5F0WA

Crystal structure of human copper homeostatic proteins atox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Structure of tetrasilver bound to human copper homeostatic proteins atox1 at 1.7 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5f0wA00
2GFFA 5T7LA 2KT2A 2AW0A 2HIQA 2K1RA 4OJ1A 4ZOSA 5B0FA 1XBWA 1TZ0A 4A4JA 1TR0A 3BB5A 1X8DA 4Y2KA 1GXTA 1YJTA 2ROGA 3LO3A 4NL5A 4DPOA 2XMWA 2IFXA 2OD6A 2RMLA 4Y2MA 2AP6A 4A47A 5B09A 3HHLC 4Q2LA 1VQYA 1KVIA 2FHMA 2HQIA 3DCAA 4QOTA 1URRA 5A6WA 2W4DA 5B0AA 1OSDA 2HFOA 1Y3JA 2GV1A 2K7JA 3QGPA 3F44A 5F0UA 1JWWA 1SB6A 2CRLA 4ZA1A 1TL5A 4OJ3A 3KG1A 1N5SA 1Y3KA 1S6UA 2EW9A 1X7VA 1JK9B 2IYGA 2OAUA 2LQBA 2XMJA 3FGVA 1Q8LA 2XMUA 1FE0A 1GXUA 2OFGX 4FNIA 5F0WA 2N4CA 3CJKB 5K9FA 2N4DA 1W2IA 3BGUA 2OP5A 2FB0A 3BM7A 1CPZA 2QLWA 1TUVA 1Q8BA 2OMOA 3E8OA 1YRXA 1K0VA 2FIUA 2VV5A 4YEAA 5B0DA 3HHLD 3UDCA 1FVQA 1SI9A 5B08A 4HI1A 2HFNA 1MWYA 3BN7A 3LGMA 3CJKA 1Q53A 3BDEA 4OJGA 3T9NA 3WDOA 3VTIA 2HLTA 2KYZA 2ROPA 3IWLA 2XMTA 2Q3PA 3GZ7A 2G9OA 2QLXA 2BBEA 1AFJA 4NPOA 1IUJA 1OQ6A 3FMBA 2ACYA 1R6YA 2BUNA 3MZIA 2ZDPA 5B0GA 2BYCA 2W4PA 2GGPB 1U7LA 3HF5A 1ULRA 3KKFA 1Y9OA 3MCSA 2KT3A 1SQEA 3FRYA 1S6OA 3HDSA 4DN9A 1YJUA 1P6TA 1KVJA 2N7YA 4A46A 5IXUA 1TL4A 2W4CA 3QMQA 3HHLB 3KNGA 2FTRA 1FD8A 2LQ9A 4OJHA 2BJDA 4U9RA 3HFKA 4HH1A 1P8GA 1N5TA 3KG0A 3DXSX 1YJVA 2GGPA 2XMMA 4HI2A 2K1RB 2LDIA 2GO8A 2RILA 4FNHA 3IWXA 1VQSA 2HLUA 1V3ZA 2AJ0A 1N5QA 1OPZA 3HHLA 1FESA 2IYIA 2ZDOA 2PD1A 2AJ1A 3TNVA 3HX9A 3I9ZA 1FE4A 1N5VA 2L3MA 3K7RA 5B0CA 5A6PA 1WD6A 2K2PA 5B0BA 3BF4A 1Y0HA 2GCFA 2OKQA 2OD4A 1AFIA 2ROEA 2BJEA 2JDJA 1RJJA 5B0EA 1OQ3A 2XMKA 1AW0A 2RU9A 1MWZA 1QUPA 2ASYA 4YDXA 4HH0A 1FEEA 1Q4RA 1LQ9A 2KKHA 3BR8A 3LGNA 2VH7A 4Y2IA 4DL0C 2K7KA 2OFHX 5T7LB 1YG0A 4HL9A 3TRGA 2RSQA 1APSA 5KAKA 1CC8A 1CC7A 2PGCA 1KQKA 4EFAC 4F67A 2GA7A 1FVSA 4A48A 1X0PA 2QYCA 2LXFA 3TOQA 2XMVA 2QIFA 4Q2MA 4OIXA 1YJRA
chains in the Genus database with same CATH superfamily
1H2UX 4LF8F 2BQUA 1ZETA 4TY8B 3JQKA 5D78A 4EUVA 3LO3A 1RHJB 3IWNC 1TK8A 4MKBA 5KG1A 2OMLA 1GX6A 4FYXB 4IR1A 2WTFA 4RBVA 4I7FB 2YWWA 2MQPA 1L3TA 2BA9A 2VPZB 1UTAA 2OELA 5C24A 4P10A 2V2KA 4BCAA 5FLXY 4M5KA 3CMES 4M5MA 1VYAA 3E01B 4TN2A 5EDWA 5ETPA 4ZP9A 3CW2C 3F73A 2DHHA 2MKJA 3QGGA 1W26A 1VQSA 3CJTA 3RB3A 3PRBA 4M5NA 2JLEA 1MG7A 2CNNB 2JH3A 3EICA 1VJQA 4RU2A 5BR8J 4HL9A 1TKZA 3RG6A 4C9DA 3IMQJ 3SBMA 4GVBA 4P7VA 3CCZA 2HGNA 4TYAA 1XBWA 4X4NA 3M2VB 3JSYA 1HPZA 2IDEA 1CJUB 2ZUAA 4ANCA 3CCMS 4ZCKA 2E1MC 3BPSP 2V4RA 4ECWA 1RCOB 1S1VA 3D3BJ 3CJKB 1Q5VA 1SKSA 2KL8A 3LANA 4MKYA 3W9IA 1CULB 2D3OR 2O5DA 5DG7A 1X5TA 4OYBA 4NPOA 4PXEA 3ZZZA 4DV4J 2P5VA 2W4PA 3IM9A 1N32J 2DGOA 2J7KA 1FEHA 1OSCA 4NE9C 4OJHA 3SDEB 4NZ6A 2VFRA 1ZM3A 1WWHA 1HNZF 2BKNA 1D9DA 4PG7A 1R7IA 1AFIA 1T03A 5I42B 1TKXB 2VG5A 2VPXB 2FC8A 4EEYA 4RNFA 4Y2IA 5DZ7A 1RACB 1FA0A 2CPYA 3G8SA 3AY0A 3KJFB 5DJBA 2MDAA 2XS2A 3CCLS 1R27B 4HT5A 2FHMA 2VODA 1KBRA 3BS9A 1R6VA 1BD6A 2HGLA 4USUA 2JX2A 3FSYA 2XBPA 3AXMA 4TXSA 2IVFB 2WVCA 2B9EA 2G1HA 2MZQA 2W7PA 4DF8A 2ZDPA 4YDDB 2BZ2A 3AQOA 4UOGA 3ZZYA 3VQTA 1G1XA 2JSXA 2FVQA 3TJAA 2X3GA 1Q81T 5E7OB 3D5MA 1UVMA 5D3GA 3SYZA 4PWUA 4EU0A 4R5PB 1DTTB 1C2PA 1RP5A 1SJRA 4ED7A 3LAKA 4ZMMA 2GCFA 1JKHB 4RW6B 1XR6A 2CZ9A 4C2MA 4DSKA 2BVZA 3BH6B 5EWEA 2AZ1A 3QWPA 5HJYA 1VBZA 3CPWR 4X2BA 3M2RA 3RB4A 2Q66A 4RW7A 1JJHA 1QVFR 2VPWB 3IBFB 3I82A 3BBFA 2KDOA 5HO4A 4FF1A 1U1PA 1NPKA 1RHRB 1S49A 5IS2A 3NS6A 2VKZG 3FDSA 3NAHA 4K4YA 3R97A 4O0NA 2L9DA 2ZC4A 1NRKA 1U1NA 1NJIT 1O6XA 2R8KA 3R5BA 2HFZA 5J2NA 1JX4A 3CO0P 3KUEA 5GAGU 3PKMA 1ZAWA 4ZN1A 4PUOA 1RU2A 2LDIA 3HHNB 2FLNA 2YNIA 5BJRA 1PIEA 2XG8A 1PBAA 4UQTA 3M6VA 1XNQF 4FBUA 3BR8A 5KFQA 2RHSB 3V4MA 4FKXA 1APSA 1C1BA 2VUGA 1IR0A 2E7WA 1YJRA 2KT2A 1RAHB 4PQUA 4OLPA 1HHQA 4Y65A 4DZ6A 4CRJA 2CADA 3NY0A 3KK3B 4JI7J 2EW9A 5CYQB 3HVAA 1X9WA 1SQGA 3O1LA 4KO0B 4PPDA 3DRPB 1IBKJ 3UN5A 2NLWA 3WDOA 4MIBA 3OR2A 3CD0A 4CIOA 4HACB 4NOHA 4NYZA 4B02A 4RW8A 4OFZA 2V9WA 1AZSA 2Z2LA 2BR0A 2GO8A 4K59A 4ILLA 3FBFA 4DPXA 1RTZA 3OBIA 4O3SA 3GQCA 2C42A 4FYVB 2CQGA 3KWMA 1GMVA 1QAIA 4B3TF 3OL6A 3R6GB 4X62J 4NEZA 4LRCA 1PBUA 2C1EB 4ZJQA 2I38A 4ZDNA 1WKKA 1WF2A 3HVTB 3IR6B 4LSNB 2IDLA 2RF2B 2GZOA 1RT7A 3E51A 1HFEL 2FHOB 3FEYB 3C15A 2DHSA 3MM5B 3W2VA 4I56A 4H4KA 4NXMF 1N34J 4X66J 3T19A 5KFTA 1UA0A 1UWAA 2DR8A 1VS3A 1TKTB 3NCPA 4X4RA 2F4VJ 2YWGA 1UW4A 2B43A 4K5RA 4NLTA 3OL7A 3N0VA 3MGJA 1FCAA 4I2QB 3W5ZA 2DGQA 2DH7A 4K4UA 5M2UA 1PYSB 3FCWA 1CS4A 2C2DA 4OYMA 3W65A 1DHMA 3FSIA 1SJ1A 2DNHA 3T1HJ 4LFBF 3WX8A 4F0MA 1KN6A 4JOUA 2H5JB 2M2BA 1N5YA 3M8ZA 4OYAA 5IT9Y 3J81Y 1X4EA 1YSJA 3RB0A 1GMWA 2HPUA 2OLWA 2VASA 2XYPB 2BE9B 1WC1A 2FHJA 2HWTA 4ZVGA 2MZJA 4TLRA 2RMLA 2F4FA 3V6DB 1G2EA 2CQBA 3ILLA 3KLVA 4L3KA 1KNZA 4FNIA 4WFNQ 3MEKA 3KLIA 2ALYB 5F8IA 4DV2J 1LW2B 3E8OA 3N9UC 1EETA 4JI4J 2GHWA 2JRSA 4TQSA 3OVAA 4D3GA 3CCSS 2W7AA 1HHTP 3HMJG 4MFBB 2BBEA 1FT8A 1NAQA 1R6YA 1ZAXA 1SKUB 3EYZA 1WF1A 4I68A 2KTQA 1U6ZA 2XULA 5ETTA 3GSIA 3W66A 1G3OA 1SVDA 1HI1A 1XWLA 3G82A 3D54A 2G0CA 2KU7A 3IM8A 4ZLNA 2WVDA 2FDNA 1JLCA 5D77A 3TYTA 5ETLA 1BQNB 3VVTA 4URQU 3FKBA 4PXBA 3V81B 5B0EA 4KH0B 2YKMB 1VIXA 2HBYB 1Y10A 1H0HB 5FJ4A 1TVRA 3QJJA 4P75A 1DBDA 3C8YA 2B9YA 2UUCJ 4YY3F 2UXDF 2VFSA 5K8NA 3G6ES 5GMEA 1HD1A 5DDQC 2C3YA 3UCUP 1N36F 2IJNA 4FS2A 3U1LA 3MURP 2DO0A 1XIQA 3O8WA 8ATCB 1D1UA 4DFJA 3MAAA 4LRDA 3ZTOA 3FEZA 3BM7A 4J9SA 4C0OC 4YEAA 2E1CA 2DPIA 1S59A 1T11A 2ROPA 1RYRA 2NS1B 3IR5B 1IKVA 4WTYA 2QLXA 4KB7A 4CH0S 5B0GA 2IIHA 2RNEA 5KT4A 1LWFB 2RVJA 5E3AA 3PKYA 2XMAA 4J9NA 3OTEA 3DLLQ 2OUGA 3K59A 1HNZJ 2GHVC 4C8NA 1HBMA 2WW8A 2ZM6F 3SSRA 2CQ1A 1MN7A 4OYIA 2DR5A 3AHPA 4IO1A 4CTAB 1T9YA 3S01A 1HQUB 2DYAA 4O3PA 2RQCA 2J8AA 2VC1A 1EZZB 4PXDA 4B3RJ 1VQPS 2A2CA 4X64F 1RBLA 2B8QA 1TV6B 4OI6A 2V63A 4IRCA 1XR7A 5B0DA 3VVUA 1CJKA 2YX1A 1FKOA 4CCHA 3OXLA 4M95A 2ZBIA 4DV1F 3I6PA 3ZZ0A 4NXNJ 2DGSA 2JVRA 3UCGA 2RRAA 3VZIA 4AL6A 3TR5A 5KFIA 3M6WA 3DRSB 2E9ZA 4MK9A 2QG9B 4DN9A 1M90T 2N7YA 2F63A 4RLEA 2BJDA 3CJ2A 1NHKL 2QL7B 5CYJA 2ZEJA 5T14A 2CWKA 1XTZA 4HHJA 1UFLA 3D4JA 4NCGB 1WD6A 2VA2A 5KFSA 4I6YA 2MZRA 4WU2A 1NM2A 1VQ6S 4TY9A 3LGNA 3GIMA 5DDRC 2DNRA 3JXOA 4Y0FA 4B9UA 1Y4ZB 1HARA 2HIYA 4A48A 3H5XA 4ZOSA 3DOMB 1Q8IA 2CQ3A 4QR1A 5DLFA 2EC2A 4RUAA 2ZOMA 3IN5A 3SV4A 3DLGA 2RQMA 1BQXA 4C8KA 4F4YA 3P6YC 4PAAA 4RW4B 3CXCR 1JLQA 1F5CA 3TA2A 3HLUA 3PX0A 3FMWA 5GAHI 4NZ7A 4IYQA 1RTHB 2Y9HA 2YKNA 3GPAA 2ZJPQ 1FD8A 3DLEA 1RWOB 2DPJA 3PIOQ 2HQDA 3KG0A 1VQ7S 4CM0A 1CJVA 2YKPA 3J7Z5 2ZH3A 1U49A 5IC6B 5C2GA 5F9LA 2JHEA 4MIWA 2WSCC 4WYWA 4DPWA 3CDUA 3KFWX 5KFMA 3UDLA 4I6AA 2CFXA 1R8BA 1KQFB 5EX0A 3UCZP 1U45A 1T9VA 2QIFA 2ASLA 5G4DA 1N8RT 1EP4B 1RT4A 4ECUA 1YJTA 1P9QC 4N76A 4UY85 1UJ5A 2D9OA 5D4OA 1TMJA 3TUIC 3M8SA 1TTHB 2DGUA 3EJMA 3PYFA 1Y3KA 3KYLA 3D7SB 3IS9B 4I0WA 2IVMA 3I5CA 4F2RA 3UD5A 1WHVA 1SI9A 2VBXA 3MM7A 2UV8A 4F3QA 1U6FA 4MYTA 5GADU 3TVKA 1BWVA 3BO4A 5CD4H 3K17A 2FJDB 4Y28C 3W9HA 4LF6F 5IC4B 3DYAA 4OHZA 4F8RA 2P9CA 4F7VA 2JLFA 3DLHA 2O66A 1YQHA 2L3MA 2Z2ZA 5B0CA 3C2PA 3VAJA 3OHAA 1HBOA 2MLZA 2XLIA 3CC7S 4NLYA 1E6YB 2AHOB 3O2IA 2RSQA 2YNHB 2XNRA 5AJ3F 4DUZF 4OYZA 4JV1A 2LDYA 1QVGR 1OWXA 3P5TL 3RB6A 2K8GA 2HHVA 1NJWA 2E5HA 3MMAA 4DQSA 4NLWA 5M2RA 2G2OA 2VF3A 3RAQA 1PAEX 4ZJOA 4NCAA 2ZH8A 2P2CB 4QJVA 3CGIA 2KYXA 2J9EA 5CD4A 4AUKA 3U02A 3KUGA 2V4JB 4UQGA 4DR5F 2X1AA 5I3QA 5AXKA 1WI6A 5A8KA 3GV5B 4ID5A 1IWAA 3GB0A 1YITS 3PR5B 1JJ4A 2J9CA 3QNWB 2AMCB 2YH0A 1U1OA 1FTCA 3T6JA 4C6AA 3NEKA 1QSLA 4LFBJ 7AT1B 2UUAF 3Q86A 3D6HB 4DX5A 1M5PC 3NGRA 2FLOA 3Q22A 3D6FB 2CJXB 2F9JA 2X51A 2VBYA 1CEZA 2GA7A 3KG4A 2M4MA 1RAIB 1S6PA 4QCLA 2BABA 3UDEA 1FI4A 2HS0A 1RYSA 1OY6A 2IPOB 3EPIA 3OFGA 4WXOA 5F0UA 1SV5A 2JNJA 1Q8LA 3GIKA 5F8MA 1HBUB 4NMXA 2G13A 2C2KB 1MWQA 3BPDA 3A8IA 2ZH6A 8RUCA 1HW9A 1RWUA 4DMZA 5HP1A 2CJQA 4ILMA 4NYPA 2XEXA 2HNYA 3NGDA 1WSRA 4ZVRB 1VQ8S 2MLXA 1JIHA 3E2EA 3HZEA 4BC9A 1Q1KA 2JVOA 2IMWP 5F8NA 2VICA 5LXRA 2XLKA 4DUTA 2V69A 2EFOA 4EMDA 4QZVB 3WBZA 2GMJA 3W61A 1AW0A 1JXEA 3H59A 4OLOA 4F4WA 3QO9B 1FEEA 1QSSA 2V6AA 1P27B 1I1GA 3N6NA 1KLMB 4JI1J 4PQAA 3US5A 5D0EA 4ED3A 2AQ4A 5LMUF 2UXDJ 3CCVS 3PHEA 3QT7A 3PX6A 2DISA 4DR1J 1W7WA 1KRPA 4DV3F 3KK2B 2FVSA 2ILZA 1YJWS 2ZNZA 2K7JA 3HD1A 3A3PB 3IGNA 2XMUA 3CJQA 3BYPA 4CO5A 5L1LA 1H2TZ 1FWKA 1YIJS 3QATA 1FXRA 3ISND 2V68A 3EGWB 1T03B 1HHSA 4EWTA 3BJYA 2Y8WA 3TAQA 4F4KA 1F2HA 1YX2A 3ZFVA 1MMNA 1H98A 3V6JA 1SCJB 4P52A 1Q82T 2CPJA 1Q7LB 2V8GA 4Q44A 3H40A 4H4KC 1FNXH 4YR0A 2R4FA 2U1AA 1FE4A 5F3ZA 1TKDA 2YX4A 5HL7Q 1KR4A 2CJYB 3LPEA 4QWEA 3D28A 4CLYA 1PO6A 1XN9A 2OPRA 4NI2A 2ZM6J 4ENOA 1D8YA 2ZKTA 2QT7A 4IFYA 5LT5A 2PGCA 3GONA 3FFIB 2A6MA 1RT2A 4Q0BA 1ZPWX 4K0KF 2GQQA 2HHQA 3C6TB 1LFPA 3HFVA 4Q7AA 4DR2J 3NAIA 5I3PA 1VQ5S 4X64J 4XDCA 4USHA 1EB0A 2MXYA 4AL5A 2KXHA 2HYIB 2ZJRQ 2AJFE 1EAYC 4DQRA 5IWAF 5CXTA 1IKYB 1YJ9S 2XTJP 2DGTA 2XY6A 2RRBA 1DURA 2HS3A 4ZVOB 4XAKA 3Q24A 3IC1A 3NXZA 3QMQA 1UMJA 4H54A 2LFVA 4PWDA 3GLJA 3L09A 1LWEA 2YPYA 3THVA 1HIYA 4RW7B 5D0GA 4M5HA 3N4WA 3I0RA 1FXLA 4H4MA 2ROEA 1DLOA 1BQMB 1SJQA 2AGQA 4YDXA 1UEKA 2VB6A 5EWFA 4E8UA 1N6QA 2FY1A 4IQXA 4CYUB 2QYGA 4AYBD 2FY8A 3CF5Q 2H5IB 3GFYA 3HKWA 2W9CA 2HZCA 5ETRA 2R7XA 2CPFA 4DS5A 3NKYA 3HCXA 2OO4A 1XMQJ 4DL3A 1SKRA 4RBTA 4QIEA 1UVKA 2XMWA 2AF6A 4ZVTB 1X5SA 4TY8A 4UTGA 1VRTB 3R5JB 3N6MA 4JI3F 1RGVA 2B6AB 1VOMA 1H7WA 4RWWA 3UNYA 4LRBA 1OYDA 2LCWA 4J5OA 2RKIB 2W2PP 1FDBA 4I7FA 3NGSA 4U8VA 2EKYA 4OX9J 1S6QB 4ZIWA 5L38A 4N7TA 1M5HA 1N48A 1B4SA 1VFJA 1F5BA 4YB1P 1KFSA 2DNQA 1PYOB 3E01A 4ATNA 3CT9A 2FJVA 2B56A 4PQUB 2MEWA 2KVIA 2A18A 3D66A 3A1YG 2N3LA 1XMBA 1UJ6A 1VHIA 1S4EA 2DIVA 2QRRA 1VC5A 3UR0A 3H7HB 3GIIA 3HKZD 4ECRA 3KHLA 3AOCA 2P6SA 3MM9B 2QSWA 2QLJB 1GTHA 3M2UB 4RWXA 3AB2B 2NSBA 3OR2B 2H4WB 1S99A 3A8JA 1TR0A 4FVMA 3LP2A 2J76E 3LP0B 1AXQA 3WZ0A 4DCJB 2R2TA 2R7OA 4NZ0A 3BKTA 5J2MB 4H4OB 1Q78A 1GT8A 2ZOGA 3F0NA 3FVYA 3M2VA 3I4PA 2KRBA 1GXUA 3BO3A 4CO4A 1CJUA 3R9LA 2QN6B 1H3DA 3TARA 1WEZA 1FNOA 3MEDA 1K9MT 3G4SS 2E5GA 3CJKA 1H73A 1N54B 2LU1A 4AFFA 2DXDA 2ASJA 1RISA 1CULA 1Y9OA 2QMWA 2HEKA 3W63A 4B9MA 3CIMA 4NX9A 2UVUA 2WAQD 1DARA 1KSPA 1AB8A 2XS7A 3T41A 4E2FB 1HYSA 2LEPA 4DV5J 3FRZA 2JOQA 3MD1A 2GQCA 2G2ZA 3EGNA 4KHRA 3OW2R 2AV5A 3RUBL 3TA0A 1S0NA 4C97A 1RAJA 2NUHA 3GYNA 2DNZA 4HR2A 5FDLB 2IM2A 4X4TA 2MKCA 2VFTA 5I42A 4L74A 4YHHJ 2V4QA 4A8YA 2JFKA 3FEXB 3H98A 5F8LA 5AJ3J 3TANA 4LVOP 3OVSA 2BEFA 1FRIA 3RU0A 3ULHA 5D4PA 3AJ1A 3ICLA 1NB2A 2RHQB 4WF9Q 2ZHOA 4K2JA 2LKZA 1XERA 4QWAA 3BV8A 2LQBA 3A3NB 1S9EA 4AQYF 4WFYA 1VQLS 1RQ0A 5A76A 2HAIA 2MJNA 1RT3B 3J80U 4K7QA 3MR2A 2EKNA 4DX6A 5F8GA 3KLFB 4OYWA 1N5YB 2GHPA 4DR5J 3FRYA 4OV6A 2ZUGA 4FS1A 2AYGA 3BKUA 4Y6IA 3BREA 2HG4A 4LFAF 3HFKA 1DQ9A 1OPZA 5E3RA 1S9GB 3CNQP 2X7IA 2EBEA 1WEXA 4R5PA 2CVEA 2UUAJ 5HBMB 1DTTA 4JI8F 3VAGA 2DHAA 3LAMA 3G6YA 3UVJA 1JKHA 4RW6A 1HNXF 3NMRA 4GKJF 1KFDA 1RK8A 5CCMA 3UW1A 5MAOA 3ETOA 4LF5J 2CJAA 2XZTB 3OFFA 4J91A 3TEGA 2ZBQA 1JWWA 1SL0A 4BHQA 2UZAA 1UVNA 3R8YA 1J5EF 2M52A 3OJSA 1YI2S 1P9YA 3P96A 1YRXA 3HK2A 5EN1A 1Y7PA 2KXNB 2Z56B 2JEFA 1Q0NA 4NLRA 5K5MA 2JEJA 4PWWA 2LXUA 1IUJA 4ZJLA 3QRPA 4GKKJ 5HQ8A 3D0GE 2FTRA 3R1HA 1VK3A 3DXSX 2XO6A 3BGLA 2JWNA 2AJ1A 3HX9A 3C66A 3GJQB 3TUPA 3M8QB 1NK9A 1ACMB 2V0NA 4R8UB 1NZ8A 2N82B 2FYXA 4Y34A 3MAAB 5HJXA 1ELOA 1RB0A 3QFWA 3R7NB 3ENQA 2HVDA 3JQJA 3M9NB 5KFXA 2CDRB 2KH9A 1T8EA 4O44B 5DM7Q 3CDBA 3SSQA 3OTCA 1BUXA 2B8PA 2E5LF 1HMVB 2CQ0A 4EYIB 2CQ2A 2AEMA 1UPPA 1MMDA 3J7A1 3NBPB 2FGCA 1RXOB 3KK3A 5CYQA 2IJRA 4HI1A 4LSLB 5LXYA 1IKXA 1LOUA 4KO0A 1FF2A 3DRPA 5EX3A 1ULRA 2W24A 1H2VZ 4XO0A 3ZTQA 3R7SB 1CQMA 4C8MA 4HACA 5KG2A 1X5PA 2MGZB 2YTCA 2RQ4A 1R0AB 4U7UK 1UJ4A 3EZ5A 3HD2A 3OPKA 2RQKA 3THPA 1ZS6A 4NLPA 4LR9A 3T6BA 2DITA 2NXCA 4KT0C 3GYGA 1VQKS 4TQRA 2WHOA 1NHUA 4JYAF 3K57A 3CMQA 2DT9A 4JI2F 4PG4A 4GC7A 2EVZA 5H9FJ 2OGUA 3HVTA 3FBBA 3NNAA 4LSNA 2RF2A 1WUUA 4LR7A 3TVYA 3M9OB 3RRGA 3MM5A 4DFPA 1MW7A 2W1BA 4LF1A 2J0QD 4QR2A 4URSA 5HVFA 4F0KA 5IT0A 5IZHA 1A7GE 5IWAJ 1WKLA 3HHEA 4FPIA 3IO1A 2KJWA 3KKFA 4C11B 4QYRA 4OZ0A 3DGVA 4LFCF 2LQ9A 4DV0J 3MUVP 4ZHRA 2QA4S 4ED5A 4I2QA 2CQIA 2VG6B 4LVNP 3T5KA 3PRDA 3BSOA 2Y0SD 2JJ4D 3OTOF 3PNIA 3T3FA 4EZ9A 2PMWA 3V6KA 3PHTA 1LNQA 2Q6BA 4JUZA 4J7CA 3M8WA 2N3OA 3MUTP 2JL9A 4CT9A 3PO4A 3AD9C 1S97A 3R1LA 3PYDA 4CWBA 3CCTA 4CLTA 4WK3A 2ZZNA 1OY8A 3P5BP 3HJVA 5E33A 4IQMA 3V6DA 4O3OA 1UA1A 3M32A 2GIQA 2R8HA 2UXCF 2WOMB 1TL7B 5KFFA 3UR3C 2RE1A 3F56A 1SH3A 4DR6F 1LW2A 2BUNA 4R0JA 2XZDB 2BE2B 2M3DA 3KLEA 2AKWB 2E1PA 3MPDA 4MFBA 1Y5IB 4GVLA 1VLOA 2G0IA 3MOJB 1RTDB 3N28A 4CLLA 3QZ7A 1JLAB 4RW9B 5D0RA 1SJ3P 2ZZMA 1MROB 1RI7A 3VV2B 1SIWB 2H4YB 1QUPA 3NRBA 5AXLA 2KO1A 1QAJA 5KG6A 1BQNA 3CJ0A 2Z58B 4YFUA 3V81A 1KQKA 2YKMA 5J1EB 1YZ6A 3MM7B 5CZXA 3ZZOA 1WTBA 1XK8A 2W2MP 3N5FA 2FVRA 4UUXA 4ICLB 3FUYA 3JAMU 3OTDA 3C46A 1YRTA 2E5IA 2XGPA 1X5OA 3GG0A 3TA1A 2DB1A 1Q8KA 2I6WA 5HMYA 2KFYA 1HNIA 2LU2A 2MB0B 3D0HE 4F3MA 2XMTA 2CG4A 4X4PA 1RHUB 3G86A 4P74A 1NDLA 4C3KA 3GCWP 3RR8A 4WFBQ 1LWFA 1RCXB 4XIUA 2IJFA 1FX2A 1FESA 3BEGB 2B7BB 5K8MA 1JLGB 1LWCB 4A8MP 2G0JA 1FXDA 3RRHA 3FCVA 2J7WA 3MFIA 5U47A 2KXFA 1RUSA 2OIHA 4Y00A 2HSEB 2LXFA 1XC9A 4CTAA 2I9SA 1HQUA 2HFUA 2YWHA 2W9BB 2OD6A 1X9MA 5A8KB 3BQ0A 1WG5A 4JI5J 4JI0J 1ITPA 2AD9A 1NCLA 2HMIB 1WI8A 2ZWPA 2IAJB 2JZ5A 1SL2A 4RUBA 4DPTA 1KDNA 1CSJA 2VKRA 4E0DA 3HZGA 3LA0A 3QFHA 2WRMA 4J9OA 2RAQA 2M8HA 4Q45A 1RWNB 3KLGA 1WELA 1VRQC 2EI5A 2MZTA 4DUYF 3DRSA 2HHPA 5KFGA 3AODA 3ZO7A 2KG0A 3K8VA 2KZZA 3DLJA 4IG3A 4KHPF 1FERA 1S72S 2R9LA 4TU8A 2V2VA 4OI4A 4RUCA 4QW9A 5L39A 1VCTA 3TZYA 4NCGA 3BYRA 3DN9A 3D9BA 2HBQB 2W2NP 4N47A 2MY8A 2R7UA 1X0PA 4M5DB 4HYKA 4ED4A 2Q6CA 2VZ9A 2R7QA 5LMNJ 3KUHA 4NLQA 2EC0A 3DCAA 4QOTA 2FJEB 5C7PA 1Y3JA 3DOMA 2DRDA 1VQMS 1UP1A 1N4LA 1JLFB 1IBMF 1K8AT 2LVWA 2MQNA 2BANA 3MR3A 2FD2A 5LL6d 3IFEA 3BN7A 1ZAVA 4ZCLA 1TL3B 2KYZA 3W5YA 4RW4A 2WW4A 1S1UB 1PGZA 4DV7F 3QSYB 3HDSA 5GAEI 2MZ1A 1XNRF 1OIAA 4M5LA 2DCLA 5DETA 2CIMA 2Y0BB 3H4DA 1RTHA 1IN0A 1AROP 1YJVA 2EFQA 3UN2A 3HFZB 2MPUA 3GFZA 2GVDB 3AD8C 4OX8A 3ZXWA 2GVZB 1XMOF 2WSFC 3K5NA 3BF4A 1AYEA 4KY3A 5HATA 4WFAQ 3T5LA 3QT5A 3C14B 3VCDA 2IRUA 1D09B 4OZJA 3TP2A 2J6SA 3QT8A 3I55S 2W8LA 4USMA 4ED0A 2L9WA 1ZTTA 2NXUA 2VFVA 1R0CB 1RBOB 1K1SA 4DI6A 8AT1B 2J9DA 1EP4A 1NXIA 2C2ZB 1GK8A 2DNMA 4FXVA 2NXJA 1B3TA 1RT5B 1NUEA 2VOOA 1Y00A 2N4CA 1NO8A 3MEEB 2DY1A 2R8GA 5IFMA 3U1NA 4DEZA 3IS9A 2W2OP 4RNHA 3U7JA 2OEKA 5L9NA 1FD2A 3TWZA 1SQFA 3ZTRA 3OHBA 2VDIA 3IA0A 2VQEF 2MKIA 3ZNJ1 4Q0BB 4K4VA 1ZA2B 4CI0B 2VU5A 5K14A 1DQ8A 1G4CA 2C3PA 2P9EA 5E0OA 2CKWA 4W98A 3G71S 1SH2A 4J9LA 1HNWJ 2ZH2A 1QJHA 1BMQB 1DTQA 1RWMB 4KSEB 4DL0C 2UXBF 1HWJA 5KFUA 5T7LB 2RS8A 2CWXA 1GH8A 1TL1B 1S7HA 5L46A 1ZPVA 1E6YA 4K4SA 2DGWA 2POKA 2K1RA 2YNHA 4PKDB 1I3OB 2HRYA 5L9XA 1P1TA 1UVJA 2ZVSA 3M8YA 2BJ9A 4RJVA 2XY5A 2UUBF 2OAUA 3MF5A 1UEVA 3DOKB 2DNPA 4LF4J 1W2IA 2ASDA 1UFWA 4DHVA 2A6OA 5MLCV 1C0TB 3O44A 4OJGA 3UFCX 4XTTA 1DLOB 1LEOA 4HTJA 3EXYA 2V4JA 1KWMA 2GO9A 4IOBA 4A46A 1TL4A 3H42A 3MMCB 3KMSA 1U48A 2YKAA 4I2PB 4WIQA 2IA6A 5A2QY 4GRSA 2H54B 3OR1A 1X0FA 3OXFA 5GAEU 4JV5F 1ZBTA 3PYGA 3CEDA 1PJ7A 2KKHA 5CQGA 1JXLA 5T41A 3GILA 4ZPTR 4ES3A 3JQMA 1S1XB 1HD0A 2C2RA 2ZZTA 1NSKL 4NASA 2XB2D 1TAQA 2HFVA 5KT6A 4IRKA 2J0SD 5B0AA 4CNYA 5FLXU 5HROA 2CRLA 2GJFA 4GO7X 3BDPA 3OVBA 2VBWA 3JYTB 5LM7E 3DC2A 2HWIA 3PW5A 1CJTB 2OP5A 4IG0B 3CULA 2UP1A 3P45B 2UV8G 4F04B 1HBUA 4RNOA 2A2DA 4LRAA 5JUMA 4TU7A 1OQ6A 1NK5A 3G6XA 3CD5A 1NSQA 4QU6A 3LALA 1X31C 4GC6A 4DR3F 2E9TA 3KNGA 2OTJS 5L1KA 4AD6A 2F1FA 3DOLA 3LP2B 3CVKA 3QAEA 3EDRB 2D3ZA 4QBUA 4DR4F 4O23A 1RTJB 3KTQA 3J80Y 1VR6A 5LJ3Y 4P6QA 2K7KA 1VC0A 2UUTA 4DR7J 4QQBA 3T1YJ 2MSSA 3MEDB 3QO9A 1LK7A 1QAYA 4PXCA 2HURA 1KLMA 3H4BA 5GAGI 3DU6A 3CJRA 1FJEB 2DH8A 1R8CA 4M5IA 1NU4A 2HHUA 1HNVB 1FDAA 4ER8A 3KK2A 3BGUA 2WCXA 4PZVA 3M8PA 4KHMA 1HYSB 1Z1ZA 4WE1B 3V2UC 2V8PA 1NH7A 1SJ4P 4ELUA 2V9KA 2HNDB 1QSYA 3W8PA 2VQFJ 4L3NA 4YUDA 1VMBA 1KTVA 4C8LA 1T9WA 2DR7A 2DHXA 1N5TA 3PO5A 1ZM4A 9ATCB 4ZP8A 3H25A 2DBBA 4EO8A 3VGUA 2ZFHA 3TX0A 1EKSA 5A0YB 2WBRA 1S9EB 3OXGA 2HKEA 3RAXA 4N5SA 4PPZA 3M30B 4Q5VA 1IKWB 3PVXA 3T5JA 1C4AA 2AT1B 2DO4A 3FFIA 4CLUA 1VQYA 3C6TA 1SJFA 3L7PA 5F3TA 1T9TA 1FFGB 2IRYA 1RWKB 1JXVA 4YB5A 9RUBA 5JVGQ 2IM1A 4K2XA 2B3TB 1HI8A 4USTA 4DOZA 3PIPQ 4LF9J 1T0TV 4KGXB 5H9EK 4PG5A 1RAGB 3UVJB 1IKYA 1X60A 3LGHA 2HHHF 4LMZA 2E9RX 3H5UA 1WORA 2XHWA 4JI6F 1VQNS 1FDNA 3R2CJ 4B3MF 2RT3A 1WOSA 1BLUA 4B3SF 1XJWB 2GQ2A 3KOAA 3R5GA 4MK8A 3RTVA 3L3CA 2F65A 2VG7B 2XMKA 4JBCA 2V50A 1KTQA 4NA3A 1KS2A 2B9WA 3H90A 4DWIA 4WK1A 1BQMA 1CC8A 3M8RA 4ZPCA 5A8WB 2KI2A 4F36A 3MCNA 3PZPA 4QIFA 2DHGA 2R7TA 5B0FA 4CYUA 5AXMA 1C4CA 1N33F 2HQIA 3GFXA 4HT7A 2DNKA 1A6LA 2HQFA 6AT1B 4DFMA 2I8EA 1IBMJ 1PYTA 1VRTA 3SCKE 2B6AA 3HHLD 3ITHB 3OSPA 2HFNA 2PEBA 4ED6A 4UZBA 1D3WA 2RKIA 4O0IA 3K5MA 4OI1A 1H6KX 1FNMA 2HFSA 1FJGJ 1S6QA 2PEHA 5EGYA 1WC6A 2M88A 2MHEA 4YB6A 4AXJA 1R43A 2BMBA 2YY3A 2R8IA 3UDVA 5KFYA 5C42B 3TW0A 4UOCA 1GFWB 4C8OA 3VZHA 1RKIA 3HM9A 3R5DA 2G4BA 4G1IA 2BM0A 3I0SB 4N8OA 1XMOJ 1SC4B 3NNHA 3UD3P 3PEJA 4HKQA 2NQPA 4B9TA 5DDOC 2QGFB 3NWGA 4F4XA 1TFWA 3R2DJ 3QGHA 2QL5B 4J9QA 2RS2A 1IKXB 4USIA 2BDPA 4CZCA 3HSZA 4N41A 5CAAA 3MM9A 2LMIA 3M2UA 2W4DA 2EPIA 2Y1IA 4WTOB 2RDIA 2FZGB 1JMTA 3KK1B 1U24A 3LP0A 1X7VA 5F0WA 5J2MA 4H4OA 3VAFA 2CQPA 6FDRA 1DAXA 2XYHB 5D15A 1CBKA 5I3UB 3MM8A 1M1HA 3GG1A 1J2VA 2IBOA 5A8RB 3SV3A 3LH2S 2R8JA 2E66A 1B0TA 3DI6B 2GAHC 1XEZA 1OO0B 2MKSA 4LF7F 3DXBA 3JTNA 3C16B 1HA1A 2QLBB 1QUVA 3EGZA 4CLZA 1WNEA 3MCMA 1FRJA 1RA7A 2NREA 2W9AA 2E1AA 2UXBJ 4EFAC 4B08A 4PYAA 5DQIA 2D41A 2Z4PA 5FDLA 4B9LA 3SI8A 3MMJA 5DRKA 5BR8F 1CLFA 1IBCB 1HWKA 2ACMA 2CUYA 1D9FA 2QO3A 1M5VC 4ZHRB 4WBFA 1I94J 1PJ5A 2B7CB 3JSMB 3ENAA 3K5PA 4RU9A 1RT1A 5DO2A 2AGOA 1RAFB 4PCQA 5DLGA 1IWGA 1RT3A 2KM8B 4J9RA 3NS7B 2HAFA 2D69A 4ID8A 2M5YA 3WC0A 3KLFA 2QLFB 2QZ8A 1S4FA 4ELTA 4DV4F 5KT2A 2BW2A 3MCOA 5EUHA 1N32F 1NJXA 2UU9J 2V34A 2ZBRA 2VIHA 1IQTA 2XWXA 3DHXA 1VBYA 4JV5J 4LF8J 2BM1A 1RWVB 1T02A 1S9GA 3M32B 2VH7A 5HSPA 4HTIA 4Q8EA 3MAHA 5KAKA 4ECZA 3H20A 4U7UD 5HBMA 3DDIA 3IRXB 2VD3A 4A4JA 3P49B 3AA9A 4B3OB 2H48B 2QE5A 2F8MA 3O3LA 3KLEB 3ZZTA 4OZ2A 2APOA 3BH7B 4KBIA 2XMJA 4WFZA 3DRRB 4X65F 3TUZC 4ZVSB 3HI9A 3LGMA 2ERRA 3LUYA 2GGPB 4QWCA 3HHLB 1YKWA 1ROFA 2LA4A 4DR3J 3M6UA 3N01A 3JTOA 1YJNS 2ZDOA 1TMMA 2XZWA 1VGYA 1U6BA 1UWBB 3GJTB 2YWKA 3R5CA 1D9AA 1K44A 1FWPA 4ED2A 3G8QA 4NRUA 2ZE2B 2P8IA 2HW3A 1IJEB 3H5SA 1X4HA 4EGLA 2DNOA 3M8QA 5BXIA 1M5KC 2M7SA 3DHWC 3EWGA 1NK7A 1HNIB 4R8UA 2BXJA 4ZVEA 3G2XA 3QIPB 2OI2A 3GE9A 4M5GA 2C28A 3DLBA 2I5JB 3BSNA 1U8WA 2NXNA 2AP6A 1C0UB 2CDQA 4U67Q 4FYYB 1JB0C 4I67A 4R0EA 1L3UA 4OZ1A 1U25A 3PACA 3K58A 5KG4A 4O44A 3RBEA 2IYGA 1JJ2R 3RW6A 3AJ2A 3MMBB 1HMVA 3NGTA 5E41A 4HHUA 2FHKA 3DKDA 1MN9A 1TAUA 3WQPA 2LYVA 2VDHA 1L3KA 1B0PA 3KHGA 2GAGC 3CCRS 3NBPA 3FMBA 4CLFA 1L3VA 2HVIA 4U96A 4LSLA 3P3DA 1YVFA 3HT3A 2O3DA 3H5YA 3H2LA 4NLGA 3DDKA 2MGZA 2EFPA 1R0AA 2CZ4A 4WFXA 2HQGA 1WHXA 1NK6A 3DDNA 4A8FA 2BJ1A 3T5HA 4FXDA 5IM0A 5C5JA 5GADI 1GX5A 2B4OA 1T05B 3QPIA 1Y5LB 3TJ9A 2UUWA 1JNRB 1FRLA 4Y2CA 3KLGB 3MI7X 1T9XA 1VIOA 2YQ0A 2CPXA 4NLOA 3EUNA 2CPZA 2V2QA 2UVVA 1K0VA 1W25A 4IG3B 4ZPVR 3VWSA 3KDNA 6FD1A 4RPFA 2FJXA 4JI7F 4ZVUB 1AFJA 1NBEB 3H2VE 1RWWB 1C1CB 3QJPA 3HULA 2W4CA 1FO1A 1IBKF 1IBLF 1Q16B 1UAWA 4C11A 2XI3A 2FJWA 2CZVC 3QT6A 5D6GA 1IXKA 2IYIA 3EPGA 1Q95G 4TKTA 1JLEB 1N5VA 2RH3A 2DGXA 4QPTA 4B3SJ 1QE1B 4CH1A 1VRUB 2B5JB 4OX7A 1F2GA 4LBIA 1F3FA 4C8ZA 1WG4A 2VG6A 1RABB 4LIRA 3VAIA 3M1VA 1NK4A 2BANB 3A3OB 3ELHA 3W2WB 4RX6A 1LW0B 3Q8QB 3EVMA 4G3IA 1X4FA 3CMAS 3MUMP 1NH8A 4UW2A 1EQ0A 2ZWOA 3C6UB 3UO0A 2DY9A 4FYWB 2KT5A 5L1IA 1N33J 4X62F 3HT0A 3GR1A 1JLBB 5EWGA 1VDHA 1E6VB 3IP0A 1JK9B 5I4MA 2ADCA 1NZAA 2ALZA 2N4DA 4C7QA 4YR3A 4DPUA 4B17A 2XGQA 4DCOB 2WOMA 3POTB 1TL7A 3E3XA 3PEHA 1N34F 2IVYA 4IDKB 2BKOA 1GEHA 3QBCA 2VBZA 3GR0A 2BE2A 4K8RA 2OPSA 1XNQJ 2F4VF 4NWBA 3J7YU 4BDPA 3AA8A 1EIYB 4WCEQ 1RWPB 3LP1B 4NMLA 1RTDA 3M6XA 3ZZUA 1JLAA 1VQ4S 1ZZFA 4RW9A 4RNNA 2MKKA 1MROA 2RUSA 3HVWA 5J2PB 3T1HF 1Q79A 1R8PA 3B6BA 1TZ0A 2BOPA 1X8DA 1GXTA 4L6V3 5DM6Q 3R7BB 5J1EA 4W92B 2QA2A 2L9NA 1KLNA 4ZITA 5K14B 2VHGA 4ICLA 2PI5A 1CPZA 4J90A 2FIUA 2YQ3A 2OHDA 4WZQA 1SKWA 1FTRA 5H9EJ 1I6JA 3IGVA 3IWLA 3GZ7A 1VBXA 1HQEB 4QR0A 1DTQB 3I4HX 1XR5A 1H38A 2CXEA 4DV2F 4KV8B 1KOHA 2QJ3A 4UOFA 3VALA 2KT3A 4MMOA 4ECVA 1HWIA 1SPBP 2M70A 2PFFB 4JI4F 2K06A 4U9RA 2F9DA 1S77D 2Z2MA 3PY8A 1FX4A 2H3EB 2K1RB 1S57A 2DK2A 4DQQA 1V3ZA 4B3TJ 2PSZA 4LF7J 2MQ8A 1B7YB 4YQWA 1YZ7A 4OHXA 1T95A 1ZOTA 5D8HB 5IQQA 1JLGA 4PR6A 1TK0A 4ED8A 1LWCA 2C2NA 3BSAA 3IAM9 4TVAB 1WC4A 2O1PA 5KFKA 5KOXA 1KOOA 4NXMJ 3PW7A 4Y2KA 3M9MB 3M7VA 4DPYA 5B09A 1J5OB 1KVIA 1Z2ZA 2UUCF 2DR9A 2EFVA 1NKCA 1BGXT 2W9BA 2YNFB 1N52B 4M63A 2DCUB 3OR1B 1TUVA 5KOWA 1KKHA 2HMIA 2IAJA 1RT6B 1S1WA 3V4IB 4KTQA 2OSQA 2IY5B 4YOEA 4W4MA 3K89A 3GJSB 3UD4P 2W01A 3BKFA 3BGOP 5KTQA 1RLDA 2AJ0A 4OMFG 4TYBA 1G7CB 3PV8A 1RAEB 4X84A 2V67A 3RW7A 4ZS6A 2K2PA 5HROB 3BR9A 3Q89A 1F3VA 5GVQA 1QLNA 4O3RA 4ANDA 3OJUA 5H9FK 2LEAA 2BJ8A 3BZQA 4LR8A 4L76A 2ZC3A 4A8QA 1F1BB 4M5DA 2COLA 1HW8A 4X4VA 3V5RA 4DL7A 1U02A 2R3VA 4PYDA 3NP5A 2JEIA 4M1KA 3K0JA 4ECQA 2NUUG 3DOLB 4B3RF 3FJ2A 2AZ3A 4X65J 2E1RA 1JQGA 5E3QA 2DXFA 1JLFA 1WHYA 3T9NA 1RAOA 2C3UA 3X3UA 3KXDA 1TL3A 2XSFA 3VAMA 4KQZA 4A8OA 4P2XA 2J0XA 2CNOB 1YGYA 2HK2A 1S1UA 5C2CA 4NXNF 3IG1B 2VOPA 5DQGA 5KG3A 3DM2A 2W7OA 1FRXA 5K8OA 3DGPB 4YY3J 4DSFA 4ZVFA 3MECB 5IV4A 2GVDA 5IQ6A 3ILOA 3ENVA 2GVZA 1N36J 3NLCA 4KR0B 3M8PB 3DRXA 4NLXA 1D8ZA 3J7ZT 3C14A 4F26A 5HLFB 2CJ9A 2ATCB 5ETVA 1OSDA 3ISNC 2MSTA 4ZA1A 2AIRB 3ZC4A 2Y1RI 4IFVB 4C0BA 2E7XA 3QRRA 2QMUB 3PJXA 2OMOA 2HNZB 3TI0A 1RT5A 2ZH7A 3MEEA 3CCJS 4F4ZA 3HXMA 2FUG9 4UY8T 3JTPA 2SXLA 3MCSA 3D1HA 1KQGB 2H51B 4P2SA 2EEYA 4ZVHA 3TAPA 4S0MA 4K50A 4KKOB 5KG7A 5HQMA 2F3JA 2DNNA 1LKZA 3KJVB 4GMKA 2OKQA 2EFNA 3G6VA 1Q7YT 1MLAA 5DZ6A 4QW8A 2LQ8A 1T94A 1HWLA 3GIJA 4M8LA 3KLHB 5CCLA 2XSJB 4J37A 2QEXS 3HSDA 5T7LA 4YMEA 1Y11A 1IM6A 4RKUC 1TL1A 5DDPC 3N79A 4LUBA 2BRKA 4MK7A 3C3LA 2C3MA 2WONB 4DV1J 3V6HA 2HVZA 1QAXA 5DGAA 2B0GA 3P8BB 2ZD1B 4ILRA 2GIFA 5LJ5Y 1T3NA 5B08A 3DOKA 1V3RA 1Q53A 3VTIA 1FRKA 1QM9A 4KFBB 2AWZA 3H8YA 4UT4A 5JJBA 1C0TA 2AYBA 1WACA 1IBLJ 1WF0A 2J5AA 2BQRA 3MMCA 2YNGA 4ITSA 4I2PA 2YH1A 2RRNA 2PIIA 3QRQA 4EI2A 2V5HG 3S6EA 4OQJA 3FBEA 1TUGB 2PC6A 3BGRB 2FQQB 5HK4A 3WIUA 3L4BC 5AE1A 3Q8SB 3BB5A 3ENWA 1S1TB 2P9GA 2R2SA 2NSCA 3L7UA 2IFXA 2EXUA 1SIZA 3IBWA 4UF4A 1S1XA 4IR9A 4K4WA 1TUWA 3LWLA 1WDDA 4WJBA 4O4RA 1RHQB 1H74A 2PDAA 3JYTA 2VC0A 3D6MB 3T9ZA 4HDGA 1T3OA 4CLSA 1M5OC 1CJTA 4IG0A 2HBZB 2MKHA 5HQLA 3NCRA 4ZKAA 4ED1A 4F2SA 4CDIA 4YB7A 1KVJA 2X1GA 4FBTA 1YLXA 7FDRA 1REVB 2NXEA 2ZKUA 4RO0A 3O6QA 1WOPA 2HHXA 3G9CA 3UNGC 5FIIA 1NLKL 2IBKA 2Z0GA 2PMHA 1RTJA 4YP3A 4F67A 1FVSA 3Q2TC 4LBPA 3WX4A 3MM8B 1KHWA 2OEMA 2WB1D 2JFDA 1TQLA 2D7SA 2D9PA 4LBHA 4ZP6A 2CPHA 4CO3A 3MEGB 3GJRB 1VC6A 3SCIE 1HNVA 4OV1A 4LF6J 4IKAA 1FWLA 1PG5B 4EZ6A 4WE1A 3N5BA 1U7LA 5FD1A 4WKYA 1MU2B 4V1Ak 3FK4A 4EYHB 2OPPB 2HNDA 1U47A 3KJQB 1HR0F 3FZBA 3CE8A 2VA3A 4DUZJ 1KC8T 4BWJA 3PYEA 1VQOS 1S0VA 1M1GA 5LOQA 1UETA 1Q4RA 5F41A 1SBRA 3PCOB 4FXWA 1I51B 1OMSA 4ZIVA 1LXJA 3SQGB 5A0YA 1SC3B 2L48A 1RT1B 3TEHB 3L7OA 1HL6A 1Q86T 2EWHA 2PI4A 4RZRA 4LIWA 2PA8D 3M30A 4FP9A 4JI1F 1IKWA 1F0XA 1LFWA 3L9ZA 1TL5A 2IC3B 4PABA 1X9SA 1KP6A 4CO0A 4DR1F 2Q79A 3I31A 2QLWA 3ZZPA 4DZDA 1F6TA 1FVQA 3ETMA 1RWXB 2H65B 4YN3B 1F9EB 1L3SA 5E3CA 2OPQB 3GFHA 3R6LB 4DG1B 1UFKA 2IMOA 2NYIA 3PX4A 3AQPA 2A0FB 4KGZB 5IXUA 1NPRA 2QX0A 1Z4UA 4I69A 4NEYA 2WBMA 5KT5A 3TZXA 3CSKA 3MWBA 1RTIB 4Q8FA 3NNCA 2XM3A 4HEA9 2BJEA 2RU9A 3FNNA 2MHNA 4FZVA 1FKPB 5KFJA 3CB4A 1CVJA 4I64A 5CZVA 2VG7A 1SXLA 3T1AA 2ZHAA 3DMJB 3AXKA 5A8WA 3CCES 1LK5A 1YK9A 4CH7A 3H2UB 1M5SA 2R7WA 2M0GB 4USKA 2GV1A 4AXIA 3F44A 3DNCA 1SB6A 5SUHA 4DR2F 2CPDA 5K9FA 3VF0B 2HBRB 2D1CA 1NEEA 3L95X 2I2YA 1GNKA 4NYOA 4F02A 4N8NA 4Z7YA 3LF0A 1F9FA 2PT0A 4ETZA 1WC5A 3ITHA 4KPCA 4FF2A 2WVEA 4OYXA 5KFAA 1OJ4A 2XCAA 5CA5A 1J27A 2GJIA 4DL6A 1SUQB 3JSRA 2FC9A 1T9UA 1U26A 2BE7D 5C42A 2V8DA 4IH5A 4WPAA 4ECSA 5LSLA 5LMUJ 2LQ5A 3UQSA 2ZH1A 5EHHA 2KFZA 2GJ2A 2OTLS 1NKEA 4DV3J 3I0SA 2FLPA 1CC7A 3RZAA 3VHQA 4WYLA 4CLKA 4LJMA 1U09A 5IOLA 3Q8RB 5KFBA 2PN6A 2KFNA 1IR2A 1NJYA 4DN0A 3MTKA 5CYMB 3EM1A 1TFYA 2KJVA 4BBYA 1EARA 1UPMB 4Q2LA 2HZVA 2RD5C 3OUYB 3OL9A 5G0RB 3WC2A 4V19X 3I56S 2UVRA 1F9HA 1XMQF 4EBCA 1N56A 2RJZA 4F25A 3KK1A 2J9DE 2HRTA 3AT1B 1GQEA 1K47A 1UVLA 4CLPA 2KVQE 4DJBA 2HGMA 5IM0B 1EQMA 4O3NA 5F8JA 4P7TA 1P1LA 1V5VA 5I3UA 4G1QB 3RBDA 2YX7A 4OX9F 3PG9A 2EFGA 5A8RA 3CTRA 3B54A 3K8WA 2PO4A 3DI6A 3EE3A 4K0KJ 1RJJA 3OFEA 2CNLB 5KFLA 3QLHB 4K5SA 5ADZA 3DFEA 1HQ2A 3BO2A 3C16A 4DDFA 4ECTA 2NZCA 1KD1T 1FJ7A 5J1PA 2HIQA 3PM9A 2CPEA 2MQQA 3LQVA 1RBAA 1OY9A 4DPOA 3PDNA 2VPYB 3EVOA 1PAUB 3KJNB 5ETKA 1DFDA 3I96A 2HVEA 1PSDA 5F8HA 3FZ2A 4IOAQ 3MPUB 4C4WA 4WWSA 5CH7B 4FYDA 1VLYA 4QIGA 5E5NA 4IH7A 3GV8B 4RR5A 2AX0A 3JSMA 2KB2A 4OYPA 1RLCL 3CD7A 4ZK7M 3ZZRA 4EO6A 2D3UA 3M1VB 3X1LB 1URNA 3OSNA 4DL2A 2FZCB 2QSFA 3VGVA 2B51A 3Q2SC 1D0EA 4RL1A 2G2YA 4N77A 1S0MA 4DBQA 3BN4A 4CNZA 3ET6B 2E44A 4FVCA 2D3O1 2KZMA 1DY3A 4O4GB 1WJ9A 5E3PA 4U95A 4WIIA 7FD1A 4OI0A 4I4BA 4D3HA 1S0OA 4WZMA 3IXQA 4DV5F 4WP8A 4JI3J 4DV6F 2C2OB 4NLDA 2ROGA 1HBNB 1S7IA 1WEYA 3IRXA 5A6WA 3WIVA 2E5JA 4YHHF 4OL8A 4B3OA 1FK9B 3A12A 1N5SA 2OPSB 3N6LA 4DX8H 3C19A 3HHKA 3PRVA 1YBUA 4FDFA 3TAMA 3CIZA 3DRRA 1BXNA 2GX8A 4QYZK 2AJQA 4PG6A 3DLKB 5ETOA 5KFDA 4URGA 3SQOP 2KHCA 3MZIA 2IM3A 3D1QA 1U0HB 1NPPA 5J2QB 4MJKA 4OZNA 2AEFA 3ADAC 4KGMA 2GGPA 3BSCA 2OSRA 1AT1B 3IWXA 3IAS9 3HHLA 4DSIA 5KT7A 2GIRA 4KE5A 2RU3A 3KHRA 4KRWA 4BS2A 1PCAA 1V3SA 3MM6B 2G1DA 4HH0A 1UWBA 3GCXP 2PA3A 4J9PA 5GAHU 2BJ3A 1EHWA 4IOCQ 2ZE2A 3CJSA 5KFWA 4KC5A 2Q43A 1ZA1B 4ZPAA 2FZKB 2FVPA 1S79A 3QIPA 2NPIA 3PW0A 2I5JA 1FKAF 3J7AN 3D67A 5C24B 1C0UA 1R0BG 1ZZNA 3SCJE 4EK2A 3K5OA 4LF5F 2EBGA 4DCPB 1N0VC 3TQ1A 4L73A 1RE1B 5HVHA 2HHSA 3MMBA 3OLBA 4ANEA 4V19J 5E2QA 3B78A 4JV2A 4LT6A 4C48A 5KFEA 3I9V9 1Q5YA 1FJCA 3FBCA 3MPWA 4GKKF 2MLYA 5KFNA 5ITHA 5A6PA 3MFHA 3W3SA 1TKZB 1HR0J 1OQ3A 4ZLPA 2M8DB 3FC9A 3VGSA 4GVBB 2JLGA 3VAHA 3CWJA 5HAOA 3NOGA 2WVFA 3HJFA 1HPZB 1S1WB 4AQYJ 1S1VB 2CQ4A 4NLSA 4LF2A 1T05A 3QWUA 2IM0A 4G6VB 2WZ1A 1QTNB 2LXIA 4ZPDA 2R7SA 1FRHA 4IH6A 3PW4A 3FGVA 2FVCA 5SZTA 1BHNA 2C3OA 1OPIA 5KFVA 1B70B 2AJ2A 1ZYQA 4J9VA 2ILYA 4LFAJ 5LSOA 4NA1A 2F8EX 5J1NA 2MKYA 4OHVA 3A8EA 4K4XA 1S6OA 3CDEA 2HQ3A 3B8HA 5THWA 4BWMA 2C22A 2CYYA 3QQCD 1R8HA 1C1CA 4JI8J 1V9OA 4FN5A 2VONA 1HNXJ 2VG5B 4GKJJ 1UW9A 5DQHA 4C3MA 1AUDA 3SCLE 3CCQS 2U2FA 4OI3A 1JLEA 3CO9A 1OS5A 2XS5A 4MAKA 2HS4A 4LQ3A 4KGKA 3TRGA 2PFDA 1QE1A 1VRUA 2B5JA 3A4TA 2XMVA 5C25A 1YJ7A 2AW0A 4DF4A 3PJ9A 4KPYA 2LEBA 3W2WA 1J5EJ 1HKAA 1LW0A 4L75A 1WHWA 4J9MA 2J8SA 3AJDA 1F5AA 3OL8A 2EK6A 3C6UA 1S76D 1G6BA 4J9KA 3OV7A 3DM2B 4MIAA 2X1FA 1JLBA 2RDJA 1OYEA 1E6VA 1O8BA 2R42A 2CQCA 3MR6A 4W90B 3MPYA 2HQCA 2Z8QA 5D3GB 4ETXA 3POTA 2Y1LB 2CVIA 3KDOA 3Q8UA 1GMWD 4KH1B 1N5QA 2FHJD 4IDKA 3W64A 1I5OB 2A1BA 3SFUA 2Z30B 4DV0F 3FQLA 3W7BA 2I1RA 4HDHA 5IT4A 3M2RB 3LP1A 2AYEA 2AU0A 2E5LJ 4DQPA 3RBXA 2Y1JA 2J6TA 1W2BR 4OJ1A 5J2PA 5GMDA 4XPCA 2H9ZA 5D4NA 2DVIA 4TNOA 4QWBA 3NGUA 4Y2AA 5M2PA 2QA4G 2HFOA 3SFGA 1UKUA 5KFRA 1X4DA 4B9VA 2O01C 2DKOB 3W9JA 2ZHBA 5AT1B 2FB0A 1O0PA 3CDAA 5J2NB 2MQLA 2H5EA 1HI0P 5D0HA 3G8TA 1U1KA 1QTMA 2W2QP 4PUOB 1WG1A 5ETMA 3O5TB 4KJIA 1YJUA 3CJ5A 4YR2A 3D2WA 4I1TA 1HQEA 2YNIB 3NG8A 4OZLA 1P8GA 4USJC 2DD8S 4KV8A 1AUSL 2X3DA 1U1MA 2WVBA 2GNKA 4JYAJ 5KG0A 4QIVA 2PE8A 2MY7A 1C1BB 3J81j 3RBZA 2RUGA 4JI2J 4ECXA 2YWFA 2MYFA 3PR4A 4HHHA 5ETSA 3AOBA 1Y5NB 1Z2LA 1ZH5A 3MPVA 4F4AA 4DLEA 1K1QA 4O3QA 4ZP7A 1RADB 4RNMA 1VHFA 4A47A 2C2EA 2MTLA 2XI2A 2DH9A 4C0HA 2QV6A 1B0VA 1J5OA 4OZ5A 4Z7CA 2LLZA 3QAUA 3GP9A 4BLGA 2YNGB 2VV5A 3I87A 4LFCJ 2YXLA 4IUFA 2YNFA 4RW8B 2BW7A 5ETNA 4P73A 2HHWA 1A9NB 5A2QU 3A8KA 1AZSB 1RT6A 1SQEA 4R25A 1B7FA 3HSJA 1IR1A 2N7CA 3RAMA 3V4IA 2H1YA 1PC4A 1ZM9A 4B9SA 4UOHA 1NMEB 5HMWA 3OTOJ 2EG2A 4F0HA 4NLUA 2KRRA 4DL5A 4FF4A 2JC0A 2R2RA 3I32A 3RRKA 3PJWA 4Q2MA 1RT7B 3SDEA 2B4PA 1U1RA 4DV6J 2Y3YA 3C15B 1VQ9S 3VGTA 3W2VB 1GXLA 2UXCJ 3PTWA 1AA1B 4DR6J 1WSVA 4DSJA 3GU0A 1WDTA 1FHTA 1TKXA 4ZPWR 1U2RA 4LSZB 1WKJA 4MT1A 5ETQA 3U1MA 2NPFA 1UZDA 1VJWA 1YWXA 5CABA 2R7RA 2HLTA 4JI5F 4JI0F 3ILIA 1DJ0A 1DZ5A 2FPHX 1M1KT 4AT1B 3R5AA 3SIPB 1IJFB 3HF5A 3Q0AA 1CS4B 4OX6A 2XHCA 1PC5A 1MSWD 4HI2A 4QPXA 3TUJC 1MNEA 4IRDA 3WHIA 2A10A 2BOAA 2R2UA 1EJ7L 3K7RA 3IG1A 4OHWA 3OQ2A 1T7PA 1VBKA 2DXEA 3MR5A 2JEGA 1V6HA 2HRUA 3DGPA 3PXGa 2Z57B 4NCBA 1YG0A 3MECA 3LOUA 2CA9A 3MAQA 3IRWP 2QYCA 2FJAB 2NCKL 3D0IE 1WC3A 2BX6A 1TK5A 3HP6A 1EX8A 3SSSA 3JSBA 4ZVQB 1RHMB 3KLIB 2BV3A 3BGFA 4Z2XA 4DU7A 4UUWA 4ZVPB 2EK1A 2ZBCA 1EETB 4MKAA 5HLFA 5LMNF 2ZOFA 2FLLA 3UDCA 3UWTA 3KMQA 1YDLA 4XK8C 3EZUA 4IFVA 5BYRA 3HPOA 4WKRA 2LQJA 4WP3A 4OI2A 2YQ1A 5BYQA 3CC4S 2HNZA 2HZAA 3GSDA 2DRAA 4BC7A 2F7VA 1U2FA 4M94A 3OTBA 4C98A 2VJUA 1YBTA 3G82B 1GAOA 3GWCA 1JLCB 1NK0A 2V2ZA 5KG5A 1H72C 3GYXB 3H0PA 4FPRA 3LW5C 2YBVA 4FF3A 3SEOA 4ERDA 1H7XA 1S10A 3EXCX 4KKOA 3TZZA 3MXHP 1TVRB 2RB7A 1R31A 2ZITA 3KJVA 4WU3A 3PW2A 1MWZA 2E7VA 2IA0A 1LQ9A 1X4GA 1FFWB 1K0TA 3AFGA 2MQMA 3GMGA 5L1JA 4QWDA 1NDCA 3KLHA 2ZVIA 4ZCMA 2KM8C 4RBUA 2XSJA 2XQCA 4DSEA 3MOZA 3RR7A 4P2MA 1NK8A 1PILA 3W60A 2P6TA 5H1SV 3UPFA 2EG1A 1X4AA 1RA6A 4QYZJ 2WONA 1IKVB 1U4BA 1RAAB 3ONQA 1S5ZA 2QL9B 5K8PA 1V5IB 3GV7B 4DUYJ 3EX7B 2CPIA 2QA1A 2ZD1A 2Q3PA 4XDDA 2F40A 4IO9Q 4HLBA 1RU1A 2V8HA 2F8HA 1TP7A 4ZPBA 4KHPJ 2ZBPA 4KFBA 3JS9A 4DS4A 3VAKA 2MMYA 2DIUA 3OD2A 2BJ7A 1B64A 2A3JA 1SH0A 1HBMB 1PJ6A 3R27A 4F3OA 2HLUA 4DL4A 4CM2A 3HHDA 4EBDA 3TNVA 4CLWA 3JB9k 2CG8A 1VISA 3CDWA 3B4DA 3SMZA 5KFZA 2KHDA 1NSAA 3TJ8A 2XYGB 4Z37A 2BACA 1WTFA 3CJ3A 2VFUA 1KVKA 2B9XA 1BE4A 4Y3CA 3S8SA 4U6PA 3BGRA 1SC6A 1HNWF 2XLJA 3HSGA 1UL3A 4NL5A 1N88A 1FDDA 2KG1A 2MZSA 1CJKB 1JNZB 3HHLC 3D68A 3DU5A 1FKOB 1UEUA 1S1TA 1M0SA 3A13A 3W62A 4MYUA 4JP8A 3EDQB 3CUNA 2F5GA 4DV7J 5HN0A 1S12A 4KAIA 5DGBA 2Q1LA 2MQOA 1XNRJ 1DRZA 3AOAA 3AD7C 3S7RA 2G9OA 4XPEA 4LF4F 3Q83A 4A8KA 4ZCIA 3EZOA 1P6TA 3LWMA 2QFJA 2NZ4A 2HWHA 1IVZA 5KFPA 1MMLA 2AJ4A 1HWUA 3CCWA 2CJBA 3CC2S 1REVA 1Y0HA 2ZJQQ 1L5UA 1R3NA 1X4CA 1TKTA 4KIAA 4JB8B 1RHKB 3UE2A 2DJWA 4P2FA 1KEKA 4M5JA 2PMZD 4Q43A 2ZH9A 1K73T 3OLAA 1R89A 3DLGB 2ZH5A 3QYYA 1NDPA 1IM4A 4MTPA 1URRA 3K5LA 4MKVA 3NOCA 4ZN3A 1JLQB 2CQDA 1S48A 1SC1B 2K3IA 5GMKa 3QJLA 4UZCA 2VQEJ 3TVZA 3KHHA 3BQ1A 3BDEA 3VQSA 2YKNB 1S9FA 4PRFA 3Q8YA 3MEGA 1JJCB 3DLEB 2ACYA 3FQKA 2NYHA 5AE2A 1CJVB 2DNGA 3GTYX 4NLVA 5KFOA 2RILA 4NRTA 1U8SA 4TLQA 2J6UA 4U8YA 1MU2A 5KFCA 3THTA 1U2CA 1YRUA 2OPPA 2WSEC 1ZTWA 1HLWA 2RDDA 3D1OA 1QY7A 3AH6A 1IQZA 4X4SA 1RDRA 3RYLA 1RT4B 3ILJA 4ES2A 2UUBJ 4WXWA 2GFFA 2JC1A 3SQGA 2DEIA 3CJ4A 5KT3A 3IBCB 4RUHA 4DQIA 1GMUA 4DR7F 3T1YF 3W8GA 1O51A 2VL1A 1UVIA 4X4UA 4ALZA 1FE0A 4HVZA 1WC0A 3BBBA 3OT9A 2IC3A 2X1BA 5HI7A 1LV5A 3JAMY 4C8YA 2XNQA 5IT9U 3J81U 3HVRA 3FCHA 3DYAB 3QIDA 2ZNYA 2OPQA 3CCUS 2CJKA 1NSPA 3S1TA 4DG1A 4HH1A 2ABYA 4OHYA 2M9KA 4DFKA 4CQ1A 1HBOB 1ZM2A 4L72B 2FJBB 5B7WA 3I9ZA 4A8SA 2VQFF 2XO7A 5JMNA 3HO1A 1NHVA 2D74B 5F9NA 2R7VA 2O67A 1RKJA 4AE5A 4PG8A 4N56A 1RTIA 4TU9A 2CAJA 3TAMB 1FKPA 4OZ3A 4OIXA 3ZTPA 3MMAB 4DU8A 3TZWA 5LSRA 3DMJA 1PKUA 4P9SA 4B9NA 1F60B 3B4MA 1NNDA 2BKPA 2C2MB 1VI7A 4X4QA 2IHR1 2DTJA 4ELVA 2CQHA 2GC8A 1MWYA 3U27A 2GMLA 4ID5B 3EVWA 3ZTSA 1GTEA 4X4OA 4U7CA 3KNAA 1BWEA 2WB4A 1XQIA 2CNKB 4DR4J 1TV6A 2HHTA 1VK8A 3I5AA 2LECA 2V94A 2OH2A 5HMXA 1X4BA 2OEJA 3M4XA 1A0OB 3R3TA 2W8KA 4LF9F 2HVHA 4ECYA 1SUQA 3QGIA 5JVHQ 2ASYA 3W5XA 2DRBA 2YWEA 3NWRA 1S6PB 2OFHX 4I6WA 5L8RC 2OJ3A 1UZHA 3Q23A 4NA2A 4KYZA 4USWA 5IV3A 4JV0A 1SV5B 4PEOA 2ATLA 2AEJA 2DGVA 1EKRA 3QGPA 3NS5A 5CYMA 2YKOA 4OJ3A 5DS7A 1QDUB 3G87A 3F41A 3FSXA 3J7YI 3VR1A 3OUYA 5HP1B 5G0RA 4CO2A 2YKQA 3NMAA 1FRMA 3ISZA 3MDFA 4DSLA 1YTYA 2HNYB 2V8VA 3AB4B 5HMZA 2WK4A 2ADBA 4CO1A 1BC6A 2ZH4A 4A8XA 5AE3A 2W25A 5KFHA 2BQ3A 3PFEA 2Z2YB 2L08A 3SZ2A 2QFIA 1LXNA 4FNHA 3BBCA 2PD1A 5HANA 2YVSA 4G1QA 3EMTA 1FJGF 4P71A 4LREA 1N0UA 1CQNA 1ICEB 2E29A 3MD3A 5RUBA 1RZMA 2Y8YA 3NL0A 4ZLJA 1KQSR 2KN4A 1BY9A 1SL1A 1B99A 2J7UA 3QLHA 3BQ2A 4F50A 3M05A 4J9UE 2DNYA 1YHQS 4LRFA 4DXLA 3IR7B 4E98A 2UVWA 2K3KA 2VJVA 4A8WA 3SXLA 4AL7A 3MTJA 2AYMA 3D6TB 1NB7A 2AX1A 3KG1A 4K4TA 1S6UA 4EBEA 2OFGX 1KHVA 2QMXA 2LA6A 4G65A 4G1PA 2L41A 2AGPA 1Q8BA 3QZ8A 2HHHJ 3W1YC 2BRLA 2YPZA 5D4LA 4JI6J 2DEJA 1TELA 2B4VA 4WP9A 3UI3A 4B3MJ 2GW8A 3MR7A 2XWYA 4LQ9A 4DX7A 2XMMA 5C25B 4USVA 1TU0B 3Q8PB 1RSCA 2OPRB 4NI2B 1CG2A 2GS8A 3RGIA 3DRYA 4QU7A 3CJ8A 4CP5A 2JDJA 4IFYB 3PFOA 2DR6A 2XC9A 1RT2B 3ET6A 1R8AA 3K2YA 3TO8A 2RIJA 2FGOA 3MHYA 4ZLLA 4O4GA 5AXNA 2DNLA 1U1QA 1LWXA 2MJUA 3TOQA 4C3LA 1UCNA 1U0SA 3NGKA 1KONA 1WOOA 2IRXA 1NKBA 4Y2MA 3B82A 3LTOA 4OYOA 4QIWD 4ES1A 2QTWA 5DG9A 5DG8A 4FKYA 1HBNA 3RJMB 5CHCB 4X66F 2J0WA 1FK9A 3GIRA 4YS2A 3ZNUA 1DQAA 1YBAA 3D3CJ 3CD6S 4GO5X 3EGVA 1O5JA 1FFSB 2I0XA 1QD1A 2XY7A 1I94F 1NJZA 2BYCA 3P4UB 4PWDB 3NCQA 3TX8A 2XCPA 1LWEB 3UN3A 3DLKA 3OFHA 1U1LA 3AAWB 3LPYA 1U0HA 2NR0A 2QC3A 5J2QA 2GMHA 4KGVB 2B4UA 3I0RB 4H4MB 4MH8A 5K20B 2HK3A 5BYSA 5B0BA 1N6QB 2OD4A 4K4ZA 3G96A 3Q8VA 1REGX 3TQEA 2W9CB 4P72A 4DLGA 2LP4A 3I5BA 2UU9F 5JXSA 3MM6A 4CT8A 1NDKA 3QSIA 5HVGA
chains in the Genus database with same CATH topology
1H2UX 2D41A 2NSBA 2Z4PA 3OR2B 5FDLA 4LF8F 2BQUA 4NLDA 1S99A 4TY8B 1ZETA 1TR0A 4FVMA 4B9LA 3LP2A 3SI8A 2J76E 2ROGA 5D78A 4EUVA 3LO3A 3LP0B 3IWNC 1AXQA 3MMJA 5DRKA 3WZ0A 5BR8F 2R2TA 1TK8A 2R7OA 1HBNB 1CLFA 1WEYA 4MKBA 5KG1A 4NZ0A 3IRXA 5A6WA 1HWKA 5J2MB 2OMLA 1GX6A 1Q78A 2E5JA 4H4OB 4YHHF 4OL8A 1GT8A 2ZOGA 4B3OA 3FVYA 1FK9B 3M2VA 4IR1A 2WTFA 3I4PA 1D9FA 1N5SA 2KRBA 2QO3A 4RBVA 1M5VC 4I7FB 2OPSB 4ZHRB 2MQPA 3N6LA 1GXUA 1L3TA 3BO3A 4DX8H 3HHKA 4CO4A 2B7CB 2BA9A 2VPZB 1H3DA 3TARA 3JSMB 1WEZA 3TAMA 3K5PA 1FNOA 3MEDA 5C24A 3CIZA 4RU9A 3DRRA 3G4SS 1K9MT 2E5GA 1RT1A 2V2KA 2GX8A 5DO2A 3CJKA 4BCAA 2AJQA 5FLXY 4PG6A 2AGOA 1N54B 2LU1A 4AFFA 3DLKB 3CMES 5KFDA 2ASJA 1RISA 4PCQA 4URGA 5DLGA 2KHCA 3MZIA 1RT3A 2KM8B 2IM3A 3D1QA 4J9RA 3E01B 1Y9OA 2QMWA 5J2QB 4TN2A 4ID8A 2M5YA 3WC0A 4MJKA 3KLFA 4OZNA 5EDWA 4ZP9A 3F73A 4B9MA 4KGMA 3CIMA 2GGPA 4NX9A 3BSCA 2QZ8A 2MKJA 2OSRA 3QGGA 3IWXA 2UVUA 3IAS9 1S4FA 2WAQD 1VQSA 4ELTA 4DV4F 1DARA 3HHLA 3RB3A 5KT7A 1KSPA 3PRBA 4DSIA 5KT2A 2XS7A 2GIRA 2BW2A 5EUHA 4KE5A 1N32F 2RU3A 1NJXA 3KHRA 2JLEA 1HYSA 4KRWA 2LEPA 1IQTA 2XWXA 4BS2A 2JH3A 3FRZA 2JOQA 3DHXA 3MD1A 2GQCA 1VBYA 3EGNA 4RU2A 1V3SA 3MM6B 4KHRA 3OW2R 2AV5A 2BM1A 3TA0A 2G1DA 4HH0A 1UWBA 1T02A 1S0NA 4C97A 1S9GA 1RAJA 2NUHA 3GYNA 2PA3A 3M32B 2DNZA 2VH7A 4HTIA 4J9PA 5GAHU 5FDLB 2IM2A 4Q8EA 4HL9A 1TKZA 3MAHA 4X4TA 2MKCA 4C9DA 4IOCQ 5KAKA 4ECZA 3H20A 2ZE2A 2VFTA 5I42A 5HBMA 2V4QA 4A8YA 4P7VA 3CCZA 2JFKA 3FEXB 5KFWA 3H98A 3IRXB 2HGNA 4KC5A 4TYAA 5F8LA 2VD3A 2Q43A 1XBWA 4A4JA 3TANA 4LVOP 3P49B 3AA9A 4ZPAA 3OVSA 4B3OB 2FVPA 4X4NA 3M2VB 2QE5A 2F8MA 1S79A 3QIPA 1FRIA 3RU0A 3ULHA 3O3LA 2NPIA 3KLEB 3JSYA 3ZZTA 1HPZA 5D4PA 3AJ1A 3ICLA 3PW0A 2I5JA 2APOA 4WF9Q 1FKAF 2ZHOA 4ZCKA 2E1MC 2V4RA 2LKZA 1XERA 4QWAA 3CCMS 4ECWA 1S1VA 4KBIA 5C24B 2LQBA 2XMJA 1C0UA 3DRRB 4WFZA 1S9EA 4AQYF 1ZZNA 3SCJE 4WFYA 4X65F 1VQLS 3CJKB 1RQ0A 3K5OA 3TUZC 4LF5F 2EBGA 1SKSA 1N0VC 2HAIA 3TQ1A 2MJNA 3LANA 4MKYA 1RT3B 3HI9A 3MR2A 2D3OR 2O5DA 3LGMA 5DG7A 1X5TA 5F8GA 3KLFB 2HHSA 2ERRA 3MMBA 4NPOA 4PXEA 3OLBA 3ZZZA 3LUYA 2P5VA 1N5YB 2W4PA 2GGPB 4QWCA 2DGOA 2GHPA 4V19J 3FRYA 2J7KA 2ZUGA 4FS1A 5E2QA 1FEHA 3B78A 1OSCA 4JV2A 3HHLB 4LT6A 2AYGA 4OJHA 4Y6IA 3BREA 2HG4A 4LFAF 1ROFA 2LA4A 3HFKA 5KFEA 3I9V9 1FJCA 3SDEB 4NZ6A 3M6UA 2VFRA 1DQ9A 1ZM3A 3JTOA 3MPWA 3N01A 1YJNS 1WWHA 1HNZF 1OPZA 4GKKF 2ZDOA 2XZWA 1VGYA 1U6BA 1D9DA 5KFNA 1UWBB 4PG7A 5E3RA 1S9GB 2YWKA 1D9AA 3R5CA 5ITHA 5A6PA 3MFHA 3W3SA 1R7IA 1TKZB 4ED2A 1AFIA 3G8QA 4NRUA 1T03A 2EBEA 1OQ3A 2ZE2B 1WEXA 4ZLPA 2CVEA 5I42B 4R5PA 1TKXB 2VG5A 1DTTA 5HBMB 2M8DB 2HW3A 2VPXB 2FC8A 2JLGA 1IJEB 4EEYA 3H5SA 4RNFA 3VAHA 1X4HA 4JI8F 4Y2IA 2DNOA 3CWJA 4EGLA 3VAGA 2DHAA 3LAMA 3G6YA 3M8QA 1JKHA 4RW6A 1HNXF 1M5KC 3NMRA 4GKJF 1KFDA 1RK8A 2M7SA 1FA0A 2CPYA 3DHWC 1NK7A 1HNIB 4R8UA 2BXJA 4ZVEA 3QIPB 3G8SA 3HJFA 5CCMA 3GE9A 3UW1A 2C28A 1HPZB 1S1WB 3DLBA 2I5JB 5MAOA 3AY0A 3ETOA 5DJBA 3BSNA 2MDAA 2XS2A 3CCLS 1R27B 2CJAA 1S1VB 2CQ4A 4HT5A 4NLSA 2AP6A 1C0UB 3OFFA 2CDQA 1T05A 2FHMA 4U67Q 3QWUA 2IM0A 3BS9A 4G6VB 2VODA 1JB0C 1JWWA 4I67A 2LXIA 4R0EA 1L3UA 4ZPDA 1BD6A 4OZ1A 1SL0A 2R7SA 1U25A 1FRHA 3PACA 4IH6A 3K58A 2HGLA 5KG4A 4O44A 3PW4A 3RBEA 2IYGA 3FGVA 4BHQA 2UZAA 2FVCA 5SZTA 1JJ2R 1UVNA 2C3OA 2JX2A 3AJ2A 1OPIA 3RW6A 3FSYA 1J5EF 5KFVA 2M52A 2XBPA 3MMBB 1HMVA 4TXSA 3OJSA 5E41A 1YI2S 2IVFB 3P96A 1ZYQA 1YRXA 3HK2A 5EN1A 1Y7PA 2FHKA 2ILYA 2KXNB 1TAUA 2JEFA 5LSOA 2LYVA 4NA1A 4NLRA 1L3KA 1B0PA 2F8EX 5J1NA 3KHGA 5K5MA 2JEJA 3CCRS 2LXUA 3NBPA 2MZQA 1IUJA 3FMBA 4OHVA 2W7PA 4DF8A 1L3VA 3A8EA 2ZDPA 5HQ8A 4YDDB 2BZ2A 2HVIA 3AQOA 3D0GE 3ZZYA 4LSLA 3VQTA 4K4XA 1S6OA 1G1XA 3P3DA 2JSXA 3CDEA 2HQ3A 2FTRA 2FVQA 3B8HA 1YVFA 5THWA 4BWMA 2C22A 3R1HA 2X3GA 1VK3A 2CYYA 3DXSX 1Q81T 1R8HA 5E7OB 3D5MA 1UVMA 3HT3A 5D3GA 3SYZA 1C1CA 4PWUA 1V9OA 4FN5A 3BGLA 2JWNA 2O3DA 3H5YA 4EU0A 4R5PB 3H2LA 2VONA 2AJ1A 2VG5B 1DTTB 1C2PA 3C66A 1RP5A 3HX9A 4NLGA 1SJRA 4ED7A 3DDKA 4C3MA 3LAKA 3M8QB 5DQHA 2MGZA 4ZMMA 1NK9A 2GCFA 1JKHB 2EFPA 4RW6B 1AUDA 1R0AA 3SCLE 2CZ4A 2V0NA 1XR6A 3CCQS 4WFXA 4R8UB 4C2MA 2U2FA 4DSKA 2BVZA 4OI3A 1WHXA 1JLEA 1NK6A 3DDNA 2N82B 4A8FA 3CO9A 1OS5A 4Y34A 2XS5A 3T5HA 4MAKA 5EWEA 3QWPA 2HS4A 4FXDA 4LQ3A 5IM0A 4KGKA 3TRGA 1QE1A 1ELOA 5C5JA 1VRUA 2B5JA 1VBZA 5GADI 1GX5A 2XMVA 3ENQA 2B4OA 1T05B 3M9NB 3CPWR 4X2BA 5KFXA 5C25A 3M2RA 2AW0A 3QPIA 1Y5LB 3RB4A 4DF4A 2KH9A 4KPYA 2Q66A 2LEBA 3W2WA 1T8EA 4RW7A 1LW0A 2UUWA 4O44B 5DM7Q 1JNRB 3CDBA 1WHWA 1JJHA 4J9MA 1QVFR 3SSQA 3OTCA 1F5AA 1FRLA 4Y2CA 2VPWB 3KLGB 3OL8A 3MI7X 2E5LF 1HMVB 3I82A 2CQ0A 4EYIB 2EK6A 1VIOA 2KDOA 5HO4A 4FF1A 3C6UA 1U1PA 1S76D 1S49A 2CPXA 4NLOA 5IS2A 1G6BA 3NS6A 3EUNA 4J9KA 2CPZA 2CQ2A 2VKZG 3FDSA 3OV7A 1MMDA 3NAHA 4K4YA 3DM2B 4MIAA 3J7A1 2X1FA 3NBPB 1JLBA 2FGCA 2RDJA 2UVVA 1K0VA 1W25A 3KK3A 1E6VA 4IG3B 2L9DA 5CYQA 4ZPVR 3VWSA 1O8BA 2ZC4A 4HI1A 1NRKA 4LSLB 5LXYA 1IKXA 1LOUA 4KO0A 1FF2A 2CQCA 6FD1A 2FJXA 3MR6A 4JI7F 1U1NA 1NJIT 1AFJA 3DRPA 3H2VE 4W90B 3MPYA 2R8KA 5EX3A 1ULRA 2Z8QA 5D3GB 2W24A 2HFZA 3R5BA 5J2NA 1C1CB 4ETXA 1H2VZ 4XO0A 3QJPA 1JX4A 2W4CA 1FO1A 1CQMA 3POTA 1IBKF 1IBLF 4C8MA 5GAGU 2CVIA 3PKMA 1ZAWA 4PUOA 5KG2A 1X5PA 1Q16B 1UAWA 4C11A 2LDIA 2XI3A 2MGZB 2CZVC 2FJWA 3HHNB 2YTCA 5D6GA 2RQ4A 1IXKA 4U7UK 1R0AB 1N5QA 2FHJD 4IDKA 2IYIA 3EPGA 2FLNA 2YNIA 4TKTA 1JLEB 5BJRA 1N5VA 2RH3A 1UJ4A 3EZ5A 2DGXA 3OPKA 2A1BA 4QPTA 2XG8A 1QE1B 2RQKA 3SFUA 4UQTA 3THPA 4CH1A 4DV0F 3FQLA 1VRUB 2B5JB 4OX7A 1F2GA 3W7BA 3M6VA 4NLPA 1XNQF 2I1RA 4FBUA 4HDHA 4C8ZA 1WG4A 2VG6A 3T6BA 3BR8A 2DITA 5KFQA 4KT0C 4LIRA 5IT4A 3VAIA 3M2RB 3LP1A 3M1VA 3V4MA 2AYEA 1APSA 1NK4A 2BANB 1VQKS 3W2WB 4TQRA 4RX6A 1C1BA 2AU0A 1LW0B 2WHOA 1NHUA 4DQPA 2VUGA 1IR0A 3K57A 4JYAF 2Y1JA 3Q8QB 4G3IA 2E7WA 1YJRA 2J6TA 1X4FA 3CMAS 3MUMP 1W2BR 2KT2A 4OJ1A 5J2PA 2DT9A 4JI2F 4PQUA 1NH8A 4PG4A 4XPCA 4UW2A 2H9ZA 5D4NA 2DVIA 4TNOA 4QWBA 3C6UB 4Y2AA 4OLPA 5M2PA 2KT5A 5L1IA 2QA4G 4GC7A 2HFOA 4X62F 2EVZA 5H9FJ 3SFGA 1UKUA 4Y65A 5KFRA 1X4DA 3HVTA 4B9VA 2O01C 3GR1A 1JLBB 5EWGA 3NNAA 3KK3B 1E6VB 2EW9A 5CYQB 4LSNA 1JK9B 5I4MA 2ADCA 3HVAA 1NZAA 2RF2A 2ALZA 3TVYA 1X9WA 2ZHBA 2N4DA 3O1LA 4KO0B 4PPDA 2FB0A 3M9OB 3RRGA 3DRPB 1O0PA 3MM5A 4C7QA 4DFPA 1MW7A 4YR3A 3CDAA 4B17A 2J0QD 2NLWA 4QR2A 4URSA 3WDOA 2XGQA 5J2NB 4MIBA 2MQLA 3OR2A 2H5EA 3CD0A 5IT0A 1HI0P 5IZHA 1A7GE 4CIOA 2WOMA 3POTB 3G8TA 1U1KA 3HHEA 1QTMA 3E3XA 3IO1A 2KJWA 4PUOB 1WG1A 3KKFA 3O5TB 3PEHA 4NOHA 1N34F 4NYZA 4C11B 4QYRA 4KJIA 1YJUA 4B02A 3CJ5A 4OZ0A 4RW8A 4YR2A 2IVYA 3D2WA 4I1TA 4OFZA 4IDKB 2LQ9A 4LFCF 2V9WA 1HQEA 2YNIB 3NG8A 4OZLA 2VBZA 3GR0A 1P8GA 2BE2A 4USJC 2DD8S 3MUVP 2Z2LA 2OPSA 4ZHRA 4KV8A 2BR0A 2GO8A 4K59A 2QA4S 4ILLA 2F4VF 4ED5A 4I2QA 4NWBA 1U1MA 3J7YU 4BDPA 2CQIA 2VG6B 4LVNP 3AA8A 2GNKA 3T5KA 3PRDA 4WCEQ 3OBIA 4O3SA 3GQCA 3LP1B 5KG0A 4QIVA 4NMLA 2PE8A 3BSOA 2C42A 2MY7A 1RTDA 2Y0SD 1C1BB 2RUGA 3M6XA 3ZZUA 4ECXA 1JLAA 2JJ4D 2CQGA 2YWFA 1VQ4S 1ZZFA 4RW9A 4RNNA 3KWMA 2MKKA 3OTOF 1QAIA 3PNIA 4B3TF 1MROA 3T3FA 3HVWA 5J2PB 3T1HF 2MYFA 3OL6A 3PR4A 1Q79A 1R8PA 4EZ9A 1Y5NB 3V6KA