5IT9Y

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5it9Y00
5LL6d 3J7A1 3J80Y 5FLXY 5IT9Y 5A2QY 3J81Y 3JAMY
chains in the Genus database with same CATH superfamily
4B3TF 3FRZA 4H4OB 1B0VA 5I3QA 1KEKA 4DU8A 2Y0BB 2M4MA 3RB4A 4A48A 2H51B 1QJHA 3OSPA 2YKNB 1SC3B 4HDHA 3RRKA 3Q8QB 1ACMB 2IVMA 3DN9A 4HT5A 1MNEA 2XCAA 5HMXA 2IYGA 3HHKA 3BH7B 5JJBA 3BQ1A 3ZZRA 2R9LA 2CPZA 4CH0S 4GO5X 2D3OR 3DHWC 5KFCA 3LPEA 4ED7A 1U49A 1R0AB 3DLJA 2AJ2A 1HYSB 2DPJA 3ZZOA 3C66A 2DIUA 1RAGB 4RW4B 2DNZA 1BGXT 2ABYA 1QAXA 1EP4B 2HHQA 4DS5A 2W9CA 3SMZA 2E5LJ 5MAOA 2Z4PA 5T7LB 4CT9A 2PO4A 3BBFA 2M8DB 4FPIA 3E01A 2HK3A 1B0PA 1TKTB 2VH7A 4HACA 2MKKA 1LXNA 3OXGA 2IA0A 2QO3A 1PYOB 1DTQB 2ZH5A 3SQGA 2HHTA 4OYPA 4JI0F 4N56A 4GO7X 2RF2B 1Y11A 2DY1A 2VJUA 3CCMS 4RUBA 1U1PA 4DV6J 2ASLA 5FLXY 3KLFA 4TLRA 1E6YB 1OMSA 2PIIA 2IVFB 1KVJA 4C4WA 1NHKL 1UEUA 2WOMB 3ZZTA 1DTTA 4I6AA 5I42A 1UVLA 5T41A 2NZ4A 2QMXA 5KOXA 4C6AA 4TNOA 3GJRB 2JWNA 1JKHB 1RAEB 2KVQE 2D3UA 3IA0A 2A6OA 2GIFA 2R2SA 2OEKA 2QLBB 3MMCA 3H5UA 1B64A 3THVA 2VUGA 2W7AA 2AHOB 3Q8RB 3D6TB 4ED3A 2BQUA 1TK0A 2PEHA 3DOMB 4YHHJ 4BLGA 1KP6A 1IKWA 4A8MP 2Z2ZA 3MMBB 1TUWA 1RQ0A 3I4PA 4PG6A 4LQ9A 3RB0A 1FXDA 3V4MA 2QN6B 4C8KA 1WEYA 1BY9A 3FSXA 2P8IA 3MAQA 3NBPB 4PR6A 3VZHA 3V6DA 3R27A 2O66A 3BN4A 1RT4B 3LF0A 3WX8A 3M32B 1NCLA 3LALA 4DV0F 4GKKF 1TV6B 5IQQA 1D8YA 3VV2B 4UUWA 2V6AA 3ZFVA 3M8PB 1VBYA 1KFDA 2EBEA 4YP3A 3KK3A 3FQKA 5C2GA 3QZ7A 2W8LA 1VDHA 1QY7A 2XULA 4OI1A 2Z0GA 1XERA 4O0NA 3FKBA 2H48B 5EWFA 4X4VA 3Q89A 4WP3A 5KG2A 1UFWA 4K4ZA 1T8EA 1U25A 4X65J 4DV4J 1S1UA 4I69A 1HI1A 2IBOA 1HQUB 1SJ4P 5GVQA 2HNZB 1N33F 5A2QY 4C2MA 1OJ4A 1V9OA 4WU3A 2V2KA 2PC6A 1C4CA 3BGFA 3KK1B 1U26A 1NK6A 5FLXU 5GAEU 1NM2A 3MCOA 5GMKa 3MM9B 1UAWA 2RIJA 5IWAF 2FHJA 5ETTA 2CJQA 4NCGB 1ELOA 3RAQA 2HMIA 2CZVC 2VFTA 3POTB 2JVRA 5HP1B 1XIQA 1H74A 2H5JB 1HNWF 2P5VA 5DQIA 1AZSA 4OI0A 2XYHB 5B7WA 3TA0A 4DV5F 1FRHA 4LF9J 2CZ9A 2DT9A 1MROA 4ZVSB 1NPKA 1H7WA 1RTJB 4ECZA 2W2QP 1N5YA 3DLLQ 2D9OA 4RZRA 2XM3A 3K57A 3TJ9A 4RNNA 4ZVFA 1G3OA 2EFGA 1V3ZA 3I0RA 1H0HB 4F50A 1GTHA 4B3OA 1TL7A 1RWOB 4IDKA 3D6HB 3PX6A 4LFCF 5I3PA 4I2QB 5AXLA 3LQVA 1HI0P 2CFXA 1TR0A 3H42A 2EW9A 1IBKJ 1HBOA 4C7QA 4ECUA 3KLEA 1LK5A 1CQMA 4M8LA 4EEYA 2CADA 2LQ9A 5IM0A 3HDSA 2MHEA 3M8QB 3KLFB 4ELVA 3D3BJ 1VRTB 1KLNA 4K0KF 2MY8A 3EVMA 4DQSA 4ZS6A 3MCNA 1XR5A 1JK9B 5F8NA 3SEOA 2FJXA 1HNXF 2MJNA 3DOLB 3MM8B 2DGOA 1NSPA 3I6PA 1U1QA 4KR0B 2CJAA 3JS9A 2VKRA 1SH0A 2OHDA 1WOPA 2XMAA 3PRVA 2XY5A 1YZ7A 4ILMA 2L9WA 4YUDA 1WOSA 2MLYA 1N48A 4IR1A 2LEAA 3CDBA 1QLNA 5KG6A 2OPRA 2OAUA 2VFUA 1D0EA 1U2CA 3H4DA 1IWGA 5E2QA 1VC5A 1VOMA 3VZIA 5IFMA 5EHHA 4F26A 1XNRF 1H2VZ 2QA1A 4HH0A 4QIFA 3C15B 3D68A 2KFNA 2HVEA 3AFGA 4ECYA 3IC1A 3MPYA 2QA4S 1VISA 4FBUA 3D0HE 3W65A 5KOWA 1O6XA 2J0SD 1CJKA 1WEXA 1D9AA 2C3PA 5HL7Q 4CLWA 2DYAA 2JLGA 4USTA 2Y1LB 4CLKA 4A8OA 1YJTA 1ZPWX 2KT5A 1DURA 4MK7A 3J81j 4ZP8A 4HYKA 1H3DA 3UDCA 1ZA2B 4OV1A 1S6PB 3QBCA 4NPOA 1Z2ZA 4ED6A 3C6TB 1SPBP 1VBZA 4GVBA 1BQMA 3TZZA 4ZKAA 2BYCA 5KFJA 1F9FA 1URRA 5MLCV 2VA2A 1A7GE 5A6WA 3OTOF 2GMHA 2BKOA 1C1BA 4DL7A 2DR6A 1H2UX 1V5VA 4Y2CA 3IS9A 4FF1A 1J5EF 2NSBA 1WF0A 3PG9A 1JJ2R 3N5FA 4MT1A 1NJWA 3LGMA 4TU8A 4WK1A 2VASA 4RUAA 3IR7B 1UA1A 2ZWPA 3AAWB 5HJXA 2E5HA 3PVXA 2MKHA 4DEZA 4LF8J 2OPPA 1BC6A 2YH0A 2HWHA 3HFVA 3GCWP 2WW4A 1HMVB 1X4AA 2YKPA 4DX6A 4PQUB 4DZ6A 3R5JB 1AZSB 3BBBA 3WDOA 5H9EK 3QT8A 4J37A 3LWLA 2ZH1A 1HBMA 4WFBQ 3ITHA 4KC5A 2HZVA 1I94J 8RUCA 2FHKA 2J7KA 2ALYB 5LXRA 1ZZNA 2YKMB 5LMNJ 4WIIA 1SUQB 1X4EA 1GMVA 2NUHA 2VONA 3HD2A 2DH8A 3LP2B 1QVFR 2UXCJ 4KHMA 1KQFB 1TL7B 2YX1A 4M1KA 1UMJA 3GV7B 4I0WA 3NOGA 1M5HA 2QTWA 3HJFA 5L9XA 4J90A 3GILA 1HBOB 3M6WA 5DS7A 2R2TA 4DR4F 4L3NA 3JAMY 3UCZP 4XAKA 1RT3B 3PW4A 2BANA 4FXWA 3ZTOA 1TKXA 4NZ7A 1Q7LB 2BACA 3DLKA 1NMEB 2OD6A 3GG0A 4LR7A 3OR1B 4ED5A 2IDLA 2PA8D 1CC7A 2LFVA 1CEZA 1XMQJ 2CXEA 3PXGa 3MEEB 1UTAA 3MMAB 3ZTQA 5B0BA 1ROFA 2RMLA 2MGZB 1MMLA 1O51A 4LR8A 1XC9A 2ZJRQ 2UU9F 4G6VB 2HHWA 3A8IA 3BGRA 4NWBA 3L09A 1TELA 3AH6A 1FFSB 4OHXA 2QJ3A 4CCHA 3AXMA 4H4KC 3CJ0A 2AQ4A 1E6VB 3CXCR 2FQQB 2W7PA 4WXWA 2IM3A 1NPRA 4NMXA 2BV3A 3SV4A 1YG0A 1LOUA 2LQBA 3FUYA 2ROPA 2E29A 1DJ0A 5F8GA 4U7CA 5B0GA 4NRTA 1QAYA 2UUAJ 1RT2B 2B9YA 1R0CB 1RT5A 4RW7A 1APSA 1GTEA 2QGFB 4O23A 3CCJS 2A18A 2W9AA 4LF7J 3DDKA 4K4WA 1HHQA 2IHR1 2V67A 1NK9A 4OI3A 4DL0C 4ZMMA 2HHPA 1FXLA 4B3MF 5G4DA 3Q8UA 4Z37A 4I2PB 1RB0A 1SB6A 4HKQA 4DQRA 1RT6B 1IM4A 2Y8YA 3IR5B 1GAOA 5CYMB 3HXMA 3FK4A 3ISNC 1PAUB 3JTOA 1L3SA 2XWYA 2HVZA 3UO0A 3UN5A 4X66F 5LMUJ 2XY7A 1RZMA 3DM2B 2F4FA 2W2NP 4DPOA 2Q6BA 2KVIA 3LO3A 3QLHA 2VPWB 4Q0BA 3CMQA 2N7CA 1NB7A 1C1BB 3SFGA 1CJVB 2L9NA 4F4ZA 2GC8A 4F0KA 1HA1A 3UNYA 4X4OA 3K7RA 2K2PA 5LM7E 2J0WA 3JAMU 2B5JA 4YOEA 1SJFA 3PFOA 5GAGU 2KG1A 5IT9U 4U67Q 3VAIA 3PEHA 1RWNB 1IBLJ 3VGVA 2VF3A 1XR6A 1KR4A 4CP5A 4MYTA 2JEIA 4KH1B 2YWHA 3SCKE 4U7UK 2OPPB 1WC1A 1UL3A 5C25B 4DR5J 2DNMA 2JEFA 2J9DE 1ZM9A 2R8HA 3P45B 2ZFHA 9ATCB 4AFFA 4K4SA 2M2BA 4Y65A 3EXCX 5D6GA 5JMNA 5HROA 4L74A 5I4MA 5DG7A 3OL7A 5HJYA 5U47A 2DRDA 4P73A 1T05B 2GJIA 4HT7A 3HULA 5BR8F 1SL0A 1B4SA 1PAEX 2FZCB 4F2SA 3C16B 1OO0B 2ZOMA 4Y2KA 4OZ0A 4MIWA 1FK9A 1T9VA 3FFIA 3FMWA 3IN5A 1X0PA 3CCLS 4OZ1A 2DNGA 1RA6A 5KG3A 2CKWA 2PMHA 4CM2A 1ZETA 2NQPA 2GQ2A 1QSYA 4IRCA 3W5XA 1Q8BA 2ZM6F 2BE2A 2CQIA 4ELTA 2OSRA 2QFIA 4GKJF 4KB7A 1FTRA 2E5JA 3VAFA 1A9NB 2DNRA 3IWXA 1TKXB 3GIJA 4KV8A 1HWLA 2DNKA 1QM9A 4DV7F 1M90T 3CNQP 3ET6A 2DGQA 3Q8PB 1YVFA 2QL5B 1KQSR 4JI6F 3M7VA 1SL2A 4YY3J 2LECA 1RWVB 4KGZB 5HATA 2J0QD 4TLQA 4IG3B 2CQ0A 1FRJA 2JLEA 3CC4S 1RJJA 1WC0A 3P8BB 1NO8A 2YY3A 1RABB 2EFQA 2DRAA 3FBCA 2KRBA 1CC8A 3MECA 3MXHP 4KGMA 3TUPA 2ZOFA 2ZC3A 1QAIA 1YWXA 2IM0A 3Q23A 1W25A 2N3LA 3MURP 3K58A 1RACB 3P4UB 2F1FA 3TVZA 2DBBA 4JI5F 4MJKA 1ICEB 2FJBB 3EJMA 1UFLA 2WCXA 4IH7A 2C22A 1T03B 1TKDA 1T11A 5CYQA 1DHMA 5GADU 3U1LA 3Q0AA 2V9WA 1UVJA 2KFYA 3JQMA 1S7IA 4DJBA 3KDOA 3LAKA 1FJ7A 4TYAA 2QE5A 3FBEA 3PO4A 5B0FA 5KFIA 1BMQB 2HHUA 2LEPA 5CZXA 3SDEA 3NOCA 2KI2A 2VG6B 2F4VJ 4YR0A 2KN4A 3QLHB 3IFEA 4Q0BB 1P1LA 1R0BG 1DLOA 2DHSA 2XZWA 3VGSA 2BW7A 2OKQA 4OJHA 5KFXA 3VF0B 1FFGB 4PG4A 1ZA1B 2CNLB 5CAAA 1X8DA 2ZDOA 2KHDA 5EDWA 2B5JB 3PKMA 2HNYB 1BLUA 3T5JA 2WONB 4I67A 2WVDA 2NXCA 3OJSA 4USWA 2MLXA 2LXIA 2HVHA 1XEZA 2L41A 4BDPA 3E3XA 3HHEA 1XN9A 3T5LA 5L9NA 4ID5A 1K8AT 2JC1A 2WW8A 4ECXA 1HWKA 3UVJA 1HBNB 2OPSB 4RU9A 3U1MA 2EWHA 2YNHB 3G6VA 1KOOA 1PC5A 4JBCA 3QNWB 2GVZA 1SJ1A 4P10A 4LFBF 2D9PA 3MFHA 1J5OB 2R8KA 1Y9OA 2WTFA 1UPPA 2XS2A 2P9GA 1SQEA 4ZLPA 4HHJA 4OJ3A 4EBDA 4EU0A 4NLOA 3R1LA 5EUHA 4C8OA 3H8YA 3CF5Q 4CLSA 2RT3A 3HSDA 1X4HA 3H98A 4M5KA 3IO1A 4OYXA 1ZPVA 4NLUA 3VAGA 1JXVA 2BABA 1GMWD 1SC6A 2LVWA 3M2RB 4DWIA 2J6SA 1JXEA 2A2CA 2GVDA 1RT1B 5M2PA 4JV5J 3W2WA 2IAJB 4OX6A 3GTYX 3QO9A 4WFZA 2W4CA 1NHVA 1FXRA 1VC0A 2FLPA 3ENWA 4UW2A 5GAEI 1IBMF 4Q45A 1K9MT 1CJTA 2BE2B 1WSVA 3OQ2A 3SI8A 3HZGA 2ZKUA 4WP9A 2BM0A 4NA3A 2KYXA 3ETOA 1IKVB 5E41A 2CNNB 2HIYA 3C19A 3KNGA 3MWBA 3DRSA 2AEMA 1R3NA 4ZVEA 1FF2A 3WIVA 4IOBA 3R2CJ 2X1BA 4F04B 4J9VA 2YNGA 4HEA9 3HSZA 3GWCA 5DG9A 5KT2A 4ZITA 4ED0A 4JP8A 2VFVA 3KLHB 4DX5A 5B0AA 4KY3A 4RW6A 4R0EA 1VQ4S 2ZZMA 4R8UB 3MECB 2XO7A 1S48A 4OHYA 4IO1A 2Y1JA 2VIHA 3GP9A 4WTOB 3HHLD 1JLBA 4L73A 2RJZA 3KJFB 1JLGB 5L1JA 1BWEA 3OR2B 2QG9B 2XQCA 2QT7A 1T3NA 1UZDA 3RBEA 4UOFA 2V8HA 2CPHA 1S1WB 1S72S 5B09A 1PC4A 4CIOA 2EBGA 4C0BA 1VMBA 2GMLA 3DYAA 4ZCKA 4L3KA 2VFSA 1B70B 1I1GA 2J9CA 3TYTA 4ETXA 3T1AA 1HNWJ 2RRBA 3MM6B 4Q43A 2VDHA 4RU2A 2EC2A 7FD1A 4DV5J 1GH8A 1EAYC 2V2QA 1XMOF 1UW4A 3HSGA 4DSKA 4N76A 5HLFA 4LSNB 4JOUA 2VOPA 1SCJB 1UWAA 1FDAA 2C3MA 6AT1B 5F0UA 2W1BA 4NYPA 4ATNA 2OJ3A 1U47A 1N6QA 3T1HJ 4LFCJ 2GO9A 4CYUB 3Q8VA 1WEZA 2C3YA 2XCPA 3TNVA 3D0IE 4AXIA 4IUFA 2YTCA 5A8WB 2DD8S 2V8DA 2DGXA 2ZBIA 1WG4A 3M8YA 2UVUA 1RSCA 1N88A 4OI4A 2AYEA 1YRTA 2MHNA 1S59A 4LBPA 5HMWA 4K0KJ 3C6UA 2LQ8A 5ETLA 2CQ4A 1KHWA 1ZAWA 4GMKA 1HNXJ 1FX4A 1CS4A 1AA1B 4WJBA 3EX7B 1PKUA 1S99A 2F8MA 2CQCA 2UUBJ 4CLUA 1U1RA 4K4UA 4J9RA 3A8JA 4EYIB 1XR7A 5AE2A 2ZDPA 5KFPA 2MMYA 4M95A 3L7OA 3RAMA 4QIEA 1FKPB 2B6AB 4FBTA 1I3OB 2QLXA 4I6YA 2HFZA 2FUG9 3K5OA 1WC6A 2DNYA 3KLVA 2ZHOA 3L95X 4ZPAA 5FIIA 2BJEA 4G1QA 2HNDA 2PMWA 1JB0C 3D1QA 1MW7A 1F2HA 2LA4A 1HWIA 4OLPA 2BJ8A 3BZQA 4ECWA 2XLJA 3GR1A 4XDDA 1S9EA 4KHPF 4ES3A 1NHUA 2HBRB 1B7YB 5IT0A 2E1CA 2HFSA 4C8NA 2W8KA 3DRSB 2MLZA 1VJWA 3PY8A 1D9FA 3F41A 3QQCD 3JYTA 4OQJA 4ZIVA 4JUZA 4LF6F 3UW1A 1VHIA 4GC7A 4NEZA 2PT0A 1TK5A 4DPWA 2GW8A 3CJKB 1ZOTA 1EJ7L 1RK8A 4BC9A 4Z7YA 2V94A 4RW6B 5HVHA 2GCFA 2VODA 1HNZJ 1RKJA 1U1MA 4ZPVR 3FRYA 1K1SA 5E3QA 5HI7A 2MZRA 2HS0A 3QIPB 2DEIA 1PJ7A 4F3MA 2G2YA 2WVEA 3ISZA 4F3QA 2FPHX 4IH6A 5F8MA 4C11B 2RHSB 2VZ9A 5EX3A 2L48A 4WE1A 2GMJA 3MZIA 2BQ3A 1D8ZA 4NASA 3GFYA 4NLGA 2F65A 5IZHA 1R6YA 2DR5A 4USIA 1H38A 1S79A 1NZ8A 4YN3B 3C14B 5DLGA 2HGMA 2X3DA 4QIGA 5F41A 1XNQF 3AT1B 1NNDA 1WUUA 1Y0HA 1WG1A 3LP1A 1WACA 2JDJA 3DKDA 1ZYQA 1U2RA 2HQDA 4O3OA 4DSLA 1KDNA 2DR8A 3J81Y 3QGHA 2UXDJ 3MUTP 1TU0B 2BJ3A 3SZ2A 1D1UA 1SH2A 2CQHA 2CPEA 4XDCA 2G13A 2ZBPA 2CPIA 2MDAA 4ZOSA 2QL9B 2HHXA 1KS2A 2DXEA 4A8QA 2R3VA 2FC9A 4LSLB 1GQEA 3UNGC 2DHHA 2AGQA 3DI6B 2KFZA 1CJUA 1VHFA 2R8IA 4O44B 3QAUA 2Y3YA 4NOHA 2V8VA 4XK8C 3V2UC 5LJ3Y 1R6VA 4OJGA 4M5LA 4RNHA 4RBTA 5DZ7A 4UTGA 2H5IB 1HQEA 4F67A 2YNFA 1FKAF 2NSCA 4MFBB 4TU7A 2IJFA 1TP7A 2HGNA 4LRDA 2O01C 1MU2A 5C24A 2K1RB 4TY8A 3PKYA 1TL5A 2OFHX 1IN0A 4DFPA 1PSDA 2DCUB 3O1LA 2EFNA 1C4AA 4DR3F 1AUDA 2W7OA 3NWGA 2BW2A 2EXUA 1VQLS 4PPDA 2DY9A 3M2UA 3BKFA 1OPIA 4ELUA 2G1HA 4QWAA 5A8RA 1UETA 2R7TA 1RTDA 2CJ9A 3JSMA 4N77A 4NLXA 1S0MA 4ES2A 2ASDA 3PNIA 4U8VA 2HLTA 1BWVA 1EZZB 1FDBA 4CLYA 4RL1A 1H7XA 5F8HA 5CCMA 2KG0A 2EEYA 4X64J 3MMJA 3NP5A 3O44A 2QMUB 2ZVIA 1NK5A 1WI8A 1R7IA 3ELHA 3WZ0A 4I4BA 1SL1A 1VBXA 3W2VA 2R2UA 4G1QB 2HNDB 1K44A 1FJGJ 3OFEA 3MD1A 5GAGI 1RHUB 4UOGA 2KYZA 2VICA 1IJFB 3J7YU 5CZVA 4ITSA 2H54B 1JLFA 2UV8G 1VQSA 5D0GA 4H4KA 2MTLA 2XI3A 3Q8SB 1S1VA 1TQLA 2PDAA 2CQPA 1IKXB 2DH9A 2HWTA 4Y34A 3ZZYA 3AJ1A 2P2CB 3L9ZA 2LMIA 4K59A 2BKPA 1WI6A 2EFPA 4PYAA 2VFRA 3JYTB 2ZKTA 2ZH7A 1NJIT 4EZ6A 5HN0A 1ZZFA 3IXQA 1H6KX 3MD3A 3WC2A 5AJ3J 4DLEA 2KU7A 4AE5A 1P9YA 3TJ8A 4DZDA 4X66J 1Q7YT 2JH3A 2UVVA 3AODA 3MUMP 3NCQA 3HPOA 2MZJA 3VGTA 2I1RA 2IRYA 4CT8A 3W66A 1RWMB 2ZC4A 2Z58B 1BQXA 1F5AA 2F8HA 1KLMA 1BE4A 2BJDA 1N5QA 3L7UA 3TP2A 2HAFA 2MKYA 3G82B 3UPFA 1Q8IA 5HBMB 4WE1B 3KMSA 2Q1LA 5E5NA 1YIJS 4Q44A 1S4FA 2ZH3A 3I56S 3KG1A 5K8PA 3PX4A 3BO4A 2OD4A 5KFSA 5ETNA 3TQEA 2QZ8A 3AB4B 4ANCA 2GGPA 3QZ8A 4YS2A 1Q79A 3BF4A 5J2PA 2MQOA 2BEFA 3VAHA 3RJMB 2D3ZA 4PAAA 4RW9A 4UQTA 2KDOA 4B3SF 4LFAJ 5FDLA 4P2MA 2HQGA 3WQPA 3HHDA 2HLUA 4O3RA 3EVOA 2QLJB 1UVNA 4DLGA 4JI7F 4ETZA 4C0HA 2E1MC 2QC3A 4M5DB 2B8PA 4C8ZA 1VK3A 3UD3P 3ENVA 3I0SA 2NXEA 3R5DA 3M9NB 1KTQA 2D74B 4KO0A 3LP0A 4D3HA 1DAXA 2DKOB 5DM7Q 2FHMA 4IFYA 3HLUA 1IJEB 1P9QC 1ZBTA 3AJDA 4Q8EA 1KTVA 1T9YA 2RUSA 4LIRA 2HRUA 2I6WA 3V81A 4IR9A 3K17A 3CD0A 3IAS9 2FJAB 3QPIA 1HHSA 2AWZA 1NJZA 3TZXA 3AD9C 1AFJA 4P52A 4GKJJ 3PW7A 4DF8A 5GADI 2OPQA 2J9DA 1SIZA 2G4BA 4DV7J 4DU7A 4JI6J 3MM5B 2Q66A 1UKUA 1S6OA 1VQ5S 3DMJB 2PE8A 1VQ8S 3IM8A 4KFBB 3D2WA 4L6V3 1S4EA 4UY8T 2E1PA 2B4PA 4ZVQB 1G4CA 1T0TV 1B3TA 3W60A 4ANEA 3DLEB 3DRPA 2AZ3A 1U09A 2EG2A 1FEEA 3PJXA 2FVSA 3MR2A 2P9CA 3DLBA 3M05A 3LUYA 2GQCA 3TWZA 1RT7A 3MEDB 4H4OA 4QPTA 3CCTA 3MPVA 4I7FB 4OHVA 1Q53A 2VG7A 2HG4A 3TAQA 4ECTA 1YDLA 5DZ6A 2YKNA 3W64A 2DGUA 3TO8A 5CHCB 2XSJB 3FCVA 3V6KA 4UY85 3W3SA 1JLFB 2FZKB 4AQYF 4LUBA 2Z56B 5D15A 4USUA 2N3OA 4EZ9A 3BR9A 3EZUA 2LXFA 2HS3A 2GHWA 1JJ4A 1HNVB 1WTBA 3NKYA 5DJBA 2ASYA 4OX8A 1LWCB 4LF4F 2KZZA 3EWGA 3NGKA 4ECRA 1TL4A 4ZP6A 3K59A 3D54A 4C0OC 4FF3A 1U7LA 3OHAA 4OYMA 1R0AA 3CTRA 2DHXA 4WYWA 4YDDB 2N82B 4FN5A 3FJ2A 3GR0A 4RW4A 4UF4A 1H72C 3Q8YA 1EP4A 3TJAA 1VLOA 3NGDA 4NXNF 2F63A 4ZVPB 3CCWA 1KVIA 4Y28C 5F9LA 3CCRS 5T7LA 2MSTA 3QFWA 4YMEA 1YHQS 2YWFA 1HARA 1SC1B 1TKTA 5CH7B 5D4OA 4ZLLA 4FYXB 4ZJLA 1DTQA 1SV5B 2V4QA 3SYZA 1HPZB 4FKYA 3R5BA 4NI2A 4K4VA 2JLFA 4ECQA 2RF2A 4Z7CA 4CM0A 4WFAQ 3OBIA 1E6YA 1UVIA 1QTNB 3D3CJ 3JB9k 5LSLA 5ETSA 2BOAA 4WK3A 2WOMA 4A46A 1CSJA 2LDIA 4QWBA 2O67A 1FD8A 2RRNA 3CIZA 4IRDA 4KGXB 3CGIA 1SC4B 4K5RA 3I9V9 3FVYA 4FXVA 4XTTA 3TARA 2CVIA 2LQJA 4LJMA 4NLQA 2AJ4A 3OUYB 3HM9A 3ZZPA 3VCDA 3RBZA 4FKXA 1EETB 4CO1A 2V34A 3DOMA 1YSJA 2KH9A 1HKAA 2E9ZA 2ZZTA 3MEGA 3MMBA 1MN9A 5F3TA 2HZAA 4WTYA 5KFMA 3FCHA 1R89A 2V0NA 2W2PP 5ETPA 1R8BA 3RR8A 2MKJA 1SBRA 2B51A 2CQGA 3NBPA 1IR1A 3NRBA 2YPZA 1W2IA 4KO0B 2M88A 1RT4A 2V4JB 2CJXB 3M32A 3DGVA 5J2QA 4IFYB 4NA1A 4R0JA 1TV6A 4KYZA 3BDEA 4JI2J 2OSQA 1DQ8A 3V81B 1FE0A 3M8PA 1GK8A 4MKAA 4Z2XA 4UOHA 1W7WA 4DF4A 3IWLA 4O4GB 1RP5A 2E7VA 2FDNA 4DL5A 1NK8A 1U6BA 2CJKA 2DRBA 2C28A 2E5LF 3WBZA 1RWWB 5K8MA 2J76E 4PEOA 5KFYA 3R1HA 4NLYA 2E44A 2XNQA 3LGHA 3EYZA 1X4DA 2W4PA 3K2YA 1YITS 5KT3A 1RHJB 4P72A 4K2JA 1SKWA 5K14B 3ZZ0A 1PCAA 3I31A 1HQUA 2HNZA 3V4IA 4Q7AA 4DV6F 1R8CA 4P2XA 3VAJA 3OW2R 4WZMA 3KK1A 3DDIA 4Y2AA 3X1LB 3GSDA 5A8KB 2AJ0A 3UE2A 3P5TL 3MM9A 1Y3JA 2BQRA 5A76A 3HI9A 5IC6B 3NGSA 3LA0A 2VG7B 1NH7A 2B8QA 2WVFA 1X7VA 4NCGA 4RW8B 4UQGA 3M8SA 3KLIB 5F8LA 3ZO7A 3POTA 5HP1A 2W2MP 3GV5B 4HVZA 3LH2S 2IJRA 3IBFB 2FJVA 3OTCA 3LAMA 3D6MB 1GX5A 1NDPA 3R5AA 1N0VC 4CH1A 3OTDA 2HVIA 3RB3A 1Q95G 2VQEJ 3A4TA 4J9NA 1FWLA 2OEJA 1LXJA 1N36F 1S9FA 5HMZA 4B9MA 5KFEA 1OYEA 4ZVTB 1FE4A 1RTJA 2VG5A 4RX6A 3UDEA 4DR2F 3OHBA 3T1YJ 2F5GA 2HKEA 3OL9A 2OO4A 4BC7A 3FEXB 1Q82T 5HAOA 2LEBA 4AD6A 4LVOP 1ZH5A 1RAOA 3MFIA 3AHPA 1XMOJ 4ZPDA 4C3KA 4M5HA 1CPZA 3R3TA 4ECSA 3IGVA 1FFWB 2KM8B 5KFHA 4I2QA 1NKCA 3IP0A 4N47A 1T7PA 4E0DA 2QFJA 2ZJPQ 2IMOA 2RQKA 4OMFG 3GIRA 1SJRA 4NI2B 5AXMA 2G0IA 4TVAB 4ZP7A 1YRXA 2AT1B 3M8QA 3CSKA 3FEZA 1VRTA 3I96A 2V2ZA 1NKBA 5E33A 3CC2S 3AD7C 4NLVA 1FJEB 4O3PA 1G6BA 4LF1A 4W98A 3MM7A 2IJNA 4FVCA 3DOLA 5A0YB 3MM8A 2OGUA 4DMZA 4NLDA 3VQSA 2IDEA 4L76A 4DSEA 3A8KA 3HP6A 2EKNA 3BSOA 4PQAA 1YX2A 4DV4F 1VFJA 5D78A 3QRRA 2ZNZA 3CJ5A 4LF5J 4DUTA 3CEDA 3H59A 5HQ8A 2AYBA 4B9NA 4YDXA 4DX8H 2RU3A 4ID8A 1CULB 5GMEA 3NNAA 2XMUA 3MEGB 1RAFB 5M2UA 1KSPA 2KXFA 1AW0A 5KG4A 3F56A 4CO0A 2CWKA 1P8GA 2DNLA 3N79A 1X5SA 5D4LA 2MPUA 2DH7A 3C15A 4DV2J 5KT7A 4PXDA 1IR2A 1FESA 2VPYB 2Y8WA 5FJ4A 4DBQA 2VKZG 2DNPA 1SQFA 1PJ5A 3TX0A 4F4WA 2FZGB 5J2QB 4ZLJA 3R2DJ 1FO1A 1PIEA 2JFDA 4LF9F 3A3NB 1I6JA 2YWWA 2HQIA 4WZQA 1FI4A 3RG6A 5EWGA 5KFUA 1TL3B 4HR2A 2DO0A 1S6PA 3C6TA 3QIDA 4YB1P 4B17A 1KWMA 3AA8A 1T9UA 2EFOA 3NGTA 3TR5A 1UCNA 4DG1B 4ZIWA 2ZBRA 3NAIA 2AGPA 3M4XA 2XWXA 4CWBA 2F9JA 1BQNB 3GQCA 1I51B 3TA1A 3DFEA 4X4QA 2HGLA 4OX9F 3V4IB 4USKA 4WBFA 1MWZA 4J9OA 4JV1A 3TOQA 1J27A 3T6JA 3CB4A 4OZJA 1GMUA 3CD7A 2CQ2A 1B99A 3I87A 5IS2A 3E51A 4QBUA 3H40A 4FF4A 2CDQA 1LW0B 4NYOA 2XHWA 2XS5A 5L38A 2BE7D 4AL7A 4DR1J 2VC1A 3IM9A 4KGVB 1F5CA 1HMVA 5BYQA 1JLAA 2W9BB 4PQUA 3MOJB 1UJ6A 3GB0A 4DUZJ 1S6QB 4PXCA 2G9OA 4IFVA 2MZQA 4DL4A 3A3OB 1X9MA 4QYRA 1XNQJ 1ZS6A 4USJC 4WPAA 5BYRA 2I5JB 1U4BA 3R7BB 4DN0A 4HDGA 4PUOB 3DLHA 3F73A 1X0FA 5DGAA 2VPZB 3D6FB 4HHHA 1Y3KA 2VG5B 4RBVA 1K0VA 1PGZA 3CD6S 3PYFA 2NXNA 3HSJA 2YKMA 4I1TA 4F3OA 4RNFA 1SUQA 3HF5A 4Y00A 4NCBA 4EMDA 3M1VB 3PR5B 2XY6A 4ZVRB 2CJYB 2PGCA 3LP2A 3JTNA 1N56A 3RAXA 2JEJA 3VHQA 1C1CB 4RBUA 4ZDNA 2Z2LA 1Y7PA 1CLFA 4PYDA 4O0IA 3CJTA 3LW5C 2FJEB 2WRMA 3PZPA 1VQNS 2ZE2B 1HW9A 4RNOA 1RT3A 2UUTA 4WWSA 2D69A 3O6QA 3FDSA 4K5SA 3BYPA 2DB1A 1GEHA 2YNIB 3KYLA 1YJNS 1RHQB 4FYWB 4B3RF 1RWUA 3OR1A 3J7YI 3MM7B 5EGYA 2R8JA 2WHOA 4JI3J 4CH7A 2ZD1B 1WC3A 3MEEA 3BO3A 2AX0A 2HFUA 3MMAA 3RRGA 2AZ1A 3FNNA 4OZ3A 3U1NA 2MGZA 4QZVB 3EVWA 4J9UE 4BS2A 2G2OA 4F25A 2FYXA 5A2QU 3ZZZA 1PJ6A 3ICLA 4M5NA 2C2RA 2LKZA 5GAHU 1VBKA 3UR0A 3NAHA 1FNXH 1AROP 2ADCA 2IIHA 3BGLA 3K8VA 1E6VA 2RB7A 3GJSB 3MF5A 3FMBA 2GHVC 5KT6A 3HK2A 4M63A 1PYTA 1IVZA 3HX9A 4YR2A 4USHA 2IA6A 3CJ2A 2XNRA 4UUXA 3CC7S 2ACYA 1YLXA 2J8SA 1NH8A 3PTWA 1RT2A 3S1TA 3QRPA 4F8RA 3J7A1 1WG5A 4DQQA 1U1OA 3Q86A 1I94F 2AJFE 3MOZA 4DV1F 4J9SA 1LQ9A 1HNIB 4MIBA 1KQGB 2BKNA 4ZP9A 5LMNF 4I2PA 2A2DA 1S0NA 1XTZA 4EGLA 5B0EA 1FDNA 4QWDA 1RT6A 4A8XA 2UXCF 1YI2S 4OYIA 1UJ5A 1RCXB 5CYMA 3J80Y 1K73T 4FS1A 2YVSA 2K3KA 1U8SA 4NL5A 2DGVA 3DM2A 3SFUA 2HFOA 2C42A 3CDWA 5F8IA 4EUVA 2MXYA 4JI4F 1TAUA 3KDNA 2JOQA 5DDOC 1CJVA 4DOZA 3UDVA 2JL9A 3PIOQ 1X5PA 3GJQB 4FYYB 4X4UA 3AQPA 5CD4A 2RQMA 2B7CB 3HFZB 1B7FA 1U2FA 4BBYA 2BMBA 2IPOB 6FDRA 1OY6A 3CCSS 1EQMA 2WBMA 1YBUA 1C0UB 2AIRB 2PI5A 5B0CA 3G2XA 1UWBB 2GFFA 3FCWA 2SXLA 3HKZD 3HO1A 3EICA 3ILIA 4ZLNA 1QDUB 5K8OA 5C25A 3NEKA 2AEJA 2RD5C 1JLAB 3OSNA 4G3IA 1YBTA 4IFVB 3CULA 1QAJA 4ED8A 5J2NB 2CDRB 1ZTTA 4O4RA 1NSAA 3EDQB 2CAJA 2R7VA 4RR5A 2R2RA 2B4UA 3T19A 3T9NA 3D67A 1T05A 3IG1A 3OL8A 2R42A 2WAQD 5L1KA 3C16A 4F4XA 3KJNB 4KSEB 2XMMA 1RA7A 1YRUA 3MAAB 4ZVGA 1BUXA 3BEGB 1DBDA 1N4LA 1TFYA 2UUAF 3CVKA 4UZCA 4JI7J 2J7UA 2Z57B 3US5A 2LQ5A 3VWSA 2LYVA 2UXBF 3KTQA 2VA3A 4G1PA 3FZ2A 3UD5A 4IG0B 2H9ZA 5H9FK 3M2VB 4OHWA 3HHLC 2M3DA 2APOA 3UDLA 4DHVA 2V68A 2NLWA 4H4MB 1P27B 1WDDA 4ZPWR 5ETRA 2RU9A 5LMUF 5HVFA 2OI2A 3J80U 5JXSA 2HFVA 2B9XA 3WC0A 3QGPA 4X84A 3MDFA 5H9EJ 3BPDA 4HTJA 4IG3A 1NUEA 1FERA 1MG7A 2JZ5A 3AQOA 2E9TA 2JC0A 3OXLA 2YH1A 3W9IA 4G65A 3EXYA 3AOCA 2EPIA 4F0MA 3PYEA 2R7OA 1NAQA 9RUBA 1OYDA 1WC4A 4MH8A 3W63A 1TVRB 3H20A 3PM9A 2DK2A 4LT6A 1Q1KA 3GIIA 4CLLA 4CO3A 5ITHA 1EKSA 2FLLA 1ZM2A 4OJ1A 3M8RA 4QIWD 1RAHB 2GHPA 4LRCA 4ZCIA 1VRUB 3RU0A 4MYUA 2OH2A 1T03A 4QIVA 2C2EA 3RUBL 2CPYA 4X4SA 4C97A 4DSIA 2CUYA 2CRLA 4P9SA 1TTHB 2FHJD 3CCQS 1RXOB 3MGJA 1VRQC 4AQYJ 3BKUA 1QE1B 2MEWA 4RPFA 1V5IB 2KL8A 2QA2A 3LGNA 2ROEA 1MMNA 3CJ3A 4MK8A 2HIQA 4CLPA 5JUMA 3MPDA 4NLRA 5J1EB 4LF4J 4NXMJ 2FD2A 2RNEA 2D1CA 2VG6A 1RHMB 1M0SA 4URQU 1WELA 1X9SA 3W8PA 1VLYA 2VL1A 1Z2LA 3MUVP 4NXNJ 2OUGA 2DEJA 2QLWA 1SKSA 4J9LA 3NXZA 2HNYA 4KQZA 2CPXA 4JV0A 2WONA 2BOPA 3I9ZA 5J2MB 2R7SA 3LPYA 3MR3A 3CJ8A 4URSA 3TW0A 2IVYA 2E1AA 2FVCA 3G86A 4LMZA 4OIXA 3SIPB 1TZ0A 2K06A 3NY0A 1MSWD 5H1SV 4ZHRA 4ICLB 3RW6A 2HSEB 1HBNA 2OPSA 3GV8B 2YNHA 4M94A 1Y5LB 4ZPBA 3D9BA 1GXUA 1RYRA 3U27A 2FVRA 1J5OA 4K50A 3VVTA 2KXNB 1T95A 3QJLA 1DRZA 3IBWA 3QT7A 3CJSA 4PG8A 2DNQA 2ATCB 2VB6A 2JHEA 2J6TA 4LQ3A 3BSCA 4MKYA 5G0RA 1GXTA 3IG1B 3AA9A 3HVTA 4TY9A 2YQ3A 4P7VA 4FS2A 1DFDA 5LSRA 3GCXP 1R8HA 3K5MA 1S12A 3M2RA 1ITPA 2XC9A 3THPA 3KMQA 1RT1A 4TU9A 2IAJA 4DDFA 2LP4A 1SH3A 4YB7A 4CTAB 1VC6A 4ZN1A 3RBDA 1U48A 2AYMA 2DCLA 4QWEA 2Z30B 2R4FA 2QA4G 2CJBA 3H5SA 4JI1F 5L39A 3BM7A 1WKLA 4NE9C 2POKA 3DRRA 3VQTA 2HK2A 5BXIA 3GJTB 1IKVA 1FNMA 5HMYA 1JWWA 4HI2A 5AE1A 1U02A 2VQFJ 1CG2A 3HVAA 3PCOB 1DARA 3R97A 3PO5A 3V6HA 4JI8J 1J2VA 4ED1A 4E98A 3A1YG 2F4VF 1GNKA 1NRKA 1NJXA 2YWKA 1S1TA 5KFDA 2LDYA 3JQJA 3KLHA 4DFJA 1JIHA 1SIWB 2IYIA 2NYHA 1DZ5A 1KVKA 3E2EA 4ANDA 3KG0A 1VQKS 3VALA 2Y1IA 1TKZB 4Q2MA 4RO0A 3BDPA 2HVDA 4FXDA 4R8UA 3ENAA 3KOAA 1N0UA 4DPUA 1WWHA 3D1HA 2B0GA 2MQPA 1RBOB 1S5ZA 3TVKA 3DGPB 2OMLA 3IRXB 3NG8A 4J9KA 1SJQA 2G2ZA 1O8BA 3FBBA 2FJDB 2BM1A 3H25A 1TK8A 2J8AA 3PACA 4PG5A 1JLGA 2ZEJA 3MR7A 3OR2A 2E9RX 3SSQA 2NXUA 4B3TJ 1C0TA 1Q0NA 3J7ZT 3KLGB 1DQAA 1S1WA 1YK9A 1WHVA 4CO5A 3DU6A 5RUBA 2JX2A 4KGKA 3KJVB 3G9CA 5KFBA 4IKAA 3KFWX 3L4BC 4PWDB 2B43A 2KM8C 1VQPS 3KUGA 4DL6A 3VGUA 3MM6A 4A8FA 2ACMA 1JLQB 3ZTRA 2EG1A 1N36J 1TMMA 2E7XA 4EBEA 4JV5F 2RHQB 3G4SS 4LSNA 1UJ4A 1Z4UA 4DR2J 1SQGA 3BYRA 1RYSA 4DQIA 3J7Z5 3SV3A 3SBMA 3T5KA 1HL6A 5HSPA 1LV5A 2UUCF 1TUVA 1R27B 4QW9A 4C8LA 2A10A 2B4OA 3B6BA 3C46A 4DPTA 2DR9A 3EGWB 1BXNA 1N32F 1RTZA 2NCKL 1EQ0A 3B82A 2DO4A 4CYUA 2N4DA 4FDFA 3IAM9 2QX0A 3P5BP 5BJRA 5A8WA 4JI0J 3W8GA 1VQ7S 1JLCA 2FVQA 4USVA 1FEHA 3I55S 4ZHRB 3PHEA 1FDDA 3R8YA 3DXBA 4U7UD 3SCIE 2MYFA 2B9WA 2E5GA 3TQ1A 4OYAA 5D0EA 2DJWA 2J9EA 4UT4A 4ENOA 1I5OB 2AKWB 5HK4A 4FNIA 4G1IA 2JFKA 5KFFA 2CNOB 5HO4A 4AYBD 4ZN3A 5G0RB 2KKHA 3Q24A 3S8SA 2G0JA 3HVTB 4X4PA 3NMRA 4ED2A 1RHRB 4P2FA 2VV5A 1FKPA 2B6AA 4DXLA 4UOCA 3T5HA 3LWMA 1U0SA 3CDEA 5T14A 2AEFA 3D66A 4B9LA 3EZ5A 3W7BA 2MKIA 4K7QA 4RWXA 1YJWS 2JSXA 2ZH8A 4R25A 4D3GA 5KFLA 3DRRB 4K4YA 2XTJP 5K5MA 4C3LA 4RUHA 3BB5A 4OL8A 1N34F 2ZUAA 3D0GE 1HQ2A 4DV0J 3PHTA 4GKKJ 5GMDA 3FSIA 4CO2A 2OELA 2IC3A 4RJVA 2K8GA 5L8RC 3OJUA 1S57A 4K8RA 1QD1A 5KAKA 1NDLA 3OVAA 1S1TB 2RVJA 5KT5A 4V19J 3IMQJ 3R7NB 2DGTA 2LCWA 2W9CB 2XZTB 3CJKA 1L3TA 2V2VA 5KFKA 3T1HF 4BWMA 3MR6A 2JVOA 3E01B 3BGOP 4HACB 2MJUA 1UVKA 3HJVA 5CABA 3SQGB 3G8QA 1RBLA 1IQTA 3QIPA 3K5LA 4F4KA 1R8AA 4EWTA 1OPZA 2HRYA 1N33J 4OX9J 1S7HA 3ZNJ1 2WZ1A 1RU1A 2NUUG 3QFHA 3HVRA 4C11A 4R5PA 4FVMA 2HZCA 3KNAA 3CPWR 3C8YA 1W26A 2B9EA 5IWAJ 1BHNA 1C0TB 1DTTB 5DDQC 3GFZA 5I42B 3GU0A 3C14A 2AV5A 2UUBF 2BDPA 2WK4A 1N5SA 4WKRA 2NZCA 3RW7A 1QUVA 2Q6CA 4EBCA 3CCZA 1F9HA 1C2PA 3MMCB 1F0XA 2RQCA 5F8JA 1Q78A 1NK0A 3K0JA 2YQ0A 2IY5B 4X4TA 1IKWB 3AB2B 3NNHA 4LSLA 3CE8A 3DI6A 1LFWA 4TQSA 1ULRA 1DY3A 2FY8A 2BUNA 3X3UA 3TZYA 4O44A 1IXKA 2V5HG 1M5PC 2D7SA 5GAHI 3V6DB 4LREA 2F40A 4ERDA 3GYGA 1RWKB 3TAMA 1M1GA 2ZUGA 1UA0A 2CQDA 4MFBA 2A6MA 1FTCA 4J9QA 1FD2A 4MMOA 2J6UA 3H90A 2K1RA 4KHRA 1JLCB 2FB0A 3KK3B 2O1PA 1Q16B 4NEYA 4QU6A 1WKKA 2VPXB 2NR0A 3PV8A 3M30A 1NPPA 3O2IA 4N41A 4N5SA 4B3RJ 4YB6A 1SKRA 3Q83A 2YWEA 3TUZC 2V9KA 1FHTA 1HNZF 5HVGA 4FPRA 4I56A 3HFKA 2DHAA 4O3SA 1U1LA 4N8NA 1S1UB 3BSAA 1LK7A 2CPJA 2C2KB 4DR7F 3H5YA 2C2NA 2QSFA 2YX4A 2IMWP 1LFPA 4F02A 1K47A 1NSQA 5C5JA 4TXSA 1EARA 1RWPB 1GT8A 1O0PA 5ADZA 3M9MB 1V6HA 4F2RA 2ZBCA 3DDNA 4A8SA 3OLAA 4LRAA 3NNCA 1RCOB 2M52A 1QTMA 2H4WB 1HWUA 3BGUA 4OFZA 2J0XA 5F0WA 1AB8A 1XNRJ 5M2RA 3QSIA 3GFHA 3U7JA 3ZC4A 2HMIB 4OI6A 1M5KC 1UFKA 3W62A 4XIUA 1EB0A 3QAEA 4NZ0A 1SKUB 4FF2A 1VQYA 4OYBA 5KTQA 1UZHA 3G6XA 2UXDF 1JXLA 4KIAA 4PWWA 4QPXA 3UN3A 3KK2A 2AJQA 2HWIA 3EPGA 3PIPQ 1IKXA 4NLSA 1MROB 2IC3B 2L08A 2L3MA 2MQQA 4DV1J 2OLWA 1N5YB 1RU2A 2AGOA 3RTVA 3OV7A 3I0RB 2XMWA 3H2VE 3K8WA 2F7VA 4OHZA 3TEHB 2DNNA 4B3OB 2RS8A 4IDKB 4WXOA 4NX9A 4J9MA 1AFIA 2EK1A 1M1HA 2VBYA 3OTOJ 1MMDA 4X4RA 3G8SA 4JI4J 4Y2IA 1RHKB 1VS3A 3KLEB 4PXEA 3OVBA 2ZJQQ 3UWTA 2RDJA 1REVA 5IM0B 1J5EJ 5IT9Y 3N0VA 3KJQB 3G82A 4R5PB 1FVSA 1LKZA 3MTJA 5HBMA 4F36A 1F9EB 2XMTA 3AOAA 2WVCA 3PEJA 3PX0A 2MB0B 1HWJA 1W2BR 2MQLA 2X7IA 4N7TA 2IM2A 2H4YB 1GMWA 4DCOB 1D9DA 3J7AN 3QRQA 5DQGA 2ZZNA 5LT5A 2XGPA 4KPYA 1G2EA 2ROGA 4NYZA 4X64F 2OPRB 3AJ2A 3RZAA 1EHWA 3N6NA 1EKRA 4WFXA 4EK2A 3O5TB 4ZJOA 3MTKA 1ZM4A 4NZ6A 3VAMA 1NSKL 3MAHA 3H2LA 4M5MA 4XO0A 3FBFA 4M5DA 1M1KT 1FJGF 5D77A 2ZH2A 3H4BA 4DV3F 4OI2A 2RILA 2KZMA 4B08A 2P6TA 4LRFA 4TYBA 5E3RA 2MQMA 1U45A 3FSYA 5DQHA 3NL0A 3TAMB 4DL2A 4DR6F 1CJKB 3W5ZA 5BYSA 4CRJA 2GAHC 2DHGA 1LW2A 2OTJS 1WDTA 5DRKA 1ZAXA 1YBAA 2KO1A 1FT8A 2UXBJ 3RRHA 4DR4J 4A8WA 4U6PA 1S10A 4NRUA 5ETMA 1FA0A 4GVBB 1BQMB 2FTRA 2EI5A 1RTIA 2BZ2A 3M30B 4I6WA 5AJ3F 2VBZA 1QSSA 3MM5A 4MTPA 2B4VA 3DMJA 1OQ3A 1BD6A 4KFBA 3HHLA 4JB8B 2M8HA 3EM1A 2PFFB 4PXBA 2LLZA 4QOTA 1VGYA 3GIKA 3E8OA 4OYOA 3IWNC 3IS9B 5C42A 2HHSA 3DLEA 3UCUP 4J5OA 4FYVB 1H2TZ 3N6LA 2UU9J 4MKBA 2HHVA 4BHQA 3U02A 2GQQA 1NKEA 2PFDA 3MEDA 5K20B 4AL6A 3IRWP 4I7FA 1WHXA 2GO8A 2QIFA 2AYGA 2GV1A 1RADB 1LNQA 1KHVA 4OZLA 1RLDA 5EWEA 2U2FA 3KHGA 2XSJA 1S1XA 3JXOA 4OZ5A 4P74A 2NS1B 2QMWA 3HZEA 5IOLA 2C1EB 5CCLA 1A0OB 3ZZUA 3S01A 1VR6A 1YQHA 3KK2B 2VDIA 2CPDA 4ZVHA 2P9EA 3D7SB 3J81U 3RB6A 4OZ2A 4LFAF 1HNVA 4L72B 3A8EA 4C3MA 3VTIA 2KJVA 4FNHA 2FJWA 3GONA 1HBMB 1LWCA 4NLTA 3ITHB 4HLBA 3EGZA 2XYPB 2IBKA 3K5NA 2IRXA 2WB4A 3BO2A 4B3MJ 1HW8A 2PMZD 1T3OA 3A12A 2CA9A 2V4RA 4IO9Q 4JYAF 1XBWA 2JRSA 1QSLA 5DGBA 3V6JA 2AD9A 1V3RA 4WYLA 1KONA 2JNJA 4CDIA 3K89A 3PFEA 2XLIA 4YQWA 1TAQA 3PYDA 1LEOA 3P6YC 4B9TA 4K4TA 1IR0A 1SV5A 2M5YA 1FVQA 4U9RA 1HPZA 1YJUA 4ZCLA 1CVJA 4WIQA 2NXJA 2RKIA 2P6SA 3UN2A 2GAGC 3DU5A 2UV8A 1REVB 4CNZA 4Y3CA 2RRAA 2BANB 2OFGX 5KFGA 2CWXA 1HR0F 3CCES 2MQNA 3DLKB 2H5EA 5LOQA 5D0RA 4ILLA 3PJWA 2WSEC 4IOAQ 2HQ3A 4K4XA 3LOUA 2IFXA 2NYIA 2VBXA 1RTHA 4EFAC 4BWJA 1REGX 3OUYA 4A8KA 5ETQA 4AT1B 2XB2D 4LR9A 3GPAA 1U8WA 4QR1A 4F0HA 3BR8A 1IKYA 3VR1A 1EETA 4K2XA 4Y6IA 3BGRB 1U6FA 4EO6A 4YR3A 3M6XA 1OWXA 8AT1B 3N4WA 4NMLA 3OFHA 2UVRA 2DXFA 3HT3A 4HL9A 5J1NA 2D41A 3FGVA 1U24A 3BJYA 3GZ7A 1Y5IB 2PI4A 3JSYA 5BR8J 3W5YA 4DSFA 4GRSA 1R43A 2A3JA 2Z8QA 2XLKA 5KFZA 2E66A 2BJ9A 4LSZB 2BXJA 2XS7A 2PA3A 1WSRA 2V4JA 1T9XA 4P7TA 5LL6d 4M5IA 3W61A 3H7HB 1WKJA 1RT5B 4RW7B 2MQ8A 4EYHB 1LW2B 3L3CA 3CT9A 4JI1J 5B08A 5HQLA 4ZCMA 3K5PA 4A4JA 2ZM6J 1OY8A 5KFRA 2AMCB 2N4CA 3ZTSA 4O4GA 3KXDA 3DXSX 3DOKA 3KHRA 1YJRA 1KBRA 3CIMA 1VQMS 1RTIB 2KHCA 4PKDB 3O8WA 3VAKA 1IM6A 1FRIA 4X62F 1X60A 1P1TA 1Q8LA 3HHLB 3NWRA 1GX6A 2BRKA 5L46A 1WF2A 3I82A 1ZAVA 5K14A 5L1LA 2R7WA 4QJVA 4J91A 3TI0A 2LU2A 3CJQA 3NCRA 5C42B 4DUYF 2DITA 3QGGA 4CLTA 3F0NA 2MZSA 2IRUA 1OS5A 1NDCA 3DHXA 1UVMA 1RWXB 4CNYA 5A8KA 2C2MB 4ZA1A 3QT6A 2FLOA 3H0PA 4RLEA 4RW8A 1S76D 3Q2TC 1Z1ZA 3KLIA 4RWWA 2U1AA 3OXFA 4P2SA 2GJ2A 2XMKA 3TUIC 4KE5A 3EDRB 1S1XB 4CI0B 4JI5J 3GFXA 2YKAA 3MR5A 3QATA 3BREA 1PG5B 2VC0A 4DL3A 2LA6A 4Q8FA 3DRYA 5HROB 1R31A 3GIMA 1P6TA 3QSYB 1RLCL 5CQGA 1S0VA 1JNZB 3LTOA 4B9SA 1RKIA 1QVGR 3KUHA 2ZH9A 4NLPA 2HHHF 1WJ9A 3H5XA 1JMTA 3EUNA 4I68A 2RH3A 2CIMA 4P6QA 3WIUA 2DNOA 4NA2A 5AE3A 2QLFB 3NS6A 1FK9B 3OTBA 1TL1A 4W90B 2CYYA 3FFIB 1AT1B 2RUGA 3MCMA 3I5CA 3KHLA 4ER8A 2H1YA 3N9UC 5E7OB 3ILJA 3C2PA 5IT4A 1NZAA 2UUCJ 5KT4A 4M5JA 2M9KA 4JI2F 2DGSA 1VCTA 3DLGA 3BN7A 3M6UA 4ZVUB 3P49B 1N32J 2RKIB 3B4MA 3BPSP 3R7SB 1TFWA 2W01A 3T9ZA 3NLCA 4LBIA 3R5GA 2KT2A 1M5SA 4B9VA 4KV8B 1UW9A 3ET6B 4WFYA 4Y2MA 1NB2A 3CO9A 5D8HB 4TKTA 2BRLA 4ZVOB 4WP8A 2X3GA 2CQ1A 5A0YA 1EX8A 1CQNA 4DS4A 4FYDA 1NK7A 1JJCB 4PRFA 3A3PB 1RTHB 4LBHA 5K8NA 4LFBJ 5KFOA 5LXYA 3Q22A 4X2BA 2VD3A 1IKYB 1F3VA 4ECVA 3MPUB 1VQOS 5EX0A 2OEMA 5DG8A 2PN6A 3ILLA 3QYYA 1CULA 1FCAA 1JQGA 4DCJB 2RDIA 4OYZA 4JV2A 2W2OP 2UUWA 2RE1A 2W24A 2X1AA 1U1NA 4QU7A 4Q5VA 1RDRA 4KAIA 1OSCA 5KFQA 1X9WA 2V8PA 2OP5A 3BQ0A 3UCGA 4P75A 2F3JA 1PBAA 2VQEF 3WX4A 4A47A 4ZPTR 1ZM3A 3ADAC 2XSFA 2JJ4D 5CYQB 2HBQB 3UFCX 2HFNA 5KFAA 4B9UA 4H54A 3CMES 1PYSB 1IBMJ 3T1YF 2BBEA 3B78A 4DQPA 1TL3A 4PPZA 4OZNA 4EO8A 3G96A 2YKOA 4ILRA 2NREA 3DOKB 5CD4H 3CCVS 1N34J 2VJVA 3SXLA 4UZBA 5C7PA 2XYGB 3EGNA 4C9DA 2GIQA 4DG1A 1HLWA 3VVUA 3SDEB 2QL7B 4F7VA 1M5VC 5I3UA 3CDAA 1PILA 2QEXS 1BQNA 3MCSA 1DLOB 2E5IA 2ZITA 5IC4B 2DTJA 1MN7A 5F9NA 1Y10A 1VK8A 2DR7A 2CNKB 4IQMA 1VI7A 5F3ZA 1XJWB 5IV3A 2R7UA 1S49A 1FRXA 3B4DA 4CZCA 3UI3A 3TUJC 2YPYA 2N7YA 4DN9A 1UEVA 2Q43A 4ID5B 1LW0A 5KG5A 3MHYA 1SJ3P 2X1FA 8ATCB 3UVJB 4NCAA 1Y5NB 2YXLA 2HAIA 1M5OC 5ETVA 3RR7A 4WCEQ 2GVZB 2W9BA 4LF5F 3TX8A 4MK9A 4CQ1A 3BQ2A 3ISND 1S6QA 2G1DA 1N54B 1AYEA 4YHHF 1T02A 2I5JA 3JQKA 2KB2A 3OVSA 5ETOA 3AXKA 4PUOA 3P96A 2VU5A 3CMAS 2GJFA 1KC8T 1F60B 1S77D 1NK4A 4AL5A 3QWPA 2QV6A 4F4YA 3ZXWA 4DV2F 4O3QA 3PDNA 4OV6A 4ED4A 2PD1A 3M1VA 2BJ7A 1N8RT 2CG8A 3BH6B 3H2UB 1U0HA 3HKWA 3D4JA 4GC6A 2H65B 1TL1B 4V1Ak 1X31C 2AJ1A 2GVDB 1G7CB 1C1CA 3B8HA 3W2WB 1SXLA 3QO9B 3HCXA 1NEEA 2QRRA 3PJ9A 2CQBA 1L5UA 4M5GA 5IV4A 1JNRB 2ZH4A 2PSZA 3OL6A 3DLGB 2ZE2A 3GE9A 2X51A 2AX1A 2HW3A 1CJTB 4IH5A 4O3NA 2RSQA 3MPWA 2K3IA 1N52B 1SVDA 3W1YC 3GG1A 2YNIA 4V19X 2OIHA 3PW0A 5CA5A 5E0OA 4DPYA 5IQ6A 1H98A 2HYIB 2E7WA 4U95A 2ZD1A 4AXJA 3I5AA 5FD1A 1XK8A 1S97A 2ZOGA 2DPIA 2ATLA 1WF1A 2K7JA 4HHUA 2YNGB 4X65F 3IR6B 3O3LA 4A8YA 1U6ZA 2QSWA 1O5JA 1FRKA 3R5CA 3DCAA 1WC5A 7FDRA 3JSRA 1X4FA 2ZVSA 5KFTA 4DCPB 2V8GA 1YGYA 1KN6A 1V3SA 2ZWOA 1KRPA 4KRWA 4C8YA 4DR7J 2WVBA 5J1PA 4KT0C 1Y00A 5DDRC 1VIXA 1JLBB 4FZVA 1OSDA 2C2DA 1MLAA 4DR1F 1HD0A 2B56A 2RAQA 3ENQA 3M8WA 1ZTWA 5A6PA 1WD6A 3CJ4A 4DUZF 4LRBA 2ILZA 1DQ9A 2ILYA 1L3KA 1TMJA 2H3EB 4Q2LA 1VYAA 2AP6A 3F44A 4PABA 1FX2A 2A1BA 3DYAB 3TZWA 1NXIA 1NU4A 4LVNP 2YQ1A 3PYGA 1D3WA 1HNIA 1KQKA 2GX8A 1TUGB 1PBUA 2HPUA 4KJIA 1XWLA 2XBPA 2FGOA 2YBVA 1S9GA 4E8UA 4KHPJ 1Y4ZB 3N5BA 1VIOA 4OX7A 1HD1A 1WTFA 4U96A 2EFVA 3G6YA 5HLFB 5DDPC 3EGVA 3UR3C 1IBKF 1JLEA 5I3UB 5DO2A 2WSFC 4XPEA 3QT5A 1KD1T 4LF6J 2XEXA 4DFKA 1HBUA 2HURA 2VBWA 3UD4P 4ALZA 4QR2A 3G6ES 3TAPA 1N6QB 1LWFA 2UZAA 3CUNA 2BE9B 4WU2A 3OT9A 4FP9A 2RQ4A 2XO6A 1HI8A 4OLOA 4JI3F 1C0UA 3PRDA 5HANA 3EPIA 3PRBA 1K0TA 1UWBA 5K9FA 2OMOA 1Q86T 1X5TA 1G1XA 1KOHA 3AOBA 3HMJG 3HHNB 2FY1A 3C6UB 4W92B 5AXNA 1GFWB 3G8TA 3CD5A 2PEBA 2MZTA 2IM1A 1CS4B 5L1IA 3BSNA 2Y1RI 3DNCA 2YX7A 2CG4A 3CCUS 5J2NA 1F2GA 3D28A 5D4NA 1IWAA 3A13A 3BBCA 1FWPA 1YTYA 2K7KA 2L9DA 3KWMA 2O3DA 5HQMA 2B7BB 2J7WA 3BKTA 3DRXA 4TQRA 4IRKA 3MAAA 1U0HB 2YWGA 2ALZA 4CLZA 4HTIA 2RS2A 1UEKA 3GLJA 1CBKA 4RKUC 3S6EA 3P3DA 5DM6Q 4DV3J 4TN2A 3IGNA 1GXLA 1H73A 1R8PA 1RI7A 4IG0A 3M2VA 3B54A 2XHCA 1S6UA 1S9EB 1UP1A 2DIVA 4W4MA 4DR6J 2I38A 2KT3A 3JTPA 2WSCC 4H4MA 3CO0P 4QQBA 2I0XA 3KUEA 4LIWA 5THWA 3N01A 2BR0A 1WHWA 3ULHA 1NJYA 1X4GA 3OTEA 3TEGA 3ILOA 1JX4A 4MAKA 2C3UA 2I9SA 2MKCA 3IBCB 3HT0A 3TANA 2FHOB 4URGA 2CZ4A 2V63A 2XMVA 3OLBA 2Y0SD 4DR3J 4KKOA 4DSJA 2BA9A 3KKFA 3M8ZA 2LU1A 3QWUA 4IOCQ 1F5BA 5D4PA 4C8MA 4I64A 1TVRA 3NGUA 4KTQA 2V50A 2KRRA 1FKOA 2A0FB 4LF8F 3NS7B 2COLA 4RUCA 4IQXA 2ZH6A 2BX6A 3MEKA 3FC9A 2ZHBA 1U1KA 2ERRA 2UP1A 5SUHA 3HD1A 2Q79A 1VRUA 3SCJE 2WBRA 3CDUA 1N5TA 2MKSA 1T94A 4DFMA 2HRTA 3LP1B 2FGCA 3OD2A 3T6BA 2MSSA 4ZK7M 3V5RA 2M70A 4KPCA 1QE1A 5LSOA 4X4NA 4LF2A 1VQ9S 3D1OA 1Q8KA 4EI2A 1MWQA 2J5AA 2V69A 5D3GA 1S9GB 2KJWA 3C3LA 3THTA 2OTLS 2FLNA 5J1EA 3SQOP 1JJHA 4PWUA 2G0CA 1X5OA 2JEGA 1VJQA 1IBCB 2M7SA 1CJUB 1JLEB 1F6TA 3ETMA 2KXHA 2Z2MA 2AW0A 4J7CA 4JYAJ 1HBUB 1IQZA 1T9WA 3BS9A 4QYZK 1XMBA 1LWFB 1VQ6S 1HQEB 5J2MA 3ONQA 2YNFB 1N5VA 3GYNA 5D0HA 1FRLA 2AU0A 2HBYB 1RUSA 2HBZB 3JSBA 2DGWA 1MU2B 4N8OA 4XPCA 1XMQF 3CJRA 5C24B 1Q5VA 3M6VA 4TY8B 1RAJA 2GZOA 4ICLA 2E1RA 4J9PA 1HR0J 3R9LA 1AUSL 2O5DA 1WOOA 3M2UB 2DNHA 1D09B 3LANA 1QUPA 3WHIA 1NBEB 2ZNYA 5A8RB 4YFUA 2R8GA 2FIUA 3KHHA 2C3OA 4BCAA 1MWYA 3D5MA 3FQLA 1RTDB 1URNA 3JSMB 2NPFA 1NLKL 3NCPA 4B02A 4ES1A 2MY7A 5EN1A 2QYGA 1RAAB 2GNKA 3BV8A 5KG0A 4B3SJ 2EKYA 1OQ6A 1LWEA 3OFFA 3N6MA 3S7RA 2X1GA 1RISA 5E3CA 1FJCA 3QGIA 4IYQA 4CTAA 1X4CA 4QYZJ 2B3TB 5JVGQ 1S0OA 4DPXA 5C2CA 2NPIA 4NLWA 2EVZA 3W2VB 4WKYA 2EK6A 2LXUA 2W4DA 4LF7F 2I2YA 3I4HX 2BJ1A 2DXDA 5E3PA 5ETKA 2XG8A 1KFSA 1YJ9S 2XI2A 4E2FB 3W9HA 3HVWA 5KFVA 3GYXB 4QCLA 2R7QA 1S1VB 4Y0FA 3SSSA 4C48A 4NXMF 3G87A 3SSRA 1RGVA 2XGQA 1YKWA 4F4AA 1HYSA 1HIYA 5SZTA 4MKVA 4YB5A 3FEYB 2CQ3A 2XZDB 2ASJA 3PW5A 3AY0A 4CLFA 1Q4RA 4QR0A 3CW2C 4KKOB 2KTQA 3QMQA 2YKQA 2UVWA 1TKZA 3OFGA 3ZTPA 2CPFA 4CO4A 1HFEL 5DETA 2MZ1A 3EMTA 4U8YA 4X62J 3MI7X 2ZBQA 2GA7A 3QJJA 3NMAA 1WNEA 1YJ7A 1IBLF 2ZHAA 5CYJA 1FWKA 3Q2SC 4USMA 1KLMB 3DGPA 3IRXA 1OIAA 3W9JA 2C2ZB 2EC0A 1FKOB 4S0MA 3NS5A 4DUYJ 2GS8A 1FRMA 1F3FA 3ZNUA 4DR5F 4PZVA 2CVEA 2HQFA 1WHYA 1HHTP 3EE3A 3TRGA 3KLGA 1OY9A 4OYWA 3L7PA 5H9FJ 3AD8C 3GSIA 4ZPCA 4QWCA 2VOOA 1PO6A 4DX7A 1RAIB 4KBIA 5KG1A 3R6GB 2C2OB 3KJVA 2W25A 1JKHA 2GGPB 4PWDA 2FVPA 5J2PB 3EZOA 1UPMB 1SI9A 4RW9B 4AUKA 1IUJA 1JLQA 4GVLA 1L3UA 2Q3PA 1X4BA 1KKHA 7AT1B 5KFNA 5FDLB 3T3FA 4PG7A 5D3GB 3OPKA 3PR4A 4YEAA 2VHGA 1RBAA 3RYLA 5AXKA 2HHHJ 1LWXA 3T41A 3DC2A 3I0SB 3SCLE 1WORA 2AF6A 2HQCA 5LJ5Y 3R6LB 2RDDA 2Y9HA 2DISA 3NGRA 3LP0B 2I8EA 1T9TA 4DI6A 3G71S 4P71A 2VQFF 4WF9Q 2ADBA 3KG4A 2HS4A 4HH1A 4JI8F 3FZBA 4YY3F 4HI1A 1B0TA 3GMGA 2DVIA 2Z2YB 3I32A 5JVHQ 3I5BA 2HEKA 2D3O1 1NDKA 2R7XA 5KG7A 2OPQB 3TA2A 1A6LA 5CXTA 1Q5YA 2FC8A 2F8EX 2WB1D 3UQSA 4QW8A 5AT1B 1KNZA 1EIYB 5B0DA 4PCQA 3TVYA 4C98A 1Q81T 2QYCA 2BVZA 3RGIA 4KH0B 5DLFA 3CWJA 4MIAA 2M0GB 2XMJA 2F9DA 3N28A 1YJVA 1K1QA 4L75A 3M9OB 4ZJQA 1L3VA 5IXUA 3PW2A 5KFWA 5E3AA 3DRPB 1F1BB 4RNMA 1XQIA 1YZ6A 1FNOA 3RBXA 1AXQA 6FD1A 1RE1B 2R7RA 2GIRA 1RT7B 4WFNQ 3QJPA 1LWEB
chains in the Genus database with same CATH topology
3FMBA 4B3TF 1IR0A 1SV5A 2GHVC 2M5YA 1FVQA 3FRZA 4U9RA 4H4OB 4M63A 1HPZA 5KT6A 1N6QA 1B0VA 3HK2A 1YJUA 4ZCLA 5I3QA 1CVJA 2GO9A 1KEKA 2RKIA 3HX9A 2P6SA 4YR2A 2M4MA 3RB4A 4A48A 1QJHA 1WEZA 2C3YA 3OSPA 4USHA 2YKNB 2IA6A 3CJ2A 3DU5A 2UV8A 1REVB 4HDHA 4UUXA 2XCPA 2XNRA 4CNZA 4Y3CA 2RRAA 2BANB 3CC7S 3RRKA 2ACYA 3TNVA 1NH8A 3D0IE 4AXIA 2OFGX 5KFGA 4IUFA 2YTCA 1RT2A 5A8WB 2DD8S 1HR0F 3S1TA 2V8DA 2DGXA 2ZBIA 1WG4A 3Q8QB 3CCES 2MQNA 3DLKB 2H5EA 4F8RA 3J7A1 4QPTA 2UVUA 4ILLA 1WG5A 1N88A 3PJWA 2IVMA 3DN9A 4HT5A 1MNEA 4OI4A 4DQQA 2AYEA 2WSEC 1YRTA 2XCAA 1U1OA 5HMXA 1I94F 2AJFE 2MHNA 4IOAQ 3MOZA 4DV1F 2IYGA 4J9SA 2HQ3A 3HHKA 1LQ9A 5HMWA 1HNIB 5JJBA 4MIBA 3C6UA 4K4XA 3BQ1A 2CQ4A 1KHWA 1KQGB 1ZAWA 3LOUA 4ZP9A 3ZZRA 5LMNF 4I2PA 4GMKA 2R9LA 2A2DA 1S0NA 2IFXA 1XTZA 2CPZA 2NYIA 2VBXA 5B0EA 4EGLA 1RTHA 4CH0S 4GO5X 1FDNA 4WJBA 4QWDA 2D3OR 1RT6A 4EFAC 3DHWC 5KFCA 3EX7B 1S99A 2F8MA 4BWJA 3OUYA 4A8XA 4ED7A 2CQCA 4A8KA 1YI2S 1U49A 2UXCF 1UJ5A 5CYMA 1R0AB 2XB2D 3J80Y 3DLJA 1U1RA 1HYSB 1K73T 4FS1A 4QR1A 2DPJA 2YVSA 3BR8A 3ZZOA 1IKYA 3VR1A 3C66A 4J9RA 4K4UA 2K3KA 1U8SA 2DIUA 4NL5A 2DGVA 3DM2A 4RW4B 2DNZA 1BGXT 3SFUA 1EETA 2ABYA 2C42A 2HFOA 4K2XA 4Y6IA 4EYIB 1QAXA 3BGRB 3CDWA 1U6FA 1EP4B 4EO6A 2HHQA 4DS5A 1XR7A 5AE2A 4EUVA 3SMZA 5F8IA 2MXYA 4YR3A 2W9CA 4JI4F 1TAUA 3M6XA 2ZDPA 5MAOA 1OWXA 5KFPA 2MMYA 4M95A 3L7OA 2JOQA 2Z4PA 5T7LB 4CT9A 3N4WA 5DDOC 2PO4A 3OFHA 4NMLA 3RAMA 2UVRA 4QIEA 2M8DB 3HT3A 4HL9A 5J1NA 1FKPB 2B6AB 4DOZA 4FBTA 3E01A 2JL9A 3PIOQ 1B0PA 2D41A 3FGVA 1X5PA 2VH7A 1TKTB 2MKKA 1U24A 3BJYA 3GZ7A 1LXNA 3OXGA 2QLXA 1Y5IB 4X4UA 2IA0A 2PI4A 3AQPA 2QO3A 2RQMA 3JSYA 4I6YA 1DTQB 2ZH5A 2HFZA 2FUG9 3SQGA 3K5OA 2HHTA 2DNYA 3KLVA 2ZHOA 3L95X 4ZPAA 2B7CB 4JI0F 4N56A 5FIIA 4DSFA 1U2FA 2BJEA 1B7FA 1R43A 4GO7X 2RF2B 2A3JA 2Z8QA 4BBYA 3CCMS 2XLKA 4G1QA 6FDRA 5KFZA 2HNDA 1U1PA 2E66A 3CCSS 2BXJA 2WBMA 2ASLA 2XS7A 5FLXY 1JB0C 3D1QA 2PA3A 4TLRA 3KLFA 2V4JA 1E6YB 1C0UB 1MW7A 4P7TA 5LL6d 2PI5A 2PIIA 2IVFB 2LA4A 1KVJA 1HWIA 5B0CA 4C4WA 1UWBB 2GFFA 1RT5B 4RW7B 1UEUA 2SXLA 4OLPA 2WOMB 3HKZD 3ZZTA 3HO1A 3BZQA 1LW2B 4EYHB 4ECWA 5K8OA 3L3CA 2XLJA 3CT9A 5C25A 5B08A 1DTTA 4I6AA 5I42A 3GR1A 4ZCMA 4XDDA 1S9EA 3K5PA 4A4JA 1UVLA 5T41A 4KHPF 4ES3A 1NHUA 2RD5C 1JLAB 2NZ4A 5KFRA 2QMXA 2N4CA 5IT0A 5KOXA 2E1CA 4O4GA 3OSNA 3DXSX 4C8NA 2W8KA 4G3IA 3DOKA 3DRSB 4TNOA 4IFVB 1VJWA 3KHRA 1YJRA 2JWNA 1QAJA 3CULA 1JKHB 3CIMA 3PY8A 1D9FA 3F41A 1RTIB 4ED8A 1VQMS 5J2NB 2KHCA 1ZTTA 2D3UA 3IA0A 4O4RA 3JYTA 2R7VA 2R2SA 4OQJA 4PKDB 2R2RA 2B4UA 3O8WA 4JUZA 3MMCA 4LF6F 3H5UA 1B64A 3UW1A 3VAKA 2VUGA 2W7AA 3T19A 4GC7A 3THVA 3T9NA 2PT0A 1T05A 1FRIA 3Q8RB 4X62F 4ED3A 3IG1A 1TK5A 2BQUA 1TK0A 2PEHA 1P1TA 1Q8LA 2GW8A 3CJKB 3OL8A 3HHLB 1ZOTA 2WAQD 1IKWA 1GX6A 5L1KA 1RK8A 4BC9A 2BRKA 4F4XA 1WF2A 2V94A 3I82A 4RW6B 1ZAVA 5K14A 5L1LA 4A8MP 2R7WA 3MMBB 4QJVA 4KSEB 1RQ0A 2XMMA 2GCFA 3I4PA 4PG6A 4LQ9A 2VODA 1RKJA 1U1MA 1RA7A 4ZPVR 3RB0A 3FRYA 1YRUA 1FXDA 1K1SA 3TI0A 5E3QA 4ZVGA 2LU2A 3NCRA 5C42B 4DUYF 3BEGB 3V4MA 2DITA 5HI7A 4C8KA 1DBDA 2MZRA 1WEYA 3QGGA 1N4LA 1TFYA 1BY9A 2MZSA 2HS0A 2IRUA 3QIPB 2UUAF 3FSXA 3CVKA 1OS5A 3DHXA 2J7UA 1UVMA 3MAQA 3NBPB 4CNYA 4F3MA 5A8KA 4PR6A 3VZHA 3V6DA 3R27A 3ISZA 2O66A 3BN4A 3US5A 4F3QA 2FPHX 4IH6A 1RT4B 2LQ5A 3LF0A 5F8MA 4C11B 4ZA1A 3M32B 2FLOA 2VZ9A 5EX3A 2L48A 2LYVA 3VWSA 2UXBF 4WE1A 3LALA 2GMJA 4DV0F 3KTQA 3MZIA 4RLEA 2BQ3A 2VA3A 1D8ZA 4RW8A 1S76D 4G1PA 3FZ2A 3GFYA 3Q2TC 1Z1ZA 4GKKF 3KLIA 1TV6B 4NLGA 4RWWA 5IQQA 2U1AA 3OXFA 4P2SA 2GJ2A 4IG0B 5IZHA 2H9ZA 1R6YA 2DR5A 1D8YA 3M2VB 4USIA 4OHWA 2XMKA 1H38A 1S79A 3HHLC 3TUIC 4KE5A 4UUWA 1S1XB 2M3DA 2APOA 3ZFVA 2HGMA 5DLGA 3M8PB 4QIGA 3UDLA 4CI0B 5F41A 1XNQF 4DHVA 1VBYA 1NNDA 1KFDA 2EBEA 2NLWA 4YP3A 1Y0HA 4H4MB 3KK3A 1WG1A 3GFXA 2YKAA 3FQKA 3LP1A 1P27B 3MR5A 1WACA 4ZPWR 3BREA 2RU9A 5LMUF 3QZ7A 2W8LA 2VC0A 5JXSA 2JDJA 4DL3A 2LA6A 4Q8FA 3DRYA 1QY7A 5HROB 1ZYQA 1R31A 3GIMA 2XULA 1P6TA 5CQGA 1U2RA 4O3OA 4DSLA 1S0VA 2DR8A 4OI1A 1JNZB 2Z0GA 2B9XA 3WC0A 3QGHA 3J81Y 4B9SA 1RKIA 1XERA 3MUTP 1QVGR 3QGPA 4X84A 3MDFA 3SZ2A 5H9EJ 1D1UA 2ZH9A 1SH2A 4HTJA 2CQHA 4IG3A 2CPEA 5KG2A 5EWFA 4X4VA 4XDCA 1UFWA 1FERA 2G13A 4NLPA 2HHHF 4K4ZA 2JZ5A 3AQOA 3H5XA 2CPIA 1JMTA 1U25A 1T8EA 3EUNA 2E9TA 2JC0A 4I68A 3OXLA 2RH3A 2CIMA 2MDAA 4ZOSA 4P6QA 2YH1A 2HHXA 3EXYA 1S1UA 2DNOA 4NA2A 1KS2A 5AE3A 4I69A 2EPIA 1HI1A 2IBOA 4A8QA 3NS6A 1HQUB 1SJ4P 5GVQA 2HNZB 1FK9B 1N33F 3OTBA 1TL1A 5A2QY 2R7OA 2FC9A 4LSLB 1GQEA 3UNGC 4C2MA 1NAQA 4W90B 2AGQA 1V9OA 4WU3A 3DI6B 2KFZA 2CYYA 2V2KA 3FFIB 1VHFA 2PC6A 2RUGA 2R8IA 1C4CA 3BGFA 3I5CA 3KK1B 3KHLA 1U26A 1NK6A 4MH8A 4O44B 3N9UC 1TVRB 5E7OB 3H20A 3QAUA 5GAEU 3PM9A 3C2PA 5IT4A 2DK2A 4NOHA 2V8VA 4LT6A 4XK8C 3V2UC 5LJ3Y 1Q1KA 5GMKa 3MM9B 4OJGA 3GIIA 1NZAA 5KT4A 1UAWA 2RIJA 2M9KA 4JI2F 2DGSA 5IWAF 4CO3A 4RNHA 2FHJA 4RBTA 3DLGA 3BN7A 5ITHA 2CJQA 3M6UA 3P49B 2FLLA 1HQEA 2RKIB 4F67A 4NCGB 1ELOA 2YNFA 3B4MA 1ZM2A 1FKAF 4OJ1A 1TFWA 2NSCA 3M8RA 4QIWD 3T9ZA 2GHPA 4MFBB 4TU7A 3NLCA 3RAQA 2IJFA 2HMIA 2CZVC 2VFTA 3POTB 2JVRA 4ZCIA 1VRUB 3RU0A 5HP1B 1TP7A 4MYUA 2OH2A 2HGNA 2KT2A 1T03A 1M5SA 4QIVA 2O01C 1MU2A 4B9VA 2C2EA 4KV8B 5C24A 2CPYA 2K1RB 4X4SA 4TY8A 4C97A 4WFYA 3PKYA 4DSIA 4Y2MA 1TL5A 2OFHX 3CO9A 1HNWF 1IN0A 2CRLA 2P5VA 5DQIA 5D8HB 4TKTA 4OI0A 2BRLA 4DFPA 1PSDA 2CQ1A 2DCUB 2X3GA 5A0YA 5B7WA 3O1LA 1CQNA 2EFNA 1C4AA 3TA0A 4DS4A 4FYDA 2FHJD 3CCQS 1NK7A 4DR3F 1AUDA 2W7OA 3MGJA 3NWGA 4DV5F 2BW2A 4PRFA 1FRHA 1VQLS 4PPDA 1QE1B 3M2UA 1MROA 2DT9A 1H7WA 1OPIA 4ELUA 1RTHB 1RTJB 2QA2A 4ECZA 3LGNA 4QWAA 2ROEA 1MMNA 5K8NA 3CJ3A 5A8RA 1UETA 5KFOA 1N5YA 4MK8A 2HIQA 3DLLQ 2R7TA 2D9OA 4RZRA 5LXYA 3Q22A 5JUMA 1RTDA 3K57A 2CJ9A 3JSMA 4NLRA 5J1EB 4X2BA 4RNNA 4N77A 2VD3A 4NLXA 1S0MA 4ES2A 4ZVFA 1IKYB 1G3OA 2EFGA 2ASDA 1V3ZA 2FD2A 3I0RA 3PNIA 4ECVA 1H0HB 2RNEA 1VQOS 5EX0A 5DG8A 2D1CA 4F50A 2VG6A 2PN6A 2HLTA 1GTHA 4B3OA 4IDKA 3QYYA 1FCAA 3PX6A 1M0SA 1FDBA 4URQU 4LFCF 5I3PA 1WELA 4I2QB 1X9SA 5F8HA 1H7XA 5AXLA 1VLYA 3LQVA 5CCMA 1HI0P 2KG0A 2CFXA 2RDIA 2VL1A 4JV2A 3MMJA 1Z2LA 3MUVP 2UUWA 1TR0A 2QLWA 2EW9A 2RE1A 2W24A 2X1AA 3NP5A 1HBOA 4C7QA 4ECUA 1U1NA 4QU7A 3O44A 4Q5VA 3KLEA 1LK5A 1NK5A 1SKSA 4J9LA 1WI8A 1R7IA 2HNYA 1CQMA 4KQZA 1RDRA 4M8LA 4EEYA 3WZ0A 2CPXA 4JV0A 2WONA 2BOPA 3I9ZA 4I4BA 4KAIA 5J2MB 2R7SA 1SL1A 2LQ9A 1OSCA 3LPYA 1VBXA 3MR3A 3W2VA 5KFQA 2R2UA 1X9WA 4G1QB 2OP5A 2HNDB 5IM0A 3BQ0A 3UCGA 4URSA 3OFEA 3HDSA 3TW0A 2IVYA 2F3JA 2MHEA 3M8QB 2E1AA 3MD1A 5GAGI 3WX4A 3KLFB 2VQEF 4ELVA 2KYZA 4A47A 4ZPTR 1IJFB 3J7YU 2FVCA 3G86A 4OIXA 1ZM3A 5CZVA 1VRTB 1KLNA 4LMZA 2XSFA 2JJ4D 4ITSA 4K0KF 1TZ0A 1JLFA 2MY8A 5CYQB 2UV8G 1VQSA 3UFCX 4DQSA 2HFNA 5KFAA 4B9UA 4ZS6A 1MSWD 1XR5A 5H1SV 1JK9B 4ZHRA 4H54A 4ICLB 3RW6A 4H4KA 1HBNA 2OPSA 3SEOA 3GV8B 1HNXF 2FJXA 5F8NA 2MJNA 2YNHA 3CMES 4M94A 3DOLB 3MM8B 1Y5LB 2DGOA 4ZPBA 2XI3A 3I6PA 3Q8SB 1U1QA 1GXUA 3T1YF 1RYRA 2BBEA 3B78A 4KR0B 1S1VA 2CJAA 3U27A 1TQLA 1J5OA 2FVRA 2PDAA 2CQPA 4K50A 1IKXB 4DQPA 1TL3A 2DH9A 4PPZA 2VKRA 2HWTA 1SH0A 4OZNA 4EO8A 3G96A 2YKOA 4ILRA 4Y34A 2KXNB 3DOKB 3AJ1A 3ZZYA 2NREA 2XY5A 1T95A 5CD4H 3QJLA 4ILMA 3CCVS 1DRZA 3IBWA 2LMIA 2L9WA 4K59A 4YUDA 3SXLA 1WI6A 4PG8A 2EFPA 3EGNA 2VFRA 3JYTB 1N48A 2DNQA 2ZKTA 2ZH7A 2VB6A 1NJIT 4EZ6A 4IR1A 2JHEA 2LEAA 4C9DA 5HN0A 1ZZFA 2GIQA 4DG1A 3IXQA 3CDBA 2J6TA 4LQ3A 1H6KX 3BSCA 1QLNA 3MD3A 4MKYA 3SDEB 5KG6A 2OPRA 5G0RA 1GXTA 3IG1B 2OAUA 1M5VC 2VFUA 1D0EA 3AA9A 3HVTA 3H4DA 4TY9A 2YQ3A 5I3UA 3WC2A 3CDAA 4P7VA 2KU7A 5E2QA 1PILA 4DLEA 1VC5A 2QEXS 1BQNA 4AE5A 4FS2A 1VOMA 1DFDA 5LSRA 3VZIA 3MCSA 1DLOB 1Q7YT 1R8HA 5IFMA 2E5IA 3K5MA 2ZITA 2JH3A 4F26A 5EHHA 2UVVA 1XNRF 2DTJA 1H2VZ 3M2RA 5F9NA 3MUMP 3NCQA 2QA1A 2XC9A 3HPOA 1VK8A 2MZJA 3THPA 2DR7A 2I1RA 4HH0A 2IRYA 3KMQA 1RT1A 4QIFA 4CT8A 4IQMA 4TU9A 1VI7A 5F3ZA 2ZC4A 2IAJA 4DDFA 1BQXA 1F5AA 2F8HA 1KLMA 2R7UA 1SH3A 4YB7A 4CTAB 2KFNA 1VC6A 1S49A 1FRXA 4ECYA 3B4DA 3RBDA 3IC1A 3UI3A 3TUJC 4CZCA 2BJDA 2N7YA 3MPYA 1N5QA 3TP2A 1U48A 2AYMA 2DCLA 4QWEA 2R4FA 2QA4S 2QA4G 2CJBA 3H5SA 4FBUA 4JI1F 3UPFA 3D0HE 4DN9A 1UEVA 5L39A 2Q43A 4ID5B 1Q8IA 5HBMB 3BM7A 4WE1B 5KOWA 1LW0A 2J0SD 3KMSA 1WEXA 5KG5A 1D9AA 2C3PA 2Q1LA 5HL7Q 5E5NA 2POKA 1YIJS 3DRRA 3VQTA 3MHYA 1S4FA 4Q44A 3I56S 2ZH3A 1SJ3P 2X1FA 3KG1A 2JLGA 5K8PA 4NCAA 1Y5NB 2HAIA 3PX4A 1M5OC 4A8OA 3RR7A 1YJTA 1IKVA 4WCEQ 1FNMA 5HMYA 2W9BA 4LF5F 1JWWA 4HI2A 3BO4A 1ZPWX 2KT5A 2OD4A 3TX8A 1DURA 4MK9A 5AE1A 5KFSA 4CQ1A 4MK7A 3BQ2A 3ISND 1CG2A 4ZP8A 3HVAA 4HYKA 1S6QA 1H3DA 3UDCA 2G1DA 4OV1A 1S6PB 4NPOA 4ED6A 1DARA 1Z2ZA 3PO5A 3V6HA 2QZ8A 3AB4B 3C6TB 2GGPA 1J2VA 1VBZA 3QZ8A 1BQMA 4ED1A 1Q79A 4ZKAA 4E98A 3BF4A 1N54B 3A1YG 2F4VF 5J2PA 1GNKA 2MQOA