5IT9Y

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5it9Y00
5IT9Y 3JAMY 3J80Y 5LL6d 3J7A1 3J81Y 5FLXY 5A2QY
chains in the Genus database with same CATH superfamily
1B4SA 2E44A 2HNDA 1L3SA 4QOTA 1UVLA 3EDQB 1IQZA 3JS9A 5K14A 4KRWA 4LFAJ 3I55S 4ID8A 4X4PA 2RUGA 4ECYA 2D1CA 2NXNA 2HS3A 5B0AA 4X4SA 1S1WB 2OKQA 4MTPA 4CI0B 3U27A 5KFMA 4DR3J 5DLFA 1DFDA 1BQNB 2GVZB 4CO5A 2CDRB 2ILYA 1CQMA 1M5HA 4CWBA 1FXRA 2ROPA 2OSRA 3U1LA 3H90A 4FPIA 2CXEA 2NSCA 3D5MA 3MWBA 1G3OA 3BSAA 1CJUB 1FXLA 3AB2B 4Y2CA 3MM6B 3JAMY 4RBTA 1SCJB 2M9KA 3C66A 3Q22A 1UKUA 5A8WB 3OL8A 2G0JA 1RBLA 4F4WA 1NPRA 4ES2A 2HVDA 3TI0A 4Q44A 3Q8RB 5A8WA 1RACB 3FSYA 3M8QB 2CPIA 3GJTB 4MYTA 5K8OA 5CXTA 1NDCA 3KNAA 5DO2A 1XK8A 2FTRA 2F5GA 4FNIA 3UWTA 2EK6A 3K17A 2DNNA 4LR8A 5FDLB 5KFVA 3PW4A 5JVGQ 1N0VC 1K47A 4EU0A 3F44A 4QU7A 1F3FA 4G1QA 4CLUA 5J1EA 2AIRB 2UUAJ 3T6JA 2N4CA 1IKXA 1RT7A 1FTRA 2DIVA 3A8JA 3IXQA 4OYPA 4TYBA 5D0GA 1IBLJ 1LWXA 2GMJA 5L38A 5KFTA 3WX8A 3G8TA 1HQEB 5M2RA 1FDBA 1Q79A 4X2BA 4RNFA 4LRBA 4GKJJ 3PTWA 2ACYA 5F41A 2V2VA 3WIUA 3Q8VA 4LBPA 4M5GA 6AT1B 2R7RA 1X9SA 4X62J 3J81Y 3LWMA 5G4DA 5ETQA 3HSZA 3MM5B 1ULRA 1W2IA 2WVEA 2YKMA 5IQ6A 2LA4A 3M8PB 2U1AA 4ERDA 4JV1A 2CNNB 1VRQC 4F3MA 4RKUC 2QL9B 2Z8QA 2GVDB 1ZAWA 4LQ9A 4USJC 1QSYA 5KFQA 2XB2D 3FFIA 3OUYB 2RH3A 2V2ZA 3OPKA 1DBDA 2IYIA 5D0EA 3NNHA 1VLOA 1D9AA 4V19X 5KT7A 5FLXU 3SCIE 3EUNA 4B9TA 3SBMA 4J9LA 5KG6A 4ELVA 3UI3A 3P96A 4PQUB 1UA1A 3W2WB 4DU8A 4U6PA 3UD3P 2DNKA 3MM9B 1HARA 2HSEB 3LP0A 1YVFA 4WTYA 4QPTA 2YTCA 1RT3B 2CPHA 2Z2ZA 1CULA 2GA7A 3HKZD 3KJNB 4MFBB 1X4EA 3R5GA 3UVJB 4UQGA 4NASA 1YHQS 2UXBJ 1V5IB 1WOPA 1NSQA 2HG4A 1GH8A 3OT9A 2AT1B 2ZH2A 3BYRA 4C0OC 2PMZD 4CYUA 1M5OC 1T05B 4KJIA 4KPCA 4WE1B 2HRUA 1T3NA 1GQEA 2I38A 3BR9A 4YB6A 3NNAA 4DR4J 2OPRA 4B02A 2RUSA 3PFEA 4OX7A 4R5PA 4LFCF 3CDBA 1LFPA 2HFOA 2KFYA 2LEAA 2VKRA 1TVRB 3IP0A 3OBIA 2Y0SD 5IFMA 5E33A 2DNQA 5SZTA 2D3O1 2CZVC 2DH7A 1M1GA 2DNHA 2DR6A 1EAYC 2G9OA 3BBBA 5DZ7A 2OI2A 5FDLA 2HLUA 3NXZA 1T02A 3GJSB 3I0SA 4QZVB 2VUGA 2KZZA 2FVCA 2KKHA 3OR2B 3UDEA 1GX5A 5JXSA 5LMNJ 2C2NA 4O4RA 2LEBA 1RAIB 4WYLA 5LSLA 1RTZA 2J7KA 2BANA 5KFLA 2KG0A 4FF1A 2JNJA 1X4CA 3DLKB 1NXIA 3DC2A 3ILJA 4GO7X 3VQSA 1NAQA 3PO4A 1OIAA 4LRCA 1CC7A 4OYXA 3RRKA 2YKNB 5D4PA 3KK1B 3NMAA 3PHEA 2XMVA 1HNVB 3HVTB 4QWAA 1RT5A 4HI2A 4PG4A 2VG7A 5LSRA 3OHBA 2R8GA 4O3SA 4Q7AA 3LO3A 1EP4A 1NHVA 5DS7A 4CZCA 1VC6A 2MSSA 2HAFA 1VBYA 3W65A 4X64J 4FYVB 1J27A 4I56A 1AUSL 5HQ8A 3GJQB 2MB0B 2AQ4A 4ZPCA 5CYMA 5C24B 1CS4A 3HO1A 1HPZA 3IG1A 2JFKA 4YS2A 3KLFB 4XIUA 9RUBA 1NJWA 1PC4A 4ED5A 3O6QA 4NLSA 3K5LA 4ZLPA 4F25A 2HW3A 5KFKA 1GFWB 1S10A 5CYQB 4C8ZA 5DQHA 2MLYA 1KP6A 1TTHB 2V4JA 2BJ3A 2XC9A 3S1TA 5EX0A 1FD2A 2PFFB 1XN9A 1RT6A 3J80Y 4M1KA 4ED7A 4B3OA 1X31C 3FEXB 1QTNB 4TU7A 4A8SA 3LTOA 2PDAA 4AL6A 1YI2S 4B3MF 2B9YA 3AT1B 3M9NB 3Q23A 3ZZZA 3C8YA 2Z56B 3VVTA 5J2MB 4NXNJ 3WC0A 4Y2AA 4DV7F 4X4VA 2DNGA 4HHHA 3T19A 1RWWB 1U48A 2ZH5A 3D3BJ 2X1FA 2RRBA 4KGXB 2LECA 3BH7B 2HAIA 2WBRA 5BJRA 2MLXA 3NAHA 5CAAA 1QD1A 1UFKA 3L9ZA 4JI0J 2VOOA 2YWHA 4DLEA 3J7YU 2YQ3A 3BS9A 2IMOA 3MM7A 2R8JA 3GJRB 5C42A 2C22A 1M5SA 3HHNB 5L9XA 3M2VB 1EETA 1IBLF 3B8HA 2AGQA 2DRBA 4FYYB 1AZSB 2ZD1A 1NO8A 1APSA 4BWJA 1JLGB 4QIVA 3TA2A 4DPYA 3EX7B 2JEFA 4ZVSB 5CYMB 3FK4A 5E41A 5BYRA 1SKSA 3HVTA 1S1TA 1S1VB 3TUIC 4EUVA 4IO1A 3OLBA 2LXFA 2W4PA 4FNHA 4K5RA 4O4GB 2CQ3A 4CLZA 5KFNA 2KTQA 4DUZJ 2C2OB 4I6AA 1WSVA 1K44A 3BDEA 4EBEA 4WWSA 4C11B 5AJ3J 1QE1A 3W7BA 2QC3A 1S48A 2FGCA 4CQ1A 5K20B 3M8RA 4DPXA 1BHNA 4ZVGA 2R8HA 3NMRA 3DLKA 1KVJA 4XAKA 4XDCA 4AXJA 1CJVB 1EX8A 2CQ4A 3SQGA 2IVMA 3DI6B 4D3GA 3FEZA 2CQPA 4DHVA 2AZ3A 3GYGA 2XGPA 3B4DA 3BO2A 1U1PA 3ITHB 4P9SA 1SC6A 1ZZFA 1R6YA 4OYOA 5D0HA 2VDHA 3MAQA 2HIQA 5LM7E 3J7ZT 4UTGA 1UVIA 2D7SA 3AJDA 3BO3A 3A3NB 2H1YA 5C2CA 5KTQA 2RF2B 2IVFB 3FEYB 3Q89A 2HLTA 2C3MA 3N9UC 1DTQA 1KHVA 2F8HA 2G1HA 4ICLA 2GMHA 2V63A 2ZH8A 1QVGR 2G1DA 4WFXA 1VQ9S 1H6KX 3V4MA 4WU2A 3IM9A 2K8GA 1EHWA 4YDXA 3PR5B 1T05A 3HSDA 2B6AA 1ACMB 2GO8A 2HVZA 1S97A 2YNIA 2MZSA 4FXVA 1QAXA 1U02A 1WC3A 3OQ2A 3PJ9A 4F4YA 4DQRA 2CQ2A 2UVVA 1HWUA 2E7XA 1SC3B 4ZITA 3MEGA 3R2CJ 3G82A 3VGTA 5D15A 2BJ1A 1PG5B 2RHQB 3TVKA 1FNXH 2FLPA 4DWIA 3MUMP 2HGNA 2GAGC 1DLOA 1SQGA 4Q8FA 2CNOB 3VAJA 3OVBA 4IDKB 3GSDA 1WI6A 1FKPA 1P1TA 2OP5A 2XZDB 2W25A 2EBGA 2WW8A 4PCQA 3TP2A 2DH8A 1WC0A 2JX2A 4PG6A 3TEGA 1SJ3P 1H72C 4ZVPB 1OJ4A 4N76A 1WG5A 1TFWA 3P49B 1XMOF 4C97A 3KK2B 4WFNQ 3FGVA 1XIQA 2B6AB 3AXMA 1G6BA 2DGTA 2E5LF 2B56A 2E29A 2HPUA 1UFLA 1FF2A 3NGDA 1Q16B 4OQJA 3FDSA 4GVLA 3US5A 1T8EA 3KHRA 1NCLA 1LK7A 1BC6A 1YX2A 2FC9A 4N7TA 4RZRA 3O44A 4DSFA 4ICLB 1H2VZ 1HQEA 1R27B 3HVRA 1LW0B 2KHCA 4B9NA 3QJJA 5A8KB 2RILA 2HURA 2GV1A 1T9WA 3I5CA 1VIXA 1XC9A 3R3TA 3HK2A 2QX0A 4CM2A 4M94A 4MK7A 1Y0HA 2JC1A 1O51A 3JYTA 1WWHA 2B9XA 2N82B 2WVDA 3P5BP 2LLZA 4NYOA 1M0SA 2ZC3A 3DDNA 3IN5A 2GNKA 3MMAB 1EB0A 1FRMA 2EC2A 5C7PA 2N3OA 3G8SA 3NOGA 1KLMB 1WORA 2J9DE 4NEZA 4OJHA 3THPA 5E2QA 1HMVB 1WF1A 4LRAA 1R43A 1HNXJ 3W1YC 1WEZA 1AROP 1HWLA 1WTBA 2OPPA 1NU4A 4J5OA 4Z37A 2QEXS 1NNDA 1I94F 1NRKA 4CNYA 1PO6A 1G4CA 3QO9B 5CYJA 2YKAA 2CG4A 1U24A 2FJAB 2MJNA 3CGIA 3CJ3A 3I0RB 3KDNA 5F8HA 1FWPA 3VCDA 3VVUA 1NZ8A 3LAKA 4YHHF 1C1BA 2GGPB 1S1WA 1CSJA 2N4DA 3QRRA 1CEZA 1OY6A 1SH3A 1UW9A 3NGRA 4CO1A 4TU9A 5THWA 4LF8J 4CTAB 2MQLA 1L3VA 1HQ2A 1OSCA 1U25A 4I4BA 2YKQA 2JWNA 2QSFA 1PBUA 4NX9A 5BYQA 3CCVS 3QGGA 2DHAA 4J7CA 5HVFA 2E5LJ 4LFCJ 3EM1A 4WFBQ 4ID5B 2NZ4A 4ZS6A 3AA9A 2ZDOA 3FC9A 4EBCA 5J2NB 1KVIA 1CLFA 2BW7A 1IR2A 3WIVA 1FKPB 1NBEB 4FXWA 3CDAA 4OI2A 3SCLE 4DL0C 2VA2A 4DR4F 2OHDA 4IDKA 5D4LA 1F2HA 3NS6A 4C3LA 3AAWB 4MIAA 1KRPA 3IBCB 3JQMA 2ZJQQ 1YTYA 4PG8A 3FNNA 3KLHB 2AYGA 1YJ7A 1HMVA 4LF6F 1C1CB 5D4OA 3CJQA 1XMQF 4W92B 2IYGA 2VG6B 4USVA 4XPCA 1IQTA 1FTCA 3MEGB 3M2UA 1U47A 4ELTA 1D9DA 3H5YA 2M2BA 2VODA 3U7JA 2JVRA 2XY7A 4YFUA 2YNFB 2DD8S 4RBVA 2DNYA 1KOOA 4OLPA 4LF7F 4RNNA 2W9CB 1F9EB 1UCNA 2IM0A 1S6UA 3CCTA 1FEHA 3TVYA 5CYQA 1U2CA 2V34A 3E8OA 4A8XA 2M8DB 1NSAA 4KH1B 2ZZTA 4X65J 4IRCA 1XNRJ 1YG0A 3EDRB 1S6QB 2FHMA 3C6UB 1DQAA 2CPYA 2DXDA 2AZ1A 2FJEB 2KXHA 3WX4A 4NLYA 1L3TA 5C24A 4MAKA 1LWEA 4F4AA 2CJXB 3F73A 3PRVA 2Q1LA 1WHVA 2XI3A 2K2PA 2YVSA 2XSFA 3D6TB 4L3NA 4ANCA 2H54B 2J0XA 4MIWA 3RJMB 3I4HX 5IC6B 2V2KA 1V3ZA 2UP1A 1IBCB 2MYFA 1PAEX 1JNRB 3H5UA 1U0SA 3MCMA 2QMWA 1VQMS 3IA0A 3VWSA 1S6OA 5I3PA 2UXDF 1HYSA 4B17A 4Y65A 4EWTA 1KS2A 4LSLB 4KQZA 4EMDA 1FWKA 4WXWA 2JHEA 2QFIA 1SKUB 1QE1B 2XTJP 5ETTA 4RNMA 3KMSA 3VAHA 3HF5A 4X64F 4NLGA 2V9KA 2DY9A 4CLFA 1W2BR 4CM0A 4AL5A 1K1QA 1UETA 4LF2A 1CJKA 5AJ3F 3WDOA 4LIRA 3JTPA 5A0YA 1B0PA 1S6PB 2B43A 4O4GA 4DUYF 2JJ4D 2V8GA 2CRLA 1VK3A 3CJKA 1I3OB 4WIQA 5JVHQ 5C25A 1TK8A 3H5XA 1NMEB 3QT5A 2LCWA 3MECA 2MY7A 2Y0BB 3CD0A 2QLXA 2F63A 2QSWA 3W61A 3KK3B 3OVSA 4IO9Q 4PG5A 1D8ZA 3L09A 2F7VA 5AXMA 4RUHA 4BC9A 1ZAVA 1JLAA 4JOUA 3UN5A 1K73T 4DQIA 1SQFA 1H73A 5G0RB 2PGCA 4DL4A 3QYYA 4KSEB 1IM6A 4I7FB 2NREA 4F02A 3MECB 1RHKB 2WB1D 5D78A 3SXLA 1EJ7L 2DHXA 2R7XA 3RB6A 4YQWA 4RU2A 1JMTA 4MFBA 2L08A 1SJ4P 1SH0A 4UOHA 3CCMS 5FLXY 2J0QD 4AT1B 3J7YI 4B3SJ 1VLYA 3A8EA 4PUOB 2H5IB 2V8VA 1NDPA 2BJEA 1R8HA 3AJ1A 4M8LA 2EI5A 2XBPA 3HI9A 2W2OP 5FIIA 3ZTSA 4ZKAA 4GC7A 3K5MA 1D0EA 5HMXA 1X5PA 4LSLA 3MEDB 4UW2A 1FX2A 4ECVA 4JI4F 3MOJB 1KSPA 4OZJA 4YEAA 5ETLA 5EGYA 4GKKF 2UUBJ 3ZZ0A 2EFNA 3AOBA 3FQKA 4BWMA 4HH0A 2RVJA 4B3TJ 4P72A 2HHVA 1S1UB 4WFZA 3SDEA 3AFGA 1RAGB 2KXFA 4PYDA 3SSRA 1CS4B 4N77A 2OMOA 4AE5A 3I87A 4J91A 2CUYA 4I64A 1TKZB 4PPZA 5M2UA 3DLHA 2BE9B 3KJQB 4YY3F 1F5AA 1QY7A 2HBRB 2RDDA 1HBUA 1RA6A 2KVIA 2LP4A 1RAEB 2HZAA 1N5TA 3C16A 3M2VA 1Z2ZA 1VQYA 8ATCB 3MR6A 1RAJA 3H2LA 2ZJPQ 1S6QA 1XTZA 2CG8A 1ZTWA 4UOFA 1Z1ZA 2CJ9A 5A6WA 2JRSA 3K5PA 1MN9A 2AKWB 3QO9A 5IOLA 5J2PB 4B3SF 1VJWA 2K1RA 2MDAA 2WONB 1U8WA 4S0MA 1FKOA 2HRYA 4DV4J 2N7YA 1QVFR 4IH7A 1NHKL 1XR5A 3C14B 1Q53A 2R2UA 3TAQA 2VQEJ 1S9EA 5LL6d 3QAUA 5KOWA 2MKYA 3AOCA 2EFQA 2R2RA 2VICA 4LF9F 1L3KA 3BKUA 1S12A 1Y3JA 5IT4A 3MM6A 1S79A 3QZ7A 4DPTA 3K57A 4J9KA 3MXHP 3W3SA 2LXIA 5KT4A 1S4EA 2M70A 1SPBP 2M0GB 1CJUA 1D09B 2YH0A 3BH6B 1S4FA 4LIWA 1WNEA 2M5YA 1OYEA 4EO6A 5KFPA 1SC1B 3MM8A 2X3GA 1HLWA 1U4BA 1HWKA 3MPVA 5CCMA 1HPZB 2K3IA 2VD3A 3K5OA 1LW0A 3DNCA 1BMQB 3W9JA 2FQQB 5LJ5Y 4DSKA 3NEKA 1X4DA 1U1LA 3IO1A 3GPAA 4FDFA 4MYUA 4DUYJ 2BQUA 1B0TA 2VBZA 2ALYB 1VQ6S 2PA8D 2IC3B 4DPOA 1ZPWX 2EKNA 4FS2A 1MU2A 3RB0A 3EZOA 1HFEL 5A8RB 2VG7B 4ZJQA 3OVAA 2M8HA 4P2SA 2P2CB 2AEJA 2CQIA 2GGPA 2VFTA 3RW7A 2D41A 9ATCB 2MGZA 1NH8A 2W7OA 2VBWA 3EZUA 3QLHB 3LP0B 2RE1A 4NZ6A 5KG5A 3KK1A 1KOHA 2Y1RI 3PCOB 4TQSA 1RCXB 3IRXB 4CLSA 4DV0J 1VJQA 2KL8A 4M5HA 5KFXA 3KG4A 3PX4A 1LV5A 2X1GA 5GAHU 4DJBA 5F8GA 2C2MB 3N6NA 3G2XA 2BUNA 5E3QA 1B0VA 2AX1A 4R8UA 1YZ6A 3VGUA 5CD4A 1FX4A 2DGWA 1HNWF 5CABA 4G1IA 3RBEA 2Q43A 1WI8A 3BQ2A 3CXCR 1RK8A 4RUAA 3QNWB 3H42A 2OEMA 1NPKA 2B9WA 3DM2B 2EFGA 2AYBA 1RAAB 2BE2B 3PXGa 4DV5J 1YK9A 2QZ8A 4YY3J 3FZBA 3H59A 4ER8A 1VQ7S 5BXIA 1TVRA 1LWCB 2HFVA 4KO0B 3GIIA 1NHUA 4X65F 1IKWA 1UEUA 4OFZA 1FCAA 1S5ZA 2B8QA 2GZOA 2LMIA 3MTKA 1TZ0A 1FRJA 3CD5A 2ZOGA 3PYGA 2OPQA 4OX9F 4P2MA 4JB8B 3TZWA 4YUDA 4G1QB 3CJ2A 2E9RX 3G9CA 2WSEC 3DFEA 3EVOA 3HLUA 4PXCA 2AGOA 4DN0A 2APOA 3IAM9 3T5KA 1N56A 1CULB 1S1XA 1WF2A 2VFRA 1LFWA 3DU6A 4EFAC 4B9MA 4DPUA 4F3OA 1VRUA 3CDUA 1TU0B 1FNMA 3CO0P 4IRKA 2KO1A 5LSOA 3EGVA 2F4FA 2GHWA 3D6HB 2YQ1A 3ET6A 2AYEA 3OTDA 1C0TB 3TX8A 4M5DB 1XBWA 3ITHA 5IWAJ 2VJUA 2QJ3A 4KHPJ 1XR6A 2LVWA 1RXOB 3AXKA 4M5IA 4DF8A 3IRXA 4CLYA 5KFCA 1A9NB 2J6TA 2XULA 5F9LA 3CD6S 2GIQA 4I0WA 4AXIA 1BD6A 2RSQA 3QLHA 1DTTB 3ULHA 5GADU 3LA0A 3HD2A 5HSPA 2J9EA 3KG1A 1ZBTA 3LPEA 3MEEA 5A2QU 3CPWR 4OX8A 2VHGA 2N3LA 3UE2A 1VQ8S 2XMUA 4O3QA 4DZDA 2YNIB 1OPZA 4ALZA 4JI5F 4RO0A 5F3TA 3QGIA 1OPIA 4HHJA 4ZJOA 2ALZA 3OR1A 4DV2J 3C6TA 5ETKA 4DR3F 2Z2LA 4W90B 4OZNA 3ZZRA 1ZA2B 1KN6A 1BGXT 2HWIA 3BR8A 4NA2A 1VC5A 2ZITA 4K5SA 4JI3J 2Z2YB 1DTQB 1U26A 4CO4A 1XERA 3E3XA 5J1EB 1EIYB 1NSPA 3M6WA 2IA6A 1HNXF 2ZH4A 1TAUA 2M88A 1FRHA 2XLKA 1N0UA 3DLGB 1UEVA 4NCGB 3HSGA 3FMBA 3PW0A 1M5PC 1VQ5S 1KC8T 1Z4UA 2AJFE 3TRGA 2BJ8A 2BE7D 3DGPA 3KLGA 4RW7B 3GIMA 2RRAA 2DGXA 4DN9A 4HH1A 4OI3A 2C1EB 5H1SV 1HNZJ 1N32F 2MHNA 1FXDA 4DQSA 3M30A 2CJYB 3IGNA 3ETOA 1N5QA 2XMJA 5I3UA 1ITPA 3TZZA 4KFBA 2DNPA 2CPFA 2XMTA 4M5JA 1YRUA 1P27B 4TNOA 4JI7F 2DT9A 3C15B 3TOQA 3VV2B 5FD1A 1HI0P 1RGVA 2AJ4A 2IAJB 4O3OA 2V4JB 1MN7A 3MZIA 4DFJA 4P2FA 1RWKB 2LFVA 2V0NA 3N5BA 3EGWB 2AMCB 1HWJA 1RKIA 2DITA 3SIPB 2Z0GA 1R8PA 1HBNB 2DRDA 3C3LA 2J0SD 1H7XA 4LMZA 2MHEA 5KFYA 2FYXA 4NLWA 3QWPA 3SDEB 2CFXA 5HMWA 5GAGI 2E66A 2R7UA 1FFWB 2H5JB 3TEHB 2HNDB 1SJQA 1T0TV 4OJ3A 1H98A 5B0DA 2BOAA 4OIXA 2BDPA 2QO3A 3R2DJ 1VR6A 4RW6A 3N0VA 1RT5B 5HMYA 1SUQB 1K9MT 1HNVA 4LF8F 3JXOA 3M2RB 5GAEI 3M8YA 1WEYA 3HJVA 4Z7CA 4TU8A 3HPOA 2UXCJ 1HHTP 2JVOA 3T1AA 3Q86A 5D3GA 1R3NA 3K7RA 3G86A 2I8EA 2QA4G 4DR6F 1Y5IB 4WIIA 5GAEU 3GIKA 2R2SA 5D8HB 3RG6A 1RWOB 3FUYA 4KYZA 5CZVA 1S0OA 2Z2MA 4K50A 2Q79A 4DFKA 1C4CA 2FZCB 3BYPA 4QR0A 1PC5A 2Z4PA 2CPJA 2EFPA 4FP9A 4ZHRA 1T7PA 3TX0A 4OHYA 3UDVA 3D1QA 3DLGA 1MMNA 1DZ5A 4FYXB 4ZLLA 2BXJA 4I1TA 2KT3A 1ZM9A 2LU1A 2KB2A 2GFFA 3MFIA 3A1YG 4ZK7M 3PW5A 1U7LA 1RYSA 4LF5F 2MKJA 2IM3A 2G0IA 1RTDA 2JEGA 1BY9A 1JLFA 2VKZG 1RBOB 5IC4B 3CVKA 2KM8B 1N34J 3X1LB 4Q0BA 4P7TA 2XCPA 3MTJA 4K8RA 1NJXA 1IN0A 1JJ4A 4LF5J 3SFUA 2GIRA 2I2YA 4UUWA 1N52B 3OTEA 4AQYF 1FRLA 4WFYA 1N48A 2EPIA 2C2KB 3LGNA 2NYIA 1RT3A 1N8RT 3QWUA 5U47A 2RIJA 3DMJA 4DX5A 4KGKA 2ZKTA 1YJVA 5CH7B 4QIGA 2YWEA 4F67A 4D3HA 2BEFA 2KYXA 4TY8A 5K9FA 2VBXA 4WP8A 5GAGU 2UXCF 3FBFA 3Q8QB 1FJCA 3DRSA 2GJIA 4QWCA 3TJ9A 2XZTB 2J76E 3QQCD 4HEA9 5HBMB 3T1YJ 2FVRA 3MPDA 2BMBA 3HDSA 1JLEB 5HI7A 3DRXA 1U0HA 5J2QA 2ZH6A 1DARA 3V81B 1ZYQA 3OFHA 4JI7J 1TKXA 3VZHA 1LWEB 3J81j 5I42A 4Q5VA 4ZVQB 4FYDA 2GHPA 5D77A 2E1PA 3LP2A 2Z30B 1R0BG 3CJSA 5LJ3Y 5IWAF 1VDHA 1IKVB 1HBMA 4HACB 3R5AA 2V68A 4MT1A 1MMDA 4OV1A 4ZN3A 4DR2J 4A8WA 2IAJA 2DCUB 3J7AN 4CRJA 1QTMA 1CJTA 5F0WA 2NQPA 2O01C 4IFVB 2YNFA 2HGMA 2X7IA 2ZBPA 5HP1B 2W1BA 3QFWA 4DPWA 3HT3A 3JSMA 2XY6A 1U1OA 3OL9A 3CCQS 1JNZB 3I6PA 4WF9Q 3NS7B 1H74A 5F8LA 1C1CA 3QFHA 2DR8A 1AFJA 3CCUS 3MI7X 3EPGA 3DGPB 4NA1A 4R8UB 4V19J 3HHDA 3QSYB 2B7BB 4LSNB 4ANDA 2VQFJ 2BJDA 4NOHA 4XDDA 4DSIA 3KLIB 1S9GB 2FHJD 1IKYA 2G13A 1JXVA 3MMJA 2E5HA 3L7OA 4NLVA 1YIJS 3KWMA 4ID5A 5KFHA 4KH0B 4F04B 4QQBA 5D6GA 2DGUA 3IWXA 4ZP7A 2HS4A 1FK9B 2OD4A 1BWVA 3DOKA 1ZA1B 3DRRB 3ICLA 2QA4S 5F8JA 4IOAQ 5B0GA 4CTAA 3CULA 3DCAA 3CWJA 5GADI 1DQ8A 3KNGA 3KHGA 1O5JA 7AT1B 1FT8A 1P9YA 1ZM3A 2IJRA 3EICA 3LUYA 4ETZA 4HI1A 4L6V3 2ABYA 2XQCA 2YWFA 1ZM4A 3LWLA 1YJRA 2RAQA 1U1MA 3G4SS 1XJWB 3ZZPA 2JLGA 3BM7A 5F3ZA 1NK9A 1TKTB 5GMDA 1TKDA 1F5BA 2PN6A 4LRFA 3PKYA 4OYBA 5AE3A 4ZN1A 5HN0A 3T5JA 1H38A 3I4PA 4TKTA 5LMNF 1DY3A 4F50A 4C8OA 5IT9Y 4OX9J 2MKHA 3HFVA 4CO3A 4C8YA 1A7GE 2UUWA 3O5TB 2VQEF 4DUZF 4ECWA 3RAXA 4U7CA 3NAIA 4G3IA 4CLPA 1JWWA 3CC4S 2IY5B 4YB5A 2YH1A 3JYTB 4RW9A 3CF5Q 3O3LA 3B54A 4H4MA 4PWDA 3CUNA 5KG1A 1M1KT 1P1LA 2F65A 5A8KA 4JI1F 4NXNF 1RE1B 4J9UE 1JB0C 3UNGC 4OHVA 4C0BA 1MWYA 3AD7C 5KFGA 3CCLS 2NUHA 2ROGA 2ATCB 3JB9k 3R9LA 5KG7A 3PW2A 1WACA 1FDAA 1YDLA 1BQNA 2GVZA 3BN7A 5JMNA 1N4LA 3CO9A 1NK8A 3QAEA 4E8UA 2QGFB 2F9JA 4ZVUB 2ASYA 4DV0F 3T1HJ 1HL6A 1KTQA 1WELA 3ETMA 3BBCA 4C8NA 1I6JA 1NJYA 2LQ5A 4KKOA 1U6FA 1VHIA 5HQLA 2AYMA 3MDFA 1BUXA 4ED8A 3V4IA 1U0HB 5ETOA 3TW0A 5J2QB 4ZPTR 3V81A 4C4WA 4OI1A 4YOEA 3MGJA 3M05A 3DLJA 3W9IA 3D3CJ 2VU5A 2RQCA 1AA1B 1QSSA 4QW9A 1WHYA 2OO4A 3R6GB 3AB4B 4KR0B 2KRBA 3KLEA 4G6VB 1HNWJ 2E7VA 2BR0A 4UZCA 1IBKJ 1X0PA 3W2VA 5B0FA 5B08A 2QN6B 4USHA 2XNRA 2YX4A 2ADCA 2OMLA 1NB7A 4LF4F 1PCAA 1NB2A 3GONA 3VQTA 1OMSA 1RT4A 1LK5A 1YZ7A 3DMJB 1FJEB 4JYAF 3ENAA 3OXFA 4K2XA 2BA9A 2ASDA 1UP1A 2XYPB 4WXOA 1Q5YA 4F0KA 2A1BA 3OFGA 3UDLA 2HZVA 1LQ9A 1X5TA 2BACA 3J81U 3OSNA 1WKKA 3R7NB 3HZGA 4N5SA 3D4JA 2HNYB 3UO0A 2UUCJ 3VTIA 1Y10A 4U8VA 1SKWA 2QL7B 3BV8A 4AFFA 2IM2A 4J90A 2MTLA 2UU9J 2PO4A 3JSRA 4PWWA 2P9CA 2CZ4A 4MIBA 4XK8C 4BBYA 4HT7A 2R7SA 2I1RA 2M3DA 2UUCF 4JBCA 4I6WA 1VRTA 3BGFA 2ZH1A 4ZCKA 2W2PP 3NWRA 1O0PA 4K4ZA 2KT5A 1UJ6A 4PPDA 5FJ4A 1Q8IA 1YBAA 2GC8A 4LF9J 3GCWP 1CJVA 5L39A 2JFDA 2VV5A 3CCZA 1HKAA 1RP5A 3HHLA 1RTJB 2QL5B 2HBQB 3LH2S 3P8BB 2QT7A 3SSSA 3TJAA 1RUSA 3GILA 3LGHA 2DPIA 2O67A 2WONA 1RZMA 4P10A 4JYAJ 1Y7PA 2DIUA 1PJ7A 2YY3A 4DV4F 3TAPA 1PIEA 1GT8A 1U1RA 1E6YB 5JJBA 2HHHF 1HYSB 3B82A 1VYAA 4R0EA 5BR8J 3TAMA 1IBKF 2ZBQA 5IXUA 3MMBB 1REGX 1PJ6A 1YGYA 2V6AA 3DGVA 4ZVRB 1KQGB 3MCSA 1NKCA 3M9OB 4DV1J 1E6VA 5HLFA 1PGZA 4JI4J 4GKKJ 5HO4A 2BABA 4IQXA 4C8LA 1VQKS 1K0VA 4WZMA 1T11A 2B4PA 4U7UK 2HWTA 2RMLA 3GFHA 2R7OA 3R5CA 3LQVA 3OFEA 4Y0FA 4FPRA 1P8GA 3GIRA 2V67A 4B9SA 2O5DA 1IR1A 1VS3A 3A3PB 2X3DA 3FCVA 3KXDA 3MUTP 2P9EA 3MMBA 5E3RA 2FHJA 2YQ0A 4PXBA 2GMLA 3A4TA 4GKJF 4IG3B 1SL1A 3QZ8A 4LF7J 4B3TF 3G6VA 3IS9A 4ILLA 1VBKA 2NUUG 3MR7A 1YKWA 4USIA 2I9SA 4PXDA 4PABA 1MWQA 2W9CA 1VQPS 3BB5A 1S7HA 2HFSA 3NBPB 2HQFA 1Q5VA 2OFGX 3MPYA 4BCAA 2L9DA 2YPZA 1H2UX 2MQQA 4DQQA 4OYAA 4ZVEA 1R89A 5I3UB 1BLUA 1C4AA 4KGMA 3RGIA 1Q1KA 2VG6A 2HIYA 2BW2A 4JP8A 2XMWA 1FFGB 2FB0A 4ED4A 2MMYA 3TANA 1Q0NA 4NI2A 2GJ2A 4DL6A 1QUVA 1RCOB 4UOCA 3TNVA 4Q45A 1PYTA 2MXYA 2EKYA 1N36J 3NNCA 3TUZC 4DL3A 3GTYX 5G0RA 5J2NA 2B5JA 2BKPA 5DDRC 1T95A 1UL3A 4H4OA 2IFXA 4F3QA 3PIPQ 2WVCA 2K7KA 3PM9A 4G65A 5E0OA 3PR4A 1B7YB 2GAHC 2HQ3A 2MEWA 4GMKA 2BQRA 1F3VA 3MD1A 1EP4B 3H2UB 3BO4A 3P6YC 2KVQE 2PT0A 4NLRA 3C6TB 2OH2A 2J6SA 1TV6A 2IRUA 4RJVA 3O1LA 2RQ4A 5GAHI 2ZOFA 3MAHA 3J7Z5 3I0RA 5A0YB 4PWUA 5L1IA 1ZZNA 2Y1LB 2M52A 1SL0A 4FF3A 2ZH9A 3QIPA 3BF4A 3GP9A 4LFAF 1VQNS 4OYZA 1AYEA 5KFAA 2IJFA 1F5CA 1V3RA 2ZWOA 4IFYA 2ZHOA 4LFBJ 1YJUA 1FE0A 2YNHA 2XO7A 5L1LA 4EI2A 2DXFA 4RWWA 2DO4A 4CNZA 1KLMA 2DGOA 1KHWA 5LXYA 1SH2A 3AH6A 2BRKA 3DYAA 2XZWA 1SIWB 1X5OA 3OJSA 1N33J 3CCES 1WEXA 5DETA 3SV4A 4F2SA 3RB3A 2A6MA 5K8NA 2AEMA 1JJHA 2H9ZA 1R6VA 1TAQA 3GR1A 5HVHA 3GV5B 2JLEA 3EXCX 1X4FA 1JXEA 3FBEA 1PBAA 3KG0A 5AE2A 3DDKA 4K4YA 5HANA 1V5VA 2UV8A 4XTTA 2F1FA 4I2PB 1I5OB 3UR3C 3HHKA 1F1BB 1RT1B 1Q8KA 5H9FJ 5CA5A 3BDPA 5IT9U 1RU2A 1X4AA 1TL1A 3BBFA 2CJBA 3OD2A 4GO5X 4HT5A 1CC8A 3D1OA 2GJFA 1UFWA 1RQ0A 4WK3A 5LMUJ 2EW9A 3R5BA 2ZC4A 4GVBB 1J2VA 1HW8A 3Q83A 3VGVA 4JI6J 1N54B 2E1AA 1OO0B 2H51B 2RDJA 1C2PA 5K8MA 4QU6A 1KDNA 4TVAB 3RUBL 3TYTA 2XLIA 5ADZA 3D6FB 3DN9A 3ZO7A 5KG2A 2DEIA 1HNIB 1XMQJ 4QR2A 1DLOB 4KY3A 3KLHA 4EYIB 4N8OA 2IBKA 4HLBA 2MLZA 4HR2A 2YNHB 3V6KA 1Q7LB 1N5YA 5HAOA 4K2JA 1S57A 1R8CA 1REVA 5IV3A 3QIPB 2VG5A 1J5EJ 3DLLQ 1XR7A 2WCXA 4KKOB 2CQHA 2VL1A 1SIZA 2AF6A 4AL7A 1VBXA 5IM0B 2GQQA 4TLQA 3BQ1A 2XSJB 1S7IA 3IR6B 3IC1A 2ZM6J 1TK0A 2HYIB 1BQXA 5A8RA 5KFFA 1WUUA 3H7HB 1BXNA 1O8BA 2ZBIA 4M5MA 5ETPA 5KFRA 4FXDA 1JQGA 3D28A 1C1BB 2LEPA 1PSDA 4ANEA 4E0DA 4NRTA 2LU2A 3ENVA 5EHHA 4YHHJ 2KFNA 1ZTTA 4EZ6A 2IA0A 1RDRA 1RB0A 2WBMA 2MKCA 4NL5A 2JOQA 1WTFA 2Q6BA 2RD5C 2ZDPA 4CLLA 4DG1A 4YR2A 3TQEA 4RL1A 4PWDB 4WKRA 1JLBB 2A2CA 4IG0B 3UR0A 1MWZA 4X4QA 1HQUB 4QIFA 2YWGA 4QR1A 4NI2B 2KFZA 2CWKA 3PO5A 3EVWA 3ILLA 3P5TL 1SV5A 2FPHX 5LT5A 2QYGA 1ICEB 1BQMB 2B3TB 2NS1B 5SUHA 2DO0A 4DXLA 1U49A 1B99A 1LXJA 3GFYA 2CYYA 5CHCB 5EX3A 5KFZA 2NSBA 3NCQA 5KFJA 1DJ0A 1SV5B 2D74B 4ZP8A 1LXNA 2M4MA 1VQOS 2ZNYA 1TUVA 2Z57B 4O3NA 2VPZB 4UT4A 4ED1A 1B3TA 4ZMMA 1MMLA 4F4ZA 2ZM6F 1F9HA 2HRTA 4PRFA 3NGUA 2R7QA 2RKIA 4ED3A 4A8YA 3Q24A 4NXMF 2OEKA 2QG9B 3IS9B 4NLTA 4X84A 3QBCA 3T9ZA 3H25A 1IKVA 4DL7A 1VBZA 4DV2F 2FGOA 4J9VA 3T6BA 4DL2A 1KD1T 3D7SB 2R7WA 4QW8A 2DNMA 3LP2B 1S1TB 2P6SA 3NGKA 2YKOA 3HFKA 2LYVA 1SXLA 3OXGA 5DG7A 3TA0A 2R4FA 2FJWA 3R27A 4CLTA 2R7TA 3BSCA 1TKXB 4NZ0A 2ZHAA 3VALA 1YJ9S 1RTHA 2E1RA 2C3YA 2JH3A 3KK2A 2I5JB 3LP1A 2RHSB 3A8IA 2FZKB 2HFNA 3CTRA 3QGPA 2EFVA 3H98A 5HLFB 4HKQA 2PSZA 4XO0A 3RBDA 2P6TA 1J5OB 1S1UA 2WRMA 4DI6A 5LXRA 2J5AA 3LW5C 4RUBA 1D3WA 2KJWA 3I9V9 4CH1A 3CNQP 4ZLJA 4MH8A 4DQPA 1BWEA 2XGQA 1FESA 1T94A 4IYQA 3SCJE 4RR5A 2CWXA 5C2GA 1N6QA 1NUEA 1HD0A 3OL6A 3CJ8A 3PVXA 5DJBA 1SC4B 3ZZOA 5KFUA 4B9VA 1YSJA 1FVQA 4J9PA 2O3DA 2DYAA 3AHPA 4HTJA 1K8AT 1TK5A 4F7VA 1S77D 2Y8WA 4O44B 2ZKUA 3TZXA 1JKHB 3PJWA 4RU9A 8AT1B 4DLGA 2LXUA 1R0AA 3W64A 4UQTA 1VCTA 3E51A 5EWGA 1HNZF 1N32J 3HP6A 1OQ6A 1UVNA 2B4OA 2PD1A 4DUTA 3BEGB 3TR5A 2W24A 2ZZNA 3MPUB 1F9FA 3BJYA 2PI4A 1RLDA 3HM9A 1ZOTA 1GXLA 2GQ2A 3DDIA 3BKFA 4URQU 4ETXA 1WC6A 3KLFA 3O8WA 2QTWA 3PG9A 4O23A 4DV7J 4UY85 2PI5A 5F8IA 1RLCL 4URGA 1DHMA 1RI7A 1YRTA 1TQLA 3M8SA 3CMQA 2DHHA 2XWXA 5HJXA 5AXKA 2IDLA 2IHR1 4MK9A 4NWBA 4ES1A 4IOCQ 4ZHRB 1FKAF 5F0UA 3CCSS 1WKLA 1XWLA 4FN5A 5HL7Q 3T5LA 3TWZA 3NGSA 1K1SA 4R0JA 2PEHA 2NZCA 4DS4A 4ZPAA 2IM1A 3DI6A 1OQ3A 3E01B 3R7BB 1NKBA 3SEOA 2F40A 1URRA 2WK4A 4U9RA 3CE8A 2O66A 5DLGA 4KC5A 2E1MC 3V6HA 2QMXA 1H0HB 3CSKA 3MCNA 1X4BA 1EQMA 1RTJA 2ILZA 3NG8A 3PNIA 4IFYB 4RBUA 4ZP9A 5DZ6A 5LOQA 2X1AA 4FZVA 4DSLA 4ITSA 3H0PA 5C5JA 4LR7A 1U1QA 4H54A 1JIHA 1F2GA 4IOBA 3TUJC 3ILOA 3OR2A 3PYDA 3BKTA 2BRLA 3AOAA 1W25A 3MF5A 3QT8A 3OTBA 2XCAA 1SKRA 1IBMJ 1NK0A 2C42A 5KFBA 2FDNA 4OZLA 2QLJB 3VR1A 2ADBA 3AJ2A 2C2RA 2FIUA 2LQ9A 1QAIA 1JLFB 1GX6A 2KI2A 5EN1A 4DX7A 4RX6A 2ZHBA 1GAOA 5L9NA 2IRYA 4LVOP 3P3DA 3EPIA 2D3ZA 1ZETA 2ZFHA 5H9EK 1QSLA 4LREA 2D3UA 3SYZA 4CYUB 1YJNS 3MM7B 4IR1A 4YP3A 3K2YA 2LQJA 3UN3A 3M7VA 2V4QA 4E98A 3LPYA 1CQNA 2ZBCA 4OHXA 3JTNA 4UY8T 3R6LB 1XMBA 3H4BA 2OPSA 1RA7A 1C0UB 4LF4J 3RBXA 2D9OA 3OFFA 4BDPA 2NYHA 1FA0A 1GMVA 4USWA 3ZFVA 3L3CA 5KFDA 2IMWP 2CNKB 4QCLA 4LVNP 2XWYA 3LOUA 1XQIA 3JAMU 1R7IA 2OFHX 4J9SA 2ROEA 1SUQA 1WC1A 2UV8G 1N6QB 1J5OA 1YRXA 4OZ3A 4WBFA 2Y1IA 5KFOA 1Q95G 3GU0A 3R1LA 1KWMA 1I1GA 3M8PA 4JV0A 4RW8B 1FEEA 3QIDA 3G87A 4HDHA 1HBOB 3QRQA 1UWAA 3IR5B 1Z2LA 1URNA 3IFEA 3UNYA 1X0FA 2UUBF 3EXYA 1UVJA 2YNGA 1TL3A 3Q8UA 1YITS 4NE9C 3D68A 2W01A 3CJTA 2DR5A 3D0IE 4ZVHA 3BSNA 5AXLA 3DRYA 3GWCA 2HMIA 1GMWA 2C28A 1WC4A 3GFZA 1FJGF 2OLWA 2YBVA 3RU0A 2I0XA 3KLIA 2EXUA 3W5YA 2XM3A 2RKIB 4X62F 3M30B 3KDOA 4QIWD 4U96A 1H3DA 4C3MA 6FDRA 2E7WA 2OPPB 3DLEB 4EZ9A 1VMBA 4IUFA 3ZTPA 1FE4A 1S0VA 2J8AA 1LKZA 2XI2A 4FBTA 4A48A 4NCGA 1BQMA 5F9NA 1R31A 4QWEA 3HFZB 1NLKL 3LALA 4ATNA 4ED6A 3J80U 1T03A 1RT2A 4LUBA 2H48B 4WKYA 4IFVA 2MZQA 2ZEJA 5T14A 5DDOC 3QMQA 1CJTB 3CB4A 2OPQB 3EE3A 4I69A 2BVZA 3D0GE 3RAMA 2PFDA 3KHLA 1IWAA 2OSQA 4JV2A 2MY8A 2IVYA 3JQKA 1WJ9A 2DNOA 2FUG9 1T9XA 3IMQJ 1LWFA 2A18A 2CJQA 3N79A 4P71A 1R8BA 1XEZA 4Z7YA 5E3AA 2D3OR 1S76D 4EGLA 5KFIA 2ACMA 3ZC4A 1YLXA 2WSFC 4ENOA 3I96A 2PC6A 3EGNA 3NCRA 2QLBB 3DM2A 4CDIA 2SXLA 1X8DA 1ZS6A 4K4TA 4X4UA 4CH0S 4X66J 1U1NA 2V4RA 2BBEA 3DOMB 3H20A 5HBMA 3UN2A 3MUVP 1T3OA 4X4TA 2VG5B 1XNRF 4WZQA 1NM2A 1RTIA 3AQOA 4DZ6A 2QMUB 1U6ZA 2FVQA 1O6XA 3ZXWA 5IZHA 4ZIWA 2QA1A 2KHDA 3KLEB 4F4KA 3MPWA 2HHQA 3FSIA 3Q2TC 5AE1A 1Y3KA 2LQ8A 1HNIA 1S99A 2DK2A 3A12A 3HSJA 5AXNA 1WHXA 2HHTA 2HKEA 2CVIA 2G2OA 2AW0A 3HD1A 3CEDA 1VC0A 3OTOF 2ZZMA 1GXUA 2XNQA 3JTOA 5KG4A 1AFIA 2NR0A 4JI8J 4KTQA 2VOPA 1TL1B 4X66F 3K5NA 2YKMB 3VAFA 1V6HA 4C8KA 3J7A1 1KQSR 4O3RA 3HJFA 4ZOSA 5KFEA 1KQFB 4OL8A 4H4KC 2DRAA 4DV6J 1HBMB 2W2MP 4DFPA 1PILA 4ELUA 1RT1A 2XYHB 2VIHA 3SZ2A 1RTDB 2QLFB 2W7AA 1FVSA 2HHHJ 2DISA 2HQDA 2RQMA 4DEZA 3U1MA 2DH9A 3RBZA 2WHOA 3D1HA 2UUAF 3DHXA 2CJAA 2KRRA 1RJJA 4DF4A 2C2EA 2NLWA 3FQLA 2XG8A 3I31A 4ZVOB 3D9BA 4V1Ak 1RYRA 1UWBB 2ZVIA 3M8WA 3G6XA 2F8MA 2IDEA 3KKFA 3KHHA 3ISZA 4WYWA 2A2DA 4FS1A 4C7QA 1UAWA 2AJ0A 4DU7A 1T9TA 1WKJA 5E5NA 1AT1B 2HK2A 2EBEA 3BREA 4DX6A 3QPIA 2W8KA 2ZJRQ 3SI8A 2FY1A 4LJMA 2NXEA 3BPSP 3F41A 2RQKA 4ZPDA 4CP5A 5M2PA 3SQGB 1RTIB 3MOZA 3TQ1A 3K8VA 4K0KF 4ILRA 4QYRA 5KT2A 2W8LA 3Q8YA 2W2NP 2CZ9A 3D0HE 1AXQA 2WSCC 2ZBRA 4KIAA 1SJ1A 2UU9F 2HMIB 1TL4A 2MQ8A 2MGZB 5ETSA 4IH5A 2VZ9A 4FYWB 1GMUA 2RS2A 3BGUA 3CJRA 3C16B 3GG0A 2NPIA 1W26A 3M32B 4NCAA 2ASJA 1WD6A 2AP6A 3NWGA 1S1VA 3HKWA 3QSIA 3ONQA 3QJLA 3CD7A 5F8MA 3I82A 1RWMB 4M95A 1HBOA 2CVEA 1M90T 2HQCA 3FZ2A 4DR7F 5IT0A 5B0CA 1T9YA 3BSOA 4L73A 5K14B 4ED0A 2MQNA 3CW2C 2AJ2A 4NLPA 3DXSX 1UEKA 4F26A 3OTCA 4WJBA 3V2UC 4ZVTB 4ECRA 2RT3A 4TLRA 2JLFA 1PKUA 4OZ1A 2EK1A 4L75A 2IRXA 1UVKA 1QAYA 1FRKA 2B9EA 3JSBA 1R0AB 2OUGA 5KT6A 4DR2F 1TMMA 2KDOA 4CCHA 3RRHA 2VC0A 2ZNZA 4LSNA 1DAXA 3FJ2A 2V8HA 4DV3J 2OAUA 2XS5A 4J9RA 1M1HA 1YJTA 4DDFA 1J5EF 2DGSA 2OPSB 3I32A 3IAS9 3U1NA 4JV5J 1CG2A 6FD1A 5J2MA 1HHSA 1OSDA 4M5KA 5D3GB 3T1HF 4IG3A 4ZPVR 3EJMA 1GMWD 3ISND 4DR5J 3GB0A 4NA3A 4RUCA 2YX7A 3IR7B 4H4KA 2P9GA 4IH6A 1FDNA 1FWLA 3K59A 5E7OB 2GIFA 1VI7A 3R8YA 2AGPA 3MD3A 2M7SA 4USMA 2DVIA 1U1KA 4KV8A 4Z2XA 3S01A 1RTHB 2PIIA 5LMUF 4JI1J 4MJKA 4OHZA 2FJBB 2KXNB 4ES3A 4N41A 4UOGA 1G1XA 1PJ5A 3V6DB 1UA0A 1KTVA 1F60B 3DKDA 3N28A 5CZXA 3WBZA 4A8OA 2R42A 1IJFB 4NLOA 4WFAQ 2W7PA 4YR3A 4CLKA 3Q8PB 4Y00A 3HZEA 2HVEA 2G2ZA 1S72S 1WC5A 2ZVSA 2GO9A 1D1UA 3ILIA 4CT8A 2B4UA 3RTVA 1OY8A 5GMEA 2X1BA 3TZYA 2QFJA 2XS7A 3K89A 2C3OA 4Q2MA 2ZE2B 2VFUA 2V5HG 2WVBA 3E01A 3PEJA 4CT9A 2QYCA 2JL9A 3WHIA 2DXEA 2EFOA 3D54A 3IBFB 4LBIA 1FFSB 1I94J 4DCJB 2DR9A 5B0BA 4NLDA 1VRTB 4HHUA 5DDQC 3BGRA 3RAQA 5DG8A 2C2ZB 4TYAA 2BOPA 5T41A 2MSTA 3GE9A 2KU7A 4BC7A 4C2MA 1VIOA 3DOLA 4Q2LA 5HQMA 5EWEA 4MKAA 3OV7A 4ZPWR 2CJKA 1X4HA 1S1XB 5L1JA 1X5SA 1IJEB 3HX9A 4KBIA 3FRYA 4A8FA 1U6BA 3FBCA 3N5FA 3SQOP 3DLBA 3KJVA 5HJYA 3L7PA 1H7WA 4GRSA 5DRKA 3VAKA 3S7RA 3CIMA 1KNZA 4KHRA 7FDRA 2HNZA 2AU0A 4P75A 4JI2F 1D8YA 2F4VF 3S6EA 4WE1A 3IRWP 3N6LA 3PRDA 4Y6IA 1LWCA 4KO0A 4RW4B 2PEBA 3I5AA 2AEFA 3QT7A 1JKHA 3GQCA 1CJKB 2ZWPA 4OYMA 3MR5A 2KN4A 4O0NA 4YB1P 4X4RA 1JJCB 3TARA 4P73A 4U95A 4DBQA 3MMCA 3R97A 1YWXA 2L41A 1XMOJ 2VONA 1NDLA 1Q8LA 2QA2A 3M1VB 3W2WA 5L1KA 4C9DA 1HW9A 1VFJA 1MNEA 2H5EA 5KOXA 2W9AA 2CPDA 2LKZA 1TFYA 3M2RA 3UCZP 4PZVA 4TXSA 1TL7B 1AUDA 3V4IB 2HWHA 4HL9A 4M63A 3NP5A 1KONA 1HI8A 3KFWX 4I6YA 3FFIB 1TR0A 4C98A 3OUYA 3DOMA 3PYEA 4BS2A 1UWBA 2GX8A 2J0WA 4QBUA 5DG9A 2BJ9A 4DR1J 2C2DA 1TP7A 3QJPA 2CADA 3AD8C 3GCXP 4U8YA 3TUPA 3D67A 4X4OA 3G6YA 2IC3A 1HR0J 3O2IA 4MMOA 4LFBF 3CCRS 2EEYA 3FSXA 3D2WA 4KGZB 4LF1A 5B7WA 2XEXA 2FJXA 1NH7A 4Y2MA 1V9OA 3FVYA 2A3JA 4TN2A 4UZBA 2EC0A 4JV5F 3JQJA 4J9MA 2MQOA 4FKXA 4J37A 3KLVA 4ECSA 1S9FA 3C15A 1RHJB 2I6WA 4O44A 4QIEA 3SV3A 2E1CA 3MHYA 3DU5A 1Y5LB 2H3EB 4W4MA 5KFSA 1VOMA 3DYAB 4B3MJ 1DQ9A 1F6TA 2Q6CA 4H4MB 2RB7A 2DPJA 2P8IA 5L46A 2QV6A 3THTA 5J1PA 5BR8F 1RAOA 1UW4A 3ZZUA 1HI1A 2XLJA 2G0CA 1HQUA 4IKAA 3GYXB 4PQAA 5KAKA 4K4SA 2QIFA 2J9DA 2DCLA 4C3KA 2F4VJ 4DG1B 1MLAA 2ZH3A 2UZAA 5J2PA 2BJ7A 4L3KA 3KJFB 1N34F 5H9FK 3GV8B 5CQGA 1WG1A 3PV8A 1Y5NB 3ELHA 2DBBA 1UZDA 1N33F 2I5JA 3D66A 2N7CA 3M9MB 3NCPA 4QYZK 2QLWA 2WVFA 2V9WA 1UMJA 2PE8A 3PW7A 2NXJA 1MROA 3MAAB 3C46A 5L8RC 1TL3B 2YNGB 2V8DA 4DCPB 2RS8A 1KLNA 3ISNC 4KHPF 1HBUB 3R7SB 2J9CA 1CVJA 3B6BA 3X3UA 1LWFB 2BM0A 1TL5A 2PA3A 2J7WA 2W2QP 5IM0A 3JSYA 4ECZA 4DFMA 2HHSA 2JEIA 3DRRA 4QWBA 4ECUA 1LW2B 1VQLS 1S9GA 2WB4A 3MM8B 5DQIA 3CMAS 1REVB 3RB4A 3C19A 5CD4H 3VAGA 4Y28C 3UCUP 5AT1B 5I3QA 4EEYA 1RT2B 1KBRA 4RPFA 1YQHA 4EO8A 3NOCA 1Q86T 3UD4P 2V2QA 2GHVC 5MAOA 3PEHA 3ET6B 4C6AA 3UCGA 1RHRB 3VAIA 3DLEA 3T3FA 4GVBA 1RAHB 4DL5A 3F56A 4P2XA 5HP1A 4P7VA 1VRUB 2L9WA 3NL0A 1NK6A 1L3UA 2J7UA 3IWLA 4FKYA 3ZZTA 2F9DA 2F8EX 1NK5A 2FVPA 1NSKL 2DGVA 5DDPC 5IV4A 1ZPVA 4BLGA 1G7CB 1R0CB 4FF2A 2RRNA 1OYDA 3WZ0A 4BHQA 2HGLA 4I2PA 2DGQA 4PG7A 1Q82T 2R8KA 4I7FA 3KTQA 2UVUA 1DRZA 2Y8YA 5ETVA 2UXBF 3I56S 4F0HA 2HHWA 3EYZA 4F2RA 4ZDNA 1SJFA 3WC2A 1SI9A 1H2TZ 2IPOB 2W4DA 1GXTA 1OWXA 2ZOMA 3CJ0A 3RYLA 3V5RA 4QWDA 3OTOJ 1IKWB 3BGOP 1UJ4A 3OXLA 1NEEA 3IBWA 2Q66A 5ITHA 1RBAA 1Y00A 3MCOA 2IBOA 1UTAA 2IJNA 4OV6A 3U02A 2WTFA 2W9BB 2BE2A 1VISA 1RHUB 4R25A 1JLQB 2MJUA 2DB1A 1QM9A 4DCOB 5KT3A 3RR7A 1PYSB 2JSXA 3Q0AA 1EKRA 3EWGA 4CO2A 5A2QY 1XNQF 2YXLA 1E6YA 2CQBA 2LDIA 2LDYA 3BN4A 3DRSB 4LT6A 4PKDB 4K59A 4DOZA 2L48A 2FLNA 2VPWB 1QLNA 3BPDA 3MMCB 2H4YB 4O0IA 3G82B 1JLCB 4MKBA 2CAJA 4ZVFA 4J9NA 2FVSA 2EWHA 4JI3F 4WK1A 2XMAA 3PRBA 1SJRA 4ILMA 2LQBA 3R5DA 4RW4A 4O3PA 2OIHA 4DR7J 2XYGB 1WOSA 3ENWA 2FHKA 3VAMA 4NYPA 3MR2A 2HFZA 3HXMA 3QATA 1QUPA 3TA1A 2HNZB 1S0NA 4IR9A 4Q0BB 4DMZA 2VBYA 3EZ5A 3DRPB 3KMQA 3PYFA 1RWVB 3CJ4A 2IIHA 3BGLA 3T9NA 2K7JA 4AQYJ 3C2PA 1LOUA 2EVZA 2CDQA 1X9MA 1Y9OA 2FY8A 2DY1A 2RF2A 2JDJA 2YWWA 2YX1A 5K8PA 4EBDA 3PX6A 2ATLA 1Q7YT 3Q2SC 4K4VA 4NEYA 2BKOA 3KUGA 2ZUGA 2KYZA 2VASA 3P4UB 4NPOA 1HWIA 4C8MA 4U67Q 3DOLB 3ADAC 3PJXA 4URSA 3G71S 1B70B 4I2QA 2A0FB 2RU9A 3N6MA 3KOAA 3PACA 3W60A 2L3MA 3CJKB 4IRDA 1T9UA 1ELOA 5KT5A 3CT9A 3EMTA 4F8RA 2HFUA 4W98A 4A8MP 2MZRA 3MEKA 2HS0A 2CPEA 4OJ1A 1MW7A 2G4BA 1TELA 2H65B 2HVIA 2ZE2A 2Z58B 3HCXA 1UVMA 3UQSA 4JI8F 1JLCA 3W2VB 1CBKA 5DQGA 3MURP 3BQ0A 1P6TA 1OY9A 1Q78A 2B51A 3ZZYA 3NBPA 4MKVA 1TMJA 3VGSA 4ZP6A 1NJIT 4C11A 2W4CA 4OJGA 4WPAA 4RW6B 2GQCA 1RWXB 3GLJA 3GZ7A 4PAAA 5HATA 3NLCA 2R2TA 2PMHA 4P74A 4Y34A 5KG3A 4USUA 4MKYA 4OLOA 3IG1B 3L7UA 3ZTQA 4USTA 4C0HA 1U2FA 2OGUA 4N47A 3R1HA 2DJWA 2W9BA 2AD9A 1FI4A 2CQ1A 3PKMA 1RSCA 4Y2KA 2E5GA 4DV5F 2CA9A 4KV8B 1RISA 2E9ZA 1WF0A 3GG1A 4H4OB 3L4BC 3AODA 2K3KA 4F4XA 4JUZA 2DEJA 1G2EA 4OI6A 2R7VA 5DGBA 3B78A 7FD1A 1S0MA 1NDKA 2DNLA 4L74A 1KEKA 4B3RF 3GMGA 4LRDA 4CH7A 3THVA 2FHOB 3PY8A 4YDDB 3I9ZA 3CDEA 1ZH5A 3IM8A 1GK8A 4LSZB 3UPFA 4RNOA 3W8GA 2OEJA 3HHLB 4RW7A 4E2FB 2BANB 3A8KA 1N5SA 1VQSA 3M2UB 3T1YF 2JEJA 1WHWA 2H4WB 3PHTA 5IQQA 1NKEA 4LF6J 3RW6A 2HVHA 5J1NA 2VB6A 2MQPA 1IWGA 1WSRA 3PX0A 1NK7A 1RT6B 2AV5A 3NKYA 4LR9A 5A76A 3KLGB 1HA1A 2V50A 3SCKE 2GW8A 2ASLA 2BQ3A 4I2QB 2VJVA 1UPPA 3G96A 4FF4A 1VHFA 1JLBA 1UPMB 2QRRA 4IG0A 2ERRA 4ZJLA 5E3CA 3FBBA 1QDUB 2Q3PA 3TVZA 4ECQA 3W66A 5A6PA 4FVMA 1JLAB 2V69A 1IVZA 3LP1B 1RWPB 1SQEA 3UDCA 3UFCX 1YBUA 2K06A 3LF0A 3OR1B 4Y2IA 3KK3A 5GVQA 1Q4RA 2D69A 3VF0B 4QYZJ 1DURA 3HHLD 3GFXA 4HVZA 4KGVB 4ECXA 1IXKA 1MROB 3MAAA 2D9PA 1M5KC 2WOMB 3UVJA 3M8ZA 1TUGB 3MEEB 3TAMB 2CPZA 2GS8A 2VFSA 2BYCA 4OI4A 3GSIA 3K58A 2Y9HA 2HQGA 1SL2A 3M4XA 5K5MA 1X4GA 1PYOB 2C3PA 2V8PA 4PQUA 2VPXB 3VZIA 1DTTA 3IGVA 1A6LA 2KM8C 2FC8A 1W7WA 2NXUA 2WZ1A 4NLXA 4L76A 5EUHA 5GMKa 4X4NA 3DHWC 3ZTOA 4NCBA 5KFWA 2PMWA 1IUJA 4ZCIA 1AB8A 3K0JA 2CQDA 1FNOA 1XNQJ 1C0TA 2GVDA 1YJWS 3MMAA 3NY0A 2HBYB 2G2YA 4UUXA 4WU3A 1EZZB 3JSMB 1JLQA 4DR6J 2VA3A 2A10A 1RHQB 1ZM2A 4YMEA 2DNZA 3V6JA 1VQ4S 4USKA 1HIYA 4HDGA 2E9TA 1QJHA 2ZH7A 1R8AA 2MPUA 2CQCA 2DHSA 4IQMA 4CLWA 2DR7A 2OPRB 2HNYA 1U8SA 5BYSA 4KAIA 2DHGA 2QE5A 3H8YA 4A8KA 3HVWA 1JX4A 1HR0F 5I42B 1Y11A 5MLCV 3IWNC 2YPYA 4K7QA 5CCLA 5ETNA 2CQ0A 1VK8A 4N56A 2XSJA 1GTEA 1JLEA 3FKBA 3WQPA 2ZUAA 3AQPA 3SFGA 2FJVA 4UF4A 4RLEA 2NXCA 4WP9A 2KH9A 4A46A 3I5BA 4F0MA 1N88A 3FMWA 1V3SA 1FRXA 3SMZA 1N5YB 2HZCA 2RU3A 3OHAA 3M6UA 1WG4A 2OELA 2V94A 4RWXA 4B08A 4K4XA 1GNKA 1S49A 3M1VA 2B7CB 1X9WA 3AY0A 4HYKA 4ZIVA 1WDTA 1TKTA 1KFSA 3SSQA 3VHQA 2JZ5A 4DV1F 4OHWA 2MKIA 2MKKA 1LW2A 3ZNUA 1KR4A 4ZCMA 1QAJA 4A47A 2Y1JA 4PYAA 5DM6Q 4ECTA 4WTOB 4YR0A 4Q8EA 4F36A 1KQKA 3CMES 2MKSA 1TV6B 2WOMA 4OMFG 5EDWA 4JI2J 4DSJA 3LGMA 2BZ2A 3H5SA 3MFHA 3KYLA 1MU2B 1IBMF 4I67A 3OJUA 2YKPA 5KG0A 4NXMJ 2EG1A 3DOKB 5D0RA 1IKXB 1RT7B 2HEKA 2CKWA 4KT0C 3T41A 4LBHA 3KJVB 2UVRA 2HHXA 1FRIA 3HHLC 4ED2A 4NLQA 2HQIA 2DTJA 1NJZA 1U09A 1IKYB 4LQ3A 2UXDJ 2POKA 1GEHA 4A4JA 5C42B 1D9FA 3UW1A 2GCFA 3W9HA 4P52A 2UUTA 3D6MB 3GV7B 3H4DA 3CCJS 1NPPA 1PAUB 2A6OA 1IM4A 2L9NA 4U7UD 4G1PA 1F0XA 1S9EB 2VQFF 4NLUA 1L5UA 1FJGJ 2XMMA 1YBTA 3CJ5A 3Q8SB 5HMZA 2UVWA 3L95X 1UJ5A 2E5JA 4QJVA 1FKOB 4OZ0A 4WCEQ 3ZTRA 1P9QC 1RABB 4NMLA 5ETRA 3NRBA 1TUWA 2VC1A 3C14A 3P45B 2R9LA 4DR1F 1EQ0A 3F0NA 2DKOB 4YB7A 3N4WA 4N8NA 3G8QA 4HTIA 1RADB 2LA6A 3M6XA 2K1RB 3TJ8A 2FJDB 4AD6A 4ZLNA 3MR3A 3W8PA 1T9VA 3W63A 2HHPA 4ZA1A 5E3PA 2RNEA 3AA8A 4ZPBA 2HK3A 2X51A 3AD9C 2XHCA 5B09A 5ETMA 2HHUA 4OYIA 1LNQA 1Y4ZB 5HVGA 1TKZA 2KG1A 2BM1A 3QRPA 1FERA 4Q43A 1GTHA 4RW8A 3B4MA 5HK4A 3A3OB 2VH7A 4KE5A 2MQMA 1FK9A 1HBNA 3GIJA 1JLGA 2AWZA 4CIOA 3G6ES 5F8NA 3A13A 4K4UA 3QT6A 1FHTA 4M5LA 1RHMB 4I68A 1JXLA 2KZMA 1E6VB 4K4WA 4DSEA 1MG7A 1B7FA 4FBUA 2B5JB 4L72B 1TL7A 3W5ZA 3MEDA 1K0TA 1A0OB 1U2RA 2DNRA 1U45A 2F3JA 1FD8A 3PDNA 2BX6A 4A8QA 1VGYA 5EWFA 3FCWA 4KFBB 1S59A 1WDDA 2FZGB 2NPFA 2U2FA 3HHEA 1C0UA 2XO6A 3W62A 2MZJA 1HHQA 3H2VE 4OYWA 3POTA 1SBRA 4NZ7A 5HROA 4AUKA 4EYHB 1I51B 4YN3B 2XHWA 1WOOA 4PUOA 3HVAA 1AW0A 1HD1A 3CIZA 1X7VA 3GYNA 4Y3CA 5DM7Q 1RKJA 3I0SB 3K8WA 3FRZA 1FDDA 4HACA 4KHMA 3LAMA 4DX8H 3NS5A 4B9LA 5T7LB 2OJ3A 3M6VA 3ENQA 1RWUA 2JC0A 1KVKA 4R5PB 1SB6A 4RNHA 1EARA 4NYZA 1CPZA 2NCKL 5C25B 2XY5A 3E2EA 1JJ2R 1T03B 3DRPA 3H40A 3N01A 1S6PA 3M32A 1UZHA 4TY9A 2MZ1A 5JUMA 4M5NA 5HROB 1RU1A 2B4VA 2E5IA 3BGRB 2RJZA 4PEOA 4TY8B 1RT4B 2AX0A 2AHOB 1LEOA 3FCHA 5IS2A 1FJ7A 2YKNA 2VDIA 2YWKA 2WAQD 2EG2A 2CIMA 2KJVA 2OD6A 3OW2R 4J9QA 4XPEA 1SVDA 1RAFB 5RUBA 4OZ5A 4C48A 4M5DA 4CO0A 4NRUA 1KKHA 3CC7S 2VPYB 3QGHA 3T5HA 2CQGA 4JI5J 2R8IA 2WW4A 4ZCLA 1NZAA 1X60A 3NGTA 4GC6A 4KPYA 1Q8BA 5DGAA 3RZAA 3PZPA 4JI0F 4DR5F 2KT2A 4FVCA 2MZTA 2O1PA 3PIOQ 2FLOA 2VFVA 2CPXA 3V6DA 4TQRA 3MM5A 4PXEA 2VF3A 2J8SA 4K0KJ 4B9UA 1OS5A 1N36F 4KB7A 5B0EA 2BKNA 1M5VC 3CDWA 1BE4A 3C6UA 4B3RJ 1B64A 5H9EJ 3CCWA 4DV3F 2CNLB 3EVMA 5I4MA 5T7LA 1AZSA 1FO1A 2ZD1B 3DXBA 4AYBD 3HMJG 1EETB 1Q81T 2AJ1A 3RR8A 2FLLA 3HULA 3ZNJ1 2J6UA 4OI0A 3PFOA 3LANA 2P5VA 2B8PA 3KUEA 3TO8A 3EGZA 2OTJS 3HT0A 3R5JB 2RDIA 4J9OA 3W5XA 2AJQA 3POTB 3RRGA 2Y3YA 1MSWD 4RW9B 4JI6F 3M8QA 1ROFA 3GR0A 3MM9A 1NK4A 1KFDA 3S8SA 2OTLS 2B0GA 1IR0A 3OL7A 5D4NA 2FD2A 2XS2A 1N5VA 4OX6A 4MK8A 2XMKA 4PR6A 2HBZB 3KUHA 3UD5A 1ZAXA 4OZ2A 4EK2A 3CC2S 4DV6F 1EKSA 4QPXA 2R3VA 4DS5A 4B3OB 1RWNB 2C3UA 8RUCA 2BV3A 4P6QA 4WP3A 1JK9B 3OSPA 3OLAA 3BZQA 4NMXA 2COLA
chains in the Genus database with same CATH topology
2HNDA 2E44A 1L3SA 1UVLA 4QOTA 3I55S 1IQZA 5K14A 4KRWA 4ID8A 4X4PA 2RUGA 4ECYA 2D1CA 2HS3A 5B0AA 4X4SA 1S1WB 2OKQA 4MTPA 4CI0B 3U27A 5KFMA 5DLFA 1DFDA 1BQNB 4CO5A 1CQMA 1M5HA 2ILYA 1FXRA 2ROPA 2OSRA 3U1LA 2NSCA 3D5MA 3MWBA 1G3OA 3BSAA 1FXLA 3AB2B 4Y2CA 3MM6B 3JAMY 4RBTA 2M9KA 3C66A 3Q22A 1UKUA 5A8WB 3OL8A 4F4WA 4ES2A 3TI0A 4Q44A 3Q8RB 5A8WA 3FSYA 3M8QB 2CPIA 4MYTA 5K8OA 5CXTA 3KNAA 5DO2A 1XK8A 2FTRA 3UWTA 4FNIA 2EK6A 1NJZA 2DNNA 1B64A 5FDLB 5KFVA 3PW4A 5JVGQ 1N0VC 4EU0A 4QU7A 3F44A 4G1QA 5J1EA 3T6JA 2N4CA 1IKXA 1RT7A 1FTRA 2DIVA 3IXQA 4TYBA 2GMJA 5L38A 5KFTA 3G8TA 1HQEB 5M2RA 1FDBA 1Q79A 4X2BA 4RNFA 2ACYA 5F41A 1X9SA 2R7RA 3J81Y 3LWMA 5G4DA 3MM5B 1ULRA 1W2IA 2YKMA 5IQ6A 4ERDA 2LA4A 3M8PB 2U1AA 4JV1A 4F3MA 4RKUC 4USJC 2Z8QA 2XB2D 1ZAWA 4LQ9A 1QSYA 5KFQA 3FFIA 3OUYB 2RH3A 3OPKA 3NNHA 1DBDA 2IYIA 1D9AA 4V19X 5KT7A 3SCIE 3EUNA 4B9TA 4J9LA 5KG6A 4ELVA 3UI3A 3P96A 4PQUB 1UA1A 3W2WB 4U6PA 3UD3P 2DNKA 3MM9B 1HARA 3LP0A 1YVFA 4WTYA 4QPTA 2YTCA 1RT3B 2CPHA 3R1HA 2GA7A 4MFBB 3HKZD 4UQGA 1X4EA 1YHQS 1GH8A 2HG4A 2ZH2A 4C0OC 2PMZD 1M5OC 4KJIA 1T05B 4WE1B 1T3NA 2HRUA 1GQEA 2I38A 3BR9A 4YB6A 3NNAA 2OPRA 4B02A 3PFEA 4OX7A 4R5PA 3CDBA 1LFPA 2HFOA 2KFYA 2LEAA 2VKRA 1TVRB 3OBIA 5IFMA 2Y0SD 5E33A 2DNQA 5SZTA 4LFCF 2CZVC 2DH7A 5FDLA 2DNHA 1FJEB 2G9OA 1T03B 2HLUA 4QZVB 1T02A 3I0SA 2KZZA 2VUGA 2FVCA 2KKHA 3OR2B 1GX5A 5JXSA 2LEBA 4O4RA 4WYLA 5LSLA 2KG0A 2J7KA 2BANA 5KFLA 4FF1A 3DLKB 1X4CA 3DC2A 4GO7X 3VQSA 1NAQA 3PO4A 1OIAA 1CC7A 3RRKA 2YKNB 5D4PA 3KK1B 3NMAA 3PHEA 2XMVA 1HNVB 3HVTB 4QWAA 1RT5A 4HI2A 4PG4A 2VG7A 5LSRA 3OHBA 2R8GA 4O3SA 4Q7AA 3LO3A 1EP4A 1NHVA 5DS7A 4CZCA 1VC6A 2MSSA 1VBYA 4I56A 5HQ8A 2MB0B 2AQ4A 4ZPCA 5CYMA 5C24B 3HO1A 1HPZA 3IG1A 2JFKA 3KLFB 4XIUA 1NJWA 1PC4A 4ED5A 3O6QA 4NLSA 3K5LA 4ZLPA 4F25A 2HW3A 5KFKA 1S10A 5CYQB 5DQHA 2XC9A 2V4JA 2PFFB 3S1TA 5EX0A 1FD2A 1XN9A 1RT6A 3J80Y 4M1KA 4ED7A 4B3OA 3FEXB 4A8SA 4TU7A 1YI2S 4B3MF 4AL6A 2PDAA 2B9YA 3M9NB 3Q23A 3ZZZA 3C8YA 5J2MB 3WC0A 4Y2AA 4DV7F 4X4VA 2DNGA 3T19A 1U48A 2ZH5A 2X1FA 2RRBA 2LECA 2HAIA 2WBRA 5BJRA 3NAHA 2VOOA 2YWHA 4DLEA 3J7YU 2YQ3A 3BS9A 2IMOA 3MM7A 2R8JA 5C42A 2C22A 3HHNB 1M5SA 5L9XA 3M2VB 1EETA 1IBLF 3B8HA 2AGQA 2DRBA 1APSA 2ZD1A 1NO8A 4BWJA 1JLGB 4QIVA 3TA2A 3EX7B 2JEFA 5CYMB 5E41A 1SKSA 5BYRA 3HVTA 1S1TA 1S1VB 3TUIC 4EUVA 4IO1A 3OLBA 2LXFA 2W4PA 4FNHA 4K5RA 4O4GB 2CQ3A 5KFNA 2KTQA 4I6AA 3BDEA 4EBEA 4C11B 1QE1A 3W7BA 4CQ1A 1S48A 2FGCA 3M8RA 4ZVGA 2R8HA 3NMRA 3DLKA 1KVJA 4XAKA 4XDCA 4AXJA 2CQ4A 3SQGA 2IVMA 3DI6B 4D3GA 3FEZA 2CQPA 4DHVA 3BO2A 2XGPA 3B4DA 1U1PA 3ITHB 1SC6A 1ZZFA 1R6YA 3MAQA 2HIQA 3J7ZT 1UVIA 2D7SA 3BO3A 5KTQA 2RF2B 2IVFB 3FEYB 2HLTA 2C3MA 3N9UC 1DTQA 1KHVA 2F8HA 4ICLA 2ZH8A 2GMHA 1QVGR 1VQ9S 2G1DA 4WFXA 1H6KX 3V4MA 4WU2A 2K8GA 4YDXA 3PR5B 1T05A 2B6AA 2GO8A 2HVZA 1S97A 2YNIA 2MZSA 4FXVA 1QAXA 4F4YA 2UVVA 3OQ2A 4DQRA 2CQ2A 1HWUA 2E7XA 3MEGA 1FNXH 3TVKA 2FLPA 4DWIA 3MUMP 2HGNA 1DLOA 4Q8FA 3VAJA 3OVBA 4IDKB 3GSDA 1WI6A 1FKPA 1P1TA 2OP5A 2W25A 2EBGA 2WW8A 4PCQA 3TP2A 2DH8A 2JX2A 4PG6A 1SJ3P 3P49B 4N76A 1WG5A 1XMOF 4C97A 3KK2B 4WFNQ 3FGVA 2B6AB 1G6BA 2DGTA 2E5LF 2B56A 2E29A 2HPUA 1UFLA 1FF2A 3NGDA 1Q16B 4OQJA 3FDSA 3US5A 1T8EA 3KHRA 1LK7A 1BC6A 2FC9A 4RZRA 3O44A 4DSFA 4ICLB 1H2VZ 1HQEA 1R27B 3HVRA 1LW0B 2KHCA 4B9NA 3QJJA 5A8KB 2RILA 2GV1A 3I5CA 1XC9A 1VIXA 3R3TA 3HK2A 4M94A 4MK7A 1Y0HA 2JC1A 1O51A 3JYTA 1WWHA 2B9XA 2N82B 2LLZA 4NYOA 1M0SA 2ZC3A 3DDNA 3IN5A 2GNKA 3MMAB 1FRMA 2N3OA 3G8SA 1KLMB 2J9DE 4OJHA 3THPA 5E2QA 1HMVB 1WF1A 1R43A 1WEZA 1AROP 1HWLA 1WTBA 2OPPA 1NU4A 4J5OA 4Z37A 2QEXS 1NNDA 1I94F 1NRKA 4CNYA 1PO6A 3QO9B 5CYJA 2YKAA 2CG4A 1U24A 2FJAB 2MJNA 3CGIA 3CJ3A 3I0RB 5F8HA 4YHHF 3BQ2A 3VCDA 2R7TA 3LAKA 1C1BA 2GGPB 1S1WA 1CSJA 2N4DA 1CEZA 1SH3A 4CO1A 4TU9A 5THWA 4CTAB 2MQLA 1L3VA 5BYQA 1OSCA 1U25A 4I4BA 2YKQA 2JWNA 2QSFA 4NX9A 2FJXA 3CCVS 3QGGA 2DHAA 4WFBQ 4ID5B 2NZ4A 4ZS6A 3AA9A 2ZDOA 4EBCA 1KVIA 5J2NB 1CLFA 4DL0C 1FKPB 4FXWA 3SCLE 3CDAA 4OI2A 2VA2A 4DR4F 4IDKA 5D4LA 3NS6A 4C3LA 3AAWB 4MIAA 1KRPA 2AYGA 2ZJQQ 1YTYA 4PG8A 3FNNA 3KLHB 1HMVA 4LF6F 1C1CB 5D4OA 1XMQF 4W92B 2IYGA 2VG6B 4XPCA 1IQTA 1FTCA 3MEGB 3M2UA 1U47A 4ELTA 1D9DA 3H5YA 2M2BA 2VODA 3U7JA 2JVRA 2XY7A 4YFUA 2YNFB 2DD8S 4RBVA 2DNYA 1KOOA 4OLPA 4LF7F 4RNNA 2W9CB 3TVYA 2IM0A 1S6UA 3CCTA 1FEHA 5CYQA 4A8XA 3E8OA 2M8DB 4IRCA 1YG0A 1S6QB 2FHMA 3C6UB 1DQAA 2CPYA 2KXHA 2FJEB 3WX4A 4NLYA 1L3TA 5C24A 4MAKA 1LWEA 3F73A 2Q1LA 1WHVA 2XI3A 2K2PA 2YVSA 2XSFA 4L3NA 2J0XA 4MIWA 3I4HX 2V2KA 1V3ZA 2UP1A 2MYFA 1JNRB 3H5UA 1VQMS 2QMWA 3IA0A 3VWSA 1S6OA 5I3PA 1HYSA 4B17A 4Y65A 4EWTA 1KS2A 4LSLB 4KQZA 4WXWA 2JHEA 1QE1B 4NLGA 4RNMA 3KMSA 3VAHA 3HF5A 4X64F 4AL5A 2V9KA 4LFBF 1W2BR 1K1QA 1UETA 5AJ3F 3WDOA 4LIRA 3JTPA 5A0YA 1B0PA 1S6PB 2B43A 4O4GA 4DUYF 2JJ4D 2V8GA 2CRLA 1VK3A 3CJKA 5JVHQ 5C25A 1TK8A 3H5XA 2LCWA 3MECA 2MY7A 3CD0A 2QLXA 4IO9Q 2QSWA 3KK3B 3OVSA 4PG5A 1D8ZA 3L09A 2F7VA 5AXMA 4RUHA 4BC9A 1ZAVA 1JLAA 4JOUA 1K73T 4DQIA 5G0RB 2PGCA 4DL4A 3QYYA 4KSEB 4I7FB 2NREA 4F02A 3MECB 2WB1D 5D78A 3SXLA 2DHXA 2R7XA 3RB6A 4YQWA 4RU2A 1JMTA 4MFBA 2L08A 1SJ4P 1SH0A 3CCMS 5FLXY 2J0QD 3J7YI 1VLYA 3A8EA 4PUOB 3AJ1A 2BJEA 2V8VA 1R8HA 4M8LA 2EI5A 2XBPA 3HI9A 5FIIA 4ZKAA 4GC7A 1D0EA 3K5MA 5HMXA 1X5PA 4LSLA 3MEDB 4UW2A 4ECVA 4JI4F 3MOJB 1KSPA 4OZJA 4YEAA 5EGYA 4GKKF 3ZZ0A 2EFNA 3FQKA 4BWMA 4HH0A 2RVJA 2HHVA 1S1UB 4WFZA 3SDEA 2KXFA 3SSRA 4N77A 2OMOA 4AE5A 3I87A 3DLHA 5M2UA 4I64A 1TKZB 4PPZA 4YY3F 1F5AA 1QY7A 1HBUA 1RA6A 2KVIA 1N5TA 3M2VA 1Z2ZA 1VQYA 3MR6A 1RAJA 3H2LA 2ZJPQ 1S6QA 1XTZA 1ZTWA 1Z1ZA 2CJ9A 5A6WA 2JRSA 3K5PA 3QO9A 5J2PB 4B3SF 1VJWA 2K1RA 2MDAA 2WONB 1FKOA 2HRYA 2N7YA 1QVFR 4IH7A 1XR5A 3TAQA 1Q53A 2R2UA 1S9EA 5LL6d 3QAUA 5KOWA 2R2RA 2EFQA 4LF9F 1AW0A 1L3KA 1Y3JA 5IT4A 3QZ7A 3MM6A 1S79A 3K57A 4J9KA 3MXHP 3W3SA 2LXIA 5KT4A 2M70A 2M0GB 2YH0A 1S4FA 4LIWA 1WNEA 2M5YA 4EO6A 5KFPA 3MM8A 2X3GA 1U4BA 1HWKA 3MPVA 5CCMA 1HPZB 2K3IA 2VD3A 3K5OA 1LW0A 3DNCA 5LJ5Y 4DSKA 1X4DA 1U1LA 3IO1A 4MYUA 2BQUA 1B0TA 2VBZA 1VQ6S 2PA8D 2IC3B 4DPOA 1ZPWX 4FS2A 1MU2A 3RB0A 1HFEL 5A8RB 2VG7B 3OVAA 4C8ZA 2M8HA 4P2SA 2CQIA 2GGPA 2VFTA 3RW7A 2MGZA 2D41A 1NH8A 2W7OA 2VBWA 3EZUA 3QLHB 3LP0B 2RE1A 4NZ6A 5KG5A 3KK1A 1KOHA 2Y1RI 4TQSA 3IRXB 1LV5A 5KFXA 3PX4A 3KG4A 2X1GA 5GAHU 4DJBA 5F8GA 3N6NA 2BUNA 5E3QA 1B0VA 2AX1A 4R8UA 1HNWF 1JWWA 2DGWA 3RBEA 4G1IA 2Q43A 1WI8A 3CXCR 1RK8A 4RUAA 2B9WA 3DM2B 2EFGA 2AYBA 2BE2B 3PXGa 2QZ8A 3FZBA 3H59A 1VQ7S 1TVRA 1LWCB 4KO0B 3GIIA 1NHUA 4X65F 1IKWA 1UEUA 4OFZA 1FCAA 2LMIA 3MTKA 1TZ0A 1FRJA 3CD5A 2ZOGA 4YUDA 2OPQA 4OX9F 2E9RX 3G9CA 4G1QB 3CJ2A 2WSEC 3DFEA 3HLUA 4PXCA 2AGOA 4DN0A 2APOA 3IAM9 3T5KA 1N56A 1S1XA 1WF2A 2VFRA 1LFWA 3DU6A 4EFAC 4B9MA 4F3OA 1VRUA 3CDUA 4IRKA 1FNMA 2KO1A 5LSOA 2GHWA 3TX8A 2AYEA 3OTDA 1C0TB 4M5DB 1XBWA 3ITHA 1XR6A 2LVWA 4DF8A 1A9NB 3IRXA 5KFCA 2J6TA 2XULA 5F9LA 3CD6S 2GIQA 4I0WA 4AXIA 1BD6A 2RSQA 3QLHA 1DTTB 3ULHA 5GADU 2J9EA 3KG1A 1ZBTA 3MEEA 3CPWR 4OX8A 2N3LA 3UE2A 1VQ8S 2XMUA 4O3QA 2YNIB 1OPZA 4ALZA 4JI5F 5F3TA 3QGIA 1OPIA 4HHJA 2ALZA 3OR1A 3C6TA 4DR3F 2Z2LA 4W90B 4OZNA 3ZZRA 1KN6A 1BGXT 2HWIA 3BR8A 4NA2A 1VC5A 2ZITA 4K5SA 5J1EB 1DTQB 1U26A 4CO4A 1XERA 3E3XA 2IA6A 3M6WA 1HNXF 2ZH4A 1TAUA 2M88A 1FRHA 2XLKA 1N0UA 3DLGB 1UEVA 4NCGB 3FMBA 3PW0A 1M5PC 1VQ5S 1KC8T 1Z4UA 2AJFE 3TRGA 4K50A 3DGPA 3KLGA 3GIMA 4RW7B 2RRAA 2DGXA 4DN9A 4HH1A 4OI3A 1N32F 5H1SV 2MHNA 1FXDA 4DQSA 3M30A 3IGNA 3ETOA 1N5QA 2XMJA 5I3UA 4KFBA 2DNPA 2CPFA 2XMTA 4JI7F 1YRUA 1P27B 4TNOA 2DT9A 3TOQA 5FD1A 1HI0P 1RGVA 2AJ4A 2IAJB 4O3OA 2V4JB 3MZIA 4DFJA 2V0NA 3N5BA 3EGWB 1HWJA 1RKIA 2DITA 2Z0GA 1R8PA 1HBNB 3C3LA 2J0SD 1H7XA 2MHEA 5KFYA 4NLWA 3QWPA 3SDEB 2CFXA 5HMWA 5GAGI 2E66A 2R7UA 2HNDB 1SJQA 4OJ3A 1H98A 5B0DA 4OIXA 2BDPA 2QO3A 4RW6A 3N0VA 1RT5B 5HMYA 1SUQB 1K9MT 1HNVA 4LF8F 3M2RB 5GAEI 1WEYA 4TU8A 3HPOA 1HHTP 2JVOA 3T1AA 5D3GA 1R3NA 3K7RA 3G86A 2I8EA 2QA4G 4DR6F 1Y5IB 4WIIA 5GAEU 3GIKA 2R2SA 5D8HB 5CZVA 1S0OA 2Z2MA 2Q79A 4DFKA 1C4CA 4QR0A 1PC5A 2Z4PA 2CPJA 2EFPA 4FP9A 4ZHRA 1T7PA 4OHYA 3D1QA 3DLGA 1MMNA 1DZ5A 2BXJA 4I1TA 2KT3A 1ZM9A 2LU1A 2KB2A 2GFFA 3MFIA 3A1YG 4ZK7M 3PW5A 1U7LA 1RYSA 4LF5F 2MKJA 2IM3A 2JEGA 1RTDA 1BY9A 1JLFA 2VKZG 2KM8B 3CVKA 3X1LB 4Q0BA 4P7TA 2XCPA 3MTJA 1NJXA 1JJ4A 1IN0A 3SFUA 2GIRA 2I2YA 4UUWA 1N52B 3OTEA 1FRLA 4WFYA 1N48A 2EPIA 3LGNA 2NYIA 1RT3A 1N8RT 3QWUA 5U47A 2RIJA 3DMJA 4KGKA 2ZKTA 1YJVA 5CH7B 4QIGA 2YWEA 4F67A 4D3HA 2KYXA 4TY8A 5K9FA 5GAGU 2VBXA 2UXCF 3Q8QB 1FJCA 3DRSA 2GJIA 4QWCA 2J76E 4HEA9 5HBMB 2FVRA 3HDSA 5HI7A 1JLEB 3DRXA 5J2QA 3V81B 2ZH6A 1DARA 1ZYQA 3OFHA 1TKXA 3VZHA 1LWEB 5I42A 4Q5VA 4FYDA 2GHPA 5D77A 3LP2A 5LJ3Y 5IWAF 1IKVB 1HBMA 3R5AA <