4QR0A

Crystal structure of streptococcus pyogenes cas2 at ph 5.6
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
MMVLVTYDVNTETPAGRKRLRHVAKLCVDYGQRVQNSVFECSVTPAEFVDIKHRLTQIIDEKTDSIRFYLLGKNWQRRVETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Structural and functional characterization of Streptococcus pyogenes Cas2 protein under different pH conditions
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
total genus 21
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qr0A00
3E3XA 2I8EA 1VI7A 4QR0A 2KDOA 4FN5A 1P9QC 1U2RA 1ZM9A 4ES3A 2I0XA 2WBMA 5G4DA 1ZM4A 3LH2S 4ZCLA 1FNMA 3ZZUA 3B8HA 1N0VC 1ZM2A 2NPFA 1DARA 1ZPWX 1ELOA 3OQ2A 4MYTA 4ZCIA 3EXCX 2ZITA 2L9NA 1N0UA 4TNOA 3ZZTA 4QR2A 1ZM3A 2EFGA 2IVYA 3B78A 2XEXA 2E1RA 3B82A 4QR1A 4MYUA 4ZCMA 1KTVA 4M1KA 2BV3A 4ES1A 4ZCKA 3ZZ0A 2CVEA 2BM1A 3UI3A 4ES2A 2J7KA 4MAKA 1T95A 2BM0A
chains in the Genus database with same CATH superfamily
4ZVHA 1VISA 3SSRA 1TTHB 1S4EA 4FNIA 2IA6A 1P1TA 4ZPVR 2Q6BA 1PIEA 3MM8B 4ZPDA 3NEKA 3UCUP 3D9BA 1WEZA 2GJIA 2G0CA 2GGPA 4B3SF 4Y6IA 5D0GA 3M32A 2DGUA 1F3VA 1DHMA 2RS2A 4B3RJ 5ETVA 1O0PA 2FVCA 3SFUA 4QZVB 1U1LA 4AE5A 3MPVA 4NLPA 2B4VA 1QE1B 3T3FA 2ZBPA 1R0CB 4URQU 1QSLA 1CQMA 1WTFA 3OHAA 3ZTSA 1S6OA 3M2UA 1HARA 3CJQA 1JQGA 3BKTA 2E1CA 4I68A 4ZCKA 3QGHA 3RBZA 2P6SA 3CJTA 4OLPA 1Z2LA 4OYMA 1X4DA 1NJYA 2A18A 4X62F 4EYHB 4A47A 3CJSA 3PW7A 3RJMB 2OPSB 1F5CA 1IKVB 3AHPA 2VDHA 4HT7A 2OTJS 4JYAJ 5KFVA 2P9GA 3P4UB 5B08A 4GC6A 2AX1A 4X66F 4ITSA 2AT1B 3SCIE 5L9NA 2RAQA 1SI9A 1G6BA 2ZH1A 2U1AA 1FRKA 1D09B 3I87A 2KTQA 4L73A 3MEDB 2M8DB 4ZP6A 3UPFA 3D54A 3J80Y 4ZVSB 4F4WA 3AODA 3DGPB 3PYFA 3H7HB 4R8UB 1MROA 2OTLS 4NE9C 3D1HA 3IG1A 3D7SB 4X4TA 3NS7B 3FQLA 2X3DA 4RW7A 3SXLA 2AD9A 3UE2A 4KGKA 4FZVA 2V2VA 3DOKA 4M94A 4USUA 2XYPB 3VAMA 4DSEA 2C2ZB 1RACB 2IM1A 4DR6J 2MZRA 3LTOA 4CYUA 3LH2S 2HSEB 4F4YA 4FXWA 2XGPA 2PGCA 2YX1A 4BBYA 1BWVA 2ZM6J 3A3NB 3G6XA 1RWNB 4NLOA 2NR0A 4P73A 1S6PA 3BREA 4PQUA 1C1BA 4USKA 1S49A 1S7HA 1IKXB 2AKWB 5IT9U 1MNEA 2OPPA 2QSFA 1H38A 5J2NA 3C8YA 2X3GA 3J81j 3OBIA 4UOCA 4RU2A 1DTTB 1V3RA 2HQGA 3BKUA 5C2CA 2XNQA 5H9EJ 5K14B 3FEXB 3LWMA 3N6LA 4JOUA 5G4DA 3HZGA 1GAOA 4N77A 4BDPA 4ZN3A 2WAQD 4WP8A 3OW2R 4F26A 1NH8A 4W4MA 3KLHB 1AZSB 5CA5A 2F63A 1CS4A 4UW2A 2GAHC 2LU2A 3SSSA 2MZ1A 3D6MB 1S9GA 3TEHB 5IM0B 1OY8A 1I94J 4PYAA 1UZDA 2LMIA 2DNQA 2ROEA 4PKDB 1BQMB 1RAIB 2DGOA 5D6GA 1T9YA 1GX5A 2W9BB 5C42A 2CQ3A 1FVQA 4GC7A 1AB8A 2V2ZA 2J8SA 2M0GB 2EFGA 1DTQB 2B3TB 3PNIA 4WIQA 1N34F 3PEJA 3HI9A 1KN6A 2DD8S 3N0VA 1F1BB 4DQQA 1R89A 5KFYA 3A8EA 2ILYA 2UUCJ 3CD7A 1HQEB 2MKCA 3LWLA 1GMWD 5G0RB 3SYZA 4Y34A 3A4TA 1VHIA 1H2TZ 2Y3YA 4QPXA 1Q16B 1KKHA 2LQ9A 4RL1A 4Y2CA 3SDEB 2DIVA 3WHIA 3U27A 2IVYA 1ZAVA 2XWYA 2XSJB 1D8YA 1SJRA 1X0PA 1PAEX 1QUPA 2I8EA 3VGUA 3J81U 2HHHF 1RTIA 3G86A 1Q82T 2R7VA 2N4DA 4O4GB 2RSQA 4WTYA 1RAEB 3NLCA 1EJ7L 1VR6A 3W2VA 1RZMA 4G1QA 3MTJA 2B9YA 3RAQA 3EUNA 1KVJA 1UEVA 3GE9A 3LA0A 2CPZA 1YBUA 3I32A 2C2EA 4ECRA 4ES3A 2H54B 3EWGA 2QA1A 1I94F 1WOPA 1NSPA 3R5CA 3Q86A 3DXBA 4B17A 3OR1B 1FCAA 2AIRB 4NMXA 2CZ9A 2PC6A 3JTNA 1FWPA 5CCLA 1OS5A 2IBOA 1C0TA 3RYLA 3FEZA 3BGLA 1Q8BA 3FZBA 1FRXA 1HLWA 3U02A 4LSNA 2IM2A 3GJTB 1RT4B 3POTB 5E3QA 1XR7A 5AXNA 1KWMA 2ADCA 1HKAA 2ERRA 2WBRA 3BO4A 1XIQA 1HFEL 3D4JA 4IOCQ 2IBKA 2V4JA 3TUIC 2R2SA 3JTPA 2X1FA 5KG1A 4B02A 1REVA 2CA9A 1FKPA 2OO4A 3R1HA 1JJHA 2ZUGA 4O44A 1U1QA 1HWIA 2OFGX 3CJKA 3BGOP 4WJBA 2AJ2A 1HYSA 2FZGB 1GFWB 1VQ7S 4O4RA 5HROB 4DLEA 4KPYA 3KHGA 1WACA 1RWOB 3HKWA 1IJFB 3DDIA 1NSAA 3DC2A 1KTVA 2QLWA 1B0TA 3HM9A 2WSCC 5BJRA 3AJDA 4RKUC 2KJWA 3BPSP 2WK4A 2DJWA 4QJVA 2R7WA 1WC6A 1RT7A 3M8PB 2JEFA 3TVKA 5AE1A 3R7NB 4HHHA 5KFMA 1YJ7A 1WHVA 4KQZA 4ZA1A 4X64J 1S79A 1T9UA 4X65J 3E01B 3RG6A 3M8WA 3GYGA 1CJUB 3DN9A 2AJQA 3M7VA 4G1IA 3C14A 4OHWA 2W4CA 1HI0P 3MUMP 1GK8A 1HNIA 4I67A 4FNHA 3MTKA 3KWMA 2CPYA 1IKWB 4NLGA 2VQEJ 1VI7A 4HYKA 3KK1A 1XMOJ 1PILA 5KOXA 2B6AA 2C3OA 4DX8H 4W98A 2P6TA 1NK6A 4JB8B 1B0PA 1U25A 3CCSS 5F8NA 5HLFA 4ES2A 2JFKA 4LRFA 3J7Z5 4Z7YA 1NZAA 4K8RA 3G8TA 3M8QB 2DNOA 1S0VA 2VPXB 4X4SA 3N4WA 4R5PA 1SUQA 4QWCA 2UUAF 1FJ7A 5MLCV 1T03B 1SKUB 2BJ1A 1TL5A 3U7JA 4JI2F 3I0SB 3GG1A 3C16A 4TU7A 4C3LA 1YBAA 2J76E 4CO0A 3F56A 4WFXA 1KS2A 4B9UA 3TO8A 1T9XA 1LFWA 4KV8A 4QWDA 1VBKA 1UJ6A 3IS9A 5KFRA 3MAAA 4DV7J 1Y5LB 5FDLA 1M1KT 1U8WA 3FFIB 1VJWA 2HQCA 2HHWA 1R8HA 2ZH5A 4PG7A 2HMIB 3R7BB 2GVDA 4H4OA 4X64F 2HLUA 4HI1A 2BJDA 2XCPA 2KDOA 1OPIA 2OUGA 3RUBL 5A8WB 1SQEA 1P9QC 4F4KA 1RTJB 5CYMB 3VV2B 1I6JA 2VODA 3OQ2A 3KLVA 3GZ7A 1J5OA 4M5LA 5I3UA 1H0HB 1M5VC 3CGIA 1N32J 3UI3A 5CABA 1S1TB 1N88A 4RZRA 4CT8A 2ZE2B 3GMGA 2HW3A 2GIQA 1VFJA 3JYTB 2KXFA 5GADI 1LW0B 2HS3A 3CSKA 3LANA 5CHCB 2QL7B 4FYVB 2VQEF 4J9UE 1B64A 4ZVOB 1XMOF 3HSGA 2XMAA 4GVLA 4K4YA 1CJTA 2WB4A 1TK8A 2ZBIA 4OJHA 1BQXA 1FKOB 2ADBA 2DO0A 3IBCB 2FZKB 4AUKA 2FJBB 1B99A 2MKYA 5KFBA 3IRXB 4EFAC 4RU9A 2JNJA 1WC3A 1HWLA 1VIOA 2G1HA 4J37A 4M5MA 2YPZA 3NAHA 3GYNA 4OZLA 1FD8A 3PX6A 3D6FB 4OYAA 4QPTA 1D9FA 1SV5B 1X8DA 4FKYA 1JB0C 1T3OA 1HR0F 2AHOB 1FNXH 5CD4A 3MOZA 3J7ZT 1X9WA 3N9UC 2LVWA 3GV7B 3CXCR 4IDKB 3GILA 4OJ1A 2AU0A 3TJ9A 3JQKA 2UP1A 3KLIA 4NI2A 1JLAA 2NREA 2CQ1A 3DMJB 3BN4A 1XN9A 4QWEA 4DV7F 3WC2A 2BUNA 5CXTA 4CLKA 4ELTA 4DR1J 3SZ2A 1UKUA 4K2JA 2R2RA 5B09A 3PR4A 2QL5B 4ANDA 3F73A 2OSRA 1KFSA 3MM8A 4ZLLA 1B70B 3T5LA 2BRLA 1X4BA 3E51A 3GSIA 4NLUA 3GFXA 4ZHRB 5M2UA 4X84A 3OSNA 3KKFA 3P3DA 2A6OA 1N32F 4C6AA 3MGJA 1VRQC 2QL9B 5EX0A 1FT8A 3DLHA 1RBOB 3PW2A 4CLSA 1BMQB 2JX2A 3MPWA 2V2QA 1VRTB 2GMHA 5F9LA 2XNRA 3M6VA 4B3TF 2PSZA 2NSCA 1QE1A 3GIMA 1RHMB 5E7OB 3OJUA 3FDSA 1U1NA 1XMQJ 1MWYA 1LWEB 3KDOA 2YKOA 1ROFA 3GB0A 4LT6A 5KTQA 2OSQA 3EGWB 2C3UA 4Y2KA 2RNEA 4TU8A 3DI6A 1FWKA 4KE5A 2EFOA 2KXHA 2PFDA 4AXJA 2XEXA 4X4VA 1YTYA 3PJWA 1LXNA 3UFCX 4LRBA 4N41A 2HBQB 1YG0A 1IKVA 5F9NA 1JXEA 2WRMA 4YR0A 2ZJPQ 4F02A 4KKOB 3PX0A 2JWNA 2DO4A 2HIQA 1L3UA 4DR3J 2ALYB 1JNZB 1ZZFA 3MEDA 3L7OA 5HJXA 3TNVA 3KG0A 1UETA 4QIVA 3EDRB 1URNA 2R9LA 4ZIWA 3SCLE 4DR1F 4L3KA 4S0MA 1E6VA 3DGPA 5ETMA 4R8UA 4WFNQ 2VONA 1XR6A 2JZ5A 4PG4A 1JJ2R 1KNZA 2HQDA 1YZ7A 3BSNA 2ATCB 2I9SA 4OZ2A 3BDEA 2WVCA 4CM2A 3GU0A 2MQPA 1VDHA 2VJVA 1FVSA 1G7CB 3MEEB 2R8GA 3LGHA 1M5KC 3H40A 1T05B 5HMZA 3GFHA 3Q8VA 2QSWA 3P6YC 2XMJA 3FCVA 4C4WA 3PO4A 3D5MA 3OFHA 2HHSA 5LSRA 4FPIA 2EXUA 3A8KA 4MIAA 4J9PA 1AYEA 4ZPBA 3S6EA 4ENOA 4DU7A 2LDYA 1CLFA 4N8NA 2HWIA 3MEGA 2ZJQQ 5IV4A 3CO0P 3UR0A 2XZWA 1SBRA 2B7CB 1X5PA 3HK2A 1RWXB 1HBOB 4NLRA 2V8VA 1IKXA 4WZQA 2GAGC 1LWFA 3UW1A 4CLPA 1U02A 4CO3A 1VQPS 2FTRA 3ZZZA 3R6LB 1ZBTA 1F9HA 4YUDA 1Y5IB 4DV0J 1A9NB 4NYPA 2KM8B 4DCOB 1DTTA 5B0AA 1ZETA 1HNZJ 1G2EA 2JL9A 3NNHA 1WF0A 5K14A 4DSJA 4CH1A 3OUYB 1H2VZ 1SQGA 2ALZA 1RTHB 4BWJA 1ZS6A 5F8GA 1RT2A 1TELA 4QYRA 3R5DA 4C8NA 3DM2B 3OL9A 5LMNJ 1SH3A 1K47A 4FYYB 1NJXA 3FGVA 3KJQB 1TL7A 4YY3J 3PKMA 3C6UB 3EXYA 1IR2A 2VPYB 1YJNS 5IM0A 4K4WA 1BQMA 4YB5A 2ZH6A 2W9BA 2UVVA 3MR5A 3BBFA 3OTOF 4HH1A 2M8HA 4WFZA 1DTQA 5ETOA 2XS2A 1PJ6A 4U8YA 1OPZA 1YJVA 2VUGA 2I5JB 4K4VA 1E6YB 2HURA 5GAEI 4NWBA 1HQEA 2YWFA 2E7XA 2E7VA 5G0RA 4ZVEA 2CNNB 2R3VA 4JI4F 1JNRB 4A8YA 2VC1A 4DPUA 1UTAA 2XMUA 2V94A 3H4BA 3CT9A 4NXNJ 5K5MA 5KFUA 3JTOA 3SMZA 4ED5A 1HNZF 3CCWA 3D28A 3VGVA 4K4XA 1WHYA 5EWEA 4NA2A 3MM9A 2DNGA 4LRAA 2ASYA 4D3HA 2DITA 4XDDA 3AAWB 3ENAA 4G3IA 4F3MA 3QRRA 1RHQB 1TMMA 3VGTA 5EHHA 5LMNF 1IQZA 3PJXA 4LFBF 2EFQA 2N7YA 4O0IA 2FGCA 4PXEA 3SFGA 1U0SA 3KXDA 3BDPA 3OR1A 2FB0A 1NDLA 4NCBA 4WU3A 2HHXA 2HQIA 4LBIA 1S6QB 5AE2A 4CI0B 1T0TV 1WOOA 2E9RX 2ZWPA 2CNOB 4KR0B 1R8CA 2WCXA 4X4UA 3D3BJ 3KG4A 2RQ4A 3BKFA 1KHVA 4LF4F 3AFGA 3POTA 3HT0A 1NKCA 2Z2LA 5DZ6A 4F4ZA 1F5BA 4KGZB 3TUPA 4NASA 4A48A 2Y8WA 3DYAB 5B0GA 4DV4J 3CB4A 2BOPA 4DR7J 4AL6A 4ICLA 1JXLA 1Q86T 4W90B 3HHNB 1VIXA 3EDQB 2DB1A 3HHEA 3AOBA 2G0IA 3KNAA 3BQ2A 3Q8QB 4YP3A 3QLHB 4WU2A 2W1BA 3GJRB 3WQPA 1C4AA 3AA8A 1B4SA 5HROA 2R8JA 3OSPA 2JVOA 4RBVA 4ZPAA 3IBFB 2R7XA 5HQLA 3DLJA 3F44A 2VFRA 2G1DA 4M5HA 4GRSA 4I7FA 2V63A 5DQHA 1WC4A 3AD7C 5GAGU 5K8MA 4Q7AA 2P9CA 3Q22A 4LR7A 4JV5F 5KFDA 2HFOA 5KFZA 3M30A 3AXMA 4OL8A 3M8PA 2RILA 4IFVA 1AFIA 1F5AA 1WG4A 1FE4A 4AFFA 4JI7J 2QZ8A 5KT4A 3H2LA 3M1VA 1HBNB 2HNZA 1CJUA 4OYIA 3C3LA 3FK4A 4DG1B 5DM7Q 2RKIA 2OHDA 3A8IA 2IHR1 3U1NA 1NAQA 3MCMA 3THPA 4OZ3A 2AEFA 4LREA 4DPTA 2ZH9A 2B9EA 1HQ2A 4KT0C 4DR2J 2J7UA 3K5PA 4H4KC 3MFHA 4ZJOA 1SKWA 1IBLJ 1WI8A 2J0SD 2Z30B 4Y3CA 2YTCA 1SB6A 2QLBB 3M8QA 2RQCA 3IGVA 4M5GA 2M70A 4R25A 2YNGB 2YKQA 3NNCA 2OD6A 2C3YA 4DR5F 4KHPF 5J2MB 2WOMB 3Q8PB 3I0SA 2WSFC 1SC4B 3TA0A 4JI8J 3VAGA 1VQMS 1X4GA 4JI3J 2OEJA 4NYZA 3KJVB 1TP7A 1BD6A 2J9DA 3FFIA 1YLXA 4B3MJ 4DL5A 2BE7D 2C2DA 4WF9Q 5KAKA 2R7OA 2WONB 4JI6F 2HGMA 5A8WA 4K5SA 4ZK7M 1M5HA 1FK9B 3MFIA 1RTJA 3QMQA 5DQIA 4C0BA 4K4ZA 3NCRA 1FX2A 2VBXA 1X5SA 2HEKA 2ASJA 4OJGA 1BUXA 3MCOA 1S1TA 4MKAA 3TZXA 4DN0A 2Q1LA 5F8HA 4OV6A 2BX6A 1LW0A 3G8QA 4RW9B 3T5HA 2YWEA 3HULA 1X5TA 2DGXA 3BH7B 2GV1A 2J5AA 1NO8A 1FKOA 2M2BA 3MAHA 3IRXA 2Q79A 5HVHA 2FLLA 2MLZA 3ZZPA 2Z0GA 4HLBA 4JP8A 1JIHA 5CCMA 4H4MB 3PVXA 4K4SA 3FCHA 4DWIA 4DQIA 2CVEA 5CH7B 4DFPA 1HL6A 5JJBA 2UUWA 3UCGA 3HP6A 1G4CA 1FRJA 4JI8F 3KK3B 4UOGA 4RUBA 4UQGA 4QWAA 2GX8A 2F40A 4IDKA 1RUSA 2W7PA 2KHCA 4KHRA 5ETNA 4DFKA 3DMJA 3R5GA 2B8PA 4LVOP 5GMEA 3KG1A 1XJWB 5HL7Q 5DJBA 2HS0A 1NZ8A 4QWBA 4PXBA 2OKQA 3VALA 2DHSA 2XG8A 2A2CA 2MY7A 4EYIB 4ZHRA 4EU0A 4LF6F 2HRUA 2LKZA 1FHTA 4DL3A 2KB2A 5HAOA 4HEA9 5B7WA 1F2HA 1WEYA 4FS1A 2DNZA 3AB4B 2OJ3A 1VRTA 5IT4A 3B82A 2ZBCA 5DG7A 4GMKA 4OFZA 3Q8RB 3VAHA 1YIJS 3WX8A 5A8RB 3M9NB 1UFLA 2ZOMA 3O1LA 4PWDA 3WBZA 3RB4A 1WDTA 2VA2A 3W9HA 1SVDA 3OTDA 3NY0A 3A3OB 2BM0A 1V5VA 4OHVA 5KFCA 1RK8A 4F3QA 1X0FA 2MQ8A 4OX7A 2XMVA 1B0VA 3KLGB 3RBDA 2YNIB 2YVSA 1J5EJ 3K57A 2NQPA 5D8HB 3X1LB 1S1VB 2QMWA 3W64A 4RW6B 4ZP8A 1TFWA 3OFEA 3MURP 2DGVA 1KP6A 4ATNA 1O5JA 4QIWD 4DL7A 2V34A 3JQJA 5DG9A 2XMTA 1O51A 3ILJA 1LWCB 4DL6A 3QZ8A 1ZPWX 5EWGA 3IMQJ 3CO9A 1KEKA 2JLEA 1KC8T 3T41A 2I0XA 1A7GE 2KM8C 1WI6A 3RR8A 2HNYA 2YNFA 5D78A 1N6QA 1PCAA 2M9KA 3MEEA 1BY9A 2Q3PA 4K0KF 4USTA 3D66A 4K7QA 2DRDA 1JLGB 3KLFA 2JFDA 5DDPC 2LEPA 2FJXA 2YQ3A 4ELVA 1JLEA 1WDDA 3N01A 5EGYA 1Z1ZA 1P9YA 2HK2A 4WP3A 3JSMB 3DNCA 3FMBA 1XC9A 4DU8A 4UOFA 2XY6A 3IWXA 3K5MA 3H2VE 1N8RT 4PG5A 1HBUA 4NRTA 2AMCB 2K1RB 4Y28C 5H9FK 1HBOA 3PFEA 1R0AA 2DBBA 4WZMA 3N5BA 1MU2B 5ETLA 2ZJRQ 4I64A 2EKYA 1BXNA 1PYTA 1X9MA 2P9EA 5FIIA 2G9OA 1VQKS 3TUZC 3QJPA 1J5EF 2JC1A 2FJDB 1HHQA 2JEGA 2VFVA 1MMLA 3TZWA 3GIRA 5LMUF 5HMWA 3OUYA 2C3MA 3T19A 1RTHA 2W4PA 3W66A 3ONQA 2XI3A 3NL0A 4ZLJA 1CJKA 2FVPA 4M63A 2UXDJ 3AOCA 3KLEB 1AXQA 5A0YB 5L1KA 5M2PA 2XY5A 3DM2A 3VWSA 4KFBB 4RNHA 4LSLB 3BBCA 5KOWA 2COLA 3D1OA 3DRRB 3R5JB 2HFVA 4B9LA 2MEWA 7AT1B 3IO1A 3GR0A 1VQ4S 4NA1A 4ZKAA 2JOQA 3LGNA 1SH2A 2YX4A 3RU0A 1W25A 1IXKA 2BV3A 3EVMA 2CADA 2ZUAA 4IG0B 2I5JA 3D0HE 2PFFB 3SQGB 3HVTA 2JHEA 1PG5B 1F3FA 1TUWA 5IC4B 2KO1A 3VQTA 4ED3A 1S97A 4UZBA 4OMFG 1U7LA 3HHLB 1MMNA 1VK3A 3DKDA 4LF7F 3G8SA 1LV5A 1Y4ZB 4WKYA 3TR5A 2HVDA 5GMDA 1Y0HA 3DRYA 1WF2A 4IOAQ 2XM3A 2UU9J 4P2XA 3IR5B 1PJ7A 3KNGA 1KLNA 5LJ5Y 2D41A 5KFFA 3QRPA 1L3SA 1CVJA 1VOMA 2GHWA 2YKNB 3HXMA 3AD9C 3FMWA 1UPPA 4LF9J 1RT1A 2DH8A 1EP4B 2HRTA 3TI0A 2BABA 4IRKA 1RT5B 4YB6A 1HIYA 3LAMA 4KH1B 2BE2B 5KFJA 2R8HA 2K7JA 2BJ9A 4DPWA 5L39A 5EWFA 4XK8C 4UT4A 2W9CA 4RJVA 1AUSL 1ZAWA 1FEEA 5DGBA 2DNLA 1Q4RA 1F9EB 2RB7A 4N76A 3TJAA 1ELOA 2GCFA 4AQYJ 3UCZP 5HQ8A 1JLQA 4X4NA 3I55S 1S6QA 3CDAA 3Q23A 2DH7A 1LW2B 3AA9A 2ZHAA 4A8QA 4IRCA 4J9VA 1SC6A 3OTEA 2EKNA 2DT9A 1FRMA 3PYDA 4LSZB 4OYPA 5IC6B 3P8BB 2HRYA 1RLDA 3U1MA 2IPOB 2QYGA 3PTWA 2XHCA 4WIIA 2GS8A 4RO0A 3HX9A 4EBEA 3EGNA 4WE1B 2MZSA 2MYFA 2FHOB 3UD5A 2RDJA 1HNXJ 2SXLA 4DV6J 1EETB 3SCJE 2W24A 6AT1B 3IM9A 4GKKJ 4DF4A 2UXBF 3SV3A 1Y3KA 2GIRA 2X1GA 4NRUA 2VG5B 2K8GA 1X4EA 1IBKF 2LECA 4ED1A 3PW5A 1X7VA 5A2QU 2CPJA 4K4UA 5C24B 1VBYA 2EFVA 3NXZA 5HO4A 2IJNA 2VL1A 2BANB 1KQSR 5KT3A 1FERA 1RWUA 3MM7B 5HI7A 2ZOFA 2J6TA 3EZUA 3TJ8A 3M2RA 4LF9F 5LXRA 4CH7A 4DUYF 5F3TA 1D9DA 1U1RA 4DUZJ 1U2RA 2HKEA 4OYWA 1Q8KA 2E7WA 2KHDA 3QGIA 4MIBA 4J9KA 2B0GA 3O8WA 1HPZB 3R3TA 1IR1A 3D0IE 1ZYQA 4DZDA 1K9MT 4U7UD 2VG6B 2DHGA 5KG5A 4I4BA 5E33A 1MWQA 3US5A 4MK9A 3PYEA 4KIAA 5D0HA 1HBNA 3H5XA 1GQEA 1N5TA 3Q8SB 1RAHB 4KSEB 1AT1B 2O5DA 3W9JA 2RUSA 2X51A 2XHWA 3K89A 4C97A 4J9QA 4NXMJ 4M5IA 4IH6A 3QPIA 4DL0C 3DRPB 3EZ5A 4ANCA 3QYYA 2KG1A 3PW0A 3NWGA 2CG8A 2YNHB 1KR4A 3MM5A 1SJFA 1O8BA 2YWHA 4P9SA 4LR8A 3V5RA 2HHQA 4DFJA 1HWUA 2GHVC 2QE5A 2V68A 5KG7A 1YJ9S 1QAJA 2CQBA 4XTTA 1TZ0A 3MR3A 3R5AA 4ZOSA 3BO3A 1SJ1A 4AXIA 3Q83A 1HWKA 1TFYA 2JDJA 2HFUA 5J2MA 2WOMA 1RP5A 2MQLA 2AGPA 2BQ3A 4DSIA 4NZ7A 4CNYA 2DRBA 2W8KA 2R2TA 1NJZA 3TX8A 3P45B 4MAKA 4ZVPB 1JXVA 1HHTP 3D0GE 2GC8A 3G6ES 2V67A 1TKZB 1G1XA 4I2PB 5DDQC 2QLJB 4YN3B 4ED6A 2BA9A 1U0HA 2MQOA 2WONA 1YITS 3W60A 1FK9A 2ZH8A 4LF5J 2IJRA 2O66A 4U96A 1IJEB 4ER8A 2AW0A 1TQLA 5GAHI 2ZVIA 3WC0A 5CYQB 1TL3B 3L9ZA 2XMWA 4DR4F 3MECB 4A4JA 1WNEA 4Q0BB 1C0UB 9RUBA 1EQ0A 4UQTA 3I4HX 4TU9A 1NHUA 3K0JA 5F3ZA 1RAGB 2MB0B 1IKYB 1HNVB 3NP5A 4DV3J 1JKHB 2QYCA 1FJGF 4CNZA 3T1HJ 3WDOA 4AT1B 3H5SA 3QIPB 4H4MA 1WKKA 3TX0A 2Z56B 4AD6A 2QEXS 5DDRC 2FJAB 3GWCA 5DZ7A 4WFBQ 2FPHX 2ABYA 1R7IA 4DV2F 3E3XA 2CJQA 4OI6A 1I3OB 4A8KA 2EC2A 3KK3A 1U47A 4MKVA 2IM3A 5ETTA 2WHOA 2G2YA 3CCVS 1JJCB 3T9ZA 4XIUA 3D67A 3OR2B 3CF5Q 3MF5A 3SI8A 1GTHA 4HDHA 1URRA 1HQUB 2QFIA 2PE8A 2Y8YA 2BJ3A 4OZNA 4TYAA 1TL4A 3IGNA 3NOCA 3AQOA 3BR9A 3OD2A 2NXCA 3W5XA 4LF5F 2UUBF 1S1UB 4CZCA 1HMVB 1NUEA 2OELA 3NGSA 4B08A 4X62J 1UJ4A 2VFSA 2WW8A 3MPUB 3IWLA 4ED4A 4LQ3A 5AT1B 2V5HG 3QO9B 4HDGA 4FPRA 3U1LA 5KFTA 1XNRF 3GTYX 4X66J 4ID5B 3I9ZA 2DIUA 3QJJA 1X4FA 3I96A 2AV5A 4MKBA 2ACMA 3ET6B 4N56A 2DR7A 1FFWB 3BPDA 3CUNA 1VQ8S 1KQKA 4I2QA 3BH6B 3ZTOA 1R8AA 5JXSA 2G13A 4J7CA 1S1WB 2W2OP 4OI1A 1VRUB 4X4PA 4O3PA 1SKRA 1VQNS 1JLFA 3G2XA 2ATLA 1V5IB 1HI1A 1UPMB 3PYGA 2QMUB 1FDNA 1RXOB 4KH0B 5H9FJ 1DLOA 5DRKA 1WD6A 1S1VA 5DLFA 4RW6A 5J2QB 2RHQB 1SL0A 4K2XA 2JLGA 3MWBA 4YS2A 1JLCB 2V8PA 4KGMA 2VV5A 4Q5VA 4J9LA 4DL4A 4ECUA 1P6TA 1LWCA 4J9NA 3BGRB 3OV7A 1XQIA 4X4OA 3H20A 4RBTA 3VGSA 3GV8B 2L41A 3QSIA 2HQFA 2VICA 4CWBA 3AD8C 1UVNA 3ZZTA 2EWHA 1LK5A 1IM6A 4QW9A 2VU5A 2APOA 2MZTA 3W8PA 1ZOTA 1FRLA 3CDUA 2EC0A 2DEJA 3PRVA 3H98A 5L38A 2KFNA 2H51B 2ZKTA 3PIOQ 1A6LA 1Y7PA 3P5BP 2RU3A 2KYZA 2J0WA 3S1TA 1PGZA 1GNKA 2LQ8A 2BR0A 2ZHBA 1QJHA 1EKRA 2DR5A 5I42B 2FHKA 4FN5A 2K1RA 3O2IA 1RT3A 4JV1A 2OPRB 2QTWA 5T7LA 2B7BB 2NPFA 2CJXB 4IQMA 1RAJA 4X4RA 1MU2A 2BJ7A 4PYDA 4WYWA 4TY8B 3UDEA 3DRSA 4GKJF 1A0OB 1DBDA 2BOAA 3BSOA 3IN5A 3ILIA 4C11B 3KFWX 5AJ3F 1FDDA 3DLGA 1OSDA 2AEJA 4E98A 1FRHA 4CP5A 3UD4P 3QQCD 3HHLC 2YY3A 1N34J 3OPKA 4X2BA 3KLEA 4NLXA 1MMDA 2FHJA 4DV5F 5A0YA 1PBUA 4RBUA 3CIZA 1U1MA 2R4FA 4LJMA 1NJWA 4YB7A 3EXCX 4KFBA 2XQCA 4LSLA 4NZ6A 3FC9A 5ETPA 3MUVP 5IT9Y 4O3RA 2AJ0A 2LA6A 3DRRA 4ECVA 2FHMA 3TYTA 4OHYA 4FBUA 3UNYA 4EO6A 3DLEA 1WTBA 4Q43A 1XEZA 1Q78A 2GGPB 4QIEA 4ERDA 3M32B 1VQ9S 1PBAA 3J7YI 1SJ4P 2F4FA 2HHPA 1C1CA 1UA1A 2HVZA 3M8RA 2QMXA 1N0UA 2HHHJ 1R8BA 4ZS6A 2C28A 1H72C 3SQGA 2BQRA 2IVFB 1NK5A 3P5TL 2P5VA 3D68A 2CJKA 3M2UB 4OYBA 4RWXA 1TUVA 2EW9A 2C2MB 3HHLA 1DJ0A 4EEYA 3PXGa 5BYRA 1NU4A 1SCJB 3HSJA 3IR7B 2HQ3A 1ZA1B 3BGFA 4ETXA 1NSQA 5J2PB 5B0CA 1CC7A 4NEZA 1RYSA 2OFHX 2DY9A 3N28A 2VJUA 1Q0NA 2GMJA 4HTIA 4PABA 3ULHA 5SZTA 5KFGA 1FX4A 2XO7A 2PIIA 4C8YA 5CD4H 4C2MA 1MWZA 4DS5A 2M4MA 4DPOA 1S4FA 5HQMA 1EP4A 2DGSA 5LOQA 2BMBA 3G9CA 3EICA 3LP1B 2X1BA 4FF2A 1LWXA 4HI2A 3KJFB 1KDNA 3ZZUA 1DY3A 1RKJA 3ZNJ1 2V4RA 3QJLA 2CNKB 4ED0A 5AXMA 4QR0A 4MFBA 2QJ3A 1NB7A 3J81Y 1N5VA 4YHHJ 2FZCB 2PEBA 3CCMS 4MK7A 4HACB 2KVIA 1K8AT 1XERA 1LW2A 3L4BC 3O6QA 1NDKA 1YBTA 4CYUB 3W2WA 4CO1A 4P7VA 5FLXU 2XMMA 3GLJA 5KFKA 2NYIA 1DQ9A 1VC5A 1AFJA 4NMLA 2QO3A 2AF6A 1EARA 4U7UK 4WE1A 4PQUB 3OFGA 1RSCA 2ZH4A 4DZ6A 2O3DA 1QAXA 4GVBB 2DR8A 4NL5A 4YOEA 2GZOA 3OVSA 2ZD1B 2OPPB 3R97A 4RW8B 5J2NB 2VZ9A 1WELA 3DFEA 3R27A 3GR1A 2VG5A 1L3KA 4K59A 1NNDA 3JSRA 3DOMB 1EB0A 1RI7A 1MG7A 1WJ9A 2BANA 2N82B 2E5LF 2XZTB 4MKYA 2LQBA 3R1LA 1F0XA 2I6WA 3S8SA 1REGX 2FD2A 2RUGA 2KG0A 2OGUA 3IRWP 3MMBB 2UZAA 2MZJA 4NCGB 1CS4B 2W01A 2CPXA 1UAWA 1TV6B 1RQ0A 2WTFA 1RYRA 1WG1A 1UMJA 4USMA 1SIZA 4QQBA 3EMTA 2VG6A 1YJTA 5IZHA 4KY3A 2DCLA 2PD1A 5BR8F 2A10A 2GIFA 1RWWB 2DKOB 4YHHF 4DSLA 2BQUA 3I9V9 1K1SA 4Y00A 1SPBP 1LKZA 3BJYA 3GP9A 4WK3A 3TANA 3M2VB 4CCHA 4OI4A 4IO1A 4B9NA 2FC9A 1FFGB 3TW0A 2AZ1A 2UUAJ 3H25A 4BLGA 1N5SA 3DRPA 4ZLPA 1NMEB 2HVHA 3OL8A 5AXKA 4JI2J 4UY85 4YFUA 3FKBA 4DJBA 3OL7A 2BJ8A 2DPJA 3PO5A 4CRJA 1TKXB 1CG2A 3EZOA 1UWAA 2D1CA 5KFXA 5H9EK 3VVUA 2RS8A 3ZC4A 4RR5A 4F0HA 4DX6A 1PSDA 4DSFA 4Z37A 3IC1A 2H4WB 4LBPA 2H5IB 3UVJB 3ZFVA 2RDDA 5B0DA 1OYEA 1LFPA 4IG3A 5LM7E 1Y11A 3OXFA 5HP1B 2DVIA 1Q7YT 3A12A 4QOTA 5KFOA 2VDIA 3W2VB 2YKPA 3NG8A 1T7PA 4HT5A 2Q6CA 2B5JB 1W2BR 4ZDNA 4WCEQ 1WSRA 4PXCA 2FDNA 1Q8IA 4ES1A 3QT8A 4ZN1A 2HZVA 3MCSA 4OHXA 2XB2D 1TKZA 4I2PA 3JXOA 3KYLA 1N0VC 3FJ2A 4OX9F 4TKTA 4OZ1A 4QR1A 1H2UX 1OMSA 1C0TB 1WOSA 3H42A 2H1YA 1LQ9A 4DCPB 3ENVA 4LSNB 2LLZA 4USIA 3BS9A 4BC7A 5BXIA 2R7UA 2Y0BB 1TKTA 3G82B 2VFUA 1FF2A 4CTAA 1RU2A 4ZIVA 3JSYA 5CYQA 2I2YA 1TL3A 1RAFB 3MECA 4Q0BA 2B4OA 1Y5NB 2MMYA 4OJ3A 1RAOA 4KYZA 2OEMA 1TKDA 2HFSA 1R6YA 2W2NP 3PR5B 2V4JB 1HR0J 1OSCA 2G2ZA 4YDDB 3TOQA 3PEHA 4F4AA 3UD3P 2MZQA 2W2PP 1IKYA 4P6QA 3DHXA 2CWKA 1YHQS 2VOPA 3NBPB 1FKPB 4ZCMA 2Z2YB 5DS7A 4O44B 1JKHA 4DQRA 2MHEA 2LA4A 2YQ0A 2YH1A 2FYXA 3FBBA 4TQSA 2JEIA 3T9NA 1HYSB 1GH8A 3VAKA 3LPEA 3QIPA 5KG3A 1CJVB 4J9MA 4UY8T 3MPYA 1OY9A 2CDRB 4B3OA 3GFZA 5SUHA 4EWTA 2KFYA 5CYJA 1IUJA 5D77A 2JJ4D 1U48A 1NBEB 3RRGA 2WVEA 3M6UA 1U26A 3BN7A 2J0QD 3V4IA 5L46A 3CCJS 4JV0A 3OXGA 1OQ3A 1SXLA 2RVJA 1RT7B 4XO0A 3OR2A 1V3ZA 3NMRA 2NPIA 3BQ1A 4HL9A 1TR0A 4B3TJ 1NPPA 1Z4UA 2HS4A 5B0FA 3W7BA 4F67A 1FDBA 4YR2A 9ATCB 4E2FB 3EGVA 4LIRA 2Q43A 1NSKL 4IFYB 1HMVA 1HI8A 3NWRA 3KK2A 3QBCA 1HNIB 1VBZA 2ZH7A 4PAAA 4QU7A 3DU6A 4NEYA 2OPQB 2KL8A 3QO9A 3HCXA 4ID5A 4WXOA 4A8OA 5D0RA 5HLFB 2CQ2A 1S99A 3ET6A 2CWXA 1HWJA 1QM9A 3R2CJ 5GVQA 3CMQA 1T9VA 2HHVA 2C1EB 4ECSA 1VMBA 3AB2B 1S1WA 1S59A 2IJFA 1RJJA 2B4PA 5T41A 1SUQB 4HR2A 1H7WA 2WBMA 3VQSA 1NK9A 2IC3B 3LUYA 5KFNA 1CQNA 3MMCB 1WKJA 1GMUA 2GQQA 1N36F 5HBMB 2PA8D 4USWA 1H3DA 4LVNP 5M2RA 3T1YF 4B9TA 4KAIA 2ZZNA 5J2QA 2KYXA 1HHSA 1S5ZA 1NPRA 1JLCA 3GG0A 2RRNA 2MKJA 3IS9B 3MAAB 3EVWA 3UNGC 1XK8A 4AL7A 2DISA 2YKMB 2KT2A 2PI4A 2PDAA 3H59A 3LAKA 2GO9A 2GVDB 4H4OB 3V6KA 2AGOA 3CDEA 2KFZA 1DARA 3BGRA 4ZVRB 5HATA 3GIKA 3K58A 4ZP7A 5LL6d 1U4BA 1RWKB 4FKXA 1IBMJ 2NCKL 1HD1A 1NKBA 4ELUA 5J1NA 2QIFA 1FTRA 2KJVA 1J5OB 3Q24A 2HWTA 1TAQA 4LRDA 2QLXA 3Q0AA 2JH3A 2ZC4A 4ECTA 4OZ5A 3ZZ0A 3I5CA 3H5UA 3KTQA 2FY8A 1GMVA 3ZXWA 2ROPA 2OPSA 4I1TA 1QTNB 4CLUA 2KU7A 4M5JA 2B51A 2VBWA 4TLRA 4LF8F 4TVAB 1OO0B 1M1GA 2PO4A 4PG6A 2LEAA 2LCWA 3D2WA 4A8MP 4EZ6A 1R3NA 4QYZK 3RW6A 3ZZYA 1KSPA 2EVZA 3HPOA 1VQOS 1RA6A 1NEEA 2OPRA 3HHKA 2E66A 2DGQA 4ZLNA 3FQKA 4Q44A 4ZMMA 4I6WA 3W1YC 1WHXA 2DTJA 2M88A 4PWWA 2JEJA 3LO3A 2EPIA 2H5EA 3LP0B 4JBCA 2CJ9A 2OMOA 2CPFA 4F2RA 3WZ0A 2IM0A 3OTOJ 1NRKA 2HHUA 4RNFA 2PEHA 4TN2A 3G96A 4CLYA 2DXEA 3CJ4A 3KMQA 2L08A 3C66A 1KD1T 3MOJB 4HH0A 2VBYA 3HKZD 3SV4A 1IBMF 4DL2A 3RBXA 4Y0FA 5EUHA 5KFPA 3W65A 3FVYA 4RW4B 1DFDA 4EO8A 5K8PA 5E3AA 4JI4J 2MQMA 2UXCJ 3ISZA 1GXUA 4ECQA 1ZM9A 2N3LA 4MH8A 4Q45A 3SEOA 2WW4A 2WVDA 3EE3A 4FVMA 1CBKA 2M52A 3M8SA 1PC5A 2E5GA 4L75A 2R7SA 4JI1F 3PW4A 3ENQA 2LXUA 2IDEA 3PHTA 1M0SA 2GNKA 1U49A 3MI7X 2BE9B 1WHWA 3C6TB 4JI5F 2AP6A 2VKZG 1FRIA 1N33J 5K8OA 1YDLA 4WXWA 3AT1B 2BM1A 2YKAA 5A6WA 3PCOB 3DI6B 3TEGA 3MDFA 3KLHA 1AZSA 1UVJA 2NZ4A 5ETQA 2X7IA 3K8VA 4YR3A 2R42A 2HNDB 2LDIA 2DRAA 4F0MA 4LFBJ 5J2PA 1U1OA 1RB0A 1PYSB 2L3MA 2V8GA 2IVMA 4EBDA 3TARA 3HF5A 3SBMA 4J9SA 5D4PA 2F65A 1XNQJ 2IYIA 3HJVA 4M8LA 4P2MA 4N47A 5KFIA 4CLFA 4I56A 1TU0B 3HHDA 4LIWA 1WUUA 1KVIA 4C48A 1NK0A 4FF3A 1Q79A 2W4DA 3FBCA 1EQMA 2WB1D 3T6JA 4DV1J 3CJ8A 4RNMA 4PUOB 4KHMA 1KVKA 4LF4J 4N5SA 1E6VB 2VG7B 3LP1A 2HFNA 2E29A 4DX7A 5JUMA 1JMTA 3ISNC 3LF0A 1VQ6S 1GXTA 4M5DB 5KT5A 1DURA 3J80U 1ZM4A 3GCWP 3NRBA 3CCLS 1VCTA 4NOHA 1JJ4A 2F5GA 4WTOB 2K3KA 2UXCF 1TMJA 4MT1A 1EZZB 4WBFA 4HACA 1FNOA 3SDEA 2CJAA 1X4AA 4B3RF 3H0PA 2RT3A 4PXDA 2R8IA 2XSJA 4FBTA 3BF4A 3CCQS 2DNMA 4TNOA 1VK8A 5A8KB 4C0OC 5GAHU 2MLXA 4O4GA 3MEGB 1N33F 3TA1A 4NLQA 2Z2ZA 4NCAA 4QIGA 1IWGA 1NK7A 1B7YB 4GVBA 2DHHA 3NGRA 5F8IA 1RA7A 3MEKA 2ZD1A 3TUJC 4RW8A 1LWFB 3W61A 3QWUA 2PA3A 1I51B 4F0KA 2VKRA 3NKYA 2CDQA 4JV5J 3N5FA 3ETMA 4OYZA 3RRKA 4JYAF 1OWXA 1HBMB 1XNQF 3ADAC 4FYXB 1UCNA 3DOMA 3BSCA 3KOAA 5HSPA 3C2PA 3I56S 1RHRB 3QZ7A 1HA1A 1UW9A 4IR9A 3VAIA 4J9OA 4NLWA 3GYXB 4EBCA 4IKAA 1RT2B 4DPXA 3D6TB 2VD3A 1XWLA 1SH0A 4DV1F 3MMBA 4NCGA 5HK4A 4DQPA 5ITHA 2ZBRA 1R27B 4ZP9A 1RT4A 4LMZA 4DN9A 2IAJB 4WKRA 4UUXA 3CDWA 1S0NA 1TV6A 3HJFA 1TL7B 1NJIT 2XLKA 2LXFA 2FUG9 1JX4A 2HHTA 3QRQA 2LEBA 1KTQA 4R0EA 4KGVB 5L1LA 1HW8A 3BSAA 4F50A 5L9XA 3GCXP 1BQNB 4DR6F 3H8YA 3M2VA 3TA2A 2N3OA 4FS2A 4PPZA 3UDLA 1P27B 3B54A 3GSDA 4RUHA 3G6VA 4DR5J 3CW2C 4KHPJ 1T11A 2ZM6F 4OLOA 4A8XA 2YWGA 5KFHA 2CPHA 2MY8A 3LGMA 4J90A 1X31C 3TZYA 4F25A 2DNRA 1TKXA 2GVZB 4CLWA 4O3OA 7FD1A 2XWXA 3K59A 2YBVA 3IM8A 4F3OA 5IQQA 4ECWA 4HTJA 4I0WA 3R2DJ 3CC2S 3C46A 3UVJA 1S12A 2X1AA 2EG2A 4DDFA 2ASLA 4JI6J 4LF1A 4RUAA 5E2QA 1GEHA 3E01A 3MM9B 5HP1A 1R43A 4FF4A 3A1YG 1ZM3A 4L74A 2KRBA 2B5JA 3FNNA 3BO2A 1LXJA 2C2OB 2BVZA 2NXUA 3A13A 5ETRA 1G3OA 3H2UB 1Q81T 2E5JA 1IKWA 1FD2A 4KB7A 3MCNA 2MDAA 5IFMA 4OQJA 2GQ2A 1M5OC 2RRBA 3N6MA 4GO5X 2O01C 2CG4A 1QAYA 3OL6A 1FJCA 4G6VB 3K8WA 2F8EX 5E5NA 1VYAA 2AWZA 4XDCA 3B78A 5F0WA 2CUYA 3G82A 4FYDA 2AJ4A 2CKWA 1T03A 2UUCF 1VLOA 2ZKUA 4UOHA 1NHKL 1UL3A 1U2CA 3I0RB 4EMDA 4KO0B 1WEXA 1LK7A 4ICLB 3GONA 1YI2S 1S76D 1J2VA 3NBPA 4ZVTB 2IMWP 3OJSA 5F0UA 3R6GB 1QTMA 1IR0A 3VAFA 1U6FA 1GXLA 3V6DB 4FF1A 3T5JA 1BLUA 1SKSA 1CJVA 4NLSA 3DU5A 3CJ0A 2HMIA 2KXNB 4H4KA 3OHBA 1RBAA 1UZHA 4TQRA 1RAAB 4DQSA 2U2FA 5E3PA 5CYMA 4I7FB 3AY0A 3PRBA 4USHA 5THWA 3NS5A 4O23A 2MQNA 2ZDOA 4LF6J 3F41A 1FJEB 3UQSA 4DMZA 2ZE2A 2M3DA 3M30B 1YRTA 2BW2A 4IFVB 4Z2XA 4P52A 3JYTA 4TLQA 3DHWC 3UN5A 3CJ5A 2A0FB 2AYBA 3M1VB 4KRWA 2HNZB 4C98A 3CMES 2A1BA 1ZH5A 1VHFA 5KG6A 2RKIB 1C4CA 1EHWA 1JWWA 3ZZRA 2BZ2A 2CVIA 4IFYA 2AYEA 4DBQA 2E5HA 1YK9A 2W7OA 1UW4A 4ZPTR 3OLAA 2RE1A 2V4QA 3HFKA 1VQ5S 1YRUA 3VHQA 3THTA 1CPZA 1PC4A 1RISA 2OPQA 3RR7A 4E8UA 3K2YA 2LXIA 1ZZNA 3FBFA 1QLNA 2E1AA 2FHJD 1SV5A 3J7YU 3I5BA 1K0TA 3MR2A 3QT7A 1Y9OA 3ZTQA 3IXQA 3I6PA 1F6TA 2B9XA 3H5YA 3G4SS 5KG4A 2UUTA 1ZTTA 3Q8YA 2FVRA 2ZNYA 1S0MA 2HIYA 1FTCA 5LJ3Y 2H65B 4QYZJ 1QD1A 2VHGA 2IC3A 2ZVSA 2E1PA 1S9EB 2HBZB 4P75A 3CEDA 3MMCA 2GJ2A 6FDRA 5HBMA 3K5OA 2BDPA 2Y1RI 2BKPA 1RADB 2NYHA 3KJNB 1NDPA 4K0KJ 1SC3B 2UVUA 3KHLA 1GX6A 1Q1KA 3O3LA 3TAMB 3M9MB 3NCQA 1KONA 3RB0A 1X4CA 1FESA 1WC5A 2D3UA 3HHLD 1LOUA 4B9SA 3V2UC 2YKMA 1WWHA 2VPZB 1D8ZA 2ACYA 4X65F 5F8LA 1KFDA 2H4YB 4Z7CA 1LWEA 1M1HA 1T02A 3MMAB 2DH9A 1CC8A 2JSXA 3J7AN 2QX0A 5B0EA 3DLKB 3FRYA 4Q8FA 3BR8A 2CRLA 2QLFB 2H48B 2D3OR 1CULB 2BKOA 3T6BA 1Z2ZA 1S6UA 2F3JA 1FO1A 2IDLA 3AXKA 3C19A 4KKOA 4O0NA 5LMUJ 1FA0A 2FC8A 3CVKA 3JAMY 3SQOP 4PEOA 2E5IA 2YWKA 2XY7A 1FI4A 4ZJLA 4F8RA 3MXHP 1KLMB 1L5UA 3JAMU 2FLNA 2C3PA 4UZCA 3CC4S 2LP4A 2QG9B 1D3WA 5KFWA 5HVFA 3QWPA 2VH7A 3EYZA 3LP0A 1HW9A 1Y00A 2I1RA 1QAIA 1IM4A 2DXFA 5HVGA 2WSEC 1FFSB 3RTVA 1S1XB 2CAJA 3DCAA 1JLBB 1T05A 4XAKA 3AQPA 1TL1B 1LEOA 3IBWA 1FE0A 4KGXB 1VQYA 4C7QA 2XS5A 4AYBD 1UVMA 4N7TA 2UV8A 1PAUB 3DRXA 1WSVA 1UEUA 4P10A 1IBCB 2GJFA 5D4LA 3RB6A 4RW4A 1P1LA 2E1MC 4LF7J 3PRDA 2XI2A 2V8HA 3I5AA 1SJ3P 2DR6A 3ELHA 4UTGA 3K5NA 2C22A 4A46A 2F9JA 5A6PA 4CH0S 1MN9A 1ULRA 2D3O1 2CJYB 2C2KB 3M05A 3ENWA 1M5PC 4QBUA 1YGYA 1F9FA 5K8NA 2L9WA 3VF0B 1VLYA 5FD1A 4PWDB 3C6TA 4V19X 2PMHA 2UVRA 1TVRB 3GV5B 1FNMA 4UF4A 2Z58B 5KT7A 3SCKE 3W62A 4KJIA 2FJEB 1CSJA 4D3GA 2J6SA 2HNDA 2KT5A 2CZ4A 3C6UA 1S9FA 5KT2A 3OTCA 3OT9A 3IAS9 2QT7A 4ZITA 3W5YA 2L9DA 2D9PA 3DDNA 3TQ1A 1DZ5A 3DXSX 2CQHA 3CMAS 3DGVA 5C5JA 2QN6B 4PUOA 2DR9A 2V6AA 1RTDB 2VG7A 1I1GA 2ASDA 3FSXA 3S7RA 1E6YA 2Y0SD 2F8MA 1VBXA 4IQXA 4M5DA 3QGPA 4CT9A 5EN1A 4EK2A 2M5YA 1BC6A 2HNYB 2ROGA 2YNFB 3QIDA 1N6QB 2H3EB 2AJFE 2YWWA 3B4MA 4ZPCA 2UXBJ 1R8PA 3FSIA 2DNYA 4ECZA 1T8EA 3KLFB 1NPKA 2IRYA 2VF3A 3L7PA 3TWZA 2CPIA 2J9DE 2FY1A 3K17A 3RAXA 2RMLA 1IBKJ 3L09A 1JLEB 3BV8A 4P2SA 5A8KA 3IR6B 3HDSA 1KOHA 1K44A 3DDKA 1XMQF 3FUYA 4DUTA 4RUCA 3W3SA 1HBUB 3LALA 2RQKA 1WF1A 4IOBA 4ED8A 4DXLA 1QSYA 2RHSB 4DUYJ 2Z8QA 1Q7LB 2MXYA 4OYOA 1R0AB 3EX7B 2H9ZA 4MMOA 5AE3A 1U6ZA 5LT5A 4J5OA 1OQ6A 3LP2B 3WIUA 2CIMA 5RUBA 3M6WA 3GIJA 4K5RA 4N8OA 1HBMA 2VOOA 2B9WA 2NXEA 3IWNC 5JVGQ 2LQ5A 1Y10A 4DR3F 4ZPWR 5FJ4A 3TP2A 1CJKB 3Q8UA 2XS7A 3MAQA 4DOZA 1RWMB 2HPUA 4IUFA 2EBEA 1NXIA 3EPIA 4Q8EA 4W92B 4YQWA 2NS1B 2FGOA 2P2CB 2IAJA 2NZCA 1S10A 1W7WA 2J8AA 2MQQA 3RW7A 5J1PA 5LSLA 2CZVC 2RH3A 2YPYA 5KG2A 3DYAA 2I38A 4ILRA 3I31A 1FXLA 2GO8A 5A2QY 2FIUA 3R7SB 2HBRB 1U1KA 3T1AA 1BQNA 2BEFA 4ZVQB 4H54A 5J1EB 2EFPA 1IWAA 2XYGB 1H73A 2H5JB 3QLHA 2V8DA 3HVTB 2B56A 3J7A1 2EI5A 2OIHA 3UDCA 4ZVFA 5CZXA 3WIVA 1V6HA 4Q2LA 4ZCIA 2R2UA 2GW8A 3EJMA 4YMEA 8RUCA 4OX6A 3FBEA 2GVZA 4GO7X 4G65A 3TAQA 1AROP 4U6PA 3W8GA 2CQDA 4ECYA 2F9DA 1U6BA 3W63A 2DCUB 2D69A 4DV0F 2IRUA 2XSFA 1RU1A 1NCLA 2HGNA 2IIHA 1X60A 1FKAF 3O44A 5DDOC 4U7CA 2C42A 3PACA 1RT1B 2VA3A 3FEYB 4DG1A 3P96A 1U8SA 1J27A 3QAUA 3K5LA 4DR4J 3PY8A 3KMSA 3AOAA 1LNQA 4L72B 1X5OA 2UV8G 3GJSB 2W9CB 2ZNZA 2J6UA 2VB6A 4NYOA 5I3QA 2GHPA 4YY3F 4ZJQA 5DG8A 1S7IA 5DGAA 1JLQB 2L48A 4NX9A 4ZVGA 3VZHA 4DHVA 4M5KA 3SIPB 1FJGJ 1TK5A 2EG1A 3L7UA 5D0EA 2XGQA 4IO9Q 1S48A 3FZ2A 2NXNA 2YNGA 4LBHA 4KTQA 1ITPA 3BYPA 5JVHQ 2AYGA 5DQGA 3PJ9A 3NMAA 3IFEA 3NOGA 6FD1A 3N79A 2RRAA 3I0RA 4TYBA 2VQFJ 3GJQB 4DV2J 4ETZA 4KO0A 3MPDA 2CPEA 1U45A 4A8WA 1K73T 4CDIA 1QVFR 1KRPA 1MN7A 1K1QA 2LFVA 3ZTRA 4QW8A 1WC0A 2J7KA 3KJVA 5H1SV 3HSZA 4NXNF 3EM1A 2NLWA 2C2RA 3PM9A 3V6DA 4YEAA 3I82A 2EFNA 3ILOA 1IN0A 2D9OA 3QGGA 5K20B 3L3CA 3GIIA 1PYOB 2XMKA 3MD1A 2XLJA 2RQMA 4C9DA 2EK6A 3BYRA 3M2RB 3QSYB 3K7RA 3ETOA 2UUBJ 2HAFA 4OI0A 4OX8A 2XTJP 4QCLA 5F41A 2V69A 4EI2A 1UVLA 4LF2A 4MIWA 3NS6A 1U1PA 3HO1A 1I5OB 4RW9A 4FP9A 1XNRJ 2J7WA 1PO6A 4P7TA 4OYXA 5IOLA 1V9OA 1FDAA 1H7XA 2YX7A 3CIMA 3MM6B 5E0OA 2BJEA 2CNLB 1EX8A 1R0BG 2B8QA 4I6YA 4DI6A 1QVGR 1RCOB 3LOUA 2HZAA 2W2QP 1VQSA 2QA4S 1EKSA 5IV3A 1RTZA 5F8MA 2P8IA 4OIXA 2CQIA 1GTEA 3ZTPA 3W5ZA 2B43A 3DLBA 5HANA 4V1Ak 5I4MA 3CCES 1O6XA 4DV4F 2VQFF 1KQGB 4ILLA 3MM5B 4DR7F 4PG8A 3Q2TC 1UWBB 1JK9B 2W7AA 1RHKB 2DNPA 3VZIA 4LRCA 3JQMA 2HFZA 4U67Q 2K3IA 1N56A 3PDNA 4RLEA 2MTLA 4A8SA 1Q8LA 2OI2A 1GMWA 4LUBA 2BACA 3L95X 1ZAXA 5KFAA 5U47A 1DQAA 1HD0A 3N6NA 3DLLQ 5IQ6A 3G71S 1S9EA 1RT6B 1NK8A 1N52B 3BB5A 4OI3A 1X9SA 4TY9A 4URGA 1DAXA 3CJ3A 3G87A 5DETA 1UJ5A 4Y2AA 3ICLA 2MKSA 3ITHB 3KHRA 2HVEA 5KFEA 3TAMA 5KFSA 2M7SA 2N4CA 3ZO7A 1OYDA 4PPDA 4C0HA 3CPWR 1S57A 2QC3A 1MW7A 4JI7F 5A8RA 3CD6S 1U0HB 1UFKA 3A3PB 4QR2A 1SL2A 3IA0A 5IWAJ 3RGIA 2A2DA 2E9ZA 2IY5B 2KZZA 4NLTA 2IYGA 4HKQA 5D4NA 1VS3A 2N7CA 4X4QA 2CYYA 4AL5A 3MMAA 5C25B 5F8JA 1VJQA 3NAIA 1BHNA 3NGUA 2QRRA 4PWUA 3DLKA 8ATCB 1Q53A 3D6HB 4P71A 2ZHOA 1N4LA 2K2PA 3P49B 2EK1A 4F36A 3KLGA 3OFFA 2ZWOA 2YNIA 3ZNUA 1ZPVA 3C15B 2ZC3A 3B8HA 1CULA 4GKJJ 2PI5A 3UN3A 2J9CA 2WVBA 1U09A 1VGYA 4DR2F 1RLCL 5D3GB 2FJVA 5HMXA 2ZFHA 5AJ3J 4ALZA 5KFLA 4R0JA 2OMLA 5HN0A 1IBLF 2DNKA 3LQVA 2HBYB 4O3QA 1CEZA 3B4DA 3M8ZA 1ZM2A 1TK0A 4MYTA 2MSTA 2KI2A 4DV5J 2QA4G 1VQLS 1X4HA 3HD1A 4JV2A 1YJRA 3HT3A 1KLMA 3MMJA 4ECXA 2CQPA 1UVIA 3BGUA 2ZBQA 1Q95G 1OJ4A 2QFJA 5EX3A 1DRZA 1RGVA 4OI2A 1IQTA 2GFFA 4RPFA 2MGZB 4DCJB 4F4XA 2DGTA 1S1XA 4JI3F 5I3PA 2HGLA 4YDXA 1JLBA 1JLGA 4QIFA 3HFVA 2A3JA 2V9WA 1T94A 2NXJA 4NLVA 1GT8A 2VASA 2XC9A 3PZPA 1TL1A 4MJKA 2Q66A 3QT5A 3CCTA 4B3MF 2RF2B 3Q2SC 2MJUA 3FRZA 5CZVA 5L8RC 3ISND 3JSMA 2RDIA 3RAMA 2POKA 5IWAF 1EIYB 1V3SA 3IP0A 4J9RA 3PX4A 2L9NA 1KQFB 4Y65A 3NGTA 4QU6A 2D3ZA 2AX0A 1S77D 5LSOA 4ZCLA 4JI0J 5D15A 5ADZA 2D74B 4WFYA 1YKWA 2PT0A 4USJC 4PR6A 2CQ0A 2R7RA 4PCQA 4I69A 2OLWA 4XPEA 3KDNA 3V81B 3NNAA 2K7KA 1XMBA 4DPYA 2XYHB 3THVA 2MLYA 2XULA 4I2QB 2PN6A 1TVRA 2PMZD 2OEKA 3V4MA 4CQ1A 1N5YB 3DOLB 2CQCA 1KBRA 2RU9A 4C8KA 2QV6A 1JLFB 3ILLA 1HNWJ 5LXYA 4B9MA 1NHVA 4C8MA 1ICEB 2BYCA 4CLTA 1DLOB 1RHJB 4F04B 1XR5A 4KC5A 5C2GA 1N5QA 3BM7A 3HD2A 1ZTWA 3CJRA 4PZVA 4CLLA 2BKNA 4DLGA 4CM0A 4FXVA 4F7VA 1RWVB 1S72S 5IXUA 1WG5A 1NM2A 2BXJA 3QFHA 1SJQA 2BBEA 1RTDA 4IG0A 2XCAA 4NLDA 1QSSA 2G2OA 2V50A 5KT6A 2HYIB 4CO4A 4OHZA 3HZEA 3QATA 2G0JA 4CO5A 5HMYA 3AH6A 3RRHA 4I6AA 2OD4A 3VR1A 2B4UA 4JI0F 3CTRA 1DQ8A 4Q2MA 5KG0A 2ZEJA 2W9AA 2MHNA 3OVAA 1IVZA 3FCWA 2E5LJ 4LQ9A 4B9VA 3CCUS 1B3TA 2YKNA 1XTZA 5BYSA 3KHHA 4LFAJ 4FXDA 3EPGA 2W8LA 4OZ0A 2EEYA 1RT3B 4K50A 2J9EA 2OP5A 5GMKa 3JSBA 5T7LB 1SL1A 1RT5A 1T95A 5CQGA 1HNWF 1MROB 2BE2A 4P2FA 3IG1B 3LP2A 2HG4A 1YSJA 5DLGA 3RBEA 3CNQP 5IT0A 2FLPA 5C7PA 3DRSB 1D1UA 4M1KA 1D0EA 4RW7B 5ETSA 1TAUA 5BR8J 4RX6A 1L3TA 3DOKB 5FLXY 2DHXA 3DLGB 3CWJA 3B6BA 2ZH3A 1RHUB 2Y1JA 3QT6A 1Q5VA 3RB3A 1R31A 5E41A 4EGLA 1SIWB 4G1PA 2JLFA 3LW5C 2VPWB 2HZCA 4IH5A 4Y2IA 3BBBA 3FSYA 3NGKA 3CULA 2LU1A 1S6PB 2W25A 5B0BA 2AYMA 1C1BB 3DLEB 2VC0A 2Z4PA 4C8OA 1UVKA 3LPYA 1SC1B 1EETA 2BRKA 3A8JA 1RKIA 1MLAA 2FJWA 1KOOA 2VBZA 1C1CB 3HFZB 3IAM9 3UO0A 5J1EA 2HWHA 3SSQA 4J91A 1RE1B 3MUTP 1PJ5A 2ZDPA 3VAJA 2DY1A 1YVFA 5C24A 1YJUA 2FLOA 3VCDA 3S01A 1M5SA 4ILMA 3CC7S 4ZVUB 2V9KA 3MM7A 4ID8A 3HVRA 4BHQA 2VIHA 1RABB 4LFAF 1H98A 1T3NA 4L76A 2KKHA 4IR1A 4NZ0A 1S9GB 1FEHA 2YQ1A 4RWWA 1HPZA 5BYQA 1NDCA 5HJYA 1B7FA 2KH9A 4MTPA 2AEMA 3PKYA 5C42B 2KRRA 3CJ2A 4LR9A 4OX9J 3F0NA 5K9FA 1W2IA 3BZQA 1U2FA 2Y1IA 2AQ4A 3E2EA 4RNOA 3BQ0A 2UXDF 2ZOGA 4U8VA 2ZITA 3BEGB 3HVWA 2FVQA 1OY6A 2OH2A 2MPUA 2GQCA 3E8OA 1F60B 4U95A 4UUWA 4O3NA 2O67A 4DEZA 4OV1A 4DS4A 2YNHA 4MFBB 3X3UA 3HMJG 5D4OA 3UN2A 2DHAA 4C8LA 1M90T 2XZDB 3R8YA 3O5TB 2HVIA 2D7SA 1BGXT 1U24A 5AXLA 3Q89A 3W2WB 1W26A 1YQHA 1WC1A 3PG9A 2PMWA 3H90A 3VVTA 2AZ3A 3CD5A 3JS9A 2KZMA 2HAIA 5ETKA 1APSA 3TRGA 1L3VA 2Z57B 1RTIB 4BWMA 4L6V3 2C2NA 4V19J 4CO2A 2G4BA 5IS2A 1XBWA 1P8GA 2JC0A 2MKKA 2XBPA 3M9OB 2MJNA 3MHYA 3MR7A 2RIJA 4G1QB 5T14A 1RWPB 5GADU 3TVZA 2IRXA 5EDWA 4WP9A 2UU9F 2KVQE 5E3CA 2JVRA 3AJ2A 4ANEA 3CCRS 3TVYA 3AJ1A 1Q5YA 1VC0A 1T9WA 1NKEA 2IFXA 3UR3C 2V2KA 1K0VA 1MSWD 3PHEA 3MD3A 1S0OA 5DO2A 2AGQA 3NCPA 1H74A 3TAPA 2LQJA 3TZZA 1WKLA 2RD5C 3D3CJ 5CAAA 1C2PA 2VFTA 1YX2A 3NGDA 2FQQB 3OXLA 1UP1A 3M8YA 2GA7A 2ZZTA 2R7TA 1SQFA 5L1IA 3GQCA 1C0UA 1H6KX 2ZH2A 3PFOA 1RDRA 4P74A 2IMOA 2KN4A 2YXLA 4AQYF 1KHWA 1RBLA 2R8KA 3CE8A 1AUDA 2MKHA 1REVB 4JUZA 4M95A 3MM6A 1HNVA 4L3NA 4NLYA 4CLZA 4DSKA 4FVCA 5A76A 4EZ9A 1FWLA 4IYQA 1RCXB 3CJKB 3V6JA 4P72A 5DM6Q 1NLKL 2E44A 3I4PA 1NB2A 4EUVA 4WYLA 1QY7A 3HVAA 4URSA 1QDUB 2DK2A 2F7VA 1ZA2B 1N36J 1HNXF 3T1YJ 4KPCA 4C3KA 4DV6F 3EVOA 1YJWS 4GKKF 1UWBA 3T5KA 3VTIA 2CJBA 3MZIA 1QUVA 1Y3JA 1R6VA 4BS2A 1HQUA 2DYAA 2NSBA 2BW7A 2GMLA 4IG3B 2F4VJ 2V0NA 2DEIA 4A8FA 3JB9k 1AA1B 1RT6A 4DX5A 3GFYA 4USVA 2NUUG 2MSSA 4F2SA 3C14B 1S1UA 5L1JA 3R9LA 2CQ4A 4ED7A 4DUZF 2HK3A 4DF8A 3ITHA 4PQAA 2CPDA 2DNHA 1AW0A 4FYWB 4O3SA 3GPAA 2XLIA 4U9RA 1UEKA 4KBIA 4CIOA 4ED2A 4NA3A 2Y1LB 3KK1B 3ZZOA 3OVBA 2B6AB 2RJZA 2DGWA 4LF8J 2W2MP 4LFCJ 2MKIA 1UA0A 2ZZMA 2E1RA 2QGFB 1TKTB 4CTAB 7FDRA 2CXEA 2ILZA 1FXDA 5C25A 4R5PB 2R7QA 4NXMF 1VRUA 3HSDA 2O1PA 4XPCA 2K06A 3CD0A 3C16B 2CFXA 8AT1B 2HLTA 3C15A 2NUHA 2F8HA 2KT3A 4Y2MA 2LYVA 1NH7A 1YZ6A 2WZ1A 4MK8A 5D3GA 3W9IA 3G6YA 4KV8B 3UWTA 2IA0A 3KUHA 2EBGA 5FDLB 1TUGB 1BWEA 2DPIA 1FXRA 4HHJA 2XO6A 3V6HA 4IH7A 2FVSA 1D9AA 1BE4A 4IRDA 4B3OB 4C3MA 2DXDA 2F4VF 1NK4A 3D1QA 2UVWA 3HLUA 4K4TA 5I3UB 3QNWB 4B3SJ 2CQGA 4YB1P 3V4IB 3PV8A 2MGZA 3M6XA 1N54B 2J0XA 2OAUA 3KUGA 4PRFA 3H4DA 3M4XA 1YRXA 3TQEA 2Z2MA 4JI1J 1YWXA 3QFWA 1T9TA 2RF2A 1CJTB 4JI5J 3MR6A 2DNNA 4C8ZA 3CDBA 3PIPQ 4WFAQ 4LFCF 1UFWA 2E9TA 4FDFA 3KK2B 5I42A 3KUEA 3WX4A 4E0DA 4HVZA 4OZJA 2AJ1A 3R5BA 1OIAA 4WWSA 4BC9A 5GAGI 2WVFA 1N48A 3QAEA 3EGZA 3CCZA 4TY8A 2F1FA 5JMNA 1F2GA 2Y9HA 5E3RA 5MAOA 3OTBA 4MYUA 4HHUA 1WORA 4TXSA 3V81A 4WPAA 4RNNA 4M5NA 4C11A 1EAYC 4WK1A 1PKUA 3KLIB 4NI2B 1JLAB 4DV3F 4DFMA 4BCAA 1ACMB 2QA2A 3T1HF 3UDVA 2JRSA 4NPOA 1N5YA 3DOLA 3OLBA 2A6MA 1VC6A 3RZAA 5GAEU 5KFQA 2YH0A
chains in the Genus database with same CATH topology
3NCRA 1N5SA 3DRPA 4ZVHA 2VBXA 3SSRA 1QSYA 1X5SA 4ZLPA 2Z8QA 2HVHA 1Q7LB 2MXYA 4FNIA 2IA6A 1P1TA 3OL8A 4ZPVR 5AXKA 3EX7B 1R0AB 4UY85 2Q6BA 4YFUA 4DJBA 2ASJA 3MM8B 4OJGA 4MKAA 1S1TA 2H9ZA 4MMOA 5AE3A 1U6ZA 4ZPDA 3OL7A 3UCUP 5LT5A 4DN0A 2Q1LA 5F8HA 4J5OA 1WEZA 1OQ6A 2DPJA 3PO5A 3LP2B 1TKXB 2GJIA 1CG2A 2G0CA 2GGPA 4B3SF 4Y6IA 3M32A 2DGUA 1LW0A 2CIMA 3G8QA 4RW9B 2D1CA 1DHMA 3T5HA 2YWEA 3M6WA 5KFXA 3GIJA 2RS2A 4K5RA 4N8OA 1HBMA 2VOOA 1X5TA 2B9WA 2RS8A 1O0PA 2FVCA 2DGXA 3SFUA 2GV1A 2J5AA 4QZVB 1NO8A 1U1LA 3IWNC 5JVGQ 3ZC4A 4AE5A 1FKOA 2LQ5A 3MPVA 2M2BA 4NLPA 1PSDA 4DSFA 4Z37A 3MAHA 3IC1A 4DR3F 4ZPWR 5FJ4A 2B4VA 3TP2A 3IRXA 2Q79A 1QE1B 2XS7A 3T3FA 3MAQA 4DOZA 2FLLA 3ZFVA 2HPUA 4URQU 1QSLA 3ZZPA 4IUFA 2EBEA 1CQMA 1WTFA 5B0DA 3OHAA 3EPIA 1LFPA 2Z0GA 4IG3A 4HLBA 1JIHA 5CCMA 4Q8EA 1S6OA 4W92B 3M2UA 4YQWA 1HARA 4H4MB 2NS1B 3OXFA 2FGOA 3PVXA 5HP1B 4K4SA 3FCHA 4DWIA 2DVIA 1Q7YT 2E1CA 4I68A 2IAJA 4QOTA 4ZCKA 3QGHA 4DQIA 2CVEA 5KFOA 5CH7B 2P6SA 3W2VB 1S10A 4DFPA 2YKPA 2J8AA 4OLPA 3NG8A 1Z2LA 1T7PA 2MQQA 1HL6A 3RW7A 5J1PA 4HT5A 2Q6CA 5LSLA 2CZVC 1X4DA 2RH3A 2B5JB 5JJBA 1NJYA 2A18A 2UUWA 4X62F 1W2BR 5KG2A 4EYHB 4A47A 3DYAA 4ZDNA 4WCEQ 3UCGA 3HP6A 2I38A 4ILRA 3PW7A 3I31A 1FRJA 4PXCA 4JI8F 2GO8A 2FDNA 3KK3B 1FXLA 2OPSB 1F5CA 5A2QY 1Q8IA 4UQGA 4ES1A 1IKVB 3AHPA 2GX8A 4QWAA 2FIUA 2F40A 4HT7A 4IDKA 3MCSA 1U1KA 2OTJS 2W7PA 2KHCA 3T1AA 4KHRA 4OHXA 5KFVA 2P9GA 4GC6A 5B08A 1TKZA 2XB2D 2AX1A 1BQNA 4DFKA 4X66F 4H54A 4ITSA 4I2PA 3DMJA 3SCIE 5L9NA 5J1EB 2EFPA 3KYLA 1SI9A 1G6BA 2ZH1A 1N0VC 3FJ2A 2U1AA 1FRKA 4LVOP 3I87A 4OX9F 2KTQA 4TKTA 4OZ1A 4QR1A 3QLHA 3KG1A 1H2UX 3MEDB 5HL7Q 2M8DB 1C0TB 4ZP6A 5DJBA 2HS0A 2V8DA 3HVTB 1LQ9A 2B56A 3UPFA 3ENVA 4LSNB 2LLZA 3J7A1 4USIA 3BS9A 4BC7A 2R7UA 2EI5A 4QWBA 3D54A 4PXBA 2OIHA 1TKTA 3UDCA 2VFUA 1FF2A 4CTAA 3J80Y 4ZVFA 2OKQA 5CZXA 4F4WA 3JSYA 5CYQA 2I2YA 1TL3A 3VALA 1V6HA 4Q2LA 2DHSA 2XG8A 3MECA 4ZCIA 4R8UB 2A2CA 2MY7A 2GW8A 2R2UA 4Q0BA 2B4OA 1MROA 2OTLS 4YMEA 4EYIB 3D1HA 1Y5NB 2MMYA 4OJ3A 3IG1A 4OX6A 4ZHRA 1TKDA 4GO7X 4EU0A 1R6YA 4X4TA 4LF6F 2HRUA 3TAQA 2LKZA 3PR5B 1FHTA 2V4JB 4DL3A 3FQLA 2KB2A 1AROP 1OSCA 4HEA9 4YDDB 3TOQA 5B7WA 4U6PA 4RW7A 3SXLA 2AD9A 2CQDA 3UE2A 4ECYA 2F9DA 1WEYA 3PEHA 4FS1A 3UD3P 2DNZA 2MZQA 4FZVA 1IKYA 4KGKA 4P6QA 1U6BA 3DHXA 1YHQS 3AB4B 2OJ3A 2VOPA 2DCUB 3NBPB 3DOKA 1FKPB 1VRTA 5IT4A 3B82A 4ZCMA 2ZBCA 4DV0F 5DS7A 4M94A 5DG7A 3VAMA 4DSEA 4GMKA 4O44B 1JKHA 4DQRA 2MHEA 4OFZA 2IRUA 2IM1A 3Q8RB 3VAHA 1YIJS 2LA4A 3M9NB 5A8RB 2YH1A 4TQSA 2JEIA 2XSFA 2MZRA 3T9NA 1HYSB 2HGNA 1UFLA 2ZOMA 3LH2S 4F4YA 1FKAF 4FXWA 3O44A 3VAKA 3O1LA 1GH8A 4PWDA 3WBZA 3QIPA 4U7CA 5DDOC 5KG3A 2C42A 3RB4A 2XGPA 4J9MA 4UY8T 2VA2A 3MPYA 3PACA 1RT1B 2VA3A 3FEYB 2PGCA 4DG1A 3OTDA 4B3OA 2YX1A 3P96A 4BBYA 1U8SA 3G6XA 3GFZA 5SUHA 2BM0A 4EWTA 3QAUA 4NLOA 4OHVA 5KFCA 1RK8A 2KFYA 2NR0A 4F3QA 1IUJA 5CYJA 1S6PA 3BREA 3K5LA 4PQUA 3PY8A 3KMSA 5D77A 1X0FA 1C1BA 4L72B 1X5OA 2UV8G 2JJ4D 1S49A 2W9CB 1U48A 2ZNZA 2J6UA 2VB6A 4NYOA 5I3QA 4OX7A 3RRGA 2GHPA 4YY3F 2XMVA 3M6UA 1B0VA 1S7HA 1U26A 3BN7A 1IKXB 2J0QD 3KLGB 3V4IA 3CCJS 5DG8A 3RBDA 1MNEA 2YNIB 2OPPA 2YVSA 3K57A 2QSFA 1H38A 2NQPA 5DGAA 5D8HB 4JV0A 3X1LB 1S1VB 5J2NA 3C8YA 3OXGA 1OQ3A 2QMWA 2X3GA 1SXLA 2RVJA 1JLQB 1RT7B 4RW6B 3OR2A 4ZP8A 4XO0A 1TFWA 1V3ZA 2L48A 3OFEA 4NX9A 4ZVGA 2DGVA 3VZHA 3MURP 3NMRA 4DHVA 2NPIA 3OBIA 4UOCA 3BQ1A 4HL9A 4RU2A 4ATNA 1O5JA 1TR0A 4QIWD 4DL7A 1DTTB 1V3RA 5DG9A 2XMTA 2XNQA 1O51A 5H9EJ 2EG1A 1TK5A 5K14B 3FEXB 2XGQA 4IO9Q 1S48A 1Z4UA 2HS4A 3LWMA 1LWCB 3N6LA 4JOUA 5B0FA 3W7BA 4F67A 1FDBA 4DL6A 4YR2A 3FZ2A 5G4DA 3HZGA 3QZ8A 2YNGA 1GAOA 4LIRA 4N77A 4BDPA 4KTQA 2WAQD 1ZPWX 3OW2R 5JVHQ 4F26A 1NH8A 5EWGA 2Q43A 3KLHB 2AYGA 4IFYB 1HMVA 3CO9A 5DQGA 1KEKA 5CA5A 2JLEA 3NMAA 1HI8A 3IFEA 6FD1A 3KK2A 1HNIB 3N79A 2RRAA 1VBZA 1KC8T 2ZH7A 4UW2A 3I0RA 4TYBA 4QU7A 2LU2A 2I0XA 3DU6A 3SSSA 1A7GE 4ETZA 4KO0A 2KM8C 2MZ1A 1S9GA 1WI6A 2OPQB 3RR8A 2CPEA 2HNYA 4A8WA 2YNFA 5D78A 1U45A 1K73T 1N6QA 1QVFR 1KRPA 2M9KA 3MEEA 1BY9A 5IM0B 2Q3PA 4K0KF 2LMIA 1K1QA 3QO9A 2DNQA 4QW8A 1JLGB 2ROEA 4PKDB 1BQMB 3KLFA 2J7KA 2DGOA 5D6GA 3KJVA 5H1SV 1GX5A 4ID5A 4NXNF 2JFDA 4WXOA 4A8OA 5DDPC 2LEPA 2W9BB 2FJXA 5C42A 2CQ3A 2NLWA 5HLFB 2C2RA 1FVQA 3PM9A 4GC7A 2CQ2A 3V6DA 2YQ3A 1S99A 4YEAA 3I82A 1HWJA 4ELVA 1QM9A 2M0GB 1JLEA 2EFNA 3N01A 1IN0A 5EGYA 2D9OA 3QGGA 1Z1ZA 5GVQA 3L3CA 2HHVA 2EFGA 1DTQB 4ECSA 2B3TB 3GIIA 3PNIA 2XMKA 3JSMB 3DNCA 3MD1A 2XLJA 1N34F 2RQMA 1VMBA 3PEJA 3AB2B 1S1WA 4C9DA 3FMBA 1XC9A 2IJFA 1RJJA 2B4PA 5T41A 1SUQB 2EK6A 3HI9A 2XY6A 3IWXA 3K5MA 3H2VE 1H7WA 3M2RB 4PG5A 2WBMA 1HBUA 3K7RA 1N8RT 1KN6A 2DD8S 3N0VA 3ETOA 4DQQA 3VQSA 1NK9A 1R89A 5KFYA 4OI0A 4NRTA 4OX8A 3A8EA 2ILYA 2IC3B 3LUYA 2K1RB 4Y28C 3CD7A 5KFNA 1HQEB 4QCLA 2MKCA 5F41A 1HBOA 1CQNA 3MMCB 3PFEA 1R0AA 2GQQA 2DBBA 5HBMB 1N36F 3LWLA 4WZMA 2PA8D 5G0RB 3N5BA 3SYZA 4Y34A 1MU2B 1UVLA 3T1YF 1H3DA 1H2TZ 4LVNP 5M2RA 4QPXA 4B9TA 2ZJRQ 4KAIA 2ZZNA 4I64A 4MIWA 2EKYA 5J2QA 3NS6A 1U1PA 1Q16B 3HO1A 2KYXA 1HHSA 1X9MA 2LQ9A 2P9EA 5FIIA 2G9OA 1JLCA 3GG0A 4Y2CA 2RRNA 2MKJA 3SDEB 1VQKS 3IS9B 3TUZC 3QJPA 2DIVA 4RW9A 2JC1A 1J5EF 4FP9A 3U27A 2IVYA 1ZAVA 2XWYA 2J7WA 2FJDB 2XSJB 1D8YA 1SJRA 3UNGC 1PO6A 2JEGA 4P7TA 1X0PA 1XK8A 4AL7A 2VFVA 1V9OA 1MMLA 1FDAA 1QUPA 1H7XA 2DISA 2I8EA 2YX7A 3CIMA 5LMUF 3MM6B 2YKMB 5E0OA 5HMWA 3OUYA 2BJEA 2KT2A 2PI4A 2C3MA 3T19A 1RTHA 2W4PA 3ONQA 2PDAA 3H59A 2XI3A 3LAKA 2HHHF 2GO9A 3NL0A 1RTIA 4H4OB 3G86A 3V6KA 2AGOA 1Q82T 3CDEA 2KFZA 1DARA 3BGRA 4I6YA 1QVGR 3GIKA 3LOUA 3K58A 2FVPA 4M63A 4ZP7A 5LL6d 1VQSA 1U4BA 2R7VA 2N4DA 2QA4S 3KLEB 1AXQA 4O4GB 5A0YB 1HD1A 5L1KA 5M2PA 5F8MA 2XY5A 1NKBA 4ELUA 3DM2A 2RSQA 4OIXA 3VWSA 4KFBB 4RNHA 5J1NA 4WTYA 2QIFA 1FTRA 2KJVA 1J5OB 2CQIA 1GTEA 4LSLB 3NLCA 3Q24A 2HWTA 1TAQA 2B43A 3DLBA 3W2VA 5I4MA 2QLXA 5KOWA 3Q0AA 4G1QA 2JH3A 3MTJA 2B9YA 2COLA 3D1OA 3DRRB 3RAQA 2ZC4A 3CCES 4OZ5A 4ECTA 4DV4F 3EUNA 1KVJA 1UEVA 3I5CA 1KQGB 3GE9A 3ZZ0A 2VQFF 4B9LA 3H5UA 4ILLA 2CPZA 3MM5B 4DR7F 3IO1A 4PG8A 3GR0A 3I32A 3KTQA 1VQ4S 3Q2TC 2C2EA 1UWBB 4NA1A 1JK9B 4ECRA 4ZKAA 2W7AA 2ROPA 2OPSA 4ES3A 2JOQA 4I1TA 2QA1A 3LGNA 1I94F 3R5CA 2DNPA 1SH2A 3VZIA 2YX4A 3DXBA 3OR1B 3RU0A 4B17A 2KU7A 2HFZA 4U67Q 1FCAA 2K3IA 1N56A 3PDNA 1W25A 4RLEA 1IXKA 2BV3A 4A8SA 1Q8LA 2B51A 2VBWA 2PC6A 4TLRA 4LF8F 3JTNA 1OO0B 4LUBA 4IG0B 2BACA 2PO4A 3L95X 1ZAXA 2I5JA 1OS5A 2LEAA 3D0HE 2IBOA 4PG6A 5KFAA 5CCLA 5U47A 2LCWA 1C0TA 1DQAA 3RYLA 3FEZA 3D2WA 2PFFB 3BGLA 3SQGB 4A8MP 4EZ6A 1R3NA 3HVTA 1Q8BA 3FZBA 1FRXA 1HD0A 2JHEA 3N6NA 3U02A 3DLLQ 4LSNA 2IM2A 3RW6A 3ZZYA 1KSPA 2EVZA 2KO1A 5IQ6A 3G71S 1S9EA 1RT6B 3HPOA 1RT4B 1VQOS 1RA6A 1NK8A 3POTB 1NEEA 1N52B 2OPRA 3VQTA 5E3QA 4ED3A 3HHKA 1S97A 3BB5A 1XR7A 2E66A 4OI3A 5AXNA 2DGQA 1X9SA 4OMFG 4TY9A 1U7LA 3HHLB 1MMNA 3FQKA 1VK3A 4Q44A 4URGA 1DAXA 4ZMMA 3CJ3A 4I6WA 4LF7F 5DETA 1UJ5A 4Y2AA 3G8SA 2ADCA 3ICLA 1LV5A 1WHXA 1Y4ZB 2MKSA 2WBRA 3ITHB 3TR5A 4WKYA 2DTJA 3BO4A 2ERRA 1HFEL 2M88A 3KHRA 1Y0HA 2JEJA 3LO3A 4IOCQ 2EPIA 3DRYA 1WF2A 2IBKA 4IOAQ 2V4JA 3TAMA 2H5EA 3TUIC 5KFEA 3LP0B 4JBCA 5KFSA 2R2SA 3IR5B 2CJ9A 3JTPA 2OMOA 2M7SA 2N4CA 2CPFA 4F2RA 3WZ0A 2IM0A 4PPDA 2X1FA 4C0HA 5KG1A 4B02A 1REVA 3CPWR 3KNGA 1FKPA 1NRKA 2OO4A 5LJ5Y 3R1HA 1KLNA 1JJHA 2ZUGA 4O44A 2D41A 5KFFA 1U1QA 2HHUA 1MW7A 4JI7F 1HWIA 2OFGX 1L3SA 5A8RA 1CVJA 3CD6S 3CJKA 4WJBA 4QR2A 1HYSA 1SL2A 1VOMA 3IA0A 4RNFA 2PEHA 4TN2A 2GHWA 2YKNB 3G96A 3HXMA 1VQ7S 4O4RA 2A2DA 3CJ4A 5HROB 2E9ZA 3FMWA 3KMQA 2KZZA 2L08A 1RT1A 2IYGA 4NLTA 2DH8A 4DLEA 4HKQA 3C66A 5D4NA 4KPYA 1KD1T 1VS3A 2N7CA 3KHGA 4X4QA 2CYYA 4HH0A 1EP4B 1WACA 2VBYA 3MOJB 3TI0A 4AL5A 2BABA 4IRKA 3HKZD 3MMAA 5C25B 3SV4A 1IBMF 1RT5B 5F8JA 4DL2A 4Y0FA 3HKWA 4YB6A 3LAMA 3NAIA 1IJFB 5EUHA 5KFPA 3DC2A 2BE2B 5KFJA 1KTVA 3FVYA 4RW4B 2R8HA 1DFDA 2K7JA 4EO8A 2QLWA 5K8PA 5L39A 5EWFA 5E3AA 1B0TA 4XK8C 2QRRA 2W9CA 3HM9A 4PWUA 2MQMA 3DLKA 1ZAWA 3ISZA 1Q53A 1GXUA 2ZHOA 1FEEA 2WSCC 5BJRA 5DGBA 4ECQA 1ZM9A 2N3LA 4MH8A 2DNLA 1N4LA 2K2PA 4Q45A 3SEOA 1Q4RA 4RKUC 2EK1A 3KLGA 3P49B 3OFFA 4FVMA 2KJWA 2YNIA 1ZPVA 2ZC3A 3B8HA 2M52A 2RB7A 2WK4A 2DJWA 4QJVA 2PI5A 3M8SA 1ELOA 2GCFA 4N76A 2J9CA 1PC5A 2E5GA 2R7WA 3UCZP 5HQ8A 1JLQA 1RT7A 1U09A 1VGYA 4DR2F 3M8PB 5D3GB 2FJVA 4X4NA 5HMXA 2JEFA 2ZFHA 2R7SA 3I55S 1S6QA 4ALZA 3CDAA 5KFLA 3TVKA 4JI1F