2EC2A

Crystal structure of transposase from sulfolobus tokodaii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
b'MEYKSTRHAKYLCNYHFVWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFQELKKSTNGKLWTRSYFVSTSGNVSSETIKKYIEEQWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 136aa long hypothetical transposase
publication title Crystal structure of transposase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Gene regulation
total genus 31
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2ec2A00
2F4FA 2VJVA 2FYXA 2A6OA 2XQCA 2F5GA 2XMAA 2XO6A 2VHGA 2VJUA 2XM3A 2VIHA 2EC2A 4ER8A 2A6MA 2VICA
chains in the Genus database with same CATH superfamily
1IBLF 3AOBA 2K3IA 2I38A 2BDPA 5JXSA 3R5CA 2KJWA 2OGUA 2VG5A 3DI6B 5C25B 1SPBP 3UPFA 2P5VA 4DV2J 4QCLA 2ZWPA 2WRMA 1IKYB 4BBYA 1HBUB 5FDLA 5J2MB 1IM4A 3TUJC 4K8RA 2CJKA 2FUG9 5HROA 1NPRA 3TR5A 1UEKA 3W5XA 3FFIB 4J9SA 2CVEA 1VHIA 5DLFA 5BJRA 2J9CA 4LSNA 1NKBA 2LKZA 4QYZK 1QSSA 1RAGB 2Y3YA 3SDEB 2MHNA 2ZUAA 3BJYA 4IH5A 3TX8A 3OTOF 3QBCA 4JUZA 2B4UA 2HNZB 3J80Y 3FSIA 2IM3A 1LEOA 3EMTA 2QJ3A 3N28A 4RW9A 3N4WA 4ED0A 2QMXA 4B9UA 4N5SA 2QRRA 1C1BB 4KHPJ 3EYZA 4ZCIA 4MMOA 3MMCA 5KOWA 1FESA 4KIAA 4I4BA 5J2QA 2BJ3A 5KFPA 4O44A 1H72C 2VONA 1J27A 3LTOA 3NP5A 1QTMA 2R9LA 1S6OA 3CNQP 2BKNA 1S9FA 3I56S 3H0PA 3AA9A 3FCWA 1RP5A 2CPXA 4FKYA 3NXZA 1UMJA 4OV1A 3AD8C 4FYYB 2MLXA 2QLXA 1VQ4S 5GMEA 4H4KC 5L1JA 2UXBJ 3RB4A 2ZHBA 1TP7A 1RTJA 1PBUA 4P2SA 1YBUA 2E44A 1REVA 4NXMF 3HD1A 4DCOB 2ZNYA 3B54A 2BKPA 1U49A 3J7Z5 4Y2CA 4PG5A 2CJBA 2Q1LA 5C2CA 2OMOA 2MZSA 3W66A 3W2WB 1X4BA 5D4OA 2CPDA 3AD9C 3H4BA 1OY9A 2HWIA 4LF2A 4F26A 1S59A 1X4GA 2CPZA 3RU0A 5D0RA 2Y1LB 2J5AA 4USJC 3DMJA 2FYXA 1DURA 2PI4A 1HIYA 1WDTA 3KLVA 4W92B 4P6QA 4B9LA 4X4SA 5LJ5Y 1HI1A 1FRKA 4RBUA 3ZZOA 2R7SA 1H98A 2HWHA 1UP1A 2C3MA 1FF2A 1YJ9S 4MYTA 3CW2C 1WOPA 2ACMA 4LFBJ 4NA2A 1N4LA 1Y9OA 4P52A 5ETTA 2DGVA 3VALA 1HFEL 4GMKA 4CLSA 2DT9A 2HFZA 1MLAA 1T02A 4RUBA 4GRSA 4A8QA 3L95X 2R7QA 2VBZA 4WP8A 4UF4A 3OUYB 3FGVA 1WC5A 2AHOB 4WWSA 4ED5A 1CJVA 1UEVA 3HFKA 2GAGC 3MEDA 3TZWA 3IR6B 3NGKA 4QZVB 1J5EJ 1RWXB 1F6TA 1ZM3A 2IAJB 3MEGB 4TY8B 5J1EB 5LSOA 4R8UB 4CLPA 2RU3A 1U25A 2C2ZB 3ZZUA 2QT7A 1I94F 3LP1A 1TL3B 1IKWA 1IQZA 3R7BB 3HKWA 1WNEA 1LW2A 2XO6A 3I5AA 4P7TA 5E3AA 3BQ0A 3BF4A 5KG5A 1RTIA 5T7LB 4WFZA 1AZSB 3D0GE 5T14A 2YWHA 2RQ4A 1TL7A 2YNGB 2GHPA 5D8HB 5GMKa 2FJVA 3KUEA 1EZZB 5KFSA 4K4VA 5EX3A 2DGXA 2F9JA 2FLNA 3UFCX 1YG0A 3K5OA 4RW4B 1G6BA 4NCGA 1LNQA 3Q0AA 4F02A 2YXLA 2LXIA 4I56A 1U6FA 1TL1B 2ROPA 3IWNC 2E7VA 3B6BA 3LH2S 2QG9B 5DQHA 1Q4RA 4Y2KA 2J0QD 3RB6A 4C97A 4W98A 4URGA 1FDBA 3RBZA 2AJ2A 4Q44A 1XMBA 3LAKA 4JI0J 2HMIA 1KBRA 2HK2A 4DV4J 4A48A 2OPRA 3TA1A 3NNCA 3N5BA 3DOMA 4X4RA 3TUZC 1XNQF 4WIQA 3K5LA 1R6VA 2RS2A 3T3FA 2CZ9A 3MHYA 1HNVA 2ASYA 4FF1A 4I2PB 1BC6A 1QAXA 3RUBL 1LWEB 1N5TA 3Q8VA 3RAQA 4EBDA 2AP6A 1GMWA 2HRTA 5D78A 1WG4A 2EC0A 1S4FA 2XYPB 4F2RA 4C3MA 3Q86A 1S6QA 3GYNA 3IBWA 1ZYQA 3JQJA 5CYQA 2ASLA 2OEMA 2IY5B 4CLYA 2G2YA 2GHWA 5BYRA 3I6PA 2AMCB 2EBGA 3L7PA 1IWAA 4DV7F 1MWYA 2VC1A 4K5RA 4USMA 1GK8A 4CLKA 1H7WA 1S49A 1DAXA 3B82A 4KQZA 4K4YA 3GFYA 5KT6A 2E29A 2A6OA 1WKKA 2P8IA 2NXNA 2YKOA 5G0RA 1ZM4A 3M4XA 4WE1B 3HD2A 2HHUA 2QSFA 5F9NA 2HGMA 4OX8A 3FJ2A 2YH0A 1RSCA 2M88A 3DNCA 4K4ZA 1BHNA 1XIQA 4OX9J 4NMLA 1WACA 2B7CB 1LQ9A 2OKQA 3TNVA 2GNKA 3DGVA 4DX6A 4B3OA 2HNDA 2CXEA 4WPAA 2B6AB 1Q8KA 3L09A 3R2DJ 4ICLA 2M52A 2E7XA 4OJHA 2MSSA 4ATNA 3UVJA 3HO1A 1FTCA 4B3MF 1RHJB 4F04B 1VYAA 8RUCA 1SC3B 4KGXB 4P10A 2QL5B 3FBCA 1NHVA 4E2FB 1SL0A 2EKYA 2N82B 4WZMA 1OYDA 2GV1A 1FWLA 1IBMF 1S12A 3VGSA 1GNKA 3MWBA 3TZYA 3I5BA 1CJTA 2P2CB 2FDNA 4F4AA 5DETA 4HTJA 3FC9A 1T3OA 2XGQA 1QLNA 1GX5A 3BQ2A 5D77A 2BKOA 5KFIA 2FHOB 4AQYF 3PEHA 2K7JA 2EWHA 4PPZA 4Z2XA 3FEZA 1N6QB 2VG7A 2XZDB 3CMAS 2PSZA 3QIDA 3SCLE 3MM6B 1KLNA 2R7WA 4V19X 3CTRA 1SJ3P 5DO2A 4MIAA 5CZVA 3E01A 1R0CB 3DDKA 3R6LB 5DG9A 4OI3A 4F50A 4NRTA 2IYGA 1N8RT 2IM0A 4ZPDA 2XCPA 1C4AA 5E3RA 3AJ1A 4PXBA 2AEFA 4ED2A 3D3BJ 3DI6A 4Q8FA 5C25A 4ANDA 1HBNB 2IMOA 1HBUA 5J2MA 4CO3A 1D9AA 3V6KA 2WVFA 3CCRS 3PXGa 1Y3KA 2N4DA 2RUGA 3FFIA 3GWCA 1AXQA 2ROEA 1P1TA 2ZVIA 2RSQA 2JVOA 1IQTA 4LF8J 4YR3A 4FVMA 2DTJA 2DHHA 3ZC4A 3SDEA 3R7SB 2OEJA 1R0AB 4USTA 3PZPA 1SJ4P 2ZH4A 5AJ3F 4M5LA 2HNZA 2CQGA 4A46A 1NAQA 3HHKA 3TUPA 2EI5A 1S9GB 4M1KA 4QR1A 1ZM9A 4ZLPA 3CO9A 2KB2A 3BH7B 2C3OA 2O66A 2B5JB 1C1BA 3BB5A 2YH1A 4OLOA 3AOCA 5HLFB 1WHWA 4TKTA 4WP3A 1YTYA 2XSJB 3OVBA 3D6HB 3VAGA 1WJ9A 5E5NA 3PO4A 3GV8B 3MGJA 3SEOA 4A8WA 2BE2B 3CJ4A 4FDFA 3EGNA 1CSJA 2AWZA 3C8YA 3VWSA 4NA1A 2V67A 1PAUB 1FFGB 2ALZA 4OHZA 1S72S 4DV6J 4U6PA 1NCLA 4ZLLA 4OI2A 1GXUA 2FVSA 2KH9A 2DH9A 1YRXA 2W7OA 2QFIA 5F8HA 1RWUA 3W9HA 3B8HA 2HFOA 2P6SA 2RD5C 1WEZA 2MY7A 1SXLA 4DL4A 2JL9A 2GO9A 3C14B 3KXDA 4F4YA 2F8HA 3HJVA 2LQ8A 4NLDA 3PX6A 2HQIA 2XMTA 5DDOC 3W2WA 4DR5F 2C2OB 4MFBB 3W61A 1VLYA 1Y11A 1X4FA 1HWKA 2Z0GA 1U2FA 4I7FB 1TL5A 3TEGA 1YRUA 2DXEA 4P2MA 1GH8A 1N5QA 3FCHA 3GIIA 2J9DA 2ZZTA 3SV3A 4RL1A 4B3SF 5HMYA 4O3QA 3NEKA 3M05A 2IC3B 2K2PA 3EZUA 3MUTP 1CLFA 1FRJA 1VIXA 3JQKA 1ZAVA 1PGZA 4UOFA 1NJZA 1PYSB 3NCQA 1MSWD 4ER8A 2CQDA 4KGZB 3N6MA 2ZH5A 4B3RF 1B0TA 2CPEA 3Q83A 4ZCLA 4OJGA 3QRPA 1S77D 2RQMA 3HT0A 1VMBA 3C6TB 3Q22A 3QLHB 3Q8UA 2WB4A 3T1HJ 4WIIA 2AQ4A 5F0WA 2DK2A 3BDPA 5IT9U 4PG7A 2EFOA 1WDDA 1XEZA 4I2QB 4RWWA 1NB7A 2MKHA 3ITHB 5IM0B 5SZTA 3EVMA 1RT1B 2MHEA 5KFRA 4USUA 2GFFA 1M5PC 3OUYA 4B08A 4ZDNA 4BS2A 3L4BC 3GYGA 3WZ0A 4B3TJ 2RVJA 1FK9B 3GCWP 2ZE2B 1BE4A 1VC0A 2GCFA 2DNKA 2XBPA 4JYAF 4FYWB 5I4MA 2UU9F 1FKOB 1F0XA 4DWIA 3G71S 2W4PA 2IAJA 4O0NA 4ANEA 2XS2A 3MEGA 4TY8A 5J1EA 4F2SA 4X4UA 5BR8J 4R8UA 3GFXA 2IYIA 4AT1B 4MKVA 5DJBA 1HR0F 4AUKA 2R4FA 1TL3A 3UQSA 3OSNA 4TU7A 3HHLC 3JTOA 4WFBQ 3UD4P 5T7LA 1AZSA 3N9UC 1NJIT 3CULA 4OZNA 7FD1A 2YNGA 2B8PA 1N33F 4J9PA 1ZH5A 3BH6B 3C46A 5B0FA 2EVZA 3TZZA 1F9HA 2FQQB 4HH0A 3ZTQA 2LDIA 3Q8YA 3AT1B 5LJ3Y 4RW4A 5FJ4A 4ZLNA 3M6VA 1RWPB 1IVZA 2KI2A 1HQUB 3BPDA 2FD2A 4AE5A 1TL1A 2AGPA 2ZBRA 1Q7YT 1Z1ZA 3QYYA 3G86A 1B4SA 2NYHA 5KOXA 1F5BA 4ETXA 1FJ7A 1M90T 2YX7A 2F40A 2MGZB 3ENVA 1YBTA 2B3TB 3QO9B 2KRBA 1YX2A 2F7VA 2DNMA 3EDRB 3GJSB 3PRVA 4DR2F 4B9MA 3K58A 1WG1A 3MD1A 3M6UA 4KH0B 4UUWA 1E6YB 4CZCA 3FRZA 3ADAC 1SC1B 1RA6A 1U2RA 2RU9A 2QMUB 3ZO7A 2JEGA 1EQMA 4DL2A 1DARA 2UUTA 4JI6J 2C1EB 2J8AA 3FEXB 4FF4A 3VAHA 1LWEA 5B0GA 1SJQA 1X4DA 1JNZB 1CQNA 1UVMA 3S7RA 4DV5J 1V3SA 1VBXA 4UW2A 4WFYA 4N47A 2DGTA 1TUWA 4DOZA 4A4JA 2G0IA 3ZNUA 3GZ7A 1FJGJ 1T8EA 5IT4A 3OL7A 1MW7A 4CDIA 2X7IA 4FXVA 3JS9A 3KFWX 3HP6A 3FSXA 5LXRA 2ZJRQ 4DPUA 2GAHC 4TYAA 1YKWA 3OR2B 3HKZD 3C3LA 3OL9A 2PMZD 1VBZA 5KFOA 1Q16B 1GEHA 5L8RC 3HSJA 2HEKA 3KK3B 4A8YA 1TK5A 2Z2MA 3BREA 3HCXA 4WE1A 1K1QA 1NRKA 3DOKB 4M5JA 3J80U 1ZOTA 2DR5A 4OZ2A 2KXNB 2BE9B 2CFXA 3W8GA 1UW9A 1LK7A 4BHQA 3RRKA 1K47A 4LSLB 2CQPA 3IWXA 4ZK7M 2CAJA 5H9FK 3BKUA 2AYEA 5E33A 4DV1J 3OR1B 4N8NA 3AQPA 3ZZRA 2J76E 4U7CA 1YSJA 1U1OA 2XEXA 5KFQA 3NMAA 2P9CA 2ZUGA 5L1KA 1GT8A 5KFKA 2VQFF 4L75A 4OYZA 2LEAA 2GIQA 2MQOA 2LU2A 1FE0A 3E8OA 1WHVA 1X9WA 4LFAF 2NXJA 1HHTP 2L9NA 3IR7B 1S1UB 2H4YB 1KTVA 4Q45A 4AFFA 2RAQA 4TYBA 5L9XA 2CPJA 4BLGA 1FT8A 3TARA 1N0UA 2HKEA 1MWZA 3SSQA 4FPIA 4K4UA 2HBRB 3KG0A 5H1SV 1RT5B 2JSXA 4KSEB 1FXRA 1KNZA 1HQEA 2DO4A 1JLFB 1M5KC 3LGHA 1N6QA 2HVEA 4AXIA 1DRZA 4J9UE 1XMQF 1GMUA 3MM6A 2EFPA 1W2BR 1RT7B 2EG2A 1RWWB 4C0OC 1SQGA 3D6MB 4Y2AA 2V8VA 5EDWA 3FZ2A 1HBNA 1WI8A 1V5VA 3MMBB 4DR3J 3T1YF 1Y3JA 4GO7X 3GYXB 2KYXA 2F4VF 3KHLA 1U2CA 4UOCA 3AJDA 4NYOA 1V3ZA 4A8KA 5F3ZA 2XHCA 2BM1A 2MMYA 2AX1A 4C8MA 4J9NA 2I6WA 1R0AA 1OWXA 4E98A 1UVKA 4TN2A 2E1AA 2D9PA 4Q43A 4HEA9 1HNXF 4NEZA 3HHEA 5LXYA 2YNIB 4X66J 1X5TA 2DR8A 4YHHJ 1WC4A 3S6EA 2W01A 1S9GA 3HXMA 4TQRA 3AFGA 2YKPA 3V4IB 5KT5A 1XWLA 2B5JA 3DXBA 5HLFA 1TQLA 1XN9A 2YTCA 2ZITA 2HZVA 2W8KA 2WVCA 2ZM6F 5G4DA 2XSJA 1RB0A 4ANCA 4QR0A 1C0UB 2BE2A 3PYFA 5KT7A 1RXOB 3U1LA 4CI0B 2HFUA 4PAAA 1JLQB 5KG7A 7FDRA 1BQNB 4JV5J 1R8HA 4JI3J 4DBQA 2VDIA 4KO0B 3LALA 4OX6A 1GQEA 3PYGA 3CD6S 1Y5NB 4HR2A 4F7VA 2GA7A 3GMGA 3QT6A 3FBEA 2BJDA 5HJYA 4CH0S 4DF4A 4ZVRB 4ED8A 4ZN1A 2XY6A 5J2NB 2J0SD 2F4FA 2OEKA 3HJFA 1WEYA 4LSZB 3CXCR 4X4NA 1TKXB 3K7RA 3QFHA 1ZETA 4OZ3A 1RAOA 3C14A 2IJRA 4HACB 1Q82T 1S4EA 1VRQC 1OJ4A 2BQRA 4K0KF 4NLUA 1R31A 5KFMA 4OHYA 1X0FA 4MFBA 2V8PA 1UVNA 3AB2B 2YBVA 1FNXH 4I7FA 5IXUA 1KD1T 2GMHA 4FS2A 2Z56B 3M8PB 4ZOSA 2QTWA 3QSYB 3M2RB 6FDRA 5F8MA 5LMUJ 5KFDA 2IC3A 2JZ5A 3WDOA 2DVIA 1PILA 2QO3A 1FXLA 2E9ZA 5HVGA 1J5OB 2J6UA 1T05B 2B51A 2HHPA 4X2BA 1IJFB 3OPKA 3MM9B 2KN4A 1I6JA 2XTJP 1TVRB 1VQMS 5F41A 4KHPF 2UUBF 2VFTA 3MR5A 3SZ2A 3C6TA 3QLHA 3OXLA 3G82B 5KFJA 2HHHJ 4P74A 1U47A 1N32F 1R8CA 1NDPA 4I2QA 1WHYA 2PMHA 4FXDA 4F0MA 2P6TA 3CD5A 3AHPA 2V4JB 3QGGA 3ITHA 5IM0A 3D0HE 1S57A 1RT1A 3KG4A 2XS5A 2BMBA 2HNYB 4WCEQ 1RI7A 3Q2SC 2NSBA 1M1GA 3WX4A 4RBVA 2BOAA 2KG1A 3DRXA 1FK9A 2EK1A 2ZE2A 3CE8A 5C24B 5K14B 1BWVA 4LT6A 1FKOA 3KTQA 3HMJG 4ED1A 1TTHB 3HZGA 5GAEI 1Y4ZB 3EVWA 2VFVA 2DR6A 3CDAA 4RO0A 1I1GA 2CQIA 3KDNA 3QZ7A 1CQMA 2CYYA 3I55S 2H5JB 1GMVA 5KFCA 3OFFA 2H5IB 5GAHI 2CNOB 2RKIB 3OXFA 5KG6A 2WVBA 1KVKA 2MJUA 1U1KA 4ZHRB 2OD6A 2ZOGA 3PX4A 1CC7A 1BD6A 4UQGA 5GAGU 2D3UA 2XI3A 5HP1B 4GKJJ 1EKSA 2RB7A 2YWGA 3ISZA 3PRDA 4NASA 2CA9A 1O5JA 3CCQS 4FBUA 2YKMB 3W1YC 2R7UA 3CT9A 1IBCB 5E3QA 1R7IA 1LWCB 1FRLA 3GSIA 5IC6B 2DXFA 4X4VA 2F5GA 1HNIB 4OYWA 1Q53A 5HMZA 3MCOA 3TAMB 1HQUA 1TK8A 4IG0B 1OYEA 3ZNJ1 2H9ZA 1HNZJ 4HVZA 4U96A 3MM7B 2W2NP 1QD1A 4NWBA 4UOHA 3ILIA 4Q0BB 2MKIA 3FMWA 3G8SA 4DQPA 3GILA 2B4VA 3D54A 2MGZA 2C2KB 1R27B 3PW4A 2R2UA 1U26A 5FLXY 3KJFB 3QO9A 3HT3A 2NXEA 3W63A 4ZPTR 4U67Q 2CQ2A 2R8HA 1E6YA 3AXKA 1DQ8A 2PA8D 4ZVSB 4OQJA 3GSDA 3GJTB 1F5AA 2XG8A 1RCOB 5KG2A 2VA3A 1J5EF 5B0DA 4BCAA 2PDAA 1QY7A 4K59A 4DQQA 4DV0J 2RDDA 3U1NA 4NL5A 1WHXA 4OV6A 3QSIA 2JFKA 1Y7PA 4LF9J 3N6NA 2VIHA 2HFVA 2UUCJ 1T3NA 2E5JA 4TQSA 1Q86T 3OR2A 2RT3A 2BW2A 4YDXA 2ABYA 5D0GA 2V4RA 4FZVA 5KFUA 2DR7A 1R0BG 3UDLA 2QA4G 2Y1RI 3KK3A 3WQPA 2BRLA 2XLKA 3DOKA 4EZ9A 4TNOA 2XQCA 2LDYA 2MJNA 4JI5F 1EAYC 4X62F 4ZP6A 2DPJA 4LSLA 2Y1JA 1WF0A 6FD1A 3GP9A 1N48A 4OYAA 5LSLA 3OR1A 3RR8A 2HHSA 2RE1A 2GGPA 2GVDB 2O5DA 3M6WA 1DY3A 2C3YA 3VZIA 1AFIA 1TL4A 3PCOB 4JI2F 4CH7A 4X4PA 3DKDA 4MIWA 5GAGI 5IWAF 1HHQA 3HULA 3GPAA 4CO1A 1B7FA 1O6XA 3OTDA 1YITS 4MKYA 4OYOA 2WBRA 3O2IA 4Y3CA 3QWUA 2AYBA 4NI2B 3PO5A 2Z8QA 2OUGA 4CQ1A 2MKSA 1S1UA 4DFPA 4I6YA 3ZTRA 2F8MA 1VC5A 2LQ9A 3PW7A 4KBIA 4QJVA 4OLPA 4WXWA 3S1TA 4DZ6A 2B8QA 3R5AA 2D41A 3CDUA 3IM9A 1RT5A 4KC5A 2FPHX 3SQGB 3UD5A 3GJQB 1JLFA 2CWKA 3ILJA 5ETSA 2KHCA 2CNLB 4ALZA 2XI2A 4ZJLA 2KM8C 3R1HA 3S01A 4LUBA 1UCNA 2U1AA 1UAWA 3P49B 1ELOA 1G2EA 1RT7A 4LIWA 4ECUA 3DRPB 1XR7A 1EP4B 3P8BB 4QWDA 2FLPA 4DV3J 1NK7A 4XO0A 4USKA 3IRWP 3PX0A 2GQQA 4HHUA 4A8XA 3MMBA 4C8KA 1PBAA 3Q89A 4GKKF 3W2VB 3BGFA 1VQ8S 2MYFA 1X4EA 3K5MA 1ULRA 3W5ZA 4DL0C 4URQU 5M2UA 1V9OA 2N3LA 3NGTA 3D6FB 4L76A 4HLBA 3A8KA 3M32B 5KFYA 2RMLA 3KLEB 4B9SA 2CRLA 2YNIA 2QLBB 4DR4F 3T5LA 2BQUA 3G6ES 2HFSA 4AYBD 1BGXT 1CEZA 2R8GA 4LRAA 2CJAA 2JC0A 3EM1A 1MN7A 1X31C 1IBLJ 2ALYB 3V4IA 4G6VB 2HHWA 1HLWA 1S48A 3H90A 4ILLA 2BANB 3MCNA 4CO5A 1RYRA 1U6ZA 3D6TB 2AEJA 4A8FA 5IOLA 1FNOA 3SXLA 1C0UA 2ZZNA 1PJ6A 4EGLA 4X65F 3DLKB 4DR6F 4PABA 1B99A 1CJUB 2UXCF 4CLWA 1JLQA 2MQQA 1LK5A 3PJXA 1BQNA 3MTKA 4KO0A 5IFMA 3JYTB 3MFIA 2JJ4D 3OFEA 3WIVA 2IPOB 5FIIA 2VG6B 4MK9A 4AL6A 3IWLA 5J2NA 5ETKA 2V5HG 3OTOJ 1TKXA 3QT5A 2RF2B 4CM0A 3A3OB 1L3VA 3EPIA 2DGOA 1RGVA 1Q79A 3EPGA 4HACA 3DLLQ 2BM0A 1NKCA 5E2QA 4CNYA 1UPPA 2LCWA 3QRRA 4NYZA 5H9EJ 1H6KX 2WVDA 1UWBB 2HRUA 3NRBA 4XK8C 3P96A 5M2PA 3QAEA 4LF8F 4P71A 4GO5X 3P4UB 3M8PA 4PKDB 4RU9A 4KT0C 3M2RA 2Z58B 1N34F 1SUQB 1U1LA 4Y28C 5EWGA 4TLQA 5ETRA 4DMZA 1L3TA 2N4CA 3UDCA 4QOTA 1J5OA 1T05A 2PD1A 2Q3PA 5ETPA 3MM9A 5A6WA 1OSDA 5ETNA 4IQXA 1TVRA 2VKRA 2VD3A 4F3MA 1YIJS 3V5RA 5RUBA 2FVQA 4KRWA 4O4GB 3G82A 2EBEA 4BWJA 3D1HA 2RHQB 1B7YB 5C7PA 5KG1A 5JUMA 5CD4H 2V4QA 2DIUA 2ZHOA 1FD2A 4URSA 5K5MA 3GG0A 1U1RA 1VLOA 2YWEA 3RRHA 2V4JA 4ZITA 4DS4A 3THVA 3NAIA 1U8WA 3IFEA 2AX0A 2HNYA 3K5NA 1TUVA 3BN7A 2B9EA 1MNEA 2COLA 2DR9A 4J9QA 5IQ6A 5JMNA 2FTRA 2P9EA 1ZA1B 3OLBA 5C24A 5K14A 2B9XA 3I4PA 2XB2D 4LF1A 3KHRA 3LW5C 4Y0FA 1RK8A 1FX4A 4ZS6A 1UETA 2NSCA 3KK1B 3I31A 3T9NA 3JSRA 1WSRA 4EWTA 2BEFA 2OPQB 3NS6A 2J9DE 5KT4A 5BYQA 1WD6A 1PO6A 2HHQA 3ENQA 3UCZP 2FLOA 3IGNA 4QIFA 4PPDA 3O44A 2WOMB 1AW0A 3D66A 3BN4A 4ZHRA 3U7JA 5F8IA 1KVJA 3BYPA 3HZEA 5DG7A 4KR0B 5HP1A 1JX4A 2L41A 5EX0A 4LRCA 2BYCA 3VCDA 2MQLA 2YKMA 1EIYB 3DLJA 3JTNA 2V34A 1U1NA 1QAIA 3CMQA 4WKRA 2CQBA 1LWCA 1FWPA 2QIFA 3UR0A 2E5LJ 1RHUB 1HNIA 2R2SA 3NS5A 3TAMA 4F0KA 3G6VA 2PEHA 1SKSA 1TU0B 4IG0A 3MMJA 2IM2A 5KTQA 3MM7A 2IVFB 1NHKL 2JNJA 2MTLA 4LREA 2GIFA 2VV5A 4LJMA 3PRBA 4Q0BA 1QUVA 1R43A 3RB0A 2ACYA 2VQEF 1I94J 3QGPA 4N56A 4NCBA 3ULHA 3MEKA 3TJ8A 4A8MP 5J1NA 1FE4A 4F4XA 2VFRA 1X5OA 3W7BA 2FJXA 4QIWD 2D3ZA 2WW8A 4USWA 1UEUA 3EXCX 4CO4A 3FRYA 1GTEA 2CUYA 5L9NA 1WELA 4WK1A 2B7BB 1VQLS 2FZCB 4Z37A 2GQ2A 1S6UA 3G4SS 4K4XA 4Z7CA 1Q95G 4L73A 2HQDA 3G2XA 1RAEB 5DZ7A 1NDKA 3ENAA 2FJAB 3KJVB 2DXDA 1YQHA 4IKAA 4RU2A 2HWTA 1N54B 3DU6A 2HQGA 4OYMA 4MIBA 5HO4A 2HHXA 2J0XA 4WFNQ 3L3CA 1S1TB 2LLZA 2DNRA 1X8DA 3IMQJ 4F8RA 1RBLA 3RW7A 2I0XA 1F2GA 3Q8RB 4DQIA 2BOPA 1XNQJ 5B7WA 3FUYA 3V6HA 1KC8T 3ISNC 5HQMA 1FJCA 5K8MA 1Q78A 1K0VA 4GVBB 2I9SA 1JLCB 1KFSA 2RQKA 1NPPA 2RS8A 2R7VA 3CJQA 4A8OA 4DR7F 1SL2A 2GVDA 3R97A 8ATCB 1N88A 5A8KB 2IMWP 4ZKAA 2PO4A 1F60B 2MKKA 4G1PA 1AYEA 4YEAA 1RT6B 1IBKJ 2H48B 4ZVGA 1NSQA 4Y34A 3DLEB 4OIXA 3TP2A 5I3QA 4DV7J 3CCWA 4NX9A 2PT0A 3OVSA 1CJKB 4LRFA 3AB4B 2NREA 2W2OP 4NI2A 1XNRF 3D28A 1RQ0A 3D5MA 1Y10A 2M0GB 2EPIA 1H0HB 4YS2A 3W64A 1D8YA 3H8YA 1ZS6A 2DH7A 1UTAA 2A10A 1QE1B 4YR0A 4HYKA 4PXCA 1DJ0A 1FJGF 4ZMMA 5K8NA 4KJIA 3SQGA 3QIPB 3H5UA 1R3NA 2GS8A 5CYJA 1S1VB 3B4DA 4ENOA 4DQSA 3U02A 3PIPQ 2Z30B 3LF0A 3H5YA 3MECB 4RUCA 1VQSA 3VF0B 3D9BA 3CDEA 1OQ6A 4FYDA 4ZP9A 1YJWS 3DRPA 1ZM2A 4F3OA 1EP4A 2QA4S 4B3MJ 2V2VA 3CCMS 3DN9A 3I4HX 3ZZ0A 4KH1B 4WYLA 4P9SA 4F4WA 4IO1A 1RLDA 4J9OA 3JAMY 1IBMJ 4EO8A 4EUVA 2GZOA 3W2VA 1T9XA 4USIA 1DQAA 2JOQA 5T41A 1R6YA 2VOPA 2XZTB 3TO8A 4B9VA 3W8PA 4NLPA 3CGIA 3TVYA 4LFCF 3KDOA 4AQYJ 4ZPWR 3M32A 1G1XA 3W5YA 4DZDA 2GMLA 3ZFVA 3QWPA 1W25A 3KLEA 1FRHA 5JJBA 1MMLA 4Q8EA 2GIRA 2XMJA 3OLAA 2VF3A 3J81j 1NHUA 2K7KA 5AXMA 2DNYA 3KOAA 4YUDA 1B64A 2GW8A 2HZAA 5CYMB 4KGMA 3HI9A 2I8EA 2UVWA 1VQPS 2BANA 3QRQA 3CPWR 4S0MA 3ISND 3NOGA 2MQPA 4DL3A 3D7SB 3KHHA 2KVQE 4UT4A 1QDUB 3QGHA 4RW8B 3HK2A 4RX6A 3CCSS 2NPFA 3IGVA 2PGCA 3DLKA 2IHR1 6AT1B 1CJUA 3B4MA 2R8IA 4WBFA 2KKHA 1JMTA 4DCPB 3JYTA 1OQ3A 3K17A 4KTQA 2GVZB 2VG6A 3NBPB 2QMWA 3R8YA 4DUTA 5AJ3J 3SQOP 4H4MB 5H9FJ 2IA0A 3CJTA 2RF2A 1SIWB 1A9NB 1NJXA 4RJVA 2IVMA 4DR3F 1UZDA 4ZJOA 2MZTA 5F9LA 5A0YB 4DL5A 4EZ6A 1VQKS 4CO2A 3H4DA 4K4WA 3F73A 1O0PA 1UWBA 2W9AA 2AEMA 4LBIA 3QGIA 4JI7F 3CMES 1SJFA 2HBYB 3A13A 4FP9A 3OV7A 2R42A 5EHHA 1YZ7A 2LP4A 4PYDA 4U9RA 3IN5A 4D3GA 2VFUA 3H40A 2YWWA 1HBMB 1SUQA 2HZCA 3BGUA 4F4KA 1EHWA 5FLXU 1VISA 2EC2A 1KWMA 2NUHA 4PUOB 4Q7AA 1Q1KA 1X5PA 4J9VA 2C2DA 3D0IE 2VPWB 1CULB 3T1AA 3DDNA 4N8OA 1JXVA 2XGPA 3LGNA 4K5SA 4CT9A 4RR5A 4HKQA 5CA5A 3MZIA 3IBFB 5A6PA 2MLZA 4O4GA 3MM8B 5MAOA 3MR7A 2D1CA 2FJEB 5ETQA 5U47A 1RADB 3G8QA 1KQSR 3GR0A 1VQ9S 2R3VA 4RUHA 2XO7A 1LXNA 4ZP7A 5K9FA 3R5DA 2V0NA 2QYGA 3H42A 2OPPB 4DR5J 1U4BA 1AROP 1NK6A 2UXDF 2H3EB 2OSRA 2KVIA 1QJHA 3DRSB 1N0VC 4L72B 4NXNF 5LMNF 2EFGA 4B3SJ 2MQNA 1VR6A 2N7CA 3K8WA 3TWZA 9ATCB 3EDQB 1NK9A 4R5PB 2ILZA 4LQ9A 5HN0A 1I51B 1UKUA 4RNHA 3OQ2A 4DPXA 1TAUA 3KK1A 2KXFA 2CQ4A 4B3RJ 2OPQA 2ADCA 3D67A 3BSAA 1APSA 2WOMA 1Q8BA 1YDLA 3KLIB 2DO0A 2WSCC 2E9TA 3C15B 2R8KA 5K8OA 4ZVHA 2BACA 4NLSA 3IXQA 1LW0B 4DN9A 1RWMB 5L46A 2FVPA 3BBCA 3QFWA 2DIVA 4ZVTB 4MKAA 3NAHA 4DQRA 3QT8A 3O1LA 3US5A 3CC2S 4YY3F 2BQ3A 3LUYA 1WWHA 2ZH1A 2KG0A 4PWWA 1XR5A 2E1CA 3PM9A 1RTHB 4CT8A 1H2VZ 1S99A 2LECA 2ZH2A 3M8RA 1GX6A 1U09A 1SKWA 2UU9J 2O67A 2R8JA 2M2BA 4KFBB 3NS7B 1PYTA 1PYOB 3SI8A 4Q2MA 3RAXA 3R3TA 5FD1A 4O23A 2XWXA 1HARA 1HR0J 3AH6A 1AUDA 2CQCA 5DRKA 4LF4F 2BUNA 3PKMA 2RDIA 2J9EA 3DLHA 1RWNB 2UV8G 4YOEA 2FC8A 1WKJA 3CJ2A 5KFHA 5AXKA 3HHLA 1FDNA 2V94A 1M5OC 1SBRA 4X4QA 2FJBB 2YKNA 1ZAWA 4OI4A 5D0HA 5AT1B 2RHSB 2KXHA 4LR9A 1VI7A 1ZZNA 1I3OB 4NLGA 2OLWA 4RLEA 1JLBB 4KKOB 3PFOA 5H9EK 3R5GA 2BJEA 2NS1B 2YX1A 4O4RA 3C66A 1KHWA 3OHBA 1JK9B 4RNOA 3DRRB 5KFTA 3GCXP 1S0OA 3O6QA 3KJVA 2DNLA 4DL6A 4NOHA 3PR5B 1NK4A 2G2OA 1KR4A 2DHSA 2UVVA 3MOZA 5HVHA 3CJ0A 4IYQA 4MJKA 4GKJF 4JB8B 4C98A 1S1TA 1RE1B 2YX4A 1Q8LA 2HQFA 5F3TA 4DR2J 3M7VA 4CH1A 4TU8A 4KB7A 3HPOA 3LA0A 2NLWA 1HQEB 5I42B 4GVBA 2DGWA 1JLCA 2XZWA 4YB7A 2UUAF 3AD7C 5ITHA 2LA4A 1R8AA 4NLOA 2MEWA 4U8YA 3TOQA 5AE3A 5A8KA 4J9KA 2VBYA 5KFWA 2V9WA 5HQ8A 4XPEA 4N76A 3AA8A 4D3HA 1IR0A 1RT6A 1ZBTA 1M1HA 3MPDA 4PG4A 1N5SA 3VVTA 3DLEA 2EFQA 2IJNA 1CJKA 2W4CA 4DUZF 3HLUA 2QC3A 3CDBA 2LQBA 1FNMA 4OYBA 2AGQA 4JBCA 4K2JA 4TY9A 1KSPA 4M5NA 2DD8S 3ICLA 2A2CA 3OT9A 3NGUA 1LFPA 1AT1B 4J9RA 1QE1A 1HBOB 2ZKTA 3H98A 3TX0A 2RJZA 1Z2ZA 4M5MA 3QIPA 1JKHB 2RRNA 2VOOA 4C9DA 1JJ2R 5LSRA 4QIEA 5K8PA 1DQ9A 2CNNB 1S1VA 5J1PA 5E3PA 5K20B 1WEXA 2L3MA 1ZPWX 1TKDA 3TW0A 3BS9A 3HDSA 1VJQA 3MECA 3PG9A 1UFLA 2L9WA 2HW3A 3PHEA 4E0DA 4E8UA 1KTQA 3A8IA 2YKQA 4OZ1A 3KWMA 3BZQA 4LF7J 3LOUA 4YB5A 2HK3A 4QR2A 1FFSB 4LFAJ 3EGZA 1FKAF 1XBWA 3DCAA 3HM9A 3W62A 3AAWB 1VQYA 3T41A 1M5SA 1VBKA 5C5JA 1U1PA 3K59A 1CS4B 4FYVB 1S0MA 2Y1IA 4G1IA 4YQWA 4FF3A 2WCXA 4F0HA 1HKAA 2XYGB 4IUFA 1WF1A 2ZH6A 3RB3A 3ZXWA 3A3NB 1I5OB 2F3JA 4OZJA 2VU5A 3H25A 4ZP8A 2JHEA 2ATCB 2ZFHA 3A8EA 3IM8A 3KLGB 2IFXA 4P7VA 2ZD1B 4FNIA 1U1MA 1XMOF 3PKYA 5CYMA 1K8AT 4WU2A 3VAIA 4G1QA 1ICEB 2GC8A 5THWA 2RQCA 2FHKA 1BQXA 1IKXB 3MDFA 2AD9A 3KUHA 4RW8A 1NMEB 1BXNA 4YP3A 3OW2R 3PW0A 3I87A 2DNPA 3G9CA 2F4VJ 3TEHB 4KPYA 3MAAB 4CLUA 2DCLA 3GIJA 2FJWA 2W25A 2KFNA 1ZA2B 2HAIA 2JEFA 2VUGA 1OPZA 2DNOA 1WOOA 5D4PA 1F9FA 3LP0B 3OBIA 3D1OA 2GVZA 4B9TA 3IR5B 4KPCA 3NBPA 3JQMA 1UZHA 1HNXJ 3V6DB 3UNGC 2QL9B 4H4MA 1WTFA 4M5GA 4OZ5A 2M3DA 1KQGB 1U1QA 3SFUA 2MB0B 2ZOMA 3M8SA 3E51A 4WF9Q 2Z4PA 3HSZA 4PRFA 2W9CB 3VQSA 1VDHA 5A0YA 2H54B 5CZXA 1CPZA 1RWOB 2G0JA 1Z2LA 4DX5A 2KT2A 2BZ2A 2RNEA 2ZM6J 5D6GA 1YI2S 4HI1A 1VQOS 4DFKA 1S9EB 2MDAA 3DDIA 2AKWB 1FKPB 4AXJA 3MOJB 4X64F 3V4MA 1JLGB 4PWDB 4XDCA 2JLFA 1HBMA 3M9NB 4DR1F 3P5BP 4C8NA 3H2UB 2WSEC 1QAJA 3CCES 4PUOA 3K8VA 4IH6A 1NH8A 5L39A 1ZTWA 2BBEA 3OVAA 1CULA 3A1YG 3EICA 5DM7Q 2QFJA 1A0OB 2HURA 4PZVA 1L3KA 3ETOA 2CPHA 4DU7A 1HA1A 2NZ4A 4QWAA 4L3KA 5LL6d 4FS1A 1WKLA 3M2VB 5D3GB 1SCJB 5LT5A 4EFAC 3MM8A 2ZVSA 1FA0A 1MU2B 2CDRB 5IV3A 2JEIA 2YPYA 2X1FA 4DUYJ 1RHMB 4WYWA 1L3SA 4ZCKA 1AA1B 1NDCA 1K0TA 2G2ZA 4QPXA 3I0RB 4AL7A 4K0KJ 1D3WA 3R1LA 2GHVC 4IQMA 3FZBA 2OPPA 1RLCL 1VRUB 4ED3A 4KY3A 3BKTA 1HW9A 2HPUA 2FY8A 1W26A 2XLJA 4ILRA 4HL9A 2Q66A 3UCGA 3DRSA 3SV4A 3QJLA 2YWFA 3FQLA 5E7OB 3RRGA 3ET6B 1ROFA 4CYUB 2DH8A 4R5PA 1A6LA 3PNIA 2XHWA 1ZZFA 4ERDA 4LF6F 3EVOA 5DDPC 3ZZYA 1RACB 2DEIA 1RTDB 4NZ6A 3QATA 1KQKA 2UUBJ 1DBDA 1S10A 1F9EB 3CCLS 3KLIA 3BO2A 1TKZB 5KFZA 3C15A 5B08A 4ETZA 2BVZA 1N32J 1LW0A 4A8SA 2Z57B 2JVRA 1S0VA 1TAQA 2ZH9A 2CJQA 3BBBA 4DN0A 2F63A 3MXHP 1URNA 4Y2MA 1FX2A 1NDLA 1Y5IB 1RT2B 2HHVA 4NLVA 3ZTPA 2JFDA 2YWKA 1MMDA 5DZ6A 1RTHA 1F5CA 3CCUS 2ZKUA 4IFYB 2XYHB 2HSEB 1YZ6A 3R5BA 2UP1A 4KFBA 1SVDA 4ELVA 3IA0A 3QJPA 5AE2A 4CRJA 4I0WA 3GJRB 3LWLA 4RZRA 5ETMA 3Q8PB 3SCIE 1HYSB 2LXUA 1HD1A 4MK7A 2YQ1A 2OJ3A 3V81B 4P73A 2E7WA 1YVFA 2EXUA 2GGPB 1HNWF 3I9ZA 3NGSA 5HBMB 4DX8H 2VZ9A 3UI3A 1WF2A 1JLBA 4KKOA 1E6VB 5HANA 3GIRA 1EKRA 3I82A 2JEJA 2XCAA 3RTVA 3JAMU 1RAIB 1TMJA 3DRRA 1YWXA 4WK3A 2E66A 4N41A 4C6AA 4FKXA 1B0VA 3NNHA 4ZVQB 1UA1A 1N36J 3CCTA 4B02A 3VHQA 3WC0A 3UN3A 2YKAA 4B17A 3NOCA 2HVIA 1KVIA 1Y0HA 3FCVA 1WSVA 3RGIA 2L48A 3OTEA 3MTJA 3RAMA 2ZC3A 5IQQA 1M1KT 2XMAA 3V2UC 2OIHA 2FB0A 2Y8YA 1RT4B 4R25A 1SB6A 4LF5J 2HVZA 1JIHA 2KHDA 2MKCA 1H38A 2VA2A 5I42A 4ZVUB 4NYPA 4IR9A 2E5LF 2ZBIA 2MKYA 4W90B 4PYAA 4MKBA 2A0FB 4YN3B 2D74B 4M94A 3TANA 1NH7A 4K4TA 4ID5B 1X4CA 3DOLB 3FBFA 4JI4F 4NE9C 3F44A 2MZRA 2IDLA 4ZPVR 5AXLA 2MZQA 2W2MP 2POKA 1U48A 4ZN3A 2YY3A 3KJNB 3BSNA 3DYAB 2HQ3A 3KYLA 2RILA 4HDHA 2BJ1A 2R7TA 1SL1A 2KT3A 3BGOP 3OHAA 5KFVA 1T7PA 5B0CA 1L3UA 3JTPA 2XSFA 2F1FA 5I3UB 1SIZA 3TZXA 1FI4A 5KG0A 3MAQA 3OTBA 2Q6BA 4JI8F 4BC7A 3NG8A 4JI5J 4X62J 1HBOA 3NCRA 3R9LA 3UN2A 4U7UK 4U8VA 2FHJD 1JKHA 2IDEA 2K8GA 4Q2LA 1FWKA 3QMQA 1RT3B 3AQOA 3BGRB 4C8YA 4JI2J 1T03B 2RDJA 2X1AA 2FZKB 2KT5A 5LM7E 3MR2A 5CCLA 3CC4S 1JLAB 5IWAJ 1EETB 1XK8A 4JV2A 5D4LA 4EEYA 1MROA 1GXTA 5DLGA 2BXJA 1RAJA 1C4CA 1BQMB 2V63A 2VFSA 2KZZA 4OI1A 1K73T 2HAFA 4IDKB 1S1WB 3TAQA 3ILLA 3U1MA 1IXKA 2O3DA 1CS4A 1NSAA 3SFGA 2HIYA 1O51A 2QSWA 4NLWA 2Q79A 1PSDA 1EJ7L 3BGLA 3PIOQ 2F8EX 2XULA 2UV8A 2BR0A 5CABA 1VFJA 2ZEJA 3DXSX 3MCMA 4OHXA 1IBKF 2D9OA 3DC2A 2CPYA 2EKNA 1B0PA 2OELA 2QLJB 5I3PA 4DV2F 4ED7A 1TV6B 1JWWA 4HT7A 4UQTA 2A1BA 2KRRA 4PWUA 1D1UA 4RBTA 2WVEA 3KLGA 1D9DA 1SI9A 3DFEA 2H5EA 3SCJE 4DSIA 3VAJA 3M8WA 2CDQA 2ZD1A 1LWXA 2Z2LA 3GE9A 2RRBA 4KV8B 2FVCA 2VBWA 4F25A 3CD0A 1EX8A 1R8BA 1VK3A 4AL5A 3GG1A 2ASDA 2GO8A 2EEYA 1IKXA 3HHNB 4H54A 3K57A 1K1SA 3G96A 3PW5A 3H2LA 3BR8A 4GKKJ 3NY0A 1TKTB 1MMNA 3DRYA 3W9JA 4EO6A 3MAAA 3CD7A 2UVRA 5HAOA 1VQ5S 3WC2A 5C42B 4ELUA 3IBCB 5J2PB 3UNYA 4C4WA 3THPA 3MAHA 4OJ3A 3P6YC 1PJ7A 1IR1A 3LP0A 3LWMA 3I96A 2N7YA 4PR6A 4M63A 4ZPBA 2ZBQA 4PXDA 2ZNZA 3W3SA 1JJCB 1W7WA 2ZC4A 3V6DA 4ED4A 5EGYA 2OMLA 1F1BB 4DR4J 1NLKL 1TMMA 3N0VA 2YPZA 5KFBA 1S0NA 3JSYA 5M2RA 1JB0C 4LMZA 3K5PA 1SH2A 4ES2A 1VOMA 4ECVA 4OX7A 2ERRA 2L08A 3MF5A 2BJ7A 1YJUA 1EARA 1HPZB 2DITA 3N01A 1PIEA 2ASJA 1Q0NA 1ZAXA 2W9CA 4NZ7A 1OY6A 3LPEA 3LAMA 2BABA 2FVRA 5SUHA 2HG4A 4DCJB 1KRPA 4O3SA 1RU2A 1T11A 3HVAA 1S9EA 1TR0A 2R7XA 1YRTA 1FKPA 2JX2A 4LRDA 2XY5A 4DPYA 3EZ5A 2KZMA 2UXBF 1H2UX 1JLGA 5D15A 1LOUA 4PWDA 1TFYA 4X65J 4DR6J 2V8DA 3D2WA 4DSLA 5KT2A 3CF5Q 3CIMA 2UXCJ 2M4MA 3OL8A 1HW8A 1VIOA 2QZ8A 2LEBA 2A6MA 4DLGA 3SBMA 2FLLA 5E41A 1SH0A 1KN6A 2Z2YB 2RUSA 4F36A 4K7QA 1YK9A 1SJ1A 2OH2A 1IJEB 3M2VA 4Y6IA 2CG4A 2OO4A 3MUVP 5D3GA 2AJFE 5A8RB 1IKYA 1MU2A 4LR8A 3OFHA 1V6HA 2Y0SD 2C2RA 3PTWA 5IV4A 1PAEX 2D3OR 2DRDA 3I0RA 5EWEA 2HVDA 3ZZPA 3CCZA 2JH3A 5BYSA 1LWFB 1VRUA 2KFZA 2CJ9A 1FDDA 2DBBA 2EFNA 3HF5A 2ZHAA 2W24A 2M70A 3VV2B 4CWBA 4ZVOB 4OMFG 1O8BA 2VJVA 3MFHA 1N34J 1X60A 1R89A 3H59A 3CEDA 4FXWA 3ET6A 3PJ9A 4K50A 4CYUA 4IRDA 4LFBF 1NUEA 2OTJS 1SKUB 3L7OA 3A8JA 3TI0A 3WIUA 1S7IA 5A76A 3UDVA 4KAIA 1ZTTA 2K1RB 3NWGA 3JSMB 3ILOA 4CP5A 1RJJA 4NLYA 1RTDA 1S5ZA 4K4SA 1NK8A 3SCKE 4XAKA 1TK0A 1V3RA 2KO1A 4QW9A 4RW7B 1KS2A 3DGPB 3VGVA 3IS9B 1TKZA 2APOA 2C3UA 2HS4A 4Z7YA 4NLXA 5DM6Q 3M9OB 2IVYA 3CCVS 1OMSA 2PEBA 4OJ1A 1VGYA 2ZBCA 3FEYB 4ES1A 2OAUA 3RZAA 2BW7A 4M5IA 3P3DA 4QW8A 5DQGA 2XNRA 1RT2A 2NZCA 4HHHA 5DDQC 2LFVA 1SV5B 2M5YA 3M2UB 4YMEA 2AJ1A 4IFYA 4QQBA 1RTZA 3TRGA 4ZPAA 2D3O1 3MR3A 2DKOB 2Y9HA 4ZJQA 2DHGA 3OFGA 4R0JA 2LA6A 2LQ5A 4YDDB 4FBTA 2BJ8A 4QU6A 1UL3A 1CVJA 3KJQB 2CWXA 1HYSA 1A7GE 5EUHA 1RBOB 2V9KA 2DYAA 1P27B 3V81A 1JXLA 1YBAA 1K9MT 3HVTB 1ZPVA 2DCUB 1UA0A 2IBKA 3O3LA 3MMAB 5HBMA 4JP8A 1RHQB 2NXCA 4MT1A 2DRBA 3BO3A 3PY8A 3EWGA 4IG3B 1E6VA 3GFHA 2CQ1A 3BPSP 3OJSA 3KNGA 3NKYA 2BX6A 2F9DA 2AT1B 8AT1B 2IJFA 1RZMA 4JI0F 5F8LA 4DV4F 3C16B 1JLEB 4DPWA 4QWCA 4OL8A 3C6UB 3J7YU 2HHTA 1FHTA 4QWBA 1VRTB 2O1PA 3GONA 4USHA 5ADZA 2BV3A 3VAKA 4RNMA 1MWQA 2VQEJ 3D68A 3QJJA 3KG1A 3DHXA 1RT4A 3AODA 2DY9A 5F8JA 2YNFB 2NCKL 4JI1J 4ZA1A 3VGTA 1NXIA 3NCPA 4DHVA 1HWIA 7AT1B 3T5JA 3MCSA 2CQ3A 5HL7Q 3BBFA 5E0OA 3T6BA 4OHWA 2DHXA 2OHDA 2CJXB 1KHVA 1U8SA 3R7NB 5CXTA 3PR4A 2NPIA 4EMDA 4ID5A 3DOLA 2Q6CA 2X1BA 2VDHA 4M5DB 4HT5A 3M8QB 3R5JB 1JXEA 4TU9A 2ZH7A 1WORA 3TA2A 2ZZMA 2KL8A 5HMXA 1MG7A 3DYAA 3F41A 3RJMB 4XIUA 3MURP 1OY8A 2VHGA 4CIOA 4M95A 4QBUA 4OX9F 4ECWA 5I3UA 1S76D 1IUJA 1VJWA 3W65A 2PFDA 1RDRA 1YJTA 1EB0A 1C2PA 2AYMA 2G13A 4FPRA 4FN5A 2OFGX 1UWAA 4I6AA 1S6PB 3R2CJ 4DR7J 2QLFB 2GJIA 1IWGA 2MKJA 3N79A 2QEXS 1RT3A 3QNWB 3BGRA 1HI0P 4DEZA 1T03A 4N77A 4EBEA 1NJYA 2XM3A 3BKFA 1SJRA 1JLAA 1JJ4A 1EETA 3MPWA 1ACMB 4P2FA 2W8LA 2C22A 2AZ1A 1TUGB 2YNHB 3CJRA 4X4TA 1H2TZ 3UO0A 1FDAA 4NRUA 4L3NA 5HSPA 2R7OA 2LVWA 1BQMA 2E9RX 1M5VC 2OPSB 4U7UD 4IDKA 3VZHA 1KONA 1S1WA 1XNRJ 2A2DA 4I2PA 9RUBA 1VHFA 3PJWA 1H7XA 4WU3A 1P6TA 1D9FA 4RNNA 1QAYA 3N6LA 2MSTA 3MPUB 4IRKA 2AU0A 1PCAA 3J7YI 3OJUA 3J81Y 2DY1A 3JSBA 1X9MA 4EYHB 3PACA 1TV6A 3UR3C 1DTTB 2R2TA 5JVHQ 1QSYA 2ZOFA 2L9DA 3ZZZA 1NPKA 4PG6A 3CJKB 4ZIWA 4HI2A 4J7CA 5KFAA 4NLTA 1CG2A 3J7AN 4ECYA 1Q7LB 4KV8A 1VQ7S 4C8ZA 1FRIA 1RA7A 4OYXA 1HQ2A 1LV5A 3AY0A 2EG1A 1T9UA 2JC1A 1URRA 1UPMB 5ETVA 5L1IA 1J2VA 4OI0A 1XQIA 3S8SA 1EQ0A 1RHRB 2OD4A 4MAKA 1HWJA 1S7HA 2NXUA 1TKTA 4IFVB 4C7QA 2ZJPQ 3E3XA 2C28A 3ENWA 2O01C 1H73A 4C3LA 2WHOA 5C42A 5J2PA 4CCHA 2UUWA 3PFEA 4LFCJ 2B6AA 2DISA 3M30B 1H3DA 3HHLD 4H4KA 2WZ1A 4WZQA 4NXMJ 1CC8A 2M7SA 4RW6B 1T94A 2FHJA 4ZIVA 1F2HA 1YLXA 5A2QY 5KFXA 2QX0A 1YHQS 4PQUB 2D69A 4LF7F 1T9VA 1U0HB 5C2GA 1VC6A 1HPZA 4JOUA 2VODA 4J90A 1N52B 4F3QA 4Y2IA 4L74A 2J6TA 2B4OA 3KLHB 4I64A 5F8NA 3P45B 4HTIA 4HDGA 3IAM9 2MXYA 2B43A 4DDFA 3MD3A 2VKZG 3I9V9 4DX7A 1HWUA 4DV6F 1NU4A 1RUSA 3EZOA 2ADBA 4C11B 2LU1A 4CNZA 3KKFA 1FRXA 2KTQA 2MQMA 4CLZA 2ZWOA 2G4BA 2VJUA 3H5SA 4J9MA 2E5IA 1BY9A 2HS3A 4IOBA 4EBCA 2MZ1A 1VQNS 1DZ5A 2K3KA 3TJ9A 3GV7B 2FIUA 2I1RA 1Q5YA 3I32A 4BWMA 2DNHA 4ECTA 1WC1A 2HLUA 5A8RA 2AW0A 2DNGA 3BR9A 2E1RA 4PG8A 3AJ2A 2EK6A 4DLEA 1WUUA 5HJXA 4QYRA 4UZBA 1Z4UA 2FY1A 1JJHA 2QL7B 1LWFA 3A12A 3TQ1A 4OZ0A 1NB2A 2VBXA 4JI7J 3I0SB 3HVRA 3TQEA 5KG4A 3OSPA 2VPZB 2M8HA 3D3CJ 1Y5LB 2IIHA 3RBEA 1WC6A 1S1XB 5IS2A 3OL6A 5CD4A 3T1HF 4EU0A 1P9YA 4PXEA 4J9LA 1NEEA 1PC4A 3EGVA 4BDPA 1BLUA 5MLCV 1UVLA 1VK8A 2K1RA 3JSMA 1NK5A 3BSCA 1PG5B 3IRXB 3M1VB 2WSFC 2D7SA 5HI7A 1BUXA 3EXYA 3CVKA 2CPIA 5B0EA 3HHLB 5L38A 2GX8A 4RW7A 5GAEU 2ZH8A 2NYIA 3DGPA 3IS9A 3JB9k 2AJQA 2YKNB 2IRYA 4B3TF 3J7A1 5A8WB 1Y00A 3H5XA 3F56A 5GAHU 4O3NA 3RR7A 3TYTA 2H65B 3NNAA 1DFDA 4UTGA 4IH7A 2CIMA 3FNNA 4U95A 4ILMA 5BR8F 2UXDJ 1IKVB 3PHTA 3P5TL 2GJ2A 3GU0A 5HATA 4OZLA 4NXNJ 5LMNJ 2RRAA 4I1TA 1SV5A 2RH3A 4F4ZA 3M2UA 2FGOA 4IR1A 2LMIA 3KMSA 5B0AA 4XDDA 4Q5VA 1N56A 2GJFA 1KFDA 2WAQD 5DS7A 1QTNB 4KE5A 4DUYF 4PEOA 1UJ4A 1N5YB 4DI6A 1WC0A 4O3PA 4DFMA 2X1GA 3UE2A 4PQAA 2HGNA 4EYIB 1X5SA 4G3IA 1FXDA 2IRUA 3POTB 4KGKA 5D4NA 1WG5A 3HVTA 4V1Ak 4OFZA 2CKWA 3O5TB 5IC4B 3X1LB 1QSLA 3WBZA 2UVUA 3KHGA 1QVFR 3OXGA 1FEEA 3MMAA 4CTAB 4P72A 4GC7A 2VL1A 2IBOA 4NEYA 2E1MC 1W2IA 3GV5B 3MEEB 3U27A 2IM1A 4YY3J 4IG3A 2HLTA 3AOAA 3KLFB 2K06A 4DSKA 2V69A 2C42A 4ZVFA 3GB0A 2E5HA 3CJ8A 4WKYA 2BE7D 3C16A 3FKBA 1JLEA 1KEKA 3RYLA 2CADA 1U45A 4H4OB 3C6UA 2NR0A 1G4CA 1VRTA 2J7KA 4ED6A 1Q8IA 1VCTA 1UVJA 1ITPA 2XMVA 4JI6F 2GMJA 4LF4J 1SC4B 1F3FA 3EUNA 4DV5F 4EK2A 2C2EA 2CQ0A 2YNFA 3DLGB 4X84A 1RBAA 2XNQA 2B56A 3BO4A 3PDNA 2LYVA 2WONB 4LBHA 2VH7A 2V2ZA 4DSFA 2HS0A 3A3PB 4CO0A 4NZ0A 4CLLA 2XY7A 1OS5A 2ILYA 2XS7A 2XC9A 4ES3A 4C8OA 3Q23A 3IG1B 2PN6A 3UCUP 1VBYA 2LQJA 4M5DA 2P9GA 1HHSA 1C0TB 3Q8SB 3M8QA 2DGQA 4QYZJ 1NJWA 1YJVA 4ECRA 4FVCA 4ECQA 3H2VE 2AYGA 2DGSA 4FNHA 1C1CB 2W4DA 4M5KA 1LFWA 4OI6A 1GXLA 2PIIA 3PYEA 3ZZTA 4DV1F 4ZVEA 3O8WA 2DNZA 1D8ZA 2MPUA 5ETOA 3NL0A 1XR6A 2JLGA 1U0SA 4OYIA 1UFKA 4DPOA 4KYZA 4LVNP 1KDNA 4UY8T 4J91A 2DJWA 3UD3P 3NGRA 1FJEB 4Y00A 1U7LA 3X3UA 1REGX 1GAOA 4XTTA 2PC6A 1YJRA 4C2MA 2J7WA 3LP2B 1S6PA 5DGBA 2UUAJ 3E2EA 1N36F 4PCQA 1QM9A 4MYUA 2GQCA 3KK2B 3R6GB 4C48A 5GADU 3F0NA 2XMMA 3H7HB 4G1QB 3HFZB 3IAS9 3DU5A 1FEHA 2Y0BB 4TXSA 1XC9A 5DG8A 2YNHA 1NZAA 3A4TA 2WBMA 4LF5F 4DU8A 1BWEA 4DUZJ 4DG1B 2J0WA 2OPSA 3H20A 1T0TV 1L5UA 2PE8A 3LO3A 3GTYX 1DTQB 2Y8WA 2FHMA 2J8SA 1S97A 1KLMB 4O3RA 2HGLA 1QVGR 5JVGQ 3KNAA 4FYXB 1HMVB 1OO0B 4RNFA 3MM5B 3VQTA 1NM2A 2DNNA 2JDJA 2WW4A 2I5JB 1FTRA 3GR1A 4NPOA 1DTTA 2KDOA 1DLOB 1RWKB 3G8TA 3MPVA 1F3VA 4CM2A 1HI8A 3CJKA 2KFYA 2B9YA 3FSYA 3ZTSA 3CSKA 4Y65A 4RPFA 2ATLA 1TFWA 2B4PA 3I5CA 4MH8A 3DM2B 2WK4A 1T9TA 3WX8A 4JV1A 3D4JA 4USVA 1SC6A 5B0BA 3NMRA 4IFVA 4X66F 5CH7B 4O3OA 4YHHF 3MR6A 4UUXA 2G1HA 4OYPA 2V68A 1RU1A 4EI2A 2W9BB 1YJ7A 2MZJA 2G0CA 2ZDPA 4W4MA 3M30A 3CJ3A 1X7VA 2QLWA 2VPYB 1SKRA 2ZH3A 1V5IB 5EWFA 3QZ8A 1NO8A 3IO1A 2VG5B 2BRKA 3M8YA 3MPYA 4RW6A 1FCAA 1KQFB 4LQ3A 5FDLB 1P8GA 2C2NA 4PQUA 3SMZA 1U0HA 1R8PA 2CZ4A 3R27A 5CQGA 3HSDA 5HROB 5ETLA 1XMOJ 2SXLA 4DJBA 4LVOP 3BQ1A 2C3PA 3HX9A 2AIRB 4L6V3 4V19J 4TLRA 3KLHA 1M5HA 4LSNB 2ZBPA 3G87A 1OPIA 1IM6A 2A18A 4C3KA 5CAAA 1NBEB 1XJWB 4JV5F 1AFJA 4DF8A 5IT0A 4JI3F 3J7ZT 2HQCA 2V2QA 5AE1A 1HL6A 3EGWB 2HRYA 4C11A 4K2XA 2MY8A 3VAMA 5GADI 2MLYA 1GFWB 1RCXB 2HIQA 3QT7A 3RW6A 2FZGB 4M5HA 1G7CB 4KGVB 4RW9B 4DL7A 4NA3A 4ZVPB 3RBXA 4YB1P 2ZDOA 3IP0A 5KFGA 2V8GA 4G65A 3CO0P 4UZCA 3MMCB 2HFNA 3UN5A 1OIAA 4P2XA 3K89A 2VPXB 1HD0A 1UJ6A 4FF2A 2HBQB 5J2QB 3IC1A 4O44B 2J6SA 2YVSA 3RBDA 4WFAQ 4NMXA 3T5HA 2VASA 4I68A 5LMUF 2AJ4A 3QPIA 3LGMA 2CZVC 4B9NA 2R2RA 4GC6A 1PJ5A 1U24A 2XMKA 3SSRA 4MK8A 3I0SA 4ID8A 1NSPA 3THTA 4KHRA 4LBPA 3OD2A 4X64J 1YJNS 1TELA 1JNRB 3G6XA 2OTLS 1S1XA 4JYAJ 1RTJB 4DR1J 4I69A 1REVB 3V6JA 3BSOA 5KT3A 3Q8QB 1X9SA 2HHHF 2VICA 2W2PP 1TZ0A 3CIZA 3VR1A 2EFVA 4IOAQ 5AXNA 1AB8A 1B3TA 2OSQA 2XLIA 2X51A 2QYCA 3IRXA 4CLFA 1RAHB 3M1VA 3G6YA 3EE3A 1RKJA 4DS5A 1B70B 4GVLA 2MQ8A 4X4OA 4YB6A 4DSEA 4LIRA 2AJ0A 3T19A 4ECZA 5KFEA 1PC5A 1N33J 1P1LA 3T6JA 5HK4A 3BYRA 3DMJB 3MI7X 2YQ0A 3CUNA 4JV0A 3W9IA 1DHMA 5A8WA 3HHDA 2VB6A 1X4HA 5KFNA 2U2FA 5CHCB 4HH1A 5HVFA 3CJ5A 3ELHA 3TA0A 4ELTA 1XERA 1M0SA 4J37A 2PI5A 4AD6A 2Q43A 1IKVA 5KAKA 1SQEA 3SYZA 2BJ9A 3EJMA 4NLQA 3D1QA 1T9WA 1NZ8A 4ITSA 2KYZA 2CVIA 4LR7A 3T5KA 2Z2ZA 1X4AA 2DPIA 3ONQA 4DFJA 4QPTA 3LQVA 5DDRC 3UDEA 2KJVA 2F65A 4LF6J 2B9WA 3N5FA 2DRAA 2AV5A 1P9QC 3FMBA 3GIKA 1N5YA 1UW4A 4WP9A 1GMWD 2WB1D 3VGUA 1KKHA 3FK4A 2G9OA 1S79A 5BXIA 4WTOB 4J5OA 2HVHA 2C2MB 4HHJA 3GIMA 4F67A 2QN6B 1XTZA 1JQGA 3POTA 1U02A 2RIJA 4YR2A 1CJVB 3L7UA 4DXLA 3MEDB 4KHMA 1NNDA 2AZ3A 3UWTA 2NQPA 3FBBA 4CTAA 3ETMA 3HFVA 1HNZF 4LRBA 4QIVA 4IRCA 2CPFA 1MN9A 1SQFA 2UZAA 1T9YA 3MEEA 2YQ3A 1KOHA 3NGDA 3KLFA 1AUSL 4DSJA 2JWNA 2PFFB 2JLEA 4ZPCA 1QUPA 5GVQA 5EN1A 3LP1B 2DHAA 1IKWB 3VTIA 1LW2B 3QQCD 2LEPA 3B78A 1WOSA 3K2YA 4IOCQ 1RTIB 3RG6A 5HQLA 1IR2A 4ZCMA 2X3DA 4H4OA 4M8LA 2PMWA 4QU7A 3PV8A 1TL7B 2FC9A 3BDEA 2V2KA 1RYSA 3J81U 3MUMP 2V50A 2J7UA 1D09B 3SSSA 3W60A 2XWYA 1VS3A 4WTYA 2E5GA 3LPYA 2CG8A 2N3OA 1H74A 1GTHA 4NCGB 3DLGA 4ECSA 4UOGA 4DV0F 3FVYA 2WONA 1Q5VA 4C0BA 1KP6A 3OTCA 5L1LA 4LF9F 1OSCA 2OP5A 3TJAA 1WI6A 2PA3A 2W2QP 4NLRA 3PYDA 3T9ZA 3CC7S 1HNWJ 2CQHA 3KMQA 2UUCF 4N7TA 4I67A 2I2YA 1RISA 2AGOA 2XMWA 4CLTA 1YGYA 3IG1A 4RWXA 1LXJA 1PKUA 5E3CA 1C0TA 3VAFA 3AXMA 1RABB 2VQFJ 1MROB 1NSKL 2AF6A 2HMIB 1D0EA 1FRMA 2DGUA 2OPRB 3CJSA 2RKIA 1Q81T 3DOMB 4YFUA 1NK0A 3TVKA 3UW1A 2HBZB 2V8HA 1HNVB 1BMQB 1FVSA 2CNKB 1C1CA 5IZHA 3VVUA 2H4WB 2A3JA 1FD8A 2V6AA 1RHKB 3HVWA 2H51B 4WJBA 3TUIC 2HYIB 3C2PA 1UJ5A 1RWVB 4R0EA 2QGFB 3L9ZA 5A2QU 4ECXA 2BA9A 4ZLJA 4A47A 1S6QB 1HWLA 5IT9Y 2H1YA 3SIPB 5KFFA 5CYQB 2VC0A 4I6WA 1NKEA 2IA6A 3EX7B 4XPCA 1RAFB 3QAUA 2R7RA 2DB1A 2QA2A 3CB4A 3LP2A 5DGAA 3M6XA 1XMQJ 4JI4J 1SH3A 1UFWA 1KOOA 3KK2A 5F8GA 2KM8B 5GMDA 1UVIA 4QWEA 5KG3A 4C8LA 1T95A 4QIGA 4C0HA 5G0RB 2M8DB 4BC9A 1FVQA 2KU7A 5D0EA 3TAPA 3T1YJ 4RUAA 4JI1F 4DG1A 2QE5A 1LKZA 2W7PA 3C19A 2FJDB 3PW2A 4WXOA 3KUGA 1DTQA 4MTPA 3NWRA 1KLMA 4B3OB 1CBKA 3DHWC 2HNDB 4DPTA 2W1BA 4JI8J 2XMUA 5KFLA 3BM7A 2IRXA 1HMVA 4ICLB 2DEJA 1IN0A 1FERA 3MM5A 2M9KA 2DNQA 3CCJS 3UVJB 1X0PA 4DV3F 3BEGB 2G1DA 2I5JA 3CWJA 5CCMA 2OI2A 4P75A 1DLOA 3BV8A 1G3OA 3DLBA 4UY85 3PEJA 1WTBA 1FFWB 2X3GA 3HSGA 1CJTB 3K0JA 2QA1A 2JRSA 2E1PA 5B09A 3FQKA 3TVZA 5HMWA 1RAAB 2W7AA 3WHIA 2QV6A 2ROGA 2EW9A 3M9MB 2OFHX 3Q2TC 2ZJQQ 1VQ6S 1RKIA 3DM2A 4O0IA 3JXOA 1U6BA 2NUUG 4WFXA 4RKUC 2B0GA 3GQCA 3PVXA 3CDWA 4IO9Q 3ZTOA 1N5VA 4OHVA 3GLJA 3M8ZA 2LXFA 2VG7B 3Q24A 3LANA 3FDSA 1WC3A 2FGCA 2WTFA 5LOQA 1FO1A 4TVAB 3E01B 1K44A 3NLCA 4NCAA 3GFZA 5F0UA 2W9BA 2CJYB 5DQIA
chains in the Genus database with same CATH topology
2F4FA 2VJVA 2FYXA 2A6OA 2XQCA 2F5GA 2XMAA 2XO6A 2VHGA 2VJUA 2XM3A 2VIHA 2EC2A 4ER8A 2A6MA 2VICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4F A;  2VJV A;  2FYX A;  2A6O A;  2XQC A;  2F5G A;  2XMA A;  2XO6 A;  2VHG A;  2VJU A;  2XM3 A;  2VIH A;  2EC2 A;  4ER8 A;  2A6M A;  2VIC A; 
#chains in the Genus database with same CATH topology
 1IBL F;  3AOB A;  2K3I A;  2I38 A;  2BDP A;  5JXS A;  3R5C A;  2KJW A;  2OGU A;  2VG5 A;  3DI6 B;  5C25 B;  1SPB P;  3UPF A;  2P5V A;  4DV2 J;  4QCL A;  2ZWP A;  2WRM A;  1IKY B;  4BBY A;  1HBU B;  5FDL A;  5J2M B;  1IM4 A;  3TUJ C;  4K8R A;  2CJK A;  2FUG 9;  5HRO A;  1NPR A;  3TR5 A;  1UEK A;  3W5X A;  3FFI B;  4J9S A;  2CVE A;  1VHI A;  5DLF A;  5BJR A;  2J9C A;  4LSN A;  1NKB A;  2LKZ A;  4QYZ K;  1QSS A;  1RAG B;  2Y3Y A;  3SDE B;  2MHN A;  2ZUA A;  3BJY A;  4IH5 A;  3TX8 A;  3OTO F;  3QBC A;  4JUZ A;  2B4U A;  2HNZ B;  3J80 Y;  3FSI A;  2IM3 A;  1LEO A;  3EMT A;  2QJ3 A;  3N28 A;  4RW9 A;  3N4W A;  4ED0 A;  2QMX A;  4B9U A;  4N5S A;  2QRR A;  1C1B B;  4KHP J;  3EYZ A;  4ZCI A;  4MMO A;  3MMC A;  5KOW A;  1FES A;  4KIA A;  4I4B A;  5J2Q A;  2BJ3 A;  5KFP A;  4O44 A;  1H72 C;  2VON A;  1J27 A;  3LTO A;  3NP5 A;  1QTM A;  2R9L A;  1S6O A;  3CNQ P;  2BKN A;  1S9F A;  3I56 S;  3H0P A;  3AA9 A;  3FCW A;  1RP5 A;  2CPX A;  4FKY A;  3NXZ A;  1UMJ A;  4OV1 A;  3AD8 C;  4FYY B;  2MLX A;  2QLX A;  1VQ4 S;  5GME A;  4H4K C;  5L1J A;  2UXB J;  3RB4 A;  2ZHB A;  1TP7 A;  1RTJ A;  1PBU A;  4P2S A;  1YBU A;  2E44 A;  1REV A;  4NXM F;  3HD1 A;  4DCO B;  2ZNY A;  3B54 A;  2BKP A;  1U49 A;  3J7Z 5;  4Y2C A;  4PG5 A;  2CJB A;  2Q1L A;  5C2C A;  2OMO A;  2MZS A;  3W66 A;  3W2W B;  1X4B A;  5D4O A;  2CPD A;  3AD9 C;  3H4B A;  1OY9 A;  2HWI A;  4LF2 A;  4F26 A;  1S59 A;  1X4G A;  2CPZ A;  3RU0 A;  5D0R A;  2Y1L B;  2J5A A;  4USJ C;  3DMJ A;  2FYX A;  1DUR A;  2PI4 A;  1HIY A;  1WDT A;  3KLV A;  4W92 B;  4P6Q A;  4B9L A;  4X4S A;  5LJ5 Y;  1HI1 A;  1FRK A;  4RBU A;  3ZZO A;  2R7S A;  1H98 A;  2HWH A;  1UP1 A;  2C3M A;  1FF2 A;  1YJ9 S;  4MYT A;  3CW2 C;  1WOP A;  2ACM A;  4LFB J;  4NA2 A;  1N4L A;  1Y9O A;  4P52 A;  5ETT A;  2DGV A;  3VAL A;  1HFE L;  4GMK A;  4CLS A;  2DT9 A;  2HFZ A;  1MLA A;  1T02 A;  4RUB A;  4GRS A;  4A8Q A;  3L95 X;  2R7Q A;  2VBZ A;  4WP8 A;  4UF4 A;  3OUY B;  3FGV A;  1WC5 A;  2AHO B;  4WWS A;  4ED5 A;  1CJV A;  1UEV A;  3HFK A;  2GAG C;  3MED A;  3TZW A;  3IR6 B;  3NGK A;  4QZV B;  1J5E J;  1RWX B;  1F6T A;  1ZM3 A;  2IAJ B;  3MEG B;  4TY8 B;  5J1E B;  5LSO A;  4R8U B;  4CLP A;  2RU3 A;  1U25 A;  2C2Z B;  3ZZU A;  2QT7 A;  1I94 F;  3LP1 A;  1TL3 B;  1IKW A;  1IQZ A;  3R7B B;  3HKW A;  1WNE A;  1LW2 A;  2XO6 A;  3I5A A;  4P7T A;  5E3A A;  3BQ0 A;  3BF4 A;  5KG5 A;  1RTI A;  5T7L B;  4WFZ A;  1AZS B;  3D0G E;  5T14 A;  2YWH A;  2RQ4 A;  1TL7 A;  2YNG B;  2GHP A;  5D8H B;  5GMK a;  2FJV A;  3KUE A;  1EZZ B;  5KFS A;  4K4V A;  5EX3 A;  2DGX A;  2F9J A;  2FLN A;  3UFC X;  1YG0 A;  3K5O A;  4RW4 B;  1G6B A;  4NCG A;  1LNQ A;  3Q0A A;  4F02 A;  2YXL A;  2LXI A;  4I56 A;  1U6F A;  1TL1 B;  2ROP A;  3IWN C;  2E7V A;  3B6B A;  3LH2 S;  2QG9 B;  5DQH A;  1Q4R A;  4Y2K A;  2J0Q D;  3RB6 A;  4C97 A;  4W98 A;  4URG A;  1FDB A;  3RBZ A;  2AJ2 A;  4Q44 A;  1XMB A;  3LAK A;  4JI0 J;  2HMI A;  1KBR A;  2HK2 A;  4DV4 J;  4A48 A;  2OPR A;  3TA1 A;  3NNC A;  3N5B A;  3DOM A;  4X4R A;  3TUZ C;  1XNQ F;  4WIQ A;  3K5L A;  1R6V A;  2RS2 A;  3T3F A;  2CZ9 A;  3MHY A;  1HNV A;  2ASY A;  4FF1 A;  4I2P B;  1BC6 A;  1QAX A;  3RUB L;  1LWE B;  1N5T A;  3Q8V A;  3RAQ A;  4EBD A;  2AP6 A;  1GMW A;  2HRT A;  5D78 A;  1WG4 A;  2EC0 A;  1S4F A;  2XYP B;  4F2R A;  4C3M A;  3Q86 A;  1S6Q A;  3GYN A;  3IBW A;  1ZYQ A;  3JQJ A;  5CYQ A;  2ASL A;  2OEM A;  2IY5 B;  4CLY A;  2G2Y A;  2GHW A;  5BYR A;  3I6P A;  2AMC B;  2EBG A;  3L7P A;  1IWA A;  4DV7 F;  1MWY A;  2VC1 A;  4K5R A;  4USM A;  1GK8 A;  4CLK A;  1H7W A;  1S49 A;  1DAX A;  3B82 A;  4KQZ A;  4K4Y A;  3GFY A;  5KT6 A;  2E29 A;  2A6O A;  1WKK A;  2P8I A;  2NXN A;  2YKO A;  5G0R A;  1ZM4 A;  3M4X A;  4WE1 B;  3HD2 A;  2HHU A;  2QSF A;  5F9N A;  2HGM A;  4OX8 A;  3FJ2 A;  2YH0 A;  1RSC A;  2M88 A;  3DNC A;  4K4Z A;  1BHN A;  1XIQ A;  4OX9 J;  4NML A;  1WAC A;  2B7C B;  1LQ9 A;  2OKQ A;  3TNV A;  2GNK A;  3DGV A;  4DX6 A;  4B3O A;  2HND A;  2CXE A;  4WPA A;  2B6A B;  1Q8K A;  3L09 A;  3R2D J;  4ICL A;  2M52 A;  2E7X A;  4OJH A;  2MSS A;  4ATN A;  3UVJ A;  3HO1 A;  1FTC A;  4B3M F;  1RHJ B;  4F04 B;  1VYA A;  8RUC A;  1SC3 B;  4KGX B;  4P10 A;  2QL5 B;  3FBC A;  1NHV A;  4E2F B;  1SL0 A;  2EKY A;  2N82 B;  4WZM A;  1OYD A;  2GV1 A;  1FWL A;  1IBM F;  1S12 A;  3VGS A;  1GNK A;  3MWB A;  3TZY A;  3I5B A;  1CJT A;  2P2C B;  2FDN A;  4F4A A;  5DET A;  4HTJ A;  3FC9 A;  1T3O A;  2XGQ A;  1QLN A;  1GX5 A;  3BQ2 A;  5D77 A;  2BKO A;  5KFI A;  2FHO B;  4AQY F;  3PEH A;  2K7J A;  2EWH A;  4PPZ A;  4Z2X A;  3FEZ A;  1N6Q B;  2VG7 A;  2XZD B;  3CMA S;  2PSZ A;  3QID A;  3SCL E;  3MM6 B;  1KLN A;  2R7W A;  4V19 X;  3CTR A;  1SJ3 P;  5DO2 A;  4MIA A;  5CZV A;  3E01 A;  1R0C B;  3DDK A;  3R6L B;  5DG9 A;  4OI3 A;  4F50 A;  4NRT A;  2IYG A;  1N8R T;  2IM0 A;  4ZPD A;  2XCP A;  1C4A A;  5E3R A;  3AJ1 A;  4PXB A;  2AEF A;  4ED2 A;  3D3B J;  3DI6 A;  4Q8F A;  5C25 A;  4AND A;  1HBN B;  2IMO A;  1HBU A;  5J2M A;  4CO3 A;  1D9A A;  3V6K A;  2WVF A;  3CCR S;  3PXG a;  1Y3K A;  2N4D A;  2RUG A;  3FFI A;  3GWC A;  1AXQ A;  2ROE A;  1P1T A;  2ZVI A;  2RSQ A;  2JVO A;  1IQT A;  4LF8 J;  4YR3 A;  4FVM A;  2DTJ A;  2DHH A;  3ZC4 A;  3SDE A;  3R7S B;  2OEJ A;  1R0A B;  4UST A;  3PZP A;  1SJ4 P;  2ZH4 A;  5AJ3 F;  4M5L A;  2HNZ A;  2CQG A;  4A46 A;  1NAQ A;  3HHK A;  3TUP A;  2EI5 A;  1S9G B;  4M1K A;  4QR1 A;  1ZM9 A;  4ZLP A;  3CO9 A;  2KB2 A;  3BH7 B;  2C3O A;  2O66 A;  2B5J B;  1C1B A;  3BB5 A;  2YH1 A;  4OLO A;  3AOC A;  5HLF B;  1WHW A;  4TKT A;  4WP3 A;  1YTY A;  2XSJ B;  3OVB A;  3D6H B;  3VAG A;  1WJ9 A;  5E5N A;  3PO4 A;  3GV8 B;  3MGJ A;  3SEO A;  4A8W A;  2BE2 B;  3CJ4 A;  4FDF A;  3EGN A;  1CSJ A;  2AWZ A;  3C8Y A;  3VWS A;  4NA1 A;  2V67 A;  1PAU B;  1FFG B;  2ALZ A;  4OHZ A;  1S72 S;  4DV6 J;  4U6P A;  1NCL A;  4ZLL A;  4OI2 A;  1GXU A;  2FVS A;  2KH9 A;  2DH9 A;  1YRX A;  2W7O A;  2QFI A;  5F8H A;  1RWU A;  3W9H A;  3B8H A;  2HFO A;  2P6S A;  2RD5 C;  1WEZ A;  2MY7 A;  1SXL A;  4DL4 A;  2JL9 A;  2GO9 A;  3C14 B;  3KXD A;  4F4Y A;  2F8H A;  3HJV A;  2LQ8 A;  4NLD A;  3PX6 A;  2HQI A;  2XMT A;  5DDO C;  3W2W A;  4DR5 F;  2C2O B;  4MFB B;  3W61 A;  1VLY A;  1Y11 A;  1X4F A;  1HWK A;  2Z0G A;  1U2F A;  4I7F B;  1TL5 A;  3TEG A;  1YRU A;  2DXE A;  4P2M A;  1GH8 A;  1N5Q A;  3FCH A;  3GII A;  2J9D A;  2ZZT A;  3SV3 A;  4RL1 A;  4B3S F;  5HMY A;  4O3Q A;  3NEK A;  3M05 A;  2IC3 B;  2K2P A;  3EZU A;  3MUT P;  1CLF A;  1FRJ A;  1VIX A;  3JQK A;  1ZAV A;  1PGZ A;  4UOF A;  1NJZ A;  1PYS B;  3NCQ A;  1MSW D;  4ER8 A;  2CQD A;  4KGZ B;  3N6M A;  2ZH5 A;  4B3R F;  1B0T A;  2CPE A;  3Q83 A;  4ZCL A;  4OJG A;  3QRP A;  1S77 D;  2RQM A;  3HT0 A;  1VMB A;  3C6T B;  3Q22 A;  3QLH B;  3Q8U A;  2WB4 A;  3T1H J;  4WII A;  2AQ4 A;  5F0W A;  2DK2 A;  3BDP A;  5IT9 U;  4PG7 A;  2EFO A;  1WDD A;  1XEZ A;  4I2Q B;  4RWW A;  1NB7 A;  2MKH A;  3ITH B;  5IM0 B;  5SZT A;  3EVM A;  1RT1 B;  2MHE A;  5KFR A;  4USU A;  2GFF A;  1M5P C;  3OUY A;  4B08 A;  4ZDN A;  4BS2 A;  3L4B C;  3GYG A;  3WZ0 A;  4B3T J;  2RVJ A;  1FK9 B;  3GCW P;  2ZE2 B;  1BE4 A;  1VC0 A;  2GCF A;  2DNK A;  2XBP A;  4JYA F;  4FYW B;  5I4M A;  2UU9 F;  1FKO B;  1F0X A;  4DWI A;  3G71 S;  2W4P A;  2IAJ A;  4O0N A;  4ANE A;  2XS2 A;  3MEG A;  4TY8 A;  5J1E A;  4F2S A;  4X4U A;  5BR8 J;  4R8U A;  3GFX A;  2IYI A;  4AT1 B;  4MKV A;  5DJB A;  1HR0 F;  4AUK A;  2R4F A;  1TL3 A;  3UQS A;  3OSN A;  4TU7 A;  3HHL C;  3JTO A;  4WFB Q;  3UD4 P;  5T7L A;  1AZS A;  3N9U C;  1NJI T;  3CUL A;  4OZN A;  7FD1 A;  2YNG A;  2B8P A;  1N33 F;  4J9P A;  1ZH5 A;  3BH6 B;  3C46 A;  5B0F A;  2EVZ A;  3TZZ A;  1F9H A;  2FQQ B;  4HH0 A;  3ZTQ A;  2LDI A;  3Q8Y A;  3AT1 B;  5LJ3 Y;  4RW4 A;  5FJ4 A;  4ZLN A;  3M6V A;  1RWP B;  1IVZ A;  2KI2 A;  1HQU B;  3BPD A;  2FD2 A;  4AE5 A;  1TL1 A;  2AGP A;  2ZBR A;  1Q7Y T;  1Z1Z A;  3QYY A;  3G86 A;  1B4S A;  2NYH A;  5KOX A;  1F5B A;  4ETX A;  1FJ7 A;  1M90 T;  2YX7 A;  2F40 A;  2MGZ B;  3ENV A;  1YBT A;  2B3T B;  3QO9 B;  2KRB A;  1YX2 A;  2F7V A;  2DNM A;  3EDR B;  3GJS B;  3PRV A;  4DR2 F;  4B9M A;  3K58 A;  1WG1 A;  3MD1 A;  3M6U A;  4KH0 B;  4UUW A;  1E6Y B;  4CZC A;  3FRZ A;  3ADA C;  1SC1 B;  1RA6 A;  1U2R A;  2RU9 A;  2QMU B;  3ZO7 A;  2JEG A;  1EQM A;  4DL2 A;  1DAR A;  2UUT A;  4JI6 J;  2C1E B;  2J8A A;  3FEX B;  4FF4 A;  3VAH A;  1LWE A;  5B0G A;  1SJQ A;  1X4D A;  1JNZ B;  1CQN A;  1UVM A;  3S7R A;  4DV5 J;  1V3S A;  1VBX A;  4UW2 A;  4WFY A;  4N47 A;  2DGT A;  1TUW A;  4DOZ A;  4A4J A;  2G0I A;  3ZNU A;  3GZ7 A;  1FJG J;  1T8E A;  5IT4 A;  3OL7 A;  1MW7 A;  4CDI A;  2X7I A;  4FXV A;  3JS9 A;  3KFW X;  3HP6 A;  3FSX A;  5LXR A;  2ZJR Q;  4DPU A;  2GAH C;  4TYA A;  1YKW A;  3OR2 B;  3HKZ D;  3C3L A;  3OL9 A;  2PMZ D;  1VBZ A;  5KFO A;  1Q16 B;  1GEH A;  5L8R C;  3HSJ A;  2HEK A;  3KK3 B;  4A8Y A;  1TK5 A;  2Z2M A;  3BRE A;  3HCX A;  4WE1 A;  1K1Q A;  1NRK A;  3DOK B;  4M5J A;  3J80 U;  1ZOT A;  2DR5 A;  4OZ2 A;  2KXN B;  2BE9 B;  2CFX A;  3W8G A;  1UW9 A;  1LK7 A;  4BHQ A;  3RRK A;  1K47 A;  4LSL B;  2CQP A;  3IWX A;  4ZK7 M;  2CAJ A;  5H9F K;  3BKU A;  2AYE A;  5E33 A;  4DV1 J;  3OR1 B;  4N8N A;  3AQP A;  3ZZR A;  2J76 E;  4U7C A;  1YSJ A;  1U1O A;  2XEX A;  5KFQ A;  3NMA A;  2P9C A;  2ZUG A;  5L1K A;  1GT8 A;  5KFK A;  2VQF F;  4L75 A;  4OYZ A;  2LEA A;  2GIQ A;  2MQO A;  2LU2 A;  1FE0 A;  3E8O A;  1WHV A;  1X9W A;  4LFA F;  2NXJ A;  1HHT P;  2L9N A;  3IR7 B;  1S1U B;  2H4Y B;  1KTV A;  4Q45 A;  4AFF A;  2RAQ A;  4TYB A;  5L9X A;  2CPJ A;  4BLG A;  1FT8 A;  3TAR A;  1N0U A;  2HKE A;  1MWZ A;  3SSQ A;  4FPI A;  4K4U A;  2HBR B;  3KG0 A;  5H1S V;  1RT5 B;  2JSX A;  4KSE B;  1FXR A;  1KNZ A;  1HQE A;  2DO4 A;  1JLF B;  1M5K C;  3LGH A;  1N6Q A;  2HVE A;  4AXI A;  1DRZ A;  4J9U E;  1XMQ F;  1GMU A;  3MM6 A;  2EFP A;  1W2B R;  1RT7 B;  2EG2 A;  1RWW B;  4C0O C;  1SQG A;  3D6M B;  4Y2A A;  2V8V A;  5EDW A;  3FZ2 A;  1HBN A;  1WI8 A;  1V5V A;  3MMB B;  4DR3 J;  3T1Y F;  1Y3J A;  4GO7 X;  3GYX B;  2KYX A;  2F4V F;  3KHL A;  1U2C A;  4UOC A;  3AJD A;  4NYO A;  1V3Z A;  4A8K A;  5F3Z A;  2XHC A;  2BM1 A;  2MMY A;  2AX1 A;  4C8M A;  4J9N A;  2I6W A;  1R0A A;  1OWX A;  4E98 A;  1UVK A;  4TN2 A;  2E1A A;  2D9P A;  4Q43 A;  4HEA 9;  1HNX F;  4NEZ A;  3HHE A;  5LXY A;  2YNI B;  4X66 J;  1X5T A;  2DR8 A;  4YHH J;  1WC4 A;  3S6E A;  2W01 A;  1S9G A;  3HXM A;  4TQR A;  3AFG A;  2YKP A;  3V4I B;  5KT5 A;  1XWL A;  2B5J A;  3DXB A;  5HLF A;  1TQL A;  1XN9 A;  2YTC A;  2ZIT A;  2HZV A;  2W8K A;  2WVC A;  2ZM6 F;  5G4D A;  2XSJ A;  1RB0 A;  4ANC A;  4QR0 A;  1C0U B;  2BE2 A;  3PYF A;  5KT7 A;  1RXO B;  3U1L A;  4CI0 B;  2HFU A;  4PAA A;  1JLQ B;  5KG7 A;  7FDR A;  1BQN B;  4JV5 J;  1R8H A;  4JI3 J;  4DBQ A;  2VDI A;  4KO0 B;  3LAL A;  4OX6 A;  1GQE A;  3PYG A;  3CD6 S;  1Y5N B;  4HR2 A;  4F7V A;  2GA7 A;  3GMG A;  3QT6 A;  3FBE A;  2BJD A;  5HJY A;  4CH0 S;  4DF4 A;  4ZVR B;  4ED8 A;  4ZN1 A;  2XY6 A;  5J2N B;  2J0S D;  2F4F A;  2OEK A;  3HJF A;  1WEY A;  4LSZ B;  3CXC R;  4X4N A;  1TKX B;  3K7R A;  3QFH A;  1ZET A;  4OZ3 A;  1RAO A;  3C14 A;  2IJR A;  4HAC B;  1Q82 T;  1S4E A;  1VRQ C;  1OJ4 A;  2BQR A;  4K0K F;  4NLU A;  1R31 A;  5KFM A;  4OHY A;  1X0F A;  4MFB A;  2V8P A;  1UVN A;  3AB2 B;  2YBV A;  1FNX H;  4I7F A;  5IXU A;  1KD1 T;  2GMH A;  4FS2 A;  2Z56 B;  3M8P B;  4ZOS A;  2QTW A;  3QSY B;  3M2R B;  6FDR A;  5F8M A;  5LMU J;  5KFD A;  2IC3 A;  2JZ5 A;  3WDO A;  2DVI A;  1PIL A;  2QO3 A;  1FXL A;  2E9Z A;  5HVG A;  1J5O B;  2J6U A;  1T05 B;  2B51 A;  2HHP A;  4X2B A;  1IJF B;  3OPK A;  3MM9 B;  2KN4 A;  1I6J A;  2XTJ P;  1TVR B;  1VQM S;  5F41 A;  4KHP F;  2UUB F;  2VFT A;  3MR5 A;  3SZ2 A;  3C6T A;  3QLH A;  3OXL A;  3G82 B;  5KFJ A;  2HHH J;  4P74 A;  1U47 A;  1N32 F;  1R8C A;  1NDP A;  4I2Q A;  1WHY A;  2PMH A;  4FXD A;  4F0M A;  2P6T A;  3CD5 A;  3AHP A;  2V4J B;  3QGG A;  3ITH A;  5IM0 A;  3D0H E;  1S57 A;  1RT1 A;  3KG4 A;  2XS5 A;  2BMB A;  2HNY B;  4WCE Q;  1RI7 A;  3Q2S C;  2NSB A;  1M1G A;  3WX4 A;  4RBV A;  2BOA A;  2KG1 A;  3DRX A;  1FK9 A;  2EK1 A;  2ZE2 A;  3CE8 A;  5C24 B;  5K14 B;  1BWV A;  4LT6 A;  1FKO A;  3KTQ A;  3HMJ G;  4ED1 A;  1TTH B;  3HZG A;  5GAE I;  1Y4Z B;  3EVW A;  2VFV A;  2DR6 A;  3CDA A;  4RO0 A;  1I1G A;  2CQI A;  3KDN A;  3QZ7 A;  1CQM A;  2CYY A;  3I55 S;  2H5J B;  1GMV A;  5KFC A;  3OFF A;  2H5I B;  5GAH I;  2CNO B;  2RKI B;  3OXF A;  5KG6 A;  2WVB A;  1KVK A;  2MJU A;  1U1K A;  4ZHR B;  2OD6 A;  2ZOG A;  3PX4 A;  1CC7 A;  1BD6 A;  4UQG A;  5GAG U;  2D3U A;  2XI3 A;  5HP1 B;  4GKJ J;  1EKS A;  2RB7 A;  2YWG A;  3ISZ A;  3PRD A;  4NAS A;  2CA9 A;  1O5J A;  3CCQ S;  4FBU A;  2YKM B;  3W1Y C;  2R7U A;  3CT9 A;  1IBC B;  5E3Q A;  1R7I A;  1LWC B;  1FRL A;  3GSI A;  5IC6 B;  2DXF A;  4X4V A;  2F5G A;  1HNI B;  4OYW A;  1Q53 A;  5HMZ A;  3MCO A;  3TAM B;  1HQU A;  1TK8 A;  4IG0 B;  1OYE A;  3ZNJ 1;  2H9Z A;  1HNZ J;  4HVZ A;  4U96 A;  3MM7 B;  2W2N P;  1QD1 A;  4NWB A;  4UOH A;  3ILI A;  4Q0B B;  2MKI A;  3FMW A;  3G8S A;  4DQP A;  3GIL A;  2B4V A;  3D54 A;  2MGZ A;  2C2K B;  1R27 B;  3PW4 A;  2R2U A;  1U26 A;  5FLX Y;  3KJF B;  3QO9 A;  3HT3 A;  2NXE A;  3W63 A;  4ZPT R;  4U67 Q;  2CQ2 A;  2R8H A;  1E6Y A;  3AXK A;  1DQ8 A;  2PA8 D;  4ZVS B;  4OQJ A;  3GSD A;  3GJT B;  1F5A A;  2XG8 A;  1RCO B;  5KG2 A;  2VA3 A;  1J5E F;  5B0D A;  4BCA A;  2PDA A;  1QY7 A;  4K59 A;  4DQQ A;  4DV0 J;  2RDD A;  3U1N A;  4NL5 A;  1WHX A;  4OV6 A;  3QSI A;  2JFK A;  1Y7P A;  4LF9 J;  3N6N A;  2VIH A;  2HFV A;  2UUC J;  1T3N A;  2E5J A;  4TQS A;  1Q86 T;  3OR2 A;  2RT3 A;  2BW2 A;  4YDX A;  2ABY A;  5D0G A;  2V4R A;  4FZV A;  5KFU A;  2DR7 A;  1R0B G;  3UDL A;  2QA4 G;  2Y1R I;  3KK3 A;  3WQP A;  2BRL A;  2XLK A;  3DOK A;  4EZ9 A;  4TNO A;  2XQC A;  2LDY A;  2MJN A;  4JI5 F;  1EAY C;  4X62 F;  4ZP6 A;  2DPJ A;  4LSL A;  2Y1J A;  1WF0 A;  6FD1 A;  3GP9 A;  1N48 A;  4OYA A;  5LSL A;  3OR1 A;  3RR8 A;  2HHS A;  2RE1 A;  2GGP A;  2GVD B;  2O5D A;  3M6W A;  1DY3 A;  2C3Y A;  3VZI A;  1AFI A;  1TL4 A;  3PCO B;  4JI2 F;  4CH7 A;  4X4P A;  3DKD A;  4MIW A;  5GAG I;  5IWA F;  1HHQ A;  3HUL A;  3GPA A;  4CO1 A;  1B7F A;  1O6X A;  3OTD A;  1YIT S;  4MKY A;  4OYO A;  2WBR A;  3O2I A;  4Y3C A;  3QWU A;  2AYB A;  4NI2 B;  3PO5 A;  2Z8Q A;  2OUG A;  4CQ1 A;  2MKS A;  1S1U A;  4DFP A;  4I6Y A;  3ZTR A;  2F8M A;  1VC5 A;  2LQ9 A;  3PW7 A;  4KBI A;  4QJV A;  4OLP A;  4WXW A;  3S1T A;  4DZ6 A;  2B8Q A;  3R5A A;  2D41 A;  3CDU A;  3IM9 A;  1RT5 A;  4KC5 A;  2FPH X;  3SQG B;  3UD5 A;  3GJQ B;  1JLF A;  2CWK A;  3ILJ A;  5ETS A;  2KHC A;  2CNL B;  4ALZ A;  2XI2 A;  4ZJL A;  2KM8 C;  3R1H A;  3S01 A;  4LUB A;  1UCN A;  2U1A A;  1UAW A;  3P49 B;  1ELO A;  1G2E A;  1RT7 A;  4LIW A;  4ECU A;  3DRP B;  1XR7 A;  1EP4 B;  3P8B B;  4QWD A;  2FLP A;  4DV3 J;  1NK7 A;  4XO0 A;  4USK A;  3IRW P;  3PX0 A;  2GQQ A;  4HHU A;  4A8X A;  3MMB A;  4C8K A;  1PBA A;  3Q89 A;  4GKK F;  3W2V B;  3BGF A;  1VQ8 S;  2MYF A;  1X4E A;  3K5M A;  1ULR A;  3W5Z A;  4DL0 C;  4URQ U;  5M2U A;  1V9O A;  2N3L A;  3NGT A;  3D6F B;  4L76 A;  4HLB A;  3A8K A;  3M32 B;  5KFY A;  2RML A;  3KLE B;  4B9S A;  2CRL A;  2YNI A;  2QLB B;  4DR4 F;  3T5L A;  2BQU A;  3G6E S;  2HFS A;  4AYB D;  1BGX T;  1CEZ A;  2R8G A;  4LRA A;  2CJA A;  2JC0 A;  3EM1 A;  1MN7 A;  1X31 C;  1IBL J;  2ALY B;  3V4I A;  4G6V B;  2HHW A;  1HLW A;  1S48 A;  3H90 A;  4ILL A;  2BAN B;  3MCN A;  4CO5 A;  1RYR A;  1U6Z A;  3D6T B;  2AEJ A;  4A8F A;  5IOL A;  1FNO A;  3SXL A;  1C0U A;  2ZZN A;  1PJ6 A;  4EGL A;  4X65 F;  3DLK B;  4DR6 F;  4PAB A;  1B99 A;  1CJU B;  2UXC F;  4CLW A;  1JLQ A;  2MQQ A;  1LK5 A;  3PJX A;  1BQN A;  3MTK A;  4KO0 A;  5IFM A;  3JYT B;  3MFI A;  2JJ4 D;  3OFE A;  3WIV A;  2IPO B;  5FII A;  2VG6 B;  4MK9 A;  4AL6 A;  3IWL A;  5J2N A;  5ETK A;  2V5H G;  3OTO J;  1TKX A;  3QT5 A;  2RF2 B;  4CM0 A;  3A3O B;  1L3V A;  3EPI A;  2DGO A;  1RGV A;  1Q79 A;  3EPG A;  4HAC A;  3DLL Q;  2BM0 A;  1NKC A;  5E2Q A;  4CNY A;  1UPP A;  2LCW A;  3QRR A;  4NYZ A;  5H9E J;  1H6K X;  2WVD A;  1UWB B;  2HRU A;  3NRB A;  4XK8 C;  3P96 A;  5M2P A;  3QAE A;  4LF8 F;  4P71 A;  4GO5 X;  3P4U B;  3M8P A;  4PKD B;  4RU9 A;  4KT0 C;  3M2R A;  2Z58 B;  1N34 F;  1SUQ B;  1U1L A;  4Y28 C;  5EWG A;  4TLQ A;  5ETR A;  4DMZ A;  1L3T A;  2N4C A;  3UDC A;  4QOT A;  1J5O A;  1T05 A;  2PD1 A;  2Q3P A;  5ETP A;  3MM9 A;  5A6W A;  1OSD A;  5ETN A;  4IQX A;  1TVR A;  2VKR A;  2VD3 A;  4F3M A;  1YIJ S;  3V5R A;  5RUB A;  2FVQ A;  4KRW A;  4O4G B;  3G82 A;  2EBE A;  4BWJ A;  3D1H A;  2RHQ B;  1B7Y B;  5C7P A;  5KG1 A;  5JUM A;  5CD4 H;  2V4Q A;  2DIU A;  2ZHO A;  1FD2 A;  4URS A;  5K5M A;  3GG0 A;  1U1R A;  1VLO A;  2YWE A;  3RRH A;  2V4J A;  4ZIT A;  4DS4 A;  3THV A;  3NAI A;  1U8W A;  3IFE A;  2AX0 A;  2HNY A;  3K5N A;  1TUV A;  3BN7 A;  2B9E A;  1MNE A;  2COL A;  2DR9 A;  4J9Q A;  5IQ6 A;  5JMN A;  2FTR A;  2P9E A;  1ZA1 B;  3OLB A;  5C24 A;  5K14 A;  2B9X A;  3I4P A;  2XB2 D;  4LF1 A;  3KHR A;  3LW5 C;  4Y0F A;  1RK8 A;  1FX4 A;  4ZS6 A;  1UET A;  2NSC A;  3KK1 B;  3I31 A;  3T9N A;  3JSR A;  1WSR A;  4EWT A;  2BEF A;  2OPQ B;  3NS6 A;  2J9D E;  5KT4 A;  5BYQ A;  1WD6 A;  1PO6 A;  2HHQ A;  3ENQ A;  3UCZ P;  2FLO A;  3IGN A;  4QIF A;  4PPD A;  3O44 A;  2WOM B;  1AW0 A;  3D66 A;  3BN4 A;  4ZHR A;  3U7J A;  5F8I A;  1KVJ A;  3BYP A;  3HZE A;  5DG7 A;  4KR0 B;  5HP1 A;  1JX4 A;  2L41 A;  5EX0 A;  4LRC A;  2BYC A;  3VCD A;  2MQL A;  2YKM A;  1EIY B;  3DLJ A;  3JTN A;  2V34 A;  1U1N A;  1QAI A;  3CMQ A;  4WKR A;  2CQB A;  1LWC A;  1FWP A;  2QIF A;  3UR0 A;  2E5L J;  1RHU B;  1HNI A;  2R2S A;  3NS5 A;  3TAM A;  4F0K A;  3G6V A;  2PEH A;  1SKS A;  1TU0 B;  4IG0 A;  3MMJ A;  2IM2 A;  5KTQ A;  3MM7 A;  2IVF B;  1NHK L;  2JNJ A;  2MTL A;  4LRE A;  2GIF A;  2VV5 A;  4LJM A;  3PRB A;  4Q0B A;  1QUV A;  1R43 A;  3RB0 A;  2ACY A;  2VQE F;  1I94 J;  3QGP A;  4N56 A;  4NCB A;  3ULH A;  3MEK A;  3TJ8 A;  4A8M P;  5J1N A;  1FE4 A;  4F4X A;  2VFR A;  1X5O A;  3W7B A;  2FJX A;  4QIW D;  2D3Z A;  2WW8 A;  4USW A;  1UEU A;  3EXC X;  4CO4 A;  3FRY A;  1GTE A;  2CUY A;  5L9N A;  1WEL A;  4WK1 A;  2B7B B;  1VQL S;  2FZC B;  4Z37 A;  2GQ2 A;  1S6U A;  3G4S S;  4K4X A;  4Z7C A;  1Q95 G;  4L73 A;  2HQD A;  3G2X A;  1RAE B;  5DZ7 A;  1NDK A;  3ENA A;  2FJA B;  3KJV B;  2DXD A;  1YQH A;  4IKA A;  4RU2 A;  2HWT A;  1N54 B;  3DU6 A;  2HQG A;  4OYM A;  4MIB A;  5HO4 A;  2HHX A;  2J0X A;  4WFN Q;  3L3C A;  1S1T B;  2LLZ A;  2DNR A;  1X8D A;  3IMQ J;  4F8R A;  1RBL A;  3RW7 A;  2I0X A;  1F2G A;  3Q8R B;  4DQI A;  2BOP A;  1XNQ J;  5B7W A;  3FUY A;  3V6H A;  1KC8 T;  3ISN C;  5HQM A;  1FJC A;  5K8M A;  1Q78 A;  1K0V A;  4GVB B;  2I9S A;  1JLC B;  1KFS A;  2RQK A;  1NPP A;  2RS8 A;  2R7V A;  3CJQ A;  4A8O A;  4DR7 F;  1SL2 A;  2GVD A;  3R97 A;  8ATC B;  1N88 A;  5A8K B;  2IMW P;  4ZKA A;  2PO4 A;  1F60 B;  2MKK A;  4G1P A;  1AYE A;  4YEA A;  1RT6 B;  1IBK J;  2H48 B;  4ZVG A;  1NSQ A;  4Y34 A;  3DLE B;  4OIX A;  3TP2 A;  5I3Q A;  4DV7 J;  3CCW A;  4NX9 A;  2PT0 A;  3OVS A;  1CJK B;  4LRF A;  3AB4 B;  2NRE A;  2W2O P;  4NI2 A;  1XNR F;  3D28 A;  1RQ0 A;  3D5M A;  1Y10 A;  2M0G B;  2EPI A;  1H0H B;  4YS2 A;  3W64 A;  1D8Y A;  3H8Y A;  1ZS6 A;  2DH7 A;  1UTA A;  2A10 A;  1QE1 B;  4YR0 A;  4HYK A;  4PXC A;  1DJ0 A;  1FJG F;  4ZMM A;  5K8N A;  4KJI A;  3SQG A;  3QIP B;  3H5U A;  1R3N A;  2GS8 A;  5CYJ A;  1S1V B;  3B4D A;  4ENO A;  4DQS A;  3U02 A;  3PIP Q;  2Z30 B;  3LF0 A;  3H5Y A;  3MEC B;  4RUC A;  1VQS A;  3VF0 B;  3D9B A;  3CDE A;  1OQ6 A;  4FYD A;  4ZP9 A;  1YJW S;  3DRP A;  1ZM2 A;  4F3O A;  1EP4 A;  2QA4 S;  4B3M J;  2V2V A;  3CCM S;  3DN9 A;  3I4H X;  3ZZ0 A;  4KH1 B;  4WYL A;  4P9S A;  4F4W A;  4IO1 A;  1RLD A;  4J9O A;  3JAM Y;  1IBM J;  4EO8 A;  4EUV A;  2GZO A;  3W2V A;  1T9X A;  4USI A;  1DQA A;  2JOQ A;  5T41 A;  1R6Y A;  2VOP A;  2XZT B;  3TO8 A;  4B9V A;  3W8P A;  4NLP A;  3CGI A;  3TVY A;  4LFC F;  3KDO A;  4AQY J;  4ZPW R;  3M32 A;  1G1X A;  3W5Y A;  4DZD A;  2GML A;  3ZFV A;  3QWP A;  1W25 A;  3KLE A;  1FRH A;  5JJB A;  1MML A;  4Q8E A;  2GIR A;  2XMJ A;  3OLA A;  2VF3 A;  3J81 j;  1NHU A;  2K7K A;  5AXM A;  2DNY A;  3KOA A;  4YUD A;  1B64 A;  2GW8 A;  2HZA A;  5CYM B;  4KGM A;  3HI9 A;  2I8E A;  2UVW A;  1VQP S;  2BAN A;  3QRQ A;  3CPW R;  4S0M A;  3ISN D;  3NOG A;  2MQP A;  4DL3 A;  3D7S B;  3KHH A;  2KVQ E;  4UT4 A;  1QDU B;  3QGH A;  4RW8 B;  3HK2 A;  4RX6 A;  3CCS S;  2NPF A;  3IGV A;  2PGC A;  3DLK A;  2IHR 1;  6AT1 B;  1CJU A;  3B4M A;  2R8I A;  4WBF A;  2KKH A;  1JMT A;  4DCP B;  3JYT A;  1OQ3 A;  3K17 A;  4KTQ A;  2GVZ B;  2VG6 A;  3NBP B;  2QMW A;  3R8Y A;  4DUT A;  5AJ3 J;  3SQO P;  4H4M B;  5H9F J;  2IA0 A;  3CJT A;  2RF2 A;  1SIW B;  1A9N B;  1NJX A;  4RJV A;  2IVM A;  4DR3 F;  1UZD A;  4ZJO A;  2MZT A;  5F9L A;  5A0Y B;  4DL5 A;  4EZ6 A;  1VQK S;  4CO2 A;  3H4D A;  4K4W A;  3F73 A;  1O0P A;  1UWB A;  2W9A A;  2AEM A;  4LBI A;  3QGI A;  4JI7 F;  3CME S;  1SJF A;  2HBY B;  3A13 A;  4FP9 A;  3OV7 A;  2R42 A;  5EHH A;  1YZ7 A;  2LP4 A;  4PYD A;  4U9R A;  3IN5 A;  4D3G A;  2VFU A;  3H40 A;  2YWW A;  1HBM B;  1SUQ A;  2HZC A;  3BGU A;  4F4K A;  1EHW A;  5FLX U;  1VIS A;  2EC2 A;  1KWM A;  2NUH A;  4PUO B;  4Q7A A;  1Q1K A;  1X5P A;  4J9V A;  2C2D A;  3D0I E;  2VPW B;  1CUL B;  3T1A A;  3DDN A;  4N8O A;  1JXV A;  2XGP A;  3LGN A;  4K5S A;  4CT9 A;  4RR5 A;  4HKQ A;  5CA5 A;  3MZI A;  3IBF B;  5A6P A;  2MLZ A;  4O4G A;  3MM8 B;  5MAO A;  3MR7 A;  2D1C A;  2FJE B;  5ETQ A;  5U47 A;  1RAD B;  3G8Q A;  1KQS R;  3GR0 A;  1VQ9 S;  2R3V A;  4RUH A;  2XO7 A;  1LXN A;  4ZP7 A;  5K9F A;  3R5D A;  2V0N A;  2QYG A;  3H42 A;  2OPP B;  4DR5 J;  1U4B A;  1ARO P;  1NK6 A;  2UXD F;  2H3E B;  2OSR A;  2KVI A;  1QJH A;  3DRS B;  1N0V C;  4L72 B;  4NXN F;  5LMN F;  2EFG A;  4B3S J;  2MQN A;  1VR6 A;  2N7C A;  3K8W A;  3TWZ A;  9ATC B;  3EDQ B;  1NK9 A;  4R5P B;  2ILZ A;  4LQ9 A;  5HN0 A;  1I51 B;  1UKU A;  4RNH A;  3OQ2 A;  4DPX A;  1TAU A;  3KK1 A;  2KXF A;  2CQ4 A;  4B3R J;  2OPQ A;  2ADC A;  3D67 A;  3BSA A;  1APS A;  2WOM A;  1Q8B A;  1YDL A;  3KLI B;  2DO0 A;  2WSC C;  2E9T A;  3C15 B;  2R8K A;  5K8O A;  4ZVH A;  2BAC A;  4NLS A;  3IXQ A;  1LW0 B;  4DN9 A;  1RWM B;  5L46 A;  2FVP A;  3BBC A;  3QFW A;  2DIV A;  4ZVT B;  4MKA A;  3NAH A;  4DQR A;  3QT8 A;  3O1L A;  3US5 A;  3CC2 S;  4YY3 F;  2BQ3 A;  3LUY A;  1WWH A;  2ZH1 A;  2KG0 A;  4PWW A;  1XR5 A;  2E1C A;  3PM9 A;  1RTH B;  4CT8 A;  1H2V Z;  1S99 A;  2LEC A;  2ZH2 A;  3M8R A;  1GX6 A;  1U09 A;  1SKW A;  2UU9 J;  2O67 A;  2R8J A;  2M2B A;  4KFB B;  3NS7 B;  1PYT A;  1PYO B;  3SI8 A;  4Q2M A;  3RAX A;  3R3T A;  5FD1 A;  4O23 A;  2XWX A;  1HAR A;  1HR0 J;  3AH6 A;  1AUD A;  2CQC A;  5DRK A;  4LF4 F;  2BUN A;  3PKM A;  2RDI A;  2J9E A;  3DLH A;  1RWN B;  2UV8 G;  4YOE A;  2FC8 A;  1WKJ A;  3CJ2 A;  5KFH A;  5AXK A;  3HHL A;  1FDN A;  2V94 A;  1M5O C;  1SBR A;  4X4Q A;  2FJB B;  2YKN A;  1ZAW A;  4OI4 A;  5D0H A;  5AT1 B;  2RHS B;  2KXH A;  4LR9 A;  1VI7 A;  1ZZN A;  1I3O B;  4NLG A;  2OLW A;  4RLE A;  1JLB B;  4KKO B;  3PFO A;  5H9E K;  3R5G A;  2BJE A;  2NS1 B;  2YX1 A;  4O4R A;  3C66 A;  1KHW A;  3OHB A;  1JK9 B;  4RNO A;  3DRR B;  5KFT A;  3GCX P;  1S0O A;  3O6Q A;  3KJV A;  2DNL A;  4DL6 A;  4NOH A;  3PR5 B;  1NK4 A;  2G2O A;  1KR4 A;  2DHS A;  2UVV A;  3MOZ A;  5HVH A;  3CJ0 A;  4IYQ A;  4MJK A;  4GKJ F;  4JB8 B;  4C98 A;  1S1T A;  1RE1 B;  2YX4 A;  1Q8L A;  2HQF A;  5F3T A;  4DR2 J;  3M7V A;  4CH1 A;  4TU8 A;  4KB7 A;  3HPO A;  3LA0 A;  2NLW A;  1HQE B;  5I42 B;  4GVB A;  2DGW A;  1JLC A;  2XZW A;  4YB7 A;  2UUA F;  3AD7 C;  5ITH A;  2LA4 A;  1R8A A;  4NLO A;  2MEW A;  4U8Y A;  3TOQ A;  5AE3 A;  5A8K A;  4J9K A;  2VBY A;  5KFW A;  2V9W A;  5HQ8 A;  4XPE A;  4N76 A;  3AA8 A;  4D3H A;  1IR0 A;  1RT6 A;  1ZBT A;  1M1H A;  3MPD A;  4PG4 A;  1N5S A;  3VVT A;  3DLE A;  2EFQ A;  2IJN A;  1CJK A;  2W4C A;  4DUZ F;  3HLU A;  2QC3 A;  3CDB A;  2LQB A;  1FNM A;  4OYB A;  2AGQ A;  4JBC A;  4K2J A;  4TY9 A;  1KSP A;  4M5N A;  2DD8 S;  3ICL A;  2A2C A;  3OT9 A;  3NGU A;  1LFP A;  1AT1 B;  4J9R A;  1QE1 A;  1HBO B;  2ZKT A;  3H98 A;  3TX0 A;  2RJZ A;  1Z2Z A;  4M5M A;  3QIP A;  1JKH B;  2RRN A;  2VOO A;  4C9D A;  1JJ2 R;  5LSR A;  4QIE A;  5K8P A;  1DQ9 A;  2CNN B;  1S1V A;  5J1P A;  5E3P A;  5K20 B;  1WEX A;  2L3M A;  1ZPW X;  1TKD A;  3TW0 A;  3BS9 A;  3HDS A;  1VJQ A;  3MEC A;  3PG9 A;  1UFL A;  2L9W A;  2HW3 A;  3PHE A;  4E0D A;  4E8U A;  1KTQ A;  3A8I A;  2YKQ A;  4OZ1 A;  3KWM A;  3BZQ A;  4LF7 J;  3LOU A;  4YB5 A;  2HK3 A;  4QR2 A;  1FFS B;  4LFA J;  3EGZ A;  1FKA F;  1XBW A;  3DCA A;  3HM9 A;  3W62 A;  3AAW B;  1VQY A;  3T41 A;  1M5S A;  1VBK A;  5C5J A;  1U1P A;  3K59 A;  1CS4 B;  4FYV B;  1S0M A;  2Y1I A;  4G1I A;  4YQW A;  4FF3 A;  2WCX A;  4F0H A;  1HKA A;  2XYG B;  4IUF A;  1WF1 A;  2ZH6 A;  3RB3 A;  3ZXW A;  3A3N B;  1I5O B;  2F3J A;  4OZJ A;  2VU5 A;  3H25 A;  4ZP8 A;  2JHE A;  2ATC B;  2ZFH A;  3A8E A;  3IM8 A;  3KLG B;  2IFX A;  4P7V A;  2ZD1 B;  4FNI A;  1U1M A;  1XMO F;  3PKY A;  5CYM A;  1K8A T;  4WU2 A;  3VAI A;  4G1Q A;  1ICE B;  2GC8 A;  5THW A;  2RQC A;  2FHK A;  1BQX A;  1IKX B;  3MDF A;  2AD9 A;  3KUH A;  4RW8 A;  1NME B;  1BXN A;  4YP3 A;  3OW2 R;  3PW0 A;  3I87 A;  2DNP A;  3G9C A;  2F4V J;  3TEH B;  4KPY A;  3MAA B;  4CLU A;  2DCL A;  3GIJ A;  2FJW A;  2W25 A;  2KFN A;  1ZA2 B;  2HAI A;  2JEF A;  2VUG A;  1OPZ A;  2DNO A;  1WOO A;  5D4P A;  1F9F A;  3LP0 B;  3OBI A;  3D1O A;  2GVZ A;  4B9T A;  3IR5 B;  4KPC A;  3NBP A;  3JQM A;  1UZH A;  1HNX J;  3V6D B;  3UNG C;  2QL9 B;  4H4M A;  1WTF A;  4M5G A;  4OZ5 A;  2M3D A;  1KQG B;  1U1Q A;  3SFU A;  2MB0 B;  2ZOM A;  3M8S A;  3E51 A;  4WF9 Q;  2Z4P A;  3HSZ A;  4PRF A;  2W9C B;  3VQS A;  1VDH A;  5A0Y A;  2H54 B;  5CZX A;  1CPZ A;  1RWO B;  2G0J A;  1Z2L A;  4DX5 A;  2KT2 A;  2BZ2 A;  2RNE A;  2ZM6 J;  5D6G A;  1YI2 S;  4HI1 A;  1VQO S;  4DFK A;  1S9E B;  2MDA A;  3DDI A;  2AKW B;  1FKP B;  4AXJ A;  3MOJ B;  4X64 F;  3V4M A;  1JLG B;  4PWD B;  4XDC A;  2JLF A;  1HBM A;  3M9N B;  4DR1 F;  3P5B P;  4C8N A;  3H2U B;  2WSE C;  1QAJ A;  3CCE S;  4PUO A;  3K8V A;  4IH6 A;  1NH8 A;  5L39 A;  1ZTW A;  2BBE A;  3OVA A;  1CUL A;  3A1Y G;  3EIC A;  5DM7 Q;  2QFJ A;  1A0O B;  2HUR A;  4PZV A;  1L3K A;  3ETO A;  2CPH A;  4DU7 A;  1HA1 A;  2NZ4 A;  4QWA A;  4L3K A;  5LL6 d;  4FS1 A;  1WKL A;  3M2V B;  5D3G B;  1SCJ B;  5LT5 A;  4EFA C;  3MM8 A;  2ZVS A;  1FA0 A;  1MU2 B;  2CDR B;  5IV3 A;  2JEI A;  2YPY A;  2X1F A;  4DUY J;  1RHM B;  4WYW A;  1L3S A;  4ZCK A;  1AA1 B;  1NDC A;  1K0T A;  2G2Z A;  4QPX A;  3I0R B;  4AL7 A;  4K0K J;  1D3W A;  3R1L A;  2GHV C;  4IQM A;  3FZB A;  2OPP A;  1RLC L;  1VRU B;  4ED3 A;  4KY3 A;  3BKT A;  1HW9 A;  2HPU A;  2FY8 A;  1W26 A;  2XLJ A;  4ILR A;  4HL9 A;  2Q66 A;  3UCG A;  3DRS A;  3SV4 A;  3QJL A;  2YWF A;  3FQL A;  5E7O B;  3RRG A;  3ET6 B;  1ROF A;  4CYU B;  2DH8 A;  4R5P A;  1A6L A;  3PNI A;  2XHW A;  1ZZF A;  4ERD A;  4LF6 F;  3EVO A;  5DDP C;  3ZZY A;  1RAC B;  2DEI A;  1RTD B;  4NZ6 A;  3QAT A;  1KQK A;  2UUB J;  1DBD A;  1S10 A;  1F9E B;  3CCL S;  3KLI A;  3BO2 A;  1TKZ B;  5KFZ A;  3C15 A;  5B08 A;  4ETZ A;  2BVZ A;  1N32 J;  1LW0 A;  4A8S A;  2Z57 B;  2JVR A;  1S0V A;  1TAQ A;  2ZH9 A;  2CJQ A;  3BBB A;  4DN0 A;  2F63 A;  3MXH P;  1URN A;  4Y2M A;  1FX2 A;  1NDL A;  1Y5I B;  1RT2 B;  2HHV A;  4NLV A;  3ZTP A;  2JFD A;  2YWK A;  1MMD A;  5DZ6 A;  1RTH A;  1F5C A;  3CCU S;  2ZKU A;  4IFY B;  2XYH B;  2HSE B;  1YZ6 A;  3R5B A;  2UP1 A;  4KFB A;  1SVD A;  4ELV A;  3IA0 A;  3QJP A;  5AE2 A;  4CRJ A;  4I0W A;  3GJR B;  3LWL A;  4RZR A;  5ETM A;  3Q8P B;  3SCI E;  1HYS B;  2LXU A;  1HD1 A;  4MK7 A;  2YQ1 A;  2OJ3 A;  3V81 B;  4P73 A;  2E7W A;  1YVF A;  2EXU A;  2GGP B;  1HNW F;  3I9Z A;  3NGS A;  5HBM B;  4DX8 H;  2VZ9 A;  3UI3 A;  1WF2 A;  1JLB A;  4KKO A;  1E6V B;  5HAN A;  3GIR A;  1EKR A;  3I82 A;  2JEJ A;  2XCA A;  3RTV A;  3JAM U;  1RAI B;  1TMJ A;  3DRR A;  1YWX A;  4WK3 A;  2E66 A;  4N41 A;  4C6A A;  4FKX A;  1B0V A;  3NNH A;  4ZVQ B;  1UA1 A;  1N36 J;  3CCT A;  4B02 A;  3VHQ A;  3WC0 A;  3UN3 A;  2YKA A;  4B17 A;  3NOC A;  2HVI A;  1KVI A;  1Y0H A;  3FCV A;  1WSV A;  3RGI A;  2L48 A;  3OTE A;  3MTJ A;  3RAM A;  2ZC3 A;  5IQQ A;  1M1K T;  2XMA A;  3V2U C;  2OIH A;  2FB0 A;  2Y8Y A;  1RT4 B;  4R25 A;  1SB6 A;  4LF5 J;  2HVZ A;  1JIH A;  2KHD A;  2MKC A;  1H38 A;  2VA2 A;  5I42 A;  4ZVU B;  4NYP A;  4IR9 A;  2E5L F;  2ZBI A;  2MKY A;  4W90 B;  4PYA A;  4MKB A;  2A0F B;  4YN3 B;  2D74 B;  4M94 A;  3TAN A;  1NH7 A;  4K4T A;  4ID5 B;  1X4C A;  3DOL B;  3FBF A;  4JI4 F;  4NE9 C;  3F44 A;  2MZR A;  2IDL A;  4ZPV R;  5AXL A;  2MZQ A;  2W2M P;  2POK A;  1U48 A;  4ZN3 A;  2YY3 A;  3KJN B;  3BSN A;  3DYA B;  2HQ3 A;  3KYL A;  2RIL A;  4HDH A;  2BJ1 A;  2R7T A;  1SL1 A;  2KT3 A;  3BGO P;  3OHA A;  5KFV A;  1T7P A;  5B0C A;  1L3U A;  3JTP A;  2XSF A;  2F1F A;  5I3U B;  1SIZ A;  3TZX A;  1FI4 A;  5KG0 A;  3MAQ A;  3OTB A;  2Q6B A;  4JI8 F;  4BC7 A;  3NG8 A;  4JI5 J;  4X62 J;  1HBO A;  3NCR A;  3R9L A;  3UN2 A;  4U7U K;  4U8V A;  2FHJ D;  1JKH A;  2IDE A;  2K8G A;  4Q2L A;  1FWK A;  3QMQ A;  1RT3 B;  3AQO A;  3BGR B;  4C8Y A;  4JI2 J;  1T03 B;  2RDJ A;  2X1A A;  2FZK B;  2KT5 A;  5LM7 E;  3MR2 A;  5CCL A;  3CC4 S;  1JLA B;  5IWA J;  1EET B;  1XK8 A;  4JV2 A;  5D4L A;  4EEY A;  1MRO A;  1GXT A;  5DLG A;  2BXJ A;  1RAJ A;  1C4C A;  1BQM B;  2V63 A;  2VFS A;  2KZZ A;  4OI1 A;  1K73 T;  2HAF A;  4IDK B;  1S1W B;  3TAQ A;  3ILL A;  3U1M A;  1IXK A;  2O3D A;  1CS4 A;  1NSA A;  3SFG A;  2HIY A;  1O51 A;  2QSW A;  4NLW A;  2Q79 A;  1PSD A;  1EJ7 L;  3BGL A;  3PIO Q;  2F8E X;  2XUL A;  2UV8 A;  2BR0 A;  5CAB A;  1VFJ A;  2ZEJ A;  3DXS X;  3MCM A;  4OHX A;  1IBK F;  2D9O A;  3DC2 A;  2CPY A;  2EKN A;  1B0P A;  2OEL A;  2QLJ B;  5I3P A;  4DV2 F;  4ED7 A;  1TV6 B;  1JWW A;  4HT7 A;  4UQT A;  2A1B A;  2KRR A;  4PWU A;  1D1U A;  4RBT A;  2WVE A;  3KLG A;  1D9D A;  1SI9 A;  3DFE A;  2H5E A;  3SCJ E;  4DSI A;  3VAJ A;  3M8W A;  2CDQ A;  2ZD1 A;  1LWX A;  2Z2L A;  3GE9 A;  2RRB A;  4KV8 B;  2FVC A;  2VBW A;  4F25 A;  3CD0 A;  1EX8 A;  1R8B A;  1VK3 A;  4AL5 A;  3GG1 A;  2ASD A;  2GO8 A;  2EEY A;  1IKX A;  3HHN B;  4H54 A;  3K57 A;  1K1S A;  3G96 A;  3PW5 A;  3H2L A;  3BR8 A;  4GKK J;  3NY0 A;  1TKT B;  1MMN A;  3DRY A;  3W9J A;  4EO6 A;  3MAA A;  3CD7 A;  2UVR A;  5HAO A;  1VQ5 S;  3WC2 A;  5C42 B;  4ELU A;  3IBC B;  5J2P B;  3UNY A;  4C4W A;  3THP A;  3MAH A;  4OJ3 A;  3P6Y C;  1PJ7 A;  1IR1 A;  3LP0 A;  3LWM A;  3I96 A;  2N7Y A;  4PR6 A;  4M63 A;  4ZPB A;  2ZBQ A;  4PXD A;  2ZNZ A;  3W3S A;  1JJC B;  1W7W A;  2ZC4 A;  3V6D A;  4ED4 A;  5EGY A;  2OML A;  1F1B B;  4DR4 J;  1NLK L;  1TMM A;  3N0V A;  2YPZ A;  5KFB A;  1S0N A;  3JSY A;  5M2R A;  1JB0 C;  4LMZ A;  3K5P A;  1SH2 A;  4ES2 A;  1VOM A;  4ECV A;  4OX7 A;  2ERR A;  2L08 A;  3MF5 A;  2BJ7 A;  1YJU A;  1EAR A;  1HPZ B;  2DIT A;  3N01 A;  1PIE A;  2ASJ A;  1Q0N A;  1ZAX A;  2W9C A;  4NZ7 A;  1OY6 A;  3LPE A;  3LAM A;  2BAB A;  2FVR A;  5SUH A;  2HG4 A;  4DCJ B;  1KRP A;  4O3S A;  1RU2 A;  1T11 A;  3HVA A;  1S9E A;  1TR0 A;  2R7X A;  1YRT A;  1FKP A;  2JX2 A;  4LRD A;  2XY5 A;  4DPY A;  3EZ5 A;  2KZM A;  2UXB F;  1H2U X;  1JLG A;  5D15 A;  1LOU A;  4PWD A;  1TFY A;  4X65 J;  4DR6 J;  2V8D A;  3D2W A;  4DSL A;  5KT2 A;  3CF5 Q;  3CIM A;  2UXC J;  2M4M A;  3OL8 A;  1HW8 A;  1VIO A;  2QZ8 A;  2LEB A;  2A6M A;  4DLG A;  3SBM A;  2FLL A;  5E41 A;  1SH0 A;  1KN6 A;  2Z2Y B;  2RUS A;  4F36 A;  4K7Q A;  1YK9 A;  1SJ1 A;  2OH2 A;  1IJE B;  3M2V A;  4Y6I A;  2CG4 A;  2OO4 A;  3MUV P;  5D3G A;  2AJF E;  5A8R B;  1IKY A;  1MU2 A;  4LR8 A;  3OFH A;  1V6H A;  2Y0S D;  2C2R A;  3PTW A;  5IV4 A;  1PAE X;  2D3O R;  2DRD A;  3I0R A;  5EWE A;  2HVD A;  3ZZP A;  3CCZ A;  2JH3 A;  5BYS A;  1LWF B;  1VRU A;  2KFZ A;  2CJ9 A;  1FDD A;  2DBB A;  2EFN A;  3HF5 A;  2ZHA A;  2W24 A;  2M70 A;  3VV2 B;  4CWB A;  4ZVO B;  4OMF G;  1O8B A;  2VJV A;  3MFH A;  1N34 J;  1X60 A;  1R89 A;  3H59 A;  3CED A;  4FXW A;  3ET6 A;  3PJ9 A;  4K50 A;  4CYU A;  4IRD A;  4LFB F;  1NUE A;  2OTJ S;  1SKU B;  3L7O A;  3A8J A;  3TI0 A;  3WIU A;  1S7I A;  5A76 A;  3UDV A;  4KAI A;  1ZTT A;  2K1R B;  3NWG A;  3JSM B;  3ILO A;  4CP5 A;  1RJJ A;  4NLY A;  1RTD A;  1S5Z A;  4K4S A;  1NK8 A;  3SCK E;  4XAK A;  1TK0 A;  1V3R A;  2KO1 A;  4QW9 A;  4RW7 B;  1KS2 A;  3DGP B;  3VGV A;  3IS9 B;  1TKZ A;  2APO A;  2C3U A;  2HS4 A;  4Z7Y A;  4NLX A;  5DM6 Q;  3M9O B;  2IVY A;  3CCV S;  1OMS A;  2PEB A;  4OJ1 A;  1VGY A;  2ZBC A;  3FEY B;  4ES1 A;  2OAU A;  3RZA A;  2BW7 A;  4M5I A;  3P3D A;  4QW8 A;  5DQG A;  2XNR A;  1RT2 A;  2NZC A;  4HHH A;  5DDQ C;  2LFV A;  1SV5 B;  2M5Y A;  3M2U B;  4YME A;  2AJ1 A;  4IFY A;  4QQB A;  1RTZ A;  3TRG A;  4ZPA A;  2D3O 1;  3MR3 A;  2DKO B;  2Y9H A;  4ZJQ A;  2DHG A;  3OFG A;  4R0J A;  2LA6 A;  2LQ5 A;  4YDD B;  4FBT A;  2BJ8 A;  4QU6 A;  1UL3 A;  1CVJ A;  3KJQ B;  2CWX A;  1HYS A;  1A7G E;  5EUH A;  1RBO B;  2V9K A;  2DYA A;  1P27 B;  3V81 A;  1JXL A;  1YBA A;  1K9M T;  3HVT B;  1ZPV A;  2DCU B;  1UA0 A;  2IBK A;  3O3L A;  3MMA B;  5HBM A;  4JP8 A;  1RHQ B;  2NXC A;  4MT1 A;  2DRB A;  3BO3 A;  3PY8 A;  3EWG A;  4IG3 B;  1E6V A;  3GFH A;  2CQ1 A;  3BPS P;  3OJS A;  3KNG A;  3NKY A;  2BX6 A;  2F9D A;  2AT1 B;  8AT1 B;  2IJF A;  1RZM A;  4JI0 F;  5F8L A;  4DV4 F;  3C16 B;  1JLE B;  4DPW A;  4QWC A;  4OL8 A;  3C6U B;  3J7Y U;  2HHT A;  1FHT A;  4QWB A;  1VRT B;  2O1P A;  3GON A;  4USH A;  5ADZ A;  2BV3 A;  3VAK A;  4RNM A;  1MWQ A;  2VQE J;  3D68 A;  3QJJ A;  3KG1 A;  3DHX A;  1RT4 A;  3AOD A;  2DY9 A;  5F8J A;  2YNF B;  2NCK L;  4JI1 J;  4ZA1 A;  3VGT A;  1NXI A;  3NCP A;  4DHV A;  1HWI A;  7AT1 B;  3T5J A;  3MCS A;  2CQ3 A;  5HL7 Q;  3BBF A;  5E0O A;  3T6B A;  4OHW A;  2DHX A;  2OHD A;  2CJX B;  1KHV A;  1U8S A;  3R7N B;  5CXT A;  3PR4 A;  2NPI A;  4EMD A;  4ID5 A;  3DOL A;  2Q6C A;  2X1B A;  2VDH A;  4M5D B;  4HT5 A;  3M8Q B;  3R5J B;  1JXE A;  4TU9 A;  2ZH7 A;  1WOR A;  3TA2 A;  2ZZM A;  2KL8 A;  5HMX A;  1MG7 A;  3DYA A;  3F41 A;  3RJM B;  4XIU A;  3MUR P;  1OY8 A;  2VHG A;  4CIO A;  4M95 A;  4QBU A;  4OX9 F;  4ECW A;  5I3U A;  1S76 D;  1IUJ A;  1VJW A;  3W65 A;  2PFD A;  1RDR A;  1YJT A;  1EB0 A;  1C2P A;  2AYM A;  2G13 A;  4FPR A;  4FN5 A;  2OFG X;  1UWA A;  4I6A A;  1S6P B;  3R2C J;  4DR7 J;  2QLF B;  2GJI A;  1IWG A;  2MKJ A;  3N79 A;  2QEX S;  1RT3 A;  3QNW B;  3BGR A;  1HI0 P;  4DEZ A;  1T03 A;  4N77 A;  4EBE A;  1NJY A;  2XM3 A;  3BKF A;  1SJR A;  1JLA A;  1JJ4 A;  1EET A;  3MPW A;  1ACM B;  4P2F A;  2W8L A;  2C22 A;  2AZ1 A;  1TUG B;  2YNH B;  3CJR A;  4X4T A;  1H2T Z;  3UO0 A;  1FDA A;  4NRU A;  4L3N A;  5HSP A;  2R7O A;  2LVW A;  1BQM A;  2E9R X;  1M5V C;  2OPS B;  4U7U D;  4IDK A;  3VZH A;  1KON A;  1S1W A;  1XNR J;  2A2D A;  4I2P A;  9RUB A;  1VHF A;  3PJW A;  1H7X A;  4WU3 A;  1P6T A;  1D9F A;  4RNN A;  1QAY A;  3N6L A;  2MST A;  3MPU B;  4IRK A;  2AU0 A;  1PCA A;  3J7Y I;  3OJU A;  3J81 Y;  2DY1 A;  3JSB A;  1X9M A;  4EYH B;  3PAC A;  1TV6 A;  3UR3 C;  1DTT B;  2R2T A;  5JVH Q;  1QSY A;  2ZOF A;  2L9D A;  3ZZZ A;  1NPK A;  4PG6 A;  3CJK B;  4ZIW A;  4HI2 A;  4J7C A;  5KFA A;  4NLT A;  1CG2 A;  3J7A N;  4ECY A;  1Q7L B;  4KV8 A;  1VQ7 S;  4C8Z A;  1FRI A;  1RA7 A;  4OYX A;  1HQ2 A;  1LV5 A;  3AY0 A;  2EG1 A;  1T9U A;  2JC1 A;  1URR A;  1UPM B;  5ETV A;  5L1I A;  1J2V A;  4OI0 A;  1XQI A;  3S8S A;  1EQ0 A;  1RHR B;  2OD4 A;  4MAK A;  1HWJ A;  1S7H A;  2NXU A;  1TKT A;  4IFV B;  4C7Q A;  2ZJP Q;  3E3X A;  2C28 A;  3ENW A;  2O01 C;  1H73 A;  4C3L A;  2WHO A;  5C42 A;  5J2P A;  4CCH A;  2UUW A;  3PFE A;  4LFC J;  2B6A A;  2DIS A;  3M30 B;  1H3D A;  3HHL D;  4H4K A;  2WZ1 A;  4WZQ A;  4NXM J;  1CC8 A;  2M7S A;  4RW6 B;  1T94 A;  2FHJ A;  4ZIV A;  1F2H A;  1YLX A;  5A2Q Y;  5KFX A;  2QX0 A;  1YHQ S;  4PQU B;  2D69 A;  4LF7 F;  1T9V A;  1U0H B;  5C2G A;  1VC6 A;  1HPZ A;  4JOU A;  2VOD A;  4J90 A;  1N52 B;  4F3Q A;  4Y2I A;  4L74 A;  2J6T A;  2B4O A;  3KLH B;  4I64 A;  5F8N A;  3P45 B;  4HTI A;  4HDG A;  3IAM 9;  2MXY A;  2B43 A;  4DDF A;  3MD3 A;  2VKZ G;  3I9V 9;  4DX7 A;  1HWU A;  4DV6 F;  1NU4 A;  1RUS A;  3EZO A;  2ADB A;  4C11 B;  2LU1 A;  4CNZ A;  3KKF A;  1FRX A;  2KTQ A;  2MQM A;  4CLZ A;  2ZWO A;  2G4B A;  2VJU A;  3H5S A;  4J9M A;  2E5I A;  1BY9 A;  2HS3 A;  4IOB A;  4EBC A;  2MZ1 A;  1VQN S;  1DZ5 A;  2K3K A;  3TJ9 A;  3GV7 B;  2FIU A;  2I1R A;  1Q5Y A;  3I32 A;  4BWM A;  2DNH A;  4ECT A;  1WC1 A;  2HLU A;  5A8R A;  2AW0 A;  2DNG A;  3BR9 A;  2E1R A;  4PG8 A;  3AJ2 A;  2EK6 A;  4DLE A;  1WUU A;  5HJX A;  4QYR A;  4UZB A;  1Z4U A;  2FY1 A;  1JJH A;  2QL7 B;  1LWF A;  3A12 A;  3TQ1 A;  4OZ0 A;  1NB2 A;  2VBX A;  4JI7 J;  3I0S B;  3HVR A;  3TQE A;  5KG4 A;  3OSP A;  2VPZ B;  2M8H A;  3D3C J;  1Y5L B;  2IIH A;  3RBE A;  1WC6 A;  1S1X B;  5IS2 A;  3OL6 A;  5CD4 A;  3T1H F;  4EU0 A;  1P9Y A;  4PXE A;  4J9L A;  1NEE A;  1PC4 A;  3EGV A;  4BDP A;  1BLU A;  5MLC V;  1UVL A;  1VK8 A;  2K1R A;  3JSM A;  1NK5 A;  3BSC A;  1PG5 B;  3IRX B;  3M1V B;  2WSF C;  2D7S A;  5HI7 A;  1BUX A;  3EXY A;  3CVK A;  2CPI A;  5B0E A;  3HHL B;  5L38 A;  2GX8 A;  4RW7 A;  5GAE U;  2ZH8 A;  2NYI A;  3DGP A;  3IS9 A;  3JB9 k;  2AJQ A;  2YKN B;  2IRY A;  4B3T F;  3J7A 1;  5A8W B;  1Y00 A;  3H5X A;  3F56 A;  5GAH U;  4O3N A;  3RR7 A;  3TYT A;  2H65 B;  3NNA A;  1DFD A;  4UTG A;  4IH7 A;  2CIM A;  3FNN A;  4U95 A;  4ILM A;  5BR8 F;  2UXD J;  1IKV B;  3PHT A;  3P5T L;  2GJ2 A;  3GU0 A;  5HAT A;  4OZL A;  4NXN J;  5LMN J;  2RRA A;  4I1T A;  1SV5 A;  2RH3 A;  4F4Z A;  3M2U A;  2FGO A;  4IR1 A;  2LMI A;  3KMS A;  5B0A A;  4XDD A;  4Q5V A;  1N56 A;  2GJF A;  1KFD A;  2WAQ D;  5DS7 A;  1QTN B;  4KE5 A;  4DUY F;  4PEO A;  1UJ4 A;  1N5Y B;  4DI6 A;  1WC0 A;  4O3P A;  4DFM A;  2X1G A;  3UE2 A;  4PQA A;  2HGN A;  4EYI B;  1X5S A;  4G3I A;  1FXD A;  2IRU A;  3POT B;  4KGK A;  5D4N A;  1WG5 A;  3HVT A;  4V1A k;  4OFZ A;  2CKW A;  3O5T B;  5IC4 B;  3X1L B;  1QSL A;  3WBZ A;  2UVU A;  3KHG A;  1QVF R;  3OXG A;  1FEE A;  3MMA A;  4CTA B;  4P72 A;  4GC7 A;  2VL1 A;  2IBO A;  4NEY A;  2E1M C;  1W2I A;  3GV5 B;  3MEE B;  3U27 A;  2IM1 A;  4YY3 J;  4IG3 A;  2HLT A;  3AOA A;  3KLF B;  2K06 A;  4DSK A;  2V69 A;  2C42 A;  4ZVF A;  3GB0 A;  2E5H A;  3CJ8 A;  4WKY A;  2BE7 D;  3C16 A;  3FKB A;  1JLE A;  1KEK A;  3RYL A;  2CAD A;  1U45 A;  4H4O B;  3C6U A;  2NR0 A;  1G4C A;  1VRT A;  2J7K A;  4ED6 A;  1Q8I A;  1VCT A;  1UVJ A;  1ITP A;  2XMV A;  4JI6 F;  2GMJ A;  4LF4 J;  1SC4 B;  1F3F A;  3EUN A;  4DV5 F;  4EK2 A;  2C2E A;  2CQ0 A;  2YNF A;  3DLG B;  4X84 A;  1RBA A;  2XNQ A;  2B56 A;  3BO4 A;  3PDN A;  2LYV A;  2WON B;  4LBH A;  2VH7 A;  2V2Z A;  4DSF A;  2HS0 A;  3A3P B;  4CO0 A;  4NZ0 A;  4CLL A;  2XY7 A;  1OS5 A;  2ILY A;  2XS7 A;  2XC9 A;  4ES3 A;  4C8O A;  3Q23 A;  3IG1 B;  2PN6 A;  3UCU P;  1VBY A;  2LQJ A;  4M5D A;  2P9G A;  1HHS A;  1C0T B;  3Q8S B;  3M8Q A;  2DGQ A;  4QYZ J;  1NJW A;  1YJV A;  4ECR A;  4FVC A;  4ECQ A;  3H2V E;  2AYG A;  2DGS A;  4FNH A;  1C1C B;  2W4D A;  4M5K A;  1LFW A;  4OI6 A;  1GXL A;  2PII A;  3PYE A;  3ZZT A;  4DV1 F;  4ZVE A;  3O8W A;  2DNZ A;  1D8Z A;  2MPU A;  5ETO A;  3NL0 A;  1XR6 A;  2JLG A;  1U0S A;  4OYI A;  1UFK A;  4DPO A;  4KYZ A;  4LVN P;  1KDN A;  4UY8 T;  4J91 A;  2DJW A;  3UD3 P;  3NGR A;  1FJE B;  4Y00 A;  1U7L A;  3X3U A;  1REG X;  1GAO A;  4XTT A;  2PC6 A;  1YJR A;  4C2M A;  2J7W A;  3LP2 B;  1S6P A;  5DGB A;  2UUA J;  3E2E A;  1N36 F;  4PCQ A;  1QM9 A;  4MYU A;  2GQC A;  3KK2 B;  3R6G B;  4C48 A;  5GAD U;  3F0N A;  2XMM A;  3H7H B;  4G1Q B;  3HFZ B;  3IAS 9;  3DU5 A;  1FEH A;  2Y0B B;  4TXS A;  1XC9 A;  5DG8 A;  2YNH A;  1NZA A;  3A4T A;  2WBM A;  4LF5 F;  4DU8 A;  1BWE A;  4DUZ J;  4DG1 B;  2J0W A;  2OPS A;  3H20 A;  1T0T V;  1L5U A;  2PE8 A;  3LO3 A;  3GTY X;  1DTQ B;  2Y8W A;  2FHM A;  2J8S A;  1S97 A;  1KLM B;  4O3R A;  2HGL A;  1QVG R;  5JVG Q;  3KNA A;  4FYX B;  1HMV B;  1OO0 B;  4RNF A;  3MM5 B;  3VQT A;  1NM2 A;  2DNN A;  2JDJ A;  2WW4 A;  2I5J B;  1FTR A;  3GR1 A;  4NPO A;  1DTT A;  2KDO A;  1DLO B;  1RWK B;  3G8T A;  3MPV A;  1F3V A;  4CM2 A;  1HI8 A;  3CJK A;  2KFY A;  2B9Y A;  3FSY A;  3ZTS A;  3CSK A;  4Y65 A;  4RPF A;  2ATL A;  1TFW A;  2B4P A;  3I5C A;  4MH8 A;  3DM2 B;  2WK4 A;  1T9T A;  3WX8 A;  4JV1 A;  3D4J A;  4USV A;  1SC6 A;  5B0B A;  3NMR A;  4IFV A;  4X66 F;  5CH7 B;  4O3O A;  4YHH F;  3MR6 A;  4UUX A;  2G1H A;  4OYP A;  2V68 A;  1RU1 A;  4EI2 A;  2W9B B;  1YJ7 A;  2MZJ A;  2G0C A;  2ZDP A;  4W4M A;  3M30 A;  3CJ3 A;  1X7V A;  2QLW A;  2VPY B;  1SKR A;  2ZH3 A;  1V5I B;  5EWF A;  3QZ8 A;  1NO8 A;  3IO1 A;  2VG5 B;  2BRK A;  3M8Y A;  3MPY A;  4RW6 A;  1FCA A;  1KQF B;  4LQ3 A;  5FDL B;  1P8G A;  2C2N A;  4PQU A;  3SMZ A;  1U0H A;  1R8P A;  2CZ4 A;  3R27 A;  5CQG A;  3HSD A;  5HRO B;  5ETL A;  1XMO J;  2SXL A;  4DJB A;  4LVO P;  3BQ1 A;  2C3P A;  3HX9 A;  2AIR B;  4L6V 3;  4V19 J;  4TLR A;  3KLH A;  1M5H A;  4LSN B;  2ZBP A;  3G87 A;  1OPI A;  1IM6 A;  2A18 A;  4C3K A;  5CAA A;  1NBE B;  1XJW B;  4JV5 F;  1AFJ A;  4DF8 A;  5IT0 A;  4JI3 F;  3J7Z T;  2HQC A;  2V2Q A;  5AE1 A;  1HL6 A;  3EGW B;  2HRY A;  4C11 A;  4K2X A;  2MY8 A;  3VAM A;  5GAD I;  2MLY A;  1GFW B;  1RCX B;  2HIQ A;  3QT7 A;  3RW6 A;  2FZG B;  4M5H A;  1G7C B;  4KGV B;  4RW9 B;  4DL7 A;  4NA3 A;  4ZVP B;  3RBX A;  4YB1 P;  2ZDO A;  3IP0 A;  5KFG A;  2V8G A;  4G65 A;  3CO0 P;  4UZC A;  3MMC B;  2HFN A;  3UN5 A;  1OIA A;  4P2X A;  3K89 A;  2VPX B;  1HD0 A;  1UJ6 A;  4FF2 A;  2HBQ B;  5J2Q B;  3IC1 A;  4O44 B;  2J6S A;  2YVS A;  3RBD A;  4WFA Q;  4NMX A;  3T5H A;  2VAS A;  4I68 A;  5LMU F;  2AJ4 A;  3QPI A;  3LGM A;  2CZV C;  4B9N A;  2R2R A;  4GC6 A;  1PJ5 A;  1U24 A;  2XMK A;  3SSR A;  4MK8 A;  3I0S A;  4ID8 A;  1NSP A;  3THT A;  4KHR A;  4LBP A;  3OD2 A;  4X64 J;  1YJN S;  1TEL A;  1JNR B;  3G6X A;  2OTL S;  1S1X A;  4JYA J;  1RTJ B;  4DR1 J;  4I69 A;  1REV B;  3V6J A;  3BSO A;  5KT3 A;  3Q8Q B;  1X9S A;  2HHH F;  2VIC A;  2W2P P;  1TZ0 A;  3CIZ A;  3VR1 A;  2EFV A;  4IOA Q;  5AXN A;  1AB8 A;  1B3T A;  2OSQ A;  2XLI A;  2X51 A;  2QYC A;  3IRX A;  4CLF A;  1RAH B;  3M1V A;  3G6Y A;  3EE3 A;  1RKJ A;  4DS5 A;  1B70 B;  4GVL A;  2MQ8 A;  4X4O A;  4YB6 A;  4DSE A;  4LIR A;  2AJ0 A;  3T19 A;  4ECZ A;  5KFE A;  1PC5 A;  1N33 J;  1P1L A;  3T6J A;  5HK4 A;  3BYR A;  3DMJ B;  3MI7 X;  2YQ0 A;  3CUN A;  4JV0 A;  3W9I A;  1DHM A;  5A8W A;  3HHD A;  2VB6 A;  1X4H A;  5KFN A;  2U2F A;  5CHC B;  4HH1 A;  5HVF A;  3CJ5 A;  3ELH A;  3TA0 A;  4ELT A;  1XER A;  1M0S A;  4J37 A;  2PI5 A;  4AD6 A;  2Q43 A;  1IKV A;  5KAK A;  1SQE A;  3SYZ A;  2BJ9 A;  3EJM A;  4NLQ A;  3D1Q A;  1T9W A;  1NZ8 A;  4ITS A;  2KYZ A;  2CVI A;  4LR7 A;  3T5K A;  2Z2Z A;  1X4A A;  2DPI A;  3ONQ A;  4DFJ A;  4QPT A;  3LQV A;  5DDR C;  3UDE A;  2KJV A;  2F65 A;  4LF6 J;  2B9W A;  3N5F A;  2DRA A;  2AV5 A;  1P9Q C;  3FMB A;  3GIK A;  1N5Y A;  1UW4 A;  4WP9 A;  1GMW D;  2WB1 D;  3VGU A;  1KKH A;  3FK4 A;  2G9O A;  1S79 A;  5BXI A;  4WTO B;  4J5O A;  2HVH A;  2C2M B;  4HHJ A;  3GIM A;  4F67 A;  2QN6 B;  1XTZ A;  1JQG A;  3POT A;  1U02 A;  2RIJ A;  4YR2 A;  1CJV B;  3L7U A;  4DXL A;  3MED B;  4KHM A;  1NND A;  2AZ3 A;  3UWT A;  2NQP A;  3FBB A;  4CTA A;  3ETM A;  3HFV A;  1HNZ F;  4LRB A;  4QIV A;  4IRC A;  2CPF A;  1MN9 A;  1SQF A;  2UZA A;  1T9Y A;  3MEE A;  2YQ3 A;  1KOH A;  3NGD A;  3KLF A;  1AUS L;  4DSJ A;  2JWN A;  2PFF B;  2JLE A;  4ZPC A;  1QUP A;  5GVQ A;  5EN1 A;  3LP1 B;  2DHA A;  1IKW B;  3VTI A;  1LW2 B;  3QQC D;  2LEP A;  3B78 A;  1WOS A;  3K2Y A;  4IOC Q;  1RTI B;  3RG6 A;  5HQL A;  1IR2 A;  4ZCM A;  2X3D A;  4H4O A;  4M8L A;  2PMW A;  4QU7 A;  3PV8 A;  1TL7 B;  2FC9 A;  3BDE A;  2V2K A;  1RYS A;  3J81 U;  3MUM P;  2V50 A;  2J7U A;  1D09 B;  3SSS A;  3W60 A;  2XWY A;  1VS3 A;  4WTY A;  2E5G A;  3LPY A;  2CG8 A;  2N3O A;  1H74 A;  1GTH A;  4NCG B;  3DLG A;  4ECS A;  4UOG A;  4DV0 F;  3FVY A;  2WON A;  1Q5V A;  4C0B A;  1KP6 A;  3OTC A;  5L1L A;  4LF9 F;  1OSC A;  2OP5 A;  3TJA A;  1WI6 A;  2PA3 A;  2W2Q P;  4NLR A;  3PYD A;  3T9Z A;  3CC7 S;  1HNW J;  2CQH A;  3KMQ A;  2UUC F;  4N7T A;  4I67 A;  2I2Y A;  1RIS A;  2AGO A;  2XMW A;  4CLT A;  1YGY A;  3IG1 A;  4RWX A;  1LXJ A;  1PKU A;  5E3C A;  1C0T A;  3VAF A;  3AXM A;  1RAB B;  2VQF J;  1MRO B;  1NSK L;  2AF6 A;  2HMI B;  1D0E A;  1FRM A;  2DGU A;  2OPR B;  3CJS A;  2RKI A;  1Q81 T;  3DOM B;  4YFU A;  1NK0 A;  3TVK A;  3UW1 A;  2HBZ B;  2V8H A;  1HNV B;  1BMQ B;  1FVS A;  2CNK B;  1C1C A;  5IZH A;  3VVU A;  2H4W B;  2A3J A;  1FD8 A;  2V6A A;  1RHK B;  3HVW A;  2H51 B;  4WJB A;  3TUI C;  2HYI B;  3C2P A;  1UJ5 A;  1RWV B;  4R0E A;  2QGF B;  3L9Z A;  5A2Q U;  4ECX A;  2BA9 A;  4ZLJ A;  4A47 A;  1S6Q B;  1HWL A;  5IT9 Y;  2H1Y A;  3SIP B;  5KFF A;  5CYQ B;  2VC0 A;  4I6W A;  1NKE A;  2IA6 A;  3EX7 B;  4XPC A;  1RAF B;  3QAU A;  2R7R A;  2DB1 A;  2QA2 A;  3CB4 A;  3LP2 A;  5DGA A;  3M6X A;  1XMQ J;  4JI4 J;  1SH3 A;  1UFW A;  1KOO A;  3KK2 A;  5F8G A;  2KM8 B;  5GMD A;  1UVI A;  4QWE A;  5KG3 A;  4C8L A;  1T95 A;  4QIG A;  4C0H A;  5G0R B;  2M8D B;  4BC9 A;  1FVQ A;  2KU7 A;  5D0E A;  3TAP A;  3T1Y J;  4RUA A;  4JI1 F;  4DG1 A;  2QE5 A;  1LKZ A;  2W7P A;  3C19 A;  2FJD B;  3PW2 A;  4WXO A;  3KUG A;  1DTQ A;  4MTP A;  3NWR A;  1KLM A;  4B3O B;  1CBK A;  3DHW C;  2HND B;  4DPT A;  2W1B A;  4JI8 J;  2XMU A;  5KFL A;  3BM7 A;  2IRX A;  1HMV A;  4ICL B;  2DEJ A;  1IN0 A;  1FER A;  3MM5 A;  2M9K A;  2DNQ A;  3CCJ S;  3UVJ B;  1X0P A;  4DV3 F;  3BEG B;  2G1D A;  2I5J A;  3CWJ A;  5CCM A;  2OI2 A;  4P75 A;  1DLO A;  3BV8 A;  1G3O A;  3DLB A;  4UY8 5;  3PEJ A;  1WTB A;  1FFW B;  2X3G A;  3HSG A;  1CJT B;  3K0J A;  2QA1 A;  2JRS A;  2E1P A;  5B09 A;  3FQK A;  3TVZ A;  5HMW A;  1RAA B;  2W7A A;  3WHI A;  2QV6 A;  2ROG A;  2EW9 A;  3M9M B;  2OFH X;  3Q2T C;  2ZJQ Q;  1VQ6 S;  1RKI A;  3DM2 A;  4O0I A;  3JXO A;  1U6B A;  2NUU G;  4WFX A;  4RKU C;  2B0G A;  3GQC A;  3PVX A;  3CDW A;  4IO9 Q;  3ZTO A;  1N5V A;  4OHV A;  3GLJ A;  3M8Z A;  2LXF A;  2VG7 B;  3Q24 A;  3LAN A;  3FDS A;  1WC3 A;  2FGC A;  2WTF A;  5LOQ A;  1FO1 A;  4TVA B;  3E01 B;  1K44 A;  3NLC A;  4NCA A;  3GFZ A;  5F0U A;  2W9B A;  2CJY B;  5DQI A; 
#chains in the Genus database with same CATH homology
 2F4F A;  2VJV A;  2FYX A;  2A6O A;  2XQC A;  2F5G A;  2XMA A;  2XO6 A;  2VHG A;  2VJU A;  2XM3 A;  2VIH A;  2EC2 A;  4ER8 A;  2A6M A;  2VIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...