4DR5J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr5J00
4DV4J 4JI6J 4LF5J 4DV5J 1N32J 2MTLA 4DR7J 1HR0J 4LFAJ 5FLXU 2UUAJ 4LFCJ 4PWWA 4DV1J 4LF9J 4DR2J 4K0KJ 4X64J 1XMQJ 4B3TJ 1XNRJ 4GKJJ 4KHPJ 4JI8J 3OTOJ 4DV2J 2UXBJ 4DUYJ 4GKKJ 2HHHJ 1IBLJ 4JI0J 4LF7J 4YHHJ 2UU9J 2UXCJ 4DR5J 4DUZJ 4B3RJ 4RJVA 2KVQE 1HNZJ 4LF8J 2E5LJ 4JYAJ 4X65J 3J7AN 1HNWJ 3R2DJ 2UXDJ 2UUBJ 2MEWA 2KL8A 3JAMU 4AQYJ 4V1Ak 4B3SJ 2UUCJ 5IT9U 2ZM6J 4OX9J 1IBKJ 4JI1J 3D3BJ 4JI7J 3IMQJ 1J5EJ 3J81U 1N34J 1IBMJ 5AJ3J 5BR8J 2VQEJ 4JI2J 1N33J 3T1YJ 5LMNJ 4YY3J 2MQ8A 4DR4J 5LM7E 1XMOJ 4JV5J 4LF6J 2F4VJ 3J80U 4LFBJ 5LMUJ 3W1YC 1HNXJ 3D3CJ 4JI3J 4B3MJ 4DR6J 1N36J 4HHUA 5A2QU 4DR1J 4NEZA 3T1HJ 4JI4J 1FJGJ 4DR3J 4DV7J 4NXNJ 4KYZA 4JI5J 2VQFJ 5IWAJ 1XNQJ 4DV3J 1I94J 4LF4J 4DV0J 4NXMJ 4X66J 4NEYA 4KY3A 3R2CJ 4DV6J 4X62J
chains in the Genus database with same CATH superfamily
2DNHA 4U7CA 4ER8A 5J2MB 2HIQA 2N4DA 1ZM9A 3FGVA 3D6HB 3AT1B 3W64A 3R8YA 3SCIE 1QD1A 3DRSA 1S48A 5GAHU 1N5YA 4ZP8A 1Q5YA 2BE2A 2NLWA 4NE9C 5K20B 3DYAB 3UR3C 2VPXB 1N52B 4UQTA 4OYZA 4PYDA 3E01A 2QRRA 1AT1B 2H48B 4ECYA 5HP1B 5AT1B 2ATCB 1OWXA 3SV4A 2FHKA 1HBUA 4LRAA 2WW4A 3M8PB 3M32A 1FK9A 1LK5A 1UJ6A 4PXDA 4AL6A 1LW2A 3IM8A 3ZO7A 3IR6B 1PC5A 4RPFA 3K5OA 1LQ9A 3MCNA 1S1VA 2UUAF 2MPUA 1X4EA 2YKPA 3AJ1A 1S97A 1R0AB 4A8WA 3FRYA 1NK8A 3OTDA 2Z2LA 2AD9A 2IRUA 4J9VA 2CQIA 3BO2A 2BQRA 2GAHC 4KB7A 2DH7A 4GMKA 3MCOA 4C3KA 4GKJJ 3AXKA 4DR2F 1IKYB 3LF0A 4EO8A 3HVTB 4NX9A 3G8QA 2AJ2A 1HNZJ 2JLEA 2V0NA 4K4YA 5IQ6A 4URQU 3AOBA 1J5OB 3HZEA 4L72B 4WXOA 2CPFA 1S4FA 2GQ2A 4USIA 1ZETA 3WX4A 2H5IB 4JI2J 4PQUB 4FDFA 4OYXA 3CD0A 1VCTA 4OI3A 2DKOB 2HGNA 1JJCB 1DJ0A 1OPZA 5ETTA 3PX4A 1SUQA 4X4SA 1Q16B 2I5JA 1FWPA 4KGXB 1NDLA 2W9CA 3TAMB 4K50A 1FI4A 3OT9A 2B56A 1Z2ZA 1RYRA 1S0OA 2BV3A 3VGVA 2QMXA 4M5LA 4DV6J 3I9ZA 4OI0A 1GNKA 2G2OA 2FJBB 3CCRS 2RJZA 3TQEA 3U1NA 3V4IA 3MR3A 1U0HB 4ZLPA 4RUAA 1CJTA 3I9V9 5GAEI 4KHPJ 4JI8J 2F9JA 4LF7J 4P2XA 2HVIA 4RBVA 2ASDA 1Q7LB 5AJ3F 1UW9A 3JSMA 4ZITA 5J1EA 1T3NA 2CRLA 4Q8EA 2CJAA 4ICLB 2G13A 4OYBA 2ZBPA 2AYGA 3CMQA 3IR7B 2HHSA 2OI2A 2W8LA 2FTRA 4EO6A 2ILYA 3KLHA 1WTBA 3PFOA 2X1FA 4QIFA 1VQ7S 3J7YU 1UA1A 2HLUA 3ZNJ1 4JI4F 3P45B 4ZVTB 3KLEB 3PCOB 1D0EA 3D6MB 1T94A 1W2IA 3UE2A 2I8EA 1RWWB 1AA1B 3BV8A 3GTYX 4F4YA 4DBQA 4DR3J 4J9PA 4GO5X 2GQQA 1RAFB 1SB6A 2P6TA 5J2PA 1FJEB 1HI1A 3I5AA 1CG2A 3PX6A 3NBPB 2ALZA 2WONB 5HLFA 3H4BA 1F6TA 3M8WA 1RBOB 4USKA 1TKXA 2F63A 4DR2J 2DXDA 2ZJRQ 3PJWA 4TXSA 1C0UB 2CWKA 3CJ8A 3ELHA 5EHHA 1UJ5A 3QQCD 2B9XA 1IJEB 3BBBA 1NU4A 2IPOB 3MEEA 4I56A 5KT5A 1S77D 1HNWF 5KFXA 1HWUA 1XMOF 4MFBB 2R7XA 5ETRA 1EETB 4HEA9 1X5PA 4PUOA 3MMJA 1CS4B 2RDDA 2JEGA 1CEZA 3H5YA 6FDRA 1S1XB 4JI3J 1U1NA 1NK9A 2J0XA 2ALYB 1HHQA 1VQMS 1FO1A 4BDPA 1XBWA 3MECB 5M2PA 5CABA 3MCSA 1K0VA 1RADB 4AYBD 3V5RA 4ILLA 4NEYA 4P75A 1PJ6A 1FDDA 1VRUA 2MLYA 4JB8B 4ZJLA 1Z1ZA 1B4SA 3TUZC 3Q8SB 1UFKA 1RWPB 3MEDB 4FF2A 2J6TA 1M0SA 3GIMA 2CADA 2CG8A 1DRZA 2V2VA 3LA0A 1KWMA 3R2DJ 4OX6A 5CYMB 2HZVA 4ES1A 4TYAA 3NKYA 4ZPWR 1UL3A 4P52A 2DNNA 4U8VA 3CDUA 3FCHA 4IUFA 5I4MA 3Q8RB 1RQ0A 1U2FA 3OJSA 2MQ8A 4K4SA 2Q6BA 2ZHAA 2D3O1 1U26A 4J9QA 2C2KB 3LTOA 2VUGA 3JTOA 2CNLB 4C98A 1JB0C 2J6SA 1ZPVA 5F9NA 1TK0A 2BE9B 5C25A 2NUHA 4AE5A 2RQMA 4CT8A 5H1SV 3VAGA 1BD6A 2K7KA 2CQPA 1WOOA 3CD7A 3MF5A 1F2GA 2KTQA 4LIRA 4DV2F 1HR0J 1TUWA 1D8YA 2J8SA 4GKKJ 3J81Y 3CCVS 2ADCA 3TP2A 1ZAXA 2CNKB 5E3AA 3M6WA 5F8MA 1HNWJ 2V4JB 5D6GA 2EG2A 1VI7A 5KFFA 1S6PB 4DG1A 4DR4F 1NZ8A 2UUCF 4WFNQ 5KFIA 1TP7A 5LL6d 1JJHA 2QE5A 5F8LA 1BLUA 3JTPA 3FMBA 4Y2KA 1KFDA 2PA8D 3ONQA 4O4GB 2DIVA 3BKTA 5KG5A 5LMNF 2WHOA 1G2EA 4QWCA 2X3GA 4PAAA 1T9XA 3F73A 2B7CB 1DTTA 1RT5B 1FD2A 1X9WA 2B3TB 1N54B 1REGX 2F8EX 2MGZA 4PG4A 1LWFA 3UN3A 4U67Q 3HPOA 3KJFB 1G6BA 3D5MA 1YWXA 3GU0A 2N7YA 1MROA 1S9EB 1XMQJ 2FJXA 3TUIC 5DETA 3POTA 5BYRA 3GV5B 1RT2B 1OYEA 2CQHA 4Q0BB 4NYZA 2CJ9A 3O3LA 2Z2YB 4LREA 2VBXA 4KKOB 1UEUA 3LP0B 3FDSA 1TV6B 2UUBJ 4DX8H 1K1QA 5A8RB 4QPTA 2IM0A 5A8KA 4ZVHA 2DR5A 1N0UA 3CIZA 3DLJA 1VC0A 2RKIA 4P7VA 2MZTA 3CJSA 3OSNA 1SIWB 5HJYA 1IM4A 4ATNA 4NLUA 1RBLA 4R5PA 3UD4P 3HLUA 4L74A 3V6KA 2G9OA 2HVEA 4LF6F 1YJWS 4RU9A 7AT1B 1HQEB 3BGFA 4BCAA 1KHVA 4V19X 4CDIA 2OSQA 1OPIA 2OMLA 2NS1B 2FJDB 2V2ZA 1T9UA 3THTA 3UQSA 1S5ZA 4GVBA 1Q0NA 2J9DE 2H54B 2VPWB 3SMZA 1C1CB 2AEFA 2WVCA 4OJGA 5KFGA 3H25A 3QFHA 2KM8C 5B0GA 1IM6A 1RT4A 4O3QA 3NY0A 4G1QB 2UUCJ 2W7OA 2IFXA 1M5KC 2LP4A 2ZH8A 1T9YA 2BA9A 3OFHA 4J9NA 3IC1A 3I56S 2DRAA 3AOCA 3CDBA 1YBTA 4ZPTR 4L3NA 3CC4S 5LMNJ 4YY3J 2HG4A 4FZVA 1HNIA 3EDQB 2M52A 2BZ2A 1H2UX 1MWZA 3UCUP 3SDEA 4PXEA 4I68A 5FDLB 4WKYA 3CC7S 2J76E 3W62A 4RUBA 2QTWA 2RRBA 2E66A 1JLAA 4CT9A 2Y8YA 4USVA 5IWAF 1PGZA 3KFWX 3RBZA 2HHHF 5G0RB 3CO0P 3BQ0A 1U6BA 5F0WA 4EI2A 2E5LF 3HHLA 1ZA2B 1G3OA 3LP1B 3SEOA 1N6QA 3OXFA 5AXNA 5DG9A 3RTVA 4YMEA 2BM0A 5MAOA 1S6QA 3DLBA 1NDKA 4KGKA 5J2QA 5A6PA 3L7OA 4Y3CA 2F7VA 5E2QA 3HJFA 1NHVA 2V63A 4LF6J 1XERA 3D3CJ 1TL7B 3KLGB 2RHQB 4CLUA 1RWNB 3HFZB 2VBWA 3CCTA 4KV8A 2HFVA 2P9EA 5K14B 5B0DA 1JLFA 3PIOQ 4X66J 2EG1A 5IS2A 1WI8A 3KK3A 3A4TA 2AP6A 1ZM4A 3MPYA 3QRRA 3GIKA 4B3RF 3JSRA 2MQMA 3W2WA 4ID5A 4DN9A 1WEYA 4Y2AA 3CCJS 1SL2A 1DURA 3ZFVA 3IN5A 3IS9B 4FKXA 2VBZA 4R8UA 3UDCA 4A8XA 1RHUB 2MDAA 3GB0A 4ED8A 4HH0A 2D9PA 3FKBA 3MDFA 4UZBA 2HPUA 4DCOB 1I5OB 2J6UA 4NASA 2ABYA 3QT7A 3DGPB 4IO9Q 3H20A 5KAKA 5JXSA 5KOXA 2ZITA 1UWAA 1RAEB 1TELA 3DI6B 2AU0A 2B0GA 4ELTA 1M5VC 2VFVA 1U2RA 3D9BA 3NNAA 2OPQB 5IWAJ 5L8RC 3OTCA 1QUVA 4O44B 1S79A 3CTRA 4MYTA 2DHAA 4K4ZA 1K47A 1JJ4A 3FJ2A 3KYLA 2JJ4D 4PWUA 3DLLQ 2JFDA 2NUUG 4V19J 2XMVA 1RLCL 3D6TB 5H9EK 1DAXA 1VISA 4WK3A 1GMWD 1OSDA 1X9SA 4YFUA 2AZ3A 2ZZNA 3PM9A 5ETSA 1WF0A 1MWQA 5AXMA 3LP2B 1XR7A 4LQ3A 1VR6A 3QATA 4AL7A 3D1QA 2GHPA 1N36F 2HNZB 4XK8C 3CJKA 4J5OA 2CDRB 2AT1B 2UP1A 2G0JA 3Q83A 1HI8A 1VQYA 3MM7A 2XMJA 3ISNC 4ELVA 2MLXA 4DR7F 2YWWA 3Q86A 5F8GA 3TYTA 3GYGA 1Q5VA 4CLTA 1CULA 4RW6B 3TNVA 4AT1B 4CM0A 3K5PA 1N32F 1PG5B 3SZ2A 4CLLA 4CNZA 1QSLA 3GIIA 1Y5LB 1VK8A 4ZP6A 4CLFA 1SKUB 1HNVB 5J1PA 3DNCA 4ALZA 1UEVA 4MAKA 3MUMP 1UVNA 4OZJA 1H98A 4QWDA 4ZHRA 3A12A 1E6VA 5ADZA 1R6YA 2AJ0A 2KB2A 4H4MA 3KK1B 4EFAC 2FC8A 3I0SA 2BJ3A 5I3QA 1C0TB 2XSFA 5HK4A 2CNOB 5EGYA 3RAXA 1I94F 2B8PA 2VG5A 3HSJA 4H4KA 1MMNA 1RTDB 4FBUA 1RA6A 1PO6A 2RU3A 2RVJA 4MIWA 2XWYA 1C1BB 2HQGA 2BOPA 1WACA 2GVDA 1YVFA 4LBPA 3T6BA 4PXBA 3O5TB 1IKXA 2WRMA 1HBMB 5AE2A 1E6YB 3LO3A 3UFCX 2HW3A 3M2RA 5J1NA 1FRLA 2QFIA 3QWPA 2Z8QA 3ILLA 1FRMA 4M8LA 2GIFA 1S4EA 1ZM2A 4N8NA 2PN6A 2GVZB 5H9EJ 5LXYA 2XLIA 3H4DA 1JLQA 2DHHA 2ACYA 1REVA 1YX2A 5IZHA 2NYHA 5A2QY 1PAEX 2MKCA 4JI1F 1FKOB 1HARA 1PCAA 2M0GB 2WBMA 3J81j 1RT6A 2BKOA 2R7WA 4DFPA 2MQPA 1Q53A 3LUYA 2VDIA 2IY5B 1PC4A 2PMHA 4XPCA 3HSZA 3QIPB 3MM6A 5F3ZA 4X4QA 2IYGA 3MFHA 3GILA 3NNHA 4Q45A 2GJFA 1R89A 3PY8A 1N32J 2MTLA 2HZCA 2F4FA 1B0PA 1IVZA 4LFCJ 5A6WA 3NWGA 5KFBA 1LFPA 4O0IA 2EK6A 1RYSA 3RU0A 3GPAA 4KTQA 4K0KF 1FKPA 2BJ8A 1WHXA 4DMZA 2O1PA 3AFGA 4DSJA 1KHWA 1V9OA 5KT4A 2DK2A 4C8MA 4EEYA 5IQQA 2VKZG 5C24B 5RUBA 4U6PA 2E7VA 5CYQB 4A48A 4HR2A 3HO1A 4CLWA 4MFBA 4DPTA 4ED3A 1S6UA 4K7QA 3BQ1A 3NGDA 3VCDA 5I3UA 4C48A 3BYRA 2BRLA 4R25A 3VALA 3PRBA 5D4OA 2XQCA 2V4QA 4WPAA 4UW2A 3OL8A 3JQJA 3DLGA 4USHA 3DMJA 4DL0C 3DOLB 4YB1P 2VG6B 1ZPWX 5C7PA 2ROEA 3HZGA 3DN9A 4M5DA 1RT7A 1S1TB 1S76D 1SH0A 2ZH3A 2ZVIA 4DOZA 2QLXA 1IKVB 3P6YC 4I2QB 3I32A 2WVFA 3N01A 2MSSA 3MR5A 1EQMA 1OIAA 3DLKB 5KT3A 2KYXA 3QJJA 5GMDA 2DNYA 5LSOA 2KJWA 4ITSA 5IV3A 5KOWA 1HBNB 4ZLNA 3K89A 4NLDA 2M7SA 4Y2CA 1YZ7A 4C97A 2RS8A 3OFGA 5IT4A 2C2NA 3OR2B 2IDEA 4JI1J 4DU8A 4JV5F 2ZD1B 3CT9A 3M6VA 3DM2A 2BMBA 2BM1A 4ED1A 3CWJA 3JSBA 1S7HA 4A46A 3DU5A 2OPRB 5EWFA 2IC3B 4NXMF 1RWXB 4OZNA 4C8NA 3H98A 4RW7B 3OQ2A 5D77A 4CRJA 1XR5A 4KRWA 2G2YA 1HPZA 2CQ2A 1F3VA 1FJGF 1U6ZA 3SQGB 2C3UA 1TFYA 3M05A 3LH2S 2YKNB 5J2NB 1UWBB 4LBHA 5LSRA 1S0MA 1JKHB 2HFOA 4K0KJ 2KFZA 4C11A 3K17A 2XMUA 4WYLA 3AJ2A 3BGUA 4ZCMA 1IBLJ 2OPPA 4PABA 4DR5J 3PXGa 1GQEA 1NSQA 4WWSA 2O01C 4PPDA 2NR0A 3U7JA 1YJ7A 2JFKA 2YPZA 2JDJA 3RUBL 1HMVB 1NDCA 1HFEL 2IM1A 2AMCB 1UVMA 2MJNA 2MMYA 1B70B 2WK4A 2ZJPQ 2LXFA 4UOHA 1YZ6A 4I6WA 1UJ4A 4B3OB 5ETOA 3BH7B 2HMIB 1ZAWA 4TY9A 4Z2XA 1Z2LA 1BGXT 2V34A 2AEMA 1TTHB 2QO3A 2ZC3A 4JI5J 4OZ1A 3VVTA 2DYAA 3SCJE 2AKWB 1U1LA 2B9YA 5SUHA 3ET6A 3V81B 1JNRB 3D0HE 3B4DA 2PI5A 3THVA 3R5AA 2ZDPA 2DGTA 1LW0B 2R7RA 1U1PA 5I42A 3JYTA 3U02A 2NZ4A 2DGWA 4F7VA 3SCKE 2YWGA 1JLGB 2VZ9A 4BLGA 1JLEB 1TL3B 3D1OA 2RRAA 2CJBA 5L1KA 4AQYJ 3S1TA 4NPOA 4WF9Q 4C4WA 3AD8C 3OXLA 4OX9F 3ZZYA 4Q43A 5C42A 2B4VA 3WZ0A 3D1HA 1F60B 1VQOS 4NA1A 5HQMA 5HROB 3FMWA 4DSEA 2VOOA 3WDOA 4MT1A 1F9EB 4NI2B 3MPUB 4KE5A 2ZHOA 1XWLA 1RCOB 1SV5B 3Q2TC 1W25A 4YS2A 1FJGJ 3KJVB 2LEBA 1RGVA 4EK2A 3PIPQ 1RWKB 3EGVA 3DOKB 1PYTA 1A7GE 2DCLA 2V8PA 4IFYB 3PHEA 3FBCA 3QMQA 2QA4S 4NLXA 1B3TA 1R43A 3C6UB 3AJDA 4ZCKA 4PG6A 3DRRB 3C46A 2KHCA 4NLGA 2UV8A 5HVGA 2DBBA 2ZUAA 5HQ8A 2P6SA 3NAIA 4OYWA 4OV6A 5K8MA 2DNQA 4A8OA 3G82B 3Q8QB 5IC6B 2C2RA 3VAHA 3PVXA 4DSIA 1FTCA 1S1WB 2JX2A 3MTKA 2HRTA 3HHLD 3J80Y 4J9KA 3PR5B 4QWAA 4PKDB 2F8MA 2IM3A 5LJ5Y 2B6AA 1HNXF 4OFZA 6AT1B 4IYQA 3K2YA 1TL1B 3C16A 3M8RA 2W01A 5T7LA 4Y00A 4P10A 3IBFB 2GX8A 4C6AA 2L3MA 2K8GA 1VFJA 1LWCB 2AWZA 3KNGA 2J7UA 4OMFG 1RTJA 1EKSA 3VQSA 2J9DA 2K3KA 4FXDA 2FB0A 4DV4F 3QYYA 4MK9A 2H5EA 4ZOSA 3SFUA 4OHVA 1I51B 2C2ZB 4NYPA 1U45A 1ICEB 2YPYA 3HT0A 3PEJA 1HBOB 4N7TA 1LWEA 4G6VB 3RB4A 2C2DA 2DH9A 2CA9A 3VVUA 5E3QA 3IWLA 3DOMB 2BEFA 3EE3A 3OTOJ 1AROP 4JV1A 1YK9A 2VHGA 2JLGA 4X4NA 2QA1A 3NWRA 2IJNA 2PEHA 1N33F 3T19A 4OX9J 5CYJA 4X4VA 1KP6A 3N6NA 1HQUA 5D0GA 2QL9B 2E29A 2ZE2A 1RTHA 4LR7A 1O8BA 2X1BA 2ZBRA 2YKMA 1SH3A 3T5KA 1QTNB 3UDLA 6FD1A 1QE1B 3ZZRA 1Y11A 3D54A 2HNYA 1EIYB 5DZ7A 2YNHA 1KSPA 5DO2A 1X4HA 2CWXA 3PO5A 3FCWA 3KK2B 3AAWB 1KRPA 5HN0A 1KVJA 1X60A 4U9RA 4ZVFA 4NCGB 1Q8IA 3RAMA 3MAAA 4DPXA 4UUWA 3EXYA 2W2NP 2GJ2A 5C5JA 5HVHA 2E5IA 2I38A 5HANA 1QDUB 5GAGI 3MFIA 1IXKA 4OHYA 5CZXA 3BH6B 3PYEA 2FY1A 1WEZA 3FBFA 3N5BA 3CCQS 4Q5VA 4CO5A 5CZVA 3HFKA 2QG9B 4OI4A 4Y65A 4OQJA 3O8WA 3VGUA 1LOUA 1EJ7L 4F50A 2HFNA 3J81U 2MKKA 2ZOMA 3PV8A 1DHMA 3ZTSA 3MD1A 4EWTA 1KBRA 1Y7PA 5E7OB 2B43A 4ZPVR 1RK8A 4I67A 4FS1A 4TY8A 2FJAB 4BWJA 3TO8A 3TANA 3E8OA 1AZSA 4EGLA 4FF4A 4C8LA 4IKAA 2YBVA 3M30B 3ENVA 1JWWA 1AUSL 1UVKA 2VKRA 2IYIA 4X84A 2PEBA 4DF8A 2KXFA 3IBCB 4A8FA 4HI2A 1VBZA 1JMTA 1SH2A 3QRQA 1TZ0A 1KLMB 1UAWA 3MPWA 1Z4UA 1TVRB 4IDKA 1EB0A 2D3UA 2WVBA 4PPZA 4USJC 3EJMA 2DISA 3KHRA 3OHAA 5D78A 3EZUA 3MEGB 4RKUC 2FDNA 4HLBA 4YB5A 4O3PA 3B8HA 2FLLA 3TVZA 1FEHA 1IBMJ 1S9GA 2HBYB 2ASYA 4ECQA 5DGAA 1RKIA 2JVOA 1TMMA 4IO1A 3IBWA 1X8DA 3MMCB 2CG4A 4RW8B 4LR8A 2V50A 1FF2A 2HIYA 4PZVA 4LSNB 5D0EA 3V6DA 2XHWA 3T1HJ 3OW2R 2OGUA 1CQNA 3IR5B 5ETNA 5E3PA 4HT5A 3PW4A 2XS2A 3HVAA 1F3FA 1NBEB 1B7YB 3CJTA 4IOAQ 2AYBA 1X4BA 9RUBA 4DV5F 2OAUA 3QLHA 4URGA 4IG0B 2KDOA 4B3SF 3GJSB 4NOHA 3LWLA 2EEYA 3WBZA 4OZ3A 4RJVA 1GX6A 2KVQE 3DDNA 3A8KA 3OUYA 4BC9A 2RDJA 3IGNA 2UVUA 1J5EJ 1HI0P 1J27A 2XWXA 1TAQA 3W9HA 3OL7A 1MN9A 1R8AA 1IQZA 1UTAA 2D41A 3BPDA 4KBIA 4IH5A 3RRHA 2W9AA 3SYZA 4J9RA 4DR6F 4M5KA 4J37A 2Z2MA 3BGOP 2YX1A 4A47A 4ED4A 5GMKa 1QAJA 4PG5A 3RAQA 1ZH5A 4DS5A 1VRTB 4KY3A 1G1XA 1DTQA 1YJTA 2M5YA 1CLFA 4WU2A 3OR1B 3BKUA 4FYYB 3W2VB 5KFHA 3QIDA 3GFHA 4Q2MA 3LAMA 4MKVA 2EFQA 3MURP 4CLZA 3CB4A 4DQIA 3TR5A 3QNWB 3M2VA 3EWGA 4OYAA 3MAHA 1RDRA 3E51A 4OJHA 3CULA 3ZTPA 1PILA 3V6JA 1URRA 1WTFA 3P5BP 1KKHA 1FFSB 2AF6A 1PYSB 4V1Ak 1H38A 1VJWA 4IH6A 1LEOA 2HQIA 3QGIA 4IRCA 1CBKA 2FGCA 3CO9A 3K8WA 3ITHA 4ZLJA 4IG3A 1UA0A 3HHKA 4ECWA 3C6TB 3ILJA 4CO0A 3MZIA 3UI3A 5K8PA 3OHBA 2F4VJ 1SXLA 4F0KA 3M6UA 1TL5A 3UNYA 4W90B 3TJ8A 3VTIA 4LT6A 2HWIA 3BS9A 2ZZTA 3QIPA 2LQBA 4ID8A 5DM7Q 4OJ1A 1FA0A 2IVMA 3TZZA 4DV5J 2C2OB 1UKUA 1WC0A 3IG1A 5GADI 1LXNA 2WTFA 3VGTA 2LLZA 2FZKB 2KXHA 3TEGA 4RR5A 5ETLA 3RW7A 3KJQB 4J7CA 4K5SA 3JQKA 2R42A 1WEXA 1N34F 1K8AT 1P1LA 4C8KA 1X7VA 3QT6A 1IBKJ 2OSRA 4DLEA 4YOEA 1HHTP 4LRBA 4KO0B 4HI1A 2VOPA 2YX4A 3CMES 2XO6A 1H2TZ 4Y6IA 3TWZA 2W1BA 4LRCA 1NH8A 1FT8A 2GGPB 4DR6J 4TKTA 2AGOA 5A8WB 5EWGA 4PWDA 1RLDA 4MIAA 3G6XA 4Q2LA 2V9WA 3BSCA 1JLCA 5KFPA 4QU7A 3NS7B 4WFZA 1EQ0A 1RABB 4HACA 4D3GA 2MZRA 5D4LA 5L46A 4G3IA 3VV2B 4C7QA 5HBMA 2QLBB 4DL4A 4ZVOB 2CIMA 2B51A 2A2CA 3DDKA 3PTWA 1RBAA 3MI7X 1MWYA 1IWGA 1ZS6A 3N5FA 1SJFA 4PYAA 3NGSA 1UZDA 3GCXP 4USUA 5B0BA 4X4UA 4FVCA 2EFVA 2QC3A 3CCUS 3W3SA 4MKBA 4DL5A 3H7HB 3PRDA 4NRTA 1CJUA 5KFJA 1AXQA 2J8AA 3CXCR 2XZDB 4NCBA 2XNQA 2BABA 3L7UA 3MM9B 4EYIB 3OR2A 5HAOA 3QO9B 2P2CB 1SQEA 1F2HA 3C15A 3GQCA 2ZBIA 4YR2A 2IAJB 3W8PA 2W9BB 1NK5A 4I0WA 4ILMA 3DCAA 2O3DA 3M8QA 2DPIA 1L3UA 3CCWA 2GA7A 4WFAQ 3RR8A 4KFBA 3LWMA 1ZBTA 2DHXA 1VQ6S 1RCXB 3UDEA 2D3ZA 4P9SA 1QJHA 1FRXA 4JV2A 4MYUA 4WFBQ 4J91A 1V6HA 2IA0A 5AE1A 1YITS 1L3SA 5DQIA 2BRKA 1U8SA 2GQCA 3H5SA 1Q8BA 4LF2A 3M2UB 2XMAA 1K44A 4Y2IA 3MUVP 1HYSB 1NJZA 2LQ5A 2G1DA 1RB0A 2K1RB 4LSLA 3TVKA 2DH8A 5KFUA 2CNNB 1BXNA 4NZ6A 3AOAA 3UVJA 4B9UA 1DQ8A 1SC6A 1TFWA 3K59A 1FD8A 2XMTA 2BJ9A 1KS2A 1NJWA 1EP4A 3H8YA 3WX8A 1A6LA 1S6OA 2X1GA 3I5CA 4I7FA 1U47A 1NRKA 4DQPA 4P6QA 2BJ7A 2W2OP 1P9YA 4NLSA 3B54A 4B9TA 2JLFA 1SL0A 4UF4A 2AQ4A 2CPYA 4B9VA 1KR4A 2YWEA 1Y5NB 4RX6A 3K7RA 5A0YA 1Q8LA 3RZAA 1K0TA 1PAUB 1RTIB 1CJKB 9ATCB 4YR3A 3MPDA 3BGRB 3KLFB 4LVOP 1VC5A 1NK4A 4WCEQ 4GKJF 3J7ZT 3T3FA 2VDHA 1LWXA 1U7LA 3DRYA 1SIZA 4LSZB 3A3PB 2KZZA 2MB0B 2UVVA 3HI9A 4U7UK 1IKWA 3RYLA 3HULA 3SXLA 4YEAA 5FD1A 4G65A 2LDYA 4ZIWA 3TA1A 3HVRA 4JI2F 5CD4A 3D3BJ 1NB7A 1F9FA 1KOOA 4HKQA 2W2QP 5AE3A 3DDIA 1Y5IB 2JVRA 2BANB 2KVIA 2CQBA 2CVIA 2ROPA 2FHOB 3GONA 4ZP9A 3L3CA 1AYEA 2G0IA 2YNIA 3PDNA 2FQQB 5A2QU 4DV6F 3IRXB 1HW8A 2DHGA 4LF4J 2ZJQQ 3GSDA 3EGWB 2QMUB 3L95X 2DY9A 4KHPF 4JI8F 2CDQA 1HA1A 1O0PA 2Y1IA 1HD0A 1MU2B 3BPSP 1H74A 4DU7A 4LF7F 4N47A 4YB7A 2EC2A 1LV5A 3C6UA 1S57A 3TEHB 3HHLC 1CJVA 3CNQP 2KG1A 3TI0A 1PBUA 5KFWA 3HSDA 2YNGA 3DRSB 2YH0A 2BW2A 1T11A 1ACMB 1N5YB 1UVLA 3IAM9 2NQPA 4F36A 2B4OA 3EUNA 5B0EA 2FGOA 1XEZA 1KOHA 4ECTA 2J5AA 4ZCIA 2V67A 2BE2B 1DLOA 4DS4A 4OZLA 2N7CA 1FXDA 2WOMB 1WSRA 4DR3F 5HMZA 4GO7X 2OEJA 3E01B 2VFUA 5ETQA 1GMWA 3A8IA 3F56A 4DZ6A 4I1TA 5FLXY 4RLEA 1HBUB 1R8BA 3HKWA 1UFLA 2XY5A 3A8EA 3M32B 1FK9B 2R7SA 1LW2B 4WJBA 4B9SA 4NLTA 1NKBA 3QJLA 4DV0F 4MMOA 3QAUA 3EGNA 2GAGC 4ZVQB 1UW4A 2W4CA 1S1VB 1X5SA 1NUEA 4NWBA 1RT1A 3MM5A 3NCQA 4TU9A 3W8GA 3I82A 1F5AA 1KQFB 2HHWA 2L08A 5CXTA 1FESA 2BW7A 4DLGA 3N28A 4QYZJ 1SBRA 4OI6A 4QJVA 4FXWA 3NGUA 3UDVA 2B9WA 3T5HA 5CA5A 1FHTA 3FQLA 4JI3F 4BBYA 5DLGA 3NAHA 4LRFA 2V4RA 4WP8A 3HCXA 2Z0GA 4OYPA 2J0QD 3JTNA 1VQKS 3W1YC 2NPFA 4DR1J 4UY8T 2N82B 2B5JA 2ZNYA 2WSEC 2QJ3A 4P2FA 2BOAA 2VC1A 5BYSA 1SUQB 4AUKA 2NXJA 2AYMA 5KFOA 2I5JB 3QRPA 1T9WA 2W9CB 1YJUA 3J7YI 1T7PA 3NS5A 4KQZA 2VH7A 3PHTA 3Q0AA 2LA4A 1VC6A 3V6HA 1NZAA 2OLWA 3NRBA 1GH8A 3CCSS 1OO0B 1NJXA 1RTZA 1FWKA 3C14A 3ICLA 4F02A 3P8BB 3PX0A 4DWIA 1L3VA 2V68A 1BQNB 3V4IB 4JI0J 2PO4A 1TKTA 1P27B 4RW4A 4FVMA 1CJTB 4NLQA 1TAUA 3R6LB 1DZ5A 1CQMA 2RNEA 3V4MA 2XBPA 3ZZPA 2ZC4A 3A1YG 1NSPA 3PYFA 2A2DA 3X1LB 1GK8A 1BQMA 5J1EB 3JSMB 3BSNA 3NP5A 1YG0A 1IWAA 4OZ0A 2AEJA 3NNCA 1WUUA 2DXFA 2ZHBA 4E0DA 2NXNA 3KLHB 4QWEA 2JRSA 3VR1A 5ETVA 1N5TA 1PYOB 2ACMA 4ZKAA 4DN0A 1X5TA 4ZJQA 1HR0F 3R7NB 4CO3A 2FVQA 2VBYA 2W2MP 4DV0J 1VYAA 2R8GA 3KUEA 2M88A 4GKKF 2YQ1A 1RAIB 5F9LA 1S10A 5F8IA 1VQ9S 5J2PB 5K9FA 3T9NA 1FRJA 3HX9A 2PIIA 5HLFB 4NLYA 1VDHA 3BDPA 2RE1A 1TKXB 4USMA 3CJRA 2OIHA 1S9FA 4XTTA 1T03A 4JBCA 3GIJA 1M1HA 3MD3A 1JX4A 2NXEA 3IGVA 4ENOA 2DO0A 4HDGA 5CCMA 1RT3A 2DTJA 4CH1A 3MEEB 1KQSR 3M1VA 1U1MA 2XYPB 1YSJA 3ENWA 5LM7E 3D7SB 2GC8A 1JXVA 2I2YA 4FNIA 4PUOB 3EPGA 2OPSA 1WHVA 3KLIA 4LSNA 2A3JA 2VG7A 5KFZA 1VQLS 4URSA 4EZ9A 3B4MA 3TAQA 3KLVA 2DR8A 4JOUA 2HNDA 3GYNA 1XMQF 3TQ1A 4ZPBA 3T5JA 4FYWB 3ETOA 5A76A 1FJ7A 4NZ0A 4PEOA 3H90A 2B8QA 2UUBF 1VRUB 2UVRA 3I0RA 1TK8A 2YH1A 4IG0A 2Z56B 3OFEA 1D9DA 1BC6A 2Z58B 2AGQA 1MMDA 1Q78A 1RAGB 1T05A 5EUHA 5KFKA 2BACA 4E2FB 2HVHA 1TR0A 2RUGA 3JB9k 2IIHA 2UXDF 4F4WA 2XNRA 4DX5A 8RUCA 5HMXA 3THPA 3S7RA 3DLEA 1YBAA 2F3JA 2M70A 3J80U 2PFFB 1RAOA 5KFYA 1FNXH 4ANEA 3FNNA 3Q8UA 2F9DA 2CYYA 1W26A 3NCPA 3AY0A 2H4WB 3CC2S 2SXLA 4N5SA 3CE8A 4TQRA 2V8HA 4C8ZA 3IRWP 3BN4A 3EPIA 1DFDA 4L3KA 2VFRA 5C25B 1VRTA 4OZ5A 3QPIA 1V3RA 1VRQC 2G2ZA 2DGSA 3ZZTA 4N41A 4RWXA 4RO0A 2ZKUA 2CZVC 3W7BA 1PSDA 2OJ3A 4ZA1A 2DO4A 3NCRA 4Q7AA 4LF8J 3L9ZA 4WP3A 1NM2A 5IM0A 3MM8A 1RI7A 3FRZA 4YY3F 4U96A 3CSKA 1X4CA 5KG6A 1WF1A 4XPEA 5IFMA 2JHEA 4PG7A 4WFXA 2OP5A 1KEKA 2FD2A 2M2BA 3QSYB 3QGGA 5EX0A 4OZ2A 4DG1B 1OYDA 2E44A 2DT9A 2ZOFA 2N3OA 5GVQA 3PJXA 3E2EA 3TOQA 4Z7YA 4B02A 1ZM3A 4J90A 4P72A 4NXNJ 2RQCA 1FKAF 4OI1A 1F5BA 4UQGA 3US5A 2Q79A 1WOPA 1VQ5S 1IUJA 3C8YA 5E3RA 1DTTB 3EX7B 1YJRA 4Z7CA 2Z4PA 4K8RA 1U09A 2E1PA 1SJ1A 2MGZB 2HS3A 3GFYA 3D28A 1QY7A 3G8TA 1LWFB 1DARA 3CDAA 1F9HA 1HLWA 5F3TA 2XTJP 3EGZA 1VLOA 1AUDA 1OQ6A 2D1CA 2MSTA 3MMAA 1ZZFA 1MROB 4JYAJ 2HS0A 1CC8A 2GHVC 3FK4A 3POTB 3UWTA 2UXDJ 3D67A 2PT0A 2CZ4A 4G1IA 4FF3A 1WDDA 3L09A 5SZTA 4YP3A 2HFZA 4H4OA 5F0UA 2C22A 2W4PA 4KO0A 1H2VZ 2FHMA 3J7Z5 2EVZA 4O3OA 4DQQA 2VQEF 3F44A 2VICA 3FFIA 2GIRA 5A8KB 5JVHQ 3KDNA 4X66F 3S6EA 4NEZA 4Y0FA 2RKIB 4TLRA 2EFNA 1YRTA 2LQ9A 4KGVB 8AT1B 2NSCA 3GWCA 4R5PB 2CKWA 5IC4B 1X9MA 4A8SA 1V5VA 3W5ZA 2XS5A 2C42A 2QA2A 2COLA 2C3YA 3M6XA 4XDCA 4ETZA 2NXCA 5IT9Y 3OL6A 1XR6A 4DPOA 1WKKA 2HZAA 3OVSA 2XGQA 3QGPA 2HYIB 1RUSA 4GVBB 4DUTA 5L1JA 2GFFA 2XHCA 4I2PB 1UMJA 1H7WA 3H40A 1S99A 2E5GA 3MUTP 1S1UA 4NA2A 3QGHA 3AD7C 4IFVA 2KFNA 4OYMA 2P9CA 1RT4B 2OUGA 1IR2A 2RH3A 2F1FA 4DX7A 1L5UA 2JZ5A 1NSAA 3OTEA 4LFBJ 1X0FA 1KLNA 2JL9A 1BHNA 4CLKA 1Y4ZB 4RBUA 1WHWA 3LW5C 1GX5A 5T14A 2CXEA 1HNIB 5KG3A 1TU0B 1YLXA 4DPWA 4I64A 2CUYA 3VF0B 4WKRA 3DRPA 2RF2A 5D3GA 2YY3A 3SDEB 2BKNA 3O44A 4TLQA 2ASJA 2Y1RI 3PW2A 1OJ4A 1ZAVA 3IFEA 1JLAB 2DJWA 4DX6A 2P5VA 1T02A 1KONA 1NCLA 5DQGA 1YI2S 4XIUA 1WSVA 3BREA 4WP9A 4AL5A 2EWHA 3HHLB 1RSCA 1KFSA 2VL1A 1KTVA 3RBEA 4U7UD 1GTHA 2IMOA 1N6QB 1WELA 4IRDA 2VQEJ 3I4HX 2EC0A 1S6QB 4EMDA 3BO4A 2LMIA 1GXTA 1TKZA 3BEGB 3NOCA 3R7BB 4WE1A 2R8JA 5U47A 3SQOP 2JEJA 1YQHA 3MTJA 5KG2A 3NMRA 1S49A 4CTAA 1NHUA 3DRXA 2AGPA 2MY7A 2ZFHA 4EYHB 1CJKA 1SI9A 3I6PA 2MKIA 1N48A 4KV8B 4TU7A 5F8JA 2MKHA 3ZZZA 2XC9A 4LF5F 1JLFB 2RD5C 4NYOA 2BR0A 3KK3B 2E7XA 1IR1A 2KO1A 3WQPA 3W2WB 4ID5B 1H73A 2CAJA 5KT7A 4Z37A 4R8UB 4CZCA 2X3DA 4FF1A 1M1KT 3CDEA 1HIYA 4CYUA 3FSIA 1R0CB 4DL2A 5THWA 3PO4A 2YTCA 2VU5A 3KWMA 4ED6A 3CJ0A 1JLBA 3HKZD 2HFSA 3GJQB 3NOGA 1IN0A 4ECVA 2RHSB 1Q79A 1OY6A 5J2MA 2KJVA 2APOA 3DHXA 3N79A 5MLCV 2M3DA 1SKRA 4ZN3A 5CD4H 4EUVA 2AYEA 3TUJC 1U2CA 2R4FA 2CJYB 3R5BA 4ZVPB 1HWIA 4K4TA 2E9RX 3HFVA 3FC9A 4OLOA 3FBBA 1Y9OA 3MR7A 4W92B 3T41A 3G6ES 2XCAA 4F0MA 3DYAA 2LXUA 4L73A 2F40A 1VMBA 3W66A 4UOFA 4RUHA 2R2SA 4UTGA 3R5GA 5HP1A 3FQKA 2J7WA 2M9KA 2CJXB 1WC1A 4F4AA 2C2EA 4ZK7M 2HHXA 3M8PA 5DGBA 4HTIA 3HJVA 4N8OA 4DXLA 5K5MA 4BWMA 2R8HA 3TW0A 3AD9C 2VONA 3KG4A 4QU6A 2K06A 3EVMA 2WOMA 2BE7D 2HEKA 1APSA 1R0AA 3CJKB 2LQJA 4B9NA 2BDPA 5KFRA 3AQPA 2OTLS 3LANA 3OV7A 4LFCF 2Y1JA 1VK3A 4CCHA 3R2CJ 4QPXA 4D3HA 1TMJA 3MM7B 4LF5J 2LVWA 2V8GA 3NS6A 2CQCA 3G6VA 1FERA 2HQCA 3FSXA 1IKYA 4P71A 2FVSA 3HVTA 3BQ2A 4DFJA 2BXJA 4WIQA 4CO2A 1SJQA 4RUCA 1CULB 5ITHA 4B3TJ 2IVYA 3H5XA 2CQ3A 1X0PA 3ULHA 2FC9A 2AJ1A 4KJIA 1BY9A 1R31A 1U25A 1J5OA 3ISND 4M5MA 3ZXWA 2UZAA 3K58A 3F41A 2XYGB 2V9KA 2G1HA 3DKDA 4C9DA 2K3IA 4LVNP 5KFTA 4PQUA 1U1OA 2BYCA 1Q7YT 1AB8A 4MKYA 4ES2A 2AW0A 3PACA 4ZHRB 2R2UA 4ANCA 1I1GA 2ZH6A 1E6VB 1A0OB 3ZNUA 4ECSA 3CJQA 2C1EB 3TAMA 3W9JA 1BUXA 4QR1A 3T1YF 4H4MB 2EKYA 4X2BA 5HQLA 3I0SB 2LQ8A 5KFAA 1FE0A 1LK7A 4B3MF 2GMLA 4XAKA 3GCWP 2DGQA 2C3MA 4HYKA 1R8PA 3GE9A 2WW8A 5AXLA 3TJ9A 1D9AA 1U0HA 2VG5B 4F04B 2OMOA 3EDRB 1NMEB 3HM9A 4IR9A 4JI6J 2HSEB 2V2QA 3TZXA 1NKEA 2JWNA 4AXJA 1M5OC 3JAMY 2GVDB 2E5HA 1IKXB 1VLYA 4ICLA 1GTEA 2RDIA 2H4YB 4DSFA 1VBXA 2IRXA 1BQNA 3M2RB 1N56A 2FHJA 4J9UE 2MQLA 1D3WA 4CQ1A 3KLEA 1C4CA 1BWVA 4QIEA 3HHNB 2Y3YA 1JLQB 3KHGA 1WOSA 4HL9A 3WHIA 1FXRA 1REVB 2OD6A 2F8HA 2DGVA 2GJIA 1FRKA 1QAIA 5GAEU 1TKDA 5GMEA 4YUDA 4BC7A 2DPJA 1RT6B 3NBPA 2FVPA 5T41A 2WONA 2IMWP 4EBCA 3RB6A 4I6YA 3KHHA 1C0UA 3N0VA 3GR1A 4A8QA 2XM3A 3N6LA 1IBLF 3NL0A 3MM6B 2UUAJ 1S0NA 4DR5F 2OHDA 2ZBQA 3HVWA 4RBTA 1HW9A 2NREA 4P74A 1TUGB 3OFFA 1L3KA 1WJ9A 1AFJA 1NH7A 2VASA 1EETA 1I6JA 4ZVUB 2DITA 4QBUA 2GW8A 4AD6A 4M5GA 1CS4A 3J7A1 3C19A 1FXLA 4XDDA 1FKPB 4Q44A 2MKYA 3OLAA 3A13A 3KTQA 1S1XA 3NGTA 3T1YJ 3MECA 4PQAA 2JC1A 1WKLA 2NZCA 1SJ4P 3EVWA 4JI5F 4B3MJ 3QZ7A 2EKNA 5C2CA 3LPYA 3JXOA 1N5VA 5CH7B 4EBEA 5I3UB 4F4XA 4CLSA 3CD5A 2DNKA 3D0GE 3I87A 5LXRA 3MEDA 1EHWA 2H1YA 4AFFA 1NEEA 4S0MA 4FS2A 4DF4A 3DLGB 3DMJB 2OFGX 4C0HA 3BB5A 3P4UB 5B7WA 5DDOC 1NNDA 5L38A 4M5DB 2DGUA 4KH1B 3W63A 1RT7B 2HLTA 1TUVA 5CYMA 4AQYF 1WORA 3CCZA 2PC6A 2HQDA 3RBXA 1JXLA 2JH3A 2DGXA 4R0JA 3M9NB 5KFEA 4FN5A 3VHQA 2GO8A 3OTBA 2XLKA 4IH7A 3UNGC 1U0SA 2E5JA 5AJ3J 1N8RT 1FDAA 2ZH1A 4CLPA 4GC7A 4M5JA 2V8VA 5HJXA 1NPKA 1NXIA 3KUGA 2WB4A 3DM2B 5HVFA 3H5UA 2FJVA 2VJUA 1F5CA 3HK2A 4C0OC 2XG8A 2ASLA 2Z30B 3QZ8A 2PGCA 2HAFA 4JI4J 3R7SB 2LFVA 4QOTA 3W65A 1BMQB 1K73T 2CVEA 2FLNA 1XK8A 4RNOA 1BQXA 4LUBA 4ES3A 4P73A 2CZ9A 5FLXU 1HPZB 4WBFA 3GG1A 3HXMA 3BKFA 1QAXA 2V4JA 3ZTQA 1VIXA 3MOJB 1JNZB 4FPRA 1S6PA 1N4LA 3BM7A 3CW2C 5H9FK 4C11B 4CP5A 4F26A 2Q1LA 3I5BA 4QW8A 5KFCA 1WKJA 1F0XA 2OPPB 4ZS6A 4O4GA 4OX7A 2K2PA 2VODA 1FDBA 1ELOA 2HS4A 1JJ2R 1K1SA 3G4SS 1RT5A 1XMOJ 4C0BA 3TA2A 2XEXA 1DQAA 1QSSA 3T9ZA 4OYIA 1T3OA 2MLZA 4DPYA 1O6XA 3UO0A 1UEKA 2IJRA 4F2SA 3IXQA 4LQ9A 4LMZA 3R5JB 4LIWA 2L41A 1S9EA 1RHMB 2MYFA 1YIJS 2M8HA 1RT2A 4KAIA 4Q0BA 3OTOF 2XMWA 1KD1T 1RHQB 2V94A 5HMYA 3CJ5A 4NRUA 2FJEB 4IQMA 1U8WA 3KUHA 4KKOA 3LP0A 3MXHP 1NK7A 1TV6A 3ET6B 3C2PA 5A8RA 1NPRA 2FZCB 1FRIA 2UUTA 2EBEA 3W5YA 3Q24A 5I42B 3JYTB 2QN6B 1FDNA 5EN1A 2Q6CA 2R7UA 2VIHA 2R7QA 4DQSA 2DNMA 3IWNC 4NCAA 1UZHA 3OVAA 1HQEA 2XZWA 5JUMA 1ZA1B 1MN7A 5C42B 4KPYA 2EBGA 4MK8A 3HP6A 4OL8A 4X4PA 5DM6Q 3H42A 2MHNA 1O51A 4DL7A 2KH9A 1R6VA 3IP0A 1RHKB 2XB2D 1WD6A 2QX0A 1C1CA 3NGRA 3R3TA 2E9TA 3D66A 4RZRA 2HAIA 2XCPA 3R5CA 3RW6A 4CH0S 4G1QA 2Z57B 4DV2J 3N4WA 2Y0SD 2RSQA 1FNOA 2AV5A 3CIMA 2QV6A 2L9NA 3D4JA 4O23A 3R9LA 2H9ZA 4CWBA 1C2PA 3G86A 1SC1B 4MTPA 4KHRA 4ILRA 3SIPB 5KFDA 2XULA 4JUZA 2VB6A 1CC7A 2G4BA 2JEIA 3D68A 5H9FJ 4I2PA 2DNPA 2H65B 1VQPS 1IBCB 2KRRA 3H2UB 2AX0A 5E33A 1WC3A 1OS5A 3AA8A 5B0AA 4NL5A 1ZTTA 1YKWA 4DR4J 3N9UC 4MJKA 5FDLA 1ZTWA 4WIIA 2B6AB 3UPFA 1L3TA 2B4PA 3C16B 4F3MA 4RNMA 4FYDA 5T7LB 4B9MA 5KFVA 2QA4G 5G0RA 5LJ3Y 1RTJB 2XO7A 4QIVA 2X7IA 5EDWA 3MHYA 3AB4B 3LP1A 4PWWA 4FKYA 3P49B 4EU0A 2RIJA 4CIOA 3CDWA 2DEJA 2RILA 2ROGA 4F3OA 2XZTB 4FPIA 1X4GA 1X5OA 3T1AA 1XNRF 1KNZA 3SSRA 1LWEB 1T95A 1IBMF 4P2SA 2UXCF 2V69A 2AJFE 4J9LA 4M5NA 3FEYB 3BBFA 3W9IA 1KVIA 3OXGA 3B6BA 1V3ZA 2HBZB 3PEHA 3BO3A 1SKSA 4HDHA 2CPZA 2X1AA 1TL7A 1WNEA 3KLGA 3VAJA 4QCLA 4DSKA 2B4UA 4MIBA 3T1HF 2XMMA 3FEXB 2ZOGA 5K14A 4F4ZA 1S7IA 2YWKA 1HQUB 3LQVA 4NLPA 3GR0A 5L1IA 1Q4RA 2ZE2B 1FEEA 1RTHB 2KT3A 2YKMB 3NG8A 3FVYA 2VA2A 2WSFC 2XI2A 2QYCA 2XY7A 4CH7A 3HHEA 4DV3F 2HNYB 1N88A 5EWEA 2YNHB 2DGOA 4NMLA 2CPHA 3IS9A 2QYGA 4KIAA 4WU3A 1VQNS 2ZVSA 2HHUA 5KT2A 2ZH5A 2MXYA 3EYZA 5DS7A 3SCLE 1VQSA 1RWVB 1M1GA 3A3NB 1VIOA 2VFSA 3MAAB 4U95A 3OJUA 4ED0A 1J5EF 4OYOA 4Y2MA 2Y0BB 3RRKA 4UZCA 2AIRB 3FZBA 1NKCA 4W98A 3M8SA 1FE4A 3DGPA 2EFOA 3MGJA 3VQTA 2U2FA 2E7WA 4MKAA 3DI6A 5HO4A 1C4AA 1Y00A 3G87A 2CPJA 3AQOA 2B7BB 3ZTOA 3PRVA 5KG1A 1VHFA 4NZ7A 1HKAA 2DY1A 2CPIA 2DD8S 3GV8B 1FRHA 4O0NA 1B0VA 1SQGA 1FCAA 2OPQA 1WC6A 1UP1A 4O44A 3WIUA 3M8YA 2GZOA 3O2IA 1WDTA 5JJBA 4DEZA 3W5XA 3IWXA 4JV0A 5IT0A 3IAS9 2AX1A 4C3MA 4ED2A 1FX2A 2HVDA 2QLWA 2IBOA 5DDPC 1X4DA 2EFGA 4J9SA 3VAMA 2BX6A 5B08A 2DHSA 2CPXA 4TY8B 5K8NA 2C28A 1SQFA 1AZSB 3FEZA 3LGMA 2VPZB 4DV1F 1XNRJ 3PFEA 2V8DA 2HHHJ 5F8NA 3LP2A 4IQXA 2PD1A 3SV3A 2UXCJ 2IVFB 2Y9HA 1H7XA 2E5LJ 3K5MA 2HNZA 1RJJA 2W8KA 2YQ3A 4PG8A 2FZGB 3GZ7A 2IBKA 4ZN1A 5LOQA 2F4VF 3LGHA 1UFWA 4IDKB 4CM2A 4JI7F 3BSAA 2OEMA 1FFWB 2KU7A 2XS7A 1N5SA 1QTMA 1FTRA 1T9TA 1SVDA 3PJ9A 3D0IE 1IJFB 4P2MA 1S9GB 3BF4A 4RW6A 4AXIA 2DNLA 2ATLA 4QR0A 5BXIA 2R3VA 5HL7Q 1FJCA 4DV3J 3CD6S 2KT2A 3M7VA 1XC9A 3V6DB 2XI3A 3KDOA 2WVEA 2HBQB 2LECA 1URNA 1U48A 3B82A 1HNVA 2BQ3A 2LU1A 3FSYA 4KT0C 2FUG9 1IBKF 3K8VA 1VQ4S 4B3RJ 3GV7B 3QLHB 3H2LA 3KK1A 3UCZP 4DUZF 1NSKL 3HMJG 5IT9U 3MMBB 2PI4A 1D8ZA 4B9LA 4FXVA 1C0TA 3BBCA 3Q23A 1YTYA 3CGIA 2D3OR 2I0XA 3OUYB 3WC2A 3NGKA 3LALA 2DB1A 1RTDA 4OHXA 4FBTA 1MG7A 1S0VA 1BE4A 2FHJD 3M4XA 5ETKA 1C1BA 1YGYA 4K4WA 2JOQA 1U49A 5LMUF 3OPKA 1NJYA 4P7TA 1U1QA 1R8CA 1HBMA 3BZQA 2DR9A 1E6YA 2WCXA 1R7IA 5JVGQ 5IV4A 2KFYA 2Q66A 4M5HA 1W7WA 4GC6A 2WAQD 1MSWD 2RQKA 1U1RA 3KNAA 4DV1J 1DTQB 2ZUGA 4F2RA 4LFAF 1YJ9S 2GVZA 5DJBA 2HWTA 1WC4A 3TVYA 4A8MP 3W61A 3KXDA 3K5LA 2LEAA 4F8RA 1FKOA 3M2VB 2OH2A 4YDXA 3ILOA 4X65F 3QAEA 4JI7J 2VV5A 5KG7A 2OD4A 3Q89A 1UVIA 2RT3A 2P9GA 3TARA 2C3OA 3GP9A 4Y34A 2W24A 1Q86T 1GXLA 1RA7A 3UN2A 1V5IB 3U27A 1N36J 3HDSA 1UPPA 3ITHB 4IG3B 3Q22A 2W7AA 3MEKA 4DZDA 2YNFB 5DDRC 3GFXA 3EMTA 2POKA 4FNHA 4DCJB 1GFWB 1VHIA 1H6KX 1JK9B 2KRBA 1G7CB 5DDQC 3M9OB 1PBAA 3TX0A 4HTJA 2IJFA 2HRUA 1XN9A 1PJ5A 4EBDA 4DR7J 4OHZA 4BS2A 4M94A 5G4DA 2R2TA 4K5RA 1JQGA 5ETPA 2QSWA 5CAAA 3PW5A 1WC5A 3IG1B 3KG1A 2PA3A 4DDFA 5C24A 1VQ8S 2LYVA 4E8UA 1XJWB 4DUZJ 1HWKA 2BJEA 5CYQA 3R1HA 1M90T 1OSCA 2HQ3A 1R8HA 2YWHA 1QUPA 1Q95G 3IMQJ 2IHR1 4TU8A 3CCES 3CEDA 1ZYQA 4OV1A 4DQRA 3T5LA 1U02A 1AW0A 2KHDA 2DNRA 2E1MC 3DOLA 5LMUJ 3PYDA 2VG6A 4LBIA 2YKOA 3R6GB 3QT5A 2RRNA 2M8DB 1S1TA 3EZOA 4YN3B 3HD2A 4FYVB 4OHWA 4DPUA 1I3OB 4LR9A 4KYZA 4KR0B 1I94J 4NLWA 1IKVA 4I2QA 4ECXA 4FP9A 2FVCA 4PWDB 5DLFA 2M4MA 2VQFF 2E1RA 1SJRA 2AJ4A 3CMAS 2NSBA 1JLCB 1NDPA 3DLKA 2ZBCA 2W25A 4LFAJ 3CJ4A 3ZZOA 2L9WA 2MZQA 4HACB 4PCQA 1FWLA 2ADBA 4O3NA 2NXUA 5HBMB 1HBNA 1RHRB 4RNFA 3HF5A 3IA0A 4ERDA 1CVJA 2UUWA 1Y3KA 2ZD1A 4ZPCA 1EKRA 4ZIVA 4X65J 1N5QA 2A6OA 2KL8A 5B0CA 4DL6A 1QAYA 1ITPA 1OQ3A 3UW1A 2LU2A 1M5HA 3QWUA 3JQMA 4B08A 2AHOB 3KKFA 4MH8A 2ERRA 2OPRA 1KC8T 2IC3A 2LXIA 4IOBA 1CJUB 2HRYA 2W2PP 5DQHA 4RW7A 2PFDA 1MMLA 1NO8A 1IR0A 1T9VA 4LF4F 1HL6A 1S59A 3CCLS 3C15B 3SQGA 4RL1A 4YB6A 2JEFA 2D7SA 2YKNA 5J2NA 1HWJA 1UWBA 3M8QB 4WXWA 2DRDA 3X3UA 3A3OB 1JKHA 2V2KA 4KFBB 5IOLA 2K7JA 2RU9A 3L4BC 1XMBA 3FZ2A 1LNQA 4WFYA 2NPIA 2AZ1A 2W7PA 1HMVA 3HHDA 1Q81T 1YRUA 2HKEA 2C2MB 4UOGA 1X4AA 2CJKA 2UXBF 1PKUA 1TK5A 3DU6A 3CJ2A 2HQFA 4F3QA 5L1LA 4ED5A 3LAKA 2QFJA 5L9XA 3TZYA 2DIUA 3DGVA 4NLRA 3RJMB 4LSLB 3KHLA 3G71S 2QMWA 2XSJB 1T8EA 4OI2A 1AFIA 1X31C 3UVJB 4B3OA 4RW9B 3TJAA 4OX8A 2HMIA 5FIIA 2VJVA 2I6WA 4Q8FA 4DHVA 2I1RA 2KI2A 3IM9A 3SSQA 2Q43A 1Y10A 2PMWA 4ZCLA 3NEKA 1EP4B 2R2RA 5KG0A 2KM8B 4TQSA 1D1UA 2WZ1A 1LXJA 3V81A 4I7FB 2DXEA 5KFSA 2NYIA 2VQFJ 3RG6A 1LW0A 2A18A 1Y0HA 4OJ3A 3H2VE 2HBRB 2CPEA 2KT5A 5A0YB 4X62F 1SCJB 1JLGA 2CQ0A 4RNHA 2BVZA 3ZZUA 2MKJA 3SI8A 5DRKA 5JMNA 1JLEA 4RNNA 1TL3A 3MR2A 1DBDA 3RRGA 2RAQA 2FY8A 3S8SA 5D8HB 3DHWC 2H51B 4ED7A 5KTQA 1T0TV 4I69A 5E41A 2R7VA 3AXMA 5GAHI 3NLCA 3NXZA 3J7AN 2EFPA 2MEWA 1B99A 3JAMU 8ATCB 2MQOA 4HVZA 4M1KA 5HROA 4NLOA 3K5NA 2J9CA 1IKWB 5B0FA 2GMJA 4K59A 2V6AA 2BUNA 4NI2A 3SSSA 3QSIA 3I4PA 1QVFR 4DR1F 3VZHA 1SV5A 2D74B 2QLFB 7FDRA 3QJPA 4JV5J 3TUPA 2O5DA 3KJVA 4F67A 3O6QA 2KG0A 2FYXA 3ISZA 4GVLA 4OLPA 5E3CA 4U8YA 3DOKA 2QGFB 2YWFA 4IFYA 1WHYA 2YVSA 3KJNB 1P8GA 2YNIB 1EX8A 4NXMJ 2CQDA 3DRRA 2KN4A 2FVRA 3SBMA 1KTQA 1WG4A 4JI0F 5B09A 2YXLA 1U24A 3VAKA 5F41A 2FPHX 2PDAA 3BGLA 3G82A 3A8JA 1S1WA 2UXBJ 5FJ4A 2ILZA 1HWLA 1YRXA 1NK0A 4DUYF 3R5DA 2UU9F 1U1KA 2ZZMA 2KXNB 1TL1A 2QIFA 3W60A 1CJVB 2QL7B 2VF3A 3OSPA 4ANDA 5KFQA 2FJWA 4DCPB 5HMWA 1LWCA 2YNGB 3FUYA 3GLJA 1UVJA 1KQKA 4IR1A 3Q2SC 2CQ1A 3ENQA 4K4VA 2E9ZA 5LT5A 1EZZB 1XTZA 1DLOB 1OY9A 3RBDA 4ECRA 2E1AA 1QLNA 4W4MA 1SC4B 1HBOA 2QEXS 4NA3A 4X62J 4DV7F 2J7KA 3DOMA 3G9CA 1V3SA 5M2RA 3UD3P 1QM9A 4N77A 2LKZA 4C2MA 4F0HA 2WSCC 3PW0A 3R97A 1RT1B 3MM5B 4YHHF 3EZ5A 3UN5A 2BKPA 4BHQA 3MWBA 2BBEA 4ECZA 2X51A 1QE1A 2F5GA 1YBUA 1RU2A 4ETXA 2W4DA 4G1PA 4ZLLA 4C8OA 4L76A 4A4JA 1SC3B 3GSIA 4USWA 3KK2A 1F1BB 2HGMA 1P9QC 3PKMA 4NCGA 3KOAA 2AJQA 4O3SA 3EVOA 2GMHA 2B5JB 1JXEA 3IO1A 2LDIA 3DXBA 2BJDA 1ROFA 1QSYA 4HH1A 3B78A 2HK3A 2XY6A 3CVKA 4DUYJ 2MQNA 4XO0A 2UU9J 3C14B 2ZNZA 1VGYA 4RU2A 2R8IA 5M2UA 1KQGB 2ZDOA 2DNZA 2UVWA 1PIEA 1TKTB 3VAFA 1EAYC 4I4BA 3M9MB 1BWEA 1CSJA 4RW4B 4ZPDA 2OKQA 1ZOTA 2RMLA 3R27A 3RB0A 1HD1A 3T6JA 3BSOA 3H0PA 5D0RA 1ULRA 3AODA 2QZ8A 1JIHA 1S72S 3LPEA 3EXCX 1HNXJ 2DRBA 4M63A 1BQMB 2EXUA 4M5IA 1GT8A 1GEHA 1H0HB 1FNMA 4KH0B 3ILIA 2ZH7A 2A0FB 4NLVA 5GAGU 3GJRB 4DSLA 2KYZA 4QR2A 3M30A 4DV7J 1HQ2A 1GMVA 3ZC4A 2G0CA 2HHVA 2Y1LB 4DV4J 1WG1A 2QT7A 1R27B 2DVIA 4ZDNA 1WF2A 1KLMA 4LF8F 1GMUA 1TVRA 3R1LA 4C3LA 1LFWA 4EZ6A 3PKYA 3PW7A 3MEGA 1VJQA 4LF1A 4YHHJ 2R9LA 3GJTB 4L6V3 2C3PA 5KT6A 2DEIA 2A6MA 1XQIA 1RHJB 4TVAB 1N0VC 4TNOA 1B64A 3MMCA 2EK1A 4RW8A 1RZMA 2RB7A 4H4KC 1T03B 2ZEJA 2O66A 2OO4A 3CCMS 1N33J 3OVBA 1GAOA 1X4FA 5BR8F 1FX4A 4QYRA 1DY3A 2D9OA 3BR9A 4QZVB 4NXNF 5DZ6A 1RT3B 2HFUA 2XMKA 1R0BG 5HI7A 3M1VB 2MJUA 5ETMA 3BN7A 1YHQS 3HT3A 1RAAB 2OPSB 2R8KA 5KG4A 1RAJA 3KLIB 2VG7B 2GS8A 3I31A 1SKWA 2ZH9A 4QWBA 3K57A 3ETMA 1UCNA 5BYQA 3JS9A 2HNDB 4N76A 4JYAF 4YR0A 1B7FA 1XIQA 3TA0A 5K8OA 1RAHB 4X64F 3CPWR 1LKZA 1Q82T 4B17A 3PYGA 3DC2A 2VPYB 1YDLA 1Q1KA 2D69A 2E1CA 2GHWA 2JSXA 3K0JA 3I0RB 2H3EB 4DI6A 3EM1A 5AXKA 2LA6A 3MMBA 4ZVGA 2RUSA 4HHJA 1T05B 1P6TA 4KGMA 1U4BA 3TX8A 4X4OA 1TQLA 5LSLA 3D6FB 1NLKL 1YJNS 1WG5A 3QFWA 4DL3A 2FLOA 2DNOA 2GV1A 4LJMA 4L75A 2CQGA 1RU1A 3OR1A 3DLEB 1RE1B 4MK7A 2OELA 2FLPA 3W2VA 2CQ4A 2R7TA 3L7PA 1RKJA 4NMXA 1R3NA 3I96A 1CPZA 5E0OA 3S01A 2J0WA 2YQ0A 2KZMA 3HD1A 2QSFA 1SL1A 4WK1A 4ECUA 2MQQA 2IM2A 2GCFA 4WYWA 2YKQA 3WC0A 2ZKTA 4PR6A 4RWWA 2ZH4A 4ELUA 3HSGA 3KMSA 1K9MT 2LEPA 3OD2A 3OLBA 1WI6A 2UV8G 4UUXA 5HSPA 2KKHA 3Q8PB 5IXUA 3TRGA 4ZVRB 1U6FA 1B0TA 3C6TA 1RP5A 3AA9A 1IQTA 4LFBF 2ZM6F 4H54A 3TZWA 5IM0B 5BR8J 3M8ZA 4DFKA 2NCKL 3MM8B 3P5TL 2BQUA 4O4RA 5D0HA 4K2JA 2MY8A 3RGIA 1S12A 4QIGA 3I55S 2DR6A 3OL9A 4ZVSB 2JNJA 4QQBA 4TYBA 4E98A 2RS2A 1NK6A 5KFMA 1Q8KA 1VS3A 1D09B 2HURA 3GMGA 3ADAC 1YJVA 2YNFA 2R7OA 1FVSA 4YDDB 3UCGA 5DG8A 4ZP7A 1RWMB 3BYPA 3RB3A 3GG0A 2HHQA 4UOCA 2HGLA 4KPCA 2Z2ZA 4X64J 4DJBA 4HHHA 4F25A 3BDEA 2J9EA 2HWHA 3PZPA 3C3LA 3VZIA 1OY8A 2HK2A 5BJRA 2Y8WA 4OIXA 1PJ7A 5L9NA 2VC0A 3DLHA 4B3SJ 4JP8A 1FFGB 4HT7A 3CF5Q 4UT4A 2GGPA 3MMAB 3GFZA 3O1LA 2BJ1A 3C66A 2HHPA 1J2VA 4CLYA 5A8WA 4DFMA 2PMZD 4X4TA 1FVQA 5GADU 2L9DA 4H4OB 2DNGA 4WTYA 3MR6A 5D4PA 4WZQA 3G8SA 3VGSA 4QW9A 3FFIB 3VWSA 2HHTA 1MW7A 4O3RA 1RXOB 3JSYA 1GXUA 4KSEB 2IRYA 3EICA 1H3DA 4J9OA 3CJ3A 5KFNA 1RWOB 1TL4A 1KN6A 1OMSA 5D4NA 2IDLA 3MAQA 4LF9F 3PG9A 5E5NA 4KGZB 2EI5A 2O67A 1UETA 3G6YA 4CNYA 3MM9A 3QO9A 4X4RA 5D15A 1MLAA 1MNEA 4WZMA 2ZM6J 2IAJA 7FD1A 3Q8VA 2W9BA 1WWHA 4ZPAA 4ZJOA 1VOMA 4IRKA 5EX3A 3Q8YA 2VA3A 3SFGA 2OTJS 4K4UA 2VD3A 2B9EA 1Y3JA 3MPVA 3P96A 1M5SA 1S1UB 3ENAA 4USTA 4F4KA 4IFVB 2ZWPA 2CFXA 4YQWA 1W2BR 4WTOB 2L48A 2IA6A 2A10A 3BR8A 2CJQA 4ZVEA 3LOUA 1NPPA 4A8KA 3QT8A 3M2UA 2XLJA 4J9MA 2N3LA 2J0SD 2A1BA 5C2GA 1XNQF 4A8YA 1HYSA 2N4CA 3PNIA 2H5JB 3F0NA 1NAQA 4K2XA 2WB1D 2YX7A 2K1RA 2ZH2A 1RISA 4KHMA 4K4XA 4CO4A 3GYXB 3V2UC 4I6AA 2MHEA 3UR0A 2WBRA 3DRPB 2RF2B 5D3GB 3P3DA 3AB2B 1M5PC 2GNKA 2ZWOA 2MZSA 4CI0B 4Y28C 3ZTRA 4C8YA 1DQ9A 3MOZA 5J2QB 4KC5A 3N6MA 1QVGR 2HVZA 3FBEA 4PXCA 3LGNA 3AHPA 5KFLA 4ZMMA 1N34J 2MZ1A 4FYXB 1RWUA 2XSJA 3U1LA 3G2XA 2QLJB 3GIRA 4QIWD 3MCMA 4M95A 1VBKA 2GIQA 2MKSA 4RW9A 2XGPA 2U1AA 1RTIA 3ZZ0A 2JC0A 5HATA 3BGRA 3KLFA 3DFEA 1EARA 3PR4A 3G96A 1RACB 1TKZB 2YKAA 2FIUA 4WE1B 2P8IA 1D9FA 3KMQA 2EW9A 1A9NB 1H72C 4B3TF 1ZZNA 1NB2A 5CCLA 5I3PA 1VBYA 2OEKA 4PRFA 2RQ4A 4CTAB 3H59A 3BJYA 4UY85 2PSZA 4LF9J 3DXSX 3NMAA 2V5HG 5L39A 1UPMB 5DG7A 2GO9A 3AH6A 2PE8A 1G4CA 1O5JA 3KG0A 4N56A 5F8HA 1HHSA 1HNZF 1NJIT 1KVKA 4QYZK 3OBIA 2BANA 3U1MA 2Q3PA 3TAPA 5CQGA 3E3XA 1SPBP 4R0EA 2XYHB 1NHKL 1SJ3P 2VFTA 2QL5B 3FCVA 3UD5A 2F65A 3IRXA 4LRDA 2CPDA 2OFHX 2MZJA 4CYUB 4HHUA 2DR7A 1KDNA 4JI6F 2DCUB 4CO1A 3CUNA 4TN2A 1MU2A 1P1TA 2I9SA 3D2WA 3VAIA 1XNQJ 4GRSA 2WVDA 2EPIA 1JLBB 3WIVA 5CHCB 3RR7A 4IOCQ 3QBCA 2LCWA
chains in the Genus database with same CATH topology
4DV4J 4JI6J 4LF5J 4DV5J 1N32J 2MTLA 4DR7J 1HR0J 4LFAJ 5FLXU 2UUAJ 4LFCJ 4PWWA 4DV1J 4LF9J 4DR2J 4K0KJ 4X64J 1XMQJ 4B3TJ 1XNRJ 4GKJJ 4KHPJ 4JI8J 3OTOJ 4DV2J 2UXBJ 4DUYJ 4GKKJ 2HHHJ 1IBLJ 4JI0J 4LF7J 4YHHJ 2UU9J 2UXCJ 4DR5J 4DUZJ 4B3RJ 4RJVA 2KVQE 1HNZJ 4LF8J 2E5LJ 4JYAJ 4X65J 3J7AN 1HNWJ 3R2DJ 2UXDJ 2UUBJ 2MEWA 2KL8A 3JAMU 4AQYJ 4V1Ak 4B3SJ 2UUCJ 5IT9U 2ZM6J 4OX9J 1IBKJ 4JI1J 3D3BJ 4JI7J 3IMQJ 1J5EJ 3J81U 1N34J 1IBMJ 5AJ3J 5BR8J 2VQEJ 4JI2J 1N33J 3T1YJ 5LMNJ 4YY3J 2MQ8A 4DR4J 5LM7E 1XMOJ 4JV5J 4LF6J 2F4VJ 3J80U 4LFBJ 5LMUJ 3W1YC 1HNXJ 3D3CJ 4JI3J 4B3MJ 4DR6J 1N36J 4HHUA 5A2QU 4DR1J 4NEZA 3T1HJ 4JI4J 1FJGJ 4DR3J 4DV7J 4NXNJ 4KYZA 4JI5J 2VQFJ 5IWAJ 1XNQJ 4DV3J 1I94J 4LF4J 4DV0J 4NXMJ 4X66J 4NEYA 4KY3A 3R2CJ 4DV6J 4X62J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 J;  4JI6 J;  4LF5 J;  4DV5 J;  1N32 J;  2MTL A;  4DR7 J;  1HR0 J;  4LFA J;  5FLX U;  2UUA J;  4LFC J;  4PWW A;  4DV1 J;  4LF9 J;  4DR2 J;  4K0K J;  4X64 J;  1XMQ J;  4B3T J;  1XNR J;  4GKJ J;  4KHP J;  4JI8 J;  3OTO J;  4DV2 J;  2UXB J;  4DUY J;  4GKK J;  2HHH J;  1IBL J;  4JI0 J;  4LF7 J;  4YHH J;  2UU9 J;  2UXC J;  4DR5 J;  4DUZ J;  4B3R J;  4RJV A;  2KVQ E;  1HNZ J;  4LF8 J;  2E5L J;  4JYA J;  4X65 J;  3J7A N;  1HNW J;  3R2D J;  2UXD J;  2UUB J;  2MEW A;  2KL8 A;  3JAM U;  4AQY J;  4V1A k;  4B3S J;  2UUC J;  5IT9 U;  2ZM6 J;  4OX9 J;  1IBK J;  4JI1 J;  3D3B J;  4JI7 J;  3IMQ J;  1J5E J;  3J81 U;  1N34 J;  1IBM J;  5AJ3 J;  5BR8 J;  2VQE J;  4JI2 J;  1N33 J;  3T1Y J;  5LMN J;  4YY3 J;  2MQ8 A;  4DR4 J;  5LM7 E;  1XMO J;  4JV5 J;  4LF6 J;  2F4V J;  3J80 U;  4LFB J;  5LMU J;  3W1Y C;  1HNX J;  3D3C J;  4JI3 J;  4B3M J;  4DR6 J;  1N36 J;  4HHU A;  5A2Q U;  4DR1 J;  4NEZ A;  3T1H J;  4JI4 J;  1FJG J;  4DR3 J;  4DV7 J;  4NXN J;  4KYZ A;  4JI5 J;  2VQF J;  5IWA J;  1XNQ J;  4DV3 J;  1I94 J;  4LF4 J;  4DV0 J;  4NXM J;  4X66 J;  4NEY A;  4KY3 A;  3R2C J;  4DV6 J;  4X62 J; 
#chains in the Genus database with same CATH topology
 2DNH A;  4U7C A;  4ER8 A;  5J2M B;  2HIQ A;  2N4D A;  1ZM9 A;  3FGV A;  3D6H B;  3AT1 B;  3W64 A;  3R8Y A;  3SCI E;  1QD1 A;  3DRS A;  1S48 A;  5GAH U;  1N5Y A;  4ZP8 A;  1Q5Y A;  2BE2 A;  2NLW A;  4NE9 C;  5K20 B;  3DYA B;  3UR3 C;  2VPX B;  1N52 B;  4UQT A;  4OYZ A;  4PYD A;  3E01 A;  2QRR A;  1AT1 B;  2H48 B;  4ECY A;  5HP1 B;  5AT1 B;  2ATC B;  1OWX A;  3SV4 A;  2FHK A;  1HBU A;  4LRA A;  2WW4 A;  3M8P B;  3M32 A;  1FK9 A;  1LK5 A;  1UJ6 A;  4PXD A;  4AL6 A;  1LW2 A;  3IM8 A;  3ZO7 A;  3IR6 B;  1PC5 A;  4RPF A;  3K5O A;  1LQ9 A;  3MCN A;  1S1V A;  2UUA F;  2MPU A;  1X4E A;  2YKP A;  3AJ1 A;  1S97 A;  1R0A B;  4A8W A;  3FRY A;  1NK8 A;  3OTD A;  2Z2L A;  2AD9 A;  2IRU A;  4J9V A;  2CQI A;  3BO2 A;  2BQR A;  2GAH C;  4KB7 A;  2DH7 A;  4GMK A;  3MCO A;  4C3K A;  4GKJ J;  3AXK A;  4DR2 F;  1IKY B;  3LF0 A;  4EO8 A;  3HVT B;  4NX9 A;  3G8Q A;  2AJ2 A;  1HNZ J;  2JLE A;  2V0N A;  4K4Y A;  5IQ6 A;  4URQ U;  3AOB A;  1J5O B;  3HZE A;  4L72 B;  4WXO A;  2CPF A;  1S4F A;  2GQ2 A;  4USI A;  1ZET A;  3WX4 A;  2H5I B;  4JI2 J;  4PQU B;  4FDF A;  4OYX A;  3CD0 A;  1VCT A;  4OI3 A;  2DKO B;  2HGN A;  1JJC B;  1DJ0 A;  1OPZ A;  5ETT A;  3PX4 A;  1SUQ A;  4X4S A;  1Q16 B;  2I5J A;  1FWP A;  4KGX B;  1NDL A;  2W9C A;  3TAM B;  4K50 A;  1FI4 A;  3OT9 A;  2B56 A;  1Z2Z A;  1RYR A;  1S0O A;  2BV3 A;  3VGV A;  2QMX A;  4M5L A;  4DV6 J;  3I9Z A;  4OI0 A;  1GNK A;  2G2O A;  2FJB B;  3CCR S;  2RJZ A;  3TQE A;  3U1N A;  3V4I A;  3MR3 A;  1U0H B;  4ZLP A;  4RUA A;  1CJT A;  3I9V 9;  5GAE I;  4KHP J;  4JI8 J;  2F9J A;  4LF7 J;  4P2X A;  2HVI A;  4RBV A;  2ASD A;  1Q7L B;  5AJ3 F;  1UW9 A;  3JSM A;  4ZIT A;  5J1E A;  1T3N A;  2CRL A;  4Q8E A;  2CJA A;  4ICL B;  2G13 A;  4OYB A;  2ZBP A;  2AYG A;  3CMQ A;  3IR7 B;  2HHS A;  2OI2 A;  2W8L A;  2FTR A;  4EO6 A;  2ILY A;  3KLH A;  1WTB A;  3PFO A;  2X1F A;  4QIF A;  1VQ7 S;  3J7Y U;  1UA1 A;  2HLU A;  3ZNJ 1;  4JI4 F;  3P45 B;  4ZVT B;  3KLE B;  3PCO B;  1D0E A;  3D6M B;  1T94 A;  1W2I A;  3UE2 A;  2I8E A;  1RWW B;  1AA1 B;  3BV8 A;  3GTY X;  4F4Y A;  4DBQ A;  4DR3 J;  4J9P A;  4GO5 X;  2GQQ A;  1RAF B;  1SB6 A;  2P6T A;  5J2P A;  1FJE B;  1HI1 A;  3I5A A;  1CG2 A;  3PX6 A;  3NBP B;  2ALZ A;  2WON B;  5HLF A;  3H4B A;  1F6T A;  3M8W A;  1RBO B;  4USK A;  1TKX A;  2F63 A;  4DR2 J;  2DXD A;  2ZJR Q;  3PJW A;  4TXS A;  1C0U B;  2CWK A;  3CJ8 A;  3ELH A;  5EHH A;  1UJ5 A;  3QQC D;  2B9X A;  1IJE B;  3BBB A;  1NU4 A;  2IPO B;  3MEE A;  4I56 A;  5KT5 A;  1S77 D;  1HNW F;  5KFX A;  1HWU A;  1XMO F;  4MFB B;  2R7X A;  5ETR A;  1EET B;  4HEA 9;  1X5P A;  4PUO A;  3MMJ A;  1CS4 B;  2RDD A;  2JEG A;  1CEZ A;  3H5Y A;  6FDR A;  1S1X B;  4JI3 J;  1U1N A;  1NK9 A;  2J0X A;  2ALY B;  1HHQ A;  1VQM S;  1FO1 A;  4BDP A;  1XBW A;  3MEC B;  5M2P A;  5CAB A;  3MCS A;  1K0V A;  1RAD B;  4AYB D;  3V5R A;  4ILL A;  4NEY A;  4P75 A;  1PJ6 A;  1FDD A;  1VRU A;  2MLY A;  4JB8 B;  4ZJL A;  1Z1Z A;  1B4S A;  3TUZ C;  3Q8S B;  1UFK A;  1RWP B;  3MED B;  4FF2 A;  2J6T A;  1M0S A;  3GIM A;  2CAD A;  2CG8 A;  1DRZ A;  2V2V A;  3LA0 A;  1KWM A;  3R2D J;  4OX6 A;  5CYM B;  2HZV A;  4ES1 A;  4TYA A;  3NKY A;  4ZPW R;  1UL3 A;  4P52 A;  2DNN A;  4U8V A;  3CDU A;  3FCH A;  4IUF A;  5I4M A;  3Q8R B;  1RQ0 A;  1U2F A;  3OJS A;  2MQ8 A;  4K4S A;  2Q6B A;  2ZHA A;  2D3O 1;  1U26 A;  4J9Q A;  2C2K B;  3LTO A;  2VUG A;  3JTO A;  2CNL B;  4C98 A;  1JB0 C;  2J6S A;  1ZPV A;  5F9N A;  1TK0 A;  2BE9 B;  5C25 A;  2NUH A;  4AE5 A;  2RQM A;  4CT8 A;  5H1S V;  3VAG A;  1BD6 A;  2K7K A;  2CQP A;  1WOO A;  3CD7 A;  3MF5 A;  1F2G A;  2KTQ A;  4LIR A;  4DV2 F;  1HR0 J;  1TUW A;  1D8Y A;  2J8S A;  4GKK J;  3J81 Y;  3CCV S;  2ADC A;  3TP2 A;  1ZAX A;  2CNK B;  5E3A A;  3M6W A;  5F8M A;  1HNW J;  2V4J B;  5D6G A;  2EG2 A;  1VI7 A;  5KFF A;  1S6P B;  4DG1 A;  4DR4 F;  1NZ8 A;  2UUC F;  4WFN Q;  5KFI A;  1TP7 A;  5LL6 d;  1JJH A;  2QE5 A;  5F8L A;  1BLU A;  3JTP A;  3FMB A;  4Y2K A;  1KFD A;  2PA8 D;  3ONQ A;  4O4G B;  2DIV A;  3BKT A;  5KG5 A;  5LMN F;  2WHO A;  1G2E A;  4QWC A;  2X3G A;  4PAA A;  1T9X A;  3F73 A;  2B7C B;  1DTT A;  1RT5 B;  1FD2 A;  1X9W A;  2B3T B;  1N54 B;  1REG X;  2F8E X;  2MGZ A;  4PG4 A;  1LWF A;  3UN3 A;  4U67 Q;  3HPO A;  3KJF B;  1G6B A;  3D5M A;  1YWX A;  3GU0 A;  2N7Y A;  1MRO A;  1S9E B;  1XMQ J;  2FJX A;  3TUI C;  5DET A;  3POT A;  5BYR A;  3GV5 B;  1RT2 B;  1OYE A;  2CQH A;  4Q0B B;  4NYZ A;  2CJ9 A;  3O3L A;  2Z2Y B;  4LRE A;  2VBX A;  4KKO B;  1UEU A;  3LP0 B;  3FDS A;  1TV6 B;  2UUB J;  4DX8 H;  1K1Q A;  5A8R B;  4QPT A;  2IM0 A;  5A8K A;  4ZVH A;  2DR5 A;  1N0U A;  3CIZ A;  3DLJ A;  1VC0 A;  2RKI A;  4P7V A;  2MZT A;  3CJS A;  3OSN A;  1SIW B;  5HJY A;  1IM4 A;  4ATN A;  4NLU A;  1RBL A;  4R5P A;  3UD4 P;  3HLU A;  4L74 A;  3V6K A;  2G9O A;  2HVE A;  4LF6 F;  1YJW S;  4RU9 A;  7AT1 B;  1HQE B;  3BGF A;  4BCA A;  1KHV A;  4V19 X;  4CDI A;  2OSQ A;  1OPI A;  2OML A;  2NS1 B;  2FJD B;  2V2Z A;  1T9U A;  3THT A;  3UQS A;  1S5Z A;  4GVB A;  1Q0N A;  2J9D E;  2H54 B;  2VPW B;  3SMZ A;  1C1C B;  2AEF A;  2WVC A;  4OJG A;  5KFG A;  3H25 A;  3QFH A;  2KM8 C;  5B0G A;  1IM6 A;  1RT4 A;  4O3Q A;  3NY0 A;  4G1Q B;  2UUC J;  2W7O A;  2IFX A;  1M5K C;  2LP4 A;  2ZH8 A;  1T9Y A;  2BA9 A;  3OFH A;  4J9N A;  3IC1 A;  3I56 S;  2DRA A;  3AOC A;  3CDB A;  1YBT A;  4ZPT R;  4L3N A;  3CC4 S;  5LMN J;  4YY3 J;  2HG4 A;  4FZV A;  1HNI A;  3EDQ B;  2M52 A;  2BZ2 A;  1H2U X;  1MWZ A;  3UCU P;  3SDE A;  4PXE A;  4I68 A;  5FDL B;  4WKY A;  3CC7 S;  2J76 E;  3W62 A;  4RUB A;  2QTW A;  2RRB A;  2E66 A;  1JLA A;  4CT9 A;  2Y8Y A;  4USV A;  5IWA F;  1PGZ A;  3KFW X;  3RBZ A;  2HHH F;  5G0R B;  3CO0 P;  3BQ0 A;  1U6B A;  5F0W A;  4EI2 A;  2E5L F;  3HHL A;  1ZA2 B;  1G3O A;  3LP1 B;  3SEO A;  1N6Q A;  3OXF A;  5AXN A;  5DG9 A;  3RTV A;  4YME A;  2BM0 A;  5MAO A;  1S6Q A;  3DLB A;  1NDK A;  4KGK A;  5J2Q A;  5A6P A;  3L7O A;  4Y3C A;  2F7V A;  5E2Q A;  3HJF A;  1NHV A;  2V63 A;  4LF6 J;  1XER A;  3D3C J;  1TL7 B;  3KLG B;  2RHQ B;  4CLU A;  1RWN B;  3HFZ B;  2VBW A;  3CCT A;  4KV8 A;  2HFV A;  2P9E A;  5K14 B;  5B0D A;  1JLF A;  3PIO Q;  4X66 J;  2EG1 A;  5IS2 A;  1WI8 A;  3KK3 A;  3A4T A;  2AP6 A;  1ZM4 A;  3MPY A;  3QRR A;  3GIK A;  4B3R F;  3JSR A;  2MQM A;  3W2W A;  4ID5 A;  4DN9 A;  1WEY A;  4Y2A A;  3CCJ S;  1SL2 A;  1DUR A;  3ZFV A;  3IN5 A;  3IS9 B;  4FKX A;  2VBZ A;  4R8U A;  3UDC A;  4A8X A;  1RHU B;  2MDA A;  3GB0 A;  4ED8 A;  4HH0 A;  2D9P A;  3FKB A;  3MDF A;  4UZB A;  2HPU A;  4DCO B;  1I5O B;  2J6U A;  4NAS A;  2ABY A;  3QT7 A;  3DGP B;  4IO9 Q;  3H20 A;  5KAK A;  5JXS A;  5KOX A;  2ZIT A;  1UWA A;  1RAE B;  1TEL A;  3DI6 B;  2AU0 A;  2B0G A;  4ELT A;  1M5V C;  2VFV A;  1U2R A;  3D9B A;  3NNA A;  2OPQ B;  5IWA J;  5L8R C;  3OTC A;  1QUV A;  4O44 B;  1S79 A;  3CTR A;  4MYT A;  2DHA A;  4K4Z A;  1K47 A;  1JJ4 A;  3FJ2 A;  3KYL A;  2JJ4 D;  4PWU A;  3DLL Q;  2JFD A;  2NUU G;  4V19 J;  2XMV A;  1RLC L;  3D6T B;  5H9E K;  1DAX A;  1VIS A;  4WK3 A;  1GMW D;  1OSD A;  1X9S A;  4YFU A;  2AZ3 A;  2ZZN A;  3PM9 A;  5ETS A;  1WF0 A;  1MWQ A;  5AXM A;  3LP2 B;  1XR7 A;  4LQ3 A;  1VR6 A;  3QAT A;  4AL7 A;  3D1Q A;  2GHP A;  1N36 F;  2HNZ B;  4XK8 C;  3CJK A;  4J5O A;  2CDR B;  2AT1 B;  2UP1 A;  2G0J A;  3Q83 A;  1HI8 A;  1VQY A;  3MM7 A;  2XMJ A;  3ISN C;  4ELV A;  2MLX A;  4DR7 F;  2YWW A;  3Q86 A;  5F8G A;  3TYT A;  3GYG A;  1Q5V A;  4CLT A;  1CUL A;  4RW6 B;  3TNV A;  4AT1 B;  4CM0 A;  3K5P A;  1N32 F;  1PG5 B;  3SZ2 A;  4CLL A;  4CNZ A;  1QSL A;  3GII A;  1Y5L B;  1VK8 A;  4ZP6 A;  4CLF A;  1SKU B;  1HNV B;  5J1P A;  3DNC A;  4ALZ A;  1UEV A;  4MAK A;  3MUM P;  1UVN A;  4OZJ A;  1H98 A;  4QWD A;  4ZHR A;  3A12 A;  1E6V A;  5ADZ A;  1R6Y A;  2AJ0 A;  2KB2 A;  4H4M A;  3KK1 B;  4EFA C;  2FC8 A;  3I0S A;  2BJ3 A;  5I3Q A;  1C0T B;  2XSF A;  5HK4 A;  2CNO B;  5EGY A;  3RAX A;  1I94 F;  2B8P A;  2VG5 A;  3HSJ A;  4H4K A;  1MMN A;  1RTD B;  4FBU A;  1RA6 A;  1PO6 A;  2RU3 A;  2RVJ A;  4MIW A;  2XWY A;  1C1B B;  2HQG A;  2BOP A;  1WAC A;  2GVD A;  1YVF A;  4LBP A;  3T6B A;  4PXB A;  3O5T B;  1IKX A;  2WRM A;  1HBM B;  5AE2 A;  1E6Y B;  3LO3 A;  3UFC X;  2HW3 A;  3M2R A;  5J1N A;  1FRL A;  2QFI A;  3QWP A;  2Z8Q A;  3ILL A;  1FRM A;  4M8L A;  2GIF A;  1S4E A;  1ZM2 A;  4N8N A;  2PN6 A;  2GVZ B;  5H9E J;  5LXY A;  2XLI A;  3H4D A;  1JLQ A;  2DHH A;  2ACY A;  1REV A;  1YX2 A;  5IZH A;  2NYH A;  5A2Q Y;  1PAE X;  2MKC A;  4JI1 F;  1FKO B;  1HAR A;  1PCA A;  2M0G B;  2WBM A;  3J81 j;  1RT6 A;  2BKO A;  2R7W A;  4DFP A;  2MQP A;  1Q53 A;  3LUY A;  2VDI A;  2IY5 B;  1PC4 A;  2PMH A;  4XPC A;  3HSZ A;  3QIP B;  3MM6 A;  5F3Z A;  4X4Q A;  2IYG A;  3MFH A;  3GIL A;  3NNH A;  4Q45 A;  2GJF A;  1R89 A;  3PY8 A;  1N32 J;  2MTL A;  2HZC A;  2F4F A;  1B0P A;  1IVZ A;  4LFC J;  5A6W A;  3NWG A;  5KFB A;  1LFP A;  4O0I A;  2EK6 A;  1RYS A;  3RU0 A;  3GPA A;  4KTQ A;  4K0K F;  1FKP A;  2BJ8 A;  1WHX A;  4DMZ A;  2O1P A;  3AFG A;  4DSJ A;  1KHW A;  1V9O A;  5KT4 A;  2DK2 A;  4C8M A;  4EEY A;  5IQQ A;  2VKZ G;  5C24 B;  5RUB A;  4U6P A;  2E7V A;  5CYQ B;  4A48 A;  4HR2 A;  3HO1 A;  4CLW A;  4MFB A;  4DPT A;  4ED3 A;  1S6U A;  4K7Q A;  3BQ1 A;  3NGD A;  3VCD A;  5I3U A;  4C48 A;  3BYR A;  2BRL A;  4R25 A;  3VAL A;  3PRB A;  5D4O A;  2XQC A;  2V4Q A;  4WPA A;  4UW2 A;  3OL8 A;  3JQJ A;  3DLG A;  4USH A;  3DMJ A;  4DL0 C;  3DOL B;  4YB1 P;  2VG6 B;  1ZPW X;  5C7P A;  2ROE A;  3HZG A;  3DN9 A;  4M5D A;  1RT7 A;  1S1T B;  1S76 D;  1SH0 A;  2ZH3 A;  2ZVI A;  4DOZ A;  2QLX A;  1IKV B;  3P6Y C;  4I2Q B;  3I32 A;  2WVF A;  3N01 A;  2MSS A;  3MR5 A;  1EQM A;  1OIA A;  3DLK B;  5KT3 A;  2KYX A;  3QJJ A;  5GMD A;  2DNY A;  5LSO A;  2KJW A;  4ITS A;  5IV3 A;  5KOW A;  1HBN B;  4ZLN A;  3K89 A;  4NLD A;  2M7S A;  4Y2C A;  1YZ7 A;  4C97 A;  2RS8 A;  3OFG A;  5IT4 A;  2C2N A;  3OR2 B;  2IDE A;  4JI1 J;  4DU8 A;  4JV5 F;  2ZD1 B;  3CT9 A;  3M6V A;  3DM2 A;  2BMB A;  2BM1 A;  4ED1 A;  3CWJ A;  3JSB A;  1S7H A;  4A46 A;  3DU5 A;  2OPR B;  5EWF A;  2IC3 B;  4NXM F;  1RWX B;  4OZN A;  4C8N A;  3H98 A;  4RW7 B;  3OQ2 A;  5D77 A;  4CRJ A;  1XR5 A;  4KRW A;  2G2Y A;  1HPZ A;  2CQ2 A;  1F3V A;  1FJG F;  1U6Z A;  3SQG B;  2C3U A;  1TFY A;  3M05 A;  3LH2 S;  2YKN B;  5J2N B;  1UWB B;  4LBH A;  5LSR A;  1S0M A;  1JKH B;  2HFO A;  4K0K J;  2KFZ A;  4C11 A;  3K17 A;  2XMU A;  4WYL A;  3AJ2 A;  3BGU A;  4ZCM A;  1IBL J;  2OPP A;  4PAB A;  4DR5 J;  3PXG a;  1GQE A;  1NSQ A;  4WWS A;  2O01 C;  4PPD A;  2NR0 A;  3U7J A;  1YJ7 A;  2JFK A;  2YPZ A;  2JDJ A;  3RUB L;  1HMV B;  1NDC A;  1HFE L;  2IM1 A;  2AMC B;  1UVM A;  2MJN A;  2MMY A;  1B70 B;  2WK4 A;  2ZJP Q;  2LXF A;  4UOH A;  1YZ6 A;  4I6W A;  1UJ4 A;  4B3O B;  5ETO A;  3BH7 B;  2HMI B;  1ZAW A;  4TY9 A;  4Z2X A;  1Z2L A;  1BGX T;  2V34 A;  2AEM A;  1TTH B;  2QO3 A;  2ZC3 A;  4JI5 J;  4OZ1 A;  3VVT A;  2DYA A;  3SCJ E;  2AKW B;  1U1L A;  2B9Y A;  5SUH A;  3ET6 A;  3V81 B;  1JNR B;  3D0H E;  3B4D A;  2PI5 A;  3THV A;  3R5A A;  2ZDP A;  2DGT A;  1LW0 B;  2R7R A;  1U1P A;  5I42 A;  3JYT A;  3U02 A;  2NZ4 A;  2DGW A;  4F7V A;  3SCK E;  2YWG A;  1JLG B;  2VZ9 A;  4BLG A;  1JLE B;  1TL3 B;  3D1O A;  2RRA A;  2CJB A;  5L1K A;  4AQY J;  3S1T A;  4NPO A;  4WF9 Q;  4C4W A;  3AD8 C;  3OXL A;  4OX9 F;  3ZZY A;  4Q43 A;  5C42 A;  2B4V A;  3WZ0 A;  3D1H A;  1F60 B;  1VQO S;  4NA1 A;  5HQM A;  5HRO B;  3FMW A;  4DSE A;  2VOO A;  3WDO A;  4MT1 A;  1F9E B;  4NI2 B;  3MPU B;  4KE5 A;  2ZHO A;  1XWL A;  1RCO B;  1SV5 B;  3Q2T C;  1W25 A;  4YS2 A;  1FJG J;  3KJV B;  2LEB A;  1RGV A;  4EK2 A;  3PIP Q;  1RWK B;  3EGV A;  3DOK B;  1PYT A;  1A7G E;  2DCL A;  2V8P A;  4IFY B;  3PHE A;  3FBC A;  3QMQ A;  2QA4 S;  4NLX A;  1B3T A;  1R43 A;  3C6U B;  3AJD A;  4ZCK A;  4PG6 A;  3DRR B;  3C46 A;  2KHC A;  4NLG A;  2UV8 A;  5HVG A;  2DBB A;  2ZUA A;  5HQ8 A;  2P6S A;  3NAI A;  4OYW A;  4OV6 A;  5K8M A;  2DNQ A;  4A8O A;  3G82 B;  3Q8Q B;  5IC6 B;  2C2R A;  3VAH A;  3PVX A;  4DSI A;  1FTC A;  1S1W B;  2JX2 A;  3MTK A;  2HRT A;  3HHL D;  3J80 Y;  4J9K A;  3PR5 B;  4QWA A;  4PKD B;  2F8M A;  2IM3 A;  5LJ5 Y;  2B6A A;  1HNX F;  4OFZ A;  6AT1 B;  4IYQ A;  3K2Y A;  1TL1 B;  3C16 A;  3M8R A;  2W01 A;  5T7L A;  4Y00 A;  4P10 A;  3IBF B;  2GX8 A;  4C6A A;  2L3M A;  2K8G A;  1VFJ A;  1LWC B;  2AWZ A;  3KNG A;  2J7U A;  4OMF G;  1RTJ A;  1EKS A;  3VQS A;  2J9D A;  2K3K A;  4FXD A;  2FB0 A;  4DV4 F;  3QYY A;  4MK9 A;  2H5E A;  4ZOS A;  3SFU A;  4OHV A;  1I51 B;  2C2Z B;  4NYP A;  1U45 A;  1ICE B;  2YPY A;  3HT0 A;  3PEJ A;  1HBO B;  4N7T A;  1LWE A;  4G6V B;  3RB4 A;  2C2D A;  2DH9 A;  2CA9 A;  3VVU A;  5E3Q A;  3IWL A;  3DOM B;  2BEF A;  3EE3 A;  3OTO J;  1ARO P;  4JV1 A;  1YK9 A;  2VHG A;  2JLG A;  4X4N A;  2QA1 A;  3NWR A;  2IJN A;  2PEH A;  1N33 F;  3T19 A;  4OX9 J;  5CYJ A;  4X4V A;  1KP6 A;  3N6N A;  1HQU A;  5D0G A;  2QL9 B;  2E29 A;  2ZE2 A;  1RTH A;  4LR7 A;  1O8B A;  2X1B A;  2ZBR A;  2YKM A;  1SH3 A;  3T5K A;  1QTN B;  3UDL A;  6FD1 A;  1QE1 B;  3ZZR A;  1Y11 A;  3D54 A;  2HNY A;  1EIY B;  5DZ7 A;  2YNH A;  1KSP A;  5DO2 A;  1X4H A;  2CWX A;  3PO5 A;  3FCW A;  3KK2 B;  3AAW B;  1KRP A;  5HN0 A;  1KVJ A;  1X60 A;  4U9R A;  4ZVF A;  4NCG B;  1Q8I A;  3RAM A;  3MAA A;  4DPX A;  4UUW A;  3EXY A;  2W2N P;  2GJ2 A;  5C5J A;  5HVH A;  2E5I A;  2I38 A;  5HAN A;  1QDU B;  5GAG I;  3MFI A;  1IXK A;  4OHY A;  5CZX A;  3BH6 B;  3PYE A;  2FY1 A;  1WEZ A;  3FBF A;  3N5B A;  3CCQ S;  4Q5V A;  4CO5 A;  5CZV A;  3HFK A;  2QG9 B;  4OI4 A;  4Y65 A;  4OQJ A;  3O8W A;  3VGU A;  1LOU A;  1EJ7 L;  4F50 A;  2HFN A;  3J81 U;  2MKK A;  2ZOM A;  3PV8 A;  1DHM A;  3ZTS A;  3MD1 A;  4EWT A;  1KBR A;  1Y7P A;  5E7O B;  2B43 A;  4ZPV R;  1RK8 A;  4I67 A;  4FS1 A;  4TY8 A;  2FJA B;  4BWJ A;  3TO8 A;  3TAN A;  3E8O A;  1AZS A;  4EGL A;  4FF4 A;  4C8L A;  4IKA A;  2YBV A;  3M30 B;  3ENV A;  1JWW A;  1AUS L;  1UVK A;  2VKR A;  2IYI A;  4X84 A;  2PEB A;  4DF8 A;  2KXF A;  3IBC B;  4A8F A;  4HI2 A;  1VBZ A;  1JMT A;  1SH2 A;  3QRQ A;  1TZ0 A;  1KLM B;  1UAW A;  3MPW A;  1Z4U A;  1TVR B;  4IDK A;  1EB0 A;  2D3U A;  2WVB A;  4PPZ A;  4USJ C;  3EJM A;  2DIS A;  3KHR A;  3OHA A;  5D78 A;  3EZU A;  3MEG B;  4RKU C;  2FDN A;  4HLB A;  4YB5 A;  4O3P A;  3B8H A;  2FLL A;  3TVZ A;  1FEH A;  1IBM J;  1S9G A;  2HBY B;  2ASY A;  4ECQ A;  5DGA A;  1RKI A;  2JVO A;  1TMM A;  4IO1 A;  3IBW A;  1X8D A;  3MMC B;  2CG4 A;  4RW8 B;  4LR8 A;  2V50 A;  1FF2 A;  2HIY A;  4PZV A;  4LSN B;  5D0E A;  3V6D A;  2XHW A;  3T1H J;  3OW2 R;  2OGU A;  1CQN A;  3IR5 B;  5ETN A;  5E3P A;  4HT5 A;  3PW4 A;  2XS2 A;  3HVA A;  1F3F A;  1NBE B;  1B7Y B;  3CJT A;  4IOA Q;  2AYB A;  1X4B A;  9RUB A;  4DV5 F;  2OAU A;  3QLH A;  4URG A;  4IG0 B;  2KDO A;  4B3S F;  3GJS B;  4NOH A;  3LWL A;  2EEY A;  3WBZ A;  4OZ3 A;  4RJV A;  1GX6 A;  2KVQ E;  3DDN A;  3A8K A;  3OUY A;  4BC9 A;  2RDJ A;  3IGN A;  2UVU A;  1J5E J;  1HI0 P;  1J27 A;  2XWX A;  1TAQ A;  3W9H A;  3OL7 A;  1MN9 A;  1R8A A;  1IQZ A;  1UTA A;  2D41 A;  3BPD A;  4KBI A;  4IH5 A;  3RRH A;  2W9A A;  3SYZ A;  4J9R A;  4DR6 F;  4M5K A;  4J37 A;  2Z2M A;  3BGO P;  2YX1 A;  4A47 A;  4ED4 A;  5GMK a;  1QAJ A;  4PG5 A;  3RAQ A;  1ZH5 A;  4DS5 A;  1VRT B;  4KY3 A;  1G1X A;  1DTQ A;  1YJT A;  2M5Y A;  1CLF A;  4WU2 A;  3OR1 B;  3BKU A;  4FYY B;  3W2V B;  5KFH A;  3QID A;  3GFH A;  4Q2M A;  3LAM A;  4MKV A;  2EFQ A;  3MUR P;  4CLZ A;  3CB4 A;  4DQI A;  3TR5 A;  3QNW B;  3M2V A;  3EWG A;  4OYA A;  3MAH A;  1RDR A;  3E51 A;  4OJH A;  3CUL A;  3ZTP A;  1PIL A;  3V6J A;  1URR A;  1WTF A;  3P5B P;  1KKH A;  1FFS B;  2AF6 A;  1PYS B;  4V1A k;  1H38 A;  1VJW A;  4IH6 A;  1LEO A;  2HQI A;  3QGI A;  4IRC A;  1CBK A;  2FGC A;  3CO9 A;  3K8W A;  3ITH A;  4ZLJ A;  4IG3 A;  1UA0 A;  3HHK A;  4ECW A;  3C6T B;  3ILJ A;  4CO0 A;  3MZI A;  3UI3 A;  5K8P A;  3OHB A;  2F4V J;  1SXL A;  4F0K A;  3M6U A;  1TL5 A;  3UNY A;  4W90 B;  3TJ8 A;  3VTI A;  4LT6 A;  2HWI A;  3BS9 A;  2ZZT A;  3QIP A;  2LQB A;  4ID8 A;  5DM7 Q;  4OJ1 A;  1FA0 A;  2IVM A;  3TZZ A;  4DV5 J;  2C2O B;  1UKU A;  1WC0 A;  3IG1 A;  5GAD I;  1LXN A;  2WTF A;  3VGT A;  2LLZ A;  2FZK B;  2KXH A;  3TEG A;  4RR5 A;  5ETL A;  3RW7 A;  3KJQ B;  4J7C A;  4K5S A;  3JQK A;  2R42 A;  1WEX A;  1N34 F;  1K8A T;  1P1L A;  4C8K A;  1X7V A;  3QT6 A;  1IBK J;  2OSR A;  4DLE A;  4YOE A;  1HHT P;  4LRB A;  4KO0 B;  4HI1 A;  2VOP A;  2YX4 A;  3CME S;  2XO6 A;  1H2T Z;  4Y6I A;  3TWZ A;  2W1B A;  4LRC A;  1NH8 A;  1FT8 A;  2GGP B;  4DR6 J;  4TKT A;  2AGO A;  5A8W B;  5EWG A;  4PWD A;  1RLD A;  4MIA A;  3G6X A;  4Q2L A;  2V9W A;  3BSC A;  1JLC A;  5KFP A;  4QU7 A;  3NS7 B;  4WFZ A;  1EQ0 A;  1RAB B;  4HAC A;  4D3G A;  2MZR A;  5D4L A;  5L46 A;  4G3I A;  3VV2 B;  4C7Q A;  5HBM A;  2QLB B;  4DL4 A;  4ZVO B;  2CIM A;  2B51 A;  2A2C A;  3DDK A;  3PTW A;  1RBA A;  3MI7 X;  1MWY A;  1IWG A;  1ZS6 A;  3N5F A;  1SJF A;  4PYA A;  3NGS A;  1UZD A;  3GCX P;  4USU A;  5B0B A;  4X4U A;  4FVC A;  2EFV A;  2QC3 A;  3CCU S;  3W3S A;  4MKB A;  4DL5 A;  3H7H B;  3PRD A;  4NRT A;  1CJU A;  5KFJ A;  1AXQ A;  2J8A A;  3CXC R;  2XZD B;  4NCB A;  2XNQ A;  2BAB A;  3L7U A;  3MM9 B;  4EYI B;  3OR2 A;  5HAO A;  3QO9 B;  2P2C B;  1SQE A;  1F2H A;  3C15 A;  3GQC A;  2ZBI A;  4YR2 A;  2IAJ B;  3W8P A;  2W9B B;  1NK5 A;  4I0W A;  4ILM A;  3DCA A;  2O3D A;  3M8Q A;  2DPI A;  1L3U A;  3CCW A;  2GA7 A;  4WFA Q;  3RR8 A;  4KFB A;  3LWM A;  1ZBT A;  2DHX A;  1VQ6 S;  1RCX B;  3UDE A;  2D3Z A;  4P9S A;  1QJH A;  1FRX A;  4JV2 A;  4MYU A;  4WFB Q;  4J91 A;  1V6H A;  2IA0 A;  5AE1 A;  1YIT S;  1L3S A;  5DQI A;  2BRK A;  1U8S A;  2GQC A;  3H5S A;  1Q8B A;  4LF2 A;  3M2U B;  2XMA A;  1K44 A;  4Y2I A;  3MUV P;  1HYS B;  1NJZ A;  2LQ5 A;  2G1D A;  1RB0 A;  2K1R B;  4LSL A;  3TVK A;  2DH8 A;  5KFU A;  2CNN B;  1BXN A;  4NZ6 A;  3AOA A;  3UVJ A;  4B9U A;  1DQ8 A;  1SC6 A;  1TFW A;  3K59 A;  1FD8 A;  2XMT A;  2BJ9 A;  1KS2 A;  1NJW A;  1EP4 A;  3H8Y A;  3WX8 A;  1A6L A;  1S6O A;  2X1G A;  3I5C A;  4I7F A;  1U47 A;  1NRK A;  4DQP A;  4P6Q A;  2BJ7 A;  2W2O P;  1P9Y A;  4NLS A;  3B54 A;  4B9T A;  2JLF A;  1SL0 A;  4UF4 A;  2AQ4 A;  2CPY A;  4B9V A;  1KR4 A;  2YWE A;  1Y5N B;  4RX6 A;  3K7R A;  5A0Y A;  1Q8L A;  3RZA A;  1K0T A;  1PAU B;  1RTI B;  1CJK B;  9ATC B;  4YR3 A;  3MPD A;  3BGR B;  3KLF B;  4LVO P;  1VC5 A;  1NK4 A;  4WCE Q;  4GKJ F;  3J7Z T;  3T3F A;  2VDH A;  1LWX A;  1U7L A;  3DRY A;  1SIZ A;  4LSZ B;  3A3P B;  2KZZ A;  2MB0 B;  2UVV A;  3HI9 A;  4U7U K;  1IKW A;  3RYL A;  3HUL A;  3SXL A;  4YEA A;  5FD1 A;  4G65 A;  2LDY A;  4ZIW A;  3TA1 A;  3HVR A;  4JI2 F;  5CD4 A;  3D3B J;  1NB7 A;  1F9F A;  1KOO A;  4HKQ A;  2W2Q P;  5AE3 A;  3DDI A;  1Y5I B;  2JVR A;  2BAN B;  2KVI A;  2CQB A;  2CVI A;  2ROP A;  2FHO B;  3GON A;  4ZP9 A;  3L3C A;  1AYE A;  2G0I A;  2YNI A;  3PDN A;  2FQQ B;  5A2Q U;  4DV6 F;  3IRX B;  1HW8 A;  2DHG A;  4LF4 J;  2ZJQ Q;  3GSD A;  3EGW B;  2QMU B;  3L95 X;  2DY9 A;  4KHP F;  4JI8 F;  2CDQ A;  1HA1 A;  1O0P A;  2Y1I A;  1HD0 A;  1MU2 B;  3BPS P;  1H74 A;  4DU7 A;  4LF7 F;  4N47 A;  4YB7 A;  2EC2 A;  1LV5 A;  3C6U A;  1S57 A;  3TEH B;  3HHL C;  1CJV A;  3CNQ P;  2KG1 A;  3TI0 A;  1PBU A;  5KFW A;  3HSD A;  2YNG A;  3DRS B;  2YH0 A;  2BW2 A;  1T11 A;  1ACM B;  1N5Y B;  1UVL A;  3IAM 9;  2NQP A;  4F36 A;  2B4O A;  3EUN A;  5B0E A;  2FGO A;  1XEZ A;  1KOH A;  4ECT A;  2J5A A;  4ZCI A;  2V67 A;  2BE2 B;  1DLO A;  4DS4 A;  4OZL A;  2N7C A;  1FXD A;  2WOM B;  1WSR A;  4DR3 F;  5HMZ A;  4GO7 X;  2OEJ A;  3E01 B;  2VFU A;  5ETQ A;  1GMW A;  3A8I A;  3F56 A;  4DZ6 A;  4I1T A;  5FLX Y;  4RLE A;  1HBU B;  1R8B A;  3HKW A;  1UFL A;  2XY5 A;  3A8E A;  3M32 B;  1FK9 B;  2R7S A;  1LW2 B;  4WJB A;  4B9S A;  4NLT A;  1NKB A;  3QJL A;  4DV0 F;  4MMO A;  3QAU A;  3EGN A;  2GAG C;  4ZVQ B;  1UW4 A;  2W4C A;  1S1V B;  1X5S A;  1NUE A;  4NWB A;  1RT1 A;  3MM5 A;  3NCQ A;  4TU9 A;  3W8G A;  3I82 A;  1F5A A;  1KQF B;  2HHW A;  2L08 A;  5CXT A;  1FES A;  2BW7 A;  4DLG A;  3N28 A;  4QYZ J;  1SBR A;  4OI6 A;  4QJV A;  4FXW A;  3NGU A;  3UDV A;  2B9W A;  3T5H A;  5CA5 A;  1FHT A;  3FQL A;  4JI3 F;  4BBY A;  5DLG A;  3NAH A;  4LRF A;  2V4R A;  4WP8 A;  3HCX A;  2Z0G A;  4OYP A;  2J0Q D;  3JTN A;  1VQK S;  3W1Y C;  2NPF A;  4DR1 J;  4UY8 T;  2N82 B;  2B5J A;  2ZNY A;  2WSE C;  2QJ3 A;  4P2F A;  2BOA A;  2VC1 A;  5BYS A;  1SUQ B;  4AUK A;  2NXJ A;  2AYM A;  5KFO A;  2I5J B;  3QRP A;  1T9W A;  2W9C B;  1YJU A;  3J7Y I;  1T7P A;  3NS5 A;  4KQZ A;  2VH7 A;  3PHT A;  3Q0A A;  2LA4 A;  1VC6 A;  3V6H A;  1NZA A;  2OLW A;  3NRB A;  1GH8 A;  3CCS S;  1OO0 B;  1NJX A;  1RTZ A;  1FWK A;  3C14 A;  3ICL A;  4F02 A;  3P8B B;  3PX0 A;  4DWI A;  1L3V A;  2V68 A;  1BQN B;  3V4I B;  4JI0 J;  2PO4 A;  1TKT A;  1P27 B;  4RW4 A;  4FVM A;  1CJT B;  4NLQ A;  1TAU A;  3R6L B;  1DZ5 A;  1CQM A;  2RNE A;  3V4M A;  2XBP A;  3ZZP A;  2ZC4 A;  3A1Y G;  1NSP A;  3PYF A;  2A2D A;  3X1L B;  1GK8 A;  1BQM A;  5J1E B;  3JSM B;  3BSN A;  3NP5 A;  1YG0 A;  1IWA A;  4OZ0 A;  2AEJ A;  3NNC A;  1WUU A;  2DXF A;  2ZHB A;  4E0D A;  2NXN A;  3KLH B;  4QWE A;  2JRS A;  3VR1 A;  5ETV A;  1N5T A;  1PYO B;  2ACM A;  4ZKA A;  4DN0 A;  1X5T A;  4ZJQ A;  1HR0 F;  3R7N B;  4CO3 A;  2FVQ A;  2VBY A;  2W2M P;  4DV0 J;  1VYA A;  2R8G A;  3KUE A;  2M88 A;  4GKK F;  2YQ1 A;  1RAI B;  5F9L A;  1S10 A;  5F8I A;  1VQ9 S;  5J2P B;  5K9F A;  3T9N A;  1FRJ A;  3HX9 A;  2PII A;  5HLF B;  4NLY A;  1VDH A;  3BDP A;  2RE1 A;  1TKX B;  4USM A;  3CJR A;  2OIH A;  1S9F A;  4XTT A;  1T03 A;  4JBC A;  3GIJ A;  1M1H A;  3MD3 A;  1JX4 A;  2NXE A;  3IGV A;  4ENO A;  2DO0 A;  4HDG A;  5CCM A;  1RT3 A;  2DTJ A;  4CH1 A;  3MEE B;  1KQS R;  3M1V A;  1U1M A;  2XYP B;  1YSJ A;  3ENW A;  5LM7 E;  3D7S B;  2GC8 A;  1JXV A;  2I2Y A;  4FNI A;  4PUO B;  3EPG A;  2OPS A;  1WHV A;  3KLI A;  4LSN A;  2A3J A;  2VG7 A;  5KFZ A;  1VQL S;  4URS A;  4EZ9 A;  3B4M A;  3TAQ A;  3KLV A;  2DR8 A;  4JOU A;  2HND A;  3GYN A;  1XMQ F;  3TQ1 A;  4ZPB A;  3T5J A;  4FYW B;  3ETO A;  5A76 A;  1FJ7 A;  4NZ0 A;  4PEO A;  3H90 A;  2B8Q A;  2UUB F;  1VRU B;  2UVR A;  3I0R A;  1TK8 A;  2YH1 A;  4IG0 A;  2Z56 B;  3OFE A;  1D9D A;  1BC6 A;  2Z58 B;  2AGQ A;  1MMD A;  1Q78 A;  1RAG B;  1T05 A;  5EUH A;  5KFK A;  2BAC A;  4E2F B;  2HVH A;  1TR0 A;  2RUG A;  3JB9 k;  2IIH A;  2UXD F;  4F4W A;  2XNR A;  4DX5 A;  8RUC A;  5HMX A;  3THP A;  3S7R A;  3DLE A;  1YBA A;  2F3J A;  2M70 A;  3J80 U;  2PFF B;  1RAO A;  5KFY A;  1FNX H;  4ANE A;  3FNN A;  3Q8U A;  2F9D A;  2CYY A;  1W26 A;  3NCP A;  3AY0 A;  2H4W B;  3CC2 S;  2SXL A;  4N5S A;  3CE8 A;  4TQR A;  2V8H A;  4C8Z A;  3IRW P;  3BN4 A;  3EPI A;  1DFD A;  4L3K A;  2VFR A;  5C25 B;  1VRT A;  4OZ5 A;  3QPI A;  1V3R A;  1VRQ C;  2G2Z A;  2DGS A;  3ZZT A;  4N41 A;  4RWX A;  4RO0 A;  2ZKU A;  2CZV C;  3W7B A;  1PSD A;  2OJ3 A;  4ZA1 A;  2DO4 A;  3NCR A;  4Q7A A;  4LF8 J;  3L9Z A;  4WP3 A;  1NM2 A;  5IM0 A;  3MM8 A;  1RI7 A;  3FRZ A;  4YY3 F;  4U96 A;  3CSK A;  1X4C A;  5KG6 A;  1WF1 A;  4XPE A;  5IFM A;  2JHE A;  4PG7 A;  4WFX A;  2OP5 A;  1KEK A;  2FD2 A;  2M2B A;  3QSY B;  3QGG A;  5EX0 A;  4OZ2 A;  4DG1 B;  1OYD A;  2E44 A;  2DT9 A;  2ZOF A;  2N3O A;  5GVQ A;  3PJX A;  3E2E A;  3TOQ A;  4Z7Y A;  4B02 A;  1ZM3 A;  4J90 A;  4P72 A;  4NXN J;  2RQC A;  1FKA F;  4OI1 A;  1F5B A;  4UQG A;  3US5 A;  2Q79 A;  1WOP A;  1VQ5 S;  1IUJ A;  3C8Y A;  5E3R A;  1DTT B;  3EX7 B;  1YJR A;  4Z7C A;  2Z4P A;  4K8R A;  1U09 A;  2E1P A;  1SJ1 A;  2MGZ B;  2HS3 A;  3GFY A;  3D28 A;  1QY7 A;  3G8T A;  1LWF B;  1DAR A;  3CDA A;  1F9H A;  1HLW A;  5F3T A;  2XTJ P;  3EGZ A;  1VLO A;  1AUD A;  1OQ6 A;  2D1C A;  2MST A;  3MMA A;  1ZZF A;  1MRO B;  4JYA J;  2HS0 A;  1CC8 A;  2GHV C;  3FK4 A;  3POT B;  3UWT A;  2UXD J;  3D67 A;  2PT0 A;  2CZ4 A;  4G1I A;  4FF3 A;  1WDD A;  3L09 A;  5SZT A;  4YP3 A;  2HFZ A;  4H4O A;  5F0U A;  2C22 A;  2W4P A;  4KO0 A;  1H2V Z;  2FHM A;  3J7Z 5;  2EVZ A;  4O3O A;  4DQQ A;  2VQE F;  3F44 A;  2VIC A;  3FFI A;  2GIR A;  5A8K B;  5JVH Q;  3KDN A;  4X66 F;  3S6E A;  4NEZ A;  4Y0F A;  2RKI B;  4TLR A;  2EFN A;  1YRT A;  2LQ9 A;  4KGV B;  8AT1 B;  2NSC A;  3GWC A;  4R5P B;  2CKW A;  5IC4 B;  1X9M A;  4A8S A;  1V5V A;  3W5Z A;  2XS5 A;  2C42 A;  2QA2 A;  2COL A;  2C3Y A;  3M6X A;  4XDC A;  4ETZ A;  2NXC A;  5IT9 Y;  3OL6 A;  1XR6 A;  4DPO A;  1WKK A;  2HZA A;  3OVS A;  2XGQ A;  3QGP A;  2HYI B;  1RUS A;  4GVB B;  4DUT A;  5L1J A;  2GFF A;  2XHC A;  4I2P B;  1UMJ A;  1H7W A;  3H40 A;  1S99 A;  2E5G A;  3MUT P;  1S1U A;  4NA2 A;  3QGH A;  3AD7 C;  4IFV A;  2KFN A;  4OYM A;  2P9C A;  1RT4 B;  2OUG A;  1IR2 A;  2RH3 A;  2F1F A;  4DX7 A;  1L5U A;  2JZ5 A;  1NSA A;  3OTE A;  4LFB J;  1X0F A;  1KLN A;  2JL9 A;  1BHN A;  4CLK A;  1Y4Z B;  4RBU A;  1WHW A;  3LW5 C;  1GX5 A;  5T14 A;  2CXE A;  1HNI B;  5KG3 A;  1TU0 B;  1YLX A;  4DPW A;  4I64 A;  2CUY A;  3VF0 B;  4WKR A;  3DRP A;  2RF2 A;  5D3G A;  2YY3 A;  3SDE B;  2BKN A;  3O44 A;  4TLQ A;  2ASJ A;  2Y1R I;  3PW2 A;  1OJ4 A;  1ZAV A;  3IFE A;  1JLA B;  2DJW A;  4DX6 A;  2P5V A;  1T02 A;  1KON A;  1NCL A;  5DQG A;  1YI2 S;  4XIU A;  1WSV A;  3BRE A;  4WP9 A;  4AL5 A;  2EWH A;  3HHL B;  1RSC A;  1KFS A;  2VL1 A;  1KTV A;  3RBE A;  4U7U D;  1GTH A;  2IMO A;  1N6Q B;  1WEL A;  4IRD A;  2VQE J;  3I4H X;  2EC0 A;  1S6Q B;  4EMD A;  3BO4 A;  2LMI A;  1GXT A;  1TKZ A;  3BEG B;  3NOC A;  3R7B B;  4WE1 A;  2R8J A;  5U47 A;  3SQO P;  2JEJ A;  1YQH A;  3MTJ A;  5KG2 A;  3NMR A;  1S49 A;  4CTA A;  1NHU A;  3DRX A;  2AGP A;  2MY7 A;  2ZFH A;  4EYH B;  1CJK A;  1SI9 A;  3I6P A;  2MKI A;  1N48 A;  4KV8 B;  4TU7 A;  5F8J A;  2MKH A;  3ZZZ A;  2XC9 A;  4LF5 F;  1JLF B;  2RD5 C;  4NYO A;  2BR0 A;  3KK3 B;  2E7X A;  1IR1 A;  2KO1 A;  3WQP A;  3W2W B;  4ID5 B;  1H73 A;  2CAJ A;  5KT7 A;  4Z37 A;  4R8U B;  4CZC A;  2X3D A;  4FF1 A;  1M1K T;  3CDE A;  1HIY A;  4CYU A;  3FSI A;  1R0C B;  4DL2 A;  5THW A;  3PO4 A;  2YTC A;  2VU5 A;  3KWM A;  4ED6 A;  3CJ0 A;  1JLB A;  3HKZ D;  2HFS A;  3GJQ B;  3NOG A;  1IN0 A;  4ECV A;  2RHS B;  1Q79 A;  1OY6 A;  5J2M A;  2KJV A;  2APO A;  3DHX A;  3N79 A;  5MLC V;  2M3D A;  1SKR A;  4ZN3 A;  5CD4 H;  4EUV A;  2AYE A;  3TUJ C;  1U2C A;  2R4F A;  2CJY B;  3R5B A;  4ZVP B;  1HWI A;  4K4T A;  2E9R X;  3HFV A;  3FC9 A;  4OLO A;  3FBB A;  1Y9O A;  3MR7 A;  4W92 B;  3T41 A;  3G6E S;  2XCA A;  4F0M A;  3DYA A;  2LXU A;  4L73 A;  2F40 A;  1VMB A;  3W66 A;  4UOF A;  4RUH A;  2R2S A;  4UTG A;  3R5G A;  5HP1 A;  3FQK A;  2J7W A;  2M9K A;  2CJX B;  1WC1 A;  4F4A A;  2C2E A;  4ZK7 M;  2HHX A;  3M8P A;  5DGB A;  4HTI A;  3HJV A;  4N8O A;  4DXL A;  5K5M A;  4BWM A;  2R8H A;  3TW0 A;  3AD9 C;  2VON A;  3KG4 A;  4QU6 A;  2K06 A;  3EVM A;  2WOM A;  2BE7 D;  2HEK A;  1APS A;  1R0A A;  3CJK B;  2LQJ A;  4B9N A;  2BDP A;  5KFR A;  3AQP A;  2OTL S;  3LAN A;  3OV7 A;  4LFC F;  2Y1J A;  1VK3 A;  4CCH A;  3R2C J;  4QPX A;  4D3H A;  1TMJ A;  3MM7 B;  4LF5 J;  2LVW A;  2V8G A;  3NS6 A;  2CQC A;  3G6V A;  1FER A;  2HQC A;  3FSX A;  1IKY A;  4P71 A;  2FVS A;  3HVT A;  3BQ2 A;  4DFJ A;  2BXJ A;  4WIQ A;  4CO2 A;  1SJQ A;  4RUC A;  1CUL B;  5ITH A;  4B3T J;  2IVY A;  3H5X A;  2CQ3 A;  1X0P A;  3ULH A;  2FC9 A;  2AJ1 A;  4KJI A;  1BY9 A;  1R31 A;  1U25 A;  1J5O A;  3ISN D;  4M5M A;  3ZXW A;  2UZA A;  3K58 A;  3F41 A;  2XYG B;  2V9K A;  2G1H A;  3DKD A;  4C9D A;  2K3I A;  4LVN P;  5KFT A;  4PQU A;  1U1O A;  2BYC A;  1Q7Y T;  1AB8 A;  4MKY A;  4ES2 A;  2AW0 A;  3PAC A;  4ZHR B;  2R2U A;  4ANC A;  1I1G A;  2ZH6 A;  1E6V B;  1A0O B;  3ZNU A;  4ECS A;  3CJQ A;  2C1E B;  3TAM A;  3W9J A;  1BUX A;  4QR1 A;  3T1Y F;  4H4M B;  2EKY A;  4X2B A;  5HQL A;  3I0S B;  2LQ8 A;  5KFA A;  1FE0 A;  1LK7 A;  4B3M F;  2GML A;  4XAK A;  3GCW P;  2DGQ A;  2C3M A;  4HYK A;  1R8P A;  3GE9 A;  2WW8 A;  5AXL A;  3TJ9 A;  1D9A A;  1U0H A;  2VG5 B;  4F04 B;  2OMO A;  3EDR B;  1NME B;  3HM9 A;  4IR9 A;  4JI6 J;  2HSE B;  2V2Q A;  3TZX A;  1NKE A;  2JWN A;  4AXJ A;  1M5O C;  3JAM Y;  2GVD B;  2E5H A;  1IKX B;  1VLY A;  4ICL A;  1GTE A;  2RDI A;  2H4Y B;  4DSF A;  1VBX A;  2IRX A;  1BQN A;  3M2R B;  1N56 A;  2FHJ A;  4J9U E;  2MQL A;  1D3W A;  4CQ1 A;  3KLE A;  1C4C A;  1BWV A;  4QIE A;  3HHN B;  2Y3Y A;  1JLQ B;  3KHG A;  1WOS A;  4HL9 A;  3WHI A;  1FXR A;  1REV B;  2OD6 A;  2F8H A;  2DGV A;  2GJI A;  1FRK A;  1QAI A;  5GAE U;  1TKD A;  5GME A;  4YUD A;  4BC7 A;  2DPJ A;  1RT6 B;  3NBP A;  2FVP A;  5T41 A;  2WON A;  2IMW P;  4EBC A;  3RB6 A;  4I6Y A;  3KHH A;  1C0U A;  3N0V A;  3GR1 A;  4A8Q A;  2XM3 A;  3N6L A;  1IBL F;  3NL0 A;  3MM6 B;  2UUA J;  1S0N A;  4DR5 F;  2OHD A;  2ZBQ A;  3HVW A;  4RBT A;  1HW9 A;  2NRE A;  4P74 A;  1TUG B;  3OFF A;  1L3K A;  1WJ9 A;  1AFJ A;  1NH7 A;  2VAS A;  1EET A;  1I6J A;  4ZVU B;  2DIT A;  4QBU A;  2GW8 A;  4AD6 A;  4M5G A;  1CS4 A;  3J7A 1;  3C19 A;  1FXL A;  4XDD A;  1FKP B;  4Q44 A;  2MKY A;  3OLA A;  3A13 A;  3KTQ A;  1S1X A;  3NGT A;  3T1Y J;  3MEC A;  4PQA A;  2JC1 A;  1WKL A;  2NZC A;  1SJ4 P;  3EVW A;  4JI5 F;  4B3M J;  3QZ7 A;  2EKN A;  5C2C A;  3LPY A;  3JXO A;  1N5V A;  5CH7 B;  4EBE A;  5I3U B;  4F4X A;  4CLS A;  3CD5 A;  2DNK A;  3D0G E;  3I87 A;  5LXR A;  3MED A;  1EHW A;  2H1Y A;  4AFF A;  1NEE A;  4S0M A;  4FS2 A;  4DF4 A;  3DLG B;  3DMJ B;  2OFG X;  4C0H A;  3BB5 A;  3P4U B;  5B7W A;  5DDO C;  1NND A;  5L38 A;  4M5D B;  2DGU A;  4KH1 B;  3W63 A;  1RT7 B;  2HLT A;  1TUV A;  5CYM A;  4AQY F;  1WOR A;  3CCZ A;  2PC6 A;  2HQD A;  3RBX A;  1JXL A;  2JH3 A;  2DGX A;  4R0J A;  3M9N B;  5KFE A;  4FN5 A;  3VHQ A;  2GO8 A;  3OTB A;  2XLK A;  4IH7 A;  3UNG C;  1U0S A;  2E5J A;  5AJ3 J;  1N8R T;  1FDA A;  2ZH1 A;  4CLP A;  4GC7 A;  4M5J A;  2V8V A;  5HJX A;  1NPK A;  1NXI A;  3KUG A;  2WB4 A;  3DM2 B;  5HVF A;  3H5U A;  2FJV A;  2VJU A;  1F5C A;  3HK2 A;  4C0O C;  2XG8 A;  2ASL A;  2Z30 B;  3QZ8 A;  2PGC A;  2HAF A;  4JI4 J;  3R7S B;  2LFV A;  4QOT A;  3W65 A;  1BMQ B;  1K73 T;  2CVE A;  2FLN A;  1XK8 A;  4RNO A;  1BQX A;  4LUB A;  4ES3 A;  4P73 A;  2CZ9 A;  5FLX U;  1HPZ B;  4WBF A;  3GG1 A;  3HXM A;  3BKF A;  1QAX A;  2V4J A;  3ZTQ A;  1VIX A;  3MOJ B;  1JNZ B;  4FPR A;  1S6P A;  1N4L A;  3BM7 A;  3CW2 C;  5H9F K;  4C11 B;  4CP5 A;  4F26 A;  2Q1L A;  3I5B A;  4QW8 A;  5KFC A;  1WKJ A;  1F0X A;  2OPP B;  4ZS6 A;  4O4G A;  4OX7 A;  2K2P A;  2VOD A;  1FDB A;  1ELO A;  2HS4 A;  1JJ2 R;  1K1S A;  3G4S S;  1RT5 A;  1XMO J;  4C0B A;  3TA2 A;  2XEX A;  1DQA A;  1QSS A;  3T9Z A;  4OYI A;  1T3O A;  2MLZ A;  4DPY A;  1O6X A;  3UO0 A;  1UEK A;  2IJR A;  4F2S A;  3IXQ A;  4LQ9 A;  4LMZ A;  3R5J B;  4LIW A;  2L41 A;  1S9E A;  1RHM B;  2MYF A;  1YIJ S;  2M8H A;  1RT2 A;  4KAI A;  4Q0B A;  3OTO F;  2XMW A;  1KD1 T;  1RHQ B;  2V94 A;  5HMY A;  3CJ5 A;  4NRU A;  2FJE B;  4IQM A;  1U8W A;  3KUH A;  4KKO A;  3LP0 A;  3MXH P;  1NK7 A;  1TV6 A;  3ET6 B;  3C2P A;  5A8R A;  1NPR A;  2FZC B;  1FRI A;  2UUT A;  2EBE A;  3W5Y A;  3Q24 A;  5I42 B;  3JYT B;  2QN6 B;  1FDN A;  5EN1 A;  2Q6C A;  2R7U A;  2VIH A;  2R7Q A;  4DQS A;  2DNM A;  3IWN C;  4NCA A;  1UZH A;  3OVA A;  1HQE A;  2XZW A;  5JUM A;  1ZA1 B;  1MN7 A;  5C42 B;  4KPY A;  2EBG A;  4MK8 A;  3HP6 A;  4OL8 A;  4X4P A;  5DM6 Q;  3H42 A;  2MHN A;  1O51 A;  4DL7 A;  2KH9 A;  1R6V A;  3IP0 A;  1RHK B;  2XB2 D;  1WD6 A;  2QX0 A;  1C1C A;  3NGR A;  3R3T A;  2E9T A;  3D66 A;  4RZR A;  2HAI A;  2XCP A;  3R5C A;  3RW6 A;  4CH0 S;  4G1Q A;  2Z57 B;  4DV2 J;  3N4W A;  2Y0S D;  2RSQ A;  1FNO A;  2AV5 A;  3CIM A;  2QV6 A;  2L9N A;  3D4J A;  4O23 A;  3R9L A;  2H9Z A;  4CWB A;  1C2P A;  3G86 A;  1SC1 B;  4MTP A;  4KHR A;  4ILR A;  3SIP B;  5KFD A;  2XUL A;  4JUZ A;  2VB6 A;  1CC7 A;  2G4B A;  2JEI A;  3D68 A;  5H9F J;  4I2P A;  2DNP A;  2H65 B;  1VQP S;  1IBC B;  2KRR A;  3H2U B;  2AX0 A;  5E33 A;  1WC3 A;  1OS5 A;  3AA8 A;  5B0A A;  4NL5 A;  1ZTT A;  1YKW A;  4DR4 J;  3N9U C;  4MJK A;  5FDL A;  1ZTW A;  4WII A;  2B6A B;  3UPF A;  1L3T A;  2B4P A;  3C16 B;  4F3M A;  4RNM A;  4FYD A;  5T7L B;  4B9M A;  5KFV A;  2QA4 G;  5G0R A;  5LJ3 Y;  1RTJ B;  2XO7 A;  4QIV A;  2X7I A;  5EDW A;  3MHY A;  3AB4 B;  3LP1 A;  4PWW A;  4FKY A;  3P49 B;  4EU0 A;  2RIJ A;  4CIO A;  3CDW A;  2DEJ A;  2RIL A;  2ROG A;  4F3O A;  2XZT B;  4FPI A;  1X4G A;  1X5O A;  3T1A A;  1XNR F;  1KNZ A;  3SSR A;  1LWE B;  1T95 A;  1IBM F;  4P2S A;  2UXC F;  2V69 A;  2AJF E;  4J9L A;  4M5N A;  3FEY B;  3BBF A;  3W9I A;  1KVI A;  3OXG A;  3B6B A;  1V3Z A;  2HBZ B;  3PEH A;  3BO3 A;  1SKS A;  4HDH A;  2CPZ A;  2X1A A;  1TL7 A;  1WNE A;  3KLG A;  3VAJ A;  4QCL A;  4DSK A;  2B4U A;  4MIB A;  3T1H F;  2XMM A;  3FEX B;  2ZOG A;  5K14 A;  4F4Z A;  1S7I A;  2YWK A;  1HQU B;  3LQV A;  4NLP A;  3GR0 A;  5L1I A;  1Q4R A;  2ZE2 B;  1FEE A;  1RTH B;  2KT3 A;  2YKM B;  3NG8 A;  3FVY A;  2VA2 A;  2WSF C;  2XI2 A;  2QYC A;  2XY7 A;  4CH7 A;  3HHE A;  4DV3 F;  2HNY B;  1N88 A;  5EWE A;  2YNH B;  2DGO A;  4NML A;  2CPH A;  3IS9 A;  2QYG A;  4KIA A;  4WU3 A;  1VQN S;  2ZVS A;  2HHU A;  5KT2 A;  2ZH5 A;  2MXY A;  3EYZ A;  5DS7 A;  3SCL E;  1VQS A;  1RWV B;  1M1G A;  3A3N B;  1VIO A;  2VFS A;  3MAA B;  4U95 A;  3OJU A;  4ED0 A;  1J5E F;  4OYO A;  4Y2M A;  2Y0B B;  3RRK A;  4UZC A;  2AIR B;  3FZB A;  1NKC A;  4W98 A;  3M8S A;  1FE4 A;  3DGP A;  2EFO A;  3MGJ A;  3VQT A;  2U2F A;  2E7W A;  4MKA A;  3DI6 A;  5HO4 A;  1C4A A;  1Y00 A;  3G87 A;  2CPJ A;  3AQO A;  2B7B B;  3ZTO A;  3PRV A;  5KG1 A;  1VHF A;  4NZ7 A;  1HKA A;  2DY1 A;  2CPI A;  2DD8 S;  3GV8 B;  1FRH A;  4O0N A;  1B0V A;  1SQG A;  1FCA A;  2OPQ A;  1WC6 A;  1UP1 A;  4O44 A;  3WIU A;  3M8Y A;  2GZO A;  3O2I A;  1WDT A;  5JJB A;  4DEZ A;  3W5X A;  3IWX A;  4JV0 A;  5IT0 A;  3IAS 9;  2AX1 A;  4C3M A;  4ED2 A;  1FX2 A;  2HVD A;  2QLW A;  2IBO A;  5DDP C;  1X4D A;  2EFG A;  4J9S A;  3VAM A;  2BX6 A;  5B08 A;  2DHS A;  2CPX A;  4TY8 B;  5K8N A;  2C28 A;  1SQF A;  1AZS B;  3FEZ A;  3LGM A;  2VPZ B;  4DV1 F;  1XNR J;  3PFE A;  2V8D A;  2HHH J;  5F8N A;  3LP2 A;  4IQX A;  2PD1 A;  3SV3 A;  2UXC J;  2IVF B;  2Y9H A;  1H7X A;  2E5L J;  3K5M A;  2HNZ A;  1RJJ A;  2W8K A;  2YQ3 A;  4PG8 A;  2FZG B;  3GZ7 A;  2IBK A;  4ZN1 A;  5LOQ A;  2F4V F;  3LGH A;  1UFW A;  4IDK B;  4CM2 A;  4JI7 F;  3BSA A;  2OEM A;  1FFW B;  2KU7 A;  2XS7 A;  1N5S A;  1QTM A;  1FTR A;  1T9T A;  1SVD A;  3PJ9 A;  3D0I E;  1IJF B;  4P2M A;  1S9G B;  3BF4 A;  4RW6 A;  4AXI A;  2DNL A;  2ATL A;  4QR0 A;  5BXI A;  2R3V A;  5HL7 Q;  1FJC A;  4DV3 J;  3CD6 S;  2KT2 A;  3M7V A;  1XC9 A;  3V6D B;  2XI3 A;  3KDO A;  2WVE A;  2HBQ B;  2LEC A;  1URN A;  1U48 A;  3B82 A;  1HNV A;  2BQ3 A;  2LU1 A;  3FSY A;  4KT0 C;  2FUG 9;  1IBK F;  3K8V A;  1VQ4 S;  4B3R J;  3GV7 B;  3QLH B;  3H2L A;  3KK1 A;  3UCZ P;  4DUZ F;  1NSK L;  3HMJ G;  5IT9 U;  3MMB B;  2PI4 A;  1D8Z A;  4B9L A;  4FXV A;  1C0T A;  3BBC A;  3Q23 A;  1YTY A;  3CGI A;  2D3O R;  2I0X A;  3OUY B;  3WC2 A;  3NGK A;  3LAL A;  2DB1 A;  1RTD A;  4OHX A;  4FBT A;  1MG7 A;  1S0V A;  1BE4 A;  2FHJ D;  3M4X A;  5ETK A;  1C1B A;  1YGY A;  4K4W A;  2JOQ A;  1U49 A;  5LMU F;  3OPK A;  1NJY A;  4P7T A;  1U1Q A;  1R8C A;  1HBM A;  3BZQ A;  2DR9 A;  1E6Y A;  2WCX A;  1R7I A;  5JVG Q;  5IV4 A;  2KFY A;  2Q66 A;  4M5H A;  1W7W A;  4GC6 A;  2WAQ D;  1MSW D;  2RQK A;  1U1R A;  3KNA A;  4DV1 J;  1DTQ B;  2ZUG A;  4F2R A;  4LFA F;  1YJ9 S;  2GVZ A;  5DJB A;  2HWT A;  1WC4 A;  3TVY A;  4A8M P;  3W61 A;  3KXD A;  3K5L A;  2LEA A;  4F8R A;  1FKO A;  3M2V B;  2OH2 A;  4YDX A;  3ILO A;  4X65 F;  3QAE A;  4JI7 J;  2VV5 A;  5KG7 A;  2OD4 A;  3Q89 A;  1UVI A;  2RT3 A;  2P9G A;  3TAR A;  2C3O A;  3GP9 A;  4Y34 A;  2W24 A;  1Q86 T;  1GXL A;  1RA7 A;  3UN2 A;  1V5I B;  3U27 A;  1N36 J;  3HDS A;  1UPP A;  3ITH B;  4IG3 B;  3Q22 A;  2W7A A;  3MEK A;  4DZD A;  2YNF B;  5DDR C;  3GFX A;  3EMT A;  2POK A;  4FNH A;  4DCJ B;  1GFW B;  1VHI A;  1H6K X;  1JK9 B;  2KRB A;  1G7C B;  5DDQ C;  3M9O B;  1PBA A;  3TX0 A;  4HTJ A;  2IJF A;  2HRU A;  1XN9 A;  1PJ5 A;  4EBD A;  4DR7 J;  4OHZ A;  4BS2 A;  4M94 A;  5G4D A;  2R2T A;  4K5R A;  1JQG A;  5ETP A;  2QSW A;  5CAA A;  3PW5 A;  1WC5 A;  3IG1 B;  3KG1 A;  2PA3 A;  4DDF A;  5C24 A;  1VQ8 S;  2LYV A;  4E8U A;  1XJW B;  4DUZ J;  1HWK A;  2BJE A;  5CYQ A;  3R1H A;  1M90 T;  1OSC A;  2HQ3 A;  1R8H A;  2YWH A;  1QUP A;  1Q95 G;  3IMQ J;  2IHR 1;  4TU8 A;  3CCE S;  3CED A;  1ZYQ A;  4OV1 A;  4DQR A;  3T5L A;  1U02 A;  1AW0 A;  2KHD A;  2DNR A;  2E1M C;  3DOL A;  5LMU J;  3PYD A;  2VG6 A;  4LBI A;  2YKO A;  3R6G B;  3QT5 A;  2RRN A;  2M8D B;  1S1T A;  3EZO A;  4YN3 B;  3HD2 A;  4FYV B;  4OHW A;  4DPU A;  1I3O B;  4LR9 A;  4KYZ A;  4KR0 B;  1I94 J;  4NLW A;  1IKV A;  4I2Q A;  4ECX A;  4FP9 A;  2FVC A;  4PWD B;  5DLF A;  2M4M A;  2VQF F;  2E1R A;  1SJR A;  2AJ4 A;  3CMA S;  2NSB A;  1JLC B;  1NDP A;  3DLK A;  2ZBC A;  2W25 A;  4LFA J;  3CJ4 A;  3ZZO A;  2L9W A;  2MZQ A;  4HAC B;  4PCQ A;  1FWL A;  2ADB A;  4O3N A;  2NXU A;  5HBM B;  1HBN A;  1RHR B;  4RNF A;  3HF5 A;  3IA0 A;  4ERD A;  1CVJ A;  2UUW A;  1Y3K A;  2ZD1 A;  4ZPC A;  1EKR A;  4ZIV A;  4X65 J;  1N5Q A;  2A6O A;  2KL8 A;  5B0C A;  4DL6 A;  1QAY A;  1ITP A;  1OQ3 A;  3UW1 A;  2LU2 A;  1M5H A;  3QWU A;  3JQM A;  4B08 A;  2AHO B;  3KKF A;  4MH8 A;  2ERR A;  2OPR A;  1KC8 T;  2IC3 A;  2LXI A;  4IOB A;  1CJU B;  2HRY A;  2W2P P;  5DQH A;  4RW7 A;  2PFD A;  1MML A;  1NO8 A;  1IR0 A;  1T9V A;  4LF4 F;  1HL6 A;  1S59 A;  3CCL S;  3C15 B;  3SQG A;  4RL1 A;  4YB6 A;  2JEF A;  2D7S A;  2YKN A;  5J2N A;  1HWJ A;  1UWB A;  3M8Q B;  4WXW A;  2DRD A;  3X3U A;  3A3O B;  1JKH A;  2V2K A;  4KFB B;  5IOL A;  2K7J A;  2RU9 A;  3L4B C;  1XMB A;  3FZ2 A;  1LNQ A;  4WFY A;  2NPI A;  2AZ1 A;  2W7P A;  1HMV A;  3HHD A;  1Q81 T;  1YRU A;  2HKE A;  2C2M B;  4UOG A;  1X4A A;  2CJK A;  2UXB F;  1PKU A;  1TK5 A;  3DU6 A;  3CJ2 A;  2HQF A;  4F3Q A;  5L1L A;  4ED5 A;  3LAK A;  2QFJ A;  5L9X A;  3TZY A;  2DIU A;  3DGV A;  4NLR A;  3RJM B;  4LSL B;  3KHL A;  3G71 S;  2QMW A;  2XSJ B;  1T8E A;  4OI2 A;  1AFI A;  1X31 C;  3UVJ B;  4B3O A;  4RW9 B;  3TJA A;  4OX8 A;  2HMI A;  5FII A;  2VJV A;  2I6W A;  4Q8F A;  4DHV A;  2I1R A;  2KI2 A;  3IM9 A;  3SSQ A;  2Q43 A;  1Y10 A;  2PMW A;  4ZCL A;  3NEK A;  1EP4 B;  2R2R A;  5KG0 A;  2KM8 B;  4TQS A;  1D1U A;  2WZ1 A;  1LXJ A;  3V81 A;  4I7F B;  2DXE A;  5KFS A;  2NYI A;  2VQF J;  3RG6 A;  1LW0 A;  2A18 A;  1Y0H A;  4OJ3 A;  3H2V E;  2HBR B;  2CPE A;  2KT5 A;  5A0Y B;  4X62 F;  1SCJ B;  1JLG A;  2CQ0 A;  4RNH A;  2BVZ A;  3ZZU A;  2MKJ A;  3SI8 A;  5DRK A;  5JMN A;  1JLE A;  4RNN A;  1TL3 A;  3MR2 A;  1DBD A;  3RRG A;  2RAQ A;  2FY8 A;  3S8S A;  5D8H B;  3DHW C;  2H51 B;  4ED7 A;  5KTQ A;  1T0T V;  4I69 A;  5E41 A;  2R7V A;  3AXM A;  5GAH I;  3NLC A;  3NXZ A;  3J7A N;  2EFP A;  2MEW A;  1B99 A;  3JAM U;  8ATC B;  2MQO A;  4HVZ A;  4M1K A;  5HRO A;  4NLO A;  3K5N A;  2J9C A;  1IKW B;  5B0F A;  2GMJ A;  4K59 A;  2V6A A;  2BUN A;  4NI2 A;  3SSS A;  3QSI A;  3I4P A;  1QVF R;  4DR1 F;  3VZH A;  1SV5 A;  2D74 B;  2QLF B;  7FDR A;  3QJP A;  4JV5 J;  3TUP A;  2O5D A;  3KJV A;  4F67 A;  3O6Q A;  2KG0 A;  2FYX A;  3ISZ A;  4GVL A;  4OLP A;  5E3C A;  4U8Y A;  3DOK A;  2QGF B;  2YWF A;  4IFY A;  1WHY A;  2YVS A;  3KJN B;  1P8G A;  2YNI B;  1EX8 A;  4NXM J;  2CQD A;  3DRR A;  2KN4 A;  2FVR A;  3SBM A;  1KTQ A;  1WG4 A;  4JI0 F;  5B09 A;  2YXL A;  1U24 A;  3VAK A;  5F41 A;  2FPH X;  2PDA A;  3BGL A;  3G82 A;  3A8J A;  1S1W A;  2UXB J;  5FJ4 A;  2ILZ A;  1HWL A;  1YRX A;  1NK0 A;  4DUY F;  3R5D A;  2UU9 F;  1U1K A;  2ZZM A;  2KXN B;  1TL1 A;  2QIF A;  3W60 A;  1CJV B;  2QL7 B;  2VF3 A;  3OSP A;  4AND A;  5KFQ A;  2FJW A;  4DCP B;  5HMW A;  1LWC A;  2YNG B;  3FUY A;  3GLJ A;  1UVJ A;  1KQK A;  4IR1 A;  3Q2S C;  2CQ1 A;  3ENQ A;  4K4V A;  2E9Z A;  5LT5 A;  1EZZ B;  1XTZ A;  1DLO B;  1OY9 A;  3RBD A;  4ECR A;  2E1A A;  1QLN A;  4W4M A;  1SC4 B;  1HBO A;  2QEX S;  4NA3 A;  4X62 J;  4DV7 F;  2J7K A;  3DOM A;  3G9C A;  1V3S A;  5M2R A;  3UD3 P;  1QM9 A;  4N77 A;  2LKZ A;  4C2M A;  4F0H A;  2WSC C;  3PW0 A;  3R97 A;  1RT1 B;  3MM5 B;  4YHH F;  3EZ5 A;  3UN5 A;  2BKP A;  4BHQ A;  3MWB A;  2BBE A;  4ECZ A;  2X51 A;  1QE1 A;  2F5G A;  1YBU A;  1RU2 A;  4ETX A;  2W4D A;  4G1P A;  4ZLL A;  4C8O A;  4L76 A;  4A4J A;  1SC3 B;  3GSI A;  4USW A;  3KK2 A;  1F1B B;  2HGM A;  1P9Q C;  3PKM A;  4NCG A;  3KOA A;  2AJQ A;  4O3S A;  3EVO A;  2GMH A;  2B5J B;  1JXE A;  3IO1 A;  2LDI A;  3DXB A;  2BJD A;  1ROF A;  1QSY A;  4HH1 A;  3B78 A;  2HK3 A;  2XY6 A;  3CVK A;  4DUY J;  2MQN A;  4XO0 A;  2UU9 J;  3C14 B;  2ZNZ A;  1VGY A;  4RU2 A;  2R8I A;  5M2U A;  1KQG B;  2ZDO A;  2DNZ A;  2UVW A;  1PIE A;  1TKT B;  3VAF A;  1EAY C;  4I4B A;  3M9M B;  1BWE A;  1CSJ A;  4RW4 B;  4ZPD A;  2OKQ A;  1ZOT A;  2RML A;  3R27 A;  3RB0 A;  1HD1 A;  3T6J A;  3BSO A;  3H0P A;  5D0R A;  1ULR A;  3AOD A;  2QZ8 A;  1JIH A;  1S72 S;  3LPE A;  3EXC X;  1HNX J;  2DRB A;  4M63 A;  1BQM B;  2EXU A;  4M5I A;  1GT8 A;  1GEH A;  1H0H B;  1FNM A;  4KH0 B;  3ILI A;  2ZH7 A;  2A0F B;  4NLV A;  5GAG U;  3GJR B;  4DSL A;  2KYZ A;  4QR2 A;  3M30 A;  4DV7 J;  1HQ2 A;  1GMV A;  3ZC4 A;  2G0C A;  2HHV A;  2Y1L B;  4DV4 J;  1WG1 A;  2QT7 A;  1R27 B;  2DVI A;  4ZDN A;  1WF2 A;  1KLM A;  4LF8 F;  1GMU A;  1TVR A;  3R1L A;  4C3L A;  1LFW A;  4EZ6 A;  3PKY A;  3PW7 A;  3MEG A;  1VJQ A;  4LF1 A;  4YHH J;  2R9L A;  3GJT B;  4L6V 3;  2C3P A;  5KT6 A;  2DEI A;  2A6M A;  1XQI A;  1RHJ B;  4TVA B;  1N0V C;  4TNO A;  1B64 A;  3MMC A;  2EK1 A;  4RW8 A;  1RZM A;  2RB7 A;  4H4K C;  1T03 B;  2ZEJ A;  2O66 A;  2OO4 A;  3CCM S;  1N33 J;  3OVB A;  1GAO A;  1X4F A;  5BR8 F;  1FX4 A;  4QYR A;  1DY3 A;  2D9O A;  3BR9 A;  4QZV B;  4NXN F;  5DZ6 A;  1RT3 B;  2HFU A;  2XMK A;  1R0B G;  5HI7 A;  3M1V B;  2MJU A;  5ETM A;  3BN7 A;  1YHQ S;  3HT3 A;  1RAA B;  2OPS B;  2R8K A;  5KG4 A;  1RAJ A;  3KLI B;  2VG7 B;  2GS8 A;  3I31 A;  1SKW A;  2ZH9 A;  4QWB A;  3K57 A;  3ETM A;  1UCN A;  5BYQ A;  3JS9 A;  2HND B;  4N76 A;  4JYA F;  4YR0 A;  1B7F A;  1XIQ A;  3TA0 A;  5K8O A;  1RAH B;  4X64 F;  3CPW R;  1LKZ A;  1Q82 T;  4B17 A;  3PYG A;  3DC2 A;  2VPY B;  1YDL A;  1Q1K A;  2D69 A;  2E1C A;  2GHW A;  2JSX A;  3K0J A;  3I0R B;  2H3E B;  4DI6 A;  3EM1 A;  5AXK A;  2LA6 A;  3MMB A;  4ZVG A;  2RUS A;  4HHJ A;  1T05 B;  1P6T A;  4KGM A;  1U4B A;  3TX8 A;  4X4O A;  1TQL A;  5LSL A;  3D6F B;  1NLK L;  1YJN S;  1WG5 A;  3QFW A;  4DL3 A;  2FLO A;  2DNO A;  2GV1 A;  4LJM A;  4L75 A;  2CQG A;  1RU1 A;  3OR1 A;  3DLE B;  1RE1 B;  4MK7 A;  2OEL A;  2FLP A;  3W2V A;  2CQ4 A;  2R7T A;  3L7P A;  1RKJ A;  4NMX A;  1R3N A;  3I96 A;  1CPZ A;  5E0O A;  3S01 A;  2J0W A;  2YQ0 A;  2KZM A;  3HD1 A;  2QSF A;  1SL1 A;  4WK1 A;  4ECU A;  2MQQ A;  2IM2 A;  2GCF A;  4WYW A;  2YKQ A;  3WC0 A;  2ZKT A;  4PR6 A;  4RWW A;  2ZH4 A;  4ELU A;  3HSG A;  3KMS A;  1K9M T;  2LEP A;  3OD2 A;  3OLB A;  1WI6 A;  2UV8 G;  4UUX A;  5HSP A;  2KKH A;  3Q8P B;  5IXU A;  3TRG A;  4ZVR B;  1U6F A;  1B0T A;  3C6T A;  1RP5 A;  3AA9 A;  1IQT A;  4LFB F;  2ZM6 F;  4H54 A;  3TZW A;  5IM0 B;  5BR8 J;  3M8Z A;  4DFK A;  2NCK L;  3MM8 B;  3P5T L;  2BQU A;  4O4R A;  5D0H A;  4K2J A;  2MY8 A;  3RGI A;  1S12 A;  4QIG A;  3I55 S;  2DR6 A;  3OL9 A;  4ZVS B;  2JNJ A;  4QQB A;  4TYB A;  4E98 A;  2RS2 A;  1NK6 A;  5KFM A;  1Q8K A;  1VS3 A;  1D09 B;  2HUR A;  3GMG A;  3ADA C;  1YJV A;  2YNF A;  2R7O A;  1FVS A;  4YDD B;  3UCG A;  5DG8 A;  4ZP7 A;  1RWM B;  3BYP A;  3RB3 A;  3GG0 A;  2HHQ A;  4UOC A;  2HGL A;  4KPC A;  2Z2Z A;  4X64 J;  4DJB A;  4HHH A;  4F25 A;  3BDE A;  2J9E A;  2HWH A;  3PZP A;  3C3L A;  3VZI A;  1OY8 A;  2HK2 A;  5BJR A;  2Y8W A;  4OIX A;  1PJ7 A;  5L9N A;  2VC0 A;  3DLH A;  4B3S J;  4JP8 A;  1FFG B;  4HT7 A;  3CF5 Q;  4UT4 A;  2GGP A;  3MMA B;  3GFZ A;  3O1L A;  2BJ1 A;  3C66 A;  2HHP A;  1J2V A;  4CLY A;  5A8W A;  4DFM A;  2PMZ D;  4X4T A;  1FVQ A;  5GAD U;  2L9D A;  4H4O B;  2DNG A;  4WTY A;  3MR6 A;  5D4P A;  4WZQ A;  3G8S A;  3VGS A;  4QW9 A;  3FFI B;  3VWS A;  2HHT A;  1MW7 A;  4O3R A;  1RXO B;  3JSY A;  1GXU A;  4KSE B;  2IRY A;  3EIC A;  1H3D A;  4J9O A;  3CJ3 A;  5KFN A;  1RWO B;  1TL4 A;  1KN6 A;  1OMS A;  5D4N A;  2IDL A;  3MAQ A;  4LF9 F;  3PG9 A;  5E5N A;  4KGZ B;  2EI5 A;  2O67 A;  1UET A;  3G6Y A;  4CNY A;  3MM9 A;  3QO9 A;  4X4R A;  5D15 A;  1MLA A;  1MNE A;  4WZM A;  2ZM6 J;  2IAJ A;  7FD1 A;  3Q8V A;  2W9B A;  1WWH A;  4ZPA A;  4ZJO A;  1VOM A;  4IRK A;  5EX3 A;  3Q8Y A;  2VA3 A;  3SFG A;  2OTJ S;  4K4U A;  2VD3 A;  2B9E A;  1Y3J A;  3MPV A;  3P96 A;  1M5S A;  1S1U B;  3ENA A;  4UST A;  4F4K A;  4IFV B;  2ZWP A;  2CFX A;  4YQW A;  1W2B R;  4WTO B;  2L48 A;  2IA6 A;  2A10 A;  3BR8 A;  2CJQ A;  4ZVE A;  3LOU A;  1NPP A;  4A8K A;  3QT8 A;  3M2U A;  2XLJ A;  4J9M A;  2N3L A;  2J0S D;  2A1B A;  5C2G A;  1XNQ F;  4A8Y A;  1HYS A;  2N4C A;  3PNI A;  2H5J B;  3F0N A;  1NAQ A;  4K2X A;  2WB1 D;  2YX7 A;  2K1R A;  2ZH2 A;  1RIS A;  4KHM A;  4K4X A;  4CO4 A;  3GYX B;  3V2U C;  4I6A A;  2MHE A;  3UR0 A;  2WBR A;  3DRP B;  2RF2 B;  5D3G B;  3P3D A;  3AB2 B;  1M5P C;  2GNK A;  2ZWO A;  2MZS A;  4CI0 B;  4Y28 C;  3ZTR A;  4C8Y A;  1DQ9 A;  3MOZ A;  5J2Q B;  4KC5 A;  3N6M A;  1QVG R;  2HVZ A;  3FBE A;  4PXC A;  3LGN A;  3AHP A;  5KFL A;  4ZMM A;  1N34 J;  2MZ1 A;  4FYX B;  1RWU A;  2XSJ A;  3U1L A;  3G2X A;  2QLJ B;  3GIR A;  4QIW D;  3MCM A;  4M95 A;  1VBK A;  2GIQ A;  2MKS A;  4RW9 A;  2XGP A;  2U1A A;  1RTI A;  3ZZ0 A;  2JC0 A;  5HAT A;  3BGR A;  3KLF A;  3DFE A;  1EAR A;  3PR4 A;  3G96 A;  1RAC B;  1TKZ B;  2YKA A;  2FIU A;  4WE1 B;  2P8I A;  1D9F A;  3KMQ A;  2EW9 A;  1A9N B;  1H72 C;  4B3T F;  1ZZN A;  1NB2 A;  5CCL A;  5I3P A;  1VBY A;  2OEK A;  4PRF A;  2RQ4 A;  4CTA B;  3H59 A;  3BJY A;  4UY8 5;  2PSZ A;  4LF9 J;  3DXS X;  3NMA A;  2V5H G;  5L39 A;  1UPM B;  5DG7 A;  2GO9 A;  3AH6 A;  2PE8 A;  1G4C A;  1O5J A;  3KG0 A;  4N56 A;  5F8H A;  1HHS A;  1HNZ F;  1NJI T;  1KVK A;  4QYZ K;  3OBI A;  2BAN A;  3U1M A;  2Q3P A;  3TAP A;  5CQG A;  3E3X A;  1SPB P;  4R0E A;  2XYH B;  1NHK L;  1SJ3 P;  2VFT A;  2QL5 B;  3FCV A;  3UD5 A;  2F65 A;  3IRX A;  4LRD A;  2CPD A;  2OFH X;  2MZJ A;  4CYU B;  4HHU A;  2DR7 A;  1KDN A;  4JI6 F;  2DCU B;  4CO1 A;  3CUN A;  4TN2 A;  1MU2 A;  1P1T A;  2I9S A;  3D2W A;  3VAI A;  1XNQ J;  4GRS A;  2WVD A;  2EPI A;  1JLB B;  3WIV A;  5CHC B;  3RR7 A;  4IOC Q;  3QBC A;  2LCW A; 
#chains in the Genus database with same CATH homology
 4DV4 J;  4JI6 J;  4LF5 J;  4DV5 J;  1N32 J;  2MTL A;  4DR7 J;  1HR0 J;  4LFA J;  5FLX U;  2UUA J;  4LFC J;  4PWW A;  4DV1 J;  4LF9 J;  4DR2 J;  4K0K J;  4X64 J;  1XMQ J;  4B3T J;  1XNR J;  4GKJ J;  4KHP J;  4JI8 J;  3OTO J;  4DV2 J;  2UXB J;  4DUY J;  4GKK J;  2HHH J;  1IBL J;  4JI0 J;  4LF7 J;  4YHH J;  2UU9 J;  2UXC J;  4DR5 J;  4DUZ J;  4B3R J;  4RJV A;  2KVQ E;  1HNZ J;  4LF8 J;  2E5L J;  4JYA J;  4X65 J;  3J7A N;  1HNW J;  3R2D J;  2UXD J;  2UUB J;  2MEW A;  2KL8 A;  3JAM U;  4AQY J;  4V1A k;  4B3S J;  2UUC J;  5IT9 U;  2ZM6 J;  4OX9 J;  1IBK J;  4JI1 J;  3D3B J;  4JI7 J;  3IMQ J;  1J5E J;  3J81 U;  1N34 J;  1IBM J;  5AJ3 J;  5BR8 J;  2VQE J;  4JI2 J;  1N33 J;  3T1Y J;  5LMN J;  4YY3 J;  2MQ8 A;  4DR4 J;  5LM7 E;  1XMO J;  4JV5 J;  4LF6 J;  2F4V J;  3J80 U;  4LFB J;  5LMU J;  3W1Y C;  1HNX J;  3D3C J;  4JI3 J;  4B3M J;  4DR6 J;  1N36 J;  4HHU A;  5A2Q U;  4DR1 J;  4NEZ A;  3T1H J;  4JI4 J;  1FJG J;  4DR3 J;  4DV7 J;  4NXN J;  4KYZ A;  4JI5 J;  2VQF J;  5IWA J;  1XNQ J;  4DV3 J;  1I94 J;  4LF4 J;  4DV0 J;  4NXM J;  4X66 J;  4NEY A;  4KY3 A;  3R2C J;  4DV6 J;  4X62 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...