5F0WA

Crystal structure of human copper homeostatic proteins atox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of tetrasilver bound to human copper homeostatic proteins atox1 at 1.7 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Copper transport protein ATOX1
total genus 18
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5f0wA00
1Q53A 3DXSX 2AJ0A 2VH7A 2GFFA 2QLXA 2KT2A 1Y9OA 1YJRA 1R6YA 5F0UA 5B0GA 4Q2MA 4OJGA 1V3ZA 3VTIA 1YJVA 2AJ1A 2N4CA 1GXUA 1P6TA 3BDEA 1KQKA 1Q8LA 1QUPA 1URRA 2FIUA 2K7KA 1WD6A 1YRXA 2W4DA 3BM7A 1S6OA 2HLUA 3HDSA 1N5TA 1TUVA 2IYIA 2HLTA 2OAUA 1KVJA 2QLWA 4OIXA 5A6WA 4A47A 2BYCA 2GV1A 3F44A 4YDXA 4F67A 1OQ6A 1CPZA 2HIQA 1Q4RA 2XMKA 1TL4A 2GGPB 5IXUA 2OD4A 3QMQA 1SB6A 2W4CA 2RSQA 4HH1A 2HFNA 4QOTA 4Y2KA 5B0FA 5B0DA 4OJ1A 1OSDA 1Q8BA 1AW0A 3HFKA 1FVSA 3TRGA 3TOQA 3MZIA 1N5VA 1OPZA 4EFAC 1LQ9A 2BBEA 1TZ0A 2XMVA 3HHLC 4HI1A 2GA7A 3FMBA 4DL0C 2OKQA 4Q2LA 1SQEA 2IFXA 1X8DA 1YJUA 2LQ9A 2OMOA 1FESA 1RJJA 3K7RA 2AP6A 3CJKA 2HQIA 2ROPA 1FEEA 2OD6A 2RU9A 2ROGA 1SI9A 4A48A 5B0BA 5F0WA 2BJDA 2KKHA 3UDCA 5B08A 3HHLA 2FB0A 2KYZA 5K9FA 2EW9A 1YJTA 3QGPA 4A46A 2K7JA 1P8GA 1MWYA 2N7YA 3KG1A 1AFJA 3DCAA 2RILA 1MWZA 2XMUA 2PGCA 3TNVA 2LQBA 2K1RB 3BF4A 4FNHA 2VV5A 2KT3A 2BJEA 3T9NA 4HH0A 4Y2MA 2XMMA 2BUNA 3LGMA 4FNIA 4OJHA 3FRYA 1U7LA 4U9RA 1FVQA 2RMLA 2ASYA 4Y2IA 2XMTA 5A6PA 1XBWA 4NPOA 5B0AA 3WDOA 1JK9B 2IYGA 2OFGX 3BB5A 4ZA1A 1GXTA 1TR0A 1X7VA 1OQ3A 1ULRA 3BR8A 2K1RA 2ACYA 5B0EA 3MCSA 3IWXA 2QYCA 3IWLA 3KNGA 4HI2A 3FGVA 3KKFA 1W2IA 4YEAA 5T7LA 3LGNA 1VQSA 2XMJA 3BN7A 3HHLB 5B09A 1APSA 3KG0A 2AW0A 1FD8A 3E8OA 5B0CA 1YG0A 1VQYA 1AFIA 1FE0A 2ZDOA 2PD1A 2Q3PA 2JDJA 1CC7A 1JWWA 1Y3JA 1K0VA 2FTRA 2FHMA 3HF5A 1X0PA 2XMWA 4OJ3A 1Y3KA 2L3MA 1CC8A 4NL5A 4DPOA 5KAKA 1Y0HA 3GZ7A 3CJKB 3LO3A 5T7LB 2ROEA 3BGUA 2OP5A 3I9ZA 2GGPA 1S6UA 2ZDPA 2HFOA 4DN9A 2GCFA 2N4DA 2W4PA 2LXFA 4ZOSA 1KVIA 1N5QA 2G9OA 1TL5A 4A4JA 2OFHX 3HHLD 1FE4A 1N5SA 2K2PA 2GO8A 4HL9A 2CRLA 1IUJA 2LDIA 2QIFA 3HX9A
chains in the Genus database with same CATH superfamily
3NGRA 5HMYA 2BW2A 2XWYA 4DFMA 3OTBA 4NXMF 1Y9OA 2IA0A 5F0UA 3CTRA 4X66J 2O5DA 2DNMA 2YNIB 5FLXU 4FS2A 1ZTWA 2N4CA 1LV5A 3NBPA 5A76A 1RWWB 3T5LA 2ZOGA 4M94A 2FDNA 3M8PB 2QFIA 2R2RA 3B82A 3OTOJ 1HW9A 4AE5A 3HP6A 1G3OA 1D8YA 5CYMA 3T6JA 3TW0A 4DXLA 1FJGJ 1O6XA 3VAHA 1IBLJ 2BEFA 3VAKA 4H4KC 1Q16B 5K14A 1LWXA 4YDXA 5A8WB 3E51A 3WBZA 1NDLA 1MNEA 4OZ2A 4DWIA 4IH5A 1KQFB 2AX0A 1F9FA 2V4JA 2AYGA 1EETB 4QOTA 2W9CA 4JI2J 1OSDA 1GTEA 5HROB 1FVSA 1VJQA 3QAEA 4P71A 4CLYA 2DR9A 2QX0A 1IXKA 1WI8A 4QIVA 2QSFA 3TX8A 1VRUA 3BH7B 1NSPA 1QD1A 5C5JA 2AZ1A 2VODA 5DGAA 2DH9A 3D0GE 1Z1ZA 4ZMMA 3OTCA 2FVPA 1YJUA 2LQ9A 3WC0A 2UUBJ 2XQCA 1JNRB 3TX0A 3DXBA 4JYAJ 2HHUA 1IVZA 1NO8A 3DDNA 3J80Y 4FVCA 2VICA 3I55S 2DRDA 4P74A 1UJ5A 2YWHA 3L7UA 4CZCA 4OMFG 3MMBA 3PX0A 1PYOB 1PILA 2BANA 2O01C 2ZUGA 1DARA 2QIFA 4OYPA 1RCOB 2IIHA 1RTHB 2MKJA 4O4GA 4XPCA 2F4VJ 3OL7A 2CPZA 2JLFA 3BF4A 3T9ZA 2OHDA 1HWIA 2W7AA 3MAQA 4ZVGA 3BR9A 4KO0A 4ZS6A 2D7SA 5KFZA 3TZYA 1FO1A 2YH1A 2PEHA 1WHVA 4B3TJ 4JI5F 4K4SA 1FXRA 3PTWA 4ZVRB 4JOUA 1VQ8S 3M2UA 3R7NB 4DCPB 2HK3A 5B0AA 3OVAA 3DM2B 4AD6A 1F3FA 3BGLA 2YXLA 2G4BA 2GQQA 4FYYB 3OD2A 1YITS 3W8PA 4LF7J 3GR1A 4PUOB 3R9LA 3FFIB 1C1CA 1WKJA 3KNGA 4OI1A 1VQ5S 2AJFE 2RS2A 3ULHA 2VBWA 2KB2A 4WP9A 3LF0A 1S6QA 2FJBB 1REGX 3HHLB 4R0JA 5BYSA 4CLFA 2B9XA 1VLYA 5AE1A 2CQDA 2HG4A 1Y10A 2B7CB 2MZSA 2V68A 2ZZTA 3IP0A 1AFIA 2P9GA 2DT9A 4YS2A 3DMJA 2Q6BA 5EDWA 1O0PA 5C42A 1H2UX 5D3GB 1U1NA 1JWWA 1IKWA 3C8YA 1MSWD 2L3MA 1HR0J 2CQCA 1PCAA 2OGUA 1XEZA 4LF1A 2DVIA 1RT7A 4RW7B 1TUGB 4LRDA 3WQPA 2C2RA 5CXTA 2J0XA 1YQHA 3BGUA 2GQ2A 5AXMA 2B5JA 4N47A 2KM8C 1HARA 2LXIA 5IV3A 3SMZA 2GGPA 4DV5F 4QU7A 1SUQA 1GEHA 1RBLA 2M88A 1WG5A 3NXZA 3HJVA 3OXFA 2V0NA 3FMWA 5RUBA 4J9OA 1P9YA 4B9VA 5KFUA 1FCAA 1BHNA 2B6AB 1F5AA 1SXLA 3NY0A 4H4OA 3VAMA 4DSJA 3UQSA 3KLIB 7AT1B 1RHUB 2E1AA 2VH7A 2EK1A 4H4MA 1SC3B 2YPZA 3PJWA 4IG0A 4OX8A 3CJQA 4QQBA 3HHKA 4F4XA 3OXGA 2AWZA 4NMXA 1CJTA 3CT9A 2O3DA 1QM9A 1V3ZA 1YJVA 3UDEA 4ZVPB 4N56A 2A10A 2VG6B 4QPXA 2K7KA 1TK8A 1VGYA 3BREA 2NR0A 2HLUA 1R31A 2FJEB 5I4MA 3J7YI 4PR6A 1N5TA 3FEXB 3MPVA 5KT4A 2AT1B 2KXNB 3MUTP 4UY85 1YHQS 4PCQA 1KVJA 1RBOB 4A8YA 4X84A 4URQU 4Q0BB 5H9FK 2KT5A 4ED7A 4OYZA 2HIQA 1RT6B 4I7FB 1AT1B 1UEVA 2HWTA 5J2MA 2ADBA 5D78A 1X4EA 3DRRB 1IR1A 4USMA 2DNRA 2I9SA 4X4UA 4O3SA 3TARA 2ASLA 4LSNA 2CAJA 2RD5C 2ZNYA 1X4FA 3KK2A 1S1UB 1HPZA 3PXGa 4C8YA 3CJ0A 3TOQA 4ECVA 2WRMA 5KFDA 2R7UA 1LWCA 5KFTA 2FUG9 2AX1A 3Q83A 3RUBL 4LIWA 5CA5A 4ZCLA 2OKQA 3JQJA 1RAJA 4F4ZA 4C11B 3MOJB 2YNGA 1EARA 4EO8A 2FC8A 2H65B 3BGOP 5J1EA 4OZLA 4K4UA 4KAIA 4QYZK 2XZTB 3Q86A 2ZJRQ 4CLSA 4DR2J 1HQEA 1TP7A 3IR6B 1CQMA 2PFDA 2CNLB 2UXCJ 4C8NA 1TQLA 2MYFA 4R25A 4HR2A 5CHCB 4TKTA 3UDCA 2POKA 2MKIA 3Q8SB 1IQTA 1HA1A 2EW9A 2RVJA 3U02A 5HLFA 3K89A 2M52A 1FWLA 2K7JA 1H98A 4ED2A 4HTJA 5HI7A 1AZSA 2HRYA 4UOHA 1G1XA 4NYZA 4RX6A 4F2RA 3PDNA 1DTTB 3PCOB 1X60A 2HQ3A 3I0RA 2J0WA 3MHYA 3V81A 1BQNA 2R2UA 2KT3A 1HYSA 2F8EX 2C3OA 3HULA 2HFZA 3NCRA 3AT1B 3T1AA 3G8QA 4X4QA 1W25A 1BC6A 1C4CA 1WDDA 1NH7A 3G6YA 3GYGA 3J7YU 4C0OC 3ZZRA 2MGZB 3OR1B 1NK0A 1SL0A 5L38A 2IDEA 1WKLA 3DGVA 4WXOA 5JVHQ 2W9BB 3V6DB 3OLBA 5B0FA 4Z2XA 5DG9A 3GTYX 1UVNA 3L95X 5DO2A 5CYJA 1RT5B 2K3IA 3TQEA 1DBDA 3V6HA 3KLEB 4M95A 1NBEB 3MR2A 2D3OR 2IC3B 3EVWA 1X5TA 5J1PA 3ZFVA 1FJ7A 2MZJA 1FRXA 2XBPA 3C3LA 1TMJA 4IH6A 2UZAA 4ZCKA 1Y5NB 3FVYA 2ZZNA 4DR7J 2BJ1A 1BE4A 2CPJA 5JVGQ 3EJMA 3FCHA 3FFIA 3NOCA 2HVDA 3HFZB 3H4BA 2J8AA 4ZVFA 1HNZJ 1GNKA 4NLUA 2GO9A 2FJWA 1G6BA 2RS8A 4MIWA 1UZHA 5GVQA 1SL2A 2QA1A 3IG1B 1Y0HA 2EC0A 3W63A 1UPPA 1R0BG 2BOAA 3DMJB 2B4OA 1WHWA 2LA6A 4IFYA 4DLEA 2OIHA 3NNHA 3KWMA 5T14A 2JOQA 1IKWB 2BQRA 4TU9A 5F41A 1LWEB 2G2ZA 3UVJA 3RAQA 4X64J 2WW4A 3K5LA 5M2RA 4RLEA 2NQPA 1X5OA 2V2VA 2FZCB 1ELOA 4FPRA 1TL5A 3MR3A 1Q95G 2NXEA 1J5EF 3K57A 4TXSA 4JI0J 1FJCA 2CRLA 2PMWA 3MAHA 3KJFB 4J9VA 2DR5A 4ELVA 2CQ3A 4F0MA 2OTLS 3DOKA 3H2VE 1R8PA 2AJ0A 4GRSA 2C2KB 2R7WA 4ZHRB 1XTZA 3KUGA 2C2DA 3EXYA 3NCPA 3P5BP 4I2PB 2C2OB 4UOCA 5CZVA 1KQKA 3KLIA 3CPWR 2V2KA 5KG6A 3H40A 4JV2A 1RWOB 4H4MB 2E1CA 1QUPA 1Z2LA 2IBKA 1XERA 3H7HB 3RBDA 4MFBB 4HDHA 1MW7A 3R27A 3US5A 4DU7A 5K8OA 5IWAJ 3BQ0A 2KYXA 1OWXA 3GONA 2V4RA 3AB2B 3AOCA 5EX3A 3NWGA 4PG8A 1U1OA 3I31A 4QWEA 3L4BC 1PSDA 2DH7A 3GCXP 1FKOA 1QJHA 5IZHA 4LF4F 4RNOA 2E5HA 4WU2A 3PW5A 3UI3A 4Q44A 2ZOFA 2HFNA 3SQGB 3DOLA 1N34J 3DLKB 2HNYA 1ACMB 4WFYA 5KG0A 3D4JA 3T6BA 1VK3A 1FFSB 4NCBA 1X4DA 1FI4A 4IQMA 4IO9Q 2PA3A 2FZKB 2CPEA 3IFEA 4OHWA 3B78A 1U0HB 1RHMB 3AD8C 2G13A 3DDKA 1VDHA 4AT1B 4DBQA 1S1TA 2COLA 2GMLA 3LA0A 4OZ1A 3CO9A 1VQPS 1PO6A 4Q0BA 1F6TA 1IN0A 1W7WA 2M4MA 3M4XA 5KFOA 1B0TA 3TQ1A 1PGZA 2YNHB 1H38A 2AEFA 3BSNA 3CJ8A 1KTQA 4O3NA 2FVCA 4A46A 3IN5A 5EUHA 4ENOA 2FHJD 4UUXA 1YJ7A 1AFJA 1S9EB 4RNMA 3LPEA 3UR3C 2HQGA 4Q5VA 1FDDA 4JI3J 1TL3A 3RB6A 5HLFB 2VQFJ 2L08A 1TKXA 5I42B 4Q8EA 1URNA 3ZZUA 1UP1A 3OUYB 3V5RA 5I3QA 1AZSB 4XTTA 3MPWA 3DNCA 3R3TA 1RU1A 3G6VA 2QL7B 4FNIA 4ES3A 3P6YC 1WORA 2H5IB 2HGMA 3FK4A 4ED6A 2QMUB 3NLCA 4ED0A 3P49B 2CQPA 4USJC 2RMLA 1BQNB 1HYSB 3VAGA 1MROB 2F63A 2ZNZA 4LMZA 2RRAA 3ILJA 4F26A 1R43A 1S7IA 3A3NB 2V8GA 3A13A 4A8WA 1B7FA 2E29A 2OPPA 2ERRA 2BX6A 2X51A 4C2MA 1U24A 2MGZA 3MMAA 3VZHA 3V4MA 5C24B 4DUYJ 1VQ6S 1F60B 3QWPA 1T7PA 4GVBA 4Y28C 4KQZA 4ETXA 3LAKA 3IM8A 3SFUA 1FE0A 4P52A 1RWXB 3IXQA 3J81Y 3KLEA 3A8JA 3VAFA 1RZMA 2YX1A 2MLXA 4B17A 3PEHA 2MQNA 4P6QA 1SQFA 2CQ4A 3C6UA 1TL7A 2RF2B 3H5UA 2CA9A 4OJ3A 1M5HA 5KAKA 5L1JA 2E1MC 4NL5A 4DLGA 4J9QA 3PHTA 2VC0A 3K5PA 4C8OA 1XNRF 3ZTOA 2YQ0A 2ZH6A 3BGRA 1ZZFA 3OTOF 1S6PB 2OPRA 5HO4A 4KKOA 5ETSA 1N56A 1HMVB 1F1BB 5D8HB 3DRXA 3QRRA 1HNIB 4PXCA 1FJEB 2RUGA 3GJRB 3DRPB 4U7UD 2OPQA 2VQFF 1YI2S 3ZNJ1 4DPTA 4CNZA 3A8KA 1TVRA 3B6BA 1KC8T 4OX9F 5FLXY 4AQYJ 3PIPQ 1LWEA 4HL9A 3UVJB 2B7BB 1FD2A 5AE2A 4DV3F 5KG7A 4LRFA 3GV5B 2Y1JA 1ZTTA 4IQXA 2XSFA 4NEYA 4P9SA 4Y0FA 1UZDA 3QATA 2BACA 4N8NA 5KFAA 2CZ4A 3RBEA 3HHNB 1XNQJ 1NNDA 1GXUA 1LXNA 2QSWA 3VGUA 5KFMA 2R8KA 4OI0A 3R1HA 1CBKA 4KBIA 2EEYA 4LF8J 1OY9A 2FGOA 2V67A 4RWXA 1RTJA 1JLFA 4I4BA 4Q45A 1SKSA 3CCMS 2ADCA 3CJTA 5FD1A 4EO6A 3LP2A 2DCUB 4ANCA 2MJNA 3T1YF 2XG8A 1GTHA 1NB7A 2DXEA 2KN4A 2FY1A 2VONA 1N88A 2G0CA 4LF8F 4PPDA 2XZWA 2XEXA 2CQHA 4RUAA 1JJ2R 2PI5A 4DQPA 4C8KA 2BE2A 4Y2KA 3IM9A 1U2RA 1VQNS 4DN0A 2PI4A 1OPZA 4CYUA 4HI1A 1SJRA 3TZXA 2AJ2A 1LWFA 1YKWA 4ZJLA 2V6AA 1WEZA 3MUVP 3BBCA 3SDEA 2MKSA 2HNYB 1LW0A 4RW8B 4DFPA 1K8AT 4FBTA 3J7Z5 3KLHA 1U45A 3R5BA 3GE9A 1S1XB 5LMUF 2ROGA 2VBYA 1B7YB 1SI9A 2DNQA 2OMLA 4CTAA 2R7RA 4DPYA 4JUZA 5DDQC 3CCLS 4PWWA 4D3GA 1SKRA 2FB0A 4AUKA 3CCWA 5ETLA 2XLKA 4CT8A 3MD1A 2ZJQQ 2ATLA 1S7HA 2V63A 3EZOA 2GS8A 2MLZA 4GO5X 1NKEA 1IKXB 1Q86T 2MQOA 1I3OB 3AXKA 1XIQA 3ZZYA 2VFRA 4WFAQ 2HWHA 3PRBA 3M1VA 3IS9A 4WFBQ 2AU0A 1C4AA 2E5LJ 3MR6A 3S7RA 1IKVB 2VV5A 3QIPA 4H54A 2BJEA 2IY5B 3B4DA 5GMKa 4Y65A 4CLKA 3QBCA 4JP8A 4YFUA 3BZQA 3GU0A 1NKCA 2HQFA 5KFSA 2YNIA 3SV3A 1FRIA 1B3TA 4ZIWA 1TK0A 4DR4F 2HHTA 1FXLA 1RUSA 2EWHA 2UVWA 1IBMF 3EGNA 3M8PA 4ZITA 2ZH5A 3I4PA 4ZA1A 4KHPF 4NLVA 1WSRA 2JLGA 5GADI 1VQ4S 4ECSA 1FERA 5H9FJ 2RH3A 4OX6A 4KPYA 3C19A 2QE5A 2H48B 3QLHA 5G0RA 4RKUC 3ZZOA 3L7OA 5T7LA 5HMXA 3FEYB 4A8KA 5E0OA 2DHAA 4QIEA 4UZCA 4C98A 2O66A 2AW0A 3GV7B 4DUYF 1T0TV 2QV6A 1OS5A 4L75A 1K44A 2NS1B 2V4JB 1XR7A 1CSJA 1FTCA 1FF2A 1YDLA 4M5HA 2W9CB 5C24A 5HP1B 1S9GB 2KTQA 5GAHI 4WK3A 1B99A 2GC8A 2ZD1B 3T41A 3M6UA 1AUSL 2BMBA 2XMWA 3N6LA 8AT1B 1IR2A 2GMHA 2BW7A 3IBFB 5EGYA 1GX5A 4LR9A 2CJQA 2GVDB 4DV2J 1VRTA 3JS9A 1L5UA 2X1BA 3UFCX 2BQUA 4B3OA 1RQ0A 3UWTA 5HATA 4EBDA 3DU5A 3CE8A 2OP5A 3FBEA 4KPCA 2GX8A 4HVZA 1KD1T 4J9LA 1MMNA 1U47A 1N48A 2VFSA 4Z7CA 4LF9F 2M70A 2J7WA 2Q6CA 4A8XA 2NSCA 1RP5A 1FWKA 2UV8G 4UZBA 3BO2A 4A8FA 4ELTA 2CXEA 2IBOA 3CB4A 3Q8PB 4CCHA 1JJHA 2CZ9A 4ALZA 3VGVA 2JH3A 3DRPA 5CABA 3C14B 3RR8A 1WELA 3SYZA 3ISNC 4GMKA 1S57A 2YNFA 2EPIA 4DL3A 5HVFA 1S59A 2MY7A 5E41A 1PG5B 4BS2A 3KK3B 5U47A 1VISA 4B9MA 2ZJPQ 4EYHB 2YWFA 3G96A 2ZBQA 4N77A 1JLAA 3IAS9 3MM9A 2FIUA 4DG1B 4EGLA 3UR0A 3MDFA 4NLYA 3LOUA 4ES1A 2J6UA 1HWKA 3QJPA 2R42A 4LQ9A 2HLTA 4TQRA 2B4UA 3TA1A 2UV8A 3MFHA 4B9SA 4ED3A 2XNRA 2UUCJ 3P3DA 3M32A 3HO1A 4CH0S 1D3WA 3K58A 3UCGA 1VIXA 4JI6F 3M7VA 4QR0A 1SH3A 3U27A 5EHHA 5EWGA 3RTVA 4DDFA 2RSQA 4GKKJ 1LOUA 1RT3A 1VC5A 4RR5A 2QC3A 3HT0A 1KFDA 5B0DA 2APOA 2E5IA 1V5IB 1CJUB 4ERDA 5LMNJ 4XPEA 3Q8VA 2MZQA 2N82B 4EI2A 5DETA 4QBUA 5KFPA 3PW2A 4GKKF 2CUYA 3D6HB 3ITHB 4XDDA 2YQ3A 1LFPA 5KG2A 1UAWA 1S10A 2VFUA 2ZUAA 1FK9A 4ZCMA 4DL5A 1FEEA 3UCUP 2AYBA 5D0GA 1U2CA 2QT7A 2QN6B 2BE7D 4DX8H 2VPWB 2CDQA 4C3KA 1RABB 3V6JA 1YZ7A 3EVOA 2XGQA 1DHMA 2HS3A 4WPAA 5E7OB 1JLEB 4P2FA 4B3RF 3FCVA 1HNWJ 1P8GA 3KTQA 3T1HJ 1S1XA 1K1SA 3D6FB 1HWJA 3TNVA 2W9AA 2BM0A 2AGQA 3D9BA 3IO1A 2DGXA 3TP2A 4ZK7M 4LSZB 2GJFA 3CCES 4NMLA 2EVZA 3PIOQ 3N79A 3WHIA 4D3HA 5BYRA 5EWEA 1NK5A 2B56A 2R2SA 1F0XA 2I38A 2V2QA 3MAAB 3TUZC 2DGVA 4IR1A 2YKNA 1EKRA 4PXDA 1PJ7A 3MECB 4WZMA 1NM2A 3BN4A 3PYFA 2DRBA 4B3SJ 4NA3A 4KHMA 1KR4A 1IBLF 2IJRA 2H5EA 1UVLA 1HBNA 1FX4A 3ZNUA 5HBMB 4RW6A 2K3KA 3ICLA 3LP0B 1QAYA 3TANA 4LFCF 1B70B 1VCTA 3VGSA 5M2UA 5KFHA 2HMIA 3BS9A 1WNEA 4FS1A 3Q89A 5JXSA 2ILZA 3H2LA 3KG0A 1BQXA 3NMRA 3N9UC 2CFXA 5J2QA 3ELHA 1Y11A 3KJVA 3QLHB 1U1QA 2EFPA 2AJQA 2ZH3A 3GCWP 3AJDA 4LF2A 4IYQA 3O44A 3RG6A 3DGPB 2H9ZA 2LYVA 1JLGB 1A0OB 3K17A 3CJKB 4MMOA 2ZKTA 5DQGA 2R8HA 4ZN1A 4RBTA 4HT7A 4MKAA 5A2QU 4R0EA 3MCMA 3EGWB 3N6NA 4KYZA 2ZD1A 4R5PB 5J1EB 3W9JA 3E2EA 4PQUB 2W8KA 1TU0B 5C7PA 3DHWC 1VRTB 3W2WB 4LR8A 4PXEA 4LF9J 2J0SD 1L3SA 2OEMA 1SBRA 1HNVB 2EFOA 2IRXA 3H20A 4KGKA 1LXJA 2ZWOA 4K4TA 3EZUA 5KFGA 2QMXA 4K8RA 4Y00A 4ANDA 1HR0F 1XR6A 1G2EA 2KHCA 2HHSA 3DOMA 1P9QC 1N32J 5DDPC 3I0RB 2ALZA 3VTIA 4B9LA 5GADU 2KHDA 1WWHA 4ID5B 2KDOA 3R5CA 3EE3A 1URRA 5JUMA 3CCSS 1F3VA 1YRXA 3LUYA 3IGNA 1D09B 1BWEA 4ZP6A 5A6WA 2VDIA 4OHZA 2BYCA 2NZCA 5HMWA 3Q8QB 2V69A 1ICEB 4FPIA 2XYHB 5ETKA 4LFAJ 4M5DA 5DDRC 2R2TA 4DL6A 1S97A 2GHWA 2YQ1A 2KXFA 2WOMB 2LEPA 3M32B 1FRMA 1TKTA 1NPRA 3RW6A 1N5VA 1HBUA 3A8IA 1LQ9A 4EK2A 2HAFA 5HSPA 2DNPA 1EQMA 3AH6A 3FMBA 1RT3B 2HSEB 4F3QA 2V9KA 5T41A 4Q2LA 1UWBB 5C25B 9ATCB 1NKBA 4F3OA 1JQGA 3JSYA 3LH2S 4FXWA 3ZO7A 3CGIA 3G6XA 4QYZJ 4X4SA 4EBEA 3EMTA 1FESA 2CQ0A 2G2YA 1MG7A 1S1WA 1WOPA 4Z37A 1Q7YT 5BYQA 3Q8RB 1F5CA 4OYWA 2HVHA 3PV8A 4DV4J 2KYZA 3SZ2A 2RT3A 1YJTA 2GJIA 1M5OC 1GMUA 2VB6A 3OVBA 1V9OA 1D9FA 2HHHJ 3ET6A 1HNWF 1ZYQA 2XLIA 4O44B 1MWZA 3M6XA 1HI0P 5IFMA 1DY3A 1FNOA 3OJSA 2KRRA 4ZPBA 4MAKA 4DFJA 1N36J 1C0UA 2R4FA 1X4HA 2FHJA 1KONA 4AXIA 2IPOB 1KBRA 4W90B 1L3TA 2DBBA 2YX4A 5DGBA 5KT5A 3SSRA 1VBKA 4I2PA 3TUJC 2ASYA 4DV7F 3FJ2A 1N5YA 4KIAA 2HZAA 4TY8B 2AQ4A 1U4BA 3EWGA 1T94A 1OQ3A 1YBAA 1DLOA 5CCLA 5A8KA 3VCDA 3TAPA 3FGVA 3SIPB 5F3TA 4LFCJ 2MSSA 3K5MA 5EWFA 4CLLA 2XMJA 2LECA 2V4QA 4IOAQ 1FD8A 1FKOB 1IWGA 3OFHA 1LFWA 1YG0A 2CNNB 2R7QA 2VKZG 4RW6B 3J7ZT 3QZ8A 3DU6A 4O0NA 4DL7A 3O3LA 2GVZA 3UDVA 4P72A 3QJLA 2R8JA 5IXUA 1NJIT 5DM7Q 1U2FA 4ZPVR 3HPOA 4I64A 1XNQF 2F4VF 2OTJS 4BC7A 3LO3A 3N0VA 5L9NA 3CSKA 1VBXA 4HKQA 2DB1A 3E01A 2VPZB 3VGTA 1VR6A 2PT0A 1Y5IB 3DGPA 3UNGC 1XMQF 1UA0A 2VU5A 3VQTA 2FVSA 4JI7F 4JYAF 4JI3F 2W4PA 2ZHAA 7FDRA 1H3DA 2N3LA 2Y0SD 5CYQB 1MU2A 3AQPA 5HROA 1L3VA 3HLUA 4CLTA 2G9OA 2LLZA 1KNZA 1FXDA 2OFHX 3PACA 3VF0B 5KOXA 4R5PA 2DRAA 5KTQA 4BLGA 3D2WA 2J0QD 3J81j 2A2CA 3VVUA 4A8SA 1FA0A 1SJ3P 3GG1A 1Q53A 1JXVA 2IM3A 5EX0A 4NCGB 2CQBA 2B4VA 3GFYA 4GO7X 4MIBA 5L1KA 1DQAA 3S6EA 4UT4A 3HSDA 2NUHA 4ATNA 1SKUB 5B0GA 2RQ4A 1TKXB 3H5YA 1JLCB 4LR7A 1U8SA 5I42A 4B3TF 1T05B 3ZTSA 4OLPA 1VRQC 2RU3A 1RYSA 4RUHA 1Q8LA 5D15A 1FFGB 1S6OA 1RWNB 2QLFB 4DOZA 3GILA 2E5GA 2XY7A 3CC7S 1FEHA 4O3RA 2OJ3A 2XYGB 1JNZB 2VZ9A 1RT2B 2XZDB 3F44A 4WBFA 4F67A 4I68A 1JLQB 2H51B 2IAJB 2U1AA 4LIRA 2VASA 3HHDA 3Q23A 4J91A 2BZ2A 4CO1A 3TVKA 4J9KA 4F8RA 1M1HA 4X4RA 2VQEJ 1XN9A 2KFYA 3M9NB 2G0JA 2V8DA 1JJCB 1WI6A 2IJFA 1K1QA 4DCOB 1UW9A 3PR5B 3PRVA 4ICLA 2PO4A 5HJYA 4ZJOA 1TAUA 1X9SA 1WF1A 3O2IA 2MMYA 4X4VA 5HAOA 4R8UB 2RJZA 3DM2A 4FN5A 1TKTB 3VAJA 2OMOA 1HBUB 2VG7A 1Q5VA 1RHQB 2HBZB 4OHXA 4ECRA 3NS7B 1H2TZ 2GZOA 2C2EA 1EQ0A 5IT9Y 4DR3F 2FY8A 2AGPA 4XK8C 1WG4A 4LF5F 3HHLA 5KFYA 4F3MA 1WF0A 3M8QA 1DTQA 8ATCB 2HWIA 4U95A 2W24A 3MEKA 2B9EA 2HNDA 4BC9A 5IV4A 3EPIA 2PSZA 4EBCA 1DZ5A 3WC2A 4X4NA 2XM3A 3DCAA 2Z57B 1XMQJ 1IWAA 2VIHA 2A2DA 4K0KJ 3RRKA 1RTIB 3RBZA 2Z2MA 4DMZA 1VIOA 2CNKB 1X4CA 1VOMA 1FDAA 3JSMA 4I6WA 3BBFA 4ZVOB 3M9OB 4HEA9 4F0HA 1OIAA 4KGZB 1ZA2B 1S1VB 2KFZA 3FZ2A 4NE9C 4OJHA 3QZ7A 1NHVA 2Z4PA 1S76D 2PFFB 4EMDA 3MPUB 5SUHA 3BPSP 1X9MA 1M1GA 2RNEA 4FZVA 5BR8J 4DV0J 2MB0B 1UFWA 2IYGA 4NXNF 3M30B 4AYBD 4MYUA 1RTJB 2P8IA 2MKKA 1JXLA 2K1RA 1PBAA 3GMGA 1NJYA 3MCSA 4DQQA 1I94J 2VQEF 3JSRA 1ZAXA 1CLFA 4LF6F 3PHEA 4URGA 1UTAA 5HQLA 1S0NA 1N5YB 1KRPA 3LGNA 1RWKB 4JI4J 2PC6A 3KXDA 2HGLA 1R8BA 3EM1A 4QR1A 4DR2F 2ZHBA 2GHVC 3HCXA 1CJTB 3IBCB 4PWUA 1DLOB 3RAMA 2DNYA 3D66A 4J9PA 2CG8A 3T1YJ 4XO0A 3AD7C 4J9UE 2ZH2A 3POTB 3GG0A 4Y3CA 1T95A 1CULA 4YB5A 2FHMA 2MKCA 1N6QB 4KR0B 2Y3YA 2FJDB 2DNOA 2LQ8A 3TVYA 1CJVB 3QGIA 1HQUB 1ZM3A 1N4LA 4LRBA 4A8OA 1NJZA 1OJ4A 3QAUA 3GJSB 4FYVB 2OEKA 2AHOB 2Y1IA 5J2MB 1S6UA 2NLWA 2UUTA 2HFOA 4IRDA 2C2ZB 4W4MA 2JC0A 3DRRA 2DEIA 4DSKA 3D5MA 1BLUA 2LXFA 4OYIA 4JV5F 4DF4A 5KFRA 3KK2B 1UVMA 2HFUA 1N54B 2B8QA 3R7SB 3HHLD 4A4JA 3TZZA 3OVSA 4J9SA 2ZHOA 2Y8WA 4DR4J 4U8VA 2MKHA 2BJ3A 2HZCA 1TAQA 2EK6A 3R5AA 2HBQB 4NA2A 4C0BA 4F7VA 1QE1B 2X1AA 4DX5A 3NKYA 1OPIA 2J76E 3M1VB 1JMTA 2H1YA 3OFGA 4IH7A 4DS4A 4DL2A 3R8YA 4OHVA 2HHQA 1E6YB 4KB7A 2VD3A 1SQGA 2M8DB 2FLNA 2X1FA 1V3SA 1RWUA 4OYXA 3SSSA 3V2UC 2BKOA 4ZJQA 5B7WA 2OH2A 2PDAA 1NK4A 1TKZA 2V8HA 2IYIA 2X1GA 2MLYA 3EXCX 2VFVA 1TKDA 1N52B 3HSZA 2HVIA 1A9NB 2VUGA 1T05A 1VLOA 3GR0A 4OV6A 3THPA 3MCOA 5L39A 3C6TB 2HBRB 4P2SA 4WKYA 2DGSA 3CW2C 2JVOA 5I3UB 3ZXWA 1MLAA 1SB6A 3QMQA 2EXUA 2V2ZA 5GAGI 2QA4G 1NCLA 3FC9A 1KHVA 1Q8BA 1SV5B 3DC2A 2JSXA 2K06A 3TRGA 3W61A 1CG2A 5F9LA 2FLLA 3SV4A 1TZ0A 2KVIA 2D9OA 2WVEA 5F3ZA 1VQOS 1KKHA 1NPKA 2P2CB 3CCUS 1KHWA 3PZPA 1ZZNA 2Y1LB 2YKMB 5H1SV 2E1PA 5IC4B 2MJUA 1VFJA 1XWLA 3I96A 5LSRA 2AP6A 4B9TA 3CMAS 1QLNA 4WIQA 1UA1A 3W7BA 1O5JA 3DYAA 4KFBB 4A48A 4YY3F 2L41A 2XLJA 1TL1A 1UEKA 4QZVB 5K9FA 4OYMA 4DCJB 3CDEA 1T9XA 3M2VB 4HHUA 2NREA 2Z56B 3D3CJ 3MEDA 5HQ8A 3ILIA 4FDFA 2U2FA 1WTBA 4M5LA 2RILA 1NSKL 1AUDA 4RPFA 1X31C 2PGCA 2D9PA 2BRLA 4G1QA 3R97A 3K5NA 1LW2A 5AXLA 3FZBA 4IFYB 3BSAA 2L9NA 4KV8A 4RU9A 1YK9A 5C2CA 1Q0NA 2VHGA 1M5VC 1QDUB 2BV3A 3KHGA 3G86A 2DCLA 4NLRA 2UXBJ 4X2BA 5KT6A 1RBAA 1U7LA 2RE1A 2UVVA 4AL5A 4C8MA 3CXCR 2HHPA 3A3PB 3IRXA 3VQSA 3M8ZA 4A8MP 4K4VA 2J6SA 2ZFHA 1GXTA 1TV6A 4UOGA 3BDPA 2HFSA 2WHOA 5J2PB 2YKAA 2F1FA 2B8PA 4AL7A 1ZM2A 2VDHA 2J9EA 4V19J 4ID8A 3MEEB 2DGUA 4ZPWR 3SCIE 2V94A 2ZVIA 4PQAA 4ZHRA 4B3MF 1B0VA 4CQ1A 1R8AA 5ETVA 4FP9A 2BVZA 3PW7A 2C3UA 2JDJA 3LPYA 1RCXB 5CCMA 2ASJA 1Y3JA 2ZKUA 2XHWA 1YBUA 1SJ4P 2IHR1 4DPOA 2DJWA 3ENQA 4LVNP 4C4WA 4OZ3A 1R27B 2N7CA 2C3YA 5GAGU 2P6SA 2JWNA 3HKZD 4L72B 4F02A 3ITHA 1RA6A 2NSBA 4NLOA 4PEOA 2IMWP 5IT9U 1AXQA 2HQCA 1H72C 4I0WA 4RW4A 3OT9A 2VJVA 2UU9J 1VC0A 2GAGC 2H5JB 2P5VA 4LF6J 1HQUA 3GV8B 4TVAB 5DJBA 5KFJA 2C22A 4UUWA 5LOQA 2DR7A 1FE4A 1MN9A 1JLEA 2J6TA 3F0NA 2NPFA 3OL6A 2DXFA 5F8IA 3HX9A 1VI7A 5LXRA 1YWXA 2XI3A 4IG3B 2P6TA 4P7TA 2EBEA 2H4WB 1NJWA 3MOZA 4L3KA 1TMMA 3I4HX 3O6QA 5KFKA 4Q2MA 4PRFA 1PAUB 1FFWB 3HT3A 4J9NA 3CD7A 5HQMA 4QWAA 1QE1A 2DYAA 2RDJA 3QSYB 1M5PC 2AF6A 4M8LA 3LW5C 3OJUA 4C7QA 4DL4A 2OAUA 4UY8T 1ZA1B 4OIXA 5F8NA 1VRUB 5AXNA 4NA1A 4RBUA 2YX7A 3R2DJ 1XK8A 1JX4A 1IM6A 3HD2A 1CPZA 4DSIA 1TL4A 3LP0A 5THWA 4K2XA 4WE1A 3MR7A 2RHSB 3KDOA 2LEBA 3X1LB 2RKIA 3FRZA 3HSGA 3N5FA 3W65A 2D3O1 1SJ1A 4FF2A 3AB4B 3SBMA 4HTIA 1IKYA 2F8HA 3C6TA 3NGKA 3MM8B 2J7KA 4K4WA 1U49A 3D3BJ 5HJXA 2ABYA 4FYDA 1FRKA 1WSVA 3CVKA 1C0TB 2XCAA 3Q22A 5A8WA 4O4GB 2R7OA 2OPPB 1RJJA 4ZP7A 3CJKA 3TZWA 5CD4A 3OXLA 2ZOMA 3MMAB 5F9NA 3RRGA 1PC5A 4UF4A 4CH1A 4ECWA 4C0HA 1I94F 3GFXA 2DNZA 3PX6A 2YKMA 2XI2A 2J9CA 3AA8A 3GWCA 2FVRA 4LQ3A 6AT1B 3PVXA 2NUUG 1IM4A 2YTCA 5F8GA 4ILMA 2KZZA 4ZDNA 3FBFA 4EUVA 4C3MA 4OQJA 4QIWD 5MAOA 3C6UB 1BGXT 4LBPA 2XMUA 2XS2A 1KLMA 3CJRA 2CVIA 4B08A 2VOOA 3TAMA 3KYLA 1H2VZ 1YZ6A 1ZPVA 2AZ3A 2KXHA 1RU2A 4NXMJ 4ECZA 3BO3A 1NHUA 3EICA 2C1EB 2LCWA 2YWEA 1T9UA 1Y00A 4Y2AA 5E3PA 1S6PA 1S6QB 2MKYA 2OPRB 5E3CA 2BR0A 2R8GA 3H8YA 4G1QB 3OR2A 1HNIA 1G7CB 2FJAB 1Z4UA 3AQOA 1XBWA 3B4MA 4ZP9A 2KG0A 1RHRB 2PMHA 4F25A 1HBMB 1WEYA 4GKJF 1NDPA 1X7VA 3BR8A 2UU9F 3A12A 3AAWB 3VVTA 3MI7X 2YKQA 1YRTA 2HAIA 2QL5B 1N0VC 2EG2A 3HKWA 4HI2A 4E2FB 3ILOA 4CNYA 4RU2A 2HHVA 1RT7B 2R3VA 4RW7A 1EAYC 1BY9A 4F4YA 3RW7A 2MQLA 4QCLA 2XSJA 3LP1A 1X4AA 4O23A 1A7GE 1R0CB 3CDWA 5AJ3F 1QAXA 1SUQB 3RYLA 1YIJS 4OL8A 1S48A 3QWUA 2MZ1A 4URSA 1CQNA 4DUZF 2QLJB 1CS4B 3ONQA 2HURA 2Z58B 2DXDA 4L73A 4BCAA 2FTRA 3ETOA 3H42A 3SXLA 4EEYA 1BXNA 4F0KA 2B6AA 2KJWA 3D67A 2G0IA 2CKWA 5HMZA 3K8VA 1D1UA 4HDGA 2HHHF 4OI2A 2YVSA 3HVTA 4OZ0A 3MM7B 2Y8YA 1CEZA 3R5DA 1HW8A 2UUAJ 1XMOF 4EU0A 3CCJS 4JBCA 1Q8IA 4ITSA 1GFWB 4NRTA 2CQ1A 3GB0A 4KC5A 3GIIA 3JYTA 1N36F 1GMWA 2BE2B 3D0HE 3GLJA 1E6VA 4G6VB 4YUDA 4LRCA 1PYSB 3MPDA 3C15A 1Y7PA 3AA9A 2JLEA 3N28A 1IUJA 3W66A 2YY3A 4QWCA 3TR5A 4PXBA 3ET6B 1LWFB 1U8WA 1HI1A 2EG1A 2FC9A 1KVKA 3DKDA 3GSDA 2I5JB 2YWGA 3SDEB 3TUIC 2XMAA 2ALYB 1YJRA 3HXMA 2YWKA 3KHHA 3A1YG 2FGCA 5D4LA 4NLWA 2E44A 4YMEA 4CIOA 4DPXA 2HHWA 2XHCA 4NLPA 2CWXA 3P45B 4IG3A 2GJ2A 4MYTA 3K59A 4UTGA 1WD6A 2A6OA 2R7TA 1FKPB 3C46A 2KU7A 4TN2A 1K9MT 3ADAC 3GIRA 2B3TB 3FQKA 3IC1A 1XJWB 2H3EB 1FDBA 4RJVA 3U1LA 1IKXA 1LWCB 1NEEA 2BQ3A 2KL8A 4TY8A 5ETQA 1Z2ZA 5F8LA 4IG0B 4ZPTR 1UL3A 1M0SA 2I0XA 3CJ2A 1Q4RA 2XMKA 3GSIA 3HZGA 2IM1A 3ZZZA 4WP3A 4LFAF 5FJ4A 3DLEA 1DFDA 2PIIA 1HQEB 2P9CA 4MIAA 2UUAF 4JI8J 1H7XA 2MZTA 5HL7Q 2HVZA 2HRTA 1PJ6A 4B02A 1H74A 4WTYA 2XMVA 4WE1B 2GA7A 1U0SA 2RKIB 2LVWA 4DL0C 1RHKB 4MTPA 2D3ZA 5DZ6A 1ZAWA 1WHXA 2M0GB 5ETPA 4DX7A 4UQGA 4OI6A 2IFXA 1X8DA 1IKYB 4M5KA 4NI2B 5GAEU 2LDYA 4DV7J 3TA2A 2Y9HA 2LEAA 1RK8A 2YBVA 3CC4S 2NXNA 4DR6J 1HNXF 2G2OA 5F8JA 2E1RA 3WIUA 5G0RB 3NAHA 3PRDA 2CWKA 2H54B 2VBZA 1R8CA 4MKVA 1T9TA 1TTHB 1OYEA 1YRUA 4X65F 3IR5B 4CRJA 3CCTA 4IO1A 1KN6A 4DSLA 5HP1A 3OR1A 4G3IA 2PEBA 1J5EJ 2VOPA 1MU2B 1S9GA 3DLJA 3D68A 3HD1A 2YNGB 3LALA 4WU3A 1FDNA 3TEGA 3BQ2A 1H6KX 3OFEA 4NYOA 5DZ7A 1RT5A 1YLXA 4DV1F 3J80U 4QWDA 1EB0A 3KMQA 3K8WA 2WONB 1ZPWX 3BKUA 2AJ4A 2W2QP 5GMDA 3CIZA 5KFEA 2DY9A 5K8MA 2ILYA 3OW2R 5HK4A 1NK9A 2NXJA 4K59A 4Y2IA 5FIIA 2XO7A 2F5GA 3N6MA 2ZZMA 4DV6F 4ES2A 3GIKA 4Y34A 4ZPCA 3H98A 1FRHA 1EHWA 1UCNA 2RQCA 3QFWA 1G4CA 4ZKAA 4UW2A 1Q81T 3V81B 3IG1A 3M05A 3CMES 2MQPA 3R2CJ 3G82A 1RAFB 1W2IA 3M6VA 3WZ0A 2OO4A 3G9CA 4W98A 1HBMA 3IGVA 3K0JA 3KUHA 3PR4A 4DR1J 2KI2A 2IAJA 4H4KA 4FF1A 4YDDB 3KK3A 2DITA 5A8RB 4I1TA 3EDRB 2IVMA 1VYAA 2Q79A 4DG1A 2XSJB 4WP8A 4HLBA 3SCJE 1U1PA 3HF5A 5HN0A 2YKOA 2F65A 1VJWA 1RTDB 4ED4A 1RB0A 2M8HA 4S0MA 3G6ES 2VBXA 1N32F 4Y6IA 3PJ9A 4KHRA 1GQEA 5A0YA 4R8UA 3VWSA 3OQ2A 4DR5J 1CJKB 2CPYA 2FPHX 2YKPA 1BUXA 2MDAA 3M8WA 5SZTA 2ZDPA 3NP5A 4DN9A 1XMOJ 2F3JA 4TU7A 3QYYA 2ZM6F 1Q5YA 1AB8A 1YX2A 3MM7A 4ZOSA 1KQSR 2EKNA 1N5QA 3QJJA 3UNYA 1S9FA 3M8QB 1CJUA 4MH8A 1NAQA 2RRNA 3FEZA 2EFQA 3I0SB 2IVFB 4M1KA 2DEJA 2PN6A 4DHVA 5J2NA 2HNDB 1IBCB 4CLPA 2UUBF 2WK4A 2J8SA 2GFFA 3MMCB 4USKA 4RBVA 3OBIA 1E6VB 2F4FA 2VC1A 1TELA 4DPUA 2QA4S 5LMNF 2BRKA 4HYKA 4A8QA 4JI1F 4C8ZA 1JKHB 4K2JA 1OYDA 4L76A 3FKBA 1FK9B 2QMWA 3P96A 3JSMB 4ILLA 3ILLA 2CQIA 4OYBA 3KK1B 3BM7A 3HDSA 3DOLB 2HZVA 1ROFA 2I5JA 4WJBA 2XB2D 3LAMA 1NHKL 3P5TL 3NG8A 1PBUA 1HI8A 3K5OA 2AV5A 3DOKB 4RL1A 1AROP 2ZBPA 3VHQA 3MFIA 1HBOB 1U6ZA 1YVFA 3N01A 5CQGA 5KFIA 5E33A 2NXUA 1OO0B 2V50A 4DEZA 1CVJA 4DZDA 2DGOA 1V3RA 1Q1KA 1S1TB 2D3UA 2LQ5A 3AFGA 2OSRA 2ZBIA 2ZEJA 2BABA 4OJ1A 4RNHA 2DNHA 4MFBA 3I32A 1J5OB 3MAAA 3UN2A 2UP1A 1SC1B 1N33F 4TYAA 2UXDF 1HD1A 2YKNB 4AL6A 2JC1A 2C2MB 1RAIB 2HNZB 1T11A 3DLEB 1UEUA 3UD3P 2DNKA 4DQIA 3MECA 2DHHA 1CULB 1SC6A 2O1PA 3RB4A 2AEMA 2ZH1A 3CF5Q 1HBNB 3K7RA 2Q66A 1T02A 3BBBA 2HQIA 3CJ3A 4OI3A 3KHLA 3BYPA 3NBPB 4M5GA 1NSQA 3DI6B 4KSEB 3AOBA 3SQGA 3CDAA 5KFLA 2K8GA 3OUYA 2BJDA 5L1LA 3H25A 4YHHF 1OY6A 3HVWA 4KGVB 4ZP8A 3KMSA 4ZVQB 1DQ8A 1HWLA 3QGPA 5CYMB 4P7VA 3GJTB 1GMWD 1H7WA 2CPDA 3ZC4A 2DO4A 3T19A 3OLAA 4M63A 3KG1A 3PO4A 1UPMB 2M3DA 3NS5A 2ZE2B 2A18A 3W60A 1WTFA 3DLBA 4N41A 2H4YB 3PKMA 4I6YA 1KOOA 4FYWB 5KG1A 4YHHJ 3JQMA 4USUA 3T9NA 4CO2A 4DQRA 2DH8A 3PX4A 4OYAA 2E9ZA 4GC6A 3MF5A 4O3OA 1B64A 3QRQA 1U6BA 3FRYA 2R7XA 5ETRA 1X4BA 3IMQJ 4USWA 2BM1A 2FJVA 1QY7A 1KWMA 2WCXA 2XMTA 5E2QA 1U1KA 4CLUA 1SC4B 1NLKL 5FDLB 1RSCA 5CAAA 2FHKA 2W2OP 1TL3B 1TKZB 2J7UA 1U1MA 4LUBA 2QYCA 1AYEA 5KG5A 5KFQA 2ZBCA 2JEJA 2IDLA 1L3UA 1FHTA 2WVFA 5IQQA 3RZAA 3LGHA 4MK7A 5KT2A 1ITPA 1HMVA 1LK7A 3A4TA 3GYNA 3MMBB 4MKBA 1ZBTA 4JI2F 3ZTRA 4DR1F 4B9NA 4WFZA 3W8GA 4JI1J 4KTQA 4ID5A 2OPQB 4W92B 3S1TA 1CC7A 1SV5A 1S72S 1UVKA 3U1MA 3Q2TC 4B3RJ 4PWDB 1WJ9A 3Q24A 3W5YA 2W1BA 1GXLA 2QYGA 2VKRA 5K5MA 5M2PA 1VC6A 2QLBB 4TYBA 5A8RA 4V19X 3CUNA 5IOLA 3CCZA 1F9HA 5D4PA 1EX8A 1HKAA 4IUFA 4JV1A 3M2UB 2RUSA 4NZ6A 3LQVA 4CWBA 3UW1A 3UD4P 4RW9B 4KFBA 2RIJA 4NLSA 4X4PA 5LXYA 1SVDA 4HHJA 4I2QB 1UMJA 4NLGA 1PAEX 3O8WA 1NZAA 2A1BA 2K2PA 3I82A 9RUBA 2DK2A 2GO8A 3EVMA 4PUOA 3MEDB 3RB0A 4Q43A 3H5XA 3IWNC 2CPXA 2MPUA 2XWXA 3NGDA 1WC4A 4M5IA 4F4KA 2ZH7A 4OHYA 4KKOB 1UJ4A 2E7VA 2MZRA 1OSCA 4BHQA 1S1WB 2R8IA 5J2NB 4YR0A 2B9WA 4YR2A 2X3DA 3RU0A 3QFHA 5C42B 4X62F 4C48A 2OEJA 1TVRB 2LP4A 3W2VB 2JEIA 1L3KA 1JKHA 2DD8S 4RO0A 1HNZF 3IRXB 3MXHP 2XY6A 1RADB 4ECYA 1O8BA 1H0HB 4CI0B 3OV7A 3H2UB 2LU1A 3QPIA 4RUBA 2GGPB 2GQCA 4YR3A 1WC1A 2D74B 3BV8A 1TUWA 2F9JA 1AA1B 1HL6A 4E8UA 2WTFA 2UVUA 1HBOA 3D0IE 3M9MB 4CLZA 1TK5A 2Y1RI 2DNGA 4ZPAA 1JLFB 3PFOA 3KLVA 1UETA 3MZIA 2F9DA 1WC0A 5AXKA 5C2GA 4H4OB 5BJRA 1ZS6A 1VQMS 4B3SF 1KFSA 4KHPJ 3CJ4A 2UXBF 4WF9Q 2C42A 5LL6d 3LP2B 5KFWA 2MQQA 5GAHU 3L09A 4WFXA 2ZH8A 4AQYF 1PKUA 1VHIA 2AYEA 1J5OA 5LMUJ 3VALA 1HFEL 4DR5F 3D28A 3QIPB 4P10A 2RU9A 4O3QA 2VG6A 3BQ1A 3EUNA 3CEDA 3IAM9 5B0BA 4DV5J 3CULA 4WYLA 2QZ8A 3WX8A 4FBUA 3SCLE 2RRBA 3KJNB 1FX2A 4OV1A 2A0FB 2CVEA 1MWYA 3JTPA 2A6MA 3DI6A 1XNRJ 4OFZA 2GNKA 2GVZB 2QL9B 1PYTA 3AJ2A 3FBBA 1GT8A 4PPZA 3TJ8A 2ZWPA 3W64A 4ZLLA 4RW8A 4I7FA 2XO6A 3EYZA 3PW0A 1IQZA 4B9UA 1KQGB 2E66A 1REVB 1QSYA 3R5JB 4X64F 5ADZA 1PJ5A 1U6FA 2CJBA 4LSNB 1S49A 3BEGB 4Y2MA 2ZE2A 5JMNA 1HPZB 2XNQA 3FSIA 4UOFA 4ECQA 1T9YA 1T03B 3D1HA 4Z7YA 3SCKE 1MWQA 3HVRA 1RGVA 4E0DA 3WDOA 1IR0A 2M5YA 5LT5A 3KNAA 2UVRA 2IRUA 2OFGX 3ENVA 4EYIB 1FRLA 1ULRA 4WWSA 3H5SA 2SXLA 2XTJP 3IA0A 1IKVA 4ZLPA 4X62J 1VHFA 1X5PA 5LJ3Y 1F2HA 3M8SA 1M5KC 5FDLA 2HQDA 1I51B 3DLHA 1MN7A 4B3OB 1SJQA 1YJ9S 4U8YA 1RDRA 1HLWA 3V4IB 2KZMA 2WSEC 1WOSA 4EZ6A 2RQMA 2MQ8A 1YJWS 1S4FA 1NDCA 2ACMA 2OLWA 4CO4A 3I5CA 3OHAA 1RAEB 3MM8A 1YBTA 4QR2A 2CPFA 2F8MA 4JI5J 1W26A 3VAIA 4IR9A 1NU4A 1UVIA 4CH7A 4DU8A 5T7LB 5DQIA 3T5JA 1C0TA 2I2YA 4NLTA 1RAOA 1Y5LB 3ISZA 4ETZA 5AJ3J 2R9LA 1VQKS 3J7AN 4X4TA 1RYRA 4ZVTB 4PWDA 1WC6A 3MMJA 3Q0AA 1UW4A 1WKKA 3OL8A 4LBHA 1KS2A 2ZH9A 3I9V9 1I6JA 1DRZA 2IVYA 2Z30B 5IM0A 3M8RA 2D69A 2EBGA 4ZPDA 3V6DA 2VL1A 3BKTA 1JLAB 3B8HA 3MM9B 5BR8F 4NXNJ 1RA7A 4JV5J 1GH8A 3H59A 1HQ2A 1N5SA 1UKUA 3TO8A 3J7A1 3M2RA 2HS0A 2HW3A 2LDIA 2IC3A 3MM5A 1RWVB 1SH0A 3NGTA 4MK9A 4JI8F 1XR5A 1JXEA 1Q79A 6FD1A 1RHJB 3D54A 3GFHA 3TEHB 2QLXA 4YP3A 4TY9A 1R6YA 2NYIA 3QO9B 4OI4A 4OJGA 3TAMB 2VG7B 3NOGA 3JTOA 4KRWA 3HMJG 1DURA 3GIMA 3A8EA 8RUCA 4LFBF 4DQSA 4PYAA 2W4DA 4HT5A 4F36A 4ZVEA 1RTDA 2PMZD 2B0GA 2V9WA 3W3SA 3B54A 4K5RA 3OR2B 4DI6A 2DO0A 3KUEA 4DV2F 2DNLA 2L48A 4RWWA 3HM9A 1OQ6A 5IT4A 2EKYA 3S8SA 2KJVA 1WUUA 1ZM9A 2RB7A 1RTIA 3OHBA 5E3AA 4PYDA 5ETNA 4QJVA 1S79A 2M2BA 4EWTA 1KSPA 3UPFA 2FVQA 4JI6J 1X5SA 1EP4A 2WVCA 4L74A 1Q82T 1C1BB 4C8LA 4C9DA 1BD6A 2F7VA 2JFDA 3GFZA 3M8YA 3NAIA 3DLGA 3DRSB 3TVZA 4N5SA 2Z2ZA 2C2NA 2GIRA 4NZ7A 2YH0A 2LXUA 1YJNS 1CS4A 3PG9A 4I69A 1B4SA 2D1CA 2DISA 3ETMA 1R7IA 1SQEA 3HZEA 3LANA 4JI0F 3HVAA 2N3OA 5F8MA 5D0RA 5IS2A 4ED1A 2A3JA 4DV0F 3KOAA 3HVTB 4G65A 4GVLA 3OSNA 3EPGA 3HJFA 2HKEA 5B08A 3T3FA 1S5ZA 2GIQA 4KH0B 1R89A 2DHGA 2DKOB 2ZVSA 3DN9A 3MR5A 4FXDA 4RNNA 2WW8A 1Q8KA 3EX7B 1GX6A 1N8RT 1MMLA 2VFTA 2XS7A 1FJGF 1C2PA 4F2SA 3O1LA 4DFKA 2CJYB 2W2MP 1RWPB 1RWMB 2RQKA 3H90A 1N6QA 4O3PA 3MCNA 3QT6A 1NUEA 4DSEA 2B43A 3NGSA 1FKAF 1CJVA 2PE8A 3TUPA 1VBZA 2Z2YB 5DRKA 2O67A 3AODA 3RAXA 1NK7A 3DLKA 2LKZA 2BUNA 3KLGA 2KO1A 4OZNA 2IRYA 5D0HA 3UN3A 4K0KF 4J90A 3TA0A 1NDKA 1RISA 1REVA 1RT4A 3EDQB 4WXWA 2ZC3A 4NPOA 4ZVUB 5A6PA 4RUCA 2CNOB 1S0MA 1QAIA 4M5NA 1TR0A 1FKPA 5K14B 1T03A 2HHXA 6FDRA 1U0HA 3IWXA 3TJ9A 3IWLA 2ZM6J 5KG4A 4OX7A 4FF3A 3MGJA 5L46A 2OELA 4OZJA 2XS5A 2XYPB 1KP6A 1ZM4A 3E8OA 2EI5A 4RZRA 1HNXJ 1VQYA 4PAAA 4KGXB 1E6YA 1HD0A 4ZLJA 3CD6S 3THTA 2Q3PA 3WX4A 1S9EA 1UJ6A 3D6TB 4FKYA 4QIGA 4HACA 4WK1A 3SEOA 4K5SA 3W2WA 4DSFA 3QNWB 3QT5A 4K7QA 1X0PA 3QGGA 5HBMA 1JB0C 1CC8A 1O51A 2B51A 2CADA 1KLNA 2QA2A 3PNIA 4ECTA 1FNXH 4N76A 3N5BA 1N0UA 3W9IA 1VQ9S 2M7SA 3PY8A 3ENAA 5KFVA 1B0PA 4ANEA 3JXOA 4FXVA 5I3UA 1RKJA 3KJVB 5GAEI 2W01A 2BANB 1FRJA 3JAMY 1RI7A 2FLOA 1H73A 2QTWA 3G4SS 1ZH5A 4IDKA 3FSXA 2JFKA 2Y0BB 2YPYA 5HVHA 4ER8A 2JVRA 2WB4A 3DXSX 3LWLA 2I1RA 1EIYB 5ETOA 4C3LA 3ENWA 2QO3A 2VG5B 4XAKA 4PQUA 4CT9A 4DR3J 3M2RB 2Z8QA 3BDEA 2NZ4A 4B3MJ 3BSCA 3FQLA 5HANA 2Q43A 3DYAB 4ZLNA 4IRCA 1WACA 3PM9A 3MWBA 4USHA 1TL7B 2RF2A 5IWAF 2FQQB 3F56A 3QO9A 4CDIA 2VA2A 2E9TA 1EJ7L 1TUVA 1NB2A 1HHQA 3A3OB 1HIYA 4A47A 4DV4F 1HHSA 3LTOA 3TWZA 4DZ6A 4X4OA 3MUMP 2C28A 5C25A 3QT7A 1DQ9A 4WYWA 1UWAA 3MM6B 1WOOA 2EFNA 2HS4A 4ECUA 2LFVA 2J9DA 3Q8UA 3G82B 4U96A 4HH1A 4WZQA 5H9EK 5D3GA 1AW0A 1RAAB 4KV8B 4I56A 5MLCV 1K73T 2HK2A 3CWJA 2B9YA 4QIFA 3BSOA 3VZIA 1U48A 2LA4A 4NYPA 2BBEA 4DX6A 4LT6A 2VPYB 4TLRA 1QTNB 3CDBA 3FCWA 4U7UK 1RE1B 4X65J 5DLFA 2QJ3A 3IR7B 3PW4A 3MTKA 1NK8A 3BO4A 2GMJA 3DLGB 4M5DB 2HRUA 4YB1P 3NNCA 1S4EA 2ZC4A 4QU6A 3DRSA 2ROPA 1SL1A 1PIEA 2OD6A 2EFGA 5A0YB 5F0WA 3PFEA 4KY3A 5L8RC 4DS5A 1CJKA 4ZVSB 5A8KB 2LQJA 4DV1J 3PO5A 2J5AA 3F41A 3VV2B 2IM2A 3AD9C 3ZTPA 1VQLS 2N7YA 3I56S 4LF7F 1UWBA 5HVGA 3SI8A 5CH7B 4K4ZA 5DS7A 2JZ5A 2EFVA 4F04B 3L7PA 2DR6A 2E7XA 3ZTQA 1FTRA 4OZ5A 4Q8FA 3BKFA 3AJ1A 3NCQA 3UO0A 2CG4A 1U26A 2F40A 2X7IA 3MMCA 3MPYA 4M5JA 5E3RA 3W9HA 4CM2A 1U1LA 2DIVA 3BYRA 4J9MA 3G87A 1JLBA 4G1IA 3AHPA 1S99A 3UN5A 4RW4B 3MD3A 4CYUB 4WTOB 3FBCA 1R0AA 1UFKA 2C3MA 2JEFA 4EZ9A 5KFXA 3G8SA 2R7SA 1OMSA 3JAMU 4K4XA 1VK8A 2BJ8A 2V8VA 2DGQA 3Q8YA 4O44A 2AGOA 1U1RA 1TFWA 1N33J 3K2YA 3KLGB 1LW0B 1RT6A 2J9DE 4GKJJ 2RDDA 2BJ7A 1C0UB 5I3PA 5LM7E 5DG8A 3KLHB 2DHXA 2UXCF 1RT4B 1ZAVA 3O5TB 2RDIA 4ECXA 4Y2CA 1NSAA 4NRUA 1R3NA 2FJXA 4WKRA 3E01B 3EZ5A 4DPWA 2KH9A 1S1UA 1RAHB 3GYXB 4QW8A 2UUWA 4ED5A 4YB6A 2ZDOA 2WVBA 2OI2A 3JQKA 4ELUA 2EC2A 3WIVA 5CYQA 3KHRA 2OUGA 5CD4H 1M90T 4C11A 4PG5A 2FLPA 2DGWA 2E5JA 2WBMA 2RHQB 2ZBRA 3RJMB 3HHEA 3CC2S 4FF4A 2HNZA 2W2NP 4LFBJ 3BH6B 1T8EA 1RAGB 1FNMA 5KFFA 1GMVA 5ETTA 4AXJA 1WC5A 4F50A 1WF2A 4NCGA 4HACB 5E3QA 4YOEA 4NX9A 4KGMA 2WSFC 3CCRS 2DY1A 4NLQA 3G8TA 4NEZA 1QSLA 1QSSA 4K4YA 2JL9A 2N4DA 4LBIA 3R6LB 5L1IA 3VR1A 3HK2A 1WEXA 4IOCQ 5ETMA 2BE9B 1RT1A 2BKPA 4V1Ak 5KT3A 1DTTA 4BBYA 4WFNQ 3H4DA 2I6WA 1KEKA 5DQHA 3CD5A 2AMCB 1YGYA 2L9DA 4PKDB 3RGIA 1U02A 4PZVA 2IM0A 2FHOB 1LKZA 2QG9B 3CD0A 2JX2A 4IDKB 3NGUA 3D1OA 1D9DA 1JLQA 3TJAA 2CYYA 2AJ1A 2C3PA 1GK8A 1KOHA 2DGTA 3HSJA 4M5MA 2KG1A 1DAXA 2Q1LA 2BOPA 2B4PA 2ZITA 4XDCA 3PKYA 2W9BA 4RNFA 3T1HF 1NMEB 3OTDA 3QSIA 2FD2A 4CLWA 2VG5A 3BPDA 5KG3A 5G4DA 4IFVA 2MEWA 2QLWA 1JIHA 2QGFB 4ICLB 1APSA 5DM6Q 2GVDA 1R8HA 2GV1A 3OTEA 3M6WA 3U1NA 2FYXA 1A6LA 3W5ZA 3C66A 4X66F 1KLMB 3QRPA 3SFGA 1JLCA 4HHHA 1U09A 3W5XA 2OD4A 1SCJB 5EN1A 1TFYA 2GIFA 3BGFA 2HPUA 3R1LA 2DNNA 5BXIA 4LSLA 5K20B 1T9WA 1YSJA 3MM6A 3R6GB 4EFAC 5IT0A 5D4NA 3V6KA 2W7PA 4C97A 3UCZP 5KT7A 4GC7A 3JB9k 2CJKA 2NYHA 2V34A 3C14A 2DPJA 1ZOTA 1RT2A 1RTZA 4LREA 5D6GA 3BJYA 2YNFB 4USVA 2HIYA 5D77A 1EZZB 4E98A 2XCPA 1VQ7S 2R7VA 2HEKA 4LRAA 2WAQD 3GP9A 3KLFA 4LF5J 3EGVA 4JI7J 3DRYA 2AD9A 2KKHA 3PJXA 1LNQA 3I6PA 4Q7AA 3LP1B 4DF8A 1QVGR 1J2VA 2DHSA 3GJQB 2HFVA 1XC9A 1R6VA 5JJBA 3D7SB 4RW9A 3IBWA 1W2BR 4I2QA 5GMEA 1I1GA 2WSCC 2P9EA 3E3XA 2E9RX 3KJQB 3IRWP 2K1RB 4FNHA 4CP5A 1NH8A 1ZETA 4HH0A 1LEOA 3JSBA 2XMMA 4QYRA 3CDUA 3LGMA 1DTQB 2BA9A 2AEJA 4PG4A 1QAJA 4KJIA 5L9XA 4AFFA 1Q7LB 2Z0GA 4U9RA 3AOAA 3W62A 1T3OA 2GHPA 2VPXB 3PEJA 5K8NA 3JYTB 3C16A 1JK9B 2CZVC 2MXYA 3GIJA 4I67A 4CO0A 3THVA 3BB5A 1Q78A 5B0EA 7FD1A 3RBXA 4QPTA 3R7BB 3W2VA 3C15B 1JLBB 4ZVHA 3F73A 1R0AB 2MHNA 3PYEA 1NXIA 2IJNA 2OPSA 3MEGA 1S1VA 1VQSA 2CJXB 2PA8D 3BN7A 4G1PA 1BQMB 3ZZPA 4J9RA 4JI4F 5KOWA 5KFCA 3UE2A 4P2XA 1NRKA 2NCKL 4CO3A 4TQSA 5H9EJ 2JEGA 2IA6A 2W2PP 5CZXA 2WBRA 1T3NA 4DJBA 3M30A 3QT8A 4PABA 1QVFR 2UXDJ 4JV0A 3QIDA 3G71S 2E7WA 2MTLA 4QWBA 4KE5A 3G2XA 3ZZTA 5K8PA 1WC3A 1Y3KA 2KVQE 1SIZA 3KDNA 4UQTA 2UUCF 5IC6B 1F2GA 2XY5A 2CIMA 2ZH4A 4TNOA 1IBKF 4LF4J 3LWMA 4ZCIA 2ROEA 4BWJA 3DLLQ 3S01A 3Q2SC 3AY0A 3NL0A 1UFLA 4NLXA 3OPKA 1KDNA 2YNHA 4QW9A 4YY3J 1IJFB 2HVEA 3L3CA 3TAQA 2HYIB 1S0VA 3POTA 1FT8A 4XIUA 2M9KA 1KVIA 2CQ2A 4U7CA 1XMBA 4NOHA 4OX9J 1D9AA 2VA3A 4I6AA 1J27A 2MY8A 5KFBA 4MKYA 4YQWA 1PC4A 3DHXA 2AYMA 1UVJA 4FKXA 4FVMA 2IMOA 4DR7F 3NEKA 3MURP 3R5GA 1K47A 1S12A 2BKNA 3ZZ0A 2HMIB 4NZ0A 3RR7A 4WCEQ 4PG7A 2KT2A 1NJXA 4NI2A 1RT1B 2LMIA 5J2QB 4L3NA 3NRBA 4CO5A 1P6TA 2QEXS 2G1DA 4F4WA 1RLCL 4F4AA 1MROA 4C6AA 4P2MA 1HHTP 2D41A 4J37A 3CJSA 1RACB 2I8EA 3CNQP 4KH1B 3SSQA 5DDOC 1JLGA 2BXJA 3OL9A 3P8BB 4PG6A 4DUZJ 5AE3A 1EETA 3FDSA 2CDRB 1SH2A 3GPAA 1S0OA 5D4OA 1NK6A 2GAHC 4IRKA 1IJEB 4GVBB 2ATCB 2LU2A 3HFVA 4YN3B 5LSOA 3CO0P 1BMQB 4IFVB 3RB3A 2W4CA 4ED8A 5KFNA 2XC9A 1MMDA 1FWPA 2HBYB 2WONA 2L9WA 2CPIA 4L6V3 2BJ9A 3HFKA 3X3UA 3KG4A 4ZIVA 1YTYA 2AIRB 4LJMA 3KFWX 3CJ5A 4WIIA 4O4RA 1HNVA 3I5AA 5E5NA 1T9VA 3TYTA 3HHLC 5IQ6A 3V4IA 2ASDA 4O0IA 3RRHA 4USTA 3BGRB 2V5HG 1BWVA 4JB8B 4YB7A 3OSPA 2OSQA 4LSLB 3DOMB 4MT1A 5DLGA 3EGZA 4BDPA 2WB1D 1SPBP 2XULA 2CQGA 1NZ8A 1P1LA 3PYGA 4DV6J 3T5KA 4ILRA 4NCAA 1RTHA 2CPHA 2RAQA 2KRBA 2WZ1A 2FZGB 1P1TA 3NS6A 4NWBA 1D0EA 3C2PA 1VS3A 4P75A 2KM8B 1QTMA 5IM0B 4KO0B 3KLFB 4U6PA 4LVOP 5A2QY 4IOBA 4IKAA 2MQMA 3DFEA 3N4WA 1N34F 2LQBA 1SIWB 3J81U 2XGPA 2VF3A 3CCQS 1M1KT 2HGNA 5J2PA 4TLQA 1V5VA 3D1QA 5D0EA 3NNAA 3MM5B 1RXOB 1WHYA 3FNNA 3GQCA 2WOMA 3NMAA 4CM0A 3MEEA 1DJ0A 1TL1B 3UD5A 4TU8A 1IBKJ 1Y4ZB 3M2VA 2DTJA 3H0PA 4DV3J 2CJ9A 2JRSA 1I5OB 1WDTA 3NWRA 3HI9A 1FVQA 1RKIA 1C1CB 2X3GA 5ITHA 4ZN3A 1K0TA 2BDPA 1VMBA 2GW8A 2NXCA 4K50A 1F5BA 3L9ZA 3FUYA 3AXMA 3OFFA 4MJKA 2QRRA 5J1NA 1SKWA 4MK8A 2ACYA 4J7CA 2KFNA 3I0SA 1XQIA 1SJFA 1LW2B 1QUVA 1RLDA 1S77D 3TI0A 4USIA 3KKFA 2Z2LA 3C16B 4YEAA 1IBMJ 2NPIA 3ISND 3QGHA 1GAOA 2AKWB 3T5HA 2JHEA 2DPIA 4DR6F 1KTVA 4NASA 5B09A 1P27B 1X0FA 1F9EB 4J5OA 4N8OA 5B0CA 2JJ4D 1V6HA 5LJ5Y 3PYDA 2G1HA 3CCVS 3CMQA 2PD1A 1EP4B 4DUTA 3UDLA 5F8HA 1X4GA 1JJ4A 1C1BA 2V8PA 3KK1A 2B5JB 2OPSB 1TV6B 3CIMA 3MEGB 4N7TA 4OLOA 3FSYA 3W1YC 1BQMA 2YWWA 1K0VA 3JTNA 2CJAA 3I5BA 3QQCD 3GZ7A 4NLDA 4P73A 3SQOP 5LSLA 5DG7A 2WVDA 2W7OA 2QFJA 4CTAB 1HWUA 2DIUA 1M5SA 3MTJA 4KT0C 1WG1A 2MSTA 2MHEA 3I9ZA 2W8LA 1EKSA 1LK5A 3P4UB 2GCFA 2JNJA 1VBYA 4OYOA 2E5LF 3D6MB 3I87A 2DR8A 5AT1B 1X9WA 3DDIA 4BWMA 1OY8A 3U7JA 3IS9B 4U67Q 4FYXB 1U25A 2W25A 1D8ZA 1NPPA 2VJUA
chains in the Genus database with same CATH topology
5HMYA 2BW2A 2XWYA 4DFMA 3OTBA 4NXMF 1Y9OA 2IA0A 5F0UA 3CTRA 1ZTWA 2O5DA 2DNMA 2YNIB 4FS2A 1LV5A 2N4CA 3NBPA 3T5LA 2ZOGA 4M94A 2FDNA 3M8PB 2R2RA 3B82A 1HW9A 4AE5A 3HP6A 1G3OA 1D8YA 5CYMA 3T6JA 3TW0A 3VAHA 3VAKA 4H4KC 1Q16B 5K14A 4YDXA 5A8WB 3E51A 3WBZA 1MNEA 4DWIA 4IH5A 1KQFB 2AX0A 1F9FA 2V4JA 2AYGA 1EETB 4QOTA 2W9CA 1OSDA 1GTEA 5HROB 1FVSA 3QAEA 2DR9A 1IXKA 1WI8A 4QIVA 2QSFA 3TX8A 1VRUA 5C5JA 2VODA 5DGAA 2DH9A 3D0GE 1Z1ZA 4ZMMA 3OTCA 2FVPA 1YJUA 2LQ9A 3WC0A 1JNRB 3DXBA 2HHUA 1NO8A 3DDNA 3J80Y 4FVCA 3I55S 4CZCA 1UJ5A 2YWHA 4OMFG 3MMBA 3PX0A 1PILA 2BANA 2O01C 2ZUGA 1DARA 1RTHB 2MKJA 4O4GA 4XPCA 3OL7A 2CPZA 2JLFA 3BF4A 3T9ZA 1HWIA 2W7AA 3MAQA 4ZVGA 3BR9A 4KO0A 4ZS6A 2D7SA 5KFZA 2YH1A 1FO1A 4JI5F 2PEHA 1WHVA 4K4SA 1FXRA 4JOUA 1VQ8S 3M2UA 5B0AA 3OVAA 3DM2B 3BGLA 2GQQA 1YITS 3GR1A 4PUOB 3FFIB 1C1CA 3KNGA 4OI1A 1VQ5S 2AJFE 2RS2A 3ULHA 2VBWA 2KB2A 3LF0A 1S6QA 2FJBB 3HHLB 4R0JA 5BYSA 1IBMF 1APSA 2B9XA 1VLYA 5AE1A 2CQDA 2HG4A 2B7CB 2MZSA 1AFIA 2P9GA 2DT9A 3DMJA 2Q6BA 5EDWA 1O0PA 5C42A 1H2UX 5D3GB 1U1NA 1JWWA 1IKWA 3C8YA 1MSWD 2L3MA 2G4BA 2CQCA 2DVIA 1XEZA 1RT7A 4RW7B 2C2RA 5CXTA 2J0XA 1YQHA 3BGUA 2GQ2A 5AXMA 2B5JA 4N47A 2KM8C 1HARA 2LXIA 3SMZA 2GGPA 4DV5F 4QU7A 1SUQA 2M88A 1WG5A 3OXFA 2V0NA 3FMWA 4J9OA 4B9VA 5KFUA 1FCAA 2B6AB 1F5AA 1SXLA 4H4OA 4DSJA 3VAMA 3UQSA 3KLIB 4H4MA 2E1AA 2VH7A 2EK1A 3PJWA 4IG0A 4OX8A 4QQBA 4F4XA 3HHKA 3OXGA 2AWZA 3CT9A 2O3DA 1QM9A 1V3ZA 1YJVA 4N56A 2A10A 2VG6B 4QPXA 2K7KA 1TK8A 1VGYA 3BREA 2NR0A 2HLUA 1R31A 2FJEB 5I4MA 3J7YI 4PR6A 1N5TA 3FEXB 3MPVA 5KT4A 2KXNB 3MUTP 4UY85 1KVJA 1YHQS 4PCQA 4A8YA 4X84A 4URQU 4Q0BB 2KT5A 4ED7A 2HIQA 1RT6B 4I7FB 1UEVA 2HWTA 5J2MA 2ADBA 5D78A 1X4EA 3DRRB 4X4UA 2DNRA 2I9SA 4O3SA 3TARA 2ASLA 4LSNA 2RD5C 2ZNYA 1X4FA 3KK2A 1S1UB 1HPZA 3PXGa 4C8YA 3CJ0A 3TOQA 4ECVA 2WRMA 5KFDA 2R7UA 1LWCA 5KFTA 2FUG9 2AX1A 4LIWA 5CA5A 4ZCLA 2OKQA 3MOJB 1RAJA 4F4ZA 4C11B 2YNGA 4EO8A 2FC8A 5J1EA 4OZLA 4K4UA 4KAIA 2ZJRQ 1HQEA 1TP7A 3IR6B 1CQMA 4C8NA 1TQLA 2MYFA 4R25A 3UDCA 5CHCB 4TKTA 2MKIA 2POKA 3Q8SB 1IQTA 1HA1A 2EW9A 2RVJA 3U02A 5HLFA 2M52A 2K7JA 1H98A 4ED2A 4HTJA 5HI7A 2HRYA 1G1XA 4NYZA 4RX6A 4F2RA 3PDNA 1DTTB 2HQ3A 3I0RA 2J0WA 3MHYA 3V81A 1BQNA 2R2UA 2KT3A 1HYSA 2F8EX 2C3OA 2HFZA 3NCRA 4X4QA 3G8QA 1W25A 1BC6A 1C4CA 1NH7A 3G6YA 3J7YU 4C0OC 3ZZRA 2MGZB 3OR1B 1NK0A 1SL0A 5L38A 4WXOA 5JVHQ 2W9BB 3V6DB 3OLBA 5B0FA 4Z2XA 5DG9A 1UVNA 3L95X 5DO2A 5CYJA 1RT5B 2K3IA 1DBDA 3V6HA 3KLEB 4M95A 3MR2A 2D3OR 2IC3B 1X5TA 5J1PA 3ZFVA 1FJ7A 2MZJA 1FRXA 2XBPA 3C3LA 4IH6A 2UZAA 4ZCKA 1Y5NB 3FVYA 2ZZNA 2CPJA 5JVGQ 3FFIA 3FCHA 3H4BA 2J8AA 4ZVFA 1GNKA 4NLUA 2GO9A 2FJWA 1G6BA 2RS8A 4MIWA 5GVQA 1SL2A 2EC0A 2QA1A 3IG1B 1Y0HA 3DMJB 4IFYA 2B4OA 1WHWA 2LA6A 4DLEA 2OIHA 3NNHA 3KWMA 5T14A 2JOQA 1IKWB 2BQRA 4TU9A 5F41A 1LWEB 3RAQA 3K5LA 5M2RA 4RLEA 2NQPA 1X5OA 1ELOA 4FPRA 1TL5A 3MR3A 1J5EF 3K57A 4TXSA 1FJCA 2CRLA 3MAHA 2DR5A 4ELVA 2CQ3A 2OTLS 3DOKA 3H2VE 1R8PA 2AJ0A 2R7WA 4ZHRB 1XTZA 2C2DA 3EXYA 3NCPA 1KQKA 4I2PB 5CZVA 4UOCA 3CPWR 2IMWP 3KLIA 2V2KA 5KG6A 3H40A 4JV2A 4H4MB 2E1CA 1QUPA 1Z2LA 2IBKA 1XERA 3RBDA 4MFBB 4HDHA 1MW7A 3R27A 3US5A 5K8OA 3BQ0A 2KYXA 1OWXA 2V4RA 3AB2B 5EX3A 3NWGA 4PG8A 1U1OA 3I31A 4QWEA 1PSDA 2DH7A 1FKOA 1QJHA 5IZHA 4LF4F 4RNOA 2E5HA 4WU2A 3PW5A 3UI3A 4Q44A 2ZOFA 2HFNA 3SQGB 3DOLA 3DLKB 2HNYA 4WFYA 5KG0A 3T6BA 1VK3A 4NCBA 1X4DA 4IQMA 4IO9Q 2PA3A 2CPEA 3IFEA 4OHWA 3B78A 2G13A 3DDKA 4DBQA 1S1TA 2COLA 2GMLA 4OZ1A 1VQPS 3CO9A 1PO6A 5KFOA 1IN0A 2M4MA 3M4XA 3TQ1A 1PGZA 1B0TA 1H38A 4LMZA 2YNHB 3BSNA 4O3NA 1KTQA 4A46A 2FVCA 4C8LA 5EUHA 2FHJD 4UUXA 1AFJA 1S9EB 4RNMA 3UR3C 4Q5VA 1FDDA 3W3SA 1TL3A 3RB6A 5HLFB 4Q8EA 2L08A 1TKXA 5I42B 1URNA 3ZZUA 1UP1A 3OUYB 3V5RA 5I3QA 3G6VA 3MPWA 3DNCA 3R3TA 3P6YC 4FNIA 4ES3A 2HGMA 4ED6A 3NLCA 4ED0A 3P49B 2CQPA 4USJC 2RMLA 1BQNB 1HYSB 3VAGA 1MROB 2ZNZA 2RRAA 4F26A 1R43A 4A8WA 2V8GA 1B7FA 2E29A 2OPPA 2ERRA 2X51A 4C2MA 1U24A 2MGZA 3MMAA 3VZHA 3V4MA 5C24B 1VQ6S 1F60B 3QWPA 1T7PA 4Y28C 4KQZA 4ETXA 3LAKA 3SFUA 1FE0A 3KLEA 3IXQA 3J81Y 2YX1A 4B17A 3PEHA 2MQNA 4P6QA 2CQ4A 3C6UA 2RF2B 3H5UA 4DLGA 4OJ3A 1M5HA 5KAKA 5L1JA 2E1MC 4NL5A 4J9QA 2VC0A 3K5PA 4C8OA 1XNRF 2ZH6A 3BGRA 1ZZFA 3OTOF 1S6PB 2OPRA 5HO4A 4KKOA 1N56A 1HMVB 5D8HB 3DRXA 1HNIB 4PXCA 1FJEB 2RUGA 3DRPB 2OPQA 2VQFF 1YI2S 4CNZA 1TVRA 1KC8T 4OX9F 5FLXY 3PIPQ 1LWEA 4HL9A 5AE2A 2B7BB 1FD2A 4DV3F 5KG7A 3GV5B 1ZTTA 2Y1JA 4IQXA 2XSFA 4Y0FA 4N8NA 2BACA 5KFAA 2CZ4A 3RBEA 3HHNB 1NNDA 1GXUA 1LXNA 2QSWA 5KFMA 2R8KA 4OI0A 3R1HA 4KBIA 2FGOA 4RWXA 1RTJA 1JLFA 4I4BA 4Q45A 1SKSA 3CCMS 2ADCA 5FD1A 4EO6A 3LP2A 2DCUB 3T1YF 2MJNA 2XG8A 1GTHA 1NB7A 2KN4A 2FY1A 2VONA 1N88A 2G0CA 4LF8F 4PPDA 2XZWA 2XEXA 2CQHA 4RUAA 1JJ2R 2PI5A 4DQPA 4C8KA 2BE2A 4Y2KA 1U2RA 1VQNS 4DN0A 2PI4A 1OPZA 4HI1A 1SJRA 1LWFA 3MUVP 1WEZA 3SDEA 2MKSA 2HNYB 1LW0A 4RW8B 4DFPA 1K8AT 4FBTA 3J7Z5 3KLHA 1U45A 3R5BA 3GE9A 1S1XB 5LMUF 2ROGA 2VBYA 1SI9A 2DNQA 2OMLA 4CTAA 2R7RA 3CCLS 4JUZA 5DDQC 4D3GA 2XLKA 1SKRA 2FB0A 4AUKA 3CCWA 4CT8A 3MD1A 2ZJQQ 2ATLA 1S7HA 4GO5X 1NKEA 1IKXB 1Q86T 2MQOA 3ZZYA 2VFRA 4WFAQ 2HWHA 3PRBA 3M1VA 3IS9A 4WFBQ 2AU0A 1C4AA 3MR6A 3S7RA 1IKVB 2VV5A 3QIPA 4H54A 2BJEA 3B4DA 5GMKa 4Y65A 4YFUA 3BZQA 1NKCA 5KFSA 2YNIA 1FRIA 1TK0A 4DR4F 2HHTA 1FXLA 2UVWA 2EWHA 3EGNA 3M8PA 2ZH5A 3I4PA 4ZA1A 4KHPF 4NLVA 2JLGA 5GADI 1VQ4S 4ECSA 1FERA 5H9FJ 2RH3A 4OX6A 4KPYA 2QE5A 3QLHA 5G0RA 4RKUC 3ZZOA 3L7OA 5T7LA 5HMXA 3FEYB 4A8KA 5E0OA 2DHAA 4QIEA 4C98A 4DUYF 2O66A 2AW0A 3GV7B 2QV6A 1OS5A 2NS1B 2V4JB 1XR7A 1CSJA 1FTCA 1FF2A 2W9CB 5HP1B 2KTQA 5C24A 1S9GB 5GAHI 4WK3A 2GC8A 2ZD1B 3M6UA 2XMWA 5DG8A 3N6LA 2GMHA 5EGYA 1GX5A 2CJQA 1VRTA 1L5UA 2X1BA 3UFCX 2BQUA 4B3OA 1RQ0A 3UWTA 4EBDA 3DU5A 3CE8A 2OP5A 1KD1T 2GX8A 4HVZA 4J9LA 1MMNA 1U47A 1N48A 2VFSA 4LF9F 2M70A 2J7WA 2Q6CA 4A8XA 2NSCA 1RP5A 2UV8G 3BO2A 4A8FA 4ELTA 2IBOA 3CB4A 3Q8PB 4CCHA 1JJHA 4ALZA 2JH3A 3DRPA 3RR8A 1WELA 3SYZA 3ISNC 4GMKA 2YNFA 2EPIA 4DL3A 5E41A 2MY7A 4BS2A 3KK3B 5U47A 4B9MA 2ZJPQ 4EYHB 2YWFA 3G96A 4N77A 1JLAA 3IAS9 3MM9A 2FIUA 4DG1B 4EGLA 3UR0A 3MDFA 4NLYA 3LOUA 4ES1A 2J6UA 1HWKA 4LQ9A 2HLTA 4TQRA 2B4UA 3TA1A 2UV8A 3MFHA 4B9SA 4ED3A 2XNRA 3HO1A 3P3DA 3M32A 4CH0S 1D3WA 3K58A 3UCGA 1VIXA 4JI6F 4QR0A 1SH3A 3U27A 5EHHA 5EWGA 3RTVA 4DDFA 2RSQA 1LOUA 1RT3A 1VC5A 5B0DA 1KFDA 2APOA 2E5IA 4ERDA 4XPEA 2N82B 2MZQA 5DETA 4QBUA 5KFPA 3PW2A 4GKKF 3ITHB 4XDDA 2YQ3A 1LFPA 5KG2A 1UAWA 1S10A 2VFUA 4ZCMA 1FK9A 4DL5A 3UCUP 1FEEA 2AYBA 2QT7A 4DX8H 2VPWB 2CDQA 4C3KA 3V6JA 2XGQA 1DHMA 2HS3A 5E7OB 1JLEB 4B3RF 1P8GA 3KTQA 1S1XA 1K1SA 1HWJA 3TNVA 2W9AA 2BM0A 2AGQA 3IO1A 2DGXA 3TP2A 4ZK7M 3CCES 4NMLA 2EVZA 3PIOQ 3N79A 4D3HA 5BYRA 5EWEA 1NK5A 2B56A 2R2SA 1F0XA 2I38A 3TUZC 2DGVA 4IR1A 2YKNA 4PXDA 3MECB 4WZMA 3BN4A 2DRBA 4NA3A 4KHMA 1KR4A 1IBLF 1UVLA 2H5EA 1HBNA 5HBMB 4RW6A 2K3KA 3ICLA 3LP0B 1QAYA 3TANA 4LFCF 5M2UA 5KFHA 2HMIA 3BS9A 1WNEA 4FS1A 5JXSA 2ILZA 3H2LA 3KG0A 1BQXA 3NMRA 3N9UC 2CFXA 5J2QA 3KJVA 1U1QA 3QLHB 2EFPA 2AJQA 2ZH3A 4IYQA 3O44A 2H9ZA 2LYVA 1JLGB 3CJKB 4MMOA 2ZKTA 5DQGA 2R8HA 4RBTA 4HT7A 4MKAA