5F0WA

Crystal structure of human copper homeostatic proteins atox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper transport protein ATOX1
publication title Structure of tetrasilver bound to human copper homeostatic proteins atox1 at 1.7 Angstroms resolution
rcsb
source organism Homo sapiens
total genus 18
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5f0wA00
3BB5A 3GZ7A 4DN9A 3FRYA 2LQ9A 4OIXA 1X8DA 4YEAA 4DPOA 1FESA 3UDCA 4NPOA 1AW0A 2BUNA 2FTRA 2XMKA 3HFKA 5T7LB 2OD6A 3BM7A 1SI9A 2RILA 2G9OA 3MZIA 1X0PA 2ZDPA 2KYZA 2QIFA 2RMLA 5T7LA 1K0VA 3LGMA 2W4DA 2OMOA 1N5SA 2BJDA 1XBWA 1S6OA 4OJHA 5F0UA 1KQKA 3KG1A 1AFJA 3HF5A 2EW9A 5B0BA 3E8OA 4A47A 4FNHA 2HIQA 1FEEA 2L3MA 4OJ1A 3BGUA 1JK9B 4A48A 5A6WA 1P6TA 4Y2KA 3LO3A 2BJEA 3TOQA 1CPZA 3WDOA 1MWZA 1OPZA 1YJRA 1MWYA 2GV1A 2JDJA 3QGPA 2XMUA 2PD1A 1JWWA 2RU9A 4NL5A 1Y0HA 4OJ3A 1KVIA 1WD6A 2LXFA 4HI1A 2HQIA 1Y3KA 1FE4A 2QLXA 3TNVA 1Q8LA 4F67A 2N7YA 2PGCA 3VTIA 4U9RA 4DL0C 3HDSA 4Y2IA 1VQYA 1YJVA 4HH1A 2GCFA 1FVSA 1CC8A 2AP6A 3FMBA 1YRXA 3CJKB 1OSDA 1TUVA 2IYIA 2K7JA 3BR8A 2ASYA 3KKFA 1CC7A 3IWLA 3FGVA 1VQSA 1GXUA 1YG0A 2XMTA 4ZA1A 5B0DA 1IUJA 2HLTA 3CJKA 3F44A 1N5VA 2BBEA 3QMQA 5A6PA 2HLUA 2K1RB 4ZOSA 1FD8A 1Y3JA 3IWXA 2OFHX 2OFGX 2XMJA 1FVQA 1OQ3A 3HX9A 1S6UA 2GGPB 4OJGA 4EFAC 5B09A 1OQ6A 2K1RA 5IXUA 1AFIA 1SB6A 3LGNA 2K7KA 5B08A 3KG0A 5B0CA 4Y2MA 2N4DA 2GGPA 1KVJA 1YJTA 1TL4A 3DXSX 4FNIA 1YJUA 2FB0A 1Y9OA 2RSQA 4YDXA 1RJJA 1TR0A 2K2PA 3BDEA 2XMWA 5KAKA 2VH7A 2FIUA 1N5QA 2OD4A 3DCAA 2GA7A 2AJ1A 3BF4A 3HHLB 3BN7A 5B0EA 3KNGA 4A46A 2W4PA 3HHLC 1FE0A 2XMVA 2LQBA 5B0AA 1APSA 3MCSA 1GXTA 1R6YA 2IYGA 2OKQA 1U7LA 2QYCA 1N5TA 4Q2LA 5K9FA 2W4CA 3HHLA 4HI2A 1Q8BA 1SQEA 1TZ0A 2ACYA 1ULRA 2Q3PA 4HL9A 5F0WA 4A4JA 1P8GA 1QUPA 4QOTA 1Q4RA 3K7RA 1X7VA 2ZDOA 2XMMA 2IFXA 2ROGA 1TL5A 2AJ0A 2N4CA 2AW0A 3TRGA 5B0GA 3T9NA 2ROEA 2KKHA 2GO8A 4HH0A 1LQ9A 2OP5A 2CRLA 2KT3A 5B0FA 2HFOA 2KT2A 1URRA 1Q53A 2QLWA 1V3ZA 3HHLD 2ROPA 3I9ZA 2HFNA 2OAUA 2GFFA 4Q2MA 2VV5A 2LDIA 1W2IA 2FHMA 2BYCA
chains in the Genus database with same CATH superfamily
4DN9A 3CMAS 3MR2A 2RS2A 1UKUA 1KR4A 2DIUA 3H40A 1AYEA 2FLOA 2MEWA 4JI5J 2A6OA 4DV7J 1VC6A 2EKYA 2QN6B 4ZVRB 5ETSA 3G9CA 5CQGA 4DR1F 3UDVA 1WELA 4O3QA 3R2DJ 2HVDA 3AA9A 3W5YA 5HATA 4NLVA 4LMZA 1VGYA 2FY1A 3MMAB 5HBMA 3P5TL 3SYZA 3GMGA 4BDPA 2HZVA 3DDKA 1RAAB 1N0VC 2BE9B 2CZVC 3MM8A 4MT1A 1RKIA 4D3HA 3KLEB 3HD1A 4UOFA 3BPSP 3PO4A 1UVJA 1JJ2R 2HQDA 4Q2LA 3H7HB 3DRXA 4ECZA 3RBEA 2DR6A 4DUZF 2QLJB 2CVIA 3CJ4A 2H54B 2M8DB 1M5HA 2YNGB 1BQNB 2E5JA 3W2WA 4Q2MA 2JWNA 5LSRA 4DFPA 5E2QA 2E1RA 2FTRA 2MQOA 4TNOA 2WVDA 3PACA 3HHNB 4C8YA 2AYEA 2ERRA 2E1MC 1UTAA 3BBBA 3MECA 2QA1A 4ECVA 4ZJLA 5AE3A 1RDRA 4YP3A 1N0UA 2RVJA 1N34J 3IXQA 2HFUA 2R8IA 2KRBA 4RU2A 1AB8A 3GSIA 2G13A 4LBPA 1H38A 2JEFA 2JSXA 1HWUA 2EG2A 4BHQA 1X5OA 3KXDA 4OV1A 1UFKA 4C97A 1S48A 2D1CA 1WF2A 1REGX 5F41A 2CQ1A 2VKRA 1IR1A 3DM2B 4HTIA 2J9EA 3G71S 3WHIA 3Q8UA 4F26A 2JLGA 1Y5IB 4LF9J 1E6VA 2MZJA 2E1CA 1B64A 3DGPB 3VZHA 4CO5A 3TQEA 4YY3F 4ECQA 1N56A 5JXSA 4U8YA 4PXDA 4DR6J 2LDIA 4RZRA 3DYAB 2F1FA 2OGUA 5FJ4A 4DPOA 3PW0A 3V81B 1MW7A 3CDUA 3RGIA 4UTGA 3W1YC 2DNNA 1H6KX 1RT1A 1MMDA 2HHUA 2JLFA 2L3MA 2XZDB 4Y3CA 3LF0A 3US5A 3B4MA 1VRTB 4WU3A 2ZZNA 2EC0A 4W90B 3I6PA 5KG5A 4ES1A 2R42A 2NUUG 4RW4B 1HNWJ 4G6VB 3E01A 3ISNC 4IH5A 2W9CB 1T05B 3FQKA 2ATLA 1IUJA 2H4YB 1WOOA 2CJQA 1XNRJ 3LTOA 3T9ZA 2NYIA 3RBXA 3I87A 2F3JA 3MM9B 2IM1A 4CLWA 4USKA 3OFEA 1XMQF 2ZWPA 1HNVB 5IWAF 5F0WA 3MPVA 1JLFA 1LWXA 1L3VA 2LVWA 4NLDA 3TRGA 3Q22A 2J6SA 3MPWA 3MR5A 5L46A 2W9BA 5DO2A 1NKBA 1GTEA 1G1XA 1JNZB 5A8WB 1UJ4A 2UUBF 4P71A 4RW7B 2ZJQQ 2DHXA 4QU7A 1JLGA 3M6VA 5CZXA 5T7LA 2B5JA 1N5SA 1Y4ZB 4BWJA 3O3LA 1RT5B 4OHWA 3VF0B 5A8KB 2FC9A 2BZ2A 3IGVA 4EI2A 2VQEJ 2FLNA 4HACA 4ZVEA 5L1JA 1SC3B 2P8IA 4HTJA 2GQQA 3L4BC 1A6LA 3P3DA 1NHVA 3HSGA 4OZLA 2FHJA 4QYZJ 4YDXA 1Q82T 1Q81T 3CCVS 3MI7X 2DNLA 4WYWA 3NWRA 2D69A 2E29A 3IG1B 4F3MA 4K50A 1TV6A 1ZPWX 1RTHA 3BDPA 2M52A 3PRBA 3A8KA 4K8RA 4O3SA 4RWXA 4NXNJ 5CYMB 4DFMA 4LBIA 5F3ZA 4CO4A 4OI6A 5K14A 3SSSA 4DR4J 2BEFA 3KHRA 1XMOF 4RUCA 4C8MA 2C3YA 3CJ2A 1TL7A 3JSRA 1RE1B 4CCHA 4NI2A 2UP1A 1UEVA 1I1GA 5C2GA 2G2ZA 1H2VZ 3F41A 3PJXA 2AGPA 4Y2IA 1Q7YT 4B3MF 1MN9A 1C0TB 2K7JA 1YJ9S 3WBZA 4ZA1A 2V6AA 2G0JA 1X4FA 3PYDA 1WEXA 4JI7J 3R97A 4JI2F 4Z2XA 4DX5A 2P9EA 1SXLA 2YXLA 4USJC 1K9MT 4ZLLA 1F9FA 4JV1A 5DQHA 4B08A 2MQ8A 1UMJA 1I3OB 3DKDA 3KUEA 4F4AA 1IKWA 4J9PA 4YB7A 4F25A 2VA2A 4BLGA 2DHHA 1V3ZA 1YSJA 1M1KT 3O8WA 2M88A 1Q8IA 1UAWA 1F5CA 2GJ2A 3OHAA 1VC5A 3LA0A 3D67A 1S1WA 5F3TA 3KJNB 1UP1A 3GIJA 1PBUA 2E5IA 3BBCA 4K2JA 1WTBA 4EZ9A 4WTOB 2WTFA 1I94F 4N76A 4KGKA 4ZPTR 2OTLS 3HSJA 4U6PA 4UZBA 3IS9B 3BSAA 3HDSA 4JYAF 1F5BA 2AP6A 2ZH2A 2FVCA 3HCXA 4UUXA 2Z2MA 2BBEA 1T9VA 4ZVPB 5KG1A 2C2DA 2X1AA 4J7CA 3GFXA 2PA3A 4ID5A 1OMSA 3EPIA 2XYPB 3K5MA 3T1YJ 2MKIA 4X65J 3KLIB 1RWUA 1H7XA 2KG1A 2R7SA 3OV7A 2FLPA 2MLZA 4ZVTB 4LSNA 4CO0A 4NCGB 2DNGA 2V5HG 1J5OB 3H8YA 1HI8A 3RUBL 3VCDA 2KDOA 1Q95G 3A4TA 2JVOA 2NXNA 2DNHA 2HS3A 4WU2A 3PJ9A 4DUYJ 2MQQA 3P45B 3LW5C 2PI5A 2XTJP 3MAHA 1H0HB 4NEZA 1RWVB 1EX8A 2CJBA 5D6GA 4B3RJ 2V4RA 2ZOMA 3N4WA 4QYRA 1P1TA 2QJ3A 3DDIA 1RWOB 4R25A 2GVZB 3VAHA 2RRNA 1BLUA 1X5TA 2VDIA 3CO0P 1GFWB 1U49A 2HZAA 3SBMA 2Q66A 3M30B 4A8WA 3Q89A 2ZM6J 1T02A 1VLOA 2V2QA 4P2SA 3UN3A 2FGCA 4LF7F 3HHLA 4DPYA 1ULRA 2VASA 1HNIA 2M8HA 3IMQJ 1NB7A 2GVDA 4DU8A 1MG7A 1R0BG 1S9EB 3Q2SC 3DRSA 3SQGA 4NA3A 3W8GA 1QAYA 5G0RA 2MKYA 2BUNA 4FDFA 4OLOA 1C1CA 5GAHI 4ZVHA 2ZDPA 5HVFA 5CHCB 2V4JA 1TKZA 1B3TA 4DQQA 1RISA 2W1BA 1NJWA 5F8GA 5T41A 2H51B 2MPUA 2H4WB 4NCBA 3NCPA 4DL5A 1YQHA 3T41A 3D68A 3RTVA 2EFVA 4F4YA 3TANA 3GYNA 1S49A 2RRAA 3PIPQ 5M2RA 3M1VA 2B8QA 1XEZA 2OFHX 4P7TA 4G1QA 1TL1A 2BA9A 5E41A 3PV8A 1YLXA 1RCOB 1OWXA 2L9DA 4QW9A 1AA1B 1U6BA 1FJ7A 4CTAA 2GQCA 1FNXH 4LF4J 3PVXA 1FFGB 2CNOB 3P8BB 4M5MA 3FBEA 2O1PA 4LSLA 1EIYB 2W2PP 4RNFA 1NJZA 1CJVB 1S6PB 4YMEA 1FJEB 1HI0P 4H4OB 4HH0A 5CCLA 4U95A 3AA8A 7FDRA 4OYAA 1RLDA 2V8HA 1LEOA 4KR0B 3G82A 1FT8A 2Z2YB 1FESA 1YBUA 4EWTA 2RF2B 3IBWA 4NPOA 4NA2A 1EKSA 3J7YU 4DR3F 2CNKB 3GB0A 1S0VA 2KYZA 1H7WA 4ELTA 1BC6A 2HNYA 3G6XA 3DMJA 4TY8A 2HQCA 4P75A 4MKVA 4CZCA 2VBZA 4ERDA 2W2OP 3CXCR 4LF1A 1S1TA 1FDNA 4K4UA 4M5HA 2IDEA 3GJQB 4J9QA 4KFBB 4IOCQ 1REVA 1GT8A 1TAQA 4PG6A 2HHQA 2OJ3A 3HX9A 1U1OA 3MM7B 3KJFB 3W64A 2HGMA 1VRUB 2NQPA 1LWEA 4DV4F 1NSPA 1NHKL 3DLKB 2FJXA 1IWGA 1S7IA 5KG6A 4L3KA 2C3MA 1P8GA 5HANA 3MEEB 1HNZJ 1GMWD 2BE2B 2X1BA 3GR1A 2ZNZA 3FDSA 2HYIB 1M90T 2B56A 3LWLA 5F8NA 2LQ8A 5J1EB 1UVNA 3SCKE 1TU0B 3QIPB 4K59A 4C98A 2X1FA 3QZ8A 3DRPB 1L3SA 2FJWA 1K0VA 2BVZA 1TMMA 2DR7A 2R2TA 3H4BA 2JZ5A 2EWHA 3H0PA 5LOQA 4NLSA 3QGPA 2VD3A 3BH7B 1Y3KA 3CE8A 3HHDA 4A8OA 1TUWA 1DURA 5ETLA 5KT7A 1FVSA 2XWYA 1BHNA 3D54A 1S1VB 2BKPA 2HFSA 3IWXA 3OFFA 2OFGX 1U1KA 1RAIB 4KPYA 3H5SA 3MMAA 5IM0B 5B0CA 1VQNS 1YJTA 1HBMA 5KOWA 2IMOA 5KFRA 4PQAA 4KKOB 1UWAA 3KLEA 1FRHA 2QL7B 3GG1A 4LF2A 4OI0A 3QO9B 2UV8G 2AEFA 2ACMA 3EVMA 3I4PA 3C46A 2Q6CA 4AXJA 2E9ZA 4DR7J 2OO4A 2YNGA 1BQNA 3MEKA 3SXLA 3KHGA 3BM7A 3TA2A 1VQ5S 4FKYA 5KG7A 3CIZA 3EXCX 2R7VA 4JI8F 4KRWA 2XQCA 1PSDA 4USVA 2KJWA 3FKBA 2GHWA 2B4PA 5H9EK 1O51A 4DF4A 2JJ4D 1MWYA 2XS7A 2V50A 3MEDB 3Q8QB 2UU9J 1MSWD 4PXEA 3PCOB 5FDLB 4ZVUB 1YTYA 4NLWA 2XSJB 3OPKA 2NPFA 1R7IA 2QMWA 1VQPS 5KFHA 2XY6A 1YG0A 3LUYA 2PIIA 1N5VA 5D4LA 2AT1B 2MSSA 4KHRA 3MAAB 3DM2A 3CJSA 2RQCA 1RTZA 4CM0A 1SH3A 4UF4A 3LAKA 1VR6A 2EPIA 2XYHB 5LXYA 4JI3F 3LOUA 3M6XA 2QSWA 1ZTTA 1P9QC 4WFBQ 1W7WA 3WC2A 4V1Ak 1U25A 2ZH7A 2MZ1A 3DGPA 4JI1J 2UV8A 4LF9F 3NG8A 4J9OA 1OYEA 5DG7A 2BJ3A 3LP2B 2RILA 2J0WA 1S6QB 5AT1B 3K2YA 3KJVB 2H1YA 1GH8A 1UZHA 4DR6F 1KOOA 3TOQA 3BGOP 4I6YA 4FF4A 4C0BA 1FDAA 2W7PA 2MB0B 1DAXA 2ZH1A 4ZS6A 4KQZA 1V9OA 2XZWA 1VRTA 2D3ZA 1U2RA 1H98A 3ISND 1N6QB 3PX4A 3KUHA 1KOHA 4RW4A 3HJFA 2XMTA 3PTWA 2W9CA 1J27A 1T05A 4DEZA 3EGVA 5CH7B 2YX4A 5KFOA 2BX6A 2NYHA 3EPGA 2GHVC 1GX6A 1HNWF 4WXWA 1X9MA 2WW4A 3MM9A 2V8GA 1BWEA 5BYRA 4B3OB 4CLKA 2DEJA 2YH1A 2XI3A 1XNRF 2P5VA 2HMIB 1U8WA 3OLBA 1VQOS 1HNVA 3WIUA 3ENAA 5F8LA 2DITA 3QLHB 5ETVA 1CLFA 4L76A 4ECWA 4WIQA 3M8SA 3T1HJ 3NCQA 5E33A 5A8WA 3BQ2A 4YHHJ 4KB7A 3LH2S 4P10A 4RW7A 1HBNB 4MIAA 1U1RA 4A47A 3TUJC 2V9KA 4C8LA 3EX7B 2HS4A 4YUDA 5FLXU 3AD9C 1RT5A 3JQJA 2RNEA 5A8KA 3SI8A 4H4KC 5D15A 1OS5A 2RH3A 4ZITA 2CUYA 3Q8YA 2P9GA 5CA5A 1QM9A 2MHNA 3M8YA 3OVBA 2F40A 2DNZA 4I6WA 4ATNA 3M8RA 4KE5A 1Y3JA 5EGYA 4PPZA 2E5LF 2VQEF 4WE1B 4QWCA 4H4KA 1RT4B 5DJBA 5D0RA 2MZRA 3OW2R 3OVSA 3LALA 1NJIT 5C42B 4K2XA 1F9EB 4C7QA 5BR8J 3IG1A 1PKUA 3RW6A 2PI4A 4ZLPA 4F36A 2D9PA 1UJ5A 3I9ZA 5J2NB 2I1RA 3BB5A 5CYMA 4JI0F 2C3PA 3DLGB 1M5OC 1R43A 3OL7A 2QG9B 2JOQA 4ALZA 1VIOA 4DL7A 3R9LA 2KG0A 1X5PA 1PYSB 1YJRA 4YFUA 3OR1B 4X66F 2F4VJ 4L75A 1T9XA 4PR6A 2HSEB 2VODA 1EHWA 2R3VA 5DS7A 1RAJA 2YKOA 4M1KA 4UOCA 1WHYA 2BDPA 4ZJQA 1ICEB 1C0TA 1NB2A 3UD4P 1CBKA 2HHSA 3CCES 5DLGA 4IDKB 3A8IA 4MMOA 4MK9A 4HYKA 4I7FB 4QWEA 4GKKJ 3MWBA 2Y1JA 3M4XA 3R8YA 2MQLA 2FDNA 2D3UA 3R5AA 3C16B 5K9FA 1SQEA 5KFSA 4ECRA 3J81U 3DGVA 1UW4A 9ATCB 5KFPA 2AKWB 2QLBB 4UOHA 3OUYB 2ZBPA 3TP2A 4OHYA 3GV7B 2ASLA 4ELVA 3TX8A 3ONQA 5KFZA 1TFYA 1FXLA 1OPIA 2XMAA 3PW5A 2LCWA 4HDGA 2P6TA 1TQLA 1OPZA 2ALZA 4TVAB 1JWWA 2HHTA 5KFUA 5AXKA 4AYBD 3T3FA 2KI2A 2OIHA 1SUQB 2N7YA 2B3TB 4EEYA 1X9WA 5IV4A 3IS9A 2FHKA 2C3OA 4OX9F 2DGTA 2UVRA 2B9EA 3AFGA 2PC6A 4OYIA 3W2VB 1PYTA 2FHOB 1Y9OA 4ED3A 4BBYA 1F9HA 4OHVA 5D0EA 1AXQA 3T5LA 2LDYA 3ZZTA 1K1SA 3TA0A 3BYRA 5I4MA 4ED1A 3WIVA 2ZZTA 2ZD1B 2IFXA 3EDQB 5HP1B 3HZGA 3BGFA 5J2QB 4URSA 2J0QD 3T1YF 2ASDA 4C2MA 2YWWA 1GTHA 4NCGA 1PGZA 4NZ0A 5HAOA 1J5OA 1Q78A 1RLCL 3FEYB 3ZNUA 2FPHX 5I3PA 1XQIA 4OJHA 2BKNA 4HT7A 4Z37A 4DPUA 4J9VA 4DCJB 2A10A 1R31A 4W92B 4OI1A 5EDWA 2HZCA 4DUYF 1WG5A 1GEHA 1P27B 2R7XA 4PXCA 3D0GE 2K1RB 1FD8A 2LKZA 3GIMA 1X4HA 1D8YA 2GVZA 5A8RB 1BMQB 4B3RF 3VZIA 1HKAA 2E66A 1KLMB 4HEA9 3IM9A 3EZOA 2EFQA 1UL3A 1H72C 2OH2A 1B4SA 5JVHQ 1S97A 2B8PA 4I0WA 2ROPA 2ZM6F 2FJAB 4IOBA 4RLEA 1S9EA 4IUFA 1Y00A 1RTDB 3BKFA 3VAMA 3MCNA 4ZIWA 2AD9A 1YZ6A 2PDAA 1FRIA 3GYGA 2U1AA 3V6HA 2F7VA 4DMZA 4PG7A 5LJ5Y 2SXLA 2V68A 2UXDJ 3RZAA 3Q86A 1S10A 4M5NA 3AJ2A 1OSCA 2XGQA 3UD5A 1NCLA 2DHAA 4NLQA 3TUIC 4YOEA 3HPOA 1U0SA 3B4DA 1PYOB 2DNRA 5GAHU 1OSDA 1IXKA 5DM7Q 1LXNA 2D9OA 2AZ1A 3EICA 3Q8PB 1XTZA 4P74A 4E0DA 4NEYA 3D6TB 3G6VA 2BACA 4X4SA 3M05A 2OPPA 2LEAA 1RB0A 4MYUA 3QGHA 2OPRA 2NSBA 5KFWA 1OY6A 3IRWP 4AUKA 2D3OR 1CJVA 1S6PA 1Q53A 4URGA 3M9OB 4LF4F 4XK8C 3QZ7A 2JL9A 1ITPA 2RF2A 3I0RA 1A7GE 1NSKL 3SDEB 1VQ7S 3QBCA 3TJ9A 2MLYA 4N47A 4J9LA 1CULB 3OT9A 2IA0A 4RL1A 1D0EA 3MM5B 2LXFA 2PA8D 2LXUA 4C9DA 2XZTB 2FVPA 1NO8A 3CWJA 1KWMA 3KKFA 1VQ6S 5ETRA 2W7OA 4QIWD 3CDBA 1VISA 3DLEB 2OUGA 4K0KJ 1F5AA 1FWPA 1NBEB 1RHRB 1F60B 2R8KA 4NLYA 2KZZA 2VG6A 4ZJOA 1VRUA 3GQCA 2D41A 3CEDA 3ZZUA 2AJ1A 4DG1B 1Y7PA 3DLKA 2ACYA 2KFZA 1EJ7L 3NMRA 1EQMA 3MEEA 2ZFHA 1M5KC 1FKOB 4RU9A 2BE2A 4CH1A 3JQMA 4A8XA 1IBLJ 3OFHA 4DQSA 4UQTA 2OD6A 5J1EA 3QIPA 5JVGQ 4A8FA 3SFUA 4FPIA 1FX4A 3CJRA 1XBWA 2UXCF 3DRPA 1UZDA 2NREA 2ZNYA 4LVOP 2NS1B 3UR3C 3J81Y 3SZ2A 2VJVA 5GVQA 2EEYA 1HHTP 4DFKA 1FD2A 3KFWX 4ZPDA 1QE1B 3BQ1A 3GILA 3CJKB 1XN9A 2IC3B 2IYIA 1SH2A 3G96A 3A1YG 2XMJA 3GPAA 2DIVA 1S1VA 4LF5J 2GJFA 2JX2A 5IM0A 3Q8VA 3GFZA 4DQIA 4O4GB 2CQ0A 5MAOA 4KKOA 3V4MA 4HI2A 1YZ7A 2XULA 1Q4RA 3I5CA 1D9DA 2GMHA 4C6AA 2ZE2B 2HQGA 2V2KA 4QIFA 3MFHA 2B43A 3HD2A 3QO9A 3SQOP 2DR8A 4ETZA 3OR2B 2HK3A 3U27A 2BW2A 1HQUA 4NX9A 4DR2J 3H59A 1D9FA 1RBOB 2BJDA 1S6OA 3V5RA 2WCXA 2CAJA 2CZ9A 5IV3A 4FYWB 4O0NA 3VR1A 4ANCA 4DR7F 4L6V3 3N6MA 2ZJPQ 4ZPBA 1VQMS 1IQZA 4C4WA 2HWTA 4QCLA 5C7PA 4WP8A 2L08A 1HBOB 3ENWA 3MEDA 5F8MA 1W25A 2G2YA 2R2SA 4ZVSB 5FDLA 2BJ8A 4J9MA 2XSJA 3D3BJ 4QR1A 3W5XA 2QFJA 2M9KA 4ILRA 1VCTA 2ZEJA 1G4CA 1FFWB 2MMYA 1EAYC 3DLJA 4MKYA 1VJWA 5B0AA 1APSA 5KFLA 1VQLS 1RWWB 2YQ1A 2ZWOA 2IHR1 4IG3B 4OI2A 2KN4A 5E5NA 1Z4UA 2POKA 4I4BA 4D3GA 4J91A 3GIRA 3D1HA 1JXEA 2FHMA 1WORA 4OL8A 2RUGA 1AW0A 3TVZA 1UVIA 2HWHA 2ATCB 1YKWA 2HHPA 3LP2A 3CCSS 2Z56B 1SJ1A 1MMLA 3CDWA 4LIWA 4JOUA 3KJVA 1P6TA 4O3NA 4IRCA 3I82A 4OFZA 2KO1A 1OY8A 3WC0A 2VOPA 2MY7A 1K73T 4DV1J 2ADBA 4QWBA 3THPA 3CCWA 3RJMB 3KK3A 4DF8A 4KT0C 4X64J 5IFMA 3FEXB 1N6QA 1IBKJ 1LW0B 5KG0A 2DYAA 1JLFB 3HLUA 1WI6A 3ILJA 3NS6A 1M5PC 3ZTRA 2W9BB 3THTA 3QYYA 2H5IB 1BWVA 1RABB 1IJFB 1ZM3A 2PE8A 2L9NA 4A8MP 1NDPA 5L1LA 5BYQA 2ROGA 4KC5A 1QSLA 1RT7B 2NR0A 1KLNA 3QLHA 1PJ6A 3CJQA 1LNQA 4Q45A 1OIAA 4ZPWR 4TQRA 3I5BA 4OIXA 4CO3A 1I5OB 4HACB 3O5TB 3EVOA 3UDEA 4CLSA 4CO2A 3V2UC 3K57A 3VGSA 3W61A 1SQGA 1HBNA 1DFDA 4JBCA 4DV5J 1XMBA 3T1HF 1NKEA 2V8DA 1KQSR 3CSKA 3CCTA 3M2UB 3IR5B 1W2BR 5A2QU 1GK8A 2MXYA 3M2VB 4U9RA 1X0FA 4IFVB 3W7BA 4FXDA 3L3CA 2O3DA 2ZITA 4U67Q 3PX0A 4KHPJ 2V67A 3W66A 1WSRA 4ED8A 2AJFE 2Q6BA 4R0JA 4QR2A 3EJMA 3KNAA 5KAKA 1JLEB 2FJVA 1RT4A 2H48B 2KHCA 1NDLA 3ELHA 4Q44A 2Y8YA 3H25A 1IM6A 1TL7B 1XK8A 5C42A 1ZZFA 2YKAA 1NK0A 4K5RA 4CM2A 2GO9A 3CDAA 5J2NA 5D77A 3RR8A 3TW0A 2N82B 3HP6A 5L38A 4NZ6A 3Q24A 2QA2A 3NGDA 3DLGA 4U96A 4FNHA 4DZ6A 1V3RA 5SZTA 2A18A 2CPXA 4A8YA 2CVEA 5HK4A 5KFJA 1WC3A 2ZBIA 2ZZMA 3W63A 4LVNP 3OR1A 4V19J 4FZVA 3E2EA 1NDKA 3EXYA 3T5JA 3H98A 2C22A 4LFBJ 5CABA 1Q5VA 5LMNJ 2F4VF 2EBEA 4OJGA 5GAGU 1TK0A 3BGLA 3KDNA 4IDKA 4DSJA 1RBLA 4L3NA 3MHYA 4I7FA 1GMUA 3AB4B 3DCAA 5ETKA 1N48A 2LP4A 4TU9A 4KSEB 4ZHRA 4O4RA 4C0OC 3ZZ0A 2PMHA 3NAHA 3PNIA 4ZMMA 3C16A 5AJ3F 2E1AA 4GKKF 4Q0BB 3GV5B 1JLQB 2A2DA 3AXMA 4ZK7M 3W9HA 2YQ3A 3FFIB 5KT3A 4NYZA 3OUYA 5LXRA 3NXZA 2F5GA 5AXMA 2VFSA 1X4DA 2DY9A 4F02A 4UW2A 3FRZA 2YWKA 4R0EA 4RJVA 2QIFA 2DPJA 3TZYA 1AUSL 4U7CA 3D7SB 3M6UA 2CDRB 4WIIA 1CPZA 2NXCA 1HR0F 2C42A 1T9TA 4XTTA 1CS4B 4OX8A 3EVWA 2I9SA 1JMTA 3A3OB 3FCHA 2PGCA 2UUAJ 1SUQA 4DL4A 2UUTA 2BANB 1KN6A 4EK2A 3UO0A 3SMZA 1EP4B 3JSBA 1LW2B 2DBBA 2DNOA 2M4MA 2OPQB 3SCIE 3W2VA 2XBPA 1U26A 3I55S 5HQMA 4ZKAA 1NUEA 3F0NA 1AROP 4RNNA 4IOAQ 4KYZA 1QUPA 4RNHA 3JXOA 2ROEA 2ZD1A 4FYVB 5HP1A 1LOUA 3DC2A 2Y3YA 2VL1A 4NMLA 5J2QA 1OYDA 1IR2A 3QSIA 1N33J 2V8VA 3UNGC 4FP9A 2DHGA 4KH1B 1YJNS 1SIWB 2WVEA 2ILZA 1SVDA 2OLWA 1FO1A 4DCPB 1HWKA 3UQSA 2L48A 3TNVA 1SL0A 2KM8C 4USHA 4Z7YA 1CC7A 4OYXA 4RNMA 1LV5A 5KFFA 2HWIA 2DH8A 4F0MA 4F2SA 3AOAA 2YWFA 5B7WA 2K1RA 4CP5A 3D66A 2C28A 1NK4A 3H5XA 2IVFB 2KXNB 2Q79A 3GCXP 4MH8A 3TEHB 1WG1A 2MZQA 1KLMA 2VG5A 2V4JB 4KY3A 1HYSA 1VLYA 5L1IA 2KKHA 3VALA 1HD0A 3KWMA 4LBHA 3L9ZA 1HNXJ 1FKPB 4ILMA 3DRRB 3J7AN 1U0HB 1WKLA 4YS2A 2NPIA 5D4NA 2IIHA 4IQXA 3N01A 4HLBA 2DO4A 3WZ0A 3OJUA 1RTDA 4O3OA 1XNQJ 3M9MB 1ZAVA 3IO1A 1SL2A 4NASA 4DCOB 1SH0A 3BEGB 3D0IE 2B51A 5F8JA 2AMCB 3B78A 1KQFB 4Y65A 2UXDF 1QTMA 2KFYA 3IR6B 2RIJA 1ROFA 4KGXB 4WF9Q 1KVJA 1HD1A 4J9KA 1D9AA 4F3QA 2OEMA 4QU6A 1U09A 2G2OA 4DV0F 3KK2A 4OMFG 3P96A 3DMJB 1KTVA 3AXKA 3BSCA 3PW7A 2HPUA 3HHLD 4YR3A 1MROA 1RAOA 3OXGA 3KK1B 1R27B 4P6QA 3CJ8A 4DX7A 4DL2A 3BGUA 3SDEA 2GZOA 4O44B 5RUBA 3FSIA 1NH7A 4FYYB 4KH0B 2YH0A 4YB1P 3CC2S 4DLEA 1NSAA 3K8VA 3HM9A 1QD1A 1CULA 1B0VA 3MURP 3ILLA 5IT0A 5LMUJ 4E8UA 3PIOQ 1IKVA 1TKTA 2J76E 3MM5A 2UUCF 1BXNA 1H73A 1RT2B 1RAGB 1ZA2B 2CPYA 4LF6J 1D1UA 4QPXA 2J8AA 1K8AT 5A6PA 1DRZA 4A8SA 3OL9A 3OFGA 2RSQA 1FI4A 1I51B 2W2QP 4ZVQB 1GNKA 3BN7A 2Z2ZA 1N54B 2G0CA 4OZ1A 1GXTA 4K0KF 2VU5A 4I64A 4DG1A 2B4UA 2LU2A 2MHEA 2AW0A 1RCXB 4PWWA 5B0FA 4LREA 3E51A 5JMNA 1GMWA 4O23A 2BYCA 1FKOA 2RDDA 2KRRA 1BQXA 3QNWB 2DJWA 4Y0FA 4C48A 1VQ4S 1U24A 4R5PB 3PR4A 1M5SA 1IBLF 1WF0A 1JB0C 1HBMB 4B9MA 2GAGC 4YB6A 1T3OA 2DRBA 2HAFA 3I31A 1QE1A 4LFAJ 2ASYA 1A9NB 3JAMY 3QT7A 3ET6B 3CJKA 1KTQA 2DXEA 2IC3A 2FJDB 1KC8T 3VGUA 3TAQA 5KG2A 3GIIA 3LGHA 3S6EA 4WBFA 1X4EA 2OSRA 1WC5A 2VFVA 4LFCJ 1UFWA 2DH9A 1JX4A 2IRUA 5B0EA 2IJNA 4AL5A 3TAMA 3D1OA 1N5TA 4O4GA 3D28A 4GVLA 4NLGA 4LF5F 2NSCA 2ZKTA 4K4TA 3M9NB 2ZE2A 4B9UA 2KT2A 4MIBA 2XCAA 3ZNJ1 2B9YA 1T9UA 2E44A 3OR2A 3GLJA 2NCKL 3R6GB 2HNZB 2WZ1A 3TX0A 3R27A 4N56A 3C2PA 5DQGA 3DHXA 3PX6A 5A6WA 4DWIA 2NUHA 4NLOA 1LK7A 1S59A 4I2PB 3MD1A 1DTQB 2GCFA 4UT4A 1HBOA 2E5GA 3NP5A 4IO9Q 2JH3A 3D6FB 5B0DA 2H9ZA 3W9JA 3AAWB 2PMWA 4TYBA 2HNDB 2E1PA 3OVAA 3QWUA 3A12A 4Y2MA 4R8UB 4Y2AA 2VH7A 3VWSA 1VOMA 4XO0A 3CW2C 1M0SA 5HL7Q 5H9FJ 4GC6A 1PC4A 4IG3A 1C4CA 4ZIVA 4DUZJ 4Q8FA 1TL3A 1LFWA 1PAEX 2ZH5A 1YI2S 3UVJB 2F63A 2JC1A 4IFYA 1C1BB 1FERA 4QYZK 3KJQB 4TKTA 2CJXB 2GNKA 4XPCA 1EETB 3FUYA 4IYQA 3UWTA 2AYMA 1S0NA 3NL0A 3D0HE 4LRAA 3VTIA 2E9RX 3FMBA 4P72A 1QSSA 4J9SA 1PBAA 2U2FA 5C25B 2ILYA 2HLUA 2XHWA 5DZ6A 1LW0A 3EDRB 1FRLA 4DV1F 1J2VA 2DNYA 3F56A 1MMNA 2K3IA 4FF2A 1RJJA 3H2LA 1TKXB 4X64F 1XC9A 1RAHB 4DV6J 4RUAA 2B6AB 2Y1IA 3RB4A 3SV4A 4X4TA 3T9NA 4F2RA 4PABA 4QZVB 4YY3J 2KHDA 3AH6A 1RT7A 4OQJA 3SFGA 9RUBA 3NLCA 3MZIA 4PRFA 4F3OA 4NZ7A 3DOMB 3MOJB 4ELUA 1N32J 2EFOA 3FQLA 3M2UA 5SUHA 3UCGA 4CT9A 4ED2A 1X4CA 4ES3A 8ATCB 3M2VA 1T8EA 2BM0A 4S0MA 1JKHB 4IFVA 4DV5F 3HJVA 1HQEB 1FEHA 3L7UA 2HBYB 5ETQA 4C8NA 5CCMA 5CYQB 1XMQJ 1PILA 2QZ8A 1Q16B 3LP0A 3EMTA 4KHPF 4ZVGA 2KXHA 1JLEA 1T03B 3JTNA 1LWCA 1HW9A 4BCAA 2V34A 2Q3PA 2CDQA 4HL9A 3VAKA 1X7VA 1MN7A 2FGOA 4USTA 5DZ7A 4OZ3A 1O5JA 2HFNA 4OYWA 1RACB 1X8DA 3TJAA 3HFKA 2UXBF 2YKNB 1YBAA 2IPOB 1CJKA 1T11A 3D9BA 4P2MA 1UVMA 4ED5A 2MZSA 3NS5A 3DOLB 4X62J 2E7XA 1SV5B 1KONA 1EB0A 5KT5A 1JIHA 2ZOGA 1I6JA 4F67A 2Z58B 4XIUA 5J2PB 3CCRS 2PO4A 3UN2A 2QFIA 4ZLJA 2XCPA 3BO3A 1VQ8S 5FIIA 1FX2A 4CLFA 4M5KA 3LANA 2HBZB 4AQYJ 1WTFA 4F4WA 4M5JA 2RQ4A 2UVVA 2MQNA 2IM2A 4FS2A 4B9VA 2DKOB 1N36F 4LFBF 4BC9A 4GMKA 4WFXA 2X7IA 5LMNF 4HHHA 2C2KB 2EBGA 4RPFA 2DR9A 1U1QA 3NGUA 1HQ2A 5HROB 1N52B 4Q0BA 1JLQA 1V5IB 3ILIA 2VV5A 3GZ7A 4TQSA 2VPZB 7FD1A 3FFIA 3MM6B 3H42A 3C3LA 5K5MA 2GJIA 2HHHF 2J0SD 2MYFA 1U6ZA 3HHEA 4RW8B 2AJQA 2WB4A 2FC8A 3UPFA 4F50A 3CCLS 3DU6A 2AGQA 4CLUA 3I5AA 2Z8QA 1CS4A 4DSFA 1Q1KA 3OTEA 4GRSA 2NXUA 2RU3A 2D74B 1UPPA 5C24B 3PR5B 4B3MJ 4Y2CA 5L9XA 4U7UD 3LQVA 2J9DE 4B3TJ 1VQKS 2BANA 3DI6B 4EFAC 3K5NA 4G1IA 2KH9A 1WEYA 1EP4A 1SKRA 1LW2A 3JQKA 4DUTA 3KDOA 3MFIA 1FF2A 2OPQA 4RW6B 4C8OA 2VJUA 4M5DB 2VPYB 2KTQA 4RO0A 4JI4J 2VB6A 3K58A 2DGQA 5KTQA 2C2OB 1PJ5A 1P1LA 3R1LA 2W2MP 1SC1B 2JHEA 1SI9A 4X84A 2G9OA 3AOCA 4ICLA 4DI6A 4WWSA 2EW9A 3EYZA 4EU0A 3CIMA 4CLTA 4FYDA 5I3UB 5DDPC 3PRVA 1I94J 2ZUAA 4OYBA 2H5JB 1N33F 1RWXB 1M1HA 4JYAJ 2J8SA 3HFZB 2XS5A 3KLFB 2LECA 4JV5F 4USMA 2WBMA 1UA1A 2DD8S 3FSYA 1U2CA 3HVAA 2RHQB 2J7UA 1MU2B 2YNFB 4LF8J 4WFYA 3ZFVA 1KD1T 3B8HA 2BJ9A 2BQUA 1DZ5A 3N6NA 3QRRA 5DDRC 2HFZA 2VFTA 2HVIA 3AD8C 4DSKA 1UA0A 1LWFA 1WWHA 1X4BA 1FDDA 1FKPA 1F1BB 4YB5A 3DRRA 2OEJA 3IFEA 1U0HA 5KFCA 1EQ0A 1KSPA 4TU8A 2YBVA 1HNXF 5HMXA 3DLHA 1MWQA 2WHOA 2BMBA 4RBVA 3ZC4A 2YKPA 1D8ZA 4AXIA 4WK1A 3THVA 3R5CA 1G2EA 2PD1A 1GX5A 2OPPB 3G2XA 1NPRA 5HQLA 2QL9B 5KFXA 2OPRB 5ADZA 3WX4A 3JYTB 1PAUB 2R7UA 1XNQF 2CWKA 2LU1A 3C15B 2DTJA 3A13A 2WONB 2KXFA 2R7WA 3AB2B 2UVWA 3SV3A 3D1QA 3MTKA 5KFVA 1NK7A 2F4FA 3CUNA 1RK8A 5J2MB 3K5LA 3CGIA 3TZZA 3NMAA 3I0RB 4LF7J 2VC0A 3N79A 3QGGA 1FHTA 4URQU 5MLCV 1HMVA 1VBXA 1N4LA 3H90A 2AQ4A 3PRDA 4KJIA 3PM9A 2DXFA 2HFOA 2QEXS 2HVEA 1S0MA 2Q43A 4C8ZA 3ZO7A 3KK1A 2N7CA 1S99A 4NYOA 2RB7A 3H20A 4Y34A 1NEEA 3PZPA 1SKUB 3CCQS 3UCZP 4O44A 2VG6B 1HPZB 1S4FA 3M32B 1NSQA 4DL0C 2YKMB 3TO8A 2HVHA 1TELA 1L5UA 3D2WA 3FGVA 3KOAA 1RT2A 3JSYA 5E3RA 2C2NA 2CQDA 1DQAA 2ZHAA 3LGNA 2CQHA 4X4RA 3KG0A 1GAOA 4QW8A 3K59A 2AJ4A 4LF6F 1HHSA 5KT2A 1SL1A 1N5QA 3R6LB 5LJ3Y 2XB2D 2IA6A 4DZDA 4JV2A 2IMWP 3QFHA 2HBQB 3MCMA 1XWLA 2W2NP 1RWPB 1URRA 2F9DA 3PXGa 4M63A 4LRBA 5JUMA 1SBRA 4OZJA 2QRRA 1P9YA 2J6UA 4EGLA 4O3RA 4FBTA 4JI5F 2MZTA 4LT6A 3RRHA 2OMOA 4DV7F 3Q83A 4WYLA 1X9SA 2DGSA 1KBRA 4O0IA 3MR3A 2HFVA 1JXVA 5ETOA 4R5PA 5KG4A 2DNPA 2AHOB 3OTCA 4N8NA 1CC8A 3KTQA 3TYTA 4DU7A 3IWLA 4V19X 3NOGA 2VPWB 5D78A 3GE9A 2WOMB 3ET6A 4ANEA 3MUVP 1FVQA 3POTB 2Y8WA 1OQ6A 4ZCMA 2JC0A 3RAQA 1U4BA 1VJQA 4KGZB 2K2PA 2DXDA 2XMWA 4LFAF 1F3VA 4C3MA 1HQUB 5LM7E 3PFEA 1ZA1B 2E5HA 1PG5B 5DETA 3C66A 2MY8A 3S01A 1QAXA 4LFCF 2HIYA 2YNIB 3CCJS 5LSLA 4PWDA 2ZC3A 4HHUA 1K0TA 3JSMB 3GFHA 2HNZA 3O6QA 4ER8A 1F3FA 2I0XA 3E8OA 1NJYA 1PIEA 4X4QA 2C2RA 1N34F 3FNNA 3OLAA 4PQUB 3ITHA 1X31C 1H2TZ 2C1EB 2JDJA 2KL8A 2UUWA 1RT6B 3OD2A 2DGXA 1BQMA 5IT9U 2DCLA 1WOPA 1RTIB 1O0PA 4I2PA 1DTQA 3HT3A 2VBWA 4N77A 5IC4B 2KFNA 2OPSB 1RWMB 3CC4S 4FF1A 2DISA 2HNDA 4K4ZA 2VBXA 3CJ5A 2R2RA 1K1QA 4M8LA 4R8UA 4CIOA 3C14B 3MMJA 4LR9A 2RUSA 1CQNA 1UEKA 1NH8A 3KHLA 2IAJB 3NAIA 1S4EA 2DK2A 4DS5A 5DGBA 4F4XA 4QOTA 2FJEB 2GX8A 2XMMA 4WFAQ 3HVTB 3HSZA 4FVMA 4BS2A 4NLXA 2WSFC 3FZBA 5M2PA 3PY8A 3GJTB 3OHBA 1U1PA 4HDHA 2D7SA 3UVJA 1S0OA 3FK4A 3R3TA 3KK3B 1C0UB 1C1BA 5A76A 1N8RT 1PO6A 3VVTA 1RP5A 1JQGA 3DRYA 3K8WA 4JI8J 4FBUA 5KFTA 4NE9C 3I96A 3ULHA 5KT4A 2DVIA 1JLBB 1D09B 3N9UC 1EETA 3R1HA 4F8RA 2PEBA 4TLRA 2AX0A 4G3IA 1T7PA 1YJVA 5I42B 3HVRA 3RB6A 4JP8A 2X51A 3AD7C 2VA3A 2CPFA 4X4NA 1FWKA 4OZ5A 1JLCB 5C25A 1UPMB 4ECSA 3LPYA 5DDQC 3KLHB 5BYSA 5HO4A 3ZTSA 1K44A 4HHJA 4F0KA 2C2MB 2QL5B 3BGRB 4JUZA 4X2BA 4LRDA 2CG8A 2QLFB 1TKXA 3MMCB 3QIDA 4JI3J 3RAXA 4IKAA 3ISZA 2AJ0A 2B6AA 3UI3A 1NAQA 1LQ9A 2OP5A 2RKIB 4GKJJ 4DSEA 3UD3P 2N3OA 3TQ1A 3C6UB 2UZAA 1VBZA 4DV6F 3GONA 2ALYB 2XGPA 3CCUS 3S1TA 2IDLA 2MKKA 2J0XA 1S7HA 1HWIA 2RJZA 3DOMA 4F7VA 4OI4A 3IP0A 2Y0SD 5KFYA 3QRPA 1KVIA 2HQ3A 3E3XA 2FVQA 3V6JA 2XS2A 1T94A 2WSCC 1N32F 1XJWB 3T6BA 4FXVA 3ZZOA 1WC4A 1HWLA 4ZOSA 1BY9A 1JKHA 3GJRB 1J5EJ 4PPDA 1HQEA 1GQEA 3HVWA 2YPZA 1G3OA 2B7BB 2WVCA 1RAEB 2HHWA 5CYQA 4X4VA 1F6TA 5F8IA 5L8RC 3HULA 3HKWA 2LLZA 2XNQA 1MNEA 4PKDB 4W4MA 2XY7A 4MK8A 1T03A 5IS2A 1QLNA 5B0GA 2LA6A 4NXNF 5KFDA 4M94A 3K5OA 3KHHA 4M95A 5GAGI 2MLXA 5HVHA 3NGSA 4DR4F 5EWEA 2HRUA 1VK8A 2FJBB 3QWPA 2HK2A 2YKNA 1UVLA 3PYGA 1WC0A 1WKJA 1FEEA 3HSDA 3Q0AA 3CC7S 3MTJA 2VG7B 3L09A 2EXUA 3PDNA 3H5YA 3ZZZA 3DOLA 2XC9A 1SV5A 4KAIA 3DOKB 3QT5A 4ZHRB 5J2PA 1GXUA 4JI7F 4X62F 1WJ9A 3IRXB 2AYGA 2E5LJ 4G1PA 1DQ9A 1NJXA 4USUA 3S7RA 3JTPA 1VHFA 3V6DB 1ZBTA 4OI3A 4RWWA 2W4PA 3QT8A 1RHQB 3OL8A 3A3NB 1V3SA 2M7SA 4AQYF 5CXTA 5HJXA 4DQPA 3RBDA 3V4IB 3ZZPA 4PG5A 4XDCA 2WVBA 3G8TA 4OZ0A 3ZZYA 3AOBA 3ETOA 5CZVA 2JNJA 3BBFA 1JNRB 5HROA 1HIYA 1N5YB 1RU1A 2XNRA 4QIGA 2ASJA 3N5BA 3TVKA 2YX7A 4JI0J 4B3SJ 3TUPA 1L3KA 2IM0A 3B6BA 3MM6A 5D4OA 5HLFB 5C2CA 4ITSA 4CYUB 4ECTA 2Y1LB 4WP3A 4NLPA 1MWZA 2CG4A 3G8QA 3N5FA 3DLLQ 2GV1A 4RW8A 2XMUA 1Q7LB 1C2PA 4HI1A 2YPYA 4X66J 5ITHA 3CMES 1V6HA 1FNOA 4N5SA 2ZHOA 3SIPB 4DQRA 5C24A 4RUHA 4P2FA 1RXOB 2F9JA 2FY8A 2YX1A 3DI6A 3K89A 1U48A 2FB0A 4DBQA 4OX7A 3SCLE 4X65F 1S79A 3MPYA 2APOA 4IR1A 3BF4A 4B3TF 5IT9Y 2A2CA 4RW6A 1O6XA 2XWXA 2RD5C 2FQQB 1AZSB 1TL5A 2EKNA 4M5DA 2GW8A 2GO8A 1YRTA 3PYFA 1W2IA 4C0HA 2XSFA 5LSOA 3TI0A 1YJWS 4JI4F 2CJ9A 2V4QA 1X0PA 5K8PA 1AT1B 3PEHA 1HARA 1EKRA 2W8KA 1B99A 4C3LA 2BQRA 3R7NB 1UCNA 5CYJA 5I3UA 1XIQA 3BPDA 4KGVB 4RBUA 4AT1B 4M5GA 2KM8B 4HVZA 4MFBB 5GADI 3NOCA 2AX1A 1PCAA 3R7SB 2HLTA 2DHSA 2CQ3A 4OX9J 1HW8A 3CTRA 1G7CB 2VG5B 1ZPVA 4IQMA 3KLFA 1HYSB 1ZTWA 1C4AA 4ENOA 1QSYA 4J9NA 1MU2A 3RRKA 4DPTA 5D8HB 3HK2A 3BDEA 2EK1A 2YNFA 2BJ1A 4N41A 3VAIA 4IH7A 2OHDA 4U8VA 4NRTA 2IYGA 1E6YB 1IVZA 4CT8A 1TZ0A 5DLFA 1TK8A 2AJ2A 3R2CJ 1NHUA 5KFQA 2JLEA 4LF8F 4J5OA 2CA9A 2G1DA 5L9NA 4ZP6A 2Q1LA 4CO1A 3MAQA 3FBFA 1KHVA 4UZCA 4MAKA 3WQPA 2FVSA 4PG8A 3J81j 4TN2A 2VIHA 4F0HA 2RQKA 1IBMJ 1JLAA 1KQKA 4ZCIA 1TVRB 2RT3A 2QA4G 1MLAA 1B70B 2BJEA 2I5JB 4LUBA 2A6MA 1FRJA 1ZAXA 3JS9A 5D0GA 4AE5A 2BE7D 2ZBRA 1NK6A 1SJFA 2Y9HA 2BRKA 2ZH4A 4C11B 3JYTA 5U47A 3KK2B 1RAFB 3TUZC 4EUVA 3X1LB 1QAJA 1NK9A 3C15A 4QIEA 3D4JA 1S72S 4DR5J 5B09A 2WONA 2AU0A 2BXJA 3MEGB 3W8PA 1R8HA 1MROB 4O3PA 3GYXB 1RI7A 4HR2A 1VK3A 4A46A 3HHLC 4LR7A 5J2MA 3SCJE 5D3GB 3T6JA 3IAS9 2ZDOA 4I56A 4QR0A 3QQCD 5DM6Q 1T95A 2RHSB 4LIRA 5F9NA 1DARA 2OMLA 2QV6A 1IKVB 1TKTB 2CPDA 1BD6A 1B0PA 4EMDA 4USIA 2WB1D 2WVFA 3G86A 1WHWA 1GXLA 3NRBA 4OZNA 2M3DA 4L73A 2RU9A 1KVKA 2LQ5A 1PJ7A 1SIZA 3C19A 1Q8LA 2VPXB 4DL6A 4PXBA 1HPZA 3M32A 4MK7A 5IZHA 2B9WA 2YKMA 2HHVA 2ZOFA 3BH6B 3MMBA 2BABA 2JEGA 1Q8KA 3OSNA 2X3DA 4EBEA 5ETTA 3EGNA 1U1NA 1S1XB 3CULA 4FXWA 3JB9k 2XMVA 1VRQC 1HLWA 4PCQA 4FS1A 1HNZF 3MPDA 3NS7B 4ANDA 1UJ6A 1TFWA 1NZ8A 3T19A 2N4CA 5J1NA 2J6TA 3AODA 1S77D 3VQTA 4CH7A 3KLGA 4UOGA 1U02A 1VDHA 4ECUA 1RQ0A 1T3NA 3T1AA 2VOOA 4YEAA 1DLOA 4DX6A 4PWUA 4MYTA 3FBCA 4WPAA 3HHKA 1UFLA 4TU7A 4YR2A 5E3QA 2GIFA 2DR5A 3LAMA 4KV8B 1WDDA 1FJCA 5HMWA 3ZTOA 3GFYA 4GVBB 3Q8SB 4ID8A 4FF3A 2D3O1 2F8MA 2MSTA 1DY3A 2HGLA 2ZKUA 1RTJB 2WK4A 3CJTA 1DHMA 1NLKL 4A8KA 1XR6A 2F65A 3TAMB 4F04B 1IR0A 2PMZD 5GMKa 1R0AB 1CEZA 2DNKA 4WKRA 2NXJA 4L74A 2DT9A 2RQMA 2HRYA 3EGWB 2OEKA 1FRMA 2JFKA 2WOMA 3VGTA 2Y1RI 3POTA 3DXSX 3ZTQA 3N28A 4OV6A 3HMJG 3TAPA 4DL3A 1R6YA 4KO0B 4DLGA 2RRBA 1F0XA 2JEIA 4DJBA 4I69A 4RKUC 2WBRA 2M5YA 2IRYA 2QSFA 3KMSA 2YNIA 4Z7CA 3ENQA 4ZVFA 2CJKA 4QQBA 1S1UA 2IJFA 3BS9A 3JSMA 3F73A 2UXCJ 4TY9A 4A48A 1FA0A 2W24A 3UNYA 3TWZA 1SQFA 4FN5A 2UU9F 4PQUA 2A1BA 4J9RA 1TTHB 2EC2A 1RT6A 3LWMA 2HG4A 1RTIA 3M8PB 3R5DA 3CJ0A 2ZH8A 5KT6A 4XAKA 1WUUA 1KFDA 2CPJA 2YQ0A 3H5UA 5IXUA 1TL3B 1IKYB 3NGTA 3M7VA 2MGZB 2HEKA 5DQIA 4B17A 1FRXA 2OPSA 3BQ0A 3I0SB 4IFYB 5IQ6A 4ED6A 4UY8T 1KP6A 3C14A 2N3LA 3HKZD 1X5SA 5D0HA 1T0TV 2IAJA 3DLBA 4Q8EA 2DGOA 4G65A 3HVTA 2B0GA 4JI1F 1LXJA 2R8JA 5GAEI 4N8OA 3SEOA 3U1LA 4CLYA 5ETMA 2F8HA 1ZM4A 4HT5A 4ZPCA 4LRFA 1C0UA 1ZH5A 2WRMA 4OYPA 8AT1B 2VDHA 3L7OA 3VQSA 2YWEA 5IQQA 4XDDA 2FZGB 4JI6J 1JLBA 3VAJA 4ECYA 2VUGA 3ZXWA 8RUCA 1CQMA 1VC0A 3CD6S 5I42A 2ZH6A 1U47A 1R3NA 2DGWA 5E0OA 3W5ZA 1JLCA 1ZOTA 4EYHB 3MXHP 2J7KA 1YJUA 3KLHA 2BOAA 2OD4A 2QTWA 3BGRA 2Z4PA 2NZCA 1S76D 2LA4A 3L95X 3MMCA 3LP1B 4WCEQ 2Z57B 3H4DA 2NXEA 3TZXA 4WTYA 5LL6d 3ZTPA 3TR5A 2RKIA 3D5MA 1FXRA 2IBKA 4YHHF 3KMQA 3C6UA 6FDRA 3I4HX 1RA6A 3JTOA 4EBDA 1Y5LB 4GKJF 1RSCA 3K17A 3A3PB 4W98A 4MJKA 3QT6A 3IGNA 1X4GA 2RDJA 1FJGJ 2CNNB 4PEOA 3DYAA 5L39A 2ZH3A 2L9WA 1WHXA 3MGJA 3V81A 3LP0B 3IWNC 1TUVA 2AV5A 3W9IA 2YY3A 3CD7A 1LWCB 1FRKA 2QMUB 1FK9B 2QX0A 3QMQA 4DXLA 1QAIA 2GGPB 5T14A 3OXLA 5B08A 4U7UK 4IG0B 2CXEA 1YIJS 6AT1B 3EWGA 2IVYA 4K4WA 4B02A 5EX3A 4LR8A 3NCRA 3AY0A 2BW7A 5H9EJ 1WACA 1J5EF 2DNMA 1CJKB 4ILLA 1NPKA 5FD1A 2R7OA 5AXLA 3TEGA 5BR8F 4B9SA 4JV0A 3W3SA 3GTYX 4UQGA 2BKOA 2I8EA 4ED4A 3M2RB 2KT3A 3VAFA 2DEIA 3J7A1 2LQ9A 4QPTA 3UDCA 1SC6A 2AEMA 2EFGA 2XLKA 3FEZA 3GSDA 1M1GA 2KB2A 2VG7A 3PKYA 4OJ3A 3ETMA 2V2VA 4RW9B 1YVFA 4HH1A 1ZZNA 1SCJB 4WP9A 1R89A 1DTTB 3DOKA 3VGVA 1NXIA 2CIMA 1VFJA 2FUG9 2FHJD 1T9YA 4DHVA 2IY5B 2ZHBA 2K7KA 1RT3B 2G4BA 4P2XA 3O1LA 5LT5A 2G0IA 1SKWA 3IRXA 3EE3A 2DB1A 2JFDA 2HGNA 3V6DA 1UWBB 2OKQA 4LSZB 1B0TA 1UETA 3CJ3A 1NMEB 2VFRA 1OJ4A 3H2UB 3JAMU 3OTOJ 1KNZA 3V4IA 3BV8A 4ZCKA 2CPIA 3FRYA 2YKQA 5KFAA 2K3KA 1N5YA 3FCWA 4H4MB 2XO6A 3RR7A 3BKUA 3BZQA 5KG3A 5B0BA 1FWLA 5CD4A 2VHGA 5HLFA 3M6WA 4CYUA 1IWAA 1XR7A 2HVZA 2FZKB 3QGIA 3U02A 4B3SF 3NWGA 1QVGR 1YDLA 1DQ8A 3MD3A 3AJ1A 2M2BA 4QIVA 2DH7A 2RS8A 5DRKA 3F44A 2MQPA 2K8GA 4TYAA 1F2HA 2W7AA 4N7TA 1YX2A 3QSYB 1CJTB 3P5BP 1O8BA 2FIUA 4ECXA 4DV3J 5F8HA 2O67A 2YWHA 1X60A 4ICLB 3IM8A 1AUDA 5AJ3J 1U8SA 4FPRA 4NXMJ 3RBZA 1KHWA 1AZSA 1Y10A 4WXOA 2R2UA 4NLUA 2LXIA 4XPEA 2FYXA 1G6BA 3NEKA 2EG1A 4B9TA 1OY9A 2FZCB 4Y2KA 3PW4A 1HR0J 3UE2A 4I2QB 2ZC4A 1IKXB 3KUGA 2EFNA 4DSIA 3C8YA 3NBPB 4GO5X 3M8WA 1RHKB 4MFBA 1LFPA 1VQSA 5EN1A 4CQ1A 2LEBA 2WW8A 2J7WA 4QJVA 4LQ9A 2YNHB 3IN5A 4K7QA 4BC7A 4EYIB 3PHTA 2CQPA 1LWFB 2E9TA 4FNIA 1FCAA 1Z2ZA 4CI0B 2HRTA 3DHWC 1TR0A 2XYGB 3T5KA 1TP7A 5GADU 2CQ2A 4ZP7A 3SSRA 2J9DA 2H65B 1E6YA 3D6HB 3A8JA 3UW1A 3FSXA 1B7FA 3VV2B 2I2YA 2UVUA 1HFEL 1FXDA 4NRUA 1V5VA 2VC1A 3RW7A 2QC3A 2YWGA 5HN0A 1YGYA 3KLIA 2LMIA 2CADA 4IRKA 3UR0A 3FCVA 3IA0A 3CCZA 1FDBA 4KGMA 3WDOA 1TVRA 2FD2A 3J80U 4Y00A 4QBUA 4ZDNA 3GWCA 1KKHA 2I5JA 3MDFA 2AYBA 3PG9A 2XI2A 2DRAA 1IBMF 2M70A 2VQFJ 4OYZA 3T5HA 1LK5A 1U2FA 3CF5Q 1FTCA 3P49B 1Y5NB 1HMVB 1JJ4A 1NU4A 2QO3A 4C11A 3WX8A 4DV2J 3GG0A 3OJSA 1OQ3A 1YK9A 2BM1A 4UUWA 5KOXA 1TL4A 3Q2TC 1RWKB 3MEGA 4FYXB 4I67A 1TKDA 1RHJB 4ZP9A 1VYAA 2XHCA 2ABYA 4DOZA 3MCSA 1Z1ZA 1VS3A 2W4CA 1RYRA 4DR5F 1LKZA 4A4JA 4OZ2A 4ZLNA 5D3GA 4BWMA 3Q23A 2EK6A 3UDLA 1ZYQA 2H5EA 1WC6A 3W62A 1CJUB 5IC6B 2FVRA 2MKHA 3M30A 3PYEA 3CO9A 2R7RA 3I56S 2PFFB 1U1LA 3ENVA 4P9SA 2DPIA 3FJ2A 4CRJA 2CYYA 3MUTP 4OJ1A 1WNEA 1D3WA 2ZJRQ 6FD1A 2KVIA 2PEHA 1PC5A 3BN4A 2HQIA 2IRXA 2KYXA 3O2IA 2VONA 3ZZRA 2J5AA 2DCUB 2VICA 2HHXA 4MTPA 1Y11A 2DO0A 3D3CJ 1Q86T 4DX8H 1NM2A 4KHMA 4L72B 1RA7A 4CNZA 2I6WA 4F4KA 5DGAA 1WOSA 1HL6A 3M8QB 2Z0GA 4J9UE 4IO1A 2GC8A 3V6KA 4QWDA 4EBCA 1FE0A 4K5SA 4OX6A 1S1XA 4DV0J 1Q8BA 2V8PA 3CB4A 2G1HA 3PHEA 3TVYA 1VHIA 5FLXY 1UEUA 1S5ZA 1GMVA 3QFWA 2OAUA 4YN3B 4EO8A 4UY85 1H3DA 1H74A 2RE1A 4P52A 2XMKA 1TK5A 3HF5A 1M5VC 4H4OA 5H9FK 3QAUA 2C2EA 4KV8A 1HA1A 2KU7A 3OQ2A 5ETNA 4GVBA 2I38A 1Y0HA 5KFKA 3RRGA 3RU0A 4OHZA 3TA1A 5ETPA 1NK5A 3NNHA 2XLIA 4NLRA 1RTJA 2R8HA 2UUCJ 3MOZA 4WFZA 3GCWP 3CDEA 5HMZA 2F8EX 1UVKA 1VBYA 1RBAA 3RG6A 1S9FA 1R0AA 3C6TB 5A0YB 4PUOB 2PSZA 1VQ9S 3BYPA 4NA1A 2VBYA 3VHQA 1HBUB 3J7ZT 1S9GB 2OELA 4KFBA 4PWDB 3ILOA 4X4UA 1BGXT 2R7QA 2LQBA 2OTJS 4KO0A 3FZ2A 2Z2LA 1JJCB 3MM7A 3O44A 3ITHB 1FKAF 5H1SV 3CD5A 1NRKA 2LFVA 1BQMB 4DR1J 4DR2F 4DPXA 2R8GA 4K4SA 3LGMA 1AFJA 1JJHA 4M5IA 1JK9B 1TMJA 4ZCLA 1Q0NA 2FLLA 2X1GA 3RB3A 2YVSA 2QMXA 2AF6A 5L1KA 4J90A 5D4PA 2H3EB 3BSOA 1TAUA 2B4VA 5HBMB 5E3AA 3GP9A 4IRDA 4FKXA 3M8PA 3MM8B 3NKYA 4CH0S 5E3CA 5DG9A 1R8CA 3MF5A 2ADCA 1IKYA 1YHQS 2Z30B 2MGZA 2ZVSA 3I0SA 2BQ3A 3GR0A 3W65A 4CLPA 1HHQA 1SJ3P 4GC7A 1Z2LA 3W2WB 4NMXA 3AQOA 1ZAWA 1L3UA 3CMQA 3UCUP 4MIWA 2KZMA 3SSQA 3MECB 2DGUA 3QRQA 3P6YC 2RMLA 2AEJA 4YQWA 1ZETA 3TZWA 2HIQA 3EUNA 7AT1B 4CLLA 4ZN1A 2P2CB 3RYLA 4CLZA 3EGZA 5K8NA 2QYGA 5GAEU 5HMYA 4Q43A 1WG4A 1XR5A 4Y6IA 1VBKA 3NNCA 2RAQA 3BR8A 1NNDA 1IBKF 2CWXA 2BR0A 3FC9A 3AT1B 1W26A 3B82A 3UFCX 4JI6F 5F9LA 4F4ZA 2PT0A 1WDTA 1U45A 3J80Y 4FVCA 1NPPA 2WSEC 3ADAC 3S8SA 4PAAA 4KPCA 1E6VB 3N6LA 1HI1A 1SKSA 3R7BB 4E98A 2CQCA 1CVJA 3LP1A 2CRLA 3U7JA 3MAAA 5KFBA 1YITS 2IVMA 5KFEA 1RHMB 4IH6A 1H2UX 3W60A 2IM3A 1OO0B 3PJWA 2BOPA 3R5GA 2XM3A 3U1NA 5K8MA 1RT1B 4I1TA 3OSPA 4E2FB 2W9AA 4C3KA 3BR9A 4MKAA 3MR6A 4DFJA 4DS4A 1B7YB 1ACMB 2MKSA 3LO3A 3DXBA 3D6MB 3G8SA 4DSLA 1SC4B 4ZPAA 4ZPVR 5IOLA 3PO5A 5GMDA 4WZQA 3E01B 3HO1A 2P6SA 5HI7A 3DNCA 1SJQA 1S6QA 2W8LA 4WKYA 3IR7B 2C3UA 3CD0A 2R7TA 2M0GB 1FK9A 1FJGF 5IWAJ 1AFIA 2XO7A 2GGPA 4KBIA 1ZM2A 4OLPA 2DGVA 1RUSA 4IG0A 2YTCA 4Q5VA 3G6ES 3MR7A 2LQJA 2EFPA 1CSJA 2UUBJ 1RWNB 1NDCA 3A8EA 1R8BA 4OHXA 1Q5YA 4ES2A 4QWAA 2HAIA 5DDOC 2LYVA 4B9NA 2PN6A 3I32A 2XG8A 1IM4A 3M2RA 1URNA 2CPHA 2QGFB 3EM1A 1WHVA 1JLGB 5CD4H 4B3OA 1WC1A 1A0OB 3PFOA 5T7LB 2B5JB 3PEJA 4CWBA 4ZVOB 2HMIA 5KFGA 1VIXA 2VZ9A 2VKZG 2MJUA 3OTDA 4OYMA 5CAAA 3G87A 3MPUB 1IQTA 3HZEA 2V94A 2C2ZB 5I3QA 3I9V9 1FE4A 4K4YA 2IBOA 1QVFR 4RW9A 5AE2A 1HWJA 1KDNA 3QAEA 1RADB 2CQIA 2GAHC 3NGKA 1DTTA 3KYLA 2CQGA 3ICLA 1ZM9A 4RUBA 2CNLB 1R0CB 1RT3A 2CQBA 5HJYA 1WSVA 3DN9A 2OI2A 1TV6B 2PFDA 3TARA 2W01A 4YDDB 1RTHB 1U7LA 3DFEA 2CZ4A 1R8PA 1UWBA 3MCOA 3K7RA 1XMOJ 4I6AA 3BO4A 1QDUB 3AQPA 1SJRA 4WE1A 1NZAA 4NWBA 3X3UA 2NZ4A 4YR0A 2E7VA 1WF1A 5K14B 3HI9A 1L3TA 3GJSB 1QUVA 2UXBJ 4PYAA 2B7CB 3OTOF 1ELOA 4H4MA 1KRPA 2AIRB 3OTBA 4NI2B 2JRSA 2HQFA 3AHPA 1QY7A 2X3GA 1KEKA 2NLWA 3N0VA 3MUMP 2CJYB 4JI2J 2QA4S 2ZBQA 1WD6A 4PZVA 3OXFA 4WFNQ 3TJ8A 2DY1A 3U1MA 2CJAA 1YWXA 4PG4A 2UUAF 3DDNA 2MJNA 4RX6A 5G4DA 1QTNB 4I68A 3CNQP 5GMEA 4DDFA 5JJBA 4EZ6A 2KVQE 3HXMA 5KFNA 3RB0A 1RU2A 2IJRA 1ZS6A 3FVYA 1U1MA 3CPWR 3VVUA 1CJTA 4K4VA 3KNGA 1N36J 4WJBA 1IKWB 4AL7A 4NOHA 4IR9A 4H54A 1BUXA 2AGOA 3K5PA 1QJHA 3BREA 5K20B 4ED0A 4A8QA 4DV3F 4Q7AA 2GFFA 3HFVA 2HKEA 4C8KA 1S1WB 1NKCA 2GS8A 4TXSA 4M5LA 2XY5A 2BV3A 4MKBA 4NXMF 1T9WA 3OBIA 3KG1A 2GMLA 2HHHJ 2GQ2A 2Y0BB 5C5JA 2V0NA 3QJJA 4K4XA 2XEXA 2E7WA 4RR5A 3BO2A 2J9CA 2L41A 4I2QA 1IKXA 2ZUGA 1N88A 2BRLA 3G4SS 3NBPA 1WEZA 2DNQA 4AL6A 1SPBP 3AJDA 1S6UA 4ID5B 3KLVA 2YNHA 4AD6A 2V63A 5THWA 3BJYA 1DJ0A 3B54A 4TLQA 3IBFB 3QJLA 2K06A 1RKJA 1TUGB 3LPEA 2VF3A 4X4OA 2KT5A 2CPZA 4LSNB 1JLAB 4HKQA 2CKWA 4CDIA 4P73A 1S12A 4DN0A 1FNMA 3NNAA 3R5BA 3VAGA 1KFSA 2BJ7A 3DU5A 2LEPA 2DRDA 5J1PA 2RDIA 4JB8B 1X4AA 2GMJA 2ZBCA 5KFMA 3HT0A 1KS2A 4USWA 1VMBA 5E3PA 4NYPA 4WZMA 4EO6A 1IBCB 4CNYA 2ZH9A 3H2VE 4AFFA 2WAQD 2QLXA 3M8ZA 4ZN3A 5EHHA 1RGVA 1WKKA 4GO7X 1NK8A 4KTQA 5EUHA 1U6FA 4JV5J 3KG4A 5EX0A 3CCMS 3BKTA 2CFXA 4NLTA 2KJVA 4WK3A 2N4DA 2O66A 5M2UA 2VQFF 2CQ4A 1S57A 2GIRA 3QATA 2MKJA 3HHLB 1F2GA 2QYCA 2CPEA 4DV2F 1HNIB 3NY0A 5IT4A 1KQGB 2OSQA 1RHUB 2GVDB 1UW9A 1FFSB 4RNOA 2P9CA 2GIQA 1VI7A 2QT7A 5A8RA 3IBCB 3DRSB 2HS0A 3J7Z5 3SQGB 2A3JA 3PKMA 5G0RB 5EWFA 1XERA 4PYDA 1C1CB 2QE5A 1EZZB 1CJUA 1K47A 2GHPA 1TKZB 3PW2A 4DPWA 3IAM9 2MKCA 1CG2A 1BE4A 3MMBB 4J37A 3EZ5A 3CVKA 4RBTA 5LMUF 4X4PA 1YRUA 3G6YA 3P4UB 1DBDA 4ED7A 4NCAA 1EARA 2MDAA 2V9WA 3M1VB 3NGRA 4G1QB 1TL1B 1IJEB 2B4OA 3UN5A 2HW3A 2EVZA 2XLJA 5AE1A 3CT9A 1SJ4P 5EWGA 1YJ7A 5E7OB 4CTAB 3KLGB 3R5JB 4LQ3A 1IN0A 3K0JA 3M8QA 1DLOB 4LSLB 4ETXA 3J7YI 5K8OA 5DG8A 3OL6A 4LJMA 3BSNA 2VFUA 4DR3J 2A0FB 3QPIA 1RZMA 2QLWA 3GV8B 3G82B 5A2QY 2COLA 3IC1A 5HQ8A 2HNYB 4TY8B 2B9XA 2W4DA 5F0UA 4LRCA 2HURA 2R4FA 2JVRA 2AZ3A 2O5DA 5BJRA 3FBBA 1S1TB 4Y28C 1R6VA 4NL5A 1REVB 3Q8RB 4P7VA 1WI8A 2ZVIA 1VQYA 5AXNA 1YRXA 1RYSA 1JXLA 2EI5A 4DV4J 2MTLA 4KIAA 3QJPA 3L7PA 3EZUA 2W25A 1LWEB 1SB6A 4OYOA 3C6TA 5A0YA 1Q79A 4PUOA 4B9LA 1HBUA 2HBRB 2GA7A 1S9GA 1FTRA 5BXIA 2V2ZA 3GU0A 1S1UB 2AWZA 5HSPA 5HVGA 3DLEA 1R8AA 3RAMA 5KFIA 2O01C 4ZP8A 2R9LA 2MQMA 2V69A 1YBTA 3GIKA 2JEJA 3FMWA
chains in the Genus database with same CATH topology
1FXRA 3GZ7A 4RLEA 4DN9A 2VPZB 7FD1A 4TQSA 3CMAS 3MR2A 2IBKA 2RS2A 1S9EA 4YHHF 3KMQA 4IUFA 1UKUA 1KR4A 1Y00A 3C6UA 3FFIA 3MM6B 1RTDB 3VAMA 6FDRA 2DIUA 3I4HX 3H40A 2AD9A 2FLOA 1RA6A 2PDAA 3JTOA 1FRIA 5K5MA 2U1AA 3C3LA 3V6HA 4EBDA 1Y5LB 4GKJF 2GJIA 2F7VA 4DMZA 4PG7A 1VC6A 2HHHF 2J0SD 5LJ5Y 2MYFA 1U6ZA 3HHEA 2EKYA 2SXLA 4RW8B 2AJQA 4MJKA 2WB4A 2FC8A 3RZAA 3UPFA 4F50A 1S10A 3CCLS 3IGNA 3AJ2A 1OSCA 1X4GA 3DU6A 2XGQA 2RDJA 3G9CA 2AGQA 5CQGA 4DR1F 1WELA 3I5AA 3DYAA 2Z8QA 5L39A 4DSFA 2DHAA 1Q1KA 4NLQA 4O3QA 3OTEA 3TUIC 4YOEA 3HPOA 2ZH3A 2L9WA 3AA9A 1WHXA 3MGJA 3V81A 3B4DA 2NXUA 2DNRA 3LP0B 2RU3A 3IWNC 5GAHU 2D74B 1OSDA 1TUVA 5C24B 2AV5A 3PR5B 1IXKA 2YY3A 3CD7A 1LXNA 4Y2CA 1LWCB 5DM7Q 1FRKA 2D9OA 4NLVA 5L9XA 3Q8PB 1XTZA 1FK9B 3LQVA 3QMQA 2J9DE 4E0DA 4LMZA 1VGYA 2FY1A 1VQKS 2BANA 3MMAB 5HBMA 3G6VA 2BACA 3DI6B 1QAIA 3P5TL 4X4SA 3SYZA 3GMGA 2GGPB 4EFAC 4BDPA 5T14A 3K5NA 3DDKA 4G1IA 1N0VC 3M05A 3OXLA 5B08A 2CZVC 3MM8A 2KH9A 4U7UK 4IG0B 1YIJS 1WEYA 1EP4A 2OPPA 1RKIA 1SKRA 4D3HA 1LW2A 2LEAA 2IVYA 4MYUA 3KLEB 3QGHA 4K4WA 4B02A 3MFIA 1FF2A 2OPQA 4RW6B 4C8OA 2OPRA 5EX3A 2NSBA 3PO4A 1UVJA 3NCRA 5KFWA 3AY0A 1JJ2R 5H9EJ 4Q2LA 1WACA 1J5EF 2DNMA 4ILLA 4M5DB 2VPYB 3DRXA 5FD1A 5AXLA 2R7OA 4B9SA 2KTQA 5BR8F 4JV0A 3W3SA 4ECZA 3IRWP 3RBEA 4UQGA 2VB6A 2I8EA 4AUKA 4DUZF 3K58A 2DGQA 3M2RB 2CVIA 3CJ4A 5KTQA 2D3OR 2KT3A 1S6PA 3VAFA 2M8DB 1Q53A 1P1LA 1M5HA 2YNGB 1BQNB 4URGA 2E5JA 3R1LA 3W2WA 3M9OB 4LF4F 4Q2MA 4XK8C 3J7A1 2JWNA 5LSRA 2LQ9A 2JHEA 4DFPA 5E2QA 4QPTA 3QZ7A 3UDCA 2E1RA 2FTRA 1SC6A 2JL9A 3PACA 4TNOA 2MQOA 3HHNB 4C8YA 2AYEA 1SI9A 4X84A 2G9OA 2ERRA 2RF2A 3I0RA 2E1MC 1A7GE 3SDEB 1VQ7S 2EFGA 2QA1A 3MECA 4ICLA 2EW9A 3EYZA 4ECVA 2XLKA 5AE3A 3FEZA 4N47A 3GSDA 4EU0A 3CIMA 1RDRA 4FYDA 4J9LA 5I3UB 4YP3A 5DDPC 2IA0A 2KB2A 1N0UA 2RVJA 3IXQA 2VG7A 3PKYA 1D0EA 4OJ3A 1N33F 2R8IA 3MM5B 2LXFA 2KRBA 2PA8D 4RU2A 2LXUA 4C9DA 2G13A 4RW9B 1H38A 2JEFA 1YVFA 2JSXA 4HH1A 1HWUA 2EG2A 2FVPA 1NO8A 4BHQA 1X5OA 3CWJA 1ZZNA 4OV1A 1R89A 1DTTB 3KKFA 4C97A 1VQ6S 3DOKA 2W7OA 4QIWD 2XS5A 1S48A 2D1CA 2CIMA 1WF2A 1VFJA 2FUG9 3CDBA 3KLFB 2LECA 4JV5F 2WBMA 5F41A 1UA1A 3DLEB 2CQ1A 1F5AA 2DD8S 2FHJD 2VKRA 3DM2B 3FSYA 4HTIA 4DHVA 3HVAA 2ZHBA 2J7UA 1MU2B 2K7KA 1F60B 1RT3B 2G4BA 3O1LA 2R8KA 5LT5A 4NLYA 1SKWA 2KZZA 3IRXA 2YNFB 2VG6A 4WFYA 2J9EA 1VRUA 3GQCA 2DB1A 2D41A 3ZFVA 1KD1T 3CEDA 3B8HA 2JFDA 3G71S 3ZZUA 2AJ1A 2HGNA 2BQUA 1DZ5A 3V6DA 4DG1B 1UWBB 2OKQA 4F26A 1Y7PA 3DLKA 3N6NA 1B0TA 2JLGA 1Y5IB 1UETA 3CJ3A 2ACYA 2VFRA 5DDRC 3H2UB 2KFZA 2HFZA 3NMRA 1E6VA 2MZJA 2E1CA 1B64A 3VZHA 1KNZA 4CO5A 2VFTA 3MEEA 2HVIA 4YY3F 4DSKA 2ZFHA 4ECQA 3V4IA 1UA0A 1LWFA 5JXSA 1N56A 1FKOB 4RU9A 2BE2A 1M5KC 4PXDA 1WWHA 1X4BA 1FDDA 4ZCKA 2LDIA 4RZRA 2CPIA 4CH1A 3DYAB 1FKPA 2F1FA 4A8XA 3FRYA 2YKQA 3OFHA 5FJ4A 5KFAA 2K3KA 4DPOA 4YB5A 3PW0A 1N5YA 4DQSA 3DRRA 3V81B 4H4MB 3RR7A 1MW7A 3CDUA 4UQTA 2OD6A 3IFEA 5J1EA 5KFCA 3QIPA 2DNNA 5JVGQ 3BZQA 4A8FA 3SFUA 5KG3A 1H6KX 4TU8A 1KSPA 1XBWA 2UXCF 3DRPA 1RT1A 5B0BA 1HNXF 5HMXA 2NREA 1MMDA 3DLHA 2JLFA 2WHOA 2L3MA 2HHUA 5HLFA 2ZNYA 3M6WA 4LVOP 2NS1B 4RBVA 3UR3C 3J81Y 4Y3CA 3ZC4A 3SZ2A 2YKPA 3LF0A 3US5A 5GVQA 1D8ZA 1XR7A 2HVZA 3B4MA 4AXIA 1HHTP 4WK1A 3THVA 4DFKA 3R5CA 3QGIA 1VRTB 1FD2A 2PD1A 1G2EA 4WU3A 1GX5A 2OPPB 2ZZNA 2EC0A 3U02A 4B3SF 3NWGA 4W90B 1QVGR 5KFXA 3I6PA 1DQ8A 3MD3A 3KFWX 3AJ1A 4ZPDA 5KG5A 2M2BA 4QIVA 1QE1B 4ES1A 2OPRB 3BQ1A 2NUUG 4RW4B 5ADZA 3WX4A 3JYTB 2DH7A 3GILA 3CJKB 4G6VB 2RS8A 5DRKA 1XN9A 2IC3B 2IYIA 3E01A 3ISNC 4IH5A 2W9CB 1T05B 1XNQF 2R7UA 3FQKA 2ATLA 1SH2A 1IUJA 2LU1A 3F44A 2CJQA 2DTJA 2MQPA 3G96A 2WONB 2KXFA 3A1YG 2XMJA 3T9ZA 2R7WA 3AB2B 2K8GA 2NYIA 2DIVA 1S1VA 4TYAA 3I87A 2F3JA 2W7AA 2UVWA 3SV3A 3MM9B 3D1QA 2JX2A 2IM1A 3MTKA 3OFEA 5KFVA 5IM0A 1XMQF 1NK7A 3CUNA 1RK8A 1O8BA 2FIUA 5J2MB 3K5LA 3GFZA 4ECXA 4DQIA 4O4GB 2CQ0A 5F8HA 3CGIA 2O67A 5MAOA 1HNVB 3NMAA 2YWHA 4KKOA 3V4MA 3I0RB 4HI2A 5IWAF 2VC0A 2XULA 3N79A 3QGGA 4URQU 5F0WA 1HMVA 4ICLB 5MLCV 1VBXA 1Q4RA 3I5CA 1N4LA 1D9DA 2GMHA 2AQ4A 1AUDA 3MPVA 1JLFA 2ZE2B 3PRDA 2V2KA 4QIFA 1U8SA 2LVWA 3MFHA 4FPRA 1L3VA 4NLDA 2B43A 3TRGA 3Q22A 2J6SA 3QO9A 3PM9A 4KJIA 3MPWA 2DR8A 3MR5A 1KHWA 2W9BA 2HFOA 4WXOA 5DO2A 4ETZA 1NKBA 2R2UA 4NLUA 1GTEA 2QEXS 3OR2B 1G1XA 1JNZB 5A8WB 1UJ4A 2UUBF 1S0MA 2LXIA 3U27A 4XPEA 2Q43A 1G6BA 2BW2A 1HQUA 4C8ZA 4RW7B 2ZJQQ 2DHXA 4QU7A 1JLGA 3M6VA 4NX9A 2EG1A 3H59A 3KK1A 2N7CA 5CZXA 4B9TA 5T7LA 1S99A 2B5JA 1D9FA 1N5SA 4NYOA 2BJDA 1S6OA 2RB7A 3V5RA 2WCXA 1Y4ZB 4BWJA 3O3LA 3H20A 1RT5B 4OHWA 4Y34A 1NEEA 4Y2KA 3VF0B 3VR1A 4DR7F 3PZPA 4L6V3 3PW4A 5A8KB 3N6MA 2ZJPQ 2FC9A 3CCQS 4ZPBA 3UCZP 4O44A 2BZ2A 1VQMS 3IGVA 1IQZA 3UE2A 4C4WA 2HWTA 4QCLA 2VG6B 4I2QB 2ZC4A 1HPZB 1IKXB 1S4FA 3M32B 2L08A 1HBOB 3ENWA 3MEDA 2FLNA 2EFNA 4DL0C 4DSIA 2YKMB 3C8YA 4ZVEA 3NBPB 3TO8A 5L1JA 2HVHA 5F8MA 1W25A 4GO5X 1L5UA 3D2WA 2R2SA 5FDLA 4MFBA 1LFPA 3FGVA 1VQSA 4J9MA 2XSJA 3KOAA 1RT2A 4HTJA 5EN1A 4CQ1A 2LEBA 2WW8A 4QR1A 2GQQA 3JSYA 5E3RA 1A6LA 2J7WA 4QJVA 2CQDA 1NHVA 3P3DA 4LQ9A 2YNHB 1DQAA 2M9KA 4ILRA 2QFJA 3IN5A 2ZHAA 4BC7A 4EYIB 2CQPA 3LGNA 2CQHA 4X4RA 3KG0A 1LWFB 1GAOA 4QW8A 2MMYA 4OZLA 2FHJA 4FNIA 1FCAA 2AJ4A 3K59A 2E9TA 4QYZJ 1Z2ZA 4CI0B 4LF6F 3DHWC 4YDXA 1TR0A 3DLJA 1HHSA 5KT2A 1SL1A 1Q82T 1Q81T 1N5QA 4MKYA 3T5KA 1VJWA 1TP7A 3CCVS 3MI7X 5GADU 2CQ2A 5LJ3Y 4ZP7A 2XB2D 2IA6A 5B0AA 1APSA 2DNLA 4WYWA 3SSRA 2E29A 2J9DA 5KFLA 1VQLS 4JV2A 3IG1B 4F3MA 4K50A 1TV6A 2IHR1 4IG3B 1ZPWX 4OI2A 2KN4A 5E5NA 1Z4UA 2POKA 4I4BA 2IMWP 1E6YA 1RTHA 3BDPA 2M52A 1XWLA 3UW1A 3FSXA 3PRBA 4D3GA 1B7FA 2I2YA 2UVUA 1HFEL 4O3SA 1FXDA 4RWXA 4NRUA 1URRA 2F9DA 3D1HA 3PXGa 4M63A 1JXEA 5CYMB 2VC1A 3RW7A 2FHMA 4DFMA 5JUMA 1SBRA 4OZJA 5F3ZA 4OL8A 4CO4A 4OI6A 2RUGA 1AW0A 2QRRA 2YWGA 3TVZA 5K14A 3SSSA 5HN0A 1YGYA 3KLIA 4EGLA 2J6UA 1UVIA 2LMIA 4O3RA 2HWHA 3KHRA 4RUCA 4C8MA 3UR0A 2C3YA 1XMOF 4FBTA 4IRKA 2HHPA 2MZTA 4LT6A 3RRHA 2OMOA 3LP2A 3CCSS 4DV7F 3CJ2A 4JI5F 3IA0A 3JSRA 4CCHA 1SJ1A 4WYLA 1MMLA 3CCZA 3CDWA 4LIWA 1X9SA 2DGSA 1FDBA 4JOUA 3KJVA 4KGMA 1P6TA 4O0IA 3MR3A 2UP1A 4O3NA 1TVRA 1UEVA 3WDOA 2FD2A 1I1GA 4IRCA 3I82A 4OFZA 2KO1A 4Y00A 4QBUA 3WC0A 1H2VZ 4ZDNA 3GWCA 4R5PA 2I5JA 3MDFA 5KG4A 2AYBA 2XI2A 2DNPA 3F41A 2VOPA 3PJXA 2MY7A 1K73T 2DRAA 3OTCA 2AGPA 2ADBA 4Y2IA 1IBMF 4N8NA 4QWBA 3THPA 1Q7YT 1CC8A 3KTQA 3CCWA 4B3MF 2M70A 3TYTA 3KK3A 4DF8A 1C0TB 4KT0C 2K7JA 1YJ9S 3T5HA 1LK5A 1U2FA 3IWLA 3FEXB 3WBZA 5IFMA 4ZA1A 1N6QA 4V19X 1X4FA 1FTCA 3CF5Q 1Y5NB 1HMVB 2VPWB 1LW0B 5KG0A 5D78A 1NU4A 1JJ4A 2QO3A 1WEXA 3GE9A 4C11A 2WOMB 1JLFB 3HLUA 3GG0A 4JI2F 1WI6A 3MUVP 1FVQA 1OQ3A 3POTB 3OJSA 2BM1A 1OQ6A 3NS6A 4ZCMA 2JC0A 4UUWA 5KOXA 3RAQA 4Z2XA 2W9BB 1U4BA 1M5PC 3THTA 2P9EA 1SXLA 1TL4A 3QYYA 4USJC 3Q2TC 1IJFB 1K9MT 2K2PA 2XMWA 3MEGA 1F9FA 4C3MA 4LFAF 4I67A 4JV1A 1HQUB 5DQHA 4B08A 1ZM3A 1TKDA 4ZP9A 3PFEA 1UMJA 2PE8A 2ABYA 2L9NA 4DOZA 3MCSA 4A8MP 1Z1ZA 1VS3A 2W4CA 1RYRA 2E5HA 4DR5F 1LKZA 3C66A 5DETA 2MY8A 4A4JA 5BYQA 5L1LA 1IKWA 3S01A 4J9PA 5D3GA 2ROGA 4YB7A 4KC5A 4BWMA 3Q23A 2EK6A 1QAXA 3UDLA 4LFCF 1ZYQA 2H5EA