4DR5J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr5J00
3J7AN 2KL8A 4YY3J 4JI6J 1J5EJ 4GKKJ 2UU9J 2MTLA 1I94J 4JI4J 1FJGJ 5AJ3J 2E5LJ 4NEYA 3T1HJ 4JI3J 4JI8J 4AQYJ 4LF5J 4B3SJ 4V1Ak 2UXBJ 4JI5J 1IBKJ 4JI7J 2KVQE 4DV5J 4PWWA 2HHHJ 1N32J 4DV6J 1IBMJ 5A2QU 4NXMJ 4B3MJ 2UUBJ 4KY3A 4DV0J 3IMQJ 4DV1J 2UUAJ 4JI0J 4DR4J 1XNQJ 3T1YJ 4KYZA 4JI2J 1HNZJ 3R2DJ 4DUYJ 3JAMU 4B3TJ 4DUZJ 4DR5J 4LF9J 4NXNJ 5BR8J 2VQFJ 2VQEJ 4LFAJ 4GKJJ 3D3BJ 4DR2J 5LMUJ 4DV3J 4DV2J 1XMOJ 3J81U 4DV4J 1XMQJ 1XNRJ 2UXCJ 4B3RJ 4DV7J 4RJVA 2MEWA 2UUCJ 2ZM6J 4K0KJ 1HNWJ 2MQ8A 4LF7J 4JV5J 4X65J 4YHHJ 4LF6J 1N34J 3R2CJ 4JYAJ 4DR6J 5FLXU 1IBLJ 4LF8J 5IT9U 4X62J 1N33J 4DR3J 4NEZA 5LM7E 4X64J 1HR0J 3W1YC 4HHUA 1N36J 4LFCJ 5IWAJ 4DR7J 4DR1J 4OX9J 2UXDJ 3OTOJ 5LMNJ 4KHPJ 4JI1J 4LFBJ 3J80U 2F4VJ 4X66J 4LF4J 1HNXJ 3D3CJ
chains in the Genus database with same CATH superfamily
4OFZA 2O01C 3EGVA 5K8NA 3GG0A 2DKOB 3TI0A 4I4BA 4ZVPB 2XHWA 4WF9Q 2B43A 3CD7A 3U1NA 4MYUA 4PYAA 2JNJA 3LPYA 3ULHA 1YVFA 5B0EA 1A0OB 3KLFA 2JLGA 4IH6A 1TMMA 1K9MT 5L1JA 2D41A 4PZVA 5HROA 1LWCB 4PG4A 4AYBD 1FDAA 3W9HA 1X5PA 1S6QB 5E3QA 1IKVB 4QR0A 3DLHA 5LL6d 3N6MA 2YNFA 1VQOS 2DRDA 4BS2A 4N7TA 3QT7A 1RLDA 3BSNA 3TAQA 4HHHA 1TP7A 4LF5F 1GX5A 2BOPA 3BO2A 2ZBQA 3CIMA 5A8WB 2C2EA 4WU2A 4KRWA 2H1YA 3E51A 4X64J 3D1HA 1JMTA 2AGPA 2VDHA 3AH6A 4DUYF 2H4YB 3T5JA 1UJ4A 5DQGA 1VIOA 1WG1A 2FZCB 4DV2F 1QUPA 3M9OB 3JAMY 1BWEA 2XGQA 2EFVA 4K4WA 4RNOA 4MKBA 4AQYJ 1UA0A 2W2NP 1XTZA 2XMUA 2V2KA 4DV5J 3W2WB 5B0GA 2HRUA 1FTCA 2G2YA 1NHUA 3HHNB 1REVA 4P7TA 3AJDA 4JB8B 4K5RA 1Q7LB 3I0RB 1U48A 5LSRA 4DN0A 4XK8C 4IYQA 1R3NA 2DISA 1RE1B 4QQBA 1SV5A 1J5EF 5KFIA 4B3OB 1UVLA 2DITA 2YKNA 3K5OA 1IKVA 3DI6B 1C0UB 3HI9A 4ZOSA 4ZPWR 2AJ4A 2B8QA 1TZ0A 1B99A 4CTAA 2LP4A 2HAFA 3BS9A 2E1AA 2WVEA 3A8KA 5FJ4A 2RUSA 2IM0A 1TV6B 2NSCA 4FKXA 4YB7A 5JVHQ 2N4DA 4KH1B 2C28A 1TKXB 3MMCA 2CPYA 1NPPA 4C11A 2GJ2A 1RQ0A 1C0TB 2R7QA 4ANDA 2IMOA 1X5OA 2B3TB 5D15A 4JI8J 2LQ5A 1XC9A 3AD7C 2JVRA 4ELTA 2GW8A 3KK2A 3TOQA 4KKOB 3SI8A 1B70B 1GXTA 1SL1A 5LJ5Y 1NKCA 1S10A 2KYXA 4NCGA 2QA4G 1OPIA 5ITHA 2AX0A 2BKOA 3EZOA 2B7BB 4Q7AA 1JLBA 3H2LA 1VQNS 2WAQD 2L3MA 1RAJA 4DV4J 2VA3A 4DPXA 1XNRJ 1TKZA 3ZFVA 2KXNB 3KLIA 2NYIA 2M0GB 2OD6A 4TY8A 4KHRA 3JQMA 1FEEA 2ZHBA 2AJ0A 2Y1IA 3CO9A 2XULA 3MM7A 3UE2A 3RB0A 2V69A 2WVDA 3CCJS 1P9YA 2H4WB 1SC4B 4JI2F 3DI6A 3K2YA 5A0YB 2ZKUA 2CIMA 4LFAF 4HLBA 3J81j 4WZQA 4CP5A 4MAKA 2RNEA 2KTQA 4WFXA 2HHXA 3CD6S 2C2OB 3GFHA 1VHFA 2FJXA 2R2SA 2V5HG 3OLAA 4GVLA 2AV5A 4P9SA 1IBKJ 2GIQA 5D0HA 4USHA 1W2BR 3HK2A 2C2MB 4Q8FA 1PBAA 2QA1A 2Z8QA 1BE4A 1WTBA 2IC3B 1U1RA 2W2OP 1UPMB 2R7XA 4RBUA 2ZBRA 4B02A 5HATA 4OX7A 5T41A 2HIQA 2ROEA 2AHOB 3KDNA 4B3RJ 4K7QA 3C19A 2XS7A 4IFYB 5AE3A 3T1HF 4U96A 3SDEA 4TYBA 1T9VA 1JJ2R 3FQLA 3VQSA 3MR7A 1WEXA 1A9NB 4ZVEA 1SKRA 3R7BB 1PCAA 2DNMA 5M2RA 1DHMA 2GQQA 4J9MA 2IDLA 5J1EB 2ZKTA 2QC3A 3WX8A 1WD6A 3NNHA 3DLLQ 4URGA 5GAHI 4KFBA 1TFYA 2AJQA 2MDAA 4QBUA 3M8ZA 3J7YU 1QUVA 2MKKA 4JI6J 5F8GA 1TL5A 3QRRA 3LH2S 4TVAB 1NSQA 4B9LA 1HHSA 2EG2A 5E0OA 3IRXA 1RT7A 5IOLA 3GB0A 5HMWA 4J9UE 4L3KA 1VGYA 4WZMA 2EBEA 1F3FA 1NDKA 4KC5A 2IYIA 3CCLS 2M2BA 4QU7A 3JTOA 4J9RA 4DPWA 5C25B 5DG9A 5KOWA 4NLOA 2DO0A 2XHCA 4FXVA 2UUCJ 3VR1A 1HI1A 1U1NA 1VQLS 2RILA 3C6UB 2HLTA 4LF7J 2XLIA 4CWBA 3OL7A 3C15B 4X65J 4X2BA 2YKMA 2BM0A 1KC8T 5HI7A 1BHNA 1X4AA 1GMUA 5E41A 5D4LA 4KPYA 1S0NA 1HNZF 5B09A 1S7IA 2N82B 2VG5A 1EQ0A 3VTIA 3KFWX 5ETVA 5K5MA 5ETNA 1R6VA 2MTLA 3UR0A 2LA6A 1SCJB 3ZTSA 1ELOA 1EQMA 4DG1B 1YJ9S 2HFVA 3WC0A 1TK5A 2XZWA 3JS9A 3H8YA 2C42A 1S0MA 2F8EX 3N0VA 3CSKA 1S1XA 3EPIA 2DNPA 1CJVA 5HJYA 4FN5A 3AQOA 2IAJA 1FKOB 2J76E 2R3VA 1DARA 2CKWA 3D9BA 1AZSA 3LO3A 3PIPQ 5C5JA 1NJWA 5HLFA 2J9DA 4J5OA 1RISA 3CW2C 2JLEA 1TR0A 7FD1A 4K0KJ 2QT7A 5G0RA 3J7Z5 1V3ZA 3UD4P 1BWVA 3UO0A 1FRJA 1VC0A 5HMYA 3GR0A 3RAMA 3AOBA 1AROP 1LK7A 4IKAA 1S1UA 1Z1ZA 1HNIA 2A0FB 1JLEA 3FSXA 2HZVA 1CS4B 5IT0A 4ZVFA 3SCKE 5EX3A 1LXNA 3KTQA 4K2XA 3KJVA 1MNEA 4J9NA 2W01A 1T9XA 3PJ9A 1YRTA 1OSDA 3SFGA 3KK3B 2HQCA 1NK5A 3HVRA 2N4CA 4A8MP 4WFNQ 2VDIA 2D1CA 2VKZG 3GWCA 2PGCA 2M4MA 4DR6F 5GMDA 4RZRA 2DHXA 3QIPA 2I0XA 2MHNA 3HX9A 3T1YJ 3VAMA 4WFAQ 3PM9A 3T3FA 1SJ4P 1ZA1B 3TA0A 1GMWD 2XEXA 4WFYA 1Q86T 4DEZA 4NA2A 2HHUA 1NMEB 3L7UA 5KOXA 1H7XA 4B9VA 1FKOA 4CLKA 3IFEA 2IBOA 5KFMA 1YJNS 2BJ1A 4BCAA 3ZZZA 2FJEB 4N5SA 3MPWA 2BJ9A 4I64A 2D3OR 2WONB 1GX6A 2AKWB 1RAIB 1TKTB 2XTJP 3KLEA 1VR6A 5K8MA 3G6VA 2J0XA 3BV8A 3H7HB 4M94A 3TAMB 2MB0B 1RBAA 4RLEA 3R97A 1G4CA 3OJSA 2V4JB 4CLFA 3K8VA 4JI3J 2A2DA 1FDBA 2QL5B 3SMZA 1UFKA 3FFIA 2H48B 1N0UA 3FCHA 4CO2A 2BJEA 3POTB 3LGMA 4C0HA 2U2FA 2HZAA 2L9NA 4X64F 1T9TA 3DLJA 5IM0A 3PEHA 2FZKB 2VBZA 3TP2A 4DF4A 1QE1A 1CVJA 2I8EA 1VQSA 4IR1A 2XYHB 4DV7J 3TEHB 1NK7A 1LK5A 2FIUA 2OJ3A 2ZM6J 4AQYF 1HNWJ 1MLAA 4F0HA 4NLUA 3L9ZA 2IRXA 3CDWA 3EWGA 4DV5F 5KT4A 3IBCB 4ZPBA 1RGVA 2DGUA 4PUOB 3L7OA 4CNZA 4UQTA 5J2NB 5CD4A 1T9WA 3P5TL 4TKTA 3MPYA 2BVZA 4G65A 4FKYA 4LVNP 3IP0A 1EIYB 2IJNA 2HHPA 1FFWB 1LW0B 1VCTA 1G7CB 2IM1A 2LFVA 4UOFA 1TKTA 3O3LA 2M52A 6FD1A 4EFAC 1N6QA 3GMGA 1R0BG 3OTCA 3SSRA 1RTDB 2J9DE 3DM2B 3CDUA 2KHCA 1TUWA 4RR5A 3DOLA 1S59A 1AUSL 1RJJA 1TL3B 4DQIA 3PW4A 3AODA 3AHPA 3M2RB 4AE5A 3Q8VA 3CCMS 1KHWA 4BLGA 4ES1A 1YZ6A 3AA8A 4LSLB 1P1TA 1XR6A 2C2NA 1S79A 1U1LA 4Y65A 2CQ1A 1QY7A 3NKYA 2JWNA 2RF2B 3F73A 4JI8F 2HEKA 2GZOA 2VONA 3ET6A 4NX9A 2YQ3A 5KFEA 4UF4A 3I56S 1WG5A 5A8KB 3D6TB 5DZ6A 2Y9HA 4K4SA 2IDEA 2OO4A 3MI7X 1RT1A 4DL6A 4FDFA 4MFBB 2V2QA 2D3UA 3SZ2A 3QMQA 4DV4F 5HQ8A 1XNRF 1EARA 5CYJA 4CI0B 3VALA 3CJRA 5HBMB 4OYAA 2BE2B 1LW0A 4ECYA 2DNZA 2R2UA 4YR2A 2VG7B 4PG6A 1WF0A 1HARA 1H72C 4DV1J 4HACA 2V9WA 3MPVA 1MROB 4B3TJ 2J9CA 3DM2A 3RZAA 2HGMA 4YB6A 1TL3A 2YPZA 2W8LA 3CULA 3EGZA 2B0GA 4L74A 2ILZA 4UOHA 2CG4A 3IM9A 2ZE2A 2QLFB 1IBKF 2HGLA 3R5AA 3S6EA 5F8HA 4LSZB 3S8SA 4FS2A 1X9WA 2M7SA 3DKDA 2VFVA 3VAGA 1CJTA 4PYDA 4TN2A 3N4WA 1SJ1A 1PSDA 4DJBA 5FD1A 1DQ9A 4B3RF 2W2PP 4PR6A 2GHVC 3FEYB 4L72B 2VOPA 1VISA 2YVSA 3GONA 4JI5J 1X4DA 4WTOB 2HS3A 2FDNA 3EVWA 2R2TA 2MPUA 1FX4A 4W90B 4AL6A 4DV0J 2F8MA 1OIAA 2MSTA 2BKNA 3SSSA 4MK8A 3W61A 5J2PA 1S9FA 2XY7A 3OVBA 2FHJD 3BZQA 3Q83A 4OHXA 1LW2A 2I5JA 1NO8A 2KRBA 2V6AA 2KO1A 4JI6F 3CEDA 3DRRB 1Y5IB 3PDNA 1PAUB 2C2KB 2VIHA 4FXWA 1XR7A 1NCLA 1NDLA 4Y6IA 2XLKA 2QFIA 2LA4A 1TK8A 3MUVP 2D9OA 2K06A 1IM6A 4RW4B 5IWAJ 5KFKA 4IRDA 4OX9J 1H6KX 5L8RC 1IR1A 3ETOA 2RKIA 3MTJA 4WPAA 3ITHB 3RTVA 5H1SV 1RAOA 3VV2B 3IGVA 1GXLA 2CZVC 1RABB 2UUCF 4WTYA 2ILYA 4OJHA 1Z4UA 4ED4A 2B9WA 1NSPA 4LF7F 4N76A 4JI7J 1TFWA 1Z2LA 4X65F 2A6MA 2ASLA 4DV6J 3OXLA 4ILLA 4LSNA 3G82A 4QPTA 4F7VA 4ES2A 2XS2A 5D6GA 3CO0P 1SI9A 1D1UA 4NXNJ 1CJUB 1S48A 4C0BA 4PPZA 1NJXA 1R27B 1RUSA 4CLLA 4F0KA 1I6JA 3VAIA 1AA1B 4URQU 3PX4A 3M6VA 2FZGB 4ZVRB 2RB7A 3TVKA 1HWLA 2DNGA 4DSFA 1T03B 3GE9A 1U1OA 1XJWB 1CSJA 5DM7Q 1KBRA 4YS2A 1U6FA 1Y4ZB 4DL4A 3D68A 4CO3A 3DLGB 3PVXA 2ZC4A 3SBMA 1T05B 3THPA 3DCAA 2BJ3A 4CLTA 2NREA 1VQ6S 4RW6A 3W66A 1LFWA 3D6FB 2GMLA 3GV8B 2AD9A 4KJIA 2CPHA 4EYHB 2IY5B 2BDPA 1T7PA 2W4PA 5BYQA 3R5DA 4H4OA 2PMZD 4OYWA 2CJYB 1DTQA 5KG7A 2O1PA 3MM8A 1O8BA 1E6VA 2ABYA 4K0KF 1KN6A 1ZZFA 5E33A 5DZ7A 4OI3A 3BDPA 3W7BA 4F4WA 1U0HB 3V5RA 4FF4A 1HWIA 3UN3A 1N5QA 5LXRA 5KFCA 2YKPA 7AT1B 2MGZA 1JWWA 2AJFE 5I3UB 3HVAA 4I7FB 1FD8A 2PD1A 1BGXT 5HK4A 3QJPA 1RBLA 4WXWA 1X8DA 3F56A 5HVGA 3M7VA 2J6UA 5J2QB 3MURP 1X5SA 3KDOA 1KOHA 2YNHB 4P6QA 5B7WA 4QW8A 1PG5B 1WKLA 3T1YF 1EP4A 4NCAA 3KK1A 4DR1J 4AUKA 4Q44A 3DLGA 1JLGB 2LXUA 1PC5A 3PTWA 4GVBB 5KFAA 2V8DA 2GGPB 1BQXA 3RYLA 1CQNA 1X4HA 3EVMA 1UEVA 4DU7A 3O6QA 2AQ4A 1BUXA 1IKXA 2GJIA 1Y9OA 3ONQA 3SFUA 4NWBA 3QO9B 1DLOB 2N7CA 3PW0A 4EU0A 3W5YA 4DCPB 4QPXA 2APOA 3IGNA 1YRUA 4LF9J 4TLQA 3D3BJ 2KT2A 3OUYA 1HI8A 2EKYA 4IDKB 3UDCA 3MFHA 2QJ3A 3S7RA 4ILMA 3P49B 2I1RA 4DMZA 4DCJB 3MAAB 3H4DA 1HMVA 4JI3F 5IC6B 4JBCA 3EXCX 1K0VA 2ZWPA 3V6DB 1NK9A 1FO1A 1HBMB 2HQDA 5IZHA 4DPYA 4B9NA 1WF1A 4OZ0A 1KHVA 2MKJA 2KFZA 3I5CA 3I4HX 1LWXA 3PXGa 1VRTB 4HDHA 2CJ9A 2CPDA 3LOUA 4H54A 4Z7YA 3OVAA 4DV7F 5HQMA 4GC6A 1DURA 2QLWA 2ZM6F 1FXDA 1HNWF 1LWEB 3GIIA 2E1PA 4Y34A 2DGSA 4HVZA 3DLBA 1HWUA 4OZLA 4K2JA 5C2GA 3D5MA 5I4MA 2X7IA 3W9IA 2W9CB 4QIFA 3C16A 4EK2A 4M63A 2XMAA 2X1BA 3R2DJ 4J9QA 4DZDA 3O8WA 2RQ4A 2M8DB 4KGMA 2RRNA 2XZDB 2BANB 4ERDA 1JJ4A 3NCRA 1TUGB 2F5GA 4M8LA 3HFKA 1S1TB 1S1VB 2JEGA 3PJWA 1UVKA 4IR9A 3NAHA 3G6ES 4JYAJ 3MCMA 4ZDNA 2RS8A 3QPIA 4NRTA 1RXOB 2DXFA 4Q2MA 3NBPA 2MXYA 1RT6B 5L39A 2RH3A 4J91A 3R5JB 2HAIA 3A3OB 4CDIA 3VGUA 4AXJA 3OR2B 3R27A 1BQNB 5C24B 1FEHA 3HHLB 2QN6B 1VRTA 3NAIA 1UAWA 2ZUAA 3MWBA 1U6ZA 3ZZ0A 2BV3A 3IS9B 4CM0A 2V67A 4TU8A 4N41A 2JRSA 1NDCA 2HBYB 3VGTA 2HBRB 3HZEA 5D78A 2MZ1A 2HNYA 4J9KA 3PO4A 4O3NA 3RR7A 3UI3A 3BBBA 3BBFA 1AXQA 5F41A 1RT2B 9RUBA 2A1BA 2VD3A 4UZBA 4NRUA 3Q0AA 2UV8G 3KHLA 5DJBA 1SL2A 1NU4A 4Y28C 3H90A 4F4YA 3OJUA 2RIJA 3KUHA 3G9CA 4DR3J 4DV1F 1IJEB 4ECZA 2F9JA 1CQMA 4ER8A 1ZM3A 2XNRA 1CPZA 4B3TF 4DX6A 3JSMA 5BYSA 1ZETA 3DDIA 2UVWA 4B9UA 2BW2A 2DNKA 2KZZA 2DVIA 3H20A 1B0TA 2F7VA 5CHCB 1RZMA 1X4EA 3PFOA 3BH7B 1TQLA 3BKUA 3ZZYA 3DFEA 3LAKA 1HFEL 4IG3B 5KFQA 2AEFA 4PABA 5I42A 3G2XA 4DR4J 2B8PA 2WSEC 1OO0B 2XSFA 2VQFJ 1KQGB 1WUUA 1O0PA 1VQ7S 1RAGB 3ENVA 4DV3J 2GQ2A 4OHYA 3IS9A 5KAKA 3J81U 2YX1A 4F8RA 2HQ3A 3H2UB 3CDBA 2PO4A 2AT1B 2LCWA 4F4XA 2PDAA 4USUA 4JI5F 4ECSA 2PE8A 5F8NA 2HNZA 4NOHA 2W2MP 1X9MA 4TU9A 4IH5A 5AXKA 4DV0F 2ZBCA 2E5GA 3HP6A 2UV8A 2Z2ZA 4RW9A 9ATCB 1N36J 2RDJA 5E3CA 1RKIA 2YNIB 4LF4J 2WSCC 2IRUA 4A8WA 1F0XA 2FHMA 3RW7A 2QL9B 2FB0A 3CXCR 4V1Ak 1RWKB 5AT1B 1RWPB 2FPHX 2XLJA 1X4GA 4X4NA 1CULA 3HZGA 3GFZA 2VJUA 2VFUA 5IWAF 4OX9F 2QSWA 4A8SA 3ZTOA 4ZVQB 5BJRA 2QFJA 4ECRA 1VBKA 5AE1A 2R8JA 3BH6B 3BKFA 2FY1A 1S9GA 3UVJA 2GJFA 4Q0BB 2RHQB 4JOUA 5CQGA 3TYTA 1VBYA 1RTIB 3M8PA 4DV6F 3DLEB 4A48A 2J6SA 1N33J 4GRSA 4HKQA 2MKIA 4EZ6A 4I2PA 1JX4A 4RNNA 2W4CA 3IXQA 3HDSA 2NYHA 1VDHA 4CYUB 4NXNF 1U6BA 5JJBA 2VICA 2YBVA 4XAKA 4EEYA 1WC5A 3KNAA 2DH9A 4QIWD 2R4FA 2OEJA 4O4RA 3UCZP 1RK8A 5DQIA 3ZNJ1 4U7UD 1W26A 2XMKA 4NLYA 1BQMA 3JSBA 3MGJA 1V5VA 1HPZA 1OJ4A 3THTA 1Q0NA 1J27A 2AZ1A 4CM2A 4YUDA 4O23A 2AYGA 3MCSA 4AL5A 4A4JA 3MEEB 3GCWP 3NOCA 4JV0A 1PJ5A 3W65A 2DY1A 1YJWS 1JNRB 5IFMA 2XCPA 1NB2A 1IVZA 3CCSS 3D0IE 5H9EK 1NAQA 5IS2A 2HFOA 2WW4A 2DRAA 3GG1A 4DOZA 2X3GA 2CAJA 5LJ3Y 1N56A 3CCWA 2EFPA 3EUNA 2KRRA 4UUWA 4RUBA 5D3GA 1RP5A 1VS3A 1RWXB 4IRKA 4BWMA 1Q8BA 3MM9B 3PX6A 1HW9A 3BN4A 2ZOGA 2F63A 3NS5A 1RWNB 2OIHA 5F3TA 4NYOA 3TA2A 1RTIA 3TEGA 3DLEA 2CQIA 3RRHA 4F67A 2OPPB 3PZPA 5D0RA 4RBTA 2Q43A 2Q6CA 1LKZA 3PW5A 3KYLA 3W8GA 2ATCB 4QIEA 3AXKA 3MMAB 2MY8A 3V81A 1FVQA 1M0SA 2HS4A 3KLVA 2LQ8A 2ZH4A 4NLQA 3MPUB 3M1VA 1HNVB 1HYSA 4PXEA 4MT1A 3MR2A 2HQGA 4OYXA 1EETB 2PIIA 2HK3A 3NGTA 4A8KA 4DR1F 3G8TA 4P10A 2C2RA 3WX4A 3UD5A 1U24A 2DCUB 2FGCA 1U2RA 4RX6A 5F0UA 2CYYA 1L3KA 3FZ2A 1KRPA 2Y0SD 4QWBA 1FRLA 1KTQA 5IT9U 3P3DA 3OLBA 1SUQB 3TA1A 5E3RA 3BQ1A 3IA0A 1E6YB 4LF9F 1RT4B 2CQHA 1DY3A 1Q8IA 1VQKS 3RUBL 2G1HA 2HBQB 1VRUB 3R5CA 4WP8A 3CC7S 1V3RA 3Q8YA 3FC9A 2HHHJ 2BACA 3B54A 3L09A 3TNVA 4R8UB 1FNMA 4IQMA 4RW8A 1WC6A 1OYDA 3K57A 3Q86A 3QZ7A 1LWFB 1YLXA 5G4DA 4FF2A 2JH3A 3DYAA 5M2PA 1FRXA 3DLKB 4A8OA 4EBDA 2EPIA 3QFHA 2FHOB 2E7XA 5B0AA 2KYZA 4CLWA 3QLHA 1SL0A 4FZVA 3HFZB 2G0IA 4PXBA 5FLXU 1MU2B 4KB7A 5CYQA 1P6TA 1S6PB 4M5IA 3PV8A 3M8QB 3QGHA 2KH9A 3J81Y 3N9UC 3DMJA 4FS1A 2CQ0A 3JB9k 1X31C 4KPCA 1JLFB 3T9NA 2HK2A 4U67Q 2QLXA 3M32A 1SJRA 1JQGA 2OPQA 1LV5A 3LPEA 1UW4A 1VQMS 1IBMJ 4JYAF 5ETSA 3MMBB 2MQMA 1QSSA 1VRUA 1QD1A 4M5HA 1TL7B 2W9BB 2GS8A 3BKTA 1L5UA 4P52A 4UZCA 4U7CA 2VQEJ 3KMQA 2NUHA 1SBRA 5KFWA 4NASA 2GMJA 1LFPA 5KFRA 3UD3P 4LT6A 1H2UX 1H73A 4FF1A 3HCXA 2ZZNA 1NK8A 4NYPA 4X4SA 4FPRA 4OL8A 1RTJA 1FI4A 5CD4H 4YHHJ 2NQPA 4UY8T 3S01A 1IQTA 1BY9A 2V8GA 4RNMA 2LYVA 3V6HA 5IV3A 5LM7E 2FLNA 4OYOA 1M5OC 2ZEJA 2ZWOA 4LQ3A 1MN7A 4ZS6A 2BMBA 2C2DA 2IVFB 3CJ3A 3DGPA 2QLBB 2DIUA 2XYPB 3CVKA 3R7SB 3E01B 2Q79A 1B64A 2UXBJ 3C3LA 3PACA 2WTFA 1LNQA 3ZC4A 3IRWP 4EUVA 3BGUA 3HHEA 3RAQA 3DDKA 4ZJQA 3MECA 4FF3A 3NWRA 3DXSX 1VQPS 4DR3F 3HLUA 4I0WA 3H59A 1UFWA 3NLCA 4ZP8A 3UR3C 3OV7A 2YKAA 2DY9A 1FESA 2CA9A 3TAPA 2MSSA 1IR0A 2FY8A 1U4BA 1NRKA 5T14A 4ZVHA 2DH7A 3UNGC 3GCXP 2KT3A 2FVSA 2HFZA 2QMWA 4WP9A 3M30A 2R7SA 2RU9A 1NXIA 2PT0A 1S6UA 2BA9A 2IA6A 3HFVA 1YZ7A 1FE0A 2HMIB 4DR4F 4ZLNA 3CTRA 3QGIA 2BQRA 2VQFF 3I55S 1NSAA 3IR6B 4KO0B 5KFDA 4JI1J 4DPTA 1QJHA 4DV3F 1GH8A 2EEYA 2B51A 2Z4PA 4OV1A 2ZH5A 2B9YA 5DRKA 3OXGA 2W1BA 1S0OA 5KG2A 5EWGA 1R89A 1WF2A 4X84A 2OLWA 1CJKA 3WBZA 4I2QA 1DTTB 5JUMA 2BRLA 1WEYA 3MCNA 2UUBJ 3M2UA 4WYWA 3GYNA 4A47A 3I82A 4J9OA 3OR1B 4MMOA 1WOPA 1RADB 1N36F 3ICLA 3M2VB 3JAMU 4NZ7A 4GKJJ 1VFJA 5H9EJ 3FDSA 2ZH2A 2VBYA 4LF4F 4B17A 3QT6A 2LQJA 4NZ6A 1WEZA 1BC6A 3OHBA 4DHVA 4G1QA 4R5PB 3CMES 3AD9C 1PJ6A 3TARA 4CRJA 5ADZA 4WK3A 4F26A 2K1RB 4U8VA 2M3DA 4NYZA 2MZSA 4FBUA 1NSKL 2IJFA 1B3TA 1FK9B 4M5LA 4NI2A 4U7UK 4ZPAA 4MTPA 1X9SA 1N5SA 4B9TA 4Y3CA 3MEGB 4Q8EA 5L46A 3R6GB 4C3KA 5IT9Y 3W5XA 2OKQA 5F3ZA 2V2VA 2ACYA 2B5JB 1N33F 4ECTA 1FE4A 1ZM2A 3I9V9 5J1PA 2E5IA 3MEDA 4MIWA 5RUBA 2FJDB 3BQ2A 3E2EA 3QRQA 4YEAA 3DOKA 4KIAA 1GT8A 3PKYA 4L76A 4YOEA 3NS6A 2YX4A 3CWJA 2J8AA 2BKPA 4ZPCA 3IWLA 3A12A 1PYSB 3GQCA 3SQGA 2VZ9A 4ZK7M 1LQ9A 2VPZB 3KKFA 2LQ9A 3OPKA 5KT7A 4Y2AA 5CAAA 2RDDA 3LP2B 3PYGA 1RT3B 3VZIA 1H0HB 5J2MB 2DH8A 3T9ZA 2KVIA 3VCDA 1N5YA 4YN3B 3SQOP 4UOCA 1XIQA 4C8NA 3CCZA 3I0SB 4OYPA 3M05A 1HNXJ 1FFSB 1MMLA 3FBCA 3JYTB 1F5CA 4ZPTR 3DRPB 5MLCV 4WBFA 5SZTA 3ILIA 4P2XA 2HIYA 2XBPA 3V2UC 2FVPA 2DNRA 2RQKA 4YDXA 3ENAA 4A8FA 3WIVA 1C4CA 4B08A 4DFJA 2X1GA 1SQEA 3TJAA 1V6HA 2DXDA 1LOUA 3OQ2A 1VQ4S 4F4AA 2HHSA 3IAS9 2VL1A 3NCPA 2VBWA 5LXYA 4ID5A 3SCLE 4HHJA 1YDLA 3P6YC 1CLFA 4DL5A 1HBUB 1ZM9A 5FIIA 1HWJA 2VPXB 1Y5NB 3IWXA 1V3SA 4WCEQ 5IQQA 1RHJB 1SIWB 4IOAQ 2UVVA 2B56A 2RDIA 3SXLA 3HJFA 2G0JA 4F3MA 3OTOJ 3H4BA 3KNGA 2OSRA 2P9EA 4GO7X 1WC3A 1RT3A 3J7AN 4AT1B 2DCLA 1Q79A 4K4YA 3MEKA 4UT4A 2G0CA 3VVUA 3CE8A 1UWBB 4F36A 3CJ4A 1TVRB 3D1OA 3G8SA 2IRYA 2RE1A 2LLZA 4CLPA 2D3O1 2YX7A 1R8HA 1YJTA 1LEOA 4I68A 3TRGA 3MTKA 1F9EB 1ZZNA 4IO1A 1SH2A 3BYRA 1RTHA 4OHWA 3QGPA 1S5ZA 2HHHF 1JB0C 3PW2A 4QWDA 1GTEA 3IG1A 4DSJA 3UCGA 3CCVS 1TKDA 3TR5A 3TX0A 4PPDA 3VGSA 2G13A 2HWTA 3MD1A 4KT0C 2OH2A 3M8SA 3PRBA 3OT9A 3J7YI 5HP1A 1S9EB 1KVIA 4FYYB 2YH1A 3DC2A 2AEMA 3VAKA 4IG0B 3G6YA 4LMZA 1HBOA 4FVMA 1NJIT 3FJ2A 2DNNA 1NH7A 3EJMA 3EMTA 4CZCA 2JLFA 2R2RA 4DFPA 4PQAA 3SCIE 2OPSB 4KE5A 3HHKA 3DOMA 5KG0A 4PQUA 3HHLC 1I3OB 3HXMA 5A6PA 1IKWA 1VK3A 2EC0A 1WOSA 3HF5A 1UWBA 3IM8A 3UCUP 5DO2A 2R7RA 1TVRA 4CO5A 2R8KA 1M5VC 2GV1A 1XMOJ 4EO6A 1J5OA 1YJUA 2CVEA 1VJQA 1SJ3P 3C6TB 1JLCA 1F9HA 4P74A 4ED8A 3CJKB 3FNNA 3HVWA 4PG7A 1IBMF 2YWKA 2V8PA 3RB3A 3UN2A 4EZ9A 3FCWA 3JSRA 1URNA 2DR9A 3BPDA 2DNOA 2UXDJ 3CCES 2VQEF 1KVKA 5E3PA 1JLQA 3LP1B 2LEAA 2MY7A 4F4ZA 1S4FA 2ZH7A 3HSZA 1AFJA 1UW9A 4KV8B 1RWVB 1Q16B 1I51B 1FKPB 2DHAA 1C1BB 3LA0A 2XQCA 2DJWA 4YHHF 2VC0A 3HVTB 1TELA 3QT5A 4IFVB 2XG8A 4CLSA 2BEFA 1LWCA 5DG8A 4O3SA 3LP0B 1GXUA 1S6QA 3ZZPA 4P75A 3LUYA 1YJRA 2AMCB 3QGGA 2OD4A 2FJAB 1D3WA 1X7VA 1VLOA 1WKJA 3D7SB 3D6HB 4R25A 2FJVA 1QAYA 2JDJA 4JUZA 4ZHRB 1GAOA 5D4PA 4C2MA 3H5YA 2UXBF 5ETQA 1S4EA 3EXYA 4ZVGA 4ZN1A 3UQSA 1IXKA 5A8WA 3OSPA 4ZIVA 2CNOB 3N6NA 3OL8A 3A8EA 2CDQA 3N28A 3R5GA 3HULA 2CPJA 3QSYB 1X5TA 3CUNA 2EKNA 4N47A 2VH7A 3KUEA 1N5VA 1RSCA 3NRBA 3ELHA 1GMWA 2MQNA 1H2TZ 2CWKA 3MM5B 4LRCA 3W2WA 3LW5C 5KFNA 2WW8A 2Z2LA 2DEIA 1W7WA 2B4OA 5HQLA 1OWXA 2VJVA 1N52B 1HHTP 3PR5B 3AD8C 3I0RA 1RHQB 5GADI 1FFGB 2PI4A 4P2SA 3HVTA 1VBXA 3A1YG 4JI1F 3FEXB 4TY9A 2DHSA 4OJ1A 2FJWA 1XMQJ 1WI8A 2UXCJ 4B3OA 4CLYA 3M8YA 2ERRA 4NA3A 1QVFR 2C1EB 1C0UA 4Y2CA 2HG4A 3GJTB 3UNYA 1TU0B 4USTA 2QEXS 1JJCB 4NLDA 1U8WA 3JQKA 5ETTA 3PHEA 2UUBF 4O4GB 3G86A 4ZHRA 4C4WA 3OVSA 1TV6A 3ISNC 2VHGA 1SXLA 3RGIA 1TKXA 5DDQC 4GKJF 4G1IA 1HQUB 4MYTA 1C0TA 4DSLA 1K1QA 1KKHA 2D3ZA 3FBBA 1VMBA 2MQLA 5AJ3J 4QWCA 3G71S 2MZQA 1XEZA 4CO4A 1KP6A 1G1XA 4HH1A 4KKOA 4O44B 4C3LA 2ROGA 1NK6A 3R7NB 1KDNA 1K1SA 1WKKA 1SH3A 2R7WA 1NLKL 1H74A 4JV2A 2DO4A 3LAMA 2OFHX 4KGKA 4NL5A 4S0MA 4A8QA 1F9FA 2ZZTA 2YWGA 5I3PA 3OFFA 2CWXA 2HSEB 4HYKA 1U45A 2HNDB 4PAAA 2XMTA 4A8XA 3NMAA 4OJ3A 2DYAA 4USMA 1UEUA 3KHGA 2IVMA 3BSCA 4LF6J 3I96A 3QWUA 1YWXA 2JHEA 1R6YA 2Z2MA 3NL0A 4WE1B 2CQ2A 2NUUG 2QGFB 3W1YC 5A0YA 5GAGI 3CB4A 3JQJA 2IHR1 2G2OA 1N0VC 5CH7B 2WSFC 1KLNA 6AT1B 3CF5Q 2XSJB 1UTAA 3BSAA 4FBTA 2E1CA 5JXSA 1DFDA 1F5AA 4IOBA 1RTZA 1KLMB 1NM2A 2QYCA 5KG6A 3HHDA 2IC3A 1NKEA 5L1IA 4M5KA 4X4VA 3N5FA 4Z2XA 1G6BA 2YWWA 2XO6A 3GLJA 2RRBA 2KDOA 5K8OA 3GZ7A 4F50A 1HNXF 5KG4A 2OHDA 3TUJC 2Q66A 2RT3A 2K2PA 4IFYA 1NPKA 4PKDB 4ED7A 2HVEA 5IQ6A 4P72A 2ZJRQ 1IQZA 5ETPA 4EGLA 2PFDA 5BXIA 1RWOB 2CDRB 2EBGA 1IBLJ 1VQYA 5J1EA 1L3VA 3KWMA 4EYIB 2B4VA 1TL1B 3NWGA 2IBKA 3GIRA 4C7QA 3W2VB 2DNYA 1VOMA 2XY6A 1FRMA 4DCOB 3K89A 4ALZA 4DQPA 4NLVA 1R31A 2NXEA 2C3PA 2Y1JA 3UDVA 2GO8A 1UEKA 4ZCMA 2CRLA 2FHKA 1N32J 2GCFA 3P4UB 2GNKA 2XYGB 1HW8A 5IT4A 1QTMA 3W8PA 4FYDA 1U1KA 4OIXA 1D09B 1OY8A 1NZ8A 1DAXA 4DUZJ 3O2IA 2VBXA 4HT5A 1F3VA 2GMHA 3OTOF 4EBEA 1M1HA 2BW7A 2KN4A 4ZN3A 1QM9A 2R9LA 3ZO7A 1UJ6A 5C25A 1GK8A 4BDPA 2M9KA 1RWUA 3PYEA 1SC6A 3FCVA 3EX7B 3C6UA 3RU0A 4YQWA 8RUCA 2F3JA 4O3RA 3C15A 2BQUA 4CLZA 5KFXA 3UW1A 1BMQB 4A46A 2OMLA 2QX0A 2DGVA 4LF1A 4ZLJA 4X62J 4MIBA 4RO0A 2XY5A 1PIEA 2NXNA 2KI2A 4DBQA 3EM1A 1L3TA 2JVOA 4DG1A 3RAXA 2EC2A 2HHTA 2GVZB 2W25A 3TWZA 3MOZA 5KTQA 3MOJB 2H54B 2CQ4A 1RT5B 1CEZA 1S76D 2UUAJ 1PYTA 2R8HA 2YTCA 1QAIA 2B6AB 5KG5A 1FWPA 1RLCL 2HKEA 2K3KA 3K7RA 3GJRB 2DT9A 2VFTA 3TUPA 4K4UA 1S7HA 1NBEB 3Q8UA 2WOMB 3OL9A 2X51A 4BWJA 4H4KA 4YP3A 3O44A 1PAEX 5GAEU 1CS4A 1U09A 2SXLA 1FWLA 4R0JA 1WDDA 2D69A 2HQIA 1XMOF 4NMLA 3SYZA 3PJXA 2ACMA 1V5IB 1T3NA 5ETKA 3KK3A 4NPOA 2Y8YA 2J0QD 2WB1D 4F0MA 3R9LA 1JNZB 3JSYA 1WI6A 2KFNA 2HBZB 1Q8KA 2PMHA 1FRHA 2BJ7A 2CJKA 2KFYA 2RJZA 2LEBA 5DS7A 2HURA 3MFIA 2UXDF 1WDTA 3DU6A 2BUNA 3AFGA 3QSIA 4F04B 2YNGB 1L3SA 3TANA 2PI5A 1OMSA 4QYZJ 3PX0A 1JIHA 4XPCA 1GFWB 2GO9A 2GVDB 1GTHA 2HZCA 2J7KA 2W24A 4E0DA 4PWDB 5D77A 1ITPA 4CQ1A 1WC4A 2QYGA 3BGRB 2WONA 4ICLB 1SVDA 4RNFA 2HHWA 4LBHA 3L95X 4DU8A 3W62A 2KHDA 4FYXB 4DR7J 1KFDA 5HMXA 3TAMA 1KOOA 4LR7A 3NNAA 2E5HA 2V4JA 1OQ6A 2B4UA 4OZ1A 3OSNA 3M6WA 1NH8A 4AFFA 2L08A 3NOGA 2NZCA 1WHYA 4ZMMA 4C98A 1RB0A 3POTA 2WVBA 4RUHA 3TJ8A 2DGQA 1Q78A 3TQ1A 1YBTA 4GO5X 1FERA 4M5DB 2NSBA 4KYZA 3A3NB 4HI2A 4LF2A 1OSCA 1UKUA 4A8YA 4L75A 1SKUB 3DU5A 4PG8A 1HD0A 2DB1A 4I56A 1FNOA 4RJVA 1MSWD 4LIRA 1P8GA 5HVFA 1F2HA 1RWMB 2J0WA 1Q95G 2JL9A 4PUOA 1R0AB 1O5JA 1U0SA 3CGIA 1YHQS 5J2NA 4DSEA 3B78A 3P8BB 5F9NA 4TU7A 3RW6A 2W7OA 2GVDA 2EWHA 3ZZOA 1MWZA 1OQ3A 2ALYB 5T7LB 1JXEA 3FVYA 3R1LA 3GJSB 1XMQF 3RB6A 4RWXA 4UUXA 2UXCF 2XMMA 3OTEA 1TAUA 5KFZA 4OYZA 5K14B 2L41A 1Y7PA 2FVCA 1RTDA 4ZVSB 2AYEA 2MZJA 2AZ3A 5A2QU 1NUEA 1FKAF 2E7WA 3B6BA 3KLFB 4O0NA 2DPJA 3M2RA 5EHHA 1T8EA 3TQEA 1WACA 2H65B 4I69A 4USKA 5HROB 2BYCA 1A6LA 2JSXA 3P5BP 4LSLA 4X4RA 4K4VA 2RVJA 2YNFB 2CPZA 4J37A 2JZ5A 1Y00A 4DL0C 1G3OA 2RF2A 5AJ3F 2A2CA 1WNEA 1WC1A 2OEKA 2MKHA 3ILOA 3R2CJ 4KHMA 1ZYQA 1JXLA 2Y0BB 3K59A 1REGX 5A8KA 4DSIA 1YSJA 2EVZA 4PG5A 4ECQA 4ZITA 4MFBA 4B9MA 1QDUB 4QWAA 3V6JA 4C9DA 2AEJA 2ATLA 4PWUA 3FSIA 3ENQA 4M5MA 4JI4J 4RUCA 3TJ9A 4ECWA 4ZCLA 4ETXA 5HBMA 2ZITA 1DZ5A 4DFMA 2NLWA 3BREA 2BE2A 2CPFA 5T7LA 2KVQE 3THVA 1EB0A 4LF6F 2VG7A 2NXCA 3PRVA 3GSIA 2Y3YA 4KY3A 1Q5VA 3T6BA 2MQOA 2H5IB 3VAJA 4WJBA 2DR8A 4FXDA 5K14A 3CPWR 1MROA 1WWHA 1REVB 2KT5A 4NLWA 1OYEA 5DLGA 4QWEA 1Q1KA 4OHZA 4ELVA 2KU7A 2QTWA 3CD5A 1IBCB 4U8YA 2IVYA 4WKYA 1DRZA 4PXCA 4W98A 3B4MA 1SV5B 1MWYA 2GFFA 3N5BA 2ADCA 2AYBA 2YKNB 5DGBA 3K0JA 1U8SA 5KFFA 2HWIA 4V19X 4YMEA 2ZH8A 2GC8A 4CTAB 5AE2A 5D4OA 3NS7B 1S1WB 4V19J 3MMCB 2ZH6A 4C11B 2Z56B 5KFGA 4U6PA 2VPYB 2HVZA 4GKKJ 4DSKA 3SV4A 4J90A 1CC8A 3CIZA 3Q8PB 3M8RA 1ULRA 4WFBQ 2GAGC 4ED5A 1SQFA 2XWYA 1JK9B 3H5SA 3M4XA 3KK2B 1JKHB 3IWNC 3HSGA 1IBLF 2ZHAA 2KB2A 2CADA 4QOTA 2CNLB 2BZ2A 1S72S 4NCGB 2C2ZB 4NZ0A 2Q3PA 3ZZUA 1JLBB 1V9OA 4YB5A 1I1GA 3EPGA 3SSQA 4ZP6A 1T3OA 3DRRA 2VPWB 4FP9A 1TKZB 5HMZA 3V4IB 3VGVA 3KLIB 1SQGA 3I6PA 3CT9A 4DLGA 5CYMB 1N32F 4TY8B 3K17A 4I6YA 5KG3A 3K5PA 4ZVOB 4C8LA 3PRDA 4RW4A 5B08A 1I5OB 3J7ZT 3MM7B 1R43A 3CJ0A 4DUZF 2QA4S 1UETA 3FBFA 3Q23A 3S1TA 4CH7A 3WZ0A 3ITHA 5L1LA 4Y0FA 4KH0B 2QL7B 5KFLA 3DXBA 2VUGA 3UPFA 1S1WA 5U47A 4ZIWA 3W60A 2RUGA 2W7PA 4FNHA 2JJ4D 3H25A 2MQQA 4X62F 1CJUA 4K4ZA 1UJ5A 3EGNA 5D4NA 4ED3A 1R7IA 1JKHA 3M6UA 4QYRA 3N79A 1T03A 1VHIA 2ADBA 3KG4A 2V4RA 3SDEB 1PYOB 1YQHA 2OI2A 3QJLA 1K8AT 1U2CA 1WHWA 1HQ2A 1T05A 1YITS 3HPOA 4GC7A 2EG1A 4WFZA 4ED6A 2UUAF 2HFUA 3V4IA 1SC3B 2GX8A 4ED1A 4KFBB 5CYMA 2XMVA 4X4PA 2RQCA 2PN6A 1KS2A 1FJGJ 2HYIB 4ZCKA 1UPPA 1Y10A 4MJKA 1VQ5S 3TW0A 1Q7YT 4C6AA 1D8ZA 3U1MA 3IRXB 1QLNA 1RT7B 2YQ0A 1U0HA 2J9EA 2H51B 1J2VA 1K73T 3I87A 2PEHA 3NG8A 4TNOA 2YQ1A 3PFEA 4EI2A 2OGUA 5I3UA 3FGVA 4I7FA 4H4MB 4D3GA 4ZA1A 2MKYA 3LWMA 3LQVA 3QAEA 5A2QY 1EKSA 1UZHA 1XERA 4JV5J 5J2QA 1WJ9A 2QMXA 2YKMB 3AT1B 3IR5B 4BBYA 2YNHA 1BD6A 2WZ1A 2CPIA 3M6XA 3EICA 2FD2A 2Z2YB 2XNQA 3GU0A 4I6WA 2FUG9 1JLGA 5CABA 2VG5B 4GVBA 1KTVA 1KONA 2GGPA 1U26A 3FMBA 2BABA 3MD3A 1D9DA 2L9WA 2E9TA 2M8HA 2VA2A 4OI4A 1AUDA 5AXMA 2J5AA 2DGXA 2N3LA 5IC4B 2ALZA 1QSYA 3PW7A 5F8IA 3QO9A 1DLOA 4ETZA 4RL1A 3IMQJ 1P9QC 1S1XB 3KJFB 1CJVB 2L9DA 2IAJB 4I6AA 4DR7F 1P27B 4FYVB 4IDKA 1R8PA 5K9FA 4PCQA 1AZSB 2MHEA 3IBFB 1U1PA 5HLFB 3MAAA 2IJRA 3G4SS 2MKSA 2YH0A 2ASYA 5EGYA 1X0FA 1S6OA 4LR8A 4DWIA 4XIUA 2MLYA 1TMJA 4Y2KA 2X1FA 5G0RB 3V6DA 2B9EA 1K0TA 1IJFB 1HBMA 4H4MA 2MLXA 4ZPDA 2M88A 4P73A 4ID8A 4DQSA 1FVSA 1S1UB 4HHUA 1HNIB 5AXNA 3E3XA 1JLEB 4ECUA 5BYRA 4CT9A 1KQFB 3KJVB 4C3MA 3MMJA 1AB8A 5CXTA 4HI1A 2NR0A 2JFKA 2WHOA 1LWEA 2FGOA 3QYYA 1RCXB 2DGOA 2KZMA 2YPYA 3H42A 3Q8SB 3JTNA 1IUJA 2XM3A 1H7WA 2W9CA 2CZ9A 3QIPB 1FDDA 1ZM4A 2AX1A 1HWKA 4N8NA 4CO1A 1B7FA 1FXRA 2BJ8A 2AGQA 1MG7A 2L48A 4C0OC 1EZZB 2LQBA 2BANA 1F1BB 1GNKA 1S1TA 1S1VA 2RMLA 3LANA 4PXDA 2XI3A 2VASA 3QRPA 2WK4A 5JMNA 1YG0A 7FDRA 3CJQA 1AFIA 1KWMA 3CNQP 3EYZA 5C2CA 1YBAA 2GAHC 4XDCA 2IPOB 3TUZC 1KR4A 1NKBA 4M5GA 1RT6A 1RHMB 2HRYA 3KLEB 4XO0A 1S57A 2OPRB 2G4BA 3NGUA 1ZPVA 1KSPA 3GR1A 3V6KA 3FZBA 4MKVA 2CQCA 3OR2A 4Y2MA 3TZYA 1BQNA 2QRRA 1VBZA 5C24A 3HHLA 1ACMB 2I2YA 5KFUA 3FFIB 4X4OA 2E44A 2E5JA 3FQKA 4NXMJ 4ANCA 1HKAA 1Q81T 5KFOA 4MKYA 2W9AA 3MXHP 3D54A 4LRAA 4LRFA 2R8GA 5IM0B 1RT2A 1ZOTA 1QE1B 1KQKA 2EK1A 4DI6A 3LGNA 4JI4F 3JTPA 2NZ4A 4LUBA 4CH0S 3AXMA 4RKUC 5GADU 4LRDA 4NLTA 1H98A 2B9XA 3BGLA 4P71A 1RA6A 3Q22A 5EWFA 1SKSA 5KFBA 2ZNYA 4B9SA 2YKQA 2LU1A 2RAQA 1R8BA 4ILRA 2HPUA 3D28A 1EKRA 3QAUA 3T41A 2CQDA 2OPRA 3DHWC 2W7AA 3ZTRA 3KUGA 5IXUA 3KG0A 1N6QB 4C97A 4IG3A 2E7VA 4NLPA 2XS5A 3DOLB 2E1MC 3W5ZA 1U25A 4HDGA 4ENOA 4KAIA 5F8JA 4NLXA 3CCQS 2AGOA 1QAJA 3U7JA 3P45B 3GTYX 2LEPA 5LMUJ 3HJVA 3RG6A 3H5UA 5DDOC 5DG7A 4PRFA 4OLPA 1PILA 5CZVA 4GKKF 3IR7B 2CJXB 3O1LA 5L1KA 4HH0A 1JLAB 4H4KC 3ET6B 3OL6A 2J7UA 2VF3A 1WTFA 2HFNA 3JXOA 4JV1A 2EFNA 1HR0J 4WXOA 3SCJE 1NEEA 4WKRA 3M8WA 3GYGA 2YNIA 1RT1B 2RD5C 2CFXA 1HIYA 3J80U 2AYMA 5GAHU 1IN0A 2UP1A 3HD1A 5B0DA 4M95A 1HD1A 2EK6A 3RJMB 5A76A 4G6VB 4USJC 3C46A 1U7LA 3NNCA 4DFKA 4QJVA 4ES3A 3CCTA 4PWWA 5KT3A 5GAGU 3QNWB 4R0EA 4NLGA 1EX8A 5I3QA 4HACB 2D9PA 3LF0A 5EUHA 4M1KA 4DR2J 3OD2A 3J7A1 1WHVA 1FD2A 4IQXA 2CPXA 1UP1A 2FLPA 4L6V3 2CJBA 2ROPA 1SPBP 4Q0BA 2LDIA 1ZPWX 1R8AA 2ZE2B 2BM1A 2W8KA 1W2IA 4CO0A 2I38A 2DIVA 1FWKA 4NLSA 4CYUA 2G1DA 1JLAA 3WDOA 1G2EA 1CJTB 3MR3A 1NHVA 3BGOP 1N4LA 1XMBA 2F4FA 1T02A 3HT3A 3HSJA 5HAOA 1VI7A 1L3UA 2AF6A 1FXLA 4DS5A 4OYMA 3BB5A 2NS1B 1TTHB 2XWXA 1MMNA 3DN9A 1MW7A 5KFTA 4N8OA 3MEEA 2ZFHA 4QIVA 1NJZA 2MJUA 4DLEA 1HL6A 4ZVUB 1S77D 1T9UA 2CJQA 2QG9B 4TLRA 5J2PB 1ZH5A 2BE7D 1B0PA 4CIOA 1B7YB 2EI5A 2AJ1A 1LW2B 3NCQA 1FJGF 2I5JB 5A6WA 2CVIA 3R8YA 2IA0A 2MQ8A 4Q5VA 4YR0A 3BN7A 3KLGB 2QE5A 3OBIA 2EXUA 3MM9A 4TQSA 2XI2A 5L38A 2X3DA 2VOOA 2BXJA 4DUTA 2ZJPQ 2OPPA 2KM8B 4P7VA 2DRBA 2RKIB 3SEOA 2KL8A 3MMAA 4NEYA 1VIXA 1S97A 3IN5A 1PJ7A 3D2WA 4GMKA 3T6JA 1UVIA 4JV5F 2OSQA 2UVRA 2UZAA 1HNVA 2KG0A 3AJ2A 1Q82T 3EZUA 4LSNB 3G82B 1ZA2B 1EETA 2MYFA 1N54B 1RI7A 3I5BA 1S0VA 4IRCA 4FYWB 3OXFA 2Z0GA 4EMDA 3CC4S 1ROFA 3BF4A 3TZZA 1RAAB 4KR0B 1RU1A 5AXLA 3Q8QB 1MWQA 5KT2A 5KG1A 4ITSA 3HO1A 1BXNA 1SUQA 3ZNUA 2JEFA 5KFHA 3PYFA 2RHSB 1E6YA 4LFCJ 1RT4A 3KLGA 2Z58B 4HEA9 1K44A 1Q4RA 3ZTQA 4RW6B 3G6XA 5DLFA 4Y2IA 2P2CB 4C8KA 4DQQA 2KJWA 3QATA 3HM9A 1GQEA 4RWWA 4L73A 3OW2R 4H4OB 2E66A 3CJ8A 2F9DA 3US5A 1DTQB 3MM8B 1E6VB 3E8OA 3HD2A 3A4TA 4URSA 1IWGA 4B3MJ 5HANA 4R8UA 4OX6A 3OHAA 2ZOMA 4QIGA 2XO7A 1T95A 5HO4A 2YKOA 2RSQA 1LWFA 2NCKL 1NK4A 4DR5J 3KLHB 4DDFA 1FF2A 4HL9A 3VHQA 4C8OA 1GMVA 3BEGB 3FK4A 2VU5A 3DLKA 4OI2A 4YB1P 5KFPA 2MGZB 2QLJB 2ZJQQ 3EDRB 2VODA 1JJHA 2A6OA 2RQMA 1SJQA 3CCRS 4KSEB 5LOQA 1VQ8S 3FRYA 1B0VA 1MU2A 3MUMP 1OS5A 1S6PA 3GPAA 3M8QA 4KGZB 4WIIA 5ETLA 2V9KA 3KOAA 1EP4B 3KK1B 5LMNJ 1PC4A 4DL2A 1JLFA 3VAHA 4OV6A 1AT1B 2UU9J 2G9OA 1Y5LB 3N01A 2QIFA 2OTJS 3MMBA 1IKXB 3M9NB 1TL7A 2W9BA 2LU2A 3J80Y 1KFSA 2BOAA 1FRKA 3NGRA 5BR8J 4WYLA 3BJYA 1IM4A 3D1QA 3OUYB 2CQGA 2VV5A 4J9SA 2C3MA 3T5KA 1VQ9S 3NMRA 4OI6A 2DGTA 4BC9A 3KLHA 1HMVB 2CG8A 4LR9A 1SJFA 2HW3A 3CD0A 1N5TA 3IAM9 2LXFA 3W3SA 4NXMF 4EWTA 5B0FA 1Q5YA 4O3PA 5KFSA 4DL7A 1ZAXA 1DQAA 3TZWA 2XGPA 5D8HB 4KHPJ 2LXIA 4F2RA 4MK9A 1M1KT 1RU2A 1HI0P 2F4VJ 8ATCB 2KJVA 1M1GA 3GFYA 2YWHA 2E9RX 2VKRA 4IOCQ 2CQ3A 3PCOB 3E01A 4UTGA 2IM2A 1RHKB 2E1RA 4JP8A 3FUYA 4USVA 2ZC3A 4WIQA 2VG6B 3FBEA 3PNIA 2ZUGA 1PO6A 4PEOA 2J7WA 8AT1B 1QAXA 1FCAA 2FC8A 3G87A 3C16B 3TZXA 4OX8A 1R0CB 3I32A 2DR7A 4ZLLA 3RBEA 4LIWA 4IO9Q 4UQGA 2UUWA 2NPIA 5F0WA 3ZTPA 4ANEA 4CLUA 2P6SA 5C42B 3IC1A 2R7TA 1KEKA 5F8LA 2H3EB 2Y1LB 1U1QA 4USIA 5DQHA 1NNDA 3LGHA 2HMIA 3ETMA 1FT8A 5KT5A 3I5AA 2QA2A 3NBPB 3T5HA 1KD1T 4KO0A 2WB4A 5HN0A 1IR2A 4U9RA 2YWFA 5LMUF 3K58A 4I1TA 3D3CJ 3H40A 1VRQC 5M2UA 2JEIA 3I4PA 4UW2A 3NXZA 4ZJLA 4LVOP 4B3SJ 1DTTA 2XCAA 2PEBA 4DQRA 2FQQB 3DDNA 3L4BC 4Z7CA 3OR1A 3FKBA 4NA1A 2CUYA 5D0GA 3P96A 1HR0F 3RBZA 3M2VA 3PR4A 2MQPA 3W9JA 1O51A 1HBNB 1YJVA 2HNYB 2VG6A 3T19A 4FNIA 3MR5A 2W4DA 2B4PA 2C22A 1K47A 1YGYA 1OY9A 2M70A 2EFOA 3FRZA 1VYAA 5H9FK 1KVJA 1ZTWA 2ZDPA 4R5PA 5CA5A 3MPDA 1QSLA 3CMAS 3HKWA 1FDNA 2P8IA 3RRGA 1X60A 4NMXA 5D0EA 2K1RA 2C3OA 3GFXA 1F6TA 3D0GE 3F41A 1FRIA 5C42A 2DD8S 2EFQA 2YXLA 1RAEB 3BM7A 1FK9A 1Y3JA 1RYRA 4F4KA 4ZJOA 1ZTTA 3JSMB 4DR2F 4WU3A 1TK0A 2KKHA 2DTJA 5GMKa 3MEGA 4KBIA 4YDDB 3MF5A 3MAQA 2A18A 2ZD1B 2B5JA 2P5VA 2AWZA 3F0NA 1YX2A 1PKUA 4G1PA 3X1LB 5I42B 4C8ZA 2ZH1A 2DXEA 2W2QP 2Q1LA 2R7UA 2XMJA 2FVQA 5LT5A 3Q89A 4UY85 2CXEA 2OAUA 3MHYA 3UDEA 3QIDA 1Q53A 3NGSA 2J6TA 1DQ8A 1RKJA 1QVGR 3ENWA 2PA8D 3ADAC 3OFGA 2QSFA 2BRKA 1HBNA 1APSA 2HHQA 2MMYA 2O5DA 3LP2A 1NJYA 1N34J 1RA7A 1KQSR 5J2MA 2BJDA 2HNZB 2OELA 2WBMA 2JX2A 2WVFA 4ECXA 2DNHA 4RBVA 2GHWA 2P9GA 4RW9B 3DHXA 3I0SA 5L9NA 1NPRA 4C8MA 3L7PA 4OZ2A 4W4MA 4J9PA 3L3CA 4ZP9A 3JYTA 3DRPA 2UUTA 3Q8RB 1RCOB 2H5EA 1I94J 1UVNA 1UMJA 3PEJA 3R5BA 3T5LA 3H5XA 4J9LA 3CJ2A 4MK7A 4OI0A 4KTQA 4DZ6A 1DJ0A 3RR8A 1CULB 1RYSA 4E98A 1U02A 1XNQJ 3UDLA 2FJBB 5E5NA 1FX2A 3VF0B 4OZ5A 2K7JA 5EX0A 2ZD1A 5E7OB 3U02A 3CDEA 1DBDA 3AQPA 1HBUA 4ED2A 2E9ZA 3WIUA 4OHVA 4OZNA 2OTLS 2R42A 3VZHA 3GV5B 1S9GB 1RWWB 3ZXWA 3UVJB 2LECA 2FTRA 1ZS6A 3D4JA 1YTYA 3M8PB 4LF8J 4CCHA 1UZDA 2C3UA 5C7PA 1HA1A 3UFCX 4I2PB 1RAHB 1WSVA 3A13A 5E3AA 2JC0A 3MDFA 1NZAA 1B4SA 4LFBJ 2VC1A 2Q6BA 3QZ8A 4OZJA 3BDEA 4NLRA 2DNLA 4FPIA 2CJAA 3H98A 3CMQA 1BQMB 1HPZB 3IO1A 2Z30B 1RDRA 4NE9C 1D8YA 2V4QA 4K8RA 1P1LA 3BR8A 3W63A 4JI0J 4HR2A 4LFCF 5GMEA 1NB7A 2OUGA 3K5NA 1F60B 1H3DA 3D66A 4L3NA 5CCMA 2QV6A 2F1FA 3RBDA 1HQEB 2F65A 3ZZRA 5MAOA 3KG1A 2IMWP 4BHQA 4O0IA 4RU9A 5KT6A 4B3MF 2B7CB 2HVDA 5D3GB 2QO3A 2RRAA 4IH7A 5KFYA 1WELA 4DR5F 2JEJA 4KQZA 1S9EA 1Y11A 3F44A 2DK2A 5CZXA 1MN9A 4JI7F 5LSOA 2WRMA 4QU6A 3MAHA 1EAYC 4HTJA 3G8QA 4LBPA 4IG0A 4QR1A 3LTOA 1Y0HA 3Q24A 2ZVIA 5FDLB 4X4QA 3V81B 4BC7A 4OLOA 1NDPA 2OPSA 1SIZA 3AY0A 3QBCA 2OMOA 3M1VB 2Y1RI 4LRBA 1HYSB 2R7VA 3HKZD 2EW9A 2QMUB 1SKWA 1M5HA 2HLUA 3KHHA 4OI1A 3KMSA 3A8IA 2PC6A 5LMNF 4DS4A 1WSRA 3SIPB 1X0PA 3D67A 1VK8A 3WHIA 3QJJA 3VQTA 1UA1A 1MMDA 4ELUA 3PYDA 2UU9F 3C6TA 3TVYA 1RBOB 3ISZA 5HJXA 1O6XA 2HWHA 4K50A 3QQCD 3CJKA 5L9XA 4CT8A 2X1AA 5F8MA 2LDYA 4HT7A 4N77A 2FC9A 3NEKA 5THWA 4DPUA 1YK9A 2YY3A 2QZ8A 1HQEA 1CC7A 2PA3A 5K8PA 1WHXA 2OEMA 4Q2LA 2LVWA 4N56A 1FNXH 1AYEA 5BR8F 3LP1A 3BQ0A 4X66J 2O3DA 4KV8A 2R8IA 3X3UA 4YY3J 1HLWA 1FKPA 1C1BA 5GVQA 5ETMA 2JC1A 4OJGA 1URRA 4IFVA 3NY0A 4O3QA 1HHQA 1S49A 4U95A 3LP0A 4QYZK 5EN1A 4Y00A 3MCOA 2N3OA 5FDLA 4TQRA 4RW8B 2ZNZA 4ZVTB 4KHPF 3DRXA 3FMWA 3PY8A 3VAFA 2OFGX 2F4VF 4EO8A 3DYAB 5H9FJ 3R1HA 4ZP7A 4Z37A 4HTIA 3WQPA 2GIRA 2DNQA 1TUVA 1YRXA 2MZRA 1VC6A 2HS0A 4FVCA 3ILJA 3QLHB 4NCBA 2XC9A 3QT8A 1OY6A 5GAEI 1H38A 4Q43A 3EVOA 3CCUS 5CYQB 1ZAWA 2D7SA 3K5LA 4LBIA 3DMJB 4ED0A 2Z57B 2LMIA 1RHRB 3VVTA 1SC1B 2E5LJ 3MM5A 1M5SA 2HHVA 3M32B 2OPQB 2HVHA 2VB6A 3BSOA 5K20B 1WORA 3TVZA 2NPFA 2BR0A 3A3PB 3I31A 5DGAA 3RRKA 3EE3A 2FLLA 3K5MA 1YIJS 5F9LA 2HFSA 1LXJA 2OP5A 3QWPA 1CG2A 2COLA 3HMJG 4LREA 3BR9A 3EGWB 2H5JB 1CBKA 4AL7A 2VFSA 2GIFA 2XZTB 1RACB 3ZZTA 2Y8WA 2DR5A 1C1CB 4B3SF 1RTJB 4O4GA 3AJ1A 3HHLD 3DGVA 2V34A 3KJQB 1FJCA 4F2SA 5SUHA 1D0EA 1RHUB 1HQUA 3NP5A 4F3OA 3WC2A 3C14B 3R3TA 3DGPB 2C3YA 1PGZA 4AD6A 4LF5J 4C8YA 4O44A 2V94A 4O3OA 4X4TA 4QZVB 3AAWB 2P6TA 2CZ4A 3FEZA 3EZ5A 3MECB 2BE9B 2NXJA 3GP9A 3W64A 4QCLA 1ICEB 4DUYJ 3Q2SC 1AW0A 5IV4A 2DEJA 1IKYB 4TYAA 4DV2J 1U49A 2HNDA 2M5YA 2GQCA 1WC0A 2I9SA 3C8YA 5KFJA 1WG4A 2O66A 4WP3A 3M30B 3N6LA 2ASJA 3DNCA 4WE1A 3OFEA 3MM6B 4DN9A 2ZZMA 4OQJA 5ETRA 4W92B 1X4CA 1C1CA 3OTBA 4M5NA 3PG9A 2ASDA 4YR3A 1C2PA 4D3HA 3BBCA 2F8HA 2POKA 3LALA 2HGNA 4RU2A 5DDRC 1J5EJ 2XSJA 1S12A 2HQFA 1UCNA 2KM8C 4OYIA 4K4TA 3KJNB 1CJKB 1H2VZ 1KLMA 1IWAA 2U1AA 1M90T 4I2QB 1N34F 3BO3A 3C14A 2V0NA 5LSLA 3GV7B 3M2UB 1T11A 4DX7A 1XK8A 2HVIA 2E29A 4C48A 4RUAA 4E8UA 2MKCA 2ZBIA 2VFRA 4TXSA 2RU3A 4ZKAA 3CJ5A 2F40A 3UN5A 2V8VA 2LKZA 3MUTP 1UFLA 2DR6A 4DXLA 5HSPA 3H2VE 3SV3A 1I94F 3C2PA 5HL7Q 2G2ZA 4OMFG 4K4XA 4G1QB 3AB4B 3AOAA 1IKYA 2DHGA 3R6LB 2V8HA 3G96A 1FHTA 2PFFB 2V63A 1UVJA 1TL1A 2JOQA 4UOGA 4NEZA 2FHJA 3Q2TC 2PSZA 3U1LA 5HVHA 1XNQF 3W2VA 4DX5A 1XBWA 2MLZA 3MM6A 4NI2B 1BLUA 1XN9A 5B0BA 4KGXB 4DF8A 4J9VA 2CNNB 3GSDA 4RNHA 2V2ZA 2WCXA 3BPSP 1ZAVA 1N48A 3ISND 1EHWA 4LF8F 5DETA 2KXFA 4JI2J 3MEDB 3EDQB 1TL4A 4LFAJ 3BO4A 3DOKB 1YJ7A 4LFBF 2XMWA 2YWEA 2ZOFA 4E2FB 1U47A 3TO8A 2DBBA 3MR6A 3IBWA 3PHTA 4QR2A 5CCLA 1VLYA 1X4FA 4ZCIA 2D74B 3SQGB 2V50A 1GEHA 2GA7A 3RB4A 4G3IA 3ILLA 2I6WA 3FSYA 1UL3A 2CPEA 2DGWA 4AXIA 4MH8A 1A7GE 3AOCA 4JI0F 4OZ3A 4RW7B 1XQIA 1M5PC 1N5YB 1XR5A 4M5JA 2K7KA 4P2MA 1T0TV 2BX6A 4F25A 3HT0A 3KHRA 2AP6A 4DPOA 3T1HJ 2DHHA 2GVZA 3KXDA 2ZDOA 1WOOA 1XWLA 4WK1A 3V4MA 2BQ3A 1RT5A 4XPEA 3AA9A 2FLOA 2WBRA 5J1NA 5DM6Q 2V68A 1PBUA 3AB2B 1FA0A 3VWSA 1D9AA 4K5SA 2O67A 3CJTA 3H0PA 2B6AA 4ID5B 3BGFA 4OYBA 3NGKA 4DX8H 1W25A 2P9CA 3GYXB 2MJNA 3B82A 3A8JA 3GJQB 1VJWA 2NXUA 1RAFB 3DRSB 4YFUA 1TAQA 3U27A 1M5KC 2WOMA 2KG1A 4IUFA 2RS2A 1U1MA 3UWTA 2H9ZA 5A8RB 3O5TB 4QW9A 3K8WA 1ZBTA 1Z2ZA 3B8HA 2ZVSA 1F5BA 1SB6A 4X4UA 2ZH9A 6FDRA 3HSDA 4LJMA 2CQBA 1UVMA 5EDWA 4Q45A 3GIJA 1Q8LA 4RW7A 2ZBPA 2DPIA 2A3JA 1R8CA 3PO5A 5DDPC 2KXHA 1FTRA 3NGDA 1C4AA 4F02A 2JFDA 2FVRA 1YKWA 4P2FA 1HNZJ 4MIAA 1S99A 5FLXY 1YI2S 5ETOA 2YNGA 4K59A 2GHPA 4X66F 2MZTA 1YBUA 2IIHA 1N88A 5E2QA 4YY3F 2J0SD 2MEWA 1QTNB 2N7YA 4KGVB 4PWDA 1NK0A 2IM3A 4USWA 1RTHB 3GILA 3BGRA 4ICLA 3QFWA 4DL3A 3MZIA 3IG1B 3GIKA 3D0HE 4I67A 4XDDA 3DRSA 3TUIC 3D6MB 5JVGQ 2EFGA 2AIRB 4CNYA 3LWLA 3DRYA 5EWEA 3OTDA 1Y3KA 4ATNA 2AJ2A 5HP1B 5A8RA 2ZHOA 4ZLPA 1T94A 2K8GA 1HBOB 5KFVA 1U2FA 3CDAA 4ZPVR 4F3QA 4CH1A 1SH0A 2IFXA 2WVCA 3M9MB 4M5DA 4MKAA 2K3IA 2CQPA 5B0CA 3DOMB 4EBCA 4PQUB 2IYGA 3CC2S 4XTTA 3C66A 4LQ9A 1IKWB 1KNZA 1VC5A 2PMWA 1T9YA 2R7OA 1OPZA 4WWSA 2CNKB 1J5OB 3RBXA 3T1AA 2E5LF 1EJ7L 3OFHA 2AW0A 1F2GA 4J7CA 2HRTA 2J8SA 2BBEA 1JLCB 1R0AA 3B4DA 1FJEB 4DR6J 1X4BA 3TX8A 2XB2D 1JXVA 3GIMA 2AU0A 2FYXA 1N8RT 1NHKL 2UVUA 1D9FA 3PIOQ 3I9ZA 3BYPA 1FJ7A 3PKMA 4RPFA 2A10A 1UWAA 3CJSA 4ECVA 2ZH3A 1JLQB
chains in the Genus database with same CATH topology
3J7AN 2KL8A 4YY3J 4JI6J 1J5EJ 4GKKJ 2UU9J 2MTLA 1I94J 4JI4J 1FJGJ 5AJ3J 2E5LJ 4NEYA 3T1HJ 4JI3J 4JI8J 4AQYJ 4LF5J 4B3SJ 4V1Ak 2UXBJ 4JI5J 1IBKJ 4JI7J 2KVQE 4DV5J 4PWWA 2HHHJ 1N32J 4DV6J 1IBMJ 5A2QU 4NXMJ 4B3MJ 2UUBJ 4KY3A 4DV0J 3IMQJ 4DV1J 2UUAJ 4JI0J 4DR4J 1XNQJ 3T1YJ 4KYZA 4JI2J 1HNZJ 3R2DJ 4DUYJ 3JAMU 4B3TJ 4DUZJ 4DR5J 4LF9J 4NXNJ 5BR8J 2VQFJ 2VQEJ 4LFAJ 4GKJJ 3D3BJ 4DR2J 5LMUJ 4DV3J 4DV2J 1XMOJ 3J81U 4DV4J 1XMQJ 1XNRJ 2UXCJ 4B3RJ 4DV7J 4RJVA 2MEWA 2UUCJ 2ZM6J 4K0KJ 1HNWJ 2MQ8A 4LF7J 4JV5J 4X65J 4YHHJ 4LF6J 1N34J 3R2CJ 4JYAJ 4DR6J 5FLXU 1IBLJ 4LF8J 5IT9U 4X62J 1N33J 4DR3J 4NEZA 5LM7E 4X64J 1HR0J 3W1YC 4HHUA 1N36J 4LFCJ 5IWAJ 4DR7J 4DR1J 4OX9J 2UXDJ 3OTOJ 5LMNJ 4KHPJ 4JI1J 4LFBJ 3J80U 2F4VJ 4X66J 4LF4J 1HNXJ 3D3CJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A N;  2KL8 A;  4YY3 J;  4JI6 J;  1J5E J;  4GKK J;  2UU9 J;  2MTL A;  1I94 J;  4JI4 J;  1FJG J;  5AJ3 J;  2E5L J;  4NEY A;  3T1H J;  4JI3 J;  4JI8 J;  4AQY J;  4LF5 J;  4B3S J;  4V1A k;  2UXB J;  4JI5 J;  1IBK J;  4JI7 J;  2KVQ E;  4DV5 J;  4PWW A;  2HHH J;  1N32 J;  4DV6 J;  1IBM J;  5A2Q U;  4NXM J;  4B3M J;  2UUB J;  4KY3 A;  4DV0 J;  3IMQ J;  4DV1 J;  2UUA J;  4JI0 J;  4DR4 J;  1XNQ J;  3T1Y J;  4KYZ A;  4JI2 J;  1HNZ J;  3R2D J;  4DUY J;  3JAM U;  4B3T J;  4DUZ J;  4DR5 J;  4LF9 J;  4NXN J;  5BR8 J;  2VQF J;  2VQE J;  4LFA J;  4GKJ J;  3D3B J;  4DR2 J;  5LMU J;  4DV3 J;  4DV2 J;  1XMO J;  3J81 U;  4DV4 J;  1XMQ J;  1XNR J;  2UXC J;  4B3R J;  4DV7 J;  4RJV A;  2MEW A;  2UUC J;  2ZM6 J;  4K0K J;  1HNW J;  2MQ8 A;  4LF7 J;  4JV5 J;  4X65 J;  4YHH J;  4LF6 J;  1N34 J;  3R2C J;  4JYA J;  4DR6 J;  5FLX U;  1IBL J;  4LF8 J;  5IT9 U;  4X62 J;  1N33 J;  4DR3 J;  4NEZ A;  5LM7 E;  4X64 J;  1HR0 J;  3W1Y C;  4HHU A;  1N36 J;  4LFC J;  5IWA J;  4DR7 J;  4DR1 J;  4OX9 J;  2UXD J;  3OTO J;  5LMN J;  4KHP J;  4JI1 J;  4LFB J;  3J80 U;  2F4V J;  4X66 J;  4LF4 J;  1HNX J;  3D3C J; 
#chains in the Genus database with same CATH topology
 4OFZ A;  2O01 C;  3EGV A;  5K8N A;  3GG0 A;  2DKO B;  3TI0 A;  4I4B A;  4ZVP B;  2XHW A;  4WF9 Q;  2B43 A;  3CD7 A;  3U1N A;  4MYU A;  4PYA A;  2JNJ A;  3LPY A;  3ULH A;  1YVF A;  5B0E A;  1A0O B;  3KLF A;  2JLG A;  4IH6 A;  1TMM A;  1K9M T;  5L1J A;  2D41 A;  4PZV A;  5HRO A;  1LWC B;  4PG4 A;  4AYB D;  1FDA A;  3W9H A;  1X5P A;  1S6Q B;  5E3Q A;  1IKV B;  4QR0 A;  3DLH A;  5LL6 d;  3N6M A;  2YNF A;  1VQO S;  2DRD A;  4BS2 A;  4N7T A;  3QT7 A;  1RLD A;  3BSN A;  3TAQ A;  4HHH A;  1TP7 A;  4LF5 F;  1GX5 A;  2BOP A;  3BO2 A;  2ZBQ A;  3CIM A;  5A8W B;  2C2E A;  4WU2 A;  4KRW A;  2H1Y A;  3E51 A;  4X64 J;  3D1H A;  1JMT A;  2AGP A;  2VDH A;  3AH6 A;  4DUY F;  2H4Y B;  3T5J A;  1UJ4 A;  5DQG A;  1VIO A;  1WG1 A;  2FZC B;  4DV2 F;  1QUP A;  3M9O B;  3JAM Y;  1BWE A;  2XGQ A;  2EFV A;  4K4W A;  4RNO A;  4MKB A;  4AQY J;  1UA0 A;  2W2N P;  1XTZ A;  2XMU A;  2V2K A;  4DV5 J;  3W2W B;  5B0G A;  2HRU A;  1FTC A;  2G2Y A;  1NHU A;  3HHN B;  1REV A;  4P7T A;  3AJD A;  4JB8 B;  4K5R A;  1Q7L B;  3I0R B;  1U48 A;  5LSR A;  4DN0 A;  4XK8 C;  4IYQ A;  1R3N A;  2DIS A;  1RE1 B;  4QQB A;  1SV5 A;  1J5E F;  5KFI A;  4B3O B;  1UVL A;  2DIT A;  2YKN A;  3K5O A;  1IKV A;  3DI6 B;  1C0U B;  3HI9 A;  4ZOS A;  4ZPW R;  2AJ4 A;  2B8Q A;  1TZ0 A;  1B99 A;  4CTA A;  2LP4 A;  2HAF A;  3BS9 A;  2E1A A;  2WVE A;  3A8K A;  5FJ4 A;  2RUS A;  2IM0 A;  1TV6 B;  2NSC A;  4FKX A;  4YB7 A;  5JVH Q;  2N4D A;  4KH1 B;  2C28 A;  1TKX B;  3MMC A;  2CPY A;  1NPP A;  4C11 A;  2GJ2 A;  1RQ0 A;  1C0T B;  2R7Q A;  4AND A;  2IMO A;  1X5O A;  2B3T B;  5D15 A;  4JI8 J;  2LQ5 A;  1XC9 A;  3AD7 C;  2JVR A;  4ELT A;  2GW8 A;  3KK2 A;  3TOQ A;  4KKO B;  3SI8 A;  1B70 B;  1GXT A;  1SL1 A;  5LJ5 Y;  1NKC A;  1S10 A;  2KYX A;  4NCG A;  2QA4 G;  1OPI A;  5ITH A;  2AX0 A;  2BKO A;  3EZO A;  2B7B B;  4Q7A A;  1JLB A;  3H2L A;  1VQN S;  2WAQ D;  2L3M A;  1RAJ A;  4DV4 J;  2VA3 A;  4DPX A;  1XNR J;  1TKZ A;  3ZFV A;  2KXN B;  3KLI A;  2NYI A;  2M0G B;  2OD6 A;  4TY8 A;  4KHR A;  3JQM A;  1FEE A;  2ZHB A;  2AJ0 A;  2Y1I A;  3CO9 A;  2XUL A;  3MM7 A;  3UE2 A;  3RB0 A;  2V69 A;  2WVD A;  3CCJ S;  1P9Y A;  2H4W B;  1SC4 B;  4JI2 F;  3DI6 A;  3K2Y A;  5A0Y B;  2ZKU A;  2CIM A;  4LFA F;  4HLB A;  3J81 j;  4WZQ A;  4CP5 A;  4MAK A;  2RNE A;  2KTQ A;  4WFX A;  2HHX A;  3CD6 S;  2C2O B;  3GFH A;  1VHF A;  2FJX A;  2R2S A;  2V5H G;  3OLA A;  4GVL A;  2AV5 A;  4P9S A;  1IBK J;  2GIQ A;  5D0H A;  4USH A;  1W2B R;  3HK2 A;  2C2M B;  4Q8F A;  1PBA A;  2QA1 A;  2Z8Q A;  1BE4 A;  1WTB A;  2IC3 B;  1U1R A;  2W2O P;  1UPM B;  2R7X A;  4RBU A;  2ZBR A;  4B02 A;  5HAT A;  4OX7 A;  5T41 A;  2HIQ A;  2ROE A;  2AHO B;  3KDN A;  4B3R J;  4K7Q A;  3C19 A;  2XS7 A;  4IFY B;  5AE3 A;  3T1H F;  4U96 A;  3SDE A;  4TYB A;  1T9V A;  1JJ2 R;  3FQL A;  3VQS A;  3MR7 A;  1WEX A;  1A9N B;  4ZVE A;  1SKR A;  3R7B B;  1PCA A;  2DNM A;  5M2R A;  1DHM A;  2GQQ A;  4J9M A;  2IDL A;  5J1E B;  2ZKT A;  2QC3 A;  3WX8 A;  1WD6 A;  3NNH A;  3DLL Q;  4URG A;  5GAH I;  4KFB A;  1TFY A;  2AJQ A;  2MDA A;  4QBU A;  3M8Z A;  3J7Y U;  1QUV A;  2MKK A;  4JI6 J;  5F8G A;  1TL5 A;  3QRR A;  3LH2 S;  4TVA B;  1NSQ A;  4B9L A;  1HHS A;  2EG2 A;  5E0O A;  3IRX A;  1RT7 A;  5IOL A;  3GB0 A;  5HMW A;  4J9U E;  4L3K A;  1VGY A;  4WZM A;  2EBE A;  1F3F A;  1NDK A;  4KC5 A;  2IYI A;  3CCL S;  2M2B A;  4QU7 A;  3JTO A;  4J9R A;  4DPW A;  5C25 B;  5DG9 A;  5KOW A;  4NLO A;  2DO0 A;  2XHC A;  4FXV A;  2UUC J;  3VR1 A;  1HI1 A;  1U1N A;  1VQL S;  2RIL A;  3C6U B;  2HLT A;  4LF7 J;  2XLI A;  4CWB A;  3OL7 A;  3C15 B;  4X65 J;  4X2B A;  2YKM A;  2BM0 A;  1KC8 T;  5HI7 A;  1BHN A;  1X4A A;  1GMU A;  5E41 A;  5D4L A;  4KPY A;  1S0N A;  1HNZ F;  5B09 A;  1S7I A;  2N82 B;  2VG5 A;  1EQ0 A;  3VTI A;  3KFW X;  5ETV A;  5K5M A;  5ETN A;  1R6V A;  2MTL A;  3UR0 A;  2LA6 A;  1SCJ B;  3ZTS A;  1ELO A;  1EQM A;  4DG1 B;  1YJ9 S;  2HFV A;  3WC0 A;  1TK5 A;  2XZW A;  3JS9 A;  3H8Y A;  2C42 A;  1S0M A;  2F8E X;  3N0V A;  3CSK A;  1S1X A;  3EPI A;  2DNP A;  1CJV A;  5HJY A;  4FN5 A;  3AQO A;  2IAJ A;  1FKO B;  2J76 E;  2R3V A;  1DAR A;  2CKW A;  3D9B A;  1AZS A;  3LO3 A;  3PIP Q;  5C5J A;  1NJW A;  5HLF A;  2J9D A;  4J5O A;  1RIS A;  3CW2 C;  2JLE A;  1TR0 A;  7FD1 A;  4K0K J;  2QT7 A;  5G0R A;  3J7Z 5;  1V3Z A;  3UD4 P;  1BWV A;  3UO0 A;  1FRJ A;  1VC0 A;  5HMY A;  3GR0 A;  3RAM A;  3AOB A;  1ARO P;  1LK7 A;  4IKA A;  1S1U A;  1Z1Z A;  1HNI A;  2A0F B;  1JLE A;  3FSX A;  2HZV A;  1CS4 B;  5IT0 A;  4ZVF A;  3SCK E;  5EX3 A;  1LXN A;  3KTQ A;  4K2X A;  3KJV A;  1MNE A;  4J9N A;  2W01 A;  1T9X A;  3PJ9 A;  1YRT A;  1OSD A;  3SFG A;  3KK3 B;  2HQC A;  1NK5 A;  3HVR A;  2N4C A;  4A8M P;  4WFN Q;  2VDI A;  2D1C A;  2VKZ G;  3GWC A;  2PGC A;  2M4M A;  4DR6 F;  5GMD A;  4RZR A;  2DHX A;  3QIP A;  2I0X A;  2MHN A;  3HX9 A;  3T1Y J;  3VAM A;  4WFA Q;  3PM9 A;  3T3F A;  1SJ4 P;  1ZA1 B;  3TA0 A;  1GMW D;  2XEX A;  4WFY A;  1Q86 T;  4DEZ A;  4NA2 A;  2HHU A;  1NME B;  3L7U A;  5KOX A;  1H7X A;  4B9V A;  1FKO A;  4CLK A;  3IFE A;  2IBO A;  5KFM A;  1YJN S;  2BJ1 A;  4BCA A;  3ZZZ A;  2FJE B;  4N5S A;  3MPW A;  2BJ9 A;  4I64 A;  2D3O R;  2WON B;  1GX6 A;  2AKW B;  1RAI B;  1TKT B;  2XTJ P;  3KLE A;  1VR6 A;  5K8M A;  3G6V A;  2J0X A;  3BV8 A;  3H7H B;  4M94 A;  3TAM B;  2MB0 B;  1RBA A;  4RLE A;  3R97 A;  1G4C A;  3OJS A;  2V4J B;  4CLF A;  3K8V A;  4JI3 J;  2A2D A;  1FDB A;  2QL5 B;  3SMZ A;  1UFK A;  3FFI A;  2H48 B;  1N0U A;  3FCH A;  4CO2 A;  2BJE A;  3POT B;  3LGM A;  4C0H A;  2U2F A;  2HZA A;  2L9N A;  4X64 F;  1T9T A;  3DLJ A;  5IM0 A;  3PEH A;  2FZK B;  2VBZ A;  3TP2 A;  4DF4 A;  1QE1 A;  1CVJ A;  2I8E A;  1VQS A;  4IR1 A;  2XYH B;  4DV7 J;  3TEH B;  1NK7 A;  1LK5 A;  2FIU A;  2OJ3 A;  2ZM6 J;  4AQY F;  1HNW J;  1MLA A;  4F0H A;  4NLU A;  3L9Z A;  2IRX A;  3CDW A;  3EWG A;  4DV5 F;  5KT4 A;  3IBC B;  4ZPB A;  1RGV A;  2DGU A;  4PUO B;  3L7O A;  4CNZ A;  4UQT A;  5J2N B;  5CD4 A;  1T9W A;  3P5T L;  4TKT A;  3MPY A;  2BVZ A;  4G65 A;  4FKY A;  4LVN P;  3IP0 A;  1EIY B;  2IJN A;  2HHP A;  1FFW B;  1LW0 B;  1VCT A;  1G7C B;  2IM1 A;  2LFV A;  4UOF A;  1TKT A;  3O3L A;  2M52 A;  6FD1 A;  4EFA C;  1N6Q A;  3GMG A;  1R0B G;  3OTC A;  3SSR A;  1RTD B;  2J9D E;  3DM2 B;  3CDU A;  2KHC A;  1TUW A;  4RR5 A;  3DOL A;  1S59 A;  1AUS L;  1RJJ A;  1TL3 B;  4DQI A;  3PW4 A;  3AOD A;  3AHP A;  3M2R B;  4AE5 A;  3Q8V A;  3CCM S;  1KHW A;  4BLG A;  4ES1 A;  1YZ6 A;  3AA8 A;  4LSL B;  1P1T A;  1XR6 A;  2C2N A;  1S79 A;  1U1L A;  4Y65 A;  2CQ1 A;  1QY7 A;  3NKY A;  2JWN A;  2RF2 B;  3F73 A;  4JI8 F;  2HEK A;  2GZO A;  2VON A;  3ET6 A;  4NX9 A;  2YQ3 A;  5KFE A;  4UF4 A;  3I56 S;  1WG5 A;  5A8K B;  3D6T B;  5DZ6 A;  2Y9H A;  4K4S A;  2IDE A;  2OO4 A;  3MI7 X;  1RT1 A;  4DL6 A;  4FDF A;  4MFB B;  2V2Q A;  2D3U A;  3SZ2 A;  3QMQ A;  4DV4 F;  5HQ8 A;  1XNR F;  1EAR A;  5CYJ A;  4CI0 B;  3VAL A;  3CJR A;  5HBM B;  4OYA A;  2BE2 B;  1LW0 A;  4ECY A;  2DNZ A;  2R2U A;  4YR2 A;  2VG7 B;  4PG6 A;  1WF0 A;  1HAR A;  1H72 C;  4DV1 J;  4HAC A;  2V9W A;  3MPV A;  1MRO B;  4B3T J;  2J9C A;  3DM2 A;  3RZA A;  2HGM A;  4YB6 A;  1TL3 A;  2YPZ A;  2W8L A;  3CUL A;  3EGZ A;  2B0G A;  4L74 A;  2ILZ A;  4UOH A;  2CG4 A;  3IM9 A;  2ZE2 A;  2QLF B;  1IBK F;  2HGL A;  3R5A A;  3S6E A;  5F8H A;  4LSZ B;  3S8S A;  4FS2 A;  1X9W A;  2M7S A;  3DKD A;  2VFV A;  3VAG A;  1CJT A;  4PYD A;  4TN2 A;  3N4W A;  1SJ1 A;  1PSD A;  4DJB A;  5FD1 A;  1DQ9 A;  4B3R F;  2W2P P;  4PR6 A;  2GHV C;  3FEY B;  4L72 B;  2VOP A;  1VIS A;  2YVS A;  3GON A;  4JI5 J;  1X4D A;  4WTO B;  2HS3 A;  2FDN A;  3EVW A;  2R2T A;  2MPU A;  1FX4 A;  4W90 B;  4AL6 A;  4DV0 J;  2F8M A;  1OIA A;  2MST A;  2BKN A;  3SSS A;  4MK8 A;  3W61 A;  5J2P A;  1S9F A;  2XY7 A;  3OVB A;  2FHJ D;  3BZQ A;  3Q83 A;  4OHX A;  1LW2 A;  2I5J A;  1NO8 A;  2KRB A;  2V6A A;  2KO1 A;  4JI6 F;  3CED A;  3DRR B;  1Y5I B;  3PDN A;  1PAU B;  2C2K B;  2VIH A;  4FXW A;  1XR7 A;  1NCL A;  1NDL A;  4Y6I A;  2XLK A;  2QFI A;  2LA4 A;  1TK8 A;  3MUV P;  2D9O A;  2K06 A;  1IM6 A;  4RW4 B;  5IWA J;  5KFK A;  4IRD A;  4OX9 J;  1H6K X;  5L8R C;  1IR1 A;  3ETO A;  2RKI A;  3MTJ A;  4WPA A;  3ITH B;  3RTV A;  5H1S V;  1RAO A;  3VV2 B;  3IGV A;  1GXL A;  2CZV C;  1RAB B;  2UUC F;  4WTY A;  2ILY A;  4OJH A;  1Z4U A;  4ED4 A;  2B9W A;  1NSP A;  4LF7 F;  4N76 A;  4JI7 J;  1TFW A;  1Z2L A;  4X65 F;  2A6M A;  2ASL A;  4DV6 J;  3OXL A;  4ILL A;  4LSN A;  3G82 A;  4QPT A;  4F7V A;  4ES2 A;  2XS2 A;  5D6G A;  3CO0 P;  1SI9 A;  1D1U A;  4NXN J;  1CJU B;  1S48 A;  4C0B A;  4PPZ A;  1NJX A;  1R27 B;  1RUS A;  4CLL A;  4F0K A;  1I6J A;  3VAI A;  1AA1 B;  4URQ U;  3PX4 A;  3M6V A;  2FZG B;  4ZVR B;  2RB7 A;  3TVK A;  1HWL A;  2DNG A;  4DSF A;  1T03 B;  3GE9 A;  1U1O A;  1XJW B;  1CSJ A;  5DM7 Q;  1KBR A;  4YS2 A;  1U6F A;  1Y4Z B;  4DL4 A;  3D68 A;  4CO3 A;  3DLG B;  3PVX A;  2ZC4 A;  3SBM A;  1T05 B;  3THP A;  3DCA A;  2BJ3 A;  4CLT A;  2NRE A;  1VQ6 S;  4RW6 A;  3W66 A;  1LFW A;  3D6F B;  2GML A;  3GV8 B;  2AD9 A;  4KJI A;  2CPH A;  4EYH B;  2IY5 B;  2BDP A;  1T7P A;  2W4P A;  5BYQ A;  3R5D A;  4H4O A;  2PMZ D;  4OYW A;  2CJY B;  1DTQ A;  5KG7 A;  2O1P A;  3MM8 A;  1O8B A;  1E6V A;  2ABY A;  4K0K F;  1KN6 A;  1ZZF A;  5E33 A;  5DZ7 A;  4OI3 A;  3BDP A;  3W7B A;  4F4W A;  1U0H B;  3V5R A;  4FF4 A;  1HWI A;  3UN3 A;  1N5Q A;  5LXR A;  5KFC A;  2YKP A;  7AT1 B;  2MGZ A;  1JWW A;  2AJF E;  5I3U B;  3HVA A;  4I7F B;  1FD8 A;  2PD1 A;  1BGX T;  5HK4 A;  3QJP A;  1RBL A;  4WXW A;  1X8D A;  3F56 A;  5HVG A;  3M7V A;  2J6U A;  5J2Q B;  3MUR P;  1X5S A;  3KDO A;  1KOH A;  2YNH B;  4P6Q A;  5B7W A;  4QW8 A;  1PG5 B;  1WKL A;  3T1Y F;  1EP4 A;  4NCA A;  3KK1 A;  4DR1 J;  4AUK A;  4Q44 A;  3DLG A;  1JLG B;  2LXU A;  1PC5 A;  3PTW A;  4GVB B;  5KFA A;  2V8D A;  2GGP B;  1BQX A;  3RYL A;  1CQN A;  1X4H A;  3EVM A;  1UEV A;  4DU7 A;  3O6Q A;  2AQ4 A;  1BUX A;  1IKX A;  2GJI A;  1Y9O A;  3ONQ A;  3SFU A;  4NWB A;  3QO9 B;  1DLO B;  2N7C A;  3PW0 A;  4EU0 A;  3W5Y A;  4DCP B;  4QPX A;  2APO A;  3IGN A;  1YRU A;  4LF9 J;  4TLQ A;  3D3B J;  2KT2 A;  3OUY A;  1HI8 A;  2EKY A;  4IDK B;  3UDC A;  3MFH A;  2QJ3 A;  3S7R A;  4ILM A;  3P49 B;  2I1R A;  4DMZ A;  4DCJ B;  3MAA B;  3H4D A;  1HMV A;  4JI3 F;  5IC6 B;  4JBC A;  3EXC X;  1K0V A;  2ZWP A;  3V6D B;  1NK9 A;  1FO1 A;  1HBM B;  2HQD A;  5IZH A;  4DPY A;  4B9N A;  1WF1 A;  4OZ0 A;  1KHV A;  2MKJ A;  2KFZ A;  3I5C A;  3I4H X;  1LWX A;  3PXG a;  1VRT B;  4HDH A;  2CJ9 A;  2CPD A;  3LOU A;  4H54 A;  4Z7Y A;  3OVA A;  4DV7 F;  5HQM A;  4GC6 A;  1DUR A;  2QLW A;  2ZM6 F;  1FXD A;  1HNW F;  1LWE B;  3GII A;  2E1P A;  4Y34 A;  2DGS A;  4HVZ A;  3DLB A;  1HWU A;  4OZL A;  4K2J A;  5C2G A;  3D5M A;  5I4M A;  2X7I A;  3W9I A;  2W9C B;  4QIF A;  3C16 A;  4EK2 A;  4M63 A;  2XMA A;  2X1B A;  3R2D J;  4J9Q A;  4DZD A;  3O8W A;  2RQ4 A;  2M8D B;  4KGM A;  2RRN A;  2XZD B;  2BAN B;  4ERD A;  1JJ4 A;  3NCR A;  1TUG B;  2F5G A;  4M8L A;  3HFK A;  1S1T B;  1S1V B;  2JEG A;  3PJW A;  1UVK A;  4IR9 A;  3NAH A;  3G6E S;  4JYA J;  3MCM A;  4ZDN A;  2RS8 A;  3QPI A;  4NRT A;  1RXO B;  2DXF A;  4Q2M A;  3NBP A;  2MXY A;  1RT6 B;  5L39 A;  2RH3 A;  4J91 A;  3R5J B;  2HAI A;  3A3O B;  4CDI A;  3VGU A;  4AXJ A;  3OR2 B;  3R27 A;  1BQN B;  5C24 B;  1FEH A;  3HHL B;  2QN6 B;  1VRT A;  3NAI A;  1UAW A;  2ZUA A;  3MWB A;  1U6Z A;  3ZZ0 A;  2BV3 A;  3IS9 B;  4CM0 A;  2V67 A;  4TU8 A;  4N41 A;  2JRS A;  1NDC A;  2HBY B;  3VGT A;  2HBR B;  3HZE A;  5D78 A;  2MZ1 A;  2HNY A;  4J9K A;  3PO4 A;  4O3N A;  3RR7 A;  3UI3 A;  3BBB A;  3BBF A;  1AXQ A;  5F41 A;  1RT2 B;  9RUB A;  2A1B A;  2VD3 A;  4UZB A;  4NRU A;  3Q0A A;  2UV8 G;  3KHL A;  5DJB A;  1SL2 A;  1NU4 A;  4Y28 C;  3H90 A;  4F4Y A;  3OJU A;  2RIJ A;  3KUH A;  3G9C A;  4DR3 J;  4DV1 F;  1IJE B;  4ECZ A;  2F9J A;  1CQM A;  4ER8 A;  1ZM3 A;  2XNR A;  1CPZ A;  4B3T F;  4DX6 A;  3JSM A;  5BYS A;  1ZET A;  3DDI A;  2UVW A;  4B9U A;  2BW2 A;  2DNK A;  2KZZ A;  2DVI A;  3H20 A;  1B0T A;  2F7V A;  5CHC B;  1RZM A;  1X4E A;  3PFO A;  3BH7 B;  1TQL A;  3BKU A;  3ZZY A;  3DFE A;  3LAK A;  1HFE L;  4IG3 B;  5KFQ A;  2AEF A;  4PAB A;  5I42 A;  3G2X A;  4DR4 J;  2B8P A;  2WSE C;  1OO0 B;  2XSF A;  2VQF J;  1KQG B;  1WUU A;  1O0P A;  1VQ7 S;  1RAG B;  3ENV A;  4DV3 J;  2GQ2 A;  4OHY A;  3IS9 A;  5KAK A;  3J81 U;  2YX1 A;  4F8R A;  2HQ3 A;  3H2U B;  3CDB A;  2PO4 A;  2AT1 B;  2LCW A;  4F4X A;  2PDA A;  4USU A;  4JI5 F;  4ECS A;  2PE8 A;  5F8N A;  2HNZ A;  4NOH A;  2W2M P;  1X9M A;  4TU9 A;  4IH5 A;  5AXK A;  4DV0 F;  2ZBC A;  2E5G A;  3HP6 A;  2UV8 A;  2Z2Z A;  4RW9 A;  9ATC B;  1N36 J;  2RDJ A;  5E3C A;  1RKI A;  2YNI B;  4LF4 J;  2WSC C;  2IRU A;  4A8W A;  1F0X A;  2FHM A;  3RW7 A;  2QL9 B;  2FB0 A;  3CXC R;  4V1A k;  1RWK B;  5AT1 B;  1RWP B;  2FPH X;  2XLJ A;  1X4G A;  4X4N A;  1CUL A;  3HZG A;  3GFZ A;  2VJU A;  2VFU A;  5IWA F;  4OX9 F;  2QSW A;  4A8S A;  3ZTO A;  4ZVQ B;  5BJR A;  2QFJ A;  4ECR A;  1VBK A;  5AE1 A;  2R8J A;  3BH6 B;  3BKF A;  2FY1 A;  1S9G A;  3UVJ A;  2GJF A;  4Q0B B;  2RHQ B;  4JOU A;  5CQG A;  3TYT A;  1VBY A;  1RTI B;  3M8P A;  4DV6 F;  3DLE B;  4A48 A;  2J6S A;  1N33 J;  4GRS A;  4HKQ A;  2MKI A;  4EZ6 A;  4I2P A;  1JX4 A;  4RNN A;  2W4C A;  3IXQ A;  3HDS A;  2NYH A;  1VDH A;  4CYU B;  4NXN F;  1U6B A;  5JJB A;  2VIC A;  2YBV A;  4XAK A;  4EEY A;  1WC5 A;  3KNA A;  2DH9 A;  4QIW D;  2R4F A;  2OEJ A;  4O4R A;  3UCZ P;  1RK8 A;  5DQI A;  3ZNJ 1;  4U7U D;  1W26 A;  2XMK A;  4NLY A;  1BQM A;  3JSB A;  3MGJ A;  1V5V A;  1HPZ A;  1OJ4 A;  3THT A;  1Q0N A;  1J27 A;  2AZ1 A;  4CM2 A;  4YUD A;  4O23 A;  2AYG A;  3MCS A;  4AL5 A;  4A4J A;  3MEE B;  3GCW P;  3NOC A;  4JV0 A;  1PJ5 A;  3W65 A;  2DY1 A;  1YJW S;  1JNR B;  5IFM A;  2XCP A;  1NB2 A;  1IVZ A;  3CCS S;  3D0I E;  5H9E K;  1NAQ A;  5IS2 A;  2HFO A;  2WW4 A;  2DRA A;  3GG1 A;  4DOZ A;  2X3G A;  2CAJ A;  5LJ3 Y;  1N56 A;  3CCW A;  2EFP A;  3EUN A;  2KRR A;  4UUW A;  4RUB A;  5D3G A;  1RP5 A;  1VS3 A;  1RWX B;  4IRK A;  4BWM A;  1Q8B A;  3MM9 B;  3PX6 A;  1HW9 A;  3BN4 A;  2ZOG A;  2F63 A;  3NS5 A;  1RWN B;  2OIH A;  5F3T A;  4NYO A;  3TA2 A;  1RTI A;  3TEG A;  3DLE A;  2CQI A;  3RRH A;  4F67 A;  2OPP B;  3PZP A;  5D0R A;  4RBT A;  2Q43 A;  2Q6C A;  1LKZ A;  3PW5 A;  3KYL A;  3W8G A;  2ATC B;  4QIE A;  3AXK A;  3MMA B;  2MY8 A;  3V81 A;  1FVQ A;  1M0S A;  2HS4 A;  3KLV A;  2LQ8 A;  2ZH4 A;  4NLQ A;  3MPU B;  3M1V A;  1HNV B;  1HYS A;  4PXE A;  4MT1 A;  3MR2 A;  2HQG A;  4OYX A;  1EET B;  2PII A;  2HK3 A;  3NGT A;  4A8K A;  4DR1 F;  3G8T A;  4P10 A;  2C2R A;  3WX4 A;  3UD5 A;  1U24 A;  2DCU B;  2FGC A;  1U2R A;  4RX6 A;  5F0U A;  2CYY A;  1L3K A;  3FZ2 A;  1KRP A;  2Y0S D;  4QWB A;  1FRL A;  1KTQ A;  5IT9 U;  3P3D A;  3OLB A;  1SUQ B;  3TA1 A;  5E3R A;  3BQ1 A;  3IA0 A;  1E6Y B;  4LF9 F;  1RT4 B;  2CQH A;  1DY3 A;  1Q8I A;  1VQK S;  3RUB L;  2G1H A;  2HBQ B;  1VRU B;  3R5C A;  4WP8 A;  3CC7 S;  1V3R A;  3Q8Y A;  3FC9 A;  2HHH J;  2BAC A;  3B54 A;  3L09 A;  3TNV A;  4R8U B;  1FNM A;  4IQM A;  4RW8 A;  1WC6 A;  1OYD A;  3K57 A;  3Q86 A;  3QZ7 A;  1LWF B;  1YLX A;  5G4D A;  4FF2 A;  2JH3 A;  3DYA A;  5M2P A;  1FRX A;  3DLK B;  4A8O A;  4EBD A;  2EPI A;  3QFH A;  2FHO B;  2E7X A;  5B0A A;  2KYZ A;  4CLW A;  3QLH A;  1SL0 A;  4FZV A;  3HFZ B;  2G0I A;  4PXB A;  5FLX U;  1MU2 B;  4KB7 A;  5CYQ A;  1P6T A;  1S6P B;  4M5I A;  3PV8 A;  3M8Q B;  3QGH A;  2KH9 A;  3J81 Y;  3N9U C;  3DMJ A;  4FS1 A;  2CQ0 A;  3JB9 k;  1X31 C;  4KPC A;  1JLF B;  3T9N A;  2HK2 A;  4U67 Q;  2QLX A;  3M32 A;  1SJR A;  1JQG A;  2OPQ A;  1LV5 A;  3LPE A;  1UW4 A;  1VQM S;  1IBM J;  4JYA F;  5ETS A;  3MMB B;  2MQM A;  1QSS A;  1VRU A;  1QD1 A;  4M5H A;  1TL7 B;  2W9B B;  2GS8 A;  3BKT A;  1L5U A;  4P52 A;  4UZC A;  4U7C A;  2VQE J;  3KMQ A;  2NUH A;  1SBR A;  5KFW A;  4NAS A;  2GMJ A;  1LFP A;  5KFR A;  3UD3 P;  4LT6 A;  1H2U X;  1H73 A;  4FF1 A;  3HCX A;  2ZZN A;  1NK8 A;  4NYP A;  4X4S A;  4FPR A;  4OL8 A;  1RTJ A;  1FI4 A;  5CD4 H;  4YHH J;  2NQP A;  4UY8 T;  3S01 A;  1IQT A;  1BY9 A;  2V8G A;  4RNM A;  2LYV A;  3V6H A;  5IV3 A;  5LM7 E;  2FLN A;  4OYO A;  1M5O C;  2ZEJ A;  2ZWO A;  4LQ3 A;  1MN7 A;  4ZS6 A;  2BMB A;  2C2D A;  2IVF B;  3CJ3 A;  3DGP A;  2QLB B;  2DIU A;  2XYP B;  3CVK A;  3R7S B;  3E01 B;  2Q79 A;  1B64 A;  2UXB J;  3C3L A;  3PAC A;  2WTF A;  1LNQ A;  3ZC4 A;  3IRW P;  4EUV A;  3BGU A;  3HHE A;  3RAQ A;  3DDK A;  4ZJQ A;  3MEC A;  4FF3 A;  3NWR A;  3DXS X;  1VQP S;  4DR3 F;  3HLU A;  4I0W A;  3H59 A;  1UFW A;  3NLC A;  4ZP8 A;  3UR3 C;  3OV7 A;  2YKA A;  2DY9 A;  1FES A;  2CA9 A;  3TAP A;  2MSS A;  1IR0 A;  2FY8 A;  1U4B A;  1NRK A;  5T14 A;  4ZVH A;  2DH7 A;  3UNG C;  3GCX P;  2KT3 A;  2FVS A;  2HFZ A;  2QMW A;  4WP9 A;  3M30 A;  2R7S A;  2RU9 A;  1NXI A;  2PT0 A;  1S6U A;  2BA9 A;  2IA6 A;  3HFV A;  1YZ7 A;  1FE0 A;  2HMI B;  4DR4 F;  4ZLN A;  3CTR A;  3QGI A;  2BQR A;  2VQF F;  3I55 S;  1NSA A;  3IR6 B;  4KO0 B;  5KFD A;  4JI1 J;  4DPT A;  1QJH A;  4DV3 F;  1GH8 A;  2EEY A;  2B51 A;  2Z4P A;  4OV1 A;  2ZH5 A;  2B9Y A;  5DRK A;  3OXG A;  2W1B A;  1S0O A;  5KG2 A;  5EWG A;  1R89 A;  1WF2 A;  4X84 A;  2OLW A;  1CJK A;  3WBZ A;  4I2Q A;  1DTT B;  5JUM A;  2BRL A;  1WEY A;  3MCN A;  2UUB J;  3M2U A;  4WYW A;  3GYN A;  4A47 A;  3I82 A;  4J9O A;  3OR1 B;  4MMO A;  1WOP A;  1RAD B;  1N36 F;  3ICL A;  3M2V B;  3JAM U;  4NZ7 A;  4GKJ J;  1VFJ A;  5H9E J;  3FDS A;  2ZH2 A;  2VBY A;  4LF4 F;  4B17 A;  3QT6 A;  2LQJ A;  4NZ6 A;  1WEZ A;  1BC6 A;  3OHB A;  4DHV A;  4G1Q A;  4R5P B;  3CME S;  3AD9 C;  1PJ6 A;  3TAR A;  4CRJ A;  5ADZ A;  4WK3 A;  4F26 A;  2K1R B;  4U8V A;  2M3D A;  4NYZ A;  2MZS A;  4FBU A;  1NSK L;  2IJF A;  1B3T A;  1FK9 B;  4M5L A;  4NI2 A;  4U7U K;  4ZPA A;  4MTP A;  1X9S A;  1N5S A;  4B9T A;  4Y3C A;  3MEG B;  4Q8E A;  5L46 A;  3R6G B;  4C3K A;  5IT9 Y;  3W5X A;  2OKQ A;  5F3Z A;  2V2V A;  2ACY A;  2B5J B;  1N33 F;  4ECT A;  1FE4 A;  1ZM2 A;  3I9V 9;  5J1P A;  2E5I A;  3MED A;  4MIW A;  5RUB A;  2FJD B;  3BQ2 A;  3E2E A;  3QRQ A;  4YEA A;  3DOK A;  4KIA A;  1GT8 A;  3PKY A;  4L76 A;  4YOE A;  3NS6 A;  2YX4 A;  3CWJ A;  2J8A A;  2BKP A;  4ZPC A;  3IWL A;  3A12 A;  1PYS B;  3GQC A;  3SQG A;  2VZ9 A;  4ZK7 M;  1LQ9 A;  2VPZ B;  3KKF A;  2LQ9 A;  3OPK A;  5KT7 A;  4Y2A A;  5CAA A;  2RDD A;  3LP2 B;  3PYG A;  1RT3 B;  3VZI A;  1H0H B;  5J2M B;  2DH8 A;  3T9Z A;  2KVI A;  3VCD A;  1N5Y A;  4YN3 B;  3SQO P;  4UOC A;  1XIQ A;  4C8N A;  3CCZ A;  3I0S B;  4OYP A;  3M05 A;  1HNX J;  1FFS B;  1MML A;  3FBC A;  3JYT B;  1F5C A;  4ZPT R;  3DRP B;  5MLC V;  4WBF A;  5SZT A;  3ILI A;  4P2X A;  2HIY A;  2XBP A;  3V2U C;  2FVP A;  2DNR A;  2RQK A;  4YDX A;  3ENA A;  4A8F A;  3WIV A;  1C4C A;  4B08 A;  4DFJ A;  2X1G A;  1SQE A;  3TJA A;  1V6H A;  2DXD A;  1LOU A;  3OQ2 A;  1VQ4 S;  4F4A A;  2HHS A;  3IAS 9;  2VL1 A;  3NCP A;  2VBW A;  5LXY A;  4ID5 A;  3SCL E;  4HHJ A;  1YDL A;  3P6Y C;  1CLF A;  4DL5 A;  1HBU B;  1ZM9 A;  5FII A;  1HWJ A;  2VPX B;  1Y5N B;  3IWX A;  1V3S A;  4WCE Q;  5IQQ A;  1RHJ B;  1SIW B;  4IOA Q;  2UVV A;  2B56 A;  2RDI A;  3SXL A;  3HJF A;  2G0J A;  4F3M A;  3OTO J;  3H4B A;  3KNG A;  2OSR A;  2P9E A;  4GO7 X;  1WC3 A;  1RT3 A;  3J7A N;  4AT1 B;  2DCL A;  1Q79 A;  4K4Y A;  3MEK A;  4UT4 A;  2G0C A;  3VVU A;  3CE8 A;  1UWB B;  4F36 A;  3CJ4 A;  1TVR B;  3D1O A;  3G8S A;  2IRY A;  2RE1 A;  2LLZ A;  4CLP A;  2D3O 1;  2YX7 A;  1R8H A;  1YJT A;  1LEO A;  4I68 A;  3TRG A;  3MTK A;  1F9E B;  1ZZN A;  4IO1 A;  1SH2 A;  3BYR A;  1RTH A;  4OHW A;  3QGP A;  1S5Z A;  2HHH F;  1JB0 C;  3PW2 A;  4QWD A;  1GTE A;  3IG1 A;  4DSJ A;  3UCG A;  3CCV S;  1TKD A;  3TR5 A;  3TX0 A;  4PPD A;  3VGS A;  2G13 A;  2HWT A;  3MD1 A;  4KT0 C;  2OH2 A;  3M8S A;  3PRB A;  3OT9 A;  3J7Y I;  5HP1 A;  1S9E B;  1KVI A;  4FYY B;  2YH1 A;  3DC2 A;  2AEM A;  3VAK A;  4IG0 B;  3G6Y A;  4LMZ A;  1HBO A;  4FVM A;  1NJI T;  3FJ2 A;  2DNN A;  1NH7 A;  3EJM A;  3EMT A;  4CZC A;  2JLF A;  2R2R A;  4DFP A;  4PQA A;  3SCI E;  2OPS B;  4KE5 A;  3HHK A;  3DOM A;  5KG0 A;  4PQU A;  3HHL C;  1I3O B;  3HXM A;  5A6P A;  1IKW A;  1VK3 A;  2EC0 A;  1WOS A;  3HF5 A;  1UWB A;  3IM8 A;  3UCU P;  5DO2 A;  2R7R A;  1TVR A;  4CO5 A;  2R8K A;  1M5V C;  2GV1 A;  1XMO J;  4EO6 A;  1J5O A;  1YJU A;  2CVE A;  1VJQ A;  1SJ3 P;  3C6T B;  1JLC A;  1F9H A;  4P74 A;  4ED8 A;  3CJK B;  3FNN A;  3HVW A;  4PG7 A;  1IBM F;  2YWK A;  2V8P A;  3RB3 A;  3UN2 A;  4EZ9 A;  3FCW A;  3JSR A;  1URN A;  2DR9 A;  3BPD A;  2DNO A;  2UXD J;  3CCE S;  2VQE F;  1KVK A;  5E3P A;  1JLQ A;  3LP1 B;  2LEA A;  2MY7 A;  4F4Z A;  1S4F A;  2ZH7 A;  3HSZ A;  1AFJ A;  1UW9 A;  4KV8 B;  1RWV B;  1Q16 B;  1I51 B;  1FKP B;  2DHA A;  1C1B B;  3LA0 A;  2XQC A;  2DJW A;  4YHH F;  2VC0 A;  3HVT B;  1TEL A;  3QT5 A;  4IFV B;  2XG8 A;  4CLS A;  2BEF A;  1LWC A;  5DG8 A;  4O3S A;  3LP0 B;  1GXU A;  1S6Q A;  3ZZP A;  4P75 A;  3LUY A;  1YJR A;  2AMC B;  3QGG A;  2OD4 A;  2FJA B;  1D3W A;  1X7V A;  1VLO A;  1WKJ A;  3D7S B;  3D6H B;  4R25 A;  2FJV A;  1QAY A;  2JDJ A;  4JUZ A;  4ZHR B;  1GAO A;  5D4P A;  4C2M A;  3H5Y A;  2UXB F;  5ETQ A;  1S4E A;  3EXY A;  4ZVG A;  4ZN1 A;  3UQS A;  1IXK A;  5A8W A;  3OSP A;  4ZIV A;  2CNO B;  3N6N A;  3OL8 A;  3A8E A;  2CDQ A;  3N28 A;  3R5G A;  3HUL A;  2CPJ A;  3QSY B;  1X5T A;  3CUN A;  2EKN A;  4N47 A;  2VH7 A;  3KUE A;  1N5V A;  1RSC A;  3NRB A;  3ELH A;  1GMW A;  2MQN A;  1H2T Z;  2CWK A;  3MM5 B;  4LRC A;  3W2W A;  3LW5 C;  5KFN A;  2WW8 A;  2Z2L A;  2DEI A;  1W7W A;  2B4O A;  5HQL A;  1OWX A;  2VJV A;  1N52 B;  1HHT P;  3PR5 B;  3AD8 C;  3I0R A;  1RHQ B;  5GAD I;  1FFG B;  2PI4 A;  4P2S A;  3HVT A;  1VBX A;  3A1Y G;  4JI1 F;  3FEX B;  4TY9 A;  2DHS A;  4OJ1 A;  2FJW A;  1XMQ J;  1WI8 A;  2UXC J;  4B3O A;  4CLY A;  3M8Y A;  2ERR A;  4NA3 A;  1QVF R;  2C1E B;  1C0U A;  4Y2C A;  2HG4 A;  3GJT B;  3UNY A;  1TU0 B;  4UST A;  2QEX S;  1JJC B;  4NLD A;  1U8W A;  3JQK A;  5ETT A;  3PHE A;  2UUB F;  4O4G B;  3G86 A;  4ZHR A;  4C4W A;  3OVS A;  1TV6 A;  3ISN C;  2VHG A;  1SXL A;  3RGI A;  1TKX A;  5DDQ C;  4GKJ F;  4G1I A;  1HQU B;  4MYT A;  1C0T A;  4DSL A;  1K1Q A;  1KKH A;  2D3Z A;  3FBB A;  1VMB A;  2MQL A;  5AJ3 J;  4QWC A;  3G71 S;  2MZQ A;  1XEZ A;  4CO4 A;  1KP6 A;  1G1X A;  4HH1 A;  4KKO A;  4O44 B;  4C3L A;  2ROG A;  1NK6 A;  3R7N B;  1KDN A;  1K1S A;  1WKK A;  1SH3 A;  2R7W A;  1NLK L;  1H74 A;  4JV2 A;  2DO4 A;  3LAM A;  2OFH X;  4KGK A;  4NL5 A;  4S0M A;  4A8Q A;  1F9F A;  2ZZT A;  2YWG A;  5I3P A;  3OFF A;  2CWX A;  2HSE B;  4HYK A;  1U45 A;  2HND B;  4PAA A;  2XMT A;  4A8X A;  3NMA A;  4OJ3 A;  2DYA A;  4USM A;  1UEU A;  3KHG A;  2IVM A;  3BSC A;  4LF6 J;  3I96 A;  3QWU A;  1YWX A;  2JHE A;  1R6Y A;  2Z2M A;  3NL0 A;  4WE1 B;  2CQ2 A;  2NUU G;  2QGF B;  3W1Y C;  5A0Y A;  5GAG I;  3CB4 A;  3JQJ A;  2IHR 1;  2G2O A;  1N0V C;  5CH7 B;  2WSF C;  1KLN A;  6AT1 B;  3CF5 Q;  2XSJ B;  1UTA A;  3BSA A;  4FBT A;  2E1C A;  5JXS A;  1DFD A;  1F5A A;  4IOB A;  1RTZ A;  1KLM B;  1NM2 A;  2QYC A;  5KG6 A;  3HHD A;  2IC3 A;  1NKE A;  5L1I A;  4M5K A;  4X4V A;  3N5F A;  4Z2X A;  1G6B A;  2YWW A;  2XO6 A;  3GLJ A;  2RRB A;  2KDO A;  5K8O A;  3GZ7 A;  4F50 A;  1HNX F;  5KG4 A;  2OHD A;  3TUJ C;  2Q66 A;  2RT3 A;  2K2P A;  4IFY A;  1NPK A;  4PKD B;  4ED7 A;  2HVE A;  5IQ6 A;  4P72 A;  2ZJR Q;  1IQZ A;  5ETP A;  4EGL A;  2PFD A;  5BXI A;  1RWO B;  2CDR B;  2EBG A;  1IBL J;  1VQY A;  5J1E A;  1L3V A;  3KWM A;  4EYI B;  2B4V A;  1TL1 B;  3NWG A;  2IBK A;  3GIR A;  4C7Q A;  3W2V B;  2DNY A;  1VOM A;  2XY6 A;  1FRM A;  4DCO B;  3K89 A;  4ALZ A;  4DQP A;  4NLV A;  1R31 A;  2NXE A;  2C3P A;  2Y1J A;  3UDV A;  2GO8 A;  1UEK A;  4ZCM A;  2CRL A;  2FHK A;  1N32 J;  2GCF A;  3P4U B;  2GNK A;  2XYG B;  1HW8 A;  5IT4 A;  1QTM A;  3W8P A;  4FYD A;  1U1K A;  4OIX A;  1D09 B;  1OY8 A;  1NZ8 A;  1DAX A;  4DUZ J;  3O2I A;  2VBX A;  4HT5 A;  1F3V A;  2GMH A;  3OTO F;  4EBE A;  1M1H A;  2BW7 A;  2KN4 A;  4ZN3 A;  1QM9 A;  2R9L A;  3ZO7 A;  1UJ6 A;  5C25 A;  1GK8 A;  4BDP A;  2M9K A;  1RWU A;  3PYE A;  1SC6 A;  3FCV A;  3EX7 B;  3C6U A;  3RU0 A;  4YQW A;  8RUC A;  2F3J A;  4O3R A;  3C15 A;  2BQU A;  4CLZ A;  5KFX A;  3UW1 A;  1BMQ B;  4A46 A;  2OML A;  2QX0 A;  2DGV A;  4LF1 A;  4ZLJ A;  4X62 J;  4MIB A;  4RO0 A;  2XY5 A;  1PIE A;  2NXN A;  2KI2 A;  4DBQ A;  3EM1 A;  1L3T A;  2JVO A;  4DG1 A;  3RAX A;  2EC2 A;  2HHT A;  2GVZ B;  2W25 A;  3TWZ A;  3MOZ A;  5KTQ A;  3MOJ B;  2H54 B;  2CQ4 A;  1RT5 B;  1CEZ A;  1S76 D;  2UUA J;  1PYT A;  2R8H A;  2YTC A;  1QAI A;  2B6A B;  5KG5 A;  1FWP A;  1RLC L;  2HKE A;  2K3K A;  3K7R A;  3GJR B;  2DT9 A;  2VFT A;  3TUP A;  4K4U A;  1S7H A;  1NBE B;  3Q8U A;  2WOM B;  3OL9 A;  2X51 A;  4BWJ A;  4H4K A;  4YP3 A;  3O44 A;  1PAE X;  5GAE U;  1CS4 A;  1U09 A;  2SXL A;  1FWL A;  4R0J A;  1WDD A;  2D69 A;  2HQI A;  1XMO F;  4NML A;  3SYZ A;  3PJX A;  2ACM A;  1V5I B;  1T3N A;  5ETK A;  3KK3 A;  4NPO A;  2Y8Y A;  2J0Q D;  2WB1 D;  4F0M A;  3R9L A;  1JNZ B;  3JSY A;  1WI6 A;  2KFN A;  2HBZ B;  1Q8K A;  2PMH A;  1FRH A;  2BJ7 A;  2CJK A;  2KFY A;  2RJZ A;  2LEB A;  5DS7 A;  2HUR A;  3MFI A;  2UXD F;  1WDT A;  3DU6 A;  2BUN A;  3AFG A;  3QSI A;  4F04 B;  2YNG B;  1L3S A;  3TAN A;  2PI5 A;  1OMS A;  4QYZ J;  3PX0 A;  1JIH A;  4XPC A;  1GFW B;  2GO9 A;  2GVD B;  1GTH A;  2HZC A;  2J7K A;  2W24 A;  4E0D A;  4PWD B;  5D77 A;  1ITP A;  4CQ1 A;  1WC4 A;  2QYG A;  3BGR B;  2WON A;  4ICL B;  1SVD A;  4RNF A;  2HHW A;  4LBH A;  3L95 X;  4DU8 A;  3W62 A;  2KHD A;  4FYX B;  4DR7 J;  1KFD A;  5HMX A;  3TAM A;  1KOO A;  4LR7 A;  3NNA A;  2E5H A;  2V4J A;  1OQ6 A;  2B4U A;  4OZ1 A;  3OSN A;  3M6W A;  1NH8 A;  4AFF A;  2L08 A;  3NOG A;  2NZC A;  1WHY A;  4ZMM A;  4C98 A;  1RB0 A;  3POT A;  2WVB A;  4RUH A;  3TJ8 A;  2DGQ A;  1Q78 A;  3TQ1 A;  1YBT A;  4GO5 X;  1FER A;  4M5D B;  2NSB A;  4KYZ A;  3A3N B;  4HI2 A;  4LF2 A;  1OSC A;  1UKU A;  4A8Y A;  4L75 A;  1SKU B;  3DU5 A;  4PG8 A;  1HD0 A;  2DB1 A;  4I56 A;  1FNO A;  4RJV A;  1MSW D;  4LIR A;  1P8G A;  5HVF A;  1F2H A;  1RWM B;  2J0W A;  1Q95 G;  2JL9 A;  4PUO A;  1R0A B;  1O5J A;  1U0S A;  3CGI A;  1YHQ S;  5J2N A;  4DSE A;  3B78 A;  3P8B B;  5F9N A;  4TU7 A;  3RW6 A;  2W7O A;  2GVD A;  2EWH A;  3ZZO A;  1MWZ A;  1OQ3 A;  2ALY B;  5T7L B;  1JXE A;  3FVY A;  3R1L A;  3GJS B;  1XMQ F;  3RB6 A;  4RWX A;  4UUX A;  2UXC F;  2XMM A;  3OTE A;  1TAU A;  5KFZ A;  4OYZ A;  5K14 B;  2L41 A;  1Y7P A;  2FVC A;  1RTD A;  4ZVS B;  2AYE A;  2MZJ A;  2AZ3 A;  5A2Q U;  1NUE A;  1FKA F;  2E7W A;  3B6B A;  3KLF B;  4O0N A;  2DPJ A;  3M2R A;  5EHH A;  1T8E A;  3TQE A;  1WAC A;  2H65 B;  4I69 A;  4USK A;  5HRO B;  2BYC A;  1A6L A;  2JSX A;  3P5B P;  4LSL A;  4X4R A;  4K4V A;  2RVJ A;  2YNF B;  2CPZ A;  4J37 A;  2JZ5 A;  1Y00 A;  4DL0 C;  1G3O A;  2RF2 A;  5AJ3 F;  2A2C A;  1WNE A;  1WC1 A;  2OEK A;  2MKH A;  3ILO A;  3R2C J;  4KHM A;  1ZYQ A;  1JXL A;  2Y0B B;  3K59 A;  1REG X;  5A8K A;  4DSI A;  1YSJ A;  2EVZ A;  4PG5 A;  4ECQ A;  4ZIT A;  4MFB A;  4B9M A;  1QDU B;  4QWA A;  3V6J A;  4C9D A;  2AEJ A;  2ATL A;  4PWU A;  3FSI A;  3ENQ A;  4M5M A;  4JI4 J;  4RUC A;  3TJ9 A;  4ECW A;  4ZCL A;  4ETX A;  5HBM A;  2ZIT A;  1DZ5 A;  4DFM A;  2NLW A;  3BRE A;  2BE2 A;  2CPF A;  5T7L A;  2KVQ E;  3THV A;  1EB0 A;  4LF6 F;  2VG7 A;  2NXC A;  3PRV A;  3GSI A;  2Y3Y A;  4KY3 A;  1Q5V A;  3T6B A;  2MQO A;  2H5I B;  3VAJ A;  4WJB A;  2DR8 A;  4FXD A;  5K14 A;  3CPW R;  1MRO A;  1WWH A;  1REV B;  2KT5 A;  4NLW A;  1OYE A;  5DLG A;  4QWE A;  1Q1K A;  4OHZ A;  4ELV A;  2KU7 A;  2QTW A;  3CD5 A;  1IBC B;  4U8Y A;  2IVY A;  4WKY A;  1DRZ A;  4PXC A;  4W98 A;  3B4M A;  1SV5 B;  1MWY A;  2GFF A;  3N5B A;  2ADC A;  2AYB A;  2YKN B;  5DGB A;  3K0J A;  1U8S A;  5KFF A;  2HWI A;  4V19 X;  4YME A;  2ZH8 A;  2GC8 A;  4CTA B;  5AE2 A;  5D4O A;  3NS7 B;  1S1W B;  4V19 J;  3MMC B;  2ZH6 A;  4C11 B;  2Z56 B;  5KFG A;  4U6P A;  2VPY B;  2HVZ A;  4GKK J;  4DSK A;  3SV4 A;  4J90 A;  1CC8 A;  3CIZ A;  3Q8P B;  3M8R A;  1ULR A;  4WFB Q;  2GAG C;  4ED5 A;  1SQF A;  2XWY A;  1JK9 B;  3H5S A;  3M4X A;  3KK2 B;  1JKH B;  3IWN C;  3HSG A;  1IBL F;  2ZHA A;  2KB2 A;  2CAD A;  4QOT A;  2CNL B;  2BZ2 A;  1S72 S;  4NCG B;  2C2Z B;  4NZ0 A;  2Q3P A;  3ZZU A;  1JLB B;  1V9O A;  4YB5 A;  1I1G A;  3EPG A;  3SSQ A;  4ZP6 A;  1T3O A;  3DRR A;  2VPW B;  4FP9 A;  1TKZ B;  5HMZ A;  3V4I B;  3VGV A;  3KLI B;  1SQG A;  3I6P A;  3CT9 A;  4DLG A;  5CYM B;  1N32 F;  4TY8 B;  3K17 A;  4I6Y A;  5KG3 A;  3K5P A;  4ZVO B;  4C8L A;  3PRD A;  4RW4 A;  5B08 A;  1I5O B;  3J7Z T;  3MM7 B;  1R43 A;  3CJ0 A;  4DUZ F;  2QA4 S;  1UET A;  3FBF A;  3Q23 A;  3S1T A;  4CH7 A;  3WZ0 A;  3ITH A;  5L1L A;  4Y0F A;  4KH0 B;  2QL7 B;  5KFL A;  3DXB A;  2VUG A;  3UPF A;  1S1W A;  5U47 A;  4ZIW A;  3W60 A;  2RUG A;  2W7P A;  4FNH A;  2JJ4 D;  3H25 A;  2MQQ A;  4X62 F;  1CJU A;  4K4Z A;  1UJ5 A;  3EGN A;  5D4N A;  4ED3 A;  1R7I A;  1JKH A;  3M6U A;  4QYR A;  3N79 A;  1T03 A;  1VHI A;  2ADB A;  3KG4 A;  2V4R A;  3SDE B;  1PYO B;  1YQH A;  2OI2 A;  3QJL A;  1K8A T;  1U2C A;  1WHW A;  1HQ2 A;  1T05 A;  1YIT S;  3HPO A;  4GC7 A;  2EG1 A;  4WFZ A;  4ED6 A;  2UUA F;  2HFU A;  3V4I A;  1SC3 B;  2GX8 A;  4ED1 A;  4KFB B;  5CYM A;  2XMV A;  4X4P A;  2RQC A;  2PN6 A;  1KS2 A;  1FJG J;  2HYI B;  4ZCK A;  1UPP A;  1Y10 A;  4MJK A;  1VQ5 S;  3TW0 A;  1Q7Y T;  4C6A A;  1D8Z A;  3U1M A;  3IRX B;  1QLN A;  1RT7 B;  2YQ0 A;  1U0H A;  2J9E A;  2H51 B;  1J2V A;  1K73 T;  3I87 A;  2PEH A;  3NG8 A;  4TNO A;  2YQ1 A;  3PFE A;  4EI2 A;  2OGU A;  5I3U A;  3FGV A;  4I7F A;  4H4M B;  4D3G A;  4ZA1 A;  2MKY A;  3LWM A;  3LQV A;  3QAE A;  5A2Q Y;  1EKS A;  1UZH A;  1XER A;  4JV5 J;  5J2Q A;  1WJ9 A;  2QMX A;  2YKM B;  3AT1 B;  3IR5 B;  4BBY A;  2YNH A;  1BD6 A;  2WZ1 A;  2CPI A;  3M6X A;  3EIC A;  2FD2 A;  2Z2Y B;  2XNQ A;  3GU0 A;  4I6W A;  2FUG 9;  1JLG A;  5CAB A;  2VG5 B;  4GVB A;  1KTV A;  1KON A;  2GGP A;  1U26 A;  3FMB A;  2BAB A;  3MD3 A;  1D9D A;  2L9W A;  2E9T A;  2M8H A;  2VA2 A;  4OI4 A;  1AUD A;  5AXM A;  2J5A A;  2DGX A;  2N3L A;  5IC4 B;  2ALZ A;  1QSY A;  3PW7 A;  5F8I A;  3QO9 A;  1DLO A;  4ETZ A;  4RL1 A;  3IMQ J;  1P9Q C;  1S1X B;  3KJF B;  1CJV B;  2L9D A;  2IAJ B;  4I6A A;  4DR7 F;  1P27 B;  4FYV B;  4IDK A;  1R8P A;  5K9F A;  4PCQ A;  1AZS B;  2MHE A;  3IBF B;  1U1P A;  5HLF B;  3MAA A;  2IJR A;  3G4S S;  2MKS A;  2YH0 A;  2ASY A;  5EGY A;  1X0F A;  1S6O A;  4LR8 A;  4DWI A;  4XIU A;  2MLY A;  1TMJ A;  4Y2K A;  2X1F A;  5G0R B;  3V6D A;  2B9E A;  1K0T A;  1IJF B;  1HBM A;  4H4M A;  2MLX A;  4ZPD A;  2M88 A;  4P73 A;  4ID8 A;  4DQS A;  1FVS A;  1S1U B;  4HHU A;  1HNI B;  5AXN A;  3E3X A;  1JLE B;  4ECU A;  5BYR A;  4CT9 A;  1KQF B;  3KJV B;  4C3M A;  3MMJ A;  1AB8 A;  5CXT A;  4HI1 A;  2NR0 A;  2JFK A;  2WHO A;  1LWE A;  2FGO A;  3QYY A;  1RCX B;  2DGO A;  2KZM A;  2YPY A;  3H42 A;  3Q8S B;  3JTN A;  1IUJ A;  2XM3 A;  1H7W A;  2W9C A;  2CZ9 A;  3QIP B;  1FDD A;  1ZM4 A;  2AX1 A;  1HWK A;  4N8N A;  4CO1 A;  1B7F A;  1FXR A;  2BJ8 A;  2AGQ A;  1MG7 A;  2L48 A;  4C0O C;  1EZZ B;  2LQB A;  2BAN A;  1F1B B;  1GNK A;  1S1T A;  1S1V A;  2RML A;  3LAN A;  4PXD A;  2XI3 A;  2VAS A;  3QRP A;  2WK4 A;  5JMN A;  1YG0 A;  7FDR A;  3CJQ A;  1AFI A;  1KWM A;  3CNQ P;  3EYZ A;  5C2C A;  1YBA A;  2GAH C;  4XDC A;  2IPO B;  3TUZ C;  1KR4 A;  1NKB A;  4M5G A;  1RT6 A;  1RHM B;  2HRY A;  3KLE B;  4XO0 A;  1S57 A;  2OPR B;  2G4B A;  3NGU A;  1ZPV A;  1KSP A;  3GR1 A;  3V6K A;  3FZB A;  4MKV A;  2CQC A;  3OR2 A;  4Y2M A;  3TZY A;  1BQN A;  2QRR A;  1VBZ A;  5C24 A;  3HHL A;  1ACM B;  2I2Y A;  5KFU A;  3FFI B;  4X4O A;  2E44 A;  2E5J A;  3FQK A;  4NXM J;  4ANC A;  1HKA A;  1Q81 T;  5KFO A;  4MKY A;  2W9A A;  3MXH P;  3D54 A;  4LRA A;  4LRF A;  2R8G A;  5IM0 B;  1RT2 A;  1ZOT A;  1QE1 B;  1KQK A;  2EK1 A;  4DI6 A;  3LGN A;  4JI4 F;  3JTP A;  2NZ4 A;  4LUB A;  4CH0 S;  3AXM A;  4RKU C;  5GAD U;  4LRD A;  4NLT A;  1H98 A;  2B9X A;  3BGL A;  4P71 A;  1RA6 A;  3Q22 A;  5EWF A;  1SKS A;  5KFB A;  2ZNY A;  4B9S A;  2YKQ A;  2LU1 A;  2RAQ A;  1R8B A;  4ILR A;  2HPU A;  3D28 A;  1EKR A;  3QAU A;  3T41 A;  2CQD A;  2OPR A;  3DHW C;  2W7A A;  3ZTR A;  3KUG A;  5IXU A;  3KG0 A;  1N6Q B;  4C97 A;  4IG3 A;  2E7V A;  4NLP A;  2XS5 A;  3DOL B;  2E1M C;  3W5Z A;  1U25 A;  4HDG A;  4ENO A;  4KAI A;  5F8J A;  4NLX A;  3CCQ S;  2AGO A;  1QAJ A;  3U7J A;  3P45 B;  3GTY X;  2LEP A;  5LMU J;  3HJV A;  3RG6 A;  3H5U A;  5DDO C;  5DG7 A;  4PRF A;  4OLP A;  1PIL A;  5CZV A;  4GKK F;  3IR7 B;  2CJX B;  3O1L A;  5L1K A;  4HH0 A;  1JLA B;  4H4K C;  3ET6 B;  3OL6 A;  2J7U A;  2VF3 A;  1WTF A;  2HFN A;  3JXO A;  4JV1 A;  2EFN A;  1HR0 J;  4WXO A;  3SCJ E;  1NEE A;  4WKR A;  3M8W A;  3GYG A;  2YNI A;  1RT1 B;  2RD5 C;  2CFX A;  1HIY A;  3J80 U;  2AYM A;  5GAH U;  1IN0 A;  2UP1 A;  3HD1 A;  5B0D A;  4M95 A;  1HD1 A;  2EK6 A;  3RJM B;  5A76 A;  4G6V B;  4USJ C;  3C46 A;  1U7L A;  3NNC A;  4DFK A;  4QJV A;  4ES3 A;  3CCT A;  4PWW A;  5KT3 A;  5GAG U;  3QNW B;  4R0E A;  4NLG A;  1EX8 A;  5I3Q A;  4HAC B;  2D9P A;  3LF0 A;  5EUH A;  4M1K A;  4DR2 J;  3OD2 A;  3J7A 1;  1WHV A;  1FD2 A;  4IQX A;  2CPX A;  1UP1 A;  2FLP A;  4L6V 3;  2CJB A;  2ROP A;  1SPB P;  4Q0B A;  2LDI A;  1ZPW X;  1R8A A;  2ZE2 B;  2BM1 A;  2W8K A;  1W2I A;  4CO0 A;  2I38 A;  2DIV A;  1FWK A;  4NLS A;  4CYU A;  2G1D A;  1JLA A;  3WDO A;  1G2E A;  1CJT B;  3MR3 A;  1NHV A;  3BGO P;  1N4L A;  1XMB A;  2F4F A;  1T02 A;  3HT3 A;  3HSJ A;  5HAO A;  1VI7 A;  1L3U A;  2AF6 A;  1FXL A;  4DS5 A;  4OYM A;  3BB5 A;  2NS1 B;  1TTH B;  2XWX A;  1MMN A;  3DN9 A;  1MW7 A;  5KFT A;  4N8O A;  3MEE A;  2ZFH A;  4QIV A;  1NJZ A;  2MJU A;  4DLE A;  1HL6 A;  4ZVU B;  1S77 D;  1T9U A;  2CJQ A;  2QG9 B;  4TLR A;  5J2P B;  1ZH5 A;  2BE7 D;  1B0P A;  4CIO A;  1B7Y B;  2EI5 A;  2AJ1 A;  1LW2 B;  3NCQ A;  1FJG F;  2I5J B;  5A6W A;  2CVI A;  3R8Y A;  2IA0 A;  2MQ8 A;  4Q5V A;  4YR0 A;  3BN7 A;  3KLG B;  2QE5 A;  3OBI A;  2EXU A;  3MM9 A;  4TQS A;  2XI2 A;  5L38 A;  2X3D A;  2VOO A;  2BXJ A;  4DUT A;  2ZJP Q;  2OPP A;  2KM8 B;  4P7V A;  2DRB A;  2RKI B;  3SEO A;  2KL8 A;  3MMA A;  4NEY A;  1VIX A;  1S97 A;  3IN5 A;  1PJ7 A;  3D2W A;  4GMK A;  3T6J A;  1UVI A;  4JV5 F;  2OSQ A;  2UVR A;  2UZA A;  1HNV A;  2KG0 A;  3AJ2 A;  1Q82 T;  3EZU A;  4LSN B;  3G82 B;  1ZA2 B;  1EET A;  2MYF A;  1N54 B;  1RI7 A;  3I5B A;  1S0V A;  4IRC A;  4FYW B;  3OXF A;  2Z0G A;  4EMD A;  3CC4 S;  1ROF A;  3BF4 A;  3TZZ A;  1RAA B;  4KR0 B;  1RU1 A;  5AXL A;  3Q8Q B;  1MWQ A;  5KT2 A;  5KG1 A;  4ITS A;  3HO1 A;  1BXN A;  1SUQ A;  3ZNU A;  2JEF A;  5KFH A;  3PYF A;  2RHS B;  1E6Y A;  4LFC J;  1RT4 A;  3KLG A;  2Z58 B;  4HEA 9;  1K44 A;  1Q4R A;  3ZTQ A;  4RW6 B;  3G6X A;  5DLF A;  4Y2I A;  2P2C B;  4C8K A;  4DQQ A;  2KJW A;  3QAT A;  3HM9 A;  1GQE A;  4RWW A;  4L73 A;  3OW2 R;  4H4O B;  2E66 A;  3CJ8 A;  2F9D A;  3US5 A;  1DTQ B;  3MM8 B;  1E6V B;  3E8O A;  3HD2 A;  3A4T A;  4URS A;  1IWG A;  4B3M J;  5HAN A;  4R8U A;  4OX6 A;  3OHA A;  2ZOM A;  4QIG A;  2XO7 A;  1T95 A;  5HO4 A;  2YKO A;  2RSQ A;  1LWF A;  2NCK L;  1NK4 A;  4DR5 J;  3KLH B;  4DDF A;  1FF2 A;  4HL9 A;  3VHQ A;  4C8O A;  1GMV A;  3BEG B;  3FK4 A;  2VU5 A;  3DLK A;  4OI2 A;  4YB1 P;  5KFP A;  2MGZ B;  2QLJ B;  2ZJQ Q;  3EDR B;  2VOD A;  1JJH A;  2A6O A;  2RQM A;  1SJQ A;  3CCR S;  4KSE B;  5LOQ A;  1VQ8 S;  3FRY A;  1B0V A;  1MU2 A;  3MUM P;  1OS5 A;  1S6P A;  3GPA A;  3M8Q A;  4KGZ B;  4WII A;  5ETL A;  2V9K A;  3KOA A;  1EP4 B;  3KK1 B;  5LMN J;  1PC4 A;  4DL2 A;  1JLF A;  3VAH A;  4OV6 A;  1AT1 B;  2UU9 J;  2G9O A;  1Y5L B;  3N01 A;  2QIF A;  2OTJ S;  3MMB A;  1IKX B;  3M9N B;  1TL7 A;  2W9B A;  2LU2 A;  3J80 Y;  1KFS A;  2BOA A;  1FRK A;  3NGR A;  5BR8 J;  4WYL A;  3BJY A;  1IM4 A;  3D1Q A;  3OUY B;  2CQG A;  2VV5 A;  4J9S A;  2C3M A;  3T5K A;  1VQ9 S;  3NMR A;  4OI6 A;  2DGT A;  4BC9 A;  3KLH A;  1HMV B;  2CG8 A;  4LR9 A;  1SJF A;  2HW3 A;  3CD0 A;  1N5T A;  3IAM 9;  2LXF A;  3W3S A;  4NXM F;  4EWT A;  5B0F A;  1Q5Y A;  4O3P A;  5KFS A;  4DL7 A;  1ZAX A;  1DQA A;  3TZW A;  2XGP A;  5D8H B;  4KHP J;  2LXI A;  4F2R A;  4MK9 A;  1M1K T;  1RU2 A;  1HI0 P;  2F4V J;  8ATC B;  2KJV A;  1M1G A;  3GFY A;  2YWH A;  2E9R X;  2VKR A;  4IOC Q;  2CQ3 A;  3PCO B;  3E01 A;  4UTG A;  2IM2 A;  1RHK B;  2E1R A;  4JP8 A;  3FUY A;  4USV A;  2ZC3 A;  4WIQ A;  2VG6 B;  3FBE A;  3PNI A;  2ZUG A;  1PO6 A;  4PEO A;  2J7W A;  8AT1 B;  1QAX A;  1FCA A;  2FC8 A;  3G87 A;  3C16 B;  3TZX A;  4OX8 A;  1R0C B;  3I32 A;  2DR7 A;  4ZLL A;  3RBE A;  4LIW A;  4IO9 Q;  4UQG A;  2UUW A;  2NPI A;  5F0W A;  3ZTP A;  4ANE A;  4CLU A;  2P6S A;  5C42 B;  3IC1 A;  2R7T A;  1KEK A;  5F8L A;  2H3E B;  2Y1L B;  1U1Q A;  4USI A;  5DQH A;  1NND A;  3LGH A;  2HMI A;  3ETM A;  1FT8 A;  5KT5 A;  3I5A A;  2QA2 A;  3NBP B;  3T5H A;  1KD1 T;  4KO0 A;  2WB4 A;  5HN0 A;  1IR2 A;  4U9R A;  2YWF A;  5LMU F;  3K58 A;  4I1T A;  3D3C J;  3H40 A;  1VRQ C;  5M2U A;  2JEI A;  3I4P A;  4UW2 A;  3NXZ A;  4ZJL A;  4LVO P;  4B3S J;  1DTT A;  2XCA A;  2PEB A;  4DQR A;  2FQQ B;  3DDN A;  3L4B C;  4Z7C A;  3OR1 A;  3FKB A;  4NA1 A;  2CUY A;  5D0G A;  3P96 A;  1HR0 F;  3RBZ A;  3M2V A;  3PR4 A;  2MQP A;  3W9J A;  1O51 A;  1HBN B;  1YJV A;  2HNY B;  2VG6 A;  3T19 A;  4FNI A;  3MR5 A;  2W4D A;  2B4P A;  2C22 A;  1K47 A;  1YGY A;  1OY9 A;  2M70 A;  2EFO A;  3FRZ A;  1VYA A;  5H9F K;  1KVJ A;  1ZTW A;  2ZDP A;  4R5P A;  5CA5 A;  3MPD A;  1QSL A;  3CMA S;  3HKW A;  1FDN A;  2P8I A;  3RRG A;  1X60 A;  4NMX A;  5D0E A;  2K1R A;  2C3O A;  3GFX A;  1F6T A;  3D0G E;  3F41 A;  1FRI A;  5C42 A;  2DD8 S;  2EFQ A;  2YXL A;  1RAE B;  3BM7 A;  1FK9 A;  1Y3J A;  1RYR A;  4F4K A;  4ZJO A;  1ZTT A;  3JSM B;  4DR2 F;  4WU3 A;  1TK0 A;  2KKH A;  2DTJ A;  5GMK a;  3MEG A;  4KBI A;  4YDD B;  3MF5 A;  3MAQ A;  2A18 A;  2ZD1 B;  2B5J A;  2P5V A;  2AWZ A;  3F0N A;  1YX2 A;  1PKU A;  4G1P A;  3X1L B;  5I42 B;  4C8Z A;  2ZH1 A;  2DXE A;  2W2Q P;  2Q1L A;  2R7U A;  2XMJ A;  2FVQ A;  5LT5 A;  3Q89 A;  4UY8 5;  2CXE A;  2OAU A;  3MHY A;  3UDE A;  3QID A;  1Q53 A;  3NGS A;  2J6T A;  1DQ8 A;  1RKJ A;  1QVG R;  3ENW A;  2PA8 D;  3ADA C;  3OFG A;  2QSF A;  2BRK A;  1HBN A;  1APS A;  2HHQ A;  2MMY A;  2O5D A;  3LP2 A;  1NJY A;  1N34 J;  1RA7 A;  1KQS R;  5J2M A;  2BJD A;  2HNZ B;  2OEL A;  2WBM A;  2JX2 A;  2WVF A;  4ECX A;  2DNH A;  4RBV A;  2GHW A;  2P9G A;  4RW9 B;  3DHX A;  3I0S A;  5L9N A;  1NPR A;  4C8M A;  3L7P A;  4OZ2 A;  4W4M A;  4J9P A;  3L3C A;  4ZP9 A;  3JYT A;  3DRP A;  2UUT A;  3Q8R B;  1RCO B;  2H5E A;  1I94 J;  1UVN A;  1UMJ A;  3PEJ A;  3R5B A;  3T5L A;  3H5X A;  4J9L A;  3CJ2 A;  4MK7 A;  4OI0 A;  4KTQ A;  4DZ6 A;  1DJ0 A;  3RR8 A;  1CUL B;  1RYS A;  4E98 A;  1U02 A;  1XNQ J;  3UDL A;  2FJB B;  5E5N A;  1FX2 A;  3VF0 B;  4OZ5 A;  2K7J A;  5EX0 A;  2ZD1 A;  5E7O B;  3U02 A;  3CDE A;  1DBD A;  3AQP A;  1HBU A;  4ED2 A;  2E9Z A;  3WIU A;  4OHV A;  4OZN A;  2OTL S;  2R42 A;  3VZH A;  3GV5 B;  1S9G B;  1RWW B;  3ZXW A;  3UVJ B;  2LEC A;  2FTR A;  1ZS6 A;  3D4J A;  1YTY A;  3M8P B;  4LF8 J;  4CCH A;  1UZD A;  2C3U A;  5C7P A;  1HA1 A;  3UFC X;  4I2P B;  1RAH B;  1WSV A;  3A13 A;  5E3A A;  2JC0 A;  3MDF A;  1NZA A;  1B4S A;  4LFB J;  2VC1 A;  2Q6B A;  3QZ8 A;  4OZJ A;  3BDE A;  4NLR A;  2DNL A;  4FPI A;  2CJA A;  3H98 A;  3CMQ A;  1BQM B;  1HPZ B;  3IO1 A;  2Z30 B;  1RDR A;  4NE9 C;  1D8Y A;  2V4Q A;  4K8R A;  1P1L A;  3BR8 A;  3W63 A;  4JI0 J;  4HR2 A;  4LFC F;  5GME A;  1NB7 A;  2OUG A;  3K5N A;  1F60 B;  1H3D A;  3D66 A;  4L3N A;  5CCM A;  2QV6 A;  2F1F A;  3RBD A;  1HQE B;  2F65 A;  3ZZR A;  5MAO A;  3KG1 A;  2IMW P;  4BHQ A;  4O0I A;  4RU9 A;  5KT6 A;  4B3M F;  2B7C B;  2HVD A;  5D3G B;  2QO3 A;  2RRA A;  4IH7 A;  5KFY A;  1WEL A;  4DR5 F;  2JEJ A;  4KQZ A;  1S9E A;  1Y11 A;  3F44 A;  2DK2 A;  5CZX A;  1MN9 A;  4JI7 F;  5LSO A;  2WRM A;  4QU6 A;  3MAH A;  1EAY C;  4HTJ A;  3G8Q A;  4LBP A;  4IG0 A;  4QR1 A;  3LTO A;  1Y0H A;  3Q24 A;  2ZVI A;  5FDL B;  4X4Q A;  3V81 B;  4BC7 A;  4OLO A;  1NDP A;  2OPS A;  1SIZ A;  3AY0 A;  3QBC A;  2OMO A;  3M1V B;  2Y1R I;  4LRB A;  1HYS B;  2R7V A;  3HKZ D;  2EW9 A;  2QMU B;  1SKW A;  1M5H A;  2HLU A;  3KHH A;  4OI1 A;  3KMS A;  3A8I A;  2PC6 A;  5LMN F;  4DS4 A;  1WSR A;  3SIP B;  1X0P A;  3D67 A;  1VK8 A;  3WHI A;  3QJJ A;  3VQT A;  1UA1 A;  1MMD A;  4ELU A;  3PYD A;  2UU9 F;  3C6T A;  3TVY A;  1RBO B;  3ISZ A;  5HJX A;  1O6X A;  2HWH A;  4K50 A;  3QQC D;  3CJK A;  5L9X A;  4CT8 A;  2X1A A;  5F8M A;  2LDY A;  4HT7 A;  4N77 A;  2FC9 A;  3NEK A;  5THW A;  4DPU A;  1YK9 A;  2YY3 A;  2QZ8 A;  1HQE A;  1CC7 A;  2PA3 A;  5K8P A;  1WHX A;  2OEM A;  4Q2L A;  2LVW A;  4N56 A;  1FNX H;  1AYE A;  5BR8 F;  3LP1 A;  3BQ0 A;  4X66 J;  2O3D A;  4KV8 A;  2R8I A;  3X3U A;  4YY3 J;  1HLW A;  1FKP A;  1C1B A;  5GVQ A;  5ETM A;  2JC1 A;  4OJG A;  1URR A;  4IFV A;  3NY0 A;  4O3Q A;  1HHQ A;  1S49 A;  4U95 A;  3LP0 A;  4QYZ K;  5EN1 A;  4Y00 A;  3MCO A;  2N3O A;  5FDL A;  4TQR A;  4RW8 B;  2ZNZ A;  4ZVT B;  4KHP F;  3DRX A;  3FMW A;  3PY8 A;  3VAF A;  2OFG X;  2F4V F;  4EO8 A;  3DYA B;  5H9F J;  3R1H A;  4ZP7 A;  4Z37 A;  4HTI A;  3WQP A;  2GIR A;  2DNQ A;  1TUV A;  1YRX A;  2MZR A;  1VC6 A;  2HS0 A;  4FVC A;  3ILJ A;  3QLH B;  4NCB A;  2XC9 A;  3QT8 A;  1OY6 A;  5GAE I;  1H38 A;  4Q43 A;  3EVO A;  3CCU S;  5CYQ B;  1ZAW A;  2D7S A;  3K5L A;  4LBI A;  3DMJ B;  4ED0 A;  2Z57 B;  2LMI A;  1RHR B;  3VVT A;  1SC1 B;  2E5L J;  3MM5 A;  1M5S A;  2HHV A;  3M32 B;  2OPQ B;  2HVH A;  2VB6 A;  3BSO A;  5K20 B;  1WOR A;  3TVZ A;  2NPF A;  2BR0 A;  3A3P B;  3I31 A;  5DGA A;  3RRK A;  3EE3 A;  2FLL A;  3K5M A;  1YIJ S;  5F9L A;  2HFS A;  1LXJ A;  2OP5 A;  3QWP A;  1CG2 A;  2COL A;  3HMJ G;  4LRE A;  3BR9 A;  3EGW B;  2H5J B;  1CBK A;  4AL7 A;  2VFS A;  2GIF A;  2XZT B;  1RAC B;  3ZZT A;  2Y8W A;  2DR5 A;  1C1C B;  4B3S F;  1RTJ B;  4O4G A;  3AJ1 A;  3HHL D;  3DGV A;  2V34 A;  3KJQ B;  1FJC A;  4F2S A;  5SUH A;  1D0E A;  1RHU B;  1HQU A;  3NP5 A;  4F3O A;  3WC2 A;  3C14 B;  3R3T A;  3DGP B;  2C3Y A;  1PGZ A;  4AD6 A;  4LF5 J;  4C8Y A;  4O44 A;  2V94 A;  4O3O A;  4X4T A;  4QZV B;  3AAW B;  2P6T A;  2CZ4 A;  3FEZ A;  3EZ5 A;  3MEC B;  2BE9 B;  2NXJ A;  3GP9 A;  3W64 A;  4QCL A;  1ICE B;  4DUY J;  3Q2S C;  1AW0 A;  5IV4 A;  2DEJ A;  1IKY B;  4TYA A;  4DV2 J;  1U49 A;  2HND A;  2M5Y A;  2GQC A;  1WC0 A;  2I9S A;  3C8Y A;  5KFJ A;  1WG4 A;  2O66 A;  4WP3 A;  3M30 B;  3N6L A;  2ASJ A;  3DNC A;  4WE1 A;  3OFE A;  3MM6 B;  4DN9 A;  2ZZM A;  4OQJ A;  5ETR A;  4W92 B;  1X4C A;  1C1C A;  3OTB A;  4M5N A;  3PG9 A;  2ASD A;  4YR3 A;  1C2P A;  4D3H A;  3BBC A;  2F8H A;  2POK A;  3LAL A;  2HGN A;  4RU2 A;  5DDR C;  1J5E J;  2XSJ A;  1S12 A;  2HQF A;  1UCN A;  2KM8 C;  4OYI A;  4K4T A;  3KJN B;  1CJK B;  1H2V Z;  1KLM A;  1IWA A;  2U1A A;  1M90 T;  4I2Q B;  1N34 F;  3BO3 A;  3C14 A;  2V0N A;  5LSL A;  3GV7 B;  3M2U B;  1T11 A;  4DX7 A;  1XK8 A;  2HVI A;  2E29 A;  4C48 A;  4RUA A;  4E8U A;  2MKC A;  2ZBI A;  2VFR A;  4TXS A;  2RU3 A;  4ZKA A;  3CJ5 A;  2F40 A;  3UN5 A;  2V8V A;  2LKZ A;  3MUT P;  1UFL A;  2DR6 A;  4DXL A;  5HSP A;  3H2V E;  3SV3 A;  1I94 F;  3C2P A;  5HL7 Q;  2G2Z A;  4OMF G;  4K4X A;  4G1Q B;  3AB4 B;  3AOA A;  1IKY A;  2DHG A;  3R6L B;  2V8H A;  3G96 A;  1FHT A;  2PFF B;  2V63 A;  1UVJ A;  1TL1 A;  2JOQ A;  4UOG A;  4NEZ A;  2FHJ A;  3Q2T C;  2PSZ A;  3U1L A;  5HVH A;  1XNQ F;  3W2V A;  4DX5 A;  1XBW A;  2MLZ A;  3MM6 A;  4NI2 B;  1BLU A;  1XN9 A;  5B0B A;  4KGX B;  4DF8 A;  4J9V A;  2CNN B;  3GSD A;  4RNH A;  2V2Z A;  2WCX A;  3BPS P;  1ZAV A;  1N48 A;  3ISN D;  1EHW A;  4LF8 F;  5DET A;  2KXF A;  4JI2 J;  3MED B;  3EDQ B;  1TL4 A;  4LFA J;  3BO4 A;  3DOK B;  1YJ7 A;  4LFB F;  2XMW A;  2YWE A;  2ZOF A;  4E2F B;  1U47 A;  3TO8 A;  2DBB A;  3MR6 A;  3IBW A;  3PHT A;  4QR2 A;  5CCL A;  1VLY A;  1X4F A;  4ZCI A;  2D74 B;  3SQG B;  2V50 A;  1GEH A;  2GA7 A;  3RB4 A;  4G3I A;  3ILL A;  2I6W A;  3FSY A;  1UL3 A;  2CPE A;  2DGW A;  4AXI A;  4MH8 A;  1A7G E;  3AOC A;  4JI0 F;  4OZ3 A;  4RW7 B;  1XQI A;  1M5P C;  1N5Y B;  1XR5 A;  4M5J A;  2K7K A;  4P2M A;  1T0T V;  2BX6 A;  4F25 A;  3HT0 A;  3KHR A;  2AP6 A;  4DPO A;  3T1H J;  2DHH A;  2GVZ A;  3KXD A;  2ZDO A;  1WOO A;  1XWL A;  4WK1 A;  3V4M A;  2BQ3 A;  1RT5 A;  4XPE A;  3AA9 A;  2FLO A;  2WBR A;  5J1N A;  5DM6 Q;  2V68 A;  1PBU A;  3AB2 B;  1FA0 A;  3VWS A;  1D9A A;  4K5S A;  2O67 A;  3CJT A;  3H0P A;  2B6A A;  4ID5 B;  3BGF A;  4OYB A;  3NGK A;  4DX8 H;  1W25 A;  2P9C A;  3GYX B;  2MJN A;  3B82 A;  3A8J A;  3GJQ B;  1VJW A;  2NXU A;  1RAF B;  3DRS B;  4YFU A;  1TAQ A;  3U27 A;  1M5K C;  2WOM A;  2KG1 A;  4IUF A;  2RS2 A;  1U1M A;  3UWT A;  2H9Z A;  5A8R B;  3O5T B;  4QW9 A;  3K8W A;  1ZBT A;  1Z2Z A;  3B8H A;  2ZVS A;  1F5B A;  1SB6 A;  4X4U A;  2ZH9 A;  6FDR A;  3HSD A;  4LJM A;  2CQB A;  1UVM A;  5EDW A;  4Q45 A;  3GIJ A;  1Q8L A;  4RW7 A;  2ZBP A;  2DPI A;  2A3J A;  1R8C A;  3PO5 A;  5DDP C;  2KXH A;  1FTR A;  3NGD A;  1C4A A;  4F02 A;  2JFD A;  2FVR A;  1YKW A;  4P2F A;  1HNZ J;  4MIA A;  1S99 A;  5FLX Y;  1YI2 S;  5ETO A;  2YNG A;  4K59 A;  2GHP A;  4X66 F;  2MZT A;  1YBU A;  2IIH A;  1N88 A;  5E2Q A;  4YY3 F;  2J0S D;  2MEW A;  1QTN B;  2N7Y A;  4KGV B;  4PWD A;  1NK0 A;  2IM3 A;  4USW A;  1RTH B;  3GIL A;  3BGR A;  4ICL A;  3QFW A;  4DL3 A;  3MZI A;  3IG1 B;  3GIK A;  3D0H E;  4I67 A;  4XDD A;  3DRS A;  3TUI C;  3D6M B;  5JVG Q;  2EFG A;  2AIR B;  4CNY A;  3LWL A;  3DRY A;  5EWE A;  3OTD A;  1Y3K A;  4ATN A;  2AJ2 A;  5HP1 B;  5A8R A;  2ZHO A;  4ZLP A;  1T94 A;  2K8G A;  1HBO B;  5KFV A;  1U2F A;  3CDA A;  4ZPV R;  4F3Q A;  4CH1 A;  1SH0 A;  2IFX A;  2WVC A;  3M9M B;  4M5D A;  4MKA A;  2K3I A;  2CQP A;  5B0C A;  3DOM B;  4EBC A;  4PQU B;  2IYG A;  3CC2 S;  4XTT A;  3C66 A;  4LQ9 A;  1IKW B;  1KNZ A;  1VC5 A;  2PMW A;  1T9Y A;  2R7O A;  1OPZ A;  4WWS A;  2CNK B;  1J5O B;  3RBX A;  3T1A A;  2E5L F;  1EJ7 L;  3OFH A;  2AW0 A;  1F2G A;  4J7C A;  2HRT A;  2J8S A;  2BBE A;  1JLC B;  1R0A A;  3B4D A;  1FJE B;  4DR6 J;  1X4B A;  3TX8 A;  2XB2 D;  1JXV A;  3GIM A;  2AU0 A;  2FYX A;  1N8R T;  1NHK L;  2UVU A;  1D9F A;  3PIO Q;  3I9Z A;  3BYP A;  1FJ7 A;  3PKM A;  4RPF A;  2A10 A;  1UWA A;  3CJS A;  4ECV A;  2ZH3 A;  1JLQ B; 
#chains in the Genus database with same CATH homology
 3J7A N;  2KL8 A;  4YY3 J;  4JI6 J;  1J5E J;  4GKK J;  2UU9 J;  2MTL A;  1I94 J;  4JI4 J;  1FJG J;  5AJ3 J;  2E5L J;  4NEY A;  3T1H J;  4JI3 J;  4JI8 J;  4AQY J;  4LF5 J;  4B3S J;  4V1A k;  2UXB J;  4JI5 J;  1IBK J;  4JI7 J;  2KVQ E;  4DV5 J;  4PWW A;  2HHH J;  1N32 J;  4DV6 J;  1IBM J;  5A2Q U;  4NXM J;  4B3M J;  2UUB J;  4KY3 A;  4DV0 J;  3IMQ J;  4DV1 J;  2UUA J;  4JI0 J;  4DR4 J;  1XNQ J;  3T1Y J;  4KYZ A;  4JI2 J;  1HNZ J;  3R2D J;  4DUY J;  3JAM U;  4B3T J;  4DUZ J;  4DR5 J;  4LF9 J;  4NXN J;  5BR8 J;  2VQF J;  2VQE J;  4LFA J;  4GKJ J;  3D3B J;  4DR2 J;  5LMU J;  4DV3 J;  4DV2 J;  1XMO J;  3J81 U;  4DV4 J;  1XMQ J;  1XNR J;  2UXC J;  4B3R J;  4DV7 J;  4RJV A;  2MEW A;  2UUC J;  2ZM6 J;  4K0K J;  1HNW J;  2MQ8 A;  4LF7 J;  4JV5 J;  4X65 J;  4YHH J;  4LF6 J;  1N34 J;  3R2C J;  4JYA J;  4DR6 J;  5FLX U;  1IBL J;  4LF8 J;  5IT9 U;  4X62 J;  1N33 J;  4DR3 J;  4NEZ A;  5LM7 E;  4X64 J;  1HR0 J;  3W1Y C;  4HHU A;  1N36 J;  4LFC J;  5IWA J;  4DR7 J;  4DR1 J;  4OX9 J;  2UXD J;  3OTO J;  5LMN J;  4KHP J;  4JI1 J;  4LFB J;  3J80 U;  2F4V J;  4X66 J;  4LF4 J;  1HNX J;  3D3C J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...