4X65J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4x65J00
2KVQE 3T1HJ 4OX9J 1HNZJ 2HHHJ 4KY3A 4DV2J 2UXBJ 4JI0J 4DV3J 4DR4J 4NEZA 3OTOJ 5A2QU 2KL8A 4DUZJ 2MQ8A 2UUCJ 4JI5J 5LMNJ 4K0KJ 4X64J 2F4VJ 1XNQJ 4DR6J 1IBKJ 4JI3J 3J7AN 4KYZA 2UXDJ 4DR2J 4LF9J 3J81U 2VQEJ 1HNXJ 4LF5J 4X66J 4DUYJ 4LF8J 1XMQJ 3IMQJ 1N34J 3R2CJ 4JI8J 4LF7J 4JYAJ 2UUBJ 5IT9U 4B3SJ 1J5EJ 4YHHJ 4LFAJ 2MEWA 3W1YC 1HR0J 3T1YJ 4DR1J 2UUAJ 4DR3J 4JI2J 1N32J 4V1Ak 1XMOJ 1N36J 5BR8J 4JV5J 3J80U 2UU9J 4DR5J 3R2DJ 1FJGJ 2ZM6J 4GKKJ 4DV4J 4JI7J 4HHUA 5FLXU 4DV0J 3D3CJ 1IBMJ 1HNWJ 5AJ3J 4DV5J 2E5LJ 3D3BJ 4DV6J 4KHPJ 1N33J 4JI6J 2UXCJ 2VQFJ 4LF4J 1XNRJ 5LMUJ 2MTLA 4X62J 4NXMJ 4JI4J 4B3RJ 4PWWA 4RJVA 1I94J 4YY3J 4B3TJ 1IBLJ 4DR7J 4NXNJ 4AQYJ 4JI1J 4LFBJ 4LFCJ 4B3MJ 5IWAJ 4X65J 4DV7J 4GKJJ 4DV1J 4LF6J 4NEYA 5LM7E 3JAMU
chains in the Genus database with same CATH superfamily
4MIWA 4Q44A 2IVMA 3D0HE 3TAMB 1HNVB 2HHPA 4WKYA 1JLEB 1E6YA 1M90T 2MZJA 1D1UA 4PUOB 4NCGA 4KR0B 2CJBA 2BUNA 4J9RA 2YPZA 3JTNA 1IBKJ 4JI3J 4MIBA 3MMCA 2CA9A 3N6MA 3S7RA 4CTAA 4KTQA 4MMOA 3X1LB 3MEGA 3CJ2A 1U48A 4GVBB 4YS2A 2M7SA 2QLJB 1HWIA 3ELHA 3NOGA 5DM6Q 3CC4S 2XMJA 4M5NA 1WORA 2MQLA 1E6YB 1U25A 4F0KA 2VC0A 3W63A 3DNCA 2XMWA 1LWEA 4DR7F 4QW8A 1G3OA 1R3NA 3MMCB 2POKA 5H9EK 2F1FA 3PDNA 1U0SA 4AQYJ 4B9MA 2N3LA 1OYEA 3MEGB 4C97A 1HNZJ 1T11A 1QVGR 3W2WB 3KG1A 4RW4A 1YK9A 4Y2AA 5CH7B 1VBZA 1B7YB 1VBXA 4NZ7A 1JLQB 2WVFA 3FNNA 2NPFA 2DHXA 2B51A 2MXYA 5KFGA 4Q7AA 2VQEJ 1S97A 5F8LA 3K59A 1LWEB 4DF4A 3QJJA 3V2UC 2J6TA 1PSDA 3EM1A 4OYBA 3U7JA 1S76D 5F0WA 1V3ZA 5HATA 1SI9A 1YJVA 2LA6A 1FO1A 4K7QA 2D3O1 3H4BA 4ZVEA 3RGIA 1FI4A 5I3QA 1XR6A 4FPIA 4FYVB 3MD1A 4QZVB 4RW4B 5J1EB 2OIHA 2B7BB 2Z58B 5JJBA 2QGFB 4ECVA 5C25A 5DJBA 3VV2B 1P1LA 1CJTA 1QAYA 3OTOF 1SJ4P 1DTTB 2KJVA 4Q5VA 4OL8A 3MECA 2QRRA 1O8BA 3KJQB 5LXYA 3MUVP 3W61A 1ZAWA 1H2TZ 4LF2A 2XS5A 3HHNB 2GVZB 2LA4A 4I7FA 2NXJA 3Q24A 4B3SF 3HSZA 4C8OA 1DARA 2MSSA 5IT9Y 3W66A 4UW2A 2HFOA 4OYWA 2GHWA 1N54B 4DPXA 3NP5A 3NS7B 7FD1A 1UFKA 5C25B 2ZUGA 3ZNUA 1U1LA 1FCAA 2MMYA 2G2YA 3NGKA 2HG4A 4JV5J 3GG0A 1KNZA 2F7VA 3UQSA 2B6AB 5A6PA 3PNIA 2CQ4A 1QDUB 2N3OA 2NZ4A 4HHHA 1TKDA 4IFYB 4I7FB 2MZTA 1VQ4S 1MWYA 4NI2A 4BS2A 4KB7A 4QQBA 5FJ4A 1NM2A 1C1BA 3K2YA 1UA0A 1TZ0A 4EFAC 2M0GB 2QG9B 2C3OA 2ZHBA 4K5SA 1RWUA 4UUWA 2HHHJ 3WBZA 4HACA 1PBUA 2XGPA 1RTHA 2HEKA 2R7RA 4W4MA 4NLQA 3C2PA 2ILZA 1N5YA 1F5CA 1FDBA 2J7WA 4ELTA 3J7AN 3SQGB 4AYBD 1HI0P 4KPYA 5HVGA 2G13A 4J9UE 1WKKA 3MPUB 1XMQJ 4QIWD 4NI2B 4OJ1A 1SVDA 3BBBA 1C1BB 2KVIA 1Y9OA 3RU0A 1FEHA 3E8OA 4PXEA 2QLBB 2E9TA 4HACB 3A8IA 2ZOFA 2RHQB 2ZZTA 4C8NA 5ETLA 1XMBA 2XMMA 1FJ7A 1VOMA 4ZPWR 1N5YB 2YWEA 5A6WA 4ZN3A 4C0BA 5HO4A 2GAHC 3MEDA 4UOHA 2DYAA 1LWFA 1QAJA 3NCRA 1JJCB 1WD6A 3HHEA 4CLZA 3M6WA 4WPAA 2CJKA 2VU5A 3QO9A 3FUYA 4U8YA 2R7UA 3OSNA 4DPYA 4DV3J 3Q23A 3A3OB 5D15A 4JV5F 2XZWA 4DLGA 4RR5A 4DFKA 2F4VJ 3T6BA 3EYZA 4EBEA 2Z2LA 4YMEA 2PI4A 2FZGB 1REVA 5LJ5Y 2YX1A 2HHTA 3BGRA 2YNHA 3DFEA 2DHGA 2NPIA 1ZM4A 5KG4A 1LWFB 2DRAA 5I42B 3PO5A 2CQGA 2AYBA 2ATCB 1G1XA 2U1AA 3L9ZA 3QO9B 1U47A 3PJWA 4D3GA 4M5IA 5JMNA 2E5IA 2YWFA 4HH0A 2HHHF 2YH1A 4DCPB 2GGPA 3HT3A 2IJRA 5AJ3J 1H38A 4YY3F 3P96A 3GFHA 3BYRA 4FXDA 2HNZA 1XNRJ 1MMLA 3Q2TC 1O6XA 1REVB 2GNKA 3BGRB 3G6YA 1TQLA 2GJIA 4IYQA 1U45A 3LF0A 4ZCIA 1VDHA 3PVXA 4ZP6A 3OV7A 2YWGA 3T1AA 2UZAA 4DV2J 4ID8A 4ES1A 2YPYA 4IH5A 3V6HA 3OL6A 2YXLA 5JXSA 2R7WA 1PILA 2BW7A 1RHQB 3JQKA 1OSCA 5AE3A 3ZTPA 2XYPB 1DRZA 1RP5A 3MPDA 2V4JA 4ATNA 4CO1A 3TA0A 2HNZB 4Y28C 3NMRA 4DLEA 4DSEA 2CNOB 2BEFA 4R5PA 2M70A 1FRXA 4F4YA 4JV0A 2JSXA 2ZHOA 1YJRA 4UZBA 2RD5C 2UUTA 3N28A 1D09B 4K4TA 4DV3F 3CJTA 5E0OA 5F41A 3CCSS 1HWUA 3QZ8A 2F4VF 1EARA 2DXFA 2DR5A 2RVJA 3AOCA 5B0FA 1UZDA 1F3FA 1YSJA 1KVJA 5IWAJ 1VJWA 2FHJA 2IDLA 3OVAA 1AFJA 2L9WA 5ETMA 3MUTP 2ZBQA 2FVSA 3SV4A 2H4WB 1ZBTA 1YZ6A 5HL7Q 5HJXA 5KT4A 1PYTA 2B9WA 4DX7A 1ELOA 2PIIA 1KN6A 2VDHA 1WG5A 4A46A 2KZMA 3CW2C 3CMES 4ILRA 4RUBA 3HCXA 5A8KB 1DTQA 4K2XA 5JVGQ 1N32F 3R2CJ 2J76E 4LRCA 2VPZB 1YGYA 2EXUA 3N6NA 3I32A 1H6KX 4QR1A 1RT1B 2K7KA 1XMOJ 2XWYA 1TUWA 1NB7A 2BM0A 3AA8A 1NHVA 5ETSA 2PGCA 4L72B 2IBOA 1SJ3P 2V8GA 4DV2F 1WI8A 1T05A 3KLFB 3KHLA 3H42A 1TVRA 4NPOA 2ROPA 1ZTTA 2W9BB 2J5AA 1JJ2R 1DTQB 2DO4A 3CGIA 5ETNA 1S4FA 3HZGA 1F5AA 2HHXA 2ZH5A 5MLCV 4IDKA 4KC5A 3J7Z5 5G0RA 3UDLA 5L8RC 4PPDA 2BE2A 1GX6A 4JV2A 2AD9A 2XHWA 3PO4A 4DQQA 4LR7A 2H3EB 4A8YA 2LFVA 3D66A 3MWBA 1TVRB 2GJFA 2DIUA 2B4PA 3SBMA 3JYTB 1RSCA 1RHRB 3KHGA 3PTWA 4WXOA 1LNQA 1GAOA 3P4UB 1ULRA 4M1KA 3FQKA 3B82A 2O5DA 3SXLA 2CFXA 4ZP8A 3TOQA 2K8GA 3M8ZA 1KLNA 1EIYB 4KV8A 4IDKB 2DGOA 3DXSX 1B99A 2BR0A 5G0RB 3AQPA 4UTGA 9ATCB 3Q86A 2BE2B 1BQMA 2WSCC 3CJRA 1T9VA 3PG9A 1YX2A 2MB0B 3VAFA 3LPYA 4DX5A 2BZ2A 2LEAA 2YQ0A 2DGSA 2X51A 5MAOA 2GAGC 4N47A 5C2CA 4ZLJA 3OTEA 3C6UB 1NKBA 1RYSA 5KFXA 1HBMA 1OO0B 3HFZB 1JLCB 5HP1A 1R6YA 3GLJA 4LSLA 3IXQA 4DQRA 4PQAA 1S9EA 3OVBA 1OY8A 2PMWA 2AJQA 5EHHA 2RUSA 4OV6A 4K0KJ 4KV8B 4HVZA 1JXLA 3POTA 2WVEA 3IAS9 5KG5A 2NXEA 5ITHA 3HVRA 3CDBA 3DLJA 4O4GA 1Y10A 4ZPTR 2HK3A 3BS9A 4U9RA 4RNFA 4FP9A 1JXVA 1HBMB 5HP1B 2C3MA 1N48A 2XYGB 1ITPA 3VCDA 1S9EB 4ED0A 4LRAA 3KK2A 1HW9A 4HH1A 1RXOB 2IYIA 1HWLA 3AAWB 2VPXB 1S49A 3MDFA 3POTB 2G2ZA 4IG3A 4HHJA 4A47A 2W4CA 2ZJRQ 2RNEA 5D3GA 2OMOA 3EVMA 2UXBF 4MK7A 2FY1A 4HEA9 4KFBB 1HBUA 4ZCMA 3JAMU 2YKOA 4E0DA 5HN0A 4NEZA 4WIQA 3CC2S 4CH7A 4J9NA 2HZCA 2MQ8A 5F8JA 2OPSA 2G1HA 3KK2B 4QPXA 2ZD1A 1FNXH 2R7TA 2VFSA 3OR1B 4WK1A 4TYAA 2VONA 3J7ZT 1D8YA 2BQ3A 2JFKA 2V63A 4X4VA 4IG3B 2KZZA 3QSIA 1FJGF 5LT5A 1KVIA 2W2OP 3G87A 2M4MA 4JI2J 1NJZA 1HBUB 2MZSA 1RT6A 1PAEX 3HHLD 1C0TB 4ZP7A 3VGSA 2DO0A 3BSAA 4Q2LA 2OGUA 4WBFA 3MTKA 1F9HA 3PR4A 2FUG9 2OPSB 3TZZA 2E5JA 1NPKA 4LSZB 1LQ9A 1U0HA 5IQ6A 1KLMB 3H8YA 2ZD1B 1G2EA 4CLWA 1UEVA 4LRBA 3KLGA 4IR9A 3AD7C 2C2OB 1RADB 1NSPA 2P9EA 2BJ9A 1K73T 2Q6CA 2QA4G 2R42A 4NXNJ 3MR7A 2CQ2A 4LFBJ 3QIDA 2JC0A 3KDOA 1I3OB 1YKWA 2DXEA 1RWOB 1T9YA 5HLFA 1YIJS 2EWHA 5ETVA 1RT6B 1HNXF 1W2BR 2DNZA 4Y2IA 1F2GA 3I82A 2R2RA 4UQTA 2VBWA 2LU1A 4Y6IA 4ZJQA 2DR9A 1VC6A 3FEXB 4ZITA 2BOPA 2ASDA 3GU0A 2PC6A 4J37A 1U0HB 2XYHB 2XCPA 5KFYA 3SYZA 3QRPA 1VMBA 2W4DA 3KLGB 2HQFA 2YH0A 5D4NA 3TEHB 4YHHJ 1OS5A 2Z56B 3OBIA 2CPDA 3GR1A 2J9CA 4Y34A 2FJWA 1AXQA 2JLEA 3RTVA 1A7GE 3CMQA 1WC0A 1X5SA 1CEZA 3PX4A 4X62F 5IZHA 4QBUA 1L5UA 4USMA 1Y5NB 4OHZA 5HMXA 2NLWA 1NO8A 4OQJA 3PW0A 1Q8IA 3BSOA 4GVLA 2W25A 2VZ9A 2P6SA 2AW0A 4AXIA 3IWXA 4KSEB 2J0WA 1J2VA 1NK5A 4NCBA 1S5ZA 3IGVA 4N8NA 1X4GA 3SDEA 2OP5A 4USTA 2C22A 3W9HA 4LF9F 3KLEB 5C24A 3BBFA 1G6BA 3EE3A 4KGKA 3TZWA 1FDNA 2CXEA 2FJBB 2F4FA 1FDDA 3FCVA 4DR2J 3OXFA 2VG6A 3UDEA 1RK8A 1VQ6S 1JNZB 2DVIA 3P6YC 2F8EX 2XEXA 3P5TL 2N4CA 4LFBF 2F65A 1VRTA 4KKOA 4ERDA 5G4DA 1LEOA 4RWXA 2I0XA 3LP1B 3EGWB 3SDEB 3VAIA 3KHRA 3PHTA 1YJTA 3M6VA 3AY0A 4DSJA 3LANA 4JI1F 4LIRA 3W9JA 3JSRA 3CD0A 3MZIA 1YLXA 2HFUA 2VG6B 5KT2A 4K59A 2BQRA 1HL6A 1RLCL 2V68A 5LMNF 4Y2MA 5J1PA 4ZS6A 5KG2A 1PC4A 4FNHA 2AP6A 1VRTB 5KFHA 4KKOB 2YX7A 4RW6B 2ZKTA 2FVPA 2CJQA 4ANDA 3VF0B 3EWGA 2VASA 4P2SA 3PM9A 4DFPA 8RUCA 3HD2A 2VF3A 3G71S 1Q78A 2CWXA 1B3TA 3GWCA 3BQ2A 4ZVTB 1VHFA 5ETQA 1J5OA 2QLFB 4ECZA 2CWKA 4H4KC 1JLFB 4O0IA 2E5LF 4OJ3A 3NGDA 2DGXA 5FLXU 4RNOA 5LL6d 1OQ6A 3O2IA 3JSYA 3DRSB 3TAQA 4YUDA 1X4FA 5KFTA 2RDJA 1WDDA 3I0RA 5DG9A 1N88A 3M2UB 3MR2A 4KBIA 4DR2F 1FWLA 2VJVA 4QOTA 1N6QA 3MM7A 1D9AA 3TP2A 5THWA 4ZVGA 2KXFA 4WIIA 5LM7E 4R0EA 1VQSA 2NYHA 3AFGA 3QZ7A 1TV6A 3CCUS 3CJ4A 2LXIA 3RR8A 1YBUA 2G2OA 4JI5J 3I31A 1H73A 3BBCA 4KH0B 4F3OA 1C1CB 2W2QP 3B4DA 4OHXA 4AL5A 4LFAF 1NRKA 4NMLA 4DQSA 3SCIE 3EGVA 1EETB 1L3UA 2CG8A 4M94A 4C3MA 4ETXA 2HVDA 4PAAA 3CB4A 2QFIA 2GIFA 3U02A 1T9UA 1FE4A 5KOXA 3K5PA 2EKNA 1IBMJ 3TARA 5BYQA 2LQ9A 3AB2B 3GG1A 1DFDA 1VQNS 1SC4B 1DAXA 1S4EA 1VGYA 3E51A 3D6TB 4PG6A 1Q0NA 4A4JA 4EO6A 3C16A 2RJZA 2DNYA 5KFCA 2OH2A 2J6SA 2E7VA 5B0BA 1IKVA 2XZDB 1PYOB 3NOCA 3CWJA 2WVCA 2B9EA 1MROB 4WP9A 3EPGA 3BR8A 2M8DB 1RTZA 2RKIA 3R5CA 4OYAA 4QU6A 4UOGA 4NLSA 1H3DA 2CUYA 2ILYA 4C2MA 1CC7A 2VUGA 1HBNA 3W1YC 3C16B 3AJDA 2ADBA 1IM4A 1DURA 4BWJA 1HYSA 2FHOB 2ZH2A 4C8ZA 4E2FB 4CLUA 1IKVB 2ZH1A 2G0JA 2IM3A 1NXIA 3TRGA 1Q7LB 1PC5A 1DZ5A 1NU4A 1N33J 9RUBA 1BGXT 2RKIB 3J7YU 3RRHA 2JJ4D 4NWBA 1OPIA 4OI2A 1RB0A 4ECWA 2MLYA 2QSWA 2HVHA 4DHVA 1T9XA 2UUWA 4OIXA 4IOCQ 2QFJA 2BJ8A 1F9FA 1SC1B 5IV4A 3KLIB 3IMQJ 3ITHA 3A3PB 4K4ZA 4OYMA 2ZM6F 1M0SA 1CS4A 5IFMA 3UNYA 4RL1A 3J7YI 2KTQA 3MM5A 1QM9A 4LUBA 3OL8A 2B8QA 1TL1A 1Q8BA 2OPRA 2FHMA 2BJ3A 2ASJA 1YHQS 2JVOA 4B3TF 3VHQA 3BH7B 2ROGA 3VGVA 3WIUA 1BQNA 2CDQA 3N0VA 3CIZA 3QAEA 3WIVA 3CCVS 2DRBA 3TQEA 3R6GB 2FC8A 1RCOB 3QIPA 4GC7A 4X65J 3QT8A 1ROFA 2YKNB 1CS4B 3GFZA 3DLLQ 3MFIA 3MM5B 2YVSA 1FD2A 3H90A 4U8VA 1RA7A 2WOMA 1TL1B 4LF8F 2CQHA 4ECRA 4FF4A 1WOOA 1HI1A 4MKAA 5I3UA 3KUGA 4ALZA 4NRUA 4F25A 5DZ7A 4TQRA 2ZZMA 1BQNB 5H9FK 4WE1B 5DDPC 2UVUA 2Q43A 3R7BB 4JOUA 3TUJC 1X0PA 2Y9HA 3MGJA 4DR3J 4WJBA 2I6WA 4YDXA 1H74A 4NASA 1TL3A 2CJXB 3I56S 5RUBA 3CCRS 3MCNA 2A10A 1WF1A 2K1RA 2YTCA 2MPUA 4F0MA 1RAJA 3G86A 1RT7B 1DY3A 4MH8A 4ZPBA 2VQFJ 3SCLE 4C48A 5I3UB 2M9KA 2H4YB 2ALYB 5DQGA 1I94J 2BJDA 4RLEA 1CULA 1YJNS 1S0VA 2IVFB 4I1TA 3UPFA 4L74A 4ZOSA 3QPIA 1RT3A 4G1IA 3L7PA 4CT8A 2DNQA 4NX9A 4EK2A 4DR6F 1TL3B 4NL5A 1O51A 2UXDF 3MCMA 2FB0A 1RU1A 3OTBA 2K1RB 3CD5A 3LWMA 4Y2KA 1QY7A 3MR5A 1U24A 2I5JA 3OTDA 3Q22A 2LMIA 3W5XA 3CDUA 5J2MA 1GEHA 2DNLA 2HURA 3CJ8A 2J9DA 3LPEA 2VODA 3NKYA 3CCZA 2E1PA 4HR2A 2KH9A 4GKKJ 4AE5A 4EO8A 3DLKA 4IQMA 5K8OA 3BKUA 1V5IB 3CCMS 4M5KA 2ZBIA 1VLOA 3CULA 1KWMA 3MD3A 1SJ1A 2I5JB 2Z0GA 1TL7B 4LRFA 1UVJA 4MKYA 2H48B 2BQUA 1NDLA 1IR2A 1Y3KA 4TY8A 3PZPA 4C3KA 5J2MB 1RACB 4Q43A 2UUCF 1I6JA 1IR0A 2I8EA 5FIIA 3DYAA 2VBYA 4QPTA 3HVAA 4LF5F 1CBKA 3DLKB 2EC0A 2EC2A 2AMCB 4U7UK 2XNRA 1BC6A 2AEMA 4G65A 2CPFA 4CYUA 1N36F 3DRRB 2MQMA 4DI6A 1SBRA 5A76A 2EFGA 3GIRA 4OI4A 4TY8B 4WTOB 5SUHA 1EX8A 2D3UA 4J7CA 1Y00A 4HDGA 1EAYC 3OR2A 1L3SA 3P49B 1S7IA 2WW8A 2VBZA 3DYAB 2HFSA 4W98A 5HJYA 4ZVPB 3CCJS 3CDEA 1WELA 4R8UA 2OPPA 1OQ3A 4ZP9A 1ZA2B 4H4OA 4PYAA 1WACA 4CYUB 4ICLB 3EPIA 3VAJA 2HVEA 5GADU 1VJQA 3SFUA 1HIYA 2Z2YB 3U1LA 3GCWP 3WX8A 4JUZA 1UKUA 1U1NA 1U1QA 3HZEA 2VPYB 5EX0A 3FJ2A 4GKKF 3OR2B 5K14B 4ELVA 3NS6A 2X1FA 3JQMA 3HKWA 1X4AA 2V9KA 3CDAA 4BC7A 3M9OB 3SV3A 1RWXB 2R7SA 2BJEA 1MN9A 2ZJPQ 4DFMA 4R8UB 1GH8A 3G82A 5KFJA 1U6ZA 3J80Y 3RUBL 4H4OB 2HS0A 1TL5A 5HVFA 3T5LA 5E5NA 1NPPA 4XDDA 4F3QA 1IKYB 4YN3B 1ZTWA 1NZAA 1HI8A 3PACA 4C8YA 1FXRA 3D1OA 5D0EA 2D7SA 1EJ7L 4EZ9A 2JDJA 5GADI 1UJ5A 3VAGA 4OFZA 1Q5VA 2R8IA 3LGMA 3V4MA 5CCLA 2DISA 3ENAA 3A8JA 1U09A 3H40A 4ZK7M 2FHJD 2GA7A 2Q1LA 5AE2A 3G82B 3DOMA 4DUZF 3HJVA 1TAQA 3TANA 5M2RA 3HJFA 4A8SA 1CJKA 3VQSA 3RB3A 1NDPA 5E3RA 3R5GA 4F4AA 2IC3A 4HDHA 4ZDNA 3F56A 4ID5A 4P72A 2B7CB 3M9MB 2JEIA 3S01A 1K1QA 4DCJB 1OY6A 2V6AA 1SQFA 2HKEA 1ZOTA 3SSSA 3VQTA 1WKLA 2YKQA 3T1YJ 4NA1A 3BM7A 1ZZNA 2D9OA 3DN9A 1TKTA 1Q81T 3OPKA 3M8PB 1EB0A 3MR3A 3OXLA 2GO9A 4WFNQ 1CJKB 1SKSA 4KE5A 2RSQA 2IC3B 2VH7A 4ITSA 1RJJA 2MGZB 1XTZA 1X5PA 3BGFA 1RHUB 4ID5B 4CO2A 1ZYQA 4C7QA 1SPBP 2V50A 5LSLA 4X4PA 1TKXB 2Q66A 1BUXA 3CCTA 2D3OR 3LW5C 4X4SA 2CJYB 2AQ4A 2QMXA 2BKNA 4FS2A 4DR4J 5A2QU 2PMHA 3G6XA 3AXMA 4DU7A 2OD4A 3QATA 1UVLA 4X64J 3RAMA 1RKJA 1JLAA 1ZPVA 3BQ0A 2HW3A 4KYZA 4DG1A 4DN0A 5K9FA 5GMKa 2ZJQQ 4YB6A 3VAMA 2ZVSA 4LF1A 3I4PA 1K9MT 3UO0A 4P7VA 1RBLA 1NJXA 2RHSB 2XLKA 1VQPS 2LKZA 4OZ3A 2VD3A 4OHWA 4ZCLA 1SL0A 2P2CB 2E5HA 3TI0A 4LR9A 3FKBA 3DHXA 2B3TB 4CO3A 5SZTA 2VJUA 1XJWB 2LQJA 3RBXA 1HKAA 3BGLA 4IRDA 1X5OA 1BXNA 4HTJA 2CJ9A 5A0YA 1JLAB 1VHIA 1S1XA 1YRUA 2ZOGA 1U8WA 5CA5A 4K4WA 3MOZA 4Y2CA 3BDEA 3V6KA 3V6DB 1AW0A 2OEKA 2RDIA 2E1AA 3BEGB 1PJ5A 2OPQB 1NNDA 2D74B 4PG8A 1DLOA 4IOAQ 4TLQA 3UN3A 3H98A 3ZFVA 3T1YF 2CQ1A 1AZSA 1D8ZA 3GYNA 3IFEA 3AJ1A 3QLHA 1SV5B 2VFUA 5D0HA 5D6GA 1RT2A 3FSYA 1RWMB 2VKRA 2CQCA 3NAHA 5M2PA 1RAOA 1S1XB 3M05A 3HHLA 4OLPA 4M5LA 4TXSA 1LW0A 2RB7A 1KC8T 1DLOB 1WEZA 1QVFR 5E33A 2Y8WA 2JOQA 1NBEB 2YNGB 4DV0J 1UCNA 3AD9C 2CRLA 1S1VB 3ZZPA 3PRVA 1AZSB 1R7IA 3QLHB 1T94A 1KTVA 3A4TA 1RT2B 3UCUP 1XQIA 1B4SA 2ASLA 3TO8A 1RE1B 3LP2A 4RW9B 1L3TA 3HHLB 1WWHA 4AD6A 4DV1J 3DMJA 3R7NB 2X3DA 3HKZD 4DL0C 1LW0B 4BLGA 1PJ6A 3GIMA 1VQ7S 5J2PA 4ZLNA 3A13A 3O3LA 1S1UB 2YQ1A 3NAIA 4A8OA 5DGAA 2CNKB 4AL6A 1RWNB 3G6VA 2AZ3A 4OZJA 4EGLA 2OSQA 2XSJA 2IA6A 2GQQA 2WCXA 3GV5B 5AXMA 4B9VA 2EBGA 3HVTA 2WTFA 3LTOA 4Y0FA 2HS4A 1CC8A 4RBVA 2FC9A 1JJHA 3LGHA 1Y11A 2Z4PA 5L1LA 1T3OA 1S72S 2XO7A 2JVRA 3WC2A 4TY9A 5L1KA 3C19A 2C2RA 2VIHA 1UFLA 4LFCF 2X3GA 3Q2SC 1RTDA 1IBLJ 3QYYA 1EZZB 4I56A 2XSJB 4KGZB 2ZEJA 3R5DA 3TJAA 3KYLA 2F9DA 4JI0J 4OYXA 5DZ6A 2ZH9A 1P1TA 1VQ9S 4DV0F 3ZZUA 1LV5A 5A2QY 3FFIA 4UZCA 3C15A 1IKWA 3D1HA 1I5OB 2QEXS 4UOFA 3UD3P 1BLUA 3ISNC 1RTDB 1IXKA 3T41A 3TA2A 3CJKA 2HHQA 1BQXA 4DV1F 1SKRA 4LJMA 5ETKA 4IOBA 4QWCA 3NNHA 4GMKA 1WOPA 3C8YA 3W60A 3RBZA 4LF4J 3FFIB 3MMJA 1IKWB 4XIUA 3FBCA 2XULA 3NRBA 3N79A 1VQMS 4B3RJ 1TL4A 2YKMA 4ER8A 2AX0A 3RR7A 5KFSA 3ISZA 3I5AA 3GIKA 4KY3A 1RWKB 3CJKB 2HQIA 4NLDA 1TMMA 2GIRA 2ZWOA 4USIA 2GJ2A 4BHQA 2DPJA 5J2QA 1H7WA 4PZVA 1BY9A 3RRKA 3RW7A 3R8YA 3CUNA 3OFEA 5T7LB 3D7SB 1FRLA 4XDCA 5DETA 2VA3A 1F3VA 2RH3A 3EMTA 1KKHA 3BPDA 4TVAB 2MKCA 3QRQA 2RQ4A 1HFEL 1DQAA 1SKWA 2ZH4A 1M5OC 1N5QA 3GIJA 5B09A 1NK7A 4O23A 3CJQA 3IM9A 2ZDPA 1PCAA 2AJ4A 3GJRB 2H1YA 5KFOA 2P8IA 4DR7J 2F63A 4OYOA 3W5YA 4ES3A 1CPZA 5KTQA 2XQCA 4HT5A 2CQBA 2H9ZA 4NLRA 1VIOA 2A0FB 4CLKA 5F3ZA 2QSFA 1F9EB 2QYCA 3ENQA 2AGQA 3KJFB 1FTCA 2CG4A 5F3TA 4ED1A 1NK0A 2OJ3A 1JLEA 2VDIA 1PKUA 2Y1LB 1FERA 2J7KA 3FVYA 3UWTA 4LF4F 4I67A 4GC6A 3JSMA 3GONA 4DV4F 2MHNA 1KOOA 4B3RF 2CVIA 4U7UD 4O3NA 1FD8A 4IH7A 2PSZA 5DRKA 4PXCA 2DH7A 2IRUA 4GVBA 3IP0A 2YKPA 2X1BA 2WZ1A 4K4VA 1JLGA 4OYPA 1B7FA 5L39A 1UFWA 4DSKA 3BPSP 1JWWA 1OSDA 3W65A 3T6JA 2ACMA 4DL5A 4LRDA 3JSMB 2BACA 1QUVA 4F4KA 1REGX 2YNIA 3KMSA 1WDTA 5HBMA 3OTOJ 4P52A 1F2HA 3FBEA 1EQMA 4IG0A 1OY9A 4CLTA 1RAHB 3HF5A 3Q8QB 2DPIA 3N9UC 3FBFA 5K8MA 1FRIA 3EXYA 4QJVA 3QWUA 2RAQA 3W2WA 4CH1A 1JLGB 5B08A 2VBXA 4A8KA 1FDAA 3DLGA 3PJXA 4B3SJ 1JLQA 2WSFC 5KFVA 2JL9A 2QLWA 1HW8A 2W7OA 4MK9A 3PW7A 2L08A 4U6PA 2ZNYA 2D1CA 2M5YA 3PIOQ 1V5VA 2FJAB 2XMAA 4B02A 2YNIB 2UVWA 1S0MA 1RUSA 5HBMB 5J1NA 5DLFA 4IG0B 3IBFB 1NUEA 4K4SA 1N0VC 4MFBB 3GCXP 1NAQA 2BANA 4XK8C 2HBRB 3LALA 3KK3B 3FGVA 5J1EA 4ECQA 2NYIA 3DLGB 4USVA 1WKJA 3BDPA 2KT3A 1XR5A 1R8CA 4OZLA 1XWLA 1DTTA 3L09A 2ZOMA 4ED6A 1FA0A 4O4RA 4ZVHA 3QGHA 2IVYA 3OHBA 4M95A 2GVZA 4H54A 2V2KA 2W7AA 4NRTA 2YX4A 1YJWS 1YBAA 2H65B 2KXHA 2BANB 2E5GA 3VALA 4NOHA 2OI2A 2AX1A 2RS8A 4E8UA 2AHOB 5D4OA 3R5BA 4WFAQ 4KHPF 1CVJA 2EG1A 4RW7B 5K20B 2CZ4A 3KDNA 3OJSA 4EBCA 4EYIB 2HQCA 1YJ7A 2UV8G 5B0DA 1Z2ZA 3I4HX 3A8KA 2B6AA 4I2QA 4B3OA 1WF0A 4OI1A 1RAEB 2I9SA 4DV7F 4A8FA 2LXFA 2MKYA 3UNGC 4IFYA 2HAFA 2ROEA 4N56A 2MSTA 2CIMA 5E2QA 1VQ5S 1GXTA 2YWKA 1T8EA 1YRXA 3MCOA 1WC3A 4FDFA 4RUAA 2RQCA 3BGUA 1RAAB 1NMEB 4M5MA 1O0PA 2LEBA 1RLDA 2W1BA 3C3LA 3Q83A 1MLAA 3QFHA 3CF5Q 3MFHA 1B0VA 2F9JA 4X66J 4F67A 2RF2B 4I2QB 4B3OB 2FLNA 1PJ7A 2JEFA 3SQGA 2HZVA 1HMVB 2CADA 3M32B 2DHAA 1EKSA 3AHPA 1F5BA 4DZDA 1WNEA 3R2DJ 1IWGA 2UP1A 1KQSR 5C5JA 3HSGA 2FJDB 1WOSA 1S99A 1P8GA 1W7WA 4LMZA 3G8TA 2VFVA 2JNJA 3MR6A 4NA2A 2QA1A 3BKFA 4YY3J 3DU5A 4LBIA 3JTOA 1Y0HA 2BDPA 4Q2MA 3VZIA 2RRBA 4ANCA 3MM8A 2RS2A 2DKOB 3RW6A 2EG2A 3KMQA 4KGMA 2OUGA 5J2NA 4F2SA 4FXWA 5KFLA 1GNKA 1RABB 2EBEA 4F26A 1S10A 3EVWA 2J7UA 1HPZA 5E3CA 4DZ6A 1K0TA 4RKUC 2HLUA 1U1OA 1UJ6A 1VS3A 3TYTA 2RQMA 1XR7A 5HVHA 3MM6A 1VRUA 5BYRA 2R2UA 2DNRA 2CPHA 1VYAA 4KJIA 3PEHA 2KT5A 3DRYA 4WP8A 4URGA 4WU3A 4NLGA 2WAQD 2PEHA 1SQEA 4Z7CA 3MTJA 1H72C 5KFMA 1AA1B 3MM8B 2V8VA 4DV6F 2XNQA 4FKXA 2JEGA 5J2NB 2V9WA 4RPFA 1HNIA 2HHSA 2VG5A 1NZ8A 1WUUA 5I42A 3THPA 1HPZB 3M8QA 4CO4A 4O0NA 3OTCA 1JNRB 2N82B 3EDRB 1SH0A 1ZA1B 2AYEA 3MM6B 4QWBA 1N5TA 4V19X 1VRUB 4X66F 3F41A 2VL1A 2WK4A 4ELUA 3W5ZA 3ZO7A 2HRUA 3T1HJ 4X4RA 2KL8A 1SC3B 3A3NB 1LXNA 5K5MA 2KHCA 4ZIWA 1HNIB 4LF7F 2VG5B 5ETRA 3W64A 4M5HA 3AT1B 3M8QB 2R7VA 2RU9A 2HGNA 3UR3C 2MQOA 4ECYA 3GSIA 4OYZA 4FXVA 3TJ8A 2K3KA 3GJSB 3D6FB 3UCZP 2KDOA 1HR0J 1M5KC 1N32J 4ILLA 1GFWB 1TKZA 2H5EA 4DR5J 3W7BA 3T9NA 2HWHA 1T3NA 3G96A 1MWQA 3H2VE 1B70B 5BJRA 4RNNA 5LMUF 2ZC3A 2J8AA 3QBCA 2W9AA 2KXNB 2G0IA 5CXTA 4OX9F 1WSVA 1Q16B 2DNHA 3M9NB 1SCJB 1U02A 4N5SA 1FRMA 2PA3A 1PYSB 3SFGA 1PBAA 2QN6B 1I51B 2GVDA 2C2NA 4OJGA 3OL9A 4TKTA 2WB4A 1TKZB 2J0XA 2R3VA 1VK3A 4DUYF 1NJWA 1B64A 4I6WA 3F0NA 3NMAA 4YFUA 3PIPQ 1NLKL 1LXJA 4OZNA 1VC5A 4C9DA 2Y3YA 3GJQB 2LXUA 6AT1B 1KQGB 2YY3A 1F60B 3BSCA 5A8KA 1FKOA 3GQCA 1URRA 4ZHRA 4USJC 3N01A 2GVDB 4HHUA 3T1HF 2FLLA 4I2PB 3V81B 1RT1A 3N5FA 2HGLA 2HRTA 3EVOA 4PCQA 3QMQA 2JHEA 1FWKA 1NJIT 4KT0C 2QYGA 1N52B 5CHCB 1TP7A 1R8PA 3OT9A 1X4CA 3OLAA 2IYGA 3DLEB 3KLFA 2YNFA 3S1TA 2W9BA 1JQGA 2GO8A 5DS7A 1ZETA 1D9DA 1FKOB 2XS2A 5B7WA 1S9FA 1HR0F 3BJYA 4ZHRB 1T9TA 1C4AA 1SL2A 3PYGA 4CH0S 1HBOA 2AJ0A 4DR5F 1TUVA 3VZHA 2OLWA 5L1IA 3IAM9 1Y7PA 1YZ7A 2VA2A 4PWUA 4HTIA 3B6BA 2BRKA 3GFYA 3R3TA 4ZA1A 2GV1A 5T41A 3ILLA 2B0GA 2OELA 2FYXA 2NCKL 1UEKA 1RWPB 5H9EJ 1H2UX 2R8JA 2RQKA 2YNFB 5D4LA 3GR0A 2E1CA 3JYTA 3KWMA 3CEDA 1Q8KA 2BMBA 4TU9A 5C2GA 1HBOB 2VICA 3GFXA 1YRTA 2GC8A 2ZH8A 1GTEA 2XMVA 1NKEA 3CO0P 4RNHA 1RHMB 2MKHA 2DY1A 4GKJF 4HT7A 3BQ1A 3NWRA 3OFGA 1WI6A 1UP1A 4YB5A 4G6VB 1A9NB 4WZMA 1R8BA 3MPYA 3C6UA 2Q3PA 2BVZA 2EEYA 2UXBJ 2NQPA 2M52A 4RW8B 1R27B 4X2BA 1JLCA 1VISA 3FSIA 3GYXB 1QD1A 2BW2A 3H2UB 3OFFA 4JYAF 3ZC4A 1VK8A 1U26A 4QWAA 2HFVA 3CXCR 1AUDA 5DDQC 5KOWA 2BXJA 4JV1A 2COLA 3CD7A 3D5MA 4OI6A 3GTYX 1V9OA 2YBVA 2UUAJ 4M5DA 3NBPB 2XWXA 2B4OA 4F36A 1FEEA 1HNWF 4YB1P 4OZ2A 1FJGJ 2NUHA 2K7JA 3I55S 5KFFA 4MT1A 2HNDA 4JI6F 4DL6A 1HWKA 3TUIC 3IS9A 3GV8B 1QE1B 1ZAXA 3B4MA 1FK9A 4ECTA 1NK6A 4B9NA 2C3UA 1WC6A 2KHDA 1VBYA 2QMUB 4FS1A 1MMDA 1N4LA 3SSRA 1BWEA 2I1RA 4C0OC 1HD1A 5H1SV 2MJUA 1FWPA 4U95A 3TQ1A 2D3ZA 5DDRC 2QL5B 4DF8A 4M5DB 1RYRA 4MTPA 3CD6S 1VC0A 4KFBA 3M2VA 4DPWA 2HNDB 1KDNA 3QRRA 2YWWA 1PGZA 4J9QA 3IS9B 3BO4A 1Y3JA 2E7XA 2E1RA 3EICA 3MAAA 1NEEA 1HNXJ 1FK9B 4DPUA 5HAOA 2IMWP 1IM6A 4TLRA 4JI8J 2IJFA 4HI2A 4ECSA 3BYPA 2ZZNA 1GXUA 3OR1A 3E3XA 1JX4A 5CQGA 4HLBA 2WW4A 4RWWA 2UU9J 2R8GA 5L9NA 5GMEA 3PHEA 2UV8A 2NSCA 5L9XA 4JP8A 3M2VB 1NK9A 4PYDA 4DV5J 3K8WA 2GMJA 3RB4A 1C0TA 4EI2A 2DH8A 4I6AA 3DC2A 5LSRA 2I2YA 4B08A 1YDLA 4IH6A 3MAAB 4X62J 2V4RA 3FRZA 4Q0BA 2D41A 4K4UA 1KLMA 1T0TV 2AZ1A 1D9FA 2PA8D 3UDVA 3DHWC 1IQZA 3LP0B 2UUAF 4WXWA 3JTPA 1Q82T 4N8OA 2EPIA 4A8WA 3LQVA 1N34F 2HBQB 1J5EF 3TR5A 1SH2A 3D6MB 1RBAA 4LF9J 4HKQA 1SIZA 4J9SA 3AOAA 1Q1KA 4KHMA 5BR8F 5IT9U 1WEYA 3WHIA 4AT1B 4QYZJ 3LAMA 1UPPA 1SUQA 4Q0BB 1LK5A 2DCUB 3UE2A 1RKIA 2R7OA 3VGUA 3D3CJ 3H7HB 4NLUA 1S59A 5AE1A 3ZXWA 2ZKUA 3ZZYA 2RDDA 3WC0A 1S6QB 1ICEB 1RHKB 5BYSA 4B3MF 3QT6A 1NSQA 1FRKA 5IT4A 2KN4A 2GHVC 5FD1A 3FDSA 3HX9A 4JBCA 3UI3A 5C42A 4C3LA 2EK1A 5KT6A 5IT0A 1DQ9A 4JI1J 4JI8F 3EJMA 4EYHB 1FF2A 4YP3A 2BA9A 1SUQB 3G8SA 4LQ9A 1CLFA 3L7OA 2UU9F 3TUPA 5LMNJ 3BN4A 4DQPA 4A8QA 3BKTA 1XNQJ 2W2MP 2R2TA 2NZCA 4K5RA 4DOZA 5HANA 4P75A 1R0AA 4DV5F 4DXLA 3KLEA 3R27A 1ZAVA 5CZXA 1QSYA 2HLTA 1NH7A 1LKZA 3PXGa 2AT1B 2HQDA 5BXIA 3SCKE 5C42B 2B9YA 3HT0A 4CLPA 3QQCD 1TMJA 2H51B 2F5GA 4IFVA 4PRFA 2VFTA 1R31A 1RISA 4TU7A 3MPWA 2XG8A 4FF2A 3VAHA 4YEAA 4FPRA 5EGYA 2OEJA 2E5LJ 4LSNA 4P7TA 3LAKA 5HQLA 3LP1A 2D69A 3H20A 1R0AB 1BWVA 1OIAA 3T19A 4AL7A 1B0PA 2V0NA 4FVMA 2GCFA 4NCGB 1YJ9S 4CI0B 3US5A 1RCXB 2PO4A 3CCLS 2XI2A 2HNYA 5LOQA 1KS2A 2QTWA 4IFVB 3W8GA 1JMTA 4CTAB 3ENVA 2HGMA 3PYFA 4RZRA 1UVNA 1RHJB 1T95A 2FD2A 1K1SA 2QL7B 1UL3A 3F73A 1GT8A 4LSNB 1SKUB 2EW9A 4RW6A 2JZ5A 1C0UA 3LOUA 3KJVA 5GAGU 2LP4A 3T5HA 4FN5A 2AJFE 3L4BC 4LFAJ 3DGVA 3GZ7A 1U6BA 3IRXA 3E2EA 3JS9A 2QE5A 2JC1A 1X4EA 1X4BA 5HQMA 2C42A 3UCGA 2HNYB 3UVJA 2UXCF 3GILA 5EN1A 2NREA 1FX4A 2AEFA 1UTAA 4MAKA 2Y1IA 3PW2A 4Q8FA 5IC6B 4TQSA 4LREA 1JLFA 2CNNB 5KFIA 1Q7YT 4OX8A 1XNQF 3TWZA 4L3NA 1UA1A 3DRSA 1S48A 2IY5B 3JAMY 3KLHA 2APOA 1H2VZ 3NGTA 2W2NP 2HHUA 1C0UB 3KJVB 3M2UA 3H5SA 4LF6J 4DFJA 2FQQB 4IO9Q 3CIMA 2HFNA 5GAGI 3IRXB 4M8LA 1IBKF 5F8HA 2ALZA 4JI3F 3HO1A 2F40A 1MW7A 1UEUA 1YQHA 3UVJB 4M63A 1KHWA 4DL2A 1Y4ZB 4NLYA 1M1GA 4M5GA 2E66A 4DCOB 4TYBA 2IM1A 4YB7A 1H0HB 1R0CB 3DI6A 2IMOA 2AJ1A 1U49A 1C1CA 1P9QC 3KLHB 1M5PC 4NMXA 2XY6A 1NKCA 2C2ZB 2ZBCA 1EETA 2J0SD 3DGPA 2CVEA 1RZMA 4K4XA 1FFWB 4OMFG 4P9SA 1JK9B 3QGGA 4MIAA 1CJTB 1SJQA 1KSPA 4AQYF 4OX6A 2XBPA 3MECB 1GMWA 1SH3A 3TNVA 2DT9A 3DI6B 1HNZF 3CSKA 4J9LA 3SMZA 3HD1A 5GMDA 1DQ8A 5E3QA 1IVZA 3ULHA 1WTFA 5KFZA 4U7CA 3DGPB 3T9ZA 3UD5A 2VQEF 3UN2A 3PR5B 1OWXA 2V2ZA 5E3AA 2LECA 4J9KA 2AIRB 4NYOA 3W2VA 3ZTQA 3HHLC 1DJ0A 3JSBA 1MROA 2GQCA 4ZJOA 3OSPA 1U8SA 1Q8LA 3CE8A 3QJLA 4USUA 4WCEQ 2ZWPA 2DIVA 3QFWA 2VB6A 5L1JA 2DITA 4ED2A 2B5JA 3N5BA 1BE4A 4LF6F 2ZM6J 1M5VC 3EUNA 2HS3A 1BMQB 2Z2ZA 1P6TA 4DL7A 2GX8A 4DBQA 3FEYB 2M3DA 2FJVA 1IWAA 4CRJA 1J27A 2QJ3A 3W2VB 1XIQA 4RJVA 1T7PA 3OVSA 3VAKA 4B3TJ 1RTHB 3PY8A 1X8DA 4LVNP 3FCHA 2M88A 4N77A 4CDIA 4B17A 2L9DA 2IHR1 4N7TA 1VLYA 3DDKA 2C2KB 3FK4A 4QYZK 5EDWA 2G1DA 3OD2A 4IR1A 2B5JB 1X31C 1KFDA 2QX0A 2BE7D 1URNA 1R89A 3Q0AA 2DNPA 4TNOA 4O3OA 3EXCX 1LK7A 1S57A 3AJ2A 3NWGA 2L9NA 2NXCA 2AYGA 4LF8J 1U6FA 3CC7S 2F8HA 4WK3A 3CMAS 5L38A 2KFNA 3KLIA 4EU0A 4DL4A 2AJ2A 3EGNA 2RE1A 1Q5YA 5E7OB 4NLWA 3MEDB 3DLHA 2QL9B 3ILOA 3M6UA 3I9V9 2FGOA 3UN5A 3VTIA 3MURP 1AYEA 5EWFA 5LJ3Y 2ZH7A 3K8VA 3HMJG 4XO0A 4F2RA 3PV8A 2XMUA 3CDWA 4GO7X 4IRKA 4B9SA 1KQFB 4WP3A 1WHWA 4EWTA 3RAQA 4DPOA 5IM0A 3SIPB 2MYFA 2HWIA 1XMQF 2YNHB 2YKNA 2MLZA 4DR6J 1VI7A 1NSKL 2BOAA 3SQOP 3NGSA 3IGNA 2UXDJ 1V6HA 2RU3A 2BABA 1KVKA 3ZZOA 3PX0A 2E7WA 2X1GA 3S6EA 1UW4A 2N7YA 4USHA 5KFWA 5FLXY 5C7PA 2GGPB 2CQDA 4QWEA 4H4MA 2R7QA 4WE1A 1UAWA 4Z7YA 2MLXA 2HWTA 3HP6A 2XMKA 1RAGB 3HI9A 2O01C 3U1MA 2QC3A 5IM0B 3KKFA 3BB5A 2WRMA 1FXLA 4ZVSB 2V2QA 5D0GA 2XO6A 2PFDA 2FVCA 2DJWA 1RT7A 2UVVA 4LVOP 2A1BA 1I1GA 1E6VA 1TU0B 3KOAA 2FZKB 3MXHP 2MKJA 1S6PA 2AKWB 2V8DA 2UVRA 2HZAA 2KO1A 2BRLA 3BZQA 1UWBA 1PO6A 8AT1B 4H4MB 3OLBA 2GIQA 2EFQA 4DJBA 2V4JB 2UUCJ 2DEJA 1S0NA 2Z57B 2CPEA 1TTHB 1LWXA 4LIWA 3T3FA 3OHAA 2IJNA 2WVDA 2Y1RI 4LF5J 4R5PB 4P2FA 3MPVA 3ZTRA 1TK8A 1U2RA 4FZVA 1S77D 2KM8B 4OYIA 2HVIA 1ZH5A 1E6VB 1NB2A 1N36J 2FTRA 3HHKA 1UMJA 5IC4B 4ZN1A 5AJ3F 1S6PB 3HSDA 2B9XA 3VVTA 4ZVQB 1WTBA 3TA1A 1UWBB 2WB1D 2LQ5A 4ENOA 1XNRF 1NDKA 2J9DE 2VV5A 2ATLA 1FFSB 5F8IA 2C3YA 1FESA 1JLBA 3CJSA 2EKYA 5CYQA 2L48A 4AFFA 3TVYA 4X4OA 2DBBA 2XM3A 3HM9A 2IBKA 3HHDA 1K47A 4WYLA 4U67Q 5EUHA 2CDRB 3IWLA 1TL7A 1F0XA 4YOEA 1EQ0A 1U2FA 3B8HA 2XC9A 1VR6A 2R2SA 4URSA 2EFPA 2OSRA 4OI0A 5CAAA 2PFFB 3BO2A 3K89A 3A8EA 3P8BB 1NPRA 3FMBA 2X7IA 2DGVA 1ACMB 1JLBB 2W2PP 4F02A 5CYQB 4P6QA 1MG7A 5K8PA 4TN2A 1RBOB 1MN7A 1MWZA 1T05B 1O5JA 2QIFA 3DRRA 3W9IA 4FYYB 1R43A 3Q8PB 2OFGX 1S1TA 2CQ3A 1G4CA 1DBDA 1VQ8S 2KFZA 3NS5A 4YR2A 1VIXA 3WQPA 2MKSA 4OZ1A 2DB1A 1BD6A 1RI7A 2FLOA 3PKYA 5IWAF 1N0UA 3D54A 4Q8EA 1NCLA 2K06A 2B4VA 4WU2A 1D0EA 2DTJA 1HHTP 4NLPA 5EWEA 2MKKA 2BM1A 2A2CA 4ICLA 1LWCA 4DUZJ 4CP5A 2LDIA 3H5UA 1S1TB 1CJUA 4NLTA 3F44A 4IQXA 7AT1B 2ACYA 2V2VA 1UJ4A 1T9WA 5K14A 1XMOF 1VQOS 3ZZTA 4X4QA 1TUGB 3SI8A 2FGCA 4R25A 2W8KA 2PDAA 4O3QA 2XB2D 4ED8A 1BQMB 4RX6A 4R0JA 4C8MA 3H5YA 3MEEA 1R8HA 1IKYA 1LWCB 5KT5A 2ZBPA 4QW9A 6FDRA 2HBZB 3H4DA 1X9SA 3FQLA 1ZM3A 1SQGA 4RBUA 4UUXA 4XTTA 1CJUB 1FHTA 2H5IB 1Q79A 1XERA 2P5VA 2ASYA 2V67A 4LSLB 3IWNC 3V4IA 4GRSA 3QNWB 5HMZA 3K58A 2V4QA 3W62A 4DEZA 3FEZA 1UVIA 5DQHA 1W2IA 4DMZA 2BV3A 1GQEA 4A48A 1QSLA 1Z1ZA 2AYMA 3D1QA 4O4GB 2ZUAA 4N76A 1A0OB 4PABA 1VRQC 3R97A 2MHEA 3MEEB 2WBRA 2DGTA 3SZ2A 4WZQA 2G0CA 2K2PA 2PN6A 2BBEA 3M1VA 2FY8A 2HQGA 5ETOA 3V4IB 4WFYA 2MEWA 5EX3A 2GFFA 2QA2A 3HDSA 1NDCA 4CO5A 3V5RA 3K57A 2DH9A 1YI2S 1Q53A 3R6LB 3OW2R 1X0FA 2AGOA 3D9BA 1X9WA 4CT9A 1XC9A 2DR6A 2OO4A 4B9UA 4FYDA 4EEYA 4IRCA 2IDEA 4LT6A 5F8MA 3D3BJ 5D3GB 2NSBA 4I0WA 2RT3A 4KH1B 3M8PA 2HYIB 3HVWA 5HROA 1EP4A 1PAUB 1RAFB 4ED3A 4Q45A 2W01A 4WWSA 3M1VB 2QLXA 2DGQA 1AT1B 2MGZA 3M8WA 2L41A 3H25A 4K0KF 2DK2A 2EK6A 1VBKA 1HQ2A 1TKXA 1NK8A 1MU2A 2YQ3A 3DRPA 3GIIA 4F3MA 2LU2A 5IXUA 2F3JA 3AA9A 3CNQP 1IJFB 3CJ0A 1LOUA 3J81U 2B8PA 4F4WA 3M2RA 2C2EA 3C6TA 5HROB 1EP4B 3R1HA 4ED4A 2IM0A 3SCJE 4RBTA 2H54B 3UDCA 4EMDA 4UF4A 2G4BA 2H5JB 4C4WA 4FYXB 2RRNA 5F8GA 3ONQA 1RTJA 1QTNB 1MU2B 2SXLA 4C11A 1YG0A 3DRPB 1X5TA 2XZTB 2XLJA 1HHSA 1IR1A 1UWAA 2J6UA 3TJ9A 2CZ9A 3M2RB 5HLFB 3UFCX 3C6TB 4JB8B 1X60A 3G4SS 1L3VA 2PE8A 4WTYA 3V6DA 4TU8A 3OFHA 3A1YG 2HSEB 4P71A 1YITS 2FLPA 2OPQA 4ZKAA 1IBCB 2LYVA 2KJWA 1RTJB 1LW2A 2EFOA 1AUSL 3EZ5A 3D6HB 4O3SA 3HXMA 2HK2A 1SB6A 4C11B 4F4XA 4JI2F 3NGUA 1SV5A 3NNCA 2M8HA 3I87A 3GYGA 3RZAA 6FD1A 2P9CA 3M30A 4QIVA 3MMAA 2LEPA 3ET6A 2MZQA 1FTRA 4RU9A 4OJHA 2E9ZA 2FHKA 4NZ0A 3NCQA 2A18A 4QIGA 1WSRA 1LW2B 4Y00A 4NXNF 2DR7A 2YNGA 5K8NA 1W25A 3BV8A 2R9LA 3CCWA 2WBMA 1D3WA 3MHYA 1S1VA 4ZVRB 2ZE2A 4BC9A 1UW9A 4LFCJ 3JB9k 2C28A 1S0OA 5C24B 2MQPA 5H9FJ 3RBDA 5HMYA 4UOCA 5DO2A 2AV5A 3M30B 1KQKA 4KAIA 3IA0A 4RW9A 4X4NA 1Z2LA 3MMAB 4CO0A 3D67A 3ET6B 3LH2S 1GMUA 1VQLS 4ZLLA 1FFGB 3MF5A 4KQZA 5CZVA 5A8WA 1YVFA 2KG1A 1SIWB 2JWNA 4YHHF 5ETPA 4BBYA 3KJNB 4W90B 4ZVFA 2VG7A 1S1UA 3CTRA 2DRDA 2UUBJ 2JH3A 3M4XA 2JRSA 2WHOA 3WDOA 3M7VA 2DHHA 3KUHA 4LQ3A 3KLVA 2ZE2B 1LFPA 2LQ8A 1EHWA 4V1Ak 2VKZG 5LSOA 5A8RA 2MJNA 1FNOA 2XS7A 3TZYA 1A6LA 4CLLA 2AU0A 3AODA 3R5JB 4K4YA 5KFUA 4FNIA 2HRYA 1HQUA 5E3PA 3T5JA 1JXEA 2CYYA 3GSDA 5A8WB 4MJKA 5GAHU 1KD1T 4YQWA 3M6XA 2VG7B 3K5OA 2B56A 2KYXA 3EDQB 4ZLPA 2DEIA 2HMIA 4ZMMA 1TFYA 2ZH3A 3SSQA 1TAUA 5A8RB 2Z8QA 2CPXA 4PPZA 1CSJA 2FVQA 4PWDA 5CYJA 1VQYA 4PG7A 5AXNA 1KEKA 3G2XA 1HQUB 4EUVA 2VHGA 1J5OB 4ILMA 4C6AA 1XEZA 4Y65A 4WFXA 1U1MA 3LUYA 4EZ6A 5D78A 5CD4H 4BDPA 3FSXA 3J81Y 5KFNA 2N7CA 2OAUA 1VCTA 4AXJA 5GAHI 4DS5A 1K44A 1IN0A 3J7A1 2HVZA 1N56A 2CQIA 3KUEA 1RWWB 3JQJA 1KBRA 2HMIB 4JI7J 2ZVIA 1WC1A 3I0RB 2O3DA 2ZC4A 4D3HA 2LCWA 3DLBA 5KG6A 1V3SA 1N6QB 4PWDB 3N6LA 2G9OA 3LGNA 3MM7B 2ZFHA 4CLFA 2HFZA 2KFYA 4FVCA 4UY85 2ABYA 4K2JA 3PW4A 1WHXA 2O1PA 3ETOA 1TV6B 4Y3CA 2UUBF 2Y0SD 2MZ1A 2DR8A 4O44A 2J0QD 4KHRA 4QU7A 1S6UA 4NZ6A 2EVZA 3PRDA 4AUKA 3DKDA 4CIOA 1ZS6A 4RUCA 2XY7A 3TW0A 3HFVA 4P2XA 3IO1A 3DDIA 1BHNA 2XMTA 1WF2A 2NR0A 2BX6A 4XPCA 2PT0A 4C98A 5U47A 4C8KA 1H7XA 2FIUA 2DNMA 1KONA 1TELA 4O44B 4DV4J 5T7LA 3ILJA 2I38A 4NYZA 2LQBA 1JB0C 3ZTOA 2AGPA 1YJUA 3ADAC 3N4WA 5DQIA 4DX6A 1KFSA 3LWLA 2AWZA 2BJ1A 3NLCA 4FBTA 2W9CA 4JI5F 2HQ3A 3GP9A 5KFRA 2X1AA 5KFAA 4G1PA 4PR6A 1SL1A 2K3IA 4HI1A 2PEBA 1FT8A 2J8SA 4JI7F 4ED7A 1MMNA 3UW1A 4RU2A 1B0TA 1GXLA 2DGUA 1OJ4A 1HBNB 3D2WA 3CJ5A 1S7HA 1HYSB 3K0JA 5DG7A 3QWPA 2XY5A 1VFJA 4MK8A 3Q89A 2MKIA 1IBMF 4P74A 1WEXA 5IV3A 2W9CB 3K5LA 4OZ0A 4A8MP 5KT3A 1KOHA 4F4ZA 2NS1B 2PMZD 4NA3A 2OHDA 2VFRA 3FMWA 5GVQA 3O5TB 2XSFA 1NH8A 1WC5A 3IBWA 2Z30B 1AFIA 2BKPA 5HI7A 3DXBA 1SC6A 4PWWA 4WF9Q 4HYKA 3PYDA 1GTHA 5AXKA 5D4PA 3B54A 3QJPA 1QJHA 5B0GA 4CNYA 3KNGA 4UY8T 3VWSA 2ZDOA 5KFKA 2HPUA 5HQ8A 1RDRA 1IUJA 3ITHB 3FRYA 2DY9A 2RRAA 1XK8A 2VPWB 1ZM9A 1U1KA 1C2PA 2KT2A 3CCQS 1L3KA 4OHVA 4YR3A 3PW5A 5EWGA 2OPRB 3TAPA 4MYTA 4KIAA 4C8LA 3J80U 1N5VA 4X84A 1N33F 4OHYA 3HPOA 5T14A 4NCAA 1UVMA 3GV7B 4GO5X 4FBUA 1GMWD 3PX6A 3BH6B 4ZPVR 4KHPJ 3K5NA 3QIPB 1AB8A 4IUFA 4J91A 4J9OA 3H5XA 4URQU 2ERRA 3BN7A 3ENWA 4BWMA 3KG4A 4FYWB 4MFBA 2WOMB 4DV7J 2YWHA 2LDYA 3KK3A 1RT5A 1QAXA 1Q86T 1Y5IB 3PFEA 4BCAA 4RO0A 4PEOA 2CPZA 5M2UA 3GE9A 5KAKA 4S0MA 3I9ZA 2N4DA 1HLWA 3L7UA 5CCMA 3ZNJ1 3QAUA 3OUYA 3GB0A 2E44A 5CABA 2JEJA 1R0BG 1CQMA 5JVHQ 3TZXA 2GS8A 4IO1A 2Q6BA 2L3MA 1PIEA 3ZTSA 4WFBQ 4DDFA 2CZVC 3RYLA 4L73A 4P10A 1RT5B 3CPWR 2JLGA 1NHKL 2DNNA 3BO3A 3IG1A 2NUUG 2E1MC 1CULB 2IIHA 3QGPA 3O6QA 3RRGA 4O3RA 3HFKA 2CNLB 5D0RA 5KFPA 1GK8A 3TVZA 1Q95G 4K50A 2KB2A 4RW7A 4K8RA 1IKXA 3OUYB 4X65F 1RT3B 2KRBA 1M1HA 4NLXA 3R5AA 4NXMJ 3W3SA 4B9TA 1RWVB 3AXKA 3KHHA 2GW8A 4FF3A 1H98A 3MOJB 5D8HB 2HHWA 4DSIA 2MY7A 3QT7A 3H59A 3P3DA 4CCHA 3NY0A 3I5CA 4MKVA 2V8HA 3CO9A 4F0HA 3IG1B 5IOLA 1RT4A 4QR2A 3NG8A 2P6TA 3Q8VA 4DR3F 3O44A 1APSA 4OZ5A 1IKXB 3HLUA 1X4DA 5DG8A 2CJAA 4F8RA 3MEKA 4I64A 4PXDA 5HMWA 4L3KA 3M8RA 2RF2A 4DN9A 1YBTA 1ZM2A 4PXBA 2RILA 4Z37A 3HSJA 1HMVA 3M32A 2VQFF 3BF4A 3ZZZA 3A12A 4DX8H 2HIQA 4ANEA 1I94F 3C14A 4DV6J 3ICLA 1RT4B 3G8QA 4F04B 4PG4A 4JI4J 1M5SA 4J9MA 1LFWA 2HHVA 2V69A 3NCPA 1WC4A 3P5BP 1MSWD 1RTIA 1S6OA 3KNAA 2KVQE 3I0SA 5GAEU 3FZBA 5ETTA 3NL0A 1C4CA 2OFHX 4J5OA 1Y5LB 2LVWA 2HIYA 2R4FA 3IR6B 1WHVA 3P45B 3RB0A 1FE0A 2QT7A 3RJMB 3O8WA 3IM8A 4P2MA 2CQPA 3C14B 5KFDA 1OPZA 3U1NA 3X3UA 4LF7J 4ZPDA 3CVKA 4NXMF 2KKHA 2LLZA 1S79A 4DR1J 2HBYB 4KGXB 1X9MA 4WKRA 1FKPA 1RTIB 2CPJA 3I0SB 3UR0A 4NE9C 4ECUA 3EZOA 4P73A 2DGWA 2OPPB 2NXUA 5DM7Q 5GAEI 1CJVA 4ZJLA 2CPYA 5LMUJ 1QSSA 2XCAA 2JLFA 4F50A 3D28A 2VC1A 3BREA 2ZHAA 4I68A 4USWA 2GZOA 4UT4A 4OX9J 1FKPB 3B78A 3V6JA 2QA4S 2BKOA 1SXLA 4Z2XA 1S9GA 3OJUA 1CJVB 2JX2A 4DUYJ 4ECXA 5KG1A 2IPOB 1FXDA 4YDDB 1FJCA 2OMLA 4CLYA 2BYCA 4JI4F 3MI7X 3TVKA 1F6TA 3BGOP 5DGBA 1HARA 3RG6A 2ZH6A 1KP6A 2B4UA 4I4BA 2J9EA 3KXDA 3HULA 2KU7A 1N5SA 2DNOA 2A6OA 1RGVA 3GPAA 3ISND 3NNAA 1CQNA 3NEKA 2MDAA 4CQ1A 3DOMB 5B0AA 1S9GB 3TUZC 4DWIA 5DDOC 1X4HA 3K7RA 3MAHA 2DD8S 3RAXA 2DNGA 1U4BA 4DQIA 1X7VA 4N41A 1U1RA 2A2DA 1XN9A 3BR9A 2W24A 5ADZA 4DR1F 4DS4A 2GHPA 3K5MA 2XLIA 4ED5A 1OMSA 2QMWA 1FRJA 3Q8SB 4IKAA 4CM0A 2BJ7A 3THVA 4DSLA 2W4PA 1FJEB 2ZBRA 4DUTA 3I6PA 1OYDA 1NK4A 1TKTB 4DPTA 3D0IE 2FZCB 1AROP 1T02A 1ZPWX 4CLSA 4PQUA 3IRWP 3MAQA 1DHMA 3J81j 2Y8YA 5KG7A 2Z2MA 2C2MB 2PD1A 3WX4A 4H4KA 3R7SB 4C0HA 4NYPA 2F8MA 1FKAF 1JIHA 3IN5A 4V19J 4RUHA 3ILIA 3DU6A 3THTA 1KTQA 2DHSA 3TX8A 3I96A 4I2PA 3NXZA 3V81A 1NJYA 3PEJA 4QIEA 5CYMA 7FDRA 2IAJA 2MQQA 3AB4B 4WFZA 4GKJJ 4E98A 3MM9A 3M8SA 5CD4A 2M2BA 2B43A 4CNZA 3JXOA 3DLEA 3GMGA 4KO0A 4DG1B 1G7CB 4PQUB 3KFWX 4XAKA 5I3PA 1WJ9A 1TK5A 3MCSA 3H2LA 3TEGA 1QLNA 4QWDA 2KYZA 1V3RA 1WHYA 2A3JA 2R7XA 3KG0A 2WSEC 2R8HA 4JYAJ 4FF1A 1HD0A 5HSPA 2DXDA 1UVKA 3PKMA 4OI3A 3HK2A 5CYMB 2O66A 2IAJB 2QV6A 5FDLA 4PG5A 1M1KT 3CT9A 1IQTA 1SJFA 4WYWA 3MM9B 2V8PA 5A0YB 1QTMA 3Q8RB 4KO0B 3H0PA 1RQ0A 1HNWJ 1T03A 2W8LA 2E9RX 4JI6J 2MY8A 1KRPA 3LA0A 2XGQA 1GX5A 3QGIA 1RAIB 1R8AA 5DLGA 2IRXA 3KTQA 4NLOA 3OXGA 2A6MA 1UPMB 4I6YA 3DOLA 4LR8A 1KR4A 4DR4F 4QIFA 4MKBA 1NSAA 3BSNA 4X64F 3I5BA 3ETMA 5FDLB 2OTLS 1RA6A 3DOKA 5IQQA 2VOPA 3AOBA 1WG4A 3KK1A 5IS2A 4ETZA 3D68A 2C2DA 4L75A 5D77A 4HL9A 3CJ3A 3DDNA 4RW8A 3SEOA 2NXNA 2AF6A 3PYEA 2ADCA 1T03B 2FJXA 1HQEA 2U2FA 4J90A 3TX0A 2P9GA 5AXLA 4ZPAA 4KPCA 1QAIA 2GMLA 1XBWA 2GMHA 1S12A 1P27B 3M8YA 3ZZRA 3DOLB 3AH6A 3Q8YA 2EI5A 1EKRA 3NGRA 3IBCB 4USKA 3D4JA 3MMBA 5KG3A 3RBEA 1TK0A 3NBPA 2OTJS 3S8SA 3DOKB 1K0VA 1M5HA 3KK1B 3LP2B 5KFEA 2KM8C 4J9PA 1FNMA 3FCWA 1FVSA 3DMJB 2KG0A 2MTLA 3OQ2A 8ATCB 4EBDA 1QE1A 3K17A 5B0EA 3OL7A 5L46A 1HQEB 4KRWA 3PFOA 2V94A 4LBPA 3EGZA 1RU2A 1FX2A 5F9LA 1JJ4A 5J2PB 3AD8C 2E29A 4DU8A 3PJ9A 2IFXA 1UETA 2C1EB 3Q8UA 3T5KA 1KHVA 1U7LA 1VQKS 3CCES 3DCAA 3MMBB 4OV1A 4W92B 4ZPCA 1QUPA 4G1QA 4B9LA 4DSFA 3HVTB 5F0UA 3FC9A 4ZIVA 2KI2A 1N34J 3FZ2A 1NHUA 2Y1JA 3IR7B 2ZITA 2CKWA 2EFVA 1J5EJ 1MNEA 2OEMA 4M5JA 2Q79A 2QO3A 4ES2A 2XI3A 3R1LA 3L95X 4X4UA 2IRYA 5BR8J 1W26A 2CAJA 4OLOA 4A8XA 1PG5B 3E01A 2XTJP 1TFWA 2XHCA 3AQOA 4ZVOB 3IC1A 4CM2A 3U27A 3C66A 4UQGA 2V5HG 4FKYA 2R8KA 3IR5B 3RB6A 5F8NA 4OX7A 4G3IA 4G1QB 3GJTB 4I69A 5HK4A 3O1LA 1WG1A 3QT5A 2IA0A 4B3MJ 2GQ2A 2AEJA 3QSYB 2MQNA 3ZZ0A 3C15B 1YWXA 3UD4P 3E01B 4X4TA 3VR1A 2WVBA 3LP0A 4CZCA 4L6V3 1FVQA 3PRBA 5E41A 2WONA 4F7VA 2RIJA 1HA1A 4L76A 4ZCKA 1CG2A 2VOOA 4QCLA 5JUMA 2ZNZA 3DM2A 4J9VA 3FBBA 2OKQA 2FPHX 1HWJA 1P9YA 5I4MA 4U96A 2YKMB 2O67A 1IBLF 4KGVB 3EZUA 2IM2A 1SJRA 1S1WA 2WONB 4NLVA 1S6QA 2W7PA 5F9NA 1Z4UA 4JI0F 2JFDA 3EX7B 2EFNA 2MZRA 4NEYA 2V34A 3WZ0A 5J2QB 2Y0BB 1GMVA 1FRHA 3D0GE 3DM2B 2KRRA 2HAIA 2DCLA 3L3CA 2RMLA 3LO3A 1TR0A 2CQ0A 4CWBA 2FJEB 5KG0A 4MYUA 1ZZFA 3VGTA 4PKDB 4YR0A 4O3PA 2DNKA 1K8AT 4XPEA 5AT1B 1JKHA 2RUGA 1S1WB 3R9LA 1UZHA 3VVUA 3PCOB 3TAMA 1HNVA 2PI5A 5KT7A 2QZ8A 4QR0A 4PUOA 1U1PA 4QYRA 2FDNA 1N8RT 1Q4RA 4DL3A 2FVRA 4RNMA 2CPIA 2OD6A 1HHQA 2YKAA 2C3PA 3DRXA 2UXCJ 5KFQA 1YTYA 5KFBA 1U2CA 3C46A 1F1BB 2D9PA 3G6ES 5LXRA 3W8PA 1IJEB 3MUMP 1JKHB 2BE9B 5B0CA 1R6VA 3G9CA 4ZVUB 4LBHA
chains in the Genus database with same CATH topology
2KVQE 3T1HJ 4OX9J 1HNZJ 2HHHJ 4KY3A 4DV2J 2UXBJ 4JI0J 4DV3J 4DR4J 4NEZA 3OTOJ 5A2QU 2KL8A 4DUZJ 2MQ8A 2UUCJ 4JI5J 5LMNJ 4K0KJ 4X64J 2F4VJ 1XNQJ 4DR6J 1IBKJ 4JI3J 3J7AN 4KYZA 2UXDJ 4DR2J 4LF9J 3J81U 2VQEJ 1HNXJ 4LF5J 4X66J 4DUYJ 4LF8J 1XMQJ 3IMQJ 1N34J 3R2CJ 4JI8J 4LF7J 4JYAJ 2UUBJ 5IT9U 4B3SJ 1J5EJ 4YHHJ 4LFAJ 2MEWA 3W1YC 1HR0J 3T1YJ 4DR1J 2UUAJ 4DR3J 4JI2J 1N32J 4V1Ak 1XMOJ 1N36J 5BR8J 4JV5J 3J80U 2UU9J 4DR5J 3R2DJ 1FJGJ 2ZM6J 4GKKJ 4DV4J 4JI7J 4HHUA 5FLXU 4DV0J 3D3CJ 1IBMJ 1HNWJ 5AJ3J 4DV5J 2E5LJ 3D3BJ 4DV6J 4KHPJ 1N33J 4JI6J 2UXCJ 2VQFJ 4LF4J 1XNRJ 5LMUJ 2MTLA 4X62J 4NXMJ 4JI4J 4B3RJ 4PWWA 4RJVA 1I94J 4YY3J 4B3TJ 1IBLJ 4DR7J 4NXNJ 4AQYJ 4JI1J 4LFBJ 4LFCJ 4B3MJ 5IWAJ 4X65J 4DV7J 4GKJJ 4DV1J 4LF6J 4NEYA 5LM7E 3JAMU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVQ E;  3T1H J;  4OX9 J;  1HNZ J;  2HHH J;  4KY3 A;  4DV2 J;  2UXB J;  4JI0 J;  4DV3 J;  4DR4 J;  4NEZ A;  3OTO J;  5A2Q U;  2KL8 A;  4DUZ J;  2MQ8 A;  2UUC J;  4JI5 J;  5LMN J;  4K0K J;  4X64 J;  2F4V J;  1XNQ J;  4DR6 J;  1IBK J;  4JI3 J;  3J7A N;  4KYZ A;  2UXD J;  4DR2 J;  4LF9 J;  3J81 U;  2VQE J;  1HNX J;  4LF5 J;  4X66 J;  4DUY J;  4LF8 J;  1XMQ J;  3IMQ J;  1N34 J;  3R2C J;  4JI8 J;  4LF7 J;  4JYA J;  2UUB J;  5IT9 U;  4B3S J;  1J5E J;  4YHH J;  4LFA J;  2MEW A;  3W1Y C;  1HR0 J;  3T1Y J;  4DR1 J;  2UUA J;  4DR3 J;  4JI2 J;  1N32 J;  4V1A k;  1XMO J;  1N36 J;  5BR8 J;  4JV5 J;  3J80 U;  2UU9 J;  4DR5 J;  3R2D J;  1FJG J;  2ZM6 J;  4GKK J;  4DV4 J;  4JI7 J;  4HHU A;  5FLX U;  4DV0 J;  3D3C J;  1IBM J;  1HNW J;  5AJ3 J;  4DV5 J;  2E5L J;  3D3B J;  4DV6 J;  4KHP J;  1N33 J;  4JI6 J;  2UXC J;  2VQF J;  4LF4 J;  1XNR J;  5LMU J;  2MTL A;  4X62 J;  4NXM J;  4JI4 J;  4B3R J;  4PWW A;  4RJV A;  1I94 J;  4YY3 J;  4B3T J;  1IBL J;  4DR7 J;  4NXN J;  4AQY J;  4JI1 J;  4LFB J;  4LFC J;  4B3M J;  5IWA J;  4X65 J;  4DV7 J;  4GKJ J;  4DV1 J;  4LF6 J;  4NEY A;  5LM7 E;  3JAM U; 
#chains in the Genus database with same CATH topology
 4MIW A;  4Q44 A;  2IVM A;  3D0H E;  3TAM B;  1HNV B;  2HHP A;  4WKY A;  1JLE B;  1E6Y A;  1M90 T;  2MZJ A;  1D1U A;  4PUO B;  4NCG A;  4KR0 B;  2CJB A;  2BUN A;  4J9R A;  2YPZ A;  3JTN A;  1IBK J;  4JI3 J;  4MIB A;  3MMC A;  2CA9 A;  3N6M A;  3S7R A;  4CTA A;  4KTQ A;  4MMO A;  3X1L B;  3MEG A;  3CJ2 A;  1U48 A;  4GVB B;  4YS2 A;  2M7S A;  2QLJ B;  1HWI A;  3ELH A;  3NOG A;  5DM6 Q;  3CC4 S;  2XMJ A;  4M5N A;  1WOR A;  2MQL A;  1E6Y B;  1U25 A;  4F0K A;  2VC0 A;  3W63 A;  3DNC A;  2XMW A;  1LWE A;  4DR7 F;  4QW8 A;  1G3O A;  1R3N A;  3MMC B;  2POK A;  5H9E K;  2F1F A;  3PDN A;  1U0S A;  4AQY J;  4B9M A;  2N3L A;  1OYE A;  3MEG B;  4C97 A;  1HNZ J;  1T11 A;  1QVG R;  3W2W B;  3KG1 A;  4RW4 A;  1YK9 A;  4Y2A A;  5CH7 B;  1VBZ A;  1B7Y B;  1VBX A;  4NZ7 A;  1JLQ B;  2WVF A;  3FNN A;  2NPF A;  2DHX A;  2B51 A;  2MXY A;  5KFG A;  4Q7A A;  2VQE J;  1S97 A;  5F8L A;  3K59 A;  1LWE B;  4DF4 A;  3QJJ A;  3V2U C;  2J6T A;  1PSD A;  3EM1 A;  4OYB A;  3U7J A;  1S76 D;  5F0W A;  1V3Z A;  5HAT A;  1SI9 A;  1YJV A;  2LA6 A;  1FO1 A;  4K7Q A;  2D3O 1;  3H4B A;  4ZVE A;  3RGI A;  1FI4 A;  5I3Q A;  1XR6 A;  4FPI A;  4FYV B;  3MD1 A;  4QZV B;  4RW4 B;  5J1E B;  2OIH A;  2B7B B;  2Z58 B;  5JJB A;  2QGF B;  4ECV A;  5C25 A;  5DJB A;  3VV2 B;  1P1L A;  1CJT A;  1QAY A;  3OTO F;  1SJ4 P;  1DTT B;  2KJV A;  4Q5V A;  4OL8 A;  3MEC A;  2QRR A;  1O8B A;  3KJQ B;  5LXY A;  3MUV P;  3W61 A;  1ZAW A;  1H2T Z;  4LF2 A;  2XS5 A;  3HHN B;  2GVZ B;  2LA4 A;  4I7F A;  2NXJ A;  3Q24 A;  4B3S F;  3HSZ A;  4C8O A;  1DAR A;  2MSS A;  5IT9 Y;  3W66 A;  4UW2 A;  2HFO A;  4OYW A;  2GHW A;  1N54 B;  4DPX A;  3NP5 A;  3NS7 B;  7FD1 A;  1UFK A;  5C25 B;  2ZUG A;  3ZNU A;  1U1L A;  1FCA A;  2MMY A;  2G2Y A;  3NGK A;  2HG4 A;  4JV5 J;  3GG0 A;  1KNZ A;  2F7V A;  3UQS A;  2B6A B;  5A6P A;  3PNI A;  2CQ4 A;  1QDU B;  2N3O A;  2NZ4 A;  4HHH A;  1TKD A;  4IFY B;  4I7F B;  2MZT A;  1VQ4 S;  1MWY A;  4NI2 A;  4BS2 A;  4KB7 A;  4QQB A;  5FJ4 A;  1NM2 A;  1C1B A;  3K2Y A;  1UA0 A;  1TZ0 A;  4EFA C;  2M0G B;  2QG9 B;  2C3O A;  2ZHB A;  4K5S A;  1RWU A;  4UUW A;  2HHH J;  3WBZ A;  4HAC A;  1PBU A;  2XGP A;  1RTH A;  2HEK A;  2R7R A;  4W4M A;  4NLQ A;  3C2P A;  2ILZ A;  1N5Y A;  1F5C A;  1FDB A;  2J7W A;  4ELT A;  3J7A N;  3SQG B;  4AYB D;  1HI0 P;  4KPY A;  5HVG A;  2G13 A;  4J9U E;  1WKK A;  3MPU B;  1XMQ J;  4QIW D;  4NI2 B;  4OJ1 A;  1SVD A;  3BBB A;  1C1B B;  2KVI A;  1Y9O A;  3RU0 A;  1FEH A;  3E8O A;  4PXE A;  2QLB B;  2E9T A;  4HAC B;  3A8I A;  2ZOF A;  2RHQ B;  2ZZT A;  4C8N A;  5ETL A;  1XMB A;  2XMM A;  1FJ7 A;  1VOM A;  4ZPW R;  1N5Y B;  2YWE A;  5A6W A;  4ZN3 A;  4C0B A;  5HO4 A;  2GAH C;  3MED A;  4UOH A;  2DYA A;  1LWF A;  1QAJ A;  3NCR A;  1JJC B;  1WD6 A;  3HHE A;  4CLZ A;  3M6W A;  4WPA A;  2CJK A;  2VU5 A;  3QO9 A;  3FUY A;  4U8Y A;  2R7U A;  3OSN A;  4DPY A;  4DV3 J;  3Q23 A;  3A3O B;  5D15 A;  4JV5 F;  2XZW A;  4DLG A;  4RR5 A;  4DFK A;  2F4V J;  3T6B A;  3EYZ A;  4EBE A;  2Z2L A;  4YME A;  2PI4 A;  2FZG B;  1REV A;  5LJ5 Y;  2YX1 A;  2HHT A;  3BGR A;  2YNH A;  3DFE A;  2DHG A;  2NPI A;  1ZM4 A;  5KG4 A;  1LWF B;  2DRA A;  5I42 B;  3PO5 A;  2CQG A;  2AYB A;  2ATC B;  1G1X A;  2U1A A;  3L9Z A;  3QO9 B;  1U47 A;  3PJW A;  4D3G A;  4M5I A;  5JMN A;  2E5I A;  2YWF A;  4HH0 A;  2HHH F;  2YH1 A;  4DCP B;  2GGP A;  3HT3 A;  2IJR A;  5AJ3 J;  1H38 A;  4YY3 F;  3P96 A;  3GFH A;  3BYR A;  4FXD A;  2HNZ A;  1XNR J;  1MML A;  3Q2T C;  1O6X A;  1REV B;  2GNK A;  3BGR B;  3G6Y A;  1TQL A;  2GJI A;  4IYQ A;  1U45 A;  3LF0 A;  4ZCI A;  1VDH A;  3PVX A;  4ZP6 A;  3OV7 A;  2YWG A;  3T1A A;  2UZA A;  4DV2 J;  4ID8 A;  4ES1 A;  2YPY A;  4IH5 A;  3V6H A;  3OL6 A;  2YXL A;  5JXS A;  2R7W A;  1PIL A;  2BW7 A;  1RHQ B;  3JQK A;  1OSC A;  5AE3 A;  3ZTP A;  2XYP B;  1DRZ A;  1RP5 A;  3MPD A;  2V4J A;  4ATN A;  4CO1 A;  3TA0 A;  2HNZ B;  4Y28 C;  3NMR A;  4DLE A;  4DSE A;  2CNO B;  2BEF A;  4R5P A;  2M70 A;  1FRX A;  4F4Y A;  4JV0 A;  2JSX A;  2ZHO A;  1YJR A;  4UZB A;  2RD5 C;  2UUT A;  3N28 A;  1D09 B;  4K4T A;  4DV3 F;  3CJT A;  5E0O A;  5F41 A;  3CCS S;  1HWU A;  3QZ8 A;  2F4V F;  1EAR A;  2DXF A;  2DR5 A;  2RVJ A;  3AOC A;  5B0F A;  1UZD A;  1F3F A;  1YSJ A;  1KVJ A;  5IWA J;  1VJW A;  2FHJ A;  2IDL A;  3OVA A;  1AFJ A;  2L9W A;  5ETM A;  3MUT P;  2ZBQ A;  2FVS A;  3SV4 A;  2H4W B;  1ZBT A;  1YZ6 A;  5HL7 Q;  5HJX A;  5KT4 A;  1PYT A;  2B9W A;  4DX7 A;  1ELO A;  2PII A;  1KN6 A;  2VDH A;  1WG5 A;  4A46 A;  2KZM A;  3CW2 C;  3CME S;  4ILR A;  4RUB A;  3HCX A;  5A8K B;  1DTQ A;  4K2X A;  5JVG Q;  1N32 F;  3R2C J;  2J76 E;  4LRC A;  2VPZ B;  1YGY A;  2EXU A;  3N6N A;  3I32 A;  1H6K X;  4QR1 A;  1RT1 B;  2K7K A;  1XMO J;  2XWY A;  1TUW A;  1NB7 A;  2BM0 A;  3AA8 A;  1NHV A;  5ETS A;  2PGC A;  4L72 B;  2IBO A;  1SJ3 P;  2V8G A;  4DV2 F;  1WI8 A;  1T05 A;  3KLF B;  3KHL A;  3H42 A;  1TVR A;  4NPO A;  2ROP A;  1ZTT A;  2W9B B;  2J5A A;  1JJ2 R;  1DTQ B;  2DO4 A;  3CGI A;  5ETN A;  1S4F A;  3HZG A;  1F5A A;  2HHX A;  2ZH5 A;  5MLC V;  4IDK A;  4KC5 A;  3J7Z 5;  5G0R A;  3UDL A;  5L8R C;  4PPD A;  2BE2 A;  1GX6 A;  4JV2 A;  2AD9 A;  2XHW A;  3PO4 A;  4DQQ A;  4LR7 A;  2H3E B;  4A8Y A;  2LFV A;  3D66 A;  3MWB A;  1TVR B;  2GJF A;  2DIU A;  2B4P A;  3SBM A;  3JYT B;  1RSC A;  1RHR B;  3KHG A;  3PTW A;  4WXO A;  1LNQ A;  1GAO A;  3P4U B;  1ULR A;  4M1K A;  3FQK A;  3B82 A;  2O5D A;  3SXL A;  2CFX A;  4ZP8 A;  3TOQ A;  2K8G A;  3M8Z A;  1KLN A;  1EIY B;  4KV8 A;  4IDK B;  2DGO A;  3DXS X;  1B99 A;  2BR0 A;  5G0R B;  3AQP A;  4UTG A;  9ATC B;  3Q86 A;  2BE2 B;  1BQM A;  2WSC C;  3CJR A;  1T9V A;  3PG9 A;  1YX2 A;  2MB0 B;  3VAF A;  3LPY A;  4DX5 A;  2BZ2 A;  2LEA A;  2YQ0 A;  2DGS A;  2X51 A;  5MAO A;  2GAG C;  4N47 A;  5C2C A;  4ZLJ A;  3OTE A;  3C6U B;  1NKB A;  1RYS A;  5KFX A;  1HBM A;  1OO0 B;  3HFZ B;  1JLC B;  5HP1 A;  1R6Y A;  3GLJ A;  4LSL A;  3IXQ A;  4DQR A;  4PQA A;  1S9E A;  3OVB A;  1OY8 A;  2PMW A;  2AJQ A;  5EHH A;  2RUS A;  4OV6 A;  4K0K J;  4KV8 B;  4HVZ A;  1JXL A;  3POT A;  2WVE A;  3IAS 9;  5KG5 A;  2NXE A;  5ITH A;  3HVR A;  3CDB A;  3DLJ A;  4O4G A;  1Y10 A;  4ZPT R;  2HK3 A;  3BS9 A;  4U9R A;  4RNF A;  4FP9 A;  1JXV A;  1HBM B;  5HP1 B;  2C3M A;  1N48 A;  2XYG B;  1ITP A;  3VCD A;  1S9E B;  4ED0 A;  4LRA A;  3KK2 A;  1HW9 A;  4HH1 A;  1RXO B;  2IYI A;  1HWL A;  3AAW B;  2VPX B;  1S49 A;  3MDF A;  3POT B;  2G2Z A;  4IG3 A;  4HHJ A;  4A47 A;  2W4C A;  2ZJR Q;  2RNE A;  5D3G A;  2OMO A;  3EVM A;  2UXB F;  4MK7 A;  2FY1 A;  4HEA 9;  4KFB B;  1HBU A;  4ZCM A;  3JAM U;  2YKO A;  4E0D A;  5HN0 A;  4NEZ A;  4WIQ A;  3CC2 S;  4CH7 A;  4J9N A;  2HZC A;  2MQ8 A;  5F8J A;  2OPS A;  2G1H A;  3KK2 B;  4QPX A;  2ZD1 A;  1FNX H;  2R7T A;  2VFS A;  3OR1 B;  4WK1 A;  4TYA A;  2VON A;  3J7Z T;  1D8Y A;  2BQ3 A;  2JFK A;  2V63 A;  4X4V A;  4IG3 B;  2KZZ A;  3QSI A;  1FJG F;  5LT5 A;  1KVI A;  2W2O P;  3G87 A;  2M4M A;  4JI2 J;  1NJZ A;  1HBU B;  2MZS A;  1RT6 A;  1PAE X;  3HHL D;  1C0T B;  4ZP7 A;  3VGS A;  2DO0 A;  3BSA A;  4Q2L A;  2OGU A;  4WBF A;  3MTK A;  1F9H A;  3PR4 A;  2FUG 9;  2OPS B;  3TZZ A;  2E5J A;  1NPK A;  4LSZ B;  1LQ9 A;  1U0H A;  5IQ6 A;  1KLM B;  3H8Y A;  2ZD1 B;  1G2E A;  4CLW A;  1UEV A;  4LRB A;  3KLG A;  4IR9 A;  3AD7 C;  2C2O B;  1RAD B;  1NSP A;  2P9E A;  2BJ9 A;  1K73 T;  2Q6C A;  2QA4 G;  2R42 A;  4NXN J;  3MR7 A;  2CQ2 A;  4LFB J;  3QID A;  2JC0 A;  3KDO A;  1I3O B;  1YKW A;  2DXE A;  1RWO B;  1T9Y A;  5HLF A;  1YIJ S;  2EWH A;  5ETV A;  1RT6 B;  1HNX F;  1W2B R;  2DNZ A;  4Y2I A;  1F2G A;  3I82 A;  2R2R A;  4UQT A;  2VBW A;  2LU1 A;  4Y6I A;  4ZJQ A;  2DR9 A;  1VC6 A;  3FEX B;  4ZIT A;  2BOP A;  2ASD A;  3GU0 A;  2PC6 A;  4J37 A;  1U0H B;  2XYH B;  2XCP A;  5KFY A;  3SYZ A;  3QRP A;  1VMB A;  2W4D A;  3KLG B;  2HQF A;  2YH0 A;  5D4N A;  3TEH B;  4YHH J;  1OS5 A;  2Z56 B;  3OBI A;  2CPD A;  3GR1 A;  2J9C A;  4Y34 A;  2FJW A;  1AXQ A;  2JLE A;  3RTV A;  1A7G E;  3CMQ A;  1WC0 A;  1X5S A;  1CEZ A;  3PX4 A;  4X62 F;  5IZH A;  4QBU A;  1L5U A;  4USM A;  1Y5N B;  4OHZ A;  5HMX A;  2NLW A;  1NO8 A;  4OQJ A;  3PW0 A;  1Q8I A;  3BSO A;  4GVL A;  2W25 A;  2VZ9 A;  2P6S A;  2AW0 A;  4AXI A;  3IWX A;  4KSE B;  2J0W A;  1J2V A;  1NK5 A;  4NCB A;  1S5Z A;  3IGV A;  4N8N A;  1X4G A;  3SDE A;  2OP5 A;  4UST A;  2C22 A;  3W9H A;  4LF9 F;  3KLE B;  5C24 A;  3BBF A;  1G6B A;  3EE3 A;  4KGK A;  3TZW A;  1FDN A;  2CXE A;  2FJB B;  2F4F A;  1FDD A;  3FCV A;  4DR2 J;  3OXF A;  2VG6 A;  3UDE A;  1RK8 A;  1VQ6 S;  1JNZ B;  2DVI A;  3P6Y C;  2F8E X;  2XEX A;  3P5T L;  2N4C A;  4LFB F;  2F65 A;  1VRT A;  4KKO A;  4ERD A;  5G4D A;  1LEO A;  4RWX A;  2I0X A;  3LP1 B;  3EGW B;  3SDE B;  3VAI A;  3KHR A;  3PHT A;  1YJT A;  3M6V A;  3AY0 A;  4DSJ A;  3LAN A;  4JI1 F;  4LIR A;  3W9J A;  3JSR A;  3CD0 A;  3MZI A;  1YLX A;  2HFU A;  2VG6 B;  5KT2 A;  4K59 A;  2BQR A;  1HL6 A;  1RLC L;  2V68 A;  5LMN F;  4Y2M A;  5J1P A;  4ZS6 A;  5KG2 A;  1PC4 A;  4FNH A;  2AP6 A;  1VRT B;  5KFH A;  4KKO B;  2YX7 A;  4RW6 B;  2ZKT A;  2FVP A;  2CJQ A;  4AND A;  3VF0 B;  3EWG A;  2VAS A;  4P2S A;  3PM9 A;  4DFP A;  8RUC A;  3HD2 A;  2VF3 A;  3G71 S;  1Q78 A;  2CWX A;  1B3T A;  3GWC A;  3BQ2 A;  4ZVT B;  1VHF A;  5ETQ A;  1J5O A;  2QLF B;  4ECZ A;  2CWK A;  4H4K C;  1JLF B;  4O0I A;  2E5L F;  4OJ3 A;  3NGD A;  2DGX A;  5FLX U;  4RNO A;  5LL6 d;  1OQ6 A;  3O2I A;  3JSY A;  3DRS B;  3TAQ A;  4YUD A;  1X4F A;  5KFT A;  2RDJ A;  1WDD A;  3I0R A;  5DG9 A;  1N88 A;  3M2U B;  3MR2 A;  4KBI A;  4DR2 F;  1FWL A;  2VJV A;  4QOT A;  1N6Q A;  3MM7 A;  1D9A A;  3TP2 A;  5THW A;  4ZVG A;  2KXF A;  4WII A;  5LM7 E;  4R0E A;  1VQS A;  2NYH A;  3AFG A;  3QZ7 A;  1TV6 A;  3CCU S;  3CJ4 A;  2LXI A;  3RR8 A;  1YBU A;  2G2O A;  4JI5 J;  3I31 A;  1H73 A;  3BBC A;  4KH0 B;  4F3O A;  1C1C B;  2W2Q P;  3B4D A;  4OHX A;  4AL5 A;  4LFA F;  1NRK A;  4NML A;  4DQS A;  3SCI E;  3EGV A;  1EET B;  1L3U A;  2CG8 A;  4M94 A;  4C3M A;  4ETX A;  2HVD A;  4PAA A;  3CB4 A;  2QFI A;  2GIF A;  3U02 A;  1T9U A;  1FE4 A;  5KOX A;  3K5P A;  2EKN A;  1IBM J;  3TAR A;  5BYQ A;  2LQ9 A;  3AB2 B;  3GG1 A;  1DFD A;  1VQN S;  1SC4 B;  1DAX A;  1S4E A;  1VGY A;  3E51 A;  3D6T B;  4PG6 A;  1Q0N A;  4A4J A;  4EO6 A;  3C16 A;  2RJZ A;  2DNY A;  5KFC A;  2OH2 A;  2J6S A;  2E7V A;  5B0B A;  1IKV A;  2XZD B;  1PYO B;  3NOC A;  3CWJ A;  2WVC A;  2B9E A;  1MRO B;  4WP9 A;  3EPG A;  3BR8 A;  2M8D B;  1RTZ A;  2RKI A;  3R5C A;  4OYA A;  4QU6 A;  4UOG A;  4NLS A;  1H3D A;  2CUY A;  2ILY A;  4C2M A;  1CC7 A;  2VUG A;  1HBN A;  3W1Y C;  3C16 B;  3AJD A;  2ADB A;  1IM4 A;  1DUR A;  4BWJ A;  1HYS A;  2FHO B;  2ZH2 A;  4C8Z A;  4E2F B;  4CLU A;  1IKV B;  2ZH1 A;  2G0J A;  2IM3 A;  1NXI A;  3TRG A;  1Q7L B;  1PC5 A;  1DZ5 A;  1NU4 A;  1N33 J;  9RUB A;  1BGX T;  2RKI B;  3J7Y U;  3RRH A;  2JJ4 D;  4NWB A;  1OPI A;  4OI2 A;  1RB0 A;  4ECW A;  2MLY A;  2QSW A;  2HVH A;  4DHV A;  1T9X A;  2UUW A;  4OIX A;  4IOC Q;  2QFJ A;  2BJ8 A;  1F9F A;  1SC1 B;  5IV4 A;  3KLI B;  3IMQ J;  3ITH A;  3A3P B;  4K4Z A;  4OYM A;  2ZM6 F;  1M0S A;  1CS4 A;  5IFM A;  3UNY A;  4RL1 A;  3J7Y I;  2KTQ A;  3MM5 A;  1QM9 A;  4LUB A;  3OL8 A;  2B8Q A;  1TL1 A;  1Q8B A;  2OPR A;  2FHM A;  2BJ3 A;  2ASJ A;  1YHQ S;  2JVO A;  4B3T F;  3VHQ A;  3BH7 B;  2ROG A;  3VGV A;  3WIU A;  1BQN A;  2CDQ A;  3N0V A;  3CIZ A;  3QAE A;  3WIV A;  3CCV S;  2DRB A;  3TQE A;  3R6G B;  2FC8 A;  1RCO B;  3QIP A;  4GC7 A;  4X65 J;  3QT8 A;  1ROF A;  2YKN B;  1CS4 B;  3GFZ A;  3DLL Q;  3MFI A;  3MM5 B;  2YVS A;  1FD2 A;  3H90 A;  4U8V A;  1RA7 A;  2WOM A;  1TL1 B;  4LF8 F;  2CQH A;  4ECR A;  4FF4 A;  1WOO A;  1HI1 A;  4MKA A;  5I3U A;  3KUG A;  4ALZ A;  4NRU A;  4F25 A;  5DZ7 A;  4TQR A;  2ZZM A;  1BQN B;  5H9F K;  4WE1 B;  5DDP C;  2UVU A;  2Q43 A;  3R7B B;  4JOU A;  3TUJ C;  1X0P A;  2Y9H A;  3MGJ A;  4DR3 J;  4WJB A;  2I6W A;  4YDX A;  1H74 A;  4NAS A;  1TL3 A;  2CJX B;  3I56 S;  5RUB A;  3CCR S;  3MCN A;  2A10 A;  1WF1 A;  2K1R A;  2YTC A;  2MPU A;  4F0M A;  1RAJ A;  3G86 A;  1RT7 B;  1DY3 A;  4MH8 A;  4ZPB A;  2VQF J;  3SCL E;  4C48 A;  5I3U B;  2M9K A;  2H4Y B;  2ALY B;  5DQG A;  1I94 J;  2BJD A;  4RLE A;  1CUL A;  1YJN S;  1S0V A;  2IVF B;  4I1T A;  3UPF A;  4L74 A;  4ZOS A;  3QPI A;  1RT3 A;  4G1I A;  3L7P A;  4CT8 A;  2DNQ A;  4NX9 A;  4EK2 A;  4DR6 F;  1TL3 B;  4NL5 A;  1O51 A;  2UXD F;  3MCM A;  2FB0 A;  1RU1 A;  3OTB A;  2K1R B;  3CD5 A;  3LWM A;  4Y2K A;  1QY7 A;  3MR5 A;  1U24 A;  2I5J A;  3OTD A;  3Q22 A;  2LMI A;  3W5X A;  3CDU A;  5J2M A;  1GEH A;  2DNL A;  2HUR A;  3CJ8 A;  2J9D A;  3LPE A;  2VOD A;  3NKY A;  3CCZ A;  2E1P A;  4HR2 A;  2KH9 A;  4GKK J;  4AE5 A;  4EO8 A;  3DLK A;  4IQM A;  5K8O A;  3BKU A;  1V5I B;  3CCM S;  4M5K A;  2ZBI A;  1VLO A;  3CUL A;  1KWM A;  3MD3 A;  1SJ1 A;  2I5J B;  2Z0G A;  1TL7 B;  4LRF A;  1UVJ A;  4MKY A;  2H48 B;  2BQU A;  1NDL A;  1IR2 A;  1Y3K A;  4TY8 A;  3PZP A;  4C3K A;  5J2M B;  1RAC B;  4Q43 A;  2UUC F;  1I6J A;  1IR0 A;  2I8E A;  5FII A;  3DYA A;  2VBY A;  4QPT A;  3HVA A;  4LF5 F;  1CBK A;  3DLK B;  2EC0 A;  2EC2 A;  2AMC B;  4U7U K;  2XNR A;  1BC6 A;  2AEM A;  4G65 A;  2CPF A;  4CYU A;  1N36 F;  3DRR B;  2MQM A;  4DI6 A;  1SBR A;  5A76 A;  2EFG A;  3GIR A;  4OI4 A;  4TY8 B;  4WTO B;  5SUH A;  1EX8 A;  2D3U A;  4J7C A;  1Y00 A;  4HDG A;  1EAY C;  3OR2 A;  1L3S A;  3P49 B;  1S7I A;  2WW8 A;  2VBZ A;  3DYA B;  2HFS A;  4W98 A;  5HJY A;  4ZVP B;  3CCJ S;  3CDE A;  1WEL A;  4R8U A;  2OPP A;  1OQ3 A;  4ZP9 A;  1ZA2 B;  4H4O A;  4PYA A;  1WAC A;  4CYU B;  4ICL B;  3EPI A;  3VAJ A;  2HVE A;  5GAD U;  1VJQ A;  3SFU A;  1HIY A;  2Z2Y B;  3U1L A;  3GCW P;  3WX8 A;  4JUZ A;  1UKU A;  1U1N A;  1U1Q A;  3HZE A;  2VPY B;  5EX0 A;  3FJ2 A;  4GKK F;  3OR2 B;  5K14 B;  4ELV A;  3NS6 A;  2X1F A;  3JQM A;  3HKW A;  1X4A A;  2V9K A;  3CDA A;  4BC7 A;  3M9O B;  3SV3 A;  1RWX B;  2R7S A;  2BJE A;  1MN9 A;  2ZJP Q;  4DFM A;  4R8U B;  1GH8 A;  3G82 A;  5KFJ A;  1U6Z A;  3J80 Y;  3RUB L;  4H4O B;  2HS0 A;  1TL5 A;  5HVF A;  3T5L A;  5E5N A;  1NPP A;  4XDD A;  4F3Q A;  1IKY B;  4YN3 B;  1ZTW A;  1NZA A;  1HI8 A;  3PAC A;  4C8Y A;  1FXR A;  3D1O A;  5D0E A;  2D7S A;  1EJ7 L;  4EZ9 A;  2JDJ A;  5GAD I;  1UJ5 A;  3VAG A;  4OFZ A;  1Q5V A;  2R8I A;  3LGM A;  3V4M A;  5CCL A;  2DIS A;  3ENA A;  3A8J A;  1U09 A;  3H40 A;  4ZK7 M;  2FHJ D;  2GA7 A;  2Q1L A;  5AE2 A;  3G82 B;  3DOM A;  4DUZ F;  3HJV A;  1TAQ A;  3TAN A;  5M2R A;  3HJF A;  4A8S A;  1CJK A;  3VQS A;  3RB3 A;  1NDP A;  5E3R A;  3R5G A;  4F4A A;  2IC3 A;  4HDH A;  4ZDN A;  3F56 A;  4ID5 A;  4P72 A;  2B7C B;  3M9M B;  2JEI A;  3S01 A;  1K1Q A;  4DCJ B;  1OY6 A;  2V6A A;  1SQF A;  2HKE A;  1ZOT A;  3SSS A;  3VQT A;  1WKL A;  2YKQ A;  3T1Y J;  4NA1 A;  3BM7 A;  1ZZN A;  2D9O A;  3DN9 A;  1TKT A;  1Q81 T;  3OPK A;  3M8P B;  1EB0 A;  3MR3 A;  3OXL A;  2GO9 A;  4WFN Q;  1CJK B;  1SKS A;  4KE5 A;  2RSQ A;  2IC3 B;  2VH7 A;  4ITS A;  1RJJ A;  2MGZ B;  1XTZ A;  1X5P A;  3BGF A;  1RHU B;  4ID5 B;  4CO2 A;  1ZYQ A;  4C7Q A;  1SPB P;  2V50 A;  5LSL A;  4X4P A;  1TKX B;  2Q66 A;  1BUX A;  3CCT A;  2D3O R;  3LW5 C;  4X4S A;  2CJY B;  2AQ4 A;  2QMX A;  2BKN A;  4FS2 A;  4DR4 J;  5A2Q U;  2PMH A;  3G6X A;  3AXM A;  4DU7 A;  2OD4 A;  3QAT A;  1UVL A;  4X64 J;  3RAM A;  1RKJ A;  1JLA A;  1ZPV A;  3BQ0 A;  2HW3 A;  4KYZ A;  4DG1 A;  4DN0 A;  5K9F A;  5GMK a;  2ZJQ Q;  4YB6 A;  3VAM A;  2ZVS A;  4LF1 A;  3I4P A;  1K9M T;  3UO0 A;  4P7V A;  1RBL A;  1NJX A;  2RHS B;  2XLK A;  1VQP S;  2LKZ A;  4OZ3 A;  2VD3 A;  4OHW A;  4ZCL A;  1SL0 A;  2P2C B;  2E5H A;  3TI0 A;  4LR9 A;  3FKB A;  3DHX A;  2B3T B;  4CO3 A;  5SZT A;  2VJU A;  1XJW B;  2LQJ A;  3RBX A;  1HKA A;  3BGL A;  4IRD A;  1X5O A;  1BXN A;  4HTJ A;  2CJ9 A;  5A0Y A;  1JLA B;  1VHI A;  1S1X A;  1YRU A;  2ZOG A;  1U8W A;  5CA5 A;  4K4W A;  3MOZ A;  4Y2C A;  3BDE A;  3V6K A;  3V6D B;  1AW0 A;  2OEK A;  2RDI A;  2E1A A;  3BEG B;  1PJ5 A;  2OPQ B;  1NND A;  2D74 B;  4PG8 A;  1DLO A;  4IOA Q;  4TLQ A;  3UN3 A;  3H98 A;  3ZFV A;  3T1Y F;  2CQ1 A;  1AZS A;  1D8Z A;  3GYN A;  3IFE A;  3AJ1 A;  3QLH A;  1SV5 B;  2VFU A;  5D0H A;  5D6G A;  1RT2 A;  3FSY A;  1RWM B;  2VKR A;  2CQC A;  3NAH A;  5M2P A;  1RAO A;  1S1X B;  3M05 A;  3HHL A;  4OLP A;  4M5L A;  4TXS A;  1LW0 A;  2RB7 A;  1KC8 T;  1DLO B;  1WEZ A;  1QVF R;  5E33 A;  2Y8W A;  2JOQ A;  1NBE B;  2YNG B;  4DV0 J;  1UCN A;  3AD9 C;  2CRL A;  1S1V B;  3ZZP A;  3PRV A;  1AZS B;  1R7I A;  3QLH B;  1T94 A;  1KTV A;  3A4T A;  1RT2 B;  3UCU P;  1XQI A;  1B4S A;  2ASL A;  3TO8 A;  1RE1 B;  3LP2 A;  4RW9 B;  1L3T A;  3HHL B;  1WWH A;  4AD6 A;  4DV1 J;  3DMJ A;  3R7N B;  2X3D A;  3HKZ D;  4DL0 C;  1LW0 B;  4BLG A;  1PJ6 A;  3GIM A;  1VQ7 S;  5J2P A;  4ZLN A;  3A13 A;  3O3L A;  1S1U B;  2YQ1 A;  3NAI A;  4A8O A;  5DGA A;  2CNK B;  4AL6 A;  1RWN B;  3G6V A;  2AZ3 A;  4OZJ A;  4EGL A;  2OSQ A;  2XSJ A;  2IA6 A;  2GQQ A;  2WCX A;  3GV5 B;  5AXM A;  4B9V A;  2EBG A;  3HVT A;  2WTF A;  3LTO A;  4Y0F A;  2HS4 A;  1CC8 A;  4RBV A;  2FC9 A;  1JJH A;  3LGH A;  1Y11 A;  2Z4P A;  5L1L A;  1T3O A;  1S72 S;  2XO7 A;  2JVR A;  3WC2 A;  4TY9 A;  5L1K A;  3C19 A;  2C2R A;  2VIH A;  1UFL A;  4LFC F;  2X3G A;  3Q2S C;  1RTD A;  1IBL J;  3QYY A;  1EZZ B;  4I56 A;  2XSJ B;  4KGZ B;  2ZEJ A;  3R5D A;  3TJA A;  3KYL A;  2F9D A;  4JI0 J;  4OYX A;  5DZ6 A;  2ZH9 A;  1P1T A;  1VQ9 S;  4DV0 F;  3ZZU A;  1LV5 A;  5A2Q Y;  3FFI A;  4UZC A;  3C15 A;  1IKW A;  3D1H A;  1I5O B;  2QEX S;  4UOF A;  3UD3 P;  1BLU A;  3ISN C;  1RTD B;  1IXK A;  3T41 A;  3TA2 A;  3CJK A;  2HHQ A;  1BQX A;  4DV1 F;  1SKR A;  4LJM A;  5ETK A;  4IOB A;  4QWC A;  3NNH A;  4GMK A;  1WOP A;  3C8Y A;  3W60 A;  3RBZ A;  4LF4 J;  3FFI B;  3MMJ A;  1IKW B;  4XIU A;  3FBC A;  2XUL A;  3NRB A;  3N79 A;  1VQM S;  4B3R J;  1TL4 A;  2YKM A;  4ER8 A;  2AX0 A;  3RR7 A;  5KFS A;  3ISZ A;  3I5A A;  3GIK A;  4KY3 A;  1RWK B;  3CJK B;  2HQI A;  4NLD A;  1TMM A;  2GIR A;  2ZWO A;  4USI A;  2GJ2 A;  4BHQ A;  2DPJ A;  5J2Q A;  1H7W A;  4PZV A;  1BY9 A;  3RRK A;  3RW7 A;  3R8Y A;  3CUN A;  3OFE A;  5T7L B;  3D7S B;  1FRL A;  4XDC A;  5DET A;  2VA3 A;  1F3V A;  2RH3 A;  3EMT A;  1KKH A;  3BPD A;  4TVA B;  2MKC A;  3QRQ A;  2RQ4 A;  1HFE L;  1DQA A;  1SKW A;  2ZH4 A;  1M5O C;  1N5Q A;  3GIJ A;  5B09 A;  1NK7 A;  4O23 A;  3CJQ A;  3IM9 A;  2ZDP A;  1PCA A;  2AJ4 A;  3GJR B;  2H1Y A;  5KFO A;  2P8I A;  4DR7 J;  2F63 A;  4OYO A;  3W5Y A;  4ES3 A;  1CPZ A;  5KTQ A;  2XQC A;  4HT5 A;  2CQB A;  2H9Z A;  4NLR A;  1VIO A;  2A0F B;  4CLK A;  5F3Z A;  2QSF A;  1F9E B;  2QYC A;  3ENQ A;  2AGQ A;  3KJF B;  1FTC A;  2CG4 A;  5F3T A;  4ED1 A;  1NK0 A;  2OJ3 A;  1JLE A;  2VDI A;  1PKU A;  2Y1L B;  1FER A;  2J7K A;  3FVY A;  3UWT A;  4LF4 F;  4I67 A;  4GC6 A;  3JSM A;  3GON A;  4DV4 F;  2MHN A;  1KOO A;  4B3R F;  2CVI A;  4U7U D;  4O3N A;  1FD8 A;  4IH7 A;  2PSZ A;  5DRK A;  4PXC A;  2DH7 A;  2IRU A;  4GVB A;  3IP0 A;  2YKP A;  2X1B A;  2WZ1 A;  4K4V A;  1JLG A;  4OYP A;  1B7F A;  5L39 A;  1UFW A;  4DSK A;  3BPS P;  1JWW A;  1OSD A;  3W65 A;  3T6J A;  2ACM A;  4DL5 A;  4LRD A;  3JSM B;  2BAC A;  1QUV A;  4F4K A;  1REG X;  2YNI A;  3KMS A;  1WDT A;  5HBM A;  3OTO J;  4P52 A;  1F2H A;  3FBE A;  1EQM A;  4IG0 A;  1OY9 A;  4CLT A;  1RAH B;  3HF5 A;  3Q8Q B;  2DPI A;  3N9U C;  3FBF A;  5K8M A;  1FRI A;  3EXY A;  4QJV A;  3QWU A;  2RAQ A;  3W2W A;  4CH1 A;  1JLG B;  5B08 A;  2VBX A;  4A8K A;  1FDA A;  3DLG A;  3PJX A;  4B3S J;  1JLQ A;  2WSF C;  5KFV A;  2JL9 A;  2QLW A;  1HW8 A;  2W7O A;  4MK9 A;  3PW7 A;  2L08 A;  4U6P A;  2ZNY A;  2D1C A;  2M5Y A;  3PIO Q;  1V5V A;  2FJA B;  2XMA A;  4B02 A;  2YNI B;  2UVW A;  1S0M A;  1RUS A;  5HBM B;  5J1N A;  5DLF A;  4IG0 B;  3IBF B;  1NUE A;  4K4S A;  1N0V C;  4MFB B;  3GCX P;  1NAQ A;  2BAN A;  4XK8 C;  2HBR B;  3LAL A;  3KK3 B;  3FGV A;  5J1E A;  4ECQ A;  2NYI A;  3DLG B;  4USV A;  1WKJ A;  3BDP A;  2KT3 A;  1XR5 A;  1R8C A;  4OZL A;  1XWL A;  1DTT A;  3L09 A;  2ZOM A;  4ED6 A;  1FA0 A;  4O4R A;  4ZVH A;  3QGH A;  2IVY A;  3OHB A;  4M95 A;  2GVZ A;  4H54 A;  2V2K A;  2W7A A;  4NRT A;  2YX4 A;  1YJW S;  1YBA A;  2H65 B;  2KXH A;  2BAN B;  2E5G A;  3VAL A;  4NOH A;  2OI2 A;  2AX1 A;  2RS8 A;  4E8U A;  2AHO B;  5D4O A;  3R5B A;  4WFA Q;  4KHP F;  1CVJ A;  2EG1 A;  4RW7 B;  5K20 B;  2CZ4 A;  3KDN A;  3OJS A;  4EBC A;  4EYI B;  2HQC A;  1YJ7 A;  2UV8 G;  5B0D A;  1Z2Z A;  3I4H X;  3A8K A;  2B6A A;  4I2Q A;  4B3O A;  1WF0 A;  4OI1 A;  1RAE B;  2I9S A;  4DV7 F;  4A8F A;  2LXF A;  2MKY A;  3UNG C;  4IFY A;  2HAF A;  2ROE A;  4N56 A;  2MST A;  2CIM A;  5E2Q A;  1VQ5 S;  1GXT A;  2YWK A;  1T8E A;  1YRX A;  3MCO A;  1WC3 A;  4FDF A;  4RUA A;  2RQC A;  3BGU A;  1RAA B;  1NME B;  4M5M A;  1O0P A;  2LEB A;  1RLD A;  2W1B A;  3C3L A;  3Q83 A;  1MLA A;  3QFH A;  3CF5 Q;  3MFH A;  1B0V A;  2F9J A;  4X66 J;  4F67 A;  2RF2 B;  4I2Q B;  4B3O B;  2FLN A;  1PJ7 A;  2JEF A;  3SQG A;  2HZV A;  1HMV B;  2CAD A;  3M32 B;  2DHA A;  1EKS A;  3AHP A;  1F5B A;  4DZD A;  1WNE A;  3R2D J;  1IWG A;  2UP1 A;  1KQS R;  5C5J A;  3HSG A;  2FJD B;  1WOS A;  1S99 A;  1P8G A;  1W7W A;  4LMZ A;  3G8T A;  2VFV A;  2JNJ A;  3MR6 A;  4NA2 A;  2QA1 A;  3BKF A;  4YY3 J;  3DU5 A;  4LBI A;  3JTO A;  1Y0H A;  2BDP A;  4Q2M A;  3VZI A;  2RRB A;  4ANC A;  3MM8 A;  2RS2 A;  2DKO B;  3RW6 A;  2EG2 A;  3KMQ A;  4KGM A;  2OUG A;  5J2N A;  4F2S A;  4FXW A;  5KFL A;  1GNK A;  1RAB B;  2EBE A;  4F26 A;  1S10 A;  3EVW A;  2J7U A;  1HPZ A;  5E3C A;  4DZ6 A;  1K0T A;  4RKU C;  2HLU A;  1U1O A;  1UJ6 A;  1VS3 A;  3TYT A;  2RQM A;  1XR7 A;  5HVH A;  3MM6 A;  1VRU A;  5BYR A;  2R2U A;  2DNR A;  2CPH A;  1VYA A;  4KJI A;  3PEH A;  2KT5 A;  3DRY A;  4WP8 A;  4URG A;  4WU3 A;  4NLG A;  2WAQ D;  2PEH A;  1SQE A;  4Z7C A;  3MTJ A;  1H72 C;  5KFM A;  1AA1 B;  3MM8 B;  2V8V A;  4DV6 F;  2XNQ A;  4FKX A;  2JEG A;  5J2N B;  2V9W A;  4RPF A;  1HNI A;  2HHS A;  2VG5 A;  1NZ8 A;  1WUU A;  5I42 A;  3THP A;  1HPZ B;  3M8Q A;  4CO4 A;  4O0N A;  3OTC A;  1JNR B;  2N82 B;  3EDR B;  1SH0 A;  1ZA1 B;  2AYE A;  3MM6 B;  4QWB A;  1N5T A;  4V19 X;  1VRU B;  4X66 F;  3F41 A;  2VL1 A;  2WK4 A;  4ELU A;  3W5Z A;  3ZO7 A;  2HRU A;  3T1H J;  4X4R A;  2KL8 A;  1SC3 B;  3A3N B;  1LXN A;  5K5M A;  2KHC A;  4ZIW A;  1HNI B;  4LF7 F;  2VG5 B;  5ETR A;  3W64 A;  4M5H A;  3AT1 B;  3M8Q B;  2R7V A;  2RU9 A;  2HGN A;  3UR3 C;  2MQO A;  4ECY A;  3GSI A;  4OYZ A;  4FXV A;  3TJ8 A;  2K3K A;  3GJS B;  3D6F B;  3UCZ P;  2KDO A;  1HR0 J;  1M5K C;  1N32 J;  4ILL A;  1GFW B;  1TKZ A;  2H5E A;  4DR5 J;  3W7B A;  3T9N A;  2HWH A;  1T3N A;  3G96 A;  1MWQ A;  3H2V E;  1B70 B;  5BJR A;  4RNN A;  5LMU F;  2ZC3 A;  2J8A A;  3QBC A;  2W9A A;  2KXN B;  2G0I A;  5CXT A;  4OX9 F;  1WSV A;  1Q16 B;  2DNH A;  3M9N B;  1SCJ B;  1U02 A;  4N5S A;  1FRM A;  2PA3 A;  1PYS B;  3SFG A;  1PBA A;  2QN6 B;  1I51 B;  2GVD A;  2C2N A;  4OJG A;  3OL9 A;  4TKT A;  2WB4 A;  1TKZ B;  2J0X A;  2R3V A;  1VK3 A;  4DUY F;  1NJW A;  1B64 A;  4I6W A;  3F0N A;  3NMA A;  4YFU A;  3PIP Q;  1NLK L;  1LXJ A;  4OZN A;  1VC5 A;  4C9D A;  2Y3Y A;  3GJQ B;  2LXU A;  6AT1 B;  1KQG B;  2YY3 A;  1F60 B;  3BSC A;  5A8K A;  1FKO A;  3GQC A;  1URR A;  4ZHR A;  4USJ C;  3N01 A;  2GVD B;  4HHU A;  3T1H F;  2FLL A;  4I2P B;  3V81 B;  1RT1 A;  3N5F A;  2HGL A;  2HRT A;  3EVO A;  4PCQ A;  3QMQ A;  2JHE A;  1FWK A;  1NJI T;  4KT0 C;  2QYG A;  1N52 B;  5CHC B;  1TP7 A;  1R8P A;  3OT9 A;  1X4C A;  3OLA A;  2IYG A;  3DLE B;  3KLF A;  2YNF A;  3S1T A;  2W9B A;  1JQG A;  2GO8 A;  5DS7 A;  1ZET A;  1D9D A;  1FKO B;  2XS2 A;  5B7W A;  1S9F A;  1HR0 F;  3BJY A;  4ZHR B;  1T9T A;  1C4A A;  1SL2 A;  3PYG A;  4CH0 S;  1HBO A;  2AJ0 A;  4DR5 F;  1TUV A;  3VZH A;  2OLW A;  5L1I A;  3IAM 9;  1Y7P A;  1YZ7 A;  2VA2 A;  4PWU A;  4HTI A;  3B6B A;  2BRK A;  3GFY A;  3R3T A;  4ZA1 A;  2GV1 A;  5T41 A;  3ILL A;  2B0G A;  2OEL A;  2FYX A;  2NCK L;  1UEK A;  1RWP B;  5H9E J;  1H2U X;  2R8J A;  2RQK A;  2YNF B;  5D4L A;  3GR0 A;  2E1C A;  3JYT A;  3KWM A;  3CED A;  1Q8K A;  2BMB A;  4TU9 A;  5C2G A;  1HBO B;  2VIC A;  3GFX A;  1YRT A;  2GC8 A;  2ZH8 A;  1GTE A;  2XMV A;  1NKE A;  3CO0 P;  4RNH A;  1RHM B;  2MKH A;  2DY1 A;  4GKJ F;  4HT7 A;  3BQ1 A;  3NWR A;  3OFG A;  1WI6 A;  1UP1 A;  4YB5 A;  4G6V B;  1A9N B;  4WZM A;  1R8B A;  3MPY A;  3C6U A;  2Q3P A;  2BVZ A;  2EEY A;  2UXB J;  2NQP A;  2M52 A;  4RW8 B;  1R27 B;  4X2B A;  1JLC A;  1VIS A;  3FSI A;  3GYX B;  1QD1 A;  2BW2 A;  3H2U B;  3OFF A;  4JYA F;  3ZC4 A;  1VK8 A;  1U26 A;  4QWA A;  2HFV A;  3CXC R;  1AUD A;  5DDQ C;  5KOW A;  2BXJ A;  4JV1 A;  2COL A;  3CD7 A;  3D5M A;  4OI6 A;  3GTY X;  1V9O A;  2YBV A;  2UUA J;  4M5D A;  3NBP B;  2XWX A;  2B4O A;  4F36 A;  1FEE A;  1HNW F;  4YB1 P;  4OZ2 A;  1FJG J;  2NUH A;  2K7J A;  3I55 S;  5KFF A;  4MT1 A;  2HND A;  4JI6 F;  4DL6 A;  1HWK A;  3TUI C;  3IS9 A;  3GV8 B;  1QE1 B;  1ZAX A;  3B4M A;  1FK9 A;  4ECT A;  1NK6 A;  4B9N A;  2C3U A;  1WC6 A;  2KHD A;  1VBY A;  2QMU B;  4FS1 A;  1MMD A;  1N4L A;  3SSR A;  1BWE A;  2I1R A;  4C0O C;  1HD1 A;  5H1S V;  2MJU A;  1FWP A;  4U95 A;  3TQ1 A;  2D3Z A;  5DDR C;  2QL5 B;  4DF8 A;  4M5D B;  1RYR A;  4MTP A;  3CD6 S;  1VC0 A;  4KFB A;  3M2V A;  4DPW A;  2HND B;  1KDN A;  3QRR A;  2YWW A;  1PGZ A;  4J9Q A;  3IS9 B;  3BO4 A;  1Y3J A;  2E7X A;  2E1R A;  3EIC A;  3MAA A;  1NEE A;  1HNX J;  1FK9 B;  4DPU A;  5HAO A;  2IMW P;  1IM6 A;  4TLR A;  4JI8 J;  2IJF A;  4HI2 A;  4ECS A;  3BYP A;  2ZZN A;  1GXU A;  3OR1 A;  3E3X A;  1JX4 A;  5CQG A;  4HLB A;  2WW4 A;  4RWW A;  2UU9 J;  2R8G A;  5L9N A;  5GME A;  3PHE A;  2UV8 A;  2NSC A;  5L9X A;  4JP8 A;  3M2V B;  1NK9 A;  4PYD A;  4DV5 J;  3K8W A;  2GMJ A;  3RB4 A;  1C0T A;  4EI2 A;  2DH8 A;  4I6A A;  3DC2 A;  5LSR A;  2I2Y A;  4B08 A;  1YDL A;  4IH6 A;  3MAA B;  4X62 J;  2V4R A;  3FRZ A;  4Q0B A;  2D41 A;  4K4U A;  1KLM A;  1T0T V;  2AZ1 A;  1D9F A;  2PA8 D;  3UDV A;  3DHW C;  1IQZ A;  3LP0 B;  2UUA F;  4WXW A;  3JTP A;  1Q82 T;  4N8O A;  2EPI A;  4A8W A;  3LQV A;  1N34 F;  2HBQ B;  1J5E F;  3TR5 A;  1SH2 A;  3D6M B;  1RBA A;  4LF9 J;  4HKQ A;  1SIZ A;  4J9S A;  3AOA A;  1Q1K A;  4KHM A;  5BR8 F;  5IT9 U;  1WEY A;  3WHI A;  4AT1 B;  4QYZ J;  3LAM A;  1UPP A;  1SUQ A;  4Q0B B;  1LK5 A;  2DCU B;  3UE2 A;  1RKI A;  2R7O A;  3VGU A;  3D3C J;  3H7H B;  4NLU A;  1S59 A;  5AE1 A;  3ZXW A;  2ZKU A;  3ZZY A;  2RDD A;  3WC0 A;  1S6Q B;  1ICE B;  1RHK B;  5BYS A;  4B3M F;  3QT6 A;  1NSQ A;  1FRK A;  5IT4 A;  2KN4 A;  2GHV C;  5FD1 A;  3FDS A;  3HX9 A;  4JBC A;  3UI3 A;  5C42 A;  4C3L A;  2EK1 A;  5KT6 A;  5IT0 A;  1DQ9 A;  4JI1 J;  4JI8 F;  3EJM A;  4EYH B;  1FF2 A;  4YP3 A;  2BA9 A;  1SUQ B;  3G8S A;  4LQ9 A;  1CLF A;  3L7O A;  2UU9 F;  3TUP A;  5LMN J;  3BN4 A;  4DQP A;  4A8Q A;  3BKT A;  1XNQ J;  2W2M P;  2R2T A;  2NZC A;  4K5R A;  4DOZ A;  5HAN A;  4P75 A;  1R0A A;  4DV5 F;  4DXL A;  3KLE A;  3R27 A;  1ZAV A;  5CZX A;  1QSY A;  2HLT A;  1NH7 A;  1LKZ A;  3PXG a;  2AT1 B;  2HQD A;  5BXI A;  3SCK E;  5C42 B;  2B9Y A;  3HT0 A;  4CLP A;  3QQC D;  1TMJ A;  2H51 B;  2F5G A;  4IFV A;  4PRF A;  2VFT A;  1R31 A;  1RIS A;  4TU7 A;  3MPW A;  2XG8 A;  4FF2 A;  3VAH A;  4YEA A;  4FPR A;  5EGY A;  2OEJ A;  2E5L J;  4LSN A;  4P7T A;  3LAK A;  5HQL A;  3LP1 A;  2D69 A;  3H20 A;  1R0A B;  1BWV A;  1OIA A;  3T19 A;  4AL7 A;  1B0P A;  2V0N A;  4FVM A;  2GCF A;  4NCG B;  1YJ9 S;  4CI0 B;  3US5 A;  1RCX B;  2PO4 A;  3CCL S;  2XI2 A;  2HNY A;  5LOQ A;  1KS2 A;  2QTW A;  4IFV B;  3W8G A;  1JMT A;  4CTA B;  3ENV A;  2HGM A;  3PYF A;  4RZR A;  1UVN A;  1RHJ B;  1T95 A;  2FD2 A;  1K1S A;  2QL7 B;  1UL3 A;  3F73 A;  1GT8 A;  4LSN B;  1SKU B;  2EW9 A;  4RW6 A;  2JZ5 A;  1C0U A;  3LOU A;  3KJV A;  5GAG U;  2LP4 A;  3T5H A;  4FN5 A;  2AJF E;  3L4B C;  4LFA J;  3DGV A;  3GZ7 A;  1U6B A;  3IRX A;  3E2E A;  3JS9 A;  2QE5 A;  2JC1 A;  1X4E A;  1X4B A;  5HQM A;  2C42 A;  3UCG A;  2HNY B;  3UVJ A;  2UXC F;  3GIL A;  5EN1 A;  2NRE A;  1FX4 A;  2AEF A;  1UTA A;  4MAK A;  2Y1I A;  3PW2 A;  4Q8F A;  5IC6 B;  4TQS A;  4LRE A;  1JLF A;  2CNN B;  5KFI A;  1Q7Y T;  4OX8 A;  1XNQ F;  3TWZ A;  4L3N A;  1UA1 A;  3DRS A;  1S48 A;  2IY5 B;  3JAM Y;  3KLH A;  2APO A;  1H2V Z;  3NGT A;  2W2N P;  2HHU A;  1C0U B;  3KJV B;  3M2U A;  3H5S A;  4LF6 J;  4DFJ A;  2FQQ B;  4IO9 Q;  3CIM A;  2HFN A;  5GAG I;  3IRX B;  4M8L A;  1IBK F;  5F8H A;  2ALZ A;  4JI3 F;  3HO1 A;  2F40 A;  1MW7 A;  1UEU A;  1YQH A;  3UVJ B;  4M63 A;  1KHW A;  4DL2 A;  1Y4Z B;  4NLY A;  1M1G A;  4M5G A;  2E66 A;  4DCO B;  4TYB A;  2IM1 A;  4YB7 A;  1H0H B;  1R0C B;  3DI6 A;  2IMO A;  2AJ1 A;  1U49 A;  1C1C A;  1P9Q C;  3KLH B;  1M5P C;  4NMX A;  2XY6 A;  1NKC A;  2C2Z B;  2ZBC A;  1EET A;  2J0S D;  3DGP A;  2CVE A;  1RZM A;  4K4X A;  1FFW B;  4OMF G;  4P9S A;  1JK9 B;  3QGG A;  4MIA A;  1CJT B;  1SJQ A;  1KSP A;  4AQY F;  4OX6 A;  2XBP A;  3MEC B;  1GMW A;  1SH3 A;  3TNV A;  2DT9 A;  3DI6 B;  1HNZ F;  3CSK A;  4J9L A;  3SMZ A;  3HD1 A;  5GMD A;  1DQ8 A;  5E3Q A;  1IVZ A;  3ULH A;  1WTF A;  5KFZ A;  4U7C A;  3DGP B;  3T9Z A;  3UD5 A;  2VQE F;  3UN2 A;  3PR5 B;  1OWX A;  2V2Z A;  5E3A A;  2LEC A;  4J9K A;  2AIR B;  4NYO A;  3W2V A;  3ZTQ A;  3HHL C;  1DJ0 A;  3JSB A;  1MRO A;  2GQC A;  4ZJO A;  3OSP A;  1U8S A;  1Q8L A;  3CE8 A;  3QJL A;  4USU A;  4WCE Q;  2ZWP A;  2DIV A;  3QFW A;  2VB6 A;  5L1J A;  2DIT A;  4ED2 A;  2B5J A;  3N5B A;  1BE4 A;  4LF6 F;  2ZM6 J;  1M5V C;  3EUN A;  2HS3 A;  1BMQ B;  2Z2Z A;  1P6T A;  4DL7 A;  2GX8 A;  4DBQ A;  3FEY B;  2M3D A;  2FJV A;  1IWA A;  4CRJ A;  1J27 A;  2QJ3 A;  3W2V B;  1XIQ A;  4RJV A;  1T7P A;  3OVS A;  3VAK A;  4B3T J;  1RTH B;  3PY8 A;  1X8D A;  4LVN P;  3FCH A;  2M88 A;  4N77 A;  4CDI A;  4B17 A;  2L9D A;  2IHR 1;  4N7T A;  1VLY A;  3DDK A;  2C2K B;  3FK4 A;  4QYZ K;  5EDW A;  2G1D A;  3OD2 A;  4IR1 A;  2B5J B;  1X31 C;  1KFD A;  2QX0 A;  2BE7 D;  1URN A;  1R89 A;  3Q0A A;  2DNP A;  4TNO A;  4O3O A;  3EXC X;  1LK7 A;  1S57 A;  3AJ2 A;  3NWG A;  2L9N A;  2NXC A;  2AYG A;  4LF8 J;  1U6F A;  3CC7 S;  2F8H A;  4WK3 A;  3CMA S;  5L38 A;  2KFN A;  3KLI A;  4EU0 A;  4DL4 A;  2AJ2 A;  3EGN A;  2RE1 A;  1Q5Y A;  5E7O B;  4NLW A;  3MED B;  3DLH A;  2QL9 B;  3ILO A;  3M6U A;  3I9V 9;  2FGO A;  3UN5 A;  3VTI A;  3MUR P;  1AYE A;  5EWF A;  5LJ3 Y;  2ZH7 A;  3K8V A;  3HMJ G;  4XO0 A;  4F2R A;  3PV8 A;  2XMU A;  3CDW A;  4GO7 X;  4IRK A;  4B9S A;  1KQF B;  4WP3 A;  1WHW A;  4EWT A;  3RAQ A;  4DPO A;  5IM0 A;  3SIP B;  2MYF A;  2HWI A;  1XMQ F;  2YNH B;  2YKN A;  2MLZ A;  4DR6 J;  1VI7 A;  1NSK L;  2BOA A;  3SQO P;  3NGS A;  3IGN A;  2UXD J;  1V6H A;  2RU3 A;  2BAB A;  1KVK A;  3ZZO A;  3PX0 A;  2E7W A;  2X1G A;  3S6E A;  1UW4 A;  2N7Y A;  4USH A;  5KFW A;  5FLX Y;  5C7P A;  2GGP B;  2CQD A;  4QWE A;  4H4M A;  2R7Q A;  4WE1 A;  1UAW A;  4Z7Y A;  2MLX A;  2HWT A;  3HP6 A;  2XMK A;  1RAG B;  3HI9 A;  2O01 C;  3U1M A;  2QC3 A;  5IM0 B;  3KKF A;  3BB5 A;  2WRM A;  1FXL A;  4ZVS B;  2V2Q A;  5D0G A;  2XO6 A;  2PFD A;  2FVC A;  2DJW A;  1RT7 A;  2UVV A;  4LVO P;  2A1B A;  1I1G A;  1E6V A;  1TU0 B;  3KOA A;  2FZK B;  3MXH P;  2MKJ A;  1S6P A;  2AKW B;  2V8D A;  2UVR A;  2HZA A;  2KO1 A;  2BRL A;  3BZQ A;  1UWB A;  1PO6 A;  8AT1 B;  4H4M B;  3OLB A;  2GIQ A;  2EFQ A;  4DJB A;  2V4J B;  2UUC J;  2DEJ A;  1S0N A;  2Z57 B;  2CPE A;  1TTH B;  1LWX A;  4LIW A;  3T3F A;  3OHA A;  2IJN A;  2WVD A;  2Y1R I;  4LF5 J;  4R5P B;  4P2F A;  3MPV A;  3ZTR A;  1TK8 A;  1U2R A;  4FZV A;  1S77 D;  2KM8 B;  4OYI A;  2HVI A;  1ZH5 A;  1E6V B;  1NB2 A;  1N36 J;  2FTR A;  3HHK A;  1UMJ A;  5IC4 B;  4ZN1 A;  5AJ3 F;  1S6P B;  3HSD A;  2B9X A;  3VVT A;  4ZVQ B;  1WTB A;  3TA1 A;  1UWB B;  2WB1 D;  2LQ5 A;  4ENO A;  1XNR F;  1NDK A;  2J9D E;  2VV5 A;  2ATL A;  1FFS B;  5F8I A;  2C3Y A;  1FES A;  1JLB A;  3CJS A;  2EKY A;  5CYQ A;  2L48 A;  4AFF A;  3TVY A;  4X4O A;  2DBB A;  2XM3 A;  3HM9 A;  2IBK A;  3HHD A;  1K47 A;  4WYL A;  4U67 Q;  5EUH A;  2CDR B;  3IWL A;  1TL7 A;  1F0X A;  4YOE A;  1EQ0 A;  1U2F A;  3B8H A;  2XC9 A;  1VR6 A;  2R2S A;  4URS A;  2EFP A;  2OSR A;  4OI0 A;  5CAA A;  2PFF B;  3BO2 A;  3K89 A;  3A8E A;  3P8B B;  1NPR A;  3FMB A;  2X7I A;  2DGV A;  1ACM B;  1JLB B;  2W2P P;  4F02 A;  5CYQ B;  4P6Q A;  1MG7 A;  5K8P A;  4TN2 A;  1RBO B;  1MN7 A;  1MWZ A;  1T05 B;  1O5J A;  2QIF A;  3DRR A;  3W9I A;  4FYY B;  1R43 A;  3Q8P B;  2OFG X;  1S1T A;  2CQ3 A;  1G4C A;  1DBD A;  1VQ8 S;  2KFZ A;  3NS5 A;  4YR2 A;  1VIX A;  3WQP A;  2MKS A;  4OZ1 A;  2DB1 A;  1BD6 A;  1RI7 A;  2FLO A;  3PKY A;  5IWA F;  1N0U A;  3D54 A;  4Q8E A;  1NCL A;  2K06 A;  2B4V A;  4WU2 A;  1D0E A;  2DTJ A;  1HHT P;  4NLP A;  5EWE A;  2MKK A;  2BM1 A;  2A2C A;  4ICL A;  1LWC A;  4DUZ J;  4CP5 A;  2LDI A;  3H5U A;  1S1T B;  1CJU A;  4NLT A;  3F44 A;  4IQX A;  7AT1 B;  2ACY A;  2V2V A;  1UJ4 A;  1T9W A;  5K14 A;  1XMO F;  1VQO S;  3ZZT A;  4X4Q A;  1TUG B;  3SI8 A;  2FGC A;  4R25 A;  2W8K A;  2PDA A;  4O3Q A;  2XB2 D;  4ED8 A;  1BQM B;  4RX6 A;  4R0J A;  4C8M A;  3H5Y A;  3MEE A;  1R8H A;  1IKY A;  1LWC B;  5KT5 A;  2ZBP A;  4QW9 A;  6FDR A;  2HBZ B;  3H4D A;  1X9S A;  3FQL A;  1ZM3 A;  1SQG A;  4RBU A;  4UUX A;  4XTT A;  1CJU B;  1FHT A;  2H5I B;  1Q79 A;  1XER A;  2P5V A;  2ASY A;  2V67 A;  4LSL B;  3IWN C;  3V4I A;  4GRS A;  3QNW B;  5HMZ A;  3K58 A;  2V4Q A;  3W62 A;  4DEZ A;  3FEZ A;  1UVI A;  5DQH A;  1W2I A;  4DMZ A;  2BV3 A;  1GQE A;  4A48 A;  1QSL A;  1Z1Z A;  2AYM A;  3D1Q A;  4O4G B;  2ZUA A;  4N76 A;  1A0O B;  4PAB A;  1VRQ C;  3R97 A;  2MHE A;  3MEE B;  2WBR A;  2DGT A;  3SZ2 A;  4WZQ A;  2G0C A;  2K2P A;  2PN6 A;  2BBE A;  3M1V A;  2FY8 A;  2HQG A;  5ETO A;  3V4I B;  4WFY A;  2MEW A;  5EX3 A;  2GFF A;  2QA2 A;  3HDS A;  1NDC A;  4CO5 A;  3V5R A;  3K57 A;  2DH9 A;  1YI2 S;  1Q53 A;  3R6L B;  3OW2 R;  1X0F A;  2AGO A;  3D9B A;  1X9W A;  4CT9 A;  1XC9 A;  2DR6 A;  2OO4 A;  4B9U A;  4FYD A;  4EEY A;  4IRC A;  2IDE A;  4LT6 A;  5F8M A;  3D3B J;  5D3G B;  2NSB A;  4I0W A;  2RT3 A;  4KH1 B;  3M8P A;  2HYI B;  3HVW A;  5HRO A;  1EP4 A;  1PAU B;  1RAF B;  4ED3 A;  4Q45 A;  2W01 A;  4WWS A;  3M1V B;  2QLX A;  2DGQ A;  1AT1 B;  2MGZ A;  3M8W A;  2L41 A;  3H25 A;  4K0K F;  2DK2 A;  2EK6 A;  1VBK A;  1HQ2 A;  1TKX A;  1NK8 A;  1MU2 A;  2YQ3 A;  3DRP A;  3GII A;  4F3M A;  2LU2 A;  5IXU A;  2F3J A;  3AA9 A;  3CNQ P;  1IJF B;  3CJ0 A;  1LOU A;  3J81 U;  2B8P A;  4F4W A;  3M2R A;  2C2E A;  3C6T A;  5HRO B;  1EP4 B;  3R1H A;  4ED4 A;  2IM0 A;  3SCJ E;  4RBT A;  2H54 B;  3UDC A;  4EMD A;  4UF4 A;  2G4B A;  2H5J B;  4C4W A;  4FYX B;  2RRN A;  5F8G A;  3ONQ A;  1RTJ A;  1QTN B;  1MU2 B;  2SXL A;  4C11 A;  1YG0 A;  3DRP B;  1X5T A;  2XZT B;  2XLJ A;  1HHS A;  1IR1 A;  1UWA A;  2J6U A;  3TJ9 A;  2CZ9 A;  3M2R B;  5HLF B;  3UFC X;  3C6T B;  4JB8 B;  1X60 A;  3G4S S;  1L3V A;  2PE8 A;  4WTY A;  3V6D A;  4TU8 A;  3OFH A;  3A1Y G;  2HSE B;  4P71 A;  1YIT S;  2FLP A;  2OPQ A;  4ZKA A;  1IBC B;  2LYV A;  2KJW A;  1RTJ B;  1LW2 A;  2EFO A;  1AUS L;  3EZ5 A;  3D6H B;  4O3S A;  3HXM A;  2HK2 A;  1SB6 A;  4C11 B;  4F4X A;  4JI2 F;  3NGU A;  1SV5 A;  3NNC A;  2M8H A;  3I87 A;  3GYG A;  3RZA A;  6FD1 A;  2P9C A;  3M30 A;  4QIV A;  3MMA A;  2LEP A;  3ET6 A;  2MZQ A;  1FTR A;  4RU9 A;  4OJH A;  2E9Z A;  2FHK A;  4NZ0 A;  3NCQ A;  2A18 A;  4QIG A;  1WSR A;  1LW2 B;  4Y00 A;  4NXN F;  2DR7 A;  2YNG A;  5K8N A;  1W25 A;  3BV8 A;  2R9L A;  3CCW A;  2WBM A;  1D3W A;  3MHY A;  1S1V A;  4ZVR B;  2ZE2 A;  4BC9 A;  1UW9 A;  4LFC J;  3JB9 k;  2C28 A;  1S0O A;  5C24 B;  2MQP A;  5H9F J;  3RBD A;  5HMY A;  4UOC A;  5DO2 A;  2AV5 A;  3M30 B;  1KQK A;  4KAI A;  3IA0 A;  4RW9 A;  4X4N A;  1Z2L A;  3MMA B;  4CO0 A;  3D67 A;  3ET6 B;  3LH2 S;  1GMU A;  1VQL S;  4ZLL A;  1FFG B;  3MF5 A;  4KQZ A;  5CZV A;  5A8W A;  1YVF A;  2KG1 A;  1SIW B;  2JWN A;  4YHH F;  5ETP A;  4BBY A;  3KJN B;  4W90 B;  4ZVF A;  2VG7 A;  1S1U A;  3CTR A;  2DRD A;  2UUB J;  2JH3 A;  3M4X A;  2JRS A;  2WHO A;  3WDO A;  3M7V A;  2DHH A;  3KUH A;  4LQ3 A;  3KLV A;  2ZE2 B;  1LFP A;  2LQ8 A;  1EHW A;  4V1A k;  2VKZ G;  5LSO A;  5A8R A;  2MJN A;  1FNO A;  2XS7 A;  3TZY A;  1A6L A;  4CLL A;  2AU0 A;  3AOD A;  3R5J B;  4K4Y A;  5KFU A;  4FNI A;  2HRY A;  1HQU A;  5E3P A;  3T5J A;  1JXE A;  2CYY A;  3GSD A;  5A8W B;  4MJK A;  5GAH U;  1KD1 T;  4YQW A;  3M6X A;  2VG7 B;  3K5O A;  2B56 A;  2KYX A;  3EDQ B;  4ZLP A;  2DEI A;  2HMI A;  4ZMM A;  1TFY A;  2ZH3 A;  3SSQ A;  1TAU A;  5A8R B;  2Z8Q A;  2CPX A;  4PPZ A;  1CSJ A;  2FVQ A;  4PWD A;  5CYJ A;  1VQY A;  4PG7 A;  5AXN A;  1KEK A;  3G2X A;  1HQU B;  4EUV A;  2VHG A;  1J5O B;  4ILM A;  4C6A A;  1XEZ A;  4Y65 A;  4WFX A;  1U1M A;  3LUY A;  4EZ6 A;  5D78 A;  5CD4 H;  4BDP A;  3FSX A;  3J81 Y;  5KFN A;  2N7C A;  2OAU A;  1VCT A;  4AXJ A;  5GAH I;  4DS5 A;  1K44 A;  1IN0 A;  3J7A 1;  2HVZ A;  1N56 A;  2CQI A;  3KUE A;  1RWW B;  3JQJ A;  1KBR A;  2HMI B;  4JI7 J;  2ZVI A;  1WC1 A;  3I0R B;  2O3D A;  2ZC4 A;  4D3H A;  2LCW A;  3DLB A;  5KG6 A;  1V3S A;  1N6Q B;  4PWD B;  3N6L A;  2G9O A;  3LGN A;  3MM7 B;  2ZFH A;  4CLF A;  2HFZ A;  2KFY A;  4FVC A;  4UY8 5;  2ABY A;  4K2J A;  3PW4 A;  1WHX A;  2O1P A;  3ETO A;  1TV6 B;  4Y3C A;  2UUB F;  2Y0S D;  2MZ1 A;  2DR8 A;  4O44 A;  2J0Q D;  4KHR A;  4QU7 A;  1S6U A;  4NZ6 A;  2EVZ A;  3PRD A;  4AUK A;  3DKD A;  4CIO A;  1ZS6 A;  4RUC A;  2XY7 A;  3TW0 A;  3HFV A;  4P2X A;  3IO1 A;  3DDI A;  1BHN A;  2XMT A;  1WF2 A;  2NR0 A;  2BX6 A;  4XPC A;  2PT0 A;  4C98 A;  5U47 A;  4C8K A;  1H7X A;  2FIU A;  2DNM A;  1KON A;  1TEL A;  4O44 B;  4DV4 J;  5T7L A;  3ILJ A;  2I38 A;  4NYZ A;  2LQB A;  1JB0 C;  3ZTO A;  2AGP A;  1YJU A;  3ADA C;  3N4W A;  5DQI A;  4DX6 A;  1KFS A;  3LWL A;  2AWZ A;  2BJ1 A;  3NLC A;  4FBT A;  2W9C A;  4JI5 F;  2HQ3 A;  3GP9 A;  5KFR A;  2X1A A;  5KFA A;  4G1P A;  4PR6 A;  1SL1 A;  2K3I A;  4HI1 A;  2PEB A;  1FT8 A;  2J8S A;  4JI7 F;  4ED7 A;  1MMN A;  3UW1 A;  4RU2 A;  1B0T A;  1GXL A;  2DGU A;  1OJ4 A;  1HBN B;  3D2W A;  3CJ5 A;  1S7H A;  1HYS B;  3K0J A;  5DG7 A;  3QWP A;  2XY5 A;  1VFJ A;  4MK8 A;  3Q89 A;  2MKI A;  1IBM F;  4P74 A;  1WEX A;  5IV3 A;  2W9C B;  3K5L A;  4OZ0 A;  4A8M P;  5KT3 A;  1KOH A;  4F4Z A;  2NS1 B;  2PMZ D;  4NA3 A;  2OHD A;  2VFR A;  3FMW A;  5GVQ A;  3O5T B;  2XSF A;  1NH8 A;  1WC5 A;  3IBW A;  2Z30 B;  1AFI A;  2BKP A;  5HI7 A;  3DXB A;  1SC6 A;  4PWW A;  4WF9 Q;  4HYK A;  3PYD A;  1GTH A;  5AXK A;  5D4P A;  3B54 A;  3QJP A;  1QJH A;  5B0G A;  4CNY A;  3KNG A;  4UY8 T;  3VWS A;  2ZDO A;  5KFK A;  2HPU A;  5HQ8 A;  1RDR A;  1IUJ A;  3ITH B;  3FRY A;  2DY9 A;  2RRA A;  1XK8 A;  2VPW B;  1ZM9 A;  1U1K A;  1C2P A;  2KT2 A;  3CCQ S;  1L3K A;  4OHV A;  4YR3 A;  3PW5 A;  5EWG A;  2OPR B;  3TAP A;  4MYT A;  4KIA A;  4C8L A;  3J80 U;  1N5V A;  4X84 A;  1N33 F;  4OHY A;  3HPO A;  5T14 A;  4NCA A;  1UVM A;  3GV7 B;  4GO5 X;  4FBU A;  1GMW D;  3PX6 A;  3BH6 B;  4ZPV R;  4KHP J;  3K5N A;  3QIP B;  1AB8 A;  4IUF A;  4J91 A;  4J9O A;  3H5X A;  4URQ U;  2ERR A;  3BN7 A;  3ENW A;  4BWM A;  3KG4 A;  4FYW B;  4MFB A;  2WOM B;  4DV7 J;  2YWH A;  2LDY A;  3KK3 A;  1RT5 A;  1QAX A;  1Q86 T;  1Y5I B;  3PFE A;  4BCA A;  4RO0 A;  4PEO A;  2CPZ A;  5M2U A;  3GE9 A;  5KAK A;  4S0M A;  3I9Z A;  2N4D A;  1HLW A;  3L7U A;  5CCM A;  3ZNJ 1;  3QAU A;  3OUY A;  3GB0 A;  2E44 A;  5CAB A;  2JEJ A;  1R0B G;  1CQM A;  5JVH Q;  3TZX A;  2GS8 A;  4IO1 A;  2Q6B A;  2L3M A;  1PIE A;  3ZTS A;  4WFB Q;  4DDF A;  2CZV C;  3RYL A;  4L73 A;  4P10 A;  1RT5 B;  3CPW R;  2JLG A;  1NHK L;  2DNN A;  3BO3 A;  3IG1 A;  2NUU G;  2E1M C;  1CUL B;  2IIH A;  3QGP A;  3O6Q A;  3RRG A;  4O3R A;  3HFK A;  2CNL B;  5D0R A;  5KFP A;  1GK8 A;  3TVZ A;  1Q95 G;  4K50 A;  2KB2 A;  4RW7 A;  4K8R A;  1IKX A;  3OUY B;  4X65 F;  1RT3 B;  2KRB A;  1M1H A;  4NLX A;  3R5A A;  4NXM J;  3W3S A;  4B9T A;  1RWV B;  3AXK A;  3KHH A;  2GW8 A;  4FF3 A;  1H98 A;  3MOJ B;  5D8H B;  2HHW A;  4DSI A;  2MY7 A;  3QT7 A;  3H59 A;  3P3D A;  4CCH A;  3NY0 A;  3I5C A;  4MKV A;  2V8H A;  3CO9 A;  4F0H A;  3IG1 B;  5IOL A;  1RT4 A;  4QR2 A;  3NG8 A;  2P6T A;  3Q8V A;  4DR3 F;  3O44 A;  1APS A;  4OZ5 A;  1IKX B;  3HLU A;  1X4D A;  5DG8 A;  2CJA A;  4F8R A;  3MEK A;  4I64 A;  4PXD A;  5HMW A;  4L3K A;  3M8R A;  2RF2 A;  4DN9 A;  1YBT A;  1ZM2 A;  4PXB A;  2RIL A;  4Z37 A;  3HSJ A;  1HMV A;  3M32 A;  2VQF F;  3BF4 A;  3ZZZ A;  3A12 A;  4DX8 H;  2HIQ A;  4ANE A;  1I94 F;  3C14 A;  4DV6 J;  3ICL A;  1RT4 B;  3G8Q A;  4F04 B;  4PG4 A;  4JI4 J;  1M5S A;  4J9M A;  1LFW A;  2HHV A;  2V69 A;  3NCP A;  1WC4 A;  3P5B P;  1MSW D;  1RTI A;  1S6O A;  3KNA A;  2KVQ E;  3I0S A;  5GAE U;  3FZB A;  5ETT A;  3NL0 A;  1C4C A;  2OFH X;  4J5O A;  1Y5L B;  2LVW A;  2HIY A;  2R4F A;  3IR6 B;  1WHV A;  3P45 B;  3RB0 A;  1FE0 A;  2QT7 A;  3RJM B;  3O8W A;  3IM8 A;  4P2M A;  2CQP A;  3C14 B;  5KFD A;  1OPZ A;  3U1N A;  3X3U A;  4LF7 J;  4ZPD A;  3CVK A;  4NXM F;  2KKH A;  2LLZ A;  1S79 A;  4DR1 J;  2HBY B;  4KGX B;  1X9M A;  4WKR A;  1FKP A;  1RTI B;  2CPJ A;  3I0S B;  3UR0 A;  4NE9 C;  4ECU A;  3EZO A;  4P73 A;  2DGW A;  2OPP B;  2NXU A;  5DM7 Q;  5GAE I;  1CJV A;  4ZJL A;  2CPY A;  5LMU J;  1QSS A;  2XCA A;  2JLF A;  4F50 A;  3D28 A;  2VC1 A;  3BRE A;  2ZHA A;  4I68 A;  4USW A;  2GZO A;  4UT4 A;  4OX9 J;  1FKP B;  3B78 A;  3V6J A;  2QA4 S;  2BKO A;  1SXL A;  4Z2X A;  1S9G A;  3OJU A;  1CJV B;  2JX2 A;  4DUY J;  4ECX A;  5KG1 A;  2IPO B;  1FXD A;  4YDD B;  1FJC A;  2OML A;  4CLY A;  2BYC A;  4JI4 F;  3MI7 X;  3TVK A;  1F6T A;  3BGO P;  5DGB A;  1HAR A;  3RG6 A;  2ZH6 A;  1KP6 A;  2B4U A;  4I4B A;  2J9E A;  3KXD A;  3HUL A;  2KU7 A;  1N5S A;  2DNO A;  2A6O A;  1RGV A;  3GPA A;  3ISN D;  3NNA A;  1CQN A;  3NEK A;  2MDA A;  4CQ1 A;  3DOM B;  5B0A A;  1S9G B;  3TUZ C;  4DWI A;  5DDO C;  1X4H A;  3K7R A;  3MAH A;  2DD8 S;  3RAX A;  2DNG A;  1U4B A;  4DQI A;  1X7V A;  4N41 A;  1U1R A;  2A2D A;  1XN9 A;  3BR9 A;  2W24 A;  5ADZ A;  4DR1 F;  4DS4 A;  2GHP A;  3K5M A;  2XLI A;  4ED5 A;  1OMS A;  2QMW A;  1FRJ A;  3Q8S B;  4IKA A;  4CM0 A;  2BJ7 A;  3THV A;  4DSL A;  2W4P A;  1FJE B;  2ZBR A;  4DUT A;  3I6P A;  1OYD A;  1NK4 A;  1TKT B;  4DPT A;  3D0I E;  2FZC B;  1ARO P;  1T02 A;  1ZPW X;  4CLS A;  4PQU A;  3IRW P;  3MAQ A;  1DHM A;  3J81 j;  2Y8Y A;  5KG7 A;  2Z2M A;  2C2M B;  2PD1 A;  3WX4 A;  4H4K A;  3R7S B;  4C0H A;  4NYP A;  2F8M A;  1FKA F;  1JIH A;  3IN5 A;  4V19 J;  4RUH A;  3ILI A;  3DU6 A;  3THT A;  1KTQ A;  2DHS A;  3TX8 A;  3I96 A;  4I2P A;  3NXZ A;  3V81 A;  1NJY A;  3PEJ A;  4QIE A;  5CYM A;  7FDR A;  2IAJ A;  2MQQ A;  3AB4 B;  4WFZ A;  4GKJ J;  4E98 A;  3MM9 A;  3M8S A;  5CD4 A;  2M2B A;  2B43 A;  4CNZ A;  3JXO A;  3DLE A;  3GMG A;  4KO0 A;  4DG1 B;  1G7C B;  4PQU B;  3KFW X;  4XAK A;  5I3P A;  1WJ9 A;  1TK5 A;  3MCS A;  3H2L A;  3TEG A;  1QLN A;  4QWD A;  2KYZ A;  1V3R A;  1WHY A;  2A3J A;  2R7X A;  3KG0 A;  2WSE C;  2R8H A;  4JYA J;  4FF1 A;  1HD0 A;  5HSP A;  2DXD A;  1UVK A;  3PKM A;  4OI3 A;  3HK2 A;  5CYM B;  2O66 A;  2IAJ B;  2QV6 A;  5FDL A;  4PG5 A;  1M1K T;  3CT9 A;  1IQT A;  1SJF A;  4WYW A;  3MM9 B;  2V8P A;  5A0Y B;  1QTM A;  3Q8R B;  4KO0 B;  3H0P A;  1RQ0 A;  1HNW J;  1T03 A;  2W8L A;  2E9R X;  4JI6 J;  2MY8 A;  1KRP A;  3LA0 A;  2XGQ A;  1GX5 A;  3QGI A;  1RAI B;  1R8A A;  5DLG A;  2IRX A;  3KTQ A;  4NLO A;  3OXG A;  2A6M A;  1UPM B;  4I6Y A;  3DOL A;  4LR8 A;  1KR4 A;  4DR4 F;  4QIF A;  4MKB A;  1NSA A;  3BSN A;  4X64 F;  3I5B A;  3ETM A;  5FDL B;  2OTL S;  1RA6 A;  3DOK A;  5IQQ A;  2VOP A;  3AOB A;  1WG4 A;  3KK1 A;  5IS2 A;  4ETZ A;  3D68 A;  2C2D A;  4L75 A;  5D77 A;  4HL9 A;  3CJ3 A;  3DDN A;  4RW8 A;  3SEO A;  2NXN A;  2AF6 A;  3PYE A;  2ADC A;  1T03 B;  2FJX A;  1HQE A;  2U2F A;  4J90 A;  3TX0 A;  2P9G A;  5AXL A;  4ZPA A;  4KPC A;  1QAI A;  2GML A;  1XBW A;  2GMH A;  1S12 A;  1P27 B;  3M8Y A;  3ZZR A;  3DOL B;  3AH6 A;  3Q8Y A;  2EI5 A;  1EKR A;  3NGR A;  3IBC B;  4USK A;  3D4J A;  3MMB A;  5KG3 A;  3RBE A;  1TK0 A;  3NBP A;  2OTJ S;  3S8S A;  3DOK B;  1K0V A;  1M5H A;  3KK1 B;  3LP2 B;  5KFE A;  2KM8 C;  4J9P A;  1FNM A;  3FCW A;  1FVS A;  3DMJ B;  2KG0 A;  2MTL A;  3OQ2 A;  8ATC B;  4EBD A;  1QE1 A;  3K17 A;  5B0E A;  3OL7 A;  5L46 A;  1HQE B;  4KRW A;  3PFO A;  2V94 A;  4LBP A;  3EGZ A;  1RU2 A;  1FX2 A;  5F9L A;  1JJ4 A;  5J2P B;  3AD8 C;  2E29 A;  4DU8 A;  3PJ9 A;  2IFX A;  1UET A;  2C1E B;  3Q8U A;  3T5K A;  1KHV A;  1U7L A;  1VQK S;  3CCE S;  3DCA A;  3MMB B;  4OV1 A;  4W92 B;  4ZPC A;  1QUP A;  4G1Q A;  4B9L A;  4DSF A;  3HVT B;  5F0U A;  3FC9 A;  4ZIV A;  2KI2 A;  1N34 J;  3FZ2 A;  1NHU A;  2Y1J A;  3IR7 B;  2ZIT A;  2CKW A;  2EFV A;  1J5E J;  1MNE A;  2OEM A;  4M5J A;  2Q79 A;  2QO3 A;  4ES2 A;  2XI3 A;  3R1L A;  3L95 X;  4X4U A;  2IRY A;  5BR8 J;  1W26 A;  2CAJ A;  4OLO A;  4A8X A;  1PG5 B;  3E01 A;  2XTJ P;  1TFW A;  2XHC A;  3AQO A;  4ZVO B;  3IC1 A;  4CM2 A;  3U27 A;  3C66 A;  4UQG A;  2V5H G;  4FKY A;  2R8K A;  3IR5 B;  3RB6 A;  5F8N A;  4OX7 A;  4G3I A;  4G1Q B;  3GJT B;  4I69 A;  5HK4 A;  3O1L A;  1WG1 A;  3QT5 A;  2IA0 A;  4B3M J;  2GQ2 A;  2AEJ A;  3QSY B;  2MQN A;  3ZZ0 A;  3C15 B;  1YWX A;  3UD4 P;  3E01 B;  4X4T A;  3VR1 A;  2WVB A;  3LP0 A;  4CZC A;  4L6V 3;  1FVQ A;  3PRB A;  5E41 A;  2WON A;  4F7V A;  2RIJ A;  1HA1 A;  4L76 A;  4ZCK A;  1CG2 A;  2VOO A;  4QCL A;  5JUM A;  2ZNZ A;  3DM2 A;  4J9V A;  3FBB A;  2OKQ A;  2FPH X;  1HWJ A;  1P9Y A;  5I4M A;  4U96 A;  2YKM B;  2O67 A;  1IBL F;  4KGV B;  3EZU A;  2IM2 A;  1SJR A;  1S1W A;  2WON B;  4NLV A;  1S6Q A;  2W7P A;  5F9N A;  1Z4U A;  4JI0 F;  2JFD A;  3EX7 B;  2EFN A;  2MZR A;  4NEY A;  2V34 A;  3WZ0 A;  5J2Q B;  2Y0B B;  1GMV A;  1FRH A;  3D0G E;  3DM2 B;  2KRR A;  2HAI A;  2DCL A;  3L3C A;  2RML A;  3LO3 A;  1TR0 A;  2CQ0 A;  4CWB A;  2FJE B;  5KG0 A;  4MYU A;  1ZZF A;  3VGT A;  4PKD B;  4YR0 A;  4O3P A;  2DNK A;  1K8A T;  4XPE A;  5AT1 B;  1JKH A;  2RUG A;  1S1W B;  3R9L A;  1UZH A;  3VVU A;  3PCO B;  3TAM A;  1HNV A;  2PI5 A;  5KT7 A;  2QZ8 A;  4QR0 A;  4PUO A;  1U1P A;  4QYR A;  2FDN A;  1N8R T;  1Q4R A;  4DL3 A;  2FVR A;  4RNM A;  2CPI A;  2OD6 A;  1HHQ A;  2YKA A;  2C3P A;  3DRX A;  2UXC J;  5KFQ A;  1YTY A;  5KFB A;  1U2C A;  3C46 A;  1F1B B;  2D9P A;  3G6E S;  5LXR A;  3W8P A;  1IJE B;  3MUM P;  1JKH B;  2BE9 B;  5B0C A;  1R6V A;  3G9C A;  4ZVU B;  4LBH A; 
#chains in the Genus database with same CATH homology
 2KVQ E;  3T1H J;  4OX9 J;  1HNZ J;  2HHH J;  4KY3 A;  4DV2 J;  2UXB J;  4JI0 J;  4DV3 J;  4DR4 J;  4NEZ A;  3OTO J;  5A2Q U;  2KL8 A;  4DUZ J;  2MQ8 A;  2UUC J;  4JI5 J;  5LMN J;  4K0K J;  4X64 J;  2F4V J;  1XNQ J;  4DR6 J;  1IBK J;  4JI3 J;  3J7A N;  4KYZ A;  2UXD J;  4DR2 J;  4LF9 J;  3J81 U;  2VQE J;  1HNX J;  4LF5 J;  4X66 J;  4DUY J;  4LF8 J;  1XMQ J;  3IMQ J;  1N34 J;  3R2C J;  4JI8 J;  4LF7 J;  4JYA J;  2UUB J;  5IT9 U;  4B3S J;  1J5E J;  4YHH J;  4LFA J;  2MEW A;  3W1Y C;  1HR0 J;  3T1Y J;  4DR1 J;  2UUA J;  4DR3 J;  4JI2 J;  1N32 J;  4V1A k;  1XMO J;  1N36 J;  5BR8 J;  4JV5 J;  3J80 U;  2UU9 J;  4DR5 J;  3R2D J;  1FJG J;  2ZM6 J;  4GKK J;  4DV4 J;  4JI7 J;  4HHU A;  5FLX U;  4DV0 J;  3D3C J;  1IBM J;  1HNW J;  5AJ3 J;  4DV5 J;  2E5L J;  3D3B J;  4DV6 J;  4KHP J;  1N33 J;  4JI6 J;  2UXC J;  2VQF J;  4LF4 J;  1XNR J;  5LMU J;  2MTL A;  4X62 J;  4NXM J;  4JI4 J;  4B3R J;  4PWW A;  4RJV A;  1I94 J;  4YY3 J;  4B3T J;  1IBL J;  4DR7 J;  4NXN J;  4AQY J;  4JI1 J;  4LFB J;  4LFC J;  4B3M J;  5IWA J;  4X65 J;  4DV7 J;  4GKJ J;  4DV1 J;  4LF6 J;  4NEY A;  5LM7 E;  3JAM U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...