2EC2A

Crystal structure of transposase from sulfolobus tokodaii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
130
Chain Sequence
MEYKSTRHAKYLCNYHFVWIPKYRRKVLTGEVAEYTKEVLRTIAEELGCEVLALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFQELKKSTNGKLWTRSYFVSTSGNVSSETIKKYIEEQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 136aa long hypothetical transposase
publication title Crystal structure of transposase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Gene regulation
total genus 31
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2ec2A00
4ER8A 2EC2A 2A6MA 2XO6A 2VHGA 2VIHA 2XMAA 2XM3A 2VJVA 2A6OA 2VICA 2FYXA 2VJUA 2XQCA 2F5GA 2F4FA
chains in the Genus database with same CATH superfamily
5E0OA 3FCVA 4DPOA 1KOOA 4F4YA 3GJTB 3IXQA 5J1NA 1U49A 5C42A 1SJFA 4TU8A 3FBFA 2MZJA 4DL2A 3T5KA 2JC0A 3BO3A 2YBVA 3TP2A 1T9TA 1MROA 1RT1A 3EPIA 4JI7J 3HX9A 4CRJA 2V67A 4F0MA 2UUCF 3CDUA 1FKOB 4RWXA 3J7ZT 4GMKA 4EYIB 3PRVA 1HD0A 1WHVA 4ECVA 1YRTA 2L9WA 3OFHA 3JSMB 3H5XA 4WU2A 2LXIA 8AT1B 1PGZA 1KWMA 4O44B 2GQQA 2G4BA 1PAUB 4P10A 1WG5A 3MR5A 4TVAB 1YGYA 2J9CA 3TUPA 3KMQA 2ZH9A 3CT9A 4PQAA 2K1RA 3QPIA 3I82A 1OMSA 4KT0C 3DU5A 1HNZF 4FXVA 4DFPA 1FNOA 1TP7A 3AT1B 2DD8S 4K7QA 5HMZA 4RPFA 3IGNA 4TY8B 1N36J 1YRXA 5D4NA 4X4PA 3E01A 1GMUA 3SI8A 1DTTA 2I8EA 3KKFA 3CW2C 1BWEA 4I2PB 5C24A 2QX0A 4FYWB 2R7UA 3LTOA 1ROFA 2O66A 4F4ZA 2CDRB 2QV6A 1U24A 2W9BA 1FJCA 2YKQA 3LOUA 1R8BA 2P9GA 3Q83A 4WKRA 4P2FA 4D3HA 4PYDA 2EG2A 2FLNA 2WVFA 1KD1T 4RUBA 4HH1A 4QCLA 2CQDA 5GADI 2BKOA 4YR2A 3KMSA 4X64F 3KLHB 3KK1B 1HWIA 1KR4A 5A0YB 1RZMA 4QBUA 2UP1A 4WWSA 3ILOA 4K0KJ 3G6ES 2OPRA 4FZVA 2WSEC 3D28A 2WW8A 4RW8B 4URQU 4M8LA 4OJ1A 3V4MA 2HSEB 5DJBA 3WC2A 2R8GA 4CH0S 5A8WA 3FRYA 2RQCA 3FDSA 1QUVA 3OVBA 4ZPBA 3MWBA 2G0CA 1FFSB 1RAHB 3DM2B 2CVIA 4P7VA 4NCGB 2H51B 2ZH2A 3US5A 1Y7PA 2EFOA 3RR7A 2KKHA 1F9EB 2DBBA 4CO1A 3BGRA 4C97A 5DGBA 1TL1B 2IM3A 1GTHA 4TLRA 3KHLA 3W64A 1Z2LA 4FF3A 3M6UA 1RT2A 3T6JA 1IKYB 2E5GA 3TVZA 2YKPA 1XMQJ 4KBIA 2NXNA 2HNZB 1VQ8S 2OPSB 4WPAA 3Q8RB 1NK5A 1JIHA 3UVJB 2W25A 4DR6F 3PX0A 3C16B 3EICA 2DNMA 1KP6A 2DPJA 1XTZA 4RJVA 4Y6IA 3M9MB 3CIMA 1MLAA 5F8NA 3J81Y 1FERA 4N47A 2DNYA 1QE1A 3G9CA 2ZOFA 1TK0A 3BZQA 3OXFA 1RBOB 1FDBA 3C14B 4RW4B 2AEFA 2JEJA 2VPWB 4KHRA 2I9SA 4ZOSA 4OL8A 1FFWB 4ZIWA 4YY3F 2QMXA 2DRAA 5LOQA 3HD1A 3O8WA 2NPFA 4C8OA 1DQAA 1VBXA 4X64J 3WQPA 4XO0A 3H5SA 3N79A 2DHXA 2G1DA 1U1LA 4ZVPB 3D3BJ 4QIEA 1KLNA 3C19A 5C2GA 4DFJA 2JDJA 1VLOA 3WIVA 4LIWA 2MKIA 2QA4S 1NSPA 2CJAA 2ATCB 4ZP6A 4CCHA 3ZNJ1 5JJBA 3K5NA 2FHKA 5T41A 2BKNA 4IO9Q 3GYGA 2KL8A 5GAHI 1IKWA 5F0UA 3MOJB 4UOGA 1S1UB 1HFEL 3AA9A 1FJGJ 2CUYA 1TTHB 1TFWA 3W2WB 5D0HA 3NY0A 4LFCJ 5DLGA 2BBEA 3CEDA 1U25A 3THPA 2F1FA 1HL6A 2IIHA 5K8NA 1RWNB 3MI7X 4LF8F 4X65F 3ETOA 2LYVA 4LRAA 1BLUA 4ILRA 1EP4A 2FGCA 5CABA 1GT8A 4CIOA 5HMYA 5H9FK 3IM9A 3RB3A 3OR2B 4JI3J 2IFXA 1GX5A 1RSCA 2A2DA 1KS2A 4A8WA 3HULA 2O01C 4ZVFA 2Y8YA 3ZNUA 5AE1A 4OI4A 1XN9A 3OXGA 4WP8A 2RVJA 3T5JA 2VFTA 3NGTA 2VFVA 3TI0A 3PZPA 2EFNA 1GXTA 2DNPA 3KHHA 1S5ZA 2C28A 2UVRA 2AHOB 3AOAA 2HHSA 1UVLA 4OLPA 1LWEB 1LW0B 1SKWA 5J2QB 4B9NA 4ANDA 1KEKA 5EHHA 3W8GA 5KFDA 2DGXA 5HAOA 2HS0A 4A8XA 3DRXA 4JBCA 3TX8A 2HHXA 1IKVB 4DL6A 1WTFA 2Z2ZA 2N82B 5F3TA 1B3TA 3M8RA 4YY3J 2YNIB 5LJ5Y 4RU9A 1URRA 2RDJA 4IG3A 3OT9A 1UVNA 4FVCA 4DCPB 3R7NB 1SV5B 2C1EB 3BEGB 1Y5NB 2ZVSA 1HARA 3KLFB 1D8ZA 4PPZA 5JUMA 1G7CB 4J9MA 2C2MB 1S7HA 1HBUA 2DRDA 5IS2A 4GVBB 4PG7A 2PI4A 4YDDB 2UUAJ 4E8UA 4ZN1A 5KFLA 3O1LA 1F60B 5ETMA 4ICLA 2AJQA 1HBOB 2J6SA 2LA6A 5K14B 3PG9A 3POTB 3QT6A 2OEMA 2F7VA 3FC9A 2F8HA 1VGYA 2NXUA 4MIBA 4F26A 3MEGB 4KSEB 4NLVA 2XLJA 2YKMA 1VQYA 4UY8T 3NCRA 2DXDA 3TX0A 4X65J 1RTIB 1SJRA 1TKZB 2VHGA 3DC2A 5D78A 1KONA 1ACMB 1S99A 3ZXWA 2HPUA 2PMZD 5KG3A 4DUTA 1FKOA 4PZVA 1WEZA 1Q7YT 3NRBA 1Q8BA 3JSMA 2YQ1A 2PIIA 1RWOB 3E2EA 4OX9J 4O44A 2IJNA 5KFJA 1SC4B 3KUEA 1MMLA 2KYZA 5J1PA 3N6NA 4LMZA 1YX2A 4PQUB 3CJ2A 1AFIA 4S0MA 2J8AA 1F5AA 5L9NA 3UD3P 3RUBL 3PO4A 1UEKA 2FYXA 1B7FA 4WCEQ 4DR5F 3OUYB 4HI2A 4FS2A 5M2PA 3NMAA 3GE9A 2EK1A 3TW0A 1UPPA 5DG9A 3NLCA 4TY8A 2CNOB 3HCXA 1G4CA 4I6WA 3QGPA 4TU7A 2OEJA 2PEHA 1NSAA 4I2PA 4YMEA 3T6BA 1HMVB 5G0RB 2GHWA 2JWNA 4LVOP 2AP6A 4FYYB 4KE5A 1I94J 1U2RA 2B6AB 1T8EA 3K17A 2HVIA 4IR9A 1XBWA 1NHUA 5DS7A 2VPZB 4RW9B 1GH8A 3ILIA 2YWHA 4LJMA 2R8IA 2B9EA 1R3NA 2JHEA 2H5IB 1SC6A 3K58A 2VONA 3KLHA 1VJWA 3KK1A 2E5HA 5A0YA 3MM6B 4DV3F 3V4IB 4OHYA 4ZPAA 3K59A 4HL9A 2AV5A 4RW8A 3HHLC 1JJ4A 3TR5A 3ENAA 2MKHA 2D9PA 3IMQJ 2DB1A 2FD2A 1FRLA 2R2UA 2QYGA 1QVFR 1HWKA 3I56S 3DXSX 4L3NA 5D77A 1F6TA 1S7IA 3X3UA 2Q66A 2VKZG 3I87A 3B8HA 3DM2A 3UQSA 3W5ZA 4NCGA 2WONB 4O3QA 2VPXB 1VBKA 2E5LF 3ZFVA 2UXDJ 3OHAA 5K20B 4NASA 4Y65A 2UU9F 1P6TA 3CJRA 3LWLA 1V3RA 1TL1A 2CQ4A 3QMQA 2VKRA 5D0RA 4F0KA 3N6LA 1NZ8A 2Y0SD 2U2FA 3LAKA 2Z2MA 4HR2A 1IKYA 2OO4A 2BYCA 3OR1B 3H20A 1Q86T 4AFFA 4DR5J 1FX2A 3S8SA 3CC2S 5U47A 2HNZA 3LQVA 2NXCA 2OPSA 1P9YA 2MSSA 1RCOB 3UVJA 3HVAA 3ZO7A 5E5NA 2XCPA 2KTQA 2OELA 1RJJA 2MJUA 3M32B 2M88A 4LBIA 3PY8A 3JQMA 1RT3B 4U7UK 2BJ9A 3KUHA 2FDNA 2GAGC 1NK0A 1NNDA 1XWLA 1LK7A 4NPOA 4Y0FA 1FXDA 3U27A 2YNFB 1RAEB 4QPXA 1R7IA 2ZDPA 5HJXA 3C14A 4NZ7A 3W1YC 1FKAF 3KK3A 2OIHA 4RW4A 2R2TA 3DRYA 1Q5YA 1SBRA 3AQPA 5JMNA 3CE8A 1HYSB 1KDNA 1U2CA 4J37A 3T1YJ 5LM7E 1T9WA 3FNNA 1NB7A 1T0TV 3FCWA 1C4AA 1RACB 3OSPA 2BJ8A 3P5BP 1IWGA 4JI1F 1CBKA 2PA3A 3BBFA 1FCAA 4LFAJ 1JK9B 3RYLA 5ETRA 1U0SA 3C46A 2Q1LA 3N0VA 1SCJB 3AOBA 2B7BB 3CJ0A 3MM9B 2OEKA 4QIFA 4F8RA 4KTQA 1Y3JA 2AJ2A 4KH1B 2KM8C 3HHEA 9RUBA 5IV4A 1GXLA 1S1UA 1QD1A 1UETA 1LK5A 2CZVC 4J9NA 2AYEA 5HMWA 3UW1A 4ED6A 3HFKA 3AOCA 4O23A 1X7VA 4ID8A 4K4VA 3E3XA 1KQKA 5A8RB 4NMXA 4AXIA 2BR0A 4XAKA 3KHGA 3QFWA 4OYZA 3L95X 5D4LA 1T9VA 1UTAA 3TUZC 4ELUA 1UJ4A 3OR2A 1X5SA 2AQ4A 2J0XA 1LNQA 2Q79A 1R8AA 4DL0C 3WX8A 2HBYB 4A47A 1FKPA 5KT6A 3NCPA 4LF6J 4DV7J 3GYNA 4NWBA 4X4RA 2ZD1B 3ZTRA 2MKCA 3T1HJ 3M8SA 4ZVOB 2RS2A 3PR4A 3SFUA 4ECUA 4ZVRB 5IM0B 4Z2XA 1LWEA 1LW0A 5J2QA 2BZ2A 3KLVA 1X0FA 4M5GA 5I3UB 4M94A 4EWTA 2HNYB 3PCOB 1IKVA 2GNKA 1B4SA 3SSSA 4PG5A 2YNIA 3OFEA 5GADU 5ETOA 1XR6A 2GMLA 3CJ8A 1IBMF 2CIMA 4ENOA 1VQ5S 2X3GA 2F4VF 3FGVA 2DHHA 2RRNA 1SV5A 2Q6BA 4KR0B 1PIEA 1XNRJ 1LXNA 2QEXS 1KFDA 4R8UA 2AF6A 4LSZB 2CRLA 3KLFA 2ZH4A 3DRSB 4I0WA 4GVBA 1RADB 2F40A 4O3OA 5ETSA 1RWWB 3R7SB 5IZHA 3PW0A 3EWGA 1WKKA 2BRKA 4K4TA 2F65A 1Q8IA 3SCJE 3VAGA 1HBOA 3HVWA 5D4PA 3JXOA 1SJ4P 5K14A 1U1MA 4JI4F 5KFNA 2LEBA 3POTA 4FBTA 3QSIA 1H6KX 4F0HA 2PI5A 3MEGA 3QGGA 1N6QB 1CLFA 3K8VA 5BR8F 3MPVA 2GJIA 3VGTA 4KC5A 4QWAA 4TY9A 3FVYA 5B0EA 2XMVA 1NSQA 2RU3A 2W8KA 5KOXA 4JB8B 3I0SB 4OI0A 2XS2A 3W65A 4CYUB 3ISNC 2EG1A 3B6BA 4OYXA 4KHPF 3H2LA 4KFBB 3VALA 2AX1A 1VIXA 2DJWA 3SDEB 3MTKA 2P6SA 5CA5A 3GR0A 2QA4G 1L5UA 2K3KA 1Q4RA 3FSYA 3U02A 1N5VA 2FJVA 4UZBA 1X31C 1Y10A 4QWEA 4PQUA 4PEOA 2ZHOA 5CYMB 1WC3A 3WZ0A 2BE9B 5KFCA 2CPZA 3OUYA 1L3KA 1I5OB 1OWXA 3HF5A 5KFHA 2WVCA 2XNRA 2CG4A 1J5OB 3BKUA 2WZ1A 3CD5A 2EPIA 3LAMA 1QSLA 4JV5F 4MH8A 1XK8A 3DHWC 4OYWA 4ZVSB 2F4VJ 2N7CA 2Z4PA 2MDAA 2LFVA 3D1QA 1HMVA 3A1YG 5G0RA 1KQFB 2G1HA 5BYQA 1MW7A 1RCXB 2B6AA 4QYRA 1S0MA 3KLGB 3OL6A 4O0IA 1K0VA 2W7PA 5KTQA 4B02A 5IT4A 2FJDB 2HFNA 4DR1F 1NMEB 4RW9A 5HN0A 2KH9A 5GAHU 2KU7A 1NDPA 4HHJA 2AEJA 3CCMS 2BVZA 2CPIA 1FA0A 5AE2A 3TEHB 1CVJA 5BYSA 4LF9F 2CXEA 1TQLA 3MM6A 2KFZA 3RBEA 1HQ2A 3V4IA 4CLZA 4CNYA 1MMDA 3CCWA 2MQ8A 4J7CA 2PDAA 4OX6A 1B64A 4K4SA 1VQSA 1WDTA 3T19A 3MAHA 2P9CA 4OZJA 4X66J 4CWBA 4M5IA 3G8QA 4H4MB 4PAAA 2GMJA 3UPFA 2GX8A 4ELTA 1K47A 1HR0F 2OSQA 2L41A 4EZ9A 3G6XA 3PR5B 2H5JB 4CQ1A 2ZE2B 2BDPA 1S6OA 3Q2SC 2WONA 1RKIA 4K2JA 2FUG9 4FN5A 2IYIA 1OYDA 4P2XA 5KFTA 3D3CJ 2H3EB 2ZH7A 2DR9A 1NK9A 2OD4A 2HHVA 2HBRB 1RYRA 1VHFA 2M0GB 3FEXB 2L9NA 1XERA 2GHPA 3OR1A 3QGHA 4NRUA 3U1NA 5K8PA 1PYOB 3PNIA 3OHBA 2R2RA 2D1CA 3DNCA 2FLLA 2B4OA 5KFQA 3PEHA 2EXUA 2CPJA 2V63A 1RHQB 1KLMB 3HSZA 3TRGA 2VF3A 4ALZA 2W2PP 2IY5B 1OY8A 1VFJA 1RT3A 3J7YI 4AL7A 4OMFG 3ET6B 1M5SA 3G82B 3CDWA 2F5GA 2CYYA 3ULHA 2F8MA 2YNFA 4LF1A 4LSNB 1BY9A 2XTJP 1RA7A 3ISZA 3KG4A 1NH7A 2GQCA 4AL6A 1HYSA 4J9VA 2MQPA 1U8WA 4C11B 3TAQA 1JKHB 1TU0B 1BQNB 5KG0A 4WTOB 5AT1B 2RH3A 5HL7Q 1S4EA 1T02A 2C2DA 5DQIA 4HKQA 4NX9A 4A8FA 5F41A 4OJ3A 2MZQA 2MMYA 2WVBA 1JB0C 4Q43A 1W26A 2I1RA 3EXCX 2RRBA 3R6GB 4DL7A 1SB6A 3VWSA 2A2CA 3MM9A 2WRMA 4DUYJ 5F8LA 5E41A 1S1WB 2CJXB 3BYPA 4UQGA 1JQGA 3GFYA 4J9OA 4NL5A 2DHSA 1KTQA 2EKYA 3MDFA 3KDOA 2GCFA 5F8IA 5DQHA 3ZTPA 1VC5A 2DY1A 4DV5F 4EO6A 4JYAJ 3I6PA 1IWAA 2HQIA 1OSCA 4FYVB 3P45B 2JVRA 4ES3A 4C0OC 1A0OB 2E44A 5HJYA 4ECZA 5A8RA 2AX0A 2YKAA 1RAAB 4NEZA 1N32J 1H2TZ 3MMBB 4ANEA 4LQ9A 2LECA 2HYIB 1CQNA 2OMOA 3ZTSA 1RK8A 4B9UA 3HJVA 1RQ0A 1C4CA 4ETXA 3DCAA 1U1OA 1DTQB 2YWEA 3IBCB 2YH1A 4KV8B 3BSCA 3S01A 1ZH5A 4OZ5A 4Y3CA 2HNDB 3LA0A 2NUHA 1HQUB 2ZD1A 4TQSA 2Z8QA 1FXLA 1R31A 1RAIB 4RUHA 3H7HB 2POKA 1HNIB 2HHUA 2WAQD 1X9WA 3QT7A 4J9RA 3TWZA 1UMJA 3LP2B 4NLYA 1FRHA 2CJQA 5IM0A 4DR7F 1QSYA 2VBWA 5I3UA 5EX3A 2CNNB 3IR7B 2HNYA 3EUNA 3ONQA 2OLWA 1UJ6A 3RRHA 2G9OA 5DDRC 1S57A 1I6JA 4Y2KA 3Q24A 4LF7F 4W4MA 5E2QA 4CLSA 3CMQA 4XDCA 3J7AN 4O4RA 3DRSA 3DOLB 8RUCA 4QU7A 4F50A 1IVZA 1JNRB 2M70A 3T9ZA 3FBBA 1PG5B 4JI5J 1W7WA 1Z2ZA 1RWKB 5KT2A 3C6UB 3MURP 4IFYA 4KQZA 3CCUS 5IQQA 1VQMS 2Q6CA 2QN6B 3G8SA 4HYKA 1U26A 2IA6A 4K4XA 4NLQA 3D6TB 3CCVS 1MN7A 3IS9B 4QZVB 4B9VA 1N6QA 3DLLQ 2XBPA 1FFGB 4DI6A 4LR9A 2C2OB 4L73A 2RDIA 2ZDOA 2J6TA 2BE2B 3I0SA 3SXLA 4F4AA 3TUJC 4CYUA 2V69A 2Y3YA 3A3PB 2UV8G 4KFBA 4QWBA 3SDEA 2Z0GA 3K57A 3CUNA 2WK4A 1FT8A 2MZRA 3JAMU 4DPUA 1N48A 2MB0B 3BV8A 1J5EF 1XC9A 4NLWA 4RR5A 1N33J 1QUPA 3B78A 2AYBA 1HD1A 2HS3A 4DV4J 5CYMA 4H4OB 2C2RA 4IFVB 1MWZA 3IG1B 2XI3A 4OX7A 4ED7A 2W2MP 2NZCA 1SH2A 1WG1A 3P5TL 1W2BR 4G1PA 4IQMA 1J5OA 3EZ5A 3F0NA 1Z1ZA 4DV1F 5KOWA 2HFOA 3RBZA 1YJRA 1F2HA 4DS4A 4NCBA 4OYPA 3SZ2A 2CVEA 4LF7J 1F5BA 2R42A 3DLEA 2L9DA 3M8QB 4QQBA 2AJFE 5A6WA 2ZM6F 4P9SA 2XMUA 3QJJA 4WF9Q 1G6BA 4QR0A 4WFNQ 3KLGA 3M4XA 4O0NA 1Q78A 3NL0A 4U8YA 1WI6A 3MR7A 4ZVUB 4A8KA 2H4YB 2VC1A 1LWFB 3CMES 4ZPWR 3WDOA 1FF2A 4Y2IA 4J9LA 1RTJB 2JLFA 2YQ3A 2NSCA 2HHQA 4DL5A 1CJVB 3W60A 2HZVA 3RRGA 4IO1A 3EGNA 4DZ6A 1HNWJ 2KJVA 4KIAA 1RE1B 2CADA 5DDQC 3J81j 1HNXF 3A8JA 2A1BA 3AH6A 4F2RA 2RD5C 2OJ3A 4A8SA 3R5CA 1WDDA 4A8YA 3GSIA 2HIQA 4H4MA 1PJ5A 1M1KT 1R0AA 1GQEA 4C3KA 2LDIA 1RT6B 2D3ZA 3MD1A 1V5VA 5DZ7A 3CCTA 1FJ7A 3CDAA 4UTGA 2JJ4D 3VGSA 4BWJA 4OZLA 5ITHA 2VDIA 2ZE2A 4GO5X 3LW5C 2LQ9A 2VPYB 4Y00A 2W7OA 3R3TA 4QIGA 3DRRB 1N34F 1FDDA 5DDOC 2DITA 1S9EB 2IAJB 3T1AA 5IWAF 2GS8A 3NS6A 2AT1B 4NA1A 2RQ4A 3ZC4A 3BO2A 2IMWP 4DX6A 1IR0A 4Q44A 1BMQB 4WIQA 1R27B 5CXTA 4FP9A 3CDBA 2VH7A 3IC1A 2JLGA 2COLA 5C2CA 4QWCA 3IWXA 1SVDA 4RLEA 1M1GA 1KLMA 2N7YA 4NLTA 5HROB 1UFKA 2UXCF 1A6LA 1VYAA 2VA3A 2OAUA 4HDGA 3IFEA 2IRYA 3GV5B 3ET6A 3G82A 3I4HX 4L74A 1LOUA 4B9SA 3TA1A 2A10A 4ELVA 1NDKA 1VS3A 4LSNA 5F8JA 1T9UA 4DUZJ 1RT7B 1EAYC 4WKYA 1UFLA 2FJBB 4IDKB 3GFHA 1KSPA 2H9ZA 2M9KA 4ATNA 4ER8A 2F63A 4DR2F 4LRCA 4C11A 4CO4A 2KRRA 3C15B 5EWEA 1S77D 4MFBB 4FNIA 4WK1A 1V3ZA 1JKHA 4WBFA 2XSJB 1BQNA 3TJ9A 3LWMA 2AKWB 4NYZA 3IGVA 1TMJA 3CB4A 3IWLA 3QLHB 4WFAQ 4WFZA 1VLYA 4YP3A 1QVGR 1IR1A 1KTVA 3MTJA 4EI2A 5L38A 1HNXJ 1EB0A 1MG7A 3MOZA 1SIWB 3UD4P 5KFGA 1S1WA 3R6LB 4QYZK 4F4XA 3NOGA 2FHOB 3EJMA 3UNGC 3BBCA 3IWNC 2DR5A 3N5BA 2X1AA 2PO4A 3MGJA 5HI7A 2J0QD 2QMUB 2R4FA 2VG5B 2VJVA 4OQJA 4K4YA 1L3UA 4USTA 2JEGA 1YJUA 3M6VA 1W2IA 2RKIB 2PT0A 2FVPA 2V4RA 2HQCA 4P6QA 4UZCA 3MMBA 1U1PA 3TJ8A 1SL2A 4I2QB 2OFHX 1FRIA 2FJXA 3EMTA 5IWAJ 3MR3A 2ZC4A 3PEJA 4AQYJ 1EKRA 2CQ1A 1HW9A 4DSIA 1GTEA 4DN0A 2QA1A 4OX8A 4OI3A 1QSSA 1NLKL 1RWVB 3SCLE 2J6UA 2QLFB 1DTQA 1FX4A 4KV8A 4F4KA 1TKDA 1S0VA 4C8ZA 2HNDA 3AXMA 4U7CA 1U48A 2RU9A 1HQUA 1E6VB 2B4UA 2XB2D 4LF5F 1VIOA 5H9EK 4JI8F 1HNIA 4ED8A 3LP1B 3OTOF 2BJDA 1RISA 2ASYA 4YB6A 1WF2A 3QATA 3LP2A 2X51A 3TA2A 3EPGA 5KFAA 4OHZA 1NO8A 2BACA 2YNHB 5T7LB 1VBYA 2HFUA 1NJWA 2W4DA 2GIRA 3UD5A 4DF8A 3UDLA 3Q8SB 2DIUA 1O6XA 4MKBA 3PKMA 3CO9A 4J90A 4DR2J 2R8JA 2A6MA 2QMWA 5DM7Q 4P2MA 3HO1A 4NLSA 2UUBJ 4NA3A 5A2QY 2ZWOA 3KYLA 4Q8FA 4F25A 1FEEA 4YHHJ 5K8OA 1ZM3A 2VODA 4CLYA 2HHWA 1Y4ZB 3KUGA 2ASLA 2HHPA 3HI9A 2ZJQQ 2MJNA 3DOLA 1RDRA 5CH7B 3FRZA 1RU2A 3TJAA 4K4ZA 4IRDA 4TNOA 2HFVA 3JYTB 4ZLJA 3L7UA 3C6UA 1BD6A 2IVMA 4OYMA 3Q8YA 1X4CA 4HTIA 1AYEA 1TL5A 1UJ5A 2D69A 5EWFA 2VQEF 1AA1B 4ETZA 5D0EA 4A4JA 3IS9A 4NXMF 4Q5VA 2I38A 4N41A 1RBAA 4GKKJ 4J9SA 2DTJA 2ASJA 1ZOTA 4DS5A 1X60A 2HURA 2JEFA 2MLYA 3I55S 5EDWA 3LUYA 2FVSA 2FIUA 2BE2A 3HD2A 2VJUA 2ADCA 3MEDB 5A76A 3VHQA 4H4KC 1X9SA 1EX8A 3NXZA 1WEYA 3K2YA 3Q8QB 1RLDA 4ZCMA 4UOCA 4RBTA 1NKCA 4LF5J 4DQRA 1S0NA 1LWCB 3BDPA 5EN1A 3AQOA 3J7YU 3MEEA 1M5OC 2O5DA 2J9DA 3VQSA 4FF4A 2VQFJ 3ZZTA 2V2KA 1IKXA 3NOCA 4H4OA 4IFVA 4RNOA 3QWPA 2J76E 1FK9A 9ATCB 1X4FA 3IG1A 3MM8B 3NP5A 3GLJA 1XMOJ 3MPWA 2RDDA 3V6DB 4BS2A 2D3O1 4IRKA 4EEYA 4KB7A 4EBCA 2K3IA 5D4OA 4U67Q 3H59A 1KBRA 1NB2A 2M7SA 1WOOA 2Y1RI 2V4JB 1RHJB 3M9OB 3M8QA 5HVFA 4LBPA 4WU3A 4MJKA 5E7OB 2DISA 3U1MA 2ZZMA 2VFSA 3K5OA 4MK8A 1JXVA 2P2CB 4GRSA 5CCLA 1Q7LB 4JI7F 2BKPA 5GAEI 2QG9B 2X1BA 1I51B 5LT5A 3HK2A 2VZ9A 3SBMA 5G4DA 1TV6B 3GTYX 3CXCR 2B4PA 4YN3B 3W62A 3VGUA 3UDEA 3FQLA 1BXNA 1LWFA 1UVJA 2HG4A 4USUA 1RTJA 1ULRA 2WBRA 2XWYA 5IC4B 2VQEJ 2OKQA 3QO9B 1UKUA 3ISND 1S97A 3PW4A 3M2VB 1CJVA 3PYFA 1RT5B 4Y2CA 3GZ7A 2CG8A 1TK5A 2M5YA 1WEXA 4JV0A 3D0IE 3TZYA 1P1LA 1MU2B 5D6GA 3HFZB 2B9XA 3KG1A 3ZZOA 1PBAA 5L1JA 3HSJA 1NPKA 1OY9A 2BV3A 2L08A 3CJ4A 3OFGA 3Q23A 1TKXB 1N36F 1RT6A 3VCDA 2M2BA 2ZH3A 4C9DA 1XIQA 2ZJRQ 5KG4A 1OPZA 2IM0A 2VIHA 1VISA 3OBIA 2C22A 2FQQB 2RSQA 4L6V3 3TUIC 3DRRA 5I42B 1N5SA 4UW2A 3G87A 3KLIB 2QSWA 5FLXU 1T3OA 4IRCA 1S9EA 2IAJA 1OSDA 2EFGA 4URGA 3S7RA 4OI6A 3NGSA 4C0BA 2XSFA 4JI2J 2CJ9A 4U7UD 5KFSA 2DGWA 3H42A 4ECQA 2C2ZB 2WVDA 1R89A 2J5AA 4CI0B 4R0JA 2XGPA 3A8IA 2GVDB 1WC5A 4IH5A 2K7JA 3P4UB 2N4DA 1WHXA 2BQRA 4K0KF 1ZPVA 2LXUA 2KT5A 5HROA 2VFUA 1VC0A 1K8AT 2AEMA 2FC8A 2LDYA 2V9WA 2RILA 2DGTA 4G1QB 2UV8A 5B0FA 3J80Y 3LP0B 4PG6A 4ZA1A 1ZM9A 4IYQA 1G3OA 1RT7A 1QJHA 5KFOA 4X62F 2CWXA 4XIUA 5KAKA 3BQ1A 5HVGA 4ED3A 1T03B 4LF2A 3DN9A 2E9RX 1Q5VA 3GU0A 3C15A 5AXMA 2WB1D 4NLDA 1CG2A 4MFBA 5KFIA 4ZCLA 2MKSA 3ZZYA 2E1AA 2XSJA 4NZ0A 3KTQA 1S49A 4HI1A 4DMZA 4P2SA 3AB4B 2NLWA 2LKZA 4ZVHA 1B0VA 3QLHA 3BO4A 3GV8B 1NK6A 3M2RB 5CD4A 3MFHA 1RU1A 1FHTA 2ZITA 4ID5B 3SV4A 3GWCA 1XMQF 1K1QA 2ZBQA 1SQFA 3B82A 4J9UE 4LREA 3D6FB 3D4JA 3G86A 1NBEB 2B9WA 2AJ4A 3JS9A 2W7AA 1S9FA 1B7YB 2AWZA 4K5RA 4BBYA 1Q79A 2VG5A 1TL3B 4AXJA 4B3TJ 1EJ7L 1KVJA 1U2FA 1TMMA 4K59A 5LMUF 2JH3A 2AJ0A 2RKIA 3MAQA 2GVZB 1NKBA 2ILYA 2ERRA 4LF4F 2CNLB 1NJYA 4I2QA 5E3QA 1PJ6A 2HMIB 1IBKJ 3K8WA 1ZZFA 2HKEA 3R27A 1IXKA 2YTCA 1KN6A 1B70B 1D9FA 4W98A 3R5GA 4FS1A 1RA6A 5K9FA 1BGXT 1FDAA 4RUAA 3BR8A 4ZP8A 1VK3A 2FZKB 1ELOA 1E6VA 2ZBIA 4CLKA 3KXDA 1V9OA 3B4MA 3LP1A 3GMGA 3HVTB 2B4VA 2VG7B 1RAFB 5D15A 4HEA9 1WF0A 1SC3B 4NLUA 2YNHA 5T7LA 4DU8A 4RNHA 4X62J 1RTDB 5EGYA 3CJKB 4ERDA 1FJGF 3D54A 3LO3A 2DNOA 3OW2R 2J9DE 2CPXA 2HRTA 4Q2LA 1KRPA 4LFCF 3EYZA 3OVAA 3HHLA 4WXOA 2DNGA 3GIIA 4XPCA 1XEZA 4F3OA 2ZH5A 1DAXA 4N76A 1U1QA 2QSFA 2R8HA 4KAIA 4IR1A 2ACMA 3K5LA 2KXFA 3C2PA 2DNZA 4DL4A 2DR6A 2H65B 5FDLB 1ZAWA 4JI3F 1REGX 4OIXA 1LWXA 3EXYA 1PSDA 3AJ1A 2ZHBA 2Q43A 1D3WA 2PSZA 4BDPA 4NZ6A 3IO1A 1X4DA 3JYTA 4X4VA 4HHUA 1S76D 2JFKA 2J7WA 3E8OA 2JSXA 2N3LA 4MKYA 2QL7B 3KJVB 3UE2A 3OV7A 5LXYA 1HWJA 4CO5A 4I68A 3QWUA 4CLPA 2JZ5A 5LMUJ 1TAUA 1VRUB 2YNGB 1P1TA 5KFPA 4LF4J 3N9UC 1REVB 1X4HA 3J80U 3EZOA 2KXNB 4ZJOA 1UA0A 2B43A 3MEDA 3UN2A 4LR8A 4QR1A 5B0DA 1AXQA 3PJ9A 3DDKA 2FVRA 5KT4A 1S4FA 1LWCA 3W63A 5D8HB 2GFFA 1OO0B 3AY0A 3MCMA 1HNVB 4ZVQB 3OL8A 2UUAF 5E3PA 2K06A 4KY3A 3J7Z5 4HTJA 1N5TA 2MXYA 3WBZA 3C66A 3UI3A 3UFCX 3MM8A 1IR2A 4RX6A 4GC7A 4EYHB 3V6DA 1CJTB 8ATCB 1YJTA 5SUHA 2LU1A 1HHQA 2E5JA 4R5PB 2ZNZA 2R8KA 4LSLB 2O67A 3CMAS 1K1SA 2V4JA 1S1XB 2V8VA 3HHKA 3UR3C 4Y28C 4ZPDA 2DHGA 5EX0A 2E5IA 2DGVA 1DARA 3Q8UA 1TVRB 4YOEA 3SQGB 5A8KB 3N28A 2EFVA 3BR9A 4DR3J 2VU5A 4NLOA 1RTZA 4BLGA 1PCAA 2QLXA 2ZNYA 1KHWA 1TZ0A 2IC3B 3T5LA 3IAM9 1VBZA 1H74A 1EETB 1H7WA 4PYAA 1TV6A 2MTLA 1Q95G 2YWGA 4I56A 1YVFA 1RHKB 2ILZA 1FJEB 3DLJA 4JI0F 4OX9F 2M8HA 2A3JA 3HXMA 3QO9A 3SCIE 1NJXA 1X5OA 3CD6S 1VMBA 2LCWA 3M2VA 2CQ0A 2E9ZA 2AGQA 4WTYA 5KFVA 3J7A1 1RT5A 5FIIA 2NR0A 1CULB 2G2YA 4TN2A 3NAHA 3VV2B 1M5KC 2RF2B 4C3MA 3TANA 1IN0A 4KHMA 4H54A 1Q81T 5B7WA 5JXSA 1U09A 1TKXA 3C6TB 3OTEA 2B51A 2K7KA 3K7RA 1TL7B 2L3MA 3FSXA 2B8PA 4UQTA 1RWMB 1Q1KA 5HO4A 1I94F 2OFGX 3KLIA 1SJ3P 1L3SA 2MHEA 2ROPA 3VAJA 3TA0A 4FF2A 4YDXA 5HSPA 5RUBA 5BJRA 2R7TA 4OFZA 4P72A 2XYPB 3ZZRA 2H5EA 4DPWA 4PWUA 2WVEA 2G13A 2GVDA 3I0RB 1QLNA 4PXCA 3DLGB 4DL3A 2XI2A 2EBEA 4YR3A 4NE9C 3FSIA 5IFMA 4J9QA 3W5XA 3DHXA 1SUQB 4OZ2A 5MLCV 5HQMA 5CCMA 3DOMB 2QT7A 1RHUB 1Y11A 2A6OA 2DCLA 4G1QA 1YRUA 1SQEA 1QAYA 5AJ3J 2OPPB 1FRKA 4L72B 4ZJLA 3LP0A 2QO3A 1URNA 2IM2A 1SKSA 1R0BG 1VQ6S 3G8TA 4FDFA 1A9NB 1WJ9A 2XY5A 1YI2S 1T03A 2OPRB 2B8QA 3SYZA 2DEIA 3C8YA 4YEAA 1SJ1A 5L8RC 3MAAB 4LFBJ 4F02A 4JI0J 2EI5A 2PA8D 4B3MJ 2UXDF 2LQ5A 1UVKA 1NPPA 1WF1A 2DKOB 3GV7B 2HQDA 3JQJA 3M2RA 2DR7A 4CO3A 2UVUA 4I69A 2AJ1A 4TKTA 4ID5A 2B7CB 2Z2YB 4C8NA 1VQ4S 4JUZA 1YBUA 1KOHA 3U1LA 4PUOB 2APOA 3DDIA 3PW5A 5IT9U 3GILA 1S72S 4A46A 3I4PA 2V94A 1LV5A 1ZYQA 4L3KA 1TL3A 3L09A 1S9GB 3AXKA 4WFXA 5ETQA 4E0DA 1NSKL 2DXFA 1OYEA 3KK2B 2GVZA 4J5OA 2IVYA 4ILLA 1YSJA 5T14A 1FD8A 2GQ2A 1TR0A 2ZUGA 2HMIA 4QIWD 3T1YF 3HT0A 1VRTB 2BUNA 4EZ6A 2D9OA 2XMAA 1GX6A 2W8LA 1T94A 2J7UA 5HMXA 2F3JA 3KFWX 3BQ0A 5EWGA 1HKAA 2XMMA 4R25A 1VRQC 4LFAF 4WE1B 1U02A 3PM9A 3HVTA 1FVSA 3HHDA 2VG7A 1VQLS 4EUVA 1UP1A 2MY8A 3NMRA 1VR6A 5GAEU 4YB7A 5E3CA 2LLZA 3UNYA 1YG0A 1RTDA 2HHHJ 3CJKA 2GHVC 2ZHAA 3KJQB 4ITSA 2HVZA 2ZH8A 4OYIA 4MAKA 5H9EJ 3V5RA 3GR1A 2AYMA 1QM9A 2OI2A 3UN3A 4YB5A 3HLUA 1W25A 3R5JB 1IBLJ 2IJRA 4ZPTR 5DO2A 1VCTA 4B9MA 4K4WA 1KVKA 2AZ3A 4RNNA 4N5SA 3R1LA 3PFOA 1SC1B 4IOBA 3V6KA 5FDLA 4MKAA 3EM1A 5HQLA 1RT4B 1F2GA 5B0BA 1KHVA 2CFXA 3FFIB 5L39A 4LBHA 3T41A 2DGSA 4LF6F 2NS1B 4ECRA 1R6YA 4NLGA 1SJQA 4DV7F 3H90A 2DGOA 1WTBA 4C8KA 1FWKA 3D1HA 4ZS6A 5M2UA 3PXGa 3KG0A 3C16A 3T1HF 1R8PA 2ZFHA 1QAIA 2HW3A 3KJVA 3FEYB 3L7OA 4CH1A 1LW2B 3KDNA 2B56A 4X4UA 4NMLA 4F7VA 1FRMA 3BQ2A 1N88A 1YTYA 1VRUA 2BXJA 3IA0A 2YNGA 5D3GB 1GNKA 2GJ2A 4ZJQA 3QZ7A 3F73A 1UWAA 2IVFB 2HBQB 1REVA 3C3LA 2MQNA 3FQKA 3G71S 2CQBA 5MAOA 1YLXA 1JLEB 3CD0A 2XYHB 4KGXB 4DSJA 2CQHA 4B17A 2JLEA 2HZCA 3M7VA 3MF5A 3L9ZA 1K9MT 1F9FA 4B3SJ 3RW7A 4UY85 5I3QA 1XNRF 1UFWA 3UO0A 3H25A 2NZ4A 1JLGB 4EU0A 1CSJA 2F9DA 1B0PA 4HHHA 1ZS6A 2XO6A 1HNVA 4HACB 3DLBA 2EFPA 4AL5A 1RWUA 2DEJA 2DO0A 2AGOA 2CPHA 2ABYA 4IG3B 2F8EX 2V8HA 3SSRA 4X84A 3MEKA 2QLWA 4DLGA 2Y1LB 4BHQA 1NK7A 1DFDA 4ZVEA 1H38A 1NDLA 3KLEB 3W2WA 5K5MA 4K5SA 1U1NA 2RT3A 4PRFA 3NGKA 4RNMA 4DG1B 4R5PA 4LSLA 3PACA 4V19X 1WOPA 3UDCA 4C0HA 1UVIA 1N0UA 3GIMA 1N0VC 1NJIT 1HWUA 2B3TB 1WSVA 3GIKA 4DSKA 3SQGA 1WC6A 1VQNS 5A8KA 4RKUC 3W9JA 3O5TB 3GIRA 2Y9HA 5KFEA 1JXEA 2IC3A 3SSQA 1S12A 4LT6A 2YQ0A 4OV1A 1EETA 3OPKA 1RB0A 1QAJA 4N8OA 3MECB 2O1PA 2YKMB 1U45A 1NH8A 3TOQA 2DH9A 4NI2B 5KFWA 3ENWA 1JJCB 3CCQS 1ICEB 1HBMB 2GIFA 4FXDA 4DR4J 1Q8KA 3PYEA 3MHYA 3G96A 4A8MP 4P75A 3MR2A 2HIYA 3LGHA 2GGPB 2KRBA 1CULA 2RF2A 2JX2A 4UF4A 1J2VA 2XYGB 1FD2A 3KNGA 4UUWA 2WW4A 4ZCIA 4CH7A 1BC6A 3C6TA 2N3OA 1TL7A 1LKZA 1FE0A 1MN9A 3RAXA 1ZPWX 1Q53A 2RQMA 1KFSA 1UZDA 4KPCA 4DV6J 5L1IA 1CJKB 5J2NB 4U6PA 1P9QC 2QJ3A 4USMA 3DRPB 2E29A 2G0JA 2KHDA 1HWLA 2HVDA 2VICA 1TELA 3NNAA 2W2NP 2IPOB 3EGWB 1K73T 3CD7A 1OS5A 5KFYA 1U4BA 1LFWA 6FD1A 1VJQA 3NGRA 5LMNJ 3FCHA 1IJEB 2XMWA 2V2QA 2UVWA 5J1EB 1Y0HA 4CP5A 3DXBA 2J8SA 3QQCD 1U1RA 1ZZNA 2KVQE 2IRUA 1V3SA 4UOHA 3I0RA 3KJNB 2AU0A 4DQIA 3DLGA 3TQ1A 2Y8WA 4U8VA 3AA8A 1SUQA 1P27B 3UN5A 2A0FB 3VAKA 3DOMA 3M9NB 5HP1B 4BC9A 1RTIA 3A12A 2OPPA 1TKZA 4X66F 4MYUA 4OI2A 4M5JA 2BOPA 4URSA 5CAAA 1S6UA 3NWRA 2XMTA 1Q16B 4YUDA 2Q3PA 3MAAA 4NXNF 2HHTA 4ECXA 4NLPA 2PFDA 1YJ7A 5F9NA 4O3SA 1X8DA 3RU0A 4KRWA 3ZTOA 4Q2MA 4LRFA 3KOAA 5HVHA 3Q89A 5E33A 3GG1A 4TQRA 2NYIA 1LQ9A 3SFGA 4IH7A 2UUCJ 2FVQA 1PC4A 7FD1A 4PUOA 4ZP7A 4OI1A 1EZZB 3DKDA 2J7KA 3AAWB 2W9CB 3OTCA 3TNVA 1WG4A 3IRWP 3ILLA 4DX7A 1LXJA 3WHIA 1MNEA 1NRKA 3TEGA 1XJWB 2XS5A 2FZGB 1ZTTA 2V5HG 4DV0F 5L9XA 2I0XA 4N7TA 2ACYA 5HANA 2YWFA 3FBCA 1JWWA 1S9GA 3HFVA 1HNZJ 3KK2A 1KVIA 2MKKA 1SI9A 1J27A 4M5NA 4EBEA 3CNQP 4E2FB 3DGVA 5KG6A 3K5MA 4UT4A 1F3FA 1SH3A 1VRTA 5IC6B 2F4FA 3OLBA 1DY3A 5ETPA 3KHRA 2DIVA 4LQ3A 1X9MA 1R0CB 1YJWS 2BX6A 4CT9A 4I7FB 4USKA 3TAMB 2IDEA 3S6EA 3AJDA 4XDDA 3KK3B 5IOLA 5DRKA 4DJBA 2CPDA 4WE1A 2MHNA 4XTTA 3I9ZA 4PXDA 4ECWA 1PYTA 3QJLA 1C0UB 1YK9A 1H3DA 1DHMA 2P5VA 3QT5A 4DU7A 3D67A 3CCSS 4DUYF 2WBMA 2X3DA 4DOZA 4KO0B 4FPRA 2F9JA 2V50A 3RGIA 5DLFA 2XCAA 1HA1A 5GVQA 1PAEX 4EMDA 5B08A 5GMKa 3IBFB 5F0WA 4JYAF 4B3RF 4PABA 3R9LA 1S1TB 3TVYA 1MWYA 4NXNJ 4DN9A 4M5LA 4P52A 4C7QA 4MTPA 3QFHA 2NUUG 2Y0BB 2WTFA 3CTRA 1QTMA 4FYDA 1N32F 2MYFA 1L3TA 1Y3KA 2EBGA 3QAUA 1RWXB 3MMJA 1RT4A 2W4PA 2MSTA 1VOMA 2IDLA 2KDOA 3P96A 3FFIA 2OUGA 4RBVA 4MYTA 1NU4A 1RKJA 3HSGA 1RGVA 1U1KA 1SPBP 1UW9A 3DGPB 1MMNA 2ZC3A 2IJFA 3AJ2A 2XS7A 2BM1A 4I67A 1JX4A 2KT3A 4DV0J 3M32A 2DHAA 1EQ0A 2VOPA 4N56A 4QW9A 1LW2A 3D68A 1X4EA 3BB5A 2QA2A 3LANA 1XR7A 1FKPB 5D3GA 2VOOA 1CS4B 1HW8A 3A3NB 4KGMA 1U6BA 1IBCB 4DR6J 4LR7A 1DZ5A 5B0CA 2ADBA 1HHSA 3U7JA 4HT7A 3JB9k 3OSNA 3JAMY 1NZAA 1JLEA 1JLBB 2GO8A 1VQOS 5LJ3Y 1TK8A 2MQLA 1C0TB 3IR5B 4B3OB 3CC7S 3CDEA 2G2ZA 2HEKA 2MZTA 1AW0A 1JLGA 2X1GA 3BGUA 3HDSA 3W5YA 1IQZA 2DO4A 2FC9A 1O5JA 3CCLS 2V9KA 4HACA 1X4AA 4FNHA 3TYTA 3VAIA 1U6ZA 4JI5F 1WI8A 1RLCL 2E1CA 2MZ1A 4FKYA 5CYJA 4LRDA 5GMDA 2D3OR 3H4BA 4ANCA 1T95A 4YFUA 1B0TA 3JQKA 2XZWA 3KLEA 1S10A 3W9IA 4R8UB 3OTBA 2I2YA 4B3RJ 2CQ2A 2YPZA 4OYAA 2G0IA 4U96A 4DG1A 4RUCA 1FVQA 4DCJB 4ECTA 2IA0A 2R7RA 1WELA 5HBMB 3ENQA 1T05B 4LRBA 3THVA 1NPRA 1S48A 2EVZA 5DZ6A 2I6WA 3JTNA 3RAQA 4AUKA 1WSRA 5J2PB 3FBEA 1Q8LA 1F1BB 3IP0A 2YH0A 1NK4A 2BW7A 2VBZA 3RTVA 2R2SA 3MECA 4KYZA 2XLKA 3SCKE 3HP6A 2DGUA 1NCLA 3PYGA 1GEHA 2WSCC 2WHOA 4NI2A 1WHYA 1KC8T 2PN6A 4LF8J 3QRRA 1ZA1B 2W2QP 4OHVA 1HBMA 3RR8A 3J81U 5H9FJ 2D41A 1RHRB 1N33F 2LQBA 1T9YA 4I6YA 4DSLA 1S79A 2GW8A 2DNLA 1YZ6A 4DV4F 5IV3A 4ZLLA 1JLCB 4J91A 5EUHA 2GGPA 3HHNB 2PE8A 1RP5A 4F2SA 2DCUB 4WIIA 3NNHA 1IUJA 2KJWA 4MIAA 2BRLA 5CQGA 2NPIA 4O3RA 1HHTP 3HSDA 4B9LA 4PR6A 1S6QB 4C48A 4CM0A 1JMTA 3VAFA 1CJKA 5J2NA 3DRPA 4QW8A 3EGVA 3NGUA 1QTNB 1O51A 3R97A 3D6MB 3WIUA 4Z37A 2JVOA 2D3UA 1S1VB 3PV8A 5DM6Q 2KZMA 2CDQA 5ETTA 2VA2A 1ZM2A 5C25B 3BREA 4FF1A 3VZIA 1X5TA 2B5JB 5J1EA 2Z56B 2K8GA 3LPYA 5I4MA 5LSLA 5LL6d 3PRBA 1RYSA 3ETMA 3D6HB 2I5JB 4GC6A 4DCOB 3KWMA 2GZOA 2M8DB 2G2OA 3EGZA 3R2DJ 1HNWF 3R5DA 6AT1B 3Q86A 4DPYA 2BQUA 3MD3A 3PTWA 5KFZA 3CCRS 1M5PC 2PGCA 2GIQA 5HP1A 2OTLS 3LH2S 2KO1A 4IQXA 2CZ9A 1VI7A 4CZCA 1CPZA 3UCUP 1YWXA 3BSAA 4C8MA 1GMWD 2FLPA 3DLHA 1YBAA 2ZZTA 3H98A 2XLIA 2XQCA 2XGQA 1TUVA 3HJFA 4BCAA 3CCJS 4O4GB 1FWPA 4B9TA 2E1MC 4H4KA 2OSRA 2XG8A 3RG6A 2KT2A 4MKVA 3MCSA 2IBOA 3GP9A 3R1HA 2XO7A 2CKWA 4N77A 5FD1A 2NSBA 2W9CA 3IM8A 1UEVA 3EVMA 5DG8A 5IXUA 3VVUA 2D7SA 2E7WA 2ZH6A 5ETVA 3FEZA 2YX7A 4Q8EA 2XWXA 2H1YA 3HM9A 3W66A 1P8GA 2RAQA 5KT7A 5E3AA 2V8DA 2MKYA 4DUZF 1H72C 3BDEA 1DQ8A 3PFEA 3OFFA 3NKYA 2OTJS 2E7VA 3ICLA 4OZNA 3O2IA 2QFIA 3AD7C 2MEWA 1DBDA 4HT5A 4I7FA 3TAMA 3VF0B 1RWPB 1AZSB 2VC0A 2CNKB 3CJ5A 3IRXB 3MFIA 4R0EA 4C2MA 4C6AA 2DH7A 2DNQA 2W9AA 3CJSA 4GKJF 1F0XA 1C0UA 4OHWA 4WZMA 2AW0A 2HFSA 2ZBRA 1I3OB 3SQOP 4NYOA 3P6YC 1N56A 4KO0A 5KFUA 2NREA 2YWKA 3UR0A 4DV3J 2DNKA 2XHCA 4X4QA 2C3PA 4X2BA 2QIFA 3TZWA 1S1TA 3F56A 1SKUB 4YR0A 3OD2A 1EQMA 5GAGI 3GJSB 4WP9A 3BKFA 4PCQA 3PW2A 4JOUA 2LMIA 5KT3A 4X4OA 2W4CA 3X1LB 3MM7B 3ELHA 4DHVA 4C4WA 3M8WA 4AQYF 2RMLA 4F3QA 1S59A 3MUTP 2GAHC 3QRPA 1H0HB 5BYRA 3L4BC 3EZUA 2DH8A 4CTAB 1NM2A 3D1OA 2E5LJ 4ZPCA 5HK4A 3DGPA 3G4SS 1WC4A 1T7PA 2UU9J 1KKHA 1WC0A 3JSYA 1DLOB 4P74A 2KN4A 4KH0B 3CCES 2V8PA 1XR5A 2HGMA 5AXLA 3DMJB 2BM0A 4JV2A 1VQ7S 2HZAA 2AMCB 2KXHA 1FO1A 2MLZA 4WYLA 1CS4A 2HAIA 3I5CA 1H98A 1SQGA 2XHWA 2JNJA 1FXRA 2QE5A 3FK4A 4ZIVA 1IM4A 2XM3A 2CQ3A 4ES2A 5LSRA 1DRZA 2C2KB 4OZ3A 2UUBF 1EHWA 2HVHA 1JLBA 4QJVA 3QJPA 2DVIA 4EBDA 4QIVA 2LA4A 4TXSA 4U95A 4YHHF 1C0TA 2VBXA 4B3OA 3UCGA 2BEFA 1BWVA 4DFKA 1KQGB 3VAMA 3H2UB 3D9BA 3R5BA 4W92B 5KG5A 1FDNA 2FHJD 3Q8VA 4USVA 2GMHA 4E98A 4GKJJ 4USIA 3FKBA 1JLAB 3RZAA 4JI6F 1U6FA 4FBUA 2EC0A 4L75A 4CO0A 1CJUB 1KQSR 2FY1A 3FJ2A 3N01A 3TARA 3NNCA 3NWGA 4M5DB 2W1BA 4JI1J 2HK3A 2CA9A 4UUXA 5AXNA 3SMZA 2VUGA 3R8YA 5KFXA 5FJ4A 5HBMA 3NS5A 1T05A 4GKKF 2MKJA 4NYPA 2N4CA 3BGOP 1N8RT 4IFYB 4P73A 5F9LA 1PJ7A 3A8KA 4KGZB 2Y1JA 4DSFA 2UZAA 4AT1B 1WD6A 5J2PA 1HI1A 2QGFB 2IHR1 2HQFA 3QRQA 4NLXA 3MUMP 2GV1A 1WKLA 1H2UX 2YWWA 2EFQA 1D1UA 3SIPB 5M2RA 2NXJA 1UW4A 3JTOA 2C42A 4EGLA 3RB4A 1FWLA 1AB8A 5DG7A 1PKUA 4IH6A 5KT5A 4IG0B 3A8EA 1H73A 3M2UB 2VG6B 2VQFF 1WKJA 3T3FA 4F4WA 4RU2A 1JLCA 3V81B 3D7SB 2H48B 1RTHB 3M6WA 4D3GA 2ZWPA 3CPWR 2VBYA 1XMOF 4FXWA 4PXEA 4GVLA 1VK8A 2LQ8A 2YPYA 3CC4S 1S6QA 3TZZA 2LEPA 5FLXY 3KNAA 1Y5IB 1N5QA 2M52A 3B54A 4M5MA 2RHQB 3PJWA 1NDCA 2W01A 4ZVTB 3FUYA 4K4UA 1UPMB 4M5HA 3N4WA 2C3YA 2UUWA 5J2MB 4NA2A 5DDPC 1S1VA 3W7BA 1PO6A 4JI6J 3M8ZA 1TUWA 1NHVA 2LU2A 5C25A 3GCXP 1IBMJ 3QSYB 2B5JA 4I6AA 1V6HA 3DLEB 4ZHRB 4ILMA 3NS7B 3PKYA 2V8GA 4C8LA 3EE3A 3M8PB 2M3DA 2DR8A 2ZBCA 3F41A 5B0AA 2I5JA 1M5HA 1OIAA 1NHKL 2ZJPQ 2J0WA 2OPQB 2PC6A 5KFMA 2WCXA 1G2EA 5HLFB 1UZHA 2C3OA 1TUGB 1OY6A 4IKAA 2MY7A 3GONA 3LPEA 3ADAC 4JI4J 2JRSA 4ZLNA 2KFYA 3GYXB 1Y9OA 1HBNB 4V1Ak 3PJXA 3GJQB 3Q22A 1WACA 1U0HB 2ROGA 5D0GA 3IAS9 4ZLPA 5BR8J 3O3LA 1YIJS 5HQ8A 2XZTB 2YX1A 5KFBA 1TFYA 3WX4A 2KB2A 3QIDA 4CLUA 4M63A 4DPXA 3GIJA 2CQIA 2IM1A 3EX7B 3LF0A 1C2PA 1R0AB 4UOFA 4O4GA 1ZBTA 3PHTA 2MGZB 3PRDA 3CF5Q 3N6MA 5JVHQ 2V4QA 3BH7B 4JI2F 4KHPJ 2AGPA 2VFRA 4MK9A 1MWQA 5CD4H 1N52B 3PIOQ 1BE4A 2CPFA 3E51A 1OJ4A 1NAQA 1FRJA 2EEYA 2CAJA 1BUXA 2R7OA 1FE4A 2K2PA 4RW6B 1ZTWA 4PG4A 2HWIA 3TO8A 2FJEB 4AE5A 3LGMA 4WXWA 2OD6A 4DV2F 1YJ9S 1T11A 4RL1A 3QIPB 2A18A 3PHEA 2HLTA 4X4TA 4DXLA 1TL4A 4TLQA 4I64A 1UWBB 3BH6B 5E3RA 1RBLA 1JLFB 1XMBA 1JNZB 2UUTA 4ES1A 4JV5J 2Z57B 1CEZA 3Q0AA 4ZK7M 3H5YA 1UEUA 1X4GA 4C3LA 3M6XA 3BF4A 3W8PA 1N4LA 2JEIA 1AZSA 3VTIA 3IRXA 1AFJA 4DR1J 4USJC 1DURA 4GO7X 4DQPA 3H0PA 1RAJA 3V2UC 3D5MA 3ZTQA 3A4TA 4ECYA 5KFRA 2KG1A 2BANB 3CSKA 5L46A 5H1SV 3AFGA 3ITHB 2EC2A 4LF9J 4DZDA 1SKRA 1JLQB 2R7VA 1PC5A 2XMKA 2JOQA 2HRYA 1M90T 2BJ1A 4B3TF 2C2EA 1AUDA 3AB2B 3NBPB 3QNWB 3RB6A 4W90B 4QR2A 2VD3A 1HPZB 1YITS 3TZXA 1GMWA 1X0PA 5KG1A 4PWDB 5B09A 2IYGA 2QC3A 2JC1A 4PWWA 4AD6A 4NEYA 3MM7A 3I31A 1HR0J 3OJSA 3K0JA 1BQMB 1IBKF 4PKDB 2XULA 3OQ2A 4LVNP 4YB1P 3O44A 2RS8A 1B99A 2KYXA 2MLXA 4QPTA 2QRRA 2XEXA 2R7XA 1A7GE 2BW2A 3BN4A 3DYAB 4CTAA 1VQPS 5C7PA 2DNHA 4LIRA 3DLKB 4IUFA 2YKNB 1H7XA 1NUEA 1DLOA 2RB7A 1GK8A 3DOKB 3TAPA 4LUBA 3FMWA 4Y2MA 3DMJA 1TKTB 3PX4A 4DV2J 3PVXA 5DGAA 3V6HA 2RNEA 2FGOA 1DQ9A 4X4NA 1YJVA 2PFFB 3MMAB 2OH2A 2RJZA 3N5FA 2WOMB 2ALZA 4IDKA 3O6QA 3G6VA 3BSOA 3VVTA 1XQIA 5ADZA 1IM6A 3I5AA 1M1HA 3IBWA 5A6PA 2U1AA 4DF4A 2BA9A 3GSDA 1X4BA 1E6YB 1VQ9S 1GXUA 4C98A 3CULA 4N8NA 5F8GA 1ZETA 1YQHA 4YS2A 4WK3A 2RE1A 1X5PA 2BMBA 1FTCA 1ZM4A 1C1CB 3W61A 3T5HA 1HLWA 2ZKUA 3VZHA 2BABA 1YDLA 3D66A 2HLUA 1JLAA 2B0GA 2LXFA 4CNZA 2DYAA 1ZAXA 1NXIA 2QYCA 4AYBD 4G6VB 1CJUA 5CYQB 4M5DA 5F8MA 3DDNA 2YXLA 4WFYA 3HZEA 3BYRA 1H2VZ 2ZUAA 2VV5A 4B08A 4ED2A 3G6YA 2FZCB 2HQ3A 1YZ7A 3HT3A 3S1TA 3QT8A 3MMCB 3CWJA 1R8CA 3VQTA 7FDRA 1D9DA 2CQPA 5L1LA 1R8HA 1KNZA 3W9HA 2C3UA 3JSBA 1NKEA 3HPOA 3CJTA 2E7XA 4X4SA 5F8HA 1WHWA 3RW6A 2KVIA 3SV3A 2YVSA 3K5PA 4DV5J 1ZA2B 3RAMA 3M1VB 4ZVGA 2KZZA 3PO5A 2XZDB 3CGIA 3BGLA 1Z4UA 2C2NA 2CQCA 1C1BB 3D0HE 2B9YA 5GMEA 1N5YB 3R5AA 2LVWA 2BE7D 2DGQA 2DNNA 4IG0A 2E66A 1UVMA 2KI2A 3M2UA 2VG6A 2EWHA 3T9NA 2HGNA 2FLOA 3V81A 2KG0A 4DPTA 2HWTA 1RTHA 3G2XA 4MK7A 2NQPA 3RRKA 3M05A 5SZTA 1WUUA 1VHIA 3DI6B 3PYDA 1QAXA 4Q7AA 4ZP9A 1G1XA 2BOAA 1U8SA 3QAEA 3MEEB 4P7TA 3UCZP 2MPUA 2GA7A 3BS9A 3PW7A 3EVWA 5ETNA 1K0TA 1IKXB 4F3MA 4DR7J 4ZPVR 3NGDA 1FK9B 4EK2A 4XK8C 2FJWA 2Y1IA 3QGIA 4NRTA 4RW7B 2O3DA 3OVSA 2FPHX 3AHPA 4DR3F 1AT1B 2OGUA 2R7SA 1WOSA 3OLAA 5J2MA 2V6AA 1HQEB 3HKZD 1MSWD 2P8IA 4ZN3A 2FHJA 4Q0BB 4NLRA 4Q45A 5THWA 1UA1A 1EKSA 4ZHRA 3CVKA 4OHXA 1OQ6A 4C8YA 3MCNA 5KFKA 1NK8A 2ZH1A 2DT9A 2ZEJA 2ZOGA 3M8PA 2ZBPA 1UAWA 5C5JA 4OV6A 3BJYA 4M5KA 2RUGA 3OXLA 2FY8A 3JTPA 5GAGU 2FHMA 1F9HA 2R9LA 2OPQA 5HLFA 2CPEA 2CZ4A 2EK6A 4TU9A 2ZOMA 1FNMA 1D8YA 3EDQB 4QU6A 6FDRA 4OJGA 3UDVA 3H4DA 2NCKL 1HBNA 2Z58B 4A8OA 3D0GE 1U0HA 2V68A 2QL9B 2CJBA 5KFFA 3DFEA 1RI7A 3F44A 3HKWA 1HIYA 2XY7A 1EIYB 2EKNA 1BHNA 3GFXA 3ZZ0A 3W2VB 3ENVA 4I1TA 4ZDNA 4KKOB 5CZVA 3M30B 5IT9Y 1O0PA 2HFZA 2VL1A 4A48A 3UWTA 1RXOB 2QZ8A 3EDRB 2MGZA 2GJFA 3OL9A 2CQGA 2UXBF 2LQJA 3QYYA 1YHQS 4FVMA 4CLFA 1GMVA 1D09B 3EVOA 1S6PB 2Z2LA 3MXHP 3MM5B 5L1KA 2OP5A 4G3IA 5LSOA 1J5EJ 4RW6A 3IN5A 3CIZA 2FB0A 4CM2A 4RO0A 4K50A 1FNXH 4ED5A 4WJBA 4PG8A 2FTRA 2XC9A 3RBXA 2QLJB 1FI4A 5AJ3F 4DDFA 7AT1B 3QIPA 3ZZUA 1CQMA 3H2VE 2DNRA 2FJAB 2LP4A 2HBZB 1XNQF 1D9AA 2R7WA 4DV1J 4WFBQ 1UWBA 2YX4A 5B0GA 3KJFB 1JLFA 4M1KA 1VQKS 2X1FA 1QY7A 4YQWA 5CZXA 2MQOA 3B4DA 4G1IA 4RWWA 5C42B 1R43A 4LFBF 5BXIA 3A13A 2ZM6J 4ED4A 2RUSA 4B3MF 4CT8A 1T9XA 2H54B 1VDHA 1WNEA 4HDHA 1MROB 2IMOA 5AE3A 1RT1B 1AUSL 1OPIA 1FRXA 2P6TA 3PIPQ 3HHLD 4KGVB 3NG8A 2DK2A 3CCZA 2E9TA 4HLBA 2BANA 3BPSP 1V5IB 2UVVA 1MU2A 1RABB 4DX5A 2IBKA 2FVCA 3H40A 2CJKA 4FYXB 3ITHA 3AD9C 1SXLA 1JLQA 3V6JA 3OTDA 2J9EA 4WP3A 2K1RB 5ETKA 4K2XA 3NBPA 3MZIA 5AXKA 1LEOA 1FESA 4KPYA 2HVEA 4KGKA 4TYBA 1HPZA 1VC6A 4CO2A 2J0SD 4PWDA 5I42A 2Z30B 1FEHA 1IQTA 4ZMMA 5CHCB 5K8MA 2V2ZA 3I9V9 2WB4A 1O8BA 3RB0A 3E01B 2UXBJ 2WSFC 1BQMA 1DTTB 1QDUB 5C24B 3R7BB 4IOCQ 3HMJG 4CDIA 2HGLA 3DU6A 3DYAA 4U9RA 4NOHA 2QLBB 2QFJA 4OYOA 3OJUA 1HI8A 3GJRB 3PDNA 1AROP 2MQQA 2W9BB 3I32A 1N34J 5IT0A 3DLKA 2YKNA 2BQ3A 3VR1A 3DOKA 3HVRA 4I4BA 4BWMA 1GAOA 4OJHA 3L3CA 3TVKA 1TKTA 1SL1A 3BBBA 3NCQA 1YJNS 3FZBA 2L48A 2RHSB 2MQMA 3MMAA 1JJHA 4ZKAA 2PEBA 2WOMA 1XNQJ 2HHHF 1CC8A 1DJ0A 3H8YA 2UXCJ 2R7QA 2AD9A 3RJMB 2V34A 3MR6A 3BPDA 1IBLF 1E6YA 5A8WB 2LEAA 1NEEA 2XY6A 4Z7CA 1TAQA 1PBUA 3VGVA 3P8BB 1C1CA 3MCOA 1EARA 4BC7A 3MPDA 1UCNA 4OLOA 2RIJA 1WWHA 3QZ8A 3HHLB 1S0OA 2XMJA 2AZ1A 4RBUA 5CYQA 5HATA 4DSEA 2P9EA 1SL0A 2BJ3A 3P3DA 4MMOA 2VDHA 3BGRB 3PX6A 2DXEA 2D74B 3NEKA 4DEZA 4PXBA 4OYBA 1WORA 3MMCA 1RT2B 4CLWA 3CJQA 3LALA 3BKTA 5IQ6A 1N54B 3Q8PB 4M95A 4L76A 3HZGA 4Y2AA 2OHDA 1LFPA 4OZ0A 3MPYA 4QYZJ 2C3MA 3ZZPA 1UL3A 3Q2TC 3JSRA 4JV1A 4DQSA 4A8QA 2BJEA 2RQKA 3GFZA 3FZ2A 3SEOA 4TYAA 1M0SA 2VASA 1D0EA 3M1VA 4Z7YA 1QE1B 4J9KA 2H4WB 4B3SF 2HWHA 2CPYA 4O3PA 2PD1A 4PPDA 3ILJA 1C1BA 3R2CJ 1N5YA 2CWKA 1PYSB 4Y34A 1PILA 4DFMA 2OMLA 3WC0A 2M4MA 4P71A 1FTRA 4O3NA 1ZAVA 3IR6B 4HH0A 4F04B 2E1PA 3DI6A 1SIZA 3AODA 1IJFB 1SH0A 3CO0P 3QBCA 5JVGQ 4FPIA 2V2VA 4RZRA 4JI8J 2PMHA 5LXRA 4F67A 3H5UA 1JJ2R 3NAIA 3OTOJ 2AIRB 5KG7A 3GCWP 1RHMB 4ED1A 5I3PA 4CLLA 4G65A 1U7LA 4ED0A 1IKWB 3OL7A 4RW7A 2E1RA 2ALYB 3THTA 5DETA 1F3VA 3BM7A 4WYWA 2ATLA 3GPAA 4F36A 1HQEA 4XPEA 2ZZNA 3P49B 5ETLA 4Q0BA 2JL9A 3BN7A 1ITPA 1I1GA 3GQCA 4EO8A 2V0NA 4IOAQ 2QTWA 2RRAA 2KM8B 1GFWB 1EP4B 3GG0A 4HVZA 4ZITA 3CJ3A 2DPIA 4DR4F 4QWDA 2QL5B 4MT1A 4DWIA 3LGNA 4FKXA 2DRBA 4RNFA 3MPUB 3AD8C 1YKWA 2HAFA 4DQQA 4QOTA 2NXEA 1M5VC 5KG2A 4J9PA 2CJYB 2VB6A 3VAHA 2ASDA 2ROEA 3GB0A 4OZ1A 1HI0P 2ZKTA 1L3VA 4USHA 4USWA 1JXLA 4NXMJ 2ZVIA 4NCAA 2XNQA 4ECSA 4DV6F 2JFDA 2KFNA 3RBDA 1WC1A 4JP8A 2DY9A 2PMWA 3MUVP 5DQGA 2AYGA 2KHCA 3W2VA 1RAGB 2W2OP 1Y00A 4DX8H 4KKOA 4V19J 3M30A 2EW9A 3L7PA 1CC7A 1U47A 1OQ3A 3BGFA 5LMNF 4ZCKA 2R3VA 3BSNA 1F5CA 3W3SA 2SXLA 2BJ7A 4MIWA 1K44A 3FMBA 1CJTA 1S6PA 4KJIA 2HK2A 3MM5A 1Y5LB 1RAOA 3D2WA 3A3OB 1R6VA 5A2QU 1HBUB 2GC8A 1Q82T 4K8RA 1S1XA 4DLEA 2HRUA 4CLTA 1BQXA 1NJZA 1RUSA 4WZQA 3K89A 4EFAC 5F3ZA 2YY3A 4DBQA 4ICLB 3I5BA 2HQGA 2GO9A 3TQEA 3M8YA 2X7IA 3I96A 1TVRA 2HS4A 2MZSA 1YBTA 1T3NA 2YKOA 1Q0NA 2W24A 3ZZZA 2IRXA 2NYHA 1APSA
chains in the Genus database with same CATH topology
4ER8A 2EC2A 2A6MA 2XO6A 2VHGA 2VIHA 2XMAA 2XM3A 2VJVA 2A6OA 2VICA 2FYXA 2VJUA 2XQCA 2F5GA 2F4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ER8 A;  2EC2 A;  2A6M A;  2XO6 A;  2VHG A;  2VIH A;  2XMA A;  2XM3 A;  2VJV A;  2A6O A;  2VIC A;  2FYX A;  2VJU A;  2XQC A;  2F5G A;  2F4F A; 
#chains in the Genus database with same CATH topology
 5E0O A;  3FCV A;  4DPO A;  1KOO A;  4F4Y A;  3GJT B;  3IXQ A;  5J1N A;  1U49 A;  5C42 A;  1SJF A;  4TU8 A;  3FBF A;  2MZJ A;  4DL2 A;  3T5K A;  2JC0 A;  3BO3 A;  2YBV A;  3TP2 A;  1T9T A;  1MRO A;  1RT1 A;  3EPI A;  4JI7 J;  3HX9 A;  4CRJ A;  2V67 A;  4F0M A;  2UUC F;  3CDU A;  1FKO B;  4RWX A;  3J7Z T;  4GMK A;  4EYI B;  3PRV A;  1HD0 A;  1WHV A;  4ECV A;  1YRT A;  2L9W A;  3OFH A;  3JSM B;  3H5X A;  4WU2 A;  2LXI A;  8AT1 B;  1PGZ A;  1KWM A;  4O44 B;  2GQQ A;  2G4B A;  1PAU B;  4P10 A;  1WG5 A;  3MR5 A;  4TVA B;  1YGY A;  2J9C A;  3TUP A;  3KMQ A;  2ZH9 A;  3CT9 A;  4PQA A;  2K1R A;  3QPI A;  3I82 A;  1OMS A;  4KT0 C;  3DU5 A;  1HNZ F;  4FXV A;  4DFP A;  1FNO A;  1TP7 A;  3AT1 B;  2DD8 S;  4K7Q A;  5HMZ A;  4RPF A;  3IGN A;  4TY8 B;  1N36 J;  1YRX A;  5D4N A;  4X4P A;  3E01 A;  1GMU A;  3SI8 A;  1DTT A;  2I8E A;  3KKF A;  3CW2 C;  1BWE A;  4I2P B;  5C24 A;  2QX0 A;  4FYW B;  2R7U A;  3LTO A;  1ROF A;  2O66 A;  4F4Z A;  2CDR B;  2QV6 A;  1U24 A;  2W9B A;  1FJC A;  2YKQ A;  3LOU A;  1R8B A;  2P9G A;  3Q83 A;  4WKR A;  4P2F A;  4D3H A;  4PYD A;  2EG2 A;  2FLN A;  2WVF A;  1KD1 T;  4RUB A;  4HH1 A;  4QCL A;  2CQD A;  5GAD I;  2BKO A;  4YR2 A;  3KMS A;  4X64 F;  3KLH B;  3KK1 B;  1HWI A;  1KR4 A;  5A0Y B;  1RZM A;  4QBU A;  2UP1 A;  4WWS A;  3ILO A;  4K0K J;  3G6E S;  2OPR A;  4FZV A;  2WSE C;  3D28 A;  2WW8 A;  4RW8 B;  4URQ U;  4M8L A;  4OJ1 A;  3V4M A;  2HSE B;  5DJB A;  3WC2 A;  2R8G A;  4CH0 S;  5A8W A;  3FRY A;  2RQC A;  3FDS A;  1QUV A;  3OVB A;  4ZPB A;  3MWB A;  2G0C A;  1FFS B;  1RAH B;  3DM2 B;  2CVI A;  4P7V A;  4NCG B;  2H51 B;  2ZH2 A;  3US5 A;  1Y7P A;  2EFO A;  3RR7 A;  2KKH A;  1F9E B;  2DBB A;  4CO1 A;  3BGR A;  4C97 A;  5DGB A;  1TL1 B;  2IM3 A;  1GTH A;  4TLR A;  3KHL A;  3W64 A;  1Z2L A;  4FF3 A;  3M6U A;  1RT2 A;  3T6J A;  1IKY B;  2E5G A;  3TVZ A;  2YKP A;  1XMQ J;  4KBI A;  2NXN A;  2HNZ B;  1VQ8 S;  2OPS B;  4WPA A;  3Q8R B;  1NK5 A;  1JIH A;  3UVJ B;  2W25 A;  4DR6 F;  3PX0 A;  3C16 B;  3EIC A;  2DNM A;  1KP6 A;  2DPJ A;  1XTZ A;  4RJV A;  4Y6I A;  3M9M B;  3CIM A;  1MLA A;  5F8N A;  3J81 Y;  1FER A;  4N47 A;  2DNY A;  1QE1 A;  3G9C A;  2ZOF A;  1TK0 A;  3BZQ A;  3OXF A;  1RBO B;  1FDB A;  3C14 B;  4RW4 B;  2AEF A;  2JEJ A;  2VPW B;  4KHR A;  2I9S A;  4ZOS A;  4OL8 A;  1FFW B;  4ZIW A;  4YY3 F;  2QMX A;  2DRA A;  5LOQ A;  3HD1 A;  3O8W A;  2NPF A;  4C8O A;  1DQA A;  1VBX A;  4X64 J;  3WQP A;  4XO0 A;  3H5S A;  3N79 A;  2DHX A;  2G1D A;  1U1L A;  4ZVP B;  3D3B J;  4QIE A;  1KLN A;  3C19 A;  5C2G A;  4DFJ A;  2JDJ A;  1VLO A;  3WIV A;  4LIW A;  2MKI A;  2QA4 S;  1NSP A;  2CJA A;  2ATC B;  4ZP6 A;  4CCH A;  3ZNJ 1;  5JJB A;  3K5N A;  2FHK A;  5T41 A;  2BKN A;  4IO9 Q;  3GYG A;  2KL8 A;  5GAH I;  1IKW A;  5F0U A;  3MOJ B;  4UOG A;  1S1U B;  1HFE L;  3AA9 A;  1FJG J;  2CUY A;  1TTH B;  1TFW A;  3W2W B;  5D0H A;  3NY0 A;  4LFC J;  5DLG A;  2BBE A;  3CED A;  1U25 A;  3THP A;  2F1F A;  1HL6 A;  2IIH A;  5K8N A;  1RWN B;  3MI7 X;  4LF8 F;  4X65 F;  3ETO A;  2LYV A;  4LRA A;  1BLU A;  4ILR A;  1EP4 A;  2FGC A;  5CAB A;  1GT8 A;  4CIO A;  5HMY A;  5H9F K;  3IM9 A;  3RB3 A;  3OR2 B;  4JI3 J;  2IFX A;  1GX5 A;  1RSC A;  2A2D A;  1KS2 A;  4A8W A;  3HUL A;  2O01 C;  4ZVF A;  2Y8Y A;  3ZNU A;  5AE1 A;  4OI4 A;  1XN9 A;  3OXG A;  4WP8 A;  2RVJ A;  3T5J A;  2VFT A;  3NGT A;  2VFV A;  3TI0 A;  3PZP A;  2EFN A;  1GXT A;  2DNP A;  3KHH A;  1S5Z A;  2C28 A;  2UVR A;  2AHO B;  3AOA A;  2HHS A;  1UVL A;  4OLP A;  1LWE B;  1LW0 B;  1SKW A;  5J2Q B;  4B9N A;  4AND A;  1KEK A;  5EHH A;  3W8G A;  5KFD A;  2DGX A;  5HAO A;  2HS0 A;  4A8X A;  3DRX A;  4JBC A;  3TX8 A;  2HHX A;  1IKV B;  4DL6 A;  1WTF A;  2Z2Z A;  2N82 B;  5F3T A;  1B3T A;  3M8R A;  4YY3 J;  2YNI B;  5LJ5 Y;  4RU9 A;  1URR A;  2RDJ A;  4IG3 A;  3OT9 A;  1UVN A;  4FVC A;  4DCP B;  3R7N B;  1SV5 B;  2C1E B;  3BEG B;  1Y5N B;  2ZVS A;  1HAR A;  3KLF B;  1D8Z A;  4PPZ A;  5JUM A;  1G7C B;  4J9M A;  2C2M B;  1S7H A;  1HBU A;  2DRD A;  5IS2 A;  4GVB B;  4PG7 A;  2PI4 A;  4YDD B;  2UUA J;  4E8U A;  4ZN1 A;  5KFL A;  3O1L A;  1F60 B;  5ETM A;  4ICL A;  2AJQ A;  1HBO B;  2J6S A;  2LA6 A;  5K14 B;  3PG9 A;  3POT B;  3QT6 A;  2OEM A;  2F7V A;  3FC9 A;  2F8H A;  1VGY A;  2NXU A;  4MIB A;  4F26 A;  3MEG B;  4KSE B;  4NLV A;  2XLJ A;  2YKM A;  1VQY A;  4UY8 T;  3NCR A;  2DXD A;  3TX0 A;  4X65 J;  1RTI B;  1SJR A;  1TKZ B;  2VHG A;  3DC2 A;  5D78 A;  1KON A;  1ACM B;  1S99 A;  3ZXW A;  2HPU A;  2PMZ D;  5KG3 A;  4DUT A;  1FKO A;  4PZV A;  1WEZ A;  1Q7Y T;  3NRB A;  1Q8B A;  3JSM A;  2YQ1 A;  2PII A;  1RWO B;  3E2E A;  4OX9 J;  4O44 A;  2IJN A;  5KFJ A;  1SC4 B;  3KUE A;  1MML A;  2KYZ A;  5J1P A;  3N6N A;  4LMZ A;  1YX2 A;  4PQU B;  3CJ2 A;  1AFI A;  4S0M A;  2J8A A;  1F5A A;  5L9N A;  3UD3 P;  3RUB L;  3PO4 A;  1UEK A;  2FYX A;  1B7F A;  4WCE Q;  4DR5 F;  3OUY B;  4HI2 A;  4FS2 A;  5M2P A;  3NMA A;  3GE9 A;  2EK1 A;  3TW0 A;  1UPP A;  5DG9 A;  3NLC A;  4TY8 A;  2CNO B;  3HCX A;  1G4C A;  4I6W A;  3QGP A;  4TU7 A;  2OEJ A;  2PEH A;  1NSA A;  4I2P A;  4YME A;  3T6B A;  1HMV B;  5G0R B;  2GHW A;  2JWN A;  4LVO P;  2AP6 A;  4FYY B;  4KE5 A;  1I94 J;  1U2R A;  2B6A B;  1T8E A;  3K17 A;  2HVI A;  4IR9 A;  1XBW A;  1NHU A;  5DS7 A;  2VPZ B;  4RW9 B;  1GH8 A;  3ILI A;  2YWH A;  4LJM A;  2R8I A;  2B9E A;  1R3N A;  2JHE A;  2H5I B;  1SC6 A;  3K58 A;  2VON A;  3KLH A;  1VJW A;  3KK1 A;  2E5H A;  5A0Y A;  3MM6 B;  4DV3 F;  3V4I B;  4OHY A;  4ZPA A;  3K59 A;  4HL9 A;  2AV5 A;  4RW8 A;  3HHL C;  1JJ4 A;  3TR5 A;  3ENA A;  2MKH A;  2D9P A;  3IMQ J;  2DB1 A;  2FD2 A;  1FRL A;  2R2U A;  2QYG A;  1QVF R;  1HWK A;  3I56 S;  3DXS X;  4L3N A;  5D77 A;  1F6T A;  1S7I A;  3X3U A;  2Q66 A;  2VKZ G;  3I87 A;  3B8H A;  3DM2 A;  3UQS A;  3W5Z A;  4NCG A;  2WON B;  4O3Q A;  2VPX B;  1VBK A;  2E5L F;  3ZFV A;  2UXD J;  3OHA A;  5K20 B;  4NAS A;  4Y65 A;  2UU9 F;  1P6T A;  3CJR A;  3LWL A;  1V3R A;  1TL1 A;  2CQ4 A;  3QMQ A;  2VKR A;  5D0R A;  4F0K A;  3N6L A;  1NZ8 A;  2Y0S D;  2U2F A;  3LAK A;  2Z2M A;  4HR2 A;  1IKY A;  2OO4 A;  2BYC A;  3OR1 B;  3H20 A;  1Q86 T;  4AFF A;  4DR5 J;  1FX2 A;  3S8S A;  3CC2 S;  5U47 A;  2HNZ A;  3LQV A;  2NXC A;  2OPS A;  1P9Y A;  2MSS A;  1RCO B;  3UVJ A;  3HVA A;  3ZO7 A;  5E5N A;  2XCP A;  2KTQ A;  2OEL A;  1RJJ A;  2MJU A;  3M32 B;  2M88 A;  4LBI A;  3PY8 A;  3JQM A;  1RT3 B;  4U7U K;  2BJ9 A;  3KUH A;  2FDN A;  2GAG C;  1NK0 A;  1NND A;  1XWL A;  1LK7 A;  4NPO A;  4Y0F A;  1FXD A;  3U27 A;  2YNF B;  1RAE B;  4QPX A;  1R7I A;  2ZDP A;  5HJX A;  3C14 A;  4NZ7 A;  3W1Y C;  1FKA F;  3KK3 A;  2OIH A;  4RW4 A;  2R2T A;  3DRY A;  1Q5Y A;  1SBR A;  3AQP A;  5JMN A;  3CE8 A;  1HYS B;  1KDN A;  1U2C A;  4J37 A;  3T1Y J;  5LM7 E;  1T9W A;  3FNN A;  1NB7 A;  1T0T V;  3FCW A;  1C4A A;  1RAC B;  3OSP A;  2BJ8 A;  3P5B P;  1IWG A;  4JI1 F;  1CBK A;  2PA3 A;  3BBF A;  1FCA A;  4LFA J;  1JK9 B;  3RYL A;  5ETR A;  1U0S A;  3C46 A;  2Q1L A;  3N0V A;  1SCJ B;  3AOB A;  2B7B B;  3CJ0 A;  3MM9 B;  2OEK A;  4QIF A;  4F8R A;  4KTQ A;  1Y3J A;  2AJ2 A;  4KH1 B;  2KM8 C;  3HHE A;  9RUB A;  5IV4 A;  1GXL A;  1S1U A;  1QD1 A;  1UET A;  1LK5 A;  2CZV C;  4J9N A;  2AYE A;  5HMW A;  3UW1 A;  4ED6 A;  3HFK A;  3AOC A;  4O23 A;  1X7V A;  4ID8 A;  4K4V A;  3E3X A;  1KQK A;  5A8R B;  4NMX A;  4AXI A;  2BR0 A;  4XAK A;  3KHG A;  3QFW A;  4OYZ A;  3L95 X;  5D4L A;  1T9V A;  1UTA A;  3TUZ C;  4ELU A;  1UJ4 A;  3OR2 A;  1X5S A;  2AQ4 A;  2J0X A;  1LNQ A;  2Q79 A;  1R8A A;  4DL0 C;  3WX8 A;  2HBY B;  4A47 A;  1FKP A;  5KT6 A;  3NCP A;  4LF6 J;  4DV7 J;  3GYN A;  4NWB A;  4X4R A;  2ZD1 B;  3ZTR A;  2MKC A;  3T1H J;  3M8S A;  4ZVO B;  2RS2 A;  3PR4 A;  3SFU A;  4ECU A;  4ZVR B;  5IM0 B;  4Z2X A;  1LWE A;  1LW0 A;  5J2Q A;  2BZ2 A;  3KLV A;  1X0F A;  4M5G A;  5I3U B;  4M94 A;  4EWT A;  2HNY B;  3PCO B;  1IKV A;  2GNK A;  1B4S A;  3SSS A;  4PG5 A;  2YNI A;  3OFE A;  5GAD U;  5ETO A;  1XR6 A;  2GML A;  3CJ8 A;  1IBM F;  2CIM A;  4ENO A;  1VQ5 S;  2X3G A;  2F4V F;  3FGV A;  2DHH A;  2RRN A;  1SV5 A;  2Q6B A;  4KR0 B;  1PIE A;  1XNR J;  1LXN A;  2QEX S;  1KFD A;  4R8U A;  2AF6 A;  4LSZ B;  2CRL A;  3KLF A;  2ZH4 A;  3DRS B;  4I0W A;  4GVB A;  1RAD B;  2F40 A;  4O3O A;  5ETS A;  1RWW B;  3R7S B;  5IZH A;  3PW0 A;  3EWG A;  1WKK A;  2BRK A;  4K4T A;  2F65 A;  1Q8I A;  3SCJ E;  3VAG A;  1HBO A;  3HVW A;  5D4P A;  3JXO A;  1SJ4 P;  5K14 A;  1U1M A;  4JI4 F;  5KFN A;  2LEB A;  3POT A;  4FBT A;  3QSI A;  1H6K X;  4F0H A;  2PI5 A;  3MEG A;  3QGG A;  1N6Q B;  1CLF A;  3K8V A;  5BR8 F;  3MPV A;  2GJI A;  3VGT A;  4KC5 A;  4QWA A;  4TY9 A;  3FVY A;  5B0E A;  2XMV A;  1NSQ A;  2RU3 A;  2W8K A;  5KOX A;  4JB8 B;  3I0S B;  4OI0 A;  2XS2 A;  3W65 A;  4CYU B;  3ISN C;  2EG1 A;  3B6B A;  4OYX A;  4KHP F;  3H2L A;  4KFB B;  3VAL A;  2AX1 A;  1VIX A;  2DJW A;  3SDE B;  3MTK A;  2P6S A;  5CA5 A;  3GR0 A;  2QA4 G;  1L5U A;  2K3K A;  1Q4R A;  3FSY A;  3U02 A;  1N5V A;  2FJV A;  4UZB A;  1X31 C;  1Y10 A;  4QWE A;  4PQU A;  4PEO A;  2ZHO A;  5CYM B;  1WC3 A;  3WZ0 A;  2BE9 B;  5KFC A;  2CPZ A;  3OUY A;  1L3K A;  1I5O B;  1OWX A;  3HF5 A;  5KFH A;  2WVC A;  2XNR A;  2CG4 A;  1J5O B;  3BKU A;  2WZ1 A;  3CD5 A;  2EPI A;  3LAM A;  1QSL A;  4JV5 F;  4MH8 A;  1XK8 A;  3DHW C;  4OYW A;  4ZVS B;  2F4V J;  2N7C A;  2Z4P A;  2MDA A;  2LFV A;  3D1Q A;  1HMV A;  3A1Y G;  5G0R A;  1KQF B;  2G1H A;  5BYQ A;  1MW7 A;  1RCX B;  2B6A A;  4QYR A;  1S0M A;  3KLG B;  3OL6 A;  4O0I A;  1K0V A;  2W7P A;  5KTQ A;  4B02 A;  5IT4 A;  2FJD B;  2HFN A;  4DR1 F;  1NME B;  4RW9 A;  5HN0 A;  2KH9 A;  5GAH U;  2KU7 A;  1NDP A;  4HHJ A;  2AEJ A;  3CCM S;  2BVZ A;  2CPI A;  1FA0 A;  5AE2 A;  3TEH B;  1CVJ A;  5BYS A;  4LF9 F;  2CXE A;  1TQL A;  3MM6 A;  2KFZ A;  3RBE A;  1HQ2 A;  3V4I A;  4CLZ A;  4CNY A;  1MMD A;  3CCW A;  2MQ8 A;  4J7C A;  2PDA A;  4OX6 A;  1B64 A;  4K4S A;  1VQS A;  1WDT A;  3T19 A;  3MAH A;  2P9C A;  4OZJ A;  4X66 J;  4CWB A;  4M5I A;  3G8Q A;  4H4M B;  4PAA A;  2GMJ A;  3UPF A;  2GX8 A;  4ELT A;  1K47 A;  1HR0 F;  2OSQ A;  2L41 A;  4EZ9 A;  3G6X A;  3PR5 B;  2H5J B;  4CQ1 A;  2ZE2 B;  2BDP A;  1S6O A;  3Q2S C;  2WON A;  1RKI A;  4K2J A;  2FUG 9;  4FN5 A;  2IYI A;  1OYD A;  4P2X A;  5KFT A;  3D3C J;  2H3E B;  2ZH7 A;  2DR9 A;  1NK9 A;  2OD4 A;  2HHV A;  2HBR B;  1RYR A;  1VHF A;  2M0G B;  3FEX B;  2L9N A;  1XER A;  2GHP A;  3OR1 A;  3QGH A;  4NRU A;  3U1N A;  5K8P A;  1PYO B;  3PNI A;  3OHB A;  2R2R A;  2D1C A;  3DNC A;  2FLL A;  2B4O A;  5KFQ A;  3PEH A;  2EXU A;  2CPJ A;  2V63 A;  1RHQ B;  1KLM B;  3HSZ A;  3TRG A;  2VF3 A;  4ALZ A;  2W2P P;  2IY5 B;  1OY8 A;  1VFJ A;  1RT3 A;  3J7Y I;  4AL7 A;  4OMF G;  3ET6 B;  1M5S A;  3G82 B;  3CDW A;  2F5G A;  2CYY A;  3ULH A;  2F8M A;  2YNF A;  4LF1 A;  4LSN B;  1BY9 A;  2XTJ P;  1RA7 A;  3ISZ A;  3KG4 A;  1NH7 A;  2GQC A;  4AL6 A;  1HYS A;  4J9V A;  2MQP A;  1U8W A;  4C11 B;  3TAQ A;  1JKH B;  1TU0 B;  1BQN B;  5KG0 A;  4WTO B;  5AT1 B;  2RH3 A;  5HL7 Q;  1S4E A;  1T02 A;  2C2D A;  5DQI A;  4HKQ A;  4NX9 A;  4A8F A;  5F41 A;  4OJ3 A;  2MZQ A;  2MMY A;  2WVB A;  1JB0 C;  4Q43 A;  1W26 A;  2I1R A;  3EXC X;  2RRB A;  3R6G B;  4DL7 A;  1SB6 A;  3VWS A;  2A2C A;  3MM9 A;  2WRM A;  4DUY J;  5F8L A;  5E41 A;  1S1W B;  2CJX B;  3BYP A;  4UQG A;  1JQG A;  3GFY A;  4J9O A;  4NL5 A;  2DHS A;  1KTQ A;  2EKY A;  3MDF A;  3KDO A;  2GCF A;  5F8I A;  5DQH A;  3ZTP A;  1VC5 A;  2DY1 A;  4DV5 F;  4EO6 A;  4JYA J;  3I6P A;  1IWA A;  2HQI A;  1OSC A;  4FYV B;  3P45 B;  2JVR A;  4ES3 A;  4C0O C;  1A0O B;  2E44 A;  5HJY A;  4ECZ A;  5A8R A;  2AX0 A;  2YKA A;  1RAA B;  4NEZ A;  1N32 J;  1H2T Z;  3MMB B;  4ANE A;  4LQ9 A;  2LEC A;  2HYI B;  1CQN A;  2OMO A;  3ZTS A;  1RK8 A;  4B9U A;  3HJV A;  1RQ0 A;  1C4C A;  4ETX A;  3DCA A;  1U1O A;  1DTQ B;  2YWE A;  3IBC B;  2YH1 A;  4KV8 B;  3BSC A;  3S01 A;  1ZH5 A;  4OZ5 A;  4Y3C A;  2HND B;  3LA0 A;  2NUH A;  1HQU B;  2ZD1 A;  4TQS A;  2Z8Q A;  1FXL A;  1R31 A;  1RAI B;  4RUH A;  3H7H B;  2POK A;  1HNI B;  2HHU A;  2WAQ D;  1X9W A;  3QT7 A;  4J9R A;  3TWZ A;  1UMJ A;  3LP2 B;  4NLY A;  1FRH A;  2CJQ A;  5IM0 A;  4DR7 F;  1QSY A;  2VBW A;  5I3U A;  5EX3 A;  2CNN B;  3IR7 B;  2HNY A;  3EUN A;  3ONQ A;  2OLW A;  1UJ6 A;  3RRH A;  2G9O A;  5DDR C;  1S57 A;  1I6J A;  4Y2K A;  3Q24 A;  4LF7 F;  4W4M A;  5E2Q A;  4CLS A;  3CMQ A;  4XDC A;  3J7A N;  4O4R A;  3DRS A;  3DOL B;  8RUC A;  4QU7 A;  4F50 A;  1IVZ A;  1JNR B;  2M70 A;  3T9Z A;  3FBB A;  1PG5 B;  4JI5 J;  1W7W A;  1Z2Z A;  1RWK B;  5KT2 A;  3C6U B;  3MUR P;  4IFY A;  4KQZ A;  3CCU S;  5IQQ A;  1VQM S;  2Q6C A;  2QN6 B;  3G8S A;  4HYK A;  1U26 A;  2IA6 A;  4K4X A;  4NLQ A;  3D6T B;  3CCV S;  1MN7 A;  3IS9 B;  4QZV B;  4B9V A;  1N6Q A;  3DLL Q;  2XBP A;  1FFG B;  4DI6 A;  4LR9 A;  2C2O B;  4L73 A;  2RDI A;  2ZDO A;  2J6T A;  2BE2 B;  3I0S A;  3SXL A;  4F4A A;  3TUJ C;  4CYU A;  2V69 A;  2Y3Y A;  3A3P B;  2UV8 G;  4KFB A;  4QWB A;  3SDE A;  2Z0G A;  3K57 A;  3CUN A;  2WK4 A;  1FT8 A;  2MZR A;  3JAM U;  4DPU A;  1N48 A;  2MB0 B;  3BV8 A;  1J5E F;  1XC9 A;  4NLW A;  4RR5 A;  1N33 J;  1QUP A;  3B78 A;  2AYB A;  1HD1 A;  2HS3 A;  4DV4 J;  5CYM A;  4H4O B;  2C2R A;  4IFV B;  1MWZ A;  3IG1 B;  2XI3 A;  4OX7 A;  4ED7 A;  2W2M P;  2NZC A;  1SH2 A;  1WG1 A;  3P5T L;  1W2B R;  4G1P A;  4IQM A;  1J5O A;  3EZ5 A;  3F0N A;  1Z1Z A;  4DV1 F;  5KOW A;  2HFO A;  3RBZ A;  1YJR A;  1F2H A;  4DS4 A;  4NCB A;  4OYP A;  3SZ2 A;  2CVE A;  4LF7 J;  1F5B A;  2R42 A;  3DLE A;  2L9D A;  3M8Q B;  4QQB A;  2AJF E;  5A6W A;  2ZM6 F;  4P9S A;  2XMU A;  3QJJ A;  4WF9 Q;  1G6B A;  4QR0 A;  4WFN Q;  3KLG A;  3M4X A;  4O0N A;  1Q78 A;  3NL0 A;  4U8Y A;  1WI6 A;  3MR7 A;  4ZVU B;  4A8K A;  2H4Y B;  2VC1 A;  1LWF B;  3CME S;  4ZPW R;  3WDO A;  1FF2 A;  4Y2I A;  4J9L A;  1RTJ B;  2JLF A;  2YQ3 A;  2NSC A;  2HHQ A;  4DL5 A;  1CJV B;  3W60 A;  2HZV A;  3RRG A;  4IO1 A;  3EGN A;  4DZ6 A;  1HNW J;  2KJV A;  4KIA A;  1RE1 B;  2CAD A;  5DDQ C;  3J81 j;  1HNX F;  3A8J A;  2A1B A;  3AH6 A;  4F2R A;  2RD5 C;  2OJ3 A;  4A8S A;  3R5C A;  1WDD A;  4A8Y A;  3GSI A;  2HIQ A;  4H4M A;  1PJ5 A;  1M1K T;  1R0A A;  1GQE A;  4C3K A;  2LDI A;  1RT6 B;  2D3Z A;  3MD1 A;  1V5V A;  5DZ7 A;  3CCT A;  1FJ7 A;  3CDA A;  4UTG A;  2JJ4 D;  3VGS A;  4BWJ A;  4OZL A;  5ITH A;  2VDI A;  2ZE2 A;  4GO5 X;  3LW5 C;  2LQ9 A;  2VPY B;  4Y00 A;  2W7O A;  3R3T A;  4QIG A;  3DRR B;  1N34 F;  1FDD A;  5DDO C;  2DIT A;  1S9E B;  2IAJ B;  3T1A A;  5IWA F;  2GS8 A;  3NS6 A;  2AT1 B;  4NA1 A;  2RQ4 A;  3ZC4 A;  3BO2 A;  2IMW P;  4DX6 A;  1IR0 A;  4Q44 A;  1BMQ B;  4WIQ A;  1R27 B;  5CXT A;  4FP9 A;  3CDB A;  2VH7 A;  3IC1 A;  2JLG A;  2COL A;  5C2C A;  4QWC A;  3IWX A;  1SVD A;  4RLE A;  1M1G A;  1KLM A;  2N7Y A;  4NLT A;  5HRO B;  1UFK A;  2UXC F;  1A6L A;  1VYA A;  2VA3 A;  2OAU A;  4HDG A;  3IFE A;  2IRY A;  3GV5 B;  3ET6 A;  3G82 A;  3I4H X;  4L74 A;  1LOU A;  4B9S A;  3TA1 A;  2A10 A;  4ELV A;  1NDK A;  1VS3 A;  4LSN A;  5F8J A;  1T9U A;  4DUZ J;  1RT7 B;  1EAY C;  4WKY A;  1UFL A;  2FJB B;  4IDK B;  3GFH A;  1KSP A;  2H9Z A;  2M9K A;  4ATN A;  4ER8 A;  2F63 A;  4DR2 F;  4LRC A;  4C11 A;  4CO4 A;  2KRR A;  3C15 B;  5EWE A;  1S77 D;  4MFB B;  4FNI A;  4WK1 A;  1V3Z A;  1JKH A;  4WBF A;  2XSJ B;  1BQN A;  3TJ9 A;  3LWM A;  2AKW B;  4NYZ A;  3IGV A;  1TMJ A;  3CB4 A;  3IWL A;  3QLH B;  4WFA Q;  4WFZ A;  1VLY A;  4YP3 A;  1QVG R;  1IR1 A;  1KTV A;  3MTJ A;  4EI2 A;  5L38 A;  1HNX J;  1EB0 A;  1MG7 A;  3MOZ A;  1SIW B;  3UD4 P;  5KFG A;  1S1W A;  3R6L B;  4QYZ K;  4F4X A;  3NOG A;  2FHO B;  3EJM A;  3UNG C;  3BBC A;  3IWN C;  2DR5 A;  3N5B A;  2X1A A;  2PO4 A;  3MGJ A;  5HI7 A;  2J0Q D;  2QMU B;  2R4F A;  2VG5 B;  2VJV A;  4OQJ A;  4K4Y A;  1L3U A;  4UST A;  2JEG A;  1YJU A;  3M6V A;  1W2I A;  2RKI B;  2PT0 A;  2FVP A;  2V4R A;  2HQC A;  4P6Q A;  4UZC A;  3MMB A;  1U1P A;  3TJ8 A;  1SL2 A;  4I2Q B;  2OFH X;  1FRI A;  2FJX A;  3EMT A;  5IWA J;  3MR3 A;  2ZC4 A;  3PEJ A;  4AQY J;  1EKR A;  2CQ1 A;  1HW9 A;  4DSI A;  1GTE A;  4DN0 A;  2QA1 A;  4OX8 A;  4OI3 A;  1QSS A;  1NLK L;  1RWV B;  3SCL E;  2J6U A;  2QLF B;  1DTQ A;  1FX4 A;  4KV8 A;  4F4K A;  1TKD A;  1S0V A;  4C8Z A;  2HND A;  3AXM A;  4U7C A;  1U48 A;  2RU9 A;  1HQU A;  1E6V B;  2B4U A;  2XB2 D;  4LF5 F;  1VIO A;  5H9E K;  4JI8 F;  1HNI A;  4ED8 A;  3LP1 B;  3OTO F;  2BJD A;  1RIS A;  2ASY A;  4YB6 A;  1WF2 A;  3QAT A;  3LP2 A;  2X51 A;  3TA2 A;  3EPG A;  5KFA A;  4OHZ A;  1NO8 A;  2BAC A;  2YNH B;  5T7L B;  1VBY A;  2HFU A;  1NJW A;  2W4D A;  2GIR A;  3UD5 A;  4DF8 A;  3UDL A;  3Q8S B;  2DIU A;  1O6X A;  4MKB A;  3PKM A;  3CO9 A;  4J90 A;  4DR2 J;  2R8J A;  2A6M A;  2QMW A;  5DM7 Q;  4P2M A;  3HO1 A;  4NLS A;  2UUB J;  4NA3 A;  5A2Q Y;  2ZWO A;  3KYL A;  4Q8F A;  4F25 A;  1FEE A;  4YHH J;  5K8O A;  1ZM3 A;  2VOD A;  4CLY A;  2HHW A;  1Y4Z B;  3KUG A;  2ASL A;  2HHP A;  3HI9 A;  2ZJQ Q;  2MJN A;  3DOL A;  1RDR A;  5CH7 B;  3FRZ A;  1RU2 A;  3TJA A;  4K4Z A;  4IRD A;  4TNO A;  2HFV A;  3JYT B;  4ZLJ A;  3L7U A;  3C6U A;  1BD6 A;  2IVM A;  4OYM A;  3Q8Y A;  1X4C A;  4HTI A;  1AYE A;  1TL5 A;  1UJ5 A;  2D69 A;  5EWF A;  2VQE F;  1AA1 B;  4ETZ A;  5D0E A;  4A4J A;  3IS9 A;  4NXM F;  4Q5V A;  2I38 A;  4N41 A;  1RBA A;  4GKK J;  4J9S A;  2DTJ A;  2ASJ A;  1ZOT A;  4DS5 A;  1X60 A;  2HUR A;  2JEF A;  2MLY A;  3I55 S;  5EDW A;  3LUY A;  2FVS A;  2FIU A;  2BE2 A;  3HD2 A;  2VJU A;  2ADC A;  3MED B;  5A76 A;  3VHQ A;  4H4K C;  1X9S A;  1EX8 A;  3NXZ A;  1WEY A;  3K2Y A;  3Q8Q B;  1RLD A;  4ZCM A;  4UOC A;  4RBT A;  1NKC A;  4LF5 J;  4DQR A;  1S0N A;  1LWC B;  3BDP A;  5EN1 A;  3AQO A;  3J7Y U;  3MEE A;  1M5O C;  2O5D A;  2J9D A;  3VQS A;  4FF4 A;  2VQF J;  3ZZT A;  2V2K A;  1IKX A;  3NOC A;  4H4O A;  4IFV A;  4RNO A;  3QWP A;  2J76 E;  1FK9 A;  9ATC B;  1X4F A;  3IG1 A;  3MM8 B;  3NP5 A;  3GLJ A;  1XMO J;  3MPW A;  2RDD A;  3V6D B;  4BS2 A;  2D3O 1;  4IRK A;  4EEY A;  4KB7 A;  4EBC A;  2K3I A;  5D4O A;  4U67 Q;  3H59 A;  1KBR A;  1NB2 A;  2M7S A;  1WOO A;  2Y1R I;  2V4J B;  1RHJ B;  3M9O B;  3M8Q A;  5HVF A;  4LBP A;  4WU3 A;  4MJK A;  5E7O B;  2DIS A;  3U1M A;  2ZZM A;  2VFS A;  3K5O A;  4MK8 A;  1JXV A;  2P2C B;  4GRS A;  5CCL A;  1Q7L B;  4JI7 F;  2BKP A;  5GAE I;  2QG9 B;  2X1B A;  1I51 B;  5LT5 A;  3HK2 A;  2VZ9 A;  3SBM A;  5G4D A;  1TV6 B;  3GTY X;  3CXC R;  2B4P A;  4YN3 B;  3W62 A;  3VGU A;  3UDE A;  3FQL A;  1BXN A;  1LWF A;  1UVJ A;  2HG4 A;  4USU A;  1RTJ A;  1ULR A;  2WBR A;  2XWY A;  5IC4 B;  2VQE J;  2OKQ A;  3QO9 B;  1UKU A;  3ISN D;  1S97 A;  3PW4 A;  3M2V B;  1CJV A;  3PYF A;  1RT5 B;  4Y2C A;  3GZ7 A;  2CG8 A;  1TK5 A;  2M5Y A;  1WEX A;  4JV0 A;  3D0I E;  3TZY A;  1P1L A;  1MU2 B;  5D6G A;  3HFZ B;  2B9X A;  3KG1 A;  3ZZO A;  1PBA A;  5L1J A;  3HSJ A;  1NPK A;  1OY9 A;  2BV3 A;  2L08 A;  3CJ4 A;  3OFG A;  3Q23 A;  1TKX B;  1N36 F;  1RT6 A;  3VCD A;  2M2B A;  2ZH3 A;  4C9D A;  1XIQ A;  2ZJR Q;  5KG4 A;  1OPZ A;  2IM0 A;  2VIH A;  1VIS A;  3OBI A;  2C22 A;  2FQQ B;  2RSQ A;  4L6V 3;  3TUI C;  3DRR A;  5I42 B;  1N5S A;  4UW2 A;  3G87 A;  3KLI B;  2QSW A;  5FLX U;  1T3O A;  4IRC A;  1S9E A;  2IAJ A;  1OSD A;  2EFG A;  4URG A;  3S7R A;  4OI6 A;  3NGS A;  4C0B A;  2XSF A;  4JI2 J;  2CJ9 A;  4U7U D;  5KFS A;  2DGW A;  3H42 A;  4ECQ A;  2C2Z B;  2WVD A;  1R89 A;  2J5A A;  4CI0 B;  4R0J A;  2XGP A;  3A8I A;  2GVD B;  1WC5 A;  4IH5 A;  2K7J A;  3P4U B;  2N4D A;  1WHX A;  2BQR A;  4K0K F;  1ZPV A;  2LXU A;  2KT5 A;  5HRO A;  2VFU A;  1VC0 A;  1K8A T;  2AEM A;  2FC8 A;  2LDY A;  2V9W A;  2RIL A;  2DGT A;  4G1Q B;  2UV8 A;  5B0F A;  3J80 Y;  3LP0 B;  4PG6 A;  4ZA1 A;  1ZM9 A;  4IYQ A;  1G3O A;  1RT7 A;  1QJH A;  5KFO A;  4X62 F;  2CWX A;  4XIU A;  5KAK A;  3BQ1 A;  5HVG A;  4ED3 A;  1T03 B;  4LF2 A;  3DN9 A;  2E9R X;  1Q5V A;  3GU0 A;  3C15 A;  5AXM A;  2WB1 D;  4NLD A;  1CG2 A;  4MFB A;  5KFI A;  4ZCL A;  2MKS A;  3ZZY A;  2E1A A;  2XSJ A;  4NZ0 A;  3KTQ A;  1S49 A;  4HI1 A;  4DMZ A;  4P2S A;  3AB4 B;  2NLW A;  2LKZ A;  4ZVH A;  1B0V A;  3QLH A;  3BO4 A;  3GV8 B;  1NK6 A;  3M2R B;  5CD4 A;  3MFH A;  1RU1 A;  1FHT A;  2ZIT A;  4ID5 B;  3SV4 A;  3GWC A;  1XMQ F;  1K1Q A;  2ZBQ A;  1SQF A;  3B82 A;  4J9U E;  4LRE A;  3D6F B;  3D4J A;  3G86 A;  1NBE B;  2B9W A;  2AJ4 A;  3JS9 A;  2W7A A;  1S9F A;  1B7Y B;  2AWZ A;  4K5R A;  4BBY A;  1Q79 A;  2VG5 A;  1TL3 B;  4AXJ A;  4B3T J;  1EJ7 L;  1KVJ A;  1U2F A;  1TMM A;  4K59 A;  5LMU F;  2JH3 A;  2AJ0 A;  2RKI A;  3MAQ A;  2GVZ B;  1NKB A;  2ILY A;  2ERR A;  4LF4 F;  2CNL B;  1NJY A;  4I2Q A;  5E3Q A;  1PJ6 A;  2HMI B;  1IBK J;  3K8W A;  1ZZF A;  2HKE A;  3R27 A;  1IXK A;  2YTC A;  1KN6 A;  1B70 B;  1D9F A;  4W98 A;  3R5G A;  4FS1 A;  1RA6 A;  5K9F A;  1BGX T;  1FDA A;  4RUA A;  3BR8 A;  4ZP8 A;  1VK3 A;  2FZK B;  1ELO A;  1E6V A;  2ZBI A;  4CLK A;  3KXD A;  1V9O A;  3B4M A;  3LP1 A;  3GMG A;  3HVT B;  2B4V A;  2VG7 B;  1RAF B;  5D15 A;  4HEA 9;  1WF0 A;  1SC3 B;  4NLU A;  2YNH A;  5T7L A;  4DU8 A;  4RNH A;  4X62 J;  1RTD B;  5EGY A;  3CJK B;  4ERD A;  1FJG F;  3D54 A;  3LO3 A;  2DNO A;  3OW2 R;  2J9D E;  2CPX A;  2HRT A;  4Q2L A;  1KRP A;  4LFC F;  3EYZ A;  3OVA A;  3HHL A;  4WXO A;  2DNG A;  3GII A;  4XPC A;  1XEZ A;  4F3O A;  2ZH5 A;  1DAX A;  4N76 A;  1U1Q A;  2QSF A;  2R8H A;  4KAI A;  4IR1 A;  2ACM A;  3K5L A;  2KXF A;  3C2P A;  2DNZ A;  4DL4 A;  2DR6 A;  2H65 B;  5FDL B;  1ZAW A;  4JI3 F;  1REG X;  4OIX A;  1LWX A;  3EXY A;  1PSD A;  3AJ1 A;  2ZHB A;  2Q43 A;  1D3W A;  2PSZ A;  4BDP A;  4NZ6 A;  3IO1 A;  1X4D A;  3JYT A;  4X4V A;  4HHU A;  1S76 D;  2JFK A;  2J7W A;  3E8O A;  2JSX A;  2N3L A;  4MKY A;  2QL7 B;  3KJV B;  3UE2 A;  3OV7 A;  5LXY A;  1HWJ A;  4CO5 A;  4I68 A;  3QWU A;  4CLP A;  2JZ5 A;  5LMU J;  1TAU A;  1VRU B;  2YNG B;  1P1T A;  5KFP A;  4LF4 J;  3N9U C;  1REV B;  1X4H A;  3J80 U;  3EZO A;  2KXN B;  4ZJO A;  1UA0 A;  2B43 A;  3MED A;  3UN2 A;  4LR8 A;  4QR1 A;  5B0D A;  1AXQ A;  3PJ9 A;  3DDK A;  2FVR A;  5KT4 A;  1S4F A;  1LWC A;  3W63 A;  5D8H B;  2GFF A;  1OO0 B;  3AY0 A;  3MCM A;  1HNV B;  4ZVQ B;  3OL8 A;  2UUA F;  5E3P A;  2K06 A;  4KY3 A;  3J7Z 5;  4HTJ A;  1N5T A;  2MXY A;  3WBZ A;  3C66 A;  3UI3 A;  3UFC X;  3MM8 A;  1IR2 A;  4RX6 A;  4GC7 A;  4EYH B;  3V6D A;  1CJT B;  8ATC B;  1YJT A;  5SUH A;  2LU1 A;  1HHQ A;  2E5J A;  4R5P B;  2ZNZ A;  2R8K A;  4LSL B;  2O67 A;  3CMA S;  1K1S A;  2V4J A;  1S1X B;  2V8V A;  3HHK A;  3UR3 C;  4Y28 C;  4ZPD A;  2DHG A;  5EX0 A;  2E5I A;  2DGV A;  1DAR A;  3Q8U A;  1TVR B;  4YOE A;  3SQG B;  5A8K B;  3N28 A;  2EFV A;  3BR9 A;  4DR3 J;  2VU5 A;  4NLO A;  1RTZ A;  4BLG A;  1PCA A;  2QLX A;  2ZNY A;  1KHW A;  1TZ0 A;  2IC3 B;  3T5L A;  3IAM 9;  1VBZ A;  1H74 A;  1EET B;  1H7W A;  4PYA A;  1TV6 A;  2MTL A;  1Q95 G;  2YWG A;  4I56 A;  1YVF A;  1RHK B;  2ILZ A;  1FJE B;  3DLJ A;  4JI0 F;  4OX9 F;  2M8H A;  2A3J A;  3HXM A;  3QO9 A;  3SCI E;  1NJX A;  1X5O A;  3CD6 S;  1VMB A;  2LCW A;  3M2V A;  2CQ0 A;  2E9Z A;  2AGQ A;  4WTY A;  5KFV A;  3J7A 1;  1RT5 A;  5FII A;  2NR0 A;  1CUL B;  2G2Y A;  4TN2 A;  3NAH A;  3VV2 B;  1M5K C;  2RF2 B;  4C3M A;  3TAN A;  1IN0 A;  4KHM A;  4H54 A;  1Q81 T;  5B7W A;  5JXS A;  1U09 A;  1TKX A;  3C6T B;  3OTE A;  2B51 A;  2K7K A;  3K7R A;  1TL7 B;  2L3M A;  3FSX A;  2B8P A;  4UQT A;  1RWM B;  1Q1K A;  5HO4 A;  1I94 F;  2OFG X;  3KLI A;  1SJ3 P;  1L3S A;  2MHE A;  2ROP A;  3VAJ A;  3TA0 A;  4FF2 A;  4YDX A;  5HSP A;  5RUB A;  5BJR A;  2R7T A;  4OFZ A;  4P72 A;  2XYP B;  3ZZR A;  2H5E A;  4DPW A;  4PWU A;  2WVE A;  2G13 A;  2GVD A;  3I0R B;  1QLN A;  4PXC A;  3DLG B;  4DL3 A;  2XI2 A;  2EBE A;  4YR3 A;  4NE9 C;  3FSI A;  5IFM A;  4J9Q A;  3W5X A;  3DHX A;  1SUQ B;  4OZ2 A;  5MLC V;  5HQM A;  5CCM A;  3DOM B;  2QT7 A;  1RHU B;  1Y11 A;  2A6O A;  2DCL A;  4G1Q A;  1YRU A;  1SQE A;  1QAY A;  5AJ3 J;  2OPP B;  1FRK A;  4L72 B;  4ZJL A;  3LP0 A;  2QO3 A;  1URN A;  2IM2 A;  1SKS A;  1R0B G;  1VQ6 S;  3G8T A;  4FDF A;  1A9N B;  1WJ9 A;  2XY5 A;  1YI2 S;  1T03 A;  2OPR B;  2B8Q A;  3SYZ A;  2DEI A;  3C8Y A;  4YEA A;  1SJ1 A;  5L8R C;  3MAA B;  4LFB J;  4F02 A;  4JI0 J;  2EI5 A;  2PA8 D;  4B3M J;  2UXD F;  2LQ5 A;  1UVK A;  1NPP A;  1WF1 A;  2DKO B;  3GV7 B;  2HQD A;  3JQJ A;  3M2R A;  2DR7 A;  4CO3 A;  2UVU A;  4I69 A;  2AJ1 A;  4TKT A;  4ID5 A;  2B7C B;  2Z2Y B;  4C8N A;  1VQ4 S;  4JUZ A;  1YBU A;  1KOH A;  3U1L A;  4PUO B;  2APO A;  3DDI A;  3PW5 A;  5IT9 U;  3GIL A;  1S72 S;  4A46 A;  3I4P A;  2V94 A;  1LV5 A;  1ZYQ A;  4L3K A;  1TL3 A;  3L09 A;  1S9G B;  3AXK A;  4WFX A;  5ETQ A;  4E0D A;  1NSK L;  2DXF A;  1OYE A;  3KK2 B;  2GVZ A;  4J5O A;  2IVY A;  4ILL A;  1YSJ A;  5T14 A;  1FD8 A;  2GQ2 A;  1TR0 A;  2ZUG A;  2HMI A;  4QIW D;  3T1Y F;  3HT0 A;  1VRT B;  2BUN A;  4EZ6 A;  2D9O A;  2XMA A;  1GX6 A;  2W8L A;  1T94 A;  2J7U A;  5HMX A;  2F3J A;  3KFW X;  3BQ0 A;  5EWG A;  1HKA A;  2XMM A;  4R25 A;  1VRQ C;  4LFA F;  4WE1 B;  1U02 A;  3PM9 A;  3HVT A;  1FVS A;  3HHD A;  2VG7 A;  1VQL S;  4EUV A;  1UP1 A;  2MY8 A;  3NMR A;  1VR6 A;  5GAE U;  4YB7 A;  5E3C A;  2LLZ A;  3UNY A;  1YG0 A;  1RTD A;  2HHH J;  3CJK A;  2GHV C;  2ZHA A;  3KJQ B;  4ITS A;  2HVZ A;  2ZH8 A;  4OYI A;  4MAK A;  5H9E J;  3V5R A;  3GR1 A;  2AYM A;  1QM9 A;  2OI2 A;  3UN3 A;  4YB5 A;  3HLU A;  1W25 A;  3R5J B;  1IBL J;  2IJR A;  4ZPT R;  5DO2 A;  1VCT A;  4B9M A;  4K4W A;  1KVK A;  2AZ3 A;  4RNN A;  4N5S A;  3R1L A;  3PFO A;  1SC1 B;  4IOB A;  3V6K A;  5FDL A;  4MKA A;  3EM1 A;  5HQL A;  1RT4 B;  1F2G A;  5B0B A;  1KHV A;  2CFX A;  3FFI B;  5L39 A;  4LBH A;  3T41 A;  2DGS A;  4LF6 F;  2NS1 B;  4ECR A;  1R6Y A;  4NLG A;  1SJQ A;  4DV7 F;  3H90 A;  2DGO A;  1WTB A;  4C8K A;  1FWK A;  3D1H A;  4ZS6 A;  5M2U A;  3PXG a;  3KG0 A;  3C16 A;  3T1H F;  1R8P A;  2ZFH A;  1QAI A;  2HW3 A;  3KJV A;  3FEY B;  3L7O A;  4CH1 A;  1LW2 B;  3KDN A;  2B56 A;  4X4U A;  4NML A;  4F7V A;  1FRM A;  3BQ2 A;  1N88 A;  1YTY A;  1VRU A;  2BXJ A;  3IA0 A;  2YNG A;  5D3G B;  1GNK A;  2GJ2 A;  4ZJQ A;  3QZ7 A;  3F73 A;  1UWA A;  2IVF B;  2HBQ B;  1REV A;  3C3L A;  2MQN A;  3FQK A;  3G71 S;  2CQB A;  5MAO A;  1YLX A;  1JLE B;  3CD0 A;  2XYH B;  4KGX B;  4DSJ A;  2CQH A;  4B17 A;  2JLE A;  2HZC A;  3M7V A;  3MF5 A;  3L9Z A;  1K9M T;  1F9F A;  4B3S J;  3RW7 A;  4UY8 5;  5I3Q A;  1XNR F;  1UFW A;  3UO0 A;  3H25 A;  2NZ4 A;  1JLG B;  4EU0 A;  1CSJ A;  2F9D A;  1B0P A;  4HHH A;  1ZS6 A;  2XO6 A;  1HNV A;  4HAC B;  3DLB A;  2EFP A;  4AL5 A;  1RWU A;  2DEJ A;  2DO0 A;  2AGO A;  2CPH A;  2ABY A;  4IG3 B;  2F8E X;  2V8H A;  3SSR A;  4X84 A;  3MEK A;  2QLW A;  4DLG A;  2Y1L B;  4BHQ A;  1NK7 A;  1DFD A;  4ZVE A;  1H38 A;  1NDL A;  3KLE B;  3W2W A;  5K5M A;  4K5S A;  1U1N A;  2RT3 A;  4PRF A;  3NGK A;  4RNM A;  4DG1 B;  4R5P A;  4LSL A;  3PAC A;  4V19 X;  1WOP A;  3UDC A;  4C0H A;  1UVI A;  1N0U A;  3GIM A;  1N0V C;  1NJI T;  1HWU A;  2B3T B;  1WSV A;  3GIK A;  4DSK A;  3SQG A;  1WC6 A;  1VQN S;  5A8K A;  4RKU C;  3W9J A;  3O5T B;  3GIR A;  2Y9H A;  5KFE A;  1JXE A;  2IC3 A;  3SSQ A;  1S12 A;  4LT6 A;  2YQ0 A;  4OV1 A;  1EET A;  3OPK A;  1RB0 A;  1QAJ A;  4N8O A;  3MEC B;  2O1P A;  2YKM B;  1U45 A;  1NH8 A;  3TOQ A;  2DH9 A;  4NI2 B;  5KFW A;  3ENW A;  1JJC B;  3CCQ S;  1ICE B;  1HBM B;  2GIF A;  4FXD A;  4DR4 J;  1Q8K A;  3PYE A;  3MHY A;  3G96 A;  4A8M P;  4P75 A;  3MR2 A;  2HIY A;  3LGH A;  2GGP B;  2KRB A;  1CUL A;  2RF2 A;  2JX2 A;  4UF4 A;  1J2V A;  2XYG B;  1FD2 A;  3KNG A;  4UUW A;  2WW4 A;  4ZCI A;  4CH7 A;  1BC6 A;  3C6T A;  2N3O A;  1TL7 A;  1LKZ A;  1FE0 A;  1MN9 A;  3RAX A;  1ZPW X;  1Q53 A;  2RQM A;  1KFS A;  1UZD A;  4KPC A;  4DV6 J;  5L1I A;  1CJK B;  5J2N B;  4U6P A;  1P9Q C;  2QJ3 A;  4USM A;  3DRP B;  2E29 A;  2G0J A;  2KHD A;  1HWL A;  2HVD A;  2VIC A;  1TEL A;  3NNA A;  2W2N P;  2IPO B;  3EGW B;  1K73 T;  3CD7 A;  1OS5 A;  5KFY A;  1U4B A;  1LFW A;  6FD1 A;  1VJQ A;  3NGR A;  5LMN J;  3FCH A;  1IJE B;  2XMW A;  2V2Q A;  2UVW A;  5J1E B;  1Y0H A;  4CP5 A;  3DXB A;  2J8S A;  3QQC D;  1U1R A;  1ZZN A;  2KVQ E;  2IRU A;  1V3S A;  4UOH A;  3I0R A;  3KJN B;  2AU0 A;  4DQI A;  3DLG A;  3TQ1 A;  2Y8W A;  4U8V A;  3AA8 A;  1SUQ A;  1P27 B;  3UN5 A;  2A0F B;  3VAK A;  3DOM A;  3M9N B;  5HP1 B;  4BC9 A;  1RTI A;  3A12 A;  2OPP A;  1TKZ A;  4X66 F;  4MYU A;  4OI2 A;  4M5J A;  2BOP A;  4URS A;  5CAA A;  1S6U A;  3NWR A;  2XMT A;  1Q16 B;  4YUD A;  2Q3P A;  3MAA A;  4NXN F;  2HHT A;  4ECX A;  4NLP A;  2PFD A;  1YJ7 A;  5F9N A;  4O3S A;  1X8D A;  3RU0 A;  4KRW A;  3ZTO A;  4Q2M A;  4LRF A;  3KOA A;  5HVH A;  3Q89 A;  5E33 A;  3GG1 A;  4TQR A;  2NYI A;  1LQ9 A;  3SFG A;  4IH7 A;  2UUC J;  2FVQ A;  1PC4 A;  7FD1 A;  4PUO A;  4ZP7 A;  4OI1 A;  1EZZ B;  3DKD A;  2J7K A;  3AAW B;  2W9C B;  3OTC A;  3TNV A;  1WG4 A;  3IRW P;  3ILL A;  4DX7 A;  1LXJ A;  3WHI A;  1MNE A;  1NRK A;  3TEG A;  1XJW B;  2XS5 A;  2FZG B;  1ZTT A;  2V5H G;  4DV0 F;  5L9X A;  2I0X A;  4N7T A;  2ACY A;  5HAN A;  2YWF A;  3FBC A;  1JWW A;  1S9G A;  3HFV A;  1HNZ J;  3KK2 A;  1KVI A;  2MKK A;  1SI9 A;  1J27 A;  4M5N A;  4EBE A;  3CNQ P;  4E2F B;  3DGV A;  5KG6 A;  3K5M A;  4UT4 A;  1F3F A;  1SH3 A;  1VRT A;  5IC6 B;  2F4F A;  3OLB A;  1DY3 A;  5ETP A;  3KHR A;  2DIV A;  4LQ3 A;  1X9M A;  1R0C B;  1YJW S;  2BX6 A;  4CT9 A;  4I7F B;  4USK A;  3TAM B;  2IDE A;  3S6E A;  3AJD A;  4XDD A;  3KK3 B;  5IOL A;  5DRK A;  4DJB A;  2CPD A;  4WE1 A;  2MHN A;  4XTT A;  3I9Z A;  4PXD A;  4ECW A;  1PYT A;  3QJL A;  1C0U B;  1YK9 A;  1H3D A;  1DHM A;  2P5V A;  3QT5 A;  4DU7 A;  3D67 A;  3CCS S;  4DUY F;  2WBM A;  2X3D A;  4DOZ A;  4KO0 B;  4FPR A;  2F9J A;  2V50 A;  3RGI A;  5DLF A;  2XCA A;  1HA1 A;  5GVQ A;  1PAE X;  4EMD A;  5B08 A;  5GMK a;  3IBF B;  5F0W A;  4JYA F;  4B3R F;  4PAB A;  3R9L A;  1S1T B;  3TVY A;  1MWY A;  4NXN J;  4DN9 A;  4M5L A;  4P52 A;  4C7Q A;  4MTP A;  3QFH A;  2NUU G;  2Y0B B;  2WTF A;  3CTR A;  1QTM A;  4FYD A;  1N32 F;  2MYF A;  1L3T A;  1Y3K A;  2EBG A;  3QAU A;  1RWX B;  3MMJ A;  1RT4 A;  2W4P A;  2MST A;  1VOM A;  2IDL A;  2KDO A;  3P96 A;  3FFI A;  2OUG A;  4RBV A;  4MYT A;  1NU4 A;  1RKJ A;  3HSG A;  1RGV A;  1U1K A;  1SPB P;  1UW9 A;  3DGP B;  1MMN A;  2ZC3 A;  2IJF A;  3AJ2 A;  2XS7 A;  2BM1 A;  4I67 A;  1JX4 A;  2KT3 A;  4DV0 J;  3M32 A;  2DHA A;  1EQ0 A;  2VOP A;  4N56 A;  4QW9 A;  1LW2 A;  3D68 A;  1X4E A;  3BB5 A;  2QA2 A;  3LAN A;  1XR7 A;  1FKP B;  5D3G A;  2VOO A;  1CS4 B;  1HW8 A;  3A3N B;  4KGM A;  1U6B A;  1IBC B;  4DR6 J;  4LR7 A;  1DZ5 A;  5B0C A;  2ADB A;  1HHS A;  3U7J A;  4HT7 A;  3JB9 k;  3OSN A;  3JAM Y;  1NZA A;  1JLE A;  1JLB B;  2GO8 A;  1VQO S;  5LJ3 Y;  1TK8 A;  2MQL A;  1C0T B;  3IR5 B;  4B3O B;  3CC7 S;  3CDE A;  2G2Z A;  2HEK A;  2MZT A;  1AW0 A;  1JLG A;  2X1G A;  3BGU A;  3HDS A;  3W5Y A;  1IQZ A;  2DO4 A;  2FC9 A;  1O5J A;  3CCL S;  2V9K A;  4HAC A;  1X4A A;  4FNH A;  3TYT A;  3VAI A;  1U6Z A;  4JI5 F;  1WI8 A;  1RLC L;  2E1C A;  2MZ1 A;  4FKY A;  5CYJ A;  4LRD A;  5GMD A;  2D3O R;  3H4B A;  4ANC A;  1T95 A;  4YFU A;  1B0T A;  3JQK A;  2XZW A;  3KLE A;  1S10 A;  3W9I A;  4R8U B;  3OTB A;  2I2Y A;  4B3R J;  2CQ2 A;  2YPZ A;  4OYA A;  2G0I A;  4U96 A;  4DG1 A;  4RUC A;  1FVQ A;  4DCJ B;  4ECT A;  2IA0 A;  2R7R A;  1WEL A;  5HBM B;  3ENQ A;  1T05 B;  4LRB A;  3THV A;  1NPR A;  1S48 A;  2EVZ A;  5DZ6 A;  2I6W A;  3JTN A;  3RAQ A;  4AUK A;  1WSR A;  5J2P B;  3FBE A;  1Q8L A;  1F1B B;  3IP0 A;  2YH0 A;  1NK4 A;  2BW7 A;  2VBZ A;  3RTV A;  2R2S A;  3MEC A;  4KYZ A;  2XLK A;  3SCK E;  3HP6 A;  2DGU A;  1NCL A;  3PYG A;  1GEH A;  2WSC C;  2WHO A;  4NI2 A;  1WHY A;  1KC8 T;  2PN6 A;  4LF8 J;  3QRR A;  1ZA1 B;  2W2Q P;  4OHV A;  1HBM A;  3RR8 A;  3J81 U;  5H9F J;  2D41 A;  1RHR B;  1N33 F;  2LQB A;  1T9Y A;  4I6Y A;  4DSL A;  1S79 A;  2GW8 A;  2DNL A;  1YZ6 A;  4DV4 F;  5IV3 A;  4ZLL A;  1JLC B;  4J91 A;  5EUH A;  2GGP A;  3HHN B;  2PE8 A;  1RP5 A;  4F2S A;  2DCU B;  4WII A;  3NNH A;  1IUJ A;  2KJW A;  4MIA A;  2BRL A;  5CQG A;  2NPI A;  4O3R A;  1HHT P;  3HSD A;  4B9L A;  4PR6 A;  1S6Q B;  4C48 A;  4CM0 A;  1JMT A;  3VAF A;  1CJK A;  5J2N A;  3DRP A;  4QW8 A;  3EGV A;  3NGU A;  1QTN B;  1O51 A;  3R97 A;  3D6M B;  3WIU A;  4Z37 A;  2JVO A;  2D3U A;  1S1V B;  3PV8 A;  5DM6 Q;  2KZM A;  2CDQ A;  5ETT A;  2VA2 A;  1ZM2 A;  5C25 B;  3BRE A;  4FF1 A;  3VZI A;  1X5T A;  2B5J B;  5J1E A;  2Z56 B;  2K8G A;  3LPY A;  5I4M A;  5LSL A;  5LL6 d;  3PRB A;  1RYS A;  3ETM A;  3D6H B;  2I5J B;  4GC6 A;  4DCO B;  3KWM A;  2GZO A;  2M8D B;  2G2O A;  3EGZ A;  3R2D J;  1HNW F;  3R5D A;  6AT1 B;  3Q86 A;  4DPY A;  2BQU A;  3MD3 A;  3PTW A;  5KFZ A;  3CCR S;  1M5P C;  2PGC A;  2GIQ A;  5HP1 A;  2OTL S;  3LH2 S;  2KO1 A;  4IQX A;  2CZ9 A;  1VI7 A;  4CZC A;  1CPZ A;  3UCU P;  1YWX A;  3BSA A;  4C8M A;  1GMW D;  2FLP A;  3DLH A;  1YBA A;  2ZZT A;  3H98 A;  2XLI A;  2XQC A;  2XGQ A;  1TUV A;  3HJF A;  4BCA A;  3CCJ S;  4O4G B;  1FWP A;  4B9T A;  2E1M C;  4H4K A;  2OSR A;  2XG8 A;  3RG6 A;  2KT2 A;  4MKV A;  3MCS A;  2IBO A;  3GP9 A;  3R1H A;  2XO7 A;  2CKW A;  4N77 A;  5FD1 A;  2NSB A;  2W9C A;  3IM8 A;  1UEV A;  3EVM A;  5DG8 A;  5IXU A;  3VVU A;  2D7S A;  2E7W A;  2ZH6 A;  5ETV A;  3FEZ A;  2YX7 A;  4Q8E A;  2XWX A;  2H1Y A;  3HM9 A;  3W66 A;  1P8G A;  2RAQ A;  5KT7 A;  5E3A A;  2V8D A;  2MKY A;  4DUZ F;  1H72 C;  3BDE A;  1DQ8 A;  3PFE A;  3OFF A;  3NKY A;  2OTJ S;  2E7V A;  3ICL A;  4OZN A;  3O2I A;  2QFI A;  3AD7 C;  2MEW A;  1DBD A;  4HT5 A;  4I7F A;  3TAM A;  3VF0 B;  1RWP B;  1AZS B;  2VC0 A;  2CNK B;  3CJ5 A;  3IRX B;  3MFI A;  4R0E A;  4C2M A;  4C6A A;  2DH7 A;  2DNQ A;  2W9A A;  3CJS A;  4GKJ F;  1F0X A;  1C0U A;  4OHW A;  4WZM A;  2AW0 A;  2HFS A;  2ZBR A;  1I3O B;  3SQO P;  4NYO A;  3P6Y C;  1N56 A;  4KO0 A;  5KFU A;  2NRE A;  2YWK A;  3UR0 A;  4DV3 J;  2DNK A;  2XHC A;  4X4Q A;  2C3P A;  4X2B A;  2QIF A;  3TZW A;  1S1T A;  3F56 A;  1SKU B;  4YR0 A;  3OD2 A;  1EQM A;  5GAG I;  3GJS B;  4WP9 A;  3BKF A;  4PCQ A;  3PW2 A;  4JOU A;  2LMI A;  5KT3 A;  4X4O A;  2W4C A;  3X1L B;  3MM7 B;  3ELH A;  4DHV A;  4C4W A;  3M8W A;  4AQY F;  2RML A;  4F3Q A;  1S59 A;  3MUT P;  2GAH C;  3QRP A;  1H0H B;  5BYR A;  3L4B C;  3EZU A;  2DH8 A;  4CTA B;  1NM2 A;  3D1O A;  2E5L J;  4ZPC A;  5HK4 A;  3DGP A;  3G4S S;  1WC4 A;  1T7P A;  2UU9 J;  1KKH A;  1WC0 A;  3JSY A;  1DLO B;  4P74 A;  2KN4 A;  4KH0 B;  3CCE S;  2V8P A;  1XR5 A;  2HGM A;  5AXL A;  3DMJ B;  2BM0 A;  4JV2 A;  1VQ7 S;  2HZA A;  2AMC B;  2KXH A;  1FO1 A;  2MLZ A;  4WYL A;  1CS4 A;  2HAI A;  3I5C A;  1H98 A;  1SQG A;  2XHW A;  2JNJ A;  1FXR A;  2QE5 A;  3FK4 A;  4ZIV A;  1IM4 A;  2XM3 A;  2CQ3 A;  4ES2 A;  5LSR A;  1DRZ A;  2C2K B;  4OZ3 A;  2UUB F;  1EHW A;  2HVH A;  1JLB A;  4QJV A;  3QJP A;  2DVI A;  4EBD A;  4QIV A;  2LA4 A;  4TXS A;  4U95 A;  4YHH F;  1C0T A;  2VBX A;  4B3O A;  3UCG A;  2BEF A;  1BWV A;  4DFK A;  1KQG B;  3VAM A;  3H2U B;  3D9B A;  3R5B A;  4W92 B;  5KG5 A;  1FDN A;  2FHJ D;  3Q8V A;  4USV A;  2GMH A;  4E98 A;  4GKJ J;  4USI A;  3FKB A;  1JLA B;  3RZA A;  4JI6 F;  1U6F A;  4FBU A;  2EC0 A;  4L75 A;  4CO0 A;  1CJU B;  1KQS R;  2FY1 A;  3FJ2 A;  3N01 A;  3TAR A;  3NNC A;  3NWG A;  4M5D B;  2W1B A;  4JI1 J;  2HK3 A;  2CA9 A;  4UUX A;  5AXN A;  3SMZ A;  2VUG A;  3R8Y A;  5KFX A;  5FJ4 A;  5HBM A;  3NS5 A;  1T05 A;  4GKK F;  2MKJ A;  4NYP A;  2N4C A;  3BGO P;  1N8R T;  4IFY B;  4P73 A;  5F9L A;  1PJ7 A;  3A8K A;  4KGZ B;  2Y1J A;  4DSF A;  2UZA A;  4AT1 B;  1WD6 A;  5J2P A;  1HI1 A;  2QGF B;  2IHR 1;  2HQF A;  3QRQ A;  4NLX A;  3MUM P;  2GV1 A;  1WKL A;  1H2U X;  2YWW A;  2EFQ A;  1D1U A;  3SIP B;  5M2R A;  2NXJ A;  1UW4 A;  3JTO A;  2C42 A;  4EGL A;  3RB4 A;  1FWL A;  1AB8 A;  5DG7 A;  1PKU A;  4IH6 A;  5KT5 A;  4IG0 B;  3A8E A;  1H73 A;  3M2U B;  2VG6 B;  2VQF F;  1WKJ A;  3T3F A;  4F4W A;  4RU2 A;  1JLC A;  3V81 B;  3D7S B;  2H48 B;  1RTH B;  3M6W A;  4D3G A;  2ZWP A;  3CPW R;  2VBY A;  1XMO F;  4FXW A;  4PXE A;  4GVL A;  1VK8 A;  2LQ8 A;  2YPY A;  3CC4 S;  1S6Q A;  3TZZ A;  2LEP A;  5FLX Y;  3KNA A;  1Y5I B;  1N5Q A;  2M52 A;  3B54 A;  4M5M A;  2RHQ B;  3PJW A;  1NDC A;  2W01 A;  4ZVT B;  3FUY A;  4K4U A;  1UPM B;  4M5H A;  3N4W A;  2C3Y A;  2UUW A;  5J2M B;  4NA2 A;  5DDP C;  1S1V A;  3W7B A;  1PO6 A;  4JI6 J;  3M8Z A;  1TUW A;  1NHV A;  2LU2 A;  5C25 A;  3GCX P;  1IBM J;  3QSY B;  2B5J A;  4I6A A;  1V6H A;  3DLE B;  4ZHR B;  4ILM A;  3NS7 B;  3PKY A;  2V8G A;  4C8L A;  3EE3 A;  3M8P B;  2M3D A;  2DR8 A;  2ZBC A;  3F41 A;  5B0A A;  2I5J A;  1M5H A;  1OIA A;  1NHK L;  2ZJP Q;  2J0W A;  2OPQ B;  2PC6 A;  5KFM A;  2WCX A;  1G2E A;  5HLF B;  1UZH A;  2C3O A;  1TUG B;  1OY6 A;  4IKA A;  2MY7 A;  3GON A;  3LPE A;  3ADA C;  4JI4 J;  2JRS A;  4ZLN A;  2KFY A;  3GYX B;  1Y9O A;  1HBN B;  4V1A k;  3PJX A;  3GJQ B;  3Q22 A;  1WAC A;  1U0H B;  2ROG A;  5D0G A;  3IAS 9;  4ZLP A;  5BR8 J;  3O3L A;  1YIJ S;  5HQ8 A;  2XZT B;  2YX1 A;  5KFB A;  1TFY A;  3WX4 A;  2KB2 A;  3QID A;  4CLU A;  4M63 A;  4DPX A;  3GIJ A;  2CQI A;  2IM1 A;  3EX7 B;  3LF0 A;  1C2P A;  1R0A B;  4UOF A;  4O4G A;  1ZBT A;  3PHT A;  2MGZ B;  3PRD A;  3CF5 Q;  3N6M A;  5JVH Q;  2V4Q A;  3BH7 B;  4JI2 F;  4KHP J;  2AGP A;  2VFR A;  4MK9 A;  1MWQ A;  5CD4 H;  1N52 B;  3PIO Q;  1BE4 A;  2CPF A;  3E51 A;  1OJ4 A;  1NAQ A;  1FRJ A;  2EEY A;  2CAJ A;  1BUX A;  2R7O A;  1FE4 A;  2K2P A;  4RW6 B;  1ZTW A;  4PG4 A;  2HWI A;  3TO8 A;  2FJE B;  4AE5 A;  3LGM A;  4WXW A;  2OD6 A;  4DV2 F;  1YJ9 S;  1T11 A;  4RL1 A;  3QIP B;  2A18 A;  3PHE A;  2HLT A;  4X4T A;  4DXL A;  1TL4 A;  4TLQ A;  4I64 A;  1UWB B;  3BH6 B;  5E3R A;  1RBL A;  1JLF B;  1XMB A;  1JNZ B;  2UUT A;  4ES1 A;  4JV5 J;  2Z57 B;  1CEZ A;  3Q0A A;  4ZK7 M;  3H5Y A;  1UEU A;  1X4G A;  4C3L A;  3M6X A;  3BF4 A;  3W8P A;  1N4L A;  2JEI A;  1AZS A;  3VTI A;  3IRX A;  1AFJ A;  4DR1 J;  4USJ C;  1DUR A;  4GO7 X;  4DQP A;  3H0P A;  1RAJ A;  3V2U C;  3D5M A;  3ZTQ A;  3A4T A;  4ECY A;  5KFR A;  2KG1 A;  2BAN B;  3CSK A;  5L46 A;  5H1S V;  3AFG A;  3ITH B;  2EC2 A;  4LF9 J;  4DZD A;  1SKR A;  1JLQ B;  2R7V A;  1PC5 A;  2XMK A;  2JOQ A;  2HRY A;  1M90 T;  2BJ1 A;  4B3T F;  2C2E A;  1AUD A;  3AB2 B;  3NBP B;  3QNW B;  3RB6 A;  4W90 B;  4QR2 A;  2VD3 A;  1HPZ B;  1YIT S;  3TZX A;  1GMW A;  1X0P A;  5KG1 A;  4PWD B;  5B09 A;  2IYG A;  2QC3 A;  2JC1 A;  4PWW A;  4AD6 A;  4NEY A;  3MM7 A;  3I31 A;  1HR0 J;  3OJS A;  3K0J A;  1BQM B;  1IBK F;  4PKD B;  2XUL A;  3OQ2 A;  4LVN P;  4YB1 P;  3O44 A;  2RS8 A;  1B99 A;  2KYX A;  2MLX A;  4QPT A;  2QRR A;  2XEX A;  2R7X A;  1A7G E;  2BW2 A;  3BN4 A;  3DYA B;  4CTA A;  1VQP S;  5C7P A;  2DNH A;  4LIR A;  3DLK B;  4IUF A;  2YKN B;  1H7X A;  1NUE A;  1DLO A;  2RB7 A;  1GK8 A;  3DOK B;  3TAP A;  4LUB A;  3FMW A;  4Y2M A;  3DMJ A;  1TKT B;  3PX4 A;  4DV2 J;  3PVX A;  5DGA A;  3V6H A;  2RNE A;  2FGO A;  1DQ9 A;  4X4N A;  1YJV A;  2PFF B;  3MMA B;  2OH2 A;  2RJZ A;  3N5F A;  2WOM B;  2ALZ A;  4IDK A;  3O6Q A;  3G6V A;  3BSO A;  3VVT A;  1XQI A;  5ADZ A;  1IM6 A;  3I5A A;  1M1H A;  3IBW A;  5A6P A;  2U1A A;  4DF4 A;  2BA9 A;  3GSD A;  1X4B A;  1E6Y B;  1VQ9 S;  1GXU A;  4C98 A;  3CUL A;  4N8N A;  5F8G A;  1ZET A;  1YQH A;  4YS2 A;  4WK3 A;  2RE1 A;  1X5P A;  2BMB A;  1FTC A;  1ZM4 A;  1C1C B;  3W61 A;  3T5H A;  1HLW A;  2ZKU A;  3VZH A;  2BAB A;  1YDL A;  3D66 A;  2HLU A;  1JLA A;  2B0G A;  2LXF A;  4CNZ A;  2DYA A;  1ZAX A;  1NXI A;  2QYC A;  4AYB D;  4G6V B;  1CJU A;  5CYQ B;  4M5D A;  5F8M A;  3DDN A;  2YXL A;  4WFY A;  3HZE A;  3BYR A;  1H2V Z;  2ZUA A;  2VV5 A;  4B08 A;  4ED2 A;  3G6Y A;  2FZC B;  2HQ3 A;  1YZ7 A;  3HT3 A;  3S1T A;  3QT8 A;  3MMC B;  3CWJ A;  1R8C A;  3VQT A;  7FDR A;  1D9D A;  2CQP A;  5L1L A;  1R8H A;  1KNZ A;  3W9H A;  2C3U A;  3JSB A;  1NKE A;  3HPO A;  3CJT A;  2E7X A;  4X4S A;  5F8H A;  1WHW A;  3RW6 A;  2KVI A;  3SV3 A;  2YVS A;  3K5P A;  4DV5 J;  1ZA2 B;  3RAM A;  3M1V B;  4ZVG A;  2KZZ A;  3PO5 A;  2XZD B;  3CGI A;  3BGL A;  1Z4U A;  2C2N A;  2CQC A;  1C1B B;  3D0H E;  2B9Y A;  5GME A;  1N5Y B;  3R5A A;  2LVW A;  2BE7 D;  2DGQ A;  2DNN A;  4IG0 A;  2E66 A;  1UVM A;  2KI2 A;  3M2U A;  2VG6 A;  2EWH A;  3T9N A;  2HGN A;  2FLO A;  3V81 A;  2KG0 A;  4DPT A;  2HWT A;  1RTH A;  3G2X A;  4MK7 A;  2NQP A;  3RRK A;  3M05 A;  5SZT A;  1WUU A;  1VHI A;  3DI6 B;  3PYD A;  1QAX A;  4Q7A A;  4ZP9 A;  1G1X A;  2BOA A;  1U8S A;  3QAE A;  3MEE B;  4P7T A;  3UCZ P;  2MPU A;  2GA7 A;  3BS9 A;  3PW7 A;  3EVW A;  5ETN A;  1K0T A;  1IKX B;  4F3M A;  4DR7 J;  4ZPV R;  3NGD A;  1FK9 B;  4EK2 A;  4XK8 C;  2FJW A;  2Y1I A;  3QGI A;  4NRT A;  4RW7 B;  2O3D A;  3OVS A;  2FPH X;  3AHP A;  4DR3 F;  1AT1 B;  2OGU A;  2R7S A;  1WOS A;  3OLA A;  5J2M A;  2V6A A;  1HQE B;  3HKZ D;  1MSW D;  2P8I A;  4ZN3 A;  2FHJ A;  4Q0B B;  4NLR A;  4Q45 A;  5THW A;  1UA1 A;  1EKS A;  4ZHR A;  3CVK A;  4OHX A;  1OQ6 A;  4C8Y A;  3MCN A;  5KFK A;  1NK8 A;  2ZH1 A;  2DT9 A;  2ZEJ A;  2ZOG A;  3M8P A;  2ZBP A;  1UAW A;  5C5J A;  4OV6 A;  3BJY A;  4M5K A;  2RUG A;  3OXL A;  2FY8 A;  3JTP A;  5GAG U;  2FHM A;  1F9H A;  2R9L A;  2OPQ A;  5HLF A;  2CPE A;  2CZ4 A;  2EK6 A;  4TU9 A;  2ZOM A;  1FNM A;  1D8Y A;  3EDQ B;  4QU6 A;  6FDR A;  4OJG A;  3UDV A;  3H4D A;  2NCK L;  1HBN A;  2Z58 B;  4A8O A;  3D0G E;  1U0H A;  2V68 A;  2QL9 B;  2CJB A;  5KFF A;  3DFE A;  1RI7 A;  3F44 A;  3HKW A;  1HIY A;  2XY7 A;  1EIY B;  2EKN A;  1BHN A;  3GFX A;  3ZZ0 A;  3W2V B;  3ENV A;  4I1T A;  4ZDN A;  4KKO B;  5CZV A;  3M30 B;  5IT9 Y;  1O0P A;  2HFZ A;  2VL1 A;  4A48 A;  3UWT A;  1RXO B;  2QZ8 A;  3EDR B;  2MGZ A;  2GJF A;  3OL9 A;  2CQG A;  2UXB F;  2LQJ A;  3QYY A;  1YHQ S;  4FVM A;  4CLF A;  1GMV A;  1D09 B;  3EVO A;  1S6P B;  2Z2L A;  3MXH P;  3MM5 B;  5L1K A;  2OP5 A;  4G3I A;  5LSO A;  1J5E J;  4RW6 A;  3IN5 A;  3CIZ A;  2FB0 A;  4CM2 A;  4RO0 A;  4K50 A;  1FNX H;  4ED5 A;  4WJB A;  4PG8 A;  2FTR A;  2XC9 A;  3RBX A;  2QLJ B;  1FI4 A;  5AJ3 F;  4DDF A;  7AT1 B;  3QIP A;  3ZZU A;  1CQM A;  3H2V E;  2DNR A;  2FJA B;  2LP4 A;  2HBZ B;  1XNQ F;  1D9A A;  2R7W A;  4DV1 J;  4WFB Q;  1UWB A;  2YX4 A;  5B0G A;  3KJF B;  1JLF A;  4M1K A;  1VQK S;  2X1F A;  1QY7 A;  4YQW A;  5CZX A;  2MQO A;  3B4D A;  4G1I A;  4RWW A;  5C42 B;  1R43 A;  4LFB F;  5BXI A;  3A13 A;  2ZM6 J;  4ED4 A;  2RUS A;  4B3M F;  4CT8 A;  1T9X A;  2H54 B;  1VDH A;  1WNE A;  4HDH A;  1MRO B;  2IMO A;  5AE3 A;  1RT1 B;  1AUS L;  1OPI A;  1FRX A;  2P6T A;  3PIP Q;  3HHL D;  4KGV B;  3NG8 A;  2DK2 A;  3CCZ A;  2E9T A;  4HLB A;  2BAN A;  3BPS P;  1V5I B;  2UVV A;  1MU2 A;  1RAB B;  4DX5 A;  2IBK A;  2FVC A;  3H40 A;  2CJK A;  4FYX B;  3ITH A;  3AD9 C;  1SXL A;  1JLQ A;  3V6J A;  3OTD A;  2J9E A;  4WP3 A;  2K1R B;  5ETK A;  4K2X A;  3NBP A;  3MZI A;  5AXK A;  1LEO A;  1FES A;  4KPY A;  2HVE A;  4KGK A;  4TYB A;  1HPZ A;  1VC6 A;  4CO2 A;  2J0S D;  4PWD A;  5I42 A;  2Z30 B;  1FEH A;  1IQT A;  4ZMM A;  5CHC B;  5K8M A;  2V2Z A;  3I9V 9;  2WB4 A;  1O8B A;  3RB0 A;  3E01 B;  2UXB J;  2WSF C;  1BQM A;  1DTT B;  1QDU B;  5C24 B;  3R7B B;  4IOC Q;  3HMJ G;  4CDI A;  2HGL A;  3DU6 A;  3DYA A;  4U9R A;  4NOH A;  2QLB B;  2QFJ A;  4OYO A;  3OJU A;  1HI8 A;  3GJR B;  3PDN A;  1ARO P;  2MQQ A;  2W9B B;  3I32 A;  1N34 J;  5IT0 A;  3DLK A;  2YKN A;  2BQ3 A;  3VR1 A;  3DOK A;  3HVR A;  4I4B A;  4BWM A;  1GAO A;  4OJH A;  3L3C A;  3TVK A;  1TKT A;  1SL1 A;  3BBB A;  3NCQ A;  1YJN S;  3FZB A;  2L48 A;  2RHS B;  2MQM A;  3MMA A;  1JJH A;  4ZKA A;  2PEB A;  2WOM A;  1XNQ J;  2HHH F;  1CC8 A;  1DJ0 A;  3H8Y A;  2UXC J;  2R7Q A;  2AD9 A;  3RJM B;  2V34 A;  3MR6 A;  3BPD A;  1IBL F;  1E6Y A;  5A8W B;  2LEA A;  1NEE A;  2XY6 A;  4Z7C A;  1TAQ A;  1PBU A;  3VGV A;  3P8B B;  1C1C A;  3MCO A;  1EAR A;  4BC7 A;  3MPD A;  1UCN A;  4OLO A;  2RIJ A;  1WWH A;  3QZ8 A;  3HHL B;  1S0O A;  2XMJ A;  2AZ1 A;  4RBU A;  5CYQ A;  5HAT A;  4DSE A;  2P9E A;  1SL0 A;  2BJ3 A;  3P3D A;  4MMO A;  2VDH A;  3BGR B;  3PX6 A;  2DXE A;  2D74 B;  3NEK A;  4DEZ A;  4PXB A;  4OYB A;  1WOR A;  3MMC A;  1RT2 B;  4CLW A;  3CJQ A;  3LAL A;  3BKT A;  5IQ6 A;  1N54 B;  3Q8P B;  4M95 A;  4L76 A;  3HZG A;  4Y2A A;  2OHD A;  1LFP A;  4OZ0 A;  3MPY A;  4QYZ J;  2C3M A;  3ZZP A;  1UL3 A;  3Q2T C;  3JSR A;  4JV1 A;  4DQS A;  4A8Q A;  2BJE A;  2RQK A;  3GFZ A;  3FZ2 A;  3SEO A;  4TYA A;  1M0S A;  2VAS A;  1D0E A;  3M1V A;  4Z7Y A;  1QE1 B;  4J9K A;  2H4W B;  4B3S F;  2HWH A;  2CPY A;  4O3P A;  2PD1 A;  4PPD A;  3ILJ A;  1C1B A;  3R2C J;  1N5Y A;  2CWK A;  1PYS B;  4Y34 A;  1PIL A;  4DFM A;  2OML A;  3WC0 A;  2M4M A;  4P71 A;  1FTR A;  4O3N A;  1ZAV A;  3IR6 B;  4HH0 A;  4F04 B;  2E1P A;  3DI6 A;  1SIZ A;  3AOD A;  1IJF B;  1SH0 A;  3CO0 P;  3QBC A;  5JVG Q;  4FPI A;  2V2V A;  4RZR A;  4JI8 J;  2PMH A;  5LXR A;  4F67 A;  3H5U A;  1JJ2 R;  3NAI A;  3OTO J;  2AIR B;  5KG7 A;  3GCW P;  1RHM B;  4ED1 A;  5I3P A;  4CLL A;  4G65 A;  1U7L A;  4ED0 A;  1IKW B;  3OL7 A;  4RW7 A;  2E1R A;  2ALY B;  3THT A;  5DET A;  1F3V A;  3BM7 A;  4WYW A;  2ATL A;  3GPA A;  4F36 A;  1HQE A;  4XPE A;  2ZZN A;  3P49 B;  5ETL A;  4Q0B A;  2JL9 A;  3BN7 A;  1ITP A;  1I1G A;  3GQC A;  4EO8 A;  2V0N A;  4IOA Q;  2QTW A;  2RRA A;  2KM8 B;  1GFW B;  1EP4 B;  3GG0 A;  4HVZ A;  4ZIT A;  3CJ3 A;  2DPI A;  4DR4 F;  4QWD A;  2QL5 B;  4MT1 A;  4DWI A;  3LGN A;  4FKX A;  2DRB A;  4RNF A;  3MPU B;  3AD8 C;  1YKW A;  2HAF A;  4DQQ A;  4QOT A;  2NXE A;  1M5V C;  5KG2 A;  4J9P A;  2CJY B;  2VB6 A;  3VAH A;  2ASD A;  2ROE A;  3GB0 A;  4OZ1 A;  1HI0 P;  2ZKT A;  1L3V A;  4USH A;  4USW A;  1JXL A;  4NXM J;  2ZVI A;  4NCA A;  2XNQ A;  4ECS A;  4DV6 F;  2JFD A;  2KFN A;  3RBD A;  1WC1 A;  4JP8 A;  2DY9 A;  2PMW A;  3MUV P;  5DQG A;  2AYG A;  2KHC A;  3W2V A;  1RAG B;  2W2O P;  1Y00 A;  4DX8 H;  4KKO A;  4V19 J;  3M30 A;  2EW9 A;  3L7P A;  1CC7 A;  1U47 A;  1OQ3 A;  3BGF A;  5LMN F;  4ZCK A;  2R3V A;  3BSN A;  1F5C A;  3W3S A;  2SXL A;  2BJ7 A;  4MIW A;  1K44 A;  3FMB A;  1CJT A;  1S6P A;  4KJI A;  2HK2 A;  3MM5 A;  1Y5L B;  1RAO A;  3D2W A;  3A3O B;  1R6V A;  5A2Q U;  1HBU B;  2GC8 A;  1Q82 T;  4K8R A;  1S1X A;  4DLE A;  2HRU A;  4CLT A;  1BQX A;  1NJZ A;  1RUS A;  4WZQ A;  3K89 A;  4EFA C;  5F3Z A;  2YY3 A;  4DBQ A;  4ICL B;  3I5B A;  2HQG A;  2GO9 A;  3TQE A;  3M8Y A;  2X7I A;  3I96 A;  1TVR A;  2HS4 A;  2MZS A;  1YBT A;  1T3N A;  2YKO A;  1Q0N A;  2W24 A;  3ZZZ A;  2IRX A;  2NYH A;  1APS A; 
#chains in the Genus database with same CATH homology
 4ER8 A;  2EC2 A;  2A6M A;  2XO6 A;  2VHG A;  2VIH A;  2XMA A;  2XM3 A;  2VJV A;  2A6O A;  2VIC A;  2FYX A;  2VJU A;  2XQC A;  2F5G A;  2F4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...