2KVIA

Structure of nab3 rrm
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
PKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINIKNAFGFIQFDNPQSVRDAIECESQEMNFGKKLILEVSSSNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear polyadenylated RNA-binding protein 3
publication title Solution structure and RNA-binding study of RNA-recognition motif of Nab3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kviA00
1S79A 3I56S 2X1AA 3S8SA 2ERRA 2DH7A 3U1LA 4BS2A 3P49B 5DM6Q 2AYMA 2DNYA 3N9UC 2CJKA 1VQ9S 2VODA 1S72S 1OO0B 3MI7X 4M5DB 5JVHQ 1VQ6S 2MQNA 1FHTA 1DBDA 2GO9A 2MMYA 2DB1A 3G96A 2MGZA 4WFBQ 1X4FA 4FXWA 4LMZA 1FJCA 1YIJS 2AYEA 3NMRA 2L41A 3JB9k 2JVOA 2D3OR 2OJ3A 2MKKA 3CCMS 2CPJA 2LXIA 3RW7A 4C7QA 4ZKAA 4ERDA 2X1GA 2FC9A 2MYFA 1KC8T 5D78A 1G2EA 1Q86T 3VAHA 1UAWA 2EK1A 4CH0S 2G0CA 4W90B 3G8TA 1M1KT 2MKHA 3UCZP 2KFYA 3CCUS 3S7RA 3ZZYA 1VQPS 2F3JA 2F9DA 2CPHA 1OIAA 1AUDA 2DGTA 3B4MA 2FHOB 1VC0A 2XNRA 3NNAA 3G71S 2MZRA 3CTRA 1ZZNA 1FO1A 2CPIA 1Q7YT 2MGZB 5DDOC 1WEZA 4UY8T 2CPXA 1WG4A 3UCGA 2MZ1A 3ZZZA 1DRZA 2LYVA 2M70A 1WTBA 1N8RT 1URNA 2AYBA 4ED5A 3MD3A 5DETA 2CPYA 2CQIA 2DHAA 1SJRA 1CVJA 2FC8A 4CQ1A 2E5IA 1YITS 3CCVS 1SJ4P 2BOPA 2ADCA 2N3LA 4WFNQ 1K8AT 5GAEU 4CH1A 3CF5Q 2KRRA 3P3DA 4WCEQ 3P6YC 1KD1T 4F02A 3CCRS 1X5OA 3LQVA 3THTA 2KH9A 1KQSR 3CCJS 1H2TZ 2M7SA 2U2FA 1HD1A 1KOHA 2CQCA 1P1TA 1RK8A 2UP1A 4PR6A 1NJIT 3HHNB 2BZ2A 2N7CA 1NU4A 2ADBA 3S6EA 1IQTA 5HO4A 2RT3A 2L08A 2RUGA 2ZJPQ 3UE2A 2PE8A 2KM8B 3Q2SC 3HI9A 1X4BA 2M52A 1VQMS 1WI6A 5LJ5Y 2DH8A 1KOOA 3CC7S 1WG5A 3G4SS 3VAJA 3CD6S 1R8HA 3SMZA 1QVFR 1UFWA 1H2VZ 2MSTA 2HGLA 1U1PA 1JMTA 4WFAQ 4TLQA 4U67Q 1X4AA 2RU3A 1U1OA 1WELA 3VAMA 3BO4A 4YB1P 2M4MA 3MUMP 5EN1A 1WHXA 1FJ7A 2XNQA 2MJNA 2CPFA 2MZSA 3G8SA 2AD9A 2HVZA 3EGNA 1ZZFA 1M5KC 3EGZA 3PIPQ 3MDFA 4P6QA 5DDQC 4IUFA 2G4BA 4WIIA 3MUVP 3MD1A 1F9FA 1X4GA 3VF0B 3THPA 2DNNA 2NZ4A 3R1LA 2KM8C 1A9NB 4LIRA 4YUDA 5FJ4A 4TU7A 1XN9A 1RKJA 1HL6A 2X1BA 3NS6A 2B0GA 1FT8A 2OTLS 2YH0A 4EGLA 5IFMA 2EVZA 2KYXA 2J0QD 4QPTA 2DO0A 2D9OA 3CPWR 2CPEA 2RS2A 2RS8A 2DIVA 2OSRA 1VC5A 4A8XA 2O3DA 2VONA 2PEHA 2FPHX 3V4MA 3NNCA 2DNKA 3CXCR 1YJNS 1YWXA 5BJRA 1U1RA 2DHGA 1UP1A 1PGZA 4WKRA 2NLWA 3D2WA 1VQ8S 2DNOA 2YH1A 1WI8A 1JJ2R 1X4DA 1P27B 2KVIA 4Y0FA 1M90T 2J0SD 5GVQA 3CMES 1X5PA 1D8ZA 1WF0A 3MUTP 3UWTA 3BEGB 3DXBA 3VAGA 3FEYB 4TU8A 1U2FA 2CQBA 1OWXA 2HZCA 2DGSA 3CULA 2DGWA 2MZQA 3L3CA 2DH9A 2K8GA 3SDEB 2MPUA 2QA4S 5DDPC 3TP2A 3CC2S 1FXLA 2Q79A 3J7ZT 1YJWS 1HD0A 2CQPA 1PO6A 3I55S 2DNQA 3FEXB 3UD4P 5GAGU 1SJFA 2KRBA 2MQLA 1N52B 1VQ7S 1U1QA 2RRAA 3IWNC 3MXHP 2DHSA 1L3KA 1WF1A 2QFJA 2CQ1A 2DGVA 3BO3A 2XS7A 1H2UX 2MZTA 2MXYA 2MY8A 3TO8A 3MOJB 1DHMA 2E44A 2ZJRQ 5JVGQ 2CQ4A 1JJ4A 2CPDA 1VC6A 2YWKA 2DGOA 4PKDB 2XSFA 2CQ3A 3RW6A 2M8DB 2D9PA 2DNRA 2JX2A 3G9CA 3Q2TC 2KHCA 2E5GA 3H2VE 1NO8A 1WHVA 4V19X 1N54B 2WBRA 3LPYA 1YTYA 1X5TA 3VAIA 2CQHA 2X1FA 2E5HA 1VQOS 1YJ9S 2F9JA 2M2BA 4OZ1A 2SXLA 5IQQA 2VOOA 2JWNA 5LSLA 3VAFA 2KT5A 2A3JA 4F25A 3DLLQ 2DGQA 2M88A 2LXUA 3UCUP 2VOPA 3TYTA 1FJEB 2DISA 2KXFA 2YTCA 1QVGR 1U6FA 2LA4A 2RNEA 2M9KA 2FY1A 2MJUA 3MURP 2LA6A 3U1MA 5H1SV 3CUNA 4UQTA 3BS9A 1A7GE 1U1NA 2DO4A 2RQ4A 5GAHU 3CCES 5MLCV 2L9WA 2ZJQQ 1WEXA 2N3OA 2XS5A 3CCSS 1QM9A 2JVRA 1BY9A 2M8HA 2MQMA 1VBYA 1OPIA 1Q82T 1O0PA 5D77A 5IM0B 3SDEA 5DDRC 2DNHA 2K3KA 2DNGA 4PRFA 2G1DA 2KU7A 3R1HA 3EX7B 1K73T 1WHYA 3CMAS 1JJHA 4QQBA 2CQGA 1X4CA 2LMIA 1U6BA 5CYJA 4IO9Q 4IOCQ 2CPZA 5GADU 1W2BR 2XB2D 1VQ5S 3CCQS 2LCWA 2U1AA 2KI2A 4TU9A 1SJQA 2KG0A 2DGUA 2MZJA 2V94A 1Q81T 1WF2A 2LECA 2DK2A 2MKIA 2DITA 2J76E 1X0FA 2DIUA 3ULHA 2HGMA 3VAKA 1U1MA 4W92B 2I38A 1YHQS 1VBXA 1M5PC 2JRSA 2MKSA 2MQQA 2J8AA 1X4EA 4RU2A 1B7FA 2HYIB 1VQLS 3US5A 2KG1A 3VALA 2I2YA 2RRBA 5LJ3Y 4F26A 2AYGA 4OZ0A 2CQ2A 1WEYA 5LXRA 2CQDA 1WWHA 3OW2R 2LEBA 2CQ0A 3CC4S 5HL7Q 2LEAA 2M0GB 2MKJA 3IRWP 1DZ5A 3H2UB 3NS5A 1U1KA 5CXTA 2MB0B 3SXLA 2RQCA 2GHPA 1M5OC 4J5OA 2N82B 2E5JA 1VQKS 3J7YU 1WG1A 2LKZA 1D9AA 3S01A 3G6ES 4C0OC 5LXYA 2MHNA 3BO2A 4YOEA 5CA5A 1U1LA 2LQ5A 1X5SA 2DNPA 4FXVA 2OIHA 1H6KX 2MKCA 2MQPA 3P5TL 3PIOQ 3CCLS 2DNMA 1YI2S 1VQNS 1K9MT 2DHXA 3K0JA 1N88A 1X4HA 1VBZA 3R27A 2MSSA 4LJMA 4Y00A 2YKAA 2DNLA 2KXHA 4C4WA 1VQ4S 4QU6A 4IOAQ 4QU7A 1M5VC 5IM0A 2QEXS 2DGXA 3UD3P 2EK6A 1SJ3P 1ZH5A 2MY7A 1WHWA 2HGNA 5ITHA 2KXNB 2OSQA 4WF9Q 3B4DA 4Z2XA 2OTJS 5LSOA 2DNZA 5DM7Q 4CIOA 5GMKa 1SXLA 1FNXH 2RVJA 1HA1A 2MQOA 3NNHA 2KN4A 2XS2A 1R8PA 1UW4A
chains in the Genus database with same CATH superfamily
4G6VB 3S8SA 4BS2A 4JI7F 3QIPA 1VFJA 2ZE2B 4NLXA 2MQNA 3LANA 4IG0A 3SSQA 4LMZA 3MOZA 2AJ2A 1M1HA 2QLBB 2LXIA 1T03A 4YQWA 4HACA 3I0SA 4DV2F 3RJMB 1IBLF 4ES2A 3D4JA 5BYQA 3LP1A 3PX6A 2HZAA 1UEKA 3J81Y 2HAFA 1RP5A 4NCGB 1BC6A 3R5CA 3FKBA 2UV8G 1S6PB 2V0NA 2WVBA 3QSIA 1OY6A 4P7VA 2BE7D 4DR5F 1F3VA 5HQ8A 2KRRA 2HAIA 2QMXA 3V6KA 5F8GA 3H90A 4Y2IA 3UNYA 1T7PA 1LEOA 1M0SA 4AL5A 3S6EA 1VQMS 1N6QB 1XERA 5LJ5Y 3SV3A 1KOOA 1ZM9A 2XMAA 4CLTA 3HXMA 3M2RA 3ISZA 2IJRA 1LNQA 1OMSA 3T1YF 2J9DA 3H4DA 3CJ5A 1TKXA 1XNQF 2VPYB 4ENOA 3E3XA 5AT1B 4G3IA 4N8OA 2AIRB 3HSJA 3EGNA 1ZTTA 3CMQA 1VMBA 3DGVA 4ETXA 5FDLB 1KFSA 2D3ZA 1VDHA 4TU7A 4L75A 1HL6A 2OEJA 4OX9J 1N5YA 3EZUA 2VD3A 4WYLA 1KHWA 3AQPA 2VKRA 1IKVA 5E5NA 1RZMA 2BABA 2IHR1 4NLWA 4LREA 2W2QP 5BJRA 4WP9A 1UP1A 2QMWA 4ECZA 3CGIA 4DUZF 2ZOMA 4EZ9A 4KB7A 5GVQA 3K5OA 2Y0SD 4YDXA 1R0AA 5ETKA 2CQBA 1D1UA 4DR7J 1OWXA 4IG3B 1HR0J 4N77A 3QFHA 3IBCB 2QA4S 4OHXA 7FD1A 3UQSA 3O1LA 4WPAA 2CWXA 3TZYA 1S0MA 3D3BJ 2KKHA 3EGVA 3HHEA 1FXRA 3BR8A 4EBEA 4I6YA 3OT9A 1U1QA 3KLEB 4CO2A 5KT2A 2XHWA 4C0BA 1S57A 3D28A 3Q89A 3K5NA 1EARA 1FA0A 3HK2A 4DF8A 5IWAF 3BGLA 3I5CA 4PYDA 1VC6A 3HVTB 2H5JB 1RWWB 4DX7A 3MM7B 4I68A 3PR5B 1N54B 2W4DA 1Q4RA 5M2PA 2UUBF 3M30B 3CJSA 4QYZK 2C2OB 4FF1A 3MEGB 4IDKA 2WONB 5C2GA 4DL2A 2M88A 3C15B 1NXIA 2LA4A 5L1KA 2EKYA 2RDIA 1Z2ZA 2W25A 1SL2A 3DC2A 2AW0A 2IC3A 2B4UA 5A8WA 3NAIA 2L9WA 4C3MA 4F4XA 4L6V3 1V3RA 4IR9A 1K73T 4ZHRA 1VQ5S 4O4GB 1RAGB 3BGFA 2PD1A 4RZRA 2ZEJA 2VFVA 4OYZA 1P6TA 3BSCA 1YHQS 1HQ2A 4FNIA 2J6TA 2CKWA 5KT6A 1KBRA 4PWDA 2HS3A 3N4WA 2Y8YA 2CADA 3OLBA 1UVLA 4DPUA 5SZTA 3DOKB 4USVA 1S1WA 2M0GB 3RG6A 1KLNA 5E0OA 3PZPA 5LMNJ 4NCBA 1DZ5A 1FDAA 2GVZB 2RU9A 2PT0A 4HI1A 3PYFA 1MSWD 3MMBB 4FXVA 2DR9A 1IKXB 2Q6CA 5LMUJ 1HBOA 4Y00A 5A8RA 5HQLA 3TX0A 3HMJG 3G86A 4BHQA 3ZNUA 3UDVA 2R8KA 5AXLA 5KG4A 2Y9HA 1FNXH 1NZ8A 2XS2A 2RIJA 1N33F 1OQ3A 1P1LA 2ERRA 2R8JA 1C1CB 2VODA 4C8YA 3JQKA 5JVHQ 3JS9A 4R8UB 4DU7A 1PKUA 3HF5A 2BBEA 5EHHA 1X4FA 5THWA 4CLPA 4N41A 2D74B 3PNIA 2CPJA 3CCMS 4ZIVA 3GJSB 2ASJA 2X1GA 3TZWA 4K59A 3VAHA 2EK1A 1Y7PA 3C6UA 1JLCB 3PJWA 3SCLE 1DTQA 3A8EA 1YRTA 2K06A 4ZP7A 3ZZRA 3EDQB 3GIMA 3SQGA 3CCUS 3EUNA 3S7RA 1Y5NB 2I0XA 2R7XA 2XEXA 3B4MA 3PW0A 2LQJA 1Q7YT 1DRZA 4HYKA 4ECXA 2HNZB 3GJQB 2DHAA 2VBWA 2XY7A 2DD8S 1PSDA 1S1XB 1S9GA 2AX1A 2GQ2A 3PXGa 4IFYA 1N32J 3MTKA 4ECWA 3AD8C 3P3DA 1KD1T 4F02A 4OYIA 3RBZA 3VGUA 2VU5A 2VF3A 2HMIB 1S1TB 2XM3A 2CRLA 1U0SA 1DFDA 3OJUA 5F0WA 3TEHB 4KGMA 9RUBA 4TQRA 5IOLA 2AEMA 1XR7A 3HZEA 3HD1A 1YRXA 2XYGB 1H2VZ 5KFGA 1HQEA 2R42A 2DXDA 1KVKA 2B7CB 3DYAB 1B3TA 3I87A 3IXQA 1VK3A 2YY3A 2W7AA 2Y0BB 3Q0AA 4RUBA 2NZ4A 5FJ4A 1XN9A 2IDEA 4QR1A 4NWBA 5H9FJ 1FKOB 3CPWR 3WZ0A 2RS2A 3FBCA 4DSIA 2VONA 3M8PB 2R7VA 1PGZA 3D2WA 1SQEA 4DL7A 3DRSA 1RTZA 2RMLA 3RB0A 4ED6A 2KVIA 2J0SD 2P8IA 4RWXA 3DU6A 3CSKA 1NDLA 4OX7A 1HI8A 1ZA1B 4EWTA 3TA0A 4TYBA 1JLQA 2HURA 3LH2S 3SDEB 1HWJA 5DZ7A 1DAXA 1WC3A 2C1EB 4URSA 4MJKA 3R7NB 3FEXB 1Y3KA 3M7VA 1RT2A 1CLFA 2KRBA 4G1IA 2EKNA 4USWA 5LSRA 2DHSA 2YNGA 1L3KA 5HJYA 4A8FA 1ZPVA 2VHGA 4DX8H 2GMLA 2IMOA 2PA8D 1DHMA 3EE3A 1J5OA 3B78A 4DV4F 2YWKA 4LSLB 5J2MA 3E01B 2EFOA 5I3QA 4CP5A 2D7SA 1NHUA 4OFZA 2J9DE 3VAIA 2X1FA 1NAQA 5HLFB 4RNFA 5KFVA 3PEHA 5ETNA 4ZA1A 4Q8EA 1HWKA 4IH5A 4X64F 1NDCA 4M8LA 2FUG9 3U1MA 2DYAA 4GKKF 4G65A 2MTLA 2V4JB 2AZ1A 2XS5A 3OBIA 3F56A 1FRHA 4U8YA 1NH8A 2E29A 4WP8A 4DV6F 2DNGA 4PRFA 3EYZA 3R1HA 1X9WA 1HMVA 4WKYA 1JJHA 2RF2A 2HVHA 1CJVA 4OYXA 4L3NA 2CPZA 2X3DA 2F4FA 1LWEB 3ENQA 1O8BA 2J76E 3EXCX 5ETTA 3JQJA 5IQ6A 1FTCA 4ZVFA 2VPWB 4OYBA 3ULHA 4B02A 3PV8A 2IA0A 2X7IA 2MQQA 3PEJA 5HVGA 5DQIA 2OPPB 3MEDA 3B54A 4DDFA 4NXNJ 1WC5A 2LEAA 4ZVPB 2OH2A 2DHHA 2MB0B 1GXTA 3NBPB 4FPIA 3PX4A 1VQKS 2VUGA 5J1EB 4LF7F 1K0VA 2ATLA 4I69A 2D41A 2B6AB 5CA5A 5AE1A 4N56A 1J5EJ 1AZSA 3CJKA 5F8JA 3VGTA 3IR7B 2OPQA 3W9HA 4EBDA 3KLIA 2J9CA 2KXNB 2OSQA 2RE1A 3G6YA 4F50A 3SCJE 1HFEL 4JUZA 4LF5J 3GWCA 3MF5A 2OPRB 2H54B 2L9NA 4XDCA 5B09A 4K8RA 3RB4A 5KFIA 4I67A 1VQ9S 2V8VA 5ETOA 2HLUA 3QBCA 4IFVB 2MMYA 5CQGA 3N5FA 3V4IB 3JTOA 4FXWA 3DNCA 3DRPB 1BQMB 4C7QA 4DPWA 5KT4A 2VFUA 5AXMA 1VQPS 2F3JA 2HS4A 3SI8A 4ED8A 1RCOB 2ATCB 1FRKA 2MDAA 3BQ1A 5T7LB 1V5VA 2M70A 2QLJB 2GC8A 1GX6A 3AFGA 5L8RC 5HROA 1RTJA 5LL6d 2BJ1A 3G82A 2P6SA 2HIYA 1VGYA 3QGHA 2BANA 1JLAA 5CCMA 1QTMA 4A8WA 2ZHBA 2R7UA 2FIUA 1FNMA 4NZ6A 1V3SA 3CCRS 3I9ZA 1KWMA 2IFXA 3Q8QB 3CJ2A 3CCJS 1FKPA 2D3UA 2M7SA 2G9OA 4UOFA 3J80U 1W2IA 4TVAB 3GYXB 1HNIA 2E7XA 1JB0C 2XULA 1ZYQA 3D67A 3TANA 2M52A 2OMOA 1D9DA 2VFRA 1IN0A 1WD6A 2XSJA 1QDUB 3VAJA 1RTHA 3DRRA 2HGLA 1LK5A 1TKDA 4NCAA 1RGVA 5HP1A 4OLOA 4OHZA 3GG0A 2AD9A 2CPFA 1FFWB 2H65B 5U47A 4NA3A 4ECYA 5IT9Y 3DKDA 2NQPA 3CJ0A 1FDBA 3JAMY 4XAKA 2YWGA 2X1BA 1KEKA 1FXDA 2RS8A 2POKA 4J9VA 2CDRB 4RBVA 1IBMF 3VV2B 4FYYB 3ZZUA 1RHRB 1RWKB 3MAHA 5C24A 5AXNA 3QRRA 2DHGA 2ABYA 3GIRA 1HIYA 3VZIA 3SIPB 1AROP 3DLEB 4Q2LA 2XO6A 1SVDA 2K7KA 4J9SA 1TKZA 4HH1A 3RZAA 3P8BB 4DN0A 3DDKA 2AKWB 1UJ6A 1N34F 3MR6A 1NNDA 4DV3F 5JXSA 3MM8B 2XYHB 1RT3B 2BUNA 4DFJA 1YJVA 3I55S 5E7OB 1RXOB 3MCOA 5AJ3F 3CIMA 4CRJA 2E9RX 3C19A 3DLKA 2C22A 2UU9J 3DDIA 1IM6A 1VOMA 1RTIA 3PCOB 4C0HA 1FK9B 4KHMA 3ISND 5I42B 1LKZA 1GMVA 2CQ4A 5KFKA 4AL6A 5CABA 4YMEA 4KAIA 2E5LF 3NXZA 3MPWA 3DOMA 1T95A 3NEKA 1Z2LA 3OD2A 3GYNA 4RW7A 4ZCMA 2PFDA 3EPGA 2KT5A 4DSLA 4DV7J 2J9EA 1UWBB 3EZ5A 2W4CA 1M5SA 2DGQA 1BD6A 4DR2J 2HFZA 4DQPA 4OZJA 2CNNB 4K0KJ 4CTAA 2MLXA 2FZCB 1FE4A 3QFWA 4DF4A 3OVBA 1CS4A 3HHLB 1Y3JA 1HPZA 4JV5F 4IOCQ 1TL3A 1FESA 4NZ7A 3NCRA 2HQCA 1EHWA 2KG0A 5I4MA 1T94A 3JQMA 3POTA 3QGIA 2I9SA 5CYQA 2QLWA 1X60A 2EFGA 4Z7CA 4ZPCA 2I38A 2EFVA 1ZBTA 3BGUA 3US5A 3PRDA 3IAM9 3HFVA 2B51A 5ETMA 4GKJJ 1DTTA 3EVWA 3M1VB 5LXRA 2CQ0A 4C8OA 1QSYA 3LAMA 2MKJA 2VG7B 1T9VA 1ITPA 3KWMA 4LT6A 1EP4A 6AT1B 1U8WA 2ZBIA 3WDOA 2ZDPA 3BZQA 4WK1A 4URGA 4MAKA 4CLWA 2MQPA 3MWBA 4C97A 1HQUA 1IR2A 5KFYA 2UVUA 4Y2AA 5CZXA 1N5VA 3W5YA 5D0EA 4YB6A 4QU6A 3P4UB 3K8VA 4FYWB 4I2QB 1B0PA 1FRJA 3WX8A 1HHQA 3CCZA 5ITHA 3BBFA 3TAMA 1JQGA 5GMDA 1WC6A 4FF4A 3GR0A 5FD1A 2HNDA 1UW4A 4ZP9A 5KFLA 2LFVA 2DH7A 1E6YB 1NHKL 1N5SA 2FB0A 1U2CA 3G96A 2OD4A 5KFNA 3WIUA 2AYEA 5HANA 2OJ3A 2MKKA 3AD7C 2MYFA 4DL5A 3RAQA 2XMUA 1KDNA 2YQ0A 3TJ8A 2HK2A 3H0PA 1VRUB 2Y3YA 1OIAA 2XNRA 3I32A 2FHOB 4AQYF 4O3NA 1FCAA 3RRGA 4MKBA 2ZH2A 2YKNA 1S4EA 2DR7A 1O5JA 4ED5A 4Z7YA 3MD3A 4ZN1A 1QE1A 2G2OA 4WE1A 1SJRA 1RA6A 2YX4A 2P2CB 2BJDA 1RSCA 4ER8A 2E5IA 1TKTA 3NRBA 1S6QB 2CXEA 4A4JA 1UVNA 2ACYA 3HT3A 1CEZA 1L3VA 3J7Z5 3BPSP 3HPOA 3OFHA 4A46A 1HD1A 2V69A 4U7UD 3LP0B 1NPPA 4GVLA 3MM9B 3OL7A 2RUGA 3UE2A 4B9SA 4I6WA 5HN0A 2AU0A 2YNHB 4DU8A 2E1MC 4BCAA 3ILJA 1PC5A 4ZCLA 2LP4A 3N5BA 4NLGA 1HNZF 1UFWA 1QTNB 3W9JA 3UDLA 1EIYB 3MM5B 4K5SA 4LF8F 4FYVB 3D1OA 5EWFA 2M4MA 1ZTWA 4K4SA 3HDSA 2ILZA 2ZKTA 3W5ZA 4ZVQB 2YNGB 2DRBA 3MUVP 2DNNA 4GVBA 3O44A 2KM8C 1RKJA 4KY3A 2KZZA 4KGVB 1C1BA 4O0IA 2DO0A 5KFBA 3BKUA 2DIVA 3FDSA 1NK5A 3KNAA 2BW2A 4QWAA 1SH0A 2P6TA 1MU2B 5J2PA 1U49A 4QBUA 1YQHA 3KLGB 1I51B 2WVDA 5HJXA 1FJGF 2AJQA 3BBCA 2O1PA 4O44A 1ACMB 1RWVB 2VPXB 2ROGA 3FUYA 2ZM6J 1YBTA 4X62F 5IZHA 2CUYA 1R7IA 1C2PA 2WTFA 2GJIA 2OHDA 4I7FA 2V9WA 3A8JA 5AXKA 1JKHB 2AJ4A 2GGPB 4KKOA 2WB1D 4Y6IA 3TVZA 1N48A 4KBIA 4U7CA 1EKRA 4C2MA 4QIFA 2B9WA 4NEYA 2BX6A 5C42A 2QA2A 4ANDA 3EDRB 3I82A 4Y2CA 4AL7A 3HFZB 3KYLA 3Q2TC 4NI2B 2V4QA 4WP3A 2YVSA 2M2BA 4B3MJ 4OZ1A 3H5UA 2SXLA 3NGTA 5IQQA 1PCAA 3L4BC 2KXFA 4PXEA 3MECB 1P9QC 4PWWA 3NGUA 2KVQE 2YX1A 4NLPA 2GMJA 3R5BA 1W7WA 4TY8B 1U1NA 3M2VB 2NXNA 4F0MA 4MIAA 4DZDA 4C9DA 2DBBA 4KH1B 5F8HA 3M32A 4YP3A 1RHKB 3MFIA 4QQBA 2C2EA 1PG5B 1W2BR 3J7A1 4BC9A 1NPKA 2V94A 4DHVA 1BQNB 1Q81T 4MK9A 1EQMA 1QAIA 4DSFA 2W4PA 1U24A 3OFEA 2OEMA 4ILMA 3VAKA 1U1MA 5F3ZA 3KHLA 1FWKA 4JI3J 5L1IA 4K0KF 2KG1A 1GT8A 2HBZB 2V2ZA 3NGRA 5HQMA 2QSFA 1WEYA 3QYYA 1LWXA 2QLFB 1QD1A 2BRKA 4DUYF 3K8WA 3G6XA 2VQEF 4X4SA 3ENWA 3ZXWA 1I6JA 2NUUG 5DS7A 1HI0P 4B3TF 2LU1A 2E5JA 4A8KA 2GIQA 2H51B 3MPVA 1A6LA 2R2UA 3FBBA 3KG1A 4QIGA 3OLAA 3WQPA 1YI2S 2DHXA 1X4HA 4KV8A 4TN2A 4P2FA 1S59A 2YKAA 1K1QA 4OMFG 3H4BA 4RUAA 1FTRA 4P2MA 3B6BA 2OELA 2APOA 1XJWB 3QAUA 3BSOA 5LSOA 1CJKA 3QAEA 4X2BA 2NZCA 2X1AA 1SQGA 3TRGA 4M5DB 2PGCA 4KHPJ 1DBDA 1LFPA 4Y2KA 1P8GA 1FJCA 2L41A 4JI4J 2GQQA 3FQKA 3RW7A 1Y5IB 5D78A 1X9SA 3W8PA 5HP1B 1JJCB 2MKHA 3W7BA 2BE2B 3CO0P 3OV7A 2B7BB 5HBMB 2V2QA 1NK9A 5KG3A 3OVAA 1RDRA 2HW3A 2CPYA 2CQIA 1NSAA 2QA1A 2FGOA 4ALZA 3JXOA 4AXJA 1HNWF 2ADCA 4O0NA 2KFZA 3BN7A 4DXLA 2YNIA 2VG6B 4NYPA 2ACMA 4K5RA 1KQSR 5IV3A 3KKFA 3D1QA 1L3SA 2EFQA 1QUVA 1VQSA 1IQTA 1H73A 1REGX 1XEZA 3W66A 2G0JA 3CW2C 3IR5B 2AMCB 3I4PA 3AOCA 1JLGB 2RU3A 5KG5A 4EO8A 5K8OA 3BSNA 4NE9C 3KLFB 1N4LA 1HYSA 1DJ0A 4GMKA 3G8SA 3DLKB 3M05A 4ZJLA 1M5KC 4LVNP 3PIPQ 2HQGA 3BN4A 4ES1A 2ZZMA 4X4VA 4LRAA 3MD1A 2ZH3A 1MN7A 2W1BA 2JL9A 3FNNA 3R1LA 4PXDA 4K4ZA 3KHGA 3NS6A 4RWWA 3MR2A 3EPIA 1XMQF 2KYXA 2Q6BA 1CJTB 4NASA 4PZVA 4A8XA 3UPFA 5KFQA 2HIQA 2FPHX 2GJ2A 3DM2B 5A6PA 4JI1F 1X4DA 4C8LA 4YR2A 4EI2A 2ZH5A 2B9YA 5GADI 4RUHA 4J9QA 4QJVA 3EM1A 1JLEB 5I3PA 4DV1J 4KR0B 1JLFA 5DDPC 3GMGA 3R6LB 3KDOA 3V2UC 5B08A 1RTDA 5C25A 4R5PA 3PM9A 4LFCJ 3Q8YA 2ALZA 1UEVA 3R7BB 3CJQA 1S49A 3EICA 4LBHA 1VBKA 4JYAJ 4B9TA 1S1VB 2CQ1A 3HULA 4P71A 2CWKA 1QAJA 2AX0A 1RACB 3ZTPA 1I1GA 1JLBA 3BYRA 2J0XA 1JNRB 3T9ZA 4W98A 4JI5F 4KH0B 1GNKA 4ZVOB 1DTTB 1FDNA 1UTAA 4ZS6A 2HWTA 2CJXB 2ZM6F 3ILOA 2VOOA 2GO8A 3MCSA 3DLLQ 2FJAB 1U6FA 3KNGA 2UVRA 1TK5A 4MH8A 4PCQA 2IM1A 3MURP 5CHCB 3AXKA 3A3PB 4U8VA 1UMJA 2Q66A 5MLCV 2ZD1B 1TQLA 1NJYA 3B82A 3MM6A 1QM9A 3BB5A 2UXDJ 1SCJB 5DDRC 2BW7A 3SZ2A 1B64A 3CMAS 2CQGA 3FGVA 1PC4A 2LMIA 2M3DA 1K0TA 1H7WA 1CC8A 2DGUA 1WF2A 4B3MF 1VIOA 1WKKA 4RW9B 3RGIA 1WACA 3V81A 2PMHA 1Q8BA 3ILIA 4XK8C 4HTIA 4XIUA 2UUWA 1OYEA 5D0GA 3C16A 4OHYA 4HVZA 1VBXA 1M5PC 3BDPA 1IJEB 4UY85 2YQ3A 3W5XA 5J2NA 1RT5B 2PMWA 1N5QA 1RT4B 3Q8UA 4ED3A 3K59A 2RUSA 4I2PA 1R0BG 4G1QA 4JP8A 5B0BA 3J81j 3OW2R 2HQ3A 5HL7Q 2R8GA 1W26A 3BH7B 3SXLA 4CO4A 2AQ4A 1EB0A 1KVIA 1TU0B 2LKZA 3MAAA 5CH7B 3K5LA 3W8GA 4FBUA 2YKNB 3BO2A 3HVRA 5D3GA 1U1LA 4DOZA 2MKCA 2KJVA 2DNMA 4J9MA 1HWUA 2ZE2A 1T9YA 1VQYA 4ZPDA 3RUBL 4ECRA 4DR4J 2A6OA 3LO3A 3WHIA 2E1AA 4RW8B 3H25A 2EK6A 1PJ7A 3D0HE 4LF9F 2HS0A 5KTQA 5I3UB 3HSDA 3MMCB 3TUJC 7FDRA 2QYGA 5BR8J 3MEEB 3AT1B 4KIAA 3RRHA 4DFKA 1FHTA 2WSCC 2VBZA 2GO9A 2V2KA 5C5JA 2LU2A 4NCGA 2F4VJ 3KTQA 4X4UA 3GJRB 2D3OR 1S6PA 2FC9A 4NRUA 3KDNA 3HHLD 2EXUA 4H4OB 1NK0A 4K4WA 4QYZJ 4Y3CA 2CPIA 3UCGA 2D1CA 3TOQA 1C1BB 3PHTA 5DETA 4ECUA 2XMTA 1UZDA 3SFGA 1RI7A 3R5GA 3GSIA 5LM7E 1N6QA 3WC0A 2N3LA 4WFNQ 4OJGA 5B0CA 1ZS6A 2UXCJ 5KFMA 3DRYA 4F36A 1RHUB 2CQCA 1VHFA 1P1TA 1ZAXA 3FRYA 4CZCA 1RB0A 4C8NA 1GXLA 3Q2SC 4I56A 1TTHB 4OI0A 5FDLA 4UW2A 1KLMB 5G0RB 1R8HA 2GVDB 5D0HA 2GQCA 3LW5C 4BDPA 1Q78A 1JMTA 3LA0A 1BWEA 4PAAA 2HK3A 4YB1P 2LDIA 2HFSA 4P6QA 4IUFA 2G4BA 2ZWOA 1D3WA 2DPIA 2PO4A 1GAOA 3FRZA 4DR6F 4DI6A 1NKCA 1X8DA 4QPTA 3D6TB 1NSPA 4X4QA 4ECSA 3GQCA 1UETA 4IG3A 3IS9B 4F7VA 1N0VC 2F7VA 2Z2YB 3SSRA 3CD7A 4J9NA 1IVZA 4NLSA 4NYOA 4B3OB 2DKOB 3TQEA 3KG4A 2HWHA 1EKSA 1TUWA 3GFHA 5HK4A 1Q95G 1GTEA 5KT3A 1ELOA 5CD4H 3MUTP 2J5AA 2QT7A 2XYPB 3VAGA 3FEYB 1U2FA 2CZVC 1JNZB 4JI0F 1NCLA 5B0AA 2W8KA 2DGWA 1SC6A 2BQUA 2HHPA 4ZN3A 3PDNA 2WK4A 2HWIA 3HVTA 2JEIA 3PY8A 3MM7A 3GIJA 1RLDA 3OTOJ 3PW5A 2PI4A 3M30A 1LOUA 3TAQA 1GK8A 1B0VA 3HSGA 3MEGA 2WONA 2GHVC 3C15A 5KAKA 2H1YA 1YKWA 4EEYA 3PW7A 1WKJA 3CB4A 2ZVSA 2CQ3A 1TAUA 2M8DB 1RCXB 2JX2A 3G9CA 1RWXB 2CQHA 2HHXA 4DL3A 2P9CA 8AT1B 3GR1A 2YWHA 2UXBJ 2H4WB 3Q8VA 1R8AA 1CBKA 2MJUA 1VRQC 4MK8A 5GAHU 2UV8A 2YKOA 3OXLA 2FHKA 3ZZOA 3OL9A 1TL7A 3R5JB 2F8EX 4EO6A 1XIQA 1O0PA 5D77A 4YEAA 3BJYA 2DNHA 3KHRA 2KU7A 1ZM3A 1HWLA 1YRUA 4P73A 3LPEA 2U1AA 3RRKA 1XNRJ 3U27A 4CI0B 2DITA 3TZZA 5DLFA 3KJFB 2HGMA 3ETOA 2GVZA 4W92B 1IWAA 1FX4A 2CJBA 1AB8A 1WDDA 4LF4J 4XTTA 3MMBA 3HJFA 1IKXA 2C2MB 4F26A 4Q43A 3LP2B 1NJXA 3GFYA 4Q44A 2NSBA 2NXCA 1JK9B 4USTA 3H2UB 1T05B 4UT4A 4CO5A 3T9NA 1ZM2A 2FJWA 3R9LA 3RAMA 1YJ7A 5ETSA 1C1CA 4DFMA 1TFYA 2BKOA 1KTQA 2OFHX 3CIZA 4R8UA 3RR8A 2IRXA 3CO9A 3D54A 2QEXS 3UD3P 2X51A 5D4OA 4C48A 2UUCJ 2HVDA 5FLXU 5BXIA 1JLCA 4NL5A 4DG1B 3JYTB 2XMMA 2NPIA 2KL8A 2FQQB 5EGYA 2DNYA 4JI2F 1HI1A 3KHHA 4AD6A 3PKMA 2DB1A 4ID8A 1WOOA 2WHOA 3GU0A 2Z2LA 4PPZA 2C3PA 1VCTA 1S9FA 1NUEA 2HNZA 1VYAA 2QL7B 4F3QA 1S1XA 4BWJA 2I6WA 3EWGA 2NSCA 3NL0A 2F9DA 2CPHA 1AUDA 2YXLA 2VH7A 2MGZB 5DDOC 3EXYA 4ZITA 1HNXJ 2RRNA 3AA9A 2HMIA 1N0UA 1S1TA 3ZTQA 1QSLA 2ZZTA 3CT9A 5D4NA 2YX7A 4EK2A 3BQ0A 1MG7A 1UFKA 2Y1RI 2BJ3A 3CD5A 3ENVA 1T3OA 5K9FA 3HT0A 1J2VA 2FLLA 4K7QA 2NR0A 3F0NA 3GCXP 4Q45A 2HFNA 4GC6A 3DYAA 4YB7A 4PXCA 2D3O1 2EC2A 3HHNB 2BZ2A 2ADBA 4QWEA 4AUKA 4Y65A 2DH8A 3O3LA 3CC7S 1NJZA 3GP9A 2N4DA 3PO4A 1ZA2B 2DJWA 4DFPA 1U1PA 1X4AA 1FKOA 4OI6A 4OI1A 3HP6A 3K5PA 3CDWA 1F2HA 3M8PA 1RAIB 1XR5A 3THPA 2BMBA 4DV0J 2W9BB 4M95A 2KJWA 4ECQA 1JLBB 3TA2A 2J0QD 4RU9A 3VVTA 2FVCA 2PEHA 1OYDA 4MK7A 4V1Ak 4LIWA 1UA0A 4P2SA 1EQ0A 3QZ8A 1Q53A 3HCXA 4Q2MA 3K5MA 3ILLA 4JI8J 2VBXA 2JLEA 4PUOB 1FD8A 3L3CA 1NSKL 1TMJA 1FXLA 3J7ZT 4LSLA 2NCKL 3GONA 3E01A 5A8KB 4YY3J 4NLUA 1OY9A 1TL4A 3OR1B 1TL1B 4DN9A 1N52B 2ZUAA 5HLFA 2WRMA 5DO2A 4ZVRB 3C2PA 4WWSA 3C16B 2CVIA 3FZ2A 5ADZA 2A18A 1S10A 3PVXA 1IBKF 2J0WA 1TAQA 3M6WA 4RUCA 1QLNA 2HVIA 2DNRA 2V4JA 2AP6A 2FZKB 4NA1A 3D6HB 1RABB 2AJ0A 1VQOS 3DGPA 1IKWB 5F8LA 2A3JA 3HO1A 2XG8A 3IG1B 3UCUP 4LF6J 2VJUA 1NK6A 4CLZA 5CYMB 2QSWA 4CLUA 2XMVA 1LWEA 2R2TA 3LWMA 4FS1A 4PG7A 2DO4A 2RQ4A 3R2DJ 3CCES 2ZJQQ 4ELTA 4PG4A 1RAJA 3DRXA 1GQEA 4MKVA 1L5UA 1SH3A 4PXBA 2A6MA 4L74A 5ETVA 1VRTB 3FCWA 3NCQA 2YKQA 1XR6A 4AYBD 2OPPA 1SC4B 1AW0A 2R4FA 2GJFA 3X3UA 4ZK7M 4KRWA 1Y4ZB 2GS8A 2EI5A 1SQFA 3NBPA 1H98A 2XC9A 5J1EA 3ET6B 3FMBA 3C46A 3MHYA 3MFHA 2B6AA 1OSCA 2AJFE 2IVFB 4DPXA 5JJBA 1IKYB 5A0YB 2CQDA 5SUHA 2R2RA 2HG4A 1T9XA 2HHHF 2R7RA 3QT7A 4F0HA 4RNOA 5L1LA 2N82B 2C2KB 4NZ0A 3S01A 2HBYB 1URRA 3T5LA 1H74A 2OPRA 2ASLA 2BR0A 2MHEA 4DR3F 2I5JB 2ZFHA 1VQNS 1VBZA 1IBCB 4IFVA 4QWDA 4LJMA 1NLKL 4ZCKA 1GTHA 2FDNA 3V4IA 2V63A 3UDEA 3DRPA 4CLYA 3QT8A 1BQMA 4D3GA 3OTBA 1XWLA 1SV5B 3IGNA 3C3LA 4K2XA 4DJBA 3K89A 2BM0A 3AA8A 4DQRA 4YR3A 3D6FB 5T7LA 2R8HA 2Z58B 5E41A 4P7TA 4A8SA 5D0RA 2VQFF 3W3SA 2FJDB 4JI6J 4IRKA 2NXEA 1RT1B 3UCZP 3ZZYA 2XMWA 3DXSX 2UUAJ 2L9DA 3CTRA 2DR6A 2IYIA 4X66F 5D4LA 2GCFA 3IP0A 3W2VB 1U6ZA 1A0OB 2BJ7A 3JSYA 3PYDA 1HBUB 4OX8A 4ITSA 5KFTA 4USKA 5J2QB 1SJ4P 3UVJB 3RYLA 1F60B 1V9OA 4X65J 4RR5A 1RJJA 4AT1B 4CH1A 3W62A 5KG6A 2ZWPA 3L9ZA 3GJTB 3OHAA 1B4SA 1NSQA 3B8HA 2XZWA 4HDHA 2JEGA 3FMWA 4HI2A 2ZJPQ 1YDLA 2UVWA 1HNXF 2VG5B 4WK3A 1CQNA 2W9AA 3IC1A 2B9EA 2RAQA 3HD2A 2OP5A 3R5DA 4F2SA 3PYEA 4E0DA 1XMOJ 3VAMA 2E7WA 4WXWA 4RPFA 2XNQA 1YK9A 3EGZA 4B3SF 4QIEA 3DLEA 4J9LA 2HNYB 1N36J 2BACA 2YH0A 4EGLA 5IFMA 4M5GA 2VFTA 1BGXT 3CXCR 1IWGA 1EETB 3MM8A 1RT3A 1YWXA 2BA9A 3FK4A 5HVHA 2IM2A 1B7YB 2VDIA 4DV5F 2K2PA 3DOLB 1AFIA 2ZOGA 2KZMA 4Y0FA 5IXUA 4R0EA 3Q23A 1Y9OA 5KT5A 4YR0A 3E51A 1TL7B 1RAEB 3UD5A 1FK9A 1NRKA 4GC7A 3VGSA 4Q0BB 5I42A 2ZC4A 1YJWS 3LF0A 4FYXB 1BWVA 4LRCA 2ZOFA 3R97A 2CFXA 2OGUA 2OO4A 1G6BA 1X31C 2QFJA 1FI4A 4NLYA 1UWBA 1H2UX 2EBGA 4NLOA 2V5HG 2ZBQA 2BEFA 3M9OB 3AHPA 2C2DA 1KKHA 1RBLA 3OL6A 1FNOA 3PO5A 4V19X 2LQ8A 3KUHA 2HFUA 3WIVA 1QSSA 2F9JA 3NG8A 3T6BA 3ZTOA 2R7TA 2ALYB 3HHLA 2CA9A 2Z8QA 1I94F 4KPCA 1R3NA 5L9NA 5KFEA 3ZFVA 4IH7A 3D66A 3CUNA 4OL8A 1Y00A 3MTJA 1ZAVA 4NA2A 2EW9A 3SEOA 2IAJB 4WFYA 2QGFB 1Q82T 1UPMB 4B3RF 3DLGB 1RAOA 2PMZD 2BYCA 3V6DB 5ETRA 1UFLA 3ZO7A 5F8IA 3GZ7A 3M1VA 2V8HA 1WKLA 4N76A 1SKSA 3TX8A 4RKUC 4FN5A 4KGXB 2HPUA 2NS1B 1REVB 2VG7A 1S5ZA 1X0FA 3QJLA 1YX2A 3HFKA 1TMMA 5L46A 4RU2A 3VALA 3U02A 4NPOA 2VA2A 3QWPA 1DY3A 3H8YA 1LWCB 2FHJD 9ATCB 4CT8A 3IRWP 1WDTA 1S77D 3UI3A 4I2QA 3FCVA 2P5VA 2OUGA 2H3EB 1H0HB 2C3UA 4M5LA 1U25A 3PJXA 1F0XA 1E6YA 4CT9A 2AGOA 1FVSA 1K9MT 3C6TB 4JB8B 2Z0GA 3H2LA 4ED4A 4LF2A 2BKNA 5IM0A 3VR1A 4OV1A 4QPXA 2FJEB 2ZVIA 4CH7A 4OZLA 1SXLA 1YSJA 1S79A 1VRUA 2ZHOA 5B7WA 4KGZB 1S72S 4HT5A 1NHVA 1M1GA 3BQ2A 8ATCB 5M2RA 3JB9k 3TVKA 3HHKA 4ERDA 4HLBA 1U4BA 1Q86T 2AZ3A 3MMAB 2NPFA 4OLPA 3G8TA 1C0TB 2GNKA 1YGYA 1Y11A 3OUYB 2CJAA 1S6QA 1YZ6A 4NXMJ 5H9EK 4DSEA 3AH6A 2BJEA 4UY8T 1WG4A 2MZ1A 3ZZZA 3GG1A 1JWWA 3LP0A 2AYBA 4ZPWR 1HLWA 3IM8A 3MM9A 3RBXA 3M8SA 1R6VA 3I6PA 5T41A 2YNHA 4OX9F 5E2QA 5AE2A 4JI7J 4ZJOA 3QO9B 1MROB 3MM5A 5KFPA 4ZCIA 2KH9A 2UUTA 5F0UA 2U2FA 4QZVB 2B43A 1RYSA 1SL1A 5GAGI 4LVOP 1X9MA 3H59A 4MYTA 4DV2J 5D15A 2PIIA 1IBLJ 2GIFA 4USIA 2UZAA 3BGRB 3MGJA 4MKAA 2XLJA 2V34A 5KFZA 3LTOA 4C3KA 5B0GA 1U1OA 1WELA 4DR7F 4A8OA 1HR0F 3WBZA 1WSRA 2IVMA 4ANCA 4OZ2A 2GW8A 1KHVA 4CO3A 1NKBA 3R6GB 1MU2A 4M63A 1X4GA 2HRUA 3SSSA 1IR0A 4UF4A 2V8PA 3FEZA 3KLGA 2B4PA 2OTLS 2QN6B 1FERA 1VJWA 4HHJA 4A8YA 3OR2B 1F5AA 4K2JA 3DGPB 4KHRA 2NLWA 2DNOA 3O8WA 3IM9A 2W24A 4OJ3A 2VZ9A 1N56A 2A10A 4P9SA 2W9CB 1Y10A 2MLZA 1JKHA 3T1YJ 1WF0A 2GGPA 1XNQJ 3H5XA 3BF4A 2WVCA 1F9EB 4NRTA 1N36F 2ZC3A 4Q7AA 3U1NA 4CLLA 2Q79A 2EG1A 1HD0A 2EFNA 2LDYA 1YVFA 4NI2A 4NX9A 4H4MB 2QZ8A 4RNNA 3AJ1A 3KK3B 3NGKA 1FRLA 1LXNA 3TARA 3T6JA 1P9YA 2J8SA 3MECA 2E44A 3QSYB 5CCLA 4TNOA 1JJ4A 2CPDA 5KG0A 4DUZJ 2DEIA 4TY8A 4D3HA 2E1PA 3T41A 3M2VA 1HBMB 2K1RA 2WBRA 1X5TA 1KP6A 1DQ9A 1FEEA 4C98A 2YQ1A 1R8BA 3Q22A 4IR1A 2W7PA 2PDAA 5KT7A 2LXUA 1RYRA 3H5SA 1BLUA 2Z2MA 1BQNA 5LMNF 1T8EA 1KFDA 2XQCA 5F9LA 4XPCA 2W2MP 4C8ZA 3CCSS 2JVRA 4RL1A 3MAQA 3G6VA 4FP9A 2XB2D 5LMUF 4QR0A 1S48A 4O23A 5IWAJ 4ES3A 4UOHA 2RDDA 1HBNB 3P5BP 3D0GE 3DI6B 4L76A 2GV1A 3MEKA 4J90A 2UUBJ 1HW9A 1UJ4A 1X4EA 2VBYA 2XHCA 3FJ2A 2LLZA 1APSA 3HHLC 4W4MA 1BE4A 3HVWA 1WWHA 4B9NA 2PI5A 4ZP6A 2AWZA 5HMYA 3NS5A 4DPOA 1R31A 5GAEI 5KOXA 1F2GA 1LQ9A 1X7VA 2RKIB 4C3LA 3D5MA 3PRBA 2ROEA 2GHWA 1WSVA 1WUUA 1LW0B 4M5DA 3R27A 1WJ9A 3ZTRA 3CJ4A 2VJVA 3IA0A 3AOAA 3R7SB 1R43A 1RAFB 3OSNA 3MCMA 4ZLLA 4XPEA 4WZQA 3C8YA 5IT9U 3KLHB 4CIOA 2PFFB 2VC1A 1PJ6A 3JAMU 1N32F 1R8PA 5KG2A 5A2QU 2BE2A 3ZZPA 2HQIA 3ZC4A 5HBMA 2G0IA 2F1FA 3M2UB 3QWUA 1MNEA 3M4XA 1G2EA 1UAWA 3ETMA 5DG8A 2NXJA 1S7HA 4I6AA 4QR2A 2AHOB 2Y8WA 1CULB 6FDRA 1GMUA 4U96A 2HBQB 3JTPA 4CCHA 1F9HA 3A1YG 2MZRA 3DLBA 2VG6A 2W2NP 2RHQB 1V5IB 4I64A 5EDWA 5L9XA 2CDQA 1N8RT 3QT6A 4USHA 4QW8A 4P10A 3WX4A 3TAPA 2X3GA 1CVJA 1XBWA 4ZPBA 4JV0A 2HHQA 1BQXA 1YITS 2E9ZA 1U8SA 3T19A 2CZ4A 3W2WB 1JLGA 4MFBB 4RNMA 1B99A 3KLFA 3TI0A 1PAEX 1NJIT 1TR0A 1RWMB 3N6NA 3DFEA 4ECTA 2OPSB 2F5GA 1U47A 2QA4G 3C14B 2B3TB 5E3QA 1XTZA 2PC6A 4WFAQ 1SJ1A 1PYTA 1CJTA 2EBEA 1WHXA 4YFUA 3DM2A 1DURA 1YLXA 2LEPA 3GSDA 3VF0B 1F9FA 4LIRA 3VQSA 1GEHA 4DCPB 5K14B 2EVZA 5E3PA 3GIKA 3QJPA 2CPEA 1K44A 3FFIB 1JLEA 3ONQA 4QWBA 4JOUA 1U0HB 4ID5B 1OY8A 3L09A 3UFCX 2Q1LA 1UPPA 1FFGB 1KS2A 1XMBA 4LR7A 3DCAA 1P27B 2KDOA 3IWLA 1R27B 3CMES 1Q79A 2W01A 4IOBA 1SC3B 1HKAA 4UUXA 5KFDA 2HZCA 1S1VA 3E2EA 3KK2B 1TL5A 2K8GA 2MPUA 2O66A 1RT6A 5DQGA 4F2RA 2CQPA 4Q5VA 4LBIA 1MWQA 2V8GA 1S76D 3OXGA 4ELVA 4GRSA 3JSMB 3FSXA 1WF1A 2MY8A 5DLGA 3MZIA 2FLOA 3DLJA 3F41A 1UL3A 3AY0A 5T14A 4DX6A 2QTWA 3J7YI 3VZHA 3TR5A 2R7SA 3H2VE 2ZD1A 3LPYA 1LW2B 1Q5VA 2E5HA 3ZZTA 4M5JA 4QW9A 2RB7A 1WOPA 1RA7A 3BKFA 3KJVB 4DPYA 4ED7A 4NXNF 2XLIA 1B70B 1I5OB 4RW9A 3NLCA 2ZBPA 4DQSA 4E8UA 2H48B 1AUSL 4UQGA 1C0UB 2IRYA 1BY9A 2M8HA 4A8MP 4CM0A 3FC9A 5IM0B 1CJUB 2K3KA 2G1DA 3KXDA 1J5EF 1RT5A 1RQ0A 1U6BA 1RT4A 2QV6A 3FSYA 4CYUB 2HVEA 2YPZA 3CEDA 1S9EB 3L95X 4DV4J 1ZOTA 2MZJA 2MKIA 1SL0A 4ILRA 3CE8A 4O3SA 2E1RA 4WU2A 2JRSA 4LF5F 4I4BA 5IT4A 1FDDA 2H4YB 4OX6A 2ZH7A 2I2YA 2JZ5A 2NREA 2HKEA 3KUGA 3UW1A 5HATA 4X64J 4J9RA 5KOWA 1TV6B 4RW8A 4GKKJ 3EJMA 3QMQA 2P9GA 4OJHA 1NB2A 3K2YA 5I3UA 4KFBB 2OKQA 3MMCA 4ELUA 1RHQB 1QAYA 1T0TV 4WTOB 4LBPA 4DV6J 4P72A 1H6KX 3MEEA 4KTQA 3PIOQ 3KOAA 4NOHA 3TEGA 4ZVSB 2HFVA 2GAHC 1VQ4S 2WVFA 2KTQA 3D1HA 2PN6A 3G87A 3QLHB 4KO0A 2ASYA 5FIIA 4Z2XA 1DLOB 2BOAA 4C8MA 3CD0A 2ROPA 4H4OA 4QCLA 4QWCA 3FQLA 5DG7A 2P9EA 4RW4B 3NMRA 4UUWA 4LF7J 1O6XA 2G0CA 1ROFA 1R0CB 1Q8IA 1U02A 4KQZA 2DGTA 2PA3A 4FKYA 4HH0A 1TUGB 1KQGB 3TNVA 3PJ9A 2CPXA 3X1LB 5KFOA 2XZDB 2QRRA 1WTBA 4XDDA 3IWXA 2FC8A 3IRXB 3CCVS 5F8MA 3TUZC 2BOPA 5DZ6A 1KLMA 5G0RA 1S6UA 2GVDA 1T9TA 3KMSA 1PBAA 1NBEB 2IBOA 1RAAB 5KG7A 2R7WA 2YNFB 2QIFA 2GIRA 3OTDA 1KOHA 4PR6A 2F40A 4K4VA 1RKIA 1L3UA 2YWFA 2RH3A 4CWBA 1WG5A 2QFIA 1QVFR 2AEFA 2B4VA 4LSNB 3MUMP 2K7JA 5EN1A 3IS9A 2JHEA 2MZSA 4GO7X 2QL9B 1NJWA 3LUYA 4FYDA 4B3OA 3T1HJ 1Y5LB 2DY1A 4PG8A 3CCTA 4UOCA 4C11B 2UU9F 4KGKA 5KFHA 3FBEA 4UOGA 3D68A 2DNKA 2K1RB 3IR6B 5BYRA 4N5SA 5AE3A 2DPJA 1TVRB 1UCNA 1U1RA 5G4DA 1VQ8S 4I1TA 3H5YA 4DQQA 2K3IA 1WI8A 3K58A 5L39A 4DLEA 4USJC 4EYHB 1Z1ZA 3N28A 4MIWA 4LSZB 1M90T 2FHJA 3KJNB 1MWYA 4FPRA 1Q0NA 4PG6A 4RW6B 3MPDA 5EX3A 3AJDA 2O01C 3SBMA 4TU8A 4A47A 4DV7F 3TUPA 5ETLA 1RUSA 4DR2F 4CNYA 1ICEB 1NK8A 3K57A 4ICLA 2R3VA 2C2ZB 1U45A 3RU0A 4E2FB 2Y1LB 1KQFB 1MMDA 3IWNC 1DARA 4G1PA 3KK1B 1IBMJ 4BBYA 3HHDA 2MZTA 4AE5A 1LWFB 2MXYA 3DLHA 4PEOA 3W64A 4LFAJ 2D9PA 1E6VB 4NMXA 4YS2A 2KB2A 1JXEA 2PEBA 4KSEB 4X4RA 2J7KA 1S99A 1QY7A 2QL5B 2JWNA 2KO1A 4ZP8A 1N34J 4GKJF 4DV3J 4IH6A 2E9TA 4E98A 2GZOA 5C2CA 2F63A 4KPYA 4ECVA 3ITHB 2DEJA 3DHXA 1V3ZA 2N3OA 5AJ3J 1TFWA 2XI2A 1Q8LA 4L73A 3OTEA 2MQMA 4ZOSA 2HZVA 2W7OA 3DMJB 1RT7B 1KONA 5GADU 1SIZA 4AXIA 1HW8A 3NWGA 3LP2A 1SJQA 3QZ7A 5DGBA 2ZDOA 3NAHA 2E5LJ 5KFSA 1T05A 1NEEA 4OYMA 2XCAA 3IMQJ 2I8EA 4LFBJ 2QG9B 2OAUA 1RU1A 5HVFA 3LWLA 2RILA 3HJVA 2AV5A 2RQKA 1NK4A 2CJQA 1SBRA 2L3MA 1RBAA 4P52A 4DX5A 5HMXA 4DG1A 3LGNA 3JYTA 1R8CA 2OIHA 4JV5J 4DSKA 4QU7A 5CAAA 1SJ3P 1MW7A 4B17A 3AXMA 4WF9Q 2ZH6A 3O2IA 1BXNA 1UW9A 5DM7Q 4DBQA 3EZOA 3OSPA 3N01A 1RADB 4HEA9 4DLGA 3U1LA 2AYMA 2CJKA 4UZBA 2JLGA 4ZDNA 2MGZA 3KMQA 1SUQB 1HNVB 3DHWC 2JSXA 4P74A 2JVOA 3I0RA 3GLJA 3A8IA 1PYSB 5CZVA 4P2XA 3KG0A 3QIPB 4FVMA 3UN3A 2WSFC 3I5BA 1VIXA 4IG0B 5KFUA 5K8MA 4B9VA 1URNA 2YKMA 3NMAA 1T03B 1SH2A 4HACB 2N7YA 3I0SB 2FZGB 5D8HB 4EYIB 2FVQA 2XWXA 1G4CA 3FBFA 5IC4B 1RISA 2RDJA 3LP1B 2CAJA 4IYQA 7AT1B 3DDNA 1TP7A 4HHHA 1NMEB 1RK8A 1CSJA 1PBUA 1NU4A 2FYXA 4F4KA 1UEUA 4AFFA 5HO4A 1DQAA 4NLDA 3HI9A 4WTYA 2QLXA 4M5IA 3PR4A 2W9BA 4OI4A 3V6JA 3SMZA 1RT6B 1T02A 4U67Q 3UDCA 4AQYJ 4QYRA 3LGMA 4FKXA 2YBVA 3R3TA 2ASDA 4Z37A 2J6SA 1GMWD 5DDQC 2NUHA 4WIIA 3O5TB 4X84A 3M2RB 5KFAA 4ZVTB 2VPZB 1TKXB 4PUOA 2D9OA 1U09A 3CJ3A 2KYZA 2GAGC 1HHSA 3HZGA 1H38A 4DUTA 1VHIA 1RU2A 1RWUA 2JJ4D 3GPAA 1FRMA 5A8KA 1N5YB 1B0TA 3M6XA 1HNZJ 1FE0A 3OR1A 1TL1A 3CDUA 6FD1A 4LF8J 3HKWA 2XZTB 1YG0A 3BEGB 3T5KA 4FDFA 3T1HF 4Y2MA 1IKVB 1FRIA 2IJFA 1SKRA 2V9KA 2DH9A 1G7CB 3CC2S 3RBEA 2B5JA 2A1BA 3VGVA 1SJFA 2F8HA 2I1RA 3KJQB 3BPDA 3VCDA 3BR9A 3GV7B 3OPKA 1VQ7S 1R0AB 1IKWA 2W2OP 3J80Y 2C3MA 4DCJB 3MR3A 3IG1A 5CYMA 2M5YA 2ZJRQ 2DGOA 4WZMA 3IO1A 4DWIA 5ETPA 4HHUA 1FJGJ 4JI3F 1R6YA 2A2CA 3PTWA 1VRTA 3D9BA 3GILA 2HRTA 4GO5X 5B0EA 4URQU 5A2QY 4F4WA 2RNEA 1VJQA 3VVUA 4BC7A 4X62J 4CDIA 2RSQA 4UQTA 4RX6A 4OHWA 2Z30B 4TLRA 1VBYA 3M8QA 8RUCA 3ET6A 1S0NA 3EX7B 3H20A 3ICLA 4LFAF 4IDKB 2B4OA 5B0DA 4KO0B 2HBRB 5DRKA 5K8PA 4K4YA 3PHEA 2KI2A 1IKYA 5A0YA 1VISA 1Z4UA 2IC3B 5A8WB 3TA1A 5F9NA 3UNGC 3FZBA 4F67A 2B8PA 4M1KA 4ZPAA 2JLFA 4FBTA 3I31A 1VQLS 2VICA 1MWZA 2I5JA 4ZHRB 4OZ0A 1MMLA 4KHPF 2CQ2A 1S1UA 2JOQA 2OD6A 3MPYA 4F4AA 4JI4F 2JFDA 1VS3A 2RQCA 3W9IA 1RWNB 1WG1A 4KT0C 3A4TA 2RD5C 2L48A 3A12A 1SV5A 4Y34A 4PWDB 3HVAA 2DY9A 4X4OA 1RHMB 3RB6A 4KJIA 1UKUA 1D8YA 3TJ9A 3AB4B 4CO1A 2CYYA 4ZPVR 1S1WB 2KXHA 1M5VC 2DGXA 4WFZA 3IBWA 4Y28C 1U2RA 2DR5A 4LFBF 5J1PA 2DNZA 2KN4A 1RT1A 4F4ZA 1NZAA 3I56S 3RBDA 3SFUA 2FHMA 2VDHA 4NLQA 1AYEA 3CCWA 3N9UC 1I3OB 1OO0B 3VTIA 2KFNA 1HBOB 4DPTA 4OV6A 4IRCA 4M5HA 1XQIA 4DUYJ 2VQEJ 5A8RB 1IM4A 4JV2A 3W2VA 2EWHA 2XWYA 4B3TJ 3JSRA 2IRUA 4J37A 4DS5A 2ZZNA 2HHVA 1HBUA 5J2QA 2OI2A 3UVJA 3NNAA 3G71S 5HMZA 4OYOA 4F3MA 1FO1A 4LF1A 4P75A 3U7JA 2CZ9A 1F5CA 1SI9A 1PILA 4MYUA 2LYVA 1UVIA 1F3FA 2FGCA 2BJ9A 3C6UB 4CQ1A 4H4KA 2HHUA 1DTQB 4CLKA 4USMA 4QIWD 4F04B 4ZMMA 3SQGB 2VG5A 1K8AT 2ZH9A 3CF5Q 2R2SA 4FNHA 5KFXA 2WCXA 1X5OA 3NCPA 3J7AN 2IM3A 1NDKA 2V67A 2RT3A 1NB7A 5C7PA 4U6PA 1S9GB 3PFOA 4HKQA 3OXFA 3VHQA 2HNYA 4IFYB 4ICLB 3GYGA 3GV5B 3LGHA 1T9UA 3L7OA 4DV1F 2EG2A 1FJ7A 1U48A 2MJNA 1EETA 1JX4A 3BYPA 2A2DA 3BV8A 3IN5A 4DCOB 4WU3A 3RR7A 3DOLA 3QT5A 1S7IA 1HNWJ 4KE5A 1FT8A 1HQEB 3GFZA 4JV1A 4LFCF 2OSRA 4OYPA 4JYAF 1VR6A 3R2CJ 4KYZA 1QUPA 3OFFA 4ZLPA 4O3RA 4Q0BA 1FWLA 2LQBA 1WORA 2OLWA 1JJ2R 1SC1B 3BGOP 1PAUB 4V19J 2ZNZA 1KRPA 5K8NA 5L38A 4A48A 3NWRA 4PQUA 4LQ9A 2YKPA 2DGSA 2MZQA 1N5TA 2HLTA 2G1HA 3H7HB 3DRSB 4MIBA 3RAXA 2MQLA 2UXDF 1XMQJ 1F1BB 4A8QA 2ZH4A 1IQZA 2GMHA 1JLQB 5H9EJ 3GCWP 4OIXA 1BHNA 4JI1J 2Z56B 1NH7A 2GA7A 1RT2B 3Q83A 3UR3C 3GTYX 2KHCA 2E5GA 1NO8A 3BM7A 2BXJA 2IAJA 4M5MA 1YJ9S 3JTNA 4N7TA 2XO7A 2FLNA 5LSLA 3DLGA 2NYIA 4F25A 3V6DA 4IRDA 2O5DA 1FJEB 1QVGR 3QPIA 1J5OB 3PACA 5J2MB 1D9FA 4CM2A 3BREA 1REVA 4DL6A 4EUVA 3NKYA 5JMNA 1S6OA 3QIDA 4FZVA 5CYJA 1XK8A 1RAHB 3CCQS 2LCWA 1CQMA 4DR4F 3RB3A 4OHVA 1S0VA 1AXQA 1LWCA 2DK2A 3WC2A 2F8MA 3A3OB 1XC9A 4J9OA 4JI5J 4M5KA 4ZLJA 3BDEA 4UTGA 3AB2B 1K1SA 3RTVA 4ZIWA 3N0VA 5BR8F 1B7FA 3L7PA 2HYIB 5LT5A 1HMVB 2BRLA 2RF2B 3I0RB 1CJVB 5DJBA 5F41A 4J9PA 2AYGA 1MMNA 2CJ9A 3SV4A 3C6TA 5KFJA 2F4VF 2J7UA 3QNWB 3ELHA 4J5OA 2IDLA 3TJAA 3MCNA 2RHSB 4RLEA 2V4RA 3G6ES 1U26A 5H9FK 2WOMA 1T9WA 3KUEA 2LQ5A 1X5SA 2YKMB 3OFGA 3L7UA 1H3DA 3MEDB 3P5TL 3W61A 5HMWA 3M8ZA 2AEJA 3A8KA 3HKZD 3SCKE 1OPZA 4H54A 2EPIA 2DNLA 4ZPTR 4IOAQ 3V5RA 1YJRA 5RUBA 3LOUA 1RHJB 3MMAA 1C0TA 3PW4A 1YBAA 1TZ0A 4C6AA 5B0FA 4U7UK 3OUYA 1AZSB 1Q16B 1UVMA 2UXCF 3CJKB 1Q5YA 1TK0A 4LRDA 2XCPA 3MI7X 3ISNC 3S1TA 4X4NA 3EVOA 4WFBQ 2OPQB 1YIJS 1H72C 1WC1A 3KLIB 3QRPA 4CH0S 4NMLA 4W90B 2R7QA 1M1KT 3Q8SB 4ZLNA 2KFYA 4LR9A 3PKYA 4LR8A 4R25A 4OI2A 1VC0A 4DL0C 3PG9A 3QO9A 1MROA 3AAWB 3UO0A 4F8RA 1ZZNA 2DVIA 1WEZA 3NY0A 3LAKA 2OMLA 1W25A 4NEZA 1WNEA 4K50A 4LF9J 1LK7A 4F3OA 3D3CJ 4LRFA 4MTPA 2E66A 3K7RA 3BGRA 1CC7A 4WCEQ 1LXJA 1S12A 2VB6A 4CNZA 3EVMA 2H5EA 2UP1A 2ZITA 4HDGA 5HROB 2YWEA 1RTJB 3G82B 5CD4A 2WVEA 3AOBA 3H40A 2KM8B 1OSDA 2BANB 3Q8RB 1JLAB 3G4SS 5LOQA 2MSTA 1VLOA 2CNKB 2B5JB 4TLQA 4JBCA 1FKPB 3OR2A 2EC0A 2AGQA 2CNLB 2WW8A 1HNIB 2CJYB 1Q8KA 5E3RA 2HEKA 4WBFA 4H4KC 4YUDA 3M6UA 2XSJB 3OTOF 1Y0HA 1RTHB 2JEJA 3DRRB 2MKYA 2W9CA 5KFRA 1S0OA 2JEFA 1FRXA 1VC5A 2O3DA 3CDEA 3QJJA 1WOSA 2J6UA 3PFEA 3HM9A 3T3FA 1C4CA 2BQRA 2JH3A 4FVCA 3SCIE 1S4FA 4QOTA 1UVJA 1L3TA 3J81U 4H4MA 3UWTA 5M2UA 2ZUGA 1FWPA 2C28A 3KK3A 3M6VA 3M9MB 4PWUA 3CULA 4QIVA 2UXBF 5C24B 2LQ9A 3M8QB 5ETQA 3P45B 2R8IA 4DEZA 1GH8A 1TKZB 4DR6J 4X4PA 1R89A 1HBMA 1AFJA 5DQHA 1WC4A 3VWSA 2VASA 2Z4PA 1RWOB 2Z2ZA 2V68A 2C2RA 4IQMA 2C2NA 4HTJA 3MXHP 1T11A 5KFCA 2ZBCA 2XS7A 3NP5A 3TO8A 3FVYA 1EAYC 1XNRF 4ED2A 2XSFA 1IXKA 4B9LA 4ED1A 1S1UB 5EWEA 1WHVA 2G2YA 2VL1A 4O4RA 1YTYA 1SPBP 3H98A 2OEKA 1F5BA 2DRAA 4LF4F 3QGGA 4FF2A 1RTIB 3VAFA 4O3QA 4Q8FA 4JI0J 4OZ5A 3TYTA 2DISA 2JFKA 2ZKUA 2M9KA 3ENAA 1PJ5A 3OHBA 2FY1A 2LA6A 1HBNA 5H1SV 1ZAWA 3DI6A 3N79A 4C8KA 3DOMB 1FD2A 4RBUA 3NGSA 1KR4A 4PPDA 4RW7B 1G1XA 1OPIA 3SQOP 1PYOB 4OZ3A 3O6QA 4TY9A 2QJ3A 1O51A 1V6HA 1X4CA 4IO9Q 3I5AA 3GB0A 3W65A 2HHWA 2QYCA 3CVKA 3IGVA 1OJ4A 2VKZG 3PW2A 2WSEC 4CTAB 1KN6A 2DIUA 2C42A 2UUCF 2ZH1A 3I4HX 2MKSA 1VI7A 2RKIA 4LRBA 1CS4B 2ZHAA 1HPZB 5LJ3Y 2J7WA 1TL3B 4DZ6A 3ZZ0A 1LW0A 2VC0A 1NK7A 1SKUB 2BV3A 3POTB 2RQMA 5CXTA 5CYQB 2GHPA 1D9AA 3PRVA 2Y1JA 1KNZA 5LXYA 4NLVA 3KLHA 4K4UA 3SYZA 1GMWA 2DNPA 2QMUB 2IM0A 3QATA 5E33A 2FD2A 4DQIA 1UWAA 2WZ1A 5GMEA 5KFWA 2DR8A 3IBFB 1N88A 3M2UA 3GE9A 2BE9B 3T5HA 2MQ8A 2ZBRA 2XTJP 5K5MA 1ZM4A 2HFOA 2Z57B 5A76A 2MY7A 1WHWA 3C66A 1EP4B 2HGNA 3T1AA 1TUVA 3B4DA 4KC5A 1WTFA 3H42A 4ATNA 1CULA 3P49B 1HQUB 3E8OA 2V6AA 1ZPWX 2WB4A 4ZKAA 1NKEA 1KC8T 3TAMB 4ILLA 4DR1J 2B9XA 4MKYA 2COLA 4DS4A 2HNDB 3TWZA 2Q43A 4YB5A 1SB6A 5EUHA 3TVYA 3W2WA 1KSPA 4N47A 1GFWB 2CNOB 5K20B 4MFBA 5KFFA 4TYAA 1EJ7L 5EWGA 3AODA 1YJUA 3QGPA 4RO0A 4DV0F 2B8QA 2AJ1A 2O67A 2OPSA 5D4PA 3C14A 4PQAA 4O3PA 3P6YC 1IR1A 4JI2J 3NOGA 3LQVA 3THTA 1FX2A 1HHTP 3T5JA 2FVRA 2BM1A 4CLSA 2N7CA 1QE1B 4WE1B 1AA1B 3QQCD 2L08A 4PQUB 3A3NB 5IT0A 2IBKA 2XMJA 1TKTB 1RE1B 1X4BA 4XO0A 2HQFA 2LVWA 5HSPA 4JI8F 3CD6S 5K14A 2FVPA 4NLTA 2YWWA 3FFIA 4FS2A 5F3TA 2DCLA 1NDPA 1U0HA 2KT2A 4ID5A 3UR0A 3QRQA 1A9NB 2W2PP 3N6MA 4YY3F 2JDJA 1UVKA 3NS7B 4WYWA 4OI3A 3OJSA 2C3YA 2E7VA 4EMDA 3V4MA 2LXFA 4K4XA 4NYZA 3BH6B 4S0MA 3KK2A 3UN2A 2IIHA 1D0EA 2YH1A 2CG4A 3D0IE 4GVBB 4DL4A 4M94A 1QJHA 2Y1IA 1ULRA 1HWIA 1D8ZA 5D6GA 2BJ8A 4R0JA 2B56A 3DXBA 3JSMA 4LF6F 2XBPA 3TP2A 3DU5A 1KTVA 5J2PB 1ZETA 3EMTA 2DNQA 3UD4P 2ZH8A 2F65A 5GAGU 1CG2A 1LW2A 1SIWB 2DTJA 2G13A 2RRAA 4O44B 3GIIA 3TQ1A 4MMOA 1X0PA 3Q8PB 1NM2A 3KJVA 4ED0A 3MOJB 1HARA 1AT1B 1Q7LB 5JVGQ 4MT1A 4L3KA 4FXDA 4PKDB 3RW6A 3EGWB 2WBMA 4I7FB 2XLKA 3I9V9 2CVEA 1H7XA 4YHHJ 2XY5A 1C0UA 3CDBA 5E3CA 3THVA 4KKOB 2XY6A 1CJUA 2DT9A 4WIQA 2IA6A 2FTRA 3GV8B 3HX9A 2VOPA 2WOMB 2YTCA 4CYUA 1S9EA 5C42B 4HL9A 4RNHA 1RBOB 3BS9A 4ANEA 1FFSB 1WEXA 2MEWA 4TXSA 1J27A 1TK8A 3M9NB 4WJBA 1WC0A 1WHYA 4PG5A 2WAQD 5MAOA 2FJXA 4N8NA 4NLRA 1F6TA 4CO0A 2R9LA 4CLFA 3CJRA 3FSIA 1TV6A 5EX0A 1IBKJ 2H5IB 3KLEA 1YJTA 2IJNA 3MPUB 4DSJA 4KFBA 2NYHA 1U7LA 2J8AA 3M32B 3P96A 5HAOA 4J91A 3W60A 4X4TA 4BLGA 2JNJA 3NOCA 5KG1A 2AF6A 2G2ZA 2LEBA 3IFEA 3CC4S 2HHTA 2XGQA 4PYAA 3OQ2A 1TELA 4ZJQA 1DQ8A 1KQKA 3QLHA 2PSZA 5IV4A 3W1YC 1DLOA 4JI6F 2MHNA 4YOEA 3R8YA 2GFFA 2KHDA 2BKPA 3CCLS 2UUAF 2DXEA 2QO3A 3K0JA 1IJFB 4WXOA 1FF2A 2MSSA 1RWPB 4LQ3A 4OQJA 5L1JA 3M8WA 4C4WA 2A0FB 3G8QA 2JC1A 4RW4A 1MN9A 4BWMA 1ZH5A 5JUMA 2FJVA 2OTJS 1FEHA 4L72B 4O4GA 1HA1A 4X65F 3D6MB 5DM6Q 4USUA 1VQ6S 4KV8B 4F4YA 4OZNA 4DR5J 3OTCA 1MLAA 2HHHJ 2FLPA 4UZCA 1UA1A 3CNQP 1CJKB 3IRXA 3R5AA 2HRYA 1C4AA 3DOKA 3PYGA 2VFSA 4DR3J 3CJTA 4EZ6A 3TW0A 2IVYA 3DN9A 1XMOF 2YNFA 2NXUA 1KVJA 4IO1A 2BDPA 3OL8A 1JXVA 5IS2A 3Q86A 2D69A 2JC0A 3BSAA 1CPZA 1YBUA 4K4TA 4RJVA 5GAEU 3I96A 4EBCA 1GX5A 2FVSA 4J7CA 1BMQB 4LSNA 3BKTA 4DR1F 1M5HA 3W63A 1H2TZ 1PIEA 4ZVEA 4ZVHA 1FVQA 4HT7A 3GFXA 2QE5A 1T3NA 3ZTSA 1LV5A 2VQFJ 2PE8A 5DGAA 4EFAC 1WI6A 2R7OA 3ADAC 4IKAA 4ZVGA 1UJ5A 2YNIB 4C11A 3AJ2A 5HI7A 2XI3A 3BO4A 4X66J 5BYSA 4B9MA 2HVZA 3M8RA 1TVRA 5A6WA 1ZZFA 3MDFA 4B9UA 5FLXY 2WW4A 2BQ3A 2IYGA 3HSZA 5E3AA 2B0GA 1JIHA 4I0WA 1D09B 2VIHA 2YPYA 3NGDA 4RW6A 2V8DA 3N6LA 1HYSB 3NNCA 4YN3B 2BVZA 4DMZA 1YJNS 3CWJA 2FJBB 2EEYA 5GAHI 3CJ8A 4WKRA 3VQTA 2DCUB 2XGPA 2RJZA 3IAS9 2V2VA 1Q1KA 4HR2A 3Q24A 2GX8A 5J1NA 1X5PA 3MR5A 3G2XA 4RBTA 2E1CA 2DXFA 2C3OA 3KLVA 2HQDA 3F73A 4OYWA 3KK1A 1JXLA 1LWFA 2VV5A 4B3SJ 3F44A 1PO6A 3TZXA 2Q3PA 4ZVUB 2AT1B 1E6VA 2OFGX 4U95A 1SKWA 3V6HA 1EZZB 2DGVA 3BO3A 1OS5A 2FY8A 2QX0A 1JLFB 1GXUA 3JSBA 2V50A 2MLYA 4DV5J 3ITHA 4YDDB 1RTDB 5C25B 3PX0A 4R5PB 2IPOB 2N4CA 4IQXA 2XMKA 4LUBA 1S97A 3DMJA 3LALA 2KT3A 3MMJA 1RT7A 5F8NA 2HSEB 5DG9A 3ZNJ1 1A7GE 3D7SB 3K17A 4J9KA 3CDAA 2W8LA 3SDEA 2DRDA 3TUIC 4F0KA 4YHHF 4TU9A 2VA3A 4ETZA 2AGPA 2ILYA 1QAXA 2LECA 2ZNYA 2HHSA 4TQSA 1NPRA 3MM6B 4PABA 1IUJA 2EFPA 3AQOA 5IC6B 1K47A 1EX8A 4M5NA 1OQ6A 2QC3A 2RRBA 2IMWP 3BBBA 1VLYA 3MR7A 1I94J 4OYAA 2IY5B 4OJ1A 3M8YA 3AD9C 4J9UE 1N33J 4TKTA 4B08A 3V81B 1U1KA 3FCHA 1M5OC 1YZ7A 3OVSA 1UZHA 3J7YU 2CIMA 3KFWX 2UVVA 3UN5A 4C0OC 1RLCL 4FF3A 5J2NB 4B3RJ 4NXMF 2H9ZA 1VK8A 4I2PB 4G1QB 4U9RA 1LFWA 2CG8A 1SUQA 1HNVA 3A13A 4EU0A 3MAAB 4O3OA 1FKAF 3HLUA 5GMKa 5D3GB 1BUXA 2RVJA 1G3OA 2MQOA 3NNHA 4WFXA
chains in the Genus database with same CATH topology
1S79A 4G6VB 3I56S 3SFUA 2X1AA 3S8SA 3RBDA 4BS2A 2FHMA 4JI7F 1VRUA 4NLQA 2ZHOA 3CCWA 3N9UC 3TRGA 5B7WA 2FVRA 1S72S 3QIPA 4HT5A 1OO0B 1VFJA 2ZE2B 4M5DB 1NHVA 4NLXA 2MQNA 2PGCA 3VTIA 2KFNA 1HBOB 1DBDA 4IRCA 3LANA 1LFPA 3BQ2A 4Y2KA 5M2RA 4IG0A 3SSQA 5A8RB 4LMZA 1IM4A 3MOZA 1P8GA 1FJCA 2L41A 2GQQA 3JB9k 4JV2A 3W2VA 2EWHA 3HHKA 3FQKA 3TVKA 2XWYA 2LXIA 3RW7A 4ERDA 3JSRA 2IRUA 4J37A 4DS5A 1T03A 4HLBA 4YQWA 2ZZNA 1Y5IB 5D78A 1U4BA 3I0SA 1X9SA 3MMAB 1Q86T 2NPFA 2HHVA 4OLPA 5HP1B 1HBUA 4DV2F 3G8TA 1C0TB 2MKHA 1IBLF 2GNKA 1YGYA 4ES2A 5J2QA 3W7BA 2BE2B 3OUYB 2CJAA 1S6QA 5BYQA 3OV7A 2B7BB 3NNAA 5HBMB 3G71S 3LP1A 5HMZA 3PX6A 4F3MA 4DSEA 3AH6A 1NK9A 1FO1A 2BJEA 5KG3A 4UY8T 3J81Y 3U7JA 1RP5A 3OVAA 1F5CA 1WG4A 4NCGB 1BC6A 2MZ1A 3R5CA 3ZZZA 1SI9A 1PILA 3GG1A 1RDRA 4MYUA 2LYVA 1JWWA 1UVIA 2FGCA 3LP0A 2AYBA 4ZPWR 2UV8G 2HW3A 2CPYA 1S6PB 2CQIA 2V0NA 3MM9A 2QA1A 2FGOA 3C6UB 4ALZA 3M8SA 3I6PA 4CQ1A 4H4KA 2HHUA 5T41A 1DTQB 4P7VA 4QIWD 2YNHA 4ZMMA 4AXJA 1HNWF 2ADCA 4OX9F 3SQGB 2VG5A 4DR5F 5HQ8A 1K8AT 5E2QA 2ZH9A 2KFZA 3BN7A 5AE2A 2KRRA 2HAIA 2QMXA 2R2SA 3CF5Q 3V6KA 4FNHA 5F8GA 5KFXA 3QO9B 2YNIA 1MROB 2VG6B 3MM5A 2WCXA 1X5OA 4NYPA 5KFPA 4Y2IA 3NCPA 4K5RA 4ZCIA 2KH9A 2UUTA 1KQSR 1T7PA 1M0SA 5F0UA 2U2FA 2IM3A 3KKFA 4QZVB 3D1QA 1L3SA 2B43A 1RYSA 4AL5A 1SL1A 2EFQA 1QUVA 1VQSA 3S6EA 1IQTA 2RT3A 5GAGI 1NB7A 4LVOP 1X9MA 3H59A 4MYTA 4U6PA 1VQMS 1N6QB 1S9GB 1XERA 2PIIA 3PFOA 5LJ5Y 4HKQA 3SV3A 3OXFA 1KOOA 1ZM9A 2HNYA 4USIA 4IFYB 2UZAA 4ICLB 3BGRB 3HXMA 3M2RA 3ISZA 1XEZA 3MGJA 4MKAA 3GV5B 2XLJA 3T1YF 5KFZA 3IR5B 2J9DA 3I4PA 3H4DA 3CJ5A 1TKXA 1JLGB 4C3KA 1XNQF 2RU3A 3L7OA 5B0GA 4EO8A 5K8OA 5KG5A 2VPYB 3BSNA 1U1OA 1WELA 4DR7F 4A8OA 4DV1F 1HR0F 3KLFB 2EG2A 1N4LA 1HYSA 3E3XA 3WBZA 1FJ7A 2IVMA 1U48A 1DJ0A 2MJNA 4GMKA 3DLKB 1EETA 4N8OA 3G8SA 4G3IA 3M05A 1JX4A 2GW8A 3EGNA 1M5KC 1ZTTA 4LVNP 3PIPQ 1KHVA 4CO3A 3BN4A 4ES1A 1NKBA 2A2DA 2ZZMA 1VMBA 4X4VA 1MU2A 3MD1A 4M63A 1X4GA 3IN5A 2HRUA 2ZH3A 3SSSA 4ETXA 3FNNA 2JL9A 5FDLB 3R1LA 1KFSA 4PXDA 1IR0A 2D3ZA 4WU3A 3DOLA 3RR7A 3FEZA 4TU7A 3KLGA 2B4PA 1RT1A 1HL6A 3KHGA 4K4ZA 3NS6A 4KE5A 1FT8A 1N5YA 4RWWA 3EZUA 2OTLS 2VD3A 3MR2A 3EPIA 1HQEB 1XMQF 2KYXA 4WYLA 3GFZA 4JV1A 4LFCF 1KHWA 2Q6BA 3AQPA 2OSRA 3UPFA 4A8XA 5KFQA 1FERA 1VJWA 2HIQA 4JYAF 2VKRA 2FPHX 2GJ2A 4HHJA 4A8YA 1IKVA 3OR2B 5E5NA 2BABA 1F5AA 2IHR1 4NLWA 1QUPA 3DM2B 3OFFA 5BJRA 4ZLPA 4O3RA 5A6PA 4Q0BA 1UP1A 4KHRA 4JI1F 2NLWA 2QMWA 2DNOA 3O8WA 3CGIA 4ECZA 2LQBA 4DUZF 2ZOMA 2W24A 4OJ3A 2VZ9A 2OLWA 1JJ2R 1X4DA 1N56A 4C8LA 2A10A 4EZ9A 4YR2A 4KB7A 5GVQA 2ZNZA 1KRPA 4V19J 3K5OA 2W9CB 5K8NA 2Y0SD 2ZH5A 2B9YA 1JKHA 1WF0A 4YDXA 2GGPA 4RUHA 5L38A 4A48A 5GADI 1R0AA 3H5XA 4PQUA 4J9QA 4QJVA 3BF4A 2CQBA 1D1UA 1JLEB 5I3PA 1OWXA 4IG3B 4LQ9A 2YKPA 2DGSA 4KR0B 4N77A 4NRTA 1N36F 2ZC3A 2MZQA 4Q7AA 1N5TA 3U1NA 2QA4S 1JLFA 5DDPC 2HLTA 3GMGA 4OHXA 7FD1A 2Q79A 2EG1A 1HD0A 3O1LA 3UQSA 2EFNA 3DRSB 2LDYA 1S0MA 3V2UC 5B08A 2KKHA 4MIBA 1YVFA 3RAXA 1RTDA 5C25A 2MQLA 4R5PA 4NX9A 3HHEA 1FXRA 3BR8A 2UXDF 4EBEA 4I6YA 4H4MB 1U1QA 3PM9A 2ALZA 2QZ8A 1UEVA 3KLEB 4CO2A 4A8QA 5KT2A 2ZH4A 1IQZA 4RNNA 1S49A 2XHWA 3AJ1A 4C0BA 3NGKA 1FRLA 3KK3B 1S1VB 1LXNA 4B9TA 2CQ1A 3D28A 2GMHA 3TARA 1JLQB 3K5NA 3T6JA 5H9EJ 1FA0A 3HK2A 4DF8A 1QAJA 3MECA 2E44A 5IWAF 2AX0A 3BGLA 5CCLA 4OIXA 3I5CA 4TNOA 1I1GA 1JJ4A 2CPDA 1JLBA 5KG0A 3HVTB 1NH7A 2J0XA 1VC6A 2GA7A 1JNRB 3T9ZA 3MM7B 4TY8A 4I68A 4D3HA 4JI5F 1RT2B 1GNKA 3UR3C 3M2VA 2KHCA 3PR5B 2E5GA 1DTTB 1NO8A 1HBMB 3BM7A 1N54B 2K1RA 2BXJA 2WBRA 2W4DA 1FDNA 1X5TA 1Q4RA 5M2PA 2UUBF 1DQ9A 1FEEA 3M30B 4ZS6A 2HWTA 2IAJA 4C98A 2ZM6F 1YJ9S 3JTNA 2XO7A 2FLNA 1R8BA 3Q22A 2VOOA 5LSLA 2GO8A 3DLGA 2NYIA 4IR1A 4FF1A 3MCSA 4F25A 3MEGB 4IDKA 2W7PA 2WONB 3DLLQ 3V6DA 2PDAA 5KT7A 4DL2A 2M88A 2LXUA 4IRDA 2FJAB 2O5DA 1RYRA 3H5SA 1FJEB 1QVGR 1U6FA 2LA4A 3KNGA 1BLUA 2EKYA 3QPIA 5L1KA 1J5OB 2UVRA 2RDIA 1TK5A 2Z2MA 4MH8A 1Z2ZA 2W25A 3PACA 2IM1A 1BQNA 3DC2A 2AW0A 4PCQA 2IC3A 5J2MB 3MURP 5CHCB 2B4UA 5LMNF 1T8EA 1KFDA 1D9FA 5A8WA 3BREA 1REVA 3NAIA 1UMJA 4DL6A 2Q66A 5F9LA 5MLCV 2L9WA 2ZD1B 1TQLA 4XPCA 4EUVA 1NJYA 3B82A 4C3MA 4C8ZA 3CCSS 3MM6A 1QM9A 3BB5A 3NKYA 2JVRA 4F4XA 4L6V3 1V3RA 4IR9A 5DDRC 3MAQA 3SZ2A 1K73T 1B64A 1S6OA 3CMAS 3QIDA 2CQGA 3FGVA 4FZVA 3G6VA 1PC4A 2LMIA 4FP9A 2M3DA 5CYJA 1K0TA 4ZHRA 1XK8A 2XB2D 5LMUF 1VQ5S 3CCQS 4O4GB 2LCWA 4QR0A 1H7WA 1CC8A 1CQMA 4DR4F 1S48A 3RB3A 4OHVA 4O23A 1S0VA 1AXQA 2DGUA 4ES3A 1LWCA 1WF2A 4B3MF 1VIOA 2DK2A 1HBNB 4RW9B 3WC2A 3BGFA 3D0GE 2F8MA 3DI6B 1WACA 3V81A 2PD1A 1Q8BA 2PMHA 4XK8C 4HTIA 4RZRA 4XIUA 2VFVA 2UUWA 1XC9A 4J9OA 1P6TA 2GV1A 3BDEA 3BSCA 4OHYA 4HVZA 3AB2B 1YHQS 1K1SA 3MEKA 4FNIA 1VBXA 1M5PC 2J6TA 2CKWA 3BDPA 1HW9A 3RTVA 1IJEB