5F0WA

Crystal structure of human copper homeostatic proteins atox1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Structure of tetrasilver bound to human copper homeostatic proteins atox1 at 1.7 Angstroms resolution
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5f0wA00
3QGPA 2FHMA 3CJKA 2KYZA 3WDOA 2GGPA 1FVSA 2AW0A 3LGNA 2K1RB 1FE0A 2QIFA 2OD4A 5A6PA 2OP5A 3BN7A 3KG0A 4HI2A 2KT2A 3E8OA 1SB6A 1Y3JA 3T9NA 3VTIA 2EW9A 5T7LB 3QMQA 2XMWA 2XMJA 3TOQA 4DL0C 4EFAC 3BDEA 1KVIA 1FVQA 2KKHA 3BF4A 1U7LA 2GA7A 1YJVA 2XMTA 4OJHA 5B0CA 2QLXA 3TNVA 2BJDA 2BYCA 1Y3KA 4Y2KA 2N7YA 4HL9A 1V3ZA 2BBEA 1WD6A 2LQBA 3HF5A 2HQIA 1VQYA 4YEAA 3F44A 2XMKA 4ZOSA 2N4CA 2IFXA 3HFKA 3FGVA 1OPZA 1OSDA 4DN9A 3HHLD 1Y9OA 1Q8BA 1FE4A 2XMVA 4OJ3A 1R6YA 1CPZA 4OJGA 3MZIA 1OQ6A 3GZ7A 1SI9A 2OD6A 3BGUA 2QLWA 2LDIA 4A46A 2ZDPA 3BR8A 3HHLB 3MCSA 3I9ZA 4OJ1A 2K1RA 1CC7A 2ASYA 1YRXA 2GFFA 1MWZA 3UDCA 3KNGA 1APSA 4HI1A 2RILA 2HFNA 4YDXA 2XMUA 2OFHX 2HFOA 3BM7A 4F67A 4DPOA 2W4DA 1TR0A 1X8DA 2QYCA 1Q4RA 1JK9B 2RU9A 3BB5A 3FRYA 4NL5A 3CJKB 1W2IA 2FIUA 2K7JA 3IWXA 2AJ0A 2ROGA 2PD1A 2GV1A 2ACYA 2BJEA 2JDJA 2W4CA 1N5TA 1YG0A 1CC8A 3DCAA 5KAKA 1FEEA 2RSQA 3KG1A 1AFIA 2N4DA 1Q53A 1GXUA 2HIQA 4Q2LA 1S6OA 1URRA 2GCFA 2OMOA 3LO3A 3DXSX 5IXUA 1MWYA 5F0UA 4Y2IA 1TL5A 1RJJA 3HDSA 2OFGX 5B0GA 1FD8A 1N5QA 2G9OA 3KKFA 5B08A 2K2PA 5K9FA 2HLTA 5B0FA 4A47A 5A6WA 5T7LA 1YJTA 1GXTA 2KT3A 2VH7A 4HH0A 4Y2MA 2ROEA 2BUNA 2OKQA 3IWLA 1TUVA 2GGPB 2LXFA 3TRGA 1YJUA 1XBWA 5B0DA 2W4PA 2XMMA 2HLUA 2K7KA 2ROPA 1QUPA 1KVJA 1K0VA 4HH1A 1SQEA 2CRLA 2VV5A 4U9RA 2L3MA 1AFJA 1N5VA 1P6TA 1IUJA 2FB0A 2PGCA 3FMBA 2FTRA 1FESA 2LQ9A 5B0BA 5B09A 1ULRA 1Q8LA 2IYIA 4FNIA 1AW0A 1TZ0A 5F0WA 1JWWA 4Q2MA 4NPOA 5B0AA 1TL4A 3K7RA 1Y0HA 2Q3PA 1YJRA 5B0EA 1KQKA 4A4JA 1X0PA 1S6UA 3HHLA 2AP6A 2ZDOA 3LGMA 4FNHA 4QOTA 1X7VA 1OQ3A 1LQ9A 4A48A 3HX9A 1P8GA 2GO8A 4OIXA 3HHLC 1N5SA 4ZA1A 2OAUA 2RMLA 1VQSA 2AJ1A 2IYGA
chains in the Genus database with same CATH superfamily
4MKAA 1O5JA 3SV3A 4ED0A 3V4MA 5THWA 4LF4J 3VTIA 2IA0A 4UQTA 3TEHB 1IBLJ 3MPWA 1RQ0A 2W2QP 4KE5A 2VZ9A 3TNVA 3HM9A 1RB0A 2VC1A 3Q89A 1ZA2B 4NXMF 3ZXWA 2P9GA 3IC1A 2HHHJ 1FNXH 3CIZA 2HK2A 1RDRA 2IPOB 1XMOF 1KBRA 4DV4F 3FQKA 4DZDA 2JH3A 3PCOB 3QJLA 1JK9B 4L72B 1RU2A 1PJ5A 3KG1A 3KK2A 4EBCA 3QLHA 2VFVA 1KONA 3UD5A 4NLWA 1U2RA 4ZLLA 2J9EA 5M2UA 3ITHB 2VH7A 1FI4A 2KRBA 2XMMA 2HLUA 3ILOA 4DQRA 3H5SA 1VRUB 4ETXA 2GZOA 4P52A 1NSQA 4I1TA 4DMZA 4F4XA 2ZKTA 1VRTA 3FEXB 4NWBA 4H54A 3MOJB 2PT0A 3AOCA 1HHTP 3DLHA 1D1UA 1PG5B 4OFZA 4DPTA 3T9NA 1QAXA 3C15B 4LF8J 3KOAA 1NM2A 5KFUA 5B0CA 4OJHA 3OVBA 4PQUA 4Y2KA 3O44A 4J9VA 2WOMB 4QR2A 4DR5J 1F5BA 3FGVA 1I5OB 2ILYA 1MN9A 3BO2A 4KIAA 1RBLA 3OR2A 4AXJA 4P73A 3OTOF 1FX4A 1QUVA 1T02A 2LEPA 1RAGB 3UD4P 2HVIA 4YHHF 2W4CA 3LTOA 3CDWA 1I94F 3CC4S 1EQMA 4HACB 1GX5A 2FVQA 4ZMMA 2RRNA 4JV2A 1R8PA 2EG2A 1P27B 4C8KA 4TU7A 4ES2A 1FKOB 5A0YB 1NH8A 2E7XA 3VZIA 4PAAA 1GT8A 3HT0A 4A48A 1U8SA 3ILLA 2RMLA 1RHKB 1NB7A 2CPHA 2GGPA 3PTWA 5KFWA 1K1QA 5FLXU 3MCNA 1Q7LB 1M5KC 1VCTA 5KTQA 3RAXA 1L5UA 3FBFA 1RT4B 1RAJA 2MYFA 1DZ5A 3HFKA 1A7GE 3G6YA 1T9XA 4UY8T 2XO6A 4RUCA 2JEGA 3KYLA 5EHHA 4ZPWR 1NJWA 4YB1P 5C24A 1S57A 3J7A1 4ED5A 2D69A 2HFSA 4DSEA 1U24A 5IXUA 2DNLA 1FFWB 4LF7J 4KT0C 3R5AA 2AV5A 3CT9A 2AIRB 3A3NB 2IMWP 1VHIA 4RW4B 2CPYA 2E5LF 3NCPA 3MHYA 4AQYF 4C97A 4B3MJ 2HNDB 4X4TA 2DYAA 3TX8A 2AQ4A 1XC9A 2MSSA 3DDKA 2Z57B 3PR5B 5J1NA 2XLJA 4FVCA 3PW2A 1BLUA 1J27A 3K5MA 1RI7A 4PWDB 5GADI 3FBBA 3OFEA 3CDEA 1FNOA 1SI9A 4TYBA 1GNKA 2YWKA 3HHLB 4NA3A 3JAMY 4B9VA 2M52A 2XMUA 4W92B 1FXLA 1BQXA 3THTA 1L3VA 3M8YA 3JSMA 3G4SS 3ZTSA 4DR2F 4KHPF 2VPZB 2Z0GA 4QCLA 4GRSA 3ENVA 4HEA9 1X4EA 4N7TA 4Y2IA 1KLMB 2EFVA 2PSZA 4MIAA 1MROA 4JI1J 2ZH6A 3AAWB 2BVZA 1XBWA 3RJMB 2W4PA 3H25A 2MKJA 2HNYA 4MYUA 5F8LA 2BR0A 4OHZA 1FWPA 3T5KA 2OGUA 1S9EB 1V6HA 1NK9A 2ZBIA 1FEHA 1C0TA 3DMJB 4OHYA 3QIPB 4WK3A 1WC1A 3Q8RB 4MFBA 4K5SA 2ADCA 3X3UA 4WYLA 5K8NA 1NU4A 2W2NP 3N4WA 2XS2A 5KFFA 2FVCA 3IS9A 1N54B 3GONA 2VQEF 2CPZA 3BH7B 2KG1A 3QRRA 3TUPA 3UW1A 4CH1A 3BGUA 2W9BA 1UWBA 2BDPA 2VU5A 4DR3J 5KFGA 4UQGA 1T05B 4CTAA 4OV6A 3DHXA 2L08A 2VFSA 5I3PA 5IT9Y 4HYKA 2NXUA 2GIQA 4I4BA 5ETNA 3EVWA 2UUCJ 4E0DA 1K0TA 1SBRA 3KJNB 2VKRA 1ICEB 4FBUA 4DR1J 1ZH5A 3M8PA 3N6LA 5T41A 3W2VB 3PO4A 1PJ7A 4BWJA 5KFMA 3FMBA 5F3ZA 2BQUA 2DCUB 3CJ4A 2EBGA 1UVLA 1Q1KA 3Q0AA 2BW2A 4OZLA 2WSEC 3ZZOA 2DKOB 3K59A 3IR5B 4LQ3A 3CJRA 3CCRS 4HI2A 2MQNA 2V34A 4M5KA 2EC2A 1JLBB 3RBZA 4LBIA 2MKSA 2XWXA 1HW9A 4MK8A 3EYZA 1J5EJ 4J9LA 5EX3A 3KG4A 2BJ1A 4F04B 3QSIA 3LUYA 3DLLQ 1LW2A 2MZQA 3KJQB 1LWCB 3AA8A 2KZMA 1N5TA 3A4TA 4R0EA 4NCGA 3R2CJ 4O3NA 1DQ9A 1WEYA 5B0GA 4EUVA 4LVNP 4CO5A 1EETA 1LW0A 4B08A 1H3DA 3BQ1A 3DLKB 3D6FB 2DGSA 2CPIA 4DLEA 4M5LA 1MU2A 1FRKA 3H5UA 1OMSA 2EC0A 1JB0C 3L7UA 3IBCB 5HO4A 4H4KC 5B09A 3GJRB 4B3OA 3BGLA 2MGZA 3KK3A 4J9MA 3CTRA 1P1TA 1EKRA 1RTJB 1FHTA 2DR8A 3K58A 4F3OA 2ZEJA 1UPPA 1VBXA 3M32A 3TUZC 2HVDA 1VR6A 2A3JA 4Y6IA 4WWSA 4USTA 2ADBA 2YKMA 2XCAA 2ZHOA 3DM2B 4I68A 2FHJD 5EX0A 2FGCA 5FDLB 5G0RB 4JV5J 3B78A 2QC3A 1DY3A 3BGRB 1SJFA 2LU2A 3I9ZA 3LANA 2CVIA 3SV4A 2W8KA 4TNOA 2N3OA 3PYDA 1H7XA 2RU9A 2DRDA 2FY8A 4ZPVR 3QSYB 1V5IB 3R5CA 2FHKA 2C42A 4HT7A 4V19J 1PC5A 3TQ1A 4B3RJ 2M8DB 4EWTA 1W7WA 3WIUA 5GMKa 3KJFB 3LP1A 1XMBA 2JEFA 2KHDA 2LXFA 1RAEB 1MWQA 2CNLB 2LA4A 4WFNQ 1PYOB 1N33J 1JWWA 4YUDA 2YWEA 3I87A 3TAMB 1SKWA 1XERA 3K7RA 2ZM6F 5BJRA 1UFLA 1HHSA 4FDFA 2DK2A 3QLHB 4TQSA 3ET6B 4DR7J 2MLYA 1QD1A 1RLCL 1QAJA 5KOXA 1RTHA 1XNRJ 2QLXA 3WZ0A 2MSTA 1S7IA 4CLFA 3F73A 3PYGA 4LRCA 4NXNJ 3FMWA 1IQZA 3GFZA 4PPZA 1Q86T 2Q66A 4MJKA 2QLWA 2WHOA 1DQ8A 4PG8A 2LKZA 3FC9A 4C8OA 3C6UA 2D9OA 4JI0F 3DOLA 3V6DB 1PAUB 1MNEA 1U6ZA 2XSJA 5GAGI 1CLFA 2CPDA 2QA1A 5HQ8A 3SCIE 1N56A 2V9KA 3EM1A 5KFXA 5KG1A 4CNZA 4DF8A 4C4WA 5KOWA 1VK8A 2ZH1A 1YJUA 1SJRA 4TYAA 2V2KA 3DDNA 1Q82T 4NLVA 3H40A 2RHSB 4FN5A 2WONA 3GIJA 3SCLE 5HQLA 4MYTA 4N47A 1S9GA 2HNZA 2VBZA 3AA9A 3NKYA 2HK3A 3GYNA 3OQ2A 2RUGA 4RU2A 1RAIB 4NLQA 4YMEA 2CQIA 4TKTA 4FS1A 1S5ZA 3LGHA 1YKWA 2HGMA 1WG4A 3NMRA 2DR7A 2DO4A 4YEAA 3IRXA 2H5IB 3OL6A 4DU7A 1NHKL 5EGYA 2HS0A 1XMQJ 1B0VA 4DCOB 1I51B 1KR4A 4WP9A 2W01A 3BM7A 5SUHA 1KTVA 4CLSA 2P2CB 1QTNB 4WIQA 1SJ4P 2DO0A 2OMOA 4UOCA 4DPUA 2HAFA 2FHOB 2BANA 2HQGA 4CLTA 3AJDA 5CYMB 1X4BA 1RT6B 1RADB 3C16B 5E5NA 3R6GB 4J37A 5AXKA 2GVZA 5DG8A 4FBTA 1X0FA 2PA3A 3I0SA 3V2UC 5AXNA 2F4VF 1S0VA 1ZAXA 1R3NA 3QWUA 1SCJB 2FHMA 2KYZA 2DXFA 3IA0A 4ALZA 3K17A 3MM5A 4OYOA 2IRUA 1YHQS 5IC4B 3C14A 3F44A 3FNNA 1OPZA 2FVSA 2VQFF 3VQTA 5AJ3J 4FYXB 1Z1ZA 1GK8A 1TFYA 4FP9A 1S1XA 2Y0SD 5C2GA 5JXSA 4RW9A 5HANA 1S12A 1S79A 1HNZF 5KAKA 1BQNA 3QT5A 3HD2A 1GMWD 4QIWD 2HHXA 2V69A 3P49B 2DXDA 3Q8PB 4AYBD 3THVA 3NGUA 4DHVA 1JKHA 1SVDA 5L8RC 1SQEA 1Z2ZA 5KFZA 1QDUB 3HHEA 3MPDA 4LF6J 4ZP7A 2IDLA 3V4IA 2DGVA 4AUKA 2NXCA 2R3VA 2ZH3A 1YBTA 4IG0A 1FK9B 4TY8A 3MR5A 5CCLA 5AT1B 2N82B 2CJKA 3MM8A 4GC6A 2WTFA 4LF9F 2BRKA 2HNYB 2EKNA 3SEOA 5KFBA 2VIHA 4OYBA 2GAGC 4FYVB 2P9EA 1DTTB 1IKVA 1NK5A 4WZMA 4K0KF 2DPIA 1S97A 4PG6A 5C42A 1HNVA 4MFBB 1E6YA 3LWMA 3ZZ0A 3JQKA 2VODA 3AODA 5CAAA 3IS9B 2VKZG 5IOLA 4Q44A 2C2KB 4LF1A 3HT3A 2HQDA 2JC1A 3NGDA 1UVNA 4DX5A 3I82A 1NZAA 5J2PA 4CTAB 3K0JA 2FLPA 1YJRA 2GO8A 3HHLC 4GO7X 4Y0FA 1Q5YA 1TVRA 2XY7A 2AYMA 1RWXB 3CCMS 2HHWA 2RB7A 1SL0A 4U7CA 2HWIA 3VVUA 1RU1A 1RTDA 3T1AA 2M5YA 4LIRA 3CCLS 1X9MA 3CCES 4ED4A 3DI6B 1RAHB 2IFXA 3SI8A 1AA1B 1TK8A 1WORA 2I0XA 4F7VA 1QTMA 2RUSA 4XO0A 2YH0A 3BR8A 2K1RA 1WHXA 5CD4A 2RILA 1M1GA 2DR6A 3L9ZA 2HFOA 3KLIB 4TVAB 3WX4A 2WZ1A 1FO1A 3BS9A 1L3TA 4NLSA 4KGVB 3PKMA 4KPYA 2J0WA 3VAMA 1MWYA 2DRAA 2CQ0A 2VUGA 2ZWOA 2BKPA 3PY8A 3T1YF 2AT1B 3JAMU 5I3UA 1TKTA 2YKOA 3VHQA 4DCJB 1IJFB 3DYAB 1VS3A 3T5LA 2VG5B 4UT4A 1EETB 3QIDA 1PIEA 1ZM3A 3H90A 2JHEA 4PXEA 2NYHA 4LF5F 2CDQA 4IO1A 1MU2B 3OL9A 4LFBJ 5KFHA 1T3OA 2BBEA 2VDIA 1ZM9A 3L7OA 3UE2A 4DX6A 4B3OB 3KK3B 2GX8A 5HI7A 3HVAA 4OZ5A 4QWDA 4HTJA 1WI8A 3P6YC 4DPOA 4OYXA 2CQHA 1FCAA 4LF4F 4ZVUB 4LJMA 2GW8A 4RNHA 2OH2A 1DFDA 4F4WA 1YRTA 4O0IA 2G13A 4C3KA 2X7IA 1VQPS 3MWBA 4B3SJ 4Y2MA 2VJUA 1JLAA 3TJAA 1IWAA 1VQKS 1BC6A 3AB4B 1IBMF 2EK1A 4JYAF 3KWMA 1R0BG 1HR0F 4DV6F 5EWEA 4WP8A 3LP2B 4GO5X 5IT9U 2B9XA 2BE7D 2GQQA 2L41A 2J7KA 2V8PA 2LLZA 3ENQA 1LEOA 2FDNA 2YKAA 4DV7J 1R7IA 2RH3A 4WIIA 4P6QA 3LP1B 2WW4A 1IQTA 2ERRA 2BQRA 1YVFA 3QO9B 2MQPA 1ZYQA 4HL9A 4HHHA 3GFYA 3K57A 2AYGA 3TJ8A 4JI6J 3VAHA 4TQRA 2VOOA 3ZFVA 3EPIA 1G1XA 3UDCA 2YH1A 4ILMA 3D6MB 3VGTA 2RQ4A 2MQQA 2DR5A 3GWCA 4LF8F 5CZVA 2KDOA 4A8XA 1FRJA 4L74A 2QX0A 3W60A 1AFIA 2J5AA 3PYFA 1RTHB 4JI5F 2ZOFA 4DR5F 1EP4A 2MMYA 5KFVA 3MCMA 4BHQA 3GFHA 4DL6A 3MAQA 1KSPA 1JLFA 1QSYA 4NZ0A 3GV7B 4GMKA 2WK4A 3ZTRA 2LVWA 3OTEA 3PX0A 2XCPA 3BEGB 2RQMA 3DOLB 2LQJA 1O8BA 4FKYA 3W65A 2ATCB 2XSJB 5C2CA 1ITPA 1KD1T 4BWMA 3W66A 2AEJA 4K4SA 3THPA 3VAIA 2KKHA 2M88A 3QGHA 2V8VA 1JLQA 1VC5A 1X4CA 3M2UA 3R9LA 3EXCX 3MEDB 1OIAA 2IAJA 2QE5A 1YZ6A 5HAOA 4UY85 2OEJA 4OZ0A 2FYXA 1RP5A 2WONB 2RQKA 2DNMA 1AZSB 1S9GB 1HYSA 3RB0A 1AXQA 1ZS6A 4DF4A 2CZ9A 2W4DA 3W9HA 5IT4A 2Z2YB 1TU0B 2XHWA 3G96A 3W64A 4PQAA 1GEHA 1JMTA 3MD3A 1NNDA 2AHOB 4E98A 2XG8A 2R7VA 3IRXB 4ES1A 1TELA 1N32F 1B7YB 1D3WA 3BN4A 3S1TA 3ZNUA 5HVHA 1HNXJ 3J7YI 1S48A 2D3O1 5LSRA 4OI2A 2HHUA 1HBMA 1CVJA 3K5PA 4QOTA 3PACA 3AJ1A 2XS5A 2ZH8A 3DGVA 1JXEA 3ZTPA 3EZOA 3IAM9 4DX7A 2C2DA 2K8GA 2CNOB 2BANB 1GX6A 4DZ6A 4X4SA 4LF7F 3VGVA 4G3IA 1JXLA 5J2QA 1G4CA 1IM4A 2IBOA 3ETOA 1F3VA 2HFZA 5HJYA 3EICA 1H72C 3GIKA 4RUAA 2BA9A 4ZK7M 4QYZJ 2DH9A 5KFEA 2GS8A 3I0SB 3TVZA 1FFSB 4GKJJ 4HKQA 4JB8B 2O1PA 1FXRA 2LECA 3MM5B 2V4JA 1FDBA 4LQ9A 2W2MP 3M9NB 3RYLA 1EHWA 1I1GA 1RJJA 5D78A 3C14B 2ZH5A 4J7CA 2BJ3A 4IR1A 3NNAA 3W7BA 4K2XA 3HFVA 4YP3A 3OV7A 1V3SA 1X5PA 4OHWA 3V6JA 1NEEA 1C0UA 1ULRA 5E3CA 2MZJA 1Q8IA 1S1XB 1SH2A 2GC8A 1FTRA 3P4UB 1HD1A 1BQNB 3QGPA 3KTQA 2MPUA 2UXDJ 2ABYA 3H2VE 5E3RA 1GTEA 1N34J 3C6TA 4AXIA 2M9KA 2AWZA 3L09A 4ID5A 2YX7A 2DHGA 1A6LA 1JKHB 1KQSR 2FJBB 2MY7A 2E5JA 5KG6A 2RQCA 3FK4A 4EBEA 2CWXA 4FXWA 2EBEA 4R25A 3CD0A 3KLHA 2V6AA 3D9BA 1WF1A 3V4IB 4DU8A 4S0MA 4P2SA 4N5SA 4IH7A 2KVIA 3UPFA 4FPRA 3QRQA 1S72S 3QFHA 4JI4F 4IG0B 1C1CA 4TY8B 4HHJA 5LJ3Y 1SJ3P 2WVBA 3GJQB 2R8KA 4ZHRB 5D3GB 3BR9A 3DRPB 3MM8B 1WJ9A 1NUEA 2G9OA 2YBVA 2UXCJ 1FRLA 1YJTA 1HNIB 1SC6A 1NPKA 2XLIA 4O3PA 1AB8A 2VHGA 3BPDA 1K0VA 2FJWA 3EGVA 2VOPA 4ECSA 1RACB 4F4KA 4FNIA 2AJFE 1XR5A 4NI2A 2W25A 5C42B 1HNVB 2DGOA 3LA0A 1Z4UA 3C66A 5BR8J 3GU0A 2G4BA 3M2VA 4DV1F 4I67A 5D0HA 3W63A 3KG0A 1NSPA 2NXJA 4CDIA 3M8RA 4DQPA 3KK1A 3R1LA 2MKHA 3D54A 2HMIB 1Y9OA 1Q7YT 3NEKA 2Y1LB 4N8OA 4ETZA 2PI5A 1H2VZ 4ECUA 1TVRB 3DGPB 4Y00A 4NLYA 3ENWA 1W2IA 4YY3J 5D4PA 1WG5A 1RTDB 5H1SV 5K8PA 2AEMA 2I8EA 4KH1B 1OO0B 1TL3A 4A8WA 2RF2A 3OR1A 3E2EA 3GJSB 3FUYA 4J9RA 3MM9B 3CEDA 5KG0A 1A0OB 3LAMA 2CQ2A 4D3GA 1JXVA 3U27A 2HAIA 2VFTA 4ZITA 2AJ1A 1YITS 3M6XA 2WVDA 3GTYX 2CQ3A 3QWPA 4OI6A 3T5HA 3I96A 1FWLA 2VPWB 3BO4A 4OI3A 3D28A 1OYDA 3FJ2A 1PKUA 2CA9A 1LFPA 2WCXA 2CQDA 4K4TA 2OPRA 2F9JA 3WC0A 2OIHA 3DRRA 3HULA 3IR7B 1CQMA 4B9MA 3NXZA 2XWYA 1FWKA 3R1HA 4X66J 1FD8A 2HW3A 4JV5F 3J80Y 4HLBA 1F3FA 3D1OA 4JI8J 4ECWA 3FBEA 5J1EA 3NLCA 1M0SA 2FGOA 1W25A 1M5PC 3I55S 3V5RA 5B0BA 4CO3A 3NOCA 2DEJA 5K14A 2LDYA 4USJC 2EFQA 2VB6A 1OJ4A 4KY3A 3UNGC 4DG1A 3I4HX 4F50A 4C48A 2XS7A 1HI0P 4OZJA 1SH0A 1BY9A 5DDQC 4WTYA 2R2RA 1JLAB 4EI2A 3H5XA 2BYCA 4N56A 4WTOB 4NYPA 1V3RA 5DETA 3BGOP 4P72A 2CWKA 3DXBA 1ZPWX 2K06A 2CZ4A 1BWVA 2O5DA 2AD9A 4CH7A 4C3LA 4HT5A 4UUWA 2VG6A 1N0VC 4IOAQ 3D1HA 3PVXA 1RCOB 4DR7F 3J7ZT 5KFJA 3KLVA 2MHEA 1SKUB 1YLXA 1SC3B 4NLPA 2C2NA 2XEXA 3ZO7A 2ZHAA 4DUZJ 4I2PA 2CKWA 1XNRF 3HDSA 4DSLA 3R7BB 2BKOA 4RNOA 1N36F 5AE1A 2F9DA 5LSOA 1RBAA 2ZBCA 2WB1D 3AFGA 3BBCA 4FYYB 1S76D 2I1RA 4QU6A 3MEEA 2CZVC 3NG8A 4FNHA 2QJ3A 1F5AA 3Q22A 3J7AN 4J9QA 4J9OA 1S1WB 4DV3J 2YNGA 1FTCA 1JLFB 5E3AA 3L7PA 4DSIA 1WD6A 2YXLA 1FF2A 4DJBA 4PG4A 3G6XA 5L9NA 4ER8A 1RT2B 2PO4A 5F8JA 4IG3B 4DV2J 3TZWA 3HZGA 3CJSA 3RAQA 4IDKA 3J7YU 1UWAA 1Y4ZB 2ACYA 1FKAF 5M2PA 4XTTA 1JLQB 5DDPC 3M2UB 2C3MA 3GYGA 3WHIA 2IAJB 2CQ1A 2DJWA 1KN6A 1PAEX 1XMQF 5D4LA 1KS2A 1W26A 4DL2A 2PGCA 1RWPB 5D77A 1JJCB 2IMOA 1VGYA 3TZXA 1X31C 4MT1A 4KTQA 2UU9J 1TFWA 3ITHA 3D66A 4ZVFA 3M7VA 3N5BA 1X4HA 4QQBA 4X2BA 2HG4A 4LSNB 1U1LA 2ASDA 2ZBPA 3PXGa 3GCWP 1U7LA 5DQIA 3NAIA 1GXLA 4O3SA 1Y00A 5DQHA 1UA1A 1J2VA 4UOHA 3FVYA 2DISA 2UUBJ 2DIVA 2V4RA 3UWTA 1HBMB 3KLEA 2X1GA 3DDIA 3M30B 1EB0A 4ZLNA 5ETLA 1U0HA 3BSCA 2XC9A 2RDIA 2RRBA 2OFHX 2W7PA 2GMJA 2KM8C 1LNQA 3FBCA 4U67Q 2KL8A 2WOMA 3WX8A 1UVJA 2KFNA 1WWHA 1F9FA 2RSQA 5J2QB 4CLZA 4Z7YA 2OFGX 4Y2AA 2O3DA 1NLKL 3JSBA 3HHKA 3M05A 5LL6d 3ILIA 4OYPA 4YDDB 5M2RA 3UR0A 5JMNA 4QYZK 1H98A 2V2QA 4HH0A 1UVKA 2BUNA 1Q0NA 4U8VA 1KNZA 1NJIT 4U9RA 3QGGA 2D3UA 2FZGB 1VJWA 1TZ0A 4M63A 2Z56B 1CJTB 3M2RB 2QG9B 3GFXA 4X4QA 2Q79A 1LQ9A 4HACA 1K1SA 1VOMA 5DG7A 1HW8A 4N8NA 2CVEA 2J0XA 2UZAA 4DV0J 2PE8A 4OV1A 2FJAB 4MKBA 4O3QA 4XDCA 4DN0A 3M8WA 5A0YA 1FRHA 4WE1A 2IVMA 3R6LB 4KC5A 1HWKA 2UUWA 2XMKA 2NLWA 1C0UB 3DRYA 4LFCJ 4NA2A 4HDGA 3W9JA 1IN0A 1Y5NB 3TVKA 2WVEA 1X4GA 1VQ9S 3BB5A 1YBUA 3CMQA 2BQ3A 1AUDA 3NP5A 2F8EX 4ID5B 3EE3A 1T11A 1U26A 2V94A 4OZNA 1N5QA 1M90T 2CPXA 3QT7A 3VQSA 5ITHA 2VPYB 1Y10A 1NDCA 3D3BJ 2C2OB 3LF0A 5HROA 2V8GA 2YX4A 1E6VA 3KLHB 2JRSA 1UJ5A 3TR5A 2FVPA 3IWNC 2CRLA 1JLEA 1P6TA 1TKDA 2UUAF 4ECTA 1HNWJ 4OYMA 4LMZA 4P75A 5KG5A 3RGIA 4WFBQ 1X0PA 4PG7A 1ZZFA 4TY9A 5L1KA 2AU0A 2OTJS 3CJKA 3H7HB 4I6WA 4Q7AA 2P9CA 3CJ5A 3VVTA 4J9NA 4KR0B 2RKIA 4ZN1A 2F4FA 5JJBA 4Y3CA 4CLWA 1KQGB 3KJVA 4P2MA 3EZ5A 4ZS6A 2ZHBA 4NI2B 4QZVB 4F2SA 3UD3P 2IRYA 3R3TA 2D41A 4CP5A 1DAXA 2HIYA 3D0GE 3M2VB 3LOUA 2ZZNA 4QPXA 3MEGB 3WIVA 5HMXA 2GV1A 2F8HA 3D67A 1FEEA 1QY7A 4PWDA 2BMBA 2H9ZA 2OO4A 4KO0B 2K2PA 4ZCLA 3ETMA 1T95A 2WBMA 5KFNA 2E1PA 4ZCKA 1IVZA 4OX9J 2M7SA 2B8PA 8ATCB 3HSDA 2QL9B 5K8MA 4DOZA 8RUCA 2BV3A 1KLMA 4B3TJ 5C5JA 2OAUA 3NBPA 3L4BC 1JJ4A 4AT1B 5KG4A 3LWLA 1TL3B 4ELTA 4ZKAA 1R8CA 3NNCA 1U47A 1SV5A 2C3OA 4YB6A 3QMQA 1K9MT 3VAJA 2DVIA 2RF2B 3OXLA 5DZ7A 2AX1A 2N7YA 4ZJOA 5MLCV 2LQBA 1X9WA 2JSXA 4ICLA 4OQJA 4XDDA 1IKYA 1WKKA 1U1OA 3A8JA 3ISND 2HS4A 1C4CA 1DARA 2YWFA 4NEYA 1UZDA 2EPIA 3JXOA 2YQ0A 1NSKL 1X4AA 1D8ZA 3G71S 2YKNB 1EIYB 4FF2A 1T05A 3JB9k 1FJGJ 4EYHB 3DHWC 4PPDA 2ZH2A 2OPRB 4DXLA 1WKLA 4YFUA 5A76A 1KP6A 1DURA 2V0NA 4C2MA 3CC2S 1H6KX 1H38A 3MUMP 2YKPA 4ED6A 3V6HA 1RK8A 1S4FA 3PEHA 3HSJA 1RT1A 4UZBA 1LV5A 4KRWA 1U48A 4NXMJ 3TO8A 2R9LA 4L73A 3SSSA 2FHJA 2RS8A 2XY6A 2G2YA 3EUNA 2EEYA 1VQNS 5J1EB 2Y8WA 2H51B 4DV4J 4A8FA 3HVWA 2V8HA 1WOSA 4WU2A 3O1LA 3B4DA 2G2OA 2HBZB 4URGA 4ED8A 1CC7A 1CS4B 1UTAA 3MR3A 4H4MA 2LXIA 2J6TA 4NLXA 4G1QB 3PX6A 5ETQA 1T8EA 1JLBA 3IWXA 2ROGA 1PILA 4P2FA 4NLOA 4EU0A 2VBWA 2VD3A 4GKKF 4ERDA 4B17A 1WDDA 5IFMA 4I56A 1H73A 2F5GA 4DSJA 1LWCA 4HDHA 2VG6B 2HURA 1S9FA 2ASLA 5CABA 5BYRA 3CE8A 4A8YA 2R7UA 1YJ9S 2XB2D 2Q6BA 5LM7E 3D0IE 5IV3A 2QT7A 3DLKA 2C2MB 4I2PB 5F41A 2OD4A 4CLLA 1REGX 3NWRA 4EFAC 2C2EA 2MQ8A 2EI5A 2DNKA 3RZAA 4ED3A 4RNFA 7FD1A 1RTJA 3CCVS 1RLDA 4KBIA 1TKXA 2DB1A 2KT5A 4P9SA 1BQMB 3MEEB 3G6ES 3OSNA 3MUTP 4EO6A 4YHHJ 3F41A 2CJYB 3LP0A 2E5GA 5KFDA 1I94J 3DM2A 1Q78A 3IP0A 5FDLA 5LXYA 4ZJLA 3UR3C 3BGRA 2YNGB 5DS7A 2GCFA 5C7PA 2CPJA 2E5HA 3MGJA 3RTVA 2ROEA 5GMEA 3H59A 3P3DA 1RYRA 3BV8A 1LWXA 3DC2A 2D74B 3HHNB 5SZTA 2F63A 4IDKB 1VQ8S 2EKYA 4I6YA 2JVRA 2I6WA 3AXMA 4M5DB 3OHAA 3CMES 1N52B 4K4ZA 4PWUA 2R8GA 1EZZB 1CG2A 1M5SA 1OPIA 3J80U 3V81A 4C9DA 4DS4A 2PIIA 3TAMA 4C3MA 2CJQA 4I69A 1HNXF 2VA2A 1RWWB 3CC7S 3OFHA 1R6YA 3OFGA 1RABB 3ET6A 5GVQA 3VGSA 2HKEA 5RUBA 2OLWA 1KTQA 2IVYA 2QA4S 2NPIA 4QW9A 2HPUA 3C3LA 2YY3A 2FLOA 1VQOS 4F4AA 3PFOA 1F2HA 5F9LA 3KLEB 4CCHA 2ZITA 1U0HB 2KYXA 7FDRA 3V6DA 4F3QA 4IH6A 1L3UA 1SPBP 2B6AA 5AE2A 4P7VA 4RW7B 3HX9A 2NPFA 2QLFB 2KFYA 5A8WA 4LRBA 2ZH4A 4W4MA 3ZZPA 2ZVSA 3FCHA 3KUGA 1LXNA 2F3JA 3HCXA 3DKDA 5ETVA 1FT8A 3SCKE 3CWJA 2XMVA 2ZJQQ 2J8AA 4WU3A 4KAIA 4Z7CA 2PFDA 1NK0A 4EO8A 2JJ4D 4DR2J 4DR6J 4LFAF 3OTCA 4KHPJ 1S6PA 2ZH9A 2GAHC 1NHUA 2J76E 1N34F 4GVLA 4K4YA 3OLAA 2WB4A 1GMWA 2W2PP 3PYEA 1Q81T 4WE1B 3K2YA 5E7OB 1TV6B 1T9WA 1ACMB 3CJ8A 3EVOA 2DY1A 4ZPAA 5LJ5Y 1SC4B 5KFIA 2HS3A 4K50A 2W9AA 1KVJA 2P6SA 5IM0A 1AT1B 1KLNA 4LRDA 3W5XA 3D6HB 4Q2MA 4LSLA 4NRUA 1BUXA 2NCKL 3EXYA 5ETMA 5CYMA 4FXDA 3CF5Q 1RT6A 2HYIB 3RBDA 3H2LA 3BN7A 4MK9A 2VQEJ 3C16A 2UXCF 1VBZA 1XN9A 3KXDA 5E41A 4WKYA 2IY5B 5HROB 3BF4A 1YGYA 1E6VB 1FNMA 1JLEB 4QWEA 2ALZA 1QAYA 4DL3A 1WOPA 2IIHA 2QLBB 4KGMA 3BSOA 3GYXB 2B3TB 3CJKB 5DQGA 1F9EB 4RW8A 2RKIB 4EZ6A 3HZEA 1X5OA 2HBQB 4RW6A 4F4ZA 1WI6A 3KJVB 1IKXA 4NYOA 2KXFA 4PYDA 2MXYA 2FJEB 3FRZA 4LBHA 2FTRA 2EFPA 1L3SA 3MMCB 1D9AA 1U1KA 3T6JA 1N5SA 4F25A 2FJXA 5L1JA 3TA1A 1YZ7A 4ECZA 2W8LA 3MM7A 2R2SA 2DNQA 2XZDB 2X3GA 2I2YA 1S1UB 2XMJA 3BDEA 3MAHA 1S1VA 4L3NA 1R8BA 3AD8C 4FYWB 2W1BA 5ETRA 1Q8BA 5F3TA 1FK9A 3OPKA 3NBPB 1GH8A 4YDXA 4DQQA 5K20B 5J1PA 3RB6A 2R2TA 3A8KA 3QZ7A 3GLJA 4KQZA 2BRLA 1SV5B 2O66A 2AGOA 5J2MB 2ACMA 5U47A 3W2WA 3IN5A 5KFOA 5F0UA 3PRDA 3K5LA 2QSWA 1D9FA 1DTTA 8AT1B 4ICLB 1IKYB 5FIIA 2RJZA 2L9NA 2M8HA 2BACA 1HQUB 2ZJRQ 1T0TV 2H48B 3BGFA 1XR6A 3R8YA 1AYEA 5F0WA 3PIPQ 5D4NA 5B0AA 1SQFA 1V5VA 1B4SA 4DR4F 1JX4A 1S6UA 2HGLA 2CQCA 2KJWA 4DUTA 1HA1A 1UEUA 2YQ1A 3FKBA 2ZUAA 1LWFA 2M4MA 2HRTA 3K89A 4UF4A 3N01A 5D8HB 2GMLA 3TA0A 3CGIA 3PJ9A 4TLRA 2DD8S 1RAFB 4XK8C 1YRXA 3BSNA 1NZ8A 1OSCA 1Q79A 4DLGA 1RT1B 4ZVEA 4USVA 1RYSA 1F2GA 3ILJA 2RDJA 4DX8H 3MUVP 3DI6A 4JI7J 1S6QA 3LAKA 2A1BA 1X5TA 3OT9A 4ES3A 3RR7A 2HHQA 1N0UA 2A10A 2W7OA 3FSXA 3NCQA 3CO0P 2BM1A 2UXBJ 3C19A 1QVFR 3KLIA 2DBBA 2UVRA 4Q43A 2BJ7A 5F8GA 2B9WA 4H4MB 1TL1B 4ITSA 2CQPA 1VLOA 1NK4A 3LGMA 1S0OA 4NZ6A 4DUZF 2B4UA 1R43A 3GSDA 3ZZYA 2GJIA 1FVSA 1WC4A 1KHVA 2LFVA 3R2DJ 3CPWR 1B0PA 2UVUA 2Z30B 2J7WA 2MZ1A 4USKA 4M95A 4Q45A 5EUHA 1VI7A 3GPAA 4URSA 5LXRA 3DYAA 4ZCIA 3RW7A 4CT8A 2VG5A 2V8DA 1MWZA 2ZNYA 1WNEA 1WC0A 4J9PA 4CH0S 3PEJA 4DFJA 1QAIA 4OLOA 4ATNA 4Z37A 4MKYA 3CMAS 4AL5A 3NY0A 1JNRB 2SXLA 1SUQB 1CJUA 1UJ4A 4K8RA 1TKXB 3KUHA 2U2FA 5F9NA 3KHLA 4X4UA 2XI3A 1VC0A 2MQOA 3VAKA 1PYSB 3TEGA 2BM0A 3CSKA 3LP0B 1NO8A 4CYUB 4JP8A 4B9SA 2Y0BB 3CIMA 3EVMA 4WFXA 4FZVA 3MAAB 4C0BA 4RBUA 3UVJA 4CLPA 3QRPA 4X4NA 4I6AA 1Y11A 2AZ1A 2NUHA 3S01A 4OZ1A 4M5IA 4N41A 3QJPA 1YRUA 1V3ZA 1EQ0A 3LP2A 4I2QA 4ZVQB 4KFBB 4DN9A 4OYAA 2V9WA 4OI0A 4U95A 2UU9F 4O3RA 3JQMA 5K8OA 1NK8A 2O67A 3TZYA 5GAEU 2J6UA 4CO4A 1H2TZ 3GV5B 3IBFB 2WW8A 4G1PA 3QO9A 5L1LA 2YWGA 3V81B 1URRA 1NKEA 1VBKA 1UL3A 1GXTA 1BXNA 5B0DA 5CYQB 2HZAA 4TXSA 4CQ1A 1TL4A 5D15A 1XEZA 4CO2A 2OPSA 2VASA 1SXLA 4YR3A 1KVKA 4RBVA 4QU7A 3NCRA 1C4AA 3PR4A 2XMWA 2VQFJ 4IQXA 4ECRA 2QYGA 5BYSA 4HVZA 3SQGB 1R0AA 2B6AB 1VQ6S 1YI2S 1ZM4A 4MMOA 3OXFA 2XI2A 3GMGA 5KT6A 4G6VB 4IFVB 5A8WB 4FF1A 1HWIA 2CPEA 1W2BR 3TUJC 3N0VA 3MEDA 2GQCA 2QMXA 3UCZP 2X1BA 1N5YB 1RHUB 1UW9A 4A8SA 3R97A 2R7QA 2AEFA 5LMNJ 1AZSA 2HFUA 3PKYA 4F2RA 4J9SA 4ZVPB 4Y2CA 2ZBRA 4HR2A 2U1AA 4FKXA 3LPYA 1TUWA 2RIJA 1WC5A 3OW2R 2BEFA 4DL5A 1N5VA 3NRBA 4WKRA 2OELA 4J90A 3CCSS 1S6PB 4ZLPA 1PGZA 5IS2A 3JQJA 3T19A 1VRQC 3M6UA 2E1CA 2OP5A 2KU7A 3MXHP 4C11A 4JV1A 3M8SA 1WHVA 2Y1IA 4C8NA 2HFVA 4WF9Q 1VDHA 5IM0B 1CSJA 2R7RA 5KFLA 1FE4A 4LSLB 4KHMA 3SZ2A 3NGRA 2HFNA 3WQPA 1N48A 2OHDA 1EKSA 4ED7A 1Q4RA 2GHPA 2LQ5A 2MLXA 4O4GA 4DI6A 2E9ZA 3KDNA 1YIJS 2YKQA 3DRSA 2ZZMA 4PXBA 1JIHA 3HI9A 2CDRB 4EZ9A 2VF3A 3IXQA 1FX2A 5B08A 2KXHA 2QSFA 2ZFHA 4C6AA 2DH8A 2V2VA 2E29A 4ANDA 5HN0A 1TAUA 3BDPA 1REVA 2HHVA 4TU8A 4M94A 1NRKA 3TYTA 1JQGA 1K44A 1B0TA 3HVTA 2NZ4A 4H4OA 4RW8B 2DNOA 2XBPA 1U25A 3IRWP 3EGZA 2R7TA 4X65F 1WDTA 4NX9A 3WDOA 4RW6B 1UA0A 2QIFA 3F0NA 4JOUA 3E8OA 5F8HA 1IKXB 3S6EA 4LVOP 1WTFA 3M8ZA 2Y1JA 3OLBA 1M5HA 6AT1B 4OJGA 1OQ6A 1TAQA 4UOGA 3H8YA 3SFGA 3AOAA 2MZRA 4I7FB 1VIOA 4V1Ak 2BXJA 4IO9Q 2E1AA 2FIUA 2L48A 3MM7B 1NKBA 2IVFB 3GIIA 2XYPB 2XYGB 2CIMA 1U4BA 5DJBA 2DHAA 2HHPA 1S1VB 5DLGA 3LO3A 2XO7A 4ZP6A 4PRFA 2GO9A 3EGNA 3T1YJ 1KRPA 5C25A 2HLTA 2HRYA 3OBIA 1HPZA 4K59A 2LP4A 1XQIA 1RWKB 3QGIA 1Q8LA 4ZHRA 5D3GA 1F60B 3DRPA 5LOQA 1Y0HA 1VJQA 2MKCA 1X7VA 3CD5A 3D1QA 4ILLA 1SQGA 1IKWA 2MDAA 1HNIA 3W2WB 4RU9A 3NS6A 1UAWA 1HBUA 4X64J 3G87A 3R7NB 1UETA 2ZOGA 2YNHB 1U1NA 2MKYA 2D3OR 5IT0A 2B4OA 1ZZNA 4L3KA 4MIBA 5DG9A 4IOBA 2ZDPA 4M8LA 2ZE2A 5A8RA 1V9OA 2DHSA 2QMUB 1RHMB 2FJDB 2QYCA 4F36A 1T3NA 4DWIA 3DLJA 1LWFB 3H0PA 2HMIA 4B9UA 1Z2LA 3MTKA 1Q53A 2DNZA 4TLQA 1QE1B 3KKFA 1IBMJ 3B54A 4JYAJ 4A47A 1O51A 2WRMA 1WUUA 2DNRA 1HR0J 2QV6A 4DV6J 2H5JB 2F1FA 3DGPA 3W9IA 3T1HF 1RXOB 3VGUA 1HWLA 2G0IA 1L3KA 5HBMB 5DDRC 4USHA 2KB2A 4OX6A 3G8TA 4JI3F 4MH8A 1G6BA 2VFUA 1MLAA 3OJSA 5H9FJ 1S6QB 4F0KA 2KTQA 1NJZA 3P5BP 2FPHX 2RNEA 3MM9A 1S77D 3H20A 3ZZRA 1VK3A 3M1VB 3DN9A 5HL7Q 2CJBA 2FVRA 3PDNA 1I3OB 3FZBA 3T5JA 2UP1A 4QWBA 5G4DA 1VIXA 5HATA 4A46A 2PEBA 4DUYF 4AFFA 2DHXA 3CDUA 1NHVA 3P96A 3M8QA 1RT3B 4JI5J 5A8KB 3UCUP 4QR1A 3BKTA 1FD2A 5KFKA 3E01A 2G1DA 3EX7B 1VBYA 4NYZA 1ZPVA 3CCQS 2KN4A 2BKNA 3RW6A 1RGVA 5DRKA 4IUFA 1WSVA 1LXJA 3TANA 2GJFA 4OX8A 2H4WB 4HH1A 2L3MA 1B70B 3GG1A 2JEJA 2CQ4A 5ETPA 1IR2A 3NGSA 3LALA 3CW2C 1ZAVA 5L9XA 3MEKA 1PC4A 3QAEA 2C22A 2C3PA 2HRUA 3TUIC 1OY8A 1CEZA 3E51A 1C2PA 1CJUB 4X84A 1J5OB 1RE1B 4MTPA 1BGXT 2BE2A 1R31A 3WC2A 1SKSA 1GMVA 5KFYA 1IBLF 1YDLA 3IO1A 1WC3A 3UVJB 2HHHF 2UV8G 2NQPA 2B4PA 4PKDB 4PWWA 2MZSA 3MD1A 4O23A 1NJXA 2EWHA 1N32J 2N4DA 4WZQA 3B8HA 3ZZUA 4KSEB 1F5CA 3SFUA 3T41A 4LF2A 4I2QB 1YTYA 2MEWA 4RNNA 2OKQA 1PBAA 1CULA 3U1NA 3H42A 2H3EB 2OTLS 2R7WA 2E9TA 1GTHA 4BCAA 4EYIB 2VBYA 3HMJG 2CXEA 4WFAQ 2Q6CA 3DOMB 4LUBA 2PMWA 5KT3A 2GNKA 2J9CA 2FZKB 1HKAA 4Q8FA 4PEOA 1WEXA 2DNYA 4NA1A 5DDOC 4M1KA 4Q0BA 3AH6A 1HWJA 4WFYA 3R27A 2JWNA 4KKOA 2LQ8A 1AROP 3CD7A 2A2DA 3UN3A 1CPZA 1WSRA 5L46A 5EN1A 4N76A 5EDWA 3BKUA 2OPSB 2R42A 4JUZA 3X1LB 1U1QA 3AY0A 1S1WA 3H2UB 1DRZA 2MTLA 5CH7B 1NMEB 3ZZTA 1S1TB 3I5AA 2DGQA 1EX8A 2JLEA 4NZ7A 3Q2SC 1RT2A 2VL1A 4IG3A 1R0AB 4A8KA 3JSRA 4F0MA 4NLUA 2HVZA 2W2OP 1WKJA 4R5PA 1MG7A 3QT6A 2QFJA 3HHDA 4DR6F 1NPPA 2YQ3A 3CUNA 4F3MA 4X4PA 2NREA 5BXIA 2G1HA 4ED1A 4NCBA 2MB0B 2RHQB 1NDLA 2A6MA 1TP7A 2J6SA 4ZOSA 3K5OA 4PCQA 1RAAB 4JI4J 2WAQD 1X5SA 4LSNA 3KNGA 4GVBA 1F6TA 4XIUA 1U1MA 3Q86A 3IGVA 2JEIA 2AJ0A 3BH6B 3HD1A 4C11B 1UKUA 3UN2A 2XMAA 2BJEA 5DGAA 2IC3B 2ZOMA 2FQQB 4FXVA 2DXEA 4PUOA 2FC8A 2J7UA 1C1BB 3M30A 4KB7A 3HSZA 4LR9A 3Q8QB 4USUA 3OTBA 1MSWD 3A3PB 4O3OA 4U7UD 4KV8A 1WF2A 2YPZA 4QIGA 3EPGA 2NZCA 3B82A 1WELA 4DV1J 4I0WA 4O4GB 2I5JA 3GE9A 3ENAA 2ALYB 1RWNB 3DRSB 3HHLD 3MFHA 4IRCA 2AZ3A 2GIRA 4DBQA 5CYJA 4B3MF 4J9KA 1SKRA 1REVB 2DGUA 1CJTA 3M2RA 4IQMA 3DU6A 3QATA 1RUSA 1LKZA 2B7CB 2GHVC 4ZIVA 5IWAJ 3HVTB 2R7SA 4H4OB 1YSJA 5I4MA 4PG5A 2KRRA 2V2ZA 4QYRA 2RDDA 4Z2XA 3HFZB 4DEZA 1VQ4S 2X1FA 1N6QA 4ZIWA 1U6FA 3PRBA 2HIQA 2UUTA 5IZHA 2OUGA 1N8RT 2DY9A 1MMNA 3MFIA 2GIFA 2OSQA 4JI1F 2LQ9A 3HJVA 5B0EA 2KZZA 2XZTB 1P9QC 1X9SA 2HBRB 2K3IA 3O5TB 2ZC4A 3UN5A 3JSYA 4UOFA 1U1RA 1FRMA 1LFWA 5CXTA 5C25B 1HPZB 4LREA 4WP3A 2HVEA 2QL7B 1FKPB 3HK2A 4K4XA 1LK5A 1S0NA 3IR6B 3NGTA 4DSKA 4USIA 3ELHA 1S49A 2R7XA 4NLRA 3ISZA 1D8YA 4ZVHA 4NOHA 5LSLA 5LT5A 2IJRA 1IKWB 6FD1A 1PO6A 1D0EA 1IBCB 2LEAA 3K5NA 4DR3F 1VQMS 1IXKA 4WXWA 4ECXA 1HBUB 5GAHI 1QVGR 2AF6A 2VBXA 2VICA 3KHGA 3OD2A 4EK2A 3HJFA 4USMA 4PXCA 2UUCF 1Q5VA 3M6WA 3TRGA 2DNGA 4ZVGA 4AL7A 1Y5LB 3Q8VA 2ZE2B 5A8RB 3RB3A 4DR1F 3MEGA 1TKZA 1FESA 3UI3A 2YPYA 3BQ2A 4X4RA 2L9WA 2B0GA 5CD4H 2ZDOA 4KO0A 5KT2A 3SXLA 1GFWB 2AJQA 4JI7F 1WTBA 1UVIA 3VZHA 2QL5B 4ZVSB 2FLNA 1RT5A 4QJVA 3MR7A 4CWBA 2KT2A 3KHHA 4C8MA 2W24A 3MR2A 2UXBF 3SDEA 5KG7A 1NH7A 3BKFA 4PXDA 2KHCA 2CJXB 3H4BA 2FY1A 3FFIA 2VPXB 3KK2B 2UV8A 1U49A 4ZLJA 5H9FK 3SBMA 2R7OA 4K2JA 3CCJS 4V19X 1J5EF 4CIOA 2CPFA 2Y9HA 2DR9A 1JNZB 2RRAA 2I9SA 2Z58B 1N36J 3CD6S 4FYDA 4M5MA 4RPFA 3GR0A 3AD7C 1VRTB 3CJTA 2HBYB 2D3ZA 2KT3A 3NOGA 5D0EA 4L75A 3CO9A 2B56A 3PO5A 2XLKA 3UDEA 1SJ1A 3ZNJ1 5HK4A 3M8QB 4L76A 3FQLA 4PQUB 2KFZA 3RUBL 4ELUA 2PDAA 1H2UX 3E01B 4OI1A 4C0OC 5HSPA 2YKNA 1KHWA 5KFSA 2HQCA 3W5ZA 1KFSA 3G9CA 3OR2B 3QT8A 2B51A 3CNQP 1Y3JA 2EW9A 4K7QA 2NSBA 2N3LA 4N77A 1UFWA 2JOQA 3MOZA 2W7AA 1MW7A 4R8UA 1DHMA 5HMWA 2HEKA 4UTGA 2IJFA 3NMAA 1XNQJ 2IDEA 2GFFA 5HVGA 4CO0A 1T94A 2R2UA 3M4XA 3MECA 2V4QA 2QN6B 5K5MA 1S7HA 2NXNA 3AB2B 2M3DA 3BPSP 1CC8A 1LOUA 2BE2B 1S6OA 3DXSX 4KHRA 2IM2A 2JLFA 1N4LA 4QIEA 3MI7X 1YK9A 2CNNB 3RRGA 1CS4A 2B4VA 3I5CA 1BHNA 2VG7A 4G1QA 2GGPB 3SQOP 1SIZA 4B3RF 3O6QA 1RWMB 1IUJA 4NEZA 2Z8QA 1ZOTA 2YNFA 4QIVA 2XTJP 3GSIA 2Z2MA 2NYIA 2DNPA 2AYEA 1N33F 5D4OA 4MAKA 2ZUGA 5HQMA 4F02A 5A6PA 1K73T 3KLFA 2EFOA 4OLPA 1XJWB 5C24B 1CULB 5IQQA 5L39A 1DLOA 1HI8A 5GADU 3TVYA 4OJ3A 2LA6A 2YNIA 3H4DA 4ZN3A 2COLA 2VONA 2C28A 4NXNF 1CJKA 3GP9A 3RBEA 4F26A 2BOAA 2P8IA 3O2IA 4L6V3 4B9LA 4CM2A 2MQMA 4ZPTR 3TQEA 2IJNA 4OYIA 3R5JB 4Q0BB 1JLCA 2BABA 1IBKJ 2DGXA 1BQMA 2ZBQA 4KKOB 3W62A 1X60A 1YX2A 2BJ9A 3IAS9 4ZJQA 1G3OA 2QLJB 1U8WA 3BSAA 4QWAA 2VC0A 1AUSL 1ZA1B 3T3FA 5IC6B 1M5VC 4OIXA 4X4OA 2H54B 2M70A 2QA4G 3MMBA 1X4FA 2DITA 4DV5J 3N6MA 5LMNF 5HP1A 4NCAA 3AQOA 4QWCA 3PJXA 3I4PA 3VALA 1VISA 3JSMB 1O0PA 3E3XA 4R5PB 5EWFA 4OI4A 2BOPA 2OEMA 5HVFA 4U8YA 4M5DA 1LWEA 1MROB 3MPVA 2QA2A 2AYBA 2AGQA 1SJQA 1QLNA 1FJCA 4YR2A 2H5EA 3N79A 4RX6A 4DL4A 4DPXA 4E8UA 2QRRA 5ETKA 1C0TB 3C8YA 2UUAJ 2PN6A 3GG0A 2I38A 2GQ2A 2KJVA 1KWMA 3H5YA 3GR1A 3JTPA 2KVQE 3MMAA 1HHQA 4GVBB 3QBCA 1AW0A 5GMDA 2DGWA 3TX0A 2ZKUA 3PM9A 2HVHA 2W9BB 1UWBB 3U02A 4PUOB 1U02A 1SL1A 3DRXA 3K8WA 3AD9C 1NBEB 4OYWA 4KV8B 4RW7A 3JS9A 1RAOA 5LMUJ 2DCLA 4WXOA 3SIPB 2XSFA 1HBOA 2I5JB 3M8PB 3D6TB 3NS7B 3D4JA 2B7BB 2Y8YA 1IM6A 5AJ3F 5DLFA 5I42A 2OPQA 2KI2A 5CA5A 3G8QA 2CG4A 3OHBA 2WBRA 1XWLA 1D9DA 4AL6A 1F1BB 2RVJA 2MJUA 2CQBA 2K7KA 2LMIA 1QUPA 1EARA 3FZ2A 3BQ0A 1U45A 3CJ3A 1HWUA 2QO3A 3D0HE 4XAKA 1PSDA 1TV6A 3A1YG 1G2EA 1N6QB 2GVDA 1R8HA 1YBAA 4LF6F 3PW0A 4WPAA 1LW2B 3G82A 4DQIA 2NR0A 1RT7A 3I5BA 1UP1A 3S8SA 1UVMA 4X62J 3CCTA 4NCGB 4W98A 3GQCA 3RR8A 3I32A 3CDAA 5GAHU 3LW5C 1LW0B 3DOKA 4TU9A 4ECVA 4B02A 3POTA 1UCNA 3PFEA 2D1CA 4OHXA 4Y65A 3GIRA 3IBWA 4JV0A 2JZ5A 3NGKA 4CRJA 2QFIA 3GB0A 3CVKA 3B4MA 5L38A 2OPPA 4X64F 1DQAA 2MGZB 2C2ZB 1Y5IB 4WFZA 2IA6A 1HL6A 3R5BA 3R5DA 3OJUA 2H65B 2VJVA 3M32B 3OXGA 4CO1A 3KMQA 3PW5A 2B43A 2AKWB 3I0RA 4LR8A 4C8ZA 2YKMB 4KPCA 4FF4A 1WACA 1HQEA 4CZCA 1T9UA 3P5TL 2CFXA 1VYAA 3UFCX 2XULA 1QSLA 1Y7PA 3S7RA 2QGFB 3DLBA 2VFRA 4OMFG 3N5FA 5JUMA 1PYTA 1XTZA 1HBNA 3J81Y 3ZTQA 1JLGA 3L95X 3D7SB 3NS5A 3LH2S 2HQ3A 1YJVA 3MMCA 3KHRA 4Q8EA 5BYQA 4BC7A 1TKZB 2WVCA 4A8MP 4JI2J 3BO3A 1TMMA 2MHNA 3NNHA 5KG2A 2A0FB 2DPJA 3J81j 1S1UA 2AJ2A 3DNCA 5HJXA 2K3KA 1RT5B 1F9HA 1PJ6A 4C98A 4OL8A 4GKKJ 1RZMA 1FJEB 3SDEB 3KDOA 5GAGU 1HARA 3QJJA 3I56S 4HHUA 2VA3A 1VQ5S 2HZCA 4BC9A 1H7WA 1T9YA 3A8IA 3FFIB 2PMZD 3IWLA 2RS2A 4R0JA 1XR7A 4DFKA 2E66A 3U1LA 1WG1A 5J2MA 4QW8A 2XNRA 2B5JA 2KG0A 1DTQA 3CJ0A 2X1AA 1VLYA 3AXKA 3HKZD 1NAQA 1HQUA 2KM8B 3M9OB 2LEBA 1NCLA 3C6UB 3EZUA 3BZQA 2C3YA 4ZPDA 2HQIA 3BYRA 4J9UE 2ASJA 4LFBF 1NPRA 5CZXA 2V68A 4X4VA 1T9VA 2M2BA 5E3QA 4LIWA 4F67A 2E7VA 2R8HA 2QMWA 4DL7A 2MJNA 2PD1A 1QJHA 2B9YA 1UEVA 3W8PA 4RNMA 5DZ6A 4R8UB 2HNZB 3IGNA 4M5JA 1FRXA 1NK6A 3JTOA 1LK7A 4A8OA 1RTIA 2VV5A 3DLGA 4UW2A 2FB0A 3MECB 4F8RA 4B3SF 2FD2A 4KYZA 4YQWA 2J8SA 1KQKA 4DDFA 2XY5A 1EJ7L 2HGNA 1ROFA 3TA2A 1XMOJ 1GAOA 1MN7A 4RO0A 4PR6A 2CJ9A 3P45B 1RA6A 4RKUC 1U09A 1F0XA 4M5HA 3U7JA 2NS1B 3FSIA 2F65A 3MMJA 1TL1A 2VG7B 3MCOA 3OL7A 2EK6A 4DV7F 4ECQA 1U2FA 3O3LA 2N4CA 5MAOA 2YNFB 1TMJA 3VR1A 3MCSA 2EFGA 5KFRA 4KGXB 3GJTB 3MM6A 4JI6F 4RL1A 2MKKA 3G2XA 1Q95G 2GVZB 1SL2A 1RHQB 3KLFB 4RUHA 2YX1A 3CXCR 1DLOB 1CJVA 5KT7A 1U0SA 2YNIB 5I3QA 2YWHA 2ROPA 3RB4A 3UQSA 5CQGA 4U6PA 1RSCA 1HD0A 1CJKB 3VWSA 2Q3PA 4EMDA 1IWGA 3IFEA 1SUQA 1NXIA 3OTOJ 3C46A 1UFKA 2YTCA 3WBZA 1JLCB 4A8QA 2RE1A 3V6KA 3NL0A 5E33A 1ZTTA 2DH7A 2DTJA 3ZZZA 4WK1A 1RBOB 1HMVA 2XMTA 1TK0A 4RW9B 4CYUA 2R8IA 5HLFA 1IJEB 4QIFA 4IH5A 4LFAJ 1RHRB 3MAAA 5D0RA 4P74A 2ZH7A 4KH0B 9RUBA 2VDHA 3PW4A 5F8IA 3MMBB 3Q2TC 4ENOA 3RRKA 5HP1B 4IYQA 1R27B 3TZZA 4KFBA 2E7WA 3OVSA 4CNYA 5T7LA 3CCUS 2QZ8A 3MTJA 1GMUA 1B3TA 2E1MC 3QNWB 2NUUG 3RG6A 1LWEB 2OSRA 3PG9A 3LPEA 1RTZA 2LXUA 2LU1A 3HVRA 1RA7A 1VQSA 4ILRA 3LGNA 5CYQA 2PEHA 3TARA 3OVAA 1IKVB 2LYVA 4NMLA 5A2QY 4DL0C 3QZ8A 2G2ZA 4YB5A 1E6YB 2ILZA 1Y3KA 3MMAB 4LR7A 1SC1B 1R6VA 1NJYA 4WCEQ 1U1PA 3TJ9A 2DRBA 9ATCB 4HI1A 1FERA 4LRFA 5GAEI 4NL5A 2C2RA 2AX0A 4I64A 5J2PB 3MURP 1RKJA 1KOOA 4GKJF 2E5LJ 3SQGA 4AQYJ 4IRDA 5F8NA 2DNNA 1RWVB 3L3CA 3QYYA 4ZPCA 3PNIA 1S0MA 1R0CB 2R8JA 4DS5A 2ATLA 4ZP9A 1N88A 3ZTOA 1G7CB 1NB2A 4ANEA 4IFVA 1JJ2R 2L9DA 3VCDA 5IWAF 1HBOB 2JFKA 3RBXA 1CBKA 1DBDA 3W1YC 4G65A 1N5YA 2CAJA 2Z4PA 2G0CA 5KFTA 4U7UK 5I42B 1QM9A 3GILA 1VQ7S 2OPQB 2FJVA 1P8GA 2IM0A 1VMBA 4OYZA 1S4EA 1XIQA 1D09B 1URNA 2WSCC 2XGQA 2K1RB 3PW7A 4Y34A 1YWXA 4CLUA 4P2XA 4RLEA 1KVIA 3N6NA 2UXDF 1KFDA 1UEKA 2PC6A 2Z2ZA 4MK7A 2BE9B 4C7QA 1OSDA 3CJQA 5AXMA 2E44A 3PZPA 5HMZA 3P8BB 4AE5A 3DLEA 2GVDB 4ZPBA 5CHCB 4NE9C 3ADAC 1DJ0A 3BBFA 2LCWA 1X4DA 3GCXP 4IFYA 5I3UB 3KFWX 2CQGA 3G82B 3DCAA 2JDJA 1TKTB 4O44A 1RT7B 1PBUA 5DGBA 4TN2A 3IM8A 3PHEA 1IR0A 2A18A 2CNKB 4WYWA 1OY9A 4CLKA 2PI4A 1M1HA 2ZVIA 1RCXB 3K8VA 4DR4J 3DOKB 2Q1LA 3POTB 5KG3A 2OMLA 2XNQA 4H4KA 2JL9A 2EFNA 2DGTA 5ADZA 3UO0A 2H1YA 1WF0A 3PRVA 2Y3YA 2D9PA 4Q5VA 4DPYA 1TL7A 2OPPB 3AQPA 2B9EA 2Z2LA 5H9EJ 5BR8F 1RWOB 2O01C 3PHTA 2N7CA 3FEZA 2BJDA 5DO2A 3HPOA 2CUYA 3I0RB 2F40A 3IG1A 5ETOA 3KMSA 2DEIA 2ZD1A 3R5GA 1HQEB 3Q24A 5D6GA 2KO1A 3NAHA 3ZC4A 3KUEA 1HI1A 3I9V9 2NSCA 5KT4A 4B9TA 1HBNB 1RKIA 2ZZTA 1TUGB 1JLGB 4IRKA 1KKHA 4KJIA 3QFWA 3EDQB 3A13A 5KFPA 2Q43A 4YY3F 1RHJB 3OUYA 6FDRA 4BLGA 4I7FA 3TW0A 4QBUA 3BREA 3CJ2A 5J2NA 3I6PA 2X3DA 3UCGA 1T03A 3O8WA 4LBPA 3A8EA 2ZC3A 4C8LA 1H74A 3PX4A 5KFQA 1OWXA 3T9ZA 3TI0A 2HHTA 3EDRB 4U96A 3OTDA 1ELOA 4ZVTB 1SB6A 3G8SA 3JYTA 2FUG9 2YVSA 4USWA 3FEYB 4HTIA 3HF5A 1BD6A 2Y1RI 3MF5A 3RRHA 2XM3A 4NASA 2V63A 4O0NA 2GHWA 4DFMA 3KLGA 3AHPA 1M5OC 2V67A 3ISNC 2E5IA 5KFCA 2B5JB 1EP4B 1DTQB 5IV4A 2J0SD 4CI0B 4OX7A 3B6BA 2PFFB 2YNHA 3HLUA 2W9CA 4RBTA 5ETTA 2KH9A 2JX2A 1MMLA 3TP2A 3BYPA 5FLXY 1I6JA 2XYHB 2ZNZA 4GC7A 2UVWA 4EGLA 1TUVA 3W3SA 3H98A 1XNQF 4X66F 2IBKA 2YWWA 3KNAA 1EAYC 1NDKA 2WSFC 1FDDA 2OI2A 3ULHA 3D5MA 4JI8F 1UMJA 1QE1A 4DSFA 3VF0B 4P7TA 4ZVOB 2RD5C 3SSQA 3CCWA 4RZRA 2V5HG 3C2PA 1HYSB 2APOA 5E3PA 4WJBA 4Y28C 3FCVA 1U2CA 3N28A 5HBMA 2BJ8A 3J7Z5 1B99A 1RTIB 3DLGB 1OYEA 2JVOA 4ZDNA 4IOCQ 4IKAA 1B7FA 1WOOA 1CQNA 2OD6A 4J5OA 1ZTWA 4OJ1A 2ASYA 1FRIA 2BZ2A 1VRUA 4FS2A 2A2CA 3Q8UA 3G6VA 3M1VA 1TR0A 3FRYA 2H4YB 2ZM6J 3J81U 1P9YA 3ICLA 3HP6A 2MKIA 1GXUA 5L1IA 2DIUA 4OZ3A 3MPUB 2POKA 5K9FA 2P6TA 5E2QA 3RAMA 3C15A 3D68A 3Q23A 2PMHA 1RT3A 3W61A 4XPCA 5FJ4A 5A8KA 2RT3A 3N9UC 2J9DA 4KGZB 4NPOA 3MM6B 3M9MB 2MLZA 4A4JA 5T14A 3IMQJ 1UPMB 2FLLA 4XPEA 3SYZA 1IBKF 5AXLA 1ZBTA 4JI0J 1UW4A 1CJVB 4CM0A 3VAFA 2XZWA 4RJVA 3MDFA 3Q83A 1SIWB 2V4JB 3CCZA 1VQYA 1M1KT 4DV3F 2OEKA 3GZ7A 3DFEA 4DQSA 4C8YA 4QPTA 3LQVA 2FC9A 2MZTA 1YJWS 4D3HA 3D3CJ 1FKOA 2IHR1 5D0GA 1J5OA 4DV5F 2CYYA 3TAPA 3BBBA 2PA8D 2AMCB 1K8AT 3A12A 2F8MA 3MPYA 4DV2F 2V50A 3OL8A 2C3UA 1HMVB 5HLFB 4PZVA 3UDVA 1T7PA 3UNYA 2EVZA 3EWGA 1RT4A 3C6TB 3TWZA 2EG1A 1FXDA 2QTWA 4G1IA 4EEYA 4W90B 4IR9A 3EJMA 2C1EB 1HLWA 4E2FB 3CDBA 1OQ3A 4WBFA 3SMZA 5KT5A 2DNHA 2MY8A 4UUXA 4JBCA 2AW0A 1FJ7A 1R8AA 5T7LB 4RWXA 4YR0A 1R89A 2GA7A 2FZCB 1RWUA 1C1CB 4LSZB 1WEZA 3UDLA 5JVGQ 3Q8SB 1Q16B 1QSSA 2IM3A 2JNJA 3DOMA 1FFGB 3QQCD 1KQFB 1VHFA 4M5NA 4NMXA 3VV2B 1APSA 4YN3B 4CT9A 1ZETA 4FVMA 2UUBF 4K4WA 3CB4A 5KFAA 1KC8T 4RW4A 4FF3A 2WVFA 1TTHB 2F4VJ 2HNDA 4MKVA 3OSPA 3GIMA 1TL5A 2MQLA 5HMYA 4ZP8A 5LMUF 2HWHA 4PYAA 3QAUA 1S10A 3CULA 2GJ2A 2JFDA 3JTNA 1A9NB 1S1TA 3BJYA 1OS5A 3FDSA 2RU3A 1UZHA 1NDPA 2IYIA 4X65J 1YJ7A 5FD1A 1PCAA 2IM1A 3A3OB 4F0HA 3KK1B 2DHHA 3HHLA 3EMTA 4EBDA 4NLGA 2HHSA 3W5YA 3W8GA 2IYGA 2IRXA 4DFPA 4PABA 1MMDA 1WHWA 2HWTA 2ZJPQ 4ZVRB 1FE0A 4ECYA 3G86A 5DM6Q 2QEXS 1HNZJ 1FVQA 4DV0F 1RISA 4J91A 4KGKA 1KEKA 3DU5A 4RR5A 1GQEA 3T6BA 1U6BA 1NSAA 3HXMA 4BDPA 5ETSA 2HZVA 1ZM2A 3IM9A 1H0HB 1YQHA 3OR1B 4LFCF 1Q8KA 3FCWA 1FA0A 1X8DA 3EGWB 2K7JA 3MR6A 3U1MA 1S9EA 4P71A 5AE3A 3DMJA 4DCPB 4LRAA 4CLYA 3QIPA 2JC0A 1BWEA 4URQU 3HO1A 1HIYA 4C0HA 4X62F 2B8QA 1S59A 2A6OA 3NWGA 4B9NA 2HSEB 2G0JA 4RWWA 1KOHA 1IR1A 1KDNA 1AFJA 3HKWA 4LF9J 3DLEB 1TQLA 5B7WA 2J9DE 2IC3A 4QR0A 2F7VA 3TAQA 4IFYB 1C1BA 2ZWPA 4O44B 1HNWF 5IQ6A 1K47A 1FDNA 2CJAA 1NKCA 2DT9A 2BX6A 4K0KJ 2M0GB 2BW7A 4NLTA 1BMQB 3DRRB 1XK8A 3AT1B 5JVHQ 1ZAWA 4O4RA 1NK7A 3MZIA 1VQLS 3W2VA 1TL7B 4AD6A 3D2WA 5H9EK 1HFEL 1FDAA 2X51A 2AGPA 2CADA 3OFFA 5A2QU 3R7SB 3AOBA 5K14B 4MIWA 3SCJE 3T1HJ 4YS2A 3GV8B 4DG1B 5B0FA 3IG1B 5A6WA 4JI2F 2ZD1B 2RAQA 4BS2A 1VC6A 3Q8YA 4BBYA 4JI3J 4ID8A 4K5RA 1B64A 2NXEA 2CG8A 3F56A 1OY6A 4K4VA 2OJ3A 3ONQA 4OX9F 3PV8A 4ED2A 4OZ2A 2XQCA 3RU0A 1HQ2A 3OUYB 4B3TF 3TOQA 2J0QD 2EXUA 4NRTA 1TK5A 4LT6A 3VAGA 4ZCMA 1WC6A 4DUYJ 4ELVA 5J2NB 3QPIA 4FPIA 1VFJA 1T03B 2LDIA 3PJWA 2D7SA 5EWGA 4NLDA 2E1RA 5DM7Q 4DPWA 1O6XA 2P5VA 2UVVA 3AJ2A 2XGPA 2HQFA 1FKPA 4M5GA 4YB7A 3JYTB 1YG0A 1P1LA 2R4FA 4P10A 3HSGA 4OHVA 4Q2LA 4ANCA 2JLGA 2E9RX 5CCMA 1UJ6A 4LF5J 1JJHA 4YOEA 3KLGB 2GMHA 3FSYA 1SH3A 3US5A 5G0RA 1WHYA 2KXNB 7AT1B 4UZCA 3I31A 2XHCA 1BE4A 1YJNS 1FJGF 4RUBA 3M6VA 2AP6A 5F8MA 2AJ4A 4K4UA 3SSRA 1S99A 4ZA1A 2W9CB 4F4YA 5E0OA 1T9TA 3PIOQ
chains in the Genus database with same CATH topology
2B4UA 1R43A 3GSDA 3QGPA 4MKAA 1O5JA 3KTQA 2MPUA 3SV3A 2HVHA 3ZZYA 2ABYA 2W9BB 4ED0A 1UWBB 2GJIA 1FVSA 3H2VE 5E3RA 1GTEA 3V4MA 3U02A 1KHVA 3C6TA 5THWA 4PUOB 1SL1A 3VTIA 3DRXA 2M9KA 3K8WA 4AXIA 2IA0A 2AWZA 3CPWR 3L09A 4UQTA 1B0PA 4ID5A 2UVUA 2YX7A 2DHGA 3MPWA 1RQ0A 1A6LA 4KE5A 1JKHB 1KQSR 2FJBB 2VZ9A 3TNVA 2MY7A 3HM9A 2J7WA 2VC1A 2MZ1A 4M95A 2E5JA 4KV8B 5KG6A 4Q45A 2RQCA 4NXMF 4EBEA 2P9GA 4RW7A 1VI7A 5EUHA 4FXWA 2EBEA 3IC1A 4R25A 4URSA 5LXRA 3CD0A 1FNXH 3CIZA 3DYAA 3KLHA 2DCLA 4WXOA 4ZCIA 2XSFA 1RDRA 1HBOA 2I5JB 3RW7A 1WF1A 4CT8A 3V4IB 3M8PB 2VG5A 1XMOF 2V8DA 1MWZA 4P2SA 4N5SA 2ZNYA 4IH7A 4DV4F 1WNEA 2KVIA 3FQKA 2B7BB 2JH3A 4J9PA 4CH0S 3PEJA 4DFJA 3QJLA 3UPFA 4FPRA 1JK9B 1S72S 5AJ3F 5DLFA 4L72B 4JI4F 4IG0B 1C1CA 5I42A 4TY8B 1QAIA 2OPQA 2KI2A 4HHJA 5LJ3Y 1SJ3P 4OLOA 5CA5A 2R8KA 4ZHRB 4ATNA 3BR9A 3DRPB 5D3GB 3KG1A 4Z37A 3MM8B 4MKYA 3G8QA 3KK2A 3CMAS 4EBCA 3QLHA 2CG4A 2VFVA 4AL5A 1KONA 3OHBA 1JNRB 2WBRA 4NLWA 1XWLA 2SXLA 2G9OA 1SUQB 1U2RA 1D9DA 2J9EA 5M2UA 4AL6A 3ITHB 1FRLA 1YJTA 2RVJA 1UJ4A 2VH7A 1HNIB 1TKXB 1SC6A 2MJUA 2U2FA 5F9NA 2CQBA 3KHLA 2KRBA 2XLIA 4X4UA 4O3PA 2XMMA 2HLUA 2K7KA 2LMIA 1QUPA 4DQRA 1K0VA 2XI3A 3FZ2A 1VC0A 3BQ0A 1U45A 3CJ3A 2MQOA 3VAKA 3H5SA 2FJWA 1VRUB 2VOPA 2BM0A 4ECSA 3CSKA 1HWUA 2QO3A 4F4KA 4FNIA 4ETXA 3LP0B 2AJFE 1XR5A 1NO8A 4I1TA 2W25A 4DMZA 3D0HE 1HNVB 5C42B 4XAKA 4F4XA 1PSDA 4B9SA 1TV6A 2ZKTA 2DGOA 1VRTA 3FEXB 1Z4UA 3C66A 4NWBA 3A1YG 3CIMA 4H54A 3MOJB 4WFXA 1N6QB 1G2EA 2G4BA 1R8HA 2PT0A 4FZVA 4C0BA 1HHTP 1YBAA 4RBUA 3DLHA 3M2VA 4X4NA 4DV1F 4I6AA 4LF6F 4I67A 3PW0A 1D1UA 2NUHA 3KG0A 4OFZA 3S01A 1LW2B 3T9NA 1QAXA 3KOAA 4OZ1A 4DQIA 2NR0A 1RT7A 3I5BA 1UP1A 4N41A 3QJPA 3S8SA 5KFUA 5B0CA 4OJHA 3OVBA 1YRUA 4PQUA 1UVMA 3M8RA 4Y2KA 3O44A 3KK1A 4DQPA 1V3ZA 3R1LA 2MKHA 2WOMB 3D54A 3LP2A 4QR2A 4I2QA 2HMIB 3CCTA 1F5BA 4NCGB 3FGVA 4KFBB 4DN9A 1Y9OA 2ILYA 3GQCA 2V9WA 3RR8A 3I32A 4OI0A 3CDAA 5GAHU 3BO2A 2UU9F 4KIAA 3LW5C 1LW0B 3DOKA 4TU9A 1Q7YT 4ECVA 3OR2A 4B02A 3POTA 4AXJA 4O3RA 3PFEA 5K8OA 4N8OA 3OTOF 2D1CA 1NK8A 4ETZA 2PI5A 4OHXA 1QUVA 2O67A 4Y65A 1H2VZ 1T02A 2LEPA 4ECUA 1TVRB 5GAEU 4Y00A 3IBWA 4JV0A 2DR7A 4NLYA 2J6UA 2JZ5A 3ENWA 1W2IA 1H2TZ 3NGKA 4CO4A 3GV5B 2WW8A 3GB0A 4G1PA 3QO9A 3UD4P 2HVIA 5L1LA 5D4PA 3CVKA 1WG5A 2YWGA 3B4MA 5L38A 4YHHF 2W4CA 2OPPA 1RTDB 5H1SV 4X64F 3V81B 1DQAA 2MGZB 1Y5IB 4WFZA 1URRA 5K8PA 2IA6A 1HL6A 2I8EA 3CDWA 1OO0B 1I94F 3R5BA 3CC4S 1TL3A 1NKEA 1GX5A 2FVQA 3R5DA 3OJUA 4ZMMA 4A8WA 1UL3A 1GXTA 2RRNA 4JV2A 1R8PA 2EG2A 1P27B 2RF2A 3OR1A 3E2EA 4J9RA 4C8KA 3M32B 3OXGA 5B0DA 5CYQB 4CO1A 4TU7A 3KMQA 3MM9B 3CEDA 3PW5A 4ES2A 2B43A 5KG0A 3I0RA 4TXSA 4C8ZA 1FKOB 5A0YB 2YKMB 4FF4A 1WACA 1HQEA 4CZCA 4CQ1A 1NH8A 3P5TL 1TL4A 2E7XA 2CFXA 3UFCX 3LAMA 2XULA 2CQ2A 4D3GA 3VZIA 1QSLA 1XEZA 3U27A 1GT8A 4CO2A 1Y7PA 1U8SA 4A48A 2OPSA 3S7RA 2HAIA 2VASA 2VFTA 2RMLA 1YITS 3DLBA 1SXLA 2VFRA 3M6XA 4YR3A 4OMFG 1NB7A 2CPHA 3N5FA 2CQ3A 4RBVA 4QU7A 5JUMA 1XTZA 2GGPA 3QWPA 5KFWA 1HBNA 4OI6A 1K1QA 3J81Y 3T5HA 3NCRA 1JLGA 3I96A 1Q7LB 3L95X 1M5KC 1C4AA 5KTQA 3PR4A 3RAXA 2VPWB 3NS5A 3LH2S 2XMWA 3BO4A 2HQ3A 1YJVA 4OI3A 3MMCA 1L5UA 1RT4B 3D28A 4IQXA 3KHRA 4ECRA 4Q8EA 5BYQA 1RAJA 2MYFA 4BC7A 1DZ5A 1TKZB 4HVZA 3FJ2A 3HFKA 5BYSA 4A8MP 3SQGB 1R0AA 1A7GE 3G6YA 3BO3A 2B6AB 1VQ6S 2WCXA 1LFPA 2MHNA 4UY8T 2CQDA 4K4TA 1YI2S 3NNHA 2OPRA 4RUCA 5KG2A 1ZM4A 4MMOA 2F9JA 3OXFA 2XI2A 2DPJA 3WC0A 3KYLA 2JEGA 2OIHA 3DRRA 3GMGA 5EHHA 1S1UA 5KT6A 4G6VB 4IFVB 4ZPWR 1NJWA 3DNCA 3IR7B 5A8WB 1CQMA 4FF1A 2K3KA 4YB1P 1HWIA 2CPEA 5C24A 4B9MA 2XWYA 1RT5B 1W2BR 3J7A1 3TUJC 3N0VA 4C98A 4OL8A 4ED5A 3MEDA 2GQCA 3R1HA 2QMXA 3UCZP 1FJEB 4DSEA 2X1BA 1N5YB 1U24A 3SDEB 5GAGU 5IXUA 4A8SA 1HARA 3QJJA 3I56S 1FD8A 2HW3A 2DNLA 2R7QA 2VA3A 1VQ5S 4JV5F 2HZCA 4BC9A 1H7WA 4KT0C 3PKYA 4F2RA 3FFIB 4J9SA 3J80Y 4HLBA 2PMZD 3IWLA 4Y2CA 2RS2A 3R5AA 4R0JA 2U1AA 3D1OA 3LPYA 2RIJA 1XR7A 3OW2R 4ECWA 4DL5A 5J1EA 3NLCA 1N5VA 3NRBA 4DFKA 1M0SA 2AV5A 2FGOA 1W25A 3CT9A 1M5PC 3I55S 3V5RA 4WKRA 5B0BA 2E66A 4CO3A 3U1LA 3CCSS 1WG1A 5J2MA 1S6PB 2IMWP 5K14A 4QW8A 4ZLPA 2LDYA 1PGZA 2XNRA 4RW4B 4USJC 2B5JA 2EFQA 2VB6A 5IS2A 2KG0A 3UNGC 4DG1A 1DTQA 3T19A 2CPYA 3CJ0A 3M6UA 2X1AA 3I4HX 2E5LF 4F50A 3NCPA 3MHYA 4AQYF 2E1CA 1VLYA 2OP5A 4C97A 2XS7A 2HNDB 1HI0P 4X4TA 2KU7A 4OZJA 1SH0A 3TX8A 1BY9A 3HKZD 2AQ4A 3MXHP 4C11A 4JV1A 1NAQA 3M8SA 1XC9A 1WHVA 1HQUA 5DDQC 2MSSA 4WTYA 3DDKA 3PR5B 2R2RA 2Y1IA 2KM8B 3M9OB 1JLAB 4C8NA 2LEBA 5J1NA 3C6UB 3EZUA 3H5XA 3BZQA 2XLJA 2BYCA 4N56A 2C3YA 4NYPA 1V3RA 4WF9Q 5IM0B 4ZPDA 1CSJA 5DETA 2HQIA 4FVCA 3PW2A 1BLUA 2R7RA 3K5MA 1RI7A 4PWDB 5GADI 3OFEA 5KFLA 1FE4A 3DXBA 1ZPWX 4LSLB 3CDEA 4KHMA 2ASJA 4LFBF 1FNOA 1SI9A 3SZ2A 5CZXA 4TYBA 1GNKA 4X4VA 2YWKA 2CZ4A 3HHLB 2O5DA 4NA3A 2AD9A 4CH7A 4C3LA 2M2BA 4HT5A 5E3QA 4UUWA 3JAMY 4B9VA 2VG6A 4LIWA 1N0VC 2HFNA 2M52A 1N48A 1JJ2R 4IOAQ 3D1HA 2XMUA 4W92B 4F67A 4ED7A 1FXLA 3PVXA 1Q4RA 2GHPA 2LQ5A 1BQXA 4O4GA 3THTA 4DR7F 1L3VA 2E9ZA 3J7ZT 2R8HA 5KFJA 2QMWA 3JSMA 3G4SS 3KLVA 4DL7A 2MHEA 2MJNA 2PD1A 1YIJS 4NLPA 4DR2F 2YKQA 2XEXA 1QJHA 2B9YA 3DRSA 2ZHAA 1UEVA 4PXBA 2ZZMA 4I2PA 1JIHA 2CKWA 4KHPF 3HI9A 2VPZB 2Z0GA 1XNRF 4QCLA 3ENVA 4EZ9A 4RNMA 4HEA9 1X4EA 4Y2IA 3HDSA 3IXQA 4DSLA 1KLMB 2EFVA 5B08A 2KXHA 2QSFA 2ZFHA 4R8UB 2PSZA 4MIAA 2HNZB 1MROA 3IGNA 4RNOA 1N36F 1FRXA 2ZH6A 2DH8A 5AE1A 2E29A 3AAWB 2F9DA 5HN0A 5LSOA 1TAUA 2BVZA 1NK6A 3BDPA 3JTOA 1LK7A 1XBWA 2ZBCA 2W4PA 1REVA 4A8OA 1RTIA 2VV5A 3DLGA 2HHVA 2WB1D 4UW2A 2FB0A 4TU8A 2MKJA 1NRKA 3H25A 4M94A 2HNYA 3TYTA 4MYUA 3MECB 4F8RA 5F8LA 1S76D 2I1RA 2FD2A 2BR0A 4B3SF 4QU6A 4YQWA 4OHZA 3T5KA 1B0TA 1KQKA 3MEEA 4DDFA 3HVTA 1S9EB 2CZVC 2XY5A 2NZ4A 4H4OA 3NG8A 4FNHA 2HGNA 1V6HA 1ROFA 4RW8B 3TA2A 2DNOA 1NK9A 1GAOA 2XBPA 1FEHA 2ZBIA 1C0TA 1U25A 3DMJB 3IRWP 1F5AA 3Q22A 3EGZA 4X65F 4PR6A 4J9QA 4OHYA 2R7TA 3QIPB 2CJ9A 4WK3A 4NX9A 4MFBA 3WDOA 3Q8RB 1RA6A 4K5SA 4RW6B 2ADCA 2QIFA 4RKUC 1UA0A 3X3UA 4JOUA 1U09A 1F0XA 3E8OA 4WYLA 5K8NA 5F8HA 3CF5Q 4J9OA 3U7JA 1IKXB 2NS1B 1NU4A 3S6EA 3FSIA 4LVOP 1S1WB 1WTFA 3MMJA 2Y1JA 1TL1A 2VG7B 2YNGA 3N4WA 2XS2A 3OL7A 5KFFA 1FTCA 1JLFB 2FVCA 3IS9A 5E3AA 3OLBA 2EK6A 4DV7F 3L7PA 1N54B 4ECQA 4DSIA 1WD6A 1M5HA 1U2FA 2CPZA 2VQEF 3O3LA 1FF2A 2N4CA 2KG1A 4DJBA 4PG4A 5MAOA 5L9NA 3G6XA 2YNFB 4OJGA 3UW1A 1OQ6A 4CH1A 1TAQA 1RT2B 3BGUA 3VR1A 2W9BA 3H8YA 2PO4A 1UWBA 4IG3B 3MCSA 3SFGA 2BDPA 5F8JA 2EFGA 5KFGA 5KFRA 4UQGA 2MZRA 3HZGA 4I7FB 1T05B 4CTAA 1VIOA 3DHXA 2L08A 2VFSA 5I3PA 3MM6A 2BXJA 4IO9Q 4JI6F 2E1AA 2FIUA 2L48A 2MKKA 3MM7B 1NKBA 2IVFB 4HYKA 4IDKA 2NXUA 3GIIA 2GIQA 3RAQA 5IT9Y 4I4BA 2CIMA 1U4BA 3J7YU 1SL2A 5DJBA 2DHAA 1Y4ZB 2ACYA 3KLFB 4RUHA 2HHPA 1S1VB 1FKAF 4E0DA 5DLGA 1K0TA 5M2PA 3LO3A 2XO7A 1SBRA 2YX1A 1JLQB 4ZP6A 5DDPC 3CXCR 2VKRA 2GO9A 3EGNA 3M2UB 1DLOB 4PRFA 1KRPA 2C3MA 4FBUA 5C25A 2HLTA 2HRYA 1ZH5A 3M8PA 1HPZA 2IAJB 3OBIA 4K59A 2CQ1A 3N6LA 5KT7A 2DJWA 1KN6A 1XMQF 2YNIB 5D4LA 5I3QA 5T41A 2YWHA 2ROPA 3W2VB 3PO4A 3RB4A 4BWJA 1KS2A 5KFMA 3UQSA 4DL2A 5CQGA 2PGCA 3QGIA 4U6PA 3FMBA 5D77A 5F3ZA 1HD0A 2BQUA 2DCUB 2IMOA