2EC2A

Crystal structure of transposase from sulfolobus tokodaii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
MEYKSTRHAKYLCNYHFVWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFQELKKSTNGKLWTRSYFVSTSGNVSSETIKKYIEEQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transposase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Gene regulation
molecule keywords 136aa long hypothetical transposase
total genus 31
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2ec2A00
2VJVA 4ER8A 2XO6A 2XMAA 2A6MA 2VICA 2A6OA 2F4FA 2VHGA 2XM3A 2FYXA 2VIHA 2XQCA 2F5GA 2VJUA 2EC2A
chains in the Genus database with same CATH superfamily
2G4BA 1UEKA 3E01B 5SZTA 4GVLA 1P1TA 2XCAA 5F9NA 2H5JB 2HS4A 3IM8A 1EKSA 3GB0A 1TUGB 2B43A 2GQQA 3NNAA 3WIUA 1NPRA 1SH2A 1WC1A 1N5VA 3DGVA 2Z58B 3ZZTA 1X4DA 2V34A 1CSJA 3GCWP 4OJ3A 3S1TA 1IN0A 2AWZA 4U6PA 3KHGA 3K57A 4QPTA 4IR9A 2G1HA 2VV5A 1Z1ZA 2VB6A 5A6PA 4UQGA 4DV0F 2LYVA 2J8SA 3PJXA 1RT1A 2FHJD 4N8OA 1YBTA 5IT4A 2CIMA 2XULA 2NXUA 3ADAC 5KFKA 4F50A 2AGQA 1HWIA 1FVQA 4JI8F 1WHXA 2I5JB 5FJ4A 2CPJA 1WSRA 3D7SB 3KK2A 3G87A 5MAOA 2IM2A 4LRCA 4O3QA 4IOCQ 3OW2R 1SL0A 2R7SA 1REGX 2A6MA 2EVZA 2R7OA 4DX5A 4JI6F 4PUOB 4I4BA 1VK3A 1GEHA 2VDIA 2MMYA 4L74A 4EO6A 1HFEL 3BGRA 2FQQB 4HR2A 4IOBA 2RU9A 2JSXA 4Y6IA 5IM0B 2W2QP 2UUAF 4M94A 2OEJA 3CCUS 2W4CA 4MKAA 3BQ1A 1CS4A 1JNRB 2GQ2A 3N9UC 1JJCB 4L3KA 4NOHA 5SUHA 4OHZA 2BKOA 3HT3A 4Y00A 2R7XA 3K7RA 2OPRB 1M5SA 5KFSA 3CCMS 1YIJS 3SDEB 1RKJA 4P73A 4ZK7M 2E5HA 4LF8J 3PJWA 4ZLJA 5HK4A 2APOA 4ILRA 4J9QA 4ILMA 2YWGA 1MU2B 4F26A 1FD2A 3DOMA 2OPQA 1YI2S 3NBPB 2NLWA 1YJNS 2NXNA 3ZTOA 3MR5A 1VHIA 2HPUA 4C3KA 4P2MA 4DN9A 3NG8A 3PY8A 2GIRA 3A1YG 2P6SA 4FBUA 2HQ3A 4I2PB 1LFWA 3GYGA 2IRUA 2XLJA 2ZC4A 3CE8A 3N79A 3EZOA 5EN1A 2UXBJ 3HX9A 2CPXA 2BOAA 2DITA 1WWHA 2FJWA 1RHQB 1RI7A 2XZTB 2QFIA 2DT9A 2DGXA 3LWLA 3FBEA 4ECSA 3I32A 4DPWA 2HNZB 3V4IB 1CJTA 2P5VA 3MF5A 3ZZRA 1R8CA 1WOPA 3CCZA 4HDGA 5HSPA 5HQ8A 3BPSP 4C8NA 5KT3A 3IM9A 4LF8F 3M8ZA 1FX2A 1NUEA 1KWMA 2ZNYA 3BGFA 4V1Ak 1T03B 5AJ3J 3DLHA 2Z2YB 3G82A 3KUGA 3L9ZA 1ZTTA 4PQUB 1OSDA 1AT1B 2JEIA 4UW2A 3BSOA 3AHPA 4RUHA 3A3PB 3LPYA 2VJUA 3JQKA 2D1CA 4LRBA 1WHYA 3EUNA 4O3NA 3CJTA 5KFFA 3UR0A 2B8QA 3LA0A 4A8FA 4QYZJ 3GR0A 2Q6CA 1BQNA 4DR5F 2H48B 1RTHA 2ZVIA 2YNFB 4M5MA 2ASYA 1OYDA 1YG0A 4G1QA 5HJYA 1RTIA 2XI2A 4LF6F 1KQGB 3IWXA 4UZCA 3FRYA 3UCGA 2EWHA 2J0XA 5DM7Q 1UWBA 2K7JA 2OAUA 2DHXA 4Y65A 1UJ4A 2QA2A 1S1TB 2ABYA 1S99A 2MB0B 5AE3A 1U8WA 2N4DA 2DISA 2JOQA 2XSFA 1UVIA 3IFEA 2MKIA 3ONQA 2HHTA 2V0NA 4JI2J 2OSQA 3E51A 4KPYA 4YOEA 1SL2A 3TW0A 4RW4B 3MDFA 3GYXB 4C0OC 4KSEB 1HYSB 1N52B 4JI1J 4USHA 3LGNA 2N3OA 3DLGA 2F8HA 2FZCB 1D3WA 2F65A 2FLPA 5F8NA 1T03A 3MWBA 5E3AA 4PPZA 4A8QA 4K0KF 1X60A 1RA6A 3KUHA 3M1VB 3NS6A 4ICLB 4LSLA 1FJGF 3CC4S 4U67Q 4J7CA 1NMEB 4BDPA 2EG2A 2DD8S 1YVFA 1UFWA 5C2GA 4JI7J 1WUUA 1DTQB 3ETOA 4QIWD 4BWJA 1QE1A 2W2MP 3BEGB 5HJXA 4UZBA 2YNFA 1ZZNA 5H9FK 4NCGB 4ED7A 2CPYA 2VG6A 4KH1B 1NNDA 3V5RA 4XK8C 2MZTA 2FLLA 1KTQA 1VGYA 1B3TA 2QMUB 1BMQB 3D67A 1QJHA 3BO3A 1GMWA 3G6YA 3E2EA 5H1SV 3H7HB 3MR3A 3QIPB 5HVGA 2EKNA 2IA0A 1VCTA 4NL5A 2RUSA 1CG2A 2J8AA 3JSBA 4J9PA 1Y10A 1G6BA 2VPWB 3DHXA 3J81U 1QLNA 4QU6A 4K0KJ 2QLJB 2H9ZA 3PFEA 4J9NA 1E6YB 2V8DA 2BACA 3CCES 1YDLA 1IR2A 4BWMA 4ECYA 2XB2D 1J5EJ 2HW3A 1QTNB 2MKCA 2V4JA 4RJVA 1YJ7A 3H59A 3BQ2A 1VQLS 2CDRB 5K14A 1Z2ZA 2D74B 4E2FB 2E29A 4OJHA 4I6WA 3Q8RB 2Q79A 4OHVA 4WKYA 1YX2A 5J2MA 2UUBJ 5E41A 1BQMB 1OY9A 4PUOA 2J76E 4MFBA 4EBEA 2YKNA 5A8WA 3SZ2A 1VQPS 2X51A 2G9OA 3MUMP 1JXEA 4OZJA 3RG6A 3RUBL 4DS4A 2GW8A 4FVCA 2EG1A 2C42A 2MZSA 4PYDA 5E5NA 4WJBA 3EXCX 5AE2A 4XDDA 4LBHA 4EMDA 3I4HX 3V81B 1DZ5A 3MOJB 4B9NA 3K5MA 3MXHP 3M6UA 5T14A 3NNHA 2JEGA 1X4BA 1SCJB 2IFXA 4M8LA 2FVQA 2FVCA 1FHTA 2XM3A 2OELA 4ZIWA 3CSKA 5B09A 3CB4A 4JI5J 3DDIA 4H4MA 4M5LA 4N7TA 2HQDA 5HQMA 1N5SA 5HMWA 3PW5A 4A8OA 2N7CA 2ZM6J 2YH1A 4ECZA 1IKWA 3EMTA 4EFAC 2ALYB 3T1HJ 2DR7A 4LSZB 4OV6A 2WZ1A 3MAHA 2YKQA 4K4SA 4QIGA 1U2FA 4CO0A 2C28A 2MLZA 4CO1A 5HVHA 2XO6A 1FEEA 2OFGX 1VQ7S 4DHVA 1XMOJ 1QDUB 3F0NA 1L5UA 1CQMA 1T95A 2GVZB 4NMXA 2FJXA 2OEMA 2D41A 3P5TL 5HQLA 3CPWR 1JJ4A 2DRBA 1EQMA 3CJ2A 2NCKL 3PRBA 1HKAA 2VOPA 2GQCA 3M7VA 4ED8A 1GTEA 2AEJA 3BSCA 3CJQA 2FYXA 4LIWA 5H9FJ 1BHNA 4X64J 3IWNC 3MURP 2MXYA 1NJYA 1QAXA 1HNXF 1N5YB 2FTRA 3R5BA 4RW7A 2CJAA 4KFBA 2R7WA 1RKIA 1F9EB 1WI6A 3G82B 1HMVB 4FXDA 5IS2A 2ZHOA 1M0SA 2B56A 5A76A 3KWMA 4J9UE 2EC2A 2O66A 5FLXU 1ZZFA 1N54B 1XEZA 2AD9A 4NXNJ 1I94F 1WC5A 4ZA1A 3KTQA 1Q5YA 3POTB 3N5FA 5C2CA 2KJVA 4L3NA 3M9NB 5DLFA 2RS2A 3MPYA 2V2ZA 5IZHA 3NCPA 5DDPC 1FA0A 3JTNA 3O8WA 4RPFA 2GMLA 4RNOA 2ZH9A 3A3OB 3QJPA 4CLPA 2JLEA 3QPIA 1DJ0A 3DKDA 4WXOA 1UWBB 3PFOA 2PA8D 4U8VA 1YITS 1S6PB 1PJ7A 1SV5A 3BR9A 3QT7A 4PG5A 2AT1B 1Z2LA 2J9DA 1EKRA 1T05A 1VR6A 1TAQA 2HHSA 2C3YA 2XGPA 1PO6A 5HAOA 1AYEA 3EDQB 4YB1P 4OMFG 2H1YA 2YH0A 4NYOA 4KGMA 3W9JA 3C16B 3B54A 1HARA 1DQ8A 3UO0A 1IKVA 1HQUA 1CULB 4B9UA 3HD2A 2CPZA 2CA9A 1U47A 2JFDA 2FJVA 3SCLE 2K3IA 1WOSA 1C4CA 1B7FA 1TP7A 4EWTA 4AFFA 4YDXA 2XNQA 1I5OB 3MCMA 3ILJA 3WX4A 3I56S 2NZ4A 1TKDA 4LF2A 3VZHA 3KLVA 2FGOA 2GA7A 5I4MA 1TK8A 3BBFA 2XO7A 2MSTA 2PMHA 3IBFB 2MQOA 4ICLA 4LSLB 2V8VA 3H2VE 4DDFA 3BO4A 2FVSA 1S9GB 2GVDA 4C3LA 4URQU 3CJ0A 2QLFB 5DLGA 2HRYA 2BBEA 2NSBA 3CO9A 4NLPA 5KT7A 1BGXT 4DUZJ 2HVZA 3A8KA 4YEAA 5EGYA 1TFYA 1W7WA 3CJSA 3J7AN 3LQVA 3ITHA 4I64A 4FDFA 2DNGA 3NY0A 4O4GA 4JYAJ 1A6LA 2KFNA 3Q24A 1IJFB 3OUYA 3EPIA 3SCKE 2UU9J 1BQXA 2VG7B 1NK8A 4QPXA 4F4YA 3DM2A 3DHWC 3RAXA 2HQCA 4JI3F 4RUCA 2W25A 2AYGA 2YNGA 1N48A 3CVKA 5DG8A 1FJEB 1LOUA 1NEEA 2GHVC 4Q2MA 1HNIA 2QFJA 3TEGA 1RAJA 2MKHA 1R0CB 1S48A 4P9SA 1N36F 2R3VA 5A8RB 2POKA 1L3TA 5H9EK 2LDIA 4WK1A 4C7QA 3H42A 5F8MA 1XNQF 3AA8A 1VLOA 4LF7F 2EBEA 4RL1A 5IXUA 6FD1A 3R6GB 2OD6A 4O4RA 3D68A 4PXBA 4E0DA 1FJ7A 4F67A 1SH3A 5KG6A 3I87A 4Y2MA 3EGZA 1H3DA 2P9GA 4KGXB 3THPA 5GAHI 3OJSA 4PPDA 4X64F 2DGTA 1URRA 4ECQA 3MEDA 2LECA 1ZBTA 1WKKA 4Z7YA 2CG4A 2MZRA 5HMXA 1JLCA 4IQXA 2HFVA 3BGOP 3PG9A 2AGOA 2AX0A 3DRXA 3IP0A 3MEEB 5IQQA 2IC3A 1JXLA 3N01A 4NI2A 1SUQA 3M6WA 2F5GA 2CQHA 2DYAA 2UZAA 5LXRA 4EBCA 3W9HA 4WZQA 2AIRB 1DTTB 3QGPA 3EM1A 2YWWA 4IG3B 1NHKL 1S49A 1U09A 2J0WA 1FT8A 3AQOA 5DZ7A 4DR7J 4HT7A 5D78A 5D4LA 1NDCA 3SQGA 4A8KA 2C3OA 4KTQA 1XIQA 3BB5A 4DV5J 2WVCA 2J9DE 3R97A 3RBEA 3NAIA 2MGZB 4ECVA 4LF5F 4JUZA 2HQIA 2HNZA 3I0RB 3I9ZA 4A8YA 3Q83A 4AE5A 1SI9A 1J27A 4NEZA 1T05B 4AYBD 4TLRA 1DY3A 1Q53A 2A2DA 2ZOMA 4KV8A 4OZNA 3UCUP 1KFSA 2KRRA 4ETZA 4MK9A 2PMZD 2DR8A 2LQBA 1YZ6A 3IA0A 4DV4F 2GMJA 1RTDB 5BYQA 2RMLA 2RU3A 3IWLA 2XCPA 3IGNA 1LWCA 4OYOA 1X4EA 2JNJA 2QV6A 4K7QA 1VQYA 5K9FA 4CYUB 2BJ8A 3EVMA 1DURA 1S57A 3CCWA 3MZIA 3TA0A 5C24A 5HMZA 1U45A 1N33F 1T9XA 4CLZA 5KFPA 3LF0A 4WK3A 4B02A 3T1YJ 3THVA 4DPOA 4ER8A 1IM6A 1TL4A 4WYWA 4DJBA 1FERA 4ES3A 2BE9B 2VBWA 4I68A 3MCSA 3VQSA 1D8ZA 3I5CA 3MEEA 3CCVS 2V6AA 1PC4A 1NZAA 2HBYB 2B9XA 1RADB 2VA2A 2IM1A 4B9SA 4NYZA 1UTAA 4IFVB 4YDDB 1FKAF 1WNEA 2DY9A 3GZ7A 1Q4RA 2Z2LA 4OX6A 1X4AA 2XY5A 1PKUA 3GILA 4NLXA 4H4OA 1LK7A 3HFVA 4JV5J 3BGLA 2K7KA 1SL1A 2LXUA 1T7PA 3TAMB 4PXDA 4DSLA 5HVFA 3CNQP 3FBBA 1K8AT 4YUDA 1S9EA 1QVFR 4QWEA 1M1GA 4NLGA 3R7BB 3MECA 4ZN3A 2GHWA 1CULA 3AOCA 4FPRA 5F8GA 1Q8IA 1RTZA 2R7QA 3H5SA 1KN6A 4IDKA 4P52A 5FLXY 4K4XA 2XSJA 3SQOP 4ZVRB 5L39A 3N6NA 2UUCJ 3DMJB 2JRSA 2VHGA 2KFZA 2GIFA 4ZLPA 4FKYA 2HMIA 2NPIA 1IR0A 2E1RA 3MR7A 5J1NA 4K2XA 2HIQA 2DCUB 3HKZD 5E33A 3UWTA 1KNZA 3BN7A 1CQNA 3R7NB 4DCJB 3BO2A 4K4YA 3HFKA 4JI0J 3UVJB 4WYLA 2LU1A 1X5SA 2VG6B 5AJ3F 4DL3A 1FE0A 3BDPA 2PE8A 1EZZB 2QA1A 3MD3A 3S01A 4DN0A 4XAKA 1Q81T 2PI5A 3QRRA 2ZE2B 2GGPB 2GAGC 3OLAA 1GT8A 1T9WA 2DHAA 4C8YA 5CYMA 2ALZA 2F4VJ 2B6AB 2ZKUA 3MMBA 2MLYA 2B51A 2EKYA 3ZZOA 2VD3A 2P9CA 3MMCB 3GLJA 5KFYA 2RQMA 4ECTA 5CXTA 2Y8WA 1UEUA 1YJRA 3FEXB 1E6YA 2R42A 1EARA 4DZDA 1R0AA 2IAJB 4TY9A 3DDNA 3MTKA 1U1PA 1M5KC 3HLUA 5K14B 3TP2A 1RT7A 1RLDA 1WKJA 1WI8A 5HBMB 2ZZNA 3CEDA 5LMNF 4LQ9A 2MLXA 1HNWF 2LXFA 3OXGA 3GYNA 1I6JA 3PO5A 2C2EA 1Y5IB 4TQSA 4ZVFA 2VG5B 4GVBB 1X4GA 3CD5A 1ZM9A 2XMWA 4ZVTB 3PYFA 4NWBA 3WC0A 2XLIA 1N0VC 3VHQA 3H2UB 9RUBA 3GIRA 2VBZA 3M30B 4LF7J 3UCZP 1F0XA 5B7WA 3FK4A 5C25B 5DG9A 2CJBA 4Y2KA 1XR7A 4PG8A 3J80U 5B0DA 2CZVC 1TMMA 2IM3A 2VPXB 3HF5A 1LW2B 3CT9A 1KVKA 2E44A 1JLAA 3TZYA 5JJBA 3M2RB 2FY1A 3VVUA 1NB7A 2YVSA 4DF8A 1SIWB 2QYGA 2Y3YA 4NI2B 3QWUA 4U8YA 1FXRA 2H5EA 4FS1A 3BV8A 1IBLF 2E9RX 2KM8B 3V81A 1EP4B 4NLVA 4TLQA 1B0VA 2KJWA 3BSNA 2BOPA 3MGJA 3Q8VA 2YKOA 3NBPA 4UOFA 4QWAA 4F02A 3GWCA 2WAQD 2QGFB 1DHMA 3DCAA 4X4OA 2HHXA 2IBKA 1RBLA 1Y3KA 3QWPA 2BE2B 3KNAA 3OR1A 2AJFE 3KXDA 4LFAF 4CH7A 2CKWA 4XIUA 5LOQA 2PDAA 2KZZA 1HWLA 3B6BA 1JKHA 1WF2A 2EFPA 2FPHX 4LSNB 4NX9A 3JYTA 5JVHQ 5HLFA 2P2CB 5LJ5Y 2XS2A 2CXEA 5T41A 2L9NA 2OHDA 1DQ9A 1HI8A 1VMBA 2DNLA 1RP5A 3DOLB 3LP2A 2EFGA 4EYHB 3AXKA 2Y1RI 3I5BA 4CLUA 1OY6A 4K8RA 1M5PC 3BS9A 2JZ5A 2H4YB 2D9OA 5CH7B 2XSJB 1WDTA 2GV1A 3F41A 3HKWA 3MPWA 3TUIC 4FF3A 2BJDA 2VFVA 4MKVA 2WTFA 4DCPB 2UUCF 1O6XA 2RHQB 2HBQB 2NUHA 1YGYA 4FYVB 3VZIA 3W2WA 3Q8SB 3M9OB 4M63A 1HD1A 3KLHA 1U1RA 2ROPA 1BQNB 1S6OA 4B9TA 3PW2A 1UCNA 3NNCA 4G1QB 4GC7A 2FVRA 2BJEA 3TUJC 3FQKA 3U02A 3PV8A 4RBTA 1RBOB 2DHGA 2WOMA 4HTIA 1OO0B 3NGRA 2D3UA 2B5JB 1N5YA 4BS2A 3OTOJ 3QFWA 1NSKL 4OLPA 3J7ZT 3FSXA 3K0JA 1G3OA 4DSKA 2J9CA 1SV5B 2MYFA 4WF9Q 3VCDA 3MAAA 1X9WA 4RLEA 2QSFA 1NCLA 4OX7A 2AMCB 2W1BA 3LO3A 4Q45A 4PWDA 1LEOA 3BKFA 1S1UA 5G0RA 3L7PA 4F2SA 2FB0A 5DJBA 4KRWA 5M2PA 3KK3B 1RABB 4B3SF 2HFNA 5E3PA 3L95X 5HI7A 3RB3A 2BR0A 1Q1KA 2CNOB 3T5KA 2WONA 4JI4F 2XZWA 1Y3JA 1TL7A 2RJZA 2XYHB 3FBCA 1NKCA 4NEYA 4IQMA 2C2DA 2IMWP 3KG0A 3LP0B 3EE3A 1Q95G 4LFCF 3R5JB 1HR0J 2DHSA 2DK2A 2VG5A 4GVBA 4ZHRB 1QSSA 5DZ6A 4DSFA 1HHQA 4DPTA 2VBYA 3C6UB 3HPOA 2XNRA 2IM0A 3X1LB 1N5TA 1VQ4S 2IVMA 3KJNB 1QSYA 2CQGA 1LV5A 3F44A 4OI1A 1O8BA 5CYJA 1UVJA 2HIYA 2B6AA 3OQ2A 3VGUA 4RNFA 3KLGB 3RB4A 4S0MA 2AJ0A 4FBTA 4TN2A 3CGIA 5J2QA 3DGPB 3HSJA 2YBVA 4DR3J 4HLBA 1HWJA 3ISND 4K4ZA 3DRPB 1XMQF 2B4VA 2ZH5A 2M9KA 2UVVA 4X65F 2FHMA 4DV2F 4B9VA 1K0TA 1CC8A 3V6JA 3OUYB 3OJUA 4EZ6A 4ZVEA 1GH8A 3ENQA 1EP4A 3BKTA 2CNKB 2ZBIA 4R25A 5GMKa 1RBAA 3PW7A 4DL4A 3FMBA 3IR5B 4HACB 1BE4A 1NLKL 3D3BJ 5ETOA 1FFWB 4HH1A 5AXLA 1UVNA 2IYGA 4UOCA 3OHBA 1X7VA 3HFZB 5IWAJ 2XY7A 3U7JA 1SBRA 2C2ZB 2FJEB 3W61A 4F04B 5KAKA 4CCHA 3SI8A 4DL6A 4LQ3A 3M8QA 4MMOA 1XMBA 4CI0B 2CVEA 1IBKF 1PAUB 3SYZA 3JS9A 2MHNA 4LRFA 2M4MA 1TKXB 1WG4A 1OY8A 2VQFJ 1MWZA 1QAIA 2MQMA 4NCGA 4M95A 1C0TA 3QAUA 4KE5A 3H4BA 2RD5C 3IAM9 3N6MA 3FUYA 5RUBA 1XNQJ 2ZITA 3RRKA 3SBMA 3CCQS 1X5OA 4Q0BB 2XMAA 3SCIE 1PYOB 5B0EA 1QM9A 2CZ4A 2PIIA 5HMYA 5KT2A 2EXUA 1FFSB 4JV0A 4DUZF 5D8HB 3DLKB 1FF2A 3R9LA 4A8WA 1U25A 3OD2A 3TRGA 4J9LA 5KG2A 4CO2A 1V5VA 2RHSB 1VQKS 3A12A 4ZDNA 5JMNA 1UMJA 3FC9A 2DO4A 3VV2B 3S6EA 3W66A 4A8XA 4F4XA 1GXLA 1NDLA 1U0HB 2DRAA 1H2UX 2Y0BB 1UW4A 3A8JA 1I94J 4NMLA 3EWGA 1TK5A 1N33J 1Q5VA 3TAPA 5LMUF 4DFKA 1B64A 4DUTA 1ROFA 2ZBQA 4P75A 2LMIA 2V2QA 3PHEA 4XDCA 2PI4A 4Y34A 1V3ZA 2BMBA 2PD1A 2XZDB 8RUCA 2XLKA 3Q89A 4UTGA 4GO7X 1KSPA 3CC7S 2X1BA 3CJRA 1LNQA 4ATNA 2Q66A 1MSWD 4M5DA 5DDRC 2ZOGA 3MAAB 1RU1A 1P27B 1D9DA 1JXVA 4KFBB 3NGUA 1JLGB 3R7SB 2IDEA 4N47A 3HZEA 5GAEI 5D0GA 4B3OB 3GJRB 2ERRA 2W01A 1IWAA 2VIHA 2RE1A 3UN5A 1K0VA 4J9OA 2DNHA 3PNIA 5BJRA 3RR8A 2MY7A 2DGWA 2M52A 3S7RA 3G71S 2AW0A 4W4MA 3QSYB 3QT5A 1VBYA 3EICA 3I0RA 4ELVA 3UD3P 3KFWX 3D1HA 5HP1B 2LEBA 1B0TA 2QL9B 1LWXA 2FUG9 3NAHA 2UXDF 2V2VA 2KKHA 3HHLD 4IO9Q 2UXCJ 4CQ1A 2NPFA 2MY8A 1YLXA 2IVFB 3OL7A 3KJQB 1GXTA 3MD1A 1W25A 4RBVA 4H4KA 3SEOA 1ELOA 1XJWB 2RIJA 4PXCA 5ETMA 4B17A 3RBDA 2JC0A 1HI1A 1W26A 3DGPA 1VRUB 4DV6F 3CDWA 2ATLA 4DR3F 3OVAA 1WACA 4ZCIA 1EAYC 2FHOB 1U1QA 4USWA 1J2VA 1OYEA 3Q8PB 2HRUA 4JOUA 4BLGA 4LF5J 3LP1B 3J80Y 4ERDA 1UW9A 3HSZA 4CO3A 3IXQA 4ED0A 3MPUB 1HNZF 4FF4A 2CPHA 1U7LA 2KU7A 4R0JA 4C8LA 1CLFA 3R5AA 2EBGA 3CJ8A 5IT0A 2CQ1A 3ISZA 2A10A 3MM6A 3IG1B 4AQYJ 4F36A 4RW9B 1UJ5A 3DMJA 3JTOA 3WHIA 2EFOA 2FJBB 2W9AA 5BR8J 2RQ4A 4K59A 2AEMA 3VGSA 2JVRA 3D0HE 4WIIA 1F2HA 2HNDA 2GO8A 3TAMA 1T9UA 4YHHJ 2C22A 3ZFVA 3E8OA 1S97A 2VPYB 1KLMB 3QATA 4MYUA 3DFEA 5HANA 2K3KA 1WEXA 2DGOA 1FRKA 3P96A 4RWWA 2W2NP 2AU0A 3U1MA 1XR6A 5DETA 3CWJA 2YNIA 3TA2A 2W7OA 3H25A 2MKYA 1IVZA 3HO1A 3I31A 3IS9B 1A0OB 5KFVA 2M7SA 4G65A 1RUSA 4OJGA 3NOCA 3A8EA 3K59A 1Q79A 7FD1A 4LF9J 5F8LA 2G0JA 4HDHA 4JI2F 3D6MB 2PGCA 2QMWA 2ROEA 4ZITA 4HI1A 1SC6A 5HO4A 2V63A 4XTTA 2JH3A 3OXLA 3QIDA 4USTA 5A6WA 1IUJA 2YY3A 3UN2A 4TVAB 3VR1A 1H73A 3CCJS 1U0HA 4DV1F 4WFZA 2YWHA 1AA1B 1NK4A 4YY3J 3CJKA 1ZOTA 3AD9C 4DG1B 1YK9A 1KHVA 1FDDA 2PT0A 1RK8A 1S9GA 2GVDB 3M30A 3GFXA 3CXCR 4URGA 5EWEA 4DR2J 2WB1D 2C2NA 1PSDA 2WSCC 4ZP6A 1HMVA 1TMJA 1ZA2B 2X3GA 3NKYA 2LFVA 3NLCA 2M8DB 2YX4A 3LAKA 3HM9A 1FESA 1RHUB 3C6TB 1UL3A 3GIIA 1PBUA 4DLEA 4DI6A 4X4RA 5KT5A 4USUA 1Y7PA 3SSSA 3RAQA 2HFOA 3M8RA 4XPCA 2BA9A 1R43A 3OFEA 1YJ9S 1N56A 2FJDB 4DSIA 1OPZA 2BEFA 4JYAF 2IJNA 1H98A 2OSRA 4AXJA 2M8HA 4N76A 3NWGA 3CDUA 1R89A 1FE4A 1NHUA 2BE2A 4YY3F 1FXLA 3M6VA 4LREA 4J9MA 3B4MA 1QSLA 2V9KA 3BH7B 2CFXA 4PCQA 3GIKA 3OTCA 4PZVA 2EK6A 4MH8A 3V6HA 1R8HA 2QLXA 2MGZA 4UY85 1E6VB 1YHQS 3T6JA 3CDAA 1RAOA 3QT8A 3KLIA 1S1TA 2R7RA 3W3SA 4R5PA 4DV0J 1PG5B 3QZ7A 2AJ1A 3CJ3A 1S1XB 3JAMY 2AQ4A 3CJ5A 2PO4A 3A8IA 5BYRA 2ZH2A 2VBXA 2BVZA 3MM9B 1FWKA 4OFZA 4JI8J 2QO3A 1JNZB 1T3OA 4ED5A 3AODA 4UOGA 3ULHA 4LR9A 2HHQA 2E5JA 2CJXB 2BM0A 3EVOA 1OQ6A 1FNOA 2OLWA 2V68A 3K5OA 2ZH4A 2ACYA 3HHEA 2KFYA 4ETXA 4AL5A 3T1HF 2W24A 1OWXA 4P7TA 3MM8B 4KKOB 1GX5A 1OSCA 4IOAQ 2VC1A 4LF4J 4USIA 4WU3A 4WE1B 4LIRA 5KTQA 2MJUA 2E5GA 2V69A 2O67A 4LUBA 5KG3A 2XS7A 2W9BA 1JLEA 3QLHA 3OTEA 4OYXA 1KOHA 4USKA 4KAIA 1HQEA 2R8IA 5ETPA 4GKKF 4C97A 2HGLA 4TKTA 4OYWA 2K1RB 3PW0A 1VRUA 2UVRA 5ETLA 2H54B 2R8HA 4ES2A 1OPIA 3KK3A 1NSPA 2YPYA 4E8UA 1RTDA 1LW0B 2RB7A 2JVOA 1GMWD 2WONB 2R9LA 1XNRF 1CJUB 1GAOA 1AFIA 1WC4A 4JP8A 3GCXP 1DTQA 5KFDA 2Y1JA 3PJ9A 3AT1B 1IKXB 4YR2A 2A0FB 3UDVA 3GTYX 3TEHB 4ANCA 2CUYA 4LR7A 3Q0AA 1RHJB 1YJVA 3D1OA 3E01A 3HDSA 9ATCB 1U4BA 3M05A 2B5JA 1PYSB 3MOZA 2Z4PA 2DGVA 3TYTA 1D0EA 2KTQA 4ZP8A 5IT9U 4D3HA 2Y8YA 2HFUA 1S1VA 2I6WA 2I0XA 3JQMA 3HCXA 2ZOFA 3DC2A 3NXZA 1T3NA 2CNLB 1F3FA 3LAMA 4H4OB 3CD0A 4F25A 4X62F 4N77A 2OTJS 4PWUA 2FC8A 2J6SA 3UDLA 1T9YA 4WP8A 1EETB 1RT4A 3OV7A 2KH9A 3Q2TC 4BCAA 2QA4G 1REVB 4DR5J 1KLNA 5I42A 4MIBA 4NXNF 2MHEA 1G7CB 2V94A 1VQ9S 1QUVA 3M6XA 4KGVB 3SXLA 2RS8A 1C1BB 3PRDA 5FDLB 4CLLA 4DQRA 4DX8H 3V6DA 1S6QA 3PW4A 5J1PA 4OQJA 1S6UA 4C0BA 1IQTA 2FLOA 3DLJA 1C0UB 3NWRA 4TYAA 1AUDA 1AZSB 1RT3B 3H98A 2W9CB 5EWFA 4B3RJ 4ID5A 2W2OP 2A2CA 1Y9OA 1TQLA 1O0PA 1TVRA 1F2GA 1FJCA 5IV4A 3HT0A 2H3EB 3OL6A 1ZPVA 5J2MB 3OR2B 4DR1J 3FJ2A 2OIHA 1AFJA 2IBOA 3BN4A 2JDJA 2W7AA 2WK4A 2HK3A 1J5OB 4B3TJ 4CLWA 3MR6A 4DPUA 3RRGA 4DUYJ 4KBIA 2UV8G 4B9LA 4FYDA 4J9SA 2FD2A 4H54A 3ZTPA 4EEYA 1K73T 1SJQA 2E7WA 1HBUA 3CD6S 1LW2A 4ZVGA 2U1AA 5JUMA 3DLEA 5B0FA 1PILA 2AJ4A 2KHCA 4MJKA 1MLAA 1U1MA 4FF2A 4CP5A 5DG7A 3G86A 4IFYB 4QR0A 1FJGJ 1DARA 3LOUA 3PZPA 1GK8A 2KT3A 1PJ5A 2ZZTA 4ZVPB 2OPPB 5F8IA 4UY8T 2QEXS 1P9QC 1Z4UA 4RW6A 4FYXB 4ALZA 1FKOA 3NGDA 2OI2A 1HBOA 4W98A 2L41A 4Y28C 2KL8A 4LF4F 4LR8A 2DHHA 3AH6A 5FIIA 2LLZA 2IRXA 2XMUA 2JEJA 1CC7A 1EHWA 3CCTA 4IH7A 3AJDA 5KT6A 3UNGC 1JK9B 3N4WA 1FO1A 1HPZB 1S9EB 2IJRA 3JXOA 3O5TB 4M5GA 4WBFA 5GVQA 4U7UK 3UNYA 4R5PB 1LWCB 2G13A 4OYMA 2HK2A 2ZDOA 2V2KA 4IH5A 2ACMA 4ZPVR 3G6VA 1WORA 5EUHA 5KFXA 2HYIB 2YKAA 3FCWA 1UPMB 2DR5A 1UZHA 2DNQA 3D6HB 4NRUA 2Z2MA 2RDIA 3QZ8A 3HULA 2DNZA 3W62A 5IWAF 2E9ZA 1S1WB 1ZAXA 4DR7F 1JQGA 1T9VA 2QJ3A 3IMQJ 5HROA 2Y1LB 1IBKJ 1S76D 3UVJA 1IBMJ 4RU2A 3W8PA 3JSYA 3R2DJ 2DNKA 3Q8UA 3HHNB 4G3IA 3BGUA 1VQOS 2LP4A 2GGPA 5L38A 4A47A 3PEJA 5C5JA 1U8SA 8ATCB 2B4UA 5KFIA 4KGKA 1NDKA 3GU0A 1KQKA 4FKXA 4WFAQ 1HQ2A 1WELA 3KK1A 2JX2A 3D66A 4KHMA 4O4GB 4X4QA 4AL6A 4QBUA 1Q16B 2QL7B 3AA9A 4LBIA 3PKMA 2VKRA 4AXIA 1WHWA 3D0IE 2DVIA 3CDBA 1RT4B 4IH6A 2R7TA 3H40A 1S7HA 4OI6A 1JLFB 5ETVA 2XMTA 2ZM6F 4DF4A 2YWFA 3D54A 3IBCB 4M5NA 3VWSA 1ZA1B 1KTVA 5HBMA 5LMNJ 4EO8A 3C66A 1S1UB 3ZTQA 1FKPB 1NK7A 1RT5A 5EX0A 2GCFA 1MW7A 1EB0A 2NUUG 3CMES 1RT2A 3IO1A 2B4PA 3BGRB 2MSSA 2RRBA 3LH2S 2XWXA 3PR5B 2NS1B 3JSMB 2DNMA 2GX8A 4CO4A 3KLFA 2ZJQQ 3D6TB 1U2RA 2O3DA 4QIFA 4RUAA 1VHFA 2CQCA 3MMJA 4ITSA 3I9V9 5KOWA 3VGTA 3P3DA 2GZOA 1JJHA 4CM2A 5CYMB 1HNXJ 3UDCA 1U1LA 3LTOA 3MM6B 1PBAA 2I9SA 2P8IA 2NYIA 1JLAB 1Q8KA 3MMCA 3EYZA 3RB0A 1NK0A 1J5OA 2CQ2A 2CJYB 3CJ4A 3DOMB 2CPEA 4PYAA 6AT1B 2R2SA 3H8YA 5GADI 5KFJA 1Q7LB 1NXIA 2HHPA 3W65A 1GTHA 3IRWP 4DR4F 2X7IA 4M5JA 5E0OA 5D3GB 1JB0C 4JI6J 3NL0A 1IKYB 2VQEJ 2DNYA 4L76A 1KQFB 3JAMU 4ECRA 3OBIA 3K8WA 4V19X 3QJJA 4W90B 4KHRA 1KD1T 1RHMB 1UZDA 1F60B 2W2PP 1UA0A 5D0HA 2J0SD 1MMDA 2F9JA 1VIXA 2Y0SD 5E3QA 5HL7Q 3C3LA 5KFEA 4C4WA 5T7LA 1O51A 1IWGA 3KDOA 4ANEA 4K50A 1UVLA 1M1KT 1W2IA 1S5ZA 4JBCA 4LBPA 4MT1A 1NKEA 3KYLA 5IT9Y 3UQSA 1KDNA 3JSMA 1GQEA 2HQGA 2DRDA 4RWXA 4OV1A 2XTJP 2RVJA 2IMOA 1P6TA 2AZ1A 4WXWA 4ZCLA 4CWBA 2Q1LA 4TU9A 4MKYA 1TV6A 2JEFA 4LVOP 3NCQA 1H7WA 2RNEA 3AD7C 5ETKA 4ZPAA 4DR1F 2M88A 3DYAA 3EDRB 2QIFA 4X84A 5D77A 4PEOA 2U2FA 2XMJA 2AP6A 3HI9A 4C8ZA 2BQUA 1HW9A 3KLHB 1VJQA 2WW8A 3D4JA 4LJMA 1VQSA 2XMMA 4L72B 3MUTP 5CQGA 3AFGA 4J37A 1YJUA 1DTTA 4IG3A 5D3GA 2R8GA 3JTPA 2BQ3A 2F40A 1PIEA 5F41A 1BWVA 3TA1A 3CW2C 5F9LA 4PRFA 3ZZPA 1X4CA 2GJ2A 1RU2A 4NA1A 3R8YA 1NJXA 2HBZB 2ZDPA 1N6QA 1F5BA 1VOMA 3W8GA 5HN0A 4G1PA 1FVSA 2HQFA 1BD6A 1RGVA 2GAHC 2JC1A 4GC6A 3TNVA 1BC6A 3ZTRA 4TQRA 4FP9A 1RACB 1VIOA 2O1PA 2PMWA 3NEKA 4F4KA 1HBMA 1RJJA 3C6TA 4RW7B 1NPKA 2LA4A 2LEAA 3U1NA 4F7VA 1C1CA 2RF2A 2WVFA 2MQPA 1F1BB 2OPSB 4PG7A 5KT4A 3KLEB 4NYPA 2GIQA 2B0GA 1RTJB 3SCJE 1SQFA 2BJ7A 1I51B 1GX6A 2DXDA 2G0CA 4U9RA 3IR6B 4HL9A 3VTIA 4AD6A 1ZTWA 3PXGa 1SIZA 5KFQA 1RWMB 4Q2LA 3ET6B 2R2RA 1S7IA 4R0EA 5I3UA 1FKPA 3PCOB 4ZIVA 5M2UA 3K5NA 1HNVA 5GAEU 3OLBA 4B9MA 3D5MA 4U96A 5CAAA 1VQ8S 4F3OA 2HAIA 3QAEA 2YWEA 1KFDA 1VI7A 2XHWA 4QR2A 5CYQA 3T1YF 3FGVA 1R7IA 1TKTA 4KB7A 3DI6A 3HVTB 1CJVB 1V3SA 2X1AA 2EC0A 1Q82T 4NXMF 1V9OA 4WCEQ 1ULRA 2DNNA 3EZ5A 4I2PA 2P6TA 3MECB 2DY1A 5B0AA 2FDNA 3ZNUA 3QT6A 2IYIA 4HH0A 4ZJOA 5KFLA 3K58A 2HVHA 4IDKB 4MYTA 2QSWA 2OP5A 1B7YB 5LSRA 3BKUA 4O0IA 3KJVB 3L4BC 4DBQA 4F8RA 5G0RB 4QYZK 3WX8A 2ZJRQ 4DR4J 4NLWA 2W9BB 2MKJA 1KRPA 3HVAA 4ZMMA 1C1CB 2RF2B 2ZKTA 3N0VA 5KFOA 4X66F 4JV1A 4URSA 3F73A 4KKOA 1JJ2R 3HJFA 1D9AA 1YKWA 3I4PA 1CVJA 1RTJA 2KXFA 3LALA 3MCOA 1HI0P 4P74A 5H9EJ 1FXDA 4ZHRA 4N56A 3K5PA 4NXMJ 3AQPA 4W92B 2CDQA 2XYPB 3GIMA 2KI2A 3MPVA 3TQ1A 1FRLA 1ZETA 3KG4A 1AUSL 5CD4A 1WDDA 1RSCA 2OO4A 2HZCA 3FDSA 3IG1A 4HEA9 3VALA 2UVUA 1VS3A 2CVIA 2BYCA 2JL9A 2HAFA 1TKXA 3GQCA 3FEYB 3O44A 4FN5A 4OZLA 3GV8B 2VFSA 3HMJG 2HZVA 2K1RA 4QZVB 3K5LA 1WG1A 1R8BA 4J90A 4WFXA 5JXSA 4L6V3 1GMVA 4BHQA 2MZ1A 5C25A 2OPRA 4K4VA 4DX6A 5LSOA 2F4VF 2COLA 4V19J 2BE7D 1KR4A 5M2RA 4NLSA 4N5SA 3DYAB 3DLKA 3ZZZA 1IKYA 3M2RA 4P71A 3W1YC 2OPQB 2OEKA 2QX0A 2YNIB 3WDOA 4CTAB 4LF1A 2DH8A 3M2UA 2CQ0A 1NO8A 3G8QA 2J9EA 1N36J 2V67A 3KHHA 4CLYA 2UP1A 3MEKA 3U27A 4MK7A 5A8KB 1NSAA 3MR2A 1TAUA 1RAAB 2B9YA 5GAHU 5LM7E 3GJQB 2AX1A 3NRBA 5K20B 1ZYQA 1TK0A 1QAYA 1WG5A 4NPOA 1QAJA 2CWKA 4QU7A 3KHRA 2VFTA 3DRYA 4JI5F 1SJRA 3V4IA 3C46A 5AXKA 1MNEA 1T02A 4M5HA 4IKAA 4OZ2A 4TY8A 4LMZA 4NLOA 1ACMB 3J81Y 4F3QA 4ECXA 4IUFA 1S12A 1TVRB 2CQPA 3C15A 2HHUA 1U2CA 2R8KA 3DN9A 1RCOB 4ECWA 2QT7A 1RYSA 2R2TA 4DSEA 2PSZA 3IC1A 5LT5A 2IIHA 2V8GA 3MAQA 5KFHA 3PX6A 3I0SA 5DO2A 3C2PA 4I67A 4NZ7A 3CIMA 2Z30B 3QBCA 1X9MA 1RT3A 2HFSA 3FVYA 1OQ3A 1MMLA 5DRKA 2ZH8A 4O3PA 4FVMA 4DL2A 1FTCA 2VOOA 1HWKA 1TKTB 4O3SA 1RQ0A 1IM4A 2OUGA 5L1IA 3LANA 3J7A1 2QE5A 2AYMA 1KOOA 2MEWA 3M2VB 3LP2B 4Y2AA 3TX0A 1ZAWA 4I6YA 4J9KA 3JB9k 2VPZB 1FRIA 4KV8B 1BXNA 5K8MA 1S0OA 3TR5A 4Q7AA 4Y0FA 2WOMB 4ILLA 4QYRA 2HHHF 3V2UC 3JYTB 2DNRA 3UR3C 3C19A 2AKWB 3HHLB 3TZWA 4M1KA 2CQBA 3CMAS 3OXFA 2C1EB 3VAHA 3D28A 4NZ0A 1TU0B 4B3OA 3US5A 2N7YA 2RKIA 2EK1A 3QFHA 3HD1A 2ZC3A 3H0PA 5CD4H 3EGNA 3MUVP 3R5DA 2ZBRA 2V5HG 4EZ9A 1B99A 3MM5B 2BV3A 3DXBA 4Z2XA 4XPEA 5FD1A 2AYEA 2C3UA 1X31C 3SSRA 4NASA 1N8RT 1CBKA 7AT1B 3ILIA 5A0YA 3IRXB 1F5AA 2QRRA 5BR8F 1YTYA 2YNHB 5F3ZA 4CT8A 2BRKA 2I1RA 4QIEA 1IR1A 2CJ9A 2CNNB 4H4MB 4E98A 5GADU 4WFBQ 3RAMA 2CYYA 1LWEB 2RDDA 3FFIB 3L09A 3GJTB 3VAJA 1RWPB 3TANA 2HHHJ 2G2YA 1EX8A 2ATCB 1U48A 4PWDB 2R7VA 1Y5NB 1ZM2A 1FD8A 4Y3CA 5DQGA 4Q5VA 1HWUA 4DL0C 4I2QA 1VQ5S 2VKZG 2UV8A 3FCHA 5IC4B 3NGSA 4DOZA 2VQFF 4DV3F 3M8YA 3CTRA 1KHWA 1FTRA 3FBFA 1GNKA 1XBWA 5A8RA 2CPFA 2M3DA 3C14A 4OYIA 4RW4A 3GP9A 4C0HA 1N32J 4Q8EA 2WB4A 4NA3A 4ZVUB 4ECUA 3UD5A 1X8DA 3UE2A 2Y1IA 3GSIA 1F9FA 1TUVA 4B3MJ 1LW0A 4FNIA 1SC4B 4DFJA 1NJIT 2ASDA 4CT9A 2DR9A 2V9WA 1F9HA 1RWUA 1VC5A 2VU5A 3TQEA 5A8KA 1UVKA 2I8EA 3G8SA 1VBZA 1LQ9A 5L1LA 1U1NA 3F56A 3CUNA 2Q3PA 4F2RA 4JI4J 1R6VA 2MTLA 1A7GE 2HLUA 3H90A 2FLNA 3H2LA 2Q43A 1R3NA 2V8PA 2VA3A 5J2PA 3BDEA 1JWWA 2L3MA 1EQ0A 3FZBA 1X4FA 2AV5A 3SMZA 3KMQA 3OL8A 5L9XA 1HHSA 3M8PA 1VRQC 2DH9A 4LRAA 4C3MA 4DV3J 5B0CA 3BR8A 3BJYA 4KJIA 2C2KB 1S79A 2W4DA 1X0PA 3HZGA 1TUWA 2LQ5A 4NA2A 5AXNA 2E7XA 3DNCA 3CCLS 3PTWA 4CNZA 2H51B 1S1VB 2NXCA 1NDPA 3C15B 3TVKA 3W2VB 2O01C 2Y9HA 1SJ1A 5LXYA 2N4CA 2FZGB 3C8YA 4WP3A 3Q22A 1H38A 3O2IA 3R27A 3PR4A 2NYHA 3CD7A 3I5AA 1RT5B 2GJFA 4OJ1A 1NJWA 1XQIA 3PM9A 1WOOA 1HNZJ 2E7VA 2MKSA 4X65J 2G0IA 2CQ3A 3ENVA 3H5YA 5GAGI 5ITHA 3GG0A 5I3PA 2UU9F 1RWWB 2OMOA 3GIJA 1N0UA 3TJAA 1YBUA 1IKXA 2WVDA 4F3MA 4IR1A 2XI3A 2HWIA 4C9DA 3RZAA 4OI3A 3KLIB 3G6XA 4ELUA 4X4PA 5KFTA 1SXLA 2JFKA 1QVGR 2SXLA 4ZP7A 3M8SA 1KVJA 1JLQB 4K4TA 3DXSX 4LVNP 2DEJA 3OR2A 3J81j 5KFBA 4ZVSB 1VJWA 5DQHA 4DUYF 4MK8A 4P2XA 2DGQA 2KO1A 1RAGB 1DLOB 1S59A 2QYCA 2VC0A 2LDYA 3IBWA 1UFLA 3MI7X 4CRJA 4DU7A 5A2QU 3DRRB 4IRKA 3VAFA 3NGKA 2XBPA 3B8HA 2MQLA 1EJ7L 4XO0A 2YKPA 3KHLA 3T5JA 4NCAA 4KHPF 1EETA 5E7OB 3MM5A 2XGQA 4WWSA 2WBRA 1GXUA 4QQBA 3GR1A 1LK5A 1REVA 2CADA 3WC2A 1MMNA 3N6LA 3SDEA 3GMGA 4Z7CA 3TUPA 2KT2A 1AW0A 4LFBF 3QQCD 1TELA 3O3LA 3AY0A 2D3ZA 4DL7A 2XYGB 2DNPA 3AD8C 4ANDA 1YRUA 3P45B 5MLCV 4YR3A 3RB6A 4LFAJ 5KG1A 3R1LA 2EPIA 2DR6A 2VONA 5HP1A 3VQTA 3H5XA 3TAQA 4IG0A 1Q7YT 3AB4B 3D1QA 2KDOA 4DV7F 1CS4B 4I1TA 5K8NA 1FRJA 5LMUJ 4YQWA 4PQAA 2JWNA 4ZOSA 1VYAA 2P9EA 3M8WA 3SIPB 4DV2J 1ICEB 2J5AA 3C14B 4DV5F 4F4AA 3J7YU 3BYPA 3IN5A 1S0NA 3QO9A 1X4HA 1YSJA 2PEBA 3PYEA 4P7VA 1WHVA 4ZJQA 1VRTB 4OZ1A 2J7KA 5IQ6A 1NHVA 3MHYA 3G6ES 3TI0A 1S4EA 2EI5A 3MEDB 5JVGQ 2OTLS 1RHKB 1FK9B 2IDLA 3X3UA 2BRLA 1JLGA 2XMVA 4YMEA 4I7FB 2RQCA 4DQIA 2NQPA 2IJFA 3DU6A 2B9WA 3W2WB 3TZZA 4KT0C 3SFUA 3WIVA 4A8MP 1K1QA 3OHAA 3UI3A 2KG1A 4EBDA 4ZP9A 3FMWA 1CJVA 5KFMA 1XWLA 2WSFC 2YNHA 2BJ1A 5HROB 2E5IA 8AT1B 5K8OA 5J2PB 2FJAB 1HNVB 2KYZA 4MIWA 3H5UA 3RBXA 3G4SS 4UF4A 5EHHA 4O23A 3VF0B 2D3O1 1DRZA 5D15A 4FF1A 3W63A 2CG8A 1HQEB 5IFMA 4AUKA 2X1FA 3HSGA 2G2OA 2PFFB 2UUAJ 1L3KA 1UEVA 2RQKA 3CO0P 5CABA 2OPSA 4BC9A 1UFKA 2ASJA 2IAJA 3UFCX 4JV2A 3DM2B 4IG0B 1RT7B 4NLDA 5CZVA 1WC0A 4EK2A 4EYIB 1L3UA 2K8GA 3OT9A 1A9NB 2KYXA 2DBBA 1YQHA 1HNIB 1U6FA 1ZAVA 5L1JA 1NAQA 4C98A 2ZNZA 3SV4A 1RZMA 4CDIA 1RTIB 1JX4A 1TL7B 2M70A 1S9FA 1JLBB 1KBRA 1PYTA 5DGAA 2YKMB 1CPZA 1TL1A 2Z8QA 3LW5C 1RT2B 4OI0A 1HR0F 2FVPA 2FZKB 1SKRA 4ZLLA 1M5HA 1N5QA 2XC9A 2EFNA 4DLGA 2J6UA 2MQ8A 1H2TZ 3CJKB 2VDHA 1H74A 4DPYA 3ZXWA 5F8JA 1RHRB 3D9BA 2PFDA 3PYDA 4I56A 3R1HA 1UA1A 3IAS9 2GJIA 3MEGB 3O6QA 2D69A 2MZJA 2EFVA 1HNWJ 3ZO7A 3HP6A 1MG7A 1RWKB 4YFUA 2V4RA 2HURA 4K5RA 2OKQA 4Z37A 3ILOA 3QYYA 3R6LB 3MPDA 4IFYA 2LXIA 1XERA 1LWFB 3CIZA 4C8KA 2W7PA 1NB2A 2OPPA 2FGCA 1KKHA 1KS2A 1TTHB 3OVSA 4ED1A 1JLFA 5BYSA 1RXOB 3M1VA 2AYBA 2KVIA 4A4JA 3MFIA 1RWXB 5DM6Q 2H4WB 1S10A 4PKDB 5KFZA 1RLCL 5ADZA 4L75A 2IRYA 4KYZA 3EGWB 4B3RF 1VBXA 2QLBB 3VGVA 2KHDA 5A8WB 3TUZC 1RT6A 1TL3B 2G2ZA 3GFYA 5KFRA 3TWZA 1T94A 4B3SJ 1QUPA 2D7SA 2HBRB 4MAKA 4N8NA 1MROB 2DXFA 2Z2ZA 4P72A 3TARA 3AOAA 2PN6A 3RU0A 2DO0A 3EVWA 4QW8A 3DLBA 2XS5A 4CNYA 5DDOC 2VASA 1D9FA 1XR5A 4B3TF 1JLQA 2NR0A 1ITPA 2BJ9A 3PX0A 1C0TB 1YJTA 2YQ0A 2PA3A 3BZQA 4ED4A 3MMAA 3G96A 3CMQA 3NS5A 3THTA 3I0SB 2ZE2A 1N4LA 5L1KA 2BJ3A 4TY8B 2UVWA 3R2CJ 1ZM4A 2IY5B 2HNYB 4KO0B 4HT5A 3PVXA 2B9EA 2DKOB 5KOXA 3Q8QB 3RRHA 3AB2B 4GRSA 1TKZA 2V8HA 1IQZA 2XMKA 4I7FA 5J2NB 2V4JB 3FQLA 3W60A 3NMRA 4MTPA 3CULA 3EX7B 1HBOB 4ID8A 4NRTA 1EIYB 4F0HA 1D1UA 1VISA 4DSJA 4LF6J 1U02A 4RNNA 1WEYA 4B08A 5LSLA 3Q8YA 3MM8A 2AF6A 1MN9A 2FY8A 1Y4ZB 5DS7A 1U49A 4ELTA 3ICLA 2UUWA 1YJWS 4R8UA 2VUGA 5DGBA 2B7CB 1M90T 3P8BB 1C2PA 2HG4A 5DQIA 4U7CA 2R2UA 1D8YA 2QLWA 3W5XA 5U47A 4YP3A 2L48A 3T19A 4DWIA 2XHCA 3JQJA 3W7BA 4ZCKA 2VF3A 4M5DB 4OYPA 4YB5A 4IYQA 3ZZUA 1HL6A 2DPIA 3PO4A 5ETSA 4A48A 3L3CA 4DV7J 2HS0A 5C42B 4CH0S 4EUVA 3FZ2A 3QNWB 3TO8A 1Q8BA 1FRHA 2AEFA 1T8EA 1MU2A 1CJUA 1XK8A 1SKSA 3TJ8A 1UAWA 2RKIB 2DXEA 2F63A 3DOKB 2XEXA 4YB7A 4USVA 2UUBF 4QWCA 2DIVA 4NLRA 1S77D 1UWAA 4CLTA 4CZCA 4OIXA 1FRXA 3BREA 3ENAA 2L9DA 1VC0A 3N28A 1DFDA 2CQIA 2MDAA 4OI2A 3HHLA 2DPJA 3VAKA 1L3SA 3GPAA 2BKNA 3SSQA 1WEZA 3GFZA 1FEHA 4HTJA 3T5HA 5KFWA 1N34J 2W8KA 2A1BA 2J0QD 2ZZMA 1U1OA 2E1MC 2ZWPA 2I5JA 1FCAA 1P8GA 1LWFA 2XG8A 4D3GA 3K8VA 2E5LJ 4I2QB 3RBZA 1VFJA 4PQUA 1X5PA 4MIAA 2CRLA 2LKZA 1RE1B 3CF5Q 3PHTA 3OTOF 1LFPA 2ZUGA 2JHEA 2UUTA 4QWBA 4ED2A 2IHR1 1XN9A 3M8QB 5K5MA 1L3VA 1H0HB 2YKMA 4CIOA 4M5IA 2CQ4A 3BM7A 4TXSA 5EWGA 3FFIA 4ED3A 2LQJA 2NXEA 1TZ0A 5E3CA 3KMSA 1U0SA 2N3LA 3PIOQ 1XMOF 3NGTA 4K4UA 2GC8A 1R8PA 3K2YA 2FHKA 2HNDB 1BUXA 1WKLA 4WP9A 3DI6B 1SVDA 2RILA 1FNMA 3B82A 1QE1B 3P5BP 3P49B 1YZ7A 1N34F 3OTDA 4PR6A 4DX7A 4Q8FA 2HKEA 1BY9A 4ZLNA 4BC7A 1RT1B 3MEGA 4IRCA 2D9PA 4DS5A 2A18A 4CH1A 1K44A 2UXBF 2C3MA 2O5DA 2BKPA 2RAQA 2I38A 4J5OA 4NZ6A 3WBZA 3CCSS 3V6KA 3GFHA 1R0AB 1R0BG 1S72S 3D6FB 3LP1A 5K8PA 2MKKA 3HVRA 4ZPDA 2FHJA 1R8AA 4TNOA 1HYSA 2K2PA 4CTAA 4DV6J 4JI1F 1CEZA 3BQ0A 2YNGB 4GKKJ 2YX7A 5KG4A 4DZ6A 4F4WA 5HATA 2ILYA 2UXCF 1GFWB 3DDKA 4Y2IA 5KFUA 2CPDA 3K17A 1SQGA 3UDEA 5KFNA 3V6DB 4DG1A 4OX9J 4K5SA 3Q23A 3W5YA 3FSYA 3MM7B 1S0MA 1MROA 5F0UA 5C7PA 4KHPJ 4U7UD 1JKHB 4LSNA 4DMZA 1LXNA 5HLFB 4RX6A 1HA1A 1FFGB 5A2QY 2N82B 4MFBB 3W64A 1SJFA 3DRSB 1JLCB 1RWVB 4RNHA 4X66J 2W9CA 2AJQA 4ZPBA 5LL6d 2YXLA 4QJVA 4ZKAA 3HK2A 4NLUA 5DDQC 3AXMA 5B0GA 4JV5F 1HIYA 1WSVA 4FXVA 1CJKB 4RW8A 3EXYA 4J9VA 3I6PA 4WPAA 3RR7A 1M5VC 4QR1A 2ZHBA 1RB0A 5KFAA 5C42A 1SC3B 1FDAA 1N88A 2VL1A 1DAXA 2B8PA 2F4FA 4RW6B 3IS9A 4RU9A 3KOAA 4PXEA 4C11A 4OHYA 1WF1A 1S4FA 2Z56B 4FNHA 4USJC 4DFMA 5J2QB 2DB1A 1ZH5A 1R27B 3QJLA 4TU8A 3I96A 3DRPA 4X4NA 3M2UB 1V6HA 2VH7A 4I6AA 2F9DA 3MCNA 4ZPTR 1F3VA 2F7VA 2EEYA 4QIVA 3WZ0A 3GG1A 1RAIB 3QSIA 4TYBA 2F8MA 4L73A 4FPIA 3ELHA 4ZPCA 2YTCA 4K4WA 3PX4A 4ZN1A 2HGNA 3GJSB 3BBBA 3JSRA 3J7Z5 4AL7A 1E6VA 4LF9F 2HZAA 4HYKA 4PABA 5KG7A 2X1GA 3WQPA 2BABA 2OGUA 2ROGA 3T6BA 1S1XA 4F0MA 1DLOA 2ZBPA 3KNGA 3ZC4A 1K47A 1FRMA 2ZD1B 3MM7A 3OFGA 4QW9A 1TL5A 2IC3B 3DOLA 5D4OA 2B3TB 4O44B 1H7XA 3T9NA 4DXLA 4EU0A 3TVZA 2KM8C 1G4CA 4KGZB 2VODA 3TZXA 2ZBCA 2L9WA 4G6VB 5I3UB 3DRSA 4DR2F 4LFCJ 4QWDA 4DFPA 3M4XA 3MTJA 1SKUB 1APSA 2M2BA 5CZXA 3R3TA 5GMDA 1VQMS 1F5CA 3AJ1A 2MQNA 5AT1B 2KG0A 3PACA 3POTA 3ZTSA 1SQEA 2HWHA 2WVBA 1NU4A 2HRTA 4JB8B 4KPCA 5KFGA 5C24B 5LJ3Y 4O3RA 1U6BA 4NLYA 1RA7A 3M32B 2YQ3A 2BW7A 2CJKA 4DPXA 4B3MF 4DU8A 2CZ9A 2RT3A 4ZVOB 3BH6B 3QGGA 4GO5X 2WCXA 1URNA 3OVBA 2B4OA 2ZH7A 4M5KA 1J5EF 3P4UB 3QIPA 1T0TV 4OYBA 3TX8A 3N5BA 3MFHA 3T5LA 1VRTA 1HD0A 2GS8A 4FYWB 1OMSA 4JI3J 3MM9A 3KK1B 3PYGA 2A3JA 1FK9A 3G2XA 2UXDJ 2HLTA 2RH3A 1OIAA 1RAFB 1RWOB 5AXMA 1KEKA 5ETTA 2ADCA 1SB6A 4UQTA 2QZ8A 4HHUA 3OSNA 3VAMA 4JI0F 3KJFB 2YQ1A 1U1KA 1NH8A 2VJVA 1LXJA 2NXJA 4WFYA 3RGIA 3OPKA 3AAWB 5A0YB 1Y5LB 2J7WA 1NRKA 4WE1A 5D0RA 2KXNB 4X4TA 2HVDA 3KLFB 2AZ3A 4OZ3A 3QRQA 4HI2A 2XWYA 1HBNA 1TL1B 3L7OA 4CLFA 2ZJPQ 3LGMA 4I69A 1HW8A 4WU2A 4OHXA 2ZVSA 4OL8A 2HEKA 3HVWA 2LA6A 4KH0B 3QMQA 3VAGA 2A6OA 2IA6A 2KZMA 3BF4A 2BQRA 2E1AA 2VG7A 3RJMB 2XQCA 4Q0BA 2GHPA 3NOGA 3C16A 1OJ4A 4P6QA 3AJ2A 4Q44A 2KRBA 2W8LA 1IKWB 2VICA 1WJ9A 5T7LB 2HHWA 5L8RC 4JI7F 1QD1A 1TFWA 3D2WA 1C1BA 5FDLA 1OS5A 5ETQA 4HVZA 2WBMA 1VC6A 1PCAA 3HHDA 4WKRA 4WTOB 4GKJF 3IGVA 1M5OC 4RO0A 1AZSA 2VFUA 2ZEJA 1VQNS 2KVQE 4P10A 1UKUA 5D6GA 2CWXA 2YPZA 1HLWA 3T9ZA 3FRZA 1FWPA 1RAEB 3O1LA 4EGLA 4DL5A 1TR0A 3HXMA 2Z0GA 4HKQA 2YX1A 3BSAA 3PRVA 3HHKA 1RT6B 1TL3A 4Y2CA 3ITHB 5ETNA 5CCMA 3UD4P 5D4PA 4YR0A 3G8TA 3PDNA 4K2JA 4RR5A 1NH7A 2CPIA 5ETRA 4X4VA 1Y0HA 1MWYA 3Q2SC 1CJKA 1R6YA 4RW8B 1H2VZ 1HBUB 1UPPA 3OSPA 1TKZB 2ZHAA 1KLMA 5EDWA 3FNNA 3W2VA 5CA5A 4IRDA 3HSDA 4WIQA 2CAJA 4LRDA 3GE9A 2XY6A 3HJVA 2DEIA 4C11B 4NCBA 1VDHA 1SUQB 1NK9A 4X62J 3RW6A 4KQZA 3MMAB 1KONA 1VBKA 2JLFA 2QTWA 3ET6A 4UUXA 2Z57B 3W5ZA 2LVWA 1FX4A 2PEHA 3BYRA 4C8MA 1H6KX 1M1HA 2ZH6A 2OD4A 1U26A 2DTJA 2GVZA 1NSQA 3RYLA 3ETMA 4OZ0A 4Q43A 3P6YC 4X2BA 2DNOA 3T1AA 1V5IB 1SC1B 1XTZA 2GFFA 1KP6A 4ID5B 5THWA 4UT4A 1B0PA 4OHWA 3EGVA 4F0KA 5IC6B 3GV5B 4O3OA 3U1LA 1WF0A 2VQEF 1NK5A 2YWKA 1O5JA 2HGMA 2MPUA 2HWTA 2VFRA 1QY7A 3UN3A 4I0WA 3KUEA 1ZM3A 3OR1B 5I3QA 4WTYA 1B4SA 3R5GA 2ASLA 1KC8T 4OLOA 1MWQA 1NK6A 4FZVA 1T9TA 3T41A 2R4FA 4UOHA 1UP1A 5CYQB 2JLGA 2LQ9A 1RISA 4EI2A 1S0VA 2F3JA 1FDNA 4FS2A 4TU7A 1I3OB 1NBEB 4PG4A 2EFQA 5KFCA 3DOKA 3QGHA 3DLGB 3CDEA 3D3CJ 2ZH3A 1K9MT 1UVMA 1G2EA 1KVIA 3RTVA 3QGIA 4NE9C 1RDRA 2F8EX 1RTHB 1V3RA 5KG0A 2HFZA 4YN3B 4R8UB 1VQ6S 3I55S 2NREA 4OI4A 1RYRA 3KJVA 3GV7B 2MZQA 4IFVA 3E3XA 3B78A 1LKZA 4DR6F 3TOQA 3HVTA 2ZFHA 3GSDA 3NP5A 4WFNQ 2HVIA 3J7YI 4DEZA 3RW7A 4WZMA 7FDRA 2G1DA 1SJ4P 1WTBA 3LGHA 3KDNA 5F3TA 1W2BR 2C3PA 4C8OA 6FDRA 2BX6A 2KN4A 2BANB 1JMTA 2HSEB 3ISNC 1S6QB 3OFHA 4RNMA 4ZPWR 4KY3A 5GMEA 2ZH1A 2IPOB 4DV4J 2X3DA 4NLQA 4UUWA 4HHHA 4YS2A 1D09B 4ES1A 2DIUA 1JIHA 2QG9B 1S1WA 4P2FA 2RRAA 1P9YA 4HHJA 2RDJA 4GKJJ 5KG5A 1X0FA 4QCLA 1FWLA 1RAHB 1JLBA 5IOLA 4RW9A 2E1CA 2EW9A 2E1PA 4MKBA 3A4TA 3SV3A 5CHCB 2AHOB 1U6ZA 2CJQA 2MJNA 2RRNA 1C4AA 3M9MB 4YB6A 1KQSR 1HHTP 4FXWA 5BXIA 1XNRJ 1BQMA 1HBNB 3GONA 1B70B 1FNXH 3H4DA 4RUBA 2BXJA 3D0GE 4PWWA 1U24A 3OFFA 5J1EB 2QN6B 3CC2S 1XMQJ 3DRRA 1MN7A 3LPEA 3KKFA 1UJ6A 1Y00A 4OX8A 1N32F 3C6UA 3FEZA 1RWNB 4OX9F 2OH2A 4F4ZA 2ADBA 4OYZA 1FKOB 2M0GB 1IBLJ 2AGPA 2ZWOA 4J91A 4NLTA 2HHVA 2OMLA 3SQGB 4BBYA 2MQQA 1H72C 1NM2A 3LP0A 5L9NA 3KK2B 1Q0NA 2BANA 2OFHX 2FC9A 4C48A 4N41A 1DBDA 2L08A 2V4QA 1SPBP 4CO5A 3NMAA 4ZJLA 1HPZA 2W4PA 2HMIB 2GO9A 2C2RA 4A46A 4DQQA 4LFBJ 2HS3A 2GMHA 2H5IB 4CLKA 3KG1A 4X4SA 1SKWA 2BDPA 1P1LA 1AB8A 3VAIA 3VVTA 4HACA 4OYAA 5D4NA 3ENWA 1I1GA 3LUYA 1FI4A 4QOTA 1BLUA 3Q86A 4LT6A 5IM0A 3KLGA 5EX3A 2E5LF 2YKNB 4ZCMA 2WSEC 3QO9B 2JJ4D 1PGZA 1AXQA 2KB2A 2FIUA 4OZ5A 3UW1A 4KIAA 3TVYA 3ZZYA 1TV6B 1PAEX 2I2YA 3QRPA 3V4MA 1R31A 4J9RA 3MMBB 1NKBA 2IVYA 3LWMA 2K06A 4U95A 1GMUA 4RZRA 1F6TA 1AROP 4FYYB 3EZUA 4ZVHA 2R8JA 3K89A 2HNYA 4KO0A 3IR7B 3M2VA 3FKBA 5J2NA 3H20A 4RKUC 5I42B 3L7UA 4O0NA 2H65B 5G4DA 3CCRS 1IXKA 2NSCA 4X4UA 3UPFA 1N6QB 4GMKA 2C2OB 3HHLC 4DQPA 4KR0B 1IBCB 3A13A 5F8HA 5IV3A 1VLYA 4CM0A 1JLEB 3QLHB 4ZS6A 2KXHA 2ZD1A 1C0UA 2DGSA 1FDBA 2QMXA 3S8SA 4IO1A 1HBMB 2LEPA 4H4KC 1UETA 1RCXB 4CLSA 2QC3A 4CYUA 1NJZA 1IBMF 2AJ2A 1NZ8A 4AQYF 4PG6A 4ZVQB 3ILLA 5E2QA 2DCLA 4AT1B 1YBAA 1ZS6A 5GAGU 1X9SA 3DLLQ 1IKVB 1HQUB 1WC3A 2LQ8A 3EPGA 4YHHF 2WW4A 2HVEA 3I82A 2DH7A 1G1XA 5B0BA 3M32A 1Q86T 1LWEA 2M5YA 3A3NB 4P2SA 2ILZA 3TJ9A 1SH0A 1K1SA 3R5CA 5D0EA 3T3FA 3DLEB 2B7BB 4RBUA 2CQDA 2VZ9A 1XC9A 2LCWA 4C2MA 2D3OR 4C6AA 3IRXA 5L46A 3ZNJ1 2R7UA 1X5TA 1Q78A 2WRMA 4KC5A 1DQAA 1WTFA 2V50A 5F0WA 3W9IA 3PKYA 2QL5B 3ZZ0A 4DV1J 4A8SA 3SFGA 2QA4S 1WC6A 4G1IA 5E3RA 1CJTB 1S6PA 1WD6A 1Y11A 1YRXA 2WVEA 1VK8A 3B4DA 3DU5A 3M8PB 4O44A 5J1EA 3FCVA 4ED6A 2BW2A 3FSIA 1ZPWX 2RUGA 2BZ2A 2DJWA 5CCLA 1NPPA 2F1FA 2KT5A 1Q8LA 2RSQA 3KLEA 3PEHA 4DQSA 4DR6J 2DGUA 1YWXA 5B08A 3OL9A 2E9TA 2J6TA 3EJMA 4USMA 1SJ3P 1PC5A 2ZUAA 1IJEB 3PIPQ 1BWEA 2NZCA 2OJ3A 2BUNA 4ENOA 2LU2A 2WHOA 2E66A 3NCRA 2Q6BA 4DCOB 2GNKA 3G9CA 2J7UA 3BPDA 1PJ6A 3BBCA 2BM1A 2C2MB 1T11A 3AOBA 1YRTA 1QTMA 3OTBA 3NS7B 5AE1A 4PAAA 2PC6A
chains in the Genus database with same CATH topology
2VJVA 4ER8A 2XO6A 2XMAA 2A6MA 2VICA 2A6OA 2F4FA 2VHGA 2XM3A 2FYXA 2VIHA 2XQCA 2F5GA 2VJUA 2EC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJV A;  4ER8 A;  2XO6 A;  2XMA A;  2A6M A;  2VIC A;  2A6O A;  2F4F A;  2VHG A;  2XM3 A;  2FYX A;  2VIH A;  2XQC A;  2F5G A;  2VJU A;  2EC2 A; 
#chains in the Genus database with same CATH topology
 2G4B A;  1UEK A;  3E01 B;  5SZT A;  4GVL A;  1P1T A;  2XCA A;  5F9N A;  2H5J B;  2HS4 A;  3IM8 A;  1EKS A;  3GB0 A;  1TUG B;  2B43 A;  2GQQ A;  3NNA A;  3WIU A;  1NPR A;  1SH2 A;  1WC1 A;  1N5V A;  3DGV A;  2Z58 B;  3ZZT A;  1X4D A;  2V34 A;  1CSJ A;  3GCW P;  4OJ3 A;  3S1T A;  1IN0 A;  2AWZ A;  4U6P A;  3KHG A;  3K57 A;  4QPT A;  4IR9 A;  2G1H A;  2VV5 A;  1Z1Z A;  2VB6 A;  5A6P A;  4UQG A;  4DV0 F;  2LYV A;  2J8S A;  3PJX A;  1RT1 A;  2FHJ D;  4N8O A;  1YBT A;  5IT4 A;  2CIM A;  2XUL A;  2NXU A;  3ADA C;  5KFK A;  4F50 A;  2AGQ A;  1HWI A;  1FVQ A;  4JI8 F;  1WHX A;  2I5J B;  5FJ4 A;  2CPJ A;  1WSR A;  3D7S B;  3KK2 A;  3G87 A;  5MAO A;  2IM2 A;  4LRC A;  4O3Q A;  4IOC Q;  3OW2 R;  1SL0 A;  2R7S A;  1REG X;  2A6M A;  2EVZ A;  2R7O A;  4DX5 A;  4JI6 F;  4PUO B;  4I4B A;  1VK3 A;  1GEH A;  2VDI A;  2MMY A;  4L74 A;  4EO6 A;  1HFE L;  3BGR A;  2FQQ B;  4HR2 A;  4IOB A;  2RU9 A;  2JSX A;  4Y6I A;  5IM0 B;  2W2Q P;  2UUA F;  4M94 A;  2OEJ A;  3CCU S;  2W4C A;  4MKA A;  3BQ1 A;  1CS4 A;  1JNR B;  2GQ2 A;  3N9U C;  1JJC B;  4L3K A;  4NOH A;  5SUH A;  4OHZ A;  2BKO A;  3HT3 A;  4Y00 A;  2R7X A;  3K7R A;  2OPR B;  1M5S A;  5KFS A;  3CCM S;  1YIJ S;  3SDE B;  1RKJ A;  4P73 A;  4ZK7 M;  2E5H A;  4LF8 J;  3PJW A;  4ZLJ A;  5HK4 A;  2APO A;  4ILR A;  4J9Q A;  4ILM A;  2YWG A;  1MU2 B;  4F26 A;  1FD2 A;  3DOM A;  2OPQ A;  1YI2 S;  3NBP B;  2NLW A;  1YJN S;  2NXN A;  3ZTO A;  3MR5 A;  1VHI A;  2HPU A;  4C3K A;  4P2M A;  4DN9 A;  3NG8 A;  3PY8 A;  2GIR A;  3A1Y G;  2P6S A;  4FBU A;  2HQ3 A;  4I2P B;  1LFW A;  3GYG A;  2IRU A;  2XLJ A;  2ZC4 A;  3CE8 A;  3N79 A;  3EZO A;  5EN1 A;  2UXB J;  3HX9 A;  2CPX A;  2BOA A;  2DIT A;  1WWH A;  2FJW A;  1RHQ B;  1RI7 A;  2XZT B;  2QFI A;  2DT9 A;  2DGX A;  3LWL A;  3FBE A;  4ECS A;  3I32 A;  4DPW A;  2HNZ B;  3V4I B;  1CJT A;  2P5V A;  3MF5 A;  3ZZR A;  1R8C A;  1WOP A;  3CCZ A;  4HDG A;  5HSP A;  5HQ8 A;  3BPS P;  4C8N A;  5KT3 A;  3IM9 A;  4LF8 F;  3M8Z A;  1FX2 A;  1NUE A;  1KWM A;  2ZNY A;  3BGF A;  4V1A k;  1T03 B;  5AJ3 J;  3DLH A;  2Z2Y B;  3G82 A;  3KUG A;  3L9Z A;  1ZTT A;  4PQU B;  1OSD A;  1AT1 B;  2JEI A;  4UW2 A;  3BSO A;  3AHP A;  4RUH A;  3A3P B;  3LPY A;  2VJU A;  3JQK A;  2D1C A;  4LRB A;  1WHY A;  3EUN A;  4O3N A;  3CJT A;  5KFF A;  3UR0 A;  2B8Q A;  3LA0 A;  4A8F A;  4QYZ J;  3GR0 A;  2Q6C A;  1BQN A;  4DR5 F;  2H48 B;  1RTH A;  2ZVI A;  2YNF B;  4M5M A;  2ASY A;  1OYD A;  1YG0 A;  4G1Q A;  5HJY A;  1RTI A;  2XI2 A;  4LF6 F;  1KQG B;  3IWX A;  4UZC A;  3FRY A;  3UCG A;  2EWH A;  2J0X A;  5DM7 Q;  1UWB A;  2K7J A;  2OAU A;  2DHX A;  4Y65 A;  1UJ4 A;  2QA2 A;  1S1T B;  2ABY A;  1S99 A;  2MB0 B;  5AE3 A;  1U8W A;  2N4D A;  2DIS A;  2JOQ A;  2XSF A;  1UVI A;  3IFE A;  2MKI A;  3ONQ A;  2HHT A;  2V0N A;  4JI2 J;  2OSQ A;  3E51 A;  4KPY A;  4YOE A;  1SL2 A;  3TW0 A;  4RW4 B;  3MDF A;  3GYX B;  4C0O C;  4KSE B;  1HYS B;  1N52 B;  4JI1 J;  4USH A;  3LGN A;  2N3O A;  3DLG A;  2F8H A;  2FZC B;  1D3W A;  2F65 A;  2FLP A;  5F8N A;  1T03 A;  3MWB A;  5E3A A;  4PPZ A;  4A8Q A;  4K0K F;  1X60 A;  1RA6 A;  3KUH A;  3M1V B;  3NS6 A;  4ICL B;  4LSL A;  1FJG F;  3CC4 S;  4U67 Q;  4J7C A;  1NME B;  4BDP A;  2EG2 A;  2DD8 S;  1YVF A;  1UFW A;  5C2G A;  4JI7 J;  1WUU A;  1DTQ B;  3ETO A;  4QIW D;  4BWJ A;  1QE1 A;  2W2M P;  3BEG B;  5HJX A;  4UZB A;  2YNF A;  1ZZN A;  5H9F K;  4NCG B;  4ED7 A;  2CPY A;  2VG6 A;  4KH1 B;  1NND A;  3V5R A;  4XK8 C;  2MZT A;  2FLL A;  1KTQ A;  1VGY A;  1B3T A;  2QMU B;  1BMQ B;  3D67 A;  1QJH A;  3BO3 A;  1GMW A;  3G6Y A;  3E2E A;  5H1S V;  3H7H B;  3MR3 A;  3QIP B;  5HVG A;  2EKN A;  2IA0 A;  1VCT A;  4NL5 A;  2RUS A;  1CG2 A;  2J8A A;  3JSB A;  4J9P A;  1Y10 A;  1G6B A;  2VPW B;  3DHX A;  3J81 U;  1QLN A;  4QU6 A;  4K0K J;  2QLJ B;  2H9Z A;  3PFE A;  4J9N A;  1E6Y B;  2V8D A;  2BAC A;  3CCE S;  1YDL A;  1IR2 A;  4BWM A;  4ECY A;  2XB2 D;  1J5E J;  2HW3 A;  1QTN B;  2MKC A;  2V4J A;  4RJV A;  1YJ7 A;  3H59 A;  3BQ2 A;  1VQL S;  2CDR B;  5K14 A;  1Z2Z A;  2D74 B;  4E2F B;  2E29 A;  4OJH A;  4I6W A;  3Q8R B;  2Q79 A;  4OHV A;  4WKY A;  1YX2 A;  5J2M A;  2UUB J;  5E41 A;  1BQM B;  1OY9 A;  4PUO A;  2J76 E;  4MFB A;  4EBE A;  2YKN A;  5A8W A;  3SZ2 A;  1VQP S;  2X51 A;  2G9O A;  3MUM P;  1JXE A;  4OZJ A;  3RG6 A;  3RUB L;  4DS4 A;  2GW8 A;  4FVC A;  2EG1 A;  2C42 A;  2MZS A;  4PYD A;  5E5N A;  4WJB A;  3EXC X;  5AE2 A;  4XDD A;  4LBH A;  4EMD A;  3I4H X;  3V81 B;  1DZ5 A;  3MOJ B;  4B9N A;  3K5M A;  3MXH P;  3M6U A;  5T14 A;  3NNH A;  2JEG A;  1X4B A;  1SCJ B;  2IFX A;  4M8L A;  2FVQ A;  2FVC A;  1FHT A;  2XM3 A;  2OEL A;  4ZIW A;  3CSK A;  5B09 A;  3CB4 A;  4JI5 J;  3DDI A;  4H4M A;  4M5L A;  4N7T A;  2HQD A;  5HQM A;  1N5S A;  5HMW A;  3PW5 A;  4A8O A;  2N7C A;  2ZM6 J;  2YH1 A;  4ECZ A;  1IKW A;  3EMT A;  4EFA C;  2ALY B;  3T1H J;  2DR7 A;  4LSZ B;  4OV6 A;  2WZ1 A;  3MAH A;  2YKQ A;  4K4S A;  4QIG A;  1U2F A;  4CO0 A;  2C28 A;  2MLZ A;  4CO1 A;  5HVH A;  2XO6 A;  1FEE A;  2OFG X;  1VQ7 S;  4DHV A;  1XMO J;  1QDU B;  3F0N A;  1L5U A;  1CQM A;  1T95 A;  2GVZ B;  4NMX A;  2FJX A;  2OEM A;  2D41 A;  3P5T L;  5HQL A;  3CPW R;  1JJ4 A;  2DRB A;  1EQM A;  3CJ2 A;  2NCK L;  3PRB A;  1HKA A;  2VOP A;  2GQC A;  3M7V A;  4ED8 A;  1GTE A;  2AEJ A;  3BSC A;  3CJQ A;  2FYX A;  4LIW A;  5H9F J;  1BHN A;  4X64 J;  3IWN C;  3MUR P;  2MXY A;  1NJY A;  1QAX A;  1HNX F;  1N5Y B;  2FTR A;  3R5B A;  4RW7 A;  2CJA A;  4KFB A;  2R7W A;  1RKI A;  1F9E B;  1WI6 A;  3G82 B;  1HMV B;  4FXD A;  5IS2 A;  2ZHO A;  1M0S A;  2B56 A;  5A76 A;  3KWM A;  4J9U E;  2EC2 A;  2O66 A;  5FLX U;  1ZZF A;  1N54 B;  1XEZ A;  2AD9 A;  4NXN J;  1I94 F;  1WC5 A;  4ZA1 A;  3KTQ A;  1Q5Y A;  3POT B;  3N5F A;  5C2C A;  2KJV A;  4L3N A;  3M9N B;  5DLF A;  2RS2 A;  3MPY A;  2V2Z A;  5IZH A;  3NCP A;  5DDP C;  1FA0 A;  3JTN A;  3O8W A;  4RPF A;  2GML A;  4RNO A;  2ZH9 A;  3A3O B;  3QJP A;  4CLP A;  2JLE A;  3QPI A;  1DJ0 A;  3DKD A;  4WXO A;  1UWB B;  3PFO A;  2PA8 D;  4U8V A;  1YIT S;  1S6P B;  1PJ7 A;  1SV5 A;  3BR9 A;  3QT7 A;  4PG5 A;  2AT1 B;  1Z2L A;  2J9D A;  1EKR A;  1T05 A;  1VR6 A;  1TAQ A;  2HHS A;  2C3Y A;  2XGP A;  1PO6 A;  5HAO A;  1AYE A;  3EDQ B;  4YB1 P;  4OMF G;  2H1Y A;  2YH0 A;  4NYO A;  4KGM A;  3W9J A;  3C16 B;  3B54 A;  1HAR A;  1DQ8 A;  3UO0 A;  1IKV A;  1HQU A;  1CUL B;  4B9U A;  3HD2 A;  2CPZ A;  2CA9 A;  1U47 A;  2JFD A;  2FJV A;  3SCL E;  2K3I A;  1WOS A;  1C4C A;  1B7F A;  1TP7 A;  4EWT A;  4AFF A;  4YDX A;  2XNQ A;  1I5O B;  3MCM A;  3ILJ A;  3WX4 A;  3I56 S;  2NZ4 A;  1TKD A;  4LF2 A;  3VZH A;  3KLV A;  2FGO A;  2GA7 A;  5I4M A;  1TK8 A;  3BBF A;  2XO7 A;  2MST A;  2PMH A;  3IBF B;  2MQO A;  4ICL A;  4LSL B;  2V8V A;  3H2V E;  4DDF A;  3BO4 A;  2FVS A;  1S9G B;  2GVD A;  4C3L A;  4URQ U;  3CJ0 A;  2QLF B;  5DLG A;  2HRY A;  2BBE A;  2NSB A;  3CO9 A;  4NLP A;  5KT7 A;  1BGX T;  4DUZ J;  2HVZ A;  3A8K A;  4YEA A;  5EGY A;  1TFY A;  1W7W A;  3CJS A;  3J7A N;  3LQV A;  3ITH A;  4I64 A;  4FDF A;  2DNG A;  3NY0 A;  4O4G A;  4JYA J;  1A6L A;  2KFN A;  3Q24 A;  1IJF B;  3OUY A;  3EPI A;  3SCK E;  2UU9 J;  1BQX A;  2VG7 B;  1NK8 A;  4QPX A;  4F4Y A;  3DM2 A;  3DHW C;  3RAX A;  2HQC A;  4JI3 F;  4RUC A;  2W25 A;  2AYG A;  2YNG A;  1N48 A;  3CVK A;  5DG8 A;  1FJE B;  1LOU A;  1NEE A;  2GHV C;  4Q2M A;  1HNI A;  2QFJ A;  3TEG A;  1RAJ A;  2MKH A;  1R0C B;  1S48 A;  4P9S A;  1N36 F;  2R3V A;  5A8R B;  2POK A;  1L3T A;  5H9E K;  2LDI A;  4WK1 A;  4C7Q A;  3H42 A;  5F8M A;  1XNQ F;  3AA8 A;  1VLO A;  4LF7 F;  2EBE A;  4RL1 A;  5IXU A;  6FD1 A;  3R6G B;  2OD6 A;  4O4R A;  3D68 A;  4PXB A;  4E0D A;  1FJ7 A;  4F67 A;  1SH3 A;  5KG6 A;  3I87 A;  4Y2M A;  3EGZ A;  1H3D A;  2P9G A;  4KGX B;  3THP A;  5GAH I;  3OJS A;  4PPD A;  4X64 F;  2DGT A;  1URR A;  4ECQ A;  3MED A;  2LEC A;  1ZBT A;  1WKK A;  4Z7Y A;  2CG4 A;  2MZR A;  5HMX A;  1JLC A;  4IQX A;  2HFV A;  3BGO P;  3PG9 A;  2AGO A;  2AX0 A;  3DRX A;  3IP0 A;  3MEE B;  5IQQ A;  2IC3 A;  1JXL A;  3N01 A;  4NI2 A;  1SUQ A;  3M6W A;  2F5G A;  2CQH A;  2DYA A;  2UZA A;  5LXR A;  4EBC A;  3W9H A;  4WZQ A;  2AIR B;  1DTT B;  3QGP A;  3EM1 A;  2YWW A;  4IG3 B;  1NHK L;  1S49 A;  1U09 A;  2J0W A;  1FT8 A;  3AQO A;  5DZ7 A;  4DR7 J;  4HT7 A;  5D78 A;  5D4L A;  1NDC A;  3SQG A;  4A8K A;  2C3O A;  4KTQ A;  1XIQ A;  3BB5 A;  4DV5 J;  2WVC A;  2J9D E;  3R97 A;  3RBE A;  3NAI A;  2MGZ B;  4ECV A;  4LF5 F;  4JUZ A;  2HQI A;  2HNZ A;  3I0R B;  3I9Z A;  4A8Y A;  3Q83 A;  4AE5 A;  1SI9 A;  1J27 A;  4NEZ A;  1T05 B;  4AYB D;  4TLR A;  1DY3 A;  1Q53 A;  2A2D A;  2ZOM A;  4KV8 A;  4OZN A;  3UCU P;  1KFS A;  2KRR A;  4ETZ A;  4MK9 A;  2PMZ D;  2DR8 A;  2LQB A;  1YZ6 A;  3IA0 A;  4DV4 F;  2GMJ A;  1RTD B;  5BYQ A;  2RML A;  2RU3 A;  3IWL A;  2XCP A;  3IGN A;  1LWC A;  4OYO A;  1X4E A;  2JNJ A;  2QV6 A;  4K7Q A;  1VQY A;  5K9F A;  4CYU B;  2BJ8 A;  3EVM A;  1DUR A;  1S57 A;  3CCW A;  3MZI A;  3TA0 A;  5C24 A;  5HMZ A;  1U45 A;  1N33 F;  1T9X A;  4CLZ A;  5KFP A;  3LF0 A;  4WK3 A;  4B02 A;  3T1Y J;  3THV A;  4DPO A;  4ER8 A;  1IM6 A;  1TL4 A;  4WYW A;  4DJB A;  1FER A;  4ES3 A;  2BE9 B;  2VBW A;  4I68 A;  3MCS A;  3VQS A;  1D8Z A;  3I5C A;  3MEE A;  3CCV S;  2V6A A;  1PC4 A;  1NZA A;  2HBY B;  2B9X A;  1RAD B;  2VA2 A;  2IM1 A;  4B9S A;  4NYZ A;  1UTA A;  4IFV B;  4YDD B;  1FKA F;  1WNE A;  2DY9 A;  3GZ7 A;  1Q4R A;  2Z2L A;  4OX6 A;  1X4A A;  2XY5 A;  1PKU A;  3GIL A;  4NLX A;  4H4O A;  1LK7 A;  3HFV A;  4JV5 J;  3BGL A;  2K7K A;  1SL1 A;  2LXU A;  1T7P A;  3TAM B;  4PXD A;  4DSL A;  5HVF A;  3CNQ P;  3FBB A;  1K8A T;  4YUD A;  1S9E A;  1QVF R;  4QWE A;  1M1G A;  4NLG A;  3R7B B;  3MEC A;  4ZN3 A;  2GHW A;  1CUL A;  3AOC A;  4FPR A;  5F8G A;  1Q8I A;  1RTZ A;  2R7Q A;  3H5S A;  1KN6 A;  4IDK A;  4P52 A;  5FLX Y;  4K4X A;  2XSJ A;  3SQO P;  4ZVR B;  5L39 A;  3N6N A;  2UUC J;  3DMJ B;  2JRS A;  2VHG A;  2KFZ A;  2GIF A;  4ZLP A;  4FKY A;  2HMI A;  2NPI A;  1IR0 A;  2E1R A;  3MR7 A;  5J1N A;  4K2X A;  2HIQ A;  2DCU B;  3HKZ D;  5E33 A;  3UWT A;  1KNZ A;  3BN7 A;  1CQN A;  3R7N B;  4DCJ B;  3BO2 A;  4K4Y A;  3HFK A;  4JI0 J;  3UVJ B;  4WYL A;  2LU1 A;  1X5S A;  2VG6 B;  5AJ3 F;  4DL3 A;  1FE0 A;  3BDP A;  2PE8 A;  1EZZ B;  2QA1 A;  3MD3 A;  3S01 A;  4DN0 A;  4XAK A;  1Q81 T;  2PI5 A;  3QRR A;  2ZE2 B;  2GGP B;  2GAG C;  3OLA A;  1GT8 A;  1T9W A;  2DHA A;  4C8Y A;  5CYM A;  2ALZ A;  2F4V J;  2B6A B;  2ZKU A;  3MMB A;  2MLY A;  2B51 A;  2EKY A;  3ZZO A;  2VD3 A;  2P9C A;  3MMC B;  3GLJ A;  5KFY A;  2RQM A;  4ECT A;  5CXT A;  2Y8W A;  1UEU A;  1YJR A;  3FEX B;  1E6Y A;  2R42 A;  1EAR A;  4DZD A;  1R0A A;  2IAJ B;  4TY9 A;  3DDN A;  3MTK A;  1U1P A;  1M5K C;  3HLU A;  5K14 B;  3TP2 A;  1RT7 A;  1RLD A;  1WKJ A;  1WI8 A;  5HBM B;  2ZZN A;  3CED A;  5LMN F;  4LQ9 A;  2MLX A;  1HNW F;  2LXF A;  3OXG A;  3GYN A;  1I6J A;  3PO5 A;  2C2E A;  1Y5I B;  4TQS A;  4ZVF A;  2VG5 B;  4GVB B;  1X4G A;  3CD5 A;  1ZM9 A;  2XMW A;  4ZVT B;  3PYF A;  4NWB A;  3WC0 A;  2XLI A;  1N0V C;  3VHQ A;  3H2U B;  9RUB A;  3GIR A;  2VBZ A;  3M30 B;  4LF7 J;  3UCZ P;  1F0X A;  5B7W A;  3FK4 A;  5C25 B;  5DG9 A;  2CJB A;  4Y2K A;  1XR7 A;  4PG8 A;  3J80 U;  5B0D A;  2CZV C;  1TMM A;  2IM3 A;  2VPX B;  3HF5 A;  1LW2 B;  3CT9 A;  1KVK A;  2E44 A;  1JLA A;  3TZY A;  5JJB A;  3M2R B;  2FY1 A;  3VVU A;  1NB7 A;  2YVS A;  4DF8 A;  1SIW B;  2QYG A;  2Y3Y A;  4NI2 B;  3QWU A;  4U8Y A;  1FXR A;  2H5E A;  4FS1 A;  3BV8 A;  1IBL F;  2E9R X;  2KM8 B;  3V81 A;  1EP4 B;  4NLV A;  4TLQ A;  1B0V A;  2KJW A;  3BSN A;  2BOP A;  3MGJ A;  3Q8V A;  2YKO A;  3NBP A;  4UOF A;  4QWA A;  4F02 A;  3GWC A;  2WAQ D;  2QGF B;  1DHM A;  3DCA A;  4X4O A;  2HHX A;  2IBK A;  1RBL A;  1Y3K A;  3QWP A;  2BE2 B;  3KNA A;  3OR1 A;  2AJF E;  3KXD A;  4LFA F;  4CH7 A;  2CKW A;  4XIU A;  5LOQ A;  2PDA A;  2KZZ A;  1HWL A;  3B6B A;  1JKH A;  1WF2 A;  2EFP A;  2FPH X;  4LSN B;  4NX9 A;  3JYT A;  5JVH Q;  5HLF A;  2P2C B;  5LJ5 Y;  2XS2 A;  2CXE A;  5T41 A;  2L9N A;  2OHD A;  1DQ9 A;  1HI8 A;  1VMB A;  2DNL A;  1RP5 A;  3DOL B;  3LP2 A;  2EFG A;  4EYH B;  3AXK A;  2Y1R I;  3I5B A;  4CLU A;  1OY6 A;  4K8R A;  1M5P C;  3BS9 A;  2JZ5 A;  2H4Y B;  2D9O A;  5CH7 B;  2XSJ B;  1WDT A;  2GV1 A;  3F41 A;  3HKW A;  3MPW A;  3TUI C;  4FF3 A;  2BJD A;  2VFV A;  4MKV A;  2WTF A;  4DCP B;  2UUC F;  1O6X A;  2RHQ B;  2HBQ B;  2NUH A;  1YGY A;  4FYV B;  3VZI A;  3W2W A;  3Q8S B;  3M9O B;  4M63 A;  1HD1 A;  3KLH A;  1U1R A;  2ROP A;  1BQN B;  1S6O A;  4B9T A;  3PW2 A;  1UCN A;  3NNC A;  4G1Q B;  4GC7 A;  2FVR A;  2BJE A;  3TUJ C;  3FQK A;  3U02 A;  3PV8 A;  4RBT A;  1RBO B;  2DHG A;  2WOM A;  4HTI A;  1OO0 B;  3NGR A;  2D3U A;  2B5J B;  1N5Y A;  4BS2 A;  3OTO J;  3QFW A;  1NSK L;  4OLP A;  3J7Z T;  3FSX A;  3K0J A;  1G3O A;  4DSK A;  2J9C A;  1SV5 B;  2MYF A;  4WF9 Q;  3VCD A;  3MAA A;  1X9W A;  4RLE A;  2QSF A;  1NCL A;  4OX7 A;  2AMC B;  2W1B A;  3LO3 A;  4Q45 A;  4PWD A;  1LEO A;  3BKF A;  1S1U A;  5G0R A;  3L7P A;  4F2S A;  2FB0 A;  5DJB A;  4KRW A;  5M2P A;  3KK3 B;  1RAB B;  4B3S F;  2HFN A;  5E3P A;  3L95 X;  5HI7 A;  3RB3 A;  2BR0 A;  1Q1K A;  2CNO B;  3T5K A;  2WON A;  4JI4 F;  2XZW A;  1Y3J A;  1TL7 A;  2RJZ A;  2XYH B;  3FBC A;  1NKC A;  4NEY A;  4IQM A;  2C2D A;  2IMW P;  3KG0 A;  3LP0 B;  3EE3 A;  1Q95 G;  4LFC F;  3R5J B;  1HR0 J;  2DHS A;  2DK2 A;  2VG5 A;  4GVB A;  4ZHR B;  1QSS A;  5DZ6 A;  4DSF A;  1HHQ A;  4DPT A;  2VBY A;  3C6U B;  3HPO A;  2XNR A;  2IM0 A;  3X1L B;  1N5T A;  1VQ4 S;  2IVM A;  3KJN B;  1QSY A;  2CQG A;  1LV5 A;  3F44 A;  4OI1 A;  1O8B A;  5CYJ A;  1UVJ A;  2HIY A;  2B6A A;  3OQ2 A;  3VGU A;  4RNF A;  3KLG B;  3RB4 A;  4S0M A;  2AJ0 A;  4FBT A;  4TN2 A;  3CGI A;  5J2Q A;  3DGP B;  3HSJ A;  2YBV A;  4DR3 J;  4HLB A;  1HWJ A;  3ISN D;  4K4Z A;  3DRP B;  1XMQ F;  2B4V A;  2ZH5 A;  2M9K A;  2UVV A;  4X65 F;  2FHM A;  4DV2 F;  4B9V A;  1K0T A;  1CC8 A;  3V6J A;  3OUY B;  3OJU A;  4EZ6 A;  4ZVE A;  1GH8 A;  3ENQ A;  1EP4 A;  3BKT A;  2CNK B;  2ZBI A;  4R25 A;  5GMK a;  1RBA A;  3PW7 A;  4DL4 A;  3FMB A;  3IR5 B;  4HAC B;  1BE4 A;  1NLK L;  3D3B J;  5ETO A;  1FFW B;  4HH1 A;  5AXL A;  1UVN A;  2IYG A;  4UOC A;  3OHB A;  1X7V A;  3HFZ B;  5IWA J;  2XY7 A;  3U7J A;  1SBR A;  2C2Z B;  2FJE B;  3W61 A;  4F04 B;  5KAK A;  4CCH A;  3SI8 A;  4DL6 A;  4LQ3 A;  3M8Q A;  4MMO A;  1XMB A;  4CI0 B;  2CVE A;  1IBK F;  1PAU B;  3SYZ A;  3JS9 A;  2MHN A;  4LRF A;  2M4M A;  1TKX B;  1WG4 A;  1OY8 A;  2VQF J;  1MWZ A;  1QAI A;  2MQM A;  4NCG A;  4M95 A;  1C0T A;  3QAU A;  4KE5 A;  3H4B A;  2RD5 C;  3IAM 9;  3N6M A;  3FUY A;  5RUB A;  1XNQ J;  2ZIT A;  3RRK A;  3SBM A;  3CCQ S;  1X5O A;  4Q0B B;  2XMA A;  3SCI E;  1PYO B;  5B0E A;  1QM9 A;  2CZ4 A;  2PII A;  5HMY A;  5KT2 A;  2EXU A;  1FFS B;  4JV0 A;  4DUZ F;  5D8H B;  3DLK B;  1FF2 A;  3R9L A;  4A8W A;  1U25 A;  3OD2 A;  3TRG A;  4J9L A;  5KG2 A;  4CO2 A;  1V5V A;  2RHS B;  1VQK S;  3A12 A;  4ZDN A;  5JMN A;  1UMJ A;  3FC9 A;  2DO4 A;  3VV2 B;  3S6E A;  3W66 A;  4A8X A;  4F4X A;  1GXL A;  1NDL A;  1U0H B;  2DRA A;  1H2U X;  2Y0B B;  1UW4 A;  3A8J A;  1I94 J;  4NML A;  3EWG A;  1TK5 A;  1N33 J;  1Q5V A;  3TAP A;  5LMU F;  4DFK A;  1B64 A;  4DUT A;  1ROF A;  2ZBQ A;  4P75 A;  2LMI A;  2V2Q A;  3PHE A;  4XDC A;  2PI4 A;  4Y34 A;  1V3Z A;  2BMB A;  2PD1 A;  2XZD B;  8RUC A;  2XLK A;  3Q89 A;  4UTG A;  4GO7 X;  1KSP A;  3CC7 S;  2X1B A;  3CJR A;  1LNQ A;  4ATN A;  2Q66 A;  1MSW D;  4M5D A;  5DDR C;  2ZOG A;  3MAA B;  1RU1 A;  1P27 B;  1D9D A;  1JXV A;  4KFB B;  3NGU A;  1JLG B;  3R7S B;  2IDE A;  4N47 A;  3HZE A;  5GAE I;  5D0G A;  4B3O B;  3GJR B;  2ERR A;  2W01 A;  1IWA A;  2VIH A;  2RE1 A;  3UN5 A;  1K0V A;  4J9O A;  2DNH A;  3PNI A;  5BJR A;  3RR8 A;  2MY7 A;  2DGW A;  2M52 A;  3S7R A;  3G71 S;  2AW0 A;  4W4M A;  3QSY B;  3QT5 A;  1VBY A;  3EIC A;  3I0R A;  4ELV A;  3UD3 P;  3KFW X;  3D1H A;  5HP1 B;  2LEB A;  1B0T A;  2QL9 B;  1LWX A;  2FUG 9;  3NAH A;  2UXD F;  2V2V A;  2KKH A;  3HHL D;  4IO9 Q;  2UXC J;  4CQ1 A;  2NPF A;  2MY8 A;  1YLX A;  2IVF B;  3OL7 A;  3KJQ B;  1GXT A;  3MD1 A;  1W25 A;  4RBV A;  4H4K A;  3SEO A;  1ELO A;  1XJW B;  2RIJ A;  4PXC A;  5ETM A;  4B17 A;  3RBD A;  2JC0 A;  1HI1 A;  1W26 A;  3DGP A;  1VRU B;  4DV6 F;  3CDW A;  2ATL A;  4DR3 F;  3OVA A;  1WAC A;  4ZCI A;  1EAY C;  2FHO B;  1U1Q A;  4USW A;  1J2V A;  1OYE A;  3Q8P B;  2HRU A;  4JOU A;  4BLG A;  4LF5 J;  3LP1 B;  3J80 Y;  4ERD A;  1UW9 A;  3HSZ A;  4CO3 A;  3IXQ A;  4ED0 A;  3MPU B;  1HNZ F;  4FF4 A;  2CPH A;  1U7L A;  2KU7 A;  4R0J A;  4C8L A;  1CLF A;  3R5A A;  2EBG A;  3CJ8 A;  5IT0 A;  2CQ1 A;  3ISZ A;  2A10 A;  3MM6 A;  3IG1 B;  4AQY J;  4F36 A;  4RW9 B;  1UJ5 A;  3DMJ A;  3JTO A;  3WHI A;  2EFO A;  2FJB B;  2W9A A;  5BR8 J;  2RQ4 A;  4K59 A;  2AEM A;  3VGS A;  2JVR A;  3D0H E;  4WII A;  1F2H A;  2HND A;  2GO8 A;  3TAM A;  1T9U A;  4YHH J;  2C22 A;  3ZFV A;  3E8O A;  1S97 A;  2VPY B;  1KLM B;  3QAT A;  4MYU A;  3DFE A;  5HAN A;  2K3K A;  1WEX A;  2DGO A;  1FRK A;  3P96 A;  4RWW A;  2W2N P;  2AU0 A;  3U1M A;  1XR6 A;  5DET A;  3CWJ A;  2YNI A;  3TA2 A;  2W7O A;  3H25 A;  2MKY A;  1IVZ A;  3HO1 A;  3I31 A;  3IS9 B;  1A0O B;  5KFV A;  2M7S A;  4G65 A;  1RUS A;  4OJG A;  3NOC A;  3A8E A;  3K59 A;  1Q79 A;  7FD1 A;  4LF9 J;  5F8L A;  2G0J A;  4HDH A;  4JI2 F;  3D6M B;  2PGC A;  2QMW A;  2ROE A;  4ZIT A;  4HI1 A;  1SC6 A;  5HO4 A;  2V63 A;  4XTT A;  2JH3 A;  3OXL A;  3QID A;  4UST A;  5A6W A;  1IUJ A;  2YY3 A;  3UN2 A;  4TVA B;  3VR1 A;  1H73 A;  3CCJ S;  1U0H A;  4DV1 F;  4WFZ A;  2YWH A;  1AA1 B;  1NK4 A;  4YY3 J;  3CJK A;  1ZOT A;  3AD9 C;  4DG1 B;  1YK9 A;  1KHV A;  1FDD A;  2PT0 A;  1RK8 A;  1S9G A;  2GVD B;  3M30 A;  3GFX A;  3CXC R;  4URG A;  5EWE A;  4DR2 J;  2WB1 D;  2C2N A;  1PSD A;  2WSC C;  4ZP6 A;  1HMV A;  1TMJ A;  1ZA2 B;  2X3G A;  3NKY A;  2LFV A;  3NLC A;  2M8D B;  2YX4 A;  3LAK A;  3HM9 A;  1FES A;  1RHU B;  3C6T B;  1UL3 A;  3GII A;  1PBU A;  4DLE A;  4DI6 A;  4X4R A;  5KT5 A;  4USU A;  1Y7P A;  3SSS A;  3RAQ A;  2HFO A;  3M8R A;  4XPC A;  2BA9 A;  1R43 A;  3OFE A;  1YJ9 S;  1N56 A;  2FJD B;  4DSI A;  1OPZ A;  2BEF A;  4JYA F;  2IJN A;  1H98 A;  2OSR A;  4AXJ A;  2M8H A;  4N76 A;  3NWG A;  3CDU A;  1R89 A;  1FE4 A;  1NHU A;  2BE2 A;  4YY3 F;  1FXL A;  3M6V A;  4LRE A;  4J9M A;  3B4M A;  1QSL A;  2V9K A;  3BH7 B;  2CFX A;  4PCQ A;  3GIK A;  3OTC A;  4PZV A;  2EK6 A;  4MH8 A;  3V6H A;  1R8H A;  2QLX A;  2MGZ A;  4UY8 5;  1E6V B;  1YHQ S;  3T6J A;  3CDA A;  1RAO A;  3QT8 A;  3KLI A;  1S1T A;  2R7R A;  3W3S A;  4R5P A;  4DV0 J;  1PG5 B;  3QZ7 A;  2AJ1 A;  3CJ3 A;  1S1X B;  3JAM Y;  2AQ4 A;  3CJ5 A;  2PO4 A;  3A8I A;  5BYR A;  2ZH2 A;  2VBX A;  2BVZ A;  3MM9 B;  1FWK A;  4OFZ A;  4JI8 J;  2QO3 A;  1JNZ B;  1T3O A;  4ED5 A;  3AOD A;  4UOG A;  3ULH A;  4LR9 A;  2HHQ A;  2E5J A;  2CJX B;  2BM0 A;  3EVO A;  1OQ6 A;  1FNO A;  2OLW A;  2V68 A;  3K5O A;  2ZH4 A;  2ACY A;  3HHE A;  2KFY A;  4ETX A;  4AL5 A;  3T1H F;  2W24 A;  1OWX A;  4P7T A;  3MM8 B;  4KKO B;  1GX5 A;  1OSC A;  4IOA Q;  2VC1 A;  4LF4 J;  4USI A;  4WU3 A;  4WE1 B;  4LIR A;  5KTQ A;  2MJU A;  2E5G A;  2V69 A;  2O67 A;  4LUB A;  5KG3 A;  2XS7 A;  2W9B A;  1JLE A;  3QLH A;  3OTE A;  4OYX A;  1KOH A;  4USK A;  4KAI A;  1HQE A;  2R8I A;  5ETP A;  4GKK F;  4C97 A;  2HGL A;  4TKT A;  4OYW A;  2K1R B;  3PW0 A;  1VRU A;  2UVR A;  5ETL A;  2H54 B;  2R8H A;  4ES2 A;  1OPI A;  3KK3 A;  1NSP A;  2YPY A;  4E8U A;  1RTD A;  1LW0 B;  2RB7 A;  2JVO A;  1GMW D;  2WON B;  2R9L A;  1XNR F;  1CJU B;  1GAO A;  1AFI A;  1WC4 A;  4JP8 A;  3GCX P;  1DTQ A;  5KFD A;  2Y1J A;  3PJ9 A;  3AT1 B;  1IKX B;  4YR2 A;  2A0F B;  3UDV A;  3GTY X;  3TEH B;  4ANC A;  2CUY A;  4LR7 A;  3Q0A A;  1RHJ B;  1YJV A;  3D1O A;  3E01 A;  3HDS A;  9ATC B;  1U4B A;  3M05 A;  2B5J A;  1PYS B;  3MOZ A;  2Z4P A;  2DGV A;  3TYT A;  1D0E A;  2KTQ A;  4ZP8 A;  5IT9 U;  4D3H A;  2Y8Y A;  2HFU A;  1S1V A;  2I6W A;  2I0X A;  3JQM A;  3HCX A;  2ZOF A;  3DC2 A;  3NXZ A;  1T3N A;  2CNL B;  1F3F A;  3LAM A;  4H4O B;  3CD0 A;  4F25 A;  4X62 F;  4N77 A;  2OTJ S;  4PWU A;  2FC8 A;  2J6S A;  3UDL A;  1T9Y A;  4WP8 A;  1EET B;  1RT4 A;  3OV7 A;  2KH9 A;  3Q2T C;  4BCA A;  2QA4 G;  1REV B;  4DR5 J;  1KLN A;  5I42 A;  4MIB A;  4NXN F;  2MHE A;  1G7C B;  2V94 A;  1VQ9 S;  1QUV A;  3M6X A;  4KGV B;  3SXL A;  2RS8 A;  1C1B B;  3PRD A;  5FDL B;  4CLL A;  4DQR A;  4DX8 H;  3V6D A;  1S6Q A;  3PW4 A;  5J1P A;  4OQJ A;  1S6U A;  4C0B A;  1IQT A;  2FLO A;  3DLJ A;  1C0U B;  3NWR A;  4TYA A;  1AUD A;  1AZS B;  1RT3 B;  3H98 A;  2W9C B;  5EWF A;  4B3R J;  4ID5 A;  2W2O P;  2A2C A;  1Y9O A;  1TQL A;  1O0P A;  1TVR A;  1F2G A;  1FJC A;  5IV4 A;  3HT0 A;  2H3E B;  3OL6 A;  1ZPV A;  5J2M B;  3OR2 B;  4DR1 J;  3FJ2 A;  2OIH A;  1AFJ A;  2IBO A;  3BN4 A;  2JDJ A;  2W7A A;  2WK4 A;  2HK3 A;  1J5O B;  4B3T J;  4CLW A;  3MR6 A;  4DPU A;  3RRG A;  4DUY J;  4KBI A;  2UV8 G;  4B9L A;  4FYD A;  4J9S A;  2FD2 A;  4H54 A;  3ZTP A;  4EEY A;  1K73 T;  1SJQ A;  2E7W A;  1HBU A;  3CD6 S;  1LW2 A;  4ZVG A;  2U1A A;  5JUM A;  3DLE A;  5B0F A;  1PIL A;  2AJ4 A;  2KHC A;  4MJK A;  1MLA A;  1U1M A;  4FF2 A;  4CP5 A;  5DG7 A;  3G86 A;  4IFY B;  4QR0 A;  1FJG J;  1DAR A;  3LOU A;  3PZP A;  1GK8 A;  2KT3 A;  1PJ5 A;  2ZZT A;  4ZVP B;  2OPP B;  5F8I A;  4UY8 T;  2QEX S;  1P9Q C;  1Z4U A;  4RW6 A;  4FYX B;  4ALZ A;  1FKO A;  3NGD A;  2OI2 A;  1HBO A;  4W98 A;  2L41 A;  4Y28 C;  2KL8 A;  4LF4 F;  4LR8 A;  2DHH A;  3AH6 A;  5FII A;  2LLZ A;  2IRX A;  2XMU A;  2JEJ A;  1CC7 A;  1EHW A;  3CCT A;  4IH7 A;  3AJD A;  5KT6 A;  3UNG C;  1JK9 B;  3N4W A;  1FO1 A;  1HPZ B;  1S9E B;  2IJR A;  3JXO A;  3O5T B;  4M5G A;  4WBF A;  5GVQ A;  4U7U K;  3UNY A;  4R5P B;  1LWC B;  2G13 A;  4OYM A;  2HK2 A;  2ZDO A;  2V2K A;  4IH5 A;  2ACM A;  4ZPV R;  3G6V A;  1WOR A;  5EUH A;  5KFX A;  2HYI B;  2YKA A;  3FCW A;  1UPM B;  2DR5 A;  1UZH A;  2DNQ A;  3D6H B;  4NRU A;  2Z2M A;  2RDI A;  3QZ8 A;  3HUL A;  2DNZ A;  3W62 A;  5IWA F;  2E9Z A;  1S1W B;  1ZAX A;  4DR7 F;  1JQG A;  1T9V A;  2QJ3 A;  3IMQ J;  5HRO A;  2Y1L B;  1IBK J;  1S76 D;  3UVJ A;  1IBM J;  4RU2 A;  3W8P A;  3JSY A;  3R2D J;  2DNK A;  3Q8U A;  3HHN B;  4G3I A;  3BGU A;  1VQO S;  2LP4 A;  2GGP A;  5L38 A;  4A47 A;  3PEJ A;  5C5J A;  1U8S A;  8ATC B;  2B4U A;  5KFI A;  4KGK A;  1NDK A;  3GU0 A;  1KQK A;  4FKX A;  4WFA Q;  1HQ2 A;  1WEL A;  3KK1 A;  2JX2 A;  3D66 A;  4KHM A;  4O4G B;  4X4Q A;  4AL6 A;  4QBU A;  1Q16 B;  2QL7 B;  3AA9 A;  4LBI A;  3PKM A;  2VKR A;  4AXI A;  1WHW A;  3D0I E;  2DVI A;  3CDB A;  1RT4 B;  4IH6 A;  2R7T A;  3H40 A;  1S7H A;  4OI6 A;  1JLF B;  5ETV A;  2XMT A;  2ZM6 F;  4DF4 A;  2YWF A;  3D54 A;  3IBC B;  4M5N A;  3VWS A;  1ZA1 B;  1KTV A;  5HBM A;  5LMN J;  4EO8 A;  3C66 A;  1S1U B;  3ZTQ A;  1FKP B;  1NK7 A;  1RT5 A;  5EX0 A;  2GCF A;  1MW7 A;  1EB0 A;  2NUU G;  3CME S;  1RT2 A;  3IO1 A;  2B4P A;  3BGR B;  2MSS A;  2RRB A;  3LH2 S;  2XWX A;  3PR5 B;  2NS1 B;  3JSM B;  2DNM A;  2GX8 A;  4CO4 A;  3KLF A;  2ZJQ Q;  3D6T B;  1U2R A;  2O3D A;  4QIF A;  4RUA A;  1VHF A;  2CQC A;  3MMJ A;  4ITS A;  3I9V 9;  5KOW A;  3VGT A;  3P3D A;  2GZO A;  1JJH A;  4CM2 A;  5CYM B;  1HNX J;  3UDC A;  1U1L A;  3LTO A;  3MM6 B;  1PBA A;  2I9S A;  2P8I A;  2NYI A;  1JLA B;  1Q8K A;  3MMC A;  3EYZ A;  3RB0 A;  1NK0 A;  1J5O A;  2CQ2 A;  2CJY B;  3CJ4 A;  3DOM B;  2CPE A;  4PYA A;  6AT1 B;  2R2S A;  3H8Y A;  5GAD I;  5KFJ A;  1Q7L B;  1NXI A;  2HHP A;  3W65 A;  1GTH A;  3IRW P;  4DR4 F;  2X7I A;  4M5J A;  5E0O A;  5D3G B;  1JB0 C;  4JI6 J;  3NL0 A;  1IKY B;  2VQE J;  2DNY A;  4L76 A;  1KQF B;  3JAM U;  4ECR A;  3OBI A;  3K8W A;  4V19 X;  3QJJ A;  4W90 B;  4KHR A;  1KD1 T;  1RHM B;  1UZD A;  1F60 B;  2W2P P;  1UA0 A;  5D0H A;  2J0S D;  1MMD A;  2F9J A;  1VIX A;  2Y0S D;  5E3Q A;  5HL7 Q;  3C3L A;  5KFE A;  4C4W A;  5T7L A;  1O51 A;  1IWG A;  3KDO A;  4ANE A;  4K50 A;  1UVL A;  1M1K T;  1W2I A;  1S5Z A;  4JBC A;  4LBP A;  4MT1 A;  1NKE A;  3KYL A;  5IT9 Y;  3UQS A;  1KDN A;  3JSM A;  1GQE A;  2HQG A;  2DRD A;  4RWX A;  4OV1 A;  2XTJ P;  2RVJ A;  2IMO A;  1P6T A;  2AZ1 A;  4WXW A;  4ZCL A;  4CWB A;  2Q1L A;  4TU9 A;  4MKY A;  1TV6 A;  2JEF A;  4LVO P;  3NCQ A;  1H7W A;  2RNE A;  3AD7 C;  5ETK A;  4ZPA A;  4DR1 F;  2M88 A;  3DYA A;  3EDR B;  2QIF A;  4X84 A;  5D77 A;  4PEO A;  2U2F A;  2XMJ A;  2AP6 A;  3HI9 A;  4C8Z A;  2BQU A;  1HW9 A;  3KLH B;  1VJQ A;  2WW8 A;  3D4J A;  4LJM A;  1VQS A;  2XMM A;  4L72 B;  3MUT P;  5CQG A;  3AFG A;  4J37 A;  1YJU A;  1DTT A;  4IG3 A;  5D3G A;  2R8G A;  3JTP A;  2BQ3 A;  2F40 A;  1PIE A;  5F41 A;  1BWV A;  3TA1 A;  3CW2 C;  5F9L A;  4PRF A;  3ZZP A;  1X4C A;  2GJ2 A;  1RU2 A;  4NA1 A;  3R8Y A;  1NJX A;  2HBZ B;  2ZDP A;  1N6Q A;  1F5B A;  1VOM A;  3W8G A;  5HN0 A;  4G1P A;  1FVS A;  2HQF A;  1BD6 A;  1RGV A;  2GAH C;  2JC1 A;  4GC6 A;  3TNV A;  1BC6 A;  3ZTR A;  4TQR A;  4FP9 A;  1RAC B;  1VIO A;  2O1P A;  2PMW A;  3NEK A;  4F4K A;  1HBM A;  1RJJ A;  3C6T A;  4RW7 B;  1NPK A;  2LA4 A;  2LEA A;  3U1N A;  4F7V A;  1C1C A;  2RF2 A;  2WVF A;  2MQP A;  1F1B B;  2OPS B;  4PG7 A;  5KT4 A;  3KLE B;  4NYP A;  2GIQ A;  2B0G A;  1RTJ B;  3SCJ E;  1SQF A;  2BJ7 A;  1I51 B;  1GX6 A;  2DXD A;  2G0C A;  4U9R A;  3IR6 B;  4HL9 A;  3VTI A;  4AD6 A;  1ZTW A;  3PXG a;  1SIZ A;  5KFQ A;  1RWM B;  4Q2L A;  3ET6 B;  2R2R A;  1S7I A;  4R0E A;  5I3U A;  1FKP A;  3PCO B;  4ZIV A;  5M2U A;  3K5N A;  1HNV A;  5GAE U;  3OLB A;  4B9M A;  3D5M A;  4U96 A;  5CAA A;  1VQ8 S;  4F3O A;  2HAI A;  3QAE A;  2YWE A;  1KFD A;  1VI7 A;  2XHW A;  4QR2 A;  5CYQ A;  3T1Y F;  3FGV A;  1R7I A;  1TKT A;  4KB7 A;  3DI6 A;  3HVT B;  1CJV B;  1V3S A;  2X1A A;  2EC0 A;  1Q82 T;  4NXM F;  1V9O A;  4WCE Q;  1ULR A;  2DNN A;  3EZ5 A;  4I2P A;  2P6T A;  3MEC B;  2DY1 A;  5B0A A;  2FDN A;  3ZNU A;  3QT6 A;  2IYI A;  4HH0 A;  4ZJO A;  5KFL A;  3K58 A;  2HVH A;  4IDK B;  4MYT A;  2QSW A;  2OP5 A;  1B7Y B;  5LSR A;  3BKU A;  4O0I A;  3KJV B;  3L4B C;  4DBQ A;  4F8R A;  5G0R B;  4QYZ K;  3WX8 A;  2ZJR Q;  4DR4 J;  4NLW A;  2W9B B;  2MKJ A;  1KRP A;  3HVA A;  4ZMM A;  1C1C B;  2RF2 B;  2ZKT A;  3N0V A;  5KFO A;  4X66 F;  4JV1 A;  4URS A;  3F73 A;  4KKO A;  1JJ2 R;  3HJF A;  1D9A A;  1YKW A;  3I4P A;  1CVJ A;  1RTJ A;  2KXF A;  3LAL A;  3MCO A;  1HI0 P;  4P74 A;  5H9E J;  1FXD A;  4ZHR A;  4N56 A;  3K5P A;  4NXM J;  3AQP A;  4W92 B;  2CDQ A;  2XYP B;  3GIM A;  2KI2 A;  3MPV A;  3TQ1 A;  1FRL A;  1ZET A;  3KG4 A;  1AUS L;  5CD4 A;  1WDD A;  1RSC A;  2OO4 A;  2HZC A;  3FDS A;  3IG1 A;  4HEA 9;  3VAL A;  2UVU A;  1VS3 A;  2CVI A;  2BYC A;  2JL9 A;  2HAF A;  1TKX A;  3GQC A;  3FEY B;  3O44 A;  4FN5 A;  4OZL A;  3GV8 B;  2VFS A;  3HMJ G;  2HZV A;  2K1R A;  4QZV B;  3K5L A;  1WG1 A;  1R8B A;  4J90 A;  4WFX A;  5JXS A;  4L6V 3;  1GMV A;  4BHQ A;  2MZ1 A;  5C25 A;  2OPR A;  4K4V A;  4DX6 A;  5LSO A;  2F4V F;  2COL A;  4V19 J;  2BE7 D;  1KR4 A;  5M2R A;  4NLS A;  4N5S A;  3DYA B;  3DLK A;  3ZZZ A;  1IKY A;  3M2R A;  4P71 A;  3W1Y C;  2OPQ B;  2OEK A;  2QX0 A;  2YNI B;  3WDO A;  4CTA B;  4LF1 A;  2DH8 A;  3M2U A;  2CQ0 A;  1NO8 A;  3G8Q A;  2J9E A;  1N36 J;  2V67 A;  3KHH A;  4CLY A;  2UP1 A;  3MEK A;  3U27 A;  4MK7 A;  5A8K B;  1NSA A;  3MR2 A;  1TAU A;  1RAA B;  2B9Y A;  5GAH U;  5LM7 E;  3GJQ B;  2AX1 A;  3NRB A;  5K20 B;  1ZYQ A;  1TK0 A;  1QAY A;  1WG5 A;  4NPO A;  1QAJ A;  2CWK A;  4QU7 A;  3KHR A;  2VFT A;  3DRY A;  4JI5 F;  1SJR A;  3V4I A;  3C46 A;  5AXK A;  1MNE A;  1T02 A;  4M5H A;  4IKA A;  4OZ2 A;  4TY8 A;  4LMZ A;  4NLO A;  1ACM B;  3J81 Y;  4F3Q A;  4ECX A;  4IUF A;  1S12 A;  1TVR B;  2CQP A;  3C15 A;  2HHU A;  1U2C A;  2R8K A;  3DN9 A;  1RCO B;  4ECW A;  2QT7 A;  1RYS A;  2R2T A;  4DSE A;  2PSZ A;  3IC1 A;  5LT5 A;  2IIH A;  2V8G A;  3MAQ A;  5KFH A;  3PX6 A;  3I0S A;  5DO2 A;  3C2P A;  4I67 A;  4NZ7 A;  3CIM A;  2Z30 B;  3QBC A;  1X9M A;  1RT3 A;  2HFS A;  3FVY A;  1OQ3 A;  1MML A;  5DRK A;  2ZH8 A;  4O3P A;  4FVM A;  4DL2 A;  1FTC A;  2VOO A;  1HWK A;  1TKT B;  4O3S A;  1RQ0 A;  1IM4 A;  2OUG A;  5L1I A;  3LAN A;  3J7A 1;  2QE5 A;  2AYM A;  1KOO A;  2MEW A;  3M2V B;  3LP2 B;  4Y2A A;  3TX0 A;  1ZAW A;  4I6Y A;  4J9K A;  3JB9 k;  2VPZ B;  1FRI A;  4KV8 B;  1BXN A;  5K8M A;  1S0O A;  3TR5 A;  4Q7A A;  4Y0F A;  2WOM B;  4ILL A;  4QYR A;  2HHH F;  3V2U C;  3JYT B;  2DNR A;  3UR3 C;  3C19 A;  2AKW B;  3HHL B;  3TZW A;  4M1K A;  2CQB A;  3CMA S;  3OXF A;  2C1E B;  3VAH A;  3D28 A;  4NZ0 A;  1TU0 B;  4B3O A;  3US5 A;  2N7Y A;  2RKI A;  2EK1 A;  3QFH A;  3HD1 A;  2ZC3 A;  3H0P A;  5CD4 H;  3EGN A;  3MUV P;  3R5D A;  2ZBR A;  2V5H G;  4EZ9 A;  1B99 A;  3MM5 B;  2BV3 A;  3DXB A;  4Z2X A;  4XPE A;  5FD1 A;  2AYE A;  2C3U A;  1X31 C;  3SSR A;  4NAS A;  1N8R T;  1CBK A;  7AT1 B;  3ILI A;  5A0Y A;  3IRX B;  1F5A A;  2QRR A;  5BR8 F;  1YTY A;  2YNH B;  5F3Z A;  4CT8 A;  2BRK A;  2I1R A;  4QIE A;  1IR1 A;  2CJ9 A;  2CNN B;  4H4M B;  4E98 A;  5GAD U;  4WFB Q;  3RAM A;  2CYY A;  1LWE B;  2RDD A;  3FFI B;  3L09 A;  3GJT B;  3VAJ A;  1RWP B;  3TAN A;  2HHH J;  2G2Y A;  1EX8 A;  2ATC B;  1U48 A;  4PWD B;  2R7V A;  1Y5N B;  1ZM2 A;  1FD8 A;  4Y3C A;  5DQG A;  4Q5V A;  1HWU A;  4DL0 C;  4I2Q A;  1VQ5 S;  2VKZ G;  2UV8 A;  3FCH A;  5IC4 B;  3NGS A;  4DOZ A;  2VQF F;  4DV3 F;  3M8Y A;  3CTR A;  1KHW A;  1FTR A;  3FBF A;  1GNK A;  1XBW A;  5A8R A;  2CPF A;  2M3D A;  3C14 A;  4OYI A;  4RW4 A;  3GP9 A;  4C0H A;  1N32 J;  4Q8E A;  2WB4 A;  4NA3 A;  4ZVU B;  4ECU A;  3UD5 A;  1X8D A;  3UE2 A;  2Y1I A;  3GSI A;  1F9F A;  1TUV A;  4B3M J;  1LW0 A;  4FNI A;  1SC4 B;  4DFJ A;  1NJI T;  2ASD A;  4CT9 A;  2DR9 A;  2V9W A;  1F9H A;  1RWU A;  1VC5 A;  2VU5 A;  3TQE A;  5A8K A;  1UVK A;  2I8E A;  3G8S A;  1VBZ A;  1LQ9 A;  5L1L A;  1U1N A;  3F56 A;  3CUN A;  2Q3P A;  4F2R A;  4JI4 J;  1R6V A;  2MTL A;  1A7G E;  2HLU A;  3H90 A;  2FLN A;  3H2L A;  2Q43 A;  1R3N A;  2V8P A;  2VA3 A;  5J2P A;  3BDE A;  1JWW A;  2L3M A;  1EQ0 A;  3FZB A;  1X4F A;  2AV5 A;  3SMZ A;  3KMQ A;  3OL8 A;  5L9X A;  1HHS A;  3M8P A;  1VRQ C;  2DH9 A;  4LRA A;  4C3M A;  4DV3 J;  5B0C A;  3BR8 A;  3BJY A;  4KJI A;  2C2K B;  1S79 A;  2W4D A;  1X0P A;  3HZG A;  1TUW A;  2LQ5 A;  4NA2 A;  5AXN A;  2E7X A;  3DNC A;  3CCL S;  3PTW A;  4CNZ A;  2H51 B;  1S1V B;  2NXC A;  1NDP A;  3C15 B;  3TVK A;  3W2V B;  2O01 C;  2Y9H A;  1SJ1 A;  5LXY A;  2N4C A;  2FZG B;  3C8Y A;  4WP3 A;  3Q22 A;  1H38 A;  3O2I A;  3R27 A;  3PR4 A;  2NYH A;  3CD7 A;  3I5A A;  1RT5 B;  2GJF A;  4OJ1 A;  1NJW A;  1XQI A;  3PM9 A;  1WOO A;  1HNZ J;  2E7V A;  2MKS A;  4X65 J;  2G0I A;  2CQ3 A;  3ENV A;  3H5Y A;  5GAG I;  5ITH A;  3GG0 A;  5I3P A;  2UU9 F;  1RWW B;  2OMO A;  3GIJ A;  1N0U A;  3TJA A;  1YBU A;  1IKX A;  2WVD A;  4F3M A;  4IR1 A;  2XI3 A;  2HWI A;  4C9D A;  3RZA A;  4OI3 A;  3KLI B;  3G6X A;  4ELU A;  4X4P A;  5KFT A;  1SXL A;  2JFK A;  1QVG R;  2SXL A;  4ZP7 A;  3M8S A;  1KVJ A;  1JLQ B;  4K4T A;  3DXS X;  4LVN P;  2DEJ A;  3OR2 A;  3J81 j;  5KFB A;  4ZVS B;  1VJW A;  5DQH A;  4DUY F;  4MK8 A;  4P2X A;  2DGQ A;  2KO1 A;  1RAG B;  1DLO B;  1S59 A;  2QYC A;  2VC0 A;  2LDY A;  3IBW A;  1UFL A;  3MI7 X;  4CRJ A;  4DU7 A;  5A2Q U;  3DRR B;  4IRK A;  3VAF A;  3NGK A;  2XBP A;  3B8H A;  2MQL A;  1EJ7 L;  4XO0 A;  2YKP A;  3KHL A;  3T5J A;  4NCA A;  4KHP F;  1EET A;  5E7O B;  3MM5 A;  2XGQ A;  4WWS A;  2WBR A;  1GXU A;  4QQB A;  3GR1 A;  1LK5 A;  1REV A;  2CAD A;  3WC2 A;  1MMN A;  3N6L A;  3SDE A;  3GMG A;  4Z7C A;  3TUP A;  2KT2 A;  1AW0 A;  4LFB F;  3QQC D;  1TEL A;  3O3L A;  3AY0 A;  2D3Z A;  4DL7 A;  2XYG B;  2DNP A;  3AD8 C;  4AND A;  1YRU A;  3P45 B;  5MLC V;  4YR3 A;  3RB6 A;  4LFA J;  5KG1 A;  3R1L A;  2EPI A;  2DR6 A;  2VON A;  5HP1 A;  3VQT A;  3H5X A;  3TAQ A;  4IG0 A;  1Q7Y T;  3AB4 B;  3D1Q A;  2KDO A;  4DV7 F;  1CS4 B;  4I1T A;  5K8N A;  1FRJ A;  5LMU J;  4YQW A;  4PQA A;  2JWN A;  4ZOS A;  1VYA A;  2P9E A;  3M8W A;  3SIP B;  4DV2 J;  1ICE B;  2J5A A;  3C14 B;  4DV5 F;  4F4A A;  3J7Y U;  3BYP A;  3IN5 A;  1S0N A;  3QO9 A;  1X4H A;  1YSJ A;  2PEB A;  3PYE A;  4P7V A;  1WHV A;  4ZJQ A;  1VRT B;  4OZ1 A;  2J7K A;  5IQ6 A;  1NHV A;  3MHY A;  3G6E S;  3TI0 A;  1S4E A;  2EI5 A;  3MED B;  5JVG Q;  2OTL S;  1RHK B;  1FK9 B;  2IDL A;  3X3U A;  2BRL A;  1JLG A;  2XMV A;  4YME A;  4I7F B;  2RQC A;  4DQI A;  2NQP A;  2IJF A;  3DU6 A;  2B9W A;  3W2W B;  3TZZ A;  4KT0 C;  3SFU A;  3WIV A;  4A8M P;  1K1Q A;  3OHA A;  3UI3 A;  2KG1 A;  4EBD A;  4ZP9 A;  3FMW A;  1CJV A;  5KFM A;  1XWL A;  2WSF C;  2YNH A;  2BJ1 A;  5HRO B;  2E5I A;  8AT1 B;  5K8O A;  5J2P B;  2FJA B;  1HNV B;  2KYZ A;  4MIW A;  3H5U A;  3RBX A;  3G4S S;  4UF4 A;  5EHH A;  4O23 A;  3VF0 B;  2D3O 1;  1DRZ A;  5D15 A;  4FF1 A;  3W63 A;  2CG8 A;  1HQE B;  5IFM A;  4AUK A;  2X1F A;  3HSG A;  2G2O A;  2PFF B;  2UUA J;  1L3K A;  1UEV A;  2RQK A;  3CO0 P;  5CAB A;  2OPS A;  4BC9 A;  1UFK A;  2ASJ A;  2IAJ A;  3UFC X;  4JV2 A;  3DM2 B;  4IG0 B;  1RT7 B;  4NLD A;  5CZV A;  1WC0 A;  4EK2 A;  4EYI B;  1L3U A;  2K8G A;  3OT9 A;  1A9N B;  2KYX A;  2DBB A;  1YQH A;  1HNI B;  1U6F A;  1ZAV A;  5L1J A;  1NAQ A;  4C98 A;  2ZNZ A;  3SV4 A;  1RZM A;  4CDI A;  1RTI B;  1JX4 A;  1TL7 B;  2M70 A;  1S9F A;  1JLB B;  1KBR A;  1PYT A;  5DGA A;  2YKM B;  1CPZ A;  1TL1 A;  2Z8Q A;  3LW5 C;  1RT2 B;  4OI0 A;  1HR0 F;  2FVP A;  2FZK B;  1SKR A;  4ZLL A;  1M5H A;  1N5Q A;  2XC9 A;  2EFN A;  4DLG A;  2J6U A;  2MQ8 A;  1H2T Z;  3CJK B;  2VDH A;  1H74 A;  4DPY A;  3ZXW A;  5F8J A;  1RHR B;  3D9B A;  2PFD A;  3PYD A;  4I56 A;  3R1H A;  1UA1 A;  3IAS 9;  2GJI A;  3MEG B;  3O6Q A;  2D69 A;  2MZJ A;  2EFV A;  1HNW J;  3ZO7 A;  3HP6 A;  1MG7 A;  1RWK B;  4YFU A;  2V4R A;  2HUR A;  4K5R A;  2OKQ A;  4Z37 A;  3ILO A;  3QYY A;  3R6L B;  3MPD A;  4IFY A;  2LXI A;  1XER A;  1LWF B;  3CIZ A;  4C8K A;  2W7P A;  1NB2 A;  2OPP A;  2FGC A;  1KKH A;  1KS2 A;  1TTH B;  3OVS A;  4ED1 A;  1JLF A;  5BYS A;  1RXO B;  3M1V A;  2AYB A;  2KVI A;  4A4J A;  3MFI A;  1RWX B;  5DM6 Q;  2H4W B;  1S10 A;  4PKD B;  5KFZ A;  1RLC L;  5ADZ A;  4L75 A;  2IRY A;  4KYZ A;  3EGW B;  4B3R F;  1VBX A;  2QLB B;  3VGV A;  2KHD A;  5A8W B;  3TUZ C;  1RT6 A;  1TL3 B;  2G2Z A;  3GFY A;  5KFR A;  3TWZ A;  1T94 A;  4B3S J;  1QUP A;  2D7S A;  2HBR B;  4MAK A;  4N8N A;  1MRO B;  2DXF A;  2Z2Z A;  4P72 A;  3TAR A;  3AOA A;  2PN6 A;  3RU0 A;  2DO0 A;  3EVW A;  4QW8 A;  3DLB A;  2XS5 A;  4CNY A;  5DDO C;  2VAS A;  1D9F A;  1XR5 A;  4B3T F;  1JLQ A;  2NR0 A;  1ITP A;  2BJ9 A;  3PX0 A;  1C0T B;  1YJT A;  2YQ0 A;  2PA3 A;  3BZQ A;  4ED4 A;  3MMA A;  3G96 A;  3CMQ A;  3NS5 A;  3THT A;  3I0S B;  2ZE2 A;  1N4L A;  5L1K A;  2BJ3 A;  4TY8 B;  2UVW A;  3R2C J;  1ZM4 A;  2IY5 B;  2HNY B;  4KO0 B;  4HT5 A;  3PVX A;  2B9E A;  2DKO B;  5KOX A;  3Q8Q B;  3RRH A;  3AB2 B;  4GRS A;  1TKZ A;  2V8H A;  1IQZ A;  2XMK A;  4I7F A;  5J2N B;  2V4J B;  3FQL A;  3W60 A;  3NMR A;  4MTP A;  3CUL A;  3EX7 B;  1HBO B;  4ID8 A;  4NRT A;  1EIY B;  4F0H A;  1D1U A;  1VIS A;  4DSJ A;  4LF6 J;  1U02 A;  4RNN A;  1WEY A;  4B08 A;  5LSL A;  3Q8Y A;  3MM8 A;  2AF6 A;  1MN9 A;  2FY8 A;  1Y4Z B;  5DS7 A;  1U49 A;  4ELT A;  3ICL A;  2UUW A;  1YJW S;  4R8U A;  2VUG A;  5DGB A;  2B7C B;  1M90 T;  3P8B B;  1C2P A;  2HG4 A;  5DQI A;  4U7C A;  2R2U A;  1D8Y A;  2QLW A;  3W5X A;  5U47 A;  4YP3 A;  2L48 A;  3T19 A;  4DWI A;  2XHC A;  3JQJ A;  3W7B A;  4ZCK A;  2VF3 A;  4M5D B;  4OYP A;  4YB5 A;  4IYQ A;  3ZZU A;  1HL6 A;  2DPI A;  3PO4 A;  5ETS A;  4A48 A;  3L3C A;  4DV7 J;  2HS0 A;  5C42 B;  4CH0 S;  4EUV A;  3FZ2 A;  3QNW B;  3TO8 A;  1Q8B A;  1FRH A;  2AEF A;  1T8E A;  1MU2 A;  1CJU A;  1XK8 A;  1SKS A;  3TJ8 A;  1UAW A;  2RKI B;  2DXE A;  2F63 A;  3DOK B;  2XEX A;  4YB7 A;  4USV A;  2UUB F;  4QWC A;  2DIV A;  4NLR A;  1S77 D;  1UWA A;  4CLT A;  4CZC A;  4OIX A;  1FRX A;  3BRE A;  3ENA A;  2L9D A;  1VC0 A;  3N28 A;  1DFD A;  2CQI A;  2MDA A;  4OI2 A;  3HHL A;  2DPJ A;  3VAK A;  1L3S A;  3GPA A;  2BKN A;  3SSQ A;  1WEZ A;  3GFZ A;  1FEH A;  4HTJ A;  3T5H A;  5KFW A;  1N34 J;  2W8K A;  2A1B A;  2J0Q D;  2ZZM A;  1U1O A;  2E1M C;  2ZWP A;  2I5J A;  1FCA A;  1P8G A;  1LWF A;  2XG8 A;  4D3G A;  3K8V A;  2E5L J;  4I2Q B;  3RBZ A;  1VFJ A;  4PQU A;  1X5P A;  4MIA A;  2CRL A;  2LKZ A;  1RE1 B;  3CF5 Q;  3PHT A;  3OTO F;  1LFP A;  2ZUG A;  2JHE A;  2UUT A;  4QWB A;  4ED2 A;  2IHR 1;  1XN9 A;  3M8Q B;  5K5M A;  1L3V A;  1H0H B;  2YKM A;  4CIO A;  4M5I A;  2CQ4 A;  3BM7 A;  4TXS A;  5EWG A;  3FFI A;  4ED3 A;  2LQJ A;  2NXE A;  1TZ0 A;  5E3C A;  3KMS A;  1U0S A;  2N3L A;  3PIO Q;  1XMO F;  3NGT A;  4K4U A;  2GC8 A;  1R8P A;  3K2Y A;  2FHK A;  2HND B;  1BUX A;  1WKL A;  4WP9 A;  3DI6 B;  1SVD A;  2RIL A;  1FNM A;  3B82 A;  1QE1 B;  3P5B P;  3P49 B;  1YZ7 A;  1N34 F;  3OTD A;  4PR6 A;  4DX7 A;  4Q8F A;  2HKE A;  1BY9 A;  4ZLN A;  4BC7 A;  1RT1 B;  3MEG A;  4IRC A;  2D9P A;  4DS5 A;  2A18 A;  4CH1 A;  1K44 A;  2UXB F;  2C3M A;  2O5D A;  2BKP A;  2RAQ A;  2I38 A;  4J5O A;  4NZ6 A;  3WBZ A;  3CCS S;  3V6K A;  3GFH A;  1R0A B;  1R0B G;  1S72 S;  3D6F B;  3LP1 A;  5K8P A;  2MKK A;  3HVR A;  4ZPD A;  2FHJ A;  1R8A A;  4TNO A;  1HYS A;  2K2P A;  4CTA A;  4DV6 J;  4JI1 F;  1CEZ A;  3BQ0 A;  2YNG B;  4GKK J;  2YX7 A;  5KG4 A;  4DZ6 A;  4F4W A;  5HAT A;  2ILY A;  2UXC F;  1GFW B;  3DDK A;  4Y2I A;  5KFU A;  2CPD A;  3K17 A;  1SQG A;  3UDE A;  5KFN A;  3V6D B;  4DG1 A;  4OX9 J;  4K5S A;  3Q23 A;  3W5Y A;  3FSY A;  3MM7 B;  1S0M A;  1MRO A;  5F0U A;  5C7P A;  4KHP J;  4U7U D;  1JKH B;  4LSN A;  4DMZ A;  1LXN A;  5HLF B;  4RX6 A;  1HA1 A;  1FFG B;  5A2Q Y;  2N82 B;  4MFB B;  3W64 A;  1SJF A;  3DRS B;  1JLC B;  1RWV B;  4RNH A;  4X66 J;  2W9C A;  2AJQ A;  4ZPB A;  5LL6 d;  2YXL A;  4QJV A;  4ZKA A;  3HK2 A;  4NLU A;  5DDQ C;  3AXM A;  5B0G A;  4JV5 F;  1HIY A;  1WSV A;  4FXV A;  1CJK B;  4RW8 A;  3EXY A;  4J9V A;  3I6P A;  4WPA A;  3RR7 A;  1M5V C;  4QR1 A;  2ZHB A;  1RB0 A;  5KFA A;  5C42 A;  1SC3 B;  1FDA A;  1N88 A;  2VL1 A;  1DAX A;  2B8P A;  2F4F A;  4RW6 B;  3IS9 A;  4RU9 A;  3KOA A;  4PXE A;  4C11 A;  4OHY A;  1WF1 A;  1S4F A;  2Z56 B;  4FNH A;  4USJ C;  4DFM A;  5J2Q B;  2DB1 A;  1ZH5 A;  1R27 B;  3QJL A;  4TU8 A;  3I96 A;  3DRP A;  4X4N A;  3M2U B;  1V6H A;  2VH7 A;  4I6A A;  2F9D A;  3MCN A;  4ZPT R;  1F3V A;  2F7V A;  2EEY A;  4QIV A;  3WZ0 A;  3GG1 A;  1RAI B;  3QSI A;  4TYB A;  2F8M A;  4L73 A;  4FPI A;  3ELH A;  4ZPC A;  2YTC A;  4K4W A;  3PX4 A;  4ZN1 A;  2HGN A;  3GJS B;  3BBB A;  3JSR A;  3J7Z 5;  4AL7 A;  1E6V A;  4LF9 F;  2HZA A;  4HYK A;  4PAB A;  5KG7 A;  2X1G A;  3WQP A;  2BAB A;  2OGU A;  2ROG A;  3T6B A;  1S1X A;  4F0M A;  1DLO A;  2ZBP A;  3KNG A;  3ZC4 A;  1K47 A;  1FRM A;  2ZD1 B;  3MM7 A;  3OFG A;  4QW9 A;  1TL5 A;  2IC3 B;  3DOL A;  5D4O A;  2B3T B;  4O44 B;  1H7X A;  3T9N A;  4DXL A;  4EU0 A;  3TVZ A;  2KM8 C;  1G4C A;  4KGZ B;  2VOD A;  3TZX A;  2ZBC A;  2L9W A;  4G6V B;  5I3U B;  3DRS A;  4DR2 F;  4LFC J;  4QWD A;  4DFP A;  3M4X A;  3MTJ A;  1SKU B;  1APS A;  2M2B A;  5CZX A;  3R3T A;  5GMD A;  1VQM S;  1F5C A;  3AJ1 A;  2MQN A;  5AT1 B;  2KG0 A;  3PAC A;  3POT A;  3ZTS A;  1SQE A;  2HWH A;  2WVB A;  1NU4 A;  2HRT A;  4JB8 B;  4KPC A;  5KFG A;  5C24 B;  5LJ3 Y;  4O3R A;  1U6B A;  4NLY A;  1RA7 A;  3M32 B;  2YQ3 A;  2BW7 A;  2CJK A;  4DPX A;  4B3M F;  4DU8 A;  2CZ9 A;  2RT3 A;  4ZVO B;  3BH6 B;  3QGG A;  4GO5 X;  2WCX A;  1URN A;  3OVB A;  2B4O A;  2ZH7 A;  4M5K A;  1J5E F;  3P4U B;  3QIP A;  1T0T V;  4OYB A;  3TX8 A;  3N5B A;  3MFH A;  3T5L A;  1VRT A;  1HD0 A;  2GS8 A;  4FYW B;  1OMS A;  4JI3 J;  3MM9 A;  3KK1 B;  3PYG A;  2A3J A;  1FK9 A;  3G2X A;  2UXD J;  2HLT A;  2RH3 A;  1OIA A;  1RAF B;  1RWO B;  5AXM A;  1KEK A;  5ETT A;  2ADC A;  1SB6 A;  4UQT A;  2QZ8 A;  4HHU A;  3OSN A;  3VAM A;  4JI0 F;  3KJF B;  2YQ1 A;  1U1K A;  1NH8 A;  2VJV A;  1LXJ A;  2NXJ A;  4WFY A;  3RGI A;  3OPK A;  3AAW B;  5A0Y B;  1Y5L B;  2J7W A;  1NRK A;  4WE1 A;  5D0R A;  2KXN B;  4X4T A;  2HVD A;  3KLF B;  2AZ3 A;  4OZ3 A;  3QRQ A;  4HI2 A;  2XWY A;  1HBN A;  1TL1 B;  3L7O A;  4CLF A;  2ZJP Q;  3LGM A;  4I69 A;  1HW8 A;  4WU2 A;  4OHX A;  2ZVS A;  4OL8 A;  2HEK A;  3HVW A;  2LA6 A;  4KH0 B;  3QMQ A;  3VAG A;  2A6O A;  2IA6 A;  2KZM A;  3BF4 A;  2BQR A;  2E1A A;  2VG7 A;  3RJM B;  2XQC A;  4Q0B A;  2GHP A;  3NOG A;  3C16 A;  1OJ4 A;  4P6Q A;  3AJ2 A;  4Q44 A;  2KRB A;  2W8L A;  1IKW B;  2VIC A;  1WJ9 A;  5T7L B;  2HHW A;  5L8R C;  4JI7 F;  1QD1 A;  1TFW A;  3D2W A;  1C1B A;  5FDL A;  1OS5 A;  5ETQ A;  4HVZ A;  2WBM A;  1VC6 A;  1PCA A;  3HHD A;  4WKR A;  4WTO B;  4GKJ F;  3IGV A;  1M5O C;  4RO0 A;  1AZS A;  2VFU A;  2ZEJ A;  1VQN S;  2KVQ E;  4P10 A;  1UKU A;  5D6G A;  2CWX A;  2YPZ A;  1HLW A;  3T9Z A;  3FRZ A;  1FWP A;  1RAE B;  3O1L A;  4EGL A;  4DL5 A;  1TR0 A;  3HXM A;  2Z0G A;  4HKQ A;  2YX1 A;  3BSA A;  3PRV A;  3HHK A;  1RT6 B;  1TL3 A;  4Y2C A;  3ITH B;  5ETN A;  5CCM A;  3UD4 P;  5D4P A;  4YR0 A;  3G8T A;  3PDN A;  4K2J A;  4RR5 A;  1NH7 A;  2CPI A;  5ETR A;  4X4V A;  1Y0H A;  1MWY A;  3Q2S C;  1CJK A;  1R6Y A;  4RW8 B;  1H2V Z;  1HBU B;  1UPP A;  3OSP A;  1TKZ B;  2ZHA A;  1KLM A;  5EDW A;  3FNN A;  3W2V A;  5CA5 A;  4IRD A;  3HSD A;  4WIQ A;  2CAJ A;  4LRD A;  3GE9 A;  2XY6 A;  3HJV A;  2DEI A;  4C11 B;  4NCB A;  1VDH A;  1SUQ B;  1NK9 A;  4X62 J;  3RW6 A;  4KQZ A;  3MMA B;  1KON A;  1VBK A;  2JLF A;  2QTW A;  3ET6 A;  4UUX A;  2Z57 B;  3W5Z A;  2LVW A;  1FX4 A;  2PEH A;  3BYR A;  4C8M A;  1H6K X;  1M1H A;  2ZH6 A;  2OD4 A;  1U26 A;  2DTJ A;  2GVZ A;  1NSQ A;  3RYL A;  3ETM A;  4OZ0 A;  4Q43 A;  3P6Y C;  4X2B A;  2DNO A;  3T1A A;  1V5I B;  1SC1 B;  1XTZ A;  2GFF A;  1KP6 A;  4ID5 B;  5THW A;  4UT4 A;  1B0P A;  4OHW A;  3EGV A;  4F0K A;  5IC6 B;  3GV5 B;  4O3O A;  3U1L A;  1WF0 A;  2VQE F;  1NK5 A;  2YWK A;  1O5J A;  2HGM A;  2MPU A;  2HWT A;  2VFR A;  1QY7 A;  3UN3 A;  4I0W A;  3KUE A;  1ZM3 A;  3OR1 B;  5I3Q A;  4WTY A;  1B4S A;  3R5G A;  2ASL A;  1KC8 T;  4OLO A;  1MWQ A;  1NK6 A;  4FZV A;  1T9T A;  3T41 A;  2R4F A;  4UOH A;  1UP1 A;  5CYQ B;  2JLG A;  2LQ9 A;  1RIS A;  4EI2 A;  1S0V A;  2F3J A;  1FDN A;  4FS2 A;  4TU7 A;  1I3O B;  1NBE B;  4PG4 A;  2EFQ A;  5KFC A;  3DOK A;  3QGH A;  3DLG B;  3CDE A;  3D3C J;  2ZH3 A;  1K9M T;  1UVM A;  1G2E A;  1KVI A;  3RTV A;  3QGI A;  4NE9 C;  1RDR A;  2F8E X;  1RTH B;  1V3R A;  5KG0 A;  2HFZ A;  4YN3 B;  4R8U B;  1VQ6 S;  3I55 S;  2NRE A;  4OI4 A;  1RYR A;  3KJV A;  3GV7 B;  2MZQ A;  4IFV A;  3E3X A;  3B78 A;  1LKZ A;  4DR6 F;  3TOQ A;  3HVT A;  2ZFH A;  3GSD A;  3NP5 A;  4WFN Q;  2HVI A;  3J7Y I;  4DEZ A;  3RW7 A;  4WZM A;  7FDR A;  2G1D A;  1SJ4 P;  1WTB A;  3LGH A;  3KDN A;  5F3T A;  1W2B R;  2C3P A;  4C8O A;  6FDR A;  2BX6 A;  2KN4 A;  2BAN B;  1JMT A;  2HSE B;  3ISN C;  1S6Q B;  3OFH A;  4RNM A;  4ZPW R;  4KY3 A;  5GME A;  2ZH1 A;  2IPO B;  4DV4 J;  2X3D A;  4NLQ A;  4UUW A;  4HHH A;  4YS2 A;  1D09 B;  4ES1 A;  2DIU A;  1JIH A;  2QG9 B;  1S1W A;  4P2F A;  2RRA A;  1P9Y A;  4HHJ A;  2RDJ A;  4GKJ J;  5KG5 A;  1X0F A;  4QCL A;  1FWL A;  1RAH B;  1JLB A;  5IOL A;  4RW9 A;  2E1C A;  2EW9 A;  2E1P A;  4MKB A;  3A4T A;  3SV3 A;  5CHC B;  2AHO B;  1U6Z A;  2CJQ A;  2MJN A;  2RRN A;  1C4A A;  3M9M B;  4YB6 A;  1KQS R;  1HHT P;  4FXW A;  5BXI A;  1XNR J;  1BQM A;  1HBN B;  3GON A;  1B70 B;  1FNX H;  3H4D A;  4RUB A;  2BXJ A;  3D0G E;  4PWW A;  1U24 A;  3OFF A;  5J1E B;  2QN6 B;  3CC2 S;  1XMQ J;  3DRR A;  1MN7 A;  3LPE A;  3KKF A;  1UJ6 A;  1Y00 A;  4OX8 A;  1N32 F;  3C6U A;  3FEZ A;  1RWN B;  4OX9 F;  2OH2 A;  4F4Z A;  2ADB A;  4OYZ A;  1FKO B;  2M0G B;  1IBL J;  2AGP A;  2ZWO A;  4J91 A;  4NLT A;  2HHV A;  2OML A;  3SQG B;  4BBY A;  2MQQ A;  1H72 C;  1NM2 A;  3LP0 A;  5L9N A;  3KK2 B;  1Q0N A;  2BAN A;  2OFH X;  2FC9 A;  4C48 A;  4N41 A;  1DBD A;  2L08 A;  2V4Q A;  1SPB P;  4CO5 A;  3NMA A;  4ZJL A;  1HPZ A;  2W4P A;  2HMI B;  2GO9 A;  2C2R A;  4A46 A;  4DQQ A;  4LFB J;  2HS3 A;  2GMH A;  2H5I B;  4CLK A;  3KG1 A;  4X4S A;  1SKW A;  2BDP A;  1P1L A;  1AB8 A;  3VAI A;  3VVT A;  4HAC A;  4OYA A;  5D4N A;  3ENW A;  1I1G A;  3LUY A;  1FI4 A;  4QOT A;  1BLU A;  3Q86 A;  4LT6 A;  5IM0 A;  3KLG A;  5EX3 A;  2E5L F;  2YKN B;  4ZCM A;  2WSE C;  3QO9 B;  2JJ4 D;  1PGZ A;  1AXQ A;  2KB2 A;  2FIU A;  4OZ5 A;  3UW1 A;  4KIA A;  3TVY A;  3ZZY A;  1TV6 B;  1PAE X;  2I2Y A;  3QRP A;  3V4M A;  1R31 A;  4J9R A;  3MMB B;  1NKB A;  2IVY A;  3LWM A;  2K06 A;  4U95 A;  1GMU A;  4RZR A;  1F6T A;  1ARO P;  4FYY B;  3EZU A;  4ZVH A;  2R8J A;  3K89 A;  2HNY A;  4KO0 A;  3IR7 B;  3M2V A;  3FKB A;  5J2N A;  3H20 A;  4RKU C;  5I42 B;  3L7U A;  4O0N A;  2H65 B;  5G4D A;  3CCR S;  1IXK A;  2NSC A;  4X4U A;  3UPF A;  1N6Q B;  4GMK A;  2C2O B;  3HHL C;  4DQP A;  4KR0 B;  1IBC B;  3A13 A;  5F8H A;  5IV3 A;  1VLY A;  4CM0 A;  1JLE B;  3QLH B;  4ZS6 A;  2KXH A;  2ZD1 A;  1C0U A;  2DGS A;  1FDB A;  2QMX A;  3S8S A;  4IO1 A;  1HBM B;  2LEP A;  4H4K C;  1UET A;  1RCX B;  4CLS A;  2QC3 A;  4CYU A;  1NJZ A;  1IBM F;  2AJ2 A;  1NZ8 A;  4AQY F;  4PG6 A;  4ZVQ B;  3ILL A;  5E2Q A;  2DCL A;  4AT1 B;  1YBA A;  1ZS6 A;  5GAG U;  1X9S A;  3DLL Q;  1IKV B;  1HQU B;  1WC3 A;  2LQ8 A;  3EPG A;  4YHH F;  2WW4 A;  2HVE A;  3I82 A;  2DH7 A;  1G1X A;  5B0B A;  3M32 A;  1Q86 T;  1LWE A;  2M5Y A;  3A3N B;  4P2S A;  2ILZ A;  3TJ9 A;  1SH0 A;  1K1S A;  3R5C A;  5D0E A;  3T3F A;  3DLE B;  2B7B B;  4RBU A;  2CQD A;  2VZ9 A;  1XC9 A;  2LCW A;  4C2M A;  2D3O R;  4C6A A;  3IRX A;  5L46 A;  3ZNJ 1;  2R7U A;  1X5T A;  1Q78 A;  2WRM A;  4KC5 A;  1DQA A;  1WTF A;  2V50 A;  5F0W A;  3W9I A;  3PKY A;  2QL5 B;  3ZZ0 A;  4DV1 J;  4A8S A;  3SFG A;  2QA4 S;  1WC6 A;  4G1I A;  5E3R A;  1CJT B;  1S6P A;  1WD6 A;  1Y11 A;  1YRX A;  2WVE A;  1VK8 A;  3B4D A;  3DU5 A;  3M8P B;  4O44 A;  5J1E A;  3FCV A;  4ED6 A;  2BW2 A;  3FSI A;  1ZPW X;  2RUG A;  2BZ2 A;  2DJW A;  5CCL A;  1NPP A;  2F1F A;  2KT5 A;  1Q8L A;  2RSQ A;  3KLE A;  3PEH A;  4DQS A;  4DR6 J;  2DGU A;  1YWX A;  5B08 A;  3OL9 A;  2E9T A;  2J6T A;  3EJM A;  4USM A;  1SJ3 P;  1PC5 A;  2ZUA A;  1IJE B;  3PIP Q;  1BWE A;  2NZC A;  2OJ3 A;  2BUN A;  4ENO A;  2LU2 A;  2WHO A;  2E66 A;  3NCR A;  2Q6B A;  4DCO B;  2GNK A;  3G9C A;  2J7U A;  3BPD A;  1PJ6 A;  3BBC A;  2BM1 A;  2C2M B;  1T11 A;  3AOB A;  1YRT A;  1QTM A;  3OTB A;  3NS7 B;  5AE1 A;  4PAA A;  2PC6 A; 
#chains in the Genus database with same CATH homology
 2VJV A;  4ER8 A;  2XO6 A;  2XMA A;  2A6M A;  2VIC A;  2A6O A;  2F4F A;  2VHG A;  2XM3 A;  2FYX A;  2VIH A;  2XQC A;  2F5G A;  2VJU A;  2EC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...