2KVIA

Structure of nab3 rrm
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
PKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFGKKLILEVSSSNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and RNA-binding study of RNA-recognition motif of Nab3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords Nuclear polyadenylated RNA-binding protein 3
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kviA00
3CCLS 2PE8A 1KQSR 4TU9A 4WFAQ 5DDQC 2ERRA 2G0CA 3FEXB 2Q79A 1A7GE 1B7FA 3TO8A 3LPYA 2MQMA 3EX7B 2DIVA 2RUGA 2M8DB 1VC6A 1M1KT 2WBRA 3SXLA 2RRBA 2MKJA 2CPYA 2MZSA 5DM6Q 4CH1A 3G71S 2HYIB 2LA6A 2U2FA 3NNHA 3S01A 2DNHA 2MKKA 2MZRA 2KG0A 3CCMS 2RQ4A 2JWNA 2LXIA 3IRWP 5JVGQ 2MHNA 2XNQA 1VQ8S 3UD4P 3V4MA 1FHTA 2FC9A 1U6BA 2KYXA 4WFBQ 2KG1A 2DNZA 2DNKA 2DNRA 5GVQA 2QEXS 4V19X 1FXLA 1X4FA 2MY8A 2VODA 2DNOA 2RU3A 3RW6A 3BO4A 2CPFA 2DNPA 2MY7A 3MXHP 2MQOA 3G4SS 2LEAA 2DGTA 1OWXA 1YJ9S 1VBXA 3CCRS 2LEBA 3ZZZA 4F25A 2MGZB 2FC8A 2MKHA 4BS2A 3UCGA 2EVZA 2DH7A 3R27A 4M5DB 3G6ES 2KXHA 1KC8T 1FJCA 2DHXA 4CIOA 2OTLS 3P5TL 2E5JA 1QVGR 2LA4A 2HGNA 1X4HA 3J7ZT 4QPTA 4Y0FA 1K8AT 3G96A 1WF0A 2E5IA 2M9KA 1P1TA 2LQ5A 3BO2A 2YH0A 1WTBA 1OIAA 1N88A 2L41A 3VAFA 4TLQA 2MJUA 2MXYA 2CPIA 2AYEA 2FHOB 1F9FA 2AYGA 3VALA 1FJ7A 3JB9k 1D8ZA 2B0GA 2KXNB 2KU7A 1WHYA 2ZJRQ 1UFWA 2CQHA 1URNA 3LQVA 4LMZA 1N54B 2CPDA 1SJQA 1Q82T 2E44A 4PKDB 2A3JA 3Q2SC 2RQCA 1FNXH 2M4MA 3FEYB 2CPJA 3CF5Q 3BS9A 1M5VC 1X4BA 1VQMS 1O0PA 2MKIA 5LXYA 2JX2A 1KOOA 1VQ9S 2RT3A 5LSLA 3N9UC 2DNQA 1WI6A 1X4GA 5HL7Q 2X1BA 1X4CA 2M8HA 2XS7A 4Y00A 1ZH5A 2M88A 1WHVA 2DHSA 3L3CA 2RNEA 2LMIA 3VAIA 1R8PA 1ZZNA 2QA4S 1U1OA 2DNNA 2CQIA 5D77A 3MUMP 2OIHA 2NLWA 1H6KX 2GO9A 4ED5A 2M52A 4ERDA 4WF9Q 1X4EA 5FJ4A 2KRBA 1WF2A 2DGQA 2DISA 5H1SV 2XNRA 1FJEB 1U1LA 2V94A 2X1FA 3CULA 3ULHA 2VOPA 2CPXA 2MGZA 2D3OR 3BO3A 2YKAA 1SXLA 2CQ3A 4LIRA 2DNGA 4PR6A 4UQTA 1YJWS 1HD1A 2VONA 3SDEA 1WEXA 3S7RA 1VQLS 2DH8A 2QFJA 2KFYA 2MB0B 2MQQA 1JMTA 2J76E 3S6EA 2N82B 2AYBA 2RRAA 2G1DA 4IOCQ 2YH1A 1VQ7S 2J0SD 2YWKA 2CJKA 2AYMA 3NS5A 5GAEU 2CPEA 3CD6S 1IQTA 2N7CA 1CVJA 3VAKA 1WEZA 1BY9A 5IFMA 1Q86T 2MKSA 2XB2D 1U1PA 3S8SA 4CH0S 1H2VZ 1U1QA 2BOPA 1NO8A 2EK1A 3NMRA 5DDOC 5DDRC 2JRSA 2SXLA 3H2UB 4WIIA 1VQPS 2KM8C 2K8GA 4WFNQ 3P49B 1WHXA 2RVJA 1VQ6S 3CXCR 2VOOA 4C4WA 3MI7X 1HL6A 4IUFA 2ZJQQ 3TYTA 1Q7YT 2DGVA 2LYVA 2X1AA 4W90B 1YI2S 1AUDA 2MZJA 2DNLA 4WCEQ 3CCVS 4UY8T 3B4MA 3I55S 3HI9A 5ITHA 1SJRA 4CQ1A 3HHNB 3MUVP 2OSQA 5BJRA 2X1GA 4QU6A 1WG4A 3G9CA 2MZQA 5IQQA 5LJ5Y 3CCUS 3CC2S 2CQBA 5MLCV 1M90T 5CA5A 3NNCA 1X5OA 2PEHA 2YTCA 3TP2A 1DZ5A 3DLLQ 1X5SA 1M5KC 3CTRA 4F02A 3MDFA 5LJ3Y 2U1AA 3PIOQ 1W2BR 1WEYA 3MUTP 1M5OC 3VAMA 4FXVA 3MD3A 2M70A 1X4AA 3CMES 1FO1A 4LJMA 2CQ4A 2HVZA 2O3DA 2N3LA 2XS2A 2DNMA 3U1LA 5EN1A 4IO9Q 4OZ0A 2FY1A 4QQBA 2OTJS 1L3KA 4A8XA 2L9WA 5GAGU 1JJHA 2DGWA 3RW7A 1VQOS 1YJNS 2G4BA 4QU7A 2DO0A 2I38A 2ADCA 1K73T 2OSRA 5DDPC 2CQDA 2N3OA 3CUNA 1WELA 1SJFA 2M7SA 2DNYA 4YOEA 1A9NB 2RS8A 3CCSS 3DXBA 4OZ1A 3VAJA 2D9PA 2DGUA 1KD1T 1U1MA 1WG1A 3K0JA 3THTA 3R1HA 1ZZFA 4RU2A 2MZ1A 2E5HA 2J8AA 1U1NA 2LKZA 1DBDA 3G8TA 3I56S 1VQ5S 4C0OC 5LSOA 1R8HA 1YTYA 1UW4A 2DHAA 3OW2R 2DH9A 1WHWA 1P27B 2GHPA 2MKCA 4IOAQ 2LECA 3NNAA 2JVOA 3B4DA 2DGSA 2RS2A 1HD0A 3ZZYA 2MQLA 1SJ4P 3CC7S 2J0QD 2M0GB 2KM8B 1SJ3P 3VAGA 1PO6A 1YITS 2KT5A 2MQPA 1VQNS 4Z2XA 4P6QA 4U67Q 1VC0A 3H2VE 1N52B 2FPHX 2MZTA 4FXWA 3CPWR 1U1RA 3Q2TC 2XSFA 5HO4A 1X0FA 2DGXA 5GAHU 2I2YA 3US5A 1JJ2R 4WKRA 3VF0B 1D9AA 1HA1A 5GADU 3D2WA 1H2TZ 4YB1P 1DRZA 1DHMA 3CC4S 3UWTA 3UCZP 4W92B 1U2FA 5DETA 1QM9A 1VC5A 2MMYA 3EGNA 2XS5A 3G8SA 3U1MA 2UP1A 2CQ0A 2EK6A 3MURP 3P3DA 2KH9A 2CQCA 2D9OA 2MSSA 5CXTA 4YUDA 1U6FA 1S79A 2HZCA 3CCQS 4TU7A 1QVFR 2F9DA 4C7QA 3CCJS 2HGLA 1X5PA 1WI8A 1OPIA 2DB1A 2KN4A 2AD9A 2M2BA 1WF1A 2DITA 3NS6A 3IWNC 2DHGA 5D78A 5DM7Q 4TU8A 1VBZA 1VBYA 1PGZA 2KI2A 2KHCA 1WG5A 1NU4A 1JJ4A 2CPHA 2L08A 1WWHA 2MJNA 2MYFA 2LXUA 1VQKS 5IM0A 4ZKAA 1X5TA 1VQ4S 4J5OA 3MOJB 2MPUA 2CQGA 2F9JA 2CQ2A 3UCUP 1S72S 3EGZA 3MD1A 3J7YU 2KRRA 2F3JA 1X4DA 2K3KA 1Q81T 3UD3P 2LCWA 1YHQS 2CQ1A 3SDEB 2CQPA 3R1LA 3UE2A 5LXRA 4F26A 1U1KA 3CMAS 2ZJPQ 2DIUA 3VAHA 3P6YC 2KXFA 3PIPQ 1RK8A 1UP1A 2DGOA 3SMZA 1RKJA 1N8RT 3BEGB 2HGMA 1OO0B 2DK2A 1M5PC 1UAWA 2KVIA 2ADBA 1K9MT 1YWXA 5IM0B 3THPA 2DO4A 1NJIT 2OJ3A 1YIJS 2NZ4A 2E5GA 2MQNA 5GMKa 2MSTA 1G2EA 4PRFA 1XN9A 1FT8A 1H2UX 2CPZA 1KOHA 2BZ2A 3CCES 5CYJA 4EGLA 5JVHQ 2JVRA
chains in the Genus database with same CATH superfamily
1NJWA 5CAAA 5LM7E 3CCLS 4L72B 3BQ0A 2WOMB 2BW7A 3KLIA 4ICLB 2AGOA 4LQ3A 2NXEA 3FQKA 2AEJA 2V4QA 2DEIA 1KQSR 2O67A 5J1NA 4DSEA 2IRUA 3LP2B 3F0NA 4WYWA 4TU9A 4ZP7A 5F0UA 5F9LA 4NLRA 5KFJA 4RKUC 2ERRA 3UD5A 2ABYA 2VU5A 1S6QA 3HSDA 4GKKJ 1OMSA 1T11A 2VC1A 2COLA 5DG7A 4RNFA 3IBCB 5B0EA 2R8KA 3RUBL 2CYYA 2YNHA 3LP0B 1Q1KA 1Q16B 1CS4A 2GV1A 2I5JA 3DMJB 1B7FA 1YZ7A 2X51A 2IJNA 3FMBA 5ETRA 2RUGA 3UI3A 5I42B 2WZ1A 4ZLLA 4DL2A 1VC6A 1KN6A 1N5TA 3D28A 3D67A 2F5GA 2ZVIA 3C15A 3ETMA 4OV6A 2XM3A 3W9JA 2RRNA 3Q86A 2CPYA 3UVJA 3TX0A 2YPZA 1JLEA 2U2FA 3NNHA 1C1CB 5LMUJ 4P71A 1IKVB 3S01A 4LF5F 1HBNA 3FNNA 2A1BA 2MKKA 1FCAA 5AJ3F 3NGDA 2LXIA 2PA8D 3IRWP 4P52A 1C0TA 4LF8F 2HNYB 3UDCA 1VQ8S 4EZ9A 2L48A 4FDFA 3WQPA 2CVEA 2UXCF 2ZZNA 3V4MA 2KG1A 4DXLA 2APOA 1S9EB 3JAMU 1TUVA 4JI2J 3GV8B 1Y5IB 3TI0A 1S1TB 3HVRA 4Y6IA 2VL1A 2W9AA 1D8YA 1IBKF 1T9TA 3E01A 3TAQA 5M2PA 1X4FA 2R42A 3ELHA 4GVBB 4L73A 3KLHB 1JXVA 4MH8A 4NMLA 4DV0F 2VODA 4PPZA 4LRFA 4AL6A 5M2UA 1JNZB 2ATCB 1OYEA 4DX5A 3BO4A 1RB0A 4ED7A 4NXMF 2DNPA 3DMJA 4IDKA 3K5NA 4O4RA 2LEAA 2DGTA 3VZIA 1DQAA 4JI6F 4W98A 1XR5A 1NH8A 5KT6A 1R7IA 4ED6A 1YJ9S 3T1HF 1VBXA 3QRQA 4F25A 3C15B 2BJDA 3M32A 3VCDA 1MMDA 1XK8A 1FE0A 1JLEB 2JC0A 4YY3F 1YX2A 4BS2A 1A6LA 1IKVA 3R27A 1RBAA 2NUHA 2QMWA 3KUHA 4M5DB 4C0HA 4XO0A 2C2MB 4WK1A 3DRYA 4OYXA 5ADZA 1B0VA 4OZ3A 4X64F 1IBMJ 1PJ5A 4NRTA 4J91A 4Y28C 4ZP9A 1TL5A 1YJUA 3EXYA 1RT7A 3LGMA 3ZTQA 2XZTB 2YX7A 4DUZF 4U95A 4FF4A 4P72A 4U9RA 2QT7A 3J81Y 2QG9B 3MM9B 2EW9A 4QPTA 1S9EA 4Y0FA 2B7BB 5ETKA 2CZ4A 3MEEA 3AQPA 3GQCA 4R5PA 3G6XA 3SQGB 1P1TA 2CWXA 3CJ8A 2YH0A 3BGUA 1WTBA 4YN3B 1RT2A 3HSZA 3R5BA 2A2CA 4TLQA 2MJUA 4BLGA 2PI5A 4FZVA 1SQGA 4XDDA 1VRUB 3OTOJ 4KHPJ 2FHOB 2HFNA 1WORA 4DG1A 1APSA 4O4GB 4JYAJ 3HCXA 2HFUA 3O6QA 3QGHA 4KGVB 3PO4A 3C66A 2WAQD 3DRSB 4TYBA 1RU2A 5IV3A 1S0NA 1HBOA 2DPJA 3D1HA 3MPYA 2J8SA 2K1RA 4BC7A 4EGLA 2ZFHA 4DLEA 3TARA 2RHSB 4DS5A 1FERA 4CTAA 2FUG9 5DO2A 3HT3A 4QW9A 3GFHA 3GSDA 1GMVA 4OHWA 3EZUA 4OX7A 4EMDA 1S6QB 1XERA 4F3QA 3GILA 3ILIA 1U47A 3BB5A 1QAJA 4K4ZA 1RHQB 2NCKL 4GKKF 2WBMA 1RT7B 2ASDA 1JXLA 3TVKA 2M4MA 3CJSA 2ZM6F 1HWIA 2NXNA 1Q78A 3LUYA 3CF5Q 2HVEA 1E6YA 3BS9A 4RW7B 4AL5A 3TZWA 2RIJA 3HVWA 4F50A 1FNOA 3QJPA 2DNQA 4HL9A 2WW4A 3C19A 1FE4A 4DEZA 2VPWB 5HL7Q 3M05A 1X4CA 3M2RB 1RADB 2M8HA 2X7IA 3HSGA 3UNYA 4R8UB 1S6PA 3CDEA 1S5ZA 1QSLA 4P75A 2IBKA 3EZOA 3M9OB 4HKQA 5JJBA 3EUNA 2ZH5A 2ZNYA 1NJYA 2UVWA 1S1WB 1HLWA 4OHXA 1ZZNA 3IO1A 3DRSA 2IAJB 1XR6A 3DOKB 2AGPA 3W2VA 4JV5F 4M5HA 4DI6A 2HW3A 4K4SA 3MEGB 1SV5B 2NLWA 4CTAB 1H6KX 4UQGA 2C2DA 3A3NB 3MM6A 2IYGA 3DLBA 1RWNB 5D4LA 5HQ8A 3KLHA 1X4EA 2PN6A 3QJLA 2GVDA 2BE2A 3PW5A 4OI2A 3PKMA 1TKXA 2HHPA 1CEZA 5E2QA 2LLZA 3HDSA 5IT9Y 1RZMA 2DISA 2FY8A 2HIQA 3OR1A 2EKYA 3AJDA 9ATCB 1F60B 4PWDB 3AB2B 4JI8F 4I2PB 5IXUA 3D1QA 4YP3A 2WK4A 2QTWA 3ULHA 4BCAA 2Y3YA 3OSNA 5KG7A 2DXEA 2XMVA 4AFFA 2R7VA 2EC2A 2GCFA 4DDFA 4GKJF 7FDRA 1RAGB 2JEJA 1YBUA 4PR6A 1N33J 3AT1B 1JX4A 3R5CA 4LVNP 3QATA 1F0XA 2DYAA 4L75A 4L6V3 1HD1A 2VONA 3S7RA 5IC6B 2ALZA 3D3BJ 4ZA1A 1IKWA 4I6YA 2XZWA 3K8VA 4DX6A 5KFDA 4MK8A 1L5UA 2MEWA 2EPIA 2MQQA 4B9SA 4EZ6A 1BWEA 1RA6A 4JUZA 1NKCA 3TANA 1YJ7A 5K8MA 5KFCA 2J76E 3CWJA 3S6EA 5LMUF 2RRAA 2K2PA 5DGAA 2WVEA 1EARA 3CD7A 3N01A 4CLFA 2GGPA 3DU5A 3EMTA 1RT5B 1VQ7S 4JI1J 2HNDA 3NS7B 4K4TA 2BJ7A 2CJKA 3M1VB 1BUXA 1XTZA 2ZDOA 3NS5A 4GRSA 4QR2A 3VVUA 5GAEU 3CD6S 4X2BA 2N7CA 1P1LA 3AH6A 5E3PA 1XNQJ 3CDWA 1YRUA 5FLXU 5KFHA 1HNIB 3EGWB 1URRA 3R97A 2CJQA 4FBTA 4KQZA 1RT4B 1IBCB 2BE9B 1X60A 2DRDA 1U1QA 4M5KA 1S12A 4LBPA 1LWEA 1SQFA 4G65A 2W2OP 4KR0B 2VH7A 4M5NA 2VBWA 2EK1A 3KKFA 1IQZA 3H2UB 1VQPS 3I82A 2OD4A 3LAKA 4WFNQ 3GIKA 1CSJA 1FK9A 1WHXA 3CEDA 3OTDA 2RVJA 3AAWB 7FD1A 2VQEF 1REVA 2XMMA 3EVMA 4WBFA 3RRGA 4OI0A 4C4WA 2XTJP 3BGRA 1B0PA 4CNYA 3MI7X 4RBVA 1HL6A 1NAQA 2MQ8A 1ZM4A 3KUGA 3WX4A 4TQSA 3IWLA 3OL8A 4IUFA 4B3OB 3A3PB 4W90B 1YI2S 1B0TA 2C3YA 4RW7A 2MZJA 2IA6A 4IH7A 3JAMY 2D41A 3QO9B 4DSFA 2FLPA 3EVWA 3CD0A 3AD8C 3DRRB 4PEOA 2LFVA 1NHUA 3KHLA 4PABA 4FVMA 1MROA 2V9WA 3KK1B 2V8HA 2XMAA 4C6AA 1E6VB 1RAJA 1SQEA 2OSQA 1RT3B 1SH3A 3MM7A 3F44A 1YDLA 3H20A 3W64A 2C3MA 1Z4UA 4CCHA 4WE1B 4X4VA 5KFAA 5IQQA 4DR4F 2HS4A 3DOKA 4ZVOB 4N76A 1M90T 1RWVB 1U8WA 3LP2A 3M8QA 3LH2S 2QC3A 1RHJB 1DQ8A 1O8BA 4C3KA 2BANB 3RBZA 5KT3A 1DZ5A 1CJUB 3DLLQ 3HP6A 5DZ6A 3V6DA 1BQNB 2WONB 4K0KF 1VOMA 3GIRA 4YEAA 4JI0F 4C3LA 3T5LA 2ASLA 3MDFA 4LFCJ 3LP1B 5HVFA 4B3TF 1HHTP 3TUJC 1KWMA 4NLTA 1XMOJ 3OBIA 4F3MA 1WEYA 1R8CA 1UFLA 1ACMB 2HPUA 3FUYA 3GTYX 2R9LA 2FDNA 2P6SA 4ITSA 1SI9A 5CZXA 1DTQA 2CWKA 2NR0A 4ETZA 1NNDA 5ETMA 4IKAA 2M70A 5DRKA 2G0IA 4O23A 5THWA 4DR2J 1FO1A 4OX6A 3KK1A 1JLAA 3W5XA 2HVZA 4DFJA 2AW0A 2D74B 4QYRA 3HXMA 2O3DA 1RT3A 3MM7B 3IP0A 2E5LJ 4JV2A 5EN1A 3HFZB 2ZOMA 3HZGA 1IKWB 2OTJS 1L3KA 1HPZB 2FJWA 2V50A 3F56A 2HHSA 5F3TA 4CP5A 4WKYA 5A8RB 1SIWB 1BWVA 4HHHA 1VQOS 3TQ1A 2IYIA 2ROGA 2V63A 2DO0A 3JSBA 2YPYA 5GAHI 1U09A 2E1AA 1CJUA 1R89A 4ZN1A 2VFSA 3OVAA 1D1UA 4NZ7A 3WZ0A 5DDPC 2W4CA 1FEHA 2N3OA 1RT5A 4CO4A 5EX0A 1MWZA 3IN5A 4KPYA 1NK5A 2ZWOA 2HFZA 4DR7F 5KFOA 2RS8A 2ZKTA 4HYKA 1JLCB 2DGUA 3H98A 5B0GA 1HNIA 4EBDA 2ZZMA 1RBOB 2EC0A 2R7UA 1WG1A 1V6HA 1T9VA 3D1OA 2KJVA 1TL3B 3FBBA 3FJ2A 5EWGA 3R1HA 4YQWA 1R0AA 1XC9A 5C42A 5F8HA 4A8FA 3M8YA 4USVA 4CT8A 3FRZA 3PW7A 2LKZA 2VPYB 4C11B 3K5OA 2MLZA 1AZSA 1VQ5S 4C8OA 2IFXA 2V8DA 2RU9A 1R8HA 1T8EA 2JOQA 3GWCA 3RZAA 2BW2A 4NA1A 3TUIC 3OW2R 3CGIA 1TKTA 3MAQA 1XQIA 5KFEA 2DBBA 4ZPWR 3NL0A 4AXIA 5I3UA 4KGMA 3EJMA 3H4DA 1X9MA 1N48A 4JI1F 3BKTA 4IOAQ 2DGSA 2C2KB 1HD0A 4NLPA 5H9FK 5KOWA 3ZZYA 1BMQB 2PC6A 1NXIA 1FTCA 3IR6B 1S76D 2QSFA 3OFHA 3QWPA 2C2RA 3L09A 4NCGA 1TKZA 1K1SA 1SJ4P 4FKXA 2FVRA 2J0QD 1VRTB 2KM8B 4ES2A 1UPMB 1ZA2B 2ZH6A 1N6QB 5IT9U 2H3EB 4WK3A 2QLXA 3DGPA 3H5YA 2CIMA 2XLJA 5D0GA 3IM9A 1KP6A 2HHHF 4IRKA 2MQPA 2UXBJ 3TAMA 1OY8A 1HR0J 3M8WA 1WC0A 1VQNS 5C2CA 4JI5J 2YWHA 5AJ3J 1Y5LB 2CA9A 1WACA 4DQSA 3I9V9 3KLEB 1FDNA 3HSJA 1CJVA 1N52B 3PRDA 5EWEA 1N32J 2UUAF 1FDAA 1FKOB 2UXBF 3RU0A 5AE1A 2F63A 1OJ4A 3K5PA 4OZLA 4RBTA 1CLFA 4IR9A 3JYTB 1AZSB 1RHRB 2QYGA 1U1RA 3Q2TC 2XSFA 5AT1B 2XSJB 5HO4A 5L1JA 4AQYF 1UA1A 5GAHU 3GJRB 4X4SA 2XLIA 5U47A 4LF7J 1JJ2R 4OHYA 1FRHA 3U7JA 2C42A 2IBOA 1D9AA 5D4NA 1DHMA 4UOCA 4J9NA 1S0OA 1U2FA 1RCXB 3TWZA 1Y9OA 4RWXA 3QIPA 1SPBP 3NGSA 2CNNB 4OYIA 3C6UB 2ILZA 4QBUA 2KTQA 4B3SF 3U1MA 4UUWA 2CQ0A 5HROB 1C4AA 2KYZA 2WW8A 2CQCA 2MSSA 3ENVA 3GMGA 1RWMB 3HHLA 3O1LA 3F41A 4K5SA 4OYOA 1U6FA 2NXJA 4R8UA 3OHAA 1VRTA 4EYIB 4IQXA 1FDDA 1S6PB 2R8IA 3CIZA 1UWBA 3V4IA 4WFYA 1O5JA 2LVWA 3TJAA 3CCQS 3BYPA 4B3RF 5D0RA 2OMLA 5IQ6A 1DQ9A 2A6MA 2WOMA 3FDSA 3AXKA 2BV3A 2OPSB 3DM2B 1HPZA 4HI2A 3M9MB 4F4YA 1OPIA 2E9RX 2V4RA 2DB1A 2V4JA 3W2VB 1UJ6A 3CCWA 3GJSB 3MTJA 3ZTOA 4DV7F 1SV5A 1JLQB 1SKWA 2E7WA 3GIJA 4DPOA 3OL6A 1U45A 4I0WA 1WG5A 4B17A 1NU4A 1WC6A 1FFWB 3AJ2A 5HMYA 1S4FA 2CPHA 2AZ3A 4RBUA 3BR8A 1XMOF 1TKXB 1YKWA 4BWJA 1RDRA 1T0TV 4ED8A 1WWHA 2AKWB 2XMWA 2MJNA 4NZ0A 2I5JB 2L9NA 7AT1B 4X65F 3EPGA 4J9UE 2ZH7A 1NMEB 3I0SB 2FJBB 2VG7B 1J27A 5E3RA 2BA9A 1X5TA 2WSFC 3LGHA 1HMVA 3FQLA 3IFEA 2AJFE 1S1VB 2YVSA 5D15A 3R7SB 2CQGA 1RUSA 4HHJA 4U8VA 4DV5J 4OI4A 5EX3A 3FKBA 4F3OA 3MD1A 1ZAXA 3J7YU 3FSIA 4JYAF 1LK5A 1VIXA 3DLKA 4TNOA 4LF6J 3HZEA 3MFIA 2K3KA 3SIPB 3M30B 1IVZA 4KPCA 4NMXA 1IWGA 2DEJA 5HQLA 4DV5F 2LCWA 2IC3A 2K3IA 2CQ1A 4DFPA 3R1LA 2Z56B 4LSZB 5HLFA 5LXRA 1FRXA 1CG2A 2GJFA 1KR4A 2WCXA 2ZJPQ 4KB7A 4Y2IA 3V81A 1XEZA 3BGFA 1DURA 3NY0A 2KXFA 4HTJA 1JLQA 1RK8A 1WDTA 5E33A 3M9NB 2J9CA 3E01B 1QTNB 3LALA 1PYSB 1M5PC 1RHUB 1RACB 1Y5NB 1VQYA 1FRMA 1R43A 1YWXA 3PG9A 2HQCA 4FYXB 4ES1A 5IM0B 4OFZA 3B6BA 4LF8J 4TN2A 1EZZB 5GMKa 2BR0A 2VIHA 1F5BA 1G2EA 4PRFA 3MMAB 2PA3A 1OYDA 3B78A 4DL5A 4A8WA 3RBDA 2B6AA 2HSEB 2I6WA 4RNNA 2GC8A 4KV8A 5HMWA 5CYJA 1FWLA 2Y1IA 5BYQA 2RF2B 4I7FB 2AJ4A 2PE8A 3B8HA 1U1KA 4ANCA 2DY9A 1SIZA 4O3NA 5J2NA 3MR7A 2FLOA 2QLBB 3BKUA 3QT5A 5F8LA 2DR6A 3BBBA 3MPDA 4X4TA 2W1BA 3QIPB 3E8OA 2R2TA 1AXQA 2BABA 4KGXB 2CZ9A 1HFEL 2Q79A 3DYAB 3UNGC 4UOHA 4D3HA 3T3FA 2ATLA 4U7UD 5IT4A 2KFZA 3MHYA 1Q53A 4UZBA 2A10A 3LPYA 1FFSB 1MROB 4CM2A 2GJIA 4J9MA 3V4IB 2CFXA 1RYSA 2WBRA 3DLGA 4ZHRB 1YBTA 3KMSA 2UUAJ 3DLHA 2BKOA 1FWPA 1UL3A 2RRBA 2DRAA 4DSLA 2IDLA 4WU2A 3CJKA 1QJHA 3OFFA 1ZAWA 2LA6A 2B56A 4CT9A 2VDIA 3UFCX 3TZZA 1U48A 1TR0A 3FMWA 4OI3A 2DNHA 2XYPB 4U7CA 3VVTA 4OZ5A 2DCUB 3N5BA 4OJHA 2B6AB 4ZN3A 3TUPA 2JWNA 1RU1A 5T7LB 3M8ZA 2RQMA 2VPZB 3MECA 1FI4A 2ZH3A 2YBVA 3A8KA 2XNQA 2UUCF 3R5DA 2C3UA 2KH9A 4RJVA 1WOOA 3HJVA 1U6BA 2XWXA 1DTTB 5SZTA 1RAHB 2DNZA 4UOFA 3MZIA 1W2IA 3OD2A 4USHA 4Q0BB 4ZJOA 2HEKA 3V6JA 4RUCA 1HBMB 4FBUA 2ZH9A 1S1VA 2XGQA 2XG8A 3I4HX 4BHQA 4PG7A 3WIUA 1OQ6A 2IM1A 4L3KA 1WD6A 2B9XA 3GV5B 3RW6A 4URQU 2LXFA 1WC5A 2F1FA 2MQOA 2W7AA 4NRUA 2NYIA 2WB4A 4XPCA 3RRHA 2NSCA 1RWOB 3KHGA 3CCRS 2LQJA 3QPIA 2IM0A 2KB2A 5CD4A 5EGYA 2IC3B 3TAPA 4ED3A 3CD5A 3M6UA 4YDDB 2MKHA 3X3UA 4DUYJ 4FF2A 2EVZA 4RLEA 4ELTA 2EFGA 5HK4A 4LF9J 2QIFA 4V19J 5A8RA 2BRKA 3C6TA 2RB7A 3DKDA 3BSNA 3PX0A 4KRWA 4HEA9 3QZ7A 3LPEA 3OXGA 3NRBA 3ZXWA 3RB4A 1KC8T 2VA2A 4B3MF 4IO1A 1FJCA 1HHQA 1HIYA 1VJWA 4EU0A 3KLIB 3P5TL 4NLVA 5FD1A 4J9RA 4DR1F 3GYGA 2L9DA 5CH7B 3PY8A 1QVGR 3AD9C 2HGNA 4PUOB 3KJQB 4DL6A 3PDNA 5D0HA 4CLTA 1UA0A 1WKKA 1YGYA 4MKVA 2FYXA 2R2SA 2J7UA 4KTQA 1WF0A 4ZIVA 2CJYB 3DFEA 4EK2A 3AA9A 3BO2A 2UXDJ 4PAAA 2HQIA 4QIFA 1OIAA 1N88A 3SCIE 1C2PA 2VICA 4NXNF 1R8BA 4J9PA 2B4OA 2AYEA 5KG4A 4CLKA 4DQPA 1ZBTA 2IMOA 3KLFB 1TELA 1T95A 1U2RA 3SEOA 3OVSA 2A6OA 5J2QB 4MFBA 1B70B 1ZOTA 2FVQA 1LFWA 5F41A 1U26A 1HWJA 3IGNA 2Z30B 1KVJA 3NLCA 3H25A 1Y7PA 2GNKA 2D3UA 2UVVA 1D8ZA 5J2NB 3NWGA 2B0GA 3BPDA 1I6JA 1AFIA 2AHOB 2PMZD 2G13A 3QIDA 1BLUA 1UFWA 4Z7CA 3PVXA 3RAQA 1NH7A 3D6HB 1FVSA 5CYQB 1LV5A 1C0TB 2WVFA 3P4UB 1EAYC 2BJEA 2LDYA 2RAQA 2WVBA 4C97A 4CWBA 4DCJB 2H5EA 1IKXA 2GVZB 4ZCLA 3DYAA 2RKIB 3R3TA 8AT1B 2XY6A 1PGZA 1Q82T 1HI0P 4PKDB 2A3JA 5HP1B 3BF4A 4GC7A 3DOLB 4DCPB 3BN4A 1M5SA 1RCOB 2AZ1A 1S1TA 2CPJA 5KFFA 4F4AA 1FEEA 1RAOA 2V2ZA 1UEUA 3HPOA 5A8KA 3H0PA 2P9CA 4PG4A 4WU3A 5K8OA 1WI6A 2OUGA 3AXMA 3ENQA 1CJVB 3R7NB 1J5OA 2XS7A 1LWEB 1ZH5A 1EIYB 2HAFA 2DHSA 5F9NA 3L3CA 5KFQA 2RNEA 2LMIA 4RPFA 4CLPA 2R7WA 3PXGa 4P7TA 1AROP 3V6KA 1RWWB 3OXLA 3H59A 4DSIA 1U24A 3L7UA 1Z1ZA 2D3O1 5EHHA 2NQPA 3TX8A 1ZTTA 4DL7A 1Q5VA 2DKOB 3BH7B 4M5DA 1EX8A 3WC0A 4DL3A 4DF8A 1IBKJ 1O6XA 4ED5A 4K4XA 1HNVB 3CO0P 5JMNA 1I5OB 2ILYA 3BSOA 3IBFB 1GXLA 4K50A 3OL7A 2Q1LA 3JTPA 4QYZJ 2B51A 1Z2ZA 3NGRA 1WF2A 2VQEJ 1MW7A 1SH0A 1XBWA 1YZ6A 2ZD1A 2XNRA 1JLFB 2DXDA 4RW8B 3MEKA 3DU6A 1JLGB 1FJEB 5D4OA 4B9LA 1EQ0A 1TQLA 4LIWA 2DT9A 1CQMA 2LQBA 3M6WA 1S49A 3RAXA 3CULA 2OEKA 4YY3J 3OJSA 3F73A 4CDIA 4NE9C 2VOPA 4IFVB 4F4XA 3GJQB 2MTLA 4G1IA 3M2UA 4K8RA 5C7PA 2PT0A 3TNVA 5J2MB 2QJ3A 4MKAA 2Y0BB 4GO7X 4O4GA 4UQTA 4NXNJ 1LWFA 2Q3PA 4EUVA 1YJWS 1HWUA 1RWXB 4ELVA 4K2JA 3G82A 1S1UA 1WEXA 3SDEA 1TK5A 3W63A 2QL5B 4P7VA 1BQMA 2BEFA 3C14B 2EBGA 2XWYA 4MYTA 4OYZA 5E3AA 4PCQA 2VQFJ 2QFJA 1UPPA 2AQ4A 2DPIA 1JMTA 2VG7A 2YKNB 4B9NA 4X66F 5HI7A 2F7VA 3D66A 1TK8A 1JKHB 1J5EJ 1RWPB 2G1DA 2GA7A 3BGLA 3BR9A 3BQ2A 1LFPA 4URGA 1VBKA 1KVKA 2EEYA 3GSIA 1K0TA 1LOUA 2J0SD 2YWKA 4CO0A 2AYMA 3BPSP 4ED4A 1R0CB 3UR0A 4DLGA 3QAEA 4RW8A 3OLAA 1CVJA 3I5AA 3QQCD 3SYZA 1E6YB 3M6VA 3OQ2A 5J2PA 3HJFA 1F3VA 3BREA 3R2DJ 1N32F 1S4EA 1HHSA 3V6HA 4AT1B 4LF4J 1U0HA 2ALYB 3I87A 3ONQA 1H2VZ 4RO0A 2IVFB 1MWQA 3QAUA 1K44A 2JFDA 3FCVA 4CM0A 3M8SA 1C0UA 1TVRB 4GKJJ 1HQ2A 1NO8A 3N6NA 3LW5C 1Q8LA 2OAUA 2UUBJ 2JRSA 2J9DA 3HHLD 1AYEA 2K8GA 1HQEB 3IRXB 4MTPA 1QAYA 5ETNA 4E98A 1MWYA 2W01A 1RHKB 3P49B 2J0WA 4QWDA 4DV6F 4DR3F 2Y1RI 4NI2A 3E51A 1V3RA 3TYTA 3H5XA 2LYVA 3MEGA 3O8WA 5KG5A 4K4VA 1BD6A 2YKNA 4ZLPA 4DSKA 2FHJA 4Q45A 1FA0A 1VHIA 4DL4A 1Y11A 4UY8T 5DGBA 3ZNUA 3SCKE 1Z2LA 3B4MA 4CLSA 5KFMA 3I55S 2I0XA 4J37A 3HI9A 3OT9A 3PRVA 3D68A 3ZZTA 1KRPA 4JI7F 4CNZA 3QT6A 3GLJA 1N33F 2QA2A 3JS9A 3SCLE 3W61A 2G0JA 1ICEB 4TY8B 1YLXA 2W25A 2K7KA 3NBPA 1M1HA 1QUPA 4H4MB 4USTA 4ECQA 3ET6B 3KLGB 2HHVA 4ECVA 4QU6A 2CJAA 1S6UA 2MZQA 4OIXA 3MPVA 5LJ5Y 2FGCA 4N41A 4KHPF 2Z2LA 2Z2YB 3NNCA 3CMQA 5CA5A 1N56A 3L95X 5KFPA 2PEHA 2YTCA 3TP2A 4N5SA 2OHDA 2R2UA 3NGKA 4ANDA 5IS2A 3NGTA 3PYDA 4RW9B 2W7OA 3HFVA 4Y2AA 1JLBA 4DQIA 2Z8QA 2Y8WA 1TAUA 3R6GB 2JNJA 4F04B 4ILLA 4KE5A 3VQTA 3CTRA 5DLGA 4F02A 2XMUA 3VGVA 5LJ3Y 1CULA 2U1AA 1NHKL 1N6QA 3PIOQ 3UN5A 2N4CA 4MK7A 5DQGA 2C2OB 1LWCA 3MUTP 3BQ1A 4GVBA 2BDPA 3MR5A 1M5OC 3CIMA 3VAMA 1PAEX 1JWWA 1LWXA 2L3MA 2FHJD 2QZ8A 4LBHA 2VFUA 3MD3A 4Y65A 4CRJA 4O44A 1X4AA 3ZO7A 2F8HA 1NHVA 5K9FA 1RBLA 4P2XA 3CMES 1H0HB 1UW9A 2OP5A 5KFYA 2BJ8A 2AIRB 1RAIB 5LL6d 3NP5A 1PBUA 3JSMA 1U49A 1LWFB 2MHEA 2RD5C 2PO4A 3CDBA 3FZ2A 3MM8A 3NAHA 3JYTA 2XSJA 1V5IB 3HFKA 4OZ0A 2W7PA 3AOCA 2GMLA 3D0GE 5DZ7A 5F8GA 1NK7A 2YKOA 3EDQB 2O5DA 3KXDA 4LFAF 2VBYA 2F4VJ 1DTTA 2L9WA 4NLWA 4PXCA 2QL9B 3RG6A 3W65A 2QSWA 2A0FB 4KYZA 1IN0A 3DDIA 1KQFB 1N0UA 4E8UA 5K14A 1QLNA 4Q0BA 2AU0A 4OQJA 1F9HA 2QE5A 4QU7A 4FYVB 3T41A 2GQ2A 4OYWA 1JKHA 4ZDNA 3IWXA 2OFGX 2FGOA 4UW2A 4K4WA 1SJ1A 4B9TA 3HHLB 3ZTRA 4ZIWA 2FQQB 2WRMA 3CE8A 4FYYB 1F6TA 1ULRA 3SSQA 1MLAA 2NSBA 1QAIA 1A9NB 2CG8A 2FLLA 4ID8A 1N4LA 2BM0A 2PMHA 4OZ1A 4L3NA 3GFYA 3RRKA 1BE4A 2ACMA 1ZZFA 5B0AA 3CC7S 2WVCA 4RU2A 4PYDA 4RWWA 2HHQA 4NCAA 4WZMA 2Z4PA 2BM1A 2LDIA 2KT2A 3G8TA 1DBDA 2H4WB 5K5MA 1KVIA 3I56S 3JSMB 1NRKA 1VCTA 4C0OC 4HH0A 4G3IA 4B3RJ 1OSCA 3GFXA 5CD4H 2ROPA 4WP9A 4I56A 1JQGA 3VR1A 1WOSA 1U0SA 5KFIA 3WDOA 1P27B 2GHPA 2XHCA 4ZPDA 3A8EA 4BWMA 4BBYA 5F8JA 3SBMA 4LR9A 3RBXA 2LECA 1PCAA 3NNAA 3BDEA 4Y2MA 2RS2A 4ECRA 3NEKA 1S97A 3EYZA 3SI8A 5ETPA 2C28A 3EDRB 2YNIB 2ASJA 1R31A 4DN0A 1IR2A 2HQ3A 1RHMB 3EE3A 2HVHA 3DLKB 3NBPB 5J2QA 3ET6A 3KLGA 1ZS6A 4ILMA 3KJNB 1VDHA 2DR8A 4U67Q 3OTCA 2A2DA 5KG3A 3KOAA 2XBPA 1AFJA 4NLYA 4ZPBA 3RR8A 2KHDA 4JI6J 1YJTA 1JLAB 4FXWA 3MMJA 3V81B 3RB0A 5KFZA 4Q8FA 4I6AA 5EDWA 1LEOA 2DD8S 3BV8A 1FX4A 4NLSA 4NYZA 1S1WA 1NBEB 3KJFB 2YWWA 2RKIA 4ES3A 4LF2A 4Q2MA 4WKRA 4ANEA 4CO3A 3D5MA 3GFZA 4DV2J 3D2WA 4KBIA 1H2TZ 1RT6B 5HP1A 1Q8BA 3IXQA 1PSDA 3UWTA 3CC4S 3PFOA 3OTBA 1KLMA 1VISA 1IWAA 4OZJA 2GS8A 2BQUA 3HK2A 2MMYA 2F8EX 3G8SA 2XS5A 2NPFA 2X3DA 4KC5A 3ETOA 1M5HA 2CNLB 2UP1A 3TW0A 2W2PP 5ETVA 1KBRA 2EK6A 4H4OB 4MKBA 1VS3A 1RTJB 1IR0A 1Y0HA 2ACYA 2PGCA 2G9OA 4Q43A 3AJ1A 3PYEA 2LQ9A 2PD1A 2F9DA 1GTHA 3JQJA 4OYAA 3BBFA 5DS7A 1HBUB 1RAFB 3G86A 4UF4A 1F2GA 1WF1A 3HHDA 3MMBB 2JEIA 5HBMA 2OMOA 1RTHA 3Q8YA 3DI6A 5AXLA 2EXUA 4HT7A 3K59A 2IPOB 4ZITA 2VJVA 1I94F 3CCZA 3FZBA 4DPWA 3M7VA 4ZVHA 1EETB 1J2VA 2M3DA 4I2QA 4DU7A 5B7WA 4M94A 3MCOA 4K0KJ 3ADAC 3H4BA 4HH1A 3ZC4A 2HIYA 4ZKAA 5GMEA 2BJ1A 1NPPA 1EHWA 2VG5B 2G1HA 3N79A 2V68A 5KFVA 2HQDA 4ZHRA 5RUBA 2ZHBA 1IBMF 3CJQA 4CO1A 2OFHX 2VASA 3CJTA 3LGNA 4LSNA 4Q5VA 4A8MP 4OX9F 3RR7A 3MFHA 3IM8A 2AX0A 2KRRA 1PIEA 1SC1B 3IAM9 1R3NA 1NDCA 3OJUA 1YRXA 3D7SB 5B0FA 5HANA 2UZAA 3CCTA 1X31C 1VQSA 2QMXA 1Q81T 2FB0A 1TV6B 5K20B 2UVUA 3C16A 4A8OA 3KNAA 4LT6A 3M32B 1S1UB 2CQPA 2WB1D 3CDAA 3SDEB 5H9FJ 4LF1A 3PKYA 3HLUA 3KLEA 3CMAS 1Q95G 3C14A 2DIUA 4EYHB 1UZHA 4U7UK 3TJ8A 3P6YC 3MMBA 3JQMA 3TA2A 1ZA1B 2QV6A 2IDEA 4IFYB 4IRCA 1HWKA 2DGOA 1V9OA 3TVYA 1B4SA 1OO0B 2DK2A 3KDNA 1CS4B 2VBXA 4J9VA 3ZNJ1 1WC3A 3OPKA 3Q23A 1S99A 2KVIA 1IBLF 4DSJA 3THPA 1X0PA 2DO4A 1NJIT 2B9WA 2E5GA 1W7WA 3S1TA 3IG1A 3ZTPA 1NLKL 1RAEB 2IVMA 1H98A 4J9KA 4NA3A 3Q8RB 1UJ5A 3R5GA 4EFAC 2CRLA 3DN9A 1H2UX 1LW0A 3NOGA 2MKYA 3SFUA 4LMZA 1D09B 6FD1A 3HKWA 1QM9A 1VGYA 1HQEA 4PYAA 2E29A 1PC5A 1TV6A 4B02A 2XQCA 1WDDA 2OKQA 5L8RC 3MAHA 4USIA 5KT2A 3K58A 5JUMA 1PJ6A 1QY7A 1RABB 2G2ZA 3G8QA 4UTGA 4QWAA 1XNQF 1HBOB 4I6WA 4DV4F 1ZAVA 3QGPA 1KQKA 1XMQJ 5L38A 1SKSA 1HYSB 5SUHA 2HG4A 2E1PA 3IS9B 4WYLA 5DDQC 4WFAQ 1RISA 2VG6B 3I5CA 1B99A 2G0CA 5B08A 2V2VA 1KONA 3V5RA 3FEXB 1T03A 4C8YA 3VQSA 1NPKA 3ITHA 4F0HA 1A7GE 5K8NA 1P6TA 3PYFA 3TO8A 2MQMA 2N7YA 2IY5B 3I32A 2HLTA 1W25A 4WFXA 5BR8J 2XY5A 1RTDB 2M8DB 2J9DE 1V3ZA 2HQFA 1UMJA 3DC2A 1M1KT 2C3OA 4NEZA 5E0OA 2PI4A 4MFBB 2BKPA 2MKJA 3GPAA 1Y4ZB 4MIBA 1RAAB 1DTQB 2MZSA 4RW4A 3TOQA 2VFVA 3G71S 2F65A 1H74A 3PZPA 4CLUA 1NKBA 2HYIB 2Y1LB 3QSIA 3G2XA 5I3PA 1Q79A 3NKYA 4B9MA 4C9DA 2MZRA 2RUSA 2RQ4A 3W9HA 1FTRA 3CCMS 4JI5F 4YB5A 3FC9A 1MMNA 3CJ0A 4MIAA 3PX6A 2MHNA 1MSWD 2HHUA 4XK8C 5KFGA 4B9UA 3W1YC 4IH5A 4DQQA 3D0HE 3RTVA 2GVZA 4OL8A 4ICLA 3UD4P 1FNMA 2BQ3A 2HZAA 3T1YJ 4WFBQ 1L3VA 4I4BA 2D69A 2DNRA 2DNKA 2CNKB 3OR2B 5GVQA 2CUYA 3UN3A 1FDBA 2V6AA 3MEEB 4ZLNA 5DG8A 2I1RA 5C5JA 4A8YA 3PEJA 3HT0A 2XCAA 5H9EK 4NX9A 1LWCB 5CABA 1FXLA 2Q66A 1RXOB 4FKYA 2XEXA 3EVOA 1RA7A 2JHEA 2YWGA 3NCRA 5KG1A 4EO8A 2BE2B 2RU3A 1T03B 4FXDA 2CJXB 4XIUA 2CPFA 2B9EA 5IC4B 4ZVFA 1UWAA 1J5OB 2MLYA 3MXHP 1FJGF 2ZBCA 5H9EJ 1Y00A 2JH3A 1OWXA 4LF9F 2Y9HA 3PYGA 2ZE2B 5ETLA 1PYOB 1K47A 2W2MP 2YKMB 4DPYA 3Q0AA 2B8PA 3ISZA 4RL1A 5B0DA 2LP4A 5KOXA 2MGZB 4ED0A 4JI4J 1CPZA 2GHVC 2R8GA 4ZP8A 5KT5A 3W2WA 2W2QP 3HHKA 2HS0A 2VD3A 1WOPA 2DH7A 1TUWA 2EKNA 2HK3A 4R25A 1GT8A 1YSJA 5L9NA 4FS2A 3G6VA 2R7OA 1GK8A 4X4OA 4NXMJ 1V3SA 1U25A 4CIOA 4K5RA 2OTLS 3HVTB 1H7XA 1NB7A 4IG3B 1TFWA 2O01C 1SVDA 2E5JA 1UVLA 4M63A 1TTHB 3GCXP 1HQUA 3OFEA 1GH8A 3J7ZT 4PQAA 3G96A 3QYYA 1SL1A 1KKHA 2PIIA 2M9KA 1Q4RA 3IG1B 2XY7A 1I94J 3FSYA 3FVYA 1G1XA 1N5VA 1WJ9A 2G2OA 3NG8A 4CI0B 5D6GA 1SKUB 2MXYA 1TKZB 1J5EF 4AUKA 3M1VA 2CPIA 2IHR1 1LW0B 1EJ7L 2IRXA 4OYBA 3DGPB 3T1AA 3MR6A 3QZ8A 4K4YA 4DWIA 1W26A 3Q8SB 1OS5A 1XNRF 2CDRB 4C98A 5C2GA 4ALZA 4LF6F 5T14A 3OXFA 4DR2F 4F0MA 2KU7A 3JSYA 1CJKA 1N5YA 2HFVA 2CQHA 3QWUA 4JV1A 2Z0GA 3K7RA 2HK2A 5I3QA 3PACA 4P73A 3LQVA 2XGPA 4UOGA 1N54B 1DFDA 1SJQA 3HD1A 5HJYA 4IOBA 1T3NA 4ZCMA 4DR1J 4USJC 2UXDF 4F0KA 2VPXB 1N36J 4AD6A 2R2RA 3Q2SC 4WJBA 3T6JA 3QLHA 2C2EA 4ZVEA 4M5IA 4F2RA 4RNMA 1VQMS 1NJZA 2MKIA 3I4PA 5L9XA 2R7XA 1WKJA 3PM9A 3Q8UA 3DRRA 2RSQA 1VQ9S 2RT3A 3H90A 1ZM2A 5LSLA 2LU2A 2X1BA 1C1CA 1H73A 2OPRA 3P45B 3P8BB 3LTOA 4KH1B 1HBNB 4Y00A 3QBCA 5A6PA 4JBCA 2M88A 4DX7A 4QR0A 5L1LA 1SL0A 8ATCB 3H40A 2DJWA 1NKEA 3W8PA 4ZVUB 1SL2A 4RUHA 1FJGJ 2JEFA 4F4WA 3VAIA 1VLOA 1R8PA 1KHVA 2B5JB 5E41A 3KK3A 3D0IE 1U1OA 1UVNA 2DNNA 2ZWPA 2CQIA 1CJKB 4OX8A 2BE7D 3VV2B 2NREA 1FXDA 2G2YA 2QL7B 4USKA 5KG0A 5EWFA 2OIHA 4G1QB 4JI2F 1IKYA 3EGVA 4LSLB 1RGVA 3KK2B 2HFOA 3QJJA 4Y2CA 4ERDA 4WF9Q 4X66J 5FJ4A 2KRBA 3CJ3A 3PJXA 1WC4A 4DQRA 1YQHA 1EP4B 2AT1B 3N6LA 3Q83A 4FP9A 3AY0A 3D9BA 4PXEA 5E5NA 5H1SV 2ZH2A 5C25A 4GC6A 4MYUA 2VFRA 3I0RB 2W8KA 1N34F 3W3SA 3SFGA 2E7VA 1HNWJ 1JNRB 2MGZA 2D3OR 2FHKA 5IOLA 2RDJA 3TRGA 5HVGA 2KDOA 1HNZJ 4GMKA 2YKAA 2J6SA 4RX6A 4DR4J 2B8QA 2KFNA 2AWZA 3KLFA 1SXLA 2DHHA 1KFSA 1PKUA 3B54A 3M4XA 3K89A 2DNGA 5HBMB 3GG1A 2QLFB 4KSEB 3MAAA 1FRKA 4RW9A 4ZCIA 1L3TA 2FIUA 1U02A 2HHTA 4J9QA 1GNKA 3HHNB 2V67A 2E1CA 2JLFA 2KFYA 2R7QA 1S10A 2MB0B 3BSCA 5CQGA 4OZ2A 2ZVSA 1VK8A 4Y34A 2GJ2A 1T05A 1RSCA 5K8PA 4G1QA 3ENWA 2FJVA 2AYBA 4AL7A 3ZZRA 3KK2A 3CJ4A 1D9FA 2BBEA 3IMQJ 1FXRA 2JJ4D 2IA0A 4P2MA 3KHRA 1NDPA 1YJVA 3CNQP 2HVDA 3EPIA 4ID5A 2J7KA 1RP5A 1IQTA 3QFWA 4F7VA 2PMWA 5A2QY 1YIJS 4N56A 4ECSA 1NZAA 1WEZA 1H3DA 3R6LB 3VAKA 1SBRA 2HNZB 2P5VA 2AGQA 1Q86T 3KJVA 2XB2D 5KFRA 1D3WA 3MM8B 1WSRA 4J7CA 4DS4A 4CH0S 2DR5A 1VHFA 2BOPA 5LMNJ 2ZEJA 5KFBA 2Y1JA 1EKRA 1T3OA 3M8QB 2ZC4A 3R5JB 1N5YB 5DQIA 2BJ9A 2NXCA 1RJJA 5DDOC 3UQSA 4HACA 2SXLA 1JIHA 3LA0A 5A6WA 3PV8A 3MAAB 4OLPA 4XPEA 3SV4A 4ZVGA 1C1BA 1HW8A 1MU2B 1VK3A 4DV0J 3MEDB 1LQ9A 3H2LA 4DZDA 5L39A 2VOOA 4G1PA 4AYBD 3LP1A 2GIRA 3LF0A 3R2CJ 2DGVA 2OD6A 2X1AA 4ZPVR 2VV5A 1R8AA 3R7BB 1AUDA 2R7SA 2HWIA 1QD1A 1HNVA 2DNLA 4EEYA 1TU0B 3CCVS 2O66A 4AQYJ 3I96A 1NSPA 2CXEA 1TL7B 1BC6A 2A18A 2V69A 4NCGB 2HNDB 3IA0A 2Y0SD 4H54A 5ETTA 3OHBA 3DOMA 3W5YA 4OHVA 4Y3CA 3UW1A 9RUBA 1GQEA 4X4PA 4CQ1A 4YR2A 4EWTA 3MUVP 1RTIA 5BJRA 4A8KA 2X1GA 1RKIA 4AXJA 2H9ZA 4U6PA 1G4CA 2QMUB 2GW8A 1X9SA 1WG4A 1RT4A 1OQ3A 4M5JA 1IUJA 2VF3A 3CCUS 5J2MA 1RQ0A 3PHEA 5ETOA 4M5LA 5AXKA 4QIEA 5MLCV 5FLXY 2XLKA 5KFXA 1TP7A 4HACB 2F4FA 4FN5A 3MM6B 2YNFB 4XDCA 3NXZA 5DJBA 1HI8A 1UJ4A 1FWKA 1NDLA 1NJXA 2BYCA 1M5KC 3ITHB 4C3MA 1B64A 1EP4A 3FSXA 3BGRB 1S59A 2NPIA 2WVDA 3HVAA 4B3OA 2GIFA 2AEFA 2AJ0A 3TUZC 2B4PA 3W7BA 1W2BR 1HBMA 3MCMA 4O0NA 1JLCA 1NUEA 4I2PA 2E7XA 3OUYB 1PC4A 3A1YG 2BKNA 4QIGA 4RW4B 1UKUA 4KY3A 4Z37A 5AE2A 2CVIA 4WFZA 4FXVA 1TL7A 4C8MA 4RUAA 4B9VA 4CLYA 4FS1A 5GMDA 2CJ9A 2VBZA 1ZM9A 3DOMB 1U6ZA 5HMXA 5L1IA 2YKPA 4M1KA 1RTIB 4U96A 5IZHA 4A4JA 5IV4A 2FY1A 3BZQA 1F1BB 4KHRA 3MTKA 3WC2A 1SUQB 2YWEA 4QOTA 2DGWA 1RT6A 4M5GA 1UVMA 4KKOB 3SQOP 1YJNS 2G4BA 4NLGA 1RYRA 2I38A 2ADCA 1KNZA 3TJ9A 1WSVA 4LVOP 2CQDA 2XZDB 1QE1B 3AQOA 3CW2C 4NI2B 2B7CB 4X65J 1HNXF 3OL9A 3BH6B 4IDKB 1S6OA 2M7SA 3CJ5A 1JK9B 4YB7A 1OPZA 3CJ2A 2D9PA 1KD1T 3KJVB 1U1MA 2E9TA 1DJ0A 1UZDA 1FESA 4QJVA 1P9YA 4NLXA 1EB0A 1A0OB 3THTA 4RU9A 3K0JA 3J7YI 3HF5A 3MOZA 4CYUB 5M2RA 1S9FA 2J8AA 3Q8PB 2Z58B 3BYRA 4USWA 1U1NA 1XNRJ 2ZZTA 2HRTA 3ZTSA 3MGJA 3DI6B 4OMFG 2EI5A 1TMMA 4FPRA 3K57A 3DLJA 5LSOA 4IQMA 1YTYA 1MN9A 1UW4A 4IG3A 1F5AA 4DJBA 4DMZA 3GU0A 5HLFB 2DH9A 1X7VA 5A0YB 4A8SA 2UU9F 2ZBRA 2MKCA 3EWGA 4XTTA 2YX1A 2I9SA 2JVOA 3B4DA 2E9ZA 1NSQA 4DV2F 2WTFA 2YKQA 3LAMA 4HDGA 2D1CA 2V8GA 1JLBB 2UU9J 4O3OA 4J90A 4C8KA 3E2EA 1QE1A 2FVSA 1TL1B 4I64A 4TLRA 1IJFB 4DV4J 1XMQF 1SJ3P 1PO6A 5CHCB 1YITS 4X4QA 2EG1A 2KT5A 1E6VA 5G0RA 5KFNA 5D8HB 4LF5J 2KVQE 2FVCA 2HBYB 3ZZ0A 4Z2XA 5A8WA 1VC0A 3MMAA 3H2VE 2RH3A 2HURA 4KO0A 4PG5A 3W62A 1WTFA 2FPHX 2MZTA 2K1RB 2XO6A 1TKDA 1KS2A 3GE9A 2W9BA 2ZUAA 3FFIB 2YNFA 2BRLA 3V6DB 3O44A 4ED2A 2CADA 3OLBA 4GO5X 4FNHA 3R8YA 1SCJB 4K59A 2HHHJ 2C1EB 4DX8H 3US5A 1HWLA 1R0BG 3HHLC 2HBQB 2QLWA 1U4BA 1SC3B 5A0YA 3O3LA 4X84A 1DRZA 4HVZA 4OZNA 3TZXA 3UCZP 3DDKA 5K14B 1NM2A 4NLDA 3OUYA 4IG0B 1IM6A 2GO8A 4RW6A 1Q5YA 2W9CB 4NOHA 3MURP 4DPUA 3MR3A 4MK9A 4V19X 1I51B 4YUDA 4ED1A 4HHUA 1QAXA 4MIWA 1NK0A 1JLGA 2HZCA 4PWUA 3JQKA 3U02A 1CC8A 5MAOA 2IMWP 4LR8A 5G4DA 3VHQA 5KTQA 1QVFR 3DRPA 5A2QU 1HNZF 2H51B 1N5SA 4C7QA 1C4CA 2UV8A 1D9DA 3CCJS 3CJKB 2HGLA 1X5PA 3UDLA 3T19A 3GV7B 3OTOF 2RMLA 2IIHA 2KN4A 4Z7YA 1FKOA 4HI1A 2DITA 4KKOA 5HSPA 3TEGA 4MKYA 5E3QA 4ER8A 3IWNC 1O51A 3MECB 1IKYB 4LSLA 4PWWA 3GR1A 2KI2A 2W4PA 2KHCA 4E2FB 4TU8A 2XC9A 2IVYA 2Q6BA 3L7PA 4JV0A 4EBEA 1GEHA 1BQMB 3GJTB 4Q7AA 1KQGB 1VRQC 1VR6A 4QWEA 3T5KA 4N47A 1HNXJ 3OR1B 2MYFA 1YJRA 2LXUA 5C25B 5IM0A 5I42A 2VQFF 4KHMA 5F8IA 1VQKS 2FZGB 3I0RA 1Y3JA 3AODA 1DLOA 2P2CB 5CYMA 4ZVTB 2MPUA 4EI2A 4B3MJ 4TQRA 4M95A 2OGUA 3R5AA 2CQ2A 1TL3A 2YX4A 4HT5A 3UVJB 1S72S 2CKWA 1GAOA 2QA1A 3EGZA 1UEVA 2BACA 5BXIA 2F3JA 4ZLJA 1X4DA 3O2IA 3A3OB 1N5QA 2DY1A 2AMCB 2RF2A 4I1TA 4I7FA 4F8RA 4IRDA 1H72C 3J81j 1XWLA 1F9EB 5FIIA 4USMA 3DRPB 3POTA 4WXWA 2VC0A 2VKRA 2WHOA 4ZS6A 1TFYA 3UE2A 1PILA 1NK9A 3ILJA 3PCOB 5JVHQ 3ZZOA 2XI2A 2HBZB 5I3UB 1ZYQA 4DUTA 1R6VA 2J5AA 3HULA 1VIOA 2KO1A 3PRBA 2Q6CA 3JTNA 3PIPQ 1L3UA 1N8RT 3BEGB 4A48A 4C2MA 2ZM6J 3N6MA 3QGGA 4JI0J 1KEKA 4ETXA 2POKA 2AP6A 1LKZA 2JZ5A 1JB0C 4HDHA 4ID5B 4P2FA 3RAMA 2GFFA 2VKZG 3SSRA 2RQKA 1GTEA 3HHEA 2XO7A 4DUZJ 1K9MT 2EFVA 2B43A 3I0SA 1S77D 4ZP6A 5G0RB 5B09A 2OJ3A 2ZE2A 2ZHOA 3VGSA 1HMVB 1Q7LB 4NLQA 1Y3KA 4Y2KA 5CCLA 1SC4B 4LUBA 4DV7J 2BX6A 2MSTA 3DLEA 4OYMA 5HVHA 3Q22A 4ELUA 1S7HA 3LANA 3FCWA 3J80U 3W2WB 1F5CA 4KO0B 4ZK7M 2VHGA 1FT8A 1L3SA 1FX2A 1BQXA 2CPZA 1CC7A 4O3PA 3HKZD 3TQEA 6AT1B 3MPWA 4G6VB 4I67A 3M30A 1LW2A 2JVRA 3AHPA 2ROEA 4DFKA 2DCLA 3POTB 1UVKA 2D7SA 3Q8VA 3WIVA 3OV7A 1C1BB 1MU2A 4CLWA 3PHTA 1MNEA 4D3GA 5I4MA 5LSRA 3M8PA 4U8YA 4DN9A 2KM8C 3D3CJ 1XMBA 2V0NA 5KFLA 4ECZA 3UDEA 1UEKA 3TA0A 4RZRA 2J6UA 3G6YA 5CYQA 3VTIA 1MN7A 2XHWA 3C6UA 5HMZA 3EICA 5L46A 3SQGA 3NCQA 4ZMMA 2YXLA 5IWAJ 2W4DA 3OTEA 5HATA 3J81U 2FVPA 4JI3J 3KYLA 1S7IA 2CZVC 4B08A 2WSCC 4NL5A 2ZH4A 2W8LA 2H5IB 3EX7B 2DIVA 2QX0A 2JSXA 3C8YA 4KAIA 1NK8A 1CJTB 3TZYA 2UUCJ 2YQ1A 2HHXA 3SXLA 3IC1A 5J1EA 2DR9A 2YH1A 5A8KB 4DF4A 2UXCJ 4FVCA 1WUUA 2FZCB 2IJRA 3PFEA 5DM6Q 1QDUB 4X4RA 2RE1A 4CH1A 3C2PA 1PG5B 4PZVA 1NCLA 3X1LB 1BXNA 2GIQA 2RDIA 3BJYA 2ZBQA 4WXOA 3C6TB 4ZVRB 3PTWA 3UDVA 4F36A 5F8MA 4QWCA 2KG0A 3K17A 2BANA 3CDUA 5JVGQ 4JI7J 2JC1A 2NS1B 3MR2A 1FD2A 4FPIA 3W8GA 1BHNA 3BGOP 1KFDA 4NCBA 1IBLJ 2FC9A 2CG4A 2KYXA 3ZZPA 2JFKA 3LWMA 1R6YA 3IBWA 1IXKA 5F0WA 3EZ5A 2FTRA 1I3OB 1TK0A 3MCNA 2QEXS 3PW2A 2HZVA 3WHIA 4UT4A 4A46A 2R7RA 1DLOB 3GYNA 3GZ7A 4CH7A 4DV6J 3AB4B 2MY8A 4DR3J 1U8SA 1VFJA 2DNOA 2QLJB 4ECWA 2N4DA 1ELOA 2MY7A 4QWBA 3GG0A 3M2RA 3G4SS 2DVIA 4M5MA 4ZPAA 5AXNA 2H54B 2YWFA 1VBZA 3DHWC 3PR4A 5LMNF 2LEBA 3ZZZA 2FC8A 4Q2LA 4KFBB 3T5JA 2KZMA 4BC9A 3M2UB 4PPDA 3D4JA 3UCGA 2Z2ZA 4WTOB 2Z2MA 3J7Z5 1S0VA 1GMWD 1DAXA 3L9ZA 4LQ9A 4DBQA 2IRYA 2OELA 2KXHA 2JL9A 3G6ES 2DHXA 3TA1A 1NDKA 1IKXB 4C8NA 3EXCX 3NMAA 1UCNA 4PG8A 3JTOA 2OLWA 2BXJA 2LA4A 2P6TA 2ZOFA 1SKRA 1X4HA 2E1MC 3DOLA 3KG1A 2HQGA 4IH6A 1K8AT 1HNWF 3BBCA 3L4BC 3OFGA 4YHHJ 2EFQA 2GMJA 2VG6A 3ENAA 2E5IA 4I68A 2LQ5A 1IR1A 4R0JA 2OEJA 1S9GA 3NGUA 2PSZA 3AD7C 2L41A 1G3OA 3VAFA 4QIVA 1R0AB 3JXOA 3LP0A 1F2HA 2IJFA 3BKFA 8RUCA 2V5HG 2NYHA 4GVLA 3RB3A 4DOZA 1FF2A 2E66A 4CZCA 4BDPA 1JJCB 4KV8B 1NEEA 1YK9A 4C11A 1NK6A 4YB6A 1F9FA 5CCMA 1BGXT 3VGUA 3VALA 3RB6A 2AYGA 1P9QC 2CNOB 2ZITA 4N8NA 5HAOA 4FF1A 5CXTA 1FJ7A 3JB9k 3M8PB 1TKTB 2ZBPA 1FVQA 4P10A 1ZM3A 2KXNB 1WHYA 2ZJRQ 2R8JA 3MF5A 2ZH1A 5IT0A 1OY6A 4ECUA 1URNA 3I9ZA 1T05B 1MMLA 5HQMA 1SC6A 2F40A 4WP8A 4LR7A 2AJ2A 2ZNZA 5EUHA 5B0BA 2R4FA 3GIMA 2CPDA 3N4WA 2AF6A 4L74A 4A8QA 1RLDA 5IWAF 1QSYA 4JI3F 3DGVA 2YY3A 1FKPA 3TVZA 1M0SA 2W24A 2E44A 4DV3J 2HWTA 2RQCA 3OSPA 2I8EA 1FNXH 3IAS9 3KWMA 4ZPCA 3W5ZA 3FEYB 2AV5A 4PXDA 3DLGB 2XI3A 2HRYA 1X4BA 3E3XA 1O0PA 1TMJA 4UZCA 1LXNA 5LXYA 1M5VC 2JX2A 4K7QA 4CLZA 1KDNA 3AOBA 3TR5A 3PR5B 1KOOA 3N9UC 2VA3A 1S57A 1M1GA 1X4GA 3W9IA 4X62J 5KFUA 1VI7A 4OJ1A 2MDAA 2IM2A 3PO5A 1TAQA 2VFTA 1WHVA 5T7LA 3UR3C 4NZ6A 4DPTA 2VJUA 4H4MA 3C46A 4V1Ak 1VMBA 3FEZA 4OJ3A 4DCOB 1FK9B 2OI2A 2XMTA 1FHTA 3GP9A 1LK7A 1REVB 1OSDA 2QA4S 1D0EA 3D6FB 3MEDA 4KGKA 1V5VA 3J7AN 1EKSA 2AX1A 2EG2A 3A13A 5D77A 4MJKA 1X8DA 3MUMP 2FJXA 3ZFVA 4ECTA 2H5JB 4B3SJ 2GO9A 1GXUA 2LU1A 2OPPA 1ZPVA 3T9ZA 3J80Y 2M52A 4QPXA 3Q8QB 2DRBA 4QCLA 3QO9A 4KT0C 4NA2A 3K2YA 5HROA 2UUWA 3MMCB 2ZKUA 4TXSA 1EETA 1FRLA 4QZVB 4FYDA 1FKPB 2DGQA 1UTAA 4EO6A 1RLCL 4OI1A 3SV3A 4X64J 3QRPA 1GXTA 4CLLA 1U1LA 2V94A 3W60A 2VG5A 2WSEC 2V2KA 2X1FA 4X4NA 2C2ZB 3A4TA 2CPXA 1Q8IA 4KFBA 1U0HB 3DCAA 4HR2A 4P9SA 1VJQA 3O5TB 4A47A 3BO3A 1U7LA 2OPSA 3DM2A 4DHVA 1B3TA 2NUUG 2B3TB 1RI7A 1SH2A 2V8VA 2V4JB 4DUYF 1VRUA 2BOAA 2CQ3A 3GR0A 1DY3A 4RNHA 5D4PA 2E1RA 1G6BA 4LIRA 4OJGA 3RGIA 4CO2A 4LRCA 4DG1B 5T41A 3IRXA 1N34J 2AJQA 2HFSA 2XYGB 5C24B 1QTMA 2HMIA 1VQLS 4PUOA 3HD2A 3FRYA 4DR6J 2DH8A 2CDQA 3NAIA 1S0MA 4FNIA 1UVIA 3D54A 1AA1B 2P9GA 2YNGB 3VZHA 2XULA 4ILRA 4IFYA 1P8GA 2W2NP 1FRJA 3T1YF 2N82B 2LEPA 5E3CA 2J0XA 4YFUA 4IOCQ 2Y8YA 3GYXB 1K1QA 3N28A 4WP3A 2FJEB 2JEGA 5HJXA 4Q8EA 2CPEA 2P9EA 1JLFA 3I6PA 3QLHB 2MLXA 3ICLA 1NZ8A 1RWKB 1TL4A 3ILOA 1GMWA 1XIQA 3GB0A 4MT1A 2PFDA 2NZ4A 2RJZA 1BY9A 1I1GA 4WPAA 5IFMA 2MKSA 3Q24A 4L76A 1U1PA 2H1YA 5ETSA 2J7WA 4JOUA 2XMKA 4OI6A 4IFVA 4DU8A 3S8SA 2GMHA 4ECXA 3QNWB 3T5HA 4C8LA 4F2SA 3T1HJ 2NXUA 1X9WA 3BDPA 4YDXA 2FHMA 3NMRA 4J9OA 5DDRC 2FLNA 3MCSA 1YG0A 4WIIA 4Q44A 4JI8J 2ZHAA 3KK3B 1T9XA 1VQ6S 4PG6A 1T9WA 2JLEA 4OHZA 3CXCR 2GQCA 2HMIB 3MM5A 1HYSA 4C8ZA 5KFWA 1CULB 3CT9A 4ZVSB 3L7OA 2KT3A 1Q8KA 3BSAA 2ZJQQ 5D3GB 1Q7YT 5KG6A 3IS9A 2R3VA 4LRBA 1AUSL 4RUBA 1H38A 3KMQA 3AOAA 4KIAA 3VGTA 4JV5J 4WCEQ 2GZOA 5BYSA 2YNIA 2ZUGA 3KTQA 2BJ3A 2GHWA 4JP8A 4NPOA 4OV1A 3I31A 5ITHA 4KJIA 4O44B 4CYUA 3KDOA 4JB8B 1GX6A 2ZOGA 1SJRA 4ENOA 4DPXA 2C2NA 2GAHC 5DQHA 1LXJA 4DV1F 1KSPA 4PWDA 2PFFB 1QUVA 3OVBA 1G7CB 1T9YA 4W4MA 2E5LF 3NWRA 3PJWA 4WIQA 4WZQA 1T9UA 3MWBA 1U2CA 4USUA 5L1KA 1VLYA 2VB6A 4OX9J 2V9KA 3M2VB 1QSSA 3G9CA 1JXEA 2IM3A 3CVKA 1XJWB 2ASYA 2LQ8A 4DL0C 3CC2S 4DV1J 4K4UA 1OY9A 2CQBA 2HS3A 2YQ0A 3SZ2A 1X5OA 1RE1B 4N7TA 3QRRA 5FDLA 4IYQA 2OPPB 4LFBF 3G87A 2UV8G 1X5SA 4FYWB 2HNYA 2GQQA 2EWHA 3SCJE 3K8WA 3MMCA 3WX8A 4LRAA 2ZD1B 4C48A 4N8OA 3MM5B 1NK4A 4CO5A 3DHXA 3IR7B 5D3GA 4WTYA 3PW0A 1KLMB 4RR5A 4AE5A 2HHWA 4ZPTR 3TAMB 3KUEA 3B82A 3LO3A 5KFTA 1B7YB 4ZOSA 1ITPA 2GGPB 5A8WB 1IM4A 2VZ9A 3PEHA 5B0CA 1GMUA 2ZC3A 2OPQA 4LJMA 1RTJA 2R8HA 4TY9A 2XCPA 2CQ4A 4TY8A 2YKMA 3WBZA 2PEBA 3FFIA 2N3LA 2XS2A 2DNMA 2O1PA 4NWBA 4QR1A 5C24A 3U1LA 1KTQA 2Q43A 3G82B 4NEYA 3M8RA 4I69A 4IO9Q 4HTIA 4O3SA 4QQBA 2K7JA 1HBUA 4X62F 4E0DA 4UY85 4A8XA 1NPRA 4F4KA 1PYTA 5GAGU 1JJHA 3DDNA 2HRUA 3RW7A 3H8YA 2B4UA 2YNGA 3JSRA 4DR5F 4KGZB 4J9LA 2BQRA 5KFSA 2ZBIA 4KH0B 3H7HB 2UUTA 3QFHA 1K73T 2OSRA 2XMJA 4B3TJ 3NCPA 2KJWA 2V8PA 3MPUB 1YRTA 3CUNA 1WELA 4QIWD 4DFMA 1SJFA 1HQUB 3EM1A 3MM9A 4YOEA 2DNYA 1UVJA 3N0VA 3J7A1 4YR3A 3AFGA 1UWBB 3CCSS 3DXBA 3VAJA 4H4KA 4R5PB 2H4YB 3ILLA 3KLVA 4QYZK 2DR7A 3UN2A 2ZDPA 1RT2B 5D0EA 2B4VA 4P2SA 1S48A 4UUXA 3HX9A 1IJEB 1C0UB 1TVRA 3ZZUA 4IR1A 5LOQA 2MZ1A 2E5HA 1WNEA 3N5FA 4EBCA 1KLNA 2PDAA 2EBEA 1HKAA 3TEHB 4ZJLA 3GONA 2GAGC 4WE1A 4PQUB 3P96A 2DHAA 2KKHA 1PJ7A 2HBRB 3M6XA 1HARA 1WHWA 2HAIA 3FK4A 4YS2A 3T6BA 3FBFA 3LWLA 3T9NA 4M8LA 1RT1B 3KHHA 4ZVPB 1BQNA 2WONA 3ISNC 3KG4A 5CYMB 2OH2A 1S9GB 4YR0A 2MQLA 4FF3A 4PXBA 4LFBJ 2EFNA 3FBCA 1F3FA 2J9EA 3W66A 4DR6F 1FRIA 2M0GB 1YVFA 3A12A 3K5MA 2UUBF 1VYAA 2QGFB 3VAGA 2KL8A 3U27A 1ZTWA 1LNQA 1SB6A 1Q0NA 2QA4G 5F3ZA 4MMOA 3HM9A 2DTJA 3M2VA 4P6QA 1S1XA 2GX8A 2OPRB 3IGVA 1EQMA 3RYLA 3CSKA 2X3GA 3CPWR 2FD2A 5BR8F 4JI4F 5HN0A 5FDLB 4ZCKA 5A76A 1HR0F 3C3LA 4DR7J 5BYRA 1CBKA 3DXSX 1X0FA 2B5JA 2DGXA 1TUGB 2I2YA 5F8NA 2C22A 4I2QB 2IAJA 2VUGA 4NYOA 1AB8A 1NSKL 2V2QA 3CO9A 3VF0B 1SUQA 1HA1A 5GADU 3FBEA 2H48B 2RILA 3IR5B 4YMEA 4YB1P 2DXFA 4LRDA 1PAUB 3LOUA 3Q89A 5DETA 4W92B 1YBAA 1GFWB 4ZVQB 1VC5A 5KFKA 3EGNA 1RT1A 3H5SA 3KNGA 3A8JA 3K5LA 4LF7F 1AW0A 4LSNB 3DLEB 2GVDB 4DR5J 1FFGB 3P3DA 4NLOA 2D9OA 3D6TB 3R9LA 4DZ6A 2YNHB 3AA8A 4RNOA 4J9SA 4URSA 2FJDB 2OPQB 3BN7A 5JXSA 1S79A 4ZJQA 2R7TA 1T7PA 1WKLA 3GIIA 2XYHB 1REGX 2FZKB 2C3PA 2UVRA 4O3RA 2CJBA 1ZETA 2RHQB 3CJRA 3UO0A 4TU7A 5GAEI 3C16B 1LW2B 4LBIA 4LF4F 1ZPWX 1R27B 1AT1B 1Y10A 1WI8A 1KTVA 4F4ZA 1XR7A 1FD8A 3P5BP 2AD9A 5E7OB 4K2XA 3KG0A 2M2BA 3GCWP 4S0MA 2EFPA 1TZ0A 5KT7A 3PX4A 3NS6A 3RBEA 2DHGA 2RDDA 5D78A 4X4UA 5DM7Q 1NSAA 5GADI 1VBYA 2JLGA 1JJ4A 3ISND 1HW9A 3NOCA 2L08A 4MAKA 4YHHF 2JDJA 1MG7A 1T94A 3A8IA 1ROFA 5KG2A 1N36F 1WC1A 1CQNA 3OR2A 3THVA 3VWSA 2VDHA 4P74A 4LREA 1UETA 1CJTA 4ATNA 1VQ4S 1HI1A 3QT8A 4J5OA 5J1EB 3MOJB 1RWUA 2BVZA 3D6MB 2F8MA 1N0VC 2F9JA 3CB4A 2QO3A 4N77A 2J6TA 4O3QA 1TL1A 5DG9A 3UCUP 4H4OA 4LFAJ 2F4VF 5AXMA 2AJ1A 2V34A 2BMBA 2B9YA 3DRXA 6FDRA 5J1PA 2HNZA 3UPFA 3UD3P 1T02A 5DLFA 3U1NA 2P8IA 4PQUA 1YHQS 2M5YA 4WWSA 2AEMA 2BUNA 3SSSA 5C42B 2YQ3A 4HLBA 2HKEA 2EFOA 2QFIA 3FCHA 3QGIA 4NYPA 4F26A 3QMQA 3PW4A 4F67A 4C0BA 3QT7A 3VAHA 4TYAA 2W9BB 3H5UA 1RTHB 3DNCA 4DV3F 1UP1A 3V2UC 3SMZA 4TVAB 3QSYB 1PBAA 1RKJA 3HVTA 4QW8A 1UFKA 2HWHA 5ETQA 2HGMA 5GAGI 4LFCF 2OEMA 4OLOA 4XAKA 4NASA 1UAWA 1KHWA 2ADBA 1RTDA 3HO1A 2QN6B 1DARA 3KFWX 5CZVA 1RTZA 2HLUA 2Z57B 3RJMB 5J2PB 4ECYA 5KAKA 2FJAB 2QRRA 4IG0A 1NB2A 4R0EA 2MQNA 4RW6B 5KT4A 2ZH8A 2W9CA 3H42A 3I5BA 5AE3A 1GX5A 1S1XB 1XN9A 2QYCA 4OYPA 3HMJG 2CAJA 1H7WA 2K06A 2H65B 2NZCA 4O0IA 4NLUA 3PJ9A 4TKTA 1KOHA 3BM7A 2D3ZA 3PNIA 2BZ2A 2OO4A 5LT5A 3CCES 1FKAF 1K0VA 2HVIA 2KZZA 3FGVA 4H4KC
chains in the Genus database with same CATH topology
3CCLS 4L72B 3BQ0A 2WOMB 3KLIA 2AGOA 4ICLB 4LQ3A 3FQKA 2V4QA 1KQSR 2O67A 5J1NA 4DSEA 2IRUA 3LP2B 4WYWA 4TU9A 4ZP7A 5F0UA 5F9LA 4NLRA 5KFJA 4RKUC 2ERRA 2ABYA 1S6QA 2VC1A 2COLA 5DG7A 4RNFA 5B0EA 2R8KA 2CYYA 2YNHA 3LP0B 1Q1KA 1Q16B 2GV1A 3DMJB 2I5JA 1B7FA 2X51A 2IJNA 3FMBA 3UI3A 2RUGA 5I42B 4DL2A 1VC6A 1KN6A 1N5TA 3D28A 2RRNA 2CPYA 1JLEA 2U2FA 3NNHA 1C1CB 1IKVB 3S01A 4LF5F 1HBNA 3FNNA 2A1BA 2MKKA 1FCAA 5AJ3F 3NGDA 2LXIA 2PA8D 3IRWP 1C0TA 4LF8F 2HNYB 3UDCA 1VQ8S 4EZ9A 2L48A 2UXCF 2CVEA 2ZZNA 3V4MA 2KG1A 2APOA 1S9EB 1TUVA 3GV8B 1Y5IB 3TI0A 1S1TB 3HVRA 4Y6IA 2VL1A 2W9AA 1D8YA 1IBKF 3E01A 3TAQA 5M2PA 1X4FA 4DV0F 1NKBA 3KLHB 2VODA 4MH8A 4NMLA 4PPZA 4AL6A 5M2UA 1JNZB 3BO4A 4FF3A 4ED7A 4NXMF 2DNPA 3DMJA 4IDKA 3K5NA 4O4RA 2LEAA 2DGTA 3VZIA 1DQAA 4JI6F 1XR5A 1NH8A 5KT6A 1R7IA 4ED6A 1YJ9S 3T1HF 1VBXA 4F25A 2BJDA 3M32A 3VCDA 1MMDA 1XK8A 1FE0A 1JLEB 2JC0A 4YY3F 4BS2A 1A6LA 1IKVA 3R27A 2NUHA 2QMWA 4M5DB 4C0HA 4XO0A 4WK1A 3DRYA 5ADZA 1B0VA 4X64F 4NRTA 4Y28C 4ZP9A 1TL5A 1YJUA 3EXYA 1RT7A 3LGMA 4DUZF 2YX7A 4FF4A 4U9RA 2QT7A 3J81Y 3MM9B 2EW9A 4QPTA 1S9EA 4Y0FA 2B7BB 2CZ4A 3MEEA 3AQPA 3GQCA 4R5PA 3G6XA 3SQGB 1P1TA 2YH0A 3BGUA 1WTBA 1RT2A 4TLQA 3R5BA 2A2CA 2MJUA 4FZVA 4XDDA 1VRUB 2FHOB 2HFNA 4DG1A 1APSA 4O4GB 3O6QA 3QGHA 3C66A 2WAQD 3DRSB 4TYBA 1S0NA 1HBOA 2DPJA 3D1HA 3MPYA 2K1RA 4BC7A 4EGLA 2ZFHA 3TARA 4DS5A 1FERA 4CTAA 2FUG9 5DO2A 3HT3A 4QW9A 3GFHA 3GSDA 4OHWA 4OX7A 3EZUA 4F3QA 3GILA 1S6QB 1XERA 1U47A 2Q66A 4LMZA 4K4ZA 3BB5A 1QAJA 4GKKF 2WBMA 1RT7B 2ASDA 1JXLA 3TVKA 2M4MA 2ZM6F 1HWIA 3LUYA 1Q78A 3CF5Q 1E6YA 3BS9A 4RW7B 4AL5A 2RIJA 3HVWA 4F50A 1FNOA 3QJPA 2DNQA 4HL9A 4DEZA 1FE4A 5HL7Q 2VPWB 3M05A 1X4CA 3M2RB 2M8HA 4R8UB 1S6PA 3CDEA 1QSLA 3M9OB 4HKQA 5JJBA 3EUNA 2ZH5A 2ZNYA 1NJYA 2UVWA 1S1WB 4OHXA 1ZZNA 3IO1A 3DRSA 2IAJB 1XR6A 3DOKB 2AGPA 3W2VA 4JV5F 2HW3A 3MEGB 1SV5B 2NLWA 4CTAB 1H6KX 4UQGA 2C2DA 3MM6A 2IYGA 3DLBA 5D4LA 5HQ8A 3KLHA 1X4EA 2PN6A 3QJLA 2BE2A 3PW5A 4OI2A 3PKMA 1TKXA 2HHPA 1CEZA 5E2QA 2LLZA 3HDSA 5IT9Y 2DISA 2HIQA 3OR1A 2EKYA 1F60B 4PWDB 3AB2B 4JI8F 4I2PB 5IXUA 3D1QA 4YP3A 2WK4A 3ULHA 3OSNA 4BCAA 5KG7A 2XMVA 4AFFA 2R7VA 2GCFA 4DDFA 4GKJF 7FDRA 2JEJA 4PR6A 1JX4A 3R5CA 4LVNP 1F0XA 4L6V3 1HD1A 2VONA 3S7RA 2ALZA 4ZA1A 1IKWA 4I6YA 2XZWA 3K8VA 5KFDA 4MK8A 1L5UA 1BWEA 2EPIA 2MQQA 4B9SA 4EZ6A 1RA6A 4JUZA 1NKCA 3TANA 5K8MA 5KFCA 2J76E 3CWJA 3S6EA 5LMUF 2RRAA 2K2PA 5DGAA 3CD7A 3N01A 2GGPA 3DU5A 1RT5B 1VQ7S 2HNDA 4K4TA 2CJKA 3M1VB 1XTZA 2ZDOA 3NS5A 4QR2A 5GAEU 3CD6S 4X2BA 2N7CA 1P1LA 3AH6A 5E3PA 3CDWA 1YRUA 5KFHA 1HNIB 3EGWB 1URRA 2CJQA 4KQZA 1RT4B 1U1QA 5C42B 1LWEA 4KR0B 2VH7A 2VBWA 2EK1A 3KKFA 1IQZA 3H2UB 1VQPS 3I82A 2OD4A 3LAKA 4WFNQ 3GIKA 1CSJA 1FK9A 1WHXA 3CEDA 3OTDA 2RVJA 3AAWB 7FD1A 2VQEF 1REVA 2XMMA 3RRGA 4OI0A 4C4WA 3BGRA 1B0PA 4CNYA 3MI7X 4RBVA 1HL6A 1NAQA 3WX4A 1ZM4A 4IUFA 4B3OB 4TQSA 3IWLA 3OL8A 4W90B 1YI2S 1B0TA 2C3YA 4RW7A 2MZJA 2IA6A 4IH7A 3JAMY 2D41A 3QO9B 4DSFA 2FLPA 3CD0A 3DRRB 1NHUA 4FVMA 1MROA 2V9WA 3KK1B 2V8HA 1E6VB 1RAJA 1SQEA 2OSQA 1RT3B 1SH3A 3MM7A 3F44A 3H20A 2C3MA 1Z4UA 4CCHA 4WE1B 4X4VA 5KFAA 5IQQA 4DR4F 2HS4A 3DOKA 4N76A 1M90T 3LP2A 3M8QA 3LH2S 1DQ8A 1O8BA 4C3KA 2BANB 5KT3A 1DZ5A 3DLLQ 3HP6A 3V6DA 4K0KF 1BQNB 2WONB 1VOMA 4YEAA 4JI0F 4C3LA 3T5LA 2ASLA 3MDFA 3LP1B 4B3TF 1HHTP 3TUJC 4NLTA 3OBIA 4F3MA 1WEYA 1R8CA 1UFLA 2HPUA 2R9LA 2FDNA 2P6SA 4ITSA 1SI9A 5CZXA 1DTQA 2NR0A 4ETZA 1NNDA 4IKAA 2M70A 5DRKA 4O23A 5THWA 1FO1A 4OX6A 3KK1A 1JLAA 2HVZA 4DFJA 2AW0A 2D74B 4QYRA 3HXMA 2O3DA 1RT3A 3MM7B 4JV2A 5EN1A 2ZOMA 3HZGA 1IKWB 2OTJS 1L3KA 1HPZB 2FJWA 3F56A 2HHSA 5F3TA 4WKYA 5A8RB 1SIWB 1VQOS 3TQ1A 2IYIA 2ROGA 2DO0A 3JSBA 5GAHI 1U09A 2E1AA 1R89A 3OVAA 2VFSA 1D1UA 4NZ7A 3WZ0A 5DDPC 2W4CA 1FEHA 2N3OA 1RT5A 4CO4A 5EX0A 1MWZA 3IN5A 4KPYA 1NK5A 4DR7F 2HFZA 5KFOA 2RS8A 2ZKTA 4HYKA 1JLCB 2DGUA 3H98A 5B0GA 1HNIA 4EBDA 2ZZMA 2R7UA 2EC0A 1WG1A 1V6HA 3D1OA 5EWGA 2KJVA 1TL3B 3FJ2A 3R1HA 1R0AA 4YQWA 1XC9A 5C42A 5F8HA 4A8FA 3FRZA 3PW7A 2LKZA 2VPYB 4C11B 3K5OA 1VQ5S 4C8OA 2IFXA 2V8DA 2RU9A 1R8HA 1T8EA 2JOQA 3GWCA 3RZAA 2BW2A 4NA1A 3TUIC 3OW2R 3CGIA 1TKTA 3MAQA 5KFEA 2DBBA 4ZPWR 3NL0A 4AXIA 5I3UA 4KGMA 1X9MA 3H4DA 1N48A 4JI1F 4IOAQ 2DGSA 1HD0A 4NLPA 5KOWA 3ZZYA 2PC6A 1FTCA 3IR6B 1S76D 2QSFA 3OFHA 3QWPA 2C2RA 3L09A 4NCGA 1TKZA 1K1SA 1SJ4P 2FVRA 2J0QD 3CC7S 1VRTB 2KM8B 4ES2A 2ZH6A 1N6QB 4WK3A 2QLXA 3DGPA 3H5YA 2CIMA 2XLJA 2HHHF 4IRKA 2MQPA 3TAMA 1VQNS 2YWHA 1Y5LB 4DQSA 1WACA 3I9V9 3KLEB 1FDNA 3PRDA 1N52B 5EWEA 2UUAF 1FDAA 1FKOB 2UXBF 3RU0A 5AE1A 4OZLA 4RBTA 3K5PA 1CLFA 4IR9A 3JYTB 1U1RA 3Q2TC 2XSFA 2XSJB 5HO4A 5L1JA 4AQYF 1UA1A 5GAHU 4X4SA 2XLIA 5U47A 4OHYA 1JJ2R 1FRHA 3U7JA 2C42A 2IBOA 1D9AA 5D4NA 1DHMA 4UOCA 4J9NA