4DR5J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr5J00
4DV2J 4DR5J 4X62J 4JV5J 4GKJJ 3D3BJ 4LFCJ 4JI2J 2E5LJ 4X66J 2VQFJ 4LF9J 4YY3J 4LF6J 4YHHJ 2UXCJ 1HNWJ 4LF7J 1HNXJ 4LF4J 3J81U 3T1HJ 5LM7E 4DR6J 1XNQJ 5IWAJ 2UUBJ 4JI1J 3W1YC 4DR7J 4JI6J 4NEYA 4JI0J 2UU9J 1FJGJ 2KL8A 3J80U 2MEWA 2MQ8A 4DUYJ 4DR1J 4X64J 4B3MJ 5LMNJ 5LMUJ 3D3CJ 1N32J 2ZM6J 4DV4J 4B3TJ 4NEZA 4LFAJ 4JI5J 2HHHJ 1J5EJ 3R2CJ 4LF5J 4NXNJ 3J7AN 4KHPJ 4X65J 4KY3A 4RJVA 4DV1J 3T1YJ 4GKKJ 4AQYJ 4KYZA 4HHUA 2UUCJ 4B3RJ 1HR0J 4JYAJ 4DV3J 4DR3J 1N34J 4OX9J 1N36J 4DR2J 4B3SJ 5AJ3J 1XNRJ 3JAMU 5FLXU 2KVQE 4DV0J 4PWWA 4LFBJ 2UUAJ 1I94J 4JI8J 5BR8J 4DUZJ 3R2DJ 1IBKJ 4DV7J 4JI3J 4DV6J 1IBLJ 4JI4J 1XMOJ 5A2QU 2F4VJ 5IT9U 4K0KJ 2MTLA 2UXBJ 1N33J 2UXDJ 2VQEJ 3OTOJ 4DR4J 4NXMJ 1HNZJ 4JI7J 1XMQJ 3IMQJ 1IBMJ 4LF8J 4DV5J 4V1Ak
chains in the Genus database with same CATH superfamily
3H7HB 1S1UA 1MN9A 3MFHA 1I6JA 1H7XA 3NCRA 2E5HA 5ETLA 3C16A 3FBBA 5HMZA 1H2UX 3MCMA 5L1LA 1JXEA 3CCQS 2XWXA 4FYDA 3DLGA 4EMDA 4DHVA 2Y1RI 4B3TJ 2I1RA 1SBRA 2BVZA 4KR0B 4LRAA 3CJ8A 1EQ0A 2HMIB 5HJYA 2AJ2A 4IO1A 5KFUA 2Q79A 1LFPA 4NLDA 3KK1B 2L48A 4DX5A 2B3TB 4IH7A 4WFBQ 3E01B 3FCHA 2HFNA 2OEJA 4IRKA 1QLNA 4ED5A 3PNIA 3THPA 4BBYA 2PA3A 3MAQA 2CVEA 4RW7A 2BJ9A 4N8OA 3G82A 1LWXA 1S1UB 5T7LA 2D41A 1P1LA 4KO0A 3C16B 2KTQA 4HH1A 2LQ5A 3GR1A 3V5RA 3I96A 4OYPA 2W7OA 3LWLA 4W92B 3DLGB 5A8KB 2DGXA 3QT5A 3SSSA 2AYBA 4KGVB 2AD9A 4MMOA 3CMES 1LOUA 2KXNB 2A18A 4OJHA 2KRBA 4UY85 3ADAC 4LIWA 4PG5A 3OTOF 4I64A 1IN0A 1Q53A 2F8MA 4EUVA 1FJGJ 2KT2A 1AROP 4FF1A 1LWCA 4JV5F 3BR8A 2PC6A 4ECXA 1P6TA 3PCOB 5CYJA 3CWJA 2Y9HA 2RMLA 3NOCA 1GTEA 1WHYA 3FUYA 4MYUA 5F0UA 2BJ1A 1KOOA 4TY8A 3MPDA 3G82B 1B4SA 4YMEA 3QT8A 5T7LB 2DJWA 1WACA 1U7LA 4KO0B 3KG0A 3G96A 2BQRA 2PIIA 4P2FA 1RWXB 3FRZA 2CJKA 1GX6A 4TY9A 4F4XA 3CCLS 4F2RA 3NEKA 2LLZA 1NCLA 4PABA 1YZ6A 4JBCA 3VR1A 3MTJA 2K7JA 1U09A 4J9RA 3PACA 1H7WA 1LWCB 4LSNA 4BCAA 1T8EA 4LFCJ 4PR6A 5KG0A 1BC6A 3GYXB 5F3TA 2J5AA 3CT9A 2VL1A 4TY8B 3L9ZA 2KG1A 2N3OA 1IJFB 2GQCA 3RUBL 2ROGA 3QLHA 4ZVEA 1OY9A 4YR3A 4ZVTB 2CQDA 3QWUA 1KDNA 1N48A 2LFVA 1WC4A 4L6V3 1S4EA 3K57A 3K5PA 1BWEA 2MPUA 4JV2A 2OD6A 3M05A 1H6KX 5L9NA 2IYGA 3C19A 4V19X 3MZIA 1LXJA 2G2ZA 4NZ0A 4B9LA 1V6HA 3G6ES 5CD4A 2FHJD 2FYXA 2UP1A 1NU4A 3BYRA 1WG4A 1YRTA 5FJ4A 4LSNB 2ZH4A 2J76E 5H9EJ 3GYGA 5E5NA 1HPZA 4OZ5A 2PMHA 5F9NA 3DM2A 2ATLA 3WHIA 3IWNC 4OX9F 5HAOA 4DCPB 3MEDA 4DI6A 2VFSA 1T3OA 3FSIA 4M95A 3O6QA 3QLHB 4DV2J 1S0OA 1DQAA 4DX8H 1R8PA 3G8QA 1TK8A 1XMOF 3AT1B 4B9SA 2XCAA 1S99A 1T9TA 2FZCB 2V67A 4PYAA 3KUGA 1JLAA 4USMA 2KL8A 4DV5F 1QSLA 2RD5C 2PE8A 2QN6B 1NEEA 3TYTA 2ZUAA 4MK7A 1WSRA 5B0GA 4TU8A 5C5JA 1QAIA 1X9MA 4GKKJ 1BE4A 1HPZB 1KFDA 3DM2B 2XQCA 4FF4A 1QAXA 4WP8A 3L7PA 4KGZB 3MEDB 4MIBA 5L1KA 4WZQA 4WK3A 1HNXF 3T6BA 2OMOA 2JC1A 3JQKA 1YZ7A 5ETOA 4UUWA 2Z2MA 4WXOA 1U1RA 2QL5B 3M6XA 4YDXA 3A8JA 1U1QA 4DV3F 2FZGB 2CAJA 2B8PA 1VHFA 4K8RA 1YJ9S 2YWEA 1RTDA 2RF2A 4QQBA 2MDAA 3KLFA 1JLAB 3WIUA 1RT3B 4GKJJ 2N82B 2L9DA 4YN3B 2DHGA 4F25A 3X1LB 1JQGA 2M0GB 2UXDF 3KDOA 4DR5F 4NLSA 4H4OA 2QLBB 5HQMA 4L75A 1DJ0A 2F65A 1S59A 2PSZA 2ALZA 3LP0A 3Q2SC 1YX2A 4CYUB 2B9EA 4P2MA 3VGUA 2CFXA 4U95A 2HGLA 3HX9A 3OFGA 3QO9B 1IR1A 2ALYB 1N34J 3GWCA 2XS2A 4X66F 1RTDB 2RF2B 2VV5A 3ZTPA 4LBHA 3KLFB 2WB1D 2ILZA 4U96A 4FVCA 3R5CA 4OYBA 5GADU 5D4LA 4Q5VA 4OZ2A 1WSVA 2IVFB 3W7BA 2Z2ZA 3H2LA 4BHQA 2DPJA 2MQMA 2HIQA 3I5CA 3NS5A 2Z4PA 4H4OB 8AT1B 3LP0B 4USWA 5F0WA 1U1KA 2C3PA 1F2HA 2RE1A 4DN9A 1RABB 3LUYA 5D4NA 3TI0A 1NSPA 4USIA 5RUBA 2AJ1A 1FE0A 2QC3A 4NI2B 1FKOA 1ZH5A 4ZVHA 5DM7Q 1NHKL 1Q7YT 4I68A 2YX4A 1LWFA 1S57A 3OBIA 2NREA 3R7NB 1RI7A 4ECRA 1XNRJ 3D6TB 3U7JA 5IXUA 5HANA 3CJTA 3BQ1A 4L3NA 2KXFA 4YDDB 2KRRA 2ZNZA 2HG4A 1U1PA 3MEKA 2J6TA 1SH3A 3TZXA 3VZIA 3NKYA 3A4TA 2RDJA 1CVJA 3LPYA 4B3OA 2IMWP 3CJ2A 3W9JA 3WZ0A 4UY8T 1VJQA 1IBLF 2BE2A 5EWFA 2KG0A 3R3TA 1FKOB 1XN9A 3MUMP 5ETKA 3HD1A 3JSYA 1TUWA 1VQSA 2O3DA 1LWFB 3LGHA 1QM9A 2OD4A 4KGXB 3MEEA 2D3O1 5GAHU 4FYWB 1CPZA 3CCSS 3GSDA 4ECQA 3GQCA 1HD0A 1FWPA 4D3GA 5DDPC 1NDPA 3GPAA 1UJ6A 3WX4A 4ZN3A 4IRDA 1XIQA 2ZJQQ 2CQ3A 2W2OP 1RTIA 3PR4A 5GAGU 1Q16B 3M6WA 2CYYA 2AJ0A 4B3OB 1VYAA 1BQMA 4BS2A 3LANA 1S12A 3T6JA 2BE2B 3KJVA 2M88A 3G8SA 3PVXA 2E44A 4LVOP 5D8HB 1A9NB 2Q43A 1N36F 1TKXA 1WOPA 3L7UA 2LQ9A 3DGVA 2AEMA 2D69A 4NPOA 3M30A 3MEEB 4YHHJ 3OR1A 3T5LA 3IP0A 4ILMA 3C8YA 1RHJB 4DSIA 3QNWB 4DR1J 1JLBA 1O6XA 3CMAS 3BDPA 2PMWA 2CPHA 2Y8YA 1RTIB 2UXCF 1IQZA 3CJKA 1KBRA 1VLOA 1RWNB 1BQMB 3OL7A 1UPPA 4Z7CA 1T7PA 2HLTA 3KJVB 1KD1T 3M7VA 3KYLA 1P9YA 1NK8A 1JLQA 2V34A 3THTA 2GJIA 1WUUA 5DQIA 1WD6A 1TKXB 3ISND 4F2SA 4DQRA 4NXNF 5B0CA 1KP6A 3K5LA 3HHDA 3EZOA 4M1KA 2CJYB 3GILA 1U1LA 3LAMA 2YKAA 2F8EX 3OR1B 4LJMA 3N6NA 4K4VA 5JXSA 2JSXA 3NWGA 4TXSA 4GRSA 1X31C 3ETMA 5HATA 1JLBB 2OUGA 1D9AA 2MZJA 2W9BA 2VPYB 3POTA 7FDRA 3MR5A 3HHLD 4P75A 3CJKB 4DR2F 3BBCA 3FVYA 2W25A 2BM0A 1JLQB 3T41A 2GX8A 4LVNP 3M6UA 1VRQC 1RZMA 2J9DA 4C98A 3ISNC 2IM0A 2JEFA 2OPPA 1H74A 3BQ0A 4L72B 1KTQA 1N5YA 3UN3A 3I4PA 4P6QA 4ZPCA 1UZHA 3P3DA 3DRRA 2LQ8A 3S1TA 3VAMA 1OIAA 3IGVA 4OJ3A 2SXLA 3BZQA 4K4ZA 4XO0A 1B0PA 4QR2A 2W9BB 3POTB 2RHSB 3GSIA 1N5QA 3CW2C 4OV1A 1WEYA 4BWJA 2VKRA 2ZDOA 2H4YB 4OZNA 1I94F 1HQUA 2F4FA 3OL8A 3RAXA 4ZCMA 2CZ9A 1HNWJ 4ED4A 4OZLA 4NMXA 2RJZA 4FP9A 2OPPB 1WF0A 2RU9A 1N5YB 4B3MJ 2D7SA 1VS3A 3Q8SB 1FNMA 1RTHA 3DRRB 4PQAA 1H98A 3LO3A 1SJQA 1PCAA 4KHPJ 3EVOA 1M1GA 1YGYA 1F9HA 2ZEJA 2UUCJ 2XY6A 1WC0A 4NLYA 4WP3A 4QIVA 2JX2A 2R7OA 4UTGA 1GXUA 3R5BA 2NZCA 3H4BA 2ZJRQ 4FS1A 3EE3A 2M2BA 5BR8J 1HQUB 2JZ5A 4DUZJ 2BR0A 3HM9A 4NLVA 1K0VA 4L76A 1U8SA 1S0NA 3CDEA 2YQ1A 3KLHA 4NOHA 2HRYA 4PWDA 4PAAA 5KG5A 2H3EB 1N4LA 1UEUA 4ZPAA 1NK0A 6AT1B 2QA4G 1RTHB 3GJQB 3J7Z5 1RWKB 3HXMA 4FXWA 3V6DA 2HGNA 3O2IA 3NOGA 5KFBA 4JI7F 3BO2A 3CDUA 1FDAA 5B0EA 5BYSA 1MWYA 4DJBA 1O0PA 2R42A 4USJC 4E98A 1ZM2A 4WKRA 4ES2A 4WU2A 2HQDA 4KH0B 3CSKA 4JI6F 1FVQA 2DNLA 3KK3A 1CBKA 4RU2A 2DO0A 2DNPA 1AW0A 4HH0A 3KLHB 4DQIA 2NPFA 1H38A 4PWDB 4YEAA 1ZPVA 2NZ4A 5IC6B 1TKZB 1OYEA 3T9NA 1ROFA 2VU5A 4ANDA 1S7HA 4DLGA 4LF2A 3V6DB 1U6ZA 4O3QA 1HLWA 2H54B 1NO8A 1RU2A 3QWPA 2CQHA 1Q8KA 1BQNB 2APOA 2UVVA 5AXMA 4NLOA 4X4SA 2E5GA 4LF4J 3VAIA 1YKWA 2B9XA 3QBCA 1NSKL 1ZZNA 2EFPA 2X7IA 1IKVA 3KK3B 1S48A 1EQMA 3PYGA 1RAHB 1SJ4P 1X4EA 2GFFA 3VV2B 2ZWPA 2Z8QA 1RQ0A 2GGPA 5DG8A 3BKUA 4AFFA 4FYYB 1IM6A 3Q83A 4ECSA 2J7UA 3U1MA 2FJWA 4TN2A 3SYZA 4LMZA 3NLCA 3VAFA 2E5LF 3H5UA 1U1NA 5IT4A 3RZAA 3HT3A 3HI9A 1WEZA 1CQMA 4GVLA 5F8HA 2HHQA 2XGQA 1RAAB 2PD1A 4DEZA 1IKVB 3AB4B 2K2PA 2FD2A 2GGPB 2X1BA 4CCHA 1WHVA 3I87A 1N5VA 4RLEA 1D9DA 2B43A 2DD8S 3SQGA 1L3TA 3OLAA 2QZ8A 1NDLA 3ILIA 2DHXA 3FSXA 4CZCA 3NAHA 3THVA 3T1HF 2FJAB 1M90T 3GMGA 4P52A 1IR2A 4P73A 2MGZA 1F3FA 3PFOA 1NDKA 1NK7A 4CO0A 2FVCA 4CQ1A 4Q45A 5F8IA 4U67Q 2YKNA 1RE1B 1WC3A 3KFWX 2B56A 1T9VA 2IM2A 2NXUA 5IT0A 1CLFA 5A76A 2C42A 1SC3B 1KWMA 4V19J 2XYGB 1SL1A 3KTQA 1IWAA 1OPZA 3IAM9 3B4MA 1T0TV 4IYQA 3P5TL 5LSOA 3SQGB 1Y5LB 3CGIA 1L3SA 4PXCA 1D0EA 1VJWA 4G1PA 4J9OA 4OYXA 3QGGA 2GS8A 4PG7A 1REGX 5IV3A 2G4BA 4UOFA 1U0HA 3AAWB 2MGZB 1QSYA 4X64J 1SH0A 4JV1A 1RAJA 3EPIA 2YKNB 4LRCA 3M2VA 4E0DA 2FHJA 3PIPQ 1REVA 3T1AA 2DO4A 4DR6F 1JLFB 4DR7F 5D6GA 2UVRA 2QG9B 1MMNA 3A13A 3MGJA 4CH7A 2GCFA 2DVIA 3N0VA 2VJVA 2IRUA 5A0YA 3S7RA 4FPIA 2YH0A 3FEYB 4DDFA 3PX6A 3AXKA 2NUHA 1T05A 2F7VA 1PILA 4OI2A 3OVSA 1HR0F 2M8DB 4PPZA 4IOBA 4HTJA 1U0HB 4R25A 3NL0A 1V3SA 3KJFB 1IBMJ 3T5HA 3H5SA 2DHAA 4DV7F 3M2VB 3M32A 4LT6A 1RB0A 1REVB 1T9XA 1Q4RA 2OHDA 2XNQA 3Q8RB 4KHMA 2N3LA 2QLJB 1JLEA 1UAWA 4A8WA 5A0YB 2YKOA 2XMKA 1O5JA 3IS9A 4K59A 1T05B 1FJ7A 4I2QA 2FVSA 2ADBA 1KHVA 3OVBA 4B3SJ 2VONA 1HI1A 1RAFB 1PO6A 2FLNA 1Q8BA 4KT0C 3OXLA 4EBEA 1WWHA 5KFEA 1TZ0A 1T9UA 3M32B 3DFEA 1YK9A 2DTJA 1APSA 5DS7A 4FN5A 1L3UA 3OXGA 5ITHA 3LA0A 1UVIA 4K4WA 2LYVA 3J7ZT 2HPUA 1JLEB 2R8KA 2LP4A 1UFKA 2CPEA 2HFVA 1FKPA 3CB4A 4AYBD 1RDRA 2VB6A 3VF0B 4DQQA 2IM3A 1VHIA 3DRPA 2QE5A 3GV7B 2BJ7A 2UVUA 1NMEB 5HMWA 4I69A 5KT7A 4TLRA 1H3DA 4W4MA 3IS9B 4GO5X 3DOMA 4I2QB 3Q23A 2DB1A 2XMJA 2DR7A 2EG1A 1JK9B 4N5SA 2VF3A 3HULA 1YSJA 3RB3A 2IA6A 3TX8A 5IQQA 2MKSA 3SFUA 1XNQF 3H5XA 3W63A 4K4YA 4IFVA 4JI0F 3VAGA 2ZBRA 3FZBA 1TAQA 5H9EK 4DR3J 3W5ZA 2EPIA 2GAGC 2HBQB 5LMNF 1BMQB 4LR9A 4IFYA 1ZA2B 5DG7A 1CJKB 4RKUC 4ZP7A 4WKYA 1BHNA 4OX6A 1U2FA 1FKPB 1EP4B 3Q8QB 4HI2A 1R8HA 1WDDA 3I0SA 4A8YA 4QU6A 3I5AA 4P10A 4QWAA 1FJCA 1WHXA 3DRPB 1NNDA 2UXBJ 2V5HG 4WFZA 2ASJA 3DOMB 4OIXA 2H1YA 1X4CA 2HSEB 4N41A 2OKQA 1J27A 4J9VA 3ET6A 1XTZA 2AEJA 4LF7J 4IR1A 3WDOA 2OEKA 3V4MA 4ETXA 3H4DA 3TQEA 4IFVB 3PJXA 1M5KC 4R0EA 2XI2A 4ZDNA 5JVHQ 1SKSA 1V9OA 1M5VC 1AZSA 4YY3F 2DH8A 2QLFB 3ULHA 5IS2A 4W90B 4JI1F 5KFIA 4X65J 3I82A 1KQGB 2AYGA 1WI6A 3I0SB 2MKJA 5BJRA 4I6YA 4I4BA 1H73A 3LQVA 4WXWA 3EVMA 4R8UA 1J5EF 1U47A 2YKQA 3GP9A 1HMVA 2CWKA 1RA7A 4ED7A 3ET6B 2HHSA 2NCKL 5IOLA 2E5JA 1AUSL 1WHWA 4LF8J 4J9PA 1FE4A 3D9BA 4C8MA 1KC8T 4RWWA 3HVAA 1X5SA 4AT1B 2QFJA 3H8YA 3EXCX 3UR0A 4ZKAA 3PZPA 3SCKE 3QJJA 1IVZA 2JH3A 1YITS 1HI0P 1SH2A 2BX6A 2XO6A 1W26A 4F3MA 3GV5B 2FPHX 4ECWA 4DR4F 3FEXB 4ZMMA 2J7WA 4GVBA 1VK3A 3IM8A 3GYNA 1PIEA 2ZNYA 3UWTA 4R8UB 2LXFA 3KHLA 4MKAA 2EXUA 1VQ6S 1M0SA 3MM5A 4DV1J 1HMVB 1NH8A 5KT4A 3HHEA 1HYSA 2M4MA 3GFXA 3N9UC 1YJUA 4J91A 3GB0A 2RB7A 3HO1A 3OHBA 2IJRA 5BYQA 5B08A 5DQGA 1R8AA 1QVGR 4NMLA 4QW9A 3NGUA 4YB5A 3OXFA 2MTLA 4C3MA 4QPXA 2MKKA 1VQLS 2B7CB 3PEJA 5ETMA 4Y0FA 4GVBB 4ZVUB 2XEXA 2V69A 2XLJA 1B0TA 4JI4F 1FTCA 2HYIB 1UPMB 4DL3A 1N34F 1R7IA 2QGFB 2ROEA 3UI3A 5EWGA 1IKWA 3MM5B 2NLWA 3AHPA 4DUYJ 4H54A 1FFGB 4DSLA 1HYSB 2YKPA 3PYEA 1XWLA 3VAJA 2GA7A 4DSEA 4K4UA 2VODA 2D1CA 1UKUA 4PYDA 2ZVIA 4EZ6A 3PRBA 3M2RA 4DN0A 1LNQA 5CABA 1JXLA 4ANCA 3NCQA 3MI7X 1FD2A 5CH7B 2C1EB 3IR7B 3NGTA 3SV4A 1OY8A 3KK2A 3EGZA 4MTPA 2WTFA 4CP5A 4X2BA 1H72C 1RBOB 2O01C 3ZZZA 1WELA 3M2UA 1IKYA 2VA3A 4UOHA 5D4PA 5F41A 4FKYA 4ETZA 2DNOA 3HHLA 1J5OA 4RNFA 1SKRA 1NLKL 1IKWB 1QD1A 3GJRB 4UQGA 3TA0A 2G9OA 4KE5A 4A8OA 3LF0A 2QA2A 1T9WA 3AXMA 3CCZA 3C6UA 5HVHA 1HBMA 4CLFA 1VRTA 3KDNA 3AD9C 1YIJS 4QYZJ 2CA9A 3M2RB 5LXRA 2R7WA 2UU9J 4PXBA 2MEWA 2I9SA 3G2XA 2P9GA 1HBOA 3KK2B 4DF8A 3H5YA 2C2EA 5EUHA 4LIRA 4DQSA 3MCSA 2VFRA 2UUBF 4AQYJ 5B0BA 3M2UB 4RW6A 1IKYB 1KOHA 1PJ6A 1FWLA 3IA0A 5I3UA 3HHLB 1ICEB 3MPYA 1J5OB 4ED1A 3DLLQ 3R1HA 1JWWA 1HFEL 1MU2A 2P6SA 1K9MT 4ZVOB 2M7SA 3U27A 4X4RA 5LXYA 2JOQA 4P9SA 4CLYA 4CNYA 3C6UB 2AJQA 2BW2A 3ZZOA 4O3SA 1VRTB 1RHKB 1EB0A 1XC9A 3W3SA 3DNCA 2W8LA 3HZGA 4ZCIA 4KQZA 2RH3A 3U1LA 2LDYA 1QJHA 2CIMA 4DL2A 4I1TA 3TAQA 4H4MA 4RX6A 1HBOB 3D1OA 2A3JA 2BJEA 5C24A 5LJ3Y 2VHGA 4WFNQ 2C22A 4ZP9A 3PO4A 5I3UB 4C8ZA 2O67A 1NAQA 4P72A 2J9EA 5C42A 4HVZA 1MU2B 1EIYB 5J1PA 3ZTOA 1W7WA 4J90A 2HVIA 3FCWA 4EU0A 2VASA 1NJXA 2K06A 5BXIA 3W60A 3CO0P 4ZJOA 3FBEA 5E3RA 2EC2A 4WJBA 1LK5A 2NPIA 3JAMY 3RAQA 4PG4A 4H4MB 4YQWA 3T1YF 2OFGX 4WTOB 2LCWA 4UOGA 5KFZA 5C24B 1PYOB 3D6HB 1YJWS 2ZBQA 1Z4UA 2WSCC 2DEJA 4LREA 1ZBTA 3VAKA 2YNIA 3DCAA 4ED8A 2G1DA 4UW2A 5E3AA 1UP1A 5C42B 5DZ6A 4WP9A 4CO5A 3CCJS 3BYPA 2DR8A 2HVEA 4QJVA 2AWZA 1SL0A 5E2QA 2E9ZA 1RHUB 2H5JB 2M70A 4I6WA 4QCLA 4KGMA 3B54A 1WG1A 3N01A 4C8NA 4LF1A 2ZH3A 1S79A 1U02A 1UMJA 4N8NA 1U1OA 4CM0A 4RBTA 4ZVQB 4ZP6A 3DLHA 3W64A 4OX7A 4FZVA 2J8SA 2YNIB 3IWLA 3QT7A 1K8AT 1Y10A 4HT7A 3H2VE 1N88A 4H4KA 1LQ9A 2E1AA 1LWEA 5LSLA 3H2UB 4U8YA 3DMJA 3R9LA 3EM1A 2XZTB 4HI1A 1S1WA 2A6MA 1V3ZA 2WVBA 1C1CA 4OHWA 3UDCA 3W65A 1XQIA 3FJ2A 3H59A 3ZZUA 2W2PP 2WOMA 2FJDB 3CIMA 1TK0A 1TL1A 2KM8C 4LF6J 4YB7A 3ZC4A 3ICLA 4N77A 3EXYA 1K1QA 1B0VA 2DNMA 3DU5A 2J6SA 4JI2F 3C3LA 4DL7A 5ADZA 2KHCA 3EUNA 2K1RA 3J7AN 3EDQB 3CCMS 1UL3A 1LWEB 2D74B 4TQRA 2ZKTA 3FK4A 3C14A 3DMJB 1NZ8A 1IUJA 1S1WB 2MLZA 2F1FA 2IA0A 4RUCA 4DV4F 3OJUA 2Z56B 4LQ3A 3CD0A 3NGKA 2WOMB 2W4DA 3EGNA 2VPXB 1TL1B 3C2PA 4ELVA 1F3VA 1IXKA 2HBYB 4AXIA 3WC0A 3DKDA 2VQEJ 5A2QY 3UVJA 1YI2S 4CDIA 1EX8A 1WC6A 1P9QC 1G6BA 5J2MA 6FD1A 1FVSA 3D3BJ 3RRHA 1JX4A 2ZKUA 3IRWP 4LF9J 2YPZA 3IBFB 2CQIA 1RXOB 1IJEB 1U4BA 2BE7D 3OL6A 4JOUA 1A7GE 5E33A 2K1RB 3JSMB 1NJYA 3CJ3A 3HFKA 1D3WA 2KDOA 3C14B 5J1EA 2QLXA 3QJPA 4ZPDA 1PSDA 2M9KA 1N0VC 4IG0A 2CG8A 4G1QA 3PRDA 1NPKA 3G87A 2Q66A 3PIOQ 3T5KA 1TUGB 2ZWOA 1YJRA 6FDRA 2BBEA 1UZDA 4Y00A 2VH7A 4HLBA 4M5NA 3C6TA 2PO4A 1G1XA 3D5MA 1GH8A 3UVJB 2Q1LA 4J9KA 1RAOA 1S9GA 4NCBA 2QLWA 4WTYA 2DRAA 5J2MB 2AX0A 3G71S 1XEZA 4ECUA 2E7XA 3D28A 2RQKA 1ZAXA 2CPFA 3UD3P 3QGPA 4HHJA 3T19A 3K5NA 5J1EB 4DCOB 1I3OB 3HF5A 4MIWA 4IG0B 2OMLA 4G1QB 5KFCA 1VBZA 4NA2A 2CUYA 2ZE2B 2LQBA 3D2WA 3C6TB 3BKFA 2RUSA 3I55S 3OFHA 2DXEA 1U6BA 2UZAA 1S9GB 3JQMA 4RW8A 3M9MB 4QU7A 2BW7A 3N28A 1XR5A 3M6VA 4CLLA 3HVWA 2Q6BA 2BXJA 4F4KA 2DRDA 4I7FA 4X4OA 2VICA 2HS4A 3IXQA 4ID5B 3EVWA 3RB0A 1NM2A 3SBMA 3QSYB 4Y2MA 3F41A 1RWPB 1EKSA 1ZAWA 2W2MP 1RCOB 3TZYA 4DWIA 4X4QA 3OTOJ 1KHWA 1WORA 2L9WA 4LFBF 3GFZA 2EG2A 5ETPA 1GAOA 3BREA 1CC7A 4JV5J 2BUNA 3UW1A 4DUTA 2LMIA 1GEHA 1EETA 2LKZA 2B4OA 2F4VF 4RW8B 2IBKA 2WBRA 2DIVA 5K8MA 3BO3A 2ACMA 5HN0A 2PT0A 1OSCA 2GJ2A 2KU7A 3QQCD 2WONA 2RILA 3PRVA 1SIWB 1CG2A 4C8OA 1TUVA 3E3XA 3W5YA 4L3KA 2VDIA 3L95X 4ECVA 2MZTA 3BR9A 2JVRA 3AA8A 1OSDA 3CCRS 3BSNA 3F73A 1L5UA 5D3GA 2DNHA 2GIRA 3BBFA 2R8HA 3TA2A 3TO8A 4E2FB 1VLYA 2V6AA 3ENQA 3N5BA 3UN5A 2M52A 4GO7X 2IM1A 2PN6A 1EETB 3UDVA 2IDEA 1SC6A 3AQPA 2ZZTA 5IT9Y 1TL7A 3OW2R 2FY8A 2MY7A 2RS8A 2WONB 1T9YA 3IN5A 2XBPA 3MPWA 3TJ9A 4Z2XA 4S0MA 5LM7E 2WK4A 4ZLJA 4DQPA 3PW0A 2RKIA 3KWMA 1NSAA 2K8GA 2EBEA 1BQXA 5HK4A 4C0HA 3MMAA 4OZ3A 1Q8IA 5D3GB 5KFSA 2QYGA 1R8CA 2JLGA 1L3VA 3NNCA 3L7OA 4ZVFA 4ICLA 4O3OA 2RUGA 1S6UA 1LV5A 3GJTB 1CQNA 5T41A 4OX9J 2GQQA 1SB6A 4PXDA 1FX2A 4RUHA 2MQNA 2R7UA 2HK3A 5I3QA 2C2MB 1MSWD 4UQTA 1KLMB 1DTQA 2A10A 4ECTA 2EFNA 4PEOA 3NG8A 5AXLA 3M8SA 1GT8A 2M8HA 4EEYA 1XMOJ 3K7RA 3PTWA 4IO9Q 1FEHA 3FMBA 4EGLA 2RKIB 4LSZB 5JVGQ 1EAYC 1DRZA 4DV5J 1RWWB 2DGWA 5A8KA 3UN2A 2K7KA 3N79A 3MMAB 4WYWA 3VWSA 3V4IA 2RAQA 2WSEC 3PJ9A 4L74A 3H20A 4KFBA 3P49B 2C2KB 4ICLB 2LQJA 4KTQA 1A0OB 2AP6A 1PJ7A 5HQLA 1BY9A 3HSZA 4O4GA 1SV5A 1XBWA 1F5AA 2HWTA 2J0XA 2DRBA 5B09A 1DTQB 1KSPA 3Q8UA 3W66A 2HZCA 1KVKA 3A8IA 2FJBB 3RR8A 4Y6IA 4DV3J 5LMUF 4QWBA 3JTNA 4Q2MA 5AJ3J 4CO4A 1RHRB 4FS2A 2FQQB 3SQOP 4C0OC 3R97A 5U47A 4XDDA 3N4WA 3DGPA 3OHAA 2IC3B 4MYTA 5K14A 3NGRA 1KVJA 3V4IB 4ZLLA 2YQ3A 1MN7A 3OL9A 1QTMA 3F44A 4KFBB 2DCUB 2UXDJ 1XJWB 1TFWA 4K4XA 1WTFA 3OV7A 4M5KA 3PY8A 4DR5J 2Y1LB 1ZA1B 2BABA 2C28A 2E1MC 4O4GB 1SV5B 2OTLS 2Y1JA 4MAKA 3PEHA 4TVAB 2OSQA 1VQ7S 1NH7A 1HD1A 2DNRA 2H51B 1RWUA 4LRFA 2JFKA 4G3IA 5KTQA 4M5JA 3BGOP 4DZDA 3NMAA 4PCQA 4B9TA 1OQ6A 5D4OA 3W5XA 3MPUB 4U7CA 2FLLA 2MSTA 4ENOA 1FRXA 2AZ3A 3DGPB 4J37A 5K14B 4F4YA 1CULA 4HT5A 4QOTA 4ZLPA 4JI5F 2YX7A 3DYAA 4JI8J 3VAHA 4U7UD 4N56A 1YHQS 3MAAA 5DM6Q 1YBUA 1YBTA 1UA1A 3C46A 2DT9A 2CNLB 2MZRA 4DU8A 5EN1A 3ZO7A 2RHQB 3W9HA 1Y11A 3VVTA 1VQYA 1QAYA 2DHSA 1ZOTA 2YNFA 3K59A 5KT2A 4CO1A 1QVFR 3I6PA 5CXTA 4URGA 1VIOA 5IV4A 4K0KF 1HQEA 2K3KA 1AUDA 1Z2ZA 1D9FA 1AYEA 2Z30B 2KJWA 1VQMS 2ABYA 1CULB 1VBYA 4OYOA 2ZHAA 2E66A 2NXEA 3P45B 3DYAB 1RWMB 2HFSA 3MAAB 2OJ3A 1D8ZA 2V94A 1GQEA 2JEIA 3W9IA 2ZM6F 2XMAA 2ZH7A 2HNZA 3I0RA 4U7UK 3OTCA 1BD6A 4XPEA 3MWBA 2YNFB 2VG5B 1IBLJ 2ASDA 4A8XA 4C4WA 3T9ZA 1HQEB 5CCMA 4P7VA 1HNIA 1X4AA 3K17A 4K50A 4L73A 1RT3A 4JI3F 1YQHA 2VQFJ 2BKOA 3Q86A 2Z2LA 2WBMA 3MD1A 2YX1A 1GTHA 4C8YA 2YTCA 5G4DA 3H0PA 1JNRB 4D3HA 1XMQF 4NZ7A 1RCXB 1TTHB 3PW5A 4EK2A 4CIOA 3FDSA 5KT6A 2HNZB 3DHXA 3V6HA 3I0RB 1PC5A 1YBAA 4DG1A 3CIZA 4FYXB 4WE1A 3AA9A 3GLJA 3EGVA 4CYUA 5DLFA 1SJFA 4JB8B 2GV1A 2FJXA 1UVJA 4M5DA 4WIQA 3CD5A 5CYMA 4NLGA 1VOMA 2YVSA 2RRBA 1TQLA 2U2FA 3QO9A 1WJ9A 1N36J 2AMCB 2LEPA 1RP5A 2DCLA 4LFAF 3BQ2A 1HNIB 3RW7A 2HHHF 3QIDA 4NZ6A 4LF5F 3B4DA 2DNNA 3CJ4A 4DPTA 3AODA 3HKWA 2L3MA 1AFJA 1RWVB 2VPWB 2PI5A 5KG7A 3NNAA 3DLJA 1UA0A 1JXVA 4DFKA 1TELA 1S6QA 1K47A 2DBBA 1Q79A 3UDLA 2WZ1A 5B0DA 3KHRA 4OYAA 2OP5A 4JUZA 2XMVA 2FGOA 2CNKB 2UXCJ 5I3PA 4KB7A 2X1AA 3BO4A 4WU3A 4DG1B 3PYFA 4K2JA 2CPIA 2XLIA 4WE1B 4IH5A 3O5TB 2F40A 1PJ5A 2CADA 2HKEA 1M1HA 1FXLA 3JS9A 4M5DB 1VDHA 4NYPA 2XB2D 5CYMB 1Z2LA 3J80Y 1BGXT 3DU6A 2DGOA 4NI2A 2E9TA 4NXNJ 1FFWB 4M8LA 3UCGA 1CJVA 2RT3A 5DLGA 2GVZA 2HBZB 3BGFA 2NUUG 2K3IA 3MMJA 5H1SV 3ZXWA 1R6YA 4P2XA 2D3OR 1RKIA 4MFBA 4ZVRB 1CJUB 5D77A 1S6QB 2DGTA 4XDCA 1T03A 2DH9A 1Y5IB 1BXNA 2AX1A 3HJFA 2V50A 4IOAQ 3S01A 2MJNA 4OJ1A 3BH7B 4NXMJ 4QYZK 4K5SA 4EYIB 5L1JA 3TVYA 3M1VA 4BC7A 3CJRA 3RB4A 1Z1ZA 1TV6A 4DS4A 3MM6A 2WVFA 4MKYA 5L8RC 3GE9A 4G1IA 2Y1IA 2H65B 1AT1B 1RWOB 1M5HA 3MUVP 5KFKA 2OPSB 1CJVB 4I6AA 2GVZB 2MQ8A 3D3CJ 2IVMA 3GZ7A 1S1TA 1RHQB 4MFBB 2CJXB 3BSAA 5LL6d 2GW8A 3BM7A 1S72S 5M2RA 2W24A 3ITHA 1T03B 5KFJA 1PAEX 1R43A 4C11A 2R8GA 2XTJP 3QRRA 2J8AA 1TL4A 1X0FA 2NXJA 5IQ6A 3JAMU 4WWSA 1S97A 1OJ4A 2KVQE 5DETA 2X1FA 4CTAA 4CLWA 1I94J 1T11A 3M1VB 3ZZTA 2GAHC 1FKAF 2HBRB 1TV6B 2FHKA 3MM6B 3JXOA 1R0CB 2XY7A 1AXQA 1UETA 1NK4A 2KYXA 2MHEA 2NXNA 3OTBA 4RBVA 4WIIA 2OELA 4UZCA 3TZWA 1IBKF 3TZZA 4PQUA 2GNKA 1S1TB 1RT4A 5GAEU 1MROA 4ZA1A 3ITHB 4G6VB 4NX9A 2B4VA 3M8PA 4XAKA 3ZNUA 4C11B 1HBNA 4P74A 4F7VA 3KXDA 3JTOA 2ATCB 5E7OB 1PG5B 2C2RA 1Q0NA 3RTVA 4CTAB 4DL4A 5HLFB 2DXFA 3K5OA 4QW8A 1V5IB 2DEIA 1RISA 4DX6A 2QL9B 1XK8A 4TYAA 3I56S 2YQ0A 3H25A 1Y0HA 1FJEB 1HBUA 4QWDA 3IWXA 2MSSA 3MUTP 4PQUB 5CYQA 3OQ2A 1RT4B 2J7KA 3ZZYA 3DHWC 3GFYA 1MROB 3FC9A 4M94A 3V6JA 3M8PB 1KEKA 2R4FA 4JI7J 5I42B 2UUAF 9ATCB 1HBNB 3PKYA 1ZM4A 4DV6F 2HRUA 4F04B 3SCLE 2FY1A 1QDUB 4NCGA 3BBBA 2Z57B 4NA1A 2F63A 4JI6J 1FXRA 2ZD1A 1ULRA 3G8TA 1H2VZ 1VC0A 1NBEB 3O3LA 1S1XA 5F3ZA 3MECA 4PWUA 2N7CA 3TA1A 1HBUB 3ENVA 2XZWA 2P8IA 4KPCA 1LFWA 2J9DE 4A8FA 2BRLA 1N54B 5CYQB 5KFNA 2MLXA 2YWWA 3PX0A 3MR7A 2FJEB 2E1PA 1N32F 2FUG9 5KFXA 4LR8A 5KOXA 3MPVA 5CCLA 1Q82T 3GU0A 3VALA 4J7CA 2PEHA 1G7CB 7AT1B 2BJDA 3GIJA 4B3RF 2J0WA 5HO4A 5IFMA 5A2QU 3PFEA 4NCGB 2C2DA 1FD8A 2Y8WA 3VGVA 2CJAA 1HI8A 2ZD1B 1E6VA 3LALA 2BQUA 1F2GA 4F0HA 3PO5A 1UJ5A 1S1XB 3UPFA 3ETOA 2V2ZA 4NLXA 3MECB 2PFFB 2DR5A 2WCXA 4ZJLA 2AZ1A 2HRTA 4F3QA 2MKYA 3SFGA 2GIQA 4LBPA 5D0GA 2DKOB 2JWNA 3LP2A 2O66A 5D78A 4CLUA 4NCAA 2MYFA 3LW5C 2W1BA 4G65A 4ER8A 4DFMA 4C8LA 5KFPA 4DSFA 2ZC3A 3S6EA 1VQOS 4FYVB 4C2MA 2HVDA 1IQTA 2VBXA 4QIEA 2Y0BB 2N4DA 2HHUA 1E6VB 4M5MA 5KT5A 1S77D 1FTRA 4ECYA 3MM8A 1JNZB 1U2RA 1X4FA 3FZ2A 5DG9A 3ZTQA 4AL6A 2QL7B 4YUDA 5DGAA 4NLTA 3QAEA 2ZHBA 2R7RA 2KVIA 2VD3A 3LP2B 1NUEA 2ZOFA 3RBXA 4ILLA 3A12A 5KFVA 1FRJA 2IRXA 2XI3A 4ZVGA 3QFWA 3T1HJ 4O3PA 1QSSA 4ID8A 1C0UA 2FLOA 3CVKA 3R7BB 4KSEB 2UUTA 1VC5A 3DRSA 5AE2A 5A8RA 2AIRB 1FXDA 3TEHB 2B51A 3MM8B 4BC9A 4CT9A 4A8MP 4IQXA 4UZBA 2FTRA 2IVYA 3AH6A 4ZVSB 5K8OA 3K8WA 2G1HA 3B82A 3JYTA 1TKZA 4EZ9A 1OS5A 3HD2A 1S0MA 2LXUA 3UD4P 4WYLA 4M5HA 5F8GA 2CQ4A 2NR0A 4ILRA 3CD7A 5HBMA 1ZZFA 5E3QA 1A6LA 4BLGA 1C0UB 1DURA 1DFDA 3M8ZA 2KH9A 3RJMB 4DF4A 1RBAA 3SCIE 2N4CA 2R3VA 2V63A 2ZC4A 1BQNA 4YB1P 2Z58B 3DRSB 3O44A 2MZSA 5MAOA 2VBZA 4HL9A 2EK1A 2XZDB 2P2CB 2B9WA 5A8RB 2XYPB 4DR6J 4C3KA 2H48B 4DR7J 4DPUA 1S0VA 2IMOA 4Q2LA 3TARA 2J6UA 1RA6A 2KXHA 4J9UE 1ZETA 1R27B 2POKA 1B7FA 1UVKA 3C66A 5KFFA 3PXGa 3JYTB 3CJQA 2RQ4A 4IOCQ 4M5GA 2I6WA 1UFLA 2CQ1A 2B8QA 4J9MA 5IM0B 1HR0J 2Z2YB 2R8IA 5HBMB 4CWBA 4NE9C 3AJDA 3VVUA 5KFHA 2VIHA 1UCNA 4ED3A 3TVZA 5CHCB 4DV7J 1G3OA 1Y7PA 3H90A 4DCJB 3HK2A 2EFQA 3QPIA 5IT9U 4MJKA 3RGIA 1TL3A 5D0RA 2W4CA 4DL6A 3QRPA 3HVTA 1DQ9A 1O8BA 5KG3A 5H9FJ 2W7PA 1KRPA 2GIFA 4NWBA 4ECZA 3IFEA 1PYTA 7FD1A 3GIKA 3TW0A 2EFGA 2NSBA 4QR1A 1VQNS 2HS3A 4OX8A 4HKQA 4F36A 4NEZA 4MIAA 2X1GA 3NXZA 3J81j 1F5CA 1ZYQA 2VOOA 1MW7A 3MAHA 4B08A 1H2TZ 2G13A 1R0AA 4K5RA 4Y2IA 1R31A 2X51A 5IC4B 4QWEA 1FESA 1TL3B 2QSFA 4Y2KA 3KLGA 1E6YA 2XCPA 3MR2A 5HVFA 1X9SA 1VCTA 4J9NA 3HVTB 3KUEA 4RW7B 3BF4A 4ZP8A 2CZVC 3RRKA 4OYZA 1LW0A 2CPDA 4USUA 2RU3A 1HA1A 1F9EB 2NYIA 2HFZA 2ZH5A 1MMDA 2HQFA 1Q78A 4EO8A 5ETVA 1KS2A 2CQ0A 1DY3A 5I4MA 1XNQJ 2YWHA 2VUGA 1YJTA 1HNZF 3KKFA 4JI0J 1VRUA 1VR6A 1R0AB 4X62F 4AUKA 5LMNJ 5CAAA 1E6YB 3KLGB 3VGTA 1JLFA 5IWAF 2LA6A 2DGQA 1HNVA 2QX0A 4KYZA 1ZM9A 1B64A 2E1RA 4ED2A 2VZ9A 1EARA 1LW0B 3PYDA 4ZVPB 3IC1A 2JLFA 2P5VA 1ZAVA 2YKMA 2B4UA 2RDIA 3WBZA 4FBUA 3KLEA 1SKUB 5CD4H 1SL2A 3IAS9 5ETTA 2AHOB 3N6LA 2AGPA 1R6VA 4Q8EA 1XMBA 2VBWA 1VRUB 2IY5B 2HZAA 2N7YA 3UCUP 4DOZA 1HKAA 4YY3J 2QA1A 4M63A 2CG4A 2ZOGA 4JI1J 2C3MA 3TX0A 1HNVB 1CJTA 3DDIA 5KG1A 4EBCA 2XSJA 4RBUA 4I2PA 3H40A 2D9PA 1FWKA 3NP5A 4FPRA 4CH1A 1J5EJ 5EGYA 4CRJA 1X60A 2W4PA 2YKMB 4ZITA 2CZ4A 2HEKA 3ZZPA 1U2CA 3KLEB 4OYIA 1RTJA 3QRQA 1TVRA 2CPJA 4B3TF 2ASYA 4OI0A 4CH0S 4ZPTR 4J9SA 3R2DJ 2RRAA 2FZKB 5L38A 3PX4A 4TQSA 2HW3A 1D8YA 1B7YB 1HWLA 1WKLA 2FB0A 2I5JA 4DR4J 4I56A 3U02A 1NB2A 2RNEA 2KO1A 3CCWA 3CDBA 3MR3A 1CJTB 2XSJB 4I2PB 4FF3A 1UEVA 4USVA 3KNAA 4OV6A 1K44A 3Q8PB 3NWRA 1KR4A 1NDCA 3SIPB 5AJ3F 3EX7B 4NEYA 1QUPA 3F0NA 3TUJC 3QZ7A 4ALZA 2EVZA 2DGSA 4FDFA 3MMBA 3W61A 2DH7A 1RTJB 2IIHA 4F4AA 1FDNA 3DRXA 1TVRB 4NYZA 3TUZC 1U24A 4DPYA 1J2VA 4C3LA 5F8MA 3ONQA 3VZHA 2AF6A 3R2CJ 2CJ9A 2RQCA 4ZPVR 1Q95G 3N6MA 4RNOA 1MWQA 3LOUA 2O1PA 3MR6A 4EBDA 2MQOA 1FJGF 1YLXA 4C0BA 2I5JB 2HWHA 3LWMA 1CJKA 1WNEA 3NGDA 1ITPA 2E7WA 2CQ2A 2V8PA 5HROA 1QY7A 4NLWA 1S6OA 1EP4A 3HKZD 4E8UA 3DOLA 4JI4J 1N5TA 3NBPA 3R8YA 1DLOA 2BOAA 3HFZB 4OHXA 3UQSA 4OHVA 3DLEA 3J7A1 3MMBB 2C3OA 1NZAA 1RBLA 2XY5A 1G2EA 5KG6A 4IG3A 1L3KA 1QUVA 3HFVA 4ZPBA 1SVDA 1RAIB 2RRNA 1NK6A 3DLKA 1I5OB 1YDLA 5K8PA 4JI8F 3R1LA 2BACA 4DSJA 1HQ2A 2ERRA 4LFCF 3IRXA 1KNZA 2EI5A 5HROB 3IG1A 3VQTA 5KG4A 3M8YA 3QMQA 3DOLB 3AOAA 3EZ5A 3NBPB 3P96A 3MM9A 2AT1B 1DLOB 1WDTA 3DLEB 1S9FA 4Q8FA 3QFHA 3ZZRA 5FLXY 2RS2A 4RU9A 4IG3B 4R5PA 2D3ZA 1F6TA 2G0JA 5A6WA 2HQIA 5CQGA 2C3UA 1TU0B 1F1BB 3CC7S 3EJMA 2ZH6A 2HVZA 3B78A 1RAGB 1U48A 3DLKB 1NJZA 1S76D 4B02A 1N6QA 3JSBA 1C2PA 2COLA 1OO0B 1R89A 2D3UA 3M9NB 2F5GA 1FT8A 2GHVC 3NGSA 4QIFA 3IRXB 1IR0A 3IG1B 5B7WA 2UUBJ 3CTRA 2A1BA 2P9CA 1T02A 1RT2A 4NL5A 3J80U 2JDJA 2VFUA 4ZIVA 4DV2F 2EFOA 2GMJA 3MM9B 1TR0A 2AU0A 4OYMA 1HARA 1PGZA 3CC4S 4P2SA 1NJIT 3CPWR 4KV8A 1JKHA 4R5PB 2HHPA 2HHWA 3WQPA 2E29A 5M2PA 1XR6A 3RW6A 2WRMA 2VQFF 2DISA 4WBFA 5E3CA 2WAQD 2I38A 3HP6A 1T95A 1N6QB 3JSRA 2KB2A 2QEXS 4GKKF 4OI3A 2CVIA 3SEOA 3A8EA 2OGUA 2C2NA 3SV3A 3A3PB 4YB6A 4IQMA 4IH6A 1RT2B 1R8BA 3D54A 4IKAA 2R2TA 3J7YI 2BYCA 3CF5Q 4Y65A 3KG4A 2QMUB 2VJUA 1SUQA 2CDRB 3TAPA 2EKNA 4KV8B 1JKHB 3CCTA 2AYMA 5KFDA 1PBAA 4GKJF 4AL5A 3CC2S 1UJ4A 3Q89A 2XHWA 4F02A 4UF4A 4KHRA 2ZH8A 1N0UA 2R9LA 5GVQA 4USHA 4DL0C 4F50A 3T1YJ 4R0JA 2QO3A 2DIUA 3FNNA 4WPAA 2HK2A 4Q44A 1B99A 1EKRA 2R7TA 2RQMA 3HDSA 4PUOA 2FIUA 4XIUA 1UVLA 4DXLA 1SUQB 2M3DA 2XS7A 1XERA 4WCEQ 2EKYA 1VQPS 2GZOA 1RLCL 3NS6A 3M30B 2L41A 1DTTA 1TMJA 3G9CA 2BA9A 4ELTA 4ZN1A 3RBEA 1RT7A 3MMCA 5C2CA 2FVRA 3CJ5A 2C2OB 1HW9A 4J9LA 3BSCA 4OZ1A 5DO2A 4YR0A 3QGIA 5E0OA 8ATCB 3MF5A 1RYSA 2Z0GA 1RTZA 4WFYA 3P6YC 2WVDA 1Y4ZB 3HPOA 4TU7A 2IJFA 2HQGA 3LGNA 3M8WA 3G6VA 4NXMF 2AQ4A 2JNJA 2KYZA 1X7VA 2QJ3A 1IKXA 4PUOB 5GAEI 1PC4A 2V8DA 1X8DA 4Y2AA 4FNHA 1HWJA 1SQGA 1RSCA 2ZJPQ 4FBTA 1VISA 4LRDA 2ZVSA 1FRLA 4OJGA 1VI7A 1DTTB 3VGSA 1RT7B 3MMCB 2VC0A 1VQ5S 2LU2A 1N5SA 2QA4S 1XNRF 3TQ1A 3MURP 1X4HA 2G2YA 4V1Ak 1U26A 4J5OA 4JI2J 3D4JA 2I0XA 1CEZA 4HDHA 2BV3A 1X9WA 2PDAA 4DMZA 5EDWA 5AT1B 5EX3A 1FFSB 3ZTRA 3HJVA 1KONA 1URRA 3HHLC 1X5PA 1IKXB 3I4HX 2KZZA 2XNRA 2EFVA 3UO0A 2FC8A 4CO2A 4DV4J 2L08A 4QR0A 4X4NA 5KFGA 1VQ4S 4ZK7M 3MCOA 3AQOA 3ZNJ1 4FF2A 4BDPA 3SSRA 3MFIA 1PKUA 2DGVA 4JYAJ 3IBWA 3MTKA 2BMBA 2V4JA 2ZBCA 3EDRB 1GX5A 3K5MA 1UVMA 3VQSA 1FDDA 3CJSA 4X4UA 1N52B 1M5PC 1QAJA 1S5ZA 1WI8A 4WFAQ 5A6PA 4USTA 3OR2A 2CRLA 2V2QA 3ELHA 2HLUA 4RPFA 4O23A 1JLCA 1V3RA 1D1UA 3Q22A 4LQ9A 1N33J 3BGUA 2A2DA 4ZLNA 4YFUA 3GIMA 3JTPA 2BJ3A 1VQ8S 4AE5A 2ZOMA 2LDIA 2W2QP 3CJ0A 2HHTA 4I67A 2R2RA 4FVMA 4NA3A 3LP1A 1PBUA 4TYBA 1JLGA 4CI0B 1SKWA 3D6MB 4UOCA 2BANA 2V4JB 5SUHA 2U1AA 2AKWB 1NKCA 3W8PA 4YHHF 2JRSA 2OPQA 4X84A 1FEEA 1NRKA 3NS7B 3OR2B 2DGUA 2LVWA 4KKOA 4FNIA 1ZPWX 3AD8C 3OT9A 1C4AA 4DR1F 2GO9A 1JLCB 3FSYA 2OPRA 4Q7AA 3UE2A 2NXCA 2QRRA 3SZ2A 3K2YA 2HZVA 3HSJA 3TAMA 3RBZA 4RW9A 1LKZA 3WX8A 1SJRA 1X4BA 3BN7A 3UD5A 2CWXA 2ZBPA 3LP1B 2XLKA 5EHHA 3BB5A 4HHHA 2MZQA 1JLGB 4RO0A 4O0NA 4TKTA 4OHZA 4NLPA 2BANB 4W98A 3FKBA 2DY1A 1GNKA 5D0HA 2OPQB 1M1KT 4ELUA 3QT6A 4OLPA 1KN6A 3BGRA 3N5FA 1F60B 4ATNA 4Y34A 1I51B 1FA0A 4KKOB 3QJLA 4AD6A 2ZH1A 2JHEA 2OPRB 4OMFG 1MMLA 3TR5A 5LJ5Y 3GR0A 5F9LA 3TAMB 2PGCA 4N76A 2DYAA 3OSNA 1B70B 1X5OA 4RW9B 5C7PA 1EZZB 3DXBA 3KJNB 1AA1B 3MEGA 5K5MA 1TL5A 1DBDA 1MNEA 4DBQA 2HAFA 1RKJA 4LFBJ 3I9ZA 2GJFA 3MHYA 1HHTP 4PRFA 1UWBA 1OMSA 3BGLA 5GMDA 4DFJA 2MQLA 3NY0A 3R7SB 2KFYA 4Q43A 3TWZA 1HHQA 3SSQA 1HWUA 1Y5NB 2F4VJ 4RL1A 5KOWA 3BGRB 1U1MA 5DDRC 3I31A 2ZDPA 4URSA 2R7SA 1T3NA 2AW0A 3Q2TC 2NQPA 4IRCA 1U45A 3A3OB 2V8HA 3W2VA 3CD6S 3NRBA 2V68A 4H4KC 1CSJA 1DHMA 4X4VA 1RYRA 1SQFA 3PJWA 1NPPA 1F9FA 1VK8A 3M8RA 4AXJA 3OTEA 1AB8A 3P5BP 3JSMA 4YS2A 1TAUA 2I8EA 1RHMB 5HSPA 3OPKA 3MEGB 5BYRA 2OH2A 1HNWF 3RG6A 3BN4A 1AFIA 2EEYA 1U49A 1UWBB 3HHNB 4FXVA 3G86A 4CLPA 2LECA 4OHYA 4B3MF 3PKMA 2FLPA 1UEKA 1MG7A 4F8RA 2HGMA 1WF1A 3BDEA 2RDDA 4DV0J 2OFHX 4ZCKA 2PI4A 4KHPF 3CULA 1UFWA 2HHXA 2XULA 1FDBA 3TEGA 3W2VB 2UUCF 3RAMA 3RB6A 1JMTA 5KT3A 3QIPA 4DLEA 4Z7YA 2BEFA 1OQ3A 1S10A 2VBYA 3K8VA 4ZOSA 1WC5A 4Y3CA 5BR8F 1S9EA 4DUZF 2CPZA 2CQPA 2AYEA 1FO1A 3R5AA 3OUYA 4RNMA 1NB7A 4AL7A 3AJ2A 2HIYA 4OI1A 3TOQA 2W7AA 3Q24A 2RIJA 2ZE2A 2FVPA 1RK8A 1GMWD 2YWFA 3PV8A 2ZUGA 1GMUA 2HQ3A 4GC7A 1S1VA 3KUHA 3QATA 2GQ2A 3RR7A 4B17A 3GIIA 5E41A 1FF2A 1W2IA 4DU7A 1EHWA 3GTYX 2IDLA 3WIVA 3MCNA 1OY6A 3QZ8A 2MJUA 4ID5A 2JC0A 3QIPB 4IR9A 4O3RA 1N56A 4X4PA 2Y0SD 2IPOB 2CQGA 1NK5A 1S9EB 1GXTA 2GMLA 3ZFVA 3OUYB 4JP8A 3EICA 2CDQA 2CNNB 2WVEA 2FGCA 4RW4A 5H9FK 2GO8A 1Y3JA 3TJAA 3IMQJ 1NSQA 5L1IA 1HIYA 4P7TA 5GMEA 2RVJA 3QSIA 2HVHA 5FIIA 2MQQA 2GMHA 2OTJS 1S1VB 5C2GA 4CT8A 4B9VA 1NJWA 2ZHOA 3MM7A 1FCAA 1NKBA 3J81Y 1RLDA 4A4JA 1GFWB 3BJYA 3OTDA 4HACA 5LMUJ 4KIAA 2OO4A 3KMSA 3IR6B 2BKPA 2V2KA 2AGOA 5DDQC 4LF4F 2PA8D 3DN9A 2G0IA 4JV0A 2L9NA 2YBVA 4PG8A 4HR2A 4DPOA 3UDEA 4FKXA 9RUBA 3CXCR 3TRGA 2AGQA 2QT7A 4RW4B 5G0RA 3W8GA 3KNGA 1T94A 1FRMA 1W25A 5KFWA 2KT3A 1S7IA 1U6FA 1RT5A 1KQFB 4NLUA 4USKA 3GCXP 1W2BR 3SXLA 2XWYA 2DHHA 3JQJA 3HVRA 4KH1B 2ZH2A 2DR9A 4UUXA 5FDLA 1BWVA 3MM7B 5ETQA 1RGVA 4M5LA 4RWXA 3LH2S 5KFAA 1GXLA 2JJ4D 2GC8A 1JJ4A 5AXKA 1GMVA 2QMXA 4HACB 1VC6A 3Q8VA 2BDPA 1U8WA 4N47A 1PYSB 5LT5A 2KFNA 2P9EA 1TMMA 3ZTSA 1F0XA 2HS0A 1YJNS 2IAJA 3QAUA 1TK5A 3GCWP 2J0SD 5G0RB 2LEBA 2WW4A 2XMUA 4JI5J 1RT5B 1SXLA 2JLEA 1Q86T 2MB0B 1WF2A 2AEFA 5M2UA 1YJ7A 2LU1A 4KBIA 4DS5A 2GHPA 3K89A 3CO9A 3BS9A 5FDLB 3OJSA 1DQ8A 1UVNA 1VQ9S 2B5JA 1KLMA 5E3PA 3PHTA 3SDEA 1TKTA 1PAUB 2H5EA 3IR5B 3G4SS 1C0TA 4K0KJ 5JJBA 3D6FB 3GV8B 3RRGA 2OLWA 2IAJB 4CO3A 5DGBA 1SJ3P 3ISZA 4ZHRA 1S4FA 3NAIA 2W9AA 4A8KA 2EBGA 1WEXA 3LGMA 4A8SA 5AE1A 3DXSX 4A47A 3ENAA 4F4WA 2IBOA 3HMJG 1I1GA 2ZITA 3H42A 2CXEA 1RU1A 1KLNA 1G4CA 2V0NA 2DNZA 4HEA9 2BZ2A 5DZ7A 2MKCA 3D67A 2XSFA 2ZM6J 2VFTA 2IJNA 2BM1A 5CZXA 2MLYA 4X4TA 3NNHA 3DOKA 3AOBA 3A8KA 1HHSA 2B5JB 5DDOC 5K9FA 4CLSA 2C3YA 3PM9A 3SDEB 1TKTB 1SI9A 4F4ZA 4X64F 4HYKA 1C0TB 1DZ5A 4IFYB 4C97A 3KMQA 1ZS6A 3OVAA 3TUIC 5DJBA 4ZHRB 4PKDB 2DR6A 3CDWA 1UW4A 2ADCA 4JI3J 2F9DA 2IC3A 4DL5A 5KFTA 1WKKA 2O5DA 5F8JA 3HZEA 5HL7Q 2MHNA 2XC9A 4YP3A 1XMQJ 2V8GA 3O1LA 3D0HE 3E2EA 3HSDA 3CMQA 2OAUA 3D0GE 1HNXJ 2HNDA 2ZZNA 3DOKB 5KFMA 2F3JA 3O8WA 1HL6A 1IBMF 2CQCA 1KVIA 2ACYA 4C48A 1FRHA 1AZSB 4Q0BA 2AJFE 1Q7LB 4F0MA 2HFOA 2X3GA 4LFAJ 4A8QA 3AY0A 2HHHJ 4C9DA 1KFSA 4LF5J 5GADI 3W2WA 4KPYA 1MLAA 3FRYA 4OYWA 3UNGC 3A1YG 4QZVB 3R5GA 1HWIA 1UW9A 5FLXU 4EO6A 1YWXA 1TP7A 5J1NA 1ZM3A 2EW9A 4EWTA 3X3UA 2W8KA 1IWGA 3HLUA 1GK8A 1RADB 3M9OB 1C1BA 3R5DA 3MOJB 2HNDB 4KC5A 4B3SF 3FMWA 5C25A 2H4WB 4EI2A 4GC6A 4U8VA 4TLQA 4XK8C 4Q0BB 4X66J 4XPCA 2CJBA 3UFCX 3BPSP 3W2WB 3MOZA 4F0KA 4MK8A 3MDFA 2XYHB 4BWMA 5HVGA 3PG9A 2HAIA 3FCVA 3D66A 1Y3KA 3KLIA 2E5IA 2UV8A 1Y9OA 4QPTA 4O3NA 2VFVA 5KFLA 3R6LB 2VKZG 1NKEA 3DI6A 2OIHA 3DDKA 1SCJB 3RU0A 4XTTA 2QTWA 2DK2A 5F8LA 2HNYA 1R0BG 1C1BB 3I9V9 4WFXA 2MQPA 5L39A 2JL9A 4PPDA 5ETSA 5C25B 1NPRA 5HJXA 2PEBA 3W62A 3D0IE 4RUBA 2VG5A 4EFAC 5MLCV 2DPIA 2UV8G 2FVQA 4DR3F 1ACMB 3UR3C 4OI4A 3M8QA 2OEMA 1KTVA 4OL8A 4RUAA 2CJQA 3G6XA 2QFIA 4DSKA 3KLIB 3QGHA 3B8HA 5GAHI 2B4PA 3DDNA 2EWHA 4O44A 2DNKA 3DI6B 2VC1A 5T14A 1FK9A 1M5SA 4PXEA 4EYHB 2UXBF 4K2XA 5EWEA 2HNYB 4KRWA 2IRYA 2HURA 3K0JA 4ZIWA 3VHQA 5GAGI 3R6GB 4ZPWR 4LF7F 1RT1A 4FXDA 2OSRA 4HHUA 2WW8A 3CCUS 2ZBIA 2JFDA 5K8NA 2R7VA 4ITSA 3M8QB 2D9OA 4PG6A 2X3DA 1FNXH 2KHDA 3TJ8A 2DNYA 4X65F 1MWZA 2R2UA 1IBKJ 4A48A 2ZFHA 1WG5A 1H0HB 2YNHA 4O44B 5SZTA 2HFUA 1FK9B 2QV6A 1FRIA 2JVOA 3F56A 3HHKA 5CZVA 2R8JA 2HHVA 3LAKA 2BRKA 2KJVA 1F5BA 4TNOA 3VTIA 1HBMB 1X4DA 1VIXA 5HI7A 3OSPA 4ES3A 4CLZA 1V5VA 1U0SA 4MT1A 1RT1B 1UWAA 2E9RX 4NYOA 4LF8F 4Y2CA 2ZH9A 4F26A 2VA2A 2V9KA 1UTAA 3CNQP 2HQCA 4NRUA 3SMZA 2YWGA 4URQU 2YY3A 2A6OA 1LW2A 1KQKA 1FX4A 4M5IA 3A3NB 3TANA 2WVCA 4RW6B 4RZRA 3ENWA 4OZJA 2YNHB 5DRKA 5LSRA 5THWA 1CJUA 2IHR1 2UUAJ 3EGWB 4LBIA 2R2SA 3CUNA 4TU9A 2R7QA 4DV1F 2ZZMA 4DV6J 5L46A 1SJ1A 4K4SA 4CNZA 1FERA 3BSOA 1IM4A 2PMZD 1YRXA 1RAEB 3TP2A 3PDNA 1RACB 2A2CA 3U1NA 4DFPA 4MH8A 2G0CA 5HQ8A 2DNQA 5FD1A 1K0TA 1C4CA 2CPYA 4U6PA 1OWXA 2WHOA 1LW2B 5JUMA 3L3CA 2JEJA 3Q8YA 2KFZA 4GMKA 1YG0A 4WK1A 2OPSA 3GFHA 2GVDA 3L09A 2AV5A 2UVWA 1WOOA 4B9NA 4NLRA 1N32J 3DC2A 2EC0A 1WTBA 3J7YU 4CM2A 4ERDA 2AJ4A 5J2NA 3FEZA 1VQKS 3GONA 2ASLA 2F8HA 3CCVS 4B3RJ 4DUYF 3OFEA 2BQ3A 5KG2A 4DR2J 2QYCA 1RUSA 2P6TA 5A8WA 2XG8A 1O51A 1VFJA 2IFXA 5GMKa 3P8BB 5J2QA 1FRKA 4ZJQA 1YTYA 4C8KA 1FI4A 2UUWA 1JB0C 1HWKA 2J0QD 4ES1A 2YXLA 2FJVA 3UCZP 4DPWA 2EK6A 2GVDB 3HCXA 3OFFA 1P1TA 3GG1A 1N8RT 3GJSB 3KHHA 3WC2A 2FHOB 4J9QA 3K58A 2W01A 3SCJE 2Q6CA 3DLBA 2Q3PA 4MK9A 5J2NB 5HMYA 4P71A 1SPBP 2XGPA 3KHGA 2F9JA 2B6AA 3CEDA 1BLUA 4F67A 5KFYA 3AJ1A 3NMRA 2RSQA 5DQHA 2E7VA 1YRUA 4NASA 3E51A 5A8WB 3US5A 4I0WA 2FC9A 2KM8B 3GG0A 4RNNA 5HLFA 3B6BA 3IM9A 2MY8A 3OLBA 5J2QB 2UU9F 2NS1B 4QBUA 2BKNA 1CC8A 2J9CA 2LXIA 5KAKA 5IZHA 4QYRA 5L9XA 1LK7A 4B9UA 2DITA 3AFGA 2W9CA 4AQYF 3S8SA 1RT6A 5KFQA 1M5OC 2VG6A 2Y3YA 4DZ6A 1VBXA 3MXHP 1C1CB 2YH1A 3PW4A 3R5JB 3ILOA 2C2ZB 4YOEA 3FFIA 5I42A 1TFYA 3BEGB 2B6AB 2WSFC 2XMMA 4F3OA 1Q5VA 2QMWA 2VDHA 4JYAF 2XS5A 5D0EA 4DPXA 1X4GA 4IUFA 2KN4A 3W1YC 1JJHA 2G2OA 1KKHA 2B9YA 2DNGA 1Q5YA 3EMTA 2OI2A 3FQLA 5AXNA 1KQSR 1URNA 3ILLA 2W2NP 1VGYA 3D1HA 1N33F 4KY3A 2W9CB 2KKHA 4OQJA 1VMBA 1RT6B 1LEOA 3EYZA 2VG6B 4QIGA 5J2PA 3PW7A 1FHTA 4MKBA 2XMTA 3FGVA 4NLQA 4A46A 2V4QA 3FFIB 1QE1A 4ZS6A 3T5JA 4LUBA 2LA4A 5HP1A 3V6KA 2BOPA 2VPZB 2B0GA 3VCDA 3KG1A 2IYIA 3D68A 1Q81T 3LTOA 1NHUA 3TVKA 4DX7A 1JJ2R 3H98A 1Y00A 4OFZA 5JMNA 1GMWA 1NXIA 3ILJA 5EX0A 2V2VA 2XO7A 1D09B 1K73T 4ED6A 1DAXA 1SQEA 4QWCA 3HT0A 4OI6A 2NSCA 3I5BA 5ETRA 5J2PB 1LXNA 5K20B 3EPGA 1SC4B 2NYHA 1QTNB 3GIRA 1QE1B 4N7TA 3BPDA 1Q8LA 4PZVA 3QYYA 5HP1B 2XM3A 3MD3A 3V2UC 3P4UB 2CNOB 4WZMA 5KFRA 2MKHA 3E8OA 3AB2B 3BH6B 2H5IB 2M5YA 3UNYA 3AOCA 1B3TA 1S49A 4KJIA 4CLKA 4ZCLA 3BV8A 3CDAA 4IDKA 2FDNA 2V9WA 4HDGA 2ILYA 3ZZ0A 2MMYA 2KZMA 3AD7C 1ELOA 2A0FB 4NRTA 1EJ7L 3G6YA 5KFOA 4QIWD 2KT5A 2E5LJ 2CPXA 2MZ1A 2VG7A 2YPYA 3CE8A 1OYDA 3C15A 4U9RA 1CS4A 2YNGA 2FHMA 5LOQA 4KAIA 4ED0A 3Q0AA 1JIHA 1SC1B 3IBCB 2V4RA 3FBFA 3RYLA 2QIFA 3SI8A 2LEAA 5CA5A 4LF6F 2HWIA 2B7BB 1YJVA 1NK9A 2ROPA 3TNVA 4IDKB 1JJCB 3PW2A 3V81A 4OLOA 2WB4A 2E1CA 4I7FB 1X5TA 5F8NA 3KLVA 2BE9B 1WKJA 4CLTA 1YVFA 2H9ZA 5AE3A 1DARA 3EZUA 2MKIA 1P27B 3FBCA 4LR7A 3KOAA 1VBKA 1BUXA 1WOSA 3OD2A 2XHCA 2QSWA 3IGNA 1WC1A 2VG7B 1S6PA 4RNHA 2KI2A 4O0IA 1U25A 3C15B 3HSGA 1CS4B 1TKDA 2YNGB 5B0FA 3JB9k 1Q1KA 1HNZJ 3NCPA 3L4BC 5HMXA 4K7QA 1IBCB 1X0PA 4X62J 4LSLA 4LRBA 4OZ0A 5ETNA 3J81U 1FNOA 3BKTA 4O4RA 2GHWA 5IWAJ 2VQEF 4DV0F 3V81B 2PFDA 4KGKA 3D7SB 1R3NA 3RBDA 3CCES 2JEGA 4LF9F 3PHEA 4C6AA 4YR2A 2YWKA 3KJQB 1SIZA 3T3FA 5D15A 8RUCA 3LPEA 3DRYA 3EWGA 4RJVA 2I2YA 2DY9A 2CQBA 5B0AA 3D1QA 1S6PB 4UT4A 5IM0A 1ZTWA 2VOPA 1RJJA 2R7XA 1OPIA 2BJ8A 3R27A 3I32A 2CKWA 1K1SA 4K4TA 4PWWA 3PR5B 1ZTTA 2HMIA 4Z37A 2XMWA 4B9MA 4LSLB 1HW8A 3KK1A 3IO1A 1NHVA 1XR7A 4Y28C 3FQKA 2DXDA 3E01A 3TUPA 4RR5A 4C7QA 1P8GA 2V8VA 1TL7B 4WF9Q 4MKVA 3M4XA 2MXYA 4HTIA 4ANEA
chains in the Genus database with same CATH topology
4DV2J 4DR5J 4X62J 4JV5J 4GKJJ 3D3BJ 4LFCJ 4JI2J 2E5LJ 4X66J 2VQFJ 4LF9J 4YY3J 4LF6J 4YHHJ 2UXCJ 1HNWJ 4LF7J 1HNXJ 4LF4J 3J81U 3T1HJ 5LM7E 4DR6J 1XNQJ 5IWAJ 2UUBJ 4JI1J 3W1YC 4DR7J 4JI6J 4NEYA 4JI0J 2UU9J 1FJGJ 2KL8A 3J80U 2MEWA 2MQ8A 4DUYJ 4DR1J 4X64J 4B3MJ 5LMNJ 5LMUJ 3D3CJ 1N32J 2ZM6J 4DV4J 4B3TJ 4NEZA 4LFAJ 4JI5J 2HHHJ 1J5EJ 3R2CJ 4LF5J 4NXNJ 3J7AN 4KHPJ 4X65J 4KY3A 4RJVA 4DV1J 3T1YJ 4GKKJ 4AQYJ 4KYZA 4HHUA 2UUCJ 4B3RJ 1HR0J 4JYAJ 4DV3J 4DR3J 1N34J 4OX9J 1N36J 4DR2J 4B3SJ 5AJ3J 1XNRJ 3JAMU 5FLXU 2KVQE 4DV0J 4PWWA 4LFBJ 2UUAJ 1I94J 4JI8J 5BR8J 4DUZJ 3R2DJ 1IBKJ 4DV7J 4JI3J 4DV6J 1IBLJ 4JI4J 1XMOJ 5A2QU 2F4VJ 5IT9U 4K0KJ 2MTLA 2UXBJ 1N33J 2UXDJ 2VQEJ 3OTOJ 4DR4J 4NXMJ 1HNZJ 4JI7J 1XMQJ 3IMQJ 1IBMJ 4LF8J 4DV5J 4V1Ak
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 J;  4DR5 J;  4X62 J;  4JV5 J;  4GKJ J;  3D3B J;  4LFC J;  4JI2 J;  2E5L J;  4X66 J;  2VQF J;  4LF9 J;  4YY3 J;  4LF6 J;  4YHH J;  2UXC J;  1HNW J;  4LF7 J;  1HNX J;  4LF4 J;  3J81 U;  3T1H J;  5LM7 E;  4DR6 J;  1XNQ J;  5IWA J;  2UUB J;  4JI1 J;  3W1Y C;  4DR7 J;  4JI6 J;  4NEY A;  4JI0 J;  2UU9 J;  1FJG J;  2KL8 A;  3J80 U;  2MEW A;  2MQ8 A;  4DUY J;  4DR1 J;  4X64 J;  4B3M J;  5LMN J;  5LMU J;  3D3C J;  1N32 J;  2ZM6 J;  4DV4 J;  4B3T J;  4NEZ A;  4LFA J;  4JI5 J;  2HHH J;  1J5E J;  3R2C J;  4LF5 J;  4NXN J;  3J7A N;  4KHP J;  4X65 J;  4KY3 A;  4RJV A;  4DV1 J;  3T1Y J;  4GKK J;  4AQY J;  4KYZ A;  4HHU A;  2UUC J;  4B3R J;  1HR0 J;  4JYA J;  4DV3 J;  4DR3 J;  1N34 J;  4OX9 J;  1N36 J;  4DR2 J;  4B3S J;  5AJ3 J;  1XNR J;  3JAM U;  5FLX U;  2KVQ E;  4DV0 J;  4PWW A;  4LFB J;  2UUA J;  1I94 J;  4JI8 J;  5BR8 J;  4DUZ J;  3R2D J;  1IBK J;  4DV7 J;  4JI3 J;  4DV6 J;  1IBL J;  4JI4 J;  1XMO J;  5A2Q U;  2F4V J;  5IT9 U;  4K0K J;  2MTL A;  2UXB J;  1N33 J;  2UXD J;  2VQE J;  3OTO J;  4DR4 J;  4NXM J;  1HNZ J;  4JI7 J;  1XMQ J;  3IMQ J;  1IBM J;  4LF8 J;  4DV5 J;  4V1A k; 
#chains in the Genus database with same CATH topology
 3H7H B;  1S1U A;  1MN9 A;  3MFH A;  1I6J A;  1H7X A;  3NCR A;  2E5H A;  5ETL A;  3C16 A;  3FBB A;  5HMZ A;  1H2U X;  3MCM A;  5L1L A;  1JXE A;  3CCQ S;  2XWX A;  4FYD A;  3DLG A;  4EMD A;  4DHV A;  2Y1R I;  4B3T J;  2I1R A;  1SBR A;  2BVZ A;  4KR0 B;  4LRA A;  3CJ8 A;  1EQ0 A;  2HMI B;  5HJY A;  2AJ2 A;  4IO1 A;  5KFU A;  2Q79 A;  1LFP A;  4NLD A;  3KK1 B;  2L48 A;  4DX5 A;  2B3T B;  4IH7 A;  4WFB Q;  3E01 B;  3FCH A;  2HFN A;  2OEJ A;  4IRK A;  1QLN A;  4ED5 A;  3PNI A;  3THP A;  4BBY A;  2PA3 A;  3MAQ A;  2CVE A;  4RW7 A;  2BJ9 A;  4N8O A;  3G82 A;  1LWX A;  1S1U B;  5T7L A;  2D41 A;  1P1L A;  4KO0 A;  3C16 B;  2KTQ A;  4HH1 A;  2LQ5 A;  3GR1 A;  3V5R A;  3I96 A;  4OYP A;  2W7O A;  3LWL A;  4W92 B;  3DLG B;  5A8K B;  2DGX A;  3QT5 A;  3SSS A;  2AYB A;  4KGV B;  2AD9 A;  4MMO A;  3CME S;  1LOU A;  2KXN B;  2A18 A;  4OJH A;  2KRB A;  4UY8 5;  3ADA C;  4LIW A;  4PG5 A;  3OTO F;  4I64 A;  1IN0 A;  1Q53 A;  2F8M A;  4EUV A;  1FJG J;  2KT2 A;  1ARO P;  4FF1 A;  1LWC A;  4JV5 F;  3BR8 A;  2PC6 A;  4ECX A;  1P6T A;  3PCO B;  5CYJ A;  3CWJ A;  2Y9H A;  2RML A;  3NOC A;  1GTE A;  1WHY A;  3FUY A;  4MYU A;  5F0U A;  2BJ1 A;  1KOO A;  4TY8 A;  3MPD A;  3G82 B;  1B4S A;  4YME A;  3QT8 A;  5T7L B;  2DJW A;  1WAC A;  1U7L A;  4KO0 B;  3KG0 A;  3G96 A;  2BQR A;  2PII A;  4P2F A;  1RWX B;  3FRZ A;  2CJK A;  1GX6 A;  4TY9 A;  4F4X A;  3CCL S;  4F2R A;  3NEK A;  2LLZ A;  1NCL A;  4PAB A;  1YZ6 A;  4JBC A;  3VR1 A;  3MTJ A;  2K7J A;  1U09 A;  4J9R A;  3PAC A;  1H7W A;  1LWC B;  4LSN A;  4BCA A;  1T8E A;  4LFC J;  4PR6 A;  5KG0 A;  1BC6 A;  3GYX B;  5F3T A;  2J5A A;  3CT9 A;  2VL1 A;  4TY8 B;  3L9Z A;  2KG1 A;  2N3O A;  1IJF B;  2GQC A;  3RUB L;  2ROG A;  3QLH A;  4ZVE A;  1OY9 A;  4YR3 A;  4ZVT B;  2CQD A;  3QWU A;  1KDN A;  1N48 A;  2LFV A;  1WC4 A;  4L6V 3;  1S4E A;  3K57 A;  3K5P A;  1BWE A;  2MPU A;  4JV2 A;  2OD6 A;  3M05 A;  1H6K X;  5L9N A;  2IYG A;  3C19 A;  4V19 X;  3MZI A;  1LXJ A;  2G2Z A;  4NZ0 A;  4B9L A;  1V6H A;  3G6E S;  5CD4 A;  2FHJ D;  2FYX A;  2UP1 A;  1NU4 A;  3BYR A;  1WG4 A;  1YRT A;  5FJ4 A;  4LSN B;  2ZH4 A;  2J76 E;  5H9E J;  3GYG A;  5E5N A;  1HPZ A;  4OZ5 A;  2PMH A;  5F9N A;  3DM2 A;  2ATL A;  3WHI A;  3IWN C;  4OX9 F;  5HAO A;  4DCP B;  3MED A;  4DI6 A;  2VFS A;  1T3O A;  3FSI A;  4M95 A;  3O6Q A;  3QLH B;  4DV2 J;  1S0O A;  1DQA A;  4DX8 H;  1R8P A;  3G8Q A;  1TK8 A;  1XMO F;  3AT1 B;  4B9S A;  2XCA A;  1S99 A;  1T9T A;  2FZC B;  2V67 A;  4PYA A;  3KUG A;  1JLA A;  4USM A;  2KL8 A;  4DV5 F;  1QSL A;  2RD5 C;  2PE8 A;  2QN6 B;  1NEE A;  3TYT A;  2ZUA A;  4MK7 A;  1WSR A;  5B0G A;  4TU8 A;  5C5J A;  1QAI A;  1X9M A;  4GKK J;  1BE4 A;  1HPZ B;  1KFD A;  3DM2 B;  2XQC A;  4FF4 A;  1QAX A;  4WP8 A;  3L7P A;  4KGZ B;  3MED B;  4MIB A;  5L1K A;  4WZQ A;  4WK3 A;  1HNX F;  3T6B A;  2OMO A;  2JC1 A;  3JQK A;  1YZ7 A;  5ETO A;  4UUW A;  2Z2M A;  4WXO A;  1U1R A;  2QL5 B;  3M6X A;  4YDX A;  3A8J A;  1U1Q A;  4DV3 F;  2FZG B;  2CAJ A;  2B8P A;  1VHF A;  4K8R A;  1YJ9 S;  2YWE A;  1RTD A;  2RF2 A;  4QQB A;  2MDA A;  3KLF A;  1JLA B;  3WIU A;  1RT3 B;  4GKJ J;  2N82 B;  2L9D A;  4YN3 B;  2DHG A;  4F25 A;  3X1L B;  1JQG A;  2M0G B;  2UXD F;  3KDO A;  4DR5 F;  4NLS A;  4H4O A;  2QLB B;  5HQM A;  4L75 A;  1DJ0 A;  2F65 A;  1S59 A;  2PSZ A;  2ALZ A;  3LP0 A;  3Q2S C;  1YX2 A;  4CYU B;  2B9E A;  4P2M A;  3VGU A;  2CFX A;  4U95 A;  2HGL A;  3HX9 A;  3OFG A;  3QO9 B;  1IR1 A;  2ALY B;  1N34 J;  3GWC A;  2XS2 A;  4X66 F;  1RTD B;  2RF2 B;  2VV5 A;  3ZTP A;  4LBH A;  3KLF B;  2WB1 D;  2ILZ A;  4U96 A;  4FVC A;  3R5C A;  4OYB A;  5GAD U;  5D4L A;  4Q5V A;  4OZ2 A;  1WSV A;  2IVF B;  3W7B A;  2Z2Z A;  3H2L A;  4BHQ A;  2DPJ A;  2MQM A;  2HIQ A;  3I5C A;  3NS5 A;  2Z4P A;  4H4O B;  8AT1 B;  3LP0 B;  4USW A;  5F0W A;  1U1K A;  2C3P A;  1F2H A;  2RE1 A;  4DN9 A;  1RAB B;  3LUY A;  5D4N A;  3TI0 A;  1NSP A;  4USI A;  5RUB A;  2AJ1 A;  1FE0 A;  2QC3 A;  4NI2 B;  1FKO A;  1ZH5 A;  4ZVH A;  5DM7 Q;  1NHK L;  1Q7Y T;  4I68 A;  2YX4 A;  1LWF A;  1S57 A;  3OBI A;  2NRE A;  3R7N B;  1RI7 A;  4ECR A;  1XNR J;  3D6T B;  3U7J A;  5IXU A;  5HAN A;  3CJT A;  3BQ1 A;  4L3N A;  2KXF A;  4YDD B;  2KRR A;  2ZNZ A;  2HG4 A;  1U1P A;  3MEK A;  2J6T A;  1SH3 A;  3TZX A;  3VZI A;  3NKY A;  3A4T A;  2RDJ A;  1CVJ A;  3LPY A;  4B3O A;  2IMW P;  3CJ2 A;  3W9J A;  3WZ0 A;  4UY8 T;  1VJQ A;  1IBL F;  2BE2 A;  5EWF A;  2KG0 A;  3R3T A;  1FKO B;  1XN9 A;  3MUM P;  5ETK A;  3HD1 A;  3JSY A;  1TUW A;  1VQS A;  2O3D A;  1LWF B;  3LGH A;  1QM9 A;  2OD4 A;  4KGX B;  3MEE A;  2D3O 1;  5GAH U;  4FYW B;  1CPZ A;  3CCS S;  3GSD A;  4ECQ A;  3GQC A;  1HD0 A;  1FWP A;  4D3G A;  5DDP C;  1NDP A;  3GPA A;  1UJ6 A;  3WX4 A;  4ZN3 A;  4IRD A;  1XIQ A;  2ZJQ Q;  2CQ3 A;  2W2O P;  1RTI A;  3PR4 A;  5GAG U;  1Q16 B;  3M6W A;  2CYY A;  2AJ0 A;  4B3O B;  1VYA A;  1BQM A;  4BS2 A;  3LAN A;  1S12 A;  3T6J A;  2BE2 B;  3KJV A;  2M88 A;  3G8S A;  3PVX A;  2E44 A;  4LVO P;  5D8H B;  1A9N B;  2Q43 A;  1N36 F;  1TKX A;  1WOP A;  3L7U A;  2LQ9 A;  3DGV A;  2AEM A;  2D69 A;  4NPO A;  3M30 A;  3MEE B;  4YHH J;  3OR1 A;  3T5L A;  3IP0 A;  4ILM A;  3C8Y A;  1RHJ B;  4DSI A;  3QNW B;  4DR1 J;  1JLB A;  1O6X A;  3CMA S;  3BDP A;  2PMW A;  2CPH A;  2Y8Y A;  1RTI B;  2UXC F;  1IQZ A;  3CJK A;  1KBR A;  1VLO A;  1RWN B;  1BQM B;  3OL7 A;  1UPP A;  4Z7C A;  1T7P A;  2HLT A;  3KJV B;  1KD1 T;  3M7V A;  3KYL A;  1P9Y A;  1NK8 A;  1JLQ A;  2V34 A;  3THT A;  2GJI A;  1WUU A;  5DQI A;  1WD6 A;  1TKX B;  3ISN D;  4F2S A;  4DQR A;  4NXN F;  5B0C A;  1KP6 A;  3K5L A;  3HHD A;  3EZO A;  4M1K A;  2CJY B;  3GIL A;  1U1L A;  3LAM A;  2YKA A;  2F8E X;  3OR1 B;  4LJM A;  3N6N A;  4K4V A;  5JXS A;  2JSX A;  3NWG A;  4TXS A;  4GRS A;  1X31 C;  3ETM A;  5HAT A;  1JLB B;  2OUG A;  1D9A A;  2MZJ A;  2W9B A;  2VPY B;  3POT A;  7FDR A;  3MR5 A;  3HHL D;  4P75 A;  3CJK B;  4DR2 F;  3BBC A;  3FVY A;  2W25 A;  2BM0 A;  1JLQ B;  3T41 A;  2GX8 A;  4LVN P;  3M6U A;  1VRQ C;  1RZM A;  2J9D A;  4C98 A;  3ISN C;  2IM0 A;  2JEF A;  2OPP A;  1H74 A;  3BQ0 A;  4L72 B;  1KTQ A;  1N5Y A;  3UN3 A;  3I4P A;  4P6Q A;  4ZPC A;  1UZH A;  3P3D A;  3DRR A;  2LQ8 A;  3S1T A;  3VAM A;  1OIA A;  3IGV A;  4OJ3 A;  2SXL A;  3BZQ A;  4K4Z A;  4XO0 A;  1B0P A;  4QR2 A;  2W9B B;  3POT B;  2RHS B;  3GSI A;  1N5Q A;  3CW2 C;  4OV1 A;  1WEY A;  4BWJ A;  2VKR A;  2ZDO A;  2H4Y B;  4OZN A;  1I94 F;  1HQU A;  2F4F A;  3OL8 A;  3RAX A;  4ZCM A;  2CZ9 A;  1HNW J;  4ED4 A;  4OZL A;  4NMX A;  2RJZ A;  4FP9 A;  2OPP B;  1WF0 A;  2RU9 A;  1N5Y B;  4B3M J;  2D7S A;  1VS3 A;  3Q8S B;  1FNM A;  1RTH A;  3DRR B;  4PQA A;  1H98 A;  3LO3 A;  1SJQ A;  1PCA A;  4KHP J;  3EVO A;  1M1G A;  1YGY A;  1F9H A;  2ZEJ A;  2UUC J;  2XY6 A;  1WC0 A;  4NLY A;  4WP3 A;  4QIV A;  2JX2 A;  2R7O A;  4UTG A;  1GXU A;  3R5B A;  2NZC A;  3H4B A;  2ZJR Q;  4FS1 A;  3EE3 A;  2M2B A;  5BR8 J;  1HQU B;  2JZ5 A;  4DUZ J;  2BR0 A;  3HM9 A;  4NLV A;  1K0V A;  4L76 A;  1U8S A;  1S0N A;  3CDE A;  2YQ1 A;  3KLH A;  4NOH A;  2HRY A;  4PWD A;  4PAA A;  5KG5 A;  2H3E B;  1N4L A;  1UEU A;  4ZPA A;  1NK0 A;  6AT1 B;  2QA4 G;  1RTH B;  3GJQ B;  3J7Z 5;  1RWK B;  3HXM A;  4FXW A;  3V6D A;  2HGN A;  3O2I A;  3NOG A;  5KFB A;  4JI7 F;  3BO2 A;  3CDU A;  1FDA A;  5B0E A;  5BYS A;  1MWY A;  4DJB A;  1O0P A;  2R42 A;  4USJ C;  4E98 A;  1ZM2 A;  4WKR A;  4ES2 A;  4WU2 A;  2HQD A;  4KH0 B;  3CSK A;  4JI6 F;  1FVQ A;  2DNL A;  3KK3 A;  1CBK A;  4RU2 A;  2DO0 A;  2DNP A;  1AW0 A;  4HH0 A;  3KLH B;  4DQI A;  2NPF A;  1H38 A;  4PWD B;  4YEA A;  1ZPV A;  2NZ4 A;  5IC6 B;  1TKZ B;  1OYE A;  3T9N A;  1ROF A;  2VU5 A;  4AND A;  1S7H A;  4DLG A;  4LF2 A;  3V6D B;  1U6Z A;  4O3Q A;  1HLW A;  2H54 B;  1NO8 A;  1RU2 A;  3QWP A;  2CQH A;  1Q8K A;  1BQN B;  2APO A;  2UVV A;  5AXM A;  4NLO A;  4X4S A;  2E5G A;  4LF4 J;  3VAI A;  1YKW A;  2B9X A;  3QBC A;  1NSK L;  1ZZN A;  2EFP A;  2X7I A;  1IKV A;  3KK3 B;  1S48 A;  1EQM A;  3PYG A;  1RAH B;  1SJ4 P;  1X4E A;  2GFF A;  3VV2 B;  2ZWP A;  2Z8Q A;  1RQ0 A;  2GGP A;  5DG8 A;  3BKU A;  4AFF A;  4FYY B;  1IM6 A;  3Q83 A;  4ECS A;  2J7U A;  3U1M A;  2FJW A;  4TN2 A;  3SYZ A;  4LMZ A;  3NLC A;  3VAF A;  2E5L F;  3H5U A;  1U1N A;  5IT4 A;  3RZA A;  3HT3 A;  3HI9 A;  1WEZ A;  1CQM A;  4GVL A;  5F8H A;  2HHQ A;  2XGQ A;  1RAA B;  2PD1 A;  4DEZ A;  1IKV B;  3AB4 B;  2K2P A;  2FD2 A;  2GGP B;  2X1B A;  4CCH A;  1WHV A;  3I87 A;  1N5V A;  4RLE A;  1D9D A;  2B43 A;  2DD8 S;  3SQG A;  1L3T A;  3OLA A;  2QZ8 A;  1NDL A;  3ILI A;  2DHX A;  3FSX A;  4CZC A;  3NAH A;  3THV A;  3T1H F;  2FJA B;  1M90 T;  3GMG A;  4P52 A;  1IR2 A;  4P73 A;  2MGZ A;  1F3F A;  3PFO A;  1NDK A;  1NK7 A;  4CO0 A;  2FVC A;  4CQ1 A;  4Q45 A;  5F8I A;  4U67 Q;  2YKN A;  1RE1 B;  1WC3 A;  3KFW X;  2B56 A;  1T9V A;  2IM2 A;  2NXU A;  5IT0 A;  1CLF A;  5A76 A;  2C42 A;  1SC3 B;  1KWM A;  4V19 J;  2XYG B;  1SL1 A;  3KTQ A;  1IWA A;  1OPZ A;  3IAM 9;  3B4M A;  1T0T V;  4IYQ A;  3P5T L;  5LSO A;  3SQG B;  1Y5L B;  3CGI A;  1L3S A;  4PXC A;  1D0E A;  1VJW A;  4G1P A;  4J9O A;  4OYX A;  3QGG A;  2GS8 A;  4PG7 A;  1REG X;  5IV3 A;  2G4B A;  4UOF A;  1U0H A;  3AAW B;  2MGZ B;  1QSY A;  4X64 J;  1SH0 A;  4JV1 A;  1RAJ A;  3EPI A;  2YKN B;  4LRC A;  3M2V A;  4E0D A;  2FHJ A;  3PIP Q;  1REV A;  3T1A A;  2DO4 A;  4DR6 F;  1JLF B;  4DR7 F;  5D6G A;  2UVR A;  2QG9 B;  1MMN A;  3A13 A;  3MGJ A;  4CH7 A;  2GCF A;  2DVI A;  3N0V A;  2VJV A;  2IRU A;  5A0Y A;  3S7R A;  4FPI A;  2YH0 A;  3FEY B;  4DDF A;  3PX6 A;  3AXK A;  2NUH A;  1T05 A;  2F7V A;  1PIL A;  4OI2 A;  3OVS A;  1HR0 F;  2M8D B;  4PPZ A;  4IOB A;  4HTJ A;  1U0H B;  4R25 A;  3NL0 A;  1V3S A;  3KJF B;  1IBM J;  3T5H A;  3H5S A;  2DHA A;  4DV7 F;  3M2V B;  3M32 A;  4LT6 A;  1RB0 A;  1REV B;  1T9X A;  1Q4R A;  2OHD A;  2XNQ A;  3Q8R B;  4KHM A;  2N3L A;  2QLJ B;  1JLE A;  1UAW A;  4A8W A;  5A0Y B;  2YKO A;  2XMK A;  1O5J A;  3IS9 A;  4K59 A;  1T05 B;  1FJ7 A;  4I2Q A;  2FVS A;  2ADB A;  1KHV A;  3OVB A;  4B3S J;  2VON A;  1HI1 A;  1RAF B;  1PO6 A;  2FLN A;  1Q8B A;  4KT0 C;  3OXL A;  4EBE A;  1WWH A;  5KFE A;  1TZ0 A;  1T9U A;  3M32 B;  3DFE A;  1YK9 A;  2DTJ A;  1APS A;  5DS7 A;  4FN5 A;  1L3U A;  3OXG A;  5ITH A;  3LA0 A;  1UVI A;  4K4W A;  2LYV A;  3J7Z T;  2HPU A;  1JLE B;  2R8K A;  2LP4 A;  1UFK A;  2CPE A;  2HFV A;  1FKP A;  3CB4 A;  4AYB D;  1RDR A;  2VB6 A;  3VF0 B;  4DQQ A;  2IM3 A;  1VHI A;  3DRP A;  2QE5 A;  3GV7 B;  2BJ7 A;  2UVU A;  1NME B;  5HMW A;  4I69 A;  5KT7 A;  4TLR A;  1H3D A;  4W4M A;  3IS9 B;  4GO5 X;  3DOM A;  4I2Q B;  3Q23 A;  2DB1 A;  2XMJ A;  2DR7 A;  2EG1 A;  1JK9 B;  4N5S A;  2VF3 A;  3HUL A;  1YSJ A;  3RB3 A;  2IA6 A;  3TX8 A;  5IQQ A;  2MKS A;  3SFU A;  1XNQ F;  3H5X A;  3W63 A;  4K4Y A;  4IFV A;  4JI0 F;  3VAG A;  2ZBR A;  3FZB A;  1TAQ A;  5H9E K;  4DR3 J;  3W5Z A;  2EPI A;  2GAG C;  2HBQ B;  5LMN F;  1BMQ B;  4LR9 A;  4IFY A;  1ZA2 B;  5DG7 A;  1CJK B;  4RKU C;  4ZP7 A;  4WKY A;  1BHN A;  4OX6 A;  1U2F A;  1FKP B;  1EP4 B;  3Q8Q B;  4HI2 A;  1R8H A;  1WDD A;  3I0S A;  4A8Y A;  4QU6 A;  3I5A A;  4P10 A;  4QWA A;  1FJC A;  1WHX A;  3DRP B;  1NND A;  2UXB J;  2V5H G;  4WFZ A;  2ASJ A;  3DOM B;  4OIX A;  2H1Y A;  1X4C A;  2HSE B;  4N41 A;  2OKQ A;  1J27 A;  4J9V A;  3ET6 A;  1XTZ A;  2AEJ A;  4LF7 J;  4IR1 A;  3WDO A;  2OEK A;  3V4M A;  4ETX A;  3H4D A;  3TQE A;  4IFV B;  3PJX A;  1M5K C;  4R0E A;  2XI2 A;  4ZDN A;  5JVH Q;  1SKS A;  1V9O A;  1M5V C;  1AZS A;  4YY3 F;  2DH8 A;  2QLF B;  3ULH A;  5IS2 A;  4W90 B;  4JI1 F;  5KFI A;  4X65 J;  3I82 A;  1KQG B;  2AYG A;  1WI6 A;  3I0S B;  2MKJ A;  5BJR A;  4I6Y A;  4I4B A;  1H73 A;  3LQV A;  4WXW A;  3EVM A;  4R8U A;  1J5E F;  1U47 A;  2YKQ A;  3GP9 A;  1HMV A;  2CWK A;  1RA7 A;  4ED7 A;  3ET6 B;  2HHS A;  2NCK L;  5IOL A;  2E5J A;  1AUS L;  1WHW A;  4LF8 J;  4J9P A;  1FE4 A;  3D9B A;  4C8M A;  1KC8 T;  4RWW A;  3HVA A;  1X5S A;  4AT1 B;  2QFJ A;  3H8Y A;  3EXC X;  3UR0 A;  4ZKA A;  3PZP A;  3SCK E;  3QJJ A;  1IVZ A;  2JH3 A;  1YIT S;  1HI0 P;  1SH2 A;  2BX6 A;  2XO6 A;  1W26 A;  4F3M A;  3GV5 B;  2FPH X;  4ECW A;  4DR4 F;  3FEX B;  4ZMM A;  2J7W A;  4GVB A;  1VK3 A;  3IM8 A;  3GYN A;  1PIE A;  2ZNY A;  3UWT A;  4R8U B;  2LXF A;  3KHL A;  4MKA A;  2EXU A;  1VQ6 S;  1M0S A;  3MM5 A;  4DV1 J;  1HMV B;  1NH8 A;  5KT4 A;  3HHE A;  1HYS A;  2M4M A;  3GFX A;  3N9U C;  1YJU A;  4J91 A;  3GB0 A;  2RB7 A;  3HO1 A;  3OHB A;  2IJR A;  5BYQ A;  5B08 A;  5DQG A;  1R8A A;  1QVG R;  4NML A;  4QW9 A;  3NGU A;  4YB5 A;  3OXF A;  2MTL A;  4C3M A;  4QPX A;  2MKK A;  1VQL S;  2B7C B;  3PEJ A;  5ETM A;  4Y0F A;  4GVB B;  4ZVU B;  2XEX A;  2V69 A;  2XLJ A;  1B0T A;  4JI4 F;  1FTC A;  2HYI B;  1UPM B;  4DL3 A;  1N34 F;  1R7I A;  2QGF B;  2ROE A;  3UI3 A;  5EWG A;  1IKW A;  3MM5 B;  2NLW A;  3AHP A;  4DUY J;  4H54 A;  1FFG B;  4DSL A;  1HYS B;  2YKP A;  3PYE A;  1XWL A;  3VAJ A;  2GA7 A;  4DSE A;  4K4U A;  2VOD A;  2D1C A;  1UKU A;  4PYD A;  2ZVI A;  4EZ6 A;  3PRB A;  3M2R A;  4DN0 A;  1LNQ A;  5CAB A;  1JXL A;  4ANC A;  3NCQ A;  3MI7 X;  1FD2 A;  5CH7 B;  2C1E B;  3IR7 B;  3NGT A;  3SV4 A;  1OY8 A;  3KK2 A;  3EGZ A;  4MTP A;  2WTF A;  4CP5 A;  4X2B A;  1H72 C;  1RBO B;  2O01 C;  3ZZZ A;  1WEL A;  3M2U A;  1IKY A;  2VA3 A;  4UOH A;  5D4P A;  5F41 A;  4FKY A;  4ETZ A;  2DNO A;  3HHL A;  1J5O A;  4RNF A;  1SKR A;  1NLK L;  1IKW B;  1QD1 A;  3GJR B;  4UQG A;  3TA0 A;  2G9O A;  4KE5 A;  4A8O A;  3LF0 A;  2QA2 A;  1T9W A;  3AXM A;  3CCZ A;  3C6U A;  5HVH A;  1HBM A;  4CLF A;  1VRT A;  3KDN A;  3AD9 C;  1YIJ S;  4QYZ J;  2CA9 A;  3M2R B;  5LXR A;  2R7W A;  2UU9 J;  4PXB A;  2MEW A;  2I9S A;  3G2X A;  2P9G A;  1HBO A;  3KK2 B;  4DF8 A;  3H5Y A;  2C2E A;  5EUH A;  4LIR A;  4DQS A;  3MCS A;  2VFR A;  2UUB F;  4AQY J;  5B0B A;  3M2U B;  4RW6 A;  1IKY B;  1KOH A;  1PJ6 A;  1FWL A;  3IA0 A;  5I3U A;  3HHL B;  1ICE B;  3MPY A;  1J5O B;  4ED1 A;  3DLL Q;  3R1H A;  1JWW A;  1HFE L;  1MU2 A;  2P6S A;  1K9M T;  4ZVO B;  2M7S A;  3U27 A;  4X4R A;  5LXY A;  2JOQ A;  4P9S A;  4CLY A;  4CNY A;  3C6U B;  2AJQ A;  2BW2 A;  3ZZO A;  4O3S A;  1VRT B;  1RHK B;  1EB0 A;  1XC9 A;  3W3S A;  3DNC A;  2W8L A;  3HZG A;  4ZCI A;  4KQZ A;  2RH3 A;  3U1L A;  2LDY A;  1QJH A;  2CIM A;  4DL2 A;  4I1T A;  3TAQ A;  4H4M A;  4RX6 A;  1HBO B;  3D1O A;  2A3J A;  2BJE A;  5C24 A;  5LJ3 Y;  2VHG A;  4WFN Q;  2C22 A;  4ZP9 A;  3PO4 A;  5I3U B;  4C8Z A;  2O67 A;  1NAQ A;  4P72 A;  2J9E A;  5C42 A;  4HVZ A;  1MU2 B;  1EIY B;  5J1P A;  3ZTO A;  1W7W A;  4J90 A;  2HVI A;  3FCW A;  4EU0 A;  2VAS A;  1NJX A;  2K06 A;  5BXI A;  3W60 A;  3CO0 P;  4ZJO A;  3FBE A;  5E3R A;  2EC2 A;  4WJB A;  1LK5 A;  2NPI A;  3JAM Y;  3RAQ A;  4PG4 A;  4H4M B;  4YQW A;  3T1Y F;  2OFG X;  4WTO B;  2LCW A;  4UOG A;  5KFZ A;  5C24 B;  1PYO B;  3D6H B;  1YJW S;  2ZBQ A;  1Z4U A;  2WSC C;  2DEJ A;  4LRE A;  1ZBT A;  3VAK A;  2YNI A;  3DCA A;  4ED8 A;  2G1D A;  4UW2 A;  5E3A A;  1UP1 A;  5C42 B;  5DZ6 A;  4WP9 A;  4CO5 A;  3CCJ S;  3BYP A;  2DR8 A;  2HVE A;  4QJV A;  2AWZ A;  1SL0 A;  5E2Q A;  2E9Z A;  1RHU B;  2H5J B;  2M70 A;  4I6W A;  4QCL A;  4KGM A;  3B54 A;  1WG1 A;  3N01 A;  4C8N A;  4LF1 A;  2ZH3 A;  1S79 A;  1U02 A;  1UMJ A;  4N8N A;  1U1O A;  4CM0 A;  4RBT A;  4ZVQ B;  4ZP6 A;  3DLH A;  3W64 A;  4OX7 A;  4FZV A;  2J8S A;  2YNI B;  3IWL A;  3QT7 A;  1K8A T;  1Y10 A;  4HT7 A;  3H2V E;  1N88 A;  4H4K A;  1LQ9 A;  2E1A A;  1LWE A;  5LSL A;  3H2U B;  4U8Y A;  3DMJ A;  3R9L A;  3EM1 A;  2XZT B;  4HI1 A;  1S1W A;  2A6M A;  1V3Z A;  2WVB A;  1C1C A;  4OHW A;  3UDC A;  3W65 A;  1XQI A;  3FJ2 A;  3H59 A;  3ZZU A;  2W2P P;  2WOM A;  2FJD B;  3CIM A;  1TK0 A;  1TL1 A;  2KM8 C;  4LF6 J;  4YB7 A;  3ZC4 A;  3ICL A;  4N77 A;  3EXY A;  1K1Q A;  1B0V A;  2DNM A;  3DU5 A;  2J6S A;  4JI2 F;  3C3L A;  4DL7 A;  5ADZ A;  2KHC A;  3EUN A;  2K1R A;  3J7A N;  3EDQ B;  3CCM S;  1UL3 A;  1LWE B;  2D74 B;  4TQR A;  2ZKT A;  3FK4 A;  3C14 A;  3DMJ B;  1NZ8 A;  1IUJ A;  1S1W B;  2MLZ A;  2F1F A;  2IA0 A;  4RUC A;  4DV4 F;  3OJU A;  2Z56 B;  4LQ3 A;  3CD0 A;  3NGK A;  2WOM B;  2W4D A;  3EGN A;  2VPX B;  1TL1 B;  3C2P A;  4ELV A;  1F3V A;  1IXK A;  2HBY B;  4AXI A;  3WC0 A;  3DKD A;  2VQE J;  5A2Q Y;  3UVJ A;  1YI2 S;  4CDI A;  1EX8 A;  1WC6 A;  1P9Q C;  1G6B A;  5J2M A;  6FD1 A;  1FVS A;  3D3B J;  3RRH A;  1JX4 A;  2ZKU A;  3IRW P;  4LF9 J;  2YPZ A;  3IBF B;  2CQI A;  1RXO B;  1IJE B;  1U4B A;  2BE7 D;  3OL6 A;  4JOU A;  1A7G E;  5E33 A;  2K1R B;  3JSM B;  1NJY A;  3CJ3 A;  3HFK A;  1D3W A;  2KDO A;  3C14 B;  5J1E A;  2QLX A;  3QJP A;  4ZPD A;  1PSD A;  2M9K A;  1N0V C;  4IG0 A;  2CG8 A;  4G1Q A;  3PRD A;  1NPK A;  3G87 A;  2Q66 A;  3PIO Q;  3T5K A;  1TUG B;  2ZWO A;  1YJR A;  6FDR A;  2BBE A;  1UZD A;  4Y00 A;  2VH7 A;  4HLB A;  4M5N A;  3C6T A;  2PO4 A;  1G1X A;  3D5M A;  1GH8 A;  3UVJ B;  2Q1L A;  4J9K A;  1RAO A;  1S9G A;  4NCB A;  2QLW A;  4WTY A;  2DRA A;  5J2M B;  2AX0 A;  3G71 S;  1XEZ A;  4ECU A;  2E7X A;  3D28 A;  2RQK A;  1ZAX A;  2CPF A;  3UD3 P;  3QGP A;  4HHJ A;  3T19 A;  3K5N A;  5J1E B;  4DCO B;  1I3O B;  3HF5 A;  4MIW A;  4IG0 B;  2OML A;  4G1Q B;  5KFC A;  1VBZ A;  4NA2 A;  2CUY A;  2ZE2 B;  2LQB A;  3D2W A;  3C6T B;  3BKF A;  2RUS A;  3I55 S;  3OFH A;  2DXE A;  1U6B A;  2UZA A;  1S9G B;  3JQM A;  4RW8 A;  3M9M B;  4QU7 A;  2BW7 A;  3N28 A;  1XR5 A;  3M6V A;  4CLL A;  3HVW A;  2Q6B A;  2BXJ A;  4F4K A;  2DRD A;  4I7F A;  4X4O A;  2VIC A;  2HS4 A;  3IXQ A;  4ID5 B;  3EVW A;  3RB0 A;  1NM2 A;  3SBM A;  3QSY B;  4Y2M A;  3F41 A;  1RWP B;  1EKS A;  1ZAW A;  2W2M P;  1RCO B;  3TZY A;  4DWI A;  4X4Q A;  3OTO J;  1KHW A;  1WOR A;  2L9W A;  4LFB F;  3GFZ A;  2EG2 A;  5ETP A;  1GAO A;  3BRE A;  1CC7 A;  4JV5 J;  2BUN A;  3UW1 A;  4DUT A;  2LMI A;  1GEH A;  1EET A;  2LKZ A;  2B4O A;  2F4V F;  4RW8 B;  2IBK A;  2WBR A;  2DIV A;  5K8M A;  3BO3 A;  2ACM A;  5HN0 A;  2PT0 A;  1OSC A;  2GJ2 A;  2KU7 A;  3QQC D;  2WON A;  2RIL A;  3PRV A;  1SIW B;  1CG2 A;  4C8O A;  1TUV A;  3E3X A;  3W5Y A;  4L3K A;  2VDI A;  3L95 X;  4ECV A;  2MZT A;  3BR9 A;  2JVR A;  3AA8 A;  1OSD A;  3CCR S;  3BSN A;  3F73 A;  1L5U A;  5D3G A;  2DNH A;  2GIR A;  3BBF A;  2R8H A;  3TA2 A;  3TO8 A;  4E2F B;  1VLY A;  2V6A A;  3ENQ A;  3N5B A;  3UN5 A;  2M52 A;  4GO7 X;  2IM1 A;  2PN6 A;  1EET B;  3UDV A;  2IDE A;  1SC6 A;  3AQP A;  2ZZT A;  5IT9 Y;  1TL7 A;  3OW2 R;  2FY8 A;  2MY7 A;  2RS8 A;  2WON B;  1T9Y A;  3IN5 A;  2XBP A;  3MPW A;  3TJ9 A;  4Z2X A;  4S0M A;  5LM7 E;  2WK4 A;  4ZLJ A;  4DQP A;  3PW0 A;  2RKI A;  3KWM A;  1NSA A;  2K8G A;  2EBE A;  1BQX A;  5HK4 A;  4C0H A;  3MMA A;  4OZ3 A;  1Q8I A;  5D3G B;  5KFS A;  2QYG A;  1R8C A;  2JLG A;  1L3V A;  3NNC A;  3L7O A;  4ZVF A;  4ICL A;  4O3O A;  2RUG A;  1S6U A;  1LV5 A;  3GJT B;  1CQN A;  5T41 A;  4OX9 J;  2GQQ A;  1SB6 A;  4PXD A;  1FX2 A;  4RUH A;  2MQN A;  2R7U A;  2HK3 A;  5I3Q A;  2C2M B;  1MSW D;  4UQT A;  1KLM B;  1DTQ A;  2A10 A;  4ECT A;  2EFN A;  4PEO A;  3NG8 A;  5AXL A;  3M8S A;  1GT8 A;  2M8H A;  4EEY A;  1XMO J;  3K7R A;  3PTW A;  4IO9 Q;  1FEH A;  3FMB A;  4EGL A;  2RKI B;  4LSZ B;  5JVG Q;  1EAY C;  1DRZ A;  4DV5 J;  1RWW B;  2DGW A;  5A8K A;  3UN2 A;  2K7K A;  3N79 A;  3MMA B;  4WYW A;  3VWS A;  3V4I A;  2RAQ A;  2WSE C;  3PJ9 A;  4L74 A;  3H20 A;  4KFB A;  3P49 B;  2C2K B;  4ICL B;  2LQJ A;  4KTQ A;  1A0O B;  2AP6 A;  1PJ7 A;  5HQL A;  1BY9 A;  3HSZ A;  4O4G A;  1SV5 A;  1XBW A;  1F5A A;  2HWT A;  2J0X A;  2DRB A;  5B09 A;  1DTQ B;  1KSP A;  3Q8U A;  3W66 A;  2HZC A;  1KVK A;  3A8I A;  2FJB B;  3RR8 A;  4Y6I A;  4DV3 J;  5LMU F;  4QWB A;  3JTN A;  4Q2M A;  5AJ3 J;  4CO4 A;  1RHR B;  4FS2 A;  2FQQ B;  3SQO P;  4C0O C;  3R97 A;  5U47 A;  4XDD A;  3N4W A;  3DGP A;  3OHA A;  2IC3 B;  4MYT A;  5K14 A;  3NGR A;  1KVJ A;  3V4I B;  4ZLL A;  2YQ3 A;  1MN7 A;  3OL9 A;  1QTM A;  3F44 A;  4KFB B;  2DCU B;  2UXD J;  1XJW B;  1TFW A;  4K4X A;  1WTF A;  3OV7 A;  4M5K A;  3PY8 A;  4DR5 J;  2Y1L B;  1ZA1 B;  2BAB A;  2C28 A;  2E1M C;  4O4G B;  1SV5 B;  2OTL S;  2Y1J A;  4MAK A;  3PEH A;  4TVA B;  2OSQ A;  1VQ7 S;  1NH7 A;  1HD1 A;  2DNR A;  2H51 B;  1RWU A;  4LRF A;  2JFK A;  4G3I A;  5KTQ A;  4M5J A;  3BGO P;  4DZD A;  3NMA A;  4PCQ A;  4B9T A;  1OQ6 A;  5D4O A;  3W5X A;  3MPU B;  4U7C A;  2FLL A;  2MST A;  4ENO A;  1FRX A;  2AZ3 A;  3DGP B;  4J37 A;  5K14 B;  4F4Y A;  1CUL A;  4HT5 A;  4QOT A;  4ZLP A;  4JI5 F;  2YX7 A;  3DYA A;  4JI8 J;  3VAH A;  4U7U D;  4N56 A;  1YHQ S;  3MAA A;  5DM6 Q;  1YBU A;  1YBT A;  1UA1 A;  3C46 A;  2DT9 A;  2CNL B;  2MZR A;  4DU8 A;  5EN1 A;  3ZO7 A;  2RHQ B;  3W9H A;  1Y11 A;  3VVT A;  1VQY A;  1QAY A;  2DHS A;  1ZOT A;  2YNF A;  3K59 A;  5KT2 A;  4CO1 A;  1QVF R;  3I6P A;  5CXT A;  4URG A;  1VIO A;  5IV4 A;  4K0K F;  1HQE A;  2K3K A;  1AUD A;  1Z2Z A;  1D9F A;  1AYE A;  2Z30 B;  2KJW A;  1VQM S;  2ABY A;  1CUL B;  1VBY A;  4OYO A;  2ZHA A;  2E66 A;  2NXE A;  3P45 B;  3DYA B;  1RWM B;  2HFS A;  3MAA B;  2OJ3 A;  1D8Z A;  2V94 A;  1GQE A;  2JEI A;  3W9I A;  2ZM6 F;  2XMA A;  2ZH7 A;  2HNZ A;  3I0R A;  4U7U K;  3OTC A;  1BD6 A;  4XPE A;  3MWB A;  2YNF B;  2VG5 B;  1IBL J;  2ASD A;  4A8X A;  4C4W A;  3T9Z A;  1HQE B;  5CCM A;  4P7V A;  1HNI A;  1X4A A;  3K17 A;  4K50 A;  4L73 A;  1RT3 A;  4JI3 F;  1YQH A;  2VQF J;  2BKO A;  3Q86 A;  2Z2L A;  2WBM A;  3MD1 A;  2YX1 A;  1GTH A;  4C8Y A;  2YTC A;  5G4D A;  3H0P A;  1JNR B;  4D3H A;  1XMQ F;  4NZ7 A;  1RCX B;  1TTH B;  3PW5 A;  4EK2 A;  4CIO A;  3FDS A;  5KT6 A;  2HNZ B;  3DHX A;  3V6H A;  3I0R B;  1PC5 A;  1YBA A;  4DG1 A;  3CIZ A;  4FYX B;  4WE1 A;  3AA9 A;  3GLJ A;  3EGV A;  4CYU A;  5DLF A;  1SJF A;  4JB8 B;  2GV1 A;  2FJX A;  1UVJ A;  4M5D A;  4WIQ A;  3CD5 A;  5CYM A;  4NLG A;  1VOM A;  2YVS A;  2RRB A;  1TQL A;  2U2F A;  3QO9 A;  1WJ9 A;  1N36 J;  2AMC B;  2LEP A;  1RP5 A;  2DCL A;  4LFA F;  3BQ2 A;  1HNI B;  3RW7 A;  2HHH F;  3QID A;  4NZ6 A;  4LF5 F;  3B4D A;  2DNN A;  3CJ4 A;  4DPT A;  3AOD A;  3HKW A;  2L3M A;  1AFJ A;  1RWV B;  2VPW B;  2PI5 A;  5KG7 A;  3NNA A;  3DLJ A;  1UA0 A;  1JXV A;  4DFK A;  1TEL A;  1S6Q A;  1K47 A;  2DBB A;  1Q79 A;  3UDL A;  2WZ1 A;  5B0D A;  3KHR A;  4OYA A;  2OP5 A;  4JUZ A;  2XMV A;  2FGO A;  2CNK B;  2UXC J;  5I3P A;  4KB7 A;  2X1A A;  3BO4 A;  4WU3 A;  4DG1 B;  3PYF A;  4K2J A;  2CPI A;  2XLI A;  4WE1 B;  4IH5 A;  3O5T B;  2F40 A;  1PJ5 A;  2CAD A;  2HKE A;  1M1H A;  1FXL A;  3JS9 A;  4M5D B;  1VDH A;  4NYP A;  2XB2 D;  5CYM B;  1Z2L A;  3J80 Y;  1BGX T;  3DU6 A;  2DGO A;  4NI2 A;  2E9T A;  4NXN J;  1FFW B;  4M8L A;  3UCG A;  1CJV A;  2RT3 A;  5DLG A;  2GVZ A;  2HBZ B;  3BGF A;  2NUU G;  2K3I A;  3MMJ A;  5H1S V;  3ZXW A;  1R6Y A;  4P2X A;  2D3O R;  1RKI A;  4MFB A;  4ZVR B;  1CJU B;  5D77 A;  1S6Q B;  2DGT A;  4XDC A;  1T03 A;  2DH9 A;  1Y5I B;  1BXN A;  2AX1 A;  3HJF A;  2V50 A;  4IOA Q;  3S01 A;  2MJN A;  4OJ1 A;  3BH7 B;  4NXM J;  4QYZ K;  4K5S A;  4EYI B;  5L1J A;  3TVY A;  3M1V A;  4BC7 A;  3CJR A;  3RB4 A;  1Z1Z A;  1TV6 A;  4DS4 A;  3MM6 A;  2WVF A;  4MKY A;  5L8R C;  3GE9 A;  4G1I A;  2Y1I A;  2H65 B;  1AT1 B;  1RWO B;  1M5H A;  3MUV P;  5KFK A;  2OPS B;  1CJV B;  4I6A A;  2GVZ B;  2MQ8 A;  3D3C J;  2IVM A;  3GZ7 A;  1S1T A;  1RHQ B;  4MFB B;  2CJX B;  3BSA A;  5LL6 d;  2GW8 A;  3BM7 A;  1S72 S;  5M2R A;  2W24 A;  3ITH A;  1T03 B;  5KFJ A;  1PAE X;  1R43 A;  4C11 A;  2R8G A;  2XTJ P;  3QRR A;  2J8A A;  1TL4 A;  1X0F A;  2NXJ A;  5IQ6 A;  3JAM U;  4WWS A;  1S97 A;  1OJ4 A;  2KVQ E;  5DET A;  2X1F A;  4CTA A;  4CLW A;  1I94 J;  1T11 A;  3M1V B;  3ZZT A;  2GAH C;  1FKA F;  2HBR B;  1TV6 B;  2FHK A;  3MM6 B;  3JXO A;  1R0C B;  2XY7 A;  1AXQ A;  1UET A;  1NK4 A;  2KYX A;  2MHE A;  2NXN A;  3OTB A;  4RBV A;  4WII A;  2OEL A;  4UZC A;  3TZW A;  1IBK F;  3TZZ A;  4PQU A;  2GNK A;  1S1T B;  1RT4 A;  5GAE U;  1MRO A;  4ZA1 A;  3ITH B;  4G6V B;  4NX9 A;  2B4V A;  3M8P A;  4XAK A;  3ZNU A;  4C11 B;  1HBN A;  4P74 A;  4F7V A;  3KXD A;  3JTO A;  2ATC B;  5E7O B;  1PG5 B;  2C2R A;  1Q0N A;  3RTV A;  4CTA B;  4DL4 A;  5HLF B;  2DXF A;  3K5O A;  4QW8 A;  1V5I B;  2DEI A;  1RIS A;  4DX6 A;  2QL9 B;  1XK8 A;  4TYA A;  3I56 S;  2YQ0 A;  3H25 A;  1Y0H A;  1FJE B;  1HBU A;  4QWD A;  3IWX A;  2MSS A;  3MUT P;  4PQU B;  5CYQ A;  3OQ2 A;  1RT4 B;  2J7K A;  3ZZY A;  3DHW C;  3GFY A;  1MRO B;  3FC9 A;  4M94 A;  3V6J A;  3M8P B;  1KEK A;  2R4F A;  4JI7 J;  5I42 B;  2UUA F;  9ATC B;  1HBN B;  3PKY A;  1ZM4 A;  4DV6 F;  2HRU A;  4F04 B;  3SCL E;  2FY1 A;  1QDU B;  4NCG A;  3BBB A;  2Z57 B;  4NA1 A;  2F63 A;  4JI6 J;  1FXR A;  2ZD1 A;  1ULR A;  3G8T A;  1H2V Z;  1VC0 A;  1NBE B;  3O3L A;  1S1X A;  5F3Z A;  3MEC A;  4PWU A;  2N7C A;  3TA1 A;  1HBU B;  3ENV A;  2XZW A;  2P8I A;  4KPC A;  1LFW A;  2J9D E;  4A8F A;  2BRL A;  1N54 B;  5CYQ B;  5KFN A;  2MLX A;  2YWW A;  3PX0 A;  3MR7 A;  2FJE B;  2E1P A;  1N32 F;  2FUG 9;  5KFX A;  4LR8 A;  5KOX A;  3MPV A;  5CCL A;  1Q82 T;  3GU0 A;  3VAL A;  4J7C A;  2PEH A;  1G7C B;  7AT1 B;  2BJD A;  3GIJ A;  4B3R F;  2J0W A;  5HO4 A;  5IFM A;  5A2Q U;  3PFE A;  4NCG B;  2C2D A;  1FD8 A;  2Y8W A;  3VGV A;  2CJA A;  1HI8 A;  2ZD1 B;  1E6V A;  3LAL A;  2BQU A;  1F2G A;  4F0H A;  3PO5 A;  1UJ5 A;  1S1X B;  3UPF A;  3ETO A;  2V2Z A;  4NLX A;  3MEC B;  2PFF B;  2DR5 A;  2WCX A;  4ZJL A;  2AZ1 A;  2HRT A;  4F3Q A;  2MKY A;  3SFG A;  2GIQ A;  4LBP A;  5D0G A;  2DKO B;  2JWN A;  3LP2 A;  2O66 A;  5D78 A;  4CLU A;  4NCA A;  2MYF A;  3LW5 C;  2W1B A;  4G65 A;  4ER8 A;  4DFM A;  4C8L A;  5KFP A;  4DSF A;  2ZC3 A;  3S6E A;  1VQO S;  4FYV B;  4C2M A;  2HVD A;  1IQT A;  2VBX A;  4QIE A;  2Y0B B;  2N4D A;  2HHU A;  1E6V B;  4M5M A;  5KT5 A;  1S77 D;  1FTR A;  4ECY A;  3MM8 A;  1JNZ B;  1U2R A;  1X4F A;  3FZ2 A;  5DG9 A;  3ZTQ A;  4AL6 A;  2QL7 B;  4YUD A;  5DGA A;  4NLT A;  3QAE A;  2ZHB A;  2R7R A;  2KVI A;  2VD3 A;  3LP2 B;  1NUE A;  2ZOF A;  3RBX A;  4ILL A;  3A12 A;  5KFV A;  1FRJ A;  2IRX A;  2XI3 A;  4ZVG A;  3QFW A;  3T1H J;  4O3P A;  1QSS A;  4ID8 A;  1C0U A;  2FLO A;  3CVK A;  3R7B B;  4KSE B;  2UUT A;  1VC5 A;  3DRS A;  5AE2 A;  5A8R A;  2AIR B;  1FXD A;  3TEH B;  2B51 A;  3MM8 B;  4BC9 A;  4CT9 A;  4A8M P;  4IQX A;  4UZB A;  2FTR A;  2IVY A;  3AH6 A;  4ZVS B;  5K8O A;  3K8W A;  2G1H A;  3B82 A;  3JYT A;  1TKZ A;  4EZ9 A;  1OS5 A;  3HD2 A;  1S0M A;  2LXU A;  3UD4 P;  4WYL A;  4M5H A;  5F8G A;  2CQ4 A;  2NR0 A;  4ILR A;  3CD7 A;  5HBM A;  1ZZF A;  5E3Q A;  1A6L A;  4BLG A;  1C0U B;  1DUR A;  1DFD A;  3M8Z A;  2KH9 A;  3RJM B;  4DF4 A;  1RBA A;  3SCI E;  2N4C A;  2R3V A;  2V63 A;  2ZC4 A;  1BQN A;  4YB1 P;  2Z58 B;  3DRS B;  3O44 A;  2MZS A;  5MAO A;  2VBZ A;  4HL9 A;  2EK1 A;  2XZD B;  2P2C B;  2B9W A;  5A8R B;  2XYP B;  4DR6 J;  4C3K A;  2H48 B;  4DR7 J;  4DPU A;  1S0V A;  2IMO A;  4Q2L A;  3TAR A;  2J6U A;  1RA6 A;  2KXH A;  4J9U E;  1ZET A;  1R27 B;  2POK A;  1B7F A;  1UVK A;  3C66 A;  5KFF A;  3PXG a;  3JYT B;  3CJQ A;  2RQ4 A;  4IOC Q;  4M5G A;  2I6W A;  1UFL A;  2CQ1 A;  2B8Q A;  4J9M A;  5IM0 B;  1HR0 J;  2Z2Y B;  2R8I A;  5HBM B;  4CWB A;  4NE9 C;  3AJD A;  3VVU A;  5KFH A;  2VIH A;  1UCN A;  4ED3 A;  3TVZ A;  5CHC B;  4DV7 J;  1G3O A;  1Y7P A;  3H90 A;  4DCJ B;  3HK2 A;  2EFQ A;  3QPI A;  5IT9 U;  4MJK A;  3RGI A;  1TL3 A;  5D0R A;  2W4C A;  4DL6 A;  3QRP A;  3HVT A;  1DQ9 A;  1O8B A;  5KG3 A;  5H9F J;  2W7P A;  1KRP A;  2GIF A;  4NWB A;  4ECZ A;  3IFE A;  1PYT A;  7FD1 A;  3GIK A;  3TW0 A;  2EFG A;  2NSB A;  4QR1 A;  1VQN S;  2HS3 A;  4OX8 A;  4HKQ A;  4F36 A;  4NEZ A;  4MIA A;  2X1G A;  3NXZ A;  3J81 j;  1F5C A;  1ZYQ A;  2VOO A;  1MW7 A;  3MAH A;  4B08 A;  1H2T Z;  2G13 A;  1R0A A;  4K5R A;  4Y2I A;  1R31 A;  2X51 A;  5IC4 B;  4QWE A;  1FES A;  1TL3 B;  2QSF A;  4Y2K A;  3KLG A;  1E6Y A;  2XCP A;  3MR2 A;  5HVF A;  1X9S A;  1VCT A;  4J9N A;  3HVT B;  3KUE A;  4RW7 B;  3BF4 A;  4ZP8 A;  2CZV C;  3RRK A;  4OYZ A;  1LW0 A;  2CPD A;  4USU A;  2RU3 A;  1HA1 A;  1F9E B;  2NYI A;  2HFZ A;  2ZH5 A;  1MMD A;  2HQF A;  1Q78 A;  4EO8 A;  5ETV A;  1KS2 A;  2CQ0 A;  1DY3 A;  5I4M A;  1XNQ J;  2YWH A;  2VUG A;  1YJT A;  1HNZ F;  3KKF A;  4JI0 J;  1VRU A;  1VR6 A;  1R0A B;  4X62 F;  4AUK A;  5LMN J;  5CAA A;  1E6Y B;  3KLG B;  3VGT A;  1JLF A;  5IWA F;  2LA6 A;  2DGQ A;  1HNV A;  2QX0 A;  4KYZ A;  1ZM9 A;  1B64 A;  2E1R A;  4ED2 A;  2VZ9 A;  1EAR A;  1LW0 B;  3PYD A;  4ZVP B;  3IC1 A;  2JLF A;  2P5V A;  1ZAV A;  2YKM A;  2B4U A;  2RDI A;  3WBZ A;  4FBU A;  3KLE A;  1SKU B;  5CD4 H;  1SL2 A;  3IAS 9;  5ETT A;  2AHO B;  3N6L A;  2AGP A;  1R6V A;  4Q8E A;  1XMB A;  2VBW A;  1VRU B;  2IY5 B;  2HZA A;  2N7Y A;  3UCU P;  4DOZ A;  1HKA A;  4YY3 J;  2QA1 A;  4M63 A;  2CG4 A;  2ZOG A;  4JI1 J;  2C3M A;  3TX0 A;  1HNV B;  1CJT A;  3DDI A;  5KG1 A;  4EBC A;  2XSJ A;  4RBU A;  4I2P A;  3H40 A;  2D9P A;  1FWK A;  3NP5 A;  4FPR A;  4CH1 A;  1J5E J;  5EGY A;  4CRJ A;  1X60 A;  2W4P A;  2YKM B;  4ZIT A;  2CZ4 A;  2HEK A;  3ZZP A;  1U2C A;  3KLE B;  4OYI A;  1RTJ A;  3QRQ A;  1TVR A;  2CPJ A;  4B3T F;  2ASY A;  4OI0 A;  4CH0 S;  4ZPT R;  4J9S A;  3R2D J;  2RRA A;  2FZK B;  5L38 A;  3PX4 A;  4TQS A;  2HW3 A;  1D8Y A;  1B7Y B;  1HWL A;  1WKL A;  2FB0 A;  2I5J A;  4DR4 J;  4I56 A;  3U02 A;  1NB2 A;  2RNE A;  2KO1 A;  3CCW A;  3CDB A;  3MR3 A;  1CJT B;  2XSJ B;  4I2P B;  4FF3 A;  1UEV A;  4USV A;  3KNA A;  4OV6 A;  1K44 A;  3Q8P B;  3NWR A;  1KR4 A;  1NDC A;  3SIP B;  5AJ3 F;  3EX7 B;  4NEY A;  1QUP A;  3F0N A;  3TUJ C;  3QZ7 A;  4ALZ A;  2EVZ A;  2DGS A;  4FDF A;  3MMB A;  3W61 A;  2DH7 A;  1RTJ B;  2IIH A;  4F4A A;  1FDN A;  3DRX A;  1TVR B;  4NYZ A;  3TUZ C;  1U24 A;  4DPY A;  1J2V A;  4C3L A;  5F8M A;  3ONQ A;  3VZH A;  2AF6 A;  3R2C J;  2CJ9 A;  2RQC A;  4ZPV R;  1Q95 G;  3N6M A;  4RNO A;  1MWQ A;  3LOU A;  2O1P A;  3MR6 A;  4EBD A;  2MQO A;  1FJG F;  1YLX A;  4C0B A;  2I5J B;  2HWH A;  3LWM A;  1CJK A;  1WNE A;  3NGD A;  1ITP A;  2E7W A;  2CQ2 A;  2V8P A;  5HRO A;  1QY7 A;  4NLW A;  1S6O A;  1EP4 A;  3HKZ D;  4E8U A;  3DOL A;  4JI4 J;  1N5T A;  3NBP A;  3R8Y A;  1DLO A;  2BOA A;  3HFZ B;  4OHX A;  3UQS A;  4OHV A;  3DLE A;  3J7A 1;  3MMB B;  2C3O A;  1NZA A;  1RBL A;  2XY5 A;  1G2E A;  5KG6 A;  4IG3 A;  1L3K A;  1QUV A;  3HFV A;  4ZPB A;  1SVD A;  1RAI B;  2RRN A;  1NK6 A;  3DLK A;  1I5O B;  1YDL A;  5K8P A;  4JI8 F;  3R1L A;  2BAC A;  4DSJ A;  1HQ2 A;  2ERR A;  4LFC F;  3IRX A;  1KNZ A;  2EI5 A;  5HRO B;  3IG1 A;  3VQT A;  5KG4 A;  3M8Y A;  3QMQ A;  3DOL B;  3AOA A;  3EZ5 A;  3NBP B;  3P96 A;  3MM9 A;  2AT1 B;  1DLO B;  1WDT A;  3DLE B;  1S9F A;  4Q8F A;  3QFH A;  3ZZR A;  5FLX Y;  2RS2 A;  4RU9 A;  4IG3 B;  4R5P A;  2D3Z A;  1F6T A;  2G0J A;  5A6W A;  2HQI A;  5CQG A;  2C3U A;  1TU0 B;  1F1B B;  3CC7 S;  3EJM A;  2ZH6 A;  2HVZ A;  3B78 A;  1RAG B;  1U48 A;  3DLK B;  1NJZ A;  1S76 D;  4B02 A;  1N6Q A;  3JSB A;  1C2P A;  2COL A;  1OO0 B;  1R89 A;  2D3U A;  3M9N B;  2F5G A;  1FT8 A;  2GHV C;  3NGS A;  4QIF A;  3IRX B;  1IR0 A;  3IG1 B;  5B7W A;  2UUB J;  3CTR A;  2A1B A;  2P9C A;  1T02 A;  1RT2 A;  4NL5 A;  3J80 U;  2JDJ A;  2VFU A;  4ZIV A;  4DV2 F;  2EFO A;  2GMJ A;  3MM9 B;  1TR0 A;  2AU0 A;  4OYM A;  1HAR A;  1PGZ A;  3CC4 S;  4P2S A;  1NJI T;  3CPW R;  4KV8 A;  1JKH A;  4R5P B;  2HHP A;  2HHW A;  3WQP A;  2E29 A;  5M2P A;  1XR6 A;  3RW6 A;  2WRM A;  2VQF F;  2DIS A;  4WBF A;  5E3C A;  2WAQ D;  2I38 A;  3HP6 A;  1T95 A;  1N6Q B;  3JSR A;  2KB2 A;  2QEX S;  4GKK F;  4OI3 A;  2CVI A;  3SEO A;  3A8E A;  2OGU A;  2C2N A;  3SV3 A;  3A3P B;  4YB6 A;  4IQM A;  4IH6 A;  1RT2 B;  1R8B A;  3D54 A;  4IKA A;  2R2T A;  3J7Y I;  2BYC A;  3CF5 Q;  4Y65 A;  3KG4 A;  2QMU B;  2VJU A;  1SUQ A;  2CDR B;  3TAP A;  2EKN A;  4KV8 B;  1JKH B;  3CCT A;  2AYM A;  5KFD A;  1PBA A;  4GKJ F;  4AL5 A;  3CC2 S;  1UJ4 A;  3Q89 A;  2XHW A;  4F02 A;  4UF4 A;  4KHR A;  2ZH8 A;  1N0U A;  2R9L A;  5GVQ A;  4USH A;  4DL0 C;  4F50 A;  3T1Y J;  4R0J A;  2QO3 A;  2DIU A;  3FNN A;  4WPA A;  2HK2 A;  4Q44 A;  1B99 A;  1EKR A;  2R7T A;  2RQM A;  3HDS A;  4PUO A;  2FIU A;  4XIU A;  1UVL A;  4DXL A;  1SUQ B;  2M3D A;  2XS7 A;  1XER A;  4WCE Q;  2EKY A;  1VQP S;  2GZO A;  1RLC L;  3NS6 A;  3M30 B;  2L41 A;  1DTT A;  1TMJ A;  3G9C A;  2BA9 A;  4ELT A;  4ZN1 A;  3RBE A;  1RT7 A;  3MMC A;  5C2C A;  2FVR A;  3CJ5 A;  2C2O B;  1HW9 A;  4J9L A;  3BSC A;  4OZ1 A;  5DO2 A;  4YR0 A;  3QGI A;  5E0O A;  8ATC B;  3MF5 A;  1RYS A;  2Z0G A;  1RTZ A;  4WFY A;  3P6Y C;  2WVD A;  1Y4Z B;  3HPO A;  4TU7 A;  2IJF A;  2HQG A;  3LGN A;  3M8W A;  3G6V A;  4NXM F;  2AQ4 A;  2JNJ A;  2KYZ A;  1X7V A;  2QJ3 A;  1IKX A;  4PUO B;  5GAE I;  1PC4 A;  2V8D A;  1X8D A;  4Y2A A;  4FNH A;  1HWJ A;  1SQG A;  1RSC A;  2ZJP Q;  4FBT A;  1VIS A;  4LRD A;  2ZVS A;  1FRL A;  4OJG A;  1VI7 A;  1DTT B;  3VGS A;  1RT7 B;  3MMC B;  2VC0 A;  1VQ5 S;  2LU2 A;  1N5S A;  2QA4 S;  1XNR F;  3TQ1 A;  3MUR P;  1X4H A;  2G2Y A;  4V1A k;  1U26 A;  4J5O A;  4JI2 J;  3D4J A;  2I0X A;  1CEZ A;  4HDH A;  2BV3 A;  1X9W A;  2PDA A;  4DMZ A;  5EDW A;  5AT1 B;  5EX3 A;  1FFS B;  3ZTR A;  3HJV A;  1KON A;  1URR A;  3HHL C;  1X5P A;  1IKX B;  3I4H X;  2KZZ A;  2XNR A;  2EFV A;  3UO0 A;  2FC8 A;  4CO2 A;  4DV4 J;  2L08 A;  4QR0 A;  4X4N A;  5KFG A;  1VQ4 S;  4ZK7 M;  3MCO A;  3AQO A;  3ZNJ 1;  4FF2 A;  4BDP A;  3SSR A;  3MFI A;  1PKU A;  2DGV A;  4JYA J;  3IBW A;  3MTK A;  2BMB A;  2V4J A;  2ZBC A;  3EDR B;  1GX5 A;  3K5M A;  1UVM A;  3VQS A;  1FDD A;  3CJS A;  4X4U A;  1N52 B;  1M5P C;  1QAJ A;  1S5Z A;  1WI8 A;  4WFA Q;  5A6P A;  4UST A;  3OR2 A;  2CRL A;  2V2Q A;  3ELH A;  2HLU A;  4RPF A;  4O23 A;  1JLC A;  1V3R A;  1D1U A;  3Q22 A;  4LQ9 A;  1N33 J;  3BGU A;  2A2D A;  4ZLN A;  4YFU A;  3GIM A;  3JTP A;  2BJ3 A;  1VQ8 S;  4AE5 A;  2ZOM A;  2LDI A;  2W2Q P;  3CJ0 A;  2HHT A;  4I67 A;  2R2R A;  4FVM A;  4NA3 A;  3LP1 A;  1PBU A;  4TYB A;  1JLG A;  4CI0 B;  1SKW A;  3D6M B;  4UOC A;  2BAN A;  2V4J B;  5SUH A;  2U1A A;  2AKW B;  1NKC A;  3W8P A;  4YHH F;  2JRS A;  2OPQ A;  4X84 A;  1FEE A;  1NRK A;  3NS7 B;  3OR2 B;  2DGU A;  2LVW A;  4KKO A;  4FNI A;  1ZPW X;  3AD8 C;  3OT9 A;  1C4A A;  4DR1 F;  2GO9 A;  1JLC B;  3FSY A;  2OPR A;  4Q7A A;  3UE2 A;  2NXC A;  2QRR A;  3SZ2 A;  3K2Y A;  2HZV A;  3HSJ A;  3TAM A;  3RBZ A;  4RW9 A;  1LKZ A;  3WX8 A;  1SJR A;  1X4B A;  3BN7 A;  3UD5 A;  2CWX A;  2ZBP A;  3LP1 B;  2XLK A;  5EHH A;  3BB5 A;  4HHH A;  2MZQ A;  1JLG B;  4RO0 A;  4O0N A;  4TKT A;  4OHZ A;  4NLP A;  2BAN B;  4W98 A;  3FKB A;  2DY1 A;  1GNK A;  5D0H A;  2OPQ B;  1M1K T;  4ELU A;  3QT6 A;  4OLP A;  1KN6 A;  3BGR A;  3N5F A;  1F60 B;  4ATN A;  4Y34 A;  1I51 B;  1FA0 A;  4KKO B;  3QJL A;  4AD6 A;  2ZH1 A;  2JHE A;  2OPR B;  4OMF G;  1MML A;  3TR5 A;  5LJ5 Y;  3GR0 A;  5F9L A;  3TAM B;  2PGC A;  4N76 A;  2DYA A;  3OSN A;  1B70 B;  1X5O A;  4RW9 B;  5C7P A;  1EZZ B;  3DXB A;  3KJN B;  1AA1 B;  3MEG A;  5K5M A;  1TL5 A;  1DBD A;  1MNE A;  4DBQ A;  2HAF A;  1RKJ A;  4LFB J;  3I9Z A;  2GJF A;  3MHY A;  1HHT P;  4PRF A;  1UWB A;  1OMS A;  3BGL A;  5GMD A;  4DFJ A;  2MQL A;  3NY0 A;  3R7S B;  2KFY A;  4Q43 A;  3TWZ A;  1HHQ A;  3SSQ A;  1HWU A;  1Y5N B;  2F4V J;  4RL1 A;  5KOW A;  3BGR B;  1U1M A;  5DDR C;  3I31 A;  2ZDP A;  4URS A;  2R7S A;  1T3N A;  2AW0 A;  3Q2T C;  2NQP A;  4IRC A;  1U45 A;  3A3O B;  2V8H A;  3W2V A;  3CD6 S;  3NRB A;  2V68 A;  4H4K C;  1CSJ A;  1DHM A;  4X4V A;  1RYR A;  1SQF A;  3PJW A;  1NPP A;  1F9F A;  1VK8 A;  3M8R A;  4AXJ A;  3OTE A;  1AB8 A;  3P5B P;  3JSM A;  4YS2 A;  1TAU A;  2I8E A;  1RHM B;  5HSP A;  3OPK A;  3MEG B;  5BYR A;  2OH2 A;  1HNW F;  3RG6 A;  3BN4 A;  1AFI A;  2EEY A;  1U49 A;  1UWB B;  3HHN B;  4FXV A;  3G86 A;  4CLP A;  2LEC A;  4OHY A;  4B3M F;  3PKM A;  2FLP A;  1UEK A;  1MG7 A;  4F8R A;  2HGM A;  1WF1 A;  3BDE A;  2RDD A;  4DV0 J;  2OFH X;  4ZCK A;  2PI4 A;  4KHP F;  3CUL A;  1UFW A;  2HHX A;  2XUL A;  1FDB A;  3TEG A;  3W2V B;  2UUC F;  3RAM A;  3RB6 A;  1JMT A;  5KT3 A;  3QIP A;  4DLE A;  4Z7Y A;  2BEF A;  1OQ3 A;  1S10 A;  2VBY A;  3K8V A;  4ZOS A;  1WC5 A;  4Y3C A;  5BR8 F;  1S9E A;  4DUZ F;  2CPZ A;  2CQP A;  2AYE A;  1FO1 A;  3R5A A;  3OUY A;  4RNM A;  1NB7 A;  4AL7 A;  3AJ2 A;  2HIY A;  4OI1 A;  3TOQ A;  2W7A A;  3Q24 A;  2RIJ A;  2ZE2 A;  2FVP A;  1RK8 A;  1GMW D;  2YWF A;  3PV8 A;  2ZUG A;  1GMU A;  2HQ3 A;  4GC7 A;  1S1V A;  3KUH A;  3QAT A;  2GQ2 A;  3RR7 A;  4B17 A;  3GII A;  5E41 A;  1FF2 A;  1W2I A;  4DU7 A;  1EHW A;  3GTY X;  2IDL A;  3WIV A;  3MCN A;  1OY6 A;  3QZ8 A;  2MJU A;  4ID5 A;  2JC0 A;  3QIP B;  4IR9 A;  4O3R A;  1N56 A;  4X4P A;  2Y0S D;  2IPO B;  2CQG A;  1NK5 A;  1S9E B;  1GXT A;  2GML A;  3ZFV A;  3OUY B;  4JP8 A;  3EIC A;  2CDQ A;  2CNN B;  2WVE A;  2FGC A;  4RW4 A;  5H9F K;  2GO8 A;  1Y3J A;  3TJA A;  3IMQ J;  1NSQ A;  5L1I A;  1HIY A;  4P7T A;  5GME A;  2RVJ A;  3QSI A;  2HVH A;  5FII A;  2MQQ A;  2GMH A;  2OTJ S;  1S1V B;  5C2G A;  4CT8 A;  4B9V A;  1NJW A;  2ZHO A;  3MM7 A;  1FCA A;  1NKB A;  3J81 Y;  1RLD A;  4A4J A;  1GFW B;  3BJY A;  3OTD A;  4HAC A;  5LMU J;  4KIA A;  2OO4 A;  3KMS A;  3IR6 B;  2BKP A;  2V2K A;  2AGO A;  5DDQ C;  4LF4 F;  2PA8 D;  3DN9 A;  2G0I A;  4JV0 A;  2L9N A;  2YBV A;  4PG8 A;  4HR2 A;  4DPO A;  3UDE A;  4FKX A;  9RUB A;  3CXC R;  3TRG A;  2AGQ A;  2QT7 A;  4RW4 B;  5G0R A;  3W8G A;  3KNG A;  1T94 A;  1FRM A;  1W25 A;  5KFW A;  2KT3 A;  1S7I A;  1U6F A;  1RT5 A;  1KQF B;  4NLU A;  4USK A;  3GCX P;  1W2B R;  3SXL A;  2XWY A;  2DHH A;  3JQJ A;  3HVR A;  4KH1 B;  2ZH2 A;  2DR9 A;  4UUX A;  5FDL A;  1BWV A;  3MM7 B;  5ETQ A;  1RGV A;  4M5L A;  4RWX A;  3LH2 S;  5KFA A;  1GXL A;  2JJ4 D;  2GC8 A;  1JJ4 A;  5AXK A;  1GMV A;  2QMX A;  4HAC B;  1VC6 A;  3Q8V A;  2BDP A;  1U8W A;  4N47 A;  1PYS B;  5LT5 A;  2KFN A;  2P9E A;  1TMM A;  3ZTS A;  1F0X A;  2HS0 A;  1YJN S;  2IAJ A;  3QAU A;  1TK5 A;  3GCW P;  2J0S D;  5G0R B;  2LEB A;  2WW4 A;  2XMU A;  4JI5 J;  1RT5 B;  1SXL A;  2JLE A;  1Q86 T;  2MB0 B;  1WF2 A;  2AEF A;  5M2U A;  1YJ7 A;  2LU1 A;  4KBI A;  4DS5 A;  2GHP A;  3K89 A;  3CO9 A;  3BS9 A;  5FDL B;  3OJS A;  1DQ8 A;  1UVN A;  1VQ9 S;  2B5J A;  1KLM A;  5E3P A;  3PHT A;  3SDE A;  1TKT A;  1PAU B;  2H5E A;  3IR5 B;  3G4S S;  1C0T A;  4K0K J;  5JJB A;  3D6F B;  3GV8 B;  3RRG A;  2OLW A;  2IAJ B;  4CO3 A;  5DGB A;  1SJ3 P;  3ISZ A;  4ZHR A;  1S4F A;  3NAI A;  2W9A A;  4A8K A;  2EBG A;  1WEX A;  3LGM A;  4A8S A;  5AE1 A;  3DXS X;  4A47 A;  3ENA A;  4F4W A;  2IBO A;  3HMJ G;  1I1G A;  2ZIT A;  3H42 A;  2CXE A;  1RU1 A;  1KLN A;  1G4C A;  2V0N A;  2DNZ A;  4HEA 9;  2BZ2 A;  5DZ7 A;  2MKC A;  3D67 A;  2XSF A;  2ZM6 J;  2VFT A;  2IJN A;  2BM1 A;  5CZX A;  2MLY A;  4X4T A;  3NNH A;  3DOK A;  3AOB A;  3A8K A;  1HHS A;  2B5J B;  5DDO C;  5K9F A;  4CLS A;  2C3Y A;  3PM9 A;  3SDE B;  1TKT B;  1SI9 A;  4F4Z A;  4X64 F;  4HYK A;  1C0T B;  1DZ5 A;  4IFY B;  4C97 A;  3KMQ A;  1ZS6 A;  3OVA A;  3TUI C;  5DJB A;  4ZHR B;  4PKD B;  2DR6 A;  3CDW A;  1UW4 A;  2ADC A;  4JI3 J;  2F9D A;  2IC3 A;  4DL5 A;  5KFT A;  1WKK A;  2O5D A;  5F8J A;  3HZE A;  5HL7 Q;  2MHN A;  2XC9 A;  4YP3 A;  1XMQ J;  2V8G A;  3O1L A;  3D0H E;  3E2E A;  3HSD A;  3CMQ A;  2OAU A;  3D0G E;  1HNX J;  2HND A;  2ZZN A;  3DOK B;  5KFM A;  2F3J A;  3O8W A;  1HL6 A;  1IBM F;  2CQC A;  1KVI A;  2ACY A;  4C48 A;  1FRH A;  1AZS B;  4Q0B A;  2AJF E;  1Q7L B;  4F0M A;  2HFO A;  2X3G A;  4LFA J;  4A8Q A;  3AY0 A;  2HHH J;  4C9D A;  1KFS A;  4LF5 J;  5GAD I;  3W2W A;  4KPY A;  1MLA A;  3FRY A;  4OYW A;  3UNG C;  3A1Y G;  4QZV B;  3R5G A;  1HWI A;  1UW9 A;  5FLX U;  4EO6 A;  1YWX A;  1TP7 A;  5J1N A;  1ZM3 A;  2EW9 A;  4EWT A;  3X3U A;  2W8K A;  1IWG A;  3HLU A;  1GK8 A;  1RAD B;  3M9O B;  1C1B A;  3R5D A;  3MOJ B;  2HND B;  4KC5 A;  4B3S F;  3FMW A;  5C25 A;  2H4W B;  4EI2 A;  4GC6 A;  4U8V A;  4TLQ A;  4XK8 C;  4Q0B B;  4X66 J;  4XPC A;  2CJB A;  3UFC X;  3BPS P;  3W2W B;  3MOZ A;  4F0K A;  4MK8 A;  3MDF A;  2XYH B;  4BWM A;  5HVG A;  3PG9 A;  2HAI A;  3FCV A;  3D66 A;  1Y3K A;  3KLI A;  2E5I A;  2UV8 A;  1Y9O A;  4QPT A;  4O3N A;  2VFV A;  5KFL A;  3R6L B;  2VKZ G;  1NKE A;  3DI6 A;  2OIH A;  3DDK A;  1SCJ B;  3RU0 A;  4XTT A;  2QTW A;  2DK2 A;  5F8L A;  2HNY A;  1R0B G;  1C1B B;  3I9V 9;  4WFX A;  2MQP A;  5L39 A;  2JL9 A;  4PPD A;  5ETS A;  5C25 B;  1NPR A;  5HJX A;  2PEB A;  3W62 A;  3D0I E;  4RUB A;  2VG5 A;  4EFA C;  5MLC V;  2DPI A;  2UV8 G;  2FVQ A;  4DR3 F;  1ACM B;  3UR3 C;  4OI4 A;  3M8Q A;  2OEM A;  1KTV A;  4OL8 A;  4RUA A;  2CJQ A;  3G6X A;  2QFI A;  4DSK A;  3KLI B;  3QGH A;  3B8H A;  5GAH I;  2B4P A;  3DDN A;  2EWH A;  4O44 A;  2DNK A;  3DI6 B;  2VC1 A;  5T14 A;  1FK9 A;  1M5S A;  4PXE A;  4EYH B;  2UXB F;  4K2X A;  5EWE A;  2HNY B;  4KRW A;  2IRY A;  2HUR A;  3K0J A;  4ZIW A;  3VHQ A;  5GAG I;  3R6G B;  4ZPW R;  4LF7 F;  1RT1 A;  4FXD A;  2OSR A;  4HHU A;  2WW8 A;  3CCU S;  2ZBI A;  2JFD A;  5K8N A;  2R7V A;  4ITS A;  3M8Q B;  2D9O A;  4PG6 A;  2X3D A;  1FNX H;  2KHD A;  3TJ8 A;  2DNY A;  4X65 F;  1MWZ A;  2R2U A;  1IBK J;  4A48 A;  2ZFH A;  1WG5 A;  1H0H B;  2YNH A;  4O44 B;  5SZT A;  2HFU A;  1FK9 B;  2QV6 A;  1FRI A;  2JVO A;  3F56 A;  3HHK A;  5CZV A;  2R8J A;  2HHV A;  3LAK A;  2BRK A;  2KJV A;  1F5B A;  4TNO A;  3VTI A;  1HBM B;  1X4D A;  1VIX A;  5HI7 A;  3OSP A;  4ES3 A;  4CLZ A;  1V5V A;  1U0S A;  4MT1 A;  1RT1 B;  1UWA A;  2E9R X;  4NYO A;  4LF8 F;  4Y2C A;  2ZH9 A;  4F26 A;  2VA2 A;  2V9K A;  1UTA A;  3CNQ P;  2HQC A;  4NRU A;  3SMZ A;  2YWG A;  4URQ U;  2YY3 A;  2A6O A;  1LW2 A;  1KQK A;  1FX4 A;  4M5I A;  3A3N B;  3TAN A;  2WVC A;  4RW6 B;  4RZR A;  3ENW A;  4OZJ A;  2YNH B;  5DRK A;  5LSR A;  5THW A;  1CJU A;  2IHR 1;  2UUA J;  3EGW B;  4LBI A;  2R2S A;  3CUN A;  4TU9 A;  2R7Q A;  4DV1 F;  2ZZM A;  4DV6 J;  5L46 A;  1SJ1 A;  4K4S A;  4CNZ A;  1FER A;  3BSO A;  1IM4 A;  2PMZ D;  1YRX A;  1RAE B;  3TP2 A;  3PDN A;  1RAC B;  2A2C A;  3U1N A;  4DFP A;  4MH8 A;  2G0C A;  5HQ8 A;  2DNQ A;  5FD1 A;  1K0T A;  1C4C A;  2CPY A;  4U6P A;  1OWX A;  2WHO A;  1LW2 B;  5JUM A;  3L3C A;  2JEJ A;  3Q8Y A;  2KFZ A;  4GMK A;  1YG0 A;  4WK1 A;  2OPS A;  3GFH A;  2GVD A;  3L09 A;  2AV5 A;  2UVW A;  1WOO A;  4B9N A;  4NLR A;  1N32 J;  3DC2 A;  2EC0 A;  1WTB A;  3J7Y U;  4CM2 A;  4ERD A;  2AJ4 A;  5J2N A;  3FEZ A;  1VQK S;  3GON A;  2ASL A;  2F8H A;  3CCV S;  4B3R J;  4DUY F;  3OFE A;  2BQ3 A;  5KG2 A;  4DR2 J;  2QYC A;  1RUS A;  2P6T A;  5A8W A;  2XG8 A;  1O51 A;  1VFJ A;  2IFX A;  5GMK a;  3P8B B;  5J2Q A;  1FRK A;  4ZJQ A;  1YTY A;  4C8K A;  1FI4 A;  2UUW A;  1JB0 C;  1HWK A;  2J0Q D;  4ES1 A;  2YXL A;  2FJV A;  3UCZ P;  4DPW A;  2EK6 A;  2GVD B;  3HCX A;  3OFF A;  1P1T A;  3GG1 A;  1N8R T;  3GJS B;  3KHH A;  3WC2 A;  2FHO B;  4J9Q A;  3K58 A;  2W01 A;  3SCJ E;  2Q6C A;  3DLB A;  2Q3P A;  4MK9 A;  5J2N B;  5HMY A;  4P71 A;  1SPB P;  2XGP A;  3KHG A;  2F9J A;  2B6A A;  3CED A;  1BLU A;  4F67 A;  5KFY A;  3AJ1 A;  3NMR A;  2RSQ A;  5DQH A;  2E7V A;  1YRU A;  4NAS A;  3E51 A;  5A8W B;  3US5 A;  4I0W A;  2FC9 A;  2KM8 B;  3GG0 A;  4RNN A;  5HLF A;  3B6B A;  3IM9 A;  2MY8 A;  3OLB A;  5J2Q B;  2UU9 F;  2NS1 B;  4QBU A;  2BKN A;  1CC8 A;  2J9C A;  2LXI A;  5KAK A;  5IZH A;  4QYR A;  5L9X A;  1LK7 A;  4B9U A;  2DIT A;  3AFG A;  2W9C A;  4AQY F;  3S8S A;  1RT6 A;  5KFQ A;  1M5O C;  2VG6 A;  2Y3Y A;  4DZ6 A;  1VBX A;  3MXH P;  1C1C B;  2YH1 A;  3PW4 A;  3R5J B;  3ILO A;  2C2Z B;  4YOE A;  3FFI A;  5I42 A;  1TFY A;  3BEG B;  2B6A B;  2WSF C;  2XMM A;  4F3O A;  1Q5V A;  2QMW A;  2VDH A;  4JYA F;  2XS5 A;  5D0E A;  4DPX A;  1X4G A;  4IUF A;  2KN4 A;  3W1Y C;  1JJH A;  2G2O A;  1KKH A;  2B9Y A;  2DNG A;  1Q5Y A;  3EMT A;  2OI2 A;  3FQL A;  5AXN A;  1KQS R;  1URN A;  3ILL A;  2W2N P;  1VGY A;  3D1H A;  1N33 F;  4KY3 A;  2W9C B;  2KKH A;  4OQJ A;  1VMB A;  1RT6 B;  1LEO A;  3EYZ A;  2VG6 B;  4QIG A;  5J2P A;  3PW7 A;  1FHT A;  4MKB A;  2XMT A;  3FGV A;  4NLQ A;  4A46 A;  2V4Q A;  3FFI B;  1QE1 A;  4ZS6 A;  3T5J A;  4LUB A;  2LA4 A;  5HP1 A;  3V6K A;  2BOP A;  2VPZ B;  2B0G A;  3VCD A;  3KG1 A;  2IYI A;  3D68 A;  1Q81 T;  3LTO A;  1NHU A;  3TVK A;  4DX7 A;  1JJ2 R;  3H98 A;  1Y00 A;  4OFZ A;  5JMN A;  1GMW A;  1NXI A;  3ILJ A;  5EX0 A;  2V2V A;  2XO7 A;  1D09 B;  1K73 T;  4ED6 A;  1DAX A;  1SQE A;  4QWC A;  3HT0 A;  4OI6 A;  2NSC A;  3I5B A;  5ETR A;  5J2P B;  1LXN A;  5K20 B;  3EPG A;  1SC4 B;  2NYH A;  1QTN B;  3GIR A;  1QE1 B;  4N7T A;  3BPD A;  1Q8L A;  4PZV A;  3QYY A;  5HP1 B;  2XM3 A;  3MD3 A;  3V2U C;  3P4U B;  2CNO B;  4WZM A;  5KFR A;  2MKH A;  3E8O A;  3AB2 B;  3BH6 B;  2H5I B;  2M5Y A;  3UNY A;  3AOC A;  1B3T A;  1S49 A;  4KJI A;  4CLK A;  4ZCL A;  3BV8 A;  3CDA A;  4IDK A;  2FDN A;  2V9W A;  4HDG A;  2ILY A;  3ZZ0 A;  2MMY A;  2KZM A;  3AD7 C;  1ELO A;  2A0F B;  4NRT A;  1EJ7 L;  3G6Y A;  5KFO A;  4QIW D;  2KT5 A;  2E5L J;  2CPX A;  2MZ1 A;  2VG7 A;  2YPY A;  3CE8 A;  1OYD A;  3C15 A;  4U9R A;  1CS4 A;  2YNG A;  2FHM A;  5LOQ A;  4KAI A;  4ED0 A;  3Q0A A;  1JIH A;  1SC1 B;  3IBC B;  2V4R A;  3FBF A;  3RYL A;  2QIF A;  3SI8 A;  2LEA A;  5CA5 A;  4LF6 F;  2HWI A;  2B7B B;  1YJV A;  1NK9 A;  2ROP A;  3TNV A;  4IDK B;  1JJC B;  3PW2 A;  3V81 A;  4OLO A;  2WB4 A;  2E1C A;  4I7F B;  1X5T A;  5F8N A;  3KLV A;  2BE9 B;  1WKJ A;  4CLT A;  1YVF A;  2H9Z A;  5AE3 A;  1DAR A;  3EZU A;  2MKI A;  1P27 B;  3FBC A;  4LR7 A;  3KOA A;  1VBK A;  1BUX A;  1WOS A;  3OD2 A;  2XHC A;  2QSW A;  3IGN A;  1WC1 A;  2VG7 B;  1S6P A;  4RNH A;  2KI2 A;  4O0I A;  1U25 A;  3C15 B;  3HSG A;  1CS4 B;  1TKD A;  2YNG B;  5B0F A;  3JB9 k;  1Q1K A;  1HNZ J;  3NCP A;  3L4B C;  5HMX A;  4K7Q A;  1IBC B;  1X0P A;  4X62 J;  4LSL A;  4LRB A;  4OZ0 A;  5ETN A;  3J81 U;  1FNO A;  3BKT A;  4O4R A;  2GHW A;  5IWA J;  2VQE F;  4DV0 F;  3V81 B;  2PFD A;  4KGK A;  3D7S B;  1R3N A;  3RBD A;  3CCE S;  2JEG A;  4LF9 F;  3PHE A;  4C6A A;  4YR2 A;  2YWK A;  3KJQ B;  1SIZ A;  3T3F A;  5D15 A;  8RUC A;  3LPE A;  3DRY A;  3EWG A;  4RJV A;  2I2Y A;  2DY9 A;  2CQB A;  5B0A A;  3D1Q A;  1S6P B;  4UT4 A;  5IM0 A;  1ZTW A;  2VOP A;  1RJJ A;  2R7X A;  1OPI A;  2BJ8 A;  3R27 A;  3I32 A;  2CKW A;  1K1S A;  4K4T A;  4PWW A;  3PR5 B;  1ZTT A;  2HMI A;  4Z37 A;  2XMW A;  4B9M A;  4LSL B;  1HW8 A;  3KK1 A;  3IO1 A;  1NHV A;  1XR7 A;  4Y28 C;  3FQK A;  2DXD A;  3E01 A;  3TUP A;  4RR5 A;  4C7Q A;  1P8G A;  2V8V A;  1TL7 B;  4WF9 Q;  4MKV A;  3M4X A;  2MXY A;  4HTI A;  4ANE A; 
#chains in the Genus database with same CATH homology
 4DV2 J;  4DR5 J;  4X62 J;  4JV5 J;  4GKJ J;  3D3B J;  4LFC J;  4JI2 J;  2E5L J;  4X66 J;  2VQF J;  4LF9 J;  4YY3 J;  4LF6 J;  4YHH J;  2UXC J;  1HNW J;  4LF7 J;  1HNX J;  4LF4 J;  3J81 U;  3T1H J;  5LM7 E;  4DR6 J;  1XNQ J;  5IWA J;  2UUB J;  4JI1 J;  3W1Y C;  4DR7 J;  4JI6 J;  4NEY A;  4JI0 J;  2UU9 J;  1FJG J;  2KL8 A;  3J80 U;  2MEW A;  2MQ8 A;  4DUY J;  4DR1 J;  4X64 J;  4B3M J;  5LMN J;  5LMU J;  3D3C J;  1N32 J;  2ZM6 J;  4DV4 J;  4B3T J;  4NEZ A;  4LFA J;  4JI5 J;  2HHH J;  1J5E J;  3R2C J;  4LF5 J;  4NXN J;  3J7A N;  4KHP J;  4X65 J;  4KY3 A;  4RJV A;  4DV1 J;  3T1Y J;  4GKK J;  4AQY J;  4KYZ A;  4HHU A;  2UUC J;  4B3R J;  1HR0 J;  4JYA J;  4DV3 J;  4DR3 J;  1N34 J;  4OX9 J;  1N36 J;  4DR2 J;  4B3S J;  5AJ3 J;  1XNR J;  3JAM U;  5FLX U;  2KVQ E;  4DV0 J;  4PWW A;  4LFB J;  2UUA J;  1I94 J;  4JI8 J;  5BR8 J;  4DUZ J;  3R2D J;  1IBK J;  4DV7 J;  4JI3 J;  4DV6 J;  1IBL J;  4JI4 J;  1XMO J;  5A2Q U;  2F4V J;  5IT9 U;  4K0K J;  2MTL A;  2UXB J;  1N33 J;  2UXD J;  2VQE J;  3OTO J;  4DR4 J;  4NXM J;  1HNZ J;  4JI7 J;  1XMQ J;  3IMQ J;  1IBM J;  4LF8 J;  4DV5 J;  4V1A k; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...