3FZ2A

Crystal structure of the tail terminator protein from phage lambda (gpu-d74a)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
132
structure length
129
Chain Sequence
b'HMKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGESDTWQAELHIEVFLPAQVPASELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor tail protein U
publication title The X-ray crystal structure of the phage lambda tail terminator protein reveals the biologically relevant hexameric ring structure and demonstrates a conserved mechanism of tail termination among diverse long-tailed phages.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 24
structure length 129
sequence length 132
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06141 Phage_tail_U Phage minor tail protein U
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1700 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fz2A00
1Z1ZA 3FZ2A 3FZBA
chains in the Genus database with same CATH superfamily
4LF2A 1MMLA 2H4WB 1FO1A 2KG1A 3FCWA 4F3MA 4KKOB 3M2RB 3OTEA 1R8HA 2CPJA 1R6YA 4JI5J 2XY7A 5JVHQ 2CQ1A 2L08A 2KRRA 2MLXA 1Q4RA 4LSNB 1UL3A 2CADA 1ZTWA 3I4HX 3ICLA 2ATLA 2AX0A 1T9WA 4FXDA 3R97A 4IFYA 2UU9F 1NK4A 4KIAA 3MCNA 5A2QY 3U1NA 2Q3PA 5F3TA 2LFVA 1RWOB 3DLEA 1NB7A 2CQIA 4ZPTR 4MIAA 1H73A 3RRHA 2HIQA 4OMFG 4RBTA 4RW8A 4CO2A 1FFGB 3AJDA 1OIAA 2DO4A 1CBKA 2EFGA 3HULA 4ZVPB 1H6KX 3LUYA 2IM3A 4I67A 5F8JA 2BBEA 1BMQB 2JH3A 4PQUA 1NK8A 1LXNA 4FKYA 3DLLQ 5DZ6A 4DQPA 2OPQB 4KQZA 4CNZA 1XC9A 1DTQA 1HNZJ 3CXCR 1LQ9A 3MR5A 3J7ZT 2YH0A 4FVMA 2H51B 4ZIVA 1XR6A 3RGIA 1Y00A 2ZKTA 2VDHA 2X1FA 1R0AB 1S1VB 1VLOA 2OJ3A 3N5BA 1YJWS 1WKJA 1XMOF 2WVFA 1S6OA 3MMAA 1XR5A 2ZOGA 4CH1A 1J5EF 4C3MA 3MPDA 3R2CJ 1YRUA 2CQDA 1OSDA 1HBNB 4F4KA 1RUSA 4X64J 3I96A 1BWEA 2HGNA 5BYQA 3W9IA 2PA8D 4DV4F 1VQ6S 3EVWA 3JXOA 4W98A 5A0YA 4HACA 1YIJS 3GV8B 3UDEA 4PPDA 2YNFB 4R5PA 2B5JB 4WP3A 1BLUA 4TY9A 3EZUA 2WSEC 3DNCA 3FZ2A 3OFEA 4Q5VA 4LBIA 1NU4A 3K5PA 1VR6A 1GXUA 3S8SA 2HZAA 2LU2A 1UKUA 1ZYQA 2C2MB 3KJNB 4DPOA 1N34J 2I5JA 3DRPB 1D1UA 1RHMB 4ECSA 4GKJF 3MM9B 4DR1J 1TVRA 2IDEA 2NPIA 1G1XA 3BM7A 4ANEA 1JLGA 1EX8A 4ZPWR 4DBQA 4N41A 3BQ1A 1NKBA 4WU2A 3KLFA 2VOOA 4ELUA 5KFEA 2WAQD 4M5HA 5B0GA 3ISND 1HIYA 3BKFA 4RU9A 1MSWD 4IR9A 4WXWA 1N32F 1S9EA 1FRMA 5DJBA 1HLWA 4JBCA 5B08A 3X3UA 2R2RA 2Y1JA 3BGRB 1UVLA 1ZOTA 4ZJQA 4TVAB 1A9NB 4DSIA 4UUXA 1WEZA 2FUG9 5I3UA 1G2EA 2C22A 4I2QA 2XMUA 1VI7A 3ZZPA 4Q0BA 2YNGA 1FEEA 2BM0A 1MG7A 1PAUB 2RF2A 5MLCV 1ZZNA 1IWGA 1NK0A 2MKHA 2J5AA 2ZWPA 3W9HA 3ILJA 3C6UB 2VQEJ 2PE8A 3OTOJ 3KMSA 5EWFA 3J81Y 1XEZA 3MPYA 1K1QA 4DZ6A 1IJFB 3M8QB 1SXLA 3BBBA 4KHMA 2L9DA 5F8HA 3G6ES 1U0HB 2PFFB 2ZM6J 4Z7YA 3EUNA 1TFWA 3EMTA 3PW0A 3BDPA 3BPDA 1RWVB 2BJEA 2YNIB 4DV1F 1PBUA 4YR0A 5L1IA 2JWNA 4QYZK 4IR1A 2IJFA 3I87A 1HQ2A 1KBRA 3DLBA 5GVQA 3JSBA 3RAMA 3KYLA 3KK1A 3MZIA 4NXNF 3RR7A 1NK9A 1MU2A 4A8XA 1S79A 2VG6B 2ZHAA 3LAKA 3J80Y 1HARA 2A10A 3IGVA 2MHEA 4QYRA 1IVZA 4UOCA 2ZHBA 4YDDB 1U45A 4USHA 4ID8A 2ZBQA 3O3LA 2ZHOA 4WFXA 3RB3A 4IQMA 2ZE2A 4WZQA 1RT6B 2H54B 2B4PA 3MEDB 4KGMA 2OPSA 2J8AA 1GXTA 4ZVOB 2F9JA 4OZ0A 3P96A 1K0VA 3HVTB 4DV0F 1FWPA 1WHVA 2KXNB 3SZ2A 4DL2A 1Y9OA 3GLJA 2AGOA 5HLFB 3VQTA 2UUAJ 3KLIA 2IFXA 3D66A 5KFIA 4V19J 4WTYA 2DH8A 5U47A 4AL5A 1OY8A 2XYPB 2RU3A 2ZNZA 3MM5A 1KONA 3DYAB 6FD1A 4BC9A 1X0PA 3MCOA 2BKOA 5KG5A 2BJ1A 4J9PA 3F41A 5CH7B 3SQGA 1XNQJ 1VRTA 4GRSA 1L3KA 1KQKA 2R42A 5GADU 3VAFA 1IKXB 5KFFA 1HW8A 3U7JA 4DUYJ 3C19A 5CCMA 4LSLB 4I6WA 2KDOA 2J0XA 3T1HF 2AD9A 2ZDOA 4YB6A 5JUMA 3W61A 2V63A 2Z2LA 3P6YC 5HQLA 1NJYA 3MTJA 3R5DA 3J7YU 2R2TA 3BV8A 2CAJA 3TJ9A 1JXLA 3VALA 5BYRA 1KSPA 2PFDA 4RW4B 3DDNA 3MUMP 4LR7A 3MAAB 2BW7A 1TK0A 4G1QB 3SMZA 5LM7E 1S4EA 1XMBA 4IG3A 1U1KA 2QA4G 4C0BA 2HS0A 4HVZA 5AXNA 1JMTA 4ZCMA 2J7UA 2DR9A 2VJUA 1WUUA 1J2VA 2QLJB 4QWBA 3CD7A 1S99A 3KG1A 1NJIT 3MCSA 4L72B 3CC4S 1QUPA 3RTVA 3ZC4A 2JFDA 3KG0A 4J9RA 2QYCA 3P5TL 1ZA2B 2NLWA 5E33A 2KT5A 4N7TA 4Y2KA 5B0AA 4DV2F 2JEFA 3W2VA 2AYMA 3EXYA 1PYOB 3B6BA 1EQ0A 1NRKA 1TMJA 4DR6F 3M1VA 1FERA 3FGVA 5DGAA 4I2PA 4NCGA 3M9OB 4WFAQ 2DNQA 3OV7A 1Q5YA 2I9SA 3CCQS 4DI6A 3IXQA 3OTDA 4CYUB 4JUZA 4ZVRB 4K0KJ 2RDDA 2UUBF 1M5VC 2YWFA 2A18A 3THTA 3SQOP 3GR0A 1YZ6A 1N48A 2R7RA 3OFFA 2MB0B 4ZMMA 2R7OA 2E66A 3DMJA 4MMOA 2DXDA 2W2PP 3KJQB 5FLXU 4P71A 4AQYJ 5KFPA 2F8EX 1VS3A 3HHLC 8RUCA 1N54B 2P6SA 3M30B 3KHGA 4ELTA 4Y00A 2XNRA 3HLUA 1BUXA 4F4XA 1ZAWA 4NLVA 1HNVA 2U2FA 4UZCA 2LYVA 1H7XA 2GVDB 1LWEA 1U1QA 1E6YB 1T7PA 4RW7B 2UU9J 4NLPA 4LREA 1JLAB 1RI7A 1X4BA 1YLXA 1UPPA 3PW4A 4OV1A 4LFCF 4HT7A 4ER8A 3OHAA 2GX8A 3UE2A 2YQ3A 1K47A 1KQFB 3D9BA 2BQRA 4WJBA 5LMUF 4QWDA 3CJKA 3ZNUA 2X3GA 3TA0A 4MKAA 4KV8B 2WVBA 1WDTA 2YKQA 4QIFA 5KFYA 3Q23A 5M2PA 2HHTA 2OD4A 3KDOA 2QA2A 4M5JA 3BYPA 3JB9k 3CGIA 3M8PA 3LP0A 4ENOA 2VPXB 2C3OA 1RKJA 2FB0A 3Q8VA 3OVBA 5GAHU 2R7VA 5LMNF 3GIMA 3CCWA 5RUBA 3LANA 2IHR1 4EBEA 1JNRB 3L3CA 4CM2A 5BYSA 3OTCA 4RNHA 3P8BB 2MKIA 2IYIA 4PZVA 5E0OA 1GFWB 2QX0A 4X84A 4DV4J 3JQJA 2I2YA 3QWPA 1S1WA 1KHWA 4ILLA 3MEKA 4K8RA 4HHJA 3C14B 3PCOB 5ETLA 1ZZFA 2M88A 1BD6A 2RDIA 3R7NB 5HK4A 4TKTA 5E3QA 5KTQA 3KJVA 3JQMA 1TL3A 1D8ZA 3QGGA 3M6UA 2B3TB 4CTAB 4HH1A 2EFOA 1VQ7S 1YG0A 1AW0A 5DZ7A 2ILZA 3OQ2A 4L6V3 2R2UA 3ENVA 4YUDA 5JXSA 3I0RB 3DLGB 2HHHJ 3FMBA 5FJ4A 2QTWA 1SC6A 1N32J 3HSDA 1FKAF 3EWGA 3AOBA 3WX4A 4L74A 2ZUGA 4LFBF 3GB0A 2A2CA 2YKNA 1OY6A 2BJ7A 2XI3A 4K4SA 3FK4A 3TEHB 4O44A 3C6TA 1YBTA 3OVAA 4G6VB 1FKOA 1M0SA 4OZ3A 1GTHA 2ERRA 3BSAA 4NLUA 4QU7A 2XCPA 3QSIA 1YGYA 1SQEA 4OLPA 2DNKA 3NGUA 2DITA 4RW6B 1TKTB 2GZOA 3HHLA 3H42A 3R7SB 3W9JA 1F1BB 1FA0A 2N3OA 2MPUA 1UA0A 2IYGA 4P2SA 4C9DA 4OX8A 4UZBA 1IKWA 1JJHA 2N7CA 2QE5A 1NDCA 4KO0A 5L1JA 3BJYA 3MEEA 1KEKA 3RW7A 4UQTA 1S0OA 1X60A 4I6AA 3AXMA 4DV1J 1HQEB 3OR1A 1FFWB 2WSCC 1WNEA 5HP1B 4G65A 4G1IA 1LKZA 4OZ5A 1U24A 4J9MA 5L1KA 3CJ4A 3HVRA 2B0GA 3QIPA 4ED3A 4LBHA 1S7IA 5KOWA 1KWMA 1X4GA 3MMCB 2Y0BB 9ATCB 5E7OB 4OHZA 1J5OA 2PT0A 4EZ9A 2XI2A 2XGQA 3TAQA 2HYIB 1KHVA 3HD2A 1VIOA 5KFDA 1SUQA 3TAPA 3R8YA 1SQFA 3GSIA 3V5RA 5HROB 4A48A 2KN4A 2LQBA 5KG7A 4DV0J 3FJ2A 3M8ZA 3VGSA 4P6QA 3GILA 3DM2A 1S97A 1CJKA 1Y3KA 2W9CB 2YWEA 2LVWA 2MKSA 1SCJB 1SV5A 4DDFA 4QZVB 4OJGA 4V19X 3S1TA 1T9UA 1U2CA 2W9BA 3T3FA 3CD5A 4ZCKA 2ALYB 5HQ8A 2OPPB 3GU0A 4QPTA 4O3PA 4I0WA 1YJUA 4ZHRA 4WP9A 5F0UA 4J91A 2WVEA 3R6LB 2GGPB 2NXUA 5A8WA 3G6XA 2JFKA 2BUNA 5I42A 5HSPA 3T1HJ 4OHXA 4X66J 2J6TA 3TX8A 2GC8A 3CMAS 2B4UA 2DY1A 3PFEA 2R7QA 1D8YA 5CZVA 3UO0A 5KFUA 2K1RA 1H98A 1ZBTA 4DL7A 2CKWA 4QQBA 4DG1A 1TL1B 2P8IA 3W64A 3D6TB 5IM0A 2B8PA 1VQSA 3K5LA 4R8UA 2F8HA 4KE5A 5KFRA 4QW9A 4K4ZA 1LFPA 1SJQA 4GKKF 2OUGA 1QE1B 2R7UA 1RAFB 2XMKA 1XK8A 3KUHA 3KG4A 1RT5A 2HVEA 1FXRA 5F8NA 1FX4A 2FHOB 4FXWA 2OP5A 3G6VA 4U9RA 4C8NA 1IKVB 1HNIB 5GAGU 1CG2A 3MM6A 5C24A 3V6DB 2HHUA 5K5MA 2GQQA 4JYAF 3PYFA 3VF0B 4DV2J 2UUTA 4OI6A 1B3TA 3NWRA 1N88A 4DR6J 1VBYA 3D3CJ 2J6UA 3CJRA 4JB8B 3UN5A 2FLOA 4N56A 2RUSA 4C48A 4MH8A 2C42A 3MGJA 4DPTA 2FHJD 3Q8UA 4FPRA 1VQ4S 1EHWA 4JI8J 3VZHA 5SZTA 3LWLA 5F9LA 2DGTA 2W25A 1TZ0A 2EFNA 3HT3A 2JC0A 1L5UA 4MKYA 1ZS6A 5JJBA 9RUBA 2BRKA 3T6BA 3QT6A 3DLEB 1UVNA 3M8YA 1ZA1B 1YZ7A 5IWAF 2OEJA 3H90A 1FVQA 2BJDA 4KGVB 3ZO7A 4BBYA 4WU3A 2V4JA 3CCLS 3M9NB 3W66A 2CZ4A 3UCUP 5LSRA 1QAJA 4Y2MA 1VQNS 3SXLA 4PQUB 2FC8A 1ZAVA 3UDLA 4LFCJ 3JSYA 5HJYA 1NSPA 3ISNC 1U48A 4DL5A 4EO8A 4X2BA 1SC3B 2DB1A 3G8SA 3PYEA 2IDLA 1DTQB 1Q0NA 3V6KA 3KFWX 2MHNA 2H1YA 4CO5A 2V2QA 1RAGB 3PW2A 1Y10A 3GJRB 3MOZA 5LMUJ 1RBAA 2IC3A 4ED6A 5KFHA 4DFMA 2KB2A 4I69A 4UUWA 1TAQA 4M5LA 3V81A 2GQCA 5JMNA 3FMWA 2UUCF 2V8PA 3JTOA 1TK8A 3DU6A 3W8GA 4ZVEA 5A2QU 3ET6A 5A0YB 4HACB 3OL7A 4KRWA 2YH1A 3ZZUA 2F65A 3NGDA 1IQZA 4R5PB 4ZVHA 1H74A 1X31C 4YS2A 3H4DA 2HAFA 3S6EA 3PEHA 1YK9A 3ZXWA 2HS4A 3EX7B 1AUSL 1X4AA 2I5JB 1U8SA 2HNZA 3IWNC 2KM8C 5CYJA 1TVRB 4UOFA 4O3NA 4P74A 1YSJA 3BREA 2HFSA 1JLGB 5E2QA 1T3NA 2YKMA 5AE2A 5KFZA 2F1FA 3LH2S 4CRJA 3FBCA 2B7CB 4USUA 3KLFB 3DRSB 3T5HA 4ZPCA 1XR7A 1S9EB 2Z2MA 2JOQA 3ZTPA 2VHGA 1T02A 2YVSA 4FF3A 4I7FB 1E6VA 4OJHA 3DC2A 4RW9A 1FNXH 1VLYA 2V8HA 3EGVA 1IN0A 4FP9A 1VBKA 3MFIA 4A8WA 5I3UB 2UVWA 2CA9A 3UR3C 4PG5A 5KFSA 4I2QB 4C11B 2VKZG 1S6PA 1WHYA 4Q0BB 2YNGB 2RF2B 2WOMA 2PN6A 3CDUA 4LFBJ 4DPWA 2N3LA 2E5IA 2M4MA 2VFUA 1QUVA 2VA3A 1PKUA 1HQUB 5F8LA 1B4SA 5F3ZA 2EK1A 2FHMA 1H3DA 3KNAA 4K4XA 3TZXA 1B70B 2M5YA 2IRYA 4KKOA 3TZZA 5J2MA 3BR9A 2RD5C 5H9EK 1JKHB 4FN5A 2GHPA 4IDKB 4DR7F 1HI0P 4WK3A 4F4ZA 2M7SA 3KK1B 2HBQB 2LEPA 1TQLA 2LECA 1CS4A 5HATA 2OEMA 4E98A 3HX9A 4DR3J 1MU2B 3DLKB 3LA0A 2OSQA 1JNZB 2CIMA 1Z2LA 2VC1A 2PMWA 2HWTA 3CVKA 2D41A 2KYXA 2G13A 3VAJA 1WEYA 5HVFA 2IVYA 1UJ4A 2RUGA 4C0HA 5D78A 4ZJOA 2QFJA 2IM1A 2I0XA 4M8LA 3M2UA 2F40A 1F3VA 3GG1A 3QJPA 1G4CA 3J81U 1XMQF 3EJMA 4JI6F 4A8OA 1W25A 3OR2B 5KT6A 1JJ4A 4H4OA 4F0MA 2HG4A 1MWZA 4NEYA 4DFJA 4KGZB 4DV3F 2KT2A 3KLIB 5KT2A 4IH7A 5LOQA 4EBCA 3CDWA 1PJ6A 2BW2A 5THWA 3T1YJ 1UJ5A 4OHVA 3BYRA 1VFJA 2NUUG 1UCNA 4A8MP 2HVZA 5B7WA 2ZH6A 2LXIA 2DNLA 1BGXT 3DGPA 4BWJA 1VDHA 3BN4A 3SQGB 1QSYA 3TARA 2BXJA 3OHBA 4O3SA 1VRTB 2FLNA 4F8RA 4RBUA 1F9FA 4PCQA 3J80U 2EFPA 4ZPAA 4DR5J 4IUFA 1VGYA 2YNFA 3BGOP 5HANA 3PW7A 3SIPB 3H98A 3CDBA 1VK3A 4ECZA 4UY85 2WRMA 4J9OA 3KWMA 5L39A 1TKDA 4PXBA 1UFLA 4JI7F 3DRPA 1SBRA 3K2YA 3B54A 1VC6A 3CJSA 1IBLJ 1Q5VA 2PO4A 2FYXA 2MKYA 3MDFA 4IG3B 4N5SA 1W7WA 4WYWA 2B7BB 4KPYA 5ETTA 5ETPA 5IC4B 2VD3A 3JQKA 2K06A 3D54A 5KG2A 1S1TA 3G82A 2A2DA 2HHXA 3WZ0A 3C3LA 3CD6S 5D15A 5K9FA 3CCUS 2XLJA 3CCSS 4QWEA 4GKKJ 2DHSA 2Z4PA 3W2VB 2QG9B 4M5KA 4NCGB 1FTCA 2J9EA 3LAMA 1HA1A 4DQQA 4TU9A 1X8DA 4K2JA 3AAWB 2AW0A 3IRWP 5GAGI 1FNOA 1HD1A 2FJDB 4DEZA 3CCES 1JQGA 2J7WA 5SUHA 1UVIA 5K14B 5IQQA 2DNHA 1QAIA 3UDVA 2Z58B 1H72C 2OO4A 1WTBA 2BJ8A 2W1BA 4USWA 2CYYA 3IP0A 5DM7Q 1U0HA 3KNGA 2AU0A 2YNIA 1RWNB 4K4WA 2GJ2A 4FF4A 2DPJA 2BACA 3K8WA 4EWTA 3VGUA 1HBUA 4YOEA 3V4IB 3LALA 1RT2B 3KK2A 1PYSB 1HI8A 3NS6A 3D0HE 4HHHA 2YBVA 4FF2A 1Q7LB 2VG6A 3AHPA 5IWAJ 3GYGA 1U47A 1JB0C 4UF4A 2DNZA 2F8MA 2NPFA 3CE8A 2DXEA 3FKBA 3FEXB 4GVBA 2HGMA 5LT5A 2Y0SD 1V3SA 2AJ2A 1VJWA 2AJ1A 5IV3A 3DN9A 1SH2A 2HRUA 4A8QA 4EMDA 1SJFA 4L3NA 1SH3A 2F3JA 3ADAC 4PR6A 2I6WA 2AJ4A 1ZM4A 2MQMA 3I0SA 4CH7A 5IZHA 3T41A 4NLYA 3M8PB 1Q79A 3LP0B 3NGTA 1ZETA 2JLGA 3OSNA 3FQLA 2YQ0A 5GMKa 3W2WA 2C3PA 1QM9A 2HZVA 4JV2A 3HJFA 3J7AN 1FVSA 3GTYX 4FBTA 4AXIA 1KQSR 1Z1ZA 1H2VZ 3OUYB 2MJNA 2CPHA 4YR3A 4N77A 1H0HB 3Q2SC 4LVOP 1B7YB 4ZP6A 3R1HA 1MNEA 3JS9A 1YVFA 4HL9A 4F04B 2CQBA 1S1WB 2HFZA 5C7PA 1GX5A 2LQJA 3ZZ0A 5IS2A 1UTAA 4UOHA 4OX9J 4RU2A 2LMIA 1D9DA 4LRFA 4XTTA 4EO6A 1D9AA 2ZVIA 3IM9A 4URQU 3PYGA 4LSLA 2BX6A 5G0RA 4PXCA 2RIJA 3B4DA 5HMYA 2RHQB 3PACA 4PG4A 3UD4P 5HQMA 3KJVB 3SBMA 3GPAA 2VFTA 3CCMS 1TL3B 4CZCA 1SL1A 3AA8A 3T9ZA 1S9FA 5FLXY 1XERA 4OYWA 1DLOA 3MEGA 1Q1KA 3MAAA 4Q43A 2L48A 2H65B 4FYYB 5KFLA 2DYAA 1PYTA 2MKJA 1NHVA 2GO8A 2KO1A 3H20A 1FT8A 3TVYA 2UXDJ 2YKAA 2YKNB 2DD8S 4LRAA 2KVQE 3C6TB 1FKOB 4Y6IA 2AGQA 1B99A 2JNJA 1QSLA 1DJ0A 1WTFA 2X1GA 2VJVA 2PDAA 2RKIA 1J27A 3KHLA 4QOTA 2ZJPQ 4X4NA 2CXEA 1C0UB 5DQIA 3A3NB 4BS2A 5HJXA 3HHLB 3PIPQ 3ELHA 1LW2A 4ECWA 1RWUA 1FDAA 1TKXA 4JI5F 1AFIA 1S6UA 3QZ8A 1KVIA 4BWMA 1F3FA 1YWXA 4LSZB 3PG9A 5KFTA 1F9EB 4K2XA 1IKWB 5KOXA 1S6QA 4KJIA 4NZ0A 2J9DA 3PZPA 4KO0B 3MEEB 4LF8F 4N8NA 3WDOA 3D4JA 3ZFVA 5D3GB 1FK9B 2ZH7A 3OR1B 3HPOA 1NEEA 3CSKA 4DR7J 4HDHA 1WJ9A 1CEZA 2GVDA 3FBEA 4ED8A 2QL9B 1YDLA 4Q2LA 2MTLA 3SCKE 4JI0F 1JLAA 3LGNA 5EX0A 3AOAA 3QIPB 4P7TA 3OFGA 3A8JA 4PYAA 3BB5A 4EEYA 5EGYA 2EVZA 2KKHA 4L76A 1FTRA 4WFNQ 2IBKA 3HDSA 4DZDA 2LQ5A 2CNKB 3WIVA 2V34A 4OHWA 4A47A 2AYGA 2EFQA 3FEYB 4DN0A 3H40A 1GNKA 4KV8A 5FDLA 3QAEA 1SUQB 1RCXB 2KZZA 4WF9Q 1K1SA 1FI4A 3GR1A 4B08A 2QC3A 1R31A 3M8WA 3NS7B 4JI6J 3RR8A 2ZC3A 3E8OA 5ETSA 1RZMA 3BO2A 2JLEA 1U1LA 2BYCA 3CC2S 1GTEA 4W4MA 1M5SA 2YNHA 4X64F 2PGCA 1SQGA 2DRAA 3DM2B 4DV3J 1CJKB 3POTA 2FY8A 1SV5B 2RRNA 5M2UA 4IO1A 4OI1A 3TJAA 3BGUA 3BF4A 2G1HA 2W9BB 5FIIA 4J9VA 4Y34A 2ZH4A 2KHDA 5T7LB 2FDNA 3ILIA 1RTHA 4ZHRB 2PI5A 4EGLA 3ENAA 3UCZP 4JOUA 3QGHA 1VYAA 3ITHA 3DCAA 2CQGA 4LIRA 2CWKA 1UAWA 5I42B 2C3UA 4WYLA 2EKNA 2QJ3A 2WK4A 3P49B 4H54A 2XB2D 4HDGA 2MDAA 1L3SA 1UVJA 1U6FA 3RB0A 2PI4A 1N5TA 4F50A 2DR5A 1B7FA 3K89A 3E01A 4B9TA 4DX5A 1VK8A 2K1RB 3NCPA 3SV3A 4ECVA 3PRVA 2LEBA 1VQ9S 2CPYA 4DG1B 4YP3A 2ZH9A 3IBCB 1IR0A 3DU5A 3CTRA 2RE1A 3PJXA 3UPFA 5IM0B 2G1DA 4R8UB 4YMEA 2ZVSA 4N76A 2Z56B 4ATNA 4CO1A 1N0VC 4JI1F 2E5LF 3KLGB 3CCTA 2GHWA 2UVUA 2B8QA 1TV6A 4LF4F 3CJQA 3I0RA 2PC6A 2KH9A 4OQJA 1RT5B 2ZJQQ 1SB6A 3OJUA 1JLBB 3C15A 2IVFB 1SKUB 1UP1A 4QR0A 2G0IA 1W2IA 4TY8A 4FZVA 1R7IA 3MM6B 5C24B 2QRRA 2RB7A 4A46A 3QO9A 3AH6A 3UD5A 2VQEF 1V5IB 3OTOF 2HZCA 3D6HB 2YWWA 2GMJA 4NA3A 4DCJB 3AY0A 2HFVA 2EEYA 4HT5A 1FF2A 1WF1A 1M1KT 1CPZA 4RW6A 1TKTA 3HHDA 4ID5A 2VA2A 1AB8A 2W2QP 2ZKUA 3Q8QB 3NNHA 2DIVA 4J9LA 1X7VA 4ES3A 1Q86T 1FEHA 2E5GA 1T3OA 4ECRA 1XTZA 4P73A 2HK2A 2MQ8A 1KLMA 1RU1A 3OLBA 1F2GA 5DRKA 5T41A 5F8MA 5D0HA 3H5YA 3M4XA 3K17A 2HQ3A 5C42A 1IBMJ 2WBMA 3AB4B 3TVKA 5J1PA 3KJFB 3FCVA 2BDPA 3QZ7A 2DGXA 2OI2A 2JL9A 2V4JB 3TWZA 4EZ6A 2D1CA 1V9OA 2GAHC 2B9XA 2W2MP 2EC0A 1DQ8A 3CF5Q 1RHJB 3EGWB 1XNRF 3DRYA 4CLZA 3AJ2A 1LWXA 2DIUA 3IN5A 4C7QA 1GMUA 3CCRS 4EU0A 2XULA 2DK2A 4ZJLA 1HL6A 4DLEA 4NLGA 4XK8C 3G4SS 2IC3B 4ZVUB 4EYHB 1H2TZ 4LF1A 3V81B 7FD1A 2G9OA 4PQAA 4C4WA 3D1HA 1T8EA 3A4TA 4ZPBA 2HEKA 4M63A 4X4SA 2CJYB 4P52A 5ETVA 3MTKA 3GIKA 4KTQA 3ET6B 2HLTA 1U1PA 1QVGR 3IMQJ 5D0EA 1AFJA 1XNQF 2ACYA 3PW5A 1YJTA 3OBIA 4ZPVR 1Y0HA 2FHJA 2AGPA 3M6XA 5DG9A 1F5BA 1MWYA 3HCXA 3HKZD 4RPFA 3H25A 2UXBF 3FSIA 1LK5A 2VBZA 2YX1A 2PEHA 2DGQA 3T9NA 3M2VA 1HNWF 3GWCA 2HNZB 4ES1A 1S12A 2VV5A 4CP5A 5D77A 1SJ3P 1VOMA 4U8YA 2YTCA 2LDYA 1REGX 1T94A 4RUAA 3K58A 3G96A 3O8WA 4KGKA 4XDDA 1I3OB 1S57A 4QBUA 1LEOA 4X4VA 1NZAA 2AYBA 1IKYA 2YKOA 4NCBA 2DVIA 4TLRA 2C3MA 3TX0A 5CZXA 2CVEA 2Z2ZA 1E6VB 2WTFA 2E1AA 4OYBA 4RW9B 4RNMA 2CDQA 2ZOMA 3TAMB 4KH0B 1HNXF 2LA6A 1CJUA 5LSOA 5GAEU 3ZZZA 1IQTA 1U1OA 1RAHB 2RS2A 1S6PB 3Q8PB 5D0RA 4NZ7A 4B9MA 2AMCB 2WOMB 2FVSA 2MKCA 2ASLA 4RLEA 1FX2A 5DETA 4DS4A 3BH7B 2RMLA 4DSFA 2CPFA 2DPIA 2LP4A 3IAM9 3N28A 1KFDA 4K0KF 1U25A 3RW6A 4FYXB 2ZWOA 2OEKA 3BDEA 2X1AA 1RDRA 1KD1T 4AQYF 1JLEA 4L73A 3UCGA 2QLWA 4XO0A 4B9UA 1DAXA 4B9NA 4JV5F 5J2MB 1EKRA 2QO3A 3DRXA 3CCVS 2DBBA 1RWMB 2XYGB 2CJ9A 4ILRA 4S0MA 1P1LA 1H38A 2BA9A 2ZH5A 1CS4B 4TU8A 4O3RA 4LF8J 2VH7A 2ABYA 1NB2A 4CT8A 1X5TA 5DO2A 4HTIA 1NJZA 1R8PA 3F0NA 1PBAA 3IR5B 4FYVB 5G4DA 4DS5A 3S7RA 1FDBA 4GMKA 1K44A 4JV0A 2IJRA 3EGZA 5D4PA 2E9RX 5H9FJ 3N01A 2KT3A 4JI0J 3CPWR 4F3QA 2E7XA 3FFIB 3TOQA 3RRKA 3R6GB 3M2UB 5K8PA 3BO4A 4ANDA 4F25A 1OWXA 2RRAA 3ONQA 4ZPDA 4ZCLA 4HHUA 4H4OB 3SDEB 5DG7A 7AT1B 1RU2A 1S10A 2DGSA 2HWHA 5L46A 1FD8A 4OX6A 1YX2A 4M94A 3IWXA 4DXLA 1P1TA 2UXCJ 2DGUA 3FBBA 1Y5LB 4KAIA 4KFBA 5HO4A 5BR8J 4ZK7M 4F0KA 3DGPB 2E7WA 1B0PA 1ICEB 2XMTA 5L9NA 1SKSA 1F5AA 5KG0A 1F60B 3R27A 5E3AA 3AJ1A 3GJTB 1B0VA 5J2PA 1RLDA 2EI5A 4Q45A 2XS5A 5IT9Y 1C1BA 1C1CA 2FJAB 1TELA 4DFPA 2KJVA 5IV4A 4GO7X 3SFUA 2DHAA 5DDRC 4IH5A 1OPIA 1N8RT 3NY0A 3OL8A 4X4UA 5EX3A 4IKAA 3WX8A 4QPXA 1TR0A 4NLQA 4I4BA 3BPSP 4PABA 4RKUC 4EUVA 2KYZA 4NRTA 4B9LA 2MJUA 2W4CA 4PG6A 3MECA 3NOGA 3DRSA 5FD1A 4YHHF 4OYIA 1S1TB 2W24A 3G82B 2HHHF 1JWWA 4K4TA 1FRXA 2ILYA 4J37A 5C25A 4ED7A 3PVXA 2J0QD 3QFWA 2G2YA 3HK2A 3FEZA 4LBPA 4O4GB 3QQCD 1AA1B 4I7FA 1KP6A 1U7LA 2XNQA 4JI1J 2E5LJ 4LR8A 4A4JA 2AIRB 3RBXA 2H9ZA 1NH7A 1RE1B 2AJ0A 3UNGC 4LF4J 1UPMB 4C11A 1YI2S 5H9EJ 1T9TA 4HYKA 2CZVC 2VODA 4OZ2A 3MR3A 1FCAA 1ROFA 3NBPA 2VKRA 4MYTA 1L3VA 3LF0A 2W2NP 1SKWA 3BR8A 4NLWA 1HQUA 2NXCA 2HFOA 2MQLA 2WONA 3EGNA 2QIFA 1PC4A 4IQXA 1EP4A 2DHGA 4O4RA 2CUYA 2IRXA 3PJ9A 1IR1A 1W2BR 2SXLA 1ZAXA 4K5RA 1CLFA 3ZTSA 2WW8A 2YWGA 2GNKA 3FDSA 3MHYA 1JKHA 1N5QA 1MMNA 3GYNA 2QSWA 4IDKA 2GIQA 1HBUB 2GFFA 1REVA 4I1TA 1UETA 1SPBP 1GMWD 4LR9A 1YJ7A 2BM1A 5IT0A 2GS8A 1BQNB 1FXDA 4QCLA 3SCLE 2FHKA 3KK2B 2FJEB 2WBRA 4UQGA 2AYEA 3QMQA 3FC9A 4CLKA 1N0UA 4DOZA 3DLKA 4DR2F 4C0OC 2K7JA 3JTPA 2MXYA 4DF4A 2XYHB 1S9GA 4FF1A 1MN7A 3PM9A 5CYQA 4RUBA 3Q8SB 2VG7B 4DR4F 4K4UA 1LV5A 4GVBB 4CLWA 5J1NA 3O1LA 3D3BJ 4LF6F 3CEDA 1UFWA 2MQOA 1R0CB 3T6JA 5IT4A 4ED1A 1WC4A 3I31A 1XNRJ 4DN9A 3OPKA 1RQ0A 3CMES 2QLFB 4FPIA 3KLEA 2IA6A 5HMXA 3I0SB 4EYIB 2D3UA 1S48A 1U2FA 3F73A 3OR2A 1O0PA 3VGVA 3CW2C 2HRTA 4NLXA 2P9EA 1RTJB 3W2WB 1JLQA 2H3EB 3SSQA 2XGPA 4YB1P 1N5SA 3ZZOA 1KQGB 4OHYA 5J1EB 2W2OP 4URSA 1VQLS 1EAYC 2GIRA 3FCHA 2BABA 1KKHA 5B0CA 4UT4A 3NNCA 1LWCA 4C97A 2ASYA 1FRKA 4TU7A 2HBYB 4U7CA 3R3TA 4IOBA 4DL6A 5CAAA 4ZVQB 3T1AA 5E3PA 3O5TB 3UW1A 5G0RB 1KFSA 2UXBJ 4A8YA 4X66F 4OI3A 4P7VA 4X4TA 3LOUA 3OD2A 1HNWJ 2GW8A 3GJQB 4M1KA 2FD2A 4J9KA 3K0JA 1Y5IB 3CJ5A 2HMIA 4NZ6A 4V1Ak 3PRBA 1NBEB 4MFBA 2PMZD 5DG8A 3R5AA 1WEXA 1DLOB 4RUCA 3MEGB 2FY1A 1FRIA 1X4HA 2HNYA 2XEXA 4KGXB 3OLAA 3BGFA 3DOMA 3M32A 2OTLS 1JX4A 4DX7A 2HURA 1R3NA 3DKDA 3BQ0A 4KHPF 1UMJA 3CDAA 4PG7A 2HIYA 3EPGA 2XHCA 2O3DA 2HBZB 2J0WA 4UY8T 1U2RA 2QSFA 1A7GE 4AUKA 4KPCA 4MJKA 3W5YA 3GCWP 4LF5F 3NMRA 3W3SA 2BR0A 3FQKA 4DUTA 1HNXJ 4CT9A 1T9XA 2RKIB 4WK1A 4PWDA 4RWWA 4U7UD 2QLBB 2D9OA 3KDNA 1LW2B 3MUTP 3H59A 5KFOA 4C8ZA 1X0FA 3IAS9 1R8AA 1TKXB 3D6FB 4TLQA 1URNA 4OYPA 3I4PA 3RAXA 1S6QB 2B4OA 2JEGA 2Q66A 4URGA 5K14A 3E3XA 4CLFA 3N79A 4JI8F 4RWXA 2X1BA 2EBGA 2A6MA 2AZ1A 3A8IA 3FNNA 1LWFB 1UW4A 2DHXA 4JV5J 4CO0A 2MGZA 2H48B 3K59A 1TUWA 2ZJRQ 3N6MA 4DV7J 1BC6A 1NPRA 4JI4F 3GFHA 4U96A 2CPIA 2O66A 2VFSA 3H7HB 1RABB 1S0VA 3V4IA 3VR1A 1RT2A 4ZOSA 4FNIA 4O3QA 1RJJA 4OI2A 1YRTA 2R7WA 2KI2A 4JI3J 4F3OA 3Q24A 4F4AA 4ZN1A 1HBOA 4MK8A 4CH0S 5L38A 2DNOA 1TKZB 1N33F 1RAIB 4R0JA 5DDQC 3NLCA 4WCEQ 1U4BA 1C4AA 3JSRA 4WE1A 1Q81T 1PILA 4HLBA 5FDLB 1U49A 2FC9A 4YQWA 4JI2J 4UW2A 2KRBA 1L3UA 3QJJA 1U0SA 1BXNA 4P2FA 2RS8A 2VF3A 1HPZA 1RHKB 1HR0J 4GVLA 1RT1B 3GV5B 2YNHB 4YY3F 1CJVA 4ZP7A 3FZBA 3TVZA 2VICA 3POTB 3DOLA 4A8KA 2UP1A 4LT6A 2VDIA 1QD1A 3ZZTA 2OFGX 5EDWA 3QRPA 2VQFF 3EDQB 1GMVA 3BKTA 3GYXB 1OSCA 3T5JA 1WDDA 3OUYA 4DPYA 2XSFA 2NR0A 1RTHB 2Q6CA 2BJ3A 4FDFA 5KFMA 3W5ZA 2NZ4A 1N5YB 3ITHB 1IBCB 1EQMA 2DGOA 2CZ9A 1M5HA 4U7UK 2VONA 4WP8A 1AZSB 1WC5A 2AWZA 3TANA 1B0TA 1NK5A 4ELVA 3BSNA 4CDIA 4P72A 1WKKA 4USIA 5DS7A 2COLA 3QYYA 2QMWA 3E01B 5CYMB 1Q78A 1UW9A 4FYDA 2EPIA 2Q1LA 4TXSA 4B3RF 4F2RA 1OJ4A 5CD4A 3TJ8A 4ZLLA 3PO4A 1S1XB 1RT3A 2ZBPA 3K5NA 4CLYA 5AXKA 3HFVA 4USMA 2BKNA 1R8CA 1SJ1A 1TV6B 4KB7A 4M5IA 4YHHJ 1DTTA 2EXUA 1YJVA 3HO1A 1QSSA 2RILA 2N82B 1N6QB 2WW4A 2AP6A 2IPOB 2JLFA 1L3TA 3I55S 3ZTRA 4K4VA 3C15B 3C16A 5IFMA 4P10A 4TY8B 1JLCA 3R5CA 1KVJA 4KY3A 3CCZA 1YTYA 3QO9B 4OJ1A 5KAKA 2IY5B 3WHIA 3LQVA 4LJMA 4WKYA 1YBUA 4ZP9A 4OFZA 1RA7A 2V4QA 1C0UA 4GC6A 4O3OA 2ROGA 3U1MA 4USVA 1RA6A 4ID5B 5ADZA 1T95A 1LXJA 3HXMA 4TNOA 3ZZRA 2E1RA 2IRUA 1VRQC 1KLMB 2UVRA 1P9YA 2LEAA 4AFFA 3PRDA 1HYSB 4M5DB 2CJKA 1IM6A 3KK3B 4J7CA 2L9NA 4LF7F 4CIOA 4DR3F 3CMQA 2ROPA 4ZLPA 2Y1RI 3HFKA 5C42B 1F9HA 4DSJA 5J2QB 3CDEA 5D3GA 4G1PA 3OW2R 1FK9A 1V5VA 1ITPA 4AD6A 2OFHX 2QA4S 4P2XA 2HK3A 1DARA 2RU9A 1SC1B 3NXZA 1NDLA 1FNMA 3HSZA 3H5SA 4DR2J 4ZLJA 1VC5A 2B43A 2FTRA 4F0HA 3BBCA 3H8YA 3I82A 2E29A 3C8YA 4DR4J 3WBZA 2NS1B 3QSYB 1CJTA 5C2CA 4LQ9A 4LF6J 3NP5A 1WC0A 2DR6A 4PUOA 4AE5A 1KN6A 1RK8A 3NMAA 4R0EA 3EZ5A 1GAOA 3K5OA 4HI1A 3T1YF 2O67A 4DHVA 1EIYB 5KFJA 1HWKA 2A1BA 1O51A 2VZ9A 4AL6A 1U1MA 2EK6A 2VG5A 4ICLA 3HVAA 1PG5B 4XPCA 1OS5A 2OMLA 1GK8A 4ANCA 2D3O1 3L7PA 2EFVA 2BZ2A 3UNYA 1WORA 3K5MA 1R43A 1RISA 4DR5F 1RP5A 2HGLA 3U27A 2K8GA 2VB6A 2BOPA 3H2LA 5IXUA 2R8KA 3AODA 3M2VB 1RCOB 5T7LA 2OELA 2ASJA 5AT1B 4C8MA 1MMDA 2Y9HA 2I8EA 2V94A 5GADI 2LQ8A 3AD8C 1IBLF 1RT7A 5ETMA 4J9SA 3HZEA 1IKYB 1FDDA 1ZM9A 4EFAC 1LK7A 3GE9A 3PO5A 2R7XA 2IM2A 3NKYA 5HVHA 3J7YI 3GSDA 1Y4ZB 2ZH1A 2QMUB 4PXDA 2L41A 2ZH3A 3VHQA 2G0CA 2NYHA 3TA2A 4C8LA 3NCRA 5L1LA 1CJUB 4MTPA 2FJBB 3KLGA 4KHPJ 2F63A 2E44A 3QT8A 2HRYA 3UD3P 3R5JB 1BQMA 4WXOA 2DHHA 3PFOA 3SI8A 4OV6A 3UN3A 1MLAA 2P5VA 4DV6J 4LF5J 1JLBA 4ZS6A 4DCOB 2ZNYA 2XHWA 5D4OA 3CIMA 5IOLA 5HBMB 4WKRA 2XMMA 1YRXA 2J7KA 2ATCB 3GIRA 2B9WA 2DGWA 4DPUA 1JLEB 1FKPA 2XZTB 3DOKB 2U1AA 4XDCA 3CJTA 3VV2B 1C0TA 3LPEA 3QLHA 1TTHB 2JDJA 3PKMA 3H2UB 2M8HA 2ZH8A 3FVYA 3N0VA 1V3RA 2OD6A 3W60A 3D2WA 3PHTA 3ULHA 5EWEA 2RDJA 4A8SA 2C2DA 3N5FA 3GONA 3ILLA 3B8HA 5A8KA 3HHKA 4Q2MA 4J9UE 4MKVA 3D1OA 3NG8A 2KL8A 2C28A 3GV7B 2DNMA 3ETOA 3E51A 4NEZA 4JI4J 2GV1A 2OPRA 4FNHA 1IJEB 1FRHA 2LU1A 1S7HA 3D1QA 5H1SV 1T05A 5B09A 5ETNA 4EI2A 1WG1A 3A13A 2M9KA 3ENWA 2GQ2A 4WPAA 3JAMU 4LF9J 2V9KA 2CPDA 2PA3A 1N33J 4DFKA 1NK7A 1NDPA 2AKWB 1O5JA 4DF8A 1UZHA 4ED4A 4W90B 4ZVTB 2HNDA 3EYZA 6AT1B 2PSZA 3PHEA 4KFBB 1Q16B 4D3HA 4NLRA 5EN1A 1M5PC 2MZRA 4K50A 2F4VF 3KMQA 4YY3J 3HM9A 2E1MC 2BE7D 1SVDA 1N4LA 4ITSA 5J2PB 3DI6A 3VAKA 1HHSA 5LJ3Y 4BLGA 5GAHI 2P9GA 2CWXA 4OX9F 1FESA 5F0WA 1WI6A 4Y65A 2VQFJ 4CLUA 4DL0C 2OLWA 3AA9A 4DV5F 1C1CB 1C1BB 3AQOA 2Y1LB 1TL4A 3C46A 5DDOC 2J9DE 3IBWA 4ERDA 2HSEB 4PXEA 4OL8A 2V2ZA 3EPIA 2GA7A 2N7YA 3THPA 2IM0A 3R2DJ 2XG8A 2MZSA 3TUIC 3J81j 4M95A 3G71S 3MECB 1X5OA 3RZAA 3I5AA 3TZWA 3BBFA 3G8TA 4OZNA 5KFCA 1JJCB 2APOA 5C25B 4B3RJ 1HWIA 3G9CA 5ITHA 4ZCIA 1SH0A 2UXDF 4H4MB 5CQGA 2IVMA 2GJFA 3O6QA 1ZPVA 3M6WA 2HVHA 3IO1A 3TAMA 2NXEA 2UV8G 1FHTA 1H2UX 4K59A 2DT9A 3QRRA 4WIQA 2XZDB 3P5BP 3M6VA 2R4FA 1T11A 3D68A 4EBDA 1Y11A 2IA0A 3R5BA 2CQ0A 4MK7A 2KJWA 4IYQA 1EB0A 5IT9U 3NBPB 2XZWA 2JX2A 5KG3A 4XIUA 1X9WA 1VBXA 1DFDA 3VCDA 2WONB 2HBRB 2Z57B 2C2OB 4CLLA 2VPZB 1EP4B 3LP1A 1U8WA 3EVMA 2FGCA 2XMJA 3AB2B 2W01A 1RTIA 4IOAQ 3Q22A 2JVRA 1UVKA 3TUZC 1XWLA 2OAUA 1U09A 2DCUB 3R7BB 4RX6A 3OL6A 1HHTP 5B0BA 3IRXA 1URRA 1REVB 2VASA 5DGBA 3SCJE 4DL3A 1M90T 4WFYA 1TMMA 2PIIA 3A3PB 4K7QA 1KNZA 1CQMA 4J90A 3B78A 1ACMB 3TO8A 3QGPA 2R2SA 4LF7J 3IC1A 1VBZA 4OX7A 2OHDA 1T03A 2OH2A 3PKYA 2CDRB 4X4OA 2P2CB 1S9GB 3OTBA 3M05A 5CYQB 1DRZA 4U95A 2QYGA 2ACMA 1SKRA 2XSJA 2DO0A 3MMBA 3OSPA 1TUVA 2ZD1A 3BEGB 2CQ3A 1VQKS 4ED2A 1I94F 3FFIA 1NMEB 3OJSA 3KLEB 3V4MA 2QL5B 4Z2XA 5DLGA 3GJSB 1TK5A 2QT7A 2VFRA 3DXSX 4MT1A 3HMJG 5MAOA 3SDEA 1JLQB 3CWJA 3W62A 3GP9A 2W8KA 1SC4B 4QU6A 2HQCA 4B17A 1JLFA 1FE4A 5ETQA 1VRUA 2CJAA 2FIUA 1ZTTA 5A6WA 1B64A 1CULB 2V2VA 1VCTA 4K5SA 2V5HG 4HKQA 3L9ZA 2MLYA 5BXIA 3AD9C 1IBKJ 3IBFB 1LWCB 1N56A 1PO6A 1RTDB 1T9YA 2DGVA 2GJIA 4RL1A 2JRSA 2PD1A 5K20B 2RQMA 4ECXA 4LFAF 4FS2A 2BEFA 1GMWA 5A8RA 2XMVA 1FXLA 2KU7A 3ZNJ1 2L9WA 2ZZMA 4P75A 5EWGA 4NLSA 2FPHX 1Q8BA 2MSTA 3H2VE 1WACA 1RWKB 2HKEA 1S72S 1UEKA 2HMIB 3KOAA 3SYZA 2VC0A 4J9NA 2FQQB 4MFBB 2CQ2A 2KXHA 3DDKA 4WIIA 1PJ7A 3BZQA 4PYDA 1W26A 4Y2AA 2XY6A 2HNYB 2RQCA 5J2NB 3DOMB 3M32B 3UWTA 4CNYA 2H4YB 4BDPA 4RUHA 3LP2A 3KLVA 2C2EA 3NEKA 2CNNB 2CPXA 2DRDA 2M3DA 4J5OA 1FJ7A 4O4GA 3ZTQA 1NPKA 4DU8A 1APSA 4QR2A 3UN2A 1JXEA 2B51A 4PWDB 3D0IE 2VL1A 5IC6B 3I56S 5GMDA 5F8IA 3FRYA 3L09A 3MURP 2XTJP 3GQCA 1KOOA 1MN9A 4QIEA 4NLDA 3DRRA 4UTGA 4QYZJ 4F4WA 3B82A 1EETA 1S59A 1LOUA 4B3TF 2WVCA 3MWBA 4Q8EA 5AXMA 3MUVP 1SL2A 3UR0A 1XJWB 1HW9A 2RQ4A 6FDRA 1XMOJ 3O2IA 1K8AT 1VQYA 1GEHA 3RB6A 2XC9A 1J5EJ 1S1UB 4YEAA 2GMLA 2B4VA 1S0MA 3MF5A 4DSKA 4P9SA 2M0GB 3T19A 2LDIA 3OXFA 2MGZB 2DNRA 4IG0A 4IH6A 3GCXP 1TL7B 4E0DA 1BY9A 1IBMF 2RVJA 4XPEA 4G3IA 3NGSA 2ZBRA 4FVCA 1S76D 4K4YA 1Q53A 2DY9A 2AEFA 2HPUA 4QW8A 2YPZA 2CNOB 2F4FA 1I51B 2BKPA 1JJ2R 4WTOB 3I5CA 1U1RA 1G3OA 2AJQA 4USJC 4I68A 3TYTA 1BQNA 2HWIA 1BHNA 3Q0AA 1X4FA 1PCAA 1UA1A 3A8EA 2A6OA 1X4CA 4RBVA 4IFVA 1BE4A 2C2ZB 1HBOB 4NLTA 4C2MA 4U6PA 4RR5A 4GKJJ 2OIHA 3AOCA 2QLXA 2VG7A 5KFQA 1Y5NB 4WE1B 4DJBA 4IO9Q 5KFAA 2Y3YA 4Q8FA 1FFSB 2MZTA 4MK9A 1HPZB 2ZEJA 3D28A 4CI0B 2M70A 3DGVA 3ZZYA 3TR5A 3B4MA 1YJ9S 2YWKA 1CJVB 3CNQP 5HAOA 3D6MB 2HVDA 3FSXA 1UWBB 3UVJA 2K3KA 3DOLB 2B9EA 1X4DA 1OPZA 1RTJA 1DZ5A 2HFUA 1F6TA 3IG1A 5LL6d 3LGHA 2HQFA 5KFBA 1VC0A 1ZH5A 4N8OA 5J1EA 1WELA 2F4VJ 2GMHA 2DKOB 2FVRA 1WD6A 4RJVA 4OI4A 1PIEA 1WC6A 3Q8YA 2X51A 4OZJA 3QIDA 4USKA 2VBWA 1R89A 3JYTA 3VAIA 1YITS 3MM7A 1S0NA 2R8JA 1FWKA 4F7VA 3H0PA 1FRJA 3CO0P 3KUEA 4B3SF 1RBOB 1RWPB 3CJ8A 4DV5J 1NUEA 3W65A 2HHPA 2B9YA 3KUGA 1AUDA 1I6JA 1XBWA 5C2GA 1NJXA 1ULRA 4OI0A 2E1PA 4PAAA 2UV8A 4DPXA 4ALZA 1TL5A 3IS9B 4QWAA 1FJEB 2ZBCA 4RNFA 1RT3B 2ROEA 4OIXA 3LO3A 4DX8H 1UVMA 2JSXA 1X9SA 5CCLA 4M5NA 4QIVA 3ZTOA 5LXRA 1DTTB 4X62F 7FDRA 1MROA 1RAAB 3A8KA 4NXNJ 1F0XA 3MXHP 3I9V9 5D4NA 3C16B 4ZDNA 1HI1A 2EWHA 1JLCB 1RXOB 3A1YG 3V6HA 4NMLA 2HLUA 3X1LB 2DH7A 1C4CA 1HBMA 3RJMB 4TQRA 2XCAA 2DISA 3R5GA 5E3CA 2LQ9A 2CRLA 4DUZF 2V2KA 2DR7A 3LPYA 1NHUA 3QWUA 2K2PA 2CNLB 3TQEA 5KG4A 3MPWA 2IAJA 1A6LA 2NXNA 4C3LA 4B02A 3M9MB 4B3OA 2MLZA 3MMJA 2BANA 2VBYA 4LVNP 2W7PA 1K0TA 2B6AA 2VPWB 1LWFA 3VZIA 5K8NA 1WHXA 1G6BA 4IRCA 4FBUA 4DX6A 1RTZA 4IRDA 3MM8B 3US5A 1RT4B 2FVCA 1WSRA 4B9SA 1OO0B 5HVGA 1WOPA 3NNAA 1M1HA 1FD2A 4DWIA 3HFZB 3KLHA 4I64A 4PEOA 3C2PA 3LWMA 5EHHA 4R25A 1HMVB 3PYDA 2R8GA 2KFNA 4ZA1A 4OLOA 4J9QA 3MI7X 3BSOA 2QFIA 3UI3A 5F41A 4N47A 3PJWA 1CJTB 1TKZA 3HHNB 3MR7A 4PUOB 1Z4UA 1I1GA 1I94J 2QV6A 3A12A 3GFYA 2AEJA 1IUJA 2UXCF 4ECYA 3TW0A 3MAHA 4DCPB 3WIUA 4ECQA 2BE2A 3V6JA 4CLTA 2RQKA 5BR8F 2VG5B 3KXDA 4ICLB 1RT1A 4BHQA 3NCQA 3PR5B 4I6YA 4ECTA 2DNPA 2DRBA 2QGFB 2KVIA 1KDNA 1U1NA 2J0SD 4CO4A 2JEJA 2HQIA 3AFGA 1OQ3A 4QR1A 1OQ6A 4C8YA 3PR4A 3RBDA 2V67A 4RZRA 2QL7B 1M1GA 1PC5A 1RSCA 3RU0A 2LLZA 3I5BA 1PSDA 4ZVFA 2OSRA 4YN3B 5KFXA 1NM2A 4NWBA 3W63A 1N5YA 2ZOFA 2G2ZA 1HD0A 2UUBJ 3VWSA 1WF2A 4LFAJ 1RT7B 2BQUA 4IFYB 1AZSA 2D74B 4LIWA 4BCAA 3MPUB 3QBCA 1X9MA 2LXUA 4F26A 5CYMA 1Q82T 3LGMA 5E5NA 2XLIA 3NGKA 3NRBA 3J7Z5 1ZPWX 4RW8B 4U8VA 1S1XA 1YJRA 3RBZA 2M8DB 2FZCB 2MYFA 2GO9A 1YQHA 5A76A 1X5PA 2GVZA 1BQMB 2I38A 2RJZA 2WSFC 4NXMF 1N6QA 4ES2A 2XWXA 2D3ZA 2KFYA 4PWWA 1RAJA 2POKA 1RAOA 3SCIE 4QIWD 4HH0A 4DL4A 1WHWA 2XO6A 2EKYA 2XMAA 3PX6A 2LKZA 3SEOA 4YB7A 2BOAA 2HS3A 1KS2A 3BQ2A 1QTNB 1OYDA 1PJ5A 2V8VA 1VQ5S 3MMAB 1N36F 3DHXA 3V2UC 5ETOA 4NYOA 1FKPB 2E5HA 5H9FK 3UQSA 1C0TB 3WC2A 3QLHB 1LW0A 3W7BA 3I9ZA 2FVPA 2BQ3A 4TYBA 4B3TJ 4F36A 4AL7A 5F8GA 4NYZA 4C3KA 1NK6A 4OYMA 1EARA 2DNGA 3GIJA 2V4RA 3THVA 5LMNJ 1EZZB 2FGOA 2HQGA 2C2KB 1NCLA 2R9LA 4NI2A 3TNVA 2ZDPA 5A8KB 1HYSA 4M5DA 4DSLA 4OZ1A 3KK3A 2CG8A 1WC3A 2O5DA 4Y3CA 3HSJA 1JXVA 2XY5A 5J2QA 2OPRB 2YQ1A 5AXLA 4NASA 2O01C 3RRGA 2FZKB 3H4BA 2D3OR 2HAIA 1DY3A 2P9CA 1Q8IA 4KC5A 1T05B 1V6HA 2EG2A 8AT1B 1UFKA 1F5CA 1V3ZA 3CD0A 4L75A 2OGUA 1UJ6A 3HKWA 3WQPA 1RADB 4Y2CA 2OMOA 4I56A 4KT0C 5KFVA 1OYEA 3CULA 3Q89A 5A6PA 2WZ1A 3G6YA 3E2EA 5I4MA 5K8OA 1H7WA 1QY7A 5KFNA 1XQIA 2HNDB 5DDPC 3AXKA 2NYIA 4FXVA 1YJNS 1MWQA 1TP7A 4PKDB 4WBFA 3GFZA 3N4WA 4IOCQ 4ZKAA 3PEJA 2R8IA 2CVIA 3QJLA 3NGRA 1BQXA 1EKSA 3DI6B 4KH1B 1SI9A 1UWAA 3OFHA 2ZZTA 3JSMA 1RYSA 2MZJA 4EK2A 4MYUA 3HZGA 2OKQA 3CJ0A 2E9ZA 1NJWA 4CWBA 2Y8YA 1X4EA 3SSRA 5I3PA 3M2RA 1RBLA 2HHWA 4F02A 1RGVA 3DLHA 3N9UC 4LSNA 1WG5A 2A3JA 4X65F 4B3SJ 2W7OA 2HVIA 1VIXA 3DFEA 3M8SA 3NOCA 2GHVC 1GXLA 2IIHA 2V0NA 1G7CB 1JK9B 4ZLNA 3FBFA 3DDIA 3KTQA 4Z37A 2XS2A 5DQHA 3G87A 2JHEA 2ADCA 2E9TA 2ZZNA 2YWHA 3NAHA 2NXJA 3G2XA 1GT8A 3BN7A 5HI7A 4F4YA 2DH9A 3EM1A 2ZE2B 4L3KA 4X62J 3MD1A 2AQ4A 2YXLA 4QIGA 1OY9A 2M52A 3CJ2A 2OPSB 4HI2A 4KHRA 2EW9A 4FYWB 1VJQA 2MSSA 1QVFR 4P2MA 2OPQA 3BSCA 5CHCB 3I6PA 2XMWA 1R27B 3HD1A 5HBMA 2B56A 3PX4A 3JAMY 1R0AA 1S1VA 2KXFA 2BE9B 3LP1B 3CC7S 2Y8WA 1SL0A 1U6ZA 4DUZJ 3MM5B 1WG4A 1RTIB 3DOKA 3NL0A 5B0FA 4KBIA 1QTMA 1HBNA 4JV1A 2WHOA 3CUNA 1R6VA 5B0EA 1NLKL 4DV7F 3PY8A 3HVWA 3W8PA 2JEIA 3IRXB 2C2RA 1VMBA 5M2RA 2MQPA 1U26A 1GH8A 5BJRA 3IR7B 4C6AA 4JP8A 2G0JA 2H5JB 3VAMA 4KSEB 4CLSA 2B5JA 4ZITA 1T03B 4NOHA 1TU0B 1YBAA 5AE3A 5KG1A 2AZ3A 2FZGB 3FRZA 3IR6B 4JI3F 2HQDA 2OTJS 1CVJA 1U6BA 2H5EA 4CM0A 1OMSA 5CD4H 5AJ3F 2XSJB 3MMBB 2MZ1A 1VISA 3U02A 3MM9A 1KRPA 2ZD1B 4OZLA 5KT4A 1RKIA 3RB4A 4DSEA 1NHKL 1K73T 3CCJS 4JI2F 5HMZA 3GIIA 3D67A 3R1LA 1HR0F 1YKWA 1P9QC 3AQPA 1EJ7L 3T5KA 1T9VA 3HF5A 1F2HA 3BGRA 3P3DA 5IQ6A 1O8BA 1KC8T 4U67Q 1JLFB 5K8MA 3UDCA 1VRUB 4PPZA 4HEA9 2LXFA 1IM4A 1GX6A 1NDKA 1RB0A 2Z30B 2E1CA 3QGIA 3M1VB 4I2PB 3L4BC 4B3MF 3CO9A 1N5VA 2XWYA 5D8HB 2DNNA 2G4BA 2MQNA 1KTQA 1XIQA 4NPOA 2J8SA 2KM8B 1BWVA 1NSAA 4JYAJ 1QJHA 2AJFE 1FJGF 3C6UA 3U1LA 1QLNA 5A8RB 3DMJB 2GIFA 4PRFA 1VHIA 2MY8A 2BV3A 3IM8A 3BH6B 3M8QA 4H4KC 1CQNA 3MFHA 3T5LA 2DNYA 1RWWB 3AD7C 2WCXA 1HNVB 2JZ5A 3W5XA 4Q44A 3TEGA 1QAYA 1LWEB 3GFXA 2MQQA 2RHSB 1NSKL 2AT1B 1FWLA 1AXQA 4HTJA 3WC0A 5E41A 3H5XA 4TYAA 1NSQA 3LP2B 4AXJA 4KR0B 1DQAA 3GZ7A 2FLLA 1SIZA 2V50A 2XLKA 1N52B 2WVDA 3R9LA 2E5JA 2R3VA 2BVZA 1IR2A 4WFZA 5KG6A 1VQ8S 4H4MA 1IXKA 1UZDA 4O0NA 2ZFHA 3CJKB 4Q7AA 2HFNA 3IFEA 1UEUA 3EDRB 2HHVA 5DM6Q 1AROP 4ZIWA 4DMZA 1RT6A 1TFYA 3DXBA 3MEDA 4CLPA 1VQOS 4NXMJ 1R8BA 1RWXB 4AYBD 5DQGA 3DRRB 1S49A 2VFVA 5D4LA 2X3DA 1EETB 2KG0A 2F5GA 2BMBA 2KHCA 3HVTA 1HWLA 5B0DA 1CSJA 1S4FA 3QT7A 1N36J 4KYZA 5HLFA 1HFEL 2YX7A 3QNWB 4LMZA 3TUPA 4PWUA 2UUCJ 3S01A 3PXGa 4WZMA 3EZOA 4FS1A 2Z2YB 1D0EA 4IG0B 2PEBA 1KVKA 3K7RA 2QN6B 3DYAA 2CQ4A 3L7UA 4LUBA 3MCMA 2HHSA 2IMWP 3KKFA 1AT1B 1PGZA 1D3WA 4Z7CA 4FKXA 5HMWA 1QDUB 3L95X 1HWUA 5E3RA 1DURA 3ENQA 4OYOA 2V9WA 2VUGA 1IKXA 2JJ4D 2Q6BA 4OYXA 2M2BA 3MR6A 2VBXA 3N6NA 4IFVB 4AT1B 4OJ3A 3IWLA 1YHQS 3VTIA 3KHRA 2CJQA 1ZM2A 4RW4A 1KLNA 3UFCX 2I1RA 2V6AA 3Q86A 3HI9A 4G1QA 4IRKA 2NUHA 1O6XA 4E2FB 2KTQA 1MW7A 3SFGA 2UUWA 3K57A 5KFGA 2MKKA 2RNEA 2DEJA 3PX0A 2BJ9A 4QJVA 3UVJB 2NZCA 4OYZA 4O44B 4YB5A 1FDNA 2ZH2A 3IG1B 2HHQA 4RNOA 1KR4A 2X7IA 4X4QA 5L8RC 1WI8A 2KZMA 4LRDA 1RACB 5C5JA 3D5MA 5D6GA 1CULA 4H4KA 2J6SA 5ETKA 1KOHA 1M5KC 2MMYA 3SV4A 2AV5A 3JYTB 3L7OA 2F9DA 3MM7B 4CYUA 5HN0A 2JC1A 4NA2A 2EG1A 1RTDA 3G8QA 1HWJA 4HR2A 2A0FB 3FSYA 5LJ5Y 4Y0FA 2ZBIA 1UEVA 3NAIA 2FJXA 4DLGA 2MEWA 2V68A 2DXFA 1Q95G 4NYPA 1NNDA 4B9VA 2N4CA 3M30A 1SIWB 4NRUA 3ETMA 4X65J 1WF0A 4LQ3A 1GQEA 2CPEA 2F7VA 1LNQA 4C8KA 1E6YA 5J2NA 4Y28C 3RYLA 2Z0GA 4RW7A 4O23A 1MROB 3TI0A 3TRGA 4XAKA 2RT3A 3QPIA 2NSBA 1S5ZA 2L3MA 4OYAA 1RHRB 2VIHA 1HHQA 2CJXB 1HNZF 4DV6F 4NX9A 2V8DA 4MIBA 2VOPA 3HJVA 4RNNA 3M8RA 1J5OB 1WC1A 1CC8A 3TUJC 2DEIA 2CQHA 1HBMB 1NO8A 2XO7A 1XN9A 4TQSA 1NKEA 2DCLA 3PNIA 5GAEI 3Q8RB 2FJVA 4LRCA 4QWCA 3RAQA 1PAEX 2NSCA 1XMQJ 4DQSA 2FVQA 5CABA 2RAQA 4MIWA 3MD3A 2YY3A 2JVOA 1SJ4P 2IAJB 3M7VA 3MOJB 4YDXA 2GAGC 2WB1D 4B3OB 3RUBL 1Y3JA 3NS5A 5D0GA 1WSVA 3DLJA 2AF6A 2V69A 2BANB 1RLCL 2R7TA 2IBOA 3AT1B 3PV8A 2W4DA 2XS7A 3BS9A 1S1UA 4W92B 2IMOA 2B6AB 3NWGA 4Y2IA 1AYEA 2BRLA 2Q79A 4TN2A 1NZ8A 3HHLD 2D9PA 2DTJA 1TL7A 2W4PA 4WWSA 1D09B 1N34F 3HT0A 2MY7A 3ISZA 1TAUA 2XBPA 5AE1A 2LA4A 4DR1F 5A8WB 2QEXS 4ED0A 3KLHB 5T14A 3C14A 3QRQA 3G86A 2J9CA 4CO3A 5CA5A 4LRBA 3VAHA 3RG6A 4ZVGA 2YX4A 3TQ1A 3KHHA 1A0OB 4JI7J 4LF9F 5AJ3J 3JTNA 2KFZA 3P45B 2ADBA 2WB4A 2W9AA 2RSQA 3ILOA 1P8GA 1VQMS 4CTAA 5KT7A 3IGNA 3W1YC 1RHUB 3A3OB 4GO5X 2MZQA 2YKPA 2C2NA 4F2SA 2QA1A 3I32A 4M5GA 2LCWA 3DLGA 2BE2B 3C66A 2ALZA 2CFXA 4C8OA 3HSGA 3F44A 2AX1A 3D0GE 3MPVA 2Y1IA 1TUGB 3TA1A 1NH8A 3CJ3A 1UWBA 4NA1A 4ETXA 2HW3A 4E8UA 1WOSA 3VVTA 3HHEA 2D69A 1ELOA 4ZP8A 1LFWA 4ED5A 3QT5A 2D7SA 3VVUA 4PG8A 4B3MJ 5LXYA 3N6LA 5F9NA 4UOGA 2DR8A 3VAGA 2R8HA 2ZM6F 1NAQA 2W8LA 4DU7A 1RAEB 1VQPS 1FJGJ 1NXIA 4NLOA 2V8GA 1Q8KA 3TP2A 2XM3A 2UVVA 4NMXA 2EBEA 4GC7A 1FJCA 3PTWA 5KT3A 4NCAA 4NE9C 3EVOA 4WFBQ 3IS9A 3Q2TC 3RBEA 1Y7PA 4MKBA 2AHOB 1HQEA 3VQSA 1DHMA 1I5OB 5GMEA 5HP1A 2QZ8A 2ZUAA 2N4DA 2QMXA 5LSLA 2AEMA 4CQ1A 3EXCX 3FUYA 4X4PA 3GG0A 4NL5A 2GVZB 4X4RA 1S77D 5CXTA 4USTA 4ETZA 4D3GA 2DJWA 2Q43A 1FRLA 4M5MA 2O1PA 5ETRA 1SJRA 3GMGA 2CQPA 2PMHA 4ECUA 2ZC4A 5L9XA 1WKLA 3MMCA 3H5UA 3J7A1 5I3QA 3CB4A 2UUAF 3OXGA 2K3IA 2CG4A 1JIHA 1ZM3A 2G2OA 1K9MT 1LW0B 1D9FA 1NPPA 2C3YA 3HP6A 5HROA 3PDNA 4BC7A 1RYRA 1P6TA 5KFWA 8ATCB 3VGTA 5KFKA 3DHWC 2W9CA 2YPYA 2P6TA 2UZAA 4NI2B 3EICA 4DUYF 1KTVA 5JVGQ 1T0TV 3OVSA 3QFHA 3OXLA 1WOOA 2OPPA 4DQIA 1R0BG 1FE0A 3MM8A 2E7VA 1C2PA 1RT4A 3QAUA 2VU5A 4ZN3A 3D7SB 1WWHA 4C98A 3SSSA 2CQCA 2CJBA 1DBDA 3Q83A 1U02A 2YKMB 2GGPA 2NREA 2CPZA 1NKCA 4A8FA 2EC2A 3OT9A 1HMVA 1X5SA 2W7AA 2FJWA 1Q7YT 2Z8QA 2ZITA 1RHQB 5DLFA 2VPYB 4ZVSB 3EE3A 3QATA 1CC7A 3MAQA 2IJNA 1TL1A 3OL9A 2RRBA 3F56A 3LW5C 3CT9A 4MAKA 4YFUA 2NCKL 1QAXA 3K8VA 2R7SA 3BKUA 3LTOA 3BGLA 3O44A 5EUHA 2C1EB 5HL7Q 4ILMA 1P27B 3P4UB 1Z2ZA 5KT5A 1QE1A 2GCFA 4DQRA 2J76E 3PIOQ 3TZYA 1Q8LA 2NQPA 4RO0A 4F67A 1IBKF 2K7KA 2RH3A 3BO3A 3CIZA 1IKVA 3MR2A 4CCHA 1HNIA 1M5OC 3JSMB 2FLPA 1VHFA 1DQ9A 1HKAA 4O0IA 2XQCA 3V6DA 4YR2A 1IWAA 3IA0A 2ASDA 2H5IB
chains in the Genus database with same CATH topology
3BQ0A 4KHPF 1MMLA 1UMJA 3CDAA 4H4OA 1OO0B 2HG4A 4PG7A 1MWZA 1FO1A 2KG1A 4DFJA 4F3MA 3EPGA 3NNAA 2O3DA 4DV3F 4KKOB 2KT2A 3M2RB 2J0WA 3KLIB 1U2RA 3OTEA 4UY8T 5KT2A 1FD2A 4DWIA 4IH7A 2QSFA 1R8HA 2CPJA 1A7GE 4AUKA 3KLHA 4I64A 4EBCA 1R6YA 3CDWA 2XY7A 5JVHQ 2BW2A 4MJKA 3C2PA 2CQ1A 3LWMA 2L08A 4LF5F 5EHHA 4R25A 1HMVB 5THWA 2KRRA 3NMRA 1UJ5A 1Q4RA 4LSNB 3W3SA 4OHVA 1UL3A 1ZTWA 2BR0A 2R8GA 3I4HX 4ZA1A 2KFNA 1VFJA 3FQKA 3ICLA 2ATLA 2NUUG 2AX0A 4OLOA 4FXDA 4CT9A 4A8MP 2HVZA 2RKIB 4J9QA 5B7WA 2ZH6A 4IFYA 2LXIA 2DNLA 3MI7X 1BGXT 3BSOA 3DGPA 2UU9F 1NK4A 4BWJA 4WK1A 4PWDA 4RWWA 3BN4A 4KIAA 3SQGB 3UI3A 5A2QY 5F41A 4N47A 2BXJA 3TARA 3OHBA 3PJWA 1QSYA 2D9OA 4O3SA 3U1NA 1VRTB 2Q3PA 2FLNA 4F8RA 1TKZA 3HHNB 4RBUA 5F3TA 4PUOB 1Z4UA 1F9FA 1LW2B 3MUTP 4PCQA 3H59A 2EFPA 3DLEA 4ZPAA 5KFOA 1NB7A 4C8ZA 1I1GA 2CQIA 2QV6A 3IAS9 4ZPTR 1R8AA 1X0FA 4MIAA 1TKXB 3GFYA 3RRHA 4IUFA 1VGYA 2HIQA 4OMFG 4TLQA 1IUJA 2YNFA 4RBTA 1URNA 4RW8A 2UXCF 4CO2A 4ECYA 3TW0A 3PW7A 3I4PA 3RAXA 1S6QB 2B4OA 3MAHA 2JEGA 3H98A 3CDBA 2Q66A 1OIAA 1VK3A 4ECQA 2DO4A 2BE2A 4ECZA 4URGA 3V6JA 4UY85 2WRMA 2EFGA 2RQKA 5K14A 3E3XA 4J9OA 5BR8F 2VG5B 3KWMA 4ICLB 5L39A 1H6KX 1RT1A 3N79A 1TKDA 3LUYA 4JI8F 4PXBA 4RWXA 1UFLA 2X1BA 2IM3A 4JI7F 4BHQA 3DRPA 2EBGA 3NCQA 1SBRA 3K2YA 3PR5B 4I67A 4I6YA 1VC6A 5F8JA 2BBEA 2JH3A 4PQUA 3FNNA 1NK8A 4ECTA 2DNPA 1LWFB 1LXNA 1UW4A 2DRBA 2KVIA 3DLLQ 2DHXA 4DQPA 4CO0A 2OPQB 2MGZA 1U1NA 4KQZA 4CNZA 2J0SD 2PO4A 1XC9A 1DTQA 3MDFA 4IG3B 2HQIA 4CO4A 4N5SA 4WYWA 3CXCR 2JEJA 1LQ9A 3K59A 2B7BB 3MR5A 3N6MA 3J7ZT 2ZJRQ 4KPYA 2YH0A 1OQ3A 4FVMA 1BC6A 4QR1A 1OQ6A 1XR6A 3PR4A 4C8YA 2VD3A 3RBDA 1Y00A 3GFHA 4JI4F 3D54A 4RZRA 5KG2A 2CPIA 2O66A 2ZKTA 1S1TA 1PC5A 2X1FA 1R0AB 1S1VB 3RU0A 2VFSA 2OJ3A 2LLZA 3N5BA 1YJWS 2A2DA 3I5BA 1S0VA 1XMOF 1PSDA 4ZVFA 1S6OA 3MMAA 2OSRA 3V4IA 1XR5A 2ZOGA 5KFXA 3VR1A 2HHXA 1RT2A 4NWBA 4CH1A 1N5YA 2ZOFA 1J5EF 4C3MA 1HD0A 4ZOSA 4FNIA 3WZ0A 3VWSA 4O3QA 3C3LA 3CD6S 1RJJA 1YRUA 1YRTA 4OI2A 2CQDA 2R7WA 1OSDA 1HBNB 5K9FA 2KI2A 3CCUS 4F4KA 1WF2A 2XLJA 1RT7B 3CCSS 4IFYB 4QWEA 2BQUA 3Q24A 4F3OA 2D74B 4LIWA 4BCAA 3I96A 1HBOA 2DHSA 2Z4PA 4MK8A 3W2VB 1X9MA 2HGNA 4CH0S 1BWEA 2LXUA 5BYQA 5L38A 2DNOA 1TKZB 2PA8D 1N33F 4DV4F 4R0JA 1VQ6S 5DDQC 3NLCA 4NCGB 4WCEQ 1C4AA 1FTCA 1U4BA 4F26A 5A0YA 5CYMA 1YIJS 2J9EA 3GV8B 3LAMA 1HA1A 3JSRA 4DQQA 1Q82T 3LGMA 4WE1A 5E5NA 2XLIA 3NGKA 1Q81T 1PILA 3NRBA 4TU9A 1X8DA 4HLBA 4PPDA 5FDLB 3J7Z5 3AAWB 1U49A 2YNFB 1ZPWX 2FC9A 2B5JB 4R5PA 4YQWA 4RW8B 1BLUA 4UW2A 4TY9A 2KRBA 1L3UA 2AW0A 3EZUA 2WSEC 3IRWP 3QJJA 5GAGI 1FNOA 3DNCA 3FZ2A 3OFEA 1HD1A 4Q5VA 1S1XA 1YJRA 2RS8A 2FJDB 1HPZA 1NU4A 4DEZA 3K5PA 3CCES 2J7WA 1UVIA 5SUHA 5K14B 1GXUA 3S8SA 2LU2A 2M8DB 1RT1B 1UKUA 3GV5B 5IQQA 2MYFA 2DNHA 1ZYQA 1QAIA 2GO9A 1YQHA 2YNHB 4DPOA 4YY3F 2I5JA 3DRPB 1D1UA 2OO4A 4ZP7A 4ECSA 3FZBA 3TVZA 1WTBA 4GKJF 1X5PA 3MM9B 3POTB 1TVRA 3DOLA 1BQMB 4A8KA 2I38A 2UP1A 2NPIA 2RJZA 2WSFC 4LT6A 4NXMF 1N6QA 1G1XA 4ES2A 2XWXA 3BM7A 2D3ZA 2CYYA 2KFYA 1JLGA 5DM7Q 1RAJA 3ZZTA 2OFGX 2POKA 3KNGA 5EDWA 4ZPWR 4DBQA 2VQFF 2AU0A 4N41A 3BQ1A 3SCIE 4QIWD 4HH0A 3GYXB 4DL4A 1NKBA 4WU2A 1OSCA 3KLFA 1WHWA 2YNIA 3T5JA 2VOOA 2EKYA 4ELUA 3PX6A 3OUYA 5KFEA 2WAQD 4K4WA 2LKZA 3SEOA 2GJ2A 2XSFA 5B0GA 2NR0A 3ISND 1RTHB 4YB7A 4FF4A 2Q6CA 2DPJA 2BACA 3K8WA 4EWTA 4RU9A 2HS3A 1KS2A 3BQ2A 1MSWD 1HBUA 2V8VA 1VQ5S 4IR9A 3MMAB 4WXWA 3V4IB 4YOEA 3LALA 1N32F 1S9EA 5KFMA 1FRMA 1RT2B 1N36F 5DJBA 2NZ4A 3DHXA 3V2UC 1N5YB 4JBCA 5B08A 4NYOA 3X3UA 3KK2A 2R2RA 3ITHB 2Y1JA 1HI8A 1FKPB 2DGOA 3BGRB 3D0HE 2E5HA 3NS6A 3UQSA 1UVLA 1ZOTA 1C0TB 3WC2A 3QLHB 1M5HA 1A9NB 4U7UK 4DSIA 2VONA 1LW0A 4FF2A 1Q7LB 2AWZA 3W7BA 2VG6A 3TANA 1B0TA 3I9ZA 4UUXA 1WEZA 3AHPA 4TYBA 2BQ3A 1NK5A 2FVPA 2FUG9 1U47A 5I3UA 4ELVA 1G2EA 1JB0C 3BSNA 4AL7A 5F8GA 4NYZA 2DNZA 2F8MA 2NPFA 2C22A 4C3KA 3CE8A 4USIA 5DS7A 1NK6A 2COLA 4I2QA 3QYYA 2QMWA 3E01B 3FEXB 2DNGA 3GIJA 5CYMB 2HGMA 1Q78A 2V4RA 5LT5A 3THVA 2XMUA 2Y0SD 4FYDA 1VI7A 2FGOA 2EPIA 1V3SA 3ZZPA 4Q0BA 2YNGA 1FEEA 2BM0A 2RF2A 1VJWA 2AJ1A 2Q1LA 4TXSA 5MLCV 1ZZNA 4B3RF 3DN9A 2R9LA 1SH2A 3TNVA 1NK0A 4F2RA 2HRUA 4A8QA 1SJFA 2MKHA 2ZDPA 5A8KB 4L3NA 1SH3A 2F3JA 3PO4A 2J5AA 1HYSA 1S1XB 1RT3A 4M5DA 4OZ1A 4DSLA 3KK3A 3K5NA 3C6UB 2PE8A 5AXKA 4PR6A 3KMSA 2AJ4A 5EWFA 2O5DA 1ZM4A 4Y3CA 3J81Y 1XEZA 2MQMA 3I0SA 4CH7A 5IZHA 2XY5A 5J2QA 3MPYA 4NLYA 1K1QA 2OPRB 3M8PB 1Q79A 3LP0B 1ZETA 1R8CA 1SJ1A 5AXLA 2JLGA 1IJFB 1TV6B 4KB7A 3OSNA 2O01C 3RRGA 1DTTA 3HO1A 1YJVA 3FQLA 3H4BA 3M8QB 1QSSA 2D3OR 1SXLA 2RILA 2HAIA 5GMKa 2N82B 1N6QB 2P9CA 3W2WA 4KHMA 2AP6A 1Q8IA 2L9DA 4KC5A 1V6HA 2EG2A 2C3PA 2JLFA 5F8HA 3I55S 1QM9A 3G6ES 1L3TA 4K4VA 5IFMA 2PFFB 4JV2A 3HJFA 1FVSA 3EUNA 4FBTA 1TFWA 1F5CA 3PW0A 4TY8B 4AXIA 1KQSR 3BDPA 1JLCA 1Z1ZA 1H2VZ 1V3ZA 2BJEA 2YNIB 3R5CA 1KVJA 4DV1F 3CCZA 1YTYA 3OUYB 2MJNA 4YR0A 3QO9B 3CD0A 2CPHA 1UJ6A 5L1IA 4OJ1A 3HKWA 2JWNA 4YR3A 5KAKA 4Y2CA 4N77A 1H0HB 2OMOA 4IR1A 4I56A 2IJFA 3Q2SC 4KT0C 3LQVA 4LVOP 3I87A 4LJMA 4WKYA 5KFVA 4ZP6A 3R1HA 1MNEA 3DLBA 5GVQA 3JSBA 1YVFA 3RAMA 5A6PA 3KYLA 4ZP9A 3CULA 4OFZA 4HL9A 3KK1A 1RA7A 2V4QA 3G6YA 2CQBA 1S1WB 3E2EA 1C0UA 4GC6A 2HFZA 3MZIA 5I4MA 1GX5A 4O3OA 5K8OA 2LQJA 1H7WA 1QY7A 3ZZ0A 4NXNF 5IS2A 3RR7A 1NK9A 1MU2A 4RU2A 2LMIA 2ROGA 5KFNA 1D9DA 4A8XA 1S79A 2VG6B 2ZHAA 2HNDB 3U1MA 3LAKA 1RA6A 4EO6A 1D9AA 4ID5B 3J80Y 1HARA 5DDPC 5ADZA 2NYIA 2A10A 1T95A 4FXVA 1YJNS 4URQU 3IGVA 2MHEA 4LSLA 4QYRA 1TP7A 4PKDB 3GFZA 5G0RA 4PXCA 2RIJA 3B4DA 5HMYA 3N4WA 4IOCQ 4ZKAA 3PACA 4UOCA 2ZHBA 3PEJA 4YDDB 1LXJA 3HXMA 4PG4A 3UD4P 2R8IA 2CVIA 1U45A 4TNOA 3QJLA 4USHA 4ID8A 3KJVB 3ZZRA 2E1RA 3O3LA 2IRUA 2VFTA 3CCMS 2ZHOA 4WFXA 1KLMB 1TL3B 4CZCA 2UVRA 3RB3A 1SL1A 2LEAA 4IQMA 2ZE2A 3PRDA 3AA8A 4AFFA 4WZQA 1BQXA 1RT6B 2B4PA 3T9ZA 3MEDB 1HYSB 4M5DB 3DI6B 1S9FA 2CJKA 5FLXY 3KK3B 1XERA 1SI9A 3OFHA 2L9NA 4KGMA 4LF7F 4CIOA 4DR3F 2OPSA 3JSMA 2J8AA 1DLOA 2ROPA 1GXTA 2MZJA 4ZLPA 2Y1RI 3HFKA 3MEGA 1RYSA 5C42B 1Q1KA 4Q43A 2L48A 4DSJA 5J2QB 2F9JA 4MYUA 4OZ0A 3P96A 5KFLA 3CDEA 5D3GA 3HZGA 4G1PA 1K0VA 3OW2R 1FK9A 3HVTB 2OKQA 3CJ0A 2E9ZA 4DV0F 1WHVA 2MKJA 2KXNB 3SZ2A 1NHVA 1NJWA 4DL2A 1Y9OA 2GO8A 2OFHX 2AGOA 2KO1A 2QA4S 1X4EA 3H20A 3SSRA 5I3PA 5HLFB 3VQTA 1FT8A 3M2RA 3KLIA 2IFXA 5KFIA 1DARA 4V19J 2HHWA 2RU9A 1RGVA 3TVYA 4F02A 4WTYA 2DH8A 5U47A 2YKAA 4AL5A 2YKNB 1FNMA 2DD8S 3DLHA 3H5SA 3N9UC 3C6TB 2RU3A 1VC5A 4LSNA 1FKOB 2ZNZA 2B43A 4Y6IA 2AGQA 3MM5A 1KONA 1WG5A 2A3JA 2FTRA 4X65F 3DYAB 6FD1A 2W7OA 2HVIA 1VIXA 3H8YA 4BC9A 1QSLA 1DJ0A 1X0PA 3I82A 1WTFA 2E29A 2X1GA 3DFEA 2PDAA 2RKIA 3C8YA 5KG5A 3M8SA 3KHLA 4QOTA 2ZJPQ 4X4NA 2GHVC 1C0UB 3WBZA 3F41A 5DQIA 4J9PA 1GXLA 5CH7B 3SQGA 2NS1B 2V0NA 4BS2A 1G7CB 4LQ9A 1VRTA 1JK9B 3NP5A 1L3KA 3HHLB 1KQKA 5GADU 4PUOA 4AE5A 3PIPQ 1KN6A 3VAFA 1LW2A 1IKXB 1RK8A 4ECWA 5KFFA 1RWUA 1HW8A 3U7JA 1FDAA 3NMAA 3KTQA 4Z37A 2XS2A 5DQHA 5CCMA 4LSLB 4R0EA 2JHEA 1TKXA 2ADCA 4I6WA 2KDOA 1S6UA 2J0XA 3EZ5A 4JI5F 2E9TA 1AFIA 3QZ8A 1GAOA 4BWMA 3T1HF 2AD9A 2ZZNA 1KVIA 3K5OA 2YWHA 2ZDOA 4HI1A 1YWXA 3NAHA 3T1YF 2O67A 5KFTA 4DHVA 4K2XA 4YB6A 5JUMA 1IKWB 5KOXA 5KFJA 1S6QA 1GT8A 2Z2LA 1HWKA 2A1BA 3P6YC 3BN7A 5HI7A 4F4YA 4KJIA 4NZ0A 1O51A 2VZ9A 4AL6A 1NJYA 2DH9A 3MTJA 3R5DA 2ZE2B 1U1MA 2EK6A 3MD1A 2VG5A 3J7YU 2R2TA 4ICLA 4QIGA 2AQ4A 3HVAA 2J9DA 3PZPA 4XPCA 1JXLA 3VALA 1OS5A 4KO0B 2OMLA 5BYRA 3MEEB 1KSPA 2M52A 4RW4B 3DDNA 4LF8F 3L7PA 3CJ2A 2OPSB 4HI2A 3MUMP 4KHRA 4N8NA 2EW9A 3WDOA 1TK0A 2EFVA 2MSSA 1QVFR 2FLPA 2BZ2A 2OPQA 3BSCA 3ZFVA 4G1QB 3SMZA 5D3GB 5CHCB 3I6PA 2XMWA 1FK9B 1XMBA 3K5MA 4IG3A 1R43A 2ZH7A 3OR1B 1U1KA 1RISA 2QA4G 4DR5F 1RP5A 4C0BA 3HPOA 1NEEA 2HS0A 4HVZA 5AXNA 2HGLA 3CSKA 1JMTA 4ZCMA 3U27A 1R27B 2K8GA 2VB6A 2BOPA 4HDHA 2J7UA 2DR9A 1CEZA 3H2LA 1J2VA 5IXUA 2R8KA 3M2VB 5HBMA 4QWBA 3CD7A 2B56A 3PX4A 1S99A 3JAMY 4ED8A 3KG1A 1R0AA 1S1VA 5T7LA 2KXFA 1NJIT 2ASJA 4Q2LA 3LP1B 3MCSA 4L72B 3CC4S 3CC7S 1QUPA 3RTVA 3SCKE 4JI0F 3ZC4A 1JLAA 4C8MA 3LGNA 2JFDA 1SL0A 1U6ZA 1MMDA 3KG0A 3MM5B 4J9RA 1WG4A 1RTIB 5EX0A 2QYCA 3P5TL 3QIPB 4P7TA 3OFGA 2I8EA 2V94A 3DOKA 3NL0A 5B0FA 4KBIA 5GADI 1QTMA 3BB5A 1HBNA 2NLWA 4EEYA 2WHOA 4JV1A 5E33A 1IBLF 5EGYA 3CUNA 1RT7A 2KT5A 2EVZA 2KKHA 4Y2KA 1FTRA 4WFNQ 5B0AA 4J9SA 2IBKA 5B0EA 4DV2F 4DV7F 2JEFA 3PY8A 3HVWA 3W2VA 2JEIA 3HDSA 2AYMA 3EXYA 3HZEA 3IRXB 2LQ5A 2C2RA 1IKYB 1FDDA 1NRKA 1VMBA 1ZM9A 3M1VA 4DR6F 1FERA 3FGVA 4EFAC 5DGAA 1LK7A 3GE9A 4I2PA 4NCGA 3M9OB 3PO5A 2R7XA 4WFAQ 2DNQA 4OHWA 5M2RA 4A47A 2MQPA 1U26A 3OV7A 2AYGA 2EFQA 2IM2A 1GH8A 2I9SA 3FEYB 5BJRA 3NKYA 3CCQS 3IXQA 3IR7B 4DN0A 3J7YI 3GSDA 1GNKA 3H40A 1Y4ZB 4KV8A 3VAMA 3OTDA 2ZH1A 5FDLA 3QAEA 1SUQB 4KSEB 2L41A 4PXDA 4JUZA 2B5JA 2ZH3A 2KZZA 4WF9Q 2G0CA