3FZ2A

Crystal structure of the tail terminator protein from phage lambda (gpu-d74a)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
132
structure length
129
Chain Sequence
HMKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGESDTWQAELHIEVFLPAQVPASELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Minor tail protein U
publication title The X-ray crystal structure of the phage lambda tail terminator protein reveals the biologically relevant hexameric ring structure and demonstrates a conserved mechanism of tail termination among diverse long-tailed phages.
pubmed doi rcsb
source organism Enterobacteria phage lambda
total genus 24
structure length 129
sequence length 132
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06141 Phage_tail_U Phage minor tail protein U
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1700 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fz2A00
3FZBA 3FZ2A 1Z1ZA
chains in the Genus database with same CATH superfamily
1VS3A 2BV3A 4RW6B 1FX2A 2BANA 4Q44A 3VVTA 2WBMA 1YJ7A 3C6UA 5CHCB 4C8LA 2OMOA 2ZM6J 1ZPWX 4USIA 5DQIA 3AD9C 2YX1A 3S8SA 3PKMA 2RS2A 2H3EB 4ECWA 5GAHI 2FJBB 1EIYB 4NMXA 4YFUA 2IRYA 4J9PA 2VBYA 3ULHA 1S1XB 1YZ6A 4H4KA 5KFIA 3FEYB 2HHUA 5E5NA 5JVGQ 4ZPBA 2RJZA 4DQIA 3CWJA 3RW6A 3LGHA 4OI1A 3AXKA 4K4ZA 4PABA 2YQ0A 1V3ZA 2GMLA 2C2DA 1HPZA 4QYRA 1T9UA 5L9NA 2W7AA 4F4YA 4CO3A 2KM8C 1VI7A 4K4VA 2IBKA 2HVDA 3W62A 4JI4J 1E6VB 2YQ1A 2UXBJ 4EI2A 2LXIA 1MROA 2AJ4A 3C16A 3G71S 1E6YA 5KG7A 4AT1B 4MJKA 2W4PA 4ITSA 1BC6A 3IAM9 3WDOA 2LVWA 1CSJA 2IYGA 3PKYA 3G9CA 3RBXA 1WEYA 4F4AA 3I0RA 2VOOA 4BWMA 1ZAVA 2MJUA 2WW8A 1VQYA 3KOAA 3D2WA 1CULB 2VKZG 3RAMA 2EC2A 4RW8B 5C7PA 2J7KA 3H0PA 2K3IA 2XLJA 2CZ4A 1Y7PA 5DLFA 3PW0A 4OLPA 1U2FA 2AV5A 5EX0A 1NEEA 4E98A 5CYQB 1I94F 1WWHA 1XNRJ 3G8QA 1IKWA 1T94A 1DLOA 2G0IA 2J6SA 2E5IA 4FS1A 1FRJA 1YJVA 2L9DA 4OZNA 2PO4A 3P8BB 3TO8A 1VQ5S 1KRPA 2MHEA 2C2EA 2JVOA 3LH2S 4WIIA 4HDHA 2HHWA 1QSYA 2OPPB 3SEOA 2XMMA 4OI3A 1DHMA 1T3OA 1S6PB 1P9YA 4JI3J 1U0HB 4EO6A 2J0SD 3OXLA 1WC5A 1YKWA 4DV5F 4DCOB 4JI5F 1RCXB 3PCOB 4NXMJ 2QLXA 2BMBA 1UVJA 3IG1A 1FTCA 1SV5A 3R6GB 3GMGA 1FEHA 3IBCB 1U49A 1GMVA 3HHEA 1XIQA 1YITS 4F02A 4M5DB 4F0KA 1HIYA 4HI1A 1RBLA 2EI5A 2OI2A 2VC0A 2HFVA 3T5LA 4R5PA 3PVXA 4TYBA 2V0NA 4QBUA 2LQ9A 4G3IA 4ED6A 3HHKA 2BM0A 1EP4B 4KFBB 4WCEQ 1TK5A 1T9WA 2E1CA 2FGOA 3D3CJ 1REVB 2OPRA 4R8UA 4RWWA 5EHHA 1C1CB 2KT2A 1DZ5A 3M05A 1D0EA 2P9GA 2LDIA 3VCDA 2R7OA 1F6TA 1KSPA 4AUKA 4DPTA 3ISNC 4WIQA 2XZTB 3GJRB 2I1RA 1X4EA 1F3VA 1IKVA 3C8YA 4MH8A 1CG2A 4RNNA 3D0GE 2FZCB 4J9OA 1MWQA 2R7VA 2HIYA 3GCWP 3GILA 4PCQA 1T7PA 5AJ3F 5L1KA 3PJ9A 2EBEA 2XMJA 2VG6B 4NLRA 4J9NA 1RTZA 4RBTA 4QWAA 2WAQD 2UUWA 4C97A 2DR5A 3I55S 1WSRA 3THTA 3JQMA 2A6OA 3DCAA 3GU0A 3RG6A 1S0NA 3QJJA 1K1QA 1NLKL 2ACYA 3MFIA 2QFJA 5CD4H 4P6QA 2F7VA 4DFKA 2JEIA 4DR2F 4WWSA 4M5IA 3SV4A 3DMJA 2NXEA 1IBCB 2FVQA 1WUUA 1X5OA 2VQEJ 1LK7A 4RZRA 2HWHA 3QIPB 3UDEA 4TYAA 3G96A 3W65A 2LECA 1N5YA 4I67A 4KH0B 2N7CA 3G6YA 1BGXT 5C24A 2VDHA 2WOMB 3E01B 3NKYA 4A8QA 1Q82T 1LFPA 3QFHA 3OL6A 2FGCA 3AB4B 2XNRA 2OUGA 3IM8A 5K8PA 2J7WA 2C3PA 2V8DA 4UQGA 2F4FA 2R7RA 2QYCA 3PEHA 1T0TV 5D0RA 1ZM2A 2HK3A 1Y3KA 3KDOA 3QYYA 4DPXA 2XQCA 1Q1KA 2QC3A 3OXFA 5HAOA 3K89A 3I4HX 3HFZB 4ID5B 2VG5A 4ZVUB 3R7NB 4Z7YA 4CRJA 3CCWA 1TUGB 3DLGB 4N7TA 3Q2TC 4UZCA 4TU9A 3N28A 3X3UA 1RADB 2RIJA 3DLJA 3TR5A 2V69A 3TZXA 4OYMA 5AXNA 3QZ8A 3Q8VA 1X4HA 1RWKB 2EFNA 3RBZA 1LWCB 2DNYA 2J7UA 3T41A 4DV2J 2YKPA 3SQGA 1KVJA 2VFSA 2A0FB 2DGTA 2D3ZA 3WX8A 4P10A 1U47A 5HP1B 1MU2B 2GVDB 2B9WA 1TFYA 2UUBF 2Y8WA 2O01C 2ZDPA 3AAWB 3TYTA 4B3TJ 4K59A 1HQUA 2B4UA 5FIIA 3C6UB 5H9EJ 1LW0A 3NLCA 3MM8B 2C3UA 2J9DA 3T3FA 2ADCA 1SIWB 2XS5A 3MECB 1LWEA 1CQNA 2L48A 3KLGB 2MKCA 4WBFA 2ZJPQ 1XMOF 4OYPA 4XDDA 1F9FA 4NYZA 3TW0A 4NE9C 3HLUA 3DRPA 1R8PA 4Q2MA 1WTFA 3TA0A 1L3SA 4HHUA 2RDJA 4ICLA 1HPZB 3BM7A 1K9MT 2DHGA 3RGIA 2HHTA 2CNKB 1RWWB 2ADBA 1EX8A 3OHAA 4LFAF 4NLSA 1MROB 3C16B 4XAKA 1E6YB 1SPBP 2NZ4A 5KFHA 5CQGA 2D1CA 4OYWA 1XNQF 2RQ4A 4X64F 3LP2A 4DPWA 2YWEA 2MQOA 1RHUB 3GSIA 4FVMA 4Y0FA 1EAYC 2I8EA 2W01A 1IQTA 2HRTA 4DV5J 1UVKA 2GQ2A 4UOGA 3RAQA 4JI5J 3LOUA 4B9VA 2KXHA 4ZIWA 4WZQA 5EGYA 1Y3JA 1VQPS 2QN6B 2Y1IA 1VK8A 2D7SA 1HWUA 1XERA 3EPGA 2AZ1A 1U09A 2I38A 3HD2A 4DQRA 5AE3A 5H9FJ 2NR0A 1ZA1B 3ISND 4MTPA 4OJGA 1MMDA 5ETRA 2WW4A 1WC1A 2NPFA 5B0DA 4DR1F 4FBUA 3IFEA 1UEUA 2CQ4A 4U96A 4BDPA 4K2XA 1JLAB 1UPPA 1G7CB 1SC1B 1NDCA 4DPUA 2Q66A 2HBQB 3X1LB 1ZTTA 4LUBA 3CF5Q 4J90A 2MZSA 3H8YA 4ZPCA 4F3QA 5HI7A 5A2QY 4QZVB 2XNQA 2VOPA 1JKHA 2DGSA 1DBDA 4LF9F 3LAKA 2KHCA 4Q8FA 4ZVQB 1ZH5A 1VR6A 3HVTA 3FRZA 3CCVS 3IGNA 1QUVA 4Y00A 4C98A 2CDQA 3NGRA 1R27B 4QQBA 1RTHA 1NK4A 1NK8A 1S0OA 1CEZA 1FNOA 2ZHOA 3CJQA 3ILIA 5KT5A 1L3UA 3VQSA 1Y00A 4R5PB 2GJFA 5J2PA 3ZZUA 2CRLA 4DL5A 1NKEA 1NJZA 3A12A 1D09B 4CNZA 2M52A 2O5DA 2QSWA 3DOLA 2B0GA 4X4OA 2ZBIA 5KG1A 2J8AA 5LJ3Y 3GIMA 1UVIA 2W7PA 1FA0A 2A2DA 4QIFA 1W26A 4R8UB 1FKAF 3WHIA 4FVCA 4U7UK 5FLXY 2FUG9 5GAGU 3RBEA 2B9EA 1WACA 1YRTA 4RR5A 2VBZA 2YBVA 2L41A 3MAHA 1RHRB 4CM2A 2RILA 1KONA 2ACMA 4IRDA 4DR2J 5KFLA 1KS2A 4QIVA 1U1QA 1KLMB 5D8HB 1I1GA 1PILA 4NEZA 3AA9A 2AW0A 2DGOA 4ED8A 1WNEA 1N5TA 3HM9A 3DXSX 1JB0C 2EFPA 2B8PA 1RT3A 2HW3A 2F8HA 2ROGA 1XQIA 4ZK7M 1IBKJ 1JJ4A 3SZ2A 1N34F 1K44A 1HLWA 2ZWOA 3IR6B 1JXEA 4RO0A 5J1EB 1N0VC 3RAXA 3QLHA 1HBNA 1HHSA 4NZ6A 4KIAA 5C25B 2JRSA 1FRKA 3UDVA 1HA1A 3JYTA 4ED7A 3IA0A 1N8RT 4WTYA 4RL1A 3RJMB 1GMWA 1Q5VA 4O3SA 1VLOA 4LSNB 3DMJB 3MTJA 4MIBA 2C28A 3IRXA 1RLCL 4DCJB 3O2IA 4F4KA 1L3KA 4J5OA 4YR3A 1MLAA 3NS6A 5C24B 2C2KB 2CAJA 2X3DA 2H54B 2HBRB 3K57A 2IM1A 3BBCA 4K4WA 5HBMA 3OFGA 4LRDA 3TUJC 2GCFA 4DR7J 2UUBJ 2CJ9A 4S0MA 2HVHA 5J2MB 4K4YA 2HFOA 1IKXA 2LDYA 1M5OC 1OY8A 4LF4F 2N7YA 3CD7A 2B9YA 3CO9A 3DHWC 1C0TA 4A46A 2CIMA 4FYXB 4IKAA 2MLXA 5GVQA 1KQGB 5LSOA 1K0TA 3PACA 4ANCA 3G4SS 2BE2A 2KDOA 3HK2A 3KG4A 5L39A 3LANA 3CXCR 1R8CA 4F4XA 1LXNA 4ANEA 3CCES 3HJFA 3SQGB 1FKOB 4JI7F 2OIHA 4DCPB 1X5PA 2UXCJ 1VC0A 2VJVA 2QSFA 1CJVB 4TQRA 4UY8T 4AQYJ 4CLWA 2CJBA 1TL5A 5AE2A 4P2MA 2DNLA 1LW0B 3JSRA 2H51B 3BZQA 2UUTA 2BOPA 1LW2A 1WF2A 3EPIA 3GIJA 1S9FA 2MZJA 2UP1A 4X64J 1RT7B 3MMJA 2K06A 1B7FA 4KT0C 1RTDB 4IR1A 2DNNA 1VMBA 1SB6A 2RDDA 1XBWA 1R8AA 5AXLA 4NL5A 3DRSB 3HX9A 4PR6A 1XC9A 1O8BA 1UP1A 2DGVA 4ICLB 5E3QA 1NB2A 4KGKA 2HHVA 4BCAA 4OJHA 2QYGA 2FJWA 4FXWA 1FHTA 2AGQA 1SQFA 4OZJA 4DX5A 5E3RA 3RTVA 3CD5A 1Q53A 4DR1J 5KFWA 3M8SA 3DLEA 1X4FA 3VAMA 4EGLA 2MSTA 3Q8SB 2JDJA 4NOHA 2B6AB 4Q5VA 2D3OR 5A2QU 5ETSA 1SKSA 2ROEA 4DF4A 3LP2B 3CJ8A 4NLTA 5D4LA 3QJPA 2BJ7A 3BV8A 1Q8LA 2HS3A 1U1MA 3BO4A 3Q22A 4QU7A 4DFMA 1WHWA 3W8GA 4ZCIA 4IUFA 4FF1A 2DRBA 4ZHRA 2RKIA 5ETQA 3PIPQ 5F41A 2PD1A 4F50A 4F3MA 2ZHAA 2HVIA 2EKNA 1RHKB 2J5AA 1Y5IB 3JB9k 2FLNA 4J9QA 2JZ5A 1J5OA 5F8MA 4ZOSA 4WFNQ 3QWPA 4X4UA 2DK2A 2CYYA 5HVHA 5FLXU 3KJVA 1EHWA 3LP1A 3W5ZA 3PX6A 2KG0A 1OQ3A 3QIDA 1FJEB 2ZH2A 4N8NA 4OZLA 3MFHA 2FLLA 1S7IA 4ED0A 4LVOP 4ILLA 3NEKA 3I82A 2QLBB 2KU7A 3T1YJ 2QMWA 4KC5A 5IWAF 1HNZF 3HVTB 3I5AA 2GJ2A 1NHVA 4YR2A 4WZMA 2BOAA 4PQUA 1RTHB 2Z2LA 2DY9A 2R7WA 1N6QB 1PYSB 1YJTA 2YNIA 5G4DA 1F0XA 4L75A 1HWLA 1YJWS 2YKAA 1K73T 1Y10A 4CO2A 2ZNZA 2ZBQA 4CDIA 1F5AA 4NYOA 4WFZA 3I5CA 1YIJS 4N41A 1NMEB 2XZDB 3K8VA 2D69A 4ED5A 5KFUA 1VIXA 4UQTA 5HQMA 4Q0BB 3QGIA 2ASJA 3OW2R 2AQ4A 2MGZA 3HCXA 1RAAB 2YWFA 3AY0A 1VBKA 1K47A 1O51A 3HMJG 2R8GA 4C6AA 4LVNP 3JQJA 3CNQP 2ZE2A 3K17A 3EXCX 2F9DA 3S7RA 3ZZYA 3JSMB 1YK9A 3E3XA 2F4VF 1TKZA 1VRTB 2IRXA 1JLFA 1F2GA 2HQGA 9ATCB 2A18A 2MZTA 3VWSA 2MY7A 5C42B 4GKJF 1P27B 3HF5A 4LBPA 4ILRA 4CLTA 1VQ4S 5KFEA 1WI8A 5ETNA 4TVAB 3JYTB 2HLTA 4M5KA 1R8BA 4UUXA 4GC7A 4WYWA 2X1AA 1BQNB 3A8IA 5HROA 4H4KC 3IRXB 1FVSA 1LK5A 3GR1A 4ES1A 4HH1A 3M2RB 5HQ8A 2WRMA 3DN9A 1TV6A 4GC6A 2BEFA 1V3RA 3OJUA 4ZKAA 5GADI 3POTA 2XY6A 3P45B 1CBKA 4AD6A 2XCPA 1U6BA 1CPZA 2LEPA 2OO4A 4JI7J 1EETB 4PRFA 5LMUF 4J9SA 3T5KA 4O4RA 1B0PA 3CD6S 1A0OB 1SQGA 3OSNA 2FYXA 2MKJA 2DXDA 4DV1F 1IKXB 3BDEA 2MQ8A 4B3OA 3RW7A 4BC9A 3M7VA 1C0TB 4HR2A 1UVNA 4PXDA 3PEJA 4PWUA 4C2MA 2ZH4A 5IC4B 4C8MA 3M1VB 2IVFB 3MM6B 3GPAA 1DJ0A 4ECYA 1U48A 3KG0A 3D7SB 3OUYA 3QGPA 1OS5A 1SJ3P 2G2YA 2W4CA 1QTMA 4ZLPA 2ZZTA 5JJBA 4WFBQ 1OYEA 3L3CA 4EMDA 3DFEA 3CJ3A 1RCOB 2QA1A 3I87A 4PXCA 2VZ9A 2HZAA 3CJSA 3CO0P 4EUVA 4U95A 2WVEA 2HLUA 1UPMB 2KJWA 4MK7A 2XTJP 3KLIA 1HNWJ 5I42A 2CQ1A 1RZMA 3M8QB 2RAQA 1TUVA 1LW2B 3EUNA 2COLA 1RTJB 4X62J 2W2QP 3PW5A 3U1LA 3HT3A 3KUGA 2PMHA 1KFSA 4A8SA 5HMYA 3DU6A 3OR1A 3DKDA 4KTQA 1CJKA 3MM5A 4URGA 4WE1A 2IDEA 2H5JB 2IMWP 4ZCLA 1JK9B 1TL7A 3C46A 2D9OA 2HQ3A 3BB5A 4WU2A 2MQPA 1NDKA 4ZMMA 2FVPA 2UUCJ 2JL9A 1NZ8A 3ZZ0A 3CEDA 4IG0A 4ZITA 4ECZA 2V2KA 3FJ2A 1S6QB 4PXEA 1ROFA 3KK1B 1DTTA 5H1SV 2B3TB 3BO3A 4IFYA 1RT1B 1RI7A 3PFEA 2X51A 3R5GA 4OZ0A 4USTA 1FD8A 3R9LA 4OJ3A 2Z4PA 1WEZA 2CJYB 5DDOC 3HFKA 3KHRA 4RW7A 4FN5A 2U1AA 5DDRC 2HNYA 1X9WA 1FNXH 2LMIA 4F2RA 4O23A 5HLFA 2E5LJ 3E2EA 1HNZJ 2JX2A 3O5TB 4RBVA 2YKMA 2VBWA 2UV8A 3JXOA 2CPYA 2R2TA 4ZHRB 1D8YA 4UOFA 2RNEA 2ZWPA 3VAFA 1D3WA 2K7KA 1SH3A 3B8HA 4JV1A 3ILJA 2BABA 2VD3A 2RRBA 4QYZJ 3R5BA 3DC2A 1FXDA 4PAAA 3KJVB 3FFIA 2R9LA 2XYGB 4MKVA 3EVMA 5E33A 2Y1LB 3K0JA 2E1MC 3H98A 3R3TA 4ZVHA 3G82A 5L8RC 4G1QB 4FF4A 4LFCJ 4EFAC 1AFJA 2QA2A 3UNGC 4YHHF 3KHGA 3BO2A 1S9EA 2GC8A 5DS7A 1WDTA 4LREA 3WBZA 4QR2A 3EVOA 4TQSA 1WD6A 3AD7C 1HBOA 1SC6A 3B4MA 1T05A 3C3LA 3HSDA 2VF3A 3O1LA 4PQUB 1H6KX 2H5EA 2BDPA 1BHNA 2F4VJ 2OSRA 1FI4A 2FVRA 5AXKA 3DDKA 4H4MA 2OD4A 4YS2A 5F3TA 2Y0SD 2CNLB 5DGBA 4KGZB 2E7WA 2V50A 4NLYA 4LSLA 4DFJA 1CS4B 1HWJA 1VJWA 3PYEA 2JHEA 3M30A 1S5ZA 3BSAA 1UWBB 4OZ2A 1FO1A 3PO5A 2CWKA 2DNOA 3CC2S 1R89A 2DNZA 3AJ2A 1VOMA 1B4SA 2AT1B 2JEGA 3HSJA 3A13A 2ZE2B 5DG8A 3R7SB 1G1XA 1RA6A 4DX7A 1WKJA 1SI9A 5F8IA 4MMOA 1BQMA 1JLFB 5LMUJ 2V9WA 3VHQA 2EW9A 1ZBTA 4ZVTB 3VAKA 1FFSB 2A1BA 2BYCA 2L08A 1FK9A 3C15A 4WYLA 1SL1A 2R7TA 2KFYA 3N01A 2QMUB 5RUBA 4QJVA 1VK3A 4LSZB 2DNHA 1Y5NB 2WBRA 3NXZA 1AB8A 4DPOA 5LXRA 3JS9A 1R0CB 2ZJQQ 3IR7B 1W2BR 2FHMA 5HROB 3T5JA 4EEYA 1I51B 4IQXA 1ZTWA 3EE3A 1TV6B 4HEA9 2G13A 2V4QA 4KV8A 2QLFB 5E7OB 4Z37A 1SUQB 3POTB 1BUXA 5HMZA 1ZAXA 2V67A 1YGYA 2E29A 4LBHA 1W2IA 4KKOA 2BJEA 1W25A 4DU7A 1VQKS 4AL6A 1VRUB 3A1YG 3J7YU 1U1OA 3T9ZA 2EG1A 5B7WA 2I0XA 3MCMA 3M32B 2HHHF 3ZO7A 5ITHA 4KYZA 2PSZA 3EWGA 3M2VB 1YJ9S 4TLRA 3SMZA 1HQEA 4Z7CA 3TVZA 2X7IA 5ETVA 4DN9A 2DRAA 3F41A 4Z2XA 2RRNA 3CCSS 2GX8A 5DLGA 1MWYA 3HVWA 2DYAA 5K5MA 3KUHA 4V1Ak 3J7AN 2RH3A 2MSSA 4AL5A 4OX9F 4NI2A 3OL9A 5DETA 4N8OA 2VPZB 3UD3P 2OLWA 3MCOA 1R7IA 2ZITA 4QU6A 3UN3A 5A8RA 2E5JA 4Y3CA 3AD8C 2VODA 3SYZA 2OEMA 3FEZA 2R8KA 2RT3A 5KFXA 3AH6A 2P2CB 4M5NA 2J9DE 2Y8YA 2RUGA 3FQLA 2PIIA 1S0MA 1R8HA 2B4PA 1F5CA 1U4BA 5AE1A 4C0BA 2F40A 2W4DA 3H2LA 2NUUG 1FRIA 2ZH8A 1X5TA 4KGVB 2AEMA 1PAEX 2B8QA 3OR1B 1CJKB 3MM5B 5F9LA 2YNGA 5DM6Q 5KFJA 2MMYA 1FVQA 1NAQA 1TL7B 3CJRA 2Z2MA 4UW2A 3UN5A 5KT6A 4MKBA 5EWFA 3M9NB 4C11B 4WFYA 4CH0S 5B0CA 4FYWB 4N5SA 3EGVA 4OYBA 4IG0B 5D3GB 2R2UA 2LU2A 1JJ2R 4IFYB 1AT1B 2HS0A 5KFVA 4NMLA 2C2OB 1SJFA 1UJ6A 3N6LA 2IMOA 5A8WA 3HJVA 1RKIA 4JV5F 2HFSA 1NSQA 3D68A 1RE1B 1M5SA 4LF5J 2R8JA 3S1TA 5DM7Q 2ABYA 4ZP6A 2DGWA 3BGFA 3PX0A 3EZ5A 2JH3A 2R7QA 4RW7B 2FZKB 4YHHJ 1X5SA 1FEEA 4B9SA 1SKUB 2X3GA 3O44A 2LQ5A 1EKSA 5LXYA 3L9ZA 1P8GA 2FHKA 3R7BB 3QZ7A 1CJTA 3T5HA 1RWUA 2NSCA 2WB1D 1PGZA 1UJ5A 3D5MA 3PW4A 4ETXA 3BBBA 3HSZA 4LRFA 7FDRA 4JI8J 2C42A 2HGMA 2YXLA 3MPDA 4CH1A 5CZVA 1RWOB 5A0YA 2UUAF 2OSQA 2RQCA 3CJKA 4QIGA 3UVJA 4WK3A 2YWKA 4EBDA 2CQ3A 1KKHA 2L3MA 3NWGA 1HBUA 4U6PA 3H42A 3MMAB 3IO1A 3ZZOA 2VUGA 1QAYA 4DFPA 3DLBA 4YMEA 3ZTQA 2G0CA 2AYGA 2Q3PA 4Y2AA 2CJKA 4FXDA 3R6LB 5KG0A 1Q5YA 1NNDA 4OI2A 2RU9A 4ES2A 3VAHA 1R3NA 3HT0A 5IS2A 3VZIA 3D6TB 3DLHA 4RJVA 1HBOB 1UL3A 4RW6A 5DRKA 5GAGI 3BQ0A 1X4CA 4E0DA 3L7OA 1WKKA 2RRAA 3BKFA 1U1RA 2ZD1B 3FKBA 4CLUA 2GS8A 2DTJA 4BC7A 2J6UA 1K8AT 4DSIA 2CNOB 3FCVA 3TUZC 3U1MA 1S1XA 2EG2A 4YB5A 4LSLB 2Q79A 2RHSB 1JMTA 1RT2B 5KFQA 5L1LA 2ZFHA 4PWWA 1VC5A 3Q86A 3WIUA 2QL9B 2VU5A 3M30B 3NGKA 5F0UA 2KXFA 2CNNB 4FYDA 2C1EB 1PKUA 3LPYA 5D4OA 3MUMP 1KD1T 4WTOB 4FBTA 3ICLA 3KDNA 1RWXB 2GV1A 1Q81T 4ANDA 3BYRA 1Q78A 3EMTA 2VPWB 4WJBA 3PM9A 2ZM6F 1ZAWA 3BSCA 3IWXA 4HACB 3OTOF 3JTPA 3RZAA 1D9FA 3NRBA 3CB4A 3J7ZT 2XY5A 3JTNA 4HKQA 3MWBA 4DL4A 1PBAA 1CC8A 2XMWA 3AOCA 1H7XA 3JSYA 1FWPA 2OHDA 3M6WA 1ZS6A 2W2OP 1Q86T 4H4OB 2HHHJ 2CQIA 4GO7X 2CWXA 4LJMA 2VFVA 4B9UA 4RW8A 3D1HA 1LOUA 3OJSA 2W1BA 2GO9A 3MM7B 4FYVB 2DNPA 3D54A 4U7CA 4OV1A 1TK0A 2IC3B 4IO9Q 4YY3F 2NQPA 3QFWA 4I69A 3V4MA 4PKDB 5G0RB 4J9MA 3V2UC 3AA8A 4KHRA 3M6XA 3ADAC 3FSXA 3B78A 3M2UB 4DUZJ 5C5JA 3F44A 2APOA 1U1KA 3AB2B 4OZ1A 4FNHA 2NXNA 3D4JA 3SIPB 4CP5A 1RGVA 2V5HG 2XO6A 2DIVA 5MAOA 5CD4A 3UCGA 4O3OA 2PGCA 4PXBA 3TZZA 2LU1A 1MW7A 2VH7A 2OPPA 4KKOB 5J1NA 4ZPWR 4LQ3A 1JLCA 4PZVA 2QMXA 1PIEA 3LP0A 3B6BA 1I3OB 5AT1B 1FERA 4M63A 2B7BB 4HL9A 2RQKA 1QSSA 1Z2LA 1UWAA 5T14A 2CQBA 4Q8EA 4HHJA 4ECVA 2ATCB 4DSKA 3O3LA 4MK8A 2V34A 1VGYA 3IM9A 2BW2A 3ENQA 1X9SA 4NLXA 2DB1A 1XNRF 3TUPA 4G1IA 5A6PA 3GJTB 4U67Q 3R5DA 2GHVC 3UQSA 4J9UE 2YKNB 2IJRA 2RS8A 3S6EA 1N33F 2VB6A 1EP4A 1BQXA 5GAEU 1HNVB 4JI2F 1HL6A 1FDNA 5IM0B 3W3SA 4I68A 1C1CA 3D67A 5DJBA 2IJFA 4JI3F 1VDHA 4OYAA 1F1BB 5J2QB 4DJBA 4EK2A 3CTRA 3UCUP 4CLYA 4MYUA 1X0FA 3BS9A 2IYIA 2FPHX 2LQBA 4UOCA 1T11A 1HFEL 3EDRB 2HQDA 4JV5J 4ZIVA 4ZVRB 1WHXA 4J37A 3VGSA 2HQFA 1IJEB 1RAGB 2GFFA 5B0FA 3T6JA 2XZWA 3CSKA 2E9RX 3J80Y 4LQ9A 4IQMA 4KB7A 4ED3A 2L9WA 3W9JA 1GMWD 1LWFA 2JSXA 2H1YA 4LIRA 1X4DA 3NCRA 2GVZA 3VR1A 4NZ7A 3R5JB 3K59A 2RVJA 3TA1A 1EZZB 2W2PP 4OZ3A 1QVGR 3SFGA 1TKXA 5CXTA 3TNVA 1JLQB 4EZ9A 2YKOA 2CPIA 3CMES 1KOHA 3IN5A 3LA0A 1X4AA 1OO0B 2RUSA 1J27A 4X2BA 2UUAJ 4A48A 2J9CA 2CQGA 3GB0A 3G2XA 2IVYA 3I96A 5CYMA 2EBGA 2MEWA 2A6MA 2XS7A 1U45A 4D3HA 4ZCMA 3QIPA 1T9XA 3KLEB 3PYDA 1UA0A 3K5LA 1SH0A 1C0UA 1TK8A 2WOMA 3E01A 5EX3A 4OI6A 2K2PA 2CDRB 3OHBA 2IFXA 1KVIA 4A8XA 1LQ9A 3R5CA 2VQFJ 1NJWA 2FC8A 5F8LA 2W24A 4HTIA 1CJTB 2Y1JA 2KO1A 1N5VA 2HRUA 4ZVEA 5IXUA 1FWKA 2WONA 1EB0A 1QY7A 3QT6A 1IN0A 4CLZA 2AP6A 1JNRB 2MQQA 3NOCA 2FHOB 4J9RA 5A0YB 2M0GB 3GONA 4ID5A 3VQTA 5E3CA 1VJQA 2YNHA 2GGPB 4ZJQA 1HBUB 2AF6A 3PDNA 4FDFA 3AFGA 5E0OA 3PW2A 1KP6A 3LW5C 3HKZD 1RAEB 1TP7A 4EYIB 4F0HA 4CZCA 1R6VA 3OR2A 5L9XA 1S59A 3PYFA 3KWMA 2B4OA 4LR9A 2ASLA 4YP3A 3SDEA 5K8MA 2CKWA 3GR0A 4GMKA 3ZXWA 1P1TA 5HP1A 1MU2A 1PG5B 2GVDA 2E44A 3IR5B 1YG0A 3BR8A 3CDBA 2NYHA 3NAIA 1UA1A 2L9NA 4CM0A 2J0QD 4KE5A 1N48A 1F60B 2AKWB 2AMCB 3PJWA 2KRRA 3MM8A 3OTOJ 1WSVA 3MECA 3UN2A 3KLGA 1ICEB 2DJWA 4MKAA 2OEJA 2HGNA 2ASYA 2FVSA 1ZM3A 1LWXA 3PXGa 2W9AA 2J6TA 3UR3C 3ZFVA 4Y2IA 3GTYX 4NYPA 4C3KA 3KG1A 2NXUA 2HAFA 1X31C 2WSCC 4DV2F 1AW0A 4YY3J 4RUCA 2YTCA 3TAQA 3THVA 3MXHP 3DHXA 2V2QA 4NLVA 4JBCA 3FEXB 1OWXA 4B3TF 1KC8T 1FCAA 3PV8A 4ES3A 5CA5A 4JI6F 1YRUA 2ZHBA 2XLKA 5HVFA 1AA1B 2GHPA 3TX0A 1SL2A 2DO4A 4K4SA 3V6DB 2BE9B 4RWXA 4ZN3A 1VLYA 2B7CB 2KZZA 2QL5B 1RQ0A 3PZPA 2J8SA 2H9ZA 3J7A1 2G2ZA 4ATNA 4A8FA 3SCLE 3SSSA 1KLNA 4PG6A 1NJYA 4D3GA 4CI0B 2DHXA 3C14B 2OJ3A 2HHPA 2BJDA 2QEXS 3SSQA 1VISA 2WHOA 3PRVA 1IR0A 1JLAA 1N52B 3HFVA 1N33J 4CT8A 2QV6A 5HJYA 1DFDA 1JJCB 4O4GB 1LEOA 1ACMB 4JI2J 2XB2D 1JLCB 4MKYA 3U7JA 3TEHB 1S49A 3LP0B 2IHR1 4QW9A 2KVIA 4K50A 1BLUA 1JXVA 4ZLNA 1TQLA 4JOUA 3CDEA 3ISZA 4EYHB 3GCXP 3VF0B 1XR5A 1H2VZ 1Y4ZB 2VKRA 2MQMA 4HT5A 1XEZA 1S1TB 3SSRA 2BE7D 4XK8C 2GA7A 3J80U 3V6JA 1RHMB 2KYZA 4USJC 3OFEA 2CPZA 2XYPB 3CJ0A 1VBZA 2Z57B 4G65A 4PUOB 3MOZA 1WG5A 5LMNF 3MGJA 4QOTA 5E41A 1V5VA 1NM2A 3MPUB 1PSDA 1Q8KA 3ZNUA 5K20B 2XHCA 1AXQA 1H38A 5IZHA 1QJHA 1U0SA 4CQ1A 2HBYB 4P52A 3PO4A 2XWYA 2X1FA 5C2GA 1UZDA 1VRQC 3V4IB 2K7JA 3WC2A 4I7FB 3GIIA 1KLMA 2E5GA 4NA1A 3VAIA 3P4UB 2ILYA 3LWMA 3T1HF 2PMWA 4KRWA 3H7HB 3C19A 4NRTA 2W8LA 2Z58B 3TZWA 1PC5A 1KDNA 1VFJA 1G6BA 3GJQB 1KVKA 3W5XA 1LWFB 5J1PA 3VGTA 5A8KB 1RU1A 1O6XA 2MKYA 4OHXA 2GVZB 2KG1A 1WJ9A 2DXEA 2RE1A 5J1EA 1ZETA 2V8HA 2ZBCA 3VAGA 1TKXB 5C25A 4OV6A 2BRLA 5B08A 2CQCA 3TJ8A 4NLOA 2DNMA 1R43A 4KH1B 1I5OB 1VQ8S 4J91A 1GFWB 2MTLA 1PAUB 1RAFB 2BJ1A 4HTJA 4LSNA 3FGVA 2RU3A 1TL4A 5CYMB 3BN4A 2HHSA 1WC6A 3K5NA 2Z2ZA 1RT5A 5K9FA 1R0AA 2V4JA 1C0UB 1S1UA 3Q23A 3TOQA 1N56A 1HHQA 4URSA 4DG1B 2WSEC 4ZVFA 1DQAA 3VAJA 3DRYA 2LXFA 1IBKF 1B99A 4DR5F 3K5PA 5J2MA 2ATLA 2XI2A 1QDUB 2WONB 3TQEA 3BPSP 1UFWA 2W2MP 2MKSA 4O44A 4GO5X 2YNFA 4P73A 4I0WA 1TR0A 2YNHB 1WKLA 3V6HA 3D6HB 7AT1B 1Q16B 2ZOMA 4OX6A 5KG6A 3N5FA 2M5YA 4XO0A 3CGIA 2G1HA 4K2JA 2NCKL 4OYOA 3OR2B 1S97A 2V2ZA 2DR6A 2HZCA 2W9CA 1IWAA 5FD1A 5F8JA 1FKOA 3SDEB 5LSRA 1O5JA 2M4MA 3DI6A 4DR7F 4I2PB 4NXNF 1CJVA 1BXNA 2H4WB 4U7UD 4DF8A 2CUYA 3R1LA 5DDPC 2NZCA 4I2QA 3OV7A 2J76E 3M8ZA 2F8EX 4CO5A 1NU4A 1OY6A 4JI6J 2CVEA 2C2ZB 2BR0A 3P5BP 3ETMA 2PA8D 1K0VA 3KK2B 3FVYA 2A3JA 2IM3A 1HMVB 1RT7A 4CYUA 1TELA 3KLFA 4BBYA 3OTDA 3FBFA 1RTDA 2E7VA 4WFAQ 3GWCA 3DRSA 3MURP 4LF6F 3UDCA 3IXQA 3FUYA 3B82A 5HO4A 4C48A 2VDIA 3TAPA 4OYIA 1HNXJ 2HWTA 2X1GA 2XY7A 3U02A 4ENOA 2XYHB 3KYLA 2UXCF 4GVBA 3KFWX 4AYBD 1NKCA 1HYSB 5BR8F 1NK7A 4AQYF 3WX4A 2LYVA 3MEDB 2MKKA 5KT4A 4DX8H 2HYIB 4DV6F 1NSPA 5K14A 2CQ2A 3OBIA 5U47A 3GFHA 5KFAA 2B6AA 2JC0A 3RRGA 3QATA 3EJMA 1HI0P 4CH7A 4OHWA 4M8LA 2R7SA 2ZZMA 3BREA 1TMMA 3D28A 5KFZA 2V2VA 4NPOA 4X4TA 2E1AA 1R6YA 4CT9A 3R8YA 3K5OA 3EGNA 4M5HA 3BYPA 3K58A 2F8MA 1WHVA 2E7XA 4C7QA 1S7HA 3J7YI 3ZC4A 2QL7B 1FXLA 4TY9A 1ULRA 4XDCA 3CC7S 4FPRA 4ELVA 3A8JA 2FVCA 3AJ1A 3QBCA 4DV3F 2DR8A 5THWA 4ZP7A 1IQZA 3BGUA 4CWBA 3PFOA 2EFGA 5ETTA 1L5UA 4USVA 2KRBA 1UCNA 2IDLA 1LFWA 3IWNC 1T9YA 5LMNJ 1NPRA 4ECUA 1PO6A 4WP9A 5BJRA 3OVBA 2CQDA 1TFWA 4JUZA 1EQ0A 2N3LA 5D0GA 3RRKA 2DKOB 1GNKA 3TP2A 1NSKL 1IM6A 3LAMA 5DG7A 4JYAF 1XR6A 4I4BA 3DOKA 4TNOA 2FTRA 3NMRA 5KFRA 3OQ2A 1C4CA 4DV4F 3SFUA 3T1HJ 2LQ8A 4NASA 1BD6A 2WTFA 3DRRA 1N6QA 3Q83A 1TMJA 3W64A 3IP0A 2BKPA 4GVLA 2R2RA 3M6UA 3FNNA 4JP8A 4O0IA 5CH7B 3HI9A 3UI3A 1WC0A 1IBLF 2F5GA 1KNZA 2I6WA 2D74B 3ET6A 3HPOA 3NAHA 4KSEB 2O1PA 1RTIB 4GRSA 4Q0BA 4DR3F 2OAUA 1Y9OA 5E3PA 3BSOA 1ELOA 8ATCB 2BUNA 3T1YF 2RF2A 3NS5A 3FBCA 1QE1A 1T3NA 1RKJA 4RNHA 4P2FA 3UNYA 1HW8A 3UFCX 4C0OC 2F9JA 3M8PB 3BQ1A 1V5IB 2FJVA 2Q6CA 3UD4P 4RU2A 3RB4A 3JSMA 1OPIA 5D15A 4QWBA 1VRTA 2FB0A 2BRKA 4OX7A 2DEIA 4CIOA 4A8OA 5HVGA 2XS2A 4RUAA 1EKRA 2EFOA 2FQQB 2W8KA 3E51A 4DR5J 1TL3A 5C42A 2QE5A 3SBMA 4N47A 4ED2A 2HK2A 1VC6A 3KJNB 2JEJA 4CLLA 2ZKUA 3OFHA 1SC3B 1OSDA 5I3QA 3AQPA 3LPEA 1BQNA 2GQCA 3GV8B 3H5SA 2AJ1A 1S57A 2MKHA 1ZZNA 1RYSA 3D0HE 1NB7A 1VYAA 3M2RA 4IRCA 5IT9U 1RT5B 3N4WA 1WOSA 4BLGA 4NRUA 3H59A 3I6PA 2VIHA 5F8NA 1HBMB 1R0AB 4UZBA 2V4JB 2ZNYA 1S1UB 1FFWB 5L1IA 3N0VA 1S1VB 1EETA 1TKTB 3CC4S 2BKNA 1FJCA 2OGUA 2JOQA 2M7SA 4NXNJ 4L74A 2N4DA 4K4TA 3U27A 1NHKL 5EDWA 1YSJA 1IXKA 2FJAB 3P3DA 3ILLA 1TKDA 5CCMA 1V6HA 3MEEB 4O44B 4Q2LA 2YNFB 3M1VA 4HYKA 5D4NA 3MM6A 3HP6A 2HMIB 4FF3A 1FDDA 2VL1A 5L46A 3CCLS 3VGVA 3OLAA 4LF6J 4L72B 1U2CA 2W9CB 3THPA 1FNMA 1TVRA 3NGTA 4YDDB 4J9KA 1F9EB 3L09A 3DI6B 5B0BA 2DIUA 3PY8A 2IIHA 1LXJA 5T7LA 4CLKA 5BR8J 4KO0B 1I6JA 4RUHA 1S4FA 4I2QB 2P5VA 4DEZA 3EGWB 4DV6J 3OXGA 3M8QA 1TUWA 3CE8A 1ZA2B 1RTJA 4M94A 4ZA1A 2AD9A 1YI2S 1RB0A 4IOBA 4CYUB 2RQMA 3KLFB 2GIQA 3JQKA 4LT6A 4QCLA 2CPEA 2B56A 6FD1A 3NBPB 2F63A 3PRDA 1TL1B 5F8HA 4DBQA 2XGQA 1N32J 1U7LA 3C6TB 1HWKA 2DNQA 3PYGA 5D6GA 1D9AA 3MR2A 5KFCA 1FWLA 2ZOGA 4UTGA 1BY9A 2VG7B 4TY8A 4GVBB 3UE2A 1RBOB 2WVCA 3IRWP 1DRZA 2V63A 5IV4A 1DQ9A 1NJIT 4DV3J 1S6QA 5D0EA 3DU5A 3KK1A 2M9KA 4NA3A 4RUBA 4I6AA 4CO1A 4CTAB 1HNWF 4DUYJ 5K14B 1RT1A 1SH2A 2PE8A 4QIEA 1BE4A 1HARA 2ZEJA 3PX4A 4X62F 4FXVA 1H98A 3W2WB 4ID8A 5KG4A 3KTQA 2AJQA 5FJ4A 3A8KA 3DLKB 2AZ3A 2FJDB 4PEOA 4JV0A 1MMLA 2R8HA 4JYAJ 2JLFA 4DL0C 1DAXA 2DPIA 1X0PA 4IFVA 1KQSR 2CPDA 3HHLA 5HSPA 2BW7A 4DV4J 2J0WA 1NK9A 3SXLA 3DXBA 2UUCF 3CT9A 3QGHA 4I64A 3NCPA 2K8GA 5CABA 4MK9A 2UZAA 5KFBA 4RNOA 5LM7E 4USUA 3U1NA 4QWDA 4KPYA 1CVJA 1RAOA 3IC1A 3IMQJ 3MPWA 1JLBB 1DURA 1RHQB 4YR0A 3A4TA 1OY9A 1IBLJ 2R4FA 3FCHA 5M2PA 2LEBA 1RAJA 4QWCA 2DGUA 1Q8IA 1X9MA 4G1QA 4AXIA 2JLGA 5A76A 1T95A 4A4JA 4DR3J 3QSYB 2V4RA 2DR7A 3TWZA 3RR8A 5GAEI 4UOHA 3MI7X 1UW9A 2E5LF 2U2FA 3DOKB 1FFGB 2M2BA 2ZH6A 4YEAA 2PDAA 4L6V3 1RAHB 1NO8A 2JNJA 3NG8A 3LWLA 4F4WA 1WDDA 3EICA 3DRRB 4LF1A 4TU7A 3MEKA 4OYZA 4RU9A 2FY8A 2P9CA 1HD1A 5DZ6A 1B70B 3BH6B 1OQ6A 3CMAS 5HQLA 4OX8A 3LGNA 4F7VA 2BA9A 3RB3A 1JJHA 3ET6B 1CS4A 2XI3A 4LFCF 1YX2A 2CQPA 2HFZA 3T9NA 1UVLA 3J7Z5 3BBFA 3RYLA 3AXMA 4WP8A 2OEKA 4ZS6A 2OPSB 3D66A 1UWBA 2ZKTA 2YX7A 3RRHA 2RF2B 5ETKA 1JNZB 1S77D 2HFNA 1QE1B 3MEGA 2LA6A 2AX1A 1PBUA 4NLWA 1NK0A 4C8YA 4JV2A 3MD3A 2VA2A 3QT5A 2WCXA 3NCQA 5J2NA 3MAAA 3DYAA 4TXSA 4JI1F 5KOXA 4RX6A 3QAUA 2EVZA 3M8RA 4EO8A 3KXDA 2XO7A 2PEHA 2BJ3A 1G4CA 2QO3A 4YB1P 2K1RA 1GT8A 3EDQB 4I6YA 1FKPA 5KT3A 1OJ4A 1TL3B 4NCGB 4LIWA 2FHJA 2QA4S 2KT5A 1GAOA 1X4GA 3CIZA 5B0EA 4DOZA 4DQSA 4CCHA 2ZBPA 3L7PA 1U24A 2GNKA 3MZIA 3VGUA 2KXNB 5BYQA 1QD1A 4WP3A 4OLOA 4R0JA 2DD8S 1VQMS 3KKFA 2Y0BB 4RNFA 1T02A 1RU2A 4Y2CA 3EXYA 3V81B 1FRHA 3H4BA 3PR4A 4DV7J 2XM3A 3J81Y 1JX4A 4U8YA 1M5KC 4LF7F 1MN7A 2AJ2A 2CXEA 4ZLJA 2DXFA 4OJ1A 5KT7A 1SUQA 3UWTA 3DGPA 3MM9B 1VQ6S 3D3BJ 4DU8A 3DOMB 2Z8QA 4OFZA 1DARA 1VRUA 3L7UA 2YWWA 2DH7A 2NLWA 3M32A 1RHJB 2P8IA 1FE0A 3QGGA 4FKYA 1B64A 2BQUA 1RWPB 2H4YB 3M2VA 2HNZB 3OTBA 2QZ8A 1YJUA 3GFZA 1WF0A 1F5BA 4OHZA 3WZ0A 4C3MA 5KFYA 1UEKA 4NLUA 4RW4A 4V19X 1G2EA 1LKZA 3CJTA 2UVVA 4IG3A 3O6QA 4AFFA 1Y11A 1YJNS 4NA2A 3ELHA 4M5GA 2I2YA 1S10A 4RW9B 1PYTA 4M5JA 3DDNA 4F26A 1YTYA 5DGAA 2UVUA 3F56A 2HSEB 2XGPA 4HT7A 2GIRA 1TVRB 3SCKE 2OMLA 2MQLA 2PMZD 3ZTOA 4O0NA 3W9HA 3BPDA 3PNIA 2QA4G 4PG7A 3BGRA 2Z0GA 5T7LB 3ENWA 4LFBF 2DITA 4HH0A 1H74A 1SCJB 4MT1A 2MZRA 2QTWA 3E8OA 3KMSA 6FDRA 4UUWA 4DDFA 1H73A 1U6ZA 4B9TA 3R27A 4DR4F 3MR5A 1UMJA 3CPWR 3H5XA 2X1BA 2DGQA 4IDKA 2KFZA 2EFQA 1SQEA 4MAKA 4P2SA 3DM2A 5KT2A 3I0SB 1WOOA 1SXLA 3FK4A 4OQJA 1D8ZA 2KZMA 1S48A 2CQ0A 3CCZA 2EPIA 4CLSA 2BQ3A 1RACB 4X4PA 4YDXA 1HNIA 2AX0A 1PCAA 2PC6A 5DZ7A 2HKEA 5KFOA 1O0PA 3RB6A 1RP5A 1RLDA 3TZYA 1X7VA 2VPYB 4C11A 2ZH9A 4TY8B 2KJVA 2MYFA 2FD2A 2BANB 4KQZA 2AGPA 2C2RA 5D3GA 4ED4A 5IV3A 4P71A 1H2TZ 2XMVA 1MSWD 4ELTA 3TJAA 1S1WA 2OD6A 2C22A 3L4BC 2BKOA 3QMQA 1B3TA 1PC4A 3ENAA 2YH0A 3CD0A 5B0AA 1LNQA 4EU0A 1S4EA 3NGUA 4U8VA 2KI2A 4IH5A 3NMAA 2ALZA 3IGVA 1EQMA 1VBXA 5CZXA 2NSBA 3TEGA 4J9LA 5MLCV 3HDSA 4IFVB 1B0VA 4DV0F 5LL6d 3HULA 3HHLB 1I94J 1C1BA 5L1JA 1RYRA 2QLJB 4DQQA 2M8DB 3G87A 2RHQB 2PA3A 2D3O1 4DHVA 4WXOA 2A10A 2JJ4D 4PG4A 2WVFA 4Y2KA 2JLEA 2AEFA 3BR9A 1N88A 3MMAA 4DL7A 4DZDA 3I0RB 1N36F 4LF5F 3P96A 2FIUA 3NL0A 3J81j 2NPIA 3HHDA 1Z1ZA 1WEXA 1MG7A 1ZM9A 4XTTA 1RABB 1M0SA 1FDAA 2HG4A 3BEGB 2D3UA 4OIXA 5KG2A 3CMQA 2VC1A 1VCTA 2Y1RI 3Q24A 4ZJLA 3C66A 2XMUA 1CC7A 1S12A 2AYEA 1IWGA 1QAJA 2HPUA 1SL0A 4HHHA 1IKWB 1DLOB 3HZEA 4ZCKA 4PQAA 4XPCA 4KPCA 4LF2A 4JI8F 2DR9A 4JI1J 4M5MA 1EJ7L 1FE4A 2ZD1A 4I1TA 3Q8RB 4F25A 4IH7A 1NKBA 1P9QC 4DN0A 1HKAA 2IAJA 4DR6F 4I56A 2LA4A 5JVHQ 1RT2A 3TANA 2VASA 5CYJA 2WZ1A 1VBYA 1WF1A 3GQCA 3IG1B 1SV5B 4P75A 1WI6A 3K7RA 4USHA 2HVZA 5A6WA 2DEJA 3J81U 2ZUGA 1RWVB 4K5SA 4BWJA 4PWDA 3MEGB 2F3JA 3QPIA 2LXUA 2UVWA 5DO2A 3W7BA 4F3OA 2VHGA 4LF7J 5J2NB 4HACA 5AJ3J 3MAAB 3DYAB 3SCJE 1IUJA 1T8EA 2NXJA 2Y3YA 4F8RA 2RSQA 3BGLA 1RXOB 1AFIA 3IBFB 2VFTA 2K1RB 1FKPB 2OPRB 4H4OA 3V6KA 2EK6A 2AYBA 3CJ4A 3MM7A 2AGOA 3VVUA 2IC3A 1M1KT 1RISA 4RPFA 2XMAA 2OTLS 3IS9A 3FQKA 4X4SA 3G6XA 1XMBA 5G0RA 5GMKa 2GHWA 5ETOA 3M2UA 1IKVB 4Q43A 2OFHX 2W25A 2DNKA 3GYGA 4P2XA 2KHDA 3QRPA 2H65B 3JTOA 1V9OA 4B9NA 2ILZA 1WC4A 3AHPA 3DGPB 1BWEA 2IY5B 2AIRB 1AROP 3GV5B 5E2QA 3HZGA 1AZSA 2EK1A 2XC9A 8RUCA 1HI8A 4IYQA 4LFBJ 4DSFA 1H72C 3W61A 2HS4A 4JI0F 4C9DA 1NK6A 2HNDA 3KJFB 3UW1A 2EKYA 4DR4J 3P49B 4RW4B 4USMA 1NUEA 2POKA 3T19A 4M95A 3OVSA 4IG3B 4DLGA 4DUZF 2PEBA 2CZ9A 3G8SA 5K8OA 1N5YB 2F65A 4MIAA 1U2RA 3MCNA 3FCWA 2YKNA 1RK8A 4FF2A 2HVEA 4B9LA 1PJ5A 5DQHA 2CFXA 3OTCA 1HNVA 4KHMA 2H5IB 5I4MA 1YDLA 5IM0A 1GXUA 1T9VA 5IQQA 3BGRB 3VALA 2J9EA 3OFFA 2BQRA 5J2QA 1QSLA 3T6BA 3US5A 4PPZA 1UTAA 3BGOP 3IBWA 1A9NB 1UFLA 2MZQA 2VG5B 1S76D 3P5TL 3SI8A 2M8HA 4IDKB 1XMOJ 3TJ9A 2KVQE 3W2VA 3DM2B 3N6NA 4LRAA 1FTRA 1JXLA 2UVRA 4OHYA 1YQHA 4Y6IA 1RAIB 3PHTA 3ITHA 3MD1A 4DSJA 4X66F 4X4RA 4GKKF 3A8EA 2DPJA 1PJ7A 3GIKA 2ZC4A 5F8GA 2P9EA 1HNIB 4RNMA 4ECRA 4X65F 4O3QA 3LO3A 4USWA 4DV0J 4DQPA 3MOJB 3BKUA 4TN2A 2BXJA 4B3SF 4LFAJ 4LRBA 1ZZFA 1N0UA 4C8NA 2E9ZA 1HQUB 3LALA 1JLQA 2O66A 1APSA 2KN4A 3CW2C 1RT4A 2XLIA 3A3OB 1HHTP 4PG8A 1WELA 3ENVA 4MYTA 1KR4A 1N5SA 1FDBA 1S1WB 1LWEB 1XNQJ 4B9MA 2RMLA 1WORA 3EM1A 4W92B 4XIUA 2G2OA 3PIOQ 1UZHA 4PYDA 1N36J 2GJIA 1FESA 3KLEA 3NY0A 3DRPB 4HDGA 2KH9A 2ZDOA 5IFMA 4Y34A 2IBOA 2LEAA 1PJ6A 2EC0A 1UKUA 3M9MB 2GZOA 4ZDNA 4CNYA 2MB0B 3NS7B 3HHNB 1C1BB 2NXCA 5GMDA 2UU9F 3HO1A 1QAIA 1AUSL 5BYSA 5KFDA 2V68A 2MJNA 1YBAA 4WF9Q 5B09A 1GK8A 5JUMA 4LF8F 5IT0A 5I3PA 2GGPA 1V3SA 5IC6B 4DR6J 3QRQA 2EWHA 3CVKA 3MR7A 1Q7YT 1Q0NA 4LF9J 1GMUA 4L73A 2JWNA 1REGX 4ED1A 2QRRA 2VQFF 2HRYA 2G4BA 5KTQA 4DMZA 1SKRA 2ZJRQ 3DDIA 3NP5A 8AT1B 2KB2A 1RA7A 3H2UB 2JC1A 3H5UA 5HATA 2VICA 5M2RA 3IWLA 4P7VA 3AJDA 5ETLA 3HD1A 3G8TA 4ZVSB 2B5JA 4W4MA 5FDLA 1B7YB 2IAJB 5JMNA 5KFFA 2ZOFA 4X84A 4G6VB 1DY3A 4DS5A 1GTHA 4CO0A 2DY1A 5F9NA 4DXLA 1JKHB 3WIVA 2RD5C 2LFVA 2W7OA 2N4CA 3CJ2A 3D6FB 2CJXB 3GE9A 1GH8A 2R3VA 2R8IA 2JFKA 5KFMA 4PWDB 2O67A 4K0KF 2ALYB 4X4VA 2M70A 4KR0B 5J2PB 3OL7A 2XHWA 3UDLA 2XSJA 1OYDA 2M3DA 1NCLA 4F2SA 3MMCA 3DOLB 4LRCA 4C3LA 4A8KA 5KOWA 1N34J 3AT1B 4ZVGA 3V6DA 5H9EK 3TQ1A 1FJGF 4JI0J 3QRRA 2DISA 2DHAA 2EXUA 3SCIE 2RDIA 2DNGA 4OYXA 3IS9B 2OH2A 3FSIA 1MMNA 1HW9A 3GG0A 5GAHU 2BJ9A 1TZ0A 4PYAA 1D9DA 5LT5A 1QUPA 1UVMA 3C14A 1TU0B 3EGZA 3EX7B 1ZPVA 3EZUA 1KTVA 2V9KA 4L76A 3S01A 5DDQC 2PT0A 2WVBA 2KFNA 1RT3B 3UPFA 4ECSA 4O4GA 2DRDA 2UV8G 4N76A 4C0HA 3C2PA 1NH8A 1QTNB 3H20A 1AZSB 2VFUA 4NX9A 4E8UA 4DZ6A 3QQCD 1T03A 5EWEA 4TLQA 3GFXA 2BZ2A 1GX6A 2SXLA 3QLHB 1HBNB 1A6LA 3MAQA 4LF4J 1OMSA 2ZVSA 1GEHA 3FDSA 2KTQA 2HNDB 1JLGA 1WOPA 2DHHA 3QSIA 2HURA 3W60A 1S1TA 1SJRA 4LR8A 1JIHA 3H5YA 1S0VA 1FF2A 3EVWA 2HQIA 1FRXA 1CJUA 5KAKA 2IPOB 3BF4A 2W9BA 2MKIA 2MY8A 3V5RA 4X66J 4NCAA 4GKKJ 1YWXA 4WKYA 2HIQA 4PUOA 3HHLC 4X65J 1QLNA 1S99A 5HBMB 4K7QA 4W98A 5H9FK 3FMBA 2IA6A 3B54A 4B3SJ 1NK5A 3M8WA 4C8OA 3TAMA 4W90B 3NNAA 4RBUA 4QW8A 2YPZA 2QGFB 3ZTSA 3DLLQ 3V4IA 4DUTA 2BX6A 5HMWA 2E9TA 1SJ1A 2V94A 4I7FA 1FD2A 4DSLA 1SJQA 3FMWA 3W1YC 2AJ0A 5DQGA 3W2VB 4FKXA 1IBMF 3GZ7A 4A8YA 2BE2B 3FZBA 4ZN1A 3ITHB 5BXIA 4LMZA 4URQU 2ZVIA 3GYXB 3Q8YA 3OSPA 5A8KA 3MPYA 2DO0A 1KTQA 3N79A 2C3YA 2UU9J 1Y5LB 3KUEA 1P6TA 5D78A 9RUBA 4EZ6A 2D9PA 3VZHA 3Q89A 2CADA 4K8RA 5EUHA 2CPHA 1U1LA 1S9GA 4NLPA 1RT4B 2CA9A 4KBIA 2HAIA 1RJJA 1KWMA 4LF8J 1YJRA 4IOCQ 3PG9A 2GMHA 2PFDA 4NLDA 4KHPF 1RWNB 5EN1A 2RB7A 2H48B 4F04B 2OPQA 3LQVA 3PHEA 2VA3A 2YKQA 4NCBA 1DTQA 3FBEA 3HXMA 2FJEB 4USKA 4FPIA 4K4UA 3KMQA 5HJXA 4DG1A 4WFXA 3A3NB 3VV2B 3A3PB 1B0TA 1RBAA 4IR9A 2R7UA 3N6MA 1WTBA 2W2NP 3QNWB 4ZLLA 2VJUA 1BWVA 4XPEA 2MXYA 3DLEB 3D1OA 3F0NA 2AYMA 3P6YC 3MUTP 4UY85 3DGVA 4ETZA 3MDFA 3LF0A 3D1QA 4DI6A 3PR5B 1HQ2A 4KGMA 3ZZPA 1EARA 3MMBA 5KFGA 2R42A 1VQSA 3TARA 2NS1B 2YQ3A 5IWAJ 3W9IA 2FC9A 4I6WA 4I2PA 3KLVA 2RKIB 1H7WA 4K0KJ 2DCLA 2M88A 1HWIA 1H3DA 3ZZRA 1HI1A 4X4QA 1KQKA 1J5OB 5KFNA 2E1RA 1SKWA 3KK2A 4NLQA 1HMVA 2B5JB 5FDLB 3LP1B 4KJIA 3FSYA 2MLZA 2PI4A 1NSAA 1FX4A 3PTWA 4ZP9A 3QAEA 2P6SA 1D1UA 2MQNA 5ETMA 1FJGJ 1SIZA 4QWEA 2C2NA 4B17A 2GW8A 3OTEA 1NPPA 5KG3A 2IVMA 2MPUA 1UETA 4WPAA 2GAGC 1RSCA 1VQLS 3GYNA 1HR0F 4BS2A 3NOGA 4WK1A 1HYSA 3QJLA 1SC4B 4EBEA 2LQJA 1UFKA 3TVYA 2AEJA 3MEDA 3O8WA 3TUIC 4ILMA 3H40A 1KHVA 5M2UA 2YNIB 2BACA 4FNIA 2VV5A 3QO9A 2WVDA 2IM0A 3R97A 1XN9A 2QFIA 2VBXA 2XSJB 4FP9A 2ERRA 3R1HA 1U8SA 2LP4A 3NNHA 3MMCB 3HHLD 2BVZA 3GIRA 2HHXA 4GKJJ 3R2CJ 2C3OA 3OL8A 5GMEA 3NWRA 1GTEA 3H2VE 1XR7A 1YHQS 2MGZB 3AODA 1VIOA 3L95X 1HNXF 3LUYA 4C8KA 1VQOS 4YOEA 2ZUAA 3OVAA 3TVKA 4MFBA 2PI5A 2BBEA 5I3UA 1TAQA 4L3KA 1TKZB 1SBRA 2QJ3A 4FS2A 3RB0A 1TAUA 2B9XA 2F1FA 2I5JA 3CUNA 3TA2A 2XMTA 1OSCA 5CCLA 2FZGB 5EWGA 3KLHA 4DV1J 1T03B 6AT1B 2KT3A 1FXRA 2OELA 4F36A 1PYOB 4OMFG 3MR3A 3WQPA 1L3VA 3ZNJ1 2Y9HA 3Q8UA 4K4XA 4WU3A 1JLGB 4CLFA 1KOOA 4B02A 2EEYA 3G86A 3I4PA 2QT7A 2LCWA 4Y28C 3I9V9 3D9BA 4ALZA 3MUVP 3NNCA 1NZAA 3KK3A 3ZZTA 1IBMJ 1F9HA 1QAXA 3QWUA 4RLEA 4EWTA 2YWGA 1CJUB 3K2YA 2HFUA 1ITPA 2W9BB 2XCAA 1WG1A 2DCUB 1NDPA 3AOAA 4ER8A 5ETPA 2CG8A 4OZ5A 3MCSA 1T9TA 4DL2A 2KYXA 5BYRA 1KHWA 4QIWD 2DVIA 1N4LA 3TAMB 3KHLA 1RTIA 1YRXA 4P9SA 4B3RF 3B4DA 2Q43A 3WC0A 3AQOA 2R7XA 4B3OB 2GAHC 3RBDA 2YX4A 1JQGA 1GXTA 2KM8B 4ECTA 2B51A 1FRMA 2K3KA 3M6VA 4ERDA 1N54B 4KHPJ 3M8PA 4F67A 4AE5A 1S6OA 2Z56B 2GQQA 5KFPA 2FHJD 3OUYB 1M5VC 4B3MF 4QR1A 2G9OA 2HWIA 1C2PA 1W7WA 4HI2A 4FYYB 2MHNA 2ZBRA 3GG1A 3CCQS 4B08A 2ZH1A 1FT8A 2UXDF 1WG4A 1Z2ZA 1FRLA 1TTHB 5D0HA 2OP5A 4DL6A 4IRKA 1S9GB 1RT6A 3H25A 4DWIA 5C2CA 4KGXB 2YPYA 3PJXA 4HVZA 4ZP8A 1Q79A 3KLIB 2YH1A 5I42B 1NPKA 3Q0AA 2C2MB 4CLPA 2FLOA 3H90A 2P6TA 1URRA 4N77A 4CO4A 3JAMY 4F4ZA 2DH8A 4ZPAA 4M1KA 3HKWA 2YVSA 3QT7A 4O3PA 2C3MA 4C8ZA 2JFDA 4O3NA 4KY3A 3OLBA 1HBMA 2OPQB 4WE1B 3VTIA 1DTQB 5E3AA 2DT9A 1N5QA 4LBIA 1IJFB 5KFSA 3GV7B 4X4NA 4OL8A 1S1VA 1TKTA 2AU0A 4NEYA 2CVIA 3GLJA 2AHOB 3ZZZA 3T1AA 5LJ5Y 5HMXA 1GXLA 2QLWA 3M8YA 4UF4A 2MZ1A 1SJ4P 1DTTB 1JWWA 7FD1A 1Q8BA 2HEKA 3MEEA 2XEXA 3N5BA 1JLEA 2VPXB 5KG5A 3CCUS 1IKYA 1X8DA 3LGMA 1Q4RA 1UW4A 2E1PA 2HMIA 2BJ8A 1H2UX 1C4AA 2HNYB 2XG8A 1GX5A 2BM1A 5IT9Y 3MMBB 1YLXA 3R5AA 5HLFB 3HVRA 2IJNA 3F73A 2YKMB 3KNAA 2JEFA 1U1NA 4OHVA 1HR0J 1P1LA 3MHYA 1RWMB 2HQCA 4KO0A 1MNEA 3D0IE 3BN7A 2AWZA 4NLGA 4R0EA 4P72A 3OPKA 1KBRA 3FFIB 2G0JA 3FZ2A 3DRXA 1U25A 4Q45A 3G82B 2B4VA 4YUDA 3D6MB 4M5LA 3QT8A 1VQ9S 3NBPA 4ZPVR 1TL1A 3AOBA 4K5RA 1NRKA 1S9EB 5D4PA 3C6TA 1NXIA 2OTJS 5DG9A 3I5BA 1XK8A 1M1GA 2FY1A 3KJQB 1J5EF 2VG7A 1T05B 4DPYA 2IA0A 5L38A 1QM9A 5LSLA 1ZOTA 4DSEA 1DQ8A 1UJ4A 4CTAA 1KFDA 1GQEA 5B0GA 3SQOP 1QVFR 4H4MB 3QO9B 4PPDA 4YB7A 3BH7B 3HSGA 2WK4A 4ZPDA 2FDNA 2GMJA 1MWZA 3UCZP 2LKZA 3W2WA 2A2CA 1M90T 4DLEA 5HK4A 4EBCA 2XWXA 3N9UC 4YB6A 1IVZA 1K1SA 4P7TA 1M5HA 2CZVC 4A8MP 5HL7Q 3UO0A 3DLKA 2CPXA 4F0MA 3I56S 2Z2YB 1N32F 1XMQF 3EZOA 2PN6A 2QX0A 2HZVA 2J0XA 3CDUA 4IH6A 1E6VA 2V8GA 3PW7A 1Q95G 1KEKA 3M4XA 4MFBB 5HN0A 2O3DA 2NYIA 1J2VA 4J9VA 5LOQA 3M9OB 3ETOA 4Q7AA 2GO8A 3K5MA 5I3UB 3SV3A 2MDAA 3TI0A 3W66A 3FC9A 4DUYF 2FLPA 2CJAA 1BQMB 4G1PA 2I5JB 1CQMA 4ECXA 1JLBA 2VONA 4P74A 2R2SA 1ZYQA 3KLHB 1FK9B 2B43A 3C15B 2G1DA 1CULA 2N82B 1X60A 5K8NA 4B3RJ 2CQHA 3CCRS 4NZ0A 2D41A 1R0BG 2YWHA 1URNA 1VHFA 4U9RA 3CIMA 4ZVPB 1Z4UA 5CYQA 4ZJOA 2FJXA 4JI4F 3G6ES 1NHUA 3W63A 1XJWB 3TRGA 2HBZB 1NH7A 3PRBA 1XTZA 3KK3B 1RUSA 5F3ZA 2DNRA 2UXBF 3Q2SC 3W8PA 1VQNS 2PFFB 3MTKA 1F3FA 4B3MJ 4KV8B 4OX9J 1IM4A 1IR2A 1YBTA 3FBBA 2CG4A 4UT4A 1WC3A 3RU0A 3I31A 4MIWA 4H54A 4RKUC 2Q1LA 1AUDA 1S6PA 2KL8A 1U0HA 2UXDJ 1HD0A 2V8VA 1VHIA 2DBBA 3RR7A 4TU8A 2ZH5A 3MPVA 3JAMU 1HQEB 3IAS9 4QYZK 3MR6A 1VQ7S 3ZTRA 2OPSA 2VFRA 1YBUA 4DS4A 4ZVOB 3KNGA 3BKTA 4L3NA 3ILOA 1H0HB 3GP9A 1F2HA 4DL3A 4M5DA 4J7CA 2ZZNA 1S72S 1A7GE 4TKTA 3CJ5A 4OI4A 4NWBA 2QG9B 4NI2B 2DHSA 2GIFA 4WKRA 1U1PA 1Q7LB 4LR7A 1NJXA 4KFBA 1MN9A 1YZ7A 1UEVA 5IOLA 1NDLA 1REVA 2V8PA 4NCGA 3LTOA 2KKHA 5A8RB 1UAWA 2ZH3A 3UD5A 4KAIA 4ZPTR 4NXMF 1RT6B 5CAAA 4V19J 1S6UA 5ADZA 3ZTPA 3DNCA 4OI0A 2NUHA 1XWLA 4YQWA 3OD2A 3NGSA 3BQ2A 2MLYA 2E5HA 3V81A 2IM2A 2IRUA 1YVFA 4ELUA 3JSBA 1KQFB 1FJ7A 1X4BA 4YN3B 4QPXA 2YNGB 1OPZA 3Q8QB 3MM9A 3ONQA 3GFYA 3DOMA 2ROPA 4C4WA 2VG6A 1WHYA 2XULA 1AYEA 2XMKA 2YY3A 4N56A 2NREA 2N3OA 1R31A 2ZC3A 3I9ZA 1U8WA 5F0WA 2HNZA 2XBPA 5KFKA 3CCMS 2LLZA 3G6VA 2CPFA 3R2DJ 3CCTA 2HGLA 2WB4A 1U26A 1G3OA 3MF5A 2AJFE 4E2FB 5IT4A 5A8WB 1JLEB 2Z30B 5AXMA 1L3TA 1IKYB 2OKQA 5IQ6A 3I32A 5T41A 4A8WA 3FRYA 4RW9A 2V6AA 3CDWA 3BSNA 5SUHA 3CDAA 2ZH7A 3BJYA 4DX6A 4DV7F 4JB8B 2OFGX 2EFVA 3H4DA 1RDRA 4Y65A 5D77A 3GJSB 3K8WA 2CPJA 3HVAA 3CULA 4ECQA 4QR0A 3NGDA 2DGXA 2JVRA 1M1HA 4IO1A 5JXSA 3W5YA 1J5EJ 4WXWA 2CJQA 4QPTA 2Q6BA 4HLBA 3EYZA 3TX8A 3OT9A 5KFTA 4Y2MA 2HHQA 1Y0HA 5GADU 1LV5A 1NBEB 1KN6A 1U02A 1IR1A 4O3RA 4FZVA 1CLFA 3DLGA 3CJKB 5HANA 3UVJB 2E66A 4PG5A 2WSFC 4BHQA 1M5PC 4R25A 4AXJA 3CCJS 3KHHA 3I0SA 2VQEF 1SVDA 2QIFA 3Q8PB 3BDPA 3GSDA 1U6FA 4AL7A 2DH9A 2ASDA 1S79A 3UR0A 1LWCA 5SZTA 1XMQJ 1OIAA 2I9SA 3RUBL 4IOAQ 4A47A 1ZM4A 2XSFA 1BMQB
chains in the Genus database with same CATH topology
1RT7A 1VS3A 2BV3A 3KLFA 2MJNA 1YBAA 1X9WA 4BBYA 1FNXH 4WF9Q 4RW6B 5B09A 2LMIA 2BANA 3OTDA 4Q44A 4F2RA 5JUMA 4LF8F 4O23A 1RTDA 5HLFA 2WBMA 5IT0A 3E2EA 5I3PA 5CHCB 3C6UA 2GGPA 4WFAQ 2JX2A 3O5TB 4C8LA 2OMOA 3GWCA 1ZPWX 3DRSA 4RBVA 2YKMA 2VBWA 2UV8A 4USIA 3MURP 1V3SA 2CPYA 4LF6F 2R2TA 3UDCA 3IXQA 5DQIA 4ZHRB 2YX1A 3S8SA 3B82A 5HO4A 1D8YA 2EWHA 3PKMA 3TAPA 3CVKA 2RS2A 2RNEA 2HWTA 2X1GA 3VAFA 1D3WA 2K7KA 1SH3A 2XY7A 4ECWA 5GAHI 3U02A 2FJBB 1Q7YT 3B8HA 4YFUA 2IRYA 4J9PA 2VBYA 4JV1A 3ULHA 1S1XB 2BABA 3KYLA 2VD3A 2UXCF 2RRBA 3KFWX 4AYBD 1NKCA 2JWNA 4H4KA 5KFIA 1HYSB 3FEYB 4QYZJ 4ED1A 5BR8F 2QRRA 1NK7A 4AQYF 2HHUA 3R5BA 5E5NA 3WX4A 2VQFF 3DC2A 2HRYA 5JVGQ 2G4BA 1FXDA 2LYVA 4ZPBA 2RJZA 4DQIA 5KTQA 3CWJA 4DMZA 3MEDB 3FFIA 2MKKA 5KT4A 3KJVB 4OI1A 4DX8H 2R9LA 1SKRA 3RW6A 5E33A 4K4ZA 3K0JA 2E1MC 1V3ZA 4DV6F 3H98A 2GMLA 2HYIB 3R3TA 4ZVHA 2ZJRQ 2C2DA 5K14A 1HPZA 4QYRA 3NP5A 5L9NA 2CQ2A 3OBIA 5L8RC 2W7AA 2KB2A 4F4YA 5U47A 4CO3A 2KM8C 1VI7A 4K4VA 3GFHA 4G1QB 5KFAA 2B6AA 2JC0A 4FF4A 2IBKA 3RRGA 4EFAC 1AFJA 1RA7A 2QA2A 3H2UB 3UNGC 4YHHF 3KHGA 3BO2A 1E6VB 2JC1A 3H5UA 1S9EA 2GC8A 5M2RA 3IWLA 1HI0P 2LXIA 4OHWA 4P7VA 5DS7A 3WBZA 4CH7A 1MROA 2AJ4A 4QR2A 4M8LA 3G8TA 2R7SA 2ZZMA 3BREA 2B5JA 5FDLA 4TQSA 3D28A 5KFZA 3G71S 1E6YA 5KG7A 1WD6A 2IAJB 4NPOA 4X4TA 4MJKA 2E1AA 2W4PA 1R6YA 1HBOA 4ITSA 5KFFA 1SC6A 4CT9A 2ZOFA 1BC6A 3B4MA 3IAM9 3WDOA 1T05A 3C3LA 3K5OA 3EGNA 4X84A 4G6VB 2LVWA 2F8MA 3K58A 1WHVA 1CSJA 2E7XA 3O1LA 4PQUB 1H6KX 4C7QA 2H5EA 4DS5A 1GTHA 1S7HA 2IYGA 3J7YI 4CO0A 2BDPA 3PKYA 3ZC4A 5F9NA 3G9CA 1WEYA 2OSRA 3I0RA 1JKHB 2VOOA 4BWMA 1FXLA 1ZAVA 2RD5C 2MJUA 2WW8A 2FVRA 4TY9A 2W7OA 1VQYA 5AXKA 3DDKA 4H4MA 2N4CA 2OD4A 1ULRA 4XDCA 5F3TA 3CC7S 4FPRA 4ELVA 2FVCA 3AJ1A 2Y0SD 3CJ2A 4DV3F 3D2WA 2DR8A 5THWA 3KOAA 4ZP7A 1IQZA 5DGBA 2VKZG 3BGUA 3GE9A 3RAMA 4RW8B 1GH8A 2E7WA 2R8IA 3PFOA 2JFKA 2J7KA 2EFGA 5KFMA 2K3IA 2XLJA 1L5UA 2CZ4A 4PWDB 2O67A 4NLYA 1Y7PA 4K0KF 2KRBA 4LSLA 5DLFA 3PW0A 4OLPA 1LFWA 4DFJA 1U2FA 3IWNC 2AV5A 5EX0A 1NEEA 4X4VA 1HWJA 4E98A 1VJWA 5CYQB 1I94F 2M70A 1WWHA 4ECUA 1PO6A 2JHEA 3G8QA 3M30A 1IKWA 4KR0B 5BJRA 5J2PB 3OL7A 1T94A 1DLOA 2XHWA 3UDLA 3OVBA 2CQDA 3BSAA 2J6SA 2XSJA 1UWBB 2E5IA 1FRJA 4FS1A 1TFWA 1FO1A 2M3DA 3PO5A 4F2SA 4JUZA 3MMCA 3DOLB 2DNOA 3CC2S 1YJVA 2L9DA 4C3LA 1R89A 4OZNA 2DNZA 2N3LA 2PO4A 1VOMA 3AJ2A 3RRKA 3TO8A 5KOWA 4A8KA 1GNKA 3TP2A 1VQ5S 1KRPA 3LAMA 2MHEA 5DG7A 4ZVGA 2C2EA 4JYAF 3V6DA 4EBDA 2JVOA 2JEGA 3LH2S 4WIIA 4HDHA 2ZE2B 1QSYA 2HHWA 1XR6A 5DG8A 4I4BA 3DOKA 4TNOA 3TQ1A 2OPPB 2FTRA 1G1XA 3SEOA 1RA6A 3NMRA 1FJGF 2XMMA 5KFRA 3OQ2A 4OI3A 1C4CA 4DV4F 1DHMA 2DHAA 2DISA 3SFUA 3SCIE 2RDIA 1T3OA 1SI9A 5F8IA 1S6PB 2DNGA 4MMOA 1BQMA 1BD6A 4EO6A 2J0SD 3IS9B 3OXLA 2OH2A 2WTFA 3FSIA 1MMNA 3DRRA 1HW9A 4DV5F 1JLFB 1N6QA 2V9WA 4JI5F 3GG0A 2EW9A 5GAHU 1ZBTA 1TZ0A 1D9DA 5LT5A 2R2RA 3M6UA 3VAKA 2A1BA 1QUPA 2BYCA 2QLXA 3FNNA 2L08A 1FK9A 1UVJA 3IG1A 1UVMA 1FTCA 1SV5A 3EGZA 4WYLA 4O0IA 1SL1A 3GMGA 3HI9A 5CH7B 3UI3A 2R7TA 2KFYA 3EX7B 1ZPVA 3EZUA 1FEHA 1KTVA 1U49A 2V9KA 3N01A 3HHEA 4QJVA 1VK3A 3S01A 1YITS 4F02A 1IBLF 5DDQC 2PT0A 2DNHA 4M5DB 1KNZA 2KFNA 1Y5NB 2WBRA 2D74B 1RT3B 4DPOA 3HPOA 4HI1A 3UPFA 4ECSA 2EI5A 2VC0A 3NAHA 4KSEB 2UV8G 4O4GA 4N76A 5LXRA 2O1PA 1RTIB 4C0HA 3C2PA 1NH8A 4Q0BA 4DR3F 3T5LA 2ZJQQ 3H20A 3IR7B 1W2BR 4R5PA 2OAUA 1Y9OA 2FHMA 5HROB 3PVXA 5E3PA 2VFUA 4TYBA 4NX9A 3BSOA 1ELOA 4E8UA 2V0NA 3T5JA 4QBUA 2LQ9A 4G3IA 4EEYA 1T03A 5EWEA 4TLQA 3GFXA 2BZ2A 2BUNA 3HHKA 1GX6A 2BM0A 4ED6A 3T1YF 2SXLA 1ZTWA 1EP4B 1HBNB 3QLHB 4KFBB 4IQXA 4WCEQ 1A6LA 3MAQA 1TV6B 4HEA9 1TK5A 2RF2A 2G13A 3NS5A 2V4QA 4KV8A 2E1CA 2FGOA 1QE1A 1REVB 2ZVSA 1T3NA 5E7OB 2OPRA 4Z37A 4RNHA 1SUQB 3POTB 3FDSA 4R8UA 4RWWA 1RKJA 5HMZA 2KTQA 1ZAXA 1HW8A 2HNDB 1JLGA 1YGYA 3UFCX 2E29A 4C0OC 2F9JA 5EHHA 3M8PB 3BQ1A 1C1CB 1W2IA 4KKOA 2FJVA 2Q6CA 2BJEA 2KT2A 1W25A 3UD4P 4RU2A 1S1TA 3RB4A 1VQKS 3JSMA 3M05A 4AL6A 1DZ5A 1SJRA 1D0EA 1OPIA 1VRUB 2P9GA 3A1YG 3J7YU 4QWBA 1VRTA 1U1OA 2FB0A 2BRKA 1JIHA 4OX7A 2EG1A 3T9ZA 3H5YA 2LDIA 5B7WA 1S0VA 1FF2A 2HQIA 2I0XA 4CIOA 1FRXA 4A8OA 3M32B 2XS2A 2HHHF 3VCDA 2R7OA 1KSPA 4RUAA 4AUKA 5ITHA 5KAKA 3BF4A 2W9BA 2MKIA 2EFOA 2MY8A 2PSZA 2W8KA 3M2VB 3E51A 1YJ9S 3V5RA 3ISNC 4TLRA 4NCAA 3SMZA 1HQEA 1TL3A 5C42A 2QE5A 1YWXA 4N47A 4WKYA 3TVZA 4ED2A 2HIQA 2I1RA 1X4EA 1IKVA 4DN9A 4PUOA 3C8YA 2DRAA 3HHLC 4MH8A 1CG2A 4RNNA 3D0GE 3F41A 4Z2XA 4J9OA 1QLNA 1VC6A 2R7VA 2RRNA 1S99A 3CCSS 5HBMB 2JEJA 3GILA 4PCQA 1T7PA 2GX8A 5DLGA 3FMBA 2IA6A 5AJ3F 1MWYA 3HVWA 2ZKUA 3OFHA 5L1KA 1OSDA 1NK5A 2EBEA 5K5MA 3TAMA 4C8OA 4W90B 2XMJA 3AQPA 5I3QA 3NNAA 2VG6B 1BQNA 4NLRA 2GQCA 3GV8B 3H5SA 2AJ1A 2RH3A 4RBUA 4QW8A 4J9NA 4RBTA 4QWAA 2MSSA 4AL5A 2WAQD 4OX9F 2UUWA 2MKHA 4C97A 3DLLQ 3OL9A 1ZZNA 1RYSA 2DR5A 3I55S 3V4IA 3D0HE 5DETA 5HMWA 1NB7A 2E9TA 4N8OA 3THTA 1SJ1A 2V94A 3M2RA 4I7FA 1FD2A 2VPZB 4IRCA 3DCAA 1RT5B 3UD3P 3N4WA 2OLWA 4DSLA 1SJQA 4NRUA 3H59A 3I6PA 1S0NA 3QJJA 1K1QA 5F8NA 2ACYA 3FMWA 1HBMB 1R7IA 1R0AB 3MFIA 2QFJA 2AJ0A 2V4JB 2ZITA 5DQGA 5CD4H 4QU6A 2ZNYA 3W2VB 1S1UB 1IBMF 5L1IA 3GZ7A 4P6QA 2F7VA 4DFKA 2JEIA 5A8RA 4DR2F 3N0VA 2E5JA 4Y3CA 1S1VB 4A8YA 2BE2B 1EETA 1TKTB 3FZBA 2VODA 3SYZA 3CC4S 3ITHB 3SV4A 1FJCA 3DMJA 3FEZA 2R8KA 4LMZA 2FVQA 2RT3A 2JOQA 1X5OA 4URQU 2M7SA 1LK7A 5KFXA 4RZRA 2N4DA 2HWHA 3AH6A 3QIPB 4K4TA 3GYXB 3U27A 4TYAA 3G96A 2J9DE 2RUGA 3OSPA 2LECA 3FQLA 2PIIA 1N5YA 1S0MA 5EDWA 4I67A 5A8KA 1R8HA 2B4PA 2N7CA 3MPYA 3G6YA 1F5CA 1YSJA 1BGXT 5C24A 2DO0A 1IXKA 1U4BA 2WOMB 1KTQA 2FJAB 3E01B 3NKYA 3P3DA 4A8QA 5AE1A 1LFPA 4C0BA 1Q82T 1TKDA 2F40A 2W4DA 3H2LA 3N79A 1V6HA 2FGCA 2C3YA 2NUUG 1FRIA 1Y5LB 5CCMA 3OL6A 1P6TA 3MEEB 2ZH8A 1X5TA 3AB4B 4O44B 5D78A 4Q2LA 4EZ6A 2D9PA 2YNFB 3VZHA 2XNRA 3OR1B 3MM5B 5EUHA 3M1VA 2CPHA 5K8PA 5F9LA 1S9GA 2YNGA 4HYKA 1U1LA 4NLPA 2J7WA 2C3PA 5DM6Q 2V8DA 1RT4B 5D4NA 4UQGA 2R7RA 3MM6A 3HP6A 4KBIA 5KFJA 2HAIA 1RJJA 2HMIB 2MMYA 4FF3A 1YJRA 2QYCA 3PEHA 1FVQA 1NAQA 1ZM2A 1FDDA 2VL1A 1Y3KA 3QYYA 2Z2MA 4UW2A 3CCLS 4IOCQ 5KT6A 4MKBA 3OLAA 2GMHA 4L72B 2W9CB 5EWFA 1Q1KA 3THPA 3M9NB 4C11B 3OXFA 4WFYA 4CH0S 5B0CA 4NLDA 4KHPF 1FNMA 1TVRA 5EN1A 2RB7A 4YDDB 4J9KA 3I4HX 4N5SA 3L09A 4ID5B 2VG5A 3CCWA 2OPQA 3DLGB 3LQVA 3Q2TC 3PHEA 4IG0B 2VA3A 2YKQA 5D3GB 2R2UA 2LU2A 4NCBA 3DI6B 5B0BA 1DTQA 2DIUA 3PY8A 3HXMA 1JJ2R 4TU9A 4IFYB 2FJEB 3N28A 2HS0A 1LXJA 5T7LA 5KFVA 3X3UA 4NMLA 4K4UA 3KMQA 1SJFA 1UJ6A 4DG1A 3N6LA 2IMOA 4WFXA 5A8WA 2RIJA 4KO0B 1I6JA 3DLJA 3TR5A 1RKIA 1S4FA 4RUHA 4JV5F 4I2QB 2P5VA 4DEZA 3EGWB 3QZ8A 5AXNA 1X4HA 2EFNA 1M5SA 1LWCB 2R8JA 1B0TA 2DNYA 2J7UA 3OXGA 3S1TA 3M8QA 4IR9A 5DM7Q 2ABYA 2R7UA 2YKPA 4ZP6A 3N6MA 3CE8A 2DGWA 3BGFA 3SQGA 1KVJA 2VFSA 1RTJA 3PX0A 1WTBA 2DGTA 3EZ5A 4M94A 2D3ZA 2JH3A 4ZA1A 2R7QA 2AD9A 1YI2S 1U47A 5HP1B 1MU2B 4RW7B 1X5SA 2B9WA 1TFYA 1FEEA 4IOBA 4XPEA 2MXYA 3DLEB 4B9SA 2RQMA 3D1OA 2X3GA 3KLFB 2UUBF 3O44A 2GIQA 2O01C 4LT6A 2ZDPA 2LQ5A 2AYMA 3AAWB 3TYTA 4QCLA 2CPEA 4K59A 2B56A 1HQUA 2B4UA 6FD1A 3NBPB 5LXYA 1P8GA 2FHKA 3P6YC 5FIIA 3C6UB 3MUTP 3QZ7A 3PRDA 5H9EJ 1TL1B 4UY85 1LW0A 3T5HA 3NLCA 1RWUA 4DBQA 2NSCA 5F8HA 2XGQA 2WB1D 1PGZA 3MM8B 1UJ5A 2C3UA 4ETZA 2J9DA 3D5MA 1U7LA 3T3FA 2ADCA 3C6TB 1SIWB 3MDFA 3PW4A 4ETXA 2XS5A 3MECB 1HWKA 1CQNA 1LWEA 2DNQA 3LF0A 5D6GA 1D9AA 3D1QA 3MR2A 2L48A 3KLGB 5KFCA 7FDRA 2MKCA 2ZOGA 3PR5B 2ZJPQ 1XMOF 1BY9A 4KGMA 4XDDA 2C42A 2HGMA 2VG7B 3ZZPA 1F9FA 4NYZA 4TY8A 3TW0A 4CH1A 5CZVA 5A0YA 3MMBA 5KFGA 3UE2A 2UUAF 2OSQA 1VQSA 2RQCA 3TARA 2NS1B 3HLUA 3IRWP 3CJKA 2YQ3A 1DRZA 1DQ9A 4QIGA 1NJIT 3DRPA 4WK3A 2YWKA 1R8PA 2CQ3A 1WTFA 4Q2MA 1S6QA 2L3MA 3NWGA 1HBUA 3TA0A 4U6PA 1L3SA 3DU5A 3KK1A 3MMAB 2M9KA 4NA3A 2FC9A 3IO1A 2RDJA 4I6AA 4CO1A 4I6WA 4I2PA 4CTAB 1HNWF 3ZZOA 2VUGA 2RKIB 4ICLA 3KLVA 1H7WA 5K14B 1HPZB 1QAYA 1RT1A 1SH2A 2DCLA 2PE8A 4QIEA 3BM7A 4DFPA 1K9MT 3DLBA 2DHGA 4YMEA 1HARA 3PX4A 2G0CA 2M88A 2AYGA 1HWIA 2Q3PA 4X62F 4Y2AA 2HHTA 1H3DA 2CJKA 4FXVA 3ZZRA 1HI1A 1H98A 3W2WB 4FXDA 4ID8A 2ADBA 4X4QA 1KQKA 5KG4A 5KG0A 1J5OB 3OHAA 4LFAF 1NNDA 4OI2A 4NLSA 5KFNA 2E1RA 2RU9A 3KTQA 1MROB 1SKWA 4ES2A 3KK2A 2AJQA 5FJ4A 4NLQA 1HMVA 2B5JB 1R3NA 3VAHA 5FDLB 3DLKB 4XAKA 2FJDB 1E6YB 5IS2A 3LP1B 4KJIA 4JV0A 3VZIA 1MMLA 3FSYA 2NZ4A 3DLHA 1HBOB 1UL3A 4RW6A 5KFHA 5CQGA 2R8HA 2PI4A 2JLFA 5DRKA 2D1CA 5GAGI 4DL0C 1DAXA 3BQ0A 1X4CA 2DPIA 1X0PA 4IFVA 4ZP9A 1XNQF 1KQSR 2RQ4A 3QAEA 2P6SA 1D1UA 4E0DA 2MQNA 3L7OA 2CPDA 3HHLA 4X64F 3LP2A 1SIZA 2YWEA 2MQOA 4QWEA 2RRAA 2J0WA 1NK9A 4FVMA 4B17A 2GW8A 3SXLA 3OTEA 4Y0FA 1U1RA 3DXBA 2UUCF 2I8EA 2ZD1B 1IQTA 5KG3A 2IVMA 2MPUA 1UETA 3CT9A 3QGHA 4I64A 2DTJA 4BC7A 2J6UA 1UVKA 3NCPA 1K8AT 4DSIA 2K8GA 2GQ2A 3RAQA 1VQLS 4MK9A 3TUZC 2UZAA