5IT9Y

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5it9Y00
5A2QY 3J80Y 5IT9Y 3JAMY 3J81Y 5LL6d 3J7A1 5FLXY
chains in the Genus database with same CATH superfamily
3VGTA 4RKUC 3UD3P 4ZJLA 3QQCD 4JI1J 3W2VB 2RB7A 1RTJB 2VV5A 3VHQA 3SDEA 4ZIWA 1FRXA 2C1EB 2GIRA 2MQ8A 4PXEA 3OW2R 4DS5A 2OFGX 1URRA 2CXEA 1ZPWX 3DM2A 5F9NA 4QIEA 4FF2A 5ETMA 1CEZA 3ZZZA 2DNMA 2O3DA 4KGMA 2YWEA 3V6HA 3AB4B 3W62A 3PYFA 3V6JA 2GGPB 2ZOGA 2BJDA 3PYDA 4ETZA 5A8WA 2CDQA 3M8WA 4X65J 1Q82T 5J2MA 2RD5C 5CD4H 3RBZA 3HHLA 4QOTA 2EKYA 1NDLA 1IBLF 1IJFB 2HK2A 1TFWA 4FYDA 3DGVA 2XY6A 3HHNB 3VTIA 1U8SA 3MR3A 4ZPCA 3IO1A 3CJQA 3Q8VA 4A8MP 3G6YA 4F4YA 1NK5A 1PO6A 3KOAA 3OHAA 2IYIA 2XMKA 1KTVA 2CUYA 3Q8PB 1GH8A 4I7FB 3H2VE 2CA9A 4NRUA 2UV8A 3MM6A 5KG3A 1BY9A 4M1KA 5KFWA 3GCWP 3MHYA 2PA8D 2N4DA 5E3RA 1ZBTA 2WBMA 5AXNA 4O44B 6FDRA 1KTQA 1SUQB 1YJVA 4J7CA 1VQNS 4DMZA 4C8MA 1W7WA 2B7BB 5B0DA 1J2VA 2AZ3A 3GFHA 5I42B 1LWCB 4F4WA 4FF1A 1A9NB 2R2SA 2FHMA 1G3OA 2I8EA 3IM8A 4M5DB 4OYBA 1QSLA 2BV3A 4C6AA 2VPZB 3MCNA 4ZHRA 4TQSA 1N5YB 4LFBF 2IC3B 3IC1A 3SMZA 2VQEF 3GTYX 2DNNA 2KFYA 4DL3A 2FJBB 3M30B 1TZ0A 3EE3A 3QFHA 2WHOA 4G3IA 1ELOA 4NE9C 3K57A 4DV2F 3D7SB 1FFGB 2V0NA 4P75A 2HHTA 4F25A 2FZGB 3LGMA 3BSNA 4RW8B 1N34F 1RBOB 3UD5A 3QIPB 1NB7A 1Y4ZB 4DPOA 5LMNF 4NZ7A 3AH6A 3RGIA 2UU9J 2RUGA 1FEHA 4KAIA 3P4UB 3J81U 2C3MA 3OQ2A 1AT1B 1DBDA 1HWIA 4NL5A 5D4NA 4A47A 1NHVA 3UE2A 2C3OA 5E2QA 5HO4A 1IKXB 2WB1D 4ZLPA 4N8OA 4DSFA 1PC4A 4G65A 5E33A 2XCPA 2X1GA 5AE3A 1Q79A 2UZAA 3W61A 4IUFA 2MKSA 1T3NA 3ZTPA 3CWJA 3TA1A 1WF2A 2CQ4A 2EFOA 3AB2B 3QRRA 3IXQA 1XMOF 1U47A 1AFJA 3TAQA 3VWSA 2R7RA 2FHKA 4IYQA 3ZTSA 4CM2A 4DR3J 3TANA 2E1MC 3FBFA 1CQNA 2D3OR 1CBKA 2IVMA 3QGIA 5A2QY 2J0WA 3D3BJ 1XQIA 3ITHB 2HZVA 4G6VB 2DR7A 1S0VA 2BE2B 2YY3A 1X4AA 4TU8A 3M6UA 3QLHB 4DPXA 1QE1B 3C15A 4CI0B 3TEHB 4EI2A 3HKWA 1NJYA 2DVIA 1KFSA 2M5YA 4X4OA 1IM4A 1SL0A 3GIRA 1UFLA 1HPZA 4IKAA 3ADAC 3GE9A 1PSDA 3OTOJ 4QWEA 3BBBA 1DARA 4CO4A 3NNCA 2X7IA 4EO6A 4DR3F 1YRTA 3T5KA 5KFMA 5M2UA 1N6QA 1HQUB 4TU7A 1FXLA 3CPWR 1MWZA 1FX2A 1SH2A 2HS4A 2VC0A 2XMTA 4FNIA 2ILYA 1VISA 4DUZJ 3QRQA 1NJXA 2HURA 2VBXA 4C3KA 1XNRF 2A18A 3BN7A 5JVHQ 4RU2A 3MOZA 4KQZA 4ZVEA 4OIXA 3TAMB 2O01C 3T5HA 5D15A 3QJLA 2HNDA 3U7JA 3X3UA 2CPDA 4FPIA 2FY8A 3MMAA 3KNGA 2FC9A 2VUGA 3NAIA 4E8UA 1FXRA 4PXCA 3LGHA 1HQUA 5D4LA 2M7SA 3UR3C 3HP6A 3OVBA 2FZKB 3I9V9 2BANB 5SUHA 2J6UA 1BQNA 1JLBB 1VQSA 3SFGA 4F4KA 2ZITA 3OXGA 2R8HA 5HROA 1S76D 1MN9A 3N6NA 1N5SA 3UN3A 2YNIA 4A8FA 2ZVSA 1FJGJ 4KGVB 1SJ1A 4DX5A 2BABA 1NK7A 1HNXF 2VPWB 2UXDF 3CIMA 5KT5A 3TJ9A 1W25A 2OD4A 4NI2B 2QLBB 3PJ9A 4FVCA 2BACA 1KHVA 2OEKA 1SL1A 3PR4A 2B4UA 3HVRA 1ZTTA 5F8NA 3M2RA 3QZ7A 4URQU 1R8PA 2IDEA 1OPZA 3PYEA 2AGPA 2F4VJ 3QJJA 1S1WB 2B56A 4Q5VA 2BBEA 1RAIB 2IM0A 3C6UB 1QUPA 1R0AA 4M5DA 4ZLNA 2NR0A 1YG0A 2XS7A 2QYCA 5JXSA 2R42A 4DV3J 1VS3A 2ZKUA 4A4JA 5ETNA 3KUGA 2C2OB 2LKZA 2DR5A 3FBBA 2W4CA 5IS2A 4IOAQ 2QTWA 1GMVA 1TKTA 1TU0B 2DNYA 2V8DA 1RT5A 2ZH2A 4DL4A 5KTQA 3HXMA 3QLHA 5D0GA 1F3VA 3VQTA 3KYLA 4YQWA 4DR1F 2C2RA 1S77D 1EX8A 3M32A 3LALA 2MY7A 4NX9A 3UVJB 4YR2A 3QT5A 1X31C 4M5GA 3CIZA 1KC8T 1J27A 3LP2B 4JI6F 4X4SA 3G96A 5KFRA 4TYAA 4EBEA 3CNQP 1H0HB 3M9OB 1FK9A 1ZPVA 2NCKL 4P72A 4QIWD 3DLGA 2BOPA 4NRTA 2N3LA 4OZLA 3RJMB 3CCLS 4QWAA 2BJ8A 3D28A 2OSRA 3MMBA 4TY8A 3WHIA 4N5SA 1L3VA 3AOBA 4B9NA 3CJKB 4N41A 3LAKA 3QWUA 4RO0A 3ICLA 2HVHA 4HHJA 4RUCA 1S59A 2VG6B 5AJ3F 2AYGA 1FRHA 2DGUA 1NK4A 3M2VB 5C25B 2VOOA 1IKWB 3MF5A 4DR7F 2J6TA 2KG1A 1CG2A 2GVDB 3H59A 3GIIA 5RUBA 2XG8A 2XHCA 4DLEA 5I3QA 1N32J 4MTPA 4J9LA 4RWXA 1A6LA 1RU2A 2OFHX 2CPZA 4B9SA 3ZZRA 1U8WA 3X1LB 3P49B 1WC0A 3FSXA 1RISA 4LRAA 2BUNA 2WW8A 1VMBA 3W5XA 1NH8A 3L95X 3K8VA 2MZ1A 2AMCB 4U8YA 4OYWA 1HL6A 3FCVA 4ZIVA 4USTA 4GVLA 1KRPA 2Q6CA 1HHSA 4I0WA 4I69A 4RW6B 2CPHA 2OEJA 5A8KB 2Y1JA 4DV7J 2DISA 1WOPA 4IRKA 1HNWF 2RS8A 3ISZA 1XMQJ 1AUSL 1PYOB 2ACMA 1SJFA 3I0SB 3PNIA 1AFIA 1FI4A 1VIOA 4Y28C 4NLDA 2H51B 1S1WA 3TZZA 2V69A 2XO6A 2Z2LA 2Z30B 1WKKA 4QCLA 1RWPB 3KK2B 1BWVA 1QDUB 4W90B 1JXEA 1BQNB 4TYBA 4YP3A 3CCMS 2V2QA 3K5NA 2ADBA 3UNGC 1VQ6S 2IBKA 3JSYA 3A3PB 4WZQA 2CNNB 4JV2A 4M94A 2CQIA 4B3OA 1SC3B 3VVUA 1JWWA 2QA2A 3MXHP 4K4YA 3DDKA 4NWBA 3BGRA 2JHEA 2WONB 3ISND 4CWBA 2I2YA 1NSPA 1FE4A 4TLRA 3NXZA 1DAXA 2HK3A 2VQFF 5AJ3J 4FYXB 5D78A 1HI1A 3LANA 3AXMA 4O4GB 1JLCB 1FT8A 2OI2A 2M4MA 3R97A 1U49A 3Q24A 4DR4J 1Q7LB 1RHRB 2QN6B 3RAQA 3P5BP 1XWLA 4ZCIA 3D6HB 2A6MA 5KFNA 4OZJA 4OYIA 3W2VA 4ZVTB 3W9JA 3BYPA 3S8SA 3MGJA 2LU2A 2CQ2A 1Y0HA 4NLUA 5KG2A 3CJ5A 3FQKA 5H9EK 3AA8A 3HF5A 4DL7A 5B0FA 1ICEB 4P73A 1OQ6A 2FGOA 3TQEA 4NZ6A 4DSLA 1Y9OA 1HBMA 3MEDA 1FD2A 4MIAA 3I9ZA 2AEFA 4LR7A 3NGKA 4YHHJ 4NYPA 1RE1B 3BYRA 2CPXA 2UUAF 2XS5A 2OSQA 1S5ZA 3D4JA 1HMVA 4WFAQ 3N79A 4EU0A 1RABB 1LWEA 4USVA 5J1NA 3PX4A 3DOMA 5CYJA 2V68A 2ILZA 2NXCA 4C8NA 1ZETA 3BS9A 2ZZTA 2EFPA 4DI6A 1HNVB 4Z7CA 5CCLA 5LSRA 3BQ0A 2UVWA 3GWCA 2KZZA 1VIXA 3AT1B 1GQEA 5F0UA 4RW4A 2JEJA 2VFSA 1NSAA 2LVWA 1OQ3A 2LXIA 1KQKA 2GJIA 2W24A 2AEJA 2BW2A 4WYLA 2QZ8A 2ZE2A 3G8SA 4KH0B 3NCPA 1WC6A 1MG7A 1D3WA 2BYCA 2DGXA 3OL6A 5L1LA 1DQ8A 2VFVA 4DR5F 4PAAA 3GP9A 4OZ0A 4XO0A 3N28A 3TO8A 4EYIB 4P7TA 1XK8A 1YITS 2R7VA 3R5DA 5FLXU 3DN9A 3MUVP 4PG4A 4ALZA 1X9MA 1VQLS 2Z2MA 3DOKB 2VL1A 4Q0BA 3TJAA 3R5BA 4LSLA 4OLPA 1WACA 2Q43A 1VBKA 1TFYA 1N52B 2GCFA 1LQ9A 3Q8RB 1T03A 1U1MA 4ZVSB 5BYRA 2DO4A 2FIUA 4WP3A 5HQMA 4LF5J 1CJUB 1IKVA 3RB0A 3BREA 4X2BA 1ITPA 4I6YA 2DNGA 4PYDA 4AT1B 3SYZA 3J81j 2ZNYA 3KLIA 4JI4J 3R1LA 1QLNA 3FBCA 3UDCA 3L7UA 3OVAA 1SJRA 2OMOA 1TL1B 3W66A 1Q4RA 3DHXA 3DRRA 1HARA 2IRYA 1WC3A 3CDUA 4DV2J 2EC2A 4MKVA 2YKPA 3W9IA 2XTJP 3QBCA 4H4OB 3FRZA 2NUHA 4KE5A 3KJFB 3V2UC 4BCAA 1VBYA 2XLIA 2D3O1 1URNA 1IXKA 4JYAJ 2PSZA 2GHPA 2IYGA 1UCNA 3PTWA 4LF5F 1DTTB 1VRTB 2R7QA 3FCWA 3KG4A 1C1BA 4CO0A 1CJVA 1NJWA 3FSYA 1RWOB 3PJXA 1CC7A 3V6DA 1QAXA 3EMTA 3NS7B 1VQ5S 4GO5X 4BC9A 1HIYA 4FXVA 4MIBA 4ZA1A 4X64F 3M9MB 3BGRB 1RU1A 3NEKA 1K9MT 3PW0A 3J7AN 2IIHA 1YK9A 4KPCA 4OZ3A 2IMOA 2W9AA 4QWDA 4QW8A 3DOMB 4GO7X 3A3OB 4Z2XA 1QTMA 2YNFA 1R27B 4UF4A 2HQCA 4IQXA 4RW9B 3PXGa 3C8YA 2RUSA 3TVYA 3MAHA 2AYBA 2PFDA 1TUWA 2AW0A 2HKEA 1WSRA 1UVIA 1M5PC 1CJTB 3CD6S 1NXIA 1K1QA 1RHQB 1U6ZA 2XNQA 4WCEQ 2CG4A 3JYTA 1VYAA 4C3LA 3OUYB 1DQ9A 1KOOA 4X65F 1HWUA 3C6TB 5B0CA 4J9OA 1YTYA 3HVWA 3NRBA 3V4IB 2VODA 5J1PA 1NPKA 1FDBA 3KJQB 4LVOP 4F4ZA 1TTHB 9RUBA 2HZCA 3JQMA 5LXYA 1K73T 2OPRA 4ZITA 1IBLJ 2PGCA 3K7RA 1IBMF 4PQUB 1H2TZ 1A0OB 1H7XA 3CULA 1PAEX 5D0EA 3H4BA 1CJTA 1RZMA 2FJXA 2MJUA 4B3MF 1SH0A 3DGPB 4PZVA 4DR4F 3DLGB 2ZBRA 1M1KT 1RQ0A 3GILA 4WZMA 4F67A 4DPUA 1N56A 3NKYA 1RDRA 4IRDA 4OFZA 2DEJA 1FNXH 3OJUA 3NLCA 2HAFA 4WPAA 2Y1IA 4DG1A 2X3DA 3D3CJ 1JX4A 1OMSA 2BKPA 1WEXA 4WE1A 2E5JA 2H54B 2OPQB 1R0CB 1VLYA 3FBEA 4B02A 4K2JA 3KHRA 2G2YA 5HLFB 2F9DA 2PMZD 1MMLA 4CQ1A 5GVQA 3U27A 5A6WA 1TK5A 4TN2A 4MYTA 4LQ3A 2ZWOA 2LXUA 1DQAA 5CZXA 2ZH8A 4EK2A 2RQMA 2Z2ZA 4C9DA 4FXWA 3R7NB 4ID5B 1AUDA 2ZFHA 4WTOB 5KAKA 1S6QB 3LUYA 3KMSA 4YB1P 2E5LF 4OQJA 1SC6A 2DHXA 5K14A 2ZJQQ 4L75A 1VQKS 4LF9J 5LT5A 4H4KC 5A0YA 3GYNA 1U0HB 1JJCB 3D6TB 4LFCF 1TL3B 2HVEA 4RUBA 2JWNA 1BWEA 2N4CA 2C3PA 2WSEC 5L1IA 4DFKA 3V5RA 2XLKA 3CJ3A 4CLWA 4V19X 2F40A 3UCZP 5KG6A 1F6TA 3GR1A 5E3AA 4BLGA 2MZSA 4BHQA 3EX7B 3RG6A 2KJWA 1EARA 1AZSA 3DOLA 3PG9A 4GRSA 2DNKA 2NSCA 1U6BA 3KLEA 2B4OA 5ETQA 1RWVB 3E01A 2V34A 3KK1A 3W7BA 2OEMA 3R27A 2XYPB 4WIQA 1S4FA 3DRSA 3SCLE 1YQHA 3R5AA 2ZH9A 2E7WA 2X1BA 3UO0A 4M5LA 1SIZA 2R7UA 1S7HA 1B0VA 4PXDA 4NMLA 4B3OB 5J2QB 4LBHA 2Y8WA 1M5KC 2FLNA 3OBIA 1LFWA 1RXOB 2V8VA 1X4GA 3Q8UA 4OJGA 3R8YA 2MQPA 3SZ2A 1R3NA 5HP1A 4JI3F 1GT8A 1CULB 4DV1J 1S1TB 2OHDA 1C0UA 1RT7A 2O5DA 3HDSA 3K2YA 4OYAA 4ZVQB 3ZXWA 4ZLLA 5EWFA 3BZQA 3LOUA 4B3SF 3NOCA 4IG0A 1FRLA 2HBZB 2HRYA 1F2HA 2LMIA 3EGNA 1WOSA 2RE1A 4USJC 4LUBA 4AFFA 2UUCJ 3KJNB 4HACA 4HH0A 4ECQA 1S0MA 4KPYA 2J9DE 3MD3A 2G13A 2HS0A 3MR7A 4OI1A 3SV4A 4C4WA 4I4BA 1S9GB 4BDPA 1Q8LA 1GMUA 1FDAA 2QMWA 2CQHA 3GJTB 4NYOA 1C0UB 2QO3A 2XWYA 3BSAA 4TNOA 7FDRA 4LRCA 1EAYC 1VHFA 5KFSA 2M52A 3BH6B 3DKDA 3KUHA 3QYYA 2KG0A 1HNXJ 2AEMA 4MKBA 4V1Ak 5HVFA 3O6QA 2GAGC 2KXNB 1IBKJ 3FFIA 2Z0GA 1RAOA 3IG1A 2Z8QA 4OX6A 1SB6A 2MQNA 3MTJA 5DQHA 4C8LA 2DGQA 4DG1B 5DG8A 4DQQA 1AROP 3D54A 4I64A 3D1OA 5E0OA 5T7LB 4KY3A 4DCJB 3DRXA 3UDEA 1ZM3A 2WONA 2D74B 4ZVUB 5KFJA 3B4DA 5KFDA 2DNHA 1QD1A 5KT2A 3JTPA 3BO3A 5BYSA 7FD1A 5LL6d 3TAPA 2GFFA 2JC1A 1XBWA 2YWFA 3KLFB 2YVSA 1SL2A 1WKLA 1LXNA 1UW9A 1YKWA 1QSSA 4LF8F 4RW7B 1ZAVA 3C14A 3W2WA 3C16A 4I56A 3WBZA 2G2ZA 2DHAA 3SIPB 5B08A 5LXRA 2IM2A 3KK2A 3T19A 1OWXA 2F3JA 2PD1A 1Q0NA 5DQGA 1U1QA 1UVNA 1IR1A 3ZZUA 3W3SA 2O1PA 4DV1F 4P2XA 2J7KA 2LXFA 3ZO7A 2G0JA 1N5QA 1U1RA 3N5BA 1GAOA 1V3SA 4DU7A 2QX0A 5KFEA 3FEZA 4P2MA 2J7WA 4UQGA 2C2ZB 2FQQB 1NDCA 2Q79A 1RAGB 3DU5A 3ELHA 1VQ4S 1M5HA 2V63A 1LWEB 3R5JB 3H4DA 1BQXA 4LF8J 1RWXB 1OPIA 3NNAA 1FJCA 2HFNA 4HHHA 3M8YA 2CQDA 1K1SA 3A8EA 3H2LA 3LPEA 5GAGU 3MM8A 4PKDB 2DO0A 1TMMA 5DQIA 1TAQA 4RU9A 1CULA 2FVPA 3V81B 1XNRJ 4ANEA 3H42A 4MJKA 1MWYA 3HSZA 2BJ1A 6AT1B 1NDKA 3T3FA 2CQ1A 1SJ4P 4JI5J 2QSFA 2WW4A 2W25A 4QPTA 2G9OA 2ASLA 1B3TA 4USWA 5IV4A 2AJ4A 1IR2A 3VAKA 1SQFA 1YJUA 3G8QA 3MD1A 5EX3A 2JNJA 2ZJPQ 3ISNC 4BWJA 3G6XA 1RT2A 2BQ3A 4KHPJ 2NXJA 5ETVA 2HBRB 1FKPB 1I6JA 4JV5F 3UD4P 3C15B 4KKOB 4YN3B 1MU2A 2YPZA 1HQEB 3IWNC 2E1RA 3RBDA 4FDFA 1UJ4A 4KTQA 4CCHA 2OH2A 2D3ZA 2UXDJ 3MAAB 4PG7A 5DM7Q 2DGOA 4NCAA 5DZ6A 4WP8A 5M2PA 1WTBA 2CKWA 3U1LA 1ZZFA 3RR8A 3W64A 3TOQA 3O8WA 2RDDA 2GMLA 4CNZA 3IR5B 3OSPA 4NLGA 2XO7A 4LQ9A 2KB2A 2XMAA 1GXUA 4FBUA 4WU3A 4CO5A 5A8WB 3MPUB 4LBPA 1X7VA 3M2UA 3S1TA 5I3PA 4HACB 2V8HA 4ZP7A 4OI4A 2DNLA 2E7XA 1NK0A 3BJYA 4EZ9A 2COLA 3BBCA 4L76A 1FNMA 1YI2S 2ZC4A 4LT6A 5GADU 4YHHF 1TKXB 1HWKA 2BX6A 3NGDA 4C98A 2GJFA 3Q83A 1FERA 1ROFA 3FKBA 5IT9U 3WC2A 1FWLA 4WP9A 2DJWA 2MHEA 4LSLB 1PG5B 1PAUB 3Q8YA 4RW6A 4UOGA 5DG9A 4B17A 2FJWA 1RWUA 1L5UA 2ROEA 4PWUA 4LFAF 1JLFA 3GYGA 1L3KA 4LF6J 2E5GA 5CHCB 2GJ2A 3A12A 1NSKL 1S49A 3GU0A 3RW7A 2GIFA 3UDVA 5ADZA 5KFZA 1SXLA 5IFMA 3KLHB 2H3EB 3MMCB 3RB4A 1GXLA 1LW0A 1O0PA 1UAWA 3KLIB 4MMOA 1BC6A 3LAMA 3MEGA 4OJHA 5DDRC 1D8YA 2RQKA 1T7PA 4ER8A 1RP5A 1TUGB 3HI9A 1H3DA 4DSJA 2FVSA 2OKQA 2BMBA 2L08A 3V81A 1DZ5A 1UFKA 2XQCA 3OL7A 1S10A 3QIPA 3MZIA 3RRHA 1ZZNA 2ZJRQ 2XEXA 2W9BB 2WAQD 3K59A 1SQEA 2DRDA 2VF3A 4LREA 2LEBA 5GMDA 1U1KA 1UZHA 4OJ3A 3JTOA 1JLEA 1REVB 2G4BA 1M5VC 1KLMA 1UP1A 1AYEA 1UA1A 4X4QA 2XLJA 2MKYA 3O3LA 2R8IA 4ECZA 1JJ4A 3CMES 2KH9A 3UR0A 1DTQB 1SPBP 2CPYA 2GVZA 5EHHA 5F8JA 2B4PA 5KFAA 2KVIA 2YNGA 4OYOA 3GPAA 3NGSA 4C8ZA 4HI1A 3E01B 4ZVPB 1N36J 3EZOA 2UXBJ 4IQMA 3MM8B 4OMFG 2XMMA 4DZDA 1N54B 2DD8S 2B8QA 1ZOTA 3T41A 3TYTA 4OHVA 4DX7A 5EN1A 3HO1A 1Q16B 1Y5NB 3PZPA 1PBUA 4WXWA 3LWLA 4DV4J 2QEXS 4TVAB 3CC4S 1XNQF 2D1CA 1U2FA 2HAIA 1X5PA 2DTJA 2LQ5A 2PA3A 3ILJA 1DURA 4LF2A 4QIFA 3H25A 2MHNA 3MM7B 1X4BA 4JOUA 2MSTA 3BR9A 4DR6F 2R8KA 5IZHA 4Z37A 3CDEA 4B9MA 1S7IA 2E9RX 2EBEA 4Q2LA 3CDWA 4ZPBA 5LOQA 1HNVA 4ECVA 2R7OA 1U1NA 5I3UB 1F0XA 1FKOB 1SKUB 1RAAB 3JAMY 4CP5A 2CWXA 1U2CA 4RBUA 4OX7A 2E5IA 2CQPA 2MQLA 3N9UC 4YY3F 1Q86T 2OPSA 4A8QA 1EIYB 3CD0A 2RQ4A 2VFUA 2J9CA 1JNRB 3KG1A 4V19J 1S6QA 1S1VB 4JV0A 3PW2A 1KQSR 3PDNA 2A2DA 1XNQJ 2J8SA 5C5JA 2H4YB 3D5MA 4NCGB 1P1TA 1S12A 2W9CA 2B9YA 4RNNA 2PI4A 5GADI 5EWGA 2C2NA 4Q2MA 4DUTA 1U0SA 2VDHA 2QGFB 3ENQA 1FDDA 3M6VA 4WFBQ 3C66A 3IR6B 2GQCA 1RAFB 1FWPA 1TL3A 2G1DA 4N47A 1D8ZA 1ZAXA 4DFPA 4IR9A 4A8KA 2R3VA 4FNHA 5BR8F 4PR6A 3FFIB 3A4TA 2DB1A 2YNIB 3CJ0A 1JXVA 1NBEB 3WQPA 3PIOQ 5KFLA 2AX1A 5HL7Q 3FRYA 3M1VA 5IXUA 3VV2B 5E41A 5L1KA 2HS3A 1XMOJ 2R8JA 2IC3A 2YH0A 1R8AA 3HFVA 3LF0A 4NI2A 1F9FA 2QE5A 3AXKA 4PQAA 4X64J 2IMWP 4JI0J 3VAHA 4ENOA 3IAS9 2LYVA 3TX0A 1YJWS 3MOJB 2PEBA 3AY0A 1HBOA 4RUHA 5A6PA 2HVIA 1VRUB 1X9WA 2UVRA 3JSRA 1R6VA 3VZHA 2LP4A 5F0WA 4C97A 1Y00A 2QA1A 2V8PA 1FXDA 3HCXA 3JXOA 4DV0F 4F50A 4DQSA 1HR0F 3D1QA 1T9UA 1U25A 2KXHA 3TNVA 4ELUA 1WC4A 5JMNA 1H74A 3AA9A 4J37A 1PIEA 2K1RB 2XHWA 2AWZA 2RU9A 4K5RA 2QT7A 3AJ1A 4Y0FA 3QMQA 4R25A 2ZHBA 1WEYA 4OI0A 1CVJA 1T94A 3FJ2A 4P71A 1ZH5A 2J7UA 4I1TA 2GV1A 1IBCB 2UXCJ 2G1HA 2GAHC 4DF4A 2HMIA 2YKNB 4FYWB 3RAXA 3M4XA 1C0TA 3M32B 3D0IE 3R2CJ 2DXDA 3AAWB 1FTRA 1T05A 2IPOB 3DLLQ 4DPWA 1MWQA 2PN6A 1GXTA 3VAGA 4NLXA 4EYHB 1W26A 3LP2A 4OHXA 4WU2A 3ZC4A 4MK9A 2ZUGA 4QIGA 1YJRA 3V6KA 4O3SA 3RW6A 4OV1A 8RUCA 4U67Q 2R9LA 2YNGB 1T3OA 3DLEA 4HDHA 2ZH7A 1V6HA 1WTFA 4PG5A 4PEOA 2U2FA 2HQFA 3HT0A 2RF2A 5IQ6A 2NPFA 1K8AT 3NS6A 3EVMA 3PRDA 3VCDA 5HP1B 1X60A 1G1XA 1QTNB 2Y1LB 1EJ7L 5T41A 3A8JA 4NASA 2X1AA 4ZJQA 4QR2A 5K8OA 4JP8A 3C46A 3M2VA 3VAMA 1UWAA 3GB0A 4PXBA 2CZ9A 4ED3A 4HEA9 1RLCL 3T1HF 1U48A 4PUOA 3V4MA 2ZHAA 1UA0A 1OO0B 3JS9A 2RF2B 4KR0B 1R8HA 3CW2C 2CRLA 1VFJA 3JSBA 1S6OA 2QLWA 2K8GA 3T1YJ 3I87A 3TVKA 1VLOA 2JFKA 4ID8A 2KHDA 5FD1A 3CMAS 1B7YB 2V2KA 1D1UA 1YJNS 2BANA 1N33F 2AHOB 4LFBJ 1WI6A 2K06A 4CT8A 5G0RB 1NK8A 4C0BA 5KFUA 2HQIA 4L6V3 2HEKA 1RI7A 1Q95G 4JI3J 4N7TA 2PI5A 4OI3A 3SBMA 1R43A 3DLKA 4FKYA 2VJUA 5A2QU 1WG5A 3F0NA 1FO1A 4HL9A 3J7Z5 3EPGA 1SJ3P 3OTCA 3MECB 4Q44A 1S57A 3GONA 1TV6A 3JB9k 2DXEA 2UUBJ 2V9WA 3GJSB 1C1CB 1S4EA 1UPMB 2WRMA 2MGZA 1DFDA 4CZCA 2HBYB 2HHXA 2C22A 2F4VF 4NEYA 4FBTA 4QWBA 4OZNA 2HQDA 1HNZJ 2A1BA 1NCLA 1Z2ZA 2P9CA 1VK3A 3DLKB 1N4LA 1HBUB 3IA0A 3OTDA 1U7LA 2XULA 4LR8A 1C0TB 1KFDA 1YRXA 3MEGB 3OD2A 1LWXA 2I9SA 2VZ9A 4RPFA 4CM0A 5KT3A 3TWZA 3OLAA 4USIA 3MI7X 4U95A 2VFRA 1TQLA 5F8GA 4ECUA 3GQCA 3MUMP 1WORA 4ED6A 1RA7A 1VRQC 2VG6A 4OZ5A 4O4RA 1RYRA 3RBXA 2WVBA 2W1BA 4YB7A 2WOMB 5LMUF 1NKEA 4KKOA 4BC7A 2ADCA 3S7RA 4JI5F 1QVGR 1WJ9A 4K59A 2DH9A 2JFDA 3RTVA 2OMLA 3OR1B 1K44A 3UW1A 4RW9A 4DQIA 3PX0A 3DRSB 4ERDA 3RBEA 4ZVGA 1OY6A 3IN5A 4KB7A 4DJBA 1VQ9S 5GAHI 1Q53A 3AD7C 1BMQB 3QJPA 2ZDOA 1BUXA 2WSCC 3AODA 3B78A 1QE1A 3KHHA 3G6ES 1N48A 3CE8A 2YX7A 3L09A 4OZ1A 3CJKA 5CYQB 2YQ0A 4I2PB 4B9VA 5F9LA 1QAJA 3KJVA 4QWCA 1HPZB 4IFYB 1UETA 1RKIA 3IWLA 3DDIA 4YEAA 2YQ3A 1OSDA 3CTRA 2E5LJ 1I3OB 1U24A 3T9ZA 3PV8A 3WX4A 2IVYA 2MKKA 1SKRA 3QATA 1GK8A 2YBVA 4IG3A 2K7JA 1T9WA 2A2CA 2CJXB 1LK5A 2JRSA 3WC0A 3EVWA 3G82A 2LQJA 1VBXA 1JXLA 4OX9J 1RWMB 1SCJB 3EGZA 3UN2A 3KJVB 1S9GA 1FKOA 3VAFA 1X5SA 7AT1B 1HHTP 2QSWA 3QPIA 3UQSA 1R89A 4UY85 1EKSA 5D77A 3ILIA 2Y9HA 2IM1A 2K2PA 3K17A 4KSEB 3NGUA 2Z57B 3LPYA 2KT2A 3KHLA 4ED1A 5EGYA 2LLZA 2OJ3A 4D3GA 3T6BA 1IKXA 1KONA 1LWCA 4HKQA 4DL2A 1F5CA 5HJXA 4CYUA 1JJ2R 3BSOA 3K5MA 4LF6F 2E1CA 3LA0A 4R0JA 4CH1A 1LOUA 3BKUA 2FLPA 3DXBA 3HVTB 4ZN3A 3CCZA 3R1HA 1P27B 2JDJA 3W5YA 1SBRA 5L46A 4X4PA 4DV3F 2A0FB 3Q86A 1E6YB 4DEZA 4NLTA 4X62J 4C8OA 4NXNF 4AYBD 2BE7D 5HSPA 5IV3A 1ZM9A 3AOCA 3SEOA 2XYHB 1TL1A 2M88A 3QSIA 1KWMA 3W9HA 2D9OA 1F60B 3GMGA 4ELTA 2YPYA 2QLFB 3M8PB 3N4WA 4NLVA 5GAEI 2V9KA 3FSIA 4CIOA 2ATCB 4IOCQ 4X4VA 2KDOA 1Z2LA 5L39A 3MR5A 4LRFA 4K4SA 2EC0A 2VC1A 4GC7A 4X66J 1LNQA 2XBPA 4ZMMA 5K20B 1RLDA 1VQPS 2V5HG 1V3RA 2P6SA 2QL9B 3R6LB 4OYMA 4YMEA 1YJ9S 2U1AA 5HBMA 2JH3A 2NYIA 4M5KA 1SI9A 4FYYB 2XS2A 1VRUA 2Z56B 3D1HA 3I32A 1ZAWA 2VFTA 4ILRA 3G71S 4PWDA 2NZ4A 4K8RA 1NSQA 3OFFA 4P9SA 1RHKB 5D0RA 1YBAA 1UEKA 3RB3A 1OJ4A 3GJQB 4KIAA 4ES2A 5C42A 2MTLA 1MROB 4ITSA 3EUNA 3ENWA 5CYQA 1N88A 2ALZA 4ZPAA 3MM5B 5EUHA 5J2NB 3US5A 1JLGB 3CT9A 2KFZA 2RSQA 3UCUP 3VVTA 3MR6A 5F8MA 1TELA 3ZTRA 4DFJA 3QO9B 4RL1A 3DLJA 4IH5A 3BGUA 3PRVA 5KFCA 3CCQS 3BV8A 2DGVA 3Q89A 4DLGA 3FCHA 2VHGA 3QSYB 1TK0A 1U09A 4KBIA 4C8YA 3GJRB 1WHYA 2B5JB 1T95A 2GGPA 2N3OA 2VJVA 2LU1A 1EQMA 1TUVA 2C3YA 1EB0A 1T0TV 4KC5A 2ZZNA 2ZKTA 5K8NA 3DGPA 1WI8A 4NLSA 5F8HA 4WKYA 4W92B 5FJ4A 1T9YA 2VKZG 4JI7F 3EDQB 2UV8G 1P9QC 2JL9A 3I96A 5HQ8A 4F26A 5AE2A 3KG0A 3R6GB 3MMAB 1IVZA 4YR0A 4X4TA 2XSJA 2YKMA 1UVKA 2D41A 1XEZA 4CLLA 3K0JA 5FDLB 3P96A 2R7SA 3VGVA 4E98A 1CC8A 4HYKA 4OYXA 1JLBA 4W4MA 4K5SA 2V4JB 4LF1A 2VICA 4CLPA 2WCXA 4K4VA 1PJ7A 1ACMB 5C2CA 2JSXA 1CQMA 1C1BB 4B3TF 2IJRA 3QWPA 5KG5A 4JI7J 3AQPA 1T02A 3B82A 4IFVB 2ZBCA 2XMWA 2HHWA 3MWBA 5U47A 1RADB 4CO1A 4YS2A 5LMNJ 1UL3A 1X4DA 1RJJA 3O44A 2F5GA 5C2GA 5F8IA 1P1LA 1S1XB 4CLYA 2KZMA 1MLAA 1FRMA 5CA5A 2ABYA 1S1UA 5CQGA 5HBMB 1YBTA 1O8BA 1LEOA 2HVZA 5B0BA 3RYLA 2ZH3A 4UY8T 3TA2A 2VG7A 2M8HA 5DDQC 1MW7A 2H65B 3CSKA 3TA0A 4CDIA 1DTTA 4X84A 1TV6B 3H5UA 3QT8A 4WK1A 2QA4S 1HR0J 5GAGI 3OL9A 3LTOA 2B6AA 2XI3A 3NCRA 4LBIA 4IRCA 3N01A 4EEYA 1T05B 2J9DA 2EK6A 2ZHOA 3W65A 4XPCA 4O4GA 2GNKA 3FZ2A 4MYUA 1FKPA 3CJ8A 1ZTWA 2B8PA 3A13A 2C3UA 2C2DA 4MFBB 4DV4F 3HKZD 3IGNA 1WD6A 2PE8A 2OPPB 4LF4F 4I67A 1HYSA 1KKHA 3THTA 4GKKF 1Y5LB 2EKNA 1U26A 3EWGA 2R2TA 4C11A 2QLJB 3QAUA 4Q43A 2QMXA 2ZDPA 3LP0B 2JZ5A 2XB2D 2MLXA 4DWIA 2AJ0A 2LFVA 1DTQA 4FZVA 3D66A 1FWKA 3UDLA 1R31A 2MSSA 4P2FA 2ASDA 1K0VA 4G1QB 5J1EB 3H98A 4TXSA 5EX0A 1UVMA 4ICLB 4YFUA 2FJVA 1S0NA 4DHVA 4DR5J 4DX8H 1SH3A 4I68A 3SV3A 4LSZB 3HFZB 4PYAA 4UUWA 4A8XA 4FF4A 1M1GA 1S1TA 1RT3A 2GVDA 1C4AA 1SVDA 2B4VA 2QIFA 3LP0A 3TZYA 1YHQS 4DV0J 2L48A 1IKYB 4F4XA 4NLWA 3B54A 2QL7B 3MAAA 5J1EA 2AV5A 2HBQB 3NBPA 2P6TA 5B0GA 4UOFA 3S6EA 1RAEB 3PEJA 3WDOA 4RNMA 1N0VC 3Q22A 1NH7A 2KHCA 1FFSB 1JQGA 3DMJA 4I6WA 4RNHA 1JIHA 2H5IB 3W8PA 3A1YG 4ANDA 3L7PA 3MMCA 4YOEA 4MT1A 1UEVA 1OS5A 1M5OC 2CJAA 3DOKA 2AT1B 2GMJA 3R5GA 3O2IA 1Y7PA 1H38A 5DLGA 1DHMA 3IR7B 5HJYA 3PFEA 4XTTA 3NBPB 1SKWA 3BGFA 2OIHA 3QZ8A 4MK7A 4ED8A 4K50A 4M95A 2HFSA 5BXIA 4ZLJA 5CD4A 2V4QA 3K5LA 1FRIA 2LQ8A 4B9LA 1S1UB 4EO8A 1HBNB 3NCQA 3HJFA 4ZHRB 1N5YA 2KL8A 5LJ5Y 4Y2MA 3J7A1 3AD8C 4LJMA 4WWSA 1RK8A 3F73A 3KDOA 5K14B 1U4BA 3G2XA 2W4DA 1X0PA 4H4KA 3PKYA 2FTRA 4CRJA 2BM1A 4TQRA 1IBMJ 1UPPA 3GLJA 2EFVA 2R2RA 2J8AA 1KLMB 4U7UD 5H9FJ 3MEDB 2VU5A 4ZP9A 2VIHA 2VA2A 4JV1A 3HPOA 1LW0B 5IQQA 4Y00A 3HHLD 1P6TA 8ATCB 5T14A 2XC9A 4ILLA 1D9FA 2CQCA 4P52A 2FUG9 5DDOC 3T1HJ 3ZNJ1 2ZVIA 3CO9A 4WIIA 2P2CB 4X4RA 1KBRA 5E3PA 5SZTA 2VPXB 2DEIA 1AXQA 2XMUA 5C24A 1N34J 2DHSA 4RBVA 1A7GE 4DR6J 2H5EA 3R3TA 2QJ3A 3FC9A 2W8KA 4KO0A 1X9SA 3PX6A 2Z4PA 2W9BA 2ASJA 1CPZA 2DGSA 2CDRB 4WK3A 4UUXA 3ZTOA 1E6VB 2H48B 4ICLA 4KRWA 1D0EA 4B3TJ 4QYZJ 2C2EA 2NLWA 2F8MA 1GX6A 4JI2J 3MM9B 2GC8A 2DY1A 3SCJE 4DQPA 3OTBA 1Q5VA 4O3OA 3NL0A 4KO0B 2HMIB 1QM9A 4Q8FA 3Q2SC 2OLWA 4Q45A 3TR5A 2AF6A 2HLTA 2DCLA 4ECRA 1Q8IA 3C6TA 1E6VA 2MKCA 4KFBB 3HSGA 5K9FA 2I5JA 4DV5J 3K89A 1U6FA 3GFXA 4IR1A 4CTAA 4RNFA 4NCGA 1RTHA 1REGX 3IP0A 5JJBA 4RW4B 2AJ2A 2DRAA 2OPRB 5BR8J 4K4WA 3HJVA 1N8RT 1CS4A 2RKIA 1IKWA 1HNIB 3HFKA 3SXLA 3BDPA 4NLYA 3JSMA 3FEYB 5ETOA 5D8HB 5IT9Y 1RTDB 2BOAA 3IFEA 3UN5A 1RT4B 1ZS6A 2JEFA 4JI6J 4WF9Q 1YIJS 1LW2A 2VDIA 1QSYA 3D0HE 2I5JB 4MK8A 4OX9F 3TUZC 4A48A 5D4PA 4DV5F 3MCOA 4KGZB 4ZVHA 1B70B 4EWTA 3C14B 1HBNA 3GZ7A 2BKNA 5HVGA 3PW5A 3I6PA 4NLOA 2OUGA 3PR5B 4LIRA 3RR7A 3CJ2A 3BGLA 1TKZB 2ALYB 2BRKA 3EM1A 1RTIA 3ENVA 3HZGA 3OXFA 4WFYA 1E6YA 4IH7A 1TKDA 4LF7F 1B7FA 4G1IA 1FKAF 2WBRA 5KT6A 2BKOA 2PMWA 2MKHA 1RT6B 1VJWA 3EYZA 3M8PA 5T7LA 3L7OA 1H2UX 3HHEA 4MH8A 1B4SA 3L9ZA 3VGSA 2HSEB 4U7CA 3GV7B 3ZTQA 3L3CA 5J2PA 2Y1RI 4HH1A 1LXJA 3PACA 2OGUA 3ZZTA 2ZH1A 1FJ7A 2AJ1A 2UXCF 5A76A 3OFEA 1KP6A 4O3NA 3Q23A 2XYGB 4K4UA 2CQ3A 1G7CB 2Q6BA 3C16B 4DV7F 2AGQA 4E2FB 2ZH4A 2AJFE 5HMXA 4OHZA 2FZCB 2UUCF 3T1AA 1RTZA 5D0HA 4URGA 2DBBA 2FYXA 4HT7A 4DS4A 2BA9A 2F7VA 5A8RB 2OO4A 4C7QA 2QFJA 4J9RA 2K7KA 4GMKA 5GMEA 5IM0A 2HHUA 2PO4A 2EK1A 2POKA 2JVOA 2MZQA 3MFIA 2DIVA 5KOXA 1VC5A 3BEGB 2AYEA 2B9XA 3H20A 2ATLA 2WZ1A 1Y3KA 2GS8A 3FQLA 4M5IA 5ETSA 2G0CA 1QAYA 3MPVA 2ZD1B 1L3TA 4Y65A 2KT5A 3O1LA 2E1PA 2ZM6F 5ETKA 4ZJOA 5HMYA 2BEFA 1YLXA 1FRKA 3H2UB 2FJDB 4CTAB 4F4AA 2KU7A 1I1GA 3SSRA 5I4MA 5F3ZA 1VK8A 5HK4A 2CWKA 2KM8C 1SKSA 4OHYA 3Q2TC 3JAMU 2CADA 2BDPA 1P8GA 5E3QA 1PYTA 1N32F 3QT6A 1W2BR 2GO9A 1KR4A 4YDDB 4N56A 2YQ1A 5D6GA 1IM6A 1F5BA 4OZ2A 3OTOF 1MMNA 2H1YA 5ETTA 4KHPF 1F9HA 3PM9A 4C11B 5DGBA 4Q8EA 2KKHA 2FVQA 1BGXT 4URSA 2HNZB 1RT7B 4UTGA 5J2MB 3LP1A 1WG1A 4ID5A 4RWWA 4LRBA 4J9UE 4FF3A 2ZC3A 1H6KX 2F8EX 4KGKA 3U1NA 4I2QB 1N0UA 2RDIA 3TJ8A 1VQ8S 1RTHB 1G6BA 4DCOB 3DXSX 1NKBA 4K7QA 4OI2A 4LR9A 3D6FB 1F5AA 2C42A 2CZVC 2MKJA 4IFVA 2OPQA 5E7OB 2L3MA 4ZDNA 4YUDA 3JSMB 3PHTA 5HLFA 4EBCA 1HW9A 2PFFB 3G86A 4ECTA 4Q0BB 4AQYF 4OHWA 1RT1A 4Z7YA 1D9DA 2ACYA 4ZVFA 1AW0A 2GZOA 5CH7B 3U1MA 4C3MA 2M8DB 2DPJA 2P9EA 1OIAA 4ZOSA 3POTB 2BJ3A 3H7HB 1OSCA 1TVRB 5DS7A 2VQFJ 4NXNJ 3OR2B 4GKJF 2CPFA 1WC1A 2MKIA 3IAM9 1WWHA 3NY0A 5FDLA 4FVMA 5F41A 4NYZA 3G9CA 1IUJA 2HPUA 1YWXA 2FY1A 2KRBA 1YGYA 4M5HA 2ZZMA 4RNOA 2FLLA 1IN0A 3F44A 4WKRA 3HHLC 3EGVA 2QLXA 2DH8A 1O51A 3GIMA 3OTEA 1TP7A 4H4MB 1WNEA 1RACB 5KFBA 2MEWA 5B0AA 5IM0B 2LA6A 5KFXA 2F8HA 3SQOP 1R0AB 1H7WA 4R5PB 1Q5YA 4DF8A 2NS1B 1NPPA 2P8IA 2WOMA 2MLZA 3BR8A 2HRUA 3MDFA 2NYHA 4HDGA 4M5NA 1S6PA 3CGIA 3QRPA 1ZA1B 4U7UK 2UUWA 1NEEA 2F4FA 1S1XA 1PYSB 1PC5A 5DRKA 2RIJA 1S97A 4D3HA 4N77A 4OJ1A 2XY5A 1NK6A 1HBOB 4LVNP 1OY9A 2IHR1 5B0EA 4DDFA 5HVHA 2DPIA 2YX1A 2NPIA 2NREA 5H9EJ 1HI8A 2Q1LA 3VZIA 3KLEB 2C28A 2BXJA 3A8KA 3CC2S 4PCQA 5HI7A 5B09A 3UVJA 1RHUB 2M9KA 3FMBA 3MM7A 4F04B 4AL7A 3TARA 2K1RA 2B3TB 1FEEA 2YNFB 4MKAA 3ITHA 4AD6A 1QJHA 2EFGA 1KEKA 2BE9B 3MEKA 1GEHA 1GTEA 2DGWA 1VC6A 1UVJA 3LH2S 2GVZB 1X8DA 2W7AA 3ETOA 5HATA 2W4PA 4F0MA 5KFKA 3KLGB 2MYFA 4RX6A 3SDEB 4FS2A 4NXMF 1IKYA 1UWBB 2PDAA 4PRFA 2B7CB 2W2OP 1Q8KA 1X4EA 2VBZA 2VG5A 1VJQA 3IBWA 2XMVA 3PW4A 4KV8A 2IFXA 4RR5A 5L8RC 3R5CA 2WVCA 1PGZA 2HYIB 5K5MA 1KS2A 3UWTA 5GMKa 4O3QA 2W9CB 1Q81T 4IH6A 4NOHA 2A3JA 2RHSB 3EXCX 1I94F 5KG7A 2XNRA 3BM7A 3N6LA 4HT5A 2R7TA 1HWJA 3HZEA 4EMDA 2UU9F 1R6YA 4NPOA 3T1YF 4K2XA 3K5PA 5HMWA 3SSQA 3CCUS 2X51A 4QR0A 1YRUA 1TL4A 4ZCKA 2VG5B 3Q8SB 2OTJS 2DNOA 3P45B 3OV7A 2QG9B 4X62F 2AZ1A 1RKJA 3PY8A 1TR0A 1S72S 3PEHA 1X5OA 4Y2KA 5DGAA 1NZ8A 2IVFB 2L41A 2HHHJ 2IM3A 4FS1A 1IWAA 2YXLA 5IT0A 3M2UB 1VCTA 4XPEA 2ZOFA 1WEZA 1I94J 3PCOB 4TY8B 4LMZA 1KVJA 1G2EA 1RTDA 2V4RA 2KI2A 2WVDA 2ZM6J 1T03B 3UCGA 1IBKF 5IC4B 3ILOA 3GG1A 3TUIC 3M8RA 3BBFA 2LCWA 4ZS6A 2V2VA 4X66F 4DBQA 2LQ9A 1QVFR 3MUTP 5KOWA 3GV5B 2X1FA 1BD6A 2KXFA 2YWGA 3HHLB 2HGNA 4M63A 5F8LA 5E3CA 2DR9A 2RILA 3GIKA 2J0QD 4X4UA 3OXLA 1LKZA 2VB6A 3M2RB 4KH1B 5KFOA 1RTIB 3NOGA 2MY8A 2KM8B 1FA0A 1NMEB 1WF0A 2YNHA 2BQRA 3CCJS 4B3RJ 2RU3A 3KLVA 2JC0A 3CO0P 3HX9A 2E44A 3DFEA 3M1VB 3EDRB 1BE4A 1RCXB 3W8GA 4AXIA 1XR6A 3KDNA 4CLTA 2DITA 3J7YU 4Y2AA 3I5BA 4A8OA 4WBFA 3TUJC 1XERA 5B7WA 4U96A 3PYGA 1S9EA 4CLZA 2NXEA 2HQGA 2JLFA 3PVXA 2MQMA 2MJNA 2FPHX 2Z2YB 5DLFA 1W2IA 4ED5A 3RRGA 5DZ7A 1YJ7A 1GMWD 3MPDA 3NP5A 4NLRA 3QGGA 1B64A 4DUYF 4F3MA 1JLAA 1OYEA 2RNEA 1X4HA 1KQGB 3QO9A 3R7SB 5C7PA 5JVGQ 5A8RA 3M8SA 2NXUA 3MAQA 3KNAA 4UW2A 3H5SA 2XWXA 1FVQA 4CO2A 2B51A 1SIWB 2KN4A 3CJSA 4DZ6A 3OSNA 2C2KB 4KV8B 4U8VA 1XTZA 5CYMB 3TEGA 3WIVA 3G87A 4ED4A 5LSOA 2MMYA 1Z1ZA 2D7SA 3G8TA 4ZP8A 2P9GA 3FGVA 5AT1B 5M2RA 2NSBA 1I5OB 1S48A 2OTLS 4K0KF 4F36A 4JUZA 4DFMA 2HVDA 3PFOA 4QR1A 3V4IA 5G4DA 1DJ0A 1XIQA 3VF0B 5CAAA 4NA2A 3KKFA 3CDAA 2CJBA 3B6BA 2QC3A 5KFYA 4HLBA 1TKXA 3EVOA 4QYRA 2KT3A 2E9ZA 2IDLA 4CLSA 5HN0A 5L38A 1L3UA 1FJGF 3IRWP 2LA4A 5MAOA 2W2NP 3ET6B 3SSSA 5JUMA 2M2BA 2IY5B 1KN6A 3MFHA 1UMJA 3D0GE 2O66A 4A46A 1Q1KA 2L9DA 2N7YA 1RAHB 2YX4A 3JQKA 3WX8A 3ULHA 4RUAA 1JJHA 1PCAA 4L72B 4A8YA 3C2PA 1RAJA 2DR6A 2VBYA 1WF1A 2OELA 2R7XA 2JOQA 4QYZK 4YR3A 8AT1B 4KT0C 2UUBF 4CNYA 4CH0S 4B3MJ 2CYYA 2JJ4D 2KJVA 3QT7A 4DV6J 3I4HX 1DLOA 1WKJA 2JX2A 2E29A 3I56S 4DR1J 3W60A 1JB0C 4CO3A 1YBUA 3K8WA 3BO4A 3PJWA 3F41A 4GVBB 3MMJA 4W98A 1J5OB 3IG1B 4O0IA 1ZM4A 2H9ZA 4JBCA 1S6UA 2XMJA 2YKMB 1IWGA 4PPDA 1KSPA 3QIDA 4FP9A 3DYAA 4CLKA 3DLHA 2CNKB 4DQRA 4QW9A 1RUSA 3RB6A 2M3DA 4P6QA 2CJKA 3E3XA 3UFCX 1F3FA 2N82B 4ES1A 3ZZ0A 2J0SD 3BQ1A 1RA6A 4L73A 2FLOA 3VALA 3CF5Q 4IOBA 2X3GA 1RT6A 4RJVA 2BRLA 3HSDA 4NA1A 5GAHU 4A8SA 4PUOB 4DR7J 2WB4A 1JK9B 2RT3A 2ERRA 5HROB 1YVFA 4FPRA 5MLCV 4OYPA 2ZH6A 3H5XA 4MAKA 2ZD1A 2CIMA 1X5TA 2Y0SD 3LW5C 2EG1A 3M8ZA 3OR1A 4HTJA 2R2UA 2CPJA 1LFPA 2DHHA 5ETRA 4CLFA 5CYMA 4ED7A 2HQ3A 2J0XA 4ELVA 3D2WA 2CJQA 2V94A 3BPSP 4P7VA 3SCIE 1VDHA 4C2MA 4WYWA 3GFZA 3IRXA 1LK7A 1F1BB 3OFGA 1GX5A 3KK1B 3HD1A 1BQMB 3FDSA 3SQGA 3WZ0A 3MR2A 1R8BA 1REVA 2B0GA 1X4CA 2PC6A 4A8WA 5D3GA 1FE0A 1H2VZ 4F8RA 5CABA 4IFYA 4F3QA 1VI7A 1IJEB 2BJ9A 1M1HA 3MCSA 2VBWA 4DR2J 1TL7A 4ECWA 3LP1B 2DGTA 1UFWA 1LWFB 2CFXA 2YKQA 2OPPA 4ATNA 4LSNB 2H4WB 2VASA 2GMHA 3DM2B 4WXOA 5ITHA 1YX2A 5DG7A 4I2QA 4DL0C 4DL6A 4PPZA 3CCSS 3ZZYA 3CVKA 1FNOA 3HK2A 1N6QB 2EVZA 5C25A 2XZDB 3H90A 2FJAB 1UJ6A 3OPKA 1ZA2B 2FHOB 3NGRA 4NLQA 4OX8A 5FLXY 3DLEB 2RH3A 2M0GB 3NGTA 3QAEA 1ZYQA 3M7VA 2CNOB 4E0DA 4LSNA 2JEIA 4KFBA 4IO9Q 3U02A 3QFWA 5IWAF 3NMAA 1HD0A 2EXUA 4F7VA 5KT4A 2MB0B 5D4OA 3EPIA 2I0XA 1HNZF 4FXDA 3J7ZT 4O3PA 1MNEA 4UZBA 1UW4A 3KHGA 1VQ7S 1BLUA 2UP1A 2CG8A 2CNLB 1B0TA 4WTYA 5K8MA 4C48A 2RS2A 4K4ZA 2V2ZA 2CAJA 4DPYA 2BQUA 3IS9B 1V5IB 1S79A 1NRKA 3BDEA 3BPDA 5KFHA 4FYVB 3NG8A 1FDNA 1WSVA 4M5JA 1V3ZA 3EJMA 3KFWX 4XIUA 3QNWB 5L9NA 1XR7A 3BO2A 2DRBA 5KFQA 3LWMA 2M70A 2NXNA 3AJ2A 3F56A 2EBGA 4DSKA 1B99A 1YSJA 4MIWA 2V4JA 3DRPA 5HMZA 3PKMA 2XM3A 2LDYA 4RLEA 3ETMA 3D68A 1SC1B 2G0IA 2PEHA 4J9VA 4PWWA 5AXLA 4RW7A 3W2WB 5AE1A 1FESA 3C19A 2LECA 4USUA 1NNDA 4IDKB 4XK8C 1K47A 5IC6B 2YKNA 1FVSA 2KYXA 3MECA 4P2SA 1VOMA 3C3LA 4ZKAA 2L9WA 4UQTA 4EBDA 2F1FA 3PW7A 5THWA 1GTHA 5KFVA 1VQOS 2DR8A 4M8LA 3DRPB 4OYZA 1S99A 3CD7A 1TKTB 1EZZB 3DLBA 2YNHB 2A10A 2ZUAA 4DN9A 1XMQF 3KTQA 2W7OA 2RRNA 2CJ9A 2HZAA 3HLUA 1JLGA 3NNHA 2ZNZA 4DV6F 2H5JB 4NZ0A 4NLPA 5LMUJ 4IO1A 2IRXA 4B08A 1JLQB 1Y11A 1C2PA 1KHWA 3PHEA 2GIQA 1LWFA 3CJRA 1CJKA 1T9VA 3MPYA 3FVYA 5HAOA 5C24B 2MPUA 1OYDA 4DL5A 2A6OA 1KOHA 2HGLA 1JLEB 2XSFA 3NWRA 4ECSA 1N36F 2XZWA 1O6XA 2HIQA 3AOAA 3BKTA 3FEXB 2EG2A 3FNNA 1MMDA 1HA1A 1WHVA 1FF2A 1RTJA 2GHVC 2MQOA 1LV5A 3W63A 1FK9B 3EICA 2ZBQA 4QIVA 1HNIA 3AQOA 3T5JA 5AXMA 3FK4A 3SQGB 3JTNA 5C42B 5LSLA 1JLAB 1KLNA 5J2QA 4MFBA 3W5ZA 1HYSB 1X4FA 2V8GA 2DT9A 1SQGA 2GX8A 5HANA 2ZH5A 2BR0A 4JI8F 1IQTA 4PQUA 2DNZA 2AKWB 4ZK7M 3VGUA 1AZSB 3DOLB 1X0FA 3R9LA 5CXTA 1GFWB 4XAKA 3IBCB 2WVEA 3W1YC 2UVVA 2MLYA 1UWBA 2KFNA 4DCPB 2CQ0A 4QZVB 4DSIA 2W01A 3GFYA 1EQ0A 1TAUA 2HG4A 4JI1F 2ZOMA 2CPEA 1WC5A 2DCUB 3K58A 4QU6A 2HHSA 4L3NA 6FD1A 3TQ1A 4BBYA 3CCWA 4O0NA 3VQSA 2IA6A 4J9MA 1RT3B 3OHBA 5KG1A 3RRKA 1HLWA 2J9EA 3DNCA 2MZRA 3TZWA 5A8KA 4WFZA 4R8UB 5EWEA 2RAQA 3MEEA 1NK9A 2HWHA 1DY3A 2FC8A 4ETXA 1LW2B 4H54A 1FD8A 4IG3B 5KG0A 2NUUG 2YWHA 3I4PA 1UKUA 5GAEU 3SCKE 3A8IA 5KFGA 1L3SA 1BXNA 2DXFA 3PRBA 2AJQA 1RB0A 2JLEA 2YWWA 4IDKA 4DUYJ 2GO8A 4NXMJ 4HR2A 5G0RA 2AYMA 2RMLA 1HBUA 5ETLA 3J80Y 2OP5A 5KFIA 1FFWB 1JLFB 1WG4A 2JVRA 3TAMA 1RSCA 5CCMA 2B6AB 4OV6A 4DX6A 1WDTA 3KLHA 3VAJA 3POTA 4C8KA 1VQYA 2RRBA 4CYUB 3ZZOA 2YWKA 3N5FA 4Y6IA 3CCVS 4PABA 2L9NA 4JYAF 1C1CA 1TL5A 1VHIA 1HQ2A 1FX4A 4U9RA 2MGZB 3J7YI 3DRYA 4ZPTR 1H73A 1CJKB 3EGWB 1M0SA 4HHUA 2IAJB 1NJIT 1IQZA 1NHUA 3OFHA 2QFIA 2UXBF 4ZN1A 2G2OA 2HHHF 1NDPA 1VR6A 1APSA 4HVZA 1S9EB 1WELA 2AU0A 1VBZA 1N5VA 1U02A 2ZBIA 3KLFA 1HBMB 1QUVA 2HNYB 3FZBA 4FKXA 4P10A 1H98A 1D09B 3DI6A 1Q78A 2IAJA 5KFTA 1R0BG 4AXJA 2DHGA 2E9TA 2F63A 4JI0F 3OLBA 2VPYB 4CH7A 1SV5A 3ILLA 1F2GA 1RHJB 1JLQA 4UOHA 1FHTA 1RWWB 2I38A 5CZVA 2LEPA 3EXYA 1Y3JA 3I31A 3TP2A 3OUYA 4Y3CA 9ATCB 4NCBA 3I0RA 1CLFA 2V6AA 5D3GB 4B3RF 4YB5A 2IA0A 1RT2B 2LQBA 3ZFVA 2MZJA 2HRTA 3CD5A 5J2NA 4B9TA 1MSWD 4WJBA 5ETPA 1Q7YT 1TMJA 4RZRA 1VC0A 2AGOA 2APOA 1FJEB 2DNPA 3B4MA 3S01A 1MU2B 3M9NB 4QJVA 3CJ4A 4J9KA 2RDJA 3EZUA 4NMXA 1T9TA 2HNDB 5I3UA 1QAIA 2K3KA 3M6XA 5KFFA 2BZ2A 1XJWB 1TVRA 2BM0A 2HNZA 2XGQA 4K0KJ 2NZCA 2MXYA 4LF7J 4N76A 3M05A 2B5JA 2OPSB 1CS4B 2RKIB 4I7FA 4F3OA 2ZEJA 3HD2A 1H72C 3RAMA 2QL5B 4CT9A 1Y5IB 3J81Y 2GQQA 2EW9A 4XDDA 2XCAA 1OY8A 4YDXA 2GHWA 3CC7S 2IRUA 1T8EA 2P5VA 1WHXA 3ZZPA 2D69A 4L74A 1SJQA 3Q8QB 2MDAA 2J76E 4J9NA 1NUEA 4F2SA 1IKVB 2Q66A 1K0TA 1QY7A 4QU7A 2XSJB 1MN7A 2FHJA 3A3NB 1U1PA 4ILMA 1HQEA 1RWNB 4UT4A 4R8UA 4N8NA 2W2PP 4J91A 4U6PA 1F9EB 1GMWA 4ZCMA 1Z4UA 3J80U 3TRGA 1HW8A 1J5OA 1S9FA 4LF9F 3AJDA 3IS9A 3G4SS 2VOPA 5IOLA 3CMQA 3BB5A 5BJRA 3PIPQ 2F65A 2B9WA 4H4OA 1JKHB 1WDDA 1U0HA 3M8QB 2VQEJ 4TLQA 1N33J 1YDLA 4S0MA 3B8HA 1D9AA 4Q7AA 3MTKA 5DJBA 3IWXA 4ZPVR 2QA4G 1JNZB 2YKAA 4B3SJ 5J2PB 2FVRA 1VRTA 2XZTB 4P74A 1DRZA 5H9FK 3QGPA 3RZAA 1AB8A 4O44A 2RRAA 1YZ6A 2IBOA 1MROA 4DOZA 2W2QP 1RT5B 3ENAA 3LO3A 2DIUA 2WTFA 3CEDA 1JLCA 3G6VA 3R2DJ 3NS5A 1EETA 3RUBL 4R5PA 2FGCA 4F02A 4G1PA 2HHQA 2IJFA 3I55S 3KXDA 3R7BB 2MQQA 1PBAA 3AFGA 3UPFA 3H40A 2E7VA 1RBAA 2MZTA 5DETA 2VKRA 3MURP 4ED2A 3VR1A 2JEGA 4TKTA 1B0PA 2FDNA 4ZVOB 1U2RA 2HHVA 1XMBA 4AL5A 4Y2IA 3K5OA 4PWDB 4C0OC 4K4TA 5DM6Q 3P5TL 2ASYA 4BS2A 5EDWA 4F2RA 4RBTA 1R7IA 3GSIA 2PIIA 3H8YA 3MMBB 4ZPWR 4LFCJ 1KVIA 2HFZA 2E1AA 4I6AA 5E5NA 2WK4A 3OT9A 2VA3A 3PO4A 2CVEA 3HULA 2BJ7A 2QYGA 2AIRB 2E66A 1HFEL 2RJZA 3BF4A 3OL8A 3KLGA 3HM9A 2HIYA 3OJSA 1N5TA 2HFOA 2FJEB 3BH7B 4USHA 5IT4A 4IG0B 2CQBA 1JMTA 4K4XA 2K3IA 1ZM2A 2ZE2B 1GNKA 3I0RB 2HHPA 1VGYA 1T11A 4I2PA 2J6SA 3GG0A 1PJ6A 4DU8A 1Y10A 2Y0BB 4QPXA 3CCRS 2VH7A 4Y34A 4AQYJ 2XY7A 1RWKB 4WE1B 1EKRA 1NLKL 4HI2A 1RYSA 2DH7A 2CPIA 2CQGA 4XDCA 3THVA 3CB4A 2UUAJ 1RGVA 3P6YC 1S1VA 3I5CA 3M6WA 3DDNA 2CVIA 3T9NA 4OI6A 1YJTA 3THPA 4WFNQ 1M5SA 5I42A 2VONA 3CXCR 3BN4A 2EWHA 2C2MB 3WIUA 3CCES 3TVZA 3CUNA 3HHDA 2O67A 1UVLA 4L3KA 4DR2F 4ECYA 2V50A 3IGVA 1FRJA 1KQFB 2DYAA 3MCMA 3HMJG 2N7CA 1S0OA 3DCAA 4F0HA 2YKOA 4KHRA 1NZAA 4JI2F 4EZ6A 1NM2A 2J5AA 4GVBA 5F3TA 4KJIA 2Y3YA 3C6UA 4CLUA 3KK3B 1UEUA 1HNWJ 1EP4B 1NO8A 2KO1A 1NB2A 5FIIA 4EUVA 2RQCA 2JLGA 2FB0A 3HVTA 3MPWA 1UJ5A 1CSJA 4DUZF 2R8GA 4DSEA 4ED0A 2EEYA 3IM9A 5LM7E 2HWIA 3GCXP 3VAIA 1FCAA 3SI8A 1O5JA 4LIWA 5L9XA 4JI8J 1CJVB 5AXKA 5IWAJ 3N6MA 4NEZA 2VD3A 1CJUA 3SFUA 3GV8B 4DN0A 4YB6A 2KTQA 3E51A 3KK3A 4B9UA 2VG7B 5DO2A 1IR0A 3ZNUA 4OL8A 5KT7A 1FTCA 4JB8B 5K8PA 4NA3A 1XC9A 2Z58B 1AA1B 2HFUA 2GW8A 2OAUA 4USKA 1S6PB 5HQLA 2W7PA 4AL6A 3DRRB 2DNRA 3D9BA 4J5OA 2ROPA 3P3DA 1EHWA 4USMA 1R8CA 1BHNA 2ZBPA 3GIJA 1EETB 1HHQA 3HHKA 1HWLA 3RU0A 3CCTA 3DHWC 2ROGA 1WHWA 3ET6A 3IRXB 2D9PA 1U45A 1VQMS 1P9YA 3N0VA 3LGNA 4AUKA 1T9XA 1WUUA 1NHKL 3I5AA 4C0HA 4LFAJ 4GKKJ 3MM5A 3BQ2A 2EPIA 5KG4A 3HT3A 2XI2A 3BSCA 4UOCA 3H5YA 3JYTB 1PILA 3NWGA 2DKOB 2LDIA 1HI0P 4G1QA 3FUYA 1TL7B 2AX0A 4ECXA 3HVAA 5BYQA 2FHJD 2UUTA 4QQBA 1PKUA 2KYZA 1RT1B 3CJTA 1KD1T 3UI3A 2HWTA 2EFQA 1XN9A 2QV6A 1PJ5A 2RVJA 2W2MP 1ULRA 3D6MB 5L1JA 3TI0A 1V5VA 2DK2A 2DNQA 3OR2A 2BW7A 3E2EA 2Q3PA 1V9OA 4F0KA 1KNZA 4UZCA 4R0EA 2LEAA 3H0PA 3MM6B 1YZ7A 4O3RA 4TU9A 3EZ5A 4GC6A 1J5EJ 2UVUA 2QMUB 3G82B 2XGPA 3E8OA 4J9QA 3JQJA 4ZCLA 3KMQA 1RHMB 2GQ2A 1UZDA 2DY9A 2EI5A 1SUQA 4TY9A 3T6JA 3TX8A 4PG8A 3DMJB 3KWMA 2NQPA 3FMWA 2HW3A 2D3UA 4ZPDA 2FD2A 3IBFB 2GA7A 2IJNA 3UNYA 5KFPA 3BGOP 4KYZA 4YY3J 1UTAA 1HD1A 1EP4A 1DLOB 1RCOB 3KUEA 1I51B 3D67A 3MEEB 1KVKA 4MKYA 3TUPA 1NU4A 2AP6A 2QRRA 3TW0A 1XR5A 1TKZA 5LJ3Y 4KGXB 1HKAA 2KVQE 3M30A 4ES3A 4M5MA 2R7WA 2CZ4A 3Q0AA 2WSFC 4ANCA 3L4BC 3CDBA 2AD9A 4WFXA 2FVCA 4J90A 1TK8A 2B43A 2YTCA 1J5EF 2R4FA 5DDPC 5H1SV 2B9EA 1M90T 4ZP6A 2HFVA 2I1RA 3LQVA 3DYAB 4GKJJ 1G4CA 4DPTA 2RHQB 3DU6A 3TZXA 1WOOA 3GYXB 4LRDA 3I0SA 4J9SA 3GSDA 4H4MA 3NAHA 3AD9C 3V6DB 2Y8YA 1Q8BA 3NMRA 2PMHA 4OLOA 4HTIA 4O23A 3DI6B 3DC2A 4JI4F 2CJYB 3MM9A 4EGLA 2OD6A 1JKHA 3M8QA 4EFAC 2W8LA 2AQ4A 4PG6A 1SV5B 2F9JA 3T5LA 3PO5A 4JV5J 2WVFA 3BKFA 2BVZA 2KRRA 3OVSA 1U1OA 4DXLA 3HSJA 3O5TB 5A0YB 2V67A 1U1LA 4RW8A 3ONQA 3P8BB 4LF4J 1NJZA 4X4NA 2BJEA 4KHMA 1NAQA 1RBLA 2BE2A 2HLUA 4Y2CA 1C4CA 1HMVB 2PT0A 1KDNA 2EFNA 1BQMA 2I6WA 3I82A 3GR0A 4FN5A 3AHPA 2E5HA 2HGMA 3IMQJ 4ZVRB 4BWMA 3QGHA 4QBUA 1NKCA 1SC4B 2SXLA 1NPRA 2HNYA 1RT4A 2ZWPA 4J9PA 2YH1A 4AE5A
chains in the Genus database with same CATH topology
4RKUC 3UD3P 3W2VB 2RB7A 1RTJB 2VV5A 3SDEA 1FRXA 2GIRA 4PXEA 3OW2R 4DS5A 2OFGX 1URRA 3DM2A 1ZPWX 5F9NA 4QIEA 4FF2A 1CEZA 3ZZZA 2DNMA 2O3DA 4KGMA 2YWEA 3V6HA 3AB4B 3V6JA 2GGPB 2ZOGA 2BJDA 4ETZA 5A8WA 2CDQA 1Q82T 5J2MA 2RD5C 5CD4H 3HHLA 4QOTA 2EKYA 1IBLF 1IJFB 1TFWA 4FYDA 2XY6A 3HHNB 3VTIA 1U8SA 3MR3A 4ZPCA 3IO1A 4A8MP 3G6YA 4F4YA 1NK5A 1PO6A 3KOAA 3OHAA 2IYIA 2XMKA 1KTVA 3Q8PB 1GH8A 4I7FB 3H2VE 5KG3A 4NRUA 2UV8A 3MM6A 1BY9A 4M1KA 5KFWA 3MHYA 2PA8D 2N4DA 5E3RA 1ZBTA 2WBMA 5AXNA 4O44B 6FDRA 1KTQA 1SUQB 1YJVA 1VQNS 4DMZA 4C8MA 5B0DA 2B7BB 5I42B 1J2VA 1A9NB 3GFHA 4F4WA 1LWCB 4FF1A 2R2SA 2FHMA 1G3OA 2I8EA 4M5DB 1QSLA 2BV3A 2VPZB 4ZHRA 4TQSA 1N5YB 4LFBF 2IC3B 3IC1A 3SMZA 2VQEF 2KFYA 2DNNA 4DL3A 2FJBB 3M30B 1TZ0A 2WHOA 4G3IA 1ELOA 3K57A 4DV2F 2V0NA 2HHTA 4F25A 3LGMA 3BSNA 4RW8B 1N34F 3QIPB 1NB7A 1Y4ZB 4DPOA 5LMNF 4NZ7A 3AH6A 2RUGA 1FEHA 4KAIA 2C3MA 3OQ2A 1HWIA 1DBDA 4NL5A 5D4NA 4A47A 1NHVA 3UE2A 2C3OA 5E2QA 5HO4A 1IKXB 2WB1D 4ZLPA 4N8OA 4DSFA 1PC4A 5E33A 2XCPA 2X1GA 5AE3A 1Q79A 2UZAA 4IUFA 2MKSA 1T3NA 3CWJA 3TA1A 1WF2A 2CQ4A 2EFOA 3AB2B 3IXQA 1XMOF 1U47A 1AFJA 3TAQA 3VWSA 2R7RA 2FHKA 4IYQA 3TANA 2E1MC 1CQNA 2D3OR 3QGIA 2IVMA 5A2QY 2J0WA 3ITHB 4G6VB 2DR7A 1S0VA 2BE2B 2YY3A 1X4AA 4TU8A 3M6UA 3QLHB 1QE1B 4CI0B 3HKWA 1NJYA 2DVIA 1KFSA 2M5YA 4X4OA 1IM4A 1SL0A 1UFLA 1HPZA 4IKAA 3GE9A 1PSDA 4QWEA 1DARA 4CO4A 3NNCA 3T5KA 4EO6A 4DR3F 1YRTA 5KFMA 5M2UA 1N6QA 1HQUB 4TU7A 1FXLA 3CPWR 1MWZA 1SH2A 2HS4A 4JV5F 2VC0A 2XMTA 4FNIA 2ILYA 1NJXA 2VBXA 4C3KA 1XNRF 2A18A 3BN7A 4RU2A 3MOZA 4KQZA 4ZVEA 4OIXA 3TAMB 2O01C 3T5HA 3QJLA 2HNDA 3U7JA 3X3UA 2CPDA 3MMAA 3KNGA 2FC9A 2VUGA 3NAIA 4E8UA 1FXRA 4PXCA 5D4LA 1HQUA 3UR3C 2M7SA 3HP6A 3OVBA 3I9V9 2BANB 5SUHA 2J6UA 1BQNA 1JLBB 1VQSA 3SFGA 4F4KA 2ZITA 3OXGA 2R8HA 5HROA 1S76D 3N6NA 1N5SA 4A8FA 2YNIA 2ZVSA 1SJ1A 2BABA 1NK7A 1HNXF 2VPWB 2UXDF 3CIMA 5KT5A 1W25A 2OD4A 4FVCA 2BACA 1KHVA 1SL1A 5F8NA 3PR4A 2B4UA 3HVRA 1ZTTA 3M2RA 3QZ7A 4URQU 1R8PA 3QJJA 1OPZA 2AGPA 1S1WB 2B56A 4Q5VA 2BBEA 2IM0A 3C6UB 1NKEA 1QUPA 1R0AA 4M5DA 2NR0A 1YG0A 2XS7A 2QYCA 5JXSA 1VS3A 2ZKUA 4A4JA 2LKZA 2DR5A 2W4CA 5IS2A 4IOAQ 2V8DA 1TKTA 2DNYA 1RT5A 2ZH2A 4DL4A 5KTQA 3HXMA 3QLHA 4DR1F 2C2RA 3VQTA 3KYLA 4YQWA 1S77D 3M32A 3LALA 2MY7A 4NX9A 4YR2A 3CIZA 1KC8T 3LP2B 4JI6F 4X4SA 3G96A 5KFRA 4TYAA 4EBEA 1H0HB 3M9OB 1FK9A 1ZPVA 4QIWD 3DLGA 2BOPA 4NRTA 2N3LA 4OZLA 5JVHQ 3CCLS 4QWAA 3D28A 1L3VA 2OSRA 3MMBA 4TY8A 4N5SA 1FJGF 4B9NA 4N41A 3CJKB 2HVHA 3LAKA 3QWUA 3ICLA 4HHJA 4RUCA 2VG6B 5AJ3F 2AYGA 1FRHA 2DGUA 1NK4A 3M2VB 5C25B 2VOOA 1IKWB 3MF5A 4DR7F 2J6TA 2KG1A 1CG2A 3H59A 3GIIA 2XG8A 4DLEA 5I3QA 4MTPA 4J9LA 4RWXA 1A6LA 2OFHX 4B9SA 2CPZA 3X1LB 3ZZRA 3P49B 3FSXA 1RISA 2BUNA 2WW8A 1VMBA 1NH8A 3L95X 3K8VA 2MZ1A 1HL6A 1KRPA 2Q6CA 1HHSA 4I0WA 4I69A 4RW6B 2CPHA 5A8KB 2Y1JA 2DISA 4IRKA 1HNWF 2RS8A 3ISZA 1SJFA 3I0SB 3PNIA 1VIOA 4Y28C 4NLDA 1S1WA 2Z2LA 4QCLA 3KK2B 4W90B 1JXEA 1BQNB 4TYBA 4YP3A 3CCMS 3K5NA 2ADBA 3UNGC 1VQ6S 2IBKA 3JSYA 4WZQA 4JV2A 4M94A 2CQIA 1JWWA 2QA2A 3MXHP 4K4YA 3DDKA 4NWBA 3BGRA 2JHEA 2WONB 3ISND 2I2YA 1FE4A 4TLRA 1DAXA 2VQFF 5D78A 1HI1A 3LANA 4O4GB 1JLCB 1FT8A 1U49A 2M4MA 3Q24A 1Q7LB 3RAQA 1XWLA 4ZCIA 5KFNA 4OZJA 3W2VA 3S8SA 3MGJA 2LU2A 2CQ2A 1Y0HA 4NLUA 5KG2A 3CJ5A 3FQKA 3AA8A 3HF5A 4DL7A 5B0FA 1OQ6A 2FGOA 4NZ6A 4DSLA 1Y9OA 1HBMA 3MEDA 1FD2A 4MIAA 3I9ZA 3M8SA 3T5LA 3NGKA 2IMWP 4NYPA 2UUAF 2XS5A 2CPXA 2OSQA 1HMVA 4WFAQ 3N79A 4EU0A 1LWEA 5J1NA 3PX4A 3DOMA 5CYJA 2ILZA 4C8NA 1ZETA 3BS9A 2EFPA 1HNVB 5CCLA 5LSRA 3BQ0A 2UVWA 3GWCA 2KZZA 1VIXA 5F0UA 1GQEA 2JEJA 4RW4A 2VFSA 2LVWA 1OQ3A 2LXIA 1KQKA 2GJIA 2W24A 4WYLA 2BW2A 2QZ8A 2ZE2A 3G8SA 3NCPA 2DGXA 1D3WA 2BYCA 3OL6A 5L1LA 1DQ8A 2VFVA 4DR5F 4XO0A 4EYIB 4OZ0A 3N28A 3TO8A 4P7TA 1XK8A 1YITS 2R7VA 3R5DA 3DN9A 3MUVP 4PG4A 4ALZA 1X9MA 1VQLS 2Z2MA 3DOKB 2VL1A 4Q0BA 3R5BA 4LSLA 4OLPA 1WACA 2Q43A 1TFYA 1N52B 2GCFA 1LQ9A 3Q8RB 1T03A 1U1MA 5BYRA 2DO4A 2FIUA 1IKVA 3RB0A 3BREA 4X2BA 4I6YA 2DNGA 3SYZA 2ZNYA 3KLIA 3R1LA 1QLNA 3UDCA 3OVAA 1SJRA 2OMOA 1TL1B 3DHXA 1Q4RA 3DRRA 1HARA 2IRYA 3CDUA 2YKPA 4H4OB 3FRZA 2NUHA 4KE5A 1VBYA 3V2UC 4BCAA 2XLIA 1URNA 1IXKA 2PSZA 2GHPA 2IYGA 4LF5F 1DTTB 1VRTB 2R7QA 3KG4A 1C1BA 4CO0A 1NJWA 3FSYA 1VQ5S 3PJXA 1CC7A 3V6DA 1QAXA 4GO5X 4BC9A 4FXVA 3M9MB 4MIBA 4ZA1A 4X64F 3BGRB 1K9MT 3PW0A 2IMOA 2W9AA 4QWDA 4QW8A 4GO7X 4Z2XA 1QTMA 2YNFA 1R27B 4RW9B 3PXGa 3C8YA 3TVYA 3MAHA 2AYBA 2AW0A 1UVIA 1M5PC 3CD6S 1K1QA 1U6ZA 2XNQA 4WCEQ 2CG4A 3JYTA 4C3LA 3OUYB 1DQ9A 1KOOA 4X65F 3C6TB 1HWUA 5B0CA 4J9OA 1YTYA 3HVWA 3NRBA 3V4IB 2VODA 5J1PA 4F4ZA 1FDBA 4LVOP 2HZCA 1K73T 5LXYA 1IBMF 2OPRA 4PQUB 2PGCA 3K7RA 1H2TZ 1H7XA 3CULA 3H4BA 4B3OA 2FJXA 2MJUA 4B3MF 1SH0A 4DR4F 3DLGB 1M1KT 1RQ0A 3GILA 4WZMA 4F67A 1N56A 3NKYA 1RDRA 4IRDA 4OFZA 1FNXH 3OJUA 3NLCA 2Y1IA 4DG1A 1JX4A 1WEXA 4WE1A 2E5JA 2OPQB 4B02A 1VLYA 5HLFB 3KHRA 3IWNC 2F9DA 2PMZD 1MMLA 4CQ1A 5GVQA 3U27A 5A6WA 1TK5A 4TN2A 4MYTA 4LQ3A 2LXUA 1DQAA 5CZXA 2ZH8A 2RQMA 4C9DA 4FXWA 4ID5B 1AUDA 2ZFHA 5KAKA 1S6QB 3LUYA 3KMSA 4YB1P 2E5LF 4OQJA 1SC6A 2DHXA 5K14A 2ZJQQ 1VQKS 5LT5A 4H4KC 5A0YA 3GYNA 4LFCF 1TL3B 1BWEA 2JWNA 2N4CA 2C3PA 2WSEC 5L1IA 4DFKA 3V5RA 2XLKA 3CJ3A 4V19X 2F40A 3UCZP 5KG6A 3GR1A 5E3AA 2MZSA 4BHQA 3EX7B 2KJWA 3DOLA 2DNKA 2NSCA 1U6BA 3KLEA 2B4OA 3KK1A 3E01A 3W7BA 3R27A 1S4FA 3DRSA 3SCLE 1YQHA 3R5AA 2ZH9A 2E7WA 2X1BA 1SIZA 2R7UA 1S7HA 1B0VA 4PXDA 4NMLA 4B3OB 5J2QB 1M5KC 2FLNA 3OBIA 1LFWA 2V8VA 1X4GA 4OJGA 2MQPA 3SZ2A 1R3NA 5HP1A 4JI3F 1GT8A 1S1TB 2O5DA 1C0UA 1RT7A 3HDSA 3K2YA 4B3SF 5EWFA 3BZQA 3LOUA 4IG0A 1FRLA 3JYTB 2HRYA 2LMIA 3EGNA 4USJC 4AFFA 2RE1A 4LUBA 4ECQA 4HH0A 1S0MA 4KPYA 2J9DE 3MD3A 2G13A 2HS0A 4C4WA 4OI1A 3SV4A 4I4BA 1S9GB 4BDPA 1Q8LA 1FDAA 2QMWA 2CQHA 4NYOA 1C0UB 2QO3A 2XWYA 3BSAA 4TNOA 7FDRA 1VHFA 2KG0A 5KFSA 2M52A 3QYYA 4MKBA 2KXNB 3O6QA 3FFIA 2Z0GA 3IG1A 4OX6A 2Z8QA 4C8LA 1SB6A 2MQNA 3MTJA 5DQHA 2DGQA 4DG1B 5DG8A 4DQQA 1AROP 3D54A 4I64A 3D1OA 5E0OA 5T7LB 3DRXA 1ZM3A 2WONA 2D74B 5KFJA 3B4DA 5KFDA 2DNHA 5KT2A 3JTPA 3BO3A 5BYSA 7FD1A 5LL6d 3TAPA 2GFFA 2JC1A 1XBWA 2YWFA 3KLFB 2YVSA 1SL2A 1LXNA 1QSSA 4LF8F 4RW7B 1ZAVA 3W2WA 5LXRA 4I56A 3WBZA 2DHAA 5B08A 3KK2A 2IM2A 3T19A 1OWXA 2F3JA 2PD1A 5DQGA 1U1QA 1UVNA 3W3SA 3ZZUA 2O1PA 4DV1F 2J7KA 2LXFA 1N5QA 1U1RA 3N5BA 1GAOA 1V3SA 5KFEA 3FEZA 2J7WA 4UQGA 2Q79A 3DU5A 1VQ4S 1M5HA 3H4DA 1LWEB 3NNAA 1FJCA 1BQXA 1OPIA 2HFNA 2CQDA 1K1SA 3A8EA 3H2LA 5GAGU 3MM8A 4PKDB 2DO0A 5DQIA 4RU9A 1TAQA 2FVPA 3V81B 4MJKA 1MWYA 3T3FA 2CQ1A 2QSFA 4QPTA 2W25A 2ASLA 2G9OA 2AJ4A 3VAKA 1YJUA 3G8QA 3MD1A 5EX3A 2ZJPQ 3ISNC 4BWJA 3G6XA 1RT2A 2BQ3A 1FKPB 1I6JA 3UD4P 4KKOB 1MU2A 1HQEB 2E1RA 3RBDA 1UJ4A 4KTQA 4CCHA 2OH2A 2D3ZA 4PG7A 5DM7Q 2DGOA 4NCAA 5M2PA 1WTBA 2CKWA 3U1LA 1ZZFA 3RR8A 3TOQA 3O8WA 2GMLA 4CNZA 3IR5B 4NLGA 2XO7A 4LQ9A 2KB2A 1GXUA 4WU3A 4CO5A 5A8WB 1X7VA 3M2UA 3S1TA 5I3PA 4ZP7A 2V8HA 4OI4A 2DNLA 2E7XA 1NK0A 3BJYA 4EZ9A 2COLA 1YI2S 1FNMA 2ZC4A 4LT6A 5GADU 4YHHF 1TKXB 1HWKA 3NGDA 4C98A 1ROFA 1FERA 3WC2A 2DJWA 2MHEA 4LSLB 2FJWA 4RW6A 5DG9A 4B17A 1RWUA 1L5UA 2ROEA 4PWUA 4LFAF 1JLFA 1L3KA 2E5GA 5CHCB 2GJ2A 1S49A 3RW7A 5IFMA 3KLHB 5ADZA 5KFZA 1SXLA 3RB4A 3MMCB 1GXLA 1LW0A 1O0PA 1UAWA 3KLIB 4MMOA 1BC6A 3LAMA 3MEGA 4OJHA 5DDRC 1D8YA 2RQKA 1T7PA 1RP5A 3HI9A 1H3DA 4DSJA 2FVSA 2OKQA 2L08A 3V81A 1DZ5A 3OL7A 1S10A 3QIPA 3MZIA 3RRHA 1ZZNA 2ZJRQ 2XEXA 2W9BB 2WAQD 3K59A 1SQEA 2LEBA 1U1KA 4OJ3A 3JTOA 1JLEA 1REVB 2G4BA 1M5VC 1KLMA 1UP1A 1UA1A 4X4QA 2XLJA 2R8IA 3O3LA 4ECZA 3CMES 1JJ4A 2KH9A 3UR0A 1DTQB 2CPYA 5F8JA 5EHHA 2B4PA 5KFAA 2KVIA 2YNGA 4C8ZA 4HI1A 3E01B 4IQMA 3MM8B 4OMFG 2XMMA 1N54B 2DD8S 3TYTA 1ZOTA 4OHVA 5EN1A 3HO1A 1Q16B 1Y5NB 3PZPA 4WXWA 2QEXS 3LWLA 1XNQF 3CC4S 2D1CA 1U2FA 1X5PA 2DTJA 2HAIA 2LQ5A 2PA3A 4QIFA 1DURA 3H25A 2MHNA 3MM7B 1X4BA 4JOUA 2MSTA 3BR9A 4DR6F 2R8KA 5IZHA 4Z37A 3CDEA 4B9MA 2E9RX 2EBEA 4Q2LA 3CDWA 4ZPBA 4ECVA 1HNVA 1U1NA 2R7OA 5I3UB 1F0XA 1FKOB 3JAMY 4RBUA 4OX7A 2E5IA 2CQPA 2MQLA 3N9UC 4YY3F 1Q86T 2OPSA 4A8QA 4V19J 3CD0A 2RQ4A 2VFUA 2J9CA 1JNRB 3KG1A 1S6QA 1S1VB 4JV0A 3PW2A 1KQSR 3PDNA 2A2DA 5C5JA 3D5MA 4NCGB 1P1TA 2W9CA 2B9YA 4RNNA 2PI4A 5GADI 5EWGA 4Q2MA 3ENQA 3M6VA 4WFBQ 1FDDA 3C66A 3IR6B 2GQCA 4N47A 1TL3A 2G1DA 1D8ZA 1ZAXA 4DFPA 4IR9A 4A8KA 4FNHA 5BR8F 4PR6A 3FFIB 2DB1A 2YNIB 3CJ0A 3PIOQ 5KFLA 2AX1A 5HL7Q 3FRYA 3M1VA 5IXUA 5E41A 5L1KA 2R8JA 2HS3A 2IC3A 2YH0A 1R8AA 3LF0A 1F9FA 2QE5A 4PQAA 3VAHA 3IAS9 2LYVA 1YJWS 3MOJB 3AY0A 1HBOA 4RUHA 5A6PA 2HVIA 1VRUB 1X9WA 2UVRA 3JSRA 3VZHA 5F0WA 4C97A 1Y00A 2QA1A 4DV0F 1FXDA 4F50A 4DQSA 1HR0F 3D1QA 4ELUA 1U25A 2KXHA 3TNVA 3AA9A 4J37A 2K1RB 2XHWA 2AWZA 2RU9A 4K5RA 2QT7A 3AJ1A 4Y0FA 3QMQA 4R25A 2ZHBA <