2EC2A

Crystal structure of transposase from sulfolobus tokodaii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
MEYKSTRHAKYLCNYHFVWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFQELKKSTNGKLWTRSYFVSTSGNVSSETIKKYIEEQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transposase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Gene regulation
molecule keywords 136aa long hypothetical transposase
total genus 31
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2ec2A00
2F5GA 2VIHA 2EC2A 2XO6A 2XQCA 2A6OA 2XM3A 4ER8A 2VJUA 2VHGA 2VICA 2F4FA 2XMAA 2FYXA 2A6MA 2VJVA
chains in the Genus database with same CATH superfamily
2B3TB 3IA0A 5JVHQ 1TK8A 2M88A 3CJ2A 1VJQA 3WIVA 3RTVA 2HZAA 5D15A 4DQSA 1GTEA 3KFWX 1HD0A 3EUNA 3OFHA 4NMXA 2YNFA 3IC1A 3L09A 3NY0A 4DR5J 3OQ2A 4AXIA 5AE3A 3CJKA 4Z37A 4DV0J 2BXJA 2J0WA 2AIRB 2CWXA 1E6YA 2KN4A 1XMQF 4ITSA 2RQMA 4DFMA 2BE7D 5D78A 3KG0A 4DV6J 3CJRA 3VWSA 4B9TA 4UY8T 5D0EA 2MSSA 2Y0SD 3WC0A 1FDNA 2Z30B 3TAPA 4TKTA 1QY7A 1UWBA 4NWBA 4PCQA 3FRYA 2V63A 5C42A 2HFSA 4NA3A 4OYWA 4LFBJ 3NWGA 3V81B 2MEWA 2P5VA 4DN0A 2BE2B 4B17A 3CJSA 2XSJA 4MKAA 4IKAA 4LF5J 3AJ1A 1KQKA 3VVTA 3WBZA 1RA7A 3WHIA 4DLGA 3R5JB 4LMZA 2V0NA 1RKIA 2RJZA 1M1KT 3MXHP 1FRJA 3CO9A 2MGZB 4DS5A 1JMTA 3MEEA 1IR2A 2HQGA 1NK7A 2BJ3A 1HNXJ 2AT1B 4B3MF 1B64A 3LTOA 3LF0A 2JX2A 2MQNA 4F4XA 3IWXA 3T1YF 3M8WA 2CZ9A 4N8OA 4OJHA 3OL6A 4XDDA 1QSSA 3HVTA 4WYWA 2UXBF 1GMWD 3E2EA 2DCLA 1OS5A 1G4CA 4Y28C 2AX1A 4OJGA 1U1PA 2OEKA 3T6BA 2VASA 3CC7S 2XSJB 3BO4A 3DRSA 1UVJA 3CJ8A 3OXGA 1REVB 2V4JB 3TZWA 4C48A 2ZDOA 2HEKA 2L48A 7AT1B 2QJ3A 2I9SA 1SIZA 2GO8A 4C8OA 4LF7J 4LSLB 1FRXA 2V9WA 3P8BB 4H4KA 2BJDA 2UXBJ 1V6HA 4X4QA 2DO0A 1C0TA 1RI7A 3I5CA 4M5GA 2JH3A 5ETLA 3ONQA 3K59A 2ASLA 1UFKA 1Y5LB 2B7CB 1NUEA 4OYOA 3U7JA 2D3O1 4WBFA 1WORA 3EGWB 1DJ0A 3I96A 4UY85 2XO6A 3DM2A 4QR2A 1AFJA 2A2CA 2RQKA 1I94F 1YKWA 2VC1A 3A8IA 4OZNA 5IC4B 2HFNA 1VIXA 1E6VB 4E8UA 3OL8A 2BACA 3N4WA 2X7IA 1FHTA 4MK8A 3W7BA 4PG8A 2HS3A 2MHEA 2NREA 1DFDA 3EGNA 4DUZJ 2G13A 4FNHA 4ANCA 2I6WA 2GQQA 2MMYA 2O1PA 5FJ4A 1WC0A 3RYLA 1T9UA 1Q86T 3HZGA 1QAXA 2Q6BA 9RUBA 2J6SA 2K1RA 3QGIA 3QT6A 4B3RJ 2NZCA 4KY3A 1FNMA 2FVQA 4IOCQ 2KFZA 1DARA 5HJXA 4AL5A 4ZCIA 3KYLA 3IWNC 5SUHA 4CRJA 1EARA 1NDLA 4H4KC 4ZVUB 3IG1B 3RG6A 2KH9A 1RYSA 2IRUA 2HSEB 2CPEA 2RU9A 3M8YA 3R27A 1WTFA 3FBBA 3H2VE 4ILRA 1U1NA 1PJ5A 1OY8A 2OPRA 4K7QA 1V3ZA 2MQMA 1E6VA 3MOZA 3LH2S 1EKRA 1RAIB 3CGIA 5FLXU 3SBMA 2YNIA 3T9NA 4DV0F 4GMKA 5KFBA 2KZZA 2O67A 3DGPA 2CNLB 5LSOA 3SCLE 1T11A 2V68A 3UPFA 1S48A 1R0CB 1WG5A 4LBIA 4Y00A 3EVMA 3G6YA 4LBHA 1JX4A 3DLBA 3M6UA 3M8ZA 5GADI 4QJVA 1N5SA 4QIEA 1SB6A 1CJTB 4G6VB 2ASJA 1KKHA 1RT5A 2ROGA 3IMQJ 2DGXA 4M63A 3SSRA 4A8OA 4YS2A 4TQRA 5CXTA 4OHWA 2HZVA 4I67A 4F04B 5DZ6A 5KFPA 4MIWA 2DNZA 4ZVOB 1T3OA 1ITPA 2G9OA 4O3SA 1VYAA 4ZPDA 1EP4B 2VG7A 1U0SA 4KR0B 4I2PB 3S7RA 4PZVA 4DPWA 1DQ9A 1VISA 6FDRA 1Y0HA 4EBDA 3K5LA 4PXCA 4WP8A 1VC6A 1RJJA 4JI7F 5KFKA 2EFPA 3ENVA 2GVZB 1FKPA 2ZUGA 2LCWA 3DLGA 3PZPA 3H7HB 1U8SA 2NSBA 2CQDA 2AYEA 3C14A 2CJ9A 1S5ZA 1WF0A 4C8NA 4KAIA 1UEVA 3CPWR 3ISZA 1U09A 4X4RA 3AT1B 1FRIA 5A8WB 3CT9A 3P45B 4RW4B 3PIOQ 4DFJA 3U27A 4CI0B 3HP6A 4I6YA 2C2NA 2V2ZA 1IBCB 2YNHA 3EJMA 3ZTQA 5ADZA 2BJ7A 2D41A 1MWZA 2ILZA 2HGMA 1RBLA 1FRKA 2C3PA 2L3MA 3MAQA 1JB0C 2YKAA 3LP0A 4EBCA 2CQ1A 2HNZB 2VPXB 4YMEA 1RT1A 1S6PB 4DR2J 1N32F 3QJJA 4DV2F 3DRYA 3HJVA 3OR2B 3H5SA 4HLBA 2MQ8A 4B3TJ 3MAAB 4IQXA 2RQCA 1NK4A 1YJNS 1S10A 2ZEJA 1VC5A 2UUCJ 4JI3F 2PN6A 1UW4A 2VDHA 3HD2A 5KFZA 1JJCB 1S9FA 2F8MA 2I1RA 1A6LA 2UVWA 1FX2A 1RTJA 5BJRA 2V8HA 3VAKA 1T8EA 1N56A 3CJ4A 3HSDA 2HHTA 1CC7A 1F9FA 2GMLA 3UWTA 3G82B 3CD5A 1FK9B 1PBUA 1V5VA 1RQ0A 2CQGA 3ICLA 2DGTA 1Q16B 1RADB 2YVSA 3HZEA 4M5DA 4PKDB 3HFKA 1XTZA 4IH6A 2RB7A 1KRPA 1W2BR 8ATCB 2OTLS 2HNZA 2VPYB 1NMEB 1HWKA 2BW7A 3D5MA 1BQNB 2W7OA 2GZOA 1M5PC 1Y3JA 1FRMA 3FEYB 1K1QA 1Z2LA 5U47A 3GYXB 4CH0S 1B0TA 2GAGC 3HSJA 3QFWA 5LOQA 5IWAF 2EWHA 3CCRS 4HKQA 3ZFVA 3PO5A 1U47A 2VBWA 3I87A 5T7LA 2CZVC 4J9LA 5J2MA 2JHEA 3DCAA 4JYAJ 1OIAA 2IC3B 3IWLA 4KHPF 1RTJB 3EWGA 4DR7J 5ETKA 1FFSB 2V5HG 1URRA 2CXEA 2DITA 1NU4A 2WSEC 5HATA 3PV8A 1RKJA 2VOPA 4BC9A 2XYPB 4FNIA 1P6TA 5E33A 3QAEA 4NXNF 4KV8B 1JKHA 1KEKA 3MUTP 4IR9A 3M2VB 2VH7A 5EHHA 3HX9A 4IH5A 4X64F 3H98A 4ZP9A 4CLLA 1FEHA 1WDDA 5ETPA 2HRUA 3DFEA 4Q7AA 1QSYA 1DY3A 4RW9B 5DRKA 2UXCF 4P7VA 5DDOC 4K4TA 1JLBB 1JIHA 2JLFA 4RBUA 2HYIB 1AFIA 1O51A 5HO4A 2J5AA 4ZKAA 5J2MB 3QWPA 3MPDA 1FF2A 1DQAA 4CTAA 4EBEA 5HMXA 1CJVB 1RAJA 3H5YA 2MB0B 4ZOSA 5D0GA 2VBZA 2OSQA 3OHAA 2DCUB 3IRWP 2A3JA 2QV6A 4ZCKA 2WW4A 3SQOP 3CUNA 3K5PA 5K8PA 1RAFB 2HKEA 5KFGA 2E5IA 2B9WA 1QLNA 1TL5A 3BSAA 2HS0A 3VZHA 3MM6B 4Y2KA 1HPZA 3KLGA 2CQ4A 3BF4A 4NXMF 5HBMB 2JJ4D 4QCLA 4K4SA 3I56S 3JS9A 3EYZA 4U95A 1J5OA 2W2MP 4JV0A 5IV4A 2R7TA 2H1YA 2UVUA 3G4SS 1QE1A 1NKCA 2OELA 2ATCB 3QBCA 1D09B 2VFSA 3KUGA 4GC7A 2XEXA 5G0RB 2MZ1A 1S0OA 4GVLA 4LSLA 3GSDA 3PXGa 5D4OA 2F4FA 1DTQB 2MZQA 3MURP 3B54A 3LW5C 1D9DA 4CYUB 4HVZA 1C4CA 2BQ3A 3WC2A 2MKHA 4XDCA 1H2VZ 4CO5A 2N3LA 2BEFA 1HYSB 2NSCA 2XI3A 4OV6A 3FC9A 1SL1A 4FKYA 4HHUA 5ETVA 2ZVSA 1R6VA 3DM2B 2WRMA 3UO0A 2A10A 3RB0A 3QRPA 4F02A 3R5AA 5GAHI 2J0SD 2LP4A 4MKVA 4QIWD 1KNZA 1PYSB 4LJMA 1X7VA 1FEEA 4LRDA 2H4WB 3NCQA 3HCXA 2L41A 4FXVA 2L08A 1T95A 3QT8A 1JXLA 2ZBCA 1J5OB 1QJHA 4WU2A 2P9CA 4LFCJ 2HHXA 1R31A 5H9FJ 1QE1B 1ZA1B 4F25A 2R7SA 3ISNC 4J9VA 4NRTA 2B4VA 2FHMA 4A46A 2EFGA 2J0QD 3VV2B 5KFMA 3NNHA 1FO1A 4FS1A 3W2VB 2OPQA 4A8FA 4EYHB 3W9IA 2YKMA 4CDIA 2LMIA 1HBUA 2YQ0A 2BZ2A 1RT2A 2F9DA 4PEOA 3T1HF 4JOUA 2CQCA 3DHXA 5IS2A 1YJ7A 2WB1D 2VBYA 3MCNA 4K0KJ 1CLFA 1U6FA 4N5SA 4DCOB 2EK6A 4RLEA 2UUCF 2HBQB 1P1TA 1UPPA 1XNQJ 5KFHA 4PRFA 3K0JA 3GLJA 4KFBB 3W62A 4ZN3A 1ZAXA 1WSRA 3D7SB 3M4XA 3BSOA 1MROB 3RRHA 4Q0BA 3PYFA 4DV2J 1RAGB 2ZOMA 3LP1B 3N79A 3TUIC 3RW7A 5L9NA 3MR2A 3QNWB 3OVSA 4DS4A 1ZOTA 2HQ3A 1F3VA 1I51B 2EG2A 1KQSR 3BN7A 1RA6A 2LU2A 2RMLA 5ETMA 2QA4G 3V6JA 1UP1A 4CCHA 4G3IA 2F9JA 2LLZA 3Q86A 3RJMB 3QZ7A 4NYOA 1FKAF 4WCEQ 3N0VA 1JK9B 4I1TA 1RT5B 2YKMB 2PT0A 2ZHOA 3V6DB 3GJTB 4JI6F 1W7WA 2IRXA 4ENOA 2HVHA 4FYDA 3L7PA 4NYZA 4NCAA 4NCBA 1Z4UA 4LRCA 5KFFA 2XCAA 5ETNA 3TO8A 3DRRB 4K2XA 4ED6A 1LWCB 2UXDJ 1JLGA 1VBYA 2KVQE 2WTFA 4QBUA 2GMHA 2AEMA 5ITHA 1QTMA 4ZPWR 4QWAA 4I2PA 4EO8A 2PI4A 2E5GA 4N8NA 3BPDA 2HAIA 4ZPVR 4F4WA 1KC8T 5DGBA 4DUYF 3I82A 3DGVA 2BKNA 5K9FA 5A0YB 4ZPBA 5F3TA 1U1RA 2DPJA 2O66A 2GVZA 4K8RA 4N41A 5K8NA 4TY9A 3D0IE 2RS2A 3QFHA 2MPUA 4LIRA 3SXLA 4F26A 4ZP8A 1TL3A 4F0KA 4WFAQ 3OR1A 3O1LA 2W24A 5HVHA 2Q3PA 4HEA9 1XBWA 2JL9A 3AAWB 3N28A 4Q45A 1CQMA 2X51A 2UZAA 1VQ7S 5IFMA 4KSEB 2BYCA 4F7VA 4OQJA 2FY8A 4QU6A 4KYZA 4L3KA 4ZIWA 5HVGA 4PQUB 1DAXA 1RU2A 3EMTA 1NH8A 3JSBA 4Q8FA 3KWMA 1XNRF 2CADA 4IG0B 5D4NA 2IJNA 2JLGA 2BA9A 2R7WA 3H2UB 3VAMA 2P8IA 4ICLA 4Y6IA 5JMNA 4NE9C 3R2CJ 2OD6A 3JTNA 1HNVB 1NJXA 4Q44A 4A8KA 1T9WA 3DLKA 2D74B 2HFUA 2RE1A 4RBVA 3D2WA 2G2ZA 4MK9A 4PAAA 2HIYA 2FGCA 4ZP6A 3RU0A 3C8YA 4DV1J 3FRZA 2QG9B 1SKWA 1RGVA 3DYAB 2XLKA 4K5RA 2UU9J 3BN4A 4P2SA 2GJFA 3CDBA 3HVWA 2OEMA 1OY9A 2XULA 5F8IA 2B9XA 1CJUB 4GVBB 2LQBA 1RAAB 4WF9Q 5KG2A 3A3OB 3V4IA 2HFOA 4NYPA 3A4TA 3DOMB 1T05B 4RW7A 5F8NA 4P2FA 1RWNB 3AA9A 1MLAA 6AT1B 2FZGB 5RUBA 1KN6A 3Q2TC 1NSKL 1WEZA 1Q0NA 2HBYB 3SCJE 2OIHA 1DZ5A 2HQCA 1FERA 4MYUA 2PMZD 3U02A 2N7CA 2KHDA 4O4GB 1S57A 1MU2A 1I94J 1S4EA 4QW9A 1QAIA 3PHEA 4ID8A 4WFNQ 4J7CA 4DR3J 1K1SA 4DX7A 1FA0A 4G1IA 2YTCA 2IM3A 2IC3A 2KDOA 4Y2AA 3T41A 4AE5A 3HD1A 2RH3A 3UR0A 3CJ0A 2IYGA 1XR5A 1YX2A 2JFDA 2YPZA 4RX6A 3J7ZT 3KLFB 3OJUA 3CMAS 3VAJA 1WKLA 3RRKA 1WTBA 4GVBA 3NS6A 1KR4A 2GIRA 1ZTWA 2R7RA 3CD7A 1LW0B 2QSWA 1TP7A 3EGVA 3FKBA 4NA2A 1EETA 1S59A 1WEXA 1C1CA 1Y7PA 1JKHB 4JI4J 2HVIA 5IT4A 4DSEA 3ET6A 3W3SA 3IAM9 1LWEA 3LANA 1S99A 3ILJA 2VUGA 2MXYA 1GAOA 5DS7A 2UXDF 4WZQA 3K2YA 4O4GA 1NSAA 4ZLJA 2V8GA 3GE9A 4F36A 5A8RB 2OFHX 4OZJA 1LW2B 2OMOA 1R0AB 3ZZZA 1EQMA 4CTAB 4FPIA 2C42A 1TU0B 3RZAA 3G8SA 5DGAA 4FF3A 4X4OA 3BV8A 5FLXY 5HP1A 5GAHU 1SL0A 2AJ2A 2BJ8A 3NKYA 3Q23A 3G9CA 3ZTSA 3DU6A 1R3NA 3EVWA 1JNZB 3WDOA 2UP1A 1U02A 3H20A 3BGLA 1OQ3A 2DJWA 4I64A 4WE1A 2QLXA 3KJVB 2GAHC 2ZH4A 4QYZK 5E3QA 3IS9B 3MD1A 2B43A 3GIIA 4KT0C 3I6PA 3KLGB 3D6HB 3CC2S 5AXKA 4P73A 5HBMA 3MGJA 3TZXA 1DBDA 3P3DA 2FHOB 1FX4A 5KFVA 3TR5A 5MAOA 1JLFB 3RGIA 2GQCA 3KK1B 5L1LA 1N5VA 3M2UA 3AD7C 2P6TA 4DN9A 3EDQB 2FVSA 1F2HA 2IVYA 4JUZA 4B02A 2W01A 4N7TA 3VGUA 1S77D 3QSIA 4DR4J 4OZ2A 3KK2B 2JFKA 1PC4A 2KXHA 4CYUA 1A9NB 1AZSB 4UOGA 3TYTA 4ED3A 4NEZA 4U6PA 1IM4A 1PIEA 3TQ1A 3TW0A 2VL1A 1CULA 2BBEA 4LFCF 5EWGA 3TJ8A 2DNOA 2ZDPA 1UJ4A 3CCWA 2ILYA 2EBGA 3Q8YA 3OTBA 4LR9A 4M8LA 5G4DA 1X5OA 1OO0B 1YGYA 3IS9A 4P74A 4USTA 4R5PA 3GCWP 1N34J 1JJ2R 4LRBA 4C3KA 4PXDA 4ALZA 2G2OA 1S1TA 5HQMA 4JV5F 2XWYA 2E7VA 2VV5A 3SCIE 1JLFA 3PX4A 5KT3A 1LWFA 4GO7X 1SH2A 2J9DA 2MTLA 3CJTA 4ZVHA 4A47A 5B0EA 5IXUA 1VQLS 2Z2YB 2RU3A 2VOOA 4DF8A 1M1HA 1HD1A 2XGPA 2JEGA 4RNFA 3HKWA 4ELUA 2DB1A 1F60B 2B9YA 2CAJA 3QQCD 4P2MA 3GQCA 4O0IA 1QSLA 3QZ8A 2XQCA 4NLWA 2AYMA 4YHHJ 3GONA 3QIPA 3SMZA 2D3UA 2VKZG 3GYGA 2ALYB 3D67A 4FBUA 4C8ZA 5KFRA 1UAWA 3A3PB 3LGMA 4G1PA 2R2SA 3AH6A 1VQPS 1RTIB 4WK3A 3IM8A 5E41A 1XJWB 4R5PB 4Q0BB 2XLJA 2KG0A 3N6MA 4F0HA 1N52B 2C28A 4GKJF 3OTDA 4FP9A 2JVRA 1S49A 2I5JB 2QA1A 3MM9A 3GG1A 4NCGB 2XZDB 1HARA 3K5MA 1IQZA 2VQEF 3IR5B 2V2KA 2CQ2A 4DV1F 1S1UB 1Y00A 3MEGA 4UW2A 1HHSA 2ZH8A 4LFAF 3LUYA 4ID5A 2GX8A 2M2BA 2FDNA 2V8DA 3LQVA 1BHNA 3PACA 1O5JA 4KQZA 4LUBA 2EG1A 1UJ5A 3IR7B 3P4UB 4LVOP 2HAFA 1HNIA 1RB0A 2YKNA 4URGA 4RZRA 1TUWA 4L73A 2ZWOA 4LSNB 2F65A 1G1XA 5E2QA 1EHWA 1HKAA 1IBMF 2F3JA 2BQRA 4EZ6A 2GMJA 2M3DA 2W2QP 3C16B 1JLGB 1FRLA 1XK8A 5KFTA 3EDRB 5C25A 4ED2A 2C3MA 3PW0A 4ED4A 4MKBA 2CPDA 3U1NA 1RK8A 3OTOJ 3PW7A 3MMBA 3OHBA 1KTQA 4KH0B 4CO4A 2GIFA 5M2UA 1JLQB 5F8LA 5A0YA 2LQ8A 1RT6A 3FUYA 4DBQA 3D3BJ 4KBIA 1S1UA 5E5NA 5CYJA 3M32B 1PKUA 3HVAA 3NXZA 2KRBA 3GU0A 2IBKA 1TL3B 2XM3A 2QSFA 4PG6A 1KTVA 2EVZA 1JNRB 1U0HB 2ZOGA 1FT8A 5DDRC 4QOTA 1P9QC 2Y0BB 1X5PA 1GTHA 1BMQB 2HNDB 5B0AA 3ETMA 3R6GB 4BDPA 5HI7A 3ULHA 1FWLA 4U7CA 1TFYA 2W25A 4DR1F 1GXUA 1RTZA 1NO8A 4USVA 3IGVA 3UD4P 4ATNA 4C11A 3RB3A 2XMMA 4NLSA 5DO2A 1WI8A 3UW1A 1FVSA 5IQQA 4EFAC 4DV4J 2DVIA 2DGWA 4JI1J 2X1FA 3QJPA 1U1QA 2QA4S 2XC9A 3KLHB 3O44A 4B3SF 2F8EX 5F8HA 5L1IA 4CM0A 2CPIA 1RT6B 5KFLA 2C3UA 3TRGA 1UZDA 2CJAA 5A6PA 2KI2A 1SJRA 4NLOA 3W66A 2DNHA 1Z2ZA 2WW8A 4HH0A 2YX4A 4OZ1A 5CYQB 2FVRA 1FRHA 4ZA1A 2V4QA 4WZMA 2C2RA 2FJBB 1F5AA 4LF2A 4N47A 5HSPA 4OHYA 2C2MB 1NPRA 4OYXA 3LO3A 4H4MA 4DMZA 4K4ZA 2DGQA 3F41A 3DLJA 1FFWB 1HR0F 1XNQF 1SI9A 2MKSA 4ZPCA 4DF4A 3B82A 2A18A 3BSCA 5J2PA 5GMDA 3DOMA 2CJQA 4RW7B 2OD4A 2XYGB 2R8IA 2COLA 3MM7A 1N0VC 5THWA 5CA5A 2DK2A 1V9OA 2KRRA 1TL1A 3EGZA 3LAKA 4TYBA 1LFWA 4DCJB 2N3OA 2EC0A 4M5MA 2B6AB 2FD2A 3W9JA 2ZUAA 4IO9Q 2EC2A 3TANA 1Q81T 4UOCA 2QN6B 2BANB 2EFOA 2AJ4A 2QMUB 1G2EA 3OPKA 3QWUA 2ZC3A 4EK2A 4NLQA 3W8PA 5KG3A 2IRYA 1UFWA 2CJXB 3AD9C 3D1OA 4FYXB 4PG5A 4ECQA 3OL7A 3KHLA 1ZPVA 1D9FA 3X1LB 4DJBA 4N77A 3J81j 4TU7A 2BOPA 1T0TV 2M5YA 2OTJS 3HHEA 3NAHA 2MY8A 3CCES 2ZFHA 1N5YB 2ZBPA 1HHQA 3GR0A 5CABA 2IM0A 4DX5A 1NHUA 2BE9B 3CO0P 1LWEB 4OYMA 5DJBA 1UETA 2BJ9A 5A8KB 4X65J 3QSYB 3GFHA 2D1CA 3HDSA 1BLUA 4R8UB 2D9PA 4DWIA 1U2FA 1S6QA 3O3LA 4D3GA 1TL1B 2AZ1A 2Z58B 3BQ2A 2GHPA 9ATCB 3QO9A 4C9DA 3MM5B 4RNNA 2CPHA 2LQ5A 1K0VA 2O01C 4F2RA 1CVJA 2WZ1A 2G2YA 3OV7A 2FJEB 3G6XA 4MFBA 4LF9J 5AT1B 1HIYA 2JZ5A 5HP1B 2V8PA 7FDRA 2DIVA 1XWLA 1BWEA 1KD1T 3JSMB 2QLFB 4KB7A 2PMWA 1F2GA 3Q24A 1EZZB 4DR6J 3DMJB 4IR1A 1N5YA 3H5UA 4WE1B 3MR6A 1IKWB 1VI7A 3PIPQ 3V5RA 2ROEA 4PXEA 3OLAA 3C3LA 3M7VA 4Q2MA 2XZWA 4FF2A 4W4MA 4NLYA 3M2RA 5A8KA 1VRTA 1U8WA 2ZH6A 1BQMB 4I6WA 1KFDA 2R4FA 3CVKA 1KLMB 4KO0A 3DRPB 4ZDNA 4PG4A 2IDLA 4YDDB 1H73A 3UD5A 2UUAF 1U24A 4PUOA 4YDXA 4U96A 1FDDA 2DISA 1TV6A 3MFIA 4B3RF 2F7VA 2HLUA 1PYTA 3W8GA 2C2OB 2GCFA 4ZJOA 4CNYA 2GJIA 4TYAA 1TL7B 2IDEA 2MKKA 1CS4B 2X1AA 1VQKS 2E1PA 3GILA 3KHRA 1XERA 4ZS6A 3JSRA 3C15B 4C6AA 4KPCA 1CULB 1VK8A 1JJHA 3EE3A 3LP2B 3Q22A 1ZZNA 4BS2A 2AP6A 1FJCA 2EI5A 3M9MB 3KUEA 1YJVA 1JJ4A 2E29A 5BYSA 1IR1A 5I3UB 5A2QY 2JWNA 3CMES 3DDIA 1X4EA 2V9KA 4C0HA 2PI5A 3BKFA 1S1TB 3ZZOA 4A8MP 1WOOA 1RT7B 3CIMA 4JYAF 2CNNB 1KLMA 3PTWA 4KO0B 2ZH3A 3QJLA 4X2BA 2LXUA 4DV4F 2GVDB 4DL4A 1TKZB 2RQ4A 2DY1A 1R6YA 2OFGX 3M30B 4WWSA 2EFVA 5CHCB 3PKYA 3JYTB 1X4FA 4DR1J 1G6BA 1TV6B 3FSIA 3EXYA 5I4MA 1WNEA 4A4JA 4A8WA 3PW4A 2BR0A 1RLCL 1TL7A 4RJVA 3R1HA 5K14B 1RSCA 1ZM4A 4IRCA 4RWWA 4KH1B 3PKMA 4DQIA 1N36F 2XY7A 3P96A 1OJ4A 4OMFG 2X3DA 3LP2A 4CLTA 5KT2A 1K44A 2JNJA 3MWBA 1V5IB 3AFGA 4YN3B 3BSNA 1D0EA 1X0FA 1FXDA 1REGX 3H59A 5I3UA 1U1LA 4JI0F 3PJWA 4LBPA 1D1UA 2YPYA 4DSKA 5IM0A 4F4ZA 4EO6A 3R9LA 3M8PA 1YJUA 4NCGA 2WVDA 1MWYA 3G8QA 4QR1A 5KT7A 1LK5A 3NCPA 1IUJA 4HTIA 2QMXA 2PO4A 4H4OA 4P9SA 4WFYA 2QLBB 2ZBQA 2P9EA 1UL3A 2KT2A 3C6UA 4WYLA 3ETOA 2N4CA 3HSZA 2C3OA 2MQQA 1GXTA 2U1AA 4NPOA 4BHQA 2E5HA 1MN9A 2KM8C 4DR2F 1H7XA 1M0SA 1NB2A 1Y5IB 2JDJA 3NOGA 3S1TA 5HMZA 3ZZTA 3JSYA 3ENQA 1WUUA 2KYZA 7FD1A 5AXNA 3KG1A 4LFAJ 2F1FA 3NEKA 3PJ9A 1R7IA 3Q8SB 1SVDA 3W2WB 3CCQS 3IRXB 3TUPA 4ELVA 3ZNUA 1UPMB 1O6XA 1S1XA 1UWBB 4TU9A 3H40A 3MMJA 2VQEJ 4CM2A 3O8WA 3TAMB 2CQHA 1AW0A 1JLQA 5FIIA 3CJQA 4RUAA 2NUUG 4DQRA 1FJEB 2XS7A 3QGGA 2W4PA 1YBTA 4ZJLA 4B9MA 1NPPA 2BM1A 2MY7A 4IQMA 1WHWA 4OLPA 5LSLA 2WK4A 3HFVA 1RCOB 4DXLA 1IM6A 2RILA 4PYDA 4LF1A 4Q8EA 1ZYQA 2W4CA 3FNNA 1YK9A 2CPJA 4K4VA 1S0NA 2NXEA 4IYQA 4ZCLA 2DNPA 2P6SA 5HLFA 1GNKA 1RDRA 1HHTP 5DM6Q 2H5EA 3NGUA 2MKCA 4DG1B 3I31A 3IAS9 3IRXA 4EYIB 4PWDA 2GV1A 1F0XA 3HVTB 4USUA 4DR3F 4J9PA 3PYEA 3FQLA 1M5HA 3TAMA 1RE1B 1IKYB 1TTHB 2BKPA 4FF1A 2G0IA 2B5JB 2RRBA 5L8RC 1N34F 3M8QA 2Y3YA 2ACYA 2J6TA 4CO1A 4LIWA 3DDKA 1JLEB 1T9TA 5CYQA 4ES3A 1IKXA 4QIFA 4K5SA 2F4VJ 2E1MC 3GTYX 1C0TB 2HHHJ 1HW9A 4A8SA 1Q8LA 3KMSA 2UUTA 3L4BC 5EDWA 1OSCA 4RUCA 4KPYA 2LYVA 4O3QA 5DQHA 3GB0A 2B8PA 4JB8B 3EPIA 2BRKA 5J2PB 2OO4A 1U6ZA 4I4BA 4QQBA 4PWDB 3MM7B 4HHJA 3ZTOA 6FD1A 1IBLF 2ZH2A 2IA6A 4DSIA 3LPYA 3QGHA 4O3PA 2K7JA 3K7RA 4IDKB 4ECRA 1IWAA 2Y8WA 3W1YC 3JQMA 3J7AN 4QZVB 2VG5B 2B6AA 2ZVIA 5J2NB 2ZD1A 2CJKA 1OY6A 3Q8VA 5EX0A 4O3OA 2ZKTA 2K1RB 4PXBA 1QVFR 4C8YA 4P52A 3MR7A 5F41A 1AT1B 4B9VA 1YZ6A 1HW8A 3T6JA 3JAMY 2Q43A 3EXCX 2FJDB 2K3KA 3R5GA 3VQTA 4WPAA 2AF6A 3ZZRA 2LQ9A 4RUHA 1ZTTA 3E8OA 3R1LA 5L46A 2DNGA 1HBNA 2H65B 2RSQA 1TL4A 5HL7Q 2HGNA 4NI2B 2XYHB 4C8MA 4BWJA 4ANDA 2C22A 4F8RA 1MNEA 1UWAA 2U2FA 4JI0J 4J5OA 2DBBA 2ZE2A 2DH9A 1S1VB 5B0CA 2XLIA 1VFJA 3HKZD 3MHYA 3H25A 5ETTA 4TLRA 4OYPA 4DUYJ 5BR8J 1T02A 3MUVP 3MTJA 2ZJRQ 2CJYB 5I42B 3PEHA 4JI4F 3SI8A 1C4AA 1R43A 2IJRA 2XMKA 4RU9A 2ALZA 3CD0A 4GO5X 4QIVA 4ZPTR 3BDPA 3R3TA 4XK8C 2FHJA 3R5DA 2E9ZA 4WFBQ 5CZXA 4CLYA 1U4BA 3Q2SC 1A0OB 3ITHB 5KFWA 3DLEB 3DOLB 1RYRA 3US5A 2KO1A 1DLOA 4AFFA 3DMJA 2FVPA 1WOSA 5HROB 3G6VA 1IKWA 1ROFA 1M90T 1AYEA 3O6QA 1YQHA 1VRQC 2BJEA 2UV8G 4ANEA 5K20B 1B7YB 1RU1A 1VRTB 2Z0GA 3G71S 5E7OB 1KVKA 5HVFA 1YBUA 5AXMA 2N7YA 3KLIA 2RNEA 1ZS6A 2CPZA 3BGFA 4DI6A 3JAMU 3BYPA 3NWRA 4CIOA 2R2RA 2ZNZA 1IVZA 2IJFA 2WCXA 1GXLA 3IO1A 3K8VA 1FKPB 3NCRA 4I7FB 3SQGB 3T5LA 2ERRA 2FPHX 3I5BA 1S7IA 2W9CA 4JI2F 2J7UA 1CJKA 2WVFA 5I42A 4J90A 4ZHRB 1WC6A 3CMQA 2DNNA 3ILIA 3J80Y 4ECTA 2BQUA 2QO3A 5HANA 1U45A 2JC0A 4F4AA 3E3XA 3PYDA 2ZZMA 3QIDA 5LMUJ 3DLEA 3DOLA 1NK0A 2ZZNA 3KNGA 4K0KF 3KOAA 2GC8A 5EWFA 4USIA 2V6AA 2HFZA 3ZO7A 4J9SA 1X9MA 2VA2A 4KGKA 1NJWA 5B7WA 2Y8YA 4K4XA 2DNLA 2ZBIA 3EX7B 3SQGA 1VOMA 2R2TA 1N5QA 1O8BA 1U1OA 2OGUA 4FPRA 3QGPA 5D0HA 2LEBA 2B0GA 1XNRJ 2EKNA 3V6HA 1L3KA 1MMNA 2QL9B 2RDDA 3HULA 2CPFA 4URSA 4ZHRA 2DNRA 2HVDA 3I4HX 2DY9A 3BYRA 3MMCA 2ZJPQ 4LF9F 1HBOA 2CQIA 4R25A 5K14A 1V3SA 2CPYA 2FIUA 3M8RA 2H5JB 4IH7A 2K8GA 1QUPA 1U7LA 3RBXA 1YSJA 4BC7A 2C2KB 5IZHA 3JTPA 3GV8B 4NOHA 1AXQA 2DGUA 4P72A 1HI1A 3KKFA 2HBZB 5I3QA 4OHZA 1SV5A 5KFDA 1UVKA 1EIYB 4RWXA 1BQXA 1UCNA 4WFXA 5H9EJ 3MOJB 3UNYA 4JV5J 4R0EA 2DHHA 2IPOB 3NP5A 2JOQA 3CDEA 3ZZYA 2M4MA 1JLCB 4L6V3 2BE2A 3G2XA 4X4UA 2DXFA 1ZETA 5E3CA 3CC4S 3B6BA 3C6UB 2W9AA 3NNAA 1N6QB 3SCKE 1NZ8A 2OJ3A 1RTHA 3AJ2A 1HBOB 1U26A 3W61A 1F6TA 3NGDA 2KVIA 1SUQA 2YKPA 2C2DA 4X4PA 2CIMA 1PC5A 2K06A 4E0DA 1X60A 3LWLA 3FQKA 2CUYA 3TA2A 4FKXA 4RR5A 3NOCA 2XB2D 1UFLA 4O0NA 2DR7A 1B7FA 1S1WB 1TKXB 2RT3A 4LRAA 3KTQA 3M9NB 4JI5F 4B9NA 5J1NA 1CC8A 1JLBA 2D9OA 3JXOA 1H2UX 3D9BA 3BQ0A 2YNFB 4ZIVA 4HT5A 1REVA 4LT6A 1R89A 4DQPA 1NHKL 4G1QB 1R8HA 2CNKB 4C0BA 4DL3A 2XWXA 2XNQA 2FLOA 4DSJA 2AEFA 3HHKA 3FVYA 3GV5B 2AHOB 3MCOA 3F0NA 1CJVA 1Q82T 5B08A 4E2FB 3IBCB 2FTRA 3ELHA 3UDEA 5K8OA 1ZAWA 2AX0A 4NMLA 4O3NA 1RUSA 4C7QA 2ASYA 3GSIA 3PYGA 4ZLNA 4YR3A 4ED7A 3T5JA 4OL8A 1ELOA 1DQ8A 1TUVA 2KXFA 3X3UA 1TUGB 3J80U 2J7WA 2Z8QA 1U1MA 3PO4A 1TAQA 1YHQS 2NPIA 3MM6A 3CWJA 1HPZB 1X9WA 4HR2A 2HK3A 4ECSA 1N36J 2DGSA 2DIUA 1S1WA 1TKXA 2E44A 1FJGF 4OJ1A 2RD5C 3HLUA 3MI7X 2IFXA 1NZAA 1PSDA 2HWHA 1NXIA 4DX8H 3V81A 4P2XA 5I3PA 1Q79A 4NLGA 2HWTA 2YX7A 2E1RA 3FBEA 2VC0A 3M8QB 2Z2LA 4USKA 2ACMA 4Y34A 4RNMA 3T9ZA 1MW7A 3DNCA 5G0RA 1N33J 2LFVA 3FCHA 2KZMA 1DTQA 2QA2A 1D8ZA 3B8HA 3OFEA 1GQEA 2RDIA 4X62F 2DHGA 1RCXB 4QU7A 1FE0A 3CXCR 1NJYA 2W2PP 3U1MA 2EEYA 5E0OA 1YRTA 2LA4A 2VG6B 2KL8A 2RHQB 3I32A 2CVEA 2Q1LA 2I2YA 2OPRB 4USJC 4K4YA 1S6OA 3BBFA 4DHVA 4AXJA 3PW5A 1J5EJ 1WELA 1HBMB 2NXCA 3GJRB 3GYNA 3LGHA 3OLBA 2CYYA 3N5FA 4USMA 1NCLA 3VAIA 4NXMJ 3GJSB 1IBKJ 4ZITA 2KYXA 2QFJA 2YH0A 3I5AA 3H4BA 1IBMJ 1Q1KA 2B56A 2RDJA 4FYVB 2V4JA 2IYIA 5CQGA 3D0GE 3Q8RB 2GS8A 4JI5J 2ZJQQ 2VZ9A 2UUAJ 1QD1A 1H3DA 3H42A 2OPSA 3A1YG 4GRSA 4L75A 3SDEA 3UR3C 2ZH7A 2PMHA 2RF2B 4K4WA 2DEJA 5GVQA 1MN7A 1GX5A 4HTJA 1B0VA 3PEJA 2VJUA 4MT1A 1S6UA 2DNQA 2FJVA 2CVIA 2YY3A 1SQEA 3TEGA 5D6GA 1PAEX 3OXLA 1K73T 5F8JA 4YY3F 2KFYA 4FXWA 2R7VA 1HBNB 1F1BB 1WHVA 2CNOB 3A3NB 3DOKA 1MROA 3FEZA 4DCPB 3KHHA 2UXCJ 1HBMA 3PRDA 1HA1A 5CCLA 2GGPB 1FFGB 4A8YA 4AYBD 4W90B 4GKKF 1HMVA 1J2VA 2LDIA 3I0RA 4OI3A 1B99A 3QMQA 3AY0A 2M8DB 1X4HA 3DLGB 5J1PA 2LDYA 4X4SA 2B4OA 2E9RX 4YB5A 2L9WA 3TOQA 3W5XA 4LVNP 3PG9A 4USHA 4NXNJ 2VFRA 2SXLA 3FMWA 5HMYA 2XMUA 1LOUA 1VJWA 5M2RA 5SZTA 3KK3B 2VFTA 2HHUA 2XG8A 1RWXB 2DD8S 4RW4A 3VR1A 5A8WA 1XIQA 5F0WA 2KXNB 3ITHA 3DI6A 4YUDA 1DLOB 1YRUA 3QT7A 1LWCA 5E3RA 5IT0A 3DOKB 3LP0B 2J9DE 2G0CA 3DDNA 4OHVA 1NEEA 3KUHA 2VFVA 3VGVA 3JB9k 2HFVA 1T3NA 1IR0A 1P1LA 1KHWA 4OI2A 4ETXA 3BEGB 4OLOA 1TVRA 2YX1A 3GFZA 1QDUB 2OLWA 2JSXA 3OR2A 3PNIA 4I7FA 4NLXA 3SFGA 4CLKA 1R8BA 3MAAA 5KFUA 1BGXT 4RNOA 3MR5A 2X1GA 2HWIA 4F4YA 1H74A 2MLXA 2VDIA 5L38A 2KT3A 2PIIA 3JTOA 3M6XA 4OI1A 2OPPB 5KG6A 2FLPA 5D3GA 3OR1B 4OZ5A 1H72C 4PR6A 1CJTA 2XZTB 3WIUA 3TI0A 5DM7Q 2HIQA 4DR4F 4N76A 3CSKA 2R3VA 4OX8A 3KK3A 3MPWA 1M5OC 4JP8A 3D68A 4QWEA 4A48A 4CO0A 5B0GA 1WG4A 3F56A 3THPA 2FYXA 1UZHA 2B7BB 1FK9A 2VJVA 2HHWA 2FB0A 4CLPA 1SC1B 5LM7E 1EP4A 2Q79A 3GR1A 4IG0A 4J9UE 3CDWA 1JLAA 5B0DA 3CCSS 2GO9A 5C2CA 1HR0J 4M94A 2EKYA 3TA0A 1OSDA 1S9GA 2NXJA 1BQNA 3CCUS 1TMJA 2NYHA 4KHMA 2GHWA 4ERDA 3GPAA 4J9QA 2CDRB 4A8XA 2VQFJ 1W26A 1HWUA 1Q78A 3MM8A 1T9XA 3SIPB 5DETA 2QX0A 1VBKA 1TZ0A 5LXRA 4QWCA 2RKIB 4KTQA 2OPPA 1I6JA 4B3OB 2GFFA 3DYAA 5E3PA 3C14B 2YNGB 1S76D 2YQ1A 4OX9J 2RHSB 5KOXA 1SJFA 1K0TA 1TFWA 3TZZA 3GWCA 2AZ3A 1Q5YA 4CP5A 2WBMA 4YR0A 1ICEB 3BZQA 5C5JA 3PHTA 2YNHB 3AQPA 4EMDA 5F8MA 3R7NB 3NNCA 4ZJQA 3V4IB 3AOCA 4DLEA 2AEJA 3ZZUA 1T05A 3IN5A 1C0UB 2BUNA 2X1BA 4L74A 1HQUB 5K5MA 2V2VA 1RT1B 2RRAA 2I8EA 4ECYA 1GX6A 3M05A 4B9SA 1ZH5A 1RWUA 1RWMB 2LEPA 3SFUA 1JLCA 4OYZA 1RT3A 2PGCA 4EWTA 4UT4A 5BR8F 3CULA 3MM8B 1G3OA 3CW2C 5E3AA 5DG8A 5EWEA 4J9MA 4DZ6A 4TVAB 1QVGR 2QTWA 4F67A 4XPEA 2AGOA 2ASDA 4B3OA 3L7UA 4P10A 2R7QA 3T5HA 4B9UA 3O5TB 4UTGA 4IUFA 2GW8A 2FC8A 2KJVA 3ISND 3CEDA 2MZSA 4U9RA 5GMKa 5KTQA 2DXEA 2ZH1A 2DPIA 2R8KA 4LQ9A 1HNXF 2H54B 2CFXA 3G82A 2BM0A 2DGVA 4NEYA 2X3GA 4OZLA 2CDQA 3OSPA 3D66A 2BKOA 3DXSX 3S8SA 3KJFB 2RVJA 2XY5A 2DRBA 1RHQB 2VA3A 4O3RA 3OD2A 3P5TL 5L9XA 2PEBA 1K9MT 3EZOA 3CD6S 1CPZA 2XI2A 3D6TB 3SYZA 3BPSP 4B3MJ 5C42B 4JI8J 2QYCA 3CJ3A 1X4BA 2FUG9 3TAQA 2KHCA 1RT3B 3UNGC 2QFIA 4AUKA 1SPBP 1RWWB 3FK4A 3MZIA 4LFBF 3RAQA 4YP3A 4P75A 1WHXA 4DL7A 4JI1F 4LF4J 1ZAVA 2R9LA 2XCPA 1SKSA 4ZCMA 1IBLJ 2BX6A 2M52A 1GT8A 2WB4A 3HVRA 2MGZA 2CG4A 3MPYA 2H51B 3MEEB 5HQLA 4LF4F 1LXNA 1MSWD 1DHMA 1X31C 4MIAA 3J7YU 3DLLQ 1IXKA 4KV8A 3W5YA 2W8KA 5KOWA 2DYAA 4HI2A 3UI3A 3F73A 4G65A 3VHQA 1SJ1A 4JI8F 5F9NA 3Q8QB 2C3YA 4M5HA 4OFZA 2LVWA 3TX8A 1CQNA 1LKZA 1KVIA 4S0MA 3G86A 3OSNA 2MLYA 2AMCB 3W9HA 3MF5A 3HHLB 1OQ6A 4FYWB 3AXKA 3M2UB 4PABA 1SJ3P 1NDCA 3DU5A 2M9KA 2M8HA 2QT7A 3ZTRA 4DPYA 4DV7J 4NLTA 4AL7A 1H6KX 3AXMA 1S0MA 2DXDA 3FEXB 1BE4A 3PDNA 3W2VA 3NS5A 1FNOA 1WSVA 3I0SB 3CNQP 4RW8A 3UCZP 1M5KC 1UVNA 1V3RA 3NG8A 1RT2B 2PD1A 2YKQA 4FYYB 2NPFA 5GAGI 3UQSA 3OT9A 1NK9A 5JUMA 1S72S 4F4KA 1VQMS 1B4SA 5L39A 1WC1A 4ELTA 4KFBA 2DNYA 4I2QA 1PBAA 2HQDA 4L72B 5CAAA 3Q8PB 3W5ZA 2NUHA 3BKTA 1OYDA 4NASA 4OHXA 5K8MA 2ZHBA 3V4MA 4BLGA 2KKHA 3Q8UA 4RO0A 2A0FB 4DZDA 2EBEA 2ROPA 2ZH5A 4RL1A 5KFEA 4USWA 2H48B 4CO3A 2NXUA 2OP5A 1NJIT 1KDNA 4KGMA 1KLNA 3SZ2A 4EUVA 3M6VA 1RAEB 1YJ9S 1FNXH 2AJ1A 3SDEB 2CQBA 1EKSA 2MSTA 4WK1A 4DV5F 3OTCA 2MKJA 2RF2A 2LQJA 2VPWB 2MJNA 4Z2XA 3J7Z5 4YFUA 1SBRA 4IFYA 4MTPA 4OYAA 2ATLA 3IG1A 2DR6A 5IT9Y 4MJKA 3GG0A 2VFUA 5KFNA 2DRAA 4CQ1A 1Y3KA 1RTIA 2F8HA 3ZTPA 1FXRA 1ZA2B 5GAGU 1X4CA 4C98A 2BDPA 5EX3A 1AUDA 2XNRA 2FHJD 1RISA 2GGPA 3N01A 2W7PA 3C2PA 2IMWP 5L1JA 2Q66A 3CE8A 2I5JA 1HMVB 2YXLA 3BBBA 1VMBA 3MM9B 5B09A 1TK0A 4WU3A 1KHVA 4FZVA 4KGVB 2UUBJ 4ZVRB 3TNVA 5GADU 3POTA 1QTNB 1SC4B 4ZK7M 2BV3A 3BREA 3UDCA 4ID5B 2VODA 2ZNYA 3DRXA 4ECXA 2OPQB 2G4BA 1HNWJ 4UQTA 4DV6F 1HNIB 2YKNB 4K2JA 3OL9A 3AB4B 4BWMA 3FFIA 5J2QA 3VF0B 3A8EA 1BUXA 3FCWA 2WHOA 4DPOA 2QEXS 3QATA 1EJ7L 4V1Ak 4DR5F 1I5OB 4ZN1A 2W4DA 1PO6A 2ZOFA 2AJ0A 1HFEL 1A7GE 1WEYA 3LP1A 2XS5A 4ICLB 3EZ5A 1NKEA 1RHMB 1Q8IA 1H2TZ 1FVQA 2Q6CA 2OI2A 4ZVGA 4X66F 1VQ5S 1NH7A 3OFGA 2JEJA 1TVRB 5T41A 2DHSA 3KXDA 1HI8A 5ETSA 3DLKB 4UF4A 3L3CA 3LALA 1PCAA 1FDAA 3BH6B 2AQ4A 1I3OB 2AYGA 1Q4RA 1KP6A 2N4DA 4LSZB 2VB6A 3OBIA 4FS2A 4W98A 1QAJA 2OKQA 4P6QA 1FDBA 5JVGQ 4OI6A 2Y1JA 3D3CJ 5A6WA 1X5SA 1U0HA 2HBRB 2OMLA 5CD4A 4J9OA 4DFKA 1VQ9S 2P2CB 2HK2A 2WSCC 2Y1LB 4RKUC 3UDLA 1TK5A 4IFVB 4ED8A 5B0FA 2WONB 4OI0A 2HNDA 2PFDA 2Z57B 1WI6A 2K3IA 3KDNA 3L9ZA 4FVMA 5IV3A 1CJUA 5J2QB 1LV5A 1R27B 3ZXWA 4AT1B 2LU1A 1YG0A 1SJQA 3DRRA 3TEHB 3VVUA 5KFCA 3TWZA 2AGQA 4DSLA 5KFYA 1B3TA 1WKKA 2KM8B 1NHVA 1KONA 1D8YA 1NK5A 5LJ5Y 4GKKJ 3N6LA 4QR0A 4LF8F 2IM2A 1S9GB 3TZYA 3EPGA 1S6PA 4FN5A 3KLHA 2DH8A 4JI7J 1EAYC 3SV3A 3BJYA 2HZCA 1PILA 4IOBA 1FXLA 1R8AA 4LQ3A 3R8YA 5D4LA 1UKUA 1F5BA 2DKOB 3F44A 5LJ3Y 1F5CA 1L3SA 1TMMA 1VIOA 1JXEA 2LEAA 1KVJA 8AT1B 4FBTA 1YVFA 1U6BA 3SEOA 2QL7B 5B0BA 3OJSA 2CPXA 3T19A 4K59A 2XMJA 3LAMA 2XMWA 3ZC4A 2V67A 4IFVA 4BBYA 2MZRA 3Q83A 3FZ2A 3OFFA 4KGXB 1VHIA 3TVYA 3TVKA 2JEFA 2CA9A 4CLFA 2DHXA 5GMEA 1EETB 1WHYA 4D3HA 1YI2S 3RAXA 1IJFB 1C0UA 3PRVA 1UA0A 2D3ZA 1MMLA 4PWUA 2YQ3A 2AJFE 2IY5B 3H90A 1Q95G 4ECZA 1J5EF 5BYQA 1FTCA 4CT9A 1D3WA 3MCSA 5KT4A 4YR2A 1S97A 3HHNB 3OTEA 2R42A 3HSGA 4IO1A 4CLWA 5EGYA 2MKYA 2NYIA 2W2NP 2FZKB 3FCVA 3NGKA 5T7LB 5BXIA 3G8TA 1LW2A 2B8QA 1R0AA 2BVZA 2V69A 3D1HA 3VTIA 3VAGA 4DR7F 4X65F 4WKRA 2HW3A 3KJNB 1IKVB 3NMRA 2GNKA 1SJ4P 1GMWA 4V19J 2R8GA 1U25A 1N33F 2XMTA 4KE5A 2FGOA 1VR6A 4X4TA 1WF1A 2XTJP 3MEDB 3UCGA 4DUTA 3OVAA 3CCJS 1K8AT 2QLJB 3R5BA 4KC5A 2E9TA 2ZWPA 3PJXA 5CH7B 3M2VA 3W60A 4OYBA 2QL5B 5KFOA 4DV3F 5A2QU 1U1KA 2JRSA 2CZ4A 1FJGJ 3CCTA 4R8UA 4JI6J 4QPXA 2B4PA 4RW9A 5T14A 2D7SA 1S6QB 1MU2B 1R8PA 2J76E 4EU0A 1VQNS 3I4PA 3QO9B 1KQGB 3MDFA 3IM9A 4C3MA 3CB4A 1HNWF 5GAEI 5M2PA 3UCUP 1WD6A 3K57A 4LREA 2QGFB 1P9YA 4NLPA 1C2PA 1Q8KA 3R97A 1ZM3A 3QRQA 2DNMA 2HQIA 1AZSA 4OZ3A 1ZZFA 1VRUB 3K17A 4JI3J 2HQFA 2J8SA 3JSMA 4AD6A 1X9SA 3EZUA 5EUHA 4NZ7A 2XHCA 4HACA 4B3TF 2WBRA 3NAIA 1MWQA 4AL6A 2M7SA 1QUVA 3D4JA 1C1CB 1N32J 3ET6B 4M5NA 3WX4A 1RZMA 2XHWA 5LMNJ 1N4LA 1DTTA 1NLKL 4QW8A 5IT9U 1CSJA 3T1HJ 3NRBA 1OYEA 1LWFB 3HHLA 1X4DA 1X5TA 1ZM2A 4OYIA 1LFPA 2H3EB 2MZJA 3LPEA 5DZ7A 3U1LA 4PUOB 2OAUA 4DL6A 1LEOA 4J9NA 1Y9OA 1LNQA 3I0SA 1N5TA 4RW8B 1TR0A 4LR8A 2IVMA 4YEAA 1CS4A 1YBAA 1M5VC 2G0JA 3GIMA 2BJ1A 1GEHA 2P9GA 4DPXA 3GIRA 4DV3J 1KOHA 3OVBA 5DDPC 1HYSA 3V6KA 2W7AA 3HHLD 4HACB 2MJUA 1L3TA 3R6LB 2RUSA 1JQGA 3KJVA 4DV7F 2Y1RI 4I2QB 4WIIA 1NDPA 2DRDA 1Y5NB 1KS2A 2HRYA 1DTTB 2E66A 3VGSA 3OW2R 1LWXA 2HS4A 4AQYJ 2E5JA 2UVVA 5AJ3J 3KK1A 2JC1A 2VICA 3D1QA 4C2MA 4ZVQB 4TN2A 2GVDA 3VCDA 3MEGB 1B0PA 1YWXA 5CD4H 3UN3A 3CCMS 4M95A 1QAYA 2YWWA 3E01B 3QT5A 4E98A 5KT6A 2KTQA 3TP2A 3BBCA 3KK2A 3D6FB 3CDUA 2QRRA 4WKYA 1OMSA 3I9ZA 5DG9A 1HBUB 2AD9A 4MAKA 4HHHA 4LF8J 2EXUA 4IFYB 2MYFA 4NA1A 1RP5A 2LXFA 1YIJS 2HPUA 3AD8C 4ES2A 3B78A 4HDGA 1FWPA 4KHRA 2MQPA 5C25B 3IGNA 4J9KA 1AROP 4H54A 4DPUA 2AKWB 4NX9A 2ADCA 4J91A 5H9FK 2DNKA 1LK7A 2VF3A 3MEKA 3SSSA 3K89A 5IM0B 3FSYA 2KG1A 1VQYA 1APSA 1N0UA 4C8KA 3POTB 4KJIA 4KGZB 4Y2MA 2Z56B 4WIQA 4H4OB 2ZM6J 3QRRA 1B70B 4NLRA 3E01A 4X4VA 3UN5A 2QLWA 4K50A 2AYBA 2PDAA 4WP3A 3M8SA 1XR6A 1NKBA 4OJ3A 4U8VA 1PYOB 4X84A 1Y10A 4P71A 5D77A 3V6DA 3J7A1 2APOA 3BGOP 3T1AA 1T9VA 3VGTA 3J81Y 1RTDA 3A13A 3FFIB 4PPZA 2V4RA 2AJQA 3QIPB 3DKDA 4DUZF 4QWBA 3TARA 4X64J 4MH8A 2EFNA 1VQ4S 5DLGA 4JI2J 2R7XA 2EPIA 3TQEA 2WVBA 4KRWA 3H8YA 1SQFA 2DHAA 3FGVA 4NZ0A 4Y3CA 5CYMA 5HJYA 4QWDA 4ER8A 2RUGA 4CLUA 4RBTA 1M5SA 3MMAB 1RBAA 3AA8A 4F2SA 4XAKA 1YJWS 1S0VA 2CQ3A 2XBPA 3P5BP 1SH0A 2NR0A 1GH8A 5LSRA 1IWGA 1T03B 1G7CB 2MZTA 3HXMA 1N48A 3R5CA 1IN0A 4ZMMA 4KKOB 4HH1A 3H4DA 1URNA 2GIQA 1HQEA 4Y2IA 4X66J 4CH7A 3PW2A 2AGPA 1VHFA 4EGLA 1RTDB 3ENAA 2WONA 4LF7F 2YWKA 2J9EA 4F3OA 4DEZA 4UZCA 3GJQB 5AXLA 2C2ZB 3CCZA 1WKJA 1M1GA 2KJWA 2QC3A 2VKRA 2Z2ZA 3C16A 3MTKA 2DR9A 5KG5A 1OPIA 4M5IA 3G87A 4ETZA 1VQOS 1HNZF 4PQUA 4OX7A 5CYMB 2IAJB 3DXBA 1IQTA 2UUWA 3MMAA 3AHPA 1N54B 3T1YJ 2E5LJ 2I0XA 4RNHA 4CH1A 2FLNA 1HNVA 1IKYA 1RBOB 1TQLA 2C1EB 4Q43A 1RAHB 2WAQD 3UFCX 1RWOB 3I9V9 5C2GA 2B4UA 1T9YA 3GIKA 3M32A 1RHRB 1JLEA 1NBEB 1SC6A 1RT4A 4B08A 1Q7YT 1H0HB 2UUBF 1FWKA 4ILLA 2FJWA 4QYRA 3BO3A 2F40A 3BO2A 1HQEB 1XR7A 1SQGA 1TAUA 2F5GA 2EK1A 2FVCA 3VAHA 3BH7B 1UVLA 1WF2A 2G1HA 2ABYA 1HWIA 2GA7A 2FJAB 2WSFC 2AU0A 3EVOA 2EW9A 2ZBRA 3QYYA 5HN0A 2R7UA 1BWVA 1Q5VA 1K47A 2RS8A 1VS3A 2PEHA 2V8VA 3H2LA 2M0GB 4C11B 4XPCA 3MD3A 2XMAA 1N8RT 2E7XA 4MIBA 4NRUA 1EX8A 4PYAA 5FD1A 4UUWA 4ZVFA 1YJRA 2FC9A 2HRTA 4I0WA 2DT9A 2CJBA 1D9AA 3QAUA 2VG5A 4CT8A 3JQJA 4RPFA 4J9RA 1NDKA 1WWHA 3PX0A 3PX6A 5J2NA 3HT0A 4HYKA 2W8LA 1T94A 3RB4A 2E5LF 1EQ0A 1KSPA 2A2DA 3DN9A 3M6WA 1UJ6A 4L3NA 1XMQJ 3ZNJ1 1IKVA 4HDHA 2R2UA 2XY6A 3C66A 3EICA 2XMVA 2AW0A 5DQIA 4B9LA 3KLFA 2F4VF 3KMQA 4IRKA 2KT5A 1S4FA 3MEDA 1JXVA 1PJ6A 2QMWA 1LW0A 3AODA 1RWVB 1AUSL 1RXOB 3IXQA 3NGRA 4PQAA 5BYRA 5IOLA 1FI4A 4XO0A 3KLEB 2WVEA 4F50A 2EFQA 5D0RA 3HMJG 3WQPA 4ILMA 4O23A 1U2CA 3HHLC 4UUXA 4M5JA 3UDVA 3B4MA 2B9EA 3PVXA 2XS2A 1NB7A 1FTRA 2V50A 2NQPA 1NK8A 3RR8A 2XSFA 3SV4A 1BQMA 1SXLA 4TU8A 3UD3P 4I6AA 3R2DJ 1BD6A 1UW9A 3A8KA 1VDHA 2A1BA 3DRPA 3FJ2A 4WXOA 1XEZA 3RBEA 1YITS 3RBZA 1YDLA 2IHR1 4NLDA 5A8RA 3FBFA 2UVRA 2BANA 1VQSA 2BABA 2RIJA 4O4RA 1VC0A 2NS1B 4J37A 4DDFA 3E51A 4U8YA 1U49A 1X8DA 1LQ9A 1Y4ZB 2HNYB 3A8JA 4XIUA 3GCXP 4QYZJ 1VRUA 4OZ0A 2J0XA 2CQ0A 2IIHA 4YB1P 3C15A 4Y2CA 4EI2A 3TUZC 3W64A 3PY8A 1KBRA 1ZM9A 3GIJA 3KLEA 4FXDA 4IOAQ 4IG3B 2VONA 4W92B 2F63A 2GQ2A 1S9EA 5DLFA 3CIZA 3B4DA 4RW6B 3FBCA 2UU9F 1VLYA 2ZH9A 1T7PA 3DHWC 5F8GA 1UVIA 2FLLA 2ZM6F 4TNOA 2ZZTA 3HO1A 2WOMB 1UEKA 4F3MA 4TY8B 4U7UK 1TKZA 3M30A 1GMVA 2HHPA 2LXIA 1NM2A 2NLWA 3PFOA 1CJKB 2W9CB 1L3VA 2E1CA 3HHDA 1YJTA 1GFWB 2HLTA 2E7WA 2YWHA 4OIXA 5A76A 2QZ8A 1BY9A 4MFBB 2C2EA 1L5UA 3KNAA 3TX0A 3MCMA 2OSRA 1XMOF 4LF6J 3RW6A 3OXFA 2V2QA 1S7HA 2CG8A 4LRFA 4JV1A 2AV5A 1J27A 1FCAA 1CG2A 2WVCA 3BKUA 4Z7CA 3CF5Q 3D28A 3VAFA 1IBKF 5H9EK 3AB2B 1I1GA 3GZ7A 4DU7A 1F3FA 5D8HB 2IMOA 2QE5A 1FESA 2YWFA 3IR6B 1NK6A 5J1EB 2OUGA 3FMBA 3M2RB 4F3QA 3D0HE 4DL5A 1U48A 1VCTA 4L76A 4Q2LA 4KIAA 3ADAC 3QLHB 4ED5A 1W2IA 3D6MB 1DRZA 4YB6A 2QIFA 2WOMA 4ED1A 4TY8A 2MHNA 3MUMP 4C97A 2JVOA 3THVA 1SH3A 4X62J 1HNZJ 5H1SV 2R7OA 4AQYF 1NPKA 3K5NA 2K2PA 1P8GA 1YLXA 2RAQA 3AOAA 4ZVTB 4O44A 3SSQA 3BGUA 5DG7A 1XC9A 2PA8D 1XN9A 2J6UA 4DL0C 2YH1A 2L9DA 3GFXA 3PCOB 1NSPA 3CCVS 3UN2A 3ILOA 3MAHA 4QIGA 5KFQA 4ZLPA 8RUCA 4M5KA 5KFXA 2FY1A 3HF5A 2V34A 1OWXA 1SV5B 2W9BB 3LWMA 1T03A 2PE8A 2R8JA 2HURA 5J1EA 2DO4A 4M5LA 1S1XB 3AOBA 4OX9F 4GC6A 1WACA 2O3DA 3HK2A 3H0PA 1RT7A 2HMIA 4ZVPB 2CQPA 2HVEA 4NZ6A 3NS7B 1AA1B 1H38A 4WXWA 3JYTA 4DL2A 3J7YI 4CLSA 3CJKB 3VALA 3R7BB 3RAMA 3TJ9A 2VQFF 1UA1A 1N6QA 4FF4A 3BDEA 5LMNF 3O2IA 3BR9A 1CBKA 4O44B 1RTHB 2DR5A 3LGNA 1MMDA 1WC4A 4DQQA 4R0JA 3A12A 4LSNA 1TELA 2H9ZA 1SIWB 2HGLA 4ZP7A 5HMWA 4P7TA 3Q0AA 1YRXA 5FDLA 3T5KA 5HLFB 3P49B 4K4UA 2BMBA 4WTOB 4ZLLA 1RAOA 2KFNA 3CJ5A 5JJBA 2CKWA 3RUBL 4DG1A 5HQ8A 2W9BA 4ED0A 3MMBB 1RWKB 2LECA 4OX6A 2IBOA 1ACMB 2CRLA 2LKZA 3HFZB 1YTYA 3BB5A 3M9OB 1RLDA 3M8PB 4CWBA 2HMIB 4JBCA 5F0UA 2B5JA 5ETOA 1R0BG 5GAEU 4NLUA 2GHVC 2VBXA 3IFEA 3UE2A 2QYGA 4DR6F 2JEIA 3NGTA 4G1QA 1DURA 2GJ2A 1Q53A 4KKOA 1HQ2A 4A8QA 2OH2A 3CTRA 2G1DA 4Z7YA 2XGQA 3RR7A 2NZ4A 1TKTB 2MDAA 1HWLA 3GFYA 4MYTA 3N6NA 1H98A 4HL9A 5AE1A 3BM7A 2K7KA 3PFEA 2YWEA 5ETRA 1O0PA 3W65A 1WJ9A 2DH7A 2VD3A 3ILLA 4M1KA 5FDLB 5CZVA 1PAUB 5LXYA 5KG7A 4I69A 3ZZ0A 3HJFA 1CEZA 1BXNA 3K5OA 3PM9A 3R7SB 3W2WA 2IAJA 5JXSA 1Q7LB 3BGRA 4UZBA 2HVZA 2MQLA 3N5BA 3KHGA 4ECUA 2PC6A 5AJ3F 3MFHA 3RRGA 5F9LA 3NL0A 2RRNA 4IDKA 3I55S 1L3UA 4ECWA 1Z1ZA 1SC3B 4RUBA 3H5XA 5D4PA 4LF5F 1HL6A 3DRSB 4HT7A 2H5IB 1KWMA 2D69A 1UMJA 2ZD1B 4URQU 2XO7A 3ZZPA 3K58A 3L7OA 4DFPA 1RT4B 2BOAA 2VPZB 1VBXA 1VGYA 3W63A 3J81U 2IM1A 4PG7A 4CLZA 1TKTA 2W2OP 5AE2A 1VQ8S 4EZ9A 3D54A 3N9UC 5MLCV 1SKRA 1WOPA 4H4MB 2V94A 3TJAA 4Q5VA 2E1AA 4FVCA 3S6EA 3CCLS 3P6YC 5ETQA 4YY3J 1SKUB 1FD8A 2VU5A 2VG6A 3PR4A 1TKDA 3G6ES 3MR3A 1HI0P 3VZIA 3IBWA 5KG1A 4RU2A 5C7PA 4DU8A 3QPIA 3BGRB 3FSXA 1MG7A 1ULRA 5C24A 4NL5A 1FE4A 2BRLA 2CWKA 2NXNA 1FKOA 2KB2A 3MECA 2ZE2B 3NGSA 3UVJB 3HPOA 4DSFA 2J8AA 1VK3A 2DEIA 2NCKL 3MPUB 4N56A 4YB7A 3G96A 1WDTA 5LMUF 1RWPB 2FQQB 1P27B 2Z2MA 3ENWA 3FZBA 3JQKA 4I56A 4ES1A 5DDQC 1KFSA 5KFJA 4U67Q 3HM9A 4WP9A 5IQ6A 2Z4PA 3PR5B 2ZKUA 4JV2A 1IKXB 3CDAA 5EN1A 1VQ6S 2OPSB 2N82B 4PWWA 1NRKA 1HWJA 1UTAA 1RHJB 4DPTA 2MKIA 4HI1A 4UOFA 4ZVEA 3C19A 2FJXA 1X4GA 4MK7A 5CCMA 2UV8A 2LA6A 5HROA 3GV7B 4Y0FA 4ZVSB 1FD2A 1UEUA 2AWZA 3AQOA 1NAQA 3BS9A 4LR7A 2HHVA 1Y11A 2IA0A 4B3SJ 1WC5A 1PJ7A 4KHPJ 5C24B 2VIHA 3NLCA 3EM1A 1QM9A 5KFSA 1FKOB 2YNIB 3MECB 3KDOA 4OI4A 5KG0A 3UVJA 1KOOA 3I0RB 2PFFB 3DGPB 3KLVA 1C1BA 1PGZA 5LL6d 4C3LA 1LXJA 2M70A 5IWAJ 3LOUA 4X4NA 3MPVA 1RACB 2OEJA 3MM5A 1H7WA 4WTYA 1YZ7A 3RBDA 4XTTA 4EEYA 4YOEA 2YKOA 2FHKA 1KQFB 4Y65A 3PRBA 4QPTA 1XQIA 3KG4A 1SCJB 2H4YB 3WX8A 4UQGA 4TXSA 4DOZA 2HNYA 4MKYA 2J9CA 3M1VB 1Q8BA 1WG1A 2BW2A 2YWGA 2ZITA 2Y9HA 3OUYB 3TVZA 2ADBA 3DI6B 2JLEA 1NNDA 2A6MA 3C6TB 4BCAA 4C4WA 5KAKA 2IVFB 4IG3A 1X4AA 1S12A 1PG5B 2VG7B 5LT5A 4TQSA 4PPDA 3BQ1A 1S9EB 3BR8A 2L9NA 4CO2A 4NI2A 4RW6A 5KT5A 4UOHA 3TA1A 1BC6A 2A6OA 1S1VA 2J7KA 4WJBA 3IBFB 1GMUA 1C1BB 2ZC4A 1NSQA 2PSZA 5HAOA 4C0OC 3OTOF 1GK8A 5L1KA 1F9HA 4FDFA 2I38A 3GP9A 3T3FA 2DGOA 1OPZA 1RHKB 2R8HA 5D3GB 1R8CA 1VLOA 1XMOJ 4OV1A 4CNZA 2W1BA 4LF6F 3MMCB 2HG4A 5DQGA 4WFZA 2Y1IA 3L95X 1EB0A 3M1VA 4YQWA 4MMOA 3OUYA 2POKA 3RB6A 3C6TA 3IP0A 3GMGA 4ZPAA 1RABB 4V19X 3K8WA 4U7UD 3Q89A 5KFAA 3DC2A 3THTA 3AJDA 2D3OR 3NBPB 4DV5J 1JLAB 1VBZA 2KU7A 1ZPWX 1N88A 3TUJC 1NJZA 3DLHA 3KLIB 3HT3A 4GKJJ 1S79A 3QLHA 4F0MA 1IJEB 4NLVA 3V2UC 2VHGA 2HHSA 5IC6B 4IRDA 3HI9A 1JWWA 2B51A 1W25A 2O5DA 2RKIA 2YBVA 3KJQB 2MQOA 4DX6A 2HHHF 4C8LA 4YHHF 3C46A 3S01A 1E6YB 5KFIA 2YNGA 3FDSA 5HK4A 1AB8A 1WC3A 1HLWA 2DTJA 2PA3A 5F3ZA 3NMAA 1RHUB 1SUQB 2OHDA 1X0PA 4TLQA 3VQSA 4CZCA 2FZCB 3LA0A 2ZHAA 4ECVA 1UVMA 5KG4A 1XMBA 1FJ7A 4M5DB 1SL2A 3WZ0A 2DR8A 3NBPA 2HHQA 4I68A 1HQUA 1ZBTA 2MLZA 1U2RA 1F9EB
chains in the Genus database with same CATH topology
2F5GA 2VIHA 2EC2A 2XO6A 2XQCA 2A6OA 2XM3A 4ER8A 2VJUA 2VHGA 2VICA 2F4FA 2XMAA 2FYXA 2A6MA 2VJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5G A;  2VIH A;  2EC2 A;  2XO6 A;  2XQC A;  2A6O A;  2XM3 A;  4ER8 A;  2VJU A;  2VHG A;  2VIC A;  2F4F A;  2XMA A;  2FYX A;  2A6M A;  2VJV A; 
#chains in the Genus database with same CATH topology
 2B3T B;  3IA0 A;  5JVH Q;  1TK8 A;  2M88 A;  3CJ2 A;  1VJQ A;  3WIV A;  3RTV A;  2HZA A;  5D15 A;  4DQS A;  1GTE A;  3KFW X;  1HD0 A;  3EUN A;  3OFH A;  4NMX A;  2YNF A;  3IC1 A;  3L09 A;  3NY0 A;  4DR5 J;  3OQ2 A;  4AXI A;  5AE3 A;  3CJK A;  4Z37 A;  4DV0 J;  2BXJ A;  2J0W A;  2AIR B;  2CWX A;  1E6Y A;  2KN4 A;  1XMQ F;  4ITS A;  2RQM A;  4DFM A;  2BE7 D;  5D78 A;  3KG0 A;  4DV6 J;  3CJR A;  3VWS A;  4B9T A;  4UY8 T;  5D0E A;  2MSS A;  2Y0S D;  3WC0 A;  1FDN A;  2Z30 B;  3TAP A;  4TKT A;  1QY7 A;  1UWB A;  4NWB A;  4PCQ A;  3FRY A;  2V63 A;  5C42 A;  2HFS A;  4NA3 A;  4OYW A;  4LFB J;  3NWG A;  3V81 B;  2MEW A;  2P5V A;  4DN0 A;  2BE2 B;  4B17 A;  3CJS A;  2XSJ A;  4MKA A;  4IKA A;  4LF5 J;  3AJ1 A;  1KQK A;  3VVT A;  3WBZ A;  1RA7 A;  3WHI A;  4DLG A;  3R5J B;  4LMZ A;  2V0N A;  1RKI A;  2RJZ A;  1M1K T;  3MXH P;  1FRJ A;  3CO9 A;  2MGZ B;  4DS5 A;  1JMT A;  3MEE A;  1IR2 A;  2HQG A;  1NK7 A;  2BJ3 A;  1HNX J;  2AT1 B;  4B3M F;  1B64 A;  3LTO A;  3LF0 A;  2JX2 A;  2MQN A;  4F4X A;  3IWX A;  3T1Y F;  3M8W A;  2CZ9 A;  4N8O A;  4OJH A;  3OL6 A;  4XDD A;  1QSS A;  3HVT A;  4WYW A;  2UXB F;  1GMW D;  3E2E A;  2DCL A;  1OS5 A;  1G4C A;  4Y28 C;  2AX1 A;  4OJG A;  1U1P A;  2OEK A;  3T6B A;  2VAS A;  3CC7 S;  2XSJ B;  3BO4 A;  3DRS A;  1UVJ A;  3CJ8 A;  3OXG A;  1REV B;  2V4J B;  3TZW A;  4C48 A;  2ZDO A;  2HEK A;  2L48 A;  7AT1 B;  2QJ3 A;  2I9S A;  1SIZ A;  2GO8 A;  4C8O A;  4LF7 J;  4LSL B;  1FRX A;  2V9W A;  3P8B B;  4H4K A;  2BJD A;  2UXB J;  1V6H A;  4X4Q A;  2DO0 A;  1C0T A;  1RI7 A;  3I5C A;  4M5G A;  2JH3 A;  5ETL A;  3ONQ A;  3K59 A;  2ASL A;  1UFK A;  1Y5L B;  2B7C B;  1NUE A;  4OYO A;  3U7J A;  2D3O 1;  4WBF A;  1WOR A;  3EGW B;  1DJ0 A;  3I96 A;  4UY8 5;  2XO6 A;  3DM2 A;  4QR2 A;  1AFJ A;  2A2C A;  2RQK A;  1I94 F;  1YKW A;  2VC1 A;  3A8I A;  4OZN A;  5IC4 B;  2HFN A;  1VIX A;  1E6V B;  4E8U A;  3OL8 A;  2BAC A;  3N4W A;  2X7I A;  1FHT A;  4MK8 A;  3W7B A;  4PG8 A;  2HS3 A;  2MHE A;  2NRE A;  1DFD A;  3EGN A;  4DUZ J;  2G13 A;  4FNH A;  4ANC A;  2I6W A;  2GQQ A;  2MMY A;  2O1P A;  5FJ4 A;  1WC0 A;  3RYL A;  1T9U A;  1Q86 T;  3HZG A;  1QAX A;  2Q6B A;  9RUB A;  2J6S A;  2K1R A;  3QGI A;  3QT6 A;  4B3R J;  2NZC A;  4KY3 A;  1FNM A;  2FVQ A;  4IOC Q;  2KFZ A;  1DAR A;  5HJX A;  4AL5 A;  4ZCI A;  3KYL A;  3IWN C;  5SUH A;  4CRJ A;  1EAR A;  1NDL A;  4H4K C;  4ZVU B;  3IG1 B;  3RG6 A;  2KH9 A;  1RYS A;  2IRU A;  2HSE B;  2CPE A;  2RU9 A;  3M8Y A;  3R27 A;  1WTF A;  3FBB A;  3H2V E;  4ILR A;  1U1N A;  1PJ5 A;  1OY8 A;  2OPR A;  4K7Q A;  1V3Z A;  2MQM A;  1E6V A;  3MOZ A;  3LH2 S;  1EKR A;  1RAI B;  3CGI A;  5FLX U;  3SBM A;  2YNI A;  3T9N A;  4DV0 F;  4GMK A;  5KFB A;  2KZZ A;  2O67 A;  3DGP A;  2CNL B;  5LSO A;  3SCL E;  1T11 A;  2V68 A;  3UPF A;  1S48 A;  1R0C B;  1WG5 A;  4LBI A;  4Y00 A;  3EVM A;  3G6Y A;  4LBH A;  1JX4 A;  3DLB A;  3M6U A;  3M8Z A;  5GAD I;  4QJV A;  1N5S A;  4QIE A;  1SB6 A;  1CJT B;  4G6V B;  2ASJ A;  1KKH A;  1RT5 A;  2ROG A;  3IMQ J;  2DGX A;  4M63 A;  3SSR A;  4A8O A;  4YS2 A;  4TQR A;  5CXT A;  4OHW A;  2HZV A;  4I67 A;  4F04 B;  5DZ6 A;  5KFP A;  4MIW A;  2DNZ A;  4ZVO B;  1T3O A;  1ITP A;  2G9O A;  4O3S A;  1VYA A;  4ZPD A;  1EP4 B;  2VG7 A;  1U0S A;  4KR0 B;  4I2P B;  3S7R A;  4PZV A;  4DPW A;  1DQ9 A;  1VIS A;  6FDR A;  1Y0H A;  4EBD A;  3K5L A;  4PXC A;  4WP8 A;  1VC6 A;  1RJJ A;  4JI7 F;  5KFK A;  2EFP A;  3ENV A;  2GVZ B;  1FKP A;  2ZUG A;  2LCW A;  3DLG A;  3PZP A;  3H7H B;  1U8S A;  2NSB A;  2CQD A;  2AYE A;  3C14 A;  2CJ9 A;  1S5Z A;  1WF0 A;  4C8N A;  4KAI A;  1UEV A;  3CPW R;  3ISZ A;  1U09 A;  4X4R A;  3AT1 B;  1FRI A;  5A8W B;  3CT9 A;  3P45 B;  4RW4 B;  3PIO Q;  4DFJ A;  3U27 A;  4CI0 B;  3HP6 A;  4I6Y A;  2C2N A;  2V2Z A;  1IBC B;  2YNH A;  3EJM A;  3ZTQ A;  5ADZ A;  2BJ7 A;  2D41 A;  1MWZ A;  2ILZ A;  2HGM A;  1RBL A;  1FRK A;  2C3P A;  2L3M A;  3MAQ A;  1JB0 C;  2YKA A;  3LP0 A;  4EBC A;  2CQ1 A;  2HNZ B;  2VPX B;  4YME A;  1RT1 A;  1S6P B;  4DR2 J;  1N32 F;  3QJJ A;  4DV2 F;  3DRY A;  3HJV A;  3OR2 B;  3H5S A;  4HLB A;  2MQ8 A;  4B3T J;  3MAA B;  4IQX A;  2RQC A;  1NK4 A;  1YJN S;  1S10 A;  2ZEJ A;  1VC5 A;  2UUC J;  4JI3 F;  2PN6 A;  1UW4 A;  2VDH A;  3HD2 A;  5KFZ A;  1JJC B;  1S9F A;  2F8M A;  2I1R A;  1A6L A;  2UVW A;  1FX2 A;  1RTJ A;  5BJR A;  2V8H A;  3VAK A;  1T8E A;  1N56 A;  3CJ4 A;  3HSD A;  2HHT A;  1CC7 A;  1F9F A;  2GML A;  3UWT A;  3G82 B;  3CD5 A;  1FK9 B;  1PBU A;  1V5V A;  1RQ0 A;  2CQG A;  3ICL A;  2DGT A;  1Q16 B;  1RAD B;  2YVS A;  3HZE A;  4M5D A;  4PKD B;  3HFK A;  1XTZ A;  4IH6 A;  2RB7 A;  1KRP A;  1W2B R;  8ATC B;  2OTL S;  2HNZ A;  2VPY B;  1NME B;  1HWK A;  2BW7 A;  3D5M A;  1BQN B;  2W7O A;  2GZO A;  1M5P C;  1Y3J A;  1FRM A;  3FEY B;  1K1Q A;  1Z2L A;  5U47 A;  3GYX B;  4CH0 S;  1B0T A;  2GAG C;  3HSJ A;  3QFW A;  5LOQ A;  5IWA F;  2EWH A;  3CCR S;  4HKQ A;  3ZFV A;  3PO5 A;  1U47 A;  2VBW A;  3I87 A;  5T7L A;  2CZV C;  4J9L A;  5J2M A;  2JHE A;  3DCA A;  4JYA J;  1OIA A;  2IC3 B;  3IWL A;  4KHP F;  1RTJ B;  3EWG A;  4DR7 J;  5ETK A;  1FFS B;  2V5H G;  1URR A;  2CXE A;  2DIT A;  1NU4 A;  2WSE C;  5HAT A;  3PV8 A;  1RKJ A;  2VOP A;  4BC9 A;  2XYP B;  4FNI A;  1P6T A;  5E33 A;  3QAE A;  4NXN F;  4KV8 B;  1JKH A;  1KEK A;  3MUT P;  4IR9 A;  3M2V B;  2VH7 A;  5EHH A;  3HX9 A;  4IH5 A;  4X64 F;  3H98 A;  4ZP9 A;  4CLL A;  1FEH A;  1WDD A;  5ETP A;  2HRU A;  3DFE A;  4Q7A A;  1QSY A;  1DY3 A;  4RW9 B;  5DRK A;  2UXC F;  4P7V A;  5DDO C;  4K4T A;  1JLB B;  1JIH A;  2JLF A;  4RBU A;  2HYI B;  1AFI A;  1O51 A;  5HO4 A;  2J5A A;  4ZKA A;  5J2M B;  3QWP A;  3MPD A;  1FF2 A;  1DQA A;  4CTA A;  4EBE A;  5HMX A;  1CJV B;  1RAJ A;  3H5Y A;  2MB0 B;  4ZOS A;  5D0G A;  2VBZ A;  2OSQ A;  3OHA A;  2DCU B;  3IRW P;  2A3J A;  2QV6 A;  4ZCK A;  2WW4 A;  3SQO P;  3CUN A;  3K5P A;  5K8P A;  1RAF B;  2HKE A;  5KFG A;  2E5I A;  2B9W A;  1QLN A;  1TL5 A;  3BSA A;  2HS0 A;  3VZH A;  3MM6 B;  4Y2K A;  1HPZ A;  3KLG A;  2CQ4 A;  3BF4 A;  4NXM F;  5HBM B;  2JJ4 D;  4QCL A;  4K4S A;  3I56 S;  3JS9 A;  3EYZ A;  4U95 A;  1J5O A;  2W2M P;  4JV0 A;  5IV4 A;  2R7T A;  2H1Y A;  2UVU A;  3G4S S;  1QE1 A;  1NKC A;  2OEL A;  2ATC B;  3QBC A;  1D09 B;  2VFS A;  3KUG A;  4GC7 A;  2XEX A;  5G0R B;  2MZ1 A;  1S0O A;  4GVL A;  4LSL A;  3GSD A;  3PXG a;  5D4O A;  2F4F A;  1DTQ B;  2MZQ A;  3MUR P;  3B54 A;  3LW5 C;  1D9D A;  4CYU B;  4HVZ A;  1C4C A;  2BQ3 A;  3WC2 A;  2MKH A;  4XDC A;  1H2V Z;  4CO5 A;  2N3L A;  2BEF A;  1HYS B;  2NSC A;  2XI3 A;  4OV6 A;  3FC9 A;  1SL1 A;  4FKY A;  4HHU A;  5ETV A;  2ZVS A;  1R6V A;  3DM2 B;  2WRM A;  3UO0 A;  2A10 A;  3RB0 A;  3QRP A;  4F02 A;  3R5A A;  5GAH I;  2J0S D;  2LP4 A;  4MKV A;  4QIW D;  1KNZ A;  1PYS B;  4LJM A;  1X7V A;  1FEE A;  4LRD A;  2H4W B;  3NCQ A;  3HCX A;  2L41 A;  4FXV A;  2L08 A;  1T95 A;  3QT8 A;  1JXL A;  2ZBC A;  1J5O B;  1QJH A;  4WU2 A;  2P9C A;  4LFC J;  2HHX A;  1R31 A;  5H9F J;  1QE1 B;  1ZA1 B;  4F25 A;  2R7S A;  3ISN C;  4J9V A;  4NRT A;  2B4V A;  2FHM A;  4A46 A;  2EFG A;  2J0Q D;  3VV2 B;  5KFM A;  3NNH A;  1FO1 A;  4FS1 A;  3W2V B;  2OPQ A;  4A8F A;  4EYH B;  3W9I A;  2YKM A;  4CDI A;  2LMI A;  1HBU A;  2YQ0 A;  2BZ2 A;  1RT2 A;  2F9D A;  4PEO A;  3T1H F;  4JOU A;  2CQC A;  3DHX A;  5IS2 A;  1YJ7 A;  2WB1 D;  2VBY A;  3MCN A;  4K0K J;  1CLF A;  1U6F A;  4N5S A;  4DCO B;  2EK6 A;  4RLE A;  2UUC F;  2HBQ B;  1P1T A;  1UPP A;  1XNQ J;  5KFH A;  4PRF A;  3K0J A;  3GLJ A;  4KFB B;  3W62 A;  4ZN3 A;  1ZAX A;  1WSR A;  3D7S B;  3M4X A;  3BSO A;  1MRO B;  3RRH A;  4Q0B A;  3PYF A;  4DV2 J;  1RAG B;  2ZOM A;  3LP1 B;  3N79 A;  3TUI C;  3RW7 A;  5L9N A;  3MR2 A;  3QNW B;  3OVS A;  4DS4 A;  1ZOT A;  2HQ3 A;  1F3V A;  1I51 B;  2EG2 A;  1KQS R;  3BN7 A;  1RA6 A;  2LU2 A;  2RML A;  5ETM A;  2QA4 G;  3V6J A;  1UP1 A;  4CCH A;  4G3I A;  2F9J A;  2LLZ A;  3Q86 A;  3RJM B;  3QZ7 A;  4NYO A;  1FKA F;  4WCE Q;  3N0V A;  1JK9 B;  4I1T A;  1RT5 B;  2YKM B;  2PT0 A;  2ZHO A;  3V6D B;  3GJT B;  4JI6 F;  1W7W A;  2IRX A;  4ENO A;  2HVH A;  4FYD A;  3L7P A;  4NYZ A;  4NCA A;  4NCB A;  1Z4U A;  4LRC A;  5KFF A;  2XCA A;  5ETN A;  3TO8 A;  3DRR B;  4K2X A;  4ED6 A;  1LWC B;  2UXD J;  1JLG A;  1VBY A;  2KVQ E;  2WTF A;  4QBU A;  2GMH A;  2AEM A;  5ITH A;  1QTM A;  4ZPW R;  4QWA A;  4I2P A;  4EO8 A;  2PI4 A;  2E5G A;  4N8N A;  3BPD A;  2HAI A;  4ZPV R;  4F4W A;  1KC8 T;  5DGB A;  4DUY F;  3I82 A;  3DGV A;  2BKN A;  5K9F A;  5A0Y B;  4ZPB A;  5F3T A;  1U1R A;  2DPJ A;  2O66 A;  2GVZ A;  4K8R A;  4N41 A;  5K8N A;  4TY9 A;  3D0I E;  2RS2 A;  3QFH A;  2MPU A;  4LIR A;  3SXL A;  4F26 A;  4ZP8 A;  1TL3 A;  4F0K A;  4WFA Q;  3OR1 A;  3O1L A;  2W24 A;  5HVH A;  2Q3P A;  4HEA 9;  1XBW A;  2JL9 A;  3AAW B;  3N28 A;  4Q45 A;  1CQM A;  2X51 A;  2UZA A;  1VQ7 S;  5IFM A;  4KSE B;  2BYC A;  4F7V A;  4OQJ A;  2FY8 A;  4QU6 A;  4KYZ A;  4L3K A;  4ZIW A;  5HVG A;  4PQU B;  1DAX A;  1RU2 A;  3EMT A;  1NH8 A;  3JSB A;  4Q8F A;  3KWM A;  1XNR F;  2CAD A;  4IG0 B;  5D4N A;  2IJN A;  2JLG A;  2BA9 A;  2R7W A;  3H2U B;  3VAM A;  2P8I A;  4ICL A;  4Y6I A;  5JMN A;  4NE9 C;  3R2C J;  2OD6 A;  3JTN A;  1HNV B;  1NJX A;  4Q44 A;  4A8K A;  1T9W A;  3DLK A;  2D74 B;  2HFU A;  2RE1 A;  4RBV A;  3D2W A;  2G2Z A;  4MK9 A;  4PAA A;  2HIY A;  2FGC A;  4ZP6 A;  3RU0 A;  3C8Y A;  4DV1 J;  3FRZ A;  2QG9 B;  1SKW A;  1RGV A;  3DYA B;  2XLK A;  4K5R A;  2UU9 J;  3BN4 A;  4P2S A;  2GJF A;  3CDB A;  3HVW A;  2OEM A;  1OY9 A;  2XUL A;  5F8I A;  2B9X A;  1CJU B;  4GVB B;  2LQB A;  1RAA B;  4WF9 Q;  5KG2 A;  3A3O B;  3V4I A;  2HFO A;  4NYP A;  3A4T A;  3DOM B;  1T05 B;  4RW7 A;  5F8N A;  4P2F A;  1RWN B;  3AA9 A;  1MLA A;  6AT1 B;  2FZG B;  5RUB A;  1KN6 A;  3Q2T C;  1NSK L;  1WEZ A;  1Q0N A;  2HBY B;  3SCJ E;  2OIH A;  1DZ5 A;  2HQC A;  1FER A;  4MYU A;  2PMZ D;  3U02 A;  2N7C A;  2KHD A;  4O4G B;  1S57 A;  1MU2 A;  1I94 J;  1S4E A;  4QW9 A;  1QAI A;  3PHE A;  4ID8 A;  4WFN Q;  4J7C A;  4DR3 J;  1K1S A;  4DX7 A;  1FA0 A;  4G1I A;  2YTC A;  2IM3 A;  2IC3 A;  2KDO A;  4Y2A A;  3T41 A;  4AE5 A;  3HD1 A;  2RH3 A;  3UR0 A;  3CJ0 A;  2IYG A;  1XR5 A;  1YX2 A;  2JFD A;  2YPZ A;  4RX6 A;  3J7Z T;  3KLF B;  3OJU A;  3CMA S;  3VAJ A;  1WKL A;  3RRK A;  1WTB A;  4GVB A;  3NS6 A;  1KR4 A;  2GIR A;  1ZTW A;  2R7R A;  3CD7 A;  1LW0 B;  2QSW A;  1TP7 A;  3EGV A;  3FKB A;  4NA2 A;  1EET A;  1S59 A;  1WEX A;  1C1C A;  1Y7P A;  1JKH B;  4JI4 J;  2HVI A;  5IT4 A;  4DSE A;  3ET6 A;  3W3S A;  3IAM 9;  1LWE A;  3LAN A;  1S99 A;  3ILJ A;  2VUG A;  2MXY A;  1GAO A;  5DS7 A;  2UXD F;  4WZQ A;  3K2Y A;  4O4G A;  1NSA A;  4ZLJ A;  2V8G A;  3GE9 A;  4F36 A;  5A8R B;  2OFH X;  4OZJ A;  1LW2 B;  2OMO A;  1R0A B;  3ZZZ A;  1EQM A;  4CTA B;  4FPI A;  2C42 A;  1TU0 B;  3RZA A;  3G8S A;  5DGA A;  4FF3 A;  4X4O A;  3BV8 A;  5FLX Y;  5HP1 A;  5GAH U;  1SL0 A;  2AJ2 A;  2BJ8 A;  3NKY A;  3Q23 A;  3G9C A;  3ZTS A;  3DU6 A;  1R3N A;  3EVW A;  1JNZ B;  3WDO A;  2UP1 A;  1U02 A;  3H20 A;  3BGL A;  1OQ3 A;  2DJW A;  4I64 A;  4WE1 A;  2QLX A;  3KJV B;  2GAH C;  2ZH4 A;  4QYZ K;  5E3Q A;  3IS9 B;  3MD1 A;  2B43 A;  3GII A;  4KT0 C;  3I6P A;  3KLG B;  3D6H B;  3CC2 S;  5AXK A;  4P73 A;  5HBM A;  3MGJ A;  3TZX A;  1DBD A;  3P3D A;  2FHO B;  1FX4 A;  5KFV A;  3TR5 A;  5MAO A;  1JLF B;  3RGI A;  2GQC A;  3KK1 B;  5L1L A;  1N5V A;  3M2U A;  3AD7 C;  2P6T A;  4DN9 A;  3EDQ B;  2FVS A;  1F2H A;  2IVY A;  4JUZ A;  4B02 A;  2W01 A;  4N7T A;  3VGU A;  1S77 D;  3QSI A;  4DR4 J;  4OZ2 A;  3KK2 B;  2JFK A;  1PC4 A;  2KXH A;  4CYU A;  1A9N B;  1AZS B;  4UOG A;  3TYT A;  4ED3 A;  4NEZ A;  4U6P A;  1IM4 A;  1PIE A;  3TQ1 A;  3TW0 A;  2VL1 A;  1CUL A;  2BBE A;  4LFC F;  5EWG A;  3TJ8 A;  2DNO A;  2ZDP A;  1UJ4 A;  3CCW A;  2ILY A;  2EBG A;  3Q8Y A;  3OTB A;  4LR9 A;  4M8L A;  5G4D A;  1X5O A;  1OO0 B;  1YGY A;  3IS9 A;  4P74 A;  4UST A;  4R5P A;  3GCW P;  1N34 J;  1JJ2 R;  4LRB A;  4C3K A;  4PXD A;  4ALZ A;  2G2O A;  1S1T A;  5HQM A;  4JV5 F;  2XWY A;  2E7V A;  2VV5 A;  3SCI E;  1JLF A;  3PX4 A;  5KT3 A;  1LWF A;  4GO7 X;  1SH2 A;  2J9D A;  2MTL A;  3CJT A;  4ZVH A;  4A47 A;  5B0E A;  5IXU A;  1VQL S;  2Z2Y B;  2RU3 A;  2VOO A;  4DF8 A;  1M1H A;  1HD1 A;  2XGP A;  2JEG A;  4RNF A;  3HKW A;  4ELU A;  2DB1 A;  1F60 B;  2B9Y A;  2CAJ A;  3QQC D;  4P2M A;  3GQC A;  4O0I A;  1QSL A;  3QZ8 A;  2XQC A;  4NLW A;  2AYM A;  4YHH J;  3GON A;  3QIP A;  3SMZ A;  2D3U A;  2VKZ G;  3GYG A;  2ALY B;  3D67 A;  4FBU A;  4C8Z A;  5KFR A;  1UAW A;  3A3P B;  3LGM A;  4G1P A;  2R2S A;  3AH6 A;  1VQP S;  1RTI B;  4WK3 A;  3IM8 A;  5E41 A;  1XJW B;  4R5P B;  4Q0B B;  2XLJ A;  2KG0 A;  3N6M A;  4F0H A;  1N52 B;  2C28 A;  4GKJ F;  3OTD A;  4FP9 A;  2JVR A;  1S49 A;  2I5J B;  2QA1 A;  3MM9 A;  3GG1 A;  4NCG B;  2XZD B;  1HAR A;  3K5M A;  1IQZ A;  2VQE F;  3IR5 B;  2V2K A;  2CQ2 A;  4DV1 F;  1S1U B;  1Y00 A;  3MEG A;  4UW2 A;  1HHS A;  2ZH8 A;  4LFA F;  3LUY A;  4ID5 A;  2GX8 A;  2M2B A;  2FDN A;  2V8D A;  3LQV A;  1BHN A;  3PAC A;  1O5J A;  4KQZ A;  4LUB A;  2EG1 A;  1UJ5 A;  3IR7 B;  3P4U B;  4LVO P;  2HAF A;  1HNI A;  1RB0 A;  2YKN A;  4URG A;  4RZR A;  1TUW A;  4L73 A;  2ZWO A;  4LSN B;  2F65 A;  1G1X A;  5E2Q A;  1EHW A;  1HKA A;  1IBM F;  2F3J A;  2BQR A;  4EZ6 A;  2GMJ A;  2M3D A;  2W2Q P;  3C16 B;  1JLG B;  1FRL A;  1XK8 A;  5KFT A;  3EDR B;  5C25 A;  4ED2 A;  2C3M A;  3PW0 A;  4ED4 A;  4MKB A;  2CPD A;  3U1N A;  1RK8 A;  3OTO J;  3PW7 A;  3MMB A;  3OHB A;  1KTQ A;  4KH0 B;  4CO4 A;  2GIF A;  5M2U A;  1JLQ B;  5F8L A;  5A0Y A;  2LQ8 A;  1RT6 A;  3FUY A;  4DBQ A;  3D3B J;  4KBI A;  1S1U A;  5E5N A;  5CYJ A;  3M32 B;  1PKU A;  3HVA A;  3NXZ A;  2KRB A;  3GU0 A;  2IBK A;  1TL3 B;  2XM3 A;  2QSF A;  4PG6 A;  1KTV A;  2EVZ A;  1JNR B;  1U0H B;  2ZOG A;  1FT8 A;  5DDR C;  4QOT A;  1P9Q C;  2Y0B B;  1X5P A;  1GTH A;  1BMQ B;  2HND B;  5B0A A;  3ETM A;  3R6G B;  4BDP A;  5HI7 A;  3ULH A;  1FWL A;  4U7C A;  1TFY A;  2W25 A;  4DR1 F;  1GXU A;  1RTZ A;  1NO8 A;  4USV A;  3IGV A;  3UD4 P;  4ATN A;  4C11 A;  3RB3 A;  2XMM A;  4NLS A;  5DO2 A;  1WI8 A;  3UW1 A;  1FVS A;  5IQQ A;  4EFA C;  4DV4 J;  2DVI A;  2DGW A;  4JI1 J;  2X1F A;  3QJP A;  1U1Q A;  2QA4 S;  2XC9 A;  3KLH B;  3O44 A;  4B3S F;  2F8E X;  5F8H A;  5L1I A;  4CM0 A;  2CPI A;  1RT6 B;  5KFL A;  2C3U A;  3TRG A;  1UZD A;  2CJA A;  5A6P A;  2KI2 A;  1SJR A;  4NLO A;  3W66 A;  2DNH A;  1Z2Z A;  2WW8 A;  4HH0 A;  2YX4 A;  4OZ1 A;  5CYQ B;  2FVR A;  1FRH A;  4ZA1 A;  2V4Q A;  4WZM A;  2C2R A;  2FJB B;  1F5A A;  4LF2 A;  4N47 A;  5HSP A;  4OHY A;  2C2M B;  1NPR A;  4OYX A;  3LO3 A;  4H4M A;  4DMZ A;  4K4Z A;  2DGQ A;  3F41 A;  3DLJ A;  1FFW B;  1HR0 F;  1XNQ F;  1SI9 A;  2MKS A;  4ZPC A;  4DF4 A;  3B82 A;  2A18 A;  3BSC A;  5J2P A;  5GMD A;  3DOM A;  2CJQ A;  4RW7 B;  2OD4 A;  2XYG B;  2R8I A;  2COL A;  3MM7 A;  1N0V C;  5THW A;  5CA5 A;  2DK2 A;  1V9O A;  2KRR A;  1TL1 A;  3EGZ A;  3LAK A;  4TYB A;  1LFW A;  4DCJ B;  2N3O A;  2EC0 A;  4M5M A;  2B6A B;  2FD2 A;  3W9J A;  2ZUA A;  4IO9 Q;  2EC2 A;  3TAN A;  1Q81 T;  4UOC A;  2QN6 B;  2BAN B;  2EFO A;  2AJ4 A;  2QMU B;  1G2E A;  3OPK A;  3QWU A;  2ZC3 A;  4EK2 A;  4NLQ A;  3W8P A;  5KG3 A;  2IRY A;  1UFW A;  2CJX B;  3AD9 C;  3D1O A;  4FYX B;  4PG5 A;  4ECQ A;  3OL7 A;  3KHL A;  1ZPV A;  1D9F A;  3X1L B;  4DJB A;  4N77 A;  3J81 j;  4TU7 A;  2BOP A;  1T0T V;  2M5Y A;  2OTJ S;  3HHE A;  3NAH A;  2MY8 A;  3CCE S;  2ZFH A;  1N5Y B;  2ZBP A;  1HHQ A;  3GR0 A;  5CAB A;  2IM0 A;  4DX5 A;  1NHU A;  2BE9 B;  3CO0 P;  1LWE B;  4OYM A;  5DJB A;  1UET A;  2BJ9 A;  5A8K B;  4X65 J;  3QSY B;  3GFH A;  2D1C A;  3HDS A;  1BLU A;  4R8U B;  2D9P A;  4DWI A;  1U2F A;  1S6Q A;  3O3L A;  4D3G A;  1TL1 B;  2AZ1 A;  2Z58 B;  3BQ2 A;  2GHP A;  9ATC B;  3QO9 A;  4C9D A;  3MM5 B;  4RNN A;  2CPH A;  2LQ5 A;  1K0V A;  2O01 C;  4F2R A;  1CVJ A;  2WZ1 A;  2G2Y A;  3OV7 A;  2FJE B;  3G6X A;  4MFB A;  4LF9 J;  5AT1 B;  1HIY A;  2JZ5 A;  5HP1 B;  2V8P A;  7FDR A;  2DIV A;  1XWL A;  1BWE A;  1KD1 T;  3JSM B;  2QLF B;  4KB7 A;  2PMW A;  1F2G A;  3Q24 A;  1EZZ B;  4DR6 J;  3DMJ B;  4IR1 A;  1N5Y A;  3H5U A;  4WE1 B;  3MR6 A;  1IKW B;  1VI7 A;  3PIP Q;  3V5R A;  2ROE A;  4PXE A;  3OLA A;  3C3L A;  3M7V A;  4Q2M A;  2XZW A;  4FF2 A;  4W4M A;  4NLY A;  3M2R A;  5A8K A;  1VRT A;  1U8W A;  2ZH6 A;  1BQM B;  4I6W A;  1KFD A;  2R4F A;  3CVK A;  1KLM B;  4KO0 A;  3DRP B;  4ZDN A;  4PG4 A;  2IDL A;  4YDD B;  1H73 A;  3UD5 A;  2UUA F;  1U24 A;  4PUO A;  4YDX A;  4U96 A;  1FDD A;  2DIS A;  1TV6 A;  3MFI A;  4B3R F;  2F7V A;  2HLU A;  1PYT A;  3W8G A;  2C2O B;  2GCF A;  4ZJO A;  4CNY A;  2GJI A;  4TYA A;  1TL7 B;  2IDE A;  2MKK A;  1CS4 B;  2X1A A;  1VQK S;  2E1P A;  3GIL A;  3KHR A;  1XER A;  4ZS6 A;  3JSR A;  3C15 B;  4C6A A;  4KPC A;  1CUL B;  1VK8 A;  1JJH A;  3EE3 A;  3LP2 B;  3Q22 A;  1ZZN A;  4BS2 A;  2AP6 A;  1FJC A;  2EI5 A;  3M9M B;  3KUE A;  1YJV A;  1JJ4 A;  2E29 A;  5BYS A;  1IR1 A;  5I3U B;  5A2Q Y;  2JWN A;  3CME S;  3DDI A;  1X4E A;  2V9K A;  4C0H A;  2PI5 A;  3BKF A;  1S1T B;  3ZZO A;  4A8M P;  1WOO A;  1RT7 B;  3CIM A;  4JYA F;  2CNN B;  1KLM A;  3PTW A;  4KO0 B;  2ZH3 A;  3QJL A;  4X2B A;  2LXU A;  4DV4 F;  2GVD B;  4DL4 A;  1TKZ B;  2RQ4 A;  2DY1 A;  1R6Y A;  2OFG X;  3M30 B;  4WWS A;  2EFV A;  5CHC B;  3PKY A;  3JYT B;  1X4F A;  4DR1 J;  1G6B A;  1TV6 B;  3FSI A;  3EXY A;  5I4M A;  1WNE A;  4A4J A;  4A8W A;  3PW4 A;  2BR0 A;  1RLC L;  1TL7 A;  4RJV A;  3R1H A;  5K14 B;  1RSC A;  1ZM4 A;  4IRC A;  4RWW A;  4KH1 B;  3PKM A;  4DQI A;  1N36 F;  2XY7 A;  3P96 A;  1OJ4 A;  4OMF G;  2X3D A;  3LP2 A;  4CLT A;  5KT2 A;  1K44 A;  2JNJ A;  3MWB A;  1V5I B;  3AFG A;  4YN3 B;  3BSN A;  1D0E A;  1X0F A;  1FXD A;  1REG X;  3H59 A;  5I3U A;  1U1L A;  4JI0 F;  3PJW A;  4LBP A;  1D1U A;  2YPY A;  4DSK A;  5IM0 A;  4F4Z A;  4EO6 A;  3R9L A;  3M8P A;  1YJU A;  4NCG A;  2WVD A;  1MWY A;  3G8Q A;  4QR1 A;  5KT7 A;  1LK5 A;  3NCP A;  1IUJ A;  4HTI A;  2QMX A;  2PO4 A;  4H4O A;  4P9S A;  4WFY A;  2QLB B;  2ZBQ A;  2P9E A;  1UL3 A;  2KT2 A;  3C6U A;  4WYL A;  3ETO A;  2N4C A;  3HSZ A;  2C3O A;  2MQQ A;  1GXT A;  2U1A A;  4NPO A;  4BHQ A;  2E5H A;  1MN9 A;  2KM8 C;  4DR2 F;  1H7X A;  1M0S A;  1NB2 A;  1Y5I B;  2JDJ A;  3NOG A;  3S1T A;  5HMZ A;  3ZZT A;  3JSY A;  3ENQ A;  1WUU A;  2KYZ A;  7FD1 A;  5AXN A;  3KG1 A;  4LFA J;  2F1F A;  3NEK A;  3PJ9 A;  1R7I A;  3Q8S B;  1SVD A;  3W2W B;  3CCQ S;  3IRX B;  3TUP A;  4ELV A;  3ZNU A;  1UPM B;  1O6X A;  1S1X A;  1UWB B;  4TU9 A;  3H40 A;  3MMJ A;  2VQE J;  4CM2 A;  3O8W A;  3TAM B;  2CQH A;  1AW0 A;  1JLQ A;  5FII A;  3CJQ A;  4RUA A;  2NUU G;  4DQR A;  1FJE B;  2XS7 A;  3QGG A;  2W4P A;  1YBT A;  4ZJL A;  4B9M A;  1NPP A;  2BM1 A;  2MY7 A;  4IQM A;  1WHW A;  4OLP A;  5LSL A;  2WK4 A;  3HFV A;  1RCO B;  4DXL A;  1IM6 A;  2RIL A;  4PYD A;  4LF1 A;  4Q8E A;  1ZYQ A;  2W4C A;  3FNN A;  1YK9 A;  2CPJ A;  4K4V A;  1S0N A;  2NXE A;  4IYQ A;  4ZCL A;  2DNP A;  2P6S A;  5HLF A;  1GNK A;  1RDR A;  1HHT P;  5DM6 Q;  2H5E A;  3NGU A;  2MKC A;  4DG1 B;  3I31 A;  3IAS 9;  3IRX A;  4EYI B;  4PWD A;  2GV1 A;  1F0X A;  3HVT B;  4USU A;  4DR3 F;  4J9P A;  3PYE A;  3FQL A;  1M5H A;  3TAM A;  1RE1 B;  1IKY B;  1TTH B;  2BKP A;  4FF1 A;  2G0I A;  2B5J B;  2RRB A;  5L8R C;  1N34 F;  3M8Q A;  2Y3Y A;  2ACY A;  2J6T A;  4CO1 A;  4LIW A;  3DDK A;  1JLE B;  1T9T A;  5CYQ A;  4ES3 A;  1IKX A;  4QIF A;  4K5S A;  2F4V J;  2E1M C;  3GTY X;  1C0T B;  2HHH J;  1HW9 A;  4A8S A;  1Q8L A;  3KMS A;  2UUT A;  3L4B C;  5EDW A;  1OSC A;  4RUC A;  4KPY A;  2LYV A;  4O3Q A;  5DQH A;  3GB0 A;  2B8P A;  4JB8 B;  3EPI A;  2BRK A;  5J2P B;  2OO4 A;  1U6Z A;  4I4B A;  4QQB A;  4PWD B;  3MM7 B;  4HHJ A;  3ZTO A;  6FD1 A;  1IBL F;  2ZH2 A;  2IA6 A;  4DSI A;  3LPY A;  3QGH A;  4O3P A;  2K7J A;  3K7R A;  4IDK B;  4ECR A;  1IWA A;  2Y8W A;  3W1Y C;  3JQM A;  3J7A N;  4QZV B;  2VG5 B;  2B6A A;  2ZVI A;  5J2N B;  2ZD1 A;  2CJK A;  1OY6 A;  3Q8V A;  5EX0 A;  4O3O A;  2ZKT A;  2K1R B;  4PXB A;  1QVF R;  4C8Y A;  4P52 A;  3MR7 A;  5F41 A;  1AT1 B;  4B9V A;  1YZ6 A;  1HW8 A;  3T6J A;  3JAM Y;  2Q43 A;  3EXC X;  2FJD B;  2K3K A;  3R5G A;  3VQT A;  4WPA A;  2AF6 A;  3ZZR A;  2LQ9 A;  4RUH A;  1ZTT A;  3E8O A;  3R1L A;  5L46 A;  2DNG A;  1HBN A;  2H65 B;  2RSQ A;  1TL4 A;  5HL7 Q;  2HGN A;  4NI2 B;  2XYH B;  4C8M A;  4BWJ A;  4AND A;  2C22 A;  4F8R A;  1MNE A;  1UWA A;  2U2F A;  4JI0 J;  4J5O A;  2DBB A;  2ZE2 A;  2DH9 A;  1S1V B;  5B0C A;  2XLI A;  1VFJ A;  3HKZ D;  3MHY A;  3H25 A;  5ETT A;  4TLR A;  4OYP A;  4DUY J;  5BR8 J;  1T02 A;  3MUV P;  3MTJ A;  2ZJR Q;  2CJY B;  5I42 B;  3PEH A;  4JI4 F;  3SI8 A;  1C4A A;  1R43 A;  2IJR A;  2XMK A;  4RU9 A;  2ALZ A;  3CD0 A;  4GO5 X;  4QIV A;  4ZPT R;  3BDP A;  3R3T A;  4XK8 C;  2FHJ A;  3R5D A;  2E9Z A;  4WFB Q;  5CZX A;  4CLY A;  1U4B A;  3Q2S C;  1A0O B;  3ITH B;  5KFW A;  3DLE B;  3DOL B;  1RYR A;  3US5 A;  2KO1 A;  1DLO A;  4AFF A;  3DMJ A;  2FVP A;  1WOS A;  5HRO B;  3G6V A;  1IKW A;  1ROF A;  1M90 T;  1AYE A;  3O6Q A;  1YQH A;  1VRQ C;  2BJE A;  2UV8 G;  4ANE A;  5K20 B;  1B7Y B;  1RU1 A;  1VRT B;  2Z0G A;  3G71 S;  5E7O B;  1KVK A;  5HVF A;  1YBU A;  5AXM A;  2N7Y A;  3KLI A;  2RNE A;  1ZS6 A;  2CPZ A;  3BGF A;  4DI6 A;  3JAM U;  3BYP A;  3NWR A;  4CIO A;  2R2R A;  2ZNZ A;  1IVZ A;  2IJF A;  2WCX A;  1GXL A;  3IO1 A;  3K8V A;  1FKP B;  3NCR A;  4I7F B;  3SQG B;  3T5L A;  2ERR A;  2FPH X;  3I5B A;  1S7I A;  2W9C A;  4JI2 F;  2J7U A;  1CJK A;  2WVF A;  5I42 A;  4J90 A;  4ZHR B;  1WC6 A;  3CMQ A;  2DNN A;  3ILI A;  3J80 Y;  4ECT A;  2BQU A;  2QO3 A;  5HAN A;  1U45 A;  2JC0 A;  4F4A A;  3E3X A;  3PYD A;  2ZZM A;  3QID A;  5LMU J;  3DLE A;  3DOL A;  1NK0 A;  2ZZN A;  3KNG A;  4K0K F;  3KOA A;  2GC8 A;  5EWF A;  4USI A;  2V6A A;  2HFZ A;  3ZO7 A;  4J9S A;  1X9M A;  2VA2 A;  4KGK A;  1NJW A;  5B7W A;  2Y8Y A;  4K4X A;  2DNL A;  2ZBI A;  3EX7 B;  3SQG A;  1VOM A;  2R2T A;  1N5Q A;  1O8B A;  1U1O A;  2OGU A;  4FPR A;  3QGP A;  5D0H A;  2LEB A;  2B0G A;  1XNR J;  2EKN A;  3V6H A;  1L3K A;  1MMN A;  2QL9 B;  2RDD A;  3HUL A;  2CPF A;  4URS A;  4ZHR A;  2DNR A;  2HVD A;  3I4H X;  2DY9 A;  3BYR A;  3MMC A;  2ZJP Q;  4LF9 F;  1HBO A;  2CQI A;  4R25 A;  5K14 A;  1V3S A;  2CPY A;  2FIU A;  3M8R A;  2H5J B;  4IH7 A;  2K8G A;  1QUP A;  1U7L A;  3RBX A;  1YSJ A;  4BC7 A;  2C2K B;  5IZH A;  3JTP A;  3GV8 B;  4NOH A;  1AXQ A;  2DGU A;  4P72 A;  1HI1 A;  3KKF A;  2HBZ B;  5I3Q A;  4OHZ A;  1SV5 A;  5KFD A;  1UVK A;  1EIY B;  4RWX A;  1BQX A;  1UCN A;  4WFX A;  5H9E J;  3MOJ B;  3UNY A;  4JV5 J;  4R0E A;  2DHH A;  2IPO B;  3NP5 A;  2JOQ A;  3CDE A;  3ZZY A;  2M4M A;  1JLC B;  4L6V 3;  2BE2 A;  3G2X A;  4X4U A;  2DXF A;  1ZET A;  5E3C A;  3CC4 S;  3B6B A;  3C6U B;  2W9A A;  3NNA A;  1N6Q B;  3SCK E;  1NZ8 A;  2OJ3 A;  1RTH A;  3AJ2 A;  1HBO B;  1U26 A;  3W61 A;  1F6T A;  3NGD A;  2KVI A;  1SUQ A;  2YKP A;  2C2D A;  4X4P A;  2CIM A;  1PC5 A;  2K06 A;  4E0D A;  1X60 A;  3LWL A;  3FQK A;  2CUY A;  3TA2 A;  4FKX A;  4RR5 A;  3NOC A;  2XB2 D;  1UFL A;  4O0N A;  2DR7 A;  1B7F A;  1S1W B;  1TKX B;  2RT3 A;  4LRA A;  3KTQ A;  3M9N B;  4JI5 F;  4B9N A;  5J1N A;  1CC8 A;  1JLB A;  2D9O A;  3JXO A;  1H2U X;  3D9B A;  3BQ0 A;  2YNF B;  4ZIV A;  4HT5 A;  1REV A;  4LT6 A;  1R89 A;  4DQP A;  1NHK L;  4G1Q B;  1R8H A;  2CNK B;  4C0B A;  4DL3 A;  2XWX A;  2XNQ A;  2FLO A;  4DSJ A;  2AEF A;  3HHK A;  3FVY A;  3GV5 B;  2AHO B;  3MCO A;  3F0N A;  1CJV A;  1Q82 T;  5B08 A;  4E2F B;  3IBC B;  2FTR A;  3ELH A;  3UDE A;  5K8O A;  1ZAW A;  2AX0 A;  4NML A;  4O3N A;  1RUS A;  4C7Q A;  2ASY A;  3GSI A;  3PYG A;  4ZLN A;  4YR3 A;  4ED7 A;  3T5J A;  4OL8 A;  1ELO A;  1DQ8 A;  1TUV A;  2KXF A;  3X3U A;  1TUG B;  3J80 U;  2J7W A;  2Z8Q A;  1U1M A;  3PO4 A;  1TAQ A;  1YHQ S;  2NPI A;  3MM6 A;  3CWJ A;  1HPZ B;  1X9W A;  4HR2 A;  2HK3 A;  4ECS A;  1N36 J;  2DGS A;  2DIU A;  1S1W A;  1TKX A;  2E44 A;  1FJG F;  4OJ1 A;  2RD5 C;  3HLU A;  3MI7 X;  2IFX A;  1NZA A;  1PSD A;  2HWH A;  1NXI A;  4DX8 H;  3V81 A;  4P2X A;  5I3P A;  1Q79 A;  4NLG A;  2HWT A;  2YX7 A;  2E1R A;  3FBE A;  2VC0 A;  3M8Q B;  2Z2L A;  4USK A;  2ACM A;  4Y34 A;  4RNM A;  3T9Z A;  1MW7 A;  3DNC A;  5G0R A;  1N33 J;  2LFV A;  3FCH A;  2KZM A;  1DTQ A;  2QA2 A;  1D8Z A;  3B8H A;  3OFE A;  1GQE A;  2RDI A;  4X62 F;  2DHG A;  1RCX B;  4QU7 A;  1FE0 A;  3CXC R;  1NJY A;  2W2P P;  3U1M A;  2EEY A;  5E0O A;  1YRT A;  2LA4 A;  2VG6 B;  2KL8 A;  2RHQ B;  3I32 A;  2CVE A;  2Q1L A;  2I2Y A;  2OPR B;  4USJ C;  4K4Y A;  1S6O A;  3BBF A;  4DHV A;  4AXJ A;  3PW5 A;  1J5E J;  1WEL A;  1HBM B;  2NXC A;  3GJR B;  3GYN A;  3LGH A;  3OLB A;  2CYY A;  3N5F A;  4USM A;  1NCL A;  3VAI A;  4NXM J;  3GJS B;  1IBK J;  4ZIT A;  2KYX A;  2QFJ A;  2YH0 A;  3I5A A;  3H4B A;  1IBM J;  1Q1K A;  2B56 A;  2RDJ A;  4FYV B;  2V4J A;  2IYI A;  5CQG A;  3D0G E;  3Q8R B;  2GS8 A;  4JI5 J;  2ZJQ Q;  2VZ9 A;  2UUA J;  1QD1 A;  1H3D A;  3H42 A;  2OPS A;  3A1Y G;  4GRS A;  4L75 A;  3SDE A;  3UR3 C;  2ZH7 A;  2PMH A;  2RF2 B;  4K4W A;  2DEJ A;  5GVQ A;  1MN7 A;  1GX5 A;  4HTJ A;  1B0V A;  3PEJ A;  2VJU A;  4MT1 A;  1S6U A;  2DNQ A;  2FJV A;  2CVI A;  2YY3 A;  1SQE A;  3TEG A;  5D6G A;  1PAE X;  3OXL A;  1K73 T;  5F8J A;  4YY3 F;  2KFY A;  4FXW A;  2R7V A;  1HBN B;  1F1B B;  1WHV A;  2CNO B;  3A3N B;  3DOK A;  1MRO A;  3FEZ A;  4DCP B;  3KHH A;  2UXC J;  1HBM A;  3PRD A;  1HA1 A;  5CCL A;  2GGP B;  1FFG B;  4A8Y A;  4AYB D;  4W90 B;  4GKK F;  1HMV A;  1J2V A;  2LDI A;  3I0R A;  4OI3 A;  1B99 A;  3QMQ A;  3AY0 A;  2M8D B;  1X4H A;  3DLG B;  5J1P A;  2LDY A;  4X4S A;  2B4O A;  2E9R X;  4YB5 A;  2L9W A;  3TOQ A;  3W5X A;  4LVN P;  3PG9 A;  4USH A;  4NXN J;  2VFR A;  2SXL A;  3FMW A;  5HMY A;  2XMU A;  1LOU A;  1VJW A;  5M2R A;  5SZT A;  3KK3 B;  2VFT A;  2HHU A;  2XG8 A;  1RWX B;  2DD8 S;  4RW4 A;  3VR1 A;  5A8W A;  1XIQ A;  5F0W A;  2KXN B;  3ITH A;  3DI6 A;  4YUD A;  1DLO B;  1YRU A;  3QT7 A;  1LWC A;  5E3R A;  5IT0 A;  3DOK B;  3LP0 B;  2J9D E;  2G0C A;  3DDN A;  4OHV A;  1NEE A;  3KUH A;  2VFV A;  3VGV A;  3JB9 k;  2HFV A;  1T3N A;  1IR0 A;  1P1L A;  1KHW A;  4OI2 A;  4ETX A;  3BEG B;  4OLO A;  1TVR A;  2YX1 A;  3GFZ A;  1QDU B;  2OLW A;  2JSX A;  3OR2 A;  3PNI A;  4I7F A;  4NLX A;  3SFG A;  4CLK A;  1R8B A;  3MAA A;  5KFU A;  1BGX T;  4RNO A;  3MR5 A;  2X1G A;  2HWI A;  4F4Y A;  1H74 A;  2MLX A;  2VDI A;  5L38 A;  2KT3 A;  2PII A;  3JTO A;  3M6X A;  4OI1 A;  2OPP B;  5KG6 A;  2FLP A;  5D3G A;  3OR1 B;  4OZ5 A;  1H72 C;  4PR6 A;  1CJT A;  2XZT B;  3WIU A;  3TI0 A;  5DM7 Q;  2HIQ A;  4DR4 F;  4N76 A;  3CSK A;  2R3V A;  4OX8 A;  3KK3 A;  3MPW A;  1M5O C;  4JP8 A;  3D68 A;  4QWE A;  4A48 A;  4CO0 A;  5B0G A;  1WG4 A;  3F56 A;  3THP A;  2FYX A;  1UZH A;  2B7B B;  1FK9 A;  2VJV A;  2HHW A;  2FB0 A;  4CLP A;  1SC1 B;  5LM7 E;  1EP4 A;  2Q79 A;  3GR1 A;  4IG0 A;  4J9U E;  3CDW A;  1JLA A;  5B0D A;  3CCS S;  2GO9 A;  5C2C A;  1HR0 J;  4M94 A;  2EKY A;  3TA0 A;  1OSD A;  1S9G A;  2NXJ A;  1BQN A;  3CCU S;  1TMJ A;  2NYH A;  4KHM A;  2GHW A;  4ERD A;  3GPA A;  4J9Q A;  2CDR B;  4A8X A;  2VQF J;  1W26 A;  1HWU A;  1Q78 A;  3MM8 A;  1T9X A;  3SIP B;  5DET A;  2QX0 A;  1VBK A;  1TZ0 A;  5LXR A;  4QWC A;  2RKI B;  4KTQ A;  2OPP A;  1I6J A;  4B3O B;  2GFF A;  3DYA A;  5E3P A;  3C14 B;  2YNG B;  1S76 D;  2YQ1 A;  4OX9 J;  2RHS B;  5KOX A;  1SJF A;  1K0T A;  1TFW A;  3TZZ A;  3GWC A;  2AZ3 A;  1Q5Y A;  4CP5 A;  2WBM A;  4YR0 A;  1ICE B;  3BZQ A;  5C5J A;  3PHT A;  2YNH B;  3AQP A;  4EMD A;  5F8M A;  3R7N B;  3NNC A;  4ZJQ A;  3V4I B;  3AOC A;  4DLE A;  2AEJ A;  3ZZU A;  1T05 A;  3IN5 A;  1C0U B;  2BUN A;  2X1B A;  4L74 A;  1HQU B;  5K5M A;  2V2V A;  1RT1 B;  2RRA A;  2I8E A;  4ECY A;  1GX6 A;  3M05 A;  4B9S A;  1ZH5 A;  1RWU A;  1RWM B;  2LEP A;  3SFU A;  1JLC A;  4OYZ A;  1RT3 A;  2PGC A;  4EWT A;  4UT4 A;  5BR8 F;  3CUL A;  3MM8 B;  1G3O A;  3CW2 C;  5E3A A;  5DG8 A;  5EWE A;  4J9M A;  4DZ6 A;  4TVA B;  1QVG R;  2QTW A;  4F67 A;  4XPE A;  2AGO A;  2ASD A;  4B3O A;  3L7U A;  4P10 A;  2R7Q A;  3T5H A;  4B9U A;  3O5T B;  4UTG A;  4IUF A;  2GW8 A;  2FC8 A;  2KJV A;  3ISN D;  3CED A;  2MZS A;  4U9R A;  5GMK a;  5KTQ A;  2DXE A;  2ZH1 A;  2DPI A;  2R8K A;  4LQ9 A;  1HNX F;  2H54 B;  2CFX A;  3G82 A;  2BM0 A;  2DGV A;  4NEY A;  2X3G A;  4OZL A;  2CDQ A;  3OSP A;  3D66 A;  2BKO A;  3DXS X;  3S8S A;  3KJF B;  2RVJ A;  2XY5 A;  2DRB A;  1RHQ B;  2VA3 A;  4O3R A;  3OD2 A;  3P5T L;  5L9X A;  2PEB A;  1K9M T;  3EZO A;  3CD6 S;  1CPZ A;  2XI2 A;  3D6T B;  3SYZ A;  3BPS P;  4B3M J;  5C42 B;  4JI8 J;  2QYC A;  3CJ3 A;  1X4B A;  2FUG 9;  3TAQ A;  2KHC A;  1RT3 B;  3UNG C;  2QFI A;  4AUK A;  1SPB P;  1RWW B;  3FK4 A;  3MZI A;  4LFB F;  3RAQ A;  4YP3 A;  4P75 A;  1WHX A;  4DL7 A;  4JI1 F;  4LF4 J;  1ZAV A;  2R9L A;  2XCP A;  1SKS A;  4ZCM A;  1IBL J;  2BX6 A;  2M52 A;  1GT8 A;  2WB4 A;  3HVR A;  2MGZ A;  2CG4 A;  3MPY A;  2H51 B;  3MEE B;  5HQL A;  4LF4 F;  1LXN A;  1MSW D;  1DHM A;  1X31 C;  4MIA A;  3J7Y U;  3DLL Q;  1IXK A;  4KV8 A;  3W5Y A;  2W8K A;  5KOW A;  2DYA A;  4HI2 A;  3UI3 A;  3F73 A;  4G65 A;  3VHQ A;  1SJ1 A;  4JI8 F;  5F9N A;  3Q8Q B;  2C3Y A;  4M5H A;  4OFZ A;  2LVW A;  3TX8 A;  1CQN A;  1LKZ A;  1KVI A;  4S0M A;  3G86 A;  3OSN A;  2MLY A;  2AMC B;  3W9H A;  3MF5 A;  3HHL B;  1OQ6 A;  4FYW B;  3AXK A;  3M2U B;  4PAB A;  1SJ3 P;  1NDC A;  3DU5 A;  2M9K A;  2M8H A;  2QT7 A;  3ZTR A;  4DPY A;  4DV7 J;  4NLT A;  4AL7 A;  1H6K X;  3AXM A;  1S0M A;  2DXD A;  3FEX B;  1BE4 A;  3PDN A;  3W2V A;  3NS5 A;  1FNO A;  1WSV A;  3I0S B;  3CNQ P;  4RW8 A;  3UCZ P;  1M5K C;  1UVN A;  1V3R A;  3NG8 A;  1RT2 B;  2PD1 A;  2YKQ A;  4FYY B;  2NPF A;  5GAG I;  3UQS A;  3OT9 A;  1NK9 A;  5JUM A;  1S72 S;  4F4K A;  1VQM S;  1B4S A;  5L39 A;  1WC1 A;  4ELT A;  4KFB A;  2DNY A;  4I2Q A;  1PBA A;  2HQD A;  4L72 B;  5CAA A;  3Q8P B;  3W5Z A;  2NUH A;  3BKT A;  1OYD A;  4NAS A;  4OHX A;  5K8M A;  2ZHB A;  3V4M A;  4BLG A;  2KKH A;  3Q8U A;  4RO0 A;  2A0F B;  4DZD A;  2EBE A;  2ROP A;  2ZH5 A;  4RL1 A;  5KFE A;  4USW A;  2H48 B;  4CO3 A;  2NXU A;  2OP5 A;  1NJI T;  1KDN A;  4KGM A;  1KLN A;  3SZ2 A;  4EUV A;  3M6V A;  1RAE B;  1YJ9 S;  1FNX H;  2AJ1 A;  3SDE B;  2CQB A;  1EKS A;  2MST A;  4WK1 A;  4DV5 F;  3OTC A;  2MKJ A;  2RF2 A;  2LQJ A;  2VPW B;  2MJN A;  4Z2X A;  3J7Z 5;  4YFU A;  1SBR A;  4IFY A;  4MTP A;  4OYA A;  2ATL A;  3IG1 A;  2DR6 A;  5IT9 Y;  4MJK A;  3GG0 A;  2VFU A;  5KFN A;  2DRA A;  4CQ1 A;  1Y3K A;  1RTI A;  2F8H A;  3ZTP A;  1FXR A;  1ZA2 B;  5GAG U;  1X4C A;  4C98 A;  2BDP A;  5EX3 A;  1AUD A;  2XNR A;  2FHJ D;  1RIS A;  2GGP A;  3N01 A;  2W7P A;  3C2P A;  2IMW P;  5L1J A;  2Q66 A;  3CE8 A;  2I5J A;  1HMV B;  2YXL A;  3BBB A;  1VMB A;  3MM9 B;  5B09 A;  1TK0 A;  4WU3 A;  1KHV A;  4FZV A;  4KGV B;  2UUB J;  4ZVR B;  3TNV A;  5GAD U;  3POT A;  1QTN B;  1SC4 B;  4ZK7 M;  2BV3 A;  3BRE A;  3UDC A;  4ID5 B;  2VOD A;  2ZNY A;  3DRX A;  4ECX A;  2OPQ B;  2G4B A;  1HNW J;  4UQT A;  4DV6 F;  1HNI B;  2YKN B;  4K2J A;  3OL9 A;  3AB4 B;  4BWM A;  3FFI A;  5J2Q A;  3VF0 B;  3A8E A;  1BUX A;  3FCW A;  2WHO A;  4DPO A;  2QEX S;  3QAT A;  1EJ7 L;  4V1A k;  4DR5 F;  1I5O B;  4ZN1 A;  2W4D A;  1PO6 A;  2ZOF A;  2AJ0 A;  1HFE L;  1A7G E;  1WEY A;  3LP1 A;  2XS5 A;  4ICL B;  3EZ5 A;  1NKE A;  1RHM B;  1Q8I A;  1H2T Z;  1FVQ A;  2Q6C A;  2OI2 A;  4ZVG A;  4X66 F;  1VQ5 S;  1NH7 A;  3OFG A;  2JEJ A;  1TVR B;  5T41 A;  2DHS A;  3KXD A;  1HI8 A;  5ETS A;  3DLK B;  4UF4 A;  3L3C A;  3LAL A;  1PCA A;  1FDA A;  3BH6 B;  2AQ4 A;  1I3O B;  2AYG A;  1Q4R A;  1KP6 A;  2N4D A;  4LSZ B;  2VB6 A;  3OBI A;  4FS2 A;  4W98 A;  1QAJ A;  2OKQ A;  4P6Q A;  1FDB A;  5JVG Q;  4OI6 A;  2Y1J A;  3D3C J;  5A6W A;  1X5S A;  1U0H A;  2HBR B;  2OML A;  5CD4 A;  4J9O A;  4DFK A;  1VQ9 S;  2P2C B;  2HK2 A;  2WSC C;  2Y1L B;  4RKU C;  3UDL A;  1TK5 A;  4IFV B;  4ED8 A;  5B0F A;  2WON B;  4OI0 A;  2HND A;  2PFD A;  2Z57 B;  1WI6 A;  2K3I A;  3KDN A;  3L9Z A;  4FVM A;  5IV3 A;  1CJU A;  5J2Q B;  1LV5 A;  1R27 B;  3ZXW A;  4AT1 B;  2LU1 A;  1YG0 A;  1SJQ A;  3DRR A;  3TEH B;  3VVU A;  5KFC A;  3TWZ A;  2AGQ A;  4DSL A;  5KFY A;  1B3T A;  1WKK A;  2KM8 B;  1NHV A;  1KON A;  1D8Y A;  1NK5 A;  5LJ5 Y;  4GKK J;  3N6L A;  4QR0 A;  4LF8 F;  2IM2 A;  1S9G B;  3TZY A;  3EPG A;  1S6P A;  4FN5 A;  3KLH A;  2DH8 A;  4JI7 J;  1EAY C;  3SV3 A;  3BJY A;  2HZC A;  1PIL A;  4IOB A;  1FXL A;  1R8A A;  4LQ3 A;  3R8Y A;  5D4L A;  1UKU A;  1F5B A;  2DKO B;  3F44 A;  5LJ3 Y;  1F5C A;  1L3S A;  1TMM A;  1VIO A;  1JXE A;  2LEA A;  1KVJ A;  8AT1 B;  4FBT A;  1YVF A;  1U6B A;  3SEO A;  2QL7 B;  5B0B A;  3OJS A;  2CPX A;  3T19 A;  4K59 A;  2XMJ A;  3LAM A;  2XMW A;  3ZC4 A;  2V67 A;  4IFV A;  4BBY A;  2MZR A;  3Q83 A;  3FZ2 A;  3OFF A;  4KGX B;  1VHI A;  3TVY A;  3TVK A;  2JEF A;  2CA9 A;  4CLF A;  2DHX A;  5GME A;  1EET B;  1WHY A;  4D3H A;  1YI2 S;  3RAX A;  1IJF B;  1C0U A;  3PRV A;  1UA0 A;  2D3Z A;  1MML A;  4PWU A;  2YQ3 A;  2AJF E;  2IY5 B;  3H90 A;  1Q95 G;  4ECZ A;  1J5E F;  5BYQ A;  1FTC A;  4CT9 A;  1D3W A;  3MCS A;  5KT4 A;  4YR2 A;  1S97 A;  3HHN B;  3OTE A;  2R42 A;  3HSG A;  4IO1 A;  4CLW A;  5EGY A;  2MKY A;  2NYI A;  2W2N P;  2FZK B;  3FCV A;  3NGK A;  5T7L B;  5BXI A;  3G8T A;  1LW2 A;  2B8Q A;  1R0A A;  2BVZ A;  2V69 A;  3D1H A;  3VTI A;  3VAG A;  4DR7 F;  4X65 F;  4WKR A;  2HW3 A;  3KJN B;  1IKV B;  3NMR A;  2GNK A;  1SJ4 P;  1GMW A;  4V19 J;  2R8G A;  1U25 A;  1N33 F;  2XMT A;  4KE5 A;  2FGO A;  1VR6 A;  4X4T A;  1WF1 A;  2XTJ P;  3MED B;  3UCG A;  4DUT A;  3OVA A;  3CCJ S;  1K8A T;  2QLJ B;  3R5B A;  4KC5 A;  2E9T A;  2ZWP A;  3PJX A;  5CH7 B;  3M2V A;  3W60 A;  4OYB A;  2QL5 B;  5KFO A;  4DV3 F;  5A2Q U;  1U1K A;  2JRS A;  2CZ4 A;  1FJG J;  3CCT A;  4R8U A;  4JI6 J;  4QPX A;  2B4P A;  4RW9 A;  5T14 A;  2D7S A;  1S6Q B;  1MU2 B;  1R8P A;  2J76 E;  4EU0 A;  1VQN S;  3I4P A;  3QO9 B;  1KQG B;  3MDF A;  3IM9 A;  4C3M A;  3CB4 A;  1HNW F;  5GAE I;  5M2P A;  3UCU P;  1WD6 A;  3K57 A;  4LRE A;  2QGF B;  1P9Y A;  4NLP A;  1C2P A;  1Q8K A;  3R97 A;  1ZM3 A;  3QRQ A;  2DNM A;  2HQI A;  1AZS A;  4OZ3 A;  1ZZF A;  1VRU B;  3K17 A;  4JI3 J;  2HQF A;  2J8S A;  3JSM A;  4AD6 A;  1X9S A;  3EZU A;  5EUH A;  4NZ7 A;  2XHC A;  4HAC A;  4B3T F;  2WBR A;  3NAI A;  1MWQ A;  4AL6 A;  2M7S A;  1QUV A;  3D4J A;  1C1C B;  1N32 J;  3ET6 B;  4M5N A;  3WX4 A;  1RZM A;  2XHW A;  5LMN J;  1N4L A;  1DTT A;  1NLK L;  4QW8 A;  5IT9 U;  1CSJ A;  3T1H J;  3NRB A;  1OYE A;  1LWF B;  3HHL A;  1X4D A;  1X5T A;  1ZM2 A;  4OYI A;  1LFP A;  2H3E B;  2MZJ A;  3LPE A;  5DZ7 A;  3U1L A;  4PUO B;  2OAU A;  4DL6 A;  1LEO A;  4J9N A;  1Y9O A;  1LNQ A;  3I0S A;  1N5T A;  4RW8 B;  1TR0 A;  4LR8 A;  2IVM A;  4YEA A;  1CS4 A;  1YBA A;  1M5V C;  2G0J A;  3GIM A;  2BJ1 A;  1GEH A;  2P9G A;  4DPX A;  3GIR A;  4DV3 J;  1KOH A;  3OVB A;  5DDP C;  1HYS A;  3V6K A;  2W7A A;  3HHL D;  4HAC B;  2MJU A;  1L3T A;  3R6L B;  2RUS A;  1JQG A;  3KJV A;  4DV7 F;  2Y1R I;  4I2Q B;  4WII A;  1NDP A;  2DRD A;  1Y5N B;  1KS2 A;  2HRY A;  1DTT B;  2E66 A;  3VGS A;  3OW2 R;  1LWX A;  2HS4 A;  4AQY J;  2E5J A;  2UVV A;  5AJ3 J;  3KK1 A;  2JC1 A;  2VIC A;  3D1Q A;  4C2M A;  4ZVQ B;  4TN2 A;  2GVD A;  3VCD A;  3MEG B;  1B0P A;  1YWX A;  5CD4 H;  3UN3 A;  3CCM S;  4M95 A;  1QAY A;  2YWW A;  3E01 B;  3QT5 A;  4E98 A;  5KT6 A;  2KTQ A;  3TP2 A;  3BBC A;  3KK2 A;  3D6F B;  3CDU A;  2QRR A;  4WKY A;  1OMS A;  3I9Z A;  5DG9 A;  1HBU B;  2AD9 A;  4MAK A;  4HHH A;  4LF8 J;  2EXU A;  4IFY B;  2MYF A;  4NA1 A;  1RP5 A;  2LXF A;  1YIJ S;  2HPU A;  3AD8 C;  4ES2 A;  3B78 A;  4HDG A;  1FWP A;  4KHR A;  2MQP A;  5C25 B;  3IGN A;  4J9K A;  1ARO P;  4H54 A;  4DPU A;  2AKW B;  4NX9 A;  2ADC A;  4J91 A;  5H9F K;  2DNK A;  1LK7 A;  2VF3 A;  3MEK A;  3SSS A;  3K89 A;  5IM0 B;  3FSY A;  2KG1 A;  1VQY A;  1APS A;  1N0U A;  4C8K A;  3POT B;  4KJI A;  4KGZ B;  4Y2M A;  2Z56 B;  4WIQ A;  4H4O B;  2ZM6 J;  3QRR A;  1B70 B;  4NLR A;  3E01 A;  4X4V A;  3UN5 A;  2QLW A;  4K50 A;  2AYB A;  2PDA A;  4WP3 A;  3M8S A;  1XR6 A;  1NKB A;  4OJ3 A;  4U8V A;  1PYO B;  4X84 A;  1Y10 A;  4P71 A;  5D77 A;  3V6D A;  3J7A 1;  2APO A;  3BGO P;  3T1A A;  1T9V A;  3VGT A;  3J81 Y;  1RTD A;  3A13 A;  3FFI B;  4PPZ A;  2V4R A;  2AJQ A;  3QIP B;  3DKD A;  4DUZ F;  4QWB A;  3TAR A;  4X64 J;  4MH8 A;  2EFN A;  1VQ4 S;  5DLG A;  4JI2 J;  2R7X A;  2EPI A;  3TQE A;  2WVB A;  4KRW A;  3H8Y A;  1SQF A;  2DHA A;  3FGV A;  4NZ0 A;  4Y3C A;  5CYM A;  5HJY A;  4QWD A;  4ER8 A;  2RUG A;  4CLU A;  4RBT A;  1M5S A;  3MMA B;  1RBA A;  3AA8 A;  4F2S A;  4XAK A;  1YJW S;  1S0V A;  2CQ3 A;  2XBP A;  3P5B P;  1SH0 A;  2NR0 A;  1GH8 A;  5LSR A;  1IWG A;  1T03 B;  1G7C B;  2MZT A;  3HXM A;  1N48 A;  3R5C A;  1IN0 A;  4ZMM A;  4KKO B;  4HH1 A;  3H4D A;  1URN A;  2GIQ A;  1HQE A;  4Y2I A;  4X66 J;  4CH7 A;  3PW2 A;  2AGP A;  1VHF A;  4EGL A;  1RTD B;  3ENA A;  2WON A;  4LF7 F;  2YWK A;  2J9E A;  4F3O A;  4DEZ A;  4UZC A;  3GJQ B;  5AXL A;  2C2Z B;  3CCZ A;  1WKJ A;  1M1G A;  2KJW A;  2QC3 A;  2VKR A;  2Z2Z A;  3C16 A;  3MTK A;  2DR9 A;  5KG5 A;  1OPI A;  4M5I A;  3G87 A;  4ETZ A;  1VQO S;  1HNZ F;  4PQU A;  4OX7 A;  5CYM B;  2IAJ B;  3DXB A;  1IQT A;  2UUW A;  3MMA A;  3AHP A;  1N54 B;  3T1Y J;  2E5L J;  2I0X A;  4RNH A;  4CH1 A;  2FLN A;  1HNV A;  1IKY A;  1RBO B;  1TQL A;  2C1E B;  4Q43 A;  1RAH B;  2WAQ D;  3UFC X;  1RWO B;  3I9V 9;  5C2G A;  2B4U A;  1T9Y A;  3GIK A;  3M32 A;  1RHR B;  1JLE A;  1NBE B;  1SC6 A;  1RT4 A;  4B08 A;  1Q7Y T;  1H0H B;  2UUB F;  1FWK A;  4ILL A;  2FJW A;  4QYR A;  3BO3 A;  2F40 A;  3BO2 A;  1HQE B;  1XR7 A;  1SQG A;  1TAU A;  2F5G A;  2EK1 A;  2FVC A;  3VAH A;  3BH7 B;  1UVL A;  1WF2 A;  2G1H A;  2ABY A;  1HWI A;  2GA7 A;  2FJA B;  2WSF C;  2AU0 A;  3EVO A;  2EW9 A;  2ZBR A;  3QYY A;  5HN0 A;  2R7U A;  1BWV A;  1Q5V A;  1K47 A;  2RS8 A;  1VS3 A;  2PEH A;  2V8V A;  3H2L A;  2M0G B;  4C11 B;  4XPC A;  3MD3 A;  2XMA A;  1N8R T;  2E7X A;  4MIB A;  4NRU A;  1EX8 A;  4PYA A;  5FD1 A;  4UUW A;  4ZVF A;  1YJR A;  2FC9 A;  2HRT A;  4I0W A;  2DT9 A;  2CJB A;  1D9A A;  3QAU A;  2VG5 A;  4CT8 A;  3JQJ A;  4RPF A;  4J9R A;  1NDK A;  1WWH A;  3PX0 A;  3PX6 A;  5J2N A;  3HT0 A;  4HYK A;  2W8L A;  1T94 A;  3RB4 A;  2E5L F;  1EQ0 A;  1KSP A;  2A2D A;  3DN9 A;  3M6W A;  1UJ6 A;  4L3N A;  1XMQ J;  3ZNJ 1;  1IKV A;  4HDH A;  2R2U A;  2XY6 A;  3C66 A;  3EIC A;  2XMV A;  2AW0 A;  5DQI A;  4B9L A;  3KLF A;  2F4V F;  3KMQ A;  4IRK A;  2KT5 A;  1S4F A;  3MED A;  1JXV A;  1PJ6 A;  2QMW A;  1LW0 A;  3AOD A;  1RWV B;  1AUS L;  1RXO B;  3IXQ A;  3NGR A;  4PQA A;  5BYR A;  5IOL A;  1FI4 A;  4XO0 A;  3KLE B;  2WVE A;  4F50 A;  2EFQ A;  5D0R A;  3HMJ G;  3WQP A;  4ILM A;  4O23 A;  1U2C A;  3HHL C;  4UUX A;  4M5J A;  3UDV A;  3B4M A;  2B9E A;  3PVX A;  2XS2 A;  1NB7 A;  1FTR A;  2V50 A;  2NQP A;  1NK8 A;  3RR8 A;  2XSF A;  3SV4 A;  1BQM A;  1SXL A;  4TU8 A;  3UD3 P;  4I6A A;  3R2D J;  1BD6 A;  1UW9 A;  3A8K A;  1VDH A;  2A1B A;  3DRP A;  3FJ2 A;  4WXO A;  1XEZ A;  3RBE A;  1YIT S;  3RBZ A;  1YDL A;  2IHR 1;  4NLD A;  5A8R A;  3FBF A;  2UVR A;  2BAN A;  1VQS A;  2BAB A;  2RIJ A;  4O4R A;  1VC0 A;  2NS1 B;  4J37 A;  4DDF A;  3E51 A;  4U8Y A;  1U49 A;  1X8D A;  1LQ9 A;  1Y4Z B;  2HNY B;  3A8J A;  4XIU A;  3GCX P;  4QYZ J;  1VRU A;  4OZ0 A;  2J0X A;  2CQ0 A;  2IIH A;  4YB1 P;  3C15 A;  4Y2C A;  4EI2 A;  3TUZ C;  3W64 A;  3PY8 A;  1KBR A;  1ZM9 A;  3GIJ A;  3KLE A;  4FXD A;  4IOA Q;  4IG3 B;  2VON A;  4W92 B;  2F63 A;  2GQ2 A;  1S9E A;  5DLF A;  3CIZ A;  3B4D A;  4RW6 B;  3FBC A;  2UU9 F;  1VLY A;  2ZH9 A;  1T7P A;  3DHW C;  5F8G A;  1UVI A;  2FLL A;  2ZM6 F;  4TNO A;  2ZZT A;  3HO1 A;  2WOM B;  1UEK A;  4F3M A;  4TY8 B;  4U7U K;  1TKZ A;  3M30 A;  1GMV A;  2HHP A;  2LXI A;  1NM2 A;  2NLW A;  3PFO A;  1CJK B;  2W9C B;  1L3V A;  2E1C A;  3HHD A;  1YJT A;  1GFW B;  2HLT A;  2E7W A;  2YWH A;  4OIX A;  5A76 A;  2QZ8 A;  1BY9 A;  4MFB B;  2C2E A;  1L5U A;  3KNA A;  3TX0 A;  3MCM A;  2OSR A;  1XMO F;  4LF6 J;  3RW6 A;  3OXF A;  2V2Q A;  1S7H A;  2CG8 A;  4LRF A;  4JV1 A;  2AV5 A;  1J27 A;  1FCA A;  1CG2 A;  2WVC A;  3BKU A;  4Z7C A;  3CF5 Q;  3D28 A;  3VAF A;  1IBK F;  5H9E K;  3AB2 B;  1I1G A;  3GZ7 A;  4DU7 A;  1F3F A;  5D8H B;  2IMO A;  2QE5 A;  1FES A;  2YWF A;  3IR6 B;  1NK6 A;  5J1E B;  2OUG A;  3FMB A;  3M2R B;  4F3Q A;  3D0H E;  4DL5 A;  1U48 A;  1VCT A;  4L76 A;  4Q2L A;  4KIA A;  3ADA C;  3QLH B;  4ED5 A;  1W2I A;  3D6M B;  1DRZ A;  4YB6 A;  2QIF A;  2WOM A;  4ED1 A;  4TY8 A;  2MHN A;  3MUM P;  4C97 A;  2JVO A;  3THV A;  1SH3 A;  4X62 J;  1HNZ J;  5H1S V;  2R7O A;  4AQY F;  1NPK A;  3K5N A;  2K2P A;  1P8G A;  1YLX A;  2RAQ A;  3AOA A;  4ZVT B;  4O44 A;  3SSQ A;  3BGU A;  5DG7 A;  1XC9 A;  2PA8 D;  1XN9 A;  2J6U A;  4DL0 C;  2YH1 A;  2L9D A;  3GFX A;  3PCO B;  1NSP A;  3CCV S;  3UN2 A;  3ILO A;  3MAH A;  4QIG A;  5KFQ A;  4ZLP A;  8RUC A;  4M5K A;  5KFX A;  2FY1 A;  3HF5 A;  2V34 A;  1OWX A;  1SV5 B;  2W9B B;  3LWM A;  1T03 A;  2PE8 A;  2R8J A;  2HUR A;  5J1E A;  2DO4 A;  4M5L A;  1S1X B;  3AOB A;  4OX9 F;  4GC6 A;  1WAC A;  2O3D A;  3HK2 A;  3H0P A;  1RT7 A;  2HMI A;  4ZVP B;  2CQP A;  2HVE A;  4NZ6 A;  3NS7 B;  1AA1 B;  1H38 A;  4WXW A;  3JYT A;  4DL2 A;  3J7Y I;  4CLS A;  3CJK B;  3VAL A;  3R7B B;  3RAM A;  3TJ9 A;  2VQF F;  1UA1 A;  1N6Q A;  4FF4 A;  3BDE A;  5LMN F;  3O2I A;  3BR9 A;  1CBK A;  4O44 B;  1RTH B;  2DR5 A;  3LGN A;  1MMD A;  1WC4 A;  4DQQ A;  4R0J A;  3A12 A;  4LSN A;  1TEL A;  2H9Z A;  1SIW B;  2HGL A;  4ZP7 A;  5HMW A;  4P7T A;  3Q0A A;  1YRX A;  5FDL A;  3T5K A;  5HLF B;  3P49 B;  4K4U A;  2BMB A;  4WTO B;  4ZLL A;  1RAO A;  2KFN A;  3CJ5 A;  5JJB A;  2CKW A;  3RUB L;  4DG1 A;  5HQ8 A;  2W9B A;  4ED0 A;  3MMB B;  1RWK B;  2LEC A;  4OX6 A;  2IBO A;  1ACM B;  2CRL A;  2LKZ A;  3HFZ B;  1YTY A;  3BB5 A;  3M9O B;  1RLD A;  3M8P B;  4CWB A;  2HMI B;  4JBC A;  5F0U A;  2B5J A;  5ETO A;  1R0B G;  5GAE U;  4NLU A;  2GHV C;  2VBX A;  3IFE A;  3UE2 A;  2QYG A;  4DR6 F;  2JEI A;  3NGT A;  4G1Q A;  1DUR A;  2GJ2 A;  1Q53 A;  4KKO A;  1HQ2 A;  4A8Q A;  2OH2 A;  3CTR A;  2G1D A;  4Z7Y A;  2XGQ A;  3RR7 A;  2NZ4 A;  1TKT B;  2MDA A;  1HWL A;  3GFY A;  4MYT A;  3N6N A;  1H98 A;  4HL9 A;  5AE1 A;  3BM7 A;  2K7K A;  3PFE A;  2YWE A;  5ETR A;  1O0P A;  3W65 A;  1WJ9 A;  2DH7 A;  2VD3 A;  3ILL A;  4M1K A;  5FDL B;  5CZV A;  1PAU B;  5LXY A;  5KG7 A;  4I69 A;  3ZZ0 A;  3HJF A;  1CEZ A;  1BXN A;  3K5O A;  3PM9 A;  3R7S B;  3W2W A;  2IAJ A;  5JXS A;  1Q7L B;  3BGR A;  4UZB A;  2HVZ A;  2MQL A;  3N5B A;  3KHG A;  4ECU A;  2PC6 A;  5AJ3 F;  3MFH A;  3RRG A;  5F9L A;  3NL0 A;  2RRN A;  4IDK A;  3I55 S;  1L3U A;  4ECW A;  1Z1Z A;  1SC3 B;  4RUB A;  3H5X A;  5D4P A;  4LF5 F;  1HL6 A;  3DRS B;  4HT7 A;  2H5I B;  1KWM A;  2D69 A;  1UMJ A;  2ZD1 B;  4URQ U;  2XO7 A;  3ZZP A;  3K58 A;  3L7O A;  4DFP A;  1RT4 B;  2BOA A;  2VPZ B;  1VBX A;  1VGY A;  3W63 A;  3J81 U;  2IM1 A;  4PG7 A;  4CLZ A;  1TKT A;  2W2O P;  5AE2 A;  1VQ8 S;  4EZ9 A;  3D54 A;  3N9U C;  5MLC V;  1SKR A;  1WOP A;  4H4M B;  2V94 A;  3TJA A;  4Q5V A;  2E1A A;  4FVC A;  3S6E A;  3CCL S;  3P6Y C;  5ETQ A;  4YY3 J;  1SKU B;  1FD8 A;  2VU5 A;  2VG6 A;  3PR4 A;  1TKD A;  3G6E S;  3MR3 A;  1HI0 P;  3VZI A;  3IBW A;  5KG1 A;  4RU2 A;  5C7P A;  4DU8 A;  3QPI A;  3BGR B;  3FSX A;  1MG7 A;  1ULR A;  5C24 A;  4NL5 A;  1FE4 A;  2BRL A;  2CWK A;  2NXN A;  1FKO A;  2KB2 A;  3MEC A;  2ZE2 B;  3NGS A;  3UVJ B;  3HPO A;  4DSF A;  2J8A A;  1VK3 A;  2DEI A;  2NCK L;  3MPU B;  4N56 A;  4YB7 A;  3G96 A;  1WDT A;  5LMU F;  1RWP B;  2FQQ B;  1P27 B;  2Z2M A;  3ENW A;  3FZB A;  3JQK A;  4I56 A;  4ES1 A;  5DDQ C;  1KFS A;  5KFJ A;  4U67 Q;  3HM9 A;  4WP9 A;  5IQ6 A;  2Z4P A;  3PR5 B;  2ZKU A;  4JV2 A;  1IKX B;  3CDA A;  5EN1 A;  1VQ6 S;  2OPS B;  2N82 B;  4PWW A;  1NRK A;  1HWJ A;  1UTA A;  1RHJ B;  4DPT A;  2MKI A;  4HI1 A;  4UOF A;  4ZVE A;  3C19 A;  2FJX A;  1X4G A;  4MK7 A;  5CCM A;  2UV8 A;  2LA6 A;  5HRO A;  3GV7 B;  4Y0F A;  4ZVS B;  1FD2 A;  1UEU A;  2AWZ A;  3AQO A;  1NAQ A;  3BS9 A;  4LR7 A;  2HHV A;  1Y11 A;  2IA0 A;  4B3S J;  1WC5 A;  1PJ7 A;  4KHP J;  5C24 B;  2VIH A;  3NLC A;  3EM1 A;  1QM9 A;  5KFS A;  1FKO B;  2YNI B;  3MEC B;  3KDO A;  4OI4 A;  5KG0 A;  3UVJ A;  1KOO A;  3I0R B;  2PFF B;  3DGP B;  3KLV A;  1C1B A;  1PGZ A;  5LL6 d;  4C3L A;  1LXJ A;  2M70 A;  5IWA J;  3LOU A;  4X4N A;  3MPV A;  1RAC B;  2OEJ A;  3MM5 A;  1H7W A;  4WTY A;  1YZ7 A;  3RBD A;  4XTT A;  4EEY A;  4YOE A;  2YKO A;  2FHK A;  1KQF B;  4Y65 A;  3PRB A;  4QPT A;  1XQI A;  3KG4 A;  1SCJ B;  2H4Y B;  3WX8 A;  4UQG A;  4TXS A;  4DOZ A;  2HNY A;  4MKY A;  2J9C A;  3M1V B;  1Q8B A;  1WG1 A;  2BW2 A;  2YWG A;  2ZIT A;  2Y9H A;  3OUY B;  3TVZ A;  2ADB A;  3DI6 B;  2JLE A;  1NND A;  2A6M A;  3C6T B;  4BCA A;  4C4W A;  5KAK A;  2IVF B;  4IG3 A;  1X4A A;  1S12 A;  1PG5 B;  2VG7 B;  5LT5 A;  4TQS A;  4PPD A;  3BQ1 A;  1S9E B;  3BR8 A;  2L9N A;  4CO2 A;  4NI2 A;  4RW6 A;  5KT5 A;  4UOH A;  3TA1 A;  1BC6 A;  2A6O A;  1S1V A;  2J7K A;  4WJB A;  3IBF B;  1GMU A;  1C1B B;  2ZC4 A;  1NSQ A;  2PSZ A;  5HAO A;  4C0O C;  3OTO F;  1GK8 A;  5L1K A;  1F9H A;  4FDF A;  2I38 A;  3GP9 A;  3T3F A;  2DGO A;  1OPZ A;  1RHK B;  2R8H A;  5D3G B;  1R8C A;  1VLO A;  1XMO J;  4OV1 A;  4CNZ A;  2W1B A;  4LF6 F;  3MMC B;  2HG4 A;  5DQG A;  4WFZ A;  2Y1I A;  3L95 X;  1EB0 A;  3M1V A;  4YQW A;  4MMO A;  3OUY A;  2POK A;  3RB6 A;  3C6T A;  3IP0 A;  3GMG A;  4ZPA A;  1RAB B;  4V19 X;  3K8W A;  4U7U D;  3Q89 A;  5KFA A;  3DC2 A;  3THT A;  3AJD A;  2D3O R;  3NBP B;  4DV5 J;  1JLA B;  1VBZ A;  2KU7 A;  1ZPW X;  1N88 A;  3TUJ C;  1NJZ A;  3DLH A;  3KLI B;  3HT3 A;  4GKJ J;  1S79 A;  3QLH A;  4F0M A;  1IJE B;  4NLV A;  3V2U C;  2VHG A;  2HHS A;  5IC6 B;  4IRD A;  3HI9 A;  1JWW A;  2B51 A;  1W25 A;  2O5D A;  2RKI A;  2YBV A;  3KJQ B;  2MQO A;  4DX6 A;  2HHH F;  4C8L A;  4YHH F;  3C46 A;  3S01 A;  1E6Y B;  5KFI A;  2YNG A;  3FDS A;  5HK4 A;  1AB8 A;  1WC3 A;  1HLW A;  2DTJ A;  2PA3 A;  5F3Z A;  3NMA A;  1RHU B;  1SUQ B;  2OHD A;  1X0P A;  4TLQ A;  3VQS A;  4CZC A;  2FZC B;  3LA0 A;  2ZHA A;  4ECV A;  1UVM A;  5KG4 A;  1XMB A;  1FJ7 A;  4M5D B;  1SL2 A;  3WZ0 A;  2DR8 A;  3NBP A;  2HHQ A;  4I68 A;  1HQU A;  1ZBT A;  2MLZ A;  1U2R A;  1F9E B; 
#chains in the Genus database with same CATH homology
 2F5G A;  2VIH A;  2EC2 A;  2XO6 A;  2XQC A;  2A6O A;  2XM3 A;  4ER8 A;  2VJU A;  2VHG A;  2VIC A;  2F4F A;  2XMA A;  2FYX A;  2A6M A;  2VJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...