2EC2A

Crystal structure of transposase from sulfolobus tokodaii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
MEYKSTRHAKYLCNYHFVWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFQELKKSTNGKLWTRSYFVSTSGNVSSETIKKYIEEQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transposase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Gene regulation
molecule keywords 136aa long hypothetical transposase
total genus 31
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2ec2A00
2VJUA 2A6MA 2F4FA 2XQCA 2F5GA 2XM3A 2VIHA 2VHGA 2FYXA 2EC2A 2XO6A 2XMAA 4ER8A 2A6OA 2VJVA 2VICA
chains in the Genus database with same CATH superfamily
3N0VA 3X3UA 4ZJQA 2DHHA 4PG6A 1VR6A 2BJ3A 4KKOA 2G13A 3C16A 3G6VA 4F4YA 2HHSA 2GJIA 3BPDA 1MU2A 2ZWPA 5JVGQ 5KFQA 2RT3A 2KZMA 4UQGA 1V3RA 4UW2A 2B9YA 1RT6A 4O4GA 2D3OR 2QTWA 2E5JA 3BGRB 3DRSA 3FCHA 1F0XA 1U0HA 2PD1A 5J2MB 4Q44A 1KLMA 3TW0A 2QX0A 4OFZA 3DYAB 2HVDA 2GC8A 4JI5F 3M8PA 5J2PB 2HSEB 2VHGA 4WXWA 2WHOA 2DNOA 1RTJB 1O6XA 3PFEA 2E7VA 4B08A 4AQYJ 2QA2A 3TAQA 2E9RX 2JH3A 2CA9A 1P9QC 2D9PA 4OZLA 4CYUA 3T1HF 3Q22A 1HI0P 1ZAXA 3ZZPA 2XS2A 3M9NB 2VBXA 3IP0A 1ZM9A 5KFMA 4IUFA 2M70A 4J9NA 3P4UB 2LQ8A 4JOUA 1KNZA 2B8QA 4XDDA 2FJVA 3R7NB 2GO9A 4PXCA 3FBEA 2XZWA 3NLCA 3RBZA 2HIQA 1BLUA 4DI6A 1WF1A 2KRBA 3RW6A 2RB7A 4UOFA 1LWCB 1I5OB 5ETKA 3TYTA 3F56A 4G1QA 3THTA 2W01A 3J80Y 2HRTA 3CJ8A 3HHKA 3EYZA 2PI5A 4CLTA 1F9EB 3BKFA 2F3JA 2PI4A 3IGVA 2HLTA 3MM8A 4FF4A 3UNGC 2KT5A 2XYPB 1VC0A 4EO8A 4B3RF 1PYSB 3G82A 3OXLA 1X5SA 3FQLA 4WP9A 2HVIA 2ZDPA 3WIVA 3MTKA 2RAQA 2Z2YB 3DGPA 2H5EA 1TAUA 3DOKA 4RW9B 2F65A 1WDDA 4C98A 1NDPA 2CQPA 3FRYA 3TUIC 3BN7A 4G6VB 1C0UA 2RS2A 3PYGA 2MTLA 1HQEA 4JI4J 3HX9A 2UP1A 4LIRA 1CPZA 2ZC4A 3KLHA 1ZA2B 4HT7A 4K4ZA 4G1IA 3HKZD 8ATCB 3CC2S 4C8YA 1L3VA 3TUJC 3ZTSA 1FX4A 1CQMA 1FTRA 1T3OA 3FCWA 2VUGA 4NL5A 5KFTA 4ER8A 1TZ0A 5SZTA 2F4FA 3BR8A 2OEKA 3ISZA 4U96A 3IM8A 1DRZA 1BXNA 2DH9A 4J7CA 1QSSA 4KGMA 3FK4A 3CMAS 4MKBA 3PKYA 4EUVA 3HJVA 1NPPA 1TV6A 4CIOA 4K0KF 2X7IA 1WC3A 4V1Ak 1CQNA 4WYWA 1X4GA 1Q0NA 2CQ1A 4XPCA 5KFCA 4JV0A 3NY0A 5C25A 3OTOF 1XN9A 2UUAF 1A9NB 2DCUB 2Y1IA 3RJMB 5KFZA 4Q2LA 3HVRA 5HP1B 2FHJA 2FDNA 1LWEA 2HQFA 3MM6A 5KOXA 4X4VA 3PW2A 4M5NA 4NXMF 3CCRS 4C8NA 3FSYA 1U1OA 1SCJB 3QWUA 4F4ZA 1UKUA 2DXDA 2DGQA 2H65B 4ZPCA 3KOAA 2GVDA 2ZE2B 1NZAA 2AJQA 2YWWA 5ETOA 1FFSB 1FKPB 1QUPA 4K2JA 4X64J 5HVGA 1O5JA 1SBRA 3HVTB 2MB0B 1KTVA 3HHLA 4X66J 4O4RA 1FDAA 2WK4A 2R2RA 4PQUA 1VRUB 2UXBJ 5I3UB 2HNDB 5D6GA 4Y2AA 2E5HA 2HNZB 2XMAA 1HMVA 1IWAA 3LPEA 2RMLA 3D7SB 1UWBA 3UR3C 1DY3A 4UUXA 4B9TA 2WW8A 2HHWA 3VV2B 2QSFA 3A8EA 2P8IA 4WZMA 1EJ7L 2QN6B 3RB0A 2BRLA 2ZDOA 5DGBA 3PDNA 2I2YA 2VC1A 3RBDA 2IM3A 4ETZA 2DO4A 1Z1ZA 1BMQB 3I56S 1GXLA 1U2RA 3HT3A 4WU2A 5KFLA 1Q53A 3V6HA 4KTQA 2NR0A 1B70B 1RZMA 2GV1A 3TR5A 4HI1A 1RCOB 3QIPA 5A8RA 1D0EA 2J6SA 4B9UA 2YWKA 2HNZA 2VBWA 5GAHI 5ETPA 3GV5B 5I3UA 1WHVA 4P9SA 2JVRA 1AROP 1TKTA 4KQZA 8AT1B 2ZUGA 3DCAA 3EMTA 3HZEA 4CO1A 5I3QA 2HHHJ 3N28A 2AT1B 2DH7A 5JJBA 4NA1A 3UVJB 3M2VA 4UY8T 1DTQB 5CYJA 2J9DE 1WHXA 4QIEA 2LQJA 2MQMA 5J2NB 3QSYB 4O23A 2Y0SD 3D0IE 3D1OA 1PC4A 1S6PA 1X9MA 5KG5A 3S7RA 1T11A 3PXGa 2UVUA 1KC8T 2XTJP 3ZZTA 5IS2A 4YOEA 4JI8F 3ENQA 1N54B 2HNYB 4OZ2A 4Q5VA 4ZP9A 2HBYB 1N5YA 4OLPA 3V81B 1J5EJ 2NSCA 1X60A 2YQ0A 5D0EA 2J5AA 2UUCJ 2J0SD 2NZCA 1G6BA 1RACB 3OL6A 2FLLA 2LLZA 2HS0A 3VAFA 1JX4A 3M2VB 4LR8A 1AUDA 3RRGA 3BSCA 2JLEA 2EBGA 1RWXB 1S1TA 2IHR1 1RT4A 1JQGA 4GMKA 5EX0A 5IQ6A 1K1QA 1X5PA 1VQSA 3W64A 3W7BA 2XGQA 3KJVA 1NKBA 4IRDA 2UXCJ 2BJ8A 3L7OA 1SL2A 4NXNF 2B5JA 3LW5C 4DR7J 4I6AA 4OLOA 4YY3F 2FVPA 5DM7Q 2POKA 2EVZA 2VPWB 3EJMA 3HSZA 3KLHB 4KYZA 1Q8IA 2C2ZB 4CH0S 5LMUF 4CLUA 4LFCJ 1C0UB 1QDUB 3AQPA 3DXBA 4NLVA 1SJ1A 1YITS 3DOMA 3MXHP 1VS3A 2E7WA 5CAAA 4DQRA 2ACYA 1DTQA 3RG6A 1X31C 2ALYB 4LF7J 4CWBA 1EIYB 4OI0A 1IWGA 1M5KC 4H4KA 2FHOB 5AXMA 3RBXA 1IM6A 1RADB 1R27B 2QIFA 2ZOFA 3OL8A 4DR1J 4HDHA 3W8PA 1PG5B 1F5AA 3NOGA 2PC6A 2GS8A 4TQRA 4OX8A 3CWJA 1VRUA 4C0OC 4TU7A 3T1YJ 2C2NA 2XLIA 2V4JB 1U6FA 1NK9A 1H2TZ 2AMCB 2OTLS 4M5GA 2XMWA 2K7KA 3BR9A 5BR8J 1I51B 3WZ0A 2HFNA 1DFDA 4P2FA 2MKYA 4ZA1A 1N36F 4TXSA 1RT2A 1LW0A 3DOMB 2A6MA 4FNIA 4NEYA 3I6PA 2BQUA 2MHNA 1XR6A 2ABYA 3VZIA 3J7A1 1XR5A 4DR4F 3MM5A 1I94J 4PABA 5KG0A 1R8CA 4LBIA 1WEXA 4ECQA 1XNRF 4S0MA 4DV5J 4F4WA 4LF5F 2B9WA 4U95A 1LFWA 1U1KA 1T7PA 2MEWA 3TVZA 3ISND 4DV2F 4LQ3A 3BZQA 2C2MB 1YZ6A 5DZ7A 3OUYB 2AHOB 3G96A 5DQIA 1JXLA 4ZIVA 2VPZB 5CYMA 2J8SA 2X3GA 3H5XA 1BQXA 2AJ2A 2BVZA 4HI2A 3EXYA 1AT1B 3CDAA 4KPYA 2W2OP 2XCAA 4QPTA 4DF8A 1CJUB 1H73A 3GJTB 3C16B 4JBCA 2YKMA 6FD1A 5DLGA 2V4QA 1O0PA 4QWEA 2D3UA 3PG9A 1MG7A 5BYSA 1K44A 4P74A 5HMWA 4NCAA 2KO1A 3VGSA 3GJRB 3L95X 4FF1A 4NRUA 4TY9A 2XMVA 4OI4A 3G8QA 2RU3A 3OVBA 2DGWA 3D0HE 3TQ1A 3DLJA 3IAS9 1IR0A 1WDTA 1FD8A 3K5PA 3ZZOA 3RB3A 4O3SA 3A4TA 1X4EA 2V94A 2Y8WA 5HBMA 4U6PA 1SUQB 2R2UA 4L74A 3LH2S 4CO3A 2CG4A 2DEIA 4V19X 1QE1A 3CO9A 3T6JA 5KFHA 1VQPS 5HSPA 2D41A 4WP3A 5DRKA 3HD2A 2F8MA 5KG1A 1Q86T 1SQEA 2BZ2A 3KJNB 2P9EA 2IM0A 3SSSA 4UQTA 5KTQA 1TUGB 3QWPA 4DX7A 1L3TA 4ZITA 1U4BA 3L7PA 1CJVA 1SI9A 4BWMA 4OX7A 2PMWA 3TQEA 4RUAA 5CD4H 3U27A 4PUOA 2KFNA 1R8HA 4WFZA 2MKHA 4Y6IA 1CBKA 1HBOB 1QY7A 2CNNB 3W66A 2VONA 4LMZA 2K06A 4HH1A 4NYPA 5ETLA 1H7WA 5BYQA 3MWBA 2KH9A 4J9RA 4EK2A 3AJ2A 1UWBB 3HD1A 2UV8G 4FVMA 3UCUP 1FXLA 1HMVB 4F25A 4RNNA 1WOSA 3D5MA 4E2FB 4OYZA 4PPZA 5G0RA 3VGVA 5F8GA 4JV5F 1MNEA 1D09B 4QIGA 4E8UA 2XO7A 1T03B 2FY8A 1U02A 3GLJA 3G8SA 2LA6A 5J2MA 2PEHA 4LRBA 2HFOA 3DC2A 2IA0A 3IR7B 3DLLQ 2P6TA 3PYDA 1N48A 3D1HA 1EX8A 4DS5A 1H98A 3SCIE 1NUEA 4LIWA 2DBBA 2QL9B 4DR2F 2AV5A 5ITHA 4OI3A 3D9BA 2QG9B 1KQSR 4DV1F 2DR5A 4PWDA 2IDEA 1VFJA 3C14A 4FDFA 3D54A 4GRSA 4DSFA 4H4MA 1Q7YT 2GIFA 2KYXA 3F44A 5E0OA 1R6VA 4X84A 1FWPA 3IS9A 4PRFA 4IFYB 5BJRA 2YY3A 3TAPA 4A8OA 2KJVA 4R5PB 4EZ9A 4ES2A 2O67A 4LF4F 4KHMA 4YHHF 1I3OB 2IC3B 3MUTP 4LSNA 4OYXA 5ETSA 3M8QB 3CUNA 3Q8PB 3J7YI 3T1YF 3TUPA 2QYGA 4RBTA 1GH8A 3NWRA 4F3QA 3GIJA 2RUSA 5DJBA 1C4CA 4ID5A 3DLEB 4JV1A 3MMAB 2KHCA 2M3DA 4PG4A 4GC6A 2VB6A 3M2UB 2XG8A 3GIKA 1VRQC 4ECWA 3PY8A 5ETVA 1CJKA 2P2CB 5KT3A 5GAHU 1KLNA 1E6VA 2E1MC 2F8HA 4A46A 1QE1B 1GQEA 2BRKA 3G6ES 2KYZA 3ENAA 4U7CA 2IRYA 4I67A 1N32F 2HW3A 5E7OB 1H72C 1QAJA 1TMJA 1LXNA 2CVEA 5HBMB 5LMUJ 2MPUA 4YY3J 1CSJA 1JLGB 4C11A 1VQNS 1JLBA 3O1LA 1SQFA 3PFOA 3T41A 4BBYA 3X1LB 1NZ8A 4YHHJ 3MEGA 4DV0J 2YNGB 1J27A 1HNIA 1HWUA 4UUWA 1YG0A 4N76A 1T95A 2YTCA 4HL9A 1R3NA 4ILRA 2FLNA 5D77A 1HQ2A 5B7WA 2ZH4A 1TL4A 4ZCIA 1RT3B 5DQGA 2APOA 2FVCA 2R2TA 2E5LJ 2ZITA 4Q45A 1IJEB 3CNQP 5FDLB 3QJPA 3VF0B 1CJUA 3HKWA 3UI3A 2F9JA 4MMOA 1Y5IB 4USHA 4DR6F 2HVEA 3TX8A 5DDRC 3H4BA 2JL9A 4DPXA 4JI8J 3LUYA 1S6OA 3NCRA 3M8QA 3WHIA 3HHNB 2MZJA 4HHHA 3HM9A 1YJVA 1QSYA 2NSBA 4NPOA 4KV8B 4IOCQ 4CO5A 1IBCB 1WUUA 3A13A 2OGUA 3HHLD 3UDVA 2JEFA 7FDRA 2XCPA 2MHEA 5E2QA 4F04B 5J2PA 2OH2A 2YXLA 3FEZA 3UWTA 1FNOA 1SQGA 2G0IA 2R7OA 2KT2A 2V4RA 2ZUAA 3DM2A 3MHYA 4ZN1A 3DNCA 4HACA 4J9LA 3EZUA 3FNNA 1HKAA 4YR0A 2V8DA 4FP9A 3MAAB 5FIIA 4ICLA 2ZZNA 1UW9A 3GFXA 3D6FB 2DPIA 1WC0A 4KGXB 4TYBA 5E3CA 2EPIA 2K7JA 5C2GA 3MTJA 5HMXA 4WFNQ 3PHTA 2VOOA 1TL7A 1VHIA 1SH3A 4MK8A 5HVFA 1M90T 3E3XA 5B0DA 4B9MA 3EVMA 1TFWA 1FKOA 4LRDA 1UVLA 3QLHA 1OMSA 3SDEB 3W2VA 2ZFHA 2DRDA 2I0XA 2CJAA 2HEKA 4H4KC 2HGMA 1RBOB 2MY8A 4OQJA 2AU0A 1IQTA 1WOPA 1ZOTA 5F8IA 3OSPA 4I2QA 1N34J 2UV8A 4CLFA 2F1FA 2NZ4A 4IDKA 2FD2A 5L38A 2AP6A 2F63A 2HQIA 4QIFA 1R6YA 3FSIA 3UCZP 4MIBA 5A6PA 2K1RA 5A8KB 4A8FA 2UVWA 4IYQA 1NH8A 3PJXA 3MURP 1T05B 1U26A 1TVRB 1S9GB 1JLAB 3MR6A 1RBLA 2DH8A 4HTIA 1YTYA 3QJLA 1NO8A 1YJTA 5KFFA 1UL3A 3VAIA 1VJQA 1RHJB 2XYHB 2FPHX 3I5AA 3SBMA 2BUNA 4L76A 1N5TA 4DPWA 4GO5X 5IM0B 1HBNA 1TTHB 2F8EX 3DOLB 3VTIA 4DL0C 1ZTWA 2MZSA 4P2SA 4C0HA 3GONA 5C42B 3THPA 1FNXH 2ZD1B 1P1TA 3LP0A 5M2RA 2XM3A 4DUYF 4M5KA 1FRLA 2LXFA 5T7LB 1KVIA 4X2BA 4ZOSA 1FWLA 4X4PA 5L9XA 4AXIA 2J9DA 2YKNB 2P9GA 3LALA 1U1QA 3VALA 4DV7F 4DV2J 2DNZA 3TAMB 4K0KJ 1DARA 1Y3KA 1NBEB 1FJEB 1CJTA 1OSDA 4OHZA 1VOMA 3DRPA 5I4MA 4P72A 4OYMA 4U9RA 3VQTA 1RTIA 2AF6A 2BBEA 1PC5A 3DLKA 5J2NA 1L3SA 4DR4J 2Q3PA 3CJKB 1ULRA 3GPAA 3DLBA 2DT9A 4DFMA 1S4EA 2BX6A 2GGPA 4I68A 5KT2A 3G71S 1ZETA 4Z2XA 4M94A 2KZZA 5ETTA 3LANA 3KK3B 1VIXA 5D3GA 5J1NA 2R7UA 2A0FB 4KY3A 4OJGA 4PQAA 1WKLA 2CNOB 1FRJA 2ZHBA 2MYFA 1B4SA 2GHVC 2FC9A 2IBOA 1XEZA 4DU7A 3CCSS 1T9WA 3N9UC 1UMJA 2FZCB 1S4FA 3H2VE 4A8WA 1UA0A 1IVZA 1S1UA 3H5UA 5A8RB 3MEDB 3M6WA 4WJBA 2NQPA 4DR1F 3JXOA 3Q8VA 2Y1JA 1N8RT 1Z4UA 3FCVA 1DLOB 2FC8A 4I1TA 2BJEA 1RXOB 4RW8A 4IFVB 2GVZB 5K14A 3I55S 2Q6CA 2OPRA 3D3BJ 1V9OA 3L3CA 1SC4B 5CD4A 1G2EA 3PRVA 2Q1LA 3UE2A 1HNVA 3I4HX 5KFBA 3MM7B 3KLIA 2Z2LA 2IVYA 5E3QA 1NJIT 3G9CA 4P73A 3NAIA 4P6QA 3KYLA 4EI2A 3EVWA 3NMRA 4ZLNA 2AJFE 2R3VA 2KXNB 1RT1A 2K3IA 1PILA 1NEEA 4FVCA 5KG6A 4RUCA 1KRPA 4I0WA 1GXTA 3TEHB 1TKXB 1X0PA 2BMBA 3KK2A 2R7WA 2G2ZA 2LEAA 2WRMA 1FE4A 4C3MA 3P49B 2DVIA 2HBRB 3IGNA 3GV8B 3RAQA 3M6UA 4Y2IA 3W61A 3MMBA 2O66A 3BH7B 4AL7A 2FJEB 1HNVB 3ADAC 4J9UE 2QFJA 4KH0B 1EQMA 3SMZA 3AB4B 1QM9A 2Q79A 2WSFC 1KTQA 1RAAB 3D68A 2GVZA 3Q83A 1MWYA 4PXDA 4DV4F 4ICLB 4ZPWR 5C25B 1NK7A 1FT8A 2V2ZA 3Q23A 2OFHX 1N34F 4CCHA 3MEDA 3ELHA 4MIWA 3R8YA 4NLQA 3GG1A 3IRWP 1PIEA 1TQLA 1TV6B 3HFVA 1W25A 2VQEJ 4NA3A 2ZC3A 4J9VA 3K5MA 2J0WA 1X4BA 2HQDA 4HVZA 1J5OB 5LJ3Y 5GMDA 5AXLA 5K8PA 9RUBA 1RAOA 5J1EA 1I1GA 3H4DA 4GVBB 3V81A 1FXDA 3GSIA 4NZ7A 3QZ8A 1YZ7A 2BANA 2ZZTA 2GIQA 5EWEA 4ED3A 2V69A 1HR0J 5EUHA 2HNYA 1HNWJ 4FYYB 5AXKA 2WVCA 3DRXA 1KP6A 3T5LA 4F02A 3J81Y 5DS7A 2GQCA 2BW7A 1HL6A 4N41A 2CG8A 5KOWA 1HQEB 4QU7A 5KFYA 1RK8A 4IG3B 3MD1A 4RNFA 1WG5A 2DYAA 2KM8C 4QU6A 4DXLA 5E3RA 4LF9J 2V2QA 3P45B 5LM7E 3ITHB 3T9NA 1REGX 2JDJA 1T02A 3QFHA 3FEYB 2XY7A 4WFBQ 1VK8A 4IH6A 4ZIWA 2BXJA 1AZSA 2GW8A 3T5KA 3Q8SB 4DOZA 1DTTA 5MAOA 1PSDA 1PCAA 3W1YC 1XK8A 3E01A 5F0UA 3ZTOA 5C42A 3SSQA 3PJWA 2HVZA 1S9EB 4J37A 5H1SV 4DUZF 1WC5A 4EU0A 1FJGF 1IM4A 2H51B 3GFYA 3KDNA 1S72S 1Z2ZA 1R7IA 2EFQA 4A8SA 4B3TJ 2FLOA 4DSKA 2MKCA 2MSSA 3R1HA 2BOAA 2HAFA 3DLGB 3JSMA 1Y7PA 3CDEA 3ZZYA 3SYZA 1FD2A 3OFEA 4YN3B 2W9CA 4OYOA 2I1RA 3HI9A 1BHNA 2WVDA 4PG8A 3AHPA 1MMLA 1SJRA 1U2CA 2B9EA 4RPFA 4WE1A 5GMEA 1TVRA 1RYSA 4ES3A 3FGVA 1UEVA 2QA4S 3K17A 1YJNS 1SKSA 1C1BB 2J7UA 5A8KA 1Q78A 1RTJA 3D6HB 3Q8YA 4K4WA 2AQ4A 3G2XA 3M8PB 4J9KA 3K58A 3DN9A 2IYIA 4PWWA 5IC4B 2UUAJ 1RHKB 4X62J 1LKZA 2MZ1A 2JEGA 5FJ4A 3N79A 3BGRA 2KVIA 3DRSB 5G4DA 4C8KA 1N32J 2M5YA 5B0BA 1RTZA 2J7KA 1GTEA 1FDNA 2LQ9A 3BPSP 3IS9B 2XSJB 3QLHB 3SDEA 3TA0A 3W2VB 5GADU 2L08A 3MFHA 1S0OA 5B0CA 4ILMA 4IG0A 3HFZB 4BLGA 1SXLA 3OTEA 1K73T 3NNAA 2R4FA 2RDIA 1S79A 2LMIA 1L5UA 4RBVA 3RGIA 2XSJA 4DL2A 1S10A 4JI7F 4DL3A 4ANCA 5HO4A 1YIJS 3TVYA 4YP3A 2FHKA 2CPIA 2JX2A 1ZYQA 1D1UA 2F7VA 3IWLA 5D78A 4C6AA 2CYYA 3KLFB 3JTOA 2E1RA 2DGXA 2HQGA 3PR4A 4USKA 5E3AA 4GKKJ 2IY5B 4FBUA 3IO1A 5K5MA 4CLZA 2HPUA 5CHCB 4PWUA 3DFEA 4QCLA 3EWGA 1S12A 1RTHB 3LP1B 4X4SA 4WE1B 4DR2J 4KHRA 1KSPA 2Y8YA 3C8YA 2I8EA 4PYAA 3UR0A 2MZRA 1VQ6S 3I0SA 2LU1A 1V5VA 2IVFB 4JI1J 4DV7J 3FRZA 1LWFB 2B56A 4OJ3A 5K8NA 3WDOA 4CM0A 3DXSX 4PR6A 4YB7A 1WSRA 3M32A 4FYWB 3DOKB 4RW9A 2C2OB 4ZVSB 5KFPA 2OP5A 3ILLA 2IJRA 4RL1A 2PFFB 1ZPVA 2GJFA 4DZDA 4EWTA 3MR3A 3PIOQ 1SUQA 2WZ1A 2Z2MA 1BGXT 2EKNA 4XK8C 4F4KA 1T9VA 2VG6B 4R8UB 3OHBA 2E9TA 3I5BA 3OFGA 1JLGA 3UD4P 1YLXA 2HZAA 2V5HG 3GTYX 2F4VF 2KTQA 4DV6F 4N5SA 1FNMA 3D2WA 2XHCA 3CD6S 1G4CA 4JI3F 5CH7B 1EETB 2QV6A 2J6UA 4WZQA 3IG1B 3UCGA 1V6HA 2CZVC 4E98A 4AL6A 2B6AA 2YNFA 2NXEA 1OS5A 2H48B 1WC4A 1YRTA 2VPXB 1VQ5S 1FRKA 3CT9A 4C3LA 5E41A 2JJ4D 2Z30B 2DNGA 4NLWA 3ZXWA 4DHVA 5KFNA 1JB0C 2WOMB 3R7SB 2VIHA 1M5OC 2UUWA 3BV8A 3DYAA 1NK8A 1HNXJ 3VGTA 3BSNA 2RSQA 3PIPQ 4RNMA 1RWPB 2WSEC 3TA2A 2DO0A 2GCFA 4CLYA 4ZLPA 2DGUA 4QR1A 1DAXA 1OYDA 2E1PA 2CJBA 2QYCA 3U7JA 1UETA 3OT9A 2KXHA 2W2MP 4AFFA 5L1IA 5F8NA 2YPZA 2UUBF 1EQ0A 1X4CA 2CJXB 1T3NA 1HBMB 3C6UA 1UFLA 2AJ1A 1UJ4A 1PBAA 2W1BA 3NAHA 5D4OA 2B4UA 2E1AA 5EHHA 1JJ2R 3QGGA 1VQKS 3DLGA 2JLFA 1TKDA 1NDLA 1I6JA 5HN0A 4A8MP 2Z2ZA 2Q6BA 1PJ7A 3DGVA 1HFEL 2KI2A 1JLCB 4NLSA 2JZ5A 5C24B 1Y3JA 4DR5F 4DL4A 1APSA 2HWHA 5LSOA 3EX7B 3AD9C 3KK1A 1D8YA 1NSQA 4CZCA 1NDCA 3K2YA 1HLWA 2NYIA 2FJBB 2FJDB 1HBUA 2WONB 3P5TL 3Q89A 1KDNA 3EZOA 3QYYA 1IKVB 3LGNA 3ULHA 2UU9F 1TL3B 3MM9B 2N7YA 3T19A 4CRJA 2FIUA 3T1AA 3AD7C 1U2FA 2ZBPA 4DLGA 4NZ0A 2H9ZA 4RW7A 2QT7A 4AL5A 2J76E 4ZLJA 3QATA 3R5JB 1KONA 4BC9A 1Y10A 1VGYA 2PE8A 3CF5Q 3PW0A 4B9VA 3R2CJ 3M32B 4LREA 5IFMA 2GZOA 1VI7A 1U47A 4M63A 4PUOB 5F9NA 4G3IA 3T3FA 2OEJA 3TEGA 4IR1A 1URNA 3GCWP 3RW7A 4W98A 1NU4A 2PO4A 5A0YA 3ZO7A 2G0CA 1VQMS 1F5CA 1QVGR 2HHUA 4A4JA 5F0WA 1QTMA 4DX5A 1DTTB 5KFIA 3B4DA 1MMDA 4JI6J 1PAUB 1PAEX 2YNIB 3K5OA 6FDRA 1UA1A 4W90B 4OZ3A 3IWXA 1IBKF 5KAKA 1X7VA 4LFBF 4ZPDA 3GIMA 3PYEA 1GX6A 4X65J 1EB0A 3KHRA 2DITA 2WB1D 4RO0A 2B9XA 2GFFA 3BN4A 1WD6A 5IC6B 3US5A 4C8OA 2D3O1 1P6TA 4QW9A 4OI1A 3SCLE 5KG4A 2BACA 3JAMY 4DLEA 3GCXP 4R25A 3LWLA 4BC7A 3BYRA 1U1PA 4JI6F 2KL8A 2VOPA 1RSCA 5K8MA 3VQSA 3OJUA 5H9EJ 4KSEB 3K0JA 2YX1A 4EBDA 2QA1A 4LBHA 4B3OB 1P9YA 1SV5A 1FJCA 3TRGA 1HIYA 1HQUA 2NPIA 3OW2R 5I3PA 2DNQA 1IKXB 2ASDA 2DHXA 3KLGA 2DPJA 2PA3A 2RRNA 3LP2B 2R7RA 3VAJA 4WKYA 4FKYA 2XI2A 1XMQJ 2HRUA 2L9DA 4DX6A 2YKPA 3UVJA 2OELA 4NLUA 2RH3A 1BWEA 1UCNA 3KNGA 5CXTA 2BKNA 1S0MA 4DSJA 2G9OA 2IFXA 4LRFA 1KS2A 1TKTB 4F4XA 1YRUA 3QIDA 4Y2CA 3UNYA 2QFIA 2W4CA 3VZHA 2ERRA 1QUVA 2ILYA 4FPRA 3TANA 2XS7A 5GVQA 2GX8A 5KFGA 2AJ4A 3MCSA 4YB5A 3TJAA 4DR5J 1S9GA 2PMZD 1RT5B 2UXDJ 3BSAA 3N6LA 1MN7A 5KFSA 2OEMA 2VF3A 3C6TB 4F26A 2X1AA 2ZM6F 1M5HA 1HWJA 4I2PA 3VGUA 3BBBA 3SZ2A 4OHYA 8RUCA 1G1XA 4NX9A 4LFAJ 2IRXA 2DB1A 1RDRA 2BW2A 1W26A 1YK9A 5FLXY 2V4JA 3DRRB 1OQ6A 4KGKA 4M5HA 2V34A 3NNHA 3G8TA 5L46A 4U7UD 2CNLB 3HCXA 2CVIA 4FXWA 4HLBA 3KKFA 5KFVA 3V6KA 4USWA 4CTAA 2E7XA 4EGLA 1SV5B 2LVWA 3WIUA 2RS8A 2XMTA 5LL6d 1U49A 1TKZA 1H38A 1U6BA 2ZH7A 2GMHA 1OQ3A 1XQIA 1LK7A 3KFWX 1NH7A 2VD3A 3BEGB 4F7VA 2IMWP 2MXYA 3RYLA 1OJ4A 3OHAA 2C28A 4IH7A 3JYTB 2ZJQQ 1XNQJ 4J90A 1LK5A 2RRAA 2XMKA 3CJ0A 1S6QA 1HW9A 1S1XA 2VFUA 2YWEA 2OSQA 2LEPA 3I82A 3CGIA 4Y28C 5B08A 1PGZA 1NKEA 1NK6A 2AYEA 2VKZG 3KJVB 3MAQA 4ZCMA 1UVKA 2YKNA 3M8SA 2AYBA 2CAJA 2MQ8A 3UD3P 4IOAQ 2FJXA 2Z57B 5E33A 2QMUB 3EPIA 4BDPA 3NCQA 1AB8A 1ITPA 5A0YB 3M30A 4U67Q 2EFPA 4DQQA 2LFVA 3GWCA 1H2VZ 4FKXA 2HHVA 1N5YB 4DL5A 3M8YA 4ANEA 3NKYA 1RT3A 3D67A 2IBKA 4ZVRB 2RF2B 3ZFVA 5KFUA 2OAUA 4BHQA 5LXYA 1NNDA 2MKJA 1Z2LA 3GILA 3FJ2A 4MYTA 2FZKB 5IT9U 1U1MA 3AB2B 5F8JA 2Q66A 4J9OA 3EXCX 3QQCD 1Q7LB 2MZQA 4PXBA 2ZH8A 2AEJA 5KFDA 3QAEA 3DRRA 4DV5F 4L3KA 1ZH5A 3KDOA 3EICA 2DD8S 1FXRA 5DDOC 2MQPA 1QSLA 3KUEA 1TMMA 4ZPTR 2XWXA 2L9NA 2CQBA 3HDSA 1R31A 3CXCR 2DK2A 2HAIA 2O3DA 1XMQF 2K2PA 4NXMJ 2HGNA 1FCAA 2VDIA 3C6TA 3O2IA 5GAEU 2BOPA 3A8KA 3PEJA 3UFCX 3MM7A 2ZBIA 2MQLA 1OWXA 3C15B 3MI7X 1IKYA 3M2UA 3QIPB 3CCZA 2YH0A 2LXUA 3R27A 4R0EA 4LJMA 3J81j 3RU0A 1OPZA 4C48A 3DKDA 4O3OA 1Q79A 2M0GB 4U7UK 2K1RB 2XYGB 1QAXA 2QLXA 4RKUC 3HT0A 4XO0A 2LQ5A 3J81U 1H2UX 4O3RA 4O44A 3HJFA 1O8BA 2CUYA 3ZNJ1 4LSLA 2AW0A 2VL1A 2XZTB 4ZDNA 1Y0HA 3CJRA 4MK7A 4DL7A 2VFSA 3K8VA 5KG7A 5F3TA 2ZVSA 4HHJA 1AA1B 4QWCA 4DG1B 2HNDA 3H59A 3W62A 1H74A 1VC5A 1VC6A 2FHMA 4ZMMA 4LFBJ 3BBCA 3C14B 3WX4A 2CQ4A 4J9SA 3OFFA 4PWDB 4NZ6A 3R97A 3PEHA 2EW9A 2YNHA 5CYQA 1N6QA 4DR7F 2ZBQA 4AYBD 3ET6A 1FWKA 1FRXA 3DLKB 4WYLA 1GEHA 3PW4A 1YBAA 3MAAA 1CG2A 2RNEA 3OV7A 3CJTA 3TARA 3CJSA 2H3EB 3HULA 5KFEA 3C46A 3MM6B 2U2FA 3TZWA 4CLWA 2XHWA 5CA5A 3HK2A 1AYEA 4I6YA 2R7SA 3IBCB 2EC0A 5JMNA 2IAJB 2F40A 1GMWD 1NSPA 2FJWA 2XULA 3LPYA 2R7TA 3N01A 1HNIB 5LMNF 1D8ZA 4ANDA 3P8BB 4WU3A 4FS1A 1NJZA 4GO7X 4F3OA 2ZOGA 3MCNA 1IBMF 2H4WB 3RBEA 1PBUA 3LP0B 1R0AA 3OXGA 3QRQA 1HWKA 4KT0C 3AOBA 4U8YA 3M9OB 1ZTTA 3BSOA 3PO5A 4DSLA 2B7CB 5F8LA 4MFBB 3EZ5A 3L9ZA 2A2DA 1LV5A 5FDLA 4O0NA 5J2QA 1KFDA 3BH6B 1WTBA 4M5LA 4Y3CA 1B3TA 2ZNZA 1HYSA 1ICEB 4EBEA 4C7QA 3R6GB 1FF2A 4KPCA 3H2UB 3W8GA 1MWZA 1M1HA 4ETXA 3CCMS 1S9FA 3KTQA 1OSCA 2F5GA 4DSEA 1B7FA 2ILZA 2RILA 3I32A 4ID5B 4K59A 4LF8F 5KT7A 1RHUB 2WBMA 2DKOB 2DNLA 2D3ZA 2V9KA 3AA8A 3DGPB 4USVA 2RQ4A 2RQKA 5KT5A 4H4OB 4RBUA 3PR5B 3R5BA 1FI4A 2XY5A 4I2QB 2FVRA 3FFIB 2L9WA 4NCGA 4CM2A 2XMMA 3AODA 4ERDA 4YFUA 4A8QA 2K8GA 2OIHA 2COLA 3D4JA 1UJ5A 2HHXA 2DNHA 1BE4A 3I9V9 1FKOB 2X3DA 4QWBA 1C1CA 3IWNC 2EEYA 4TLRA 1NHKL 1CJKB 1B0VA 5DETA 3UN2A 2WAQD 1TL7B 3GSDA 1JKHA 1OO0B 3W9HA 4LF1A 1UVMA 1D9AA 4B9NA 1HBMA 2E5IA 3L7UA 1NPRA 3MF5A 3MMAA 4ZKAA 4DR3J 2HZVA 2YWFA 2PA8D 1G7CB 2MLXA 2OJ3A 2H1YA 2YKOA 4P2MA 4L73A 4LSNB 4X66F 1M1KT 5EDWA 1FE0A 4ZVQB 3RB6A 3KNAA 2W8KA 2VQFJ 1BWVA 5HQ8A 2W9BA 4F36A 3Q24A 5J1PA 2W9BB 3KHLA 4DQSA 2ZHOA 2CPYA 4H4MB 1YI2S 1S48A 1BQNB 1UWAA 2JFKA 3N4WA 3K5NA 3V4IB 1AXQA 1U0HB 4ALZA 4KV8A 4OZJA 3GIRA 3OTDA 2DRAA 1IR2A 3G86A 3KMSA 3FQKA 1RT6B 4HKQA 3O3LA 3JAMU 5IV4A 3QMQA 3QO9B 2W9CB 5HAOA 4KR0B 1DJ0A 5F8MA 4O0IA 3FBCA 3GG0A 3Q2SC 1MWQA 1IXKA 4Y34A 2MQNA 5HROB 3OTOJ 2RDJA 3VAHA 2JVOA 3PV8A 2C2DA 1U1NA 1VQ9S 4DS4A 1S6UA 1PYTA 1S57A 3FZ2A 4LBPA 1WORA 1FERA 1XJWB 3AOAA 2C22A 3E51A 4YEAA 2VG6A 4R8UA 1RKJA 3D28A 3RUBL 1HD0A 2J9EA 5IV3A 5A2QU 2VG5B 1LW2A 3U1MA 2VODA 2HRYA 3MEEA 2O01C 3G6YA 1A7GE 3CDBA 3PW7A 2YBVA 1FRMA 4FYXB 4IRKA 2KG0A 4F0KA 2U1AA 3BKUA 2BKPA 5LOQA 4W4MA 1YX2A 4IO9Q 1UVJA 1AFIA 4Q2MA 1KKHA 1VISA 5IXUA 4ED7A 2ZKUA 3OTBA 2R8GA 1SPBP 3I87A 3JQMA 3OXFA 2NS1B 2GNKA 3GJSB 1JNZB 1E6VB 3P5BP 1RT7B 4Q7AA 2DHSA 3Q8QB 3GQCA 4QPXA 2ATLA 1RWKB 2MJUA 2B5JB 2G2YA 2QJ3A 2QGFB 3JQKA 4OI2A 4ZVOB 5AT1B 4DPUA 2R8IA 4FF3A 2HFZA 4WPAA 2RUGA 4CO4A 4CNYA 5GMKa 3GIIA 2V8HA 4F50A 4EO6A 1J5OA 3OLAA 4NCBA 2QL5B 1GTHA 4L75A 3HZGA 3JTNA 4N8NA 5MLCV 2IC3A 3PM9A 4ZPAA 2HWTA 5EN1A 1QAYA 2IMOA 2EG2A 1CS4B 3K89A 2V2VA 1FK9A 1F60B 1RHQB 3BYPA 3R5DA 3N6MA 2NYHA 3DI6A 1ZZNA 2HMIB 4IFYA 4ELTA 3PX6A 2XNRA 5DZ6A 1S1WA 2ZOMA 3A3OB 3TWZA 4KIAA 3FKBA 3G6XA 1S6QB 3G87A 3QNWB 2OPQB 4B3MJ 3OSNA 2KFZA 2B8PA 4YR3A 1SJQA 2AYMA 3LTOA 2B4PA 1YJ7A 2YKMB 5C2CA 1DQ9A 3CJQA 4IG0B 4WK1A 3ZZZA 1B0TA 4AQYF 5ETQA 2ASJA 3CCUS 1NSKL 4NLOA 1LW0B 2FVQA 1NPKA 4Q0BA 3TA1A 2VQFF 2YVSA 4MKAA 4JP8A 1OPIA 3M2RA 5KFJA 2R7XA 4K4YA 3P3DA 5ETMA 1FDBA 1KOOA 2EI5A 4OMFG 5HJXA 1FJGJ 1MROB 1N5SA 2BJ1A 3NGUA 4LF2A 4PPDA 4URGA 1YJWS 1HNZF 1HD1A 4X4OA 2PGCA 4ZJOA 1UPMB 3MAHA 2GO8A 3QGHA 4NRTA 3DMJA 2X1GA 3KLIB 3RRKA 4ZHRA 3BO4A 3K8WA 4LSLB 4NLYA 5AJ3J 3DU5A 4RW4B 2J9CA 3S01A 2QLJB 4LF9F 3PJ9A 1TK5A 3PYFA 2H4YB 5HQLA 1OIAA 3FDSA 3NGTA 3A12A 1RT5A 1IKYB 1NM2A 1X5OA 3PACA 2NUUG 3W5XA 3I5CA 1S1UB 4F2RA 3E01B 4USMA 2BJDA 3CD5A 1N52B 1HA1A 1U09A 4RNOA 2DGOA 3POTB 3NCPA 2OD4A 1V5IB 1B7YB 3O8WA 3U02A 3UD5A 4DCPB 5RUBA 4LF8J 3KMQA 1AZSB 2IPOB 2FLPA 3ONQA 3IMQJ 3HVTA 4PQUB 3KJFB 3H2LA 3MDFA 5JVHQ 1L3UA 5A2QY 4OYWA 3GU0A 4QYZK 1JWWA 4DBQA 2JFDA 2R7VA 3QSIA 2ZZMA 2ROGA 3OTCA 2RE1A 1HI1A 2HIYA 2XWYA 2V8PA 3C66A 4USTA 4WCEQ 2ZM6J 3AAWB 1Q5YA 1UP1A 3NS5A 4IG3A 4YMEA 2W2QP 2AYGA 1U8SA 4DFPA 2ADCA 2CQ0A 3NGDA 2H5IB 2Z4PA 3LAMA 3S6EA 4ECZA 1X4HA 4QIWD 3M6XA 3SIPB 3TOQA 1BUXA 1YWXA 4IR9A 2YWGA 2OPSA 1RHRB 1JMTA 1LFPA 2W9AA 4OYAA 1IBMJ 1Q16B 1S6PB 3I0RA 2DNPA 1JLFA 4FZVA 2VPYB 4LUBA 3AY0A 1VLOA 4HT5A 2QO3A 2DIVA 1CS4A 2C3UA 1SC1B 2P5VA 3MUMP 4ZJLA 3FC9A 3RAXA 2ZBCA 4CO2A 3GV7B 2MKKA 1FO1A 2JHEA 5EGYA 2MQQA 2DISA 5HLFA 4PYDA 1NRKA 3GJQB 1JLFB 1OY8A 1H7XA 2R7QA 4OZ5A 3SQOP 2HS3A 5DM6Q 3PNIA 2R2SA 2J7WA 1VQ4S 3MR2A 3HHLC 2GAHC 4DV3J 5DLFA 5ETRA 2FUG9 3MGJA 1SKWA 2WVBA 2B43A 3MM5B 2B51A 2X51A 4WFXA 4KAIA 1CULA 1F3FA 2NLWA 3KG1A 4OHVA 5KFRA 2J0QD 1FKAF 1S1VB 1HI8A 1M5VC 4RR5A 1FJ7A 3K57A 4DSIA 2KM8B 1SC6A 4RWXA 1TKXA 4ATNA 4HR2A 3B8HA 1M0SA 3U1LA 4UOCA 5HJYA 5IZHA 4ZP7A 1RTDA 4F3MA 3HO1A 2CQDA 5K8OA 4NYZA 3IFEA 3QJJA 3CCTA 4NLRA 3TZXA 3LQVA 4CQ1A 4DPTA 1MSWD 2KXFA 3QPIA 3HMJG 3FMBA 1UPPA 2OHDA 4UTGA 1JXEA 1N36J 4RU2A 2G4BA 5IOLA 3W9IA 2OI2A 3I96A 4ZP8A 3MPYA 1DBDA 2ZE2A 3BGUA 2YKQA 5HROA 4NOHA 3A8IA 1HARA 4CNZA 1S1VA 3N5BA 4MK9A 4P52A 5IWAJ 3HP6A 1X5TA 4CO0A 4KH1B 3AJDA 1RAEB 3IBFB 4K50A 1GFWB 4CT8A 1ZZFA 2HBQB 3DMJB 4TYAA 4ZHRB 4C2MA 3CPWR 4O3QA 1XBWA 2UUTA 3H5SA 3JSYA 1UZDA 3DI6B 2HMIA 1J2VA 3WC0A 2FHJD 3GB0A 3HHLB 1KN6A 2RJZA 2F9DA 5DO2A 2J6TA 1Q1KA 2M9KA 1RA6A 1E6YA 2HFUA 3M2RB 4OYBA 1R0BG 3IAM9 1S99A 2G2OA 1NDKA 1KWMA 1VYAA 2QMWA 2GVDB 5CCMA 4WFAQ 2XSFA 1F1BB 1SC3B 3CJKA 2W2NP 3FBFA 4C97A 1RU2A 3WX8A 2BM0A 1RTIB 3BDEA 4XDCA 4RU9A 3MCOA 2OPSB 2OUGA 3E2EA 2CXEA 1U24A 1NB2A 2VC0A 3NGKA 2VH7A 5JXSA 3NNCA 4B3OA 5HP1A 2JOQA 2XZDB 2KFYA 4KHPF 1Q95G 3TAMA 3OPKA 2FJAB 5H9FJ 3HSGA 4QOTA 3RTVA 2YX7A 3LGHA 2KT3A 3R6LB 2XQCA 3CIMA 4M5JA 4K4SA 1FK9B 3Q8RB 1YKWA 3HHDA 2VJVA 2MQOA 4V19J 2DGSA 4USJC 2B4OA 4WIIA 4MKVA 4I6WA 2AWZA 2NXJA 3GZ7A 3SCJE 4DX8H 4B3SF 3LWMA 1Q82T 3M8ZA 2VA2A 1EARA 1LW2B 1RAFB 2KVQE 2W25A 4DCOB 4EMDA 3QGPA 2W7OA 3S1TA 4KGZB 4N47A 3POTA 1SIZA 5DG7A 1KQKA 2KHDA 4DUTA 1FTCA 4C4WA 1EP4B 1RQ0A 2DR6A 2GHPA 4F67A 1NK0A 2VBYA 4JB8B 1KR4A 2Z58B 3MD3A 2QMXA 4M8LA 3IRXA 4P75A 3TO8A 2VJUA 2QEXS 4RUHA 2ASLA 1T05A 5J2QB 4JI3J 4B9SA 2X1BA 2WVEA 1LWFA 4DV6J 1SIWB 4LQ9A 4TU9A 3DDNA 3KLVA 1K1SA 4QR0A 2XMUA 4JI2F 3OJSA 3VHQA 2HHQA 4X4NA 1BY9A 2CWKA 2EK6A 4O3PA 1JLQA 2YWHA 3AD8C 4I4BA 3THVA 1T9XA 2EKYA 2C3MA 4IQXA 3I9ZA 3MEEB 3V5RA 4R5PA 1BQNA 3VAGA 4ED5A 3MM8B 3I4PA 2A1BA 2DEJA 1RGVA 1WSVA 2OMLA 3HLUA 1ZBTA 5L39A 5CCLA 4PCQA 5E3PA 2P9CA 3T9ZA 2IAJA 1S76D 4G1PA 4XAKA 1XMBA 3ZZUA 1K9MT 1ZS6A 1JLCA 1XTZA 2E66A 1EAYC 2XEXA 1FVSA 1TU0B 2C3OA 4O4GB 4YB6A 1SJ4P 3ETOA 5AE2A 1WI8A 2L3MA 5KT6A 4LR7A 2IJNA 4K7QA 4YDDB 3QO9A 3PKMA 4KRWA 3HSDA 5IQQA 4DR6J 1WJ9A 2V0NA 1F5BA 3CJ5A 1R8BA 3EDQB 1HWLA 3HFKA 3R3TA 3R2DJ 2QE5A 1U7LA 1IQZA 2GA7A 2GMJA 4QR2A 4CYUB 2M4MA 5IWAF 2V2KA 1CC7A 1U45A 2FYXA 1SJFA 1AUSL 3CD7A 4NEZA 2ZHAA 1NCLA 3OR1A 4KFBB 3VAMA 3H98A 1L3KA 1JLEB 3AXMA 3TX0A 4NCGB 3E8OA 3V6JA 3QT5A 3SXLA 3QT6A 4K5RA 3V6DA 1NB7A 1JLQB 4BCAA 1NHUA 2CPEA 1NAQA 2WSCC 3OLBA 1TAQA 1WHWA 3ISNC 1IBLF 1MU2B 2D1CA 3M1VB 2J8AA 4I56A 3OL9A 4CLLA 2BEFA 2QLWA 3PZPA 3IRXB 4H54A 2RIJA 3LAKA 1RAIB 2VG7A 4W92B 2LCWA 1N33J 1X9SA 1QAIA 4EZ6A 2C1EB 2QA4G 2CFXA 1T9YA 1TK0A 1IBKJ 5HMYA 4MFBA 1N56A 3CW2C 2HG4A 1RAGB 4X62F 2AIRB 2RRBA 3EDRB 3CSKA 1IBLJ 1RI7A 5BYRA 1WHYA 2FB0A 4TN2A 4NXNJ 2XMJA 2IVMA 2C42A 1R0AB 5ADZA 4QYZJ 5CZVA 3CJ3A 3MPUB 4WIQA 4F0HA 1SJ3P 1RA7A 3ILIA 3ZNUA 5C5JA 5DDQC 4ZCKA 3EM1A 4XIUA 3ITHA 4ZLLA 2OSRA 2VFTA 2DNNA 1REVB 2V67A 2VG7B 3MZIA 4HDGA 5C7PA 2GQ2A 3B4MA 5AE3A 3TZZA 2N4DA 3FBBA 4QBUA 1X4DA 4OX9F 1B99A 2BQRA 4LT6A 1NK4A 4B3TF 4KJIA 4JYAF 4F8RA 1U6ZA 4CDIA 4USUA 1N5QA 2BA9A 4DL6A 2CPXA 3MECB 4KBIA 1YBUA 3ETMA 3DHXA 4PAAA 4R0JA 4WBFA 3SCKE 5M2UA 1N6QB 3GYXB 4TVAB 4Q8EA 3BO3A 4Y65A 2FQQB 3CIZA 4ED2A 2LDYA 1HR0F 1Q8LA 3ENWA 3C3LA 2JRSA 4J9PA 1OY6A 2Y3YA 3PHEA 1GAOA 3GMGA 5KG3A 3RZAA 4C8ZA 4CP5A 1QTNB 3H0PA 2UUBJ 1UVNA 2LEBA 1S77D 2WB4A 2D74B 1JNRB 3QFWA 4OZ1A 4Q43A 1PKUA 4OHWA 1X0FA 2I5JB 3CEDA 5D0GA 1YHQS 4JI2J 4D3HA 1P27B 4NI2A 1UTAA 2DJWA 4KKOB 5D0HA 3LGMA 4QZVB 1JKHB 4XPEA 2V6AA 1Q8KA 2VBZA 5T41A 4CTAB 1B64A 5D4PA 3EGWB 2PEBA 4RWWA 3K59A 3D66A 4URQU 2ZH9A 2W24A 4FNHA 3GR0A 5G0RB 3W2WB 2VQEF 4DPOA 1VCTA 4ZVPB 5F3ZA 2IDLA 3KK2B 3BM7A 4NLTA 2Z8QA 4NE9C 5AJ3F 3GR1A 4PKDB 2A18A 4NLPA 1VQOS 2E1CA 4JV2A 1RAHB 1Y11A 2SXLA 4B3SJ 3GP9A 4IQMA 2HBZB 4ITSA 1HBOA 2JC1A 5FD1A 3BF4A 5B0GA 4ZVFA 3W65A 3CJ4A 3OFHA 1HNZJ 1TR0A 1VQYA 3KHGA 3BQ2A 4ZK7M 4ECXA 4ZP6A 1TL1B 4YDXA 4M5DB 1C0TA 2YQ3A 3AH6A 5A8WA 5HMZA 3MEKA 1JK9B 2CDRB 3KWMA 2FGOA 2ZEJA 1EP4A 4P7TA 5KT4A 2BR0A 3JSMB 3BGOP 3MOJB 4EYIB 3QRPA 1U8WA 1BC6A 5DDPC 3F41A 2MMYA 3CDWA 2FVSA 1QVFR 3ZZ0A 2X1FA 4CH1A 5A6WA 1RWOB 3N5FA 1U25A 3A3NB 2OPPA 3CVKA 1T94A 3LP2A 4M5IA 2DNKA 1Y5NB 2IRUA 2WBRA 5D0RA 5LSRA 3C2PA 1S7HA 4ED6A 1F3VA 3OBIA 3R9LA 3CD0A 3PVXA 4FPIA 4OI6A 3ENVA 4RLEA 4NWBA 1N88A 4JI0F 1NK5A 1WTFA 2V63A 1VRTB 1XNRJ 4OJ1A 2AEMA 1I94F 5AE1A 3NOCA 4KO0A 1TFYA 3H90A 2EG1A 1FA0A 3HVAA 3JSBA 2PIIA 5HL7Q 4LF6F 1WC6A 4GKKF 5D4NA 4ECTA 3KHHA 1GK8A 5CYMB 3PW5A 4GKJJ 2ZH6A 4DQIA 4RZRA 4NMXA 3I31A 2RKIB 2NXCA 3R5GA 4GVBA 2CQ2A 2C3YA 5BR8F 1PO6A 2YNIA 2G1DA 2DXEA 4DG1A 4JI7J 2KRRA 4GKJF 3FVYA 3D6TB 1S1XB 3EE3A 3PCOB 4LVNP 2HYIB 3BQ0A 4ELVA 1SKUB 1T9UA 3NEKA 3DOLA 3W63A 5IT4A 4B3RJ 4ELUA 4DF4A 3D1QA 5IM0A 2C2EA 1YQHA 2NUHA 3NMAA 5A76A 1NSAA 1UZHA 2VV5A 3AXKA 1SVDA 4TY8A 4YR2A 5HANA 2BQ3A 2BYCA 4DEZA 2MSTA 1TKZB 2KG1A 2OD6A 2W7AA 1Y00A 1HPZA 4ZPBA 2OFGX 3C15A 4LFCF 2V9WA 1RWMB 1TL1A 5L9NA 4L72B 1TL3A 2CZ9A 3MM9A 4QIVA 1VQ8S 4P71A 4DUYJ 4TQSA 2IYGA 2WONA 1MROA 1M5SA 2MKIA 1P1LA 1TUWA 2UXCF 3KUGA 9ATCB 1RTDB 1CLFA 4PEOA 5DGAA 4FYDA 1RHMB 2GAGC 3CMQA 1JXVA 1F2HA 1YVFA 2BJ9A 4FXVA 2NCKL 2IM1A 3W9JA 2DR7A 2ZJPQ 2G1HA 4RX6A 1IKXA 1RBAA 4CI0B 5L1JA 2LP4A 4EYHB 2UUCF 1RLCL 3H8YA 3MCMA 1FEEA 3ZTQA 1Q5VA 1Y9OA 1HPZB 3C6UB 4NLXA 2RF2A 3UO0A 3C19A 3TZYA 2DXFA 3Q8UA 1XERA 2W7PA 1T0TV 2Y1LB 1WOOA 4DUZJ 3WC2A 1RWVB 3CCVS 1S1WB 2QRRA 2IIHA 3IR6B 3IXQA 2CQGA 3OD2A 3H5YA 3CO0P 3BQ1A 1YJ9S 4K4VA 5T14A 1RT4B 3MMJA 4ZVUB 4ECRA 5I42B 5GAGU 1GNKA 3PRBA 2JLGA 3MPDA 3M4XA 4Y0FA 4ECVA 2E44A 2Y0BB 1U1LA 1WKKA 3KLGB 4FN5A 4ED1A 1Y5LB 3RB4A 1K0VA 1SL1A 2HZCA 1RP5A 2CPHA 2HWIA 3I0RB 4ECYA 5FLXU 2HS4A 1KD1T 4M95A 1UJ6A 1VQ7S 2DNYA 2CRLA 3MECA 1HNWF 2YNFB 3O6QA 3JYTA 4RW6A 4ZS6A 2CNKB 5CABA 1CEZA 1HWIA 4EBCA 2L41A 2EC2A 2RDDA 1VBXA 1N4LA 2DCLA 2H5JB 1ZM3A 3M8WA 3P6YC 1V3ZA 3T5JA 1IR1A 3A1YG 2LA4A 4EEYA 4MTPA 1FDDA 3QZ7A 1RWWB 3G82B 1FFGB 3QBCA 2XB2D 4C3KA 2ZNYA 1LOUA 2VKRA 2JNJA 4TNOA 5DG8A 2PMHA 3LF0A 4O3NA 1VMBA 2A3JA 4DV4J 1FESA 1XWLA 3MPVA 3H25A 3SV4A 4G1QB 1RU1A 1SH2A 1VQLS 2UXBF 1VHFA 3SEOA 5CQGA 3Q0AA 1ZPWX 1HBNB 1VK3A 5C24A 5CZXA 3CC4S 2CQHA 4X64F 4ID8A 4Z7CA 3BO2A 3HF5A 3BGLA 3QT8A 2VZ9A 1WC1A 5K20B 2E5LF 1Y4ZB 4IH5A 3JTPA 4I2PB 4YS2A 3W5ZA 2DGTA 1KEKA 4NMLA 4Z7YA 1YRXA 1T03A 4IOBA 5A8WB 3M05A 1JLAA 2VFRA 1C0TB 1UFWA 2RQMA 4DV0F 4ED8A 3QRRA 2HVHA 1WKJA 2XNQA 4NA2A 1FFWB 2BABA 4I7FA 4HHUA 1OYEA 4HEA9 3KJQB 2C2RA 1KFSA 2YKAA 3KG4A 1TUVA 4A48A 3HVWA 3R7BB 4DQPA 3HSJA 1KLMB 2B0GA 2W8LA 3A3PB 3SQGB 3LA0A 4Y2KA 1N0VC 1T8EA 2UVRA 4X4UA 1KQFB 3S8SA 2CZ4A 4FYVB 2DY9A 4HTJA 4I64A 4ZCLA 4OL8A 2RHQB 1N33F 3AA9A 2GHWA 4ZPVR 3W2WA 1F2GA 1R89A 3BREA 3KLEA 2HURA 4N8OA 2OO4A 2LYVA 4OJHA 1YJRA 3CE8A 1RYRA 4GVLA 4NI2B 1U1RA 1YGYA 2OPQA 1TK8A 4ILLA 5D15A 1Q8BA 2HK3A 2CJKA 1UEKA 4RUBA 2PT0A 2XGPA 2GQQA 4JI4F 4LF4J 3BBFA 3R1LA 2MGZA 2I38A 4L3NA 4QYRA 1FVQA 5IT0A 3DM2B 5F41A 2M8DB 4H4OA 4J5OA 5LXRA 1XC9A 3DDIA 2ADBA 1K8AT 4LF6J 4KC5A 4C0BA 2BM1A 1H0HB 3AQOA 1F6TA 3CTRA 4CT9A 1URRA 3ICLA 2RQCA 1G3OA 4UOGA 4GC7A 2OTJS 4LRAA 4JI0J 1GT8A 2BE2A 2D9OA 1IKWB 4PZVA 3SSRA 1SH0A 1DQAA 1V3SA 2J0XA 1HYSB 4ENOA 4HYKA 1S97A 1CJVB 3R5AA 4J91A 1IUJA 4IO1A 4PXEA 2ROPA 4A8XA 4YUDA 3M7VA 4OV6A 2XBPA 5DQHA 2Y9HA 1H3DA 3UDLA 2BJ7A 5L1KA 1S0NA 2XY6A 4WWSA 2OMOA 3TI0A 4DWIA 2G0JA 3O44A 1GX5A 1RTHA 3GYGA 4MKYA 5KFOA 2CQIA 1FX2A 3PX4A 1WELA 2CPDA 2VG5A 1IKVA 1ROFA 4C8MA 3T1HJ 1HBUB 2YH1A 5F9LA 3J7Z5 5H9FK 3IC1A 1N0UA 1R8PA 2CKWA 5GADI 1MW7A 4JI5J 1KHVA 1LWCA 1QLNA 4WK3A 2MJNA 3B78A 1QJHA 4ECSA 2N4CA 3BGFA 3W5YA 4DJBA 1VBYA 2MLZA 3MUVP 2IM2A 4AT1B 1UFKA 2AX1A 2ZH2A 1RWNB 1NJYA 2QL7B 4X4RA 3BDPA 5LSLA 4RW6B 2EBEA 1GXUA 3QT7A 4WTOB 2KKHA 1KHWA 2BE2B 1HHSA 2N7CA 4WP8A 5GAEI 4USIA 1Q4RA 4DFKA 1FRHA 2N82B 5L1LA 2BANB 2M7SA 4LRCA 3KG0A 2H54B 4KB7A 5EWGA 1WG4A 5SUHA 3CMES 4ED4A 1WACA 4I69A 4K8RA 4MYUA 4ZVHA 5KG2A 2R8KA 4DDFA 1YJUA 3BKTA 3Q86A 1E6YB 5LT5A 3KLFA 1RWUA 4AD6A 1RCXB 2B4VA 4DU8A 2IA6A 1YBTA 5I42A 4WKRA 2KN4A 4ZVEA 2K3KA 4P2XA 4O44B 3TNVA 3OUYA 4F4AA 3B6BA 3MPWA 3H7HB 2WOMA 2XLJA 2FY1A 4KHPJ 1FRIA 2QLFB 3M8RA 3GE9A 1AW0A 4PG5A 1MLAA 1JJHA 1LWXA 3CDUA 4FXDA 2M2BA 1KVJA 1W2IA 3F0NA 3K5LA 4QWAA 3IR5B 2Y1RI 4LFAF 3AT1B 1PJ5A 2KDOA 3KLEB 1S59A 4NYOA 4DN0A 3RR8A 3TJ9A 1X4AA 2MY7A 4B17A 4C9DA 3N6NA 2YQ1A 4AXJA 1EETA 1T9TA 4NASA 4P10A 3OVAA 3H20A 4JUZA 1KQGB 1XR7A 2CIMA 3CCES 4QQBA 1RISA 4N56A 3AOCA 2M8HA 4Q8FA 4J9QA 2DHGA 5LJ5Y 2HFVA 4NLDA 3SI8A 2XS5A 2D69A 2CDQA 3H42A 2DR9A 3DHWC 3HPOA 2FTRA 4I7FB 3MMCB 3NBPB 3NGSA 4OHXA 2W2PP 4JYAJ 2HGLA 1NHVA 4QW8A 3OQ2A 4MAKA 1R0CB 4RNHA 2VFVA 3VCDA 1VIOA 4CLSA 5LMNJ 3JQJA 4OX9J 1R8AA 3LOUA 1VLYA 1WG1A 2L48A 1WF2A 2NXUA 2HHPA 2V68A 2EXUA 3SFUA 2KB2A 2JSXA 4M1KA 1SKRA 4IFVA 4RW8B 3O5TB 5B0FA 3V2UC 4DMZA 3TVKA 3IN5A 4J9MA 1Q81T 2VA3A 1CC8A 1CULB 1WEYA 2Z56B 2JEJA 1NKCA 4ZN3A 3PTWA 3M30B 1A0OB 5ETNA 3MFIA 2AZ1A 2ZH1A 2JWNA 2LDIA 3LP1A 4B9LA 1JIHA 2ACMA 2DY1A 1NLKL 2XI3A 3FEXB 7FD1A 5HQMA 2AGPA 5J1EB 5HLFB 3T5HA 4TLQA 3VWSA 4LF7F 2P6SA 4E0DA 1UVIA 1ZAWA 3D6MB 3QGIA 2NPFA 3TP2A 1WNEA 1LQ9A 3GFHA 4X65F 1F9HA 1UEUA 3NS6A 5K9FA 2UVVA 3PO4A 3UW1A 4OV1A 1ELOA 1TL5A 2MDAA 2NREA 4AE5A 1WEZA 2CADA 2HK2A 3NG8A 4FBTA 3ET6B 4PG7A 1BD6A 1RLDA 2VASA 2YNHB 4QJVA 2RHSB 5CYQB 2EK1A 5E5NA 2XO6A 5KFXA 3UDEA 2CPZA 3NS7B 2OLWA 4D3GA 3SFGA 3RAMA 3MMBB 4LSZB 4WF9Q 2HFSA 2A6OA 2C3PA 2OPPB 3FZBA 4UF4A 4ES1A 2R8JA 1UW4A 4Z37A 4A47A 1FEHA 4OYPA 3SQGA 2AEFA 2HHTA 4MJKA 1ZM4A 4DV1J 2VICA 3ZTPA 1PJ6A 4OIXA 3M9MB 2EFNA 3IBWA 4AUKA 5B09A 2UU9J 1FHTA 4IRCA 2E9ZA 5EWFA 3JS9A 1C1BA 1GMUA 2GIRA 3J7ZT 4X4QA 3OR2B 4OZ0A 1UAWA 3W3SA 3TJ8A 4ED0A 2D7SA 2VDHA 2RD5C 3VVTA 4RJVA 3PRDA 4F0MA 5M2PA 2HQ3A 2OPRB 3F73A 1XMOF 3JB9k 2HLUA 5KFKA 3A8JA 1F9FA 4DZ6A 2GMLA 3J7AN 1WF0A 4JV5J 1RT2B 5HVHA 1GMVA 3NP5A 4UOHA 1VJWA 3W60A 1MMNA 4OX6A 2AKWB 4YQWA 1LNQA 1XIQA 1S9EA 4BS2A 1KBRA 2EFVA 3DDKA 4LVOP 4ZVTB 2XLKA 3UQSA 4DN9A 4WFYA 4UY85 2RKIA 1HQUB 2EFOA 2WW4A 4WTYA 4A8KA 2HKEA 3D3CJ 2NXNA 2ZH5A 5AXNA 3L09A 2O5DA 3MOZA 2CQCA 3J80U 2DRBA 1GMWA 1DLOA 2AZ3A 2QZ8A 2LXIA 3UPFA 3BB5A 1XNQF 3FUYA 1TP7A 1ZM2A 2V8VA 3KUHA 1YSJA 2RVJA 4B02A 2PSZA 3DRPB 1NXIA 1TELA 2AX0A 1U0SA 1X8DA 2MZTA 2MLYA 2Q43A 1LXJA 2QSWA 2O1PA 2UZAA 3EVOA 3NXZA 1RE1B 4HH0A 4CLKA 4CH7A 1IJFB 3ILOA 1M5PC 1BQMB 1HW8A 1U48A 1S1TB 1ACMB 1BQMA 3KK3A 2F4VJ 3NL0A 3RR7A 4K4UA 2ATCB 2AD9A 3GFZA 2I9SA 1S49A 2GGPB 4Y00A 3EGNA 3EUNA 1EZZB 4TKTA 4QWDA 4KO0B 2AJ0A 2C2KB 1D9FA 1WWHA 2GJ2A 3DU6A 4EFAC 4B3MF 2A2CA 4L6V3 3CCQS 2WTFA 2LKZA 5D4LA 1CJTB 3CB4A 3UN5A 1W2BR 3CCJS 3DLHA 1C2PA 4N77A 1K0TA 2B3TB 1EKRA 1C4AA 3LO3A 5D8HB 1VDHA 4K4XA 3R5CA 2UXDF 3VR1A 1WI6A 3B82A 3MEGB 3P96A 4JI1F 4MIAA 3MMCA 3NBPA 1O51A 1ZA1B 2ZWOA 7AT1B 1D9DA 2AGQA 2CJ9A 2ZD1A 4URSA 2BKOA 4LF5J 3Q2TC 1XMOJ 2XC9A 1NJXA 4OZNA 2FGCA 1S7IA 4KE5A 2WCXA 1H6KX 3CJ2A 1S0VA 1CVJA 2CQ3A 2BE9B 2M52A 2PFDA 1N5VA 1RT1B 3G4SS 2LQBA 5BXIA 4IKAA 4X4TA 3UN3A 1HHTP 5HI7A 3NGRA 2EWHA 2DHAA 1P8GA 2CPJA 3IA0A 4MH8A 4M5MA 4FS2A 2DIUA 1M1GA 2YPYA 1EKSA 1KOHA 1NMEB 4N7TA 3MR5A 3MR7A 4K4TA 3CCLS 2ZH3A 2DGVA 2ZJRQ 2E5GA 4K2XA 3OR2A 4BWJA 2HQCA 3DLEA 3B54A 5GAGI 2CJQA 4LR9A 4DFJA 5KFWA 1RUSA 2MKSA 4TY8B 3WBZA 5K14B 4G65A 5IT9Y 4RW4A 4IDKB 3QAUA 3WQPA 3OL7A 3V6DB 2KU7A 4Q0BB 3IM9A 3V4IA 4OYIA 2DNMA 3L4BC 5HK4A 2BE7D 3ZZRA 4ECUA 4DCJB 2DTJA 3OR1B 4KFBA 3GYNA 4WXOA 1S5ZA 3FSXA 1SL0A 1VBKA 3H40A 3VAKA 1DZ5A 1ZAVA 5THWA 2A10A 5D3GB 1FKPA 2BV3A 4UT4A 2LECA 2I6WA 1HHQA 2E29A 1W7WA 2I5JA 2RU9A 2DR8A 1RAJA 2ALZA 4DV3F 2B7BB 2B6AB 1D3WA 1KVKA 2N3LA 3AJ1A 1B0PA 5B0AA 3IG1A 5U47A 1JJCB 4UZBA 1IN0A 5HATA 1PYOB 2Z0GA 4HACB 1VRTA 1RKIA 2CWXA 1LWEB 2V50A 3D0GE 1REVA 3NRBA 4K5SA 5KFAA 4YB1P 3BJYA 1R43A 1SB6A 2W4PA 5H9EK 1C1CB 3TUZC 1OY9A 2R42A 2JC0A 3EGVA 3ZTRA 2R8HA 1RABB 1YDLA 2AGOA 3CC7S 1AFJA 2YNGA 1LEOA 2PN6A 4A8YA 2CJYB 2FZGB 3HHEA 6AT1B 3FFIA 3V4MA 2EFGA 3BS9A 2DNRA 3HXMA 5T7LA 1J5EF 1JJ4A 4C8LA 3PX0A 1JLBB 2ASYA 1DHMA 3FMWA 2N3OA 3ZC4A 1NJWA 2ROEA 2QLBB 4P7VA 4DR3F 4F2SA 2JEIA 3UDCA 4MT1A 2OKQA 5F8HA 1A6LA 1QD1A 3I0SB 3VVUA 3OVSA 4Y2MA 3ILJA 2PDAA 3J7YU 1IKWA 1EHWA 2WVFA 3JSRA 4CLPA 2KJWA 3EGZA 1K47A 5DG9A 1RT7A 2YX4A 2ZVIA 1X4FA 4RW7B 4UZCA 3M6VA 4ZVGA 1X9WA 3K7RA 4M5DA 5EX3A 4FF2A 1VBZA 2HHHF 3CULA 3M1VA 3AFGA 2LU2A 3T6BA 2M88A 3CCWA 2CPFA 4XTTA 4DPYA 2VU5A 4KGVB 1MN9A 3U1NA 4C11B 2QC3A 3KK1B 3DRYA 3KXDA 3NWGA 2V8GA 1RB0A 5B0EA 3RRHA 2R9LA 2MGZB 2W4DA 1JLEA 2IJFA 1RJJA 1DURA 2BDPA 1HNXF 5L8RC 3SV3A 1DQ8A 2ZBRA 4NLGA 4U8VA 4TU8A 3EPGA 2ZKTA 5JUMA
chains in the Genus database with same CATH topology
2VJUA 2A6MA 2F4FA 2XQCA 2F5GA 2XM3A 2VIHA 2VHGA 2FYXA 2EC2A 2XO6A 2XMAA 4ER8A 2A6OA 2VJVA 2VICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJU A;  2A6M A;  2F4F A;  2XQC A;  2F5G A;  2XM3 A;  2VIH A;  2VHG A;  2FYX A;  2EC2 A;  2XO6 A;  2XMA A;  4ER8 A;  2A6O A;  2VJV A;  2VIC A; 
#chains in the Genus database with same CATH topology
 3N0V A;  3X3U A;  4ZJQ A;  2DHH A;  4PG6 A;  1VR6 A;  2BJ3 A;  4KKO A;  2G13 A;  3C16 A;  3G6V A;  4F4Y A;  2HHS A;  2GJI A;  3BPD A;  1MU2 A;  2ZWP A;  5JVG Q;  5KFQ A;  2RT3 A;  2KZM A;  4UQG A;  1V3R A;  4UW2 A;  2B9Y A;  1RT6 A;  4O4G A;  2D3O R;  2QTW A;  2E5J A;  3BGR B;  3DRS A;  3FCH A;  1F0X A;  1U0H A;  2PD1 A;  5J2M B;  4Q44 A;  1KLM A;  3TW0 A;  2QX0 A;  4OFZ A;  3DYA B;  2HVD A;  2GC8 A;  4JI5 F;  3M8P A;  5J2P B;  2HSE B;  2VHG A;  4WXW A;  2WHO A;  2DNO A;  1RTJ B;  1O6X A;  3PFE A;  2E7V A;  4B08 A;  4AQY J;  2QA2 A;  3TAQ A;  2E9R X;  2JH3 A;  2CA9 A;  1P9Q C;  2D9P A;  4OZL A;  4CYU A;  3T1H F;  3Q22 A;  1HI0 P;  1ZAX A;  3ZZP A;  2XS2 A;  3M9N B;  2VBX A;  3IP0 A;  1ZM9 A;  5KFM A;  4IUF A;  2M70 A;  4J9N A;  3P4U B;  2LQ8 A;  4JOU A;  1KNZ A;  2B8Q A;  4XDD A;  2FJV A;  3R7N B;  2GO9 A;  4PXC A;  3FBE A;  2XZW A;  3NLC A;  3RBZ A;  2HIQ A;  1BLU A;  4DI6 A;  1WF1 A;  2KRB A;  3RW6 A;  2RB7 A;  4UOF A;  1LWC B;  1I5O B;  5ETK A;  3TYT A;  3F56 A;  4G1Q A;  3THT A;  2W01 A;  3J80 Y;  2HRT A;  3CJ8 A;  3HHK A;  3EYZ A;  2PI5 A;  4CLT A;  1F9E B;  3BKF A;  2F3J A;  2PI4 A;  3IGV A;  2HLT A;  3MM8 A;  4FF4 A;  3UNG C;  2KT5 A;  2XYP B;  1VC0 A;  4EO8 A;  4B3R F;  1PYS B;  3G82 A;  3OXL A;  1X5S A;  3FQL A;  4WP9 A;  2HVI A;  2ZDP A;  3WIV A;  3MTK A;  2RAQ A;  2Z2Y B;  3DGP A;  2H5E A;  1TAU A;  3DOK A;  4RW9 B;  2F65 A;  1WDD A;  4C98 A;  1NDP A;  2CQP A;  3FRY A;  3TUI C;  3BN7 A;  4G6V B;  1C0U A;  2RS2 A;  3PYG A;  2MTL A;  1HQE A;  4JI4 J;  3HX9 A;  2UP1 A;  4LIR A;  1CPZ A;  2ZC4 A;  3KLH A;  1ZA2 B;  4HT7 A;  4K4Z A;  4G1I A;  3HKZ D;  8ATC B;  3CC2 S;  4C8Y A;  1L3V A;  3TUJ C;  3ZTS A;  1FX4 A;  1CQM A;  1FTR A;  1T3O A;  3FCW A;  2VUG A;  4NL5 A;  5KFT A;  4ER8 A;  1TZ0 A;  5SZT A;  2F4F A;  3BR8 A;  2OEK A;  3ISZ A;  4U96 A;  3IM8 A;  1DRZ A;  1BXN A;  2DH9 A;  4J7C A;  1QSS A;  4KGM A;  3FK4 A;  3CMA S;  4MKB A;  3PKY A;  4EUV A;  3HJV A;  1NPP A;  1TV6 A;  4CIO A;  4K0K F;  2X7I A;  1WC3 A;  4V1A k;  1CQN A;  4WYW A;  1X4G A;  1Q0N A;  2CQ1 A;  4XPC A;  5KFC A;  4JV0 A;  3NY0 A;  5C25 A;  3OTO F;  1XN9 A;  2UUA F;  1A9N B;  2DCU B;  2Y1I A;  3RJM B;  5KFZ A;  4Q2L A;  3HVR A;  5HP1 B;  2FHJ A;  2FDN A;  1LWE A;  2HQF A;  3MM6 A;  5KOX A;  4X4V A;  3PW2 A;  4M5N A;  4NXM F;  3CCR S;  4C8N A;  3FSY A;  1U1O A;  1SCJ B;  3QWU A;  4F4Z A;  1UKU A;  2DXD A;  2DGQ A;  2H65 B;  4ZPC A;  3KOA A;  2GVD A;  2ZE2 B;  1NZA A;  2AJQ A;  2YWW A;  5ETO A;  1FFS B;  1FKP B;  1QUP A;  4K2J A;  4X64 J;  5HVG A;  1O5J A;  1SBR A;  3HVT B;  2MB0 B;  1KTV A;  3HHL A;  4X66 J;  4O4R A;  1FDA A;  2WK4 A;  2R2R A;  4PQU A;  1VRU B;  2UXB J;  5I3U B;  2HND B;  5D6G A;  4Y2A A;  2E5H A;  2HNZ B;  2XMA A;  1HMV A;  1IWA A;  3LPE A;  2RML A;  3D7S B;  1UWB A;  3UR3 C;  1DY3 A;  4UUX A;  4B9T A;  2WW8 A;  2HHW A;  3VV2 B;  2QSF A;  3A8E A;  2P8I A;  4WZM A;  1EJ7 L;  2QN6 B;  3RB0 A;  2BRL A;  2ZDO A;  5DGB A;  3PDN A;  2I2Y A;  2VC1 A;  3RBD A;  2IM3 A;  4ETZ A;  2DO4 A;  1Z1Z A;  1BMQ B;  3I56 S;  1GXL A;  1U2R A;  3HT3 A;  4WU2 A;  5KFL A;  1Q53 A;  3V6H A;  4KTQ A;  2NR0 A;  1B70 B;  1RZM A;  2GV1 A;  3TR5 A;  4HI1 A;  1RCO B;  3QIP A;  5A8R A;  1D0E A;  2J6S A;  4B9U A;  2YWK A;  2HNZ A;  2VBW A;  5GAH I;  5ETP A;  3GV5 B;  5I3U A;  1WHV A;  4P9S A;  2JVR A;  1ARO P;  1TKT A;  4KQZ A;  8AT1 B;  2ZUG A;  3DCA A;  3EMT A;  3HZE A;  4CO1 A;  5I3Q A;  2HHH J;  3N28 A;  2AT1 B;  2DH7 A;  5JJB A;  4NA1 A;  3UVJ B;  3M2V A;  4UY8 T;  1DTQ B;  5CYJ A;  2J9D E;  1WHX A;  4QIE A;  2LQJ A;  2MQM A;  5J2N B;  3QSY B;  4O23 A;  2Y0S D;  3D0I E;  3D1O A;  1PC4 A;  1S6P A;  1X9M A;  5KG5 A;  3S7R A;  1T11 A;  3PXG a;  2UVU A;  1KC8 T;  2XTJ P;  3ZZT A;  5IS2 A;  4YOE A;  4JI8 F;  3ENQ A;  1N54 B;  2HNY B;  4OZ2 A;  4Q5V A;  4ZP9 A;  2HBY B;  1N5Y A;  4OLP A;  3V81 B;  1J5E J;  2NSC A;  1X60 A;  2YQ0 A;  5D0E A;  2J5A A;  2UUC J;  2J0S D;  2NZC A;  1G6B A;  1RAC B;  3OL6 A;  2FLL A;  2LLZ A;  2HS0 A;  3VAF A;  1JX4 A;  3M2V B;  4LR8 A;  1AUD A;  3RRG A;  3BSC A;  2JLE A;  2EBG A;  1RWX B;  1S1T A;  2IHR 1;  1RT4 A;  1JQG A;  4GMK A;  5EX0 A;  5IQ6 A;  1K1Q A;  1X5P A;  1VQS A;  3W64 A;  3W7B A;  2XGQ A;  3KJV A;  1NKB A;  4IRD A;  2UXC J;  2BJ8 A;  3L7O A;  1SL2 A;  4NXN F;  2B5J A;  3LW5 C;  4DR7 J;  4I6A A;  4OLO A;  4YY3 F;  2FVP A;  5DM7 Q;  2POK A;  2EVZ A;  2VPW B;  3EJM A;  3HSZ A;  3KLH B;  4KYZ A;  1Q8I A;  2C2Z B;  4CH0 S;  5LMU F;  4CLU A;  4LFC J;  1C0U B;  1QDU B;  3AQP A;  3DXB A;  4NLV A;  1SJ1 A;  1YIT S;  3DOM A;  3MXH P;  1VS3 A;  2E7W A;  5CAA A;  4DQR A;  2ACY A;  1DTQ A;  3RG6 A;  1X31 C;  2ALY B;  4LF7 J;  4CWB A;  1EIY B;  4OI0 A;  1IWG A;  1M5K C;  4H4K A;  2FHO B;  5AXM A;  3RBX A;  1IM6 A;  1RAD B;  1R27 B;  2QIF A;  2ZOF A;  3OL8 A;  4DR1 J;  4HDH A;  3W8P A;  1PG5 B;  1F5A A;  3NOG A;  2PC6 A;  2GS8 A;  4TQR A;  4OX8 A;  3CWJ A;  1VRU A;  4C0O C;  4TU7 A;  3T1Y J;  2C2N A;  2XLI A;  2V4J B;  1U6F A;  1NK9 A;  1H2T Z;  2AMC B;  2OTL S;  4M5G A;  2XMW A;  2K7K A;  3BR9 A;  5BR8 J;  1I51 B;  3WZ0 A;  2HFN A;  1DFD A;  4P2F A;  2MKY A;  4ZA1 A;  1N36 F;  4TXS A;  1RT2 A;  1LW0 A;  3DOM B;  2A6M A;  4FNI A;  4NEY A;  3I6P A;  2BQU A;  2MHN A;  1XR6 A;  2ABY A;  3VZI A;  3J7A 1;  1XR5 A;  4DR4 F;  3MM5 A;  1I94 J;  4PAB A;  5KG0 A;  1R8C A;  4LBI A;  1WEX A;  4ECQ A;  1XNR F;  4S0M A;  4DV5 J;  4F4W A;  4LF5 F;  2B9W A;  4U95 A;  1LFW A;  1U1K A;  1T7P A;  2MEW A;  3TVZ A;  3ISN D;  4DV2 F;  4LQ3 A;  3BZQ A;  2C2M B;  1YZ6 A;  5DZ7 A;  3OUY B;  2AHO B;  3G96 A;  5DQI A;  1JXL A;  4ZIV A;  2VPZ B;  5CYM A;  2J8S A;  2X3G A;  3H5X A;  1BQX A;  2AJ2 A;  2BVZ A;  4HI2 A;  3EXY A;  1AT1 B;  3CDA A;  4KPY A;  2W2O P;  2XCA A;  4QPT A;  4DF8 A;  1CJU B;  1H73 A;  3GJT B;  3C16 B;  4JBC A;  2YKM A;  6FD1 A;  5DLG A;  2V4Q A;  1O0P A;  4QWE A;  2D3U A;  3PG9 A;  1MG7 A;  5BYS A;  1K44 A;  4P74 A;  5HMW A;  4NCA A;  2KO1 A;  3VGS A;  3GJR B;  3L95 X;  4FF1 A;  4NRU A;  4TY9 A;  2XMV A;  4OI4 A;  3G8Q A;  2RU3 A;  3OVB A;  2DGW A;  3D0H E;  3TQ1 A;  3DLJ A;  3IAS 9;  1IR0 A;  1WDT A;  1FD8 A;  3K5P A;  3ZZO A;  3RB3 A;  4O3S A;  3A4T A;  1X4E A;  2V94 A;  2Y8W A;  5HBM A;  4U6P A;  1SUQ B;  2R2U A;  4L74 A;  3LH2 S;  4CO3 A;  2CG4 A;  2DEI A;  4V19 X;  1QE1 A;  3CO9 A;  3T6J A;  5KFH A;  1VQP S;  5HSP A;  2D41 A;  4WP3 A;  5DRK A;  3HD2 A;  2F8M A;  5KG1 A;  1Q86 T;  1SQE A;  2BZ2 A;  3KJN B;  2P9E A;  2IM0 A;  3SSS A;  4UQT A;  5KTQ A;  1TUG B;  3QWP A;  4DX7 A;  1L3T A;  4ZIT A;  1U4B A;  3L7P A;  1CJV A;  1SI9 A;  4BWM A;  4OX7 A;  2PMW A;  3TQE A;  4RUA A;  5CD4 H;  3U27 A;  4PUO A;  2KFN A;  1R8H A;  4WFZ A;  2MKH A;  4Y6I A;  1CBK A;  1HBO B;  1QY7 A;  2CNN B;  3W66 A;  2VON A;  4LMZ A;  2K06 A;  4HH1 A;  4NYP A;  5ETL A;  1H7W A;  5BYQ A;  3MWB A;  2KH9 A;  4J9R A;  4EK2 A;  3AJ2 A;  1UWB B;  3HD1 A;  2UV8 G;  4FVM A;  3UCU P;  1FXL A;  1HMV B;  4F25 A;  4RNN A;  1WOS A;  3D5M A;  4E2F B;  4OYZ A;  4PPZ A;  5G0R A;  3VGV A;  5F8G A;  4JV5 F;  1MNE A;  1D09 B;  4QIG A;  4E8U A;  2XO7 A;  1T03 B;  2FY8 A;  1U02 A;  3GLJ A;  3G8S A;  2LA6 A;  5J2M A;  2PEH A;  4LRB A;  2HFO A;  3DC2 A;  2IA0 A;  3IR7 B;  3DLL Q;  2P6T A;  3PYD A;  1N48 A;  3D1H A;  1EX8 A;  4DS5 A;  1H98 A;  3SCI E;  1NUE A;  4LIW A;  2DBB A;  2QL9 B;  4DR2 F;  2AV5 A;  5ITH A;  4OI3 A;  3D9B A;  2QG9 B;  1KQS R;  4DV1 F;  2DR5 A;  4PWD A;  2IDE A;  1VFJ A;  3C14 A;  4FDF A;  3D54 A;  4GRS A;  4DSF A;  4H4M A;  1Q7Y T;  2GIF A;  2KYX A;  3F44 A;  5E0O A;  1R6V A;  4X84 A;  1FWP A;  3IS9 A;  4PRF A;  4IFY B;  5BJR A;  2YY3 A;  3TAP A;  4A8O A;  2KJV A;  4R5P B;  4EZ9 A;  4ES2 A;  2O67 A;  4LF4 F;  4KHM A;  4YHH F;  1I3O B;  2IC3 B;  3MUT P;  4LSN A;  4OYX A;  5ETS A;  3M8Q B;  3CUN A;  3Q8P B;  3J7Y I;  3T1Y F;  3TUP A;  2QYG A;  4RBT A;  1GH8 A;  3NWR A;  4F3Q A;  3GIJ A;  2RUS A;  5DJB A;  1C4C A;  4ID5 A;  3DLE B;  4JV1 A;  3MMA B;  2KHC A;  2M3D A;  4PG4 A;  4GC6 A;  2VB6 A;  3M2U B;  2XG8 A;  3GIK A;  1VRQ C;  4ECW A;  3PY8 A;  5ETV A;  1CJK A;  2P2C B;  5KT3 A;  5GAH U;  1KLN A;  1E6V A;  2E1M C;  2F8H A;  4A46 A;  1QE1 B;  1GQE A;  2BRK A;  3G6E S;  2KYZ A;  3ENA A;  4U7C A;  2IRY A;  4I67 A;  1N32 F;  2HW3 A;  5E7O B;  1H72 C;  1QAJ A;  1TMJ A;  1LXN A;  2CVE A;  5HBM B;  5LMU J;  2MPU A;  4YY3 J;  1CSJ A;  1JLG B;  4C11 A;  1VQN S;  1JLB A;  3O1L A;  1SQF A;  3PFO A;  3T41 A;  4BBY A;  3X1L B;  1NZ8 A;  4YHH J;  3MEG A;  4DV0 J;  2YNG B;  1J27 A;  1HNI A;  1HWU A;  4UUW A;  1YG0 A;  4N76 A;  1T95 A;  2YTC A;  4HL9 A;  1R3N A;  4ILR A;  2FLN A;  5D77 A;  1HQ2 A;  5B7W A;  2ZH4 A;  1TL4 A;  4ZCI A;  1RT3 B;  5DQG A;  2APO A;  2FVC A;  2R2T A;  2E5L J;  2ZIT A;  4Q45 A;  1IJE B;  3CNQ P;  5FDL B;  3QJP A;  3VF0 B;  1CJU A;  3HKW A;  3UI3 A;  2F9J A;  4MMO A;  1Y5I B;  4USH A;  4DR6 F;  2HVE A;  3TX8 A;  5DDR C;  3H4B A;  2JL9 A;  4DPX A;  4JI8 J;  3LUY A;  1S6O A;  3NCR A;  3M8Q A;  3WHI A;  3HHN B;  2MZJ A;  4HHH A;  3HM9 A;  1YJV A;  1QSY A;  2NSB A;  4NPO A;  4KV8 B;  4IOC Q;  4CO5 A;  1IBC B;  1WUU A;  3A13 A;  2OGU A;  3HHL D;  3UDV A;  2JEF A;  7FDR A;  2XCP A;  2MHE A;  5E2Q A;  4F04 B;  5J2P A;  2OH2 A;  2YXL A;  3FEZ A;  3UWT A;  1FNO A;  1SQG A;  2G0I A;  2R7O A;  2KT2 A;  2V4R A;  2ZUA A;  3DM2 A;  3MHY A;  4ZN1 A;  3DNC A;  4HAC A;  4J9L A;  3EZU A;  3FNN A;  1HKA A;  4YR0 A;  2V8D A;  4FP9 A;  3MAA B;  5FII A;  4ICL A;  2ZZN A;  1UW9 A;  3GFX A;  3D6F B;  2DPI A;  1WC0 A;  4KGX B;  4TYB A;  5E3C A;  2EPI A;  2K7J A;  5C2G A;  3MTJ A;  5HMX A;  4WFN Q;  3PHT A;  2VOO A;  1TL7 A;  1VHI A;  1SH3 A;  4MK8 A;  5HVF A;  1M90 T;  3E3X A;  5B0D A;  4B9M A;  3EVM A;  1TFW A;  1FKO A;  4LRD A;  1UVL A;  3QLH A;  1OMS A;  3SDE B;  3W2V A;  2ZFH A;  2DRD A;  2I0X A;  2CJA A;  2HEK A;  4H4K C;  2HGM A;  1RBO B;  2MY8 A;  4OQJ A;  2AU0 A;  1IQT A;  1WOP A;  1ZOT A;  5F8I A;  3OSP A;  4I2Q A;  1N34 J;  2UV8 A;  4CLF A;  2F1F A;  2NZ4 A;  4IDK A;  2FD2 A;  5L38 A;  2AP6 A;  2F63 A;  2HQI A;  4QIF A;  1R6Y A;  3FSI A;  3UCZ P;  4MIB A;  5A6P A;  2K1R A;  5A8K B;  4A8F A;  2UVW A;  4IYQ A;  1NH8 A;  3PJX A;  3MUR P;  1T05 B;  1U26 A;  1TVR B;  1S9G B;  1JLA B;  3MR6 A;  1RBL A;  2DH8 A;  4HTI A;  1YTY A;  3QJL A;  1NO8 A;  1YJT A;  5KFF A;  1UL3 A;  3VAI A;  1VJQ A;  1RHJ B;  2XYH B;  2FPH X;  3I5A A;  3SBM A;  2BUN A;  4L76 A;  1N5T A;  4DPW A;  4GO5 X;  5IM0 B;  1HBN A;  1TTH B;  2F8E X;  3DOL B;  3VTI A;  4DL0 C;  1ZTW A;  2MZS A;  4P2S A;  4C0H A;  3GON A;  5C42 B;  3THP A;  1FNX H;  2ZD1 B;  1P1T A;  3LP0 A;  5M2R A;  2XM3 A;  4DUY F;  4M5K A;  1FRL A;  2LXF A;  5T7L B;  1KVI A;  4X2B A;  4ZOS A;  1FWL A;  4X4P A;  5L9X A;  4AXI A;  2J9D A;  2YKN B;  2P9G A;  3LAL A;  1U1Q A;  3VAL A;  4DV7 F;  4DV2 J;  2DNZ A;  3TAM B;  4K0K J;  1DAR A;  1Y3K A;  1NBE B;  1FJE B;  1CJT A;  1OSD A;  4OHZ A;  1VOM A;  3DRP A;  5I4M A;  4P72 A;  4OYM A;  4U9R A;  3VQT A;  1RTI A;  2AF6 A;  2BBE A;  1PC5 A;  3DLK A;  5J2N A;  1L3S A;  4DR4 J;  2Q3P A;  3CJK B;  1ULR A;  3GPA A;  3DLB A;  2DT9 A;  4DFM A;  1S4E A;  2BX6 A;  2GGP A;  4I68 A;  5KT2 A;  3G71 S;  1ZET A;  4Z2X A;  4M94 A;  2KZZ A;  5ETT A;  3LAN A;  3KK3 B;  1VIX A;  5D3G A;  5J1N A;  2R7U A;  2A0F B;  4KY3 A;  4OJG A;  4PQA A;  1WKL A;  2CNO B;  1FRJ A;  2ZHB A;  2MYF A;  1B4S A;  2GHV C;  2FC9 A;  2IBO A;  1XEZ A;  4DU7 A;  3CCS S;  1T9W A;  3N9U C;  1UMJ A;  2FZC B;  1S4F A;  3H2V E;  4A8W A;  1UA0 A;  1IVZ A;  1S1U A;  3H5U A;  5A8R B;  3MED B;  3M6W A;  4WJB A;  2NQP A;  4DR1 F;  3JXO A;  3Q8V A;  2Y1J A;  1N8R T;  1Z4U A;  3FCV A;  1DLO B;  2FC8 A;  4I1T A;  2BJE A;  1RXO B;  4RW8 A;  4IFV B;  2GVZ B;  5K14 A;  3I55 S;  2Q6C A;  2OPR A;  3D3B J;  1V9O A;  3L3C A;  1SC4 B;  5CD4 A;  1G2E A;  3PRV A;  2Q1L A;  3UE2 A;  1HNV A;  3I4H X;  5KFB A;  3MM7 B;  3KLI A;  2Z2L A;  2IVY A;  5E3Q A;  1NJI T;  3G9C A;  4P73 A;  3NAI A;  4P6Q A;  3KYL A;  4EI2 A;  3EVW A;  3NMR A;  4ZLN A;  2AJF E;  2R3V A;  2KXN B;  1RT1 A;  2K3I A;  1PIL A;  1NEE A;  4FVC A;  5KG6 A;  4RUC A;  1KRP A;  4I0W A;  1GXT A;  3TEH B;  1TKX B;  1X0P A;  2BMB A;  3KK2 A;  2R7W A;  2G2Z A;  2LEA A;  2WRM A;  1FE4 A;  4C3M A;  3P49 B;  2DVI A;  2HBR B;  3IGN A;  3GV8 B;  3RAQ A;  3M6U A;  4Y2I A;  3W61 A;  3MMB A;  2O66 A;  3BH7 B;  4AL7 A;  2FJE B;  1HNV B;  3ADA C;  4J9U E;  2QFJ A;  4KH0 B;  1EQM A;  3SMZ A;  3AB4 B;  1QM9 A;  2Q79 A;  2WSF C;  1KTQ A;  1RAA B;  3D68 A;  2GVZ A;  3Q83 A;  1MWY A;  4PXD A;  4DV4 F;  4ICL B;  4ZPW R;  5C25 B;  1NK7 A;  1FT8 A;  2V2Z A;  3Q23 A;  2OFH X;  1N34 F;  4CCH A;  3MED A;  3ELH A;  4MIW A;  3R8Y A;  4NLQ A;  3GG1 A;  3IRW P;  1PIE A;  1TQL A;  1TV6 B;  3HFV A;  1W25 A;  2VQE J;  4NA3 A;  2ZC3 A;  4J9V A;  3K5M A;  2J0W A;  1X4B A;  2HQD A;  4HVZ A;  1J5O B;  5LJ3 Y;  5GMD A;  5AXL A;  5K8P A;  9RUB A;  1RAO A;  5J1E A;  1I1G A;  3H4D A;  4GVB B;  3V81 A;  1FXD A;  3GSI A;  4NZ7 A;  3QZ8 A;  1YZ7 A;  2BAN A;  2ZZT A;  2GIQ A;  5EWE A;  4ED3 A;  2V69 A;  1HR0 J;  5EUH A;  2HNY A;  1HNW J;  4FYY B;  5AXK A;  2WVC A;  3DRX A;  1KP6 A;  3T5L A;  4F02 A;  3J81 Y;  5DS7 A;  2GQC A;  2BW7 A;  1HL6 A;  4N41 A;  2CG8 A;  5KOW A;  1HQE B;  4QU7 A;  5KFY A;  1RK8 A;  4IG3 B;  3MD1 A;  4RNF A;  1WG5 A;  2DYA A;  2KM8 C;  4QU6 A;  4DXL A;  5E3R A;  4LF9 J;  2V2Q A;  3P45 B;  5LM7 E;  3ITH B;  3T9N A;  1REG X;  2JDJ A;  1T02 A;  3QFH A;  3FEY B;  2XY7 A;  4WFB Q;  1VK8 A;  4IH6 A;  4ZIW A;  2BXJ A;  1AZS A;  2GW8 A;  3T5K A;  3Q8S B;  4DOZ A;  1DTT A;  5MAO A;  1PSD A;  1PCA A;  3W1Y C;  1XK8 A;  3E01 A;  5F0U A;  3ZTO A;  5C42 A;  3SSQ A;  3PJW A;  2HVZ A;  1S9E B;  4J37 A;  5H1S V;  4DUZ F;  1WC5 A;  4EU0 A;  1FJG F;  1IM4 A;  2H51 B;  3GFY A;  3KDN A;  1S72 S;  1Z2Z A;  1R7I A;  2EFQ A;  4A8S A;  4B3T J;  2FLO A;  4DSK A;  2MKC A;  2MSS A;  3R1H A;  2BOA A;  2HAF A;  3DLG B;  3JSM A;  1Y7P A;  3CDE A;  3ZZY A;  3SYZ A;  1FD2 A;  3OFE A;  4YN3 B;  2W9C A;  4OYO A;  2I1R A;  3HI9 A;  1BHN A;  2WVD A;  4PG8 A;  3AHP A;  1MML A;  1SJR A;  1U2C A;  2B9E A;  4RPF A;  4WE1 A;  5GME A;  1TVR A;  1RYS A;  4ES3 A;  3FGV A;  1UEV A;  2QA4 S;  3K17 A;  1YJN S;  1SKS A;  1C1B B;  2J7U A;  5A8K A;  1Q78 A;  1RTJ A;  3D6H B;  3Q8Y A;  4K4W A;  2AQ4 A;  3G2X A;  3M8P B;  4J9K A;  3K58 A;  3DN9 A;  2IYI A;  4PWW A;  5IC4 B;  2UUA J;  1RHK B;  4X62 J;  1LKZ A;  2MZ1 A;  2JEG A;  5FJ4 A;  3N79 A;  3BGR A;  2KVI A;  3DRS B;  5G4D A;  4C8K A;  1N32 J;  2M5Y A;  5B0B A;  1RTZ A;  2J7K A;  1GTE A;  1FDN A;  2LQ9 A;  3BPS P;  3IS9 B;  2XSJ B;  3QLH B;  3SDE A;  3TA0 A;  3W2V B;  5GAD U;  2L08 A;  3MFH A;  1S0O A;  5B0C A;  4ILM A;  4IG0 A;  3HFZ B;  4BLG A;  1SXL A;  3OTE A;  1K73 T;  3NNA A;  2R4F A;  2RDI A;  1S79 A;  2LMI A;  1L5U A;  4RBV A;  3RGI A;  2XSJ A;  4DL2 A;  1S10 A;  4JI7 F;  4DL3 A;  4ANC A;  5HO4 A;  1YIJ S;  3TVY A;  4YP3 A;  2FHK A;  2CPI A;  2JX2 A;  1ZYQ A;  1D1U A;  2F7V A;  3IWL A;  5D78 A;  4C6A A;  2CYY A;  3KLF B;  3JTO A;  2E1R A;  2DGX A;  2HQG A;  3PR4 A;  4USK A;  5E3A A;  4GKK J;  2IY5 B;  4FBU A;  3IO1 A;  5K5M A;  4CLZ A;  2HPU A;  5CHC B;  4PWU A;  3DFE A;  4QCL A;  3EWG A;  1S12 A;  1RTH B;  3LP1 B;  4X4S A;  4WE1 B;  4DR2 J;  4KHR A;  1KSP A;  2Y8Y A;  3C8Y A;  2I8E A;  4PYA A;  3UR0 A;  2MZR A;  1VQ6 S;  3I0S A;  2LU1 A;  1V5V A;  2IVF B;  4JI1 J;  4DV7 J;  3FRZ A;  1LWF B;  2B56 A;  4OJ3 A;  5K8N A;  3WDO A;  4CM0 A;  3DXS X;  4PR6 A;  4YB7 A;  1WSR A;  3M32 A;  4FYW B;  3DOK B;  4RW9 A;  2C2O B;  4ZVS B;  5KFP A;  2OP5 A;  3ILL A;  2IJR A;  4RL1 A;  2PFF B;  1ZPV A;  2GJF A;  4DZD A;  4EWT A;  3MR3 A;  3PIO Q;  1SUQ A;  2WZ1 A;  2Z2M A;  1BGX T;  2EKN A;  4XK8 C;  4F4K A;  1T9V A;  2VG6 B;  4R8U B;  3OHB A;  2E9T A;  3I5B A;  3OFG A;  1JLG A;  3UD4 P;  1YLX A;  2HZA A;  2V5H G;  3GTY X;  2F4V F;  2KTQ A;  4DV6 F;  4N5S A;  1FNM A;  3D2W A;  2XHC A;  3CD6 S;  1G4C A;  4JI3 F;  5CH7 B;  1EET B;  2QV6 A;  2J6U A;  4WZQ A;  3IG1 B;  3UCG A;  1V6H A;  2CZV C;  4E98 A;  4AL6 A;  2B6A A;  2YNF A;  2NXE A;  1OS5 A;  2H48 B;  1WC4 A;  1YRT A;  2VPX B;  1VQ5 S;  1FRK A;  3CT9 A;  4C3L A;  5E41 A;  2JJ4 D;  2Z30 B;  2DNG A;  4NLW A;  3ZXW A;  4DHV A;  5KFN A;  1JB0 C;  2WOM B;  3R7S B;  2VIH A;  1M5O C;  2UUW A;  3BV8 A;  3DYA A;  1NK8 A;  1HNX J;  3VGT A;  3BSN A;  2RSQ A;  3PIP Q;  4RNM A;  1RWP B;  2WSE C;  3TA2 A;  2DO0 A;  2GCF A;  4CLY A;  4ZLP A;  2DGU A;  4QR1 A;  1DAX A;  1OYD A;  2E1P A;  2CJB A;  2QYC A;  3U7J A;  1UET A;  3OT9 A;  2KXH A;  2W2M P;  4AFF A;  5L1I A;  5F8N A;  2YPZ A;  2UUB F;  1EQ0 A;  1X4C A;  2CJX B;  1T3N A;  1HBM B;  3C6U A;  1UFL A;  2AJ1 A;  1UJ4 A;  1PBA A;  2W1B A;  3NAH A;  5D4O A;  2B4U A;  2E1A A;  5EHH A;  1JJ2 R;  3QGG A;  1VQK S;  3DLG A;  2JLF A;  1TKD A;  1NDL A;  1I6J A;  5HN0 A;  4A8M P;  2Z2Z A;  2Q6B A;  1PJ7 A;  3DGV A;  1HFE L;  2KI2 A;  1JLC B;  4NLS A;  2JZ5 A;  5C24 B;  1Y3J A;  4DR5 F;  4DL4 A;  1APS A;  2HWH A;  5LSO A;  3EX7 B;  3AD9 C;  3KK1 A;  1D8Y A;  1NSQ A;  4CZC A;  1NDC A;  3K2Y A;  1HLW A;  2NYI A;  2FJB B;  2FJD B;  1HBU A;  2WON B;  3P5T L;  3Q89 A;  1KDN A;  3EZO A;  3QYY A;  1IKV B;  3LGN A;  3ULH A;  2UU9 F;  1TL3 B;  3MM9 B;  2N7Y A;  3T19 A;  4CRJ A;  2FIU A;  3T1A A;  3AD7 C;  1U2F A;  2ZBP A;  4DLG A;  4NZ0 A;  2H9Z A;  4RW7 A;  2QT7 A;  4AL5 A;  2J76 E;  4ZLJ A;  3QAT A;  3R5J B;  1KON A;  4BC9 A;  1Y10 A;  1VGY A;  2PE8 A;  3CF5 Q;  3PW0 A;  4B9V A;  3R2C J;  3M32 B;  4LRE A;  5IFM A;  2GZO A;  1VI7 A;  1U47 A;  4M63 A;  4PUO B;  5F9N A;  4G3I A;  3T3F A;  2OEJ A;  3TEG A;  4IR1 A;  1URN A;  3GCW P;  3RW7 A;  4W98 A;  1NU4 A;  2PO4 A;  5A0Y A;  3ZO7 A;  2G0C A;  1VQM S;  1F5C A;  1QVG R;  2HHU A;  4A4J A;  5F0W A;  1QTM A;  4DX5 A;  1DTT B;  5KFI A;  3B4D A;  1MMD A;  4JI6 J;  1PAU B;  1PAE X;  2YNI B;  3K5O A;  6FDR A;  1UA1 A;  4W90 B;  4OZ3 A;  3IWX A;  1IBK F;  5KAK A;  1X7V A;  4LFB F;  4ZPD A;  3GIM A;  3PYE A;  1GX6 A;  4X65 J;  1EB0 A;  3KHR A;  2DIT A;  2WB1 D;  4RO0 A;  2B9X A;  2GFF A;  3BN4 A;  1WD6 A;  5IC6 B;  3US5 A;  4C8O A;  2D3O 1;  1P6T A;  4QW9 A;  4OI1 A;  3SCL E;  5KG4 A;  2BAC A;  3JAM Y;  4DLE A;  3GCX P;  4R25 A;  3LWL A;  4BC7 A;  3BYR A;  1U1P A;  4JI6 F;  2KL8 A;  2VOP A;  1RSC A;  5K8M A;  3VQS A;  3OJU A;  5H9E J;  4KSE B;  3K0J A;  2YX1 A;  4EBD A;  2QA1 A;  4LBH A;  4B3O B;  1P9Y A;  1SV5 A;  1FJC A;  3TRG A;  1HIY A;  1HQU A;  2NPI A;  3OW2 R;  5I3P A;  2DNQ A;  1IKX B;  2ASD A;  2DHX A;  3KLG A;  2DPJ A;  2PA3 A;  2RRN A;  3LP2 B;  2R7R A;  3VAJ A;  4WKY A;  4FKY A;  2XI2 A;  1XMQ J;  2HRU A;  2L9D A;  4DX6 A;  2YKP A;  3UVJ A;  2OEL A;  4NLU A;  2RH3 A;  1BWE A;  1UCN A;  3KNG A;  5CXT A;  2BKN A;  1S0M A;  4DSJ A;  2G9O A;  2IFX A;  4LRF A;  1KS2 A;  1TKT B;  4F4X A;  1YRU A;  3QID A;  4Y2C A;  3UNY A;  2QFI A;  2W4C A;  3VZH A;  2ERR A;  1QUV A;  2ILY A;  4FPR A;  3TAN A;  2XS7 A;  5GVQ A;  2GX8 A;  5KFG A;  2AJ4 A;  3MCS A;  4YB5 A;  3TJA A;  4DR5 J;  1S9G A;  2PMZ D;  1RT5 B;  2UXD J;  3BSA A;  3N6L A;  1MN7 A;  5KFS A;  2OEM A;  2VF3 A;  3C6T B;  4F26 A;  2X1A A;  2ZM6 F;  1M5H A;  1HWJ A;  4I2P A;  3VGU A;  3BBB A;  3SZ2 A;  4OHY A;  8RUC A;  1G1X A;  4NX9 A;  4LFA J;  2IRX A;  2DB1 A;  1RDR A;  2BW2 A;  1W26 A;  1YK9 A;  5FLX Y;  2V4J A;  3DRR B;  1OQ6 A;  4KGK A;  4M5H A;  2V34 A;  3NNH A;  3G8T A;  5L46 A;  4U7U D;  2CNL B;  3HCX A;  2CVI A;  4FXW A;  4HLB A;  3KKF A;  5KFV A;  3V6K A;  4USW A;  4CTA A;  2E7X A;  4EGL A;  1SV5 B;  2LVW A;  3WIU A;  2RS8 A;  2XMT A;  5LL6 d;  1U49 A;  1TKZ A;  1H38 A;  1U6B A;  2ZH7 A;  2GMH A;  1OQ3 A;  1XQI A;  1LK7 A;  3KFW X;  1NH7 A;  2VD3 A;  3BEG B;  4F7V A;  2IMW P;  2MXY A;  3RYL A;  1OJ4 A;  3OHA A;  2C28 A;  4IH7 A;  3JYT B;  2ZJQ Q;  1XNQ J;  4J90 A;  1LK5 A;  2RRA A;  2XMK A;  3CJ0 A;  1S6Q A;  1HW9 A;  1S1X A;  2VFU A;  2YWE A;  2OSQ A;  2LEP A;  3I82 A;  3CGI A;  4Y28 C;  5B08 A;  1PGZ A;  1NKE A;  1NK6 A;  2AYE A;  2VKZ G;  3KJV B;  3MAQ A;  4ZCM A;  1UVK A;  2YKN A;  3M8S A;  2AYB A;  2CAJ A;  2MQ8 A;  3UD3 P;  4IOA Q;  2FJX A;  2Z57 B;  5E33 A;  2QMU B;  3EPI A;  4BDP A;  3NCQ A;  1AB8 A;  1ITP A;  5A0Y B;  3M30 A;  4U67 Q;  2EFP A;  4DQQ A;  2LFV A;  3GWC A;  1H2V Z;  4FKX A;  2HHV A;  1N5Y B;  4DL5 A;  3M8Y A;  4ANE A;  3NKY A;  1RT3 A;  3D67 A;  2IBK A;  4ZVR B;  2RF2 B;  3ZFV A;  5KFU A;  2OAU A;  4BHQ A;  5LXY A;  1NND A;  2MKJ A;  1Z2L A;  3GIL A;  3FJ2 A;  4MYT A;  2FZK B;  5IT9 U;  1U1M A;  3AB2 B;  5F8J A;  2Q66 A;  4J9O A;  3EXC X;  3QQC D;  1Q7L B;  2MZQ A;  4PXB A;  2ZH8 A;  2AEJ A;  5KFD A;  3QAE A;  3DRR A;  4DV5 F;  4L3K A;  1ZH5 A;  3KDO A;  3EIC A;  2DD8 S;  1FXR A;  5DDO C;  2MQP A;  1QSL A;  3KUE A;  1TMM A;  4ZPT R;  2XWX A;  2L9N A;  2CQB A;  3HDS A;  1R31 A;  3CXC R;  2DK2 A;  2HAI A;  2O3D A;  1XMQ F;  2K2P A;  4NXM J;  2HGN A;  1FCA A;  2VDI A;  3C6T A;  3O2I A;  5GAE U;  2BOP A;  3A8K A;  3PEJ A;  3UFC X;  3MM7 A;  2ZBI A;  2MQL A;  1OWX A;  3C15 B;  3MI7 X;  1IKY A;  3M2U A;  3QIP B;  3CCZ A;  2YH0 A;  2LXU A;  3R27 A;  4R0E A;  4LJM A;  3J81 j;  3RU0 A;  1OPZ A;  4C48 A;  3DKD A;  4O3O A;  1Q79 A;  2M0G B;  4U7U K;  2K1R B;  2XYG B;  1QAX A;  2QLX A;  4RKU C;  3HT0 A;  4XO0 A;  2LQ5 A;  3J81 U;  1H2U X;  4O3R A;  4O44 A;  3HJF A;  1O8B A;  2CUY A;  3ZNJ 1;  4LSL A;  2AW0 A;  2VL1 A;  2XZT B;  4ZDN A;  1Y0H A;  3CJR A;  4MK7 A;  4DL7 A;  2VFS A;  3K8V A;  5KG7 A;  5F3T A;  2ZVS A;  4HHJ A;  1AA1 B;  4QWC A;  4DG1 B;  2HND A;  3H59 A;  3W62 A;  1H74 A;  1VC5 A;  1VC6 A;  2FHM A;  4ZMM A;  4LFB J;  3BBC A;  3C14 B;  3WX4 A;  2CQ4 A;  4J9S A;  3OFF A;  4PWD B;  4NZ6 A;  3R97 A;  3PEH A;  2EW9 A;  2YNH A;  5CYQ A;  1N6Q A;  4DR7 F;  2ZBQ A;  4AYB D;  3ET6 A;  1FWK A;  1FRX A;  3DLK B;  4WYL A;  1GEH A;  3PW4 A;  1YBA A;  3MAA A;  1CG2 A;  2RNE A;  3OV7 A;  3CJT A;  3TAR A;  3CJS A;  2H3E B;  3HUL A;  5KFE A;  3C46 A;  3MM6 B;  2U2F A;  3TZW A;  4CLW A;  2XHW A;  5CA5 A;  3HK2 A;  1AYE A;  4I6Y A;  2R7S A;  3IBC B;  2EC0 A;  5JMN A;  2IAJ B;  2F40 A;  1GMW D;  1NSP A;  2FJW A;  2XUL A;  3LPY A;  2R7T A;  3N01 A;  1HNI B;  5LMN F;  1D8Z A;  4AND A;  3P8B B;  4WU3 A;  4FS1 A;  1NJZ A;  4GO7 X;  4F3O A;  2ZOG A;  3MCN A;  1IBM F;  2H4W B;  3RBE A;  1PBU A;  3LP0 B;  1R0A A;  3OXG A;  3QRQ A;  1HWK A;  4KT0 C;  3AOB A;  4U8Y A;  3M9O B;  1ZTT A;  3BSO A;  3PO5 A;  4DSL A;  2B7C B;  5F8L A;  4MFB B;  3EZ5 A;  3L9Z A;  2A2D A;  1LV5 A;  5FDL A;  4O0N A;  5J2Q A;  1KFD A;  3BH6 B;  1WTB A;  4M5L A;  4Y3C A;  1B3T A;  2ZNZ A;  1HYS A;  1ICE B;  4EBE A;  4C7Q A;  3R6G B;  1FF2 A;  4KPC A;  3H2U B;  3W8G A;  1MWZ A;  1M1H A;  4ETX A;  3CCM S;  1S9F A;  3KTQ A;  1OSC A;  2F5G A;  4DSE A;  1B7F A;  2ILZ A;  2RIL A;  3I32 A;  4ID5 B;  4K59 A;  4LF8 F;  5KT7 A;  1RHU B;  2WBM A;  2DKO B;  2DNL A;  2D3Z A;  2V9K A;  3AA8 A;  3DGP B;  4USV A;  2RQ4 A;  2RQK A;  5KT5 A;  4H4O B;  4RBU A;  3PR5 B;  3R5B A;  1FI4 A;  2XY5 A;  4I2Q B;  2FVR A;  3FFI B;  2L9W A;  4NCG A;  4CM2 A;  2XMM A;  3AOD A;  4ERD A;  4YFU A;  4A8Q A;  2K8G A;  2OIH A;  2COL A;  3D4J A;  1UJ5 A;  2HHX A;  2DNH A;  1BE4 A;  3I9V 9;  1FKO B;  2X3D A;  4QWB A;  1C1C A;  3IWN C;  2EEY A;  4TLR A;  1NHK L;  1CJK B;  1B0V A;  5DET A;  3UN2 A;  2WAQ D;  1TL7 B;  3GSD A;  1JKH A;  1OO0 B;  3W9H A;  4LF1 A;  1UVM A;  1D9A A;  4B9N A;  1HBM A;  2E5I A;  3L7U A;  1NPR A;  3MF5 A;  3MMA A;  4ZKA A;  4DR3 J;  2HZV A;  2YWF A;  2PA8 D;  1G7C B;  2MLX A;  2OJ3 A;  2H1Y A;  2YKO A;  4P2M A;  4L73 A;  4LSN B;  4X66 F;  1M1K T;  5EDW A;  1FE0 A;  4ZVQ B;  3RB6 A;  3KNA A;  2W8K A;  2VQF J;  1BWV A;  5HQ8 A;  2W9B A;  4F36 A;  3Q24 A;  5J1P A;  2W9B B;  3KHL A;  4DQS A;  2ZHO A;  2CPY A;  4H4M B;  1YI2 S;  1S48 A;  1BQN B;  1UWA A;  2JFK A;  3N4W A;  3K5N A;  3V4I B;  1AXQ A;  1U0H B;  4ALZ A;  4KV8 A;  4OZJ A;  3GIR A;  3OTD A;  2DRA A;  1IR2 A;  3G86 A;  3KMS A;  3FQK A;  1RT6 B;  4HKQ A;  3O3L A;  3JAM U;  5IV4 A;  3QMQ A;  3QO9 B;  2W9C B;  5HAO A;  4KR0 B;  1DJ0 A;  5F8M A;  4O0I A;  3FBC A;  3GG0 A;  3Q2S C;  1MWQ A;  1IXK A;  4Y34 A;  2MQN A;  5HRO B;  3OTO J;  2RDJ A;  3VAH A;  2JVO A;  3PV8 A;  2C2D A;  1U1N A;  1VQ9 S;  4DS4 A;  1S6U A;  1PYT A;  1S57 A;  3FZ2 A;  4LBP A;  1WOR A;  1FER A;  1XJW B;  3AOA A;  2C22 A;  3E51 A;  4YEA A;  2VG6 A;  4R8U A;  1RKJ A;  3D28 A;  3RUB L;  1HD0 A;  2J9E A;  5IV3 A;  5A2Q U;  2VG5 B;  1LW2 A;  3U1M A;  2VOD A;  2HRY A;  3MEE A;  2O01 C;  3G6Y A;  1A7G E;  3CDB A;  3PW7 A;  2YBV A;  1FRM A;  4FYX B;  4IRK A;  2KG0 A;  4F0K A;  2U1A A;  3BKU A;  2BKP A;  5LOQ A;  4W4M A;  1YX2 A;  4IO9 Q;  1UVJ A;  1AFI A;  4Q2M A;  1KKH A;  1VIS A;  5IXU A;  4ED7 A;  2ZKU A;  3OTB A;  2R8G A;  1SPB P;  3I87 A;  3JQM A;  3OXF A;  2NS1 B;  2GNK A;  3GJS B;  1JNZ B;  1E6V B;  3P5B P;  1RT7 B;  4Q7A A;  2DHS A;  3Q8Q B;  3GQC A;  4QPX A;  2ATL A;  1RWK B;  2MJU A;  2B5J B;  2G2Y A;  2QJ3 A;  2QGF B;  3JQK A;  4OI2 A;  4ZVO B;  5AT1 B;  4DPU A;  2R8I A;  4FF3 A;  2HFZ A;  4WPA A;  2RUG A;  4CO4 A;  4CNY A;  5GMK a;  3GII A;  2V8H A;  4F50 A;  4EO6 A;  1J5O A;  3OLA A;  4NCB A;  2QL5 B;  1GTH A;  4L75 A;  3HZG A;  3JTN A;  4N8N A;  5MLC V;  2IC3 A;  3PM9 A;  4ZPA A;  2HWT A;  5EN1 A;  1QAY A;  2IMO A;  2EG2 A;  1CS4 B;  3K89 A;  2V2V A;  1FK9 A;  1F60 B;  1RHQ B;  3BYP A;  3R5D A;  3N6M A;  2NYH A;  3DI6 A;  1ZZN A;  2HMI B;  4IFY A;  4ELT A;  3PX6 A;  2XNR A;  5DZ6 A;  1S1W A;  2ZOM A;  3A3O B;  3TWZ A;  4KIA A;  3FKB A;  3G6X A;  1S6Q B;  3G87 A;  3QNW B;  2OPQ B;  4B3M J;  3OSN A;  2KFZ A;  2B8P A;  4YR3 A;  1SJQ A;  2AYM A;  3LTO A;  2B4P A;  1YJ7 A;  2YKM B;  5C2C A;  1DQ9 A;  3CJQ A;  4IG0 B;  4WK1 A;  3ZZZ A;  1B0T A;  4AQY F;  5ETQ A;  2ASJ A;  3CCU S;  1NSK L;  4NLO A;  1LW0 B;  2FVQ A;  1NPK A;  4Q0B A;  3TA1 A;  2VQF F;  2YVS A;  4MKA A;  4JP8 A;  1OPI A;  3M2R A;  5KFJ A;  2R7X A;  4K4Y A;  3P3D A;  5ETM A;  1FDB A;  1KOO A;  2EI5 A;  4OMF G;  5HJX A;  1FJG J;  1MRO B;  1N5S A;  2BJ1 A;  3NGU A;  4LF2 A;  4PPD A;  4URG A;  1YJW S;  1HNZ F;  1HD1 A;  4X4O A;  2PGC A;  4ZJO A;  1UPM B;  3MAH A;  2GO8 A;  3QGH A;  4NRT A;  3DMJ A;  2X1G A;  3KLI B;  3RRK A;  4ZHR A;  3BO4 A;  3K8W A;  4LSL B;  4NLY A;  5AJ3 J;  3DU5 A;  4RW4 B;  2J9C A;  3S01 A;  2QLJ B;  4LF9 F;  3PJ9 A;  1TK5 A;  3PYF A;  2H4Y B;  5HQL A;  1OIA A;  3FDS A;  3NGT A;  3A12 A;  1RT5 A;  1IKY B;  1NM2 A;  1X5O A;  3PAC A;  2NUU G;  3W5X A;  3I5C A;  1S1U B;  4F2R A;  3E01 B;  4USM A;  2BJD A;  3CD5 A;  1N52 B;  1HA1 A;  1U09 A;  4RNO A;  2DGO A;  3POT B;  3NCP A;  2OD4 A;  1V5I B;  1B7Y B;  3O8W A;  3U02 A;  3UD5 A;  4DCP B;  5RUB A;  4LF8 J;  3KMQ A;  1AZS B;  2IPO B;  2FLP A;  3ONQ A;  3IMQ J;  3HVT A;  4PQU B;  3KJF B;  3H2L A;  3MDF A;  5JVH Q;  1L3U A;  5A2Q Y;  4OYW A;  3GU0 A;  4QYZ K;  1JWW A;  4DBQ A;  2JFD A;  2R7V A;  3QSI A;  2ZZM A;  2ROG A;  3OTC A;  2RE1 A;  1HI1 A;  2HIY A;  2XWY A;  2V8P A;  3C66 A;  4UST A;  4WCE Q;  2ZM6 J;  3AAW B;  1Q5Y A;  1UP1 A;  3NS5 A;  4IG3 A;  4YME A;  2W2Q P;  2AYG A;  1U8S A;  4DFP A;  2ADC A;  2CQ0 A;  3NGD A;  2H5I B;  2Z4P A;  3LAM A;  3S6E A;  4ECZ A;  1X4H A;  4QIW D;  3M6X A;  3SIP B;  3TOQ A;  1BUX A;  1YWX A;  4IR9 A;  2YWG A;  2OPS A;  1RHR B;  1JMT A;  1LFP A;  2W9A A;  4OYA A;  1IBM J;  1Q16 B;  1S6P B;  3I0R A;  2DNP A;  1JLF A;  4FZV A;  2VPY B;  4LUB A;  3AY0 A;  1VLO A;  4HT5 A;  2QO3 A;  2DIV A;  1CS4 A;  2C3U A;  1SC1 B;  2P5V A;  3MUM P;  4ZJL A;  3FC9 A;  3RAX A;  2ZBC A;  4CO2 A;  3GV7 B;  2MKK A;  1FO1 A;  2JHE A;  5EGY A;  2MQQ A;  2DIS A;  5HLF A;  4PYD A;  1NRK A;  3GJQ B;  1JLF B;  1OY8 A;  1H7X A;  2R7Q A;  4OZ5 A;  3SQO P;  2HS3 A;  5DM6 Q;  3PNI A;  2R2S A;  2J7W A;  1VQ4 S;  3MR2 A;  3HHL C;  2GAH C;  4DV3 J;  5DLF A;  5ETR A;  2FUG 9;  3MGJ A;  1SKW A;  2WVB A;  2B43 A;  3MM5 B;  2B51 A;  2X51 A;  4WFX A;  4KAI A;  1CUL A;  1F3F A;  2NLW A;  3KG1 A;  4OHV A;  5KFR A;  2J0Q D;  1FKA F;  1S1V B;  1HI8 A;  1M5V C;  4RR5 A;  1FJ7 A;  3K57 A;  4DSI A;  2KM8 B;  1SC6 A;  4RWX A;  1TKX A;  4ATN A;  4HR2 A;  3B8H A;  1M0S A;  3U1L A;  4UOC A;  5HJY A;  5IZH A;  4ZP7 A;  1RTD A;  4F3M A;  3HO1 A;  2CQD A;  5K8O A;  4NYZ A;  3IFE A;  3QJJ A;  3CCT A;  4NLR A;  3TZX A;  3LQV A;  4CQ1 A;  4DPT A;  1MSW D;  2KXF A;  3QPI A;  3HMJ G;  3FMB A;  1UPP A;  2OHD A;  4UTG A;  1JXE A;  1N36 J;  4RU2 A;  2G4B A;  5IOL A;  3W9I A;  2OI2 A;  3I96 A;  4ZP8 A;  3MPY A;  1DBD A;  2ZE2 A;  3BGU A;  2YKQ A;  5HRO A;  4NOH A;  3A8I A;  1HAR A;  4CNZ A;  1S1V A;  3N5B A;  4MK9 A;  4P52 A;  5IWA J;  3HP6 A;  1X5T A;  4CO0 A;  4KH1 B;  3AJD A;  1RAE B;  3IBF B;  4K50 A;  1GFW B;  4CT8 A;  1ZZF A;  2HBQ B;  3DMJ B;  4TYA A;  4ZHR B;  4C2M A;  3CPW R;  4O3Q A;  1XBW A;  2UUT A;  3H5S A;  3JSY A;  1UZD A;  3DI6 B;  2HMI A;  1J2V A;  3WC0 A;  2FHJ D;  3GB0 A;  3HHL B;  1KN6 A;  2RJZ A;  2F9D A;  5DO2 A;  2J6T A;  1Q1K A;  2M9K A;  1RA6 A;  1E6Y A;  2HFU A;  3M2R B;  4OYB A;  1R0B G;  3IAM 9;  1S99 A;  2G2O A;  1NDK A;  1KWM A;  1VYA A;  2QMW A;  2GVD B;  5CCM A;  4WFA Q;  2XSF A;  1F1B B;  1SC3 B;  3CJK A;  2W2N P;  3FBF A;  4C97 A;  1RU2 A;  3WX8 A;  2BM0 A;  1RTI B;  3BDE A;  4XDC A;  4RU9 A;  3MCO A;  2OPS B;  2OUG A;  3E2E A;  2CXE A;  1U24 A;  1NB2 A;  2VC0 A;  3NGK A;  2VH7 A;  5JXS A;  3NNC A;  4B3O A;  5HP1 A;  2JOQ A;  2XZD B;  2KFY A;  4KHP F;  1Q95 G;  3TAM A;  3OPK A;  2FJA B;  5H9F J;  3HSG A;  4QOT A;  3RTV A;  2YX7 A;  3LGH A;  2KT3 A;  3R6L B;  2XQC A;  3CIM A;  4M5J A;  4K4S A;  1FK9 B;  3Q8R B;  1YKW A;  3HHD A;  2VJV A;  2MQO A;  4V19 J;  2DGS A;  4USJ C;  2B4O A;  4WII A;  4MKV A;  4I6W A;  2AWZ A;  2NXJ A;  3GZ7 A;  3SCJ E;  4DX8 H;  4B3S F;  3LWM A;  1Q82 T;  3M8Z A;  2VA2 A;  1EAR A;  1LW2 B;  1RAF B;  2KVQ E;  2W25 A;  4DCO B;  4EMD A;  3QGP A;  2W7O A;  3S1T A;  4KGZ B;  4N47 A;  3POT A;  1SIZ A;  5DG7 A;  1KQK A;  2KHD A;  4DUT A;  1FTC A;  4C4W A;  1EP4 B;  1RQ0 A;  2DR6 A;  2GHP A;  4F67 A;  1NK0 A;  2VBY A;  4JB8 B;  1KR4 A;  2Z58 B;  3MD3 A;  2QMX A;  4M8L A;  3IRX A;  4P75 A;  3TO8 A;  2VJU A;  2QEX S;  4RUH A;  2ASL A;  1T05 A;  5J2Q B;  4JI3 J;  4B9S A;  2X1B A;  2WVE A;  1LWF A;  4DV6 J;  1SIW B;  4LQ9 A;  4TU9 A;  3DDN A;  3KLV A;  1K1S A;  4QR0 A;  2XMU A;  4JI2 F;  3OJS A;  3VHQ A;  2HHQ A;  4X4N A;  1BY9 A;  2CWK A;  2EK6 A;  4O3P A;  1JLQ A;  2YWH A;  3AD8 C;  4I4B A;  3THV A;  1T9X A;  2EKY A;  2C3M A;  4IQX A;  3I9Z A;  3MEE B;  3V5R A;  4R5P A;  1BQN A;  3VAG A;  4ED5 A;  3MM8 B;  3I4P A;  2A1B A;  2DEJ A;  1RGV A;  1WSV A;  2OML A;  3HLU A;  1ZBT A;  5L39 A;  5CCL A;  4PCQ A;  5E3P A;  2P9C A;  3T9Z A;  2IAJ A;  1S76 D;  4G1P A;  4XAK A;  1XMB A;  3ZZU A;  1K9M T;  1ZS6 A;  1JLC A;  1XTZ A;  2E66 A;  1EAY C;  2XEX A;  1FVS A;  1TU0 B;  2C3O A;  4O4G B;  4YB6 A;  1SJ4 P;  3ETO A;  5AE2 A;  1WI8 A;  2L3M A;  5KT6 A;  4LR7 A;  2IJN A;  4K7Q A;  4YDD B;  3QO9 A;  3PKM A;  4KRW A;  3HSD A;  5IQQ A;  4DR6 J;  1WJ9 A;  2V0N A;  1F5B A;  3CJ5 A;  1R8B A;  3EDQ B;  1HWL A;  3HFK A;  3R3T A;  3R2D J;  2QE5 A;  1U7L A;  1IQZ A;  2GA7 A;  2GMJ A;  4QR2 A;  4CYU B;  2M4M A;  5IWA F;  2V2K A;  1CC7 A;  1U45 A;  2FYX A;  1SJF A;  1AUS L;  3CD7 A;  4NEZ A;  2ZHA A;  1NCL A;  3OR1 A;  4KFB B;  3VAM A;  3H98 A;  1L3K A;  1JLE B;  3AXM A;  3TX0 A;  4NCG B;  3E8O A;  3V6J A;  3QT5 A;  3SXL A;  3QT6 A;  4K5R A;  3V6D A;  1NB7 A;  1JLQ B;  4BCA A;  1NHU A;  2CPE A;  1NAQ A;  2WSC C;  3OLB A;  1TAQ A;  1WHW A;  3ISN C;  1IBL F;  1MU2 B;  2D1C A;  3M1V B;  2J8A A;  4I56 A;  3OL9 A;  4CLL A;  2BEF A;  2QLW A;  3PZP A;  3IRX B;  4H54 A;  2RIJ A;  3LAK A;  1RAI B;  2VG7 A;  4W92 B;  2LCW A;  1N33 J;  1X9S A;  1QAI A;  4EZ6 A;  2C1E B;  2QA4 G;  2CFX A;  1T9Y A;  1TK0 A;  1IBK J;  5HMY A;  4MFB A;  1N56 A;  3CW2 C;  2HG4 A;  1RAG B;  4X62 F;  2AIR B;  2RRB A;  3EDR B;  3CSK A;  1IBL J;  1RI7 A;  5BYR A;  1WHY A;  2FB0 A;  4TN2 A;  4NXN J;  2XMJ A;  2IVM A;  2C42 A;  1R0A B;  5ADZ A;  4QYZ J;  5CZV A;  3CJ3 A;  3MPU B;  4WIQ A;  4F0H A;  1SJ3 P;  1RA7 A;  3ILI A;  3ZNU A;  5C5J A;  5DDQ C;  4ZCK A;  3EM1 A;  4XIU A;  3ITH A;  4ZLL A;  2OSR A;  2VFT A;  2DNN A;  1REV B;  2V67 A;  2VG7 B;  3MZI A;  4HDG A;  5C7P A;  2GQ2 A;  3B4M A;  5AE3 A;  3TZZ A;  2N4D A;  3FBB A;  4QBU A;  1X4D A;  4OX9 F;  1B99 A;  2BQR A;  4LT6 A;  1NK4 A;  4B3T F;  4KJI A;  4JYA F;  4F8R A;  1U6Z A;  4CDI A;  4USU A;  1N5Q A;  2BA9 A;  4DL6 A;  2CPX A;  3MEC B;  4KBI A;  1YBU A;  3ETM A;  3DHX A;  4PAA A;  4R0J A;  4WBF A;  3SCK E;  5M2U A;  1N6Q B;  3GYX B;  4TVA B;  4Q8E A;  3BO3 A;  4Y65 A;  2FQQ B;  3CIZ A;  4ED2 A;  2LDY A;  1HR0 F;  1Q8L A;  3ENW A;  3C3L A;  2JRS A;  4J9P A;  1OY6 A;  2Y3Y A;  3PHE A;  1GAO A;  3GMG A;  5KG3 A;  3RZA A;  4C8Z A;  4CP5 A;  1QTN B;  3H0P A;  2UUB J;  1UVN A;  2LEB A;  1S77 D;  2WB4 A;  2D74 B;  1JNR B;  3QFW A;  4OZ1 A;  4Q43 A;  1PKU A;  4OHW A;  1X0F A;  2I5J B;  3CED A;  5D0G A;  1YHQ S;  4JI2 J;  4D3H A;  1P27 B;  4NI2 A;  1UTA A;  2DJW A;  4KKO B;  5D0H A;  3LGM A;  4QZV B;  1JKH B;  4XPE A;  2V6A A;  1Q8K A;  2VBZ A;  5T41 A;  4CTA B;  1B64 A;  5D4P A;  3EGW B;  2PEB A;  4RWW A;  3K59 A;  3D66 A;  4URQ U;  2ZH9 A;  2W24 A;  4FNH A;  3GR0 A;  5G0R B;  3W2W B;  2VQE F;  4DPO A;  1VCT A;  4ZVP B;  5F3Z A;  2IDL A;  3KK2 B;  3BM7 A;  4NLT A;  2Z8Q A;  4NE9 C;  5AJ3 F;  3GR1 A;  4PKD B;  2A18 A;  4NLP A;  1VQO S;  2E1C A;  4JV2 A;  1RAH B;  1Y11 A;  2SXL A;  4B3S J;  3GP9 A;  4IQM A;  2HBZ B;  4ITS A;  1HBO A;  2JC1 A;  5FD1 A;  3BF4 A;  5B0G A;  4ZVF A;  3W65 A;  3CJ4 A;  3OFH A;  1HNZ J;  1TR0 A;  1VQY A;  3KHG A;  3BQ2 A;  4ZK7 M;  4ECX A;  4ZP6 A;  1TL1 B;  4YDX A;  4M5D B;  1C0T A;  2YQ3 A;  3AH6 A;  5A8W A;  5HMZ A;  3MEK A;  1JK9 B;  2CDR B;  3KWM A;  2FGO A;  2ZEJ A;  1EP4 A;  4P7T A;  5KT4 A;  2BR0 A;  3JSM B;  3BGO P;  3MOJ B;  4EYI B;  3QRP A;  1U8W A;  1BC6 A;  5DDP C;  3F41 A;  2MMY A;  3CDW A;  2FVS A;  1QVF R;  3ZZ0 A;  2X1F A;  4CH1 A;  5A6W A;  1RWO B;  3N5F A;  1U25 A;  3A3N B;  2OPP A;  3CVK A;  1T94 A;  3LP2 A;  4M5I A;  2DNK A;  1Y5N B;  2IRU A;  2WBR A;  5D0R A;  5LSR A;  3C2P A;  1S7H A;  4ED6 A;  1F3V A;  3OBI A;  3R9L A;  3CD0 A;  3PVX A;  4FPI A;  4OI6 A;  3ENV A;  4RLE A;  4NWB A;  1N88 A;  4JI0 F;  1NK5 A;  1WTF A;  2V63 A;  1VRT B;  1XNR J;  4OJ1 A;  2AEM A;  1I94 F;  5AE1 A;  3NOC A;  4KO0 A;  1TFY A;  3H90 A;  2EG1 A;  1FA0 A;  3HVA A;  3JSB A;  2PII A;  5HL7 Q;  4LF6 F;  1WC6 A;  4GKK F;  5D4N A;  4ECT A;  3KHH A;  1GK8 A;  5CYM B;  3PW5 A;  4GKJ J;  2ZH6 A;  4DQI A;  4RZR A;  4NMX A;  3I31 A;  2RKI B;  2NXC A;  3R5G A;  4GVB A;  2CQ2 A;  2C3Y A;  5BR8 F;  1PO6 A;  2YNI A;  2G1D A;  2DXE A;  4DG1 A;  4JI7 J;  2KRR A;  4GKJ F;  3FVY A;  3D6T B;  1S1X B;  3EE3 A;  3PCO B;  4LVN P;  2HYI B;  3BQ0 A;  4ELV A;  1SKU B;  1T9U A;  3NEK A;  3DOL A;  3W63 A;  5IT4 A;  4B3R J;  4ELU A;  4DF4 A;  3D1Q A;  5IM0 A;  2C2E A;  1YQH A;  2NUH A;  3NMA A;  5A76 A;  1NSA A;  1UZH A;  2VV5 A;  3AXK A;  1SVD A;  4TY8 A;  4YR2 A;  5HAN A;  2BQ3 A;  2BYC A;  4DEZ A;  2MST A;  1TKZ B;  2KG1 A;  2OD6 A;  2W7A A;  1Y00 A;  1HPZ A;  4ZPB A;  2OFG X;  3C15 A;  4LFC F;  2V9W A;  1RWM B;  1TL1 A;  5L9N A;  4L72 B;  1TL3 A;  2CZ9 A;  3MM9 A;  4QIV A;  1VQ8 S;  4P71 A;  4DUY J;  4TQS A;  2IYG A;  2WON A;  1MRO A;  1M5S A;  2MKI A;  1P1L A;  1TUW A;  2UXC F;  3KUG A;  9ATC B;  1RTD B;  1CLF A;  4PEO A;  5DGA A;  4FYD A;  1RHM B;  2GAG C;  3CMQ A;  1JXV A;  1F2H A;  1YVF A;  2BJ9 A;  4FXV A;  2NCK L;  2IM1 A;  3W9J A;  2DR7 A;  2ZJP Q;  2G1H A;  4RX6 A;  1IKX A;  1RBA A;  4CI0 B;  5L1J A;  2LP4 A;  4EYH B;  2UUC F;  1RLC L;  3H8Y A;  3MCM A;  1FEE A;  3ZTQ A;  1Q5V A;  1Y9O A;  1HPZ B;  3C6U B;  4NLX A;  2RF2 A;  3UO0 A;  3C19 A;  3TZY A;  2DXF A;  3Q8U A;  1XER A;  2W7P A;  1T0T V;  2Y1L B;  1WOO A;  4DUZ J;  3WC2 A;  1RWV B;  3CCV S;  1S1W B;  2QRR A;  2IIH A;  3IR6 B;  3IXQ A;  2CQG A;  3OD2 A;  3H5Y A;  3CO0 P;  3BQ1 A;  1YJ9 S;  4K4V A;  5T14 A;  1RT4 B;  3MMJ A;  4ZVU B;  4ECR A;  5I42 B;  5GAG U;  1GNK A;  3PRB A;  2JLG A;  3MPD A;  3M4X A;  4Y0F A;  4ECV A;  2E44 A;  2Y0B B;  1U1L A;  1WKK A;  3KLG B;  4FN5 A;  4ED1 A;  1Y5L B;  3RB4 A;  1K0V A;  1SL1 A;  2HZC A;  1RP5 A;  2CPH A;  2HWI A;  3I0R B;  4ECY A;  5FLX U;  2HS4 A;  1KD1 T;  4M95 A;  1UJ6 A;  1VQ7 S;  2DNY A;  2CRL A;  3MEC A;  1HNW F;  2YNF B;  3O6Q A;  3JYT A;  4RW6 A;  4ZS6 A;  2CNK B;  5CAB A;  1CEZ A;  1HWI A;  4EBC A;  2L41 A;  2EC2 A;  2RDD A;  1VBX A;  1N4L A;  2DCL A;  2H5J B;  1ZM3 A;  3M8W A;  3P6Y C;  1V3Z A;  3T5J A;  1IR1 A;  3A1Y G;  2LA4 A;  4EEY A;  4MTP A;  1FDD A;  3QZ7 A;  1RWW B;  3G82 B;  1FFG B;  3QBC A;  2XB2 D;  4C3K A;  2ZNY A;  1LOU A;  2VKR A;  2JNJ A;  4TNO A;  5DG8 A;  2PMH A;  3LF0 A;  4O3N A;  1VMB A;  2A3J A;  4DV4 J;  1FES A;  1XWL A;  3MPV A;  3H25 A;  3SV4 A;  4G1Q B;  1RU1 A;  1SH2 A;  1VQL S;  2UXB F;  1VHF A;  3SEO A;  5CQG A;  3Q0A A;  1ZPW X;  1HBN B;  1VK3 A;  5C24 A;  5CZX A;  3CC4 S;  2CQH A;  4X64 F;  4ID8 A;  4Z7C A;  3BO2 A;  3HF5 A;  3BGL A;  3QT8 A;  2VZ9 A;  1WC1 A;  5K20 B;  2E5L F;  1Y4Z B;  4IH5 A;  3JTP A;  4I2P B;  4YS2 A;  3W5Z A;  2DGT A;  1KEK A;  4NML A;  4Z7Y A;  1YRX A;  1T03 A;  4IOB A;  5A8W B;  3M05 A;  1JLA A;  2VFR A;  1C0T B;  1UFW A;  2RQM A;  4DV0 F;  4ED8 A;  3QRR A;  2HVH A;  1WKJ A;  2XNQ A;  4NA2 A;  1FFW B;  2BAB A;  4I7F A;  4HHU A;  1OYE A;  4HEA 9;  3KJQ B;  2C2R A;  1KFS A;  2YKA A;  3KG4 A;  1TUV A;  4A48 A;  3HVW A;  3R7B B;  4DQP A;  3HSJ A;  1KLM B;  2B0G A;  2W8L A;  3A3P B;  3SQG B;  3LA0 A;  4Y2K A;  1N0V C;  1T8E A;  2UVR A;  4X4U A;  1KQF B;  3S8S A;  2CZ4 A;  4FYV B;  2DY9 A;  4HTJ A;  4I64 A;  4ZCL A;  4OL8 A;  2RHQ B;  1N33 F;  3AA9 A;  2GHW A;  4ZPV R;  3W2W A;  1F2G A;  1R89 A;  3BRE A;  3KLE A;  2HUR A;  4N8O A;  2OO4 A;  2LYV A;  4OJH A;  1YJR A;  3CE8 A;  1RYR A;  4GVL A;  4NI2 B;  1U1R A;  1YGY A;  2OPQ A;  1TK8 A;  4ILL A;  5D15 A;  1Q8B A;  2HK3 A;  2CJK A;  1UEK A;  4RUB A;  2PT0 A;  2XGP A;  2GQQ A;  4JI4 F;  4LF4 J;  3BBF A;  3R1L A;  2MGZ A;  2I38 A;  4L3N A;  4QYR A;  1FVQ A;  5IT0 A;  3DM2 B;  5F41 A;  2M8D B;  4H4O A;  4J5O A;  5LXR A;  1XC9 A;  3DDI A;  2ADB A;  1K8A T;  4LF6 J;  4KC5 A;  4C0B A;  2BM1 A;  1H0H B;  3AQO A;  1F6T A;  3CTR A;  4CT9 A;  1URR A;  3ICL A;  2RQC A;  1G3O A;  4UOG A;  4GC7 A;  2OTJ S;  4LRA A;  4JI0 J;  1GT8 A;  2BE2 A;  2D9O A;  1IKW B;  4PZV A;  3SSR A;  1SH0 A;  1DQA A;  1V3S A;  2J0X A;  1HYS B;  4ENO A;  4HYK A;  1S97 A;  1CJV B;  3R5A A;  4J91 A;  1IUJ A;  4IO1 A;  4PXE A;  2ROP A;  4A8X A;  4YUD A;  3M7V A;  4OV6 A;  2XBP A;  5DQH A;  2Y9H A;  1H3D A;  3UDL A;  2BJ7 A;  5L1K A;  1S0N A;  2XY6 A;  4WWS A;  2OMO A;  3TI0 A;  4DWI A;  2G0J A;  3O44 A;  1GX5 A;  1RTH A;  3GYG A;  4MKY A;  5KFO A;  2CQI A;  1FX2 A;  3PX4 A;  1WEL A;  2CPD A;  2VG5 A;  1IKV A;  1ROF A;  4C8M A;  3T1H J;  1HBU B;  2YH1 A;  5F9L A;  3J7Z 5;  5H9F K;  3IC1 A;  1N0U A;  1R8P A;  2CKW A;  5GAD I;  1MW7 A;  4JI5 J;  1KHV A;  1LWC A;  1QLN A;  4WK3 A;  2MJN A;  3B78 A;  1QJH A;  4ECS A;  2N4C A;  3BGF A;  3W5Y A;  4DJB A;  1VBY A;  2MLZ A;  3MUV P;  2IM2 A;  4AT1 B;  1UFK A;  2AX1 A;  2ZH2 A;  1RWN B;  1NJY A;  2QL7 B;  4X4R A;  3BDP A;  5LSL A;  4RW6 B;  2EBE A;  1GXU A;  3QT7 A;  4WTO B;  2KKH A;  1KHW A;  2BE2 B;  1HHS A;  2N7C A;  4WP8 A;  5GAE I;  4USI A;  1Q4R A;  4DFK A;  1FRH A;  2N82 B;  5L1L A;  2BAN B;  2M7S A;  4LRC A;  3KG0 A;  2H54 B;  4KB7 A;  5EWG A;  1WG4 A;  5SUH A;  3CME S;  4ED4 A;  1WAC A;  4I69 A;  4K8R A;  4MYU A;  4ZVH A;  5KG2 A;  2R8K A;  4DDF A;  1YJU A;  3BKT A;  3Q86 A;  1E6Y B;  5LT5 A;  3KLF A;  1RWU A;  4AD6 A;  1RCX B;  2B4V A;  4DU8 A;  2IA6 A;  1YBT A;  5I42 A;  4WKR A;  2KN4 A;  4ZVE A;  2K3K A;  4P2X A;  4O44 B;  3TNV A;  3OUY A;  4F4A A;  3B6B A;  3MPW A;  3H7H B;  2WOM A;  2XLJ A;  2FY1 A;  4KHP J;  1FRI A;  2QLF B;  3M8R A;  3GE9 A;  1AW0 A;  4PG5 A;  1MLA A;  1JJH A;  1LWX A;  3CDU A;  4FXD A;  2M2B A;  1KVJ A;  1W2I A;  3F0N A;  3K5L A;  4QWA A;  3IR5 B;  2Y1R I;  4LFA F;  3AT1 B;  1PJ5 A;  2KDO A;  3KLE B;  1S59 A;  4NYO A;  4DN0 A;  3RR8 A;  3TJ9 A;  1X4A A;  2MY7 A;  4B17 A;  4C9D A;  3N6N A;  2YQ1 A;  4AXJ A;  1EET A;  1T9T A;  4NAS A;  4P10 A;  3OVA A;  3H20 A;  4JUZ A;  1KQG B;  1XR7 A;  2CIM A;  3CCE S;  4QQB A;  1RIS A;  4N56 A;  3AOC A;  2M8H A;  4Q8F A;  4J9Q A;  2DHG A;  5LJ5 Y;  2HFV A;  4NLD A;  3SI8 A;  2XS5 A;  2D69 A;  2CDQ A;  3H42 A;  2DR9 A;  3DHW C;  3HPO A;  2FTR A;  4I7F B;  3MMC B;  3NBP B;  3NGS A;  4OHX A;  2W2P P;  4JYA J;  2HGL A;  1NHV A;  4QW8 A;  3OQ2 A;  4MAK A;  1R0C B;  4RNH A;  2VFV A;  3VCD A;  1VIO A;  4CLS A;  5LMN J;  3JQJ A;  4OX9 J;  1R8A A;  3LOU A;  1VLY A;  1WG1 A;  2L48 A;  1WF2 A;  2NXU A;  2HHP A;  2V68 A;  2EXU A;  3SFU A;  2KB2 A;  2JSX A;  4M1K A;  1SKR A;  4IFV A;  4RW8 B;  3O5T B;  5B0F A;  3V2U C;  4DMZ A;  3TVK A;  3IN5 A;  4J9M A;  1Q81 T;  2VA3 A;  1CC8 A;  1CUL B;  1WEY A;  2Z56 B;  2JEJ A;  1NKC A;  4ZN3 A;  3PTW A;  3M30 B;  1A0O B;  5ETN A;  3MFI A;  2AZ1 A;  2ZH1 A;  2JWN A;  2LDI A;  3LP1 A;  4B9L A;  1JIH A;  2ACM A;  2DY1 A;  1NLK L;  2XI3 A;  3FEX B;  7FD1 A;  5HQM A;  2AGP A;  5J1E B;  5HLF B;  3T5H A;  4TLQ A;  3VWS A;  4LF7 F;  2P6S A;  4E0D A;  1UVI A;  1ZAW A;  3D6M B;  3QGI A;  2NPF A;  3TP2 A;  1WNE A;  1LQ9 A;  3GFH A;  4X65 F;  1F9H A;  1UEU A;  3NS6 A;  5K9F A;  2UVV A;  3PO4 A;  3UW1 A;  4OV1 A;  1ELO A;  1TL5 A;  2MDA A;  2NRE A;  4AE5 A;  1WEZ A;  2CAD A;  2HK2 A;  3NG8 A;  4FBT A;  3ET6 B;  4PG7 A;  1BD6 A;  1RLD A;  2VAS A;  2YNH B;  4QJV A;  2RHS B;  5CYQ B;  2EK1 A;  5E5N A;  2XO6 A;  5KFX A;  3UDE A;  2CPZ A;  3NS7 B;  2OLW A;  4D3G A;  3SFG A;  3RAM A;  3MMB B;  4LSZ B;  4WF9 Q;  2HFS A;  2A6O A;  2C3P A;  2OPP B;  3FZB A;  4UF4 A;  4ES1 A;  2R8J A;  1UW4 A;  4Z37 A;  4A47 A;  1FEH A;  4OYP A;  3SQG A;  2AEF A;  2HHT A;  4MJK A;  1ZM4 A;  4DV1 J;  2VIC A;  3ZTP A;  1PJ6 A;  4OIX A;  3M9M B;  2EFN A;  3IBW A;  4AUK A;  5B09 A;  2UU9 J;  1FHT A;  4IRC A;  2E9Z A;  5EWF A;  3JS9 A;  1C1B A;  1GMU A;  2GIR A;  3J7Z T;  4X4Q A;  3OR2 B;  4OZ0 A;  1UAW A;  3W3S A;  3TJ8 A;  4ED0 A;  2D7S A;  2VDH A;  2RD5 C;  3VVT A;  4RJV A;  3PRD A;  4F0M A;  5M2P A;  2HQ3 A;  2OPR B;  3F73 A;  1XMO F;  3JB9 k;  2HLU A;  5KFK A;  3A8J A;  1F9F A;  4DZ6 A;  2GML A;  3J7A N;  1WF0 A;  4JV5 J;  1RT2 B;  5HVH A;  1GMV A;  3NP5 A;  4UOH A;  1VJW A;  3W60 A;  1MMN A;  4OX6 A;  2AKW B;  4YQW A;  1LNQ A;  1XIQ A;  1S9E A;  4BS2 A;  1KBR A;  2EFV A;  3DDK A;  4LVO P;  4ZVT B;  2XLK A;  3UQS A;  4DN9 A;  4WFY A;  4UY8 5;  2RKI A;  1HQU B;  2EFO A;  2WW4 A;  4WTY A;  4A8K A;  2HKE A;  3D3C J;  2NXN A;  2ZH5 A;  5AXN A;  3L09 A;  2O5D A;  3MOZ A;  2CQC A;  3J80 U;  2DRB A;  1GMW A;  1DLO A;  2AZ3 A;  2QZ8 A;  2LXI A;  3UPF A;  3BB5 A;  1XNQ F;  3FUY A;  1TP7 A;  1ZM2 A;  2V8V A;  3KUH A;  1YSJ A;  2RVJ A;  4B02 A;  2PSZ A;  3DRP B;  1NXI A;  1TEL A;  2AX0 A;  1U0S A;  1X8D A;  2MZT A;  2MLY A;  2Q43 A;  1LXJ A;  2QSW A;  2O1P A;  2UZA A;  3EVO A;  3NXZ A;  1RE1 B;  4HH0 A;  4CLK A;  4CH7 A;  1IJF B;  3ILO A;  1M5P C;  1BQM B;  1HW8 A;  1U48 A;  1S1T B;  1ACM B;  1BQM A;  3KK3 A;  2F4V J;  3NL0 A;  3RR7 A;  4K4U A;  2ATC B;  2AD9 A;  3GFZ A;  2I9S A;  1S49 A;  2GGP B;  4Y00 A;  3EGN A;  3EUN A;  1EZZ B;  4TKT A;  4QWD A;  4KO0 B;  2AJ0 A;  2C2K B;  1D9F A;  1WWH A;  2GJ2 A;  3DU6 A;  4EFA C;  4B3M F;  2A2C A;  4L6V 3;  3CCQ S;  2WTF A;  2LKZ A;  5D4L A;  1CJT B;  3CB4 A;  3UN5 A;  1W2B R;  3CCJ S;  3DLH A;  1C2P A;  4N77 A;  1K0T A;  2B3T B;  1EKR A;  1C4A A;  3LO3 A;  5D8H B;  1VDH A;  4K4X A;  3R5C A;  2UXD F;  3VR1 A;  1WI6 A;  3B82 A;  3MEG B;  3P96 A;  4JI1 F;  4MIA A;  3MMC A;  3NBP A;  1O51 A;  1ZA1 B;  2ZWO A;  7AT1 B;  1D9D A;  2AGQ A;  2CJ9 A;  2ZD1 A;  4URS A;  2BKO A;  4LF5 J;  3Q2T C;  1XMO J;  2XC9 A;  1NJX A;  4OZN A;  2FGC A;  1S7I A;  4KE5 A;  2WCX A;  1H6K X;  3CJ2 A;  1S0V A;  1CVJ A;  2CQ3 A;  2BE9 B;  2M52 A;  2PFD A;  1N5V A;  1RT1 B;  3G4S S;  2LQB A;  5BXI A;  4IKA A;  4X4T A;  3UN3 A;  1HHT P;  5HI7 A;  3NGR A;  2EWH A;  2DHA A;  1P8G A;  2CPJ A;  3IA0 A;  4MH8 A;  4M5M A;  4FS2 A;  2DIU A;  1M1G A;  2YPY A;  1EKS A;  1KOH A;  1NME B;  4N7T A;  3MR5 A;  3MR7 A;  4K4T A;  3CCL S;  2ZH3 A;  2DGV A;  2ZJR Q;  2E5G A;  4K2X A;  3OR2 A;  4BWJ A;  2HQC A;  3DLE A;  3B54 A;  5GAG I;  2CJQ A;  4LR9 A;  4DFJ A;  5KFW A;  1RUS A;  2MKS A;  4TY8 B;  3WBZ A;  5K14 B;  4G65 A;  5IT9 Y;  4RW4 A;  4IDK B;  3QAU A;  3WQP A;  3OL7 A;  3V6D B;  2KU7 A;  4Q0B B;  3IM9 A;  3V4I A;  4OYI A;  2DNM A;  3L4B C;  5HK4 A;  2BE7 D;  3ZZR A;  4ECU A;  4DCJ B;  2DTJ A;  3OR1 B;  4KFB A;  3GYN A;  4WXO A;  1S5Z A;  3FSX A;  1SL0 A;  1VBK A;  3H40 A;  3VAK A;  1DZ5 A;  1ZAV A;  5THW A;  2A10 A;  5D3G B;  1FKP A;  2BV3 A;  4UT4 A;  2LEC A;  2I6W A;  1HHQ A;  2E29 A;  1W7W A;  2I5J A;  2RU9 A;  2DR8 A;  1RAJ A;  2ALZ A;  4DV3 F;  2B7B B;  2B6A B;  1D3W A;  1KVK A;  2N3L A;  3AJ1 A;  1B0P A;  5B0A A;  3IG1 A;  5U47 A;  1JJC B;  4UZB A;  1IN0 A;  5HAT A;  1PYO B;  2Z0G A;  4HAC B;  1VRT A;  1RKI A;  2CWX A;  1LWE B;  2V50 A;  3D0G E;  1REV A;  3NRB A;  4K5S A;  5KFA A;  4YB1 P;  3BJY A;  1R43 A;  1SB6 A;  2W4P A;  5H9E K;  1C1C B;  3TUZ C;  1OY9 A;  2R42 A;  2JC0 A;  3EGV A;  3ZTR A;  2R8H A;  1RAB B;  1YDL A;  2AGO A;  3CC7 S;  1AFJ A;  2YNG A;  1LEO A;  2PN6 A;  4A8Y A;  2CJY B;  2FZG B;  3HHE A;  6AT1 B;  3FFI A;  3V4M A;  2EFG A;  3BS9 A;  2DNR A;  3HXM A;  5T7L A;  1J5E F;  1JJ4 A;  4C8L A;  3PX0 A;  1JLB B;  2ASY A;  1DHM A;  3FMW A;  2N3O A;  3ZC4 A;  1NJW A;  2ROE A;  2QLB B;  4P7V A;  4DR3 F;  4F2S A;  2JEI A;  3UDC A;  4MT1 A;  2OKQ A;  5F8H A;  1A6L A;  1QD1 A;  3I0S B;  3VVU A;  3OVS A;  4Y2M A;  3ILJ A;  2PDA A;  3J7Y U;  1IKW A;  1EHW A;  2WVF A;  3JSR A;  4CLP A;  2KJW A;  3EGZ A;  1K47 A;  5DG9 A;  1RT7 A;  2YX4 A;  2ZVI A;  1X4F A;  4RW7 B;  4UZC A;  3M6V A;  4ZVG A;  1X9W A;  3K7R A;  4M5D A;  5EX3 A;  4FF2 A;  1VBZ A;  2HHH F;  3CUL A;  3M1V A;  3AFG A;  2LU2 A;  3T6B A;  2M88 A;  3CCW A;  2CPF A;  4XTT A;  4DPY A;  2VU5 A;  4KGV B;  1MN9 A;  3U1N A;  4C11 B;  2QC3 A;  3KK1 B;  3DRY A;  3KXD A;  3NWG A;  2V8G A;  1RB0 A;  5B0E A;  3RRH A;  2R9L A;  2MGZ B;  2W4D A;  1JLE A;  2IJF A;  1RJJ A;  1DUR A;  2BDP A;  1HNX F;  5L8R C;  3SV3 A;  1DQ8 A;  2ZBR A;  4NLG A;  4U8V A;  4TU8 A;  3EPG A;  2ZKT A;  5JUM A; 
#chains in the Genus database with same CATH homology
 2VJU A;  2A6M A;  2F4F A;  2XQC A;  2F5G A;  2XM3 A;  2VIH A;  2VHG A;  2FYX A;  2EC2 A;  2XO6 A;  2XMA A;  4ER8 A;  2A6O A;  2VJV A;  2VIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...