4X65J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4x65J00
4KY3A 1IBLJ 4LF5J 3J7AN 4PWWA 1XMQJ 4X62J 2UUCJ 4DUYJ 4DV6J 3T1HJ 3R2CJ 2KVQE 4HHUA 4YHHJ 1HNZJ 4JV5J 1FJGJ 4DR3J 4JI2J 4DR7J 2KL8A 4NXMJ 4DR4J 3W1YC 2UUAJ 4JI0J 4KYZA 5IWAJ 4GKKJ 1XMOJ 2MTLA 4B3TJ 2ZM6J 2E5LJ 4DR2J 4DV1J 1I94J 4DR5J 4LF7J 4X65J 2UU9J 5LMNJ 2UXCJ 5IT9U 4JI4J 4LF4J 4GKJJ 3T1YJ 4JI1J 4JYAJ 4LFBJ 3JAMU 1J5EJ 1IBKJ 4DV2J 4DV0J 4B3SJ 3D3CJ 1N33J 4DR1J 4LF8J 4AQYJ 2F4VJ 4NEYA 4V1Ak 1IBMJ 3OTOJ 4DV7J 4JI8J 3J80U 1XNQJ 4DV4J 5A2QU 4LFAJ 4YY3J 4OX9J 4DV3J 5LMUJ 4JI5J 4JI7J 4NEZA 2VQFJ 4JI3J 4B3MJ 1N36J 3D3BJ 4RJVA 4B3RJ 5FLXU 1N32J 3R2DJ 4KHPJ 2UXBJ 1HNXJ 1HNWJ 4X64J 2MEWA 3IMQJ 1XNRJ 5AJ3J 4LFCJ 5LM7E 2UXDJ 4DR6J 5BR8J 2HHHJ 2VQEJ 1HR0J 4K0KJ 4LF6J 2MQ8A 2UUBJ 4DUZJ 4X66J 4LF9J 4NXNJ 4JI6J 3J81U 1N34J 4DV5J
chains in the Genus database with same CATH superfamily
3N9UC 1FNMA 4ES2A 4LFCF 4X62J 4J37A 2CFXA 3PRBA 4ILMA 3W7BA 5C2GA 4O3QA 3TQEA 2AF6A 2NXJA 1FWPA 2O66A 2C3OA 1VQNS 4H54A 3Q2TC 2B4UA 3EGVA 2MKYA 1ZAWA 1HA1A 5ETQA 1CULA 1IBKJ 1RT6B 3VF0B 2ZUGA 3VGSA 2VD3A 3GLJA 2BE9B 4KH0B 5I3QA 1VC0A 1VJQA 1R0AA 1FX4A 1WSVA 1PAEX 3PNIA 1I5OB 5E2QA 3HVTA 3HSDA 4O3SA 4WP8A 1B0TA 1LWCB 1WC0A 2C28A 1UJ5A 2EEYA 4BHQA 2EFNA 3W5YA 2R7UA 4B9TA 3TJAA 2YWHA 2CPXA 1RYSA 1PYTA 3V6DA 2IMOA 5BR8J 2XHCA 2PMZD 3OJUA 2MLXA 1RWWB 4KV8A 4UY85 3VQTA 4NZ0A 2WW4A 2FIUA 2HURA 1U8WA 2V4QA 3PW4A 4QPTA 3OHAA 3UDVA 5C42A 2CAJA 3MMAA 2R8GA 3FBEA 2ACYA 3DYAB 3FK4A 1VQ5S 1BQXA 4K2JA 4FYVB 2D41A 2MTLA 3CJKB 2UU9J 3S7RA 2WVFA 2CQGA 1SKWA 2QSWA 3DRXA 3DHXA 3QZ8A 1BWEA 2XZDB 4OMFG 1F2HA 2IAJB 1CVJA 3BREA 2WK4A 2DB1A 2LXFA 1KS2A 3IC1A 4AL5A 4IQXA 2IBKA 2JFKA 1F3VA 2EG1A 1RTZA 2V63A 2D3OR 3QAEA 4OYMA 3K17A 5LOQA 3DFEA 3ZZRA 1R3NA 2XI2A 3MPWA 3LWMA 2M3DA 3MR3A 1IWGA 4JI5J 4XPEA 2WOMB 3BKTA 2M0GB 1F6TA 2B9YA 2PD1A 4U95A 4NLQA 2HRUA 4DHVA 2VOOA 1CLFA 4LF6J 1G7CB 2VBWA 1M5VC 2MQ8A 3CCMS 2NPIA 1WOOA 3D6HB 4ZVRB 4PWWA 2GMHA 1OO0B 2QO3A 3PJXA 5I42A 3NXZA 2QL5B 3P8BB 3A8JA 3PDNA 4CH7A 3W5XA 4DCJB 2ASYA 2A2DA 2R8IA 1RCXB 4BCAA 2FVQA 4KBIA 3R5GA 1VYAA 4NX9A 1QSSA 3AODA 3D54A 3DRYA 1R8BA 4ZJQA 4DFMA 1HQUA 3TZYA 3CB4A 2I2YA 2HLUA 3KHLA 1H3DA 2HBYB 3RBEA 2N4CA 2M70A 3ZZ0A 3RTVA 4MK7A 1X0FA 4YP3A 4Q7AA 1XJWB 5FLXU 1VK8A 1NZAA 1UVKA 3F44A 5IT0A 2ATLA 1CJUA 4K0KJ 2G4BA 3S8SA 2RVJA 3PEJA 4E98A 1I3OB 4PWUA 3HD1A 2Z57B 1AROP 3ILLA 2P8IA 5AE3A 3GFYA 1X4AA 3TOQA 4ECTA 4DPXA 1FXLA 5L38A 5ETPA 1DLOB 1A9NB 1S4EA 4MKYA 3MM9A 2V67A 2E7WA 1MSWD 3U1MA 1Y3JA 2BANB 3P5TL 1VBZA 1QD1A 1WEYA 1CJTA 2BKNA 4G1QB 4P74A 1FVSA 4X4NA 4OLPA 5KAKA 1GXLA 3C16B 4IRDA 1HQEB 1NBEB 4NMXA 1TL3A 2DIUA 2ILYA 4EYIB 2B8QA 5LMNF 3ITHB 1S1UA 2FJVA 4LSNB 3TAMA 4LFBF 2VONA 1XNQJ 2MLZA 3K7RA 4HACB 4RR5A 4FF2A 1ROFA 1W25A 4C0BA 1KHVA 1V9OA 3P96A 1PJ7A 3QIDA 3IAM9 4NLPA 1FCAA 3WBZA 2Q43A 3V4IB 3HT3A 5F41A 4HHHA 3HJVA 3FEYB 3TR5A 4OHXA 1XNRF 5KOWA 3SQOP 1C4AA 2FHOB 5D4LA 2M7SA 3OTEA 4DR3J 1F60B 4EI2A 4ES3A 4JB8B 1HBMA 4EO6A 3OR2B 4DPUA 2AEMA 4OJGA 3HSZA 4NLUA 2VH7A 5L9XA 1AXQA 3IN5A 5EX0A 2ADCA 1YX2A 3H8YA 3DI6A 3D9BA 2OPRA 4J91A 4NCAA 3JS9A 1JX4A 1F9EB 5HJYA 5KT2A 2RRAA 1AUSL 3M1VA 3PRDA 4DSKA 4TN2A 1S1TA 1ZM4A 4ICLB 1WF2A 1P6TA 3VZIA 3H2VE 1AZSB 3DNCA 2FHMA 3CCUS 3QGPA 2IMWP 5RUBA 1OY9A 2B4OA 5IQ6A 3HHNB 3ZTQA 4CO4A 3FZ2A 3HHEA 3LPYA 3MMCA 4WU3A 2APOA 1NPRA 3T5KA 5F8IA 4KRWA 3M8WA 5ETKA 4IFYB 2EKNA 3OJSA 2K2PA 2G0JA 1RJJA 3D68A 2B8PA 1JLAB 3AT1B 3DOLA 4R0JA 3MCOA 2P9CA 4UOFA 2XSFA 2FZKB 2B6AB 5SUHA 3CMES 2OH2A 1E6YA 1PGZA 5THWA 3W9JA 4DR7J 3HHKA 3H90A 1FK9A 2CPJA 3MECA 2ZM6J 5DGAA 3ZZUA 1JJ4A 1TFWA 3M8QA 2C2RA 4JYAJ 3CC4S 4FZVA 3W9IA 2BRKA 2VU5A 1IJEB 5KFAA 5E5NA 2X1BA 2A2CA 4CLFA 2R8KA 1DAXA 1FD8A 2Y1JA 1IKWA 2BJ8A 2QSFA 4DV2F 1P8GA 1RQ0A 2C2OB 5DLGA 4Y2MA 5CH7B 2MKHA 2HHWA 3CDWA 2WVDA 4WK1A 2EPIA 3LWLA 1HWUA 2XY7A 5AJ3J 3D66A 1F5AA 4Y2IA 3G86A 2YWKA 1RWOB 3DRPB 5HK4A 3K89A 1N32F 2GAHC 2MQLA 3H7HB 2HK3A 4WJBA 1X60A 2V9KA 1N52B 4EMDA 4I7FA 3M7VA 3PIOQ 3RR8A 1QSLA 3NOGA 1X4CA 3D5MA 3OD2A 5CHCB 3MAQA 4K4ZA 3DM2B 2C2MB 2DTJA 2DEIA 3TQ1A 2ZDPA 2HHTA 2OPQA 4YUDA 2WHOA 1XEZA 2CQ4A 5DDQC 4DS4A 4RZRA 4F2RA 4X65F 2DRAA 2W4DA 4TY8A 1TMMA 1OPIA 3SYZA 4UOGA 2CJXB 1HBNB 4I68A 2H51B 3RU0A 2YKNB 5T7LA 3N6LA 3IG1A 3O5TB 1GTEA 2BE2B 2M9KA 1SC3B 3IA0A 2WZ1A 3A1YG 5FDLB 3PX6A 4I0WA 3GCXP 3IR6B 4QU7A 4OZ5A 4IRCA 4D3HA 2HEKA 3UDCA 5K14B 2OSQA 1T95A 1U49A 2WSCC 3KLGB 3AJ2A 4WP9A 1RU1A 3L4BC 4XDCA 3C6UB 2HBRB 1FJGF 3O44A 1OY8A 2L41A 2IRUA 2CQCA 3T6JA 2YKOA 4P7VA 3VAFA 4WYLA 3V2UC 3CWJA 2X3DA 2PMWA 5B0GA 3E51A 1ZM9A 4XIUA 5FLXY 3W8PA 2U1AA 4F4KA 2DNOA 1WJ9A 1GAOA 2XMTA 3K5NA 3Q24A 4QBUA 1EAYC 1N88A 2VFRA 4TYAA 4YB1P 2MQNA 4ZVFA 2B4VA 4GVBB 2XC9A 2CQ0A 5ETOA 3BBBA 1RT6A 4CM2A 2BKOA 2RQMA 2FVPA 3K0JA 1S0NA 2WBRA 1BWVA 2M52A 1ZAVA 4I1TA 4CO2A 3QT7A 3CJ2A 3M6VA 5CAAA 4DV6J 1FE4A 2AKWB 1LWCA 4LVNP 2UVUA 3RBDA 2CDQA 2OFHX 4DL6A 5CXTA 4URGA 3BGLA 1NMEB 2RUGA 2P2CB 3KWMA 3QZ7A 3K57A 5DGBA 5J1EB 3AD8C 1RHMB 1R0BG 1H72C 3VQSA 1KTVA 4ELUA 3DYAA 2V69A 3NAHA 2F3JA 3OFHA 3GCWP 3CJKA 1EP4B 5H9EJ 2J0SD 2RQCA 4ANCA 3HF5A 1IKXB 4FVCA 4JI3F 3HULA 2OTJS 4FXDA 3HX9A 2ALZA 2K3IA 2DHSA 5KFWA 2IJNA 2IAJA 2VDIA 2EWHA 2DH7A 2FGCA 1HNXF 1PILA 5LSRA 4Y28C 2F1FA 1U2CA 1SB6A 2QLWA 3TX0A 2HHSA 3FFIB 2V8DA 3AQOA 3M8ZA 1REVB 4CLLA 3NGUA 4QIFA 4Y6IA 2WOMA 1FDNA 3HK2A 4CLZA 2HMIB 3VTIA 1CQNA 1H73A 2I8EA 3FSXA 4RBTA 3UE2A 2HGNA 4LF6F 1SL2A 3NWGA 2FHKA 1NJXA 3UNGC 1V3ZA 1LOUA 1FVQA 1S10A 3D4JA 3IGVA 4PKDB 2XMAA 1NO8A 1OS5A 2QX0A 3KLIB 5HROB 5JJBA 1NJWA 4DN0A 1DHMA 3UWTA 4N8OA 4MKBA 3BSAA 3D3BJ 3R1HA 3PYDA 5KFGA 5H9FK 3TEHB 5L1JA 3BB5A 4CI0B 1KONA 2HQ3A 1F0XA 4LQ9A 1CPZA 4DQPA 5HQLA 3AOCA 4DV5J 4L3KA 1KBRA 3CJ4A 1QY7A 2LVWA 5KFMA 5D4OA 1ZETA 3EUNA 3DGVA 4ZMMA 1EJ7L 3FJ2A 3NS6A 1U1QA 1U24A 4TU8A 1YTYA 2R7SA 1X4GA 4ZLNA 2H48B 2E66A 3T1HF 2XG8A 4O0IA 2FVCA 2NLWA 2IFXA 5GAEU 3FUYA 2EW9A 4FYDA 1C1BB 3SIPB 3ZZZA 2MQMA 2MHEA 4JI8J 3RBXA 1DLOA 2AYBA 1PCAA 3PFEA 4IO9Q 2R2RA 5CCLA 1T8EA 2H65B 4ECXA 5HMYA 3A3PB 2YTCA 2BANA 2GC8A 3VGUA 1U47A 4G1QA 4ZVEA 1Y4ZB 4WBFA 3C16A 1QVGR 4B3OB 1HQEA 4KH1B 1NK8A 1B7FA 3SQGB 1EQ0A 3ITHA 4LSNA 4HHUA 1IR1A 3GILA 1VQ9S 2D69A 1FWKA 3CC2S 1VHFA 1FESA 3X1LB 3IWLA 4HACA 4RKUC 4RPFA 1WG1A 2N3LA 3HJFA 1IWAA 3SI8A 1J5EJ 2DNKA 4B3SJ 1RWMB 4PABA 3NEKA 4DR2F 3V4IA 5HATA 4I67A 3H40A 3P5BP 4FBTA 2UXCF 4QW9A 2UV8G 2VBXA 2A10A 4LRBA 5GAEI 3UO0A 2DGVA 1TVRB 4F0HA 3KLHB 1RKIA 2DHHA 2MZRA 3OR2A 2XMKA 2AYGA 2HWTA 3IP0A 5CQGA 2CQPA 5K8OA 4JI7F 3NS7B 2PDAA 2YWEA 4CWBA 3FC9A 1LNQA 4I2QB 4ED0A 5KFOA 2UUWA 3VAHA 1FKOB 3THVA 2H54B 3THTA 2E1PA 1SUQB 2B9WA 3MFIA 4LJMA 3RRHA 1MROA 4ICLA 1LWXA 3M6XA 3LTOA 1AZSA 2E5LJ 4WTYA 1ITPA 2IDLA 2DPJA 2FHJA 4NXMF 2CNLB 2BRLA 4IFYA 4ZPCA 3GTYX 1ZZFA 3MURP 4ZJOA 2CJAA 1MW7A 1UA1A 5M2UA 2HNYB 1C2PA 2DKOB 3CCRS 3NL0A 1DFDA 2B6AA 3QO9B 2QA2A 3CW2C 4A8YA 4JOUA 2F4VF 2VZ9A 3A8EA 1IBMF 4O0NA 2KT5A 2AEJA 2DNNA 2DR5A 4HI2A 2B3TB 4DSEA 3U7JA 4C8KA 3M4XA 3G96A 1SC1B 4OQJA 2UUCJ 1WG5A 1T03B 1YJNS 1SQFA 4M94A 2XMVA 3RB4A 1FDBA 1RU2A 4WP3A 1ACMB 2RS8A 1NK5A 2ZOMA 2YH1A 1NDKA 3AXMA 3OFGA 1V6HA 1F9FA 1XMQF 1YBUA 2HVIA 2HNDB 2FJDB 2RU9A 5EWFA 1N0UA 2EC0A 5DM6Q 4FF1A 1AFIA 2ROEA 4ERDA 2VA3A 2GIRA 3MAHA 3MM7B 2ATCB 3DRPA 1FKPA 1SQGA 2MJUA 2XS5A 1GTHA 3KLEB 3G82B 7FD1A 5KFVA 1WSRA 2XBPA 4K8RA 2E7VA 2ILZA 1BMQB 2BW7A 3B82A 2HFOA 2VQFJ 4EBCA 2YX7A 3PCOB 1M5SA 2E1MC 2DK2A 5KFRA 4CH0S 2FQQB 1X4DA 1IN0A 2BYCA 4Y2AA 1ZBTA 4QQBA 3J7A1 2XHWA 1V3SA 2V8PA 4H4KA 3DM2A 2BW2A 3NGTA 4FP9A 2ZNZA 1K1QA 1S5ZA 3POTB 1WC1A 2ROGA 3EWGA 1OYEA 4TQRA 3TZZA 2RDJA 1VR6A 1H0HB 3G6YA 1D1UA 1RGVA 2HHHF 2WW8A 5LT5A 1YJ7A 1UVJA 5L1LA 5K8NA 4U9RA 2W8LA 2ASJA 2XMJA 3BKFA 4EWTA 1HBNA 1UZHA 2F8MA 2YKNA 3S6EA 1S1VB 4OZ3A 2GFFA 4V19J 2CZ9A 4JI2F 1KC8T 4J5OA 4I56A 4DV0J 1SL1A 1Q79A 1VBKA 3UN5A 3V81B 3RYLA 4ELTA 2BE2A 2QMWA 2QIFA 3I5CA 2HAIA 5FDLA 4CLUA 3BSCA 3I82A 2W7PA 1G1XA 4PPZA 4K4VA 1FT8A 3VVTA 5K14A 1PBAA 3KLGA 4FYWB 4DDFA 1RHUB 1X5PA 4ZITA 2CPZA 3N4WA 1F3FA 1Q4RA 4RNMA 3R1LA 3C6UA 2IC3B 5C2CA 3QT5A 2MKSA 2YKQA 4ANEA 3GR1A 4ZIVA 4EYHB 2EK1A 1VOMA 3VR1A 3QWUA 4TY9A 4B3RF 5DDRC 3D1HA 1HNWF 1WG4A 3RB0A 3TEGA 3CCTA 2D7SA 1EETB 2CZ4A 4DUZF 1CSJA 1YK9A 2CPYA 4NLWA 1D0EA 2UUTA 3GSIA 1SC4B 4FDFA 4GVBA 4DFJA 1TAQA 5IWAF 2KJWA 4WFYA 1S9EB 1I94F 3DLBA 4L6V3 4ZLPA 5D0RA 4QIGA 4DV6F 1XR6A 2FZCB 3H0PA 1CBKA 4F8RA 2D9OA 4YY3J 1N4LA 3NOCA 5BYSA 1D9AA 3NWRA 2XYGB 4LIRA 5IFMA 1UFWA 4RJVA 4CYUB 2QLBB 3IMQJ 3SCKE 4DZ6A 3RR7A 4CQ1A 1NCLA 5IT9Y 3I0SB 4KQZA 3UDLA 2OEKA 2RHQB 3CCES 3I4HX 1GMWA 3TX8A 5J1EA 4ATNA 1TUVA 1XWLA 1DY3A 4QYRA 2QMUB 5J2QB 3CF5Q 2KJVA 1GT8A 4FNIA 1HR0F 4M8LA 3KYLA 1SIZA 1S0OA 2XMMA 3T41A 3TJ9A 1HNIB 4WFBQ 2XWXA 3BH6B 1DTQB 1A6LA 2E1RA 2PE8A 1EP4A 1IKYB 3K5MA 1FFWB 3Q8SB 1FJ7A 3Q8YA 3EGNA 1IKXA 4QYZJ 3SZ2A 3FBCA 3O6QA 4OJ3A 1M0SA 2QV6A 3BN7A 3IR7B 2CVEA 1FTRA 3HXMA 2VBZA 3R5CA 4X4VA 3NGDA 3W2WB 1HPZB 3FFIA 2GO8A 1RE1B 2O3DA 3D1OA 2HW3A 3QNWB 1N36J 1ZTTA 3VAJA 1RAIB 5D0GA 5E41A 2V34A 3MAAB 1X9MA 4L73A 5HLFB 4QW8A 5KFSA 2QL9B 1YI2S 1OIAA 1N8RT 4LVOP 4OI2A 2Y8YA 5F8JA 2J0QD 1HWLA 2DGSA 2HVEA 3CIZA 2QYCA 3LGMA 1HI8A 4DR6F 3IBFB 4NYPA 2KVQE 1UZDA 3J7YU 2AGQA 4OI3A 4PUOB 2F8HA 4ZP9A 4JI6F 3C15B 3KLIA 5HROA 3CE8A 5IQQA 5AXNA 2JC0A 4KB7A 3EZ5A 4DR5J 2F40A 3M30B 3MMJA 3DOKB 4LF4J 2OFGX 2XQCA 2OMOA 3QSYB 3BDEA 2B7BB 1WI6A 3NMRA 1JJCB 3E2EA 1T9TA 2B0GA 1UPPA 4LREA 5IM0B 3CCJS 2N7YA 4RUHA 4IG0B 4PG7A 2KTQA 4A8MP 4X4PA 4Y2CA 5KFNA 3FCWA 3SEOA 3QRPA 1R8AA 4CZCA 2DO4A 3WX8A 3UFCX 1RT4B 3PW2A 5GMKa 4YR3A 3HSJA 1S1XB 4OX9F 3OR1B 2QMXA 2AWZA 5HP1B 4TQSA 3MUTP 1UP1A 1C0UB 1WKLA 1LQ9A 2FJBB 4CRJA 3IM8A 1C1BA 4KHPF 2FJXA 1UPMB 4Z7YA 1Q86T 2R8JA 2UVWA 4P6QA 4DSFA 3H5SA 2DD8S 4X4OA 4I2PB 3D67A 4C0OC 4FKYA 1YRXA 2AD9A 2LEBA 2AJQA 2HYIB 1N56A 3PHEA 4DI6A 1D8YA 2H9ZA 4DF4A 1U0SA 2QTWA 2CWKA 4DOZA 2ZHAA 3MUMP 3LPEA 1N33J 1AFJA 2VC0A 4B3OA 3QGGA 4HTJA 4ENOA 3I4PA 2D3O1 5J2MB 4P71A 4C8YA 3SQGA 4J9RA 5KT6A 2GJFA 3R8YA 4RNHA 1WD6A 4U8YA 1EIYB 2FLPA 1K73T 2VOPA 3NG8A 5KG4A 1U1MA 1DQAA 4G1PA 2HFZA 1OQ6A 2C22A 1JNZB 2XULA 3OL7A 3M8SA 2AX1A 2LFVA 4FXWA 2VG5B 1S7IA 2JSXA 2O5DA 5E3CA 3M2UB 1RTIB 4U96A 1APSA 4USJC 4J9VA 4NCGB 1TK0A 4U7UD 4KY3A 4PEOA 3Q83A 3PACA 1UEKA 3OFEA 3D1QA 4YHHJ 4DG1A 4JV5J 5DJBA 3IXQA 1KN6A 3PW5A 3C14B 1S1WB 2GNKA 5D6GA 1TVRA 4B9LA 3KLHA 3PVXA 5I4MA 1RWXB 3RJMB 1SI9A 1UVNA 2X1AA 2MKCA 2ZC4A 2Z30B 1S72S 2V2ZA 4JUZA 2KHCA 3QGHA 5EUHA 4I2QA 2KRRA 4BDPA 3MM6B 1FKOA 4P52A 4HDHA 2IRXA 1SUQA 2ZH4A 3UR0A 1SIWB 2W2NP 3BGRB 3SV4A 2FZGB 3IRWP 1VQ6S 1X4FA 1NAQA 3FDSA 3QIPB 6FD1A 1HYSB 4RW9B 1LXNA 1S99A 1T11A 1WHWA 1FJEB 4OL8A 1SXLA 2Y1RI 2Z0GA 4YB6A 5D3GB 2BXJA 2HQIA 3W66A 4P10A 5U47A 3KK2B 3AOBA 1H74A 3DXSX 2HNYA 4DU7A 2YQ1A 2X7IA 3QO9A 4ZKAA 4ILLA 1RWKB 1XMOJ 1OY6A 1GQEA 3NNCA 1IBLF 3UR3C 3WX4A 1OSDA 3VHQA 2CPDA 4WXWA 4BLGA 3VAMA 2YY3A 4OJHA 2UUAF 3IBWA 1KDNA 1Q8LA 2Z4PA 4M63A 4QCLA 3AB2B 4HR2A 3PKYA 3ET6B 4V1Ak 1G4CA 4PXDA 3PTWA 5D0EA 1UW9A 5M2PA 1T03A 2ROPA 1Z1ZA 2ZH9A 5HMZA 4DR1F 4UY8T 4JV2A 1X5SA 5E3AA 5F3TA 3NRBA 4OI6A 3G6VA 4O3NA 3KNAA 1FF2A 2XLIA 4A8OA 2HIQA 4ID5B 1U6ZA 2HNDA 2HQFA 1VQOS 3LA0A 3JTOA 2NR0A 1KKHA 5FJ4A 1RHJB 2D1CA 3GFHA 4WE1B 2JVRA 3MM7A 3DLEB 4LRCA 4KT0C 2JWNA 4O3OA 3KLEA 3G82A 2AU0A 1T9XA 1P1LA 2DGWA 5AE2A 1N5VA 2Z8QA 3KUEA 2XGQA 1AYEA 2QT7A 2VQFF 3DMJB 1QTMA 4MKVA 2QE5A 4J9QA 4NPOA 2HHUA 3QLHB 1YBAA 4RU2A 4J9SA 1Q0NA 2NREA 4UZCA 2MGZB 1RT3B 3Q8RB 2J5AA 2JRSA 3ZO7A 4ZLJA 3POTA 3A8KA 1YDLA 2PA3A 1KQSR 3B54A 2PSZA 2V5HG 4YR0A 1VIOA 3Q86A 1H6KX 3TNVA 4ED6A 2CQBA 5GAGU 3QMQA 4IKAA 3QWPA 1S1VA 2HVDA 4V19X 1HQ2A 3MZIA 3M8YA 5KT3A 4B3MF 1SJ3P 1GX6A 4OLOA 5KG0A 3K5LA 5F9NA 4C98A 3V81A 2ZH6A 3W3SA 1ZZNA 3GSDA 2W25A 3SSQA 5DO2A 2YWGA 3ZZTA 2W4CA 3JTNA 2GIFA 4KHRA 1N34F 1QE1B 4OZ2A 2ZJPQ 5EX3A 2IHR1 2XM3A 1NLKL 4C8NA 3GYXB 4DQSA 5EDWA 2HSEB 2IC3A 1U6FA 2C3UA 2FJAB 2E1AA 2MHNA 4I4BA 2RJZA 2RIJA 3GFXA 4OYIA 5H1SV 2R3VA 3X3UA 5KG2A 4LT6A 1EETA 3TVKA 3C3LA 3FQKA 1VQSA 5F8LA 5F8HA 1S49A 4M5IA 4ECWA 4ER8A 3MDFA 4WFNQ 4QIWD 3A3NB 3UNYA 2B4PA 1FKAF 3NGSA 5BJRA 5LMUF 4Q0BB 5IV3A 1LK7A 2EFPA 1FRJA 1PJ6A 1KR4A 1S9EA 2W7AA 4F50A 4IO1A 3GYGA 2JL9A 1FRKA 3EZUA 3BGOP 2HQGA 4HDGA 2KL8A 4CP5A 2HFSA 1IUJA 3QYYA 1C4CA 2YNGB 1F5CA 4F4XA 4RNFA 1FRMA 3I31A 3K8WA 3D0GE 2QLFB 4CYUA 4USIA 3OVBA 1T9WA 3E3XA 2Z2YB 1Y5IB 4ZP6A 4N76A 2W9CA 4WU2A 4PYDA 3I0SA 2ZUAA 3SBMA 2QG9B 3HFZB 2G0CA 2M8HA 3Q2SC 3GR0A 3EDQB 1DQ8A 2V2KA 2RE1A 3DLGB 4O3PA 5J2QA 3IGNA 4PQAA 3J80U 4DV4J 4F3QA 4NMLA 4U7CA 3BQ2A 5AXLA 4K4WA 3JSMB 4A8KA 1RBOB 4NWBA 1E6VB 3BQ1A 1G2EA 1HNIA 2K7KA 4F3OA 1RBLA 3AJDA 1IQZA 1IKYA 5LXRA 3ADAC 4Q8FA 5F9LA 2XGPA 2GIQA 3MMCB 3MXHP 4M95A 4DLEA 4I64A 4DL4A 3J7AN 2ASLA 1T3NA 2VQEF 3HI9A 4OYOA 4CO0A 2J6SA 1D09B 3QQCD 4RW4B 3ZTRA 3W2WA 1HPZA 3G71S 4QJVA 3Q8VA 4Z37A 1RISA 2R7VA 1Y0HA 4MYUA 3OL8A 1MNEA 2DR6A 3MR2A 4DWIA 1NUEA 3MAAA 4KC5A 1IQTA 5HLFA 2LQJA 3EDRB 3KDOA 5A8KB 2ZBPA 4MIAA 1JKHB 3CGIA 4ZN3A 2NZ4A 2IA6A 4C6AA 5GAHU 3CCSS 3TYTA 1B4SA 2MQPA 2QEXS 2J7KA 3KTQA 2J6TA 4PUOA 3C15A 3OXGA 4Q8EA 4DR5F 3RB6A 2W1BA 3O2IA 1OQ3A 2OAUA 3M30A 1TL5A 3DOKA 2VASA 4IH5A 4LRFA 2BDPA 4C48A 1NM2A 3W61A 2UP1A 5A6PA 2OSRA 4DCOB 2B7CB 5GADI 4USWA 4ZCKA 3R9LA 3BBCA 2E7XA 1BD6A 4ZPDA 2YQ0A 3OQ2A 1U2FA 4IG0A 1HNZJ 4KGKA 1AUDA 1NDPA 3ETMA 2OJ3A 1YIJS 4JI0J 2BR0A 4TXSA 2RNEA 3IWNC 4ZVOB 1RT4A 4LF7J 3Q23A 4Q5VA 1S1XA 3OR1A 4DJBA 2BUNA 5HP1A 3MPYA 2FY1A 5BYQA 1C0UA 3BBFA 4DUTA 4OHYA 3R27A 4OYWA 1D3WA 3TJ8A 1U48A 1OSCA 1SKSA 1B7YB 3H42A 1Q7LB 2JNJA 3ONQA 2DIVA 1YGYA 2OTLS 4I2PA 4UTGA 3R5AA 4H4KC 1CC7A 3M2VB 2G1DA 4KJIA 1HNVB 2UXDJ 4LFAF 1RTJB 4ECSA 4R5PB 1VC6A 2RQKA 4NLOA 1IXKA 3D28A 1FD2A 1NNDA 2GZOA 3SFGA 4HHJA 5CABA 2XZWA 1IM6A 4DBQA 3CCLS 5J2MA 2ASDA 3IG1B 3ZNJ1 3NNHA 2V9WA 1YJ9S 5B0FA 2IPOB 5DZ7A 1SJ1A 2Q6CA 1R0CB 1T9VA 4DEZA 3FVYA 2WSEC 3NGRA 1N5SA 3MEDA 1WWHA 3L9ZA 2P6TA 3OT9A 1SJFA 4AT1B 2VG5A 3M2UA 1RTIA 1PC4A 3T9NA 2POKA 4NCGA 2RDIA 1SVDA 3T1YF 4NASA 2PA8D 4ZPWR 5HSPA 4LF8F 2HQDA 3H4BA 1AT1B 2RUSA 4ECRA 4MIBA 5HANA 2BKPA 1ICEB 2ZH3A 2KG1A 4XAKA 2VFUA 3KJQB 1HHTP 3PX4A 1Q53A 2HFVA 4LF9J 4IRKA 4EFAC 2ZH5A 2W8KA 2RD5C 4NA2A 1CC8A 3GQCA 4ZJLA 3ISNC 2IM1A 4NCBA 2JDJA 2R7TA 2CNNB 3MM6A 2HHPA 5J2PB 1ZS6A 4X66F 1RWNB 4UOHA 2D3ZA 4ECVA 3BGRA 2PFFB 2A0FB 1ZA2B 4DV1J 2DNPA 2MZQA 4DL5A 4ZP8A 3WQPA 4GKJJ 4C7QA 1WF1A 3QIPA 4USHA 3W60A 1HYSA 4RW9A 2BBEA 1RT5B 1CJVB 3TUPA 2VUGA 3TWZA 5D3GA 4JI4F 1SQEA 1QAIA 3KK2A 4DV7J 2J6UA 2C2NA 5H9EK 2XB2D 1Q8KA 1HHSA 3IRXB 4X4SA 2RKIB 5I3PA 3PZPA 4ZVUB 5HO4A 3KUGA 3V6JA 1Q16B 1JLEB 1URRA 2J76E 1BUXA 3TP2A 1HMVB 1WI8A 3T6BA 5EGYA 4LR7A 1EARA 2YH0A 2EK6A 3ET6A 4ED3A 2GQ2A 3KJFB 2EG2A 3PRVA 3UDEA 3NS5A 2G13A 4YB5A 3OL9A 2QLJB 1YZ7A 4Q43A 3UPFA 2YVSA 3NP5A 2B9EA 4DX5A 2KDOA 3AB4B 1NK9A 4LF5F 3I32A 4ID5A 1TZ0A 2DGXA 3GZ7A 3J80Y 4GKKF 3DLJA 2Y0SD 4B3TF 3BKUA 4KPYA 4IOAQ 2IY5B 4AYBD 4WE1A 1FRIA 2M4MA 3DLEA 4P2FA 4CLPA 3TANA 4PYAA 2NCKL 4I6YA 3G8QA 2VICA 1U02A 2HFNA 1TTHB 1NH7A 1S12A 1T0TV 3DMJA 3ENVA 1UFLA 2HS4A 5AT1B 3GPAA 3MEGB 3HM9A 2X3GA 2ZHBA 2KU7A 3QLHA 1R27B 4O4GB 3SDEB 3TA0A 4N5SA 4DPWA 2MGZA 3I55S 1ULRA 1KFSA 1RT3A 3BSOA 1REGX 4PG8A 2PEHA 1FRXA 1VI7A 2DPIA 3TA2A 4ZVPB 2DNZA 5CZVA 2OGUA 2VKRA 1JLFB 2EC2A 2ZBQA 2VODA 2RAQA 1KVJA 1Y5LB 3TARA 1EKRA 3MOJB 1K8AT 1RDRA 1IR2A 2HHQA 1X4EA 1UVLA 5JVGQ 2V8GA 2R2SA 1FRHA 4HYKA 1CS4B 4B9NA 1MN7A 2HFUA 4HT5A 4RUBA 5JVHQ 3UN2A 1ZYQA 3G87A 2XMWA 2M8DB 3VCDA 3J81j 4ZVGA 1W26A 4L75A 3H2UB 4Z2XA 1NJYA 2HS0A 3CDUA 1N0VC 1QE1A 1RSCA 2R7QA 2LQ8A 4J9KA 5CA5A 4LFCJ 5CYMB 2MYFA 2A6OA 2E44A 2CXEA 3ULHA 1ZH5A 3BDPA 3HMJG 1VRUA 3TO8A 2HZVA 1RTDB 1RHKB 1WACA 2BJ7A 1HWJA 4B17A 5B0DA 1T94A 1NK4A 2GGPB 3N0VA 1Q1KA 4USUA 4AXJA 2K7JA 1KWMA 3D0IE 4DUYF 4ZN1A 1RHQB 3GJQB 3BS9A 2XLJA 2CQIA 2P9EA 4NA3A 3IS9B 4WFAQ 4I6WA 2YNHB 4Q0BA 3PW0A 5KG7A 3MHYA 2XLKA 1KQKA 3WC0A 3MPVA 3GJSB 1TMJA 4P73A 4C0HA 1KHWA 1JB0C 1B99A 2KZMA 2JZ5A 3I87A 3NKYA 4J9PA 3GE9A 2YNGA 4JV0A 3KK1B 1Z2LA 3FBFA 1BHNA 1S4FA 5G0RB 1Y11A 5E3RA 2W4PA 4PAAA 4IUFA 2ADBA 1BXNA 3KJVB 4PWDB 4OX6A 1U2RA 3N6NA 1LFWA 3IFEA 3NCPA 3VZHA 1WEZA 1MWZA 4X64F 5KFUA 3DLGA 1R43A 6FDRA 3JSMA 1RAFB 2R2UA 1YQHA 1E6VA 2B5JB 3IO1A 3PJ9A 2YXLA 1Y9OA 1JLQB 4Y34A 5J2NB 3ZZOA 1MROB 1RT2B 4ZK7M 2I38A 1WOPA 2P5VA 3N5FA 4AXIA 1DJ0A 3AXKA 1VQMS 2H5JB 4ES1A 2L48A 4HI1A 3MD3A 1NHKL 3HDSA 2W9AA 2CJKA 1TR0A 2Y3YA 1GNKA 2IJRA 3KOAA 1R31A 2XY6A 2FYXA 4RW4A 4DPYA 5L9NA 1BQNB 2XYPB 4ED8A 1L3VA 4ZVQB 1YITS 3BF4A 4LBIA 4N56A 5K20B 1WF0A 3CDAA 5D4PA 2KXFA 5DETA 4OHWA 2VJUA 2WAQD 4OYPA 5JUMA 2CJBA 1TQLA 5KFFA 4RWWA 5LSLA 1BY9A 2UXBF 5A8KA 4FS2A 4OV1A 2QA4G 1JKHA 1PKUA 4WK3A 2OPSB 2ZBIA 4MFBA 1NHVA 3I5BA 2P6SA 4U7UK 1V5IB 4RX6A 2AHOB 2MDAA 4WKYA 3CVKA 4TLRA 1LKZA 5IOLA 1RAOA 3WC2A 4DSJA 3DLHA 3Q8QB 3ENQA 1CJKB 4AL7A 2W2QP 3JAMU 3HHLB 3CJTA 1NK6A 3B8HA 4FS1A 3MTKA 2HLTA 1SKUB 3MCNA 4CLKA 3K8VA 4NZ6A 2GVDB 2JEGA 3LOUA 4C97A 4GC7A 1WUUA 4KGVB 3Q8PB 4MTPA 4ECUA 3UVJB 1J27A 3P45B 2BJ1A 1FKPB 2R7OA 4ID8A 2JEJA 4Q2LA 3W64A 4X4QA 3RGIA 4OJ1A 2OLWA 2JFDA 3B4DA 3P49B 1XK8A 5KOXA 4DV3F 1VISA 4WIQA 5IT4A 1URNA 1WNEA 2AYEA 2ZH1A 2ZWPA 4USTA 4DSIA 2DY1A 1ZAXA 1TKZB 1RB0A 2EXUA 1H2TZ 5SZTA 3KG0A 8ATCB 1RT7B 5MAOA 3DDNA 3IM9A 1WDDA 2V8HA 2HWHA 3M2VA 2G1HA 5LMNJ 4RWXA 1IKVB 1HNVA 1X0PA 4P7TA 4LFBJ 1RTJA 1KSPA 3L7PA 4R5PA 1PAUB 4FN5A 1A7GE 4AQYJ 3I6PA 1B0PA 4BBYA 1NSAA 1YJTA 1RAJA 4ILRA 1SJQA 5M2RA 1JJ2R 4IDKB 5CCMA 2KN4A 4K2XA 2LECA 2GS8A 2BQ3A 4P72A 3DLKB 4HKQA 2BABA 3PHTA 3UI3A 2GX8A 3DXBA 3OTOF 1RUSA 2NXCA 1XNRJ 4GC6A 5J1PA 3EGZA 2CQDA 1Q81T 4ANDA 2UUBJ 3MPUB 1KLMB 4OYXA 5F0WA 1S59A 1VBXA 2BMBA 2PI4A 2FB0A 4OI1A 1UAWA 2A3JA 1GFWB 4NXNF 1X8DA 2KXNB 2RRBA 1T9YA 4NOHA 4X62F 3EICA 2Q3PA 4GO5X 2VBYA 2CQ3A 2J8SA 3TW0A 2NUHA 2Y1LB 3UCGA 3CPWR 2NUUG 5KFLA 3H4DA 2XCAA 4PG5A 1UJ4A 5KG3A 3N5BA 1IBKF 1NU4A 5J2PA 4FPRA 3K59A 2C2DA 3EPGA 2GMJA 1VQPS 2COLA 1K47A 2VPZB 4CO3A 1HW9A 4KAIA 4M5LA 4IH7A 4ED1A 1UJ6A 4W98A 2NSCA 1RT5A 2QC3A 3OSNA 5KG1A 1IJFB 1CJVA 4NI2B 2RT3A 5F8MA 3BH7B 4LR8A 2DHXA 2DRDA 5BR8F 1H7WA 1ZA1B 2V8VA 1S9GB 1XBWA 5E3PA 3GV8B 3VV2B 3P4UB 3IRXA 2RKIA 2J9EA 2FGOA 2FC8A 4QYZK 5GMEA 1JLEA 1B0VA 3OPKA 1N6QB 4FPIA 4W92B 4DV2J 1HARA 2JEFA 1HMVA 3MEKA 3D3CJ 2HVZA 1NSKL 1WDTA 3LW5C 3FEXB 1R6VA 2UU9F 3GJRB 2LQBA 2ZH8A 3QT8A 3S01A 4ZDNA 1HW8A 5E0OA 3R5DA 1FDDA 1Z4UA 2ZVIA 5A6WA 3JSRA 1P9QC 2NQPA 3A8IA 1TFYA 3G9CA 3Q89A 4KFBA 2AQ4A 1N32J 1K1SA 2ZOGA 4N41A 1QVFR 3GIRA 3R97A 1MMDA 4JI5F 3QJLA 1SCJB 4PXBA 1TKXB 2QGFB 3BYPA 3LGNA 3I9V9 1GXUA 4UQTA 2DXEA 4ED7A 3WIUA 3MM8B 2WB1D 2ZNYA 4ITSA 2GHVC 1PJ5A 1N54B 2EFQA 2ZDOA 3FBBA 2ACMA 1RZMA 3VALA 3AAWB 5KFKA 1S6PB 1NDLA 2OMLA 4X65J 4JP8A 3MEGA 1JLBB 2VV5A 2LYVA 2UVRA 4O4GA 2IYGA 4DS5A 3SDEA 5ETLA 4LQ3A 1W2BR 3R6GB 1R7IA 2AJ2A 1DARA 3Q22A 3UD4P 3JQKA 3MPDA 2YPZA 3THPA 5F8GA 3CTRA 3G8SA 5C25B 2KT3A 2Y8WA 4DLGA 2DT9A 2IA0A 3C46A 1HL6A 1JLFA 2QL7B 3EYZA 4MJKA 3V6KA 1M5HA 3OBIA 1GEHA 3S1TA 2KO1A 2YNFB 4X84A 2MEWA 1WKJA 4F4WA 4Q2MA 2H5EA 2PC6A 5CYJA 4PZVA 4A8SA 3MR7A 1CS4A 3A13A 4E2FB 1UCNA 5LSOA 2HAFA 3L7UA 3U02A 4OI4A 3AQPA 4K0KF 1FJGJ 1C0TB 1NEEA 1SPBP 1FE0A 3JAMY 2F5GA 4ZVTB 2U2FA 3CD0A 3CC7S 2VF3A 1AW0A 2J7UA 4J9LA 3ZTPA 1YJRA 4YEAA 2Z2MA 1GMWD 1JLCB 2XNQA 3R5BA 5CYMA 2HVHA 1LW0A 3LGHA 5C24B 3LP0B 1GX5A 5L8RC 1K9MT 2VFVA 2KYXA 1RTDA 3UN3A 4CLWA 2DH9A 6AT1B 1LEOA 2GGPA 4WFZA 2DGTA 4RW8B 4N7TA 1R89A 2AP6A 3T5JA 3DHWC 4U6PA 1XNQF 1B70B 2D3UA 2IVMA 3DLLQ 1YBTA 5ETNA 3IS9A 5D0HA 1NZ8A 1KEKA 2YNHA 4KTQA 2JLEA 2AV5A 3H98A 4K4UA 3QAUA 3ILOA 4F4AA 1PBUA 1NKCA 1B3TA 3GMGA 1NB7A 2AZ3A 3AJ1A 2HKEA 4XK8C 1SBRA 3DU5A 3KK1A 1J5OB 3Q8UA 3MCMA 3MCSA 1UVIA 2ZE2B 5G0RA 4ZPTR 9RUBA 3EVOA 1X31C 4DG1B 4DR3F 1HBOB 3SCJE 2KYZA 2MY8A 1BLUA 4IOBA 1FO1A 3KJVA 4PWDA 3LP2B 1Y3KA 1TL4A 1T9UA 4TLQA 3EPIA 5A76A 1O8BA 2JVOA 1LXJA 2VG6A 3VVUA 2VIHA 3BO3A 4JI3J 1RWUA 2ZZNA 2GVZA 1DBDA 2O01C 2P9GA 1M1HA 3M32B 2XS2A 2XYHB 4KO0A 4RUCA 2B5JA 4M5NA 1HNXJ 1VK3A 1NSQA 3T1AA 4K7QA 1JLQA 5J2NA 4WZQA 1RT2A 1DZ5A 4E8UA 3LANA 4DL2A 4NYOA 1FNOA 2CKWA 3AY0A 4BS2A 1BQMB 3FCVA 1NSPA 2AX0A 2DNHA 3TAPA 2WVEA 4CDIA 3CO0P 5D77A 4KYZA 5KFYA 1BQNA 2J7WA 4ZHRB 1OJ4A 2EBEA 3GIKA 3JTPA 2BM0A 3CJSA 4USVA 3KXDA 4OZJA 2DR8A 1FFSB 2RRNA 4DR7F 4FXVA 2ZM6F 1ZPWX 5E33A 1LFPA 3GONA 1SH3A 5KFHA 4KIAA 5IV4A 3N01A 3BEGB 1Q95G 1LWFB 3FSIA 2WSFC 3M2RA 1YHQS 4R0EA 3GV7B 1XR5A 4JYAF 2CQ2A 2CYYA 2CDRB 3PW7A 1S76D 5HAOA 5D8HB 4ED4A 2OPSA 1PIEA 4O44B 2JJ4D 1U4BA 1H38A 2C3PA 2RHSB 4RBUA 2DR7A 2XCPA 5A0YB 2YQ3A 4WTOB 2N3OA 2UVVA 1JIHA 4ZVHA 1CJKA 3VAKA 5E7OB 1KOOA 1U1PA 3HHLA 3JYTB 5KFEA 2J9DE 1MWQA 3P6YC 2DNYA 3A3OB 3V4MA 1SV5B 5AJ3F 2GVDA 4UT4A 3T1HJ 5KT7A 1QUPA 1C1CB 2J0WA 2MMYA 2BOAA 2IBOA 4QWBA 4DR4J 3UVJA 2XO7A 3OLAA 3CCQS 4W90B 1LWEB 4WYWA 1T3OA 2YX1A 4YMEA 2RS2A 2LXIA 2F9JA 1PYOB 3CDBA 4Y00A 4JI1J 4ZP7A 4PQUB 1QTNB 1WHXA 1X7VA 1VQKS 2H5IB 4CT8A 3CCWA 3CEDA 3F0NA 1O51A 1TKZA 2HQCA 3QBCA 2V2VA 4HTIA 3F41A 4ELVA 4ZVSB 1VRTB 3TA1A 2BZ2A 1RT7A 1KNZA 3N79A 2AJ1A 1VCTA 5HI7A 1U09A 1VMBA 4LF1A 5KT5A 4UOCA 1VDHA 2OP5A 5B0AA 1IKVA 2MKJA 2AJFE 3TZXA 3BO2A 1UL3A 5HMWA 5HMXA 2XNRA 3CD6S 2K8GA 4AQYF 2VPWB 3J81U 2RMLA 4HH0A 1MMLA 4EUVA 2YKMB 2FTRA 4USMA 5GVQA 4IDKA 4J9NA 4C3MA 2HG4A 4K4SA 4MT1A 3O8WA 1RA7A 3ZNUA 3CD5A 3O3LA 3UCZP 3KHHA 3DLKA 4EU0A 4DR2J 2RSQA 2E9ZA 1G3OA 2Y1IA 4F7VA 4OZLA 3OUYB 4M5DB 1TV6B 2UXCJ 3TVZA 2ZBRA 2EKYA 2LQ9A 3E01B 1NPPA 2UUBF 2FLNA 1JXEA 1OMSA 1F9HA 1KLMA 2GW8A 3A12A 2GQCA 5KFQA 3OTCA 4ZCIA 4CNYA 4G3IA 3DRRB 4AUKA 2JLFA 1RADB 4JI7J 4MMOA 2UZAA 5KFPA 4CLYA 4EBEA 4X4UA 4LSZB 3R2DJ 3MMBB 3MM5B 2KVIA 2RF2B 1DQ9A 1Y5NB 2X1FA 4LMZA 2IM2A 1WELA 5CYQB 3HZGA 1F2GA 2BJ3A 4B08A 4EBDA 1UEVA 2C3MA 2CG8A 3ZZPA 1MU2B 3R7NB 3G6XA 1RWVB 3C2PA 4Y0FA 1U26A 4NXMJ 3MTJA 3T5HA 2V6AA 3H20A 1VS3A 5EWGA 2A1BA 4DQIA 4N47A 4EK2A 1KLNA 1XR7A 4DL7A 3EXYA 4B02A 1D9FA 3NNAA 4KGXB 5F3ZA 2Q6BA 4A8WA 2F4VJ 5DQIA 4NI2A 3NAIA 4ZCMA 2W9CB 4G1IA 3TRGA 1N48A 1IBMJ 3LF0A 4UF4A 4ETXA 2DISA 2IM0A 1S9GA 4E0DA 3JQMA 1Q8IA 4CIOA 4BWMA 2KM8B 4OZ0A 1U1LA 4MAKA 2M2BA 4QOTA 1N6QA 3B4MA 1FHTA 2RH3A 1RAGB 4U8VA 1XMQJ 3R2CJ 1CQMA 4TYBA 2CPFA 1CEZA 5HQMA 2OO4A 1QDUB 1O6XA 3VGTA 1VQYA 4I69A 3TVYA 2AYMA 1FTCA 4Y2KA 1P9YA 3K5OA 3RUBL 2G2YA 2L9NA 2GA7A 3DOMB 3RBZA 3J7ZT 1PG5B 2RU3A 2GHPA 4FBUA 3H25A 3V6HA 4C3LA 4K5RA 1SH0A 3R5JB 1TKXA 5T41A 2ZZTA 3HD2A 1P1TA 3BYRA 1UW4A 2JEIA 3H5XA 3C8YA 3MM8A 2QYGA 1YG0A 5HQ8A 3AD9C 3E8OA 5LXYA 3DKDA 2AT1B 4ECYA 1S7HA 1S6PA 3ENWA 4A46A 4EZ6A 1JLBA 1SKRA 1WOSA 4LSLB 1ZM2A 2HHHJ 1O5JA 1S79A 2XI3A 3TAQA 1DTTB 1VBYA 2FJEB 1TK8A 3ISZA 5C25A 1YZ6A 1U7LA 4UUWA 3AA8A 2CQ1A 4OFZA 4JI2J 2NXEA 1YJWS 3PXGa 4DV5F 3K58A 5JXSA 3PR5B 3CSKA 2ZHOA 2YNFA 1RT1B 4KHMA 2IYIA 4C8OA 3CULA 1Q5YA 4D3GA 2VFTA 3UD3P 1HI1A 3GFZA 1P27B 1C0TA 1F5BA 2LXUA 3ZC4A 3C66A 2LKZA 4KSEB 1DURA 4B3RJ 4F3MA 3Q0AA 3DN9A 1HNWJ 4JI8F 5A8RB 3N28A 1JLCA 2KB2A 1X4HA 3RW6A 2ZC3A 4HVZA 2LDIA 5C24A 4DUZJ 1UMJA 3LP0A 1OYDA 3MEEB 4A8QA 2XSJB 1R8CA 1CG2A 2Z2ZA 2DCUB 2H4WB 1J2VA 2G9OA 2E5IA 3ILIA 3J7YI 1YRUA 5IWAJ 1O0PA 4RW8A 4C4WA 3HVRA 1I94J 2QFJA 1YVFA 2OEMA 1AB8A 4WIIA 2KZZA 3DCAA 3G6ES 1T7PA 4NA1A 4DPTA 4ZPBA 1JMTA 4F4ZA 5ADZA 3MEDB 3D6FB 3PM9A 4NEYA 3EM1A 2F63A 1XN9A 1J5EF 3AFGA 3HVAA 3LUYA 4B3SF 2YWWA 4UUXA 4F04B 4QZVB 1VLYA 1JXVA 3J81Y 1L3UA 2N82B 4OZNA 1J5OA 1N5YB 2ZE2A 3D2WA 4OI0A 4O3RA 2NYIA 9ATCB 5D4NA 2KRBA 1HR0J 1HBOA 1AA1B 1HBUB 2NSBA 4X4RA 2CADA 3LP2A 2DVIA 1JXLA 2G2OA 2GO9A 4JBCA 4YR2A 3HKWA 3ZTSA 1FERA 2MZTA 1HKAA 1KVIA 3F56A 1T05B 2F7VA 3M32A 3UW1A 1VJWA 1OWXA 3I9ZA 2KHDA 3LH2S 3L95X 2Z2LA 2HRTA 2JX2A 4ZCLA 3GV5B 3RRGA 1JWWA 1RTHB 2E5LF 1FEHA 3PIPQ 2J8AA 3ETOA 2KG0A 1TL1B 4Q44A 1LW2B 1BQMA 2LMIA 4NLGA 4C11B 2ABYA 2B9XA 3RAMA 2KT2A 3C6TB 4XTTA 3NMAA 4CCHA 4ZHRA 4DR6J 2CRLA 3KJNB 3PO5A 1UKUA 3FRYA 3RG6A 4JI6J 1R8HA 2DBBA 2V0NA 2QLXA 2HHVA 1LWFA 4FVMA 1UVMA 3KK3B 4F0KA 4PG4A 1X9WA 4O44A 3QGIA 5A0YA 2CPHA 2UUCF 1DRZA 2N7CA 3OVSA 2F8EX 3TUIC 4MK9A 1HD1A 1TKTB 3W5ZA 2F4FA 2Q79A 4HEA9 5D78A 2EFOA 4M5KA 3ENAA 2GV1A 1VQ7S 3JYTA 2F9DA 1S48A 4CO1A 1SV5A 4Y65A 4EGLA 4BC7A 1M90T 3KLVA 2M5YA 2UV8A 4FNHA 3KUHA 4OX9J 4C8ZA 1C1CA 4DR4F 4PG6A 3NCQA 1RCOB 4QWCA 4L3NA 3BGFA 3TUJC 3TUZC 1Q8BA 1NDCA 4C8MA 1LWEA 4KHPJ 4OV6A 2BOPA 4J9UE 4JI1F 4CT9A 1WHYA 2DGOA 5EN1A 1PC5A 4DX7A 4PQUA 3QPIA 1GH8A 2NPFA 2YBVA 3CIMA 3EXCX 1TELA 3PX0A 4NLDA 2DCLA 1NK0A 4WF9Q 4TVAB 4R25A 2AJ4A 2H1YA 4DCPB 1VRTA 3F73A 3FQLA 4NRTA 3LO3A 3PG9A 2A6MA 4F4YA 4IOCQ 4PR6A 5B0CA 1FXRA 3GU0A 2F65A 5IT9U 4CLTA 2VFSA 3VWSA 3FGVA 4DQQA 1S9FA 2CNOB 2L9WA 2DITA 5A8WB 1R8PA 4MKAA 1N5QA 2K06A 2BEFA 2L3MA 1UWBB 4H4OB 3KMQA 4RNNA 5F0UA 3SXLA 1VQ8S 2YKMA 3IAS9 4MH8A 2H3EB 5IXUA 1S6UA 5L1KA 4DV0F 4ED2A 4RUAA 1FA0A 3HFKA 1UETA 3NBPB 3K2YA 4J9OA 3OUYA 4M5DA 1TV6A 3GG1A 3T19A 5T14A 5HVFA 4F2SA 3RAQA 3E01A 3FZBA 1EB0A 2ZWOA 3M8RA 3M6WA 3BN4A 3T9ZA 3KHGA 3WDOA 3NLCA 5DQGA 3A4TA 3LP1B 3DRRA 1VRUB 1V3RA 2VA2A 1WORA 2MZJA 1KFDA 2C42A 2K3KA 2WBMA 2EFGA 5JMNA 3I56S 5ETTA 1S57A 3MMBA 1Q82T 2LLZA 3I5AA 3MM5A 2HZCA 2MY7A 2YPYA 2RF2A 3FMBA 2QA4S 2Z58B 4HH1A 4FF4A 5HN0A 2Z56B 4NLXA 2HHXA 3CJQA 3WIVA 4DN9A 2M88A 3VGVA 5CYQA 1Q5VA 2WTFA 1Y00A 1OPZA 1UA0A 4ALZA 5LJ5Y 3GG0A 1VFJA 5A2QU 4N77A 1MU2A 3D6TB 1N5TA 3UQSA 2BQRA 3UCUP 5GAGI 1UWAA 5BYRA 3EE3A 1Q7YT 2GQQA 2ZD1B 5D15A 3HKZD 2V4JB 2CQHA 4J9MA 1JLAA 2LU2A 1KQFB 4YY3F 1YSJA 4BWJA 1XERA 4URQU 1QLNA 3TI0A 2FUG9 3H2LA 3MUVP 5LL6d 4Y3CA 5DG7A 1IBLJ 3M8PB 1MN9A 1TUWA 4IR9A 3H59A 2UUAJ 5C7PA 1FFGB 2LEAA 2BX6A 4DZDA 4ECQA 5DS7A 3L3CA 3J7Z5 2WONB 1TL7B 3KLFB 3GWCA 1RKJA 2CPEA 2QJ3A 4KGMA 4QR2A 4DR1J 4QIEA 2DGQA 1S0VA 4LUBA 1RAAB 2OD6A 2AEFA 4LF2A 1UFKA 3KDNA 4NLVA 2PEBA 4H4MB 3QJPA 1YLXA 3HSGA 2CPIA 1FI4A 4A48A 2ZFHA 4ZOSA 2HZAA 4LRDA 4OYZA 4PPDA 2R42A 3DOMA 5HBMB 2KXHA 1MMNA 1NXIA 1U0HB 1N36F 1A0OB 3T5LA 2MQOA 1FEEA 2DNRA 1H98A 3JSYA 3AD7C 1EQMA 1NJZA 2X1GA 4DL0C 3OVAA 3EJMA 4MFBB 5KFTA 3EVWA 5EWEA 4IG3B 3HFVA 3CCZA 5DG8A 1VGYA 2OPPB 1YJVA 4LSLA 1JLGB 5KG5A 1HHQA 3V5RA 1QAYA 3BGUA 1HD0A 2AW0A 5L1IA 3WZ0A 4LF4F 1NHUA 1DTTA 1U6BA 2LA6A 3RB3A 1MG7A 3DRSB 2W2MP 1K0TA 3D7SB 2WB4A 4B3MJ 3SCIE 5FD1A 1KOHA 1FRLA 1WHVA 3PYEA 1NJIT 5FIIA 1GMUA 2LA4A 3HHLC 4LIWA 5BXIA 1RT1A 4N8NA 4RL1A 1HLWA 3RRKA 1JK9B 3OL6A 3IWXA 4PXCA 2K1RB 3AOAA 1N34J 2R7RA 4KGZB 3MWBA 3BZQA 1X5OA 3GIIA 4DSLA 4CTAB 4RO0A 2QZ8A 4DPOA 2KFZA 3EVMA 2RDDA 1X4BA 1U45A 1YJUA 1L3SA 2QFIA 2G0IA 3LQVA 1HI0P 3ICLA 3RZAA 5HJXA 1BE4A 5A8RA 3HPOA 2MKKA 4EO8A 4QIVA 5DRKA 3MI7X 3MEEA 2H4YB 2XSJA 2CA9A 4RW7B 5K8MA 5GAHI 3OXFA 2FVRA 3IBCB 4RW6B 2MZ1A 5LMUJ 3W62A 1N33F 4MYTA 2XMUA 3PV8A 3DGPB 3FCHA 2KI2A 1M1GA 5CZXA 1I1GA 4TKTA 3U1LA 1SC6A 2LU1A 2I6WA 4NLYA 2HPUA 3W2VB 4CH1A 5IZHA 4QR0A 1RAEB 2FJWA 2WCXA 4Z7CA 5K8PA 1RHRB 4OX8A 2EVZA 2LCWA 4BC9A 2E9TA 2JC1A 3OTDA 4ECZA 2VPYB 1I51B 3AA9A 2PFDA 3FSYA 2EBGA 1WTFA 1F1BB 1S6QB 3SMZA 4CO5A 3HVWA 4YHHF 3CDEA 4JV5F 1N5YA 1ZOTA 2DNMA 2OUGA 4P75A 1HBUA 1V5VA 4YFUA 1RABB 4QPXA 1YKWA 3DU6A 2C1EB 4JV1A 4QWDA 3N6MA 4DFPA 2HNZB 1IVZA 3QFHA 2VB6A 3B78A 4KKOB 5KFXA 2VC1A 3W8GA 4B9MA 2AGOA 4QU6A 4LRAA 4X2BA 2XS7A 8RUCA 1T05A 2ZKTA 4NRUA 1QJHA 1RAHB 1KP6A 3MFHA 2VQEJ 2E1CA 1GXTA 4QWEA 1NRKA 4M5HA 1RTHA 2HK2A 1REVA 2I9SA 5ETMA 1X9SA 4FYXB 1BGXT 2BJDA 2XWYA 4QWAA 2E5HA 4OZ1A 3PFOA 2YKPA 3CJ8A 4TU7A 2HMIA 1TL1A 1LW2A 3M05A 5HL7Q 3EMTA 3RW7A 2HGMA 2N4DA 4C11A 3R7BB 5IC6B 2DNGA 3SSRA 2YNIB 1H2VZ 2PT0A 2HGLA 3BJYA 3C6TA 5F8NA 2FVSA 3SFUA 5CD4A 3LAKA 3ZFVA 4ZLLA 5LJ3Y 2BJ9A 5DZ6A 2IRYA 1SL0A 7AT1B 2Q66A 2DRBA 1XMOF 5A2QY 2LQ5A 3DC2A 1IM4A 3ILJA 2DHGA 3L7OA 3H5YA 2B43A 2MZSA 3O1LA 4ZPVR 1ELOA 3KK3A 4URSA 2HRYA 3BM7A 1QAJA 4RBVA 1R6YA 3G4SS 3HLUA 2VG7B 1X5TA 1U1OA 4EZ9A 4YS2A 3PR4A 1NKBA 4IH6A 4C9DA 2ALYB 4HLBA 2MJNA 3LAMA 2V4RA 2R7XA 5IS2A 3D0HE 1TKTA 4K4YA 1U1NA 3KKFA 4R8UB 2W7OA 1NPKA 5H9FJ 4KFBB 3ZXWA 2R7WA 2I5JB 2V2QA 3CJRA 4AD6A 4W4MA 3GYNA 5KTQA 3BPDA 4WXOA 4DMZA 1ZPVA 2DJWA 5C5JA 2FLLA 1RXOB 3KMSA 3HP6A 4AFFA 3ZZYA 4YDDB 2O1PA 5I3UB 4J90A 4M5GA 2EFVA 3GP9A 3R3TA 2ZZMA 2IJFA 2B51A 5G4DA 1WEXA 3US5A 3R7SB 1ZTWA 3CXCR 2FDNA 1MLAA 1IBCB 4LFAJ 1VRQC 5ETSA 3T3FA 4EEYA 2DR9A 1HFEL 3BO4A 3JQJA 3D6MB 1L3KA 4NZ7A 1S0MA 1Q78A 4OHZA 1K44A 5A8WA 1QSYA 2VL1A 4YOEA 1UWBA 4H4OA 4LR9A 1QUVA 3HT0A 1U25A 4X4TA 4RLEA 1RBAA 4L72B 3L09A 3CUNA 5ETVA 5KFJA 3VAGA 2W01A 1VQLS 1RWPB 3K5PA 2IM3A 1M5OC 2OKQA 5EHHA 2BACA 2BM1A 3GB0A 3NBPA 4DFKA 3T1YJ 1M5PC 2W9BB 4IFVB 4S0MA 1I6JA 3I0RB 3AH6A 4LF8J 5GMDA 5IC4B 4NYZA 4L76A 2BA9A 1LW0B 2DXFA 1PO6A 3LP1A 1H7XA 3PY8A 4NLRA 2MPUA 4LBHA 2VDHA 4A47A 4XPCA 4LBPA 3PYFA 1CULB 1FNXH 2VJVA 2X51A 2DYAA 2XEXA 2NS1B 4X66J 1R0AB 2MLYA 4HL9A 3W9HA 1U8SA 1RA6A 2JLGA 3HVTB 4GO7X 3CJ3A 4GRSA 2V50A 3QSIA 4L74A 2CVIA 2NXUA 2FY8A 4IR1A 3FRZA 1W7WA 2XO6A 5KFCA 1FDAA 2VKZG 3PO4A 4NE9C 3PJWA 2HWIA 2ZD1A 4O4RA 2V4JA 3V6DB 4JI4J 4KV8B 3CCVS 2J9CA 3KHRA 2DY9A 4A8FA 3UD5A 2I0XA 2R8HA 2Y0BB 1RK8A 2SXLA 4F36A 3CT9A 1KTQA 5C42B 3MMAB 4CLSA 2ZJQQ 3KG1A 3M8PA 1YRTA 2HBQB 1M5KC 3QFWA 1TAUA 3BPSP 1YWXA 1D8ZA 3LALA 1TUGB 4YDXA 2OELA 3HO1A 7FDRA 4PXEA 1NH8A 3QATA 2VG6B 2DNQA 2DO0A 5LM7E 4DV4F 4WCEQ 5ITHA 3I96A 2GVZB 1TL7A 2WONA 3KLFA 3OTBA 4DQRA 4KO0B 3DDIA 1SJ4P 5KFIA 3ELHA 3HCXA 4LF5J 3FKBA 4K50A 4OX7A 4FKXA 4F0MA 2MB0B 1EHWA 5DM7Q 2MSTA 4GKKJ 4YB7A 4B3TJ 3AHPA 1T02A 2YX4A 4H4MA 1RYRA 1KQGB 1VIXA 2DH8A 1S6OA 1TK5A 1MWYA 1Z2ZA 3G2XA 3PYGA 1JQGA 1HWKA 3MF5A 2Q1LA 2JH3A 2CJ9A 5HBMA 2J0XA 2CIMA 3B6BA 1U0HA 2CG4A 2OEJA 4B9UA 3NGKA 2OD4A 2OIHA 5I42B 4A8XA 4GMKA 5K9FA 2QN6B 2DHAA 5CD4H 1W2IA 4HT7A 1VLOA 5KFDA 3M2RB 4PCQA 2KFYA 2KFNA 4ZPAA 4K4TA 3CD7A 2WVBA 3EX7B 3QRRA 4C3KA 2PGCA 2HBZB 4IG3A 1QM9A 2FD2A 2OPPA 4GVLA 1VC5A 1KRPA 1JLGA 2I1RA 3CJ5A 1HIYA 1HQUB 2ZH7A 5KT4A 2CNKB 1D9DA 4UQGA 3EGWB 4C2MA 2BVZA 2NYHA 4AE5A 4KR0B 3W63A 2HS3A 3P3DA 4F67A 4DU8A 1WC6A 4CNZA 4F25A 1RLCL 4OIXA 2CWXA 3DRSA 4M1KA 2FPHX 2Y9HA 4TNOA 3OV7A 1K0VA 2YKAA 4C8LA 3PKMA 4DF8A 3OHBA 5B0EA 1HNZF 1CJUB 1SJRA 1TP7A 3VAIA 4G65A 1EZZB 2OI2A 4JI0F 5J1NA 4UZBA 2ZBCA 2J9DA 1U1KA 2IDEA 2K1RA 4LF7F 1XTZA 4B9VA 1UEUA 2AMCB 2PI5A 2C3YA 4CTAA 2D74B 3MM9B 4NLSA 2W2PP 1M1KT 3MOZA 2HIYA 1GMVA 1CJTB 3GIMA 2B56A 4F02A 3MD1A 2AIRB 4XDDA 2AZ1A 2ZITA 5AXMA 5AXKA 1XQIA 3CO9A 1TL3B 2CJQA 4YN3B 4K4XA 2ZEJA 3M9MB 1S1UB 2EI5A 3TAMB 4USKA 2UXDF 1B64A 4DUYJ 4RW7A 4K5SA 1RLDA 3RAXA 3OLBA 5B7WA 4RW6A 3W1YC 2YWFA 1H2UX 5AE1A 2FLOA 3DGPA 4J7CA 2L08A 4NL5A 1EKSA 3BSNA 3M6UA 2ZVSA 3MGJA 4FF3A 2RB7A 2CZVC 1XC9A 2R2TA 2FHJD 3W2VA 4DXLA 2DXDA 4P2SA 4Q45A 4XO0A 4DX8H 5L39A 3QRQA 2PMHA 3FEZA 3TZWA 1FJCA 3ZTOA 4MK8A 2BQUA 1Y10A 1QAXA 5B09A 5DDOC 2E5JA 4NEZA 1RI7A 1U1RA 1IR0A 1FXDA 2MSSA 1HBMB 2LEPA 4KPCA 1VHIA 4X64J 4RU9A 1S6QA 2XTJP 1EX8A 3DDKA 1BC6A 4KE5A 3U27A 3QJJA 5E3QA 1JNRB 3DI6B 2OPRB 3H5UA 2GAGC 5KFBA 1NKEA 4U67Q 3HHDA 1FWLA 5GADU 1RACB 3M1VB 2A18A 3SV3A 1DTQA 5K5MA 1RP5A 5DG9A 1S1TB 4B9SA 4DX6A 3GIJA 2HNZA 1VQ4S 2IIHA 4LF9F 1LK5A 4KKOA 3PEHA 4ZIWA 3HHLD 4WWSA 2V94A 2IVYA 5HVHA 1PSDA 4RNOA 3CMAS 2L9DA 2GCFA 3GJTB 4WZMA 4WKRA 4TU9A 4DV1F 3IR5B 2C2ZB 3M9NB 3DOLB 5DDPC 1S77D 4GKJF 4WPAA 2O67A 3BV8A 1KD1T 2IVFB 1E6YB 3CNQP 2LP4A 3JXOA 1FK9B 3MECB 2R9LA 5B08A 2E5GA 4IYQA 2XZTB 3OFFA 2OHDA 2PN6A 2YNIA 2E9RX 2UXBJ 3M8QB 4QR1A 4P2MA 3WHIA 3CJ0A 2E29A 4DV7F 1TKDA 1L5UA 2W2OP 1Y7PA 4OYBA 3BQ0A 1NK7A 2DNLA 1WTBA 2JHEA 2AJ0A 5ETRA 2MKIA 1IKWB 3JSBA 1UTAA 1KVKA 1NB2A 1S97A 1TU0B 2C2EA 3EZOA 2KM8C 1PYSB 2QRRA 3MR5A 4P2XA 8AT1B 2FC9A 2RILA 3M9OB 2VG7A 5IM0A 4YQWA 4AL6A 3HZEA 4ZS6A 2ZOFA 3OXLA 2GJ2A 3CMQA 2GJIA 2WVCA 1WC5A 2NZCA 1L3TA 4R8UA 2DGUA 2I5JA 1WKKA 2D9PA 5MLCV 3C19A 2ERRA 4ZA1A 4OYAA 2NXNA 5KFZA 4I7FB 4DV3J 2ZJRQ 1XMBA 1ZM3A 2PIIA 2QA1A 4ED5A 2KKHA 5HVGA 4FYYB 1WC4A 2DEJA 2W24A 5I3UA 2PO4A 3FMWA 1G6BA 2GMLA 2OPQB 4M5MA 4P9SA 2CJYB 2BV3A 2ZKUA 4PRFA 4M5JA 3BR9A 2RQ4A 5KG6A 4TY8B 2MXYA 2JOQA 4UW2A 2R4FA 2GHWA 3SSSA 1JJHA 3ISND 2BJEA 4I6AA 3NCRA 5T7LB 4MIWA 1GK8A 1HWIA 3MR6A 1SH2A 1WC3A 3OW2R 4F26A 5DLFA 4OHVA 3BR8A 3FNNA 1XIQA 3JB9k 4IQMA 3KFWX 2BE7D 1LV5A 5DQHA 4WFXA 3OTOJ 4G6VB 3W65A 3OSPA 5B0BA 2LDYA 2VHGA 3U1NA 2ZH2A 2CUYA 4O23A 3QT6A 2AGPA 4DL3A 1FX2A 2WRMA 2C2KB 2VPXB 4ETZA 4K59A 3KNGA 3KG4A 2V68A 4CM0A 2KH9A 4NLTA 3R6LB 2W9BA 3NY0A 3G8TA 4IFVA 2G2ZA 2MQQA 5L46A 4NXNJ 3I0RA 3SCLE 2XY5A 3C14A 4A4JA 1S1WA
chains in the Genus database with same CATH topology
4KY3A 1IBLJ 4LF5J 3J7AN 4PWWA 1XMQJ 4X62J 2UUCJ 4DUYJ 4DV6J 3T1HJ 3R2CJ 2KVQE 4HHUA 4YHHJ 1HNZJ 4JV5J 1FJGJ 4DR3J 4JI2J 4DR7J 2KL8A 4NXMJ 4DR4J 3W1YC 2UUAJ 4JI0J 4KYZA 5IWAJ 4GKKJ 1XMOJ 2MTLA 4B3TJ 2ZM6J 2E5LJ 4DR2J 4DV1J 1I94J 4DR5J 4LF7J 4X65J 2UU9J 5LMNJ 2UXCJ 5IT9U 4JI4J 4LF4J 4GKJJ 3T1YJ 4JI1J 4JYAJ 4LFBJ 3JAMU 1J5EJ 1IBKJ 4DV2J 4DV0J 4B3SJ 3D3CJ 1N33J 4DR1J 4LF8J 4AQYJ 2F4VJ 4NEYA 4V1Ak 1IBMJ 3OTOJ 4DV7J 4JI8J 3J80U 1XNQJ 4DV4J 5A2QU 4LFAJ 4YY3J 4OX9J 4DV3J 5LMUJ 4JI5J 4JI7J 4NEZA 2VQFJ 4JI3J 4B3MJ 1N36J 3D3BJ 4RJVA 4B3RJ 5FLXU 1N32J 3R2DJ 4KHPJ 2UXBJ 1HNXJ 1HNWJ 4X64J 2MEWA 3IMQJ 1XNRJ 5AJ3J 4LFCJ 5LM7E 2UXDJ 4DR6J 5BR8J 2HHHJ 2VQEJ 1HR0J 4K0KJ 4LF6J 2MQ8A 2UUBJ 4DUZJ 4X66J 4LF9J 4NXNJ 4JI6J 3J81U 1N34J 4DV5J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY3 A;  1IBL J;  4LF5 J;  3J7A N;  4PWW A;  1XMQ J;  4X62 J;  2UUC J;  4DUY J;  4DV6 J;  3T1H J;  3R2C J;  2KVQ E;  4HHU A;  4YHH J;  1HNZ J;  4JV5 J;  1FJG J;  4DR3 J;  4JI2 J;  4DR7 J;  2KL8 A;  4NXM J;  4DR4 J;  3W1Y C;  2UUA J;  4JI0 J;  4KYZ A;  5IWA J;  4GKK J;  1XMO J;  2MTL A;  4B3T J;  2ZM6 J;  2E5L J;  4DR2 J;  4DV1 J;  1I94 J;  4DR5 J;  4LF7 J;  4X65 J;  2UU9 J;  5LMN J;  2UXC J;  5IT9 U;  4JI4 J;  4LF4 J;  4GKJ J;  3T1Y J;  4JI1 J;  4JYA J;  4LFB J;  3JAM U;  1J5E J;  1IBK J;  4DV2 J;  4DV0 J;  4B3S J;  3D3C J;  1N33 J;  4DR1 J;  4LF8 J;  4AQY J;  2F4V J;  4NEY A;  4V1A k;  1IBM J;  3OTO J;  4DV7 J;  4JI8 J;  3J80 U;  1XNQ J;  4DV4 J;  5A2Q U;  4LFA J;  4YY3 J;  4OX9 J;  4DV3 J;  5LMU J;  4JI5 J;  4JI7 J;  4NEZ A;  2VQF J;  4JI3 J;  4B3M J;  1N36 J;  3D3B J;  4RJV A;  4B3R J;  5FLX U;  1N32 J;  3R2D J;  4KHP J;  2UXB J;  1HNX J;  1HNW J;  4X64 J;  2MEW A;  3IMQ J;  1XNR J;  5AJ3 J;  4LFC J;  5LM7 E;  2UXD J;  4DR6 J;  5BR8 J;  2HHH J;  2VQE J;  1HR0 J;  4K0K J;  4LF6 J;  2MQ8 A;  2UUB J;  4DUZ J;  4X66 J;  4LF9 J;  4NXN J;  4JI6 J;  3J81 U;  1N34 J;  4DV5 J; 
#chains in the Genus database with same CATH topology
 3N9U C;  1FNM A;  4ES2 A;  4LFC F;  4X62 J;  4J37 A;  2CFX A;  3PRB A;  4ILM A;  3W7B A;  5C2G A;  4O3Q A;  3TQE A;  2AF6 A;  2NXJ A;  1FWP A;  2O66 A;  2C3O A;  1VQN S;  4H54 A;  3Q2T C;  2B4U A;  3EGV A;  2MKY A;  1ZAW A;  1HA1 A;  5ETQ A;  1CUL A;  1IBK J;  1RT6 B;  3VF0 B;  2ZUG A;  3VGS A;  2VD3 A;  3GLJ A;  2BE9 B;  4KH0 B;  5I3Q A;  1VC0 A;  1VJQ A;  1R0A A;  1FX4 A;  1WSV A;  1PAE X;  3PNI A;  1I5O B;  5E2Q A;  3HVT A;  3HSD A;  4O3S A;  4WP8 A;  1B0T A;  1LWC B;  1WC0 A;  2C28 A;  1UJ5 A;  2EEY A;  4BHQ A;  2EFN A;  3W5Y A;  2R7U A;  4B9T A;  3TJA A;  2YWH A;  2CPX A;  1RYS A;  1PYT A;  3V6D A;  2IMO A;  5BR8 J;  2XHC A;  2PMZ D;  3OJU A;  2MLX A;  1RWW B;  4KV8 A;  4UY8 5;  3VQT A;  4NZ0 A;  2WW4 A;  2FIU A;  2HUR A;  1U8W A;  2V4Q A;  3PW4 A;  4QPT A;  3OHA A;  3UDV A;  5C42 A;  2CAJ A;  3MMA A;  2R8G A;  3FBE A;  2ACY A;  3DYA B;  3FK4 A;  1VQ5 S;  1BQX A;  4K2J A;  4FYV B;  2D41 A;  2MTL A;  3CJK B;  2UU9 J;  3S7R A;  2WVF A;  2CQG A;  1SKW A;  2QSW A;  3DRX A;  3DHX A;  3QZ8 A;  1BWE A;  2XZD B;  4OMF G;  1F2H A;  2IAJ B;  1CVJ A;  3BRE A;  2WK4 A;  2DB1 A;  2LXF A;  1KS2 A;  3IC1 A;  4AL5 A;  4IQX A;  2IBK A;  2JFK A;  1F3V A;  2EG1 A;  1RTZ A;  2V63 A;  2D3O R;  3QAE A;  4OYM A;  3K17 A;  5LOQ A;  3DFE A;  3ZZR A;  1R3N A;  2XI2 A;  3MPW A;  3LWM A;  2M3D A;  3MR3 A;  1IWG A;  4JI5 J;  4XPE A;  2WOM B;  3BKT A;  2M0G B;  1F6T A;  2B9Y A;  2PD1 A;  4U95 A;  4NLQ A;  2HRU A;  4DHV A;  2VOO A;  1CLF A;  4LF6 J;  1G7C B;  2VBW A;  1M5V C;  2MQ8 A;  3CCM S;  2NPI A;  1WOO A;  3D6H B;  4ZVR B;  4PWW A;  2GMH A;  1OO0 B;  2QO3 A;  3PJX A;  5I42 A;  3NXZ A;  2QL5 B;  3P8B B;  3A8J A;  3PDN A;  4CH7 A;  3W5X A;  4DCJ B;  2ASY A;  2A2D A;  2R8I A;  1RCX B;  4BCA A;  2FVQ A;  4KBI A;  3R5G A;  1VYA A;  4NX9 A;  1QSS A;  3AOD A;  3D54 A;  3DRY A;  1R8B A;  4ZJQ A;  4DFM A;  1HQU A;  3TZY A;  3CB4 A;  2I2Y A;  2HLU A;  3KHL A;  1H3D A;  2HBY B;  3RBE A;  2N4C A;  2M70 A;  3ZZ0 A;  3RTV A;  4MK7 A;  1X0F A;  4YP3 A;  4Q7A A;  1XJW B;  5FLX U;  1VK8 A;  1NZA A;  1UVK A;  3F44 A;  5IT0 A;  2ATL A;  1CJU A;  4K0K J;  2G4B A;  3S8S A;  2RVJ A;  3PEJ A;  4E98 A;  1I3O B;  4PWU A;  3HD1 A;  2Z57 B;  1ARO P;  3ILL A;  2P8I A;  5AE3 A;  3GFY A;  1X4A A;  3TOQ A;  4ECT A;  4DPX A;  1FXL A;  5L38 A;  5ETP A;  1DLO B;  1A9N B;  1S4E A;  4MKY A;  3MM9 A;  2V67 A;  2E7W A;  1MSW D;  3U1M A;  1Y3J A;  2BAN B;  3P5T L;  1VBZ A;  1QD1 A;  1WEY A;  1CJT A;  2BKN A;  4G1Q B;  4P74 A;  1FVS A;  4X4N A;  4OLP A;  5KAK A;  1GXL A;  3C16 B;  4IRD A;  1HQE B;  1NBE B;  4NMX A;  1TL3 A;  2DIU A;  2ILY A;  4EYI B;  2B8Q A;  5LMN F;  3ITH B;  1S1U A;  2FJV A;  4LSN B;  3TAM A;  4LFB F;  2VON A;  1XNQ J;  2MLZ A;  3K7R A;  4HAC B;  4RR5 A;  4FF2 A;  1ROF A;  1W25 A;  4C0B A;  1KHV A;  1V9O A;  3P96 A;  1PJ7 A;  3QID A;  3IAM 9;  4NLP A;  1FCA A;  3WBZ A;  2Q43 A;  3V4I B;  3HT3 A;  5F41 A;  4HHH A;  3HJV A;  3FEY B;  3TR5 A;  4OHX A;  1XNR F;  5KOW A;  3SQO P;  1C4A A;  2FHO B;  5D4L A;  2M7S A;  3OTE A;  4DR3 J;  1F60 B;  4EI2 A;  4ES3 A;  4JB8 B;  1HBM A;  4EO6 A;  3OR2 B;  4DPU A;  2AEM A;  4OJG A;  3HSZ A;  4NLU A;  2VH7 A;  5L9X A;  1AXQ A;  3IN5 A;  5EX0 A;  2ADC A;  1YX2 A;  3H8Y A;  3DI6 A;  3D9B A;  2OPR A;  4J91 A;  4NCA A;  3JS9 A;  1JX4 A;  1F9E B;  5HJY A;  5KT2 A;  2RRA A;  1AUS L;  3M1V A;  3PRD A;  4DSK A;  4TN2 A;  1S1T A;  1ZM4 A;  4ICL B;  1WF2 A;  1P6T A;  3VZI A;  3H2V E;  1AZS B;  3DNC A;  2FHM A;  3CCU S;  3QGP A;  2IMW P;  5RUB A;  1OY9 A;  2B4O A;  5IQ6 A;  3HHN B;  3ZTQ A;  4CO4 A;  3FZ2 A;  3HHE A;  3LPY A;  3MMC A;  4WU3 A;  2APO A;  1NPR A;  3T5K A;  5F8I A;  4KRW A;  3M8W A;  5ETK A;  4IFY B;  2EKN A;  3OJS A;  2K2P A;  2G0J A;  1RJJ A;  3D68 A;  2B8P A;  1JLA B;  3AT1 B;  3DOL A;  4R0J A;  3MCO A;  2P9C A;  4UOF A;  2XSF A;  2FZK B;  2B6A B;  5SUH A;  3CME S;  2OH2 A;  1E6Y A;  1PGZ A;  5THW A;  3W9J A;  4DR7 J;  3HHK A;  3H90 A;  1FK9 A;  2CPJ A;  3MEC A;  2ZM6 J;  5DGA A;  3ZZU A;  1JJ4 A;  1TFW A;  3M8Q A;  2C2R A;  4JYA J;  3CC4 S;  4FZV A;  3W9I A;  2BRK A;  2VU5 A;  1IJE B;  5KFA A;  5E5N A;  2X1B A;  2A2C A;  4CLF A;  2R8K A;  1DAX A;  1FD8 A;  2Y1J A;  1IKW A;  2BJ8 A;  2QSF A;  4DV2 F;  1P8G A;  1RQ0 A;  2C2O B;  5DLG A;  4Y2M A;  5CH7 B;  2MKH A;  2HHW A;  3CDW A;  2WVD A;  4WK1 A;  2EPI A;  3LWL A;  1HWU A;  2XY7 A;  5AJ3 J;  3D66 A;  1F5A A;  4Y2I A;  3G86 A;  2YWK A;  1RWO B;  3DRP B;  5HK4 A;  3K89 A;  1N32 F;  2GAH C;  2MQL A;  3H7H B;  2HK3 A;  4WJB A;  1X60 A;  2V9K A;  1N52 B;  4EMD A;  4I7F A;  3M7V A;  3PIO Q;  3RR8 A;  1QSL A;  3NOG A;  1X4C A;  3D5M A;  3OD2 A;  5CHC B;  3MAQ A;  4K4Z A;  3DM2 B;  2C2M B;  2DTJ A;  2DEI A;  3TQ1 A;  2ZDP A;  2HHT A;  2OPQ A;  4YUD A;  2WHO A;  1XEZ A;  2CQ4 A;  5DDQ C;  4DS4 A;  4RZR A;  4F2R A;  4X65 F;  2DRA A;  2W4D A;  4TY8 A;  1TMM A;  1OPI A;  3SYZ A;  4UOG A;  2CJX B;  1HBN B;  4I68 A;  2H51 B;  3RU0 A;  2YKN B;  5T7L A;  3N6L A;  3IG1 A;  3O5T B;  1GTE A;  2BE2 B;  2M9K A;  1SC3 B;  3IA0 A;  2WZ1 A;  3A1Y G;  5FDL B;  3PX6 A;  4I0W A;  3GCX P;  3IR6 B;  4QU7 A;  4OZ5 A;  4IRC A;  4D3H A;  2HEK A;  3UDC A;  5K14 B;  2OSQ A;  1T95 A;  1U49 A;  2WSC C;  3KLG B;  3AJ2 A;  4WP9 A;  1RU1 A;  3L4B C;  4XDC A;  3C6U B;  2HBR B;  1FJG F;  3O44 A;  1OY8 A;  2L41 A;  2IRU A;  2CQC A;  3T6J A;  2YKO A;  4P7V A;  3VAF A;  4WYL A;  3V2U C;  3CWJ A;  2X3D A;  2PMW A;  5B0G A;  3E51 A;  1ZM9 A;  4XIU A;  5FLX Y;  3W8P A;  2U1A A;  4F4K A;  2DNO A;  1WJ9 A;  1GAO A;  2XMT A;  3K5N A;  3Q24 A;  4QBU A;  1EAY C;  1N88 A;  2VFR A;  4TYA A;  4YB1 P;  2MQN A;  4ZVF A;  2B4V A;  4GVB B;  2XC9 A;  2CQ0 A;  5ETO A;  3BBB A;  1RT6 A;  4CM2 A;  2BKO A;  2RQM A;  2FVP A;  3K0J A;  1S0N A;  2WBR A;  1BWV A;  2M52 A;  1ZAV A;  4I1T A;  4CO2 A;  3QT7 A;  3CJ2 A;  3M6V A;  5CAA A;  4DV6 J;  1FE4 A;  2AKW B;  1LWC A;  4LVN P;  2UVU A;  3RBD A;  2CDQ A;  2OFH X;  4DL6 A;  5CXT A;  4URG A;  3BGL A;  1NME B;  2RUG A;  2P2C B;  3KWM A;  3QZ7 A;  3K57 A;  5DGB A;  5J1E B;  3AD8 C;  1RHM B;  1R0B G;  1H72 C;  3VQS A;  1KTV A;  4ELU A;  3DYA A;  2V69 A;  3NAH A;  2F3J A;  3OFH A;  3GCW P;  3CJK A;  1EP4 B;  5H9E J;  2J0S D;  2RQC A;  4ANC A;  3HF5 A;  1IKX B;  4FVC A;  4JI3 F;  3HUL A;  2OTJ S;  4FXD A;  3HX9 A;  2ALZ A;  2K3I A;  2DHS A;  5KFW A;  2IJN A;  2IAJ A;  2VDI A;  2EWH A;  2DH7 A;  2FGC A;  1HNX F;  1PIL A;  5LSR A;  4Y28 C;  2F1F A;  1U2C A;  1SB6 A;  2QLW A;  3TX0 A;  2HHS A;  3FFI B;  2V8D A;  3AQO A;  3M8Z A;  1REV B;  4CLL A;  3NGU A;  4QIF A;  4Y6I A;  2WOM A;  1FDN A;  3HK2 A;  4CLZ A;  2HMI B;  3VTI A;  1CQN A;  1H73 A;  2I8E A;  3FSX A;  4RBT A;  3UE2 A;  2HGN A;  4LF6 F;  1SL2 A;  3NWG A;  2FHK A;  1NJX A;  3UNG C;  1V3Z A;  1LOU A;  1FVQ A;  1S10 A;  3D4J A;  3IGV A;  4PKD B;  2XMA A;  1NO8 A;  1OS5 A;  2QX0 A;  3KLI B;  5HRO B;  5JJB A;  1NJW A;  4DN0 A;  1DHM A;  3UWT A;  4N8O A;  4MKB A;  3BSA A;  3D3B J;  3R1H A;  3PYD A;  5KFG A;  5H9F K;  3TEH B;  5L1J A;  3BB5 A;  4CI0 B;  1KON A;  2HQ3 A;  1F0X A;  4LQ9 A;  1CPZ A;  4DQP A;  5HQL A;  3AOC A;  4DV5 J;  4L3K A;  1KBR A;  3CJ4 A;  1QY7 A;  2LVW A;  5KFM A;  5D4O A;  1ZET A;  3EUN A;  3DGV A;  4ZMM A;  1EJ7 L;  3FJ2 A;  3NS6 A;  1U1Q A;  1U24 A;  4TU8 A;  1YTY A;  2R7S A;  1X4G A;  4ZLN A;  2H48 B;  2E66 A;  3T1H F;  2XG8 A;  4O0I A;  2FVC A;  2NLW A;  2IFX A;  5GAE U;  3FUY A;  2EW9 A;  4FYD A;  1C1B B;  3SIP B;  3ZZZ A;  2MQM A;  2MHE A;  4JI8 J;  3RBX A;  1DLO A;  2AYB A;  1PCA A;  3PFE A;  4IO9 Q;  2R2R A;  5CCL A;  1T8E A;  2H65 B;  4ECX A;  5HMY A;  3A3P B;  2YTC A;  2BAN A;  2GC8 A;  3VGU A;  1U47 A;  4G1Q A;  4ZVE A;  1Y4Z B;  4WBF A;  3C16 A;  1QVG R;  4B3O B;  1HQE A;  4KH1 B;  1NK8 A;  1B7F A;  3SQG B;  1EQ0 A;  3ITH A;  4LSN A;  4HHU A;  1IR1 A;  3GIL A;  1VQ9 S;  2D69 A;  1FWK A;  3CC2 S;  1VHF A;  1FES A;  3X1L B;  3IWL A;  4HAC A;  4RKU C;  4RPF A;  1WG1 A;  2N3L A;  3HJF A;  1IWA A;  3SI8 A;  1J5E J;  2DNK A;  4B3S J;  1RWM B;  4PAB A;  3NEK A;  4DR2 F;  3V4I A;  5HAT A;  4I67 A;  3H40 A;  3P5B P;  4FBT A;  2UXC F;  4QW9 A;  2UV8 G;  2VBX A;  2A10 A;  4LRB A;  5GAE I;  3UO0 A;  2DGV A;  1TVR B;  4F0H A;  3KLH B;  1RKI A;  2DHH A;  2MZR A;  3OR2 A;  2XMK A;  2AYG A;  2HWT A;  3IP0 A;  5CQG A;  2CQP A;  5K8O A;  4JI7 F;  3NS7 B;  2PDA A;  2YWE A;  4CWB A;  3FC9 A;  1LNQ A;  4I2Q B;  4ED0 A;  5KFO A;  2UUW A;  3VAH A;  1FKO B;  3THV A;  2H54 B;  3THT A;  2E1P A;  1SUQ B;  2B9W A;  3MFI A;  4LJM A;  3RRH A;  1MRO A;  4ICL A;  1LWX A;  3M6X A;  3LTO A;  1AZS A;  2E5L J;  4WTY A;  1ITP A;  2IDL A;  2DPJ A;  2FHJ A;  4NXM F;  2CNL B;  2BRL A;  4IFY A;  4ZPC A;  3GTY X;  1ZZF A;  3MUR P;  4ZJO A;  2CJA A;  1MW7 A;  1UA1 A;  5M2U A;  2HNY B;  1C2P A;  2DKO B;  3CCR S;  3NL0 A;  1DFD A;  2B6A A;  3QO9 B;  2QA2 A;  3CW2 C;  4A8Y A;  4JOU A;  2F4V F;  2VZ9 A;  3A8E A;  1IBM F;  4O0N A;  2KT5 A;  2AEJ A;  2DNN A;  2DR5 A;  4HI2 A;  2B3T B;  4DSE A;  3U7J A;  4C8K A;  3M4X A;  3G96 A;  1SC1 B;  4OQJ A;  2UUC J;  1WG5 A;  1T03 B;  1YJN S;  1SQF A;  4M94 A;  2XMV A;  3RB4 A;  1FDB A;  1RU2 A;  4WP3 A;  1ACM B;  2RS8 A;  1NK5 A;  2ZOM A;  2YH1 A;  1NDK A;  3AXM A;  3OFG A;  1V6H A;  1F9F A;  1XMQ F;  1YBU A;  2HVI A;  2HND B;  2FJD B;  2RU9 A;  5EWF A;  1N0U A;  2EC0 A;  5DM6 Q;  4FF1 A;  1AFI A;  2ROE A;  4ERD A;  2VA3 A;  2GIR A;  3MAH A;  3MM7 B;  2ATC B;  3DRP A;  1FKP A;  1SQG A;  2MJU A;  2XS5 A;  1GTH A;  3KLE B;  3G82 B;  7FD1 A;  5KFV A;  1WSR A;  2XBP A;  4K8R A;  2E7V A;  2ILZ A;  1BMQ B;  2BW7 A;  3B82 A;  2HFO A;  2VQF J;  4EBC A;  2YX7 A;  3PCO B;  1M5S A;  2E1M C;  2DK2 A;  5KFR A;  4CH0 S;  2FQQ B;  1X4D A;  1IN0 A;  2BYC A;  4Y2A A;  1ZBT A;  4QQB A;  3J7A 1;  2XHW A;  1V3S A;  2V8P A;  4H4K A;  3DM2 A;  2BW2 A;  3NGT A;  4FP9 A;  2ZNZ A;  1K1Q A;  1S5Z A;  3POT B;  1WC1 A;  2ROG A;  3EWG A;  1OYE A;  4TQR A;  3TZZ A;  2RDJ A;  1VR6 A;  1H0H B;  3G6Y A;  1D1U A;  1RGV A;  2HHH F;  2WW8 A;  5LT5 A;  1YJ7 A;  1UVJ A;  5L1L A;  5K8N A;  4U9R A;  2W8L A;  2ASJ A;  2XMJ A;  3BKF A;  4EWT A;  1HBN A;  1UZH A;  2F8M A;  2YKN A;  3S6E A;  1S1V B;  4OZ3 A;  2GFF A;  4V19 J;  2CZ9 A;  4JI2 F;  1KC8 T;  4J5O A;  4I56 A;  4DV0 J;  1SL1 A;  1Q79 A;  1VBK A;  3UN5 A;  3V81 B;  3RYL A;  4ELT A;  2BE2 A;  2QMW A;  2QIF A;  3I5C A;  2HAI A;  5FDL A;  4CLU A;  3BSC A;  3I82 A;  2W7P A;  1G1X A;  4PPZ A;  4K4V A;  1FT8 A;  3VVT A;  5K14 A;  1PBA A;  3KLG A;  4FYW B;  4DDF A;  1RHU B;  1X5P A;  4ZIT A;  2CPZ A;  3N4W A;  1F3F A;  1Q4R A;  4RNM A;  3R1L A;  3C6U A;  2IC3 B;  5C2C A;  3QT5 A;  2MKS A;  2YKQ A;  4ANE A;  3GR1 A;  4ZIV A;  4EYH B;  2EK1 A;  1VOM A;  3VR1 A;  3QWU A;  4TY9 A;  4B3R F;  5DDR C;  3D1H A;  1HNW F;  1WG4 A;  3RB0 A;  3TEG A;  3CCT A;  2D7S A;  1EET B;  2CZ4 A;  4DUZ F;  1CSJ A;  1YK9 A;  2CPY A;  4NLW A;  1D0E A;  2UUT A;  3GSI A;  1SC4 B;  4FDF A;  4GVB A;  4DFJ A;  1TAQ A;  5IWA F;  2KJW A;  4WFY A;  1S9E B;  1I94 F;  3DLB A;  4L6V 3;  4ZLP A;  5D0R A;  4QIG A;  4DV6 F;  1XR6 A;  2FZC B;  3H0P A;  1CBK A;  4F8R A;  2D9O A;  4YY3 J;  1N4L A;  3NOC A;  5BYS A;  1D9A A;  3NWR A;  2XYG B;  4LIR A;  5IFM A;  1UFW A;  4RJV A;  4CYU B;  2QLB B;  3IMQ J;  3SCK E;  4DZ6 A;  3RR7 A;  4CQ1 A;  1NCL A;  5IT9 Y;  3I0S B;  4KQZ A;  3UDL A;  2OEK A;  2RHQ B;  3CCE S;  3I4H X;  1GMW A;  3TX8 A;  5J1E A;  4ATN A;  1TUV A;  1XWL A;  1DY3 A;  4QYR A;  2QMU B;  5J2Q B;  3CF5 Q;  2KJV A;  1GT8 A;  4FNI A;  1HR0 F;  4M8L A;  3KYL A;  1SIZ A;  1S0O A;  2XMM A;  3T41 A;  3TJ9 A;  1HNI B;  4WFB Q;  2XWX A;  3BH6 B;  1DTQ B;  1A6L A;  2E1R A;  2PE8 A;  1EP4 A;  1IKY B;  3K5M A;  1FFW B;  3Q8S B;  1FJ7 A;  3Q8Y A;  3EGN A;  1IKX A;  4QYZ J;  3SZ2 A;  3FBC A;  3O6Q A;  4OJ3 A;  1M0S A;  2QV6 A;  3BN7 A;  3IR7 B;  2CVE A;  1FTR A;  3HXM A;  2VBZ A;  3R5C A;  4X4V A;  3NGD A;  3W2W B;  1HPZ B;  3FFI A;  2GO8 A;  1RE1 B;  2O3D A;  3D1O A;  2HW3 A;  3QNW B;  1N36 J;  1ZTT A;  3VAJ A;  1RAI B;  5D0G A;  5E41 A;  2V34 A;  3MAA B;  1X9M A;  4L73 A;  5HLF B;  4QW8 A;  5KFS A;  2QL9 B;  1YI2 S;  1OIA A;  1N8R T;  4LVO P;  4OI2 A;  2Y8Y A;  5F8J A;  2J0Q D;  1HWL A;  2DGS A;  2HVE A;  3CIZ A;  2QYC A;  3LGM A;  1HI8 A;  4DR6 F;  3IBF B;  4NYP A;  2KVQ E;  1UZD A;  3J7Y U;  2AGQ A;  4OI3 A;  4PUO B;  2F8H A;  4ZP9 A;  4JI6 F;  3C15 B;  3KLI A;  5HRO A;  3CE8 A;  5IQQ A;  5AXN A;  2JC0 A;  4KB7 A;  3EZ5 A;  4DR5 J;  2F40 A;  3M30 B;  3MMJ A;  3DOK B;  4LF4 J;  2OFG X;  2XQC A;  2OMO A;  3QSY B;  3BDE A;  2B7B B;  1WI6 A;  3NMR A;  1JJC B;  3E2E A;  1T9T A;  2B0G A;  1UPP A;  4LRE A;  5IM0 B;  3CCJ S;  2N7Y A;  4RUH A;  4IG0 B;  4PG7 A;  2KTQ A;  4A8M P;  4X4P A;  4Y2C A;  5KFN A;  3FCW A;  3SEO A;  3QRP A;  1R8A A;  4CZC A;  2DO4 A;  3WX8 A;  3UFC X;  1RT4 B;  3PW2 A;  5GMK a;  4YR3 A;  3HSJ A;  1S1X B;  4OX9 F;  3OR1 B;  2QMX A;  2AWZ A;  5HP1 B;  4TQS A;  3MUT P;  1UP1 A;  1C0U B;  1WKL A;  1LQ9 A;  2FJB B;  4CRJ A;  3IM8 A;  1C1B A;  4KHP F;  2FJX A;  1UPM B;  4Z7Y A;  1Q86 T;  2R8J A;  2UVW A;  4P6Q A;  4DSF A;  3H5S A;  2DD8 S;  4X4O A;  4I2P B;  3D67 A;  4C0O C;  4FKY A;  1YRX A;  2AD9 A;  2LEB A;  2AJQ A;  2HYI B;  1N56 A;  3PHE A;  4DI6 A;  1D8Y A;  2H9Z A;  4DF4 A;  1U0S A;  2QTW A;  2CWK A;  4DOZ A;  2ZHA A;  3MUM P;  3LPE A;  1N33 J;  1AFJ A;  2VC0 A;  4B3O A;  3QGG A;  4HTJ A;  4ENO A;  3I4P A;  2D3O 1;  5J2M B;  4P71 A;  4C8Y A;  3SQG A;  4J9R A;  5KT6 A;  2GJF A;  3R8Y A;  4RNH A;  1WD6 A;  4U8Y A;  1EIY B;  2FLP A;  1K73 T;  2VOP A;  3NG8 A;  5KG4 A;  1U1M A;  1DQA A;  4G1P A;  2HFZ A;  1OQ6 A;  2C22 A;  1JNZ B;  2XUL A;  3OL7 A;  3M8S A;  2AX1 A;  2LFV A;  4FXW A;  2VG5 B;  1S7I A;  2JSX A;  2O5D A;  5E3C A;  3M2U B;  1RTI B;  4U96 A;  1APS A;  4USJ C;  4J9V A;  4NCG B;  1TK0 A;  4U7U D;  4KY3 A;  4PEO A;  3Q83 A;  3PAC A;  1UEK A;  3OFE A;  3D1Q A;  4YHH J;  4DG1 A;  4JV5 J;  5DJB A;  3IXQ A;  1KN6 A;  3PW5 A;  3C14 B;  1S1W B;  2GNK A;  5D6G A;  1TVR A;  4B9L A;  3KLH A;  3PVX A;  5I4M A;  1RWX B;  3RJM B;  1SI9 A;  1UVN A;  2X1A A;  2MKC A;  2ZC4 A;  2Z30 B;  1S72 S;  2V2Z A;  4JUZ A;  2KHC A;  3QGH A;  5EUH A;  4I2Q A;  2KRR A;  4BDP A;  3MM6 B;  1FKO A;  4P52 A;  4HDH A;  2IRX A;  1SUQ A;  2ZH4 A;  3UR0 A;  1SIW B;  2W2N P;  3BGR B;  3SV4 A;  2FZG B;  3IRW P;  1VQ6 S;  1X4F A;  1NAQ A;  3FDS A;  3QIP B;  6FD1 A;  1HYS B;  4RW9 B;  1LXN A;  1S99 A;  1T11 A;  1WHW A;  1FJE B;  4OL8 A;  1SXL A;  2Y1R I;  2Z0G A;  4YB6 A;  5D3G B;  2BXJ A;  2HQI A;  3W66 A;  4P10 A;  5U47 A;  3KK2 B;  3AOB A;  1H74 A;  3DXS X;  2HNY A;  4DU7 A;  2YQ1 A;  2X7I A;  3QO9 A;  4ZKA A;  4ILL A;  1RWK B;  1XMO J;  1OY6 A;  1GQE A;  3NNC A;  1IBL F;  3UR3 C;  3WX4 A;  1OSD A;  3VHQ A;  2CPD A;  4WXW A;  4BLG A;  3VAM A;  2YY3 A;  4OJH A;  2UUA F;  3IBW A;  1KDN A;  1Q8L A;  2Z4P A;  4M63 A;  4QCL A;  3AB2 B;  4HR2 A;  3PKY A;  3ET6 B;  4V1A k;  1G4C A;  4PXD A;  3PTW A;  5D0E A;  1UW9 A;  5M2P A;  1T03 A;  2ROP A;  1Z1Z A;  2ZH9 A;  5HMZ A;  4DR1 F;  4UY8 T;  4JV2 A;  1X5S A;  5E3A A;  5F3T A;  3NRB A;  4OI6 A;  3G6V A;  4O3N A;  3KNA A;  1FF2 A;  2XLI A;  4A8O A;  2HIQ A;  4ID5 B;  1U6Z A;  2HND A;  2HQF A;  1VQO S;  3LA0 A;  3JTO A;  2NR0 A;  1KKH A;  5FJ4 A;  1RHJ B;  2D1C A;  3GFH A;  4WE1 B;  2JVR A;  3MM7 A;  3DLE B;  4LRC A;  4KT0 C;  2JWN A;  4O3O A;  3KLE A;  3G82 A;  2AU0 A;  1T9X A;  1P1L A;  2DGW A;  5AE2 A;  1N5V A;  2Z8Q A;  3KUE A;  2XGQ A;  1AYE A;  2QT7 A;  2VQF F;  3DMJ B;  1QTM A;  4MKV A;  2QE5 A;  4J9Q A;  4NPO A;  2HHU A;  3QLH B;  1YBA A;  4RU2 A;  4J9S A;  1Q0N A;  2NRE A;  4UZC A;  2MGZ B;  1RT3 B;  3Q8R B;  2J5A A;  2JRS A;  3ZO7 A;  4ZLJ A;  3POT A;  3A8K A;  1YDL A;  2PA3 A;  1KQS R;  3B54 A;  2PSZ A;  2V5H G;  4YR0 A;  1VIO A;  3Q86 A;  1H6K X;  3TNV A;  4ED6 A;  2CQB A;  5GAG U;  3QMQ A;  4IKA A;  3QWP A;  1S1V A;  2HVD A;  4V19 X;  1HQ2 A;  3MZI A;  3M8Y A;  5KT3 A;  4B3M F;  1SJ3 P;  1GX6 A;  4OLO A;  5KG0 A;  3K5L A;  5F9N A;  4C98 A;  3V81 A;  2ZH6 A;  3W3S A;  1ZZN A;  3GSD A;  2W25 A;  3SSQ A;  5DO2 A;  2YWG A;  3ZZT A;  2W4C A;  3JTN A;  2GIF A;  4KHR A;  1N34 F;  1QE1 B;  4OZ2 A;  2ZJP Q;  5EX3 A;  2IHR 1;  2XM3 A;  1NLK L;  4C8N A;  3GYX B;  4DQS A;  5EDW A;  2HSE B;  2IC3 A;  1U6F A;  2C3U A;  2FJA B;  2E1A A;  2MHN A;  4I4B A;  2RJZ A;  2RIJ A;  3GFX A;  4OYI A;  5H1S V;  2R3V A;  3X3U A;  5KG2 A;  4LT6 A;  1EET A;  3TVK A;  3C3L A;  3FQK A;  1VQS A;  5F8L A;  5F8H A;  1S49 A;  4M5I A;  4ECW A;  4ER8 A;  3MDF A;  4WFN Q;  4QIW D;  3A3N B;  3UNY A;  2B4P A;  1FKA F;  3NGS A;  5BJR A;  5LMU F;  4Q0B B;  5IV3 A;  1LK7 A;  2EFP A;  1FRJ A;  1PJ6 A;  1KR4 A;  1S9E A;  2W7A A;  4F50 A;  4IO1 A;  3GYG A;  2JL9 A;  1FRK A;  3EZU A;  3BGO P;  2HQG A;  4HDG A;  2KL8 A;  4CP5 A;  2HFS A;  1IUJ A;  3QYY A;  1C4C A;  2YNG B;  1F5C A;  4F4X A;  4RNF A;  1FRM A;  3I31 A;  3K8W A;  3D0G E;  2QLF B;  4CYU A;  4USI A;  3OVB A;  1T9W A;  3E3X A;  2Z2Y B;  1Y5I B;  4ZP6 A;  4N76 A;  2W9C A;  4WU2 A;  4PYD A;  3I0S A;  2ZUA A;  3SBM A;  2QG9 B;  3HFZ B;  2G0C A;  2M8H A;  3Q2S C;  3GR0 A;  3EDQ B;  1DQ8 A;  2V2K A;  2RE1 A;  3DLG B;  4O3P A;  5J2Q A;  3IGN A;  4PQA A;  3J80 U;  4DV4 J;  4F3Q A;  4NML A;  4U7C A;  3BQ2 A;  5AXL A;  4K4W A;  3JSM B;  4A8K A;  1RBO B;  4NWB A;  1E6V B;  3BQ1 A;  1G2E A;  1HNI A;  2K7K A;  4F3O A;  1RBL A;  3AJD A;  1IQZ A;  1IKY A;  5LXR A;  3ADA C;  4Q8F A;  5F9L A;  2XGP A;  2GIQ A;  3MMC B;  3MXH P;  4M95 A;  4DLE A;  4I64 A;  4DL4 A;  3J7A N;  2ASL A;  1T3N A;  2VQE F;  3HI9 A;  4OYO A;  4CO0 A;  2J6S A;  1D09 B;  3QQC D;  4RW4 B;  3ZTR A;  3W2W A;  1HPZ A;  3G71 S;  4QJV A;  3Q8V A;  4Z37 A;  1RIS A;  2R7V A;  1Y0H A;  4MYU A;  3OL8 A;  1MNE A;  2DR6 A;  3MR2 A;  4DWI A;  1NUE A;  3MAA A;  4KC5 A;  1IQT A;  5HLF A;  2LQJ A;  3EDR B;  3KDO A;  5A8K B;  2ZBP A;  4MIA A;  1JKH B;  3CGI A;  4ZN3 A;  2NZ4 A;  2IA6 A;  4C6A A;  5GAH U;  3CCS S;  3TYT A;  1B4S A;  2MQP A;  2QEX S;  2J7K A;  3KTQ A;  2J6T A;  4PUO A;  3C15 A;  3OXG A;  4Q8E A;  4DR5 F;  3RB6 A;  2W1B A;  3O2I A;  1OQ3 A;  2OAU A;  3M30 A;  1TL5 A;  3DOK A;  2VAS A;  4IH5 A;  4LRF A;  2BDP A;  4C48 A;  1NM2 A;  3W61 A;  2UP1 A;  5A6P A;  2OSR A;  4DCO B;  2B7C B;  5GAD I;  4USW A;  4ZCK A;  3R9L A;  3BBC A;  2E7X A;  1BD6 A;  4ZPD A;  2YQ0 A;  3OQ2 A;  1U2F A;  4IG0 A;  1HNZ J;  4KGK A;  1AUD A;  1NDP A;  3ETM A;  2OJ3 A;  1YIJ S;  4JI0 J;  2BR0 A;  4TXS A;  2RNE A;  3IWN C;  4ZVO B;  1RT4 A;  4LF7 J;  3Q23 A;  4Q5V A;  1S1X A;  3OR1 A;  4DJB A;  2BUN A;  5HP1 A;  3MPY A;  2FY1 A;  5BYQ A;  1C0U A;  3BBF A;  4DUT A;  4OHY A;  3R27 A;  4OYW A;  1D3W A;  3TJ8 A;  1U48 A;  1OSC A;  1SKS A;  1B7Y B;  3H42 A;  1Q7L B;  2JNJ A;  3ONQ A;  2DIV A;  1YGY A;  2OTL S;  4I2P A;  4UTG A;  3R5A A;  4H4K C;  1CC7 A;  3M2V B;  2G1D A;  4KJI A;  1HNV B;  2UXD J;  4LFA F;  1RTJ B;  4ECS A;  4R5P B;  1VC6 A;  2RQK A;  4NLO A;  1IXK A;  3D28 A;  1FD2 A;  1NND A;  2GZO A;  3SFG A;  4HHJ A;  5CAB A;  2XZW A;  1IM6 A;  4DBQ A;  3CCL S;  5J2M A;  2ASD A;  3IG1 B;  3ZNJ 1;  3NNH A;  2V9W A;  1YJ9 S;  5B0F A;  2IPO B;  5DZ7 A;  1SJ1 A;  2Q6C A;  1R0C B;  1T9V A;  4DEZ A;  3FVY A;  2WSE C;  3NGR A;  1N5S A;  3MED A;  1WWH A;  3L9Z A;  2P6T A;  3OT9 A;  1SJF A;  4AT1 B;  2VG5 A;  3M2U A;  1RTI A;  1PC4 A;  3T9N A;  2POK A;  4NCG A;  2RDI A;  1SVD A;  3T1Y F;  4NAS A;  2PA8 D;  4ZPW R;  5HSP A;  4LF8 F;  2HQD A;  3H4B A;  1AT1 B;  2RUS A;  4ECR A;  4MIB A;  5HAN A;  2BKP A;  1ICE B;  2ZH3 A;  2KG1 A;  4XAK A;  2VFU A;  3KJQ B;  1HHT P;  3PX4 A;  1Q53 A;  2HFV A;  4LF9 J;  4IRK A;  4EFA C;  2ZH5 A;  2W8K A;  2RD5 C;  4NA2 A;  1CC8 A;  3GQC A;  4ZJL A;  3ISN C;  2IM1 A;  4NCB A;  2JDJ A;  2R7T A;  2CNN B;  3MM6 A;  2HHP A;  5J2P B;  1ZS6 A;  4X66 F;  1RWN B;  4UOH A;  2D3Z A;  4ECV A;  3BGR A;  2PFF B;  2A0F B;  1ZA2 B;  4DV1 J;  2DNP A;  2MZQ A;  4DL5 A;  4ZP8 A;  3WQP A;  4GKJ J;  4C7Q A;  1WF1 A;  3QIP A;  4USH A;  3W60 A;  1HYS A;  4RW9 A;  2BBE A;  1RT5 B;  1CJV B;  3TUP A;  2VUG A;  3TWZ A;  5D3G A;  4JI4 F;  1SQE A;  1QAI A;  3KK2 A;  4DV7 J;  2J6U A;  2C2N A;  5H9E K;  2XB2 D;  1Q8K A;  1HHS A;  3IRX B;  4X4S A;  2RKI B;  5I3P A;  3PZP A;  4ZVU B;  5HO4 A;  3KUG A;  3V6J A;  1Q16 B;  1JLE B;  1URR A;  2J76 E;  1BUX A;  3TP2 A;  1HMV B;  1WI8 A;  3T6B A;  5EGY A;  4LR7 A;  1EAR A;  2YH0 A;  2EK6 A;  3ET6 A;  4ED3 A;  2GQ2 A;  3KJF B;  2EG2 A;  3PRV A;  3UDE A;  3NS5 A;  2G13 A;  4YB5 A;  3OL9 A;  2QLJ B;  1YZ7 A;  4Q43 A;  3UPF A;  2YVS A;  3NP5 A;  2B9E A;  4DX5 A;  2KDO A;  3AB4 B;  1NK9 A;  4LF5 F;  3I32 A;  4ID5 A;  1TZ0 A;  2DGX A;  3GZ7 A;  3J80 Y;  4GKK F;  3DLJ A;  2Y0S D;  4B3T F;  3BKU A;  4KPY A;  4IOA Q;  2IY5 B;  4AYB D;  4WE1 A;  1FRI A;  2M4M A;  3DLE A;  4P2F A;  4CLP A;  3TAN A;  4PYA A;  2NCK L;  4I6Y A;  3G8Q A;  2VIC A;  1U02 A;  2HFN A;  1TTH B;  1NH7 A;  1S12 A;  1T0T V;  3DMJ A;  3ENV A;  1UFL A;  2HS4 A;  5AT1 B;  3GPA A;  3MEG B;  3HM9 A;  2X3G A;  2ZHB A;  2KU7 A;  3QLH A;  1R27 B;  4O4G B;  3SDE B;  3TA0 A;  4N5S A;  4DPW A;  2MGZ A;  3I55 S;  1ULR A;  1KFS A;  1RT3 A;  3BSO A;  1REG X;  4PG8 A;  2PEH A;  1FRX A;  1VI7 A;  2DPI A;  3TA2 A;  4ZVP B;  2DNZ A;  5CZV A;  2OGU A;  2VKR A;  1JLF B;  2EC2 A;  2ZBQ A;  2VOD A;  2RAQ A;  1KVJ A;  1Y5L B;  3TAR A;  1EKR A;  3MOJ B;  1K8A T;  1RDR A;  1IR2 A;  2HHQ A;  1X4E A;  1UVL A;  5JVG Q;  2V8G A;  2R2S A;  1FRH A;  4HYK A;  1CS4 B;  4B9N A;  1MN7 A;  2HFU A;  4HT5 A;  4RUB A;  5JVH Q;  3UN2 A;  1ZYQ A;  3G87 A;  2XMW A;  2M8D B;  3VCD A;  3J81 j;  4ZVG A;  1W26 A;  4L75 A;  3H2U B;  4Z2X A;  1NJY A;  2HS0 A;  3CDU A;  1N0V C;  1QE1 A;  1RSC A;  2R7Q A;  2LQ8 A;  4J9K A;  5CA5 A;  4LFC J;  5CYM B;  2MYF A;  2A6O A;  2E44 A;  2CXE A;  3ULH A;  1ZH5 A;  3BDP A;  3HMJ G;  1VRU A;  3TO8 A;  2HZV A;  1RTD B;  1RHK B;  1WAC A;  2BJ7 A;  1HWJ A;  4B17 A;  5B0D A;  1T94 A;  1NK4 A;  2GGP B;  3N0V A;  1Q1K A;  4USU A;  4AXJ A;  2K7J A;  1KWM A;  3D0I E;  4DUY F;  4ZN1 A;  1RHQ B;  3GJQ B;  3BS9 A;  2XLJ A;  2CQI A;  2P9E A;  4NA3 A;  3IS9 B;  4WFA Q;  4I6W A;  2YNH B;  4Q0B A;  3PW0 A;  5KG7 A;  3MHY A;  2XLK A;  1KQK A;  3WC0 A;  3MPV A;  3GJS B;  1TMJ A;  4P73 A;  4C0H A;  1KHW A;  1JB0 C;  1B99 A;  2KZM A;  2JZ5 A;  3I87 A;  3NKY A;  4J9P A;  3GE9 A;  2YNG A;  4JV0 A;  3KK1 B;  1Z2L A;  3FBF A;  1BHN A;  1S4F A;  5G0R B;  1Y11 A;  5E3R A;  2W4P A;  4PAA A;  4IUF A;  2ADB A;  1BXN A;  3KJV B;  4PWD B;  4OX6 A;  1U2R A;  3N6N A;  1LFW A;  3IFE A;  3NCP A;  3VZH A;  1WEZ A;  1MWZ A;  4X64 F;  5KFU A;  3DLG A;  1R43 A;  6FDR A;  3JSM A;  1RAF B;  2R2U A;  1YQH A;  1E6V A;  2B5J B;  3IO1 A;  3PJ9 A;  2YXL A;  1Y9O A;  1JLQ B;  4Y34 A;  5J2N B;  3ZZO A;  1MRO B;  1RT2 B;  4ZK7 M;  2I38 A;  1WOP A;  2P5V A;  3N5F A;  4AXI A;  1DJ0 A;  3AXK A;  1VQM S;  2H5J B;  4ES1 A;  2L48 A;  4HI1 A;  3MD3 A;  1NHK L;  3HDS A;  2W9A A;  2CJK A;  1TR0 A;  2Y3Y A;  1GNK A;  2IJR A;  3KOA A;  1R31 A;  2XY6 A;  2FYX A;  4RW4 A;  4DPY A;  5L9N A;  1BQN B;  2XYP B;  4ED8 A;  1L3V A;  4ZVQ B;  1YIT S;  3BF4 A;  4LBI A;  4N56 A;  5K20 B;  1WF0 A;  3CDA A;  5D4P A;  2KXF A;  5DET A;  4OHW A;  2VJU A;  2WAQ D;  4OYP A;  5JUM A;  2CJB A;  1TQL A;  5KFF A;  4RWW A;  5LSL A;  1BY9 A;  2UXB F;  5A8K A;  4FS2 A;  4OV1 A;  2QA4 G;  1JKH A;  1PKU A;  4WK3 A;  2OPS B;  2ZBI A;  4MFB A;  1NHV A;  3I5B A;  2P6S A;  4U7U K;  1V5I B;  4RX6 A;  2AHO B;  2MDA A;  4WKY A;  3CVK A;  4TLR A;  1LKZ A;  5IOL A;  1RAO A;  3WC2 A;  4DSJ A;  3DLH A;  3Q8Q B;  3ENQ A;  1CJK B;  4AL7 A;  2W2Q P;  3JAM U;  3HHL B;  3CJT A;  1NK6 A;  3B8H A;  4FS1 A;  3MTK A;  2HLT A;  1SKU B;  3MCN A;  4CLK A;  3K8V A;  4NZ6 A;  2GVD B;  2JEG A;  3LOU A;  4C97 A;  4GC7 A;  1WUU A;  4KGV B;  3Q8P B;  4MTP A;  4ECU A;  3UVJ B;  1J27 A;  3P45 B;  2BJ1 A;  1FKP B;  2R7O A;  4ID8 A;  2JEJ A;  4Q2L A;  3W64 A;  4X4Q A;  3RGI A;  4OJ1 A;  2OLW A;  2JFD A;  3B4D A;  3P49 B;  1XK8 A;  5KOX A;  4DV3 F;  1VIS A;  4WIQ A;  5IT4 A;  1URN A;  1WNE A;  2AYE A;  2ZH1 A;  2ZWP A;  4UST A;  4DSI A;  2DY1 A;  1ZAX A;  1TKZ B;  1RB0 A;  2EXU A;  1H2T Z;  5SZT A;  3KG0 A;  8ATC B;  1RT7 B;  5MAO A;  3DDN A;  3IM9 A;  1WDD A;  2V8H A;  2HWH A;  3M2V A;  2G1H A;  5LMN J;  4RWX A;  1IKV B;  1HNV A;  1X0P A;  4P7T A;  4LFB J;  1RTJ A;  1KSP A;  3L7P A;  4R5P A;  1PAU B;  4FN5 A;  1A7G E;  4AQY J;  3I6P A;  1B0P A;  4BBY A;  1NSA A;  1YJT A;  1RAJ A;  4ILR A;  1SJQ A;  5M2R A;  1JJ2 R;  4IDK B;  5CCM A;  2KN4 A;  4K2X A;  2LEC A;  2GS8 A;  2BQ3 A;  4P72 A;  3DLK B;  4HKQ A;  2BAB A;  3PHT A;  3UI3 A;  2GX8 A;  3DXB A;  3OTO F;  1RUS A;  2NXC A;  1XNR J;  4GC6 A;  5J1P A;  3EGZ A;  2CQD A;  1Q81 T;  4AND A;  2UUB J;  3MPU B;  1KLM B;  4OYX A;  5F0W A;  1S59 A;  1VBX A;  2BMB A;  2PI4 A;  2FB0 A;  4OI1 A;  1UAW A;  2A3J A;  1GFW B;  4NXN F;  1X8D A;  2KXN B;  2RRB A;  1T9Y A;  4NOH A;  4X62 F;  3EIC A;  2Q3P A;  4GO5 X;  2VBY A;  2CQ3 A;  2J8S A;  3TW0 A;  2NUH A;  2Y1L B;  3UCG A;  3CPW R;  2NUU G;  5KFL A;  3H4D A;  2XCA A;  4PG5 A;  1UJ4 A;  5KG3 A;  3N5B A;  1IBK F;  1NU4 A;  5J2P A;  4FPR A;  3K59 A;  2C2D A;  3EPG A;  2GMJ A;  1VQP S;  2COL A;  1K47 A;  2VPZ B;  4CO3 A;  1HW9 A;  4KAI A;  4M5L A;  4IH7 A;  4ED1 A;  1UJ6 A;  4W98 A;  2NSC A;  1RT5 A;  2QC3 A;  3OSN A;  5KG1 A;  1IJF B;  1CJV A;  4NI2 B;  2RT3 A;  5F8M A;  3BH7 B;  4LR8 A;  2DHX A;  2DRD A;  5BR8 F;  1H7W A;  1ZA1 B;  2V8V A;  1S9G B;  1XBW A;  5E3P A;  3GV8 B;  3VV2 B;  3P4U B;  3IRX A;  2RKI A;  2J9E A;  2FGO A;  2FC8 A;  4QYZ K;  5GME A;  1JLE A;  1B0V A;  3OPK A;  1N6Q B;  4FPI A;  4W92 B;  4DV2 J;  1HAR A;  2JEF A;  1HMV A;  3MEK A;  3D3C J;  2HVZ A;  1NSK L;  1WDT A;  3LW5 C;  3FEX B;  1R6V A;  2UU9 F;  3GJR B;  2LQB A;  2ZH8 A;  3QT8 A;  3S01 A;  4ZDN A;  1HW8 A;  5E0O A;  3R5D A;  1FDD A;  1Z4U A;  2ZVI A;  5A6W A;  3JSR A;  1P9Q C;  2NQP A;  3A8I A;  1TFY A;  3G9C A;  3Q89 A;  4KFB A;  2AQ4 A;  1N32 J;  1K1S A;  2ZOG A;  4N41 A;  1QVF R;  3GIR A;  3R97 A;  1MMD A;  4JI5 F;  3QJL A;  1SCJ B;  4PXB A;  1TKX B;  2QGF B;  3BYP A;  3LGN A;  3I9V 9;  1GXU A;  4UQT A;  2DXE A;  4ED7 A;  3WIU A;  3MM8 B;  2WB1 D;  2ZNY A;  4ITS A;  2GHV C;  1PJ5 A;  1N54 B;  2EFQ A;  2ZDO A;  3FBB A;  2ACM A;  1RZM A;  3VAL A;  3AAW B;  5KFK A;  1S6P B;  1NDL A;  2OML A;  4X65 J;  4JP8 A;  3MEG A;  1JLB B;  2VV5 A;  2LYV A;  2UVR A;  4O4G A;  2IYG A;  4DS5 A;  3SDE A;  5ETL A;  4LQ3 A;  1W2B R;  3R6G B;  1R7I A;  2AJ2 A;  1DAR A;  3Q22 A;  3UD4 P;  3JQK A;  3MPD A;  2YPZ A;  3THP A;  5F8G A;  3CTR A;  3G8S A;  5C25 B;  2KT3 A;  2Y8W A;  4DLG A;  2DT9 A;  2IA0 A;  3C46 A;  1HL6 A;  1JLF A;  2QL7 B;  3EYZ A;  4MJK A;  3V6K A;  1M5H A;  3OBI A;  1GEH A;  3S1T A;  2KO1 A;  2YNF B;  4X84 A;  2MEW A;  1WKJ A;  4F4W A;  4Q2M A;  2H5E A;  2PC6 A;  5CYJ A;  4PZV A;  4A8S A;  3MR7 A;  1CS4 A;  3A13 A;  4E2F B;  1UCN A;  5LSO A;  2HAF A;  3L7U A;  3U02 A;  4OI4 A;  3AQP A;  4K0K F;  1FJG J;  1C0T B;  1NEE A;  1SPB P;  1FE0 A;  3JAM Y;  2F5G A;  4ZVT B;  2U2F A;  3CD0 A;  3CC7 S;  2VF3 A;  1AW0 A;  2J7U A;  4J9L A;  3ZTP A;  1YJR A;  4YEA A;  2Z2M A;  1GMW D;  1JLC B;  2XNQ A;  3R5B A;  5CYM A;  2HVH A;  1LW0 A;  3LGH A;  5C24 B;  3LP0 B;  1GX5 A;  5L8R C;  1K9M T;  2VFV A;  2KYX A;  1RTD A;  3UN3 A;  4CLW A;  2DH9 A;  6AT1 B;  1LEO A;  2GGP A;  4WFZ A;  2DGT A;  4RW8 B;  4N7T A;  1R89 A;  2AP6 A;  3T5J A;  3DHW C;  4U6P A;  1XNQ F;  1B70 B;  2D3U A;  2IVM A;  3DLL Q;  1YBT A;  5ETN A;  3IS9 A;  5D0H A;  1NZ8 A;  1KEK A;  2YNH A;  4KTQ A;  2JLE A;  2AV5 A;  3H98 A;  4K4U A;  3QAU A;  3ILO A;  4F4A A;  1PBU A;  1NKC A;  1B3T A;  3GMG A;  1NB7 A;  2AZ3 A;  3AJ1 A;  2HKE A;  4XK8 C;  1SBR A;  3DU5 A;  3KK1 A;  1J5O B;  3Q8U A;  3MCM A;  3MCS A;  1UVI A;  2ZE2 B;  5G0R A;  4ZPT R;  9RUB A;  3EVO A;  1X31 C;  4DG1 B;  4DR3 F;  1HBO B;  3SCJ E;  2KYZ A;  2MY8 A;  1BLU A;  4IOB A;  1FO1 A;  3KJV A;  4PWD A;  3LP2 B;  1Y3K A;  1TL4 A;  1T9U A;  4TLQ A;  3EPI A;  5A76 A;  1O8B A;  2JVO A;  1LXJ A;  2VG6 A;  3VVU A;  2VIH A;  3BO3 A;  4JI3 J;  1RWU A;  2ZZN A;  2GVZ A;  1DBD A;  2O01 C;  2P9G A;  1M1H A;  3M32 B;  2XS2 A;  2XYH B;  4KO0 A;  4RUC A;  2B5J A;  4M5N A;  1HNX J;  1VK3 A;  1NSQ A;  3T1A A;  4K7Q A;  1JLQ A;  5J2N A;  4WZQ A;  1RT2 A;  1DZ5 A;  4E8U A;  3LAN A;  4DL2 A;  4NYO A;  1FNO A;  2CKW A;  3AY0 A;  4BS2 A;  1BQM B;  3FCV A;  1NSP A;  2AX0 A;  2DNH A;  3TAP A;  2WVE A;  4CDI A;  3CO0 P;  5D77 A;  4KYZ A;  5KFY A;  1BQN A;  2J7W A;  4ZHR B;  1OJ4 A;  2EBE A;  3GIK A;  3JTP A;  2BM0 A;  3CJS A;  4USV A;  3KXD A;  4OZJ A;  2DR8 A;  1FFS B;  2RRN A;  4DR7 F;  4FXV A;  2ZM6 F;  1ZPW X;  5E33 A;  1LFP A;  3GON A;  1SH3 A;  5KFH A;  4KIA A;  5IV4 A;  3N01 A;  3BEG B;  1Q95 G;  1LWF B;  3FSI A;  2WSF C;  3M2R A;  1YHQ S;  4R0E A;  3GV7 B;  1XR5 A;  4JYA F;  2CQ2 A;  2CYY A;  2CDR B;  3PW7 A;  1S76 D;  5HAO A;  5D8H B;  4ED4 A;  2OPS A;  1PIE A;  4O44 B;  2JJ4 D;  1U4B A;  1H38 A;  2C3P A;  2RHS B;  4RBU A;  2DR7 A;  2XCP A;  5A0Y B;  2YQ3 A;  4WTO B;  2N3O A;  2UVV A;  1JIH A;  4ZVH A;  1CJK A;  3VAK A;  5E7O B;  1KOO A;  1U1P A;  3HHL A;  3JYT B;  5KFE A;  2J9D E;  1MWQ A;  3P6Y C;  2DNY A;  3A3O B;  3V4M A;  1SV5 B;  5AJ3 F;  2GVD A;  4UT4 A;  3T1H J;  5KT7 A;  1QUP A;  1C1C B;  2J0W A;  2MMY A;  2BOA A;  2IBO A;  4QWB A;  4DR4 J;  3UVJ A;  2XO7 A;  3OLA A;  3CCQ S;  4W90 B;  1LWE B;  4WYW A;  1T3O A;  2YX1 A;  4YME A;  2RS2 A;  2LXI A;  2F9J A;  1PYO B;  3CDB A;  4Y00 A;  4JI1 J;  4ZP7 A;  4PQU B;  1QTN B;  1WHX A;  1X7V A;  1VQK S;  2H5I B;  4CT8 A;  3CCW A;  3CED A;  3F0N A;  1O51 A;  1TKZ A;  2HQC A;  3QBC A;  2V2V A;  4HTI A;  3F41 A;  4ELV A;  4ZVS B;  1VRT B;  3TA1 A;  2BZ2 A;  1RT7 A;  1KNZ A;  3N79 A;  2AJ1 A;  1VCT A;  5HI7 A;  1U09 A;  1VMB A;  4LF1 A;  5KT5 A;  4UOC A;  1VDH A;  2OP5 A;  5B0A A;  1IKV A;  2MKJ A;  2AJF E;  3TZX A;  3BO2 A;  1UL3 A;  5HMW A;  5HMX A;  2XNR A;  3CD6 S;  2K8G A;  4AQY F;  2VPW B;  3J81 U;  2RML A;  4HH0 A;  1MML A;  4EUV A;  2YKM B;  2FTR A;  4USM A;  5GVQ A;  4IDK A;  4J9N A;  4C3M A;  2HG4 A;  4K4S A;  4MT1 A;  3O8W A;  1RA7 A;  3ZNU A;  3CD5 A;  3O3L A;  3UCZ P;  3KHH A;  3DLK A;  4EU0 A;  4DR2 J;  2RSQ A;  2E9Z A;  1G3O A;  2Y1I A;  4F7V A;  4OZL A;  3OUY B;  4M5D B;  1TV6 B;  2UXC J;  3TVZ A;  2ZBR A;  2EKY A;  2LQ9 A;  3E01 B;  1NPP A;  2UUB F;  2FLN A;  1JXE A;  1OMS A;  1F9H A;  1KLM A;  2GW8 A;  3A12 A;  2GQC A;  5KFQ A;  3OTC A;  4ZCI A;  4CNY A;  4G3I A;  3DRR B;  4AUK A;  2JLF A;  1RAD B;  4JI7 J;  4MMO A;  2UZA A;  5KFP A;  4CLY A;  4EBE A;  4X4U A;  4LSZ B;  3R2D J;  3MMB B;  3MM5 B;  2KVI A;  2RF2 B;  1DQ9 A;  1Y5N B;  2X1F A;  4LMZ A;  2IM2 A;  1WEL A;  5CYQ B;  3HZG A;  1F2G A;  2BJ3 A;  4B08 A;  4EBD A;  1UEV A;  2C3M A;  2CG8 A;  3ZZP A;  1MU2 B;  3R7N B;  3G6X A;  1RWV B;  3C2P A;  4Y0F A;  1U26 A;  4NXM J;  3MTJ A;  3T5H A;  2V6A A;  3H20 A;  1VS3 A;  5EWG A;  2A1B A;  4DQI A;  4N47 A;  4EK2 A;  1KLN A;  1XR7 A;  4DL7 A;  3EXY A;  4B02 A;  1D9F A;  3NNA A;  4KGX B;  5F3Z A;  2Q6B A;  4A8W A;  2F4V J;  5DQI A;  4NI2 A;  3NAI A;  4ZCM A;  2W9C B;  4G1I A;  3TRG A;  1N48 A;  1IBM J;  3LF0 A;  4UF4 A;  4ETX A;  2DIS A;  2IM0 A;  1S9G A;  4E0D A;  3JQM A;  1Q8I A;  4CIO A;  4BWM A;  2KM8 B;  4OZ0 A;  1U1L A;  4MAK A;  2M2B A;  4QOT A;  1N6Q A;  3B4M A;  1FHT A;  2RH3 A;  1RAG B;  4U8V A;  1XMQ J;  3R2C J;  1CQM A;  4TYB A;  2CPF A;  1CEZ A;  5HQM A;  2OO4 A;  1QDU B;  1O6X A;  3VGT A;  1VQY A;  4I69 A;  3TVY A;  2AYM A;  1FTC A;  4Y2K A;  1P9Y A;  3K5O A;  3RUB L;  2G2Y A;  2L9N A;  2GA7 A;  3DOM B;  3RBZ A;  3J7Z T;  1PG5 B;  2RU3 A;  2GHP A;  4FBU A;  3H25 A;  3V6H A;  4C3L A;  4K5R A;  1SH0 A;  3R5J B;  1TKX A;  5T41 A;  2ZZT A;  3HD2 A;  1P1T A;  3BYR A;  1UW4 A;  2JEI A;  3H5X A;  3C8Y A;  3MM8 A;  2QYG A;  1YG0 A;  5HQ8 A;  3AD9 C;  3E8O A;  5LXY A;  3DKD A;  2AT1 B;  4ECY A;  1S7H A;  1S6P A;  3ENW A;  4A46 A;  4EZ6 A;  1JLB A;  1SKR A;  1WOS A;  4LSL B;  1ZM2 A;  2HHH J;  1O5J A;  1S79 A;  2XI3 A;  3TAQ A;  1DTT B;  1VBY A;  2FJE B;  1TK8 A;  3ISZ A;  5C25 A;  1YZ6 A;  1U7L A;  4UUW A;  3AA8 A;  2CQ1 A;  4OFZ A;  4JI2 J;  2NXE A;  1YJW S;  3PXG a;  4DV5 F;  3K58 A;  5JXS A;  3PR5 B;  3CSK A;  2ZHO A;  2YNF A;  1RT1 B;  4KHM A;  2IYI A;  4C8O A;  3CUL A;  1Q5Y A;  4D3G A;  2VFT A;  3UD3 P;  1HI1 A;  3GFZ A;  1P27 B;  1C0T A;  1F5B A;  2LXU A;  3ZC4 A;  3C66 A;  2LKZ A;  4KSE B;  1DUR A;  4B3R J;  4F3M A;  3Q0A A;  3DN9 A;  1HNW J;  4JI8 F;  5A8R B;  3N28 A;  1JLC A;  2KB2 A;  1X4H A;  3RW6 A;  2ZC3 A;  4HVZ A;  2LDI A;  5C24 A;  4DUZ J;  1UMJ A;  3LP0 A;  1OYD A;  3MEE B;  4A8Q A;  2XSJ B;  1R8C A;  1CG2 A;  2Z2Z A;  2DCU B;  2H4W B;  1J2V A;  2G9O A;  2E5I A;  3ILI A;  3J7Y I;  1YRU A;  5IWA J;  1O0P A;  4RW8 A;  4C4W A;  3HVR A;  1I94 J;  2QFJ A;  1YVF A;  2OEM A;  1AB8 A;  4WII A;  2KZZ A;  3DCA A;  3G6E S;  1T7P A;  4NA1 A;  4DPT A;  4ZPB A;  1JMT A;  4F4Z A;  5ADZ A;  3MED B;  3D6F B;  3PM9 A;  4NEY A;  3EM1 A;  2F63 A;  1XN9 A;  1J5E F;  3AFG A;  3HVA A;  3LUY A;  4B3S F;  2YWW A;  4UUX A;  4F04 B;  4QZV B;  1VLY A;  1JXV A;  3J81 Y;  1L3U A;  2N82 B;  4OZN A;  1J5O A;  1N5Y B;  2ZE2 A;  3D2W A;  4OI0 A;  4O3R A;  2NYI A;  9ATC B;  5D4N A;  2KRB A;  1HR0 J;  1HBO A;  1AA1 B;  1HBU B;  2NSB A;  4X4R A;  2CAD A;  3LP2 A;  2DVI A;  1JXL A;  2G2O A;  2GO9 A;  4JBC A;  4YR2 A;  3HKW A;  3ZTS A;  1FER A;  2MZT A;  1HKA A;  1KVI A;  3F56 A;  1T05 B;  2F7V A;  3M32 A;  3UW1 A;  1VJW A;  1OWX A;  3I9Z A;  2KHD A;  3LH2 S;  3L95 X;  2Z2L A;  2HRT A;  2JX2 A;  4ZCL A;  3GV5 B;  3RRG A;  1JWW A;  1RTH B;  2E5L F;  1FEH A;  3PIP Q;  2J8A A;  3ETO A;  2KG0 A;  1TL1 B;  4Q44 A;  1LW2 B;  1BQM A;  2LMI A;  4NLG A;  4C11 B;  2ABY A;  2B9X A;  3RAM A;  2KT2 A;  3C6T B;  4XTT A;  3NMA A;  4CCH A;  4ZHR A;  4DR6 J;  2CRL A;  3KJN B;  3PO5 A;  1UKU A;  3FRY A;  3RG6 A;  4JI6 J;  1R8H A;  2DBB A;  2V0N A;  2QLX A;  2HHV A;  1LWF A;  4FVM A;  1UVM A;  3KK3 B;  4F0K A;  4PG4 A;  1X9W A;  4O44 A;  3QGI A;  5A0Y A;  2CPH A;  2UUC F;  1DRZ A;  2N7C A;  3OVS A;  2F8E X;  3TUI C;  4MK9 A;  1HD1 A;  1TKT B;  3W5Z A;  2F4F A;  2Q79 A;  4HEA 9;  5D78 A;  2EFO A;  4M5K A;  3ENA A;  2GV1 A;  1VQ7 S;  3JYT A;  2F9D A;  1S48 A;  4CO1 A;  1SV5 A;  4Y65 A;  4EGL A;  4BC7 A;  1M90 T;  3KLV A;  2M5Y A;  2UV8 A;  4FNH A;  3KUH A;  4OX9 J;  4C8Z A;  1C1C A;  4DR4 F;  4PG6 A;  3NCQ A;  1RCO B;  4QWC A;  4L3N A;  3BGF A;  3TUJ C;  3TUZ C;  1Q8B A;  1NDC A;  4C8M A;  1LWE A;  4KHP J;  4OV6 A;  2BOP A;  4J9U E;  4JI1 F;  4CT9 A;  1WHY A;  2DGO A;  5EN1 A;  1PC5 A;  4DX7 A;  4PQU A;  3QPI A;  1GH8 A;  2NPF A;  2YBV A;  3CIM A;  3EXC X;  1TEL A;  3PX0 A;  4NLD A;  2DCL A;  1NK0 A;  4WF9 Q;  4TVA B;  4R25 A;  2AJ4 A;  2H1Y A;  4DCP B;  1VRT A;  3F73 A;  3FQL A;  4NRT A;  3LO3 A;  3PG9 A;  2A6M A;  4F4Y A;  4IOC Q;  4PR6 A;  5B0C A;  1FXR A;  3GU0 A;  2F65 A;  5IT9 U;  4CLT A;  2VFS A;  3VWS A;  3FGV A;  4DQQ A;  1S9F A;  2CNO B;  2L9W A;  2DIT A;  5A8W B;  1R8P A;  4MKA A;  1N5Q A;  2K06 A;  2BEF A;  2L3M A;  1UWB B;  4H4O B;  3KMQ A;  4RNN A;  5F0U A;  3SXL A;  1VQ8 S;  2YKM A;  3IAS 9;  4MH8 A;  2H3E B;  5IXU A;  1S6U A;  5L1K A;  4DV0 F;  4ED2 A;  4RUA A;  1FA0 A;  3HFK A;  1UET A;  3NBP B;  3K2Y A;  4J9O A;  3OUY A;  4M5D A;  1TV6 A;  3GG1 A;  3T19 A;  5T14 A;  5HVF A;  4F2S A;  3RAQ A;  3E01 A;  3FZB A;  1EB0 A;  2ZWO A;  3M8R A;  3M6W A;  3BN4 A;  3T9Z A;  3KHG A;  3WDO A;  3NLC A;  5DQG A;  3A4T A;  3LP1 B;  3DRR A;  1VRU B;  1V3R A;  2VA2 A;  1WOR A;  2MZJ A;  1KFD A;  2C42 A;  2K3K A;  2WBM A;  2EFG A;  5JMN A;  3I56 S;  5ETT A;  1S57 A;  3MMB A;  1Q82 T;  2LLZ A;  3I5A A;  3MM5 A;  2HZC A;  2MY7 A;  2YPY A;  2RF2 A;  3FMB A;  2QA4 S;  2Z58 B;  4HH1 A;  4FF4 A;  5HN0 A;  2Z56 B;  4NLX A;  2HHX A;  3CJQ A;  3WIV A;  4DN9 A;  2M88 A;  3VGV A;  5CYQ A;  1Q5V A;  2WTF A;  1Y00 A;  1OPZ A;  1UA0 A;  4ALZ A;  5LJ5 Y;  3GG0 A;  1VFJ A;  5A2Q U;  4N77 A;  1MU2 A;  3D6T B;  1N5T A;  3UQS A;  2BQR A;  3UCU P;  5GAG I;  1UWA A;  5BYR A;  3EE3 A;  1Q7Y T;  2GQQ A;  2ZD1 B;  5D15 A;  3HKZ D;  2V4J B;  2CQH A;  4J9M A;  1JLA A;  2LU2 A;  1KQF B;  4YY3 F;  1YSJ A;  4BWJ A;  1XER A;  4URQ U;  1QLN A;  3TI0 A;  2FUG 9;  3H2L A;  3MUV P;  5LL6 d;  4Y3C A;  5DG7 A;  1IBL J;  3M8P B;  1MN9 A;  1TUW A;  4IR9 A;  3H59 A;  2UUA J;  5C7P A;  1FFG B;  2LEA A;  2BX6 A;  4DZD A;  4ECQ A;  5DS7 A;  3L3C A;  3J7Z 5;  2WON B;  1TL7 B;  3KLF B;  3GWC A;  1RKJ A;  2CPE A;  2QJ3 A;  4KGM A;  4QR2 A;  4DR1 J;  4QIE A;  2DGQ A;  1S0V A;  4LUB A;  1RAA B;  2OD6 A;  2AEF A;  4LF2 A;  1UFK A;  3KDN A;  4NLV A;  2PEB A;  4H4M B;  3QJP A;  1YLX A;  3HSG A;  2CPI A;  1FI4 A;  4A48 A;  2ZFH A;  4ZOS A;  2HZA A;  4LRD A;  4OYZ A;  4PPD A;  2R42 A;  3DOM A;  5HBM B;  2KXH A;  1MMN A;  1NXI A;  1U0H B;  1N36 F;  1A0O B;  3T5L A;  2MQO A;  1FEE A;  2DNR A;  1H98 A;  3JSY A;  3AD7 C;  1EQM A;  1NJZ A;  2X1G A;  4DL0 C;  3OVA A;  3EJM A;  4MFB B;  5KFT A;  3EVW A;  5EWE A;  4IG3 B;  3HFV A;  3CCZ A;  5DG8 A;  1VGY A;  2OPP B;  1YJV A;  4LSL A;  1JLG B;  5KG5 A;  1HHQ A;  3V5R A;  1QAY A;  3BGU A;  1HD0 A;  2AW0 A;  5L1I A;  3WZ0 A;  4LF4 F;  1NHU A;  1DTT A;  1U6B A;  2LA6 A;  3RB3 A;  1MG7 A;  3DRS B;  2W2M P;  1K0T A;  3D7S B;  2WB4 A;  4B3M J;  3SCI E;  5FD1 A;  1KOH A;  1FRL A;  1WHV A;  3PYE A;  1NJI T;  5FII A;  1GMU A;  2LA4 A;  3HHL C;  4LIW A;  5BXI A;  1RT1 A;  4N8N A;  4RL1 A;  1HLW A;  3RRK A;  1JK9 B;  3OL6 A;  3IWX A;  4PXC A;  2K1R B;  3AOA A;  1N34 J;  2R7R A;  4KGZ B;  3MWB A;  3BZQ A;  1X5O A;  3GII A;  4DSL A;  4CTA B;  4RO0 A;  2QZ8 A;  4DPO A;  2KFZ A;  3EVM A;  2RDD A;  1X4B A;  1U45 A;  1YJU A;  1L3S A;  2QFI A;  2G0I A;  3LQV A;  1HI0 P;  3ICL A;  3RZA A;  5HJX A;  1BE4 A;  5A8R A;  3HPO A;  2MKK A;  4EO8 A;  4QIV A;  5DRK A;  3MI7 X;  3MEE A;  2H4Y B;  2XSJ A;  2CA9 A;  4RW7 B;  5K8M A;  5GAH I;  3OXF A;  2FVR A;  3IBC B;  4RW6 B;  2MZ1 A;  5LMU J;  3W62 A;  1N33 F;  4MYT A;  2XMU A;  3PV8 A;  3DGP B;  3FCH A;  2KI2 A;  1M1G A;  5CZX A;  1I1G A;  4TKT A;  3U1L A;  1SC6 A;  2LU1 A;  2I6W A;  4NLY A;  2HPU A;  3W2V B;  4CH1 A;  5IZH A;  4QR0 A;  1RAE B;  2FJW A;  2WCX A;  4Z7C A;  5K8P A;  1RHR B;  4OX8 A;  2EVZ A;  2LCW A;  4BC9 A;  2E9T A;  2JC1 A;  3OTD A;  4ECZ A;  2VPY B;  1I51 B;  3AA9 A;  2PFD A;  3FSY A;  2EBG A;  1WTF A;  1F1B B;  1S6Q B;  3SMZ A;  4CO5 A;  3HVW A;  4YHH F;  3CDE A;  4JV5 F;  1N5Y A;  1ZOT A;  2DNM A;  2OUG A;  4P75 A;  1HBU A;  1V5V A;  4YFU A;  1RAB B;  4QPX A;  1YKW A;  3DU6 A;  2C1E B;  4JV1 A;  4QWD A;  3N6M A;  4DFP A;  2HNZ B;  1IVZ A;  3QFH A;  2VB6 A;  3B78 A;  4KKO B;  5KFX A;  2VC1 A;  3W8G A;  4B9M A;  2AGO A;  4QU6 A;  4LRA A;  4X2B A;  2XS7 A;  8RUC A;  1T05 A;  2ZKT A;  4NRU A;  1QJH A;  1RAH B;  1KP6 A;  3MFH A;  2VQE J;  2E1C A;  1GXT A;  4QWE A;  1NRK A;  4M5H A;  1RTH A;  2HK2 A;  1REV A;  2I9S A;  5ETM A;  1X9S A;  4FYX B;  1BGX T;  2BJD A;  2XWY A;  4QWA A;  2E5H A;  4OZ1 A;  3PFO A;  2YKP A;  3CJ8 A;  4TU7 A;  2HMI A;  1TL1 A;  1LW2 A;  3M05 A;  5HL7 Q;  3EMT A;  3RW7 A;  2HGM A;  2N4D A;  4C11 A;  3R7B B;  5IC6 B;  2DNG A;  3SSR A;  2YNI B;  1H2V Z;  2PT0 A;  2HGL A;  3BJY A;  3C6T A;  5F8N A;  2FVS A;  3SFU A;  5CD4 A;  3LAK A;  3ZFV A;  4ZLL A;  5LJ3 Y;  2BJ9 A;  5DZ6 A;  2IRY A;  1SL0 A;  7AT1 B;  2Q66 A;  2DRB A;  1XMO F;  5A2Q Y;  2LQ5 A;  3DC2 A;  1IM4 A;  3ILJ A;  2DHG A;  3L7O A;  3H5Y A;  2B43 A;  2MZS A;  3O1L A;  4ZPV R;  1ELO A;  3KK3 A;  4URS A;  2HRY A;  3BM7 A;  1QAJ A;  4RBV A;  1R6Y A;  3G4S S;  3HLU A;  2VG7 B;  1X5T A;  1U1O A;  4EZ9 A;  4YS2 A;  3PR4 A;  1NKB A;  4IH6 A;  4C9D A;  2ALY B;  4HLB A;  2MJN A;  3LAM A;  2V4R A;  2R7X A;  5IS2 A;  3D0H E;  1TKT A;  4K4Y A;  1U1N A;  3KKF A;  4R8U B;  2W7O A;  1NPK A;  5H9F J;  4KFB B;  3ZXW A;  2R7W A;  2I5J B;  2V2Q A;  3CJR A;  4AD6 A;  4W4M A;  3GYN A;  5KTQ A;  3BPD A;  4WXO A;  4DMZ A;  1ZPV A;  2DJW A;  5C5J A;  2FLL A;  1RXO B;  3KMS A;  3HP6 A;  4AFF A;  3ZZY A;  4YDD B;  2O1P A;  5I3U B;  4J90 A;  4M5G A;  2EFV A;  3GP9 A;  3R3T A;  2ZZM A;  2IJF A;  2B51 A;  5G4D A;  1WEX A;  3US5 A;  3R7S B;  1ZTW A;  3CXC R;  2FDN A;  1MLA A;  1IBC B;  4LFA J;  1VRQ C;  5ETS A;  3T3F A;  4EEY A;  2DR9 A;  1HFE L;  3BO4 A;  3JQJ A;  3D6M B;  1L3K A;  4NZ7 A;  1S0M A;  1Q78 A;  4OHZ A;  1K44 A;  5A8W A;  1QSY A;  2VL1 A;  4YOE A;  1UWB A;  4H4O A;  4LR9 A;  1QUV A;  3HT0 A;  1U25 A;  4X4T A;  4RLE A;  1RBA A;  4L72 B;  3L09 A;  3CUN A;  5ETV A;  5KFJ A;  3VAG A;  2W01 A;  1VQL S;  1RWP B;  3K5P A;  2IM3 A;  1M5O C;  2OKQ A;  5EHH A;  2BAC A;  2BM1 A;  3GB0 A;  3NBP A;  4DFK A;  3T1Y J;  1M5P C;  2W9B B;  4IFV B;  4S0M A;  1I6J A;  3I0R B;  3AH6 A;  4LF8 J;  5GMD A;  5IC4 B;  4NYZ A;  4L76 A;  2BA9 A;  1LW0 B;  2DXF A;  1PO6 A;  3LP1 A;  1H7X A;  3PY8 A;  4NLR A;  2MPU A;  4LBH A;  2VDH A;  4A47 A;  4XPC A;  4LBP A;  3PYF A;  1CUL B;  1FNX H;  2VJV A;  2X51 A;  2DYA A;  2XEX A;  2NS1 B;  4X66 J;  1R0A B;  2MLY A;  4HL9 A;  3W9H A;  1U8S A;  1RA6 A;  2JLG A;  3HVT B;  4GO7 X;  3CJ3 A;  4GRS A;  2V50 A;  3QSI A;  4L74 A;  2CVI A;  2NXU A;  2FY8 A;  4IR1 A;  3FRZ A;  1W7W A;  2XO6 A;  5KFC A;  1FDA A;  2VKZ G;  3PO4 A;  4NE9 C;  3PJW A;  2HWI A;  2ZD1 A;  4O4R A;  2V4J A;  3V6D B;  4JI4 J;  4KV8 B;  3CCV S;  2J9C A;  3KHR A;  2DY9 A;  4A8F A;  3UD5 A;  2I0X A;  2R8H A;  2Y0B B;  1RK8 A;  2SXL A;  4F36 A;  3CT9 A;  1KTQ A;  5C42 B;  3MMA B;  4CLS A;  2ZJQ Q;  3KG1 A;  3M8P A;  1YRT A;  2HBQ B;  1M5K C;  3QFW A;  1TAU A;  3BPS P;  1YWX A;  1D8Z A;  3LAL A;  1TUG B;  4YDX A;  2OEL A;  3HO1 A;  7FDR A;  4PXE A;  1NH8 A;  3QAT A;  2VG6 B;  2DNQ A;  2DO0 A;  5LM7 E;  4DV4 F;  4WCE Q;  5ITH A;  3I96 A;  2GVZ B;  1TL7 A;  2WON A;  3KLF A;  3OTB A;  4DQR A;  4KO0 B;  3DDI A;  1SJ4 P;  5KFI A;  3ELH A;  3HCX A;  4LF5 J;  3FKB A;  4K50 A;  4OX7 A;  4FKX A;  4F0M A;  2MB0 B;  1EHW A;  5DM7 Q;  2MST A;  4GKK J;  4YB7 A;  4B3T J;  3AHP A;  1T02 A;  2YX4 A;  4H4M A;  1RYR A;  1KQG B;  1VIX A;  2DH8 A;  1S6O A;  1TK5 A;  1MWY A;  1Z2Z A;  3G2X A;  3PYG A;  1JQG A;  1HWK A;  3MF5 A;  2Q1L A;  2JH3 A;  2CJ9 A;  5HBM A;  2J0X A;  2CIM A;  3B6B A;  1U0H A;  2CG4 A;  2OEJ A;  4B9U A;  3NGK A;  2OD4 A;  2OIH A;  5I42 B;  4A8X A;  4GMK A;  5K9F A;  2QN6 B;  2DHA A;  5CD4 H;  1W2I A;  4HT7 A;  1VLO A;  5KFD A;  3M2R B;  4PCQ A;  2KFY A;  2KFN A;  4ZPA A;  4K4T A;  3CD7 A;  2WVB A;  3EX7 B;  3QRR A;  4C3K A;  2PGC A;  2HBZ B;  4IG3 A;  1QM9 A;  2FD2 A;  2OPP A;  4GVL A;  1VC5 A;  1KRP A;  1JLG A;  2I1R A;  3CJ5 A;  1HIY A;  1HQU B;  2ZH7 A;  5KT4 A;  2CNK B;  1D9D A;  4UQG A;  3EGW B;  4C2M A;  2BVZ A;  2NYH A;  4AE5 A;  4KR0 B;  3W63 A;  2HS3 A;  3P3D A;  4F67 A;  4DU8 A;  1WC6 A;  4CNZ A;  4F25 A;  1RLC L;  4OIX A;  2CWX A;  3DRS A;  4M1K A;  2FPH X;  2Y9H A;  4TNO A;  3OV7 A;  1K0V A;  2YKA A;  4C8L A;  3PKM A;  4DF8 A;  3OHB A;  5B0E A;  1HNZ F;  1CJU B;  1SJR A;  1TP7 A;  3VAI A;  4G65 A;  1EZZ B;  2OI2 A;  4JI0 F;  5J1N A;  4UZB A;  2ZBC A;  2J9D A;  1U1K A;  2IDE A;  2K1R A;  4LF7 F;  1XTZ A;  4B9V A;  1UEU A;  2AMC B;  2PI5 A;  2C3Y A;  4CTA A;  2D74 B;  3MM9 B;  4NLS A;  2W2P P;  1M1K T;  3MOZ A;  2HIY A;  1GMV A;  1CJT B;  3GIM A;  2B56 A;  4F02 A;  3MD1 A;  2AIR B;  4XDD A;  2AZ1 A;  2ZIT A;  5AXM A;  5AXK A;  1XQI A;  3CO9 A;  1TL3 B;  2CJQ A;  4YN3 B;  4K4X A;  2ZEJ A;  3M9M B;  1S1U B;  2EI5 A;  3TAM B;  4USK A;  2UXD F;  1B64 A;  4DUY J;  4RW7 A;  4K5S A;  1RLD A;  3RAX A;  3OLB A;  5B7W A;  4RW6 A;  3W1Y C;  2YWF A;  1H2U X;  5AE1 A;  2FLO A;  3DGP A;  4J7C A;  2L08 A;  4NL5 A;  1EKS A;  3BSN A;  3M6U A;  2ZVS A;  3MGJ A;  4FF3 A;  2RB7 A;  2CZV C;  1XC9 A;  2R2T A;  2FHJ D;  3W2V A;  4DXL A;  2DXD A;  4P2S A;  4Q45 A;  4XO0 A;  4DX8 H;  5L39 A;  3QRQ A;  2PMH A;  3FEZ A;  3TZW A;  1FJC A;  3ZTO A;  4MK8 A;  2BQU A;  1Y10 A;  1QAX A;  5B09 A;  5DDO C;  2E5J A;  4NEZ A;  1RI7 A;  1U1R A;  1IR0 A;  1FXD A;  2MSS A;  1HBM B;  2LEP A;  4KPC A;  1VHI A;  4X64 J;  4RU9 A;  1S6Q A;  2XTJ P;  1EX8 A;  3DDK A;  1BC6 A;  4KE5 A;  3U27 A;  3QJJ A;  5E3Q A;  1JNR B;  3DI6 B;  2OPR B;  3H5U A;  2GAG C;  5KFB A;  1NKE A;  4U67 Q;  3HHD A;  1FWL A;  5GAD U;  1RAC B;  3M1V B;  2A18 A;  3SV3 A;  1DTQ A;  5K5M A;  1RP5 A;  5DG9 A;  1S1T B;  4B9S A;  4DX6 A;  3GIJ A;  2HNZ A;  1VQ4 S;  2IIH A;  4LF9 F;  1LK5 A;  4KKO A;  3PEH A;  4ZIW A;  3HHL D;  4WWS A;  2V94 A;  2IVY A;  5HVH A;  1PSD A;  4RNO A;  3CMA S;  2L9D A;  2GCF A;  3GJT B;  4WZM A;  4WKR A;  4TU9 A;  4DV1 F;  3IR5 B;  2C2Z B;  3M9N B;  3DOL B;  5DDP C;  1S77 D;  4GKJ F;  4WPA A;  2O67 A;  3BV8 A;  1KD1 T;  2IVF B;  1E6Y B;  3CNQ P;  2LP4 A;  3JXO A;  1FK9 B;  3MEC B;  2R9L A;  5B08 A;  2E5G A;  4IYQ A;  2XZT B;  3OFF A;  2OHD A;  2PN6 A;  2YNI A;  2E9R X;  2UXB J;  3M8Q B;  4QR1 A;  4P2M A;  3WHI A;  3CJ0 A;  2E29 A;  4DV7 F;  1TKD A;  1L5U A;  2W2O P;  1Y7P A;  4OYB A;  3BQ0 A;  1NK7 A;  2DNL A;  1WTB A;  2JHE A;  2AJ0 A;  5ETR A;  2MKI A;  1IKW B;  3JSB A;  1UTA A;  1KVK A;  1NB2 A;  1S97 A;  1TU0 B;  2C2E A;  3EZO A;  2KM8 C;  1PYS B;  2QRR A;  3MR5 A;  4P2X A;  8AT1 B;  2FC9 A;  2RIL A;  3M9O B;  2VG7 A;  5IM0 A;  4YQW A;  4AL6 A;  3HZE A;  4ZS6 A;  2ZOF A;  3OXL A;  2GJ2 A;  3CMQ A;  2GJI A;  2WVC A;  1WC5 A;  2NZC A;  1L3T A;  4R8U A;  2DGU A;  2I5J A;  1WKK A;  2D9P A;  5MLC V;  3C19 A;  2ERR A;  4ZA1 A;  4OYA A;  2NXN A;  5KFZ A;  4I7F B;  4DV3 J;  2ZJR Q;  1XMB A;  1ZM3 A;  2PII A;  2QA1 A;  4ED5 A;  2KKH A;  5HVG A;  4FYY B;  1WC4 A;  2DEJ A;  2W24 A;  5I3U A;  2PO4 A;  3FMW A;  1G6B A;  2GML A;  2OPQ B;  4M5M A;  4P9S A;  2CJY B;  2BV3 A;  2ZKU A;  4PRF A;  4M5J A;  3BR9 A;  2RQ4 A;  5KG6 A;  4TY8 B;  2MXY A;  2JOQ A;  4UW2 A;  2R4F A;  2GHW A;  3SSS A;  1JJH A;  3ISN D;  2BJE A;  4I6A A;  3NCR A;  5T7L B;  4MIW A;  1GK8 A;  1HWI A;  3MR6 A;  1SH2 A;  1WC3 A;  3OW2 R;  4F26 A;  5DLF A;  4OHV A;  3BR8 A;  3FNN A;  1XIQ A;  3JB9 k;  4IQM A;  3KFW X;  2BE7 D;  1LV5 A;  5DQH A;  4WFX A;  3OTO J;  4G6V B;  3W65 A;  3OSP A;  5B0B A;  2LDY A;  2VHG A;  3U1N A;  2ZH2 A;  2CUY A;  4O23 A;  3QT6 A;  2AGP A;  4DL3 A;  1FX2 A;  2WRM A;  2C2K B;  2VPX B;  4ETZ A;  4K59 A;  3KNG A;  3KG4 A;  2V68 A;  4CM0 A;  2KH9 A;  4NLT A;  3R6L B;  2W9B A;  3NY0 A;  3G8T A;  4IFV A;  2G2Z A;  2MQQ A;  5L46 A;  4NXN J;  3I0R A;  3SCL E;  2XY5 A;  3C14 A;  4A4J A;  1S1W A; 
#chains in the Genus database with same CATH homology
 4KY3 A;  1IBL J;  4LF5 J;  3J7A N;  4PWW A;  1XMQ J;  4X62 J;  2UUC J;  4DUY J;  4DV6 J;  3T1H J;  3R2C J;  2KVQ E;  4HHU A;  4YHH J;  1HNZ J;  4JV5 J;  1FJG J;  4DR3 J;  4JI2 J;  4DR7 J;  2KL8 A;  4NXM J;  4DR4 J;  3W1Y C;  2UUA J;  4JI0 J;  4KYZ A;  5IWA J;  4GKK J;  1XMO J;  2MTL A;  4B3T J;  2ZM6 J;  2E5L J;  4DR2 J;  4DV1 J;  1I94 J;  4DR5 J;  4LF7 J;  4X65 J;  2UU9 J;  5LMN J;  2UXC J;  5IT9 U;  4JI4 J;  4LF4 J;  4GKJ J;  3T1Y J;  4JI1 J;  4JYA J;  4LFB J;  3JAM U;  1J5E J;  1IBK J;  4DV2 J;  4DV0 J;  4B3S J;  3D3C J;  1N33 J;  4DR1 J;  4LF8 J;  4AQY J;  2F4V J;  4NEY A;  4V1A k;  1IBM J;  3OTO J;  4DV7 J;  4JI8 J;  3J80 U;  1XNQ J;  4DV4 J;  5A2Q U;  4LFA J;  4YY3 J;  4OX9 J;  4DV3 J;  5LMU J;  4JI5 J;  4JI7 J;  4NEZ A;  2VQF J;  4JI3 J;  4B3M J;  1N36 J;  3D3B J;  4RJV A;  4B3R J;  5FLX U;  1N32 J;  3R2D J;  4KHP J;  2UXB J;  1HNX J;  1HNW J;  4X64 J;  2MEW A;  3IMQ J;  1XNR J;  5AJ3 J;  4LFC J;  5LM7 E;  2UXD J;  4DR6 J;  5BR8 J;  2HHH J;  2VQE J;  1HR0 J;  4K0K J;  4LF6 J;  2MQ8 A;  2UUB J;  4DUZ J;  4X66 J;  4LF9 J;  4NXN J;  4JI6 J;  3J81 U;  1N34 J;  4DV5 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...