2EC2A

Crystal structure of transposase from sulfolobus tokodaii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
MEYKSTRHAKYLCNYHFVWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFQELKKSTNGKLWTRSYFVSTSGNVSSETIKKYIEEQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords 136aa long hypothetical transposase
publication title Crystal structure of transposase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
total genus 31
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2ec2A00
2FYXA 2EC2A 2VJVA 2XQCA 4ER8A 2VHGA 2F4FA 2XO6A 2F5GA 2VICA 2VIHA 2XM3A 2VJUA 2A6OA 2XMAA 2A6MA
chains in the Genus database with same CATH superfamily
2A3JA 4QIEA 5GMDA 4AXJA 3Q8QB 2KG1A 3EICA 2D7SA 3ZO7A 3D1HA 1U1NA 3I4HX 4NYPA 4ZP7A 1LWFB 4Y6IA 5C25A 4G3IA 4U8YA 2IMOA 2J7WA 3E51A 2HQCA 2ZVSA 1FFGB 3KMQA 3B8HA 3M6WA 3J7AN 3DOMB 3ZC4A 5BR8F 2MB0B 4JBCA 1S76D 3T5HA 4Q44A 1GTEA 1S5ZA 4CYUB 3OLAA 4DV1J 2NLWA 3I5CA 2VL1A 4ILMA 5J2MA 4B08A 2BRKA 3WIUA 4YOEA 4IUFA 5KFFA 2CVEA 2IDLA 2ZD1A 3OTEA 2VC1A 1MWZA 3MM5B 1NSAA 2LXUA 2FVQA 2LVWA 3I9ZA 4X84A 3FSYA 4OHZA 5FDLB 3OVBA 2ACMA 2VJVA 4K50A 1FK9B 1NDPA 2BR0A 3C16A 3LPEA 4OYMA 2K06A 2E44A 5CYMB 5IT0A 2C3YA 4HHHA 3O5TB 1T9TA 1YJ7A 2R2SA 5CZXA 5E33A 2CQDA 1U1MA 2BE7D 1YIJS 2DR5A 3PV8A 8ATCB 3MTKA 1V3SA 2GQCA 2MQPA 3O44A 4NA3A 5KT3A 5KFQA 3LP0B 2DJWA 2V8GA 1SVDA 2BA9A 2FJWA 4DEZA 3OFEA 4Y2AA 5E3CA 4UZCA 1H38A 1Y3KA 2KT2A 4X65J 1YSJA 1ZZNA 4F36A 4M5MA 1M5PC 1FD2A 1PJ6A 3NGUA 3HM9A 1FRIA 4U7UD 3G86A 4LF7J 2AJ4A 4K5RA 5D6GA 4LF1A 2V9KA 3D9BA 1K8AT 4PR6A 4K2XA 3BR8A 3VQTA 1IJEB 3NXZA 1IM4A 1GAOA 3NOCA 4DR4F 3AXKA 2M88A 4PYAA 2AGOA 2B4VA 1PJ5A 1QE1A 2J9CA 4CO5A 3LA0A 2DRDA 4WPAA 2F63A 3BSNA 3MMCA 2MKHA 3QRPA 1MWQA 3UN3A 5IXUA 2Z57B 3W2WA 2OJ3A 2DGSA 2Q6CA 4UTGA 4FXDA 3P5TL 5D4NA 3ET6A 2KVIA 5J1EA 1C4AA 3C66A 4IDKA 3EWGA 2KJWA 3RGIA 4GO7X 4MJKA 4DZDA 4LIWA 2A1BA 4ED5A 4QU6A 4PRFA 3CCTA 2QMXA 5L1LA 2J6TA 3MM7A 2XNRA 2W7AA 4X2BA 1TK0A 1GMVA 1FWLA 1PBAA 2QLWA 5AE2A 3E3XA 2JWNA 5LSRA 2OIHA 5CZVA 2N82B 4RX6A 1RT4B 1R8AA 1G6BA 2F40A 4KV8A 4FYYB 1FRKA 1FRHA 2MKKA 2LEPA 4KHMA 1CJUA 5B0DA 5AJ3J 1KD1T 4ZVHA 5JVHQ 2R8HA 4KPCA 4URSA 1F5AA 2P5VA 5J1NA 3T5JA 5DZ6A 1EETB 4DS5A 4B3TF 2JSXA 2QYGA 5DETA 2VC0A 2CJBA 1DJ0A 1J5EF 4DSLA 2J76E 5ETNA 1FNOA 2XS2A 4NLRA 1TU0B 5K8OA 5EWEA 1S7HA 3TR5A 4QOTA 3TAMA 4NYOA 1NCLA 3GG1A 2UVVA 3DMJB 2MSSA 1S57A 2AJ0A 2DNRA 4P10A 4EBDA 3SCJE 1VQMS 3C15B 4X4RA 2KT5A 1VQLS 1UA1A 1OY6A 3BO4A 4O3NA 2ZNZA 1SJ4P 1TFWA 3MFHA 4GC7A 3KK3A 3TAQA 4UOHA 2OPSA 2E5JA 2IVFB 1U6FA 2WOMB 5DDQC 2E1RA 3NNHA 2FY1A 1KLMA 3WHIA 3BGRA 4ED2A 2RVJA 3M7VA 2HFNA 2XCAA 2CPXA 1WTFA 4DL2A 4USTA 1Q1KA 2CNKB 4C8MA 1GX6A 5A8WB 4EEYA 2KVQE 1X4AA 1U7LA 1WD6A 2ZOFA 1SKWA 2F7VA 2ZWPA 3NGTA 4LF4J 3CW2C 1SV5B 3GV7B 1HL6A 1WWHA 3MTJA 2WB4A 4GKKF 3TJAA 1RI7A 1T9YA 4JI5F 5CAAA 4HI2A 2XBPA 1B4SA 4EZ6A 4I1TA 1MG7A 3V4IB 2KHDA 4L3KA 2WAQD 4LSNA 1N5SA 3FBCA 1QSLA 2OSRA 1SQGA 7AT1B 3TP2A 4OHXA 3PJXA 5M2UA 2QLXA 4FNHA 4QIFA 4TN2A 3BQ0A 2GX8A 3ILOA 3M8QA 4AL5A 1V3RA 3J7Z5 5LXYA 3GFXA 4PUOA 4ID8A 1UWBB 2EFNA 4A8SA 3AY0A 4LT6A 5EWGA 2MLZA 3MM8A 1OY8A 2YWFA 2XYGB 3RW6A 4JI7J 3PCOB 4EBCA 2KXFA 3THVA 4C7QA 3W63A 3QT8A 2KL8A 2UV8A 2N3LA 5BYQA 3BB5A 1D8ZA 4L73A 3D3BJ 5EX3A 1EHWA 3PNIA 4EI2A 3B4DA 2B3TB 1RTDB 1KVIA 4XO0A 2ZZNA 4ZPBA 1RT3B 4RW8B 3RAQA 3OSNA 4I68A 4O44A 4JYAF 2OSQA 5EGYA 5KG5A 4OIXA 4PWWA 3GV5B 4DPOA 1S12A 3K89A 1VQOS 3AJ1A 3U02A 2M2BA 4FKXA 5DG9A 2B7BB 3E8OA 2R8GA 1HNIB 2WVFA 3AT1B 3KNGA 5SUHA 4KFBA 1KR4A 3HJFA 3K57A 2LU2A 5U47A 1FESA 3DU5A 3LP1B 1B64A 3O2IA 4QYZK 1JLGA 3OQ2A 2GVZB 4W4MA 1VJQA 3DM2B 1VRUA 2Y9HA 3HDSA 4QW8A 4NX9A 4TY8B 1ROFA 3UNGC 1RT1B 2E66A 3OHBA 5ETMA 1GQEA 2M52A 3J7YU 2VU5A 2MKYA 3ENQA 1F9FA 3TA2A 3ELHA 4OX8A 3NNCA 3MPYA 4C0BA 5KFWA 4GC6A 1MMNA 2L48A 2XSJB 2MQOA 3CJ2A 4C9DA 3IGVA 1SJFA 2B9WA 2AW0A 3ZZUA 3RAXA 3T9ZA 1L3VA 1H3DA 3UI3A 4M5LA 2YKNA 3MZIA 2QTWA 2F3JA 2EK1A 3OTBA 5IT9Y 3Q89A 2KU7A 1FRLA 4TXSA 3QQCD 1SJ3P 3Q8SB 3OT9A 4DLGA 3MPDA 1JKHB 2EFGA 3AODA 1CSJA 4WIQA 4ECQA 1TUWA 4LR8A 2LDYA 4H4OB 3S01A 4DPYA 4BDPA 1N32J 2F5GA 4RUCA 4X62J 4R0EA 5D15A 2CJYB 3IS9B 2XGQA 2VBYA 3UD3P 2VFTA 1IBLJ 4OYPA 1UVNA 1FE0A 4DV0F 2UXDF 1RJJA 3RTVA 3MR5A 4DF8A 4M5NA 4LRDA 8RUCA 3N9UC 5A0YA 2ZBIA 1KC8T 3BPSP 4IFYB 4QWEA 2GO9A 2QYCA 2NR0A 1WOPA 5T41A 2WBMA 3N0VA 4WWSA 1LWFA 4Q2MA 3IRXB 3H5SA 3HPOA 3GCWP 4ZJLA 3DOMA 4LMZA 1CC8A 1H0HB 1WHWA 4LF9J 5C42B 1TVRB 1RLCL 1ZTTA 4KSEB 1SJ1A 2QL5B 4CYUA 1T9VA 3KLHA 2OMLA 4OMFG 4DV2J 2R2TA 5JUMA 2HS0A 3NOGA 3UW1A 2LP4A 1HBMA 5HQ8A 1U2RA 4ZPVR 1B99A 1KQSR 1GT8A 3MM5A 3MMAA 4U95A 1VJWA 2RUSA 4NASA 3THPA 2CWKA 3PVXA 4M5IA 5FDLA 2ZHOA 3PW2A 2AEJA 2HHUA 3HXMA 2AYEA 2UVUA 4EFAC 4DU8A 4NEYA 2JH3A 4AE5A 2MEWA 2ZBRA 4BBYA 3J81U 5CYMA 2OEMA 4I7FB 1BQXA 1WDDA 2MQNA 1KEKA 4Q0BB 1HI0P 1B0PA 3BJYA 2CG8A 5LT5A 1O8BA 1FTCA 4P2FA 4YS2A 3BS9A 3T19A 5THWA 4USVA 3DGPA 2B9XA 2GGPA 1BXNA 1MNEA 2WBRA 4CLUA 4QCLA 2XYPB 2VKZG 1XEZA 3RYLA 2VQFF 1EAYC 1SC4B 1NJWA 2RKIA 3JXOA 1N5QA 1GXUA 5L1JA 4OI1A 1ZPWX 2GS8A 3A8KA 4JI2J 2MSTA 1RBAA 2FZGB 3T1AA 2BKNA 1JJHA 3MMJA 3TQ1A 4OI4A 3H5XA 4F4AA 4LFCF 2QRRA 1HNXJ 3BGUA 1K0VA 2HVHA 3W62A 2ZC4A 5IV4A 4ZVOB 3DLGB 2W8KA 1KKHA 3T6JA 4CO4A 4DSFA 5IC6B 3CJKB 5KFOA 4EYHB 4DSEA 2XSFA 4ZKAA 2R8KA 3I0SA 2AT1B 3NGRA 1YG0A 4OJ1A 3MGJA 3IBWA 3CDEA 1B0VA 2MZ1A 4QWBA 1AZSA 3K8WA 4JOUA 3RJMB 5FD1A 1Y11A 4FYXB 4NXNF 3KTQA 4K4SA 3CJRA 1Q86T 1XNRJ 1GNKA 4DL0C 3H20A 1CJKA 3GJQB 3SV3A 2VA3A 4UUWA 5J2PB 4NL5A 1P6TA 1XNQF 4ENOA 1V5VA 2PT0A 2FIUA 5AE3A 4O0IA 3MF5A 2Y1IA 4O3RA 4S0MA 1TL3B 2NUUG 4V19X 1HA1A 3DRXA 3K8VA 1FTRA 2VF3A 4ZHRB 3CF5Q 4LRFA 2IRYA 3MHYA 4F4WA 4RW9B 3GR0A 3N6NA 1U1OA 1TQLA 1D8YA 5KFDA 1PC5A 1FVSA 4IG3B 1URRA 2C2OB 5K5MA 4F26A 4TLRA 3MD3A 1LWXA 4USUA 1NEEA 4IFVA 3C2PA 3FMBA 1DTQA 2OTLS 1KP6A 1EETA 3PRVA 4DR1J 3H0PA 4RNOA 3D28A 2ZKTA 4EK2A 4DV4F 2PA8D 1ZM9A 1WC3A 3VWSA 3TANA 1LEOA 1FKOA 3P96A 3D6FB 1RZMA 2MHEA 4G6VB 4L3NA 2CVIA 3RRHA 3W65A 1Q8IA 3S1TA 3D4JA 4BCAA 4TLQA 5K8NA 3SV4A 3TZXA 1NBEB 3DU6A 5HMXA 2HIQA 3MD1A 3AD7C 1Q16B 4DL7A 3C46A 1FDNA 4YB5A 4PG7A 4PPZA 5C7PA 1QM9A 2RUGA 4PCQA 1Y5NB 4AT1B 2KYZA 3R9LA 4Y0FA 2CJXB 4CT8A 5D0GA 2WOMA 1C1CA 2ZC3A 3FQKA 4DR7F 2AWZA 4U96A 2VG6A 3D6MB 2N7CA 1HD0A 3IG1A 1AFIA 1HW9A 2M5YA 3VALA 4M5DB 4DQRA 3A4TA 2MJUA 2HHWA 1U1RA 4KY3A 3TI0A 3R6LB 4DUZJ 4N76A 2DGVA 2FPHX 2O67A 3D66A 2HEKA 2YQ0A 3GTYX 2OI2A 2NZ4A 1RWNB 2IM2A 3UR0A 2NXUA 2GV1A 3CB4A 3HF5A 2LA4A 3T3FA 3KNAA 1SV5A 2V8HA 1B3TA 4RUBA 3L4BC 2V68A 3AD8C 3KKFA 2PN6A 3HHLC 1M90T 4FNIA 4FXVA 1D0EA 1YJWS 3PFOA 1OY9A 2KB2A 3OXGA 2HQ3A 2BANA 2HGMA 5B09A 2JL9A 2XI2A 5AT1B 2CDQA 2PD1A 1VCTA 2YBVA 3BBCA 2GJIA 3DDKA 2QL9B 1M1HA 5G0RB 2QO3A 2A6MA 3QGIA 2OFGX 5KT7A 4KGVB 1F2HA 3HHLA 4C6AA 3OL8A 1X5TA 3CEDA 5HMYA 2ASDA 5HMZA 2VBWA 5IT9U 2M9KA 4MKVA 1YZ7A 2X3GA 3POTA 2BABA 1I6JA 3H5YA 1Y7PA 2D3ZA 3QAEA 3UE2A 4P71A 5E0OA 1YKWA 3PM9A 3GMGA 4OX6A 5KTQA 2H51B 1RWKB 1RTDA 4IKAA 2CPEA 3MEKA 2XLKA 3I0RB 4F2SA 1RT3A 3CULA 4RW8A 1M1GA 1C0UB 2MZRA 3KG0A 4C4WA 3JQKA 1ZAXA 1KQFB 3H4BA 3LWMA 3CCVS 4LF5J 3R5JB 4DR4J 1UCNA 4ED3A 1WEYA 5DLFA 4EUVA 2ZEJA 3BKTA 3QZ8A 3AA8A 4A4JA 2K1RB 4YDDB 5E2QA 2DPJA 3BYPA 5KFGA 2WVBA 2RU3A 4YR0A 3LP1A 4O4RA 4RO0A 2P9EA 3P49B 3TYTA 1WHXA 5L1IA 3MM6B 4WFBQ 3HFVA 5KG0A 3IMQJ 1HBUB 3KLGB 4R8UA 2ZKUA 4ZVUB 1RT1A 3DOKB 2FJBB 3CDUA 5BXIA 2XC9A 2E5LF 2DYAA 4H4MB 4A46A 3PG9A 2NPIA 1HPZB 2F8MA 1K1SA 4BLGA 3KXDA 5J2NB 2XSJA 2GIRA 4C0HA 1BHNA 1SUQB 5LMNF 3CVKA 3P5BP 3LW5C 4QYZJ 3SI8A 1HBNA 3S6EA 2E1CA 5CYQA 1CVJA 3LF0A 3W61A 4NI2A 3QFWA 3KUEA 4MIWA 1RB0A 4WK1A 4WJBA 3Q0AA 2C2ZB 4X4VA 1TKZA 2X7IA 2BDPA 3PR5B 3ZZTA 2ZH7A 4Z7YA 2ZUAA 2J0WA 1RHJB 1JKHA 1PAUB 1UETA 2UUBJ 3CC7S 2VFVA 4PABA 2OGUA 2ZWOA 2YQ3A 1Q5YA 1T8EA 4H4OA 3BDPA 2W4DA 2AZ1A 1ZTWA 2XZWA 2ZE2A 2HNZA 2E7WA 3IS9A 3LANA 1YX2A 1WSRA 3M2VB 2DR8A 5H9FK 4X64J 4J9NA 2VASA 2IRXA 2L9DA 2B8QA 1FDAA 5IM0B 3F56A 4WKYA 4C2MA 5HBMB 2DGTA 3UPFA 5JMNA 1RWPB 2FZCB 1VRTB 2V2QA 1U1KA 3W9JA 4CLZA 1LK7A 4DSIA 4FBUA 4F4KA 2VFRA 2HNYB 1YZ6A 2ZDOA 4M95A 2H5IB 3SYZA 1A0OB 2RT3A 3FDSA 4LF8J 1K47A 3BBBA 3EXYA 1FCAA 3GONA 4O4GB 4CZCA 4WKRA 1H72C 1FFWB 4ZIVA 5A6PA 4XIUA 1Q79A 1S9GB 1RAFB 1JXLA 3G6ES 3QNWB 5KFXA 3V6DA 3HVTB 1JLAB 3QT5A 4YHHJ 5DQIA 3I96A 4X4UA 2IBKA 3W1YC 1VQKS 5LOQA 3MMBB 5CABA 2UXCJ 3EGNA 4CIOA 5AXMA 2DEJA 3V2UC 1X31C 3MUTP 3IR5B 1D1UA 1ZPVA 3NP5A 4OZ0A 4I7FA 3L7UA 2LYVA 4USIA 4Q0BA 3R97A 2DBBA 5HQMA 4DR6F 2R7VA 5F8GA 1Y10A 4DL6A 2HYIB 1IJFB 1I3OB 1S1TB 3BZQA 3A8EA 2PMWA 2E5GA 1GEHA 2RAQA 3SDEB 3PYGA 2L3MA 4DV1F 3CC4S 3CCRS 4ELUA 2RQCA 4ECSA 1XR7A 3CE8A 3SBMA 2DPIA 4K8RA 2YWHA 3CJTA 1N6QB 2YWWA 2VV5A 3LGNA 2XLJA 4V1Ak 1ZA1B 4M5HA 5IQQA 4QWAA 4WFXA 4ZPAA 1RP5A 3MCOA 1GTHA 3S8SA 1I51B 1SH2A 2XMJA 4JI6J 5IV3A 2M0GB 1W26A 4C11B 2W9AA 3FCHA 1DLOB 2EPIA 3QYYA 4P75A 3D67A 2HVIA 2GIFA 3KLEB 2EFQA 2L08A 2D1CA 4I56A 1YJ9S 3DRPA 4E8UA 2Y3YA 4ECYA 3HFKA 3NMRA 2HPUA 3QO9B 4PG8A 2K3IA 4Q45A 2P9GA 3DLGA 1YJVA 5HLFA 1ITPA 3CJKA 4E2FB 2HGLA 1YI2S 5D4LA 4PQUB 5IC4B 2JHEA 1XBWA 4IH6A 1MW7A 3TUZC 2CZVC 3EZ5A 4HHUA 3AJ2A 2G0IA 4FXWA 1CJVA 4OYOA 4RW4A 3O1LA 2CZ9A 2MJNA 1WUUA 1T05A 4X65F 2CYYA 4OYZA 1GXTA 3IWLA 5J2PA 2VPZB 2HFUA 3SSSA 4J9OA 3KDOA 3IBFB 3G82A 4RU9A 5KG3A 4CH7A 1TL3A 3GR1A 2PE8A 2WHOA 3PW5A 3LGMA 2AJ2A 3FKBA 1U0SA 2KT3A 3RZAA 1X4HA 2HBQB 2AGPA 2LEAA 1T03A 1O0PA 3OFGA 1PGZA 2VPWB 3BF4A 4KGXB 4IG3A 1HQUB 2GQ2A 3ITHA 1RBLA 3JS9A 1VIXA 1JLEB 1QY7A 3IXQA 1FRMA 2AYMA 3LALA 2AYGA 2CPJA 3N5FA 2JC0A 1HNZF 2GQQA 5C5JA 4R5PB 3VHQA 1OQ6A 4CLWA 2KHCA 1QVGR 2NS1B 3FBBA 2E29A 3DOLB 1VHFA 1D9FA 3PXGa 1VBKA 1QJHA 5D3GB 3HHLD 1WACA 2E9RX 3KOAA 2C2MB 2RQMA 4CLLA 2K2PA 3NWGA 4A8WA 2UXDJ 1HWKA 4FF2A 4PAAA 2Z8QA 5IZHA 2CQ0A 3T9NA 3I9V9 1UA0A 2MQQA 1N33J 1NK5A 1SIWB 4Z7CA 4K4XA 1NHUA 4XTTA 2BX6A 2IIHA 3OVSA 1UJ6A 4EWTA 3GSIA 1S77D 3D1QA 3QPIA 2J0XA 1ELOA 5AJ3F 4QJVA 4TY9A 4FDFA 5ADZA 4QIWD 1Q5VA 1RTJA 2DEIA 3MOZA 2FZKB 2B0GA 7FDRA 4MK9A 1URNA 1R3NA 3MEGA 1M0SA 1CS4B 3BGLA 3PO4A 1Q4RA 1WTBA 3BQ1A 3TZZA 5HATA 3Q8PB 3M2RB 2YX1A 2H4WB 2HMIA 2BW7A 2EKYA 1HYSB 2OUGA 2LQ5A 2BOAA 3H2LA 1WELA 2PFFB 5D4OA 1GH8A 4JI0F 4LF2A 4RW6A 4WE1B 3O6QA 3D68A 1OSCA 2EC0A 2EFPA 4LSZB 4D3HA 1FJ7A 3H42A 4OI6A 4IQXA 1FEHA 2V5HG 1N56A 4M5JA 4ZPWR 2YPYA 4DFKA 4K4UA 4DR5J 2XMMA 1U25A 3A3PB 3CO0P 2ILYA 2F65A 2GMHA 4FVCA 1TUGB 2MKIA 3L09A 4KO0A 3A12A 2VG7A 3FC9A 4LF4F 5FIIA 1RU1A 4DV3J 2ZD1B 3CO9A 1X4GA 4QYRA 3ETMA 1HIYA 5A2QU 4PG4A 1IKXB 1Y00A 4OI2A 3ILIA 2X1BA 2NXNA 4OHYA 4FYDA 4ED4A 2CPZA 4DQIA 3NGDA 3W8PA 3C16B 3MDFA 2F9JA 2GZOA 4UT4A 5I3UA 1IKYA 4YFUA 3FEZA 2ADCA 2MYFA 3L7PA 1RAIB 3RR7A 3FJ2A 3PEHA 2MKJA 5K8PA 2DNOA 1V3ZA 4DQQA 4RBUA 3KWMA 1AUSL 1UP1A 1SB6A 4JV0A 4UOFA 4AYBD 4I0WA 2DY9A 2JOQA 3TX0A 1WEZA 2YX4A 3JTNA 3FSIA 2QX0A 1JQGA 2AD9A 2KXHA 3KK1B 2UV8G 1PBUA 1IN0A 3R2CJ 4NXNJ 2YNGB 2PO4A 3FUYA 1R89A 1N5VA 3OR1B 5KAKA 1UWAA 4P74A 4RUAA 1JLQA 1HBUA 5GAGU 3KJNB 3KLGA 1F9HA 3V6HA 5KFTA 3DOKA 1XNQJ 5KFIA 5ETRA 1ZETA 2V8VA 5DQHA 1T9UA 1JXVA 1U47A 3MOJB 3UVJA 2M3DA 4WXWA 1S4FA 2G4BA 4NLUA 4E0DA 1SUQA 1FRXA 3D0GE 3MAAA 1PSDA 1CULA 3MAHA 1QE1B 6FD1A 4JI4J 4L74A 1AB8A 1EQMA 5LSLA 2AEMA 3MMCB 1ZH5A 2K7JA 1EKSA 1S79A 1VRQC 3IWNC 1FF2A 3W2WB 2Y0BB 4Q5VA 1YJNS 1U45A 2ZH4A 1U02A 2PGCA 5KFNA 5K8MA 4XDCA 1RYSA 4IYQA 3PW0A 5KOWA 2JX2A 1K9MT 2B8PA 1VQ6S 1CJTA 1O6XA 2JEGA 1QVFR 1PIEA 4WCEQ 2CQ4A 4ED0A 4MTPA 4NMXA 1DBDA 1BE4A 3C14B 3W9HA 4Y00A 5EWFA 1RK8A 2AMCB 1WF1A 4OZLA 3TO8A 2W7PA 4CI0B 1UEKA 4LBPA 3RUBL 2XMWA 2RNEA 1HNVA 3HP6A 1DQ8A 3M2VA 2V2KA 2AKWB 3US5A 1U2FA 2EWHA 1HR0F 2HFSA 2UP1A 4HR2A 1R8PA 4DPWA 1OIAA 3UDVA 3FCVA 1CJUB 1M5HA 3KHLA 3C3LA 3IFEA 5HBMA 3Q2TC 3P6YC 3CJ5A 2BW2A 4MIAA 2I8EA 3Q8UA 4A8YA 1R0AA 3PYEA 3QJLA 3LTOA 2CQHA 1VRTA 3SQOP 2RQ4A 1WI8A 3GFHA 2A6OA 1Z1ZA 3OTDA 4IRKA 2BJEA 4JV2A 5ETVA 1YJTA 1JIHA 2FLPA 4OHVA 3O8WA 3D6TB 3BKFA 1JLBB 4HH0A 5H9FJ 2QZ8A 5JXSA 3U1MA 2RF2A 3LO3A 1N32F 1T02A 1S9GA 3QWPA 4AFFA 1V9OA 2B4PA 1FXLA 2QA1A 1Q95G 4OV1A 3M8PB 5DG8A 5KFRA 2BZ2A 4RNNA 1PCAA 3FSXA 5KFHA 4DL4A 2W1BA 2OPSB 3LH2S 3HHDA 2F4VF 2A2DA 1S72S 2HHHJ 2XS7A 1SBRA 2W01A 4I6WA 2BVZA 2YWEA 1H7WA 2AIRB 1OYEA 1HARA 2JC1A 1OO0B 1F0XA 4KH0B 3UDCA 1KTQA 3HD2A 4LFAF 1S1TA 3EZUA 2R2UA 2IY5B 4P7VA 4HT5A 3KYLA 2LXIA 2IJRA 4X4PA 1KWMA 3W7BA 5CH7B 3R3TA 4IO9Q 4BWMA 4BHQA 1X4BA 3EDQB 3SSRA 2VQEJ 3FCWA 3CCMS 2CQ2A 1N6QA 3HFZB 2YNHB 1G1XA 3EVOA 2CJAA 3VGUA 3B54A 2ZVIA 3M05A 5HJXA 1PG5B 3MXHP 3IAM9 1XQIA 2ZJRQ 1TK8A 5A76A 4C11A 3M6UA 6AT1B 2DNYA 5KFPA 5LJ5Y 2DGUA 3GILA 5LMUF 1F2GA 2MXYA 3G87A 4B9NA 3B6BA 2CXEA 2MLXA 2FHJA 2XNQA 2U2FA 1E6YB 4WK3A 1RCXB 4F50A 3MM8B 1S99A 5B0CA 1U4BA 5IQ6A 3TQEA 4P73A 4QR0A 2AEFA 2ZZTA 3BSAA 3IRWP 1XJWB 1WNEA 4RUHA 1WC0A 1GX5A 2DB1A 1VBZA 3GZ7A 1T0TV 3DRSA 3GIIA 2YWGA 5DRKA 4OI0A 2E5LJ 3WBZA 2ZHBA 2ZOGA 2EG2A 3W66A 4J5OA 3AXMA 4O44B 1NNDA 1YLXA 1WORA 3D2WA 2D3OR 2F8HA 1TKXB 4U67Q 4ZP9A 1DQ9A 3M32B 1S6QB 1BMQB 4MIBA 1EP4B 4JI8F 3J81j 2BE9B 1HQUA 2VDIA 4I6AA 4KFBB 2BXJA 2LQ8A 3PX4A 4RPFA 2AGQA 4RKUC 2R7OA 2KI2A 2GAGC 2HKEA 1JLGB 4R5PA 5MAOA 3DHXA 3LP2A 3AAWB 4WZMA 1VRUB 4ECZA 3EMTA 1FJEB 3DN9A 2ZBQA 4ZPCA 3B4MA 4X66J 3MAQA 3DOLA 2W24A 1TR0A 3HVAA 2IVYA 2VICA 1RT7B 5D3GA 1G2EA 3R8YA 5KT4A 5DDOC 3UN5A 1JJ4A 1U0HA 5B0EA 1UMJA 2YKPA 1BY9A 1KONA 3SEOA 4QIGA 3IGNA 5DGAA 2BJ8A 3CJ0A 4ZCMA 1JNZB 1S1VB 5ETQA 2E9ZA 2DNLA 2QLJB 1XIQA 4BS2A 3HO1A 2RHSB 4USWA 3V81A 2Z30B 3JB9k 3MM9A 4OFZA 4FS2A 4CLTA 3PACA 2FYXA 1IR0A 2VG5B 4NCAA 2B5JA 1R31A 2MLYA 4IR9A 4XPCA 4NRUA 2JFDA 3EVWA 4B3MF 2I9SA 3M30B 5KOXA 2FLNA 4DR1F 4KQZA 2HHVA 5D0HA 1KDNA 1U49A 2FHKA 1FNXH 3EX7B 2XEXA 5BYSA 2OH2A 3KHRA 1EQ0A 3HK2A 3MI7X 2EBEA 2W9CA 3FEYB 3UN2A 4ZLJA 4KE5A 2WB1D 5KG7A 2XWXA 3NCPA 5A0YB 3HD1A 2CPDA 4DL3A 1BQNB 4JB8B 4WE1A 1N52B 2FJEB 3R6GB 2DR7A 4UZBA 3MR7A 1SKRA 5F9LA 4NCGB 4PXBA 2OKQA 3F73A 5ITHA 2WSEC 4JV1A 3HVWA 4CM0A 4USJC 4DR6J 1SPBP 3G8SA 1U48A 1F60B 2RHQB 1HHQA 1YITS 4PG5A 2IBOA 1O5JA 1SL1A 2EXUA 4CLKA 3NS6A 3KLHB 1UVLA 4CDIA 1S1XB 3QWUA 2DIVA 3PIOQ 4DUZF 4WFNQ 3BEGB 3GYXB 4HLBA 1AFJA 1HBMB 1NK8A 1SQEA 2V50A 3EGZA 3MMAB 2RQKA 1WSVA 3OXFA 2XS5A 1IKXA 4U7CA 2C3UA 1QUVA 1WF0A 4U6PA 3UDLA 1GMWA 1C0TB 2NREA 1KOHA 3CD5A 1UKUA 3VCDA 2E5IA 1KQGB 1Y9OA 4DFPA 2ACYA 5L38A 1VK8A 2I38A 2IC3B 1UEUA 2VJUA 1FNMA 4R0JA 1D3WA 3V6JA 3DGPB 1LWEB 1RWXB 3BBFA 1NK9A 2GGPB 4QBUA 3JYTA 4OV6A 4LR9A 1VISA 3OUYB 3IR7B 3UCGA 5F8LA 3KK1A 3AOBA 2BE2B 4WFAQ 2DNNA 1J27A 2YNGA 2RKIB 4BC9A 3A3NB 3B82A 2DGOA 1D9AA 3ICLA 2OD4A 3OR1A 1S4EA 1VQ7S 2PI5A 2GVDA 1X9WA 1RWOB 2FJVA 4WFYA 1XN9A 4NEZA 2DXDA 3CD6S 4NLQA 1N34J 1L3TA 2IA6A 1RE1B 1T94A 4EU0A 1N4LA 1IQTA 1RA6A 3RBZA 1NM2A 1T9WA 3H5UA 3ZZZA 1FWPA 2HHXA 4O3PA 1F3FA 1F5BA 2C2EA 2OPQA 3CDBA 4K4VA 2G2ZA 4M1KA 4LF5F 2V4JB 2ATLA 5A8KA 4G1QA 2XLIA 1QDUB 2XQCA 1N8RT 1H73A 4K4WA 5SZTA 3I0SB 4K4TA 3RG6A 1X4EA 1HNZJ 4UW2A 4HI1A 3HJVA 1B70B 3PX6A 1AZSB 1TUVA 3H7HB 4DX7A 3U7JA 2HG4A 3G4SS 3I82A 5B0BA 1CJKB 4RR5A 4NWBA 7FD1A 5KFMA 4MYUA 2C28A 1NKCA 1LXJA 3R1LA 4J9MA 1LWCA 3C14A 1HBOB 3J81Y 1RTHA 5GAGI 4YB1P 2EEYA 2KXNB 1TAQA 3H59A 1HHTP 4HEA9 4N8NA 1ZOTA 4P6QA 4CLSA 3NGKA 2V8DA 1Y5IB 2DNMA 5DDPC 1UVJA 3GU0A 3WX8A 2VONA 3GFYA 2V34A 3CJ4A 2V69A 5HAOA 2R7SA 2FHMA 3I32A 1OWXA 1WC5A 2BM0A 2XI3A 1QTNB 4IFVB 1SC6A 4FKYA 4K5SA 1DTQB 3I87A 4F0HA 5LL6d 5GMEA 4CNZA 3CWJA 3PW7A 4A8FA 4Y28C 1I94J 4QR1A 1TZ0A 2FHJD 1FKOB 1G3OA 4WFZA 1IM6A 3CIMA 2UUBF 1JLBA 1NKBA 2JEIA 3KLVA 1RHUB 2OEKA 4YB7A 4KBIA 2G2OA 2ZJQQ 4J9LA 3QSYB 2UXBJ 3NEKA 2L9WA 2PMHA 1Q78A 2FLOA 4DR2F 3R7BB 2HBYB 3K5NA 5KFLA 3QGHA 4NLXA 1UVKA 4WTYA 3CD7A 4JI0J 2DGWA 2F8EX 3M8PA 4M63A 2PI4A 4X64F 4LR7A 2ZH2A 5F8JA 4HYKA 2LLZA 3BH7B 3SCLE 2UU9J 1SCJB 4ZVFA 4ANEA 1C1CB 2ZBPA 2V0NA 3NRBA 2PIIA 4ED1A 2VG6B 2CPIA 4Y2CA 1DRZA 4V19J 1H74A 3IG1B 1RHMB 2IJFA 5K14A 1DTTA 3KK2A 2VB6A 2LQ9A 4IG0A 2COLA 4LRCA 2H48B 2IRUA 1R27B 3CMES 1H98A 3BGOP 3R27A 2OHDA 4LF8F 1OPIA 1SIZA 1UAWA 2DISA 4RJVA 1B0TA 3AOAA 3SXLA 1PC4A 3MCMA 1HWUA 2MQLA 5F9NA 4CH0S 4K7QA 3DLEA 4DV7F 2YNHA 4KH1B 2DCUB 2Q1LA 4E98A 4YHHF 2R7QA 2DHAA 3AH6A 4R25A 1C1BB 2BANB 2BJ9A 1IKVA 1IWAA 3GP9A 1ICEB 3HSJA 3SQGA 5KFZA 2O01C 3E2EA 2UXCF 2FJXA 1S6OA 5KG4A 4ZVGA 3TVYA 2J9DA 3JSRA 2ZM6F 1RADB 1KVJA 2W7OA 1VC0A 4EO6A 4C8YA 5KFAA 2BEFA 3C6TA 1E6YA 1VGYA 4O3SA 5B0AA 3HHLB 2YKMA 2HQGA 2DHHA 4N8OA 2BOPA 3P8BB 5GVQA 3OLBA 3NS7B 3POTB 1YRXA 4K59A 5G4DA 1U6BA 1VQSA 2G0JA 1AW0A 4YEAA 3BSOA 3FEXB 3T1YJ 4EO8A 4IRDA 1TK5A 5EN1A 2BRLA 3GV8B 2ZITA 4HL9A 5M2RA 2UUWA 4JI6F 1WF2A 5I3PA 4XAKA 4U7UK 2HBRB 5L8RC 5EX0A 2YQ1A 1G4CA 1RGVA 3TOQA 1TKXA 2UUCJ 2GMLA 2JZ5A 3M32A 1S6QA 1C2PA 1U8WA 4DPXA 4DN0A 1EP4A 4DF4A 1N54B 5M2PA 5D0EA 3GPAA 2VIHA 4ECWA 4ZDNA 4ANDA 3M1VB 1P1LA 2BKPA 3OR2A 4TYBA 3W9IA 5KFUA 2EVZA 4B9MA 3AHPA 1CLFA 2ZFHA 1VFJA 2QEXS 3QMQA 3N01A 2HIYA 4F2RA 4R8UB 4WXOA 1NZAA 1YTYA 2RDDA 5JVGQ 3PHTA 1MROA 2IHR1 1RT7A 4OZJA 3HX9A 4LVNP 3OJUA 1S10A 1IR2A 5C24B 2FDNA 2JRSA 5I4MA 4TU7A 1FJGF 4UF4A 4JV5F 3VQSA 1HR0J 2J8AA 3QFHA 1S1VA 3D3CJ 2O3DA 4USKA 4CO0A 1TL7B 4YR2A 1HBNB 2FVSA 5CYQB 1GMWD 4NI2B 4Q8EA 1TP7A 1S0NA 3AD9C 2VG5A 4DOZA 4Z37A 1TKZB 3GLJA 2GC8A 3LOUA 1LV5A 1N48A 4C8NA 3M30A 5BJRA 5ETSA 2MGZB 1S6PB 2DXEA 4F0KA 2P2CB 1X5OA 3KLFA 2C2KB 3TVKA 1RWWB 5KFJA 4L75A 4EBEA 2YNIA 4N5SA 5E5NA 2KZMA 3BM7A 8AT1B 2ZE2B 2HNZB 2XCPA 2G0CA 4ZVRB 1SJQA 4DQSA 4JI1J 4RWWA 1H2TZ 3OW2R 4A8MP 1FVQA 4KTQA 2YKQA 4PKDB 1MN7A 3KDNA 3C8YA 2NUHA 1ZYQA 4LRAA 3F0NA 2KKHA 2MHNA 1BQNA 1SKSA 2DGXA 2KG0A 3K17A 1N33F 2F4VJ 3I55S 1OQ3A 3IWXA 4WU3A 5DGBA 4Q8FA 4NCGA 1FJCA 3HHNB 3E01A 4CT9A 4Y3CA 2EBGA 2DTJA 4ZCKA 1T3OA 3Q22A 2C22A 3OPKA 4C8KA 2YX7A 2ZH1A 1NH8A 4NMLA 4RLEA 4LFAJ 1LOUA 4I2QA 4RNMA 5IFMA 3W2VA 3WDOA 1PKUA 1S1XA 3TA0A 3JSMB 3OBIA 2CFXA 1KSPA 4PWUA 2IDEA 1RWUA 3QLHA 1GXLA 2QA2A 1UEVA 3V6DB 4ECTA 5KFSA 2ZH9A 3VAGA 1S97A 1YQHA 1BC6A 1O51A 1U1QA 4ECXA 2XMTA 3EGVA 3I4PA 3ZZYA 1NPKA 2VZ9A 1C0TA 1S9EB 5LMUJ 2I0XA 3H25A 3SZ2A 3U27A 2ROGA 1VBYA 5HL7Q 3KJQB 2ALZA 3A1YG 2IC3A 4NA1A 2FHOB 2RJZA 2IFXA 4DR5F 2QA4G 2WSFC 1LWEA 1NU4A 4CRJA 2CIMA 4F3MA 3OUYA 3I6PA 1X7VA 2DD8S 3D0HE 1FERA 2QFJA 2BE2A 3W5YA 2KM8C 2VODA 4DV3F 3TJ8A 2CQ1A 1TL5A 1UJ4A 1ZBTA 3H4DA 4GMKA 2R7XA 4OI3A 5A8RA 3MUMP 4FYVB 4B02A 4QWDA 5CXTA 1ACMB 2XMUA 1DURA 4ZJOA 2D9OA 3OL9A 2DITA 3P3DA 1WJ9A 3FFIA 1AA1B 2XYHB 3GIRA 2IMWP 3PYFA 2V4RA 1PILA 3DRPB 1P8GA 5MLCV 3LPYA 2ASLA 4JI8J 3UCUP 1RAEB 2V4JA 4AL6A 3D7SB 5HLFB 1RAJA 1R0BG 3VZHA 2D74B 1NJZA 2R7TA 3H2VE 3PZPA 2CQGA 1HMVA 1TELA 2RD5C 1X8DA 3HCXA 5E3PA 4OZ2A 1ZS6A 4YP3A 1S6UA 1CJVB 4C8OA 4RW4B 5EUHA 5J2QA 2P8IA 2GAHC 5AXLA 1T05B 1U09A 2N4DA 4GRSA 4J7CA 4YR3A 4DCOB 4U8VA 4A8KA 3L7OA 4DXLA 1SQFA 3G82B 1HBOA 2OELA 1YHQS 3CTRA 4ZCLA 1JWWA 1T03B 3CJ8A 4ZJQA 1SH0A 2DRAA 4QIVA 3ITHB 1FA0A 2M8DB 4YUDA 4I2PB 1RT2B 4JI4F 4NLSA 4O3OA 2OP5A 3K5PA 3M6VA 4B3MJ 3CGIA 1IQZA 2DH8A 1K44A 4NXMJ 4CTAA 3JQJA 3OFFA 3QT7A 4TVAB 5ETLA 4DV6J 3TJ9A 4I64A 4HACA 4LVOP 2HRUA 2UUAF 3RU0A 3KG4A 1REGX 4DL5A 4KGKA 4PYDA 2HSEB 1MN9A 4A48A 3DXSX 1WC1A 5C2GA 2J7UA 4J9SA 1LFWA 2J6SA 3LWLA 4IQMA 2W9BB 2H5EA 1Y0HA 1NB7A 1RLDA 1MU2A 3OHAA 1XERA 4B9SA 2HRYA 2JNJA 1NPPA 4DUTA 5I3QA 2D69A 3CCSS 2BACA 2FC8A 1RQ0A 3AJDA 3KUGA 4ZPDA 1FRJA 3FRZA 1WKLA 2HS4A 1RTJB 3GIMA 1RAHB 1B7FA 2J9EA 4OJGA 3MEGB 1NHKL 1QTMA 3P45B 5HVHA 4ICLB 2DNGA 3M8WA 1S59A 3OV7A 2HMIB 2B51A 4NYZA 2HHQA 1SH3A 1X5PA 4ALZA 2NZCA 2YNFA 1S1UA 2PDAA 1RTZA 2B4UA 4RW6B 5D0RA 1BWVA 1C1BA 4J9KA 2OTJS 4B3OA 2HHSA 2I6WA 4FPRA 2CQCA 2B9YA 2DXFA 2HHPA 5IWAJ 2LCWA 1BQMB 2HHHF 3N28A 1RWMB 2DNZA 3UR3C 2CADA 5FLXU 4ECUA 2DRBA 5DM6Q 1Q8LA 2N7YA 2XZDB 3SIPB 2HS3A 2BMBA 1VMBA 3M8RA 4KO0B 4KKOA 2HQIA 2CNLB 3S7RA 5T7LA 1WHYA 2VG7B 2AJFE 4HDGA 2PMZD 1REVB 2ASJA 3TAPA 3G8QA 4ZS6A 3OVAA 3BREA 3J80U 1EJ7L 2BQUA 4W92B 1HKAA 3A3OB 2YH0A 2VQEF 3MEDB 2GHWA 3HMJG 3NL0A 1F5CA 4ID5A 2F1FA 1SKUB 1BUXA 3DYAA 1DAXA 5I3UB 1IKYB 3JTPA 3N6MA 1MSWD 1CC7A 2DO4A 4F8RA 2ADBA 2OEJA 2MKSA 1A9NB 1WOOA 2ZH5A 3MR3A 3EGWB 2E9TA 4KYZA 4KHPF 4IH7A 2XM3A 3GCXP 3KJFB 1IBCB 2APOA 2H5JB 2A2CA 4ERDA 3ILJA 1VI7A 4ATNA 4NLDA 4DX8H 4DX6A 1U24A 2HLTA 1X5SA 3K2YA 3M1VA 3F44A 1ULRA 4OX9F 1WC6A 2RU9A 4F67A 3LAMA 1RWVB 1PJ7A 4LQ9A 1RT5B 4MT1A 4KC5A 2GHVC 2XTJP 1H2UX 2AYBA 1JLQB 1XR5A 4CQ1A 4HTJA 4DG1A 2M70A 2E1AA 5F41A 3TUPA 2QMWA 3PDNA 2ALYB 4UOGA 4WU2A 2DR9A 1TL1B 4UOCA 1F6TA 1BWEA 4CNYA 3KHGA 3CUNA 4Q43A 2FTRA 2MY7A 5C24A 3UVJB 5DQGA 3VGSA 4LF6J 4CH1A 1P9QC 2CZ4A 4LRBA 4B3SF 2YKOA 1FEEA 1UFWA 2ZZMA 3MAAB 3DLHA 1TL7A 1CULB 3EE3A 1IR1A 1R7IA 1SI9A 1JXEA 4YN3B 3D54A 3CSKA 1XWLA 3DLKA 3NG8A 1FX4A 1NUEA 3NY0A 3MPUB 3R1HA 3RBDA 1L3SA 2LMIA 2DGQA 4FZVA 2EG1A 5A2QY 4CP5A 2L41A 2AU0A 4L76A 1JLFA 2V67A 4L72B 4HT7A 1D9DA 2MGZA 1S6PA 4C98A 3BDEA 1CJTB 1UPPA 3ILLA 2VBZA 4X66F 4DR2J 3BYRA 5CYJA 3G8TA 3IM9A 3D6HB 3FK4A 2RDIA 4GO5X 4UQGA 2J8SA 1HNVB 3J7YI 2XHWA 3N79A 1UPMB 2EI5A 2MPUA 5H9EK 1KOOA 3GJTB 1EX8A 2MZTA 4DR3F 1W2BR 3M8SA 4PPDA 5CHCB 4ECVA 2KO1A 2WSCC 1R0AB 3K0JA 2J0QD 3RR8A 3JTOA 4CCHA 1SL0A 2FGCA 4RU2A 2FVPA 3UD4P 1UFLA 1WKKA 5H1SV 2B7CB 2IJNA 2XY6A 1N36J 3KFWX 4FS1A 4MKYA 5L46A 4MFBA 4P7TA 1W7WA 4N41A 1LQ9A 2JVOA 4UUXA 2CJQA 2OO4A 3C6UB 3O3LA 3K5OA 3JSMA 1JLCA 3K7RA 2RF2B 2Z0GA 4DU7A 4F4ZA 1GK8A 1RHRB 4DV7J 3GJRB 2XMVA 2A18A 2RS2A 3K5LA 3GSDA 3DHWC 4AQYJ 2ILZA 4Q7AA 2I5JB 3NCQA 3DGVA 2CQIA 3NLCA 1TKTA 2I1RA 2AQ4A 5KFKA 4ETXA 5HMWA 1LW0A 1HW8A 4KT0C 2IYGA 2C2DA 1VLOA 1S1WA 4FF3A 1Q0NA 2HURA 1S9EA 2Q3PA 3HZGA 3N6LA 2ZM6J 1U8SA 2B6AB 3Q8YA 4I69A 1ZAWA 3ENAA 5I42A 2AP6A 4MAKA 3TEGA 4PZVA 1DHMA 5B7WA 4XK8C 1RTIA 2DH9A 2V2ZA 2R8IA 1GMUA 2RSQA 5RUBA 1H2VZ 3A13A 2OPPA 3EPGA 2V94A 2PEBA 2FVRA 4HDHA 1VDHA 3VGVA 1XTZA 2MKCA 3DDNA 3R5AA 2CPYA 4KB7A 2YTCA 2RMLA 2IVMA 2VBXA 4C3LA 4ZN1A 1HNWJ 4TU8A 4PXCA 3FBEA 2X51A 2V2VA 2EFVA 5LJ3Y 2Y8YA 5E3AA 3GB0A 1YGYA 4ZPTR 1APSA 2DNPA 3P4UB 3PEJA 1T7PA 4NOHA 5HVGA 3WIVA 4L6V3 2QLFB 2BM1A 5LM7E 1LW2A 3CPWR 4KPYA 4OYXA 2XO7A 1W2IA 4K4YA 3CCES 5L39A 1P27B 2X1FA 1RSCA 4ZVTB 2JLEA 3TARA 1RT6B 1Q8KA 1X0PA 2VFSA 2XG8A 2LDIA 2CJKA 4MMOA 1NK7A 1XMBA 1IBKJ 4QW9A 1U1PA 2ZBCA 3L3CA 3DRSB 3D0IE 1Z2ZA 3CCWA 1VBXA 3BKUA 2FUG9 3M2UB 2YH1A 3OXLA 2DH7A 4F02A 3ZZOA 4OZ1A 1XMOF 2L9NA 2AV5A 1VS3A 1FJGJ 1IKWB 1N34F 4JV5J 4M5KA 3PTWA 4OYAA 4WBFA 3EPIA 2KRRA 2J7KA 2DHSA 1T95A 4TQSA 2XHCA 2KFZA 3AFGA 2UVRA 3CCZA 1QSSA 2U1AA 4PWDB 4IO1A 3WC2A 4I2PA 1RT2A 3SSQA 3OTOJ 3M8YA 1RISA 1TV6B 1Y5LB 2MMYA 1M1KT 2E1MC 5GAEU 3LP2B 4JI3F 4ELTA 5CQGA 5GADU 1SC3B 3FZ2A 1K1QA 5J1PA 3T1HJ 1X0FA 4KAIA 1Q7YT 1X9SA 4UY8T 4DPTA 3QRRA 1U0HB 1QAXA 1TL4A 1YWXA 2JEJA 2OPRB 1HI8A 3IO1A 3UD5A 4PXDA 1OPZA 4TQRA 3V6KA 3CDWA 4NZ0A 4MK7A 2LFVA 3RB3A 3MWBA 2W9BA 1NRKA 3G2XA 4BWJA 2HLUA 3V81B 1UW9A 3QGGA 1R6VA 2B43A 1MMLA 3MM9B 2M8HA 4TKTA 2DCLA 2AX1A 4YY3F 4J90A 5HSPA 4ILRA 2B5JB 3KUHA 1FK9A 3VAHA 6FDRA 2LQJA 2NSBA 4G65A 2H54B 3MR2A 3SCKE 1NJIT 3N5BA 1RAGB 4F4YA 1IXKA 1FD8A 3DCAA 3Q83A 3T6BA 4EGLA 5EHHA 3WC0A 1I94F 4G1PA 2DHXA 4MYTA 4DCPB 2PSZA 4ICLA 2R9LA 1L5UA 1BGXT 2K8GA 2KZZA 2W9CB 4DUYJ 1NSKL 2UXBF 1X60A 1FDDA 1T3NA 2YVSA 3PRDA 3R7NB 3HLUA 2V9WA 4WZQA 4KR0B 4J91A 1RACB 2DKOB 3RB0A 2LEBA 1AROP 2KFYA 3LP0A 5HANA 4USHA 2MZSA 3ULHA 5CD4A 1EZZB 5ETKA 2GO8A 2UU9F 2Z2MA 1KHWA 3HI9A 3IR6B 2W25A 1BQMA 1HWJA 4HTIA 5HROB 4IRCA 4URQU 5CA5A 5E3QA 2CJ9A 2ATCB 3DRYA 3ENVA 2CA9A 2HZVA 3MPVA 3W60A 2GJ2A 1G7CB 3PR4A 5EDWA 5DLGA 3BPDA 1B7YB 3I31A 2GCFA 3ADAC 3D1OA 1REVA 1U6ZA 2W2PP 3HVRA 1EARA 3GJSB 2WW4A 2ROPA 3EZOA 4Y34A 3HSZA 3I5AA 3W5XA 3G6XA 5HJYA 3MEDA 4RNFA 4J9VA 4KHRA 4TU9A 2PFDA 3PHEA 1R6YA 4B9LA 1HLWA 2LKZA 4NLGA 1Z4UA 2JLFA 2Y1RI 1R0CB 2C3PA 2KH9A 3GFZA 3MCSA 3MCNA 4FP9A 1K73T 2WONB 2CRLA 2F9DA 1V5IB 2HVDA 5A6WA 2LU1A 3M6XA 4FPIA 2QGFB 1WHVA 1FX2A 1QAIA 5E7OB 4J9QA 1SL2A 4MH8A 2KJVA 5F8MA 4O3QA 3M9OB 4ZN3A 3JYTB 1TTHB 1PO6A 2VPXB 4ES2A 1VQNS 5D4PA 1RT4A 2J5AA 1XMQJ 3DXBA 4OHWA 5F8HA 1RT5A 1VYAA 3ZFVA 2XMAA 2AX0A 2GVDB 2G13A 2MY8A 4Q2LA 3T1YF 1TL1A 3GQCA 2QIFA 1RDRA 2NYIA 1GFWB 2ZUGA 3U1NA 2FY8A 2XY7A 1QUPA 1RCOB 2OPQB 2Y8WA 2DR6A 3H40A 1FXDA 2OAUA 3KJVB 5A8KB 1Y3JA 1KFSA 2UUCF 4G1QB 5KFYA 3DMJA 1F3VA 3TX8A 3VZIA 3C15A 4CM2A 3ZTRA 3VAKA 1M5OC 3ZTOA 2RB7A 2O66A 4HKQA 2CUYA 1UZHA 4OL8A 1QAJA 2E7XA 2PC6A 4DJBA 1JMTA 5D8HB 4N56A 3TZWA 2UUAJ 2FLLA 1L3UA 2RE1A 5BR8J 2HAIA 1TKDA 1ZZFA 2QSFA 2FD2A 2X3DA 4F3QA 2BUNA 1LWCB 2IAJB 1RTHB 4QQBA 4N7TA 4N77A 3ZTSA 3T41A 2C3OA 4CLPA 1HHSA 1FFSB 5A8WA 5L1KA 1IBMF 3QT6A 5B0FA 2OMOA 3BH6B 4FF1A 3KHHA 3BO3A 3KLIB 1WI6A 1MLAA 3PJ9A 3DRRB 3JAMY 2AZ3A 3QIPB 1NH7A 2NXEA 2D41A 3UNYA 4IR1A 2K7KA 4MK8A 2AHOB 2HHTA 4LFBF 2JFKA 4PQAA 1FDBA 4KGMA 4OYWA 3LQVA 4AL7A 1F1BB 3L9ZA 2JVRA 4YDXA 4LSLB 2VA2A 3V4IA 1VQ4S 3TZYA 3A8IA 3SMZA 4A47A 3TA1A 9RUBA 3LGHA 5CCMA 1KNZA 1HFEL 1PYOB 1U1LA 5DO2A 3PY8A 1RYRA 3C6UA 3HKZD 3G71S 5H9EJ 1M5KC 2RIJA 2POKA 3ZTQA 3JSBA 2QV6A 3LUYA 4FYWB 1UWBA 2C2NA 2IM1A 2ZH3A 4ZITA 4K0KF 3AA9A 4JI1F 2HWTA 2R7UA 2QLBB 5E41A 5KT5A 4F4XA 2I5JA 2ZDPA 1NMEB 4LUBA 1NXIA 2QC3A 1DY3A 3QRQA 4B3RF 3AQOA 1HI1A 1U2CA 1AXQA 3QJJA 1RKIA 3BGFA 1VOMA 4FVMA 2B6AA 3KK2B 5K14B 1DTTB 4DCJB 5E3RA 1IUJA 1HQ2A 3ZNUA 3K58A 4IG0B 1KQKA 1NLKL 1VQYA 3G6VA 4YMEA 3EM1A 5D78A 1PYSB 2A0FB 2Z58B 3RRGA 2PA3A 5DG7A 3PKYA 5KG2A 5ETPA 3TWZA 2YKAA 1DQAA 1Y4ZB 3OTCA 4ZP6A 4ZVEA 3DLEB 3T5KA 1HNIA 4UY85 2EK6A 2VHGA 3UQSA 4MKBA 2EC2A 3ZTPA 1IKVB 1S9FA 2C3MA 4ED7A 3SQGB 2BJ1A 5HQLA 2Y0SD 4RW7B 3M9MB 4ED8A 1U26A 2BQRA 2IM3A 4NLOA 2GVZA 2DNKA 2NXJA 3DM2A 2GW8A 5F0UA 2DY1A 4X4TA 4NLYA 3MEEB 4TY8A 2V8PA 4HHJA 4KHPJ 5DJBA 4WIIA 3MFIA 1HQEB 2B4OA 2EKNA 3CJQA 4CLFA 1KLNA 1NAQA 3DNCA 2MZQA 2R7RA 3I5BA 4X4SA 3C6TB 2R4FA 3U1LA 1JK9B 2B56A 3PIPQ 2YKMB 4KGZB 1X4DA 3R5CA 1S0MA 3RBEA 1DFDA 1RT6A 2Z2LA 4OX9J 5DDRC 1DARA 3FMWA 4EYIB 5LXRA 3ETOA 1WC4A 1FKAF 2HK3A 4H54A 2FJAB 3IC1A 2VFUA 2HVZA 3AOCA 2RRNA 2CKWA 3NKYA 1VQ8S 2XO6A 3C19A 2LECA 2VDHA 1WDTA 4B3TJ 3VAFA 4DX5A 2QE5A 3M2UA 3NBPB 2BQ3A 4PXEA 1J5EJ 3CCUS 1M5VC 2E1PA 4IOCQ 1IKWA 3WX4A 4CWBA 3Q8RB 2CDRB 3CT9A 4B3SJ 4ZVSB 3DLLQ 4DSKA 2NXCA 1NK6A 2ZNYA 1UL3A 2GIQA 3PO5A 2HAFA 1NDCA 2CQPA 3MECB 4OLOA 3GIJA 4PWDA 5AE1A 2V4QA 4X4QA 4ZVPB 3OR2B 4GKJF 2W8LA 1FWKA 1TV6A 3CD0A 4IFYA 3TEHB 4USMA 2P9CA 2QFIA 1ZAVA 3TVZA 1LFPA 1CQMA 5L9NA 1PAEX 3GG0A 3ZZPA 4NA2A 3IRXA 2HFZA 3AQPA 1MROB 1J5OB 5LSOA 3BN4A 2Z2ZA 1YBUA 1WG5A 1LNQA 4A8OA 5C42A 2XZTB 3HT3A 1TVRA 4GVBB 2OPRA 2WVCA 1LXNA 2N3OA 2GMJA 1CEZA 2JLGA 4Y2KA 4DR3J 4DI6A 3TRGA 4CO1A 4GKKJ 3UCZP 1UTAA 4ED6A 3NNAA 3Q23A 4JI5J 1NPRA 4WYLA 3KG1A 3NS5A 2NQPA 3RAMA 4MKAA 3ZZRA 4DV5F 2QA4S 5JJBA 4I67A 2NCKL 3OSPA 2FJDB 1PYTA 3CJSA 4CO2A 5KFBA 2IM0A 3EXCX 3EVMA 4DPUA 1S48A 1H7XA 4NZ7A 2CNOB 4NXMF 3KLFB 4DV6F 2MZJA 2YNIB 4OQJA 5GAEI 1KS2A 4CO3A 1AYEA 2IYIA 5GADI 2G9OA 2HVEA 3FNNA 3K5MA 2WK4A 1YK9A 3NWRA 1ZM4A 1KBRA 3SCIE 2FQQB 1FKPB 3AB4B 5GAHU 3PKMA 3CDAA 3DLBA 1VQPS 2KN4A 2CPFA 3FGVA 2HNDB 3A8JA 3R5BA 5HI7A 4P2XA 5BYRA 3E01B 1YJUA 2AJQA 3Q24A 4P2MA 5ETTA 1QLNA 5HROA 2QL7B 2ASYA 1RBOB 1I1GA 4JYAJ 4I2QB 2JJ4D 4QPTA 4LREA 2DIUA 4B9UA 1LKZA 2BKOA 1V6HA 2WCXA 3W2VB 2AF6A 3FRYA 5D77A 3QLHB 2HGNA 2RRAA 3V5RA 4WTOB 4RWXA 2WVDA 4AUKA 3PW4A 2A10A 1UVIA 4Y2IA 5KG6A 1RAAB 4QPXA 2ABYA 2HBZB 3R7SB 4NLPA 1RU2A 3HSDA 4OLPA 2LA6A 3IA0A 3UDEA 4DQPA 1P1TA 3QJPA 3M9NB 3CIZA 3Q2SC 2O5DA 3FZBA 2Z2YB 3PJWA 4ZLNA 1WKJA 4DWIA 4RBVA 5HVFA 1T9XA 5F3ZA 2WONA 1OMSA 2J6UA 4D3GA 5KT6A 2MQMA 3BQ2A 5IWAF 3CCLS 1NK4A 4ES1A 1RXOB 3R5GA 3VR1A 4P2SA 4LF7F 3JAMU 3TW0A 2UVWA 3Q8VA 5CCLA 4ZHRA 3GIKA 4OJHA 5F0WA 4RW9A 2VUGA 1RUSA 1R8HA 2KYXA 2QT7A 4FF4A 4BC7A 3FVYA 2DVIA 1EIYB 1YDLA 2SXLA 4DHVA 2HWIA 5A8RB 1XMOJ 1L3KA 2J9DE 3AB2B 4ILLA 4XPEA 2XB2D 2LXFA 4B9VA 4M5GA 3FFIB 1P9YA 1KTVA 2ERRA 3N4WA 4LJMA 4OX7A 4CLYA 3GWCA 5L9XA 4ZMMA 1HWLA 5HP1B 3BSCA 3LAKA 3PX0A 1S0VA 3KJVA 2J0SD 2H65B 1N0VC 2KM8B 4DV0J 2ZH8A 3G6YA 2W2OP 2G1HA 2UZAA 1HMVB 3MPWA 1VR6A 4B9TA 2CG4A 4NE9C 1IWGA 2HK2A 2G1DA 4JI3J 4LBIA 3DI6B 4ETZA 1X4CA 3ZNJ1 1NK0A 2NPFA 3CC2S 5B0GA 3GYNA 3VVTA 5J2QB 1TMJA 1S0OA 1VQ5S 2W2NP 1E6VB 2WVEA 1VQ9S 1VLYA 3CMAS 3MR6A 1RHKB 4JP8A 4F04B 1XK8A 4ZLPA 3X1LB 4ELVA 1N5YB 1RABB 4M5DA 2IAJA 2B9EA 1HD1A 1S7IA 5AXKA 2DO0A 4AD6A 4G1IA 4ZIWA 4ZK7M 3ISZA 3F41A 2X1AA 5GMKa 1SXLA 4NLWA 3ISNC 4J9RA 1KRPA 4LF6F 3KLIA 4GVLA 4YB6A 4ECRA 3FQLA 4YY3J 4I6YA 3DRRA 1T11A 3QIPA 2QMUB 3MUVP 2Q43A 1NKEA 2C2RA 3EUNA 1N88A 1EKRA 3HT0A 4XDDA 4CTAB 1AT1B 1VHIA 4M8LA 4EMDA 4DSJA 4LSLA 1QAYA 5C25B 1RA7A 4HACB 5DS7A 3CJ3A 4OYIA 4EZ9A 2R8JA 4HH1A 2WRMA 2OD6A 4DFJA 1S49A 4LQ3A 3QZ7A 5F8NA 1KVKA 1WEXA 1FO1A 4J37A 4QWCA 3QGPA 2V63A 5G0RA 4QU7A 3IP0A 4F25A 2G2YA 1NZ8A 4QZVB 1VC5A 1EB0A 2X1GA 3H2UB 4PG6A 4RNHA 3NMAA 2WZ1A 5J2MB 1Q7LB 1MU2B 2VQFJ 2E5HA 3DFEA 4KIAA 3NGSA 2ZHAA 1BD6A 3HULA 2W2MP 5F3TA 1Q8BA 2VOOA 3K59A 1UW4A 4IH5A 3BR9A 1J2VA 2CAJA 1N5TA 3QATA 3PYDA 2GA7A 2EFOA 2M4MA 2HZAA 4A8QA 5HO4A 4LFCJ 3I0RA 2MDAA 2K3KA 1N36F 4NZ6A 3I56S 1C0UA 3DC2A 2XWYA 2GHPA 3J7A1 4Y65A 3PFEA 2P6TA 2YWKA 4ZVQB 1OYDA 3BO2A 2W4CA 1HWIA 3OD2A 2C42A 2XGPA 1UJ5A 1CBKA 4Y2MA 3CMQA 4TYAA 2K1RA 2YNFB 1S1UB 2W4PA 4AQYF 4DLEA 2R2RA 2C1EB 3X3UA 4JI7F 4DFMA 3NAHA 3OL7A 2GNKA 3BN7A 4B3OB 5HN0A 4ER8A 4RW7A 2VKRA 2RILA 2HWHA 2WW8A 1XC9A 3MM6A 4C97A 1K0TA 3MEEA 1QSYA 1XR6A 3QIDA 4P52A 3W3SA 4H4KC 1HQEA 5CD4H 3HKWA 3IAS9 3JQMA 1NO8A 1R43A 4H4MA 5KFEA 4F3OA 3ENWA 1YRTA 2YPZA 5KFCA 5AXNA 4J9UE 1HPZA 4KKOB 2EW9A 4C48A 5T7LB 4F0MA 1C4CA 3VAIA 5J2NA 2HZCA 4DN9A 3WZ0A 5IOLA 3BV8A 1MMDA 3KMSA 2XMKA 3CXCR 2HQFA 3VVUA 2GJFA 1FHTA 2WTFA 3HHKA 4OJ3A 3MURP 3HSGA 4P9SA 4AXIA 1HNWF 4ID5B 4NRTA 3JSYA 3QAUA 2DHGA 2JDJA 4DV4J 2ROEA 3DYAB 3NBPA 4H4KA 4KJIA 3UFCX 2DK2A 1Z2LA 3ET6B 2ZJPQ 5J1EB 4UQTA 1TFYA 3R2DJ 4IDKB 4F7VA 4OZ5A 1OSDA 4RBTA 2D9PA 3G96A 4KRWA 2R3VA 2HRTA 3GE9A 3VAJA 2PEHA 3MM7B 1BLUA 2O1PA 1UFKA 1SJRA 3G9CA 4DS4A 4NLTA 3Q86A 3GYGA 1WG1A 2VPYB 3CCQS 3MECA 1IVZA 2P6SA 3SFUA 1OS5A 3NCRA 4WP3A 5C2CA 1NSQA 4I4BA 4ZOSA 3QBCA 4LIRA 4KV8B 3UO0A 3W8GA 2BV3A 5IM0A 3HHEA 4C8ZA 4FN5A 4M94A 4DR7J 3THTA 2CNNB 3EJMA 1IBKF 4DG1B 4P72A 1ZM3A 2UUTA 2GFFA 3ONQA 2Y1JA 2RRBA 1JNRB 4O23A 1Q81T 2HNYA 1J5OA 2FB0A 3EYZA 2Y1LB 4C3MA 4DMZA 1IBMJ 2Z56B 4GVBA 1FXRA 4U9RA 4YQWA 1DZ5A 5DM7Q 4HVZA 4ZLLA 1Q53A 1NSPA 4O4GA 1YBAA 2W2QP 5FLXY 2NYHA 3DLJA 2CQ3A 3TAMB 2Q6BA 4X62F 3HVTA 2QN6B 1JLAA 4A8XA 2DT9A 4LFBJ 3TUJC 3DLKB 3RBXA 3TUIC 2KFNA 1IBLF 2Z4PA 4NCBA 3EDRB 3IN5A 1R8BA 3VGTA 1AUDA 1CG2A 1YBTA 4IOAQ 4FBTA 2DNQA 3J80Y 3CCJS 3MMBA 3KK3B 1YVFA 3OTOF 2VH7A 1JLFB 2MQ8A 2Q66A 4K4ZA 5KG1A 1KLMB 3M8ZA 1W25A 4W98A 3TNVA 3BGRB 1NJXA 3T1HF 3W5ZA 2BBEA 2AJ1A 4K0KJ 1RAOA 2JEFA 4LF9F 9ATCB 4WP9A 3DDIA 1FKPA 4OYBA 3WQPA 3VAMA 3SDEA 4URGA 2BJDA 5KFVA 4B3RJ 1KFDA 5HK4A 1WOSA 4DV2F 2VD3A 4C3KA 1Q82T 2HNDA 5F8IA 2ZH6A 2CWXA 4WF9Q 3ZXWA 3OL6A 3RW7A 1LK5A 1UVMA 2RS8A 5KT2A 2HQDA 4DBQA 4LSNB 2V6AA 4MFBB 3T5LA 5ETOA 1DLOA 4W90B 3KLEA 2RDJA 1FI4A 2D3O1 3H90A 2YY3A 1JLCB 3M8QB 2R42A 2D3UA 2CQBA 4PEOA 4PUOB 1JJ2R 3QO9A 2I2YA 2NSCA 2OLWA 2KTQA 4DUYF 3RB6A 3QSIA 1TKTB 2FVCA 4OZNA 2HFVA 1UZDA 1CPZA 3CNQP 1YRUA 1LW0B 4X4OA 4PQUA 1JX4A 1S1WB 2Q79A 5IS2A 2FGOA 2QJ3A 5GAHI 3W64A 2H9ZA 4ZCIA 1F9EB 1A6LA 4RZRA 1OJ4A 1FE4A 5I42B 3FBFA 1QD1A 5B08A 1NB2A 2DNHA 4LBHA 4C8LA 5IT4A 1M5SA 1ZM2A 1WG4A 5K9FA 4JI2F 1RTIB 4ES3A 4WYWA 1NHVA 1VIOA 1RKJA 2M7SA 5DZ7A 2IA0A 3UWTA 2BYCA 4NPOA 1ZA2B 1CQNA 2OFHX 2OPPB 2HW3A 1X9MA 4ZP8A 1TMMA 4N47A 5LMNJ 4TNOA 4WP8A 1HNXF 4C0OC 2XY5A 1VK3A 1YJRA 2HFOA 2XULA 2ZOMA 2H3EB 1X4FA 1JLEA 1VC6A 4DZ6A 2H4YB 1JB0C 4B17A 4O0NA 3H8YA 2H1YA 1D09B 3ZZ0A 3ISND 4NLVA 3OJSA 1NJYA 2FC9A 2F4FA 2E7VA 1LW2B 2QSWA 2IPOB 1MWYA 4Z2XA 5HP1A 1XNRF 5T14A 3B78A 4QR2A 4OZ3A 1I5OB 1R8CA 3DKDA 3D5MA 4DDFA 1A7GE 3H98A 4GKJJ 1JJCB 2CPHA 1NDKA 3OFHA 3NAIA 3DI6A 1NDLA 2YKNB 2N4CA 2YXLA 1TAUA 4JUZA 3VV2B 3VF0B 4RL1A 1XMQF 4ANCA 5K20B 3J7ZT 1E6VA 2R7WA 1KN6A 1H6KX 3RB4A 1N5YA 4ZA1A 3VTIA 4K2JA 5FJ4A 2LQBA 1CS4A 2QG9B 4X4NA 3PRBA 1KHVA 3L95X 3IBCB 1N0UA 4IOBA 3SFGA 3R5DA 2VOPA 3M2RA 4J9PA 3HZEA 3IM8A 2BJ3A 2MTLA 2KRBA 2KDOA 3RRKA 1HYSA 4DV5J 2BJ7A 3M4XA 4ITSA 2RH3A 1RHQB 1FT8A 1SC1B 3V4MA
chains in the Genus database with same CATH topology
2FYXA 2EC2A 2VJVA 2XQCA 4ER8A 2VHGA 2F4FA 2XO6A 2F5GA 2VICA 2VIHA 2XM3A 2VJUA 2A6OA 2XMAA 2A6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYX A;  2EC2 A;  2VJV A;  2XQC A;  4ER8 A;  2VHG A;  2F4F A;  2XO6 A;  2F5G A;  2VIC A;  2VIH A;  2XM3 A;  2VJU A;  2A6O A;  2XMA A;  2A6M A; 
#chains in the Genus database with same CATH topology
 2A3J A;  4QIE A;  5GMD A;  4AXJ A;  3Q8Q B;  2KG1 A;  3EIC A;  2D7S A;  3ZO7 A;  3D1H A;  1U1N A;  3I4H X;  4NYP A;  4ZP7 A;  1LWF B;  4Y6I A;  5C25 A;  4G3I A;  4U8Y A;  2IMO A;  2J7W A;  3E51 A;  2HQC A;  2ZVS A;  1FFG B;  3KMQ A;  3B8H A;  3M6W A;  3J7A N;  3DOM B;  3ZC4 A;  5BR8 F;  2MB0 B;  4JBC A;  1S76 D;  3T5H A;  4Q44 A;  1GTE A;  1S5Z A;  4CYU B;  3OLA A;  4DV1 J;  2NLW A;  3I5C A;  2VL1 A;  4ILM A;  5J2M A;  4B08 A;  2BRK A;  3WIU A;  4YOE A;  4IUF A;  5KFF A;  2CVE A;  2IDL A;  2ZD1 A;  3OTE A;  2VC1 A;  1MWZ A;  3MM5 B;  1NSA A;  2LXU A;  2FVQ A;  2LVW A;  3I9Z A;  4X84 A;  3FSY A;  4OHZ A;  5FDL B;  3OVB A;  2ACM A;  2VJV A;  4K50 A;  1FK9 B;  1NDP A;  2BR0 A;  3C16 A;  3LPE A;  4OYM A;  2K06 A;  2E44 A;  5CYM B;  5IT0 A;  2C3Y A;  4HHH A;  3O5T B;  1T9T A;  1YJ7 A;  2R2S A;  5CZX A;  5E33 A;  2CQD A;  1U1M A;  2BE7 D;  1YIJ S;  2DR5 A;  3PV8 A;  8ATC B;  3MTK A;  1V3S A;  2GQC A;  2MQP A;  3O44 A;  4NA3 A;  5KT3 A;  5KFQ A;  3LP0 B;  2DJW A;  2V8G A;  1SVD A;  2BA9 A;  2FJW A;  4DEZ A;  3OFE A;  4Y2A A;  5E3C A;  4UZC A;  1H38 A;  1Y3K A;  2KT2 A;  4X65 J;  1YSJ A;  1ZZN A;  4F36 A;  4M5M A;  1M5P C;  1FD2 A;  1PJ6 A;  3NGU A;  3HM9 A;  1FRI A;  4U7U D;  3G86 A;  4LF7 J;  2AJ4 A;  4K5R A;  5D6G A;  4LF1 A;  2V9K A;  3D9B A;  1K8A T;  4PR6 A;  4K2X A;  3BR8 A;  3VQT A;  1IJE B;  3NXZ A;  1IM4 A;  1GAO A;  3NOC A;  4DR4 F;  3AXK A;  2M88 A;  4PYA A;  2AGO A;  2B4V A;  1PJ5 A;  1QE1 A;  2J9C A;  4CO5 A;  3LA0 A;  2DRD A;  4WPA A;  2F63 A;  3BSN A;  3MMC A;  2MKH A;  3QRP A;  1MWQ A;  3UN3 A;  5IXU A;  2Z57 B;  3W2W A;  2OJ3 A;  2DGS A;  2Q6C A;  4UTG A;  4FXD A;  3P5T L;  5D4N A;  3ET6 A;  2KVI A;  5J1E A;  1C4A A;  3C66 A;  4IDK A;  3EWG A;  2KJW A;  3RGI A;  4GO7 X;  4MJK A;  4DZD A;  4LIW A;  2A1B A;  4ED5 A;  4QU6 A;  4PRF A;  3CCT A;  2QMX A;  5L1L A;  2J6T A;  3MM7 A;  2XNR A;  2W7A A;  4X2B A;  1TK0 A;  1GMV A;  1FWL A;  1PBA A;  2QLW A;  5AE2 A;  3E3X A;  2JWN A;  5LSR A;  2OIH A;  5CZV A;  2N82 B;  4RX6 A;  1RT4 B;  1R8A A;  1G6B A;  2F40 A;  4KV8 A;  4FYY B;  1FRK A;  1FRH A;  2MKK A;  2LEP A;  4KHM A;  1CJU A;  5B0D A;  5AJ3 J;  1KD1 T;  4ZVH A;  5JVH Q;  2R8H A;  4KPC A;  4URS A;  1F5A A;  2P5V A;  5J1N A;  3T5J A;  5DZ6 A;  1EET B;  4DS5 A;  4B3T F;  2JSX A;  2QYG A;  5DET A;  2VC0 A;  2CJB A;  1DJ0 A;  1J5E F;  4DSL A;  2J76 E;  5ETN A;  1FNO A;  2XS2 A;  4NLR A;  1TU0 B;  5K8O A;  5EWE A;  1S7H A;  3TR5 A;  4QOT A;  3TAM A;  4NYO A;  1NCL A;  3GG1 A;  2UVV A;  3DMJ B;  2MSS A;  1S57 A;  2AJ0 A;  2DNR A;  4P10 A;  4EBD A;  3SCJ E;  1VQM S;  3C15 B;  4X4R A;  2KT5 A;  1VQL S;  1UA1 A;  1OY6 A;  3BO4 A;  4O3N A;  2ZNZ A;  1SJ4 P;  1TFW A;  3MFH A;  4GC7 A;  3KK3 A;  3TAQ A;  4UOH A;  2OPS A;  2E5J A;  2IVF B;  1U6F A;  2WOM B;  5DDQ C;  2E1R A;  3NNH A;  2FY1 A;  1KLM A;  3WHI A;  3BGR A;  4ED2 A;  2RVJ A;  3M7V A;  2HFN A;  2XCA A;  2CPX A;  1WTF A;  4DL2 A;  4UST A;  1Q1K A;  2CNK B;  4C8M A;  1GX6 A;  5A8W B;  4EEY A;  2KVQ E;  1X4A A;  1U7L A;  1WD6 A;  2ZOF A;  1SKW A;  2F7V A;  2ZWP A;  3NGT A;  4LF4 J;  3CW2 C;  1SV5 B;  3GV7 B;  1HL6 A;  1WWH A;  3MTJ A;  2WB4 A;  4GKK F;  3TJA A;  1RI7 A;  1T9Y A;  4JI5 F;  5CAA A;  4HI2 A;  2XBP A;  1B4S A;  4EZ6 A;  4I1T A;  1MG7 A;  3V4I B;  2KHD A;  4L3K A;  2WAQ D;  4LSN A;  1N5S A;  3FBC A;  1QSL A;  2OSR A;  1SQG A;  7AT1 B;  3TP2 A;  4OHX A;  3PJX A;  5M2U A;  2QLX A;  4FNH A;  4QIF A;  4TN2 A;  3BQ0 A;  2GX8 A;  3ILO A;  3M8Q A;  4AL5 A;  1V3R A;  3J7Z 5;  5LXY A;  3GFX A;  4PUO A;  4ID8 A;  1UWB B;  2EFN A;  4A8S A;  3AY0 A;  4LT6 A;  5EWG A;  2MLZ A;  3MM8 A;  1OY8 A;  2YWF A;  2XYG B;  3RW6 A;  4JI7 J;  3PCO B;  4EBC A;  2KXF A;  3THV A;  4C7Q A;  3W63 A;  3QT8 A;  2KL8 A;  2UV8 A;  2N3L A;  5BYQ A;  3BB5 A;  1D8Z A;  4L73 A;  3D3B J;  5EX3 A;  1EHW A;  3PNI A;  4EI2 A;  3B4D A;  2B3T B;  1RTD B;  1KVI A;  4XO0 A;  2ZZN A;  4ZPB A;  1RT3 B;  4RW8 B;  3RAQ A;  3OSN A;  4I68 A;  4O44 A;  4JYA F;  2OSQ A;  5EGY A;  5KG5 A;  4OIX A;  4PWW A;  3GV5 B;  4DPO A;  1S12 A;  3K89 A;  1VQO S;  3AJ1 A;  3U02 A;  2M2B A;  4FKX A;  5DG9 A;  2B7B B;  3E8O A;  2R8G A;  1HNI B;  2WVF A;  3AT1 B;  3KNG A;  5SUH A;  4KFB A;  1KR4 A;  3HJF A;  3K57 A;  2LU2 A;  5U47 A;  1FES A;  3DU5 A;  3LP1 B;  1B64 A;  3O2I A;  4QYZ K;  1JLG A;  3OQ2 A;  2GVZ B;  4W4M A;  1VJQ A;  3DM2 B;  1VRU A;  2Y9H A;  3HDS A;  4QW8 A;  4NX9 A;  4TY8 B;  1ROF A;  3UNG C;  1RT1 B;  2E66 A;  3OHB A;  5ETM A;  1GQE A;  2M52 A;  3J7Y U;  2VU5 A;  2MKY A;  3ENQ A;  1F9F A;  3TA2 A;  3ELH A;  4OX8 A;  3NNC A;  3MPY A;  4C0B A;  5KFW A;  4GC6 A;  1MMN A;  2L48 A;  2XSJ B;  2MQO A;  3CJ2 A;  4C9D A;  3IGV A;  1SJF A;  2B9W A;  2AW0 A;  3ZZU A;  3RAX A;  3T9Z A;  1L3V A;  1H3D A;  3UI3 A;  4M5L A;  2YKN A;  3MZI A;  2QTW A;  2F3J A;  2EK1 A;  3OTB A;  5IT9 Y;  3Q89 A;  2KU7 A;  1FRL A;  4TXS A;  3QQC D;  1SJ3 P;  3Q8S B;  3OT9 A;  4DLG A;  3MPD A;  1JKH B;  2EFG A;  3AOD A;  1CSJ A;  4WIQ A;  4ECQ A;  1TUW A;  4LR8 A;  2LDY A;  4H4O B;  3S01 A;  4DPY A;  4BDP A;  1N32 J;  2F5G A;  4RUC A;  4X62 J;  4R0E A;  5D15 A;  2CJY B;  3IS9 B;  2XGQ A;  2VBY A;  3UD3 P;  2VFT A;  1IBL J;  4OYP A;  1UVN A;  1FE0 A;  4DV0 F;  2UXD F;  1RJJ A;  3RTV A;  3MR5 A;  4DF8 A;  4M5N A;  4LRD A;  8RUC A;  3N9U C;  5A0Y A;  2ZBI A;  1KC8 T;  3BPS P;  4IFY B;  4QWE A;  2GO9 A;  2QYC A;  2NR0 A;  1WOP A;  5T41 A;  2WBM A;  3N0V A;  4WWS A;  1LWF A;  4Q2M A;  3IRX B;  3H5S A;  3HPO A;  3GCW P;  4ZJL A;  3DOM A;  4LMZ A;  1CC8 A;  1H0H B;  1WHW A;  4LF9 J;  5C42 B;  1TVR B;  1RLC L;  1ZTT A;  4KSE B;  1SJ1 A;  2QL5 B;  4CYU A;  1T9V A;  3KLH A;  2OML A;  4OMF G;  4DV2 J;  2R2T A;  5JUM A;  2HS0 A;  3NOG A;  3UW1 A;  2LP4 A;  1HBM A;  5HQ8 A;  1U2R A;  4ZPV R;  1B99 A;  1KQS R;  1GT8 A;  3MM5 A;  3MMA A;  4U95 A;  1VJW A;  2RUS A;  4NAS A;  3THP A;  2CWK A;  3PVX A;  4M5I A;  5FDL A;  2ZHO A;  3PW2 A;  2AEJ A;  2HHU A;  3HXM A;  2AYE A;  2UVU A;  4EFA C;  4DU8 A;  4NEY A;  2JH3 A;  4AE5 A;  2MEW A;  2ZBR A;  4BBY A;  3J81 U;  5CYM A;  2OEM A;  4I7F B;  1BQX A;  1WDD A;  2MQN A;  1KEK A;  4Q0B B;  1HI0 P;  1B0P A;  3BJY A;  2CG8 A;  5LT5 A;  1O8B A;  1FTC A;  4P2F A;  4YS2 A;  3BS9 A;  3T19 A;  5THW A;  4USV A;  3DGP A;  2B9X A;  2GGP A;  1BXN A;  1MNE A;  2WBR A;  4CLU A;  4QCL A;  2XYP B;  2VKZ G;  1XEZ A;  3RYL A;  2VQF F;  1EAY C;  1SC4 B;  1NJW A;  2RKI A;  3JXO A;  1N5Q A;  1GXU A;  5L1J A;  4OI1 A;  1ZPW X;  2GS8 A;  3A8K A;  4JI2 J;  2MST A;  1RBA A;  2FZG B;  3T1A A;  2BKN A;  1JJH A;  3MMJ A;  3TQ1 A;  4OI4 A;  3H5X A;  4F4A A;  4LFC F;  2QRR A;  1HNX J;  3BGU A;  1K0V A;  2HVH A;  3W62 A;  2ZC4 A;  5IV4 A;  4ZVO B;  3DLG B;  2W8K A;  1KKH A;  3T6J A;  4CO4 A;  4DSF A;  5IC6 B;  3CJK B;  5KFO A;  4EYH B;  4DSE A;  2XSF A;  4ZKA A;  2R8K A;  3I0S A;  2AT1 B;  3NGR A;  1YG0 A;  4OJ1 A;  3MGJ A;  3IBW A;  3CDE A;  1B0V A;  2MZ1 A;  4QWB A;  1AZS A;  3K8W A;  4JOU A;  3RJM B;  5FD1 A;  1Y11 A;  4FYX B;  4NXN F;  3KTQ A;  4K4S A;  3CJR A;  1Q86 T;  1XNR J;  1GNK A;  4DL0 C;  3H20 A;  1CJK A;  3GJQ B;  3SV3 A;  2VA3 A;  4UUW A;  5J2P B;  4NL5 A;  1P6T A;  1XNQ F;  4ENO A;  1V5V A;  2PT0 A;  2FIU A;  5AE3 A;  4O0I A;  3MF5 A;  2Y1I A;  4O3R A;  4S0M A;  1TL3 B;  2NUU G;  4V19 X;  1HA1 A;  3DRX A;  3K8V A;  1FTR A;  2VF3 A;  4ZHR B;  3CF5 Q;  4LRF A;  2IRY A;  3MHY A;  4F4W A;  4RW9 B;  3GR0 A;  3N6N A;  1U1O A;  1TQL A;  1D8Y A;  5KFD A;  1PC5 A;  1FVS A;  4IG3 B;  1URR A;  2C2O B;  5K5M A;  4F26 A;  4TLR A;  3MD3 A;  1LWX A;  4USU A;  1NEE A;  4IFV A;  3C2P A;  3FMB A;  1DTQ A;  2OTL S;  1KP6 A;  1EET A;  3PRV A;  4DR1 J;  3H0P A;  4RNO A;  3D28 A;  2ZKT A;  4EK2 A;  4DV4 F;  2PA8 D;  1ZM9 A;  1WC3 A;  3VWS A;  3TAN A;  1LEO A;  1FKO A;  3P96 A;  3D6F B;  1RZM A;  2MHE A;  4G6V B;  4L3N A;  2CVI A;  3RRH A;  3W65 A;  1Q8I A;  3S1T A;  3D4J A;  4BCA A;  4TLQ A;  5K8N A;  3SV4 A;  3TZX A;  1NBE B;  3DU6 A;  5HMX A;  2HIQ A;  3MD1 A;  3AD7 C;  1Q16 B;  4DL7 A;  3C46 A;  1FDN A;  4YB5 A;  4PG7 A;  4PPZ A;  5C7P A;  1QM9 A;  2RUG A;  4PCQ A;  1Y5N B;  4AT1 B;  2KYZ A;  3R9L A;  4Y0F A;  2CJX B;  4CT8 A;  5D0G A;  2WOM A;  1C1C A;  2ZC3 A;  3FQK A;  4DR7 F;  2AWZ A;  4U96 A;  2VG6 A;  3D6M B;  2N7C A;  1HD0 A;  3IG1 A;  1AFI A;  1HW9 A;  2M5Y A;  3VAL A;  4M5D B;  4DQR A;  3A4T A;  2MJU A;  2HHW A;  1U1R A;  4KY3 A;  3TI0 A;  3R6L B;  4DUZ J;  4N76 A;  2DGV A;  2FPH X;  2O67 A;  3D66 A;  2HEK A;  2YQ0 A;  3GTY X;  2OI2 A;  2NZ4 A;  1RWN B;  2IM2 A;  3UR0 A;  2NXU A;  2GV1 A;  3CB4 A;  3HF5 A;  2LA4 A;  3T3F A;  3KNA A;  1SV5 A;  2V8H A;  1B3T A;  4RUB A;  3L4B C;  2V68 A;  3AD8 C;  3KKF A;  2PN6 A;  3HHL C;  1M90 T;  4FNI A;  4FXV A;  1D0E A;  1YJW S;  3PFO A;  1OY9 A;  2KB2 A;  3OXG A;  2HQ3 A;  2BAN A;  2HGM A;  5B09 A;  2JL9 A;  2XI2 A;  5AT1 B;  2CDQ A;  2PD1 A;  1VCT A;  2YBV A;  3BBC A;  2GJI A;  3DDK A;  2QL9 B;  1M1H A;  5G0R B;  2QO3 A;  2A6M A;  3QGI A;  2OFG X;  5KT7 A;  4KGV B;  1F2H A;  3HHL A;  4C6A A;  3OL8 A;  1X5T A;  3CED A;  5HMY A;  2ASD A;  5HMZ A;  2VBW A;  5IT9 U;  2M9K A;  4MKV A;  1YZ7 A;  2X3G A;  3POT A;  2BAB A;  1I6J A;  3H5Y A;  1Y7P A;  2D3Z A;  3QAE A;  3UE2 A;  4P71 A;  5E0O A;  1YKW A;  3PM9 A;  3GMG A;  4OX6 A;  5KTQ A;  2H51 B;  1RWK B;  1RTD A;  4IKA A;  2CPE A;  3MEK A;  2XLK A;  3I0R B;  4F2S A;  1RT3 A;  3CUL A;  4RW8 A;  1M1G A;  1C0U B;  2MZR A;  3KG0 A;  4C4W A;  3JQK A;  1ZAX A;  1KQF B;  3H4B A;  3LWM A;  3CCV S;  4LF5 J;  3R5J B;  4DR4 J;  1UCN A;  4ED3 A;  1WEY A;  5DLF A;  4EUV A;  2ZEJ A;  3BKT A;  3QZ8 A;  3AA8 A;  4A4J A;  2K1R B;  4YDD B;  5E2Q A;  2DPJ A;  3BYP A;  5KFG A;  2WVB A;  2RU3 A;  4YR0 A;  3LP1 A;  4O4R A;  4RO0 A;  2P9E A;  3P49 B;  3TYT A;  1WHX A;  5L1I A;  3MM6 B;  4WFB Q;  3HFV A;  5KG0 A;  3IMQ J;  1HBU B;  3KLG B;  4R8U A;  2ZKU A;  4ZVU B;  1RT1 A;  3DOK B;  2FJB B;  3CDU A;  5BXI A;  2XC9 A;  2E5L F;  2DYA A;  4H4M B;  4A46 A;  3PG9 A;  2NPI A;  1HPZ B;  2F8M A;  1K1S A;  4BLG A;  3KXD A;  5J2N B;  2XSJ A;  2GIR A;  4C0H A;  1BHN A;  1SUQ B;  5LMN F;  3CVK A;  3P5B P;  3LW5 C;  4QYZ J;  3SI8 A;  1HBN A;  3S6E A;  2E1C A;  5CYQ A;  1CVJ A;  3LF0 A;  3W61 A;  4NI2 A;  3QFW A;  3KUE A;  4MIW A;  1RB0 A;  4WK1 A;  4WJB A;  3Q0A A;  2C2Z B;  4X4V A;  1TKZ A;  2X7I A;  2BDP A;  3PR5 B;  3ZZT A;  2ZH7 A;  4Z7Y A;  2ZUA A;  2J0W A;  1RHJ B;  1JKH A;  1PAU B;  1UET A;  2UUB J;  3CC7 S;  2VFV A;  4PAB A;  2OGU A;  2ZWO A;  2YQ3 A;  1Q5Y A;  1T8E A;  4H4O A;  3BDP A;  2W4D A;  2AZ1 A;  1ZTW A;  2XZW A;  2ZE2 A;  2HNZ A;  2E7W A;  3IS9 A;  3LAN A;  1YX2 A;  1WSR A;  3M2V B;  2DR8 A;  5H9F K;  4X64 J;  4J9N A;  2VAS A;  2IRX A;  2L9D A;  2B8Q A;  1FDA A;  5IM0 B;  3F56 A;  4WKY A;  4C2M A;  5HBM B;  2DGT A;  3UPF A;  5JMN A;  1RWP B;  2FZC B;  1VRT B;  2V2Q A;  1U1K A;  3W9J A;  4CLZ A;  1LK7 A;  4DSI A;  4FBU A;  4F4K A;  2VFR A;  2HNY B;  1YZ6 A;  2ZDO A;  4M95 A;  2H5I B;  3SYZ A;  1A0O B;  2RT3 A;  3FDS A;  4LF8 J;  1K47 A;  3BBB A;  3EXY A;  1FCA A;  3GON A;  4O4G B;  4CZC A;  4WKR A;  1H72 C;  1FFW B;  4ZIV A;  5A6P A;  4XIU A;  1Q79 A;  1S9G B;  1RAF B;  1JXL A;  3G6E S;  3QNW B;  5KFX A;  3V6D A;  3HVT B;  1JLA B;  3QT5 A;  4YHH J;  5DQI A;  3I96 A;  4X4U A;  2IBK A;  3W1Y C;  1VQK S;  5LOQ A;  3MMB B;  5CAB A;  2UXC J;  3EGN A;  4CIO A;  5AXM A;  2DEJ A;  3V2U C;  1X31 C;  3MUT P;  3IR5 B;  1D1U A;  1ZPV A;  3NP5 A;  4OZ0 A;  4I7F A;  3L7U A;  2LYV A;  4USI A;  4Q0B A;  3R97 A;  2DBB A;  5HQM A;  4DR6 F;  2R7V A;  5F8G A;  1Y10 A;  4DL6 A;  2HYI B;  1IJF B;  1I3O B;  1S1T B;  3BZQ A;  3A8E A;  2PMW A;  2E5G A;  1GEH A;  2RAQ A;  3SDE B;  3PYG A;  2L3M A;  4DV1 F;  3CC4 S;  3CCR S;  4ELU A;  2RQC A;  4ECS A;  1XR7 A;  3CE8 A;  3SBM A;  2DPI A;  4K8R A;  2YWH A;  3CJT A;  1N6Q B;  2YWW A;  2VV5 A;  3LGN A;  2XLJ A;  4V1A k;  1ZA1 B;  4M5H A;  5IQQ A;  4QWA A;  4WFX A;  4ZPA A;  1RP5 A;  3MCO A;  1GTH A;  3S8S A;  1I51 B;  1SH2 A;  2XMJ A;  4JI6 J;  5IV3 A;  2M0G B;  1W26 A;  4C11 B;  2W9A A;  3FCH A;  1DLO B;  2EPI A;  3QYY A;  4P75 A;  3D67 A;  2HVI A;  2GIF A;  3KLE B;  2EFQ A;  2L08 A;  2D1C A;  4I56 A;  1YJ9 S;  3DRP A;  4E8U A;  2Y3Y A;  4ECY A;  3HFK A;  3NMR A;  2HPU A;  3QO9 B;  4PG8 A;  2K3I A;  4Q45 A;  2P9G A;  3DLG A;  1YJV A;  5HLF A;  1ITP A;  3CJK A;  4E2F B;  2HGL A;  1YI2 S;  5D4L A;  4PQU B;  5IC4 B;  2JHE A;  1XBW A;  4IH6 A;  1MW7 A;  3TUZ C;  2CZV C;  3EZ5 A;  4HHU A;  3AJ2 A;  2G0I A;  4FXW A;  1CJV A;  4OYO A;  4RW4 A;  3O1L A;  2CZ9 A;  2MJN A;  1WUU A;  1T05 A;  4X65 F;  2CYY A;  4OYZ A;  1GXT A;  3IWL A;  5J2P A;  2VPZ B;  2HFU A;  3SSS A;  4J9O A;  3KDO A;  3IBF B;  3G82 A;  4RU9 A;  5KG3 A;  4CH7 A;  1TL3 A;  3GR1 A;  2PE8 A;  2WHO A;  3PW5 A;  3LGM A;  2AJ2 A;  3FKB A;  1U0S A;  2KT3 A;  3RZA A;  1X4H A;  2HBQ B;  2AGP A;  2LEA A;  1T03 A;  1O0P A;  3OFG A;  1PGZ A;  2VPW B;  3BF4 A;  4KGX B;  4IG3 A;  1HQU B;  2GQ2 A;  3ITH A;  1RBL A;  3JS9 A;  1VIX A;  1JLE B;  1QY7 A;  3IXQ A;  1FRM A;  2AYM A;  3LAL A;  2AYG A;  2CPJ A;  3N5F A;  2JC0 A;  1HNZ F;  2GQQ A;  5C5J A;  4R5P B;  3VHQ A;  1OQ6 A;  4CLW A;  2KHC A;  1QVG R;  2NS1 B;  3FBB A;  2E29 A;  3DOL B;  1VHF A;  1D9F A;  3PXG a;  1VBK A;  1QJH A;  5D3G B;  3HHL D;  1WAC A;  2E9R X;  3KOA A;  2C2M B;  2RQM A;  4CLL A;  2K2P A;  3NWG A;  4A8W A;  2UXD J;  1HWK A;  4FF2 A;  4PAA A;  2Z8Q A;  5IZH A;  2CQ0 A;  3T9N A;  3I9V 9;  1UA0 A;  2MQQ A;  1N33 J;  1NK5 A;  1SIW B;  4Z7C A;  4K4X A;  1NHU A;  4XTT A;  2BX6 A;  2IIH A;  3OVS A;  1UJ6 A;  4EWT A;  3GSI A;  1S77 D;  3D1Q A;  3QPI A;  2J0X A;  1ELO A;  5AJ3 F;  4QJV A;  4TY9 A;  4FDF A;  5ADZ A;  4QIW D;  1Q5V A;  1RTJ A;  2DEI A;  3MOZ A;  2FZK B;  2B0G A;  7FDR A;  4MK9 A;  1URN A;  1R3N A;  3MEG A;  1M0S A;  1CS4 B;  3BGL A;  3PO4 A;  1Q4R A;  1WTB A;  3BQ1 A;  3TZZ A;  5HAT A;  3Q8P B;  3M2R B;  2YX1 A;  2H4W B;  2HMI A;  2BW7 A;  2EKY A;  1HYS B;  2OUG A;  2LQ5 A;  2BOA A;  3H2L A;  1WEL A;  2PFF B;  5D4O A;  1GH8 A;  4JI0 F;  4LF2 A;  4RW6 A;  4WE1 B;  3O6Q A;  3D68 A;  1OSC A;  2EC0 A;  2EFP A;  4LSZ B;  4D3H A;  1FJ7 A;  3H42 A;  4OI6 A;  4IQX A;  1FEH A;  2V5H G;  1N56 A;  4M5J A;  4ZPW R;  2YPY A;  4DFK A;  4K4U A;  4DR5 J;  2XMM A;  1U25 A;  3A3P B;  3CO0 P;  2ILY A;  2F65 A;  2GMH A;  4FVC A;  1TUG B;  2MKI A;  3L09 A;  4KO0 A;  3A12 A;  2VG7 A;  3FC9 A;  4LF4 F;  5FII A;  1RU1 A;  4DV3 J;  2ZD1 B;  3CO9 A;  1X4G A;  4QYR A;  3ETM A;  1HIY A;  5A2Q U;  4PG4 A;  1IKX B;  1Y00 A;  4OI2 A;  3ILI A;  2X1B A;  2NXN A;  4OHY A;  4FYD A;  4ED4 A;  2CPZ A;  4DQI A;  3NGD A;  3W8P A;  3C16 B;  3MDF A;  2F9J A;  2GZO A;  4UT4 A;  5I3U A;  1IKY A;  4YFU A;  3FEZ A;  2ADC A;  2MYF A;  3L7P A;  1RAI B;  3RR7 A;  3FJ2 A;  3PEH A;  2MKJ A;  5K8P A;  2DNO A;  1V3Z A;  4DQQ A;  4RBU A;  3KWM A;  1AUS L;  1UP1 A;  1SB6 A;  4JV0 A;  4UOF A;  4AYB D;  4I0W A;  2DY9 A;  2JOQ A;  3TX0 A;  1WEZ A;  2YX4 A;  3JTN A;  3FSI A;  2QX0 A;  1JQG A;  2AD9 A;  2KXH A;  3KK1 B;  2UV8 G;  1PBU A;  1IN0 A;  3R2C J;  4NXN J;  2YNG B;  2PO4 A;  3FUY A;  1R89 A;  1N5V A;  3OR1 B;  5KAK A;  1UWA A;  4P74 A;  4RUA A;  1JLQ A;  1HBU A;  5GAG U;  3KJN B;  3KLG A;  1F9H A;  3V6H A;  5KFT A;  3DOK A;  1XNQ J;  5KFI A;  5ETR A;  1ZET A;  2V8V A;  5DQH A;  1T9U A;  1JXV A;  1U47 A;  3MOJ B;  3UVJ A;  2M3D A;  4WXW A;  1S4F A;  2G4B A;  4NLU A;  4E0D A;  1SUQ A;  1FRX A;  3D0G E;  3MAA A;  1PSD A;  1CUL A;  3MAH A;  1QE1 B;  6FD1 A;  4JI4 J;  4L74 A;  1AB8 A;  1EQM A;  5LSL A;  2AEM A;  3MMC B;  1ZH5 A;  2K7J A;  1EKS A;  1S79 A;  1VRQ C;  3IWN C;  1FF2 A;  3W2W B;  2Y0B B;  4Q5V A;  1YJN S;  1U45 A;  2ZH4 A;  1U02 A;  2PGC A;  5KFN A;  5K8M A;  4XDC A;  1RYS A;  4IYQ A;  3PW0 A;  5KOW A;  2JX2 A;  1K9M T;  2B8P A;  1VQ6 S;  1CJT A;  1O6X A;  2JEG A;  1QVF R;  1PIE A;  4WCE Q;  2CQ4 A;  4ED0 A;  4MTP A;  4NMX A;  1DBD A;  1BE4 A;  3C14 B;  3W9H A;  4Y00 A;  5EWF A;  1RK8 A;  2AMC B;  1WF1 A;  4OZL A;  3TO8 A;  2W7P A;  4CI0 B;  1UEK A;  4LBP A;  3RUB L;  2XMW A;  2RNE A;  1HNV A;  3HP6 A;  1DQ8 A;  3M2V A;  2V2K A;  2AKW B;  3US5 A;  1U2F A;  2EWH A;  1HR0 F;  2HFS A;  2UP1 A;  4HR2 A;  1R8P A;  4DPW A;  1OIA A;  3UDV A;  3FCV A;  1CJU B;  1M5H A;  3KHL A;  3C3L A;  3IFE A;  5HBM A;  3Q2T C;  3P6Y C;  3CJ5 A;  2BW2 A;  4MIA A;  2I8E A;  3Q8U A;  4A8Y A;  1R0A A;  3PYE A;  3QJL A;  3LTO A;  2CQH A;  1VRT A;  3SQO P;  2RQ4 A;  1WI8 A;  3GFH A;  2A6O A;  1Z1Z A;  3OTD A;  4IRK A;  2BJE A;  4JV2 A;  5ETV A;  1YJT A;  1JIH A;  2FLP A;  4OHV A;  3O8W A;  3D6T B;  3BKF A;  1JLB B;  4HH0 A;  5H9F J;  2QZ8 A;  5JXS A;  3U1M A;  2RF2 A;  3LO3 A;  1N32 F;  1T02 A;  1S9G A;  3QWP A;  4AFF A;  1V9O A;  2B4P A;  1FXL A;  2QA1 A;  1Q95 G;  4OV1 A;  3M8P B;  5DG8 A;  5KFR A;  2BZ2 A;  4RNN A;  1PCA A;  3FSX A;  5KFH A;  4DL4 A;  2W1B A;  2OPS B;  3LH2 S;  3HHD A;  2F4V F;  2A2D A;  1S72 S;  2HHH J;  2XS7 A;  1SBR A;  2W01 A;  4I6W A;  2BVZ A;  2YWE A;  1H7W A;  2AIR B;  1OYE A;  1HAR A;  2JC1 A;  1OO0 B;  1F0X A;  4KH0 B;  3UDC A;  1KTQ A;  3HD2 A;  4LFA F;  1S1T A;  3EZU A;  2R2U A;  2IY5 B;  4P7V A;  4HT5 A;  3KYL A;  2LXI A;  2IJR A;  4X4P A;  1KWM A;  3W7B A;  5CH7 B;  3R3T A;  4IO9 Q;  4BWM A;  4BHQ A;  1X4B A;  3EDQ B;  3SSR A;  2VQE J;  3FCW A;  3CCM S;  2CQ2 A;  1N6Q A;  3HFZ B;  2YNH B;  1G1X A;  3EVO A;  2CJA A;  3VGU A;  3B54 A;  2ZVI A;  3M05 A;  5HJX A;  1PG5 B;  3MXH P;  3IAM 9;  1XQI A;  2ZJR Q;  1TK8 A;  5A76 A;  4C11 A;  3M6U A;  6AT1 B;  2DNY A;  5KFP A;  5LJ5 Y;  2DGU A;  3GIL A;  5LMU F;  1F2G A;  2MXY A;  3G87 A;  4B9N A;  3B6B A;  2CXE A;  2MLX A;  2FHJ A;  2XNQ A;  2U2F A;  1E6Y B;  4WK3 A;  1RCX B;  4F50 A;  3MM8 B;  1S99 A;  5B0C A;  1U4B A;  5IQ6 A;  3TQE A;  4P73 A;  4QR0 A;  2AEF A;  2ZZT A;  3BSA A;  3IRW P;  1XJW B;  1WNE A;  4RUH A;  1WC0 A;  1GX5 A;  2DB1 A;  1VBZ A;  3GZ7 A;  1T0T V;  3DRS A;  3GII A;  2YWG A;  5DRK A;  4OI0 A;  2E5L J;  3WBZ A;  2ZHB A;  2ZOG A;  2EG2 A;  3W66 A;  4J5O A;  3AXM A;  4O44 B;  1NND A;  1YLX A;  1WOR A;  3D2W A;  2D3O R;  2F8H A;  1TKX B;  4U67 Q;  4ZP9 A;  1DQ9 A;  3M32 B;  1S6Q B;  1BMQ B;  4MIB A;  1EP4 B;  4JI8 F;  3J81 j;  2BE9 B;  1HQU A;  2VDI A;  4I6A A;  4KFB B;  2BXJ A;  2LQ8 A;  3PX4 A;  4RPF A;  2AGQ A;  4RKU C;  2R7O A;  2KI2 A;  2GAG C;  2HKE A;  1JLG B;  4R5P A;  5MAO A;  3DHX A;  3LP2 A;  3AAW B;  4WZM A;  1VRU B;  4ECZ A;  3EMT A;  1FJE B;  3DN9 A;  2ZBQ A;  4ZPC A;  3B4M A;  4X66 J;  3MAQ A;  3DOL A;  2W24 A;  1TR0 A;  3HVA A;  2IVY A;  2VIC A;  1RT7 B;  5D3G A;  1G2E A;  3R8Y A;  5KT4 A;  5DDO C;  3UN5 A;  1JJ4 A;  1U0H A;  5B0E A;  1UMJ A;  2YKP A;  1BY9 A;  1KON A;  3SEO A;  4QIG A;  3IGN A;  5DGA A;  2BJ8 A;  3CJ0 A;  4ZCM A;  1JNZ B;  1S1V B;  5ETQ A;  2E9Z A;  2DNL A;  2QLJ B;  1XIQ A;  4BS2 A;  3HO1 A;  2RHS B;  4USW A;  3V81 A;  2Z30 B;  3JB9 k;  3MM9 A;  4OFZ A;  4FS2 A;  4CLT A;  3PAC A;  2FYX A;  1IR0 A;  2VG5 B;  4NCA A;  2B5J A;  1R31 A;  2MLY A;  4IR9 A;  4XPC A;  4NRU A;  2JFD A;  3EVW A;  4B3M F;  2I9S A;  3M30 B;  5KOX A;  2FLN A;  4DR1 F;  4KQZ A;  2HHV A;  5D0H A;  1KDN A;  1U49 A;  2FHK A;  1FNX H;  3EX7 B;  2XEX A;  5BYS A;  2OH2 A;  3KHR A;  1EQ0 A;  3HK2 A;  3MI7 X;  2EBE A;  2W9C A;  3FEY B;  3UN2 A;  4ZLJ A;  4KE5 A;  2WB1 D;  5KG7 A;  2XWX A;  3NCP A;  5A0Y B;  3HD1 A;  2CPD A;  4DL3 A;  1BQN B;  4JB8 B;  4WE1 A;  1N52 B;  2FJE B;  3R6G B;  2DR7 A;  4UZB A;  3MR7 A;  1SKR A;  5F9L A;  4NCG B;  4PXB A;  2OKQ A;  3F73 A;  5ITH A;  2WSE C;  4JV1 A;  3HVW A;  4CM0 A;  4USJ C;  4DR6 J;  1SPB P;  3G8S A;  1U48 A;  1F60 B;  2RHQ B;  1HHQ A;  1YIT S;  4PG5 A;  2IBO A;  1O5J A;  1SL1 A;  2EXU A;  4CLK A;  3NS6 A;  3KLH B;  1UVL A;  4CDI A;  1S1X B;  3QWU A;  2DIV A;  3PIO Q;  4DUZ F;  4WFN Q;  3BEG B;  3GYX B;  4HLB A;  1AFJ A;  1HBM B;  1NK8 A;  1SQE A;  2V50 A;  3EGZ A;  3MMA B;  2RQK A;  1WSV A;  3OXF A;  2XS5 A;  1IKX A;  4U7C A;  2C3U A;  1QUV A;  1WF0 A;  4U6P A;  3UDL A;  1GMW A;  1C0T B;  2NRE A;  1KOH A;  3CD5 A;  1UKU A;  3VCD A;  2E5I A;  1KQG B;  1Y9O A;  4DFP A;  2ACY A;  5L38 A;  1VK8 A;  2I38 A;  2IC3 B;  1UEU A;  2VJU A;  1FNM A;  4R0J A;  1D3W A;  3V6J A;  3DGP B;  1LWE B;  1RWX B;  3BBF A;  1NK9 A;  2GGP B;  4QBU A;  3JYT A;  4OV6 A;  4LR9 A;  1VIS A;  3OUY B;  3IR7 B;  3UCG A;  5F8L A;  3KK1 A;  3AOB A;  2BE2 B;  4WFA Q;  2DNN A;  1J27 A;  2YNG A;  2RKI B;  4BC9 A;  3A3N B;  3B82 A;  2DGO A;  1D9A A;  3ICL A;  2OD4 A;  3OR1 A;  1S4E A;  1VQ7 S;  2PI5 A;  2GVD A;  1X9W A;  1RWO B;  2FJV A;  4WFY A;  1XN9 A;  4NEZ A;  2DXD A;  3CD6 S;  4NLQ A;  1N34 J;  1L3T A;  2IA6 A;  1RE1 B;  1T94 A;  4EU0 A;  1N4L A;  1IQT A;  1RA6 A;  3RBZ A;  1NM2 A;  1T9W A;  3H5U A;  3ZZZ A;  1FWP A;  2HHX A;  4O3P A;  1F3F A;  1F5B A;  2C2E A;  2OPQ A;  3CDB A;  4K4V A;  2G2Z A;  4M1K A;  4LF5 F;  2V4J B;  2ATL A;  5A8K A;  4G1Q A;  2XLI A;  1QDU B;  2XQC A;  1N8R T;  1H73 A;  4K4W A;  5SZT A;  3I0S B;  4K4T A;  3RG6 A;  1X4E A;  1HNZ J;  4UW2 A;  4HI1 A;  3HJV A;  1B70 B;  3PX6 A;  1AZS B;  1TUV A;  3H7H B;  4DX7 A;  3U7J A;  2HG4 A;  3G4S S;  3I82 A;  5B0B A;  1CJK B;  4RR5 A;  4NWB A;  7FD1 A;  5KFM A;  4MYU A;  2C28 A;  1NKC A;  1LXJ A;  3R1L A;  4J9M A;  1LWC A;  3C14 A;  1HBO B;  3J81 Y;  1RTH A;  5GAG I;  4YB1 P;  2EEY A;  2KXN B;  1TAQ A;  3H59 A;  1HHT P;  4HEA 9;  4N8N A;  1ZOT A;  4P6Q A;  4CLS A;  3NGK A;  2V8D A;  1Y5I B;  2DNM A;  5DDP C;  1UVJ A;  3GU0 A;  3WX8 A;  2VON A;  3GFY A;  2V34 A;  3CJ4 A;  2V69 A;  5HAO A;  2R7S A;  2FHM A;  3I32 A;  1OWX A;  1WC5 A;  2BM0 A;  2XI3 A;  1QTN B;  4IFV B;  1SC6 A;  4FKY A;  4K5S A;  1DTQ B;  3I87 A;  4F0H A;  5LL6 d;  5GME A;  4CNZ A;  3CWJ A;  3PW7 A;  4A8F A;  4Y28 C;  1I94 J;  4QR1 A;  1TZ0 A;  2FHJ D;  1FKO B;  1G3O A;  4WFZ A;  1IM6 A;  3CIM A;  2UUB F;  1JLB A;  1NKB A;  2JEI A;  3KLV A;  1RHU B;  2OEK A;  4YB7 A;  4KBI A;  2G2O A;  2ZJQ Q;  4J9L A;  3QSY B;  2UXB J;  3NEK A;  2L9W A;  2PMH A;  1Q78 A;  2FLO A;  4DR2 F;  3R7B B;  2HBY B;  3K5N A;  5KFL A;  3QGH A;  4NLX A;  1UVK A;  4WTY A;  3CD7 A;  4JI0 J;  2DGW A;  2F8E X;  3M8P A;  4M63 A;  2PI4 A;  4X64 F;  4LR7 A;  2ZH2 A;  5F8J A;  4HYK A;  2LLZ A;  3BH7 B;  3SCL E;  2UU9 J;  1SCJ B;  4ZVF A;  4ANE A;  1C1C B;  2ZBP A;  2V0N A;  3NRB A;  2PII A;  4ED1 A;  2VG6 B;  2CPI A;  4Y2C A;  1DRZ A;  4V19 J;  1H74 A;  3IG1 B;  1RHM B;  2IJF A;  5K14 A;  1DTT A;  3KK2 A;  2VB6 A;  2LQ9 A;  4IG0 A;  2COL A;  4LRC A;  2H48 B;  2IRU A;  1R27 B;  3CME S;  1H98 A;  3BGO P;  3R27 A;  2OHD A;  4LF8 F;  1OPI A;  1SIZ A;  1UAW A;  2DIS A;  4RJV A;  1B0T A;  3AOA A;  3SXL A;  1PC4 A;  3MCM A;  1HWU A;  2MQL A;  5F9N A;  4CH0 S;  4K7Q A;  3DLE A;  4DV7 F;  2YNH A;  4KH1 B;  2DCU B;  2Q1L A;  4E98 A;  4YHH F;  2R7Q A;  2DHA A;  3AH6 A;  4R25 A;  1C1B B;  2BAN B;  2BJ9 A;  1IKV A;  1IWA A;  3GP9 A;  1ICE B;  3HSJ A;  3SQG A;  5KFZ A;  2O01 C;  3E2E A;  2UXC F;  2FJX A;  1S6O A;  5KG4 A;  4ZVG A;  3TVY A;  2J9D A;  3JSR A;  2ZM6 F;  1RAD B;  1KVJ A;  2W7O A;  1VC0 A;  4EO6 A;  4C8Y A;  5KFA A;  2BEF A;  3C6T A;  1E6Y A;  1VGY A;  4O3S A;  5B0A A;  3HHL B;  2YKM A;  2HQG A;  2DHH A;  4N8O A;  2BOP A;  3P8B B;  5GVQ A;  3OLB A;  3NS7 B;  3POT B;  1YRX A;  4K59 A;  5G4D A;  1U6B A;  1VQS A;  2G0J A;  1AW0 A;  4YEA A;  3BSO A;  3FEX B;  3T1Y J;  4EO8 A;  4IRD A;  1TK5 A;  5EN1 A;  2BRL A;  3GV8 B;  2ZIT A;  4HL9 A;  5M2R A;  2UUW A;  4JI6 F;  1WF2 A;  5I3P A;  4XAK A;  4U7U K;  2HBR B;  5L8R C;  5EX0 A;  2YQ1 A;  1G4C A;  1RGV A;  3TOQ A;  1TKX A;  2UUC J;  2GML A;  2JZ5 A;  3M32 A;  1S6Q A;  1C2P A;  1U8W A;  4DPX A;  4DN0 A;  1EP4 A;  4DF4 A;  1N54 B;  5M2P A;  5D0E A;  3GPA A;  2VIH A;  4ECW A;  4ZDN A;  4AND A;  3M1V B;  1P1L A;  2BKP A;  3OR2 A;  4TYB A;  3W9I A;  5KFU A;  2EVZ A;  4B9M A;  3AHP A;  1CLF A;  2ZFH A;  1VFJ A;  2QEX S;  3QMQ A;  3N01 A;  2HIY A;  4F2R A;  4R8U B;  4WXO A;  1NZA A;  1YTY A;  2RDD A;  5JVG Q;  3PHT A;  1MRO A;  2IHR 1;  1RT7 A;  4OZJ A;  3HX9 A;  4LVN P;  3OJU A;  1S10 A;  1IR2 A;  5C24 B;  2FDN A;  2JRS A;  5I4M A;  4TU7 A;  1FJG F;  4UF4 A;  4JV5 F;  3VQS A;  1HR0 J;  2J8A A;  3QFH A;  1S1V A;  3D3C J;  2O3D A;  4USK A;  4CO0 A;  1TL7 B;  4YR2 A;  1HBN B;  2FVS A;  5CYQ B;  1GMW D;  4NI2 B;  4Q8E A;  1TP7 A;  1S0N A;  3AD9 C;  2VG5 A;  4DOZ A;  4Z37 A;  1TKZ B;  3GLJ A;  2GC8 A;  3LOU A;  1LV5 A;  1N48 A;  4C8N A;  3M30 A;  5BJR A;  5ETS A;  2MGZ B;  1S6P B;  2DXE A;  4F0K A;  2P2C B;  1X5O A;  3KLF A;  2C2K B;  3TVK A;  1RWW B;  5KFJ A;  4L75 A;  4EBE A;  2YNI A;  4N5S A;  5E5N A;  2KZM A;  3BM7 A;  8AT1 B;  2ZE2 B;  2HNZ B;  2XCP A;  2G0C A;  4ZVR B;  1SJQ A;  4DQS A;  4JI1 J;  4RWW A;  1H2T Z;  3OW2 R;  4A8M P;  1FVQ A;  4KTQ A;  2YKQ A;  4PKD B;  1MN7 A;  3KDN A;  3C8Y A;  2NUH A;  1ZYQ A;  4LRA A;  3F0N A;  2KKH A;  2MHN A;  1BQN A;  1SKS A;  2DGX A;  2KG0 A;  3K17 A;  1N33 F;  2F4V J;  3I55 S;  1OQ3 A;  3IWX A;  4WU3 A;  5DGB A;  4Q8F A;  4NCG A;  1FJC A;  3HHN B;  3E01 A;  4CT9 A;  4Y3C A;  2EBG A;  2DTJ A;  4ZCK A;  1T3O A;  3Q22 A;  2C22 A;  3OPK A;  4C8K A;  2YX7 A;  2ZH1 A;  1NH8 A;  4NML A;  4RLE A;  4LFA J;  1LOU A;  4I2Q A;  4RNM A;  5IFM A;  3W2V A;  3WDO A;  1PKU A;  1S1X A;  3TA0 A;  3JSM B;  3OBI A;  2CFX A;  1KSP A;  4PWU A;  2IDE A;  1RWU A;  3QLH A;  1GXL A;  2QA2 A;  1UEV A;  3V6D B;  4ECT A;  5KFS A;  2ZH9 A;  3VAG A;  1S97 A;  1YQH A;  1BC6 A;  1O51 A;  1U1Q A;  4ECX A;  2XMT A;  3EGV A;  3I4P A;  3ZZY A;  1NPK A;  2VZ9 A;  1C0T A;  1S9E B;  5LMU J;  2I0X A;  3H25 A;  3SZ2 A;  3U27 A;  2ROG A;  1VBY A;  5HL7 Q;  3KJQ B;  2ALZ A;  3A1Y G;  2IC3 A;  4NA1 A;  2FHO B;  2RJZ A;  2IFX A;  4DR5 F;  2QA4 G;  2WSF C;  1LWE A;  1NU4 A;  4CRJ A;  2CIM A;  4F3M A;  3OUY A;  3I6P A;  1X7V A;  2DD8 S;  3D0H E;  1FER A;  2QFJ A;  2BE2 A;  3W5Y A;  2KM8 C;  2VOD A;  4DV3 F;  3TJ8 A;  2CQ1 A;  1TL5 A;  1UJ4 A;  1ZBT A;  3H4D A;  4GMK A;  2R7X A;  4OI3 A;  5A8R A;  3MUM P;  4FYV B;  4B02 A;  4QWD A;  5CXT A;  1ACM B;  2XMU A;  1DUR A;  4ZJO A;  2D9O A;  3OL9 A;  2DIT A;  3P3D A;  1WJ9 A;  3FFI A;  1AA1 B;  2XYH B;  3GIR A;  2IMW P;  3PYF A;  2V4R A;  1PIL A;  3DRP B;  1P8G A;  5MLC V;  3LPY A;  2ASL A;  4JI8 J;  3UCU P;  1RAE B;  2V4J A;  4AL6 A;  3D7S B;  5HLF B;  1RAJ A;  1R0B G;  3VZH A;  2D74 B;  1NJZ A;  2R7T A;  3H2V E;  3PZP A;  2CQG A;  1HMV A;  1TEL A;  2RD5 C;  1X8D A;  3HCX A;  5E3P A;  4OZ2 A;  1ZS6 A;  4YP3 A;  1S6U A;  1CJV B;  4C8O A;  4RW4 B;  5EUH A;  5J2Q A;  2P8I A;  2GAH C;  5AXL A;  1T05 B;  1U09 A;  2N4D A;  4GRS A;  4J7C A;  4YR3 A;  4DCO B;  4U8V A;  4A8K A;  3L7O A;  4DXL A;  1SQF A;  3G82 B;  1HBO A;  2OEL A;  1YHQ S;  3CTR A;  4ZCL A;  1JWW A;  1T03 B;  3CJ8 A;  4ZJQ A;  1SH0 A;  2DRA A;  4QIV A;  3ITH B;  1FA0 A;  2M8D B;  4YUD A;  4I2P B;  1RT2 B;  4JI4 F;  4NLS A;  4O3O A;  2OP5 A;  3K5P A;  3M6V A;  4B3M J;  3CGI A;  1IQZ A;  2DH8 A;  1K44 A;  4NXM J;  4CTA A;  3JQJ A;  3OFF A;  3QT7 A;  4TVA B;  5ETL A;  4DV6 J;  3TJ9 A;  4I64 A;  4HAC A;  4LVO P;  2HRU A;  2UUA F;  3RU0 A;  3KG4 A;  1REG X;  4DL5 A;  4KGK A;  4PYD A;  2HSE B;  1MN9 A;  4A48 A;  3DXS X;  1WC1 A;  5C2G A;  2J7U A;  4J9S A;  1LFW A;  2J6S A;  3LWL A;  4IQM A;  2W9B B;  2H5E A;  1Y0H A;  1NB7 A;  1RLD A;  1MU2 A;  3OHA A;  1XER A;  4B9S A;  2HRY A;  2JNJ A;  1NPP A;  4DUT A;  5I3Q A;  2D69 A;  3CCS S;  2BAC A;  2FC8 A;  1RQ0 A;  3AJD A;  3KUG A;  4ZPD A;  1FRJ A;  3FRZ A;  1WKL A;  2HS4 A;  1RTJ B;  3GIM A;  1RAH B;  1B7F A;  2J9E A;  4OJG A;  3MEG B;  1NHK L;  1QTM A;  3P45 B;  5HVH A;  4ICL B;  2DNG A;  3M8W A;  1S59 A;  3OV7 A;  2HMI B;  2B51 A;  4NYZ A;  2HHQ A;  1SH3 A;  1X5P A;  4ALZ A;  2NZC A;  2YNF A;  1S1U A;  2PDA A;  1RTZ A;  2B4U A;  4RW6 B;  5D0R A;  1BWV A;  1C1B A;  4J9K A;  2OTJ S;  4B3O A;  2HHS A;  2I6W A;  4FPR A;  2CQC A;  2B9Y A;  2DXF A;  2HHP A;  5IWA J;  2LCW A;  1BQM B;  2HHH F;  3N28 A;  1RWM B;  2DNZ A;  3UR3 C;  2CAD A;  5FLX U;  4ECU A;  2DRB A;  5DM6 Q;  1Q8L A;  2N7Y A;  2XZD B;  3SIP B;  2HS3 A;  2BMB A;  1VMB A;  3M8R A;  4KO0 B;  4KKO A;  2HQI A;  2CNL B;  3S7R A;  5T7L A;  1WHY A;  2VG7 B;  2AJF E;  4HDG A;  2PMZ D;  1REV B;  2ASJ A;  3TAP A;  3G8Q A;  4ZS6 A;  3OVA A;  3BRE A;  3J80 U;  1EJ7 L;  2BQU A;  4W92 B;  1HKA A;  3A3O B;  2YH0 A;  2VQE F;  3MED B;  2GHW A;  3HMJ G;  3NL0 A;  1F5C A;  4ID5 A;  2F1F A;  1SKU B;  1BUX A;  3DYA A;  1DAX A;  5I3U B;  1IKY B;  3JTP A;  3N6M A;  1MSW D;  1CC7 A;  2DO4 A;  4F8R A;  2ADB A;  2OEJ A;  2MKS A;  1A9N B;  1WOO A;  2ZH5 A;  3MR3 A;  3EGW B;  2E9T A;  4KYZ A;  4KHP F;  4IH7 A;  2XM3 A;  3GCX P;  3KJF B;  1IBC B;  2APO A;  2H5J B;  2A2C A;  4ERD A;  3ILJ A;  1VI7 A;  4ATN A;  4NLD A;  4DX8 H;  4DX6 A;  1U24 A;  2HLT A;  1X5S A;  3K2Y A;  3M1V A;  3F44 A;  1ULR A;  4OX9 F;  1WC6 A;  2RU9 A;  4F67 A;  3LAM A;  1RWV B;  1PJ7 A;  4LQ9 A;  1RT5 B;  4MT1 A;  4KC5 A;  2GHV C;  2XTJ P;  1H2U X;  2AYB A;  1JLQ B;  1XR5 A;  4CQ1 A;  4HTJ A;  4DG1 A;  2M70 A;  2E1A A;  5F41 A;  3TUP A;  2QMW A;  3PDN A;  2ALY B;  4UOG A;  4WU2 A;  2DR9 A;  1TL1 B;  4UOC A;  1F6T A;  1BWE A;  4CNY A;  3KHG A;  3CUN A;  4Q43 A;  2FTR A;  2MY7 A;  5C24 A;  3UVJ B;  5DQG A;  3VGS A;  4LF6 J;  4CH1 A;  1P9Q C;  2CZ4 A;  4LRB A;  4B3S F;  2YKO A;  1FEE A;  1UFW A;  2ZZM A;  3MAA B;  3DLH A;  1TL7 A;  1CUL B;  3EE3 A;  1IR1 A;  1R7I A;  1SI9 A;  1JXE A;  4YN3 B;  3D54 A;  3CSK A;  1XWL A;  3DLK A;  3NG8 A;  1FX4 A;  1NUE A;  3NY0 A;  3MPU B;  3R1H A;  3RBD A;  1L3S A;  2LMI A;  2DGQ A;  4FZV A;  2EG1 A;  5A2Q Y;  4CP5 A;  2L41 A;  2AU0 A;  4L76 A;  1JLF A;  2V67 A;  4L72 B;  4HT7 A;  1D9D A;  2MGZ A;  1S6P A;  4C98 A;  3BDE A;  1CJT B;  1UPP A;  3ILL A;  2VBZ A;  4X66 F;  4DR2 J;  3BYR A;  5CYJ A;  3G8T A;  3IM9 A;  3D6H B;  3FK4 A;  2RDI A;  4GO5 X;  4UQG A;  2J8S A;  1HNV B;  3J7Y I;  2XHW A;  3N79 A;  1UPM B;  2EI5 A;  2MPU A;  5H9E K;  1KOO A;  3GJT B;  1EX8 A;  2MZT A;  4DR3 F;  1W2B R;  3M8S A;  4PPD A;  5CHC B;  4ECV A;  2KO1 A;  2WSC C;  1R0A B;  3K0J A;  2J0Q D;  3RR8 A;  3JTO A;  4CCH A;  1SL0 A;  2FGC A;  4RU2 A;  2FVP A;  3UD4 P;  1UFL A;  1WKK A;  5H1S V;  2B7C B;  2IJN A;  2XY6 A;  1N36 J;  3KFW X;  4FS1 A;  4MKY A;  5L46 A;  4MFB A;  4P7T A;  1W7W A;  4N41 A;  1LQ9 A;  2JVO A;  4UUX A;  2CJQ A;  2OO4 A;  3C6U B;  3O3L A;  3K5O A;  3JSM A;  1JLC A;  3K7R A;  2RF2 B;  2Z0G A;  4DU7 A;  4F4Z A;  1GK8 A;  1RHR B;  4DV7 J;  3GJR B;  2XMV A;  2A18 A;  2RS2 A;  3K5L A;  3GSD A;  3DHW C;  4AQY J;  2ILZ A;  4Q7A A;  2I5J B;  3NCQ A;  3DGV A;  2CQI A;  3NLC A;  1TKT A;  2I1R A;  2AQ4 A;  5KFK A;  4ETX A;  5HMW A;  1LW0 A;  1HW8 A;  4KT0 C;  2IYG A;  2C2D A;  1VLO A;  1S1W A;  4FF3 A;  1Q0N A;  2HUR A;  1S9E A;  2Q3P A;  3HZG A;  3N6L A;  2ZM6 J;  1U8S A;  2B6A B;  3Q8Y A;  4I69 A;  1ZAW A;  3ENA A;  5I42 A;  2AP6 A;  4MAK A;  3TEG A;  4PZV A;  1DHM A;  5B7W A;  4XK8 C;  1RTI A;  2DH9 A;  2V2Z A;  2R8I A;  1GMU A;  2RSQ A;  5RUB A;  1H2V Z;  3A13 A;  2OPP A;  3EPG A;  2V94 A;  2PEB A;  2FVR A;  4HDH A;  1VDH A;  3VGV A;  1XTZ A;  2MKC A;  3DDN A;  3R5A A;  2CPY A;  4KB7 A;  2YTC A;  2RML A;  2IVM A;  2VBX A;  4C3L A;  4ZN1 A;  1HNW J;  4TU8 A;  4PXC A;  3FBE A;  2X51 A;  2V2V A;  2EFV A;  5LJ3 Y;  2Y8Y A;  5E3A A;  3GB0 A;  1YGY A;  4ZPT R;  1APS A;  2DNP A;  3P4U B;  3PEJ A;  1T7P A;  4NOH A;  5HVG A;  3WIV A;  4L6V 3;  2QLF B;  2BM1 A;  5LM7 E;  1LW2 A;  3CPW R;  4KPY A;  4OYX A;  2XO7 A;  1W2I A;  4K4Y A;  3CCE S;  5L39 A;  1P27 B;  2X1F A;  1RSC A;  4ZVT B;  2JLE A;  3TAR A;  1RT6 B;  1Q8K A;  1X0P A;  2VFS A;  2XG8 A;  2LDI A;  2CJK A;  4MMO A;  1NK7 A;  1XMB A;  1IBK J;  4QW9 A;  1U1P A;  2ZBC A;  3L3C A;  3DRS B;  3D0I E;  1Z2Z A;  3CCW A;  1VBX A;  3BKU A;  2FUG 9;  3M2U B;  2YH1 A;  3OXL A;  2DH7 A;  4F02 A;  3ZZO A;  4OZ1 A;  1XMO F;  2L9N A;  2AV5 A;  1VS3 A;  1FJG J;  1IKW B;  1N34 F;  4JV5 J;  4M5K A;  3PTW A;  4OYA A;  4WBF A;  3EPI A;  2KRR A;  2J7K A;  2DHS A;  1T95 A;  4TQS A;  2XHC A;  2KFZ A;  3AFG A;  2UVR A;  3CCZ A;  1QSS A;  2U1A A;  4PWD B;  4IO1 A;  3WC2 A;  4I2P A;  1RT2 A;  3SSQ A;  3OTO J;  3M8Y A;  1RIS A;  1TV6 B;  1Y5L B;  2MMY A;  1M1K T;  2E1M C;  5GAE U;  3LP2 B;  4JI3 F;  4ELT A;  5CQG A;  5GAD U;  1SC3 B;  3FZ2 A;  1K1Q A;  5J1P A;  3T1H J;  1X0F A;  4KAI A;  1Q7Y T;  1X9S A;  4UY8 T;  4DPT A;  3QRR A;  1U0H B;  1QAX A;  1TL4 A;  1YWX A;  2JEJ A;  2OPR B;  1HI8 A;  3IO1 A;  3UD5 A;  4PXD A;  1OPZ A;  4TQR A;  3V6K A;  3CDW A;  4NZ0 A;  4MK7 A;  2LFV A;  3RB3 A;  3MWB A;  2W9B A;  1NRK A;  3G2X A;  4BWJ A;  2HLU A;  3V81 B;  1UW9 A;  3QGG A;  1R6V A;  2B43 A;  1MML A;  3MM9 B;  2M8H A;  4TKT A;  2DCL A;  2AX1 A;  4YY3 F;  4J90 A;  5HSP A;  4ILR A;  2B5J B;  3KUH A;  1FK9 A;  3VAH A;  6FDR A;  2LQJ A;  2NSB A;  4G65 A;  2H54 B;  3MR2 A;  3SCK E;  1NJI T;  3N5B A;  1RAG B;  4F4Y A;  1IXK A;  1FD8 A;  3DCA A;  3Q83 A;  3T6B A;  4EGL A;  5EHH A;  3WC0 A;  1I94 F;  4G1P A;  2DHX A;  4MYT A;  4DCP B;  2PSZ A;  4ICL A;  2R9L A;  1L5U A;  1BGX T;  2K8G A;  2KZZ A;  2W9C B;  4DUY J;  1NSK L;  2UXB F;  1X60 A;  1FDD A;  1T3N A;  2YVS A;  3PRD A;  3R7N B;  3HLU A;  2V9W A;  4WZQ A;  4KR0 B;  4J91 A;  1RAC B;  2DKO B;  3RB0 A;  2LEB A;  1ARO P;  2KFY A;  3LP0 A;  5HAN A;  4USH A;  2MZS A;  3ULH A;  5CD4 A;  1EZZ B;  5ETK A;  2GO8 A;  2UU9 F;  2Z2M A;  1KHW A;  3HI9 A;  3IR6 B;  2W25 A;  1BQM A;  1HWJ A;  4HTI A;  5HRO B;  4IRC A;  4URQ U;  5CA5 A;  5E3Q A;  2CJ9 A;  2ATC B;  3DRY A;  3ENV A;  2CA9 A;  2HZV A;  3MPV A;  3W60 A;  2GJ2 A;  1G7C B;  3PR4 A;  5EDW A;  5DLG A;  3BPD A;  1B7Y B;  3I31 A;  2GCF A;  3ADA C;  3D1O A;  1REV A;  1U6Z A;  2W2P P;  3HVR A;  1EAR A;  3GJS B;  2WW4 A;  2ROP A;  3EZO A;  4Y34 A;  3HSZ A;  3I5A A;  3W5X A;  3G6X A;  5HJY A;  3MED A;  4RNF A;  4J9V A;  4KHR A;  4TU9 A;  2PFD A;  3PHE A;  1R6Y A;  4B9L A;  1HLW A;  2LKZ A;  4NLG A;  1Z4U A;  2JLF A;  2Y1R I;  1R0C B;  2C3P A;  2KH9 A;  3GFZ A;  3MCS A;  3MCN A;  4FP9 A;  1K73 T;  2WON B;  2CRL A;  2F9D A;  1V5I B;  2HVD A;  5A6W A;  2LU1 A;  3M6X A;  4FPI A;  2QGF B;  1WHV A;  1FX2 A;  1QAI A;  5E7O B;  4J9Q A;  1SL2 A;  4MH8 A;  2KJV A;  5F8M A;  4O3Q A;  3M9O B;  4ZN3 A;  3JYT B;  1TTH B;  1PO6 A;  2VPX B;  4ES2 A;  1VQN S;  5D4P A;  1RT4 A;  2J5A A;  1XMQ J;  3DXB A;  4OHW A;  5F8H A;  1RT5 A;  1VYA A;  3ZFV A;  2XMA A;  2AX0 A;  2GVD B;  2G13 A;  2MY8 A;  4Q2L A;  3T1Y F;  1TL1 A;  3GQC A;  2QIF A;  1RDR A;  2NYI A;  1GFW B;  2ZUG A;  3U1N A;  2FY8 A;  2XY7 A;  1QUP A;  1RCO B;  2OPQ B;  2Y8W A;  2DR6 A;  3H40 A;  1FXD A;  2OAU A;  3KJV B;  5A8K B;  1Y3J A;  1KFS A;  2UUC F;  4G1Q B;  5KFY A;  3DMJ A;  1F3V A;  3TX8 A;  3VZI A;  3C15 A;  4CM2 A;  3ZTR A;  3VAK A;  1M5O C;  3ZTO A;  2RB7 A;  2O66 A;  4HKQ A;  2CUY A;  1UZH A;  4OL8 A;  1QAJ A;  2E7X A;  2PC6 A;  4DJB A;  1JMT A;  5D8H B;  4N56 A;  3TZW A;  2UUA J;  2FLL A;  1L3U A;  2RE1 A;  5BR8 J;  2HAI A;  1TKD A;  1ZZF A;  2QSF A;  2FD2 A;  2X3D A;  4F3Q A;  2BUN A;  1LWC B;  2IAJ B;  1RTH B;  4QQB A;  4N7T A;  4N77 A;  3ZTS A;  3T41 A;  2C3O A;  4CLP A;  1HHS A;  1FFS B;  5A8W A;  5L1K A;  1IBM F;  3QT6 A;  5B0F A;  2OMO A;  3BH6 B;  4FF1 A;  3KHH A;  3BO3 A;  3KLI B;  1WI6 A;  1MLA A;  3PJ9 A;  3DRR B;  3JAM Y;  2AZ3 A;  3QIP B;  1NH7 A;  2NXE A;  2D41 A;  3UNY A;  4IR1 A;  2K7K A;  4MK8 A;  2AHO B;  2HHT A;  4LFB F;  2JFK A;  4PQA A;  1FDB A;  4KGM A;  4OYW A;  3LQV A;  4AL7 A;  1F1B B;  3L9Z A;  2JVR A;  4YDX A;  4LSL B;  2VA2 A;  3V4I A;  1VQ4 S;  3TZY A;  3A8I A;  3SMZ A;  4A47 A;  3TA1 A;  9RUB A;  3LGH A;  5CCM A;  1KNZ A;  1HFE L;  1PYO B;  1U1L A;  5DO2 A;  3PY8 A;  1RYR A;  3C6U A;  3HKZ D;  3G71 S;  5H9E J;  1M5K C;  2RIJ A;  2POK A;  3ZTQ A;  3JSB A;  2QV6 A;  3LUY A;  4FYW B;  1UWB A;  2C2N A;  2IM1 A;  2ZH3 A;  4ZIT A;  4K0K F;  3AA9 A;  4JI1 F;  2HWT A;  2R7U A;  2QLB B;  5E41 A;  5KT5 A;  4F4X A;  2I5J A;  2ZDP A;  1NME B;  4LUB A;  1NXI A;  2QC3 A;  1DY3 A;  3QRQ A;  4B3R F;  3AQO A;  1HI1 A;  1U2C A;  1AXQ A;  3QJJ A;  1RKI A;  3BGF A;  1VOM A;  4FVM A;  2B6A A;  3KK2 B;  5K14 B;  1DTT B;  4DCJ B;  5E3R A;  1IUJ A;  1HQ2 A;  3ZNU A;  3K58 A;  4IG0 B;  1KQK A;  1NLK L;  1VQY A;  3G6V A;  4YME A;  3EM1 A;  5D78 A;  1PYS B;  2A0F B;  2Z58 B;  3RRG A;  2PA3 A;  5DG7 A;  3PKY A;  5KG2 A;  5ETP A;  3TWZ A;  2YKA A;  1DQA A;  1Y4Z B;  3OTC A;  4ZP6 A;  4ZVE A;  3DLE B;  3T5K A;  1HNI A;  4UY8 5;  2EK6 A;  2VHG A;  3UQS A;  4MKB A;  2EC2 A;  3ZTP A;  1IKV B;  1S9F A;  2C3M A;  4ED7 A;  3SQG B;  2BJ1 A;  5HQL A;  2Y0S D;  4RW7 B;  3M9M B;  4ED8 A;  1U26 A;  2BQR A;  2IM3 A;  4NLO A;  2GVZ A;  2DNK A;  2NXJ A;  3DM2 A;  2GW8 A;  5F0U A;  2DY1 A;  4X4T A;  4NLY A;  3MEE B;  4TY8 A;  2V8P A;  4HHJ A;  4KHP J;  5DJB A;  4WII A;  3MFI A;  1HQE B;  2B4O A;  2EKN A;  3CJQ A;  4CLF A;  1KLN A;  1NAQ A;  3DNC A;  2MZQ A;  2R7R A;  3I5B A;  4X4S A;  3C6T B;  2R4F A;  3U1L A;  1JK9 B;  2B56 A;  3PIP Q;  2YKM B;  4KGZ B;  1X4D A;  3R5C A;  1S0M A;  3RBE A;  1DFD A;  1RT6 A;  2Z2L A;  4OX9 J;  5DDR C;  1DAR A;  3FMW A;  4EYI B;  5LXR A;  3ETO A;  1WC4 A;  1FKA F;  2HK3 A;  4H54 A;  2FJA B;  3IC1 A;  2VFU A;  2HVZ A;  3AOC A;  2RRN A;  2CKW A;  3NKY A;  1VQ8 S;  2XO6 A;  3C19 A;  2LEC A;  2VDH A;  1WDT A;  4B3T J;  3VAF A;  4DX5 A;  2QE5 A;  3M2U A;  3NBP B;  2BQ3 A;  4PXE A;  1J5E J;  3CCU S;  1M5V C;  2E1P A;  4IOC Q;  1IKW A;  3WX4 A;  4CWB A;  3Q8R B;  2CDR B;  3CT9 A;  4B3S J;  4ZVS B;  3DLL Q;  4DSK A;  2NXC A;  1NK6 A;  2ZNY A;  1UL3 A;  2GIQ A;  3PO5 A;  2HAF A;  1NDC A;  2CQP A;  3MEC B;  4OLO A;  3GIJ A;  4PWD A;  5AE1 A;  2V4Q A;  4X4Q A;  4ZVP B;  3OR2 B;  4GKJ F;  2W8L A;  1FWK A;  1TV6 A;  3CD0 A;  4IFY A;  3TEH B;  4USM A;  2P9C A;  2QFI A;  1ZAV A;  3TVZ A;  1LFP A;  1CQM A;  5L9N A;  1PAE X;  3GG0 A;  3ZZP A;  4NA2 A;  3IRX A;  2HFZ A;  3AQP A;  1MRO B;  1J5O B;  5LSO A;  3BN4 A;  2Z2Z A;  1YBU A;  1WG5 A;  1LNQ A;  4A8O A;  5C42 A;  2XZT B;  3HT3 A;  1TVR A;  4GVB B;  2OPR A;  2WVC A;  1LXN A;  2N3O A;  2GMJ A;  1CEZ A;  2JLG A;  4Y2K A;  4DR3 J;  4DI6 A;  3TRG A;  4CO1 A;  4GKK J;  3UCZ P;  1UTA A;  4ED6 A;  3NNA A;  3Q23 A;  4JI5 J;  1NPR A;  4WYL A;  3KG1 A;  3NS5 A;  2NQP A;  3RAM A;  4MKA A;  3ZZR A;  4DV5 F;  2QA4 S;  5JJB A;  4I67 A;  2NCK L;  3OSP A;  2FJD B;  1PYT A;  3CJS A;  4CO2 A;  5KFB A;  2IM0 A;  3EXC X;  3EVM A;  4DPU A;  1S48 A;  1H7X A;  4NZ7 A;  2CNO B;  4NXM F;  3KLF B;  4DV6 F;  2MZJ A;  2YNI B;  4OQJ A;  5GAE I;  1KS2 A;  4CO3 A;  1AYE A;  2IYI A;  5GAD I;  2G9O A;  2HVE A;  3FNN A;  3K5M A;  2WK4 A;  1YK9 A;  3NWR A;  1ZM4 A;  1KBR A;  3SCI E;  2FQQ B;  1FKP B;  3AB4 B;  5GAH U;  3PKM A;  3CDA A;  3DLB A;  1VQP S;  2KN4 A;  2CPF A;  3FGV A;  2HND B;  3A8J A;  3R5B A;  5HI7 A;  4P2X A;  5BYR A;  3E01 B;  1YJU A;  2AJQ A;  3Q24 A;  4P2M A;  5ETT A;  1QLN A;  5HRO A;  2QL7 B;  2ASY A;  1RBO B;  1I1G A;  4JYA J;  4I2Q B;  2JJ4 D;  4QPT A;  4LRE A;  2DIU A;  4B9U A;  1LKZ A;  2BKO A;  1V6H A;  2WCX A;  3W2V B;  2AF6 A;  3FRY A;  5D77 A;  3QLH B;  2HGN A;  2RRA A;  3V5R A;  4WTO B;  4RWX A;  2WVD A;  4AUK A;  3PW4 A;  2A10 A;  1UVI A;  4Y2I A;  5KG6 A;  1RAA B;  4QPX A;  2ABY A;  2HBZ B;  3R7S B;  4NLP A;  1RU2 A;  3HSD A;  4OLP A;  2LA6 A;  3IA0 A;  3UDE A;  4DQP A;  1P1T A;  3QJP A;  3M9N B;  3CIZ A;  3Q2S C;  2O5D A;  3FZB A;  2Z2Y B;  3PJW A;  4ZLN A;  1WKJ A;  4DWI A;  4RBV A;  5HVF A;  1T9X A;  5F3Z A;  2WON A;  1OMS A;  2J6U A;  4D3G A;  5KT6 A;  2MQM A;  3BQ2 A;  5IWA F;  3CCL S;  1NK4 A;  4ES1 A;  1RXO B;  3R5G A;  3VR1 A;  4P2S A;  4LF7 F;  3JAM U;  3TW0 A;  2UVW A;  3Q8V A;  5CCL A;  4ZHR A;  3GIK A;  4OJH A;  5F0W A;  4RW9 A;  2VUG A;  1RUS A;  1R8H A;  2KYX A;  2QT7 A;  4FF4 A;  4BC7 A;  3FVY A;  2DVI A;  1EIY B;  1YDL A;  2SXL A;  4DHV A;  2HWI A;  5A8R B;  1XMO J;  1L3K A;  2J9D E;  3AB2 B;  4ILL A;  4XPE A;  2XB2 D;  2LXF A;  4B9V A;  4M5G A;  3FFI B;  1P9Y A;  1KTV A;  2ERR A;  3N4W A;  4LJM A;  4OX7 A;  4CLY A;  3GWC A;  5L9X A;  4ZMM A;  1HWL A;  5HP1 B;  3BSC A;  3LAK A;  3PX0 A;  1S0V A;  3KJV A;  2J0S D;  2H65 B;  1N0V C;  2KM8 B;  4DV0 J;  2ZH8 A;  3G6Y A;  2W2O P;  2G1H A;  2UZA A;  1HMV B;  3MPW A;  1VR6 A;  4B9T A;  2CG4 A;  4NE9 C;  1IWG A;  2HK2 A;  2G1D A;  4JI3 J;  4LBI A;  3DI6 B;  4ETZ A;  1X4C A;  3ZNJ 1;  1NK0 A;  2NPF A;  3CC2 S;  5B0G A;  3GYN A;  3VVT A;  5J2Q B;  1TMJ A;  1S0O A;  1VQ5 S;  2W2N P;  1E6V B;  2WVE A;  1VQ9 S;  1VLY A;  3CMA S;  3MR6 A;  1RHK B;  4JP8 A;  4F04 B;  1XK8 A;  4ZLP A;  3X1L B;  4ELV A;  1N5Y B;  1RAB B;  4M5D A;  2IAJ A;  2B9E A;  1HD1 A;  1S7I A;  5AXK A;  2DO0 A;  4AD6 A;  4G1I A;  4ZIW A;  4ZK7 M;  3ISZ A;  3F41 A;  2X1A A;  5GMK a;  1SXL A;  4NLW A;  3ISN C;  4J9R A;  1KRP A;  4LF6 F;  3KLI A;  4GVL A;  4YB6 A;  4ECR A;  3FQL A;  4YY3 J;  4I6Y A;  3DRR A;  1T11 A;  3QIP A;  2QMU B;  3MUV P;  2Q43 A;  1NKE A;  2C2R A;  3EUN A;  1N88 A;  1EKR A;  3HT0 A;  4XDD A;  4CTA B;  1AT1 B;  1VHI A;  4M8L A;  4EMD A;  4DSJ A;  4LSL A;  1QAY A;  5C25 B;  1RA7 A;  4HAC B;  5DS7 A;  3CJ3 A;  4OYI A;  4EZ9 A;  2R8J A;  4HH1 A;  2WRM A;  2OD6 A;  4DFJ A;  1S49 A;  4LQ3 A;  3QZ7 A;  5F8N A;  1KVK A;  1WEX A;  1FO1 A;  4J37 A;  4QWC A;  3QGP A;  2V63 A;  5G0R A;  4QU7 A;  3IP0 A;  4F25 A;  2G2Y A;  1NZ8 A;  4QZV B;  1VC5 A;  1EB0 A;  2X1G A;  3H2U B;  4PG6 A;  4RNH A;  3NMA A;  2WZ1 A;  5J2M B;  1Q7L B;  1MU2 B;  2VQF J;  2E5H A;  3DFE A;  4KIA A;  3NGS A;  2ZHA A;  1BD6 A;  3HUL A;  2W2M P;  5F3T A;  1Q8B A;  2VOO A;  3K59 A;  1UW4 A;  4IH5 A;  3BR9 A;  1J2V A;  2CAJ A;  1N5T A;  3QAT A;  3PYD A;  2GA7 A;  2EFO A;  2M4M A;  2HZA A;  4A8Q A;  5HO4 A;  4LFC J;  3I0R A;  2MDA A;  2K3K A;  1N36 F;  4NZ6 A;  3I56 S;  1C0U A;  3DC2 A;  2XWY A;  2GHP A;  3J7A 1;  4Y65 A;  3PFE A;  2P6T A;  2YWK A;  4ZVQ B;  1OYD A;  3BO2 A;  2W4C A;  1HWI A;  3OD2 A;  2C42 A;  2XGP A;  1UJ5 A;  1CBK A;  4Y2M A;  3CMQ A;  4TYA A;  2K1R A;  2YNF B;  1S1U B;  2W4P A;  4AQY F;  4DLE A;  2R2R A;  2C1E B;  3X3U A;  4JI7 F;  4DFM A;  3NAH A;  3OL7 A;  2GNK A;  3BN7 A;  4B3O B;  5HN0 A;  4ER8 A;  4RW7 A;  2VKR A;  2RIL A;  2HWH A;  2WW8 A;  1XC9 A;  3MM6 A;  4C97 A;  1K0T A;  3MEE A;  1QSY A;  1XR6 A;  3QID A;  4P52 A;  3W3S A;  4H4K C;  1HQE A;  5CD4 H;  3HKW A;  3IAS 9;  3JQM A;  1NO8 A;  1R43 A;  4H4M A;  5KFE A;  4F3O A;  3ENW A;  1YRT A;  2YPZ A;  5KFC A;  5AXN A;  4J9U E;  1HPZ A;  4KKO B;  2EW9 A;  4C48 A;  5T7L B;  4F0M A;  1C4C A;  3VAI A;  5J2N A;  2HZC A;  4DN9 A;  3WZ0 A;  5IOL A;  3BV8 A;  1MMD A;  3KMS A;  2XMK A;  3CXC R;  2HQF A;  3VVU A;  2GJF A;  1FHT A;  2WTF A;  3HHK A;  4OJ3 A;  3MUR P;  3HSG A;  4P9S A;  4AXI A;  1HNW F;  4ID5 B;  4NRT A;  3JSY A;  3QAU A;  2DHG A;  2JDJ A;  4DV4 J;  2ROE A;  3DYA B;  3NBP A;  4H4K A;  4KJI A;  3UFC X;  2DK2 A;  1Z2L A;  3ET6 B;  2ZJP Q;  5J1E B;  4UQT A;  1TFY A;  3R2D J;  4IDK B;  4F7V A;  4OZ5 A;  1OSD A;  4RBT A;  2D9P A;  3G96 A;  4KRW A;  2R3V A;  2HRT A;  3GE9 A;  3VAJ A;  2PEH A;  3MM7 B;  1BLU A;  2O1P A;  1UFK A;  1SJR A;  3G9C A;  4DS4 A;  4NLT A;  3Q86 A;  3GYG A;  1WG1 A;  2VPY B;  3CCQ S;  3MEC A;  1IVZ A;  2P6S A;  3SFU A;  1OS5 A;  3NCR A;  4WP3 A;  5C2C A;  1NSQ A;  4I4B A;  4ZOS A;  3QBC A;  4LIR A;  4KV8 B;  3UO0 A;  3W8G A;  2BV3 A;  5IM0 A;  3HHE A;  4C8Z A;  4FN5 A;  4M94 A;  4DR7 J;  3THT A;  2CNN B;  3EJM A;  1IBK F;  4DG1 B;  4P72 A;  1ZM3 A;  2UUT A;  2GFF A;  3ONQ A;  2Y1J A;  2RRB A;  1JNR B;  4O23 A;  1Q81 T;  2HNY A;  1J5O A;  2FB0 A;  3EYZ A;  2Y1L B;  4C3M A;  4DMZ A;  1IBM J;  2Z56 B;  4GVB A;  1FXR A;  4U9R A;  4YQW A;  1DZ5 A;  5DM7 Q;  4HVZ A;  4ZLL A;  1Q53 A;  1NSP A;  4O4G A;  1YBA A;  2W2Q P;  5FLX Y;  2NYH A;  3DLJ A;  2CQ3 A;  3TAM B;  2Q6B A;  4X62 F;  3HVT A;  2QN6 B;  1JLA A;  4A8X A;  2DT9 A;  4LFB J;  3TUJ C;  3DLK B;  3RBX A;  3TUI C;  2KFN A;  1IBL F;  2Z4P A;  4NCB A;  3EDR B;  3IN5 A;  1R8B A;  3VGT A;  1AUD A;  1CG2 A;  1YBT A;  4IOA Q;  4FBT A;  2DNQ A;  3J80 Y;  3CCJ S;  3MMB A;  3KK3 B;  1YVF A;  3OTO F;  2VH7 A;  1JLF B;  2MQ8 A;  2Q66 A;  4K4Z A;  5KG1 A;  1KLM B;  3M8Z A;  1W25 A;  4W98 A;  3TNV A;  3BGR B;  1NJX A;  3T1H F;  3W5Z A;  2BBE A;  2AJ1 A;  4K0K J;  1RAO A;  2JEF A;  4LF9 F;  9ATC B;  4WP9 A;  3DDI A;  1FKP A;  4OYB A;  3WQP A;  3VAM A;  3SDE A;  4URG A;  2BJD A;  5KFV A;  4B3R J;  1KFD A;  5HK4 A;  1WOS A;  4DV2 F;  2VD3 A;  4C3K A;  1Q82 T;  2HND A;  5F8I A;  2ZH6 A;  2CWX A;  4WF9 Q;  3ZXW A;  3OL6 A;  3RW7 A;  1LK5 A;  1UVM A;  2RS8 A;  5KT2 A;  2HQD A;  4DBQ A;  4LSN B;  2V6A A;  4MFB B;  3T5L A;  5ETO A;  1DLO A;  4W90 B;  3KLE A;  2RDJ A;  1FI4 A;  2D3O 1;  3H90 A;  2YY3 A;  1JLC B;  3M8Q B;  2R42 A;  2D3U A;  2CQB A;  4PEO A;  4PUO B;  1JJ2 R;  3QO9 A;  2I2Y A;  2NSC A;  2OLW A;  2KTQ A;  4DUY F;  3RB6 A;  3QSI A;  1TKT B;  2FVC A;  4OZN A;  2HFV A;  1UZD A;  1CPZ A;  3CNQ P;  1YRU A;  1LW0 B;  4X4O A;  4PQU A;  1JX4 A;  1S1W B;  2Q79 A;  5IS2 A;  2FGO A;  2QJ3 A;  5GAH I;  3W64 A;  2H9Z A;  4ZCI A;  1F9E B;  1A6L A;  4RZR A;  1OJ4 A;  1FE4 A;  5I42 B;  3FBF A;  1QD1 A;  5B08 A;  1NB2 A;  2DNH A;  4LBH A;  4C8L A;  5IT4 A;  1M5S A;  1ZM2 A;  1WG4 A;  5K9F A;  4JI2 F;  1RTI B;  4ES3 A;  4WYW A;  1NHV A;  1VIO A;  1RKJ A;  2M7S A;  5DZ7 A;  2IA0 A;  3UWT A;  2BYC A;  4NPO A;  1ZA2 B;  1CQN A;  2OFH X;  2OPP B;  2HW3 A;  1X9M A;  4ZP8 A;  1TMM A;  4N47 A;  5LMN J;  4TNO A;  4WP8 A;  1HNX F;  4C0O C;  2XY5 A;  1VK3 A;  1YJR A;  2HFO A;  2XUL A;  2ZOM A;  2H3E B;  1X4F A;  1JLE A;  1VC6 A;  4DZ6 A;  2H4Y B;  1JB0 C;  4B17 A;  4O0N A;  3H8Y A;  2H1Y A;  1D09 B;  3ZZ0 A;  3ISN D;  4NLV A;  3OJS A;  1NJY A;  2FC9 A;  2F4F A;  2E7V A;  1LW2 B;  2QSW A;  2IPO B;  1MWY A;  4Z2X A;  5HP1 A;  1XNR F;  5T14 A;  3B78 A;  4QR2 A;  4OZ3 A;  1I5O B;  1R8C A;  3DKD A;  3D5M A;  4DDF A;  1A7G E;  3H98 A;  4GKJ J;  1JJC B;  2CPH A;  1NDK A;  3OFH A;  3NAI A;  3DI6 A;  1NDL A;  2YKN B;  2N4C A;  2YXL A;  1TAU A;  4JUZ A;  3VV2 B;  3VF0 B;  4RL1 A;  1XMQ F;  4ANC A;  5K20 B;  3J7Z T;  1E6V A;  2R7W A;  1KN6 A;  1H6K X;  3RB4 A;  1N5Y A;  4ZA1 A;  3VTI A;  4K2J A;  5FJ4 A;  2LQB A;  1CS4 A;  2QG9 B;  4X4N A;  3PRB A;  1KHV A;  3L95 X;  3IBC B;  1N0U A;  4IOB A;  3SFG A;  3R5D A;  2VOP A;  3M2R A;  4J9P A;  3HZE A;  3IM8 A;  2BJ3 A;  2MTL A;  2KRB A;  2KDO A;  3RRK A;  1HYS A;  4DV5 J;  2BJ7 A;  3M4X A;  4ITS A;  2RH3 A;  1RHQ B;  1FT8 A;  1SC1 B;  3V4M A; 
#chains in the Genus database with same CATH homology
 2FYX A;  2EC2 A;  2VJV A;  2XQC A;  4ER8 A;  2VHG A;  2F4F A;  2XO6 A;  2F5G A;  2VIC A;  2VIH A;  2XM3 A;  2VJU A;  2A6O A;  2XMA A;  2A6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...