2KVIA

Structure of nab3 rrm
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
PKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFGKKLILEVSSSNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear polyadenylated RNA-binding protein 3
publication title Solution structure and RNA-binding study of RNA-recognition motif of Nab3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kviA00
4IUFA 2ZJRQ 1X4EA 2E5HA 2N7CA 2AYEA 3EGNA 2KRBA 1N8RT 3CC7S 2DO4A 2J76E 2M70A 3B4MA 2MKJA 1KOOA 1R8PA 1QVFR 1SJQA 1U2FA 1VQPS 4F02A 1VQNS 1WEZA 5LSLA 4UY8T 4WFNQ 4WCEQ 2V94A 3R1LA 1X4BA 2QFJA 1RK8A 1OWXA 1X4CA 1U6BA 3UCUP 2FHOB 1DBDA 5IQQA 1FHTA 3VAIA 2X1FA 1UW4A 2DHXA 1RKJA 1U6FA 1S72S 5DDOC 2M2BA 4TLQA 2LEAA 2D3OR 3ULHA 3G4SS 1Q7YT 1WHWA 3CMAS 2OTLS 3UD4P 1CVJA 2KXHA 5LSOA 1U1LA 3VAMA 3UD3P 1X4GA 5D78A 1X5SA 5HO4A 2ADCA 1OPIA 2MMYA 5GADU 2LXUA 3N9UC 1Q81T 2DIVA 2CQHA 2DHGA 1M5PC 2ERRA 1YITS 1P27B 3S8SA 2DNQA 3CCVS 2KT5A 3CD6S 2MGZA 4LIRA 1YJWS 1FJ7A 2MKCA 1SXLA 1XN9A 4U67Q 5FJ4A 2MJUA 2MKKA 1FNXH 2XNQA 4F25A 5LXYA 3P49B 2MZRA 2DO0A 2M88A 2NZ4A 4ZKAA 2CPJA 2DNMA 3U1MA 4TU8A 2MZJA 2DH8A 2HVZA 2MPUA 1HA1A 4LMZA 1K9MT 1WELA 5IM0A 3BO4A 4PR6A 1YWXA 1VQ9S 2XNRA 2KRRA 3R1HA 3FEYB 3CMES 2FC9A 2MKIA 2RT3A 5DDQC 2KI2A 1K73T 3UCZP 2BOPA 3MI7X 3NS6A 4Y0FA 5CA5A 3MUTP 2L9WA 5JVGQ 3P5TL 1KD1T 3J7YU 2KH9A 2QEXS 2MZTA 5DM6Q 1YI2S 2EK6A 2UP1A 2DNYA 3S01A 1X0FA 2AYBA 2I2YA 4W90B 3MUVP 3SDEA 5DETA 1DZ5A 3V4MA 2AYMA 3VAHA 2VODA 3CCES 3VALA 2Q79A 3BO3A 1QM9A 2U2FA 2YTCA 1WG1A 2AD9A 1X5PA 2KM8C 1UFWA 1WTBA 3G71S 4IOCQ 2OJ3A 3EGZA 2CQCA 3CXCR 3UCGA 1YJNS 5D77A 2MSSA 2JVOA 3VAJA 2JX2A 3SXLA 2HGMA 2MXYA 1BY9A 1N88A 2KVIA 3RW7A 2LMIA 2LA6A 2FPHX 1VQOS 1URNA 1U1RA 5ITHA 1VQ4S 3ZZZA 3TYTA 2DB1A 2L08A 2MZ1A 1QVGR 2DNRA 2LXIA 2SXLA 4WFBQ 1M5VC 2G4BA 2MQLA 3G6ES 2BZ2A 2DNOA 3IWNC 2RVJA 2OSRA 3G96A 3H2VE 1PO6A 5CXTA 1W2BR 2KYXA 1KC8T 1NU4A 2KG1A 5BJRA 2MQMA 1WI6A 3NNCA 2MQNA 4ED5A 3CTRA 2ADBA 1OO0B 1KQSR 4FXVA 5DDRC 2G1DA 2MQOA 2MSTA 2XB2D 3NNAA 2MZQA 1ZZFA 2HGNA 2RS2A 2DGXA 2XSFA 2KHCA 1OIAA 4QU6A 3CCJS 2E44A 2CQDA 3SMZA 3HHNB 3CCQS 2X1GA 4WIIA 1U1QA 2PEHA 2CPIA 1WF0A 2MKSA 2RU3A 2EVZA 2M8DB 3DXBA 3MOJB 2I38A 2MY8A 1M1KT 2JWNA 1X5OA 2CPZA 4V19X 2DGVA 3G8TA 3MD1A 2FC8A 4EGLA 2M52A 3CUNA 2MY7A 4C7QA 2DGQA 2DK2A 3BO2A 3Q2SC 4PRFA 3K0JA 1NJIT 1WEYA 2RUGA 2CPXA 3MUMP 1UP1A 2QA4S 2DGWA 2RNEA 1FO1A 2YH0A 2VOPA 2A3JA 2D9PA 1YHQS 1U1OA 2CPYA 2L41A 3TO8A 2ZJQQ 2GHPA 4W92B 1Q86T 2DNHA 1U1NA 3US5A 2DH9A 4C0OC 1VQLS 2CQ1A 3IRWP 1R8HA 5GVQA 3JB9k 2J0SD 2KU7A 3ZZYA 4CH0S 2RRAA 2O3DA 1X4AA 2LQ5A 3G9CA 2F9DA 3CC2S 1H2VZ 3CF5Q 3MDFA 4CIOA 5IFMA 1HL6A 3UE2A 2MQQA 2MB0B 1FJCA 2X1BA 2XS5A 2OIHA 2LYVA 1VQKS 2CQ4A 2RRBA 3CC4S 5MLCV 1VQ8S 1L3KA 3VAFA 2XS7A 2VOOA 3L3CA 3CCSS 1FJEB 2CQ2A 3MURP 3PIPQ 4YOEA 1WF1A 1ZH5A 3MXHP 1H2UX 2LCWA 4WKRA 1X4HA 2DITA 2YKAA 3LQVA 3CULA 2DIUA 2F3JA 3VAGA 2NLWA 2DNGA 2CJKA 2MZSA 2DHAA 3I55S 3VF0B 2YWKA 1WF2A 2DISA 4WFAQ 2MJNA 2CQPA 2VONA 3CCRS 4IO9Q 1X4FA 1YJ9S 3Q2TC 2RQ4A 1VC5A 5GMKa 1FT8A 5CYJA 5GAHU 5JVHQ 1U1MA 1WHYA 1JJ2R 1S79A 3J7ZT 1Q82T 2CQBA 4QQBA 3DLLQ 2MYFA 1JJHA 1H6KX 2KFYA 2D9OA 2CPEA 3OW2R 3S7RA 2EK1A 4WF9Q 3EX7B 1N52B 2DNKA 4FXWA 3PIOQ 3R27A 4IOAQ 3VAKA 2N3LA 4QPTA 1P1TA 2MQPA 1K8AT 2YH1A 2OTJS 4YUDA 2B0GA 2CPFA 3NS5A 2J8AA 4ERDA 1VQ6S 4LJMA 2M8HA 4TU9A 2MGZB 3CCUS 2X1AA 3H2UB 4RU2A 2M0GB 4Y00A 2LECA 1AUDA 2J0QD 4TU7A 1SJRA 1G2EA 1WHVA 2OSQA 2LEBA 3TP2A 5DM7Q 1VC6A 2N3OA 2CPDA 1WG4A 4UQTA 1YIJS 5GAGU 2DGSA 1B7FA 1VQMS 4PKDB 1SJFA 3P3DA 2M4MA 1VQ5S 1U1KA 2CQ0A 4C4WA 5IM0B 1VBXA 4M5DB 2KXNB 2KN4A 4QU7A 2DGTA 1M5OC 1IQTA 2DH7A 1M5KC 2CQ3A 2HGLA 1ZZNA 2E5IA 3MD3A 3D2WA 4OZ0A 1WEXA 2DHSA 1D9AA 4OZ1A 4A8XA 1WI8A 2LKZA 5EN1A 2DNNA 1H2TZ 3THPA 3HI9A 4F26A 4Z2XA 2PE8A 5GAEU 1YTYA 3G8SA 3U1LA 2FY1A 2G0CA 2KG0A 1X4DA 2MHNA 2JVRA 2DGOA 3UWTA 3SDEB 1VBZA 3I56S 1VC0A 1D8ZA 2GO9A 1U1PA 1A9NB 2N82B 3S6EA 1A7GE 2ZJPQ 1O0PA 2RS8A 3B4DA 2KXFA 2LA4A 2U1AA 3BEGB 2CQGA 2AYGA 1HD1A 1FXLA 1KOHA 2CQIA 5DDPC 3BS9A 3CCMS 3THTA 2DNZA 2CPHA 5LXRA 5LJ3Y 1NO8A 2XS2A 1WHXA 1VQ7S 1JJ4A 4YB1P 2HYIB 1VBYA 3RW6A 2MKHA 3P6YC 1WWHA 2E5GA 2K8GA 4J5OA 4CQ1A 1N54B 5H1SV 1M90T 3NNHA 2M7SA 1F9FA 1DHMA 2JRSA 3CPWR 2F9JA 2M9KA 2DGUA 4BS2A 4CH1A 1HD0A 2HZCA 5HL7Q 1SJ3P 2WBRA 2RQCA 2KM8B 1X5TA 1UAWA 1WG5A 3CCLS 1SJ4P 2E5JA 2K3KA 2DNPA 3LPYA 1PGZA 1DRZA 3NMRA 4P6QA 1JMTA 2DNLA 5LJ5Y 3FEXB
chains in the Genus database with same CATH superfamily
2ZJRQ 1X4EA 2E5HA 2AYEA 1UMJA 2IVFB 4FBUA 4PG4A 1EETA 4IO1A 3B4MA 4YN3B 2MKJA 2X51A 1VQPS 2AGOA 5LSLA 4LF1A 1HBUB 3VTIA 3FEZA 3FK4A 2AU0A 1HW8A 4J9RA 3QMQA 1RKJA 2COLA 2V8HA 3FRYA 2LEPA 1FKAF 2FVCA 2OTLS 1CVJA 4JBCA 2MMYA 4RWXA 4ES1A 2HLUA 2R8KA 2F8EX 1R7IA 2FTRA 1Q4RA 4TQRA 4YFUA 4AXJA 2HQDA 5LXYA 2M88A 3AQPA 4RL1A 4ZKAA 2MEWA 3U1MA 4DUYF 4P2SA 1N6QA 5J1NA 5IM0A 4LFBJ 2KRRA 1E6VA 5E3QA 2VG5A 2B6AB 4G1PA 3TZZA 1OS5A 3PYDA 3D54A 2BQRA 4Y0FA 3CJKA 3IGVA 2L9WA 3ZZPA 1IWAA 2EG2A 2UP1A 3F0NA 3UNGC 2OAUA 1Q1KA 2BW2A 1YZ6A 1DZ5A 3DOMB 4KHRA 3TJ9A 4FNHA 3FDSA 2ZH2A 2UVRA 3OXGA 5KT3A 4CT8A 1TL7A 4DZDA 2XO7A 1HBOA 1H38A 3W66A 1T03B 1WTBA 4R25A 3RBEA 2UUBF 4DR5F 2W2PP 1PJ7A 3CJ4A 1BY9A 2LA6A 3RB3A 1FKOA 4UUWA 3DDIA 2B8QA 5DGAA 2ALYB 3ZZZA 2HEKA 2DY1A 1W2BR 1H3DA 1XNRJ 3M8QA 1AZSA 2DCLA 1EX8A 3R97A 3ISZA 4HH0A 5HMYA 4QU6A 2HVIA 1WC3A 4KH1B 2FLOA 5C25B 2NYIA 2ZUAA 4FNIA 1FWLA 1NSQA 3MOJB 4IG3A 1RWVB 1UVLA 1U45A 4QR2A 3BJYA 4FF4A 3I96A 3SSQA 4X66J 1ZTTA 4JB8B 2FJEB 4M5DA 3KLHA 4PQUB 2GIRA 1ZPWX 2BM1A 3HHLA 4AYBD 1U1NA 3IRWP 5GVQA 2XZTB 3ZZYA 4MTPA 1VDHA 2XLIA 3D0GE 4JV5J 1CJVA 1YGYA 3BGUA 2UZAA 2AZ3A 2X1BA 2NPFA 1MMLA 5ETRA 4KC5A 1HWJA 2XS7A 3HD2A 3CCSS 3TARA 2BM0A 3DI6A 3DRRB 3W8PA 2L3MA 3HO1A 1H2UX 2LCWA 4ID8A 3ZNUA 4QW9A 3V6JA 3VAGA 5HQLA 3R7BB 1A6LA 1C1BB 1WF2A 3CCRS 4IO9Q 1S1TA 2HHXA 5GMKa 2GJIA 5A8KB 4D3GA 4WYWA 1SJ1A 1S79A 1JJHA 3DDKA 1RWKB 3SZ2A 3OT9A 4J9NA 5CZVA 1RT1A 2YH1A 4YUDA 4NXMF 3TAPA 3MMAA 4QWBA 2AEJA 1HQUA 5ETLA 3OV7A 5HQ8A 1ZBTA 2OSQA 4RW9B 1T11A 3TP2A 4X65F 1NHVA 2EBEA 2AJ0A 1PYOB 3D1HA 1VQMS 2VJUA 1VJWA 2M4MA 3HX9A 3DOLA 1DLOA 1IBKF 2DKOB 1N5YB 3R5DA 4FDFA 1RWUA 1WEXA 2G9OA 2HRUA 5M2UA 1OYEA 2AQ4A 3AOAA 3CO0P 2YKOA 5K8PA 3EUNA 1O5JA 5E33A 2H5JB 2FY1A 2XG8A 2MLYA 1SQEA 3H0PA 3AY0A 1X7VA 4AQYJ 1NJZA 3UR0A 3MM9A 2HHVA 1YSJA 4OYWA 4B3RF 2BKNA 4WYLA 3H4BA 3MMCA 3HF5A 4B3MJ 3CNQP 4Q45A 1UFLA 2J0XA 2NQPA 3IM9A 1JJ4A 5KG3A 4JOUA 1FRHA 5H1SV 3PRDA 1R0CB 1N33J 4DR4J 4M5GA 2QA2A 5HBMB 1NB2A 1YRTA 2WBRA 2HBZB 3ILIA 3HT3A 2KFNA 1X5TA 4O4GB 2E5JA 4LQ3A 4P6QA 9RUBA 5LJ5Y 2HS4A 2AHOB 1U25A 4OJHA 2CYYA 2WSFC 1LKZA 1HHQA 2FHJA 2V94A 3GPAA 5F8GA 2ZITA 5E41A 3FSXA 1FDDA 2F7VA 2CAJA 5E3RA 2ZD1A 1UVJA 4DV0J 4NZ0A 4U6PA 1BQXA 2YNGB 3UD3P 3TOQA 1LFPA 4DL7A 1YBTA 1RISA 2DHGA 3OXFA 2XMTA 2DNQA 4LSLB 3IAM9 1B0VA 2V6AA 3SIPB 3M8PA 3SCKE 4NLOA 3D1OA 4J9KA 3T1HF 3A8IA 2DO0A 4TU8A 1LK7A 4N8OA 1HHSA 5KFPA 3BGLA 2E7VA 2UXCF 4U8VA 2Q66A 1MU2A 1RUSA 4LF7F 1OQ6A 2R8JA 3IGNA 1Y5IB 2ZH6A 5KG7A 2ZBRA 4NA2A 3VGUA 3IS9A 3KWMA 2PI5A 4CO2A 2JLGA 3KK2A 4M1KA 2DNYA 4USHA 3JAMY 4HEA9 4ECRA 4ZS6A 3VALA 3RU0A 2BA9A 4HKQA 4F3QA 4ZA1A 5GADI 4ZN1A 2U2FA 4LR9A 2AD9A 1X5PA 3PX6A 1KQGB 2D41A 3I0SB 4RNHA 2HGMA 2MXYA 3E01B 3LUYA 1URNA 3PVXA 4CYUB 3FFIB 1DTTB 3DKDA 1I51B 3NL0A 1OSDA 2MZ1A 1WD6A 4R5PB 4B9UA 2LLZA 3EMTA 2G4BA 5E3PA 1AT1B 4ECSA 5DLGA 2D1CA 2B7BB 3K5LA 1NPRA 1F60B 2B8PA 2JZ5A 3MM8A 5KOXA 1FTRA 1JLCB 1JLEB 2FJDB 3OFFA 3EZUA 2VFRA 2CUYA 2M8DB 3DXBA 3SCJE 3V6HA 2KKHA 3DRSB 2DCUB 2M52A 2MY7A 3MECA 4LIWA 4WE1A 3OL9A 4DR7J 5IS2A 4PUOA 5ADZA 1ZM3A 1U0HB 3CIMA 1FESA 3ENQA 3GJQB 2L41A 3TO8A 2DD8S 1EZZB 4PWDA 2DNHA 4DSFA 4X4TA 2LQ5A 4K4XA 4JI1F 2IA6A 4OYZA 2YKMA 4UOHA 3KHGA 4LF5J 1LWFB 3RRKA 4NWBA 4N7TA 1FJEB 2CNKB 3LA0A 2MLZA 3BR8A 4JI7J 2V2VA 4IOBA 4OX9J 4B9VA 2KL8A 3WC0A 1KLNA 2QJ3A 2DIUA 2F3JA 1NB7A 1EETB 1XQIA 2JDJA 1SL1A 2DHAA 3EXCX 3I55S 4ETZA 3ZTOA 4O3SA 1JXVA 4RUAA 2XCPA 4A8SA 2H51B 1R3NA 1BD6A 4YB6A 5GAHU 3P8BB 1U1MA 1C0UB 3D28A 3KG0A 1L3SA 1CJUA 4G1IA 4LSNA 5IC4B 3R27A 2B4OA 1B70B 5J2QA 4U7UD 2WVEA 3OXLA 3TJAA 3T1YJ 2YY3A 5AT1B 4OHXA 1Q8BA 2LECA 1URRA 1JLGB 1VC6A 4ANDA 3EICA 2CQ0A 1N6QB 5IM0B 5I3PA 5CAAA 3NEKA 2BKOA 1IQTA 1E6VB 3GV7B 1NJXA 1HNIA 2VG5B 2CDQA 3LP2A 1CJKA 4DF8A 3AB4B 2IDLA 1N36J 3BM7A 3TQEA 2XWXA 3CJKB 4CO3A 3WIVA 1RACB 4R0JA 4QIGA 1FF2A 2AEFA 3DXSX 1TL1B 2W4CA 4F7VA 1HBMA 1ELOA 4YP3A 1HWUA 5AXLA 4KE5A 1WC5A 1RT3A 1TL7B 2ABYA 3IR5B 1HBOB 3EZOA 1KOHA 2G0IA 2CA9A 5LXRA 2CRLA 5HLFA 3CJRA 4EWTA 1FKOB 5JUMA 1NH8A 2W24A 4DI6A 3GV5B 1RT5A 4B9SA 1I1GA 1BQMA 2W2OP 4FPIA 3M8QB 3AJDA 4TNOA 1AZSB 1Q5VA 3T5HA 3WX8A 2KRBA 1BGXT 4LRBA 4BC9A 5LT5A 1LK5A 4U8YA 4Z7YA 4UY8T 4KSEB 5KG6A 1WDTA 4IG3B 3OL8A 2HFZA 4QWDA 4DN0A 1FK9A 5L8RC 4KB7A 3SSRA 2UVVA 1L3TA 4FKXA 2EFNA 2IJFA 3LP1A 4AE5A 4FZVA 4C3KA 1DURA 1TP7A 3ENAA 5D78A 3QZ8A 3D9BA 1CQMA 2RE1A 2UXBJ 5A0YA 2NXJA 4KHPF 3HHLB 3CD6S 4IYQA 1V3SA 4I1TA 4UZCA 4DL4A 3OFEA 2ZHOA 1QUVA 5IWAJ 3ET6A 1CJVB 4ZVRB 1NKCA 3GTYX 3GYXB 2EPIA 2F8HA 4LRDA 2HVZA 1R8AA 3V6DA 1PYSB 1HBNA 1GX5A 1BUXA 3R1HA 2FC9A 2HNDA 5DDQC 2BABA 5CA5A 2DXEA 1HQ2A 3I5AA 2F4VJ 2MZTA 5DM6Q 2N4DA 3C16A 1NK9A 2W7OA 4CRJA 3T5LA 1S1TB 1K1QA 2B51A 1F2HA 1F9EB 1WC4A 1ZTWA 2GMHA 4ENOA 2KZMA 4UOCA 3KMQA 1Q0NA 2MQ8A 3C19A 2DR7A 4LUBA 1JXEA 3BR9A 4USJC 4UUXA 4PABA 4USKA 1NK5A 1QM9A 4ICLA 3SCIE 2OEKA 4V19J 1KN6A 1RT1B 1UFWA 2PGCA 2C2DA 4DFMA 4LQ9A 3MMAB 4EBEA 4D3HA 5KG4A 1HQUB 2IRUA 4LRCA 2ZUGA 1FDBA 5DZ6A 2RHQB 3HHKA 4LF2A 5B0AA 1NPKA 3M2UA 2G2OA 3J7Z5 4ZITA 3DOLB 1DLOB 1HIYA 4CO4A 1HR0F 4PEOA 3BZQA 3M4XA 2VFUA 2MQOA 5KFKA 3CCQS 4DL2A 2WONA 2QA4G 4HHHA 2MY8A 1M1KT 2B43A 1BLUA 5KT6A 4ELUA 2JEFA 3TVYA 3MM9B 3OJSA 2I1RA 3EGWB 2QLXA 3FZBA 1WUUA 2YH0A 2D9PA 3MMCB 1FA0A 1FXDA 3W63A 2OI2A 1VYAA 1FKPA 3PNIA 2PI4A 2YX4A 2K2PA 3N5BA 3CF5Q 2DT9A 1B7YB 4MK7A 1MMDA 1RBOB 2MQQA 1FJCA 2XS5A 1EB0A 2HLTA 4XTTA 4IRKA 3CO9A 5E3CA 2VH7A 4XO0A 2XTJP 5K8OA 2YKAA 4ATNA 2QTWA 1F5CA 3PKYA 2JL9A 3ZZUA 1NNDA 5KFAA 4MK9A 2MJNA 3LO3A 1SCJB 7FD1A 5T7LA 2E5LF 1SL0A 1SKRA 3UR3C 2ZD1B 5F8HA 5KAKA 3R7SB 3EVOA 5BXIA 3KJVA 2OTJS 2XI2A 4PWWA 1UZHA 3ZC4A 2VBXA 5C24A 4YHHJ 1H0HB 3KNGA 3OLAA 2E1CA 3M8PB 2R7OA 2HHHF 1AUDA 3TANA 2PA3A 1SJRA 5LMUJ 5IC6B 3PYFA 2HNYA 1WG4A 2CZ4A 3B82A 3DOKA 2IMOA 2VB6A 1GH8A 3GV8B 2Z57B 2ROPA 3IG1A 2DH7A 3C15A 1M5KC 3LW5C 1TR0A 2C2MB 4FVMA 4U96A 2LVWA 5GAEU 3IBFB 3W9HA 3D0IE 3IS9B 3TQ1A 4X4NA 3KK2B 1U02A 4C3MA 4OI2A 4YR2A 4DX5A 3W2VB 1RBAA 4OZ5A 1SH3A 4DX8H 1UZDA 2R7QA 5DRKA 1PBAA 3DGPA 1FXLA 2J6SA 1S1WA 5DDPC 2Z2MA 1PYTA 3OTOJ 3J81Y 2Y1JA 1OPZA 2ILYA 2JLFA 1YJ7A 2W8KA 4JI7F 4L6V3 4A8FA 2FIUA 2BRLA 3IBWA 4KJIA 1HD0A 3TRGA 4NRTA 1WG5A 4OV1A 3CGIA 3S1TA 3NMRA 1U7LA 2YWWA 4GC7A 4MIBA 3HJFA 5A8WB 4QJVA 4MYUA 2KJWA 2VPXB 2M70A 2A2DA 2FYXA 1S6UA 2J9CA 2CFXA 4K4ZA 3VQSA 2DHXA 1KFSA 3MECB 2ZKUA 4R8UA 4PUOB 4JI4F 1Y9OA 1L3UA 1FFGB 5T41A 3PY8A 3HZEA 3JSMA 3FQKA 5K9FA 4PWDB 4ZN3A 2VFVA 1P27B 4TKTA 2KT5A 4QYZJ 3C46A 5FD1A 2B4PA 4YQWA 2POKA 2ZNYA 4U67Q 4Y34A 2WSEC 4C8LA 3KJNB 2YKMB 2MZRA 3CJ3A 3KLFA 3PJXA 3H25A 2XWYA 3BO4A 4C6AA 1RZMA 2XMAA 3FRZA 4WXWA 5LL6d 2VQFF 3DLBA 4ZP8A 3IM8A 3UCZP 2GJ2A 5F41A 2NREA 4DV2F 3P5TL 2XGPA 4F36A 1VRTA 2AYBA 4DV4J 3G6YA 4LF6F 2IY5B 3Q83A 4XDDA 3NAIA 4KHMA 1CJUB 2H5EA 3TWZA 4LSNB 1FD8A 2OGUA 5J2QB 4YDDB 5HQMA 2CQCA 3CJTA 2GCFA 1MSWD 3M2VA 2LMIA 3DGVA 4GVBB 2Z2LA 4LF8J 2HWHA 1VFJA 2FVRA 5M2PA 1KQSR 4DV6F 1HNIB 4YB7A 3LP2B 1UVIA 1CJKB 2XSFA 2QG9B 3O1LA 2PEHA 4PZVA 2CVIA 3KXDA 1S9GA 3KJFB 1CS4B 3DRPA 3G82B 1N0VC 2DGVA 2WBMA 3KUHA 2FD2A 3MAAA 1RT3B 2IA0A 5C5JA 1JLAA 2FVQA 4K4SA 3HT0A 1W26A 3DMJA 2CQ1A 3TUIC 3OL7A 2J0SD 3G9CA 2F9DA 4HACB 5J1EA 4Q7AA 3TA1A 5A76A 1S48A 4CO5A 1RT5B 3K2YA 1WC6A 2LYVA 2K06A 1BQMB 3QATA 4MKYA 4A8KA 4CLPA 2AF6A 3W5XA 2VICA 3M8YA 1ZH5A 1R89A 2KJVA 2P6TA 2O1PA 3JSRA 5ETPA 3QRPA 4GC6A 5AXMA 4ZCLA 2J7UA 4FYYB 3Q8SB 4DR6F 4EYIB 1FK9B 1WHYA 3W65A 4M94A 2MYFA 3JSBA 3SQOP 4KPYA 4ZJQA 4DR2F 3LP1B 2EK1A 4QWEA 2N7YA 2XY7A 1S57A 3GIIA 2XYGB 4QR1A 3H2LA 3NS5A 1VQ6S 2IJNA 1MN9A 4Y00A 2J0QD 5H9FK 4B02A 4OL8A 3P3DA 4J9SA 3V6DB 2RF2B 1HBNB 2ZH1A 5BYSA 4X84A 4ZIVA 2HNDB 3THPA 1JQGA 6FD1A 4NLDA 4JYAF 2BOAA 1N32J 1RAEB 2G13A 4J9LA 4F4WA 1V5IB 3C16B 5L46A 2MHNA 3IFEA 2DJWA 2PSZA 2H65B 2FHMA 3ILLA 4I2PA 4LBPA 2W9AA 1G3OA 3GB0A 1MG7A 3A13A 1EJ7L 3BEGB 1JNZB 1RWWB 4ICLB 4FXDA 2VG6A 4NZ6A 1NSPA 1P8GA 5EWEA 1YK9A 2UU9J 1KKHA 5IOLA 3FCVA 1EKSA 2VFSA 4J5OA 2DXDA 2DPJA 5J1PA 3JTOA 4BC7A 2JRSA 4H4KC 3M2UB 3L7UA 1UEKA 2UV8A 1TK8A 3BSNA 3QGPA 1CEZA 1RWXB 3M1VA 3GZ7A 5C42A 3WBZA 3PTWA 2GV1A 3O3LA 2HHPA 2W1BA 1N8RT 1DARA 1VLYA 2CVEA 2PDAA 2ZBQA 4JI3J 2YX1A 4X64J 1QVFR 3T9ZA 1SJQA 2WONB 2PMHA 3I5CA 3CW2C 2FJAB 1XEZA 3V2UC 3GFZA 1TUGB 3I31A 1LXJA 4OLPA 2R8HA 2DVIA 2IM0A 2V8PA 3W8GA 2GZOA 2AJ4A 8AT1B 3R5GA 5KFLA 2DIVA 3MAQA 3U1NA 2A0FB 2IBOA 1HNWF 4OYPA 1FKPB 2GC8A 3D3BJ 2XHWA 3BBCA 1SXLA 2NYHA 2R7SA 2HHWA 1U47A 1XN9A 1M5SA 4KPCA 4PPZA 1FNXH 4J90A 4F25A 1VLOA 2V4QA 2OMOA 4PWUA 3QJPA 2MPUA 5CD4A 3HP6A 3RRGA 4YMEA 3CMES 4RLEA 2HK3A 3RG6A 4YR3A 3NY0A 3J80Y 2VL1A 2OELA 3UFCX 1FI4A 4IQMA 4OJGA 3PW7A 3QIPA 1UJ4A 5AJ3F 2HQ3A 1V6HA 1B99A 1R31A 4DSJA 3KJVB 1I6JA 3DLEA 1TKZA 4Y6IA 3NLCA 2R8IA 5C24B 3SSSA 4LF9F 2JVOA 1L3VA 1B4SA 3SXLA 2E1PA 1OY9A 1H73A 2W25A 5EDWA 2HNYB 2G0JA 2LXIA 2R7XA 3DOKB 2C2EA 3QT6A 1F3VA 5KFIA 1NU4A 2KG1A 3NCPA 1IKVA 4GRSA 3C15B 3N6LA 2ZVIA 4DQSA 1VRQC 2XB2D 5H9EK 1VHFA 4JP8A 1OIAA 4JI0J 4KQZA 3AB2B 4WIIA 4TYAA 2ZNZA 4DG1A 2YNHA 4OI1A 4N76A 3CJ5A 2BJEA 3MEGA 2CPZA 3QAUA 4EGLA 3GSIA 5EX0A 2DGQA 3QGGA 4ZPWR 4C48A 1IBMJ 4ZP6A 5HMZA 4CM0A 2HSEB 3IAS9 1KHWA 3Q23A 3DGPB 3AHPA 2QZ8A 3LPEA 2VOPA 2FLNA 1S1WB 2A3JA 4IG0A 3BQ2A 1Q86T 2GAGC 4K4VA 3JB9k 2UVWA 3POTA 3AAWB 4UTGA 4K50A 3C3LA 5KFBA 1XC9A 4AL6A 4I67A 1ULRA 4DBQA 4NEZA 1RU1A 4I6YA 1N34F 1X9WA 4ECYA 4X4VA 4DLGA 4DS5A 3WZ0A 2NLWA 4F0HA 2V9KA 3H5SA 2WSCC 1YJ9S 3BYRA 1PSDA 1RE1B 1G4CA 2HKEA 3C6TA 3OSNA 1LWXA 4R8UB 1S1VB 2WB1D 1NCLA 5LM7E 3JSMB 5BR8J 1P1TA 5LMNJ 4WU3A 4ANEA 4LF8F 2AMCB 4DUZF 1UW9A 2M8HA 2P9CA 3E8OA 4ZHRA 1OY8A 4RUBA 2UXDF 3KLFB 3QT5A 3QWPA 4FS2A 5F9LA 1SJFA 1VQ5S 3L95X 5GMDA 3A12A 4Q5VA 2V50A 1RTHA 1YJTA 3D2WA 3HD1A 1QSSA 1FRLA 5ETVA 2C2KB 2AZ1A 3M8SA 4K8RA 3EXYA 3HVTA 1KVIA 4GKKF 4CDIA 1X4DA 2O5DA 2JVRA 5HMWA 2UUAJ 5DQHA 4I7FA 4F0MA 4X4SA 1WKLA 4DSEA 3NGTA 1O0PA 2QLWA 1FEHA 1TQLA 3OVAA 4CLFA 2AYGA 1U8WA 2HFNA 3LGMA 2DR8A 4DV1F 4K0KF 2W4DA 1WHXA 3T5JA 1GMUA 3M2VB 3CIZA 2OFGX 3AD8C 3NCQA 2A2CA 4C0BA 1TL5A 3N4WA 1M90T 3OR1A 4CH1A 2HZCA 1A0OB 3VWSA 3KUGA 3LWMA 2W2NP 3TAMA 4KKOA 2QSWA 2V68A 4LF4J 1UVMA 3NGRA 5G0RA 3EM1A 2FDNA 5DGBA 3DLGA 3EGNA 2Z4PA 4B9LA 1C4AA 1B0PA 1SVDA 5DQIA 2Y1RI 1VQNS 1S9GB 1NRKA 3BBBA 5HVGA 4B3SF 1LW0A 1FE4A 1FRXA 3MAAB 2AJ1A 3QLHA 4K5RA 4ED7A 3JTPA 1JLAB 1UA0A 2RU9A 1Q7YT 3TX0A 3LALA 5LSOA 3LTOA 1X5SA 2ADCA 1OPIA 3QBCA 2GFFA 2ERRA 5EGYA 3O6QA 4LIRA 4P52A 3PW5A 3DLKA 2E1AA 2IHR1 5FLXY 2HG4A 5KFVA 1REGX 1RSCA 1WC1A 3KLEA 1TAUA 3EDQB 4DWIA 3MMBA 4PYAA 2X7IA 3BYPA 1WSRA 2VDHA 3GR1A 4ZLJA 5RUBA 1S12A 1TKDA 1KD1T 4KGZB 4PG6A 3V5RA 3LANA 1D3WA 3T5KA 4JI5F 5F0UA 5KT4A 3RTVA 4HH1A 5A6WA 2VU5A 2YXLA 2OPSB 4MYTA 2VC1A 4OHZA 1WOOA 2FHJD 3NXZA 5KFEA 3D6HB 2E1RA 1WG1A 3NRBA 3HHEA 3EGZA 4QWAA 1KFDA 3CSKA 3W7BA 2R7WA 2KVIA 5CQGA 3M05A 4N5SA 4OZ3A 1T8EA 1OYDA 1HNXF 1T02A 5U47A 1M1HA 4OYOA 4M95A 1QE1B 1RT4A 4FF3A 1XJWB 4CCHA 2OEMA 4P9SA 3PEJA 3NNCA 2AKWB 3LH2S 1SI9A 1FCAA 2DRBA 3NNAA 3GFYA 4RNMA 3MTJA 4KYZA 4DX7A 3QGIA 5L1IA 3GIMA 2VQEF 2APOA 2LDYA 4JI2F 5KT2A 1P1LA 2R2UA 3IC1A 3VVTA 3KUEA 1HI8A 4MT1A 3U02A 2FC8A 4PQAA 3OSPA 4I2PB 2KO1A 5HAOA 1GK8A 4EO8A 3TJ8A 2BMBA 2CG8A 3M32A 4RX6A 2VG6B 4DUYJ 3J80U 2QGFB 4PXCA 3NBPA 2FGCA 2KU7A 2O3DA 2XMUA 2RDIA 4PPDA 1JKHA 1P9YA 4N77A 2BQUA 2FJXA 2MB0B 1F5AA 1XMOF 1FWPA 3R3TA 4OYBA 3M1VB 4WP3A 5C42B 4USWA 3CDWA 1ZM4A 2D69A 1TMMA 3M6VA 4AUKA 1SH0A 2C3PA 4I6WA 3VF0B 3SFUA 3ENWA 2UUBJ 4DR5J 1PG5B 2VUGA 2ZM6F 3LGNA 2A6MA 1JX4A 5JVHQ 2UV8G 3M9OB 1RT6A 1SQFA 1JJ2R 3J7ZT 3FMBA 3G6XA 1SBRA 4J9UE 2P8IA 2PN6A 2Q1LA 1YBUA 2I8EA 2CPFA 4WTOB 1KQKA 2K7JA 3UDEA 3KLIA 3H2UB 4DCOB 4UQTA 4S0MA 1S59A 4K7QA 1NZ8A 4MIAA 1YJUA 4DFKA 3ELHA 4CWBA 1DQ8A 4NLUA 1H2TZ 2ZKTA 3QT7A 3HI9A 3JSYA 4N41A 3LAMA 3U1LA 4QYRA 4F67A 3PW4A 3PG9A 4DSLA 3D68A 2ZZMA 2JJ4D 3QIPB 4ZVOB 2RS8A 4DR3F 3OBIA 3V4IA 3IN5A 3FBFA 3DLEB 4O3OA 4AFFA 1TKZB 3B78A 1HQEA 1J5OA 3ISNC 3CCTA 4FVCA 1D09B 2XBPA 1ZYQA 2F1FA 3QJJA 2OPPA 3T1AA 4DMZA 1N54B 4USIA 2DGUA 1KP6A 3RB6A 2AJFE 3RRHA 1IKVB 3LPYA 1DRZA 1KTVA 2GJFA 3QFHA 4ZCKA 5C7PA 2B7CB 2HMIA 3I0RA 1MMNA 2J6TA 1FTCA 4P2MA 2Y8WA 4DG1B 2YNHB 1DJ0A 1KOOA 4J9OA 2MHEA 1R6VA 5L1JA 4NXMJ 1RK8A 1OWXA 3MEGB 2FHOB 2NZCA 2J7KA 3D6TB 5HP1A 4TLQA 4X65J 1F2GA 3DLHA 1VI7A 1BQNA 2HAIA 1FE0A 3GJSB 4ZVUB 4IG0B 1IBKJ 5KFRA 1D9DA 3POTB 3W9IA 4QIEA 2MKCA 4Y65A 4MKAA 5D0HA 3CEDA 1JB0C 3LAKA 1LWEA 1D1UA 2XNRA 1YKWA 1JLFA 3KOAA 1FNOA 4X4RA 1L5UA 2BJ9A 2MKIA 1Y10A 2HHQA 2RT3A 4YEAA 3PX0A 4ZMMA 4OYAA 4ZP9A 4B3RJ 2BOPA 3MUTP 2R9LA 2LQJA 2IIHA 3FCWA 2QL9B 5HJXA 2ZWOA 3C6TB 5ETKA 4NXNF 2E29A 3UW1A 3B54A 4LRFA 2P9EA 4M5KA 3TUZC 1U0SA 4WP8A 1Y0HA 3BKFA 1VK8A 2ZOGA 2DR9A 3NGKA 4ZHRB 3PRVA 2HURA 1IKYA 1NEEA 1TU0B 4U95A 1RLDA 3RBXA 1M5VC 1KQFB 2IVMA 3G96A 1PO6A 5CXTA 4CLSA 5BJRA 1RTHB 1ZAWA 3PACA 2RS2A 4B3TF 2EBGA 2KZZA 4NX9A 1VRUA 3KK1A 4TN2A 1NH7A 2XYPB 3HVTB 2JEGA 3DM2A 3NKYA 2JWNA 1NK4A 3D0HE 3E2EA 4I7FB 4ZPBA 4IRCA 1CPZA 3T1HJ 3M8WA 2CKWA 3MUMP 2BJ1A 2ZFHA 4XPCA 3DNCA 1S6QA 4ZVSB 2GQCA 1VMBA 4EFAC 3K59A 2UXCJ 4K4TA 1LWCA 2ZC4A 3MZIA 3RBZA 2RRAA 4B9TA 4DQQA 2BE2A 4CZCA 4LF7J 3CB4A 2W9CA 4EZ6A 3OR1B 1UETA 4F2RA 4OYXA 3M7VA 3TAMB 4RPFA 1T9VA 4KKOB 3VAFA 3HSJA 1NMEB 4MJKA 1WF1A 5G0RB 2XSJA 3R8YA 2OKQA 2EEYA 3J81j 4IQXA 4FYDA 3OFHA 2JOQA 4HTIA 3EE3A 4URQU 3OHAA 1RWMB 1LW0B 3Q2TC 2HPUA 1H72C 2W7PA 2VG7A 4K5SA 4O3NA 1X60A 1TVRA 2D9OA 4CM2A 4DV7F 3HCXA 1KBRA 1FFSB 1UWAA 1RWOB 2VC0A 2ZH8A 5CABA 1IUJA 1M5HA 5JMNA 3DLKB 3KLGB 2HQGA 5KFDA 3V6KA 2CPDA 3BSCA 3QYYA 4JV0A 2PIIA 3FCHA 4FF1A 4C8NA 5KFTA 4X4UA 1NM2A 3QAEA 4C4WA 3KLEB 4DUTA 1S5ZA 1VBKA 4WBFA 3DRYA 4U7UK 1ZZNA 3A1YG 4RR5A 3DN9A 3MMBB 1AA1B 2QLBB 1AXQA 3GQCA 2IM2A 1KS2A 1LFWA 4IH6A 2HFUA 5ETNA 3IMQJ 2IRXA 3G8QA 3IBCB 3UWTA 3HVAA 1VC0A 4IRDA 4C8MA 2OFHX 4LT6A 4JI1J 1TFYA 3W1YC 2WCXA 2LA4A 3M6UA 3AD7C 4L74A 3DHWC 2XYHB 1TTHB 4PG5A 4K4YA 2CQIA 3FJ2A 4NPOA 4MIWA 2B56A 1ZM2A 2VBWA 2HYIB 4HT7A 2G2YA 2DRAA 1GAOA 1F9FA 2C1EB 4Q2MA 4EK2A 5K8MA 2F9JA 1TUVA 1U4BA 1CQNA 1RT4B 4AT1B 2HQIA 5M2RA 4QW8A 5A8RA 4TQSA 4H54A 4NLXA 3CC7S 3K7RA 3HM9A 3Q8QB 2DR5A 4H4MB 5L1LA 2FUG9 2QA1A 1LOUA 3R1LA 1X4BA 1UPPA 4TY9A 1ITPA 3QZ7A 1WOPA 3MR2A 1FRKA 1RHJB 2V8VA 3AOBA 4M5MA 3EYZA 2J0WA 3M32B 4HHUA 3KLVA 2NXCA 2B4UA 1D8YA 3VAMA 5GADU 3AODA 1Q7LB 3NBPB 3HFVA 3THVA 1JXLA 1JNRB 4ILMA 2NSCA 1P9QC 2HIYA 3HHLC 1NLKL 1FJ7A 3MEEA 1N5QA 1JKHB 1FD2A 4B3OA 4OHVA 2ZBCA 1KR4A 2QE5A 3U7JA 2V0NA 3M2RB 4A48A 4PR6A 3AXKA 2ACMA 3FEYB 4A47A 4WPAA 3SCLE 3MWBA 4I56A 4YY3F 2PMWA 4UQGA 2RJZA 4RW4B 2QX0A 4J7CA 2QEXS 1IKXA 1YI2S 4ES3A 1PC5A 3X3UA 2HBQB 1NBEB 1UVKA 1UL3A 3CCES 5HVHA 3KNAA 2YTCA 4DPXA 3W2WA 4EZ9A 4LRAA 1IN0A 1PAEX 3D5MA 1HYSA 5D77A 2PC6A 1TK0A 3KHLA 3KLIB 4O23A 5AE3A 1EIYB 4ZCMA 1IVZA 2FPHX 3W61A 4ED4A 4ZPTR 3MFIA 3F41A 2DB1A 1YLXA 2L08A 2XM3A 2DNRA 4USVA 1CJTA 4WJBA 4ZPDA 1SKUB 3H7HB 3Q86A 1GMVA 3D4JA 3BDEA 1RAHB 3ITHB 2E44A 2BBEA 5DZ7A 3J7YI 3AH6A 5KFNA 4C97A 4BHQA 2ATLA 2Y0BB 2MTLA 4KHPJ 1DTQB 1X5OA 2HWIA 4WIQA 3KKFA 5J2MA 2UUCF 4P72A 3Q0AA 4DPTA 2FVPA 1ZOTA 4TLRA 4G65A 2WVBA 3CJ2A 1RTIA 3V4IB 3M9NB 3HJVA 3VGVA 1NJYA 1U2CA 2ZJQQ 3AQOA 1HQEB 3US5A 2A10A 3MGJA 1J5OB 4QR0A 4NZ7A 4WFYA 2J9DA 1NSAA 4F4XA 2OPPB 3MDFA 4CIOA 2OPRA 3AFGA 3IP0A 3CWJA 1G6BA 2HW3A 2ILZA 3CC4S 1VQ8S 3ZTPA 2VOOA 3KFWX 5CHCB 2W9BA 5L9NA 1PJ6A 1H7WA 4IDKA 1RBLA 3I0RB 1T94A 4P2XA 2H48B 5F8NA 3K89A 3NOCA 2V2QA 2NXNA 1LQ9A 2DNGA 3KHHA 3QSIA 2DBBA 1RQ0A 2CQPA 2I5JA 3G2XA 5DG9A 1VQSA 1FT8A 3F73A 5HP1B 3EVWA 1Y3KA 4L76A 5KT5A 3AOCA 2F65A 1BQNB 2DNKA 4XAKA 4FXWA 1RT2B 7FDRA 3CD0A 2H4WB 1HR0J 3EDRB 4A8YA 2HQCA 2DHHA 1WHVA 1IM4A 4E8UA 2DGSA 4NCBA 4K2JA 5D4PA 1UA1A 1LWEB 1VBXA 1RJJA 5B08A 1JLFB 1SB6A 1NHKL 2R3VA 2DGTA 1R8CA 1EAYC 1XNQF 1VISA 2DHSA 3KG1A 1WI8A 4NASA 1K0TA 2EKNA 4J9PA 3RAXA 4HI1A 2RIJA 3NWRA 3VGSA 4J91A 1RABB 2KG0A 3PXGa 4RBUA 1U1PA 3S6EA 1ZETA 3G87A 4QIFA 4H4OB 1GFWB 4ZJOA 4X4PA 4F4AA 2NSBA 3CJSA 4JV2A 4DCPB 2AV5A 2DXFA 3D6MB 3OHBA 1FJGF 2YQ0A 4F04B 4HL9A 4RW7A 2BACA 2ASJA 2XLKA 1IKYB 2QMUB 3UI3A 1Z1ZA 2M7SA 5KG2A 4BS2A 2J9DE 1NUEA 3MR7A 4JI6F 4DCJB 1RT7A 2NXUA 4CTAA 2DNPA 3DOMA 1PGZA 3MEDB 2E5LJ 2ASYA 2ZDPA 1SC6A 1T9WA 5I3UB 2ZH9A 2HS0A 5F8LA 4F3MA 2BE7D 4ZVQB 4CO1A 1Q95G 3RAQA 3KK1B 4Z7CA 1JJCB 1WTFA 1WEZA 2C2OB 3PFOA 2LXFA 3DM2B 1AB8A 4NE9C 3W62A 2HHHJ 3EGVA 2M2BA 3RBDA 2WK4A 3C8YA 3CMAS 2IPOB 3ZTQA 2KXHA 1X4GA 1NJWA 4RBTA 4ILRA 1LWCB 9ATCB 4LFCF 5HROB 1Q8LA 2JEJA 2KT3A 2BE2B 4X2BA 4A8QA 5MAOA 2W9CB 1CBKA 2MDAA 3P49B 2NR0A 2JH3A 1NK6A 3LF0A 1WELA 3AJ2A 3DDNA 2XSJB 3MTKA 4ZIWA 3KG4A 3NS6A 5KFGA 4PQUA 5KT7A 3MM5A 1U6ZA 5SZTA 2ZH5A 4F4KA 2JHEA 4C0HA 2I2YA 1WDDA 3BDPA 4UZBA 1UFKA 1KNZA 2VG7B 4PXDA 4CLYA 4ZPAA 5C2GA 2JFDA 4NLPA 2XMMA 2B4VA 1HWLA 1TVRB 1FXRA 4C9DA 3RB4A 4Y2IA 4IKAA 4CLZA 2WVCA 4HR2A 2GS8A 2OJ3A 3L4BC 1IR1A 3UCGA 2JX2A 5KFZA 4CH7A 2RKIA 5F3TA 4TYBA 4U9RA 4WFBQ 2IVYA 4XIUA 4ED5A 2G1DA 1RWNB 3P45B 4XPEA 4JI4J 2KHCA 2CQDA 3SMZA 2BJ8A 2H9ZA 4OI3A 1E6YA 3WQPA 4ZJLA 3TEHB 2BANA 2I38A 4N8NA 4C8YA 2XULA 1GXTA 4ITSA 4TVAB 3Q2SC 2FZCB 2H4YB 4NMLA 3PZPA 4B08A 2QA4S 4ID5A 3V81A 3C6UA 4X62F 3EWGA 4ECTA 4QZVB 3JXOA 3K17A 4CI0B 1R8BA 1R8HA 4DV3F 2OO4A 1X4AA 4RO0A 4YB5A 2VQFJ 1SUQA 1RTJA 4A4JA 1DQ9A 3UE2A 3E51A 2Y0SD 4WK3A 5KTQA 4DV2J 3PHTA 3M6XA 1U24A 3D1QA 4DDFA 2A6OA 4DV5F 2VF3A 1QJHA 3MURP 4ALZA 4LF6J 2HHTA 2RDDA 2XCAA 5CCLA 1QUPA 2V9WA 4UW2A 4UOGA 3VCDA 1V5VA 2AX0A 5D4NA 2VDIA 2BW7A 2CZVC 2UUTA 5AXKA 4CLKA 1MLAA 2RRNA 1NHUA 3TNVA 3DRXA 5HBMA 5F8IA 2VZ9A 2A18A 2YKNA 2CPEA 4LFAF 5J2NA 3OLBA 1W25A 4EYHB 1K8AT 2BJDA 1SIWB 3MPVA 4WK1A 1SKWA 4CP5A 4TU9A 1RP5A 3H59A 4DV6J 3MEEB 5B0FA 1SPBP 1SV5A 3NS7B 4TU7A 4B3OB 4WFXA 2JC1A 4ER8A 1B7FA 3IWXA 3TUJC 3MM7A 5HSPA 2HAFA 4M5DB 3KLHB 1TAQA 4WU2A 2FLLA 4ED1A 1VOMA 3BGRA 4KH0B 1S0MA 4HYKA 3SV3A 2E5IA 2WB4A 1Z2LA 2W4PA 4IFVA 4GO5X 2CDRB 3SFGA 1IKXB 4LSLA 3IR6B 4WKYA 2K1RA 3PFEA 3GILA 3DI6B 2KFZA 1X31C 5D4OA 2U1AA 1WOSA 2CQGA 1HD1A 3W2WB 5IV4A 1IBLJ 1JLBA 2WW8A 1ZPVA 1KLMA 1D9FA 4HTJA 2XMJA 3O44A 4NA3A 1B64A 2PA8D 2GAHC 2C3MA 3EPGA 2BR0A 1DHMA 4CO0A 1T3OA 4EO6A 5HL7Q 2EG1A 2RQCA 1CJTB 2R7RA 2YPYA 4DR6J 2BV3A 4F4ZA 4WFZA 2XQCA 5D15A 3R5JB 4OI0A 4R0EA 4DR2J 1JLQA 3ONQA 1R8PA 1I94F 1HARA 2OLWA 3CE8A 1RKIA 2VIHA 2X1FA 4O0IA 3FFIA 5J2MB 1H7XA 1KHVA 2KVQE 2OUGA 2PFFB 4C8KA 1N5VA 4MAKA 3BSAA 2W7AA 1X0PA 3S8SA 1HWKA 4MKBA 2MGZA 1YJWS 1JLEA 3W3SA 1C1CA 4OX7A 3I9V9 2OPRB 3AXMA 4JYAJ 5HN0A 4G3IA 1C0TA 5KFQA 2P5VA 2DH8A 4NCGA 2C42A 1FRJA 1V3ZA 2Z8QA 1GXUA 4OYIA 1Y7PA 2W9BB 2HHUA 3FBEA 3FBBA 3Q22A 4IDKB 1K73T 3MI7X 1UTAA 4DQRA 1QD1A 1PC4A 3DYAA 2VA3A 1GTEA 1J5EF 2DEIA 4O3QA 1NDLA 3BH7B 5K5MA 1IJEB 4DLEA 1H74A 1WKJA 1B3TA 4DQIA 4GVLA 2XMKA 3HKZD 2RB7A 1LEOA 4P75A 3W64A 3MEKA 4U7CA 3TR5A 4DZ6A 4BWMA 3RW7A 4DSIA 5HANA 4DXLA 2DNOA 4HI2A 1KC8T 6AT1B 1RWPB 1C0UA 1YJVA 3MPUB 8RUCA 3CTRA 4FXVA 5DDRC 3TZYA 4NLGA 5B0CA 2DGXA 3K58A 2CPIA 1ZM9A 1YX2A 4RZRA 1WF0A 4L3NA 6FDRA 2FQQB 1M1GA 3BH6B 4I64A 8ATCB 1HNWJ 5D0RA 5HATA 1JLGA 1QAYA 4IR1A 2CJBA 2E7XA 5E3AA 1UP1A 2IDEA 2WZ1A 4F3OA 4DR1F 2DGWA 1MU2B 2YQ3A 3RYLA 4YDXA 1HMVA 2ZEJA 3R2DJ 2B9WA 2D3ZA 4HLBA 4RW7B 5I4MA 3N6MA 1H2VZ 3QPIA 2R2SA 5IFMA 4KBIA 1XTZA 1QTMA 5F3ZA 4C11A 2YX7A 1VQKS 1TL1A 3FZ2A 1RT7B 4CTAB 2EC0A 2J6UA 1N0UA 3PIPQ 1I5OB 5AJ3J 3QGHA 1S0NA 5B0EA 4PAAA 5A2QU 3ZZ0A 4ES2A 2YNFA 4LF9J 1IBCB 2DISA 4WXOA 2FJVA 1EARA 2RQ4A 1T9XA 4I2QA 2PT0A 4M5IA 2QIFA 3MM8B 3OW2R 3JQJA 1HNZF 3NGUA 3HDSA 3CCUS 4P2FA 3ZZRA 3ZTRA 4RU2A 4I6AA 4Z37A 1CC8A 4WE1B 3K5MA 5GAGU 4HT5A 5IXUA 1U1KA 1APSA 1MWYA 3H40A 2QSFA 2KXNB 5DG7A 3ZZTA 4M5NA 2D3UA 2GMJA 4LVNP 1OSCA 2DNNA 2AWZA 5T14A 4F26A 2HIQA 2PE8A 3P4UB 3GIRA 4DU7A 3MM5B 2H3EB 3OFGA 2G0CA 3HMJG 2L48A 3BQ0A 3JQMA 1VBZA 3UDCA 4O3PA 2KXFA 2O66A 4OJ1A 4MH8A 3THTA 2DNZA 1N34J 2CPHA 5D0GA 2ZH3A 4CT9A 2XS2A 1VBYA 3RW6A 4RNOA 2RKIB 2GHVC 2Y1IA 1WORA 3GFXA 4I0WA 1XERA 4CLUA 3F56A 3DC2A 3AD9C 1Q16B 3KTQA 2UUWA 1HLWA 2P6SA 1Q8IA 1JWWA 2HHSA 1VS3A 4IUFA 1Y11A 2C2RA 4BDPA 1U48A 2RQKA 2DO4A 3D6FB 3LOUA 1E6YB 1YJRA 1U2FA 3MFHA 1YDLA 3QJLA 3PJ9A 2BANB 2XGQA 3D7SB 5B0GA 4DUZJ 1GTHA 2ZH7A 5IQQA 2LFVA 3TAQA 3DLJA 2AX1A 1S72S 1IQZA 5DDOC 2J9EA 2UXDJ 1IM6A 2AT1B 1VK3A 3ULHA 3OTEA 4ID5B 4PCQA 3V81B 3C6UB 3GYNA 4DJBA 5DG8A 1NKBA 1OMSA 1P6TA 1NDKA 1SUQB 3HSDA 1RTJB 4GKJF 4NYZA 3HPOA 4M5HA 1HBMB 4NLRA 2CZ9A 5KFJA 1T05A 4GKKJ 1K9MT 3VQTA 3C14A 2W2MP 2KI2A 3GFHA 2FZKB 5HLFB 4ZLPA 4WWSA 1WNEA 2R8GA 1S0VA 1UPMB 2HBYB 2RSQA 4FF2A 4DV1J 1SL2A 3TVKA 2EK6A 1NDPA 4K0KJ 1KWMA 4NI2A 1X0FA 5AXNA 1LW2A 1IBLF 4C3LA 5HVFA 2YKNB 3GCXP 1KVKA 2Q79A 3BO3A 5J2NB 1F0XA 4P74A 1QY7A 2BXJA 1ACMB 2GHWA 2GVDA 5D0EA 1XMQF 3G86A 3HHDA 1SV5B 2RQMA 5AE1A 3SV4A 3VZHA 2W8LA 1QVGR 2HNZA 4BLGA 3MM7B 3PX4A 1YVFA 2DYAA 4B3SJ 2FZGB 4NLWA 3BGRB 2MQMA 5A0YB 2ADBA 1OO0B 2EFOA 2YPZA 4IFVB 5E0OA 3I4PA 4YS2A 4Y2MA 4FYWB 3ET6B 1VQYA 1XK8A 3T19A 2E66A 2YVSA 2EVZA 2ASDA 5ETSA 2XY5A 4ECVA 2GGPA 2K1RB 3MCMA 3GYGA 4DPUA 4OI6A 2IAJA 2C3YA 1U1OA 1JLBB 1KONA 2BRKA 2YWEA 1KLMB 1DQAA 1UCNA 3G6VA 2LDIA 1GMWD 1FERA 1I3OB 3KHRA 4ZK7M 1S9FA 4YR0A 4JI5J 4PG8A 3B6BA 3W2VA 3OQ2A 2HS3A 4WKRA 1K1SA 1JLQB 2HWTA 3WC2A 5FDLA 4KO0A 2MZSA 4CLLA 5C2CA 4L3KA 4ED8A 1X4FA 4JI8F 2ATCB 2V2ZA 2KDOA 3RUBL 4Q44A 1HNXJ 2CQBA 3H42A 1SH2A 4DEZA 3QT8A 1XWLA 2KB2A 3S7RA 3PDNA 4PYDA 4ZDNA 3TZXA 1KVJA 5B0BA 2ZHBA 1SIZA 2C28A 2IMWP 3H98A 5A8WA 2MGZB 3EPIA 1C1CB 2X3DA 1TL3A 3IA0A 5HK4A 4FKYA 2LEBA 2VQEJ 3NGDA 1C0TB 1QSLA 4JI2J 2VHGA 3MPDA 3D67A 4NCGB 1TK5A 1VHIA 4XDCA 2CQ3A 1R27B 1TKTA 4JUZA 1QAJA 3GWCA 2AP6A 2GNKA 4K4WA 3DYAB 1R6YA 3DCAA 4N47A 5IT9Y 5E2QA 4LFBF 2FJBB 3I56S 4ECXA 5KFXA 1IR0A 2ZJPQ 1FEEA 1XMOJ 1S4FA 3BS9A 1U26A 1FX4A 4FP9A 3H5UA 3K5OA 2R7VA 1N4LA 2MKHA 5T7LB 4USTA 2C3UA 3QQCD 3CPWR 3CMQA 5EWFA 3TUPA 3GP9A 3CCLS 1SJ4P 1T9UA 1F9HA 1H98A 2ZM6J 5KFUA 1JMTA 4HDGA 5AE2A 2N7CA 4ZPVR 3SEOA 2DEJA 4QIWD 4OLOA 2VPWB 2QO3A 2YBVA 3ILOA 2QFJA 3F44A 4O3RA 1X9MA 3OUYA 1XNRF 4F0KA 5JXSA 2C2ZB 1Q53A 2ZH4A 4GVBA 1U6FA 2QL7B 3IG1B 1N5TA 1CG2A 4FN5A 1RAJA 1LNQA 3K8VA 1HHTP 2YKPA 4RUHA 2LXUA 1GNKA 1Q81T 2ALZA 1HMVB 2IC3A 4DU8A 3KDNA 3HULA 1RTDA 4X66F 2QC3A 1CS4A 2NZ4A 2HQFA 2V67A 3G82A 3MHYA 4C11B 2MZJA 3IWLA 2VD3A 4O0NA 4ZVEA 1VJQA 3NP5A 1RAAB 1FX2A 1NPPA 2Z2ZA 4DR3J 4IH7A 4JV5F 3HKWA 3ADAC 3A4TA 4RW6A 2YNFB 5DJBA 2O67A 2IBKA 4P7TA 4HACA 3T6BA 2HBRB 3R5BA 4BBYA 4P7VA 2EFVA 1S6PA 4QYZK 5DETA 4I2QB 3VAHA 1RDRA 2QL5B 4I69A 2EC2A 2EI5A 3I82A 1O8BA 2CIMA 4IOCQ 2YQ1A 4HDHA 2K3IA 1T9TA 1HNVA 1VQ4S 2ROEA 3HSGA 2EKYA 3H2VE 3UNYA 1IR2A 5DQGA 4LBHA 4Q0BA 3TI0A 2XO6A 2IRYA 2MQNA 2MSTA 2NXEA 5ETQA 3HHNB 2X1GA 5KFOA 4QWCA 1RA6A 1WKKA 2HRTA 4ZPCA 3TX8A 5ETMA 2GIFA 3BO2A 2CNLB 3K0JA 4QIVA 2RUGA 2CPXA 1TELA 4MMOA 2UVUA 2H54B 2RNEA 2RF2A 2CPYA 2CJXB 4LVOP 2DH9A 5SUHA 1QLNA 5L38A 4O44A 1S76D 1HKAA 1T95A 1F6TA 1VRTB 1Y4ZB 4AQYF 1T9YA 3GCWP 4EMDA 2FVSA 3GSDA 3M8ZA 2ZZNA 4B3MF 3UVJA 1VIXA 3KMSA 1TKXA 2CQ2A 2I9SA 4NXNJ 3QO9A 1B0TA 5H9FJ 1X4HA 2DITA 1X9SA 4OYMA 1N33F 4DR4F 2FHKA 4X4OA 1BE4A 2YWKA 2IFXA 4DF4A 2H5IB 3NWGA 1YRXA 1PCAA 3DLLQ 5D6GA 2KFYA 1VCTA 2L9DA 1N52B 1RHQB 2YWHA 3PIOQ 4IOAQ 4KR0B 3FC9A 4USUA 2N3LA 4ED6A 4ZLLA 5LOQA 4ERDA 4IFYA 5IT4A 2J5AA 3DRPB 1FRIA 1Q5YA 4B3TJ 1HI0P 2KHDA 2NUHA 4ZVTB 4J9MA 4EUVA 4EEYA 1Z4UA 1YIJS 4DV0F 1T05B 3J7A1 3C14B 3PYEA 2LP4A 3OJUA 5KFSA 2RAQA 4XK8C 2H1YA 2HGLA 2ZOMA 3DMJB 1R0AA 4KIAA 1FWKA 1Y00A 4FBTA 5EN1A 4W4MA 2LQ8A 1HWIA 4ED0A 4Z2XA 4Q43A 3G8SA 5J1EB 2ZVSA 2QN6B 4FYVB 3JAMU 2YKQA 2LQ9A 3SYZA 4NI2B 5GAHI 1LW2B 4F2SA 3ETOA 5GMEA 4K2XA 5CYQA 1W7WA 3M8RA 4OX8A 5THWA 3CCWA 4UOFA 3PR5B 3FKBA 2ZZTA 3CCMS 2GVDB 2VFTA 5DS7A 3N6NA 1NO8A 3W5YA 3ZTSA 1YQHA 2QYGA 3MR5A 4K59A 4AXIA 4F8RA 3HXMA 2V4JA 3GG1A 2HNZB 5E7OB 2PO4A 2R7TA 4RBVA 3KYLA 2IM3A 3R5CA 1K47A 4C98A 2RHSB 3FEXB 2WVDA 1M0SA 1UWBA 4CNYA 2V4RA 3CCZA 4DV7J 1W2IA 2AW0A 4ANCA 3N01A 1UKUA 1X4CA 1EQ0A 3UCUP 1N48A 3LGHA 3VAIA 3I87A 1RYRA 2GGPB 5ETOA 2FJWA 4WZQA 2NS1B 3AA8A 1C4CA 1HI1A 2VKZG 1WHWA 2IAJB 3MMJA 3UD4P 2XY6A 3FGVA 5IT9U 1T0TV 2XZWA 1MROA 1NK7A 1TUWA 2L9NA 4OHYA 5FJ4A 4DR7F 2MKKA 3MCNA 4OFZA 2DNMA 5B0DA 2GW8A 1NAQA 5CCMA 4J37A 3KDOA 4DPWA 4IR9A 3UDVA 3PKMA 1NK0A 3FSYA 3EJMA 3M30A 1RTZA 2IJRA 5FDLB 3GIKA 3TW0A 4KO0B 4LF5F 4OJ3A 3BQ1A 5BYRA 4KGKA 3PO4A 2QFIA 2JC0A 2DPIA 4W90B 3SDEA 1OY6A 4OQJA 3GLJA 5H9EJ 4OX9F 1GT8A 4OZJA 2AYMA 3L09A 1NSKL 2VODA 4GMKA 3BF4A 2CNNB 4OHWA 2G1HA 2KM8C 2N4CA 5K8NA 4ILLA 1YJNS 3H20A 3OTBA 1IJFB 4ED3A 2CWKA 4Y28C 1TL3B 2PD1A 5F9NA 1WACA 4Y2CA 1S77D 1U1RA 4QPXA 2JSXA 4LR7A 5D8HB 2CNOB 4KFBA 1NKEA 3JTNA 3IWNC 2LU1A 2WW4A 2F40A 2Z58B 2YWGA 2VV5A 3BSOA 2K7KA 2ZE2A 3T1YF 1S1VA 3GU0A 3QWUA 2E7WA 1ZZFA 1TKTB 4ZOSA 2OD4A 3SQGA 1KRPA 2I0XA 2V5HG 5E5NA 1Z2ZA 5IZHA 2MKSA 3H5XA 2KYZA 4RJVA 3MD1A 3H4DA 1SKSA 4L72B 2F63A 4OIXA 3FUYA 4PRFA 3QFWA 1NJIT 2NCKL 3HFKA 1PKUA 1TZ0A 1N36F 3GIJA 3WX4A 5FIIA 3BPDA 3GJTB 4ECQA 1VQLS 4ZLNA 3PYGA 2KTQA 4KGXB 1ZAXA 4CH0S 1FVQA 4YY3J 3CDEA 4FYXB 1SC4B 3ZNJ1 4RU9A 3OTDA 2RRBA 1L3KA 3UDLA 1AUSL 1EP4A 2WVFA 3LP0A 3R6GB 3C2PA 1YG0A 2WRMA 2R42A 3PJWA 2CJKA 2AGPA 3DU5A 2D74B 3PCOB 1QAIA 3OUYB 1ZS6A 1S7HA 5CYJA 4ECZA 1PBUA 2BJ3A 1Q82T 4QQBA 4LSZB 4KV8A 4GO7X 3EX7B 1IKWA 4QPTA 4G6VB 1RAIB 2P9GA 2D3O1 2IC3B 3PRBA 3HFZB 3NMAA 1RTDB 5HJYA 4NEYA 3OVBA 2C3OA 1S97A 4P10A 2JLEA 2UXBF 2CJ9A 5F0WA 3HSZA 1R0BG 2HZVA 3IXQA 1XR6A 2UUCJ 4ZVHA 3MD3A 1U8SA 3GR0A 4OZ1A 2LKZA 3KK3A 5IWAF 3TZWA 2XMWA 4J9QA 2Z30B 4RW6B 4NLQA 1REVA 3BBFA 3D66A 3BV8A 2FY8A 5CZXA 1S6PB 1AFJA 1HFEL 3CDBA 1FDNA 3ISND 2Z2YB 5CD4H 4DFPA 4NCAA 3PW2A 3ZO7A 3GG0A 2J7WA 3P96A 2PMZD 4Q8FA 4KT0C 1BC6A 2VASA 2F4VF 4F4YA 3N0VA 1S4EA 3RR7A 1DAXA 2XLJA 4DL0C 1HNVB 3ZZOA 4YB1P 4V1Ak 3P6YC 1EHWA 1MN7A 2HVDA 2K8GA 3MR3A 4DL5A 1O6XA 3NNHA 4OZLA 4ZP7A 3HK2A 5L39A 1UAWA 2GA7A 4Q0BB 2K3KA 1GMWA 2OPSA 5KG1A 1BMQB 1KEKA 1OQ3A 4RKUC 2BEFA 5GAEI 4IH5A 3OL6A 1LXNA 5B7WA 2OPQA 4AD6A 4LREA 4DX6A 4F02A 4WFNQ 3HZGA 2Y1LB 2GIQA 1XBWA 3MF5A 1UW4A 3D3CJ 1JK9B 4DQPA 1D0EA 1JIHA 1QE1A 1S10A 3IO1A 3T41A 1K44A 1RHUB 5D3GA 2HFSA 3N28A 2CQHA 1YITS 4O44B 1XNQJ 3CCVS 3UN3A 4C2MA 2R2TA 4M5JA 1S1UA 2MJUA 2OP5A 1TV6A 4O4RA 2CPJA 2HRYA 1RLCL 1HA1A 4Y2AA 3UVJB 3CD5A 1IWGA 5KG5A 1TKXB 1T3NA 3W9JA 3QO9B 5KFYA 1VGYA 3PV8A 5JVGQ 3N5FA 4AL5A 3J7YU 2KH9A 3SI8A 3CJ8A 2V8GA 1FJGJ 1EQMA 5EUHA 2OH2A 2BE9B 5GAGI 4L73A 3CT9A 3WHIA 2WHOA 3DLGB 4JI6J 2XI3A 1MWQA 3G71S 1FRMA 1BWEA 4IFYB 2QMWA 3JYTA 4H4KA 4UT4A 5ITHA 2ASLA 5K20B 3QLHB 3TYTA 2HFVA 2GO8A 2BX6A 4USMA 1CLFA 4EI2A 3IRXA 4YHHF 1WI6A 4F50A 1J27A 3TA2A 3LWLA 1R0AB 1WJ9A 2HGNA 5L9XA 4KY3A 3CCJS 5LMUF 4QOTA 1U1QA 3L7PA 3RGIA 4I68A 4KGVB 3CVKA 1RXOB 1CSJA 2RU3A 3QRQA 2F5GA 1O51A 4LFCJ 5LSRA 5J2PA 3G8TA 3H8YA 3CJ0A 4ZVGA 5CYQB 4C7QA 4ETXA 3MOZA 4KGMA 3QSYB 2F8MA 4M5LA 3K5NA 3J81U 2QV6A 3IR7B 1YHQS 4QCLA 4NLVA 4CLWA 4W92B 1QTNB 4C0OC 3M9MB 1HPZA 2EW9A 4DL6A 2DRDA 1WSVA 1RB0A 3A3PB 2V4JB 3R2CJ 1XR5A 2YNIA 3A8KA 4NLSA 3FNNA 4NYPA 1TFWA 3OTOF 3VGTA 4YOEA 1NXIA 4UF4A 3MXHP 1UWBB 4NLYA 2LU2A 1TMJA 4PXEA 1LV5A 2E9TA 1RAGB 4MFBA 4ZVPB 3EVMA 1WC0A 1QSYA 2B9YA 5CH7B 1S9EA 1X8DA 3CDAA 1GXLA 1UJ6A 3JQKA 2VPZB 2PFDA 3VVUA 2B9EA 2XEXA 1F5BA 1BWVA 2R4FA 5EHHA 3RAMA 3VAKA 2M3DA 1FDAA 1ICEB 1RYSA 2V63A 4RW8A 2B0GA 4HVZA 3UO0A 1UEUA 4LJMA 1ROFA 2E1MC 2MLXA 1MROB 2ZBPA 1G2EA 2YWFA 1Y3JA 4PXBA 2Y3YA 3BREA 4A8OA 3UN5A 2E9ZA 1CULA 3GE9A 2AIRB 5I42A 1M5OC 1D9AA 1GQEA 3M30B 4DL3A 3Q8RB 4X62J 5KFCA 1C2PA 1DFDA 2VPYB 3BGFA 4ELVA 2V2KA 3MCSA 3ICLA 4DV3J 2ACYA 3TEGA 2GQ2A 3SDEB 1FFWB 4ECWA 1D8ZA 1A7GE 1MNEA 1J2VA 1RAOA 3OTCA 4DV5J 5LJ3Y 1AYEA 1VQ7S 4BWJA 2FB0A 4DV4F 1WWHA 5I3QA 3UD5A 4DPOA 4CQ1A 1RT6B 1V9OA 1AROP 3MAHA 4AL7A 2F4FA 4KFBB 2KM8B 3L7OA 2B5JA 1S1XA 2V34A 2E9RX 4B9NA 1XMBA 2ZE2B 4Q2LA 4ZVFA 1SC3B 2DR6A 5KFFA 4HHJA 4G1QA 4LFAJ 3SQGB 3EZ5A 1MW7A 4EBDA 2M5YA 1U6BA 1RHMB 1DBDA 4ELTA 4Q8EA 3HHLD 1FNMA 3E3XA 3WDOA 2OD6A 5K14A 5B09A 3G4SS 5CYMA 2QMXA 3N9UC 1M5PC 1ZA1B 3BB5A 1UVNA 4RNNA 3W60A 3BN7A 2CADA 3I9ZA 4RNFA 2WOMA 2V69A 3SBMA 3R9LA 3Q8PB 4DS4A 4TY8A 1YWXA 1VQ9S 1EP4B 4DSKA 4CNZA 3PM9A 3LP0B 2CJAA 2XHCA 3NG8A 1XR7A 1KSPA 4I4BA 2ZC3A 1NZAA 1YZ7A 4ED2A 4FS1A 4ZCIA 4QBUA 3Q8UA 4URGA 1RGVA 2RD5C 4KV8B 2VBYA 1HW9A 5KOWA 2GVZA 2R7UA 1IKWB 3A8EA 2HMIB 4NRUA 2MKYA 2MSSA 3MM6A 3VAJA 5IT0A 4A8WA 1MWZA 2C2NA 3B8HA 3FQLA 1I94J 3A3NB 2RILA 2GMLA 3G6ES 2BZ2A 4B17A 3OR2A 2Q43A 2OSRA 3CJQA 2BKPA 4K4UA 3H5YA 4A8MP 2MZQA 3OVSA 3KK3B 3NOGA 4ECUA 1N5SA 3VZIA 1REVB 2B9XA 3GJRB 3T9NA 3FBCA 1HBUA 1RCXB 2CJYB 3K8WA 4OV6A 4NOHA 2Z0GA 3KLGA 3CUNA 2J8SA 1RI7A 1G1XA 2VA2A 4OMFG 2XC9A 3PEHA 3R6LB 1FO1A 1N32F 5DO2A 2Q6BA 2EFQA 3ENVA 1DY3A 3NAHA 4M63A 3CC2S 2OEJA 4X4QA 1U49A 2DTJA 2Q6CA 1HL6A 1RAFB 2GQQA 2OIHA 2C22A 4OX6A 1F3FA 2RUSA 1J5EJ 5HMXA 5MLCV 3L9ZA 3ETMA 2NPIA 4NMXA 4JV1A 2UU9F 4DPYA 2B6AA 4RUCA 2OPQB 3MPWA 3WIUA 2QRRA 3OPKA 3HVRA 3VR1A 3A3OB 4DOZA 2VONA 1RADB 2CWXA 1VC5A 1FVSA 2QYCA 1RU2A 4CLTA 2BQ3A 1U2RA 1PJ5A 1H6KX 1PAUB 1TL4A 4WF9Q 2HFOA 4JI3F 5D3GB 4X64F 1T03A 1VRUB 2MQPA 2O01C 3T3FA 2HK2A 4E98A 4LBIA 3H90A 3DHXA 3A8JA 4TXSA 2M0GB 4UY85 2AGQA 1S1UB 4H4MA 4KAIA 4NLTA 1TV6B 5DM7Q 4WP9A 3MR6A 4DN9A 4PKDB 3R7NB 1S6QB 1IXKA 2Y8YA 4LR8A 1BXNA 3PO5A 4OZ0A 2ZBIA 2JFKA 1F1BB 3X1LB 2AEMA 4DR1J 3AJ1A 1PILA 5C25A 2OMLA 2EXUA 4MKVA 1AFIA 1S99A 3DU6A 2EFPA 3TVZA 2GO9A 4P73A 2FGOA 2N82B 3B4DA 3Q89A 5A6PA 5G4DA 3M2RA 1PIEA 4FPRA 7AT1B 2CJQA 1S0OA 2IYIA 3JYTB 3MCOA 1S6OA 3Q24A 4RW4A 4KRWA 2M9KA 5ETTA 3ZXWA 1SJ3P 2EFGA 3FVYA 2AJ2A 3IRXB 1GX6A 3Q8VA 1Q79A 4NYOA 2DNLA 3DRRA 4DFJA 4RWWA 2J76E 4M8LA 2GX8A 3PR4A 4N56A 4Y3CA 4WCEQ 1HNZJ 1NK8A 3VHQA 1C1BA 1RHRB 5J2PB 2BDPA 1FHTA 5A2QY 5A8KA 2RMLA 2W01A 5EX3A 2QLFB 2LEAA 2D3OR 4JI0F 3BGOP 3O2IA 2ZDOA 1U1LA 3BKTA 5HO4A 4BCAA 2I6WA 2BVZA 4OZNA 1N56A 5HI7A 5KFMA 3HLUA 1HPZB 4KTQA 2R2RA 3UN2A 3RZAA 3QIDA 1KDNA 3ITHA 1QDUB 1IBMF 4OZ2A 4RW9A 2BYCA 1Y5LB 1YBAA 2XNQA 2YNIB 1DTQA 2P2CB 1G7CB 4NA1A 1ZAVA 4LMZA 1CC7A 3GMGA 1N5YA 5EWGA 4WZMA 3U27A 4L75A 1Y5NB 4MFBB 2WTFA 3QRRA 3BPSP 2OHDA 2LQBA 5L1KA 3S01A 1S9EB 4J9VA 3MUVP 5IQ6A 3V4MA 5A8RB 3KJQB 3R5AA 5BYQA 3UPFA 5KG0A 4WTYA 4RW8B 5JJBA 3CXCR 3FSIA 1GEHA 2CXEA 1N88A 1U09A 5D4LA 1VQOS 3I4HX 2SXLA 2MQLA 1CULB 4W98A 2KT2A 5I42B 2RVJA 5BR8F 5LMNF 4O4GA 2KYXA 4EBCA 3CD7A 2V8DA 1S7IA 1XIQA 1RT2A 3VV2B 2ZOFA 2ROGA 4PG7A 1UEVA 4V19X 2B3TB 1SC1B 2A1BA 2DK2A 3RJMB 4GKJJ 1WEYA 3NGSA 3JS9A 3PW0A 2QLJB 1UJ5A 3J7AN 3UQSA 5F8MA 2YNGA 1V3RA 1EKRA 2RDJA 3N79A 2EWHA 3QNWB 2WAQD 2GHPA 3NCRA 2BUNA 4E2FB 2UUAF 2HVEA 3OD2A 1S49A 3O8WA 4URSA 1NDCA 4P71A 3T6JA 3P5BP 2IM1A 2QT7A 3C66A 2CQ4A 2ZWPA 2B5JB 1S1XB 2RH3A 3L3CA 2JNJA 3I32A 1HYSB 4H4OA 5IV3A 2W2QP 4C8OA 3LQVA 3CULA 4G1QB 5F8JA 2X3GA 3BKUA 2VBZA 3PHEA 1SQGA 1RCOB 4C8ZA 1XMQJ 4WFAQ 3ILJA 3CDUA 2FLPA 4LF4F 1T7PA 4B9MA 5K14B 4MK8A 2HVHA 5CYMB 1AW0A 3K57A 1VR6A 3ZFVA 4E0DA 3MEDA 1OJ4A 1Q8KA 2HZAA 1RHKB 3I0SA 5FLXU 2AJQA 2J8AA 3K5PA 5I3UA 2XMVA 2X1AA 3AA9A 5KFHA 3E01A 1BHNA 4CYUA 1R43A 1DTTA 3BN4A 2N3OA 3AT1B 2BJ7A 4R5PA 2WOMB 1VIOA 2Q3PA 1YRUA 1RTIB 3I6PA 2JEIA 5DLFA 3M6WA 2KN4A 2XZDB 3O5TB 4TY8B 4QU7A 1Q78A 4A8XA 2G2ZA 1JLCA 3I5BA 1YTYA 3GONA 2DY9A 2IYGA 3RB0A 5HROA 2DGOA 4Y2KA 1RA7A 3DRSA 3DFEA 4DHVA 1A9NB 3RR8A 1K0VA 1QAXA 3FMWA 1U0HA 2GVZB 4NL5A 4OI4A 1KTQA 3W5ZA 4EU0A 3MM6B 3Q8YA 4A46A 1ZA2B 2PEBA 5KFWA 3HVWA 2I5JB 2Y9HA 2VKRA 2E5GA 3TA0A 3MPYA 2VJVA 2NUUG 2Z56B 3OR2B 2D7SA 2ZHAA 2CG4A 1LWFA 4JI8J
chains in the Genus database with same CATH topology
2ZDPA 1M0SA 1SC6A 1UWBA 2ZJRQ 1X4EA 2E5HA 2GV1A 2AYEA 3O3LA 4CNYA 1UMJA 5I3UB 2V4RA 2HHPA 2IVFB 2HS0A 5F8LA 4F3MA 2ZH9A 1N8RT 1DARA 1VLYA 4CO1A 3CCZA 2CVEA 2PDAA 4FBUA 4PG4A 1EETA 4IO1A 2YX1A 3RAQA 1W2IA 3B4MA 3KK1B 2MKJA 1QVFR 3T9ZA 1SJQA 2WONB 2X51A 1VQPS 2PMHA 3I5CA 1WTFA 2AGOA 1WEZA 5LSLA 2AW0A 1HBUB 2FJAB 3VTIA 3PFOA 3N01A 1UKUA 1X4CA 2LXFA 3DM2B 3FEZA 1XEZA 3V2UC 2AU0A 1HW8A 3UCUP 4J9RA 1N48A 3VAIA 3I87A 3GFZA 1RYRA 2GGPB 3QMQA 1RKJA 3I31A 1LXJA 2FJWA 2COLA 4WZQA 4OLPA 2M2BA 2R8HA 2V8HA 2DVIA 2NS1B 3AA8A 3RBDA 2IM0A 1C4CA 2WK4A 3FRYA 2LEPA 3C8YA 1HI1A 2VKZG 1FKAF 1WHWA 3CMAS 2IAJB 2FVCA 3MMJA 2AJ4A 2OTLS 3UD4P 1CVJA 2KXHA 2XY6A 1X4GA 4JBCA 5KFLA 2MMYA 1NJWA 4RWXA 4ES1A 2DIVA 2HLUA 3FGVA 4RBTA 3MAQA 2R8KA 3U1NA 4ILRA 1LWCB 2F8EX 2IBOA 1R7IA 1HNWF 2FTRA 1Q4RA 4LFCF 1FKPB 4TQRA 2GC8A 5HROB 1Q8LA 2JEJA 4YFUA 2KT3A 2XZWA 2XHWA 1MROA 2BE2B 4AXJA 1NK7A 2L9NA 1SXLA 2R7SA 4OHYA 2HHWA 4X2BA 4A8QA 1U47A 1XN9A 5MAOA 5FJ4A 1M5SA 4DR7F 2MKKA 2W9CB 2MDAA 4PPZA 1FNXH 3P49B 4F25A 5LXYA 4OFZA 2NR0A 2M88A 2JH3A 2V4QA 3AQPA 2OMOA 4PWUA 4ZKAA 2DNMA 4DUYF 3U1MA 1NK6A 3QJPA 4P2SA 2MPUA 5B0DA 3LF0A 1WELA 1N6QA 5J1NA 5IM0A 3AJ2A 3HP6A 2GW8A 3RRGA 1NAQA 2KRRA 5CCMA 4J37A 4YMEA 3CMES 4IR9A 1E6VA 5E3QA 2VG5A 3DDNA 4RLEA 2B6AB 2XSJB 3PKMA 1NK0A 3FSYA 3MTKA 4G1PA 3KG4A 1OS5A 3M30A 2BQRA 3D54A 3NS6A 4Y0FA 5KFGA 4YR3A 4PQUA 3CJKA 5FDLB 3IGVA 2L9WA 3GIKA 5KT7A 3TW0A 3ZZPA 3MM5A 4KO0B 1U6ZA 5SZTA 2ZH5A 4F4KA 2EG2A 4OJ3A 2UP1A 4LF5F 3J80Y 2JHEA 4C0HA 5BYRA 3BQ1A 4KGKA 3PO4A 3UNGC 2JC0A 2VL1A 2OAUA 3UFCX 2I2YA 2DPIA 3BDPA 4W90B 3SDEA 4IQMA 1Q1KA 2BW2A 1DZ5A 2VG7B 1KNZA 4OQJA 4PXDA 4KHRA 4OJGA 3PW7A 5H9EJ 4ZPAA 4OX9F 3QIPA 1GT8A 2JFDA 1UJ4A 4FNHA 4OZJA 3FDSA 4NLPA 2XMMA 5AJ3F 2AYMA 2B4VA 3L09A 3OXGA 2ZH2A 2UVRA 5KT3A 2VODA 2HQ3A 4GMKA 1HWLA 4CT8A 1TVRB 1V6HA 3BF4A 1FXRA 1R31A 2XO7A 1HBOA 4DSJA 4C9DA 4OHWA 3KJVB 3RB4A 1H38A 1I6JA 1T03B 4Y2IA 3DLEA 2KM8C 1WTBA 1TKZA 4R25A 4IKAA 3NLCA 4Y6IA 2N4CA 5K8NA 4ILLA 2R8IA 5C24B 2OJ3A 1YJNS 3H20A 3SSSA 3UCGA 4LF9F 3OTBA 3RBEA 2JVOA 1L3VA 2UUBF 4DR5F 1IJFB 4ED3A 2JX2A 3SXLA 4Y28C 3CJ4A 5KFZA 1TL3B 4CH7A 1BY9A 2RKIA 2LA6A 2PD1A 5F9NA 1WACA 4Y2CA 2W25A 3RB3A 1U1RA 4QPXA 1FKOA 4UUWA 5DGAA 5F3TA 1S77D 3ZZZA 4TYBA 5EDWA 4U9RA 2HNYB 2JSXA 5D8HB 2LXIA 2R7XA 3DOKB 4WFBQ 2C2EA 4KFBA 1NKEA 3JTNA 3IWNC 2IVYA 2LU1A 1W2BR 5KFIA 2F40A 1NU4A 2KG1A 1H3DA 3NCPA 4XIUA 1IKVA 2YWGA 3M8QA 2VV5A 4ED5A 3N6LA 3BSOA 4DQSA 2DCLA 2G1DA 2K7KA 2ZE2A 3T1YF 1S1VA 3QWUA 2XB2D 2E7WA 3ISZA 1ZZFA 4XPEA 1TKTB 1VHFA 4HH0A 5HMYA 2KHCA 4ZOSA 1OIAA 4QU6A 2OD4A 2CQDA 4KQZA 3SMZA 3AB2B 4WIIA 2HVIA 2H9ZA 4TYAA 2FLOA 2ZNZA 4OI3A 2YNHA 1E6YA 4OI1A 3SQGA 4DG1A 2I0XA 2NYIA 2V5HG 5E5NA 5C25B 1KRPA 1Z2ZA 5IZHA 2MKSA 4N76A 3H5XA 3CJ5A 4FNIA 2KYZA 2BANA 2BJEA 3MOJB 3MEGA 2I38A 4IG3A 4N8NA 4C8YA 2CPZA 1UVLA 3MD1A 2XULA 3H4DA 1GXTA 3QAUA 4EGLA 1SKSA 4L72B 4OIXA 5EX0A 2DGQA 4ITSA 1U45A 3QGGA 4ZPWR 4QR2A 3BJYA 3Q2SC 4FF4A 4PRFA 4ZP6A 1NJIT 3I96A 3SSQA 3HFKA 5HMZA 4NMLA 1TZ0A 3PZPA 1N36F 4B08A 3IAS9 1KHWA 3GIJA 3WX4A 3Q23A 4ID5A 2QA4S 1ZTTA 5FIIA 3AHPA 2QZ8A 2FJEB 4M5DA 3KLHA 3V81A 2FLNA 1S1WB 2A3JA 3C6UA 4X62F 2VOPA 4PQUB 4IG0A 4ECTA 4QZVB 3BQ2A 2GIRA 1Q86T 1ZPWX 2BM1A 3HHLA 4AYBD 1U1NA 4ECQA 1VQLS 4CI0B 2KTQA 1R8BA 3IRWP 1R8HA 5GVQA 4K4VA 3JB9k 4DV3F 2UVWA 1ZAXA 3POTA 2OO4A 3ZZYA 4CH0S 1X4AA 4YB5A 3AAWB 4MTPA 4K50A 1SUQA 1RTJA 2XLIA 3D0GE 1FVQA 3CDEA 4A4JA 1DQ9A 1YGYA 3C3LA 3UE2A 3E51A 4RU9A 3BGUA 2Y0SD 4WK3A 5KTQA 2UZAA 5KFBA 3OTDA 1XC9A 2X1BA 3M6XA 2NPFA 1MMLA 1U24A 3D1QA 4AL6A 4DDFA 2RRBA 4I67A 1ULRA 4KC5A 1L3KA 3UDLA 1HWJA 2XS7A 4DBQA 4I6YA 1EP4A 1X9WA 4DV5F 1N34F 3CCSS 4ECYA 4X4VA 4DLGA 3TARA 1QJHA 2BM0A 3DI6A 3MURP 3DRRB 4ALZA 2L3MA 2HHTA 3LP0A 3HO1A 1H2UX 2XCAA 5CCLA 2LCWA 1QUPA 3C2PA 2V9WA 4ID8A 4UW2A 3VCDA 1YG0A 4DS5A 4QW9A 3V6JA 2WRMA 3WZ0A 3VAGA 2AX0A 2NLWA 5D4NA 3PJWA 2CJKA 2CZVC 2AGPA 2UUTA 1A6LA 3DU5A 2D74B 5AXKA 1C1BB 1WF2A 2V9KA 3H5SA 1QAIA 2WSCC 3OUYB 3CCRS 4IO9Q 1YJ9S 1S1TA 2HHXA 5GMKa 1S7HA 2RRNA 1PSDA 2GJIA 4D3GA 1NHUA 5A8KB 4WYWA 5CYJA 1SJ1A 3C6TA 3TNVA 3OSNA 4ECZA 1S79A 3DRXA 5HBMA 1Q82T 4QQBA 4R8UB 5F8IA 1S1VB 2VZ9A 2A18A 1JJHA 2YKNA 4KV8A 3DDKA 2CPEA 2WB1D 4GO7X 4LFAF 3EX7B 5J2NA 1IKWA 3OLBA 1W25A 3SZ2A 4J9NA 3JSMB 5CZVA 4QPTA 1P1TA 4EYHB 1RT1A 2BJDA 2YH1A 4WU3A 1SIWB 4G6VB 1K8AT 4YUDA 4LF8F 4NXMF 3TAPA 2P9GA 3MPVA 4WK1A 4DUZF 1SKWA 2M8HA 2P9CA 4TU9A 1RP5A 3H59A 3MMAA 4QWBA 3MEEB 2IC3B 3E8OA 5B0FA 1HQUA 3PRBA 4ZHRA 3NMAA 1SV5A 3OV7A 5HQ8A 4TU7A 4B3OB 1ZBTA 4WFXA 2OSQA 1RTDB 4RW9B 3TP2A 4X65F 2JC1A 2UXDF 1NHVA 2EBEA 3KLFB 2C3OA 3OVBA 2AJ0A 3QWPA 1B7FA 3IWXA 3D1HA 3TUJC 4FS2A 1VQMS 1S97A 5F9LA 1VJWA 1SJFA 2JLEA