2KVIA

Structure of nab3 rrm
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
PKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFGKKLILEVSSSNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Nuclear polyadenylated RNA-binding protein 3
publication title Solution structure and RNA-binding study of RNA-recognition motif of Nab3
rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kviA00
1WG4A 1BY9A 1KOOA 3PIOQ 3TP2A 4LMZA 3R27A 4W90B 4TU8A 1M5KC 5IQQA 2KRRA 1X4HA 2MKCA 5GVQA 1KC8T 1YI2S 2XS2A 1VQ4S 2DGVA 1VQ9S 2YH0A 3BS9A 1D9AA 3BO3A 1G2EA 2WBRA 1JJ2R 2DNOA 2M7SA 3RW6A 1WF0A 1NU4A 2KI2A 1H6KX 3SXLA 2LYVA 2M52A 5CXTA 2JRSA 3LQVA 5D78A 1N54B 2XB2D 3NNCA 2I2YA 3Q2SC 2YWKA 2XNQA 1Q86T 1M90T 3G8TA 2MSTA 4QU6A 1FJ7A 1SJFA 1P27B 2FPHX 5JVHQ 2DNQA 4QPTA 1PGZA 1R8PA 3ZZYA 2CQHA 3BO2A 2MQMA 1RK8A 4C7QA 1VQOS 2BZ2A 1VQLS 2QEXS 3VALA 2G0CA 3HI9A 1OPIA 2KG1A 1AUDA 2M0GB 1WHXA 2MMYA 3R1HA 3U1MA 1SJ4P 2MB0B 4YUDA 2KXFA 5EN1A 2KG0A 1N88A 2NZ4A 3CULA 4V19X 3CXCR 1HL6A 2JVOA 2MQLA 5DETA 2N7CA 2KN4A 2MYFA 1WEZA 4A8XA 2MQOA 4W92B 1S72S 2XNRA 3K0JA 4TU9A 2KXNB 2DO0A 1DHMA 2YKAA 5LXYA 3CC7S 2CPZA 2PE8A 4WIIA 2DNHA 2MKKA 3G6ES 1FNXH 1VQ8S 2Q79A 2MJNA 2X1GA 3UD4P 4QU7A 3S01A 3CC2S 2N82B 2FC9A 2CQGA 2LCWA 4FXWA 3I56S 3CTRA 1SJ3P 1VC5A 1WG1A 1K73T 2MJUA 1YITS 4TU7A 2DHAA 2LQ5A 1S79A 2BOPA 3MUVP 2LECA 1ZH5A 2E5HA 2XS7A 1P1TA 2GHPA 1UFWA 2E44A 2DH8A 4CIOA 1W2BR 2DNRA 4J5OA 1WHWA 2KT5A 2JWNA 4YOEA 2VOOA 2OJ3A 2YTCA 2SXLA 2MZQA 2DGTA 4YB1P 4F25A 2A3JA 2CPHA 2DGQA 5FJ4A 1K9MT 2F3JA 5IM0A 4IUFA 1CVJA 2DB1A 2D9PA 2DNLA 2U2FA 2AD9A 5GMKa 2J0SD 1YJWS 2DHXA 1YJNS 2E5IA 2MZRA 3IWNC 3CMAS 4QQBA 1OO0B 2MQNA 5CA5A 3S7RA 2OTJS 3UE2A 2U1AA 2DH7A 3G4SS 2CQ4A 2RQCA 1KQSR 3SDEB 4IOCQ 4PKDB 2V94A 4ED5A 2GO9A 2M8DB 2DNKA 1VQ6S 2K8GA 1U1QA 5ITHA 3L3CA 2DO4A 2L9WA 1X4DA 5LSOA 1WF1A 2CPIA 2VODA 1VQNS 5GAGU 1H2TZ 2ZJRQ 2MQPA 3MURP 2RQ4A 2MKSA 1SJQA 2FY1A 1A9NB 3SDEA 3B4DA 1X4AA 2CQ0A 2RNEA 2FC8A 1K8AT 3IRWP 1PO6A 1X4GA 2MY7A 2AYGA 2N3LA 1A7GE 3CMES 2ZJQQ 1YTYA 2M4MA 1U1PA 2M8HA 3UD3P 1SXLA 2MKIA 1U1OA 3TYTA 1F9FA 1OIAA 2RRBA 2DGXA 3SMZA 1XN9A 3MUMP 1Q7YT 1WWHA 4Z2XA 3VAMA 1WEYA 2LXUA 2CPXA 1DBDA 2AYMA 3NMRA 2QFJA 2DNPA 1JJHA 3J7YU 2VOPA 3OW2R 2LA4A 2RS8A 3VAHA 3MXHP 2DGWA 3J7ZT 2ADCA 3CD6S 2MZSA 2KYXA 1WTBA 3S6EA 3NS5A 3VAGA 1WHYA 5HO4A 2J0QD 1ZZNA 1HD0A 1URNA 1HA1A 1X5SA 3Q2TC 2OSRA 4ZKAA 3MOJB 1IQTA 1R8HA 2CQBA 4C0OC 2X1BA 2KM8C 2CQCA 1NJIT 5DDPC 1M5OC 3CC4S 1X5OA 1X4EA 3FEYB 2JVRA 5DM6Q 2HGMA 3ULHA 3MUTP 1U1KA 2K3KA 2XS5A 4ERDA 3VF0B 2LMIA 3D2WA 4CQ1A 5LJ5Y 3LPYA 3RW7A 2D3OR 4LJMA 3CCLS 2LXIA 2HVZA 1WELA 1HD1A 5JVGQ 3HHNB 5GAEU 2DGSA 3CPWR 3ZZZA 2DHSA 4WF9Q 2MZTA 5MLCV 4M5DB 4UQTA 2KXHA 5IFMA 2XSFA 2MGZB 2CQ3A 3FEXB 2CQDA 4WCEQ 2MZJA 3MD3A 3B4MA 1U6BA 1YHQS 4WFNQ 2DGOA 3CCVS 2AYEA 1M5PC 2HZCA 1U6FA 1VQMS 2ZJPQ 2VONA 2KVIA 1WF2A 3N9UC 3G9CA 2L08A 2DIVA 2MY8A 1QVFR 2DH9A 3DXBA 1YJ9S 1VBYA 2MGZA 2RU3A 2X1FA 3PIPQ 5D77A 1N52B 3NNHA 2PEHA 5DDQC 4F26A 1YWXA 2DNGA 2EVZA 2LA6A 2MKHA 5DDOC 4PRFA 3P49B 2DIUA 2M88A 3EGZA 5LXRA 3DLLQ 2J8AA 2EK1A 2KFYA 1X4FA 2CPYA 1VBZA 3NS6A 1KD1T 3CCSS 4WKRA 1M1KT 4CH1A 3EX7B 4BS2A 2HGNA 1WG5A 2CJKA 2CQIA 2KH9A 5DDRC 4EGLA 3G96A 3THPA 1RKJA 1VQPS 3CUNA 2CQPA 1VBXA 4U67Q 1ZZFA 2RT3A 2N3OA 3G71S 2AYBA 3CF5Q 1H2VZ 5HL7Q 3I55S 2MZ1A 2DK2A 3CCJS 5DM7Q 2DITA 3VAIA 1Q81T 1WI8A 4OZ1A 2KM8B 1UAWA 1U1MA 3G8SA 2FHOB 1DZ5A 4LIRA 3TO8A 2JX2A 5CYJA 2CPFA 2NLWA 1U1LA 1N8RT 1UW4A 1WI6A 2KU7A 4TLQA 1JJ4A 1X0FA 2QA4S 3BO4A 2D9OA 1KOHA 3H2UB 3UCUP 3CCQS 1U1RA 3VAFA 1B7FA 2DHGA 2MKJA 3MI7X 1FJCA 5GADU 2ADBA 3CCES 3R1LA 1FJEB 5GAHU 1X5PA 1QVGR 1X4CA 1U1NA 2OIHA 2KHCA 3THTA 4F02A 2RUGA 4Y00A 2DNZA 2MQQA 4CH0S 1Q82T 5H1SV 1WHVA 2E5GA 2MHNA 3VAJA 2MXYA 1VC6A 4C4WA 2UP1A 3P3DA 1O0PA 2CPJA 3MD1A 5BJRA 1H2UX 2J76E 2G1DA 1SJRA 4P6QA 2O3DA 3UCGA 2F9JA 3JB9k 3EGNA 1FXLA 4WFAQ 2ERRA 3P6YC 1U2FA 2DNYA 2EK6A 3MDFA 3BEGB 3UWTA 4FXVA 3CCRS 2DISA 1DRZA 1FO1A 1WEXA 1VQ7S 2L41A 2LEAA 2M70A 4WFBQ 2DNMA 1L3KA 1X4BA 3U1LA 4UY8T 2CQ1A 4Y0FA 2X1AA 5IM0B 1VQ5S 1FT8A 3V4MA 2DGUA 2E5JA 4RU2A 2M2BA 4OZ0A 2MPUA 2DNNA 2OSQA 2CPEA 1QM9A 3US5A 2KRBA 2M9KA 1VQKS 2I38A 2CPDA 2G4BA 3VAKA 3S8SA 2LEBA 2RVJA 2MSSA 2CQ2A 4PR6A 3CCUS 1FHTA 5LSLA 2LKZA 1NO8A 2HYIB 2YH1A 2RS2A 3CCMS 3NNAA 3H2VE 4IOAQ 5LJ3Y 2RRAA 3P5TL 4IO9Q 2HGLA 1VC0A 1X5TA 1JMTA 1OWXA 1M5VC 3UCZP 1UP1A 2B0GA 1D8ZA 2OTLS 2F9DA 1YIJS
chains in the Genus database with same CATH superfamily
2D7SA 4H4MB 2FY8A 3I0SB 2QX0A 3NG8A 3Q8QB 4RJVA 4Y65A 4WZQA 4C11B 4TY8B 4H4KC 2UUCJ 1JJ2R 4C8ZA 1C4AA 2IRYA 5CD4A 3QNWB 3G6VA 1PAUB 4IRCA 2R8IA 1Q86T 5F8MA 1T9TA 1S6PA 1M90T 2FLPA 3QMQA 2C2MB 1RK8A 1VQLS 1GEHA 1AUDA 1VYAA 1FERA 5JMNA 4YUDA 2E1RA 3KUGA 4LRBA 1T05B 3ENWA 1TMMA 1KNZA 5DETA 2PMWA 1LFWA 3M30A 1FRHA 2A6OA 4F4KA 1I1GA 5KFPA 3HZGA 1X60A 1XR7A 3FQLA 4QW8A 4J90A 2HQCA 3MOZA 3C15B 2E1CA 4DPXA 2B7CB 1QUPA 2JEJA 2CADA 1A6LA 2VG5B 4MK9A 2RIJA 2AJ0A 3R6LB 4HKQA 4A4JA 2A6MA 2BJ7A 2VOOA 3BF4A 3IRXB 2DGQA 1HMVA 2JL9A 1AZSA 2A2CA 1HQ2A 4IUFA 3MPDA 2D9PA 2DNLA 4NA1A 5J2NB 3CDBA 4GO5X 4RPFA 4Q0BA 2LXFA 2U1AA 3H25A 2GVDB 3Q22A 2ZH1A 2C28A 2VPYB 1WKLA 3GLJA 4H4KA 2VFUA 5KFZA 1UMJA 1LNQA 2IVFB 3DLGB 3NGRA 1CBKA 4ETZA 3RJMB 2H65B 3B4DA 2DR8A 4YHHJ 5D0EA 4ECSA 1Y11A 1PO6A 4M95A 4F8RA 1KRPA 1IBLF 2GQCA 1LW0B 2V8HA 4ICLA 3QO9B 5L1IA 2C3MA 1Q7YT 1UVMA 2ATCB 2CPXA 1F60B 1TAQA 2PA8D 2DGWA 3MPYA 2O5DA 2HRYA 5DQIA 5LT5A 1YKWA 2HGMA 2AJ4A 3NCPA 2VQEF 3JAMU 4DR5J 4A8FA 3CJ5A 1Q8IA 2BOAA 2ZOFA 2P8IA 2XWYA 4FYVB 5CZVA 5KG0A 1P9YA 1RLDA 4DI6A 3ZNJ1 4WF9Q 1L3SA 3HXMA 4DV6J 3LUYA 1OYDA 1YRUA 2MZJA 5BR8J 4CLWA 5CQGA 1OPZA 1U6BA 3QGPA 1UJ6A 4ZP7A 3VZIA 2DXFA 5HVGA 1UA0A 5EWFA 4RW6A 5A6WA 3G9CA 4KY3A 3MCOA 1WORA 3H20A 2X1FA 1FWLA 1O6XA 2A10A 4NLPA 2W9CB 1OSDA 4X4NA 4PRFA 5D0GA 4DPTA 3DHWC 4CO0A 2OLWA 2KL8A 1LWCB 1HNZJ 2UVWA 1RHKB 2XSJA 3LP0B 2DRAA 3EX7B 4V1Ak 2QT7A 5J2PB 3OXLA 3IWLA 4XPEA 3QWPA 1RKJA 4LF7F 1HNIA 3L9ZA 5AXLA 4CDIA 1XJWB 2DK2A 2FLNA 2EW9A 4JI0J 3CIZA 3T5KA 3T1YJ 3BM7A 3PDNA 2AQ4A 5C25A 1VRUB 3PHEA 4LVNP 1FJGF 1S5ZA 3EGVA 1WI6A 2XY7A 1RAEB 5KFIA 1JLAA 2AEFA 5GADU 2VQFF 2J0XA 3T3FA 1QVGR 4UOCA 4KIAA 2IVYA 4RX6A 2E5LJ 3AJDA 3OXGA 2DNZA 2P9GA 1VC6A 2HRUA 2KO1A 1H2UX 2J76E 3UCGA 3QLHA 2Q1LA 2V69A 2GJFA 3BGLA 2DNYA 5F8JA 4M94A 2ZDPA 3R2DJ 3AJ2A 4K59A 1VQ5S 3TEGA 1EX8A 5HJXA 3MZIA 1ZETA 5KFGA 4GKKF 3VAKA 1QAJA 5KT6A 1HWIA 1XNRJ 4Q2LA 4DL5A 4FKYA 2ZH4A 4KC5A 2B0GA 1WKJA 4O3NA 4FBUA 2XO6A 4KHRA 4JI4F 3BGRB 4RKUC 1M5KC 5IQQA 3GIRA 1VQYA 1QE1B 3PCOB 1KEKA 4YR3A 1Y3KA 3ET6B 3PJWA 4OI6A 1GMUA 3OJSA 3SXLA 3LOUA 3ENVA 5I42B 5JVHQ 2DNQA 1HIYA 4DFKA 2YBVA 3KLHB 2G0CA 4EK2A 1H7XA 1JJCB 3H5YA 2ZZMA 5L1KA 2YPYA 5K14A 4DV4F 2F63A 5K8MA 4CP5A 5JJBA 1M1HA 4IG3A 3K0JA 2KXNB 3H2LA 3BSAA 2BRKA 4ZITA 2WSFC 2AP6A 5B7WA 1S1WA 2GZOA 4A8YA 1XC9A 3DLKA 1CS4B 4U9RA 3VTIA 3GV8B 2WHOA 4OZ2A 1KTQA 3WQPA 2HHXA 1RABB 3E8OA 5DO2A 2HNDB 1Y5LB 2A1BA 1VQSA 4U6PA 4KTQA 2MZQA 2DGTA 4YB1P 1ZM9A 1Q8KA 1XBWA 2DB1A 4OYOA 2MQ8A 3R5CA 4JP8A 3CO9A 4HHHA 2FJBB 2CFXA 2P6SA 1VRTB 1QAXA 1KQFB 3SDEB 4IOCQ 1ULRA 4I0WA 1MNEA 4A48A 3A8JA 2RHQB 5AXKA 4PXDA 1LV5A 3M8RA 1CSJA 2JOQA 3ZZTA 1LFPA 1VQNS 4DR4J 2H5EA 3W8GA 4USWA 3NGSA 4O44B 1RAOA 5A8RB 3IM8A 3POTB 3V6DA 4DR7F 3NCRA 4KR0B 3NKYA 4K4VA 2HW3A 4DZ6A 3RRGA 4ZPVR 2G9OA 4O4GA 5KFQA 4PWUA 4K4ZA 3VZHA 3OW2R 4QW9A 3MR2A 2E7VA 5KFMA 1HWKA 2O01C 1NH7A 2H9ZA 2MZSA 2KYXA 4KBIA 4KH0B 1NK4A 4ZKAA 1UVNA 2CZ4A 5IWAJ 2AEMA 2OPPB 2YKOA 2HVEA 2J0WA 3CCLS 2KYZA 3N6LA 4HDHA 3J80U 1RTDA 4M5KA 2BJDA 4R25A 4G1QA 1ZA1B 2YWGA 3B8HA 5J1EB 2AGPA 1MLAA 5H9FJ 3ETMA 1VK3A 3PW4A 3PV8A 1RTHA 3DM2B 4RWXA 3DXBA 3IR7B 2CJ9A 5KFWA 2NXNA 2CXEA 4F26A 1SKUB 3EGZA 3DFEA 4ILMA 3WX8A 3CT9A 5G4DA 5HP1A 2XY6A 4ZOSA 2BXJA 1CC7A 4LF9F 2FGOA 2N4CA 4U67Q 2NXCA 4A8KA 1Z2LA 1J27A 5EGYA 3MR3A 3PX0A 2ROPA 5J2MB 2RRNA 2KM8B 2OH2A 1PG5B 2HBRB 4OYPA 5T41A 2WVBA 2KU7A 4B9UA 2D9OA 3DRRB 1U09A 5GAHU 2FZKB 3BKTA 5D4PA 1FXRA 5KFXA 2MQQA 1Q82T 5H1SV 1R6YA 2MHNA 3KKFA 2DY1A 2P5VA 1R0CB 2QYGA 2Q66A 4NLSA 5AE2A 3EGNA 1IKVA 2IFXA 1G1XA 1SC6A 1FO1A 4OX8A 2M70A 4GRSA 4F4WA 3GYGA 3M8PA 4RU2A 2V5HG 2ZKUA 1Q5VA 2OSQA 2PFFB 3OR2B 3H4BA 4PR6A 4DV3F 2GAHC 3LP2A 3SV3A 5LJ3Y 3JQJA 3P5TL 4F2RA 2V68A 3LWMA 1UP1A 2G13A 4NLVA 5KG3A 5ETRA 3TJAA 3TANA 5HQ8A 4LMZA 4W90B 3CJKB 5KT5A 4EI2A 3LA0A 2ZITA 5J1PA 4NYZA 3M1VB 1DQ8A 1AUSL 2Y3YA 4CWBA 1C0TB 3I9ZA 3H42A 3F73A 5K8NA 2BRLA 1A0OB 3IMQJ 3TW0A 4ECWA 3AOCA 5C42A 4L6V3 2D1CA 4R0EA 1CJUA 4IKAA 1NK0A 1Q4RA 1VQOS 5IT9U 3MECA 4YN3B 1UW9A 3NCQA 1WHXA 1O8BA 2W25A 1W25A 1SJ4P 2Y8YA 2K1RA 4ZS6A 4U8YA 1BLUA 3A8IA 3MAHA 2KN4A 4ATNA 1TQLA 2OPQA 4C0HA 2QFIA 3LGMA 2FUG9 1XEZA 3AJ1A 2NR0A 4YEAA 2BDPA 1X31C 3MHYA 4PG7A 1T0TV 4IH5A 1S6QB 1HQEA 2GA7A 2YKPA 1K73T 4CT8A 4Q7AA 2IM0A 1M0SA 3NGDA 1SL1A 3MMAA 2DH8A 2DNRA 1WHWA 3R2CJ 1S9GA 2Y0BB 2FHMA 2Z2MA 4DF4A 1T94A 4FBTA 3CJ4A 2AD9A 1WC0A 3EYZA 1HBUB 1UVJA 2HIQA 3G82A 4AXJA 3CB4A 2HVHA 1TL3A 2ZC3A 2NPIA 4RBUA 3KLEB 1P6TA 3BPSP 2HKEA 4QR0A 3W9HA 3UQSA 3Q0AA 1WF1A 5JUMA 1I51B 2HURA 3UVJB 2C2OB 5DLGA 3VQTA 1EP4A 1T9XA 2QL9B 1HBMA 2H51B 2BM1A 1X4AA 2W7OA 2PT0A 4RNHA 5HI7A 2ZZNA 2M8HA 1JNRB 2ZVSA 3H59A 3UPFA 4DG1B 3Q86A 4KGKA 2ZBCA 2YNHB 3R7BB 3VAHA 3I4HX 1TK0A 1V3ZA 4LF6J 2AV5A 1WHYA 1TTHB 4DPYA 4JI1J 3UDEA 3CJQA 3T1AA 1WC5A 2H4YB 2VC1A 3BSNA 1CJKB 1S9EA 2C3OA 2MTLA 4NX9A 4YDDB 2K3KA 2BANA 3OJUA 2LU1A 1OY6A 2LXIA 2ROGA 2BE2A 2BKNA 1MMLA 3DHXA 3T9ZA 1IBCB 3ENQA 1VJWA 4J9MA 4JV2A 4B9NA 2XZWA 1LWFB 1WUUA 3CCVS 1EETA 1ZPWX 2VONA 4B3RJ 1K47A 2UUWA 3J81j 3SQGA 3HFZB 3I5AA 3OHAA 1YJUA 1HKAA 2DHHA 1RT3A 2NCKL 3EE3A 1VR6A 2QLJB 5LOQA 3RB4A 4EUVA 4O3OA 1ZAVA 1KD1T 3K2YA 3ZTOA 2O1PA 1Y5NB 2DYAA 3D6HB 1WC6A 3QIPA 1SUQA 4GVBB 5HANA 3OVAA 2N3OA 3PJXA 3PTWA 5DM7Q 4S0MA 1SQFA 4XAKA 4M63A 2YKMA 4Y2CA 5CYQA 3TO8A 1U1LA 2YVSA 3HLUA 3MEDA 3UCUP 1H98A 4O3SA 4LREA 3R1LA 4DF8A 1UPMB 4CRJA 2ZBIA 2V8VA 9ATCB 4RNOA 3MEEA 3VWSA 1HYSB 2UUBF 2VV5A 1TUWA 1QD1A 3DGPA 3EDQB 3M2RB 1F2GA 2HS4A 2LQJA 1U2FA 1F2HA 4O3QA 5A76A 2OKQA 2ILZA 4IYQA 4OZ0A 2MPUA 2DNNA 1FRKA 3KLGB 2M9KA 2IPOB 3LAMA 3V81B 4W4MA 4YDXA 3D66A 1TELA 4CNZA 3M8QA 4M8LA 4D3HA 5E3QA 4FF2A 1N4LA 2F4FA 3VGUA 2L9NA 2V9WA 2LDIA 1NKEA 4KQZA 2X7IA 2EI5A 1KOOA 3CVKA 4F4ZA 4UY85 2KRRA 1YI2S 1HR0F 1S6PB 2DEIA 3R6GB 2Z30B 2M7SA 4ZA1A 5ADZA 4X4QA 3HHDA 1GX6A 3C46A 1RT4B 4OL8A 3MFIA 2GHVC 5E3CA 1SJFA 5FLXY 3PR4A 2ALZA 1IBMJ 4DV5F 2AJFE 3M30B 3LP1A 4QPXA 4FPIA 2FVCA 4ZVSB 2MMYA 1FRMA 5HATA 1Y00A 4TNOA 1R0AA 4DR2F 4DX7A 3JSMA 3PHTA 3EZ5A 2YPZA 4ZPTR 1IR2A 2FTRA 4JI3F 2DNHA 1RHRB 3I0RA 2HS3A 4G65A 3K8WA 3RB0A 5L1JA 4OYWA 4GC7A 4XPCA 1HMVB 1AZSB 4PWDA 2DHAA 2V63A 2VU5A 4DV2F 2PN6A 4Q0BB 4P75A 5B0CA 8AT1B 5GADI 4RR5A 1YBTA 3TA1A 1NDLA 4LF4F 2XY5A 2BA9A 4QIFA 3GYNA 4Y6IA 1YJRA 1SV5A 2P6TA 2Y1JA 1FVSA 1FF2A 5L39A 2R7RA 4KT0C 2N4DA 3W5ZA 4NOHA 3TX0A 1DTQA 1TV6A 4M5NA 4DQQA 3MM6B 1SL0A 3ZNUA 3TA2A 3BBBA 3IRWP 2MY7A 1EQ0A 2AYGA 2VA3A 4L76A 2B8PA 2XWXA 4XDCA 3KG4A 3W7BA 4DEZA 1RWUA 2LXUA 2KFZA 2QFJA 3AQOA 1CJVA 3FKBA 3BSOA 4N77A 1SC3B 3M8YA 1BE4A 1TUVA 4DFJA 3FJ2A 1RP5A 3TX8A 4ZPAA 1H0HB 4PAAA 3QZ8A 1XMQJ 1NJIT 3Q24A 1YJVA 1FRLA 3LANA 4K4XA 2JDJA 1U1KA 5AXMA 4ERDA 3DRPA 4LUBA 5B0FA 3OL8A 2B9YA 1XIQA 4RW6B 4J9RA 4DR6F 1P8GA 1RCXB 2RDIA 4ZCKA 2IC3A 5M2RA 4OJ3A 5CABA 4ECXA 4BC7A 2BJEA 2ZM6J 2ZJPQ 1NJZA 1DJ0A 2KVIA 1YG0A 3MTJA 2XSJB 4WXWA 4ECTA 3QT8A 4URSA 3TAQA 1KFSA 2A0FB 5DQHA 2GNKA 1U0HA 1T95A 4TYAA 1CJTB 1HNIB 1RAFB 2M88A 1BD6A 4OI1A 2R7OA 4IRDA 1FDAA 5C25B 2CQIA 3B54A 1YDLA 1E6VB 3CUNA 3GSDA 2FVPA 3HM9A 1FNMA 1AXQA 5F3ZA 2KZMA 1H38A 4KH1B 1X8DA 2PC6A 3HSGA 2MKJA 3NOGA 1R27B 3T19A 4KYZA 3QLHB 1OMSA 3TQEA 3J7A1 3OVBA 2HEKA 3BN4A 4QWCA 4MT1A 2DJWA 4RLEA 2KJWA 3M8WA 4PCQA 5T14A 4J9PA 1AFJA 2ZEJA 2QLFB 2ZWOA 4A8QA 1NDCA 4IG0B 4DV1F 1SI9A 4C9DA 1TVRB 4JV5J 4F7VA 1BQNA 3W8PA 2CNKB 5K5MA 1FHTA 4MAKA 3BSCA 4FP9A 3WBZA 3W63A 2W4DA 3DI6A 2R7VA 4B3MF 4KHMA 3NAIA 2OTLS 2ROEA 2ZE2B 4QR2A 2DCLA 4I56A 4QIVA 2MKCA 3DXSX 3KMQA 5M2UA 2IJNA 3OTOF 1NMEB 1NKBA 2F5GA 1HW9A 4ZP8A 2XB2D 3NNCA 2YWKA 2XULA 2BMBA 3G8TA 3BDEA 3AY0A 1EHWA 3M2VA 5K14B 2WSEC 1ACMB 2QEXS 4IG3B 2KG1A 2M0GB 4F3OA 2IRUA 5ETVA 1UL3A 4B02A 5T7LA 2R2UA 1TR0A 4CM2A 2WVCA 1NKCA 2BJ3A 4DUZF 4IQXA 4OHVA 1TL7A 1X9WA 3L7UA 1UTAA 2XNRA 3QJPA 4HT7A 4IH6A 1S1WB 3ZTQA 5AE3A 3DLKB 3C16A 1Z4UA 4NE9C 4AL6A 3R3TA 2X1GA 2K06A 2H1YA 3VCDA 3W1YC 5F9LA 1UPPA 2Q6CA 4OZJA 5KFVA 1SQGA 2E1AA 1AA1B 4AYBD 2FVRA 2MJUA 1MWZA 2C2ZB 4YY3J 4P2XA 4IDKA 2R7SA 2V0NA 2A3JA 2CPHA 3RGIA 1JLBB 1JNZB 5IM0A 3KHGA 4R8UA 2E5IA 4AL7A 2AJ1A 3CMAS 3TR5A 2Y8WA 3UE2A 1ZTTA 3QFHA 2LVWA 1BWVA 1RB0A 4CLYA 5DRKA 4Q5VA 2QA4G 3BGUA 3V6DB 3TOQA 5DGBA 1X4DA 1JLEA 5GAGU 1D8YA 2W4PA 1FDNA 2NZCA 3MURP 2RQ4A 1WC3A 4DN0A 1XR6A 2C2EA 4O4GB 3T9NA 2VUGA 3DCAA 1HNXF 4NXNF 3O5TB 1RWOB 2M4MA 3Q8UA 1DTTA 3UD3P 2FVSA 3M32B 1B4SA 2AMCB 3A12A 5B0BA 1WWHA 1WEYA 1GT8A 1JXEA 3DKDA 3HVTA 1JJHA 2HAIA 2R9LA 7FDRA 2GJIA 5LMUJ 3K5OA 2ADCA 3TJ9A 1RT7B 4C3KA 4XDDA 2ZKTA 1HA1A 2C1EB 1IQTA 2ZC4A 3NEKA 2CQCA 4ECQA 5HMZA 3FSXA 4G6VB 3MUTP 2AU0A 4G1QB 3GV7B 1QAYA 2ZBPA 4E0DA 4WYLA 3M8ZA 4MKVA 3HCXA 2KFNA 1B70B 2VZ9A 1I94J 2YY3A 3ZC4A 4DL3A 3FK4A 3BJYA 1RTHB 1VHIA 1Z2ZA 1RBOB 1KLNA 4ZVFA 1T8EA 1R8CA 2IMOA 4J9OA 4UZBA 4DUTA 2C2DA 2AYEA 3I31A 2KB2A 3OL6A 4CNYA 5HP1B 4M5DA 3UFCX 4CLTA 4YS2A 2HFUA 2PEHA 2GQ2A 5K9FA 1MMNA 4MIAA 3RYLA 4AQYF 4WPAA 3BH6B 2WONA 1K0TA 4K50A 3CO0P 4C8OA 2CPYA 3V6KA 3CCSS 1Q5YA 3HZEA 3ADAC 3OV7A 5RUBA 5HMYA 4KE5A 2H3EB 3OTCA 1DAXA 1VQPS 2ZZTA 1FEHA 2J5AA 2RT3A 2AJ2A 4RUCA 3PO4A 1UCNA 4E8UA 2ZHBA 2F4VF 3IFEA 1KTVA 2Q6BA 3K89A 3SI8A 5I3UA 5CYJA 2CPFA 1LK7A 1UEKA 2Z56B 3FMBA 2QA4S 3BO4A 4WU3A 3VAFA 3W66A 1UJ5A 1WDTA 5D0RA 1C0UA 1RT2A 2RUSA 1S0NA 3HSDA 1RKIA 3QT6A 4HLBA 3VAJA 1IR1A 3G6XA 3A3OB 2GMJA 5ETLA 1IBLJ 1N5QA 4NMXA 1X4BA 2UUAF 2F8EX 2DXEA 2X1AA 2YX4A 2FVQA 3SCKE 2UXDF 3IXQA 3W60A 3T1HF 2XM3A 2I38A 1IKXA 4P7TA 3S8SA 3PY8A 3O1LA 3QFWA 2AGOA 2AGQA 1XMBA 1TMJA 4IO9Q 2HGLA 2VQEJ 1VC0A 1G7CB 5KFSA 3D6MB 1D8ZA 1WG4A 1K1QA 3PIOQ 2EXUA 3AXMA 1PJ6A 3RBZA 1HWLA 3TARA 1T02A 2NYHA 1KQKA 1ITPA 1VQ9S 1FE0A 4YQWA 4PZVA 5C42B 4F0KA 3M6VA 4WK3A 1D9AA 1ZTWA 1T03A 4CLSA 2LYVA 4QBUA 3AA9A 2K1RB 4I2PA 3ZZRA 2XQCA 2W8KA 1FJ7A 4JI7F 1RHMB 4C8MA 3ZZYA 1KHVA 2OPSB 4RNNA 1RBAA 1T7PA 3KK3A 1KKHA 3ZFVA 3HFKA 4B3SF 2B3TB 2I6WA 2XMAA 2R7WA 4M5HA 4ELTA 1EQMA 1TL1B 1HQEB 2J9DE 2HVDA 4LF7J 4P52A 1KQGB 3D7SB 5A8KB 5K8OA 1N32F 4OX9F 5LXYA 3G6ES 5A0YA 3MMAB 1OY8A 1FNXH 2YNFA 4ZHRA 4NI2B 1H7WA 4ZP6A 2KTQA 1S9GB 2N82B 4K8RA 3V4IA 1BHNA 2V2ZA 1CG2A 5B0AA 3G82B 2VQFJ 1RTIA 1TL3B 4YOEA 2OJ3A 2C22A 2OHDA 4DMZA 2ZNYA 3X3UA 2HWTA 1TKXA 1MSWD 4ITSA 2CJXB 4A8SA 4QWAA 1CPZA 1EP4B 5HQLA 2CQ4A 1HBMB 1KBRA 1XWLA 4PKDB 4QYRA 1VQ6S 2K8GA 3C2PA 2EFVA 1TUGB 5IXUA 1MU2A 4LRAA 3H4DA 2FY1A 1NJWA 4C97A 5KFHA 5D4LA 1S1VB 2QJ3A 1Y3JA 2DD8S 5BXIA 3NL0A 2YWHA 1SKWA 2ZJQQ 2MKIA 4PABA 1NNDA 3BV8A 3KJVA 4JI4J 4F36A 3H0PA 3RAMA 1HHQA 4M5LA 1S9EB 2DBBA 3BYPA 5L9NA 1NDKA 5G0RB 2PFDA 5BR8F 4X4PA 1ZZNA 1S0VA 1X5SA 2OSRA 2F8HA 3MOJB 2BE2B 3D0IE 2Y9HA 3RUBL 3CC4S 4OZ3A 2CKWA 1X5OA 3FEYB 3W5XA 2OO4A 3D4JA 4RNMA 2OELA 4C8KA 5IT4A 4EWTA 4FF4A 2DHSA 3NBPA 3EJMA 5MLCV 3SCLE 2IHR1 3LPEA 4DV4J 4X62F 1S7IA 1LOUA 2CQDA 2CDQA 2UU9F 1NJYA 2XMWA 3B4MA 1RT3B 2DPJA 3A4TA 1OYEA 1U6FA 4OZLA 4CT9A 4WP9A 1RAAB 1URRA 1ZBTA 2VG6A 1IKYA 4YR0A 5AJ3J 1SUQB 3C19A 1SJ1A 2OFHX 4J9LA 2EFQA 3DLLQ 2EK1A 2HQ3A 3GJRB 3HF5A 1SC4B 2KFYA 4DSJA 1KLMA 1M1KT 1GTHA 1RAGB 4TVAB 2YKMB 5CYQB 1YJTA 1Q8LA 1VBXA 1Q16B 2GO8A 3MEDB 2DITA 4LSNA 5LSRA 5C5JA 1B0PA 2A2DA 1KVIA 1HNVA 4OZ1A 3FFIA 3DMJA 1HHSA 3MEEB 5HROA 1X7VA 2HFVA 4UZCA 4OJ1A 2V2QA 2ZVIA 1FJCA 1ZOTA 1F3VA 2VDIA 3Q83A 3C14A 4IFYA 2B4VA 2D41A 1Y5IB 4ZJLA 1S4FA 1FA0A 2PMZD 2MXYA 1X9SA 3LW5C 3QIDA 4DR7J 4PG6A 4ELUA 1RE1B 1T9VA 3CD5A 1FXLA 2ERRA 3BDPA 3M05A 2XC9A 3BEGB 4LF8F 3HP6A 2LP4A 4WFBQ 4U7UD 4P2SA 4JUZA 4KFBA 2E5JA 1HPZB 3M8QB 2QSWA 4A47A 3C6TB 4IRKA 1NCLA 3OFHA 4JOUA 2CQ2A 2NUUG 1UA1A 3Q8SB 4WBFA 1RYRA 2DR5A 5KG4A 4M5IA 4ZLPA 2XS2A 3V5RA 4DV0J 4PYAA 1O51A 5CXTA 4PXBA 1N54B 3EXYA 5I4MA 5H9EK 1R89A 3AXKA 4N47A 3AT1B 3UN3A 4J9SA 1NHKL 1R0AB 2GMHA 1KP6A 1FKOA 3BO2A 3PRBA 3JSMB 3PVXA 1OPIA 4F3QA 3IR6B 4EFAC 1K44A 2RKIA 3I0RB 1KWMA 3BREA 3K8VA 1GFWB 2G0JA 2MYFA 3M9NB 4LF9J 3PO5A 3QAEA 3HVRA 4MYTA 4TU9A 3OFFA 1DHMA 3MM7B 1J5EF 3TQ1A 4V19J 3D0HE 3SCJE 3LAKA 1YRTA 3KLFA 3NP5A 2VPXB 3TZWA 2XZTB 3MEGA 2HWHA 3I56S 3CTRA 4DBQA 3CE8A 1WTFA 3BZQA 2AJQA 5KT2A 1VI7A 3W64A 2W24A 1HBOA 5HVHA 1S49A 4C6AA 5A6PA 3BQ2A 4RUHA 4FYYB 4K7QA 1SV5B 3MM5A 5FJ4A 1XQIA 2OFGX 2J0SD 4YB5A 4BBYA 1RCOB 4F04B 3MMBA 4X4SA 1MMDA 3C6UA 3JTPA 4HI2A 1I6JA 3SFGA 1KQSR 3ZTPA 2HSEB 2QTWA 2YWFA 2BX6A 4DL2A 2UVVA 3DRXA 1H2TZ 3FQKA 3PW5A 3N5BA 3RRKA 5D15A 2WVEA 2IYGA 2JFDA 3KK2A 5IWAF 4DV3J 4ZCLA 5E41A 2V2VA 4USKA 3GB0A 5L1LA 1GNKA 2JEFA 1WC1A 4C11A 1GAOA 4TY8A 1A7GE 1CJVB 4FYDA 2XCAA 2JC0A 2XLKA 3RZAA 2VFRA 3GV5B 1U1OA 1LW2A 2RRBA 1GXTA 4MKAA 4X66F 1FKAF 4NLUA 2BJ1A 4OI0A 3N79A 2LA4A 2RS8A 4B3OA 4Z7CA 1PJ7A 2XMMA 4P72A 1WTBA 3G87A 3EVMA 4K0KF 1URNA 2WAQD 2GV1A 5FLXU 3BQ1A 2Z0GA 3DC2A 4JYAF 5AE1A 2IC3B 1XMOJ 4NCGA 1JXLA 2G2OA 5F9NA 4ER8A 4B9MA 2VG5A 4LIWA 3PR5B 4JI8J 3MD3A 1Q0NA 3MPVA 2JH3A 2VJVA 3IBFB 3JSRA 1ICEB 2HNYA 2CJBA 1WF2A 3Q8PB 3D0GE 9RUBA 1RA7A 3IS9A 1YWXA 2DNGA 2NUHA 4ELVA 4ES1A 1JQGA 4USJC 4ZCIA 5DG8A 2GVDA 4BLGA 4I69A 5DQGA 3EZOA 5ETKA 4A8WA 4CH1A 2NXEA 3G96A 2CZ9A 2F7VA 5U47A 3DLGA 1KSPA 4USIA 4IR1A 2BUNA 3HHEA 3MM8B 1UAWA 4KGXB 3C66A 5KFBA 4DS4A 4DQSA 4EEYA 4DJBA 1UW4A 3H2UB 2X3DA 1VHFA 2NSCA 1HQUA 3CCES 3QO9A 3LTOA 4KSEB 1NPKA 4GC6A 1V6HA 1B0VA 2VPWB 5GAGI 5KFUA 3OR1A 3FC9A 2QA1A 2V4RA 4U7CA 4OV1A 4N5SA 2OGUA 2HHSA 3UWTA 3TJ8A 4HEA9 1QTMA 1YQHA 1PSDA 3D28A 3QPIA 4WWSA 1FT8A 1Y7PA 3OFEA 2DT9A 2VBYA 2GVZA 4K2JA 1QM9A 4ZLJA 3DI6B 3N6MA 1J5OB 2EBGA 2ZH2A 2I5JA 2HYIB 3P45B 1IXKA 2HHQA 3ISZA 3P96A 1DURA 2Q43A 2DTJA 5HQMA 3FDSA 5HMXA 3DOLA 3MF5A 3TUPA 3N01A 2W9CA 2QYCA 3C8YA 5HN0A 5HVFA 2BACA 2KI2A 4DU8A 1LWCA 5E33A 3O3LA 1S1TA 4CTAA 5T7LB 3AAWB 3CDUA 3KJFB 4LRCA 1WOOA 4Y3CA 3MMCA 1TL7B 2MQMA 4C7QA 4ED7A 3GILA 1E6YB 3N0VA 2PGCA 3KHLA 3DOMB 3C16B 5HMWA 2NZ4A 3CULA 2PEBA 2MQLA 1RXOB 1G6BA 2VHGA 4ZJQA 4NRUA 2XZDB 4PG5A 2ZH7A 4Q2MA 1B3TA 4KPCA 2E29A 4EYIB 5DS7A 3WC0A 2HHWA 1FRXA 4ZDNA 3KOAA 1R43A 3JTOA 4WE1A 2LQ5A 3MUVP 4OHWA 3GE9A 3CJ0A 2PSZA 2GS8A 4YFUA 2R3VA 4I68A 5C2CA 3ZZUA 2J6TA 4F25A 1TFWA 1H73A 1VMBA 1SH3A 1WD6A 3RR8A 4FYXB 4L73A 4ZVGA 4QQBA 1GXUA 4LBHA 3KNGA 5DZ6A 4KJIA 4G1PA 3HMJG 3AB4B 3JSBA 2CZVC 2GGPA 2B9EA 1WOSA 4KGMA 3UNGC 4EMDA 4Y34A 4LF6F 4OV6A 4JI1F 3HO1A 3BGRA 1VIOA 1SVDA 1A9NB 4WU2A 5KFTA 1QE1A 3OD2A 4WKYA 1X4GA 4MKBA 4F4XA 2HQGA 1GQEA 3HVTB 5F0UA 1IQZA 3ET6A 3IBCB 2IY5B 5L9XA 3SMZA 5D6GA 4NLDA 4Z2XA 3JS9A 3PW0A 1Q79A 3UR3C 1YSJA 4I6AA 3PRDA 1UJ4A 2AX0A 1FFSB 3PNIA 1REVB 4AUKA 2OPRA 1HW8A 3Q2TC 3EPGA 2CQBA 1Q1KA 4B3RF 3S1TA 3AFGA 4NLYA 4I2QB 2VBXA 1IM4A 3CNQP 1S7HA 3PM9A 1OQ6A 2Y0SD 4UW2A 3IBWA 4FS1A 4PPDA 3GR0A 5C7PA 2IM2A 3D1QA 1IVZA 1U8WA 4TY9A 1YZ6A 4M5DB 3CD0A 4ANDA 3ONQA 4TN2A 1CS4A 4JV1A 2VH7A 2WONB 3U27A 2HNDA 4TQRA 2IVMA 3U1NA 4QWEA 1VBYA 4DU7A 1D1UA 4DR1J 4G3IA 2ACMA 2RJZA 4HTIA 4DV2J 4C48A 2J8AA 1VRTA 3ILJA 3PJ9A 3NOCA 2IRXA 1L3VA 5I3UB 4EGLA 2NPFA 2YKQA 1PC5A 2W01A 4K5SA 5A8RA 1YZ7A 2ZOMA 2GIQA 3UO0A 3POTA 1U1MA 2FHOB 1DZ5A 1C0UB 5ETOA 4HHJA 1RT2B 3QBCA 2V8GA 1PILA 1B7FA 1RAHB 4OZ5A 4GKJF 2HLUA 3H8YA 1WDDA 1X9MA 1TL5A 2KHCA 1AFIA 2I8EA 4K4WA 2UXBF 1S1XB 1FEEA 1FI4A 2ZUGA 3P6YC 3OBIA 1DRZA 1IKXB 2OPPA 8ATCB 1QDUB 4BHQA 4LF2A 2K7KA 2JLEA 4KPYA 4MFBB 2XLJA 3UI3A 2CJQA 2ZUAA 3EVWA 3QWUA 2ZH3A 1U2RA 3W3SA 1GTEA 2FLLA 2RRAA 5J1EA 3HT3A 1IBMF 3RBEA 3KXDA 1X5TA 3BB5A 5HSPA 3IN5A 2B43A 1YIJS 4ZCMA 2F40A 2XMVA 2W4CA 1NK5A 3R27A 3BBFA 4LBIA 4HL9A 2P9EA 1X4HA 3TUJC 4DR6J 2EKNA 1H74A 3OSNA 4ZVEA 3BGFA 1FRIA 4DL0C 2XYPB 4M5GA 1ZS6A 1Y9OA 3DU5A 3Q2SC 3KK3B 2OD4A 4B9VA 4NEYA 3CWJA 1KFDA 2B5JA 1ZPVA 2BE7D 4RO0A 4DUYF 2XI2A 5GMEA 3TA0A 2I9SA 4DX8H 4DFPA 4Q44A 3VALA 2QG9B 5J2MA 3SCIE 2H54B 3JQMA 1SIWB 3OSPA 5A0YB 4YB7A 2YNFB 2QLWA 4ZHRB 2VG7A 4P7VA 4C3MA 2W2NP 2QE5A 5A2QY 3ILOA 3H40A 5B09A 1RT5A 5CZXA 2MJNA 2JZ5A 1W2IA 5KT7A 1YJ7A 2CDRB 5KFRA 2Z2LA 2AT1B 1NSAA 1DY3A 2AW0A 2V8DA 2LECA 2GHPA 4QR1A 1FK9A 4ZPWR 2IAJB 3PKMA 5HBMA 3UN5A 4EO8A 2BR0A 2A18A 4OFZA 5B0GA 4ZVRB 1K9MT 4HYKA 2AIRB 2V4QA 2RU9A 1QSLA 2KT2A 5J2QA 3T5LA 2C2KB 1MU2B 4LFCJ 1IR0A 1FD2A 1RU1A 2HWIA 4M5MA 2BJ8A 3SBMA 2RD5C 4RW9A 3AD7C 4DV1J 4URQU 5LSOA 3CJ8A 2W1BA 1DQ9A 2ZJRQ 2GQQA 4XIUA 5IC6B 4ED4A 2E9ZA 4RW4A 3KJVB 2W7PA 1ZYQA 3CJKA 3PRVA 1REGX 2HBQB 4LR7A 4UUWA 1S77D 4RUBA 3GCXP 4HH0A 2L9DA 4B3MJ 3GP9A 2VA2A 3HHLD 2VFVA 1OIAA 3IP0A 4J91A 3TI0A 1MWYA 3VAMA 2AYMA 2GAGC 1SB6A 4B9TA 3AHPA 2V2KA 3J7YU 2WB4A 3J7ZT 3OTOJ 2NXUA 4YMEA 3HJVA 4MMOA 3CD6S 3ILLA 3VAGA 1HNWF 2CG8A 4F3MA 2V9KA 3P8BB 2Z4PA 1JLCA 2X1BA 2H5JB 5E3PA 1UZHA 1N36F 3PEJA 4ZLLA 1QSYA 2LQBA 4ED6A 3A8KA 4QCLA 3JQKA 3KLIA 5JVGQ 3HFVA 5GMDA 4HHUA 5KFKA 3HHNB 5GAEU 3CPWR 2ATLA 1FKPA 2JNJA 2CQ3A 3FEXB 1R7IA 2XTJP 3PEHA 2VG6B 3FCHA 2CA9A 4DX6A 4ZK7M 2HZCA 4ANEA 5B0EA 2DH9A 1YJ9S 1KLMB 4ZVQB 3NS7B 1YBUA 2DRBA 3F44A 3ZTSA 1WSVA 5HLFA 2L48A 5BYRA 4LSNB 2JLGA 3ENAA 1RT6A 1X4FA 1VISA 2HLTA 3FVYA 1HNVB 1WSRA 5D4OA 1J2VA 2EFNA 3KDOA 5DDRC 3KJQB 3DMJB 4ED2A 5KT3A 5HROB 1LK5A 2VC0A 1WI8A 2W9BB 4XK8C 1IBKF 1TK8A 2NLWA 1Y0HA 2EC2A 3NWRA 4B3TF 1FX4A 1Q8BA 3MI7X 4P9SA 3FBCA 2XEXA 1S10A 4DG1A 4ED0A 4NCBA 3THTA 1BMQB 2RUGA 1N5VA 1RJJA 2JC1A 4ES3A 3N6NA 4KFBB 1HNXJ 3EPIA 4NXNJ 2BYCA 1NJXA 3K5LA 1NK6A 2UV8G 4HVZA 3M7VA 1CJKA 4P2MA 2RF2A 3K57A 2CQ1A 4I1TA 3V4MA 5I3QA 1N6QB 3MR7A 2CPEA 1N48A 2VDHA 5KFJA 1GK8A 1VK8A 2ZH5A 1RDRA 2RVJA 2MSSA 3RAXA 2YH1A 1EKRA 4IOAQ 4AE5A 5B08A 4X4TA 4RW7A 1MW7A 4ZN3A 1TL4A 3PXGa 4WFYA 4TU8A 3MTKA 5GVQA 3WIUA 2M3DA 2HBZB 1N5SA 2XMTA 4RU9A 2C3PA 5EX0A 1PJ5A 1FKOB 3RW6A 2W7AA 3GONA 3J81Y 5D3GA 2OD6A 4BWMA 2RKIB 1GMWD 4N8OA 5ETPA 2HK3A 3PW7A 4ZVHA 2UXCJ 1RA6A 1OQ3A 2HG4A 4AQYJ 3HI9A 3OL9A 2CRLA 2J7WA 2MB0B 1K0VA 3KLFB 4GVLA 3MEGB 1UFLA 1HBNA 4TXSA 3TZYA 2FDNA 2F4VJ 3EGWB 1HBOB 1S57A 4USTA 3MPUB 2K7JA 4KV8B 1VJQA 2LCWA 4X84A 3AD8C 1HYSA 1FXDA 3MM5B 2YQ0A 1WG1A 2QMXA 3SV4A 4PQUA 1UWBA 3J7AN 4PG8A 4USMA 3HVWA 2FLOA 3RRHA 3ZZOA 4P2FA 1W2BR 3MMBB 4LVOP 3NAHA 1PBUA 2V34A 4C2MA 4ZVPB 2U2FA 1QUVA 3UR0A 5KTQA 5BYQA 4LRDA 3EXCX 1KHWA 3G4SS 3KK2B 1VIXA 2QMWA 3VQSA 4QOTA 4ED5A 2NQPA 2E7WA 2UUAJ 1S99A 4DQRA 2UXDJ 5LMUF 2BJ9A 4ZLNA 3EICA 2WW4A 4FVMA 3T1HJ 4UOHA 4G1IA 1LW2B 2Z57B 4DCPB 4U8VA 5ETQA 4B3OB 2ASDA 4NXMJ 1C1CA 2G2ZA 2R7UA 4NLXA 3TYTA 3G6YA 1RT4A 2CG4A 3LGHA 1I94F 2QIFA 1JK9B 8RUCA 2E9RX 3MGJA 5IOLA 5CYMA 4J9QA 3H7HB 4Y2IA 4NCGB 4LFAF 2IJRA 1M5OC 4L75A 4NA3A 1UZDA 3TRGA 3ULHA 1FTCA 2ACYA 2HHHF 1VGYA 3GWCA 4JI7J 1RTZA 1B64A 2LMIA 3D2WA 1W26A 2LFVA 4CLZA 1RTJB 4B3SJ 2ZBQA 4UUXA 1CC8A 1NHVA 2HNYB 2R42A 3HVAA 5IFMA 2KXHA 3Q23A 3K59A 1D09B 3IS9B 1N32J 3IG1A 5THWA 4OX9J 1AYEA 3ICLA 1FFWB 1XK8A 2R8HA 4H54A 2HHVA 2L08A 2MHEA 3HDSA 2MGZA 2C2NA 1O5JA 3GFHA 4ED1A 2DY9A 1PKUA 4ZMMA 2R4FA 2MKHA 3V6HA 3DRSA 3TUIC 2K2PA 4H4OA 4X4VA 1VBZA 2MLXA 2AZ1A 3ELHA 2B8QA 3EDRB 3PFEA 1ROFA 1HQUB 3MM6A 1RACB 4EO6A 6FD1A 4LIRA 4NLTA 2O66A 4OI4A 1N8RT 1EAYC 4JI2F 1V3RA 3OR1B 3T5HA 1VFJA 4CI0B 1HWUA 5KG6A 3GMGA 3W65A 3FMWA 2VASA 3A3NB 4OI3A 2Z58B 3P3DA 1KVKA 3NLCA 2GVZB 3G2XA 1NUEA 1C1BA 2AWZA 5KFAA 2LU2A 2I5JB 1CQNA 3U1LA 1EZZB 2VBZA 2M2BA 3US5A 2KRBA 1IJFB 3N4WA 4KHPF 2D3UA 2MKYA 3L09A 4X4OA 3SYZA 2RB7A 2HK2A 2W2OP 3I5BA 4OZNA 4OHXA 3H2VE 2F8MA 1R3NA 2B6AA 1HHTP 3DOLB 1M5VC 2OI2A 1SQEA 4L3NA 3MCNA 4CLPA 1S1TB 2CNLB 4CTAB 3EWGA 2JJ4D 3D67A 4DSLA 3BS9A 5KFFA 4X62J 1CJTA 2UU9J 1YVFA 3MMCB 2EFOA 4OYIA 4CLLA 3LQVA 2I2YA 4ICLB 5EHHA 3CW2C 1WNEA 2HVIA 1E6VA 3UDCA 4CLKA 1UVLA 2Y1IA 2CQHA 1S1UA 3G86A 4BCAA 2BZ2A 2LLZA 3FCWA 3W62A 4NZ0A 2ASLA 4ECUA 1F9HA 3IM9A 3QAUA 1RWKB 2KG0A 4RBVA 3FSYA 3JYTA 3CGIA 1TFYA 4OQJA 3K17A 4IOBA 2MQOA 4HTJA 3RBXA 5IC4B 2WBMA 4WE1B 4WIIA 4I67A 3GFZA 3I82A 3DNCA 4L3KA 3H5SA 3KWMA 5FDLA 4QU7A 4PQAA 1S79A 2JEIA 3OTBA 3AOBA 4JBCA 3EUNA 2E1PA 2JWNA 5CH7B 1XERA 3AOAA 4DCOB 4IG0A 1ZM2A 2GGPB 1T9WA 1TVRA 1YJWS 2WVFA 3I87A 1PAEX 1S59A 2MQNA 1WKKA 1CEZA 2DH7A 3SSQA 2KZZA 4LF8J 2QLXA 5KOWA 4OI2A 2EBEA 2HIYA 4OX7A 3FRZA 3K5PA 5B0DA 4PUOA 1NH8A 2JLFA 2JEGA 2CPIA 2VJUA 2ZE2A 5LMNF 3SQOP 5DG9A 4CO2A 3JXOA 4DLEA 2QV6A 3GFYA 3LF0A 2FQQB 2AF6A 1SC1B 4JI6F 4WTOB 2HMIA 2DEJA 3MWBA 4QWBA 1B7YB 1JLAB 3PYFA 2XCPA 1VLYA 2GCFA 1F9FA 2OPRB 3KDNA 1RT1A 2Z8QA 3A8EA 5DJBA 2BE9B 4B08A 4X4RA 2H48B 5HJYA 3WX4A 1AT1B 4RUAA 2V8PA 4X65F 4DV7J 1U45A 4WFXA 3S6EA 2W2MP 1NB7A 4C98A 4ECZA 3RG6A 1R8HA 1NPPA 5IQ6A 3OXFA 3BR9A 4DR3F 3F0NA 2M5YA 3N5FA 1UKUA 4J9UE 3MAAA 1P9QC 4QIEA 3A13A 5AJ3F 4LJMA 4DN9A 3UD5A 1NK9A 3MCMA 4NLQA 4KO0A 4K4YA 2MLZA 5LL6d 4EZ9A 3HT0A 1OJ4A 3HHKA 3K7RA 1XNQJ 2RQMA 2HFZA 4NWBA 3D6FB 2V50A 1PBAA 4LT6A 2RILA 2CNOB 4MK8A 3R7SB 4FNIA 1NK8A 1J5EJ 1NAQA 4LSZB 5H9EJ 3CJ3A 1JLBA 2MY8A 4X64F 1TKTA 3PIPQ 1N52B 2LQ9A 5KG7A 1H3DA 3KK1A 2YNGA 2EFPA 4NCAA 1KR4A 4LRFA 4C3LA 2DCUB 2EKYA 4NL5A 2OEKA 2BM0A 3Q8RB 3TVKA 4DHVA 4TLRA 4WYWA 1Q53A 4ZIWA 2MZ1A 3CCJS 2FB0A 2BVZA 2O67A 3LWLA 1RHUB 1JJ4A 4NLGA 1X0FA 1XR5A 4LF5F 1KOHA 3M32A 4OYZA 2FJAB 3PYDA 3R5GA 1FJEB 2NREA 2ALYB 3TWZA 3H5UA 1RI7A 1WHVA 5E3RA 4KGZB 4ZIVA 5J1NA 5KG5A 1O0PA 3PG9A 1RT7A 2G1DA 2UVRA 4DPOA 1TAUA 4ED8A 4ECRA 1D9DA 3HKWA 3U02A 3FRYA 4X66J 3FZBA 1L3KA 1JXVA 4DV0F 4UF4A 3VV2B 2DGUA 3HHLC 4QYZJ 1VQKS 2GW8A 3J7YI 4K0KJ 2G4BA 3QRRA 3HD2A 3CJTA 2PI4A 1NZ8A 4L74A 4Q8EA 3NNAA 1TKZA 2V6AA 4JYAJ 3M6WA 3D9BA 3QYYA 1WC4A 3NWGA 4ZJOA 1SH0A 4LSLA 3A3PB 1SKRA 4NZ7A 1IWGA 3MM9A 4YP3A 5HAOA 1VRQC 2B5JB 1FWKA 2I1RA 1GX5A 1G2EA 5GAEI 4XO0A 2PMHA 2M52A 4I64A 4DSEA 2YKNA 5KOXA 3GSIA 2YXLA 4I6WA 3GIIA 2QN6B 3OFGA 2FPHX 2VG7B 1R8PA 3CD7A 3TAPA 2FHJD 2BKPA 1RT5B 4LR8A 2KJVA 1JLQA 1N88A 3D1HA 4YB6A 1U26A 1HL6A 3ILIA 1W7WA 2WTFA 4DLGA 2N7CA 4JI5F 1WEZA 1IWAA 2UVUA 4MKYA 2CPZA 3AB2B 1TZ0A 1FK9B 4ID5A 1RTDB 5HBMB 1FTRA 1U02A 2ZD1A 1SJ3P 1VC5A 3HHLA 2IM3A 4FDFA 5K20B 3FBFA 1UVIA 4Y2MA 1RHQB 2OMOA 1DARA 3IA0A 1OY9A 4K2XA 5J2QB 1JLFA 3ZO7A 3M8SA 3DDNA 2CVEA 1CULA 4RW9B 4ALZA 1YJNS 1DLOA 2XHWA 3WIVA 2WB1D 1UFKA 3P4UB 2RDJA 4AFFA 4K5RA 1N34F 1R0BG 2HRTA 4CH7A 1BGXT 2D3ZA 4RW4B 2OUGA 2RQCA 3F41A 4IH7A 3T5JA 1N33F 2R2RA 5E3AA 5KFDA 2M8DB 1U1QA 2DO4A 1SIZA 1ELOA 4CYUA 2XMKA 2V4JA 3O8WA 3HD1A 3JTNA 3HPOA 4KKOA 3W2VA 3R5AA 4ETXA 1TK5A 2FHKA 2W9AA 1XMOF 2J7UA 4OYXA 4LFBF 3SSSA 2IJFA 2DGXA 2PIIA 4BDPA 1JLCB 1DBDA 3BPDA 1R8AA 4MTPA 4ZVTB 2YWWA 2LDYA 2OPSA 1HARA 4JI8F 2DKOB 2HBYB 3UNYA 2HQFA 3D3CJ 4F67A 1ZAWA 3CCZA 1HD0A 3KTQA 1IKVB 3M6XA 4BC9A 3KLIB 5DM6Q 3ETOA 3O6QA 4QWDA 2GIRA 1FKPB 1TL1A 4CO1A 4QIWD 2B4OA 3VF0B 5A8KA 3M8PB 3FNNA 5LJ5Y 2BW7A 4I7FA 2FZGB 3DGVA 4M1KA 3RU0A 4F50A 4HH1A 2UZAA 4NI2A 4EYHB 3ITHA 1T9YA 4O3PA 1NBEB 5A2QU 3LP2B 2XSFA 2I0XA 2UUCF 3IAS9 3T6BA 1S76D 2XGPA 4K4SA 1M5PC 5HLFB 1VQMS 1RT6B 2DIVA 2E66A 1LKZA 4MJKA 4MK7A 4FXDA 2HAFA 3ZZ0A 2VFTA 4DXLA 4ID8A 1DQAA 1S6OA 3WHIA 1BC6A 1N56A 3W2WA 1TP7A 1WG5A 2KH9A 1RWPB 3T41A 3T6JA 1CJUB 1ZZFA 3DLBA 3MECB 5CHCB 2F65A 3C3LA 3CJ2A 4E98A 1S1VA 1H72C 2E7XA 2JX2A 2YNIA 3QGIA 4HR2A 5ETSA 2BQ3A 3DN9A 2OPQB 2CYYA 2QC3A 3D6TB 3I96A 4UT4A 3CCQS 1YGYA 2P2CB 5D4NA 3BYRA 1EARA 4W98A 1X5PA 2B51A 3GZ7A 2WW8A 4X4UA 4FZVA 1U1NA 4Y00A 2FGCA 5G0RA 2RF2B 4DPWA 2J9EA 2UP1A 4OLPA 3M9OB 1Y4ZB 1GMWA 3W9JA 4WFAQ 2BABA 3I4PA 1FVQA 2HQIA 1UEUA 1VQ7S 4CO4A 2L41A 3FSIA 3NGUA 3QSYB 2DNMA 2VL1A 1XTZA 1FJGJ 1D3WA 2FD2A 3P5BP 4RW7B 5EUHA 2CPDA 2NXJA 1RUSA 2LKZA 1T11A 1F5CA 2EG2A 4YHHF 2CWXA 3TNVA 4OX6A 5IV3A 3JSYA 2Z2ZA 1JMTA 4FNHA 3MEKA 1BY9A 2HZAA 3VGSA 2N7YA 5D3GB 2FJXA 3CDWA 3R5BA 3M4XA 4PPZA 3DDKA 3KYLA 5KFNA 3D54A 3DOKA 3MR6A 1H6KX 4GKKJ 1HLWA 5D78A 4CLFA 3MR5A 3PYGA 4NYPA 2DVIA 2BQRA 2RSQA 1IN0A 4R0JA 1HBNB 2ZHAA 4HT5A 1UVKA 4DR5F 3DLHA 1TU0B 1HI8A 4RW8A 4AD6A 3VR1A 2R8JA 4ZPCA 5EN1A 1NK7A 3MPWA 4V19X 3PX6A 2RMLA 4DV6F 3M2UA 2FJWA 3MFHA 4WP3A 4W92B 2BANB 4PQUB 4N8NA 1UWBB 2DO0A 3THVA 1KONA 2PE8A 3IC1A 3AODA 3BKFA 3I32A 4BWJA 5EWGA 3UD4P 3S01A 4R5PA 4GO7X 5JXSA 3CC2S 5IV4A 2EG1A 1IKWA 3RBDA 1V5IB 4O3RA 2WOMA 1ZH5A 4DL4A 4GKJJ 2E44A 2F1FA 4TKTA 2E9TA 1HNZF 1EETB 4RZRA 1Q7LB 3SQGB 1HPZA 2UXBJ 3DDIA 3ZTRA 3C6TA 1JLGA 3IGNA 5EWEA 3D5MA 4JI0F 1OO0B 2B4UA 3S7RA 3T1YF 4EZ6A 4ZN1A 4EBDA 4ANCA 4HACA 1FNOA 1BQMA 1LQ9A 5CAAA 1N5YA 2GO9A 3IR5B 4DDFA 3QIPB 4QIGA 4IFVA 3CIMA 1C1CB 2Z2YB 5F3TA 2E5LF 2CQ0A 2FC8A 3E01A 4UQGA 2N3LA 1UETA 1M5SA 4CLUA 5CD4H 5CYMB 1RYSA 1EIYB 4A46A 1YTYA 2C2RA 1KN6A 1SXLA 1M5HA 3DU6A 3GJQB 5DG7A 3EMTA 1G3OA 4OHYA 3L7PA 2WVDA 3KJNB 4P71A 1B0TA 3N28A 3J81U 3DGPB 3DYAA 2XGQA 2RQKA 4L72B 2J7KA 2GIFA 2GHWA 2JVRA 2E1MC 1XNRF 4MYUA 4DUYJ 1N0UA 4JV0A 3OUYA 5A8WA 4U96A 1NLKL 4DR1F 3MM7A 2YX7A 3ZZPA 2OMLA 3IG1B 2WK4A 1HD1A 4KB7A 3ZZZA 1BXNA 2HNZA 2MZTA 3J7Z5 4LQ9A 4UQTA 3FEZA 1S4EA 1WOPA 4O23A 2MGZB 1M1GA 2JHEA 2NYIA 3DRSB 4DL7A 3K5NA 3O2IA 5FIIA 4JB8B 1APSA 2XHCA 4H4OB 5ETTA 3HSZA 2HFNA 1NPRA 5CCMA 4DQPA 2ZBRA 3NNHA 2COLA 5DDQC 1NXIA 2PDAA 3R5DA 4RBTA 1VCTA 2QA2A 1QSSA 4E2FB 2BBEA 1I5OB 2VFSA 2CIMA 3R97A 1HWJA 2CJKA 3OPKA 5C24A 5IZHA 3LP1B 3VAIA 3FBEA 4K4TA 4QJVA 3FBBA 2C3YA 4Q43A 3DLEA 4PG4A 1HI0P 4WJBA 3R8YA 5MAOA 2BV3A 4OHZA 1MROA 2GFFA 1X4CA 2OIHA 1C1BB 1D0EA 2FYXA 1SKSA 3HULA 1SCJB 1VOMA 2RE1A 2LEPA 4PWDB 3TAMA 5L8RC 4P6QA 3JB9k 1B99A 1OS5A 2EK6A 4PXEA 3VGTA 1Y10A 4F2SA 2QL5B 3GTYX 1LWEA 4QZVB 1LWXA 2B6AB 1FESA 2AHOB 4DR4F 1RSCA 1HNWJ 2LEBA 3KLVA 1PC4A 2K3IA 1NO8A 2B4PA 3HSJA 2VPZB 5LM7E 4DQIA 4ECVA 1N36J 2B7BB 1JKHA 1NSPA 3SEOA 2CVIA 1RISA 2QSFA 1DTQB 1PCAA 1TV6B 2KHDA 2IDEA 3OHBA 3KUEA 2BQUA 1VQ4S 3Q89A 1FDBA 2R7XA 4QYZK 2WBRA 4H4MA 1FWPA 1S1UB 4UTGA 3H5XA 5H9FK 2HHPA 3I0SA 3QRQA 2W2PP 2JRSA 5L46A 3AQPA 2KVQE 3FUYA 2MSTA 3TUZC 4C8LA 2Q3PA 2WSCC 3I9V9 4Z37A 3JYTB 4PWWA 1T3OA 4Y28C 1NDPA 4QPTA 1L3TA 4D3GA 3R1HA 3JAMY 3U1MA 4F0MA 3MM8A 1U24A 4OYAA 4P74A 3CXCR 3OL7A 5FDLB 4DX5A 3KMSA 2EC0A 2HZVA 4A8XA 2D69A 3X1LB 1S72S 5CCLA 3DRPB 3CDEA 3H98A 1T05A 4LFCF 1IBKJ 2XO7A 3PW2A 4MIWA 2FC9A 2CQGA 4ILLA 2HFSA 2YQ3A 4B3TJ 7FD1A 2BOPA 1WACA 1UFWA 2L3MA 2R2TA 4J5OA 3C15A 2VKRA 4CCHA 1RWNB 6FDRA 2F3JA 1RBLA 5GMKa 2ASJA 4PUOB 2QMUB 3H90A 1GXLA 3IWNC 1U0HB 1J5OA 4FF1A 1VDHA 2OTJS 2FZCB 3K5MA 3IRXA 5J2NA 3L4BC 2DNKA 1C4CA 2L9WA 4WK1A 2IBOA 4J37A 2HMIB 3QJLA 5E5NA 1P1LA 3KHHA 1SJQA 1RWWB 4RL1A 1RT1B 1SH2A 2JSXA 2RNEA 4F4YA 2VKZG 1U1PA 5AXNA 3VVTA 4MH8A 4Y2KA 4NLOA 3MUMP 1RWMB 4NMLA 3RTVA 3OLBA 5E7OB 3ISND 4XTTA 4OIXA 2DNPA 3FGVA 2GX8A 2VIHA 1IJEB 3MXHP 3SSRA 1E6YA 3MAAB 5EX3A 4B17A 2IA0A 3NS5A 3M9MB 1LW0A 4EU0A 4J9NA 1MG7A 3DOMA 2R8GA 2EEYA 5DDPC 1Z1ZA 3OQ2A 2DR9A 2MEWA 2ZWPA 4KO0B 1NB2A 2XS5A 3LPYA 3E51A 2D3OR 3B78A 1BQNB 2X51A 3PX4A 2J6SA 4B9LA 4ZP9A 2B56A 1TKTB 5GAHI 2J8SA 3MAQA 2ABYA 4WCEQ 3R7NB 2QGFB 1HFEL 5DLFA 4P73A 3KK1B 2YNGB 3I5CA 2ZHOA 2D3O1 3CCWA 2IMWP 3AA8A 3IGVA 2RU3A 5SUHA 1TKDA 4ED3A 2G2YA 4RWWA 2LA6A 4C8YA 1EJ7L 2HFOA 3UDVA 3HK2A 2APOA 4IO1A 3D3BJ 3PZPA 3RB6A 2NSBA 2CNNB 4WTYA 1F5AA 1EKSA 4ECYA 1KDNA 4AL5A 2RHSB 3M2VB 4ZPDA 2CQPA 3U7JA 2CWKA 3K58A 1H2VZ 5HL7Q 3BQ0A 1FX2A 4DSKA 1FE4A 3DLJA 1Q81T 4AXIA 2BW2A 1F3FA 3LP0A 3L95X 3G8SA 1K1SA 5J2PA 1MN9A 1SBRA 4USVA 4CO3A 4TLQA 4DPUA 3Q8YA 1I3OB 1ZAXA 3D68A 1QAIA 1YX2A 1AB8A 1VRUA 3VGVA 4F02A 3HKZD 1FDDA 2E5GA 4DL6A 4I6YA 2CPJA 3TEHB 2O3DA 4OMFG 2OEJA 1REVA 3B6BA 7AT1B 2ZH8A 3CDAA 3R9LA 3MDFA 2DR6A 4IQMA 4I2QA 1SL2A 4IDKB 2FHJA 1AROP 1VBKA 4KRWA 3TVYA 5IM0B 2IIHA 4R8UB 1TKZB 4Y2AA 2R7TA 1KS2A 2FJEB 2GMLA 2NS1B 2EFGA 1AW0A 2C3UA 4LFAJ 1T3NA 3KFWX 4LSLB 4WZMA 3CCUS 3UW1A 1GMVA 3OTEA 3QT5A 4DCJB 2RS2A 4Q45A 2UUBJ 2HHHJ 2UXCF 1Q78A 3MM9B 3W5YA 1N5TA 4OJGA 3CJSA 3BN7A 1JLEB 3UCZP 4OLOA 2QL7B 1MWQA 2YKNB 2QLBB 1KC8T 3B82A 2DGVA 1FCAA 2CJYB 5F8HA 3BO3A 1JIHA 1DTTB 1NU4A 2KKHA 2ZOGA 5F8IA 1JLQB 2W8LA 4QU6A 1BUXA 1P27B 1PGZA 2G0IA 3BH7B 1S9FA 4PYDA 3PACA 2KXFA 1NSQA 2JVOA 4ID5B 5ETNA 1HR0J 3J80Y 2Y1LB 5I42A 3VHQA 4LQ3A 1S12A 3KLHA 3EZUA 2ZD1B 1BQXA 2KT3A 3HHLB 1RAJA 1YBAA 2YKAA 3CC7S 4J9KA 3AH6A 2MKKA 1U2CA 3CCTA 3EM1A 5DGAA 2KDOA 2FJVA 4DWIA 2MDAA 2YQ1A 1JLFB 4FXWA 1S1XA 1WJ9A 2MLYA 4JI2J 4DV5J 4TU7A 1RLCL 1CULB 1UEVA 2B9WA 1DLOB 2XS7A 3TZXA 1P1TA 4B9SA 3OTDA 4NASA 1U25A 3CEDA 3LH2S 2SXLA 3KUHA 3SIPB 4NA2A 4DR2J 2ZDOA 4CO5A 2DHXA 2MZRA 1QTNB 1QLNA 4NXMF 4UOFA 4JI3J 2UV8A 4CYUB 4MFBA 2IDLA 2BEFA 2R7QA 4YR2A 1NHUA 4TQSA 3LO3A 2V4JB 5F0WA 3PFOA 4K4UA 4KKOB 3W9IA 3W2VB 3L3CA 3I6PA 2G1HA 1PYSB 4PEOA 2MKSA 4KHPJ 3SDEA 4RNFA 3CSKA 1K8AT 4TYBA 2XMUA 2DPIA 3CMES 4LF4J 2Y1RI 3GJSB 4O44A 3GYXB 1RQ0A 2WCXA 2XI3A 1RZMA 2POKA 3QRPA 3NMRA 2XG8A 1JWWA 2VOPA 5SZTA 3NMAA 1FD8A 3GR1A 5HO4A 4I7FB 4J9VA 2J0QD 3GQCA 2KM8C 5KT4A 4ILRA 3ITHB 1S0MA 1R8BA 3QGHA 3BKUA 4CQ1A 2IM1A 1RWVB 4WP8A 2EPIA 1NM2A 2VD3A 1FFGB 2DGSA 3KG0A 2OAUA 5IS2A 3EVOA 5KG2A 3QQCD 2IBKA 3UDLA 1YHQS 4WFNQ 1C2PA 3GPAA 2IAJA 3GCWP 4AT1B 2H4WB 3W2WB 1FRJA 1QVFR 2AKWB 3OLAA 4LF1A 5D77A 2ILYA 3IO1A 2RDDA 2EVZA 5KFYA 2D74B 3D1OA 4KAIA 2UUTA 5DDOC 2DIUA 1T03B 5LXRA 5HK4A 5IT9Y 2QZ8A 3DM2A 3NS6A 3MMJA 4I2PB 4A8MP 4BS2A 2VF3A 2HGNA 4FN5A 2PO4A 1F0XA 1D9FA 1RU2A 2YNIB 1VLOA 4NLRA 4DSIA 1U6ZA 1SPBP 3G71S 4KGVB 3QT7A 1RHJB 3Q8VA 2DRDA 1S48A 4O0IA 2CUYA 2YWEA 3E3XA 3QGGA 1ZM3A 3M6UA 1NRKA 1DFDA 2IA6A 4HI1A 2OP5A 4OYBA 1U1RA 2B9XA 2DHGA 4WIQA 1T9UA 5LMNJ 1EB0A 3WC2A 1CQMA 4URGA 2IYIA 3NGKA 1VS3A 4N7TA 2AEJA 3DRRA 4C4WA 1S97A 1RADB 4LBPA 3MD1A 3QZ7A 5KFOA 1X0PA 3V4IB 4JI6J 3FCVA 2HS0A 1V9OA 4FXVA 2QRRA 3CCRS 2DISA 1RTIB 2XYGB 3PKYA 3RAQA 2R8KA 4ENOA 4UY8T 5D0HA 1OSCA 4I4BA 1TKXB 2ZH9A 3UN2A 4M5JA 4X65J 3KHRA 2FJDB 4NPOA 3CMQA 3IAM9 4DR3J 5FD1A 3CCMS 2EWHA 4HDGA 3GIKA 2AX1A 3DOKB 4WFZA 3OR2A 1S0OA 3BR8A 3KNAA 2H5IB 3TP2A 4FF3A 1QY7A 3WZ0A 3GJTB 2YH0A 4WXOA 4NRTA 1IM6A 2DNOA 4PXCA 2HPUA 1WF0A 1BWEA 2V67A 3E2EA 4RW8B 2GC8A 4USHA 3GIMA 1U4BA 4O4RA 1XMQF 3QJJA 2XNQA 3TZZA 3OVSA 1ZA2B 2ZNZA 4X64J 3M1VA 3MCSA 2WZ1A 3M2UB 1UWAA 1C0TA 2W9BA 2RAQA 2GJ2A 1PYTA 1HI1A 3CJRA 4R5PB 3BBCA 4FKXA 3VVUA 4U7UK 3AD9C 1IKWB 4ZVOB 2HHTA 2WOMB 4ZVUB 2ZM6F 1VQ8S 2Q79A 3BGOP 1NSKL 3GG0A 5D8HB 5KFCA 3NBPB 4Q8FA 1NEEA 4FVCA 1YITS 4DZDA 4LF5J 1LXJA 2E5HA 1JLGB 2DR7A 4J7CA 4OJHA 1YRXA 4FS2A 4EBEA 4CIOA 4F4AA 5ETMA 2KT5A 2YTCA 1S6QA 2YX1A 4N56A 1L3UA 4HACB 4DUZJ 1CVJA 1BQMB 3G8QA 1N6QA 1N5YB 1IKYB 5CA5A 4IFVB 6AT1B 1PIEA 2XYHB 3RB3A 1N0VC 2V94A 1HBUA 4FPRA 3R5JB 3E01B 5ITHA 3TVZA 1G4CA 1PYOB 4DV7F 1YK9A 2PD1A 2VODA 2MQPA 5KAKA 5L38A 1F9EB 3KLEA 3F56A 3FFIB 3HJFA 3GU0A 1S6UA 3NY0A 3UVJA 1U48A 1V3SA 4USUA 4UOGA 1F1BB 3DYAB 3HX9A 1RGVA 4IFYB 3C14B 3DRYA 1XN9A 2XMJA 4CM0A 3LGNA 5K8PA 2X3GA 2VICA 1MN7A 2ASYA 4NZ6A 1XNQF 5DZ7A 3OUYB 4JV5F 5A8WB 4Z7YA 2HHUA 3QATA 4C0OC 2ZFHA 1L5UA 2C42A 5E0OA 1X4EA 4NEZA 2YNHA 4N76A 3V2UC 2J9DA 4O0NA 5F8GA 2HNZB 4DS5A 2J6UA 4DSFA 4U95A 5F8NA 2VBWA 3RW7A 3L7OA 3ZXWA 4LR9A 3KG1A 2HVZA 2LQ8A 4C0BA 1WELA 2JFKA 1GH8A 5M2PA 4KV8A 1U0SA 2R2SA 4ES2A 2HQDA 4JI5J 1JB0C 3SFUA 3A1YG 2DGOA 1LXNA 2J9CA 2DXDA 3N9UC 3PYEA 4IR9A 3GG1A 3FZ2A 1YLXA 2XLIA 1LWFA 4DOZA 5C24B 3LALA 3P49B 4N41A 5F41A 1U49A 1NZAA 3V6JA 1RAIB 2BKOA 3GIJA 5KFEA 4WKRA 3NXZA 3SZ2A 3IWXA 2XBPA 2CAJA 3THPA 3DLEB 2RH3A 1U8SA 4CZCA 2ZH6A 2AYBA 3CF5Q 3O44A 3I55S 1CLFA 2WRMA 3QSIA 5I3PA 1N34J 3GFXA 3NGTA 5F8LA 1MROB 1U47A 5E2QA 1N33J 2PA3A 4MIBA 4GVBA 1F5BA 1IUJA 3OT9A 4F0HA 3TAMB 4GMKA 2ADBA 4P10A 5C2GA 4YY3F 1Q95G 2OEMA 5KFLA 1R6VA 4CH0S 4ZPBA 4EBCA 1U7LA 1LWEB 2AZ3A 4C8NA 3WDOA 2QO3A 4A8OA 5BJRA 1SJRA 1JX4A 2F9JA 1LEOA 4NLWA 4LFBJ 1RWXB 2PI5A 1R31A 1WEXA 2CJAA 3RR7A 2LEAA 1F6TA 4DFMA 1QJHA 4Y0FA 3M2RA 2P9CA 1JKHB 4X2BA 4NYOA 5KG1A 1V5VA 2FIUA 1ZM4A 2W2QP 5EDWA 1RTJA 3ISNC 4FYWB 2VB6A 5LSLA 3C6UB 5IT0A 5AT1B 3NRBA 5BYSA 3KLGA 1KVJA 3W61A 4OYMA 1OWXA 3V81A 2F9DA
chains in the Genus database with same CATH topology
2ROEA 2ZE2B 2D7SA 1BY9A 3MEKA 4H4MB 4QR2A 4ZCMA 2F40A 2DCLA 2XMVA 4I56A 2N7YA 2W4CA 5D3GB 1NK5A 3I0SB 3R27A 2FJXA 3CDWA 4HL9A 2P9EA 4QIVA 1X4HA 2MKCA 3DXSX 3R5BA 3TUJC 3M4XA 4PPZA 3NG8A 3KMQA 5M2UA 3DDKA 3Q8QB 2IJNA 3OSNA 3OTOF 4Y65A 3KYLA 5KFNA 4WZQA 4C11B 3D54A 4TY8B 3DOKA 1NKBA 4H4KC 1JJ2R 4ZVEA 3BGFA 3MR6A 1FRIA 4DL0C 4C8ZA 1C4AA 1H6KX 1HW9A 2IRYA 4ZP8A 1Y9OA 3DU5A 5D78A 2XB2D 3NNCA 3MR5A 3Q2SC 2YWKA 3G6VA 3KK3B 4IRCA 2OD4A 4B9VA 3CWJA 2R8IA 1Q86T 5F8MA 2XULA 4NYPA 1S6PA 1M90T 2FLPA 1KFDA 3G8TA 2BQRA 2RSQA 2DVIA 3BDEA 2B5JA 3AY0A 1ZPVA 4DUYF 1IN0A 3M2VA 2XI2A 5K14B 3TA0A 2WSEC 3QMQA 4R0JA 1HBNB 2ZHAA 2I9SA 4HT5A 1UVKA 4DX8H 4DFPA 4DR5F 1RK8A 1VQLS 3DLHA 2QEXS 4Q44A 4IG3B 3VALA 1HI8A 4RW8A 2M0GB 2KG1A 2IRUA 1AUDA 4F3OA 1FERA 3VR1A 1UL3A 4B02A 5J2MA 3SCIE 2R8JA 4ZPCA 1SIWB 3OSPA 5T7LA 4YUDA 5EN1A 1NK7A 2E1RA 3MPWA 5A0YB 4YB7A 2R2UA 1T05B 4V19X 1TR0A 2YNFB 3ENWA 3PX6A 2QLWA 2RMLA 4ZHRB 1NKCA 1KNZA 2VG7A 5DETA 4P7VA 4C3MA 4DUZF 1LFWA 3M2UA 4DV6F 2FJWA 4IQXA 3MFHA 3M30A 4OHVA 1X9WA 1FRHA 4W92B 2BANB 2XNRA 4F4KA 1I1GA 4N8NA 3QJPA 2QE5A 5A2QY 1UWBB 4PQUB 4HT7A 4IH6A 1S1WB 2DO0A 3H40A 5AE3A 3HZGA 3DLKB 5KFPA 3THVA 1KONA 2PE8A 5B09A 1RT5A 3IC1A 1XR7A 3FQLA 4QW8A 1Z4UA 4AL6A 3I32A 3R3TA 5CZXA 4BWJA 5EWGA 2MJNA 2X1GA 2JZ5A 3UD4P 1W2IA 3S01A 3VCDA 5F9LA 4R5PA 4GO7X 5JXSA 2Q6CA 3MOZA 2E1CA 5KT7A 3CC2S 4OZJA 5KFVA 2B7CB 5KFRA 2Z2LA 1QUPA 2E1AA 2JEJA 2EG1A 4AYBD 1IKWA 3RBDA 4O3RA 2FVRA 1A6LA 2MJUA 2VG5B 4MK9A 1MWZA 2WOMA 2RIJA 2AW0A 2AJ0A 2V8DA 2LECA 1ZH5A 4HKQA 2GHPA 4DL4A 4QR1A 2E44A 1FK9A 2F1FA 4ZPWR 2IAJB 4A4JA 4TKTA 3PKMA 5HBMA 2E9TA 1HNZF 1EETB 2VOOA 4EO8A 4IDKA 2BR0A 2R7SA 3BF4A 1Q7LB 3IRXB 4RZRA 2A18A 2A3JA 2V0NA 2CPHA 4OFZA 5B0GA 3SQGB 2DGQA 1HMVA 2JL9A 1JLBB 2A2CA 1K9MT 1JNZB 5IM0A 4IUFA 3KHGA 2D9PA 2DNLA 4HYKA 4NA1A 4R8UA 1HPZA 5J2NB 2V4QA 3CDBA 4GO5X 2E5IA 2RU9A 3C6TA 1JLGA 3IGNA 4AL7A 1QSLA 2AJ1A 5EWEA 2KT2A 3CMAS 2LXFA 4Q0BA 3TR5A 3D5MA 4JI0F 1OO0B 2B4UA 3S7RA 5J2QA 3UE2A 1ZTTA 3T1YF 2U1AA 3T5LA 2LVWA 1MU2B 3H25A 4EZ6A 1IR0A 1FD2A 2HWIA 3Q22A 4EBDA 1FNOA 2RD5C 5DRKA 1BQMA 2ZH1A 2C28A 2VPYB 4RW9A 4Q5VA 2QA4G 1LQ9A 1N5YA 2GO9A 3BGUA 4H4KA 3V6DB 3IR5B 4DDFA 3TOQA 2VFUA 4URQU 5DGBA 1X4DA 5LSOA 3QIPB 4QIGA 5KFZA 1JLEA 4IFVA 1UMJA 5GAGU 1D8YA 3CIMA 2IVFB 1DQ9A 2W4PA 2ZJRQ 1FDNA 3MURP 3DLGB 2RQ4A 1C1CB 2GQQA 4XIUA 2E9ZA 4RW4A 3KJVB 2W7PA 4ETZA 5F3TA 1ZYQA 2E5LF 3CJKA 3B4DA 2DR8A 2CQ0A 4DN0A 1XR6A 2FC8A 2C2EA 4ECSA 3E01A 4O4GB 1PO6A 4M95A 3T9NA 4UQGA 2VUGA 3DCAA 2N3LA 4F8RA 1UETA 4UUWA 1HNXF 1IBLF 1M5SA 5CD4H 3O5TB 5CYMB 1KRPA 4NXNF 1S77D 1RYSA 4A46A 1YTYA 2M4MA 4HH0A 1DTTA 2C2RA 1KN6A 3UD3P 1SXLA 2L9DA 1M5HA 3DU6A 2FVSA 3M32B 2GQCA 2VA2A 5DG7A 3HHLD 1LW0B 2V8HA 1OIAA 2VFVA 1G3OA 4ICLA 3QO9B 4OHYA 5L1IA 3TI0A 5B0BA 2C3MA 1WWHA 1Q7YT 1MWYA 3VAMA 1UVMA 1WEYA 2CPXA 3L7PA 1GT8A 1JXEA 2AYMA 1F60B 1SB6A 4B9TA 3AHPA 2V2KA 1TAQA 1B0TA 1JJHA 2PA8D 2HAIA 3HVTA 3N28A 2WB4A 3J7YU 2R9LA 7FDRA 2GJIA 2DGWA 3J7ZT 2NXUA 4YMEA 2ADCA 3K5OA 1RT7B 4MMOA 3CD6S 3DYAA 4XDDA 4C3KA 3VAGA 3MPYA 2ZKTA 1HNWF 4F3MA 2O5DA 2XGQA 2V9KA 2RQKA 1HA1A 1IQTA 2Z4PA 2ZC4A 1JLCA 2X1BA 4L72B 2CQCA 2HRYA 5E3PA 4ECQA 2J7KA 5HMZA 5DQIA 5LT5A 2GHWA 2JVRA 2E1MC 1XNRF 2HGMA 3FSXA 4MYUA 4G6VB 1N36F 3MUTP 3PEJA 2AU0A 2AJ4A 4G1QB 1N0UA 3NCPA 4JV0A 3OUYA 3GV7B 2VQEF 5A8WA 1QAYA 4DR1F 1QSYA 4E0DA 4WYLA 3MM7A 4A8FA 3CJ5A 2YX7A 1Q8IA 2LQBA 4ED6A 2ZOFA 3ZZPA 2OMLA 3IG1B 2WK4A 4QCLA 2XWYA 3KLIA 5CZVA 1HD1A 5JVGQ 4KB7A 5KG0A 5KFKA 3HHNB 2KFNA 5GAEU 2VZ9A 3CPWR 2YY3A 3ZZZA 3ZC4A 2ATLA 1FKPA 4WF9Q 1L3SA 4DL3A 3BJYA 1RTHB 2HNZA 3HXMA 1Z2ZA 2MZTA 3J7Z5 4LQ9A 4UQTA 3FEZA 3LUYA 1KLNA 4O23A 2MGZB 2CQ3A 3FEXB 1YRUA 4ZVFA 1R7IA 1T8EA 2MZJA 1R8CA 2IMOA 4J9OA 3PEHA 2VG6B 1OPZA 5CQGA 1U6BA 2JHEA 3FCHA 2C2DA 3QGPA 2NYIA 1UJ6A 3DRSB 4ZP7A 2AYEA 4DL7A 3K5NA 4ZK7M 2HZCA 3O2IA 5FIIA 3VZIA 3I31A 2KB2A 1APSA 1UA0A 4H4OB 3OL6A 5EWFA 4RW6A 4CNYA 5A6WA 5HP1B 3G9CA 4M5DA 2HFNA 3UFCX 5B0EA 2DH9A 3H20A 1YJ9S 1KLMB 2X1FA 5CCMA 4DQPA 3NNHA 2COLA 2PEHA 2A10A 2GQ2A 5DDQC 5K9FA 2DRBA 1MMNA 4MIAA 2PDAA 3F44A 3R5DA 4NLPA 3RYLA 2W9CB 4RBTA 4AQYF 2WONA 1OSDA 4X4NA 1K0TA 5HLFA 4K50A 4PRFA 2QA2A 2L48A 5BYRA 1QSSA 3DHWC 4CO0A 2OLWA 4LSNB 4C8OA 2JLGA 2BBEA 1LWCB 1RT6A 1X4FA 2HLTA 3FVYA 2CPYA 1HNVB 3V6KA 3CCSS 5D4OA 2VFSA 2UVWA 2CIMA 2XSJA 3HZEA 3LP0B 1J2VA 2DRAA 3EX7B 1HWJA 3OV7A 2CJKA 2EFNA 5HMYA 3OPKA 2QT7A 4KE5A 5DDRC 5J2PB 3OTCA 3OXLA 5C24A 3IWLA 3DMJB 4XPEA 1DAXA 3QWPA 1RKJA 4ED2A 1VQPS 4LF7F 5KT3A 1FEHA 2J5AA 1HNIA 5HROB 2RT3A 5AXLA 5IZHA 4RUCA 3PO4A 2DK2A 1LK5A 2VC0A 3LP1B 4E8UA 2FLNA 2ZHBA 2F4VF 2EW9A 3IFEA 3VAIA 1KTVA 3CIZA 2Q6BA 1WI8A 2W9BB 3T5KA 4XK8C 3BM7A 1IBKF 4K4TA 3PDNA