5F0WA

Crystal structure of human copper homeostatic proteins atox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
b'MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Structure of tetrasilver bound to human copper homeostatic proteins atox1 at 1.7 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5f0wA00
3IWLA 1Q8LA 3HHLD 1S6OA 3GZ7A 2OKQA 2HIQA 3E8OA 1Q53A 2BBEA 5T7LB 3HX9A 1YJUA 1TUVA 2RILA 4OJ1A 1KVIA 1X0PA 2G9OA 2LQBA 4YDXA 5T7LA 3HHLB 1N5VA 2EW9A 2OFHX 2RU9A 4Y2IA 1OQ6A 1K0VA 1FE4A 1Y0HA 1N5QA 3BN7A 2FTRA 2VV5A 5B0FA 3BGUA 4DL0C 1APSA 2HLTA 3T9NA 5B09A 1AFIA 2LQ9A 1CC8A 2OMOA 3BB5A 1OPZA 1YJVA 5A6WA 2GA7A 5A6PA 5B08A 2L3MA 2OFGX 1V3ZA 2ASYA 2BYCA 1P6TA 1RJJA 2FIUA 2K1RA 2IYIA 3KKFA 1TL5A 2IFXA 2OAUA 2ROPA 2OD6A 2XMUA 3BR8A 5K9FA 3CJKA 2AJ0A 2JDJA 3I9ZA 1MWYA 4EFAC 1Q8BA 3LGMA 4NL5A 1LQ9A 1QUPA 2GGPB 2GO8A 2VH7A 2HLUA 2XMWA 2ZDPA 3TOQA 2QIFA 3FGVA 2QLWA 3IWXA 4HH1A 4Q2LA 4NPOA 2IYGA 1U7LA 2QYCA 4FNHA 1SB6A 4Y2MA 1FVQA 2N4CA 1KQKA 2K7JA 3TRGA 2CRLA 2OD4A 2BJDA 2HFNA 4HL9A 4OJ3A 1FVSA 4A47A 3FRYA 2XMJA 5F0WA 1SI9A 3HHLA 1W2IA 2K2PA 1Y9OA 5B0EA 4A48A 1N5SA 2LDIA 5IXUA 1KVJA 2LXFA 2ROGA 3F44A 1Y3KA 4HI2A 2RMLA 3DCAA 1X7VA 3DXSX 2BJEA 2KT3A 2GFFA 3KG0A 2N4DA 2W4PA 3MCSA 4F67A 1P8GA 3QGPA 1R6YA 2BUNA 3QMQA 1ULRA 1WD6A 2RSQA 1SQEA 2GGPA 2XMKA 4DPOA 5B0AA 2Q3PA 1XBWA 1TR0A 1AFJA 1Y3JA 3K7RA 2AP6A 3HFKA 1Q4RA 4Q2MA 5B0GA 4HI1A 2W4DA 3MZIA 3BDEA 1S6UA 1N5TA 1VQYA 1GXUA 2PD1A 3KNGA 4DN9A 2GCFA 2ROEA 1YJTA 3LO3A 1YG0A 4OJHA 1JK9B 2XMTA 5F0UA 1GXTA 2GV1A 3HHLC 4Y2KA 4OJGA 3TNVA 2KYZA 1YJRA 2KT2A 1FD8A 1FESA 1FE0A 3LGNA 4QOTA 3WDOA 2AW0A 5B0CA 1IUJA 1MWZA 2FHMA 2XMMA 3BF4A 2OP5A 3HF5A 2AJ1A 3HDSA 1OQ3A 2FB0A 2ZDOA 2HFOA 1TZ0A 2QLXA 2ACYA 1URRA 3UDCA 4FNIA 1CPZA 1X8DA 4A4JA 4HH0A 3BM7A 1VQSA 2KKHA 4OIXA 5B0BA 2HQIA 2K1RB 5KAKA 4U9RA 3CJKB 2N7YA 2XMVA 4ZOSA 3FMBA 1AW0A 1JWWA 3KG1A 3VTIA 2K7KA 2W4CA 2PGCA 1YRXA 5B0DA 1OSDA 1TL4A 1CC7A 4ZA1A 4YEAA 4A46A 1FEEA
chains in the Genus database with same CATH superfamily
1RQ0A 4F25A 5F8NA 5M2UA 2CNOB 4JI8F 1U2CA 1TU0B 1E6YB 2DRAA 1VC0A 4F7VA 4LREA 3N79A 4JI6J 4JYAJ 3DLEB 2VUGA 1U1MA 1NKCA 3OR1A 4PG6A 4YHHF 1HBUA 4LSNB 2CJBA 4K4XA 1F0XA 1NAQA 1VJQA 2CQ1A 3BN4A 4BCAA 7FD1A 4WYLA 1VQ4S 3K7RA 5CA5A 2DJWA 1WEYA 2UUCF 1U45A 4DJBA 2AHOB 4KO0A 3TZXA 1JLAA 3GFYA 2KT2A 4RBTA 4UT4A 2PO4A 2FB0A 5D6GA 2PDAA 2IJRA 1VC6A 4EO6A 2HVDA 1NCLA 3OTEA 4X62J 4ZVQB 2E5LJ 1N54B 4DUZJ 2OIHA 3OR1B 2DY9A 1EJ7L 2BMBA 3RR8A 2C2NA 4JP8A 3QT8A 1PKUA 2VASA 3FVYA 4IFYA 2VD3A 1OO0B 2R2RA 4IDKA 1CBKA 2PE8A 2CJ9A 1REGX 1UVJA 4KGVB 5AJ3F 2CDRB 4ZPTR 3D0HE 3Q8SB 1U1OA 2HFUA 4KO0B 3IBCB 1SXLA 4DV2J 3IFEA 3LAMA 4NLTA 3TEHB 1WHYA 1ZTTA 3DNCA 3H20A 4WZMA 3HKWA 2Y0BB 3KLIB 3I31A 5KFXA 2HGMA 4GC7A 1WHXA 1ZM3A 4DR6F 2XS2A 1KS2A 4AT1B 2CPEA 2A18A 5D15A 2CPZA 2HURA 1RHUB 3M2RB 1YZ7A 3V2UC 4IDKB 3KK3A 1UW9A 4USTA 4N41A 4AE5A 2DR5A 2YH1A 2HWHA 4PCQA 3VVUA 3SZ2A 4LQ3A 5KAKA 1PIEA 1RJJA 1NPKA 4OQJA 4BBYA 3TI0A 2UXDJ 4LRAA 2H3EB 3CW2C 5MAOA 1LK7A 4WIIA 2F8HA 3NOGA 4ECZA 4GKKJ 1KOHA 1VBKA 4F04B 3FRZA 1FI4A 4GKJF 2NPFA 3D6MB 2ZFHA 3N5FA 3V5RA 5ITHA 5KT7A 2MEWA 4JI4F 1C1BA 3JTNA 2AYGA 3FEXB 1SQEA 1HWJA 3KK3B 3D1QA 4EZ6A 3W9JA 2V2QA 4YY3F 4DQIA 3VGUA 3BZQA 4OI2A 1VQKS 5KFVA 2NR0A 4QOTA 1XTZA 1LWCB 1NJWA 3QNWB 2P8IA 1HQEA 2QMXA 2QLXA 2DNRA 2DNPA 1UFKA 3CIZA 4CZCA 2A0FB 1ZBTA 1FKOA 3J80Y 3CDWA 3N0VA 2JOQA 2V0NA 1WEXA 2CJQA 2B4VA 4OI3A 2ZVSA 1U2FA 2ASYA 1VQ8S 4JV2A 1C1BB 5CYQA 3MMAB 2XMUA 2RU3A 3G9CA 3I4HX 2M9KA 4Y2MA 3HVTB 2XS5A 5G0RB 4GMKA 4DLGA 2QYGA 1C0UA 3RRKA 1N0VC 2YNGA 3R6LB 3MAHA 4A8OA 2VQFJ 2VU5A 2D3OR 4MYTA 2C2DA 3FBEA 4DV4J 3A1YG 4TNOA 2YX1A 3SSRA 3T1AA 4YB6A 4F8RA 4QR1A 2V34A 2LQJA 4CCHA 2CPFA 1H6KX 4I2QB 3CDAA 1S1VA 4DLEA 3GG1A 5B0BA 2G0JA 3QIPA 5H9FK 2HBQB 4YB1P 5DGAA 2CKWA 4YEAA 1R8CA 1Q8LA 3OSNA 1GNKA 3UQSA 3A12A 2E1CA 1N0UA 3JSBA 4E0DA 5ETTA 1N32F 3BB5A 1X4FA 5DDOC 4FXWA 5HMXA 5D4LA 2IY5B 2HHQA 3IG1A 3OT9A 1T02A 3UNGC 2DRBA 4DSJA 3TA0A 3PYFA 3D0GE 3LTOA 4U8YA 1UW4A 3AOCA 4GRSA 1AUDA 1B70B 4U95A 5DO2A 3PRVA 2EC0A 4J37A 2HS4A 3SFGA 1RT5A 2R3VA 4FYVB 5KT3A 4A8QA 3R5CA 2NXNA 3RW7A 2EFNA 1NKBA 4UF4A 1S1VB 3MMCA 2MQLA 2R7WA 4I68A 1X4BA 2MQMA 3K58A 4DPWA 3SMZA 4UY85 3QO9A 1NK5A 3NS6A 2M3DA 4KTQA 2AV5A 3O3LA 4RBVA 3AQPA 2C42A 2UVWA 2B4PA 2HEKA 1FNOA 2ILYA 4ER8A 2M52A 2YNHA 1XERA 2KYXA 1BLUA 1FJGJ 3MUMP 4B3TF 3R5DA 5DLFA 2MKSA 4ZHRA 2WW4A 3E2EA 1RT5B 1TKZA 4ES3A 4QU7A 3NGKA 1RBLA 2J5AA 2R8GA 2LCWA 3Q83A 3M8SA 1M1KT 4IH5A 3MMCB 3CJQA 5GMKa 1TK8A 4AL5A 2VODA 2ZH8A 3L9ZA 4DX6A 4HL9A 5DS7A 3SCKE 1JLQA 3JS9A 1B7YB 2QA4G 1Y3KA 1ZM9A 3PO5A 4WFBQ 4ID5A 2JJ4D 1SUQA 4DV5F 4LF1A 2BUNA 3MTJA 4C7QA 4CO4A 1N48A 2L9DA 4ZPDA 1S79A 2YNHB 4EK2A 2RQMA 2LA4A 4J7CA 2ATLA 1ZAVA 2XYPB 3UWTA 4LBPA 4MTPA 3QJJA 4ZHRB 1FESA 5L46A 1NJYA 2AEMA 3H90A 1TKZB 2M88A 1QAXA 2WBRA 2VF3A 1EKSA 3W9HA 1ZAWA 1FEHA 5KFWA 5IQ6A 2AIRB 2W2QP 5K14A 2V4JA 2DRDA 2Z2LA 1G4CA 2MZ1A 1RTIA 2XTJP 1JLQB 3QRQA 3GV5B 1KLNA 4F4WA 2QLBB 4ELUA 2G2YA 4JI3J 2OEJA 4LT6A 2DCLA 2IDEA 2L3MA 4KT0C 2UUAJ 1EX8A 1SUQB 1CJKB 3JQJA 4NASA 4PR6A 4X64F 4J9SA 2O66A 3QGHA 2G2OA 2F4VF 2CQIA 2EWHA 4J9KA 1XMQF 2GIFA 4JV0A 1U4BA 1IBKJ 2QEXS 1HI1A 2J0SD 4CQ1A 3QGPA 3K8WA 2RJZA 5JVGQ 1FJCA 2R7XA 2MGZA 1L3TA 5K14B 2V4JB 3NMAA 3NGDA 3LW5C 4AD6A 4IKAA 4JV5F 1WSVA 2O1PA 4AFFA 1KQGB 3LAKA 4KR0B 2NXEA 2ZUGA 3CC2S 4DR2F 1C0TA 4RW8B 5DDQC 2LMIA 2UUBJ 5DLGA 2RQ4A 4CLKA 5EN1A 3FNNA 4EI2A 1IQZA 4NCGA 3GZ7A 5C24A 3VQSA 2XC9A 5KG5A 1U0SA 5B0FA 4KIAA 3EM1A 3GJRB 1AFIA 3A8EA 3EZUA 4WU3A 2HYIB 1RT1A 3QSYB 2MGZB 2ERRA 1TUGB 2FLOA 3O8WA 2G0IA 3PV8A 3CJ2A 3C3LA 5D4OA 4H4OA 2BVZA 3W9IA 4ZK7M 1D1UA 3HZGA 4D3GA 1KTQA 5DQGA 1T3NA 3DU6A 1C0TB 3HHEA 2J8SA 3V6KA 1TR0A 2IRXA 3TYTA 1DFDA 4NA2A 3CD0A 1ZETA 2AX0A 4R5PA 3ZNJ1 5E41A 4CT8A 1RAEB 5C24B 1VI7A 2W7AA 2Y9HA 1C2PA 2YKMA 1L5UA 3O44A 4OLOA 3RJMB 5HP1A 3PIPQ 1J5EJ 5BJRA 3H2UB 2D9PA 2GHPA 4DOZA 4CO3A 2UZAA 4BC7A 2I1RA 1VJWA 4H4OB 1BQXA 5LMNJ 4DFKA 4DR4F 1RTHB 3CCZA 1TL5A 4P2SA 1XK8A 3LF0A 3JQMA 3CCUS 2LP4A 4R5PB 2E44A 2DNNA 3NP5A 1IBLJ 4USHA 1H2TZ 4A48A 2XM3A 4HI2A 2KU7A 2YKMB 1R6YA 1WD6A 3T5JA 4MMOA 4LF8J 1UA1A 3JAMY 5KFOA 5HP1B 1W26A 1YKWA 1Q78A 1S6UA 1OMSA 1Z4UA 1IR1A 4JBCA 4WF9Q 3ZNUA 5ETKA 3ZZOA 2F9DA 4QCLA 4ED3A 1HNIA 3MGJA 5HQLA 1KFDA 4CNYA 2OMLA 2M8HA 5DQIA 4U7CA 3A8IA 4Y6IA 3P6YC 1A0OB 1TFYA 2OSRA 2H4WB 2KFYA 2KXFA 5GAEU 5IS2A 2ZH9A 4KRWA 4DL7A 3OR2A 3IWXA 2GAHC 3TEGA 4ES1A 3I4PA 4ANEA 1WDTA 4OYXA 3G71S 3GMGA 1GXLA 2DCUB 3G2XA 2K3KA 3BSCA 1YX2A 2WVEA 5KFYA 4K0KJ 3D54A 1R43A 2Q43A 1VQYA 1NK8A 2EBGA 3KTQA 4ECRA 5BR8J 3LGNA 2N3OA 4ZCKA 2QX0A 4P7TA 3LP2B 2H5EA 4I2PB 4DV0J 3DDKA 1UCNA 3RB3A 3OR2B 4PG5A 1R8PA 3NG8A 3PJ9A 4N77A 4PWDB 2X3DA 4NLWA 2ADCA 4OYMA 5HLFA 1UVIA 4DL2A 4TU7A 1RXOB 2VB6A 3WZ0A 3N6MA 2AQ4A 3OJSA 1HBMA 1T11A 2LQ5A 5EUHA 4KGMA 2DH9A 2AGOA 2LLZA 1S10A 4DQQA 1IQTA 3LP0A 4N8OA 4F4AA 1KP6A 2E7XA 4H4KA 4PAAA 4Y2CA 4KKOA 2UVRA 2RDDA 3OXFA 1NK6A 1KHWA 3OV7A 2CJYB 1FNXH 5AE3A 2RHQB 5F9LA 3BH6B 1ZZFA 4JB8B 3KMSA 4KFBA 1RAFB 2OP5A 4WYWA 2ZH4A 4HHHA 4QIEA 4CTAA 1QSYA 5CABA 2E7VA 3HPOA 3U7JA 2HNZA 3V4IA 3VTIA 3V6JA 1FDBA 2NUHA 1RHQB 4U67Q 3R8YA 1X4HA 1SH2A 4ZVGA 1S0VA 2JVOA 2B56A 2MKJA 4CM0A 5GAGI 3UFCX 4M63A 3PKMA 4B3OB 5KFMA 2IYIA 5K9FA 1A7GE 1PYOB 3EXYA 4KKOB 2M4MA 5ETLA 3MFHA 4FF1A 3PRBA 2XULA 4I67A 2KB2A 2DO0A 1UPPA 1N88A 1VQLS 3R3TA 5KFIA 3NAIA 5K8MA 2BV3A 4LBIA 3OBIA 1NJZA 3TJAA 4J91A 3OTBA 3DOKA 4KFBB 3Q86A 5IT9Y 1FDDA 2B8PA 2JL9A 3AJDA 2FJEB 1WKKA 4CTAB 3TQEA 1B4SA 3FKBA 2HNZB 3V4IB 1L3UA 4EMDA 1N5TA 3KMQA 2GCFA 3MPUB 2RVJA 4Q44A 4OYIA 1SC4B 2OGUA 1AW0A 4J9NA 2FGCA 1FJEB 4O23A 1MSWD 2BA9A 2EFGA 4M1KA 1QD1A 3KUHA 2I0XA 2QSWA 2KZMA 4IR1A 3AODA 2UVUA 2DKOB 5KT2A 4ZPAA 2CXEA 3M4XA 3HT3A 1T05A 3RW6A 4ECXA 3AJ1A 5J2MB 1TL3A 4E8UA 5A2QY 4Y00A 2V50A 1QSSA 3CDBA 3IGVA 2EK6A 3VALA 4YN3B 2V8PA 2MKIA 1EHWA 2W4PA 1TELA 2LU2A 2FY8A 1S4FA 3RUBL 2VFSA 2M0GB 1X4GA 1S0NA 4WPAA 3KUEA 1T95A 6FDRA 4QQBA 2MYFA 2OJ3A 4M94A 4OJGA 4OZ0A 3FMWA 1SJRA 3KFWX 3VAMA 2B51A 4ZLJA 2O5DA 4FS2A 4YUDA 5DM6Q 1TL1A 4XIUA 4JOUA 3M05A 1UFLA 3GB0A 3U02A 2OFHX 2J0QD 1FCAA 3BGLA 2Z30B 5AE2A 1XMBA 1WEZA 4G65A 3GPAA 3ONQA 3WC2A 2LKZA 1GX5A 3ZZUA 2K06A 4FZVA 1RCXB 4W4MA 3TR5A 2XEXA 4UOCA 4ATNA 1FXRA 1FWPA 2V9WA 3UDVA 1UEKA 3S8SA 1TL1B 2VG5A 1YZ6A 5KFTA 4WFAQ 4OX6A 2OPQA 4F26A 1C4CA 4B3RF 4DV3F 3MXHP 2VJVA 4O3QA 3DMJB 1PYSB 1V3SA 1MN7A 1GX6A 1NLKL 3BM7A 2DD8S 3CT9A 1KONA 4PPDA 4DR6J 2DGOA 4MH8A 4MK8A 5KFJA 2Q66A 1UP1A 4J9UE 2A6OA 1HNZF 2L41A 4M95A 1LK5A 3EPIA 3QAUA 3EX7B 4ZVPB 5J2QA 3Q8YA 1YJVA 5IQQA 3LGMA 4C3LA 1Q79A 3SSSA 2ZHAA 4YR3A 3BREA 1XMOF 3JTOA 1GT8A 2OPQB 4FXDA 4N5SA 3C15A 1IKVA 1S77D 2ZBQA 2IVYA 1RYRA 1N33J 2R2SA 4LF5J 5CXTA 1D9FA 2Z58B 3K5LA 4RBUA 2UU9F 1FF2A 5D0HA 2DHHA 2ZBCA 3DU5A 4K7QA 3VGTA 5HANA 1V9OA 2WVFA 4EYHB 2V67A 4HYKA 3JTPA 8AT1B 3HVAA 4JI6F 3RYLA 2HRTA 4F3OA 4JYAF 1RT3A 3C66A 1KDNA 3PFEA 2HS3A 3M8QA 7AT1B 3OHBA 1N5YB 4DF4A 3K5MA 1NZ8A 4RNOA 3HJFA 1I6JA 2DGTA 2DPIA 3QRRA 3TZWA 4I7FA 1U24A 3KNAA 2AYMA 3B54A 3C15B 1IKVB 2CPJA 4O0IA 2EW9A 2RU9A 1KBRA 2FJDB 4XPEA 4YR0A 4QIFA 4MKYA 3BGFA 1LKZA 2PFDA 2FYXA 2QSFA 1UVMA 4RL1A 1RAGB 3FUYA 3ENWA 4WE1A 1S6QA 3I55S 1KN6A 4OYAA 3LA0A 1RAAB 2GVZA 2GX8A 1SPBP 3IRXA 5AT1B 5LMUJ 5E3AA 2QMUB 3VAHA 2SXLA 1RT3B 2QJ3A 1WTBA 1J27A 3MEGA 2COLA 3M8QB 2NYHA 2DNLA 4X62F 2L9WA 3H5YA 4DUZF 5GMDA 5B0AA 1NO8A 3ILJA 1DAXA 3QGGA 4Q2MA 4I7FB 1NHKL 2IC3A 3C46A 4JI1J 3GV8B 4JI0J 3N01A 3PHTA 3J7AN 1QAJA 1XWLA 2Z8QA 3CJ5A 3LOUA 2XMVA 2WONA 3KXDA 4WE1B 1S6QB 2HG4A 2GVZB 1X9MA 4DV2F 4YFUA 5H9EK 1RT7B 3IRXB 3M6XA 2DVIA 4USWA 3M8YA 3KYLA 3NS7B 1S1TA 4TVAB 1O51A 1P6TA 3ADAC 3PHEA 2X51A 1SKSA 4A8SA 5D4PA 3QPIA 3BPSP 2M7SA 3FDSA 4CO2A 2KDOA 1SJ1A 3W1YC 2FDNA 3TRGA 4PXDA 2IC3B 3MM7A 2PMHA 3C6TA 2EXUA 4QW9A 3IAM9 1K9MT 2YWEA 2DGUA 2AJ4A 3FFIA 1WI8A 4NYOA 1UZDA 3M32B 1VK8A 2XMAA 4URSA 3RZAA 2R8JA 3OLAA 3DXBA 2YKPA 4KHPJ 4CLZA 4NWBA 3JXOA 1WACA 1YGYA 1S1TB 5HI7A 4OX7A 4O3OA 2OEKA 2UXDF 2ZOFA 1SJ3P 4ZOSA 3QZ8A 2WZ1A 1D0EA 5AXKA 5M2PA 1B64A 4RKUC 3T1YJ 2Z2MA 3B78A 1Y4ZB 1O6XA 5CYJA 2RILA 2LQBA 2V2KA 4WU2A 4ECYA 3MM7B 2BE9B 5BYQA 1VQ9S 3OXLA 4E98A 4IG0A 2IM2A 1F3FA 4MKBA 1HNVA 2HGNA 2H5JB 2PI4A 5K5MA 3MM9A 1JIHA 2F63A 3RTVA 2Y1IA 5IWAJ 3POTB 5CAAA 2EFOA 1X7VA 3I0SA 2HW3A 2OTJS 2HHTA 1G3OA 3H5SA 2XMKA 2HFVA 3OTDA 2MKCA 1JLFA 1F60B 2I8EA 2WW8A 4CDIA 3L7PA 3HHKA 1JXVA 2N7CA 3T3FA 2VG6A 2HMIA 2FZCB 2YKNA 1CPZA 5DZ7A 5HQ8A 3CDEA 1KC8T 3M9NB 1HNVB 1VQNS 3IP0A 2ZJQQ 3UNYA 1H2UX 1K44A 3MM9B 5T7LA 3THVA 1X0FA 1VBYA 1HL6A 4ZP7A 1ZA1B 4P75A 3P45B 4NEZA 1XNRJ 3I0SB 4ZVTB 2RNEA 4DV4F 3MM6B 2AKWB 4RNHA 3SIPB 3TUJC 4RNMA 1GH8A 2V4QA 1JLFB 1NK7A 4RWXA 3PM9A 5HQMA 4ZP9A 1CLFA 3MUTP 2HMIB 3MPDA 4LRDA 2YNFA 3HP6A 4U7UK 1WC6A 1Y10A 1HW8A 2YKNB 2ASLA 2V8GA 2CQ0A 2GGPA 4KGKA 3H40A 2OPPA 2Z2ZA 4HI1A 5D78A 2V69A 2EEYA 2XYHB 2UUWA 3ICLA 2DNOA 1DLOA 2RQKA 2VOPA 2IAJA 1OQ3A 3THPA 2NUUG 2WVCA 3QATA 2B5JA 2P6TA 4DUTA 1Q5YA 1PBAA 2VFVA 2ZOGA 1TV6A 3M8PA 5FLXU 1TAQA 4J9QA 4DSIA 4F50A 1JNRB 3BO3A 4ILMA 3UD3P 1IR0A 4WZQA 4C6AA 2OUGA 2GGPB 4V19X 2JVRA 2OPPB 2ZZMA 3C16A 2C28A 2KN4A 2EG1A 2JNJA 5F0WA 1DLOB 3QWPA 2IAJB 1NDKA 3KLGA 1S4EA 1M5HA 4RW9A 1SL0A 1RT6A 1T94A 2HVHA 4FYXB 2DO4A 3NWRA 2J9EA 2B5JB 2XNQA 1XBWA 2NS1B 1NDCA 4R8UA 2IMWP 2XCAA 2B9YA 1TV6B 4RW4B 3L09A 4ID8A 1WHVA 1ZOTA 4ENOA 2QA1A 3NOCA 2EG2A 4YQWA 4P73A 5HL7Q 2ZJRQ 3G6XA 1Q16B 5IT0A 1X4EA 4B9UA 1RBAA 1HI0P 4NLSA 1FRLA 4UW2A 3FSXA 4UUXA 5F8IA 3NEKA 1REVB 4ZJQA 1S6OA 3C16B 2GZOA 4A8FA 5CZXA 5KOWA 3WX4A 3G6ES 2LQ9A 1HWUA 4C11A 4RW9B 4RU2A 2IM1A 1RT6B 3QLHA 4XDCA 4HT5A 1GEHA 2BRLA 4KH1B 2BR0A 1T9YA 2C3UA 2VH7A 4ES2A 2QL7B 4TQSA 2HQFA 4TU8A 4DL5A 2CRLA 1VRUA 2OD4A 1P9QC 1WC3A 1IKXA 4K4WA 2BJEA 3KG0A 5F8HA 2R8IA 1HYSA 2APOA 2E1MC 2YY3A 4TXSA 1Q4RA 2A1BA 3T5KA 2PT0A 1TL7A 1DRZA 3O2IA 2UUAF 1V5VA 5E3RA 1FRHA 1XR7A 4C11B 3HSZA 3CCMS 4ICLB 3QLHB 4L73A 3FMBA 4FF4A 1FRIA 5D0EA 3H8YA 3MCMA 1JXLA 1HHQA 2CWXA 3MMJA 1VRUB 4P6QA 3L7OA 1IBKF 4P71A 1RLDA 4U8VA 1IKXB 4WKRA 3TUIC 4CO5A 4ECTA 3NAHA 4W90B 4MFBA 3B6BA 2GA7A 5I3UA 3SCLE 3ZTOA 4OV1A 2GO8A 1HYSB 2DHGA 4M5DA 2XB2D 3D0IE 2D69A 2DNZA 3M8ZA 2YQ3A 3TUZC 3HHLA 3BKUA 2ZD1A 2UUBF 3ILIA 1HWKA 1U6FA 5DG7A 2CQDA 4K4UA 2AX1A 4P2XA 2R8HA 1U47A 3MD3A 3W66A 4LF7J 4LSLB 5HO4A 3OD2A 4HHUA 3IA0A 3LQVA 2KRBA 4OYPA 3D6TB 4BWMA 3K57A 1FO1A 2F9JA 4HLBA 4MFBB 4K4YA 2ACYA 4FNIA 2RDJA 3OL9A 1CQMA 2MHEA 1B0VA 3G8SA 3ETMA 3JB9k 1OY9A 4M5DB 1LEOA 3NXZA 4UTGA 4AL7A 1R6VA 1K0TA 3PJWA 2A3JA 3AD8C 3HHLB 2MJNA 3PW0A 2ZD1B 4WP9A 3MI7X 1S9EA 2HGLA 2ZNYA 5DG9A 3CJRA 4B9TA 1QUPA 2LDYA 3QT7A 3WHIA 2HZCA 3GJSB 1RU1A 1VYAA 3LGHA 3M6WA 4DEZA 3G82A 3N6NA 1PC5A 4JI7F 1N6QA 4CM2A 2PMWA 2FHKA 3UVJB 1DQ8A 3V81A 3CTRA 3BR9A 3D3BJ 4CH1A 5J1EA 2C2MB 4LFAF 4ZPVR 5ADZA 2Q3PA 2OLWA 2KM8C 1X9SA 1RISA 2MJUA 2FGOA 2J0WA 5LMNF 2F65A 4OYBA 1NM2A 1UKUA 5KFUA 1FE0A 2BQ3A 3MEEB 1YJ7A 5F8LA 2AJ1A 3BS9A 3OL8A 5ETPA 4H4KC 4AL6A 4USKA 4NLYA 2HK2A 1R8BA 2KI2A 4KB7A 2HHWA 1IBLF 2HSEB 1WDDA 2KVIA 3QIDA 4Q8EA 3W2WA 2DIUA 3MPVA 1DQAA 2IM0A 1GMVA 3G82B 3RBDA 4DL0C 1N6QB 1DBDA 3VAKA 2F5GA 4B9NA 4BS2A 4LF8F 4LMZA 3Q8QB 5L38A 4WFNQ 5J1EB 3GIIA 5KG1A 4NE9C 4A8YA 2VHGA 1CG2A 4AUKA 2W9CA 4YMEA 5GADU 2VKRA 2AEJA 2RB7A 4DU7A 2QG9B 2BM0A 4NLVA 2GMJA 4QR0A 2FJVA 4C4WA 3FEZA 2XHWA 4QW8A 1EB0A 4CLYA 2F3JA 3Q89A 3R97A 3KNGA 2ZH3A 2R7VA 2IRUA 3W2WB 4DS4A 5HJYA 3NNHA 2E66A 3CCQS 1HBOA 1P27B 1TMJA 3M8WA 2RKIA 4RUAA 2QA4S 4EO8A 1R31A 3I5CA 2C3OA 1RWUA 3HCXA 3CGIA 1KWMA 2CVIA 2R2TA 3BBBA 3NKYA 2JFKA 4X4OA 4XDDA 5A8KB 1FXDA 2LVWA 4K0KF 2ALZA 2OD6A 5FDLA 2QIFA 4NI2A 2VBYA 5BR8F 1WG1A 1XR6A 1NEEA 3PYDA 1AZSA 1YTYA 3CCTA 5KG7A 3H42A 2XSJA 1VHIA 4DV0F 1TK0A 1AXQA 3AAWB 1HQUA 2PA3A 5F41A 4IFVA 3AD9C 4QU6A 2XWXA 3MZIA 1T9VA 1UJ4A 3Q22A 1YJTA 2IA6A 3C2PA 2ZOMA 3AQOA 4OHXA 3MR7A 4AYBD 4M5LA 2YBVA 2CWKA 1N34J 3HZEA 4I69A 1RB0A 1R3NA 4MAKA 2DXDA 5FDLB 2DY1A 1JX4A 1OY6A 4FP9A 1FRKA 3R5JB 2V63A 1U48A 5HROA 3HFVA 5KG2A 2CYYA 2XSJB 1U49A 5M2RA 1B3TA 2J9DA 4EUVA 2VPXB 3MAAA 3CC4S 1SBRA 2DHSA 1HQUB 5DM7Q 2VDIA 1RWNB 2OAUA 5EX0A 4FYWB 4RPFA 4DMZA 5JUMA 1LQ9A 1FDNA 3HXMA 2L08A 4IFVB 1YBAA 3IMQJ 2KL8A 4BDPA 4A8XA 4A47A 3C8YA 2CAJA 2AEFA 3J7YU 3VZIA 3M1VA 2DR9A 1UWBA 1BGXT 4LR9A 1BQMB 3ZZRA 1UEVA 3ILOA 5F0UA 1GTHA 4PXBA 3H5UA 2F40A 5HROB 3RAMA 4F3QA 3TWZA 3CJSA 3WBZA 3OUYA 1CS4B 1RT2A 1WKLA 1WC5A 1KQFB 4X4SA 3VCDA 1LNQA 3Q8PB 3MAAB 3DLKA 4HH0A 1QLNA 5L1LA 4I0WA 3AJ2A 1VS3A 3GIRA 2X3GA 1RWPB 2CQ3A 4ECWA 4JV1A 4G3IA 1Q1KA 3S1TA 4WXWA 1I5OB 3CC7S 3D2WA 3OLBA 3LP1A 3O1LA 1E6YA 2E29A 3NCPA 3T9NA 5DJBA 1JNZB 4PYDA 1F5CA 1RAOA 2ZH2A 4KV8A 4IUFA 3AD7C 4ZKAA 4OZ3A 3M1VB 4EZ9A 1UWBB 2UP1A 2YVSA 1SC3B 2XZTB 3J7Z5 2CNKB 4TQRA 3KLHB 1WKJA 2N82B 2K7JA 2O01C 5LL6d 5F8GA 4YOEA 2Z56B 3HMJG 2MZSA 2YWGA 3VZHA 3MCNA 1U8WA 2LEBA 3DLKB 5EHHA 2VBZA 2AYEA 5GVQA 4NMXA 1Q95G 3SDEA 1K8AT 3SCJE 3NS5A 1FA0A 1TKDA 4CO0A 4O3PA 3LP1B 3WDOA 4RJVA 2XMMA 1EKRA 4PWWA 3G8TA 1NUEA 2MKYA 2EVZA 4KV8B 4Q7AA 2GW8A 3BSAA 1HI8A 3IR7B 3MEDA 4DFPA 2PIIA 2AWZA 3MURP 3BDPA 3J7A1 1RLCL 1RAHB 4OX8A 3ZZTA 5B09A 4C48A 1RWOB 3EGVA 1ZS6A 2R7UA 1RKIA 1HA1A 2B9WA 3SDEB 1NK0A 3HFZB 3LUYA 9ATCB 4PPZA 3K17A 2DYAA 5CQGA 4PABA 2GFFA 2FHOB 3MEDB 2ATCB 4U7UD 4DN0A 3KLIA 4LVNP 4C8MA 3TVYA 1EAYC 2ZHBA 2UXCJ 2QFIA 1F3VA 5F3TA 4X4PA 1SKUB 4A8KA 2AW0A 3CD6S 4G1IA 4DI6A 4ZLNA 3G6VA 2Y8WA 3M2RA 3MFIA 1YJNS 3PO4A 1FEEA 4LF4F 3V4MA 1RI7A 3M7VA 2KZZA 2UXBJ 4LQ9A 2DHXA 3RB4A 4ZCIA 8RUCA 1X0PA 4F0KA 2XYGB 1FXLA 1OQ6A 3X3UA 4CLWA 2MQPA 1V3ZA 3CO9A 4PXEA 1MWYA 1N8RT 2B9EA 3PTWA 3TOQA 1WELA 1V5IB 1HBNB 2GAGC 4DR3J 4F4XA 1S76D 3FQKA 2AZ3A 3KHLA 3GJTB 2E1PA 3IBFB 2RS2A 1WG5A 4KGZB 2HK3A 4GC6A 2DIVA 2Y3YA 1R8AA 1OSCA 3R2DJ 2GV1A 5LSLA 4Y2KA 3CCRS 2FZGB 5KFEA 4USUA 2QO3A 4ZVFA 1PC4A 4NZ0A 3VF0B 3M6VA 2BJ9A 4ED2A 1LWCA 4WFZA 1UMJA 4C3MA 5JMNA 2H4YB 3PW4A 4NRTA 4TLRA 4NEYA 4TLQA 1RTZA 5KFHA 3HT0A 2LECA 1N33F 4LF5F 4FKYA 2LEAA 2D7SA 1R89A 2BBEA 5EGYA 3CO0P 3FZ2A 3H98A 5A8WA 1XR5A 3PY8A 3H59A 2E5JA 1F5BA 1N5QA 2EKNA 4ECQA 3BV8A 1S7HA 4OZLA 2BW7A 5DRKA 5T41A 2LXIA 3I9ZA 5AXLA 3MMAA 3PNIA 1K1SA 2AZ1A 3CCWA 4ZCMA 4M5JA 2VC0A 3P5BP 3CMQA 3HVTA 2DK2A 2V68A 5E7OB 2RIJA 5G0RA 4PKDB 4RW6A 2FQQB 4IQMA 1IBMJ 5KFQA 4BWJA 4N56A 2R9LA 4B9LA 5J1NA 3EJMA 5I3QA 4RLEA 2HQGA 2CQPA 4HHJA 5HJXA 4PYAA 3QRPA 1FTRA 5A8WB 1VR6A 3EICA 1QE1A 3HI9A 1KHVA 2OPSA 3OTOJ 1X4AA 3KJFB 3UO0A 4I2QA 4NLUA 2D9OA 4ED5A 3UN2A 1NJXA 1Y5LB 4ZA1A 2YWWA 3KK2B 3J80U 1QTNB 2CQCA 2DNKA 5LMUF 3OFGA 1I94J 2E5GA 2C3PA 3C19A 4OZ1A 3E51A 2LFVA 1N52B 4CO1A 4RX6A 4ZIVA 2F8EX 2R4FA 4DSFA 4RW6B 2D3ZA 1UVLA 4HDHA 3PDNA 1UJ5A 3KK1A 2GVDA 5C42A 2CPXA 4JI1F 4JI0F 1S99A 1MN9A 3M8RA 4NRUA 2HHXA 2YXLA 3FBFA 4OI1A 2B8QA 3R7BB 1QE1B 2UV8A 4NCBA 3OTCA 3H7HB 2ALYB 4G6VB 1VOMA 1U1QA 2OPSB 3H4BA 2O67A 5AXMA 1RT4B 2QMWA 2ZZTA 3KLFA 5LXRA 3BO4A 4K5SA 1SH0A 3MR6A 4OMFG 4XO0A 3LPEA 1X9WA 2WTFA 3TZYA 1PJ5A 2RS8A 1S12A 4F36A 3EDRB 1T8EA 4NYPA 5L1KA 3HK2A 4O44B 2KG1A 3KK1B 3KWMA 2QRRA 2GVDB 5C42B 1B0TA 1UZHA 2HVEA 3NNAA 2HBRB 1FRXA 4UOFA 1DTQB 3R27A 1ELOA 1KOOA 5KG6A 2AGPA 3KLFB 3BBCA 4NXNF 3V6DB 2XLKA 3NLCA 3DOLA 5L8RC 1RCOB 4LRFA 4P7VA 5AE1A 2W25A 3PFOA 4KHPF 2QLJB 4XTTA 2YWHA 3TA1A 2VPYB 1QM9A 1NHUA 3CD7A 2FHJA 3U1LA 1R7IA 4RU9A 4HR2A 1P8GA 1Q86T 3TA2A 3A3PB 3FEYB 1BMQB 4CYUB 3T1YF 9RUBA 1U25A 3TVKA 1RK8A 2NXUA 3TX0A 3P8BB 2K8GA 2MDAA 4NLDA 1DTTA 1YJWS 3QFHA 3BYPA 4M8LA 5IT4A 3S7RA 2B4UA 3DDNA 4X65J 4R0JA 2W8LA 1NB7A 3QSIA 1M5OC 4Y2AA 1HFEL 2K7KA 3ENAA 2D41A 3F56A 3ZFVA 3KDOA 3DOLB 1Z1ZA 5H9FJ 4OZNA 4QWEA 5IWAF 2FVRA 2J8AA 3QGIA 1SJFA 3HJVA 2CFXA 2AJQA 3T9ZA 2DH8A 1U2RA 3MPYA 2DTJA 2CQHA 2FC9A 2VA3A 3Q2SC 1OPIA 2BJ3A 4YDDB 2BXJA 2DNGA 3QJPA 2DNQA 3FCVA 1WHWA 4J9RA 2CQ2A 3LWLA 2HVIA 4JI2J 1TTHB 1CJKA 3TO8A 1U1LA 3ZTSA 2ZJPQ 4M5GA 2RDIA 2KHDA 4X4RA 5E2QA 1VK3A 3K2YA 1SI9A 1DTTB 1I3OB 2DR8A 1DJ0A 4PQUA 2Q1LA 1TKXA 2B7CB 3DXSX 2YX7A 4CLLA 3TARA 2NSBA 3CCSS 5IC6B 3NNCA 3NBPA 4K8RA 5KT6A 4IOBA 5I42A 1TFWA 4BHQA 1UVNA 2GMHA 2BX6A 3F0NA 3ZC4A 2YKOA 2DT9A 4KAIA 1CJTB 2I9SA 3KHGA 2V8HA 2A2DA 3GU0A 3UDEA 3UCZP 3TAPA 1VGYA 1XNRF 1G1XA 4Q8FA 2KKHA 1C4AA 1IJFB 2ZH7A 4RW8A 1P9YA 5HSPA 4LF9J 2NYIA 2ASJA 1JLCA 2G9OA 1K0VA 4C0OC 3CB4A 2CPIA 2FC8A 4PQUB 1TKTA 1TKXB 3MDFA 4F0MA 3NBPB 5I42B 5L1IA 3L4BC 3PG9A 2ZNZA 2V8VA 1OJ4A 1LXNA 3C14A 4P52A 4KHMA 1Y9OA 4B9VA 4KHRA 2JLEA 1P1TA 2HZAA 2ACMA 4QPXA 1T3OA 2FD2A 2DXEA 3OSPA 1BXNA 1KTVA 3R2CJ 2W2NP 3OXGA 5IV4A 2MLYA 1JLCB 4LF6J 2PA8D 3HHLC 3H4DA 3FBBA 3DLHA 3ZZYA 2MZRA 4CNZA 4HTJA 4L72B 1TKTB 2YPZA 1TZ0A 1JMTA 1URRA 5HMWA 4CLSA 4ZCLA 1VBXA 4OI6A 2ILZA 3HVWA 3DI6A 1FX4A 2WB1D 1KVKA 4NOHA 1VIOA 3MD1A 2H51B 2WCXA 2NSCA 3LPYA 4EBDA 1YI2S 1Q53A 2HKEA 4DX7A 3C14B 1FE4A 1Y0HA 5A8RA 1HNXJ 2HLTA 1LW2A 4OHWA 2FIUA 4URQU 4MIBA 3G86A 1RTHA 4O3NA 3EGZA 1XC9A 2ZDPA 4HH1A 1M5VC 2ZH6A 4GVBA 4DWIA 3MTKA 4CLUA 3DM2A 3CJTA 4ETZA 3W5YA 3WX8A 4F0HA 1VQ7S 2OPRA 4ETXA 1SC6A 3GYXB 2YNIB 3DI6B 5LM7E 4JI7J 2RD5C 3BGOP 1AFJA 2V6AA 1BWVA 5DGBA 1KRPA 3IGNA 4IQXA 2ZM6J 5B7WA 3VWSA 4CP5A 4LFAJ 4OZJA 1M1HA 5A8RB 1FRMA 1LW2B 3MMBA 4DV1J 4ZS6A 2R2UA 1NXIA 4NLOA 4C8YA 3W5ZA 2L48A 4UOGA 4QIGA 4TN2A 3TJ8A 1N36J 3UN5A 2FJXA 2BACA 5ETRA 1S72S 3GSDA 3SV4A 3JSYA 4GVBB 4KQZA 1TAUA 5CZVA 3DRSB 3DM2B 2OMOA 3ZTPA 3SCIE 1JJCB 1TMMA 2H9ZA 2BE2A 2OPRB 1RUSA 4NL5A 3MM5A 5L39A 2HHHJ 1YJ9S 4DFJA 4OYWA 4Y0FA 2NZCA 1S49A 3GV7B 1TK5A 2QE5A 1RKJA 2J6TA 4DV7F 3HO1A 1NRKA 4I4BA 2J0XA 2Z0GA 3MMBB 1FWKA 1URNA 1OYEA 2HPUA 3A3OB 3U1NA 4PXCA 5HVGA 4H54A 3JAMU 4R0EA 5EX3A 2AP6A 2IPOB 2O3DA 1NH7A 4QPTA 4ZJOA 2PD1A 1P1LA 1ZM4A 3OPKA 3J81Y 1JLEB 3CE8A 3LP2A 2BE2B 3M9OB 4I2PA 2MTLA 3MM5B 5D3GA 2AD9A 2J76E 3FZBA 4Q43A 2LYVA 2YQ0A 2JSXA 2PEBA 3W5XA 5HMZA 1F2GA 4ZLLA 3UCUP 4PWDA 1RHMB 2RQCA 1FJ7A 4JI5F 4LF7F 1LFPA 4KC5A 5HN0A 3PW7A 4DR5J 1HPZA 1SB6A 2ZKTA 2AU0A 3K5OA 1AA1B 2NQPA 1C1CB 5HK4A 2LXFA 3DN9A 4DZ6A 4HEA9 1VBZA 1R8HA 5JXSA 3HD1A 3FSIA 5D3GB 3DGPA 1GMUA 4ZPCA 2XG8A 2IDLA 1Z2LA 1JXEA 2W01A 5J2PA 4GVLA 2U1AA 1YJRA 1L3KA 2XLJA 2HNDB 1Q8IA 3BEGB 1FDAA 1VRTA 4J5OA 1T0TV 1YRXA 1TL4A 4OYZA 1HPZB 5HVFA 1YSJA 3BH7B 1HIYA 4L3KA 4DHVA 2IM3A 3T5LA 2GS8A 3RB6A 1Q81T 2WOMA 2M2BA 3AT1B 5BYSA 5D0RA 3D5MA 3TJ9A 4PG4A 3PX0A 4B3OA 3ETOA 2XMWA 3DGPB 1GK8A 4J9MA 2FVQA 1AT1B 2BJDA 1CEZA 4ZLPA 5J2PB 1SL2A 2GO9A 1S48A 3KJNB 4DR7J 3DCAA 2KT3A 5KFPA 2CADA 4ZVHA 2W8KA 1VRTB 4OFZA 2CZ9A 3UD4P 3TANA 2PEHA 3HHNB 4EYIB 2XY7A 3BDEA 3CXCR 1H38A 2NREA 4LJMA 1WC1A 2D3UA 2WOMB 3K8VA 3R1HA 3EWGA 1QY7A 2FJBB 4K59A 3CJ3A 1JLBA 3HSJA 2JFDA 2DGXA 1CC7A 3OVBA 1EQMA 2PSZA 1ITPA 5E3CA 1ZYQA 2QL9B 3OL7A 4UUWA 3UPFA 2HAIA 1HARA 2E9TA 2VQEJ 2FTRA 3KJVA 4K4VA 1K1QA 4O3SA 5E3QA 3O5TB 3GR0A 4OI4A 3QFWA 4CH0S 2E9RX 1U09A 1NBEB 2BW2A 3M6UA 4MJKA 1HBUB 5J2MA 3AA8A 4QR2A 5HMYA 1N5SA 4FPIA 2JH3A 5IT9U 4TY9A 3OVSA 3D3CJ 1PJ6A 1JLBB 2B4OA 4DUYJ 4KY3A 1Y3JA 4HT7A 5B0GA 1TUWA 5KG0A 1JLAB 2JZ5A 1UPMB 5CH7B 1IN0A 2QTWA 3KJVB 3VQTA 1V3RA 4HDGA 4MIWA 1YHQS 3FC9A 1N56A 4MT1A 3BPDA 1BD6A 4QWDA 3NY0A 2CDQA 1R0AA 4B3MJ 2BRKA 2Z4PA 3GILA 3PKYA 2W1BA 1H3DA 1UFWA 3BN7A 4IR9A 2CG4A 4IFYB 2E7WA 2EKYA 4W92B 4ZITA 3KOAA 3VGSA 3JQKA 2VZ9A 2NCKL 1DHMA 1Q8BA 4ZVOB 1WWHA 1MLAA 5A2QU 1Q8KA 1Q0NA 2IVMA 2MQQA 1PILA 1UWAA 3GP9A 3PXGa 1N34F 5J1PA 4P10A 4DL3A 3EXCX 5CD4H 3OFFA 1IR2A 3RBZA 1R0AB 3AB4B 3N6LA 4DQRA 3LO3A 1YG0A 2C3MA 3AB2B 1FD8A 2GHVC 3DMJA 3W61A 2AJFE 3BQ0A 4DDFA 1KFSA 2DGVA 3CMAS 3MECA 3KG1A 3R5BA 2LA6A 2ZHOA 3GFHA 2C2RA 4XPCA 4U6PA 2DR7A 1YJUA 4OLPA 4FVCA 1JLGA 3VR1A 4M5NA 3H0PA 4DQSA 2XI2A 4LF4J 3EPGA 3ENQA 3MCOA 1U1KA 4CIOA 3N9UC 4OZ5A 1UL3A 2AJ0A 4J90A 1NSKL 3T6JA 2EFPA 3AOAA 3I56S 1HHSA 3N4WA 2FJAB 1U02A 4USMA 2WHOA 3GLJA 4RUBA 4ZPWR 1FFSB 4OHVA 1T9TA 1IBCB 2VICA 3ZXWA 2RH3A 1H74A 1DY3A 2IBKA 4WP8A 2NZ4A 2M70A 1CSJA 4JUZA 2VFTA 3MECB 2WB4A 3H25A 2W4DA 1U0HA 4K2JA 2I5JA 1WC4A 2FVPA 2GC8A 4D3HA 4K4TA 1WSRA 3VAFA 1HQEB 3EE3A 1JLGB 3M9MB 4KH0B 4FN5A 4L76A 3RGIA 1H7XA 3TAMA 2RUSA 4PUOA 2CVEA 1DURA 2HQIA 1H2VZ 1FKOB 3BQ1A 1XNQJ 1N5YA 1F9EB 4QJVA 3Q0AA 1KSPA 3R7SB 2B6AA 4KPCA 4M5MA 3D28A 1RWWB 2R7QA 3L7UA 4OJ1A 3Q8UA 5ETSA 4V1Ak 1XN9A 2YX4A 4ZVUB 2OSQA 5CYQB 2EFVA 3QBCA 3PEJA 1F9FA 2IFXA 3BR8A 2OEMA 2XI3A 1NK9A 5F3ZA 2HLUA 3AXKA 2XBPA 3T19A 1U0HB 2I5JB 2XZWA 3ISNC 2QFJA 1MMDA 3FRYA 2I2YA 1C0UB 1RABB 2YNGB 4WWSA 5FIIA 2DPJA 2GQCA 1VLYA 1WORA 4X84A 3TAMB 4PUOB 4OHYA 3CCVS 1ULRA 1VQ6S 1CULA 1F2HA 5DQHA 3DFEA 3O6QA 4ELVA 1OIAA 2VIHA 4IRCA 2B6AB 4ED8A 2HFZA 2V2VA 4C9DA 1ZPWX 4C0BA 3QIPB 2VJUA 3FCWA 2DGQA 3HVRA 3T5HA 1Y5IB 3FQLA 2RRBA 4L74A 4U9RA 2L9NA 4C98A 3HHLD 1SIWB 1PCAA 3HX9A 2ZBIA 1BY9A 2J9DE 4Y2IA 4LSZB 1RT7A 3IG1B 3MPWA 3SV3A 1SJQA 2BYCA 1OYDA 2K1RA 3CJKA 3LALA 2JDJA 1CULB 4ZVRB 1EQ0A 2UXCF 2BJ1A 2W2PP 3DLLQ 4NPOA 1PBUA 1S1XA 2HNYA 4MK9A 1RWMB 1LXJA 3CIMA 2HFNA 3OJUA 2XLIA 1ZZNA 3HD2A 3B8HA 3EGWB 1L3SA 3B82A 5IV3A 1B0PA 1W25A 3PZPA 5KFDA 3T1HJ 1WF0A 2MLXA 2ZZNA 2UXBF 3QO9B 2C2ZB 3GG0A 1H7WA 3M32A 2A10A 3DLBA 4GO5X 1D3WA 1VQ5S 1O0PA 4P74A 3A8KA 1FFGB 2K1RB 3CJKB 1Y11A 5IFMA 4DPUA 3N5BA 4DR3F 5B0DA 1VLOA 3E8OA 1S1XB 2HNYB 3Q2TC 5ETQA 2CG8A 3TQ1A 3MM8A 1SKWA 2DB1A 2QT7A 1JQGA 4DX8H 1GMWA 2BZ2A 3KKFA 3I6PA 1X60A 3AY0A 2XGQA 5CHCB 4NA1A 2QLWA 5CD4A 5GAHU 1H73A 3B4MA 1G2EA 4LIWA 3IXQA 2MMYA 1I1GA 1ZA2B 4NXNJ 2K2PA 2DEIA 4ID5B 3TZZA 2RE1A 4TU9A 1L3VA 3M2UA 2UUTA 4LFBF 3POTA 2N4DA 1SC1B 2NXJA 1LWFA 4RNNA 2QV6A 3DRYA 2J6UA 1YDLA 2FY1A 4PG8A 3NGTA 4X4UA 3I5AA 4W98A 4DR1J 1X5OA 3MM8B 4WTYA 3G6YA 4N7TA 3M30A 2GJFA 2KFNA 3BKFA 2R7OA 2KJVA 3DDIA 1WNEA 5GADI 1QSLA 1RTIB 5LSRA 5E33A 1NSQA 2BJ7A 3OFEA 1IBMF 4YB7A 2JLGA 2ADBA 2A6MA 4DU8A 1MMLA 4FF3A 3M2UB 4NCAA 3K59A 5H9EJ 1H72C 1PJ7A 5EWEA 3W3SA 3TUPA 5RUBA 5KT5A 3W62A 4RUCA 1LWFB 3MM6A 2J9CA 4KSEB 1VDHA 1F6TA 1H0HB 1QUVA 4CH7A 3OTOF 1VFJA 1YQHA 2XZDB 4PZVA 3M30B 1JJHA 2J7KA 4I64A 1U1PA 3S6EA 1VQMS 1I94F 1KR4A 4ERDA 5THWA 4ZIWA 2GIQA 4IRKA 3RRGA 4EEYA 3IN5A 5U47A 2P5VA 1UA0A 2JC0A 5E0OA 2DBBA 2VPWB 4OIXA 1NPPA 4XAKA 4IG3A 4NCGB 3SQOP 3TVZA 1NPRA 4QIVA 1MROA 2OKQA 4I6YA 3BSNA 4FYDA 1UETA 2BABA 5I3PA 4DL6A 3RBEA 1KNZA 2GJ2A 5A6WA 1SJ4P 1RT1B 3IBWA 3GTYX 1S0OA 4WK3A 1VIXA 4LRCA 2HWTA 4FS1A 3QZ7A 4X4NA 2OTLS 2G4BA 3W63A 4C97A 3IR5B 1NSPA 4J9PA 1LWEA 4RNFA 4BC9A 4Q5VA 2C2OB 3Q24A 3EZ5A 4F67A 1T9UA 3CSKA 2XO7A 4IG3B 2ZKUA 4KPYA 3OW2R 1PGZA 2V8DA 2HHSA 1MROB 1N4LA 4EBCA 4WP3A 2HBYB 4RW4A 2VFUA 2OH2A 2DXFA 3CDUA 3R5GA 2CUYA 4OX9F 2VL1A 1IM6A 1JWWA 3ILLA 1S9FA 3IC1A 4YR2A 2E5IA 4F02A 1REVA 3J7YI 4LIRA 1GQEA 1LWEB 2CJAA 1RYSA 2VKZG 1RU2A 4Z7CA 3AOBA 1PG5B 3KUGA 4QYRA 5KOXA 5KFSA 4USJC 5ETNA 4NLXA 3CCLS 3N28A 1B99A 3UR3C 1JJ2R 3Q8RB 3GCWP 1HR0F 4Y28C 4X65F 4M5KA 2DISA 3G8QA 4NA3A 4K2XA 3MAQA 3HSDA 1WC0A 4C8ZA 4EGLA 4I6WA 4PG7A 5HATA 1RWXB 3IWNC 1S1WA 2G1DA 4OYOA 1YWXA 4WBFA 5KFRA 2WK4A 4WIQA 1HNIB 4OI0A 3VVTA 3RBXA 1UVKA 2RF2A 4LFCF 4JI2F 3VAGA 2AF6A 4AQYJ 1S5ZA 4ICLA 4USIA 2WRMA 4DV6J 2AJ2A 4MKAA 4ILLA 2BOPA 5H1SV 5IXUA 4B3SJ 2G1HA 2I38A 5C5JA 4FYYB 2JEGA 3DHXA 3D1OA 3BJYA 5KFGA 5SUHA 1HWIA 3CJ8A 4FDFA 2H48B 4FXVA 2IMOA 4WFYA 1S59A 4NX9A 5EWFA 1EZZB 4IO1A 5LJ3Y 1BQNA 1M5PC 2WAQD 2DNMA 1S1WB 1M90T 3J7ZT 3GONA 1UJ6A 3SEOA 3RB0A 5HBMA 2XMJA 1RP5A 4OZ2A 2RF2B 3SXLA 4DXLA 3D7SB 3ZZ0A 4DV7J 1BE4A 4LF9F 4DF8A 4N76A 4F4YA 1RA6A 1RWKB 5LXYA 1OWXA 2IHR1 4LSLA 2JLFA 1X5TA 3T41A 4LUBA 2AMCB 2JRSA 3W2VA 2ZDOA 5KFBA 3UE2A 2WBMA 1BWEA 1RSCA 3SQGA 2NXCA 3TAQA 4NXMF 2X7IA 2UVVA 4F2SA 1YITS 3ZZZA 3OL6A 1BQNB 2CQBA 2MZJA 1BHNA 2HIQA 5D77A 1J2VA 1KVIA 5HBMB 4X4QA 2XQCA 5HLFB 1LFWA 2X1GA 1CC8A 1VMBA 1R0CB 1EIYB 2JEFA 2ZITA 1HBMB 1S6PA 1HNWJ 3PW5A 2KM8B 2HHVA 1XQIA 4LF6F 3FGVA 4NLQA 1WG4A 4X4TA 4JI5J 1QJHA 1KD1T 1IKYA 3LP0B 2KO1A 3G87A 1R27B 3W2VB 1HWLA 4KYZA 1TVRA 3SQGB 3UVJA 1XIQA 3I32A 2HHUA 3R5AA 1GXUA 2R7RA 2ROEA 1HNXF 4IOCQ 2XO6A 1PSDA 1Z2ZA 4FBTA 2BDPA 2RT3A 1MU2A 3UN3A 3RAQA 3K5NA 3IAS9 2CNNB 3MEEA 5ETOA 3ULHA 2DHAA 2MXYA 4XK8C 1X8DA 2F4FA 3D6HB 1S6PB 2C1EB 1S1UA 1LOUA 3WIVA 4X66J 1FKPA 3DLJA 1IKYB 2HRYA 5K8OA 1TUVA 2N3LA 4ANDA 1M1GA 2F8MA 3GYNA 5KG4A 4CT9A 1MNEA 3GIMA 3JYTA 2GNKA 1TVRB 4RZRA 2MZQA 2ZM6F 2G13A 3W60A 4Q0BA 3DOKB 2WSCC 4DV1F 3VAIA 4JI8J 1X5PA 2ROGA 1MU2B 4QWAA 2D3O1 3W64A 4LR8A 1S7IA 1N36F 4ZVEA 4WXOA 2RSQA 4HVZA 1ROFA 3GYGA 4DCOB 1S1UB 3ISND 4O4RA 1CVJA 2QLFB 1FKPB 4TKTA 3GWCA 1F1BB 1WF2A 2ZWPA 4CWBA 1FKAF 4LRBA 5A0YA 2AT1B 4YHHJ 2HHHF 4ZVSB 1HLWA 3CEDA 3JYTB 1MG7A 3OFHA 1S57A 4ED1A 4CLTA 4GO7X 1EARA 2EBEA 5DZ6A 4Q0BB 3K89A 2JWNA 1WTFA 2UUCJ 1J5OA 5DDRC 2VV5A 4OHZA 4DCPB 3UDLA 1RTDA 1T05B 3MEKA 1NMEB 5A8KA 3KLVA 1TL3B 3P49B 3PVXA 1M0SA 1U1RA 4CLPA 4ECVA 1U26A 4ZJLA 2DGWA 4MKVA 1UAWA 1R0BG 4C8OA 1S97A 5C25A 3QQCD 4RO0A 2RAQA 5A0YB 4UQTA 3I96A 3EVMA 3R9LA 1HKAA 3NGSA 3SSQA 2V9KA 2V4RA 4ZMMA 2AGQA 1T9WA 1SCJB 4AXIA 5DG8A 1ZTWA 2CA9A 2JEJA 1RAIB 1YBTA 4DN9A 2JEIA 1RHKB 2VPZB 4RWWA 2CQ4A 3MR3A 4DSEA 3ELHA 3SFUA 5AJ3J 2MKKA 1J5OB 4EU0A 2VBXA 5ETMA 4YS2A 4Q45A 1RTDB 3EMTA 2MLZA 1VQSA 1ZPVA 4DR5F 1AROP 2EC2A 3GFZA 2BM1A 3UD5A 2AYBA 4DSKA 1T9XA 4P2FA 4DS5A 5C25B 5A76A 2FLLA 4M5IA 2QZ8A 2GQ2A 2W9BA 5A6PA 2ZH1A 5G4DA 4ITSA 1T7PA 2WVDA 2ZVIA 2MZTA 3AH6A 4I56A 3CCES 1O5JA 2PFFB 2MQNA 1ZM2A 1U7LA 2QYCA 2HQ3A 4V19J 4OJ3A 1FVSA 3LWMA 5JVHQ 2P6SA 2NLWA 2OHDA 3I0RA 3DOMA 4J9OA 2VG5B 5ETVA 3R1LA 1FWLA 3NCQA 1A6LA 2KFZA 3I82A 1NZAA 4ZPBA 2HWIA 1BQMA 2Q6CA 3PYEA 2LQ8A 4O4GA 2IBOA 5HVHA 4WTOB 1NDLA 3CMES 2W9BB 4C2MA 4GKJJ 1CS4A 5K8NA 2IJFA 3L95X 3BQ2A 1MW7A 4JI4J 2W4CA 1PYTA 4NYZA 2OELA 4KE5A 4R25A 5KFLA 4J9VA 4LR7A 4MIAA 2HBZB 3P96A 4DR7F 1CQNA 5LJ5Y 2FHJD 5J2QB 4YY3J 3H2LA 3I0RB 3DOMB 2MSSA 2OFGX 4HKQA 4F4KA 2BE7D 2FLNA 3NWGA 2WSFC 2FZKB 3W65A 2CZVC 5LT5A 4IRDA 4IO9Q 1DARA 4B9MA 3KLHA 3FSYA 4A8WA 3DLGA 1W2IA 4O4GB 2IVFB 2ZBRA 2LDIA 4ED7A 4F4ZA 4UY8T 1Q7LB 1IJEB 4U96A 3ZZPA 4NLPA 1M5SA 4QYZK 3CNQP 4DPYA 2HRUA 1H98A 3EZOA 2HS0A 2KH9A 4C8KA 2VQEF 1KLMA 2GMLA 3CVKA 4ZN3A 3HHDA 4OL8A 1VC5A 3E01A 3BKTA 2Y1RI 4CLFA 4QBUA 4F2RA 1IUJA 2KXNB 1FX2A 2E5LF 5CYMA 1SQFA 2BKOA 1RBOB 3LH2S 3KLEA 1A9NB 3GE9A 4G1QA 5JJBA 3IWLA 5KFNA 3FJ2A 5I4MA 4B17A 2W7OA 1YRUA 3DLGB 1SV5A 1VCTA 4ZDNA 1U6BA 4O3RA 4DUYF 4FPRA 2XS7A 4RUHA 4K50A 2G2ZA 1HW9A 4FF2A 3KG4A 2HIYA 2DH7A 1XEZA 2MKHA 1KQKA 5FD1A 1Q5VA 1KLMB 1S0MA 2CJXB 3R7NB 3MEGB 3E01B 2LU1A 2YKAA 1FERA 2HFSA 5CYMB 5E5NA 1NJIT 2EFQA 5SZTA 1IM4A 4B3MF 3KLEB 4LBHA 4P2MA 5E3PA 1N32J 2ZH5A 4DPOA 4G1QB 4F3MA 1PAEX 4RR5A 3W8GA 2CZ4A 3PX6A 3ENVA 1GXTA 1MWQA 1SV5B 2DR6A 2HVZA 3VGVA 2C2KB 4K4SA 3M2VA 1F9HA 2WONB 2VA2A 4WKYA 4QYZJ 1RZMA 4URGA 2PGCA 3D9BA 2C3YA 2RHSB 2VONA 1RHJB 1RAJA 1PO6A 3DRRA 2B9XA 3MOZA 2GHWA 2BQRA 4PQAA 2POKA 3H2VE 4ANCA 1LW0A 3FBCA 2PN6A 2ROPA 4GKKF 5MLCV 1E6VA 2FPHX 1Y00A 1YBUA 4Y3CA 1B7FA 3LANA 3SYZA 1IKWA 1D9AA 1GTEA 3PR4A 4WJBA 1HBNA 3C6TB 4PWUA 3FFIB 2WVBA 4DZDA 4B3TJ 1U1NA 3M2VB 3MCSA 2DNHA 1CJUA 2EPIA 5GAGU 3PW2A 2VFRA 3KJQB 3VHQA 2RUGA 1CJVA 1U8SA 4I6AA 5LSOA 1JB0C 1Y7PA 2HQCA 2OO4A 4DG1A 3DRRB 4J9LA 1G6BA 5LOQA 2M8DB 3MOJB 2Y1JA 5DETA 3DRXA 1LW0B 3IR6B 1QAYA 3I9V9 1MMNA 2MY8A 1E6VB 5F9NA 4QWBA 3QWUA 3FK4A 2ABYA 4DV5J 1I51B 3UCGA 1IKWB 3HM9A 3CF5Q 2XWYA 4N47A 2XGPA 1OPZA 4P72A 4DPTA 1KQSR 4IG0B 4WFXA 1NHVA 1CJUB 1RTJA 2MY7A 1CJVB 3QYYA 4AXJA 1WOPA 2A2CA 2J7UA 4Q2LA 2PC6A 2KHCA 3UI3A 4PEOA 4DG1B 4NZ6A 1X4CA 2VQFF 1AUSL 8ATCB 1XNQF 5D4NA 4I1TA 2B43A 3WIUA 2FJWA 5IM0A 1VISA 4EBEA 1RE1B 5KFAA 1V6HA 3HSGA 2BEFA 4LFBJ 4X64J 1YIJS 2VG7A 2VG6B 4O0NA 2F4VJ 2P2CB 5IOLA 1XMQJ 4FVMA 2EI5A 4H4MA 3S01A 2QGFB 3BBFA 1UEUA 4A4JA 1RTJB 3X1LB 2N7YA 2E1RA 1NSAA 5FLXY 5T7LB 2VC1A 3KK2A 2MQ8A 4ED6A 2NPIA 3H5XA 4JV5J 1Q7YT 3NCRA 3EYZA 2MB0B 2VOOA 4TYBA 4B9SA 4DL4A 4K5RA 3G4SS 2W2OP 3CWJA 2ASDA 4EFAC 4DR2J 5IM0B 2P9GA 1D8YA 1VQOS 5C2CA 5GAEI 2JC1A 2BKPA 1QTMA 3MR2A 2ZC3A 1VRQC 2VG7B 1OS5A 3ZO7A 6AT1B 2YNFB 4NLRA 4IOAQ 3G96A 3GFXA 2HQDA 2J6SA 4TYAA 5BYRA 4H4MB 2XCPA 4KBIA 3DGVA 4EWTA 2DNYA 3NGUA 1RT4A 2W2MP 2FUG9 2D1CA 1HHTP 3D6FB 1RADB 3EUNA 3AFGA 3DHWC 5C2GA 2I6WA 2YWKA 5IC4B 2E5HA 2KRRA 2KVQE 3JSMA 4X2BA 3PACA 5F8JA 2HAFA 3UDCA 1VQPS 1FJGF 3A8JA 3BSOA 2XNRA 3MUVP 3M8PB 1FD2A 4HTIA 4A46A 3F73A 4O44A 4Z37A 4Z7YA 1BC6A 1YRTA 2R7SA 3T1HF 3D67A 4DFMA 1Y5NB 3IRWP 1VHFA 4ZP8A 4WK1A 5L9XA 1BUXA 4C8LA 1DTQA 2ZUAA 5J2NA 2V94A 2W7PA 5K8PA 2WSEC 3IS9A 2GQQA 3DYAA 1K47A 2MQOA 3V6DA 4E2FB 4Z2XA 1NB2A 3B4DA 1SH3A 3RG6A 3RU0A 3EVOA 3KLGB 1ZH5A 1FTCA 2V5HG 3JSMB 1KKHA 1XJWB 3ET6A 4R8UB 4DR4J 5GMEA 4UZCA 5KFKA 4L3NA 2H65B 4CYUA 1FRJA 2R42A 2ZE2A 2VDHA 3D4JA 1K73T 3C6UA 2UV8G 1D9DA 5J2NB 1TP7A 2LXUA 3IS9B 3GR1A 3DYAB 4IYQA 1IVZA 4JI3F 4OX9J 4NMLA 4ZP6A 2XY5A 1X5SA 1NU4A 1EETA 2ZBPA 2YTCA 4ELTA 1JJ4A 3EGNA 2BQUA 3D68A 4ZN1A 2YH0A 2IIHA 4NLGA 2J7WA 4LVOP 3ET6B 2D74B 3P4UB 1SL1A 5CCMA 5K20B 1ACMB 2ZE2B 3I5BA 4DR1F 4S0MA 3HLUA 3R6GB 1OY8A 2JX2A 2DGSA 1KVJA 3C6UB 2QC3A 1D8ZA 1WJ9A 3RRHA 4YB5A 3OVAA 1QDUB 1HR0J 2IJNA 1TQLA 1HD0A 2GIRA 3CD5A 3U27A 1TL7B 1GAOA 1QVFR 1YLXA 1CJTA 1EETB 2Y0SD 3MR5A 4UOHA 3CPWR 2VBWA 1EP4A 4UQGA 1JKHA 2MPUA 1F5AA 4USVA 3AHPA 3AXMA 2YPYA 2C2EA 4DX5A 3KDNA 5D8HB 1ICEB 1GFWB 4LFCJ 2RRNA 4ED4A 2EK1A 5D0GA 2R7TA 4A8MP 1N5VA 1YK9A 4LF2A 2B7BB 5I3UB 4K4ZA 1SKRA 2HHPA 1KEKA 2Z2YB 1SQGA 3IM8A 2IA0A 3GIKA 3PR5B 2GJIA 4DQPA 2M5YA 3K5PA 3PJXA 3F41A 2QA2A 1T03A 2P9CA 4Y65A 1O8BA 4UZBA 1QAIA 5B0EA 1EP4B 1JKHB 3BYRA 3VAJA 3HKZD 2PI5A 3ITHA 1DZ5A 2CPYA 2MHNA 2X1FA 4HACA 4ILRA 4QZVB 3A13A 4WCEQ 1WUUA 3TNVA 4DPXA 2HZVA 3A3NB 2FVSA 2KTQA 3UW1A 2HFOA 3QT5A 3QT6A 1J5EF 2BOAA 3PIOQ 2PMZD 2B0GA 2H1YA 5BXIA 2H54B 3PX4A 4M5HA 1QVGR 1NK4A 1SIZA 2BANA 4NXMJ 3DC2A 1T03B 1HD1A 2DEJA 1X4DA 3GSIA 1S9EB 5CCLA 2CNLB 1LWXA 3L3CA 2X1BA 5KG3A 2H5IB 3ITHB 3E3XA 4HACB 2CIMA 1RHRB 3ZTRA 3THTA 2KXHA 4C8NA 2W9AA 1X31C 2CPDA 1WOSA 3V81B 2W24A 4RW7A 3W7BA 3NRBA 2KG0A 2YWFA 3K0JA 1UTAA 1G7CB 3EVWA 2QL5B 2E9ZA 6FD1A 3MWBA 3QMQA 3IO1A 4B02A 2YNIA 1U6ZA 2KJWA 2X1AA 2BANB 3FCHA 2KYZA 3PEHA 3HF5A 2F1FA 5HAOA 1FHTA 1RGVA 1WI6A 1FNMA 2BJ8A 1RACB 5KFCA 5KTQA 4N8NA 2QN6B 4ECSA 4IH7A 3MF5A 4B08A 3D66A 3BO2A 1APSA 3MHYA 2XSFA 4Y34A 4RW7B 3TP2A 3DRSA 2YKQA 4IH6A 1NDPA 1WOOA 3EDQB 4DSLA 4CRJA 3DRPA 2U2FA 2W9CB 1FVQA 4NZ7A 2Q6BA 1RDRA 3DKDA 1RWVB 3GQCA 2JHEA 3ZTQA 3CUNA 4OV6A 3F44A 5EDWA 4AQYF 4DV6F 5F8MA 4G1PA 4B3SF 2BKNA 5T14A 3OQ2A 3HFKA 2LEPA 2ZC4A 3BGRA 3RR7A 2XMTA 1HMVA 1HBOB 1IWAA 2RKIB 1M5KC 4CI0B 2G0CA 3SBMA 2P9EA 2V2ZA 3P5TL 4KJIA 1AYEA 1JLEA 4L75A 3CULA 3DRPB 4YP3A 3SI8A 4QWCA 4YDXA 3GIJA 1PAUB 3P3DA 5C7PA 3BGUA 5DDPC 3GJQB 2XHCA 2YQ1A 5KT4A 4ED0A 3UR0A 2Z57B 4FBUA 1FK9A 4NI2B 2B3TB 4KGXB 5FJ4A 2E1AA 3OHAA 3GCXP 1AZSB 1NKEA 4MYUA 3A4TA 2IYGA 3QJLA 2N4CA 3BGRB 2Y1LB 1WF1A 1HMVB 3W8PA 1ZAXA 2MSTA 3QAEA 4FKXA 2CJKA 1C1CA 3PCOB 3I87A 3NGRA 4TY8A 1S9GA 2ZWOA 3NMRA 5IZHA 1W2BR 3TW0A 2IRYA 2K3IA 3PRDA 4ALZA 3WC0A 2F7VA 3D1HA 1FT8A 7FDRA 3T6BA 4OJHA 1JK9B 3VV2B 4C0HA 5AXNA 1NNDA 3JSRA 4C3KA 4P9SA 2FHMA 1MWZA 3BF4A 4DBQA 4L6V3 1HNWF 1Q82T 1D09B 1IXKA 3J81U 1AB8A 4X4VA 3US5A 2HNDA 1FK9B 2ZEJA 1DQ9A 2KT5A 2CPHA 3KHHA 2Y8YA 1FFWB 5EWGA 3Q8VA 1IWGA 4B3RJ 4DV3J 4MK7A 3RAXA 3ISZA 5B08A 5KFZA 2XY6A 4TY8B 1S9GB 4QIWD 3Q23A 4BLGA 2C22A 3CJ4A 1RA7A 4FNHA 4PRFA 3U1MA 3NL0A 3KHRA 3WQPA 3AA9A 2OI2A 1HNZJ 2RMLA 5KFFA 1LV5A 3DLEA 3CCJS 3CJ0A 1SVDA 4X66F 3TX8A 1HQ2A 1NH8A 3HULA 2DITA 3V6HA 4LSNA 3OUYB 1RT2B 3J81j 1XMOJ 4ECUA 4DCJB 5B0CA 1W7WA 2RRAA 1GMWD 2R8KA 3IM9A 3HDSA 2Q79A 1YVFA 5L9NA 3PYGA 5GAHI 5L1JA 2UU9J 2FLPA 1OSDA 2FVCA 2CQGA
chains in the Genus database with same CATH topology
2CQBA 2HG4A 5H9FJ 1RQ0A 2MZJA 4OZNA 4F25A 1X9MA 2HIQA 4QWEA 5M2UA 4YFUA 5IWAF 4JI8F 4DV2F 2FVRA 5F8NA 2J8AA 5D77A 1J2VA 3QGIA 1KVIA 1E6YB 5HBMB 4X4QA 1SJFA 5HLFB 2DRAA 1RT7B 2CFXA 3IRXB 2AJQA 3T9ZA 1VC0A 3M6XA 2DH8A 2DVIA 1U2RA 3MPYA 1LFWA 2CQHA 2DTJA 2FC9A 2VA3A 3Q2SC 1OPIA 2X1GA 3N79A 3KYLA 1CC8A 4YDDB 1VMBA 1S1TA 1O51A 2JEFA 2BXJA 2DNGA 1P6TA 2ZITA 1HBMB 2DNQA 3QJPA 1WHWA 1S6PA 3DLEB 3PHEA 4J9RA 2CQ2A 2X51A 3PW5A 3LWLA 2VUGA 1SKSA 2KM8B 2HVIA 2HHVA 4A8SA 5D4PA 3QPIA 3TO8A 4LF6F 2M7SA 3FDSA 3FGVA 4NLQA 4CO2A 1U1MA 1WG4A 2KDOA 1U1LA 1NKCA 1SJ1A 2ZJPQ 2RDIA 4X4TA 1QJHA 2FDNA 3OR1A 1IKYA 2KHDA 4PG6A 4PXDA 3TRGA 5E2QA 3LP0B 2IC3B 4X4RA 1VK3A 2KO1A 3K2YA 4YHHF 1HBUA 1DTTB 1SI9A 2CJBA 4LSNB 2DR8A 1DJ0A 1R27B 4K4XA 3MM7A 4PQUA 2PMHA 3W2VB 3C6TA 1F0XA 2Q1LA 1TKXA 1NAQA 3IAM9 4QW9A 1K9MT 2B7CB 2YWEA 2DGUA 1HWLA 2AJ4A 2YX7A 3DXSX 3FFIA 2CQ1A 3TARA 3BN4A 2NSBA 3CCSS 1WI8A 1TVRA 3NNCA 3NBPA 4NYOA 4BCAA 7FD1A 3SQGB 5KT6A 4IOBA 5I42A 1TFWA 4WYLA 4BHQA 1UVNA 3I32A 2GMHA 1VQ4S 3M32B 2HHUA 3ZC4A 1VK8A 2YKOA 3K7RA 5CA5A 2DT9A 2DJWA 1WEYA 3R5AA 4KAIA 2UUCF 1GXUA 2I9SA 4URSA 2R7RA 2ROEA 1HNXF 1U45A 3KHGA 2V8HA 4DJBA 3RZAA 2A2DA 4KO0A 4IOCQ 1JLAA 3UCZP 3GFYA 1PSDA 1VGYA 1Z2ZA 2KT2A 3OLAA 3TAPA 2R8JA 2BDPA 4FBTA 1XNRF 4RBTA 2RT3A 2PO4A 3DXBA 2YKPA 1MU2A 3RAQA 1G1XA 2FB0A 3K5NA 4NWBA 5D6GA 1WACA 2PDAA 1YGYA 3IAS9 3MEEA 1S1TB 1VC6A 4Q8FA 3ULHA 2DHAA 2MXYA 4XK8C 5HI7A 1X8DA 4OX7A 2KKHA 4O3OA 1C4AA 1S6PB 1IJFB 4EO6A 2UXDF 2ZOFA 2ZH7A 1SJ3P 4ZOSA 4RW8A 3QZ8A 1D0EA 3OTEA 5AXKA 1S1UA 5M2PA 1LOUA 1N54B 1B64A 4RKUC 2Z2MA 1FKPA 3B78A 3DLJA 2NYIA 2ASJA 1Y4ZB 1IKYB 1JLCA 3OR1B 2OIHA 2HRYA 5CYJA 1TUVA 2RILA 5K8OA 2G9OA 2LQBA 2V2KA 4WU2A 1K0VA 2N3LA 4ECYA 3RR8A 4C0OC 3CB4A 2CPIA 2FC8A 4PQUB 3MM7B 1TKTA 2F8MA 2HHQA 1TKXB 3MDFA 3GYNA 5BYQA 2VASA 5KG4A 3FVYA 1VQ9S 4CT9A 1MNEA 3GIMA 3JYTA 2GNKA 4IFYA 2VD3A 1OO0B 1TVRB 3NBPB 3OXLA 4E98A 2R2RA 4IG0A 2IM2A 5I42B 5L1IA 4IDKA 1HNVA 4MKBA 4RZRA 2HGNA 2PI4A 2PE8A 2MZQA 2ZM6F 2CJ9A 5K5MA 1UVJA 2G13A 5AJ3F 2ZNZA 1KD1T 4Q0BA 4ZPTR 2V8VA 4B3TF 3D0HE 3DOKB 3Q8SB 1LXNA 3MM9A 1JIHA 1U1OA 2WSCC 4DV1F 4KO0B 4KHMA 1Y9OA 3VAIA 3RTVA 2Y1IA 1SXLA 3IFEA 4B9VA 3LAMA 3POTB 1X5PA 2ROGA 4KHRA 1MU2B 2JLEA 2EFOA 4NLTA 4QWAA 1X7VA 3I0SA 1WHYA 2HW3A 1P1TA 1ZTTA 3DNCA 3H20A 4WZMA 3HKWA 1N36F 4ZVEA 2OTJS 4WXOA 3KLIB 2HHTA 1G3OA 2RSQA 3H5SA 4HVZA 2XMKA 4QPXA 1ROFA 3OTDA 1T3OA 2MKCA 2FD2A 1S1UB 3I31A 3ISND 3OSPA 4O4RA 1KTVA 5KFXA 1CVJA 1JLFA 2HGMA 1F60B 2I8EA 3OXGA 4GC7A 1FKPB 4TKTA 3GWCA 2WW8A 3L7PA 1JLCB 1WF2A 2PA8D 3HHKA 3HHLC 1FKAF 2N7CA 3H4DA 3T3FA 1WHXA 1ZM3A 4DR6F 3DLHA 2XS2A 1KS2A 5A0YA 3ZZYA 2VG6A 2MZRA 4CNZA 2CPEA 4HTJA 4L72B 2HMIA 1TKTB 2A18A 1TZ0A 2CPZA 1JMTA 2HHHF 1URRA 2YKNA 5HMWA 1CPZA 5HQ8A 4ZCLA 3CEDA 3M2RB 1VBXA 3JYTB 4OI6A 3CDEA 2ILZA 3V2UC 3HVWA 1KC8T 3DI6A 3OFHA 3M9NB 4ED1A 2WB1D 4GO7X 1HNVB 4IDKB 4NOHA 3KK3A 1VQNS 1VIOA 3MD1A 2EBEA 2WCXA 2NSCA 3LPYA 4EBDA 4N41A 1YI2S 2ZJQQ 4AE5A 1Q53A 4Q0BB 1H2UX 2DR5A 2JWNA 3MM9B 2YH1A 2HWHA 4PCQA 1WTFA 5T7LA 3THVA 1X0FA 1VBYA 1HL6A 4ZP7A 3SZ2A 1J5OA 5DDRC 4LQ3A 1FE4A 1Y0HA 5A8RA 2VV5A 4OHZA 2HLTA 3UDLA 1RTDA 1LW2A 1T05B 5KAKA 3MEKA 4OHWA 3I0SB 2RNEA 1RJJA 2FIUA 4URQU 4DV4F 5A8KA 4MIBA 3G86A 3KLVA 1RTHA 1TL3B 3MM6B 4O3NA 4OQJA 3EGZA 3P49B 3PVXA 1XC9A 4RNHA 4BBYA 1M0SA 1U1RA 2ZDPA 3TI0A 4ECVA 4HH1A 1M5VC 3TUJC 4RNMA 1U26A 1GH8A 2DGWA 5MAOA 2V4QA 1JLFB 1LK7A 4WIIA 1UAWA 2ZH6A 2F8HA 4DWIA 4C8OA 4ECZA 1S97A 5C25A 1NK7A 1KOHA 4RWXA 3PM9A 3FRZA 3MTKA 4ZP9A 4GKJF 2NPFA 1CLFA 3MUTP 5A0YB 4UQTA 2HMIB 3I96A 3DM2A 2YNFA 3HP6A 4U7UK 2ZFHA 3N5FA 3V5RA 4ETZA 5ITHA 5KT7A 4JI4F 1HW8A 1C1BA 2YKNB 1VQ7S 3SSQA 2ASLA 2V9KA 2OPRA 2V8GA 3JTNA 4ETXA 2V4RA 1SC6A 3GYXB 4ZMMA 2AYGA 2YNIB 2AGQA 2CQ0A 3FEXB 1SQEA 2GGPA 3DI6B 1HWJA 4KGKA 2RD5C 1AFJA 3H40A 3KK3B 2OPPA 4AXIA 3D1QA 5DG8A 1ZTWA 4EZ6A 4HI1A 5D78A 2JEJA 4DN9A 2JEIA 2VPZB 4YY3F 5DGBA 4DQIA 3BZQA 2CQ4A 3IGNA 4RWWA 3MR3A 1KRPA 4IQXA 4DSEA 2UUWA 3ICLA 3VWSA 5B7WA 2DNOA 1DLOA 3SFUA 4OI2A 2MKKA 1VQKS 5KFVA 2NR0A 1J5OB 4QOTA 1XTZA 2RQKA 4EU0A 4OZJA 2VOPA 2VBXA 5A8RB 2IAJA 1LWCB 1NJWA 1FRMA 4Q45A 1OQ3A 3THPA 1RTDB 1LW2B 2NUUG 1HQEA 2QMXA 3MMBA 4ZS6A 2R2UA 2QLXA 4NLOA 4C8YA 2DNRA 1VQSA 2L48A 1ZPVA 2DNPA 4DR5F 1AROP 3CIZA 4CZCA 2B5JA 2P6TA 3GFZA 4QIGA 2BM1A 4TN2A 1ZBTA 2FJXA 1FKOA 3J80Y 2VFVA 2BACA 2ZOGA 2AYBA 4DSKA 3CDWA 1TV6A 3M8PA 3N0VA 1S72S 1TAQA 3GSDA 2JOQA 4J9QA 3SV4A 2V0NA 4DSIA 3JSYA 4DS5A 5C25B 4F50A 2FLLA 4KQZA 2QZ8A 1WEXA 1JNRB 2GQ2A 1TAUA 5CZVA 3BO3A 2CJQA 2B4VA 3DRSB 3UD3P 4ILMA 2W9BA 3DM2B 4OI3A 2OMOA 2ZVSA 5A6PA 2ZH1A 3SCIE 5G4DA 1U2FA 2ASYA 1VQ8S 4ITSA 1T7PA 4JV2A 1IR0A 1C1BB 2H9ZA 2BE2A 3MMAB 5CYQA 2MZTA 2OPRB 3AH6A 4WZQA 2XMUA 4I56A 4NL5A 3MM5A 5L39A 2RU3A 2GGPB 4V19X 3CCES 2JVRA 1O5JA 3I4HX 3G9CA 2PFFB 2MQNA 2OPPB 4DFJA 1YJ9S 2M9KA 1ZM2A 1U7LA 2QYCA 4Y0FA 1S49A 4Y2MA 2C28A 2ZZMA 2KN4A 3GV7B 2EG1A 2HQ3A 3HVTB 2QE5A 1TK5A 4V19J 2XS5A 5G0RB 4OJ3A 1FVSA 3LWMA 4GMKA 5JVHQ 2P6SA 1RKJA 2J6TA 5F0WA 1DLOB 4DV7F 4DLGA 2NLWA 3I0RA 3HO1A 1NRKA 3DOMA 3QWPA 4I4BA 2J0XA 2IAJB 4J9OA 3KLGA 1C0UA 3RRKA 2Z0GA 3MMBB 1M5HA 1URNA 1N0VC 2YNGA 4RW9A 1SL0A 2VG5B 3MAHA 4A8OA 1RT6A 1T94A 3R1LA 2HPUA 2HVHA 3NCQA 3U1NA 1A6LA 2DO4A 4PXCA 4H54A 2KFZA 2J9EA 2B5JB 2D3OR 4MYTA 2XNQA 2C2DA 3I82A 1XBWA 1NZAA 2NS1B 4R8UA 4ZPBA 4R0EA 2HWIA 2AP6A 3A1YG 4TNOA 2YX1A 5EX3A 3SSRA 2IMWP 3T1AA 4YB6A 2O3DA 1NH7A 2XCAA 2B9YA 4QPTA 2PD1A 1BQMA 1TV6B 4RW4B 3L09A 4F8RA 4QR1A 2Q6CA 4ID8A 2LQJA 1WHVA 4O4GA 2IBOA 4CCHA 1ZOTA 1P1LA 1ZM4A 2QA1A 3OPKA 4YQWA 2EG2A 2CPFA 1H6KX 4I2QB 3CMES 5HL7Q 2W9BB 3J81Y 2ZJRQ 4C2MA 3G6XA 1JLEB 3CDAA 1Q16B 1S1VA 5IT0A 1X4EA 4DLEA 3CE8A 3GG1A 5K8NA 5B0BA 4B9UA 3QIPA 3LP2A 2BE2B 3M9OB 4I2PA 2IJFA 4YB1P 3MM5B 3L95X 5D3GA 3BQ2A 1MW7A 5DGAA 2AD9A 1HI0P 2CKWA 2W4CA 1FRLA 4NLSA 4UW2A 4NYZA 2J76E 3FSXA 4KE5A 4R25A 3FZBA 4UUXA 4Q43A 4YEAA 5F8IA 1R8CA 1REVB 2LYVA 5KFLA 1Q8LA 3OSNA 1GNKA 1S6OA 2JSXA 3UQSA 4MIAA 3P96A 4DR7F 2E1CA 4A8FA 5HMZA 1CQNA 5LJ5Y 5CZXA 1F2GA 2FHJD 5KOWA 5J2QB 3WX4A 1N0UA 3UCUP 3G6ES 3JSBA 3H2LA 4PWDA 3I0RB 4E0DA 2RQCA 1N32F 2LQ9A 3BB5A 1HWUA 1X4FA 2MSSA 5DDOC 4FXWA 5HMXA 4C11A 2OFGX 5D4LA 1FJ7A 4JI5F 4RW9B 4RU2A 3IG1A 4LF7F 4F4KA 4HKQA 2IM1A 1RT6B 3QLHA 2FLNA 4XDCA 4HT5A 1T02A 3UNGC 1LFPA 2BRLA 3NWGA 2WSFC 4KC5A 2BR0A 2DRBA 4DSJA 3TA0A 2C3UA 2VH7A 5HN0A 4ES2A 2CZVC 5LT5A 4TQSA 3PW7A 3D0GE 4IRDA 4IO9Q 1UW4A 1AUDA 1DARA 1HPZA 1SB6A 4TU8A 4B9MA 3KLHA 3FSYA 4A8WA 5DO2A 2CRLA 4DL5A 1VRUA 2OD4A 2ZKTA 3DLGA 2AU0A 3K5OA 2EC0A 1P9QC 4J37A 1W2IA 2HS4A 3SFGA 1IKXA 1RT5A 4O4GB 4K4WA 2IVFB 2NQPA 1C1CB 2LDIA 4ED7A 2LXFA 5KT3A 4A8QA 3R5CA 3DN9A 4F4ZA 4UY8T 2BJEA 1Q7LB 3RW7A 2EFNA 4HEA9 3KG0A 1NKBA 1IJEB 1S1VB 1VBZA 3ZZPA 1R8HA 5JXSA 3MMCA 1M5SA 4NLPA 5F8HA 2MQLA 2R7WA 4I68A 3FSIA 2R8IA 1HYSA 1X4BA 2APOA 2E1MC 5D3GB 2YY3A 3DGPA 4TXSA 2MQMA 3K58A 4ZPCA 2HRUA 1Q4RA 2XG8A 1H98A 2A1BA 3SMZA 1Z2LA 3T5KA 2HS0A 2KH9A 4UY85 1JXEA 3QO9A 4C8KA 2VQEF 2PT0A 1NK5A 1KLMA 5J2PA 1DRZA 2GMLA 3CVKA 3O2IA 2U1AA 3HHDA 1YJRA