4DR5J

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dr5J00
4GKKJ 3D3CJ 4LF7J 4DV4J 4KY3A 1N34J 4X64J 4YY3J 4DR2J 4DV0J 2E5LJ 3J7AN 1XNQJ 4NEZA 5IWAJ 4JI4J 4LF9J 3T1HJ 4DV6J 5AJ3J 2UUCJ 5LMNJ 2UXDJ 3T1YJ 2UXCJ 4B3TJ 3IMQJ 3J81U 1XNRJ 5FLXU 4GKJJ 2KL8A 2F4VJ 1IBLJ 4JI2J 4JI6J 4JI5J 4RJVA 1N32J 1I94J 4JYAJ 4X65J 4LF8J 4JI3J 4AQYJ 3OTOJ 2HHHJ 3R2DJ 4LFAJ 2UU9J 4NEYA 5A2QU 4DR3J 4DUYJ 2UUBJ 4JI0J 4LF6J 3R2CJ 4DV7J 4JI7J 3D3BJ 4KYZA 1IBKJ 4HHUA 4LFBJ 1XMQJ 4DR4J 4JV5J 1FJGJ 4DV3J 2KVQE 4DV5J 2VQEJ 2MEWA 1IBMJ 4B3RJ 3JAMU 4JI8J 4X66J 1XMOJ 5LMUJ 1HNXJ 4B3SJ 5IT9U 1HR0J 2UXBJ 5LM7E 1HNWJ 1HNZJ 4LF5J 2MTLA 4YHHJ 2UUAJ 4DR7J 2ZM6J 4OX9J 4X62J 4DR5J 4LF4J 4DR1J 2MQ8A 4DR6J 4KHPJ 4DV1J 3W1YC 4PWWA 4V1Ak 1J5EJ 4DUZJ 4JI1J 4LFCJ 2VQFJ 4NXNJ 1N36J 1N33J 5BR8J 3J80U 4B3MJ 4K0KJ 4DV2J 4NXMJ
chains in the Genus database with same CATH superfamily
3Q89A 2RIJA 5K8OA 2MHEA 3NAIA 2RNEA 3Q24A 1RT1B 1XQIA 2IM3A 3MM9A 3N6MA 4K4WA 1IKXA 3BREA 4XO0A 4F0HA 1SJ1A 2YNIA 4I67A 4ECWA 4WTYA 4O4GB 3MWBA 1BMQB 1X5PA 2HS3A 4NLRA 3UR3C 5F8GA 1TV6B 4USVA 1IN0A 1NSQA 4ED8A 2IRYA 3KNGA 4IH5A 2GIQA 3MEGB 2AWZA 3BPDA 2AEMA 3K8WA 1Q1KA 3UVJB 2Y8WA 5HSPA 2B9EA 5CD4A 4V19J 2UXCJ 2VC0A 2QLJB 2VKRA 2K1RA 2PC6A 3IMQJ 4JOUA 5KG2A 1D8YA 4FBTA 1VC0A 4CLSA 3QGHA 2OTJS 1K8AT 1U4BA 3OW2R 4C3KA 2H4YB 1R43A 1NDLA 2ZBQA 2P5VA 1NJIT 1UFKA 2XYHB 4LF8F 3TUPA 2R8JA 4X4TA 3SSRA 3CCMS 2VODA 3HD1A 3KG0A 3ISND 2QE5A 3UFCX 5I42A 2XMWA 5L1KA 3I4PA 3QT7A 1KNZA 3R5JB 1PYOB 3D4JA 4CLWA 3DLLQ 4NYPA 4ED4A 2E9RX 4B08A 3B4DA 2CADA 4L3KA 5IM0A 2DXDA 3I31A 4DL5A 3H5UA 3MM8B 5C2GA 1RTDB 3R2DJ 2BW7A 1EHWA 3P49B 3L95X 2V69A 1UVKA 1ZBTA 1RAHB 1D8ZA 1SV5B 1X4EA 1XEZA 3KNAA 3BH6B 3CDEA 4E0DA 2EKYA 2HQIA 4JI0J 4U8YA 2HVEA 4DN9A 3MAHA 5C25B 2VPZB 3N6NA 2FZKB 2UUWA 5BYSA 3LW5C 2G2YA 4CO4A 2KJWA 4P9SA 5JJBA 1SV5A 5GMKa 4DCPB 4DQQA 2UUCF 2HHPA 5FD1A 1RLDA 2GJ2A 2XCPA 4DR4J 1IQZA 1SL2A 1QAIA 3MFIA 1KFSA 2ZUAA 5B0GA 3NEKA 1BE4A 4ZPDA 2WSCC 3FSXA 1N0VC 3LANA 4URGA 2B51A 4DR2F 1KRPA 3BGOP 3NP5A 2LLZA 4OZLA 3THTA 4EBDA 2DR5A 4JI1F 1U02A 1C2PA 9ATCB 2PI5A 1K0TA 5B0CA 3EWGA 5J2NB 3JAMU 4J9RA 4KSEB 3PW5A 5HQ8A 2R7XA 1PKUA 2V0NA 1Q8KA 2ZC4A 1TFYA 2LEPA 2AJ1A 3KKFA 2CKWA 2VICA 4A8SA 2M5YA 3MTKA 1T7PA 1Y00A 1XIQA 2UXCF 4F02A 1TL7A 3DOKA 2EC0A 1RHUB 5LXRA 2DNKA 2NXEA 2GMLA 3Q8PB 2CNOB 4DV5F 1P9YA 5BXIA 2FHKA 2YNFA 5F41A 1JJ2R 1N56A 1X60A 4Y0FA 3BEGB 3J7YI 3QIDA 2LVWA 4LBPA 4DR7J 2YNIB 5EN1A 4Z37A 2ZOFA 2VG6A 3MM5A 2E44A 1IWAA 3KFWX 3I5CA 2PIIA 1HNIA 1WF1A 4MYTA 3G6YA 4AQYF 3U1LA 1RKIA 4RR5A 1RWVB 1VBKA 4KGMA 2WRMA 2VHGA 3A12A 4YQWA 4QWDA 1Z4UA 2E7XA 5HVGA 1YJWS 3ZTOA 1U2FA 1Y5NB 1VJQA 2GQCA 3DHWC 4V1Ak 4DN0A 3M8ZA 3PRVA 4R0JA 5B7WA 3EGVA 3CUNA 4X4OA 3NMRA 1U26A 3DLEA 2B4VA 3GR1A 3PYFA 4ANCA 1NB7A 1VQ5S 4KPCA 4LSZB 3C3LA 2F5GA 2NXUA 5LJ5Y 1RBOB 2N7YA 2VC1A 1TMMA 3R5BA 4RU9A 4HLBA 4YDDB 3OXFA 2ZH6A 2N82B 2OJ3A 1G1XA 3L7OA 3LTOA 4WP3A 1JJ4A 1GMWA 4ICLB 2ZNZA 4E2FB 2JSXA 3HFVA 3VV2B 2X7IA 5DQHA 3M6UA 3SI8A 1RTIB 4USJC 3KLHA 1S49A 3KLFA 2WVCA 1IM6A 1RAIB 2ZH1A 4C8NA 4WIQA 4DV0J 2E5LJ 3K57A 2C42A 2LA4A 3NCQA 2XTJP 2Y1LB 3UE2A 2XB2D 1V3ZA 1NSAA 4LF6F 2R7VA 2OGUA 4FXWA 2DNZA 4AT1B 2O1PA 4Z7YA 3P4UB 4Y2IA 4OI3A 4Y6IA 5IC6B 3ICLA 4KQZA 3HM9A 1VQNS 3AD9C 4B9MA 3CCES 3POTA 4ALZA 2CYYA 2DCUB 3OTBA 3TUIC 4GKJJ 1JLAA 4LRBA 3M32A 1M5PC 4JI2J 1DLOB 4DUTA 4ILMA 1TR0A 2WBMA 3TZXA 3QATA 4HDGA 1JLFA 3CGIA 3IG1A 1OY8A 1NDCA 3A8EA 2MKYA 4PQUB 5I3PA 4JI3J 3GFYA 3CC2S 4RNMA 3VTIA 2CFXA 2W2OP 1PJ6A 4IKAA 3QAUA 3W8PA 2DR9A 3PJWA 1WEXA 2HBRB 4F4AA 3QSYB 2OUGA 5DGBA 5HQLA 2NREA 4DV7F 3LAMA 4C0BA 1S59A 2AGOA 3NGSA 4K2XA 4MAKA 2MKIA 1ZM4A 3K7RA 3C6TB 1N6QB 5ITHA 3VAKA 2V50A 5KT2A 1H7XA 3ITHA 1EX8A 1VK8A 2LP4A 3EXYA 2ZH2A 3O2IA 5LOQA 4DUZF 4DL2A 2BJ3A 1Z1ZA 4L72B 1U6FA 2JC0A 4K59A 1PCAA 4M8LA 4QYRA 5B0EA 4JUZA 1SKRA 1SQGA 2W4DA 4HTJA 5KT5A 4CM2A 4YR3A 2CDQA 1UJ5A 5A8KA 3CE8A 5H9FK 1FX2A 1OSDA 4ZVUB 4ENOA 2FYXA 5E0OA 4B3RF 2AQ4A 4HVZA 5DRKA 4RW6B 1FK9A 2DNPA 4A46A 2MLZA 1YJRA 4R25A 3KK2A 4FYYB 4ILRA 1T3OA 3D6FB 4OHVA 1G6BA 3TARA 3D1HA 1BC6A 3ZXWA 2ZJRQ 4O4RA 3ZTRA 4JI0F 3IBCB 4PG8A 4JI8J 1FNMA 4F3MA 2XLKA 3CDAA 3W5YA 5KAKA 3SCJE 4U7CA 4JI4F 1HA1A 5HVFA 2HZAA 3DXBA 4P2XA 2EWHA 3G82B 3IBWA 2C3PA 4NZ0A 4DQSA 4C8OA 5BR8F 3HVTB 1DARA 3P3DA 4LBHA 3MR5A 1HNXJ 1MNEA 4ZJOA 4B3MF 5KFCA 4WYWA 2P9GA 3OVSA 5LM7E 4EWTA 1IVZA 4P75A 2I8EA 3NGDA 5HBMA 2IDEA 2DR6A 2G1DA 1VDHA 2Z2LA 4UUWA 4F0MA 2ZE2B 2BVZA 4E8UA 5EHHA 2MKCA 8RUCA 4DPYA 2VBYA 1W25A 4U6PA 1UVIA 3FGVA 4ZLLA 4M63A 1M5SA 5A8RA 2AX1A 2M8DB 4C97A 1S9EA 2O5DA 3ZNUA 4XK8C 4OX9F 1CEZA 1VIOA 4WU3A 3FC9A 2Y8YA 1HBUA 4KHPJ 1FD2A 1KR4A 2BE7D 2DYAA 3H7HB 4DX6A 1U47A 1Q5VA 1RWXB 4LF5F 4OV6A 2ZWOA 2VFTA 3KLGB 2QA4G 4I6YA 4FKXA 4RX6A 1FDDA 5CD4H 3AH6A 3J7ZT 4GC6A 1CJUA 1KBRA 4NI2B 4CNYA 3OL9A 4J9OA 1RTJB 3AXKA 2IBKA 1B0VA 2MQOA 5DDRC 3FBCA 4QWAA 1RBLA 1DRZA 4F26A 2YTCA 3JSYA 3CJ8A 3H8YA 4RKUC 2LQ8A 1REGX 5K9FA 4WWSA 4DPUA 3K58A 3QZ8A 3CJTA 1NK0A 1AFIA 1JB0C 3MD1A 4OHYA 3UCGA 4N5SA 4RBUA 4OIXA 3HFKA 2W8KA 4F8RA 1RT4B 4R5PA 1G3OA 3KMSA 1U1PA 1NPPA 3BSOA 1CG2A 1U0HB 2HGNA 4TVAB 3DRPA 3JSRA 5ETNA 5HAOA 2VQFF 1UW4A 2B3TB 2CPDA 3A1YG 4C0OC 4R5PB 1TVRB 3AY0A 5HMZA 4OYWA 2R2SA 3MMAB 3AOAA 5DG7A 2IFXA 1MWZA 1NSKL 2DITA 3AB2B 2CQ2A 2OSQA 2V6AA 5GMEA 1BLUA 2RDIA 5AXNA 3DCAA 2W8LA 3E01A 5K20B 2P2CB 2W2PP 4NLPA 3N4WA 1WC3A 2B4PA 3I4HX 4ANEA 5I4MA 4X4PA 2KG1A 5D8HB 1NSPA 1WD6A 3EZUA 2ZWPA 2J8SA 3DRPB 2EK6A 2FJEB 2RQMA 2YWGA 4F36A 1WSVA 3BF4A 3VAIA 3PW2A 1VQKS 3HHLC 3IS9A 4OX8A 4LF6J 1HYSA 3MAQA 4RWWA 2ALZA 2D7SA 1YZ7A 5SZTA 1YQHA 1L3TA 3CJ4A 3KJFB 3HZGA 4QPTA 5KG1A 4LF9F 2N4CA 5B0DA 1JLBA 1SCJB 5H9FJ 4YDXA 2R7UA 1R0AA 3GZ7A 3E51A 3SMZA 3IXQA 4JI6F 1EAYC 2D3UA 3Q8VA 3DN9A 2CRLA 2Q6CA 2WVEA 5FDLB 1M0SA 2H5EA 1KDNA 1FRIA 1REVB 3S6EA 2FVPA 4WCEQ 1SBRA 2R8GA 1U45A 3MCSA 2BACA 3DI6A 5JVHQ 2YVSA 2IAJB 5A0YB 2XHWA 2W4CA 1T95A 2KYZA 3C14B 3H90A 1E6VA 1X4CA 3I0RB 3KDOA 2GZOA 3MAAA 4YB6A 2GQQA 3HT3A 1VQ6S 2AT1B 1P1LA 5CYMA 1RGVA 3K5MA 2CAJA 1U2CA 3DLKB 3FMWA 5D0RA 2KVIA 2YKMB 2V9WA 3A13A 2C2KB 3MEGA 5KFHA 1SUQB 4FPRA 3BDEA 5DG8A 1N54B 3B4MA 1RT7A 4IOAQ 2VFUA 4KFBB 4NLOA 5JMNA 1WKKA 2DVIA 3NNHA 3M8YA 3MPYA 3E2EA 1UWBB 3CCSS 2XNRA 1D0EA 2LQ9A 3AT1B 4OI6A 5CCLA 3DDIA 3TI0A 2EI5A 5K8PA 3PKMA 2EEYA 2VDHA 1HWLA 4QU6A 2CPZA 4PG7A 3CCVS 1GXTA 2GNKA 4NWBA 1GTHA 4DR4F 5IFMA 1WTBA 2XZTB 1T02A 1WHVA 5EWFA 1XN9A 4J9UE 1WELA 5B0AA 2HMIB 4IUFA 4TN2A 4LF4F 2DK2A 1P27B 2EG1A 2HWHA 3MURP 4YB5A 2ZJPQ 2BR0A 2K7JA 5D4NA 5G0RB 1M1GA 1F3VA 1T94A 4BHQA 1TKTB 1OPIA 4XTTA 1KHVA 5HN0A 4EFAC 3WX4A 2YH1A 4DV4J 4BC9A 3LO3A 3I6PA 2J7WA 3P5BP 2M7SA 2W9AA 1ZA1B 2LQ5A 4C8LA 2W24A 3V81B 6AT1B 2ZH5A 2W9CB 2VPXB 3DLEB 4I68A 1UEKA 4Z2XA 3R1LA 5I3QA 4C8YA 4DCOB 5A8WA 2DNHA 2C3YA 4NCGB 2W9BB 3TR5A 2BDPA 1FRLA 4FBUA 3CCTA 4CT8A 1NKEA 1PJ7A 2KKHA 2RSQA 4WF9Q 3Q8SB 3QFHA 4H4MB 3TAPA 2FY1A 1V3RA 2CPYA 2H5JB 3BKUA 2M52A 3HCXA 4ED2A 1URNA 2GO9A 3MAAB 5L1LA 2C22A 1VRUB 1IBLJ 5A8WB 1M5KC 4RW7A 2VG6B 3MM5B 5CH7B 3TAMB 5SUHA 4PQUA 1XK8A 2ZC3A 4JYAJ 2E5IA 3K89A 4JI5F 3CT9A 4KRWA 4LF8J 1F2GA 2GW8A 5HP1B 2A0FB 1UW9A 1WC5A 5CZVA 3CMAS 3IGVA 3NOCA 1U1OA 1IXKA 1I51B 4PYDA 4TY8A 4FS1A 5I3UA 2YKNB 1OQ3A 3QT8A 4IG0A 2CQCA 4DEZA 5E7OB 3C46A 1LWFB 1FNXH 2B4OA 1I94F 1HBOB 2NUHA 4NEYA 1HWJA 1S57A 3UD3P 2UUAF 2X1BA 3OBIA 2VZ9A 3C15B 3QT5A 5HK4A 3M8QA 1ZAXA 1V5IB 3FQKA 4ZOSA 4PUOB 1B64A 1FRHA 3R1HA 1X0FA 2XCAA 2GFFA 3AB4B 4ZN1A 3QIPA 4UY8T 2Y1RI 2A10A 2CJ9A 1ZTWA 1C1CB 2MZJA 4C0HA 5D4LA 1NU4A 1S1VA 2JX2A 3TUJC 1GEHA 4DG1B 1FHTA 3RJMB 3BH7B 3UD5A 1LW0B 2RF2A 4JV0A 4C6AA 1UKUA 2KVQE 2KTQA 2NXJA 3SIPB 1KLMA 1OO0B 4TYAA 2HNZA 3W9IA 3K5LA 2BQ3A 4QZVB 2C2EA 2IA6A 4LJMA 4FZVA 5J1NA 3ZZPA 1CJVB 1CULA 2EXUA 2ZBPA 1FFSB 1SIWB 2CQIA 3AA9A 2U1AA 1FA0A 1SUQA 3M8PA 1L5UA 4PUOA 2PMZD 4QPXA 4WP8A 4ZITA 2I5JB 2VDIA 3D28A 1RWNB 3OXGA 5KFBA 1N5VA 1FRMA 2E5HA 4HKQA 1KONA 3W2WB 3ENQA 2AKWB 1F9EB 2DNQA 1DURA 1GX6A 1X4HA 3DLGB 3MEDA 4URQU 4WJBA 5T7LA 1TL4A 3HHDA 3NXZA 2CPJA 3B6BA 2DPJA 3PACA 3MCNA 2IYGA 5ETSA 1O6XA 4ZP7A 1JXLA 3ET6B 4P71A 1FI4A 3VAHA 2YPZA 4AD6A 4BC7A 1GMVA 3TX8A 2R7RA 4OLPA 3MF5A 2H48B 3DM2A 4ZPBA 2XM3A 2XMUA 3IN5A 1VYAA 4J7CA 1HD0A 3NAHA 2XMVA 1QAXA 3CCWA 2B6AB 3GPAA 1R6VA 5LSLA 2J8AA 4XPEA 5DLFA 3VGVA 3BQ1A 4FNHA 3D6MB 3H20A 1QJHA 2PEBA 1ZPWX 2HKEA 2E29A 1B0TA 5F0UA 2F8MA 1S1TA 1S6QA 2L08A 4GRSA 3UCUP 1RLCL 1F5BA 1HQUB 3BBBA 3O3LA 5ETLA 3D3CJ 4LF7J 3HX9A 3CJQA 2E1PA 4TLQA 1HLWA 5A8RB 1KHWA 2IA0A 2LEAA 2X3DA 1I1GA 1NJXA 1VQSA 1JX4A 1WDDA 2A1BA 4FXDA 1AZSB 3KG4A 5A6PA 1UZHA 1XNQJ 4QCLA 3EUNA 3TZWA 2WVDA 4NLSA 4ZJQA 1XMBA 2VUGA 3SZ2A 5C25A 4F3OA 4DI6A 3C6TA 1N6QA 3GIKA 1RT3A 3JSMA 1G2EA 5AJ3J 3GP9A 1NKCA 2M4MA 4DS5A 1T03A 3EM1A 2E9TA 1UVLA 4IDKA 1ROFA 1Q78A 4HT5A 3EGNA 2JDJA 4ZN3A 4IO9Q 4K5RA 4M5DB 3KHHA 3ZZOA 2M3DA 3HSDA 3TJAA 2A6OA 2NQPA 1DJ0A 3Q86A 5I3UB 4FN5A 1HARA 3W64A 1JLEA 1P8GA 4O23A 5C42A 3RRKA 1WOSA 4P2MA 4UT4A 3CDUA 2XO7A 2RUSA 1O51A 3MGJA 1HNVA 2XULA 3K0JA 2HFOA 2XWYA 4MK8A 2CPEA 2Y3YA 2ZE2A 3QAEA 4CQ1A 3GV8B 4A8MP 4F4KA 1S4FA 3HSZA 4IH7A 2CJBA 3M2UA 4OYXA 5J2QB 1SC6A 1CBKA 1UEUA 4JBCA 3T6JA 3MZIA 4EZ9A 1BGXT 2RUGA 4DR3J 3KJVB 1U8WA 2WZ1A 3G82A 4NMLA 1L3SA 3H5XA 1CJUB 1R89A 1RT6A 2JWNA 3OR2B 4NCGA 4XPCA 1HI0P 5KFFA 4BS2A 4JV2A 1LQ9A 1X9SA 2DNMA 4N77A 2PD1A 5H1SV 4RZRA 3VAMA 2E7VA 2E1RA 4EBEA 3EZ5A 2HHUA 4QJVA 2VIHA 1H2VZ 1TL5A 1HBMB 2HIQA 4K8RA 3CDBA 1T05B 1IKYA 3N5FA 3P5TL 4ZA1A 2HAIA 2OPPA 4NRTA 4URSA 3AA8A 5A76A 1M1KT 2R7TA 1V9OA 1X5TA 3QQCD 5J2QA 2JHEA 3Q2TC 1LXNA 3MOJB 2HVZA 4K4ZA 1RU2A 4OYIA 1NNDA 2ZUGA 1IBMJ 1SH3A 2Z4PA 2HRYA 4HT7A 1Q95G 2F40A 2RT3A 2VH7A 3I56S 1VBYA 1HPZB 1T0TV 5BYRA 4LFCF 2UXDF 3CJ3A 1LKZA 2KHDA 2VOOA 3TWZA 4DXLA 3T41A 5F3ZA 1RWKB 2AGQA 2VPWB 4EGLA 2QT7A 4BCAA 4IR1A 1ZETA 3G2XA 3ENWA 3PO4A 3R3TA 5KFSA 1Y3JA 3DMJB 2G2ZA 2RMLA 4EZ6A 1LW2B 5CYMB 4KV8A 4OI4A 4B3SF 4OL8A 4I69A 1HNWJ 2PMWA 4C9DA 1TL1A 1HNIB 2YXLA 2MJNA 2ZBRA 3H98A 4ZP8A 4PG5A 5KFRA 4DX5A 7FDRA 1JMTA 3MR6A 3P6YC 1FJGF 1LEOA 4YHHF 4I0WA 4P73A 5B08A 2VG7B 3HVAA 3H59A 1Y7PA 4JI2F 1TTHB 1HW8A 1G7CB 2JNJA 4RNFA 4DX8H 3OXLA 1IUJA 3B82A 4LRFA 2I6WA 3KDNA 1GQEA 3BO3A 2KH9A 2WONB 2BBEA 3MPVA 2DPIA 3W2VB 4F4XA 4DR6J 1RAAB 5EUHA 4KC5A 1TAQA 1A7GE 3EX7B 4YEAA 3ENVA 2ASLA 4PWDB 2HQGA 4Q0BB 4DUZJ 4K4UA 3L4BC 1BQXA 5KFNA 2RAQA 3DI6B 3GG0A 1UP1A 3US5A 3VVUA 2RDJA 5L1IA 1HYSB 2AYEA 3CO0P 4GKJF 1HWIA 2RHQB 2WB1D 3LOUA 1S0NA 2AYMA 4QU7A 1WF0A 4Q2MA 2ZKUA 1TMJA 4NXMJ 2JEIA 1IWGA 4OZNA 1Q5YA 1VGYA 2ROGA 2D1CA 4XAKA 4X84A 2CWKA 3C66A 3DLHA 2DCLA 5B0BA 5KFKA 2DXEA 2QLWA 1BQMB 4QIFA 5CYQA 2O67A 4X64F 4M5MA 4Q5VA 4QOTA 1UFWA 3TA0A 3KHGA 3OJUA 2QYCA 3N79A 1HBNA 4NEZA 3M6XA 4PWUA 1RT7B 1BQNA 2V34A 3CB4A 2VU5A 3DFEA 3IR5B 1EQMA 3MMAA 5C42B 3EPGA 2YQ3A 3M32B 2CJKA 4LF9J 1KVIA 2OFHX 1S1WA 5LMNJ 3L3CA 3RB0A 5GAEU 4UW2A 3HSJA 1B99A 4ECRA 2GX8A 1LNQA 4WYLA 4RNNA 5FLXU 2Z30B 3BDPA 2VB6A 4DSJA 2DO0A 2LXUA 4USIA 4Q8FA 2OEKA 4G1PA 3VHQA 3IRXA 2APOA 1EZZB 5GAEI 1SIZA 3MEEB 4X66F 3AD8C 4L6V3 4LRDA 2RB7A 4KH0B 4ED1A 3KHRA 3F41A 1X31C 4X4UA 3R6LB 4ED3A 2OSRA 5KTQA 3OTOF 3CMES 2QEXS 2ZFHA 3OTOJ 3SXLA 1YDLA 2DHSA 1RHRB 3MMCB 5J2MB 4WFYA 2W01A 2HWTA 2R3VA 3TNVA 3WBZA 1FCAA 2Q79A 3M4XA 4ZVSB 4LFAJ 3NCPA 1S1VB 2Z57B 3VZIA 1BUXA 4C7QA 2LEBA 3PZPA 2B8PA 3PX0A 4UY85 4PRFA 4CO2A 1HI8A 4YUDA 1MSWD 4BDPA 1FJEB 3T9NA 2GGPB 4O44B 3TP2A 1N4LA 3CCLS 2ZHBA 1EARA 3AFGA 1V3SA 3M8QB 3TRGA 5U47A 1PAUB 2GO8A 3IS9B 5MAOA 5DDPC 3CXCR 1SQFA 2LDYA 4PXEA 2HGLA 2YKPA 1XMQJ 3CW2C 2G0JA 3CJKA 4YFUA 1SJ3P 3OSNA 3I9V9 1FKOB 1RE1B 2M0GB 3OJSA 3KXDA 1FEEA 1Y5IB 3FCVA 4RNHA 2YBVA 4DL7A 4ED6A 2XNQA 4ZHRB 1U1RA 2CPIA 3ET6A 4ELTA 4DG1A 2LECA 1VRTA 4QR2A 4QIEA 4CLFA 1VK3A 1RT5A 1SL0A 2F8EX 4B3TF 3O5TB 2KRRA 4LQ9A 1YRUA 3QRRA 3IBFB 4PR6A 2PA8D 2W1BA 3W5XA 2PO4A 3AQOA 3FSIA 3L7PA 2JLFA 2QSWA 2GIFA 1AUDA 4I4BA 5LMUJ 1HHSA 4DCJB 3EVOA 1S1XB 2UV8A 3NGRA 1OWXA 3W66A 1HR0J 1QSLA 1WNEA 2MPUA 3QBCA 3LPEA 1S1WB 3OL6A 2W9BA 4CO1A 2QRRA 2NYIA 5HROB 1I3OB 1OQ6A 3CDWA 4USWA 2OP5A 1MMLA 4CRJA 5KFQA 4TQRA 1RKJA 2UUAJ 1MU2B 3GV5B 1N48A 1QLNA 4W90B 4XDCA 3TANA 1N5YB 4OMFG 3CJRA 4R0EA 1IBLF 5KFEA 3PJXA 1UVJA 1CLFA 4RW7B 2DH8A 2V8HA 3GIMA 5E5NA 4FYDA 2EFOA 4ZVTB 5B09A 2XMMA 1JLGA 2CJYB 1M5HA 1VQOS 4ZPAA 1OYDA 3C6UB 1Q79A 3GYXB 1HMVB 2ILYA 2RKIA 1T9XA 1IJEB 4Y2AA 2H1YA 4DZ6A 3PX4A 2UVWA 2CUYA 3CCRS 3BGRB 1HNWF 4ECXA 1K1SA 3SDEA 4LR7A 2VQFJ 1A6LA 1IKWA 4Q43A 1N36J 1BWEA 3C15A 5EWEA 4YY3F 4TYBA 5KFWA 1QSSA 2MGZA 2XLIA 1H73A 2K7KA 3AOCA 4O0NA 4LSLA 4Q7AA 1NK4A 1MW7A 2PA3A 2DNNA 3ZZUA 5ETRA 1YRTA 5L1JA 1KLNA 3QGIA 1ACMB 4K0KJ 3JTPA 2ERRA 1JLCA 1NK9A 4J9LA 3RRHA 2DR8A 2V2KA 3PEJA 1U1LA 4O3SA 2XS5A 4J9KA 3IP0A 1IKYB 4NLUA 3Q0AA 2JVOA 1FO1A 2QTWA 5JXSA 5CABA 3V6DA 2R8KA 1PILA 1Y4ZB 2D9OA 4ETZA 2XI2A 2W2NP 2BJEA 4HACB 1N52B 2KT2A 1NZ8A 2C3UA 3W62A 3TAMA 4X65F 3RB4A 1IQTA 2NSCA 4FP9A 3OUYA 4X4NA 1U1KA 1RT6B 2H5IB 2IM1A 3OR2A 4NLWA 2UUCJ 1U0SA 2V63A 4U96A 2BEFA 1ITPA 3DRSA 3HP6A 2X1GA 1H38A 4HH0A 2HGMA 2KL8A 4RL1A 2KJVA 2ZITA 4CLZA 1N5TA 2YWEA 2LKZA 4H4OB 2YKQA 3GTYX 5D77A 4ETXA 1X8DA 2BQRA 4F2SA 3PRBA 3PFOA 2XMKA 4O4GA 5F8JA 3MTJA 3ISZA 1REVA 4TKTA 2IIHA 5KFGA 3W8GA 5JVGQ 2F4VF 1QUPA 3UO0A 1WC1A 4ICLA 1PYTA 3AJ2A 3I5AA 1PO6A 5T41A 4ED0A 3QZ7A 3I82A 3TUZC 1JLBB 2J9DE 2OLWA 3LP1A 2XHCA 2B7BB 5L46A 3O44A 1VQLS 1K0VA 1RT3B 4J9SA 3N6LA 2J6SA 3RUBL 5L9XA 1UPMB 2ZJQQ 4LFBF 2GHPA 2G13A 2KO1A 2VL1A 1PC4A 3DHXA 4I7FB 3HF5A 2KXHA 2JRSA 1HMVA 3PNIA 1X5SA 3D2WA 3UDEA 1X4BA 4G3IA 4ES3A 5AJ3F 3PIOQ 1R0BG 3C19A 2L48A 4CTAB 3PJ9A 4JI8F 1EB0A 5E3QA 2MB0B 1XNQF 1S6QB 3EXCX 1DQAA 5DZ7A 2AJ4A 3ADAC 3HZEA 1T9WA 3OR1B 1S79A 2CQ0A 5K14B 4B9SA 3DRRB 4N7TA 4M95A 2KT3A 2GAHC 3NBPA 4PYAA 3BO2A 4PPZA 4LF7F 3GYGA 1CPZA 3BGRA 4M5JA 3RBDA 2COLA 4GVBB 2HHQA 3OSPA 1XMOJ 2WCXA 2OEMA 5IV3A 4KKOA 4USTA 1B70B 4IFVA 2I38A 2MMYA 3QRPA 1VQMS 1R8CA 1UWAA 3LA0A 3M7VA 4CLPA 3D7SB 3I87A 1CC8A 1Y11A 3E8OA 3LGNA 4MK7A 4WKRA 3IAM9 3HKWA 2R7SA 2MHNA 3GB0A 4NXMF 2KHCA 1YRXA 2AEFA 2LQBA 5DQIA 1MMNA 2WW4A 2MKSA 4O3OA 4EK2A 3TAQA 2ZM6J 3A3NB 2FJAB 3NG8A 3B54A 4M5IA 5DDQC 3CCUS 3BM7A 4C11B 4ZHRA 5KT3A 1S0MA 4C8ZA 4K4VA 3FUYA 4DV7J 2ZOMA 3IC1A 5KFUA 1Q8LA 4CLTA 3IR6B 3O6QA 4CLUA 2NYHA 1A9NB 4YR2A 1RTJA 1U0HA 4ZP9A 4DUYF 2BKPA 3JTNA 4PKDB 2VKZG 3K5OA 3MM7B 2EK1A 4PWWA 5HVHA 1GFWB 3G8QA 1B4SA 2J7KA 3GR0A 1WC6A 4RUCA 3FZ2A 3VQSA 4UQGA 4QWCA 4I2QB 2R9LA 1FKAF 1CULB 4CLLA 1WOOA 3ZTQA 4C48A 1D09B 1VLYA 2ZDOA 4LR9A 4NPOA 4AXIA 4DSLA 1WEYA 4Q44A 3N01A 1RT1A 1WJ9A 3CC7S 2V9KA 2MQPA 4P74A 2XWXA 4TXSA 4DR1F 2BXJA 2EFGA 2NLWA 3FFIB 3R5AA 4X64J 3ZC4A 3DGVA 1S5ZA 3FBBA 4KE5A 4CDIA 2CZ4A 2YNFB 4L74A 4FF2A 3MHYA 1WHXA 1TVRA 1Q8BA 4L73A 2W4PA 4UOGA 3H25A 4DV6J 2FJXA 3WHIA 4CZCA 2K1RB 4NASA 2IJRA 5IWAF 2UXDJ 4PXDA 1VS3A 2XSFA 1KP6A 1RTDA 4B9VA 2CVEA 2KT5A 2EFQA 4TY8B 1XMOF 4C11A 2HRUA 5CHCB 3RBXA 2ACYA 2J0XA 4Q45A 4WK1A 1NKBA 3QO9A 2EW9A 3KK1A 3KYLA 4OHZA 3NL0A 1U1NA 3PYDA 3SCLE 2CQGA 3MEEA 3ZZZA 2XMAA 1N5SA 2ZHOA 3W7BA 1SC4B 3GIJA 5FLXY 2FZGB 2HQDA 4MJKA 2P9EA 3CCZA 4OZJA 5C2CA 3PM9A 2VQEF 2R2TA 2FVRA 4EU0A 5K8MA 3G96A 4DOZA 1FXLA 1FKPB 1KKHA 2H51B 2P8IA 4H54A 3UDLA 3VQTA 3PIPQ 4ECVA 4EBCA 2WHOA 2F4FA 5KFZA 3THPA 3WDOA 2RE1A 2YWKA 1S6OA 4DU8A 3OUYB 2BW2A 2E9ZA 2X1FA 2EC2A 4KYZA 3CD7A 3OTDA 4PZVA 2V94A 1BY9A 1FWPA 4B17A 4ZLJA 4WXOA 5LSOA 3IR7B 3GILA 5T14A 4ELUA 2FC9A 3IM9A 3HK2A 2RJZA 1HD1A 4Q2LA 4J9NA 2HSEB 2YX7A 4IOBA 2KYXA 2QO3A 3FBEA 4RLEA 1TKZB 3RBZA 2XS2A 3HI9A 4DV3J 1KS2A 1UFLA 3MM8A 5DGAA 1SKUB 2GS8A 2WW8A 2RU9A 3I55S 4M5HA 3DU6A 2QMWA 4LSLB 4G1IA 1IBMF 2RHSB 2HQCA 1CJTB 4L75A 1TK5A 1YJUA 3LP2A 4B3RJ 4M1KA 4ELVA 1HHTP 2KZMA 2CJXB 2CQ1A 2VFSA 3DGPA 3IGNA 2AP6A 2IRXA 2N4DA 5CZXA 2GIRA 4OJGA 2BMBA 3SFUA 1YJNS 4WU2A 2OPRB 1FRKA 2BA9A 2UXBJ 1FVQA 3T1YF 4KT0C 4IO1A 1NCLA 2Z58B 1FFWB 3W60A 1YGYA 1YK9A 3GONA 4MKAA 1CJKA 1NEEA 2BV3A 2FJDB 1N5YA 2OPQB 1NK7A 2DEJA 2ASDA 1DFDA 2HRTA 5GAGU 4CO3A 2KXNB 3KK3B 1DLOA 3JSBA 3GE9A 1DTQA 1E6YA 3K59A 2XY5A 2MY7A 2GVZA 3NWGA 2WVBA 2XC9A 2X1AA 2QA1A 2OPPB 1LW2A 2MY8A 2NPIA 1S1XA 2OELA 3D6TB 3M8WA 1YBUA 3O8WA 3R5CA 4ZVFA 5G0RA 4CO0A 2QL5B 4Y2MA 1RA7A 3T1HF 5D15A 1APSA 3QRQA 2F3JA 1RACB 3P8BB 2KFZA 3J7A1 5KFXA 1R27B 4OZ1A 4ZVRB 4F0KA 3G87A 2FUG9 1XWLA 2DHAA 3LAKA 1LWCA 1VHIA 5D4OA 3IWLA 5AT1B 5IQQA 1KQFB 1YI2S 1N36F 4OX6A 3DKDA 2RKIB 1HQ2A 3LP1B 2R2RA 3SFGA 9RUBA 2V4JB 3DOLA 3M2RA 2H3EB 5GADU 2WOMB 2Y9HA 4IR9A 2DY9A 1NAQA 1LK7A 1JLGB 4C3MA 1LV5A 3FEZA 2BANB 1O0PA 1WG5A 1UAWA 1GTEA 2CQPA 1S9GB 3H40A 1W7WA 1I5OB 2QZ8A 5D4PA 2MKHA 3AODA 5E3PA 1WHWA 2RQCA 5KOWA 4OI2A 3BR9A 1Q16B 3IG1B 3GFHA 4LF2A 3V6KA 4DS4A 1FT8A 4USHA 2G0CA 2HBZB 1VQ7S 3SDEB 4H4OA 1QVGR 1B3TA 1PJ5A 1FRXA 2FHOB 4WFZA 3BQ2A 4DL4A 2B5JA 2RQ4A 3BBCA 4DPWA 3CD5A 3DYAA 4DPXA 4NZ6A 1RUSA 4ZJLA 1WSRA 4H4KC 1S12A 1DTTB 5IQ6A 2C2DA 3U1NA 3GJSB 1FVSA 4ZVEA 3M05A 4O3NA 3MOZA 3LF0A 4LR8A 1ZAVA 1YWXA 2BJ7A 3AJ1A 4J5OA 1NHUA 1WC0A 3L7UA 3NY0A 5J1EB 1MLAA 2BJ9A 2XQCA 1MWYA 2GAGC 3NRBA 5ETVA 1DAXA 1X4AA 3Q8QB 4AQYJ 1H2UX 3BGFA 4F2RA 4IH6A 2HFUA 2DNOA 3VAFA 5L38A 3B78A 5DETA 5FJ4A 5MLCV 1S4EA 3AXMA 4FYXB 3OHBA 3KUHA 3EYZA 2FVQA 5A2QU 4MFBA 1C0TB 3I96A 3BYPA 4X4VA 4YS2A 4RUHA 2QIFA 3HHLB 2CQBA 2IY5B 2EG2A 3TJ9A 4ECZA 1UVMA 1Z2LA 5B0FA 1HBNB 3EVWA 1T9VA 3M30B 2FHMA 1NRKA 2I0XA 4Y2CA 4EEYA 3J81j 5GVQA 3K5PA 3PW4A 2FJVA 4MKBA 1TK8A 4FYWB 3F0NA 5KFIA 4DJBA 1VQ9S 2ATLA 4IYQA 3VZHA 1EP4B 1FJGJ 5HANA 2ZVSA 3KMQA 4PXCA 2CQ4A 2PN6A 4IQXA 1ZOTA 4W92B 1YJ7A 4ECYA 3UDVA 5C5JA 3MM6A 3MCOA 3MR7A 4LVOP 1VQ4S 3G8TA 1S6PA 1YG0A 5E33A 1FD8A 1MG7A 1RCXB 5AE3A 1FESA 5E3AA 4CNZA 2MKKA 4OX7A 4DX7A 3TZYA 4PWDA 2HS4A 1U24A 1P9QC 2FY8A 4NCAA 2NUUG 1KQSR 2H65B 3LQVA 1YIJS 3MXHP 6FD1A 1RQ0A 1YLXA 2B4UA 3CD0A 3BB5A 2CPFA 2KU7A 2WAQD 4OJHA 4NYZA 4BWMA 2MTLA 2HQFA 4X2BA 3K17A 4I2PA 4P6QA 1UCNA 2GV1A 1D9FA 3M9NB 4ZP6A 1RZMA 5LL6d 1JLQA 3HPOA 4OZ5A 2QJ3A 3J7Z5 3H5YA 1EETB 1Q7LB 2FDNA 3UCZP 4WKYA 1NJWA 3KLIA 3W63A 2YQ0A 3Q8RB 5M2PA 2MLXA 4KGZB 5CYQB 3PYEA 1KOHA 2BJDA 5KG6A 1YJVA 1KFDA 2IMOA 2C2NA 3C16A 1LW0A 2GJIA 2LCWA 1GH8A 2AEJA 2MKJA 4HR2A 5HATA 2R8IA 1U49A 2FLNA 4PXBA 4ERDA 3RU0A 1WORA 2SXLA 5F9LA 4ED5A 1FXRA 4WP9A 1Q0NA 3TVYA 2N3OA 4F50A 3GFZA 2AHOB 4KGXB 3BPSP 4FKYA 4A48A 1RBAA 4DSFA 1F5CA 3NBPB 2E7WA 3C8YA 5BR8J 3CMQA 3J80U 4B3MJ 1GMWD 2BE2B 3LP0B 4S0MA 2RS2A 3IO1A 3M6WA 1RTHA 2IC3B 4RW9B 3HXMA 3G9CA 2HYIB 1KTVA 3GLJA 4NE9C 2VV5A 4FF3A 4NMXA 3GU0A 2D74B 1RISA 5CAAA 3VALA 2RF2B 3A8KA 4CTAA 2IVYA 4USKA 3VCDA 3IRWP 5IS2A 1RXOB 3S7RA 3GFXA 1ULRA 1T3NA 2HFVA 2DH9A 1ZAWA 2YNHA 4DR2J 5I42B 3RAQA 4MYUA 1KVKA 4DV4F 4M5KA 5IWAJ 4CWBA 4AYBD 2ZH4A 2CQ3A 3JB9k 5HQMA 3AD7C 4DV6F 1F9FA 4JI4J 1R6YA 1WG4A 1HQEB 3RGIA 3PEHA 1VCTA 2MDAA 4K7QA 2BRLA 3UVJA 4B3TJ 3BN4A 1RU1A 5GAGI 3OL8A 4GVBA 3M2UB 2YX4A 1PIEA 5HJYA 5HMXA 4JI6J 1KEKA 4K4SA 4A8WA 1O5JA 3FVYA 4X65J 1URRA 4RBTA 1O8BA 2GHWA 1AA1B 4HHJA 5D6GA 2KM8B 1S9GA 3TYTA 2HFZA 4NZ7A 2HS0A 3JQJA 3F73A 1DY3A 2XZDB 4O3QA 4J9MA 1RHMB 1TKTA 4Y00A 2HW3A 2UU9J 1HBMA 1T05A 1T03B 3ETOA 3PW7A 5EGYA 2R7QA 4ED7A 2MGZB 3BYRA 4DUYJ 3V4MA 2OHDA 4YOEA 3D6HB 3EDQB 4KIAA 2DXFA 4ZS6A 5ETTA 5KG0A 1HW9A 2B43A 4CYUB 3ZO7A 3NGKA 1BD6A 4CM0A 3BSNA 3HO1A 4OI0A 5EX0A 3RZAA 2AYGA 2HLTA 1CSJA 1LXJA 4KGKA 3M8RA 2MZRA 4DWIA 5LJ3Y 3GCXP 2PSZA 2DGOA 1JJCB 2C2OB 2G4BA 1GXLA 4NLXA 2IJFA 2AF6A 1HQUA 1TQLA 2L3MA 3SCIE 2DIUA 3ZZYA 1TKZA 2AMCB 2VG5A 3BGUA 1SC1B 3KK3A 4Y3CA 3ZTPA 2B9YA 2BKNA 3MECA 3I9ZA 3OVBA 1L3KA 4M5LA 2HK2A 3ILJA 2NS1B 1WI6A 3RBEA 3CVKA 2HMIA 2B0GA 1NXIA 2GGPA 2OO4A 2LMIA 1SPBP 2LXFA 3DNCA 1FEHA 4HTIA 5HI7A 3V6JA 3BO4A 3PV8A 5E41A 3MI7X 4OJ1A 2Y0BB 3DM2B 1K44A 2HNDB 2UZAA 4OYZA 1R0CB 2BKOA 4IDKB 2IHR1 5C7PA 4F67A 1IR2A 1C4CA 5D0GA 3ZZRA 1X9MA 2VASA 1ZS6A 1DHMA 2DHHA 1ZA2B 4U8VA 3HJFA 1RJJA 3NNAA 3EPIA 3HFZB 5IZHA 3RW6A 2DKOB 1MROA 3DRYA 3D68A 3EICA 3WIUA 1CJTA 1NM2A 2OMLA 3H0PA 4QIVA 1HNVB 5G4DA 4O3PA 2W7OA 1SJ4P 2JEFA 2JEJA 2EKNA 4LVNP 3J80Y 3FFIA 2FVSA 1CS4A 1HWUA 2V8DA 1SQEA 2QFJA 5D3GB 1IBKF 4Y65A 1TL7B 3DOKB 2FQQB 3ETMA 4GMKA 4HL9A 2MQ8A 3TA1A 1TUGB 2HK3A 3TA2A 1K1QA 2VBWA 2ZVIA 1LWXA 3KJNB 4RW8B 2DJWA 3EMTA 4J9VA 1S0VA 1AB8A 1XMQF 4DMZA 2QV6A 2E1CA 2GHVC 4WIIA 2HBQB 1UL3A 2MXYA 1N88A 3RAMA 2QLFB 2Z2YB 3MM7A 4KO0A 4QWBA 1JK9B 2J6UA 3KJVA 3A8JA 1KN6A 1Q53A 1F6TA 2CPHA 2NXCA 3ILIA 5AXLA 5BJRA 3MFHA 3PR5B 1M5VC 3CJ0A 4ITSA 3UDCA 2OAUA 3C16B 1NZAA 2PGCA 4I6AA 1FKOA 3N28A 1S6UA 4PAAA 1VC5A 2YWFA 1TKDA 4KY3A 2Y0SD 2UP1A 1NH7A 1NHVA 2GQ2A 4IG3A 3NGUA 4MH8A 2YY3A 3MR2A 2FZCB 2OI2A 5GMDA 3PTWA 3UW1A 2BJ1A 4EO8A 2AD9A 2EFVA 5T7LB 2VA2A 2ZZMA 4MIAA 4U67Q 1NJYA 2CQDA 3T19A 2J0QD 1U8SA 4LIWA 2PMHA 4CP5A 3D9BA 1RI7A 1SVDA 1XR6A 4N47A 4LRAA 1GXUA 2GVDA 4JV1A 2BM0A 4G65A 2CJQA 1M5OC 4YB1P 4L76A 2H9ZA 2YPYA 1NDPA 3JSMB 1UA1A 2V67A 1S1UA 4YMEA 4ECQA 4TQSA 5GADI 3N9UC 4M5NA 3MEKA 5J2NA 4F4ZA 1I94J 1AZSA 4YN3B 1TL3B 1TKXA 2LDIA 1BQMA 2FIUA 3A4TA 2BRKA 1XTZA 2IJNA 3GG1A 3R7BB 5KG7A 2I9SA 4M5GA 4A8OA 3VGTA 4RUBA 2L9DA 2VFVA 3QSIA 2DTJA 1IR0A 1F3FA 3SCKE 3NGTA 4DR3F 3T3FA 1JXEA 2AV5A 3SV3A 1K73T 4CO5A 3M30A 3W5ZA 1H7WA 1RTZA 3UNYA 4Q0BA 4BWJA 1QTNB 4K5SA 2RD5C 4X4SA 2YKAA 3D1OA 4ZVPB 4JI3F 1N34F 5K14A 4AUKA 1J5OB 1NO8A 1IR1A 1RCOB 1W26A 1WI8A 4NL5A 4WXWA 3M1VB 3MPWA 1JIHA 1KLMB 1RAGB 4ES2A 2A2DA 3HLUA 4ES1A 1Y0HA 1H2TZ 2YKNA 1TZ0A 3N0VA 5J2MA 2BM1A 5D3GA 4LF1A 4NLVA 1L3UA 1Y3KA 4A8YA 1FDAA 4WZMA 4L3NA 1U2RA 4DL0C 2XBPA 1VR6A 3T9ZA 3EZOA 5GAHU 1R8HA 2XLJA 2J6TA 4P52A 2M9KA 3PCOB 2ZKTA 4DHVA 1N8RT 3BGLA 3DLGA 3MEDB 3U1MA 2NR0A 3TJ8A 4J37A 2C2RA 1VC6A 2QSFA 1KD1T 2IPOB 2JH3A 3IWNC 5CXTA 4HI1A 2UUTA 2DNYA 4K4XA 1H3DA 4USMA 4NXNF 1RYSA 2FLLA 2EBEA 2I5JA 3D5MA 2CZ9A 3GJQB 3PR4A 1W2BR 4AL7A 1UWBA 4I64A 4OJ3A 5HP1A 2ABYA 1TAUA 3G71S 3A3OB 3KK2B 1CJKB 3SQGA 2ACMA 1JLEB 2VG5B 2YNGA 3OL7A 3FBFA 5IT4A 4OYBA 2ZDPA 1IKVA 2Y1JA 2AZ3A 1S0OA 1FERA 3GMGA 4YR0A 2OPRA 2W2MP 2XY7A 3HKZD 2YWHA 2K2PA 4KTQA 4K0KF 2HNYA 2HWIA 5K8NA 4V19X 1QAYA 2OMOA 4LSNA 3NKYA 2P9CA 5F8LA 2AX0A 2F8HA 4C8MA 4NA1A 4OZ2A 3ITHB 4NA3A 4RW4A 2OD4A 3LP2B 1JJHA 3DOMA 1HPZA 1W2IA 3S1TA 1SKWA 5KG4A 2AZ1A 5J2PA 1RT2B 3OLAA 3NMAA 1FXDA 1T9UA 2RVJA 3KLFB 2XS7A 3ISNC 4RU2A 1RDRA 2BOPA 2R4FA 2KRBA 4GO7X 1IKVB 4TNOA 4RNOA 1S1TB 1K47A 2IC3A 4RW9A 5BYQA 2RH3A 3FDSA 3IFEA 3HULA 4ZCMA 5J2PB 3BQ0A 2J9DA 1C0UA 3W65A 3TZZA 3J7AN 4KFBA 3M9MB 2YWWA 2OPQA 5KFAA 1LFPA 2XO6A 2DRDA 1RAEB 4WK3A 2B9XA 4WFAQ 3TX0A 4B3OA 3GWCA 2L9WA 1WHYA 2DNLA 1KSPA 3WX8A 1DQ8A 2Z0GA 3OT9A 3J81U 2LU2A 2GA7A 3LUYA 2VFRA 2YNGB 3JYTB 3OTEA 3CJ5A 2IMWP 2XG8A 1QD1A 1XJWB 2FGOA 1Q82T 2CPXA 2ZH8A 1Q81T 3TEHB 3FRZA 2OH2A 1F60B 1FTRA 1MU2A 3UPFA 3E3XA 4UUXA 5KFDA 3PX6A 2Q3PA 4ZVGA 3MMBA 4C8KA 2ADCA 4DU7A 1R8BA 4O0IA 3QJLA 2ZOGA 1VBXA 3VF0B 3UWTA 1ZH5A 1RAJA 2F63A 4RPFA 5L8RC 4DR7F 1X4DA 1PBAA 2GVDB 1U6ZA 2IM0A 2HLUA 2DT9A 4EMDA 3UN2A 4NLQA 1LWEB 4FDFA 1WOPA 3KG1A 3RR8A 2KZZA 3RB6A 2E5JA 1NLKL 2JLEA 2DGVA 3Q83A 4GVLA 1B7YB 5CCMA 5A0YA 2B9WA 4DQIA 4DLEA 2OIHA 2J9EA 4HHUA 2V8GA 4N41A 5E2QA 4LFBJ 4ZIWA 5F8NA 5KFVA 3CULA 3C6UA 1VFJA 1ZM9A 4CIOA 1ZTTA 5CYJA 1YBTA 2HNZB 3I0SB 3UN3A 4YP3A 2L41A 2KM8C 5KT7A 4DFPA 4GKKF 3EVMA 1RHKB 3LWLA 1VLOA 2DNGA 4UF4A 2F1FA 1R0AB 4R8UA 2XYPB 1AYEA 3HMJG 3FQLA 3CJKB 4MMOA 3VWSA 3DLJA 1VOMA 2CXEA 4UOHA 1OS5A 4WPAA 2IVMA 2JZ5A 3NS7B 5EX3A 3SYZA 3TVZA 2ROEA 3NS5A 1G4CA 4AL5A 5HROA 2HHSA 3ZTSA 5KFTA 2J7UA 2NXNA 3VVTA 2VBZA 3IWXA 5A2QY 4CCHA 4DR6F 2CQHA 5EWGA 2BZ2A 4DPTA 4LRCA 1TUWA 4A8QA 4WE1B 1FJCA 3R8YA 2FHJA 4C98A 1OY9A 4LF5J 2ZD1A 5F9NA 5DG9A 4HYKA 2NSBA 3ONQA 1EKRA 3KTQA 4QYZJ 4DSEA 2A6MA 2OKQA 3U02A 3T5HA 3NWRA 1AROP 4FPIA 3R9LA 2O66A 2GMHA 4AL6A 5C24A 1MROB 3Q2SC 2AJ2A 2POKA 4OX9J 1NMEB 1S1UB 4R8UB 2ZD1B 2FLPA 4B9NA 4PG6A 1JNRB 3D67A 1KWMA 1SJRA 3ZZTA 4AXJA 2RU3A 4UOFA 1PG5B 3HVTA 2UVRA 2CNNB 3PVXA 4CI0B 3IM8A 2QLBB 4P72A 1KVJA 4U95A 4UZBA 2C2MB 3D54A 4ZLNA 1TV6A 1F5AA 7FD1A 2AGPA 2DRAA 4LFCJ 4FF4A 3W3SA 2WVFA 4AFFA 2CVIA 5F8HA 3DRXA 4RW8A 3QT6A 2VJUA 3CD6S 1S7HA 3T6BA 4HHHA 2D69A 2WBRA 3MM9B 5D0EA 1QTMA 1B0PA 1RWMB 2WONA 4CT9A 4TU7A 3MMCA 2OTLS 4GKKJ 2M8HA 2V2ZA 2RDDA 2DHXA 4KB7A 3WZ0A 3OFEA 2AYBA 1EIYB 4IRCA 1UVNA 3X1LB 1YZ6A 1VRQC 1CS4B 4BLGA 2EPIA 2RRAA 5IT9Y 4LT6A 5C24B 1UPPA 2XSJB 2DRBA 2W2QP 2F9DA 3CIZA 3R7NB 2XGQA 2HVIA 3IRXB 4JP8A 1M1HA 1HI1A 4UZCA 3JYTA 1R8PA 3ULHA 2O01C 5HBMB 1MWQA 3R6GB 1YX2A 2D41A 4DPOA 4ZLPA 1NK6A 4NCBA 1YSJA 3HVRA 1QE1B 1IJFB 3QFWA 3CPWR 3MPUB 5ETPA 4DV0F 2BQUA 4HH1A 2E5LF 1RWWB 2OEJA 1S10A 3DDNA 1HNXF 4QR0A 5CQGA 2IDLA 2E1MC 1YHQS 3GIIA 1M90T 3LALA 2ZEJA 4RJVA 5HL7Q 4J9PA 2VG7A 1KQKA 4IRKA 3QGPA 1FFGB 3GQCA 5KFJA 1V5VA 1NK8A 1GK8A 2BX6A 2GMJA 4GC7A 1VISA 4DR5F 4QYZK 3HT0A 3KHLA 1FDNA 2CIMA 2E66A 4W98A 5HLFA 2EBGA 2HHXA 3QWUA 2DGTA 4G6VB 2F7VA 3RRGA 3KUGA 1J5EF 3DRSB 1CC7A 3QNWB 3A8IA 1XC9A 5D78A 3D0GE 3FKBA 2UUBF 5DJBA 1F1BB 2ZBCA 1C1BA 4KO0B 5KG3A 1RA6A 4Q8EA 2N3LA 1LFWA 1PSDA 1S99A 3C14A 2CWXA 2D9PA 4NA2A 2MZ1A 2IAJA 3GV7B 2Q43A 2JC1A 1T9YA 3PYGA 1KQGB 3BV8A 3JQMA 4H4KA 4HACA 2XGPA 2AIRB 2ASJA 1YJ9S 3EGZA 1WG1A 1HFEL 2EVZA 4Y28C 1FE4A 2JL9A 1NK5A 5FDLA 3NLCA 1LWFA 2AW0A 4LUBA 4QW8A 4PG4A 4DV2J 1VQPS 1DZ5A 5KG5A 2VF3A 4JV5J 1DTQB 1E6YB 2QL7B 3JXOA 1NHKL 4NLTA 3WC0A 3Q22A 2HVDA 1TUVA 2CA9A 2WK4A 3H2UB 4K4YA 5H9EJ 2Z2MA 3D1QA 1JXVA 1NPRA 2K3IA 1WF2A 2KG0A 4RO0A 2RILA 2V8VA 3R97A 1JWWA 3G4SS 1I6JA 3CC4S 1EQ0A 4I6WA 4F04B 1VBZA 5IT0A 4JV5F 1JNZB 1PC5A 4EO6A 2DEIA 1VMBA 4KAIA 2QYGA 4KV8B 2ROPA 5KFOA 3PXGa 1LOUA 2HBYB 1S7IA 2Y1IA 2QGFB 2Z56B 3A3PB 4H4MA 3FNNA 1Y9OA 1ZZFA 2HPUA 3GIRA 4KHRA 2LXIA 4U9RA 4USUA 2JFKA 1YKWA 3OVAA 4B02A 4ANDA 3T1AA 5EDWA 1S77D 4ZPWR 4OI1A 3E01B 1Q86T 3UN5A 4ECUA 1T8EA 3SV4A 1UA0A 1QUVA 1WTFA 2QMXA 5F8IA 1HL6A 3W61A 3KK1B 4P2SA 4XDDA 4MTPA 3GSIA 3FJ2A 4UTGA 2HHHF 2ZZNA 1X4FA 4DR5J 4X4QA 3O1LA 2JEGA 4AE5A 3CCQS 1VQ8S 4U7UD 4JI7F 4MIBA 4M5DA 4CH1A 5DM7Q 1KC8T 3HVWA 4DSIA 1WWHA 3ILLA 4DV1J 1QE1A 4ZVOB 2BE2A 3QMQA 1FWKA 2RRBA 1AUSL 4CH0S 8AT1B 3Q23A 2XMJA 4K2JA 3THVA 1CVJA 3L9ZA 3DOMB 3OV7A 3R5GA 1S97A 2MSTA 4HI2A 4WFXA 4KHMA 5J1PA 4LSNB 4C4WA 2QA2A 1QVFR 2HNYB 4CLYA 2QN6B 4F7VA 2XSJA 5M2UA 3TO8A 2DO4A 2M88A 3DDKA 3MM6B 2XMTA 4LIRA 2A18A 4FF1A 3MD3A 1NUEA 1RSCA 3D0IE 4KBIA 3SEOA 4DV3F 5ETOA 4JYAF 2FPHX 3PKYA 1TK0A 2D3ZA 2DBBA 1V6HA 5HLFB 1RWOB 1F2HA 1VIXA 3FEYB 1GT8A 2BUNA 1N34J 2A3JA 3SQGB 2K3KA 4OLOA 3KWMA 4KPYA 4NI2A 1JLFB 1F9HA 1EETA 1R31A 2UVUA 4OYAA 4TY9A 4QQBA 2GC8A 4QIGA 5DDOC 3KLGA 3B8HA 1U1MA 4DSKA 3HHNB 2V2QA 4JB8B 1SI9A 1OSCA 2CG4A 2QFIA 4I1TA 2JVRA 2C1EB 3GCWP 3DLKA 5F0WA 1S76D 1MN7A 3BZQA 3PG9A 3T1YJ 2FVCA 4MKYA 4ZCIA 4LF4J 3EGWB 2F4VJ 3LH2S 4WFNQ 2OPSB 1YTYA 1FNOA 1RT4A 1FJ7A 4N56A 3CSKA 3WQPA 4EYHB 2G1HA 2JOQA 4JI5J 1N32J 2DHGA 2Q6BA 2YNHB 2O3DA 3R5DA 2U2FA 2MLYA 2ZH3A 4B9LA 4IRDA 4K4TA 3OTCA 4CH7A 3J81Y 1OJ4A 4TLRA 1RTIA 1ICEB 5HMWA 4D3HA 1Z2ZA 1RAOA 3U27A 2B56A 3PRDA 2W7AA 4OQJA 4ZDNA 4FYVB 2YQ1A 3TOQA 1SJFA 1R7IA 3DYAB 2YH0A 3K8VA 4J9QA 4P10A 5KFYA 3H5SA 2FTRA 2K8GA 3QGGA 4DDFA 1UMJA 3R2CJ 2PFDA 2B6AA 1J2VA 2HFSA 3G6XA 2FC8A 3HHLA 2MQLA 1KTQA 3VAJA 4P7TA 1L3VA 3J7YU 1WDTA 2OFGX 2DGXA 3MECB 1RAFB 4IG3B 4WFBQ 1K9MT 1SH0A 2DR7A 1N0UA 1FK9B 3CIMA 3NOGA 2ZBIA 1TP7A 2AJ0A 1WKJA 4EI2A 1F0XA 4C2MA 3PW0A 2D3OR 5ADZA 1EP4A 1NB2A 2R42A 3AHPA 2VQEJ 2LQJA 2MEWA 2WSEC 3BJYA 1PGZA 2R7OA 1J27A 4F3QA 4NLYA 3GYNA 2MZQA 2YX1A 2VOPA 4MT1A 1OIAA 3KLIB 3AOBA 3TW0A 2QMUB 2ZNYA 3MUTP 1AFJA 1BHNA 3QJPA 1KOOA 4I2QA 3L09A 2W25A 4DV2F 4I2PB 1CQMA 1YVFA 3KUEA 1VRUA 4ZCLA 2GCFA 3OPKA 2FHJD 2RQKA 4FVMA 3S8SA 5GAHI 2WSFC 2PT0A 2DGSA 1RADB 3FCHA 3QWPA 3W2VA 1SL1A 2FD2A 1HHQA 4P7VA 1HR0F 5IT9U 2WB4A 3CJ2A 2V8PA 1HNZJ 2N7CA 1XBWA 3MPDA 5LSRA 5LMUF 3MMBB 4ZIVA 4K50A 1H74A 4HEA9 2DGUA 1NDKA 2DGQA 3G86A 1RHJB 4CLKA 2R2UA 2XYGB 2DH7A 2HURA 2VPYB 3DRRA 3V81A 1RB0A 4QW9A 3PHTA 4LBIA 3CF5Q 3TVKA 1IKXB 3DU5A 1OY6A 4OYPA 4F25A 1A0OB 4EYIB 1UZDA 1Q7YT 4X62J 4O3RA 2BANA 3KOAA 4DR1J 5RUBA 2NPFA 2DISA 2LU1A 2XZWA 4OYMA 3VGSA 1X7VA 2JFDA 3I0SA 4TU9A 4IFVB 5DM6Q 3W1YC 3R7SB 2ZH9A 2B8QA 1C1CA 4W4MA 2DY1A 3FEXB 5CA5A 1X5OA 4J91A 2C3MA 2NZCA 4QWEA 1JKHB 4RWXA 4Y2KA 4RUAA 2Q66A 2HZVA 4X62F 3RB3A 2I2YA 1C0UB 1N33J 3JQKA 1LWEA 1C0TA 3ELHA 4QIWD 4IOCQ 5H9EK 2UVVA 2VA3A 1GMUA 2DIVA 4FXVA 4GO5X 2IRUA 3MUVP 1NJZA 2K06A 3SSSA 3UI3A 4DFKA 4IG0B 1Q8IA 3PHEA 2BJ8A 3Q8YA 5HJXA 1ZYQA 1RP5A 2H54B 2V4JA 3DOLB 3FSYA 3M2RB 3WIVA 5KOXA 1JQGA 3QLHB 5E3RA 3G6ES 4DFJA 1X9WA 4RW4B 3D66A 3NS6A 2ZH7A 2PFFB 1JKHA 2CZVC 3KLEA 1U25A 2L9NA 1TL1B 4G1QB 3T1HJ 1QSYA 4PPDA 1Y10A 3POTB 1ZZNA 2OD6A 2PI4A 2HHVA 5L9NA 1QAJA 1FKPA 3OFFA 1ZM2A 2H4WB 4IFYB 5IOLA 1XNRF 3H2LA 1U6BA 1XNRJ 1UJ4A 4B3OB 3OQ2A 1TELA 2B5JB 5DS7A 2IVFB 4DL3A 1E6VB 2KXFA 3I0RA 3I32A 2ZM6F 5L39A 2E1AA 3S01A 4DLGA 4HDHA 4N8NA 3HSGA 2G0IA 3RW7A 1DBDA 1MN9A 3QLHA 3RG6A 2MQQA 1YJTA 5AE2A 1AW0A 2UV8G 2ILZA 2RS8A 3C2PA 2MZSA 2QX0A 2V68A 3ZNJ1 3DLBA 4QR1A 1S9FA 2DB1A 5A8KB 3BSCA 3HDSA 4NRUA 2DNRA 2WOMA 2YKMA 4ZPTR 3H4BA 4N8OA 2QA4S 1HKAA 1SB6A 4NOHA 2KB2A 4OFZA 1J5OA 2HVHA 2C3OA 3BS9A 4ILLA 2HHTA 2CNKB 2UU9F 1YBAA 3CTRA 2VD3A 2HG4A 1EKSA 3AQPA 2X51A 2QL9B 3CEDA 1ZM3A 5HO4A 3OLBA 4DQRA 1HNZF 1PYSB 4ZCKA 3U7JA 3MMJA 5M2RA 2IM2A 4Y34A 2FJWA 3W9JA 4OV1A 2FB0A 2PE8A 2C28A 4LMZA 1C1BB 2ATCB 4A8KA 2GJFA 4DBQA 4LREA 3Q8UA 3BSAA 4NX9A 4EUVA 1QDUB 3KLHB 1S48A 3OHAA 2VJVA 2GVZB 2MQNA 3UNGC 4ID8A 3T5KA 5E3CA 3F56A 3M1VA 1SH2A 1QM9A 2M2BA 1DQ9A 1U7LA 3CWJA 3KJQB 3LP0A 1D9AA 3I5BA 4IQMA 4OHXA 3M2VB 4A8XA 3RTVA 1IBCB 2QLXA 3LGMA 4OZ0A 1SKSA 1IKWB 1NPKA 2PEHA 2I1RA 4Z7CA 1XR7A 3NNCA 3CO9A 1R3NA 2CG8A 2XEXA 1SJQA 3EDRB 3BKTA 3JTOA 3PDNA 1UEVA 4UOCA 1RHQB 4KHPF 5IV4A 4U7UK 3TQEA 3FRYA 4ZVHA 1D9DA 1RABB 4B3SJ 5LT5A 5LXYA 4NLGA 1HWKA 4A47A 2F65A 5ETQA 4LQ3A 2MYFA 4DF4A 5F8MA 2ALYB 4YHHJ 4MIWA 3V2UC 3H4DA 1WKLA 2VBXA 1RT5B 5F3TA 3AAWB 2E5GA 3V5RA 1P1TA 5KT6A 3TQ1A 5J1EA 2OPSA 3CNQP 2BE9B 3FK4A 2CNLB 2V5HG 2DD8S 3TEGA 3W2WA 3WC2A 3PO5A 4DL6A 4B9UA 5AE1A 2J0SD 4WE1A 1FX4A 1FWLA 1RK8A 3MUMP 1RTHB 4DF8A 2BABA 2KDOA 2FLOA 3HJVA 3VGUA 5HMYA 3HHKA 4BBYA 2EFNA 2LYVA 4J90A 3M8PB 1FF2A 3HHLD 3ZFVA 3ZZ0A 4PQAA 1D1UA 4O44A 4YB7A 1BQNB 4ZKAA 3PY8A 5D0HA 3SQOP 4NXNJ 2KFNA 5ETMA 4DZDA 1RWPB 2J76E 4ZPVR 1MMDA 2B7CB 2J9CA 4NLDA 1VRTB 4PCQA 1FE0A 1HBUB 4FVCA 1N32F 3FCWA 3K2YA 1NH8A 4D3GA 3AJDA 2NZ4A 5IM0B 1CQNA 1VQYA 3MR3A 2JJ4D 4YY3J 3VAGA 5AXKA 5ETKA 2NCKL 3ENAA 1C4AA 1TKXB 1TL3A 3F44A 4WBFA 1OMSA 3H2VE 5DZ6A 4ATNA 1P6TA 3HD2A 3LWMA 3K5NA 1JLQB 4ECSA 4ECTA 3UD4P 2AU0A 1LWCB 2FGCA 1U48A 1BXNA 4M94A 1ELOA 3IA0A 2V2VA 3RYLA 2KI2A 4LFAF 1UTAA 4MFBB 2PDAA 5DLGA 1HBOA 1AXQA 1GAOA 1X0PA 1T11A 2HNDA 5A6WA 4KKOB 3ILOA 2A2CA 5KFMA 1RWUA 1U1QA 1AT1B 5KFPA 2BYCA 4MK9A 1Y5LB 3SBMA 3MCMA 1S9EB 1TU0B 3LPYA 4E98A 1SXLA 3M6VA 1CJVA 1S6PB 3RR7A 1H0HB 4PABA 2MJUA 2HQ3A 4PEOA 4ER8A 4B9TA 2BOAA 2J5AA 1XR5A 1ZPVA 4NYOA 1N33F 4WZQA 4OHWA 3P96A 4KR0B 2HHHJ 3H42A 3BR8A 2IBOA 3NCRA 4KH1B 1DTTA 2V4QA 3DMJA 3SSQA 4IFYA 1FRJA 1BWVA 2HEKA 1IM4A 1X4GA 3GJTB 4OZ3A 6FDRA 3RAXA 1YITS 3G6VA 4TU8A 4KJIA 1QY7A 4DV1F 2UUBJ 4I7FA 5THWA 4G1QA 3QIPB 3UQSA 2CDRB 2P6TA 4A4JA 4JI7J 4ZPCA 5FIIA 2W7PA 3D3BJ 2AJQA 1IBKJ 1WUUA 5DO2A 3OFHA 3R27A 3DC2A 5DQGA 3M2VA 2M70A 3V4IA 1OYEA 3OFGA 1B7FA 1SC3B 3V6DB 4XIUA 4P2FA 2R7WA 7AT1B 1WACA 2QG9B 1GNKA 3PFEA 4RW6A 3T5LA 2HHWA 1TFWA 1UETA 1S72S 2HAFA 3BBFA 1Q4RA 3W9HA 1JLCB 3FMBA 4QBUA 1GX5A 4ZK7M 4DV5J 2D3O1 3VR1A 1R8AA 2MZTA 3UR0A 3N5BA 2KFYA 2QC3A 3KLVA 3V4IB 4I56A 3OD2A 1VI7A 8ATCB 1FDBA 3HHEA 3LGHA 4CYUA 1HIYA 4ID5B 1JLAB 3GJRB 4X66J 4C3LA 3CJSA 1PAEX 5KT4A 1VHFA 3M9OB 3QYYA 2IYIA 2X3GA 4KGVB 4ZMMA 5IXUA 3G8SA 2DGWA 1RYRA 1UJ6A 4FS2A 1FTCA 3DGPB 4UQTA 3EE3A 3T5JA 3V6HA 2G2OA 4MKVA 1HQEA 2RRNA 5JUMA 3KLEB 2R8HA 2JLGA 5LMNF 2FJBB 3DXSX 4A8FA 4RBVA 1D3WA 2ASYA 2LA6A 5AXMA 2MSSA 2P6SA 2W9CA 2ADBA 2MQMA 1LK5A 2V4RA 3QPIA 1EJ7L 4DQPA 2CJAA 3QO9B 3BN7A 3OR1A 3JAMY 2AJFE 1WEZA 2HIYA 3MDFA 4OYOA 1NBEB 2UXBF 1XERA 2ZHAA 3EJMA 2J0WA 3JS9A 4N76A 2VONA 4WTOB 2ZZTA 3IAS9 1H72C 1WC4A 3X3UA 2KN4A 3CCJS 1RT2A 2HZCA 4X4RA 2XI3A 2EFPA 1H6KX 2Q1LA 1VJWA 4ID5A 1J5EJ 3BKFA 1PBUA 3FZBA 4JI1J 4F4WA 4F4YA 1T9TA 4FNIA 1H98A 2Z8QA 2HFNA 1N5QA 1U09A 4ZVQB 3GSDA 5IC4B 3D0HE 5KFLA 2F9JA 3P45B 2YKOA 2C2ZB 3QJJA 2LFVA 5K5MA 4DFMA 2XY6A 2WTFA 2Z2ZA 2G9OA 1OPZA 3M8SA
chains in the Genus database with same CATH topology
4GKKJ 3D3CJ 4LF7J 4DV4J 4KY3A 1N34J 4X64J 4YY3J 4DR2J 4DV0J 2E5LJ 3J7AN 1XNQJ 4NEZA 5IWAJ 4JI4J 4LF9J 3T1HJ 4DV6J 5AJ3J 2UUCJ 5LMNJ 2UXDJ 3T1YJ 2UXCJ 4B3TJ 3IMQJ 3J81U 1XNRJ 5FLXU 4GKJJ 2KL8A 2F4VJ 1IBLJ 4JI2J 4JI6J 4JI5J 4RJVA 1N32J 1I94J 4JYAJ 4X65J 4LF8J 4JI3J 4AQYJ 3OTOJ 2HHHJ 3R2DJ 4LFAJ 2UU9J 4NEYA 5A2QU 4DR3J 4DUYJ 2UUBJ 4JI0J 4LF6J 3R2CJ 4DV7J 4JI7J 3D3BJ 4KYZA 1IBKJ 4HHUA 4LFBJ 1XMQJ 4DR4J 4JV5J 1FJGJ 4DV3J 2KVQE 4DV5J 2VQEJ 2MEWA 1IBMJ 4B3RJ 3JAMU 4JI8J 4X66J 1XMOJ 5LMUJ 1HNXJ 4B3SJ 5IT9U 1HR0J 2UXBJ 5LM7E 1HNWJ 1HNZJ 4LF5J 2MTLA 4YHHJ 2UUAJ 4DR7J 2ZM6J 4OX9J 4X62J 4DR5J 4LF4J 4DR1J 2MQ8A 4DR6J 4KHPJ 4DV1J 3W1YC 4PWWA 4V1Ak 1J5EJ 4DUZJ 4JI1J 4LFCJ 2VQFJ 4NXNJ 1N36J 1N33J 5BR8J 3J80U 4B3MJ 4K0KJ 4DV2J 4NXMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK J;  3D3C J;  4LF7 J;  4DV4 J;  4KY3 A;  1N34 J;  4X64 J;  4YY3 J;  4DR2 J;  4DV0 J;  2E5L J;  3J7A N;  1XNQ J;  4NEZ A;  5IWA J;  4JI4 J;  4LF9 J;  3T1H J;  4DV6 J;  5AJ3 J;  2UUC J;  5LMN J;  2UXD J;  3T1Y J;  2UXC J;  4B3T J;  3IMQ J;  3J81 U;  1XNR J;  5FLX U;  4GKJ J;  2KL8 A;  2F4V J;  1IBL J;  4JI2 J;  4JI6 J;  4JI5 J;  4RJV A;  1N32 J;  1I94 J;  4JYA J;  4X65 J;  4LF8 J;  4JI3 J;  4AQY J;  3OTO J;  2HHH J;  3R2D J;  4LFA J;  2UU9 J;  4NEY A;  5A2Q U;  4DR3 J;  4DUY J;  2UUB J;  4JI0 J;  4LF6 J;  3R2C J;  4DV7 J;  4JI7 J;  3D3B J;  4KYZ A;  1IBK J;  4HHU A;  4LFB J;  1XMQ J;  4DR4 J;  4JV5 J;  1FJG J;  4DV3 J;  2KVQ E;  4DV5 J;  2VQE J;  2MEW A;  1IBM J;  4B3R J;  3JAM U;  4JI8 J;  4X66 J;  1XMO J;  5LMU J;  1HNX J;  4B3S J;  5IT9 U;  1HR0 J;  2UXB J;  5LM7 E;  1HNW J;  1HNZ J;  4LF5 J;  2MTL A;  4YHH J;  2UUA J;  4DR7 J;  2ZM6 J;  4OX9 J;  4X62 J;  4DR5 J;  4LF4 J;  4DR1 J;  2MQ8 A;  4DR6 J;  4KHP J;  4DV1 J;  3W1Y C;  4PWW A;  4V1A k;  1J5E J;  4DUZ J;  4JI1 J;  4LFC J;  2VQF J;  4NXN J;  1N36 J;  1N33 J;  5BR8 J;  3J80 U;  4B3M J;  4K0K J;  4DV2 J;  4NXM J; 
#chains in the Genus database with same CATH topology
 3Q89 A;  2RIJ A;  5K8O A;  2MHE A;  3NAI A;  2RNE A;  3Q24 A;  1RT1 B;  1XQI A;  2IM3 A;  3MM9 A;  3N6M A;  4K4W A;  1IKX A;  3BRE A;  4XO0 A;  4F0H A;  1SJ1 A;  2YNI A;  4I67 A;  4ECW A;  4WTY A;  4O4G B;  3MWB A;  1BMQ B;  1X5P A;  2HS3 A;  4NLR A;  3UR3 C;  5F8G A;  1TV6 B;  4USV A;  1IN0 A;  1NSQ A;  4ED8 A;  2IRY A;  3KNG A;  4IH5 A;  2GIQ A;  3MEG B;  2AWZ A;  3BPD A;  2AEM A;  3K8W A;  1Q1K A;  3UVJ B;  2Y8W A;  5HSP A;  2B9E A;  5CD4 A;  4V19 J;  2UXC J;  2VC0 A;  2QLJ B;  2VKR A;  2K1R A;  2PC6 A;  3IMQ J;  4JOU A;  5KG2 A;  1D8Y A;  4FBT A;  1VC0 A;  4CLS A;  3QGH A;  2OTJ S;  1K8A T;  1U4B A;  3OW2 R;  4C3K A;  2H4Y B;  1R43 A;  1NDL A;  2ZBQ A;  2P5V A;  1NJI T;  1UFK A;  2XYH B;  4LF8 F;  3TUP A;  2R8J A;  4X4T A;  3SSR A;  3CCM S;  2VOD A;  3HD1 A;  3KG0 A;  3ISN D;  2QE5 A;  3UFC X;  5I42 A;  2XMW A;  5L1K A;  3I4P A;  3QT7 A;  1KNZ A;  3R5J B;  1PYO B;  3D4J A;  4CLW A;  3DLL Q;  4NYP A;  4ED4 A;  2E9R X;  4B08 A;  3B4D A;  2CAD A;  4L3K A;  5IM0 A;  2DXD A;  3I31 A;  4DL5 A;  3H5U A;  3MM8 B;  5C2G A;  1RTD B;  3R2D J;  2BW7 A;  1EHW A;  3P49 B;  3L95 X;  2V69 A;  1UVK A;  1ZBT A;  1RAH B;  1D8Z A;  1SV5 B;  1X4E A;  1XEZ A;  3KNA A;  3BH6 B;  3CDE A;  4E0D A;  2EKY A;  2HQI A;  4JI0 J;  4U8Y A;  2HVE A;  4DN9 A;  3MAH A;  5C25 B;  2VPZ B;  3N6N A;  2FZK B;  2UUW A;  5BYS A;  3LW5 C;  2G2Y A;  4CO4 A;  2KJW A;  4P9S A;  5JJB A;  1SV5 A;  5GMK a;  4DCP B;  4DQQ A;  2UUC F;  2HHP A;  5FD1 A;  1RLD A;  2GJ2 A;  2XCP A;  4DR4 J;  1IQZ A;  1SL2 A;  1QAI A;  3MFI A;  1KFS A;  2ZUA A;  5B0G A;  3NEK A;  1BE4 A;  4ZPD A;  2WSC C;  3FSX A;  1N0V C;  3LAN A;  4URG A;  2B51 A;  4DR2 F;  1KRP A;  3BGO P;  3NP5 A;  2LLZ A;  4OZL A;  3THT A;  4EBD A;  2DR5 A;  4JI1 F;  1U02 A;  1C2P A;  9ATC B;  2PI5 A;  1K0T A;  5B0C A;  3EWG A;  5J2N B;  3JAM U;  4J9R A;  4KSE B;  3PW5 A;  5HQ8 A;  2R7X A;  1PKU A;  2V0N A;  1Q8K A;  2ZC4 A;  1TFY A;  2LEP A;  2AJ1 A;  3KKF A;  2CKW A;  2VIC A;  4A8S A;  2M5Y A;  3MTK A;  1T7P A;  1Y00 A;  1XIQ A;  2UXC F;  4F02 A;  1TL7 A;  3DOK A;  2EC0 A;  1RHU B;  5LXR A;  2DNK A;  2NXE A;  2GML A;  3Q8P B;  2CNO B;  4DV5 F;  1P9Y A;  5BXI A;  2FHK A;  2YNF A;  5F41 A;  1JJ2 R;  1N56 A;  1X60 A;  4Y0F A;  3BEG B;  3J7Y I;  3QID A;  2LVW A;  4LBP A;  4DR7 J;  2YNI B;  5EN1 A;  4Z37 A;  2ZOF A;  2VG6 A;  3MM5 A;  2E44 A;  1IWA A;  3KFW X;  3I5C A;  2PII A;  1HNI A;  1WF1 A;  4MYT A;  3G6Y A;  4AQY F;  3U1L A;  1RKI A;  4RR5 A;  1RWV B;  1VBK A;  4KGM A;  2WRM A;  2VHG A;  3A12 A;  4YQW A;  4QWD A;  1Z4U A;  2E7X A;  5HVG A;  1YJW S;  3ZTO A;  1U2F A;  1Y5N B;  1VJQ A;  2GQC A;  3DHW C;  4V1A k;  4DN0 A;  3M8Z A;  3PRV A;  4R0J A;  5B7W A;  3EGV A;  3CUN A;  4X4O A;  3NMR A;  1U26 A;  3DLE A;  2B4V A;  3GR1 A;  3PYF A;  4ANC A;  1NB7 A;  1VQ5 S;  4KPC A;  4LSZ B;  3C3L A;  2F5G A;  2NXU A;  5LJ5 Y;  1RBO B;  2N7Y A;  2VC1 A;  1TMM A;  3R5B A;  4RU9 A;  4HLB A;  4YDD B;  3OXF A;  2ZH6 A;  2N82 B;  2OJ3 A;  1G1X A;  3L7O A;  3LTO A;  4WP3 A;  1JJ4 A;  1GMW A;  4ICL B;  2ZNZ A;  4E2F B;  2JSX A;  3HFV A;  3VV2 B;  2X7I A;  5DQH A;  3M6U A;  3SI8 A;  1RTI B;  4USJ C;  3KLH A;  1S49 A;  3KLF A;  2WVC A;  1IM6 A;  1RAI B;  2ZH1 A;  4C8N A;  4WIQ A;  4DV0 J;  2E5L J;  3K57 A;  2C42 A;  2LA4 A;  3NCQ A;  2XTJ P;  2Y1L B;  3UE2 A;  2XB2 D;  1V3Z A;  1NSA A;  4LF6 F;  2R7V A;  2OGU A;  4FXW A;  2DNZ A;  4AT1 B;  2O1P A;  4Z7Y A;  3P4U B;  4Y2I A;  4OI3 A;  4Y6I A;  5IC6 B;  3ICL A;  4KQZ A;  3HM9 A;  1VQN S;  3AD9 C;  4B9M A;  3CCE S;  3POT A;  4ALZ A;  2CYY A;  2DCU B;  3OTB A;  3TUI C;  4GKJ J;  1JLA A;  4LRB A;  3M32 A;  1M5P C;  4JI2 J;  1DLO B;  4DUT A;  4ILM A;  1TR0 A;  2WBM A;  3TZX A;  3QAT A;  4HDG A;  1JLF A;  3CGI A;  3IG1 A;  1OY8 A;  1NDC A;  3A8E A;  2MKY A;  4PQU B;  5I3P A;  4JI3 J;  3GFY A;  3CC2 S;  4RNM A;  3VTI A;  2CFX A;  2W2O P;  1PJ6 A;  4IKA A;  3QAU A;  3W8P A;  2DR9 A;  3PJW A;  1WEX A;  2HBR B;  4F4A A;  3QSY B;  2OUG A;  5DGB A;  5HQL A;  2NRE A;  4DV7 F;  3LAM A;  4C0B A;  1S59 A;  2AGO A;  3NGS A;  4K2X A;  4MAK A;  2MKI A;  1ZM4 A;  3K7R A;  3C6T B;  1N6Q B;  5ITH A;  3VAK A;  2V50 A;  5KT2 A;  1H7X A;  3ITH A;  1EX8 A;  1VK8 A;  2LP4 A;  3EXY A;  2ZH2 A;  3O2I A;  5LOQ A;  4DUZ F;  4DL2 A;  2BJ3 A;  1Z1Z A;  4L72 B;  1U6F A;  2JC0 A;  4K59 A;  1PCA A;  4M8L A;  4QYR A;  5B0E A;  4JUZ A;  1SKR A;  1SQG A;  2W4D A;  4HTJ A;  5KT5 A;  4CM2 A;  4YR3 A;  2CDQ A;  1UJ5 A;  5A8K A;  3CE8 A;  5H9F K;  1FX2 A;  1OSD A;  4ZVU B;  4ENO A;  2FYX A;  5E0O A;  4B3R F;  2AQ4 A;  4HVZ A;  5DRK A;  4RW6 B;  1FK9 A;  2DNP A;  4A46 A;  2MLZ A;  1YJR A;  4R25 A;  3KK2 A;  4FYY B;  4ILR A;  1T3O A;  3D6F B;  4OHV A;  1G6B A;  3TAR A;  3D1H A;  1BC6 A;  3ZXW A;  2ZJR Q;  4O4R A;  3ZTR A;  4JI0 F;  3IBC B;  4PG8 A;  4JI8 J;  1FNM A;  4F3M A;  2XLK A;  3CDA A;  3W5Y A;  5KAK A;  3SCJ E;  4U7C A;  4JI4 F;  1HA1 A;  5HVF A;  2HZA A;  3DXB A;  4P2X A;  2EWH A;  3G82 B;  3IBW A;  2C3P A;  4NZ0 A;  4DQS A;  4C8O A;  5BR8 F;  3HVT B;  1DAR A;  3P3D A;  4LBH A;  3MR5 A;  1HNX J;  1MNE A;  4ZJO A;  4B3M F;  5KFC A;  4WYW A;  2P9G A;  3OVS A;  5LM7 E;  4EWT A;  1IVZ A;  4P75 A;  2I8E A;  3NGD A;  5HBM A;  2IDE A;  2DR6 A;  2G1D A;  1VDH A;  2Z2L A;  4UUW A;  4F0M A;  2ZE2 B;  2BVZ A;  4E8U A;  5EHH A;  2MKC A;  8RUC A;  4DPY A;  2VBY A;  1W25 A;  4U6P A;  1UVI A;  3FGV A;  4ZLL A;  4M63 A;  1M5S A;  5A8R A;  2AX1 A;  2M8D B;  4C97 A;  1S9E A;  2O5D A;  3ZNU A;  4XK8 C;  4OX9 F;  1CEZ A;  1VIO A;  4WU3 A;  3FC9 A;  2Y8Y A;  1HBU A;  4KHP J;  1FD2 A;  1KR4 A;  2BE7 D;  2DYA A;  3H7H B;  4DX6 A;  1U47 A;  1Q5V A;  1RWX B;  4LF5 F;  4OV6 A;  2ZWO A;  2VFT A;  3KLG B;  2QA4 G;  4I6Y A;  4FKX A;  4RX6 A;  1FDD A;  5CD4 H;  3AH6 A;  3J7Z T;  4GC6 A;  1CJU A;  1KBR A;  4NI2 B;  4CNY A;  3OL9 A;  4J9O A;  1RTJ B;  3AXK A;  2IBK A;  1B0V A;  2MQO A;  5DDR C;  3FBC A;  4QWA A;  1RBL A;  1DRZ A;  4F26 A;  2YTC A;  3JSY A;  3CJ8 A;  3H8Y A;  4RKU C;  2LQ8 A;  1REG X;  5K9F A;  4WWS A;  4DPU A;  3K58 A;  3QZ8 A;  3CJT A;  1NK0 A;  1AFI A;  1JB0 C;  3MD1 A;  4OHY A;  3UCG A;  4N5S A;  4RBU A;  4OIX A;  3HFK A;  2W8K A;  4F8R A;  1RT4 B;  4R5P A;  1G3O A;  3KMS A;  1U1P A;  1NPP A;  3BSO A;  1CG2 A;  1U0H B;  2HGN A;  4TVA B;  3DRP A;  3JSR A;  5ETN A;  5HAO A;  2VQF F;  1UW4 A;  2B3T B;  2CPD A;  3A1Y G;  4C0O C;  4R5P B;  1TVR B;  3AY0 A;  5HMZ A;  4OYW A;  2R2S A;  3MMA B;  3AOA A;  5DG7 A;  2IFX A;  1MWZ A;  1NSK L;  2DIT A;  3AB2 B;  2CQ2 A;  2OSQ A;  2V6A A;  5GME A;  1BLU A;  2RDI A;  5AXN A;  3DCA A;  2W8L A;  3E01 A;  5K20 B;  2P2C B;  2W2P P;  4NLP A;  3N4W A;  1WC3 A;  2B4P A;  3I4H X;  4ANE A;  5I4M A;  4X4P A;  2KG1 A;  5D8H B;  1NSP A;  1WD6 A;  3EZU A;  2ZWP A;  2J8S A;  3DRP B;  2EK6 A;  2FJE B;  2RQM A;  2YWG A;  4F36 A;  1WSV A;  3BF4 A;  3VAI A;  3PW2 A;  1VQK S;  3HHL C;  3IS9 A;  4OX8 A;  4LF6 J;  1HYS A;  3MAQ A;  4RWW A;  2ALZ A;  2D7S A;  1YZ7 A;  5SZT A;  1YQH A;  1L3T A;  3CJ4 A;  3KJF B;  3HZG A;  4QPT A;  5KG1 A;  4LF9 F;  2N4C A;  5B0D A;  1JLB A;  1SCJ B;  5H9F J;  4YDX A;  2R7U A;  1R0A A;  3GZ7 A;  3E51 A;  3SMZ A;  3IXQ A;  4JI6 F;  1EAY C;  2D3U A;  3Q8V A;  3DN9 A;  2CRL A;  2Q6C A;  2WVE A;  5FDL B;  1M0S A;  2H5E A;  1KDN A;  1FRI A;  1REV B;  3S6E A;  2FVP A;  4WCE Q;  1SBR A;  2R8G A;  1U45 A;  3MCS A;  2BAC A;  3DI6 A;  5JVH Q;  2YVS A;  2IAJ B;  5A0Y B;  2XHW A;  2W4C A;  1T95 A;  2KYZ A;  3C14 B;  3H90 A;  1E6V A;  1X4C A;  3I0R B;  3KDO A;  2GZO A;  3MAA A;  4YB6 A;  2GQQ A;  3HT3 A;  1VQ6 S;  2AT1 B;  1P1L A;  5CYM A;  1RGV A;  3K5M A;  2CAJ A;  1U2C A;  3DLK B;  3FMW A;  5D0R A;  2KVI A;  2YKM B;  2V9W A;  3A13 A;  2C2K B;  3MEG A;  5KFH A;  1SUQ B;  4FPR A;  3BDE A;  5DG8 A;  1N54 B;  3B4M A;  1RT7 A;  4IOA Q;  2VFU A;  4KFB B;  4NLO A;  5JMN A;  1WKK A;  2DVI A;  3NNH A;  3M8Y A;  3MPY A;  3E2E A;  1UWB B;  3CCS S;  2XNR A;  1D0E A;  2LQ9 A;  3AT1 B;  4OI6 A;  5CCL A;  3DDI A;  3TI0 A;  2EI5 A;  5K8P A;  3PKM A;  2EEY A;  2VDH A;  1HWL A;  4QU6 A;  2CPZ A;  4PG7 A;  3CCV S;  1GXT A;  2GNK A;  4NWB A;  1GTH A;  4DR4 F;  5IFM A;  1WTB A;  2XZT B;  1T02 A;  1WHV A;  5EWF A;  1XN9 A;  4J9U E;  1WEL A;  5B0A A;  2HMI B;  4IUF A;  4TN2 A;  4LF4 F;  2DK2 A;  1P27 B;  2EG1 A;  2HWH A;  3MUR P;  4YB5 A;  2ZJP Q;  2BR0 A;  2K7J A;  5D4N A;  5G0R B;  1M1G A;  1F3V A;  1T94 A;  4BHQ A;  1TKT B;  1OPI A;  4XTT A;  1KHV A;  5HN0 A;  4EFA C;  3WX4 A;  2YH1 A;  4DV4 J;  4BC9 A;  3LO3 A;  3I6P A;  2J7W A;  3P5B P;  2M7S A;  2W9A A;  1ZA1 B;  2LQ5 A;  4C8L A;  2W24 A;  3V81 B;  6AT1 B;  2ZH5 A;  2W9C B;  2VPX B;  3DLE B;  4I68 A;  1UEK A;  4Z2X A;  3R1L A;  5I3Q A;  4C8Y A;  4DCO B;  5A8W A;  2DNH A;  2C3Y A;  4NCG B;  2W9B B;  3TR5 A;  2BDP A;  1FRL A;  4FBU A;  3CCT A;  4CT8 A;  1NKE A;  1PJ7 A;  2KKH A;  2RSQ A;  4WF9 Q;  3Q8S B;  3QFH A;  4H4M B;  3TAP A;  2FY1 A;  1V3R A;  2CPY A;  2H5J B;  3BKU A;  2M52 A;  3HCX A;  4ED2 A;  1URN A;  2GO9 A;  3MAA B;  5L1L A;  2C22 A;  1VRU B;  1IBL J;  5A8W B;  1M5K C;  4RW7 A;  2VG6 B;  3MM5 B;  5CH7 B;  3TAM B;  5SUH A;  4PQU A;  1XK8 A;  2ZC3 A;  4JYA J;  2E5I A;  3K89 A;  4JI5 F;  3CT9 A;  4KRW A;  4LF8 J;  1F2G A;  2GW8 A;  5HP1 B;  2A0F B;  1UW9 A;  1WC5 A;  5CZV A;  3CMA S;  3IGV A;  3NOC A;  1U1O A;  1IXK A;  1I51 B;  4PYD A;  4TY8 A;  4FS1 A;  5I3U A;  2YKN B;  1OQ3 A;  3QT8 A;  4IG0 A;  2CQC A;  4DEZ A;  5E7O B;  3C46 A;  1LWF B;  1FNX H;  2B4O A;  1I94 F;  1HBO B;  2NUH A;  4NEY A;  1HWJ A;  1S57 A;  3UD3 P;  2UUA F;  2X1B A;  3OBI A;  2VZ9 A;  3C15 B;  3QT5 A;  5HK4 A;  3M8Q A;  1ZAX A;  1V5I B;  3FQK A;  4ZOS A;  4PUO B;  1B64 A;  1FRH A;  3R1H A;  1X0F A;  2XCA A;  2GFF A;  3AB4 B;  4ZN1 A;  3QIP A;  4UY8 T;  2Y1R I;  2A10 A;  2CJ9 A;  1ZTW A;  1C1C B;  2MZJ A;  4C0H A;  5D4L A;  1NU4 A;  1S1V A;  2JX2 A;  3TUJ C;  1GEH A;  4DG1 B;  1FHT A;  3RJM B;  3BH7 B;  3UD5 A;  1LW0 B;  2RF2 A;  4JV0 A;  4C6A A;  1UKU A;  2KVQ E;  2KTQ A;  2NXJ A;  3SIP B;  1KLM A;  1OO0 B;  4TYA A;  2HNZ A;  3W9I A;  3K5L A;  2BQ3 A;  4QZV B;  2C2E A;  2IA6 A;  4LJM A;  4FZV A;  5J1N A;  3ZZP A;  1CJV B;  1CUL A;  2EXU A;  2ZBP A;  1FFS B;  1SIW B;  2CQI A;  3AA9 A;  2U1A A;  1FA0 A;  1SUQ A;  3M8P A;  1L5U A;  4PUO A;  2PMZ D;  4QPX A;  4WP8 A;  4ZIT A;  2I5J B;  2VDI A;  3D28 A;  1RWN B;  3OXG A;  5KFB A;  1N5V A;  1FRM A;  2E5H A;  4HKQ A;  1KON A;  3W2W B;  3ENQ A;  2AKW B;  1F9E B;  2DNQ A;  1DUR A;  1GX6 A;  1X4H A;  3DLG B;  3MED A;  4URQ U;  4WJB A;  5T7L A;  1TL4 A;  3HHD A;  3NXZ A;  2CPJ A;  3B6B A;  2DPJ A;  3PAC A;  3MCN A;  2IYG A;  5ETS A;  1O6X A;  4ZP7 A;  1JXL A;  3ET6 B;  4P71 A;  1FI4 A;  3VAH A;  2YPZ A;  4AD6 A;  4BC7 A;  1GMV A;  3TX8 A;  2R7R A;  4OLP A;  3MF5 A;  2H48 B;  3DM2 A;  4ZPB A;  2XM3 A;  2XMU A;  3IN5 A;  1VYA A;  4J7C A;  1HD0 A;  3NAH A;  2XMV A;  1QAX A;  3CCW A;  2B6A B;  3GPA A;  1R6V A;  5LSL A;  2J8A A;  4XPE A;  5DLF A;  3VGV A;  3BQ1 A;  4FNH A;  3D6M B;  3H20 A;  1QJH A;  2PEB A;  1ZPW X;  2HKE A;  2E29 A;  1B0T A;  5F0U A;  2F8M A;  1S1T A;  1S6Q A;  2L08 A;  4GRS A;  3UCU P;  1RLC L;  1F5B A;  1HQU B;  3BBB A;  3O3L A;  5ETL A;  3D3C J;  4LF7 J;  3HX9 A;  3CJQ A;  2E1P A;  4TLQ A;  1HLW A;  5A8R B;  1KHW A;  2IA0 A;  2LEA A;  2X3D A;  1I1G A;  1NJX A;  1VQS A;  1JX4 A;  1WDD A;  2A1B A;  4FXD A;  1AZS B;  3KG4 A;  5A6P A;  1UZH A;  1XNQ J;  4QCL A;  3EUN A;  3TZW A;  2WVD A;  4NLS A;  4ZJQ A;  1XMB A;  2VUG A;  3SZ2 A;  5C25 A;  4F3O A;  4DI6 A;  3C6T A;  1N6Q A;  3GIK A;  1RT3 A;  3JSM A;  1G2E A;  5AJ3 J;  3GP9 A;  1NKC A;  2M4M A;  4DS5 A;  1T03 A;  3EM1 A;  2E9T A;  1UVL A;  4IDK A;  1ROF A;  1Q78 A;  4HT5 A;  3EGN A;  2JDJ A;  4ZN3 A;  4IO9 Q;  4K5R A;  4M5D B;  3KHH A;  3ZZO A;  2M3D A;  3HSD A;  3TJA A;  2A6O A;  2NQP A;  1DJ0 A;  3Q86 A;  5I3U B;  4FN5 A;  1HAR A;  3W64 A;  1JLE A;  1P8G A;  4O23 A;  5C42 A;  3RRK A;  1WOS A;  4P2M A;  4UT4 A;  3CDU A;  2XO7 A;  2RUS A;  1O51 A;  3MGJ A;  1HNV A;  2XUL A;  3K0J A;  2HFO A;  2XWY A;  4MK8 A;  2CPE A;  2Y3Y A;  2ZE2 A;  3QAE A;  4CQ1 A;  3GV8 B;  4A8M P;  4F4K A;  1S4F A;  3HSZ A;  4IH7 A;  2CJB A;  3M2U A;  4OYX A;  5J2Q B;  1SC6 A;  1CBK A;  1UEU A;  4JBC A;  3T6J A;  3MZI A;  4EZ9 A;  1BGX T;  2RUG A;  4DR3 J;  3KJV B;  1U8W A;  2WZ1 A;  3G82 A;  4NML A;  1L3S A;  3H5X A;  1CJU B;  1R89 A;  1RT6 A;  2JWN A;  3OR2 B;  4NCG A;  4XPC A;  1HI0 P;  5KFF A;  4BS2 A;  4JV2 A;  1LQ9 A;  1X9S A;  2DNM A;  4N77 A;  2PD1 A;  5H1S V;  4RZR A;  3VAM A;  2E7V A;  2E1R A;  4EBE A;  3EZ5 A;  2HHU A;  4QJV A;  2VIH A;  1H2V Z;  1TL5 A;  1HBM B;  2HIQ A;  4K8R A;  3CDB A;  1T05 B;  1IKY A;  3N5F A;  3P5T L;  4ZA1 A;  2HAI A;  2OPP A;  4NRT A;  4URS A;  3AA8 A;  5A76 A;  1M1K T;  2R7T A;  1V9O A;  1X5T A;  3QQC D;  5J2Q A;  2JHE A;  3Q2T C;  1LXN A;  3MOJ B;  2HVZ A;  4K4Z A;  1RU2 A;  4OYI A;  1NND A;  2ZUG A;  1IBM J;  1SH3 A;  2Z4P A;  2HRY A;  4HT7 A;  1Q95 G;  2F40 A;  2RT3 A;  2VH7 A;  3I56 S;  1VBY A;  1HPZ B;  1T0T V;  5BYR A;  4LFC F;  2UXD F;  3CJ3 A;  1LKZ A;  2KHD A;  2VOO A;  3TWZ A;  4DXL A;  3T41 A;  5F3Z A;  1RWK B;  2AGQ A;  2VPW B;  4EGL A;  2QT7 A;  4BCA A;  4IR1 A;  1ZET A;  3G2X A;  3ENW A;  3PO4 A;  3R3T A;  5KFS A;  1Y3J A;  3DMJ B;  2G2Z A;  2RML A;  4EZ6 A;  1LW2 B;  5CYM B;  4KV8 A;  4OI4 A;  4B3S F;  4OL8 A;  4I69 A;  1HNW J;  2PMW A;  4C9D A;  1TL1 A;  1HNI B;  2YXL A;  2MJN A;  2ZBR A;  3H98 A;  4ZP8 A;  4PG5 A;  5KFR A;  4DX5 A;  7FDR A;  1JMT A;  3MR6 A;  3P6Y C;  1FJG F;  1LEO A;  4YHH F;  4I0W A;  4P73 A;  5B08 A;  2VG7 B;  3HVA A;  3H59 A;  1Y7P A;  4JI2 F;  1TTH B;  1HW8 A;  1G7C B;  2JNJ A;  4RNF A;  4DX8 H;  3OXL A;  1IUJ A;  3B82 A;  4LRF A;  2I6W A;  3KDN A;  1GQE A;  3BO3 A;  2KH9 A;  2WON B;  2BBE A;  3MPV A;  2DPI A;  3W2V B;  4F4X A;  4DR6 J;  1RAA B;  5EUH A;  4KC5 A;  1TAQ A;  1A7G E;  3EX7 B;  4YEA A;  3ENV A;  2ASL A;  4PWD B;  2HQG A;  4Q0B B;  4DUZ J;  4K4U A;  3L4B C;  1BQX A;  5KFN A;  2RAQ A;  3DI6 B;  3GG0 A;  1UP1 A;  3US5 A;  3VVU A;  2RDJ A;  5L1I A;  1HYS B;  2AYE A;  3CO0 P;  4GKJ F;  1HWI A;  2RHQ B;  2WB1 D;  3LOU A;  1S0N A;  2AYM A;  4QU7 A;  1WF0 A;  4Q2M A;  2ZKU A;  1TMJ A;  4NXM J;  2JEI A;  1IWG A;  4OZN A;  1Q5Y A;  1VGY A;  2ROG A;  2D1C A;  4XAK A;  4X84 A;  2CWK A;  3C66 A;  3DLH A;  2DCL A;  5B0B A;  5KFK A;  2DXE A;  2QLW A;  1BQM B;  4QIF A;  5CYQ A;  2O67 A;  4X64 F;  4M5M A;  4Q5V A;  4QOT A;  1UFW A;  3TA0 A;  3KHG A;  3OJU A;  2QYC A;  3N79 A;  1HBN A;  4NEZ A;  3M6X A;  4PWU A;  1RT7 B;  1BQN A;  2V34 A;  3CB4 A;  2VU5 A;  3DFE A;  3IR5 B;  1EQM A;  3MMA A;  5C42 B;  3EPG A;  2YQ3 A;  3M32 B;  2CJK A;  4LF9 J;  1KVI A;  2OFH X;  1S1W A;  5LMN J;  3L3C A;  3RB0 A;  5GAE U;  4UW2 A;  3HSJ A;  1B99 A;  4ECR A;  2GX8 A;  1LNQ A;  4WYL A;  4RNN A;  5FLX U;  2Z30 B;  3BDP A;  2VB6 A;  4DSJ A;  2DO0 A;  2LXU A;  4USI A;  4Q8F A;  2OEK A;  4G1P A;  3VHQ A;  3IRX A;  2APO A;  1EZZ B;  5GAE I;  1SIZ A;  3MEE B;  4X66 F;  3AD8 C;  4L6V 3;  4LRD A;  2RB7 A;  4KH0 B;  4ED1 A;  3KHR A;  3F41 A;  1X31 C;  4X4U A;  3R6L B;  4ED3 A;  2OSR A;  5KTQ A;  3OTO F;  3CME S;  2QEX S;  2ZFH A;  3OTO J;  3SXL A;  1YDL A;  2DHS A;  1RHR B;  3MMC B;  5J2M B;  4WFY A;  2W01 A;  2HWT A;  2R3V A;  3TNV A;  3WBZ A;  1FCA A;  2Q79 A;  3M4X A;  4ZVS B;  4LFA J;  3NCP A;  1S1V B;  2Z57 B;  3VZI A;  1BUX A;  4C7Q A;  2LEB A;  3PZP A;  2B8P A;  3PX0 A;  4UY8 5;  4PRF A;  4CO2 A;  1HI8 A;  4YUD A;  1MSW D;  4BDP A;  1FJE B;  3T9N A;  2GGP B;  4O44 B;  3TP2 A;  1N4L A;  3CCL S;  2ZHB A;  1EAR A;  3AFG A;  1V3S A;  3M8Q B;  3TRG A;  5U47 A;  1PAU B;  2GO8 A;  3IS9 B;  5MAO A;  5DDP C;  3CXC R;  1SQF A;  2LDY A;  4PXE A;  2HGL A;  2YKP A;  1XMQ J;  3CW2 C;  2G0J A;  3CJK A;  4YFU A;  1SJ3 P;  3OSN A;  3I9V 9;  1FKO B;  1RE1 B;  2M0G B;  3OJS A;  3KXD A;  1FEE A;  1Y5I B;  3FCV A;  4RNH A;  2YBV A;  4DL7 A;  4ED6 A;  2XNQ A;  4ZHR B;  1U1R A;  2CPI A;  3ET6 A;  4ELT A;  4DG1 A;  2LEC A;  1VRT A;  4QR2 A;  4QIE A;  4CLF A;  1VK3 A;  1RT5 A;  1SL0 A;  2F8E X;  4B3T F;  3O5T B;  2KRR A;  4LQ9 A;  1YRU A;  3QRR A;  3IBF B;  4PR6 A;  2PA8 D;  2W1B A;  3W5X A;  2PO4 A;  3AQO A;  3FSI A;  3L7P A;  2JLF A;  2QSW A;  2GIF A;  1AUD A;  4I4B A;  5LMU J;  1HHS A;  4DCJ B;  3EVO A;  1S1X B;  2UV8 A;  3NGR A;  1OWX A;  3W66 A;  1HR0 J;  1QSL A;  1WNE A;  2MPU A;  3QBC A;  3LPE A;  1S1W B;  3OL6 A;  2W9B A;  4CO1 A;  2QRR A;  2NYI A;  5HRO B;  1I3O B;  1OQ6 A;  3CDW A;  4USW A;  2OP5 A;  1MML A;  4CRJ A;  5KFQ A;  4TQR A;  1RKJ A;  2UUA J;  1MU2 B;  3GV5 B;  1N48 A;  1QLN A;  4W90 B;  4XDC A;  3TAN A;  1N5Y B;  4OMF G;  3CJR A;  4R0E A;  1IBL F;  5KFE A;  3PJX A;  1UVJ A;  1CLF A;  4RW7 B;  2DH8 A;  2V8H A;  3GIM A;  5E5N A;  4FYD A;  2EFO A;  4ZVT B;  5B09 A;  2XMM A;  1JLG A;  2CJY B;  1M5H A;  1VQO S;  4ZPA A;  1OYD A;  3C6U B;  1Q79 A;  3GYX B;  1HMV B;  2ILY A;  2RKI A;  1T9X A;  1IJE B;  4Y2A A;  2H1Y A;  4DZ6 A;  3PX4 A;  2UVW A;  2CUY A;  3CCR S;  3BGR B;  1HNW F;  4ECX A;  1K1S A;  3SDE A;  4LR7 A;  2VQF J;  1A6L A;  1IKW A;  4Q43 A;  1N36 J;  1BWE A;  3C15 A;  5EWE A;  4YY3 F;  4TYB A;  5KFW A;  1QSS A;  2MGZ A;  2XLI A;  1H73 A;  2K7K A;  3AOC A;  4O0N A;  4LSL A;  4Q7A A;  1NK4 A;  1MW7 A;  2PA3 A;  2DNN A;  3ZZU A;  5ETR A;  1YRT A;  5L1J A;  1KLN A;  3QGI A;  1ACM B;  4K0K J;  3JTP A;  2ERR A;  1JLC A;  1NK9 A;  4J9L A;  3RRH A;  2DR8 A;  2V2K A;  3PEJ A;  1U1L A;  4O3S A;  2XS5 A;  4J9K A;  3IP0 A;  1IKY B;  4NLU A;  3Q0A A;  2JVO A;  1FO1 A;  2QTW A;  5JXS A;  5CAB A;  3V6D A;  2R8K A;  1PIL A;  1Y4Z B;  2D9O A;  4ETZ A;  2XI2 A;  2W2N P;  2BJE A;  4HAC B;  1N52 B;  2KT2 A;  1NZ8 A;  2C3U A;  3W62 A;  3TAM A;  4X65 F;  3RB4 A;  1IQT A;  2NSC A;  4FP9 A;  3OUY A;  4X4N A;  1U1K A;  1RT6 B;  2H5I B;  2IM1 A;  3OR2 A;  4NLW A;  2UUC J;  1U0S A;  2V63 A;  4U96 A;  2BEF A;  1ITP A;  3DRS A;  3HP6 A;  2X1G A;  1H38 A;  4HH0 A;  2HGM A;  2KL8 A;  4RL1 A;  2KJV A;  2ZIT A;  4CLZ A;  1N5T A;  2YWE A;  2LKZ A;  4H4O B;  2YKQ A;  3GTY X;  5D77 A;  4ETX A;  1X8D A;  2BQR A;  4F2S A;  3PRB A;  3PFO A;  2XMK A;  4O4G A;  5F8J A;  3MTJ A;  3ISZ A;  1REV A;  4TKT A;  2IIH A;  5KFG A;  3W8G A;  5JVG Q;  2F4V F;  1QUP A;  3UO0 A;  1WC1 A;  4ICL A;  1PYT A;  3AJ2 A;  3I5A A;  1PO6 A;  5T41 A;  4ED0 A;  3QZ7 A;  3I82 A;  3TUZ C;  1JLB B;  2J9D E;  2OLW A;  3LP1 A;  2XHC A;  2B7B B;  5L46 A;  3O44 A;  1VQL S;  1K0V A;  1RT3 B;  4J9S A;  3N6L A;  2J6S A;  3RUB L;  5L9X A;  1UPM B;  2ZJQ Q;  4LFB F;  2GHP A;  2G13 A;  2KO1 A;  2VL1 A;  1PC4 A;  3DHX A;  4I7F B;  3HF5 A;  2KXH A;  2JRS A;  1HMV A;  3PNI A;  1X5S A;  3D2W A;  3UDE A;  1X4B A;  4G3I A;  4ES3 A;  5AJ3 F;  3PIO Q;  1R0B G;  3C19 A;  2L48 A;  4CTA B;  3PJ9 A;  4JI8 F;  1EB0 A;  5E3Q A;  2MB0 B;  1XNQ F;  1S6Q B;  3EXC X;  1DQA A;  5DZ7 A;  2AJ4 A;  3ADA C;  3HZE A;  1T9W A;  3OR1 B;  1S79 A;  2CQ0 A;  5K14 B;  4B9S A;  3DRR B;  4N7T A;  4M95 A;  2KT3 A;  2GAH C;  3NBP A;  4PYA A;  3BO2 A;  4PPZ A;  4LF7 F;  3GYG A;  1CPZ A;  3BGR A;  4M5J A;  3RBD A;  2COL A;  4GVB B;  2HHQ A;  3OSP A;  1XMO J;  2WCX A;  2OEM A;  5IV3 A;  4KKO A;  4UST A;  1B70 B;  4IFV A;  2I38 A;  2MMY A;  3QRP A;  1VQM S;  1R8C A;  1UWA A;  3LA0 A;  3M7V A;  4CLP A;  3D7S B;  3I87 A;  1CC8 A;  1Y11 A;  3E8O A;  3LGN A;  4MK7 A;  4WKR A;  3IAM 9;  3HKW A;  2R7S A;  2MHN A;  3GB0 A;  4NXM F;  2KHC A;  1YRX A;  2AEF A;  2LQB A;  5DQI A;  1MMN A;  2WW4 A;  2MKS A;  4O3O A;  4EK2 A;  3TAQ A;  2ZM6 J;  3A3N B;  2FJA B;  3NG8 A;  3B54 A;  4M5I A;  5DDQ C;  3CCU S;  3BM7 A;  4C11 B;  4ZHR A;  5KT3 A;  1S0M A;  4C8Z A;  4K4V A;  3FUY A;  4DV7 J;  2ZOM A;  3IC1 A;  5KFU A;  1Q8L A;  4CLT A;  3IR6 B;  3O6Q A;  4CLU A;  2NYH A;  1A9N B;  4YR2 A;  1RTJ A;  1U0H A;  4ZP9 A;  4DUY F;  2BKP A;  3JTN A;  4PKD B;  2VKZ G;  3K5O A;  3MM7 B;  2EK1 A;  4PWW A;  5HVH A;  1GFW B;  3G8Q A;  1B4S A;  2J7K A;  3GR0 A;  1WC6 A;  4RUC A;  3FZ2 A;  3VQS A;  4UQG A;  4QWC A;  4I2Q B;  2R9L A;  1FKA F;  1CUL B;  4CLL A;  1WOO A;  3ZTQ A;  4C48 A;  1D09 B;  1VLY A;  2ZDO A;  4LR9 A;  4NPO A;  4AXI A;  4DSL A;  1WEY A;  4Q44 A;  3N01 A;  1RT1 A;  1WJ9 A;  3CC7 S;  2V9K A;  2MQP A;  4P74 A;  2XWX A;  4TXS A;  4DR1 F;  2BXJ A;  2EFG A;  2NLW A;  3FFI B;  3R5A A;  4X64 J;  3ZC4 A;  3DGV A;  1S5Z A;  3FBB A;  4KE5 A;  4CDI A;  2CZ4 A;  2YNF B;  4L74 A;  4FF2 A;  3MHY A;  1WHX A;  1TVR A;  1Q8B A;  4L73 A;  2W4P A;  4UOG A;  3H25 A;  4DV6 J;  2FJX A;  3WHI A;  4CZC A;  2K1R B;  4NAS A;  2IJR A;  5IWA F;  2UXD J;  4PXD A;  1VS3 A;  2XSF A;  1KP6 A;  1RTD A;  4B9V A;  2CVE A;  2KT5 A;  2EFQ A;  4TY8 B;  1XMO F;  4C11 A;  2HRU A;  5CHC B;  3RBX A;  2ACY A;  2J0X A;  4Q45 A;  4WK1 A;  1NKB A;  3QO9 A;  2EW9 A;  3KK1 A;  3KYL A;  4OHZ A;  3NL0 A;  1U1N A;  3PYD A;  3SCL E;  2CQG A;  3MEE A;  3ZZZ A;  2XMA A;  1N5S A;  2ZHO A;  3W7B A;  1SC4 B;  3GIJ A;  5FLX Y;  2FZG B;  2HQD A;  4MJK A;  2P9E A;  3CCZ A;  4OZJ A;  5C2C A;  3PM9 A;  2VQE F;  2R2T A;  2FVR A;  4EU0 A;  5K8M A;  3G96 A;  4DOZ A;  1FXL A;  1FKP B;  1KKH A;  2H51 B;  2P8I A;  4H54 A;  3UDL A;  3VQT A;  3PIP Q;  4ECV A;  4EBC A;  2WHO A;  2F4F A;  5KFZ A;  3THP A;  3WDO A;  2RE1 A;  2YWK A;  1S6O A;  4DU8 A;  3OUY B;  2BW2 A;  2E9Z A;  2X1F A;  2EC2 A;  4KYZ A;  3CD7 A;  3OTD A;  4PZV A;  2V94 A;  1BY9 A;  1FWP A;  4B17 A;  4ZLJ A;  4WXO A;  5LSO A;  3IR7 B;  3GIL A;  5T14 A;  4ELU A;  2FC9 A;  3IM9 A;  3HK2 A;  2RJZ A;  1HD1 A;  4Q2L A;  4J9N A;  2HSE B;  2YX7 A;  4IOB A;  2KYX A;  2QO3 A;  3FBE A;  4RLE A;  1TKZ B;  3RBZ A;  2XS2 A;  3HI9 A;  4DV3 J;  1KS2 A;  1UFL A;  3MM8 A;  5DGA A;  1SKU B;  2GS8 A;  2WW8 A;  2RU9 A;  3I55 S;  4M5H A;  3DU6 A;  2QMW A;  4LSL B;  4G1I A;  1IBM F;  2RHS B;  2HQC A;  1CJT B;  4L75 A;  1TK5 A;  1YJU A;  3LP2 A;  4B3R J;  4M1K A;  4ELV A;  1HHT P;  2KZM A;  2CJX B;  2CQ1 A;  2VFS A;  3DGP A;  3IGN A;  2AP6 A;  2IRX A;  2N4D A;  5CZX A;  2GIR A;  4OJG A;  2BMB A;  3SFU A;  1YJN S;  4WU2 A;  2OPR B;  1FRK A;  2BA9 A;  2UXB J;  1FVQ A;  3T1Y F;  4KT0 C;  4IO1 A;  1NCL A;  2Z58 B;  1FFW B;  3W60 A;  1YGY A;  1YK9 A;  3GON A;  4MKA A;  1CJK A;  1NEE A;  2BV3 A;  2FJD B;  1N5Y A;  2OPQ B;  1NK7 A;  2DEJ A;  2ASD A;  1DFD A;  2HRT A;  5GAG U;  4CO3 A;  2KXN B;  3KK3 B;  1DLO A;  3JSB A;  3GE9 A;  1DTQ A;  1E6Y A;  3K59 A;  2XY5 A;  2MY7 A;  2GVZ A;  3NWG A;  2WVB A;  2XC9 A;  2X1A A;  2QA1 A;  2OPP B;  1LW2 A;  2MY8 A;  2NPI A;  1S1X A;  2OEL A;  3D6T B;  3M8W A;  1YBU A;  3O8W A;  3R5C A;  4ZVF A;  5G0R A;  4CO0 A;  2QL5 B;  4Y2M A;  1RA7 A;  3T1H F;  5D15 A;  1APS A;  3QRQ A;  2F3J A;  1RAC B;  3P8B B;  2KFZ A;  3J7A 1;  5KFX A;  1R27 B;  4OZ1 A;  4ZVR B;  4F0K A;  3G87 A;  2FUG 9;  1XWL A;  2DHA A;  3LAK A;  1LWC A;  1VHI A;  5D4O A;  3IWL A;  5AT1 B;  5IQQ A;  1KQF B;  1YI2 S;  1N36 F;  4OX6 A;  3DKD A;  2RKI B;  1HQ2 A;  3LP1 B;  2R2R A;  3SFG A;  9RUB A;  2V4J B;  3DOL A;  3M2R A;  2H3E B;  5GAD U;  2WOM B;  2Y9H A;  4IR9 A;  2DY9 A;  1NAQ A;  1LK7 A;  1JLG B;  4C3M A;  1LV5 A;  3FEZ A;  2BAN B;  1O0P A;  1WG5 A;  1UAW A;  1GTE A;  2CQP A;  1S9G B;  3H40 A;  1W7W A;  1I5O B;  2QZ8 A;  5D4P A;  2MKH A;  3AOD A;  5E3P A;  1WHW A;  2RQC A;  5KOW A;  4OI2 A;  3BR9 A;  1Q16 B;  3IG1 B;  3GFH A;  4LF2 A;  3V6K A;  4DS4 A;  1FT8 A;  4USH A;  2G0C A;  2HBZ B;  1VQ7 S;  3SDE B;  4H4O A;  1QVG R;  1B3T A;  1PJ5 A;  1FRX A;  2FHO B;  4WFZ A;  3BQ2 A;  4DL4 A;  2B5J A;  2RQ4 A;  3BBC A;  4DPW A;  3CD5 A;  3DYA A;  4DPX A;  4NZ6 A;  1RUS A;  4ZJL A;  1WSR A;  4H4K C;  1S12 A;  1DTT B;  5IQ6 A;  2C2D A;  3U1N A;  3GJS B;  1FVS A;  4ZVE A;  3M05 A;  4O3N A;  3MOZ A;  3LF0 A;  4LR8 A;  1ZAV A;  1YWX A;  2BJ7 A;  3AJ1 A;  4J5O A;  1NHU A;  1WC0 A;  3L7U A;  3NY0 A;  5J1E B;  1MLA A;  2BJ9 A;  2XQC A;  1MWY A;  2GAG C;  3NRB A;  5ETV A;  1DAX A;  1X4A A;  3Q8Q B;  4AQY J;  1H2U X;  3BGF A;  4F2R A;  4IH6 A;  2HFU A;  2DNO A;  3VAF A;  5L38 A;  3B78 A;  5DET A;  5FJ4 A;  5MLC V;  1S4E A;  3AXM A;  4FYX B;  3OHB A;  3KUH A;  3EYZ A;  2FVQ A;  5A2Q U;  4MFB A;  1C0T B;  3I96 A;  3BYP A;  4X4V A;  4YS2 A;  4RUH A;  2QIF A;  3HHL B;  2CQB A;  2IY5 B;  2EG2 A;  3TJ9 A;  4ECZ A;  1UVM A;  1Z2L A;  5B0F A;  1HBN B;  3EVW A;  1T9V A;  3M30 B;  2FHM A;  1NRK A;  2I0X A;  4Y2C A;  4EEY A;  3J81 j;  5GVQ A;  3K5P A;  3PW4 A;  2FJV A;  4MKB A;  1TK8 A;  4FYW B;  3F0N A;  5KFI A;  4DJB A;  1VQ9 S;  2ATL A;  4IYQ A;  3VZH A;  1EP4 B;  1FJG J;  5HAN A;  2ZVS A;  3KMQ A;  4PXC A;  2CQ4 A;  2PN6 A;  4IQX A;  1ZOT A;  4W92 B;  1YJ7 A;  4ECY A;  3UDV A;  5C5J A;  3MM6 A;  3MCO A;  3MR7 A;  4LVO P;  1VQ4 S;  3G8T A;  1S6P A;  1YG0 A;  5E33 A;  1FD8 A;  1MG7 A;  1RCX B;  5AE3 A;  1FES A;  5E3A A;  4CNZ A;  2MKK A;  4OX7 A;  4DX7 A;  3TZY A;  4PWD A;  2HS4 A;  1U24 A;  1P9Q C;  2FY8 A;  4NCA A;  2NUU G;  1KQS R;  2H65 B;  3LQV A;  1YIJ S;  3MXH P;  6FD1 A;  1RQ0 A;  1YLX A;  2B4U A;  3CD0 A;  3BB5 A;  2CPF A;  2KU7 A;  2WAQ D;  4OJH A;  4NYZ A;  4BWM A;  2MTL A;  2HQF A;  4X2B A;  3K17 A;  4I2P A;  4P6Q A;  1UCN A;  2GV1 A;  1D9F A;  3M9N B;  4ZP6 A;  1RZM A;  5LL6 d;  1JLQ A;  3HPO A;  4OZ5 A;  2QJ3 A;  3J7Z 5;  3H5Y A;  1EET B;  1Q7L B;  2FDN A;  3UCZ P;  4WKY A;  1NJW A;  3KLI A;  3W63 A;  2YQ0 A;  3Q8R B;  5M2P A;  2MLX A;  4KGZ B;  5CYQ B;  3PYE A;  1KOH A;  2BJD A;  5KG6 A;  1YJV A;  1KFD A;  2IMO A;  2C2N A;  3C16 A;  1LW0 A;  2GJI A;  2LCW A;  1GH8 A;  2AEJ A;  2MKJ A;  4HR2 A;  5HAT A;  2R8I A;  1U49 A;  2FLN A;  4PXB A;  4ERD A;  3RU0 A;  1WOR A;  2SXL A;  5F9L A;  4ED5 A;  1FXR A;  4WP9 A;  1Q0N A;  3TVY A;  2N3O A;  4F50 A;  3GFZ A;  2AHO B;  4KGX B;  3BPS P;  4FKY A;  4A48 A;  1RBA A;  4DSF A;  1F5C A;  3NBP B;  2E7W A;  3C8Y A;  5BR8 J;  3CMQ A;  3J80 U;  4B3M J;  1GMW D;  2BE2 B;  3LP0 B;  4S0M A;  2RS2 A;  3IO1 A;  3M6W A;  1RTH A;  2IC3 B;  4RW9 B;  3HXM A;  3G9C A;  2HYI B;  1KTV A;  3GLJ A;  4NE9 C;  2VV5 A;  4FF3 A;  4NMX A;  3GU0 A;  2D74 B;  1RIS A;  5CAA A;  3VAL A;  2RF2 B;  3A8K A;  4CTA A;  2IVY A;  4USK A;  3VCD A;  3IRW P;  5IS2 A;  1RXO B;  3S7R A;  3GFX A;  1ULR A;  1T3N A;  2HFV A;  2DH9 A;  1ZAW A;  2YNH A;  4DR2 J;  5I42 B;  3RAQ A;  4MYU A;  1KVK A;  4DV4 F;  4M5K A;  5IWA J;  4CWB A;  4AYB D;  2ZH4 A;  2CQ3 A;  3JB9 k;  5HQM A;  3AD7 C;  4DV6 F;  1F9F A;  4JI4 J;  1R6Y A;  1WG4 A;  1HQE B;  3RGI A;  3PEH A;  1VCT A;  2MDA A;  4K7Q A;  2BRL A;  3UVJ A;  4B3T J;  3BN4 A;  1RU1 A;  5GAG I;  3OL8 A;  4GVB A;  3M2U B;  2YX4 A;  1PIE A;  5HJY A;  5HMX A;  4JI6 J;  1KEK A;  4K4S A;  4A8W A;  1O5J A;  3FVY A;  4X65 J;  1URR A;  4RBT A;  1O8B A;  2GHW A;  1AA1 B;  4HHJ A;  5D6G A;  2KM8 B;  1S9G A;  3TYT A;  2HFZ A;  4NZ7 A;  2HS0 A;  3JQJ A;  3F73 A;  1DY3 A;  2XZD B;  4O3Q A;  4J9M A;  1RHM B;  1TKT A;  4Y00 A;  2HW3 A;  2UU9 J;  1HBM A;  1T05 A;  1T03 B;  3ETO A;  3PW7 A;  5EGY A;  2R7Q A;  4ED7 A;  2MGZ B;  3BYR A;  4DUY J;  3V4M A;  2OHD A;  4YOE A;  3D6H B;  3EDQ B;  4KIA A;  2DXF A;  4ZS6 A;  5ETT A;  5KG0 A;  1HW9 A;  2B43 A;  4CYU B;  3ZO7 A;  3NGK A;  1BD6 A;  4CM0 A;  3BSN A;  3HO1 A;  4OI0 A;  5EX0 A;  3RZA A;  2AYG A;  2HLT A;  1CSJ A;  1LXJ A;  4KGK A;  3M8R A;  2MZR A;  4DWI A;  5LJ3 Y;  3GCX P;  2PSZ A;  2DGO A;  1JJC B;  2C2O B;  2G4B A;  1GXL A;  4NLX A;  2IJF A;  2AF6 A;  1HQU A;  1TQL A;  2L3M A;  3SCI E;  2DIU A;  3ZZY A;  1TKZ A;  2AMC B;  2VG5 A;  3BGU A;  1SC1 B;  3KK3 A;  4Y3C A;  3ZTP A;  2B9Y A;  2BKN A;  3MEC A;  3I9Z A;  3OVB A;  1L3K A;  4M5L A;  2HK2 A;  3ILJ A;  2NS1 B;  1WI6 A;  3RBE A;  3CVK A;  2HMI A;  2B0G A;  1NXI A;  2GGP A;  2OO4 A;  2LMI A;  1SPB P;  2LXF A;  3DNC A;  1FEH A;  4HTI A;  5HI7 A;  3V6J A;  3BO4 A;  3PV8 A;  5E41 A;  3MI7 X;  4OJ1 A;  2Y0B B;  3DM2 B;  1K44 A;  2HND B;  2UZA A;  4OYZ A;  1R0C B;  2BKO A;  4IDK B;  2IHR 1;  5C7P A;  4F67 A;  1IR2 A;  1C4C A;  5D0G A;  3ZZR A;  1X9M A;  2VAS A;  1ZS6 A;  1DHM A;  2DHH A;  1ZA2 B;  4U8V A;  3HJF A;  1RJJ A;  3NNA A;  3EPI A;  3HFZ B;  5IZH A;  3RW6 A;  2DKO B;  1MRO A;  3DRY A;  3D68 A;  3EIC A;  3WIU A;  1CJT A;  1NM2 A;  2OML A;  3H0P A;  4QIV A;  1HNV B;  5G4D A;  4O3P A;  2W7O A;  1SJ4 P;  2JEF A;  2JEJ A;  2EKN A;  4LVN P;  3J80 Y;  3FFI A;  2FVS A;  1CS4 A;  1HWU A;  2V8D A;  1SQE A;  2QFJ A;  5D3G B;  1IBK F;  4Y65 A;  1TL7 B;  3DOK B;  2FQQ B;  3ETM A;  4GMK A;  4HL9 A;  2MQ8 A;  3TA1 A;  1TUG B;  2HK3 A;  3TA2 A;  1K1Q A;  2VBW A;  2ZVI A;  1LWX A;  3KJN B;  4RW8 B;  2DJW A;  3EMT A;  4J9V A;  1S0V A;  1AB8 A;  1XMQ F;  4DMZ A;  2QV6 A;  2E1C A;  2GHV C;  4WII A;  2HBQ B;  1UL3 A;  2MXY A;  1N88 A;  3RAM A;  2QLF B;  2Z2Y B;  3MM7 A;  4KO0 A;  4QWB A;  1JK9 B;  2J6U A;  3KJV A;  3A8J A;  1KN6 A;  1Q53 A;  1F6T A;  2CPH A;  2NXC A;  3ILI A;  5AXL A;  5BJR A;  3MFH A;  3PR5 B;  1M5V C;  3CJ0 A;  4ITS A;  3UDC A;  2OAU A;  3C16 B;  1NZA A;  2PGC A;  4I6A A;  1FKO A;  3N28 A;  1S6U A;  4PAA A;  1VC5 A;  2YWF A;  1TKD A;  4KY3 A;  2Y0S D;  2UP1 A;  1NH7 A;  1NHV A;  2GQ2 A;  4IG3 A;  3NGU A;  4MH8 A;  2YY3 A;  3MR2 A;  2FZC B;  2OI2 A;  5GMD A;  3PTW A;  3UW1 A;  2BJ1 A;  4EO8 A;  2AD9 A;  2EFV A;  5T7L B;  2VA2 A;  2ZZM A;  4MIA A;  4U67 Q;  1NJY A;  2CQD A;  3T19 A;  2J0Q D;  1U8S A;  4LIW A;  2PMH A;  4CP5 A;  3D9B A;  1RI7 A;  1SVD A;  1XR6 A;  4N47 A;  4LRA A;  1GXU A;  2GVD A;  4JV1 A;  2BM0 A;  4G65 A;  2CJQ A;  1M5O C;  4YB1 P;  4L76 A;  2H9Z A;  2YPY A;  1NDP A;  3JSM B;  1UA1 A;  2V67 A;  1S1U A;  4YME A;  4ECQ A;  4TQS A;  5GAD I;  3N9U C;  4M5N A;  3MEK A;  5J2N A;  4F4Z A;  1I94 J;  1AZS A;  4YN3 B;  1TL3 B;  1TKX A;  2LDI A;  1BQM A;  2FIU A;  3A4T A;  2BRK A;  1XTZ A;  2IJN A;  3GG1 A;  3R7B B;  5KG7 A;  2I9S A;  4M5G A;  4A8O A;  3VGT A;  4RUB A;  2L9D A;  2VFV A;  3QSI A;  2DTJ A;  1IR0 A;  1F3F A;  3SCK E;  3NGT A;  4DR3 F;  3T3F A;  1JXE A;  2AV5 A;  3SV3 A;  1K73 T;  4CO5 A;  3M30 A;  3W5Z A;  1H7W A;  1RTZ A;  3UNY A;  4Q0B A;  4BWJ A;  1QTN B;  4K5S A;  2RD5 C;  4X4S A;  2YKA A;  3D1O A;  4ZVP B;  4JI3 F;  1N34 F;  5K14 A;  4AUK A;  1J5O B;  1NO8 A;  1IR1 A;  1RCO B;  1W26 A;  1WI8 A;  4NL5 A;  4WXW A;  3M1V B;  3MPW A;  1JIH A;  1KLM B;  1RAG B;  4ES2 A;  2A2D A;  3HLU A;  4ES1 A;  1Y0H A;  1H2T Z;  2YKN A;  1TZ0 A;  3N0V A;  5J2M A;  2BM1 A;  5D3G A;  4LF1 A;  4NLV A;  1L3U A;  1Y3K A;  4A8Y A;  1FDA A;  4WZM A;  4L3N A;  1U2R A;  4DL0 C;  2XBP A;  1VR6 A;  3T9Z A;  3EZO A;  5GAH U;  1R8H A;  2XLJ A;  2J6T A;  4P52 A;  2M9K A;  3PCO B;  2ZKT A;  4DHV A;  1N8R T;  3BGL A;  3DLG A;  3MED B;  3U1M A;  2NR0 A;  3TJ8 A;  4J37 A;  2C2R A;  1VC6 A;  2QSF A;  1KD1 T;  2IPO B;  2JH3 A;  3IWN C;  5CXT A;  4HI1 A;  2UUT A;  2DNY A;  4K4X A;  1H3D A;  4USM A;  4NXN F;  1RYS A;  2FLL A;  2EBE A;  2I5J A;  3D5M A;  2CZ9 A;  3GJQ B;  3PR4 A;  1W2B R;  4AL7 A;  1UWB A;  4I64 A;  4OJ3 A;  5HP1 A;  2ABY A;  1TAU A;  3G71 S;  3A3O B;  3KK2 B;  1CJK B;  3SQG A;  2ACM A;  1JLE B;  2VG5 B;  2YNG A;  3OL7 A;  3FBF A;  5IT4 A;  4OYB A;  2ZDP A;  1IKV A;  2Y1J A;  2AZ3 A;  1S0O A;  1FER A;  3GMG A;  4YR0 A;  2OPR A;  2W2M P;  2XY7 A;  3HKZ D;  2YWH A;  2K2P A;  4KTQ A;  4K0K F;  2HNY A;  2HWI A;  5K8N A;  4V19 X;  1QAY A;  2OMO A;  4LSN A;  3NKY A;  2P9C A;  5F8L A;  2AX0 A;  2F8H A;  4C8M A;  4NA1 A;  4OZ2 A;  3ITH B;  4NA3 A;  4RW4 A;  2OD4 A;  3LP2 B;  1JJH A;  3DOM A;  1HPZ A;  1W2I A;  3S1T A;  1SKW A;  5KG4 A;  2AZ1 A;  5J2P A;  1RT2 B;  3OLA A;  3NMA A;  1FXD A;  1T9U A;  2RVJ A;  3KLF B;  2XS7 A;  3ISN C;  4RU2 A;  1RDR A;  2BOP A;  2R4F A;  2KRB A;  4GO7 X;  1IKV B;  4TNO A;  4RNO A;  1S1T B;  1K47 A;  2IC3 A;  4RW9 A;  5BYQ A;  2RH3 A;  3FDS A;  3IFE A;  3HUL A;  4ZCM A;  5J2P B;  3BQ0 A;  2J9D A;  1C0U A;  3W65 A;  3TZZ A;  3J7A N;  4KFB A;  3M9M B;  2YWW A;  2OPQ A;  5KFA A;  1LFP A;  2XO6 A;  2DRD A;  1RAE B;  4WK3 A;  2B9X A;  4WFA Q;  3TX0 A;  4B3O A;  3GWC A;  2L9W A;  1WHY A;  2DNL A;  1KSP A;  3WX8 A;  1DQ8 A;  2Z0G A;  3OT9 A;  3J81 U;  2LU2 A;  2GA7 A;  3LUY A;  2VFR A;  2YNG B;  3JYT B;  3OTE A;  3CJ5 A;  2IMW P;  2XG8 A;  1QD1 A;  1XJW B;  2FGO A;  1Q82 T;  2CPX A;  2ZH8 A;  1Q81 T;  3TEH B;  3FRZ A;  2OH2 A;  1F60 B;  1FTR A;  1MU2 A;  3UPF A;  3E3X A;  4UUX A;  5KFD A;  3PX6 A;  2Q3P A;  4ZVG A;  3MMB A;  4C8K A;  2ADC A;  4DU7 A;  1R8B A;  4O0I A;  3QJL A;  2ZOG A;  1VBX A;  3VF0 B;  3UWT A;  1ZH5 A;  1RAJ A;  2F63 A;  4RPF A;  5L8R C;  4DR7 F;  1X4D A;  1PBA A;  2GVD B;  1U6Z A;  2IM0 A;  2HLU A;  2DT9 A;  4EMD A;  3UN2 A;  4NLQ A;  1LWE B;  4FDF A;  1WOP A;  3KG1 A;  3RR8 A;  2KZZ A;  3RB6 A;  2E5J A;  1NLK L;  2JLE A;  2DGV A;  3Q83 A;  4GVL A;  1B7Y B;  5CCM A;  5A0Y A;  2B9W A;  4DQI A;  4DLE A;  2OIH A;  2J9E A;  4HHU A;  2V8G A;  4N41 A;  5E2Q A;  4LFB J;  4ZIW A;  5F8N A;  5KFV A;  3CUL A;  3C6U A;  1VFJ A;  1ZM9 A;  4CIO A;  1ZTT A;  5CYJ A;  1YBT A;  2HNZ B;  3I0S B;  3UN3 A;  4YP3 A;  2L41 A;  2KM8 C;  5KT7 A;  4DFP A;  4GKK F;  3EVM A;  1RHK B;  3LWL A;  1VLO A;  2DNG A;  4UF4 A;  2F1F A;  1R0A B;  4R8U A;  2XYP B;  1AYE A;  3HMJ G;  3FQL A;  3CJK B;  4MMO A;  3VWS A;  3DLJ A;  1VOM A;  2CXE A;  4UOH A;  1OS5 A;  4WPA A;  2IVM A;  2JZ5 A;  3NS7 B;  5EX3 A;  3SYZ A;  3TVZ A;  2ROE A;  3NS5 A;  1G4C A;  4AL5 A;  5HRO A;  2HHS A;  3ZTS A;  5KFT A;  2J7U A;  2NXN A;  3VVT A;  2VBZ A;  3IWX A;  5A2Q Y;  4CCH A;  4DR6 F;  2CQH A;  5EWG A;  2BZ2 A;  4DPT A;  4LRC A;  1TUW A;  4A8Q A;  4WE1 B;  1FJC A;  3R8Y A;  2FHJ A;  4C98 A;  1OY9 A;  4LF5 J;  2ZD1 A;  5F9N A;  5DG9 A;  4HYK A;  2NSB A;  3ONQ A;  1EKR A;  3KTQ A;  4QYZ J;  4DSE A;  2A6M A;  2OKQ A;  3U02 A;  3T5H A;  3NWR A;  1ARO P;  4FPI A;  3R9L A;  2O66 A;  2GMH A;  4AL6 A;  5C24 A;  1MRO B;  3Q2S C;  2AJ2 A;  2POK A;  4OX9 J;  1NME B;  1S1U B;  4R8U B;  2ZD1 B;  2FLP A;  4B9N A;  4PG6 A;  1JNR B;  3D67 A;  1KWM A;  1SJR A;  3ZZT A;  4AXJ A;  2RU3 A;  4UOF A;  1PG5 B;  3HVT A;  2UVR A;  2CNN B;  3PVX A;  4CI0 B;  3IM8 A;  2QLB B;  4P72 A;  1KVJ A;  4U95 A;  4UZB A;  2C2M B;  3D54 A;  4ZLN A;  1TV6 A;  1F5A A;  7FD1 A;  2AGP A;  2DRA A;  4LFC J;  4FF4 A;  3W3S A;  2WVF A;  4AFF A;  2CVI A;  5F8H A;  3DRX A;  4RW8 A;  3QT6 A;  2VJU A;  3CD6 S;  1S7H A;  3T6B A;  4HHH A;  2D69 A;  2WBR A;  3MM9 B;  5D0E A;  1QTM A;  1B0P A;  1RWM B;  2WON A;  4CT9 A;  4TU7 A;  3MMC A;  2OTL S;  4GKK J;  2M8H A;  2V2Z A;  2RDD A;  2DHX A;  4KB7 A;  3WZ0 A;  3OFE A;  2AYB A;  1EIY B;  4IRC A;  1UVN A;  3X1L B;  1YZ6 A;  1VRQ C;  1CS4 B;  4BLG A;  2EPI A;  2RRA A;  5IT9 Y;  4LT6 A;  5C24 B;  1UPP A;  2XSJ B;  2DRB A;  2W2Q P;  2F9D A;  3CIZ A;  3R7N B;  2XGQ A;  2HVI A;  3IRX B;  4JP8 A;  1M1H A;  1HI1 A;  4UZC A;  3JYT A;  1R8P A;  3ULH A;  2O01 C;  5HBM B;  1MWQ A;  3R6G B;  1YX2 A;  2D41 A;  4DPO A;  4ZLP A;  1NK6 A;  4NCB A;  1YSJ A;  3HVR A;  1QE1 B;  1IJF B;  3QFW A;  3CPW R;  3MPU B;  5ETP A;  4DV0 F;  2BQU A;  4HH1 A;  2E5L F;  1RWW B;  2OEJ A;  1S10 A;  3DDN A;  1HNX F;  4QR0 A;  5CQG A;  2IDL A;  2E1M C;  1YHQ S;  3GII A;  1M90 T;  3LAL A;  2ZEJ A;  4RJV A;  5HL7 Q;  4J9P A;  2VG7 A;  1KQK A;  4IRK A;  3QGP A;  1FFG B;  3GQC A;  5KFJ A;  1V5V A;  1NK8 A;  1GK8 A;  2BX6 A;  2GMJ A;  4GC7 A;  1VIS A;  4DR5 F;  4QYZ K;  3HT0 A;  3KHL A;  1FDN A;  2CIM A;  2E66 A;  4W98 A;  5HLF A;  2EBG A;  2HHX A;  3QWU A;  2DGT A;  4G6V B;  2F7V A;  3RRG A;  3KUG A;  1J5E F;  3DRS B;  1CC7 A;  3QNW B;  3A8I A;  1XC9 A;  5D78 A;  3D0G E;  3FKB A;  2UUB F;  5DJB A;  1F1B B;  2ZBC A;  1C1B A;  4KO0 B;  5KG3 A;  1RA6 A;  4Q8E A;  2N3L A;  1LFW A;  1PSD A;  1S99 A;  3C14 A;  2CWX A;  2D9P A;  4NA2 A;  2MZ1 A;  2IAJ A;  3GV7 B;  2Q43 A;  2JC1 A;  1T9Y A;  3PYG A;  1KQG B;  3BV8 A;  3JQM A;  4H4K A;  4HAC A;  2XGP A;  2AIR B;  2ASJ A;  1YJ9 S;  3EGZ A;  1WG1 A;  1HFE L;  2EVZ A;  4Y28 C;  1FE4 A;  2JL9 A;  1NK5 A;  5FDL A;  3NLC A;  1LWF A;  2AW0 A;  4LUB A;  4QW8 A;  4PG4 A;  4DV2 J;  1VQP S;  1DZ5 A;  5KG5 A;  2VF3 A;  4JV5 J;  1DTQ B;  1E6Y B;  2QL7 B;  3JXO A;  1NHK L;  4NLT A;  3WC0 A;  3Q22 A;  2HVD A;  1TUV A;  2CA9 A;  2WK4 A;  3H2U B;  4K4Y A;  5H9E J;  2Z2M A;  3D1Q A;  1JXV A;  1NPR A;  2K3I A;  1WF2 A;  2KG0 A;  4RO0 A;  2RIL A;  2V8V A;  3R97 A;  1JWW A;  3G4S S;  1I6J A;  3CC4 S;  1EQ0 A;  4I6W A;  4F04 B;  1VBZ A;  5IT0 A;  4JV5 F;  1JNZ B;  1PC5 A;  4EO6 A;  2DEI A;  1VMB A;  4KAI A;  2QYG A;  4KV8 B;  2ROP A;  5KFO A;  3PXG a;  1LOU A;  2HBY B;  1S7I A;  2Y1I A;  2QGF B;  2Z56 B;  3A3P B;  4H4M A;  3FNN A;  1Y9O A;  1ZZF A;  2HPU A;  3GIR A;  4KHR A;  2LXI A;  4U9R A;  4USU A;  2JFK A;  1YKW A;  3OVA A;  4B02 A;  4AND A;  3T1A A;  5EDW A;  1S77 D;  4ZPW R;  4OI1 A;  3E01 B;  1Q86 T;  3UN5 A;  4ECU A;  1T8E A;  3SV4 A;  1UA0 A;  1QUV A;  1WTF A;  2QMX A;  5F8I A;  1HL6 A;  3W61 A;  3KK1 B;  4P2S A;  4XDD A;  4MTP A;  3GSI A;  3FJ2 A;  4UTG A;  2HHH F;  2ZZN A;  1X4F A;  4DR5 J;  4X4Q A;  3O1L A;  2JEG A;  4AE5 A;  3CCQ S;  1VQ8 S;  4U7U D;  4JI7 F;  4MIB A;  4M5D A;  4CH1 A;  5DM7 Q;  1KC8 T;  3HVW A;  4DSI A;  1WWH A;  3ILL A;  4DV1 J;  1QE1 A;  4ZVO B;  2BE2 A;  3QMQ A;  1FWK A;  2RRB A;  1AUS L;  4CH0 S;  8AT1 B;  3Q23 A;  2XMJ A;  4K2J A;  3THV A;  1CVJ A;  3L9Z A;  3DOM B;  3OV7 A;  3R5G A;  1S97 A;  2MST A;  4HI2 A;  4WFX A;  4KHM A;  5J1P A;  4LSN B;  4C4W A;  2QA2 A;  1QVF R;  2HNY B;  4CLY A;  2QN6 B;  4F7V A;  2XSJ A;  5M2U A;  3TO8 A;  2DO4 A;  2M88 A;  3DDK A;  3MM6 B;  2XMT A;  4LIR A;  2A18 A;  4FF1 A;  3MD3 A;  1NUE A;  1RSC A;  3D0I E;  4KBI A;  3SEO A;  4DV3 F;  5ETO A;  4JYA F;  2FPH X;  3PKY A;  1TK0 A;  2D3Z A;  2DBB A;  1V6H A;  5HLF B;  1RWO B;  1F2H A;  1VIX A;  3FEY B;  1GT8 A;  2BUN A;  1N34 J;  2A3J A;  3SQG B;  2K3K A;  4OLO A;  3KWM A;  4KPY A;  4NI2 A;  1JLF B;  1F9H A;  1EET A;  1R31 A;  2UVU A;  4OYA A;  4TY9 A;  4QQB A;  2GC8 A;  4QIG A;  5DDO C;  3KLG A;  3B8H A;  1U1M A;  4DSK A;  3HHN B;  2V2Q A;  4JB8 B;  1SI9 A;  1OSC A;  2CG4 A;  2QFI A;  4I1T A;  2JVR A;  2C1E B;  3GCW P;  3DLK A;  5F0W A;  1S76 D;  1MN7 A;  3BZQ A;  3PG9 A;  3T1Y J;  2FVC A;  4MKY A;  4ZCI A;  4LF4 J;  3EGW B;  2F4V J;  3LH2 S;  4WFN Q;  2OPS B;  1YTY A;  1FNO A;  1RT4 A;  1FJ7 A;  4N56 A;  3CSK A;  3WQP A;  4EYH B;  2G1H A;  2JOQ A;  4JI5 J;  1N32 J;  2DHG A;  2Q6B A;  2YNH B;  2O3D A;  3R5D A;  2U2F A;  2MLY A;  2ZH3 A;  4B9L A;  4IRD A;  4K4T A;  3OTC A;  4CH7 A;  3J81 Y;  1OJ4 A;  4TLR A;  1RTI A;  1ICE B;  5HMW A;  4D3H A;  1Z2Z A;  1RAO A;  3U27 A;  2B56 A;  3PRD A;  2W7A A;  4OQJ A;  4ZDN A;  4FYV B;  2YQ1 A;  3TOQ A;  1SJF A;  1R7I A;  3DYA B;  2YH0 A;  3K8V A;  4J9Q A;  4P10 A;  5KFY A;  3H5S A;  2FTR A;  2K8G A;  3QGG A;  4DDF A;  1UMJ A;  3R2C J;  2PFD A;  2B6A A;  1J2V A;  2HFS A;  3G6X A;  2FC8 A;  3HHL A;  2MQL A;  1KTQ A;  3VAJ A;  4P7T A;  1L3V A;  3J7Y U;  1WDT A;  2OFG X;  2DGX A;  3MEC B;  1RAF B;  4IG3 B;  4WFB Q;  1K9M T;  1SH0 A;  2DR7 A;  1N0U A;  1FK9 B;  3CIM A;  3NOG A;  2ZBI A;  1TP7 A;  2AJ0 A;  1WKJ A;  4EI2 A;  1F0X A;  4C2M A;  3PW0 A;  2D3O R;  5ADZ A;  1EP4 A;  1NB2 A;  2R42 A;  3AHP A;  2VQE J;  2LQJ A;  2MEW A;  2WSE C;  3BJY A;  1PGZ A;  2R7O A;  1J27 A;  4F3Q A;  4NLY A;  3GYN A;  2MZQ A;  2YX1 A;  2VOP A;  4MT1 A;  1OIA A;  3KLI B;  3AOB A;  3TW0 A;  2QMU B;  2ZNY A;  3MUT P;  1AFJ A;  1BHN A;  3QJP A;  1KOO A;  4I2Q A;  3L09 A;  2W25 A;  4DV2 F;  4I2P B;  1CQM A;  1YVF A;  3KUE A;  1VRU A;  4ZCL A;  2GCF A;  3OPK A;  2FHJ D;  2RQK A;  4FVM A;  3S8S A;  5GAH I;  2WSF C;  2PT0 A;  2DGS A;  1RAD B;  3FCH A;  3QWP A;  3W2V A;  1SL1 A;  2FD2 A;  1HHQ A;  4P7V A;  1HR0 F;  5IT9 U;  2WB4 A;  3CJ2 A;  2V8P A;  1HNZ J;  2N7C A;  1XBW A;  3MPD A;  5LSR A;  5LMU F;  3MMB B;  4ZIV A;  4K50 A;  1H74 A;  4HEA 9;  2DGU A;  1NDK A;  2DGQ A;  3G86 A;  1RHJ B;  4CLK A;  2R2U A;  2XYG B;  2DH7 A;  2HUR A;  2VPY B;  3DRR A;  3V81 A;  1RB0 A;  4QW9 A;  3PHT A;  4LBI A;  3CF5 Q;  3TVK A;  1IKX B;  3DU5 A;  1OY6 A;  4OYP A;  4F25 A;  1A0O B;  4EYI B;  1UZD A;  1Q7Y T;  4X62 J;  4O3R A;  2BAN A;  3KOA A;  4DR1 J;  5RUB A;  2NPF A;  2DIS A;  2LU1 A;  2XZW A;  4OYM A;  3VGS A;  1X7V A;  2JFD A;  3I0S A;  4TU9 A;  4IFV B;  5DM6 Q;  3W1Y C;  3R7S B;  2ZH9 A;  2B8Q A;  1C1C A;  4W4M A;  2DY1 A;  3FEX B;  5CA5 A;  1X5O A;  4J91 A;  2C3M A;  2NZC A;  4QWE A;  1JKH B;  4RWX A;  4Y2K A;  4RUA A;  2Q66 A;  2HZV A;  4X62 F;  3RB3 A;  2I2Y A;  1C0U B;  1N33 J;  3JQK A;  1LWE A;  1C0T A;  3ELH A;  4QIW D;  4IOC Q;  5H9E K;  2UVV A;  2VA3 A;  1GMU A;  2DIV A;  4FXV A;  4GO5 X;  2IRU A;  3MUV P;  1NJZ A;  2K06 A;  3SSS A;  3UI3 A;  4DFK A;  4IG0 B;  1Q8I A;  3PHE A;  2BJ8 A;  3Q8Y A;  5HJX A;  1ZYQ A;  1RP5 A;  2H54 B;  2V4J A;  3DOL B;  3FSY A;  3M2R B;  3WIV A;  5KOX A;  1JQG A;  3QLH B;  5E3R A;  3G6E S;  4DFJ A;  1X9W A;  4RW4 B;  3D66 A;  3NS6 A;  2ZH7 A;  2PFF B;  1JKH A;  2CZV C;  3KLE A;  1U25 A;  2L9N A;  1TL1 B;  4G1Q B;  3T1H J;  1QSY A;  4PPD A;  1Y10 A;  3POT B;  1ZZN A;  2OD6 A;  2PI4 A;  2HHV A;  5L9N A;  1QAJ A;  1FKP A;  3OFF A;  1ZM2 A;  2H4W B;  4IFY B;  5IOL A;  1XNR F;  3H2L A;  1U6B A;  1XNR J;  1UJ4 A;  4B3O B;  3OQ2 A;  1TEL A;  2B5J B;  5DS7 A;  2IVF B;  4DL3 A;  1E6V B;  2KXF A;  3I0R A;  3I32 A;  2ZM6 F;  5L39 A;  2E1A A;  3S01 A;  4DLG A;  4HDH A;  4N8N A;  3HSG A;  2G0I A;  3RW7 A;  1DBD A;  1MN9 A;  3QLH A;  3RG6 A;  2MQQ A;  1YJT A;  5AE2 A;  1AW0 A;  2UV8 G;  2ILZ A;  2RS8 A;  3C2P A;  2MZS A;  2QX0 A;  2V68 A;  3ZNJ 1;  3DLB A;  4QR1 A;  1S9F A;  2DB1 A;  5A8K B;  3BSC A;  3HDS A;  4NRU A;  2DNR A;  2WOM A;  2YKM A;  4ZPT R;  3H4B A;  4N8O A;  2QA4 S;  1HKA A;  1SB6 A;  4NOH A;  2KB2 A;  4OFZ A;  1J5O A;  2HVH A;  2C3O A;  3BS9 A;  4ILL A;  2HHT A;  2CNK B;  2UU9 F;  1YBA A;  3CTR A;  2VD3 A;  2HG4 A;  1EKS A;  3AQP A;  2X51 A;  2QL9 B;  3CED A;  1ZM3 A;  5HO4 A;  3OLB A;  4DQR A;  1HNZ F;  1PYS B;  4ZCK A;  3U7J A;  3MMJ A;  5M2R A;  2IM2 A;  4Y34 A;  2FJW A;  3W9J A;  4OV1 A;  2FB0 A;  2PE8 A;  2C28 A;  4LMZ A;  1C1B B;  2ATC B;  4A8K A;  2GJF A;  4DBQ A;  4LRE A;  3Q8U A;  3BSA A;  4NX9 A;  4EUV A;  1QDU B;  3KLH B;  1S48 A;  3OHA A;  2VJV A;  2GVZ B;  2MQN A;  3UNG C;  4ID8 A;  3T5K A;  5E3C A;  3F56 A;  3M1V A;  1SH2 A;  1QM9 A;  2M2B A;  1DQ9 A;  1U7L A;  3CWJ A;  3KJQ B;  3LP0 A;  1D9A A;  3I5B A;  4IQM A;  4OHX A;  3M2V B;  4A8X A;  3RTV A;  1IBC B;  2QLX A;  3LGM A;  4OZ0 A;  1SKS A;  1IKW B;  1NPK A;  2PEH A;  2I1R A;  4Z7C A;  1XR7 A;  3NNC A;  3CO9 A;  1R3N A;  2CG8 A;  2XEX A;  1SJQ A;  3EDR B;  3BKT A;  3JTO A;  3PDN A;  1UEV A;  4UOC A;  1RHQ B;  4KHP F;  5IV4 A;  4U7U K;  3TQE A;  3FRY A;  4ZVH A;  1D9D A;  1RAB B;  4B3S J;  5LT5 A;  5LXY A;  4NLG A;  1HWK A;  4A47 A;  2F65 A;  5ETQ A;  4LQ3 A;  2MYF A;  4DF4 A;  5F8M A;  2ALY B;  4YHH J;  4MIW A;  3V2U C;  3H4D A;  1WKL A;  2VBX A;  1RT5 B;  5F3T A;  3AAW B;  2E5G A;  3V5R A;  1P1T A;  5KT6 A;  3TQ1 A;  5J1E A;  2OPS A;  3CNQ P;  2BE9 B;  3FK4 A;  2CNL B;  2V5H G;  2DD8 S;  3TEG A;  3W2W A;  3WC2 A;  3PO5 A;  4DL6 A;  4B9U A;  5AE1 A;  2J0S D;  4WE1 A;  1FX4 A;  1FWL A;  1RK8 A;  3MUM P;  1RTH B;  4DF8 A;  2BAB A;  2KDO A;  2FLO A;  3HJV A;  3VGU A;  5HMY A;  3HHK A;  4BBY A;  2EFN A;  2LYV A;  4J90 A;  3M8P B;  1FF2 A;  3HHL D;  3ZFV A;  3ZZ0 A;  4PQA A;  1D1U A;  4O44 A;  4YB7 A;  1BQN B;  4ZKA A;  3PY8 A;  5D0H A;  3SQO P;  4NXN J;  2KFN A;  5ETM A;  4DZD A;  1RWP B;  2J76 E;  4ZPV R;  1MMD A;  2B7C B;  2J9C A;  4NLD A;  1VRT B;  4PCQ A;  1FE0 A;  1HBU B;  4FVC A;  1N32 F;  3FCW A;  3K2Y A;  1NH8 A;  4D3G A;  3AJD A;  2NZ4 A;  5IM0 B;  1CQN A;  1VQY A;  3MR3 A;  2JJ4 D;  4YY3 J;  3VAG A;  5AXK A;  5ETK A;  2NCK L;  3ENA A;  1C4A A;  1TKX B;  1TL3 A;  3F44 A;  4WBF A;  1OMS A;  3H2V E;  5DZ6 A;  4ATN A;  1P6T A;  3HD2 A;  3LWM A;  3K5N A;  1JLQ B;  4ECS A;  4ECT A;  3UD4 P;  2AU0 A;  1LWC B;  2FGC A;  1U48 A;  1BXN A;  4M94 A;  1ELO A;  3IA0 A;  2V2V A;  3RYL A;  2KI2 A;  4LFA F;  1UTA A;  4MFB B;  2PDA A;  5DLG A;  1HBO A;  1AXQ A;  1GAO A;  1X0P A;  1T11 A;  2HND A;  5A6W A;  4KKO B;  3ILO A;  2A2C A;  5KFM A;  1RWU A;  1U1Q A;  1AT1 B;  5KFP A;  2BYC A;  4MK9 A;  1Y5L B;  3SBM A;  3MCM A;  1S9E B;  1TU0 B;  3LPY A;  4E98 A;  1SXL A;  3M6V A;  1CJV A;  1S6P B;  3RR7 A;  1H0H B;  4PAB A;  2MJU A;  2HQ3 A;  4PEO A;  4ER8 A;  4B9T A;  2BOA A;  2J5A A;  1XR5 A;  1ZPV A;  4NYO A;  1N33 F;  4WZQ A;  4OHW A;  3P96 A;  4KR0 B;  2HHH J;  3H42 A;  3BR8 A;  2IBO A;  3NCR A;  4KH1 B;  1DTT A;  2V4Q A;  3DMJ A;  3SSQ A;  4IFY A;  1FRJ A;  1BWV A;  2HEK A;  1IM4 A;  1X4G A;  3GJT B;  4OZ3 A;  6FDR A;  3RAX A;  1YIT S;  3G6V A;  4TU8 A;  4KJI A;  1QY7 A;  4DV1 F;  2UUB J;  4I7F A;  5THW A;  4G1Q A;  3QIP B;  3UQS A;  2CDR B;  2P6T A;  4A4J A;  4JI7 J;  4ZPC A;  5FII A;  2W7P A;  3D3B J;  2AJQ A;  1IBK J;  1WUU A;  5DO2 A;  3OFH A;  3R27 A;  3DC2 A;  5DQG A;  3M2V A;  2M70 A;  3V4I A;  1OYE A;  3OFG A;  1B7F A;  1SC3 B;  3V6D B;  4XIU A;  4P2F A;  2R7W A;  7AT1 B;  1WAC A;  2QG9 B;  1GNK A;  3PFE A;  4RW6 A;  3T5L A;  2HHW A;  1TFW A;  1UET A;  1S72 S;  2HAF A;  3BBF A;  1Q4R A;  3W9H A;  1JLC B;  3FMB A;  4QBU A;  1GX5 A;  4ZK7 M;  4DV5 J;  2D3O 1;  3VR1 A;  1R8A A;  2MZT A;  3UR0 A;  3N5B A;  2KFY A;  2QC3 A;  3KLV A;  3V4I B;  4I56 A;  3OD2 A;  1VI7 A;  8ATC B;  1FDB A;  3HHE A;  3LGH A;  4CYU A;  1HIY A;  4ID5 B;  1JLA B;  3GJR B;  4X66 J;  4C3L A;  3CJS A;  1PAE X;  5KT4 A;  1VHF A;  3M9O B;  3QYY A;  2IYI A;  2X3G A;  4KGV B;  4ZMM A;  5IXU A;  3G8S A;  2DGW A;  1RYR A;  1UJ6 A;  4FS2 A;  1FTC A;  3DGP B;  4UQT A;  3EE3 A;  3T5J A;  3V6H A;  2G2O A;  4MKV A;  1HQE A;  2RRN A;  5JUM A;  3KLE B;  2R8H A;  2JLG A;  5LMN F;  2FJB B;  3DXS X;  4A8F A;  4RBV A;  1D3W A;  2ASY A;  2LA6 A;  5AXM A;  2MSS A;  2P6S A;  2W9C A;  2ADB A;  2MQM A;  1LK5 A;  2V4R A;  3QPI A;  1EJ7 L;  4DQP A;  2CJA A;  3QO9 B;  3BN7 A;  3OR1 A;  3JAM Y;  2AJF E;  1WEZ A;  2HIY A;  3MDF A;  4OYO A;  1NBE B;  2UXB F;  1XER A;  2ZHA A;  3EJM A;  2J0W A;  3JS9 A;  4N76 A;  2VON A;  4WTO B;  2ZZT A;  3IAS 9;  1H72 C;  1WC4 A;  3X3U A;  2KN4 A;  3CCJ S;  1RT2 A;  2HZC A;  4X4R A;  2XI3 A;  2EFP A;  1H6K X;  2Q1L A;  1VJW A;  4ID5 A;  1J5E J;  3BKF A;  1PBU A;  3FZB A;  4JI1 J;  4F4W A;  4F4Y A;  1T9T A;  4FNI A;  1H98 A;  2Z8Q A;  2HFN A;  1N5Q A;  1U09 A;  4ZVQ B;  3GSD A;  5IC4 B;  3D0H E;  5KFL A;  2F9J A;  3P45 B;  2YKO A;  2C2Z B;  3QJJ A;  2LFV A;  5K5M A;  4DFM A;  2XY6 A;  2WTF A;  2Z2Z A;  2G9O A;  1OPZ A;  3M8S A; 
#chains in the Genus database with same CATH homology
 4GKK J;  3D3C J;  4LF7 J;  4DV4 J;  4KY3 A;  1N34 J;  4X64 J;  4YY3 J;  4DR2 J;  4DV0 J;  2E5L J;  3J7A N;  1XNQ J;  4NEZ A;  5IWA J;  4JI4 J;  4LF9 J;  3T1H J;  4DV6 J;  5AJ3 J;  2UUC J;  5LMN J;  2UXD J;  3T1Y J;  2UXC J;  4B3T J;  3IMQ J;  3J81 U;  1XNR J;  5FLX U;  4GKJ J;  2KL8 A;  2F4V J;  1IBL J;  4JI2 J;  4JI6 J;  4JI5 J;  4RJV A;  1N32 J;  1I94 J;  4JYA J;  4X65 J;  4LF8 J;  4JI3 J;  4AQY J;  3OTO J;  2HHH J;  3R2D J;  4LFA J;  2UU9 J;  4NEY A;  5A2Q U;  4DR3 J;  4DUY J;  2UUB J;  4JI0 J;  4LF6 J;  3R2C J;  4DV7 J;  4JI7 J;  3D3B J;  4KYZ A;  1IBK J;  4HHU A;  4LFB J;  1XMQ J;  4DR4 J;  4JV5 J;  1FJG J;  4DV3 J;  2KVQ E;  4DV5 J;  2VQE J;  2MEW A;  1IBM J;  4B3R J;  3JAM U;  4JI8 J;  4X66 J;  1XMO J;  5LMU J;  1HNX J;  4B3S J;  5IT9 U;  1HR0 J;  2UXB J;  5LM7 E;  1HNW J;  1HNZ J;  4LF5 J;  2MTL A;  4YHH J;  2UUA J;  4DR7 J;  2ZM6 J;  4OX9 J;  4X62 J;  4DR5 J;  4LF4 J;  4DR1 J;  2MQ8 A;  4DR6 J;  4KHP J;  4DV1 J;  3W1Y C;  4PWW A;  4V1A k;  1J5E J;  4DUZ J;  4JI1 J;  4LFC J;  2VQF J;  4NXN J;  1N36 J;  1N33 J;  5BR8 J;  3J80 U;  4B3M J;  4K0K J;  4DV2 J;  4NXM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...