3UD4P

The c92u mutant c-di-gmp-i riboswitch bound to gpa
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rna
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ud4P00
2AYMA 2CQDA 3CF5Q 2M8HA 1F9FA 2M7SA 2CQ4A 2K3KA 3CCUS 2QFJA 1X5SA 2QEXS 1X4DA 2CQBA 2GHPA 1U1PA 1WELA 3J7YU 4PRFA 2MZJA 2MKSA 1VBXA 3EX7B 3MURP 2E5JA 2DNOA 4CQ1A 5ITHA 4PKDB 1QVGR 2M2BA 1VC5A 1X4AA 1UP1A 1PO6A 3TYTA 1FXLA 2DISA 3SDEB 3UD4P 4M5DB 4P6QA 4UQTA 3CMAS 3NMRA 3CUNA 1VQLS 1N8RT 2DO0A 2KT5A 2MKJA 5H1SV 1WF2A 2KG0A 1URNA 3Q2TC 1H2UX 3ULHA 2MQPA 4OZ0A 3G8SA 3LQVA 1X4BA 3RW6A 1WEXA 3PIPQ 2D3OR 1U6BA 1FJ7A 3P6YC 3VALA 1AUDA 3THPA 5GMKa 2DNRA 1U1NA 1KQSR 1DRZA 1R8HA 5GVQA 1Q81T 1H2VZ 2DIVA 3VAFA 3CMES 4UY8T 2CPIA 2DNQA 2J0SD 1KOOA 5D78A 2CJKA 1W2BR 2EK1A 3CPWR 1VQ8S 5MLCV 1JJ2R 3MXHP 1X5OA 3HHNB 2VONA 2DB1A 2CQCA 2DHGA 1KOHA 1VQ7S 1U2FA 2RT3A 2FHOB 2X1BA 3ZZZA 2EK6A 2AYBA 2U1AA 2KFYA 1FO1A 3S7RA 2AYGA 4WCEQ 1K9MT 1U6FA 3VF0B 2MJUA 2XNRA 1Q7YT 4A8XA 1XN9A 2EVZA 2KI2A 2FC9A 1N52B 2LMIA 2DNZA 3D2WA 3FEYB 1UAWA 2MQOA 2I2YA 2VODA 1X4CA 5LXRA 2OTJS 1SJQA 3CTRA 2CQGA 1U1OA 2ERRA 1X4FA 5JVGQ 4W92B 1X4EA 1D9AA 4RU2A 1OPIA 4F25A 2YKAA 2RQCA 5LXYA 2U2FA 5JVHQ 5D77A 1FNXH 3UE2A 3G9CA 2KN4A 1KC8T 3TO8A 1DHMA 2XNQA 5IM0A 2E5HA 3RW7A 2MZSA 2CPYA 3J7ZT 2DHXA 5DDOC 3H2UB 2MQQA 1WF0A 2DITA 3SDEA 2CQPA 2KM8B 4TLQA 2G4BA 3VAKA 5DDPC 2F9JA 1YI2S 2FPHX 1BY9A 2CQ0A 2SXLA 3R1LA 1DZ5A 2OSQA 2DGSA 3VAHA 3CCQS 2J8AA 3SXLA 3R1HA 3G8TA 2ADCA 2PEHA 1X5TA 1NU4A 3P5TL 5CYJA 5LSLA 1Q82T 2FY1A 2CPFA 2LEAA 4QU6A 2F9DA 4C0OC 4WIIA 2MQLA 2MZQA 2N3LA 2LYVA 4TU7A 2MZTA 1SJ3P 3K0JA 3THTA 1OO0B 2DHAA 1U1LA 2ZJPQ 1SJ4P 1RK8A 4ZKAA 1PGZA 5LSOA 2MHNA 1SJFA 4YOEA 5EN1A 2CQ3A 1D8ZA 2KG1A 4PR6A 1VQ5S 1P1TA 2ZJRQ 1QM9A 2MXYA 3CCES 2MQNA 2DHSA 2KXNB 1S79A 3NNAA 2MY8A 2YH0A 2MMYA 2MYFA 4Y0FA 3CCJS 2MKHA 3SMZA 1VQKS 2VOPA 2M0GB 1K73T 2KH9A 3G96A 2Q79A 3MUTP 4ERDA 3P49B 3NNHA 2CQIA 1YJ9S 1X4GA 2DH9A 2BOPA 2RQ4A 4F26A 1H6KX 2KM8C 1YJWS 3UCGA 1YITS 1O0PA 2CPEA 3CC7S 3MUVP 1JJHA 1U1MA 2MGZA 1WWHA 1FHTA 3P3DA 2DIUA 3NS6A 1HA1A 4LJMA 5LJ5Y 1M5KC 3BS9A 2VOOA 1SJRA 1JJ4A 4QQBA 1JMTA 5CA5A 2OJ3A 2XS5A 4BS2A 1M5OC 2AYEA 4FXVA 4TU8A 2DNKA 3I55S 2LCWA 1VQOS 1VBZA 3UCUP 3FEXB 1Q86T 2OIHA 3B4DA 2LA4A 1HD1A 4QPTA 1UFWA 3MDFA 3G4SS 2DNLA 1RKJA 1VC0A 2KXHA 3V4MA 2LECA 4CH1A 3MI7X 2A3JA 4OZ1A 2KHCA 1OWXA 2GO9A 4CH0S 2CQHA 1QVFR 3CCLS 2M70A 3UCZP 1NJIT 3BO3A 3CC4S 3LPYA 1VQPS 2RVJA 3CCMS 2J76E 2ADBA 2DK2A 2HZCA 2HGLA 1VQ6S 1M5VC 2I38A 2DGVA 5DM7Q 1WHYA 3S8SA 4IOCQ 3JB9k 2X1AA 2HGNA 2CPDA 3IWNC 4J5OA 2CPJA 3U1LA 3S6EA 2ZJQQ 1X5PA 3MD3A 2YWKA 4CIOA 2M9KA 4C4WA 3UWTA 3I56S 2MPUA 2DO4A 1WTBA 3EGNA 4C7QA 3MUMP 5GAGU 1L3KA 4WKRA 1HL6A 1WG5A 4WFNQ 3EGZA 2MKKA 1ZZNA 2AD9A 1ZH5A 1FT8A 3PIOQ 2YH1A 5DM6Q 3VAIA 4F02A 4V19X 2DNMA 3N9UC 2JVRA 4IUFA 4Y00A 2N7CA 2J0QD 2DGOA 3H2VE 3BEGB 2HYIB 1N88A 2KYXA 1WEYA 2DGWA 2XS2A 1WEZA 1DBDA 2RUGA 2RNEA 1KD1T 2G0CA 2DNGA 1P27B 4EGLA 2JVOA 3R27A 1G2EA 2N3OA 2LA6A 3MOJB 1WG1A 4IO9Q 2M52A 3VAJA 5HO4A 2HGMA 2RU3A 1X4HA 2E5GA 1M5PC 1SXLA 1HD0A 2KXFA 2D9PA 2PE8A 2XS7A 5DDRC 2M88A 2DH7A 2DNPA 2RRBA 5IM0B 2MSSA 2E44A 3G6ES 2G1DA 1N54B 3OW2R 3CXCR 3DXBA 1U1QA 3MD1A 1CVJA 2FC8A 1M90T 4QU7A 1H2TZ 2KVIA 1FJEB 1OIAA 2DH8A 2MB0B 5FJ4A 3VAGA 2XSFA 2UP1A 3CCRS 4LIRA 5LJ3Y 3HI9A 5GAEU 2MQMA 4TU9A 2WBRA 3CD6S 2X1GA 3DLLQ 2CQ1A 2CPXA 2NZ4A 2F3JA 1IQTA 2MY7A 2L08A 1VQNS 1X0FA 3TP2A 2LXUA 2LKZA 3NNCA 1YTYA 2CQ2A 1A7GE 3B4MA 2B0GA 2MZRA 2LQ5A 3ZZYA 2LEBA 1NO8A 2RS8A 4YB1P 2JX2A 1ZZFA 2KRBA 1WHWA 2YTCA 2DNYA 2DNNA 1U1KA 2JWNA 5DDQC 2MSTA 2L41A 2BZ2A 4Z2XA 3VAMA 1YHQS 2CPZA 1WHXA 3NS5A 1B7FA 4FXWA 5CXTA 5GAHU 2RS2A 5BJRA 3L3CA 1YIJS 4W90B 2E5IA 1VQ9S 2LXIA 2MJNA 3BO2A 2DGQA 2D9OA 5IFMA 1WI8A 1M1KT 2XB2D 3CCSS 1A9NB 4WFAQ 2DGUA 1UW4A 2MKIA 2OSRA 4ED5A 2K8GA 4U67Q 2CPHA 3S01A 2MZ1A 2MGZB 1U1RA 2QA4S 2O3DA 3IRWP 1WF1A 2MKCA 1VC6A 4YUDA 2L9WA 5HL7Q 2M8DB 5IQQA 2RRAA 3G71S 3BO4A 2JRSA 2DNHA 2V94A 2HVZA 2OTLS 2DGXA 1R8PA 1YWXA 3Q2SC 2N82B 2KU7A 1FJCA 1VQ4S 4WF9Q 1WG4A 1K8AT 4IOAQ 3U1MA 3CULA 5DETA 2X1FA 3US5A 3CC2S 1WI6A 2M4MA 5GADU 1VBYA 2DGTA 1WHVA 2NLWA 2KRRA 3CCVS 4LMZA 1VQMS 1S72S 4WFBQ 3UD3P 1YJNS
chains in the Genus database with same CATH superfamily
2BJ8A 3CF5Q 2BE7D 2M7SA 2Z0GA 4ED4A 4OI0A 2O66A 5KFKA 2QA2A 3HULA 4PXDA 4RO0A 4GKJF 3OHAA 3UW1A 4RL1A 2OAUA 1VRUA 3GIKA 1VMBA 2D3O1 4IFYB 2BDPA 2MKJA 2EXUA 2P9CA 3PDNA 2P6TA 2H3EB 1U6BA 4ZIWA 1Y0HA 4NLPA 4DJBA 5GADI 1EQ0A 3N5FA 4PYAA 1CQMA 2ROPA 4OI1A 3UR0A 5MLCV 5D4NA 3N4WA 1KOHA 1RISA 4QBUA 3ILOA 4DPOA 1QE1A 1M0SA 1NJZA 2KFYA 4ZIVA 1FRJA 4TYBA 2RF2A 4B9NA 1UAWA 2QMXA 2LDIA 3ET6A 2B5JB 1BWEA 4Y28C 1TVRA 3W66A 5J2QB 3V4IA 3OR1B 2IY5B 2OFHX 3BBCA 3WX4A 1VBKA 1YDLA 2AX1A 1RAHB 1UA0A 3OBIA 5KG2A 4ZHRB 4PQAA 1ZETA 2ZD1A 4DCJB 5HP1A 2K1RA 1C4CA 1B99A 1LWEB 1RWMB 5IQ6A 4TLQA 4WPAA 4PWUA 2K7KA 5KFYA 4OJHA 5LSLA 2R2RA 3P45B 4BHQA 1TELA 2YNGA 5CD4H 3V81B 3PXGa 1OYEA 4PG6A 2GJIA 4XK8C 3GILA 1TKTA 3QFWA 3NNAA 1EZZB 1J2VA 4ZVFA 3DM2A 5DS7A 4C48A 3DDIA 3P49B 3QT8A 3MAAB 1FKPB 3LPEA 3HSGA 3RZAA 1LFWA 3PJXA 1RTIA 1D9DA 4JI5J 1DAXA 1U26A 2VH7A 4QOTA 4F0MA 1LV5A 1XMOJ 5I3UA 1DARA 1SKSA 3CO9A 2J6SA 2XYHB 3BDPA 4DR1J 3OUYB 2NREA 2YWFA 2N7YA 4FXVA 4LF5J 3KNAA 2GX8A 3S1TA 1GTEA 4KC5A 2F1FA 2LECA 1CJVA 4B9UA 3UR3C 2FJAB 5CH7B 2AF6A 4YFUA 3CCTA 1AA1B 1VQPS 2CKWA 4NLRA 1FWLA 1NLKL 3QT7A 4X64F 2JC1A 5J1NA 5E41A 1UMJA 3L7OA 3CJ3A 1UW9A 2V9KA 5L9NA 2VJUA 3I6PA 2VU5A 1JB0C 3EGZA 4BC9A 1UFLA 2W9CA 4J9KA 3H40A 1E6YA 2W2OP 3PIOQ 2O1PA 4IFYA 4CRJA 3N9UC 3BSNA 2PGCA 3TRGA 2N7CA 4TQSA 4ANEA 3ILLA 2XS2A 4P7TA 4DR6F 3BYRA 1IM4A 3HVWA 1ZBTA 2ZH1A 3O6QA 5HMZA 3RBDA 2XS7A 3BDEA 2F7VA 5D0HA 3OLBA 1WACA 1HNXJ 2WAQD 3BGRB 3OT9A 3IRXA 3TW0A 2MB0B 3W9HA 3Q8VA 5GAEU 2HFSA 1VIXA 2B5JA 5J2QA 3G87A 1WC0A 2W4PA 1TUGB 4F0HA 1LWCA 2NSCA 3T6BA 3EDQB 4ECQA 1RCXB 1RHUB 4KYZA 4OX9F 4ZHRA 3QFHA 3GFZA 5T14A 1N6QA 3FBEA 5E3QA 1JLFA 3CCSS 4WFAQ 3M6WA 2ZZMA 3W62A 4ED5A 4EBDA 4U67Q 2Y8YA 1Y9OA 3CJ0A 2FJBB 4FBTA 3FFIB 3DLJA 2H4WB 4LQ3A 3OXFA 2H51B 3C15A 1APSA 5DQHA 2X1FA 2HVHA 3QWPA 5DGAA 2CZVC 3D6HB 4ZVHA 3QATA 2AKWB 3FGVA 3MAAA 1FKPA 3Q8SB 4B17A 3J81Y 3VGVA 1B0VA 4ZJLA 4JI3F 4MK9A 3K5PA 5KFAA 4KV8B 3GWCA 4FNHA 3DU5A 2QEXS 1WELA 4D3GA 1XMQF 3OUYA 3VGUA 3DRSB 3W3SA 4X4OA 2BE2B 3Q23A 1RTJA 4NOHA 1RT4B 4NZ0A 3TQ1A 1N8RT 3PRBA 3I32A 3MMAA 4ALZA 4MYTA 2IM2A 3EZ5A 3OHBA 1U8WA 1SJ1A 1X5OA 3OTEA 3BH7B 2DB1A 1XERA 5E5NA 5IT9U 3EDRB 2V9WA 2BRLA 4OX6A 4I68A 4DBQA 4RW6B 1TL4A 1SH2A 3GYNA 1WKLA 3IGVA 1NK5A 2XYGB 5C24A 5CAAA 4KGVB 2CXEA 2BABA 2VG5B 1U1OA 5KT6A 5EX3A 5LM7E 3TVYA 1RA6A 2EI5A 2YKNA 4KGXB 3CIZA 3QIDA 3MFIA 4C11A 4BDPA 3OTDA 5K8PA 3DLEB 4JI7J 2KHDA 5M2UA 2Z2YB 3QAUA 5DRKA 2DGSA 4OYWA 4NI2B 2J8AA 3R1HA 3AQOA 2ADCA 2HHQA 3BN7A 1DLOB 1Q82T 2HWHA 4USMA 4YS2A 3MTJA 4EBCA 3QGHA 2LDYA 2J6TA 2ZJPQ 4UQGA 1R43A 2R8JA 8AT1B 2MHNA 5THWA 1VQ5S 2MTLA 2XLIA 3CCES 3ZTQA 5B0GA 2VOPA 5LMNF 2M0GB 3GTYX 1IJEB 4F3MA 3NNHA 4KQZA 2KM8C 1SKRA 5KG4A 1S6QB 2AJQA 1HA1A 2J9CA 3FFIA 3M8YA 3RRKA 1JJ4A 1JMTA 4ZCLA 1M5OC 5EWFA 2G13A 3TVKA 4H4OB 2Z30B 2ZOGA 1QTMA 5D15A 4LFAJ 4QPTA 4KPYA 3C3LA 3LA0A 3D68A 2FLOA 1Q8KA 4BBYA 4ECXA 5L9XA 4DV7F 1EP4B 4C8KA 1U02A 1U49A 1LWFB 2A0FB 2AGOA 1Q8LA 4ECSA 4X4QA 4IH7A 4KV8A 1V5VA 3T5LA 1NEEA 5M2RA 3L7PA 4K4YA 3M9MB 2R7WA 1X0PA 3DRSA 2DO4A 4EK2A 2BE2A 2CG4A 4MIBA 1ZZNA 2WK4A 3L7UA 2BQ3A 4IH6A 5HK4A 3QPIA 2JH3A 5DM6Q 2IDLA 3JSRA 2HK3A 4QCLA 2QA4G 2KZZA 1KVKA 1DBDA 4DV2F 3SYZA 2J7WA 3MPYA 1V5IB 2JVOA 3R27A 1VHFA 3AJ2A 4AUKA 2LVWA 1BQMA 2GGPB 2ZHBA 5B7WA 4JI2F 9RUBA 4NYOA 4YHHJ 2E44A 1KFDA 3QJLA 3EGVA 4RW6A 1T3NA 4N56A 1NKBA 2EC0A 1N5QA 4JV2A 3TOQA 4PG8A 3CD6S 2WSEC 2NPIA 3Q8QB 1VI7A 2H4YB 2VG5A 3H0PA 1PIEA 1TTHB 4TY8B 3W60A 2YTCA 4EWTA 5EGYA 1U1KA 5KFXA 5IT9Y 3R5BA 8RUCA 4N5SA 4A8SA 2V69A 5CQGA 1TL7A 3DGPA 5KFPA 2UUBJ 4ZOSA 1IBLJ 1NHVA 4NI2A 1IM6A 1YJTA 2NZCA 1RWXB 2ZH9A 1HPZB 5E3RA 3DDNA 4NXNJ 1DQAA 2RILA 1R8PA 2N82B 1HI1A 1VQ4S 2XY6A 3KHLA 3JSYA 1WG4A 2H5JB 1IQZA 4DSFA 4FVMA 2C28A 1RTDB 3HO1A 1IKVB 2NLWA 1NDKA 1JKHB 3GCXP 3MEEB 2DR7A 1N32J 4F4ZA 2A1BA 5DQGA 3WC0A 2HS3A 2M8HA 4Y2AA 2V68A 5KFQA 2JLEA 1BLUA 4H4OA 5DZ7A 1U45A 1XTZA 1FRKA 1X8DA 1HWJA 1CULB 2FB0A 3SDEB 2OO4A 4UQTA 5IWAF 4NRUA 5U47A 2KT5A 2UXBF 3KJVB 5H1SV 3D0HE 2OMLA 2WOMB 2R3VA 3CE8A 4P2XA 1RAIB 1LWFA 1ROFA 2NUHA 4HT5A 1X9WA 2CNOB 5GVQA 4FYDA 2J0SD 3SFGA 4CO0A 3PW0A 2XZDB 3ZZZA 4U95A 1N0VC 2RSQA 2V4RA 4NLSA 1K9MT 3DRPA 4GKJJ 1Q7YT 1RHQB 1NK7A 1N5SA 1N52B 2AQ4A 3KUGA 3I5BA 1VOMA 1KP6A 4HL9A 3CTRA 5JVGQ 1BXNA 2GGPA 2QTWA 1ELOA 5ETNA 5CCMA 3FCVA 2B4OA 4KHPF 4EO8A 4DPTA 2EFPA 5ETQA 2R2UA 5AE2A 1TFYA 3IBCB 2IJNA 2VQFF 3H2UB 2ASLA 4FXDA 1D0EA 4DL3A 5KOWA 2NPFA 3VAKA 1ULRA 2BQUA 2F9JA 1T9VA 2Y9HA 4MMOA 3NY0A 2ZFHA 1F60B 2OSQA 4NCBA 4KO0A 3CCQS 1VS3A 3CDUA 3TJ9A 2F9DA 5LMUF 4C0OC 3OR2B 2CDRB 5ETLA 1FRMA 3A8EA 2VBYA 1T9UA 4TU7A 2W25A 2C42A 1OO0B 2I5JA 4TY8A 2W8LA 4ED8A 3OJSA 2BUNA 5A8WA 4PR6A 1H7XA 3PFOA 4IR9A 2AZ1A 2MMYA 1S1VB 4Y0FA 2YKOA 2VFSA 5K5MA 3SQOP 5KG3A 3G96A 2ZM6F 5DLFA 2BOPA 2UUCF 4ZN3A 1U1MA 1GX6A 4C3KA 4ILLA 1QAYA 2VFUA 4QQBA 3I55S 1VBZA 4MFBA 1JLGA 1S10A 2JOQA 2GVDB 2EEYA 4FP9A 3RYLA 3HHLA 3D5MA 2EKYA 2VC1A 1JKHA 5KG1A 4C8ZA 2G1HA 3AAWB 4HR2A 3PW5A 1PYSB 4J7CA 3BBFA 3CW2C 2P8IA 2ZVIA 3HM9A 5CABA 2B51A 1VQ6S 2I38A 3A3PB 1YRXA 1Y00A 1HI8A 3CJ5A 2CJXB 1B3TA 2I0XA 2VA3A 3I56S 3D6MB 1CULA 2VPWB 4GRSA 2JFDA 2BKNA 3KJVA 2OFGX 2DGOA 1ZA2B 2DD8S 1NBEB 2KYXA 4NLWA 1KD1T 4NX9A 1TKXA 1SPBP 4EZ9A 4I56A 2CRLA 4H4MB 2GMJA 2ALYB 2HFZA 3LW5C 5CYMB 1HR0F 3GE9A 3P4UB 5HQLA 3V2UC 5I42B 4USJC 3OV7A 4TNOA 4USVA 4X64J 5KFLA 1HARA 3SFUA 2BXJA 5GAGI 1P9YA 1HBNB 3DLLQ 2AV5A 1GMUA 5E2QA 1NPKA 3DRXA 4YR2A 1G3OA 1HW9A 3CJKB 8ATCB 3J7AN 4DR6J 1E6VB 2GAHC 5G4DA 4L73A 2RS8A 3KLGB 3GQCA 2C3PA 5CHCB 2DNYA 3Q8RB 2VD3A 2BMBA 4JI8F 2YKMB 1FKOB 5LT5A 4Z2XA 3AH6A 1ZM9A 2ILYA 2RS2A 3L3CA 4Y6IA 2DYAA 3BM7A 2PA8D 2D9OA 4F8RA 4CT8A 3NBPA 2E9RX 5DZ6A 3DOKB 2B3TB 2MKCA 3PKYA 1TUWA 4CLUA 1YLXA 1RT7B 2KKHA 4M5GA 4IOAQ 3HFVA 4FPIA 4I2PB 4ZK7M 4QYRA 3US5A 4IRDA 3TZZA 4OX9J 2D74B 2B56A 2HHUA 1CJTA 1CPZA 4LMZA 3OQ2A 1UVLA 4WFBQ 4C97A 2KTQA 1IKWB 4C3LA 3NAHA 3IG1A 3DGVA 1Q0NA 3TX0A 1VBXA 1NB2A 5IC4B 3VTIA 3NRBA 3HSJA 1IVZA 4ECVA 4FPRA 1M1HA 1VC5A 1HKAA 1VISA 5L38A 3BQ1A 1WF2A 1P9QC 2V4JA 2IRXA 3PW2A 4EEYA 3WC2A 3PIPQ 2BQRA 1FCAA 2B9XA 1Y5LB 2F4FA 1LOUA 2WB4A 4A46A 4I67A 3MXHP 5A8KB 4JI3J 2WSCC 3BKFA 5J1EA 3POTB 1XMQJ 2HKEA 3KG0A 4WCEQ 2HHHF 1S9EB 4IG0B 2DNZA 1SC1B 4LR7A 4CTAB 1X4CA 1I94F 2OPPA 4C9DA 4DPWA 3FRZA 5KFJA 2PEBA 3IAM9 2FZGB 1ZPWX 3DOMA 5HBMA 1QD1A 3EGWB 1KVIA 3FNNA 1WDTA 1B4SA 4LIWA 5I42A 3MEGB 1HHTP 4P10A 2MZSA 2CPYA 4ENOA 2WTFA 1JJCB 1WF0A 4WJBA 5HJYA 2DBBA 1S0VA 3BV8A 2LQ9A 1HBNA 2HHXA 4A47A 3FMBA 3SXLA 2R8IA 4B02A 3HDSA 2FY1A 4QU6A 2GQ2A 3CJKA 2N3LA 3K0JA 3CJ8A 1E6VA 5J1PA 1BUXA 3PVXA 5C7PA 3KLGA 2QYGA 2UUAF 4B3OA 2VV5A 4Y34A 3SSQA 2IBOA 2YKMA 4M94A 2YKQA 2IJRA 4IRKA 3H5SA 2F40A 4B3MF 4KH0B 4K4SA 4NLTA 3M2RB 1HQEB 1X4GA 3DXSX 3DOKA 1YRTA 2ASDA 2AJ1A 3NGKA 2ZZNA 4JI0F 4MTPA 4CLYA 4WFXA 3OFEA 2VZ9A 1NSPA 4BS2A 2Z2MA 1RT7A 3PKMA 3NEKA 1C1CA 4NZ6A 3CT9A 1TKDA 3M32B 2EFQA 4JI6J 1HD1A 1RKJA 4QR1A 5KFNA 4OFZA 3Q24A 4UZBA 2KHCA 2Z56B 3H90A 3PHTA 2IVFB 3GU0A 3BO3A 2ADBA 2ZH3A 4QIFA 2HGLA 1M5VC 1WHYA 5F0WA 2CVEA 3JB9k 4LF8F 1WD6A 2ABYA 1X5PA 3O3LA 5EHHA 4WZMA 3UWTA 3KK1B 2PFDA 3ZTPA 5J2MB 4DPUA 3GZ7A 4K2XA 1NK9A 3HJFA 3H98A 3VAIA 3V6KA 1NKCA 2DNMA 3CVKA 3JSMB 2IM3A 5E3CA 1WEYA 2W7OA 3EYZA 5KFWA 4EGLA 3E01B 3MOJB 4DV7J 3HFKA 4K4VA 3ISNC 5DDRC 4KFBB 3POTA 4WE1A 3MEDA 1XEZA 3AXMA 1L3SA 2M5YA 2PSZA 4CM2A 4QWBA 2XMTA 1OIAA 4IG0A 1R3NA 4LIRA 3NAIA 3PRVA 2WVFA 2CZ9A 2ZHOA 1UEUA 4J9NA 5BR8F 1SL2A 1Q16B 1VQNS 2BJ9A 2LXUA 2LKZA 1FK9B 4LRCA 2J9EA 2V8HA 2BBEA 2HQCA 1LXNA 1Q4RA 3HPOA 2MSTA 5F3ZA 1VDHA 4LF6F 2B8QA 4UF4A 4WYLA 3PCOB 1YIJS 4JI2J 1H72C 4HDHA 1S76D 5F8NA 1M1KT 2MQ8A 1A9NB 1UCNA 3I5AA 2ZITA 2E9ZA 2FHJA 2M3DA 1RWPB 3MWBA 2DPJA 2HNYA 1KRPA 1RE1B 1S1XA 4ETXA 4HH0A 3PX4A 2W24A 1FJCA 3ISZA 3FJ2A 2BOAA 4F4WA 1PC5A 3HVTB 3M30B 1KSPA 3JQJA 3M8QB 4ZN1A 1GEHA 1H7WA 1HQEA 2V63A 3AODA 2NXEA 4HDGA 3G8QA 1F9FA 2CQBA 1U1PA 4MKVA 2YQ3A 2GC8A 2DR5A 3EX7B 2DNOA 2J9DA 3EJMA 2KYZA 1D09B 3PEJA 2W8KA 2CWKA 1LQ9A 2AEMA 1R31A 1SBRA 3I4PA 1SKWA 3QRPA 3QO9A 4I4BA 4WP8A 4CM0A 3BJYA 2VHGA 3LQVA 2Z8QA 4PYDA 1R8BA 3TNVA 2DKOB 3GFYA 5FDLB 3CMES 1KFSA 2DNQA 4NA2A 1XC9A 1KOOA 1RAAB 2GVZB 3ISND 4M5MA 3TAMA 1W2BR 3C66A 2ATLA 3ZTOA 4YB6A 2OD6A 2IYGA 2VICA 1BC6A 3T9ZA 1BMQB 3GG0A 1Q95G 2PI5A 4WP3A 2ZWOA 2N4DA 4KGMA 2W01A 2FC9A 5L39A 1T0TV 4OI6A 3JSMA 5LXRA 5IWAJ 3LF0A 4NMXA 3E3XA 2UXBJ 3GJRB 2YKAA 2V34A 1D3WA 2XSJB 3UE2A 5C2GA 3T5KA 1AW0A 1KC8T 3ZZOA 4CWBA 5ADZA 2R9LA 4OHXA 4DL5A 4XDCA 3R2CJ 1PYOB 4DF4A 4LBHA 2MQQA 2DITA 4V19J 2ASYA 4OHZA 4DR3F 3X3UA 1SQGA 1FK9A 4KGZB 4QYZK 1PAEX 3IWXA 2LYVA 4A8KA 2VBZA 1G7CB 2MLXA 3ZXWA 1IKYB 2KDOA 4ZKAA 4PXCA 3K5OA 4AQYF 2CQ3A 3PW7A 2W2PP 1QM9A 4PWDA 5IZHA 3M8PB 1VQKS 4KHPJ 4RW7B 3MUTP 2KJWA 4N8OA 1KTVA 4TXSA 1H6KX 4J91A 3UCGA 2XLJA 1YITS 2IA6A 3CC7S 2VQFJ 1JJHA 3A13A 2YPZA 1DJ0A 4X4PA 4IYQA 2AJFE 3WIVA 1PSDA 2EPIA 1FFWB 3UCUP 1H74A 1UFKA 3M1VA 4OYPA 2CYYA 1UFWA 5F3TA 4Q45A 4UY85 4PG5A 2FQQB 3M30A 1ZOTA 3TA0A 1V6HA 3CJTA 3FKBA 1CC8A 4IKAA 4N7TA 2CZ4A 3PV8A 4LSLA 3CMQA 4CLPA 4B3SF 4M5JA 5CD4A 1RA7A 1HWIA 1UVNA 2ZM6J 5KFBA 4CLFA 1O51A 2FHJD 3R6GB 3IWNC 1DTTB 3EWGA 4PQUB 4KE5A 2RAQA 2CG8A 1U48A 3R97A 1UTAA 3CJ4A 1FT8A 4MK8A 3FVYA 1BHNA 4Y00A 3HT0A 4DEZA 3DHXA 4RKUC 1FDDA 4WIQA 2B7CB 4ES3A 2M52A 1V3RA 5FDLA 3OVAA 3ZNJ1 5JJBA 2WVCA 3HHEA 2BRKA 7FDRA 3D1QA 3C19A 1VCTA 1U1QA 4H4KC 2HMIB 4YY3F 2BJ7A 2B9WA 1MU2B 1FE0A 1HNIB 1PAUB 2F3JA 4DFKA 4DV3F 2VKZG 4HI2A 4OHVA 2BM0A 2B0GA 2E9TA 4X65F 4LSNB 2KRBA 3MM5A 1GK8A 4JV1A 2HBQB 2G0JA 3MOZA 1HR0J 2BZ2A 3W9IA 2B43A 2W2QP 4C3MA 1NZAA 1PJ5A 4ECWA 2IBKA 2DJWA 1CJUB 3HX9A 3CDEA 5DG9A 3VZIA 1UKUA 2BYCA 3MM9B 1IKYA 2GW8A 3KWMA 2VASA 1WC3A 4F0KA 4C6AA 4XAKA 4DUZF 2BM1A 4HH1A 1X31C 4WK1A 1K8AT 1AT1B 1JXVA 4CLZA 3D54A 2QA1A 4F36A 5AXMA 3OFFA 3FCWA 3NKYA 3JYTB 4DWIA 1SUQA 4RW7A 5DQIA 4DV4F 2M4MA 2RDDA 1VBYA 4WYWA 4JI8J 2DR8A 1WHVA 4UOFA 4UT4A 1Q53A 3UD5A 3AD9C 1YJNS 2I6WA 4K0KF 5GAHI 3LGNA 1ZM4A 2OEKA 2CQ4A 4UZCA 2QE5A 3HT3A 1BE4A 3RRHA 2V2KA 3RRGA 2G0IA 1QSYA 2QZ8A 5B0BA 3I96A 3QIPA 2KVQE 5ITHA 3THVA 4Q44A 4KAIA 4M5DB 1F9HA 3F44A 4DPYA 1HWKA 5L1JA 4XTTA 3OXGA 3VVTA 1RAEB 1I3OB 1WDDA 1XR5A 4DX8H 1DRZA 1F1BB 2G2OA 2C2NA 4AD6A 1A6LA 1DTTA 3PJWA 3OTOF 4HT7A 5KFTA 2W7PA 3NCPA 3J7YI 4JUZA 2H54B 4S0MA 4CH7A 3M9OB 1FERA 2P6SA 4JV0A 2MQOA 3OJUA 3I0RB 1S0OA 4QWEA 1FD8A 4KHMA 3MR7A 3HFZB 2PN6A 3ZZUA 4W92B 4FZVA 3AB2B 4Y2KA 5I3QA 3RB0A 2QSWA 1UPMB 2V6AA 2HMIA 3EMTA 1MU2A 3F56A 3R8YA 5DDPC 5JMNA 1HNIA 2HHHJ 3RBXA 3NWGA 3IM8A 5KOXA 1NZ8A 6FD1A 4TKTA 1NU4A 2CPFA 4WIIA 1ZAWA 1NDPA 2BR0A 1I94J 4HVZA 1SJ3P 1AFIA 4ZVPB 1SJ4P 2F8HA 1PGZA 1SJFA 1N36F 5LL6d 2MXYA 2AIRB 4F04B 2ACYA 3GSIA 5EX0A 5C5JA 4MKAA 3FSXA 4URSA 4X4VA 3I5CA 2GHVC 1FTRA 2CADA 3RR7A 4RBTA 2VA2A 2LA4A 3Q22A 2QT7A 2VDHA 4BLGA 5KTQA 2KXHA 2LU1A 4OZ1A 2UUAJ 5A0YA 1X9SA 2Y1IA 1TL3B 4OV6A 3LWLA 3CCMS 3VR1A 3T5HA 1RAGB 4B3MJ 4IOCQ 2UVVA 1NKEA 4NZ7A 5F9LA 4UTGA 2CVIA 2CPJA 4AXIA 2PT0A 3S6EA 3A3NB 2M9KA 4C4WA 2KB2A 4L72B 2ZOFA 1U2CA 4JI0J 3LOUA 5F41A 3EGNA 2VG6B 1L3KA 1P1LA 4A8MP 2DCUB 4M5DA 3TUIC 5K14B 4JI4F 2FJDB 1R6YA 2VPYB 5D0EA 2D41A 2HGMA 3ICLA 3PO4A 3TUZC 2GIQA 3B54A 4PAAA 2QRRA 4DFPA 3AJDA 3N79A 2BA9A 3UDEA 1FXDA 1JNZB 1VGYA 2FJEB 3OW2R 3FK4A 2IRYA 2E1MC 1FJEB 3M6XA 2IVYA 4DX7A 3MPDA 2V8VA 1NUEA 3I0RA 3MTKA 4G1IA 4TYAA 4CO3A 1IQTA 2IVMA 1KHVA 1RU2A 4RBVA 1U8SA 3U02A 3D1HA 4U8YA 1R0AB 3ENQA 4NEYA 4CO1A 3IR6B 3LALA 4OV1A 4DV0J 5CXTA 4C8YA 2E5IA 4YB5A 3KLFB 4EI2A 2VKRA 2ZH2A 3LP1A 1UW4A 1PYTA 5K8MA 3FMWA 2K8GA 1LW2B 4ZPCA 3HSDA 1CEZA 2M8DB 4R8UB 1S1TB 4FF4A 5BR8J 1S6UA 3R5AA 1RYSA 3RUBL 1FVQA 3H5XA 3UI3A 5K8NA 4FKXA 4AL6A 3B8HA 4LFCF 2RH3A 3CCZA 1F6TA 1YK9A 3VWSA 4O3OA 2HAIA 3FEZA 2HRUA 1AUSL 3TR5A 4LF6J 4OJ3A 1RT2B 2NXCA 2RKIA 1TR0A 1TFWA 1L5UA 1FRHA 4RNNA 4DF8A 3BYPA 3MURP 4ZLPA 2UVWA 4IFVB 3PZPA 4ID5A 4OJ1A 3B82A 5HVGA 3BBBA 3FQLA 2B9YA 1RT1B 1R8CA 4K4ZA 4G3IA 2FGOA 3VALA 2Z57B 4FNIA 1S77D 2YNFB 4R5PB 2CPIA 1HBMB 1RDRA 4DI6A 1JJ2R 4DHVA 5IC6B 4C0BA 3M2VB 3VQTA 4X4TA 1NJWA 4I2QB 2VG6A 1WUUA 3KOAA 2YBVA 1XN9A 3QRRA 1FX4A 4BWMA 2C2EA 1JK9B 3GONA 2OPSA 1S1UA 4OQJA 1FJGF 3FBCA 1D9AA 3EE3A 1UJ5A 4O44B 4K59A 3TEGA 3K57A 1DQ9A 1VK3A 3GV8B 2FY8A 2VB6A 3K5NA 3C46A 3TO8A 5KFHA 3LUYA 2B7BB 3MHYA 1TP7A 4FKYA 1CBKA 1X9MA 4OZLA 2CQ0A 1NJXA 1DZ5A 2W2MP 1EJ7L 3BR8A 1S0MA 3IC1A 2B8PA 2LEAA 3AHPA 1C0UB 4LT6A 3O5TB 1S5ZA 1UA1A 1FNMA 4K4XA 5LSOA 2YY3A 1FVSA 1UVIA 1SL1A 2GAGC 4P7VA 5KFVA 2DHSA 4O3QA 4MIWA 1N56A 2MYFA 2R7VA 3GLJA 2Q79A 3KLFA 1YJ9S 1OPZA 3H42A 2CPEA 3IR5B 3SCJE 1RT5A 1H3DA 4JOUA 1RU1A 2ZH5A 3BS9A 2RDIA 4KKOA 4E2FB 4DR3J 1SJRA 5FIIA 4I64A 3H5YA 4R8UA 4CO2A 2AYEA 3A8JA 3GR0A 1RT6B 1K1QA 3M05A 1PILA 3SCLE 2CAJA 3MPWA 2OEJA 2BANB 3PRDA 1YSJA 5D4OA 2YWGA 4AQYJ 3FRYA 3DLGA 4CH0S 3QQCD 2QJ3A 3CC4S 3ILIA 2ZC4A 2OELA 1NDCA 4KPCA 2DK2A 4Q8EA 3K59A 4CYUB 3H4DA 2X1AA 2CPDA 1KQFB 2A6OA 3IMQJ 2ZJQQ 3MD3A 5HVFA 2E29A 1VQYA 3KJNB 4IFVA 4C7QA 4RJVA 3KK2B 1FRXA 3BGLA 1TU0B 1PC4A 3Q89A 5J2NB 2C22A 4F02A 2F4VF 1RT1A 3H2VE 3BEGB 2C3UA 3M7VA 2DGWA 4NCGA 3VZHA 3BSOA 1FF2A 4QJVA 3TZXA 3RG6A 4ICLA 4B3SJ 4EMDA 4FYWB 2DH7A 1F5AA 1FDAA 4I2QA 3CXCR 2HFUA 1HI0P 1Q8BA 4TLRA 3JQKA 4YN3B 4DR5F 1UPPA 1FFSB 2OMOA 1X0FA 1YTYA 1RWNB 1RHMB 4I69A 4O44A 2ACMA 4QR0A 2AT1B 2ROEA 3IN5A 1JLEB 2LEBA 2A2DA 2J5AA 5B08A 3O8WA 3D0IE 2W9AA 2EKNA 1ZAXA 2P5VA 3T1HF 4U8VA 4L75A 1B7FA 4KBIA 1IWGA 2RMLA 4G1QB 1C4AA 4OYMA 2DGQA 5IFMA 4RBUA 4YY3J 3W8PA 1B70B 5K20B 2MZ1A 4RUAA 3P8BB 1C0UA 2ZBRA 4L3KA 4O4GA 4GO7X 3LO3A 4DV3J 5C25A 4IG3A 5ETSA 1TV6B 2V94A 1R8AA 3VHQA 2VG7B 4IH5A 2UVRA 2KL8A 3NGDA 4ZLJA 4X65J 1CC7A 4ELVA 4WU2A 4DQIA 5AXKA 2J7UA 4F4YA 5KFCA 2FLNA 4P75A 2W1BA 2NYIA 2F65A 4E0DA 4YMEA 2E1PA 5ETPA 5D3GB 1N5YB 1FEHA 1RADB 4WXWA 1RKIA 1T05A 2IPOB 1RT6A 1MNEA 1QAIA 4MIAA 2BANA 2LLZA 4YDDB 3H2LA 2OPRB 3TARA 1S57A 2B6AB 2ZDPA 1V3SA 3LH2S 3T41A 4C8MA 4RW4B 3H4BA 4RNHA 4U7UD 5HI7A 4JYAF 3M2UA 1RI7A 3O44A 3KNGA 3P6YC 1NK4A 4G6VB 4QIWD 2K2PA 1GFWB 5GMKa 1S6PB 4DV4J 1Q81T 3UDVA 6FDRA 2Q66A 3I82A 4C8OA 2ZUAA 4K0KJ 1VQ8S 4DSEA 4ZVTB 3HHDA 4B08A 5DJBA 2GCFA 1PJ7A 2D7SA 5KFFA 3W8GA 1TMJA 3KK2A 2WONA 4A8XA 1QDUB 2FVSA 2QC3A 5KG6A 3PR4A 3T19A 4KB7A 4J9PA 4PPZA 2UXCF 4F25A 3RB4A 4PEOA 3QT6A 3T9NA 4QZVB 3MPUB 1HNZF 3OTCA 1DHMA 2XY7A 2HNDB 5CZXA 2CUYA 2IM1A 4EZ6A 3JTOA 3OTOJ 3G2XA 2MKYA 2FD2A 2KM8B 2BEFA 3I31A 2FPHX 3N5BA 2SXLA 5HJXA 4X84A 1TUVA 3HD2A 4KIAA 2H48B 1EARA 5CYJA 1RSCA 4O0IA 1C0TB 2MQLA 4ZPAA 4DQPA 3KHHA 4X66F 1U1LA 1JLEA 4C2MA 4DX5A 2GFFA 3I9V9 1T94A 2ZJRQ 4ZS6A 1IKXB 2MQNA 3CJSA 4MH8A 5KFEA 3F0NA 1OQ3A 4G1QA 1Z4UA 1RTZA 1WOOA 1SC6A 4RPFA 1NPPA 1Q1KA 4AFFA 2W2NP 3MECB 2HFOA 3OFHA 3QLHB 4ZPWR 1WWHA 1JX4A 3P3DA 4FVCA 4LJMA 5E7OB 3M8WA 3OR1A 3ZZ0A 2XS5A 2DNKA 2LCWA 3FQKA 2OIHA 4ZP8A 1WSVA 2VG7A 4OYZA 1HWLA 2KT3A 1BD6A 1KVJA 3V4MA 3KUEA 3AD7C 3D4JA 1N36J 3K17A 1LWEA 3QSIA 3MM7B 1PBUA 2IDEA 5KFZA 3N01A 4ECZA 3SV4A 4U7UK 4ZPBA 4K50A 2VFVA 1RWWB 3BR9A 4J5OA 1R7IA 3U1LA 2XHWA 4NA1A 2EBEA 4WBFA 3V81A 3BPDA 3MUMP 1REVB 2UVUA 3PTWA 1HL6A 4K4TA 1J5OB 4ZVUB 1XMOF 1NM2A 1Q8IA 4IO1A 2B6AA 2EFNA 3L9ZA 3HHKA 2HVIA 4RW4A 5CCLA 4NYZA 2GJ2A 2RUGA 1RLDA 1NRKA 1FEEA 1HYSB 4DFMA 2W9BB 1S6PA 1RBAA 2AJ2A 3W2WB 2HWIA 2JLGA 3RGIA 1KLMB 1FRLA 3TEHB 3DNCA 3R7SB 3ZZRA 1C1BB 3H8YA 3MZIA 4N77A 2XULA 3LGHA 1S6OA 2WBRA 3GV7B 2V67A 2CPXA 2Z4PA 2Y0SD 3MAQA 2QMUB 3MPVA 3SZ2A 4CNZA 3N0VA 4DSLA 3CJQA 1KR4A 2ZDOA 2XI2A 3PW4A 4P2SA 3OSNA 4J9OA 1GXUA 1R6VA 4YB1P 3WDOA 3EPIA 1X60A 2FJXA 4M5HA 1WHXA 4ES1A 2HNDA 3DLKB 1S59A 2VC0A 3B78A 3AFGA 1RT3B 3F41A 5IV4A 1WKKA 5KFUA 1GMVA 2HS0A 1C0TA 2QYCA 1O5JA 2EFGA 2E66A 5IQQA 3DRRB 2DXEA 2JRSA 3SBMA 4I7FB 2HVZA 1NH7A 1JLBB 4LF4F 5DETA 3HKWA 2L9DA 2BVZA 2AHOB 3BGRA 5GADU 1LW0B 3IP0A 3MMJA 4B3TF 4F2RA 4OLOA 3JAMU 2AYMA 2Z2ZA 4M5IA 1ZA1B 2CJ9A 1ZTTA 3JSBA 1NXIA 1VRTB 2MKSA 1LEOA 2GHWA 2XC9A 2LFVA 1X4AA 4RUBA 1RQ0A 5AJ3F 2KT2A 2DO0A 3Q2TC 3M8RA 4M95A 2V50A 3U1NA 2V5HG 2O67A 3OFGA 2IJFA 4LFCJ 3E8OA 2XMMA 3THPA 3TUPA 3HZEA 2PO4A 3M8SA 5J2PB 1Y3KA 7AT1B 2CQCA 1YZ7A 1YJRA 1NK0A 3TANA 2VIHA 3TA2A 3HK2A 2UUWA 2CJYB 5D0GA 3GR1A 5JXSA 1RUSA 1J5OA 4X2BA 3K8VA 2XGPA 3CGIA 5HANA 1XJWB 2KI2A 4M5KA 1H38A 1ZS6A 2LMIA 3FEYB 1KLNA 3L4BC 1GQEA 2OTJS 1GT8A 3L09A 1SJQA 3UVJB 1X4FA 2W9BA 3T1YF 5HMXA 4URQU 2OP5A 3SQGB 2RQCA 2D3ZA 3DHWC 5JVHQ 1F0XA 1PBAA 4ZP9A 4USIA 2ZHAA 3SI8A 3DI6B 4LVNP 1C1BA 1QUPA 3NG8A 1T02A 1U0SA 1SV5B 2RQKA 4YEAA 2XO7A 1RT4A 2O01C 4RLEA 1OMSA 1AB8A 2ROGA 1XR6A 2ZE2B 2QLFB 4ZCKA 2C2DA 1SKUB 5T7LB 2FGCA 3VQSA 1IBCB 1FJGJ 3OL6A 5ETRA 2KG1A 1FE4A 4GC7A 4O3NA 3QWUA 4FF2A 4DL0C 3DLKA 2ZH8A 1PG5B 3DDKA 2XMVA 1XR7A 1ZTWA 2EW9A 5I3PA 4LF9F 2R7SA 5E0OA 3PHEA 1EETB 3ENWA 5I4MA 2C2KB 3PFEA 5A6WA 3H25A 3WIUA 5G0RB 4I7FA 2XWXA 1IXKA 3CO0P 2FZCB 3BSAA 3LP2B 3MDFA 1Y7PA 1KQKA 4FS1A 5A8RB 1HBUB 2YWHA 1UJ6A 4ZLNA 2M70A 3DLEA 1NJIT 3EUNA 3IBWA 2GQQA 2JEFA 3PR5B 2JZ5A 2P9EA 3W5YA 3DFEA 2HQ3A 3D0GE 3IO1A 4LRAA 5A6PA 2I1RA 5DM7Q 1IWAA 1VR6A 3CIMA 1S49A 2HGNA 4A8OA 1DLOA 3R9LA 4F2SA 5HLFB 1JXLA 2R7XA 3GV5B 2YNIB 3KMSA 3GIIA 4LREA 4W4MA 4UOHA 2JVRA 4CNYA 4PCQA 1V3ZA 3IA0A 4ECRA 2GMHA 3JAMY 3TJ8A 4RW9B 2RU3A 3OXLA 2V8DA 1S6QA 2OPQB 4ANCA 2XWYA 5KAKA 5HMYA 2D1CA 3OTBA 3QGPA 3PO5A 5CZVA 4OYIA 3KG4A 3DXBA 2FC8A 1H2TZ 4Z7CA 4HTJA 2XMAA 3BGUA 1YJ7A 4GMKA 1FDBA 2X1GA 1LK7A 2CQ1A 3RB6A 2C3YA 1EP4A 3DC2A 1XK8A 3UVJA 5K9FA 2HS4A 1T9WA 1URRA 2F4VJ 3H7HB 4HHHA 3IM9A 1VRUB 2ZBIA 1ICEB 2CA9A 4GC6A 2JX2A 1ZZFA 1KS2A 2XBPA 4AXJA 4P52A 2DNNA 1YBUA 1TK8A 3QYYA 2KFNA 1KTQA 1Y10A 3VAMA 5HSPA 4OZ2A 2OD4A 2RQMA 1SH3A 2EC2A 4X4RA 2DGUA 2MKIA 1G4CA 4Y2MA 5GAEI 4DR5J 2IAJB 1N34F 2WVBA 5T7LA 1QE1B 3OVBA 1KHWA 1TK5A 2QL9B 2AJ4A 3OL8A 3A3OB 2HK2A 3GIRA 4PWWA 3IXQA 4LF7F 1WC1A 3ET6B 1KQGB 3CC2S 1VLYA 3W5ZA 3V4IB 2MLZA 5B09A 3QZ7A 1VQMS 2WCXA 2HVEA 2WRMA 2WSFC 2DTJA 2BKOA 3IWLA 3JTPA 1L3UA 2UUBF 3K58A 2C3OA 2PIIA 2ZD1B 3Q83A 3CJRA 4CQ1A 2K1RB 3ENAA 5KFOA 2C3MA 3UD4P 3DLHA 1DY3A 4A8QA 1S12A 3HKZD 1H2UX 1WEXA 5H9EJ 2FVRA 1QUVA 2YNGB 1ITPA 2DNRA 3ONQA 1OJ4A 2V8GA 3KG1A 2KZMA 3LTOA 4L76A 4WFZA 1HPZA 1TKTB 3M6UA 2VONA 5ETKA 3O2IA 1UJ4A 3FZBA 1RHKB 2Q3PA 2OGUA 3ZFVA 4OHWA 1U24A 4AYBD 1N32F 2DXFA 5LOQA 3DM2B 2AYGA 1VRQC 2R7RA 3M8ZA 4Y2IA 4NASA 3D2WA 3RAMA 1T8EA 4ED7A 4MKYA 1YBAA 5I3UB 1RTDA 1IKVA 3U27A 1FWKA 2ZBPA 3MEEA 4DL6A 2KO1A 4JYAJ 2HLUA 1Z2LA 3G6VA 1JLQB 2FTRA 2R8GA 3QMQA 2OPQA 1FNXH 3D6FB 2FVCA 1RTHB 1PCAA 4CP5A 2XNQA 3KLIB 3RW7A 1UVMA 2V2VA 1W25A 2DHXA 3EXYA 3SDEA 1Q78A 4P71A 5EUHA 3R5JB 3PY8A 3UFCX 1EQMA 4R25A 1QLNA 4DR7F 2WOMA 3G8TA 1HNVB 3NOGA 1RK8A 2DRAA 3MEKA 2UXCJ 4P9SA 2W9CB 3KKFA 1E6YB 4DN0A 3I9ZA 2MY8A 2YH0A 4J37A 1FI4A 1HNZJ 3TVZA 2CQIA 1O0PA 2RD5C 1S9GB 1FHTA 4GO5X 1UL3A 5IS2A 2IAJA 2XM3A 4WP9A 2OJ3A 2IC3B 2IMOA 3FEXB 3FC9A 5HQ8A 3IRXB 4Q2LA 4DQRA 4K8RA 4X66J 3CSKA 3TZYA 1JIHA 4C0HA 4LR8A 2FHKA 3CDBA 5IT4A 4ZJQA 1SIZA 4UUWA 2RUSA 1LKZA 1LWCB 3FSYA 2QX0A 1S99A 2RVJA 1YKWA 4Y2CA 3ZZTA 2RIJA 2Y1JA 4OMFG 3D66A 3SSSA 5L1KA 3KLHB 4RZRA 3D9BA 3GB0A 3J81j 1F3FA 3OR2A 1RAOA 1NSQA 1N6QB 4WXOA 2MKKA 3J81U 2YH1A 2A2CA 1JLFB 5D4LA 2AMCB 3E51A 4MK7A 4B9MA 4KRWA 4DUYF 2E7WA 3A8IA 1S1VA 5C42B 1FTCA 2DNGA 2N3OA 5L1LA 2CNLB 1RXOB 5HO4A 1Y5IB 1DQ8A 1EAYC 2VBXA 5AXNA 2QFIA 3LWMA 3C15B 2HURA 3PYFA 4DQQA 5H9FJ 2KVIA 2V0NA 4LFBF 3ZTRA 3TX8A 2GVDA 4ED0A 2MQMA 4ZJOA 1BWVA 3J80U 3KLEB 2K7JA 2XCAA 2BW7A 2WW8A 4ELTA 3T6JA 2CQ2A 1A7GE 3RTVA 1U7LA 4EU0A 4LRBA 1JLQA 2HAFA 2AU0A 2Y1LB 1WHWA 2GIFA 2QMWA 1RTHA 4QR2A 1RTJB 2JWNA 3KLIA 4NA3A 4F3QA 4FXWA 4O3RA 5BJRA 3MMAB 3K8WA 2LXIA 1RCOB 3A8KA 2J0XA 5JUMA 2D3UA 3GMGA 2CPHA 2MGZB 2PMZD 1HNVA 2GQCA 3PX0A 3IBFB 2I8EA 3UPFA 1VC6A 3T3FA 4H4MA 3TUJC 2UV8G 2O5DA 5CYMA 2Q6BA 4DL4A 2DGXA 1YWXA 2FJVA 3CULA 3GYXB 3CD5A 5C24B 3UO0A 3RR8A 2DGTA 2Q6CA 2KRRA 3CCWA 1RWUA 4DFJA 3OSPA 2CQDA 2YKNB 1S9GA 3CCUS 2PMWA 4DV5F 4C11B 2IC3A 1Y11A 3KHGA 1OY9A 4P6QA 3N6MA 3CUNA 1VQLS 3R3TA 1FKOA 1RLCL 1VLOA 2KG0A 5D6GA 2NR0A 1KN6A 3AD8C 4LF4J 4ZA1A 4DSIA 2WVEA 1VJWA 4DS5A 4WWSA 4EBEA 1B0TA 4B3TJ 3KLHA 4WTOB 3EICA 3V6JA 5D4PA 1QSLA 3HHNB 1DURA 1GTHA 2X1BA 2RDJA 4F50A 4C8LA 1J5EF 1FO1A 3S7RA 1HWUA 4MJKA 5KFRA 1ACMB 3NOCA 4I2PA 1RYRA 1KEKA 1PJ6A 4N47A 5AJ3J 5C42A 3AY0A 3P5BP 4U7CA 1X4EA 3E2EA 1IKWA 4QIGA 1DTQB 5LMNJ 4QWAA 1PKUA 5D77A 2F8MA 1RAJA 4W98A 3ZC4A 1TQLA 2NS1B 2AGQA 3CDAA 3R5DA 3F73A 3KFWX 3KLEA 2FHMA 2YX4A 2C2ZB 4PG7A 4E98A 1WORA 2NXUA 3T5JA 4CT9A 2MZTA 2BJEA 4F4AA 1TL5A 3T1YJ 2JJ4D 3QRQA 5A8KA 3BQ2A 3SCIE 4K4WA 1UETA 4DSKA 1S79A 3NP5A 1TAQA 2XMKA 2Z58B 4QIVA 4BCAA 4ERDA 1S9EA 1YJWS 4HHUA 4CTAA 1BQMB 5DLGA 3J80Y 2ZUGA 2MGZA 2NUUG 2DIUA 2N4CA 3R2DJ 4CLTA 2HSEB 4EO6A 4J9VA 4TU8A 1VQOS 4KTQA 3Q86A 4DV2J 1Q86T 4YR3A 3VGTA 3G4SS 3AJ1A 3MEGA 2IYIA 4FYXB 1BGXT 1EB0A 1QVFR 3CCLS 3PX6A 3MCSA 3MF5A 3R5GA 1OYDA 2NXNA 4A4JA 4LRDA 1S4FA 3LANA 3SEOA 4LBIA 3V5RA 4CLLA 2L3MA 1QTNB 3RB3A 4LF9J 1OQ6A 5ETVA 3C6UB 1TL7B 3DGPB 5GAGU 5BYRA 2MDAA 4F4XA 2ALZA 3BZQA 4HEA9 2XI3A 2HYIB 1N88A 3ZO7A 4DUTA 4JI6F 3M2RA 3MCOA 3TWZA 1G2EA 4NEZA 1WG1A 3UDLA 2ZEJA 1N5TA 4CI0B 2H5EA 3K5LA 4ZVSB 2PE8A 3SIPB 1RZMA 2XMWA 3BF4A 1NK6A 3M32A 4QU7A 2AJ0A 2EFVA 5LJ3Y 3HCXA 2LP4A 3VGSA 1T9YA 3NS7B 3NXZA 5K8OA 3NNCA 2OHDA 1DTQA 4IQXA 2ZC3A 3R6LB 1ZPVA 2LQ5A 3ZZYA 4RNMA 2I9SA 2UV8A 1XNRF 4WTYA 2E1CA 3BGOP 5DDQC 1P6TA 2L9NA 1NSAA 4HACB 1RWKB 3U7JA 5F8LA 3KK1A 2DPIA 1U6ZA 2BJ1A 5J2MA 3RBZA 4W90B 4NLDA 2OSRA 4TQRA 3IRWP 4OL8A 2A6MA 4QIEA 2F5GA 3E01A 1H0HB 4WU3A 4AT1B 3DRPB 3PG9A 3DOLB 4WF9Q 3N6LA 4RNOA 1F3VA 4KFBA 3QJJA 1W2IA 2OH2A 4RUHA 5RUBA 1RWVB 4NE9C 2OI2A 4ED6A 4NL5A 1X5SA 3C16B 1X4DA 2DEJA 3GJQB 2W4CA 4PRFA 2EBGA 2E5JA 3NWRA 1M5HA 1LNQA 1N34J 1PO6A 1K0VA 1FXLA 2DISA 4MYUA 1MLAA 5F9NA 4KO0B 2HHPA 5BYSA 2Y0BB 4LF7J 1ZAVA 3G82B 4E8UA 1U1NA 2DIVA 2I5JB 2NYHA 5D78A 2PDAA 5A8WB 1U0HB 4Q8FA 2R7OA 2VJVA 4DV1F 1GNKA 1YZ6A 3IS9B 2GIRA 4H4KA 3K7RA 4Z37A 3HVAA 3C6UA 4AE5A 5LMUJ 2XNRA 3KLVA 3HVTA 1LWXA 3M8QA 3TZWA 2X3GA 2PC6A 3H5UA 1S97A 2VDIA 4RU2A 4EUVA 4ELUA 4MFBB 1JLGB 4ILRA 3EZUA 2UUCJ 4B9VA 4USWA 1CSJA 4J9UE 5AXLA 3HHLB 1LXJA 5B0EA 5A2QU 3HZGA 4BC7A 5DDOC 4DS4A 5HATA 2BX6A 3O1LA 3NGRA 2BJ3A 3I0SB 3R1LA 5F0UA 3WQPA 2R42A 2DR6A 2PEHA 2EG2A 4IDKB 3BSCA 4DCPB 2YPYA 3EZOA 2GVZA 1AYEA 4R0EA 4HACA 2ZVSA 1RP5A 2KJVA 2MKHA 3SMZA 1K73T 2HBZB 1TKXB 1KKHA 2COLA 3KHRA 3MUVP 4XO0A 3AB4B 3NGTA 1KDNA 3BKUA 1M5KC 4N8NA 3P96A 4DR7J 1J27A 3R7BB 1VJQA 3BQ0A 4ZPDA 2AGPA 3B4DA 3UDCA 2XSJA 3DOLA 4EFAC 1TAUA 2YWEA 1M1GA 2FDNA 1FD2A 4ECTA 2XQCA 3ETOA 3V6DB 4ZPVR 3CEDA 2J76E 3H20A 4Z7YA 4B3RF 3C16A 2G2ZA 2V8PA 2DR9A 4KSEB 1WOSA 4ZITA 3ITHB 4OZ5A 1RGVA 1WTBA 1H98A 4PPDA 2IRUA 2HBRB 4D3HA 4N41A 4OZJA 3NBPB 4V19X 5KG0A 3M8PA 4PG4A 1Y4ZB 4NLXA 2ILZA 2HZVA 4Q43A 3G82A 3B6BA 1X4HA 1YX2A 4XPCA 1SXLA 3HP6A 2KXFA 1U0HA 5DO2A 4I6AA 2QLBB 3IS9A 1VK8A 1BQNB 1SL0A 3MR3A 4WKYA 2PFFB 1N54B 1SB6A 5EWGA 5C2CA 3LAKA 1CJTB 2ZNYA 1I6JA 1FFGB 5EWEA 3CCRS 4QWCA 3Q8UA 3HI9A 2ZZTA 5DGBA 3IG1B 3DYAB 2L08A 2ASJA 1RBLA 4DUYJ 1QAXA 3EVWA 3GG1A 1YQHA 5IV3A 3FDSA 4NLVA 1OSDA 5AE3A 2J9DE 3OL7A 3NCQA 4USTA 2CNKB 4PQUA 2HEKA 1B0PA 4OYXA 4DR2F 4J9MA 2QL5B 1YHQS 2V4JB 1HNWF 1HHSA 4HLBA 1R89A 3IR7B 4CCHA 2XB2D 1IN0A 3I0SA 4OX8A 4LFBJ 1MMDA 1G1XA 1UWAA 3S01A 4LUBA 4IDKA 2O3DA 4ZMMA 2JC0A 4ANDA 2L9WA 3QJPA 5J1EB 2RRAA 2L48A 2E5LF 3JXOA 3JS9A 4NYPA 4ZVEA 4USHA 3LAMA 5L8RC 1U4BA 3U1MA 3CB4A 1RJJA 1ZM3A 5A2QY 4CDIA 3C14B 2OPPB 2GV1A 1HW8A 3MR5A 2DRDA 1R27B 3CCVS 3DOMB 5HBMB 2NQPA 1Z2ZA 4NXMF 3FZ2A 4XPEA 5GMDA 2XTJP 3MM6B 2CNNB 1T11A 2NSBA 3W7BA 4I6YA 2HQGA 2XO6A 4LSNA 3TYTA 5E3AA 3CMAS 2UZAA 3EXCX 3NGSA 2BJDA 4U9RA 2UXDF 3HHLC 4J9RA 4OZ0A 3AOBA 3BH6B 4X62F 4ES2A 2HWTA 3HSZA 4DQSA 3V6DA 2VFTA 4OZNA 3ADAC 3EM1A 2JEGA 2B4VA 4DDFA 1G6BA 1RWOB 1CJUA 4UY8T 3VAFA 4P74A 4WFYA 5KT7A 1I5OB 4B3OB 5KFMA 4RUCA 4ZDNA 3MM9A 3ITHA 2WBMA 4M5NA 4NLQA 1U09A 3N28A 4O3SA 4KJIA 4DV5J 1S7IA 3GP9A 3VF0B 1JLAB 3HD1A 3NGUA 2QG9B 4X4NA 3JYTA 4I0WA 4OHYA 2CQGA 3OL9A 2ERRA 1CLFA 1GXLA 4C98A 1C1CB 2U2FA 1FX2A 4I1TA 2BV3A 2DVIA 3G9CA 2KN4A 1T3OA 3GCWP 1BQNA 2DCLA 5F8GA 5GMEA 1WC4A 1QSSA 2HW3A 4C8NA 1CS4B 4OYAA 1J5EJ 4OLPA 2HHTA 4ED1A 3DYAA 3P5TL 3ILJA 3TA1A 2V2ZA 4ED2A 2CJAA 1JLCB 3CWJA 3W1YC 2NCKL 4L74A 3I87A 3J7Z5 2BE9B 1R0CB 3RBEA 1X7VA 4JBCA 4PZVA 4Y3CA 1FNOA 1KWMA 3X1LB 2R7QA 1RBOB 4FBUA 3DN9A 4LF8J 3DRYA 1F9EB 5FLXU 4LF1A 2KH9A 1O8BA 3PEHA 3SSRA 2RHSB 2R4FA 4JV5F 3QGGA 2GMLA 4YR0A 2YKPA 1NMEB 4USKA 4NRTA 1NK8A 3NS6A 2XY5A 4Q2MA 2NXJA 4JI1F 2F8EX 4RR5A 4WE1B 3MEDB 2HQFA 5FD1A 1FA0A 2YQ1A 2C2RA 2DNLA 1IUJA 4OZ3A 4RWWA 4Q7AA 1VQSA 3ETMA 3HHLD 4GKKF 4CH1A 3C14A 2A3JA 2JEJA 1AXQA 1BQXA 3QBCA 4FDFA 2CQHA 5M2PA 4UOGA 3KUHA 2E1RA 5IT0A 4P72A 2ZH7A 2X51A 1RABB 1AROP 1XNQF 4U96A 1NH8A 4DMZA 3MM6A 4YDXA 1D8YA 1N0UA 2YWKA 1MW7A 1JXEA 4RX6A 4X4UA 4WKRA 5A76A 2IMWP 3A4TA 4MT1A 5B0AA 1T7PA 1F5CA 3ELHA 1YG0A 4IUFA 2J0QD 2HG4A 3KXDA 4DCOB 1WEZA 5EDWA 2XZTB 4EYIB 4PABA 4IO9Q 3VAJA 1XQIA 2HNYB 2VQEF 1S1XB 2ZKUA 3AA9A 1HD0A 2G2YA 3LGMA 2R2TA 2AWZA 4B9TA 3RAQA 2PMHA 1S9FA 4U6PA 2F63A 5IM0B 4FN5A 4DZDA 2XZWA 4DPXA 3MD1A 4B9LA 2P9GA 1M90T 2CFXA 4DV6F 1JLAA 4ZLLA 4TU9A 4K7QA 2GNKA 4YP3A 2YXLA 3CD7A 2V2QA 3TP2A 1TL3A 2FYXA 3B4MA 3DCAA 3OPKA 4OJGA 3Q8YA 2FLPA 3D3BJ 2ZBCA 1L3VA 1OS5A 4JP8A 4BWJA 2HNZB 1HQ2A 3UQSA 3GYGA 4KY3A 3QO9B 2L41A 4PXBA 3EVMA 1FESA 5GAHU 2Z2LA 3AXKA 3EPGA 3V6HA 5SUHA 4P2MA 3W9JA 1CS4A 2Q43A 2H1YA 1Q79A 1WI8A 1W7WA 5K14A 3QT5A 3VV2B 3TAMB 1Y3JA 1JLCA 3TQEA 4J90A 4FS2A 4FF1A 2HVDA 1WOPA 1I1GA 3G71S 3PYEA 2CJBA 4DU7A 1IR0A 3MM8B 4LRFA 1FXRA 1XNRJ 1S0NA 3D3CJ 2XYPB 3PNIA 5KFIA 1S72S 2MLYA 3OLAA 5AT1B 3TJAA 5D8HB 4IOBA 4LBPA 2CJQA 1EKRA 4CLKA 2LQ8A 2J8SA 2QFJA 4DV0F 4LR9A 3J7YU 3CDWA 3NL0A 3GFXA 3CJ2A 2DY9A 2XEXA 4M5LA 1QVGR 2OUGA 2RJZA 1R0AA 1YRUA 3C6TB 4NLYA 2XGQA 2AX0A 3G8SA 3MFHA 5FLXY 1K44A 3KYLA 4PXEA 2A10A 2AW0A 3R7NB 2CJKA 2XMUA 3CPWR 1LW2A 1W26A 9ATCB 1YGYA 4PWDB 1U2FA 2RT3A 1S1TA 2FHOB 4O0NA 1UVJA 4KHRA 2EK6A 1OY6A 3MMBB 3EVOA 1U6FA 4YQWA 2E7VA 2YX1A 4L3NA 3KJFB 1Y5NB 2HHVA 3IFEA 4H54A 1XMBA 5F8IA 4DR4F 4K2JA 2RE1A 1T9TA 1MWQA 3HVRA 1RT2A 2DRBA 4EYHB 3VCDA 4NCAA 3QSYB 1UVKA 5KT4A 3M1VB 2VUGA 1MWYA 2X3DA 4MKBA 1N5VA 1F5BA 1T95A 5IM0A 4OYOA 4NLOA 2HHWA 4P2FA 3J7ZT 4OI3A 4DV1J 2ZOMA 2A18A 4KT0C 2CQPA 4LSLB 2E1AA 1KNZA 4HKQA 1YI2S 2EFOA 1BY9A 1GAOA 3VAHA 1VIOA 2DHHA 2FJWA 3OD2A 2J7KA 1SCJB 3TAPA 2YNFA 4R5PA 5BYQA 3THTA 4ZVGA 4URGA 1VHIA 1HBMA 4XDDA 1UZDA 2HNZA 1D8ZA 2KXNB 3M2VA 4QW9A 4YB7A 3CCJS 2VPZB 4HTIA 2YQ0A 1HLWA 2RQ4A 4F26A 5KG5A 4CZCA 1TK0A 5HROB 5E33A 2OKQA 4N76A 3OVSA 2HQIA 3GFHA 5IXUA 2LQJA 4Q5VA 5DG7A 1TZ0A 3W63A 4HHJA 1VC0A 3MM8A 2OEMA 2PA3A 2Q1LA 3MI7X 1MSWD 4FF3A 1GMWA 4DX6A 3UCZP 1SQFA 1QY7A 1IBMF 1N33F 2HPUA 4R0JA 4K5SA 1EX8A 3MM5B 1YJUA 1Z1ZA 2MPUA 1NPRA 4DOZA 2JFKA 3WBZA 4WFNQ 3C6TA 2PD1A 2QIFA 2WB1D 3PJ9A 5SZTA 3CNQP 1FDNA 2RNEA 2AEJA 2G0CA 1B7YB 3HF5A 2E5GA 2GJFA 3UNGC 4A48A 2DNPA 1NNDA 2RRBA 3AOCA 3RJMB 4B3RJ 5D0RA 1DFDA 3G6ES 2G1DA 2P2CB 1SUQB 2HZAA 3MMBA 5ETTA 5FJ4A 3VAGA 2XSFA 4NPOA 2UP1A 4DZ6A 2ZBQA 4USUA 4DUZJ 1EIYB 2MHEA 2R8KA 2HFNA 2HIYA 2QO3A 2JHEA 4GVLA 4LVOP 2K3IA 1IBKF 2FVPA 3QIPB 4K5RA 1N4LA 3MR2A 2R2SA 5CYQB 4CYUA 3PACA 3IGNA 2VBWA 2B4UA 3MCNA 3TAQA 2UU9F 3UNYA 3BO2A 3BREA 5J2NA 5T41A 5MAOA 1FKAF 1U47A 2QA4S 2FZKB 2XLKA 1WF1A 2R7TA 4OX7A 1K0TA 5KT2A 3ZNUA 2OLWA 4B9SA 4RWXA 2FLLA 3NCRA 2GA7A 3DLBA 3KMQA 2CWXA 4ETZA 4UW2A 4DR2J 3KDOA 2IHR1 1HNWJ 4QW8A 1RAFB 5HROA 4F3OA 4ED3A 1NHUA 3G6YA 4DL7A 3KDNA 5F8JA 5HQMA 3PYGA 3QAEA 3AQPA 3HXMA 3NMRA 4X4SA 2E5LJ 4DSJA 4ILMA 2X7IA 2HRTA 2MQPA 2V4QA 1X4BA 3RW6A 2D3OR 4J9SA 4DU8A 4O3PA 4FYVB 1KQSR 4KR0B 1R8HA 1JWWA 2EK1A 1M5SA 3LP0B 4NXMJ 2DHGA 5F8MA 3CD0A 1TV6A 1HHQA 4M63A 1HIYA 4PUOB 4TVAB 2DY1A 3FCHA 1GMWD 2LQBA 1MMLA 2UXDJ 3BPSP 4X62J 5LXYA 4QPXA 3MAHA 3DMJB 1WJ9A 4Q0BB 1P8GA 1SI9A 2XMJA 1N5YA 5D3GA 1IR2A 2JDJA 3JTNA 3W65A 2E5HA 4JB8B 5A0YB 1OSCA 2BACA 4JI5F 2XHCA 4ZP7A 1TL1B 2POKA 1UWBB 2BW2A 2OPRA 2ZKTA 2G4BA 4I6WA 1GX5A 4DR1F 1L3TA 1F2HA 1X5TA 2IIHA 4RW8B 4LF5F 2MZQA 3UN2A 5KFGA 2APOA 5CYQA 2Y1RI 2XG8A 4O23A 2R8HA 3TI0A 3GSDA 2EWHA 4MAKA 2H65B 2QV6A 2UUTA 4AL7A 2KFZA 4M1KA 3Q8PB 4ZCIA 1F2GA 2DH9A 3D1OA 3A1YG 3PM9A 3Q0AA 2DXDA 3D67A 4TY9A 5IOLA 2J6UA 2G9OA 1JQGA 5LJ5Y 2J0WA 2IA0A 3W64A 4JI4J 2QL7B 1RB0A 2BKPA 2LU2A 1SC3B 1JNRB 2DT9A 2CDQA 4P73A 1HBOB 2GO9A 3IAS9 2LEPA 3ZTSA 3HLUA 4RNFA 4J9LA 2HIQA 3LPYA 2FIUA 2R7UA 4F67A 1I51B 1U25A 3S8SA 1S48A 4JV5J 3GPAA 2XCPA 1HNXF 4DG1B 3M4XA 1C2PA 4NWBA 5AE1A 1WC6A 1UEKA 3T1AA 4JI1J 1MG7A 4DN9A 1WTFA 1S4EA 2IM0A 2AD9A 4ECYA 1ZH5A 1LK5A 3LP1B 1IKXA 3ZZPA 4LF2A 2AZ3A 2C2MB 3DU6A 3RAXA 2ATCB 4J9QA 1P27B 1FRIA 4GKKJ 4V1Ak 1YVFA 3GIJA 4GVBB 2Y8WA 1NJYA 1MROB 2YX7A 4M8LA 3MECA 3QLHA 2HQDA 1OY8A 1MN9A 3UN3A 3LP0A 5H9EK 2M88A 2Y3YA 1N48A 2YNHB 1XNQJ 4OIXA 3KK3B 2MSSA 1Q7LB 1CVJA 2B4PA 3W61A 3KTQA 2GO8A 2HRYA 2DH8A 3KJQB 1NDLA 4QYZJ 1KBRA 2RKIB 1SQEA 2LXFA 4PUOA 2NZ4A 2WHOA 1RACB 1WSRA 1K1SA 3MM7A 2W4DA 2MZRA 3DMJA 1NO8A 4ID5B 2WZ1A 4Q0BA 3WX8A 4DLGA 1Q5VA 1SH0A 2VQEJ 1T03B 1R0BG 2E7XA 2JLFA 3NS5A 1TL1A 1CG2A 1REVA 1MN7A 1HMVB 1UWBA 1VQ9S 3M9NB 2MJNA 1UZHA 3G6XA 1B64A 2CIMA 1NCLA 1GXTA 1D1UA 2FVQA 4DV6J 1H73A 4ID8A 5BXIA 1U1RA 4RW8A 4LQ9A 3WHIA 4CO5A 1HYSA 4NLGA 1S7HA 4YUDA 1YBTA 3NMAA 2OTLS 5HVHA 3W2WA 3ENVA 4WZQA 4KH1B 1Q5YA 1KLMA 4HI1A 3W5XA 2MEWA 5KT3A 1WI6A 1CJKB 2OPSB 4A8YA 1S1UB 3UD3P 4OYBA 1D9FA 2QLWA 3MMCB 2K3KA 1WNEA 1SVDA 2GHPA 1XWLA 1TMMA 3FSIA 2MZJA 4IRCA 1SC4B 2DEIA 4PKDB 5HAOA 2M2BA 2ZH4A 1UP1A 3A12A 1KONA 3AA8A 1VFJA 1HBOA 1GH8A 1URNA 3ULHA 1LFPA 4IQMA 1FJ7A 4Y65A 1HQUB 1AUDA 1RT3A 4DLEA 1H2VZ 1RHJB 4CLSA 3FBBA 3W2VB 1AFJA 4DG1A 2H5IB 5F8HA 3RU0A 1VQ7S 4ZP6A 4JI7F 1TKZB 2AYBA 3DRRA 5HN0A 5L46A 2U1AA 3FBFA 4F7VA 2HFVA 3JQMA 2W7AA 2MJUA 2EVZA 1T9XA 1VYAA 1JLBA 2VF3A 2I2YA 4G1PA 2VODA 2VPXB 1RT5B 3VVUA 4KKOB 1LW0A 3FUYA 6AT1B 3G86A 1REGX 4ZPTR 4GVBA 3SV3A 1IJFB 2QN6B 1MROA 1OPIA 3AOAA 4TN2A 4CO4A 2ZNZA 3C2PA 5B0DA 1VRTA 4O4RA 3MGJA 3BN4A 1U2RA 2YNHA 3KK3A 4ZVQB 3DLGB 1XIQA 2YVSA 2QLXA 5DG8A 4NLUA 4CLWA 2AP6A 1YJVA 2IFXA 5H9FK 3BGFA 2WVDA 4KGKA 1QAJA 1NHKL 7FD1A 3M6VA 4ATNA 3QGIA 4LFAF 2QGFB 3D7SB 2DHAA 4DR4J 2RB7A 2D69A 3MR6A 3J7A1 5J2PA 4YOEA 5EN1A 1T03A 1P1TA 4IR1A 3QNWB 4DL2A 4HYKA 4NCGB 1HMVA 3BB5A 1S1WB 2JNJA 1CQNA 1WKJA 1AZSB 5ETOA 5L1IA 5E3PA 2HBYB 2RHQB 4ICLB 2VOOA 4F4KA 5B0CA 5CA5A 2QLJB 1QJHA 3HMJG 3SQGA 5HMWA 1SIWB 1RHRB 3DI6A 1EKSA 5KG7A 1ZYQA 2VL1A 1CJKA 1UEVA 1OWXA 4A8WA 3MCMA 3D6TB 5KFSA 1SV5A 4ER8A 3MMCA 2HZCA 2DGVA 3WZ0A 4YHHF 5ETMA 2K06A 3D28A 2ZE2A 3BKTA 1K47A 4CIOA 3GIMA 2HLTA 4G65A 3L95X 3DKDA 1NAQA 1WG5A 5KT5A 2EG1A 4FYYB 4A8FA 2JL9A 1MWZA 2RF2B 4ZVOB 2QSFA 3HJVA 1TVRB 4UOCA 1HQUA 2GS8A 2LA6A 3T1HJ 2JSXA 2AEFA 4O4GB 5C25B 4IG3B 3W2VA 1M5PC 1A0OB 1EETA 2D9PA 1IBMJ 1N33J 4ZVRB 3K5MA 4NMLA 1TKZA 2RU9A 1HFEL 4K4UA 5G0RA 1IBLF 5HP1B 4LSZB 3LP2A 5A8RA 5LSRA 1HBUA 2ZH6A 2MY7A 4UUXA 3AT1B 4NXNF 5KFDA 3H59A 4L6V3 1T05B 1FWPA 2C2OB 2HHSA 2RRNA 1ZM2A 1NSKL 4AL5A 3SCKE 5HLFA 2FUG9 3K89A 2CPZA 2C1EB 2GZOA 3GJTB 3PYDA 4ITSA 3M2UB 2YNIA 3NLCA 4OI2A 1V9OA 3K2YA 4WK3A 1RTIB 2JEIA 4XIUA 4QWDA 2B9EA 4DXLA 5B0FA 1XBWA 5HL7Q 3UN5A 4RW9A 3BO4A 2ZWPA 2DNHA 2PI4A 1NB7A 1IBKJ 4ZCMA 2WONB 3Q2SC 2KU7A 3C8YA 3N6NA 3QZ8A 4OI4A 1MMNA 3GJSB 1CJVB 4ECUA 3R5CA 1O6XA 1IR1A 2VFRA 4RU9A 1S1WA 1WC5A 3I4HX 2H9ZA 2YWWA 2WW4A 1EHWA 1AZSA 2UU9J
chains in the Genus database with same CATH topology
1Z2ZA 2AYMA 3CF5Q 4NXMF 4HDGA 3G8QA 3FZ2A 4XPEA 1F9FA 2M7SA 2CJ9A 2Z0GA 1ZTTA 4OI0A 2O66A 3JSBA 5KFKA 3MM6B 2QA2A 4PXDA 2CQBA 1U1PA 1VRTB 2MKSA 2GC8A 2YQ3A 2DR5A 4GKJF 3EX7B 3OHAA 3UW1A 2DNOA 2GHWA 2J9DA 2KYZA 3PEJA 2OAUA 2W8KA 2XC9A 1VRUA 2NSBA 3W7BA 4I6YA 1X4AA 1LQ9A 4LSNA 3TYTA 3GIKA 1R31A 1VMBA 1SBRA 1RQ0A 3I4PA 5E3AA 5AJ3F 3CMAS 2KT2A 1SKWA 2UZAA 3EXCX 2BJDA 2DO0A 3QO9A 4I4BA 4U9RA 4IFYB 2BDPA 2MKJA 3Q2TC 2UXDF 3BJYA 3M8RA 2P9CA 4M95A 3HHLC 3PDNA 3U1NA 4J9RA 4OZ0A 3LQVA 2Z8QA 2V5HG 2O67A 3OFGA 4X62F 2P6TA 4ES2A 2IJFA 1R8BA 2HWTA 1U6BA 4DQSA 3E8OA 2XMMA 3V6DA 3TNVA 1Y0HA 3THPA 2VFTA 4NLPA 4OZNA 4DJBA 2JEGA 3GFYA 5GADI 2B4VA 4DDFA 3HZEA 1G6BA 5FDLB 3N5FA 3VAFA 3CMES 2PO4A 1CQMA 3M8SA 2DNQA 1KFSA 4WFYA 4UY8T 4NA2A 1XC9A 1KOOA 5KT7A 3ISND 2ROPA 3TAMA 5J2PB 4OI1A 1W2BR 1Y3KA 4B3OB 3UR0A 5MLCV 3C66A 5KFMA 5D4NA 4RUCA 3N4WA 4ZDNA 2CQCA 2ATLA 1KOHA 1YJRA 1NK0A 1RISA 3MM9A 4YB6A 4QBUA 3ITHA 2OD6A 3TANA 2WBMA 4NLQA 1U09A 4DPOA 3TA2A 1QE1A 3N28A 1M0SA 4O3SA 2IYGA 3HK2A 2UUWA 4KJIA 1NJZA 2KFYA 1BC6A 3GR1A 5JXSA 3T9ZA 1J5OA 3GG0A 3K8VA 2XGPA 4X2BA 3VF0B 1FRJA 3CGIA 2PI5A 1JLAB 2N4DA 2KI2A 4KGMA 4TYBA 2FC9A 1H38A 2LMIA 2RF2A 4B9NA 3FEYB 1UAWA 1KLNA 5L39A 2QMXA 2LDIA 4OI6A 4X4NA 1GQEA 2B5JB 3JSMA 1BWEA 4Y28C 4I0WA 3JYTA 5LXRA 4OHYA 1TVRA 5J2QB 1GT8A 2OTJS 3V4IA 3L09A 3LF0A 1SJQA 3OR1B 2CQGA 2OFHX 3OL9A 2ERRA 1CLFA 3E3XA 1X4FA 2W9BA 3WX4A 3T1YF 5HMXA 4URQU 2OP5A 3SQGB 1GXLA 4C98A 1C1CB 2YKAA 2RQCA 2D3ZA 3DHWC 2U2FA 5JVHQ 2AX1A 1F0XA 1D3WA 2XSJB 3UE2A 4I1TA 2BV3A 1UA0A 2DVIA 3OBIA 2KN4A 5KG2A 3T5KA 3G9CA 1T3OA 4ZP9A 4USIA 2ZHAA 3SI8A 1BQNA 4ZHRB 4PQAA 1ZETA 1AW0A 1KC8T 2DCLA 3ZZOA 3DI6B 5F8GA 5ADZA 4LVNP 2R9LA 4OHXA 2ZD1A 4DL5A 1C1BA 4XDCA 1QUPA 5HP1A 2K1RA 1QSSA 1C4CA 2HW3A 4DF4A 3NG8A 2MQQA 2DITA 1T02A 1LWEB 1SV5B 2RQKA 4YEAA 4C8NA 5IQ6A 4TLQA 2XO7A 4V19J 1RT4A 2O01C 4RLEA 2ASYA 4OHZA 4DR3F 4OLPA 2HHTA 4ED1A 3DYAA 4PWUA 2K7KA 3X3UA 2ROGA 1XR6A 5KFYA 4OJHA 5LSLA 3P5TL 1FK9A 2ZE2B 3TA1A 4ED2A 2CJAA 2R2RA 1JLCB 3CWJA 4BHQA 3IWXA 2LYVA 2YNGA 5CD4H 4A8KA 4ZCKA 2C2DA 2VBZA 1G7CB 5T7LB 1IKYB 3I87A 3J7Z5 3V81B 3PXGa 3RBEA 2KDOA 4PG6A 1X7VA 2FGCA 4JBCA 3VQSA 4Y3CA 4ZKAA 2GJIA 4PXCA 3K5OA 4AQYF 1FNOA 3OL6A 4XK8C 2CQ3A 2KG1A 3GILA 3PW7A 1TKTA 1FE4A 1QM9A 4O3NA 4GC7A 3X1LB 2R7QA 4PWDA 5IZHA 3QWUA 4FBUA 4FF2A 3NNAA 3M8PB 4DL0C 3DLKA 3DN9A 1J2VA 2ZH8A 3DRYA 1VQKS 4ZVFA 4RW7B 3DM2A 5DS7A 2KH9A 3DDKA 2XMVA 1XR7A 1O8BA 3PEHA 3SSRA 3MUTP 1ZTWA 2KJWA 4N8OA 2R4FA 3P49B 4JV5F 1FKPB 1KTVA 3QGGA 3RZAA 2GMLA 1LFWA 2EW9A 1H6KX 3PJXA 4TXSA 2YKPA 5I3PA 3UCGA 4YR0A 2XLJA 1RTIA 1YITS 1D9DA 2IA6A 1DAXA 3CC7S 4LF9F 2R7SA 1JJHA 1U26A 2VH7A 5E0OA 1NK8A 4NRTA 3PHEA 4QOTA 3NS6A 1EETB 3ENWA 5I4MA 1LV5A 2XY5A 5I3UA 1DJ0A 1DARA 1SKSA 4Q2MA 3CO9A 2J6SA 3PFEA 5A6WA 4X4PA 4IYQA 3H25A 3BDPA 4JI1F 2NREA 3OUYB 2AJFE 2YWFA 2F8EX 2N7YA 4FXVA 4WE1B 3MEDB 1PSDA 2EPIA 5G0RB 4I7FA 3UCUP 5FD1A 2XWXA 3KNAA 2GX8A 3S1TA 3M1VA 1FA0A 1IXKA 2CYYA 1UFWA 1GTEA 3BSAA 3LP2B 3MDFA 2DNLA 1IUJA 5F3TA 1Y7PA 2C2RA 4RWWA 4Q45A 4Q7AA 4UY85 4KC5A 1KQKA 4FS1A 4PG5A 3M30A 3TA0A 1ZOTA 5A8RB 1VQSA 1HBUB 2F1FA 2YWHA 2LECA 3HHLD 4GKKF 4CH1A 2A3JA 2JEJA 1V6HA 1AXQA 4B9UA 3UR3C 1UJ6A 1BQXA 1CC8A 2FJAB 4IKAA 2CQHA 5CH7B 5M2PA 2AF6A 2M70A 3DLEA 1NJIT 2E1RA 3EUNA 3IBWA 4YFUA 3CCTA 2CZ4A 2GQQA 3PV8A 4LSLA 5IT0A 1VQPS 2JEFA 2CKWA 4NLRA 3PR5B 4B3SF 2ZH7A 2JZ5A 2P9EA 2X51A 3DFEA 1RA7A 2HQ3A 3D0GE 3IO1A 5A6PA 2I1RA 1HWIA 1UVNA 5DM7Q 5KFBA 4X64F 1AROP 2JC1A 1O51A 5J1NA 1XNQF 1NH8A 2FHJD 3CIMA 1S49A 2HGNA 4DMZA 5E41A 3MM6A 3IWNC 1DTTB 1UMJA 4YDXA 4A8OA 1DLOA 1D8YA 4PQUB 4F2SA 3L7OA 1N0UA 3CJ3A 2YWKA 4KE5A 5HLFB 2V9KA 1MW7A 5L9NA 1JXEA 4RX6A 1U48A 1JXLA 4X4UA 2R7XA 3I6PA 3GV5B 2YNIB 4WKRA 2IMWP 1JB0C 3KMSA 3GIIA 3EGZA 4BC9A 1UFLA 2W9CA 4J9KA 3H40A 3CJ4A 1FT8A 4MK8A 1E6YA 3FVYA 5B0AA 3PIOQ 2O1PA 4IFYA 1T7PA 1F5CA 1YG0A 2JVRA 2PGCA 3N9UC 3TRGA 3BSNA 4Y00A 2N7CA 4TQSA 2J0QD 4IUFA 4CNYA 2HG4A 4PCQA 4DEZA 4P7TA 1WEZA 2XS2A 3DHXA 4DR6F 5EDWA 1V3ZA 4RKUC 1FDDA 3IA0A 4ECRA 4EYIB 2GMHA 2B7CB 4ES3A 4IO9Q 2M52A 1V3RA 5FDLA 3JAMY 3VAJA 2VQEF 2HNYB 3OVAA 1S1XB 2ZKUA 1IM4A 4RW9B 2RU3A 3OXLA 3HVWA 2V8DA 1ZBTA 3AA9A 1HD0A 1S6QA 2OPQB 2ZH1A 2XWYA 3O6QA 5JJBA 5HMZA 5KAKA 3HHEA 3LGMA 2R2TA 2AWZA 3RBDA 5HMYA 2BRKA 3BDEA 4B9TA 7FDRA 2D1CA 3RAQA 2PMHA 2XS7A 1S9FA 4U6PA 3OTBA 3QGPA 3PO5A 2F7VA 5CZVA 5IM0B 3D1QA 3KG4A 4FN5A 3OLBA 1WACA 2XZWA 2WAQD 3BGRB 3DXBA 3MD1A 4H4KC 1U1QA 2P9GA 4B9LA 2FC8A 1M90T 2CFXA 2HMIB 3IRXA 3TW0A 1H2TZ 4DV6F 2MB0B 4YY3F 4HTJA 1JLAA 3BGUA 2B9WA 1MU2B 5GAEU 4TU9A 1FE0A 4GMKA 1HNIB 1FDBA 1VIXA 2X1GA 2B5JA 1LK7A 2CQ1A 5J2QA 3RB6A 2GNKA 2C3YA 1EP4A 2F3JA 4YP3A 3DC2A