5IWAJ

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the ge81112 peptide antibiotic
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S2
publication title Inhibition of translation initiation complex formation by GE81112 unravels a 16S rRNA structural switch involved in P-site decoding.
pubmed doi rcsb
molecule tags Translation
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 5iwaJ00
4DV1J 1XMQJ 1XNQJ 4LFCJ 2F4VJ 4YY3J 3W1YC 4KY3A 3J81U 3OTOJ 5LMUJ 4DR5J 1IBKJ 2KVQE 1N36J 4DV2J 1N33J 4JI0J 2KL8A 2UU9J 4LF5J 4LF7J 2UUAJ 4LF9J 4NEZA 4RJVA 4YHHJ 4X62J 4JI4J 4DV7J 2E5LJ 4X66J 4AQYJ 4LF4J 4DR4J 4JI5J 4B3RJ 4DV4J 2HHHJ 4NXNJ 4PWWA 1J5EJ 1HNZJ 4DR1J 2VQFJ 1I94J 1XNRJ 3JAMU 1IBLJ 5FLXU 4DR2J 3J80U 3T1HJ 4JV5J 4DUYJ 4B3MJ 3IMQJ 2UXBJ 4B3SJ 3R2DJ 3J7AN 3T1YJ 4LF6J 2MQ8A 1XMOJ 5A2QU 4DR6J 2UXDJ 4JI2J 3R2CJ 4B3TJ 1N34J 5AJ3J 4K0KJ 2MTLA 4GKKJ 4OX9J 4JI1J 3D3CJ 5BR8J 4JYAJ 1HNXJ 5IWAJ 4JI6J 4JI3J 2MEWA 2ZM6J 4LFBJ 4GKJJ 4X65J 4HHUA 4NXMJ 4DR3J 1IBMJ 1N32J 5LMNJ 5LM7E 4DV0J 1HR0J 4X64J 2VQEJ 5IT9U 4DV3J 4DV6J 4DR7J 2UXCJ 4JI8J 4NEYA 4KYZA 2UUBJ 1FJGJ 4KHPJ 4DV5J 3D3BJ 4DUZJ 2UUCJ 4LF8J 4JI7J 4LFAJ 4V1Ak 1HNWJ
chains in the Genus database with same CATH superfamily
4JBCA 1FJCA 1C4CA 5F8LA 2JNJA 3RB0A 2EC2A 4ZCLA 4CNYA 3FEXB 5B09A 2AJ1A 3I6PA 3ZFVA 1RKIA 4ECUA 3TQEA 3EX7B 3N5BA 2VFVA 5GMKa 5DLGA 4E2FB 4DLGA 4ER8A 1VQ6S 4JI5J 2BJDA 2GHVC 1RHMB 3QIPA 3MUVP 3CC7S 4Q44A 1KLNA 4ZHRA 2QSWA 4PYDA 1HLWA 2DGVA 2VPXB 5KFEA 1D8ZA 4DHVA 1WWHA 3IAS9 1F60B 2Z57B 1TV6B 5KFOA 4YFUA 1M5KC 3PFEA 2FQQB 4WFXA 4M5JA 1S7IA 3IFEA 2V4JB 1HBUA 4IFVB 1N32J 2R2TA 4TLRA 2PMHA 4KHPJ 4GKKF 1X7VA 3MGJA 3HD1A 2HGNA 3FUYA 4RZRA 5BR8F 4ZJQA 2QSFA 2LA6A 1ZM4A 3GTYX 5DJBA 1RSCA 3H90A 3QRRA 5EUHA 4IR1A 2GQCA 1NDCA 4KHMA 2DY1A 4MT1A 1KNZA 3T9NA 3P6YC 4JV0A 2WVBA 3G86A 4C9DA 3PIOQ 4ECWA 1RAEB 2Y8YA 1LOUA 4USKA 2DR5A 4JI4J 2KJVA 2K1RB 1T9UA 6AT1B 1DTTA 3MR5A 4DSFA 2XS2A 4LSLB 2XY6A 1NSKL 1JLAB 5BJRA 2CAJA 2K2PA 4ANCA 2XLJA 2CNLB 3HO1A 1IM4A 4HI1A 2MJNA 2CQPA 1VISA 2JVRA 1CC8A 1IKXB 3EE3A 1X4HA 4JI1J 1KLMA 2HFVA 2YNHB 5H9EK 2B7CB 2A2DA 1GXTA 2J6TA 1X5PA 5F0WA 4RW7B 4FPRA 3AQOA 5L9XA 4IDKB 4GC7A 3RB6A 5GAGI 2ROEA 2YWFA 1RU2A 1N5YB 1MU2B 4C8MA 2CNOB 3W65A 1NK6A 5F8HA 3WIUA 4WTOB 3W2WA 4K4ZA 3V2UC 3NNHA 3GWCA 5LSRA 3K5MA 4WKYA 1RHKB 4UQGA 4PCQA 9ATCB 3EXYA 2UV8G 3BQ0A 1R0BG 2RMLA 1YJVA 4A8KA 1X9WA 1AROP 1KSPA 4H4OA 1XNRJ 3IA0A 4ETZA 2LQ9A 2UVUA 2VG7A 2R8KA 4O4RA 3MM5A 4ZVRB 3FRYA 5K8NA 2HEKA 1V3ZA 5KG0A 3WX4A 1GEHA 2UXDJ 5AE3A 1H6KX 2W2MP 1DLOA 2V67A 5F8MA 3G2XA 2NZCA 1FFSB 4CLPA 2YY3A 1CJUA 3IRWP 1YVFA 1YJTA 2XO6A 4CIOA 3MMAA 1NXIA 4K4WA 3R7NB 3NNAA 1FDDA 4NLXA 2U2FA 1Q8LA 1UJ4A 1IKWA 3IXQA 2AZ1A 2H54B 1Z1ZA 1LEOA 2MB0B 3PXGa 2MQLA 3AB4B 2DO4A 3MAHA 4L72B 4C4WA 2QIFA 1K73T 2GGPA 2Y1LB 1X4DA 1RADB 1F9HA 1ZPVA 1JLBA 1LFWA 3QO9B 1YI2S 2A1BA 2HQIA 3PYFA 3CCUS 3UW1A 1L3KA 3R6GB 2KXNB 1X4EA 1PSDA 4HVZA 4ZVTB 2OPPB 2ZD1A 3UVJA 5EX3A 1XMOJ 5A2QU 4CZCA 1TFYA 3NS5A 3UN3A 2KG1A 3UR3C 1FKAF 4PZVA 2RB7A 5ETSA 1AW0A 5KG5A 2WB4A 4KH1B 3K7RA 3UO0A 3KMQA 1WOPA 4RNMA 3KXDA 1Q8BA 5C2GA 4ED3A 3VQSA 3THPA 3HVWA 1NJZA 2FVSA 2GX8A 2HWIA 1QSYA 3C46A 2FZCB 3D3BJ 5L1LA 2J9DA 4DLEA 5H9FJ 3TEHB 3ZXWA 1BMQB 4ED2A 1F3VA 1U0SA 5KFNA 1P1TA 2L3MA 1NZAA 4UF4A 5IT9Y 2VA3A 3CDAA 2CJQA 2D3ZA 1WC5A 1CS4A 5K8MA 4WFNQ 4CO3A 4C97A 4AFFA 3TEGA 3QAEA 3QLHB 3C6UA 4ANEA 3C6TA 3MEGA 1NMEB 3WC0A 4ZPAA 5KOWA 1LW0B 1RQ0A 2Z56B 3B8HA 3TA2A 2E5IA 5HO4A 1HQEB 1U7LA 4NRTA 2B3TB 2HNYA 4OYAA 5E33A 4B3SF 5IM0B 3T1YF 3PW5A 2P6SA 1Z4UA 4IG0B 5HK4A 1LW2B 4LBHA 1H7WA 3KK1A 2QA4G 3O44A 1VK8A 2HBRB 4USWA 1JJHA 1REGX 1DQ9A 1OPIA 3IBFB 2XMTA 3KJFB 3OTBA 5JUMA 5F0UA 4LBPA 3TARA 2YVSA 1HBNB 3Q0AA 2XGPA 2DNYA 1REVA 3N9UC 5ITHA 1XNQF 4KAIA 1KS2A 3I0RA 3SQGA 2K06A 3UDLA 2KVIA 2HLUA 1WI8A 1GMWD 1VQLS 1V9OA 1R8HA 4NLRA 2KH9A 2VG6A 1IM6A 2FIUA 2OFGX 2JH3A 3ET6B 5AJ3J 4R8UA 1J27A 3BZQA 2YKNB 1HNZF 2YKMB 1U8WA 3D2WA 2E1PA 2HQ3A 4OZLA 2JOQA 2I5JB 4DCOB 2P5VA 4ZJLA 1HNXJ 2KT3A 4LR7A 1HIYA 1XIQA 2JJ4D 3CE8A 3KTQA 1A6LA 4EBDA 2Q6CA 5A8RA 3O8WA 2ZJRQ 4EO8A 3HI9A 1Q8IA 4DV5J 5J2MA 4FVMA 5CXTA 4LF8J 1KQFB 4ZIWA 1VYAA 3OFEA 1HPZA 4DDFA 5K14B 1KVIA 3VHQA 1VQ5S 3CXCR 4HI2A 5AE1A 1IQZA 3PCOB 4JI7F 3VAGA 3DXBA 4X62J 2QFIA 4Q0BA 4OHWA 4K2JA 5CAAA 1B4SA 5HATA 2PGCA 1CG2A 3KJVA 2ZBRA 1B0TA 5D78A 2C2EA 2HRYA 1TAUA 4BHQA 3J7A1 2ZH9A 2WOMA 1F6TA 2M8DB 2RDDA 3WQPA 2X1FA 2DJWA 4JI2J 2NREA 4MIBA 1WTFA 5I42B 2LEBA 4LIRA 3CD5A 3IM8A 2DNLA 4F4WA 1ZOTA 4DMZA 4LF5F 3M2RA 2DGWA 2VASA 2VBZA 4KGKA 4I2QA 3SSQA 4DZDA 1SC4B 5M2RA 4N56A 4NXNF 1KHVA 5AE2A 3W7BA 2AGOA 1QAIA 1XR5A 3BO2A 3FCHA 4H4MA 3CCES 1RT4B 1V6HA 4LFBF 2FHJD 3PACA 2XEXA 3ZZRA 2LQJA 4DPXA 4IQMA 5HROA 2XMVA 1X5TA 2EG2A 4NE9C 1N88A 3M8PB 4ZVQB 4K59A 2HIQA 3ILOA 3KHHA 5U47A 1FD8A 4K8RA 3M30A 2ASYA 3LA0A 4LF4J 3DHWC 5E3RA 5CQGA 1T9TA 3J7YU 2DIUA 2P9GA 3PY8A 2HHUA 3T9ZA 3GFZA 3PO5A 1AFJA 3OTEA 1ELOA 3D6FB 3IMQJ 2VHGA 4CLLA 1YIJS 3HVTB 4GRSA 2YBVA 3M1VB 4DX8H 1NUEA 1BUXA 3MM9B 3V6HA 3DYAA 1J5EF 5K9FA 2IBKA 4PEOA 2UP1A 1IBLF 4OHVA 1LXJA 3NOGA 3MOZA 4RWXA 1JX4A 2HHQA 3KK2B 1S1TA 2LU1A 2JDJA 5EWGA 4B3OA 4ID5B 5THWA 2ZBPA 3TANA 3C16A 1RAHB 1RTJB 4PG4A 3KG1A 2XMAA 3BQ2A 3IN5A 3PX0A 3NS7B 3GP9A 3CCVS 1RCXB 1B7FA 3FFIA 5E0OA 4UUWA 4J9OA 1M1GA 3TZXA 1AZSB 1MLAA 3F56A 2H5EA 5I3PA 3L95X 4LF7J 3MF5A 3GR1A 4DF8A 3CJKB 4JV1A 1ZM3A 1QJHA 2GIRA 5HP1B 1YTYA 3CD0A 4OX7A 4DR1J 2RF2A 3HSZA 2QGFB 3JXOA 2LEAA 2B51A 4NPOA 1T3NA 3BGUA 4QIVA 2L41A 2FVPA 1FKOB 1U6ZA 2JX2A 5B08A 4A8SA 1MROA 4C3MA 1P9QC 3MFHA 3QJLA 3EWGA 1UKUA 2OI2A 1YX2A 2V5HG 4X65J 4O3NA 4P73A 2OKQA 2GQ2A 5KG7A 5HI7A 2W7OA 3T6JA 3W9JA 1SB6A 3AXKA 1NK9A 3SSSA 2OHDA 4OFZA 1UPMB 4B3MF 4IOCQ 4DG1B 3V4IB 3CTRA 1FO1A 2DHGA 2ZDPA 3OTOJ 2HFZA 4ZVGA 5DQGA 2RDIA 4DS4A 5CCMA 4JI8F 2C2OB 3G8SA 3QFHA 1U47A 1GFWB 2PDAA 2IC3A 3BO3A 4O44B 3OJSA 2WONA 5D0GA 5A8WA 1S99A 2HHWA 2Z30B 1NAQA 5KG1A 1NSPA 2OUGA 3SMZA 1UW4A 5C24B 3E8OA 3P8BB 2JWNA 1RTIA 1SKSA 1GT8A 2EW9A 3EMTA 3POTA 1VQNS 2DB1A 5CYMA 4RX6A 1CQMA 2OO4A 2JFDA 1B0PA 1FK9B 1VIOA 1Z2ZA 5B0BA 4JI3J 3A3NB 2RQMA 1UW9A 3PFOA 3W9IA 5D3GA 3HHKA 3DI6B 1PGZA 5KFKA 2CQ4A 4OX9F 3RJMB 2W9BB 4DX6A 3HKWA 2OMOA 1R89A 4ECZA 1ZAXA 3H59A 4NX9A 2IRXA 1HBOA 2V68A 1RWKB 2AYBA 1WOSA 1YJ9S 4F4ZA 4KH0B 2POKA 2GJFA 2WZ1A 4YY3F 5DO2A 3B4DA 3AB2B 1H2UX 2A10A 2QLXA 3AOCA 3RW6A 2JC1A 5DZ7A 4FBTA 4AL5A 3BV8A 2GMJA 4QW9A 4ED0A 4NLDA 4XPEA 1S6QB 1VQ9S 2AYEA 4LFCF 1U1QA 1FESA 4J37A 4NLSA 3V6DB 4NCAA 1FERA 1TL1A 3OVBA 5CABA 3OUYA 2O3DA 1PYOB 2H51B 1Q0NA 4B3TF 4FN5A 1HR0J 2Q79A 3M6VA 2Y1JA 3ILIA 2PEHA 4PXCA 2FPHX 2FVRA 3M9OB 2LXIA 5KFPA 3PX6A 3U02A 2MQOA 3VAIA 1FRMA 4EBEA 1UJ6A 3KHLA 1IBMF 1HQ2A 3VGVA 3J7ZT 4NLQA 4EZ6A 5F8GA 4NWBA 1VQSA 2QE5A 3K5OA 1EJ7L 2HVZA 3JSYA 3FEZA 4IFYB 3EZ5A 2AIRB 2EFGA 1RT5A 4OHZA 2VD3A 2ZC3A 1IN0A 4DR5F 2YWKA 1X4AA 1RWPB 1T7PA 2W4CA 1T9VA 3LGHA 1JXLA 2IY5B 4F3QA 3UR0A 2DHSA 3L9ZA 4OI2A 3T5KA 2CPHA 4ITSA 3RYLA 4N76A 4GKKJ 2ZE2A 5BR8J 2XI3A 4ZCIA 2HVIA 3WC2A 2QRRA 3EXCX 3I9V9 1L5UA 5K8PA 2DGUA 2H5IB 1F9FA 1DURA 5DETA 3L3CA 1VJWA 3DKDA 5FDLB 2ZHAA 3C15A 3G6YA 4NA2A 1JLEB 4X4QA 2FJDB 3NKYA 4XDCA 3G8QA 2N7CA 2QL5B 2FHOB 4WE1B 4FPIA 2E5HA 3THVA 4FXDA 1XR7A 1SIZA 1J5OA 2CJXB 2OEMA 2HNZB 2B5JA 1WOOA 3NLCA 4X4OA 3BN4A 2R8HA 2RU3A 2JLFA 3SQOP 2Q1LA 4PWDB 2U1AA 1R8CA 1IJEB 4CCHA 4LRCA 1WHWA 1R8PA 1U0HB 2DNRA 1SJ3P 3TAPA 3T41A 3MURP 3TNVA 3GQCA 5D4LA 3UD3P 3NRBA 1PJ6A 2PFFB 5DGAA 1GAOA 2WSCC 2ASLA 2A6OA 4CRJA 3BEGB 3QYYA 4LRBA 3HFKA 1U1MA 4PG6A 2MEWA 4B9TA 2CJYB 1N5VA 2XULA 1VI7A 4HT5A 2DTJA 3ZZPA 1VFJA 3CUNA 3PEJA 4CO1A 4F0MA 2DPIA 2CJ9A 1JMTA 3I31A 2KM8C 2CZVC 3PRVA 4WYWA 3AOAA 4ZP9A 2QZ8A 1SJQA 2HGLA 1WF0A 1D9AA 2VPYB 3AHPA 2VG5A 4KKOA 3NGKA 3DRRA 3D6MB 3VQTA 3L4BC 2AQ4A 3A8JA 2L48A 3W64A 4IRDA 3MCMA 4NRUA 4YP3A 2Q66A 1S9FA 2YNIA 4I6YA 2MY7A 1VRTB 3R5JB 5JVGQ 2N3OA 8AT1B 5HLFB 5A6PA 4JI0F 1IWGA 5J1EB 3Q83A 3DRRB 2K7JA 1TELA 5D8HB 2KN4A 4B9SA 1S0OA 3SZ2A 1WDTA 1IKYB 3QMQA 2OTLS 2NUUG 4NMXA 1RWUA 1TU0B 2DBBA 2ZWOA 5J2PA 4QR2A 1RTDB 3W3SA 1TMJA 3S6EA 2RKIA 3MPYA 1X60A 2DKOB 2OSRA 3IWLA 1JLCA 3U7JA 3MPDA 1IWAA 3DRSA 2Z2YB 4M8LA 5KTQA 3GJRB 3ILJA 3BGLA 1TL5A 1Z2LA 2X7IA 3DRXA 2CVIA 4YDDB 2UXCF 1RBLA 2RKIB 3JTOA 3T5JA 1X0PA 2B4OA 2E1RA 4Q2MA 1QDUB 2R8IA 2G2YA 1I1GA 4QWAA 2AX1A 3P5BP 3Q8YA 2MZQA 4FDFA 3IG1A 3W9HA 4KRWA 3J81Y 1TAQA 1V3RA 1GNKA 2MKHA 3GLJA 3GIMA 3PR4A 4Z7YA 2BW2A 2RVJA 3R27A 2DGQA 3P96A 4LQ9A 4X4TA 1TKXA 4KJIA 3D66A 1V5VA 3FKBA 4G1QB 2YXLA 4LR9A 1ZA1B 3G6XA 5H9EJ 1SV5A 1WG4A 3TUIC 2RILA 2DRDA 3KLGB 1LWEA 2BE9B 1B7YB 1HQUA 5KFXA 5T14A 1I94F 4LF2A 1Y5LB 4P71A 5J2NA 3DOLA 5L1JA 1YWXA 3J7YI 5AT1B 3MM7B 2CWKA 4ZN1A 3OVAA 3HZGA 1DQAA 2V4QA 1NSAA 3VR1A 5D0EA 1SUQB 1RYSA 5KG2A 2DNKA 1Q5YA 2KT2A 4E0DA 1QVGR 4QIWD 2C1EB 2YWEA 1T02A 2YKAA 1KOHA 4GC6A 5AXMA 2HW3A 1TKZA 4QYZK 2BM0A 3OR1A 4ERDA 4B3SJ 1G2EA 2R8JA 3T1YJ 3JYTB 1GMWA 5F9LA 1HHTP 1W7WA 3MD1A 1K1SA 2AW0A 3CCTA 2KHCA 1J2VA 4CLYA 3ZTOA 1E6YA 1SL2A 1O8BA 1UZDA 3DM2A 1YKWA 4L74A 2FLNA 2CQ0A 5M2PA 3T5LA 1QAJA 2G9OA 1NU4A 3LALA 3D6HB 3EDRB 3I55S 4ZLNA 4B17A 3FNNA 4DWIA 1E6YB 2BACA 4CTAB 1RWWB 3MMCA 1VQPS 3M32A 4DX7A 4PXDA 4HDHA 1YZ6A 1KN6A 4LQ3A 4WPAA 1CPZA 1XNQJ 2BJ1A 2HG4A 3TJAA 3TZYA 2LQBA 4UW2A 2HVHA 3HHDA 2QLWA 4Y6IA 2J0SD 4PR6A 4DU7A 2YX4A 1KDNA 4C7QA 1HNZJ 2ZUGA 2J7UA 4H4KC 1UWBB 1VMBA 4ZKAA 2DD8S 4M5DA 1WDDA 1D3WA 1RJJA 1HWUA 1N5TA 1SKRA 2C28A 2VODA 2C42A 2DK2A 5EDWA 1WELA 3M2VB 1S6PB 2HBYB 1K1QA 4TNOA 5C5JA 2DNMA 4I7FA 2VF3A 1KQKA 1YJUA 1TZ0A 2RT3A 5IV3A 4HACB 4USMA 5GMEA 3M8QB 3M8RA 1NDLA 4L6V3 1RTZA 5BXIA 1RU1A 3CCMS 3V4MA 1DHMA 4S0MA 4DR2F 2CPJA 4JI7J 1HWIA 4MH8A 1H2VZ 3PEHA 4M5MA 4NLGA 2FD2A 1S1UA 3W1YC 3X1LB 4I56A 3ZZOA 4DR7F 4WJBA 3DFEA 3VZIA 1SL1A 2W24A 2ALZA 2CPIA 4GKJF 1FJ7A 3HHLB 4FYWB 2HZCA 2OPQB 1CJVB 2VDIA 3IR5B 3MMBA 2MZ1A 1NPKA 2MKYA 3VGSA 4ZVOB 4XPCA 3MPVA 3LF0A 4N8OA 2X3DA 1DAXA 2EC0A 5G4DA 4F67A 1VOMA 3E3XA 1U26A 2Z4PA 1N36F 2CIMA 2QLFB 1UJ5A 4NLUA 2HWHA 3MI7X 1TL4A 3BDPA 4LFBJ 3TW0A 2B4UA 1IJFB 4WF9Q 5IC4B 1AFIA 3SXLA 2VH7A 5IZHA 4OYIA 1UWAA 5E3AA 4NEYA 1RT3B 2CJAA 5LJ3Y 1U48A 3ZTQA 1QE1B 2KB2A 1HMVB 3BKUA 3MZIA 1SJRA 1ULRA 1WG5A 5HJYA 2W9AA 3QAUA 1P6TA 2BANA 4DV3F 1HI8A 4NCGB 3G82B 2UUCF 2R7UA 1UL3A 3R3TA 1IVZA 1SQGA 1AB8A 3KHGA 4I2PA 3Q8UA 1LWXA 2R2SA 1R0AA 1J5EJ 1IBLJ 4DPUA 4QIGA 1JB0C 3J80U 2BVZA 4PRFA 4ZDNA 2MHNA 3J80Y 4CH1A 4RW4B 2V8VA 3OXGA 3GIKA 4ZPTR 5F8JA 4TYBA 2HLTA 1ZYQA 1T05A 4UT4A 3N6LA 4NASA 5HN0A 3KDOA 4YB6A 1RWNB 5FLXY 2NYIA 4NLWA 1U24A 1TQLA 1G3OA 1FEHA 1CULB 3U1MA 2XMMA 1W25A 3TOQA 2KXFA 2CQIA 4ES2A 1M5HA 3LGMA 2GJ2A 3BBCA 1WACA 4Y3CA 1BQMB 1RP5A 3GFYA 2OSQA 1FX4A 4KB7A 1NK7A 3M6XA 1FXRA 1VGYA 3CT9A 3AQPA 1W2BR 3PO4A 3DOMB 1HYSA 2WK4A 4ZA1A 4TVAB 2W8KA 4M1KA 2GVZA 1KWMA 4ECTA 1PG5B 2ZZMA 1FRXA 1AXQA 4R0EA 1C1CB 2IA6A 2BQUA 2DRBA 5T7LA 3SFGA 2BQRA 3AY0A 4WFYA 4C11A 1KHWA 1N6QA 3PRBA 1X4CA 4CO5A 4DUYF 2UXBF 1NK0A 3QGHA 4ECQA 1IKVB 4ZK7M 2OD4A 3UN2A 4JI8J 4OI6A 2KYZA 1GXLA 1SC6A 2O66A 2VQFF 3PTWA 4TY8A 1MSWD 4CDIA 1M5VC 4ZPWR 1RT7B 3TAMB 4Q8EA 2YQ0A 2F40A 1HNWJ 1BE4A 3OD2A 2P9EA 1URRA 5ETKA 5HBMA 4YQWA 3GIIA 3EZUA 4KY3A 3BGRB 2F5GA 2IMWP 1U6FA 2B4VA 2K3KA 1NPPA 2DXEA 1HNVB 2LP4A 2AGPA 1H2TZ 1TFWA 5G0RA 1DZ5A 4URSA 5E3PA 4I1TA 1S59A 3CJRA 2AZ3A 1VJQA 3TVZA 2HNDB 1R0CB 3A8KA 2CQGA 4G65A 1N34J 5D0HA 1EQMA 4WP9A 2HURA 2FC9A 4OX9J 2BKNA 2C2ZB 1S49A 3D6TB 4P6QA 1E6VB 1MW7A 5I3QA 2BDPA 1RT2B 5KFFA 2H5JB 2C3MA 4QPTA 1TL3A 4L76A 5ETQA 4OI1A 1LWFA 2DR6A 1ITPA 2I1RA 4LF1A 3ISND 2B6AA 2PEBA 5ETVA 2XY7A 4YY3J 1PKUA 4WXWA 4C8OA 3DGPB 1NKBA 1YZ7A 1VRUB 2XSJA 4ZPVR 3GV5B 4KTQA 3UDCA 4OZ3A 3S7RA 2FDNA 4DV1F 4IG3B 2DEIA 3UPFA 2XMKA 3MECA 4YOEA 5JJBA 3CJ0A 4MIWA 4YR2A 3AXMA 2E7XA 3VCDA 1S4FA 4PQUB 3C14A 3R5GA 1TL7A 3OXFA 3TX8A 4B3TJ 1VR6A 5L1KA 4WP8A 4QWCA 3FSXA 5ETMA 3QZ8A 4K0KJ 3KNGA 1TP7A 3KLFA 2CPDA 2VPZB 4DL5A 2OPRB 3WDOA 3OLAA 3WX8A 3OT9A 2E7WA 3ONQA 1MMLA 2VBWA 4WWSA 5K8OA 3OR2B 3I0SA 3JAMY 2GIFA 1IBMJ 2N82B 2XS5A 3LH2S 2A3JA 4NZ0A 2LYVA 4ENOA 2KT5A 3RR8A 3EZOA 1ZZFA 2RJZA 2LXFA 3WIVA 5C42B 3NP5A 1RT6B 3MD3A 2BE7D 2F1FA 2ZH7A 4RLEA 4PUOB 1DRZA 2SXLA 3UWTA 4DR3F 1C0TA 2W7AA 4PKDB 4ZCMA 4R0JA 4DR5J 2HFUA 2XYGB 1TVRA 4OJ3A 3ZNJ1 5HVFA 3CDUA 1R43A 1AA1B 3FJ2A 1OMSA 3BSNA 4WU3A 2ADBA 4RBUA 2PFDA 1JJ2R 1KC8T 3SCLE 1IR2A 3CCJS 1IBKF 1FTCA 1P8GA 4M63A 5KFWA 1TVRB 3T5HA 4DX5A 4CT8A 1T03A 1U1NA 3TUPA 2EVZA 2N4CA 2JFKA 4CM2A 4Y2IA 3BH6B 2MQNA 3UCZP 3C66A 2D3O1 4U7UK 2H1YA 4YB7A 4K4SA 4DL2A 1S9GB 1KR4A 2DGOA 2ZITA 2VQEJ 3K5NA 2KZZA 5D77A 3HJFA 4RUCA 4RW6B 3QWPA 2LLZA 2HRUA 3GJTB 1UA1A 1L3UA 1EAYC 2VOOA 1JLGA 2V4RA 1U2FA 2NXNA 2HHXA 2RUSA 3EM1A 3G6VA 1QY7A 3IBCB 3DRPB 2J5AA 3Q8PB 5ETNA 1MMNA 2QTWA 2CPFA 5DRKA 3RRHA 3QT7A 3LUYA 3R7BB 3J7AN 2MYFA 4KFBA 3DLGB 4RNFA 4DQIA 3UCUP 1S48A 4DV4F 4DPOA 4EFAC 1S9EA 4J7CA 2E44A 1PAEX 4R25A 3D0GE 2RAQA 5C25A 4ECSA 1PJ5A 3NG8A 2KXHA 2D7SA 3NGRA 2DPJA 3KLVA 2DGXA 4KE5A 2KM8B 4F3MA 1QM9A 4ZVFA 3MAAB 5SZTA 3RTVA 1JLFB 3DLEB 3SCJE 1KBRA 3MM6B 3MEEB 5HANA 1ROFA 3BDEA 1C4AA 3W60A 3RUBL 3K57A 2FJWA 5KFLA 2X1GA 4JI0J 2UZAA 2V8GA 2CQBA 5ADZA 1JQGA 2XC9A 2KDOA 3AA8A 1N5SA 4N77A 4C48A 4Y65A 1U25A 2IAJA 1XMQF 4TQSA 1Q95G 1XN9A 2OJ3A 2VJVA 1R27B 5CH7B 5F3ZA 2D9PA 3HHNB 1LK7A 1MN7A 1LKZA 4USHA 3KLHA 2YWHA 2LXUA 2M5YA 4LIWA 5D4PA 4A8WA 2ACMA 2BW7A 2DNNA 1HNIB 1EX8A 1BQXA 2AJ2A 5ETTA 4TU9A 3ZTRA 2OTJS 2EFOA 1O6XA 4USUA 1FNOA 2UXCJ 4PXBA 4O3QA 4Y00A 2HMIB 2D74B 2HVEA 2V9KA 2J76E 1RDRA 4MFBA 4L75A 4DPWA 4QQBA 1WKLA 3R9LA 1WKJA 3PYEA 4AD6A 1UAWA 2CQCA 2J8SA 4OYBA 1Q7YT 4C8KA 5DQIA 2JVOA 3G96A 5KT2A 1QLNA 2CZ9A 5H1SV 4ILMA 2DR7A 1MN9A 1XWLA 3GFXA 2YH0A 2E5GA 3EUNA 2ZNZA 4RW8B 2XHCA 4UQTA 1WG1A 4LF6J 5KOXA 4DCPB 3TRGA 4A8YA 2JLGA 2VIHA 4F25A 3QNWB 3GCXP 4L3NA 3I56S 4X4SA 4B9UA 3EDQB 5D15A 4LRDA 3MPUB 2PT0A 1FRIA 1GTEA 3ADAC 5SUHA 2VB6A 2BZ2A 1HL6A 5KFCA 3EYZA 2WCXA 1BQNB 1SJFA 5CCLA 3Q89A 1YITS 1S12A 3MDFA 1B64A 2ADCA 3MR3A 4ZS6A 1RABB 3PJXA 2YNGA 1K8AT 2V34A 2WSEC 3N5FA 4FXWA 2ACYA 3FBCA 1VQ4S 4KO0A 4RUHA 1D1UA 3KFWX 1MMDA 3B82A 5HMZA 1S1VA 1NKCA 2R9LA 4W90B 4HHJA 4OJGA 5I4MA 4Y2KA 2OPSA 2WVEA 5B0EA 1FKPB 1U1RA 3IP0A 2XCPA 2FHMA 1FI4A 3FC9A 4OZ5A 4DR6J 3OTCA 3VAJA 4PWUA 4EU0A 2E7VA 3I96A 3IBWA 1Q81T 4USIA 3ENQA 4XK8C 2R4FA 3OL9A 4CYUB 3MEDB 3DMJB 3FBFA 4LSNB 4OZNA 1HI0P 2C2RA 2GZOA 1RYRA 1NLKL 2EKYA 2DHHA 3D1OA 3CMQA 1SJ1A 1F3FA 3R7SB 4DPYA 1N52B 4HTJA 3RBDA 4NZ6A 4H4KA 3Q2TC 3HVAA 1TV6A 3DLBA 3FZ2A 4WIIA 4CLZA 1HKAA 1R7IA 2V4JA 3Q8SB 2RS2A 4IFVA 3DCAA 4IOAQ 2IRYA 4RPFA 3PKYA 3CULA 1VIXA 2I6WA 2HHPA 2Q3PA 3E01B 2XMUA 2NZ4A 1S0MA 2X1AA 1NB7A 2VFSA 2E5LF 1F2HA 4EYIB 2XYPB 4AT1B 3RG6A 3MM8B 1NH8A 3G4SS 3RAXA 2PIIA 5L8RC 2K1RA 1BWEA 1DTQB 4MKAA 4FYXB 4LSLA 3OSNA 2DEJA 1JLAA 5KFRA 3QATA 4DR7J 1X8DA 2PA8D 4KYZA 1V5IB 1S1XB 3KWMA 1N56A 3QWUA 1Q4RA 4DL6A 1YRTA 1NRKA 2W2OP 3JQMA 1UETA 1IKXA 1RTHB 2YNHA 4JB8B 2MGZB 3BO4A 1X9SA 5H9FK 4YDXA 2BBEA 4RW7A 1VBYA 4IDKA 3DOKB 4N8NA 3ZZTA 3M2UB 1N5YA 3PNIA 4ELVA 4QIFA 1FNXH 2YPYA 3L7OA 1MU2A 2HS3A 2V8DA 3M8SA 2CQ2A 2C2DA 2BE2B 1OS5A 2DYAA 2P2CB 5KT4A 4DV7F 1B3TA 3CMES 3LP2B 3GCWP 3BR9A 1U02A 4DF4A 4Z37A 3QGGA 1KOOA 4J9KA 2M4MA 1FF2A 4CLFA 1UVNA 4E8UA 2RU9A 2DNQA 3EPGA 3BJYA 4DV3J 1YHQS 2YKQA 2IVFB 8RUCA 3HULA 4DL3A 2UUCJ 2DGTA 2VZ9A 1R3NA 4LRFA 2UXDF 1LFPA 2M8HA 4DSJA 2QT7A 1H98A 2N3LA 1D9FA 3C2PA 4NEZA 1X0FA 2FJBB 1SVDA 2YKPA 1D9DA 5KFVA 3KLEB 3LP0B 5F8NA 2MKIA 2EK6A 4HKQA 1ZA2B 3KG0A 1R6YA 3S01A 3HZEA 2IBOA 1UFWA 2NPIA 3AD7C 1KD1T 4KHRA 1Q53A 2HKEA 4B9VA 3ZZ0A 1HBMB 4PQAA 4ES3A 3HT0A 1ZS6A 2CQ3A 3QO9A 1TK8A 3BGOP 1UVMA 1DBDA 3BPSP 2GC8A 1RT1B 2OMLA 2AEJA 4KBIA 5DG8A 1JKHB 2OPPA 3GR0A 5KFBA 1FX2A 4C8NA 2VKZG 1Y11A 5E2QA 2BA9A 2KHDA 5IWAF 4DSEA 3BN7A 5A8KB 1RAJA 3U1NA 1HW9A 2MJUA 1Y9OA 5HMWA 3A8IA 2D41A 4EGLA 2CPXA 1HHQA 2BXJA 3W2VB 5E7OB 2MPUA 3FEYB 2UUBF 1X31C 4NI2B 2ZH5A 4X2BA 4DJBA 2HAFA 2V8PA 3M6WA 2PSZA 1C1BB 3R5CA 4USTA 1WEYA 2AGQA 2YWWA 3J7Z5 2V63A 2DT9A 2GMLA 3PJWA 4OV1A 3NWRA 3NNCA 3K5PA 2J0WA 2UU9F 4DUYJ 1CJTB 2UXBJ 3UCGA 3FSIA 1M1KT 1XEZA 4BBYA 3R2CJ 1IUJA 5FIIA 4D3GA 5GADI 3TA0A 4ILRA 3H2LA 3OW2R 1WC6A 4ZP7A 3OV7A 2UUWA 2ZZNA 3TO8A 2IM3A 5CYQB 3BR8A 4ED1A 4ED6A 2V6AA 4OX8A 4RW9A 3M9NB 5LT5A 3KYLA 2YPZA 3QLHA 5IT9U 1N48A 2NUHA 2GFFA 1LW0A 5DG9A 2CDQA 2V69A 1Y00A 1FWPA 2XNQA 1D8YA 4N7TA 4O3RA 1BHNA 2GCFA 1HQEA 3VAFA 4RW9B 3H0PA 4ZCKA 4MK9A 1IR1A 4DU8A 3CDBA 5IM0A 4USVA 3OL6A 4AUKA 3JSMB 1F2GA 3HSGA 1YRXA 2VPWB 4IG0A 1LW2A 1QTNB 3M6UA 1NK4A 1OY8A 2IYGA 4KGMA 2YH1A 3SDEB 2MQ8A 3GYXB 4JP8A 1V3SA 1YBAA 4PG7A 3AH6A 2KRBA 4OZ0A 4B9MA 2WBMA 1HBNA 1YGYA 3JQJA 1YRUA 1RWVB 2Z2MA 3QSYB 2DISA 1ZM2A 2CPYA 1S1WB 2CDRB 2GAHC 2RS8A 5I3UB 2GMHA 4FKYA 4YB1P 3I82A 3BGFA 1R31A 1QUPA 1OWXA 2YX1A 2AYGA 2ZUAA 4YEAA 1FXDA 1LV5A 3IS9B 3NCRA 4EWTA 4DV1J 3M8ZA 3ET6A 4ES1A 1VC0A 3BSAA 2YKNA 2YKMA 5AJ3F 3CWJA 2I5JA 3R5AA 2PA3A 2BOPA 4ZMMA 2VDHA 2LVWA 3HLUA 1OYDA 3KLIB 1Q82T 3G9CA 2MKKA 4J5OA 3K17A 4K4YA 3VVUA 4DV5F 3MUTP 5JXSA 2IJNA 2UUAF 4ZPBA 4ED7A 3HMJG 1N8RT 1UFLA 4NOHA 5K14A 2VA2A 1VBXA 4ZP6A 4UZBA 3CPWR 3DLKB 1CJKB 4CLSA 2AU0A 1BY9A 1RK8A 2BJ3A 3F41A 1YJNS 2VC0A 4HHHA 1WTBA 2IMOA 2MSTA 4BC7A 3UFCX 4NXMJ 4QIEA 4DR3J 3QBCA 1APSA 3LTOA 5LM7E 1YQHA 4OZ2A 1RUSA 2W2NP 4AYBD 4TYAA 5C2CA 3H5SA 3LAKA 4W4MA 1QUVA 2MLZA 5EWEA 4UZCA 2C2KB 1JXVA 1FNMA 2Z58B 4C0OC 3IRXB 2R8GA 1RA6A 2HHVA 1Y3KA 4U7UD 1X5OA 1TK0A 5I42A 1QSLA 4J91A 2E1MC 3R1HA 3CD6S 3CCSS 3V6JA 1IBKJ 3HHLC 2ZH3A 1SH3A 3NMAA 2E9ZA 4QJVA 4RJVA 1WSVA 2NQPA 4QYRA 2HWTA 1FTRA 1OJ4A 2IVMA 4OI3A 3DDIA 2CWXA 3D7SB 4N41A 3LGNA 2ZWPA 4I4BA 1RT4A 3ITHB 2XO7A 4EBCA 4DQQA 1L3SA 3U1LA 2YNFB 1PO6A 1Q5VA 2EFPA 3M8PA 4IRKA 3BH7B 2FGOA 1LNQA 2D3UA 5GAEU 4UUXA 5D4NA 2RD5C 3HHLD 3GG1A 3D4JA 5BYQA 4DSIA 2B8PA 4C8YA 3L7PA 2BMBA 3MTJA 4TU8A 3GSIA 2C3PA 4WXOA 5KFSA 2JLEA 3NGSA 2HFNA 1WNEA 1R8AA 1T9XA 1HWLA 3TYTA 1U2RA 3HVTA 3M1VA 3MM9A 2R42A 1G7CB 2NXEA 4OQJA 3I5AA 2I9SA 3FCWA 3UE2A 4P10A 3D54A 5LOQA 2CQ1A 2WW8A 3TUZC 2AD9A 3GFHA 4O23A 1XMBA 2WB1D 3KG4A 3KK2A 4O0NA 2FVQA 2FVCA 1SQFA 3M8YA 1SCJB 2F4VF 4ID5A 4DV4J 1WUUA 4LT6A 2RRAA 2CPZA 5CYJA 5D6GA 1RTJA 2MKSA 2HS4A 2PI4A 4R5PB 1FCAA 2Y8WA 4Y34A 1U4BA 4C6AA 1FRKA 4BCAA 1AZSA 1FRJA 1YJWS 3H2VE 5IFMA 2R7SA 2MKJA 3OBIA 4FBUA 2HBQB 3KK3B 5B0DA 3D1HA 2MQQA 1NJIT 3HVRA 3CJKA 2KZMA 1NEEA 3T1HF 2H9ZA 1NM2A 1GXUA 2OLWA 5HP1A 3RGIA 5CHCB 5KT7A 1VCTA 2MZTA 4X64J 3NGTA 4O3OA 3CIZA 5KFAA 1OO0B 1EETB 1U1OA 2XZWA 2OELA 3QZ7A 4F4YA 1Q86T 5A0YB 4LFAJ 1FKOA 4Q43A 3VAHA 3FZBA 3PRDA 1RLDA 4C98A 1XMQJ 2RQKA 1LK5A 3TI0A 2QMWA 1FJGF 3K89A 2BJEA 4ZVHA 2ZFHA 5HVGA 4F4KA 2FLPA 4NZ7A 3EJMA 2YKOA 1K47A 3RRKA 4EMDA 2AX0A 2NCKL 2WBRA 1PC4A 4C0HA 1NHVA 1PBAA 5LMUF 2B43A 2YX7A 2DH7A 2W9CB 3BSOA 4NYOA 4DG1A 1FFGB 3V4IA 3H2UB 4ALZA 5KT5A 3R5BA 4V19J 3LP1B 4KV8B 3VVTA 4C0BA 7FDRA 1AUSL 4ICLB 2O5DA 4P74A 4CO0A 2MSSA 1YJRA 2NSBA 4OX6A 2QX0A 3CCQS 3MCOA 1ZPWX 4TQRA 3KDNA 4UOGA 4K4TA 1HFEL 3K8VA 4O44A 4ZJOA 1RWMB 3I5BA 3OFFA 4F4AA 1I51B 2PI5A 1ZETA 1XTZA 1JNRB 1RLCL 2FUG9 1C0UB 3MEKA 5C24A 4OZJA 4EYHB 2C3YA 2K8GA 1DFDA 4JI6F 1FRLA 1LXNA 4L3KA 2O01C 2GS8A 4DV0F 1D09B 4DV6F 3ICLA 1FHTA 4MAKA 1S6UA 1FK9A 2PN6A 3G87A 1ICEB 2EFVA 1LQ9A 2ZHOA 2EG1A 2OIHA 3DI6A 2IVYA 4J9NA 4PPDA 1RBAA 2V94A 2IJRA 4U8YA 3KHRA 2W9BA 4K50A 1S7HA 3PR5B 3HP6A 2E1CA 2EFNA 3NS6A 3CJ8A 3H25A 1XJWB 4C3KA 2QFJA 2G1DA 4NYPA 2CG8A 1TKTB 3DLJA 3CJSA 5K20B 2DNZA 1S4EA 3S8SA 2GVDB 2R7VA 5DS7A 4QWBA 5KFJA 4KGZB 1JIHA 4YS2A 1S6QA 4M5GA 1UZHA 3OQ2A 3RAMA 3MAQA 3CMAS 1EHWA 3V6DA 1SBRA 3DN9A 3NGUA 2Y0BB 4JUZA 4NYZA 2FLLA 2XQCA 2DIVA 3QFWA 1VQKS 4EEYA 2OH2A 2OEJA 1BD6A 2QG9B 4W98A 3SCIE 3ENWA 5JVHQ 4O4GB 1RKJA 1HR0F 4PWWA 3V81B 1SIWB 3CJ2A 1YDLA 4YMEA 4QBUA 4DN0A 1F5CA 4YN3B 5J2QB 3UDEA 1EP4B 2GAGC 2O1PA 2EK1A 2AJQA 4ZLLA 4GVBA 2CNKB 1RAGB 4YR0A 4WIQA 3B78A 3A3PB 3I87A 1TUVA 4KIAA 4BDPA 1T95A 4U6PA 3NCPA 4KGVB 3PYDA 1R6VA 4IFYA 1S57A 4HYKA 4CT9A 4GVBB 3DNCA 3FMWA 1X9MA 4MK8A 3QIPB 3SYZA 1AYEA 4ZHRB 4FNIA 2LDYA 1TR0A 2J7WA 3GZ7A 3QT6A 2F9DA 3W66A 2IYIA 3D0HE 3VWSA 2OD6A 3CW2C 5EN1A 3WBZA 1DY3A 4OMFG 3SV3A 4G3IA 4O3SA 3TX0A 4DL4A 1QSSA 3U27A 2XCAA 4IR9A 2FHKA 1KKHA 2E5LJ 3KMSA 1HBUB 2ZBIA 4WZMA 3CJTA 3JSRA 2ATCB 5FDLA 5IS2A 4WTYA 1JLEA 2HAIA 2C3UA 3LQVA 1GMUA 4WE1A 4P72A 2DNGA 1PIEA 5KAKA 3O5TB 2XZDB 3CF5Q 2HNZA 1BXNA 2DNOA 4NLYA 2OFHX 4PYAA 2FLOA 4J9SA 3ELHA 4XTTA 4PWDA 2DCUB 5B0GA 2A18A 2XHWA 1DTTB 2HPUA 5C7PA 4HR2A 1U0HA 3FBEA 4FNHA 4U95A 2KO1A 2DH8A 3EPIA 2E29A 2MLXA 5LMNF 1SKWA 2AF6A 2E9TA 1G4CA 1XBWA 4J9PA 1FT8A 2WHOA 1WC3A 1A0OB 1KLMB 1ZM9A 4DV7J 5RUBA 4J9UE 3Q86A 3ZZZA 4X4PA 4H54A 1VC6A 1Y0HA 1SQEA 4FYYB 3CCLS 4V19X 2PMWA 2QO3A 8ATCB 4CLUA 4JOUA 5IOLA 1RHJB 1UA0A 2QL7B 4WP3A 4IH6A 3W2WB 2EBEA 1U1PA 4AL7A 1WF2A 1VRTA 5CZVA 5HLFA 4OYOA 2Y0SD 1PBUA 5J1EA 4BWJA 4FF2A 3M9MB 2AP6A 4H4OB 3GV7B 4G1PA 1CQNA 1SKUB 1O0PA 2VG7B 3MM5B 2J9CA 1IKYA 2KJWA 4P75A 2A0FB 3N01A 2HRTA 1DLOB 3K8WA 4ZVUB 3N4WA 1OSDA 3A3OB 1CJUB 5LJ5Y 3DGVA 3MMAB 4C3LA 1RTDA 3QGIA 2FY1A 5KG4A 3GSDA 3PW0A 1OY9A 4OYWA 1IKWB 4CLWA 1ZZNA 3AAWB 5FD1A 3CJQA 1RWXB 3GV8B 2HHSA 4WFBQ 2VICA 2NS1B 4YHHF 3ZTPA 4ZITA 2HSEB 1NDPA 2CXEA 3DRYA 4RR5A 3A12A 4MIAA 1PYTA 1WORA 4QPXA 4RBVA 2GGPB 4JV5F 5IWAJ 1JLBB 4UOFA 3MUMP 2P9CA 4I69A 3I4HX 5A2QY 3CSKA 2UUBJ 3QJPA 1S10A 3LPEA 3VV2B 4AXJA 2ZD1B 3UVJB 4PABA 2N4DA 2QC3A 2W7PA 1LWCA 3VALA 3W8PA 3J81U 4PAAA 1T9WA 2G2OA 2BX6A 4G1QA 3PW7A 1X4FA 2UU9J 4WZQA 4IO9Q 1UEKA 4CLKA 5F41A 1S79A 2YQ1A 1NJYA 1LWCB 3KLGA 5GAEI 1X4BA 3JTPA 2Z8QA 5B0AA 1RB0A 3W63A 1N33F 1H74A 4P7VA 3NAHA 4OHXA 2NXCA 1XQIA 4J9RA 3MFIA 3MM7A 5M2UA 4QCLA 2JEFA 2HHTA 3OVSA 2KYXA 4Q7AA 2K3IA 1SUQA 3X3UA 4F7VA 4FXVA 4ZOSA 5F9NA 4DUTA 4FYDA 4ZVPB 4QR0A 4ZVSB 4IO1A 1HA1A 3K2YA 4KC5A 1NNDA 4RO0A 2MHEA 1CS4B 3CJ3A 3R97A 2QYCA 2ZC4A 1NK5A 1MWQA 2YTCA 3TVYA 3C6UB 3JYTA 1VHIA 1JNZB 2DY9A 4RWWA 4CO4A 3SV4A 3L7UA 3C6TB 3MEGB 1FD2A 1G1XA 1VS3A 3D67A 2ZOFA 1NKEA 3BF4A 2F3JA 2D69A 1T0TV 3THTA 4LMZA 4Y0FA 4DUZF 2XLKA 3LOUA 1XR6A 3F0NA 1NPRA 2HNYB 2ZH8A 3L09A 2AHOB 1NJXA 1IR0A 2I8EA 3RB3A 4CTAA 4DV2F 1JJCB 1GMVA 3KK1B 3F44A 5A76A 4X4VA 1OQ6A 1K0TA 2Z2LA 4DR4F 5DM6Q 2HHHF 1VQOS 5HMXA 2KU7A 2OEKA 2QYGA 5GAHU 2Y3YA 3HCXA 3FBBA 1BC6A 2GO9A 2JEJA 1REVB 4AE5A 2Y1IA 1UWBA 2JC0A 3I0RB 1H3DA 2N7YA 2DNPA 3SQGB 2LMIA 4XO0A 3JSBA 2RRNA 3QIDA 3M2VA 5KT6A 2MQMA 1Q8KA 4F4XA 1S6PA 2VG6B 5T41A 2ALYB 2CVEA 2ZHBA 3HK2A 4K4UA 2GJIA 1XERA 3HKZD 1NHUA 4R8UB 2L9DA 4HACA 4A8XA 2FJXA 3J81j 2UUAJ 2XY5A 2MZJA 2KKHA 3M8QA 4RNOA 2G4BA 2RUGA 4WCEQ 2FB0A 1IQTA 2D3OR 3IWNC 2UV8A 3NCQA 1PYSB 4QU6A 5A8RB 4CI0B 5J2MB 3W62A 2ILZA 1K0VA 2C2NA 4URQU 2RRBA 4TKTA 3H7HB 1YJ7A 1KVJA 2R7RA 1HPZB 4J9VA 7FD1A 3JB9k 1WKKA 2KG0A 2DO0A 2HK2A 3OLBA 2F7VA 3BS9A 3PV8A 3HHLA 2OPQA 5IXUA 1FEEA 1CJVA 2FHJA 1UFKA 2GA7A 4Q0BB 3W5YA 5HVHA 1RZMA 2Z2ZA 3NXZA 5L1IA 1SC3B 3KJVB 4MK7A 2A6MA 2BABA 2UVRA 1T9YA 3IR6B 3E51A 4RU2A 2WOMB 2IDLA 3DDKA 4NLPA 5KFMA 3Q2SC 3EVOA 5DLFA 1NCLA 1QAYA 2LQ5A 4LF5J 2RSQA 3BKFA 3DC2A 2XS7A 3QT8A 4WFAQ 2WAQD 2XGQA 4DS5A 3M2RB 4PG8A 5IT4A 4I2QB 1RT3A 3HT3A 1CBKA 4NXNJ 4LR8A 1UEUA 1QE1A 1NK8A 1HMVA 4A8MP 5KT3A 2ZJPQ 4BC9A 5IQQA 4LF9F 3AJ1A 3GPAA 4H4MB 3TAQA 1NB2A 5K5MA 5AXLA 2BJ8A 3HSJA 1T3OA 2NXJA 3GE9A 4Z2XA 4NCGA 2EPIA 1XK8A 5HROB 4BWMA 3I32A 4HDGA 3G82A 3NY0A 1Y5IB 7AT1B 2LECA 1DJ0A 5KFGA 1Q79A 5DGBA 1WEXA 4CNZA 3M30B 3N6MA 3KKFA 2Q6BA 1EB0A 3H8YA 4QW8A 2HVDA 5D0RA 1NHKL 4CLTA 4RW4A 1RAOA 3O3LA 2F4VJ 4Q5VA 3DYAB 4UY85 4P7TA 2J9DE 2NLWA 2E5JA 5MLCV 3PIPQ 1JLQA 2VC1A 4K5RA 5F3TA 2J6UA 1JWWA 3IM9A 2QA2A 3GILA 3WZ0A 4KQZA 4OIXA 1CULA 1S1TB 4GMKA 4F2RA 3KOAA 1SC1B 1VK3A 4B3OB 5FLXU 1VQYA 1A7GE 3T1HJ 3C16B 1QAXA 2B9YA 1JLQB 1BQMA 4O0IA 2XSFA 1VQ7S 3FFIB 4NL5A 3BQ1A 2W25A 3IWXA 5KFQA 3RR7A 1S77D 1YK9A 3DOMA 3SBMA 3SSRA 3TUJC 3PG9A 3JQKA 3MCNA 3QSIA 1VQ8S 1DARA 3WHIA 3B54A 1FJGJ 3T19A 2RF2B 1C1CA 4DFKA 3RW7A 5LMUJ 3OL8A 5KFIA 1S5ZA 1MROB 2DR9A 4RU9A 2BV3A 1NH7A 1IKVA 4WBFA 2WVCA 3GG0A 1TUWA 1U2CA 4KPCA 4TU7A 2FY8A 4QZVB 4MMOA 3UD4P 1RT7A 1VC5A 3TAMA 1OY6A 5BYRA 4B3MJ 2ZBQA 4K2XA 4QR1A 3MOJB 1HNWF 3ETOA 3BGRA 3BYRA 1Y10A 3OXLA 4B3RF 4M5KA 3NWGA 1RCOB 4DQPA 1QTMA 1KFSA 2H65B 3AJDA 4JI6J 1HNVA 1K44A 2FTRA 2FZGB 1F1BB 1YSJA 2IC3B 4DV0J 5MAOA 4ED4A 4M5NA 2QEXS 4DV6J 2GNKA 2WONB 5A8WB 1RI7A 1Q1KA 2YQ3A 2HNDA 1RTIB 1N34F 2BYCA 2R3VA 3G8TA 2KVQE 3POTB 5L39A 1E6VA 1NDKA 1KFDA 1RAAB 2DH9A 2XYHB 5CYMB 4EK2A 2DCLA 2VU5A 1RT2A 5B7WA 4KPYA 3R5DA 2R2RA 2P6TA 2V9WA 1CVJA 1RA7A 3PYGA 2XBPA 2M7SA 5D3GB 3ZC4A 4BLGA 2XNRA 3CIMA 3D68A 4PPZA 2BJ9A 2VKRA 4P2XA 3Q24A 3VGTA 2CJKA 3DXSX 5DDRC 3BBBA 3T1AA 1N54B 1S0NA 2JSXA 1DQ8A 3DGPA 1VRUA 4OHYA 2CKWA 3PZPA 5LXRA 1U45A 3AOBA 1ZAVA 3K0JA 4I68A 2B9XA 2DHXA 3GIJA 2V2QA 2ZH6A 4IG3A 3OPKA 4MKVA 2B4PA 4HHUA 1P27B 1HBOB 1X5SA 3HF5A 4ECRA 3AFGA 2ZBCA 3QRPA 1M1HA 2CQDA 2MDAA 1KQSR 4PQUA 2VOPA 3CJ4A 4X4UA 4YB5A 4ECYA 1FDBA 2ZEJA 3SEOA 3S1TA 4LFCJ 4RBTA 4YUDA 1RHRB 1U1LA 1WHXA 1P1LA 4ZVEA 2ERRA 4K0KF 2QMUB 2OPRA 1OIAA 4NMLA 3OR2A 4DFMA 2J0QD 1TL1B 2F9JA 2WRMA 2ZVSA 3CJ5A 4OYZA 4DL7A 3MPWA 3AT1B 3OUYB 3OTDA 4NCBA 4OL8A 4LVNP 3H5XA 3HDSA 5B0FA 1WHVA 1P9YA 3UNYA 3JTNA 4W92B 3JAMU 5C42A 2LA4A 1RT6A 5KG6A 3GU0A 2UUTA 4PUOA 4CM0A 3N28A 3VGUA 4IH7A 3C19A 3MR7A 3H40A 4DZ6A 2UVVA 1RBOB 3AD8C 1VLOA 2RDJA 2PE8A 1PAUB 1Q78A 2VFUA 1OPZA 1RT5B 4ECVA 1U6BA 1NZ8A 5HQMA 5EHHA 1WI6A 2BUNA 2M3DA 3CCRS 1KEKA 3NL0A 4OZ1A 4J9QA 3ETMA 4MYUA 2ZE2B 1S9GA 4DOZA 2F8EX 4FKXA 1H72C 4GO5X 2HQGA 4OLPA 5HL7Q 4D3HA 2CPEA 2VQEF 4EZ9A 3A1YG 2I2YA 1S97A 4RW6A 5CD4A 2V0NA 4TLQA 1EKSA 2CG4A 3C15B 1I5OB 1JK9B 1YLXA 2IPOB 4WU2A 2W1BA 1F5BA 4HEA9 5GADU 2G0IA 2J0XA 3DRPA 3UDVA 1TMMA 1J5OB 3LANA 3O1LA 2B5JB 5LMNJ 3CO0P 3D9BA 3EGNA 1IBCB 2COLA 1YBTA 3DLGA 4OYMA 3CB4A 1OYEA 2OAUA 4ANDA 4UOCA 3HD2A 3W61A 4DSKA 2H3EB 5IC6B 1YBUA 1GX6A 4MJKA 5HMYA 2HQDA 3TA1A 2QV6A 3FQKA 2MXYA 5EGYA 3TR5A 5E3QA 4FS2A 1GX5A 1AT1B 3ZNUA 3MAAA 5GAHI 1JLFA 3DLEA 3FDSA 3MM6A 2CADA 3E2EA 3MEEA 2NR0A 2R7QA 3OFHA 1Q16B 4U67Q 4X66F 4AQYF 3CNQP 4WK3A 2IIHA 2VG5B 3N6NA 4KKOB 4XAKA 2BQ3A 4UTGA 5L46A 1QVFR 2FC8A 2VFTA 2R7XA 2J9EA 5L38A 5DZ6A 2LU2A 3CDEA 2V8HA 2YNIB 4DPTA 2A2CA 2V2KA 1UTAA 4RKUC 2WSFC 3LPYA 2ZM6F 1IXKA 4AL6A 3K58A 1JJ4A 3BYPA 4HH1A 3CC2S 1HNIA 2DR8A 4YHHJ 4M94A 2DXFA 3C3LA 2HZVA 5J2PB 3CEDA 2HMIA 5FJ4A 2O67A 1B0VA 1RAFB 4GVLA 2RNEA 3TZZA 4JV5J 1JLCB 3DRSB 1URNA 2LEPA 2RHQB 2I0XA 1EZZB 4O3PA 4DXLA 5E3CA 4ATNA 3RBEA 3EGWB 4X4RA 2PD1A 1RAIB 3OL7A 3M8WA 5E5NA 2JRSA 1I3OB 5IV4A 1S6OA 3NGDA 4RW8A 1OQ3A 3IG1B 4F2SA 4F0KA 4DCJB 4ELTA 4AXIA 1RWOB 4LF6F 4JV2A 3VF0B 4X84A 5HQLA 1N4LA 2IFXA 1FRHA 4YR3A 1N33J 3W8GA 1TKXB 4NLTA 3ULHA 1TK5A 4U96A 2HK3A 3PJ9A 4DQSA 4WK1A 2VL1A 1SV5B 1I94J 1LWEB 1BQNA 1HQUB 2QLJB 3FQLA 2M2BA 5J2NB 3DOLB 3FGVA 3Q22A 1T8EA 3BSCA 4J90A 2D9OA 2W4PA 2KFZA 1MG7A 2M9KA 2DGSA 3IC1A 5DG7A 4UY8T 2XWXA 3VAMA 3TP2A 2APOA 4HLBA 1UEVA 3HJVA 1MWZA 3HHEA 5EX0A 2CFXA 5LSLA 2BKOA 2HBZB 1FKPA 3GONA 2PC6A 2G1HA 2MZSA 1TKZB 5ETLA 4DUZJ 1SI9A 1BWVA 4JYAF 4NLVA 1FVQA 3OR1B 2BOAA 2F63A 2BEFA 2W4DA 4DR6F 4A8OA 1AUDA 3CO9A 2NPFA 1ZAWA 4CYUA 3MEDA 3DMJA 1G6BA 2ZDOA 4LSNA 4DV2J 3GYNA 1SPBP 3I4PA 2JHEA 4Y2MA 3DM2B 3HPOA 2D1CA 4PG5A 2HQCA 4DR4J 2HHHJ 1MNEA 5CA5A 3IGNA 3AD9C 2GV1A 2AWZA 3MMCB 3M32B 2Y9HA 4DSLA 3UN5A 5ETPA 4JI5F 1UVLA 1UP1A 2VUGA 3CDWA 3N0VA 2VBYA 2EBGA 4U9RA 3PM9A 4TXSA 3E01A 2WVDA 3B4MA 2DRAA 3PHEA 1HD0A 2H48B 2M70A 1TKDA 2B9WA 4M5DB 1NBEB 4DEZA 3DU5A 2FYXA 2CQHA 5ETOA 3CCWA 4C8ZA 1N32F 2WTFA 5AXNA 1FFWB 3MM8A 1H38A 4ZPDA 1HI1A 3Q8RB 5ETRA 3RZAA 4KHPF 5HJXA 1N5QA 3FCVA 4CH0S 4IKAA 4X4NA 1DTQA 4I7FB 4ED5A 4IH5A 4ED8A 2AJ4A 1UVIA 4F3OA 2EWHA 3UNGC 2KI2A 2E9RX 1S1XA 1GH8A 4LREA 4OV6A 2P8IA 5KFTA 5HAOA 4DR2J 4K4XA 3I5CA 2FJEB 1UVKA 4JI4F 3MHYA 4Y2AA 1RTHA 5DQHA 1S1UB 5GVQA 1F9EB 4QWDA 2MGZA 4KGXB 1UMJA 1TUGB 2M52A 3D3CJ 4B9LA 3AJ2A 2GQQA 3AA9A 4GKJJ 1CEZA 1HARA 1NO8A 3DOKA 3FSYA 2EKNA 2Z0GA 3M2UA 4N5SA 4IYQA 1FWLA 4FF1A 1U49A 3MMBB 3ZZYA 4LVOP 4JI1F 3N79A 2BE2A 4F0HA 5DM7Q 1H73A 1PJ7A 4CQ1A 3LP2A 4F8RA 1R8BA 2CJBA 4USJC 2QJ3A 1CC7A 2HQFA 4WYLA 4Q8FA 3NAIA 4E98A 4TN2A 1N36J 4QYZJ 1RACB 3ZO7A 1ZBTA 4LF9J 1ZTWA 1U8SA 2ZNYA 1UPPA 3O6QA 2WW4A 3VAKA 4KR0B 3JS9A 3US5A 1WC0A 1FE0A 3P49B 1FE4A 1NJWA 1XC9A 1PCAA 3UQSA 3VTIA 2W2PP 1KVKA 4A48A 3DU6A 1H7XA 4I64A 1EKRA 2GHPA 3ILLA 2PMZD 2HZAA 4EUVA 2BANB 2BJ7A 1XNRF 4IQXA 1N0UA 3OHBA 4HT7A 3V6KA 3KNAA 4A8FA 3A8EA 4I2PB 3KLEA 3LP0A 2J6SA 1R0AB 4RL1A 4HTIA 3TVKA 1EIYB 2X1BA 2CA9A 1ZTTA 2QLBB 1EQ0A 3CVKA 3K59A 1RISA 1S72S 1MWYA 1VHFA 1FDAA 1SL0A 2AYMA 4NA3A 4LBIA 2E66A 3RB4A 1S76D 3H42A 2B7BB 2CZ4A 2C2MB 3M4XA 2ZH2A 2R2UA 1HBMA 1T05B 2ZJQQ 1RT1A 3HSDA 4OI0A 2F8MA 2AEMA 1JKHA 4M5LA 2AV5A 4CH7A 3OFGA 4P52A 4ZIVA 1Y3JA 2XLIA 2M0GB 3QQCD 2XMJA 2KRRA 5A8KA 5GMDA 4Z7CA 2DITA 3OHAA 4EO6A 3K5LA 4FS1A 2HFSA 1YG0A 3W2VA 3BBFA 4M95A 5IT0A 4NI2A 3P4UB 4F02A 3T3FA 3LAMA 1C1BA 1UCNA 4GO7X 2GW8A 1XMOF 3TQ1A 3D5MA 4K5SA 2DXDA 1HHSA 2BR0A 2M88A 1HYSB 2FJVA 3FK4A 2GVZB 1CJTA 1KTQA 4Y2CA 2GHWA 3IR7B 2R7TA 2IM1A 2IA0A 3A13A 4ID8A 3QGPA 2IHR1 5KFDA 2QA4S 1PC5A 3IGVA 2AJFE 5T7LB 3EVMA 2LDIA 3MR6A 3Q8QB 5CYQA 2HS0A 4A47A 3P45B 4P9SA 4C11B 3H98A 1N6QB 1OSCA 2QL9B 3NEKA 4LUBA 2ABYA 4B3RJ 4OYPA 2ZH4A 1H0HB 1PILA 2VQFJ 3KUEA 3TJ8A 4LRAA 4ILLA 2BKPA 4B02A 4TY8B 1U1KA 2HIYA 5LSOA 1SH0A 4J9LA 4CP5A 3ENAA 4J9MA 5HBMB 4LSZB 2ROGA 3ISNC 2QA1A 3D1QA 3DLLQ 3ZTSA 2DNHA 4DBQA 5IQ6A 3QPIA 2G2ZA 3EICA 3EVWA 3CC4S 4F36A 3JSMA 4Q2LA 2EI5A 1KRPA 4LJMA 1RE1B 3KUGA 4HH0A 3NBPA 3UI3A 4B9NA 2OP5A 1M5PC 5KG3A 5G0RB 3TWZA 3SDEA 2F65A 2LFVA 2UVWA 2IDEA 5KFUA 2MZRA 4ETXA 5KFZA 4Q45A 5DDOC 3NBPB 2MQPA 4XIUA 1WSRA 3H4BA 3KUHA 5GAGU 4M5IA 2L9WA 3RRGA 1S1WA 3W5ZA 1Y4ZB 3QT5A 1F0XA 4RNHA 2ZKUA 5I3UA 2G0CA 2WVFA 2VV5A 2V2ZA 1TTHB 2LCWA 1TL3B 3UD5A 3IS9A 5B0CA 3BKTA 1LWFB 2GIQA 2IM0A 2YWGA 3LWLA 4C2MA 2HYIB 1GQEA 2B6AB 3P3DA 4FF3A 2AMCB 3BM7A 3MWBA 3EGZA 3HFZB 1KTVA 2BRKA 3R6LB 2XSJB 3KLIA 4MKYA 3MCSA 1FDNA 2XZTB 4FP9A 2EEYA 2L08A 1RHUB 2RE1A 4Y28C 4P2MA 1UVJA 3MECB 4NLOA 4NA1A 2JEIA 3R8YA 1HNXF 2R7WA 2ILYA 5L9NA 4BS2A 3I9ZA 1M90T 4DL0C 4ZLJA 3C14B 3SI8A 3DLKA 1CJKA 1T94A 4PXEA 1TL7B 3MXHP 3VZHA 2MY8A 3D0IE 3LW5C 1HWKA 2KL8A 2FZKB 3O2IA 3KLFB 3EGVA 4LF8F 4A8QA 1VBKA 1F5AA 2OGUA 4DN9A 2XM3A 4ECXA 4NXMF 4FZVA 3I0SB 3QRQA 2XTJP 1Y5NB 2H4WB 4K4VA 3V5RA 5KFYA 2MMYA 1WEZA 1Y7PA 3IRXA 5BYSA 2BRLA 3HM9A 2W8LA 4X62F 3KJQB 3SIPB 4P2SA 4FF4A 3G71S 4I6WA 2RHSB 3M05A 1C0TB 4A4JA 2H4YB 3ENVA 5HQ8A 2MTLA 2EXUA 3H5UA 1D0EA 1I6JA 2RIJA 3GIRA 1VQMS 1SH2A 4HL9A 3NOCA 2CUYA 4G6VB 4JI2F 4U7CA 2Y1RI 2ASJA 2FJAB 3BPDA 4F26A 1L3VA 1O5JA 1CLFA 3C8YA 3ITHA 1A9NB 2X3GA 2MKCA 2LKZA 4B08A 3AODA 3CD7A 2NXUA 2YNFA 3H20A 1T03B 2IJFA 1KQGB 3B6BA 2KTQA 1C2PA 4I0WA 2ASDA 5J1NA 3RAQA 3MMJA 2B0GA 9RUBA 1N0VC 2ZZTA 2NSCA 4MTPA 3GYGA 2VBXA 2IRUA 1VDHA 4DFJA 5F8IA 1HWJA 3RBXA 1JXEA 2VJUA 2C22A 3NMRA 4OJHA 4URGA 4G1IA 2ZOMA 2GO8A 4LF4F 4DI6A 2ZKTA 3H5YA 3CGIA 5E41A 1JLGB 3Q8VA 3RU0A 1W2IA 1KONA 1SJ4P 4DFPA 2R7OA 1B70B 4KT0C 3SCKE 3RBZA 1ACMB 2RQ4A 4OYXA 2ZH1A 4EI2A 3HXMA 4FVCA 4CO2A 5DDQC 2B8QA 1RXOB 4R5PA 1KP6A 3FMBA 2AT1B 2C3OA 4ZLPA 4KFBB 2KFYA 4WFZA 3MR2A 1U09A 4ZP8A 3KK3A 2DHAA 2K7KA 2W2QP 2Q43A 3A4TA 5CZXA 2L9NA 5JMNA 2I38A 1S9EB 3PDNA 5AXKA 1RGVA 5C25B 5LXYA 1WF1A 4IUFA 2VFRA 4X66J 4AQYJ 2J7KA 4X64F 4K7QA 1EETA 2V50A 4MYTA 3P5TL 2B9EA 5A0YA 3PVXA 2DVIA 2F4FA 4LF7F 1CSJA 2PO4A 1VBZA 2XMWA 4LFAF 2HGMA 1HD1A 1GK8A 4M5HA 3QJJA 4RUBA 2V2VA 4KSEB 1WC4A 4DR1F 1FA0A 3HX9A 3DLHA 1BGXT 2KFNA 1WC1A 1L3TA 2ZM6J 1M5SA 2VONA 2IM2A 4I6AA 4OJ1A 2XB2D 1WHYA 5DDPC 2ATLA 2W9CA 1WD6A 2IAJB 4CWBA 5J1PA 2MLYA 3OSPA 2XWYA 1VRQC 5D4OA 3LP1A 2XG8A 5CD4H 4V1Ak 4KV8A 2B56A 2G0JA 4X65F 4ICLA 4F04B 2ROPA 2BM1A 1X4GA 4OI4A 3LO3A 4IOBA 3PHTA 3KLHB 1K9MT 2HFOA 1O51A 3OJUA 1FJEB 3DHXA 3TJ9A 5EWFA 3R1LA 4QU7A 4ZPCA 3FRZA 3OTOF 1B99A 3ZZUA 4TY9A 1C0UA 2CRLA 3PW4A 4QOTA 2X51A 2EFQA 3HFVA 4C8LA 3KJNB 1GTHA 3R2DJ 2W01A 3D28A 3LWMA 4MFBB 1RHQB 1S0VA 3PKMA 3BB5A 4QWEA 3BREA 2AKWB 1W26A 1VLYA 1FXLA 4FYVB 2XI2A 2QN6B 4U8VA 3TZWA 4RUAA 2CNNB 3SFUA 2NYHA 3IAM9 3GJQB 1Q7LB 1SXLA 5HSPA 1QD1A 4F50A 4JI3F 2F8HA 2AJ0A 6FDRA 3IO1A 4XDDA 1M5OC 4ELUA 3FVYA 4DQRA 3GMGA 3MTKA 5LL6d 3GJSB 3M7VA 1FVSA 3W5XA 2J8AA 1TKTA 6FD1A 3F73A 4RNNA 1ZH5A 2GVDA 1M0SA 2E1AA 2JZ5A 2AEFA 2QMXA 2JEGA 4IRCA 3GB0A 5KFHA 1BLUA 4I67A 4ZN3A 1T11A 4UOHA 4L73A 3DDNA 4N47A 3G6ES 1EARA 1FWKA 3PW2A 4A46A 2G13A 1NSQA 5A6WA 3T6BA 1WJ9A 2YNGB 4JYAJ 2FGCA 1HW8A 4KO0B 2ZVIA 3Q23A 2LQ8A 2RH3A 4O4GA 3H4DA 3V81A 1S1VB 2RQCA 2ZOGA 4WKRA 2OPSB 4MKBA 3ISZA 5J2QA 3PX4A 1EP4A 2CYYA 3CCZA 4P2FA 4OLOA 2JL9A
chains in the Genus database with same CATH topology
4DV1J 1XMQJ 1XNQJ 4LFCJ 2F4VJ 4YY3J 3W1YC 4KY3A 3J81U 3OTOJ 5LMUJ 4DR5J 1IBKJ 2KVQE 1N36J 4DV2J 1N33J 4JI0J 2KL8A 2UU9J 4LF5J 4LF7J 2UUAJ 4LF9J 4NEZA 4RJVA 4YHHJ 4X62J 4JI4J 4DV7J 2E5LJ 4X66J 4AQYJ 4LF4J 4DR4J 4JI5J 4B3RJ 4DV4J 2HHHJ 4NXNJ 4PWWA 1J5EJ 1HNZJ 4DR1J 2VQFJ 1I94J 1XNRJ 3JAMU 1IBLJ 5FLXU 4DR2J 3J80U 3T1HJ 4JV5J 4DUYJ 4B3MJ 3IMQJ 2UXBJ 4B3SJ 3R2DJ 3J7AN 3T1YJ 4LF6J 2MQ8A 1XMOJ 5A2QU 4DR6J 2UXDJ 4JI2J 3R2CJ 4B3TJ 1N34J 5AJ3J 4K0KJ 2MTLA 4GKKJ 4OX9J 4JI1J 3D3CJ 5BR8J 4JYAJ 1HNXJ 5IWAJ 4JI6J 4JI3J 2MEWA 2ZM6J 4LFBJ 4GKJJ 4X65J 4HHUA 4NXMJ 4DR3J 1IBMJ 1N32J 5LMNJ 5LM7E 4DV0J 1HR0J 4X64J 2VQEJ 5IT9U 4DV3J 4DV6J 4DR7J 2UXCJ 4JI8J 4NEYA 4KYZA 2UUBJ 1FJGJ 4KHPJ 4DV5J 3D3BJ 4DUZJ 2UUCJ 4LF8J 4JI7J 4LFAJ 4V1Ak 1HNWJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 J;  1XMQ J;  1XNQ J;  4LFC J;  2F4V J;  4YY3 J;  3W1Y C;  4KY3 A;  3J81 U;  3OTO J;  5LMU J;  4DR5 J;  1IBK J;  2KVQ E;  1N36 J;  4DV2 J;  1N33 J;  4JI0 J;  2KL8 A;  2UU9 J;  4LF5 J;  4LF7 J;  2UUA J;  4LF9 J;  4NEZ A;  4RJV A;  4YHH J;  4X62 J;  4JI4 J;  4DV7 J;  2E5L J;  4X66 J;  4AQY J;  4LF4 J;  4DR4 J;  4JI5 J;  4B3R J;  4DV4 J;  2HHH J;  4NXN J;  4PWW A;  1J5E J;  1HNZ J;  4DR1 J;  2VQF J;  1I94 J;  1XNR J;  3JAM U;  1IBL J;  5FLX U;  4DR2 J;  3J80 U;  3T1H J;  4JV5 J;  4DUY J;  4B3M J;  3IMQ J;  2UXB J;  4B3S J;  3R2D J;  3J7A N;  3T1Y J;  4LF6 J;  2MQ8 A;  1XMO J;  5A2Q U;  4DR6 J;  2UXD J;  4JI2 J;  3R2C J;  4B3T J;  1N34 J;  5AJ3 J;  4K0K J;  2MTL A;  4GKK J;  4OX9 J;  4JI1 J;  3D3C J;  5BR8 J;  4JYA J;  1HNX J;  5IWA J;  4JI6 J;  4JI3 J;  2MEW A;  2ZM6 J;  4LFB J;  4GKJ J;  4X65 J;  4HHU A;  4NXM J;  4DR3 J;  1IBM J;  1N32 J;  5LMN J;  5LM7 E;  4DV0 J;  1HR0 J;  4X64 J;  2VQE J;  5IT9 U;  4DV3 J;  4DV6 J;  4DR7 J;  2UXC J;  4JI8 J;  4NEY A;  4KYZ A;  2UUB J;  1FJG J;  4KHP J;  4DV5 J;  3D3B J;  4DUZ J;  2UUC J;  4LF8 J;  4JI7 J;  4LFA J;  4V1A k;  1HNW J; 
#chains in the Genus database with same CATH topology
 4JBC A;  1FJC A;  1C4C A;  5F8L A;  2JNJ A;  3RB0 A;  2EC2 A;  4ZCL A;  4CNY A;  3FEX B;  5B09 A;  2AJ1 A;  3I6P A;  3ZFV A;  1RKI A;  4ECU A;  3TQE A;  3EX7 B;  3N5B A;  2VFV A;  5GMK a;  5DLG A;  4E2F B;  4DLG A;  4ER8 A;  1VQ6 S;  4JI5 J;  2BJD A;  2GHV C;  1RHM B;  3QIP A;  3MUV P;  3CC7 S;  4Q44 A;  1KLN A;  4ZHR A;  2QSW A;  4PYD A;  1HLW A;  2DGV A;  2VPX B;  5KFE A;  1D8Z A;  4DHV A;  1WWH A;  3IAS 9;  1F60 B;  2Z57 B;  1TV6 B;  5KFO A;  4YFU A;  1M5K C;  3PFE A;  2FQQ B;  4WFX A;  4M5J A;  1S7I A;  3IFE A;  2V4J B;  1HBU A;  4IFV B;  1N32 J;  2R2T A;  4TLR A;  2PMH A;  4KHP J;  4GKK F;  1X7V A;  3MGJ A;  3HD1 A;  2HGN A;  3FUY A;  4RZR A;  5BR8 F;  4ZJQ A;  2QSF A;  2LA6 A;  1ZM4 A;  3GTY X;  5DJB A;  1RSC A;  3H90 A;  3QRR A;  5EUH A;  4IR1 A;  2GQC A;  1NDC A;  4KHM A;  2DY1 A;  4MT1 A;  1KNZ A;  3T9N A;  3P6Y C;  4JV0 A;  2WVB A;  3G86 A;  4C9D A;  3PIO Q;  4ECW A;  1RAE B;  2Y8Y A;  1LOU A;  4USK A;  2DR5 A;  4JI4 J;  2KJV A;  2K1R B;  1T9U A;  6AT1 B;  1DTT A;  3MR5 A;  4DSF A;  2XS2 A;  4LSL B;  2XY6 A;  1NSK L;  1JLA B;  5BJR A;  2CAJ A;  2K2P A;  4ANC A;  2XLJ A;  2CNL B;  3HO1 A;  1IM4 A;  4HI1 A;  2MJN A;  2CQP A;  1VIS A;  2JVR A;  1CC8 A;  1IKX B;  3EE3 A;  1X4H A;  4JI1 J;  1KLM A;  2HFV A;  2YNH B;  5H9E K;  2B7C B;  2A2D A;  1GXT A;  2J6T A;  1X5P A;  5F0W A;  4RW7 B;  4FPR A;  3AQO A;  5L9X A;  4IDK B;  4GC7 A;  3RB6 A;  5GAG I;  2ROE A;  2YWF A;  1RU2 A;  1N5Y B;  1MU2 B;  4C8M A;  2CNO B;  3W65 A;  1NK6 A;  5F8H A;  3WIU A;  4WTO B;  3W2W A;  4K4Z A;  3V2U C;  3NNH A;  3GWC A;  5LSR A;  3K5M A;  4WKY A;  1RHK B;  4UQG A;  4PCQ A;  9ATC B;  3EXY A;  2UV8 G;  3BQ0 A;  1R0B G;  2RML A;  1YJV A;  4A8K A;  1X9W A;  1ARO P;  1KSP A;  4H4O A;  1XNR J;  3IA0 A;  4ETZ A;  2LQ9 A;  2UVU A;  2VG7 A;  2R8K A;  4O4R A;  3MM5 A;  4ZVR B;  3FRY A;  5K8N A;  2HEK A;  1V3Z A;  5KG0 A;  3WX4 A;  1GEH A;  2UXD J;  5AE3 A;  1H6K X;  2W2M P;  1DLO A;  2V67 A;  5F8M A;  3G2X A;  2NZC A;  1FFS B;  4CLP A;  2YY3 A;  1CJU A;  3IRW P;  1YVF A;  1YJT A;  2XO6 A;  4CIO A;  3MMA A;  1NXI A;  4K4W A;  3R7N B;  3NNA A;  1FDD A;  4NLX A;  2U2F A;  1Q8L A;  1UJ4 A;  1IKW A;  3IXQ A;  2AZ1 A;  2H54 B;  1Z1Z A;  1LEO A;  2MB0 B;  3PXG a;  2MQL A;  3AB4 B;  2DO4 A;  3MAH A;  4L72 B;  4C4W A;  2QIF A;  1K73 T;  2GGP A;  2Y1L B;  1X4D A;  1RAD B;  1F9H A;  1ZPV A;  1JLB A;  1LFW A;  3QO9 B;  1YI2 S;  2A1B A;  2HQI A;  3PYF A;  3CCU S;  3UW1 A;  1L3K A;  3R6G B;  2KXN B;  1X4E A;  1PSD A;  4HVZ A;  4ZVT B;  2OPP B;  2ZD1 A;  3UVJ A;  5EX3 A;  1XMO J;  5A2Q U;  4CZC A;  1TFY A;  3NS5 A;  3UN3 A;  2KG1 A;  3UR3 C;  1FKA F;  4PZV A;  2RB7 A;  5ETS A;  1AW0 A;  5KG5 A;  2WB4 A;  4KH1 B;  3K7R A;  3UO0 A;  3KMQ A;  1WOP A;  4RNM A;  3KXD A;  1Q8B A;  5C2G A;  4ED3 A;  3VQS A;  3THP A;  3HVW A;  1NJZ A;  2FVS A;  2GX8 A;  2HWI A;  1QSY A;  3C46 A;  2FZC B;  3D3B J;  5L1L A;  2J9D A;  4DLE A;  5H9F J;  3TEH B;  3ZXW A;  1BMQ B;  4ED2 A;  1F3V A;  1U0S A;  5KFN A;  1P1T A;  2L3M A;  1NZA A;  4UF4 A;  5IT9 Y;  2VA3 A;  3CDA A;  2CJQ A;  2D3Z A;  1WC5 A;  1CS4 A;  5K8M A;  4WFN Q;  4CO3 A;  4C97 A;  4AFF A;  3TEG A;  3QAE A;  3QLH B;  3C6U A;  4ANE A;  3C6T A;  3MEG A;  1NME B;  3WC0 A;  4ZPA A;  5KOW A;  1LW0 B;  1RQ0 A;  2Z56 B;  3B8H A;  3TA2 A;  2E5I A;  5HO4 A;  1HQE B;  1U7L A;  4NRT A;  2B3T B;  2HNY A;  4OYA A;  5E33 A;  4B3S F;  5IM0 B;  3T1Y F;  3PW5 A;  2P6S A;  1Z4U A;  4IG0 B;  5HK4 A;  1LW2 B;  4LBH A;  1H7W A;  3KK1 A;  2QA4 G;  3O44 A;  1VK8 A;  2HBR B;  4USW A;  1JJH A;  1REG X;  1DQ9 A;  1OPI A;  3IBF B;  2XMT A;  3KJF B;  3OTB A;  5JUM A;  5F0U A;  4LBP A;  3TAR A;  2YVS A;  1HBN B;  3Q0A A;  2XGP A;  2DNY A;  1REV A;  3N9U C;  5ITH A;  1XNQ F;  4KAI A;  1KS2 A;  3I0R A;  3SQG A;  2K06 A;  3UDL A;  2KVI A;  2HLU A;  1WI8 A;  1GMW D;  1VQL S;  1V9O A;  1R8H A;  4NLR A;  2KH9 A;  2VG6 A;  1IM6 A;  2FIU A;  2OFG X;  2JH3 A;  3ET6 B;  5AJ3 J;  4R8U A;  1J27 A;  3BZQ A;  2YKN B;  1HNZ F;  2YKM B;  1U8W A;  3D2W A;  2E1P A;  2HQ3 A;  4OZL A;  2JOQ A;  2I5J B;  4DCO B;  2P5V A;  4ZJL A;  1HNX J;  2KT3 A;  4LR7 A;  1HIY A;  1XIQ A;  2JJ4 D;  3CE8 A;  3KTQ A;  1A6L A;  4EBD A;  2Q6C A;  5A8R A;  3O8W A;  2ZJR Q;  4EO8 A;  3HI9 A;  1Q8I A;  4DV5 J;  5J2M A;  4FVM A;  5CXT A;  4LF8 J;  1KQF B;  4ZIW A;  1VYA A;  3OFE A;  1HPZ A;  4DDF A;  5K14 B;  1KVI A;  3VHQ A;  1VQ5 S;  3CXC R;  4HI2 A;  5AE1 A;  1IQZ A;  3PCO B;  4JI7 F;  3VAG A;  3DXB A;  4X62 J;  2QFI A;  4Q0B A;  4OHW A;  4K2J A;  5CAA A;  1B4S A;  5HAT A;  2PGC A;  1CG2 A;  3KJV A;  2ZBR A;  1B0T A;  5D78 A;  2C2E A;  2HRY A;  1TAU A;  4BHQ A;  3J7A 1;  2ZH9 A;  2WOM A;  1F6T A;  2M8D B;  2RDD A;  3WQP A;  2X1F A;  2DJW A;  4JI2 J;  2NRE A;  4MIB A;  1WTF A;  5I42 B;  2LEB A;  4LIR A;  3CD5 A;  3IM8 A;  2DNL A;  4F4W A;  1ZOT A;  4DMZ A;  4LF5 F;  3M2R A;  2DGW A;  2VAS A;  2VBZ A;  4KGK A;  4I2Q A;  3SSQ A;  4DZD A;  1SC4 B;  5M2R A;  4N56 A;  4NXN F;  1KHV A;  5AE2 A;  3W7B A;  2AGO A;  1QAI A;  1XR5 A;  3BO2 A;  3FCH A;  4H4M A;  3CCE S;  1RT4 B;  1V6H A;  4LFB F;  2FHJ D;  3PAC A;  2XEX A;  3ZZR A;  2LQJ A;  4DPX A;  4IQM A;  5HRO A;  2XMV A;  1X5T A;  2EG2 A;  4NE9 C;  1N88 A;  3M8P B;  4ZVQ B;  4K59 A;  2HIQ A;  3ILO A;  3KHH A;  5U47 A;  1FD8 A;  4K8R A;  3M30 A;  2ASY A;  3LA0 A;  4LF4 J;  3DHW C;  5E3R A;  5CQG A;  1T9T A;  3J7Y U;  2DIU A;  2P9G A;  3PY8 A;  2HHU A;  3T9Z A;  3GFZ A;  3PO5 A;  1AFJ A;  3OTE A;  1ELO A;  3D6F B;  3IMQ J;  2VHG A;  4CLL A;  1YIJ S;  3HVT B;  4GRS A;  2YBV A;  3M1V B;  4DX8 H;  1NUE A;  1BUX A;  3MM9 B;  3V6H A;  3DYA A;  1J5E F;  5K9F A;  2IBK A;  4PEO A;  2UP1 A;  1IBL F;  4OHV A;  1LXJ A;  3NOG A;  3MOZ A;  4RWX A;  1JX4 A;  2HHQ A;  3KK2 B;  1S1T A;  2LU1 A;  2JDJ A;  5EWG A;  4B3O A;  4ID5 B;  5THW A;  2ZBP A;  3TAN A;  3C16 A;  1RAH B;  1RTJ B;  4PG4 A;  3KG1 A;  2XMA A;  3BQ2 A;  3IN5 A;  3PX0 A;  3NS7 B;  3GP9 A;  3CCV S;  1RCX B;  1B7F A;  3FFI A;  5E0O A;  4UUW A;  4J9O A;  1M1G A;  3TZX A;  1AZS B;  1MLA A;  3F56 A;  2H5E A;  5I3P A;  3L95 X;  4LF7 J;  3MF5 A;  3GR1 A;  4DF8 A;  3CJK B;  4JV1 A;  1ZM3 A;  1QJH A;  2GIR A;  5HP1 B;  1YTY A;  3CD0 A;  4OX7 A;  4DR1 J;  2RF2 A;  3HSZ A;  2QGF B;  3JXO A;  2LEA A;  2B51 A;  4NPO A;  1T3N A;  3BGU A;  4QIV A;  2L41 A;  2FVP A;  1FKO B;  1U6Z A;  2JX2 A;  5B08 A;  4A8S A;  1MRO A;  4C3M A;  1P9Q C;  3MFH A;  3QJL A;  3EWG A;  1UKU A;  2OI2 A;  1YX2 A;  2V5H G;  4X65 J;  4O3N A;  4P73 A;  2OKQ A;  2GQ2 A;  5KG7 A;  5HI7 A;  2W7O A;  3T6J A;  3W9J A;  1SB6 A;  3AXK A;  1NK9 A;  3SSS A;  2OHD A;  4OFZ A;  1UPM B;  4B3M F;  4IOC Q;  4DG1 B;  3V4I B;  3CTR A;  1FO1 A;  2DHG A;  2ZDP A;  3OTO J;  2HFZ A;  4ZVG A;  5DQG A;  2RDI A;  4DS4 A;  5CCM A;  4JI8 F;  2C2O B;  3G8S A;  3QFH A;  1U47 A;  1GFW B;  2PDA A;  2IC3 A;  3BO3 A;  4O44 B;  3OJS A;  2WON A;  5D0G A;  5A8W A;  1S99 A;  2HHW A;  2Z30 B;  1NAQ A;  5KG1 A;  1NSP A;  2OUG A;  3SMZ A;  1UW4 A;  5C24 B;  3E8O A;  3P8B B;  2JWN A;  1RTI A;  1SKS A;  1GT8 A;  2EW9 A;  3EMT A;  3POT A;  1VQN S;  2DB1 A;  5CYM A;  4RX6 A;  1CQM A;  2OO4 A;  2JFD A;  1B0P A;  1FK9 B;  1VIO A;  1Z2Z A;  5B0B A;  4JI3 J;  3A3N B;  2RQM A;  1UW9 A;  3PFO A;  3W9I A;  5D3G A;  3HHK A;  3DI6 B;  1PGZ A;  5KFK A;  2CQ4 A;  4OX9 F;  3RJM B;  2W9B B;  4DX6 A;  3HKW A;  2OMO A;  1R89 A;  4ECZ A;  1ZAX A;  3H59 A;  4NX9 A;  2IRX A;  1HBO A;  2V68 A;  1RWK B;  2AYB A;  1WOS A;  1YJ9 S;  4F4Z A;  4KH0 B;  2POK A;  2GJF A;  2WZ1 A;  4YY3 F;  5DO2 A;  3B4D A;  3AB2 B;  1H2U X;  2A10 A;  2QLX A;  3AOC A;  3RW6 A;  2JC1 A;  5DZ7 A;  4FBT A;  4AL5 A;  3BV8 A;  2GMJ A;  4QW9 A;  4ED0 A;  4NLD A;  4XPE A;  1S6Q B;  1VQ9 S;  2AYE A;  4LFC F;  1U1Q A;  1FES A;  4J37 A;  4NLS A;  3V6D B;  4NCA A;  1FER A;  1TL1 A;  3OVB A;  5CAB A;  3OUY A;  2O3D A;  1PYO B;  2H51 B;  1Q0N A;  4B3T F;  4FN5 A;  1HR0 J;  2Q79 A;  3M6V A;  2Y1J A;  3ILI A;  2PEH A;  4PXC A;  2FPH X;  2FVR A;  3M9O B;  2LXI A;  5KFP A;  3PX6 A;  3U02 A;  2MQO A;  3VAI A;  1FRM A;  4EBE A;  1UJ6 A;  3KHL A;  1IBM F;  1HQ2 A;  3VGV A;  3J7Z T;  4NLQ A;  4EZ6 A;  5F8G A;  4NWB A;  1VQS A;  2QE5 A;  3K5O A;  1EJ7 L;  2HVZ A;  3JSY A;  3FEZ A;  4IFY B;  3EZ5 A;  2AIR B;  2EFG A;  1RT5 A;  4OHZ A;  2VD3 A;  2ZC3 A;  1IN0 A;  4DR5 F;  2YWK A;  1X4A A;  1RWP B;  1T7P A;  2W4C A;  1T9V A;  3LGH A;  1JXL A;  2IY5 B;  4F3Q A;  3UR0 A;  2DHS A;  3L9Z A;  4OI2 A;  3T5K A;  2CPH A;  4ITS A;  3RYL A;  4N76 A;  4GKK J;  2ZE2 A;  5BR8 J;  2XI3 A;  4ZCI A;  2HVI A;  3WC2 A;  2QRR A;  3EXC X;  3I9V 9;  1L5U A;  5K8P A;  2DGU A;  2H5I B;  1F9F A;  1DUR A;  5DET A;  3L3C A;  1VJW A;  3DKD A;  5FDL B;  2ZHA A;  3C15 A;  3G6Y A;  4NA2 A;  1JLE B;  4X4Q A;  2FJD B;  3NKY A;  4XDC A;  3G8Q A;  2N7C A;  2QL5 B;  2FHO B;  4WE1 B;  4FPI A;  2E5H A;  3THV A;  4FXD A;  1XR7 A;  1SIZ A;  1J5O A;  2CJX B;  2OEM A;  2HNZ B;  2B5J A;  1WOO A;  3NLC A;  4X4O A;  3BN4 A;  2R8H A;  2RU3 A;  2JLF A;  3SQO P;  2Q1L A;  4PWD B;  2U1A A;  1R8C A;  1IJE B;  4CCH A;  4LRC A;  1WHW A;  1R8P A;  1U0H B;  2DNR A;  1SJ3 P;  3TAP A;  3T41 A;  3MUR P;  3TNV A;  3GQC A;  5D4L A;  3UD3 P;  3NRB A;  1PJ6 A;  2PFF B;  5DGA A;  1GAO A;  2WSC C;  2ASL A;  2A6O A;  4CRJ A;  3BEG B;  3QYY A;  4LRB A;  3HFK A;  1U1M A;  4PG6 A;  2MEW A;  4B9T A;  2CJY B;  1N5V A;  2XUL A;  1VI7 A;  4HT5 A;  2DTJ A;  3ZZP A;  1VFJ A;  3CUN A;  3PEJ A;  4CO1 A;  4F0M A;  2DPI A;  2CJ9 A;  1JMT A;  3I31 A;  2KM8 C;  2CZV C;  3PRV A;  4WYW A;  3AOA A;  4ZP9 A;  2QZ8 A;  1SJQ A;  2HGL A;  1WF0 A;  1D9A A;  2VPY B;  3AHP A;  2VG5 A;  4KKO A;  3NGK A;  3DRR A;  3D6M B;  3VQT A;  3L4B C;  2AQ4 A;  3A8J A;  2L48 A;  3W64 A;  4IRD A;  3MCM A;  4NRU A;  4YP3 A;  2Q66 A;  1S9F A;  2YNI A;  4I6Y A;  2MY7 A;  1VRT B;  3R5J B;  5JVG Q;  2N3O A;  8AT1 B;  5HLF B;  5A6P A;  4JI0 F;  1IWG A;  5J1E B;  3Q83 A;  3DRR B;  2K7J A;  1TEL A;  5D8H B;  2KN4 A;  4B9S A;  1S0O A;  3SZ2 A;  1WDT A;  1IKY B;  3QMQ A;  2OTL S;  2NUU G;  4NMX A;  1RWU A;  1TU0 B;  2DBB A;  2ZWO A;  5J2P A;  4QR2 A;  1RTD B;  3W3S A;  1TMJ A;  3S6E A;  2RKI A;  3MPY A;  1X60 A;  2DKO B;  2OSR A;  3IWL A;  1JLC A;  3U7J A;  3MPD A;  1IWA A;  3DRS A;  2Z2Y B;  4M8L A;  5KTQ A;  3GJR B;  3ILJ A;  3BGL A;  1TL5 A;  1Z2L A;  2X7I A;  3DRX A;  2CVI A;  4YDD B;  2UXC F;  1RBL A;  2RKI B;  3JTO A;  3T5J A;  1X0P A;  2B4O A;  2E1R A;  4Q2M A;  1QDU B;  2R8I A;  2G2Y A;  1I1G A;  4QWA A;  2AX1 A;  3P5B P;  3Q8Y A;  2MZQ A;  4FDF A;  3IG1 A;  3W9H A;  4KRW A;  3J81 Y;  1TAQ A;  1V3R A;  1GNK A;  2MKH A;  3GLJ A;  3GIM A;  3PR4 A;  4Z7Y A;  2BW2 A;  2RVJ A;  3R27 A;  2DGQ A;  3P96 A;  4LQ9 A;  4X4T A;  1TKX A;  4KJI A;  3D66 A;  1V5V A;  3FKB A;  4G1Q B;  2YXL A;  4LR9 A;  1ZA1 B;  3G6X A;  5H9E J;  1SV5 A;  1WG4 A;  3TUI C;  2RIL A;  2DRD A;  3KLG B;  1LWE A;  2BE9 B;  1B7Y B;  1HQU A;  5KFX A;  5T14 A;  1I94 F;  4LF2 A;  1Y5L B;  4P71 A;  5J2N A;  3DOL A;  5L1J A;  1YWX A;  3J7Y I;  5AT1 B;  3MM7 B;  2CWK A;  4ZN1 A;  3OVA A;  3HZG A;  1DQA A;  2V4Q A;  1NSA A;  3VR1 A;  5D0E A;  1SUQ B;  1RYS A;  5KG2 A;  2DNK A;  1Q5Y A;  2KT2 A;  4E0D A;  1QVG R;  4QIW D;  2C1E B;  2YWE A;  1T02 A;  2YKA A;  1KOH A;  4GC6 A;  5AXM A;  2HW3 A;  1TKZ A;  4QYZ K;  2BM0 A;  3OR1 A;  4ERD A;  4B3S J;  1G2E A;  2R8J A;  3T1Y J;  3JYT B;  1GMW A;  5F9L A;  1HHT P;  1W7W A;  3MD1 A;  1K1S A;  2AW0 A;  3CCT A;  2KHC A;  1J2V A;  4CLY A;  3ZTO A;  1E6Y A;  1SL2 A;  1O8B A;  1UZD A;  3DM2 A;  1YKW A;  4L74 A;  2FLN A;  2CQ0 A;  5M2P A;  3T5L A;  1QAJ A;  2G9O A;  1NU4 A;  3LAL A;  3D6H B;  3EDR B;  3I55 S;  4ZLN A;  4B17 A;  3FNN A;  4DWI A;  1E6Y B;  2BAC A;  4CTA B;  1RWW B;  3MMC A;  1VQP S;  3M32 A;  4DX7 A;  4PXD A;  4HDH A;  1YZ6 A;  1KN6 A;  4LQ3 A;  4WPA A;  1CPZ A;  1XNQ J;  2BJ1 A;  2HG4 A;  3TJA A;  3TZY A;  2LQB A;  4UW2 A;  2HVH A;  3HHD A;  2QLW A;  4Y6I A;  2J0S D;  4PR6 A;  4DU7 A;  2YX4 A;  1KDN A;  4C7Q A;  1HNZ J;  2ZUG A;  2J7U A;  4H4K C;  1UWB B;  1VMB A;  4ZKA A;  2DD8 S;  4M5D A;  1WDD A;  1D3W A;  1RJJ A;  1HWU A;  1N5T A;  1SKR A;  2C28 A;  2VOD A;  2C42 A;  2DK2 A;  5EDW A;  1WEL A;  3M2V B;  1S6P B;  2HBY B;  1K1Q A;  4TNO A;  5C5J A;  2DNM A;  4I7F A;  2VF3 A;  1KQK A;  1YJU A;  1TZ0 A;  2RT3 A;  5IV3 A;  4HAC B;  4USM A;  5GME A;  3M8Q B;  3M8R A;  1NDL A;  4L6V 3;  1RTZ A;  5BXI A;  1RU1 A;  3CCM S;  3V4M A;  1DHM A;  4S0M A;  4DR2 F;  2CPJ A;  4JI7 J;  1HWI A;  4MH8 A;  1H2V Z;  3PEH A;  4M5M A;  4NLG A;  2FD2 A;  1S1U A;  3W1Y C;  3X1L B;  4I56 A;  3ZZO A;  4DR7 F;  4WJB A;  3DFE A;  3VZI A;  1SL1 A;  2W24 A;  2ALZ A;  2CPI A;  4GKJ F;  1FJ7 A;  3HHL B;  4FYW B;  2HZC A;  2OPQ B;  1CJV B;  2VDI A;  3IR5 B;  3MMB A;  2MZ1 A;  1NPK A;  2MKY A;  3VGS A;  4ZVO B;  4XPC A;  3MPV A;  3LF0 A;  4N8O A;  2X3D A;  1DAX A;  2EC0 A;  5G4D A;  4F67 A;  1VOM A;  3E3X A;  1U26 A;  2Z4P A;  1N36 F;  2CIM A;  2QLF B;  1UJ5 A;  4NLU A;  2HWH A;  3MI7 X;  1TL4 A;  3BDP A;  4LFB J;  3TW0 A;  2B4U A;  1IJF B;  4WF9 Q;  5IC4 B;  1AFI A;  3SXL A;  2VH7 A;  5IZH A;  4OYI A;  1UWA A;  5E3A A;  4NEY A;  1RT3 B;  2CJA A;  5LJ3 Y;  1U48 A;  3ZTQ A;  1QE1 B;  2KB2 A;  1HMV B;  3BKU A;  3MZI A;  1SJR A;  1ULR A;  1WG5 A;  5HJY A;  2W9A A;  3QAU A;  1P6T A;  2BAN A;  4DV3 F;  1HI8 A;  4NCG B;  3G82 B;  2UUC F;  2R7U A;  1UL3 A;  3R3T A;  1IVZ A;  1SQG A;  1AB8 A;  3KHG A;  4I2P A;  3Q8U A;  1LWX A;  2R2S A;  1R0A A;  1J5E J;  1IBL J;  4DPU A;  4QIG A;  1JB0 C;  3J80 U;  2BVZ A;  4PRF A;  4ZDN A;  2MHN A;  3J80 Y;  4CH1 A;  4RW4 B;  2V8V A;  3OXG A;  3GIK A;  4ZPT R;  5F8J A;  4TYB A;  2HLT A;  1ZYQ A;  1T05 A;  4UT4 A;  3N6L A;  4NAS A;  5HN0 A;  3KDO A;  4YB6 A;  1RWN B;  5FLX Y;  2NYI A;  4NLW A;  1U24 A;  1TQL A;  1G3O A;  1FEH A;  1CUL B;  3U1M A;  2XMM A;  1W25 A;  3TOQ A;  2KXF A;  2CQI A;  4ES2 A;  1M5H A;  3LGM A;  2GJ2 A;  3BBC A;  1WAC A;  4Y3C A;  1BQM B;  1RP5 A;  3GFY A;  2OSQ A;  1FX4 A;  4KB7 A;  1NK7 A;  3M6X A;  1FXR A;  1VGY A;  3CT9 A;  3AQP A;  1W2B R;  3PO4 A;  3DOM B;  1HYS A;  2WK4 A;  4ZA1 A;  4TVA B;  2W8K A;  4M1K A;  2GVZ A;  1KWM A;  4ECT A;  1PG5 B;  2ZZM A;  1FRX A;  1AXQ A;  4R0E A;  1C1C B;  2IA6 A;  2BQU A;  2DRB A;  5T7L A;  3SFG A;  2BQR A;  3AY0 A;  4WFY A;  4C11 A;  1KHW A;  1N6Q A;  3PRB A;  1X4C A;  4CO5 A;  4DUY F;  2UXB F;  1NK0 A;  3QGH A;  4ECQ A;  1IKV B;  4ZK7 M;  2OD4 A;  3UN2 A;  4JI8 J;  4OI6 A;  2KYZ A;  1GXL A;  1SC6 A;  2O66 A;  2VQF F;  3PTW A;  4TY8 A;  1MSW D;  4CDI A;  1M5V C;  4ZPW R;  1RT7 B;  3TAM B;  4Q8E A;  2YQ0 A;  2F40 A;  1HNW J;  1BE4 A;  3OD2 A;  2P9E A;  1URR A;  5ETK A;  5HBM A;  4YQW A;  3GII A;  3EZU A;  4KY3 A;  3BGR B;  2F5G A;  2IMW P;  1U6F A;  2B4V A;  2K3K A;  1NPP A;  2DXE A;  1HNV B;  2LP4 A;  2AGP A;  1H2T Z;  1TFW A;  5G0R A;  1DZ5 A;  4URS A;  5E3P A;  4I1T A;  1S59 A;  3CJR A;  2AZ3 A;  1VJQ A;  3TVZ A;  2HND B;  1R0C B;  3A8K A;  2CQG A;  4G65 A;  1N34 J;  5D0H A;  1EQM A;  4WP9 A;  2HUR A;  2FC9 A;  4OX9 J;  2BKN A;  2C2Z B;  1S49 A;  3D6T B;  4P6Q A;  1E6V B;  1MW7 A;  5I3Q A;  2BDP A;  1RT2 B;  5KFF A;  2H5J B;  2C3M A;  4QPT A;  1TL3 A;  4L76 A;  5ETQ A;  4OI1 A;  1LWF A;  2DR6 A;  1ITP A;  2I1R A;  4LF1 A;  3ISN D;  2B6A A;  2PEB A;  5ETV A;  2XY7 A;  4YY3 J;  1PKU A;  4WXW A;  4C8O A;  3DGP B;  1NKB A;  1YZ7 A;  1VRU B;  2XSJ A;  4ZPV R;  3GV5 B;  4KTQ A;  3UDC A;  4OZ3 A;  3S7R A;  2FDN A;  4DV1 F;  4IG3 B;  2DEI A;  3UPF A;  2XMK A;  3MEC A;  4YOE A;  5JJB A;  3CJ0 A;  4MIW A;  4YR2 A;  3AXM A;  2E7X A;  3VCD A;  1S4F A;  4PQU B;  3C14 A;  3R5G A;  1TL7 A;  3OXF A;  3TX8 A;  4B3T J;  1VR6 A;  5L1K A;  4WP8 A;  4QWC A;  3FSX A;  5ETM A;  3QZ8 A;  4K0K J;  3KNG A;  1TP7 A;  3KLF A;  2CPD A;  2VPZ B;  4DL5 A;  2OPR B;  3WDO A;  3OLA A;  3WX8 A;  3OT9 A;  2E7W A;  3ONQ A;  1MML A;  2VBW A;  4WWS A;  5K8O A;  3OR2 B;  3I0S A;  3JAM Y;  2GIF A;  1IBM J;  2N82 B;  2XS5 A;  3LH2 S;  2A3J A;  4NZ0 A;  2LYV A;  4ENO A;  2KT5 A;  3RR8 A;  3EZO A;  1ZZF A;  2RJZ A;  2LXF A;  3WIV A;  5C42 B;  3NP5 A;  1RT6 B;  3MD3 A;  2BE7 D;  2F1F A;  2ZH7 A;  4RLE A;  4PUO B;  1DRZ A;  2SXL A;  3UWT A;  4DR3 F;  1C0T A;  2W7A A;  4PKD B;  4ZCM A;  4R0J A;  4DR5 J;  2HFU A;  2XYG B;  1TVR A;  4OJ3 A;  3ZNJ 1;  5HVF A;  3CDU A;  1R43 A;  1AA1 B;  3FJ2 A;  1OMS A;  3BSN A;  4WU3 A;  2ADB A;  4RBU A;  2PFD A;  1JJ2 R;  1KC8 T;  3SCL E;  1IR2 A;  3CCJ S;  1IBK F;  1FTC A;  1P8G A;  4M63 A;  5KFW A;  1TVR B;  3T5H A;  4DX5 A;  4CT8 A;  1T03 A;  1U1N A;  3TUP A;  2EVZ A;  2N4C A;  2JFK A;  4CM2 A;  4Y2I A;  3BH6 B;  2MQN A;  3UCZ P;  3C66 A;  2D3O 1;  4U7U K;  2H1Y A;  4YB7 A;  4K4S A;  4DL2 A;  1S9G B;  1KR4 A;  2DGO A;  2ZIT A;  2VQE J;  3K5N A;  2KZZ A;  5D77 A;  3HJF A;  4RUC A;  4RW6 B;  3QWP A;  2LLZ A;  2HRU A;  3GJT B;  1UA1 A;  1L3U A;  1EAY C;  2VOO A;  1JLG A;  2V4R A;  1U2F A;  2NXN A;  2HHX A;  2RUS A;  3EM1 A;  3G6V A;  1QY7 A;  3IBC B;  3DRP B;  2J5A A;  3Q8P B;  5ETN A;  1MMN A;  2QTW A;  2CPF A;  5DRK A;  3RRH A;  3QT7 A;  3LUY A;  3R7B B;  3J7A N;  2MYF A;  4KFB A;  3DLG B;  4RNF A;  4DQI A;  3UCU P;  1S48 A;  4DV4 F;  4DPO A;  4EFA C;  1S9E A;  4J7C A;  2E44 A;  1PAE X;  4R25 A;  3D0G E;  2RAQ A;  5C25 A;  4ECS A;  1PJ5 A;  3NG8 A;  2KXH A;  2D7S A;  3NGR A;  2DPJ A;  3KLV A;  2DGX A;  4KE5 A;  2KM8 B;  4F3M A;  1QM9 A;  4ZVF A;  3MAA B;  5SZT A;  3RTV A;  1JLF B;  3DLE B;  3SCJ E;  1KBR A;  3MM6 B;  3MEE B;  5HAN A;  1ROF A;  3BDE A;  1C4A A;  3W60 A;  3RUB L;  3K57 A;  2FJW A;  5KFL A;  2X1G A;  4JI0 J;  2UZA A;  2V8G A;  2CQB A;  5ADZ A;  1JQG A;  2XC9 A;  2KDO A;  3AA8 A;  1N5S A;  4N77 A;  4C48 A;  4Y65 A;  1U25 A;  2IAJ A;  1XMQ F;  4TQS A;  1Q95 G;  1XN9 A;  2OJ3 A;  2VJV A;  1R27 B;  5CH7 B;  5F3Z A;  2D9P A;  3HHN B;  1LK7 A;  1MN7 A;  1LKZ A;  4USH A;  3KLH A;  2YWH A;  2LXU A;  2M5Y A;  4LIW A;  5D4P A;  4A8W A;  2ACM A;  2BW7 A;  2DNN A;  1HNI B;  1EX8 A;  1BQX A;  2AJ2 A;  5ETT A;  4TU9 A;  3ZTR A;  2OTJ S;  2EFO A;  1O6X A;  4USU A;  1FNO A;  2UXC J;  4PXB A;  4O3Q A;  4Y00 A;  2HMI B;  2D74 B;  2HVE A;  2V9K A;  2J76 E;  1RDR A;  4MFB A;  4L75 A;  4DPW A;  4QQB A;  1WKL A;  3R9L A;  1WKJ A;  3PYE A;  4AD6 A;  1UAW A;  2CQC A;  2J8S A;  4OYB A;  1Q7Y T;  4C8K A;  5DQI A;  2JVO A;  3G96 A;  5KT2 A;  1QLN A;  2CZ9 A;  5H1S V;  4ILM A;  2DR7 A;  1MN9 A;  1XWL A;  3GFX A;  2YH0 A;  2E5G A;  3EUN A;  2ZNZ A;  4RW8 B;  2XHC A;  4UQT A;  1WG1 A;  4LF6 J;  5KOX A;  4DCP B;  3TRG A;  4A8Y A;  2JLG A;  2VIH A;  4F25 A;  3QNW B;  3GCX P;  4L3N A;  3I56 S;  4X4S A;  4B9U A;  3EDQ B;  5D15 A;  4LRD A;  3MPU B;  2PT0 A;  1FRI A;  1GTE A;  3ADA C;  5SUH A;  2VB6 A;  2BZ2 A;  1HL6 A;  5KFC A;  3EYZ A;  2WCX A;  1BQN B;  1SJF A;  5CCL A;  3Q89 A;  1YIT S;  1S12 A;  3MDF A;  1B64 A;  2ADC A;  3MR3 A;  4ZS6 A;  1RAB B;  3PJX A;  2YNG A;  1K8A T;  2V34 A;  2WSE C;  3N5F A;  4FXW A;  2ACY A;  3FBC A;  1VQ4 S;  4KO0 A;  4RUH A;  1D1U A;  3KFW X;  1MMD A;  3B82 A;  5HMZ A;  1S1V A;  1NKC A;  2R9L A;  4W90 B;  4HHJ A;  4OJG A;  5I4M A;  4Y2K A;  2OPS A;  2WVE A;  5B0E A;  1FKP B;  1U1R A;  3IP0 A;  2XCP A;  2FHM A;  1FI4 A;  3FC9 A;  4OZ5 A;  4DR6 J;  3OTC A;  3VAJ A;  4PWU A;  4EU0 A;  2E7V A;  3I96 A;  3IBW A;  1Q81 T;  4USI A;  3ENQ A;  4XK8 C;  2R4F A;  3OL9 A;  4CYU B;  3MED B;  3DMJ B;  3FBF A;  4LSN B;  4OZN A;  1HI0 P;  2C2R A;  2GZO A;  1RYR A;  1NLK L;  2EKY A;  2DHH A;  3D1O A;  3CMQ A;  1SJ1 A;  1F3F A;  3R7S B;  4DPY A;  1N52 B;  4HTJ A;  3RBD A;  4NZ6 A;  4H4K A;  3Q2T C;  3HVA A;  1TV6 A;  3DLB A;  3FZ2 A;  4WII A;  4CLZ A;  1HKA A;  1R7I A;  2V4J A;  3Q8S B;  2RS2 A;  4IFV A;  3DCA A;  4IOA Q;  2IRY A;  4RPF A;  3PKY A;  3CUL A;  1VIX A;  2I6W A;  2HHP A;  2Q3P A;  3E01 B;  2XMU A;  2NZ4 A;  1S0M A;  2X1A A;  1NB7 A;  2VFS A;  2E5L F;  1F2H A;  4EYI B;  2XYP B;  4AT1 B;  3RG6 A;  3MM8 B;  1NH8 A;  3G4S S;  3RAX A;  2PII A;  5L8R C;  2K1R A;  1BWE A;  1DTQ B;  4MKA A;  4FYX B;  4LSL A;  3OSN A;  2DEJ A;  1JLA A;  5KFR A;  3QAT A;  4DR7 J;  1X8D A;  2PA8 D;  4KYZ A;  1V5I B;  1S1X B;  3KWM A;  1N56 A;  3QWU A;  1Q4R A;  4DL6 A;  1YRT A;  1NRK A;  2W2O P;  3JQM A;  1UET A;  1IKX A;  1RTH B;  2YNH A;  4JB8 B;  2MGZ B;  3BO4 A;  1X9S A;  5H9F K;  4YDX A;  2BBE A;  4RW7 A;  1VBY A;  4IDK A;  3DOK B;  4N8N A;  3ZZT A;  3M2U B;  1N5Y A;  3PNI A;  4ELV A;  4QIF A;  1FNX H;  2YPY A;  3L7O A;  1MU2 A;  2HS3 A;  2V8D A;  3M8S A;  2CQ2 A;  2C2D A;  2BE2 B;  1OS5 A;  2DYA A;  2P2C B;  5KT4 A;  4DV7 F;  1B3T A;  3CME S;  3LP2 B;  3GCW P;  3BR9 A;  1U02 A;  4DF4 A;  4Z37 A;  3QGG A;  1KOO A;  4J9K A;  2M4M A;  1FF2 A;  4CLF A;  1UVN A;  4E8U A;  2RU9 A;  2DNQ A;  3EPG A;  3BJY A;  4DV3 J;  1YHQ S;  2YKQ A;  2IVF B;  8RUC A;  3HUL A;  4DL3 A;  2UUC J;  2DGT A;  2VZ9 A;  1R3N A;  4LRF A;  2UXD F;  1LFP A;  2M8H A;  4DSJ A;  2QT7 A;  1H98 A;  2N3L A;  1D9F A;  3C2P A;  4NEZ A;  1X0F A;  2FJB B;  1SVD A;  2YKP A;  1D9D A;  5KFV A;  3KLE B;  3LP0 B;  5F8N A;  2MKI A;  2EK6 A;  4HKQ A;  1ZA2 B;  3KG0 A;  1R6Y A;  3S01 A;  3HZE A;  2IBO A;  1UFW A;  2NPI A;  3AD7 C;  1KD1 T;  4KHR A;  1Q53 A;  2HKE A;  4B9V A;  3ZZ0 A;  1HBM B;  4PQA A;  4ES3 A;  3HT0 A;  1ZS6 A;  2CQ3 A;  3QO9 A;  1TK8 A;  3BGO P;  1UVM A;  1DBD A;  3BPS P;  2GC8 A;  1RT1 B;  2OML A;  2AEJ A;  4KBI A;  5DG8 A;  1JKH B;  2OPP A;  3GR0 A;  5KFB A;  1FX2 A;  4C8N A;  2VKZ G;  1Y11 A;  5E2Q A;  2BA9 A;  2KHD A;  5IWA F;  4DSE A;  3BN7 A;  5A8K B;  1RAJ A;  3U1N A;  1HW9 A;  2MJU A;  1Y9O A;  5HMW A;  3A8I A;  2D41 A;  4EGL A;  2CPX A;  1HHQ A;  2BXJ A;  3W2V B;  5E7O B;  2MPU A;  3FEY B;  2UUB F;  1X31 C;  4NI2 B;  2ZH5 A;  4X2B A;  4DJB A;  2HAF A;  2V8P A;  3M6W A;  2PSZ A;  1C1B B;  3R5C A;  4UST A;  1WEY A;  2AGQ A;  2YWW A;  3J7Z 5;  2V63 A;  2DT9 A;  2GML A;  3PJW A;  4OV1 A;  3NWR A;  3NNC A;  3K5P A;  2J0W A;  2UU9 F;  4DUY J;  1CJT B;  2UXB J;  3UCG A;  3FSI A;  1M1K T;  1XEZ A;  4BBY A;  3R2C J;  1IUJ A;  5FII A;  4D3G A;  5GAD I;  3TA0 A;  4ILR A;  3H2L A;  3OW2 R;  1WC6 A;  4ZP7 A;  3OV7 A;  2UUW A;  2ZZN A;  3TO8 A;  2IM3 A;  5CYQ B;  3BR8 A;  4ED1 A;  4ED6 A;  2V6A A;  4OX8 A;  4RW9 A;  3M9N B;  5LT5 A;  3KYL A;  2YPZ A;  3QLH A;  5IT9 U;  1N48 A;  2NUH A;  2GFF A;  1LW0 A;  5DG9 A;  2CDQ A;  2V69 A;  1Y00 A;  1FWP A;  2XNQ A;  1D8Y A;  4N7T A;  4O3R A;  1BHN A;  2GCF A;  1HQE A;  3VAF A;  4RW9 B;  3H0P A;  4ZCK A;  4MK9 A;  1IR1 A;  4DU8 A;  3CDB A;  5IM0 A;  4USV A;  3OL6 A;  4AUK A;  3JSM B;  1F2G A;  3HSG A;  1YRX A;  2VPW B;  4IG0 A;  1LW2 A;  1QTN B;  3M6U A;  1NK4 A;  1OY8 A;  2IYG A;  4KGM A;  2YH1 A;  3SDE B;  2MQ8 A;  3GYX B;  4JP8 A;  1V3S A;  1YBA A;  4PG7 A;  3AH6 A;  2KRB A;  4OZ0 A;  4B9M A;  2WBM A;  1HBN A;  1YGY A;  3JQJ A;  1YRU A;  1RWV B;  2Z2M A;  3QSY B;  2DIS A;  1ZM2 A;  2CPY A;  1S1W B;  2CDR B;  2GAH C;  2RS8 A;  5I3U B;  2GMH A;  4FKY A;  4YB1 P;  3I82 A;  3BGF A;  1R31 A;  1QUP A;  1OWX A;  2YX1 A;  2AYG A;  2ZUA A;  4YEA A;  1FXD A;  1LV5 A;  3IS9 B;  3NCR A;  4EWT A;  4DV1 J;  3M8Z A;  3ET6 A;  4ES1 A;  1VC0 A;  3BSA A;  2YKN A;  2YKM A;  5AJ3 F;  3CWJ A;  2I5J A;  3R5A A;  2PA3 A;  2BOP A;  4ZMM A;  2VDH A;  2LVW A;  3HLU A;  1OYD A;  3KLI B;  1Q82 T;  3G9C A;  2MKK A;  4J5O A;  3K17 A;  4K4Y A;  3VVU A;  4DV5 F;  3MUT P;  5JXS A;  2IJN A;  2UUA F;  4ZPB A;  4ED7 A;  3HMJ G;  1N8R T;  1UFL A;  4NOH A;  5K14 A;  2VA2 A;  1VBX A;  4ZP6 A;  4UZB A;  3CPW R;  3DLK B;  1CJK B;  4CLS A;  2AU0 A;  1BY9 A;  1RK8 A;  2BJ3 A;  3F41 A;  1YJN S;  2VC0 A;  4HHH A;  1WTB A;  2IMO A;  2MST A;  4BC7 A;  3UFC X;  4NXM J;  4QIE A;  4DR3 J;  3QBC A;  1APS A;  3LTO A;  5LM7 E;  1YQH A;  4OZ2 A;  1RUS A;  2W2N P;  4AYB D;  4TYA A;  5C2C A;  3H5S A;  3LAK A;  4W4M A;  1QUV A;  2MLZ A;  5EWE A;  4UZC A;  2C2K B;  1JXV A;  1FNM A;  2Z58 B;  4C0O C;  3IRX B;  2R8G A;  1RA6 A;  2HHV A;  1Y3K A;  4U7U D;  1X5O A;  1TK0 A;  5I42 A;  1QSL A;  4J91 A;  2E1M C;  3R1H A;  3CD6 S;  3CCS S;  3V6J A;  1IBK J;  3HHL C;  2ZH3 A;  1SH3 A;  3NMA A;  2E9Z A;  4QJV A;  4RJV A;  1WSV A;  2NQP A;  4QYR A;  2HWT A;  1FTR A;  1OJ4 A;  2IVM A;  4OI3 A;  3DDI A;  2CWX A;  3D7S B;  4N41 A;  3LGN A;  2ZWP A;  4I4B A;  1RT4 A;  3ITH B;  2XO7 A;  4EBC A;  4DQQ A;  1L3S A;  3U1L A;  2YNF B;  1PO6 A;  1Q5V A;  2EFP A;  3M8P A;  4IRK A;  3BH7 B;  2FGO A;  1LNQ A;  2D3U A;  5GAE U;  4UUX A;  5D4N A;  2RD5 C;  3HHL D;  3GG1 A;  3D4J A;  5BYQ A;  4DSI A;  2B8P A;  4C8Y A;  3L7P A;  2BMB A;  3MTJ A;  4TU8 A;  3GSI A;  2C3P A;  4WXO A;  5KFS A;  2JLE A;  3NGS A;  2HFN A;  1WNE A;  1R8A A;  1T9X A;  1HWL A;  3TYT A;  1U2R A;  3HVT A;  3M1V A;  3MM9 A;  2R42 A;  1G7C B;  2NXE A;  4OQJ A;  3I5A A;  2I9S A;  3FCW A;  3UE2 A;  4P10 A;  3D54 A;  5LOQ A;  2CQ1 A;  2WW8 A;  3TUZ C;  2AD9 A;  3GFH A;  4O23 A;  1XMB A;  2WB1 D;  3KG4 A;  3KK2 A;  4O0N A;  2FVQ A;  2FVC A;  1SQF A;  3M8Y A;  1SCJ B;  2F4V F;  4ID5 A;  4DV4 J;  1WUU A;  4LT6 A;  2RRA A;  2CPZ A;  5CYJ A;  5D6G A;  1RTJ A;  2MKS A;  2HS4 A;  2PI4 A;  4R5P B;  1FCA A;  2Y8W A;  4Y34 A;  1U4B A;  4C6A A;  1FRK A;  4BCA A;  1AZS A;  1FRJ A;  1YJW S;  3H2V E;  5IFM A;  2R7S A;  2MKJ A;  3OBI A;  4FBU A;  2HBQ B;  3KK3 B;  5B0D A;  3D1H A;  2MQQ A;  1NJI T;  3HVR A;  3CJK A;  2KZM A;  1NEE A;  3T1H F;  2H9Z A;  1NM2 A;  1GXU A;  2OLW A;  5HP1 A;  3RGI A;  5CHC B;  5KT7 A;  1VCT A;  2MZT A;  4X64 J;  3NGT A;  4O3O A;  3CIZ A;  5KFA A;  1OO0 B;  1EET B;  1U1O A;  2XZW A;  2OEL A;  3QZ7 A;  4F4Y A;  1Q86 T;  5A0Y B;  4LFA J;  1FKO A;  4Q43 A;  3VAH A;  3FZB A;  3PRD A;  1RLD A;  4C98 A;  1XMQ J;  2RQK A;  1LK5 A;  3TI0 A;  2QMW A;  1FJG F;  3K89 A;  2BJE A;  4ZVH A;  2ZFH A;  5HVG A;  4F4K A;  2FLP A;  4NZ7 A;  3EJM A;  2YKO A;  1K47 A;  3RRK A;  4EMD A;  2AX0 A;  2NCK L;  2WBR A;  1PC4 A;  4C0H A;  1NHV A;  1PBA A;  5LMU F;  2B43 A;  2YX7 A;  2DH7 A;  2W9C B;  3BSO A;  4NYO A;  4DG1 A;  1FFG B;  3V4I A;  3H2U B;  4ALZ A;  5KT5 A;  3R5B A;  4V19 J;  3LP1 B;  4KV8 B;  3VVT A;  4C0B A;  7FDR A;  1AUS L;  4ICL B;  2O5D A;  4P74 A;  4CO0 A;  2MSS A;  1YJR A;  2NSB A;  4OX6 A;  2QX0 A;  3CCQ S;  3MCO A;  1ZPW X;  4TQR A;  3KDN A;  4UOG A;  4K4T A;  1HFE L;  3K8V A;  4O44 A;  4ZJO A;  1RWM B;  3I5B A;  3OFF A;  4F4A A;  1I51 B;  2PI5 A;  1ZET A;  1XTZ A;  1JNR B;  1RLC L;  2FUG 9;  1C0U B;  3MEK A;  5C24 A;  4OZJ A;  4EYH B;  2C3Y A;  2K8G A;  1DFD A;  4JI6 F;  1FRL A;  1LXN A;  4L3K A;  2O01 C;  2GS8 A;  4DV0 F;  1D09 B;  4DV6 F;  3ICL A;  1FHT A;  4MAK A;  1S6U A;  1FK9 A;  2PN6 A;  3G87 A;  1ICE B;  2EFV A;  1LQ9 A;  2ZHO A;  2EG1 A;  2OIH A;  3DI6 A;  2IVY A;  4J9N A;  4PPD A;  1RBA A;  2V94 A;  2IJR A;  4U8Y A;  3KHR A;  2W9B A;  4K50 A;  1S7H A;  3PR5 B;  3HP6 A;  2E1C A;  2EFN A;  3NS6 A;  3CJ8 A;  3H25 A;  1XJW B;  4C3K A;  2QFJ A;  2G1D A;  4NYP A;  2CG8 A;  1TKT B;  3DLJ A;  3CJS A;  5K20 B;  2DNZ A;  1S4E A;  3S8S A;  2GVD B;  2R7V A;  5DS7 A;  4QWB A;  5KFJ A;  4KGZ B;  1JIH A;  4YS2 A;  1S6Q A;  4M5G A;  1UZH A;  3OQ2 A;  3RAM A;  3MAQ A;  3CMA S;  1EHW A;  3V6D A;  1SBR A;  3DN9 A;  3NGU A;  2Y0B B;  4JUZ A;  4NYZ A;  2FLL A;  2XQC A;  2DIV A;  3QFW A;  1VQK S;  4EEY A;  2OH2 A;  2OEJ A;  1BD6 A;  2QG9 B;  4W98 A;  3SCI E;  3ENW A;  5JVH Q;  4O4G B;  1RKJ A;  1HR0 F;  4PWW A;  3V81 B;  1SIW B;  3CJ2 A;  1YDL A;  4YME A;  4QBU A;  4DN0 A;  1F5C A;  4YN3 B;  5J2Q B;  3UDE A;  1EP4 B;  2GAG C;  2O1P A;  2EK1 A;  2AJQ A;  4ZLL A;  4GVB A;  2CNK B;  1RAG B;  4YR0 A;  4WIQ A;  3B78 A;  3A3P B;  3I87 A;  1TUV A;  4KIA A;  4BDP A;  1T95 A;  4U6P A;  3NCP A;  4KGV B;  3PYD A;  1R6V A;  4IFY A;  1S57 A;  4HYK A;  4CT9 A;  4GVB B;  3DNC A;  3FMW A;  1X9M A;  4MK8 A;  3QIP B;  3SYZ A;  1AYE A;  4ZHR B;  4FNI A;  2LDY A;  1TR0 A;  2J7W A;  3GZ7 A;  3QT6 A;  2F9D A;  3W66 A;  2IYI A;  3D0H E;  3VWS A;  2OD6 A;  3CW2 C;  5EN1 A;  3WBZ A;  1DY3 A;  4OMF G;  3SV3 A;  4G3I A;  4O3S A;  3TX0 A;  4DL4 A;  1QSS A;  3U27 A;  2XCA A;  4IR9 A;  2FHK A;  1KKH A;  2E5L J;  3KMS A;  1HBU B;  2ZBI A;  4WZM A;  3CJT A;  3JSR A;  2ATC B;  5FDL A;  5IS2 A;  4WTY A;  1JLE A;  2HAI A;  2C3U A;  3LQV A;  1GMU A;  4WE1 A;  4P72 A;  2DNG A;  1PIE A;  5KAK A;  3O5T B;  2XZD B;  3CF5 Q;  2HNZ A;  1BXN A;  2DNO A;  4NLY A;  2OFH X;  4PYA A;  2FLO A;  4J9S A;  3ELH A;  4XTT A;  4PWD A;  2DCU B;  5B0G A;  2A18 A;  2XHW A;  1DTT B;  2HPU A;  5C7P A;  4HR2 A;  1U0H A;  3FBE A;  4FNH A;  4U95 A;  2KO1 A;  2DH8 A;  3EPI A;  2E29 A;  2MLX A;  5LMN F;  1SKW A;  2AF6 A;  2E9T A;  1G4C A;  1XBW A;  4J9P A;  1FT8 A;  2WHO A;  1WC3 A;  1A0O B;  1KLM B;  1ZM9 A;  4DV7 J;  5RUB A;  4J9U E;  3Q86 A;  3ZZZ A;  4X4P A;  4H54 A;  1VC6 A;  1Y0H A;  1SQE A;  4FYY B;  3CCL S;  4V19 X;  2PMW A;  2QO3 A;  8ATC B;  4CLU A;  4JOU A;  5IOL A;  1RHJ B;  1UA0 A;  2QL7 B;  4WP3 A;  4IH6 A;  3W2W B;  2EBE A;  1U1P A;  4AL7 A;  1WF2 A;  1VRT A;  5CZV A;  5HLF A;  4OYO A;  2Y0S D;  1PBU A;  5J1E A;  4BWJ A;  4FF2 A;  3M9M B;  2AP6 A;  4H4O B;  3GV7 B;  4G1P A;  1CQN A;  1SKU B;  1O0P A;  2VG7 B;  3MM5 B;  2J9C A;  1IKY A;  2KJW A;  4P75 A;  2A0F B;  3N01 A;  2HRT A;  1DLO B;  3K8W A;  4ZVU B;  3N4W A;  1OSD A;  3A3O B;  1CJU B;  5LJ5 Y;  3DGV A;  3MMA B;  4C3L A;  1RTD A;  3QGI A;  2FY1 A;  5KG4 A;  3GSD A;  3PW0 A;  1OY9 A;  4OYW A;  1IKW B;  4CLW A;  1ZZN A;  3AAW B;  5FD1 A;  3CJQ A;  1RWX B;  3GV8 B;  2HHS A;  4WFB Q;  2VIC A;  2NS1 B;  4YHH F;  3ZTP A;  4ZIT A;  2HSE B;  1NDP A;  2CXE A;  3DRY A;  4RR5 A;  3A12 A;  4MIA A;  1PYT A;  1WOR A;  4QPX A;  4RBV A;  2GGP B;  4JV5 F;  5IWA J;  1JLB B;  4UOF A;  3MUM P;  2P9C A;  4I69 A;  3I4H X;  5A2Q Y;  3CSK A;  2UUB J;  3QJP A;  1S10 A;  3LPE A;  3VV2 B;  4AXJ A;  2ZD1 B;  3UVJ B;  4PAB A;  2N4D A;  2QC3 A;  2W7P A;  1LWC A;  3VAL A;  3W8P A;  3J81 U;  4PAA A;  1T9W A;  2G2O A;  2BX6 A;  4G1Q A;  3PW7 A;  1X4F A;  2UU9 J;  4WZQ A;  4IO9 Q;  1UEK A;  4CLK A;  5F41 A;  1S79 A;  2YQ1 A;  1NJY A;  1LWC B;  3KLG A;  5GAE I;  1X4B A;  3JTP A;  2Z8Q A;  5B0A A;  1RB0 A;  3W63 A;  1N33 F;  1H74 A;  4P7V A;  3NAH A;  4OHX A;  2NXC A;  1XQI A;  4J9R A;  3MFI A;  3MM7 A;  5M2U A;  4QCL A;  2JEF A;  2HHT A;  3OVS A;  2KYX A;  4Q7A A;  2K3I A;  1SUQ A;  3X3U A;  4F7V A;  4FXV A;  4ZOS A;  5F9N A;  4DUT A;  4FYD A;  4ZVP B;  4QR0 A;  4ZVS B;  4IO1 A;  1HA1 A;  3K2Y A;  4KC5 A;  1NND A;  4RO0 A;  2MHE A;  1CS4 B;  3CJ3 A;  3R97 A;  2QYC A;  2ZC4 A;  1NK5 A;  1MWQ A;  2YTC A;  3TVY A;  3C6U B;  3JYT A;  1VHI A;  1JNZ B;  2DY9 A;  4RWW A;  4CO4 A;  3SV4 A;  3L7U A;  3C6T B;  3MEG B;  1FD2 A;  1G1X A;  1VS3 A;  3D67 A;  2ZOF A;  1NKE A;  3BF4 A;  2F3J A;  2D69 A;  1T0T V;  3THT A;  4LMZ A;  4Y0F A;  4DUZ F;  2XLK A;  3LOU A;  1XR6 A;  3F0N A;  1NPR A;  2HNY B;  2ZH8 A;  3L09 A;  2AHO B;  1NJX A;  1IR0 A;  2I8E A;  3RB3 A;  4CTA A;  4DV2 F;  1JJC B;  1GMV A;  3KK1 B;  3F44 A;  5A76 A;  4X4V A;  1OQ6 A;  1K0T A;  2Z2L A;  4DR4 F;  5DM6 Q;  2HHH F;  1VQO S;  5HMX A;  2KU7 A;  2OEK A;  2QYG A;  5GAH U;  2Y3Y A;  3HCX A;  3FBB A;  1BC6 A;  2GO9 A;  2JEJ A;  1REV B;  4AE5 A;  2Y1I A;  1UWB A;  2JC0 A;  3I0R B;  1H3D A;  2N7Y A;  2DNP A;  3SQG B;  2LMI A;  4XO0 A;  3JSB A;  2RRN A;  3QID A;  3M2V A;  5KT6 A;  2MQM A;  1Q8K A;  4F4X A;  1S6P A;  2VG6 B;  5T41 A;  2ALY B;  2CVE A;  2ZHB A;  3HK2 A;  4K4U A;  2GJI A;  1XER A;  3HKZ D;  1NHU A;  4R8U B;  2L9D A;  4HAC A;  4A8X A;  2FJX A;  3J81 j;  2UUA J;  2XY5 A;  2MZJ A;  2KKH A;  3M8Q A;  4RNO A;  2G4B A;  2RUG A;  4WCE Q;  2FB0 A;  1IQT A;  2D3O R;  3IWN C;  2UV8 A;  3NCQ A;  1PYS B;  4QU6 A;  5A8R B;  4CI0 B;  5J2M B;  3W62 A;  2ILZ A;  1K0V A;  2C2N A;  4URQ U;  2RRB A;  4TKT A;  3H7H B;  1YJ7 A;  1KVJ A;  2R7R A;  1HPZ B;  4J9V A;  7FD1 A;  3JB9 k;  1WKK A;  2KG0 A;  2DO0 A;  2HK2 A;  3OLB A;  2F7V A;  3BS9 A;  3PV8 A;  3HHL A;  2OPQ A;  5IXU A;  1FEE A;  1CJV A;  2FHJ A;  1UFK A;  2GA7 A;  4Q0B B;  3W5Y A;  5HVH A;  1RZM A;  2Z2Z A;  3NXZ A;  5L1I A;  1SC3 B;  3KJV B;  4MK7 A;  2A6M A;  2BAB A;  2UVR A;  1T9Y A;  3IR6 B;  3E51 A;  4RU2 A;  2WOM B;  2IDL A;  3DDK A;  4NLP A;  5KFM A;  3Q2S C;  3EVO A;  5DLF A;  1NCL A;  1QAY A;  2LQ5 A;  4LF5 J;  2RSQ A;  3BKF A;  3DC2 A;  2XS7 A;  3QT8 A;  4WFA Q;  2WAQ D;  2XGQ A;  4DS5 A;  3M2R B;  4PG8 A;  5IT4 A;  4I2Q B;  1RT3 A;  3HT3 A;  1CBK A;  4NXN J;  4LR8 A;  1UEU A;  1QE1 A;  1NK8 A;  1HMV A;  4A8M P;  5KT3 A;  2ZJP Q;  4BC9 A;  5IQQ A;  4LF9 F;  3AJ1 A;  3GPA A;  4H4M B;  3TAQ A;  1NB2 A;  5K5M A;  5AXL A;  2BJ8 A;  3HSJ A;  1T3O A;  2NXJ A;  3GE9 A;  4Z2X A;  4NCG A;  2EPI A;  1XK8 A;  5HRO B;  4BWM A;  3I32 A;  4HDG A;  3G82 A;  3NY0 A;  1Y5I B;  7AT1 B;  2LEC A;  1DJ0 A;  5KFG A;  1Q79 A;  5DGB A;  1WEX A;  4CNZ A;  3M30 B;  3N6M A;  3KKF A;  2Q6B A;  1EB0 A;  3H8Y A;  4QW8 A;  2HVD A;  5D0R A;  1NHK L;  4CLT A;  4RW4 A;  1RAO A;  3O3L A;  2F4V J;  4Q5V A;  3DYA B;  4UY8 5;  4P7T A;  2J9D E;  2NLW A;  2E5J A;  5MLC V;  3PIP Q;  1JLQ A;  2VC1 A;  4K5R A;  5F3T A;  2J6U A;  1JWW A;  3IM9 A;  2QA2 A;  3GIL A;  3WZ0 A;  4KQZ A;  4OIX A;  1CUL A;  1S1T B;  4GMK A;  4F2R A;  3KOA A;  1SC1 B;  1VK3 A;  4B3O B;  5FLX U;  1VQY A;  1A7G E;  3T1H J;  3C16 B;  1QAX A;  2B9Y A;  1JLQ B;  1BQM A;  4O0I A;  2XSF A;  1VQ7 S;  3FFI B;  4NL5 A;  3BQ1 A;  2W25 A;  3IWX A;  5KFQ A;  3RR7 A;  1S77 D;  1YK9 A;  3DOM A;  3SBM A;  3SSR A;  3TUJ C;  3PG9 A;  3JQK A;  3MCN A;  3QSI A;  1VQ8 S;  1DAR A;  3WHI A;  3B54 A;  1FJG J;  3T19 A;  2RF2 B;  1C1C A;  4DFK A;  3RW7 A;  5LMU J;  3OL8 A;  5KFI A;  1S5Z A;  1MRO B;  2DR9 A;  4RU9 A;  2BV3 A;  1NH7 A;  1IKV A;  4WBF A;  2WVC A;  3GG0 A;  1TUW A;  1U2C A;  4KPC A;  4TU7 A;  2FY8 A;  4QZV B;  4MMO A;  3UD4 P;  1RT7 A;  1VC5 A;  3TAM A;  1OY6 A;  5BYR A;  4B3M J;  2ZBQ A;  4K2X A;  4QR1 A;  3MOJ B;  1HNW F;  3ETO A;  3BGR A;  3BYR A;  1Y10 A;  3OXL A;  4B3R F;  4M5K A;  3NWG A;  1RCO B;  4DQP A;  1QTM A;  1KFS A;  2H65 B;  3AJD A;  4JI6 J;  1HNV A;  1K44 A;  2FTR A;  2FZG B;  1F1B B;  1YSJ A;  2IC3 B;  4DV0 J;  5MAO A;  4ED4 A;  4M5N A;  2QEX S;  4DV6 J;  2GNK A;  2WON B;  5A8W B;  1RI7 A;  1Q1K A;  2YQ3 A;  2HND A;  1RTI B;  1N34 F;  2BYC A;  2R3V A;  3G8T A;  2KVQ E;  3POT B;  5L39 A;  1E6V A;  1NDK A;  1KFD A;  1RAA B;  2DH9 A;  2XYH B;  5CYM B;  4EK2 A;  2DCL A;  2VU5 A;  1RT2 A;  5B7W A;  4KPY A;  3R5D A;  2R2R A;  2P6T A;  2V9W A;  1CVJ A;  1RA7 A;  3PYG A;  2XBP A;  2M7S A;  5D3G B;  3ZC4 A;  4BLG A;  2XNR A;  3CIM A;  3D68 A;  4PPZ A;  2BJ9 A;  2VKR A;  4P2X A;  3Q24 A;  3VGT A;  2CJK A;  3DXS X;  5DDR C;  3BBB A;  3T1A A;  1N54 B;  1S0N A;  2JSX A;  1DQ8 A;  3DGP A;  1VRU A;  4OHY A;  2CKW A;  3PZP A;  5LXR A;  1U45 A;  3AOB A;  1ZAV A;  3K0J A;  4I68 A;  2B9X A;  2DHX A;  3GIJ A;  2V2Q A;  2ZH6 A;  4IG3 A;  3OPK A;  4MKV A;  2B4P A;  4HHU A;  1P27 B;  1HBO B;  1X5S A;  3HF5 A;  4ECR A;  3AFG A;  2ZBC A;  3QRP A;  1M1H A;  2CQD A;  2MDA A;  1KQS R;  4PQU A;  2VOP A;  3CJ4 A;  4X4U A;  4YB5 A;  4ECY A;  1FDB A;  2ZEJ A;  3SEO A;  3S1T A;  4LFC J;  4RBT A;  4YUD A;  1RHR B;  1U1L A;  1WHX A;  1P1L A;  4ZVE A;  2ERR A;  4K0K F;  2QMU B;  2OPR A;  1OIA A;  4NML A;  3OR2 A;  4DFM A;  2J0Q D;  1TL1 B;  2F9J A;  2WRM A;  2ZVS A;  3CJ5 A;  4OYZ A;  4DL7 A;  3MPW A;  3AT1 B;  3OUY B;  3OTD A;  4NCB A;  4OL8 A;  4LVN P;  3H5X A;  3HDS A;  5B0F A;  1WHV A;  1P9Y A;  3UNY A;  3JTN A;  4W92 B;  3JAM U;  5C42 A;  2LA4 A;  1RT6 A;  5KG6 A;  3GU0 A;  2UUT A;  4PUO A;  4CM0 A;  3N28 A;  3VGU A;  4IH7 A;  3C19 A;  3MR7 A;  3H40 A;  4DZ6 A;  2UVV A;  1RBO B;  3AD8 C;  1VLO A;  2RDJ A;  2PE8 A;  1PAU B;  1Q78 A;  2VFU A;  1OPZ A;  1RT5 B;  4ECV A;  1U6B A;  1NZ8 A;  5HQM A;  5EHH A;  1WI6 A;  2BUN A;  2M3D A;  3CCR S;  1KEK A;  3NL0 A;  4OZ1 A;  4J9Q A;  3ETM A;  4MYU A;  2ZE2 B;  1S9G A;  4DOZ A;  2F8E X;  4FKX A;  1H72 C;  4GO5 X;  2HQG A;  4OLP A;  5HL7 Q;  4D3H A;  2CPE A;  2VQE F;  4EZ9 A;  3A1Y G;  2I2Y A;  1S97 A;  4RW6 A;  5CD4 A;  2V0N A;  4TLQ A;  1EKS A;  2CG4 A;  3C15 B;  1I5O B;  1JK9 B;  1YLX A;  2IPO B;  4WU2 A;  2W1B A;  1F5B A;  4HEA 9;  5GAD U;  2G0I A;  2J0X A;  3DRP A;  3UDV A;  1TMM A;  1J5O B;  3LAN A;  3O1L A;  2B5J B;  5LMN J;  3CO0 P;  3D9B A;  3EGN A;  1IBC B;  2COL A;  1YBT A;  3DLG A;  4OYM A;  3CB4 A;  1OYE A;  2OAU A;  4AND A;  4UOC A;  3HD2 A;  3W61 A;  4DSK A;  2H3E B;  5IC6 B;  1YBU A;  1GX6 A;  4MJK A;  5HMY A;  2HQD A;  3TA1 A;  2QV6 A;  3FQK A;  2MXY A;  5EGY A;  3TR5 A;  5E3Q A;  4FS2 A;  1GX5 A;  1AT1 B;  3ZNU A;  3MAA A;  5GAH I;  1JLF A;  3DLE A;  3FDS A;  3MM6 A;  2CAD A;  3E2E A;  3MEE A;  2NR0 A;  2R7Q A;  3OFH A;  1Q16 B;  4U67 Q;  4X66 F;  4AQY F;  3CNQ P;  4WK3 A;  2IIH A;  2VG5 B;  3N6N A;  4KKO B;  4XAK A;  2BQ3 A;  4UTG A;  5L46 A;  1QVF R;  2FC8 A;  2VFT A;  2R7X A;  2J9E A;  5L38 A;  5DZ6 A;  2LU2 A;  3CDE A;  2V8H A;  2YNI B;  4DPT A;  2A2C A;  2V2K A;  1UTA A;  4RKU C;  2WSF C;  3LPY A;  2ZM6 F;  1IXK A;  4AL6 A;  3K58 A;  1JJ4 A;  3BYP A;  4HH1 A;  3CC2 S;  1HNI A;  2DR8 A;  4YHH J;  4M94 A;  2DXF A;  3C3L A;  2HZV A;  5J2P B;  3CED A;  2HMI A;  5FJ4 A;  2O67 A;  1B0V A;  1RAF B;  4GVL A;  2RNE A;  3TZZ A;  4JV5 J;  1JLC B;  3DRS B;  1URN A;  2LEP A;  2RHQ B;  2I0X A;  1EZZ B;  4O3P A;  4DXL A;  5E3C A;  4ATN A;  3RBE A;  3EGW B;  4X4R A;  2PD1 A;  1RAI B;  3OL7 A;  3M8W A;  5E5N A;  2JRS A;  1I3O B;  5IV4 A;  1S6O A;  3NGD A;  4RW8 A;  1OQ3 A;  3IG1 B;  4F2S A;  4F0K A;  4DCJ B;  4ELT A;  4AXI A;  1RWO B;  4LF6 F;  4JV2 A;  3VF0 B;  4X84 A;  5HQL A;  1N4L A;  2IFX A;  1FRH A;  4YR3 A;  1N33 J;  3W8G A;  1TKX B;  4NLT A;  3ULH A;  1TK5 A;  4U96 A;  2HK3 A;  3PJ9 A;  4DQS A;  4WK1 A;  2VL1 A;  1SV5 B;  1I94 J;  1LWE B;  1BQN A;  1HQU B;  2QLJ B;  3FQL A;  2M2B A;  5J2N B;  3DOL B;  3FGV A;  3Q22 A;  1T8E A;  3BSC A;  4J90 A;  2D9O A;  2W4P A;  2KFZ A;  1MG7 A;  2M9K A;  2DGS A;  3IC1 A;  5DG7 A;  4UY8 T;  2XWX A;  3VAM A;  3TP2 A;  2APO A;  4HLB A;  1UEV A;  3HJV A;  1MWZ A;  3HHE A;  5EX0 A;  2CFX A;  5LSL A;  2BKO A;  2HBZ B;  1FKP A;  3GON A;  2PC6 A;  2G1H A;  2MZS A;  1TKZ B;  5ETL A;  4DUZ J;  1SI9 A;  1BWV A;  4JYA F;  4NLV A;  1FVQ A;  3OR1 B;  2BOA A;  2F63 A;  2BEF A;  2W4D A;  4DR6 F;  4A8O A;  1AUD A;  3CO9 A;  2NPF A;  1ZAW A;  4CYU A;  3MED A;  3DMJ A;  1G6B A;  2ZDO A;  4LSN A;  4DV2 J;  3GYN A;  1SPB P;  3I4P A;  2JHE A;  4Y2M A;  3DM2 B;  3HPO A;  2D1C A;  4PG5 A;  2HQC A;  4DR4 J;  2HHH J;  1MNE A;  5CA5 A;  3IGN A;  3AD9 C;  2GV1 A;  2AWZ A;  3MMC B;  3M32 B;  2Y9H A;  4DSL A;  3UN5 A;  5ETP A;  4JI5 F;  1UVL A;  1UP1 A;  2VUG A;  3CDW A;  3N0V A;  2VBY A;  2EBG A;  4U9R A;  3PM9 A;  4TXS A;  3E01 A;  2WVD A;  3B4M A;  2DRA A;  3PHE A;  1HD0 A;  2H48 B;  2M70 A;  1TKD A;  2B9W A;  4M5D B;  1NBE B;  4DEZ A;  3DU5 A;  2FYX A;  2CQH A;  5ETO A;  3CCW A;  4C8Z A;  1N32 F;  2WTF A;  5AXN A;  1FFW B;  3MM8 A;  1H38 A;  4ZPD A;  1HI1 A;  3Q8R B;  5ETR A;  3RZA A;  4KHP F;  5HJX A;  1N5Q A;  3FCV A;  4CH0 S;  4IKA A;  4X4N A;  1DTQ A;  4I7F B;  4ED5 A;  4IH5 A;  4ED8 A;  2AJ4 A;  1UVI A;  4F3O A;  2EWH A;  3UNG C;  2KI2 A;  2E9R X;  1S1X A;  1GH8 A;  4LRE A;  4OV6 A;  2P8I A;  5KFT A;  5HAO A;  4DR2 J;  4K4X A;  3I5C A;  2FJE B;  1UVK A;  4JI4 F;  3MHY A;  4Y2A A;  1RTH A;  5DQH A;  1S1U B;  5GVQ A;  1F9E B;  4QWD A;  2MGZ A;  4KGX B;  1UMJ A;  1TUG B;  2M52 A;  3D3C J;  4B9L A;  3AJ2 A;  2GQQ A;  3AA9 A;  4GKJ J;  1CEZ A;  1HAR A;  1NO8 A;  3DOK A;  3FSY A;  2EKN A;  2Z0G A;  3M2U A;  4N5S A;  4IYQ A;  1FWL A;  4FF1 A;  1U49 A;  3MMB B;  3ZZY A;  4LVO P;  4JI1 F;  3N79 A;  2BE2 A;  4F0H A;  5DM7 Q;  1H73 A;  1PJ7 A;  4CQ1 A;  3LP2 A;  4F8R A;  1R8B A;  2CJB A;  4USJ C;  2QJ3 A;  1CC7 A;  2HQF A;  4WYL A;  4Q8F A;  3NAI A;  4E98 A;  4TN2 A;  1N36 J;  4QYZ J;  1RAC B;  3ZO7 A;  1ZBT A;  4LF9 J;  1ZTW A;  1U8S A;  2ZNY A;  1UPP A;  3O6Q A;  2WW4 A;  3VAK A;  4KR0 B;  3JS9 A;  3US5 A;  1WC0 A;  1FE0 A;  3P49 B;  1FE4 A;  1NJW A;  1XC9 A;  1PCA A;  3UQS A;  3VTI A;  2W2P P;  1KVK A;  4A48 A;  3DU6 A;  1H7X A;  4I64 A;  1EKR A;  2GHP A;  3ILL A;  2PMZ D;  2HZA A;  4EUV A;  2BAN B;  2BJ7 A;  1XNR F;  4IQX A;  1N0U A;  3OHB A;  4HT7 A;  3V6K A;  3KNA A;  4A8F A;  3A8E A;  4I2P B;  3KLE A;  3LP0 A;  2J6S A;  1R0A B;  4RL1 A;  4HTI A;  3TVK A;  1EIY B;  2X1B A;  2CA9 A;  1ZTT A;  2QLB B;  1EQ0 A;  3CVK A;  3K59 A;  1RIS A;  1S72 S;  1MWY A;  1VHF A;  1FDA A;  1SL0 A;  2AYM A;  4NA3 A;  4LBI A;  2E66 A;  3RB4 A;  1S76 D;  3H42 A;  2B7B B;  2CZ4 A;  2C2M B;  3M4X A;  2ZH2 A;  2R2U A;  1HBM A;  1T05 B;  2ZJQ Q;  1RT1 A;  3HSD A;  4OI0 A;  2F8M A;  2AEM A;  1JKH A;  4M5L A;  2AV5 A;  4CH7 A;  3OFG A;  4P52 A;  4ZIV A;  1Y3J A;  2XLI A;  2M0G B;  3QQC D;  2XMJ A;  2KRR A;  5A8K A;  5GMD A;  4Z7C A;  2DIT A;  3OHA A;  4EO6 A;  3K5L A;  4FS1 A;  2HFS A;  1YG0 A;  3W2V A;  3BBF A;  4M95 A;  5IT0 A;  4NI2 A;  3P4U B;  4F02 A;  3T3F A;  3LAM A;  1C1B A;  1UCN A;  4GO7 X;  2GW8 A;  1XMO F;  3TQ1 A;  3D5M A;  4K5S A;  2DXD A;  1HHS A;  2BR0 A;  2M88 A;  1HYS B;  2FJV A;  3FK4 A;  2GVZ B;  1CJT A;  1KTQ A;  4Y2C A;  2GHW A;  3IR7 B;  2R7T A;  2IM1 A;  2IA0 A;  3A13 A;  4ID8 A;  3QGP A;  2IHR 1;  5KFD A;  2QA4 S;  1PC5 A;  3IGV A;  2AJF E;  5T7L B;  3EVM A;  2LDI A;  3MR6 A;  3Q8Q B;  5CYQ A;  2HS0 A;  4A47 A;  3P45 B;  4P9S A;  4C11 B;  3H98 A;  1N6Q B;  1OSC A;  2QL9 B;  3NEK A;  4LUB A;  2ABY A;  4B3R J;  4OYP A;  2ZH4 A;  1H0H B;  1PIL A;  2VQF J;  3KUE A;  3TJ8 A;  4LRA A;  4ILL A;  2BKP A;  4B02 A;  4TY8 B;  1U1K A;  2HIY A;  5LSO A;  1SH0 A;  4J9L A;  4CP5 A;  3ENA A;  4J9M A;  5HBM B;  4LSZ B;  2ROG A;  3ISN C;  2QA1 A;  3D1Q A;  3DLL Q;  3ZTS A;  2DNH A;  4DBQ A;  5IQ6 A;  3QPI A;  2G2Z A;  3EIC A;  3EVW A;  3CC4 S;  4F36 A;  3JSM A;  4Q2L A;  2EI5 A;  1KRP A;  4LJM A;  1RE1 B;  3KUG A;  4HH0 A;  3NBP A;  3UI3 A;  4B9N A;  2OP5 A;  1M5P C;  5KG3 A;  5G0R B;  3TWZ A;  3SDE A;  2F65 A;  2LFV A;  2UVW A;  2IDE A;  5KFU A;  2MZR A;  4ETX A;  5KFZ A;  4Q45 A;  5DDO C;  3NBP B;  2MQP A;  4XIU A;  1WSR A;  3H4B A;  3KUH A;  5GAG U;  4M5I A;  2L9W A;  3RRG A;  1S1W A;  3W5Z A;  1Y4Z B;  3QT5 A;  1F0X A;  4RNH A;  2ZKU A;  5I3U A;  2G0C A;  2WVF A;  2VV5 A;  2V2Z A;  1TTH B;  2LCW A;  1TL3 B;  3UD5 A;  3IS9 A;  5B0C A;  3BKT A;  1LWF B;  2GIQ A;  2IM0 A;  2YWG A;  3LWL A;  4C2M A;  2HYI B;  1GQE A;  2B6A B;  3P3D A;  4FF3 A;  2AMC B;  3BM7 A;  3MWB A;  3EGZ A;  3HFZ B;  1KTV A;  2BRK A;  3R6L B;  2XSJ B;  3KLI A;  4MKY A;  3MCS A;  1FDN A;  2XZT B;  4FP9 A;  2EEY A;  2L08 A;  1RHU B;  2RE1 A;  4Y28 C;  4P2M A;  1UVJ A;  3MEC B;  4NLO A;  4NA1 A;  2JEI A;  3R8Y A;  1HNX F;  2R7W A;  2ILY A;  5L9N A;  4BS2 A;  3I9Z A;  1M90 T;  4DL0 C;  4ZLJ A;  3C14 B;  3SI8 A;  3DLK A;  1CJK A;  1T94 A;  4PXE A;  1TL7 B;  3MXH P;  3VZH A;  2MY8 A;  3D0I E;  3LW5 C;  1HWK A;  2KL8 A;  2FZK B;  3O2I A;  3KLF B;  3EGV A;  4LF8 F;  4A8Q A;  1VBK A;  1F5A A;  2OGU A;  4DN9 A;  2XM3 A;  4ECX A;  4NXM F;  4FZV A;  3I0S B;  3QRQ A;  2XTJ P;  1Y5N B;  2H4W B;  4K4V A;  3V5R A;  5KFY A;  2MMY A;  1WEZ A;  1Y7P A;  3IRX A;  5BYS A;  2BRL A;  3HM9 A;  2W8L A;  4X62 F;  3KJQ B;  3SIP B;  4P2S A;  4FF4 A;  3G71 S;  4I6W A;  2RHS B;  3M05 A;  1C0T B;  4A4J A;  2H4Y B;  3ENV A;  5HQ8 A;  2MTL A;  2EXU A;  3H5U A;  1D0E A;  1I6J A;  2RIJ A;  3GIR A;  1VQM S;  1SH2 A;  4HL9 A;  3NOC A;  2CUY A;  4G6V B;  4JI2 F;  4U7C A;  2Y1R I;  2ASJ A;  2FJA B;  3BPD A;  4F26 A;  1L3V A;  1O5J A;  1CLF A;  3C8Y A;  3ITH A;  1A9N B;  2X3G A;  2MKC A;  2LKZ A;  4B08 A;  3AOD A;  3CD7 A;  2NXU A;  2YNF A;  3H20 A;  1T03 B;  2IJF A;  1KQG B;  3B6B A;  2KTQ A;  1C2P A;  4I0W A;  2ASD A;  5J1N A;  3RAQ A;  3MMJ A;  2B0G A;  9RUB A;  1N0V C;  2ZZT A;  2NSC A;  4MTP A;  3GYG A;  2VBX A;  2IRU A;  1VDH A;  4DFJ A;  5F8I A;  1HWJ A;  3RBX A;  1JXE A;  2VJU A;  2C22 A;  3NMR A;  4OJH A;  4URG A;  4G1I A;  2ZOM A;  2GO8 A;  4LF4 F;  4DI6 A;  2ZKT A;  3H5Y A;  3CGI A;  5E41 A;  1JLG B;  3Q8V A;  3RU0 A;  1W2I A;  1KON A;  1SJ4 P;  4DFP A;  2R7O A;  1B70 B;  4KT0 C;  3SCK E;  3RBZ A;  1ACM B;  2RQ4 A;  4OYX A;  2ZH1 A;  4EI2 A;  3HXM A;  4FVC A;  4CO2 A;  5DDQ C;  2B8Q A;  1RXO B;  4R5P A;  1KP6 A;  3FMB A;  2AT1 B;  2C3O A;  4ZLP A;  4KFB B;  2KFY A;  4WFZ A;  3MR2 A;  1U09 A;  4ZP8 A;  3KK3 A;  2DHA A;  2K7K A;  2W2Q P;  2Q43 A;  3A4T A;  5CZX A;  2L9N A;  5JMN A;  2I38 A;  1S9E B;  3PDN A;  5AXK A;  1RGV A;  5C25 B;  5LXY A;  1WF1 A;  4IUF A;  2VFR A;  4X66 J;  4AQY J;  2J7K A;  4X64 F;  4K7Q A;  1EET A;  2V50 A;  4MYT A;  3P5T L;  2B9E A;  5A0Y A;  3PVX A;  2DVI A;  2F4F A;  4LF7 F;  1CSJ A;  2PO4 A;  1VBZ A;  2XMW A;  4LFA F;  2HGM A;  1HD1 A;  1GK8 A;  4M5H A;  3QJJ A;  4RUB A;  2V2V A;  4KSE B;  1WC4 A;  4DR1 F;  1FA0 A;  3HX9 A;  3DLH A;  1BGX T;  2KFN A;  1WC1 A;  1L3T A;  2ZM6 J;  1M5S A;  2VON A;  2IM2 A;  4I6A A;  4OJ1 A;  2XB2 D;  1WHY A;  5DDP C;  2ATL A;  2W9C A;  1WD6 A;  2IAJ B;  4CWB A;  5J1P A;  2MLY A;  3OSP A;  2XWY A;  1VRQ C;  5D4O A;  3LP1 A;  2XG8 A;  5CD4 H;  4V1A k;  4KV8 A;  2B56 A;  2G0J A;  4X65 F;  4ICL A;  4F04 B;  2ROP A;  2BM1 A;  1X4G A;  4OI4 A;  3LO3 A;  4IOB A;  3PHT A;  3KLH B;  1K9M T;  2HFO A;  1O51 A;  3OJU A;  1FJE B;  3DHX A;  3TJ9 A;  5EWF A;  3R1L A;  4QU7 A;  4ZPC A;  3FRZ A;  3OTO F;  1B99 A;  3ZZU A;  4TY9 A;  1C0U A;  2CRL A;  3PW4 A;  4QOT A;  2X51 A;  2EFQ A;  3HFV A;  4C8L A;  3KJN B;  1GTH A;  3R2D J;  2W01 A;  3D28 A;  3LWM A;  4MFB B;  1RHQ B;  1S0V A;  3PKM A;  3BB5 A;  4QWE A;  3BRE A;  2AKW B;  1W26 A;  1VLY A;  1FXL A;  4FYV B;  2XI2 A;  2QN6 B;  4U8V A;  3TZW A;  4RUA A;  2CNN B;  3SFU A;  2NYH A;  3IAM 9;  3GJQ B;  1Q7L B;  1SXL A;  5HSP A;  1QD1 A;  4F50 A;  4JI3 F;  2F8H A;  2AJ0 A;  6FDR A;  3IO1 A;  4XDD A;  1M5O C;  4ELU A;  3FVY A;  4DQR A;  3GMG A;  3MTK A;  5LL6 d;  3GJS B;  3M7V A;  1FVS A;  3W5X A;  2J8A A;  1TKT A;  6FD1 A;  3F73 A;  4RNN A;  1ZH5 A;  2GVD A;  1M0S A;  2E1A A;  2JZ5 A;  2AEF A;  2QMX A;  2JEG A;  4IRC A;  3GB0 A;  5KFH A;  1BLU A;  4I67 A;  4ZN3 A;  1T11 A;  4UOH A;  4L73 A;  3DDN A;  4N47 A;  3G6E S;  1EAR A;  1FWK A;  3PW2 A;  4A46 A;  2G13 A;  1NSQ A;  5A6W A;  3T6B A;  1WJ9 A;  2YNG B;  4JYA J;  2FGC A;  1HW8 A;  4KO0 B;  2ZVI A;  3Q23 A;  2LQ8 A;  2RH3 A;  4O4G A;  3H4D A;  3V81 A;  1S1V B;  2RQC A;  2ZOG A;  4WKR A;  2OPS B;  4MKB A;  3ISZ A;  5J2Q A;  3PX4 A;  1EP4 A;  2CYY A;  3CCZ A;  4P2F A;  4OLO A;  2JL9 A; 
#chains in the Genus database with same CATH homology
 4DV1 J;  1XMQ J;  1XNQ J;  4LFC J;  2F4V J;  4YY3 J;  3W1Y C;  4KY3 A;  3J81 U;  3OTO J;  5LMU J;  4DR5 J;  1IBK J;  2KVQ E;  1N36 J;  4DV2 J;  1N33 J;  4JI0 J;  2KL8 A;  2UU9 J;  4LF5 J;  4LF7 J;  2UUA J;  4LF9 J;  4NEZ A;  4RJV A;  4YHH J;  4X62 J;  4JI4 J;  4DV7 J;  2E5L J;  4X66 J;  4AQY J;  4LF4 J;  4DR4 J;  4JI5 J;  4B3R J;  4DV4 J;  2HHH J;  4NXN J;  4PWW A;  1J5E J;  1HNZ J;  4DR1 J;  2VQF J;  1I94 J;  1XNR J;  3JAM U;  1IBL J;  5FLX U;  4DR2 J;  3J80 U;  3T1H J;  4JV5 J;  4DUY J;  4B3M J;  3IMQ J;  2UXB J;  4B3S J;  3R2D J;  3J7A N;  3T1Y J;  4LF6 J;  2MQ8 A;  1XMO J;  5A2Q U;  4DR6 J;  2UXD J;  4JI2 J;  3R2C J;  4B3T J;  1N34 J;  5AJ3 J;  4K0K J;  2MTL A;  4GKK J;  4OX9 J;  4JI1 J;  3D3C J;  5BR8 J;  4JYA J;  1HNX J;  5IWA J;  4JI6 J;  4JI3 J;  2MEW A;  2ZM6 J;  4LFB J;  4GKJ J;  4X65 J;  4HHU A;  4NXM J;  4DR3 J;  1IBM J;  1N32 J;  5LMN J;  5LM7 E;  4DV0 J;  1HR0 J;  4X64 J;  2VQE J;  5IT9 U;  4DV3 J;  4DV6 J;  4DR7 J;  2UXC J;  4JI8 J;  4NEY A;  4KYZ A;  2UUB J;  1FJG J;  4KHP J;  4DV5 J;  3D3B J;  4DUZ J;  2UUC J;  4LF8 J;  4JI7 J;  4LFA J;  4V1A k;  1HNW J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...