2KVIA

Structure of nab3 rrm
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
PKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFGKKLILEVSSSNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and RNA-binding study of RNA-recognition motif of Nab3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords Nuclear polyadenylated RNA-binding protein 3
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kviA00
2M2BA 2M88A 5LSLA 4TLQA 1X4EA 2D9PA 2KHCA 2N7CA 4IUFA 1WF1A 2CQIA 2KYXA 2LQ5A 2RT3A 1HD0A 2FC9A 2RRAA 3UWTA 3G6ES 2GHPA 4OZ1A 3NNAA 3DLLQ 2K8GA 2YKAA 1WI8A 3G9CA 2DHSA 4TU7A 2YWKA 2DNRA 2D9OA 2KXHA 2X1BA 1H2UX 1X4GA 5ITHA 3ZZZA 1YJNS 2MZTA 1YJ9S 1WHXA 3CCSS 2MY7A 3OW2R 1VQ6S 2DITA 5LXYA 2MQQA 5DM6Q 2KN4A 2G1DA 3CMAS 3BO2A 2CQHA 2CPYA 2VODA 1O0PA 5LJ3Y 2DNMA 2MB0B 2MQOA 1A7GE 2MZ1A 3UCZP 2MKJA 3CCRS 2M7SA 1VQ5S 2EK1A 4FXVA 2DISA 1X5SA 1WG4A 2CPDA 3ULHA 3G71S 1X4DA 1VC6A 1M90T 2RVJA 2XS2A 1WEYA 2YH0A 1PO6A 2X1FA 2DGVA 2DNZA 4C4WA 2MGZB 1VBXA 2JX2A 2RQ4A 1CVJA 1WG5A 1SXLA 1HL6A 2I2YA 3BEGB 1L3KA 3CCES 2CQ0A 1PGZA 3VAFA 3US5A 5GADU 2MZRA 2EK6A 1JJHA 2MHNA 3EX7B 1F9FA 1KOHA 3CC7S 3U1LA 3VAIA 2E5JA 1X4HA 1X5TA 2DH7A 3K0JA 2OSQA 1SJRA 1UFWA 1HA1A 2CPFA 2VOOA 5LSOA 2DNLA 3ZZYA 2DNKA 2MJNA 1S79A 1A9NB 5CA5A 2LECA 2KXNB 3S8SA 2XS7A 4UY8T 4C0OC 4EGLA 2KRRA 3TP2A 3LPYA 2MKCA 4M5DB 2MZQA 2RNEA 1K73T 1IQTA 3THTA 5LJ5Y 2A3JA 4LMZA 1BY9A 2HZCA 3CPWR 4IOAQ 1UP1A 2CQ1A 2M9KA 2DGXA 5HL7Q 3PIOQ 3BO4A 2KI2A 3CCVS 1VQPS 5FJ4A 1H2VZ 1ZZNA 4QU7A 2DH9A 1VQ4S 2LMIA 1WEXA 2MKSA 3HI9A 1FO1A 2KG0A 1FXLA 1N52B 2JVRA 2LA6A 2CQ3A 1WG1A 2ZJQQ 2QA4S 3R27A 3UCUP 1VBYA 1U1KA 1M5VC 2FY1A 3BS9A 3JB9k 2DNHA 2MGZA 1WI6A 5DDRC 2AYEA 4W90B 3R1LA 3DXBA 1U1PA 2PE8A 2E5IA 2CQCA 1WHVA 2MZSA 3VAJA 2LKZA 2M4MA 4FXWA 1B7FA 5GAEU 2J76E 3CTRA 2FPHX 1WF2A 2HGMA 1UW4A 2CJKA 5D77A 2KM8C 2E5HA 3CC4S 3BO3A 1G2EA 1P27B 5GVQA 2MPUA 1U1OA 2WBRA 4CH0S 2ZJPQ 2DNPA 2ADCA 4F02A 1WWHA 4TU8A 2CQPA 1YWXA 3RW7A 3CUNA 2O3DA 2LYVA 3U1MA 2MZJA 5CXTA 2DHAA 1Q81T 2XSFA 2DO4A 1OPIA 2M52A 4IOCQ 1SJQA 1RKJA 5CYJA 4PRFA 1HD1A 2G4BA 2XS5A 3G8TA 2M70A 3NNHA 2RRBA 1U6BA 1RK8A 4WFNQ 2DIUA 2X1AA 2CQ2A 3I55S 2E5GA 2LEBA 2KXFA 4WFAQ 1X4BA 1N8RT 3PIPQ 3TYTA 2FHOB 1U1RA 2AD9A 1VBZA 5D78A 5GAGU 3L3CA 1YTYA 5IFMA 5GMKa 4OZ0A 1FNXH 3TO8A 5GAHU 4YB1P 3VAHA 2PEHA 1YITS 4RU2A 1VQKS 3CCQS 2X1GA 2RUGA 2DHGA 2YTCA 3P5TL 2KT5A 1QM9A 3SDEA 1U1NA 1H6KX 2DGWA 4WIIA 2MMYA 1WTBA 3MUMP 2YH1A 4UQTA 4ERDA 1WEZA 4C7QA 2UP1A 2G0CA 3J7ZT 2GO9A 5IQQA 1KOOA 2KH9A 3MXHP 1NU4A 2MSSA 2M0GB 2JVOA 3G4SS 5IM0A 2CQ4A 2RS8A 3CD6S 5JVGQ 2OTJS 2HGNA 2AYBA 4LIRA 2JRSA 1VQMS 1P1TA 3FEXB 2L08A 4QPTA 2B0GA 2XB2D 2RS2A 1ZH5A 3Q2TC 3CCMS 4F25A 2BZ2A 1M5PC 4F26A 1VC5A 2OSRA 2DGQA 3CF5Q 2ERRA 2RU3A 2MY8A 4BS2A 4ZKAA 1U1QA 5BJRA 3MI7X 2M8DB 3NS6A 2VOPA 5DM7Q 1R8PA 2K3KA 2CQGA 2KU7A 4WCEQ 2VONA 2CPEA 3THPA 3FEYB 3IRWP 5DDPC 4TU9A 2MSTA 1Q7YT 1Q86T 2HYIB 5DETA 1JJ2R 2MQLA 4WF9Q 3S01A 1WHWA 2F9DA 2DNGA 3UD3P 3CCJS 1Q82T 1WF0A 2DGSA 2D3OR 3NNCA 2CPJA 2L41A 2QFJA 2HVZA 3J7YU 3B4MA 1NO8A 4J5OA 4A8XA 2MQPA 4PR6A 2LXUA 2FC8A 4Y00A 1D9AA 3G96A 2DNOA 4V19X 1DBDA 1KC8T 3P3DA 3MUTP 1FJ7A 3CCUS 3Q2SC 2J0SD 1KD1T 1QVFR 1DRZA 5EN1A 2LXIA 1U2FA 2DB1A 2M8HA 4CQ1A 3SXLA 2DK2A 1JJ4A 1YJWS 3NS5A 2BOPA 3CC2S 1S72S 2OIHA 1X4FA 2MJUA 2SXLA 1X4AA 2Q79A 3HHNB 2DH8A 2V94A 2F9JA 1M5KC 2QEXS 2ADBA 1K8AT 4YUDA 3MD3A 4LJMA 3RW6A 4PKDB 2MYFA 4W92B 2LCWA 3CCLS 1U6FA 1ZZFA 2MKHA 2OJ3A 1FHTA 2N82B 1N88A 1VQLS 3EGZA 1YI2S 2DNNA 2HGLA 3VAKA 1N54B 4YOEA 3MDFA 1VQOS 3P6YC 2N3OA 4ED5A 3NMRA 3D2WA 3B4DA 1X4CA 2DNQA 2JWNA 2N3LA 2F3JA 4WFBQ 3CULA 2KVIA 2KFYA 1OIAA 2CQBA 2CPIA 2KRBA 2NZ4A 2CPXA 5HO4A 3UD4P 4CH1A 1YIJS 3H2UB 1R8HA 1DHMA 2J0QD 1M5OC 2NLWA 2U2FA 2DNYA 2CPHA 1FJCA 2MQMA 3MD1A 4CIOA 2DGUA 2MQNA 3MOJB 3VF0B 2CPZA 3VAMA 1WHYA 1X0FA 3UE2A 1K9MT 1JMTA 2DGOA 2J8AA 2XNRA 1YHQS 2AYMA 1D8ZA 3I56S 2KG1A 1SJ3P 1AUDA 3H2VE 3P49B 3R1HA 2DO0A 2L9WA 2MXYA 3MUVP 3CXCR 3VAGA 1OWXA 2OTLS 1WELA 2E44A 1DZ5A 5IM0B 3VALA 4Y0FA 3SMZA 2DHXA 3S7RA 1X5PA 3G8SA 2ZJRQ 3CMES 2MKIA 1X5OA 5LXRA 5JVHQ 1XN9A 1VQ8S 3V4MA 2I38A 5MLCV 2DIVA 1SJFA 1W2BR 1KQSR 2AYGA 1VQNS 2XNQA 2EVZA 1VQ7S 1U1MA 5H1SV 3LQVA 3S6EA 3MURP 2RQCA 1QVGR 5DDOC 1OO0B 1UAWA 4WKRA 4U67Q 3N9UC 3IWNC 1U1LA 4QU6A 1FJEB 2LEAA 3EGNA 1VQ9S 2U1AA 1SJ4P 2CQDA 5DDQC 2DGTA 1M1KT 1NJIT 4QQBA 1URNA 4IO9Q 4Z2XA 4P6QA 1H2TZ 3UCGA 1VC0A 3SDEB 2MKKA 2KM8B 2LA4A 1FT8A
chains in the Genus database with same CATH superfamily
2J8SA 1KLMB 2M2BA 4OYWA 2VOPA 1NDCA 3QPIA 4YB6A 3K7RA 1VK8A 3HK2A 2BM1A 3V6DB 3ZC4A 1W7WA 4OZ5A 2N7CA 2QL5B 3RBXA 3TUJC 2CNLB 7FD1A 3BGRA 4ZCKA 4IG0B 3RBDA 4LFAF 3KKFA 3KHHA 3MECA 1Y4ZB 2DHHA 4WTYA 3UWTA 2QT7A 4GKJJ 3TEHB 3G6ES 1QDUB 2VFVA 3IBCB 4HEA9 4OFZA 2B5JA 4OZ1A 3NNAA 1JLQA 4NOHA 4FS1A 1R3NA 3CJKA 4K0KJ 4TU7A 4BC7A 2XHWA 1Z1ZA 1FXDA 2DNRA 3GV8B 3U02A 4KSEB 5DJBA 1TL3B 3K5NA 2UU9F 2Q66A 1FD2A 2RDIA 1UPMB 4WFYA 2MZTA 4ETXA 2XQCA 3KLVA 1K44A 4EBCA 1VQ6S 3NCQA 4O44A 2NXJA 4ZIVA 2DTJA 5LXYA 3PX6A 1WJ9A 3MM7B 5KFDA 2IMWP 4RNNA 1SV5B 2WSFC 2XO7A 5C5JA 2BM0A 2V9WA 2CQHA 2C3MA 4HHUA 1JWWA 1S5ZA 1OYEA 4LFAJ 4XPCA 3UPFA 3GIJA 3KDOA 1SL0A 2FVQA 5E5NA 4ED8A 4N8NA 4KYZA 4LRFA 2K7KA 3VCDA 4NLGA 3LP2B 4RO0A 1A7GE 2MKYA 2CJYB 4PG6A 5J2NB 2MKJA 2I5JA 3DYAB 2HURA 2HQDA 2LA4A 3JQKA 1Q5VA 3PHEA 4P71A 3UVJA 2HMIB 4IR1A 2HHQA 2XTJP 3IM8A 1F0XA 3D7SB 5T41A 4GVLA 1MWYA 1X5SA 5HMXA 5K8PA 1WG4A 3H5SA 3HHLC 3MZIA 4S0MA 5DQGA 2JLGA 4IFYB 1SUQB 4RUAA 2COLA 4O3PA 3C19A 3D68A 3B8HA 1U8WA 2YH0A 1X0PA 4ILLA 4KHMA 3G86A 3TARA 3F44A 4YFUA 4F50A 2WW8A 1HNWJ 5ETQA 2YX7A 1A0OB 3P45B 5E0OA 1RT6B 1RAGB 5F8MA 4C8ZA 4DFMA 2E5LF 4U6PA 2IVMA 5JMNA 2C2EA 3NXZA 2V68A 4UOCA 4X65F 3WDOA 4QCLA 1JQGA 1PAEX 1WG5A 4NLVA 3KLEA 3OLBA 3DOKA 2LLZA 5KFQA 3EJMA 2KT2A 1REVB 3JSMA 3H90A 2ZH2A 3AD8C 3LW5C 5LMUF 1P9QC 4JBCA 2QIFA 3PY8A 4DV7J 3US5A 1URRA 5GADU 3DHXA 2WOMB 5B0FA 1F9FA 2DRAA 2EBGA 2FHJA 1KOHA 4LBIA 4ETZA 3CC7S 1S9GB 1PYSB 1SB6A 3HHDA 2BJ1A 2X7IA 2ZM6J 1NK5A 1QAJA 4IRDA 1XMOF 1DURA 2CJXB 2FHJD 2ZBPA 4NLUA 5A8WA 4J9OA 2OSQA 1KTQA 4PXDA 1S6PA 4P72A 4YY3F 2D41A 2C28A 3GG1A 3WX4A 2RUSA 4DG1B 5LSOA 1MLAA 2DNLA 3I32A 3EICA 3ZZYA 1CQNA 4URQU 2AJ4A 2YY3A 5HVHA 1LWFA 4ZVFA 3WHIA 2NSCA 2YBVA 1U4BA 1VRTB 3M8PA 2XS7A 4C0OC 2RIJA 1XQIA 5D15A 4RW9A 3LPYA 3OFGA 1Q5YA 4LF5F 4M5DB 1RTHA 2DEJA 2VG6B 4IFYA 2V34A 4LBPA 3IGNA 4EO6A 1EHWA 3CW2C 2VKZG 2Y3YA 4ANCA 1O51A 3M2UA 2OEJA 4X4NA 3D1QA 2ZD1A 2ZHAA 1UP1A 1I51B 1RT4B 2GVDB 2L9NA 3Q8UA 5HQMA 2XBPA 3AA8A 1LW0B 3IAM9 2M9KA 3TJ9A 4ANDA 1BUXA 5HL7Q 4RUHA 3BO4A 1MNEA 2KI2A 3ITHA 5D4OA 1VQPS 2GHWA 1IM6A 3PKYA 4EZ6A 3DRSA 3HSJA 4NYZA 3UDCA 1EP4A 1T95A 1YJ7A 3L4BC 3MM5B 1RGVA 4FZVA 4KE5A 2XI3A 3TW0A 1KONA 3IR5B 1NSAA 1PSDA 1N52B 1RAJA 4OX7A 1WC5A 3LP0A 1LXJA 2BACA 2FJVA 2ZJQQ 1RBAA 4CO2A 4K50A 1R0AB 3UCUP 4M5MA 2L9DA 1YQHA 4K4TA 4FBUA 1EARA 3IM9A 1VIOA 1TKTB 4G1PA 4TY9A 4ZIWA 1NB2A 1PBUA 2NUHA 1UTAA 1JLBA 3A1YG 4DI6A 4DS4A 1NKEA 5C42B 4C3MA 3I5CA 3RRKA 5DDRC 2AYEA 4UQGA 4W90B 2W4PA 1RAAB 3OXGA 3BREA 1U1PA 4EFAC 5J2MB 1RABB 4LF4F 1NSQA 2YKMB 2CQCA 4A47A 1E6VA 2MZSA 1Q79A 2Q1LA 4FPRA 2MLYA 1NJYA 2Z2LA 1RTIA 3AOBA 2LKZA 5KT6A 2ZH1A 5A2QU 2RJZA 2UUAJ 2K1RB 2RMLA 3FCWA 2FYXA 3HSDA 4X66F 1RDRA 4DFPA 2A0FB 4IH5A 1PJ7A 4LF1A 5B09A 3EXCX 4DX5A 4N47A 5EHHA 4X64J 3GYNA 2B9WA 4NLTA 2HGMA 2BXJA 3EM1A 4ZLJA 1D9FA 3MFHA 2AJFE 3RTVA 5D77A 1ACMB 2E5HA 3PACA 4DQRA 3CC4S 1G2EA 2PDAA 5HBMA 1HW9A 4BWMA 4X64F 4DFJA 4OI6A 5GVQA 1LKZA 3M2UB 2GNKA 2V4QA 5E41A 2HIYA 2AZ3A 1TV6B 4UUWA 1FKOA 4H54A 1ZAWA 4QIFA 4C3KA 4F4YA 2AKWB 1RAHB 1K73T 4C6AA 1JIHA 4XO0A 1X60A 2ILYA 3KG0A 3RW7A 2QG9B 2O3DA 1JXEA 1HPZB 3NS7B 5HMZA 3IC1A 4OV1A 3A3NB 5J1PA 3GV7B 1S0VA 1C1BB 3BF4A 3M8YA 3POTA 2EPIA 5C25B 5CXTA 1Q8KA 2AW0A 2CVIA 1VK3A 2DHAA 4KO0A 4P2MA 2FUG9 4PCQA 1DAXA 2DO4A 2M52A 4IKAA 4ZPTR 6FDRA 5E2QA 1T03A 4F2SA 2K7JA 4YHHF 1C2PA 1KP6A 2JFDA 1YRXA 5G0RA 2G4BA 1RAEB 3BN7A 5D3GA 2RRBA 4CLYA 1TR0A 4Q5VA 2EI5A 1FKPA 4ED6A 1T03B 1DY3A 2IJNA 5GMDA 4B3MJ 1NH8A 2E5GA 4IDKA 4WFAQ 3JTNA 4DV2F 3U27A 3PIPQ 1N8RT 3LP0B 3VGSA 1S4EA 2YNGA 4LFBF 2FHOB 3MPUB 3RB0A 3UDLA 1IN0A 4ED2A 4UTGA 1U1RA 1XK8A 3TNVA 2AD9A 2UVVA 4CCHA 2XLIA 1VBZA 4AD6A 5GAGU 4OJ1A 3A4TA 3D6TB 3D0HE 1FTCA 4OZ0A 2Z8QA 3HVTA 4F2RA 5F41A 5HSPA 2NREA 4HTIA 3TO8A 4DZDA 2CJAA 4FYXB 1HBMB 3UN3A 5HBMB 3VAHA 2HRTA 1YITS 2ASDA 3DXSX 5J2NA 2OELA 3ZTQA 2E1MC 4AL6A 2X1GA 2RUGA 2DHGA 3N01A 2F5GA 4FKYA 4B17A 4X62F 5KFRA 2YXLA 4ZVGA 3RUBL 1H38A 5KFGA 1DFDA 1HPZA 2UUAF 1HBMA 1VRTA 4EMDA 2KT5A 2OUGA 7AT1B 4JYAF 1YZ6A 4ZHRA 2MLXA 1YG0A 1KLMA 5L38A 2ZNZA 3RAQA 1U1NA 2R8KA 2KFZA 4O3QA 2UXBJ 2VDIA 4WIIA 2MMYA 2QLFB 5CAAA 4UQTA 3T9ZA 1NK4A 2PEBA 4LR7A 4ZLLA 3W63A 4LR8A 4ERDA 1R7IA 4URSA 1WEZA 1JLBB 1RWUA 3HXMA 3NAHA 1Y9OA 1HI0P 2VPWB 3K57A 4AFFA 2HAIA 4I2PA 4PABA 4WJBA 4FXDA 3BJYA 4AL5A 2KH9A 2CWKA 2OPPB 1NU4A 2MSSA 2WVDA 4I1TA 4CP5A 4TNOA 4USIA 3CJRA 4EZ9A 5A6WA 1SC6A 2AF6A 2YQ0A 3HHEA 3MAAB 5E3RA 3VGTA 4KPYA 3HZGA 4ZN3A 3GPAA 4IG3A 3M6UA 2R2UA 2QLWA 1UFLA 2R3VA 4C48A 3RAXA 1QAIA 3RR7A 1IR0A 1CJKA 1TP7A 4OYMA 4HHHA 1HNWF 1IBLJ 2BE9B 3CD6S 2HGNA 1L3TA 1N0VC 4LIRA 4PXEA 2AGQA 1U0HA 2XMWA 4A8FA 2D3UA 2L08A 2B4PA 4QPTA 5KFPA 4KFBA 1FKAF 3C6TA 1XMQJ 3ENQA 3Q2TC 1T3NA 5DQIA 2N4CA 1M5PC 1ZM2A 1CJTA 2ERRA 2DKOB 4BS2A 1MU2A 1G7CB 1UMJA 5H9EK 1IXKA 1S77D 1CC7A 4USHA 2GO8A 3NGKA 4QZVB 3MEKA 5FDLA 3I9V9 1UEKA 3W5ZA 3OUYB 1RQ0A 4TVAB 2KU7A 1WC0A 2VONA 4CLZA 4X4SA 4RW4B 1NZ8A 1BQNB 2AJ1A 2QX0A 4ID8A 2VB6A 5BYRA 3THPA 3RB4A 1M5SA 4Y6IA 2HVEA 2Z56B 2ZZTA 3L9ZA 4PAAA 4WF9Q 1X7VA 1JLGA 4NI2B 3KUEA 1Y5NB 3W64A 2R9LA 2HLUA 2P9GA 4I0WA 4I6AA 3M05A 3KK2A 3CCJS 1LW2B 3NP5A 1W2IA 1R27B 3QT7A 4F3QA 1WF0A 1L3SA 3SQGA 1DQ9A 1HNIA 2YPYA 1X9SA 3GIIA 3TAQA 5I3UB 1IBLF 3LA0A 3J7A1 2CPJA 4N76A 4ID5B 1S10A 1EKSA 3CEDA 3J7YU 3M8RA 2O5DA 3ILJA 2ZM6F 1GAOA 3JYTA 4A8XA 4A8SA 3SV3A 2JEFA 1JLAB 2DVIA 2ZKTA 3MOZA 1OPZA 2JH3A 4QYRA 4OHZA 3G96A 3BGUA 5DZ6A 4DR4F 1ZAXA 2HQCA 5KT2A 3MUTP 2ROEA 4ZVHA 5A8KB 5KFCA 3CCUS 4B3OB 2P6TA 4LF9J 2Y8YA 3DDIA 4MT1A 1QVFR 4B9TA 3NGTA 5EN1A 2CUYA 2LXIA 2M8HA 2LXFA 5GADI 4CQ1A 3AA9A 3SXLA 2BW7A 1EX8A 2DK2A 3K58A 4ECRA 3MM9A 4ECWA 1YJWS 2J9EA 3CIZA 4ELVA 2HHWA 4QWAA 3CCWA 3UFCX 4WXWA 1S72S 1Q16B 4CWBA 2NXCA 1X4AA 4YR0A 2Q79A 1N5YA 1Q0NA 5DG7A 3CJ3A 3O3LA 2V94A 1UJ6A 1VQYA 2FJEB 2RE1A 3GCWP 3UVJB 4TKTA 4AXJA 3H8YA 3S1TA 5KG6A 4TY8B 2QEXS 3A8KA 3LF0A 4IQXA 4L3KA 3VVTA 3MR5A 3Q8RB 2H1YA 5ETRA 4K4ZA 1HQEA 1IJEB 4NE9C 5T7LB 2PA3A 3CNQP 2J0XA 4UUXA 3UQSA 3W66A 2HQGA 4E8UA 1FJGF 1AZSB 1JXLA 4LJMA 1HYSA 1DLOA 2R2TA 1GMWA 2BRLA 4QWBA 3GJQB 2OJ3A 1FRIA 1I5OB 1YBUA 2Z57B 2C3PA 4USJC 4MK7A 3WBZA 3ILOA 4DHVA 3I6PA 4PQAA 2XMKA 1VJQA 5JJBA 1VHIA 3KHLA 4PG8A 3KDNA 4YP3A 4F36A 1R0CB 1ZA1B 4JV1A 3TVKA 1UVNA 1HI8A 4R8UA 4USWA 1MWQA 4Y65A 4DV0F 3EVOA 3P6YC 3E8OA 2HNDB 3IMQJ 4OI2A 3VTIA 2ABYA 2QLBB 1EAYC 2I9SA 2WCXA 3WIUA 4DF4A 2CZVC 2DNQA 4IG3B 4RW7B 1R6VA 4K8RA 3IRXB 1XNRJ 4CYUB 1HQUA 2KRBA 4QYZK 3GP9A 5HO4A 3OD2A 2OD6A 4PG7A 4DOZA 3UD4P 3QGGA 4KBIA 1HWLA 3P4UB 2E5LJ 4NA3A 3SQOP 1R8HA 5F8NA 1TU0B 1FRHA 1Y3KA 3C14A 4LRCA 3C6UA 4MYUA 1M5OC 4M8LA 2DNYA 2CPHA 3BKTA 4K2XA 3EZ5A 4B9MA 2LFVA 2MQMA 4X4VA 4NLRA 5EUHA 4JI1F 1IWGA 3KJFB 1KEKA 1KVJA 1RTZA 3LTOA 3EZUA 2VZ9A 3B78A 3RAMA 2C3OA 5DG9A 2R8JA 1R8BA 1X0FA 3T5KA 2DGOA 2FB0A 4H4MA 1LWCA 2AJQA 1IBMF 2VFSA 4K4XA 3MM6B 1D8ZA 2HIQA 4C8NA 4JI4F 2H5JB 3OFHA 1AUDA 1YBAA 3ILIA 3H2VE 3NG8A 3VZIA 4N8OA 4WBFA 3D1HA 4XTTA 1PCAA 3TX0A 4UT4A 3R1HA 1W26A 3PDNA 3NMAA 4I67A 3V81A 2MXYA 1RCXB 4KH1B 5FD1A 2OTLS 1SC1B 4FNIA 4TXSA 4DV6J 4JI4J 2ACMA 3KHRA 3VALA 5IT0A 4O0IA 2BJDA 4E0DA 3I0SA 4DSJA 4X2BA 4ED0A 4FYYB 3TUZC 2R7OA 1DTTA 2ZDOA 4EYHB 3D6FB 1FRMA 4ILMA 2IM0A 5KG0A 5CD4H 2GJFA 4OI0A 5LXRA 5B0AA 3V4MA 3R5GA 4C97A 4L3NA 2KO1A 3KK3A 1CJUA 4DCOB 1WOSA 4PUOB 4GKKJ 3M2RA 2AYGA 1R0AA 4I56A 1GX5A 4KY3A 2VJVA 4ZK7M 2B51A 2FJAB 1TKTA 4TQSA 2E7WA 3GJTB 4C9DA 1FEHA 2EEYA 3LQVA 2FVPA 3MEEB 3Q8YA 3ZZOA 4HYKA 3S6EA 1RA7A 1QVGR 5D0HA 2I0XA 1M1HA 5DDOC 3VGUA 4F67A 4JYAJ 2HWTA 2NPIA 1B70B 1FRXA 4ATNA 1HMVA 2HNDA 3EGNA 3QIPA 4ER8A 1VQ9S 3E01A 3N28A 4LQ9A 3CJ4A 2CQDA 1SJ4P 3AJ1A 4RW6A 3ZZ0A 1RBLA 2WW4A 3HPOA 1J5EF 1URNA 4IO9Q 2PMZD 1HFEL 1SH0A 3DOKB 2YNIA 1AW0A 1FFWB 2EFQA 2IRXA 3NWRA 4RPFA 3NKYA 3KUGA 2ZE2A 4WFZA 3TA0A 2W01A 4Q44A 1VC0A 3SDEB 4AUKA 3OPKA 1HIYA 1TFWA 3PRVA 2P2CB 5HN0A 1T05A 1MW7A 5A8RB 3L7PA 5L1IA 2BJ3A 1IBKF 5HMYA 3KK1A 2M88A 1WDTA 1J27A 2FLLA 5LSLA 3OL7A 3V5RA 4TLQA 1RYSA 1FE0A 1HQ2A 3EXYA 4FN5A 3RGIA 2H65B 2ZFHA 3M8QA 3M9OB 2RSQA 1AB8A 2CQIA 1SC3B 2I1RA 2LQ5A 3C6TB 3LP2A 4Q45A 2RT3A 5A8WB 4GO7X 4DLGA 1HD0A 2FC9A 2RD5C 2H5EA 2I5JB 2HWIA 2H5IB 3CMQA 3DYAA 4KGXB 3DLKB 4OLOA 4WXOA 3R5AA 2C1EB 5D0GA 4A48A 2A6OA 2HLTA 1BGXT 3FNNA 4YR2A 2J7WA 3TZXA 5J2MA 3T1YJ 3A3PB 2CXEA 3QSYB 3DLLQ 4P2XA 1S1XB 1OY8A 4KC5A 4QW8A 4D3HA 1IKWA 2YKAA 3GFXA 1WI8A 2GVZB 1JLEB 2DHSA 2QSWA 4YHHJ 2YKNB 3MEEA 2KXHA 3DRYA 3D6MB 1X4GA 2Q3PA 4OIXA 5ITHA 4K4YA 1ZTTA 4I2PB 3MF5A 4LFCF 1GEHA 4ZP8A 2OPPA 3HMJG 3R6GB 3BH7B 3I82A 1M5HA 3FJ2A 1RP5A 2A6MA 2GQQA 3DGPA 3LAKA 3P8BB 4FNHA 2FD2A 3TVYA 3UN5A 1JLQB 3WZ0A 4AXIA 2G1DA 3CMAS 5L1KA 3CJKB 1AA1B 2IM1A 5KG7A 2VODA 4CO0A 4DQPA 5LJ3Y 4JB8B 3VHQA 3VGVA 4I2QA 4LIWA 2UV8A 3OXFA 4MTPA 2MB0B 1AFJA 1M0SA 4NEZA 4Y2KA 2ZOMA 5BXIA 2OGUA 3CCRS 4NCBA 1NMEB 1DTQB 2W2QP 2ASJA 4OX9J 4LSLB 5HQ8A 1S49A 3K5MA 3VQSA 4K4WA 2WK4A 4LBHA 3HJFA 2E7XA 4KJIA 3R7NB 1UVJA 4WU2A 5DLGA 1VC6A 2RVJA 2XS2A 3D3BJ 3G87A 4K4SA 1EIYB 3AD7C 2X1FA 4KHPJ 3PTWA 4NA2A 5ADZA 2E7VA 4W98A 2Y0BB 2DNZA 5I42B 2V4RA 2MGZB 1VBXA 3MPWA 4J9QA 1XTZA 1TV6A 2JX2A 2RQ4A 2YNIB 2WAQD 1JB0C 3ET6A 1TMJA 3Q22A 1T9TA 2CJQA 1HL6A 5F8IA 2IJRA 3BEGB 2XZTB 1BLUA 1O5JA 3LWLA 1U47A 1VBKA 1U09A 1IKWB 3BZQA 1FK9A 5B0BA 3GSDA 3CCES 4PWDA 4DUZF 4G65A 1MG7A 2AEFA 2P6SA 2E9TA 1RISA 2EK6A 4CNZA 1EP4B 3ISND 3FRYA 3MM5A 3QQCD 3EX7B 3VWSA 2PFDA 3OHAA 5KFZA 3ZZTA 2QN6B 4LSNB 3VAIA 4DV0J 5DRKA 3SSQA 1X4HA 3UO0A 1HR0J 4JI8J 2IRYA 2XWXA 3K0JA 1SJRA 5A0YA 2Y9HA 4U7CA 3ZTPA 2Z2MA 4MMOA 2CYYA 5EX0A 2RH3A 4M5GA 4OI1A 3KFWX 3KTQA 5JXSA 1S79A 4JI7F 5SUHA 1G1XA 4LF7J 1N34J 1WKJA 1O6XA 5T14A 2ZWPA 4FYVB 4M1KA 5AXMA 4EYIB 2HHSA 1S1WA 4NMXA 4X4QA 2KRRA 4EBEA 3H0PA 2DY9A 2MKCA 2MZQA 2RNEA 4RJVA 3OR1A 2OPSB 3THTA 4JI6J 1BY9A 1E6YB 1G3OA 4X65J 2VG5B 3F41A 4K0KF 3KWMA 1AYEA 1Q78A 4LF2A 4RW6B 4FVCA 4BC9A 4H4OA 3JB9k 2LQ8A 2CQ1A 3DRSB 3UN2A 4DPXA 4F04B 3D4JA 2DGXA 4HR2A 4WE1B 3V6HA 1OY9A 2XLKA 5KFNA 1OQ3A 2FLPA 1VHFA 4QU7A 2OPSA 2DH9A 4RWXA 1FNOA 2QYCA 3IBWA 2AHOB 4M5DA 4E98A 3PW5A 1JNZB 2PMWA 1KN6A 1RWOB 1CULB 2HBZB 3EMTA 2YNFA 1FO1A 4PYDA 3H5YA 1XMBA 4MKYA 3MR6A 1ULRA 1RT1A 2B8PA 2QA4S 3R27A 3H98A 4MH8A 2M5YA 1R31A 1M5VC 1FKPB 3JTPA 3HKZD 2ZOFA 1Q53A 3IS9B 2YQ3A 4JOUA 2QE5A 3BS9A 2MHEA 4KB7A 2WTFA 2FY1A 2BBEA 2R4FA 2MGZA 2W7PA 1UVMA 4PQUB 3ZZUA 1WNEA 4IR9A 4BCAA 4C8YA 2UVRA 1Q8BA 2JSXA 2XMJA 3WC0A 4LREA 4IRCA 1B0PA 1RUSA 1WHVA 2G2ZA 3I0SB 4OZ3A 2EFVA 2B6AB 2KTQA 2MQ8A 3IRXA 1DTTB 2LQBA 3FMWA 4NYOA 1N5VA 2IBOA 1BWEA 1GXTA 3TEGA 4JI2F 2FZKB 3KJQB 4OLPA 4OHYA 4DPUA 3ENVA 1XR7A 2VPZB 3D28A 3SBMA 1XNQF 1RHJB 2BANB 4M63A 1QTNB 1N4LA 4YDXA 4OZLA 3DC2A 2KYZA 2W4CA 2ZH7A 2ROPA 2KM8C 4A8YA 3CCZA 1N56A 2QGFB 4QWCA 2VPYB 4H4MB 1IKXB 1P27B 3IG1B 4L74A 2BVZA 1U1OA 1SIWB 2WBRA 5E3PA 3MM6A 2ADCA 2DNPA 1WWHA 4F4KA 2WZ1A 1SQFA 1LWCB 4TU8A 2ACYA 2YNGB 3A8EA 1YDLA 4FP9A 4ZCLA 4EU0A 4ZHRB 3TAPA 5I3QA 2UUBF 1YWXA 1OYDA 4U95A 2KZMA 5LT5A 4WTOB 2C2KB 4DG1A 2RF2B 3ZZPA 1UWBA 1SKUB 3W5XA 5KOWA 1BQXA 2MZJA 4PPZA 2FJXA 1C0UB 1RT5A 3N6MA 2KL8A 4P10A 1OPIA 3ENWA 3K89A 3BR8A 4IOCQ 1SJQA 4FVMA 5CYJA 3C16A 1LWEB 3MTJA 3ZNUA 3G82B 3R5DA 3W9IA 4QWEA 1NRKA 1GXUA 2R2RA 2HZVA 4JI3J 2QRRA 4W4MA 3OTEA 5MAOA 1WSVA 2M70A 5KFUA 1XC9A 3IXQA 3NNHA 2ATLA 2KFNA 2CJBA 2GFFA 4DDFA 1XERA 2UXDJ 4WFNQ 3FZBA 1UJ4A 1NDPA 2X1AA 2VQFJ 2CQ2A 1JKHB 4KGZB 4NXMF 2HFVA 1PYOB 5J2QB 4MKAA 4YMEA 1X4BA 2VL1A 4WK1A 3JYTB 3TYTA 3SCIE 1K47A 1YRTA 2IYGA 3CD5A 5CYMA 5CZVA 2LDYA 2N7YA 1RAFB 4ECTA 4DSKA 3OL8A 3M32B 2PI5A 5KFFA 5HROB 4OYIA 2B4UA 1F60B 3HF5A 3NOCA 4WFXA 3L3CA 1S0NA 3W3SA 5F9NA 5IV4A 4F4AA 5IFMA 5K8MA 1YTYA 1FNXH 2FZGB 5T7LA 3RG6A 1CJVB 1KFDA 5GAHU 1SH3A 2CZ4A 3A8IA 5AE2A 3PW7A 1ZETA 2JOQA 2DY1A 2YX1A 2KHDA 3CJ5A 4CLUA 4RU2A 2PI4A 4DR3J 1VQKS 5D8HB 3IR6B 4LF6F 3CCQS 1F5CA 2EWHA 2Z58B 4FDFA 4B3SJ 3I31A 2HSEB 4KT0C 2FJWA 2J7UA 1FE4A 3AXKA 3OFEA 2ZHOA 4ZP9A 3DLHA 4H4KC 1KBRA 1RTHB 1T05B 4DSLA 3CJQA 4DN0A 1SI9A 1QM9A 1HNZF 3SDEA 2DR8A 4ECZA 1TKDA 2BKNA 4PG5A 5K9FA 3D9BA 3GWCA 2YH1A 3UNYA 1WTBA 2H4WB 3MGJA 4I4BA 3IP0A 1FFGB 1V3RA 2WVEA 1P8GA 3IG1A 4J9KA 4DCJB 2VFUA 3DDNA 4C7QA 3R9LA 2HS4A 1HBOA 2AV5A 2DR5A 1S57A 4A46A 2GO9A 5LMUJ 3NBPB 5B0EA 3MTKA 4PG4A 2VKRA 1TELA 2YKQA 3MCNA 3TX8A 3N4WA 1RB0A 1CLFA 4J9MA 3GB0A 1X9WA 5RUBA 3LP1B 1F9HA 2IA0A 2RHSB 1JLFB 5EX3A 3OL6A 4ZP7A 4RLEA 5IM0A 1IJFB 1YJVA 4Y2IA 3C3LA 1S1XA 1FRJA 4QR1A 1OS5A 4DUYJ 3TANA 2ASLA 2JEJA 1PG5B 2OFGX 3CVKA 6FD1A 5CQGA 4JI0J 4B9VA 2WVBA 4GKJF 1HNVB 1HWUA 3T1HF 1HARA 3OTBA 4N7TA 3IR7B 3D6HB 2XB2D 1GX6A 1MN9A 2RS2A 2ZEJA 1U24A 4K7QA 4B08A 2GW8A 1WOPA 4FF3A 3CCMS 2XCPA 2BEFA 3NMRA 5IS2A 3V6DA 1EB0A 2BJEA 2DGQA 3H20A 5I3PA 5B0DA 2RU3A 3CF5Q 2OPQA 4KGKA 2MY8A 2HRYA 2YNHB 3EZOA 2M8DB 3NOGA 1IUJA 1R8PA 3M1VA 3DOLA 2CQGA 3DLGA 4O4RA 2EFPA 4WCEQ 2CA9A 4M5IA 1ICEB 3FEYB 3IRWP 4QYZJ 1N32J 5KFSA 4TU9A 4F8RA 2MSTA 1AUSL 2QO3A 4ZN1A 1YI2S 4GO5X 3CD7A 2NXEA 5DETA 5L9NA 2BJ8A 2QFIA 1LW0A 3H5UA 4ZPAA 2D3O1 1WHWA 3PHTA 2F9DA 1RWMB 3B82A 2UXCF 3HX9A 3IWLA 2FVSA 2W7AA 1AROP 4NPOA 5CD4A 3OL9A 1N5SA 1LNQA 2XG8A 1RI7A 3DGVA 4JI6F 4Z7CA 5K8NA 3OJUA 5EDWA 4WPAA 1SV5A 2DGSA 3HO1A 2D3OR 2EW9A 4B3RF 4C8LA 1FDNA 4Y2MA 1Q8IA 3QZ7A 2QFJA 2HQFA 4IRKA 1HLWA 2HVZA 4NA1A 4DBQA 2CDQA 2E29A 4J5OA 2BJ9A 4CTAB 3GSIA 1RYRA 2KJVA 2V69A 4ED3A 2VBXA 2V67A 1PKUA 4Y00A 3D3CJ 1D9AA 4DPWA 3ZTSA 4V19X 5SZTA 4UY85 2NYHA 3UR3C 4CLTA 1J2VA 3C6UB 3MR2A 1ZS6A 5CHCB 1FFSB 1FRKA 1FTRA 3GG0A 2R8IA 4B3MF 2J0SD 3N5FA 4PZVA 1DRZA 1SUQA 3HVAA 4CO5A 1NUEA 2CJ9A 5HI7A 2PFFB 4HI1A 1N33F 1JJ4A 3MMBB 1NM2A 3GR0A 2CVEA 1GK8A 2JHEA 2F8EX 3CJ2A 4TLRA 3CB4A 1GMVA 2JLEA 4I6WA 5H9FJ 5C2CA 1UA1A 4JUZA 1J5OA 2GJIA 2G1HA 3H7HB 2F9JA 2VASA 2ZITA 4DV5F 1VIXA 4ICLB 5CYQA 1SKSA 4B3TF 1T9VA 2ADBA 2YX4A 5KG1A 2W9BB 4K59A 3NY0A 4NCGA 4FYDA 4ZDNA 1KS2A 4ECVA 4KHPF 4ZPDA 1KRPA 2LCWA 3CCLS 4DZ6A 4DV4F 1QJHA 1FHTA 4KFBB 2N82B 3D66A 3EGZA 4G1QA 1PJ5A 2YKNA 3VAKA 2BANA 4RBVA 2DEIA 3EVWA 4J9LA 1VQSA 4LRAA 1HMVB 1U8SA 2V6AA 4OZJA 5HQLA 4YOEA 3R6LB 4HDGA 2FJBB 1VQOS 3ZZRA 1F1BB 2E9RX 1XMOJ 4ED5A 3IFEA 1D9DA 4DQIA 1HQUB 5M2PA 2FQQB 1IKYB 1WD6A 2B7CB 2QL7B 2V2QA 1WOOA 4HT7A 1TK5A 4QIGA 3QAEA 2KVIA 2KFYA 4RUBA 2AIRB 3BGRB 3D67A 3R5CA 2UU9J 1SL2A 5CZXA 2F1FA 4R25A 1YIJS 1KFSA 2VC1A 5LSRA 2BE2B 3PJXA 4QPXA 4DFKA 1U6ZA 4FPIA 1D8YA 1G6BA 1T7PA 2QTWA 1DHMA 2IJFA 3O6QA 2J0QD 1REVA 4NLQA 3VZHA 1NEEA 1ZBTA 2NLWA 2YWWA 2B8QA 1CJUB 4UF4A 3SCKE 1AXQA 1LV5A 1FX4A 4NZ7A 2YPZA 1F6TA 4GC6A 2IIHA 2GQCA 2MQNA 4J9RA 2Q43A 1RBOB 5EWGA 2HPUA 3KMSA 1KVIA 3VAMA 2YNHA 1WHYA 3DN9A 1NXIA 3KUHA 4HLBA 1SQGA 4CO1A 1N48A 2W25A 2J8AA 2XNRA 1YJRA 1D09B 3PNIA 1YZ7A 4MKVA 3R7BB 5HVGA 2GV1A 3TUPA 1YK9A 2GMHA 3OXLA 3FFIB 3P49B 1QD1A 5LM7E 3GIRA 1NKCA 2ZH8A 1Y00A 3HD1A 2HHTA 3LALA 5DLFA 1PC5A 4A8OA 3H40A 1OWXA 3AXMA 3CJ8A 3QIPB 4RR5A 1RKJA 4DR7J 1DZ5A 4P75A 2ZBRA 3KMQA 4E2FB 1GMWD 4Y0FA 4OX6A 2DHXA 2G2OA 2M3DA 4LF8J 1KNZA 4PQUA 3S7RA 4RW4A 5ETOA 3D1OA 5FLXU 4C98A 2R7UA 1HNXJ 2MKIA 1X5OA 3GFYA 3KLHB 2YKMA 5LMNJ 4CO3A 4YR3A 3ICLA 5CH7B 1V3SA 4PUOA 5JVHQ 4Q8FA 1RT3B 1S4FA 1R89A 2V8HA 2DPIA 3M2VA 4ELTA 2J9DE 4NRTA 3TR5A 4ZLNA 1SJFA 1FRLA 3KHGA 1KQSR 5AE1A 3IWXA 4LRBA 2XCAA 4BDPA 5B7WA 5AXNA 4B9LA 1RWNB 4CLFA 3OLAA 1YJNS 2HBRB 5DZ7A 2PSZA 5ETVA 1F9EB 4OV6A 4DR2F 4AT1B 3G6YA 5E7OB 2G2YA 3MAQA 1DJ0A 2DR7A 5D0RA 3RYLA 4YB7A 1UAWA 3QNWB 3N9UC 2B9YA 1CJKB 1RWVB 3IWNC 1TMMA 3Q0AA 2BQRA 3V6KA 1U25A 2HS3A 3T41A 4AYBD 4KGVB 5DS7A 4ZJLA 2CDRB 1C1BA 1M1KT 2UVUA 4OYOA 3E3XA 4DSEA 4QQBA 5GAEI 4L72B 2B43A 4WP3A 4H4OB 4RX6A 1I1GA 1P9YA 3ZFVA 4GC7A 2OPRB 4ZA1A 2ZC3A 2DRDA 3I4PA 2GQ2A 3EGWB 3TOQA 3BGFA 3PV8A 2W2NP 5A6PA 5J1EA 2W9BA 2UV8G 2CRLA 3UCGA 3JQMA 4P2FA 2ZDPA 4RNMA 3NGRA 4QW9A 1TL7B 5L46A 2DR6A 2ZOGA 1IKXA 1FDDA 2KM8B 2W9CB 5JUMA 2VQEF 3GV5B 4DF8A 1I6JA 1FT8A 1RKIA 4BHQA 4DV1J 1DARA 2V2KA 3BBCA 3DM2B 2EC2A 2HFUA 1SKWA 1X4EA 2D9PA 4R0EA 2IM2A 2KHCA 2ZNYA 1GFWB 4DPOA 3FK4A 1AFIA 3BR9A 4L75A 2ZH3A 4MKBA 4O0NA 3KLGB 3K5PA 4WYWA 1F3FA 3E51A 3JS9A 3J81U 4NASA 3HFVA 4ZJQA 2UUTA 2BUNA 1T94A 2HZAA 3MR3A 2GHPA 4LVNP 2V2VA 4DR1J 4FF4A 1FF2A 4PWDB 3G82A 4CM2A 2DXEA 1BQMB 4ZVSB 1F5AA 2W2PP 1TVRB 1QUPA 2K8GA 1YBTA 3BB5A 5IQ6A 2VICA 3G9CA 2R2SA 2YWKA 2D9OA 2X1BA 3FZ2A 2AEMA 3POTB 1S9EA 3MMJA 4EUVA 1U45A 3ZZZA 4DR1F 1NBEB 5IC6B 4ECSA 1WHXA 1YJ9S 3RR8A 4RL1A 3QSIA 3G6XA 3OW2R 4LF8F 1B99A 1HHTP 1KQGB 2QJ3A 1TVRA 3BV8A 2MQQA 5KT3A 3R2DJ 4OL8A 3MPVA 1X31C 3BO2A 4DL2A 1RLCL 3CT9A 3PRBA 4RKUC 5ETKA 1IWAA 4WKYA 1P6TA 1TUGB 3BKFA 1O0PA 1D0EA 3N0VA 3DLBA 5AJ3F 4RWWA 2DNMA 3J81Y 2W4DA 1V5VA 3IBFB 5LL6d 3GR1A 3T19A 2UUBJ 4CRJA 2EKYA 3QO9B 4ES2A 4ECYA 4ELUA 1WTFA 4TYAA 2EK1A 1F2GA 2DISA 1C0TA 3R3TA 1LFPA 2R42A 4ILRA 1MROA 3K59A 1SJ1A 1C4CA 3G2XA 1S1TA 2CPDA 3J81j 2KJWA 2J0WA 2XSJA 3D0GE 1TL4A 4RNOA 3G71S 3DM2A 1QTMA 2LU2A 3BYPA 3HVRA 3MFIA 1FJGJ 3HD2A 2DGVA 3HKWA 4DL0C 3KLFB 2FTRA 2OPRA 2RB7A 4DL5A 5DQHA 4LF7F 2ALYB 3OHBA 1CVJA 4X4PA 3KG4A 3OQ2A 1SXLA 2OFHX 2Y1RI 2V8VA 3H2LA 4DR6J 2XM3A 3MMCB 3PW4A 1JKHA 2HS0A 3R5JB 3T6JA 4LFBJ 1FWPA 3MM8A 4KKOA 4R5PB 4Q7AA 4FYWB 1S9GA 2HKEA 2GCFA 3DRXA 4KRWA 4PXCA 2CQ0A 4ZPVR 1NPKA 2DCLA 2V9KA 1PGZA 4CLSA 2PMHA 2EFGA 5DGBA 3V6JA 2HK3A 4DV3F 2NQPA 4KV8A 1HNIB 2HHHJ 2LDIA 1CS4A 1EZZB 2B56A 1Z2LA 3BPDA 3OTOJ 3NLCA 4DV7F 3TJ8A 3U1LA 3MM8B 4KKOB 5LOQA 2VDHA 3MWBA 4R5PA 4DQQA 2DR9A 4ZVRB 2F4FA 1Y0HA 1JXVA 2DRBA 5AXLA 1HA1A 2CPFA 2VOOA 2YKPA 4Q8EA 4EWTA 1O8BA 1MWZA 2DNKA 2VG6A 1A9NB 2ZVIA 2R8HA 1UWBB 3HJVA 1ZM4A 4F0KA 1TK0A 1TL7A 2KXNB 3GU0A 1TUWA 1RJJA 5DO2A 1DLOB 4EGLA 1WC1A 1TAQA 3CDEA 3PYGA 4NLOA 3TP2A 4PEOA 1VYAA 4O3OA 1RXOB 1S1VB 1WC4A 4WU3A 1S1TB 1K1SA 5L8RC 3C66A 2A3JA 2B4OA 2RKIA 3IO1A 4ZLPA 2HZCA 5KFOA 1RADB 2W8LA 2K2PA 3GYXB 4WYLA 3ZXWA 4Y28C 3BSNA 2BYCA 2FLNA 4IOAQ 4C0BA 1Z2ZA 4QR0A 2XY7A 8RUCA 1EQ0A 1OJ4A 2QSFA 2FVCA 1U0HB 2AJ0A 4CM0A 4OYXA 1N5YB 5IT9U 1SVDA 2BW2A 2VBWA 1S48A 3QWPA 4JI5F 5FJ4A 2K1RA 1H2VZ 3LAMA 3BPSP 3L7OA 4RBUA 4JV5F 2LMIA 2A10A 2Z2YB 3IA0A 1EETB 2MKSA 4X66J 1RTDA 2GS8A 5E3AA 1M1GA 1B0VA 2KG0A 1KLNA 1JLFA 2JVRA 2LA6A 2CQ3A 1WG1A 3DLEB 1S99A 1U02A 2OI2A 4IYQA 4ZP6A 4K4VA 4GVBB 1K0TA 1QLNA 1ZYQA 2EBEA 1HBNA 4ZVUB 3OTOF 3M8PB 1HBUA 4J7CA 5AJ3J 1JLCA 3SEOA 3M4XA 2APOA 5K5MA 1ITPA 1RAIB 2OMLA 1RHKB 3B54A 3PYDA 2XULA 3DMJA 4BWJA 3H25A 2JFKA 5DGAA 1UVIA 3TZWA 1R6YA 5HP1A 4QWDA 3R1LA 3DXBA 4MIWA 2EFOA 2PE8A 4DQSA 4MFBB 2HMIA 4Q2LA 4JI3F 3VAJA 1LWEA 3Q8VA 4TN2A 3QRQA 2KKHA 4OZ2A 3AQOA 3H5XA 4HH0A 2ZBIA 2QLXA 3K5LA 1Q7LB 2M4MA 1B64A 1ZOTA 3I0RB 5C24B 3V81B 4IH6A 5D0EA 3QZ8A 1NNDA 3LWMA 1QE1A 2J76E 3NCRA 3CTRA 3BSOA 3SI8A 4HKQA 1WF2A 1YVFA 2QC3A 3DRPB 3C15B 1V9OA 1UW4A 2CJKA 4C8KA 3HSZA 4DCPB 4G1IA 3CO0P 5D6GA 4DL6A 3BO3A 5FLXY 1U26A 3JQJA 2MPUA 2LEPA 2GIRA 4U7UD 3KLEB 3T5JA 4F7VA 4CH0S 2VG7A 2ZJPQ 4USUA 4B3TJ 4F02A 2JEIA 1NHKL 3SSRA 3RB3A 3EYZA 5AE3A 2OPQB 1T02A 2DXFA 1SC4B 3CUNA 1OY6A 4OYPA 2IM3A 3NEKA 2IVYA 5C2GA 5L39A 1F5BA 2LYVA 2WBMA 1TL3A 1WC6A 1NJWA 1K1QA 5HATA 4C2MA 5GAHI 3Q23A 2HNZA 2MLZA 4HH1A 2WB4A 2L3MA 2XSFA 4OYBA 3NGUA 4NLPA 3TAMA 3PX4A 3SCJE 2KB2A 2G13A 3D0IE 4L73A 4YS2A 4YY3J 3AY0A 5KFJA 4DWIA 5THWA 4I2QB 1BD6A 2PO4A 1FWKA 1TFYA 3LOUA 3G8TA 3O2IA 2IYIA 3MPYA 2WB1D 1Q1KA 2A1BA 3KYLA 4ZOSA 4AQYJ 1U6BA 3DMJB 1RLDA 4X4UA 1N6QB 3PO5A 3FBEA 1IBCB 2MTLA 2V4JB 2C2NA 3HHLB 3DOMB 5KT7A 3I55S 4JV5J 4QJVA 2KXFA 4B02A 3HFZB 1FDBA 2Y0SD 2ZWOA 1NHVA 2XZDB 4KIAA 4ZCMA 4Q43A 3OVSA 4CTAA 3H4DA 4U9RA 4X4OA 1CULA 4DL3A 3M9NB 4M95A 4P73A 3HZEA 3Q8PB 1NDKA 2RU9A 2B5JB 2F8MA 4H4KA 2HFSA 3J7Z5 2F8HA 1KHVA 2C3YA 4M5JA 4F3MA 1FD8A 4NCGB 1LOUA 4QIVA 1CC8A 8ATCB 4YB1P 3T5HA 4X62J 1FEEA 4M5HA 1EJ7L 1N32F 3LGHA 2O67A 1H72C 4I7FB 4OI3A 2ZUAA 3FFIA 4IG0A 2XLJA 1UA0A 4X84A 4FBTA 1T9XA 3MM9B 2GIQA 2X3DA 5C24A 2YTCA 1RU2A 3EVMA 3ISNC 2RILA 3QYYA 2HRUA 3P5TL 2KT3A 4HI2A 4IH7A 4KAIA 1U48A 4L6V3 4M5KA 2W9CA 4JV2A 2ZE2B 5KFXA 4ED7A 4RU9A 2DGWA 5H9FK 3MUMP 2YVSA 5HLFA 2BQ3A 1HWKA 4P2SA 2J5AA 4OHWA 3CDBA 3ZTOA 1HBUB 4DX6A 2G0CA 5F0UA 4LVOP 1S7HA 4NLDA 1SKRA 1S6PB 1YX2A 3KXDA 3OFFA 1RT3A 1FVQA 2WRMA 1KOOA 3FC9A 3PJWA 4O44B 5E33A 4NMLA 1NPRA 5IQQA 2DPJA 3MXHP 2R7TA 2YNFB 4ALZA 4DR6F 1IR1A 2DT9A 1S6QA 2M0GB 2V4JA 4RW8A 3PX0A 4RNFA 1H0HB 1BQMA 3G4SS 4K2JA 5KFLA 2G0IA 2RAQA 3CDWA 2NZCA 2IC3B 4ES3A 2CKWA 4PYAA 5L1LA 4F4XA 4LF4J 2HEKA 2UXCJ 4HDHA 3UD5A 4F0HA 1PC4A 2VA2A 1FCAA 3LPEA 1CBKA 1JK9B 3MAAA 1S6QB 2JRSA 3R5BA 3BBBA 4RBTA 3A8JA 4NLWA 2ZHBA 2B0GA 1RT4A 2GVDA 3NGDA 1XR6A 2HNYB 4F25A 2BZ2A 3M2RB 3PVXA 2HQIA 3R8YA 3FSIA 2VU5A 1CPZA 2CNKB 1D3WA 1S9FA 4WZMA 3QJLA 3MI7X 3MMAB 3NS6A 3OR2A 3JAMY 1Z4UA 3M30B 1VI7A 4PWWA 1VFJA 3I96A 3DDKA 3AJDA 5J1EB 3CJ0A 2K3KA 3ETOA 3SYZA 3TI0A 5DM7Q 4JI2J 3TA2A 1JJCB 2OEKA 2R7VA 4DR3F 4C3LA 1MROB 1ZM9A 3VQTA 1NK6A 3DRRA 3C15A 3AH6A 3S01A 3K2YA 1VLYA 4NLSA 1NPPA 1QY7A 4EBDA 4DV5J 1Q82T 2OP5A 3T1HJ 3UI3A 5J2PA 3HT0A 3F73A 1CJVA 2A18A 3NNCA 3AHPA 4CT8A 4DUYF 3G8QA 3DI6A 2WONB 2H54B 5FIIA 5AXKA 2FHKA 3B4MA 1NCLA 4QBUA 2MQPA 4DR4J 4G3IA 4PR6A 4MK8A 1RHRB 1N5TA 2LXUA 2QMXA 9ATCB 2C3UA 1N0UA 1RAOA 2JZ5A 4OX8A 5IWAJ 2W1BA 3G6VA 4FS2A 2ZBCA 3DHWC 1KC8T 5HLFB 2QA1A 3C8YA 2B3TB 3P3DA 2V8GA 1RE1B 5F8HA 2W8KA 3CJTA 4F4ZA 3Q2SC 2FDNA 3PW2A 1F2HA 1KD1T 2RQKA 3JSRA 1U2RA 3BH6B 1CS4B 1SIZA 1U2FA 1KKHA 4DMZA 2VQEJ 3VV2B 2DXDA 2QMUB 1NB7A 1GMUA 1RT5B 1J5OB 4DSIA 4I7FA 3RB6A 2AGOA 4WKRA 3Q8QB 3H4BA 2MJUA 4B3RJ 2NCKL 3BM7A 5HMWA 5F9LA 3V4IA 2DH8A 2XEXA 1RT7A 4Y2AA 1Y3JA 2IAJA 5ETPA 3UDEA 1M5KC 3AJ2A 3WIVA 4O4GB 3KOAA 3K8VA 4J9PA 1IQTA 1TQLA 2FVRA 4RNHA 1NK9A 2LP4A 4OHXA 4QIWD 5HVFA 3BQ2A 5B0GA 3RW6A 3OSNA 4JI8F 3FMBA 4W92B 3FKBA 2XHCA 3P96A 3PFOA 2KZZA 1U6FA 1RT7B 1ZZFA 2MKHA 4IDKB 5ETTA 2C2ZB 5IV3A 1N88A 2DNNA 4Z37A 2BQUA 2IVFB 1N54B 1VJWA 4ITSA 4DV3J 3MDFA 1RWKB 1UVLA 4DLEA 4DUZJ 4LSLA 2WONA 3GLJA 4O3SA 3PYFA 3I9ZA 3RBEA 3B4DA 2RRAA 2VQFF 2JWNA 3TUIC 5GAGI 2XYPB 2F3JA 2C42A 3CULA 3EE3A 3KLGA 3PKMA 1OIAA 2CQBA 1AT1B 1GTHA 1QUVA 2CPIA 3FSXA 4Y3CA 2CPXA 3GIKA 1HNXF 3W9HA 3KLIB 4JP8A 2HHXA 1RT2B 1TKZA 1U0SA 3NBPA 2O1PA 3CCTA 4KGMA 1ZPVA 3MR7A 3O44A 3N79A 4KO0B 3KK1B 4U8VA 3RZAA 2U2FA 3T9NA 3KLHA 4DR7F 1FJCA 1RHQB 1KDNA 3MD1A 3DFEA 4USMA 4CIOA 3CIMA 2DGUA 4DSFA 4OJHA 4EK2A 1KR4A 3VF0B 4XDDA 1UWAA 4ANEA 1S6OA 1UCNA 2CPZA 4ZVTB 2AX1A 3TJAA 4ZITA 1JMTA 4TYBA 2XYHB 2XZWA 1K9MT 4HACB 1YHQS 4N77A 4ENOA 2QA2A 3QFHA 2KG1A 2IAJB 4AE5A 1NK7A 3JTOA 1SJ3P 1ZM3A 1S1UB 2BE7D 1C1CA 1XNQJ 2FZCB 5F8GA 4A8MP 1FXRA 1NH7A 3SFGA 1V3ZA 2DO0A 1ZA2B 2L9WA 3IGVA 4F3OA 4MIBA 4XAKA 1H98A 3M6VA 3MUVP 4DEZA 2PT0A 1LWXA 4OI4A 4WP9A 3AB2B 3QO9A 2IFXA 3MHYA 4WWSA 3UW1A 2WVFA 1UZDA 3F0NA 3NWGA 2BJ7A 3M1VB 1UEUA 3M7VA 3SMZA 4DX8H 2XYGB 2CADA 2BKPA 3Q83A 4FF1A 4LF6J 3OR2B 1VLOA 2NPFA 1X5PA 4CO4A 5CCLA 4TQRA 1UPPA 2XMTA 2B6AA 3G8SA 1VOMA 4C8OA 3QAUA 1IM4A 1CG2A 2W2MP 1U2CA 1XN9A 1VQ8S 3EDQB 1W25A 3GIMA 4B3OA 1GXLA 4NEYA 2BMBA 1RTJB 2GZOA 1RHMB 2AT1B 3QLHA 4RUCA 3LH2S 1HBNB 3DU6A 1I3OB 2PC6A 5B0CA 1VQ7S 1MMLA 1S9EB 3UR0A 3KJVA 1U1MA 4ECXA 1RT2A 1TKZB 8AT1B 5KFMA 2OH2A 3M8WA 1GNKA 3GJSB 3MURP 2GGPB 3SZ2A 1IQZA 2GMJA 1OO0B 4KTQA 2PGCA 4L76A 5G0RB 5K14A 4P52A 4ZVOB 4QU6A 2P9CA 1XEZA 5M2UA 4C0HA 1FJEB 5KFTA 2U1AA 4NXNF 2XGPA 2BV3A 4WZQA 1JLGB 1Q8LA 3Q89A 1Y5IB 3W2VB 1GT8A 2DGTA 2PN6A 3J80Y 3FDSA 2CNNB 1FVSA 4EI2A 3K5OA 2DYAA 4HACA 4Z2XA 1HYSB 4O3RA 2GAGC 2IPOB 1NK0A 1H2TZ 4DS5A 5KFWA 2A2CA 2H9ZA 3PG9A 1J5EJ 3NL0A 4CH7A 3OTDA 4U96A 2J6UA 4ZJOA 1H7XA 2OLWA 2UUWA 3FGVA 4LUBA 5HJXA 2EG1A 1VQLS 2BA9A 1ZPWX 2RQMA 2Y1JA 4CLPA 1LQ9A 4ICLA 1B0TA 2ZC4A 1WDDA 2FGOA 4OX9F 4C11B 1WSRA 1SH2A 2VF3A 4DL7A 2KVQE 2AQ4A 1HHQA 2V50A 3O5TB 3X1LB 5KFHA 1N34F 1L3UA 3M8ZA 2CNOB 4ZMMA 3EUNA 4IUFA 3GCXP 4URGA 1WF1A 2OKQA 2KYXA 3HULA 2WSCC 4MJKA 4CYUA 4NXNJ 1NAQA 1T9YA 3Q86A 4GMKA 2VC0A 1PIEA 1VISA 2VV5A 2BABA 4IFVB 3AT1B 3TVZA 4A8QA 5AT1B 3PJ9A 4MFBA 3MM7A 3W62A 2ATCB 1SBRA 3IAS9 5HROA 5GMEA 3QIDA 5B08A 1N36F 2RDDA 2XMMA 3PW0A 3BYRA 2KDOA 1BE4A 1H2UX 1IKVA 4NRUA 5J2QA 1DQAA 4M5NA 1VS3A 4CDIA 2XC9A 1HBOB 1SQEA 3CCSS 2MY7A 2DITA 3HHLA 3ELHA 2GVZA 4MK9A 3OV7A 5I42A 2E1PA 2HW3A 2CAJA 2HQ3A 5DM6Q 5I3UA 1HQEB 2KN4A 3I5BA 2BE2A 4J9SA 3SQGB 2Z30B 2OAUA 1H3DA 5J2PB 3TRGA 2CPYA 5HJYA 4DJBA 3H59A 5I4MA 5D4NA 3ENAA 2XMAA 5EWEA 1I94F 1JX4A 2MQOA 3TQ1A 3DLKA 4ZPBA 2MZ1A 1R43A 4CLKA 3FSYA 3UCZP 3OSPA 5D3GB 4M94A 1T0TV 2M7SA 1B4SA 2GAHC 2HFNA 1VQ5S 4FXVA 9RUBA 3I0RA 5G4DA 4M5LA 5HANA 2VUGA 2HNZB 3ULHA 4J90A 1X4DA 2LQJA 2YQ1A 2OD4A 3L7UA 3MEDB 1M90T 1NZAA 2XI2A 4JI1J 1WEYA 1PO6A 1KHWA 3A12A 1CJTB 3W5YA 2EC0A 4UZBA 5HP1B 4UZCA 3A3OB 4NLXA 3DGPB 1RWPB 4OHVA 3PR5B 4C4WA 3WC2A 2VD3A 4EEYA 2OHDA 2VBZA 1WKKA 4F4WA 1Q4RA 2WHOA 2I2YA 5ETSA 2ASYA 2J9CA 4OYAA 2FIUA 1L3KA 2HHVA 3QJPA 1H7WA 5F3ZA 4HT5A 3HHLD 1R8AA 3J7AN 3VAFA 2PIIA 4OQJA 3SFUA 2MZRA 1K0VA 3LGNA 4NWBA 1TAUA 1P1LA 4U8YA 3KK2B 1JJHA 2R7WA 3FEZA 4RW8B 5ETNA 2MHNA 1TKXB 3GONA 3I5AA 5K14B 2W2OP 1FK9B 2YWGA 4DV2J 2ALZA 1NLKL 3CD0A 2YWHA 2E5JA 5KT4A 4ZPWR 1X5TA 2NYIA 3W2WB 2XGQA 2VHGA 2DH7A 3QBCA 1UEVA 3TWZA 1V5IB 1RTJA 4R8UB 5K8OA 2EKNA 1UFWA 2CG8A 2G0JA 3QGPA 3R7SB 3QT8A 4ED1A 2R8GA 3AQPA 2C2DA 5BYSA 3W8GA 2MDAA 5KFEA 2LVWA 1JLAA 2MJNA 5A8RA 1FESA 3X3UA 5C25A 5CA5A 3U1NA 1ZTWA 3BQ1A 2LECA 1APSA 2P8IA 1JLCB 3S8SA 3BSCA 2H4YB 1REGX 3JAMU 4UY8T 1AZSA 4P9SA 1LWFB 4N41A 4G6VB 5LJ5Y 4PPDA 3W8PA 3ETMA 2BR0A 3OJSA 3HSGA 3CPWR 2XWYA 5F0WA 2W7OA 1HNVA 1H74A 4XPEA 2D74B 2RDJA 3W2VA 2EXUA 3QFWA 2J9DA 2AP6A 2Z4PA 3N5BA 4WIQA 3BDEA 4DR5J 4NI2A 3FBCA 4XDCA 3C2PA 1QE1B 1S7IA 3PIOQ 4LSNA 1UL3A 3EDRB 3BDPA 3CCVS 2E9ZA 1E6YA 3SV4A 1QSSA 3OT9A 4J9UE 5HAOA 5BR8F 3ZTRA 1ZZNA 1VQ4S 1TZ0A 1S6UA 3VR1A 1KSPA 4B9NA 4I68A 2HHHF 1WEXA 3HI9A 3SIPB 3RRHA 3FBFA 1BHNA 1FXLA 3QGHA 1GQEA 2NS1B 3IN5A 3BGOP 1QSLA 4JI0F 1NSKL 2CG4A 2N4DA 3CWJA 2HWHA 3MEGB 1LK7A 1XIQA 5J1NA 1S1WB 4DR2J 2WVCA 3C14B 2XY6A 2IRUA 1VBYA 4BLGA 4J9VA 1U1KA 4FF2A 3M9MB 1XR5A 5U47A 2VA3A 3DU5A 2JEGA 2Y1IA 3DOMA 3WX8A 1TUVA 2DNHA 1UETA 4P74A 1WI6A 4YEAA 4ECQA 6AT1B 3HHKA 1B3TA 4GKKF 1RT6A 2ZUGA 1BWVA 3DLEA 2E5IA 3H42A 3GILA 2H48B 1VCTA 3KLIA 5CABA 1SCJB 1IKYA 3PCOB 1MMNA 4YB5A 2K06A 2D7SA 2ILZA 4K4UA 3F56A 3T6BA 3RJMB 4FXWA 1B7FA 2ZBQA 4V19J 3LP1A 5GAEU 4NCAA 3PEJA 3PZPA 2JDJA 2AU0A 2FPHX 1VQNS 1FWLA 1DQ8A 3DNCA 2A2DA 4JI5J 4I64A 4OJGA 2X3GA 3V2UC 4G1QB 4DR5F 2D3ZA 3ONQA 3QJJA 2QMWA 3U7JA 3ZNJ1 1WKLA 3AAWB 3AOCA 4ZPCA 1LEOA 3HDSA 5ETMA 1R0BG 1FX2A 4KH0B 2W9AA 2CQPA 3C46A 2R7SA 1EKRA 4DXLA 4ZS6A 2XSJB 2IDEA 3L95X 2HVHA 4MAKA 2FGCA 5E3CA 3U1MA 2ZH4A 3NCPA 2ZH5A 1VRUB 1RZMA 2HFOA 4OMFG 1MMDA 1Q81T 3CDAA 3OTCA 4LF5J 1RTIB 1XNRF 3QRPA 1RA6A 1OSDA 3AB4B 1T9UA 1RU1A 2D1CA 4CI0B 1NSPA 7FDRA 2F7VA 1FA0A 3NAIA 5DG8A 4PRFA 2E1RA 4GRSA 2XS5A 1HD1A 2B7BB 2E1CA 2NXNA 5KFVA 3T3FA 1RHUB 2DJWA 3FQLA 4UOGA 4NXMJ 2DCUB 2YWFA 2Y1LB 3LANA 1RSCA 3PM9A 3GZ7A 4U7UK 1D1UA 1RK8A 3C16B 1CQMA 2ROGA 3M8QB 2FLOA 2DIUA 3RBZA 3TAMB 1VMBA 4DPTA 4AQYF 3M2VB 2LEBA 4DL4A 2POKA 3N6NA 2AZ1A 3GTYX 1BXNA 2GA7A 2P9EA 3PYEA 3K8WA 3MEGA 1FKOB 3DLJA 3W60A 1RTDB 3JXOA 5K20B 3TZYA 4KR0B 4LR9A 5D78A 5IOLA 4I6YA 1PAUB 3QWUA 1N6QA 1T3OA 2UZAA 4O4GA 1HW8A 1WACA 4OYZA 3GFZA 5GMKa 4NZ6A 4TY8A 1YJUA 4IOBA 3PEHA 2XY5A 4WE1A 2YKOA 4LQ3A 1QAXA 2E1AA 2V8PA 3CJSA 3J80U 3DCAA 2PEHA 3ITHB 3W9JA 1KWMA 4UOFA 5D4PA 3CSKA 4KHRA 1C4AA 2IA6A 2AEJA 2JC1A 4ZVQB 3E01B 2X51A 5KFIA 1S1UA 1RACB 3W1YC 2V8DA 2VJUA 1HKAA 1YLXA 1ZAVA 2ZVSA 3FVYA 3MMBA 4LRDA 1S0OA 3D54A 1GTEA 2RKIB 5KG4A 4JV0A 4K5SA 5KTQA 2Z2ZA 3QATA 1S1VA 3OVBA 2LQ9A 5KFKA 5IC4B 3JSBA 4ED4A 3QT5A 3QT6A 3M8SA 1H6KX 1FI4A 2K3IA 2CIMA 3BN4A 3SCLE 5D4LA 2RHQB 1T8EA 4NYPA 1I94J 3M32A 1LFWA 1NJZA 1B7YB 2O66A 4OJ3A 2UP1A 4B9SA 4X4RA 2GX8A 3J7ZT 3GQCA 3T5LA 5A0YB 2QA4G 1XBWA 3LO3A 3KNAA 5ETLA 2FHMA 2UUCF 2V63A 3GE9A 2XO6A 4D3GA 2WOMA 5IXUA 1LK5A 1TK8A 2JVOA 1HI1A 1LXNA 2AWZA 2B9EA 3CDUA 3HLUA 2V0NA 2AJ2A 3MPDA 2J6TA 4KV8B 3HVWA 1KQFB 1SL1A 2CQ4A 2CFXA 1S97A 2QV6A 2RS8A 4C8MA 2B4VA 4A4JA 1CSJA 3QRRA 4B9UA 1PILA 1BMQB 4RZRA 2E66A 4V1Ak 2HHPA 3O1LA 5JVGQ 2AYBA 1UZHA 3GYGA 2OTJS 4USTA 2WSEC 5IT9Y 1VQMS 1P1TA 3FEXB 3MAHA 2IY5B 2GHVC 5C42A 1C1CB 3K17A 1Y5LB 4KQZA 4R0JA 1BQNA 1Q95G 3T1AA 2IBKA 1ZH5A 2BX6A 4DUTA 3DOLB 3Q24A 3T1YF 3EGVA 3FCHA 4F26A 1VC5A 2OSRA 2C2OB 2FJDB 2XMVA 2V5HG 3M30A 4NX9A 3KLFA 4GVBA 4ZKAA 2CZ9A 5KOXA 1U1QA 5BJRA 3E2EA 4DN9A 4DV1F 3PO4A 2J7KA 1PJ6A 4PWUA 1FNMA 2NXUA 1NHUA 1MU2B 2GJ2A 1YSJA 2CPEA 2HNYA 1RWWB 2C2MB 4P7TA 2MEWA 5DDPC 3OVAA 3N6LA 3W2WA 1TL5A 3LGMA 3PXGa 2C2RA 1Q7YT 1Q86T 4YN3B 4DX7A 2MQLA 1JJ2R 2HYIB 2UVWA 2VIHA 1UJ5A 4LMZA 1WORA 3PRDA 3EPIA 1DTQA 3ILLA 1XMQF 2DNGA 2V2ZA 1NDLA 4QR2A 5IZHA 3UD3P 2IMOA 5KG3A 2BRKA 3ZO7A 5C7PA 4USKA 2F4VJ 3CE8A 2NR0A 4HHJA 3I4HX 1UFKA 3OR1B 1ELOA 2HVIA 2BOAA 2GGPA 1N5QA 3WQPA 5A8KA 2B9XA 4ZVEA 2L41A 1BC6A 2AX0A 2HG4A 3I87A 2NUUG 4J91A 1RWXB 5CYMB 4DPYA 4J9NA 5A76A 1NO8A 1TL1B 2VBYA 2FC8A 3AOAA 3FUYA 2ZZMA 3KNGA 2YWEA 5KFAA 2EG2A 4X4TA 4HVZA 2DNOA 3ET6B 1IKVB 1DBDA 2UXBF 2H3EB 2VH7A 2QYGA 2HK2A 1HHSA 3MCSA 1FJ7A 3L09A 3CO9A 4MYTA 1RT1B 3QMQA 1VDHA 1SPBP 5H9EJ 5IT4A 1TKXA 1YGYA 2DB1A 2G9OA 4UOHA 4ZCIA 2F4VF 5CCMA 1PYTA 3NS5A 1R8CA 4ES1A 1HNZJ 3BSAA 1NJXA 2BOPA 4OZNA 1WUUA 3CC2S 1YRUA 3V4IB 2OIHA 1F3VA 1X4FA 3UNGC 4FKXA 1S76D 2CWXA 4O3NA 2HHUA 2RF2A 2SXLA 2VFTA 2QZ8A 1EQMA 3R2CJ 3JSMB 3HHNB 3MMCA 1KVKA 1NK8A 3B6BA 2ZD1B 5BYQA 3PFEA 4Q0BB 3KG1A 2J6SA 4YDDB 5FDLB 4CT9A 3FCVA 4KPCA 3GMGA 5EGYA 2I8EA 2L48A 2VG7B 2XMUA 3HVTB 3AODA 3NGSA 2IHR1 4YUDA 1K8AT 3MD3A 2JLFA 4QIEA 3VVUA 2NSBA 1Y11A 3BKUA 4CLLA 1VGYA 1VRQC 4PKDB 2MYFA 3ISZA 5E3QA 5CYQB 3W65A 4A8KA 3QGIA 4XK8C 2D69A 4IO1A 4Q0BA 2FY8A 4N56A 2HGLA 5IWAF 3BGLA 5EWFA 4YQWA 2VFRA 4CLWA 1C0TB 2JJ4D 4K5RA 3D5MA 1UW9A 1XWLA 4DU7A 4AL7A 1IBMJ 2QL9B 2P5VA 1FERA 3O8WA 1OQ6A 1JLEA 2H51B 2N3OA 3J7YI 4WK3A 1QSYA 1OSCA 4J37A 3RU0A 3SSSA 1V6HA 1X4CA 5A2QY 1HWIA 2N3LA 3D2WA 2JC0A 2BKOA 5F3TA 4USVA 4WFBQ 3EWGA 2UXDF 2OMOA 1CEZA 2HVDA 4HTJA 5LMNF 1MN7A 2NZ4A 1T9WA 1ROFA 2EFNA 4CH1A 3M6WA 3H2UB 4RW7A 5F8JA 2PA8D 3HCXA 3DRRB 3BBFA 2HFZA 2GMLA 2OEMA 5M2RA 5KFBA 1C0UA 2HBQB 2JL9A 5KG2A 4O23A 1VRUA 3KJNB 4C11A 3DLGB 3DKDA 1N36J 1Y10A 1JNRB 3OUYA 1G4CA 2GC8A 2W24A 4MIAA 3MOJB 1OMSA 1TL1A 4EO8A 4UW2A 1UVKA 4LSZB 4BBYA 1KQKA 3UE2A 1FDAA 4DV4J 2HBYB 1Y7PA 1MSWD 3R97A 1KTVA 2AMCB 2BDPA 5KG5A 2AYMA 1IVZA 3I56S 5L1JA 1S0MA 1IBKJ 2HAFA 3MECB 2R7RA 5HK4A 1LW2A 2DD8S 3TQEA 3THVA 1UKUA 2F65A 3DRPA 2AGPA 4LT6A 3CXCR 3VAGA 3FBBA 3GJRB 1TTHB 3UDVA 1WELA 2E44A 3HFKA 3MCMA 5IM0B 4B3SF 1E6VB 2Q6CA 4LFCJ 2OO4A 4XIUA 2ZKUA 2I6WA 1U7LA 2F63A 2ZJRQ 3CMES 3Q8SB 1PBAA 4N5SA 2VPXB 5KFYA 4PXBA 1XJWB 3QLHB 3HP6A 2F40A 1X8DA 4HL9A 1VR6A 2DBBA 4NLYA 2GIFA 2I38A 5MLCV 1S12A 2DIVA 3W61A 2ZZNA 2Y8WA 4P7VA 4Z7YA 3IS9A 1W2BR 2QLJB 1H73A 2XNQA 2EVZA 3P5BP 3KK3B 4A8WA 4JI7J 3LUYA 3CGIA 1IR2A 4NL5A 3RRGA 5H1SV 3A13A 4NZ0A 1HWJA 3NRBA 3AFGA 3DI6B 2UUCJ 4LF9F 3ADAC 2RQCA 1NKBA 1HR0F 5BR8J 1YJTA 3HT3A 2IC3A 1WC3A 4ID5A 1X9MA 2Z0GA 5KT5A 3TA1A 4U67Q 3PR4A 3EPGA 3BQ0A 3W7BA 1EETA 3MCOA 4IFVA 4Y34A 4DU8A 3M6XA 1U1LA 4CNYA 1GH8A 2Q6BA 2LEAA 2O01C 3JSYA 4QOTA 4Y2CA 4F0MA 1A6LA 2JNJA 1L3VA 3OBIA 4ECUA 1T11A 2ZH9A 5DDQC 3AD9C 3KJVB 4Q2MA 1NJIT 1N33J 2R7XA 2LU1A 4P6QA 4DV6F 2C22A 1U49A 2RRNA 2VG5A 4WP8A 3HM9A 1L5UA 1QAYA 5KAKA 3FRZA 4I69A 2PD1A 3TZZA 3GFHA 3MMAA 3FQKA 5F8LA 1YKWA 3MEDA 4RW9B 5L9XA 2MKKA 2ZH6A 1RCOB 4ZVPB 2IDLA 4CZCA 1S59A 2R7QA 4IQMA
chains in the Genus database with same CATH topology
1KLMB 2M2BA 3QPIA 4YB6A 3K7RA 1VK8A 3HK2A 2BM1A 3V6DB 3ZC4A 4OZ5A 2N7CA 3TUJC 7FD1A 3BGRA 4ZCKA 4IG0B 3RBDA 4LFAF 3KKFA 3KHHA 3MECA 1Y4ZB 4WTYA 3UWTA 2QT7A 3G6ES 2VFVA 4HEA9 4OFZA 2B5JA 4OZ1A 3NNAA 1JLQA 4NOHA 4FS1A 1R3NA 3CJKA 4TU7A 4BC7A 2XHWA 1Z1ZA 1FXDA 2DNRA 3GV8B 3U02A 4KSEB 5DJBA 1TL3B 3K5NA 2UU9F 1FD2A 2RDIA 4WFYA 4ETXA 2MZTA 3KLVA 5J2QA 4EBCA 1YJNS 1VQ6S 3NCQA 4O44A 5LXYA 2DTJA 3MM7B 5KFDA 2IMWP 4RNNA 1SV5B 2WSFC 2XO7A 5C5JA 2BM0A 2V9WA 2CQHA 2C3MA 1JWWA 4XPCA 3UPFA 3GIJA 1SL0A 5E5NA 4ED8A 4N8NA 3VCDA 2K7KA 4NLGA 3LP2B 1A7GE 4PG6A 5J2NB 2MKJA 2I5JA 3DYAB 3PHEA 2HMIB 4IR1A 3OVBA 2HHQA 1F0XA 5T41A 1MWYA 1X5SA 5HMXA 5K8PA 1WG4A 3H5SA 3HHLC 3MZIA 5DQGA 2JLGA 4IFYB 1SUQB 4RUAA 2COLA 4O3PA 3B8HA 4ILLA 2YH0A 1X0PA 4KHMA 3G86A 3TARA 3F44A 4YFUA 4F50A 2WW8A 2YX7A 5F8MA 5E0OA 4C8ZA 1RT6B 4DFMA 2E5LF 4U6PA 2IVMA 2C2EA 4X65F 4QCLA 4UOCA 3WDOA 1WG5A 4NLVA 3KLEA 3OLBA 3DOKA 2LLZA 5KFQA 2KT2A 1REVB 3JSMA 2ZH2A 3LW5C 5LMUF 1P9QC 4JBCA 2QIFA 3PY8A 3US5A 1URRA 5GADU 3DHXA 2WOMB 5B0FA 1F9FA 2DRAA 2EBGA 2FHJA 1KOHA 4ETZA 3CC7S 1S9GB 1SB6A 3HHDA 1NK5A 4IRDA 1QAJA 1XMOF 1DURA 4J9OA 2FHJD 4NLUA 5A8WA 2OSQA 1KTQA 4PXDA 1S6PA 4YY3F 2D41A 2C28A 3GG1A 3WX4A 4DG1B 5LSOA 2DNLA 3I32A 3ZZYA 1CQNA 4URQU 2AJ4A 2YY3A 1LWFA 4ZVFA 2NSCA 1U4BA 1VRTB 3M8PA 2XS7A 4C0OC 2RIJA 4RW9A 3LPYA 3OFGA 4LF5F 4M5DB 1RTHA 2VG6B 4IFYA 3IGNA 4EO6A 2VKZG 1O51A 3M2UA 4X4NA 3D1QA 2ZD1A 2ZHAA 1UP1A 1RT4B 2L9NA 2XBPA 3AA8A 1LW0B 3IAM9 2M9KA 5HL7Q 4RUHA 3BO4A 1MNEA 2KI2A 3ITHA 5D4OA 1VQPS 2GHWA 3PKYA 4EZ6A 4IR9A 3DRSA 4NYZA 3UDCA 2Q66A 1EP4A 1T95A 3MM5B 4FZVA 4KE5A 1RGVA 2XI3A 3TW0A 1KONA 3IR5B 1PSDA 1N52B 1RAJA 4OX7A 3LP0A 1LXJA 2BACA 2FJVA 2ZJQQ 4CO2A 4K50A 1R0AB 3UCUP 2L9DA 1YQHA 4K4TA 4FBUA 1VIOA 1TKTB 4G1PA 4TY9A 2NUHA 3A1YG 1JLBA 4DS4A 1NKEA 5C42B 4C3MA 3I5CA 3RRKA 5DDRC 2AYEA 4UQGA 4W90B 2W4PA 3OXGA 3BREA 1U1PA 4EFAC 5J2MB 4LF4F 2YKMB 2CQCA 4A47A 1E6VA 2MZSA 1Q79A 2Q1LA 4FPRA 1NJYA 2Z2LA 1RTIA 5KT6A 2LKZA 2ZH1A 2RJZA 2K1RB 2RMLA 4X66F 1RDRA 4DFPA 4IH5A 4NCAA 5B09A 3EXCX 4N47A 5EHHA 3GYNA 2B9WA 4NLTA 2HGMA 2BXJA 1D9FA 3MFHA 2AJFE 3RTVA 5D77A 2E5HA 3PACA 4DQRA 3CC4S 1G2EA 2PDAA 5HBMA 1HW9A 4BWMA 4X64F 4DFJA 4OI6A 5GVQA 1LKZA 3M2UB 2GNKA 2V4QA 5E41A 1TV6B 4UUWA 1FKOA 4H54A 1ZAWA 4QIFA 4C3KA 4F4YA 1K73T 1JIHA 4XO0A 2ILYA 3KG0A 3RW7A 2O3DA 1JXEA 1HPZB 5HMZA 5J1PA 3IC1A 4OV1A 3GV7B 1S0VA 1C1BB 3BF4A 3POTA 2EPIA 5C25B 5CXTA 2AW0A 2CVIA 1VK3A 2DHAA 4KO0A 3KK1A 2FUG9 4PCQA 1DAXA 2DO4A 2M52A 4IKAA 4ZPTR 6FDRA 5E2QA 1T03A 4F2SA 2K7JA 4YHHF 1C2PA 2JFDA 1YRXA 5G0RA 2G4BA 3BN7A 5D3GA 2RRBA 1TR0A 4Q5VA 2EI5A 1FKPA 4ED6A 1T03B 2IJNA 1NH8A 2E5GA 4IDKA 4WFAQ 3JTNA 4DV2F 3U27A 3PIPQ 1N8RT 3LP0B 2YNGA 4LFBF 2FHOB 3RB0A 3UDLA 1IN0A 4ED2A 1U1RA 2UVVA 1XK8A 3TNVA 2AD9A 4CCHA 2XLIA 1VBZA 5GAGU 4OJ1A 3D0HE 1FTCA 4OZ0A 2Z8QA 3HVTA 4F2RA 5F41A 2NREA 4HTIA 3TO8A 2CJAA 5HBMB 1HBMB 3VAHA 1YITS 2ASDA 3DXSX 2E1MC 4AL6A 2X1GA 2RUGA 2DHGA 3N01A 4B17A 4X62F 5KFRA 4ZVGA 1H38A 5KFGA 1DFDA 1HPZA 1HBMA 1VRTA 2KT5A 4JYAF 4ZHRA 1YG0A 1KLMA 5L38A 2ZNZA 3RAQA 1U1NA 2R8KA 2KFZA 4O3QA 4WIIA 2MMYA 4UQTA 3T9ZA 1NK4A 4ERDA 1R7IA 4URSA 1WEZA 1JLBB 1RWUA 3HXMA 3NAHA 1Y9OA 1HI0P 2VPWB 3K57A 4AFFA 2HAIA 4I2PA 4FXDA 4WJBA 3BJYA 4AL5A 2KH9A 2OPPB 1NU4A 2MSSA 4I1TA 4TNOA 4USIA 4EZ9A 5A6WA 1SC6A 2AF6A 3HHEA 5E3RA 4KPYA 3HZGA 4IG3A 3M6UA 2R2UA 2QLWA 1UFLA 3RAXA 1QAIA 3RR7A 1IR0A 1TP7A 1HNWF 3CD6S 2HGNA 1L3TA 1N0VC 4LIRA 4PXEA 2AGQA 4A8FA 2XMWA 2D3UA 2L08A 2B4PA 4QPTA 5KFPA 4KFBA 1FKAF 3C6TA 3Q2TC 3ENQA 1T3NA 5DQIA 2N4CA 1M5PC 1ZM2A 2ERRA 4BS2A 1MU2A 1G7CB 1UMJA 1IXKA 1S77D 1CC7A 4USHA 2GO8A 3NGKA 4QZVB 3MEKA 5FDLA 3I9V9 3OUYB 4IRCA 1RQ0A 2KU7A 2VONA 4X4SA 4RW4B 3THPA 1BQNB 2AJ1A 4ID8A 3RB4A 2VB6A 5BYRA 2UUAF 1M5SA 4Y6IA 4WF9Q 1X7VA 1JLGA 1Y5NB 2R9LA 2HLUA 2P9GA 4I0WA 4I6AA 3M05A 3KK2A 3CCJS 1LW2B 3NP5A 1W2IA 1R27B 4F3QA 1WF0A 1L3SA 3SQGA 1DQ9A 1HNIA 1X9SA 3GIIA 3TAQA 5I3UB 1IBLF 3J7A1 2CPJA 4N76A 4ID5B 1S10A 3CEDA 3J7YU 2ZM6F 3M8RA 2O5DA 3JYTA 1GAOA 4A8SA 4A8XA 3SV3A 2JEFA 1JLAB 2DVIA 2ZKTA 3MOZA 1OPZA 2JH3A 4QYRA 4OHZA 3G96A 3BGUA 4DR4F 1ZAXA 5KT2A 3MUTP 2ROEA 4ZVHA 5A8KB 5KFCA 3CCUS 4B3OB 2P6TA 1QVFR 4B9TA 5EN1A 2LXIA 4K4YA 2M8HA 2LXFA 5GADI 4CQ1A 3AA9A 3SXLA 3K58A 2DK2A 4ECRA 4ECWA 4ELVA 3MM9A 1YJWS 2J9EA 3CIZA 2HHWA 4QWAA 3CCWA 3UFCX 4WXWA 1S72S 1Q16B 4YR0A 1X4AA 1N5YA 2Q79A 5DG7A 3CJ3A 3O3LA 2V94A 1UJ6A 1VQYA 2FJEB 2RE1A 4QPXA 4AXJA 4TKTA 2HMIA 3H8YA 3S1TA 5KG6A 4TY8B 2QEXS 3LF0A 4IQXA 3MR5A 3Q8RB 4K4ZA 1HQEA 1IJEB 5T7LB 3UQSA 2PA3A 4E8UA 2J0XA 4UUXA 1FJGF 1JXLA 4LJMA 1HYSA 1DLOA 2R2TA 2BRLA 4QWBA 2OJ3A 1FRIA 4USJC 3WBZA 1VQLS 2C3PA 4DHVA 4MK7A 1YI2S 3KHLA 4FYDA 3I6PA 4PQAA 2XMKA 2ZH4A