3UD4P

The c92u mutant c-di-gmp-i riboswitch bound to gpa
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/rna
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ud4P00
3CCSS 2CQ0A 1KD1T 2VODA 1WEYA 3SDEA 1ZH5A 1X5OA 1FXLA 2L41A 2DNQA 2VONA 4PRFA 1S72S 3I55S 4WCEQ 2DO0A 2FPHX 1R8PA 4IOAQ 4F25A 3OW2R 1A7GE 1WHYA 3CPWR 2NLWA 1D9AA 2CPDA 1WF1A 1FHTA 2M52A 1U1NA 2DHGA 3TP2A 1FJ7A 2DO4A 3I56S 1VQNS 5CXTA 2DB1A 2RT3A 4ZKAA 2VOPA 4PKDB 2MMYA 2D3OR 1P27B 1WWHA 2KXHA 1K8AT 2CQBA 3MUVP 3THTA 1U1PA 5GAEU 4QU6A 1N8RT 3CD6S 1RKJA 2E5IA 2CQCA 2DGQA 1Q82T 1K73T 2DHXA 1SJQA 2DITA 2F9DA 5D78A 1KC8T 1VQPS 2E5JA 3G6ES 4F02A 1YJ9S 2HZCA 3R1LA 2CQ1A 4A8XA 1FT8A 1RK8A 3G9CA 5LXYA 3CC7S 3TO8A 1HD0A 1WHXA 2MY8A 2B0GA 3BO2A 2KRBA 2FHOB 1F9FA 2A3JA 2MHNA 1PGZA 2CQ4A 4UQTA 3ZZYA 2KH9A 1JJ2R 3CXCR 3HHNB 2F3JA 3CUNA 1YJNS 1WHVA 1PO6A 1XN9A 1VQKS 2MZRA 1FJEB 2JVOA 1X5PA 2LEAA 2CPJA 5HL7Q 1M5KC 3MI7X 2JVRA 4CH1A 1ZZFA 4BS2A 1BY9A 4ED5A 4QU7A 3UD4P 2J0QD 1NJIT 5H1SV 3S6EA 2CQIA 2QEXS 4CQ1A 3J7ZT 2DNPA 2DH9A 5JVGQ 4TLQA 3BO3A 1Q7YT 4WFBQ 2PEHA 1D8ZA 4Y00A 1WEXA 2M4MA 3CF5Q 2E5HA 2ZJRQ 2O3DA 3LPYA 1SJ3P 2KM8B 4ERDA 3G8TA 1JJHA 3L3CA 5LXRA 2SXLA 2DNZA 1WI8A 1K9MT 3P6YC 2BZ2A 4LMZA 1U1MA 3TYTA 1H2UX 2X1AA 1YHQS 3H2VE 3MD1A 2MPUA 1X0FA 1DZ5A 3CMAS 2E5GA 1WG4A 2RQCA 1VQ7S 3RW7A 1KQSR 3P5TL 1VBXA 1HD1A 5IM0A 4UY8T 2CPIA 2AYBA 3U1LA 2HGLA 5HO4A 1U1QA 4PR6A 2M8DB 2QA4S 2MKKA 1WTBA 2XNRA 2DK2A 1H6KX 5EN1A 2X1BA 3ULHA 3IRWP 2CJKA 3EX7B 2MKHA 2WBRA 2LXIA 3N9UC 2ERRA 2CPZA 2MKIA 1FO1A 2OSQA 1M90T 1P1TA 4YOEA 2OSRA 3FEYB 1FNXH 2MQLA 2MGZB 2DHAA 2KVIA 2MXYA 2LXUA 2FC9A 2CQGA 3VAFA 4WKRA 1A9NB 1L3KA 3VAKA 2BOPA 2DNRA 3CC2S 1YIJS 2G0CA 3G8SA 2DNYA 4YUDA 1U1KA 4W92B 3MUTP 1H2TZ 3RW6A 4U67Q 2KG1A 1YTYA 2DNGA 2MQOA 2JX2A 5GAHU 2DNKA 2KHCA 2CQ2A 2DNMA 2AYGA 3DLLQ 1B7FA 5ITHA 1WEZA 1WG1A 5MLCV 3SXLA 5D77A 3NMRA 1NU4A 3DXBA 1N52B 2U2FA 4W90B 3UE2A 1X5SA 1UFWA 1QVGR 1DRZA 2AYMA 2DGOA 3P49B 1U6FA 1VQ4S 3R27A 2ADBA 3UCGA 5DM7Q 2KI2A 3K0JA 3CCES 3UD3P 5GAGU 4CIOA 2RQ4A 2XNQA 2MKJA 1HL6A 1OO0B 1U1OA 2Q79A 1QM9A 1U2FA 2UP1A 3P3DA 2DHSA 1M5OC 2KU7A 2ZJPQ 1X5TA 3VALA 2CQDA 3JB9k 1CVJA 2MSSA 2M70A 1G2EA 4TU7A 2GO9A 1OPIA 4IO9Q 3CMES 1VC6A 2KG0A 2RRBA 2PE8A 2DNOA 2N3LA 2HGNA 2DH8A 2K8GA 3HI9A 5LSOA 5DDOC 2LCWA 3CCJS 2M7SA 2N7CA 2LECA 1WI6A 2MSTA 4WIIA 2M2BA 4C7QA 1SXLA 1YWXA 2MZ1A 1HA1A 4P6QA 3FEXB 2OTLS 2M88A 2N3OA 3IWNC 5DM6Q 2L08A 1YITS 2I2YA 4QQBA 2KM8C 1X4HA 2JRSA 4Y0FA 4F26A 3D2WA 2EK6A 3B4DA 3NS5A 1VBYA 1S79A 2G1DA 3CCMS 2D9PA 3PIOQ 2MQMA 1H2VZ 1W2BR 2DGUA 1OIAA 2MZTA 2MY7A 2MQNA 2AD9A 2KXNB 5GVQA 3CCQS 2OTJS 2YWKA 4FXVA 1KOHA 1IQTA 3US5A 2MYFA 2LYVA 3S8SA 1FJCA 3H2UB 1WG5A 3MOJB 4QPTA 2MQPA 1YJWS 2KYXA 2CQHA 2CPEA 4TU8A 4RU2A 1JJ4A 1Q81T 1X4DA 1R8HA 1WHWA 2MGZA 3R1HA 2KT5A 4IOCQ 1N54B 2J76E 2RUGA 3EGZA 1DHMA 3EGNA 4CH0S 2NZ4A 5IFMA 2GHPA 2DNNA 3BEGB 2M8HA 1SJRA 2RS2A 3MD3A 2RU3A 2RRAA 2EK1A 2DNHA 2DGTA 1U1LA 2YH1A 2M0GB 2LA4A 4OZ0A 3SDEB 5GADU 3CCRS 3UWTA 4OZ1A 3NNHA 3MURP 2K3KA 4C0OC 4IUFA 1WF2A 1NO8A 3BS9A 1VQ9S 1DBDA 2YH0A 3G71S 1X4BA 2HYIB 2OIHA 2D9OA 2M9KA 2U1AA 2KFYA 3B4MA 2ADCA 3MDFA 4EGLA 1M5PC 2MJUA 2OJ3A 3NNCA 2MKCA 4YB1P 2XB2D 1URNA 2CPYA 3G4SS 1ZZNA 3LQVA 1VC0A 4WFNQ 4WFAQ 2QFJA 1VQ8S 3NNAA 4V19X 3VF0B 2AYEA 2L9WA 2I38A 2MZQA 2LKZA 2EVZA 1JMTA 1O0PA 3ZZZA 5JVHQ 3UCZP 3S01A 2LMIA 3SMZA 1VQLS 2DIUA 1M5VC 2CQPA 1VQOS 1VQ6S 1M1KT 1UW4A 3PIPQ 2E44A 2MKSA 1N88A 2DGVA 5DDRC 3J7YU 2FY1A 1Q86T 2X1FA 2CQ3A 1VQ5S 4LIRA 3CC4S 2CPFA 2KN4A 2MQQA 1U6BA 4Z2XA 1YI2S 5GMKa 2XS2A 2CPHA 2MJNA 2J0SD 2DIVA 2XS5A 1WELA 2KRRA 2LQ5A 5DETA 4TU9A 2RS8A 2DGXA 4C4WA 5DDPC 2J8AA 5CA5A 2N82B 2HGMA 4FXWA 2XSFA 1VQMS 2DNLA 1X4AA 1KOOA 2ZJQQ 1OWXA 3MXHP 5LJ3Y 3MUMP 2KXFA 1WF0A 3UCUP 3S7RA 2YKAA 4M5DB 5LJ5Y 3CCVS 1X4CA 1VBZA 2LEBA 2F9JA 4WF9Q 2MZJA 4J5OA 2DISA 3VAMA 2MZSA 3VAIA 3CCLS 3BO4A 1AUDA 1QVFR 2HVZA 5BJRA 2DH7A 2RNEA 3Q2SC 3THPA 2CPXA 3V4MA 2RVJA 3VAGA 1X4EA 5DDQC 1UAWA 5LSLA 2X1GA 3VAJA 2MB0B 3CULA 2FC8A 2V94A 5CYJA 1SJFA 3CTRA 2VOOA 1UP1A 3G96A 1VC5A 5IQQA 2DGSA 3U1MA 5FJ4A 3NS6A 1X4GA 2DGWA 1X4FA 1U1RA 2XS7A 2JWNA 2YTCA 4LJMA 5IM0B 3Q2TC 3VAHA 3CCUS 2G4BA 1SJ4P 2LA6A
chains in the Genus database with same CATH superfamily
1AZSB 1FRIA 4I6WA 3KHLA 1CC7A 3OW2R 5B0EA 1LW2A 1X31C 1XERA 2Z57B 4G1IA 4P2SA 4DF4A 3NEKA 3GG0A 2M52A 3VGSA 1IKWA 3FZBA 1N33J 1VBKA 2GJFA 1VHIA 1S1TB 1KWMA 2W24A 3BKUA 3QZ7A 3CD6S 4K5RA 3VHQA 5CYMA 3H98A 1XIQA 2J8SA 4YHHJ 1DQ8A 2VFVA 4LF6J 1IBLJ 3BO2A 3DLEB 3GIRA 4DV1F 2QG9B 3K58A 1YJNS 4Q2MA 2CPJA 1M5KC 3DLBA 2WTFA 2I0XA 2JVRA 4BS2A 3TA1A 3C14B 4EEYA 2CQIA 5FD1A 2VV5A 4JB8B 4C48A 2UUCJ 3MHYA 3PYFA 4PPDA 1WEXA 2WBMA 5DS7A 5HLFB 1XTZA 5B0FA 3B54A 4IQMA 4LSNA 2Y1JA 4IDKB 7FDRA 4PXEA 1SB6A 4JUZA 2IYIA 5K8NA 3GFXA 5EN1A 2WHOA 4DG1A 4DZDA 5FIIA 2W4DA 3I5CA 3ISND 2ZH3A 4CO4A 1VMBA 4ED2A 3AB4B 3T41A 3BDPA 1OQ3A 3TW0A 3UI3A 2HFNA 3RW6A 2DNGA 3CWJA 3ISZA 1Y4ZB 3IS9B 4DPWA 4ATNA 5B0BA 3TJAA 4IRKA 1FI4A 1S7HA 5D77A 4M5NA 4GKKJ 3FFIA 2RIJA 3OL8A 2KI2A 4AL7A 3IM9A 3FBFA 2J5AA 3IR6B 3DU5A 1JLQA 2HWIA 3D1OA 1UA1A 2DHSA 1M5OC 2KU7A 4DFKA 1G2EA 3W62A 1OPIA 1VC6A 1Q4RA 2I8EA 2HHQA 2DNOA 2N3LA 3RB0A 2ZUAA 1RAEB 2HWTA 1U25A 3CCJS 5J1EB 1N34J 1Y5LB 1UL3A 3M8SA 2M2BA 1PCAA 4B9TA 2ACMA 2FJWA 2AMCB 1RHJB 1YITS 4RLEA 1CJKA 1YDLA 3T6BA 2B43A 3NAIA 2HBQB 2HG4A 4JYAJ 4RNOA 2DGUA 3AJ1A 2AJ2A 3BH7B 3DRRB 2DR7A 1AW0A 1RTIA 4Q0BA 2QT7A 1XBWA 3H2UB 3MOJB 3HZEA 2MQPA 1CJVA 1JJ4A 4GO7X 1TKZB 5J2QB 4NLDA 3JSBA 1SUQB 1MROB 4USVA 4KHRA 2NZ4A 2GHPA 2ASLA 3NY0A 1RT1B 3ZC4A 2ZBRA 4DL2A 2YBVA 3I96A 4NYZA 5GADU 1RT3B 3IG1B 4JP8A 4RBUA 2ZD1A 4NXNF 4C0OC 2CVIA 1DBDA 2YH0A 3FCVA 2DY9A 2E29A 4CYUB 2HYIB 1ACMB 1N36J 4PXDA 4DN9A 2BX6A 5GMDA 3BZQA 1GMWA 3POTA 3G8QA 4QJVA 3T1YJ 3PRDA 2CADA 2QFIA 5C2GA 4DQIA 4IH7A 4LRDA 2L9WA 4LR8A 4USHA 2XWXA 2LKZA 5K20B 2B7CB 3CJSA 2CQPA 5L46A 2J9CA 1T05B 3OR2A 1VLOA 1O51A 3SSRA 3CNQP 3LAKA 3AD8C 3DHWC 1R0AA 3BBBA 4NXMJ 5DG8A 1WELA 5KT2A 3UPFA 2P9CA 1Y00A 4C4WA 2ATLA 3OD2A 1VGYA 4IKAA 4C11A 3KXDA 4CLLA 1ZM2A 3MCMA 2XMAA 4QIVA 4C3KA 2RDIA 4HDGA 3M7VA 4P71A 4ZCKA 1WJ9A 1RACB 1O5JA 2JH3A 1RAAB 5EX3A 3C6TA 5HK4A 2QL7B 4YR0A 3I31A 1URRA 4DV4F 2B7BB 3M9OB 5D3GB 4RKUC 3ZFVA 3H5YA 3A8KA 2HFZA 4A8FA 4LVNP 4XIUA 2D3UA 5KFLA 4WCEQ 4LRFA 2HMIB 2D7SA 2NLWA 1ICEB 3W65A 3KK2A 1R89A 4OLPA 4EMDA 1VQNS 5CXTA 3UFCX 3OXFA 3M8WA 1U45A 4P75A 2FGCA 2EG1A 3QLHA 1FVSA 2CWXA 2F9DA 4X65J 3G6ES 5H9FK 2R8IA 5KFJA 3QSYB 2HZCA 3UNGC 4JI5F 3GV8B 3CC7S 1KVJA 4ZHRA 1HWIA 2A3JA 2FUG9 2YQ0A 1HNZJ 1YBAA 2CUYA 4I7FB 2HIQA 5ETTA 3KLHA 4A8YA 1S6QA 4DR3F 1NUEA 3AA8A 1T7PA 3BGRA 1V3ZA 3SV3A 3PO5A 4ED5A 3RRKA 1NJIT 2ROPA 1JB0C 2QEXS 4WXWA 5K5MA 1JLFA 2DR5A 5ETLA 3KK3B 1NNDA 4WFBQ 2HRYA 1HNVA 1FKPB 3AOBA 4I2QA 2ZEJA 1R43A 3HHLD 2SXLA 2GQCA 3ZNJ1 1RAIB 3FMBA 2X1AA 2AU0A 4LBHA 3UNYA 3MPYA 4WFXA 4LSLA 4KB7A 2RSQA 2VFRA 3EX7B 4GKJJ 3DOMA 1M90T 4PPZA 4YOEA 1DQ9A 2MXYA 4M94A 3I0SB 1YIJS 4BHQA 2CXEA 3WZ0A 1NDLA 4B3OB 4W4MA 1VFJA 1VQYA 1B7FA 4DHVA 1FRJA 2HNZB 2ILZA 2E1RA 1NU4A 1QAIA 2RF2A 4F0KA 3MEDA 4DL0C 3UE2A 1X5SA 1BQMB 4R8UB 4WE1B 5B0CA 5DM7Q 1QD1A 1UZDA 3RTVA 4RW6A 1VJWA 4MFBA 1Z1ZA 2MKJA 4AXIA 4PCQA 5B0AA 2UP1A 4G6VB 5GAGI 2M70A 4PUOB 1T8EA 2O01C 3SSQA 3CMES 5IQ6A 2A18A 2IDEA 4ZJQA 5DDOC 4A8OA 2C2KB 4B3MF 2LDYA 5K8PA 2M88A 2N3OA 1FVQA 4K7QA 3HSGA 3IBWA 3LALA 2JRSA 2ATCB 1VBYA 3HT3A 3JQKA 4DR5J 3GQCA 4RU9A 1IBKF 1D09B 2KO1A 4LF7J 4DV3F 5C2CA 1P6TA 3A3OB 4RW7A 2AJ1A 1RWUA 1S0NA 1FEEA 4Y2IA 4A8KA 1WHWA 3FBEA 3KFWX 3SYZA 3R1HA 3MMBB 4IOCQ 1N54B 4RJVA 5A6WA 1KLMB 1MU2A 4ZCLA 4QYZJ 4AQYJ 1UWAA 4WK3A 3R5JB 4DDFA 2ZHOA 2RDJA 2B4UA 4ZK7M 5KT7A 2HLTA 1VQ9S 1X4BA 4DPOA 3IR5B 2UXBJ 2OJ3A 4JI7J 4YB1P 1GAOA 2VA2A 3OL6A 4M5LA 1HBOA 4NL5A 5H9EK 4DFJA 2EVZA 1NK4A 4AXJA 3SQGA 3Q22A 1C1BA 3W2WA 2AKWB 3EZUA 2G0JA 2ACYA 2V34A 3OFGA 1HHSA 4ELVA 4JV5J 1NH8A 1UPPA 2XZDB 5GMKa 2MJNA 5IV4A 2QYGA 2XS5A 2YKMA 2BRKA 3NXZA 3OPKA 1M1HA 4X84A 1Y5NB 5F9LA 3JSMA 3GJRB 2N82B 3N0VA 3S1TA 1DTTA 4A8QA 3Q8QB 2ZJQQ 5F0UA 2AX1A 4LFBF 3DI6A 1X0PA 4O44B 1SH2A 1RT6A 2QA2A 1DAXA 3HHLB 2AQ4A 4DSEA 1VBZA 4USMA 3KG0A 2DISA 2EKYA 3GE9A 2F4VJ 3UO0A 1RLDA 2HBZB 4DSFA 4FYDA 2R8GA 9ATCB 3GV5B 5DDQC 2YNHB 3GCWP 3CULA 1UJ5A 2CDRB 3G96A 1HQEA 3EPIA 3MM8A 3MPUB 2OPPB 1SQGA 4H54A 4LJMA 2FVQA 2PI5A 4WPAA 1WEYA 1YJVA 2OP5A 1JLGA 1T02A 2B9YA 1RTZA 4LFCF 2QIFA 2YNIA 3W7BA 4FYYB 1VOMA 2WSCC 1OPZA 4ZVSB 3TP2A 2OI2A 2DB1A 2VOPA 3GSIA 3OTCA 5KFSA 2VPYB 5J2MA 3EZ5A 1SJQA 4MH8A 1NKCA 1TTHB 2QA1A 1UETA 1U0HA 4WZMA 4KGVB 1LOUA 3R5CA 1WDTA 5D0GA 5LM7E 2P9EA 1WHVA 4DV7F 4ZLNA 3MI7X 3KHHA 1XMOF 3J7AN 4WFYA 4OYPA 1QY7A 2DXDA 1RDRA 1ZPVA 2AJFE 3HM9A 3K59A 3CO9A 4P2FA 4ECYA 2PEBA 2E5HA 4NA1A 4M5JA 3UR0A 3AAWB 3KUHA 3CJKB 1CJTB 1AUSL 4RW9B 2IY5B 1XMQF 1UTAA 4J91A 2FLNA 4AD6A 3OTOJ 1H2UX 1YHQS 2C2MB 1YX2A 2HVEA 5J2PA 1KQSR 4EI2A 3GWCA 2JNJA 4XPCA 1RXOB 1IBMJ 2ZVIA 1YSJA 1LWFB 2EKNA 2QA4S 4RNMA 3D28A 5M2PA 3QQCD 2OSRA 1HHQA 2MQLA 1NH7A 3N6LA 2GIRA 2DNRA 4CNYA 4TXSA 1ZM9A 1KN6A 3JTNA 2VG7A 3FSIA 2OLWA 5KFNA 1RT7B 2F8EX 1FKOA 4URQU 4MAKA 3V4IA 2E7VA 1JXLA 2KJVA 2ZUGA 2E7XA 4DQPA 4HHJA 2BBEA 2CNLB 1YG0A 5KG5A 2E9RX 2JLEA 2ZH4A 1T9UA 2BKOA 3K0JA 3UD3P 2VIHA 1E6YA 4EBEA 3QT5A 2LQ8A 4X4RA 2YNGA 2YKQA 3G87A 3W64A 4DUZJ 4ZP7A 1U7LA 4TY8B 2PE8A 5IC4B 1YRUA 2PI4A 3M8ZA 1YJTA 3EJMA 2KVQE 2V8PA 4EBCA 4LF4J 1TVRB 4PG4A 1GX6A 1M1GA 3NGTA 3MM6A 5DM6Q 3M1VA 3BYRA 4ECZA 1S99A 1X4HA 5L1KA 4LFAJ 2VD3A 2ZZMA 1T3OA 3PIOQ 4P73A 5KFCA 1FKAF 4IG3A 1OIAA 1S1VB 3LP1A 5GVQA 3ZTPA 5D4PA 3HXMA 2HLUA 1FF2A 3PX4A 1IQTA 1CC8A 1TFWA 1G3OA 2A10A 3DLGB 2AIRB 4TU8A 3NGSA 4WU2A 2UXCJ 1FJGJ 5HVHA 3PEJA 5IFMA 2M8HA 2RS2A 2RU3A 2RRAA 2QLJB 2HHUA 4CRJA 1Q95G 2LA4A 3V6DA 1WC3A 1LQ9A 4H4MA 4F67A 1DARA 4PAAA 2QO3A 4OI3A 1EETB 4B3TF 2V9WA 4NZ7A 4WYWA 2I5JB 2LP4A 2XMVA 2RB7A 2VU5A 1NDPA 2QFJA 2DKOB 3GFYA 1CG2A 3M2UB 2DEIA 1S1XA 2I9SA 3IXQA 4CO2A 3DLKA 2MKSA 5DDRC 4OYMA 1EKRA 3BPSP 3KNAA 2CPFA 5DGAA 2JFDA 2YXLA 3FK4A 2N4DA 5B0GA 2WSEC 1SKSA 2IRUA 1KTQA 4D3HA 1ULRA 1RCOB 4Z37A 1IKXB 2AZ3A 2BEFA 2H1YA 4N41A 1VK8A 3UD5A 4WF9Q 2R2SA 3ENWA 3CCLS 4E0DA 4OI2A 1VRTA 4OHXA 3Q2SC 4MMOA 3NG8A 4LF2A 3V4MA 2HQGA 1UVJA 2Z30B 3X1LB 1NZ8A 5EGYA 4RBVA 3TOQA 3SFUA 5F8MA 1GK8A 3Q2TC 1HARA 1S9EA 1KD1T 3OUYB 1S4EA 1DJ0A 5K8OA 2HHSA 4NCGA 3DOLA 1RTJB 3GJQB 4C3MA 3W9IA 3MECA 4DS4A 2FPHX 1G6BA 4JI1F 1L3SA 3CPWR 1ZTWA 3K17A 3KLVA 1XR6A 3RRHA 1IKYA 2HK3A 4ZVOB 1EARA 4ZKAA 3L9ZA 4QIGA 2ZWPA 2MMYA 4R25A 2LQ9A 2CQBA 1HBNA 2B5JB 2JC1A 1TUVA 1RKJA 2JHEA 2CQCA 3OTDA 1Q82T 2ZC3A 5J1NA 3BQ2A 1CBKA 1B0TA 4ANEA 3CE8A 5JMNA 1S9GA 2YNFA 4OYXA 1JLCB 3M6UA 4A8WA 4U9RA 4YY3J 1HNIB 3CUNA 1VQKS 4KE5A 1HQUA 2HNYA 4OI4A 3PM9A 3PHEA 5HANA 2VZ9A 2EBGA 4CQ1A 3GR1A 1TMJA 1N33F 5HAOA 1H74A 5L1JA 3PXGa 2KM8B 4KFBA 4B3RF 1VRUA 2VICA 2Q3PA 2Z0GA 1KLNA 3ZTQA 3QFWA 4JI8F 4ICLA 4K0KF 4YHHF 1KFSA 2BJEA 1N5TA 2MEWA 2WZ1A 4M63A 2AYBA 1U4BA 4FYXB 5HO4A 2HHHJ 4PR6A 4DQSA 4DEZA 2MKHA 4C98A 3N9UC 1YBUA 4DV5F 3FEYB 3RUBL 3DXSX 2V68A 1ZOTA 1L3KA 3CB4A 4KO0A 1W26A 3CC2S 4N7TA 4PEOA 2ZNYA 2CQ2A 2DNMA 2XSJB 3W63A 1WSRA 3MWBA 3CDAA 4ES2A 3G82B 3ENVA 3ILLA 5I3UB 3SCJE 3E01A 3ELHA 3H5UA 1UFWA 2VFTA 2CDQA 3R27A 4G1QA 3NCQA 4NYOA 2FJBB 1W7WA 2GA7A 4HH0A 4S0MA 4KH1B 1CVJA 6AT1B 1LXNA 4DSJA 1XC9A 3QWUA 4JBCA 1V9OA 1N4LA 2OPRB 3HHKA 3D54A 1SXLA 2JZ5A 5G0RB 1BHNA 2VDIA 4RUBA 5BR8J 2L08A 4ID5A 1S49A 3E8OA 2APOA 1P8GA 4F26A 2LQBA 3B4DA 3I6PA 4JI3F 2G1DA 2MQMA 2BRLA 1GQEA 1JNZB 2ZVSA 2CRLA 2BJDA 3TNVA 3H5XA 3US5A 3NCRA 3W60A 1WG5A 4QIEA 1NAQA 3QT7A 2QZ8A 4OYBA 2OH2A 5CAAA 4DR7J 2IJRA 1NPKA 1V6HA 4A46A 2DNNA 2DNHA 2DGTA 3KLFA 3HVTA 3QO9B 2B9WA 1FNOA 1NK7A 2VH7A 3G71S 2HW3A 2LFVA 2DCLA 5F8JA 3K89A 2DR6A 4DSLA 4AL5A 5GAHI 1RWNB 2R7WA 4IYQA 3DLJA 3RR7A 3D0IE 2E7WA 4WFAQ 3BSCA 1VQ8S 1T03A 3NNAA 1FE4A 1UVLA 3TANA 3KMQA 1RWPB 2DIUA 5FDLB 1C0UA 1NHUA 1CS4A 2YQ1A 2X1FA 3RRGA 1HNWF 3M8QB 3HHDA 4FBTA 2XG8A 2VPWB 3O8WA 2ILYA 5DJBA 2ZBCA 3OXLA 2PFDA 3H40A 4CT9A 4K50A 5A8KA 4FF1A 2F9JA 2QTWA 5D4LA 4DR6F 4ED7A 2Y3YA 4HVZA 4IRDA 5KT3A 2K1RA 1S4FA 2XI3A 3TVKA 3PY8A 3R7SB 3JS9A 4O4GB 3H59A 2R7TA 3EE3A 1VJQA 4YDDB 1SH0A 3NBPB 3CCUS 2G4BA 2NYHA 2VODA 3SDEA 2HK2A 1HFEL 2F7VA 2B51A 4V1Ak 4UF4A 3PFEA 1D9AA 3EVOA 5KFFA 2ZH5A 3O5TB 1FHTA 2DHGA 4OQJA 1MMLA 1IUJA 4PKDB 1KHVA 4Q45A 3EICA 3QGIA 2IVMA 3THTA 5EWGA 1HNXF 3KLEB 2AEMA 1U47A 3ONQA 3R6GB 2R2TA 4EUVA 1RBOB 3PYDA 4L72B 4A8SA 2MY8A 1S76D 3CDBA 4J9UE 1N0VC 1IJEB 3RBDA 5DRKA 1BD6A 3MEGA 4WFZA 2IAJA 1AT1B 2VQEJ 3LP2B 3MR2A 1X5PA 1XMBA 2C3OA 4I56A 4XK8C 1NB7A 3JYTB 5B09A 4JOUA 5EWFA 4C8OA 5HMXA 4Y00A 4ZDNA 1N5YB 4ECSA 2BQ3A 3QNWB 2CG8A 4UTGA 2W7OA 3Q8YA 3CIMA 4CLFA 2AGQA 2AGOA 1T0TV 2BZ2A 3UDEA 4TQRA 2E5LF 3DRPB 3CW2C 1IM6A 2Y9HA 4PQUB 5GMEA 1BWEA 4UY8T 5F8NA 2FDNA 1AZSA 2MKKA 2EC2A 3KUGA 2LXIA 1ZAXA 3MCNA 1SL2A 2VG5B 5HJYA 3SQOP 3H7HB 5H9FJ 3T5HA 1NSKL 4RNNA 4EZ9A 3BH6B 2Z58B 2RKIB 3VAKA 1OYDA 4OX6A 2EPIA 2MLXA 4UT4A 1S1TA 4U67Q 1GXTA 1YTYA 3C2PA 3IRXB 1Q79A 3NMAA 4J9PA 2ZBQA 1Y10A 4Y3CA 3SXLA 3FSXA 2C1EB 1EB0A 3MEEB 4ZPVR 2VPZB 5AE1A 2W4PA 1XNQF 1QVGR 3NKYA 3T5JA 2W9CB 2DGOA 3DDIA 4J90A 3P49B 3DLEA 1VQ4S 4EO8A 2NPIA 3UCGA 1YRXA 3WBZA 4AYBD 2FY8A 4AFFA 4CIOA 1FERA 3LGMA 4J9OA 4MT1A 3N4WA 1T9XA 3C14A 2ZM6F 2ZKTA 2AX0A 2KG0A 2JOQA 1F1BB 4NWBA 1IR1A 2LCWA 4DMZA 4FNIA 2MSTA 3FEXB 1QAXA 4RZRA 2HZVA 3TX0A 5HLFA 1SQEA 2FHJA 3PNIA 1S79A 2WW4A 1H2VZ 2B4OA 2BYCA 2W4CA 4IDKA 3SSSA 1HPZB 4URGA 2GHWA 3K5PA 3CO0P 3S8SA 1HYSB 3KMSA 1HWUA 2EFGA 3DHXA 1OJ4A 1YJWS 2HFUA 2CPEA 3OR1B 2IM1A 2OPQB 4NYPA 4JI4J 2VJUA 5E3CA 3V2UC 3ETOA 4MTPA 4X64J 1J5OB 4OJ3A 3IS9A 3C46A 2U1AA 4DR5F 3NNCA 3OL7A 2XB2D 1U8WA 3BGFA 1OS5A 3SIPB 1XNRJ 4C6AA 4EWTA 3T1AA 1YJ7A 4QWCA 4GVLA 1SL1A 3MPWA 3MMAB 2P5VA 3F44A 3MPDA 1PSDA 4ZIWA 3GFHA 2V69A 2AJ0A 4M1KA 5IT9U 5A8WA 2IM2A 2FY1A 1HKAA 4LF9J 3H2LA 5J1EA 1YVFA 3V6HA 1RAGB 5LMNJ 3J81j 3DRXA 2VF3A 3KDNA 2FLLA 1J27A 4IFYB 3X3UA 4ZPTR 3LGHA 5LJ5Y 2UXBF 1Z2ZA 3DRRA 3G2XA 2ZH1A 4CLUA 4F4YA 3QIPB 2G9OA 2V6AA 1X4EA 4UZBA 3AHPA 2MB0B 3N6MA 1U02A 1NRKA 2ZWOA 2FD2A 1TKZA 3TZZA 5J2QA 5KFPA 3ZTSA 3GJSB 1SUQA 5FJ4A 1MROA 2KFNA 4RW4B 4N8NA 1HLWA 1QTNB 1RT1A 2XYGB 4FS2A 5H9EJ 3NOCA 4OIXA 1RT3A 2F8HA 3HLUA 3IG1A 3HMJG 1QUPA 1S0OA 2P6SA 1A7GE 1BE4A 3C6UB 4ITSA 4CYUA 2FHMA 1B0VA 5ETQA 4WKYA 4C3LA 4NEYA 1KSPA 3K7RA 4K4VA 4KHMA 3LANA 4GMKA 1P27B 1ZBTA 4CLTA 2CA9A 2W8KA 2C42A 2W2PP 1GMWD 4QU6A 2I6WA 2H4YB 2DXEA 2F63A 4A8XA 1FT8A 4PG8A 4LR9A 1T05A 1VK3A 5EX0A 3ZZOA 2MHNA 3LOUA 5DG9A 5JUMA 2FJAB 1NLKL 3OLAA 3K2YA 1FJEB 2LEAA 4X62J 2UUBJ 1FWLA 5L38A 2Z8QA 4XTTA 1RQ0A 2IJNA 4ED3A 3BO3A 4G1PA 1NB2A 4GO5X 1OY6A 1RSCA 2CAJA 5LXRA 3OT9A 2AEFA 2K7KA 2OMOA 3C8YA 5C24B 2AZ1A 4DL5A 3Q86A 1VQ7S 3PVXA 5D3GA 3HKZD 2BJ7A 3NLCA 4N8OA 4ECXA 5L8RC 3MM5B 3J7A1 1RT5B 4DG1B 1TP7A 3HP6A 4CTAB 4A8MP 4K4WA 3IN5A 4DX5A 1XQIA 2HMIA 2MGZB 3F73A 3F0NA 1U24A 1UZHA 3KJFB 2W7PA 3BN7A 3MUTP 1Q78A 2KG1A 4YP3A 4TYBA 5GAHU 4MKBA 5IT9Y 2KT3A 3BBFA 3TAPA 2H3EB 1IN0A 2PT0A 5F41A 1KEKA 3UN2A 1EHWA 4ZPBA 1SC6A 2UV8G 3BBCA 1R0BG 3BYPA 1S5ZA 3K5OA 4FPRA 4I7FA 4CO3A 2HFSA 3D0GE 1E6VB 1JLQB 1L3VA 1QSYA 2ZJPQ 2RRNA 2GFFA 4NLXA 5IC6B 3RG6A 2A6OA 3PG9A 3KK3A 7FD1A 3V81B 1Q8KA 2MZ1A 1HA1A 3K8WA 2Y1LB 1M0SA 3QJPA 3K8VA 2I2YA 4QQBA 1C4AA 1CJKB 2QMUB 2R42A 2DYAA 1QE1B 1QAJA 1R8AA 4F7VA 3ZZPA 3L7UA 1FTCA 1FJCA 4FF4A 3N79A 2P9GA 2CQHA 2Z2YB 5ADZA 3MAAA 1MN7A 3LP0A 5AE2A 4Q43A 1Q16B 3HVRA 4DUZF 1QJHA 4ZMMA 3GP9A 3I0SA 3N28A 1HI8A 2V0NA 1SJRA 2AT1B 3V6KA 2B3TB 4ZVEA 4LF4F 2ZD1B 4RNFA 2XEXA 4O23A 3BS9A 3RJMB 2MLYA 2D9OA 4LFAF 2HNZA 1M5PC 1BQMA 4R8UA 4WE1A 2DXFA 3T1HF 3GPAA 2K06A 1PILA 1HMVB 4O3PA 1UWBB 2DPJA 3KNGA 4C8LA 1FWKA 2IRYA 1S10A 1TU0B 1MMNA 5D4OA 1N88A 4PUOA 2ZH8A 5KOXA 4DU7A 4OZJA 2YWHA 3MMJA 3NWGA 3KLGB 2YKPA 3RBZA 1B99A 4DV2J 4ZS6A 2X3GA 2WONB 4LR7A 3DYAB 2HGMA 3EXCX 5KG6A 4FVCA 1OWXA 3MXHP 5BYQA 1T9VA 1IR0A 2KKHA 2UUWA 4KGKA 4USIA 2NQPA 4F0HA 3SV4A 2V8GA 3TAQA 2MZSA 3VAIA 4ZPWR 4ZVUB 4LF8F 4DSIA 2L9NA 4FKYA 4GVBB 3FBBA 3C6TB 4DR4F 1KR4A 1RA7A 2OD4A 2QGFB 1VI7A 4WIQA 5K14B 2C2EA 2QLWA 3MMBA 2DGWA 1KLMA 3BSAA 5IM0B 2ABYA 3VAHA 3A3NB 1LV5A 1GH8A 1IKVB 1P9QC 2E1CA 4KHPF 4XDCA 1ZM4A 4RWWA 3OTEA 2V2ZA 4F2SA 2X7IA 3TJ9A 1NPPA 2FVCA 5HVGA 4WTOB 4ZLJA 2IA6A 3AY0A 3BSOA 1WUUA 2HIYA 4U8YA 1WDDA 2QLFB 2C3UA 3M4XA 2R7UA 3PRVA 2E5IA 1TV6B 4DL4A 2DGQA 2HQIA 2CWKA 2GJ2A 3AXKA 4UOCA 5I3PA 5A2QU 4RX6A 4TYAA 1DLOB 5B7WA 1TK0A 1LWCB 3AXMA 3MEKA 2CJYB 2KRBA 4L73A 5CYQB 2FHOB 1UKUA 2F65A 4NX9A 2Q43A 5CH7B 1S6QB 1R27B 4F3MA 6FD1A 1JLAB 3BGRB 3DGPB 4B9MA 1IWAA 1WACA 2XY7A 4O44A 4DX6A 5DQGA 1Q8LA 1JLFB 3HHLA 2WVCA 1IQZA 1TFYA 2HRTA 2AP6A 1NEEA 1RWVB 4RW8B 3HHLC 4G65A 4DBQA 4ECVA 2KDOA 2A1BA 3H8YA 4FYVB 4KBIA 2LXFA 2YNHA 4DUYF 4DR1F 1CJUA 2VQFJ 2OPPA 2RQCA 3W3SA 3IC1A 2HQFA 4DV1J 1H72C 5AXNA 3W1YC 8ATCB 3FSYA 4KGXB 2KB2A 1H6KX 2CJKA 2EI5A 1K1SA 1T9YA 4LQ3A 2PN6A 5MAOA 4IR1A 2IBOA 2H48B 3VGUA 2GIFA 3AJDA 1QLNA 4X66F 3O3LA 4MK7A 5THWA 3DN9A 3FRYA 2MHEA 3MMCB 3M2VB 1G1XA 1T11A 4CNZA 4JI2F 2WVEA 3KJNB 4DF8A 2DTJA 1PYTA 4IH5A 3RB4A 1Y0HA 2WVBA 3G6YA 4ZA1A 3CD5A 2HSEB 3OSNA 3HZGA 2HHHF 3TVYA 3D6FB 4K4ZA 1QM9A 2UVVA 3KK1B 4CO5A 2EFPA 2UVWA 4TU7A 1W2IA 2VFUA 1D8YA 3JTPA 4HI2A 4QR0A 5DLGA 4Y2CA 5LSOA 1JQGA 1MSWD 3BSNA 4EO6A 3W61A 5L39A 1Q8IA 3M9MB 3MM7B 3JQJA 1CJTA 1OY8A 4RW9A 3T6JA 4UOGA 3HD1A 2QYCA 1FD2A 4QPXA 3V6JA 3OJSA 2EBEA 2MY7A 4J9RA 3HFZB 1WC4A 1REVB 1UA0A 2CZVC 1Y3KA 4K4UA 4C8NA 1FRLA 1LWFA 2HURA 2ZBIA 4OI1A 4C0BA 3R2DJ 3CJ8A 1X4DA 3QZ8A 1WD6A 5IS2A 3RU0A 2CG4A 3M9NB 2CJAA 4CH0S 5KFKA 1MU2B 2IMWP 2KHDA 2ZOFA 4B9VA 4B3SF 5EUHA 1RT7A 4P2MA 2K3KA 3QGGA 5BR8F 1RTHB 5A2QY 2OGUA 3SBMA 1PAEX 1RHMB 4NA3A 4WXOA 1HHTP 2V4RA 3R5BA 5C25B 4J9LA 3MTJA 1VC0A 1RU2A 4WJBA 2AYEA 4BWMA 1EAYC 3I5BA 1KTVA 3SQGB 3VZHA 3KG1A 4IG0B 4Q44A 3GMGA 1UW4A 2NXJA 3A8EA 4TY8A 1JLBB 1F2HA 2C3MA 3TUZC 3BQ1A 2JJ4D 1KRPA 3GZ7A 4NLUA 1XWLA 1TVRA 2YVSA 1SQFA 1WC6A 1HWKA 3JSMB 3ILIA 4FXWA 4ALZA 9RUBA 4PWDB 4EK2A 4RO0A 3ZTOA 3P5BP 3PYGA 1S1VA 3OTBA 4OJGA 2R8JA 2NYIA 2FZGB 4QWEA 4KIAA 4WP3A 2CJXB 3B82A 3DLGA 3ZO7A 1UFKA 2JEJA 3TVZA 3LTOA 2LQJA 5DQHA 4I4BA 2ZE2B 3Q8RB 5AXLA 3QRPA 3HHEA 1F5BA 3WIVA 3H20A 4B17A 3J80Y 1AXQA 3M6XA 3BPDA 1TUGB 1S12A 1S0MA 1FXLA 4RUAA 1RBLA 3DC2A 2VUGA 3H42A 4NCAA 1TL5A 5KFMA 2BE2B 4USTA 1RTDB 4J9NA 4ZCIA 4DI6A 2CPDA 4E2FB 1HR0F 1EETA 2C22A 3DOKB 3BR8A 5D15A 1TQLA 3K5LA 2I5JA 1ROFA 3M8RA 2KXHA 4BCAA 1ELOA 5J2MB 3MUVP 2PIIA 3M2UA 4JI6F 4L74A 4ELTA 5E41A 3TARA 1RLCL 4LBIA 2JDJA 1RHKB 2A2DA 4DV4J 3CMQA 2L48A 4ZP9A 3ZZYA 1LXJA 1JJ2R 3NP5A 1JX4A 5KFBA 3TUPA 3AQPA 2JEFA 1KQGB 5H1SV 5T7LB 1IKXA 3KLIB 2Y8WA 1AYEA 2QA4G 1KDNA 4OYWA 3CF5Q 1BUXA 3W8PA 1RKIA 4X4PA 1SJ3P 4DU8A 3PW5A 1RAFB 2GJIA 3ZXWA 1K9MT 4IQXA 3BGUA 4J9SA 1WOOA 2HS4A 2XCPA 4JI5J 3SFGA 2E5GA 1WG4A 4KPCA 2QSWA 2B9EA 3K5MA 3TAMA 2PMZD 5IXUA 2FTRA 1TL4A 3OUYA 1S1WB 3D6TB 2QL9B 1RTJA 2LVWA 2R3VA 3MM9B 4DV0J 2IVYA 1EP4B 4ZVFA 2CQGA 1A9NB 5KFZA 3MOZA 4USWA 2BOPA 5DQIA 4IFVA 1X9MA 4W92B 2BDPA 4X4UA 4NA2A 2PA3A 2XY6A 1LK5A 3W2VB 2BV3A 2B5JA 2KHCA 4OV1A 4ZJOA 4XDDA 2B4PA 2H5IB 4CH7A 2A2CA 3EMTA 3FCWA 5GAEI 2Q6CA 3GLJA 1JXEA 1GFWB 2AYMA 3QJJA 4OJ1A 1JLCA 4H4OB 4B9SA 3GSDA 2NUUG 1HNIA 4CLSA 2H65B 2BM1A 2XULA 4FS1A 5KFXA 1S9FA 2MTLA 3JB9k 1X7VA 1BXNA 2FJDB 2M7SA 1RABB 3AFGA 3C66A 2R8HA 2WB4A 4C7QA 2GVZB 3C16B 2JC0A 4DSKA 3W66A 3IWNC 4EZ6A 4DCOB 2KM8C 4Y0FA 1RYSA 1SPBP 1UPMB 2UZAA 4HHHA 1R3NA 3CCTA 1NKBA 4U96A 2GHVC 1NJXA 2BVZA 3LP1B 1Y9OA 4CCHA 1LFPA 3CDWA 2LYVA 2R7SA 4CP5A 2H54B 1RB0A 2B4VA 3ITHB 4FNHA 4RU2A 5J2NB 2FGOA 3NGDA 1V3SA 4OLOA 5A6PA 2Z56B 3DFEA 1FWPA 3AJ2A 2C3PA 2KJWA 1TKXB 4B3MJ 3DNCA 3QPIA 3CCRS 2NS1B 2XSJA 5L1IA 3C19A 4DR2F 2PO4A 3OJUA 2M9KA 2W2NP 5I3UA 4ID8A 5IV3A 2ADCA 3MDFA 4EGLA 1IBKJ 1DURA 1FFWB 4AE5A 3M8YA 4DV3J 2V63A 1FRHA 2B6AB 4V19X 5M2RA 3R8YA 5LMUF 1S1XB 4DN0A 1O0PA 3S01A 2EW9A 2P2CB 1NSAA 2Y1IA 5KG7A 3D1HA 2GV1A 3DMJB 5A0YB 3PW0A 1H98A 2K7JA 2POKA 2LQ5A 5G0RA 1SKUB 1PKUA 3RAXA 2LU1A 3RBXA 1YJRA 4PG5A 1X4AA 2G2ZA 1WF0A 3U27A 1UEUA 2D3O1 2YKAA 4M5DB 1FTRA 2NSCA 1W25A 2HVZA 1XEZA 4WP9A 2BM0A 3VAGA 2E1PA 5E3AA 4M5MA 2V94A 1SJFA 2VOOA 4PWWA 2GMJA 2XBPA 1AA1B 5E3PA 2E9TA 1U1RA 4KKOB 3FBCA 3P45B 2JEGA 3QO9A 1KHWA 2L41A 3BB5A 4OI0A 3DOLB 5LMNF 1R8PA 4ANDA 3VWSA 2UXDF 1SL0A 2KYZA 4UOHA 1V5IB 5F3ZA 1PJ6A 1QUVA 3VVUA 3M2RB 3G6VA 3GIKA 4UY85 1WWHA 4OI6A 1HWLA 4OFZA 1HBNB 5BXIA 2FJXA 1TL3B 1KC8T 3WC0A 5FDLA 1GTEA 2QLBB 3R1LA 4ILLA 1CULB 1RK8A 2BE9B 3IAS9 5KFYA 3OSPA 3IGVA 3M8QA 5AXKA 3ADAC 4UQTA 3VTIA 2F3JA 1TZ0A 4UUWA 4IOBA 4U6PA 2CJQA 1GEHA 3L7PA 3O2IA 2PMHA 1F5AA 1HWJA 2DNPA 1S59A 2DH9A 2V8VA 2C2DA 1WI8A 1EJ7L 5ETOA 1TELA 1X0FA 3MD1A 1T9TA 1NK9A 4O4GA 3RW7A 1HD1A 1VCTA 5DG7A 3NBPA 1H7WA 3IRWP 2YY3A 4DV7J 1BQNB 2ERRA 2XMJA 3OFFA 1RUSA 1C0TB 1TKDA 1FD8A 3M30B 2FZCB 4OHWA 4ES1A 2VG6A 2W7AA 1V5VA 3KLEA 3FKBA 1XMQJ 2R7QA 1I5OB 4ZLPA 4OHYA 2WVFA 4HACB 2U2FA 5DGBA 2BXJA 1U6FA 4B08A 3Q8PB 4JV2A 2RILA 2OAUA 1VHFA 4XPEA 2KT2A 3T3FA 1I51B 1VISA 2HS3A 5KG0A 4ZIVA 2G1HA 2QL5B 4ED4A 4X4TA 1NZAA 1GMVA 3PKYA 3JYTA 5DZ6A 3QJLA 2N7CA 1Y11A 3THVA 2HFOA 1N5YA 2W1BA 4EFAC 1KBRA 2ALZA 3ET6B 4ZPDA 1DFDA 4KV8B 4KGZB 1SC1B 1FRXA 2EK6A 3R5GA 5KT5A 3DRPA 2ZOGA 1C1CB 2M5YA 1W2BR 1B0PA 5KT6A 4PQUA 3H25A 2AD9A 3TUIC 4UW2A 4KQZA 5A8RA 2Y0SD 2QN6B 1PC4A 2HNDB 1RHUB 5F8GA 1Q53A 2AJQA 1OMSA 4TKTA 4DFMA 4KTQA 1U2CA 2YQ3A 3DGVA 4DPTA 1V3RA 2VG5A 2BABA 3TA0A 3AH6A 4MIBA 1BGXT 5F3TA 2RKIA 3EGZA 3CCWA 2RUSA 3EGNA 1VQSA 2W8LA 3MD3A 4FVMA 2Y0BB 2YH1A 3HVTB 1N5QA 3IRXA 3EPGA 1B3TA 1OYEA 3HPOA 3GG1A 3MEEA 4ED6A 1URNA 1HW9A 2JEIA 4BDPA 5F8IA 3WHIA 1JMTA 4CDIA 3ZZZA 3UCZP 2P6TA 3WDOA 1RWWB 1VQLS 3TJ8A 1PBUA 1A0OB 1VQOS 1VQ6S 3T9NA 5L1LA 2VC1A 5HP1A 2J6SA 5D0RA 1X9WA 4FKXA 4M95A 3K5NA 1YI2S 1S6PA 1YBTA 2HQ3A 3HDSA 4TQSA 4LUBA 2A0FB 4OL8A 1B64A 1VQMS 4H4KA 1ZPWX 1UW9A 5HBMB 3I9V9 2BQRA 4ZPCA 4B3TJ 2XWYA 4H4KC 3S7RA 3CCVS 1FXRA 2BR0A 3F41A 2LEBA 3MF5A 5A8KB 1HPZA 1QDUB 5ETKA 3CJ2A 2XHWA 1HYSA 3I4PA 4G3IA 2RVJA 2P8IA 2IBKA 2AHOB 3OR1A 4NCBA 1TL1B 2VBXA 3MZIA 3A8IA 2VJVA 1JXVA 1KKHA 3CCSS 2CQ0A 2GGPB 2V4QA 4FP9A 2K2PA 4WU3A 1J5OA 1NSPA 4I6YA 1WHYA 1U09A 4I2PA 4Z7CA 4DZ6A 4NLYA 5GAEU 4ZVRB 4DQRA 2QC3A 4V19J 3GIJA 3MMAA 1K73T 3PDNA 4TVAB 3PFOA 3CJRA 4NLQA 2XZTB 1D9DA 1U49A 4LSZB 1RT4B 4HR2A 4YN3B 3TRGA 3BN4A 1PGZA 1FFGB 3U02A 2DBBA 1P1LA 2W2QP 2J6UA 4AL6A 3DM2B 1F6TA 1ZZFA 1RYRA 1N32J 2N4CA 4ETZA 1JK9B 2YPZA 2MKYA 2C2ZB 3S6EA 1R31A 4IFYA 3J7ZT 4NPOA 1IBCB 4TLQA 2XMTA 2C28A 4ZJLA 2GVDB 1JJHA 3QIPA 7AT1B 2QX0A 1VIXA 2EWHA 2DNZA 2F5GA 1RJJA 4CT8A 2BJ3A 3ZTRA 5EWEA 2MPUA 4NI2B 4B02A 5BYSA 1RWMB 4RW4A 3UQSA 3DLHA 1RP5A 2RJZA 4YDXA 4CWBA 1FK9B 1B4SA 2GO8A 2WSFC 4QIWD 4O4RA 1WTBA 1JLEB 4KRWA 2X1BA 2WBRA 4NE9C 1RAHB 2XGQA 4QCLA 3C6UA 4R5PB 2LXUA 4HH1A 5HMYA 1PBAA 4DUTA 2MDAA 2IA0A 2XTJP 4D3GA 3TX8A 4Y28C 2GAHC 1F2GA 4B3RJ 2NXCA 2OPSB 2XMWA 3LAMA 2KZZA 1WC0A 1WEZA 4JI8J 1WKKA 5MLCV 1H73A 5DZ7A 4DPXA 4K0KJ 2IYGA 2RU9A 4ED1A 3NCPA 2VQFF 1DRZA 4LQ9A 4K2JA 2ZHAA 3PV8A 2F4FA 2GMLA 4O0NA 5FLXU 2ADBA 3Q89A 3CD0A 1U0SA 1HL6A 2E1AA 3M32B 1UJ4A 2DEJA 4DX8H 4DV5J 2BMBA 4KPYA 1NHKL 4ZOSA 1NMEB 4MKVA 3TR5A 2RRBA 3DRSB 1SI9A 2R2RA 1IXKA 3EGWB 2GNKA 1T3NA 4Z7YA 3CJ3A 5AJ3F 2CVEA 4P6QA 4E8UA 5F9NA 5EDWA 1J5EF 4FZVA 3D2WA 4HHUA 2GW8A 3RYLA 5C24A 5E3QA 5JXSA 1ZAWA 4P74A 4WBFA 4CLWA 3FQKA 3KHGA 2YWKA 2BANB 3MM5A 1ZYQA 4NRTA 3HFKA 1RT5A 4K4YA 3L7OA 3NGRA 4QPTA 4DCPB 4MJKA 3QATA 4CTAA 2VPXB 1Q81T 5IWAF 1AROP 1F5CA 2MGZA 1DHMA 1LWEB 3M8PB 4HTIA 4I69A 3E2EA 2F1FA 2XMUA 4OZ0A 2B56A 2IFXA 2IM0A 5HMZA 3UWTA 3MURP 3VR1A 2UUAJ 1WF2A 2H5JB 3RB6A 4EYIB 1NJZA 4JI3J 3QIDA 1R6YA 5D4NA 4DV6F 2FLOA 3G4SS 1ZZNA 2DRAA 1O6XA 4ZVQB 3H4DA 4ZCMA 3NL0A 1GT8A 2VA3A 2Y8YA 1E6VA 2GIQA 2PA8D 2F40A 4HEA9 2E44A 2DGVA 3KTQA 3J7YU 5A8WB 2AEJA 2COLA 2DCUB 3H0PA 1SIWB 3QFHA 4UOFA 1B70B 4Z2XA 2OKQA 4UZCA 2XS2A 4OHZA 3V81A 3PJXA 1HW8A 1ZETA 4O3OA 3NGUA 5C42B 5CA5A 2PMWA 3C15B 2X51A 2BOAA 3PW7A 3CJQA 1H0HB 2J7WA 2OO4A 2RH3A 1QE1A 5DLFA 4X4VA 3R5DA 4F3QA 1T9WA 1UAWA 2E1MC 5CYJA 4W98A 3BGLA 4JV0A 2IMOA 4Y34A 2J9DE 2KZMA 2IVFB 2VDHA 4LF6F 1IBLF 1Y3JA 1HNWJ 3N6NA 3TZXA 4OMFG 2XQCA 3I55S 1S72S 3BR9A 5G4DA 4LF5J 1TK5A 2J0XA 3U1NA 3LUYA 1JWWA 4CO1A 3PX6A 4P7TA 3HF5A 2XHCA 4N76A 2KL8A 1U1NA 2VBYA 5FLXY 1HBMB 2UUCF 4DX7A 1D9FA 2RT3A 4KT0C 3L09A 2RQKA 1RT2B 3LA0A 4DR6J 1SV5B 3OHAA 1LW0B 3H4BA 1PC5A 1HMVA 4OHVA 1UWBA 2G13A 4NZ0A 1TUWA 3LWMA 3W5YA 2CQ1A 4UQGA 5LXYA 3CCZA 4KGMA 2XYHB 5HN0A 1S6OA 3AQOA 2HVIA 1LKZA 3KLGA 3HHNB 4CLZA 2QV6A 1PO6A 1XN9A 3UDVA 2MZRA 2JVOA 4HI1A 4EYHB 3D3CJ 1BMQB 4AUKA 2WONA 1NXIA 3FJ2A 3DYAA 1BY9A 3CJTA 2OUGA 3JSRA 3KG4A 1U26A 3DKDA 1Q7YT 5CCLA 1D8ZA 1YQHA 1BQXA 2FLPA 2O3DA 4NLVA 4ERDA 4LBPA 3HX9A 3L3CA 4GVBA 4GC7A 3R3TA 2V5HG 1HNXJ 2QE5A 4Y65A 4GC6A 6FDRA 1RHRB 5K14A 4GKKF 3GU0A 8AT1B 5IM0A 2RDDA 2PFFB 3U1LA 3CJ5A 1U1QA 1IKVA 1EX8A 3HSZA 3C3LA 3IO1A 1HBUB 4PWUA 1TL7B 1FX2A 2V9KA 3RGIA 1N34F 1FX4A 2IHR1 2NUHA 3IBCB 5SUHA 1RWKB 4Q7AA 3E51A 3GONA 5HMWA 2NPFA 1FDBA 2QSFA 3R7NB 1TV6A 2V4JB 3CVKA 1SH3A 3SCKE 3WQPA 2E5LJ 3NMRA 2DRDA 4JYAF 1DLOA 1LWCA 5CYQA 4USJC 4RPFA 1K47A 3EZOA 2JL9A 4I0WA 3IWLA 4OZNA 2EEYA 1ZM3A 4DV0F 1JLAA 3DGPA 2YWWA 4NEZA 1K1QA 2BKPA 3J81U 1Q1KA 2DH8A 2FJEB 4WWSA 2RMLA 1ZS6A 4RW8A 5KFUA 1YWXA 3B6BA 3HO1A 2XM3A 1L3TA 3GYNA 2ZDPA 3Q23A 1G7CB 1N36F 3NS5A 2BJ1A 1EQMA 1S1UB 3VGTA 3T1YF 2DPIA 1XNQJ 2KXNB 2YKNB 2D1CA 1JKHB 1N6QB 4Y2MA 4QW9A 1QTMA 2AGPA 4I68A 3MAAB 1RCXB 2ZM6J 3LP0B 2PC6A 1CSJA 1LFWA 5KG2A 3TA2A 1UVNA 3BEGB 4F4KA 2H51B 4Q2LA 4NXMF 3SCLE 3KJVA 5KFVA 1HIYA 3NNHA 2JFKA 4IUFA 4FXDA 3RAQA 5BYRA 3UVJB 3MMCA 3M2VA 3QSIA 1S48A 1VYAA 3LGNA 2J7UA 2QMXA 5I42B 2BW2A 3P8BB 1LWXA 4MYUA 3T5LA 2IC3B 1GMUA 2RAQA 2VBWA 3W9HA 2ASYA 2HHWA 2B9XA 3SI8A 4CM2A 2WOMB 3KK1A 1M1KT 3MAHA 1VQ5S 4LIRA 3PACA 4MIAA 1FCAA 2LEPA 3VV2B 2J0SD 2GQ2A 3PW4A 3NOGA 3MM7A 3MTKA 2CJBA 2NR0A 2J9EA 2DNLA 4ZITA 3D9BA 5AT1B 2HZAA 3UCUP 1K0TA 2ZH9A 3ENQA 3VAMA 1REVA 4MIWA 4M5IA 2EXUA 4PQAA 1FRKA 3A4TA 3CIZA 3IMQJ 4CLYA 5F8HA 5LSLA 4X65F 3HFVA 1FFSB 5D6GA 5IQQA 2DGSA 2GCFA 4LRAA 1X9SA 1HNZF 1SJ4P 2LA6A 3Q8VA 1ZH5A 4OZ3A 4FN5A 3RZAA 4M5HA 4DS5A 1RTHA 4JV1A 3PYEA 4YB7A 1HQ2A 2YWEA 3O44A 5C25A 5M2UA 4I64A 4OYZA 4QR1A 4F4WA 4NZ6A 3I5AA 1N8RT 2KTQA 3DU6A 1TAUA 3KJQB 4URSA 2E5JA 3J81Y 4IG0A 1F0XA 2W9BB 3QMQA 1WKJA 3IP0A 1TR0A 4C9DA 1Q7LB 3QAEA 1JLBA 4O3SA 3DRYA 1FE0A 4F4ZA 3CXCR 4DL6A 1I94J 4O3QA 4GKJF 1NPRA 3PR5B 3PJWA 2FB0A 4KC5A 3UD4P 1WORA 5KAKA 4PWDA 4OZ2A 3M6VA 1Z4UA 5E5NA 2HPUA 4B9LA 2PEHA 4FYWB 3AA9A 4WP8A 1K0VA 1D0EA 4PABA 4TNOA 2VKRA 3P6YC 1CQMA 5T41A 3BREA 4U7UD 2PDAA 2HVHA 4ZVPB 1CJUB 1GXLA 2ZE2A 3H2VE 2WK4A 1DZ5A 3QBCA 3P5TL 5ETNA 5B0DA 2CPIA 2ROGA 3IGNA 1N0UA 2XNRA 3LPEA 3B78A 4A4JA 3WX8A 2CPZA 4ES3A 2MKIA 1FO1A 2BE2A 3DDNA 1RTDA 2UVUA 2HBYB 2HEKA 1APSA 4DOZA 5AE3A 3DOKA 3HT0A 4KAIA 4N47A 3G8SA 1S57A 2BA9A 3CDEA 2DNYA 1U1KA 3LW5C 4M5KA 2ZH2A 3JQMA 1N56A 3OVAA 2BW7A 1MW7A 2VHGA 3DXBA 1N52B 1PYOB 3PX0A 4W90B 3QRQA 1R7IA 4P10A 4LF7F 5HI7A 3I0RB 3AODA 3NWRA 4ZLLA 3CCES 2XNQA 1Q0NA 1U1OA 3R2CJ 5E3RA 5HQ8A 2MSSA 3ETMA 5KFQA 2C2NA 5T7LA 3MAQA 3RBEA 2XZWA 3KLIA 4LT6A 1FXDA 1DTQB 4AQYF 2LECA 4B9NA 1S0VA 1HI1A 4ECUA 4OX9J 5CQGA 2ASDA 1X8DA 3ICLA 4K59A 5KFAA 2OELA 8RUCA 2NSBA 5CHCB 3MR3A 2V8DA 4JI7F 3HCXA 4HL9A 1A6LA 3GILA 1TKTB 3EM1A 5DO2A 1NCLA 3MR5A 1S1WA 2ZHBA 3FEZA 5E7OB 3MM9A 1UEVA 1EP4A 4DCJB 2NXEA 4J37A 4PG6A 3W5ZA 4JV5F 2VBZA 4ILRA 2L3MA 4CI0B 3EXYA 5HROB 3TEHB 2ZH7A 3CGIA 2M0GB 1REGX 4Y2KA 3LF0A 3KYLA 4P9SA 3W2VA 4O0IA 1YGYA 1LW2B 1NHVA 2UU9J 1IKWB 5I4MA 4F4XA 2F4VF 4H4OA 3FZ2A 4EBDA 4QYRA 1FRMA 1NSQA 2MZQA 5CYMB 3ZNUA 4ECTA 4PZVA 4P7VA 2DD8S 1M5VC 4TN2A 2ZOMA 3FVYA 4DJBA 4MKAA 2R4FA 5AXMA 2O66A 2A6MA 3IBFB 4LREA 2DIVA 4YQWA 3D6HB 2GVZA 1DQAA 3C16A 5DETA 4TU9A 5DDPC 1X60A 5KFDA 2XSFA 3G6XA 4XO0A 3R97A 3VQSA 3ZZTA 4USUA 1JJCB 2OEKA 2XO6A 3BO4A 5KTQA 3T1HJ 1QVFR 1MWZA 1F9HA 5BJRA 2FJVA 3EGVA 2V8HA 1BC6A 2XC9A 3DDKA 5KFWA 1XR5A 4BLGA 4ELUA 3ITHA 4LSNB 4JI0J 5J2NA 2PGCA 4EU0A 1UP1A 1VC5A 1B7YB 4RWXA 1WC5A 3NS6A 1SCJB 1X4GA 2IDLA 3FUYA 2YTCA 2I1RA 1TKXA 3GJTB 4UUXA 2DNQA 3UN3A 2JLFA 1NM2A 3CJ4A 2DO0A 2GX8A 3AOAA 2HQCA 3OFEA 2VL1A 2XLKA 4ZVHA 2CIMA 3IWXA 3W5XA 4N56A 2D3OR 4YMEA 2B6AA 4LIWA 4LF8J 2VC0A 3RAMA 4ER8A 1F60B 2DITA 4ZP6A 4NASA 1VQPS 4DR4J 2RHSB 4KR0B 3OTOF 3CT9A 2NREA 2ZBPA 3DMJA 3FFIB 4F2RA 5A0YA 4OX8A 1IBMF 4F8RA 2R9LA 4KHPJ 2XMMA 4QZVB 3D6MB 4QU7A 5E2QA 1GXUA 2W25A 2J0QD 3E3XA 3G86A 1UVIA 1FDDA 3QGPA 2V2QA 5JVGQ 4M5DA 2RE1A 2L9DA 1FKPA 1M5HA 4ECQA 3G8TA 2D41A 4IO1A 4C2MA 1TK8A 4YB6A 4KH0B 2DR9A 3IR7B 1IWGA 4CLKA 4KKOA 4IR9A 1VBXA 2B8QA 1RTIB 2JLGA 1RBAA 1OSDA 4Q0BB 2NZCA 3TAMB 1UFLA 4YS2A 2C2OB 1RZMA 4MYTA 3GB0A 3M05A 1CJVB 2OSQA 2FVRA 1Z2LA 1N32F 2IM3A 1P9YA 3VAFA 2LU2A 1SC3B 5I3QA 2QJ3A 3M2RA 4B3OA 4WZQA 1H2TZ 4IFVB 5K8MA 3SZ2A 1EKSA 3OQ2A 5IOLA 1JNRB 1FESA 3DLLQ 1TL3A 3IAM9 1WG1A 4DUYJ 4DR1J 3POTB 4KJIA 1CULA 4J9QA 1QSLA 4X4OA 1UVMA 1R0CB 4ZN3A 5GAGU 5B08A 2RQ4A 4F3OA 1OO0B 3T9ZA 3KWMA 3BF4A 1BLUA 3D1QA 3P3DA 2CQDA 1SIZA 4NMLA 3OR2B 2UXCF 1FJGF 4IO9Q 3HI9A 3TI0A 2GQQA 1R0AB 3PO4A 4J9MA 3T19A 1IR2A 4X66J 4WIIA 1NBEB 4M8LA 3HKWA 3GYGA 4C11B 3OL9A 2LDIA 4JI2J 2BJ9A 1I1GA 2D9PA 4E98A 4QR2A 3PKMA 2XLJA 4P72A 1WSVA 1NDCA 2EG2A 3W8GA 1RA6A 3BM7A 5A76A 2AJ4A 4I1TA 1TMMA 1BQNA 1KVIA 1FNMA 1Q5YA 2DJWA 3TEGA 2WB1D 2XGPA 1C0TA 2R2UA 1WOPA 4K4XA 2HKEA 1NK0A 2HAFA 2EK1A 2Z2ZA 4USKA 1U1LA 3M30A 5KFTA 4ENOA 4PG7A 5SZTA 4HDHA 1CLFA 2V50A 4DWIA 1EZZB 1C2PA 1KS2A 2VB6A 3KK2B 4NLWA 3FC9A 2YX4A 3CEDA 1U8SA 2MKCA 4HACA 3D4JA 5KG3A 1BWVA 4WFNQ 4X4QA 1F3VA 4NLPA 1LEOA 2OHDA 3QLHB 5ETRA 5JVHQ 1RAJA 3OV7A 1ZA1B 1WKLA 4ZHRB 1PG5B 1ZAVA 3R5AA 4MK8A 3CC4S 4ED8A 2KN4A 2MQQA 1U6BA 3OHBA 1VDHA 3OVBA 3KLHB 4B3SJ 2RS8A 3IFEA 3ET6A 2UUAF 3GTYX 4KV8A 1KOOA 3MUMP 3BDEA 3WX4A 4CZCA 3BV8A 4PXCA 5CD4H 1C1CA 2CNNB 2WCXA 2MZJA 2YWGA 1HNVB 2OD6A 1AUDA 2IRXA 4I2QB 2HNDA 2RNEA 2ZH6A 2AW0A 5HQLA 1N5SA 2BJ8A 1NJWA 1M5SA 2R7XA 1VS3A 4I6AA 4ZPAA 3CTRA 1KFDA 2O5DA 3J7Z5 1Q8BA 4NLSA 4YY3F 2NCKL 4LSLB 4DL3A 1X5OA 4FDFA 2H9ZA 2GS8A 4LVOP 1T94A 2YPYA 3DOMB 4IOAQ 4F25A 3BKFA 4RUCA 1WF1A 2EC0A 2ZNZA 2IIHA 2DO4A 3I56S 2R7OA 2D69A 1SKRA 3NAHA 4K2XA 4PYAA 1SKWA 1GTHA 2K3IA 2KFZA 1UCNA 1U1PA 5KFEA 4OV6A 2OEMA 1PAUB 2XI2A 1YJ9S 4U7UK 2RF2B 3G9CA 3MEDB 2WAQD 4OZLA 1GNKA 3OLBA 2OFGX 1F9FA 2CQ4A 2KH9A 1EQ0A 3FNNA 4RW6B 4YR3A 4MFBB 5HL7Q 2NXNA 4RBTA 4LF5F 3MGJA 5HBMA 3FMWA 3HULA 2V2KA 1HR0J 1MLAA 2FYXA 3D68A 2ZDOA 2PSZA 5KG1A 2AWZA 2J9DA 5CCMA 1H3DA 2HBRB 1MMDA 3TZWA 4Q8EA 2Q1LA 2M4MA 2ZJRQ 3UR3C 3AT1B 2V67A 3CJKA 4JI6J 2EFQA 2HWHA 4J7CA 1U48A 3R9LA 1S97A 3CJ0A 1O8BA 2J0WA 3CMAS 4P2XA 1TL1A 4WK1A 2R7VA 4RW7B 4C8YA 2M8DB 1VIOA 3WC2A 3ULHA 3EVWA 2GGPA 4NOHA 1ZTTA 2CKWA 1FNXH 4DXLA 4OYOA 3JSYA 1L5UA 4WKRA 5L9XA 4HT7A 2RQMA 5LSRA 4PXBA 1S7IA 1KQKA 4YUDA 1Y7PA 4DPYA 3ILOA 2DNKA 1NKEA 2VG6B 3HSJA 4L75A 4TY9A 3GYXB 2VFSA 5IT0A 4KSEB 1RT4A 4NRUA 5IT4A 1HBOB 3ILJA 4DQQA 2PD1A 3DM2A 3KDOA 1UMJA 1TAQA 2Q79A 4U7CA 1C1BB 2HVDA 3W2WB 3N01A 1X5TA 4DR7F 2GO9A 4OYIA 3KHRA 3AD7C 2HGNA 1Q5VA 2H5EA 3FRZA 1WI6A 4CLPA 2YKMB 4NXNJ 2GVDA 4Y2AA 3EWGA 2XMKA 1DTTB 3HVWA 3DI6B 5HSPA 3CCMS 1RT6B 2GZOA 1L3UA 3OVSA 3TQ1A 4NI2A 2MZTA 2MQNA 4FF2A 2YKOA 3CCQS 2OTJS 5A8RB 2QMWA 5HVFA 1N48A 1FK9A 1SJ1A 3HVAA 1JLEA 4F36A 1R8HA 1HQEB 2QRRA 4R5PA 3MM8B 3HJVA 2KT5A 2RUGA 2D3ZA 4DLGA 3PTWA 1JLGB 4NMXA 2B8PA 4OZ1A 4QWBA 3PW2A 3I32A 4GRSA 2YNIB 1PYSB 1VRQC 2OPSA 2DT9A 2C2RA 2AF6A 2ZFHA 2OIHA 2XO7A 5KT4A 4BC9A 3LO3A 3CSKA 2GAGC 1OY9A 1KVKA 3R7BB 1RE1B 3D66A 5ETPA 5KFRA 1UEKA 2O67A 3D0HE 3M32A 4OZ5A 2N7YA 1U0HB 3GIIA 1I3OB 3PIPQ 1HI0P 3DRSA 5HP1B 2QLXA 5RUBA 2FZKB 3O1LA 1SC4B 3CD7A 1S6PB 2KRRA 3A13A 1PJ7A 3UDLA 3V5RA 2DGXA 4I67A 2ASJA 3DCAA 4U95A 4DR2J 4IH6A 1F3FA 3PR4A 2IPOB 1X4CA 1LK7A 3I87A 4F04B 2X3DA 4P52A 4IRCA 2BANA 2DH7A 5LMUJ 3THPA 1G4CA 1R6VA 5K9FA 3AB2B 3A8JA 2HHTA 1SVDA 3P4UB 3U1MA 3MR7A 5J2PB 1LWEA 3M8PA 1WTFA 3R6LB 1MWYA 2VQEF 1EIYB 2VONA 4DR3J 3FDSA 4PRFA 1RHQB 4C8KA 4J9VA 4NLGA 1YJUA 4C8ZA 2FHKA 4I2PB 2VG7B 4TLRA 4Y6IA 2IJFA 3TWZA 1FKOB 2D74B 3V4IB 4DLEA 2DHXA 4O3NA 3Q8UA 1FDNA 4ANCA 2HFVA 5F8LA 5HATA 1D3WA 1HD0A 3U7JA 3MFHA 2WW8A 1E6YB 5ETVA 1SBRA 2ALYB 3JAMU 5LOQA 4CH1A 5KOWA 5C42A 2YNGB 3GV7B 3C15A 2MQ8A 2CFXA 2UXDJ 3BGOP 1MWQA 3TUJC 3HSDA 2E9ZA 3A12A 1KONA 3EVMA 2XCAA 3MM6B 3P96A 3M1VB 1GX5A 3NRBA 2G2YA 1U1MA 3W9JA 4IG3B 2HS0A 4FBUA 4DL7A 2G2OA 4YR2A 4N77A 2M3DA 4RUHA 1XK8A 1I94F 2XY5A 3D5MA 4XAKA 3D7SB 4YB5A 2FVSA 1KNZA 2DHAA 2KVIA 2W2MP 1R8CA 1PJ5A 2WRMA 3MPVA 1HBMA 2G0CA 3H90A 3CDUA 3N5BA 5CD4A 1RT2A 3V6DB 2MQOA 3B8HA 4H4MB 1SV5A 1LW0A 3KKFA 1C4CA 3G82A 5KFHA 1RADB 3D3BJ 1KP6A 4QYZK 3N5FA 3I4HX 2JSXA 3DLKB 4J9KA 3SCIE 1D1UA 3AD9C 2Q6BA 4JI4F 4BC7A 2K8GA 4R0JA 4K5SA 4DFPA 5C7PA 2OPRA 5U47A 4X64F 3A3PB 5LL6d 3PRBA 3VCDA 1YLXA 2W01A 2BE7D 4ETXA 3Q24A 1YZ6A 4F4AA 4OYAA 5D0HA 5HQMA 3TZYA 1LNQA 4AT1B 4RNHA 2CJ9A 1XNRF 2FVPA 4FXVA 5CABA 1KOHA 1VRTB 1NJYA 2MYFA 3ISNC 2Q66A 2KYXA 2CNOB 3PEHA 1HBUA 2HHVA 1DY3A 3UDCA 2J76E 1TL7A 4LF9F 3NS7B 1S9EB 2UVRA 1JIHA 3LH2S 2BACA 1AFJA 2OFHX 4NLOA 1XR7A 5J1PA 4NCGB 4OX9F 4HTJA 3IA0A 3MECB 2Y1RI 3Q0AA 2ZC4A 1NO8A 2V4JA 3AOCA 5E33A 3GCXP 4LFBJ 2E66A 1IKYB 3OBIA 2MJUA 2RHQB 1S77D 2YX1A 2CPYA 3LQVA 3JAMY 5KFOA 4RR5A 5CZXA 4F0MA 4X4NA 3K57A 3VF0B 5ETSA 1N5VA 1WOSA 3SMZA 3LWLA 4BWJA 3ENAA 3O6QA 3QT6A 1OSCA 2RD5C 1S9GB 2YNFB 4Q5VA 2XLIA 4O3RA 2HRUA 2CQ3A 3QWPA 3J7YI 4LFCJ 4QWAA 1HQUB 1RI7A 2HNYB 1XJWB 1YZ7A 4ZP8A 2FQQB 2H4WB 2F8MA 3GIMA 2UU9F 4Q8FA 2BKNA 1S1UA 2Z2LA 1T95A 2YKNA 2J7KA 1J2VA 1JKHA 2CZ9A 2EFNA 1N6QA 4KFBB 3PCOB 5EHHA 1VRUB 2Z4PA 3MFIA 4QOTA 2CPXA 2Z2MA 2FC8A 1UVKA 4ICLB 2DRBA 2MLZA 5C5JA 1QSSA 3EDRB 1WNEA 2XS7A 2JWNA 4YEAA 2CNKB 1CPZA 2ZZNA 4NLRA 1XMOJ 3ZZ0A 4X62F 2UUBF 2NXUA 4FPIA 2O1PA 3UVJA 4ED0A 1RWXB 1ZA2B 5GADI 2WVDA 4X2BA 4KO0B 5I42A 1FJ7A 3ZZUA 2VASA 2V2VA 3JTOA 2IC3A 1MN9A 5CZVA 1K8AT 3VZIA 1Y5IB 4L3KA 4K4SA 4LRBA 4R0EA 2GMHA 3BJYA 5D78A 2WOMA 1IJFB 4F02A 3L95X 3E01B 4C8MA 4HT5A 4JI0F 3TO8A 1ITPA 4HYKA 3T5KA 1WHXA 2B0GA 3PJ9A 4G1QB 3HD2A 1YKWA 2VKZG 3Q83A 3LP2A 2ROEA 1IM4A 1NK6A 3Q8SB 4HLBA 2YWFA 4ZVGA 3MCSA 2HHXA 2HQDA 3HK2A 3F56A 3OXGA 3I82A 2UV8A 3ZZRA 5L9NA 3KUEA 1NK8A 1FDAA 3MCOA 1OQ6A 3LPYA 4C0HA 4ID5B 1U2RA 3FCHA 3FGVA 2CYYA 4LMZA 3TYTA 2G0IA 3A1YG 3L4BC 4QWDA 4N5SA 1RISA 3I9ZA 1FA0A 3UN5A 2HGLA 3RB3A 3EUNA 2DK2A 3GFZA 5E0OA 1P1TA 5T14A 3BQ0A 2FC9A 4ILMA 2ZITA 2W2OP 2LLZA 3RR8A 1IVZA 1MNEA 4WTYA 3KLFB 1PIEA 3QYYA 2JX2A 2BUNA 3TQEA 1RAOA 2AYGA 2GC8A 4ZN1A 5ITHA 3M6WA 2HHPA 2W9BA 1H7XA 1CQNA 1H38A 1VR6A 2W9CA 4C97A 3WIUA 1T03B 2DY1A 4B9UA 1U6ZA 2EFVA 4A48A 4CM0A 5KFGA 3QAUA 4U8VA 1RU1A 1U2FA 5F0WA 1QAYA 3VVTA 3VALA 1C0UB 4X4SA 1NK5A 1CS4B 3VGVA 3D67A 4RL1A 4F50A 3NGKA 4LRCA 4MK9A 4OJHA 5LT5A 2OTLS 4QBUA 5JJBA 4NLTA 2FIUA 3UW1A 2EFOA 4QIFA 3IM8A 1RWOB 2XYPB 2FHJD 4L6V3 1K44A 3BKTA 1I6JA 2OMLA 1R8BA 4L3NA 4LF1A 3OFHA 2R8KA 4OX7A 2K1RB 4HKQA 2C3YA 2OPQA 3QT8A 5IZHA 1NDKA 4KY3A 4ECWA 5HJXA 4CO0A 4KYZA 2YX7A 2BQUA 2HAIA 5AJ3J 3SDEB 3KJVB 1F9EB 4DV2F 1J5EJ 2ZKUA 4WYLA 3J80U 4ECRA 2DVIA 3QRRA 3SEOA 1VLYA 2KFYA 3B4MA 5ETMA 3QGHA 4DPUA 3KOAA 1KQFB 1AB8A 5D8HB 4ZVTB 4FF3A 4QW8A 3I0RA 4L76A 2I38A 3PHTA 1RGVA 3MR6A 4YFUA 2LMIA 4MKYA 3HJFA 5KG4A 4BBYA 3EYZA 5IWAJ 1MG7A 2DHHA 3JXOA 2J6TA 2W9AA 4A47A 2CZ4A 1Q86T 3FQLA 2R7RA 1DTQA 3MEGB 2CPHA 2IAJB 2ZZTA 3H5SA 4K4TA 5D0EA 4K8RA 2J8AA 2DR8A 4JI1J 3PZPA 1UJ6A 5LJ3Y 3EDQB 2KXFA 5KFIA 4DV6J 2UUTA 2OEJA 4J5OA 3GR0A 1TKTA 1FEHA 2X1GA 3VAJA 4PYDA 1YK9A 4M5GA 1YRTA 1WC1A 2AV5A 1S6UA 1CEZA 1X4FA 1AFIA 3VQTA 5HROA
chains in the Genus database with same CATH topology
2JEGA 3QO9A 1FRIA 4UUXA 1KHWA 2VODA 3SDEA 2L41A 2DNQA 4I6WA 3KHLA 3BB5A 4OI0A 1CC7A 3DOLB 2JLFA 1HFEL 2F7VA 2B51A 3CJ4A 2DO0A 5LMNF 1R8PA 2GX8A 5B0EA 1LW2A 3OW2R 1XERA 3PFEA 4G1IA 3VWSA 1D9AA 2UXDF 5KFFA 1SL0A 2KYZA 4P2SA 4DF4A 2ZH5A 3O5TB 5F3ZA 3GG0A 3OFEA 2M52A 1FHTA 2VL1A 2DHGA 1IKWA 2XLKA 1QUVA 3FZBA 4ZVHA 2CIMA 4OQJA 1MMLA 3IWXA 1IUJA 3M2RB 4N56A 1S1TB 1KHVA 4PKDB 2D3OR 4Q45A 3G6VA 2W24A 3GIKA 4UY85 1WWHA 3QGIA 4OI6A 4YMEA 2B6AA 1HWLA 2IVMA 4LIWA 4OFZA 3THTA 3QZ7A 2VC0A 1HBNB 5EWGA 3RAMA 4K5RA 3CD6S 5CYMA 1F60B 2FJXA 3H98A 1TL3B 1HNXF 3KLEB 2DITA 1KC8T 4ZP6A 1VQPS 1U47A 4KR0B 3WC0A 5FDLA 3OTOF 1GTEA 3ONQA 3CT9A 3R1LA 2NREA 2R2TA 4ILLA 4EUVA 1RK8A 1DQ8A 2VFVA 3DMJA 3IAS9 4L72B 4A8SA 5KFYA 3OSPA 3FFIB 4F2RA 2MY8A 3BO2A 1S76D 3CDBA 3DLEB 3IGVA 5A0YA 1N0VC 1IJEB 3M8QA 4OX8A 5AXKA 4DV1F 3RBDA 4UQTA 1IBMF 4F8RA 5DRKA 1BD6A 3MEGA 2R9LA 3K58A 3VTIA 4WFZA 2IAJA 2F3JA 2XMMA 1YJNS 3LP2B 4Q2MA 3MR2A 1X5PA 2CPJA 1M5KC 3DLBA 2WTFA 2I0XA 2JVRA 1TZ0A 4UUWA 4IOBA 3TA1A 4BS2A 4QZVB 4U6PA 2CJQA 1XMBA 2C3OA 3L7PA 4I56A 4QU7A 5E2QA 1GXUA 2W25A 2J0QD 3O2IA 2PMHA 4EEYA 1F5AA 2CQIA 5FD1A 2VV5A 3E3XA 3G86A 1HWJA 2DNPA 4XK8C 1FDDA 1NB7A 1UVIA 2DH9A 3JYTB 3QGPA 2V8VA 5JVGQ 4M5DA 3MHYA 5B09A 4JOUA 5EWFA 2C2DA 2RE1A 4C8OA 5HMXA 4Y00A 4ZDNA 4PPDA 1N5YB 1WEXA 2L9DA 2WBMA 1FKPA 1M5HA 4ECSA 4ECQA 5DS7A 3G8TA 2D41A 2BQ3A 2W7OA 3CIMA 5HLFB 4IO1A 1WI8A 1XTZA 2AGQA 5B0FA 2AGOA 2BZ2A 4TQRA 4C2MA 2E5LF 4IQMA 1TK8A 3DRPB 4LSNA 4YB6A 2Y1JA 1X0FA 3MD1A 2DR9A 4IDKB 7FDRA 3IR7B 1NK9A 4O4GA 4PQUB 4PXEA 3RW7A 4KKOA 4IR9A 1BWEA 1VBXA 1HD1A 4UY8T 5F8NA 1SB6A 1RTIB 2FDNA 4JUZA 2JLGA 5DG7A 3NBPA 1OSDA 2IYIA 4Q0BB 5K8NA 1H7WA 3GFXA 3TAMB 1UFLA 2MKKA 5EN1A 2WHOA 4DG1A 3IRWP 4MYTA 2YY3A 3GB0A 2LXIA 1BQNB 3M05A 5FIIA 2W4DA 1ZAXA 3I5CA 3ISND 2ERRA 1SL2A 2OSQA 2ZH3A 4CO4A 2VG5B 2XMJA 2FVRA 3OFFA 1Z2LA 1N32F 1VMBA 5H9FJ 3T5HA 2IM3A 3VAFA 1C0TB 4RNNA 4ED2A 4EZ9A 2RKIB 3AB4B 1TKDA 2LU2A 3VAKA 1FD8A 3BDPA 1OQ3A 4OX6A 2EPIA 3TW0A 5I3QA 3UI3A 3M30B 3M2RA 4B3OA 2HFNA 1S1TA 4WZQA 1H2TZ 4IFVB 4U67Q 3RW6A 1GXTA 2DNGA 4OHWA 5K8MA 3SZ2A 1YTYA 3CWJA 3OQ2A 4ES1A 3C2PA 1JNRB 3IRXB 3ISZA 2VG6A 1Q79A 1FESA 3NMAA 2W7AA 1Y4ZB 3IS9B 3DLLQ 4ATNA 5B0BA 4J9PA 1TL3A 3KLEA 3IAM9 4IRKA 2R7QA 1WG1A 1S7HA 4Y3CA 3SXLA 3FSXA 5D77A 3POTB 3MEEB 4ZLPA 4KJIA 4OHYA 4ZPVR 2VPZB 2U2FA 5AE1A 4J9QA 2W4PA 1XNQF 1QVGR 3NKYA 5DGBA 3T5JA 3FFIA 2BXJA 2W9CB 2DGOA 1QSLA 3P49B 2RIJA 1U6FA 3DLEA 4X4OA 1VQ4S 4EO8A 3OL8A 1UVMA 2NPIA 4B08A 3UCGA 3Q8PB 2KI2A 4AL7A 1YRXA 3WBZA 4AYBD 4AFFA 5GAGU 5B08A 4JV2A 4CIOA 1FERA 2RQ4A 2RILA 4F3OA 3LGMA 2J5AA 2OAUA 3IR6B 1OO0B 3DU5A 1VHFA 3T9ZA 2KT2A 1JLQA 2HWIA 4XPEA 3D1OA 4J9OA 3KWMA 3BF4A 3N4WA 1UA1A 1BLUA 3D1QA 3P3DA 2DHSA 2HS3A 1M5OC 2KU7A 5KG0A 2ZM6F 4DFKA 2CQDA 1SIZA 2ZKTA 4NMLA 3OR2B 2UXCF 1G2EA 1FJGF 1OPIA 2AX0A 4IO9Q 1VC6A 4X4TA 1Q4RA 2KG0A 2I8EA 1NZAA 2JOQA 2HHQA 2DNOA 2N3LA 3RB0A 2HWTA 3HI9A 3TI0A 1U25A 4NWBA 2GQQA 3PKYA 3JYTA 2LCWA 5J1EB 3CCJS 3QJLA 1Y5LB 2N7CA 1UL3A 4DMZA 4FNIA 1R0AB 3PO4A 3THVA 4J9MA 3T19A 2HFOA 1N5YA 2MSTA 4WIIA 2M2BA 3M8SA 3FEXB 1QAXA 4EFAC 2ALZA 4B9TA 4RZRA 4M8LA 3HKWA 2FJWA 4ZPDA 1DFDA 1YITS 5HLFA 4C11B 4KV8B 4RLEA 3T6BA 3OL9A 1SQEA 2FHJA 3PNIA 2B43A 2LDIA 1FRXA 3NAIA 2EK6A 1S79A 1I1GA 2HG4A 2D9PA 5KT5A 1H2VZ 3DRPA 4E98A 2B4OA 2BYCA 2W4CA 4QR2A 3PKMA 2ZOGA 1C1CB 2M5YA 1W2BR 1B0PA 5KT6A 2XLJA 4RNOA 2DGUA 3AJ1A 4IDKA 3SSSA 1HPZB 3H25A 2AD9A 3TUIC 4UW2A 4KQZA 2GHWA 4URGA 4PQUA 5A8RA 3DRRB 2DR7A 1AW0A 2Y0SD 3K5PA 1RTIA 2EG2A 1PC4A 3S8SA 2HNDB 1RA6A 1HYSB 5F8GA 2QT7A 1Q53A 3KMSA 3BM7A 4Q0BA 1XBWA 2AJQA 3H2UB 2AJ4A 4I1TA 1HWUA 2EFGA 4TKTA 4DFMA 3DHXA 3MOJB 1YJWS 3HZEA 2MQPA 4KTQA 1BQNA 2YQ3A 2CPEA 3OR1B 1IQTA 1KVIA 1V3RA 1FNMA 1JJ4A 2DJWA 4GO7X 1TKZB 2VG5A 5J2QB 2BABA 4NLDA 3TA0A 3AH6A 4MIBA 2IM1A 2OPQB 1BGXT 2WB1D 3JSBA 2XGPA 1SUQB 4NYPA 1C0TA 2R2UA 1MROB 4KHRA 5F3TA 2RKIA 3EGZA 3CCWA 3EGNA 4K4XA 1NK0A 2NZ4A 2GHPA 1VQSA 5E3CA 2ASLA 3V2UC 3ETOA 2W8LA 1RT1B 3MD3A 4FVMA 3ZC4A 2EK1A 4DL2A 1U1LA 3M30A 2YH1A 5KFTA 3I96A 4NYZA 3HVTB 1RT3B 5GADU 3IG1B 4PG7A 4RBUA 4E0DA 4MTPA 5SZTA 4HDHA 1N5QA 2ZD1A 3IRXA 4NXNF 1CLFA 1J5OB 4DWIA 4C0OC 4OJ3A 3EPGA 3IS9A 3C46A 1C2PA 2CVIA 1KS2A 2VB6A 1DBDA 2YH0A 2E29A 2HYIB 3KK2B 4NLWA 2YX4A 2U1AA 3CEDA 4PXDA 4DN9A 3BZQA 3HPOA 3GG1A 3POTA 3G8QA 3MEEA 1U8SA 4DR5F 3NNCA 2MKCA 4QJVA 5KG3A 4ED6A 3OL7A 2XB2D 1URNA 1HW9A 2JEIA 3PRDA 3BGFA 1OS5A 4BDPA 5F8IA 4DQIA 4WFNQ 4X4QA 4IH7A 4EWTA 3T1AA 4NLPA 2L9WA 4QWCA 1SL1A 3QLHB 4USHA 2XWXA 2LKZA 3MPWA 3MMAB 1JMTA 2P5VA 3F44A 3ZZZA 5JVHQ 3UCZP 2P6TA 1RAJA 3WDOA 1VQLS 2B7CB 3OV7A 2CQPA 1PSDA 1VQOS 1VQ6S 2J9CA 3GFHA 1T05B 3OR2A 3T9NA 2AJ0A 4M1KA