KFQA 1WI6A 2HWHA 1HPZB 2BACA 3M1VA 2IRXA 1HHTP 2P9GA 3ZZYA 3GE9A 3UCGA 1EKRA 3MM8A 5B0BA 3LP2B 4K59A 4MAKA 5K9FA 4RW9B 4M5LA 2XI3A 3QT7A 1RTIA 3W5YA 5EDWA 3B78A 1X5TA 4LF2A 4WYLA 4F04B 1B7FA 5LSOA 3P45B 1HARA 3OLAA 4NE9C 2Y9HA 5I42B 1VQ5S 1YJRA 3H2LA 3CF5Q 1S4FA 1NJXA 3JSMB 4HEA9 2RQCA 5CCLA 3CCTA 1HI0P 4ALZA 2AT1B 4KC5A 1CJTA 2RU3A 3QAEA 1YG0A 2G2OA 1JK9B 4C8MA 3LWLA 1FDAA 3PO4A 4X66F 3BN7A 4B9TA 3FFIA 2FTRA 1SC3B 4NLVA 4X65F 5CA5A 1R0BG 3HP6A 4N47A 3QJPA 1CC7A 1JLAA 1U1RA 4MFBB 2CPIA 2DHSA 4DSJA 4N56A 3MUVP 1WG5A 4NMLA 1WHVA 4LF1A 4KHRA 3PJWA 1WC5A 4BLGA 4B9VA 5GMEA 2GQCA 4AD6A 4Q43A 2BKOA 4L74A 4KAIA 1BE4A 5KOXA 2W9AA 2Y0BB 3BGRB 4OZJA 3KNGA 3GU0A 1P1TA 4FF2A 1EKSA 1MU2A 1TK5A 4QU7A 2Z4PA 2W9BA 3BV8A 2DGOA 5AE2A 2ZFHA 5L39A 1LWFA 3KMQA 3OL6A 1QLNA 4NWBA 1UMJA 2V4RA 1UVJA 3O8WA 4USUA 1AFJA 3PRDA 5BR8F 4KE5A 3UDLA 4QCLA 2F8EX 1NK7A 2WW8A 2ZH4A 4CO5A 4U7CA 5KT2A 4NZ0A 2OLWA 3GTYX 1U48A 4KFBA 1FTRA 2ZOGA 3QO9B 1GTHA 3GYGA 2EBGA 3JYTB 2R42A 1XMQJ 1GX6A 2EKNA 4ED4A 1TVRB 2CVIA 4CLFA 4LIWA 7AT1B 1EETB 1VC6A 4DV0J 5C5JA 4DWIA 3BM7A 3OXLA 3RBEA 2PIIA 1ELOA 3BQ1A 2RRNA 3G9CA 4IQXA 1XWLA 1WG1A 2B43A 4F7VA 2HLUA 1GH8A 3NNHA 2B3TB 1QY7A 4IRKA 1FKAF 2H4WB 3RG6A 4DV3J 4OX9F 3TZYA 3R5CA 2PMZD 3DOKA 1APSA 2V69A 2EI5A 3UD3P 3DRSB 4R8UB 3GV7B 2CJKA 2ILYA 4YB5A 2DD8S 3JAMY 4DX6A 1S9EB 4KR0B 1S4EA 4RJVA 1JLCB 2B9YA 1NKBA 1SL0A 3CDEA 4D3GA 3PYFA 1Y3JA 2QN6B 3KLGA 1VQPS 5DQGA 2XNRA 4X64F 2KXFA 5GAEU 4LR8A 2DK2A 4W4MA 2YTCA 3OTCA 2A6MA 2B51A 1KFSA 1IQZA 1SXLA 1UW9A 3V6DB 1NDCA 5HL7Q 2F8MA 4C4WA 1KHVA 1FF2A 3OV7A 3HJFA 2D3UA 3M05A 3BGUA 3HKZD 3LGMA 4RZRA 4CH1A 5A2QU 3JQKA 4C8NA 1T03A 3DM2B 1RQ0A 2P5VA 5IWAF 4OYIA 1DRZA 3ZTRA 1IBLJ 3QJJA 4RW6A 2AJ4A 4PWDB 3VQTA 1QAJA 3T5JA 4L73A 3H0PA 3CCUS 1LFWA 4RU9A 4MT1A 4HI1A 1OPIA 3DI6B 3U1MA 4W98A 4DCJB 4OI3A 4OL8A 1EJ7L 2MKCA 3N4WA 1HWKA 3AH6A 3CPWR 1H0HB 1VISA 3GR1A 1KD1T 1JJHA 2IJRA 2WK4A 4ZVUB 4QQBA 2JLEA 2YNFB 2HNYB 4DR2J 3CMQA 4RUCA 3N01A 4P52A 3M6VA 2GIFA 3DDNA 3M9NB 4AE5A 2NSCA 1WACA 3MMCA 1NXIA 1HWLA 2BRLA 5GAHU 2E1AA 1WWHA 4QR0A 2J9DA 1UP1A 4ZVQB 1HYSB 3H90A 1DQ9A 4ANEA 5AJ3F 3HHLC 1TV6A 2KVIA 4XPEA 5AXNA 3PX4A 4YN3B 3VAGA 3CO9A 3M8PB 3PNIA 1HA1A 1JX4A 2L9WA 1X4EA 4X65J 1NEEA 2AP6A 3VAIA 3G8SA 3ADAC 1EIYB 4RWWA 2HAFA 2BBEA 4ED3A 2GVDA 2V4JB 2XM3A 2OAUA 3RJMB 2V4QA 4OQJA 2YPYA 5KFZA 3RBDA 2VL1A 2KYXA 1W7WA 4GO5X 1IR0A 4ELUA 3GJTB 3D68A 4I0WA 7FD1A 3G6XA 3KLHA 3L9ZA 1WELA 5KT4A 4ICLA 3MM6A 2GA7A 5DDQC 4JI4J 2KRBA 3LAKA 5KFDA 5HANA 5D0GA 3V6KA 2DT9A 1U49A 1X0PA 3NCPA 5H1SV 2ASJA 3UR0A 1QTMA 1SKRA 3KK3B 1N56A 2R2SA 2MMYA 1HD1A 2G1HA 2RUSA 3SV4A 4UY8T 1HI8A 5BR8J 2E1MC 4AL6A 5CH7B 4PZVA 4ENOA 4ES3A 5DJBA 1AUDA 3TA1A 2UVRA 1DTQA 3M32B 3FCHA 3QZ7A 1VHIA 5KG3A 1I3OB 1H2TZ 2DHAA 3GYNA 5HP1B 2OUGA 5KFCA 2RIJA 1M5VC 2MZQA 1JLBA 1S9GA 3TZZA 1IN0A 3HSDA 5F8NA 1MWYA 1AT1B 3M1VB 1JJ2R 4MKVA 2DY1A 3H2UB 2EEYA 2V94A 2MYFA 4FDFA 3BGFA 2OJ3A 1R0AA 1QD1A 2ZWPA 3PY8A 3LGHA 2AX1A 1WD6A 4IFVB 4ZHRA 2IRUA 3G87A 3W3SA 1G2EA 1M1GA 4K4TA 3G6ES 3M2RA 3VVUA 1Z1ZA 2SXLA 1YZ6A 4Z2XA 2CUYA 5ETVA 1URRA 1IBKF 3MGJA 2QL5B 1HNWF 3D54A 4XPCA 6AT1B 1JLQB 1NBEB 3UN2A 1KFDA 3CJKA 4HH0A 4FYWB 1LXJA 2RKIA 5KFLA 2W25A 5EHHA 5A8KA 1U7LA 2EBEA 4X64J 2KT2A 4URGA 3CJ5A 2W2NP 2ZJPQ 1TKXB 2W7PA 3DFEA 4ZPAA 3TVZA 2Z2LA 3UE2A 5HJYA 3HHLB 2DH7A 4P10A 3UCUP 3C3LA 1B70B 1SPBP 2LFVA 3RR7A 4FBTA 2E9ZA 5IWAJ 1SB6A 3UFCX 1LW0A 1QM9A 3CCLS 3NKYA 1GEHA 3D3CJ 5KG7A 3FKBA 4P2FA 2CXEA 1SQGA 2VHGA 2VG6B 1NMEB 2NPIA 2W9BB 3OFEA 3LQVA 4G1QA 3MTJA 1URNA 4TN2A 3CJRA 4ZDNA 3E3XA 3THTA 4U67Q 3NEKA 2PDAA 3O2IA 1SI9A 2CZ9A 1H2VZ 2FZKB 2XY6A 3N9UC 5J2QA 3GIKA 3ZNUA 2UU9J 5EGYA 4M5JA 2GHVC 3N0VA 4FVCA 4H4KC 3K2YA 1YHQS 3CCMS 4KFBB 3AA8A 5JJBA 1HR0F 1C0TA 4JI6F 2VA2A 1BHNA 3I0RA 1ZA2B 5HMXA 1WDDA 5LSLA 4Y2IA 2MQOA 1OY9A 3BKFA 1PYOB 1JXLA 4FYXB 2FHKA 1FERA 4O0NA 5KTQA 2HGMA 4TKTA 3MEKA 1KN6A 3RAQA 5C24B 4WCEQ 3G8QA 2C2DA 5E0OA 1F1BB 4DSLA 2BANB 3IXQA 1VRQC 1S0VA 3P96A 5LXRA 3PW7A 5KFUA 5KFRA 3CDBA 3DOKB 2HSEB 1NK4A 4QOTA 2U1AA 4QR1A 4O3QA 1IVZA 2HHHF 1FWLA 3A8IA 4DSIA 2XSJA 4OZ1A 2HS0A 5A6WA 2MLZA 2FD2A 2QL9B 3TQEA 3M8ZA 4ZVFA 4K4YA 1GFWB 4OIXA 4X4VA 5FDLA 4O4RA 1WEYA 4J5OA 2QYGA 1ZM2A 2NPFA 1Z2ZA 3ZC4A 3TUIC 1L3KA 1NCLA 3V4IB 1G1XA 1U25A 1EB0A 4Q5VA 4R0EA 2OPPA 2QFIA 1PJ5A 1U47A 2BE2A 3DRYA 2LEBA 2XLIA 2MTLA 3I9ZA 1X5OA 2HHWA 1LQ9A 1D3WA 1OIAA 5DQIA 1ZETA 1TL7A 2AGOA 4CZCA 2FJDB 3AQOA 3M6WA 2H1YA 4J9KA 4NPOA 2QGFB 2LECA 3OHAA 3LGNA 3ENAA 2OPQA 2AJQA 4BBYA 3I4HX 3X1LB 1IJFB 4Q8FA 1T9VA 4ZVPB 1FXLA 5E3PA 2HBRB 2A0FB 1VC5A 3C2PA 2VQEF 2HRYA 2BKNA 2ZHBA 4B3MF 3A8KA 1U6FA 4B08A 1FRIA 4WK1A 3M8SA 2WSFC 2DNKA 2MKKA 4KRWA 4WYWA 2C3MA 1KSPA 2QTWA 1IXKA 2R7QA 2YNGA 2CQ4A 3K89A 2QLFB 3IS9A 2WVBA 1IBKJ 2JX2A 2CJ9A 1YJNS 3CEDA 4GRSA 2B5JA 3MM7A 4HLBA 2Y8YA 4NYOA 2B6AB 1NHKL 3QPIA 3ITHA 4KPCA 1KONA 3MI7X 4EK2A 1AA1B 2RILA 3MZIA 3DHXA 3FEXB 1X60A 1F5CA 1UJ5A 5F8HA 1BLUA 3D6HB 4JP8A 5E7OB 3NBPA 2KVQE 1YZ7A 1B0TA 4A8WA 2D3OR 2XI2A 3BZQA 1VYAA 3RB4A 2J76E 4A8OA 2GHPA 1TL5A 2JWNA 4ZVRB 3M9MB 2CDRB 4XK8C 3VAMA 3R97A 3DOMA 1S0OA 3D4JA 1NK5A 3BO4A 3F73A 3RW6A 2BM0A 1UFLA 1BUXA 3M8QA 2YX4A 1XJWB 3HMJG 4Y2CA 2XWYA 4IQMA 4UUWA 4Q2LA 4UOHA 5IM0B 2QA4S 3WDOA 8RUCA 2R9LA 2AYMA 2ZUGA 4BC7A 3KLHB 4K4SA 3GPAA 6FDRA 1B4SA 4DV6F 2ZE2B 3CJ8A 4UOGA 4OI6A 3CJ2A 3OTEA 5CXTA 2WONA 3ZXWA 1BQMA 4X4TA 1IKVA 4F0MA 5IT9Y 5DDOC 1XMOF 2PMHA 4R0JA 2BA9A 4H4OB 5LJ3Y 3WQPA 2CQHA 1Q5VA 4YR3A 3TWZA 4GKKF 3E2EA 1YJ7A 1R8CA 1E6VB 3OUYA 2DB1A 1DTQB 1T11A 1NO8A 4C2MA 5DG7A 2HFOA 2RS2A 1HR0J 2VG7B 1JXVA 3DYAA 5CQGA 2VA3A 2XO7A 1S72S 2FVPA 1S9GB 3B4MA 3M30B 2E7VA 4GVBA 3HI9A 4IH7A 4RL1A 5ETMA 2I0XA 5B7WA 3TX0A 2BW7A 3PYGA 1UEKA 3N6MA 4DX5A 1RYSA 2MB0B 1TUWA 2MHNA 2BOAA 5IV3A 3NCQA 4U6PA 1R0AB 1P9QC 1RISA 2JDJA 1U1LA 1VQSA 2L9NA 1BGXT 1ZZFA 1RAHB 1GXTA 2AEFA 2ZZMA 3R5AA 5LM7E 2I6WA 2LU2A 3EXCX 3V81A 5F8MA 1HNVB 4NLUA 2UUWA 3QYYA 3S01A 2ZH9A 1CS4A 4NLQA 1NSAA 6FD1A 2HHHJ 4LSZB 3LP1B 3K5LA 4NLSA 3R1LA 1T95A 2KJWA 1FO1A 2I2YA 5KT5A 4NLGA 2VOPA 2C3OA 2JNJA 4HHJA 5KFJA 1S79A 5A8KB 2R7SA 3I96A 5I3PA 1RT5A 1Q16B 3HZEA 1LXNA 4AT1B 3RYLA 2XC9A 5H9FJ 3N79A 3NG8A 2PFDA 1OYEA 3HSGA 2IDLA 1NJYA 2XLJA 4OZ0A 1YJTA 3C15A 2E9TA 4KJIA 2EXUA 5CYMA 3F56A 2BJ7A 2HK3A 2LQBA 2CNKB 1RLDA 4DN0A 3CCES 3MPVA 3R7BB 4P2XA 2XHCA 4ZN1A 1SL2A 4HT7A 4KV8A 1KC8T 3BR9A 1SC1B 2MZRA 2XMJA 3CJQA 2RQ4A 2ZITA 2QMWA 2QA4G 1N48A 5LSRA 4DU7A 2GQ2A 2WCXA 4Q7AA 3L09A 4G1QB 4F02A 3U02A 3IBWA 2VQEJ 4QZVB 4J37A 2VKRA 2GIQA 3K5MA 4J9QA 2DHHA 4NRTA 4B3MJ 4LREA 1T3NA 2CPHA 4C8OA 1R8PA 1D09B 2X3DA 4CNYA 3ET6A 3J7YI 2J6TA 1RAGB 3MAQA 3G71S 3SI8A 4DR7F 4LVNP 9ATCB 4RX6A 3UVJB 4DZ6A 4NYPA 3I0RB 1F6TA 4LF5J 1FFGB 5HK4A 1UWAA 1FCAA 2ZM6F 2GZOA 3A12A 2Y1JA 2VUGA 1XR6A 2L9DA 5KFAA 3I6PA 2JC0A 3ONQA 3UN3A 3US5A 3LO3A 2AJFE 3B54A 2VZ9A 4EFAC 3HJVA 3IRXB 2BZ2A 4PRFA 2HFVA 1SH3A 3T3FA 1AUSL 1OQ6A 4DSKA 2R8KA 4USKA 2KH9A 1X9WA 2JVOA 1NSKL 4WKRA 3SEOA 1C0UA 4A8QA 3BF4A 5EWEA 4U8VA 4MKAA 3I0SA 2BXJA 2MPUA 3QWPA 3HCXA 2EFPA 5J1NA 1RABB 1SJRA 4RUAA 5ETSA 3MUMP 2FHJD 3NMRA 1D8ZA 5A0YA 3MR6A 3DHWC 4E0DA 4K2XA 3HLUA 3MR7A 2ASLA 1Q4RA 2RAQA 4ETXA 1S1WB 3FUYA 2JJ4D 3D1QA 4LRBA 4YDDB 4NA1A 2CNLB 1RB0A 2FVRA 2JSXA 1T7PA 2RSQA 4DR4J 2DRAA 2ZZTA 2G13A 4ZS6A 1IM4A 5K8MA 4GKKJ 4NLTA 2AYGA 3EVOA 3ZZTA 1DHMA 2IM3A 2M9KA 2MHEA 2NR0A 1CSJA 2CQGA 5A8WA 5L1JA 4ZN3A 1RHQB 4OHZA 1DY3A 2QIFA 3MM5B 4DCOB 2R2TA 3U1LA 1Y5IB 4DUZF 8AT1B 4OI2A 2L48A 1RTZA 2HIYA 4WE1B 1U2CA 2CZVC 4DX8H 4Z7YA 5IXUA 3A3NB 2OPQB 4TVAB 3MOJB 2BQRA 5LMUF 4K50A 2JZ5A 4ZCIA 4I64A 2W2OP 3AJ1A 2J7WA 5EWFA 4LSLB 4C8ZA 1VQMS 5ETLA 3TW0A 1RT6A 3KG1A 1SH2A 3R2DJ 1AFIA 1VJWA 4C9DA 3EVMA 4K5SA 2HAIA 1WC4A 4DV5J 1FE0A 1ZYQA 4PXEA 4OX7A 3C16A 2YNGB 1FX4A 2HNDA 4LF8J 4DFPA 5E3RA 3FCWA 3IS9B 1OSDA 2OTJS 1DLOA 3MM7B 3UDVA 2MXYA 1IQTA 2XS2A 2CA9A 3CCRS 1RT3A 3NS5A 4NMXA 3M2UA 3NXZA 5F9LA 5E33A 3NBPB 4OYAA 1JB0C 4WXOA 2A10A 5D3GA 2Q6CA 4BS2A 3C6TA 3T5KA 2LLZA 4A8KA 4OMFG 3VGTA 2XULA 5C7PA 3D28A 2VFTA 1HKAA 2DRBA 2I8EA 3M8QB 4KYZA 2OD6A 3PHEA 1M5OC 4GMKA 2BR0A 1XR5A 5LT5A 3UR3C 1VQ7S 3BGOP 3G4SS 4ZP6A 1DFDA 4RW7A 1A6LA 2B9WA 3LOUA 2HKEA 1FKPA 1MMLA 4JOUA 2YKAA 1FFWB 2MJUA 3W63A 3SBMA 3UNYA 2DEIA 2XEXA 4WTYA 4NLRA 1HNZF 3KUEA 3GIIA 1NK9A 1M5HA 2WONB 2YNIB 3K8WA 3P6YC 5LL6d 3PDNA 4KO0A 2R4FA 1NM2A 3EM1A 1NSPA 1RTHA 2XSFA 1JLEB 3W64A 4ZP8A 1TK8A 5MLCV 1U8WA 1RKIA 2B4UA 4L75A 3OUYB 3TO8A 3MOZA 2HQCA 5J2NB 3IMQJ 4QYZK 4AL5A 1VMBA 1WTBA 4USTA 4DR7J 4OFZA 4OZ5A 5B0DA 1VQ4S 2FHJA 3PCOB 1FXDA 3HHNB 3AD7C 4WPAA 3LF0A 1Q1KA 3GONA 2IMWP 3FDSA 1T9TA 4OZNA 2DR9A 2XO6A 2JFKA 4GVBB 2XMUA 4JI2F 1ZA1B 4RBUA 2P8IA 3PV8A 3OXFA 3OFGA 4DR1F 3W2WA 1S1XA 2CPFA 4WWSA 2DR6A 3TRGA 1V3SA 3N6NA 2YKQA 1PBUA 5HVHA 2DNNA 4NXMJ 3HX9A 2C2EA 3SZ2A 3BREA 2HVDA 1U1KA 1VFJA 4O0IA 2OEMA 1RHUB 3KG4A 2BUNA 3PJXA 4JI8J 4Q45A 3MEDA 1I94F 2CPJA 3PM9A 1YDLA 5A8RB 5C2CA 1SJQA 2K3KA 4RU2A 1M1HA 4J91A 4QBUA 2JOQA 4F2SA 1RT5B 1R6YA 3R6GB 3RBZA 2DH8A 3DGVA 1H74A 2KFYA 5FJ4A 2J7UA 2QLXA 4M1KA 1JXEA 4HACA 3NGRA 4NA3A 3D6MB 1CULA 4DN9A 4LQ3A 2BRKA 1BXNA 2R7WA 3FMBA 5LMNJ 1Q86T 3QGIA 4DF8A 1H72C 3JSYA 1U6BA 2AV5A 2ADCA 1NUEA 1KR4A 3ZZRA 2KXHA 1VIOA 4DUZJ 2BYCA 1ZH5A 2IAJA 1HMVA 1NZAA 4I7FA 4CI0B 1X4DA 4DV2J 4F67A 4BWJA 2B9EA 2CVEA 3DMJA 4B9LA 2GVZB 2DHGA 5DM7Q 2WAQD 4NLDA 5KFWA 3C14A 1WDTA 3TNVA 3J81Y 1C4CA 3BDEA 1U1OA 4KH1B 3KLVA 3ET6B 2DXEA 2OPSB 4B3SJ 2MLXA 5HO4A 1FKOA 4YB7A 2YKOA 4Y0FA 1Q8KA 3FBBA 4LQ9A 2I5JA 1FVQA 2KRRA 2MDAA 2UUAF 2V63A 5B0EA 3HSJA 3W66A 3OFFA 1NPKA 1RUSA 4DMZA 2DGTA 3UDCA 2DIVA 1VOMA 2ZH5A 4NZ7A 3FQLA 3KK2A 3THPA 3A8EA 3EE3A 3MCSA 2HHUA 1UW4A 5ETOA 2J9CA 2Z0GA 1NDPA 1FESA 4CM2A 2CQ2A 5HN0A 4YEAA 1RT7B 4P7TA 2CQIA 5IQ6A 4QWEA 3AD8C 2E1CA 3DLKA 2YKMA 3KG0A 3FVYA 2ILZA 3AOCA 4ATNA 4EU0A 3S7RA 2R8JA 2UXDJ 4MMOA 3TX8A 3IC1A 1HBMB 2F4VJ 4IFYA 4JB8B 1C0UB 2QE5A 2W7OA 3U7JA 4DZDA 1EP4A 4N76A 4TU9A 2KFZA 2ALZA 3I0SB 2KI2A 4B9UA 1N34J 4V19J 2C2NA 4DL6A 3DLJA 3JXOA 1BY9A 3EMTA 2M8DB 3LP2A 4RW9A 2A2CA 2NQPA 1P1LA 5L8RC 1QVGR 2MKIA 2MY7A 2M0GB 5D0RA 2B8PA 2ZJQQ 1QJHA 2M4MA 2NSBA 2V8DA 1QAYA 4UTGA 3FZBA 2ZEJA 1HNXF 2CG4A 1UTAA 1JNZB 1EZZB 1EAYC 1WC6A 2ROPA 3MF5A 3JSMA 3V6HA 3HO1A 5A8WB 4JI5J 1Q7YT 5KFHA 3NWRA 5CZXA 1HNIA 1P8GA 3MPYA 3MECB 3MAAB 4I2QB 1VRTB 3QATA 2HURA 4JI2J 1FDDA 2QT7A 2K7JA 4K7QA 2W24A 3GFXA 2LQ9A 2HLTA 4IO1A 4MFBA 4DR1J 2RHQB 3RZAA 4OX8A 4FF3A 1R8BA 3OSNA 2HWTA 5KT7A 3IN5A 3BQ2A 2V34A 3T1YF 3HF5A 2GO8A 3EJMA 2HHTA 1J5OB 1K47A 3HT3A 2JEIA 2PEBA 1F0XA 4NLOA 2EC2A 2J7KA 3BYRA 2NUHA 3DU5A 4XIUA 5ETQA 1FA0A 4IO9Q 3BGRA 2DGVA 1NK8A 2GV1A 2BVZA 4XTTA 1TTHB 4TLQA 1S1UA 2VC1A 2VB6A 3MMBA 4LBPA 2OEJA 2OMOA 1N36J 2V50A 3BKUA 1BWEA 4KB7A 5D3GB 2W8KA 1YKWA 1L3UA 2M7SA 3G8TA 1S6UA 3KWMA 1WNEA 4JI0J 2ROGA 3MR2A 3QFHA 5GAGU 1AW0A 2FGCA 2DHXA 1MN9A 3W61A 1U02A 2CG8A 4DQRA 2HBYB 2PFFB 2Z2ZA 3QO9A 2VU5A 2CIMA 3G6YA 2XTJP 2C22A 4QYRA 4RW7B 3C8YA 3SCLE 1NJZA 3G6VA 2XLKA 2X1GA 4M5IA 3DGPA 4MYUA 3ICLA 1N33F 1V3RA 1EETA 4LFAF 3VALA 2MQQA 2HHPA 5HVFA 4J9RA 4URSA 4K4ZA 5KAKA 1JIHA 5CZVA 3MD1A 1PAEX 5F3ZA 1H38A 4IRCA 1V9OA 1FD8A 2M3DA 3ETOA 4KO0B 5GAEI 5JXSA 1RTHB 3TA0A 1ZAXA 2DCUB 4DPWA 1LK5A 2VV5A 3AAWB 3CW2C 1J27A 4CT8A 3PW0A 4D3HA 5M2RA 3DRSA 3LP0B 1FNMA 1UJ4A 2DGSA 1TFYA 3IFEA 1U1MA 1T9UA 2GGPA 1SBRA 5FIIA 1JLCA 4ELVA 1KNZA 3HDSA 5KFKA 1WOOA 4EGLA 3IRWP 3MMAB 3GR0A 2UUAJ 2H3EB 1I51B 5SZTA 4ZVTB 4WU3A 2IC3A 1NK0A 2BV3A 4PKDB 3G86A 3J80U 1WOSA 1FX2A 2HK2A 2MKYA 1OWXA 2ZH2A 2PC6A 1RACB 2LXIA 2ADBA 2BJ3A 2HYIB 3RRHA 3J7Z5 3W2WB 1S1XB 2PN6A 1K0TA 3VZHA 5M2UA 4ZJOA 5B0AA 2IVMA 2ZWOA 4F3QA 5ETPA 1Y00A 1DARA 2CJBA 1RSCA 1VLOA 4FZVA 5BXIA 2IRYA 3UPFA 5T7LB 1FD2A 2IYIA 2YQ3A 4N77A 3TUPA 4TYAA 1Q79A 4DL3A 3MR5A 3QIDA 3PIOQ 4PWDA 5I4MA 5D4PA 3O5TB 2DR5A 1B99A 4ZKAA 3WC2A 4OHVA 4C8KA 3DI6A 4F36A 5ADZA 1PYTA 2RU9A 2V2QA 5GAHI 4UUXA 2ZH7A 2N3OA 5GMKa 1LK7A 2QLBB 1R8AA 1FEHA 5AXLA 4ZCMA 2M52A 3I56S 3UCZP 1X5PA 1SV5B 5GADU 4E98A 1JLGB 3ULHA 3R6LB 2OTLS 3OR1A 2V9KA 3EGNA 4LRAA 2HNYA 3BSNA 2ZBCA 1YBUA 1CULB 4AYBD 4YHHJ 1VI7A 3Q8RB 1UJ6A 2C2MB 3OW2R 2ERRA 1X4CA 2WVDA 1RT4B 2AWZA 1ROFA 3FBEA 2DY9A 2JLFA 1XMQF 4H4MB 3Q8VA 1U26A 3RR8A 2IMOA 4OZ2A 3OVAA 1H98A 4HVZA 1TKDA 1WSRA 1HYSA 2R7OA 2X51A 2M88A 4JV5F 3SXLA 2IAJB 3OTBA 1HMVB 2J6UA 1FJ7A 4I7FB 1KQFB 1TP7A 4J9MA 1TELA 3DMJB 2ZBPA 4P75A 4ANDA 3QGPA 1NDKA 1HWIA 3C14B 3FGVA 1QVFR 1ICEB 1YJWS 3BGLA 4DV3F 4FS1A 2HQFA 2JFDA 2NLWA 2XMTA 4LT6A 3T1YJ 1F9EB 2KDOA 4CH0S 1WF1A 1FKOB 2OEKA 3H5YA 1LKZA 1PC5A 4TNOA 3GIMA 2K3IA 3D3BJ 4AXJA 1VQ9S 2WB4A 4WBFA 2WSCC 3IM8A 1R89A 1TL1B 4I1TA 4DQQA 3L4BC 1U0SA 2N3LA 2UV8G 5ETRA 2GIRA 4BCAA 4ZPVR 2MZTA 2MEWA 4IOCQ 2H54B 1S6QB 2XZWA 2NCKL 3HVRA 4N8NA 2XBPA 2IA6A 3KK3A 4F4ZA 4DL0C 3HT0A 4F4XA 2YWEA 2OO4A 2EPIA 3CD5A 3VAJA 1CQNA 4CLYA 3DLKB 4KHPF 4FYYB 3LW5C 1RWNB 1NU4A 1IBLF 3KYLA 2X1AA 3G96A 4NASA 3T19A 3R9LA 1MROA 3EGVA 4L3KA 1Y5NB 5HP1A 3DU6A 4RNOA 1NH7A 3MEGB 3TANA 2F3JA 5KFEA 4P74A 1RCOB 3KHGA 5L46A 1JJCB 2YX7A 1N33J 4LFAJ 4J9PA 1VJQA 2LMIA 5D78A 3GILA 1NPPA 3R7SB 2ASDA 2HFNA 4CLZA 5FLXU 2QG9B 4IFVA 3FSIA 3DLHA 1WOPA 4JI1J 1RWOB 4YUDA 2NXJA 2A1BA 4GVLA 4YP3A 4DR2F 4DBQA 4Z37A 3QIPB 1NDLA 4AUKA 3TVKA 1FNXH 2D9OA 4DQSA 2MGZB 1XBWA 2H5JB 1Q78A 5DETA 1JLQA 4KKOA 2UXBJ 3OXGA 2XZTB 1FJGF 3MPUB 3CXCR 3FBCA 3DXBA 3EPGA 2JEFA 3DLBA 1L3TA 1SJFA 1HNIB 4DSEA 2B4OA 1Y3KA 4Q2MA 1TU0B 1RADB 5HLFB 3HHDA 1TKXA 3CTRA 1IKXB 2QA2A 2Y1IA 4JYAJ 3D1OA 1OMSA 3H8YA 1HHSA 3I82A 2PSZA 2L08A 1UEVA 2PA3A 4N8OA 1IKYA 3HHLA 4LF4F 3QLHB 3IP0A 2R8GA 3HD2A 3EICA 3PFOA 2J0WA 2RUGA 2CNOB 1QE1B 1NJIT 5HAOA 2YVSA 2Z58B 2H4YB 2KKHA 3KKFA 1HIYA 3OQ2A 1REGX 3H5UA 4EO8A 3QMQA 2B4VA 2W4CA 2YQ1A 2HRUA 2KM8C 4MJKA 1S1UB 2VG6A 1NSQA 1Q82T 1UAWA 4JI4F 4IRDA 3MMBB 2CQ0A 1KHWA 5CYQB 1WHXA 4OYZA 3AXMA 4TLRA 3RRGA 1C2PA 1U2FA 2Z2MA 2EW9A 1LOUA 2YH1A 1MSWD 4R25A 4QWBA 1E6YA 4NXNF 3OFHA 3R27A 4PPDA 3D67A 1HQUB 3M6XA 5IQQA 4PQUA 1S6OA 4K4XA 2OD4A 3TEHB 4YR2A 2V8PA 5BYRA 4WFNQ 1NK6A 2HS4A 5G4DA 1PYSB 3C6UB 1QSLA 4ED5A 3ILIA 3SYZA 4AQYJ 4X84A 5KFNA 3DGPB 3WZ0A 4JV5J 2LU1A 2QJ3A 5E2QA 4M5MA 3GG0A 1EQ0A 2ZH3A 3H4BA 5C24A 2IVYA 3HFZB 3RAXA 1UWBB 3I4PA 5DG8A 9RUBA 4ILLA 4EEYA 2D3O1 4HL9A 3FEZA 2R2UA 1WG4A 4I2PB 3OBIA 2JLGA 4CCHA 2YWKA 4OLOA 4DDFA 4RW8B 2BANA 1AROP 1OS5A 4WFYA 4CLSA 2NZ4A 4CO4A 4EBCA 2IFXA 1TAQA 1ZPWX 5HVGA 4AFFA 4WP8A 1P6TA 2W2QP 5AE3A 3DLLQ 3E01B 2GGPB 4CQ1A 1Y0HA 4U7UK 1XNQF 3TUJC 2DNPA 3DNCA 1EX8A 2UUTA 3WX4A 4A8XA 1HBNB 3BN4A 1CG2A 3V2UC 2IC3B 1GAOA 1SH0A 3A3OB 4CNZA 3CC7S 2CJYB 4Q44A 2QX0A 3H2VE 1QDUB 2OHDA 4HHUA 2H65B 3V4IA 4UOFA 4IOBA 3W9IA 2FVQA 1RWMB 3R2CJ 3DRXA 2OELA 2YWWA 1S0MA 3SDEB 3NL0A 2RNEA 4DSFA 3POTB 3VTIA 4FS2A 5DZ6A 5IC6B 2IY5B 4OLPA 2CQDA 2HQ3A 3QNWB 4RO0A 4CLWA 1F60B 2LKZA 2NXNA 3GMGA 3DRRA 4KHPJ 2RF2B 5ETKA 3Q0AA 3C19A 3QSIA 3VGUA 2EK1A 4M5NA 1JLFB 3IG1A 5CHCB 4HH1A 2D74B 1PJ6A 1WJ9A 4J9UE 3FEYB 1KTQA 2LXUA 2DNLA 5J2PA 1U09A 2ZD1B 2OP5A 1WKLA 4J9VA 1VBYA 3DDKA 1FNOA 1TL3B 1B64A 3UI3A 2MSSA 2KM8B 3UW1A 2UU9F 1YSJA 1KP6A 4IDKB 3CNQP 2WB1D 3OR1B 4WJBA 4PXBA 4NLYA 4U9RA 3K59A 3CVKA 3L7UA 2XCAA 3Q8UA 2HWIA 1RU1A 2OSRA 1G3OA 3H5XA 3TP2A 1PSDA 2PI5A 2B6AA 4ZLPA 4WKYA 3GG1A 1FJGJ 4H4KA 3VCDA 2LQJA 3SSQA 4ITSA 1RAFB 1PO6A 1IKWB 3CCJS 1N0UA 5HI7A 5IZHA 1HLWA 1WEXA 3NGTA 2O1PA 3IGNA 2IPOB 5K8PA 3OPKA 3UNGC 3EZOA 4LF4J 5DQHA 1IJEB 5A2QY 2M70A 3V6JA 5EN1A 2LDIA 3VHQA 3K7RA 4USHA 2EFGA 4N5SA 3NNAA 5D4LA 5L1IA 1RK8A 3NS6A 2GMHA 1SUQA 1X5SA 1RT1B 1MN7A 2V8VA 3JQJA 4MIAA 2N4DA 1T0TV 1RLCL 5IM0A 4OHWA 1K0VA 2L41A 4B3RF 3WBZA 5IFMA 3CMES 5M2PA 1SC4B 4WIQA 4F2RA 4EBDA 3HULA 2V2VA 2ZE2A 2RT3A 3D1HA 2XYGB 2C42A 2HQDA 4HR2A 2IBOA 3DLEB 4PABA 4DV4J 4LSNB 4DUYF 2QYCA 1TFWA 1ULRA 4NLXA 4M8LA 2C2OB 4H4OA 3CT9A 3ZZPA 2AW0A 4DPYA 4YQWA 1U45A 3SCIE 3GJSB 2DGUA 3R5JB 2CQPA 5KFFA 4NXNJ 1E6VA 1Q5YA 2YKNB 2I1RA 4JI7F 2FHOB 4IR9A 3NGKA 3B82A 2J8AA 3ZTSA 2DXFA 4ECTA 3CCVS 1MROB 3D7SB 2VG7A 1TUGB 4ZIWA 1PIEA 1XNRJ 4PG7A 2VC0A 5HBMA 4JUZA 5AXMA 2QO3A 4A47A 4ZCLA 3M30A 2LDYA 2HHQA 3GFZA 2LEPA 3GIJA 4AXIA 2DKOB 3F44A 3BH6B 3W7BA 1RTDA 3N6LA 1FJCA 3AQPA 1JKHB 3MPDA 2V8HA 1N32F 3GWCA 1VLYA 4ZK7M 2V2KA 2Z8QA 2DO0A 1PKUA 2GJFA 4M94A 3D6TB 1NPRA 4I69A 2ZJRQ 3PYEA 4LJMA 1HNVA 4MIWA 3HFVA 3PR5B 2QMUB 3BSAA 2DBBA 1MMNA 4EO6A 4Y00A 2DJWA 2QLWA 3UD4P 3LP1A 1IBMJ 2GCFA 2ZOMA 1XNQJ 1YK9A 4KKOB 1IWGA 3JSBA 5BYQA 2WOMB 1LWXA 1ZPVA 2QC3A 2DNYA 2KTQA 3PZPA 3L3CA 2XG8A 4QR2A 2E5IA 2XHWA 1UEUA 2HGLA 1RA6A 3R1HA 1T3OA 1TL4A 3R7NB 2BKPA 4OYXA 2VPYB 2Q3PA 2IBKA 1U4BA 4ILRA 1GMWD 1QSYA 1GQEA 4X4SA 3TAQA 1X4HA 1IKYB 2V0NA 1VBKA 4B9SA 2HFUA 2GW8A 4I56A 1HBUA 2KJVA 3VGVA 4GKJJ 1BD6A 2X1FA 4ED6A 3AJDA 4F0KA 1RWKB 1RWPB 4E8UA 1RAEB 2QSWA 1ZM9A 4DFMA 2Y0SD 2JRSA 1QAIA 4K4UA 4P6QA 3VQSA 1Y7PA 2XCPA 2EVZA 1HBOA 4YFUA 2G4BA 4DL5A 2VJUA 2FVCA 4M95A 4ZCKA 1J5EJ 5KG6A 2BE7D 3R8YA 4LFCF 2PMWA 2E1PA 3HZGA 4A8SA 2G2YA 3GSIA 4F8RA 3LALA 1E6YB 3OR2A 5L9NA 2VG5B 3G82B 1MNEA 3TQ1A 4PQUB 2LQ8A 3UVJA 4DV1F 2B7BB 2J0SD 3KLIB 2CADA 4PR6A 2GHWA 3SCJE 1LNQA 4YDXA 3U27A 2DNGA 3FSYA 2WTFA 3HM9A 4EMDA 1RP5A 1KOHA 2GC8A 1KLNA 2RQKA 3X3UA 5AT1B 1KKHA 3D9BA 3K5PA 4OX6A 3I55S 1KDNA 4RW4B 2HHXA 2WRMA 2UZAA 4OHYA 5K20B 4GC7A 1X4GA 3IRXA 3O44A 5JUMA 2F9DA 1MG7A 5KFBA 1K8AT 4KSEB 1H73A 2F8HA 3VGSA 2J5AA 4WIIA 2CJAA 2N4CA 1PC4A 5T14A 2XQCA 4N41A 1Z4UA 2MY8A 4PG5A 1UVLA 3DRPB 4LR7A 4A8MP 5F8JA 3M9OB 2BDPA 4IH5A 4OYPA 1N54B 5U47A 3EGWB 1KVJA 5MAOA 3PO5A 3HVTA 4USWA 2BE9B 4DPUA 5C25A 1DJ0A 4B3RJ 2MZ1A 4EWTA 2YKPA 4BDPA 5G0RA 3GLJA 1UL3A 1YITS 1PAUB 5I3UA 1VQOS 2XYPB 3MPWA 5KFOA 3AHPA 4FXWA 4PG4A 2A18A 2ZOFA 3OHBA 4KGXB 1F9FA 5CD4A 4NRUA 2GJIA 2FB0A 4DUYJ 2WBRA 1FRJA 2JC1A 1S1WA 2EFQA 2Q66A 2AZ3A 3K8VA 3CIZA 4DR3J 4ID5B 5H9EJ 2WW4A 4C3KA 3BPSP 4PYAA 4I68A 5D0EA 5T41A 3CCWA 4JI7J 1HW8A 3PW2A 3DRRB 5JMNA 3MM5A 3MURP 1PG5B 4PUOA 1K9MT 2K2PA 3TYTA 3CJ3A 1S10A 2DH9A 3CUNA 4WE1A 2R7TA 1GMWA 3Q2SC 2W7AA 1FK9A 1V3ZA 3IG1B 3P49B 2J8SA 3CJSA 3NOCA 1OPZA 3VAKA 5J2PB 2DPJA 3BBBA 1F2GA 1A7GE 1LEOA 4NOHA 3UDEA 2DGQA 3MCNA 4LSLA 1FDBA 1RAOA 3KJFB 2KFNA 3T41A 4RUBA 1N32J 1Q8BA 4USMA 4DR6J 1UPMB 4CLKA 1T9YA 1FRLA 5DLFA 3HVWA 4G1IA 1Y11A 3PKYA 1QAXA 2NXUA 2OPRA 2MJNA 1VQNS 2EFOA 4NCBA 1H6KX 3GV8B 5B0FA 4LRCA 2GMLA 3MM9B 2KZZA 4KGZB 3FJ2A 2APOA 1S49A 2ZHOA 3W62A 4LF5F 1EQMA 4DS4A 4LBHA 3H7HB 7FDRA 2VD3A 4KH0B 4LFBJ 1T8EA 3TJAA 3Q2TC 4R5PA 2DR8A 4G3IA 3K17A 3KJVB 2F5GA 2XWXA 1U1PA 3OD2A 3TEGA 3OSPA 3DOLB 3SV3A 1LW2A 2BJ9A 3Q8QB 2YWFA 3CULA 5D6GA 1WF0A 4JV0A 2ATLA 5RUBA 2MKJA 2G0IA 1SUQB 2R2RA 3ISND 3H4DA 5KFSA 2BMBA 5H9FK 2UXCJ 2HVIA 3NAHA 4A8FA 1MLAA 1VK3A 4PG8A 2Q43A 2MKSA 5J1EB 2LA6A 4O3SA 2B0GA 4FF4A 1T9WA 2QMXA 4Y6IA 4IKAA 1D9DA 2YNIA 3K58A 3LH2S 5KG0A 4X4UA 2OFHX 3TR5A 5ITHA 2GJ2A 2LVWA 1WKJA 1U8SA 1KQGB 3KK1B 3PW4A 2YWGA 1KOOA 1JLEA 4LFCJ 1WF2A 3FMWA 5E3AA 4DR4F 3KHLA 1GK8A 2C3PA 1KBRA 4OI1A 2VPXB 3CDAA 1P9YA 3QZ8A 5J2NA 2C2RA 1BQNA 4QWCA 2R7XA 4RNNA 3BYPA 1N5QA 4ZJQA 4YY3F 4DV1J 2LP4A 1L3SA 1QSSA 1MWZA 3A8JA 2FZGB 4ED8A 1RU2A 5HBMB 5IT4A 2XGQA 1VRUA 1TAUA 1VQ6S 4IG3A 2FC9A 2RH3A 3EXYA 4ZPWR 3JAMU 2D1CA 2WSEC 2XS7A 1KTVA 1FFSB 4ZVEA 1RTDB 1HHQA 2IVFB 3L7OA 4K0KF 1WHWA 4EI2A 1U1QA 1RTJA 3P5TL 4TYBA 4DCPB 2HZVA 1S7HA 1OY6A 5LXYA 1NHUA 5L9XA 2DGXA 2AF6A 3QT6A 4DPOA 2FJVA 3B8HA 4DV5F 1RZMA 4CTAB 4OHXA 1HI1A 1UFWA 3CE8A 4EZ6A 4FP9A 1SIZA 4LF8F 2DTJA 2BW2A 3L95X 2UVWA 1UVNA 2HRTA 3EPIA 4O3PA 5HQ8A 1UKUA 3W2VA 3BO3A 1VR6A 5A8RA 2DXDA 4G1PA 1VDHA 4A48A 2CJXB 2FQQB 2MQNA 3BO2A 3BEGB 2ZH8A 3HPOA 4ES2A 1Q81T 1GTEA 1N5YB 3NCRA 4C8LA 3TA2A 4QIEA 4LF6J 3EZ5A 4WFAQ 4JI3J 1VBXA 3MWBA 3NS7B 1HBUB 2KU7A 2AMCB 2C28A 4DEZA 2FIUA 2PD1A 2KZMA 4ZVGA 1CC8A 4CO2A 1IR2A 1FVSA 3BSOA 2AIRB 2ZUAA 1KEKA 2W4PA 3J7ZT 2KXNB 4ZVSB 3QGGA 5HATA 1GMVA 2XMKA 3QGHA 3KHHA 4NLPA 2RVJA 4ZMMA 5F8LA 4WU2A 1FRHA 1SL1A 2RS8A 3HFKA 2VH7A 1HBOB 1SQEA 5IV4A 3KDOA 1O0PA 3GCXP 4HTJA 4X62J 5K8OA 2GVZA 5KG2A 3TOQA 5THWA 2M5YA 2GQQA 2YNHB 3SQGB 4DG1B 4OJ1A 2ZDPA 3JS9A 4X4QA 2LA4A 2BABA 3AD9C 4OYWA 2AJ0A 4F4KA 3OR2B 2OPSA 3CGIA 5HROA 5E5NA 3VZIA 1W25A 4U8YA 2GAGC 4QIGA 2A6OA 3NMAA 4ED0A 1OYDA 3B6BA 5DG9A 4B9MA 1RHRB 2EG2A 2BJEA 4DPTA 1HD0A 4FNIA 2D69A 2ZVIA 5L38A 3SQOP 4PWUA 1PCAA 2KL8A 1REVA 2FUG9 2B9XA 1RT2B 2IM0A 2CDQA 1GXLA 1ZTWA 4DOZA 4O44B 1RT7A 2RRBA 4UOCA 2K1RA 2G1DA 4NXMF 3O3LA 5C42B 3DLGB 3OTDA 2O5DA 1FRXA 4QWAA 1SJ4P 1HBMA 4I6AA 4QIWD 5F9NA 4JI8F 2HIQA 5KT3A 5FD1A 4WF9Q 2D9PA 4B3TF 3HVTB 1DTTB 5C25B 4C11A 3FQKA 5G0RB 4LF9F 4ER8A 1VQKS 5I3UB 1D0EA 4NI2B 2CKWA 2AHOB 3J7AN 2ZH1A 2F40A 4DV7F 2HNZB 2W9CB 4NLWA 4AL7A 4WP3A 4X66J 3B4DA 2IA0A 3GJQB 1OJ4A 3BDPA 1B7YB 2EG1A 5LMNF 1EHWA 1GX5A 4ZPDA 1YVFA 4HTIA 1R31A 3MR3A 3QQCD 5DM6Q 2UUCF 3BKTA 2R8IA 1N4LA 4PUOB 1V6HA 4YY3J 4DR5F 4UQTA 4ECUA 1FK9B 4CT9A 4TXSA 4ES1A 1K1SA 3ZFVA 4DV2F 3MECA 3MAAA 1WEZA 4I2QA 4YB1P 1VRTA 1DZ5A 4ZP7A 2DNZA 2KT3A 4RBTA 1FWPA 4K0KJ 5DLGA 5HSPA 2X1BA 1C1CB 3P3DA 4ECWA 2EFVA 4M5KA 3KLFB 2C3YA 3CSKA 3QWUA 4B3SF 2W4DA 3MTKA 3QSYB 1Y5LB 1CVJA 1J5OA 2OPRB 1G7CB 1M0SA 1SKSA 2B4PA 1N5TA 4B3OB 1LFPA 1S9FA 2KHDA 3OVBA 1N0VC 3EDRB 5GAGI 3TAMB 4K5RA 4ECSA 3BH7B 4F4WA 4ZLJA 4KIAA 3FC9A 4Q8EA 3IR7B 1UVMA 2YWHA 2G9OA 3Q8SB 2K06A 4URQU 4CYUB 4R5PB 2KN4A 5EX3A 1YI2S 1ZAWA 4OZ3A 5KFIA 1Y4ZB 5BJRA 5EX0A 2HG4A 3ZO7A 2RQMA 3MM8B 1LWCA 1LW2B 2YY3A 1RTIB 3Q86A 4XDDA 3RTVA 3HXMA 4ED1A 4ECQA 3PIPQ 2FLPA 2UXDF 4ZA1A 2LYVA 3FRZA 2F4VF 2N82B 1CJVA 4OX9J 4BWMA 4F26A 2VFRA 3PRVA 1NRKA 2Q1LA 4CLPA 1X8DA 1N34F 3FK4A 1YTYA 1NHVA 2G0JA 1M90T 1CJTB 3GQCA 3AA9A 3ISNC 4EZ9A 3M4XA 1LV5A 2FLNA 4TU8A 4WFZA 2BJDA 2M8HA 3ILLA 2ZVSA 4U95A 3BS9A 3OL9A 3FFIB 1D1UA 1VCTA 1IUJA 2R3VA 3GYXB 1Y10A 1YBTA 4HDGA 1JLAB 1CLFA 5EWGA 1KS2A 1D8YA 2HW3A 3LP0A 1DBDA 3VAFA 1G6BA 4JI5F 1BQNB 5D77A 3BJYA 4NYZA 4FKYA 1S6PA 1RE1B 4K8RA 4OZLA 2EFNA 4G6VB 2D41A 3ILJA 3MMAA 1VRUB 4OYBA 4EYHB 1VC0A 4IG3B 3NWGA 3QBCA 3Q8PB 4O3OA 2LXFA 1MU2B 4LR9A 2WVEA 2ZKTA 1RTJB 2CAJA 2Y1LB 2AJ1A 3OT9A 3PEJA 4S0MA 3ZNJ1 1LWFB 1KVKA 2D3ZA 4ELTA 2ABYA 3PR4A 3RRKA 2PI4A 2N7YA 2GMJA 4TQSA 3GCWP 1H7WA 2QA1A 4GO7X 2NS1B 3CJ4A 1X7VA 5T7LA 4MKBA 4NEYA 3PXGa 4OI0A 5GADI 1M5KC 2AYBA 4K2JA 1R7IA 1C4AA 3BPDA 1U2RA 1RWXB 2MLYA 1FWKA 3TJ8A 3PFEA 3W2VB 1QUPA 2CQBA 2PGCA 2Q6BA 4B3TJ 2GFFA 3W1YC 1N36F 4ECYA 4X4PA 4HYKA 2K8GA 4LF9J 1WC1A 4F4YA 1CBKA 3THVA 5AJ3J 2O01C 2ACMA 2E7XA 4DV7J 4XO0A 2P6TA 1SV5A 3TARA 1JLGA 4JI0F 1R8HA 2H9ZA 1WI8A 3HVAA 2B7CB 4XAKA 2FHMA 2U2FA 1Q95G 1KRPA 4RKUC 4Y3CA 3T1HF 2IJFA 2H48B 1WHYA 3HKWA 8ATCB 1RT4A 2LQ5A 2UUCJ 4H4MA 1RDRA 2CNNB 2RHSB 1U0HA 4LIRA 4DR5J 5KFPA 1BWVA 2DO4A 4J90A 5KFYA 3HD1A 3AXKA 4J9LA 2E9RX 2DYAA 3KLGB 1S12A 2XMMA 3H25A 3BB5A 4PQAA 3ZTPA 3KLEA 3KTQA 2XMWA 3F41A 2QZ8A 3BBFA 1CJUA 2FY1A 3M8RA 1CPZA 1F3FA 4ECVA 3I9V9 3MMJA 5HROB 2IDEA 1D9AA 1B3TA 2ZC4A 1NB2A 3D5MA 2QV6A 4MYTA 1T03B 5F8IA 3I5BA 3UD5A 5D15A 1TL1A 2RDIA 3IBFB 2E44A 1TR0A 1FT8A 4RW6B 1ZTTA 3TAPA 1X9SA 3FSXA 1S6QA 5DS7A 1W2IA 3Q23A 1SIWB 3BBCA 1REVB 1IBCB 4DQPA 4FYVB 4IOAQ 3ZTQA 2HQIA 3OJUA 4QIVA 3MFIA 4ECZA 1TZ0A 2K1RB 1YX2A 5IT9U 2MQMA 2P9EA 2VFSA 1ZOTA 1RXOB 1FXRA 1YRXA 3LTOA 1XN9A 3OLBA 2JEJA 4WZQA 1PJ7A 3EVWA 5JVGQ 2QL7B 4J9OA 2VODA 3MEGA 1HNWJ 3IO1A 4IUFA 2HVEA 3MMCB 3N5FA 3RW7A 4C11B 1YJUA 3SSRA 4F0HA 3T6JA 4H54A 5J2MA 1U6ZA 3RAMA 3CCQS 1TV6B 3PACA 2R7UA 2PO4A 4KPYA 2YH0A 2KYZA 3WIVA 3J7A1 1KWMA 3CJ0A 2UV8A 4M5HA 1CJKA 1NKEA 4DXLA 2E1RA 3T5LA 5B0CA 3QIPA 4YHHF 2GVDB 3Q8YA 5D0HA 3OL7A 3KOAA 2MGZA 2F65A 1VS3A 1C1BA 2HFSA 1WC0A 4RR5A 3KFWX 1O8BA 1B0VA 2O67A 2EKYA 4QJVA 3PKMA 1J2VA 3ZTOA 4ZJLA 1S76D 3A4TA 5B09A 3GSDA 3ENWA 3HK2A 1NAQA 3SMZA 5HLFA 3QRQA 1WTFA 1IKXA 4P7VA 4ICLB 3MM6B 2HMIA 1QUVA 1WKKA 2VBWA 4K4VA 2AEMA 4U7UD 1JJ4A 5GVQA 3I32A 3QLHA 4NCGA 4A4JA 5HMZA 2VFUA 4RLEA 3VWSA 1Q7LB 3GZ7A 1RAAB 4FPRA 1M1KT 2HVHA 1UVIA 2MZJA 2YPZA 3FRYA 1QE1A 3G2XA 3DCAA 1RYRA 1S97A 3A1YG 1H2UX 2P6SA 1YBAA 4ANCA 2E66A 4Y2AA 4DU8A 4MIBA 2NYHA 2W2PP 3NGSA 3RB0A 2AKWB 3T9ZA 2E5JA 1RAIB 1HW9A 3RB6A 2FVSA 1S1TA 1Q8LA 4JI6J 3W8PA 1FEEA 1T02A 5F0UA 5CYQA 1JLBB 4UW2A 1N88A 2OSQA 3ZZOA 1B0PA 2VDIA 2VJVA 3JTNA 2V67A 4KHMA 1LWCB 1TKZA 4DUTA 3KHRA 4UZBA 2QFJA 2FYXA 4C48A 1M5SA 4ZHRB 2AJ2A 2Q79A 1HQUA 5HQLA 2H5IB 3T1HJ 3FZ2A 3M2RB 1CJVB 1YWXA 5K14A 4WK3A 4RNFA 1YLXA 3C6UA 1VQLS 4C3MA 3GP9A 4RPFA 4ECXA 5EUHA 1DAXA 4M5DA 4YS2A 1O6XA 2CQCA 4M63A 4WZMA 3CJKB 2ZNZA 1KLMA 3NGUA 2RKIB 2BQUA 5DDPC 1ZAVA 3IWXA 2G0CA 1UWBA 1UPPA 3EDQB 4I2PA 2DNMA 3MEEA 4MK8A 4JI1F 1HQEA 4RW8A 3CC4S 1XTZA 2OGUA 4C7QA 1AZSA 2PEHA 1S99A 4YMEA 5ETTA 3DN9A 4HDHA 3S8SA 2X7IA 5KFVA 3PEHA 4CO1A 3E01A 3GFHA 2UXBF 1TKTA 4PXCA 3MDFA 1S6PB 4EBEA 1YRTA 4KBIA 1RHKB 2DNQA 1XMBA 1HBNA 1LW0B 5CAAA 1R43A 4QW8A 2G2ZA 1R0CB 2HZAA 1UETA 2V2ZA 2RD5C 4J9NA 4PAAA 2ZHAA 2DRDA 4JYAF 3GV5B 4OJ3A 2DITA 4Y2KA 2PA8D 1JNRB
chains in the Genus database with same CATH topology
3J7AN 2UUAJ 2UXCJ 2UU9J 1N34J 4B3SJ 1N33J 4HHUA 4RJVA 4LFAJ 4DR1J 3J80U 4X66J 4GKJJ 4KYZA 3D3BJ 4DUYJ 3R2CJ 3R2DJ 2MQ8A 2UUCJ 2E5LJ 4AQYJ 4DV5J 5FLXU 4DR5J 4JV5J 2KL8A 4DR3J 4YHHJ 4JI6J 4LF7J 5LMNJ 4DV4J 4NEYA 4LF5J 4JI1J 4LF8J 2MEWA 4NEZA 1FJGJ 3OTOJ 1XMQJ 4JI7J 4LFBJ 2ZM6J 1HNXJ 4DV6J 1HNZJ 4DR2J 1IBKJ 4LFCJ 4YY3J 4X62J 5IT9U 5IWAJ 4KHPJ 4DR4J 4DUZJ 4NXMJ 4JI4J 5LM7E 1IBMJ 4GKKJ 4DV0J 2MTLA 1XNQJ 4B3TJ 3W1YC 1J5EJ 4JI5J 2UXBJ 1N36J 4NXNJ 4V1Ak 4LF9J 3D3CJ 4DV2J 1XMOJ 5A2QU 2UUBJ 4KY3A 2HHHJ 4DV1J 5AJ3J 4JI8J 2VQEJ 1HNWJ 3J81U 4PWWA 3T1HJ 4K0KJ 1I94J 4DV7J 5BR8J 1IBLJ 4LF4J 2VQFJ 2UXDJ 2KVQE 1XNRJ 4B3MJ 3IMQJ 4DV3J 2F4VJ 3JAMU 4B3RJ 4OX9J 4JI0J 4LF6J 4DR7J 4X65J 5LMUJ 4JYAJ 4JI2J 1N32J 4JI3J 4DR6J 3T1YJ 1HR0J 4X64J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A N;  2UUA J;  2UXC J;  2UU9 J;  1N34 J;  4B3S J;  1N33 J;  4HHU A;  4RJV A;  4LFA J;  4DR1 J;  3J80 U;  4X66 J;  4GKJ J;  4KYZ A;  3D3B J;  4DUY J;  3R2C J;  3R2D J;  2MQ8 A;  2UUC J;  2E5L J;  4AQY J;  4DV5 J;  5FLX U;  4DR5 J;  4JV5 J;  2KL8 A;  4DR3 J;  4YHH J;  4JI6 J;  4LF7 J;  5LMN J;  4DV4 J;  4NEY A;  4LF5 J;  4JI1 J;  4LF8 J;  2MEW A;  4NEZ A;  1FJG J;  3OTO J;  1XMQ J;  4JI7 J;  4LFB J;  2ZM6 J;  1HNX J;  4DV6 J;  1HNZ J;  4DR2 J;  1IBK J;  4LFC J;  4YY3 J;  4X62 J;  5IT9 U;  5IWA J;  4KHP J;  4DR4 J;  4DUZ J;  4NXM J;  4JI4 J;  5LM7 E;  1IBM J;  4GKK J;  4DV0 J;  2MTL A;  1XNQ J;  4B3T J;  3W1Y C;  1J5E J;  4JI5 J;  2UXB J;  1N36 J;  4NXN J;  4V1A k;  4LF9 J;  3D3C J;  4DV2 J;  1XMO J;  5A2Q U;  2UUB J;  4KY3 A;  2HHH J;  4DV1 J;  5AJ3 J;  4JI8 J;  2VQE J;  1HNW J;  3J81 U;  4PWW A;  3T1H J;  4K0K J;  1I94 J;  4DV7 J;  5BR8 J;  1IBL J;  4LF4 J;  2VQF J;  2UXD J;  2KVQ E;  1XNR J;  4B3M J;  3IMQ J;  4DV3 J;  2F4V J;  3JAM U;  4B3R J;  4OX9 J;  4JI0 J;  4LF6 J;  4DR7 J;  4X65 J;  5LMU J;  4JYA J;  4JI2 J;  1N32 J;  4JI3 J;  4DR6 J;  3T1Y J;  1HR0 J;  4X64 J; 
#chains in the Genus database with same CATH topology
 3MHY A;  5ETN A;  3SDE A;  3BSC A;  4FKX A;  4DFK A;  3D6F B;  3POT A;  4NL5 A;  4CDI A;  1VGY A;  1WSV A;  3T9N A;  2KT5 A;  5KT6 A;  3GB0 A;  4Y2M A;  4IYQ A;  1DQ8 A;  5J2Q B;  2XZD B;  2F1F A;  1RCX B;  2XMV A;  2IIH A;  2RF2 A;  3E8O A;  2V9W A;  1TK0 A;  4F3M A;  2UVV A;  4CRJ A;  1JLF A;  3O1L A;  1C0T B;  3AOD A;  3ZZU A;  1OSC A;  2FGO A;  2VBY A;  3CCZ A;  2XS5 A;  1NLK L;  2CRL A;  4WP9 A;  1F9H A;  2ZD1 A;  3ENV A;  1TL3 A;  1LWE A;  4HT5 A;  5HMY A;  2XY7 A;  4FVM A;  2CFX A;  4QPX A;  4MKY A;  4IDK A;  4MTP A;  3HSZ A;  4OI4 A;  2D7S A;  2FJW A;  4DPX A;  5F0W A;  3AB4 B;  4JV1 A;  2UUB F;  4Q0B A;  1X4B A;  4DQI A;  2NRE A;  1S57 A;  1T9X A;  2ASY A;  5DGA A;  1FJE B;  2BJ8 A;  1H3D A;  2CWX A;  4B17 A;  1I6J A;  1U0H B;  4AQY F;  1MWQ A;  3W65 A;  3J80 Y;  2XSJ B;  1RGV A;  2YQ0 A;  3UN5 A;  5F8G A;  4FXV A;  1IKW A;  5FDL B;  4C0O C;  1GMU A;  1N5V A;  2XGP A;  1N5S A;  3PG9 A;  4DV6 J;  3CC2 S;  3KLE B;  1RKJ A;  3UQS A;  3TZX A;  3VAH A;  2KHC A;  1VIX A;  2OPP B;  3D0H E;  1CJU B;  2BE2 B;  5HJX A;  3L7P A;  4ZVH A;  1XMO J;  4I6W A;  1YQH A;  1CQM A;  3DKD A;  1A9N B;  2DR7 A;  1RT1 A;  3VV2 B;  1KQK A;  2I38 A;  1TMJ A;  3CB4 A;  5IS2 A;  1WC3 A;  2GS8 A;  1G4C A;  5CAB A;  2E7W A;  1TL7 B;  4OJG A;  4X4N A;  1RWV B;  4J7C A;  4YR0 A;  3IA0 A;  3GJR B;  2BQ3 A;  1X9M A;  1X4F A;  3UO0 A;  3SFU A;  2DNO A;  4MK9 A;  3DLE A;  3DDI A;  2CYY A;  3HHK A;  3ILO A;  1DQA A;  2LEA A;  4DS5 A;  1AYE A;  4LSN A;  3PVX A;  2NYI A;  3PTW A;  2MKH A;  2XB2 D;  2CJQ A;  2V68 A;  4XDC A;  1IM6 A;  5J1P A;  1TUV A;  3S1T A;  3SFG A;  5LJ5 Y;  2DEJ A;  3V5R A;  3JQM A;  2W2M P;  1CEZ A;  2YKN A;  5F41 A;  1JQG A;  4CWB A;  2CQ1 A;  2ACY A;  2V5H G;  4WTO B;  4LF7 F;  3TI0 A;  4ZPB A;  4LBI A;  4JV2 A;  2RJZ A;  1I5O B;  2J6S A;  2B5J B;  3ZZZ A;  3CO0 P;  3ITH B;  5KFG A;  2C1E B;  4A8Y A;  4UY8 5;  2Y1R I;  2AU0 A;  4FYD A;  1RBA A;  5J2M B;  3PX6 A;  2MZS A;  1F2H A;  2XY5 A;  1JKH A;  4L6V 3;  3D0G E;  4Z7C A;  2HBQ B;  3EUN A;  4CH7 A;  2CWK A;  2VPW B;  3M8W A;  1CJK B;  3KDN A;  5AXK A;  2RDD A;  2GAH C;  4IG0 A;  5CYJ A;  1V5V A;  4QIF A;  2B56 A;  2VBX A;  5HQM A;  2ATC B;  3DOM B;  3KJQ B;  4OYM A;  3F0N A;  2DIS A;  3A13 A;  3AT1 B;  1C1B B;  3Q22 A;  5JVH Q;  4E2F B;  3CDW A;  3K0J A;  3KNA A;  4DFJ A;  3RBX A;  1FRK A;  2WOM A;  2HBZ B;  5F3T A;  5D8H B;  4KT0 C;  1VBZ A;  5D4O A;  4CP5 A;  1P27 B;  3Q83 A;  1HL6 A;  3IR6 B;  4L72 B;  3RUB L;  4TU7 A;  5KOW A;  4ZLN A;  3PX0 A;  3AFG A;  2R8H A;  1W26 A;  5LOQ A;  2HMI B;  4F25 A;  4DL4 A;  1R6V A;  4WFB Q;  3IM9 A;  3TUZ C;  2UP1 A;  3RGI A;  4FXD A;  3R3T A;  4WXW A;  1BQM B;  3KUG A;  4TQR A;  1OO0 B;  4A46 A;  2PT0 A;  2R7V A;  4PWW A;  4ZPC A;  4ZPT R;  4HHH A;  4NCG B;  1IKV B;  2JL9 A;  3ISZ A;  2KG0 A;  4JBC A;  1S1V A;  1Q0N A;  2IM1 A;  3K57 A;  2OH2 A;  3A3P B;  1L5U A;  1FRM A;  2IHR 1;  3MXH P;  4F4A A;  4TY9 A;  1HWJ A;  1NND A;  3QT5 A;  4QWD A;  5E3C A;  3Q89 A;  2ZKU A;  1HFE L;  1VHF A;  4ETZ A;  3M2V A;  1FHT A;  2Y3Y A;  5GMD A;  1NZ8 A;  1N6Q A;  1S1T B;  2DVI A;  3DYA B;  4EYI B;  2JEG A;  4DX7 A;  4DV4 F;  1RWW B;  2FPH X;  3T1A A;  5IC4 B;  1SKW A;  5FLX Y;  2QSF A;  2HGN A;  2ZM6 J;  4CO3 A;  2VIH A;  4ID8 A;  2AD9 A;  2VKZ G;  1TKZ B;  1FI4 A;  2YBV A;  2VIC A;  3U1N A;  1S0N A;  2VG5 A;  4DHV A;  3G82 A;  3LPY A;  2I9S A;  2UUB J;  3J81 U;  3KLI A;  4L76 A;  3V81 B;  4NCA A;  5K14 B;  1XNR F;  4C6A A;  4W90 B;  4TY8 A;  2P2C B;  3WX8 A;  4CIO A;  1CS4 B;  1WOR A;  4M5D B;  4O4G A;  4KTQ A;  3AY0 A;  1GXU A;  3W9H A;  3QRP A;  3KJN B;  2RML A;  2P9C A;  1KLM B;  3C66 A;  2KO1 A;  5KG5 A;  3W8G A;  3NY0 A;  3GFY A;  1MW7 A;  4RW4 A;  4FF1 A;  3MEE B;  3Q24 A;  1HQE B;  2NXE A;  4DLG A;  2AX0 A;  3WC0 A;  4P2S A;  1AZS B;  2V8G A;  3C15 B;  5B08 A;  5CYM B;  4N7T A;  5D4N A;  2FC8 A;  2BEF A;  1IBM F;  2HQG A;  4PEO A;  1TKT B;  3DRP A;  3IGV A;  3P8B B;  5A6P A;  1JMT A;  1S5Z A;  4KV8 B;  3JB9 k;  4USJ C;  4USV A;  3C46 A;  3CIM A;  3N5B A;  3N28 A;  2RDJ A;  2EK6 A;  3D0I E;  4DL2 A;  3NAI A;  4PXD A;  2EC0 A;  5LMU J;  4QYZ J;  2COL A;  3BQ0 A;  4OJH A;  2ZBI A;  2J9E A;  1L3V A;  1YIJ S;  2AZ1 A;  4F3O A;  3K5O A;  2L3M A;  4ID5 A;  4GKJ F;  1UVK A;  3J81 j;  2C2K B;  3TJ9 A;  4ZLL A;  1ZM3 A;  3P5B P;  1R27 B;  4P72 A;  5IOL A;  2NUU G;  1S48 A;  3CWJ A;  2NXC A;  2HZC A;  1T05 A;  4FBU A;  4UT4 A;  4U96 A;  4LF7 J;  2HVZ A;  5B0G A;  4PPZ A;  3HHE A;  4CLU A;  1ZZN A;  2VON A;  1RA7 A;  5K8N A;  2B8Q A;  5CCM A;  1YJ9 S;  1Z2L A;  1TMM A;  3MCM A;  1F5A A;  3W5Z A;  3V4M A;  4X2B A;  3CD6 S;  3IBC B;  2UVU A;  2WZ1 A;  1FE4 A;  1J5E F;  2BX6 A;  1O51 A;  4NA2 A;  4C8Y A;  4O3N A;  1LWE B;  2HS3 A;  2ZNY A;  1F3V A;  1HWU A;  3J7Y U;  2A2D A;  1VK8 A;  1RBL A;  5I3Q A;  1XEZ A;  4Q0B B;  2C3U A;  4C0B A;  4FNH A;  2RB7 A;  3AJ2 A;  3OL8 A;  3MM9 A;  1SCJ B;  2VOO A;  4HKQ A;  2GNK A;  4DF4 A;  5KFT A;  4UQG A;  1U24 A;  1FTC A;  2F9J A;  4ED7 A;  3CMA S;  1EAR A;  1WUU A;  3MFH A;  2FLO A;  1Y9O A;  1K73 T;  3AB2 B;  2WHO A;  3R5D A;  3VR1 A;  1HPZ A;  2F63 A;  2KB2 A;  3R5B A;  1NKC A;  3KJV A;  1X4A A;  4ED2 A;  2QLJ B;  1HNZ J;  3DOL A;  2E5L F;  1Q53 A;  1SQF A;  3WIU A;  5A0Y B;  3NRB A;  1T94 A;  1K44 A;  4X4R A;  2NZC A;  4V1A k;  2YX1 A;  4DI6 A;  4P71 A;  5I42 A;  2M2B A;  3LWM A;  3FCV A;  2CPX A;  2E29 A;  3H5S A;  1KVI A;  2DPI A;  3PRB A;  5SUH A;  2FZC B;  5IT0 A;  2MST A;  5J1E A;  2Z57 B;  1MMD A;  4KQZ A;  4G65 A;  2EWH A;  1ZM4 A;  1XK8 A;  2HHV A;  2VQF F;  2ZBR A;  3W60 A;  3VVT A;  1YGY A;  2JHE A;  2MQL A;  4LUB A;  3EGZ A;  1RAJ A;  2AQ4 A;  3ELH A;  1AXQ A;  3W5X A;  3PJ9 A;  1RWU A;  2FDN A;  3KK1 A;  2AEJ A;  3TZW A;  1VQ8 S;  3DXS X;  2X3G A;  3MD3 A;  4DR3 F;  3FBF A;  1RT6 B;  2VF3 A;  4ZP9 A;  4DL7 A;  4NEZ A;  2Z30 B;  3MUT P;  4L3N A;  1A0O B;  3I31 A;  4P73 A;  3C16 B;  2FJX A;  2WVF A;  4OV1 A;  3TVY A;  1BMQ B;  2HND B;  1VQY A;  1O5J A;  4FPI A;  1SJ1 A;  1GNK A;  2KG1 A;  3RB3 A;  3I5A A;  2OKQ A;  3OTO F;  2IM2 A;  4QW9 A;  4CLL A;  3SIP B;  1DLO B;  4BHQ A;  4O3R A;  2N7C A;  3IWN C;  2WBM A;  1XR7 A;  4PG6 A;  2W1B A;  1UFK A;  1I94 J;  1JWW A;  1AB8 A;  4YOE A;  1RT3 B;  4WFX A;  4QPT A;  3KMS A;  1XER A;  3NP5 A;  3M2U B;  1S7I A;  2VBZ A;  4DR6 F;  5C2G A;  2CPE A;  2DNH A;  2O3D A;  4C0H A;  4CTA A;  2HHS A;  4PYD A;  1XC9 A;  4NX9 A;  2FLL A;  1RHJ B;  1XQI A;  2DCL A;  1ZS6 A;  3C6T B;  3JSR A;  2DIU A;  4IG0 B;  2H51 B;  3QAU A;  3RU0 A;  2W8L A;  4F50 A;  3SCK E;  2LCW A;  4K4W A;  2BJ1 A;  1I1G A;  2J9D E;  3EWG A;  5KG4 A;  4CLT A;  3OJS A;  2ROE A;  2WVC A;  3QRR A;  4P9S A;  4DLE A;  1SKU B;  1M5P C;  4NZ6 A;  3JYT A;  4HI2 A;  3E51 A;  4LFB F;  4KGV B;  1IR1 A;  2AGQ A;  4QU6 A;  1FKP B;  1IWA A;  2E5H A;  4J9S A;  4B9N A;  1UA0 A;  2ZC3 A;  2RE1 A;  4MK7 A;  1TVR A;  5KFM A;  2OML A;  3CD7 A;  4UF4 A;  4Y34 A;  4ERD A;  1YJV A;  4ZIT A;  2ZBQ A;  2F4F A;  1N5Y A;  1RHM B;  3S6E A;  4ZOS A;  3BR8 A;  3H40 A;  1V5I B;  4GC6 A;  1S1V B;  5KFX A;  4CM0 A;  1OQ3 A;  3I87 A;  4KGM A;  2CPZ A;  3CD0 A;  4CO0 A;  2XYH B;  4O23 A;  5K5M A;  3JTO A;  1ITP A;  5DO2 A;  2CZ4 A;  1NH8 A;  3D2W A;  3UWT A;  1OY8 A;  2FJE B;  2UXC F;  3H42 A;  4R8U A;  3T6B A;  3LA0 A;  2VDH A;  3M8Y A;  4RNM A;  1S9E A;  2H5E A;  4LVO P;  1QTN B;  3M2V B;  4Y28 C;  1GT8 A;  2HPU A;  1SC6 A;  2FJB B;  3CJT A;  1H7X A;  1N6Q B;  2GX8 A;  2CPD A;  2BM1 A;  1UZH A;  3LUY A;  5H9E K;  2Z2Y B;  4B02 A;  1ACM B;  2OI2 A;  4FN5 A;  3PW5 A;  5L1K A;  2QEX S;  2ZZN A;  4V19 X;  3IR5 B;  2VAS A;  3V6D A;  2YNH A;  3SQG A;  5AE1 A;  4DG1 A;  3QJL A;  1N52 B;  1RJJ A;  4C97 A;  2ALY B;  2BOP A;  2CQ3 A;  1S59 A;  4I4B A;  5E41 A;  3H98 A;  4LRD A;  1HQ2 A;  5L1L A;  3M6U A;  3DM2 A;  4I67 A;  4DJB A;  1SJ3 P;  4P2M A;  4TY8 B;  3R5G A;  3ETM A;  3WHI A;  2FJA B;  2K7K A;  3AOB A;  5HMW A;  4O4G B;  4ZVO B;  2PE8 A;  2IYG A;  3I5C A;  3NGD A;  2HEK A;  4Y65 A;  4UZC A;  3MED B;  3DC2 A;  4X4O A;  3K5N A;  3QT8 A;  1UCN A;  5E3Q A;  1RI7 A;  1RT2 A;  3H20 A;  4BC9 A;  2OFG X;  3FNN A;  2YXL A;  4O44 A;  2C2Z B;  2GO9 A;  2E5L J;  3LAN A;  3OVS A;  4M5G A;  1Q8I A;  1UZD A;  3M7V A;  3SSS A;  3CDU A;  2FY8 A;  5DRK A;  4ECR A;  2V6A A;  4KGK A;  2DNR A;  5C42 A;  3DLG A;  1SVD A;  3W9J A;  3EX7 B;  1NB7 A;  4HAC B;  3H59 A;  3MCO A;  1HNX J;  2YNF A;  2Z56 B;  3P4U B;  3IAS 9;  1UA1 A;  3KXD A;  2O66 A;  2AGP A;  3NLC A;  3HHL D;  3IWL A;  2CPY A;  1K1Q A;  4RNH A;  2JVR A;  1DTT A;  2R7R A;  4ZIV A;  4OYO A;  3D66 A;  4YB6 A;  1X0F A;  4ILM A;  1BC6 A;  4KY3 A;  4NI2 A;  1R3N A;  2E5G A;  2RRA A;  4DV0 F;  2VQF J;  2J0Q D;  2HNZ A;  2W9C A;  1FDN A;  5CD4 H;  3NOG A;  4LF6 F;  3M8P A;  4C3L A;  4JI3 F;  2DGW A;  1XIQ A;  2ZDO A;  1DUR A;  2J0X A;  2VFV A;  1X31 C;  1RBO B;  4LMZ A;  1TQL A;  1YRU A;  1PIL A;  5KG1 A;  1U1N A;  3LAM A;  2W01 A;  4LRF A;  2V4J A;  3PYD A;  5DDR C;  1T05 B;  4I6Y A;  2POK A;  5BYS A;  1F5B A;  5DZ7 A;  3ENQ A;  4IH6 A;  2I5J B;  3VF0 B;  3OTO J;  2MQP A;  4C98 A;  1D9F A;  1PGZ A;  2F7V A;  3LPE A;  4X62 F;  1ZBT A;  3PHT A;  4W92 B;  2OIH A;  4USI A;  4RBV A;  1C1C A;  3EZU A;  2QRR A;  1S77 D;  1PBA A;  3KK2 B;  5A76 A;  2A3J A;  3IAM 9;  3KLF A;  3GIR A;  4OV6 A;  3CCS S;  1BQX A;  2IJN A;  4EUV A;  5DGB A;  2AYE A;  4RWX A;  1KQS R;  3AOA A;  1NJW A;  3EYZ A;  4B3O A;  3MAH A;  2Y8W A;  2JH3 A;  2YKM B;  3M32 A;  3TAM A;  3QFW A;  2XMA A;  4MH8 A;  2VPZ B;  2XNQ A;  4IFY B;  3KUH A;  3ZZ0 A;  3JTP A;  3NNC A;  2ZH6 A;  4PCQ A;  1W2B R;  1N8R T;  4IR1 A;  2MQ8 A;  1EP4 B;  4RUH A;  3T5H A;  4CYU A;  3O6Q A;  2HFZ A;  5KFQ A;  1WI6 A;  2HWH A;  1HPZ B;  2BAC A;  3M1V A;  2IRX A;  1HHT P;  2P9G A;  3ZZY A;  3GE9 A;  3UCG A;  1EKR A;  3MM8 A;  5B0B A;  3LP2 B;  4K59 A;  4MAK A;  5K9F A;  4RW9 B;  4M5L A;  2XI3 A;  3QT7 A;  1RTI A;  3W5Y A;  5EDW A;  3B78 A;  1X5T A;  4LF2 A;  4WYL A;  4F04 B;  1B7F A;  5LSO A;  3P45 B;  1HAR A;  3OLA A;  4NE9 C;  2Y9H A;  5I42 B;  1VQ5 S;  1YJR A;  3H2L A;  3CF5 Q;  1S4F A;  1NJX A;  3JSM B;  4HEA 9;  2RQC A;  5CCL A;  3CCT A;  1HI0 P;  4ALZ A;  2AT1 B;  4KC5 A;  1CJT A;  2RU3 A;  3QAE A;  1YG0 A;  2G2O A;  1JK9 B;  4C8M A;  3LWL A;  1FDA A;  3PO4 A;  4X66 F;  3BN7 A;  4B9T A;  3FFI A;  2FTR A;  1SC3 B;  4NLV A;  4X65 F;  5CA5 A;  1R0B G;  3HP6 A;  4N47 A;  3QJP A;  1CC7 A;  1JLA A;  1U1R A;  4MFB B;  2CPI A;  2DHS A;  4DSJ A;  4N56 A;  3MUV P;  1WG5 A;  4NML A;  1WHV A;  4LF1 A;  4KHR A;  3PJW A;  1WC5 A;  4BLG A;  4B9V A;  5GME A;  2GQC A;  4AD6 A;  4Q43 A;  2BKO A;  4L74 A;  4KAI A;  1BE4 A;  5KOX A;  2W9A A;  2Y0B B;  3BGR B;  4OZJ A;  3KNG A;  3GU0 A;  1P1T A;  4FF2 A;  1EKS A;  1MU2 A;  1TK5 A;  4QU7 A;  2Z4P A;  2W9B A;  3BV8 A;  2DGO A;  5AE2 A;  2ZFH A;  5L39 A;  1LWF A;  3KMQ A;  3OL6 A;  1QLN A;  4NWB A;  1UMJ A;  2V4R A;  1UVJ A;  3O8W A;  4USU A;  1AFJ A;  3PRD A;  5BR8 F;  4KE5 A;  3UDL A;  4QCL A;  2F8E X;  1NK7 A;  2WW8 A;  2ZH4 A;  4CO5 A;  4U7C A;  5KT2 A;  4NZ0 A;  2OLW A;  3GTY X;  1U48 A;  4KFB A;  1FTR A;  2ZOG A;  3QO9 B;  1GTH A;  3GYG A;  2EBG A;  3JYT B;  2R42 A;  1XMQ J;  1GX6 A;  2EKN A;  4ED4 A;  1TVR B;  2CVI A;  4CLF A;  4LIW A;  7AT1 B;  1EET B;  1VC6 A;  4DV0 J;  5C5J A;  4DWI A;  3BM7 A;  3OXL A;  3RBE A;  2PII A;  1ELO A;  3BQ1 A;  2RRN A;  3G9C A;  4IQX A;  1XWL A;  1WG1 A;  2B43 A;  4F7V A;  2HLU A;  1GH8 A;  3NNH A;  2B3T B;  1QY7 A;  4IRK A;  1FKA F;  2H4W B;  3RG6 A;  4DV3 J;  4OX9 F;  3TZY A;  3R5C A;  2PMZ D;  3DOK A;  1APS A;  2V69 A;  2EI5 A;  3UD3 P;  3DRS B;  4R8U B;  3GV7 B;  2CJK A;  2ILY A;  4YB5 A;  2DD8 S;  3JAM Y;  4DX6 A;  1S9E B;  4KR0 B;  1S4E A;  4RJV A;  1JLC B;  2B9Y A;  1NKB A;  1SL0 A;  3CDE A;  4D3G A;  3PYF A;  1Y3J A;  2QN6 B;  3KLG A;  1VQP S;  5DQG A;  2XNR A;  4X64 F;  2KXF A;  5GAE U;  4LR8 A;  2DK2 A;  4W4M A;  2YTC A;  3OTC A;  2A6M A;  2B51 A;  1KFS A;  1IQZ A;  1SXL A;  1UW9 A;  3V6D B;  1NDC A;  5HL7 Q;  2F8M A;  4C4W A;  1KHV A;  1FF2 A;  3OV7 A;  3HJF A;  2D3U A;  3M05 A;  3BGU A;  3HKZ D;  3LGM A;  4RZR A;  4CH1 A;  5A2Q U;  3JQK A;  4C8N A;  1T03 A;  3DM2 B;  1RQ0 A;  2P5V A;  5IWA F;  4OYI A;  1DRZ A;  3ZTR A;  1IBL J;  3QJJ A;  4RW6 A;  2AJ4 A;  4PWD B;  3VQT A;  1QAJ A;  3T5J A;  4L73 A;  3H0P A;  3CCU S;  1LFW A;  4RU9 A;  4MT1 A;  4HI1 A;  1OPI A;  3DI6 B;  3U1M A;  4W98 A;  4DCJ B;  4OI3 A;  4OL8 A;  1EJ7 L;  2MKC A;  3N4W A;  1HWK A;  3AH6 A;  3CPW R;  1H0H B;  1VIS A;  3GR1 A;  1KD1 T;  1JJH A;  2IJR A;  2WK4 A;  4ZVU B;  4QQB A;  2JLE A;  2YNF B;  2HNY B;  4DR2 J;  3CMQ A;  4RUC A;  3N01 A;  4P52 A;  3M6V A;  2GIF A;  3DDN A;  3M9N B;  4AE5 A;  2NSC A;  1WAC A;  3MMC A;  1NXI A;  1HWL A;  2BRL A;  5GAH U;  2E1A A;  1WWH A;  4QR0 A;  2J9D A;  1UP1 A;  4ZVQ B;  1HYS B;  3H90 A;  1DQ9 A;  4ANE A;  5AJ3 F;  3HHL C;  1TV6 A;  2KVI A;  4XPE A;  5AXN A;  3PX4 A;  4YN3 B;  3VAG A;  3CO9 A;  3M8P B;  3PNI A;  1HA1 A;  1JX4 A;  2L9W A;  1X4E A;  4X65 J;  1NEE A;  2AP6 A;  3VAI A;  3G8S A;  3ADA C;  1EIY B;  4RWW A;  2HAF A;  2BBE A;  4ED3 A;  2GVD A;  2V4J B;  2XM3 A;  2OAU A;  3RJM B;  2V4Q A;  4OQJ A;  2YPY A;  5KFZ A;  3RBD A;  2VL1 A;  2KYX A;  1W7W A;  4GO5 X;  1IR0 A;  4ELU A;  3GJT B;  3D68 A;  4I0W A;  7FD1 A;  3G6X A;  3KLH A;  3L9Z A;  1WEL A;  5KT4 A;  4ICL A;  3MM6 A;  2GA7 A;  5DDQ C;  4JI4 J;  2KRB A;  3LAK A;  5KFD A;  5HAN A;  5D0G A;  3V6K A;  2DT9 A;  1U49 A;  1X0P A;  3NCP A;  5H1S V;  2ASJ A;  3UR0 A;  1QTM A;  1SKR A;  3KK3 B;  1N56 A;  2R2S A;  2MMY A;  1HD1 A;  2G1H A;  2RUS A;  3SV4 A;  4UY8 T;  1HI8 A;  5BR8 J;  2E1M C;  4AL6 A;  5CH7 B;  4PZV A;  4ENO A;  4ES3 A;  5DJB A;  1AUD A;  3TA1 A;  2UVR A;  1DTQ A;  3M32 B;  3FCH A;  3QZ7 A;  1VHI A;  5KG3 A;  1I3O B;  1H2T Z;  2DHA A;  3GYN A;  5HP1 B;  2OUG A;  5KFC A;  2RIJ A;  1M5V C;  2MZQ A;  1JLB A;  1S9G A;  3TZZ A;  1IN0 A;  3HSD A;  5F8N A;  1MWY A;  1AT1 B;  3M1V B;  1JJ2 R;  4MKV A;  2DY1 A;  3H2U B;  2EEY A;  2V94 A;  2MYF A;  4FDF A;  3BGF A;  2OJ3 A;  1R0A A;  1QD1 A;  2ZWP A;  3PY8 A;  3LGH A;  2AX1 A;  1WD6 A;  4IFV B;  4ZHR A;  2IRU A;  3G87 A;  3W3S A;  1G2E A;  1M1G A;  4K4T A;  3G6E S;  3M2R A;  3VVU A;  1Z1Z A;  2SXL A;  1YZ6 A;  4Z2X A;  2CUY A;  5ETV A;  1URR A;  1IBK F;  3MGJ A;  2QL5 B;  1HNW F;  3D54 A;  4XPC A;  6AT1 B;  1JLQ B;  1NBE B;  3UN2 A;  1KFD A;  3CJK A;  4HH0 A;  4FYW B;  1LXJ A;  2RKI A;  5KFL A;  2W25 A;  5EHH A;  5A8K A;  1U7L A;  2EBE A;  4X64 J;  2KT2 A;  4URG A;  3CJ5 A;  2W2N P;  2ZJP Q;  1TKX B;  2W7P A;  3DFE A;  4ZPA A;  3TVZ A;  2Z2L A;  3UE2 A;  5HJY A;  3HHL B;  2DH7 A;  4P10 A;  3UCU P;  3C3L A;  1B70 B;  1SPB P;  2LFV A;  3RR7 A;  4FBT A;  2E9Z A;  5IWA J;  1SB6 A;  3UFC X;  1LW0 A;  1QM9 A;  3CCL S;  3NKY A;  1GEH A;  3D3C J;  5KG7 A;  3FKB A;  4P2F A;  2CXE A;  1SQG A;  2VHG A;  2VG6 B;  1NME B;  2NPI A;  2W9B B;  3OFE A;  3LQV A;  4G1Q A;  3MTJ A;  1URN A;  4TN2 A;  3CJR A;  4ZDN A;  3E3X A;  3THT A;  4U67 Q;  3NEK A;  2PDA A;  3O2I A;  1SI9 A;  2CZ9 A;  1H2V Z;  2FZK B;  2XY6 A;  3N9U C;  5J2Q A;  3GIK A;  3ZNU A;  2UU9 J;  5EGY A;  4M5J A;  2GHV C;  3N0V A;  4FVC A;  4H4K C;  3K2Y A;  1YHQ S;  3CCM S;  4KFB B;  3AA8 A;  5JJB A;  1HR0 F;  1C0T A;  4JI6 F;  2VA2 A;  1BHN A;  3I0R A;  1ZA2 B;  5HMX A;  1WDD A;  5LSL A;  4Y2I A;  2MQO A;  1OY9 A;  3BKF A;  1PYO B;  1JXL A;  4FYX B;  2FHK A;  1FER A;  4O0N A;  5KTQ A;  2HGM A;  4TKT A;  3MEK A;  1KN6 A;  3RAQ A;  5C24 B;  4WCE Q;  3G8Q A;  2C2D A;  5E0O A;  1F1B B;  4DSL A;  2BAN B;  3IXQ A;  1VRQ C;  1S0V A;  3P96 A;  5LXR A;  3PW7 A;  5KFU A;  5KFR A;  3CDB A;  3DOK B;  2HSE B;  1NK4 A;  4QOT A;  2U1A A;  4QR1 A;  4O3Q A;  1IVZ A;  2HHH F;  1FWL A;  3A8I A;  4DSI A;  2XSJ A;  4OZ1 A;  2HS0 A;  5A6W A;  2MLZ A;  2FD2 A;  2QL9 B;  3TQE A;  3M8Z A;  4ZVF A;  4K4Y A;  1GFW B;  4OIX A;  4X4V A;  5FDL A;  4O4R A;  1WEY A;  4J5O A;  2QYG A;  1ZM2 A;  2NPF A;  1Z2Z A;  3ZC4 A;  3TUI C;  1L3K A;  1NCL A;  3V4I B;  1G1X A;  1U25 A;  1EB0 A;  4Q5V A;  4R0E A;  2OPP A;  2QFI A;  1PJ5 A;  1U47 A;  2BE2 A;  3DRY A;  2LEB A;  2XLI A;  2MTL A;  3I9Z A;  1X5O A;  2HHW A;  1LQ9 A;  1D3W A;  1OIA A;  5DQI A;  1ZET A;  1TL7 A;  2AGO A;  4CZC A;  2FJD B;  3AQO A;  3M6W A;  2H1Y A;  4J9K A;  4NPO A;  2QGF B;  2LEC A;  3OHA A;  3LGN A;  3ENA A;  2OPQ A;  2AJQ A;  4BBY A;  3I4H X;  3X1L B;  1IJF B;  4Q8F A;  1T9V A;  4ZVP B;  1FXL A;  5E3P A;  2HBR B;  2A0F B;  1VC5 A;  3C2P A;  2VQE F;  2HRY A;  2BKN A;  2ZHB A;  4B3M F;  3A8K A;  1U6F A;  4B08 A;  1FRI A;  4WK1 A;  3M8S A;  2WSF C;  2DNK A;  2MKK A;  4KRW A;  4WYW A;  2C3M A;  1KSP A;  2QTW A;  1IXK A;  2R7Q A;  2YNG A;  2CQ4 A;  3K89 A;  2QLF B;  3IS9 A;  2WVB A;  1IBK J;  2JX2 A;  2CJ9 A;  1YJN S;  3CED A;  4GRS A;  2B5J A;  3MM7 A;  4HLB A;  2Y8Y A;  4NYO A;  2B6A B;  1NHK L;  3QPI A;  3ITH A;  4KPC A;  1KON A;  3MI7 X;  4EK2 A;  1AA1 B;  2RIL A;  3MZI A;  3DHX A;  3FEX B;  1X60 A;  1F5C A;  1UJ5 A;  5F8H A;  1BLU A;  3D6H B;  4JP8 A;  5E7O B;  3NBP A;  2KVQ E;  1YZ7 A;  1B0T A;  4A8W A;  2D3O R;  2XI2 A;  3BZQ A;  1VYA A;  3RB4 A;  2J76 E;  4A8O A;  2GHP A;  1TL5 A;  2JWN A;  4ZVR B;  3M9M B;  2CDR B;  4XK8 C;  3VAM A;  3R97 A;  3DOM A;  1S0O A;  3D4J A;  1NK5 A;  3BO4 A;  3F73 A;  3RW6 A;  2BM0 A;  1UFL A;  1BUX A;  3M8Q A;  2YX4 A;  1XJW B;  3HMJ G;  4Y2C A;  2XWY A;  4IQM A;  4UUW A;  4Q2L A;  4UOH A;  5IM0 B;  2QA4 S;  3WDO A;  8RUC A;  2R9L A;  2AYM A;  2ZUG A;  4BC7 A;  3KLH B;  4K4S A;  3GPA A;  6FDR A;  1B4S A;  4DV6 F;  2ZE2 B;  3CJ8 A;  4UOG A;  4OI6 A;  3CJ2 A;  3OTE A;  5CXT A;  2WON A;  3ZXW A;  1BQM A;  4X4T A;  1IKV A;  4F0M A;  5IT9 Y;  5DDO C;  1XMO F;  2PMH A;  4R0J A;  2BA9 A;  4H4O B;  5LJ3 Y;  3WQP A;  2CQH A;  1Q5V A;  4YR3 A;  3TWZ A;  4GKK F;  3E2E A;  1YJ7 A;  1R8C A;  1E6V B;  3OUY A;  2DB1 A;  1DTQ B;  1T11 A;  1NO8 A;  4C2M A;  5DG7 A;  2HFO A;  2RS2 A;  1HR0 J;  2VG7 B;  1JXV A;  3DYA A;  5CQG A;  2VA3 A;  2XO7 A;  1S72 S;  2FVP A;  1S9G B;  3B4M A;  3M30 B;  2E7V A;  4GVB A;  3HI9 A;  4IH7 A;  4RL1 A;  5ETM A;  2I0X A;  5B7W A;  3TX0 A;  2BW7 A;  3PYG A;  1UEK A;  3N6M A;  4DX5 A;  1RYS A;  2MB0 B;  1TUW A;  2MHN A;  2BOA A;  5IV3 A;  3NCQ A;  4U6P A;  1R0A B;  1P9Q C;  1RIS A;  2JDJ A;  1U1L A;  1VQS A;  2L9N A;  1BGX T;  1ZZF A;  1RAH B;  1GXT A;  2AEF A;  2ZZM A;  3R5A A;  5LM7 E;  2I6W A;  2LU2 A;  3EXC X;  3V81 A;  5F8M A;  1HNV B;  4NLU A;  2UUW A;  3QYY A;  3S01 A;  2ZH9 A;  1CS4 A;  4NLQ A;  1NSA A;  6FD1 A;  2HHH J;  4LSZ B;  3LP1 B;  3K5L A;  4NLS A;  3R1L A;  1T95 A;  2KJW A;  1FO1 A;  2I2Y A;  5KT5 A;  4NLG A;  2VOP A;  2C3O A;  2JNJ A;  4HHJ A;  5KFJ A;  1S79 A;  5A8K B;  2R7S A;  3I96 A;  5I3P A;  1RT5 A;  1Q16 B;  3HZE A;  1LXN A;  4AT1 B;  3RYL A;  2XC9 A;  5H9F J;  3N79 A;  3NG8 A;  2PFD A;  1OYE A;  3HSG A;  2IDL A;  1NJY A;  2XLJ A;  4OZ0 A;  1YJT A;  3C15 A;  2E9T A;  4KJI A;  2EXU A;  5CYM A;  3F56 A;  2BJ7 A;  2HK3 A;  2LQB A;  2CNK B;  1RLD A;  4DN0 A;  3CCE S;  3MPV A;  3R7B B;  4P2X A;  2XHC A;  4ZN1 A;  1SL2 A;  4HT7 A;  4KV8 A;  1KC8 T;  3BR9 A;  1SC1 B;  2MZR A;  2XMJ A;  3CJQ A;  2RQ4 A;  2ZIT A;  2QMW A;  2QA4 G;  1N48 A;  5LSR A;  4DU7 A;  2GQ2 A;  2WCX A;  4Q7A A;  3L09 A;  4G1Q B;  4F02 A;  3U02 A;  3IBW A;  2VQE J;  4QZV B;  4J37 A;  2VKR A;  2GIQ A;  3K5M A;  4J9Q A;  2DHH A;  4NRT A;  4B3M J;  4LRE A;  1T3N A;  2CPH A;  4C8O A;  1R8P A;  1D09 B;  2X3D A;  4CNY A;  3ET6 A;  3J7Y I;  2J6T A;  1RAG B;  3MAQ A;  3G71 S;  3SI8 A;  4DR7 F;  4LVN P;  9ATC B;  4RX6 A;  3UVJ B;  4DZ6 A;  4NYP A;  3I0R B;  1F6T A;  4LF5 J;  1FFG B;  5HK4 A;  1UWA A;  1FCA A;  2ZM6 F;  2GZO A;  3A12 A;  2Y1J A;  2VUG A;  1XR6 A;  2L9D A;  5KFA A;  3I6P A;  2JC0 A;  3ONQ A;  3UN3 A;  3US5 A;  3LO3 A;  2AJF E;  3B54 A;  2VZ9 A;  4EFA C;  3HJV A;  3IRX B;  2BZ2 A;  4PRF A;  2HFV A;  1SH3 A;  3T3F A;  1AUS L;  1OQ6 A;  4DSK A;  2R8K A;  4USK A;  2KH9 A;  1X9W A;  2JVO A;  1NSK L;  4WKR A;  3SEO A;  1C0U A;  4A8Q A;  3BF4 A;  5EWE A;  4U8V A;  4MKA A;  3I0S A;  2BXJ A;  2MPU A;  3QWP A;  3HCX A;  2EFP A;  5J1N A;  1RAB B;  1SJR A;  4RUA A;  5ETS A;  3MUM P;  2FHJ D;  3NMR A;  1D8Z A;  5A0Y A;  3MR6 A;  3DHW C;  4E0D A;  4K2X A;  3HLU A;  3MR7 A;  2ASL A;  1Q4R A;  2RAQ A;  4ETX A;  1S1W B;  3FUY A;  2JJ4 D;  3D1Q A;  4LRB A;  4YDD B;  4NA1 A;  2CNL B;  1RB0 A;  2FVR A;  2JSX A;  1T7P A;  2RSQ A;  4DR4 J;  2DRA A;  2ZZT A;  2G13 A;  4ZS6 A;  1IM4 A;  5K8M A;  4GKK J;  4NLT A;  2AYG A;  3EVO A;  3ZZT A;  1DHM A;  2IM3 A;  2M9K A;  2MHE A;  2NR0 A;  1CSJ A;  2CQG A;  5A8W A;  5L1J A;  4ZN3 A;  1RHQ B;  4OHZ A;  1DY3 A;  2QIF A;  3MM5 B;  4DCO B;  2R2T A;  3U1L A;  1Y5I B;  4DUZ F;  8AT1 B;  4OI2 A;  2L48 A;  1RTZ A;  2HIY A;  4WE1 B;  1U2C A;  2CZV C;  4DX8 H;  4Z7Y A;  5IXU A;  3A3N B;  2OPQ B;  4TVA B;  3MOJ B;  2BQR A;  5LMU F;  4K50 A;  2JZ5 A;  4ZCI A;  4I64 A;  2W2O P;  3AJ1 A;  2J7W A;  5EWF A;  4LSL B;  4C8Z A;  1VQM S;  5ETL A;  3TW0 A;  1RT6 A;  3KG1 A;  1SH2 A;  3R2D J;  1AFI A;  1VJW A;  4C9D A;  3EVM A;  4K5S A;  2HAI A;  1WC4 A;  4DV5 J;  1FE0 A;  1ZYQ A;  4PXE A;  4OX7 A;  3C16 A;  2YNG B;  1FX4 A;  2HND A;  4LF8 J;  4DFP A;  5E3R A;  3FCW A;  3IS9 B;  1OSD A;  2OTJ S;  1DLO A;  3MM7 B;  3UDV A;  2MXY A;  1IQT A;  2XS2 A;  2CA9 A;  3CCR S;  1RT3 A;  3NS5 A;  4NMX A;  3M2U A;  3NXZ A;  5F9L A;  5E33 A;  3NBP B;  4OYA A;  1JB0 C;  4WXO A;  2A10 A;  5D3G A;  2Q6C A;  4BS2 A;  3C6T A;  3T5K A;  2LLZ A;  4A8K A;  4OMF G;  3VGT A;  2XUL A;  5C7P A;  3D28 A;  2VFT A;  1HKA A;  2DRB A;  2I8E A;  3M8Q B;  4KYZ A;  2OD6 A;  3PHE A;  1M5O C;  4GMK A;  2BR0 A;  1XR5 A;  5LT5 A;  3UR3 C;  1VQ7 S;  3BGO P;  3G4S S;  4ZP6 A;  1DFD A;  4RW7 A;  1A6L A;  2B9W A;  3LOU A;  2HKE A;  1FKP A;  1MML A;  4JOU A;  2YKA A;  1FFW B;  2MJU A;  3W63 A;  3SBM A;  3UNY A;  2DEI A;  2XEX A;  4WTY A;  4NLR A;  1HNZ F;  3KUE A;  3GII A;  1NK9 A;  1M5H A;  2WON B;  2YNI B;  3K8W A;  3P6Y C;  5LL6 d;  3PDN A;  4KO0 A;  2R4F A;  1NM2 A;  3EM1 A;  1NSP A;  1RTH A;  2XSF A;  1JLE B;  3W64 A;  4ZP8 A;  1TK8 A;  5MLC V;  1U8W A;  1RKI A;  2B4U A;  4L75 A;  3OUY B;  3TO8 A;  3MOZ A;  2HQC A;  5J2N B;  3IMQ J;  4QYZ K;  4AL5 A;  1VMB A;  1WTB A;  4UST A;  4DR7 J;  4OFZ A;  4OZ5 A;  5B0D A;  1VQ4 S;  2FHJ A;  3PCO B;  1FXD A;  3HHN B;  3AD7 C;  4WPA A;  3LF0 A;  1Q1K A;  3GON A;  2IMW P;  3FDS A;  1T9T A;  4OZN A;  2DR9 A;  2XO6 A;  2JFK A;  4GVB B;  2XMU A;  4JI2 F;  1ZA1 B;  4RBU A;  2P8I A;  3PV8 A;  3OXF A;  3OFG A;  4DR1 F;  3W2W A;  1S1X A;  2CPF A;  4WWS A;  2DR6 A;  3TRG A;  1V3S A;  3N6N A;  2YKQ A;  1PBU A;  5HVH A;  2DNN A;  4NXM J;  3HX9 A;  2C2E A;  3SZ2 A;  3BRE A;  2HVD A;  1U1K A;  1VFJ A;  4O0I A;  2OEM A;  1RHU B;  3KG4 A;  2BUN A;  3PJX A;  4JI8 J;  4Q45 A;  3MED A;  1I94 F;  2CPJ A;  3PM9 A;  1YDL A;  5A8R B;  5C2C A;  1SJQ A;  2K3K A;  4RU2 A;  1M1H A;  4J91 A;  4QBU A;  2JOQ A;  4F2S A;  1RT5 B;  1R6Y A;  3R6G B;  3RBZ A;  2DH8 A;  3DGV A;  1H74 A;  2KFY A;  5FJ4 A;  2J7U A;  2QLX A;  4M1K A;  1JXE A;  4HAC A;  3NGR A;  4NA3 A;  3D6M B;  1CUL A;  4DN9 A;  4LQ3 A;  2BRK A;  1BXN A;  2R7W A;  3FMB A;  5LMN J;  1Q86 T;  3QGI A;  4DF8 A;  1H72 C;  3JSY A;  1U6B A;  2AV5 A;  2ADC A;  1NUE A;  1KR4 A;  3ZZR A;  2KXH A;  1VIO A;  4DUZ J;  2BYC A;  1ZH5 A;  2IAJ A;  1HMV A;  1NZA A;  4I7F A;  4CI0 B;  1X4D A;  4DV2 J;  4F67 A;  4BWJ A;  2B9E A;  2CVE A;  3DMJ A;  4B9L A;  2GVZ B;  2DHG A;  5DM7 Q;  2WAQ D;  4NLD A;  5KFW A;  3C14 A;  1WDT A;  3TNV A;  3J81 Y;  1C4C A;  3BDE A;  1U1O A;  4KH1 B;  3KLV A;  3ET6 B;  2DXE A;  2OPS B;  4B3S J;  2MLX A;  5HO4 A;  1FKO A;  4YB7 A;  2YKO A;  4Y0F A;  1Q8K A;  3FBB A;  4LQ9 A;  2I5J A;  1FVQ A;  2KRR A;  2MDA A;  2UUA F;  2V63 A;  5B0E A;  3HSJ A;  3W66 A;  3OFF A;  1NPK A;  1RUS A;  4DMZ A;  2DGT A;  3UDC A;  2DIV A;  1VOM A;  2ZH5 A;  4NZ7 A;  3FQL A;  3KK2 A;  3THP A;  3A8E A;  3EE3 A;  3MCS A;  2HHU A;  1UW4 A;  5ETO A;  2J9C A;  2Z0G A;  1NDP A;  1FES A;  4CM2 A;  2CQ2 A;  5HN0 A;  4YEA A;  1RT7 B;  4P7T A;  2CQI A;  5IQ6 A;  4QWE A;  3AD8 C;  2E1C A;  3DLK A;  2YKM A;  3KG0 A;  3FVY A;  2ILZ A;  3AOC A;  4ATN A;  4EU0 A;  3S7R A;  2R8J A;  2UXD J;  4MMO A;  3TX8 A;  3IC1 A;  1HBM B;  2F4V J;  4IFY A;  4JB8 B;  1C0U B;  2QE5 A;  2W7O A;  3U7J A;  4DZD A;  1EP4 A;  4N76 A;  4TU9 A;  2KFZ A;  2ALZ A;  3I0S B;  2KI2 A;  4B9U A;  1N34 J;  4V19 J;  2C2N A;  4DL6 A;  3DLJ A;  3JXO A;  1BY9 A;  3EMT A;  2M8D B;  3LP2 A;  4RW9 A;  2A2C A;  2NQP A;  1P1L A;  5L8R C;  1QVG R;  2MKI A;  2MY7 A;  2M0G B;  5D0R A;  2B8P A;  2ZJQ Q;  1QJH A;  2M4M A;  2NSB A;  2V8D A;  1QAY A;  4UTG A;  3FZB A;  2ZEJ A;  1HNX F;  2CG4 A;  1UTA A;  1JNZ B;  1EZZ B;  1EAY C;  1WC6 A;  2ROP A;  3MF5 A;  3JSM A;  3V6H A;  3HO1 A;  5A8W B;  4JI5 J;  1Q7Y T;  5KFH A;  3NWR A;  5CZX A;  1HNI A;  1P8G A;  3MPY A;  3MEC B;  3MAA B;  4I2Q B;  1VRT B;  3QAT A;  2HUR A;  4JI2 J;  1FDD A;  2QT7 A;  2K7J A;  4K7Q A;  2W24 A;  3GFX A;  2LQ9 A;  2HLT A;  4IO1 A;  4MFB A;  4DR1 J;  2RHQ B;  3RZA A;  4OX8 A;  4FF3 A;  1R8B A;  3OSN A;  2HWT A;  5KT7 A;  3IN5 A;  3BQ2 A;  2V34 A;  3T1Y F;  3HF5 A;  2GO8 A;  3EJM A;  2HHT A;  1J5O B;  1K47 A;  3HT3 A;  2JEI A;  2PEB A;  1F0X A;  4NLO A;  2EC2 A;  2J7K A;  3BYR A;  2NUH A;  3DU5 A;  4XIU A;  5ETQ A;  1FA0 A;  4IO9 Q;  3BGR A;  2DGV A;  1NK8 A;  2GV1 A;  2BVZ A;  4XTT A;  1TTH B;  4TLQ A;  1S1U A;  2VC1 A;  2VB6 A;  3MMB A;  4LBP A;  2OEJ A;  2OMO A;  1N36 J;  2V50 A;  3BKU A;  1BWE A;  4KB7 A;  5D3G B;  2W8K A;  1YKW A;  1L3U A;  2M7S A;  3G8T A;  1S6U A;  3KWM A;  1WNE A;  4JI0 J;  2ROG A;  3MR2 A;  3QFH A;  5GAG U;  1AW0 A;  2FGC A;  2DHX A;  1MN9 A;  3W61 A;  1U02 A;  2CG8 A;  4DQR A;  2HBY B;  2PFF B;  2Z2Z A;  3QO9 A;  2VU5 A;  2CIM A;  3G6Y A;  2XTJ P;  2C22 A;  4QYR A;  4RW7 B;  3C8Y A;  3SCL E;  1NJZ A;  3G6V A;  2XLK A;  2X1G A;  4M5I A;  3DGP A;  4MYU A;  3ICL A;  1N33 F;  1V3R A;  1EET A;  4LFA F;  3VAL A;  2MQQ A;  2HHP A;  5HVF A;  4J9R A;  4URS A;  4K4Z A;  5KAK A;  1JIH A;  5CZV A;  3MD1 A;  1PAE X;  5F3Z A;  1H38 A;  4IRC A;  1V9O A;  1FD8 A;  2M3D A;  3ETO A;  4KO0 B;  5GAE I;  5JXS A;  1RTH B;  3TA0 A;  1ZAX A;  2DCU B;  4DPW A;  1LK5 A;  2VV5 A;  3AAW B;  3CW2 C;  1J27 A;  4CT8 A;  3PW0 A;  4D3H A;  5M2R A;  3DRS A;  3LP0 B;  1FNM A;  1UJ4 A;  2DGS A;  1TFY A;  3IFE A;  1U1M A;  1T9U A;  2GGP A;  1SBR A;  5FII A;  1JLC A;  4ELV A;  1KNZ A;  3HDS A;  5KFK A;  1WOO A;  4EGL A;  3IRW P;  3MMA B;  3GR0 A;  2UUA J;  2H3E B;  1I51 B;  5SZT A;  4ZVT B;  4WU3 A;  2IC3 A;  1NK0 A;  2BV3 A;  4PKD B;  3G86 A;  3J80 U;  1WOS A;  1FX2 A;  2HK2 A;  2MKY A;  1OWX A;  2ZH2 A;  2PC6 A;  1RAC B;  2LXI A;  2ADB A;  2BJ3 A;  2HYI B;  3RRH A;  3J7Z 5;  3W2W B;  1S1X B;  2PN6 A;  1K0T A;  3VZH A;  5M2U A;  4ZJO A;  5B0A A;  2IVM A;  2ZWO A;  4F3Q A;  5ETP A;  1Y00 A;  1DAR A;  2CJB A;  1RSC A;  1VLO A;  4FZV A;  5BXI A;  2IRY A;  3UPF A;  5T7L B;  1FD2 A;  2IYI A;  2YQ3 A;  4N77 A;  3TUP A;  4TYA A;  1Q79 A;  4DL3 A;  3MR5 A;  3QID A;  3PIO Q;  4PWD A;  5I4M A;  5D4P A;  3O5T B;  2DR5 A;  1B99 A;  4ZKA A;  3WC2 A;  4OHV A;  4C8K A;  3DI6 A;  4F36 A;  5ADZ A;  1PYT A;  2RU9 A;  2V2Q A;  5GAH I;  4UUX A;  2ZH7 A;  2N3O A;  5GMK a;  1LK7 A;  2QLB B;  1R8A A;  1FEH A;  5AXL A;  4ZCM A;  2M52 A;  3I56 S;  3UCZ P;  1X5P A;  1SV5 B;  5GAD U;  4E98 A;  1JLG B;  3ULH A;  3R6L B;  2OTL S;  3OR1 A;  2V9K A;  3EGN A;  4LRA A;  2HNY A;  3BSN A;  2ZBC A;  1YBU A;  1CUL B;  4AYB D;  4YHH J;  1VI7 A;  3Q8R B;  1UJ6 A;  2C2M B;  3OW2 R;  2ERR A;  1X4C A;  2WVD A;  1RT4 B;  2AWZ A;  1ROF A;  3FBE A;  2DY9 A;  2JLF A;  1XMQ F;  4H4M B;  3Q8V A;  1U26 A;  3RR8 A;  2IMO A;  4OZ2 A;  3OVA A;  1H98 A;  4HVZ A;  1TKD A;  1WSR A;  1HYS A;  2R7O A;  2X51 A;  2M88 A;  4JV5 F;  3SXL A;  2IAJ B;  3OTB A;  1HMV B;  2J6U A;  1FJ7 A;  4I7F B;  1KQF B;  1TP7 A;  4J9M A;  1TEL A;  3DMJ B;  2ZBP A;  4P75 A;  4AND A;  3QGP A;  1NDK A;  1HWI A;  3C14 B;  3FGV A;  1QVF R;  1ICE B;  1YJW S;  3BGL A;  4DV3 F;  4FS1 A;  2HQF A;  2JFD A;  2NLW A;  2XMT A;  4LT6 A;  3T1Y J;  1F9E B;  2KDO A;  4CH0 S;  1WF1 A;  1FKO B;  2OEK A;  3H5Y A;  1LKZ A;  1PC5 A;  4TNO A;  3GIM A;  2K3I A;  3D3B J;  4AXJ A;  1VQ9 S;  2WB4 A;  4WBF A;  2WSC C;  3IM8 A;  1R89 A;  1TL1 B;  4I1T A;  4DQQ A;  3L4B C;  1U0S A;  2N3L A;  2UV8 G;  5ETR A;  2GIR A;  4BCA A;  4ZPV R;  2MZT A;  2MEW A;  4IOC Q;  2H54 B;  1S6Q B;  2XZW A;  2NCK L;  3HVR A;  4N8N A;  2XBP A;  2IA6 A;  3KK3 A;  4F4Z A;  4DL0 C;  3HT0 A;  4F4X A;  2YWE A;  2OO4 A;  2EPI A;  3CD5 A;  3VAJ A;  1CQN A;  4CLY A;  3DLK B;  4KHP F;  4FYY B;  3LW5 C;  1RWN B;  1NU4 A;  1IBL F;  3KYL A;  2X1A A;  3G96 A;  4NAS A;  3T19 A;  3R9L A;  1MRO A;  3EGV A;  4L3K A;  1Y5N B;  5HP1 A;  3DU6 A;  4RNO A;  1NH7 A;  3MEG B;  3TAN A;  2F3J A;  5KFE A;  4P74 A;  1RCO B;  3KHG A;  5L46 A;  1JJC B;  2YX7 A;  1N33 J;  4LFA J;  4J9P A;  1VJQ A;  2LMI A;  5D78 A;  3GIL A;  1NPP A;  3R7S B;  2ASD A;  2HFN A;  4CLZ A;  5FLX U;  2QG9 B;  4IFV A;  3FSI A;  3DLH A;  1WOP A;  4JI1 J;  1RWO B;  4YUD A;  2NXJ A;  2A1B A;  4GVL A;  4YP3 A;  4DR2 F;  4DBQ A;  4Z37 A;  3QIP B;  1NDL A;  4AUK A;  3TVK A;  1FNX H;  2D9O A;  4DQS A;  2MGZ B;  1XBW A;  2H5J B;  1Q78 A;  5DET A;  1JLQ A;  4KKO A;  2UXB J;  3OXG A;  2XZT B;  1FJG F;  3MPU B;  3CXC R;  3FBC A;  3DXB A;  3EPG A;  2JEF A;  3DLB A;  1L3T A;  1SJF A;  1HNI B;  4DSE A;  2B4O A;  1Y3K A;  4Q2M A;  1TU0 B;  1RAD B;  5HLF B;  3HHD A;  1TKX A;  3CTR A;  1IKX B;  2QA2 A;  2Y1I A;  4JYA J;  3D1O A;  1OMS A;  3H8Y A;  1HHS A;  3I82 A;  2PSZ A;  2L08 A;  1UEV A;  2PA3 A;  4N8O A;  1IKY A;  3HHL A;  4LF4 F;  3QLH B;  3IP0 A;  2R8G A;  3HD2 A;  3EIC A;  3PFO A;  2J0W A;  2RUG A;  2CNO B;  1QE1 B;  1NJI T;  5HAO A;  2YVS A;  2Z58 B;  2H4Y B;  2KKH A;  3KKF A;  1HIY A;  3OQ2 A;  1REG X;  3H5U A;  4EO8 A;  3QMQ A;  2B4V A;  2W4C A;  2YQ1 A;  2HRU A;  2KM8 C;  4MJK A;  1S1U B;  2VG6 A;  1NSQ A;  1Q82 T;  1UAW A;  4JI4 F;  4IRD A;  3MMB B;  2CQ0 A;  1KHW A;  5CYQ B;  1WHX A;  4OYZ A;  3AXM A;  4TLR A;  3RRG A;  1C2P A;  1U2F A;  2Z2M A;  2EW9 A;  1LOU A;  2YH1 A;  1MSW D;  4R25 A;  4QWB A;  1E6Y A;  4NXN F;  3OFH A;  3R27 A;  4PPD A;  3D67 A;  1HQU B;  3M6X A;  5IQQ A;  4PQU A;  1S6O A;  4K4X A;  2OD4 A;  3TEH B;  4YR2 A;  2V8P A;  5BYR A;  4WFN Q;  1NK6 A;  2HS4 A;  5G4D A;  1PYS B;  3C6U B;  1QSL A;  4ED5 A;  3ILI A;  3SYZ A;  4AQY J;  4X84 A;  5KFN A;  3DGP B;  3WZ0 A;  4JV5 J;  2LU1 A;  2QJ3 A;  5E2Q A;  4M5M A;  3GG0 A;  1EQ0 A;  2ZH3 A;  3H4B A;  5C24 A;  2IVY A;  3HFZ B;  3RAX A;  1UWB B;  3I4P A;  5DG8 A;  9RUB A;  4ILL A;  4EEY A;  2D3O 1;  4HL9 A;  3FEZ A;  2R2U A;  1WG4 A;  4I2P B;  3OBI A;  2JLG A;  4CCH A;  2YWK A;  4OLO A;  4DDF A;  4RW8 B;  2BAN A;  1ARO P;  1OS5 A;  4WFY A;  4CLS A;  2NZ4 A;  4CO4 A;  4EBC A;  2IFX A;  1TAQ A;  1ZPW X;  5HVG A;  4AFF A;  4WP8 A;  1P6T A;  2W2Q P;  5AE3 A;  3DLL Q;  3E01 B;  2GGP B;  4CQ1 A;  1Y0H A;  4U7U K;  1XNQ F;  3TUJ C;  2DNP A;  3DNC A;  1EX8 A;  2UUT A;  3WX4 A;  4A8X A;  1HBN B;  3BN4 A;  1CG2 A;  3V2U C;  2IC3 B;  1GAO A;  1SH0 A;  3A3O B;  4CNZ A;  3CC7 S;  2CJY B;  4Q44 A;  2QX0 A;  3H2V E;  1QDU B;  2OHD A;  4HHU A;  2H65 B;  3V4I A;  4UOF A;  4IOB A;  3W9I A;  2FVQ A;  1RWM B;  3R2C J;  3DRX A;  2OEL A;  2YWW A;  1S0M A;  3SDE B;  3NL0 A;  2RNE A;  4DSF A;  3POT B;  3VTI A;  4FS2 A;  5DZ6 A;  5IC6 B;  2IY5 B;  4OLP A;  2CQD A;  2HQ3 A;  3QNW B;  4RO0 A;  4CLW A;  1F60 B;  2LKZ A;  2NXN A;  3GMG A;  3DRR A;  4KHP J;  2RF2 B;  5ETK A;  3Q0A A;  3C19 A;  3QSI A;  3VGU A;  2EK1 A;  4M5N A;  1JLF B;  3IG1 A;  5CHC B;  4HH1 A;  2D74 B;  1PJ6 A;  1WJ9 A;  4J9U E;  3FEY B;  1KTQ A;  2LXU A;  2DNL A;  5J2P A;  1U09 A;  2ZD1 B;  2OP5 A;  1WKL A;  4J9V A;  1VBY A;  3DDK A;  1FNO A;  1TL3 B;  1B64 A;  3UI3 A;  2MSS A;  2KM8 B;  3UW1 A;  2UU9 F;  1YSJ A;  1KP6 A;  4IDK B;  3CNQ P;  2WB1 D;  3OR1 B;  4WJB A;  4PXB A;  4NLY A;  4U9R A;  3K59 A;  3CVK A;  3L7U A;  2XCA A;  3Q8U A;  2HWI A;  1RU1 A;  2OSR A;  1G3O A;  3H5X A;  3TP2 A;  1PSD A;  2PI5 A;  2B6A A;  4ZLP A;  4WKY A;  3GG1 A;  1FJG J;  4H4K A;  3VCD A;  2LQJ A;  3SSQ A;  4ITS A;  1RAF B;  1PO6 A;  1IKW B;  3CCJ S;  1N0U A;  5HI7 A;  5IZH A;  1HLW A;  1WEX A;  3NGT A;  2O1P A;  3IGN A;  2IPO B;  5K8P A;  3OPK A;  3UNG C;  3EZO A;  4LF4 J;  5DQH A;  1IJE B;  5A2Q Y;  2M70 A;  3V6J A;  5EN1 A;  2LDI A;  3VHQ A;  3K7R A;  4USH A;  2EFG A;  4N5S A;  3NNA A;  5D4L A;  5L1I A;  1RK8 A;  3NS6 A;  2GMH A;  1SUQ A;  1X5S A;  1RT1 B;  1MN7 A;  2V8V A;  3JQJ A;  4MIA A;  2N4D A;  1T0T V;  1RLC L;  5IM0 A;  4OHW A;  1K0V A;  2L41 A;  4B3R F;  3WBZ A;  5IFM A;  3CME S;  5M2P A;  1SC4 B;  4WIQ A;  4F2R A;  4EBD A;  3HUL A;  2V2V A;  2ZE2 A;  2RT3 A;  3D1H A;  2XYG B;  2C42 A;  2HQD A;  4HR2 A;  2IBO A;  3DLE B;  4PAB A;  4DV4 J;  4LSN B;  4DUY F;  2QYC A;  1TFW A;  1ULR A;  4NLX A;  4M8L A;  2C2O B;  4H4O A;  3CT9 A;  3ZZP A;  2AW0 A;  4DPY A;  4YQW A;  1U45 A;  3SCI E;  3GJS B;  2DGU A;  3R5J B;  2CQP A;  5KFF A;  4NXN J;  1E6V A;  1Q5Y A;  2YKN B;  2I1R A;  4JI7 F;  2FHO B;  4IR9 A;  3NGK A;  3B82 A;  2J8A A;  3ZTS A;  2DXF A;  4ECT A;  3CCV S;  1MRO B;  3D7S B;  2VG7 A;  1TUG B;  4ZIW A;  1PIE A;  1XNR J;  4PG7 A;  2VC0 A;  5HBM A;  4JUZ A;  5AXM A;  2QO3 A;  4A47 A;  4ZCL A;  3M30 A;  2LDY A;  2HHQ A;  3GFZ A;  2LEP A;  3GIJ A;  4AXI A;  2DKO B;  3F44 A;  3BH6 B;  3W7B A;  1RTD A;  3N6L A;  1FJC A;  3AQP A;  1JKH B;  3MPD A;  2V8H A;  1N32 F;  3GWC A;  1VLY A;  4ZK7 M;  2V2K A;  2Z8Q A;  2DO0 A;  1PKU A;  2GJF A;  4M94 A;  3D6T B;  1NPR A;  4I69 A;  2ZJR Q;  3PYE A;  4LJM A;  1HNV A;  4MIW A;  3HFV A;  3PR5 B;  2QMU B;  3BSA A;  2DBB A;  1MMN A;  4EO6 A;  4Y00 A;  2DJW A;  2QLW A;  3UD4 P;  3LP1 A;  1IBM J;  2GCF A;  2ZOM A;  1XNQ J;  1YK9 A;  4KKO B;  1IWG A;  3JSB A;  5BYQ A;  2WOM B;  1LWX A;  1ZPV A;  2QC3 A;  2DNY A;  2KTQ A;  3PZP A;  3L3C A;  2XG8 A;  4QR2 A;  2E5I A;  2XHW A;  1UEU A;  2HGL A;  1RA6 A;  3R1H A;  1T3O A;  1TL4 A;  3R7N B;  2BKP A;  4OYX A;  2VPY B;  2Q3P A;  2IBK A;  1U4B A;  4ILR A;  1GMW D;  1QSY A;  1GQE A;  4X4S A;  3TAQ A;  1X4H A;  1IKY B;  2V0N A;  1VBK A;  4B9S A;  2HFU A;  2GW8 A;  4I56 A;  1HBU A;  2KJV A;  3VGV A;  4GKJ J;  1BD6 A;  2X1F A;  4ED6 A;  3AJD A;  4F0K A;  1RWK B;  1RWP B;  4E8U A;  1RAE B;  2QSW A;  1ZM9 A;  4DFM A;  2Y0S D;  2JRS A;  1QAI A;  4K4U A;  4P6Q A;  3VQS A;  1Y7P A;  2XCP A;  2EVZ A;  1HBO A;  4YFU A;  2G4B A;  4DL5 A;  2VJU A;  2FVC A;  4M95 A;  4ZCK A;  1J5E J;  5KG6 A;  2BE7 D;  3R8Y A;  4LFC F;  2PMW A;  2E1P A;  3HZG A;  4A8S A;  2G2Y A;  3GSI A;  4F8R A;  3LAL A;  1E6Y B;  3OR2 A;  5L9N A;  2VG5 B;  3G82 B;  1MNE A;  3TQ1 A;  4PQU B;  2LQ8 A;  3UVJ A;  4DV1 F;  2B7B B;  2J0S D;  3KLI B;  2CAD A;  4PR6 A;  2GHW A;  3SCJ E;  1LNQ A;  4YDX A;  3U27 A;  2DNG A;  3FSY A;  2WTF A;  3HM9 A;  4EMD A;  1RP5 A;  1KOH A;  2GC8 A;  1KLN A;  2RQK A;  3X3U A;  5AT1 B;  1KKH A;  3D9B A;  3K5P A;  4OX6 A;  3I55 S;  1KDN A;  4RW4 B;  2HHX A;  2WRM A;  2UZA A;  4OHY A;  5K20 B;  4GC7 A;  1X4G A;  3IRX A;  3O44 A;  5JUM A;  2F9D A;  1MG7 A;  5KFB A;  1K8A T;  4KSE B;  1H73 A;  2F8H A;  3VGS A;  2J5A A;  4WII A;  2CJA A;  2N4C A;  1PC4 A;  5T14 A;  2XQC A;  4N41 A;  1Z4U A;  2MY8 A;  4PG5 A;  1UVL A;  3DRP B;  4LR7 A;  4A8M P;  5F8J A;  3M9O B;  2BDP A;  4IH5 A;  4OYP A;  1N54 B;  5U47 A;  3EGW B;  1KVJ A;  5MAO A;  3PO5 A;  3HVT A;  4USW A;  2BE9 B;  4DPU A;  5C25 A;  1DJ0 A;  4B3R J;  2MZ1 A;  4EWT A;  2YKP A;  4BDP A;  5G0R A;  3GLJ A;  1UL3 A;  1YIT S;  1PAU B;  5I3U A;  1VQO S;  2XYP B;  3MPW A;  5KFO A;  3AHP A;  4FXW A;  4PG4 A;  2A18 A;  2ZOF A;  3OHB A;  4KGX B;  1F9F A;  5CD4 A;  4NRU A;  2GJI A;  2FB0 A;  4DUY J;  2WBR A;  1FRJ A;  2JC1 A;  1S1W A;  2EFQ A;  2Q66 A;  2AZ3 A;  3K8V A;  3CIZ A;  4DR3 J;  4ID5 B;  5H9E J;  2WW4 A;  4C3K A;  3BPS P;  4PYA A;  4I68 A;  5D0E A;  5T41 A;  3CCW A;  4JI7 J;  1HW8 A;  3PW2 A;  3DRR B;  5JMN A;  3MM5 A;  3MUR P;  1PG5 B;  4PUO A;  1K9M T;  2K2P A;  3TYT A;  3CJ3 A;  1S10 A;  2DH9 A;  3CUN A;  4WE1 A;  2R7T A;  1GMW A;  3Q2S C;  2W7A A;  1FK9 A;  1V3Z A;  3IG1 B;  3P49 B;  2J8S A;  3CJS A;  3NOC A;  1OPZ A;  3VAK A;  5J2P B;  2DPJ A;  3BBB A;  1F2G A;  1A7G E;  1LEO A;  4NOH A;  3UDE A;  2DGQ A;  3MCN A;  4LSL A;  1FDB A;  1RAO A;  3KJF B;  2KFN A;  3T41 A;  4RUB A;  1N32 J;  1Q8B A;  4USM A;  4DR6 J;  1UPM B;  4CLK A;  1T9Y A;  1FRL A;  5DLF A;  3HVW A;  4G1I A;  1Y11 A;  3PKY A;  1QAX A;  2NXU A;  2OPR A;  2MJN A;  1VQN S;  2EFO A;  4NCB A;  1H6K X;  3GV8 B;  5B0F A;  4LRC A;  2GML A;  3MM9 B;  2KZZ A;  4KGZ B;  3FJ2 A;  2APO A;  1S49 A;  2ZHO A;  3W62 A;  4LF5 F;  1EQM A;  4DS4 A;  4LBH A;  3H7H B;  7FDR A;  2VD3 A;  4KH0 B;  4LFB J;  1T8E A;  3TJA A;  3Q2T C;  4R5P A;  2DR8 A;  4G3I A;  3K17 A;  3KJV B;  2F5G A;  2XWX A;  1U1P A;  3OD2 A;  3TEG A;  3OSP A;  3DOL B;  3SV3 A;  1LW2 A;  2BJ9 A;  3Q8Q B;  2YWF A;  3CUL A;  5D6G A;  1WF0 A;  4JV0 A;  2ATL A;  5RUB A;  2MKJ A;  2G0I A;  1SUQ B;  2R2R A;  3ISN D;  3H4D A;  5KFS A;  2BMB A;  5H9F K;  2UXC J;  2HVI A;  3NAH A;  4A8F A;  1MLA A;  1VK3 A;  4PG8 A;  2Q43 A;  2MKS A;  5J1E B;  2LA6 A;  4O3S A;  2B0G A;  4FF4 A;  1T9W A;  2QMX A;  4Y6I A;  4IKA A;  1D9D A;  2YNI A;  3K58 A;  3LH2 S;  5KG0 A;  4X4U A;  2OFH X;  3TR5 A;  5ITH A;  2GJ2 A;  2LVW A;  1WKJ A;  1U8S A;  1KQG B;  3KK1 B;  3PW4 A;  2YWG A;  1KOO A;  1JLE A;  4LFC J;  1WF2 A;  3FMW A;  5E3A A;  4DR4 F;  3KHL A;  1GK8 A;  2C3P A;  1KBR A;  4OI1 A;  2VPX B;  3CDA A;  1P9Y A;  3QZ8 A;  5J2N A;  2C2R A;  1BQN A;  4QWC A;  2R7X A;  4RNN A;  3BYP A;  1N5Q A;  4ZJQ A;  4YY3 F;  4DV1 J;  2LP4 A;  1L3S A;  1QSS A;  1MWZ A;  3A8J A;  2FZG B;  4ED8 A;  1RU2 A;  5HBM B;  5IT4 A;  2XGQ A;  1VRU A;  1TAU A;  1VQ6 S;  4IG3 A;  2FC9 A;  2RH3 A;  3EXY A;  4ZPW R;  3JAM U;  2D1C A;  2WSE C;  2XS7 A;  1KTV A;  1FFS B;  4ZVE A;  1RTD B;  1HHQ A;  2IVF B;  3L7O A;  4K0K F;  1WHW A;  4EI2 A;  1U1Q A;  1RTJ A;  3P5T L;  4TYB A;  4DCP B;  2HZV A;  1S7H A;  1OY6 A;  5LXY A;  1NHU A;  5L9X A;  2DGX A;  2AF6 A;  3QT6 A;  4DPO A;  2FJV A;  3B8H A;  4DV5 F;  1RZM A;  4CTA B;  4OHX A;  1HI1 A;  1UFW A;  3CE8 A;  4EZ6 A;  4FP9 A;  1SIZ A;  4LF8 F;  2DTJ A;  2BW2 A;  3L95 X;  2UVW A;  1UVN A;  2HRT A;  3EPI A;  4O3P A;  5HQ8 A;  1UKU A;  3W2V A;  3BO3 A;  1VR6 A;  5A8R A;  2DXD A;  4G1P A;  1VDH A;  4A48 A;  2CJX B;  2FQQ B;  2MQN A;  3BO2 A;  3BEG B;  2ZH8 A;  3HPO A;  4ES2 A;  1Q81 T;  1GTE A;  1N5Y B;  3NCR A;  4C8L A;  3TA2 A;  4QIE A;  4LF6 J;  3EZ5 A;  4WFA Q;  4JI3 J;  1VBX A;  3MWB A;  3NS7 B;  1HBU B;  2KU7 A;  2AMC B;  2C28 A;  4DEZ A;  2FIU A;  2PD1 A;  2KZM A;  4ZVG A;  1CC8 A;  4CO2 A;  1IR2 A;  1FVS A;  3BSO A;  2AIR B;  2ZUA A;  1KEK A;  2W4P A;  3J7Z T;  2KXN B;  4ZVS B;  3QGG A;  5HAT A;  1GMV A;  2XMK A;  3QGH A;  3KHH A;  4NLP A;  2RVJ A;  4ZMM A;  5F8L A;  4WU2 A;  1FRH A;  1SL1 A;  2RS8 A;  3HFK A;  2VH7 A;  1HBO B;  1SQE A;  5IV4 A;  3KDO A;  1O0P A;  3GCX P;  4HTJ A;  4X62 J;  5K8O A;  2GVZ A;  5KG2 A;  3TOQ A;  5THW A;  2M5Y A;  2GQQ A;  2YNH B;  3SQG B;  4DG1 B;  4OJ1 A;  2ZDP A;  3JS9 A;  4X4Q A;  2LA4 A;  2BAB A;  3AD9 C;  4OYW A;  2AJ0 A;  4F4K A;  3OR2 B;  2OPS A;  3CGI A;  5HRO A;  5E5N A;  3VZI A;  1W25 A;  4U8Y A;  2GAG C;  4QIG A;  2A6O A;  3NMA A;  4ED0 A;  1OYD A;  3B6B A;  5DG9 A;  4B9M A;  1RHR B;  2EG2 A;  2BJE A;  4DPT A;  1HD0 A;  4FNI A;  2D69 A;  2ZVI A;  5L38 A;  3SQO P;  4PWU A;  1PCA A;  2KL8 A;  1REV A;  2FUG 9;  2B9X A;  1RT2 B;  2IM0 A;  2CDQ A;  1GXL A;  1ZTW A;  4DOZ A;  4O44 B;  1RT7 A;  2RRB A;  4UOC A;  2K1R A;  2G1D A;  4NXM F;  3O3L A;  5C42 B;  3DLG B;  3OTD A;  2O5D A;  1FRX A;  4QWA A;  1SJ4 P;  1HBM A;  4I6A A;  4QIW D;  5F9N A;  4JI8 F;  2HIQ A;  5KT3 A;  5FD1 A;  4WF9 Q;  2D9P A;  4B3T F;  3HVT B;  1DTT B;  5C25 B;  4C11 A;  3FQK A;  5G0R B;  4LF9 F;  4ER8 A;  1VQK S;  5I3U B;  1D0E A;  4NI2 B;  2CKW A;  2AHO B;  3J7A N;  2ZH1 A;  2F40 A;  4DV7 F;  2HNZ B;  2W9C B;  4NLW A;  4AL7 A;  4WP3 A;  4X66 J;  3B4D A;  2IA0 A;  3GJQ B;  1OJ4 A;  3BDP A;  1B7Y B;  2EG1 A;  5LMN F;  1EHW A;  1GX5 A;  4ZPD A;  1YVF A;  4HTI A;  1R31 A;  3MR3 A;  3QQC D;  5DM6 Q;  2UUC F;  3BKT A;  2R8I A;  1N4L A;  4PUO B;  1V6H A;  4YY3 J;  4DR5 F;  4UQT A;  4ECU A;  1FK9 B;  4CT9 A;  4TXS A;  4ES1 A;  1K1S A;  3ZFV A;  4DV2 F;  3MEC A;  3MAA A;  1WEZ A;  4I2Q A;  4YB1 P;  1VRT A;  1DZ5 A;  4ZP7 A;  2DNZ A;  2KT3 A;  4RBT A;  1FWP A;  4K0K J;  5DLG A;  5HSP A;  2X1B A;  1C1C B;  3P3D A;  4ECW A;  2EFV A;  4M5K A;  3KLF B;  2C3Y A;  3CSK A;  3QWU A;  4B3S F;  2W4D A;  3MTK A;  3QSY B;  1Y5L B;  1CVJ A;  1J5O A;  2OPR B;  1G7C B;  1M0S A;  1SKS A;  2B4P A;  1N5T A;  4B3O B;  1LFP A;  1S9F A;  2KHD A;  3OVB A;  1N0V C;  3EDR B;  5GAG I;  3TAM B;  4K5R A;  4ECS A;  3BH7 B;  4F4W A;  4ZLJ A;  4KIA A;  3FC9 A;  4Q8E A;  3IR7 B;  1UVM A;  2YWH A;  2G9O A;  3Q8S B;  2K06 A;  4URQ U;  4CYU B;  4R5P B;  2KN4 A;  5EX3 A;  1YI2 S;  1ZAW A;  4OZ3 A;  5KFI A;  1Y4Z B;  5BJR A;  5EX0 A;  2HG4 A;  3ZO7 A;  2RQM A;  3MM8 B;  1LWC A;  1LW2 B;  2YY3 A;  1RTI B;  3Q86 A;  4XDD A;  3RTV A;  3HXM A;  4ED1 A;  4ECQ A;  3PIP Q;  2FLP A;  2UXD F;  4ZA1 A;  2LYV A;  3FRZ A;  2F4V F;  2N82 B;  1CJV A;  4OX9 J;  4BWM A;  4F26 A;  2VFR A;  3PRV A;  1NRK A;  2Q1L A;  4CLP A;  1X8D A;  1N34 F;  3FK4 A;  1YTY A;  1NHV A;  2G0J A;  1M90 T;  1CJT B;  3GQC A;  3AA9 A;  3ISN C;  4EZ9 A;  3M4X A;  1LV5 A;  2FLN A;  4TU8 A;  4WFZ A;  2BJD A;  2M8H A;  3ILL A;  2ZVS A;  4U95 A;  3BS9 A;  3OL9 A;  3FFI B;  1D1U A;  1VCT A;  1IUJ A;  2R3V A;  3GYX B;  1Y10 A;  1YBT A;  4HDG A;  1JLA B;  1CLF A;  5EWG A;  1KS2 A;  1D8Y A;  2HW3 A;  3LP0 A;  1DBD A;  3VAF A;  1G6B A;  4JI5 F;  1BQN B;  5D77 A;  3BJY A;  4NYZ A;  4FKY A;  1S6P A;  1RE1 B;  4K8R A;  4OZL A;  2EFN A;  4G6V B;  2D41 A;  3ILJ A;  3MMA A;  1VRU B;  4OYB A;  4EYH B;  1VC0 A;  4IG3 B;  3NWG A;  3QBC A;  3Q8P B;  4O3O A;  2LXF A;  1MU2 B;  4LR9 A;  2WVE A;  2ZKT A;  1RTJ B;  2CAJ A;  2Y1L B;  2AJ1 A;  3OT9 A;  3PEJ A;  4S0M A;  3ZNJ 1;  1LWF B;  1KVK A;  2D3Z A;  4ELT A;  2ABY A;  3PR4 A;  3RRK A;  2PI4 A;  2N7Y A;  2GMJ A;  4TQS A;  3GCW P;  1H7W A;  2QA1 A;  4GO7 X;  2NS1 B;  3CJ4 A;  1X7V A;  5T7L A;  4MKB A;  4NEY A;  3PXG a;  4OI0 A;  5GAD I;  1M5K C;  2AYB A;  4K2J A;  1R7I A;  1C4A A;  3BPD A;  1U2R A;  1RWX B;  2MLY A;  1FWK A;  3TJ8 A;  3PFE A;  3W2V B;  1QUP A;  2CQB A;  2PGC A;  2Q6B A;  4B3T J;  2GFF A;  3W1Y C;  1N36 F;  4ECY A;  4X4P A;  4HYK A;  2K8G A;  4LF9 J;  1WC1 A;  4F4Y A;  1CBK A;  3THV A;  5AJ3 J;  2O01 C;  2ACM A;  2E7X A;  4DV7 J;  4XO0 A;  2P6T A;  1SV5 A;  3TAR A;  1JLG A;  4JI0 F;  1R8H A;  2H9Z A;  1WI8 A;  3HVA A;  2B7C B;  4XAK A;  2FHM A;  2U2F A;  1Q95 G;  1KRP A;  4RKU C;  4Y3C A;  3T1H F;  2IJF A;  2H48 B;  1WHY A;  3HKW A;  8ATC B;  1RT4 A;  2LQ5 A;  2UUC J;  4H4M A;  1RDR A;  2CNN B;  2RHS B;  1U0H A;  4LIR A;  4DR5 J;  5KFP A;  1BWV A;  2DO4 A;  4J90 A;  5KFY A;  3HD1 A;  3AXK A;  4J9L A;  2E9R X;  2DYA A;  3KLG B;  1S12 A;  2XMM A;  3H25 A;  3BB5 A;  4PQA A;  3ZTP A;  3KLE A;  3KTQ A;  2XMW A;  3F41 A;  2QZ8 A;  3BBF A;  1CJU A;  2FY1 A;  3M8R A;  1CPZ A;  1F3F A;  4ECV A;  3I9V 9;  3MMJ A;  5HRO B;  2IDE A;  1D9A A;  1B3T A;  2ZC4 A;  1NB2 A;  3D5M A;  2QV6 A;  4MYT A;  1T03 B;  5F8I A;  3I5B A;  3UD5 A;  5D15 A;  1TL1 A;  2RDI A;  3IBF B;  2E44 A;  1TR0 A;  1FT8 A;  4RW6 B;  1ZTT A;  3TAP A;  1X9S A;  3FSX A;  1S6Q A;  5DS7 A;  1W2I A;  3Q23 A;  1SIW B;  3BBC A;  1REV B;  1IBC B;  4DQP A;  4FYV B;  4IOA Q;  3ZTQ A;  2HQI A;  3OJU A;  4QIV A;  3MFI A;  4ECZ A;  1TZ0 A;  2K1R B;  1YX2 A;  5IT9 U;  2MQM A;  2P9E A;  2VFS A;  1ZOT A;  1RXO B;  1FXR A;  1YRX A;  3LTO A;  1XN9 A;  3OLB A;  2JEJ A;  4WZQ A;  1PJ7 A;  3EVW A;  5JVG Q;  2QL7 B;  4J9O A;  2VOD A;  3MEG A;  1HNW J;  3IO1 A;  4IUF A;  2HVE A;  3MMC B;  3N5F A;  3RW7 A;  4C11 B;  1YJU A;  3SSR A;  4F0H A;  3T6J A;  4H54 A;  5J2M A;  1U6Z A;  3RAM A;  3CCQ S;  1TV6 B;  3PAC A;  2R7U A;  2PO4 A;  4KPY A;  2YH0 A;  2KYZ A;  3WIV A;  3J7A 1;  1KWM A;  3CJ0 A;  2UV8 A;  4M5H A;  1CJK A;  1NKE A;  4DXL A;  2E1R A;  3T5L A;  5B0C A;  3QIP A;  4YHH F;  2GVD B;  3Q8Y A;  5D0H A;  3OL7 A;  3KOA A;  2MGZ A;  2F65 A;  1VS3 A;  1C1B A;  2HFS A;  1WC0 A;  4RR5 A;  3KFW X;  1O8B A;  1B0V A;  2O67 A;  2EKY A;  4QJV A;  3PKM A;  1J2V A;  3ZTO A;  4ZJL A;  1S76 D;  3A4T A;  5B09 A;  3GSD A;  3ENW A;  3HK2 A;  1NAQ A;  3SMZ A;  5HLF A;  3QRQ A;  1WTF A;  1IKX A;  4P7V A;  4ICL B;  3MM6 B;  2HMI A;  1QUV A;  1WKK A;  2VBW A;  4K4V A;  2AEM A;  4U7U D;  1JJ4 A;  5GVQ A;  3I32 A;  3QLH A;  4NCG A;  4A4J A;  5HMZ A;  2VFU A;  4RLE A;  3VWS A;  1Q7L B;  3GZ7 A;  1RAA B;  4FPR A;  1M1K T;  2HVH A;  1UVI A;  2MZJ A;  2YPZ A;  3FRY A;  1QE1 A;  3G2X A;  3DCA A;  1RYR A;  1S97 A;  3A1Y G;  1H2U X;  2P6S A;  1YBA A;  4ANC A;  2E66 A;  4Y2A A;  4DU8 A;  4MIB A;  2NYH A;  2W2P P;  3NGS A;  3RB0 A;  2AKW B;  3T9Z A;  2E5J A;  1RAI B;  1HW9 A;  3RB6 A;  2FVS A;  1S1T A;  1Q8L A;  4JI6 J;  3W8P A;  1FEE A;  1T02 A;  5F0U A;  5CYQ A;  1JLB B;  4UW2 A;  1N88 A;  2OSQ A;  3ZZO A;  1B0P A;  2VDI A;  2VJV A;  3JTN A;  2V67 A;  4KHM A;  1LWC B;  1TKZ A;  4DUT A;  3KHR A;  4UZB A;  2QFJ A;  2FYX A;  4C48 A;  1M5S A;  4ZHR B;  2AJ2 A;  2Q79 A;  1HQU A;  5HQL A;  2H5I B;  3T1H J;  3FZ2 A;  3M2R B;  1CJV B;  1YWX A;  5K14 A;  4WK3 A;  4RNF A;  1YLX A;  3C6U A;  1VQL S;  4C3M A;  3GP9 A;  4RPF A;  4ECX A;  5EUH A;  1DAX A;  4M5D A;  4YS2 A;  1O6X A;  2CQC A;  4M63 A;  4WZM A;  3CJK B;  2ZNZ A;  1KLM A;  3NGU A;  2RKI B;  2BQU A;  5DDP C;  1ZAV A;  3IWX A;  2G0C A;  1UWB A;  1UPP A;  3EDQ B;  4I2P A;  2DNM A;  3MEE A;  4MK8 A;  4JI1 F;  1HQE A;  4RW8 A;  3CC4 S;  1XTZ A;  2OGU A;  4C7Q A;  1AZS A;  2PEH A;  1S99 A;  4YME A;  5ETT A;  3DN9 A;  4HDH A;  3S8S A;  2X7I A;  5KFV A;  3PEH A;  4CO1 A;  3E01 A;  3GFH A;  2UXB F;  1TKT A;  4PXC A;  3MDF A;  1S6P B;  4EBE A;  1YRT A;  4KBI A;  1RHK B;  2DNQ A;  1XMB A;  1HBN A;  1LW0 B;  5CAA A;  1R43 A;  4QW8 A;  2G2Z A;  1R0C B;  2HZA A;  1UET A;  2V2Z A;  2RD5 C;  4J9N A;  4PAA A;  2ZHA A;  2DRD A;  4JYA F;  3GV5 B;  4OJ3 A;  2DIT A;  4Y2K A;  2PA8 D;  1JNR B; 
#chains in the Genus database with same CATH homology
 3J7A N;  2UUA J;  2UXC J;  2UU9 J;  1N34 J;  4B3S J;  1N33 J;  4HHU A;  4RJV A;  4LFA J;  4DR1 J;  3J80 U;  4X66 J;  4GKJ J;  4KYZ A;  3D3B J;  4DUY J;  3R2C J;  3R2D J;  2MQ8 A;  2UUC J;  2E5L J;  4AQY J;  4DV5 J;  5FLX U;  4DR5 J;  4JV5 J;  2KL8 A;  4DR3 J;  4YHH J;  4JI6 J;  4LF7 J;  5LMN J;  4DV4 J;  4NEY A;  4LF5 J;  4JI1 J;  4LF8 J;  2MEW A;  4NEZ A;  1FJG J;  3OTO J;  1XMQ J;  4JI7 J;  4LFB J;  2ZM6 J;  1HNX J;  4DV6 J;  1HNZ J;  4DR2 J;  1IBK J;  4LFC J;  4YY3 J;  4X62 J;  5IT9 U;  5IWA J;  4KHP J;  4DR4 J;  4DUZ J;  4NXM J;  4JI4 J;  5LM7 E;  1IBM J;  4GKK J;  4DV0 J;  2MTL A;  1XNQ J;  4B3T J;  3W1Y C;  1J5E J;  4JI5 J;  2UXB J;  1N36 J;  4NXN J;  4V1A k;  4LF9 J;  3D3C J;  4DV2 J;  1XMO J;  5A2Q U;  2UUB J;  4KY3 A;  2HHH J;  4DV1 J;  5AJ3 J;  4JI8 J;  2VQE J;  1HNW J;  3J81 U;  4PWW A;  3T1H J;  4K0K J;  1I94 J;  4DV7 J;  5BR8 J;  1IBL J;  4LF4 J;  2VQF J;  2UXD J;  2KVQ E;  1XNR J;  4B3M J;  3IMQ J;  4DV3 J;  2F4V J;  3JAM U;  4B3R J;  4OX9 J;  4JI0 J;  4LF6 J;  4DR7 J;  4X65 J;  5LMU J;  4JYA J;  4JI2 J;  1N32 J;  4JI3 J;  4DR6 J;  3T1Y J;  1HR0 J;  4X64 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...