5IWAJ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5iwaJ00
1N36J 4JI8J 4JI1J 4JI5J 5LMNJ 4KHPJ 4X65J 1N32J 2UXDJ 2MEWA 2ZM6J 4JI2J 3R2DJ 4DUYJ 4DV3J 4B3TJ 2KL8A 4JI3J 4LFCJ 1IBMJ 3T1HJ 4DUZJ 4KY3A 2UUAJ 4JI7J 4DR2J 3OTOJ 2MTLA 2VQFJ 2UXCJ 3T1YJ 4JI4J 4PWWA 4V1Ak 1HNWJ 4X62J 3D3BJ 4DR6J 3J81U 4DV6J 3IMQJ 5LM7E 4DV7J 3JAMU 1IBKJ 4YY3J 5FLXU 4DR3J 1FJGJ 5IT9U 4OX9J 4GKJJ 5AJ3J 2HHHJ 4LF4J 3R2CJ 2F4VJ 1XNQJ 4LF9J 2VQEJ 5BR8J 1N33J 4X66J 4LF6J 4DV4J 4JI0J 4LFAJ 4B3RJ 4DV0J 4DR4J 4LF7J 4DR5J 3W1YC 4LF8J 4LFBJ 4GKKJ 4HHUA 4NXNJ 2KVQE 4JYAJ 4KYZA 5LMUJ 1IBLJ 4DV1J 1HR0J 1XNRJ 4JI6J 4X64J 5IWAJ 4RJVA 4JV5J 4AQYJ 4NEZA 2UXBJ 4NEYA 1I94J 1J5EJ 3D3CJ 2UU9J 4NXMJ 4B3SJ 4LF5J 4DR7J 2MQ8A 1HNXJ 3J80U 1XMOJ 3J7AN 1HNZJ 4B3MJ 5A2QU 4DV5J 4YHHJ 2E5LJ 1N34J 2UUBJ 4DV2J 1XMQJ 4K0KJ 4DR1J 2UUCJ
chains in the Genus database with same CATH superfamily
2GS8A 1XTZA 3TAMA 4OZ5A 2WVCA 2MZSA 1RTHB 2MKJA 2WSCC 4NLSA 2VQFF 4OI3A 1WHWA 3T1YF 3OTEA 2QMXA 3AXKA 4R5PB 2UUAJ 2IDEA 4PEOA 4NYOA 2B4OA 3W5ZA 1KVJA 1KSPA 4WJBA 1D9AA 3NLCA 2KO1A 2KXHA 2MB0B 1U8SA 3QWUA 4CT9A 4ZVUB 3BF4A 3GONA 3NG8A 1PG5B 1TV6B 4JYAF 1C1CB 4URSA 1N48A 4EI2A 1RBOB 2XYPB 1VQPS 1FTCA 1RISA 1FRIA 4PAAA 5LMUJ 1FRKA 1UPMB 1GX6A 2FHJA 3DHWC 4F4KA 4FZVA 1XMOF 2FY8A 2A1BA 2MKHA 1YQHA 2MKIA 2V2KA 4ELUA 4FYYB 2ZZMA 1YRTA 1U1LA 1LW2B 2ZNYA 4F4YA 1N36F 4CIOA 1M5VC 2LECA 4K0KJ 2HAIA 2MY8A 8ATCB 1VBYA 1JLFA 1IKXB 1M5OC 3SFGA 4EBEA 1U48A 2FJXA 3M9NB 3LF0A 1RT7B 2QA4S 3DLKB 3QO9B 5KFBA 1MU2B 3TUIC 2VPZB 2F4VF 1CJTA 3G82B 5EWFA 2PD1A 2M8DB 5GMEA 1I1GA 2DEJA 1S0VA 1CS4B 2H54B 2AGOA 2HVIA 2X7IA 4DPOA 2FHJD 3P3DA 2ZBRA 2HIYA 3QBCA 4NXNF 3QGPA 4AYBD 3CULA 4U7UK 4NOHA 4CRJA 3QATA 2NREA 3D6FB 3ILIA 2CPHA 1UJ5A 2RKIA 1T94A 1S6QA 4DPXA 2A10A 3Q83A 3M1VA 1WKLA 4LF5F 4J9UE 4TU7A 1NCLA 4O4GB 4ZVTB 5LMUF 4DEZA 4CLPA 2GFFA 4NLYA 1WDTA 1SV5B 1BWVA 3FZBA 1ZETA 1SUQA 4B02A 4EBCA 3PRDA 1T03B 5LMNJ 4F25A 1U1PA 3FCWA 3RYLA 3VALA 1WF2A 1S1WA 1NRKA 1VK3A 3SCLE 4GVLA 3QJLA 1WC3A 1Q8KA 4ECZA 2A0FB 1U1MA 4K8RA 1FNOA 2DGSA 2YPZA 2HBYB 3LH2S 2HSEB 4MT1A 5HROB 3BYPA 3I6PA 2V69A 2DRDA 1KLMA 3NCRA 3HHDA 4IRKA 1ZPWX 1NH8A 1FKPB 2P6TA 2ZZNA 4PYAA 4TNOA 4NLTA 1B4SA 4LF9J 5CZVA 2R8KA 3OXLA 2QYGA 1SKWA 4ZLNA 3TEGA 4PRFA 4QOTA 2UVWA 1YJNS 3NCPA 2W7PA 2AW0A 1Y5NB 4AQYF 4CNYA 4WFAQ 1KHVA 1HARA 4QBUA 1RTJB 3FFIA 3DRXA 2IM2A 3J7AN 3TUJC 1AROP 3OFFA 4DR1J 4CTAA 3CGIA 5IQQA 1S7HA 4Z37A 4RNHA 4DSLA 4DU8A 4K4XA 2HNZA 3F56A 2OD6A 4KFBA 2LXIA 4M5DA 4WK1A 3VAGA 3SXLA 3JYTB 1IKWA 1SH3A 3GB0A 3R7NB 1X4EA 5HMZA 2G13A 1HNWJ 3LTOA 3FRZA 5ETKA 1N4LA 1WG4A 3MURP 3TA0A 3BO4A 4O3OA 3GCXP 1HBUB 4OI6A 1NHUA 4OHWA 4Q5VA 1LWFA 2ZE2B 2NUUG 2JX2A 1SIZA 3L9ZA 4IDKB 3Q8UA 2BRLA 2CQGA 3H25A 1KR4A 1FDAA 5IXUA 2XZTB 3LUYA 4R8UA 4URQU 4IYQA 2YBVA 3TZYA 2Y1RI 2KFYA 1PILA 4MTPA 2B7BB 1T02A 1YJ9S 3PR4A 1YGYA 4TN2A 1QE1A 2BEFA 2JEGA 4WFYA 2U1AA 4IQMA 1RTZA 2SXLA 2KZMA 2F8EX 2E5IA 2OD4A 3QMQA 1T9UA 1N34J 1X9MA 5E3PA 3RR8A 3CJKA 2N3OA 1RHQB 1JLEA 2RSQA 5DQGA 5F9NA 3EICA 5IT9Y 2W25A 2J0SD 3P5TL 1VRUA 2NXJA 3MM7B 4DL7A 1HMVB 2MHNA 2W2OP 4RW7A 3IN5A 1DTTA 2AT1B 3IGVA 4GMKA 4FN5A 3NAHA 4OLPA 3FBCA 2B7CB 4W4MA 5J2QB 2FLOA 4TYBA 7FD1A 3RU0A 2DPIA 5KFCA 4DR5J 1FRHA 1IBLF 1B99A 1UEKA 3HHEA 2CJ9A 1KFSA 3E01A 2YKOA 1HD0A 1M5PC 2XMUA 2MQQA 2V4QA 2E66A 3B4MA 2J7UA 2KXFA 4RUBA 1R0AB 1WC1A 1MNEA 1HNXJ 3J80U 1C1BA 4NMLA 3OPKA 2XNRA 3Q8QB 1XMQJ 2ACYA 2CJYB 3JS9A 3LAMA 2N4CA 2ADBA 1YG0A 4X4SA 1OMSA 3A3NB 4C7QA 5DDPC 3OT9A 4RWWA 2ZBPA 2QN6B 2HWIA 4ZDNA 5DQIA 2RQ4A 3ENWA 2BDPA 4DR3F 5E7OB 3OD2A 4F26A 4ECXA 3D3BJ 4F3MA 2ASDA 3O8WA 1R0BG 1LWCA 3BGLA 4ZJLA 3GLJA 4KC5A 3G6ES 2W7AA 2FYXA 2RAQA 3T6JA 2KT2A 1FEHA 2FHMA 2YNIB 2B9WA 5KFQA 2UVRA 2V68A 1HR0J 3IWXA 2LXFA 1GX5A 4AD6A 4WP8A 3IRXB 2IM1A 3VGSA 3UCZP 4WZQA 4GO7X 3ISND 4B17A 2VOOA 3NGUA 1N88A 5J2MB 2C2NA 3UDCA 4ZP6A 5C24B 2QG9B 2AYMA 4JI2F 3I9V9 4ZVHA 4ES2A 1JNZB 4NPOA 1KOHA 4QZVB 3N5FA 5RUBA 2PFDA 2I2YA 2FGOA 1PGZA 2KYXA 3V81B 3UNYA 2IM0A 2L48A 2DTJA 4QIWD 4Q7AA 4K4VA 1U45A 1RADB 1NZAA 1SJQA 2H1YA 1S1VA 3TUPA 5KFHA 3MFHA 2FLPA 1Q8LA 4IFYA 5THWA 3MEEA 1FX2A 1GTEA 1X60A 2ZC3A 2RHQB 2HLTA 1A0OB 3T1AA 2HQDA 1NJZA 1ZM2A 3HVTB 3PG9A 2BE2B 2OH2A 4FPRA 3DMJA 1TUWA 5LXRA 2C1EB 3EZ5A 5CZXA 3A13A 2PE8A 1HR0F 3ADAC 2V67A 4OZ2A 1RAFB 2E29A 4X65F 4ZITA 4M95A 3J7Z5 1RT2B 2R7TA 1IBMF 4UOHA 2L41A 2YH0A 3GYNA 5HAOA 3ZNUA 4DJBA 5KOWA 4I68A 1CJKB 1XC9A 1D0EA 3CCWA 4URGA 4GKJF 4HVZA 3H4BA 1N5YB 2MZRA 1U2RA 1HI0P 1JQGA 1FNMA 3OL7A 5E5NA 2D7SA 3FMBA 1F9HA 4LR7A 1VS3A 1BQNB 2RF2B 1ROFA 5C7PA 4HEA9 2LU2A 2IJRA 4LF8J 1YTYA 3CMES 1YJ7A 1S9EA 2HWHA 3WDOA 4YB5A 2XI2A 4M5GA 4OFZA 3UQSA 2VZ9A 3SSSA 1EJ7L 1G6BA 1CJVA 2CKWA 3GJSB 4KPCA 3UN3A 3M8SA 2EFOA 2XSFA 3MR7A 3GSIA 2RD5C 1OPZA 3QSYB 3K5NA 2MJNA 3BN7A 3RGIA 3PEJA 3GFXA 1RAGB 4JI5J 2J9CA 5E3CA 4X4VA 3GR1A 3DM2B 4CLTA 1RHRB 1LW0B 4KT0C 5L9XA 2KRBA 2AD9A 2H4WB 2MZTA 4GC6A 3ILOA 5B09A 2VG7B 2HPUA 3O5TB 2RDIA 3KK2B 1SBRA 2VDIA 4I56A 3GYXB 1MG7A 3SCKE 2IY5B 3AB4B 5B0FA 2BKPA 1FKOB 3CWJA 2IVYA 2A2CA 2F63A 2GVDA 3KNAA 3JQKA 3QLHB 2RU9A 3F0NA 2JJ4D 3MM8A 2BM0A 1KDNA 2NXUA 3BM7A 2GV1A 5IFMA 3V4IA 1FRXA 4X64F 4DBQA 1M5HA 3IBFB 3UVJB 3M2VB 2F7VA 4BWJA 3UE2A 2IMWP 3R9LA 2RDJA 1FWPA 4X4TA 4B9LA 5FDLA 2WB1D 1SVDA 4J5OA 1VBKA 3ZFVA 1KTVA 3P5BP 2C2KB 2UV8A 3JSMB 4EO8A 4WKRA 4ANDA 4ZP9A 2JVOA 3TZZA 5I3QA 1M90T 1WHYA 4DX8H 2GA7A 1S6UA 3W3SA 1RWXB 1UZDA 4LRCA 1TL4A 3M8PA 1RLDA 3DNCA 5CD4H 4MYUA 1X4HA 4RNNA 2E9RX 4OV6A 3S8SA 2LQ5A 4I2PA 3PIPQ 4PABA 3S01A 1VQOS 3NS7B 4TKTA 5F8HA 3OL6A 4O23A 3R5JB 5D0HA 5L38A 1S0OA 4N76A 2FVPA 3CD5A 3PTWA 1P1LA 1B3TA 3BPDA 3MCNA 1SPBP 3AT1B 3I82A 1H74A 3WX4A 3HHNB 2DPJA 3PHTA 3VAKA 1WKJA 1U49A 2DKOB 1JLFB 3QRPA 2HZVA 2L9DA 4LF1A 4IQXA 5KT7A 3PR5B 3DRRB 2GQ2A 2X3GA 4HACA 3TQ1A 3FZ2A 2GJIA 5I42A 4IFVB 3UW1A 4I0WA 1CJTB 2PN6A 5F8JA 3VGTA 2LA4A 2FIUA 4DV6J 4ZP7A 3S1TA 4P2SA 1QAXA 4ED8A 2QLBB 1GMVA 3M6VA 3NS5A 4OX9J 4G1QB 4K2XA 4NYZA 2ALYB 1RWUA 3HLUA 2EC2A 4B3RJ 3A8EA 4ZLPA 2P2CB 3KLGA 2RKIB 3EVMA 2BVZA 4DCJB 1PCAA 4CI0B 2W4PA 4QIFA 2OTLS 4H4MA 4MKAA 1UJ6A 2MQ8A 4Z7YA 3BGRA 1D8YA 1VMBA 1B64A 5L8RC 1SUQB 3PX0A 1ITPA 4WE1A 2C2OB 3W2VB 1SIWB 2MSTA 3UN2A 4LFCF 4KJIA 4O44A 3D5MA 2HHVA 2XBPA 2PEBA 3JSBA 3DOKA 3BR8A 3MPUB 2PFFB 1N5QA 3KLHA 3Q22A 4ZN1A 4XPCA 1RT1A 5K8MA 4J9PA 1VQ6S 4KKOA 1BGXT 1QY7A 5DETA 2XB2D 2VFUA 3R6LB 4DR4J 2BABA 4B9MA 3H4DA 4A8SA 1J5OA 1PC5A 2KVQE 1W26A 2MLZA 2XS2A 5KFDA 2WONA 2E1PA 5A8KB 3FFIB 1TL3A 3GJTB 3D3CJ 2D69A 3CSKA 1IKYA 4OYWA 3SQGB 2MGZA 1RDRA 3AJ2A 8AT1B 4F4ZA 1F5AA 3DGPA 1UZHA 2V8GA 2R7VA 4CTAB 1HW8A 1UKUA 2YNGA 1IBCB 1GFWB 4C48A 4X4OA 2HNZB 3OXFA 4JOUA 2E44A 3CCSS 3K0JA 3D0HE 2DH7A 5CYQB 2LVWA 3B54A 1S77D 1S1TB 5F8NA 1OY8A 4LBIA 2XYGB 1QLNA 2FY1A 2BANA 5EHHA 4DPUA 3HT0A 4OJ1A 3RJMB 2VG6A 3SCJE 4NE9C 2V4RA 3H5UA 3RB6A 4CH0S 4KV8A 3R5DA 1LV5A 1Q5YA 4C4WA 1WC4A 1GH8A 3GG1A 2VASA 3KHLA 3WBZA 4DR4F 1M1HA 1HQUB 3TRGA 2FGCA 5D0RA 5ETQA 1I94J 1UWBA 3FSYA 1G4CA 1QAYA 2ZOMA 2LEPA 3GV5B 3AJDA 1EX8A 3LGMA 3HD1A 3VVTA 3UCUP 4E2FB 1TL1B 4DXLA 4ICLB 2MMYA 4ZPWR 4FBUA 1H2VZ 2Y8WA 3K5MA 3VZIA 2IJNA 3BS9A 1VRUB 1BLUA 2CQ4A 1X4FA 1HYSA 2ZJPQ 2VJUA 2AJ2A 4RW7B 3CJ4A 1DQAA 2XC9A 4QR1A 1LWXA 3BKUA 1UEUA 2KHDA 1S6PB 2R7QA 4MAKA 1PAUB 4NCBA 4A8YA 4Q8FA 1Q95G 3G86A 3KFWX 3WC2A 1T3NA 3KLIA 3NMRA 3HFZB 1JNRB 3NMAA 4JI0J 2QMWA 2GGPA 2KB2A 4RW8A 2MZQA 2JRSA 4KE5A 1UW4A 3IBWA 3ZZRA 2XULA 2RB7A 4DSJA 5C42A 3R5BA 2YWEA 2KN4A 4C3LA 3NGTA 2N3LA 3HJFA 1U4BA 3BBCA 4NXMJ 5K8OA 1C1BB 4H4OA 5EX3A 2OPPB 1F5BA 3Q8YA 1ZA2B 3P96A 1FA0A 2IVFB 3AD9C 3DOMA 2RT3A 2BQRA 3IGNA 2ATCB 3CCTA 3DDIA 2NZCA 4KAIA 2JWNA 2E5JA 3D67A 1JLAB 1CVJA 1RBAA 3ZTQA 3A12A 1LWCB 4Y0FA 4OYIA 2ZEJA 2EFPA 4GO5X 4QW9A 4OI0A 1FVSA 2HFOA 3J80Y 1V6HA 3L7PA 2XY5A 5J2PA 3MM5A 3A3OB 1XK8A 3O1LA 4Q43A 3W2WA 1T05A 1HHTP 2DRAA 2CPEA 5D0GA 3KTQA 3UR3C 2B4VA 4P73A 4DR7J 1SKRA 2VFTA 2DXEA 1T9WA 1NHKL 1OYDA 3DKDA 4BLGA 2AMCB 5C2GA 3EUNA 4CO5A 2LEAA 2DXDA 3AB2B 2C3OA 2LQ8A 1J2VA 3FSIA 4PXDA 2QMUB 3UR0A 3OR1A 1RAAB 5KT3A 1EETA 5I4MA 2RQCA 3R2DJ 2XM3A 3C14B 1F60B 4JV0A 5B08A 3WIUA 1YBAA 2YQ1A 3GILA 3ISNC 3MF5A 4PWWA 3H40A 4JUZA 5CYJA 1RGVA 5FLXU 1S1VB 2OPSA 1UA1A 5C25A 3BQ2A 1QJHA 1VLOA 3CCVS 5J1PA 4EK2A 2DO4A 2B8QA 3C19A 3EXYA 4AL5A 3RRGA 3D1OA 1V5IB 3C3LA 3PDNA 1DTQA 3KG4A 1CULA 1Z4UA 1VK8A 3CE8A 2CNLB 1DLOB 2OUGA 1ZBTA 3DMJB 2RVJA 3JB9k 3EYZA 1O51A 4CO2A 3DLBA 1X5OA 3AXMA 4IH5A 2DR7A 4X4QA 3AHPA 1FKAF 1UFKA 1MWZA 2ZBCA 5IS2A 5LSRA 1A9NB 1NXIA 4PWDA 2IC3A 3ILLA 5GAEU 4IRDA 2ZJRQ 4K7QA 2LDIA 1X4AA 2MKCA 2KYZA 2XMMA 2K3KA 3H2VE 2UXDJ 3B82A 2QO3A 1SXLA 3TX0A 2EKNA 3DLLQ 4USHA 2MJUA 4QIGA 1PAEX 3OFHA 4ED5A 2CVIA 5KAKA 3E3XA 4PYDA 6AT1B 1CC7A 1TKZA 5KFWA 1V5VA 2CJBA 4FVMA 5BXIA 2AEJA 1EAYC 2OI2A 3JQMA 4NRTA 4USTA 3POTB 2DNYA 2WOMB 4ZVSB 5A76A 4XIUA 2DIUA 2XMVA 3MTJA 4BWMA 1VHIA 3OUYA 2ZZTA 1VC6A 4KGXB 1C0UA 1V9OA 3U7JA 1WELA 6FD1A 1MN9A 3H7HB 4YB1P 4JI6J 2H51B 2EG1A 3I31A 2AU0A 2DNQA 4YEAA 4B3MF 2WTFA 2BOPA 1RXOB 2FPHX 1SI9A 1S10A 3KG0A 2C3YA 1R8PA 4CDIA 1TR0A 1SC1B 5AE2A 3KHGA 2IRUA 3NNCA 5H9EJ 2IIHA 3TARA 3MAQA 1FRJA 1FRMA 1YJUA 1PO6A 3K5OA 2F5GA 1KVKA 2F4FA 2OMOA 4AXJA 1OQ6A 3J81j 4DQSA 3QPIA 2QYCA 3G8TA 1RA7A 2ATLA 4DQIA 4LSNB 2J76E 1MMLA 1C2PA 3QT5A 3MMBB 3NGSA 3DLHA 3BR9A 5L9NA 4LVOP 4LFAF 4LT6A 4OZ3A 3MM8B 3OLBA 1XN9A 2VB6A 5IQ6A 2E1RA 2VJVA 2GO9A 1ZM9A 3IAM9 1CQMA 1EB0A 2FJVA 4OL8A 4QWAA 3VZHA 2CQPA 4NEZA 2DNRA 2KM8B 5JVHQ 3TX8A 2Z30B 4J9VA 1EQMA 1RTHA 1R8HA 3M30B 3LAKA 2MLXA 2BQ3A 4U8YA 4C98A 5D4PA 2HRTA 4WK3A 1L3VA 2ZM6F 1JLCB 5B0DA 1WEXA 5C2CA 5K8NA 4KTQA 4DCPB 2ZH4A 5CCLA 5KT5A 4DPTA 3DYAA 4RU9A 3M8PB 1H7XA 3MUMP 2CPYA 2QC3A 2QSFA 2JFDA 2MZJA 1C1CA 1OJ4A 5BR8F 3CO9A 4DV0F 3R27A 2GO8A 1DQ9A 2YWFA 3ONQA 4A8KA 3W7BA 1JXEA 1NPPA 4LSZB 3PM9A 3MDFA 3IWNC 4J9QA 4RUCA 4OJHA 2Y0BB 1O6XA 1YJWS 2KT5A 3D1HA 2B6AA 7AT1B 2NS1B 3KJFB 1G3OA 1NK0A 2NZ4A 2KKHA 4OI2A 3H42A 1RT7A 1R6VA 2E9ZA 1C0TA 2ZKTA 4FYDA 3DLKA 1YJRA 4DSEA 2CPZA 1E6YA 2RNEA 2KG0A 1IUJA 5I42B 1GMUA 3ET6B 4PG8A 1YDLA 3PYFA 3VV2B 1ZAVA 4USUA 4X62J 4ID8A 1N33F 5D6GA 2IM3A 5IOLA 2IPOB 3FC9A 2KXNB 3FCVA 3KLGB 1X9WA 2YKAA 4CLFA 4O4GA 4PXEA 4K4YA 4HHUA 2CNNB 2NYIA 2Y9HA 2MKKA 1Q78A 4OYAA 1RB0A 4H4MB 3EX7B 4A8OA 3THTA 3CIMA 2GJFA 4DV5F 4JB8B 2B9XA 3BGRB 3CDUA 3MI7X 1T03A 1GK8A 3IR5B 3MR3A 3IRWP 4WE1B 4CWBA 3OL8A 2HNYB 3TJ8A 2KJVA 2WW4A 4ANEA 3IS9B 4O44B 4ES3A 4A47A 5E3QA 1QAJA 2JEFA 1W7WA 2VG5A 2KL8A 3KLHB 4Q44A 1FKPA 1DHMA 5DLFA 2F8HA 4ZN3A 1YZ7A 2CG8A 1RT1B 4ECQA 3H5SA 4V1Ak 4DL4A 1SQFA 4KKOB 3BYRA 4OYBA 3LGHA 2HFVA 2GZOA 4U9RA 5KFZA 1SQGA 3CC4S 1QM9A 2WW8A 2B3TB 1KFDA 3PRBA 1J5OB 1K0VA 2R2TA 1UVLA 3MHYA 2VONA 4DQPA 2WONB 3WC0A 4G1IA 4P75A 1TL3B 2EG2A 1Y0HA 2P6SA 3FEZA 2DGOA 4USVA 2Q1LA 1RHKB 2FC9A 5GMDA 3DI6A 2MGZB 5KFXA 3DGPB 3VAJA 2HQGA 4OX8A 2FHKA 1B70B 2J8SA 3A8IA 2AIRB 2CYYA 2JHEA 2AGQA 2NYHA 3JYTA 2D9OA 3OTDA 3CCRS 1QTNB 3C6UA 2LLZA 1VRQC 3DOLB 4ZMMA 2KZZA 5DDOC 2R7XA 4NASA 2ROEA 1RACB 3NS6A 1IWAA 2ZE2A 4ZK7M 1XBWA 2XZWA 3RAQA 5LJ5Y 1HI8A 4ZVFA 5EDWA 2IVMA 5IT9U 3HX9A 1TKXA 4FBTA 1SJ4P 2AZ3A 4Y2IA 4J9NA 1MN7A 2Y3YA 3VGVA 4USKA 2NUHA 1CC8A 4KV8B 1RUSA 2IFXA 4KGMA 1TKDA 1UFLA 3THVA 1UVNA 3W62A 2WVEA 3FBEA 3K58A 4U7UD 1FFSB 1DY3A 5ADZA 3T9NA 3QGHA 2CXEA 1NDCA 2VC1A 1EARA 4DV2J 3KJNB 2JFKA 5HP1B 1EQ0A 1VC0A 1QVGR 2ZUGA 3ENVA 1NEEA 4DV3F 1HMVA 1RWMB 3T1HF 1WWHA 2RDDA 3SV4A 3SDEA 4QYZJ 1VIOA 4V19J 2NPIA 3C15A 2XLKA 5J2QA 5B0CA 2X3DA 4EO6A 1LXJA 3MWBA 1CBKA 3A4TA 3RG6A 5KG6A 4F4WA 4BS2A 5DZ6A 3M2RA 3UO0A 4LMZA 1QD1A 2CQBA 2GGPB 4GKKF 3IBCB 4DSKA 4W90B 2KRRA 4ED6A 3OVBA 4OYXA 3LP1A 2L9NA 3CCES 1SC3B 1NDPA 1UVIA 4F0KA 1RYSA 2KT3A 1RAHB 4ES1A 4G1PA 1T3OA 3K5PA 2E5LF 4H4OB 2MHEA 3CJQA 1UL3A 1ZOTA 2GCFA 2B9YA 4P72A 1Q81T 2HEKA 3MAAA 2M2BA 1WNEA 4UF4A 2OLWA 1RAJA 3D54A 2KFZA 3VGUA 4JI3F 2MLYA 4MIBA 2GX8A 1TP7A 1ZM3A 2EFQA 5JUMA 2G1HA 2YKQA 3US5A 2ALZA 3FEXB 1YKWA 1IKVB 2GW8A 4CO0A 2YNIA 4DDFA 1IBKJ 3DCAA 3QGIA 3HHLB 2BW7A 4DFKA 1RCXB 4O3PA 5H1SV 4L76A 2GHWA 3MM5B 3LWMA 1FD2A 4TXSA 4UY8T 3SQOP 1VCTA 3IRXA 1VRTB 4RLEA 5IWAF 3OVAA 3W2WB 1T05B 1LNQA 1S79A 1TELA 3PW4A 1NU4A 4HLBA 5C24A 1VYAA 1HNZF 1MWYA 1Q79A 1R7IA 1L3TA 2DY1A 3VQSA 2JOQA 1UMJA 3RAMA 1E6VA 3HHKA 3MZIA 3OR1B 4HT5A 3UPFA 1KKHA 4DUZF 1SJ3P 4JI7F 2HGNA 2MEWA 1T9VA 1DRZA 2YNHB 2QLFB 2XHCA 4ECSA 3ZTRA 4RZRA 3HSJA 3M9MB 2O5DA 2RS8A 1R8AA 4DR6J 1K0TA 2OPSB 5HI7A 4WYWA 3LA0A 4K5RA 3HCXA 2XCPA 4HYKA 7FDRA 3SV3A 3MD3A 4F3OA 3BREA 4I4BA 4H54A 4CLSA 4PPZA 2BE2A 4UZBA 1GMWA 3GIRA 4XPEA 1DTQB 4C3MA 4NCAA 1CULB 4WPAA 5F41A 2QIFA 4FDFA 4CLZA 4RO0A 2XCAA 3T5KA 3QQCD 1S76D 4YHHF 5DG7A 1XR6A 1RT2A 2VOPA 3QAEA 4RNFA 2ZH8A 5A2QU 4ECUA 2I8EA 4PWDB 1APSA 1CJKA 2VHGA 4YQWA 4ZCLA 3KUHA 1N32J 1UVJA 1GXTA 4LBHA 1BQMB 2ZBIA 4CNZA 2W01A 4XO0A 3IO1A 4C8MA 1K9MT 1BQNA 2BKNA 3NCQA 1XNQF 1WD6A 3IMQJ 2VQEF 3F73A 2WRMA 3E2EA 1NMEB 1OS5A 4DV4F 2IDLA 4PG7A 3PVXA 1U02A 2H4YB 3V6DB 3DDNA 1X4CA 4DR6F 4TLQA 3W5YA 2K1RB 2ZBQA 3KUGA 3S6EA 2Q6BA 1QSLA 3GP9A 1N54B 2VF3A 1A6LA 3MUVP 4MK7A 1VOMA 2H5IB 1FWKA 3CEDA 3H20A 2CPFA 1IJEB 1Q7YT 2NXEA 3HO1A 2CDQA 4CH7A 3CO0P 4RJVA 3BBFA 2BA9A 3CCLS 1HLWA 3CNQP 1R3NA 3DM2A 1HBOA 1LW0A 1U0SA 4Q45A 3N9UC 3BO2A 4JI1F 4C8ZA 4FXWA 2YKMA 3KK2A 4Q2LA 2YY3A 1VQ5S 1RYRA 3C2PA 5IM0A 1UTAA 3AD7C 1HQ2A 1SL0A 4RNMA 1B7YB 5HVGA 1JX4A 5T41A 3FKBA 3IC1A 4OZLA 1XIQA 1BQXA 1ZM4A 2UXCJ 1XR7A 2EK6A 2HS4A 1TU0B 4NI2B 2BQUA 2RE1A 5DDQC 4OLOA 4DLGA 3TW0A 4F04B 1NLKL 4I1TA 2C3UA 1RTIA 2ZJQQ 4LF7F 3H0PA 5CA5A 1FXLA 2BACA 2D9PA 4LF6J 2KTQA 2VV5A 3PW0A 1QTMA 3UVJA 3M2VA 2R7SA 4DQQA 2A18A 2I6WA 5G0RB 3HPOA 1XNRJ 1WHXA 1VDHA 5D4LA 3JSMA 3BH6B 3RB3A 5DO2A 2BE9B 4USWA 2BKOA 3TJAA 5LL6d 2Y1IA 2BOAA 2CDRB 3KLVA 3IP0A 3MCMA 5DZ7A 3M05A 2R8HA 4C0HA 2VBWA 4DL2A 1HPZA 2G9OA 5KTQA 4LUBA 4OJ3A 4NLPA 3WQPA 1F2GA 3DYAB 2YQ0A 2I5JB 5F0WA 3TVZA 3BPSP 1U6ZA 3OTOJ 4YDDB 1WF0A 5GADU 2KDOA 3IG1B 5KFTA 3C6TB 2PEHA 1TAUA 5AJ3J 2FZCB 5J1NA 1VGYA 1FI4A 4O4RA 2E1CA 4JBCA 4MK9A 2J9EA 3BKFA 1JXLA 3M6UA 3JQJA 3K2YA 5E2QA 2JDJA 4O3QA 1IM6A 3D68A 2MQPA 3VR1A 2CQ1A 3HVAA 4AFFA 2VFVA 3PO4A 2B6AB 1FD8A 3QIDA 4CLWA 4RW9B 4NEYA 4CCHA 4MKVA 4Q8EA 1HI1A 3LPEA 3Q8RB 5I3UA 1VQMS 3DRRA 4TU9A 2DBBA 3CCZA 1H2TZ 3BJYA 1C0TB 1S97A 1KS2A 4NCGB 4IFVA 2XWYA 4HH0A 1E6YB 2ASJA 3N0VA 4F2SA 3NXZA 2UUAF 4WYLA 4M1KA 4J9KA 4LJMA 1Q1KA 2RS2A 4G1QA 5SZTA 2ZH7A 3UD5A 4BHQA 2EXUA 1TKTA 5JXSA 1Y7PA 1Z1ZA 3DHXA 1EHWA 2FC8A 3UI3A 3DRPA 1FJ7A 3AQOA 2YKNB 3MMCB 3MMJA 3HT3A 5AJ3F 1F3VA 3AOAA 1D9DA 3I0RA 2GAGC 3KWMA 2W9CB 3MECA 5B0BA 1IR2A 4DPYA 2CQDA 4DV1J 2ZH2A 4ZVGA 3B78A 2FVQA 2PA8D 2HFSA 1NK8A 2NXCA 3FBFA 2UXBJ 3W2VA 1TK5A 4ZPDA 3U27A 4K0KF 1J27A 1FE4A 2BE7D 1U1NA 2GMHA 3SFUA 2IYIA 4Y2KA 4MIAA 4P9SA 2XGQA 5MAOA 2VG5B 1FJEB 3NGDA 2FJEB 3HD2A 5LOQA 3VAMA 2D3UA 4N7TA 3T5LA 1FXRA 1FDBA 2O1PA 2FZKB 1GQEA 1DZ5A 2FVRA 3NRBA 2UUWA 3NKYA 5L39A 2EPIA 1IR1A 5A8KA 5ETRA 4LFBJ 3HJVA 4JP8A 1JLQB 1NB2A 4IH7A 4K4UA 3TAQA 3SQGA 2GNKA 2CZ4A 1K44A 1HNVB 4KGKA 5HQMA 4DWIA 3DI6B 2BJ3A 5FIIA 1NK6A 3PZPA 4ZPCA 1S49A 3OJUA 3J7A1 1NDLA 2W9BB 3BDPA 1FTRA 1RLCL 2J5AA 3S7RA 1YJTA 5LMNF 2CJQA 5CYQA 5HJYA 3I56S 1KD1T 3C6UB 2DGVA 5H9FJ 1D9FA 2QA4G 1VR6A 5E3AA 1HHQA 4I2QA 5A8WB 1VI7A 1NUEA 1S1TA 4Y34A 2FD2A 9RUBA 5CQGA 2J0XA 1RJJA 1PSDA 3MD1A 2VIHA 2JVRA 1TKXB 4LF9F 1UFWA 1U6BA 4QR2A 4PCQA 4LF4J 4Q0BB 2DHXA 2QGFB 4DG1B 2H48B 3OSNA 3VF0B 2GIQA 4P71A 4ZVQB 1HQUA 2BJDA 1U47A 1NK9A 3H8YA 2NLWA 5F0UA 2DO0A 5T14A 2DHHA 1X4BA 2APOA 1MMDA 4DCOB 5ITHA 4FP9A 2XWXA 4JV5J 3WX8A 4WFXA 2F8MA 3MM9B 5KFKA 1I5OB 1TL1A 4WTOB 4DR1F 4ICLA 2ABYA 2BJ9A 4EZ9A 4RW6B 3NGKA 4OHVA 1S12A 4ZCKA 1TTHB 3GFYA 2F40A 1JMTA 1U6FA 2QJ3A 2V8HA 3I0SB 3ILJA 3SDEB 4A8QA 2L3MA 1S6PA 1N8RT 5M2RA 4DL6A 3C15B 1HNWF 2WBMA 2MKYA 2VFSA 4WFBQ 1FJCA 1S9GA 2E7WA 2UZAA 3M2RB 4YY3J 1UW9A 1RT3B 3SEOA 2A2DA 4WFZA 3MXHP 1DFDA 4YDXA 3ENQA 1G1XA 1KNZA 4UOFA 4ZP8A 3TEHB 3LP1B 1R27B 2XO6A 2B51A 1KN6A 3TP2A 2AHOB 3LO3A 4WF9Q 2DXFA 5F3ZA 5AE3A 1QDUB 4KYZA 2RMLA 2OPPA 4DF4A 4N47A 2YWKA 3W63A 1HWIA 1OO0B 2W8LA 3I96A 1FESA 4IOCQ 1N34F 4IR1A 1KWMA 3RBEA 3MAAB 3EVWA 1YLXA 2UUCJ 2I1RA 4WIQA 2MQOA 2VPYB 1JLAA 4JI8J 2MKSA 1H73A 5DM7Q 1X5PA 2OELA 5F8LA 3FQLA 4K59A 3DXBA 3O6QA 2LYVA 2W24A 1O8BA 2XY7A 5CCMA 1WC0A 4KHMA 2B4UA 4Y3CA 4DR2J 3M2UB 3QNWB 3P8BB 2CWXA 5HQ8A 4ANCA 2IBKA 2ASYA 2CRLA 1ZTWA 5A6PA 3ZZZA 1W2IA 5DLGA 1X7VA 2CQHA 2HHHJ 5E3RA 4X84A 3PHEA 4F36A 4DR5F 1N6QB 4MKBA 5KFUA 2YVSA 4WTYA 1EKSA 1FXDA 3NL0A 1M5SA 3BB5A 1PJ6A 3B4DA 2ZHAA 2NQPA 2EW9A 2GQQA 3QRRA 2G2YA 4AE5A 3D66A 3RRHA 3GPAA 3N01A 1NHVA 1HNXF 2XYHB 2PMWA 1TVRA 1AXQA 2W8KA 1XMQF 3TQEA 3NOCA 1E6VB 3CMAS 4F0HA 3C14A 4F0MA 4RKUC 1WJ9A 2IRXA 1P27B 3EWGA 4KH1B 5D3GA 2WSEC 2DT9A 2JL9A 3EPIA 1RTDA 3G87A 2X51A 1RKJA 1HNIB 3D0IE 3IR6B 3AH6A 1MSWD 3DLGB 2VBYA 3KK3A 3PX4A 2DH8A 2K3IA 2N7YA 2LQJA 1FHTA 3HFVA 2CQ3A 2M9KA 3Q2SC 2HHTA 1CPZA 4BDPA 4RL1A 2K8GA 2HHUA 1WORA 2R8JA 2XSJA 1WTBA 2BW2A 2HLUA 1YX2A 2G2ZA 3GWCA 5IV3A 1DLOA 2QL7B 4R0JA 1FERA 2V50A 1LFPA 5IC4B 1KVIA 1SB6A 2E5GA 2HHHF 2EEYA 1U0HB 5L1JA 5LJ3Y 1Y3JA 3SZ2A 3R5AA 2WVFA 1NSAA 5DRKA 3DU6A 1AW0A 2ZH5A 3DRYA 2C22A 3KK1A 2UUBJ 4P2XA 3DXSX 2CNKB 1Q8IA 4ALZA 4DLEA 4Y65A 2OEMA 4U6PA 3DLJA 3BQ0A 4KHPJ 2GHVC 3HZEA 4TY9A 5H9FK 2UUTA 4O0IA 3QSIA 1IVZA 2CPJA 3PW7A 4ZLLA 2CAJA 3N28A 2CZVC 2K7JA 2QA2A 2V2QA 3GCWP 5L1IA 1JJCB 4IUFA 4DZ6A 4J90A 4J9LA 4JI4J 4IO9Q 3POTA 2FZGB 3SI8A 2WOMA 1PIEA 5EWGA 4DX6A 1NJWA 3PACA 1TZ0A 2VL1A 5CYMA 5A2QY 4F3QA 1TMJA 4NYPA 4BBYA 3PW5A 4DPWA 1QVFR 5KFRA 3TR5A 1WG5A 1WOOA 1GXUA 4JV1A 4NLGA 4UW2A 2Q43A 2HHSA 9ATCB 1NB7A 4CLYA 2EBGA 3HI9A 2UU9J 1HBOB 3W9IA 3KNGA 3TA2A 2VU5A 2C42A 2YKMB 4NA2A 2AEFA 3HXMA 1X0FA 3MOZA 2V94A 2CJXB 1XJWB 4BCAA 5MLCV 5IM0B 2WZ1A 2GIRA 4DMZA 4NLOA 5D4OA 3NNAA 1F0XA 4N5SA 3CCQS 4LSNA 2FDNA 2UVUA 3D2WA 4DUYJ 4FXDA 3MMBA 3O3LA 4IG0A 1T9YA 4S0MA 1RABB 3RUBL 3AA9A 3CDEA 2ADCA 3G96A 2GVZA 2BJ8A 2R9LA 5ETOA 2FHOB 1O0PA 4DV7J 1FJGJ 3I87A 1RTIB 2ZNZA 2ZDPA 1HQEB 2J7KA 4KSEB 4LF8F 3AA8A 1CJUA 4F4XA 3VQTA 2HVHA 1YWXA 2DNPA 3UD3P 5KFVA 2QE5A 1FCAA 3M30A 1S72S 5BYQA 2MQLA 3KDNA 3M8WA 2QLWA 4U7CA 2KVIA 4X4RA 2M52A 1K1QA 2QV6A 1JLCA 4B3SJ 1PKUA 4L74A 1RHMB 4OZNA 4JI5F 4HI2A 3PO5A 2OSRA 2DNNA 4USJC 4M5MA 1CQNA 1HPZB 2W2MP 2A6OA 3QFWA 3NY0A 2M0GB 5AT1B 5K9FA 4YS2A 5J2NA 3M8YA 3HZGA 3L7UA 1PJ7A 2BBEA 3KLEA 3OTCA 1FWLA 1N5TA 4P6QA 2VQFJ 4MKYA 5GAGU 5DS7A 3T1YJ 1HBMA 5DJBA 1K47A 3CDAA 3AY0A 4RPFA 3H90A 3PEHA 2XNQA 2Z57B 3KJVA 1LQ9A 4P7VA 3ETMA 4L3NA 4ZLJA 1P9QC 2VKZG 1I51B 4ZVPB 1DAXA 1ELOA 1WC5A 1OWXA 2QFJA 1FK9B 2ERRA 5HK4A 3ZNJ1 3K7RA 3EGWB 3MR6A 4C9DA 2W7OA 4ZPTR 4JYAJ 1SQEA 2F9DA 3HF5A 1RT4A 2Z2YB 1VQ4S 4YMEA 4X2BA 4GVBB 3D1QA 5I3UB 2F3JA 4M5HA 1XMOJ 1Y10A 3RTVA 2C2RA 4PQUA 1Y00A 4TY8A 2HBQB 1WOSA 2H5JB 1LKZA 3ET6A 4OX7A 1N36J 4K2JA 4F7VA 1KLNA 4GRSA 3EZOA 4ZHRB 4E0DA 1Y5IB 2J9DE 5T7LA 4DOZA 1ZTTA 3PFEA 1VQLS 2FJWA 4CH1A 2GMLA 3BZQA 4EMDA 2E5HA 1TKTB 4ETXA 1OSDA 1X5SA 2R8IA 3CJ8A 4HT7A 2D41A 2QEXS 1RAIB 4WXWA 3W60A 3DRPB 3OR2A 4EWTA 1Q86T 3MPVA 2ILZA 1KQSR 2F4VJ 3TI0A 1L3KA 3ITHB 3VWSA 1WG1A 4UTGA 3DLEB 3BSAA 3I0RB 3L7OA 3M9OB 2VA2A 3PY8A 2B9EA 3TWZA 4WP3A 2V4JA 3MECB 2Z0GA 1WEZA 4NXNJ 5ETVA 3BGUA 5KFGA 3EMTA 2HNYA 1REGX 4OQJA 2R7WA 1PYSB 1OPIA 2W4CA 4QPTA 3PIOQ 2CG4A 2N4DA 2LFVA 2ZD1B 3IS9A 4LF5J 1JWWA 2B4PA 3MM6A 1AZSA 2IA6A 1H6KX 3DU5A 4KHRA 4M5LA 5DGBA 2MSSA 1ZA1B 1NKBA 3R3TA 2G2OA 3L4BC 3D6TB 2V9WA 2VFRA 1BC6A 2HVZA 2YX1A 2CQ2A 1XERA 2EI5A 1T95A 4D3HA 4UT4A 3DGVA 1I3OB 2OPRA 4DV6F 3V4MA 1KQFB 4UOCA 2HK3A 4OX9F 2UVVA 2OPQB 2RRBA 3BSNA 1P1TA 4EYHB 1R43A 2AJFE 2KHCA 3CJSA 4B3RF 3P6YC 2RJZA 3V6JA 4EBDA 2A3JA 1HW9A 3IFEA 3GR0A 2L08A 1MMNA 3W1YC 3QT8A 1TQLA 3I4HX 2F9JA 4CLLA 5A0YA 4ETZA 1FF2A 2YX7A 1BY9A 4DN0A 2XLJA 4HTIA 1GAOA 3C16B 1Y11A 5C5JA 3FQKA 1FE0A 4AQYJ 4FF3A 4IKAA 4CP5A 3UDVA 3EVOA 3PXGa 1IJFB 1N5SA 2AX1A 2RUGA 1T11A 2JSXA 2P9CA 1F9EB 4G65A 4UQTA 3DOLA 2ZWPA 3N4WA 1IXKA 4C97A 3D0GE 4J9MA 4I2QB 5HANA 4AL7A 5FD1A 3ZZUA 3OL9A 5D78A 4NA1A 1RWOB 4HDGA 2JC0A 1FDDA 3M6WA 2ZFHA 1KP6A 1U26A 2Y0SD 2MXYA 4K4ZA 4CYUB 3QGGA 2HZCA 3EGNA 1IWGA 1RSCA 3HDSA 1VQSA 4WCEQ 1FFWB 5E0OA 3DRSB 4FNIA 1HIYA 4KO0B 3ZC4A 3KKFA 4EGLA 1ACMB 1QSSA 2K06A 3A8KA 5D77A 3G6VA 2XG8A 3ULHA 2QLJB 4WKYA 3W64A 1H38A 2B0GA 2UP1A 3G2XA 4B3OB 3AODA 5DDRC 4TVAB 2POKA 2AP6A 4ED7A 1K8AT 5HP1A 2CQCA 2EFNA 4NLXA 3ZTPA 2ZITA 2CIMA 5IZHA 4FYVB 4M8LA 4FYXB 2G1DA 1NM2A 4M63A 1JXVA 1HD1A 2HGMA 4OHYA 5ETLA 1VQYA 4WBFA 2QZ8A 4J37A 1SJ1A 4OYPA 1PYOB 3LGNA 2DNOA 2V9KA 2IBOA 3VAHA 4QWEA 4ZPAA 1RT5B 3L3CA 3D28A 2IYGA 3SSQA 1S9GB 1VQ9S 4NWBA 2CJAA 1GNKA 3A3PB 4RW4A 2NSBA 1WACA 5IT4A 4PWUA 1R31A 2XS7A 1RI7A 5DM6Q 1NPRA 1JLGA 5GAGI 2C2EA 1U2FA 4DI6A 4ITSA 4CM2A 5KFYA 2OAUA 4DHVA 2P9GA 4NL5A 2HS0A 2DR6A 2AJ1A 1Q7LB 1S4FA 2HMIB 4ELVA 1I94F 1IBLJ 3DN9A 5KT4A 4L75A 2V0NA 3CD7A 2KU7A 2Z2MA 5M2UA 3LOUA 1K73T 2DHAA 1SKUB 4FS2A 2ZDOA 3MGJA 3LALA 1SKSA 3CJ2A 2PGCA 1IKVA 3ZZYA 1VISA 2YNFA 4NZ0A 4MFBA 5AXKA 2HFZA 3HHLA 1NK7A 4PZVA 4IRCA 3AOBA 3K8VA 3H5XA 5HQLA 1M0SA 4N8OA 4DR3J 1UETA 4JI0F 4ZIVA 1VRTA 5K8PA 3PFOA 2OKQA 1SC6A 1D09B 3FDSA 3TVYA 5HN0A 4NLWA 2JLGA 4K50A 5FJ4A 2IAJB 1TVRB 4NXMF 2C2ZB 1X4DA 2OGUA 2IRYA 3EJMA 3H59A 4HDHA 4PXCA 1AT1B 1YJVA 3W61A 1AYEA 2KG1A 4LRBA 1ZZNA 2AV5A 3CXCR 1D8ZA 5D3GB 2YNHA 4CO3A 2F65A 3HHLD 1RWPB 1RTDB 4X4NA 3W66A 3BEGB 5KG2A 1QSYA 4JI2J 5K20B 5L1KA 3K57A 4B3TJ 3KK3B 2IJFA 1RHJB 2XTJP 5KFEA 2PI4A 5D8HB 3B8HA 3Q86A 3TJ9A 2LA6A 4ECVA 4ED0A 4ZOSA 3EE3A 4B08A 2XSJB 2ZVSA 2R3VA 3DFEA 4FYWB 2DJWA 2VC0A 2NCKL 4U95A 2YKPA 3CJRA 1NSPA 5D4NA 1SJRA 2B56A 2CZ9A 8RUCA 1M5KC 1SC4B 2XS5A 4YB7A 4RBVA 6FDRA 5SUHA 1OY6A 1N0UA 5A6WA 3G6YA 4FS1A 3M8QA 1X4GA 2CADA 2DHSA 4K4WA 2ZH1A 3MOJB 1ZS6A 2VBZA 4DR7F 3R5CA 4I6WA 1LEOA 5KG3A 3ETOA 3FJ2A 4DSFA 2E1MC 1EP4A 4C11A 1KONA 3KLFB 3KK1B 2CA9A 2HKEA 5HATA 5KG4A 1BQMA 2O66A 3HFKA 2OSQA 4LIRA 4C8OA 5D15A 1QAIA 2G0CA 4A8XA 1YITS 4NLDA 4X65J 3MR5A 2KFNA 1FDNA 3PX6A 2LDYA 4M5IA 4WFNQ 5U47A 1BWEA 2LP4A 1RQ0A 2XMAA 1IBMJ 2HIQA 2YX4A 2AQ4A 4QJVA 3V6DA 3G9CA 4FF4A 1G2EA 2R42A 3HKWA 4B3TF 3LP0A 2K1RA 3J81U 4I67A 4GKJJ 2J7WA 1S7IA 5CYMB 4ZCIA 4IOAQ 4QWDA 2J0WA 4F02A 4IG3A 3LANA 4XDDA 1AA1B 3EGZA 4USMA 3T3FA 3T41A 2D1CA 1RWNB 2P9EA 3Q8VA 3J7ZT 3KYLA 3M32B 2DGUA 1BXNA 2XMKA 3ZTOA 2WVDA 2CUYA 2DIVA 4NRUA 4ECTA 4Y2MA 3J7YU 2FLNA 4FNHA 2ZHOA 4A8FA 1TFYA 4Z7CA 1RAEB 4NX9A 5KOXA 2AJ4A 1VQ7S 2UXDF 4WP9A 1WEYA 5G4DA 3N5BA 2H5EA 4YUDA 4IG0B 2PT0A 4NI2A 2G0JA 3RB0A 1Y9OA 3W8GA 2GVZB 5B0GA 4CZCA 4OZ1A 1IQTA 5K14A 3NAIA 4C0OC 2MTLA 1LWEB 3UWTA 1X5TA 1S6OA 2QLXA 2VD3A 1S0MA 1CJUB 1Q8BA 4A8MP 1XEZA 3BSCA 5G0RA 1R0CB 4QW8A 3NBPA 5DQHA 3MFIA 5J1EA 2OP5A 4KIAA 2W1BA 3QT6A 4CLUA 4TQRA 1T9TA 1Y4ZB 4JI6F 4HL9A 1VBZA 1X0PA 1NH7A 4UOGA 3R8YA 1GT8A 4X64J 1XQIA 4Y6IA 3UFCX 2LCWA 3D9BA 3CJ5A 2HYIB 1H98A 2P5VA 1U09A 2YWWA 1S1XA 3RB4A 2ZC4A 3MAHA 1OY9A 3QZ7A 2I5JA 1NO8A 2J6TA 3MEGB 4LF2A 5J2NB 2HVDA 3SBMA 5HLFA 3IG1A 3KLEB 4R0EA 3AQPA 3C6TA 1C4AA 2DR8A 1UCNA 1L3UA 3ZXWA 1SJFA 1WUUA 4PUOB 2VBXA 1HBMB 2EBEA 4J9SA 1UVMA 3QZ8A 2RU3A 1SCJB 1Y3KA 2MQMA 1TUVA 4P2MA 3KJVB 1S48A 3I32A 3NOGA 1XR5A 2RRNA 3R2CJ 3G4SS 5JVGQ 4ECYA 1FX4A 3RBDA 2ASLA 4QQBA 5LSOA 2HQFA 4RW9A 3GIIA 2HFNA 3M4XA 1OQ3A 1V3SA 1UJ4A 1S4EA 5JJBA 4DL3A 3CDBA 1RT4B 1MWQA 3V2UC 3EGVA 4HTJA 3RAXA 2KM8C 3GZ7A 3FCHA 4NCGA 2COLA 2XGPA 4PQUB 4TY8B 1F6TA 5IT0A 1QUPA 3SYZA 3W8PA 2E9TA 3A1YG 3JXOA 5T7LB 4F2RA 4UUXA 5HMYA 4NMXA 4FXVA 1VQNS 2QL5B 3WIVA 3KG1A 5KFJA 1S57A 4M94A 5HSPA 2YKNA 3MMCA 3TAMB 1NK5A 4EU0A 3GG0A 5KG1A 3OR2B 3HKZD 2AX0A 4L73A 3LP2A 1Q5VA 1Q0NA 2W9CA 3G71S 3U1LA 2MYFA 4ZA1A 4WIIA 2CQIA 1U2CA 4U67Q 3P45B 2V4JB 2I0XA 3V6HA 4Q2MA 2HNDA 5HVHA 3T5HA 2YWGA 1OYEA 4CQ1A 2VPXB 3H5YA 3MM6B 3VAFA 2RILA 1AZSB 4ILLA 3GFZA 5GAEI 2V6AA 5CD4A 3Q0AA 1MROA 2BZ2A 3GFHA 4CO4A 5KT6A 4DFMA 3AD8C 3Q2TC 3Q23A 2JZ5A 3BBBA 2O67A 2DNMA 3EDRB 2BRKA 4QWCA 2OPRB 4ED3A 4LFCJ 1IN0A 3TOQA 4X62F 2QFIA 3SIPB 2W2NP 2YWHA 3UNGC 4H4KA 1HWJA 2WSFC 1S1UA 3HP6A 5DGAA 1REVA 2KI2A 2X1GA 3AFGA 2UV8G 4PG4A 2B43A 1RWKB 5KG5A 4QU6A 2OFHX 1Q82T 4FVCA 3Q8SB 1JLQA 2FJBB 2IMOA 4A8WA 1WSVA 3QIPA 4X66J 1HNVA 2YQ3A 1C4CA 3OSPA 3KMSA 2LQBA 4ECWA 5A0YB 3A8JA 4P52A 3AAWB 3I9ZA 4DU7A 3K59A 2W9BA 4WXOA 2XO7A 3OW2R 3QYYA 1GTHA 1RAOA 1HHSA 5AXLA 1YRXA 2AYEA 3F44A 1NJXA 2R2RA 1L5UA 4YR3A 2J6UA 1S6QB 1TL7A 5A8WA 3O2IA 2RRAA 3NWGA 1R6YA 3M1VB 2E7VA 3T6BA 2RQKA 1Q53A 1GXLA 1FEEA 4C6AA 1DJ0A 3TA1A 3J7YI 4UUWA 2AYBA 2JC1A 2V8VA 5F8GA 1R89A 3RZAA 1W25A 3HSZA 1LFWA 1UA0A 1RZMA 4Q0BA 1SL2A 4LSLA 4B9UA 4DG1A 4QR0A 3Q89A 3BGOP 3JSRA 4OYZA 3FSXA 1S1WB 2M7SA 3GJRB 2R2SA 4K4TA 5AE1A 2W2PP 3WHIA 2HHXA 4DX7A 2P8IA 4R25A 3HSGA 1KLMB 4AL6A 3ZTSA 3MM9A 2PA3A 1U1KA 4QYRA 2LU1A 2DCLA 3Q24A 4X66F 2AZ1A 3BH7B 4OZJA 2Z4PA 2VPWB 1NK4A 4RW6A 4OYOA 5A8RA 2K2PA 2K7KA 1LK5A 1S99A 1FFGB 4OI4A 4KRWA 4KPYA 3I0SA 1IQZA 2ROPA 5CH7B 1Y5LB 2ZH9A 5HBMA 3GIKA 3WZ0A 4A4JA 3K5LA 3I55S 3W9JA 3TVKA 5HMXA 3IA0A 4YR0A 3ELHA 1PJ5A 3M6XA 3UDLA 1SL1A 3TO8A 2DYAA 2HQIA 4DSIA 3G8QA 3JTOA 2BV3A 1RT3A 1NJYA 3TZXA 4RW4B 4KBIA 2HK2A 2M5YA 2ILYA 1HBNA 4O0NA 3PW2A 1JLGB 4KFBB 4LRFA 3E51A 4I6YA 1TK0A 4JV2A 2QSWA 2OIHA 3FRYA 2GHPA 4M5DB 2HHWA 4P2FA 4ATNA 2D3ZA 1IKWB 2XEXA 1RBLA 1LK7A 5ETTA 1R8BA 1P8GA 1V3RA 2V34A 2M88A 3BKTA 2H3EB 5KT2A 1YBUA 3KHRA 2I9SA 1LWFB 2QX0A 3CJ3A 1RHUB 4DL0C 4I6AA 3IWLA 3GV8B 2PDAA 3GSDA 4R8UB 3GJQB 3D4JA 1F3FA 2DNKA 4DV2F 3HVRA 1QE1B 2Y1JA 2XZDB 4IOBA 2YNFB 3M2UA 1YRUA 2BM1A 4C8LA 1K1SA 1URNA 1OIAA 4MFBB 4KY3A 5F9LA 1Q16B 1FVQA 4BC7A 1N6QA 4ID5A 4EFAC 3CJKB 1JJ4A 3ENAA 4ED4A 2M70A 3JAMU 3KJQB 1JLEB 2ZH6A 1WI8A 2HBZB 4CLKA 2RHSB 2PSZA 1T7PA 4B9VA 1DTTB 4G3IA 3HK2A 1RT6A 2QA1A 4USIA 2DISA 1H7WA 3CB4A 4LRDA 1PBUA 4Y2CA 2HRYA 3FGVA 3W65A 2WHOA 1JJHA 2CPXA 2QL9B 3T19A 2C2DA 2DR9A 4ZVRB 1JLBA 1HNIA 4RUAA 3E01B 5EUHA 1WSRA 3DLGA 4UY85 2GQCA 3LPYA 2CFXA 2Z8QA 1BE4A 3D6MB 2QTWA 3KMQA 1U7LA 1T8EA 3CW2C 2YPYA 3GE9A 4X4PA 1IBKF 2EFGA 2DEIA 3NNHA 2DNZA 2DITA 4PG6A 3ZZ0A 3KOAA 3VVUA 3HHLC 3TUZC 4YP3A 1U0HA 2D3OR 1P9YA 4DFPA 4DF8A 3IXQA 4PXBA 4XK8C 4TLRA 4KB7A 2Q6CA 2Y1LB 1FRLA 3HM9A 4OZ0A 2WVBA 3AJ1A 2KJWA 3M8QB 2EK1A 1BUXA 5I3PA 4F4AA 1NNDA 2PMHA 1DURA 4LBPA 2B5JA 3KXDA 1VBXA 1RKIA 2ZUAA 3OV7A 1EP4B 4ZPBA 4C11B 1J5EJ 2DR5A 3OFGA 1SH0A 4WWSA 2MZ1A 1X9SA 4AUKA 5CAAA 1NSQA 3QWPA 5AXMA 2ACMA 1JKHA 1TAQA 4W92B 1FNXH 4HI1A 1GMWD 4KQZA 3BO3A 2C28A 3G6XA 3PYDA 2DY9A 3TANA 1EIYB 4IH6A 4TU8A 3MTKA 2MQNA 4ECRA 2V5HG 3LP0B 3MMAA 1A7GE 4LRAA 1WKKA 2R8GA 4XDCA 5F3TA 3G8SA 3PNIA 2MDAA 4I7FA 3GIJA 3MPYA 5F8MA 3X3UA 4IG3B 1AUSL 4HR2A 4V19X 5DG8A 4ZS6A 1ULRA 5KFIA 2EKYA 3OHBA 4N41A 2HVEA 2RH3A 4QIEA 3CF5Q 4AT1B 4IFYB 3MEEB 3DC2A 4TYAA 3T9ZA 1CG2A 4DS5A 1L3SA 3R7SB 2OEKA 3VTIA 3J81Y 2WCXA 1MLAA 4B3MJ 2Q79A 2CNOB 4YB6A 2EWHA 1JJ2R 3PRVA 1J5EF 4U8VA 2VDHA 4DL5A 5HVFA 1N32F 1VLYA 2PO4A 3F41A 5EWEA 3N79A 3MEDA 3C46A 4NZ7A 4C8YA 1NDKA 2H65B 1YK9A 1PBAA 3P4UB 1H0HB 5K14B 4NLRA 1ZAWA 1HQEA 3ZZOA 3OFEA 1YHQS 4YN3B 2M3DA 3M8ZA 1UWAA 1XMBA 1M1KT 1VHFA 3I5CA 2V63A 2C3PA 1X8DA 5KFLA 3PJXA 3NBPB 2XMJA 5J1EB 1LOUA 5M2PA 3VAIA 4LFAJ 3W9HA 2HHQA 4P7TA 2X1FA 2AYGA 3BSOA 5ETSA 1F2HA 1N56A 5KFPA 4LVNP 4KR0B 3OVSA 4EZ6A 4OI1A 2HAFA 3BN4A 2Q3PA 1S9EB 1NKEA 1YVFA 1S1XB 3JTPA 4LQ3A 2DB1A 4TQSA 2FB0A 4N77A 2IA0A 1ZAXA 1T0TV 1RWVB 1UVKA 3FBBA 2OFGX 1CJVB 1N0VC 5HLFB 5F8IA 3SMZA 1OSCA 1WDDA 2ZM6J 3ISZA 4FPIA 2UXCF 2DGWA 3L95X 2J0QD 1BHNA 2G4BA 3GMGA 4PPDA 2HZAA 3FK4A 2U2FA 1U24A 2C2MB 2HW3A 5KFMA 1HWLA 5HJXA 1FK9A 1KBRA 2F1FA 2DNHA 4LF6F 3R5GA 5BYSA 3ZZTA 4MIWA 4UQGA 5BR8J 3BV8A 2PMZD 1RP5A 4ER8A 4DV0J 5CXTA 2KH9A 4GVBA 1NPKA 1XNRF 4XAKA 2GVDB 4OMFG 1F9FA 3U02A 5BYRA 4OJGA 2B8PA 1JIHA 3V4IB 3IAS9 4ZHRA 1LXNA 3JTNA 3KDOA 1CSJA 4PR6A 4MJKA 4OV1A 2CPDA 1HKAA 3NGRA 2HFUA 4HKQA 2HBRB 5CHCB 4F67A 5E33A 5HMWA 4ED2A 2NR0A 3BGFA 4K4SA 3OTOF 2DGTA 5FDLB 5JMNA 2VUGA 4FF1A 3N6LA 1CLFA 3ITHA 4R5PA 2HHPA 2J8AA 4C3KA 1F5CA 3DLEA 3SCIE 2PIIA 3K89A 3LP2B 4ILRA 1YI2S 3MPWA 3RBXA 3UCGA 3FEYB 2C3MA 5L46A 4ZCMA 2MPUA 4ZVOB 3FUYA 1N33J 4NLVA 1YSJA 5HO4A 3VHQA 2HNDB 2VODA 2Z2LA 1U1QA 2GMJA 1TV6A 4I2PB 2ZD1A 2VA3A 1U8WA 3EDQB 4D3GA 2V8DA 3R1HA 4O3NA 1P6TA 3R1LA 2J6SA 1EKRA 5ETPA 1RK8A 4L3KA 2AJQA 2PI5A 3BQ1A 4OHZA 3I5BA 4LQ9A 3W5XA 3L09A 3HULA 3C8YA 1MROB 4ELTA 4DV5J 4FKXA 1LW2A 1S9FA 3N6NA 5E41A 1R8CA 2DHGA 2NXNA 2OPQA 5HL7Q 1IKXA 4QWBA 2EFVA 1KHWA 5EX0A 4NA3A 1N5VA 3Q8PB 1S1UB 2ZWOA 4NLQA 1REVB 4CT8A 3QJJA 5ETMA 3QO9A 1MU2A 2RIJA 2VH7A 2GAHC 4HACB 4MH8A 1DQ8A 4QIVA 5KG0A 3G82A 4PQAA 5AXNA 4PG5A 2CPIA 3THPA 3QIPB 4CO1A 4DFJA 2MY7A 1HL6A 4LIWA 1CS4A 3C16A 3QRQA 3NEKA 4DZDA 2OEJA 4DV1F 2LKZA 1M1GA 3C66A 2UXBF 1WC6A 2AKWB 2ROGA 2J9DA 4HHJA 4B9NA 2R7OA 1TL7B 1B7FA 1PC4A 3PKYA 4N8NA 5LSLA 1KQGB 1U25A 2D3O1 3EM1A 3PYEA 4DUTA 2L9WA 1SV5A 2R7RA 2O3DA 2Z56B 3QAUA 2LXUA 1HA1A 4CYUA 2EVZA 4LSLB 5GVQA 2X1AA 3T5JA 2RUSA 3DRSA 2JEIA 1Q4RA 4KO0A 1BD6A 5HROA 1URRA 2ZH3A 4IO1A 1ZPVA 5EGYA 2JLFA 3LQVA 1VQKS 3DOKB 4H4KC 1WHVA 2XQCA 5GAHU 5KFAA 1HFEL 2ZVIA 3D6HB 4F50A 4B3OA 4LFBF 2NSCA 2ZKUA 1UPPA 3I4PA 1TFWA 1NAQA 4Y00A 3FMWA 3IM9A 1BMQB 1Z2LA 5KFNA 1D1UA 1AFJA 3RR7A 1RA6A 5A8RB 3R6GB 1FT8A 2FVSA 2I38A 3P49B 2Y8YA 3CTRA 3VCDA 2XI3A 4J9RA 3DDKA 3EPGA 1RTJA 1UEVA 3V6KA 1RT5A 1B0PA 2OMLA 5HBMB 1RU2A 3GV7B 4OIXA 3AOCA 5ETNA 1IKYB 4FKYA 1H2UX 4P10A 5K5MA 5GADI 3OQ2A 4DV3J 4F8RA 2YNGB 1HBNB 3T1HJ 2GJ2A 2R4FA 4Z2XA 3CCUS 3IR7B 5B0AA 4RWXA 1NZ8A 4LF4F 1V3ZA 3CJ0A 3FVYA 5H9EK 3JSYA 2HG4A 3I5AA 2DGXA 1MW7A 1IM4A 2Z58B 4BC9A 2HMIA 4RBTA 1HBUA 4MK8A 3R97A 5IV4A 1YIJS 1O5JA 4IDKA 1PYTA 3OBIA 4GKKJ 2ZHBA 5KFOA 4ZIWA 4ZKAA 4JV5F 3E8OA 2EC0A 4NZ6A 2BANB 1I6JA 5EN1A 4C2MA 1VJWA 1WF1A 3CIZA 3KHHA 2VG6B 3IM8A 3EZUA 4ZJQA 1ZH5A 3CD0A 4MYTA 2R2UA 4O3RA 4XTTA 5KFSA 2GC8A 1W2BR 5KG7A 2E5LJ 1EZZB 4YOEA 4LR8A 1WTFA 4P74A 1N52B 2Q66A 1UWBB 2WAQD 1F1BB 1T9XA 2BMBA 4M5NA 2XHWA 4OYMA 4C0BA 3MPDA 3CUNA 4JI3J 1ICEB 3MEKA 1RWWB 4K5SA 4ID5B 2CWKA 4YY3F 3MM7A 1QUVA 1S5ZA 3U1NA 3K8WA 5LM7E 1NSKL 2BXJA 1VJQA 1HYSB 1VC5A 1RT6B 2HS3A 2IAJA 4ED1A 2WBRA 4WU3A 1JB0C 4N56A 2DNGA 2XMWA 3RW6A 1AB8A 3KLIB 2XLIA 2Z2ZA 2AWZA 2ZOFA 3PJ9A 4W98A 2X1BA 3U1MA 5IWAJ 4RNOA 2LMIA 4RW8B 4YR2A 3TAPA 4C8NA 4J91A 2W2QP 2UUCF 1JLBB 1HNZJ 4JI8F 1R0AA 3JAMY 2RQMA 5C42B 1RU1A 2DK2A 3OXGA 4WU2A 2HRUA 4QU7A 3TYTA 1TMMA 5IC6B 1RE1B 1B0VA 4DR2F 3OLAA 2BJ7A 3MUTP 4KH0B 4L6V3 1U1OA 4DUZJ 3PYGA 2OO4A 4JI7J 3DOMB 4M5KA 2BR0A 1ZZFA 2DNLA 4I69A 3OHAA 2CJKA 3NP5A 1H72C 4MMOA 2FQQB 1CEZA 4WZMA 2D74B 2R7UA 1S59A 4LR9A 4ZJOA 1KOOA 2QT7A 4UZCA 2N82B 3KLFA 3GQCA 2B5JB 3HMJG 1NJIT 3D7SB 3H2UB 3GTYX 5BJRA 5J2PB 4ERDA 2JNJA 5KFFA 3CCJS 3KUEA 2CVEA 3HVWA 4OX6A 4YHHJ 2DCUB 4B9TA 2QRRA 3CD6S 3UD4P 1AFIA 2ZOGA 1JKHB 5J2MA 4DN9A 1YZ6A 1G7CB 2XMTA 3UDEA 5LXYA 4LREA 3M8RA 3CT9A 4HHHA 4Y2AA 4X4UA 1YBTA 2PC6A 2HGLA 2HQCA 5L1LA 3MMAB 2E7XA 3V81A 1XWLA 4ZPVR 5LT5A 3RBZA 1EETB 4I7FB 4GC7A 2FUG9 2DVIA 3OJSA 1Z2ZA 4M5JA 1XNQJ 3M32A 3CC7S 2JLEA 2YTCA 2VQEJ 3ZO7A 4RU2A 2VKRA 3X1LB 1DARA 3EXCX 4DV4J 3CDWA 3GYGA 4RUHA 2DRBA 5GAHI 5C25B 1X31C 1KTQA 2JEJA 3NWRA 2FTRA 3QFHA 1UP1A 3QJPA 2V2VA 2HWTA 3HVTA 3CJTA 2UUBF 3LW5C 3H98A 2DGQA 5B0EA 2G0IA 2JH3A 4EUVA 4KGVB 2FJAB 4KHPF 3MEDB 3UN5A 4DS4A 4QCLA 1DBDA 3CC2S 2W4DA 4JI1J 1LWEA 2HQ3A 2E1AA 2GIFA 3CPWR 4DQRA 3CCMS 4YFUA 1KQKA 4JI4F 4L72B 5FLXY 3OTBA 1KC8T 2IC3B 3R7BB 3MR2A 1AUDA 1N5YA 1HWUA 5GMKa 1D3WA 1FO1A 4NLUA 2M4MA 4U96A 4A48A 1NKCA 4J7CA 1JK9B 1B0TA 2RF2A 4LF7J 5CABA 2M8HA 2N7CA 4PKDB 3TZWA 2O01C 4DX5A 1TKZB 4E8UA 1IR0A 4RR5A 3RW7A 1GEHA 2UU9F 2WK4A 2V2ZA 2LQ9A 4OHXA 3SSRA 1H3DA 3MEGA 4AXIA 4HH1A 2YXLA 4ZVEA 1U1RA 2WB4A 1KRPA 1UAWA 3OUYB 1C0UB 1WOPA 2AEMA 3O44A 4PUOA 4EYIB 2OTJS 1VFJA 2HURA 3ICLA 1TL5A 4Y28C 4DUYF 3MCOA 3H2LA 2LEBA 1ZYQA 4O3SA 3ZZPA 1NBEB 2BJ1A 2BX6A 2BJEA 4FF2A 3M7VA 3QT7A 2AJ0A 2H9ZA 2DH9A 2OJ3A 1SH2A 4E98A 4DV7F 1FJGF 2VG7A 2IHR1 1RCOB 4KGZB 3BDEA 4RX6A 2NPFA 2VICA 3MCSA 2OHDA 3GIMA 4C8KA 3RRKA 3CMQA 3K17A 2FLLA 2DD8S 1KEKA 4B9SA 1S0NA 1FKOA 4EEYA 3GU0A 2FJDB 2CQ0A 1WI6A 4QPXA 3B6BA 4QYZK 4I64A 3QLHA 2XY6A 2A6MA 2W9AA 5DG9A 3LWLA 3V5RA 4IR9A 2BUNA 1TK8A 3PV8A 3N6MA 2AF6A 2YH1A 3TNVA 5B7WA 1VIXA 3CVKA 1TUGB 3FNNA 4B3SF 3PJWA 4A46A 4ENOA 4RBUA 2V8PA 3HSDA 4J9OA 4CM0A 2FVCA 2AGPA 4G6VB 1HWKA 2BYCA 4ILMA 1VQ8S 3PKMA 3PCOB 5D0EA
chains in the Genus database with same CATH topology
1N36J 4JI8J 4JI1J 4JI5J 5LMNJ 4KHPJ 4X65J 1N32J 2UXDJ 2MEWA 2ZM6J 4JI2J 3R2DJ 4DUYJ 4DV3J 4B3TJ 2KL8A 4JI3J 4LFCJ 1IBMJ 3T1HJ 4DUZJ 4KY3A 2UUAJ 4JI7J 4DR2J 3OTOJ 2MTLA 2VQFJ 2UXCJ 3T1YJ 4JI4J 4PWWA 4V1Ak 1HNWJ 4X62J 3D3BJ 4DR6J 3J81U 4DV6J 3IMQJ 5LM7E 4DV7J 3JAMU 1IBKJ 4YY3J 5FLXU 4DR3J 1FJGJ 5IT9U 4OX9J 4GKJJ 5AJ3J 2HHHJ 4LF4J 3R2CJ 2F4VJ 1XNQJ 4LF9J 2VQEJ 5BR8J 1N33J 4X66J 4LF6J 4DV4J 4JI0J 4LFAJ 4B3RJ 4DV0J 4DR4J 4LF7J 4DR5J 3W1YC 4LF8J 4LFBJ 4GKKJ 4HHUA 4NXNJ 2KVQE 4JYAJ 4KYZA 5LMUJ 1IBLJ 4DV1J 1HR0J 1XNRJ 4JI6J 4X64J 5IWAJ 4RJVA 4JV5J 4AQYJ 4NEZA 2UXBJ 4NEYA 1I94J 1J5EJ 3D3CJ 2UU9J 4NXMJ 4B3SJ 4LF5J 4DR7J 2MQ8A 1HNXJ 3J80U 1XMOJ 3J7AN 1HNZJ 4B3MJ 5A2QU 4DV5J 4YHHJ 2E5LJ 1N34J 2UUBJ 4DV2J 1XMQJ 4K0KJ 4DR1J 2UUCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 J;  4JI8 J;  4JI1 J;  4JI5 J;  5LMN J;  4KHP J;  4X65 J;  1N32 J;  2UXD J;  2MEW A;  2ZM6 J;  4JI2 J;  3R2D J;  4DUY J;  4DV3 J;  4B3T J;  2KL8 A;  4JI3 J;  4LFC J;  1IBM J;  3T1H J;  4DUZ J;  4KY3 A;  2UUA J;  4JI7 J;  4DR2 J;  3OTO J;  2MTL A;  2VQF J;  2UXC J;  3T1Y J;  4JI4 J;  4PWW A;  4V1A k;  1HNW J;  4X62 J;  3D3B J;  4DR6 J;  3J81 U;  4DV6 J;  3IMQ J;  5LM7 E;  4DV7 J;  3JAM U;  1IBK J;  4YY3 J;  5FLX U;  4DR3 J;  1FJG J;  5IT9 U;  4OX9 J;  4GKJ J;  5AJ3 J;  2HHH J;  4LF4 J;  3R2C J;  2F4V J;  1XNQ J;  4LF9 J;  2VQE J;  5BR8 J;  1N33 J;  4X66 J;  4LF6 J;  4DV4 J;  4JI0 J;  4LFA J;  4B3R J;  4DV0 J;  4DR4 J;  4LF7 J;  4DR5 J;  3W1Y C;  4LF8 J;  4LFB J;  4GKK J;  4HHU A;  4NXN J;  2KVQ E;  4JYA J;  4KYZ A;  5LMU J;  1IBL J;  4DV1 J;  1HR0 J;  1XNR J;  4JI6 J;  4X64 J;  5IWA J;  4RJV A;  4JV5 J;  4AQY J;  4NEZ A;  2UXB J;  4NEY A;  1I94 J;  1J5E J;  3D3C J;  2UU9 J;  4NXM J;  4B3S J;  4LF5 J;  4DR7 J;  2MQ8 A;  1HNX J;  3J80 U;  1XMO J;  3J7A N;  1HNZ J;  4B3M J;  5A2Q U;  4DV5 J;  4YHH J;  2E5L J;  1N34 J;  2UUB J;  4DV2 J;  1XMQ J;  4K0K J;  4DR1 J;  2UUC J; 
#chains in the Genus database with same CATH topology
 2GS8 A;  1XTZ A;  3TAM A;  4OZ5 A;  2WVC A;  2MZS A;  1RTH B;  2MKJ A;  2WSC C;  4NLS A;  2VQF F;  4OI3 A;  1WHW A;  3T1Y F;  3OTE A;  2QMX A;  3AXK A;  4R5P B;  2UUA J;  2IDE A;  4PEO A;  4NYO A;  2B4O A;  3W5Z A;  1KVJ A;  1KSP A;  4WJB A;  1D9A A;  3NLC A;  2KO1 A;  2KXH A;  2MB0 B;  1U8S A;  3QWU A;  4CT9 A;  4ZVU B;  3BF4 A;  3GON A;  3NG8 A;  1PG5 B;  1TV6 B;  4JYA F;  1C1C B;  4URS A;  1N48 A;  4EI2 A;  1RBO B;  2XYP B;  1VQP S;  1FTC A;  1RIS A;  1FRI A;  4PAA A;  5LMU J;  1FRK A;  1UPM B;  1GX6 A;  2FHJ A;  3DHW C;  4F4K A;  4FZV A;  1XMO F;  2FY8 A;  2A1B A;  2MKH A;  1YQH A;  2MKI A;  2V2K A;  4ELU A;  4FYY B;  2ZZM A;  1YRT A;  1U1L A;  1LW2 B;  2ZNY A;  4F4Y A;  1N36 F;  4CIO A;  1M5V C;  2LEC A;  4K0K J;  2HAI A;  2MY8 A;  8ATC B;  1VBY A;  1JLF A;  1IKX B;  1M5O C;  3SFG A;  4EBE A;  1U48 A;  2FJX A;  3M9N B;  3LF0 A;  1RT7 B;  2QA4 S;  3DLK B;  3QO9 B;  5KFB A;  1MU2 B;  3TUI C;  2VPZ B;  2F4V F;  1CJT A;  3G82 B;  5EWF A;  2PD1 A;  2M8D B;  5GME A;  1I1G A;  2DEJ A;  1S0V A;  1CS4 B;  2H54 B;  2AGO A;  2HVI A;  2X7I A;  4DPO A;  2FHJ D;  3P3D A;  2ZBR A;  2HIY A;  3QBC A;  4NXN F;  3QGP A;  4AYB D;  3CUL A;  4U7U K;  4NOH A;  4CRJ A;  3QAT A;  2NRE A;  3D6F B;  3ILI A;  2CPH A;  1UJ5 A;  2RKI A;  1T94 A;  1S6Q A;  4DPX A;  2A10 A;  3Q83 A;  3M1V A;  1WKL A;  4LF5 F;  4J9U E;  4TU7 A;  1NCL A;  4O4G B;  4ZVT B;  5LMU F;  4DEZ A;  4CLP A;  2GFF A;  4NLY A;  1WDT A;  1SV5 B;  1BWV A;  3FZB A;  1ZET A;  1SUQ A;  4B02 A;  4EBC A;  3PRD A;  1T03 B;  5LMN J;  4F25 A;  1U1P A;  3FCW A;  3RYL A;  3VAL A;  1WF2 A;  1S1W A;  1NRK A;  1VK3 A;  3SCL E;  4GVL A;  3QJL A;  1WC3 A;  1Q8K A;  4ECZ A;  2A0F B;  1U1M A;  4K8R A;  1FNO A;  2DGS A;  2YPZ A;  2HBY B;  3LH2 S;  2HSE B;  4MT1 A;  5HRO B;  3BYP A;  3I6P A;  2V69 A;  2DRD A;  1KLM A;  3NCR A;  3HHD A;  4IRK A;  1ZPW X;  1NH8 A;  1FKP B;  2P6T A;  2ZZN A;  4PYA A;  4TNO A;  4NLT A;  1B4S A;  4LF9 J;  5CZV A;  2R8K A;  3OXL A;  2QYG A;  1SKW A;  4ZLN A;  3TEG A;  4PRF A;  4QOT A;  2UVW A;  1YJN S;  3NCP A;  2W7P A;  2AW0 A;  1Y5N B;  4AQY F;  4CNY A;  4WFA Q;  1KHV A;  1HAR A;  4QBU A;  1RTJ B;  3FFI A;  3DRX A;  2IM2 A;  3J7A N;  3TUJ C;  1ARO P;  3OFF A;  4DR1 J;  4CTA A;  3CGI A;  5IQQ A;  1S7H A;  4Z37 A;  4RNH A;  4DSL A;  4DU8 A;  4K4X A;  2HNZ A;  3F56 A;  2OD6 A;  4KFB A;  2LXI A;  4M5D A;  4WK1 A;  3VAG A;  3SXL A;  3JYT B;  1IKW A;  1SH3 A;  3GB0 A;  3R7N B;  1X4E A;  5HMZ A;  2G13 A;  1HNW J;  3LTO A;  3FRZ A;  5ETK A;  1N4L A;  1WG4 A;  3MUR P;  3TA0 A;  3BO4 A;  4O3O A;  3GCX P;  1HBU B;  4OI6 A;  1NHU A;  4OHW A;  4Q5V A;  1LWF A;  2ZE2 B;  2NUU G;  2JX2 A;  1SIZ A;  3L9Z A;  4IDK B;  3Q8U A;  2BRL A;  2CQG A;  3H25 A;  1KR4 A;  1FDA A;  5IXU A;  2XZT B;  3LUY A;  4R8U A;  4URQ U;  4IYQ A;  2YBV A;  3TZY A;  2Y1R I;  2KFY A;  1PIL A;  4MTP A;  2B7B B;  1T02 A;  1YJ9 S;  3PR4 A;  1YGY A;  4TN2 A;  1QE1 A;  2BEF A;  2JEG A;  4WFY A;  2U1A A;  4IQM A;  1RTZ A;  2SXL A;  2KZM A;  2F8E X;  2E5I A;  2OD4 A;  3QMQ A;  1T9U A;  1N34 J;  1X9M A;  5E3P A;  3RR8 A;  3CJK A;  2N3O A;  1RHQ B;  1JLE A;  2RSQ A;  5DQG A;  5F9N A;  3EIC A;  5IT9 Y;  2W25 A;  2J0S D;  3P5T L;  1VRU A;  2NXJ A;  3MM7 B;  4DL7 A;  1HMV B;  2MHN A;  2W2O P;  4RW7 A;  3IN5 A;  1DTT A;  2AT1 B;  3IGV A;  4GMK A;  4FN5 A;  3NAH A;  4OLP A;  3FBC A;  2B7C B;  4W4M A;  5J2Q B;  2FLO A;  4TYB A;  7FD1 A;  3RU0 A;  2DPI A;  5KFC A;  4DR5 J;  1FRH A;  1IBL F;  1B99 A;  1UEK A;  3HHE A;  2CJ9 A;  1KFS A;  3E01 A;  2YKO A;  1HD0 A;  1M5P C;  2XMU A;  2MQQ A;  2V4Q A;  2E66 A;  3B4M A;  2J7U A;  2KXF A;  4RUB A;  1R0A B;  1WC1 A;  1MNE A;  1HNX J;  3J80 U;  1C1B A;  4NML A;  3OPK A;  2XNR A;  3Q8Q B;  1XMQ J;  2ACY A;  2CJY B;  3JS9 A;  3LAM A;  2N4C A;  2ADB A;  1YG0 A;  4X4S A;  1OMS A;  3A3N B;  4C7Q A;  5DDP C;  3OT9 A;  4RWW A;  2ZBP A;  2QN6 B;  2HWI A;  4ZDN A;  5DQI A;  2RQ4 A;  3ENW A;  2BDP A;  4DR3 F;  5E7O B;  3OD2 A;  4F26 A;  4ECX A;  3D3B J;  4F3M A;  2ASD A;  3O8W A;  1R0B G;  1LWC A;  3BGL A;  4ZJL A;  3GLJ A;  4KC5 A;  3G6E S;  2W7A A;  2FYX A;  2RAQ A;  3T6J A;  2KT2 A;  1FEH A;  2FHM A;  2YNI B;  2B9W A;  5KFQ A;  2UVR A;  2V68 A;  1HR0 J;  3IWX A;  2LXF A;  1GX5 A;  4AD6 A;  4WP8 A;  3IRX B;  2IM1 A;  3VGS A;  3UCZ P;  4WZQ A;  4GO7 X;  3ISN D;  4B17 A;  2VOO A;  3NGU A;  1N88 A;  5J2M B;  2C2N A;  3UDC A;  4ZP6 A;  5C24 B;  2QG9 B;  2AYM A;  4JI2 F;  3I9V 9;  4ZVH A;  4ES2 A;  1JNZ B;  4NPO A;  1KOH A;  4QZV B;  3N5F A;  5RUB A;  2PFD A;  2I2Y A;  2FGO A;  1PGZ A;  2KYX A;  3V81 B;  3UNY A;  2IM0 A;  2L48 A;  2DTJ A;  4QIW D;  4Q7A A;  4K4V A;  1U45 A;  1RAD B;  1NZA A;  1SJQ A;  2H1Y A;  1S1V A;  3TUP A;  5KFH A;  3MFH A;  2FLP A;  1Q8L A;  4IFY A;  5THW A;  3MEE A;  1FX2 A;  1GTE A;  1X60 A;  2ZC3 A;  2RHQ B;  2HLT A;  1A0O B;  3T1A A;  2HQD A;  1NJZ A;  1ZM2 A;  3HVT B;  3PG9 A;  2BE2 B;  2OH2 A;  4FPR A;  3DMJ A;  1TUW A;  5LXR A;  2C1E B;  3EZ5 A;  5CZX A;  3A13 A;  2PE8 A;  1HR0 F;  3ADA C;  2V67 A;  4OZ2 A;  1RAF B;  2E29 A;  4X65 F;  4ZIT A;  4M95 A;  3J7Z 5;  1RT2 B;  2R7T A;  1IBM F;  4UOH A;  2L41 A;  2YH0 A;  3GYN A;  5HAO A;  3ZNU A;  4DJB A;  5KOW A;  4I68 A;  1CJK B;  1XC9 A;  1D0E A;  3CCW A;  4URG A;  4GKJ F;  4HVZ A;  3H4B A;  1N5Y B;  2MZR A;  1U2R A;  1HI0 P;  1JQG A;  1FNM A;  3OL7 A;  5E5N A;  2D7S A;  3FMB A;  1F9H A;  4LR7 A;  1VS3 A;  1BQN B;  2RF2 B;  1ROF A;  5C7P A;  4HEA 9;  2LU2 A;  2IJR A;  4LF8 J;  1YTY A;  3CME S;  1YJ7 A;  1S9E A;  2HWH A;  3WDO A;  4YB5 A;  2XI2 A;  4M5G A;  4OFZ A;  3UQS A;  2VZ9 A;  3SSS A;  1EJ7 L;  1G6B A;  1CJV A;  2CKW A;  3GJS B;  4KPC A;  3UN3 A;  3M8S A;  2EFO A;  2XSF A;  3MR7 A;  3GSI A;  2RD5 C;  1OPZ A;  3QSY B;  3K5N A;  2MJN A;  3BN7 A;  3RGI A;  3PEJ A;  3GFX A;  1RAG B;  4JI5 J;  2J9C A;  5E3C A;  4X4V A;  3GR1 A;  3DM2 B;  4CLT A;  1RHR B;  1LW0 B;  4KT0 C;  5L9X A;  2KRB A;  2AD9 A;  2H4W B;  2MZT A;  4GC6 A;  3ILO A;  5B09 A;  2VG7 B;  2HPU A;  3O5T B;  2RDI A;  3KK2 B;  1SBR A;  2VDI A;  4I56 A;  3GYX B;  1MG7 A;  3SCK E;  2IY5 B;  3AB4 B;  5B0F A;  2BKP A;  1FKO B;  3CWJ A;  2IVY A;  2A2C A;  2F63 A;  2GVD A;  3KNA A;  3JQK A;  3QLH B;  2RU9 A;  3F0N A;  2JJ4 D;  3MM8 A;  2BM0 A;  1KDN A;  2NXU A;  3BM7 A;  2GV1 A;  5IFM A;  3V4I A;  1FRX A;  4X64 F;  4DBQ A;  1M5H A;  3IBF B;  3UVJ B;  3M2V B;  2F7V A;  4BWJ A;  3UE2 A;  2IMW P;  3R9L A;  2RDJ A;  1FWP A;  4X4T A;  4B9L A;  5FDL A;  2WB1 D;  1SVD A;  4J5O A;  1VBK A;  3ZFV A;  1KTV A;  3P5B P;  2C2K B;  2UV8 A;  3JSM B;  4EO8 A;  4WKR A;  4AND A;  4ZP9 A;  2JVO A;  3TZZ A;  5I3Q A;  1M90 T;  1WHY A;  4DX8 H;  2GA7 A;  1S6U A;  3W3S A;  1RWX B;  1UZD A;  4LRC A;  1TL4 A;  3M8P A;  1RLD A;  3DNC A;  5CD4 H;  4MYU A;  1X4H A;  4RNN A;  2E9R X;  4OV6 A;  3S8S A;  2LQ5 A;  4I2P A;  3PIP Q;  4PAB A;  3S01 A;  1VQO S;  3NS7 B;  4TKT A;  5F8H A;  3OL6 A;  4O23 A;  3R5J B;  5D0H A;  5L38 A;  1S0O A;  4N76 A;  2FVP A;  3CD5 A;  3PTW A;  1P1L A;  1B3T A;  3BPD A;  3MCN A;  1SPB P;  3AT1 B;  3I82 A;  1H74 A;  3WX4 A;  3HHN B;  2DPJ A;  3PHT A;  3VAK A;  1WKJ A;  1U49 A;  2DKO B;  1JLF B;  3QRP A;  2HZV A;  2L9D A;  4LF1 A;  4IQX A;  5KT7 A;  3PR5 B;  3DRR B;  2GQ2 A;  2X3G A;  4HAC A;  3TQ1 A;  3FZ2 A;  2GJI A;  5I42 A;  4IFV B;  3UW1 A;  4I0W A;  1CJT B;  2PN6 A;  5F8J A;  3VGT A;  2LA4 A;  2FIU A;  4DV6 J;  4ZP7 A;  3S1T A;  4P2S A;  1QAX A;  4ED8 A;  2QLB B;  1GMV A;  3M6V A;  3NS5 A;  4OX9 J;  4G1Q B;  4K2X A;  4NYZ A;  2ALY B;  1RWU A;  3HLU A;  2EC2 A;  4B3R J;  3A8E A;  4ZLP A;  2P2C B;  3KLG A;  2RKI B;  3EVM A;  2BVZ A;  4DCJ B;  1PCA A;  4CI0 B;  2W4P A;  4QIF A;  2OTL S;  4H4M A;  4MKA A;  1UJ6 A;  2MQ8 A;  4Z7Y A;  3BGR A;  1D8Y A;  1VMB A;  1B64 A;  5L8R C;  1SUQ B;  3PX0 A;  1ITP A;  4WE1 A;  2C2O B;  3W2V B;  1SIW B;  2MST A;  3UN2 A;  4LFC F;  4KJI A;  4O44 A;  3D5M A;  2HHV A;  2XBP A;  2PEB A;  3JSB A;  3DOK A;  3BR8 A;  3MPU B;  2PFF B;  1N5Q A;  3KLH A;  3Q22 A;  4ZN1 A;  4XPC A;  1RT1 A;  5K8M A;  4J9P A;  1VQ6 S;  4KKO A;  1BGX T;  1QY7 A;  5DET A;  2XB2 D;  2VFU A;  3R6L B;  4DR4 J;  2BAB A;  4B9M A;  3H4D A;  4A8S A;  1J5O A;  1PC5 A;  2KVQ E;  1W26 A;  2MLZ A;  2XS2 A;  5KFD A;  2WON A;  2E1P A;  5A8K B;  3FFI B;  1TL3 A;  3GJT B;  3D3C J;  2D69 A;  3CSK A;  1IKY A;  4OYW A;  3SQG B;  2MGZ A;  1RDR A;  3AJ2 A;  8AT1 B;  4F4Z A;  1F5A A;  3DGP A;  1UZH A;  2V8G A;  2R7V A;  4CTA B;  1HW8 A;  1UKU A;  2YNG A;  1IBC B;  1GFW B;  4C48 A;  4X4O A;  2HNZ B;  3OXF A;  4JOU A;  2E44 A;  3CCS S;  3K0J A;  3D0H E;  2DH7 A;  5CYQ B;  2LVW A;  3B54 A;  1S77 D;  1S1T B;  5F8N A;  1OY8 A;  4LBI A;  2XYG B;  1QLN A;  2FY1 A;  2BAN A;  5EHH A;  4DPU A;  3HT0 A;  4OJ1 A;  3RJM B;  2VG6 A;  3SCJ E;  4NE9 C;  2V4R A;  3H5U A;  3RB6 A;  4CH0 S;  4KV8 A;  3R5D A;  1LV5 A;  1Q5Y A;  4C4W A;  1WC4 A;  1GH8 A;  3GG1 A;  2VAS A;  3KHL A;  3WBZ A;  4DR4 F;  1M1H A;  1HQU B;  3TRG A;  2FGC A;  5D0R A;  5ETQ A;  1I94 J;  1UWB A;  3FSY A;  1G4C A;  1QAY A;  2ZOM A;  2LEP A;  3GV5 B;  3AJD A;  1EX8 A;  3LGM A;  3HD1 A;  3VVT A;  3UCU P;  4E2F B;  1TL1 B;  4DXL A;  4ICL B;  2MMY A;  4ZPW R;  4FBU A;  1H2V Z;  2Y8W A;  3K5M A;  3VZI A;  2IJN A;  3BS9 A;  1VRU B;  1BLU A;  2CQ4 A;  1X4F A;  1HYS A;  2ZJP Q;  2VJU A;  2AJ2 A;  4RW7 B;  3CJ4 A;  1DQA A;  2XC9 A;  4QR1 A;  1LWX A;  3BKU A;  1UEU A;  2KHD A;  1S6P B;  2R7Q A;  4MAK A;  1PAU B;  4NCB A;  4A8Y A;  4Q8F A;  1Q95 G;  3G86 A;  3KFW X;  3WC2 A;  1T3N A;  3KLI A;  3NMR A;  3HFZ B;  1JNR B;  3NMA A;  4JI0 J;  2QMW A;  2GGP A;  2KB2 A;  4RW8 A;  2MZQ A;  2JRS A;  4KE5 A;  1UW4 A;  3IBW A;  3ZZR A;  2XUL A;  2RB7 A;  4DSJ A;  5C42 A;  3R5B A;  2YWE A;  2KN4 A;  4C3L A;  3NGT A;  2N3L A;  3HJF A;  1U4B A;  3BBC A;  4NXM J;  5K8O A;  1C1B B;  4H4O A;  5EX3 A;  2OPP B;  1F5B A;  3Q8Y A;  1ZA2 B;  3P96 A;  1FA0 A;  2IVF B;  3AD9 C;  3DOM A;  2RT3 A;  2BQR A;  3IGN A;  2ATC B;  3CCT A;  3DDI A;  2NZC A;  4KAI A;  2JWN A;  2E5J A;  3D67 A;  1JLA B;  1CVJ A;  1RBA A;  3ZTQ A;  3A12 A;  1LWC B;  4Y0F A;  4OYI A;  2ZEJ A;  2EFP A;  4GO5 X;  4QW9 A;  4OI0 A;  1FVS A;  2HFO A;  3J80 Y;  1V6H A;  3L7P A;  2XY5 A;  5J2P A;  3MM5 A;  3A3O B;  1XK8 A;  3O1L A;  4Q43 A;  3W2W A;  1T05 A;  1HHT P;  2DRA A;  2CPE A;  5D0G A;  3KTQ A;  3UR3 C;  2B4V A;  4P73 A;  4DR7 J;  1SKR A;  2VFT A;  2DXE A;  1T9W A;  1NHK L;  1OYD A;  3DKD A;  4BLG A;  2AMC B;  5C2G A;  3EUN A;  4CO5 A;  2LEA A;  2DXD A;  3AB2 B;  2C3O A;  2LQ8 A;  1J2V A;  3FSI A;  4PXD A;  2QMU B;  3UR0 A;  3OR1 A;  1RAA B;  5KT3 A;  1EET A;  5I4M A;  2RQC A;  3R2D J;  2XM3 A;  3C14 B;  1F60 B;  4JV0 A;  5B08 A;  3WIU A;  1YBA A;  2YQ1 A;  3GIL A;  3ISN C;  3MF5 A;  4PWW A;  3H40 A;  4JUZ A;  5CYJ A;  1RGV A;  5FLX U;  1S1V B;  2OPS A;  1UA1 A;  5C25 A;  3BQ2 A;  1QJH A;  1VLO A;  3CCV S;  5J1P A;  4EK2 A;  2DO4 A;  2B8Q A;  3C19 A;  3EXY A;  4AL5 A;  3RRG A;  3D1O A;  1V5I B;  3C3L A;  3PDN A;  1DTQ A;  3KG4 A;  1CUL A;  1Z4U A;  1VK8 A;  3CE8 A;  2CNL B;  1DLO B;  2OUG A;  1ZBT A;  3DMJ B;  2RVJ A;  3JB9 k;  3EYZ A;  1O51 A;  4CO2 A;  3DLB A;  1X5O A;  3AXM A;  4IH5 A;  2DR7 A;  4X4Q A;  3AHP A;  1FKA F;  1UFK A;  1MWZ A;  2ZBC A;  5IS2 A;  5LSR A;  1A9N B;  1NXI A;  4PWD A;  2IC3 A;  3ILL A;  5GAE U;  4IRD A;  2ZJR Q;  4K7Q A;  2LDI A;  1X4A A;  2MKC A;  2KYZ A;  2XMM A;  2K3K A;  3H2V E;  2UXD J;  3B82 A;  2QO3 A;  1SXL A;  3TX0 A;  2EKN A;  3DLL Q;  4USH A;  2MJU A;  4QIG A;  1PAE X;  3OFH A;  4ED5 A;  2CVI A;  5KAK A;  3E3X A;  4PYD A;  6AT1 B;  1CC7 A;  1TKZ A;  5KFW A;  1V5V A;  2CJB A;  4FVM A;  5BXI A;  2AEJ A;  1EAY C;  2OI2 A;  3JQM A;  4NRT A;  4UST A;  3POT B;  2DNY A;  2WOM B;  4ZVS B;  5A76 A;  4XIU A;  2DIU A;  2XMV A;  3MTJ A;  4BWM A;  1VHI A;  3OUY A;  2ZZT A;  1VC6 A;  4KGX B;  1C0U A;  1V9O A;  3U7J A;  1WEL A;  6FD1 A;  1MN9 A;  3H7H B;  4YB1 P;  4JI6 J;  2H51 B;  2EG1 A;  3I31 A;  2AU0 A;  2DNQ A;  4YEA A;  4B3M F;  2WTF A;  2BOP A;  1RXO B;  2FPH X;  1SI9 A;  1S10 A;  3KG0 A;  2C3Y A;  1R8P A;  4CDI A;  1TR0 A;  1SC1 B;  5AE2 A;  3KHG A;  2IRU A;  3NNC A;  5H9E J;  2IIH A;  3TAR A;  3MAQ A;  1FRJ A;  1FRM A;  1YJU A;  1PO6 A;  3K5O A;  2F5G A;  1KVK A;  2F4F A;  2OMO A;  4AXJ A;  1OQ6 A;  3J81 j;  4DQS A;  3QPI A;  2QYC A;  3G8T A;  1RA7 A;  2ATL A;  4DQI A;  4LSN B;  2J76 E;  1MML A;  1C2P A;  3QT5 A;  3MMB B;  3NGS A;  3DLH A;  3BR9 A;  5L9N A;  4LVO P;  4LFA F;  4LT6 A;  4OZ3 A;  3MM8 B;  3OLB A;  1XN9 A;  2VB6 A;  5IQ6 A;  2E1R A;  2VJV A;  2GO9 A;  1ZM9 A;  3IAM 9;  1CQM A;  1EB0 A;  2FJV A;  4OL8 A;  4QWA A;  3VZH A;  2CQP A;  4NEZ A;  2DNR A;  2KM8 B;  5JVH Q;  3TX8 A;  2Z30 B;  4J9V A;  1EQM A;  1RTH A;  1R8H A;  3M30 B;  3LAK A;  2MLX A;  2BQ3 A;  4U8Y A;  4C98 A;  5D4P A;  2HRT A;  4WK3 A;  1L3V A;  2ZM6 F;  1JLC B;  5B0D A;  1WEX A;  5C2C A;  5K8N A;  4KTQ A;  4DCP B;  2ZH4 A;  5CCL A;  5KT5 A;  4DPT A;  3DYA A;  4RU9 A;  3M8P B;  1H7X A;  3MUM P;  2CPY A;  2QC3 A;  2QSF A;  2JFD A;  2MZJ A;  1C1C A;  1OJ4 A;  5BR8 F;  3CO9 A;  4DV0 F;  3R27 A;  2GO8 A;  1DQ9 A;  2YWF A;  3ONQ A;  4A8K A;  3W7B A;  1JXE A;  1NPP A;  4LSZ B;  3PM9 A;  3MDF A;  3IWN C;  4J9Q A;  4RUC A;  4OJH A;  2Y0B B;  1O6X A;  1YJW S;  2KT5 A;  3D1H A;  2B6A A;  7AT1 B;  2NS1 B;  3KJF B;  1G3O A;  1NK0 A;  2NZ4 A;  2KKH A;  4OI2 A;  3H42 A;  1RT7 A;  1R6V A;  2E9Z A;  1C0T A;  2ZKT A;  4FYD A;  3DLK A;  1YJR A;  4DSE A;  2CPZ A;  1E6Y A;  2RNE A;  2KG0 A;  1IUJ A;  5I42 B;  1GMU A;  3ET6 B;  4PG8 A;  1YDL A;  3PYF A;  3VV2 B;  1ZAV A;  4USU A;  4X62 J;  4ID8 A;  1N33 F;  5D6G A;  2IM3 A;  5IOL A;  2IPO B;  3FC9 A;  2KXN B;  3FCV A;  3KLG B;  1X9W A;  2YKA A;  4CLF A;  4O4G A;  4PXE A;  4K4Y A;  4HHU A;  2CNN B;  2NYI A;  2Y9H A;  2MKK A;  1Q78 A;  4OYA A;  1RB0 A;  4H4M B;  3EX7 B;  4A8O A;  3THT A;  3CIM A;  2GJF A;  4DV5 F;  4JB8 B;  2B9X A;  3BGR B;  3CDU A;  3MI7 X;  1T03 A;  1GK8 A;  3IR5 B;  3MR3 A;  3IRW P;  4WE1 B;  4CWB A;  3OL8 A;  2HNY B;  3TJ8 A;  2KJV A;  2WW4 A;  4ANE A;  3IS9 B;  4O44 B;  4ES3 A;  4A47 A;  5E3Q A;  1QAJ A;  2JEF A;  1W7W A;  2VG5 A;  2KL8 A;  3KLH B;  4Q44 A;  1FKP A;  1DHM A;  5DLF A;  2F8H A;  4ZN3 A;  1YZ7 A;  2CG8 A;  1RT1 B;  4ECQ A;  3H5S A;  4V1A k;  4DL4 A;  1SQF A;  4KKO B;  3BYR A;  4OYB A;  3LGH A;  2HFV A;  2GZO A;  4U9R A;  5KFZ A;  1SQG A;  3CC4 S;  1QM9 A;  2WW8 A;  2B3T B;  1KFD A;  3PRB A;  1J5O B;  1K0V A;  2R2T A;  1UVL A;  3MHY A;  2VON A;  4DQP A;  2WON B;  3WC0 A;  4G1I A;  4P75 A;  1TL3 B;  2EG2 A;  1Y0H A;  2P6S A;  3FEZ A;  2DGO A;  4USV A;  2Q1L A;  1RHK B;  2FC9 A;  5GMD A;  3DI6 A;  2MGZ B;  5KFX A;  3DGP B;  3VAJ A;  2HQG A;  4OX8 A;  2FHK A;  1B70 B;  2J8S A;  3A8I A;  2AIR B;  2CYY A;  2JHE A;  2AGQ A;  2NYH A;  3JYT A;  2D9O A;  3OTD A;  3CCR S;  1QTN B;  3C6U A;  2LLZ A;  1VRQ C;  3DOL B;  4ZMM A;  2KZZ A;  5DDO C;  2R7X A;  4NAS A;  2ROE A;  1RAC B;  3NS6 A;  1IWA A;  2ZE2 A;  4ZK7 M;  1XBW A;  2XZW A;  3RAQ A;  5LJ5 Y;  1HI8 A;  4ZVF A;  5EDW A;  2IVM A;  5IT9 U;  3HX9 A;  1TKX A;  4FBT A;  1SJ4 P;  2AZ3 A;  4Y2I A;  4J9N A;  1MN7 A;  2Y3Y A;  3VGV A;  4USK A;  2NUH A;  1CC8 A;  4KV8 B;  1RUS A;  2IFX A;  4KGM A;  1TKD A;  1UFL A;  3THV A;  1UVN A;  3W62 A;  2WVE A;  3FBE A;  3K58 A;  4U7U D;  1FFS B;  1DY3 A;  5ADZ A;  3T9N A;  3QGH A;  2CXE A;  1NDC A;  2VC1 A;  1EAR A;  4DV2 J;  3KJN B;  2JFK A;  5HP1 B;  1EQ0 A;  1VC0 A;  1QVG R;  2ZUG A;  3ENV A;  1NEE A;  4DV3 F;  1HMV A;  1RWM B;  3T1H F;  1WWH A;  2RDD A;  3SV4 A;  3SDE A;  4QYZ J;  1VIO A;  4V19 J;  2NPI A;  3C15 A;  2XLK A;  5J2Q A;  5B0C A;  2X3D A;  4EO6 A;  1LXJ A;  3MWB A;  1CBK A;  3A4T A;  3RG6 A;  5KG6 A;  4F4W A;  4BS2 A;  5DZ6 A;  3M2R A;  3UO0 A;  4LMZ A;  1QD1 A;  2CQB A;  2GGP B;  4GKK F;  3IBC B;  4DSK A;  4W90 B;  2KRR A;  4ED6 A;  3OVB A;  4OYX A;  3LP1 A;  2L9N A;  3CCE S;  1SC3 B;  1NDP A;  1UVI A;  4F0K A;  1RYS A;  2KT3 A;  1RAH B;  4ES1 A;  4G1P A;  1T3O A;  3K5P A;  2E5L F;  4H4O B;  2MHE A;  3CJQ A;  1UL3 A;  1ZOT A;  2GCF A;  2B9Y A;  4P72 A;  1Q81 T;  2HEK A;  3MAA A;  2M2B A;  1WNE A;  4UF4 A;  2OLW A;  1RAJ A;  3D54 A;  2KFZ A;  3VGU A;  4JI3 F;  2MLY A;  4MIB A;  2GX8 A;  1TP7 A;  1ZM3 A;  2EFQ A;  5JUM A;  2G1H A;  2YKQ A;  3US5 A;  2ALZ A;  3FEX B;  1YKW A;  1IKV B;  2GW8 A;  4CO0 A;  2YNI A;  4DDF A;  1IBK J;  3DCA A;  3QGI A;  3HHL B;  2BW7 A;  4DFK A;  1RCX B;  4O3P A;  5H1S V;  4L76 A;  2GHW A;  3MM5 B;  3LWM A;  1FD2 A;  4TXS A;  4UY8 T;  3SQO P;  1VCT A;  3IRX A;  1VRT B;  4RLE A;  5IWA F;  3OVA A;  3W2W B;  1T05 B;  1LNQ A;  1S79 A;  1TEL A;  3PW4 A;  1NU4 A;  4HLB A;  5C24 A;  1VYA A;  1HNZ F;  1MWY A;  1Q79 A;  1R7I A;  1L3T A;  2DY1 A;  3VQS A;  2JOQ A;  1UMJ A;  3RAM A;  1E6V A;  3HHK A;  3MZI A;  3OR1 B;  4HT5 A;  3UPF A;  1KKH A;  4DUZ F;  1SJ3 P;  4JI7 F;  2HGN A;  2MEW A;  1T9V A;  1DRZ A;  2YNH B;  2QLF B;  2XHC A;  4ECS A;  3ZTR A;  4RZR A;  3HSJ A;  3M9M B;  2O5D A;  2RS8 A;  1R8A A;  4DR6 J;  1K0T A;  2OPS B;  5HI7 A;  4WYW A;  3LA0 A;  4K5R A;  3HCX A;  2XCP A;  4HYK A;  7FDR A;  3SV3 A;  3MD3 A;  4F3O A;  3BRE A;  4I4B A;  4H54 A;  4CLS A;  4PPZ A;  2BE2 A;  4UZB A;  1GMW A;  3GIR A;  4XPE A;  1DTQ B;  4C3M A;  4NCA A;  1CUL B;  4WPA A;  5F41 A;  2QIF A;  4FDF A;  4CLZ A;  4RO0 A;  2XCA A;  3T5K A;  3QQC D;  1S76 D;  4YHH F;  5DG7 A;  1XR6 A;  1RT2 A;  2VOP A;  3QAE A;  4RNF A;  2ZH8 A;  5A2Q U;  4ECU A;  2I8E A;  4PWD B;  1APS A;  1CJK A;  2VHG A;  4YQW A;  4ZCL A;  3KUH A;  1N32 J;  1UVJ A;  1GXT A;  4LBH A;  1BQM B;  2ZBI A;  4CNZ A;  2W01 A;  4XO0 A;  3IO1 A;  4C8M A;  1K9M T;  1BQN A;  2BKN A;  3NCQ A;  1XNQ F;  1WD6 A;  3IMQ J;  2VQE F;  3F73 A;  2WRM A;  3E2E A;  1NME B;  1OS5 A;  4DV4 F;  2IDL A;  4PG7 A;  3PVX A;  1U02 A;  2H4Y B;  3V6D B;  3DDN A;  1X4C A;  4DR6 F;  4TLQ A;  3W5Y A;  2K1R B;  2ZBQ A;  3KUG A;  3S6E A;  2Q6B A;  1QSL A;  3GP9 A;  1N54 B;  2VF3 A;  1A6L A;  3MUV P;  4MK7 A;  1VOM A;  2H5I B;  1FWK A;  3CED A;  3H20 A;  2CPF A;  1IJE B;  1Q7Y T;  2NXE A;  3HO1 A;  2CDQ A;  4CH7 A;  3CO0 P;  4RJV A;  3BBF A;  2BA9 A;  3CCL S;  1HLW A;  3CNQ P;  1R3N A;  3DM2 A;  1HBO A;  1LW0 A;  1U0S A;  4Q45 A;  3N9U C;  3BO2 A;  4JI1 F;  4C8Z A;  4FXW A;  2YKM A;  3KK2 A;  4Q2L A;  2YY3 A;  1VQ5 S;  1RYR A;  3C2P A;  5IM0 A;  1UTA A;  3AD7 C;  1HQ2 A;  1SL0 A;  4RNM A;  1B7Y B;  5HVG A;  1JX4 A;  5T41 A;  3FKB A;  3IC1 A;  4OZL A;  1XIQ A;  1BQX A;  1ZM4 A;  2UXC J;  1XR7 A;  2EK6 A;  2HS4 A;  1TU0 B;  4NI2 B;  2BQU A;  2RE1 A;  5DDQ C;  4OLO A;  4DLG A;  3TW0 A;  4F04 B;  1NLK L;  4I1T A;  2C3U A;  1RTI A;  2ZJQ Q;  4LF7 F;  3H0P A;  5CA5 A;  1FXL A;  2BAC A;  2D9P A;  4LF6 J;  2KTQ A;  2VV5 A;  3PW0 A;  1QTM A;  3UVJ A;  3M2V A;  2R7S A;  4DQQ A;  2A18 A;  2I6W A;  5G0R B;  3HPO A;  1XNR J;  1WHX A;  1VDH A;  5D4L A;  3JSM A;  3BH6 B;  3RB3 A;  5DO2 A;  2BE9 B;  4USW A;  2BKO A;  3TJA A;  5LL6 d;  2Y1I A;  2BOA A;  2CDR B;  3KLV A;  3IP0 A;  3MCM A;  5DZ7 A;  3M05 A;  2R8H A;  4C0H A;  2VBW A;  4DL2 A;  1HPZ A;  2G9O A;  5KTQ A;  4LUB A;  4OJ3 A;  4NLP A;  3WQP A;  1F2G A;  3DYA B;  2YQ0 A;  2I5J B;  5F0W A;  3TVZ A;  3BPS P;  1U6Z A;  3OTO J;  4YDD B;  1WF0 A;  5GAD U;  2KDO A;  3IG1 B;  5KFT A;  3C6T B;  2PEH A;  1TAU A;  5AJ3 J;  2FZC B;  5J1N A;  1VGY A;  1FI4 A;  4O4R A;  2E1C A;  4JBC A;  4MK9 A;  2J9E A;  3BKF A;  1JXL A;  3M6U A;  3JQJ A;  3K2Y A;  5E2Q A;  2JDJ A;  4O3Q A;  1IM6 A;  3D68 A;  2MQP A;  3VR1 A;  2CQ1 A;  3HVA A;  4AFF A;  2VFV A;  3PO4 A;  2B6A B;  1FD8 A;  3QID A;  4CLW A;  4RW9 B;  4NEY A;  4CCH A;  4MKV A;  4Q8E A;  1HI1 A;  3LPE A;  3Q8R B;  5I3U A;  1VQM S;  3DRR A;  4TU9 A;  2DBB A;  3CCZ A;  1H2T Z;  3BJY A;  1C0T B;  1S97 A;  1KS2 A;  4NCG B;  4IFV A;  2XWY A;  4HH0 A;  1E6Y B;  2ASJ A;  3N0V A;  4F2S A;  3NXZ A;  2UUA F;  4WYL A;  4M1K A;  4J9K A;  4LJM A;  1Q1K A;  2RS2 A;  4G1Q A;  5SZT A;  2ZH7 A;  3UD5 A;  4BHQ A;  2EXU A;  1TKT A;  5JXS A;  1Y7P A;  1Z1Z A;  3DHX A;  1EHW A;  2FC8 A;  3UI3 A;  3DRP A;  1FJ7 A;  3AQO A;  2YKN B;  3MMC B;  3MMJ A;  3HT3 A;  5AJ3 F;  1F3V A;  3AOA A;  1D9D A;  3I0R A;  2GAG C;  3KWM A;  2W9C B;  3MEC A;  5B0B A;  1IR2 A;  4DPY A;  2CQD A;  4DV1 J;  2ZH2 A;  4ZVG A;  3B78 A;  2FVQ A;  2PA8 D;  2HFS A;  1NK8 A;  2NXC A;  3FBF A;  2UXB J;  3W2V A;  1TK5 A;  4ZPD A;  3U27 A;  4K0K F;  1J27 A;  1FE4 A;  2BE7 D;  1U1N A;  2GMH A;  3SFU A;  2IYI A;  4Y2K A;  4MIA A;  4P9S A;  2XGQ A;  5MAO A;  2VG5 B;  1FJE B;  3NGD A;  2FJE B;  3HD2 A;  5LOQ A;  3VAM A;  2D3U A;  4N7T A;  3T5L A;  1FXR A;  1FDB A;  2O1P A;  2FZK B;  1GQE A;  1DZ5 A;  2FVR A;  3NRB A;  2UUW A;  3NKY A;  5L39 A;  2EPI A;  1IR1 A;  5A8K A;  5ETR A;  4LFB J;  3HJV A;  4JP8 A;  1JLQ B;  1NB2 A;  4IH7 A;  4K4U A;  3TAQ A;  3SQG A;  2GNK A;  2CZ4 A;  1K44 A;  1HNV B;  4KGK A;  5HQM A;  4DWI A;  3DI6 B;  2BJ3 A;  5FII A;  1NK6 A;  3PZP A;  4ZPC A;  1S49 A;  3OJU A;  3J7A 1;  1NDL A;  2W9B B;  3BDP A;  1FTR A;  1RLC L;  2J5A A;  3S7R A;  1YJT A;  5LMN F;  2CJQ A;  5CYQ A;  5HJY A;  3I56 S;  1KD1 T;  3C6U B;  2DGV A;  5H9F J;  1D9F A;  2QA4 G;  1VR6 A;  5E3A A;  1HHQ A;  4I2Q A;  5A8W B;  1VI7 A;  1NUE A;  1S1T A;  4Y34 A;  2FD2 A;  9RUB A;  5CQG A;  2J0X A;  1RJJ A;  1PSD A;  3MD1 A;  2VIH A;  2JVR A;  1TKX B;  4LF9 F;  1UFW A;  1U6B A;  4QR2 A;  4PCQ A;  4LF4 J;  4Q0B B;  2DHX A;  2QGF B;  4DG1 B;  2H48 B;  3OSN A;  3VF0 B;  2GIQ A;  4P71 A;  4ZVQ B;  1HQU A;  2BJD A;  1U47 A;  1NK9 A;  3H8Y A;  2NLW A;  5F0U A;  2DO0 A;  5T14 A;  2DHH A;  1X4B A;  2APO A;  1MMD A;  4DCO B;  5ITH A;  4FP9 A;  2XWX A;  4JV5 J;  3WX8 A;  4WFX A;  2F8M A;  3MM9 B;  5KFK A;  1I5O B;  1TL1 A;  4WTO B;  4DR1 F;  4ICL A;  2ABY A;  2BJ9 A;  4EZ9 A;  4RW6 B;  3NGK A;  4OHV A;  1S12 A;  4ZCK A;  1TTH B;  3GFY A;  2F40 A;  1JMT A;  1U6F A;  2QJ3 A;  2V8H A;  3I0S B;  3ILJ A;  3SDE B;  4A8Q A;  2L3M A;  1S6P A;  1N8R T;  5M2R A;  4DL6 A;  3C15 B;  1HNW F;  2WBM A;  2MKY A;  2VFS A;  4WFB Q;  1FJC A;  1S9G A;  2E7W A;  2UZA A;  3M2R B;  4YY3 J;  1UW9 A;  1RT3 B;  3SEO A;  2A2D A;  4WFZ A;  3MXH P;  1DFD A;  4YDX A;  3ENQ A;  1G1X A;  1KNZ A;  4UOF A;  4ZP8 A;  3TEH B;  3LP1 B;  1R27 B;  2XO6 A;  2B51 A;  1KN6 A;  3TP2 A;  2AHO B;  3LO3 A;  4WF9 Q;  2DXF A;  5F3Z A;  5AE3 A;  1QDU B;  4KYZ A;  2RML A;  2OPP A;  4DF4 A;  4N47 A;  2YWK A;  3W63 A;  1HWI A;  1OO0 B;  2W8L A;  3I96 A;  1FES A;  4IOC Q;  1N34 F;  4IR1 A;  1KWM A;  3RBE A;  3MAA B;  3EVW A;  1YLX A;  2UUC J;  2I1R A;  4WIQ A;  2MQO A;  2VPY B;  1JLA A;  4JI8 J;  2MKS A;  1H73 A;  5DM7 Q;  1X5P A;  2OEL A;  5F8L A;  3FQL A;  4K59 A;  3DXB A;  3O6Q A;  2LYV A;  2W24 A;  1O8B A;  2XY7 A;  5CCM A;  1WC0 A;  4KHM A;  2B4U A;  4Y3C A;  4DR2 J;  3M2U B;  3QNW B;  3P8B B;  2CWX A;  5HQ8 A;  4ANC A;  2IBK A;  2ASY A;  2CRL A;  1ZTW A;  5A6P A;  3ZZZ A;  1W2I A;  5DLG A;  1X7V A;  2CQH A;  2HHH J;  5E3R A;  4X84 A;  3PHE A;  4F36 A;  4DR5 F;  1N6Q B;  4MKB A;  5KFU A;  2YVS A;  4WTY A;  1EKS A;  1FXD A;  3NL0 A;  1M5S A;  3BB5 A;  1PJ6 A;  3B4D A;  2ZHA A;  2NQP A;  2EW9 A;  2GQQ A;  3QRR A;  2G2Y A;  4AE5 A;  3D66 A;  3RRH A;  3GPA A;  3N01 A;  1NHV A;  1HNX F;  2XYH B;  2PMW A;  1TVR A;  1AXQ A;  2W8K A;  1XMQ F;  3TQE A;  3NOC A;  1E6V B;  3CMA S;  4F0H A;  3C14 A;  4F0M A;  4RKU C;  1WJ9 A;  2IRX A;  1P27 B;  3EWG A;  4KH1 B;  5D3G A;  2WSE C;  2DT9 A;  2JL9 A;  3EPI A;  1RTD A;  3G87 A;  2X51 A;  1RKJ A;  1HNI B;  3D0I E;  3IR6 B;  3AH6 A;  1MSW D;  3DLG B;  2VBY A;  3KK3 A;  3PX4 A;  2DH8 A;  2K3I A;  2N7Y A;  2LQJ A;  1FHT A;  3HFV A;  2CQ3 A;  2M9K A;  3Q2S C;  2HHT A;  1CPZ A;  4BDP A;  4RL1 A;  2K8G A;  2HHU A;  1WOR A;  2R8J A;  2XSJ A;  1WTB A;  2BW2 A;  2HLU A;  1YX2 A;  2G2Z A;  3GWC A;  5IV3 A;  1DLO A;  2QL7 B;  4R0J A;  1FER A;  2V50 A;  1LFP A;  5IC4 B;  1KVI A;  1SB6 A;  2E5G A;  2HHH F;  2EEY A;  1U0H B;  5L1J A;  5LJ3 Y;  1Y3J A;  3SZ2 A;  3R5A A;  2WVF A;  1NSA A;  5DRK A;  3DU6 A;  1AW0 A;  2ZH5 A;  3DRY A;  2C22 A;  3KK1 A;  2UUB J;  4P2X A;  3DXS X;  2CNK B;  1Q8I A;  4ALZ A;  4DLE A;  4Y65 A;  2OEM A;  4U6P A;  3DLJ A;  3BQ0 A;  4KHP J;  2GHV C;  3HZE A;  4TY9 A;  5H9F K;  2UUT A;  4O0I A;  3QSI A;  1IVZ A;  2CPJ A;  3PW7 A;  4ZLL A;  2CAJ A;  3N28 A;  2CZV C;  2K7J A;  2QA2 A;  2V2Q A;  3GCW P;  5L1I A;  1JJC B;  4IUF A;  4DZ6 A;  4J90 A;  4J9L A;  4JI4 J;  4IO9 Q;  3POT A;  2FZG B;  3SI8 A;  2WOM A;  1PIE A;  5EWG A;  4DX6 A;  1NJW A;  3PAC A;  1TZ0 A;  2VL1 A;  5CYM A;  5A2Q Y;  4F3Q A;  1TMJ A;  4NYP A;  4BBY A;  3PW5 A;  4DPW A;  1QVF R;  5KFR A;  3TR5 A;  1WG5 A;  1WOO A;  1GXU A;  4JV1 A;  4NLG A;  4UW2 A;  2Q43 A;  2HHS A;  9ATC B;  1NB7 A;  4CLY A;  2EBG A;  3HI9 A;  2UU9 J;  1HBO B;  3W9I A;  3KNG A;  3TA2 A;  2VU5 A;  2C42 A;  2YKM B;  4NA2 A;  2AEF A;  3HXM A;  1X0F A;  3MOZ A;  2V94 A;  2CJX B;  1XJW B;  4BCA A;  5MLC V;  5IM0 B;  2WZ1 A;  2GIR A;  4DMZ A;  4NLO A;  5D4O A;  3NNA A;  1F0X A;  4N5S A;  3CCQ S;  4LSN A;  2FDN A;  2UVU A;  3D2W A;  4DUY J;  4FXD A;  3MMB A;  3O3L A;  4IG0 A;  1T9Y A;  4S0M A;  1RAB B;  3RUB L;  3AA9 A;  3CDE A;  2ADC A;  3G96 A;  2GVZ A;  2BJ8 A;  2R9L A;  5ETO A;  2FHO B;  1O0P A;  4DV7 J;  1FJG J;  3I87 A;  1RTI B;  2ZNZ A;  2ZDP A;  1HQE B;  2J7K A;  4KSE B;  4LF8 F;  3AA8 A;  1CJU A;  4F4X A;  3VQT A;  2HVH A;  1YWX A;  2DNP A;  3UD3 P;  5KFV A;  2QE5 A;  1FCA A;  3M30 A;  1S72 S;  5BYQ A;  2MQL A;  3KDN A;  3M8W A;  2QLW A;  4U7C A;  2KVI A;  4X4R A;  2M52 A;  1K1Q A;  2QV6 A;  1JLC A;  4B3S J;  1PKU A;  4L74 A;  1RHM B;  4OZN A;  4JI5 F;  4HI2 A;  3PO5 A;  2OSR A;  2DNN A;  4USJ C;  4M5M A;  1CQN A;  1HPZ B;  2W2M P;  2A6O A;  3QFW A;  3NY0 A;  2M0G B;  5AT1 B;  5K9F A;  4YS2 A;  5J2N A;  3M8Y A;  3HZG A;  3L7U A;  1PJ7 A;  2BBE A;  3KLE A;  3OTC A;  1FWL A;  1N5T A;  4P6Q A;  2VQF J;  4MKY A;  5GAG U;  5DS7 A;  3T1Y J;  1HBM A;  5DJB A;  1K47 A;  3CDA A;  3AY0 A;  4RPF A;  3H90 A;  3PEH A;  2XNQ A;  2Z57 B;  3KJV A;  1LQ9 A;  4P7V A;  3ETM A;  4L3N A;  4ZLJ A;  1P9Q C;  2VKZ G;  1I51 B;  4ZVP B;  1DAX A;  1ELO A;  1WC5 A;  1OWX A;  2QFJ A;  1FK9 B;  2ERR A;  5HK4 A;  3ZNJ 1;  3K7R A;  3EGW B;  3MR6 A;  4C9D A;  2W7O A;  4ZPT R;  4JYA J;  1SQE A;  2F9D A;  3HF5 A;  1RT4 A;  2Z2Y B;  1VQ4 S;  4YME A;  4X2B A;  4GVB B;  3D1Q A;  5I3U B;  2F3J A;  4M5H A;  1XMO J;  1Y10 A;  3RTV A;  2C2R A;  4PQU A;  1Y00 A;  4TY8 A;  2HBQ B;  1WOS A;  2H5J B;  1LKZ A;  3ET6 A;  4OX7 A;  1N36 J;  4K2J A;  4F7V A;  1KLN A;  4GRS A;  3EZO A;  4ZHR B;  4E0D A;  1Y5I B;  2J9D E;  5T7L A;  4DOZ A;  1ZTT A;  3PFE A;  1VQL S;  2FJW A;  4CH1 A;  2GML A;  3BZQ A;  4EMD A;  2E5H A;  1TKT B;  4ETX A;  1OSD A;  1X5S A;  2R8I A;  3CJ8 A;  4HT7 A;  2D41 A;  2QEX S;  1RAI B;  4WXW A;  3W60 A;  3DRP B;  3OR2 A;  4EWT A;  1Q86 T;  3MPV A;  2ILZ A;  1KQS R;  2F4V J;  3TI0 A;  1L3K A;  3ITH B;  3VWS A;  1WG1 A;  4UTG A;  3DLE B;  3BSA A;  3I0R B;  3L7O A;  3M9O B;  2VA2 A;  3PY8 A;  2B9E A;  3TWZ A;  4WP3 A;  2V4J A;  3MEC B;  2Z0G A;  1WEZ A;  4NXN J;  5ETV A;  3BGU A;  5KFG A;  3EMT A;  2HNY A;  1REG X;  4OQJ A;  2R7W A;  1PYS B;  1OPI A;  2W4C A;  4QPT A;  3PIO Q;  2CG4 A;  2N4D A;  2LFV A;  2ZD1 B;  3IS9 A;  4LF5 J;  1JWW A;  2B4P A;  3MM6 A;  1AZS A;  2IA6 A;  1H6K X;  3DU5 A;  4KHR A;  4M5L A;  5DGB A;  2MSS A;  1ZA1 B;  1NKB A;  3R3T A;  2G2O A;  3L4B C;  3D6T B;  2V9W A;  2VFR A;  1BC6 A;  2HVZ A;  2YX1 A;  2CQ2 A;  1XER A;  2EI5 A;  1T95 A;  4D3H A;  4UT4 A;  3DGV A;  1I3O B;  2OPR A;  4DV6 F;  3V4M A;  1KQF B;  4UOC A;  2HK3 A;  4OX9 F;  2UVV A;  2OPQ B;  2RRB A;  3BSN A;  1P1T A;  4EYH B;  1R43 A;  2AJF E;  2KHC A;  3CJS A;  4B3R F;  3P6Y C;  2RJZ A;  3V6J A;  4EBD A;  2A3J A;  1HW9 A;  3IFE A;  3GR0 A;  2L08 A;  1MMN A;  3W1Y C;  3QT8 A;  1TQL A;  3I4H X;  2F9J A;  4CLL A;  5A0Y A;  4ETZ A;  1FF2 A;  2YX7 A;  1BY9 A;  4DN0 A;  2XLJ A;  4HTI A;  1GAO A;  3C16 B;  1Y11 A;  5C5J A;  3FQK A;  1FE0 A;  4AQY J;  4FF3 A;  4IKA A;  4CP5 A;  3UDV A;  3EVO A;  3PXG a;  1IJF B;  1N5S A;  2AX1 A;  2RUG A;  1T11 A;  2JSX A;  2P9C A;  1F9E B;  4G65 A;  4UQT A;  3DOL A;  2ZWP A;  3N4W A;  1IXK A;  4C97 A;  3D0G E;  4J9M A;  4I2Q B;  5HAN A;  4AL7 A;  5FD1 A;  3ZZU A;  3OL9 A;  5D78 A;  4NA1 A;  1RWO B;  4HDG A;  2JC0 A;  1FDD A;  3M6W A;  2ZFH A;  1KP6 A;  1U26 A;  2Y0S D;  2MXY A;  4K4Z A;  4CYU B;  3QGG A;  2HZC A;  3EGN A;  1IWG A;  1RSC A;  3HDS A;  1VQS A;  4WCE Q;  1FFW B;  5E0O A;  3DRS B;  4FNI A;  1HIY A;  4KO0 B;  3ZC4 A;  3KKF A;  4EGL A;  1ACM B;  1QSS A;  2K06 A;  3A8K A;  5D77 A;  3G6V A;  2XG8 A;  3ULH A;  2QLJ B;  4WKY A;  3W64 A;  1H38 A;  2B0G A;  2UP1 A;  3G2X A;  4B3O B;  3AOD A;  5DDR C;  4TVA B;  2POK A;  2AP6 A;  4ED7 A;  1K8A T;  5HP1 A;  2CQC A;  2EFN A;  4NLX A;  3ZTP A;  2ZIT A;  2CIM A;  5IZH A;  4FYV B;  4M8L A;  4FYX B;  2G1D A;  1NM2 A;  4M63 A;  1JXV A;  1HD1 A;  2HGM A;  4OHY A;  5ETL A;  1VQY A;  4WBF A;  2QZ8 A;  4J37 A;  1SJ1 A;  4OYP A;  1PYO B;  3LGN A;  2DNO A;  2V9K A;  2IBO A;  3VAH A;  4QWE A;  4ZPA A;  1RT5 B;  3L3C A;  3D28 A;  2IYG A;  3SSQ A;  1S9G B;  1VQ9 S;  4NWB A;  2CJA A;  1GNK A;  3A3P B;  4RW4 A;  2NSB A;  1WAC A;  5IT4 A;  4PWU A;  1R31 A;  2XS7 A;  1RI7 A;  5DM6 Q;  1NPR A;  1JLG A;  5GAG I;  2C2E A;  1U2F A;  4DI6 A;  4ITS A;  4CM2 A;  5KFY A;  2OAU A;  4DHV A;  2P9G A;  4NL5 A;  2HS0 A;  2DR6 A;  2AJ1 A;  1Q7L B;  1S4F A;  2HMI B;  4ELV A;  1I94 F;  1IBL J;  3DN9 A;  5KT4 A;  4L75 A;  2V0N A;  3CD7 A;  2KU7 A;  2Z2M A;  5M2U A;  3LOU A;  1K73 T;  2DHA A;  1SKU B;  4FS2 A;  2ZDO A;  3MGJ A;  3LAL A;  1SKS A;  3CJ2 A;  2PGC A;  1IKV A;  3ZZY A;  1VIS A;  2YNF A;  4NZ0 A;  4MFB A;  5AXK A;  2HFZ A;  3HHL A;  1NK7 A;  4PZV A;  4IRC A;  3AOB A;  3K8V A;  3H5X A;  5HQL A;  1M0S A;  4N8O A;  4DR3 J;  1UET A;  4JI0 F;  4ZIV A;  1VRT A;  5K8P A;  3PFO A;  2OKQ A;  1SC6 A;  1D09 B;  3FDS A;  3TVY A;  5HN0 A;  4NLW A;  2JLG A;  4K50 A;  5FJ4 A;  2IAJ B;  1TVR B;  4NXM F;  2C2Z B;  1X4D A;  2OGU A;  2IRY A;  3EJM A;  3H59 A;  4HDH A;  4PXC A;  1AT1 B;  1YJV A;  3W61 A;  1AYE A;  2KG1 A;  4LRB A;  1ZZN A;  2AV5 A;  3CXC R;  1D8Z A;  5D3G B;  2YNH A;  4CO3 A;  2F65 A;  3HHL D;  1RWP B;  1RTD B;  4X4N A;  3W66 A;  3BEG B;  5KG2 A;  1QSY A;  4JI2 J;  5K20 B;  5L1K A;  3K57 A;  4B3T J;  3KK3 B;  2IJF A;  1RHJ B;  2XTJ P;  5KFE A;  2PI4 A;  5D8H B;  3B8H A;  3Q86 A;  3TJ9 A;  2LA6 A;  4ECV A;  4ED0 A;  4ZOS A;  3EE3 A;  4B08 A;  2XSJ B;  2ZVS A;  2R3V A;  3DFE A;  4FYW B;  2DJW A;  2VC0 A;  2NCK L;  4U95 A;  2YKP A;  3CJR A;  1NSP A;  5D4N A;  1SJR A;  2B56 A;  2CZ9 A;  8RUC A;  1M5K C;  1SC4 B;  2XS5 A;  4YB7 A;  4RBV A;  6FDR A;  5SUH A;  1OY6 A;  1N0U A;  5A6W A;  3G6Y A;  4FS1 A;  3M8Q A;  1X4G A;  2CAD A;  2DHS A;  4K4W A;  2ZH1 A;  3MOJ B;  1ZS6 A;  2VBZ A;  4DR7 F;  3R5C A;  4I6W A;  1LEO A;  5KG3 A;  3ETO A;  3FJ2 A;  4DSF A;  2E1M C;  1EP4 A;  4C11 A;  1KON A;  3KLF B;  3KK1 B;  2CA9 A;  2HKE A;  5HAT A;  5KG4 A;  1BQM A;  2O66 A;  3HFK A;  2OSQ A;  4LIR A;  4C8O A;  5D15 A;  1QAI A;  2G0C A;  4A8X A;  1YIT S;  4NLD A;  4X65 J;  3MR5 A;  2KFN A;  1FDN A;  3PX6 A;  2LDY A;  4M5I A;  4WFN Q;  5U47 A;  1BWE A;  2LP4 A;  1RQ0 A;  2XMA A;  1IBM J;  2HIQ A;  2YX4 A;  2AQ4 A;  4QJV A;  3V6D A;  3G9C A;  4FF4 A;  1G2E A;  2R42 A;  3HKW A;  4B3T F;  3LP0 A;  2K1R A;  3J81 U;  4I67 A;  4GKJ J;  2J7W A;  1S7I A;  5CYM B;  4ZCI A;  4IOA Q;  4QWD A;  2J0W A;  4F02 A;  4IG3 A;  3LAN A;  4XDD A;  1AA1 B;  3EGZ A;  4USM A;  3T3F A;  3T41 A;  2D1C A;  1RWN B;  2P9E A;  3Q8V A;  3J7Z T;  3KYL A;  3M32 B;  2DGU A;  1BXN A;  2XMK A;  3ZTO A;  2WVD A;  2CUY A;  2DIV A;  4NRU A;  4ECT A;  4Y2M A;  3J7Y U;  2FLN A;  4FNH A;  2ZHO A;  4A8F A;  1TFY A;  4Z7C A;  1RAE B;  4NX9 A;  5KOX A;  2AJ4 A;  1VQ7 S;  2UXD F;  4WP9 A;  1WEY A;  5G4D A;  3N5B A;  2H5E A;  4YUD A;  4IG0 B;  2PT0 A;  4NI2 A;  2G0J A;  3RB0 A;  1Y9O A;  3W8G A;  2GVZ B;  5B0G A;  4CZC A;  4OZ1 A;  1IQT A;  5K14 A;  3NAI A;  4C0O C;  2MTL A;  1LWE B;  3UWT A;  1X5T A;  1S6O A;  2QLX A;  2VD3 A;  1S0M A;  1CJU B;  1Q8B A;  4A8M P;  1XEZ A;  3BSC A;  5G0R A;  1R0C B;  4QW8 A;  3NBP A;  5DQH A;  3MFI A;  5J1E A;  2OP5 A;  4KIA A;  2W1B A;  3QT6 A;  4CLU A;  4TQR A;  1T9T A;  1Y4Z B;  4JI6 F;  4HL9 A;  1VBZ A;  1X0P A;  1NH7 A;  4UOG A;  3R8Y A;  1GT8 A;  4X64 J;  1XQI A;  4Y6I A;  3UFC X;  2LCW A;  3D9B A;  3CJ5 A;  2HYI B;  1H98 A;  2P5V A;  1U09 A;  2YWW A;  1S1X A;  3RB4 A;  2ZC4 A;  3MAH A;  1OY9 A;  3QZ7 A;  2I5J A;  1NO8 A;  2J6T A;  3MEG B;  4LF2 A;  5J2N B;  2HVD A;  3SBM A;  5HLF A;  3IG1 A;  3KLE B;  4R0E A;  3AQP A;  3C6T A;  1C4A A;  2DR8 A;  1UCN A;  1L3U A;  3ZXW A;  1SJF A;  1WUU A;  4PUO B;  2VBX A;  1HBM B;  2EBE A;  4J9S A;  1UVM A;  3QZ8 A;  2RU3 A;  1SCJ B;  1Y3K A;  2MQM A;  1TUV A;  4P2M A;  3KJV B;  1S48 A;  3I32 A;  3NOG A;  1XR5 A;  2RRN A;  3R2C J;  3G4S S;  5JVG Q;  4ECY A;  1FX4 A;  3RBD A;  2ASL A;  4QQB A;  5LSO A;  2HQF A;  4RW9 A;  3GII A;  2HFN A;  3M4X A;  1OQ3 A;  1V3S A;  1UJ4 A;  1S4E A;  5JJB A;  4DL3 A;  3CDB A;  1RT4 B;  1MWQ A;  3V2U C;  3EGV A;  4HTJ A;  3RAX A;  2KM8 C;  3GZ7 A;  3FCH A;  4NCG A;  2COL A;  2XGP A;  4PQU B;  4TY8 B;  1F6T A;  5IT0 A;  1QUP A;  3SYZ A;  3W8P A;  2E9T A;  3A1Y G;  3JXO A;  5T7L B;  4F2R A;  4UUX A;  5HMY A;  4NMX A;  4FXV A;  1VQN S;  2QL5 B;  3WIV A;  3KG1 A;  5KFJ A;  1S57 A;  4M94 A;  5HSP A;  2YKN A;  3MMC A;  3TAM B;  1NK5 A;  4EU0 A;  3GG0 A;  5KG1 A;  3OR2 B;  3HKZ D;  2AX0 A;  4L73 A;  3LP2 A;  1Q5V A;  1Q0N A;  2W9C A;  3G71 S;  3U1L A;  2MYF A;  4ZA1 A;  4WII A;  2CQI A;  1U2C A;  4U67 Q;  3P45 B;  2V4J B;  2I0X A;  3V6H A;  4Q2M A;  2HND A;  5HVH A;  3T5H A;  2YWG A;  1OYE A;  4CQ1 A;  2VPX B;  3H5Y A;  3MM6 B;  3VAF A;  2RIL A;  1AZS B;  4ILL A;  3GFZ A;  5GAE I;  2V6A A;  5CD4 A;  3Q0A A;  1MRO A;  2BZ2 A;  3GFH A;  4CO4 A;  5KT6 A;  4DFM A;  3AD8 C;  3Q2T C;  3Q23 A;  2JZ5 A;  3BBB A;  2O67 A;  2DNM A;  3EDR B;  2BRK A;  4QWC A;  2OPR B;  4ED3 A;  4LFC J;  1IN0 A;  3TOQ A;  4X62 F;  2QFI A;  3SIP B;  2W2N P;  2YWH A;  3UNG C;  4H4K A;  1HWJ A;  2WSF C;  1S1U A;  3HP6 A;  5DGA A;  1REV A;  2KI2 A;  2X1G A;  3AFG A;  2UV8 G;  4PG4 A;  2B43 A;  1RWK B;  5KG5 A;  4QU6 A;  2OFH X;  1Q82 T;  4FVC A;  3Q8S B;  1JLQ A;  2FJB B;  2IMO A;  4A8W A;  1WSV A;  3QIP A;  4X66 J;  1HNV A;  2YQ3 A;  1C4C A;  3OSP A;  3KMS A;  2LQB A;  4ECW A;  5A0Y B;  3A8J A;  4P52 A;  3AAW B;  3I9Z A;  4DU7 A;  3K59 A;  2W9B A;  4WXO A;  2XO7 A;  3OW2 R;  3QYY A;  1GTH A;  1RAO A;  1HHS A;  5AXL A;  1YRX A;  2AYE A;  3F44 A;  1NJX A;  2R2R A;  1L5U A;  4YR3 A;  2J6U A;  1S6Q B;  1TL7 A;  5A8W A;  3O2I A;  2RRA A;  3NWG A;  1R6Y A;  3M1V B;  2E7V A;  3T6B A;  2RQK A;  1Q53 A;  1GXL A;  1FEE A;  4C6A A;  1DJ0 A;  3TA1 A;  3J7Y I;  4UUW A;  2AYB A;  2JC1 A;  2V8V A;  5F8G A;  1R89 A;  3RZA A;  1W25 A;  3HSZ A;  1LFW A;  1UA0 A;  1RZM A;  4Q0B A;  1SL2 A;  4LSL A;  4B9U A;  4DG1 A;  4QR0 A;  3Q89 A;  3BGO P;  3JSR A;  4OYZ A;  3FSX A;  1S1W B;  2M7S A;  3GJR B;  2R2S A;  4K4T A;  5AE1 A;  2W2P P;  3WHI A;  2HHX A;  4DX7 A;  2P8I A;  4R25 A;  3HSG A;  1KLM B;  4AL6 A;  3ZTS A;  3MM9 A;  2PA3 A;  1U1K A;  4QYR A;  2LU1 A;  2DCL A;  3Q24 A;  4X66 F;  2AZ1 A;  3BH7 B;  4OZJ A;  2Z4P A;  2VPW B;  1NK4 A;  4RW6 A;  4OYO A;  5A8R A;  2K2P A;  2K7K A;  1LK5 A;  1S99 A;  1FFG B;  4OI4 A;  4KRW A;  4KPY A;  3I0S A;  1IQZ A;  2ROP A;  5CH7 B;  1Y5L B;  2ZH9 A;  5HBM A;  3GIK A;  3WZ0 A;  4A4J A;  3K5L A;  3I55 S;  3W9J A;  3TVK A;  5HMX A;  3IA0 A;  4YR0 A;  3ELH A;  1PJ5 A;  3M6X A;  3UDL A;  1SL1 A;  3TO8 A;  2DYA A;  2HQI A;  4DSI A;  3G8Q A;  3JTO A;  2BV3 A;  1RT3 A;  1NJY A;  3TZX A;  4RW4 B;  4KBI A;  2HK2 A;  2M5Y A;  2ILY A;  1HBN A;  4O0N A;  3PW2 A;  1JLG B;  4KFB B;  4LRF A;  3E51 A;  4I6Y A;  1TK0 A;  4JV2 A;  2QSW A;  2OIH A;  3FRY A;  2GHP A;  4M5D B;  2HHW A;  4P2F A;  4ATN A;  2D3Z A;  1IKW B;  2XEX A;  1RBL A;  1LK7 A;  5ETT A;  1R8B A;  1P8G A;  1V3R A;  2V34 A;  2M88 A;  3BKT A;  2H3E B;  5KT2 A;  1YBU A;  3KHR A;  2I9S A;  1LWF B;  2QX0 A;  3CJ3 A;  1RHU B;  4DL0 C;  4I6A A;  3IWL A;  3GV8 B;  2PDA A;  3GSD A;  4R8U B;  3GJQ B;  3D4J A;  1F3F A;  2DNK A;  4DV2 F;  3HVR A;  1QE1 B;  2Y1J A;  2XZD B;  4IOB A;  2YNF B;  3M2U A;  1YRU A;  2BM1 A;  4C8L A;  1K1S A;  1URN A;  1OIA A;  4MFB B;  4KY3 A;  5F9L A;  1Q16 B;  1FVQ A;  4BC7 A;  1N6Q A;  4ID5 A;  4EFA C;  3CJK B;  1JJ4 A;  3ENA A;  4ED4 A;  2M70 A;  3JAM U;  3KJQ B;  1JLE B;  2ZH6 A;  1WI8 A;  2HBZ B;  4CLK A;  2RHS B;  2PSZ A;  1T7P A;  4B9V A;  1DTT B;  4G3I A;  3HK2 A;  1RT6 A;  2QA1 A;  4USI A;  2DIS A;  1H7W A;  3CB4 A;  4LRD A;  1PBU A;  4Y2C A;  2HRY A;  3FGV A;  3W65 A;  2WHO A;  1JJH A;  2CPX A;  2QL9 B;  3T19 A;  2C2D A;  2DR9 A;  4ZVR B;  1JLB A;  1HNI A;  4RUA A;  3E01 B;  5EUH A;  1WSR A;  3DLG A;  4UY8 5;  2GQC A;  3LPY A;  2CFX A;  2Z8Q A;  1BE4 A;  3D6M B;  2QTW A;  3KMQ A;  1U7L A;  1T8E A;  3CW2 C;  2YPY A;  3GE9 A;  4X4P A;  1IBK F;  2EFG A;  2DEI A;  3NNH A;  2DNZ A;  2DIT A;  4PG6 A;  3ZZ0 A;  3KOA A;  3VVU A;  3HHL C;  3TUZ C;  4YP3 A;  1U0H A;  2D3O R;  1P9Y A;  4DFP A;  4DF8 A;  3IXQ A;  4PXB A;  4XK8 C;  4TLR A;  4KB7 A;  2Q6C A;  2Y1L B;  1FRL A;  3HM9 A;  4OZ0 A;  2WVB A;  3AJ1 A;  2KJW A;  3M8Q B;  2EK1 A;  1BUX A;  5I3P A;  4F4A A;  1NND A;  2PMH A;  1DUR A;  4LBP A;  2B5J A;  3KXD A;  1VBX A;  1RKI A;  2ZUA A;  3OV7 A;  1EP4 B;  4ZPB A;  4C11 B;  1J5E J;  2DR5 A;  3OFG A;  1SH0 A;  4WWS A;  2MZ1 A;  1X9S A;  4AUK A;  5CAA A;  1NSQ A;  3QWP A;  5AXM A;  2ACM A;  1JKH A;  1TAQ A;  4W92 B;  1FNX H;  4HI1 A;  1GMW D;  4KQZ A;  3BO3 A;  2C28 A;  3G6X A;  3PYD A;  2DY9 A;  3TAN A;  1EIY B;  4IH6 A;  4TU8 A;  3MTK A;  2MQN A;  4ECR A;  2V5H G;  3LP0 B;  3MMA A;  1A7G E;  4LRA A;  1WKK A;  2R8G A;  4XDC A;  5F3T A;  3G8S A;  3PNI A;  2MDA A;  4I7F A;  3GIJ A;  3MPY A;  5F8M A;  3X3U A;  4IG3 B;  1AUS L;  4HR2 A;  4V19 X;  5DG8 A;  4ZS6 A;  1ULR A;  5KFI A;  2EKY A;  3OHB A;  4N41 A;  2HVE A;  2RH3 A;  4QIE A;  3CF5 Q;  4AT1 B;  4IFY B;  3MEE B;  3DC2 A;  4TYA A;  3T9Z A;  1CG2 A;  4DS5 A;  1L3S A;  3R7S B;  2OEK A;  3VTI A;  3J81 Y;  2WCX A;  1MLA A;  4B3M J;  2Q79 A;  2CNO B;  4YB6 A;  2EWH A;  1JJ2 R;  3PRV A;  1J5E F;  4U8V A;  2VDH A;  4DL5 A;  5HVF A;  1N32 F;  1VLY A;  2PO4 A;  3F41 A;  5EWE A;  3N79 A;  3MED A;  3C46 A;  4NZ7 A;  4C8Y A;  1NDK A;  2H65 B;  1YK9 A;  1PBA A;  3P4U B;  1H0H B;  5K14 B;  4NLR A;  1ZAW A;  1HQE A;  3ZZO A;  3OFE A;  1YHQ S;  4YN3 B;  2M3D A;  3M8Z A;  1UWA A;  1XMB A;  1M1K T;  1VHF A;  3I5C A;  2V63 A;  2C3P A;  1X8D A;  5KFL A;  3PJX A;  3NBP B;  2XMJ A;  5J1E B;  1LOU A;  5M2P A;  3VAI A;  4LFA J;  3W9H A;  2HHQ A;  4P7T A;  2X1F A;  2AYG A;  3BSO A;  5ETS A;  1F2H A;  1N56 A;  5KFP A;  4LVN P;  4KR0 B;  3OVS A;  4EZ6 A;  4OI1 A;  2HAF A;  3BN4 A;  2Q3P A;  1S9E B;  1NKE A;  1YVF A;  1S1X B;  3JTP A;  4LQ3 A;  2DB1 A;  4TQS A;  2FB0 A;  4N77 A;  2IA0 A;  1ZAX A;  1T0T V;  1RWV B;  1UVK A;  3FBB A;  2OFG X;  1CJV B;  1N0V C;  5HLF B;  5F8I A;  3SMZ A;  1OSC A;  1WDD A;  2ZM6 J;  3ISZ A;  4FPI A;  2UXC F;  2DGW A;  3L95 X;  2J0Q D;  1BHN A;  2G4B A;  3GMG A;  4PPD A;  2HZA A;  3FK4 A;  2U2F A;  1U24 A;  2C2M B;  2HW3 A;  5KFM A;  1HWL A;  5HJX A;  1FK9 A;  1KBR A;  2F1F A;  2DNH A;  4LF6 F;  3R5G A;  5BYS A;  3ZZT A;  4MIW A;  4UQG A;  5BR8 J;  3BV8 A;  2PMZ D;  1RP5 A;  4ER8 A;  4DV0 J;  5CXT A;  2KH9 A;  4GVB A;  1NPK A;  1XNR F;  4XAK A;  2GVD B;  4OMF G;  1F9F A;  3U02 A;  5BYR A;  4OJG A;  2B8P A;  1JIH A;  3V4I B;  3IAS 9;  4ZHR A;  1LXN A;  3JTN A;  3KDO A;  1CSJ A;  4PR6 A;  4MJK A;  4OV1 A;  2CPD A;  1HKA A;  3NGR A;  2HFU A;  4HKQ A;  2HBR B;  5CHC B;  4F67 A;  5E33 A;  5HMW A;  4ED2 A;  2NR0 A;  3BGF A;  4K4S A;  3OTO F;  2DGT A;  5FDL B;  5JMN A;  2VUG A;  4FF1 A;  3N6L A;  1CLF A;  3ITH A;  4R5P A;  2HHP A;  2J8A A;  4C3K A;  1F5C A;  3DLE A;  3SCI E;  2PII A;  3K89 A;  3LP2 B;  4ILR A;  1YI2 S;  3MPW A;  3RBX A;  3UCG A;  3FEY B;  2C3M A;  5L46 A;  4ZCM A;  2MPU A;  4ZVO B;  3FUY A;  1N33 J;  4NLV A;  1YSJ A;  5HO4 A;  3VHQ A;  2HND B;  2VOD A;  2Z2L A;  1U1Q A;  2GMJ A;  1TV6 A;  4I2P B;  2ZD1 A;  2VA3 A;  1U8W A;  3EDQ B;  4D3G A;  2V8D A;  3R1H A;  4O3N A;  1P6T A;  3R1L A;  2J6S A;  1EKR A;  5ETP A;  1RK8 A;  4L3K A;  2AJQ A;  2PI5 A;  3BQ1 A;  4OHZ A;  3I5B A;  4LQ9 A;  3W5X A;  3L09 A;  3HUL A;  3C8Y A;  1MRO B;  4ELT A;  4DV5 J;  4FKX A;  1LW2 A;  1S9F A;  3N6N A;  5E41 A;  1R8C A;  2DHG A;  2NXN A;  2OPQ A;  5HL7 Q;  1IKX A;  4QWB A;  2EFV A;  1KHW A;  5EX0 A;  4NA3 A;  1N5V A;  3Q8P B;  1S1U B;  2ZWO A;  4NLQ A;  1REV B;  4CT8 A;  3QJJ A;  5ETM A;  3QO9 A;  1MU2 A;  2RIJ A;  2VH7 A;  2GAH C;  4HAC B;  4MH8 A;  1DQ8 A;  4QIV A;  5KG0 A;  3G82 A;  4PQA A;  5AXN A;  4PG5 A;  2CPI A;  3THP A;  3QIP B;  4CO1 A;  4DFJ A;  2MY7 A;  1HL6 A;  4LIW A;  1CS4 A;  3C16 A;  3QRQ A;  3NEK A;  4DZD A;  2OEJ A;  4DV1 F;  2LKZ A;  1M1G A;  3C66 A;  2UXB F;  1WC6 A;  2AKW B;  2ROG A;  2J9D A;  4HHJ A;  4B9N A;  2R7O A;  1TL7 B;  1B7F A;  1PC4 A;  3PKY A;  4N8N A;  5LSL A;  1KQG B;  1U25 A;  2D3O 1;  3EM1 A;  3PYE A;  4DUT A;  2L9W A;  1SV5 A;  2R7R A;  2O3D A;  2Z56 B;  3QAU A;  2LXU A;  1HA1 A;  4CYU A;  2EVZ A;  4LSL B;  5GVQ A;  2X1A A;  3T5J A;  2RUS A;  3DRS A;  2JEI A;  1Q4R A;  4KO0 A;  1BD6 A;  5HRO A;  1URR A;  2ZH3 A;  4IO1 A;  1ZPV A;  5EGY A;  2JLF A;  3LQV A;  1VQK S;  3DOK B;  4H4K C;  1WHV A;  2XQC A;  5GAH U;  5KFA A;  1HFE L;  2ZVI A;  3D6H B;  4F50 A;  4B3O A;  4LFB F;  2NSC A;  2ZKU A;  1UPP A;  3I4P A;  1TFW A;  1NAQ A;  4Y00 A;  3FMW A;  3IM9 A;  1BMQ B;  1Z2L A;  5KFN A;  1D1U A;  1AFJ A;  3RR7 A;  1RA6 A;  5A8R B;  3R6G B;  1FT8 A;  2FVS A;  2I38 A;  3P49 B;  2Y8Y A;  3CTR A;  3VCD A;  2XI3 A;  4J9R A;  3DDK A;  3EPG A;  1RTJ A;  1UEV A;  3V6K A;  1RT5 A;  1B0P A;  2OML A;  5HBM B;  1RU2 A;  3GV7 B;  4OIX A;  3AOC A;  5ETN A;  1IKY B;  4FKY A;  1H2U X;  4P10 A;  5K5M A;  5GAD I;  3OQ2 A;  4DV3 J;  4F8R A;  2YNG B;  1HBN B;  3T1H J;  2GJ2 A;  2R4F A;  4Z2X A;  3CCU S;  3IR7 B;  5B0A A;  4RWX A;  1NZ8 A;  4LF4 F;  1V3Z A;  3CJ0 A;  3FVY A;  5H9E K;  3JSY A;  2HG4 A;  3I5A A;  2DGX A;  1MW7 A;  1IM4 A;  2Z58 B;  4BC9 A;  2HMI A;  4RBT A;  1HBU A;  4MK8 A;  3R97 A;  5IV4 A;  1YIJ S;  1O5J A;  4IDK A;  1PYT A;  3OBI A;  4GKK J;  2ZHB A;  5KFO A;  4ZIW A;  4ZKA A;  4JV5 F;  3E8O A;  2EC0 A;  4NZ6 A;  2BAN B;  1I6J A;  5EN1 A;  4C2M A;  1VJW A;  1WF1 A;  3CIZ A;  3KHH A;  2VG6 B;  3IM8 A;  3EZU A;  4ZJQ A;  1ZH5 A;  3CD0 A;  4MYT A;  2R2U A;  4O3R A;  4XTT A;  5KFS A;  2GC8 A;  1W2B R;  5KG7 A;  2E5L J;  1EZZ B;  4YOE A;  4LR8 A;  1WTF A;  4P74 A;  1N52 B;  2Q66 A;  1UWB B;  2WAQ D;  1F1B B;  1T9X A;  2BMB A;  4M5N A;  2XHW A;  4OYM A;  4C0B A;  3MPD A;  3CUN A;  4JI3 J;  1ICE B;  3MEK A;  1RWW B;  4K5S A;  4ID5 B;  2CWK A;  4YY3 F;  3MM7 A;  1QUV A;  1S5Z A;  3U1N A;  3K8W A;  5LM7 E;  1NSK L;  2BXJ A;  1VJQ A;  1HYS B;  1VC5 A;  1RT6 B;  2HS3 A;  2IAJ A;  4ED1 A;  2WBR A;  4WU3 A;  1JB0 C;  4N56 A;  2DNG A;  2XMW A;  3RW6 A;  1AB8 A;  3KLI B;  2XLI A;  2Z2Z A;  2AWZ A;  2ZOF A;  3PJ9 A;  4W98 A;  2X1B A;  3U1M A;  5IWA J;  4RNO A;  2LMI A;  4RW8 B;  4YR2 A;  3TAP A;  4C8N A;  4J91 A;  2W2Q P;  2UUC F;  1JLB B;  1HNZ J;  4JI8 F;  1R0A A;  3JAM Y;  2RQM A;  5C42 B;  1RU1 A;  2DK2 A;  3OXG A;  4WU2 A;  2HRU A;  4QU7 A;  3TYT A;  1TMM A;  5IC6 B;  1RE1 B;  1B0V A;  4DR2 F;  3OLA A;  2BJ7 A;  3MUT P;  4KH0 B;  4L6V 3;  1U1O A;  4DUZ J;  3PYG A;  2OO4 A;  4JI7 J;  3DOM B;  4M5K A;  2BR0 A;  1ZZF A;  2DNL A;  4I69 A;  3OHA A;  2CJK A;  3NP5 A;  1H72 C;  4MMO A;  2FQQ B;  1CEZ A;  4WZM A;  2D74 B;  2R7U A;  1S59 A;  4LR9 A;  4ZJO A;  1KOO A;  2QT7 A;  4UZC A;  2N82 B;  3KLF A;  3GQC A;  2B5J B;  3HMJ G;  1NJI T;  3D7S B;  3H2U B;  3GTY X;  5BJR A;  5J2P B;  4ERD A;  2JNJ A;  5KFF A;  3CCJ S;  3KUE A;  2CVE A;  3HVW A;  4OX6 A;  4YHH J;  2DCU B;  4B9T A;  2QRR A;  3CD6 S;  3UD4 P;  1AFI A;  2ZOG A;  1JKH B;  5J2M A;  4DN9 A;  1YZ6 A;  1G7C B;  2XMT A;  3UDE A;  5LXY A;  4LRE A;  3M8R A;  3CT9 A;  4HHH A;  4Y2A A;  4X4U A;  1YBT A;  2PC6 A;  2HGL A;  2HQC A;  5L1L A;  3MMA B;  2E7X A;  3V81 A;  1XWL A;  4ZPV R;  5LT5 A;  3RBZ A;  1EET B;  4I7F B;  4GC7 A;  2FUG 9;  2DVI A;  3OJS A;  1Z2Z A;  4M5J A;  1XNQ J;  3M32 A;  3CC7 S;  2JLE A;  2YTC A;  2VQE J;  3ZO7 A;  4RU2 A;  2VKR A;  3X1L B;  1DAR A;  3EXC X;  4DV4 J;  3CDW A;  3GYG A;  4RUH A;  2DRB A;  5GAH I;  5C25 B;  1X31 C;  1KTQ A;  2JEJ A;  3NWR A;  2FTR A;  3QFH A;  1UP1 A;  3QJP A;  2V2V A;  2HWT A;  3HVT A;  3CJT A;  2UUB F;  3LW5 C;  3H98 A;  2DGQ A;  5B0E A;  2G0I A;  2JH3 A;  4EUV A;  4KGV B;  2FJA B;  4KHP F;  3MED B;  3UN5 A;  4DS4 A;  4QCL A;  1DBD A;  3CC2 S;  2W4D A;  4JI1 J;  1LWE A;  2HQ3 A;  2E1A A;  2GIF A;  3CPW R;  4DQR A;  3CCM S;  4YFU A;  1KQK A;  4JI4 F;  4L72 B;  5FLX Y;  3OTB A;  1KC8 T;  2IC3 B;  3R7B B;  3MR2 A;  1AUD A;  1N5Y A;  1HWU A;  5GMK a;  1D3W A;  1FO1 A;  4NLU A;  2M4M A;  4U96 A;  4A48 A;  1NKC A;  4J7C A;  1JK9 B;  1B0T A;  2RF2 A;  4LF7 J;  5CAB A;  2M8H A;  2N7C A;  4PKD B;  3TZW A;  2O01 C;  4DX5 A;  1TKZ B;  4E8U A;  1IR0 A;  4RR5 A;  3RW7 A;  1GEH A;  2UU9 F;  2WK4 A;  2V2Z A;  2LQ9 A;  4OHX A;  3SSR A;  1H3D A;  3MEG A;  4AXI A;  4HH1 A;  2YXL A;  4ZVE A;  1U1R A;  2WB4 A;  1KRP A;  1UAW A;  3OUY B;  1C0U B;  1WOP A;  2AEM A;  3O44 A;  4PUO A;  4EYI B;  2OTJ S;  1VFJ A;  2HUR A;  3ICL A;  1TL5 A;  4Y28 C;  4DUY F;  3MCO A;  3H2L A;  2LEB A;  1ZYQ A;  4O3S A;  3ZZP A;  1NBE B;  2BJ1 A;  2BX6 A;  2BJE A;  4FF2 A;  3M7V A;  3QT7 A;  2AJ0 A;  2H9Z A;  2DH9 A;  2OJ3 A;  1SH2 A;  4E98 A;  4DV7 F;  1FJG F;  2VG7 A;  2IHR 1;  1RCO B;  4KGZ B;  3BDE A;  4RX6 A;  2NPF A;  2VIC A;  3MCS A;  2OHD A;  3GIM A;  4C8K A;  3RRK A;  3CMQ A;  3K17 A;  2FLL A;  2DD8 S;  1KEK A;  4B9S A;  1S0N A;  1FKO A;  4EEY A;  3GU0 A;  2FJD B;  2CQ0 A;  1WI6 A;  4QPX A;  3B6B A;  4QYZ K;  4I64 A;  3QLH A;  2XY6 A;  2A6M A;  2W9A A;  5DG9 A;  3LWL A;  3V5R A;  4IR9 A;  2BUN A;  1TK8 A;  3PV8 A;  3N6M A;  2AF6 A;  2YH1 A;  3TNV A;  5B7W A;  1VIX A;  3CVK A;  1TUG B;  3FNN A;  4B3S F;  3PJW A;  4A46 A;  4ENO A;  4RBU A;  2V8P A;  3HSD A;  4J9O A;  4CM0 A;  2FVC A;  2AGP A;  4G6V B;  1HWK A;  2BYC A;  4ILM A;  1VQ8 S;  3PKM A;  3PCO B;  5D0E A; 
#chains in the Genus database with same CATH homology
 1N36 J;  4JI8 J;  4JI1 J;  4JI5 J;  5LMN J;  4KHP J;  4X65 J;  1N32 J;  2UXD J;  2MEW A;  2ZM6 J;  4JI2 J;  3R2D J;  4DUY J;  4DV3 J;  4B3T J;  2KL8 A;  4JI3 J;  4LFC J;  1IBM J;  3T1H J;  4DUZ J;  4KY3 A;  2UUA J;  4JI7 J;  4DR2 J;  3OTO J;  2MTL A;  2VQF J;  2UXC J;  3T1Y J;  4JI4 J;  4PWW A;  4V1A k;  1HNW J;  4X62 J;  3D3B J;  4DR6 J;  3J81 U;  4DV6 J;  3IMQ J;  5LM7 E;  4DV7 J;  3JAM U;  1IBK J;  4YY3 J;  5FLX U;  4DR3 J;  1FJG J;  5IT9 U;  4OX9 J;  4GKJ J;  5AJ3 J;  2HHH J;  4LF4 J;  3R2C J;  2F4V J;  1XNQ J;  4LF9 J;  2VQE J;  5BR8 J;  1N33 J;  4X66 J;  4LF6 J;  4DV4 J;  4JI0 J;  4LFA J;  4B3R J;  4DV0 J;  4DR4 J;  4LF7 J;  4DR5 J;  3W1Y C;  4LF8 J;  4LFB J;  4GKK J;  4HHU A;  4NXN J;  2KVQ E;  4JYA J;  4KYZ A;  5LMU J;  1IBL J;  4DV1 J;  1HR0 J;  1XNR J;  4JI6 J;  4X64 J;  5IWA J;  4RJV A;  4JV5 J;  4AQY J;  4NEZ A;  2UXB J;  4NEY A;  1I94 J;  1J5E J;  3D3C J;  2UU9 J;  4NXM J;  4B3S J;  4LF5 J;  4DR7 J;  2MQ8 A;  1HNX J;  3J80 U;  1XMO J;  3J7A N;  1HNZ J;  4B3M J;  5A2Q U;  4DV5 J;  4YHH J;  2E5L J;  1N34 J;  2UUB J;  4DV2 J;  1XMQ J;  4K0K J;  4DR1 J;  2UUC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...