4X65J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4x65J00
4DUZJ 1XMOJ 3JAMU 1J5EJ 4DR4J 4DR6J 1XMQJ 4B3SJ 4LF9J 4LF4J 3W1YC 4YHHJ 4DR7J 3R2DJ 2HHHJ 2ZM6J 4B3MJ 2UXCJ 2MEWA 4JI8J 4DV4J 2MTLA 2KVQE 3D3CJ 4K0KJ 4RJVA 4LF7J 3R2CJ 1N33J 1XNRJ 4X64J 5LMNJ 3IMQJ 2UUCJ 4DV0J 4KYZA 3T1YJ 2VQEJ 4DV7J 3J7AN 4LFBJ 1N34J 2UUBJ 1I94J 4X65J 3J81U 4DR3J 4X62J 3J80U 1HNZJ 2E5LJ 4NEYA 4JI1J 4LFAJ 4DV1J 4DR2J 1N32J 5FLXU 4YY3J 2VQFJ 4JI2J 1HNWJ 2KL8A 4HHUA 1IBKJ 2MQ8A 3OTOJ 3T1HJ 4JI0J 4B3TJ 5AJ3J 1N36J 4JI7J 4LF6J 4NXNJ 4B3RJ 4GKKJ 4LF5J 1XNQJ 4JI4J 1FJGJ 5IWAJ 5IT9U 5BR8J 4JI3J 1IBMJ 1IBLJ 2UXBJ 4DV5J 4KHPJ 2UXDJ 4JI6J 4DUYJ 4DV6J 4LFCJ 4JV5J 5LM7E 4DV2J 4JI5J 4DV3J 4V1Ak 3D3BJ 2UU9J 4KY3A 1HNXJ 5LMUJ 4DR1J 1HR0J 4JYAJ 4X66J 4PWWA 4LF8J 4NEZA 4NXMJ 4DR5J 4GKJJ 5A2QU 2F4VJ 4AQYJ 2UUAJ 4OX9J
chains in the Genus database with same CATH superfamily
3IS9A 4NYOA 3VGTA 2E5JA 3W2VA 3V6JA 1X9WA 1RDRA 3HSZA 4ZJOA 5AJ3F 3Q8SB 1CQNA 4U7UK 3M4XA 2F7VA 3UN2A 2IA6A 4B3RF 4JYAF 2VFTA 3HVRA 3C15A 1C4CA 2Y8YA 3FCHA 1U24A 4HL9A 5E0OA 3RRHA 4TQSA 3BKTA 2F4VF 3LANA 4Y2MA 4MH8A 1U26A 5CABA 2ILYA 4WE1B 1QVGR 1G3OA 2J6UA 2E7WA 2IY5B 1FT8A 1YWXA 2JVRA 4H4OA 3IN5A 3GV8B 2GIRA 5KFVA 1DQ9A 3T1AA 2VBWA 2XNRA 2PE8A 2F8HA 2EG2A 2EK1A 4FYXB 5BYRA 2AIRB 2YKQA 3GFZA 3H5SA 2XG8A 3G8SA 5D3GB 1R7IA 2OPQB 3R6LB 5HVHA 3CD5A 2ASDA 3SDEB 3MR7A 3U1MA 2HHQA 1HWKA 1WUUA 3FBFA 2RE1A 4QPTA 2V67A 3QZ7A 2CAJA 1N33F 3I82A 4HT7A 3IRXA 3R5DA 2IM2A 3PTWA 4UUXA 5H9EJ 2HMIB 3DRYA 3HD1A 4LF7J 3ITHA 3MAAB 1CULA 1JK9B 5HBMA 4O0IA 3M9NB 4KQZA 4NXMF 4W4MA 3BGRA 3ZZZA 1YHQS 2RRNA 3OFEA 1AB8A 3VZIA 3NCPA 2CNLB 2QC3A 4X4SA 1B99A 1K1SA 1KTVA 2CQIA 3AQOA 4OJHA 4QCLA 2JC0A 1E6VB 1Y0HA 2VFUA 4IRKA 2LU1A 2MZJA 4O3QA 1C1BB 3SCIE 2BUNA 2GO9A 2H4WB 4QIGA 1XNRF 4ES3A 4RW4A 3DRSB 4E0DA 2HNYA 2NZ4A 3QT5A 1Z2LA 1Y5LB 2EWHA 2KHDA 2QIFA 3H4BA 2XTJP 5KFOA 2XY6A 2LEAA 1WEYA 2ZD1B 1KQSR 2IRUA 3DRRB 3IWXA 5A8KA 4ZN1A 4I69A 1FRXA 4JI7F 5EX0A 4PPDA 5DG7A 3BPDA 1LK5A 5A6PA 2HFZA 2ZH5A 1EX8A 3N5BA 4OMFG 4N5SA 4EZ9A 3NMAA 1U1KA 2ZFHA 1YJUA 3FCWA 3V81B 3OVSA 2EFOA 4ILRA 4JV1A 3TQEA 3DOKA 4BS2A 3O44A 3SV4A 5C2CA 2VG7B 3EGNA 3K5PA 4M5IA 3PYEA 4JI2F 1EIYB 5HQ8A 1RQ0A 2W7AA 2AYBA 2HFUA 4B3TJ 4MJKA 4ZDNA 1H38A 1MU2B 2G2YA 5KFIA 1JJHA 4K0KF 2XYPB 2HVHA 3LP0B 3GIJA 3QWPA 2VKRA 2Y8WA 3CSKA 2UV8G 4HH1A 4NYZA 5L46A 4B9NA 3U7JA 3M32A 1S9EA 1EKSA 1LK7A 2YKPA 1D1UA 1CC8A 3BGOP 2BOAA 4I7FB 5ETLA 1WHYA 3VHQA 3RB0A 3MCOA 5LM7E 2V8HA 2GNKA 1DZ5A 1DTTB 1HD0A 1YK9A 2KT3A 2KXHA 3CJRA 3BQ0A 1IKXB 1R0BG 2RSQA 3ENWA 5IWAF 3AJ2A 3IR6B 3VGVA 2PMWA 3G6YA 3MPUB 1YIJS 2JL9A 2YNIB 2VFVA 4RUHA 3W62A 3TARA 5J2QB 2H9ZA 3CDEA 2LXUA 3MM7B 3QAEA 5KT5A 1NK0A 2E1CA 4YDXA 3QWUA 4IYQA 2KN4A 3MR6A 1RWMB 2MKYA 2XYGB 1RU1A 3HZGA 4DL5A 3HSGA 3NG8A 4DL7A 1IBKF 4IFVB 4OYPA 1R8BA 3H5YA 2I1RA 3GE9A 1S6QB 2HVEA 2W25A 3NGSA 2UUTA 2YTCA 1XMOJ 1XTZA 1SL0A 3R1LA 1FD8A 5ETKA 1RT4A 2HRTA 1PAEX 4RU2A 3GWCA 1RAGB 4HT5A 3CB4A 1V5VA 2FB0A 1AZSB 2FYXA 4DN9A 3H90A 1VBZA 3B6BA 3M2UB 5F8GA 4B3OA 2WVCA 3MM5B 3QMQA 3H20A 3PM9A 5M2RA 4X4OA 3SSQA 4IRCA 2YKMB 3SIPB 3IAM9 3G8QA 4HVZA 3B82A 4M8LA 4OZ3A 3V4MA 1ZTWA 1WDTA 5DG9A 3TNVA 3OTCA 2QL9B 4YHHJ 4GO7X 2OKQA 1RT1B 1YRTA 2HGLA 4N47A 1AFIA 4WZQA 5IM0A 5J2QA 3KLGB 1ZPVA 3NGKA 3DCAA 2EPIA 2EW9A 3ETMA 3LGMA 4LR9A 4ELTA 2PFFB 2E1RA 2VFRA 3ZNUA 1JIHA 2HQDA 3BR9A 2HNDB 4IH5A 2MEWA 3DLKA 5HATA 1Q5YA 1DJ0A 2YQ3A 2CPFA 2GS8A 3GONA 2DGUA 2V69A 3KUHA 2IRXA 4PR6A 4C97A 4WKYA 4Z7CA 3LPYA 2LECA 1I94F 2C2KB 4NA1A 3D4JA 3SV3A 2ZVSA 1KN6A 4U95A 1RAIB 1HI1A 1RHUB 3EVOA 2Y0BB 2DBBA 4QZVB 4R8UB 4RUCA 4WFAQ 5E41A 2XMAA 2IBKA 4LFAF 1EQMA 3KHLA 1N32F 2BA9A 1IM6A 2BM1A 2R7SA 5E5NA 5DDOC 3Q8UA 2CNNB 1PYOB 3A3PB 3F56A 3MM5A 1FO1A 1CJVA 3PEHA 5DJBA 4ALZA 4DI6A 4RPFA 1HBNA 2YNHB 5CD4H 4JP8A 4PXBA 1DRZA 3UI3A 2CVEA 3V5RA 4A48A 3PRBA 5D15A 4JI1J 3ZNJ1 2CKWA 1U6ZA 4TLQA 5J2NB 2QTWA 3ZZPA 4NCBA 5AT1B 3AB4B 2VQFJ 1HNWJ 3UFCX 5L1KA 1UWBA 1SJ3P 1JLAB 4LR8A 1WORA 1TP7A 2PD1A 3KLGA 4Y0FA 4NI2A 2RDIA 3UDEA 3G6VA 1HR0F 3DGPB 3K5OA 1LKZA 8RUCA 2SXLA 1U2CA 1S1VA 4LRCA 3SEOA 4Y00A 2GVZB 3DI6A 4KAIA 5JMNA 1NKCA 3G82A 2X1FA 3QRRA 1RWVB 4GVLA 4F26A 5L1JA 1S76D 4DPWA 3DC2A 3P45B 2I8EA 3T1HJ 3FKBA 1S0VA 1S12A 1X4DA 1C2PA 3SFGA 4QBUA 1NHKL 2FTRA 2CWKA 2LQ9A 2OUGA 3KLFA 2F1FA 3WIVA 3PW2A 2CQGA 4OI1A 1F9FA 2ILZA 3N9UC 4NMLA 4WE1A 3D0GE 1VHIA 2HVIA 3LA0A 4FYVB 4ZVTB 1KVJA 1WI8A 3JSRA 1UETA 3PX6A 4C8KA 4ZJQA 4QU6A 1KLMB 3M6WA 3M2UA 4ZLNA 2XCAA 3IM8A 1XERA 1X9SA 4IG3B 1FKOA 2WW4A 4LVOP 3JTOA 1B0PA 3KFWX 4CI0B 1ICEB 4DV6J 1UVNA 2AEMA 3PRDA 2G2OA 4MKVA 1ZM9A 3MPYA 3ILIA 4ZCKA 1UEVA 2EVZA 5DLFA 1IKVA 1VIXA 2HHHF 2BANA 3MMJA 3IRWP 3BZQA 3PV8A 2FJVA 5H9FK 2HVDA 2WSFC 3CJTA 1FRIA 1U25A 4DV1F 6FD1A 3E8OA 2UXBF 5D0HA 3ILJA 2YQ1A 1JXLA 4OL8A 4CYUA 1S6OA 4M5KA 5KFWA 3G9CA 1Y00A 5BXIA 4ZPTR 1GMUA 2ZH7A 1RHRB 4DR1J 3HVTA 2MQQA 2HHVA 2UZAA 1N5QA 1S4EA 3ZZTA 4NEZA 2QMWA 5HMWA 2ZHAA 2BMBA 2KHCA 5I3UB 1SJRA 2PI5A 4IOCQ 3FRZA 4XIUA 3OL7A 1SIZA 3I0RB 5L38A 3JSMB 1RBAA 1VYAA 4DUZJ 3I0SA 3MUMP 1TL1B 4DPXA 1SKWA 2Z58B 4G1IA 4ES2A 5B0CA 2MYFA 4K59A 5FIIA 5C42A 1P9QC 1TTHB 2DNNA 2Q79A 3DRSA 1DHMA 1Q0NA 4IKAA 2DRBA 4K5SA 1FVSA 2OEKA 1DLOA 4ICLA 1R8AA 3C19A 1N88A 2V4JB 3AODA 4B3SJ 2E1AA 5DDRC 2B0GA 3X1LB 2CZ4A 4WTOB 1XK8A 2W2QP 3AY0A 4HTIA 3U02A 2ZH4A 4LF4J 4ECSA 2VG5A 4KHPF 2HFOA 3DDNA 5GMEA 1RBLA 3IGVA 4HR2A 4WJBA 4DHVA 4AFFA 1Q16B 2RMLA 3P3DA 4M5HA 3S8SA 3KK2B 1MNEA 1WKLA 3TJ8A 1TL7B 3NWRA 2WVEA 2ZZTA 4IDKB 3DHXA 2DNGA 1K9MT 1R0CB 1M5VC 2VG7A 4YEAA 2UXCJ 3PNIA 4MYUA 2J7UA 4I4BA 3RG6A 2UU9F 3RAQA 4KH1B 3SMZA 3DLEB 4O44A 3RJMB 2DY1A 2V8VA 2V6AA 1RAOA 2D9PA 5LMUF 4WXOA 4ECTA 4NLWA 2BZ2A 2WSEC 4U8VA 3UN3A 3GIMA 5F0WA 3C3LA 2NXJA 1T9TA 3D1OA 3F41A 4CLUA 4JV2A 2I5JB 2LP4A 4ID5B 5F8MA 4K4TA 1U1QA 3HT3A 1M1HA 3AB2B 2MKCA 4KO0B 2F63A 4GO5X 2L9DA 4FF4A 4M95A 1LOUA 1FWKA 1KFDA 3CJ4A 2Y1RI 4DMZA 4FP9A 4YS2A 4ZVQB 4EO8A 5GMDA 5HANA 5D6GA 5FLXY 1FKPB 4DF8A 3RW7A 4ED7A 4OQJA 4B17A 3ZTSA 2VICA 2ZBPA 4DN0A 1BQMA 3DOLA 1LXJA 2A6MA 1YBTA 4N56A 2CQ0A 3LF0A 5D3GA 3SYZA 4TY8A 2N4CA 3AOCA 2QG9B 1Y3JA 2BVZA 4EO6A 2UUBF 3CCTA 1HBUA 2DH9A 2RD5C 1IR1A 3CMQA 3C46A 4HTJA 1SXLA 2H5IB 1S9GA 2VONA 2IHR1 2C42A 3FBEA 3GV7B 2DIUA 1N6QB 1HHTP 1BXNA 5K20B 3OLAA 5E3RA 5HVFA 4GC7A 4K4VA 4X2BA 4PG6A 1GMVA 3LWMA 1FNXH 2YWEA 3C16A 1RSCA 4A8MP 2POKA 1IKXA 4EBEA 1B70B 1VMBA 3JSMA 2K8GA 2MJUA 2HWTA 3SSSA 1N6QA 4O3SA 3QSYB 1S79A 2QYGA 3K5LA 4NL5A 3DRPB 1LEOA 5KOWA 2OH2A 2MLYA 3R7SB 4X4QA 1IBLJ 3EXYA 2AJ2A 4LR7A 4DU8A 3CJQA 2ADBA 2G4BA 4OFZA 3OLBA 3JYTB 3NS7B 2OD4A 4MK7A 3M05A 3N6LA 3LOUA 5A6WA 5KG1A 2YH0A 1CS4B 3R5BA 2KFYA 3BSOA 3D9BA 3GFHA 7FD1A 2M3DA 2G0CA 1TR0A 2W9CB 4BWMA 4FYYB 1J2VA 3FEZA 1Y3KA 2H5JB 3CDWA 3RW6A 3FGVA 4PXDA 1S9GB 2KZMA 1U1RA 1A6LA 3QO9A 4RBUA 1WC1A 4LRBA 3T5KA 4Z37A 3MOZA 4TU7A 3HMJG 3OSPA 3QAUA 2F8MA 3Q83A 4NRTA 3HXMA 4A8QA 2OIHA 3P49B 5A2QU 3MM6A 1U1OA 1S48A 4AQYJ 3A3NB 1TUVA 3CC7S 1RT6A 3BV8A 2C2MB 1TV6A 5CQGA 2C3PA 3MECB 5CYMB 3GU0A 1KBRA 4G65A 2MY8A 1PIEA 1OY8A 2FZGB 4ZCMA 1UA0A 4WP3A 1NPKA 1D09B 2WVDA 3PYDA 2GVDB 1IVZA 2L9WA 2P9GA 1REGX 1RCOB 3FSIA 2PFDA 3VQTA 4Q5VA 3BO4A 2XLIA 1Q8KA 2HK2A 2DNKA 4MIAA 3KG4A 4Y2AA 1P6TA 1FERA 2BEFA 1BWVA 4ZN3A 3OW2R 1NJYA 3MEDA 2AYGA 5HROA 1HA1A 3FDSA 3I87A 2CA9A 3O3LA 1RA6A 1S1XA 1DAXA 4U9RA 3FFIA 3GYGA 2EKNA 2A10A 3BM7A 3CJKA 2YQ0A 1N0VC 3M30B 1D0EA 4H4MA 5F8NA 2MLZA 2KJWA 2DGWA 3OHBA 1HWIA 3OJUA 2V0NA 1KRPA 1WTFA 1S57A 5KFTA 1S1UB 3KNGA 4YQWA 1T3OA 3OVBA 1DARA 4RO0A 1U0HA 3H2LA 5K8NA 1WG5A 3ZTQA 4X4TA 1XC9A 2DR7A 4DFKA 1N5TA 4ELVA 4CO0A 3POTA 1Q7LB 2OTJS 2F5GA 1CQMA 1D8ZA 1FEHA 4RUAA 4JUZA 1CC7A 3DU6A 3N5FA 5ETNA 4DJBA 3T1YJ 1FKAF 3IRXB 2CJKA 4LMZA 2XMTA 1LWCB 3ISZA 3VGSA 1VQ7S 4X4NA 2CPEA 4K4SA 1NJWA 1S1TB 2OFGX 4NZ7A 3MMCB 1CLFA 4N7TA 3WX4A 4G1PA 2ZH3A 4IG0A 1HKAA 3LQVA 3GIKA 2H54B 3VAMA 1PGZA 2DNPA 1WG1A 2K1RA 4Y2CA 4B9TA 5K8MA 4FXDA 2Q3PA 4QPXA 3WZ0A 1BQNB 1KP6A 2OP5A 4MTPA 4OHWA 4URGA 2XQCA 1HD1A 1NLKL 1BUXA 4U96A 3T9NA 1X4CA 3CEDA 3P96A 4LF8F 1U2RA 4DPYA 3I96A 2DJWA 2XI3A 2XCPA 4CLWA 1Q8IA 5LXYA 1N5YB 3AA9A 4DXLA 2YY3A 4UZBA 4YY3F 2QN6B 4NLQA 4USUA 5HSPA 4ID8A 1UVLA 3M6UA 4S0MA 5AJ3J 4C8OA 1U6FA 2D1CA 2P6TA 2P9EA 4DQSA 1UZHA 3R5CA 3K58A 5HLFB 3FSXA 3DOMA 4B3RJ 1MW7A 2CIMA 3EWGA 5T14A 5C7PA 1QSSA 4C98A 5IT9U 2VC1A 2APOA 1XBWA 3KJNB 5KG4A 1FXRA 4AD6A 1MU2A 4PWUA 3QT7A 2RT3A 1LWEB 3ZTPA 5F8LA 5K5MA 4OJ1A 2DR8A 4JI5J 4IOBA 3WQPA 3M8WA 3CXCR 2ZD1A 4DV2J 1VOMA 5IC6B 1TVRA 1IWGA 2MZQA 2OLWA 3MWBA 3BO3A 4QOTA 1R8PA 4ZP6A 1SV5B 3TEHB 2ZOGA 1S77D 1Y4ZB 2VV5A 3PEJA 4V1Ak 4NA2A 2RQCA 2JLEA 2ZHOA 1IR0A 2HHUA 1RA7A 4UOGA 2W8LA 1RBOB 5F8JA 1HYSA 3G8TA 1I5OB 1UEKA 4IQXA 2O1PA 4EMDA 4C8LA 5D4LA 1X0FA 4NA3A 3RAXA 4NXMJ 3KLVA 2L9NA 5U47A 2D41A 2HQIA 1JLFA 2RNEA 1RWOB 2DHHA 3HHEA 4H54A 3VTIA 3ITHB 1P27B 1T05A 2FUG9 2ZUGA 4UQTA 1VQ8S 5J2MA 4O3RA 5DO2A 1GNKA 1FFGB 3MCNA 2L48A 4A47A 2LFVA 2AYEA 4ZCIA 2XS2A 5EN1A 3UD3P 3GG0A 4I64A 4ZA1A 4DR4J 2BW7A 3G6ES 5DGAA 1S97A 2D69A 3GIRA 1S6QA 4C8YA 3H98A 1S5ZA 1KOHA 4UQGA 3Q86A 5E3QA 4EYHB 4WP8A 2M0GB 2MY7A 4QW8A 4ZP8A 1NHVA 3MUVP 1HFEL 3T5JA 1GMWD 2OEJA 1UFLA 2CQCA 3MM6B 3NGDA 4PG5A 3HD2A 4Q2MA 2QLJB 5THWA 4PUOA 2W8KA 1WHVA 5CCLA 2DGTA 3IBWA 1NJXA 4GVBB 2Y0SD 4ZPDA 4FKYA 3O2IA 3D6TB 3K5NA 2XWYA 2F8EX 3L7OA 4CCHA 1R8CA 2XSFA 2B56A 3FVYA 5E2QA 1X31C 2XNQA 4WCEQ 2R7TA 4QWCA 3GJQB 2KI2A 4KB7A 3T3FA 4N8NA 2ZBRA 3GV5B 2R7OA 1RTHA 3PDNA 3CE8A 4QR1A 1JLFB 2CZVC 2BBEA 3HSDA 1GAOA 4R0EA 4RJVA 5F41A 2FJXA 5CAAA 3D6MB 3TUPA 3RR8A 2B9XA 3NKYA 3QFWA 3O5TB 2JRSA 4UOCA 5BYQA 5GADU 1B7YB 3TAPA 1KWMA 4I56A 3BH7B 4DOZA 4DV4F 2M2BA 2LA6A 2KH9A 1AUSL 4F4WA 4ECYA 1WACA 2G0JA 2HQCA 2OGUA 1WF2A 2GGPB 2HKEA 2RHQB 1FRHA 2OPRA 4FVCA 3T41A 3LAMA 5KFLA 2CQ1A 4NLXA 1NSPA 3MUTP 3JQKA 1FWPA 4NCGB 3Q8RB 3VAIA 3B78A 1RP5A 2XEXA 3ZZYA 2HIQA 1CEZA 3OL8A 4DQIA 1MWZA 2RDDA 2R8IA 5DQGA 2EXUA 2M9KA 4CTAA 1YJNS 5HQMA 1Q4RA 3H4DA 1RGVA 3ELHA 2DNHA 1IBKJ 2GMJA 3D68A 3SCKE 1EETA 4O4GB 1K44A 4P6QA 2Q66A 4C8MA 1DFDA 4CLSA 2HQGA 2X3GA 2X7IA 4RLEA 1O51A 4OZ1A 3NLCA 2FJAB 3OL9A 1YJTA 2QO3A 2HFSA 3UVJB 4DQQA 4M5DA 1ZAWA 2N7YA 4FDFA 4DCOB 2XO6A 1T05B 1Q53A 3SFUA 5C25A 3MEDB 2VG5B 3MHYA 4DV3F 1FI4A 4LT6A 4F50A 1WJ9A 2G13A 4OLOA 3M2VB 4DV5J 3D0HE 3BKFA 3MAHA 2V4JA 1B64A 1E6YA 2DGXA 2ZVIA 3IFEA 2ZOFA 1SKUB 1VRQC 3DOKB 4IH7A 4L73A 4DFMA 3HVWA 2JEGA 3R6GB 3S01A 3L3CA 1SH2A 1YRXA 4ZMMA 3THVA 4EU0A 4N8OA 2HK3A 2EEYA 5L39A 2AHOB 4CLTA 2QA4G 3DLEA 4O44B 3L7PA 4F67A 1LWFB 1JJ4A 2CDQA 3TR5A 2J9CA 3OR2A 1KHVA 1S1VB 3EX7B 5GAGU 3BF4A 4CZCA 2NYHA 4QYZK 4I2PB 1KKHA 4TU9A 4KV8B 4F2RA 3TUJC 4ED4A 3CDAA 3QRQA 3OR2B 1VQMS 4LF9F 3HULA 3W2WB 1MN9A 2UUAJ 1JQGA 4M5DB 2ZWOA 1FDDA 4WFXA 4J9UE 2BDPA 2AGPA 2GZOA 2H1YA 3IR7B 4Z2XA 5LSOA 6AT1B 3PW5A 3Q8PB 4PXCA 1AT1B 1RABB 4MFBB 3OT9A 5HI7A 3ZZOA 5J2PB 2IRYA 5KT6A 3CCJS 2XMMA 4DWIA 2Z56B 2DH7A 4NCAA 2BE2B 3D2WA 4Q45A 1QM9A 2UVWA 4CP5A 4ZLPA 3LALA 1B3TA 1EARA 2G1DA 2A18A 3CT9A 3IG1A 3N6MA 4A8OA 3CD6S 4I67A 3OPKA 2HNZB 4K7QA 3ZZUA 4KGKA 3VALA 3KJVB 2R42A 4R0JA 4F3OA 4LFCF 1K8AT 1AFJA 1SH0A 1V3ZA 3KJFB 4XDDA 3W8GA 1NUEA 4EI2A 3V6HA 2BJ3A 3PZPA 1U48A 1RT4B 2EI5A 3R2DJ 2A3JA 2IAJB 1GXTA 1RTJB 3R7NB 3MTJA 4CYUB 3H25A 3K57A 3RTVA 2QA4S 3K8WA 1HNIB 1R27B 3MMCA 1WHWA 2CRLA 1UVMA 2IYIA 2JLFA 4HLBA 2GVZA 4ZS6A 3WBZA 1OQ6A 3US5A 2Y1JA 4CO3A 1WC0A 3QJLA 2XO7A 4N76A 3OUYA 4H4OB 5C5JA 1DURA 2AZ1A 1FNMA 3W60A 1NDKA 4F7VA 2ZH1A 1FA0A 3TZWA 3TW0A 2E5HA 1HWJA 2K7KA 4ZPBA 2YX4A 5DLGA 1DBDA 4DV7J 3LUYA 3PCOB 1X0PA 4RZRA 2DRDA 1DTTA 3LO3A 4C8ZA 5E33A 4DV6F 3J81U 1F2HA 2W7PA 2V8DA 2JNJA 5AE1A 3SXLA 3ILLA 3MTKA 1SJQA 3L95X 4AXIA 4XDCA 4DV1J 4XAKA 2KVIA 3BGFA 3SZ2A 3J81j 2GCFA 1XIQA 4X4UA 2PI4A 1S49A 2KFNA 2DD8S 4YP3A 4F4AA 2Z30B 3DXSX 4DR1F 2OHDA 1UVKA 4ZITA 5KG7A 4J9LA 1N5VA 2W7OA 2IYGA 1A0OB 3AA8A 3AFGA 3CUNA 3HFKA 3MFHA 1LW2A 2AJQA 4GRSA 4RKUC 4X4VA 1VQOS 1VC5A 4JI7J 3TA2A 3HFVA 1V3RA 4NXNJ 2XZTB 1QE1A 1APSA 1UEUA 3UW1A 4ID5A 4GKKJ 4JV5F 3BJYA 1QTNB 2WONB 1JLAA 1JLBB 1UPPA 2WW8A 1P8GA 2KYZA 3J7YI 3P8BB 5EUHA 3VV2B 4P9SA 2NQPA 4UT4A 2IC3A 5I3PA 2JSXA 1S1XB 4KHPJ 4USMA 1UAWA 4B3TF 4MKAA 1V3SA 2DHGA 3PFOA 3PJ9A 3M8QB 3OBIA 4OX8A 5CYQA 4ITSA 3OVAA 4DUYJ 4NRUA 1KSPA 4G3IA 5CYJA 1N54B 3H0PA 3KDOA 4NLSA 4WK1A 1JXEA 4P74A 2DRAA 3GSDA 4RX6A 4OZ5A 2UXCF 5CHCB 4KC5A 4OIXA 1IKWA 3HHLA 3M8PB 3QIPB 3KK2A 5GAEU 2UU9J 3M8QA 3DDIA 3FMWA 4ZPWR 2FY1A 1HLWA 4NLRA 2C2OB 2KKHA 1CULB 1OQ3A 1SI9A 3P4UB 1UPMB 1RAEB 4KGZB 5FDLA 4A4JA 2A0FB 3GCWP 4G6VB 4IFYB 5LMUJ 1H6KX 1NZ8A 3MEEB 2CNKB 2W9CA 2LEBA 3UD4P 4HKQA 2BKOA 4OX9J 4DG1B 4KPCA 2P2CB 4M5LA 2VIHA 1B7FA 4LUBA 3QZ8A 2VFSA 3DXBA 1ZYQA 1KD1T 4QR0A 3I31A 1XR5A 2IMOA 5IM0B 3GLJA 1IKVB 2EBEA 4Q2LA 1RHMB 2IAJA 1REVB 2X51A 2C2NA 4PEOA 1KTQA 2RS8A 3DLHA 4J5OA 3OV7A 3H2VE 2XMKA 1FHTA 3R9LA 3W2VB 5DQHA 1DTQB 1S4FA 3JXOA 1OPZA 3ISND 2HHTA 3BSAA 2ZE2B 4KKOA 1ZAXA 5DS7A 5BJRA 1V6HA 2GJ2A 3KG1A 4F3QA 2J9DA 3J7YU 5IOLA 4ER8A 2K1RB 2MHEA 5B0DA 1AXQA 4N77A 2FLLA 3RYLA 3RRGA 5KFEA 1DTQA 1Y9OA 2AX1A 1YI2S 5KT2A 2PO4A 3VGUA 2JH3A 4X4RA 3OTDA 1VI7A 4DV0F 2X1GA 1VFJA 1WEXA 5HJXA 1JLEA 1DY3A 4XPEA 4PWDB 3RB6A 4C3MA 3FBCA 1JLQB 3UCUP 3GFXA 3C8YA 3GTYX 1NK4A 1T03A 1AROP 1BWEA 5G0RA 3W64A 5KFMA 3R2CJ 1N33J 1FXLA 1T02A 3MMBA 4L6V3 1ZM3A 3EICA 2BABA 3GP9A 4X64J 2KU7A 3MM8A 4YMEA 3GYXB 4A8YA 1REVA 1TL4A 2RJZA 4B08A 1L3VA 2L41A 1D9AA 3UNGC 4KR0B 2VU5A 4OYWA 3CJ5A 2O67A 4EUVA 2XI2A 3NY0A 4ZVFA 4TU8A 1S10A 3LP2B 5F8IA 2B9YA 2WB4A 3BREA 2MXYA 2KM8B 2R7WA 4X65J 3QQCD 1I94J 2OTLS 2MLXA 3CJ8A 1NPPA 3UDCA 2WOMA 4PYDA 2FLOA 4LFAJ 3D5MA 1UCNA 3J80Y 3FFIB 5DM6Q 1N32J 3GIIA 2GHPA 1RHKB 4ECXA 1RHQB 2KL8A 3OTEA 1T94A 1QAYA 1PJ7A 2YVSA 4NPOA 2VC0A 2FHJA 2MPUA 2DKOB 4CLKA 1K73T 1OYDA 1ZPWX 3QIPA 2E7VA 2XB2D 4AT1B 3D67A 1KHWA 3EMTA 3UCGA 4K4WA 1TKTB 9ATCB 1SBRA 4HDGA 4URQU 4AQYF 4LRDA 4IO9Q 2WTFA 1C0UA 4IFYA 1VDHA 2MQLA 3PKYA 1HNWF 4DX6A 4WU2A 2B3TB 4OI6A 1NB7A 5T7LA 2VA2A 2RHSB 1TZ0A 3NRBA 2G0IA 2EBGA 2B7CB 1U47A 3M8PA 3NWGA 4NLGA 1MLAA 1IXKA 3LW5C 2EFVA 1LWCA 4CO1A 3KTQA 2D74B 4F4YA 1NO8A 4LIRA 5EWGA 5BR8J 3KLHB 3HX9A 1VQNS 5FDLB 4OJ3A 3KOAA 3KYLA 3HVTB 1URNA 1JB0C 1BC6A 4UTGA 1S59A 2B5JA 3TWZA 1HBOB 2DNZA 5C2GA 2RS2A 2DPJA 2OPPB 3I0RA 4K5RA 5HMXA 2GFFA 3M8YA 2R2TA 3Q23A 4DR3F 2CPHA 4X62F 1R0AB 1PSDA 4K8RA 2AMCB 2HWIA 4KE5A 4EZ6A 1SUQB 1WWHA 5L9NA 5KFSA 3BBBA 4G1QB 4LSZB 3AHPA 4ZVOB 2JDJA 4H4MB 1EAYC 5IXUA 4MIBA 2BM0A 4BBYA 3BQ1A 1TK0A 3I9ZA 1YJWS 3CDUA 2AEJA 2B4PA 2DY9A 2B6AB 3RUBL 4NX9A 1CBKA 5I3UA 1JKHA 1NJZA 5L1IA 1XMQF 2RKIB 2ZDPA 1J27A 1AZSA 1IJEB 1VIOA 2NXCA 2YWGA 3M6XA 4KBIA 5EWEA 4A8SA 3FQLA 3SQOP 3T1YF 2J5AA 1U02A 4J9RA 4OYBA 4IUFA 1HQEB 2CPDA 1PILA 5ETTA 4TQRA 2PIIA 1LQ9A 4F4KA 3E51A 2YXLA 3S1TA 1FJGF 3GPAA 1FDNA 3H40A 1QSYA 1RT6B 2B51A 4PPZA 4DL2A 3L09A 1NK5A 2GQCA 5A76A 5E3PA 4IOAQ 2R7UA 2CJAA 4USJC 5BYSA 3HVAA 4ED3A 4JI8F 1U6BA 1R8HA 3EXCX 3MMBB 3UPFA 2GAHC 2UUCJ 1NBEB 2FJWA 3D28A 1OIAA 3GR0A 4WWSA 3CJ2A 3T5LA 4DL4A 4Q43A 4NLYA 4Y65A 1EQ0A 3DHWC 3R5GA 3ZZRA 3KLEB 2GO8A 1YGYA 4KGVB 2DYAA 2DNMA 2NYIA 2WVBA 4LF4F 3Q8YA 4C0HA 2FHKA 1TKXA 4F04B 1R89A 4CO4A 2VQEF 4O23A 2VPZB 2YPYA 3CMES 2JEIA 1F60B 3RBEA 3D3CJ 1L3KA 3D54A 1VS3A 1X5OA 3W3SA 4ECRA 2MSTA 4FN5A 1T8EA 1ACMB 1MG7A 2CPJA 1WHXA 4OLPA 1MN7A 3NOCA 4K4UA 2KFZA 3Q22A 4KYZA 2VOOA 3KUEA 1RTHB 4AE5A 4DL6A 3IAS9 1EP4A 3ISNC 1KEKA 4YR3A 1N48A 3RB4A 2FC9A 2GMHA 2WRMA 3GILA 3LP1B 3MM9B 1FDAA 1M90T 4DV2F 1HMVA 3GFYA 1O8BA 3C16B 2E5LJ 5L9XA 1FX2A 3K89A 1EP4B 3OXLA 3J7Z5 4YB6A 2ZUAA 1SC6A 1TU0B 1RT1A 2LQ5A 4DSFA 1CJVB 2MQOA 1C1BA 4Q7AA 2XM3A 1HL6A 2GQ2A 1QTMA 4F4ZA 5D4PA 2HG4A 4ANDA 1RAFB 3AOBA 5L8RC 1KQFB 1GK8A 2AJ0A 2YNFB 1FK9B 3CCUS 5EHHA 1Q7YT 5C24B 2DK2A 2MQNA 2BYCA 1L5UA 4DSKA 4CM0A 2HZVA 3OR1B 4D3GA 5DQIA 3V6DA 1PC5A 2A2DA 4J9KA 4PXEA 3AXMA 1VQ6S 2OPQA 2ALYB 3AXKA 5ETQA 2XLJA 1PYTA 2NXNA 4UY85 2UXDF 1ZM2A 1FK9A 3EPGA 5DRKA 2X3DA 3W2WA 3H5UA 3W5ZA 1IUJA 3QT6A 4DR4F 2AP6A 2OI2A 3IBFB 1VQPS 1EETB 4O4GA 4ILLA 3RAMA 4J9VA 4DX8H 4RWWA 2WBMA 3PJXA 3MAAA 2V4RA 3HFZB 4HH0A 2QE5A 4NLPA 1RT7A 3TA0A 3SSRA 3TAMB 6FDRA 2DGSA 3UVJA 2R7RA 4DFPA 1LV5A 2OPSB 4NWBA 2ALZA 4NLVA 3N4WA 1RTZA 2HLTA 4P71A 3UNYA 2ERRA 1CVJA 5T7LB 5KG2A 2K7JA 2AGQA 3AD8C 3MDFA 1YJ9S 1HQEA 4USIA 4XK8C 2O5DA 4TNOA 5HP1B 5KT4A 1IBLF 2QJ3A 1E6YB 2VDIA 3ADAC 3CCLS 3DMJA 4RW9A 3DRPA 3HKZD 1YZ6A 2FIUA 2J7KA 3LAKA 4MAKA 3V4IA 2PC6A 1NCLA 3G96A 3KDNA 3PHTA 3PRVA 3VAJA 3D6HB 4ZVUB 2D7SA 2MGZA 4ZVGA 3R8YA 1TKXB 3I56S 5KT3A 2FZKB 3TUIC 4WFYA 4DR5J 2J9EA 2FDNA 2JEJA 3DMJB 1QY7A 3M1VA 2OEMA 2RH3A 4NOHA 3G87A 2ZBCA 2IM0A 4ZVRB 3GYNA 2VOPA 2MKKA 1ZOTA 2FLPA 3EE3A 5K8PA 1NJIT 3OTBA 3K0JA 5F3TA 1KVKA 3NAHA 1FKPA 1F1BB 3ZFVA 1QVFR 2AYMA 5KG6A 4V19J 2IPOB 4DR7F 1SIWB 4CNZA 2ZC3A 3TUZC 2Z2ZA 2C28A 1Q86T 4KFBA 3LP0A 4F3MA 3TX0A 3I5AA 3JB9k 3K17A 2VODA 2W2MP 4DFJA 1KDNA 2JJ4D 3B4DA 3FC9A 4DG1A 1HNIA 1BMQB 3A8EA 4KRWA 3J7ZT 4BWJA 1QDUB 2NXUA 4KFBB 3OFHA 1UW9A 2BE2A 5D77A 2P8IA 3WC0A 4CWBA 1SKRA 3BGUA 2HZAA 2NLWA 1A9NB 1S1TA 2HQ3A 1H74A 2HNZA 3DM2B 3CO9A 3TANA 4DSLA 4LFBF 3GCXP 1JNRB 1RHJB 1S6UA 1ZZNA 1UA1A 2GHVC 3R5JB 4OYOA 2BJ1A 2WAQD 2GQQA 1OO0B 3A4TA 3HI9A 3TX8A 1QAIA 1UZDA 3QIDA 4LSLB 2M88A 3I6PA 4KKOB 4QIWD 4GKJF 2VBXA 4LIWA 4OZJA 4ZIVA 2UUWA 1WSVA 4USWA 4K4YA 1HWLA 1Y11A 2CG4A 4GVBA 4X4PA 2YNFA 3H5XA 3HT0A 4HI1A 5AXNA 2ZBIA 5F0UA 4ZIWA 3AOAA 1U0SA 2ZKUA 4CLZA 4OHYA 1VC6A 1LFPA 5A2QY 4UUWA 2C2EA 3IP0A 5CCMA 2J0QD 2DXDA 1JLGB 1B0TA 1D3WA 2QX0A 4OI3A 1TK8A 2V68A 4ETZA 3PACA 2HBRB 4RW8A 4C9DA 1KOOA 3CCWA 1TUGB 4ZVSB 2CJXB 2FHJD 4DR2J 1TFYA 1ITPA 1NPRA 2KXNB 3K59A 2FD2A 2Z8QA 3MD3A 3MEEA 3MCSA 5KFYA 2ZJPQ 4DCPB 3EZ5A 1Y7PA 2MB0B 1WNEA 1YBAA 1XNQF 5AXMA 4WBFA 3BN4A 3T9ZA 4A8KA 1OPIA 1PJ5A 1F2GA 2KB2A 4ZHRB 5KG5A 2F9DA 3GB0A 5KT7A 3VF0B 2NXEA 2UUAF 2GGPA 3F44A 2XSJB 2O3DA 3CF5Q 3D1QA 1F9HA 2CXEA 1F3FA 1LW0A 2RF2B 3BR8A 2E9RX 3U1LA 2P9CA 2JZ5A 5KFPA 4IQMA 2XLKA 1RCXB 1VC0A 1HWUA 3JYTA 3D7SB 3BYPA 4OI0A 3PKMA 2CJQA 2U2FA 4U7UD 1V9OA 2UUCF 4CT9A 2HRUA 1FJ7A 4WPAA 1DLOB 5IQQA 3M9MB 1QJHA 1V5IB 2ZHBA 5KFKA 2COLA 4B9MA 4LFCJ 2JFKA 4I6AA 3UE2A 3KLEA 2D3OR 2E29A 4FF3A 1M1KT 5DM7Q 2UV8A 3I4PA 4MT1A 5IS2A 5F8HA 2W9AA 4ED2A 3BYRA 1RZMA 3W5YA 5HLFA 3CGIA 4KY3A 2M4MA 4QWEA 2DT9A 3U1NA 1ZM4A 4PAAA 1KQKA 1HNVB 1RTJA 2FC8A 1YQHA 2KT2A 1RTIA 4BC7A 2KYXA 2X1BA 3ENQA 5EGYA 2ZJRQ 1QSLA 4C4WA 4WYLA 1GH8A 4H4KA 3TAMA 4YDDB 1KC8T 2DGOA 1FJCA 5FJ4A 5ETOA 3C15B 1F5AA 5K8OA 1TL3A 2BX6A 2HIYA 4WYWA 4M5NA 2DXEA 4RW7A 4MK8A 3FEXB 3R3TA 1W25A 5IC4B 3SCLE 4RNFA 4QU7A 4OYZA 3UDLA 1NSQA 4O4RA 3W9JA 3BKUA 2DPIA 2EFNA 2OPRB 3DNCA 3QGHA 4EFAC 2PMZD 3JAMU 4G1QA 4DL3A 1SC4B 3G71S 4LF5F 4DR6J 2HQFA 3DDKA 2OFHX 2P6SA 1SKSA 3HHKA 4QIVA 4KH0B 1O6XA 3N0VA 4Y28C 1UVJA 2BJEA 2NSCA 1JLCA 1LXNA 1NH8A 2ZH6A 1NKBA 3THTA 3W8PA 5A8WA 2B4OA 2W4CA 1U1MA 4NLTA 1UTAA 4C7QA 2C3MA 3A8JA 2ATCB 3I9V9 5DGBA 4FBUA 2LEPA 2QMUB 1RTDB 1UW4A 1IBCB 1UJ6A 2FY8A 3AD7C 5CA5A 1CJUA 5EX3A 2Q1LA 3I32A 4JB8B 2CPYA 1T0TV 3RU0A 4CLPA 1TKTA 4CO5A 3AH6A 5EWFA 3IWNC 2LQJA 1TL7A 4IDKA 4DZ6A 2FHMA 4AYBD 5SZTA 2IVFB 1BE4A 9RUBA 2GA7A 3JSYA 3KLHA 2KT5A 2MKHA 3M8SA 4UOFA 5DG8A 1BLUA 2H51B 1QUVA 5SUHA 2VZ9A 1S9EB 3RZAA 1IM4A 2IDEA 2QA1A 3CJ3A 2DNYA 1KR4A 1PC4A 2BJ7A 3KLIA 1U0HB 5I3QA 2WHOA 1X5PA 3J7AN 3LGNA 2J0SD 3KJQB 2R2RA 1G2EA 3VWSA 3MCMA 2B4VA 4BLGA 3DM2A 4QIFA 4WIIA 2GIQA 4DUYF 3E2EA 1U7LA 2V5HG 5AXLA 1RKJA 3KHRA 3PO4A 3CC2S 1XEZA 2I9SA 5A8WB 3GR1A 2JC1A 4NEYA 2K06A 3RB3A 2HHSA 2QL5B 3C66A 2XY7A 4K2XA 1RE1B 5ETPA 1FRKA 5FLXU 1SJ1A 3A13A 1HI0P 2J6SA 2MKIA 3VAHA 1DQAA 2B9EA 2K3IA 3JS9A 4QIEA 3LTOA 1QUPA 2QLBB 4UOHA 2NCKL 2XC9A 3H42A 5D4OA 2L08A 1M0SA 4RW6A 2NZCA 1T9YA 2VF3A 2YWHA 4P75A 4LREA 5D0EA 3ULHA 3OSNA 5HJYA 2QFJA 3ZZ0A 4PWDA 3OFFA 2ZM6F 4DUTA 2HYIB 3LP1A 1IBMF 3OTOJ 1B4SA 5G0RB 4K0KJ 3W9IA 1JLGA 3TAQA 4YR2A 1Q8BA 3HHDA 1RTDA 4F2SA 1GQEA 2ACYA 1N4LA 5DETA 2J0XA 4RL1A 2KTQA 3FUYA 3TP2A 2QRRA 3FEYB 4FZVA 1YRUA 7FDRA 5HN0A 5KFQA 3KK1A 1U1LA 4JI4J 3NCQA 5KOXA 4ZLJA 2V8GA 2DH8A 3EZUA 3N79A 4OZNA 3FZBA 4USTA 4DS4A 1NMEB 3DLLQ 4PCQA 2GX8A 4CLFA 2NR0A 1PYSB 4O3OA 1UFWA 4LBPA 2ZH8A 3PVXA 2D3ZA 3K2YA 3MPDA 1OJ4A 2C22A 4ERDA 2G1HA 1PO6A 1YVFA 2IVYA 3IC1A 3F73A 3BEGB 4ZPVR 4DDFA 8AT1B 2CQ4A 2UVUA 1HNZF 2HW3A 1RT5B 2E5GA 2QFIA 4PQAA 2DCUB 3M2RB 3MPWA 4DV3J 1Q95G 1ZAVA 1FWLA 2YH1A 4IFVA 4J9PA 1S1WA 3B54A 4DV5F 2XMWA 4P72A 3CCES 3V81A 3JTNA 4C6AA 1T3NA 1RT7B 1NB2A 2PT0A 5IT4A 1OYEA 2HFVA 4EBDA 5LSRA 4NI2B 2I5JA 2RRAA 2I0XA 1D8YA 4X64F 2QA2A 3W61A 5AE2A 3ILOA 2YNIA 3HZEA 3GJTB 4LSNB 5HQLA 1I6JA 1FJEB 4W92B 1SQGA 1RAJA 3MEGA 3KK1B 4QQBA 4F0MA 1M5PC 4ZCLA 4JOUA 4MIWA 2R2SA 4J37A 1WD6A 3A8IA 3T6BA 2XYHB 1K0VA 2J76E 1D9DA 2I38A 2AQ4A 1J5EJ 3BDPA 5KAKA 2RF2A 1URRA 2JX2A 2OPSA 5KFAA 2DCLA 1X5TA 4I2QB 4LF9J 3M30A 2CQPA 3J7A1 2OPPA 3H2UB 3GQCA 2ZOMA 1FXDA 2CZ9A 4BC9A 4F8RA 3UDVA 4RBTA 2DO0A 2FJDB 4J90A 5DDQC 1CJKA 3EYZA 3UO0A 2WBRA 4KHMA 4CDIA 3EPIA 1TAUA 3FRYA 2GJFA 1TMMA 1TL5A 1S0NA 4OHZA 4FF2A 4Z7YA 1JJCB 5LMNF 2J0WA 2RVJA 2J7WA 2R3VA 5IQ6A 1HQUA 1W2BR 2EFQA 3DLJA 1CJKB 1RWNB 3TRGA 3TVYA 3W66A 1RU2A 4TYBA 2OSRA 3TZZA 2N7CA 4QWDA 4DU7A 1QLNA 1IWAA 2XMJA 3MZIA 2FJEB 2E9TA 1IQZA 1DQ8A 2FPHX 2ZDOA 4ZLLA 4F0HA 5F9LA 2H4YB 4P2SA 1HQUB 2ABYA 2HGNA 2M7SA 1SQEA 1SJFA 5B0EA 4TY9A 3ONQA 3M2VA 4QJVA 5DZ6A 3IR5B 3Q89A 5AE3A 4ZVPB 4WFNQ 2XGQA 1VQKS 1LNQA 4CO2A 4B9VA 2K3KA 4B3OB 1L3UA 4CLYA 5KFFA 5HBMB 1TL1A 3K5MA 4IRDA 1TK5A 2Z0GA 5I42A 3RBZA 4DR3J 1ULRA 4X62J 3EDRB 4QYRA 3QPIA 4DS5A 3T5HA 3DN9A 1N0UA 2QL7B 4XTTA 2KM8C 4NZ0A 1S6PB 4B9UA 3DYAB 8ATCB 2D3UA 3QO9B 2CG8A 2MHNA 1C4AA 4DSIA 4ILMA 4LF2A 4JI0F 4DV7F 1SJ4P 1NU4A 2R4FA 1RT2A 3CTRA 1TELA 4YR0A 3PW0A 3QGIA 1Q1KA 1YJVA 2HVZA 4RBVA 1NHUA 5M2PA 4J9MA 4B3MF 1BQNA 1TQLA 4NLDA 3VZHA 1ZETA 2F9JA 3UCZP 2M8DB 2HEKA 3TZYA 3QGGA 4CTAB 3L9ZA 1ELOA 4U7CA 3MEGB 4WK3A 1L3TA 3EZOA 2AV5A 2MQPA 4HHHA 2BRKA 2OJ3A 2W4DA 1FJGJ 4K4ZA 1O0PA 2QMXA 1CPZA 2CJ9A 4WIQA 2R8GA 2JEFA 1HBUB 5D0RA 2V50A 2LXFA 2C3OA 3IWLA 4K2JA 2DR5A 2PGCA 3BB5A 3PJWA 1RISA 3HLUA 2M70A 3KJVA 3KUGA 3RBDA 4NXNF 1SL2A 2ASYA 4DSEA 4MK9A 3DYAA 3Q0AA 4GKKF 1XJWB 3LWLA 4JV5J 2HURA 4ED8A 4N41A 1J5OA 2LXIA 3HCXA 1RT2B 2DB1A 4HI2A 3TOQA 3OXFA 4IG3A 2YKAA 1HBOA 1ZZFA 2GW8A 1QAJA 3FBBA 1VBXA 2B7BB 5B0BA 1AUDA 1MSWD 2RRBA 5IT0A 4OYXA 3CJ0A 1WI6A 2YNGA 4RU9A 4FS1A 3QJJA 4JYAJ 4ETXA 3K8VA 3HDSA 4TY8B 2L3MA 2FZCB 3CPWR 2F4VJ 2QSWA 1HW8A 1XN9A 3JQJA 5IV3A 2CNOB 4L76A 4UY8T 4TLRA 3HPOA 1Q81T 4I2PA 3JQMA 1GEHA 1RADB 5K14B 5KFGA 3TI0A 3ETOA 1NK9A 3KMQA 4Q0BB 2DHXA 2BJ8A 3TVZA 2CQDA 1I51B 2LU2A 2YWWA 3Q2SC 2BQRA 3EGWB 2XHWA 4YB7A 3QATA 5GMKa 2AKWB 4CH1A 2VPXB 5J2MB 1EHWA 4JI3F 3WIUA 4CNYA 5JUMA 1S0OA 2QLWA 4LVNP 2AEFA 2V94A 3POTB 1PKUA 4FVMA 4ES1A 2XY5A 1JX4A 2OMLA 3CCZA 4ZK7M 2IVMA 2HNDA 5CD4A 2XGPA 2CQHA 1LWFA 3NGUA 1PJ6A 3PX4A 1H2TZ 2E5IA 5H1SV 1TKDA 3CIZA 3M7VA 3MECA 4LF1A 5CYMA 4ZKAA 5KTQA 1RXOB 1TKZA 1XQIA 1HHQA 2FVRA 3CULA 2I6WA 3PR5B 4ENOA 1X4GA 1QE1B 2C3YA 1N5SA 1SV5A 5C24A 4OYMA 1VRTA 1UJ4A 2CPIA 2MJNA 3EUNA 2V2QA 4H4KC 5CH7B 3W5XA 2VJVA 2DR9A 2NUUG 4W90B 2DITA 4FNIA 4LRAA 1JLCB 4RW7B 4YN3B 5A0YB 1XNRJ 2DNQA 1K0TA 4QYZJ 1GXLA 4UW2A 3ICLA 3IMQJ 4W98A 1IKYA 4DV0J 4E2FB 2AF6A 3MF5A 3MR5A 2VPYB 2VUGA 3LGHA 1HPZA 3KHGA 4FF1A 4M1KA 2KRBA 4ICLB 1NDCA 3PX0A 2GHWA 2V9WA 1CS4A 1N34J 1RJJA 1WC3A 3D0IE 3AJ1A 4WU3A 3M8ZA 4XO0A 1Q79A 3ZTOA 1GT8A 2GAGC 2XMVA 2DVIA 1H73A 4LRFA 4F02A 1XR7A 4B9LA 5E3CA 1YLXA 3I55S 1RK8A 2PA8D 2FGOA 4JV0A 1MROB 1OY9A 2F40A 2WB1D 4JI2J 1U8WA 2VHGA 2F4FA 3FMBA 5LSLA 4JBCA 5L1LA 1WKKA 3MAQA 2IIHA 4DSJA 2GJIA 2VL1A 1EKRA 2V2KA 3HHLD 1PBUA 5CXTA 3RGIA 5F9NA 4X65F 3NNAA 4DR5F 3V4IB 3NBPA 3RBXA 1VBKA 1TMJA 2CFXA 2VBYA 3AJDA 1U8SA 2PEBA 3QT8A 1N5YA 5LOQA 5HL7Q 5GVQA 3VR1A 1H98A 1RT5A 4QWAA 3RRKA 1N36J 4FXWA 1X7VA 1G6BA 3U27A 3CD7A 3KLIB 4YB1P 3G82B 1FKOB 5KFBA 1U09A 2J8SA 4ZJLA 4NASA 4GMKA 3C6UB 3NAIA 4NYPA 5IWAJ 1UMJA 5KG3A 5HROB 2MZ1A 5J2PA 1WELA 4RW6B 3TA1A 1KLNA 3GMGA 1LW0B 2D9OA 3PIOQ 4IR1A 5IT9Y 4I6YA 4B9SA 1JKHB 1YKWA 1RLCL 4B02A 3VQSA 3KLFB 4DQPA 1C1CB 3C14B 3E01B 4J9SA 4KJIA 1UP1A 5CZVA 3FZ2A 1F0XA 3UR0A 3ZTRA 3PO5A 3W63A 1FFSB 2HAIA 1JLEB 3BPSP 4DEZA 1S1UA 5BR8F 3OQ2A 1VQ5S 4RW4B 1RI7A 2Y3YA 1ZA2B 3QYYA 2XZWA 1W26A 3JAMY 5T41A 2M5YA 4DX7A 1KONA 3DRRA 2AZ3A 5A8KB 3MPVA 1OS5A 3BBCA 3CVKA 4PWWA 4X66J 2BRLA 2VDHA 1Z1ZA 2XWXA 3R5AA 4OZ2A 4GKJJ 2IBOA 1JMTA 2PN6A 3CNQP 4MFBA 5B0FA 4O3PA 1I1GA 2DIVA 4E8UA 5KFCA 1MWYA 1FDBA 1VLOA 1WF1A 1NRKA 1R0AA 2W2OP 2V2VA 4LF6F 1L3SA 5I42B 1J5OB 2HS4A 3FK4A 1KFSA 4YHHF 1TFWA 2BR0A 4FPIA 2FJBB 2JWNA 3I5BA 3G6XA 2R7VA 3DLBA 3QLHA 1WC6A 2FHOB 2LDYA 4EYIB 4RR5A 3PR4A 4BHQA 1XMQJ 4DL0C 4DR2F 2HMIA 2Q6BA 2F3JA 4WTYA 2YX7A 4DLGA 4J9NA 1P1TA 4EBCA 4OX7A 3B4MA 2GVDA 2K2PA 4CRJA 2HS0A 4JI6F 3C6TA 1MMLA 1T11A 4L75A 2KXFA 1JNZB 4QR2A 4ED0A 1GMWA 1N52B 2AJFE 2E44A 5K14A 3SBMA 1LWXA 3A1YG 4FYDA 3CDBA 3NCRA 2R2UA 4F0KA 4IO1A 1AW0A 2EK6A 3MM9A 2IMWP 5LJ5Y 4JI8J 1HNXF 2MMYA 2YKMA 2RUGA 1VHFA 3JSBA 2WK4A 4NCGA 2NPFA 4I1TA 2CJYB 2XULA 1FFWB 2B9WA 5ETMA 2ZITA 3HF5A 1UKUA 4U67Q 1RAHB 4Q8FA 2NPIA 2CQ2A 2HRYA 4LBIA 1AA1B 3H7HB 4J91A 1UWAA 2EKYA 3Q8VA 4OX6A 4OX9F 4DPTA 2VQFF 4A8WA 1ZH5A 4WZMA 2Y1IA 3CJSA 1Y10A 2VQEJ 5GAHU 3DU5A 4NE9C 2QGFB 1NKEA 2H65B 1VQLS 3VVTA 1GX6A 2HBYB 2QZ8A 2DTJA 2CVIA 2DEJA 3NS5A 2NREA 4J7CA 2FGCA 2ZE2A 3V2UC 5GAGI 3M8RA 1F6TA 2WVFA 5GAEI 3GG1A 4ED1A 4FBTA 1VJWA 3HSJA 5JXSA 2AJ1A 2LCWA 3BSNA 3T1HF 1YDLA 2CUYA 4NMXA 4YFUA 4BDPA 2ZJQQ 4Y6IA 4DCJB 2N4DA 1FTCA 4F25A 5B0GA 4ECZA 3DRXA 2W01A 3M1VB 2W4PA 2QV6A 3H8YA 2KG1A 3DFEA 5D4NA 1HNVA 4ZVHA 4J9OA 2E5LF 1NAQA 3TZXA 3DOMB 1R31A 1X60A 1RWKB 1FTRA 3EM1A 1BD6A 2JLGA 4Q8EA 1WTBA 1HARA 3WHIA 2BKNA 2AWZA 2DGVA 4CT8A 1FE4A 1NDPA 2Z2YB 5A8RA 1RKIA 3DLGA 3FCVA 4KT0C 4LF7F 3BSCA 3D1HA 3DGVA 3Q8QB 4LF5J 1VCTA 4U8YA 3E3XA 2B5JB 2A1BA 4I7FA 3P5TL 4KGXB 4C11A 4RNNA 2R7XA 1U1PA 3IG1B 1F5CA 5A0YA 3SCJE 2UXBJ 3TYTA 4RUBA 2CADA 4R8UA 2E1PA 4J9QA 4ECWA 2UXDJ 4XPCA 1P1LA 1XR6A 2WOMB 2V63A 4OHVA 5HK4A 1JLBA 1Z4UA 2DR6A 2HBQB 2NSBA 2W2NP 3JTPA 4EK2A 2A6OA 1RWXB 2XS5A 4FNHA 2C2DA 5GAHI 2RQMA 5HAOA 3D6FB 2ZH2A 1IN0A 2HPUA 1WSRA 3EGVA 1Q78A 1VRUA 2KDOA 2HHWA 3ET6A 3Q24A 2UP1A 3QBCA 1RLDA 2LA4A 3PHEA 1S0MA 1CJTA 3GJRB 1TV6B 4LQ9A 3ZO7A 2MKJA 2OELA 3CD0A 2PDAA 3BO2A 3CCMS 1JLQA 2Q43A 4L72B 4AL6A 2JVOA 2ZKTA 3O1LA 2JFDA 1M5SA 2EFGA 1FNOA 4A46A 4CH0S 3PYFA 2D3O1 3PY8A 3C2PA 4I2QA 1HYSB 4ANEA 4Y3CA 1WEZA 3PFEA 5ETRA 3PXGa 2BANB 2DNRA 3OL6A 1NK8A 2BV3A 3HM9A 3FSYA 1SC1B 4A8XA 4NLUA 4R5PA 1RACB 4HDHA 1GTHA 5JJBA 4OJGA 2CJBA 4DZDA 3I4HX 2M8HA 1U2FA 2RAQA 3AQPA 2CPZA 2OD6A 2V9KA 2MZTA 2YNGB 3A3OB 3BS9A 3KKFA 3OJSA 4AUKA 2LLZA 4C3KA 3BGLA 3L4BC 2UVVA 3BBFA 1S99A 1T9WA 1LFWA 3SDEA 2R7QA 2W24A 4OV1A 4RNMA 2PMHA 4YOEA 2XHCA 3NL0A 4DR7J 4PG8A 1G4CA 5C42B 2BQUA 4KIAA 3MFIA 1LW2B 2HLUA 3B8HA 2ZM6J 2QLXA 1YBUA 1M5OC 1BHNA 2DNLA 4HACA 3OTOF 3QJPA 2E66A 1KS2A 4D3HA 1XWLA 3CWJA 4Y34A 4NLOA 5E7OB 1FESA 2AT1B 1M5KC 2BJDA 1KVIA 1ZBTA 1RT3A 1N56A 3C6UA 4PYAA 4YUDA 1RTIB 5KFZA 1SVDA 2YKNA 3MD1A 2FVPA 1F3VA 1OWXA 1KLMA 1T9VA 4OZ0A 5B08A 1NDLA 4ZPAA 1U4BA 2BOPA 1XMOF 3VAFA 2E9ZA 3MEKA 5KFJA 4LFBJ 1T7PA 4L3KA 5HVGA 4M5MA 5FD1A 5H9FJ 3IS9B 5DZ7A 4WF9Q 4Y2IA 2FLNA 2UUBJ 3HO1A 3NXZA 5HP1A 3MURP 3PYGA 1X9MA 2LDIA 1HNZJ 1H3DA 4PQUA 1FRMA 1RAAB 2C1EB 1XMBA 3M6VA 2N3OA 2MZSA 2N82B 2CWXA 1PBAA 1GXUA 2RQKA 2ZWPA 5MAOA 3KWMA 2MGZB 3VAKA 4C3LA 2VASA 4ECVA 4M94A 2EC0A 2HSEB 4UZCA 2R8JA 3VAGA 5HMZA 3CJKB 4ED6A 2Z2LA 1ZS6A 2B6AA 1B0VA 2MQ8A 2RU9A 1WOSA 2QLFB 3G86A 2R8KA 4V19X 3TJAA 1VISA 1RYSA 2BW2A 2UVRA 3LPEA 1VQ9S 4I6WA 3GSIA 1IKYB 3SQGB 1J5EF 4E98A 4Q44A 4OZLA 3CCSS 1XNQJ 1IQTA 3FQKA 3OD2A 4TKTA 2R8HA 1D9FA 2VBZA 2WSCC 1FX4A 4EEYA 2J8AA 4DPOA 1GFWB 4ED5A 4C48A 2U1AA 5GADI 2ADCA 4PZVA 4UF4A 2HNYB 1IR2A 2RIJA 4PQUB 2LMIA 1P9YA 1VJQA 1S6PA 1WC4A 2H48B 4O3NA 5C25B 3R27A 1TKZB 2YWKA 2Z4PA 4QW9A 4LQ3A 5D8HB 1UJ5A 2CDRB 3AT1B 2MKSA 4USVA 1S7IA 4JI1F 2ROEA 4TVAB 2KZZA 2DGQA 2J6TA 3MR2A 2IM1A 3OHAA 3CCVS 2B8QA 3TVKA 1VK8A 2DEIA 3K7RA 2H5EA 2E7XA 4MMOA 1TUWA 3THPA 4C11B 4GC6A 2ATLA 1R3NA 4LSLA 1U45A 1NSKL 2GMLA 2YX1A 1X4AA 4R25A 1H0HB 1HR0J 2KJVA 3ZC4A 4PG7A 1N8RT 3KK3B 4PG4A 4YB5A 1K1QA 2EC2A 2KG0A 4DQRA 5H9EK 3KNAA 5HMYA 4O0NA 3UWTA 4P52A 3CCRS 1Y5IB 1G7CB 1M5HA 2V34A 4M63A 5LJ3Y 2R9LA 1NM2A 2BJ9A 3OFGA 1WOOA 1ROFA 3O6QA 3WDOA 1JJ2R 4ECUA 4M5JA 1HQ2A 3FNNA 3BN7A 2V8PA 3ENAA 2AW0A 2KO1A 5LL6d 4C0BA 1SH3A 2QT7A 3W7BA 5KFHA 4DLEA 4ELUA 2EFPA 2PEHA 3QFHA 2GIFA 2VJUA 1C0TA 1T03B 5J1PA 1IJFB 1GTEA 2RILA 3PW4A 3I5CA 1EZZB 3D66A 1H2VZ 3W1YC 2YKNB 4HEA9 4AL7A 4WFBQ 3HKWA 1YJRA 2LQ8A 3X3UA 1MROA 5KFXA 4OI4A 4EGLA 3F0NA 3AAWB 4DF4A 4DR6F 3R1HA 1KQGB 3IM9A 1NEEA 5JVHQ 1VK3A 1YG0A 2ROGA 3MM7A 2HHHJ 4B3MJ 2XSJA 3LP2A 2IFXA 5J1NA 4C0OC 3EGZA 2W2PP 5ETVA 2Z2MA 1R6VA 2A2CA 2IM3A 1FRLA 3NBPB 2ZEJA 2XBPA 2E1MC 1GX5A 2OO4A 4KO0A 4M5GA 4P7VA 5LXRA 1NK6A 4F4XA 4AL5A 1K47A 2P5VA 3P6YC 3O8WA 1CJTB 2HHPA 2BACA 4P2MA 4L74A 4KSEB 5F3ZA 1CSJA 1FD2A 1H72C 4U6PA 5AXKA 4RNOA 4DUZF 2MQMA 1KNZA 3IA0A 5B0AA 2CPXA 2YKOA 2ACMA 1T9XA 1OSDA 1JXVA 3VCDA 2FVSA 5KFDA 1BQMB 3DOLB 1UWBB 4HACB 4P73A 1C0TB 3KXDA 3M2RA 4USKA 3BH6B 1SUQA 4KGMA 4ZPCA 4PRFA 1SL1A 1FEEA 7AT1B 3IXQA 4ZOSA 3J80U 3PIPQ 1X4EA 4B3SF 1X5SA 1TAQA 3CW2C 4USHA 4YY3J 2ZNYA 2Y1LB 3HJVA 4FYWB 1HIYA 1WC5A 3EDQB 3FJ2A 3OR1A 4ECQA 3V6DB 3PW7A 2F65A 3BGRB 1BY9A 1G1XA 2ASLA 3NMRA 2W1BA 2ZH9A 2HHXA 2VKZG 4KHRA 1EJ7L 1FCAA 2B43A 4HHUA 3T19A 4PUOB 2ZBQA 1RYRA 2W9BB 1VRTB 4ZP9A 1WDDA 2LKZA 2YWFA 3UD5A 3NNHA 2WONA 3QNWB 2QEXS 1Z2ZA 2QYCA 1S7HA 3QGPA 3BDEA 2OMOA 2IDLA 5ADZA 3IBCB 3Q2TC 3ZXWA 2HFNA 1ZA1B 3DLKB 4NZ6A 1F5BA 4ZVEA 2BE9B 2YPZA 3I0SB 3DI6B 2VH7A 3TJ9A 3EVWA 1HPZB 1F9EB 4JI5F 1NK7A 2O66A 2FVCA 2RQ4A 5KFNA 2NS1B 1UL3A 1YTYA 1BQXA 4CQ1A 3CCQS 1IBMJ 1X8DA 4JI3J 3NOGA 4FS2A 2JOQA 1Q5VA 2MSSA 4HYKA 1HI8A 2OSQA 5K9FA 5JVGQ 2J9DE 1C0UB 4CM2A 1E6VA 1CJUB 3OXGA 4JI4F 4WKRA 1VLYA 3VVUA 2DNOA 3G2XA 1OSCA 2YNHA 1MWQA 3WC2A 3TO8A 4URSA 4DBQA 3SQGA 1NXIA 2BE7D 2DHSA 1U1NA 2ZZNA 2HZCA 1UVIA 3GZ7A 4PKDB 4FPRA 4OI2A 2VG6B 2C2RA 3HHLC 2W9BA 3KMSA 1QAXA 3NS6A 4WXWA 2G2ZA 2I2YA 2N3LA 3NP5A 3MM8B 2PSZA 1SCJB 3LH2S 1LWEA 3N01A 5KFUA 3UQSA 2BXJA 5IV4A 2LYVA 3EJMA 3QRPA 4RW9B 4CH7A 2XS7A 2AX0A 3A12A 2C3UA 1YX2A 2HAFA 2BKPA 2DHAA 4P2XA 2LVWA 3M9OB 1HBMB 1HMVB 3L7UA 4FKXA 1N34F 2VPWB 3A8KA 2AD9A 1VQ4S 3J81Y 1VBYA 3CC4S 5B7WA 1TL3B 2HGMA 3MR3A 1VQSA 2PA3A 2H3EB 3C6TB 1U49A 3S6EA 4AXJA 3HP6A 3BQ2A 2IJFA 5KFRA 1FVQA 3MGJA 3P5BP 1NSAA 2ZC4A 4RWXA 4C2MA 3G4SS 4KTQA 3MOJB 2VB6A 2RKIA 1H7WA 2B8PA 1Q82T 4IR9A 5D78A 1FE0A 3UN5A 3QSIA 4LJMA 2AU0A 2CQ3A 4CIOA 4RNHA 1CG2A 3CIMA 4OYIA 2DXFA 4TN2A 2HBZB 1S72S 3IO1A 4ATNA 5J1EB 2FVQA 2CYYA 1W7WA 1R43A 4C8NA 1MMDA 3DGPA 4A8FA 5D0GA 4R5PB 1X4BA 1HBNB 4WFZA 4QWBA 2MTLA 4DV4J 4IG0B 4HHJA 2KVQE 1SB6A 4OYAA 3N28A 1N36F 1RWUA 1FF2A 1VQYA 4DPUA 5J2NA 2RUSA 5IFMA 1SC3B 2Q6CA 5RUBA 3ENVA 2B4UA 4BCAA 2O01C 5LMNJ 1NH7A 1BGXT 1RWWB 2BQ3A 1I3OB 1FRJA 2ZNZA 3W65A 4KV8A 1Y5NB 3V6KA 2ZZMA 4KPYA 1X4HA 3HHNB 2KRRA 4RW8B 1H2UX 4P2FA 2VD3A 2XZDB 3MMAB 3NEKA 3QLHB 4I0WA 1YITS 3AD9C 5HO4A 2Y9HA 1Q8LA 3KHHA 2V4QA 1TVRB 1R6YA 2RB7A 3W9HA 4K4XA 5MLCV 1S9FA 3CO0P 2AJ4A 3NGRA 2WCXA 2DO4A 1O5JA 4CLLA 3RR7A 1PCAA 4FXVA 1T9UA 2FQQB 2M52A 1PG5B 5ETSA 5CZXA 4MKBA 3S7RA 2HS3A 5EDWA 3KK3A 2CQBA 5G4DA 1IKWB 3HHLB 3EVMA 1VRUB 3HK2A 4OV6A 4X66F 3NNCA 1PAUB 1W2IA 2OAUA 4P10A 2IJRA 2VG6A 3UR3C 4Y2KA 1YJ7A 1EB0A 3WX8A 1MMNA 2YBVA 4ANCA 4EWTA 2ROPA 5ITHA 1YZ7A 5KG0A 4K50A 3GJSB 3R7BB 3HJFA 1RUSA 4JI0J 4LF6J 1RB0A 2IC3B 5IZHA 1NZAA 1WKJA 4L3NA 3R97A 5E3AA 3MI7X 4ZHRA 1ZTTA 2MZRA 2XMUA 1WOPA 5CYQB 2IA0A 4DX5A 2GC8A 3MMAA 3TEGA 2RU3A 4TXSA 2NUHA 1WF0A 2X1AA 2MDAA 2VA3A 1SPBP 4MYTA 3OUYB 5M2UA 4X84A 4MKYA 5A8RB 3T6JA 1RWPB 3NGTA 4WP9A 5DDPC 3TQ1A 2ASJA 3ET6B 1H7XA 3IGNA 1X4FA 4F36A 4JI6J 1YSJA 3MXHP 2GV1A 1SQFA 2HWHA 2JHEA 4IH6A 1WG4A 3CMAS 4Q0BA 1OY6A 3DKDA 3SI8A 1OMSA 1HBMA 1JWWA 1UFKA 2WZ1A 2RDJA 1HW9A 2IJNA 3KG0A 2DISA 3H59A 3D3BJ 1C1CA 1VGYA 3C14A 2QSFA 3E01A 4LSNA 5B09A 4I68A 5J1EA 2C2ZB 1T95A 2V2ZA 3PG9A 5I4MA 1HNXJ 4P7TA 2EG1A 4ZP7A 3M32B 1QD1A 3N6NA 4LF8J 2LQBA 1AYEA 1NNDA 4PABA 1HHSA 2G9OA 1M1GA 1A7GE 2Z57B 1S1WB 4LBHA 4OHXA 5LT5A 2AGOA 4TYAA 3DLGB 1RT3B 1VR6A
chains in the Genus database with same CATH topology
4DUZJ 1XMOJ 3JAMU 1J5EJ 4DR4J 4DR6J 1XMQJ 4B3SJ 4LF9J 4LF4J 3W1YC 4YHHJ 4DR7J 3R2DJ 2HHHJ 2ZM6J 4B3MJ 2UXCJ 2MEWA 4JI8J 4DV4J 2MTLA 2KVQE 3D3CJ 4K0KJ 4RJVA 4LF7J 3R2CJ 1N33J 1XNRJ 4X64J 5LMNJ 3IMQJ 2UUCJ 4DV0J 4KYZA 3T1YJ 2VQEJ 4DV7J 3J7AN 4LFBJ 1N34J 2UUBJ 1I94J 4X65J 3J81U 4DR3J 4X62J 3J80U 1HNZJ 2E5LJ 4NEYA 4JI1J 4LFAJ 4DV1J 4DR2J 1N32J 5FLXU 4YY3J 2VQFJ 4JI2J 1HNWJ 2KL8A 4HHUA 1IBKJ 2MQ8A 3OTOJ 3T1HJ 4JI0J 4B3TJ 5AJ3J 1N36J 4JI7J 4LF6J 4NXNJ 4B3RJ 4GKKJ 4LF5J 1XNQJ 4JI4J 1FJGJ 5IWAJ 5IT9U 5BR8J 4JI3J 1IBMJ 1IBLJ 2UXBJ 4DV5J 4KHPJ 2UXDJ 4JI6J 4DUYJ 4DV6J 4LFCJ 4JV5J 5LM7E 4DV2J 4JI5J 4DV3J 4V1Ak 3D3BJ 2UU9J 4KY3A 1HNXJ 5LMUJ 4DR1J 1HR0J 4JYAJ 4X66J 4PWWA 4LF8J 4NEZA 4NXMJ 4DR5J 4GKJJ 5A2QU 2F4VJ 4AQYJ 2UUAJ 4OX9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ J;  1XMO J;  3JAM U;  1J5E J;  4DR4 J;  4DR6 J;  1XMQ J;  4B3S J;  4LF9 J;  4LF4 J;  3W1Y C;  4YHH J;  4DR7 J;  3R2D J;  2HHH J;  2ZM6 J;  4B3M J;  2UXC J;  2MEW A;  4JI8 J;  4DV4 J;  2MTL A;  2KVQ E;  3D3C J;  4K0K J;  4RJV A;  4LF7 J;  3R2C J;  1N33 J;  1XNR J;  4X64 J;  5LMN J;  3IMQ J;  2UUC J;  4DV0 J;  4KYZ A;  3T1Y J;  2VQE J;  4DV7 J;  3J7A N;  4LFB J;  1N34 J;  2UUB J;  1I94 J;  4X65 J;  3J81 U;  4DR3 J;  4X62 J;  3J80 U;  1HNZ J;  2E5L J;  4NEY A;  4JI1 J;  4LFA J;  4DV1 J;  4DR2 J;  1N32 J;  5FLX U;  4YY3 J;  2VQF J;  4JI2 J;  1HNW J;  2KL8 A;  4HHU A;  1IBK J;  2MQ8 A;  3OTO J;  3T1H J;  4JI0 J;  4B3T J;  5AJ3 J;  1N36 J;  4JI7 J;  4LF6 J;  4NXN J;  4B3R J;  4GKK J;  4LF5 J;  1XNQ J;  4JI4 J;  1FJG J;  5IWA J;  5IT9 U;  5BR8 J;  4JI3 J;  1IBM J;  1IBL J;  2UXB J;  4DV5 J;  4KHP J;  2UXD J;  4JI6 J;  4DUY J;  4DV6 J;  4LFC J;  4JV5 J;  5LM7 E;  4DV2 J;  4JI5 J;  4DV3 J;  4V1A k;  3D3B J;  2UU9 J;  4KY3 A;  1HNX J;  5LMU J;  4DR1 J;  1HR0 J;  4JYA J;  4X66 J;  4PWW A;  4LF8 J;  4NEZ A;  4NXM J;  4DR5 J;  4GKJ J;  5A2Q U;  2F4V J;  4AQY J;  2UUA J;  4OX9 J; 
#chains in the Genus database with same CATH topology
 3IS9 A;  4NYO A;  3VGT A;  2E5J A;  3W2V A;  3V6J A;  1X9W A;  1RDR A;  3HSZ A;  4ZJO A;  5AJ3 F;  3Q8S B;  1CQN A;  4U7U K;  3M4X A;  2F7V A;  3UN2 A;  2IA6 A;  4B3R F;  4JYA F;  2VFT A;  3HVR A;  3C15 A;  1C4C A;  2Y8Y A;  3FCH A;  1U24 A;  4HL9 A;  5E0O A;  3RRH A;  4TQS A;  3BKT A;  2F4V F;  3LAN A;  4Y2M A;  4MH8 A;  1U26 A;  5CAB A;  2ILY A;  4WE1 B;  1QVG R;  1G3O A;  2J6U A;  2E7W A;  2IY5 B;  1FT8 A;  1YWX A;  2JVR A;  4H4O A;  3IN5 A;  3GV8 B;  2GIR A;  5KFV A;  1DQ9 A;  3T1A A;  2VBW A;  2XNR A;  2PE8 A;  2F8H A;  2EG2 A;  2EK1 A;  4FYX B;  5BYR A;  2AIR B;  2YKQ A;  3GFZ A;  3H5S A;  2XG8 A;  3G8S A;  5D3G B;  1R7I A;  2OPQ B;  3R6L B;  5HVH A;  3CD5 A;  2ASD A;  3SDE B;  3MR7 A;  3U1M A;  2HHQ A;  1HWK A;  1WUU A;  3FBF A;  2RE1 A;  4QPT A;  2V67 A;  3QZ7 A;  2CAJ A;  1N33 F;  3I82 A;  4HT7 A;  3IRX A;  3R5D A;  2IM2 A;  3PTW A;  4UUX A;  5H9E J;  2HMI B;  3DRY A;  3HD1 A;  4LF7 J;  3ITH A;  3MAA B;  1CUL A;  1JK9 B;  5HBM A;  4O0I A;  3M9N B;  4KQZ A;  4NXM F;  4W4M A;  3BGR A;  3ZZZ A;  1YHQ S;  2RRN A;  3OFE A;  1AB8 A;  3VZI A;  3NCP A;  2CNL B;  2QC3 A;  4X4S A;  1B99 A;  1K1S A;  1KTV A;  2CQI A;  3AQO A;  4OJH A;  4QCL A;  2JC0 A;  1E6V B;  1Y0H A;  2VFU A;  4IRK A;  2LU1 A;  2MZJ A;  4O3Q A;  1C1B B;  3SCI E;  2BUN A;  2GO9 A;  2H4W B;  4QIG A;  1XNR F;  4ES3 A;  4RW4 A;  3DRS B;  4E0D A;  2HNY A;  2NZ4 A;  3QT5 A;  1Z2L A;  1Y5L B;  2EWH A;  2KHD A;  2QIF A;  3H4B A;  2XTJ P;  5KFO A;  2XY6 A;  2LEA A;  1WEY A;  2ZD1 B;  1KQS R;  2IRU A;  3DRR B;  3IWX A;  5A8K A;  4ZN1 A;  4I69 A;  1FRX A;  4JI7 F;  5EX0 A;  4PPD A;  5DG7 A;  3BPD A;  1LK5 A;  5A6P A;  2HFZ A;  2ZH5 A;  1EX8 A;  3N5B A;  4OMF G;  4N5S A;  4EZ9 A;  3NMA A;  1U1K A;  2ZFH A;  1YJU A;  3FCW A;  3V81 B;  3OVS A;  2EFO A;  4ILR A;  4JV1 A;  3TQE A;  3DOK A;  4BS2 A;  3O44 A;  3SV4 A;  5C2C A;  2VG7 B;  3EGN A;  3K5P A;  4M5I A;  3PYE A;  4JI2 F;  1EIY B;  5HQ8 A;  1RQ0 A;  2W7A A;  2AYB A;  2HFU A;  4B3T J;  4MJK A;  4ZDN A;  1H38 A;  1MU2 B;  2G2Y A;  5KFI A;  1JJH A;  4K0K F;  2XYP B;  2HVH A;  3LP0 B;  3GIJ A;  3QWP A;  2VKR A;  2Y8W A;  3CSK A;  2UV8 G;  4HH1 A;  4NYZ A;  5L46 A;  4B9N A;  3U7J A;  3M32 A;  1S9E A;  1EKS A;  1LK7 A;  2YKP A;  1D1U A;  1CC8 A;  3BGO P;  2BOA A;  4I7F B;  5ETL A;  1WHY A;  3VHQ A;  3RB0 A;  3MCO A;  5LM7 E;  2V8H A;  2GNK A;  1DZ5 A;  1DTT B;  1HD0 A;  1YK9 A;  2KT3 A;  2KXH A;  3CJR A;  3BQ0 A;  1IKX B;  1R0B G;  2RSQ A;  3ENW A;  5IWA F;  3AJ2 A;  3IR6 B;  3VGV A;  2PMW A;  3G6Y A;  3MPU B;  1YIJ S;  2JL9 A;  2YNI B;  2VFV A;  4RUH A;  3W62 A;  3TAR A;  5J2Q B;  2H9Z A;  3CDE A;  2LXU A;  3MM7 B;  3QAE A;  5KT5 A;  1NK0 A;  2E1C A;  4YDX A;  3QWU A;  4IYQ A;  2KN4 A;  3MR6 A;  1RWM B;  2MKY A;  2XYG B;  1RU1 A;  3HZG A;  4DL5 A;  3HSG A;  3NG8 A;  4DL7 A;  1IBK F;  4IFV B;  4OYP A;  1R8B A;  3H5Y A;  2I1R A;  3GE9 A;  1S6Q B;  2HVE A;  2W25 A;  3NGS A;  2UUT A;  2YTC A;  1XMO J;  1XTZ A;  1SL0 A;  3R1L A;  1FD8 A;  5ETK A;  1RT4 A;  2HRT A;  1PAE X;  4RU2 A;  3GWC A;  1RAG B;  4HT5 A;  3CB4 A;  1V5V A;  2FB0 A;  1AZS B;  2FYX A;  4DN9 A;  3H90 A;  1VBZ A;  3B6B A;  3M2U B;  5F8G A;  4B3O A;  2WVC A;  3MM5 B;  3QMQ A;  3H20 A;  3PM9 A;  5M2R A;  4X4O A;  3SSQ A;  4IRC A;  2YKM B;  3SIP B;  3IAM 9;  3G8Q A;  4HVZ A;  3B82 A;  4M8L A;  4OZ3 A;  3V4M A;  1ZTW A;  1WDT A;  5DG9 A;  3TNV A;  3OTC A;  2QL9 B;  4YHH J;  4GO7 X;  2OKQ A;  1RT1 B;  1YRT A;  2HGL A;  4N47 A;  1AFI A;  4WZQ A;  5IM0 A;  5J2Q A;  3KLG B;  1ZPV A;  3NGK A;  3DCA A;  2EPI A;  2EW9 A;  3ETM A;  3LGM A;  4LR9 A;  4ELT A;  2PFF B;  2E1R A;  2VFR A;  3ZNU A;  1JIH A;  2HQD A;  3BR9 A;  2HND B;  4IH5 A;  2MEW A;  3DLK A;  5HAT A;  1Q5Y A;  1DJ0 A;  2YQ3 A;  2CPF A;  2GS8 A;  3GON A;  2DGU A;  2V69 A;  3KUH A;  2IRX A;  4PR6 A;  4C97 A;  4WKY A;  4Z7C A;  3LPY A;  2LEC A;  1I94 F;  2C2K B;  4NA1 A;  3D4J A;  3SV3 A;  2ZVS A;  1KN6 A;  4U95 A;  1RAI B;  1HI1 A;  1RHU B;  3EVO A;  2Y0B B;  2DBB A;  4QZV B;  4R8U B;  4RUC A;  4WFA Q;  5E41 A;  2XMA A;  2IBK A;  4LFA F;  1EQM A;  3KHL A;  1N32 F;  2BA9 A;  1IM6 A;  2BM1 A;  2R7S A;  5E5N A;  5DDO C;  3Q8U A;  2CNN B;  1PYO B;  3A3P B;  3F56 A;  3MM5 A;  1FO1 A;  1CJV A;  3PEH A;  5DJB A;  4ALZ A;  4DI6 A;  4RPF A;  1HBN A;  2YNH B;  5CD4 H;  4JP8 A;  4PXB A;  1DRZ A;  3UI3 A;  2CVE A;  3V5R A;  4A48 A;  3PRB A;  5D15 A;  4JI1 J;  3ZNJ 1;  2CKW A;  1U6Z A;  4TLQ A;  5J2N B;  2QTW A;  3ZZP A;  4NCB A;  5AT1 B;  3AB4 B;  2VQF J;  1HNW J;  3UFC X;  5L1K A;  1UWB A;  1SJ3 P;  1JLA B;  4LR8 A;  1WOR A;  1TP7 A;  2PD1 A;  3KLG A;  4Y0F A;  4NI2 A;  2RDI A;  3UDE A;  3G6V A;  1HR0 F;  3DGP B;  3K5O A;  1LKZ A;  8RUC A;  2SXL A;  1U2C A;  1S1V A;  4LRC A;  3SEO A;  4Y00 A;  2GVZ B;  3DI6 A;  4KAI A;  5JMN A;  1NKC A;  3G82 A;  2X1F A;  3QRR A;  1RWV B;  4GVL A;  4F26 A;  5L1J A;  1S76 D;  4DPW A;  3DC2 A;  3P45 B;  2I8E A;  3T1H J;  3FKB A;  1S0V A;  1S12 A;  1X4D A;  1C2P A;  3SFG A;  4QBU A;  1NHK L;  2FTR A;  2CWK A;  2LQ9 A;  2OUG A;  3KLF A;  2F1F A;  3WIV A;  3PW2 A;  2CQG A;  4OI1 A;  1F9F A;  2ILZ A;  3N9U C;  4NML A;  4WE1 A;  3D0G E;  1VHI A;  2HVI A;  3LA0 A;  4FYV B;  4ZVT B;  1KVJ A;  1WI8 A;  3JSR A;  1UET A;  3PX6 A;  4C8K A;  4ZJQ A;  4QU6 A;  1KLM B;  3M6W A;  3M2U A;  4ZLN A;  2XCA A;  3IM8 A;  1XER A;  1X9S A;  4IG3 B;  1FKO A;  2WW4 A;  4LVO P;  3JTO A;  1B0P A;  3KFW X;  4CI0 B;  1ICE B;  4DV6 J;  1UVN A;  2AEM A;  3PRD A;  2G2O A;  4MKV A;  1ZM9 A;  3MPY A;  3ILI A;  4ZCK A;  1UEV A;  2EVZ A;  5DLF A;  1IKV A;  1VIX A;  2HHH F;  2BAN A;  3MMJ A;  3IRW P;  3BZQ A;  3PV8 A;  2FJV A;  5H9F K;  2HVD A;  2WSF C;  3CJT A;  1FRI A;  1U25 A;  4DV1 F;  6FD1 A;  3E8O A;  2UXB F;  5D0H A;  3ILJ A;  2YQ1 A;  1JXL A;  4OL8 A;  4CYU A;  1S6O A;  4M5K A;  5KFW A;  3G9C A;  1Y00 A;  5BXI A;  4ZPT R;  1GMU A;  2ZH7 A;  1RHR B;  4DR1 J;  3HVT A;  2MQQ A;  2HHV A;  2UZA A;  1N5Q A;  1S4E A;  3ZZT A;  4NEZ A;  2QMW A;  5HMW A;  2ZHA A;  2BMB A;  2KHC A;  5I3U B;  1SJR A;  2PI5 A;  4IOC Q;  3FRZ A;  4XIU A;  3OL7 A;  1SIZ A;  3I0R B;  5L38 A;  3JSM B;  1RBA A;  1VYA A;  4DUZ J;  3I0S A;  3MUM P;  1TL1 B;  4DPX A;  1SKW A;  2Z58 B;  4G1I A;  4ES2 A;  5B0C A;  2MYF A;  4K59 A;  5FII A;  5C42 A;  1P9Q C;  1TTH B;  2DNN A;  2Q79 A;  3DRS A;  1DHM A;  1Q0N A;  4IKA A;  2DRB A;  4K5S A;  1FVS A;  2OEK A;  1DLO A;  4ICL A;  1R8A A;  3C19 A;  1N88 A;  2V4J B;  3AOD A;  4B3S J;  2E1A A;  5DDR C;  2B0G A;  3X1L B;  2CZ4 A;  4WTO B;  1XK8 A;  2W2Q P;  3AY0 A;  4HTI A;  3U02 A;  2ZH4 A;  4LF4 J;  4ECS A;  2VG5 A;  4KHP F;  2HFO A;  3DDN A;  5GME A;  1RBL A;  3IGV A;  4HR2 A;  4WJB A;  4DHV A;  4AFF A;  1Q16 B;  2RML A;  3P3D A;  4M5H A;  3S8S A;  3KK2 B;  1MNE A;  1WKL A;  3TJ8 A;  1TL7 B;  3NWR A;  2WVE A;  2ZZT A;  4IDK B;  3DHX A;  2DNG A;  1K9M T;  1R0C B;  1M5V C;  2VG7 A;  4YEA A;  2UXC J;  3PNI A;  4MYU A;  2J7U A;  4I4B A;  3RG6 A;  2UU9 F;  3RAQ A;  4KH1 B;  3SMZ A;  3DLE B;  4O44 A;  3RJM B;  2DY1 A;  2V8V A;  2V6A A;  1RAO A;  2D9P A;  5LMU F;  4WXO A;  4ECT A;  4NLW A;  2BZ2 A;  2WSE C;  4U8V A;  3UN3 A;  3GIM A;  5F0W A;  3C3L A;  2NXJ A;  1T9T A;  3D1O A;  3F41 A;  4CLU A;  4JV2 A;  2I5J B;  2LP4 A;  4ID5 B;  5F8M A;  4K4T A;  1U1Q A;  3HT3 A;  1M1H A;  3AB2 B;  2MKC A;  4KO0 B;  2F63 A;  4GO5 X;  2L9D A;  4FF4 A;  4M95 A;  1LOU A;  1FWK A;  1KFD A;  3CJ4 A;  2Y1R I;  4DMZ A;  4FP9 A;  4YS2 A;  4ZVQ B;  4EO8 A;  5GMD A;  5HAN A;  5D6G A;  5FLX Y;  1FKP B;  4DF8 A;  3RW7 A;  4ED7 A;  4OQJ A;  4B17 A;  3ZTS A;  2VIC A;  2ZBP A;  4DN0 A;  1BQM A;  3DOL A;  1LXJ A;  2A6M A;  1YBT A;  4N56 A;  2CQ0 A;  3LF0 A;  5D3G A;  3SYZ A;  4TY8 A;  2N4C A;  3AOC A;  2QG9 B;  1Y3J A;  2BVZ A;  4EO6 A;  2UUB F;  3CCT A;  1HBU A;  2DH9 A;  2RD5 C;  1IR1 A;  3CMQ A;  3C46 A;  4HTJ A;  1SXL A;  2H5I B;  1S9G A;  2VON A;  2IHR 1;  2C42 A;  3FBE A;  3GV7 B;  2DIU A;  1N6Q B;  1HHT P;  1BXN A;  5K20 B;  3OLA A;  5E3R A;  5HVF A;  4GC7 A;  4K4V A;  4X2B A;  4PG6 A;  1GMV A;  3LWM A;  1FNX H;  2YWE A;  3C16 A;  1RSC A;  4A8M P;  2POK A;  1IKX A;  4EBE A;  1B70 B;  1VMB A;  3JSM A;  2K8G A;  2MJU A;  2HWT A;  3SSS A;  1N6Q A;  4O3S A;  3QSY B;  1S79 A;  2QYG A;  3K5L A;  4NL5 A;  3DRP B;  1LEO A;  5KOW A;  2OH2 A;  2MLY A;  3R7S B;  4X4Q A;  1IBL J;  3EXY A;  2AJ2 A;  4LR7 A;  4DU8 A;  3CJQ A;  2ADB A;  2G4B A;  4OFZ A;  3OLB A;  3JYT B;  3NS7 B;  2OD4 A;  4MK7 A;  3M05 A;  3N6L A;  3LOU A;  5A6W A;  5KG1 A;  2YH0 A;  1CS4 B;  3R5B A;  2KFY A;  3BSO A;  3D9B A;  3GFH A;  7FD1 A;  2M3D A;  2G0C A;  1TR0 A;  2W9C B;  4BWM A;  4FYY B;  1J2V A;  3FEZ A;  1Y3K A;  2H5J B;  3CDW A;  3RW6 A;  3FGV A;  4PXD A;  1S9G B;  2KZM A;  1U1R A;  1A6L A;  3QO9 A;  4RBU A;  1WC1 A;  4LRB A;  3T5K A;  4Z37 A;  3MOZ A;  4TU7 A;  3HMJ G;  3OSP A;  3QAU A;  2F8M A;  3Q83 A;  4NRT A;  3HXM A;  4A8Q A;  2OIH A;  3P49 B;  5A2Q U;  3MM6 A;  1U1O A;  1S48 A;  4AQY J;  3A3N B;  1TUV A;  3CC7 S;  1RT6 A;  3BV8 A;  2C2M B;  1TV6 A;  5CQG A;  2C3P A;  3MEC B;  5CYM B;  3GU0 A;  1KBR A;  4G65 A;  2MY8 A;  1PIE A;  1OY8 A;  2FZG B;  4ZCM A;  1UA0 A;  4WP3 A;  1NPK A;  1D09 B;  2WVD A;  3PYD A;  2GVD B;  1IVZ A;  2L9W A;  2P9G A;  1REG X;  1RCO B;  3FSI A;  2PFD A;  3VQT A;  4Q5V A;  3BO4 A;  2XLI A;  1Q8K A;  2HK2 A;  2DNK A;  4MIA A;  3KG4 A;  4Y2A A;  1P6T A;  1FER A;  2BEF A;  1BWV A;  4ZN3 A;  3OW2 R;  1NJY A;  3MED A;  2AYG A;  5HRO A;  1HA1 A;  3FDS A;  3I87 A;  2CA9 A;  3O3L A;  1RA6 A;  1S1X A;  1DAX A;  4U9R A;  3FFI A;  3GYG A;  2EKN A;  2A10 A;  3BM7 A;  3CJK A;  2YQ0 A;  1N0V C;  3M30 B;  1D0E A;  4H4M A;  5F8N A;  2MLZ A;  2KJW A;  2DGW A;  3OHB A;  1HWI A;  3OJU A;  2V0N A;  1KRP A;  1WTF A;  1S57 A;  5KFT A;  1S1U B;  3KNG A;  4YQW A;  1T3O A;  3OVB A;  1DAR A;  4RO0 A;  1U0H A;  3H2L A;  5K8N A;  1WG5 A;  3ZTQ A;  4X4T A;  1XC9 A;  2DR7 A;  4DFK A;  1N5T A;  4ELV A;  4CO0 A;  3POT A;  1Q7L B;  2OTJ S;  2F5G A;  1CQM A;  1D8Z A;  1FEH A;  4RUA A;  4JUZ A;  1CC7 A;  3DU6 A;  3N5F A;  5ETN A;  4DJB A;  3T1Y J;  1FKA F;  3IRX B;  2CJK A;  4LMZ A;  2XMT A;  1LWC B;  3ISZ A;  3VGS A;  1VQ7 S;  4X4N A;  2CPE A;  4K4S A;  1NJW A;  1S1T B;  2OFG X;  4NZ7 A;  3MMC B;  1CLF A;  4N7T A;  3WX4 A;  4G1P A;  2ZH3 A;  4IG0 A;  1HKA A;  3LQV A;  3GIK A;  2H54 B;  3VAM A;  1PGZ A;  2DNP A;  1WG1 A;  2K1R A;  4Y2C A;  4B9T A;  5K8M A;  4FXD A;  2Q3P A;  4QPX A;  3WZ0 A;  1BQN B;  1KP6 A;  2OP5 A;  4MTP A;  4OHW A;  4URG A;  2XQC A;  1HD1 A;  1NLK L;  1BUX A;  4U96 A;  3T9N A;  1X4C A;  3CED A;  3P96 A;  4LF8 F;  1U2R A;  4DPY A;  3I96 A;  2DJW A;  2XI3 A;  2XCP A;  4CLW A;  1Q8I A;  5LXY A;  1N5Y B;  3AA9 A;  4DXL A;  2YY3 A;  4UZB A;  4YY3 F;  2QN6 B;  4NLQ A;  4USU A;  5HSP A;  4ID8 A;  1UVL A;  3M6U A;  4S0M A;  5AJ3 J;  4C8O A;  1U6F A;  2D1C A;  2P6T A;  2P9E A;  4DQS A;  1UZH A;  3R5C A;  3K58 A;  5HLF B;  3FSX A;  3DOM A;  4B3R J;  1MW7 A;  2CIM A;  3EWG A;  5T14 A;  5C7P A;  1QSS A;  4C98 A;  5IT9 U;  2VC1 A;  2APO A;  1XBW A;  3KJN B;  5KG4 A;  1FXR A;  4AD6 A;  1MU2 A;  4PWU A;  3QT7 A;  2RT3 A;  1LWE B;  3ZTP A;  5F8L A;  5K5M A;  4OJ1 A;  2DR8 A;  4JI5 J;  4IOB A;  3WQP A;  3M8W A;  3CXC R;  2ZD1 A;  4DV2 J;  1VOM A;  5IC6 B;  1TVR A;  1IWG A;  2MZQ A;  2OLW A;  3MWB A;  3BO3 A;  4QOT A;  1R8P A;  4ZP6 A;  1SV5 B;  3TEH B;  2ZOG A;  1S77 D;  1Y4Z B;  2VV5 A;  3PEJ A;  4V1A k;  4NA2 A;  2RQC A;  2JLE A;  2ZHO A;  1IR0 A;  2HHU A;  1RA7 A;  4UOG A;  2W8L A;  1RBO B;  5F8J A;  1HYS A;  3G8T A;  1I5O B;  1UEK A;  4IQX A;  2O1P A;  4EMD A;  4C8L A;  5D4L A;  1X0F A;  4NA3 A;  3RAX A;  4NXM J;  3KLV A;  2L9N A;  5U47 A;  2D41 A;  2HQI A;  1JLF A;  2RNE A;  1RWO B;  2DHH A;  3HHE A;  4H54 A;  3VTI A;  3ITH B;  1P27 B;  1T05 A;  2FUG 9;  2ZUG A;  4UQT A;  1VQ8 S;  5J2M A;  4O3R A;  5DO2 A;  1GNK A;  1FFG B;  3MCN A;  2L48 A;  4A47 A;  2LFV A;  2AYE A;  4ZCI A;  2XS2 A;  5EN1 A;  3UD3 P;  3GG0 A;  4I64 A;  4ZA1 A;  4DR4 J;  2BW7 A;  3G6E S;  5DGA A;  1S97 A;  2D69 A;  3GIR A;  1S6Q A;  4C8Y A;  3H98 A;  1S5Z A;  1KOH A;  4UQG A;  3Q86 A;  5E3Q A;  4EYH B;  4WP8 A;  2M0G B;  2MY7 A;  4QW8 A;  4ZP8 A;  1NHV A;  3MUV P;  1HFE L;  3T5J A;  1GMW D;  2OEJ A;  1UFL A;  2CQC A;  3MM6 B;  3NGD A;  4PG5 A;  3HD2 A;  4Q2M A;  2QLJ B;  5THW A;  4PUO A;  2W8K A;  1WHV A;  5CCL A;  2DGT A;  3IBW A;  1NJX A;  4GVB B;  2Y0S D;  4ZPD A;  4FKY A;  3O2I A;  3D6T B;  3K5N A;  2XWY A;  2F8E X;  3L7O A;  4CCH A;  1R8C A;  2XSF A;  2B56 A;  3FVY A;  5E2Q A;  1X31 C;  2XNQ A;  4WCE Q;  2R7T A;  4QWC A;  3GJQ B;  2KI2 A;  4KB7 A;  3T3F A;  4N8N A;  2ZBR A;  3GV5 B;  2R7O A;  1RTH A;  3PDN A;  3CE8 A;  4QR1 A;  1JLF B;  2CZV C;  2BBE A;  3HSD A;  1GAO A;  4R0E A;  4RJV A;  5F41 A;  2FJX A;  5CAA A;  3D6M B;  3TUP A;  3RR8 A;  2B9X A;  3NKY A;  3QFW A;  3O5T B;  2JRS A;  4UOC A;  5BYQ A;  5GAD U;  1B7Y B;  3TAP A;  1KWM A;  4I56 A;  3BH7 B;  4DOZ A;  4DV4 F;  2M2B A;  2LA6 A;  2KH9 A;  1AUS L;  4F4W A;  4ECY A;  1WAC A;  2G0J A;  2HQC A;  2OGU A;  1WF2 A;  2GGP B;  2HKE A;  2RHQ B;  1FRH A;  2OPR A;  4FVC A;  3T41 A;  3LAM A;  5KFL A;  2CQ1 A;  4NLX A;  1NSP A;  3MUT P;  3JQK A;  1FWP A;  4NCG B;  3Q8R B;  3VAI A;  3B78 A;  1RP5 A;  2XEX A;  3ZZY A;  2HIQ A;  1CEZ A;  3OL8 A;  4DQI A;  1MWZ A;  2RDD A;  2R8I A;  5DQG A;  2EXU A;  2M9K A;  4CTA A;  1YJN S;  5HQM A;  1Q4R A;  3H4D A;  1RGV A;  3ELH A;  2DNH A;  1IBK J;  2GMJ A;  3D68 A;  3SCK E;  1EET A;  4O4G B;  1K44 A;  4P6Q A;  2Q66 A;  4C8M A;  1DFD A;  4CLS A;  2HQG A;  2X3G A;  2X7I A;  4RLE A;  1O51 A;  4OZ1 A;  3NLC A;  2FJA B;  3OL9 A;  1YJT A;  2QO3 A;  2HFS A;  3UVJ B;  4DQQ A;  4M5D A;  1ZAW A;  2N7Y A;  4FDF A;  4DCO B;  2XO6 A;  1T05 B;  1Q53 A;  3SFU A;  5C25 A;  3MED B;  2VG5 B;  3MHY A;  4DV3 F;  1FI4 A;  4LT6 A;  4F50 A;  1WJ9 A;  2G13 A;  4OLO A;  3M2V B;  4DV5 J;  3D0H E;  3BKF A;  3MAH A;  2V4J A;  1B64 A;  1E6Y A;  2DGX A;  2ZVI A;  3IFE A;  2ZOF A;  1SKU B;  1VRQ C;  3DOK B;  4IH7 A;  4L73 A;  4DFM A;  3HVW A;  2JEG A;  3R6G B;  3S01 A;  3L3C A;  1SH2 A;  1YRX A;  4ZMM A;  3THV A;  4EU0 A;  4N8O A;  2HK3 A;  2EEY A;  5L39 A;  2AHO B;  4CLT A;  2QA4 G;  3DLE A;  4O44 B;  3L7P A;  4F67 A;  1LWF B;  1JJ4 A;  2CDQ A;  3TR5 A;  2J9C A;  3OR2 A;  1KHV A;  1S1V B;  3EX7 B;  5GAG U;  3BF4 A;  4CZC A;  2NYH A;  4QYZ K;  4I2P B;  1KKH A;  4TU9 A;  4KV8 B;  4F2R A;  3TUJ C;  4ED4 A;  3CDA A;  3QRQ A;  3OR2 B;  1VQM S;  4LF9 F;  3HUL A;  3W2W B;  1MN9 A;  2UUA J;  1JQG A;  4M5D B;  2ZWO A;  1FDD A;  4WFX A;  4J9U E;  2BDP A;  2AGP A;  2GZO A;  2H1Y A;  3IR7 B;  4Z2X A;  5LSO A;  6AT1 B;  3PW5 A;  3Q8P B;  4PXC A;  1AT1 B;  1RAB B;  4MFB B;  3OT9 A;  5HI7 A;  3ZZO A;  5J2P B;  2IRY A;  5KT6 A;  3CCJ S;  2XMM A;  4DWI A;  2Z56 B;  2DH7 A;  4NCA A;  2BE2 B;  3D2W A;  4Q45 A;  1QM9 A;  2UVW A;  4CP5 A;  4ZLP A;  3LAL A;  1B3T A;  1EAR A;  2G1D A;  2A18 A;  3CT9 A;  3IG1 A;  3N6M A;  4A8O A;  3CD6 S;  4I67 A;  3OPK A;  2HNZ B;  4K7Q A;  3ZZU A;  4KGK A;  3VAL A;  3KJV B;  2R42 A;  4R0J A;  4F3O A;  4LFC F;  1K8A T;  1AFJ A;  1SH0 A;  1V3Z A;  3KJF B;  4XDD A;  3W8G A;  1NUE A;  4EI2 A;  3V6H A;  2BJ3 A;  3PZP A;  1U48 A;  1RT4 B;  2EI5 A;  3R2D J;  2A3J A;  2IAJ B;  1GXT A;  1RTJ B;  3R7N B;  3MTJ A;  4CYU B;  3H25 A;  3K57 A;  3RTV A;  2QA4 S;  3K8W A;  1HNI B;  1R27 B;  3MMC A;  1WHW A;  2CRL A;  1UVM A;  2IYI A;  2JLF A;  4HLB A;  2GVZ A;  4ZS6 A;  3WBZ A;  1OQ6 A;  3US5 A;  2Y1J A;  4CO3 A;  1WC0 A;  3QJL A;  2XO7 A;  4N76 A;  3OUY A;  4H4O B;  5C5J A;  1DUR A;  2AZ1 A;  1FNM A;  3W60 A;  1NDK A;  4F7V A;  2ZH1 A;  1FA0 A;  3TZW A;  3TW0 A;  2E5H A;  1HWJ A;  2K7K A;  4ZPB A;  2YX4 A;  5DLG A;  1DBD A;  4DV7 J;  3LUY A;  3PCO B;  1X0P A;  4RZR A;  2DRD A;  1DTT A;  3LO3 A;  4C8Z A;  5E33 A;  4DV6 F;  3J81 U;  1F2H A;  2W7P A;  2V8D A;  2JNJ A;  5AE1 A;  3SXL A;  3ILL A;  3MTK A;  1SJQ A;  3L95 X;  4AXI A;  4XDC A;  4DV1 J;  4XAK A;  2KVI A;  3BGF A;  3SZ2 A;  3J81 j;  2GCF A;  1XIQ A;  4X4U A;  2PI4 A;  1S49 A;  2KFN A;  2DD8 S;  4YP3 A;  4F4A A;  2Z30 B;  3DXS X;  4DR1 F;  2OHD A;  1UVK A;  4ZIT A;  5KG7 A;  4J9L A;  1N5V A;  2W7O A;  2IYG A;  1A0O B;  3AA8 A;  3AFG A;  3CUN A;  3HFK A;  3MFH A;  1LW2 A;  2AJQ A;  4GRS A;  4RKU C;  4X4V A;  1VQO S;  1VC5 A;  4JI7 J;  3TA2 A;  3HFV A;  1V3R A;  4NXN J;  2XZT B;  1QE1 A;  1APS A;  1UEU A;  3UW1 A;  4ID5 A;  4GKK J;  4JV5 F;  3BJY A;  1QTN B;  2WON B;  1JLA A;  1JLB B;  1UPP A;  2WW8 A;  1P8G A;  2KYZ A;  3J7Y I;  3P8B B;  5EUH A;  3VV2 B;  4P9S A;  2NQP A;  4UT4 A;  2IC3 A;  5I3P A;  2JSX A;  1S1X B;  4KHP J;  4USM A;  1UAW A;  4B3T F;  4MKA A;  1V3S A;  2DHG A;  3PFO A;  3PJ9 A;  3M8Q B;  3OBI A;  4OX8 A;  5CYQ A;  4ITS A;  3OVA A;  4DUY J;  4NRU A;  1KSP A;  4G3I A;  5CYJ A;  1N54 B;  3H0P A;  3KDO A;  4NLS A;  4WK1 A;  1JXE A;  4P74 A;  2DRA A;  3GSD A;  4RX6 A;  4OZ5 A;  2UXC F;  5CHC B;  4KC5 A;  4OIX A;  1IKW A;  3HHL A;  3M8P B;  3QIP B;  3KK2 A;  5GAE U;  2UU9 J;  3M8Q A;  3DDI A;  3FMW A;  4ZPW R;  2FY1 A;  1HLW A;  4NLR A;  2C2O B;  2KKH A;  1CUL B;  1OQ3 A;  1SI9 A;  3P4U B;  1UPM B;  1RAE B;  4KGZ B;  5FDL A;  4A4J A;  2A0F B;  3GCW P;  4G6V B;  4IFY B;  5LMU J;  1H6K X;  1NZ8 A;  3MEE B;  2CNK B;  2W9C A;  2LEB A;  3UD4 P;  4HKQ A;  2BKO A;  4OX9 J;  4DG1 B;  4KPC A;  2P2C B;  4M5L A;  2VIH A;  1B7F A;  4LUB A;  3QZ8 A;  2VFS A;  3DXB A;  1ZYQ A;  1KD1 T;  4QR0 A;  3I31 A;  1XR5 A;  2IMO A;  5IM0 B;  3GLJ A;  1IKV B;  2EBE A;  4Q2L A;  1RHM B;  2IAJ A;  1REV B;  2X51 A;  2C2N A;  4PEO A;  1KTQ A;  2RS8 A;  3DLH A;  4J5O A;  3OV7 A;  3H2V E;  2XMK A;  1FHT A;  3R9L A;  3W2V B;  5DQH A;  1DTQ B;  1S4F A;  3JXO A;  1OPZ A;  3ISN D;  2HHT A;  3BSA A;  2ZE2 B;  4KKO A;  1ZAX A;  5DS7 A;  5BJR A;  1V6H A;  2GJ2 A;  3KG1 A;  4F3Q A;  2J9D A;  3J7Y U;  5IOL A;  4ER8 A;  2K1R B;  2MHE A;  5B0D A;  1AXQ A;  4N77 A;  2FLL A;  3RYL A;  3RRG A;  5KFE A;  1DTQ A;  1Y9O A;  2AX1 A;  1YI2 S;  5KT2 A;  2PO4 A;  3VGU A;  2JH3 A;  4X4R A;  3OTD A;  1VI7 A;  4DV0 F;  2X1G A;  1VFJ A;  1WEX A;  5HJX A;  1JLE A;  1DY3 A;  4XPE A;  4PWD B;  3RB6 A;  4C3M A;  3FBC A;  1JLQ B;  3UCU P;  3GFX A;  3C8Y A;  3GTY X;  1NK4 A;  1T03 A;  1ARO P;  1BWE A;  5G0R A;  3W64 A;  5KFM A;  3R2C J;  1N33 J;  1FXL A;  1T02 A;  3MMB A;  4L6V 3;  1ZM3 A;  3EIC A;  2BAB A;  3GP9 A;  4X64 J;  2KU7 A;  3MM8 A;  4YME A;  3GYX B;  4A8Y A;  1REV A;  1TL4 A;  2RJZ A;  4B08 A;  1L3V A;  2L41 A;  1D9A A;  3UNG C;  4KR0 B;  2VU5 A;  4OYW A;  3CJ5 A;  2O67 A;  4EUV A;  2XI2 A;  3NY0 A;  4ZVF A;  4TU8 A;  1S10 A;  3LP2 B;  5F8I A;  2B9Y A;  2WB4 A;  3BRE A;  2MXY A;  2KM8 B;  2R7W A;  4X65 J;  3QQC D;  1I94 J;  2OTL S;  2MLX A;  3CJ8 A;  1NPP A;  3UDC A;  2WOM A;  4PYD A;  2FLO A;  4LFA J;  3D5M A;  1UCN A;  3J80 Y;  3FFI B;  5DM6 Q;  1N32 J;  3GII A;  2GHP A;  1RHK B;  4ECX A;  1RHQ B;  2KL8 A;  3OTE A;  1T94 A;  1QAY A;  1PJ7 A;  2YVS A;  4NPO A;  2VC0 A;  2FHJ A;  2MPU A;  2DKO B;  4CLK A;  1K73 T;  1OYD A;  1ZPW X;  3QIP A;  2E7V A;  2XB2 D;  4AT1 B;  3D67 A;  1KHW A;  3EMT A;  3UCG A;  4K4W A;  1TKT B;  9ATC B;  1SBR A;  4HDG A;  4URQ U;  4AQY F;  4LRD A;  4IO9 Q;  2WTF A;  1C0U A;  4IFY A;  1VDH A;  2MQL A;  3PKY A;  1HNW F;  4DX6 A;  4WU2 A;  2B3T B;  4OI6 A;  1NB7 A;  5T7L A;  2VA2 A;  2RHS B;  1TZ0 A;  3NRB A;  2G0I A;  2EBG A;  2B7C B;  1U47 A;  3M8P A;  3NWG A;  4NLG A;  1MLA A;  1IXK A;  3LW5 C;  2EFV A;  1LWC A;  4CO1 A;  3KTQ A;  2D74 B;  4F4Y A;  1NO8 A;  4LIR A;  5EWG A;  5BR8 J;  3KLH B;  3HX9 A;  1VQN S;  5FDL B;  4OJ3 A;  3KOA A;  3KYL A;  3HVT B;  1URN A;  1JB0 C;  1BC6 A;  4UTG A;  1S59 A;  2B5J A;  3TWZ A;  1HBO B;  2DNZ A;  5C2G A;  2RS2 A;  2DPJ A;  2OPP B;  3I0R A;  4K5R A;  5HMX A;  2GFF A;  3M8Y A;  2R2T A;  3Q23 A;  4DR3 F;  2CPH A;  4X62 F;  1R0A B;  1PSD A;  4K8R A;  2AMC B;  2HWI A;  4KE5 A;  4EZ6 A;  1SUQ B;  1WWH A;  5L9N A;  5KFS A;  3BBB A;  4G1Q B;  4LSZ B;  3AHP A;  4ZVO B;  2JDJ A;  4H4M B;  1EAY C;  5IXU A;  4MIB A;  2BM0 A;  4BBY A;  3BQ1 A;  1TK0 A;  3I9Z A;  1YJW S;  3CDU A;  2AEJ A;  2B4P A;  2DY9 A;  2B6A B;  3RUB L;  4NX9 A;  1CBK A;  5I3U A;  1JKH A;  1NJZ A;  5L1I A;  1XMQ F;  2RKI B;  2ZDP A;  1J27 A;  1AZS A;  1IJE B;  1VIO A;  2NXC A;  2YWG A;  3M6X A;  4KBI A;  5EWE A;  4A8S A;  3FQL A;  3SQO P;  3T1Y F;  2J5A A;  1U02 A;  4J9R A;  4OYB A;  4IUF A;  1HQE B;  2CPD A;  1PIL A;  5ETT A;  4TQR A;  2PII A;  1LQ9 A;  4F4K A;  3E51 A;  2YXL A;  3S1T A;  1FJG F;  3GPA A;  1FDN A;  3H40 A;  1QSY A;  1RT6 B;  2B51 A;  4PPZ A;  4DL2 A;  3L09 A;  1NK5 A;  2GQC A;  5A76 A;  5E3P A;  4IOA Q;  2R7U A;  2CJA A;  4USJ C;  5BYS A;  3HVA A;  4ED3 A;  4JI8 F;  1U6B A;  1R8H A;  3EXC X;  3MMB B;  3UPF A;  2GAH C;  2UUC J;  1NBE B;  2FJW A;  3D28 A;  1OIA A;  3GR0 A;  4WWS A;  3CJ2 A;  3T5L A;  4DL4 A;  4Q43 A;  4NLY A;  4Y65 A;  1EQ0 A;  3DHW C;  3R5G A;  3ZZR A;  3KLE B;  2GO8 A;  1YGY A;  4KGV B;  2DYA A;  2DNM A;  2NYI A;  2WVB A;  4LF4 F;  3Q8Y A;  4C0H A;  2FHK A;  1TKX A;  4F04 B;  1R89 A;  4CO4 A;  2VQE F;  4O23 A;  2VPZ B;  2YPY A;  3CME S;  2JEI A;  1F60 B;  3RBE A;  3D3C J;  1L3K A;  3D54 A;  1VS3 A;  1X5O A;  3W3S A;  4ECR A;  2MST A;  4FN5 A;  1T8E A;  1ACM B;  1MG7 A;  2CPJ A;  1WHX A;  4OLP A;  1MN7 A;  3NOC A;  4K4U A;  2KFZ A;  3Q22 A;  4KYZ A;  2VOO A;  3KUE A;  1RTH B;  4AE5 A;  4DL6 A;  3IAS 9;  1EP4 A;  3ISN C;  1KEK A;  4YR3 A;  1N48 A;  3RB4 A;  2FC9 A;  2GMH A;  2WRM A;  3GIL A;  3LP1 B;  3MM9 B;  1FDA A;  1M90 T;  4DV2 F;  1HMV A;  3GFY A;  1O8B A;  3C16 B;  2E5L J;  5L9X A;  1FX2 A;  3K89 A;  1EP4 B;  3OXL A;  3J7Z 5;  4YB6 A;  2ZUA A;  1SC6 A;  1TU0 B;  1RT1 A;  2LQ5 A;  4DSF A;  1CJV B;  2MQO A;  1C1B A;  4Q7A A;  2XM3 A;  1HL6 A;  2GQ2 A;  1QTM A;  4F4Z A;  5D4P A;  2HG4 A;  4AND A;  1RAF B;  3AOB A;  5L8R C;  1KQF B;  1GK8 A;  2AJ0 A;  2YNF B;  1FK9 B;  3CCU S;  5EHH A;  1Q7Y T;  5C24 B;  2DK2 A;  2MQN A;  2BYC A;  1L5U A;  4DSK A;  4CM0 A;  2HZV A;  3OR1 B;  4D3G A;  5DQI A;  3V6D A;  1PC5 A;  2A2D A;  4J9K A;  4PXE A;  3AXM A;  1VQ6 S;  2OPQ A;  2ALY B;  3AXK A;  5ETQ A;  2XLJ A;  1PYT A;  2NXN A;  4UY8 5;  2UXD F;  1ZM2 A;  1FK9 A;  3EPG A;  5DRK A;  2X3D A;  3W2W A;  3H5U A;  3W5Z A;  1IUJ A;  3QT6 A;  4DR4 F;  2AP6 A;  2OI2 A;  3IBF B;  1VQP S;  1EET B;  4O4G A;  4ILL A;  3RAM A;  4J9V A;  4DX8 H;  4RWW A;  2WBM A;  3PJX A;  3MAA A;  2V4R A;  3HFZ B;  4HH0 A;  2QE5 A;  4NLP A;  1RT7 A;  3TA0 A;  3SSR A;  3TAM B;  6FDR A;  2DGS A;  3UVJ A;  2R7R A;  4DFP A;  1LV5 A;  2OPS B;  4NWB A;  2ALZ A;  4NLV A;  3N4W A;  1RTZ A;  2HLT A;  4P71 A;  3UNY A;  2ERR A;  1CVJ A;  5T7L B;  5KG2 A;  2K7J A;  2AGQ A;  3AD8 C;  3MDF A;  1YJ9 S;  1HQE A;  4USI A;  4XK8 C;  2O5D A;  4TNO A;  5HP1 B;  5KT4 A;  1IBL F;  2QJ3 A;  1E6Y B;  2VDI A;  3ADA C;  3CCL S;  3DMJ A;  4RW9 A;  3DRP A;  3HKZ D;  1YZ6 A;  2FIU A;  2J7K A;  3LAK A;  4MAK A;  3V4I A;  2PC6 A;  1NCL A;  3G96 A;  3KDN A;  3PHT A;  3PRV A;  3VAJ A;  3D6H B;  4ZVU B;  2D7S A;  2MGZ A;  4ZVG A;  3R8Y A;  1TKX B;  3I56 S;  5KT3 A;  2FZK B;  3TUI C;  4WFY A;  4DR5 J;  2J9E A;  2FDN A;  2JEJ A;  3DMJ B;  1QY7 A;  3M1V A;  2OEM A;  2RH3 A;  4NOH A;  3G87 A;  2ZBC A;  2IM0 A;  4ZVR B;  3GYN A;  2VOP A;  2MKK A;  1ZOT A;  2FLP A;  3EE3 A;  5K8P A;  1NJI T;  3OTB A;  3K0J A;  5F3T A;  1KVK A;  3NAH A;  1FKP A;  1F1B B;  3ZFV A;  1QVF R;  2AYM A;  5KG6 A;  4V19 J;  2IPO B;  4DR7 F;  1SIW B;  4CNZ A;  2ZC3 A;  3TUZ C;  2Z2Z A;  2C28 A;  1Q86 T;  4KFB A;  3LP0 A;  4F3M A;  3TX0 A;  3I5A A;  3JB9 k;  3K17 A;  2VOD A;  2W2M P;  4DFJ A;  1KDN A;  2JJ4 D;  3B4D A;  3FC9 A;  4DG1 A;  1HNI A;  1BMQ B;  3A8E A;  4KRW A;  3J7Z T;  4BWJ A;  1QDU B;  2NXU A;  4KFB B;  3OFH A;  1UW9 A;  2BE2 A;  5D77 A;  2P8I A;  3WC0 A;  4CWB A;  1SKR A;  3BGU A;  2HZA A;  2NLW A;  1A9N B;  1S1T A;  2HQ3 A;  1H74 A;  2HNZ A;  3DM2 B;  3CO9 A;  3TAN A;  4DSL A;  4LFB F;  3GCX P;  1JNR B;  1RHJ B;  1S6U A;  1ZZN A;  1UA1 A;  2GHV C;  3R5J B;  4OYO A;  2BJ1 A;  2WAQ D;  2GQQ A;  1OO0 B;  3A4T A;  3HI9 A;  3TX8 A;  1QAI A;  1UZD A;  3QID A;  4LSL B;  2M88 A;  3I6P A;  4KKO B;  4QIW D;  4GKJ F;  2VBX A;  4LIW A;  4OZJ A;  4ZIV A;  2UUW A;  1WSV A;  4USW A;  4K4Y A;  1HWL A;  1Y11 A;  2CG4 A;  4GVB A;  4X4P A;  2YNF A;  3H5X A;  3HT0 A;  4HI1 A;  5AXN A;  2ZBI A;  5F0U A;  4ZIW A;  3AOA A;  1U0S A;  2ZKU A;  4CLZ A;  4OHY A;  1VC6 A;  1LFP A;  5A2Q Y;  4UUW A;  2C2E A;  3IP0 A;  5CCM A;  2J0Q D;  2DXD A;  1JLG B;  1B0T A;  1D3W A;  2QX0 A;  4OI3 A;  1TK8 A;  2V68 A;  4ETZ A;  3PAC A;  2HBR B;  4RW8 A;  4C9D A;  1KOO A;  3CCW A;  1TUG B;  4ZVS B;  2CJX B;  2FHJ D;  4DR2 J;  1TFY A;  1ITP A;  1NPR A;  2KXN B;  3K59 A;  2FD2 A;  2Z8Q A;  3MD3 A;  3MEE A;  3MCS A;  5KFY A;  2ZJP Q;  4DCP B;  3EZ5 A;  1Y7P A;  2MB0 B;  1WNE A;  1YBA A;  1XNQ F;  5AXM A;  4WBF A;  3BN4 A;  3T9Z A;  4A8K A;  1OPI A;  1PJ5 A;  1F2G A;  2KB2 A;  4ZHR B;  5KG5 A;  2F9D A;  3GB0 A;  5KT7 A;  3VF0 B;  2NXE A;  2UUA F;  2GGP A;  3F44 A;  2XSJ B;  2O3D A;  3CF5 Q;  3D1Q A;  1F9H A;  2CXE A;  1F3F A;  1LW0 A;  2RF2 B;  3BR8 A;  2E9R X;  3U1L A;  2P9C A;  2JZ5 A;  5KFP A;  4IQM A;  2XLK A;  1RCX B;  1VC0 A;  1HWU A;  3JYT A;  3D7S B;  3BYP A;  4OI0 A;  3PKM A;  2CJQ A;  2U2F A;  4U7U D;  1V9O A;  2UUC F;  4CT9 A;  2HRU A;  1FJ7 A;  4WPA A;  1DLO B;  5IQQ A;  3M9M B;  1QJH A;  1V5I B;  2ZHB A;  5KFK A;  2COL A;  4B9M A;  4LFC J;  2JFK A;  4I6A A;  3UE2 A;  3KLE A;  2D3O R;  2E29 A;  4FF3 A;  1M1K T;  5DM7 Q;  2UV8 A;  3I4P A;  4MT1 A;  5IS2 A;  5F8H A;  2W9A A;  4ED2 A;  3BYR A;  1RZM A;  3W5Y A;  5HLF A;  3CGI A;  4KY3 A;  2M4M A;  4QWE A;  2DT9 A;  3U1N A;  1ZM4 A;  4PAA A;  1KQK A;  1HNV B;  1RTJ A;  2FC8 A;  1YQH A;  2KT2 A;  1RTI A;  4BC7 A;  2KYX A;  2X1B A;  3ENQ A;  5EGY A;  2ZJR Q;  1QSL A;  4C4W A;  4WYL A;  1GH8 A;  4H4K A;  3TAM A;  4YDD B;  1KC8 T;  2DGO A;  1FJC A;  5FJ4 A;  5ETO A;  3C15 B;  1F5A A;  5K8O A;  1TL3 A;  2BX6 A;  2HIY A;  4WYW A;  4M5N A;  2DXE A;  4RW7 A;  4MK8 A;  3FEX B;  3R3T A;  1W25 A;  5IC4 B;  3SCL E;  4RNF A;  4QU7 A;  4OYZ A;  3UDL A;  1NSQ A;  4O4R A;  3W9J A;  3BKU A;  2DPI A;  2EFN A;  2OPR B;  3DNC A;  3QGH A;  4EFA C;  2PMZ D;  3JAM U;  4G1Q A;  4DL3 A;  1SC4 B;  3G71 S;  4LF5 F;  4DR6 J;  2HQF A;  3DDK A;  2OFH X;  2P6S A;  1SKS A;  3HHK A;  4QIV A;  4KH0 B;  1O6X A;  3N0V A;  4Y28 C;  1UVJ A;  2BJE A;  2NSC A;  1JLC A;  1LXN A;  1NH8 A;  2ZH6 A;  1NKB A;  3THT A;  3W8P A;  5A8W A;  2B4O A;  2W4C A;  1U1M A;  4NLT A;  1UTA A;  4C7Q A;  2C3M A;  3A8J A;  2ATC B;  3I9V 9;  5DGB A;  4FBU A;  2LEP A;  2QMU B;  1RTD B;  1UW4 A;  1IBC B;  1UJ6 A;  2FY8 A;  3AD7 C;  5CA5 A;  1CJU A;  5EX3 A;  2Q1L A;  3I32 A;  4JB8 B;  2CPY A;  1T0T V;  3RU0 A;  4CLP A;  1TKT A;  4CO5 A;  3AH6 A;  5EWF A;  3IWN C;  2LQJ A;  1TL7 A;  4IDK A;  4DZ6 A;  2FHM A;  4AYB D;  5SZT A;  2IVF B;  1BE4 A;  9RUB A;  2GA7 A;  3JSY A;  3KLH A;  2KT5 A;  2MKH A;  3M8S A;  4UOF A;  5DG8 A;  1BLU A;  2H51 B;  1QUV A;  5SUH A;  2VZ9 A;  1S9E B;  3RZA A;  1IM4 A;  2IDE A;  2QA1 A;  3CJ3 A;  2DNY A;  1KR4 A;  1PC4 A;  2BJ7 A;  3KLI A;  1U0H B;  5I3Q A;  2WHO A;  1X5P A;  3J7A N;  3LGN A;  2J0S D;  3KJQ B;  2R2R A;  1G2E A;  3VWS A;  3MCM A;  2B4V A;  4BLG A;  3DM2 A;  4QIF A;  4WII A;  2GIQ A;  4DUY F;  3E2E A;  1U7L A;  2V5H G;  5AXL A;  1RKJ A;  3KHR A;  3PO4 A;  3CC2 S;  1XEZ A;  2I9S A;  5A8W B;  3GR1 A;  2JC1 A;  4NEY A;  2K06 A;  3RB3 A;  2HHS A;  2QL5 B;  3C66 A;  2XY7 A;  4K2X A;  1RE1 B;  5ETP A;  1FRK A;  5FLX U;  1SJ1 A;  3A13 A;  1HI0 P;  2J6S A;  2MKI A;  3VAH A;  1DQA A;  2B9E A;  2K3I A;  3JS9 A;  4QIE A;  3LTO A;  1QUP A;  2QLB B;  4UOH A;  2NCK L;  2XC9 A;  3H42 A;  5D4O A;  2L08 A;  1M0S A;  4RW6 A;  2NZC A;  1T9Y A;  2VF3 A;  2YWH A;  4P75 A;  4LRE A;  5D0E A;  3ULH A;  3OSN A;  5HJY A;  2QFJ A;  3ZZ0 A;  4PWD A;  3OFF A;  2ZM6 F;  4DUT A;  2HYI B;  3LP1 A;  1IBM F;  3OTO J;  1B4S A;  5G0R B;  4K0K J;  3W9I A;  1JLG A;  3TAQ A;  4YR2 A;  1Q8B A;  3HHD A;  1RTD A;  4F2S A;  1GQE A;  2ACY A;  1N4L A;  5DET A;  2J0X A;  4RL1 A;  2KTQ A;  3FUY A;  3TP2 A;  2QRR A;  3FEY B;  4FZV A;  1YRU A;  7FDR A;  5HN0 A;  5KFQ A;  3KK1 A;  1U1L A;  4JI4 J;  3NCQ A;  5KOX A;  4ZLJ A;  2V8G A;  2DH8 A;  3EZU A;  3N79 A;  4OZN A;  3FZB A;  4UST A;  4DS4 A;  1NME B;  3DLL Q;  4PCQ A;  2GX8 A;  4CLF A;  2NR0 A;  1PYS B;  4O3O A;  1UFW A;  4LBP A;  2ZH8 A;  3PVX A;  2D3Z A;  3K2Y A;  3MPD A;  1OJ4 A;  2C22 A;  4ERD A;  2G1H A;  1PO6 A;  1YVF A;  2IVY A;  3IC1 A;  3F73 A;  3BEG B;  4ZPV R;  4DDF A;  8AT1 B;  2CQ4 A;  2UVU A;  1HNZ F;  2HW3 A;  1RT5 B;  2E5G A;  2QFI A;  4PQA A;  2DCU B;  3M2R B;  3MPW A;  4DV3 J;  1Q95 G;  1ZAV A;  1FWL A;  2YH1 A;  4IFV A;  4J9P A;  1S1W A;  3B54 A;  4DV5 F;  2XMW A;  4P72 A;  3CCE S;  3V81 A;  3JTN A;  4C6A A;  1T3N A;  1RT7 B;  1NB2 A;  2PT0 A;  5IT4 A;  1OYE A;  2HFV A;  4EBD A;  5LSR A;  4NI2 B;  2I5J A;  2RRA A;  2I0X A;  1D8Y A;  4X64 F;  2QA2 A;  3W61 A;  5AE2 A;  3ILO A;  2YNI A;  3HZE A;  3GJT B;  4LSN B;  5HQL A;  1I6J A;  1FJE B;  4W92 B;  1SQG A;  1RAJ A;  3MEG A;  3KK1 B;  4QQB A;  4F0M A;  1M5P C;  4ZCL A;  4JOU A;  4MIW A;  2R2S A;  4J37 A;  1WD6 A;  3A8I A;  3T6B A;  2XYH B;  1K0V A;  2J76 E;  1D9D A;  2I38 A;  2AQ4 A;  1J5E J;  3BDP A;  5KAK A;  2RF2 A;  1URR A;  2JX2 A;  2OPS A;  5KFA A;  2DCL A;  1X5T A;  4I2Q B;  4LF9 J;  3M30 A;  2CQP A;  3J7A 1;  2OPP A;  3H2U B;  3GQC A;  2ZOM A;  1FXD A;  2CZ9 A;  4BC9 A;  4F8R A;  3UDV A;  4RBT A;  2DO0 A;  2FJD B;  4J90 A;  5DDQ C;  1CJK A;  3EYZ A;  3UO0 A;  2WBR A;  4KHM A;  4CDI A;  3EPI A;  1TAU A;  3FRY A;  2GJF A;  1TMM A;  1TL5 A;  1S0N A;  4OHZ A;  4FF2 A;  4Z7Y A;  1JJC B;  5LMN F;  2J0W A;  2RVJ A;  2J7W A;  2R3V A;  5IQ6 A;  1HQU A;  1W2B R;  2EFQ A;  3DLJ A;  1CJK B;  1RWN B;  3TRG A;  3TVY A;  3W66 A;  1RU2 A;  4TYB A;  2OSR A;  3TZZ A;  2N7C A;  4QWD A;  4DU7 A;  1QLN A;  1IWA A;  2XMJ A;  3MZI A;  2FJE B;  2E9T A;  1IQZ A;  1DQ8 A;  2FPH X;  2ZDO A;  4ZLL A;  4F0H A;  5F9L A;  2H4Y B;  4P2S A;  1HQU B;  2ABY A;  2HGN A;  2M7S A;  1SQE A;  1SJF A;  5B0E A;  4TY9 A;  3ONQ A;  3M2V A;  4QJV A;  5DZ6 A;  3IR5 B;  3Q89 A;  5AE3 A;  4ZVP B;  4WFN Q;  2XGQ A;  1VQK S;  1LNQ A;  4CO2 A;  4B9V A;  2K3K A;  4B3O B;  1L3U A;  4CLY A;  5KFF A;  5HBM B;  1TL1 A;  3K5M A;  4IRD A;  1TK5 A;  2Z0G A;  5I42 A;  3RBZ A;  4DR3 J;  1ULR A;  4X62 J;  3EDR B;  4QYR A;  3QPI A;  4DS5 A;  3T5H A;  3DN9 A;  1N0U A;  2QL7 B;  4XTT A;  2KM8 C;  4NZ0 A;  1S6P B;  4B9U A;  3DYA B;  8ATC B;  2D3U A;  3QO9 B;  2CG8 A;  2MHN A;  1C4A A;  4DSI A;  4ILM A;  4LF2 A;  4JI0 F;  4DV7 F;  1SJ4 P;  1NU4 A;  2R4F A;  1RT2 A;  3CTR A;  1TEL A;  4YR0 A;  3PW0 A;  3QGI A;  1Q1K A;  1YJV A;  2HVZ A;  4RBV A;  1NHU A;  5M2P A;  4J9M A;  4B3M F;  1BQN A;  1TQL A;  4NLD A;  3VZH A;  1ZET A;  2F9J A;  3UCZ P;  2M8D B;  2HEK A;  3TZY A;  3QGG A;  4CTA B;  3L9Z A;  1ELO A;  4U7C A;  3MEG B;  4WK3 A;  1L3T A;  3EZO A;  2AV5 A;  2MQP A;  4HHH A;  2BRK A;  2OJ3 A;  2W4D A;  1FJG J;  4K4Z A;  1O0P A;  2QMX A;  1CPZ A;  2CJ9 A;  4WIQ A;  2R8G A;  2JEF A;  1HBU B;  5D0R A;  2V50 A;  2LXF A;  2C3O A;  3IWL A;  4K2J A;  2DR5 A;  2PGC A;  3BB5 A;  3PJW A;  1RIS A;  3HLU A;  2M70 A;  3KJV A;  3KUG A;  3RBD A;  4NXN F;  1SL2 A;  2ASY A;  4DSE A;  4MK9 A;  3DYA A;  3Q0A A;  4GKK F;  1XJW B;  3LWL A;  4JV5 J;  2HUR A;  4ED8 A;  4N41 A;  1J5O A;  2LXI A;  3HCX A;  1RT2 B;  2DB1 A;  4HI2 A;  3TOQ A;  3OXF A;  4IG3 A;  2YKA A;  1HBO A;  1ZZF A;  2GW8 A;  1QAJ A;  3FBB A;  1VBX A;  2B7B B;  5B0B A;  1AUD A;  1MSW D;  2RRB A;  5IT0 A;  4OYX A;  3CJ0 A;  1WI6 A;  2YNG A;  4RU9 A;  4FS1 A;  3QJJ A;  4JYA J;  4ETX A;  3K8V A;  3HDS A;  4TY8 B;  2L3M A;  2FZC B;  3CPW R;  2F4V J;  2QSW A;  1HW8 A;  1XN9 A;  3JQJ A;  5IV3 A;  2CNO B;  4L76 A;  4UY8 T;  4TLR A;  3HPO A;  1Q81 T;  4I2P A;  3JQM A;  1GEH A;  1RAD B;  5K14 B;  5KFG A;  3TI0 A;  3ETO A;  1NK9 A;  3KMQ A;  4Q0B B;  2DHX A;  2BJ8 A;  3TVZ A;  2CQD A;  1I51 B;  2LU2 A;  2YWW A;  3Q2S C;  2BQR A;  3EGW B;  2XHW A;  4YB7 A;  3QAT A;  5GMK a;  2AKW B;  4CH1 A;  2VPX B;  5J2M B;  1EHW A;  4JI3 F;  3WIU A;  4CNY A;  5JUM A;  1S0O A;  2QLW A;  4LVN P;  2AEF A;  2V94 A;  3POT B;  1PKU A;  4FVM A;  4ES1 A;  2XY5 A;  1JX4 A;  2OML A;  3CCZ A;  4ZK7 M;  2IVM A;  2HND A;  5CD4 A;  2XGP A;  2CQH A;  1LWF A;  3NGU A;  1PJ6 A;  3PX4 A;  1H2T Z;  2E5I A;  5H1S V;  1TKD A;  3CIZ A;  3M7V A;  3MEC A;  4LF1 A;  5CYM A;  4ZKA A;  5KTQ A;  1RXO B;  1TKZ A;  1XQI A;  1HHQ A;  2FVR A;  3CUL A;  2I6W A;  3PR5 B;  4ENO A;  1X4G A;  1QE1 B;  2C3Y A;  1N5S A;  1SV5 A;  5C24 A;  4OYM A;  1VRT A;  1UJ4 A;  2CPI A;  2MJN A;  3EUN A;  2V2Q A;  4H4K C;  5CH7 B;  3W5X A;  2VJV A;  2DR9 A;  2NUU G;  4W90 B;  2DIT A;  4FNI A;  4LRA A;  1JLC B;  4RW7 B;  4YN3 B;  5A0Y B;  1XNR J;  2DNQ A;  1K0T A;  4QYZ J;  1GXL A;  4UW2 A;  3ICL A;  3IMQ J;  4W98 A;  1IKY A;  4DV0 J;  4E2F B;  2AF6 A;  3MF5 A;  3MR5 A;  2VPY B;  2VUG A;  3LGH A;  1HPZ A;  3KHG A;  4FF1 A;  4M1K A;  2KRB A;  4ICL B;  1NDC A;  3PX0 A;  2GHW A;  2V9W A;  1CS4 A;  1N34 J;  1RJJ A;  1WC3 A;  3D0I E;  3AJ1 A;  4WU3 A;  3M8Z A;  4XO0 A;  1Q79 A;  3ZTO A;  1GT8 A;  2GAG C;  2XMV A;  2DVI A;  1H73 A;  4LRF A;  4F02 A;  1XR7 A;  4B9L A;  5E3C A;  1YLX A;  3I55 S;  1RK8 A;  2PA8 D;  2FGO A;  4JV0 A;  1MRO B;  1OY9 A;  2F40 A;  2WB1 D;  4JI2 J;  1U8W A;  2VHG A;  2F4F A;  3FMB A;  5LSL A;  4JBC A;  5L1L A;  1WKK A;  3MAQ A;  2IIH A;  4DSJ A;  2GJI A;  2VL1 A;  1EKR A;  2V2K A;  3HHL D;  1PBU A;  5CXT A;  3RGI A;  5F9N A;  4X65 F;  3NNA A;  4DR5 F;  3V4I B;  3NBP A;  3RBX A;  1VBK A;  1TMJ A;  2CFX A;  2VBY A;  3AJD A;  1U8S A;  2PEB A;  3QT8 A;  1N5Y A;  5LOQ A;  5HL7 Q;  5GVQ A;  3VR1 A;  1H98 A;  1RT5 A;  4QWA A;  3RRK A;  1N36 J;  4FXW A;  1X7V A;  1G6B A;  3U27 A;  3CD7 A;  3KLI B;  4YB1 P;  3G82 B;  1FKO B;  5KFB A;  1U09 A;  2J8S A;  4ZJL A;  4NAS A;  4GMK A;  3C6U B;  3NAI A;  4NYP A;  5IWA J;  1UMJ A;  5KG3 A;  5HRO B;  2MZ1 A;  5J2P A;  1WEL A;  4RW6 B;  3TA1 A;  1KLN A;  3GMG A;  1LW0 B;  2D9O A;  3PIO Q;  4IR1 A;  5IT9 Y;  4I6Y A;  4B9S A;  1JKH B;  1YKW A;  1RLC L;  4B02 A;  3VQS A;  3KLF B;  4DQP A;  1C1C B;  3C14 B;  3E01 B;  4J9S A;  4KJI A;  1UP1 A;  5CZV A;  3FZ2 A;  1F0X A;  3UR0 A;  3ZTR A;  3PO5 A;  3W63 A;  1FFS B;  2HAI A;  1JLE B;  3BPS P;  4DEZ A;  1S1U A;  5BR8 F;  3OQ2 A;  1VQ5 S;  4RW4 B;  1RI7 A;  2Y3Y A;  1ZA2 B;  3QYY A;  2XZW A;  1W26 A;  3JAM Y;  5T41 A;  2M5Y A;  4DX7 A;  1KON A;  3DRR A;  2AZ3 A;  5A8K B;  3MPV A;  1OS5 A;  3BBC A;  3CVK A;  4PWW A;  4X66 J;  2BRL A;  2VDH A;  1Z1Z A;  2XWX A;  3R5A A;  4OZ2 A;  4GKJ J;  2IBO A;  1JMT A;  2PN6 A;  3CNQ P;  4MFB A;  5B0F A;  4O3P A;  1I1G A;  2DIV A;  4E8U A;  5KFC A;  1MWY A;  1FDB A;  1VLO A;  1WF1 A;  1NRK A;  1R0A A;  2W2O P;  2V2V A;  4LF6 F;  1L3S A;  5I42 B;  1J5O B;  2HS4 A;  3FK4 A;  1KFS A;  4YHH F;  1TFW A;  2BR0 A;  4FPI A;  2FJB B;  2JWN A;  3I5B A;  3G6X A;  2R7V A;  3DLB A;  3QLH A;  1WC6 A;  2FHO B;  2LDY A;  4EYI B;  4RR5 A;  3PR4 A;  4BHQ A;  1XMQ J;  4DL0 C;  4DR2 F;  2HMI A;  2Q6B A;  2F3J A;  4WTY A;  2YX7 A;  4DLG A;  4J9N A;  1P1T A;  4EBC A;  4OX7 A;  3B4M A;  2GVD A;  2K2P A;  4CRJ A;  2HS0 A;  4JI6 F;  3C6T A;  1MML A;  1T11 A;  4L75 A;  2KXF A;  1JNZ B;  4QR2 A;  4ED0 A;  1GMW A;  1N52 B;  2AJF E;  2E44 A;  5K14 A;  3SBM A;  1LWX A;  3A1Y G;  4FYD A;  3CDB A;  3NCR A;  2R2U A;  4F0K A;  4IO1 A;  1AW0 A;  2EK6 A;  3MM9 A;  2IMW P;  5LJ5 Y;  4JI8 J;  1HNX F;  2MMY A;  2YKM A;  2RUG A;  1VHF A;  3JSB A;  2WK4 A;  4NCG A;  2NPF A;  4I1T A;  2CJY B;  2XUL A;  1FFW B;  2B9W A;  5ETM A;  2ZIT A;  3HF5 A;  1UKU A;  4U67 Q;  1RAH B;  4Q8F A;  2NPI A;  2CQ2 A;  2HRY A;  4LBI A;  1AA1 B;  3H7H B;  4J91 A;  1UWA A;  2EKY A;  3Q8V A;  4OX6 A;  4OX9 F;  4DPT A;  2VQF F;  4A8W A;  1ZH5 A;  4WZM A;  2Y1I A;  3CJS A;  1Y10 A;  2VQE J;  5GAH U;  3DU5 A;  4NE9 C;  2QGF B;  1NKE A;  2H65 B;  1VQL S;  3VVT A;  1GX6 A;  2HBY B;  2QZ8 A;  2DTJ A;  2CVI A;  2DEJ A;  3NS5 A;  2NRE A;  4J7C A;  2FGC A;  2ZE2 A;  3V2U C;  5GAG I;  3M8R A;  1F6T A;  2WVF A;  5GAE I;  3GG1 A;  4ED1 A;  4FBT A;  1VJW A;  3HSJ A;  5JXS A;  2AJ1 A;  2LCW A;  3BSN A;  3T1H F;  1YDL A;  2CUY A;  4NMX A;  4YFU A;  4BDP A;  2ZJQ Q;  4Y6I A;  4DCJ B;  2N4D A;  1FTC A;  4F25 A;  5B0G A;  4ECZ A;  3DRX A;  2W01 A;  3M1V B;  2W4P A;  2QV6 A;  3H8Y A;  2KG1 A;  3DFE A;  5D4N A;  1HNV A;  4ZVH A;  4J9O A;  2E5L F;  1NAQ A;  3TZX A;  3DOM B;  1R31 A;  1X60 A;  1RWK B;  1FTR A;  3EM1 A;  1BD6 A;  2JLG A;  4Q8E A;  1WTB A;  1HAR A;  3WHI A;  2BKN A;  2AWZ A;  2DGV A;  4CT8 A;  1FE4 A;  1NDP A;  2Z2Y B;  5A8R A;  1RKI A;  3DLG A;  3FCV A;  4KT0 C;  4LF7 F;  3BSC A;  3D1H A;  3DGV A;  3Q8Q B;  4LF5 J;  1VCT A;  4U8Y A;  3E3X A;  2B5J B;  2A1B A;  4I7F A;  3P5T L;  4KGX B;  4C11 A;  4RNN A;  2R7X A;  1U1P A;  3IG1 B;  1F5C A;  5A0Y A;  3SCJ E;  2UXB J;  3TYT A;  4RUB A;  2CAD A;  4R8U A;  2E1P A;  4J9Q A;  4ECW A;  2UXD J;  4XPC A;  1P1L A;  1XR6 A;  2WOM B;  2V63 A;  4OHV A;  5HK4 A;  1JLB A;  1Z4U A;  2DR6 A;  2HBQ B;  2NSB A;  2W2N P;  3JTP A;  4EK2 A;  2A6O A;  1RWX B;  2XS5 A;  4FNH A;  2C2D A;  5GAH I;  2RQM A;  5HAO A;  3D6F B;  2ZH2 A;  1IN0 A;  2HPU A;  1WSR A;  3EGV A;  1Q78 A;  1VRU A;  2KDO A;  2HHW A;  3ET6 A;  3Q24 A;  2UP1 A;  3QBC A;  1RLD A;  2LA4 A;  3PHE A;  1S0M A;  1CJT A;  3GJR B;  1TV6 B;  4LQ9 A;  3ZO7 A;  2MKJ A;  2OEL A;  3CD0 A;  2PDA A;  3BO2 A;  3CCM S;  1JLQ A;  2Q43 A;  4L72 B;  4AL6 A;  2JVO A;  2ZKT A;  3O1L A;  2JFD A;  1M5S A;  2EFG A;  1FNO A;  4A46 A;  4CH0 S;  3PYF A;  2D3O 1;  3PY8 A;  3C2P A;  4I2Q A;  1HYS B;  4ANE A;  4Y3C A;  1WEZ A;  3PFE A;  5ETR A;  3PXG a;  2BAN B;  2DNR A;  3OL6 A;  1NK8 A;  2BV3 A;  3HM9 A;  3FSY A;  1SC1 B;  4A8X A;  4NLU A;  4R5P A;  1RAC B;  4HDH A;  1GTH A;  5JJB A;  4OJG A;  2CJB A;  4DZD A;  3I4H X;  2M8H A;  1U2F A;  2RAQ A;  3AQP A;  2CPZ A;  2OD6 A;  2V9K A;  2MZT A;  2YNG B;  3A3O B;  3BS9 A;  3KKF A;  3OJS A;  4AUK A;  2LLZ A;  4C3K A;  3BGL A;  3L4B C;  2UVV A;  3BBF A;  1S99 A;  1T9W A;  1LFW A;  3SDE A;  2R7Q A;  2W24 A;  4OV1 A;  4RNM A;  2PMH A;  4YOE A;  2XHC A;  3NL0 A;  4DR7 J;  4PG8 A;  1G4C A;  5C42 B;  2BQU A;  4KIA A;  3MFI A;  1LW2 B;  2HLU A;  3B8H A;  2ZM6 J;  2QLX A;  1YBU A;  1M5O C;  1BHN A;  2DNL A;  4HAC A;  3OTO F;  3QJP A;  2E66 A;  1KS2 A;  4D3H A;  1XWL A;  3CWJ A;  4Y34 A;  4NLO A;  5E7O B;  1FES A;  2AT1 B;  1M5K C;  2BJD A;  1KVI A;  1ZBT A;  1RT3 A;  1N56 A;  3C6U A;  4PYA A;  4YUD A;  1RTI B;  5KFZ A;  1SVD A;  2YKN A;  3MD1 A;  2FVP A;  1F3V A;  1OWX A;  1KLM A;  1T9V A;  4OZ0 A;  5B08 A;  1NDL A;  4ZPA A;  1U4B A;  2BOP A;  1XMO F;  3VAF A;  2E9Z A;  3MEK A;  5KFJ A;  4LFB J;  1T7P A;  4L3K A;  5HVG A;  4M5M A;  5FD1 A;  5H9F J;  3IS9 B;  5DZ7 A;  4WF9 Q;  4Y2I A;  2FLN A;  2UUB J;  3HO1 A;  3NXZ A;  5HP1 A;  3MUR P;  3PYG A;  1X9M A;  2LDI A;  1HNZ J;  1H3D A;  4PQU A;  1FRM A;  1RAA B;  2C1E B;  1XMB A;  3M6V A;  2N3O A;  2MZS A;  2N82 B;  2CWX A;  1PBA A;  1GXU A;  2RQK A;  2ZWP A;  5MAO A;  3KWM A;  2MGZ B;  3VAK A;  4C3L A;  2VAS A;  4ECV A;  4M94 A;  2EC0 A;  2HSE B;  4UZC A;  2R8J A;  3VAG A;  5HMZ A;  3CJK B;  4ED6 A;  2Z2L A;  1ZS6 A;  2B6A A;  1B0V A;  2MQ8 A;  2RU9 A;  1WOS A;  2QLF B;  3G86 A;  2R8K A;  4V19 X;  3TJA A;  1VIS A;  1RYS A;  2BW2 A;  2UVR A;  3LPE A;  1VQ9 S;  4I6W A;  3GSI A;  1IKY B;  3SQG B;  1J5E F;  4E98 A;  4Q44 A;  4OZL A;  3CCS S;  1XNQ J;  1IQT A;  3FQK A;  3OD2 A;  4TKT A;  2R8H A;  1D9F A;  2VBZ A;  2WSC C;  1FX4 A;  4EEY A;  2J8A A;  4DPO A;  1GFW B;  4ED5 A;  4C48 A;  2U1A A;  5GAD I;  2ADC A;  4PZV A;  4UF4 A;  2HNY B;  1IR2 A;  2RIJ A;  4PQU B;  2LMI A;  1P9Y A;  1VJQ A;  1S6P A;  1WC4 A;  2H48 B;  4O3N A;  5C25 B;  3R27 A;  1TKZ B;  2YWK A;  2Z4P A;  4QW9 A;  4LQ3 A;  5D8H B;  1UJ5 A;  2CDR B;  3AT1 B;  2MKS A;  4USV A;  1S7I A;  4JI1 F;  2ROE A;  4TVA B;  2KZZ A;  2DGQ A;  2J6T A;  3MR2 A;  2IM1 A;  3OHA A;  3CCV S;  2B8Q A;  3TVK A;  1VK8 A;  2DEI A;  3K7R A;  2H5E A;  2E7X A;  4MMO A;  1TUW A;  3THP A;  4C11 B;  4GC6 A;  2ATL A;  1R3N A;  4LSL A;  1U45 A;  1NSK L;  2GML A;  2YX1 A;  1X4A A;  4R25 A;  1H0H B;  1HR0 J;  2KJV A;  3ZC4 A;  4PG7 A;  1N8R T;  3KK3 B;  4PG4 A;  4YB5 A;  1K1Q A;  2EC2 A;  2KG0 A;  4DQR A;  5H9E K;  3KNA A;  5HMY A;  4O0N A;  3UWT A;  4P52 A;  3CCR S;  1Y5I B;  1G7C B;  1M5H A;  2V34 A;  4M63 A;  5LJ3 Y;  2R9L A;  1NM2 A;  2BJ9 A;  3OFG A;  1WOO A;  1ROF A;  3O6Q A;  3WDO A;  1JJ2 R;  4ECU A;  4M5J A;  1HQ2 A;  3FNN A;  3BN7 A;  2V8P A;  3ENA A;  2AW0 A;  2KO1 A;  5LL6 d;  4C0B A;  1SH3 A;  2QT7 A;  3W7B A;  5KFH A;  4DLE A;  4ELU A;  2EFP A;  2PEH A;  3QFH A;  2GIF A;  2VJU A;  1C0T A;  1T03 B;  5J1P A;  1IJF B;  1GTE A;  2RIL A;  3PW4 A;  3I5C A;  1EZZ B;  3D66 A;  1H2V Z;  3W1Y C;  2YKN B;  4HEA 9;  4AL7 A;  4WFB Q;  3HKW A;  1YJR A;  2LQ8 A;  3X3U A;  1MRO A;  5KFX A;  4OI4 A;  4EGL A;  3F0N A;  3AAW B;  4DF4 A;  4DR6 F;  3R1H A;  1KQG B;  3IM9 A;  1NEE A;  5JVH Q;  1VK3 A;  1YG0 A;  2ROG A;  3MM7 A;  2HHH J;  4B3M J;  2XSJ A;  3LP2 A;  2IFX A;  5J1N A;  4C0O C;  3EGZ A;  2W2P P;  5ETV A;  2Z2M A;  1R6V A;  2A2C A;  2IM3 A;  1FRL A;  3NBP B;  2ZEJ A;  2XBP A;  2E1M C;  1GX5 A;  2OO4 A;  4KO0 A;  4M5G A;  4P7V A;  5LXR A;  1NK6 A;  4F4X A;  4AL5 A;  1K47 A;  2P5V A;  3P6Y C;  3O8W A;  1CJT B;  2HHP A;  2BAC A;  4P2M A;  4L74 A;  4KSE B;  5F3Z A;  1CSJ A;  1FD2 A;  1H72 C;  4U6P A;  5AXK A;  4RNO A;  4DUZ F;  2MQM A;  1KNZ A;  3IA0 A;  5B0A A;  2CPX A;  2YKO A;  2ACM A;  1T9X A;  1OSD A;  1JXV A;  3VCD A;  2FVS A;  5KFD A;  1BQM B;  3DOL B;  1UWB B;  4HAC B;  4P73 A;  1C0T B;  3KXD A;  3M2R A;  4USK A;  3BH6 B;  1SUQ A;  4KGM A;  4ZPC A;  4PRF A;  1SL1 A;  1FEE A;  7AT1 B;  3IXQ A;  4ZOS A;  3J80 U;  3PIP Q;  1X4E A;  4B3S F;  1X5S A;  1TAQ A;  3CW2 C;  4USH A;  4YY3 J;  2ZNY A;  2Y1L B;  3HJV A;  4FYW B;  1HIY A;  1WC5 A;  3EDQ B;  3FJ2 A;  3OR1 A;  4ECQ A;  3V6D B;  3PW7 A;  2F65 A;  3BGR B;  1BY9 A;  1G1X A;  2ASL A;  3NMR A;  2W1B A;  2ZH9 A;  2HHX A;  2VKZ G;  4KHR A;  1EJ7 L;  1FCA A;  2B43 A;  4HHU A;  3T19 A;  4PUO B;  2ZBQ A;  1RYR A;  2W9B B;  1VRT B;  4ZP9 A;  1WDD A;  2LKZ A;  2YWF A;  3UD5 A;  3NNH A;  2WON A;  3QNW B;  2QEX S;  1Z2Z A;  2QYC A;  1S7H A;  3QGP A;  3BDE A;  2OMO A;  2IDL A;  5ADZ A;  3IBC B;  3Q2T C;  3ZXW A;  2HFN A;  1ZA1 B;  3DLK B;  4NZ6 A;  1F5B A;  4ZVE A;  2BE9 B;  2YPZ A;  3I0S B;  3DI6 B;  2VH7 A;  3TJ9 A;  3EVW A;  1HPZ B;  1F9E B;  4JI5 F;  1NK7 A;  2O66 A;  2FVC A;  2RQ4 A;  5KFN A;  2NS1 B;  1UL3 A;  1YTY A;  1BQX A;  4CQ1 A;  3CCQ S;  1IBM J;  1X8D A;  4JI3 J;  3NOG A;  4FS2 A;  2JOQ A;  1Q5V A;  2MSS A;  4HYK A;  1HI8 A;  2OSQ A;  5K9F A;  5JVG Q;  2J9D E;  1C0U B;  4CM2 A;  1E6V A;  1CJU B;  3OXG A;  4JI4 F;  4WKR A;  1VLY A;  3VVU A;  2DNO A;  3G2X A;  1OSC A;  2YNH A;  1MWQ A;  3WC2 A;  3TO8 A;  4URS A;  4DBQ A;  3SQG A;  1NXI A;  2BE7 D;  2DHS A;  1U1N A;  2ZZN A;  2HZC A;  1UVI A;  3GZ7 A;  4PKD B;  4FPR A;  4OI2 A;  2VG6 B;  2C2R A;  3HHL C;  2W9B A;  3KMS A;  1QAX A;  3NS6 A;  4WXW A;  2G2Z A;  2I2Y A;  2N3L A;  3NP5 A;  3MM8 B;  2PSZ A;  1SCJ B;  3LH2 S;  1LWE A;  3N01 A;  5KFU A;  3UQS A;  2BXJ A;  5IV4 A;  2LYV A;  3EJM A;  3QRP A;  4RW9 B;  4CH7 A;  2XS7 A;  2AX0 A;  3A12 A;  2C3U A;  1YX2 A;  2HAF A;  2BKP A;  2DHA A;  4P2X A;  2LVW A;  3M9O B;  1HBM B;  1HMV B;  3L7U A;  4FKX A;  1N34 F;  2VPW B;  3A8K A;  2AD9 A;  1VQ4 S;  3J81 Y;  1VBY A;  3CC4 S;  5B7W A;  1TL3 B;  2HGM A;  3MR3 A;  1VQS A;  2PA3 A;  2H3E B;  3C6T B;  1U49 A;  3S6E A;  4AXJ A;  3HP6 A;  3BQ2 A;  2IJF A;  5KFR A;  1FVQ A;  3MGJ A;  3P5B P;  1NSA A;  2ZC4 A;  4RWX A;  4C2M A;  3G4S S;  4KTQ A;  3MOJ B;  2VB6 A;  2RKI A;  1H7W A;  2B8P A;  1Q82 T;  4IR9 A;  5D78 A;  1FE0 A;  3UN5 A;  3QSI A;  4LJM A;  2AU0 A;  2CQ3 A;  4CIO A;  4RNH A;  1CG2 A;  3CIM A;  4OYI A;  2DXF A;  4TN2 A;  2HBZ B;  1S72 S;  3IO1 A;  4ATN A;  5J1E B;  2FVQ A;  2CYY A;  1W7W A;  1R43 A;  4C8N A;  1MMD A;  3DGP A;  4A8F A;  5D0G A;  4R5P B;  1X4B A;  1HBN B;  4WFZ A;  4QWB A;  2MTL A;  4DV4 J;  4IG0 B;  4HHJ A;  2KVQ E;  1SB6 A;  4OYA A;  3N28 A;  1N36 F;  1RWU A;  1FF2 A;  1VQY A;  4DPU A;  5J2N A;  2RUS A;  5IFM A;  1SC3 B;  2Q6C A;  5RUB A;  3ENV A;  2B4U A;  4BCA A;  2O01 C;  5LMN J;  1NH7 A;  1BGX T;  1RWW B;  2BQ3 A;  1I3O B;  1FRJ A;  2ZNZ A;  3W65 A;  4KV8 A;  1Y5N B;  3V6K A;  2ZZM A;  4KPY A;  1X4H A;  3HHN B;  2KRR A;  4RW8 B;  1H2U X;  4P2F A;  2VD3 A;  2XZD B;  3MMA B;  3NEK A;  3QLH B;  4I0W A;  1YIT S;  3AD9 C;  5HO4 A;  2Y9H A;  1Q8L A;  3KHH A;  2V4Q A;  1TVR B;  1R6Y A;  2RB7 A;  3W9H A;  4K4X A;  5MLC V;  1S9F A;  3CO0 P;  2AJ4 A;  3NGR A;  2WCX A;  2DO4 A;  1O5J A;  4CLL A;  3RR7 A;  1PCA A;  4FXV A;  1T9U A;  2FQQ B;  2M52 A;  1PG5 B;  5ETS A;  5CZX A;  4MKB A;  3S7R A;  2HS3 A;  5EDW A;  3KK3 A;  2CQB A;  5G4D A;  1IKW B;  3HHL B;  3EVM A;  1VRU B;  3HK2 A;  4OV6 A;  4X66 F;  3NNC A;  1PAU B;  1W2I A;  2OAU A;  4P10 A;  2IJR A;  2VG6 A;  3UR3 C;  4Y2K A;  1YJ7 A;  1EB0 A;  3WX8 A;  1MMN A;  2YBV A;  4ANC A;  4EWT A;  2ROP A;  5ITH A;  1YZ7 A;  5KG0 A;  4K50 A;  3GJS B;  3R7B B;  3HJF A;  1RUS A;  4JI0 J;  4LF6 J;  1RB0 A;  2IC3 B;  5IZH A;  1NZA A;  1WKJ A;  4L3N A;  3R97 A;  5E3A A;  3MI7 X;  4ZHR A;  1ZTT A;  2MZR A;  2XMU A;  1WOP A;  5CYQ B;  2IA0 A;  4DX5 A;  2GC8 A;  3MMA A;  3TEG A;  2RU3 A;  4TXS A;  2NUH A;  1WF0 A;  2X1A A;  2MDA A;  2VA3 A;  1SPB P;  4MYT A;  3OUY B;  5M2U A;  4X84 A;  4MKY A;  5A8R B;  3T6J A;  1RWP B;  3NGT A;  4WP9 A;  5DDP C;  3TQ1 A;  2ASJ A;  3ET6 B;  1H7X A;  3IGN A;  1X4F A;  4F36 A;  4JI6 J;  1YSJ A;  3MXH P;  2GV1 A;  1SQF A;  2HWH A;  2JHE A;  4IH6 A;  1WG4 A;  3CMA S;  4Q0B A;  1OY6 A;  3DKD A;  3SI8 A;  1OMS A;  1HBM A;  1JWW A;  1UFK A;  2WZ1 A;  2RDJ A;  1HW9 A;  2IJN A;  3KG0 A;  2DIS A;  3H59 A;  3D3B J;  1C1C A;  1VGY A;  3C14 A;  2QSF A;  3E01 A;  4LSN A;  5B09 A;  4I68 A;  5J1E A;  2C2Z B;  1T95 A;  2V2Z A;  3PG9 A;  5I4M A;  1HNX J;  4P7T A;  2EG1 A;  4ZP7 A;  3M32 B;  1QD1 A;  3N6N A;  4LF8 J;  2LQB A;  1AYE A;  1NND A;  4PAB A;  1HHS A;  2G9O A;  1M1G A;  1A7G E;  2Z57 B;  1S1W B;  4LBH A;  4OHX A;  5LT5 A;  2AGO A;  4TYA A;  3DLG B;  1RT3 B;  1VR6 A; 
#chains in the Genus database with same CATH homology
 4DUZ J;  1XMO J;  3JAM U;  1J5E J;  4DR4 J;  4DR6 J;  1XMQ J;  4B3S J;  4LF9 J;  4LF4 J;  3W1Y C;  4YHH J;  4DR7 J;  3R2D J;  2HHH J;  2ZM6 J;  4B3M J;  2UXC J;  2MEW A;  4JI8 J;  4DV4 J;  2MTL A;  2KVQ E;  3D3C J;  4K0K J;  4RJV A;  4LF7 J;  3R2C J;  1N33 J;  1XNR J;  4X64 J;  5LMN J;  3IMQ J;  2UUC J;  4DV0 J;  4KYZ A;  3T1Y J;  2VQE J;  4DV7 J;  3J7A N;  4LFB J;  1N34 J;  2UUB J;  1I94 J;  4X65 J;  3J81 U;  4DR3 J;  4X62 J;  3J80 U;  1HNZ J;  2E5L J;  4NEY A;  4JI1 J;  4LFA J;  4DV1 J;  4DR2 J;  1N32 J;  5FLX U;  4YY3 J;  2VQF J;  4JI2 J;  1HNW J;  2KL8 A;  4HHU A;  1IBK J;  2MQ8 A;  3OTO J;  3T1H J;  4JI0 J;  4B3T J;  5AJ3 J;  1N36 J;  4JI7 J;  4LF6 J;  4NXN J;  4B3R J;  4GKK J;  4LF5 J;  1XNQ J;  4JI4 J;  1FJG J;  5IWA J;  5IT9 U;  5BR8 J;  4JI3 J;  1IBM J;  1IBL J;  2UXB J;  4DV5 J;  4KHP J;  2UXD J;  4JI6 J;  4DUY J;  4DV6 J;  4LFC J;  4JV5 J;  5LM7 E;  4DV2 J;  4JI5 J;  4DV3 J;  4V1A k;  3D3B J;  2UU9 J;  4KY3 A;  1HNX J;  5LMU J;  4DR1 J;  1HR0 J;  4JYA J;  4X66 J;  4PWW A;  4LF8 J;  4NEZ A;  4NXM J;  4DR5 J;  4GKJ J;  5A2Q U;  2F4V J;  4AQY J;  2UUA J;  4OX9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...