5IT9Y

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5it9Y00
3J7A1 5IT9Y 5LL6d 3JAMY 5FLXY 3J80Y 5A2QY 3J81Y
chains in the Genus database with same CATH superfamily
2IYGA 1F9EB 1TR0A 3LWLA 2YQ3A 4TYAA 1AZSA 5DGAA 4NXNJ 5J2PB 2F4FA 3HZEA 1X0FA 3P96A 1PYOB 5DM7Q 1ZM2A 4CTAA 4XPEA 3AXMA 1CJKB 2EG1A 2HNZB 2VBYA 2XM3A 1BUXA 2LU1A 3PHTA 2JLGA 3P4UB 3RG6A 3DU5A 3TEHB 1JKHA 1RYRA 2B8PA 2I5JB 5IS2A 5C5JA 4RW4A 2XZTB 3UN2A 2ZHOA 3DXSX 4USKA 1IBKF 5KFFA 4J9OA 3BH6B 3NEKA 4QCLA 2PI5A 4NXMJ 3LUYA 5FIIA 1M5VC 4Y34A 4Z2XA 2V6AA 3HHLD 3T9ZA 4EMDA 3KHHA 2HBRB 4AFFA 2Z2LA 5SUHA 3GSDA 3W7BA 5HMXA 4G3IA 2Y0SD 4B08A 4H4MA 3CO9A 1WI8A 2CPYA 2HQFA 1REVB 4F3MA 3RB3A 1VQ4S 3R5BA 4HLBA 2EVZA 2CKWA 3MAAA 2NXNA 4ZCLA 1JLBB 1SH0A 2YNIA 4WP9A 4M5NA 1M0SA 4A8OA 3PY8A 4NASA 4DV6J 2E1RA 2LXFA 4HTIA 3K59A 4LFCJ 1M5OC 3DLBA 2OFHX 1RT5B 4F26A 2HAFA 2VC0A 1CLFA 2PD1A 1K0VA 2ROEA 5KFAA 5CD4A 5GAEU 3IS9A 3HI9A 1VK8A 4YR2A 5D4PA 1IBLJ 4C8MA 4ZDNA 2ZKTA 1U1QA 3OTOF 1D8ZA 4TYBA 2WZ1A 3QSIA 1C1BB 2ACYA 1FEHA 4AT1B 4EYIB 1YVFA 1NKBA 1T9UA 3Q8YA 5DG9A 2VUGA 2DXEA 1RDRA 1HWIA 1VGYA 5M2UA 3NNAA 4JOUA 1T94A 2M8DB 3V5RA 3WHIA 2CDQA 2R7QA 2HZCA 4JYAJ 2P9EA 2IRUA 1TUVA 2K3IA 2OPRA 3CJ5A 5I3QA 5HAOA 5HQMA 4PYAA 2XNRA 2M5YA 2GIRA 2BANA 4Q0BA 2CJXB 2Y9HA 1Y11A 4XAKA 2E1MC 2CQDA 4A8MP 1UJ4A 3M05A 2W9BB 1CC7A 3ET6A 3KLGB 4ZJLA 1RU1A 2E1AA 2B9WA 3H42A 4F3QA 2J9DA 2PN6A 1UFWA 5SZTA 5KFCA 1VK3A 2DO4A 2BQUA 3PX6A 2VPYB 4PXDA 2HZVA 4I7FA 4I2QB 1FRKA 1L3TA 4QW8A 3D54A 5IC4B 1M5PC 2OMOA 4P7VA 3MM5B 4RNMA 5F0WA 3VR1A 3MEKA 4CLTA 1KONA 3UDLA 4C9DA 3MM9A 2RMLA 3F41A 3C16A 4ED7A 1IM4A 5BYSA 5L9NA 3ZTOA 5H1SV 2K7KA 1N5TA 2RDJA 5DETA 4NLDA 3W9JA 2BM1A 4OYBA 4KAIA 2CPEA 1IM6A 3S6EA 4NLOA 4ED1A 4ECTA 4WTOB 1TL3A 2IRYA 1Y5NB 3D0IE 3VQSA 1NXIA 1VCTA 1IXKA 2IFXA 5AT1B 5IXUA 2R2SA 2AWZA 4URGA 1RT1B 1S6QA 3GFYA 4Y65A 2MKIA 3JSYA 3AJDA 4OX9J 3M8WA 3MPYA 2JEGA 3NBPB 1J27A 2DNRA 2DISA 3GCWP 3K58A 3Q22A 1LWCA 2KKHA 1WKLA 4LFBJ 3R2DJ 3RGIA 4Q45A 3NCQA 3QT7A 1TMJA 2HW3A 4UOHA 4EZ6A 1ZTWA 1LWXA 1HNWJ 4OHVA 3RU0A 4N56A 2C3OA 4YUDA 3KJVB 4CO0A 4ICLA 3TVKA 4GC6A 2BJEA 4I6AA 4DCOB 5FD1A 3OJSA 2VA2A 4PWWA 3PV8A 1HQEB 3QWUA 5EDWA 4WK3A 4CI0B 1GQEA 3PRVA 4X4TA 2IMWP 1SV5A 4LJMA 5J1EA 4CRJA 4QR2A 3CWJA 2IDLA 2GVDA 4UW2A 3O6QA 1X0PA 4TU7A 5IT9Y 1YQHA 3EGVA 1IKXA 5DDQC 4JI8F 4ATNA 2NREA 1R6YA 2IRXA 2ZUAA 1AUDA 3MURP 4NEYA 5L1KA 2W1BA 3SDEB 1JB0C 1N6QB 2FJWA 2R7RA 2IAJB 1S0MA 1Y7PA 2GVZA 4CYUA 3TJ8A 1TL7A 2A1BA 4OJGA 4NCGB 1S49A 4K4YA 2V69A 5E33A 4LFAF 3C6UA 4BWMA 5J2MB 4LRAA 4MYTA 3CIMA 3H98A 3ENWA 1TUWA 3KLHB 1CJUB 3TOQA 1TMMA 4IKAA 5A8RA 2SXLA 1X9SA 1TAQA 3TAQA 3FSYA 2R8KA 3MZIA 4DFKA 3PEJA 2A10A 3NL0A 4A48A 4ZOSA 1RZMA 1Z2ZA 4WU2A 3OTEA 2ZBCA 3X3UA 1SH2A 2IJFA 1X9MA 3AA8A 1Z1ZA 1S9GB 4WIQA 3ZNUA 3TWZA 4TVAB 2YKMA 1VBZA 2KXNB 1VQKS 1PAUB 2DGTA 2QL9B 3O2IA 4C0OC 3MR7A 5LXYA 3KMSA 2CPJA 2KYZA 4V1Ak 1R7IA 5IV4A 5KAKA 1YG0A 5J2QA 2XWYA 2R2UA 3KG0A 4ZVHA 3C8YA 3IR7B 2RUSA 4HHJA 5LXRA 4DUYF 5FDLB 2BE9B 2L3MA 1B64A 1H6KX 5DQIA 2JVRA 2MGZA 1LQ9A 1TFYA 3VV2B 2FHJD 3IN5A 3NRBA 3NAIA 1RWUA 3J7ZT 4U8VA 2VFUA 3A12A 2ZWOA 3H25A 4IR9A 3CJ0A 4O3OA 2MY8A 2NR0A 1JXLA 3LO3A 1N32J 3K0JA 4I4BA 3K8VA 5DQGA 3ENAA 1VRUB 2CXEA 5IFMA 2RILA 3EM1A 2YNHB 5KG0A 4Q44A 4DQPA 2VHGA 5HLFA 5KG7A 1YBUA 4DR2F 4KR0B 2K2PA 2HIYA 3OL8A 3FBEA 1GXTA 1AYEA 4YHHF 6FD1A 4X84A 1EP4B 2ABYA 2CQCA 2DD8S 4DV5J 1YDLA 5BYQA 3OJUA 2V8PA 2B8QA 3TRGA 4IFYA 1NSKL 2X1AA 1Y3JA 3OFEA 1T03A 2BW7A 2KXHA 1KQGB 1AW0A 2FY1A 2IM1A 1I6JA 4ED8A 4DSJA 1SC1B 1JLCA 2PC6A 2WW8A 2ZVSA 1B0TA 2J6SA 1KEKA 4GVBB 1HWLA 2COLA 5E5NA 4BCAA 5K8NA 3D0HE 1HBNB 2YBVA 2J9DE 3OSNA 2YWFA 2LQJA 3IR6B 1RT3B 3DYAA 2DT9A 3QJPA 4USMA 4USJC 4QIFA 3I6PA 2J6TA 2W7AA 2ZH9A 1S79A 5AE3A 2DPIA 4OZNA 2E5GA 4ED0A 3BM7A 1B7FA 4MYUA 3RW7A 3KHGA 4QYZJ 3FEXB 2FQQB 1I5OB 2HHVA 4A8XA 1U1RA 2DNGA 2J7KA 4R8UA 1DARA 2RU9A 1NJZA 2CPXA 3AB4B 4MFBA 4DMZA 1WJ9A 1WTFA 3MCSA 1BC6A 3CMQA 4FYYB 5LMNF 3N6LA 1FJGF 4DR6J 1SJ3P 2DRAA 5KFKA 4FYDA 4CH1A 4C8YA 4I2PB 1QD1A 1VI7A 1IBCB 1SQFA 1IR1A 4WXOA 1KOHA 2O01C 2UXDJ 3VQTA 3TZXA 4QIEA 1U8SA 3CCJS 3DNCA 1AT1B 4OJHA 4IUFA 2P6TA 2YQ1A 3R6GB 4KQZA 2XGQA 3SFGA 3SQGB 4ES2A 1S4FA 5L38A 2QIFA 2CQPA 3KHRA 4L72B 3ZTQA 3NLCA 3CC7S 3PNIA 1MW7A 3GILA 2HMIB 1QUPA 2UUBF 4QWAA 4V19X 3AODA 1V3RA 2VV5A 1GFWB 4FS2A 3IRXA 4UUWA 1JJ2R 1R8BA 3UO0A 2W4DA 1T8EA 3MOJB 4H54A 1KOOA 1ZBTA 4DSIA 4QIGA 4DR5F 1HR0F 2F5GA 2IMOA 4RBUA 1RWVB 3ETMA 1SUQB 2FD2A 1XNRF 5A76A 2HVEA 4OV6A 4ZK7M 3N28A 3Q8RB 2GHWA 2E7XA 1GTEA 2IVMA 3MEDB 2ZDPA 5C25B 3JTNA 4NRUA 2OTJS 1ZPVA 6FDRA 1T05B 4NCAA 4Q8EA 5LMUF 3I9ZA 5H9EK 4BBYA 4FN5A 2YWGA 2FVRA 1TKDA 3TI0A 2GIQA 4M5JA 2P2CB 1QE1A 1H38A 4FF4A 4CP5A 1QTNB 2D9OA 1LOUA 1IQTA 3ENQA 3ISZA 2EK1A 5B0EA 3DLEB 2AT1B 1NJIT 4FZVA 2HFVA 1J2VA 3W2WB 1CEZA 5LJ3Y 5DZ7A 4CLLA 3HSJA 5F9NA 2RHSB 2DNLA 5I42A 1DTQB 4X2BA 5DGBA 3S7RA 3ULHA 3UD4P 2GMHA 3VCDA 4ILLA 1NHKL 1HBMA 2YX7A 2ZH6A 5B0GA 1Y4ZB 2J9EA 2ZEJA 1REVA 5B0BA 1MROA 4Y3CA 3DRYA 1YWXA 3OXLA 2WONB 1UZHA 2VPZB 2H4YB 1WEXA 5KG6A 2MKCA 2E5JA 1NU4A 2FY8A 4OYXA 3RAMA 3RBXA 3MM8B 3RRGA 4HEA9 4LSNA 4C2MA 2EFOA 5HBMA 5KFPA 1K47A 1RU2A 3Q86A 3MF5A 1RT5A 2D3OR 2IYIA 2G2OA 1JNZB 1B7YB 2AEJA 3W1YC 4OLPA 1MMNA 2ROGA 1F2HA 4N41A 1S1XA 1C1BA 2VBXA 1X4GA 4F2SA 1QM9A 2XY6A 1O0PA 1MN7A 3BGRB 2DGOA 1S1TA 2QLWA 3OFFA 4KHPF 4PAAA 5CQGA 4QYRA 4FKXA 5I3UB 1ZM4A 1X4DA 2HNDB 2JC1A 2KFZA 3ICLA 1RP5A 2HVIA 4L75A 4ZLJA 5AXNA 3UCUP 1N5VA 2W9BA 4EBCA 2AX0A 3HPOA 2DY9A 2E44A 5ETTA 2RH3A 1ZYQA 3HFKA 4K2XA 3QLHB 4IO9Q 1JLGB 2G4BA 3EUNA 4RW9B 4RWWA 5G4DA 2RS8A 2AF6A 1JLAB 4B3RF 2A3JA 3KFWX 3M2VA 1OYDA 2ZITA 3FQKA 1RBOB 1LFWA 3ITHA 1TKZB 2IA6A 3AD7C 4O3QA 3DMJB 4KGMA 3IG1B 4OI6A 3IWNC 4P71A 1CC8A 5KG5A 3JQJA 2IBOA 2NXCA 2VD3A 2UUWA 2BABA 3DM2A 4ES1A 4YDDB 4X4PA 1VQ6S 3AOBA 1SB6A 4DU8A 2CNKB 3ZZYA 3T1AA 1HA1A 1IJFB 4DQRA 4P2XA 2B4VA 4WZQA 3I0SB 4NWBA 4DUZF 4EBDA 4M5MA 4CCHA 1FXLA 2FGOA 1WDTA 3GIMA 3BQ0A 4KKOA 2C42A 4KC5A 5C42B 3QBCA 3A3PB 5THWA 3WC2A 1PBAA 4U7CA 3IC1A 5IQ6A 5IM0A 1RT1A 1KLNA 4NRTA 3A13A 2E7WA 3RZAA 1TL1B 3JYTB 2HHUA 4JV1A 1Q53A 3J81j 3FZ2A 1Q81T 2Z0GA 4QPXA 2M7SA 4QU7A 4RW7B 3NS6A 1U6BA 4RNFA 2MQPA 2VIHA 2DH8A 5IV3A 1LW0B 1ZAWA 3UVJB 1XR6A 3PDNA 1WF2A 3H5YA 1URRA 1X8DA 2CJKA 3IA0A 3N5BA 1GMUA 2FJBB 4DPXA 4E98A 4FF2A 1WSVA 5E3QA 3KMQA 4LIWA 1L3UA 1C0TB 4KFBB 4OYWA 3PYEA 1UFLA 1S6PA 2R8JA 4CLPA 3ELHA 3SEOA 5K8OA 3PO5A 1XN9A 2DO0A 2JLEA 2V4RA 3VHQA 3J7YU 2FJXA 4LF5F 1S97A 4LF6F 2O66A 2FLLA 4RPFA 4KPYA 2PEHA 3HJFA 3AHPA 4I0WA 4KSEB 1RTJB 3BYRA 3VALA 1NAQA 2W2MP 4K4WA 2WTFA 2UVUA 4UQTA 3KLVA 1IWAA 3OXGA 1RT2B 3N79A 3SXLA 2B7BB 3ZTRA 1N0VC 3NGDA 3SDEA 1BXNA 1N6QA 2QV6A 3VAGA 5B0FA 2VQEF 3OW2R 4QPTA 2UVWA 1GTHA 2OEKA 3CCTA 2OPSB 2V8VA 4J9QA 3GYXB 1LW2B 4JI5F 4NCGA 1T7PA 4G1PA 4C0HA 3ISNC 4X4UA 1TVRB 3GYNA 1V3SA 5A2QU 2JZ5A 4QR0A 5T7LA 3CD6S 4DCPB 2J8AA 2UVRA 4F02A 1PG5B 1CJUA 2JEFA 3OBIA 4DXLA 1PILA 3CSKA 2R7TA 1S48A 3M9NB 1IKVB 4LBHA 1FRHA 4W98A 3L95X 3OXFA 1IKYB 2Y0BB 3TP2A 4NA1A 1S9EA 1FKOA 1B4SA 2JX2A 5CZXA 1YRTA 2XMAA 2AYEA 2XY7A 2MKYA 5KFOA 2KDOA 4WK1A 2OH2A 1HPZB 2R8IA 3TQ1A 1PJ6A 3VTIA 2QL5B 3A1YG 2CVIA 1U2RA 3GP9A 2M0GB 2OPPA 3P8BB 4DFJA 5L1LA 3FUYA 3QT6A 3H5SA 3R7BB 2FJEB 4N5SA 1U24A 1FRXA 4I6YA 3HFZB 4KH0B 3GR0A 1UA1A 4YB6A 3OR1A 3VZIA 1WF1A 4JI3J 1UP1A 1S9FA 3DOKA 2DEIA 3KKFA 1WKJA 4IO1A 1M1KT 4OX6A 3FKBA 5IQQA 1L3KA 3PYGA 1KS2A 4QIVA 3GONA 2CADA 2KHDA 1JXVA 4U7UD 2AGOA 1J5OB 3M8PA 1H98A 4HH0A 5HQLA 3ZXWA 3DI6A 1E6VB 2WOMB 2CRLA 5ETNA 2FDNA 5JMNA 4O3PA 3QFWA 2ZBQA 3QT5A 2BE2A 3KJNB 1XEZA 2VG6A 2YWKA 1T11A 1HBOB 2HS3A 4G1QB 3DRSB 3FMBA 1ZTTA 4C3MA 1RTDA 4U95A 1T3NA 4C3LA 1Q8IA 2Y1RI 4KY3A 1N54B 2L08A 3VZHA 3PFEA 1M1GA 1VQ9S 4JI7F 3EGZA 5CYMA 2YNHA 2BOPA 1NDLA 3D7SB 1FTCA 4XDCA 1FKPA 4LF7F 4L74A 1FRIA 2LEPA 2MQMA 2XLIA 3UFCX 2KTQA 2V94A 1QY7A 1NB2A 4FYWB 2XMJA 3M2RB 5EWGA 1H2VZ 3A4TA 1F5AA 3N9UC 1UPMB 1HNIA 4YHHJ 1L3SA 2JSXA 4ECWA 5LSOA 1S10A 3CJRA 4I67A 4C4WA 2YNGB 1DJ0A 3VAIA 2JDJA 1DBDA 5F8GA 1VQYA 2AMCB 3PW2A 2GQ2A 5KFZA 4OX7A 1TELA 4GVBA 5K14A 2DHGA 1R27B 4DSFA 3IBCB 3CB4A 3PR4A 1DLOA 4UOCA 2FTRA 1Q8KA 1SIWB 1RT3A 4JV5F 1RLCL 2K3KA 5B0AA 1UCNA 4AD6A 1FWPA 1T9TA 3FNNA 1RWKB 3D6MB 3DRPA 1QUVA 2ZJQQ 2B5JA 2EFVA 3DOLA 3UN5A 2OSRA 4ILRA 2VONA 2ZH8A 4BHQA 4RW6A 3EPIA 5J2NB 4K7QA 4B3TF 3D68A 2DCLA 4TU9A 4HTJA 2OTLS 1HI1A 2ZH1A 4YY3J 1RISA 4C3KA 4ID8A 4MH8A 4K8RA 2QSFA 5KFXA 4IOBA 2LLZA 2QE5A 2QL7B 4I2PA 4M5KA 3LOUA 2F8HA 3BBCA 3LP1A 2IM3A 5LMNJ 1FJGJ 3EVOA 2BMBA 2DYAA 2YKPA 2W2OP 2UV8G 1UEUA 4ETXA 2AJ4A 5HL7Q 4URQU 1CJTB 5ETQA 3B4MA 2APOA 1X4AA 2CIMA 4NI2B 3HFVA 4DZ6A 5KT7A 2KVIA 2HWHA 2VQFJ 3SCLE 2MTLA 4F67A 2BQ3A 2ZOFA 5K5MA 2C2ZB 3CMAS 4ZPVR 1BGXT 5BYRA 2QZ8A 1LK5A 3JSMA 3LAKA 3K8WA 5HANA 2MQ8A 1EAYC 4Q2MA 2CG8A 3DXBA 1NKEA 1YSJA 3PEHA 4UZCA 1YZ7A 1D3WA 4RWXA 4DOZA 4ZPCA 4WYWA 2ZHBA 2UUBJ 4F25A 1ZOTA 5AXMA 2MKSA 2GV1A 1CQMA 4B9LA 1JJHA 2PFFB 4R0EA 4OHZA 3KG4A 2F4VF 2QMWA 4C0BA 3MWBA 1UEVA 4DR5J 3DU6A 1HMVB 2H5IB 1HR0J 3OL6A 3W8PA 1T3OA 1XNRJ 3O1LA 4DG1B 1YJRA 5GAGI 3CW2C 3MMAB 2PFDA 3PRBA 7AT1B 1YX2A 4NXNF 2V8GA 3AT1B 1V5VA 1NPKA 2DNOA 1VRTA 3HHLB 2CUYA 2ZFHA 5KFMA 4FF3A 5E3AA 2HQDA 5L9XA 3PO4A 4ZS6A 3E01B 3POTB 3KK2B 1Q82T 1FK9B 3M9OB 3QGGA 1URNA 5C2CA 2XMMA 1YBAA 1EHWA 2QT7A 3W2WA 3LP0A 4RZRA 2E1PA 4U96A 2MZJA 3QWPA 2E9RX 2DHSA 1DTQA 1NJXA 2JEJA 2AJQA 3ZZPA 2EKNA 2A18A 1X5TA 2X7IA 4C48A 3CPWR 3L09A 2PMZD 3QGPA 1U2FA 1K44A 1WHXA 2DHXA 4LQ3A 2ZZTA 6AT1B 1QAJA 1S1UA 1C4CA 2CQ4A 2CFXA 2Z30B 2JNJA 2OPQA 4LBIA 3BKTA 2XO7A 2XCAA 3NGTA 2XSFA 4LF1A 2FJVA 3I96A 1IN0A 2C22A 2O3DA 2C1EB 1DHMA 2WVBA 4DPWA 2YH0A 4NLSA 2GW8A 4CT8A 4WCEQ 4KE5A 3MEEA 4A8SA 2W25A 3VVUA 4KH1B 2MXYA 1XMQJ 3RB4A 2E1CA 3MR3A 1TV6B 4MKVA 3QZ7A 1S76D 3DRRB 4YP3A 3MPUB 1Q4RA 2D3ZA 4NLGA 4CM2A 2YPZA 3W5YA 3L3CA 4X4VA 3IGNA 1D9AA 4DR3F 4NZ7A 4PWDB 3NG8A 2WSEC 3T19A 4DL4A 2Q6CA 3M8QA 1RJJA 2ZVIA 1RTHB 4RNNA 4ZPDA 3BGRA 3KLFB 1C2PA 1IBLF 3DC2A 2FHMA 2OFGX 2Q1LA 4YR3A 5I3UA 1Y00A 2HNDA 4IOAQ 2V9KA 2VFVA 3AOAA 3CJSA 2K1RB 4DL3A 4KHPJ 5CZVA 2GJFA 1NPRA 1FWLA 3J80U 2PI4A 1VQ7S 4HHUA 3I87A 3C6TB 3VGSA 4MMOA 3J7AN 1JLGA 4RW9A 4PPZA 2ZH2A 4OI4A 3CD5A 2ALZA 1VFJA 5D4NA 2HHPA 1JLFA 1U48A 2J76E 3OFGA 1TQLA 4B3SJ 4F50A 1G1XA 3RW6A 3LGHA 1W7WA 5IT9U 2DNHA 1UW4A 2MJUA 3Q8SB 1SKUB 2W2QP 2XLJA 1G7CB 3BZQA 4MKAA 3QT8A 1DTTA 2HHQA 1RBAA 1B99A 1MSWD 5A6PA 3J81Y 1CQNA 3BKFA 1U8WA 3P6YC 1KLMA 2PMHA 4QQBA 3M9MB 1E6YA 1HNVB 4O3RA 3IBWA 2LECA 4ZHRA 4D3HA 1FI4A 1SBRA 2LEAA 5F41A 5EGYA 2CQ2A 3G8TA 5DJBA 4RU9A 3R1HA 3BR8A 3R7NB 3K7RA 5KFJA 1U1LA 2DNPA 2EXUA 3W66A 3R5JB 2HVZA 4J9MA 4NPOA 3JYTA 3MECB 1SIZA 1P8GA 2DNNA 2GAGC 5T14A 3DOMA 1ROFA 4ZVOB 3LPEA 1MMDA 3JSBA 5EX0A 1UZDA 1IBMJ 4M8LA 1Y3KA 4ZN1A 1R8AA 3MDFA 2H54B 2BJ1A 3HD2A 3RRHA 1VQNS 3HMJG 4M5HA 1JJCB 1JIHA 3H4DA 2XS5A 4TY8A 5DG7A 3TZZA 2X1BA 5HATA 1EQMA 4DSEA 4DV4F 3U1LA 2B6AB 5GAHU 3FEYB 2HPUA 1U1PA 4PQUA 3K17A 4P10A 4IYQA 2HNYB 4OYOA 1XERA 2JH3A 2VF3A 2HFZA 3BSAA 3CCMS 1N5QA 2VDIA 2IA0A 2FZGB 4OV1A 3W9HA 4NLTA 1FX4A 2ZWPA 1KVIA 4LF6J 1VBYA 1F6TA 1G4CA 4NLVA 3K5PA 5CA5A 4KHRA 1RT4A 2EFGA 3KNGA 3WX4A 1NH7A 1X9WA 3VAFA 4U6PA 3SSRA 2DNMA 3N6MA 4RNHA 3MXHP 5E7OB 2ERRA 1ZZFA 1MMLA 3FRYA 2NYIA 2ZKUA 2EFPA 3HM9A 4XTTA 1F9FA 2Z4PA 1RB0A 4K5RA 3GIKA 4FXVA 1DFDA 1N4LA 1WNEA 1KHVA 2VKRA 2VQEJ 1Y0HA 1RAAB 1KKHA 3KK3A 4JI5J 3H7HB 2AD9A 3OTBA 2DNQA 1R6VA 4O44B 3HX9A 2PGCA 2HGNA 4TXSA 1IKYA 5DDOC 2W7PA 1TKXA 3TVYA 4ZP6A 4FDFA 3HVAA 2XCPA 3G82B 2E9ZA 1SC6A 3GV8B 2W9CB 1R0AA 1RAIB 1CVJA 2G13A 2RAQA 1NKCA 5HN0A 1XWLA 1S7IA 3WX8A 4DV0J 4GVLA 1XMOF 4F3OA 1H0HB 2K06A 2OSQA 2MDAA 1UVNA 4HL9A 2DK2A 2GHVC 2H3EB 4GMKA 1AXQA 3TQEA 2AW0A 4PUOB 2AQ4A 4B9TA 3BS9A 2D1CA 3NGKA 1NUEA 2HFOA 1EIYB 5DDPC 3W62A 1KNZA 2MY7A 3JAMU 4CM0A 3KYLA 4YR0A 3FFIB 3DLGB 4FYXB 3CC2S 1OQ6A 3MEGB 4L3NA 4G1IA 2C2RA 4UUXA 1FD8A 2V68A 1NH8A 2XGPA 5DRKA 1HYSB 2W4PA 3C19A 4K59A 2F8MA 1J5OA 3HHNB 2W2NP 4DL2A 2R8GA 4DN0A 1SQEA 4EO6A 5CAAA 2HQIA 5E2QA 5L1IA 3EJMA 2P9GA 1HD1A 1ZH5A 3R3TA 2FVSA 4J9NA 4AE5A 2M88A 3VVTA 1S57A 2ZBPA 1NB7A 4ZPTR 4P74A 4ECVA 2DBBA 2Y8YA 1RHQB 1BY9A 2RVJA 2M52A 3LP2B 3CJKA 4OZ5A 5A8WB 1RWNB 3DRSA 3TJ9A 2ASDA 3GB0A 2KFYA 4ECRA 1JLQB 2VH7A 3LW5C 4JI2J 3PG9A 3PHEA 4PXCA 4JUZA 4PCQA 4CO2A 4GKKJ 1WHVA 1RT6A 4JI7J 5DO2A 3FSXA 3M2RA 3T5LA 3DLLQ 2HS4A 4LF7J 3HXMA 4UZBA 4RW8B 2ZD1B 2KFNA 3B6BA 4CH7A 1N33J 3LQVA 2LDIA 1VLOA 1RABB 5F8MA 4J7CA 4I1TA 1KR4A 3LA0A 3V6HA 5I3PA 2BKOA 4IH6A 1OY9A 2R7XA 3K89A 3CDAA 7FDRA 4USWA 4P2MA 4DR1F 1ZM9A 5JVHQ 2MPUA 1W2IA 2KM8C 3M30B 3D2WA 4WXWA 5EHHA 3V6DA 1XQIA 1RE1B 2MLYA 5E41A 3GU0A 3GJTB 3PJWA 5FLXY 4DQIA 1IKWA 2WBMA 3GMGA 1O8BA 4B3MF 4ELVA 2XTJP 3V2UC 1FEEA 1FJEB 3T5JA 2ZZNA 3OV7A 2QA4G 5HP1A 3A8KA 2KO1A 5F3TA 3GFHA 3NNCA 3BO4A 3DN9A 1YRXA 5J2NA 3NCPA 5D3GB 4NMXA 4RR5A 4PG6A 4ZVTB 3DCAA 3IP0A 4WIIA 3TA2A 2RF2B 1X4BA 4HACB 2WK4A 3MHYA 4ZVFA 1AFIA 3EE3A 1RLDA 3OD2A 4HH1A 2KT2A 2BJDA 4HR2A 3D3BJ 1V6HA 2GGPB 5G0RA 1N52B 4K4XA 1MU2B 3MTKA 2V5HG 1BMQB 1VRQC 3QRPA 3NWRA 1CJTA 2L9WA 1OY6A 1KSPA 1LFPA 2J7WA 1N5YA 1YTYA 1TK8A 1ELOA 3MMBB 1FTRA 1HD0A 1P6TA 2YWEA 4Y00A 1YI2S 2W24A 2UXDF 1CSJA 3RAQA 5D0RA 2GA7A 1BQMB 1YJWS 2VFRA 2EK6A 4H4OB 3CT9A 5CYQB 2YKAA 2LQ5A 3EZ5A 4DX6A 1AB8A 3ISND 1APSA 2FVPA 5ETPA 2AGQA 3DGPB 1LWEB 4ANDA 1XMBA 3UE2A 1P1LA 1S1WB 4WFBQ 4ZIWA 1WKKA 3VAJA 5GADI 2PA8D 5LJ5Y 4DL6A 1UETA 1ZM3A 3S01A 2F4VJ 4LSLB 4ZVQB 2ZH7A 3CJQA 2YX4A 4JI6F 5RUBA 1RKIA 4KYZA 4IRKA 1Q16B 3H40A 5L46A 3ZZ0A 3EXCX 4IG0B 3CEDA 3CDEA 4FPIA 2E5IA 2DHHA 2R2TA 4NA2A 1LV5A 4ZCIA 4OYIA 4WKYA 4A46A 4TNOA 3WZ0A 1V3ZA 1R3NA 2DR9A 4ID5B 1HLWA 3MMCB 3VGTA 4K4ZA 2R3VA 4E8UA 4MIAA 4OI2A 4W92B 3LF0A 2IJNA 3RBDA 1EARA 3CD7A 4J9VA 1ICEB 3W2VB 3D28A 4DSLA 2G1DA 2E7VA 5I4MA 4ZVPB 2XQCA 1HHTP 2RUGA 3ZO7A 1WTBA 3NP5A 2HRTA 3I0RB 3PX0A 2BV3A 2FC8A 3V4IA 4DS5A 3ZZRA 5A6WA 3TZWA 2AYGA 4ZVRB 1K0TA 5BJRA 2KYXA 3CTRA 2VG5B 2K7JA 5D0HA 2MKHA 2PA3A 2YKQA 5E3PA 4ELUA 3H90A 1FT8A 4URSA 1NDKA 2BBEA 2QLFB 3GLJA 2FHKA 3DLKB 2NZ4A 2UUCF 1D09B 3HJVA 2PEBA 3TAPA 1OWXA 2CPDA 3KLEB 2DIUA 1VC6A 4PWDA 2CQ0A 2AJ0A 5L39A 2WVCA 5DLGA 3Q8QB 3F44A 1QVFR 4J5OA 3KG1A 1NRKA 2EEYA 2DH9A 2XI3A 2IM0A 2R7UA 2W8LA 4ZVUB 4DR3J 4X4RA 5D8HB 1Q7LB 3CGIA 3CC4S 4LREA 3SIPB 5CD4H 1TKTB 2RD5C 3KLIA 1KQSR 1AFJA 1NK9A 1VIOA 3I5AA 3HD1A 4TU8A 2K1RA 1KHWA 3JTPA 2R2RA 3FRZA 3U7JA 1VJWA 4DR7J 4LRDA 4LF9F 1R8HA 3ZFVA 1UWBA 1Q5VA 1F5BA 3C6TA 4L6V3 4LT6A 2L48A 1BQNA 3EDQB 4PG8A 1NSQA 1NBEB 2Y1IA 2J6UA 2F1FA 4ED5A 3IWLA 1P9QC 1AZSB 3QO9A 2CQ3A 3Q23A 4QYZK 1WOOA 2O1PA 3J7Z5 4PG5A 2I1RA 4OZLA 4PEOA 2FIUA 4KTQA 4RKUC 3D1OA 4C97A 4DV3F 4N7TA 2POKA 3I31A 2HHXA 8AT1B 4NA3A 3B54A 2W2PP 1U47A 2LQ8A 3NS7B 4F04B 4EU0A 1VDHA 1Y9OA 1L3VA 5DG8A 4RW4B 1PGZA 4M5DB 4QWCA 4YB7A 4DQQA 3ETOA 2G1HA 1HNVA 5C7PA 2I2YA 2IJRA 5HO4A 2XC9A 1OPZA 3B8HA 4RJVA 1NK6A 3M1VA 4R5PA 3D6HB 4F4YA 1F2GA 1F1BB 3QNWB 2IVYA 1GX5A 4XK8C 1RSCA 3DKDA 3IBFB 2FB0A 1ZA2B 2JJ4D 2XBPA 2IVFB 1KC8T 4C7QA 3ZZTA 4NLXA 4JV2A 5D4LA 3L4BC 2ZBRA 3MAAB 4PXBA 2CZ9A 5HJXA 2NQPA 1CPZA 1WEYA 4CLUA 2E5LF 3O8WA 1V5IB 2YNIB 4PQAA 1OSDA 1BD6A 2HFNA 5HJYA 3PW0A 1CULA 3PX4A 1DY3A 2VL1A 2V63A 5AE2A 4X66F 3E51A 3AAWB 1IUJA 3TJAA 3EVWA 4LRBA 3M8RA 3TZYA 2GMLA 2ALYB 4CH0S 5EN1A 2B43A 3TUIC 3IS9B 1HQ2A 1ZETA 2DRDA 5A0YA 5JUMA 3M7VA 3CF5Q 3U02A 1BE4A 2BA9A 3L9ZA 2F7VA 2EKYA 3CCLS 1FX2A 1LWFA 3HF5A 5CABA 4A8QA 5B09A 2AJ2A 2DVIA 2HQ3A 4OX8A 2V4JA 2HFSA 3MD3A 1V9OA 4LMZA 1AROP 5DDRC 1VR6A 4DV4J 1CS4A 2BRLA 4ECXA 3LPYA 1RWMB 3M32B 4F4KA 5KT6A 1LKZA 5DQHA 2LXIA 5D77A 2OPRB 4DFMA 2ATLA 2FC9A 3KUHA 1VJQA 3GJQB 4RUHA 3FC9A 4TY9A 2BANB 3R7SB 5DZ6A 4Q0BB 2JL9A 2DJWA 3HSGA 4DHVA 1XBWA 2AV5A 4J9SA 1MNEA 3ET6B 2RDIA 1NO8A 1NM2A 2R7SA 2WHOA 1IVZA 3PM9A 3BO2A 3HHDA 4QJVA 4I7FB 1YJNS 2B4OA 3C46A 4NL5A 3S1TA 1RACB 2V0NA 4NOHA 3HT3A 1IR2A 2DGXA 1FESA 2QFJA 3MM9B 1U25A 3C16B 2NZCA 2M70A 2QGFB 3MFIA 2D7SA 2VG7A 2RU3A 1FJ7A 3C66A 5C24B 3CCSS 1UFKA 2MQNA 2MHEA 1IWGA 5LSLA 1QSSA 3WIVA 2DGWA 2AYMA 2QYGA 2F9DA 2HWTA 4DDFA 3EXYA 2VBWA 1RWWB 4J91A 4KO0B 3D9BA 1OIAA 2HAIA 1WD6A 2UUAF 3D1QA 3JSRA 4IRCA 3JXOA 2B56A 4PUOA 1XMOJ 1S0VA 2C3MA 4PKDB 3AQPA 4I68A 1SJQA 1HIYA 1TL3B 1U49A 1TK0A 2A6OA 5D15A 4HT7A 2MKKA 1RUSA 2WB4A 1REGX 2BVZA 5EUHA 4DN9A 5HVFA 4PABA 4K4VA 3HK2A 3PTWA 2HZAA 1HYSA 1NMEB 2AJ1A 2R4FA 3JQMA 2GJIA 5GVQA 5K9FA 1SJ1A 1F60B 1M5HA 1UVKA 1WSRA 3K5NA 2BEFA 4KHMA 1F9HA 3RB0A 3Q2TC 3OLBA 1HWUA 2P6SA 4C8NA 1LWCB 3QIPA 1XIQA 1K1QA 5IT4A 4F4ZA 4JI3F 1T9XA 1UJ6A 1BLUA 1RT7B 1VQLS 3FEZA 3NGUA 2YNFA 1HNZJ 2YWHA 4USTA 3BJYA 2OGUA 2Z2ZA 2V67A 3O5TB 5A8WA 5GAHI 4ICLB 1RWXB 4LRFA 2ROPA 4FNHA 1MWZA 3CVKA 1HBUA 4P2SA 1VS3A 3I9V9 1PBUA 2ACMA 3PIPQ 2V2KA 3GFXA 1QAXA 5ETVA 3GFZA 4DV7F 2A0FB 2X1FA 3M2UA 3ILOA 4LF4F 4NLYA 3TA1A 2GAHC 1SV5B 1RBLA 5IZHA 5F8HA 4V19J 1UA0A 2R7VA 2GVDB 1RQ0A 2FJAB 1EETA 2G0IA 1IKXB 3OUYA 3CIZA 5A8KA 1QTMA 4BC9A 1JJ4A 1O51A 4HI1A 4Y28C 3W63A 1Q78A 2KHCA 4CYUB 4ZJOA 1TL7B 1OO0B 3CD0A 2RS2A 2ZNZA 3UPFA 3PR5B 1N56A 3C6UB 3TNVA 2DIVA 4WBFA 1VQ5S 5D6GA 4TQRA 1U45A 4C11A 4JI4F 1I51B 3KTQA 2QA1A 4O3SA 4IDKA 5A8RB 3GV7B 4DBQA 3F73A 3OVAA 4DR1J 2XEXA 1YGYA 2CJYB 5E3RA 4EUVA 1N48A 2GC8A 4B3OA 1QLNA 2VASA 3PYDA 4NZ6A 4R0JA 1FD2A 2H5JB 2AJFE 4B3MJ 4X64J 3K2YA 3WBZA 2W4CA 3KUEA 1LNQA 2XYPB 2FYXA 4DFPA 5D0GA 2V2ZA 5AXKA 2Q3PA 5JVGQ 3OVSA 3OTDA 5HMWA 2Z2YB 1Z4UA 4HACA 3THVA 1D9DA 2F3JA 2QG9B 5M2RA 4TKTA 4MJKA 1Q95G 2XYGB 5HVHA 1TUGB 3OVBA 2YTCA 2VC1A 4W4MA 2XMVA 1T0TV 5J2QB 5HMYA 2DGQA 1AA1B 4WP8A 1G6BA 1CJVA 5KFTA 2OAUA 2BACA 2C3YA 4Z7CA 3IO1A 4YY3F 2UV8A 3MMBA 2GO8A 2MGZB 3D4JA 1EKSA 2ZH3A 2CJQA 3MM7A 1RWOB 3MR5A 3R5CA 1SQGA 2QRRA 2XZDB 3IMQJ 5F9LA 3BDPA 4PWUA 3VGUA 2RIJA 4NMLA 3HKZD 4DSKA 1Q5YA 3G96A 1HNXF 1RAHB 2VQFF 1PAEX 3IM9A 2OIHA 1H7WA 3LAMA 5A2QY 2MLZA 3NOCA 5KFSA 2YPYA 2J0QD 5HLFB 2ZE2A 4K4TA 3GG0A 1TZ0A 2L9NA 1C0UA 1F3FA 5CH7B 2VPXB 1GXUA 2JOQA 3V81B 3Q8UA 4TLQA 1H73A 1PIEA 2OUGA 1WF0A 5HK4A 4MK8A 3QGHA 3CMES 2GHPA 3NXZA 4IFYB 4FXDA 1GT8A 4JI6J 2RQCA 4P7TA 1U4BA 5J2PA 1SJFA 3R5GA 4ECQA 2HFUA 1NJYA 2QA2A 3CCQS 2GQCA 4ED2A 3Q89A 3QJLA 4DJBA 4F0KA 1CJKA 2HNZA 4LR9A 4OJ3A 2EWHA 1T9WA 9ATCB 4CDIA 2BUNA 1QAIA 4ZA1A 3R1LA 4TQSA 2I5JA 2H1YA 2HBQB 1H3DA 2DRBA 2KRRA 2CDRB 3J81U 4N77A 4OL8A 1EZZB 3KOAA 1RAOA 1OSCA 4LQ9A 4MIWA 2AKWB 4F0MA 3JS9A 1M1HA 4Q5VA 4M5LA 3UCZP 2VG5A 5DLFA 4IH7A 4F7VA 3I56S 3QPIA 4FVMA 4R8UB 4B17A 2DKOB 2KVQE 4MFBB 2Y1JA 3DLKA 1U0HB 1G2EA 4K0KF 1UVIA 3WDOA 3K57A 3FSIA 2KJWA 1TAUA 1Q79A 4WFXA 1CG2A 1KD1T 5KT3A 1VC0A 4ZN3A 2RB7A 3PFOA 3RYLA 5IWAF 3WC0A 2UUCJ 1B0PA 1JLBA 2CJBA 4U7UK 4BDPA 2ATCB 2HRYA 1VQPS 3PW5A 4GKJJ 4ERDA 2LA6A 4BC7A 1QJHA 4CLKA 2ILZA 2KN4A 4ZVGA 2L41A 4LF2A 2MB0B 1XMQF 2D41A 5KOXA 1U2CA 2O5DA 5AE1A 1N34J 3BSCA 3TUZC 2OJ3A 1CBKA 1NZ8A 4IH5A 4X65F 2RSQA 2V8DA 2E5HA 2QSWA 2I6WA 2RQ4A 2FZKB 3NAHA 1PO6A 2EC0A 2KI2A 2G9OA 4DL0C 3IRXB 2V8HA 2B4PA 4HDGA 3KHLA 2FGCA 2HHTA 1A0OB 4IR1A 4LF9J 4O3NA 1NLKL 3BGLA 1SJ4P 4ETZA 3P3DA 4KIAA 4NLQA 5B0DA 3BR9A 2HHSA 1WUUA 1SKWA 2XB2D 3FJ2A 4WFYA 1YK9A 3U1MA 2FUG9 2AEMA 4OJ1A 2DH7A 3EYZA 4PG4A 2CWXA 2WBRA 1U02A 4UY85 2XZWA 4H4KC 1XR5A 5D4OA 1Q8LA 3ZC4A 3KLGA 3SCIE 2D9PA 3ZZZA 4CO4A 1S12A 1QE1B 1GAOA 3GTYX 1K73T 4DV3J 3QGIA 4M5DA 1H72C 1R0BG 3CCWA 4B3SF 3NOGA 4ENOA 4MK7A 4I2QA 4F4AA 4USIA 3MM5A 2ZOGA 2M9KA 3AH6A 3P45B 5I42B 1RAEB 2J5AA 4AL6A 3CE8A 2XG8A 3A3OB 2RRAA 3GIIA 1PJ7A 1SKSA 2A6MA 2M4MA 4UOFA 1HBMB 1WELA 1T9YA 3MD1A 2M3DA 1MROB 4NYZA 4MIBA 4X62F 4QWDA 4UTGA 3MPVA 2CZ4A 2J7UA 3AY0A 2DNKA 2ZNYA 3W60A 2MJNA 3CNQP 2RRBA 4FPRA 4ER8A 3UR0A 2QJ3A 4NEZA 1XR7A 2CNOB 2I8EA 4LSNB 3C2PA 4CLYA 5HBMB 2G2ZA 2E5LJ 4Y2AA 3GQCA 4I64A 3KWMA 1SI9A 4FKYA 3FMWA 2HK2A 4C8KA 1VC5A 2HHWA 3HKWA 3GCXP 4X66J 2UXCF 2LMIA 2DR8A 2KXFA 4ZLNA 3MCMA 2AIRB 1S1XB 4H4KA 1IBMF 3VAMA 3NBPA 2ZJPQ 4KV8B 2YVSA 3HDSA 1XC9A 2AGPA 3EGNA 4QIWD 5T41A 3CCUS 2PSZA 3BB5A 4UQGA 4P6QA 3M32A 4CO5A 5GAEI 1S1TB 3W3SA 4OQJA 2KG0A 1HI8A 3QRRA 4CNYA 3KJVA 3I5BA 3R27A 4WKRA 2XS7A 5DS7A 1P27B 4CT9A 4Q7AA 2C2DA 1D9FA 1HQEA 1ZAXA 3R6LB 3QATA 2LCWA 3SYZA 3M2VB 3SI8A 3ITHB 1U1OA 3GWCA 2BJ3A 3PYFA 3H5XA 3DFEA 4LVOP 2HHHF 2R42A 2IAJA 2BJ9A 2BZ2A 4YMEA 4MT1A 2KZMA 2CJAA 2MZRA 3QAUA 2P9CA 4R25A 5C24A 3DM2B 4DPOA 1QDUB 4CLZA 3V6KA 3G87A 3M8SA 4ZP9A 1UVLA 1RHJB 4JB8B 4X4QA 4DS4A 5J2MA 2HIQA 3ENVA 3KLHA 3H0PA 4PXEA 3PZPA 4KO0A 1R31A 2JRSA 4WFAQ 5HMZA 3BQ2A 4WP3A 1NDPA 4PG7A 4KKOB 4DX5A 2UUAJ 2VZ9A 2ZOMA 5KG4A 5MAOA 2OEMA 2V4QA 1WC1A 5FLXU 4DV0F 2QX0A 5IM0B 1VMBA 3IXQA 5IT0A 1HL6A 2ADBA 1S99A 2EG2A 1S9GA 1M5KC 2D3UA 1KFSA 3U1NA 3DHXA 3I32A 4CLWA 2NLWA 3G6VA 1VQ8S 4ZIVA 4ZVEA 4EZ9A 3HVTB 1RADB 2KG1A 1FE0A 1RT7A 5KFQA 1VHIA 2WSFC 4NX9A 1EKRA 4I69A 1KTVA 1RAFB 2DITA 3D66A 2JWNA 1TL5A 3UD3P 2GJ2A 2UZAA 3ILJA 3H20A 3J80Y 2VDHA 3FDSA 4NYOA 1S6PB 3SBMA 1T9VA 4FF1A 5B0CA 1X5PA 4DR4J 4XPCA 4USHA 5FDLA 3M8ZA 1S59A 4N76A 2QEXS 2HWIA 1O5JA 1J5EF 7FD1A 3OL7A 4U9RA 2MQQA 2JEIA 4GC7A 4DV7J 1F5CA 4Y0FA 2H5EA 1SXLA 4LF4J 2U2FA 2VBZA 2VOPA 5CCMA 3H2UB 2KT5A 2DHAA 2MMYA 4NYPA 4JI2F 1T95A 2JHEA 4GKKF 4ILMA 1VRUA 2CQIA 3U27A 3FK4A 3PXGa 4IQXA 2MZSA 3D67A 5T7LB 2W9AA 3CJ4A 4DV2F 2CA9A 1N33F 1EP4A 4DL7A 3G9CA 3SSSA 4USVA 5ETKA 4XIUA 2C2KB 5JJBA 3ZZUA 4JI4J 4LF8F 1S9EB 1FKOB 5KFGA 3JQKA 2NXEA 3CJ3A 3KXDA 5J1NA 3UWTA 2NSBA 2C3UA 4OYZA 3CJ2A 2NCKL 4J9PA 4JI1F 2XLKA 4B9UA 1TFWA 2OPPB 1KP6A 3HVRA 1HBNA 3CJ8A 3TX0A 1RKJA 1NK0A 3AFGA 4CNZA 2KH9A 5H9FJ 1I94F 1WC0A 3OR1B 1R8PA 4YS2A 3I5CA 2V2QA 4B02A 5LL6d 4I6WA 1VBKA 3DOKB 2X1GA 2B0GA 1HWJA 3MPWA 4RBVA 1K9MT 1WC5A 4QU6A 2DTJA 2J9CA 4Y2KA 3M8PB 3EX7B 3A8IA 4EYHB 4ALZA 3DI6B 3AOCA 1X7VA 4PZVA 2KRBA 1N0UA 1EQ0A 3RAXA 2DGUA 4AL7A 1S72S 1MLAA 2BE2B 2VICA 1WACA 2VG6B 3GPAA 1YBTA 4K50A 2EFQA 1RTDB 3PJXA 3UDEA 3SQGA 4RL1A 1HNXJ 2OHDA 1KTQA 2MHNA 1ZA1B 5CYMB 4P72A 4OYPA 3D1HA 1FKPB 4O23A 1R0CB 2HMIA 3A8EA 4KGZB 1KWMA 1NK7A 4DX7A 4Y2MA 3WIUA 3SCKE 1H7XA 4OZJA 3V81A 1NDCA 4KB7A 4ED4A 4JP8A 1FKAF 1OY8A 5GAGU 3LH2S 3QAEA 4QBUA 1X4FA 4EWTA 2VJUA 1SL1A 2Q79A 1PC4A 1HNIB 2WAQD 4YEAA 1JK9B 1NPPA 5KFWA 1FJCA 1SUQA 1IR0A 1WHWA 3CCRS 1Q7YT 4ZPBA 1NCLA 3BBFA 3BGFA 3CCZA 3MR6A 3ZTPA 2Q43A 1UMJA 3EMTA 4M94A 3MEDA 1RA7A 5C25A 1VYAA 5K14B 1MG7A 1T05A 2ZH4A 2OEJA 4OI3A 4KRWA 1K8AT 1DLOB 4L76A 1G3OA 4O0IA 2O67A 3TEGA 3JAMY 2F9JA 3IWXA 1FDBA 3DLEA 2LVWA 2FLOA 3BGOP 5LM7E 3SQOP 2UU9F 2BXJA 2VFSA 2WSCC 5CHCB 3DRPB 2B5JB 3DOLB 3HULA 4DF8A 2G0JA 4RW6B 2N4CA 1FE4A 1U0HA 1FF2A 1PJ5A 3G8QA 2BOAA 2NYHA 4U67Q 3UR3C 2QFIA 4OZ1A 2DNYA 4EFAC 3P5BP 2WONA 3D6TB 4K0KJ 3L7PA 3BO3A 2WRMA 2OD4A 1KQFB 1SC3B 3LP1B 2VU5A 2XS2A 1FRMA 3TANA 3MM8A 4WTYA 5IWAJ 2HURA 3NWGA 4LIRA 4F0HA 4HDHA 2XWXA 3VGVA 3OPKA 3FBFA 4N8NA 4F2RA 4GO7X 1X4EA 3B4DA 1ZZNA 5LT5A 3TVZA 2VOOA 2RQMA 3THTA 3JSMB 2Z8QA 4BWJA 2I38A 3MAHA 4JI0F 3H2LA 2AU0A 4X65J 1JXEA 2Q66A 2W01A 2WVDA 2H65B 3M8YA 2C2NA 4ECSA 2DR5A 1YJVA 3BREA 2CQBA 4IFVB 2D3O1 3ZTSA 4LSZB 1FVQA 5JXSA 2N7YA 3D0GE 3OR2B 4DR7F 1JQGA 2PO4A 2HG4A 4NLUA 3NMRA 2IY5B 1PKUA 1S77D 2EFNA 2ZHAA 2LEBA 3D5MA 3FQLA 2EI5A 2ZDOA 2WVFA 4A8WA 1PSDA 2UXBF 1R43A 3QLHA 4KPCA 1VRTB 1JLAA 1TL4A 4YB5A 2YXLA 4ZKAA 3LP0B 5LOQA 1TKZA 1N8RT 3DMJA 4N8OA 4MTPA 3OHBA 3PW7A 3GJSB 2ZC3A 2QA4S 5EWFA 1IBKJ 3IG1A 4Y6IA 2BYCA 4DCJB 9RUBA 1C4AA 5CXTA 4J37A 3C3LA 3NY0A 2F65A 2AZ1A 4TN2A 4AQYF 4QR1A 3QZ8A 3LWMA 4OIXA 4I56A 4OFZA 3SCJE 3AXKA 3ONQA 1FA0A 3IR5B 1S1UB 3Q0AA 4QOTA 3J7A1 2CQGA 1FNOA 2OPQB 1H2UX 2ZM6F 3SFUA 2QLBB 2NUHA 2ZUGA 3I0SA 4X62J 4WE1B 2NXJA 3T1YF 3Q83A 3HT0A 4IG3B 5EX3A 1VQOS 1SVDA 1UTAA 3FCHA 3DDIA 5C42A 3CCES 1XK8A 3MEEB 3UCGA 5HSPA 2MZQA 4CLFA 2B9EA 3HSDA 2L9DA 4MK9A 3LGNA 3Q2SC 3E2EA 3KK1B 1TL1A 4WPAA 2KT3A 4UOGA 3N0VA 2CQ1A 5KFNA 2UXCJ 4KV8A 3OTOJ 2MEWA 2OD6A 1X60A 2IM2A 4RW7A 4O4RA 2GZOA 3QRQA 2ASYA 2WW4A 3M8QB 1LW0A 4NCBA 1S7HA 3UVJA 1I1GA 1WG1A 4RX6A 4NLRA 2YH1A 4FBUA 4M5IA 3VAHA 2H9ZA 3DLJA 3PW4A 3IRWP 1HI0P 4CLSA 1C0TA 4KFBA 3EGWB 2OP5A 2XMTA 4CIOA 5F8LA 1SL2A 2HYIB 3W8GA 1ZPWX 1S5ZA 2LP4A 3NGRA 1Y5LB 4F8RA 2IBKA 2YKNB 2DCUB 4OYMA 1VHFA 1RTJA 4EBEA 3CXCR 5F0UA 1JX4A 2HK3A 2IC3B 4MKBA 1JLFB 3FVYA 2LKZA 4KBIA 1KBRA 4ZPAA 1RWPB 1RT2A 3TAMB 5KG3A 4ELTA 1LEOA 3KJQB 2Y3YA 2Z56B 1OQ3A 3PVXA 1O6XA 2OPSA 3DHWC 4LBPA 2ZBIA 1DTTB 1LW2A 1H2TZ 2HVDA 2HHHJ 4DPUA 4Y2CA 1TVRA 1KLMB 5HROB 1E6YB 1X31C 4ZHRB 4AXIA 4IRDA 3NNHA 2RKIB 3GV5B 5ETOA 1IKVA 2FZCB 2E9TA 4IOCQ 2Y8WA 2HQCA 5KFVA 3TW0A 3RJMB 3TARA 3P49B 1A7GE 1NK5A 4WYLA 2XO6A 3FBCA 1HPZA 3K5OA 2RDDA 2VPWB 3T5HA 4EEYA 1RAGB 2FPHX 1PC5A 3DOMB 2YX1A 3OFHA 3PKYA 2ZH5A 2CWKA 4DPTA 1SCJB 1LK7A 4C8ZA 2QC3A 2LFVA 3HVTA 2XYHB 1F3VA 3OL9A 3I55S 1FXDA 2W8KA 2XHCA 3LANA 2D69A 2XMWA 1HARA 1FFSB 2VFTA 1YJUA 3FBBA 4TY8B 3CO0P 4ANEA 3TUPA 2H4WB 2UUTA 1HW9A 4LVNP 4GRSA 4PQUB 1WOPA 4HKQA 1GMWA 8ATCB 3MUTP 1E6VA 3EICA 5F3ZA 1BHNA 1HNZF 2WOMA 1RHUB 3W65A 1RHRB 1C1CB 1OJ4A 2FHOB 1MWQA 2XSJB 5ETRA 2LYVA 4J90A 4FNIA 2LXUA 1RT4B 1UL3A 5EWEA 2AP6A 1J5EJ 3EWGA 3LTOA 3A8JA 3EVMA 4BLGA 1HBOA 2HEKA 3OQ2A 1RYSA 3W64A 2LDYA 2B7CB 4G1QA 3J7YI 2Y1LB 1RXOB 2DPJA 2BKPA 2R9LA 4JI8J 2N4DA 2WCXA 5J1PA 4YFUA 2MKJA 2MSTA 1UEKA 2OKQA 2EPIA 3WQPA 4CO3A 2NPIA 1T02A 3KK3B 2LA4A 3LALA 4XO0A 4LR7A 1U1KA 4P9SA 2ASJA 4LFAJ 3W61A 1UKUA 3G6XA 5F8IA 3NKYA 5L1JA 2G2YA 2E29A 2J0WA 4DV2J 3MOZA 1XNQF 2UP1A 1TKXB 4B9NA 2G0CA 4J9UE 2B9XA 3CUNA 1FO1A 2YNGA 2KB2A 1S0NA 2V9WA 1R0AB 4LF8J 3N4WA 1R8CA 2PIIA 3MCNA 1OPIA 2XHWA 3GIRA 2BR0A 1EX8A 5KFYA 3UN3A 3GE9A 3HZGA 3I4HX 5HI7A 4QWEA 1X4CA 3DGVA 2YY3A 2MLXA 4JI1J 2CJ9A 1YZ6A 3AJ2A 1RI7A 5C2GA 3MUVP 3MM6B 4X64F 2KL8A 2GX8A 3T3FA 1I94J 1TP7A 2FJDB 2I0XA 4C8LA 2CQHA 2JFDA 3G8SA 4OZ2A 3VWSA 4RNOA 3T6JA 2JC0A 4RO0A 4EGLA 2HBZB 5H9EJ 2BQRA 2QTWA 4WFZA 1SL0A 2GIFA 4DUYJ 2YWWA 3HHLC 3CULA 3FCWA 4WWSA 4DI6A 2YQ0A 1S1VB 4D3GA 3MR2A 3SMZA 2P8IA 3IGVA 1KQKA 4UY8T 4G65A 3CJKB 4O4GB 2ZZMA 3T1HF 2BM0A 2EBEA 4NI2A 3KDNA 1GXLA 4NZ0A 3KUGA 2NUUG 2ZJRQ 3BSNA 3GYGA 4K2JA 2RRNA 3OHAA 3AQOA 5B7WA 1RT6B 2MSSA 1TTHB 3KDOA 2C28A 2BRKA 5KFDA 5GADU 4Q2LA 1U26A 3MGJA 2R7OA 2CPFA 3RR8A 1BQXA 4ZPWR 4DR2J 1GEHA 3E3XA 5E3CA 4K4SA 1S6UA 1YRUA 4ZP8A 2Z2MA 2EC2A 2BE7D 3RBZA 3TYTA 4KT0C 1HMVA 3R9LA 1VQMS 3VAKA 2RJZA 2OMLA 3M4XA 1FDDA 3IAM9 1P9YA 1D1UA 4J9RA 5LSRA 4Q8FA 1FNXH 3C15B 4DG1A 2AX1A 2HGMA 4C6AA 3O44A 1MWYA 3MMAA 4WF9Q 3V6DB 2A2CA 3FCVA 2CPHA 4Z7YA 3HHLA 1RTIB 1PYTA 3BDEA 1IKWB 1NK8A 3EZUA 3E01A 2QLXA 3POTA 1TU0B 3VF0B 3KK2A 1FK9A 3PKMA 1X4HA 3V6JA 3W9IA 2F63A 1W25A 3T5KA 1U1MA 2QYCA 4NLWA 3N5FA 5HP1B 2CNLB 2PE8A 3C14B 5AJ3F 1RK8A 2Z58B 2UU9J 3IFEA 2BKNA 1WI6A 4RUCA 1QAYA 3ZNJ1 3TO8A 1KRPA 2EBGA 3UNGC 1N36F 1HHSA 1UVMA 4DV1F 1FERA 3HVWA 1RGVA 1Q86T 5G0RB 4A4JA 1R89A 5KFUA 5F8JA 5KG1A 3BBBA 3HHEA 1N88A 1N5YB 5CYJA 3US5A 3CCVS 2DY1A 5F8NA 5CCLA 1GX6A 1TV6A 1NHVA 1A9NB 4RU2A 1LXJA 4K4UA 3DRRA 4GKJF 3MAQA 3N6NA 2KM8B 3K5MA 1YLXA 3MPDA 1RCOB 3G2XA 3I4PA 1W2BR 1UAWA 1JLEB 5KFIA 4OI1A 4ITSA 1N34F 4ZP7A 2IDEA 4JI0J 3M6UA 3ILIA 1RTHA 2QMUB 5KFEA 3KLFA 3L7OA 4IFVA 3IAS9 3TA0A 2M8HA 5BR8F 2NPFA 3OR2A 2PMWA 4OZ3A 3GIJA 5KFHA 1ZAVA 2IPOB 4C98A 2XI2A 1N5SA 2DR6A 1FFGB 2YKOA 1UWAA 4J9LA 4RLEA 2XULA 2CAJA 1HQUB 3B82A 3DLHA 1GMVA 1YKWA 2VA3A 1FWKA 5KFRA 2JFKA 1HWKA 3PCOB 4NLPA 4P75A 1FCAA 5LMUJ 4DLGA 1BWVA 3BH7B 3G6ES 2F40A 4Y2IA 5L8RC 2UXBJ 3QJJA 2KZZA 4AXJA 3MFHA 2NSCA 5ADZA 3RBEA 2F8EX 4KGVB 1Q0NA 3JTOA 4CTAB 3EDRB 3RB6A 5HQ8A 3SZ2A 3R5DA 3CDBA 2KJVA 1BWEA 4JBCA 2DR7A 1JKHB 2JLFA 4P52A 1HHQA 3BPSP 2V34A 1S4EA 3M6XA 1DAXA 4AQYJ 4DWIA 1DZ5A 4NXMF 1SC4B 1VISA 1Q1KA 1NHUA 2RT3A 3V4IB 2NS1B 4A8KA 2N82B 4L3KA 4WE1A 2ASLA 4IG3A 4ZLPA 2ZM6J 1TK5A 1U6FA 3BN7A 1OMSA 4LRCA 3T1YJ 1NK4A 4ECUA 2MQOA 2LU2A 1FDNA 2OLWA 3KK1A 3MECA 4ZVSB 4H4MB 1PCAA 4YN3B 1NJWA 1MN9A 4DV6F 5D0EA 2MZ1A 2OELA 3MI7X 5K8PA 4QWBA 4LFCF 3KNAA 3JB9k 4J9KA 4TLRA 2IIHA 5KFLA 3FZBA 3EPGA 3AB2B 1Y10A 1VIXA 4KGKA 1YITS 1NEEA 4PYDA 4G6VB 3OSPA 1WC3A 1UJ5A 4CZCA 3R5AA 3KLIB 4QZVB 1UVJA 1ZS6A 4DL5A 4AL5A 2QMXA 2HLUA 2HSEB 4DLEA 4E2FB 1FHTA 3OT9A 3R8YA 3HSZA 2BX6A 3BPDA 3UNYA 2C2EA 4FS1A 2B6AA 3BF4A 3AA9A 5GMKa 2X51A 2K8GA 1UWBB 3RRKA 1RA6A 4CO1A 2HNYA 1M5SA 4B9MA 2M2BA 2YKNA 2ZC4A 4LR8A 3N01A 1BQNB 4JYAF 1AUSL 2DNZA 4EI2A 2RHQB 2IC3A 3QO9B 3R2CJ 4A47A 3Q8VA 1K1SA 3H8YA 3TAMA 3A3NB 3R97A 4F4WA 1VQSA 2HGLA 4B3RJ 5ITHA 1WC6A 3QYYA 4QW9A 4ES3A 4HHHA 1P1TA 3Q24A 4M63A 3GSIA 3NGSA 1YJ9S 2PT0A 1UPPA 3BV8A 4PRFA 4WZMA 3HHKA 3G4SS 3W5ZA 2HKEA 2GFFA 1XJWB 4M95A 5HROA 4MKYA 3QFHA 1B0VA 2H51B 1WC4A 3W5XA 4WU3A 1FFWB 2E66A 4O44A 2RKIA 3UDVA 1LXNA 3OTCA 2N3OA 3D3CJ 3P5TL 3M1VB 4R5PB 4EK2A 2CG4A 3G6YA 3AD9C 1PYSB 3G82A 3SSQA 4ECZA 4DUZJ 1RHMB 1OS5A 3T41A 5ETLA 2W9CA 3TR5A 1Z2LA 4CWBA 4X4OA 2MYFA 1ULRA 3D6FB 2RE1A 4F36A 1KVJA 2XY5A 5K20B 1VBXA 4N47A 8RUCA 2CPZA 2DGSA 3BN4A 4UF4A 4F4XA 1CULB 4ED3A 2QO3A 1SPBP 4GO5X 1EJ7L 1VLYA 2HLTA 4DX8H 4DEZA 4DQSA 3DDNA 2HQGA 3MTJA 2N3LA 1H74A 4OX9F 3UQSA 3FFIA 3DLGA 2QN6B 5A0YB 3MEGA 2FHJA 2B4UA 3BSOA 1S6QB 2X3DA 3S8SA 3CDWA 4FXWA 3MMJA 2FVQA 1LWFB 1KDNA 4LFBF 2V4JB 5D78A 2U1AA 2CPIA 5KOWA 5ETMA 5GMDA 1QVGR 3UI3A 5KT2A 1C1CA 4ANCA 4B9SA 1CS4B 2ILYA 4USUA 2P5VA 5FJ4A 1ACMB 2XMUA 2XSJA 1HNWF 2PDAA 1WEZA 4LF5J 1S0OA 4MAKA 1FRLA 2BJ8A 2LQBA 3HP6A 5ETSA 4PPDA 3V4MA 4DR4F 2OI2A 2WB1D 3LGMA 3LP2A 1RCXB 3BEGB 2B51A 1FDAA 4YQWA 2R8HA 2HVHA 1JLQA 2GMJA 4DUTA 3OLAA 1D0EA 4A8FA 3IM8A 3AD8C 2DGVA 3F0NA 4ED6A 1NZAA 3GG1A 5HVGA 1QSYA 1JWWA 3QIDA 5J1EB 5U47A 4OZ0A 1IQZA 5MLCV 2DB1A 4RW8A 4S0MA 4P73A 3B78A 3NS5A 5KT5A 2ZD1A 3SV4A 1DQ9A 4AUKA 1I3OB 4OI0A 4EO8A 4Z37A 3BYPA 2MZTA 3CDUA 2CZVC 2DXFA 4OLOA 2DXDA 2BJ7A 1M90T 1B3TA 2VG7B 2VODA 2BDPA 4KGXB 1XNQJ 4P2FA 2GVZB 1U09A 3RR7A 1JMTA 2NXUA 1X5SA 3UW1A 4DF4A 3PJ9A 3QSYB 4ZLLA 4ZJQA 3M30A 1WWHA 1RTZA 2C3PA 1EB0A 3DRXA 3KJFB 4X4SA 2CNNB 2CVEA 4IQMA 5KTQA 1U7LA 3AJ1A 3H2VE 2XNQA 1B70B 4Q43A 1SKRA 3MM6A 3X1LB 3GZ7A 1FVSA 1YJ7A 4WJBA 1U0SA 2J0SD 5GMEA 4JV0A 3TUJC 1WG4A 5IOLA 4L73A 3M6VA 1DRZA 3HCXA 3ZZOA 1X5OA 3GR1A 3RTVA 5D3GA 1U6ZA 4DPYA 1VOMA 2AEFA 2YKMB 3QMQA 2Q6BA 3G71S 1FNMA 2C2OB 5KG2A 2RF2A 4FBTA 3QIPB 3H59A 4U8YA 1RAJA 1S1VA 1DURA 5K8MA 3HLUA 4DU7A 2YNFB 4OHYA 2D74B 2GGPA 4OYAA 2VJVA 2Z57B 3M6WA 3H4BA 2AYBA 4ZMMA 4O4GA 2H48B 4PR6A 1MU2A 2EW9A 2W7OA 1HBUB 3I82A 1HFEL 3O3LA 4DZDA 2FLNA 3BGUA 3T1HJ 5B08A 4ZCKA 1GK8A 1HW8A 3Q8PB 3M2UB 2UVVA 3H5UA 2X3GA 1FXRA 1WHYA 1WORA 2KU7A 3G86A 1YJTA 1BQMA 4HVZA 4HYKA 1N32F 1EETB 4H4OA 1NSAA 5CYQA 3CJTA 4X4NA 1SH3A 1GMWD 3UDCA 3OUYB 4O0NA 3BQ1A 1SJRA 5A8KB 1KN6A 4M5GA 3DDKA 4HT5A 3DGPA 1LWEA 4KJIA 2DEJA 1S1WA 4ZCMA 3T9NA 1D8YA 2CYYA 2AHOB 2LQ9A 4M1KA 2J8SA 5M2PA 2RQKA 1JNRB 3C15A 4DV5F 2XMKA 4LSLA 4ECYA 1WDDA 4C11B 3HO1A 4RUBA 1IJEB 1F0XA 4IDKB 2VB6A 1KFDA 3NMAA 5AXLA 3UD5A 4C8OA 5KT4A 4FYVB 4RUAA 1RTIA 2HS0A 4IG0A 2I9SA 1T03B 4YOEA 2RNEA 2C2MB 4CQ1A 4JV5J 1QSLA 4B3OB 1WOSA 2FVCA 1OYEA 4UT4A 4ID5A 3MMCA 3C14A 2AZ3A 2WVEA 1ITPA 3GJRB 3QQCD 1JLCB 4LUBA 4OMFG 3EZOA 4NE9C 2B9YA 4FVCA 1S6OA 4YB1P 4W90B 3W2VA 1YHQS 2OO4A 5AJ3J 1Y5IB 2GQQA 2HRUA 2VKZG 3NCRA 2HBYB 1RHKB 3DYAB 3PRDA 4B3TJ 3I0RA 4A8YA 4ZITA 1YIJS 3ILLA 3K5LA 1NNDA 1N36J 2GO9A 4DV1J 5DM6Q 1XTZA 3PIOQ 1CJVB 2QLJB 4YDXA 3E8OA 5BXIA 2V50A 4K5SA 5E0OA 4DR6F 2R7WA 3L7UA 4AYBD 1UW9A 5IC6B 3RUBL 2B3TB 3MM7B 4OHWA 1DQAA 2N7CA 3THPA 1HKAA 1GNKA 1Q8BA 3KLEA 1JLEA 2IHR1 1W26A 4B9VA 2J0XA 3ADAC 1KVKA 2GCFA 2BW2A 1L5UA 3BKUA 3MUMP 1GH8A 3F56A 1TKTA 1NSPA 4E0DA 2ADCA 3MCOA 4XDDA 2A2DA 2FLPA 4RBTA 4WFNQ 1U1NA 3SV3A 3PACA 1DQ8A 5BR8J 4FP9A 2V2VA 2ZE2B 1HQUA 1A6LA 4BS2A 2GNKA 1C0UB 3FGVA 4HI2A 2MQLA 1FRJA 5KFBA 3TX8A 5H9FK 2GS8A 2JVOA 4OHXA 3T6BA 1WG5A
chains in the Genus database with same CATH topology
3PR4A 4FBUA 1DLOA 2IYGA 4UOCA 4K4VA 3HK2A 3VAHA 2H9ZA 3DLJA 1HYSA 2AJ1A 3PW4A 1TR0A 2R4FA 2GJIA 3LWLA 3IRWP 1HI0P 5GVQA 1C0TA 2FTRA 4KFBA 1SIWB 5K9FA 1RT3A 1SJ1A 2YQ3A 3EGWB 4TYAA 4JV5F 1F60B 1M5HA 1UVKA 2OP5A 5DGAA 3K5NA 5J2PB 2XMTA 4KHMA 2K3KA 5B0AA 4CIOA 3HZEA 5F8LA 3RB0A 1X0FA 1SL2A 3P96A 2HYIB 3Q2TC 3OLBA 1HWUA 2P6SA 3FNNA 4C8NA 1LWCB 5DM7Q 3QIPA 5IT4A 1K1QA 1ZM2A 4F4ZA 1ZPWX 4JI3F 4CTAA 4XPEA 1UJ6A 1BLUA 1RT7B 1VQLS 3DRPA 3FEZA 1QUVA 2EG1A 2HNZB 1Y5LB 2VBYA 2ZJQQ 4F8RA 2YNFA 2IBKA 2B5JA 2YKNB 3PO5A 2EFVA 2DCUB 2LU1A 3DOLA 2YWHA 2JLGA 3BJYA 2OSRA 1VHFA 3DU5A 4ILRA 1JKHA 1RTJA 3O5TB 4EBEA 1RYRA 2VONA 5A8WA 2ZH8A 3CXCR 4BHQA 5F0UA 5GAHI 1JX4A 2I5JB 4RW6A 3EPIA 4ICLB 5J2NB 5IS2A 2IC3B 2ROPA 4MKBA 1JLFB 3FVYA 4FNHA 4RW4A 5C5JA 1MWZA 3CVKA 2LKZA 4KBIA 4B3TF 1HBUA 4ZPAA 4P2SA 1RT2A 2DCLA 1VS3A 3TAMB 3I9V9 4TU9A 5KG3A 4HTJA 2OTLS 1HI1A 3PIPQ 2ZH1A 4ELTA 2ZHOA 2V2KA 3DXSX 3GFXA 1QAXA 1RISA 1IBKF 4C3KA 4ID8A 4MH8A 5KFFA 3GFZA 4DV7F 2QSFA 5KFXA 4IOBA 4J9OA 1OQ3A 2LLZA 2QE5A 2X1FA 3M2UA 4I2PA 3PVXA 4LF4F 3LOUA 4QCLA 4NLYA 2PI5A 3TA1A 2OPSA 3DHWC 3LUYA 5FIIA 2F8HA 2ZBIA 4Y34A 1M5VC 1DTTB 4Z2XA 1LW2A 1H2TZ 1SV5B 2IM3A 3HHLD 3LP1A 3T9ZA 5IZHA 5F8HA 3KHHA 2YKPA 4V19J 4AFFA 1UA0A 2Z2LA 2R7VA 5SUHA 3GSDA 1RQ0A 1TVRA 4Y2CA 3W7BA 2UV8G 1UEUA 5HMXA 4G3IA 2FJAB 4ETXA 2AJ4A 5HL7Q 1EETA 4URQU 3B4MA 1KLMB 2APOA 5HROB 1X4AA 2CIMA 1IKXB 2Y0SD 5KT7A 3OUYA 4B08A 1E6YB 4H4MA 3CO9A 1WI8A 2KVIA 2HWHA 2CPYA 3SCLE 4ZHRB 4F67A 3CIZA 4AXIA 2BQ3A 2ZOFA 1REVB 4IRDA 4F3MA 5K5MA 3NNHA 5A8KA 2RKIB 3RB3A 1VQ4S 1QTMA 3R5BA 4HLBA 2EVZA 3GV5B 3CMAS 2CKWA 1IKVA 4ZPVR 1BGXT 5BYRA 4BC9A 1JJ4A 1O51A 2QZ8A 1LK5A 4HI1A 3JSMA 2E9TA 4ZCLA 3LAKA 3K8WA 4Y28C 1Q78A 1JLBB 1SH0A 4IOCQ 2YNIA 4Q2MA 2KHCA 3DXBA 1NKEA 1OO0B 1YSJA 3CD0A 2RS2A 1M0SA 3PEHA 2ZNZA 5KFVA 4A8OA 3TW0A 3UPFA 3PR5B 1N56A 1D3WA 3C6UB 4RWXA 3TNVA 4DOZA 3PY8A 3TARA 2DIVA 4ZPCA 2E1RA 4WYWA 2LXFA 5D6GA 1VQ5S 4HTIA 3K59A 2ZHBA 3P49B 1M5OC 1A7GE 3DLBA 4F25A 1NK5A 4TQRA 4WYLA 2OFHX 1U45A 1HPZA 1RT5B 4C11A 2VC0A 4F26A 1CLFA 2PD1A 4JI4F 2ROEA 1K0VA 3K5OA 1ZOTA 3KTQA 5AXMA 5KFAA 2MKSA 2QA1A 4O3SA 2GV1A 1CQMA 4B9LA 4IDKA 5GAEU 3IS9A 1JJHA 5A8RB 3HI9A 4DBQA 2VPWB 3GV7B 3F73A 3T5HA 4EEYA 2PFFB 4R0EA 1VK8A 3OVAA 4YR2A 5D4PA 4OHZA 2FPHX 4C8MA 1PC5A 4ZDNA 2ZKTA 2YX1A 3OFHA 3PKYA 3KG4A 1U1QA 3OTOF 1D8ZA 2ZH5A 2XEXA 2F4VF 2QMWA 1YGYA 4C0BA 3MWBA 4TYBA 1UEVA 5E3RA 3DU6A 1HMVB 1C1BB 1LK7A 4C8ZA 4EUVA 2ACYA 3OL6A 1FEHA 3HVTA 1N48A 2GC8A 4EYIB 1T3OA 1YVFA 3OL9A 4B3OA 1QLNA 2VASA 3I55S 1FXDA 1NKBA 4NZ6A 5DG9A 3O1LA 4DG1B 1YJRA 5GAGI 2VUGA 1FD2A 4R0JA 2W8KA 1RDRA 2AJFE 1HWIA 3LANA 3K2YA 3WBZA 1VGYA 5M2UA 2W4CA 3NNAA 3MMAB 2XMWA 4JOUA 1HARA 1T94A 2M8DB 3V5RA 3PRBA 2VFTA 2CDQA 4DFPA 1YJUA 2R7QA 2HZCA 4NXNF 2V8GA 5AXKA 2DNOA 1VRTA 3HHLB 2P9EA 2ZFHA 2Q3PA 4TY8B 5KFMA 2IRUA 4FF3A 1TUVA 2K3IA 5JVGQ 5E3AA 3OVSA 2OPRA 3CJ5A 5I3QA 3OTDA 5L9XA 3PO4A 5HMWA 2UUTA 4ZS6A 3E01B 3POTB 1Z4UA 1HW9A 4LVNP 1FK9B 3KK2B 3THVA 1Q82T 3M9OB 3QGGA 1URNA 1D9DA 2F3JA 1A9NB 2XNRA 2M5YA 2XMMA 2GIRA 4PQUB 5M2RA 2BANA 1YBAA 4HKQA 4Q0BA 2QT7A 4TKTA 3W2WA 4MJKA 3LP0A 4XAKA 3MUTP 1E6VA 4RZRA 5F3ZA 2E1MC 2MZJA 2CQDA 3QWPA 1UJ4A 4A8MP 1HNZF 3M05A 2W9BB 2WOMA 2E9RX 1CC7A 3OVBA 3KLGB 2DHSA 1DTQA 1NJXA 2JEJA 2AJQA 1C1CB 2E1AA 2B9WA 2FHOB 2VC1A 2YTCA 2XSJB 2XMVA 3ZZPA 4F3QA 2A18A 1X5TA 5J2QB 2J9DA 5HMYA 2PN6A 3CPWR 2DGQA 2LYVA 1UFWA 5SZTA 3L09A 1G6BA 4FNIA 2PMZD 3QGPA 2LXUA 1RT4B 5KFTA 5KFCA 1VK3A 1UL3A 1U2FA 2DO4A 5EWEA 2AP6A 2BQUA 2OAUA 3PX6A 2BACA 2C3YA 2VPYB 3IO1A 4YY3F 4PXDA 1WHXA 2DHXA 4LQ3A 2UV8A 1HBOA 3OQ2A 4I7FA 1RYSA 4I2QB 2LDYA 2B7CB 4G1QA 1FRKA 1L3TA 4QW8A 3J7YI 3D54A 1QAJA 1S1UA 2DPJA 3MMBA 2GO8A 1C4CA 2CQ4A 1M5PC 2OMOA 4P7VA 3MM5B 2CFXA 2MGZB 2R9LA 2ZH3A 4RNMA 5F0WA 2OPQA 2CJQA 3MM7A 2N4DA 2WCXA 5J1PA 4YFUA 2XCAA 2XO7A 3VR1A 3MEKA 2XSFA 1KONA 3UDLA 2MKJA 2FJVA 3I96A 3MR5A 4C9DA 1IN0A 3MM9A 2C22A 3R5CA 2RMLA 2O3DA 3F41A 1DHMA 4ED7A 2QRRA 1IM4A 2MSTA 5F9LA 3BDPA 4PWUA 2OKQA 2EPIA 4CO3A 2YH0A 2NPIA 4NLSA 2GW8A 2RIJA 4NMLA 3HKZD 4CT8A 4DSKA 5BYSA 1T02A 3KK3B 2LA4A 3LALA 4WCEQ 4XO0A 1U1KA 5L9NA 3G96A 2ASJA 1HNXF 2VQFF 4KE5A 5H1SV 3MEEA 4A8SA 2K7KA 2W25A 1N5TA 1UKUA 2RDJA 3G6XA 5DETA 2OIHA 4NLDA 2BM1A 2MXYA 1H7WA 3RB4A 5F8IA 3NKYA 4KAIA 5L1JA 2E1CA 2E29A 2J0WA 3LAMA 3MR3A 1TV6B 3MOZA 5A2QY 1XNQF 2UP1A 3QZ7A 1S76D 3DRRB 4YP3A 1TKXB 5KFSA 1Q4RA 4B9NA 2G0CA 2CPEA 2D3ZA 4NLGA 2B9XA 3CUNA 1FO1A 3L3CA 3S6EA 4X4VA 3IGNA 2J0QD 1D9AA 2YNGA 2KB2A 4DR3F 4NLOA 5HLFB 1S0NA 4NZ7A 2V9WA 4PWDB 4ED1A 3NG8A 2ZE2A 1R0AB 4ECTA 4K4TA 1TL3A 3N4WA 3GG0A 1TZ0A 2IRYA 1R8CA 2WSEC 2PIIA 1Y5NB 3T19A 2L9NA 1OPIA 4DL4A 2Q6CA 2XHWA 3M8QA 1C0UA 1RJJA 5CH7B 3D0IE 1RTHB 2VPXB 3VQSA 4ZPDA 4RNNA 1GXUA 1IXKA 2JOQA 3BGRA 3V81B 2BR0A 2IFXA 3KLFB 4TLQA 1C2PA 5IXUA 2R2SA 2AWZA 1IBLF 5KFYA 3DC2A 1WF0A 2FHMA 4URGA 1RT1B 2OFGX 4MK8A 2Q1LA 3QGHA 4YR3A 1S6QA 3GE9A 3HZGA 3I4HX 3CMES 2GHPA 5I3UA 5HI7A 4QWEA 1Y00A 4IFYB 3GFYA 1X4CA 4Y65A 2MKIA 3JSYA 4FXDA 2HNDA 1GT8A 2RQCA 2YY3A 4IOAQ 2V9KA 2VFVA 4P7TA 3MPYA 2JEGA 2CJ9A 3NBPB 2K1RB 5J2PA 1U4BA 2DNRA 3AJ2A 2DISA 4DL3A 1SJFA 5CZVA 3K58A 1RI7A 4ECQA 3Q22A 1NJYA 3MUVP 3MM6B 2QA2A 1LWCA 4X64F 3CCQS 2GQCA 2KKHA 4ED2A 2PI4A 2GX8A 3QJLA 1VQ7S 3T3FA 4DJBA 3I87A 1TP7A 3C6TB 2HNZA 4MMOA 4OJ3A 2EWHA 2FJDB 2I0XA 4C8LA 1JLGA 4Q45A 3NCQA 2CQHA 2JFDA 2HW3A 4RW9A 4PPZA 3G8SA 4EZ6A 1ZTWA 2ZH2A 4OI4A 3CD5A 2BUNA 2ALZA 3VWSA 1QAIA 1VFJA 4RNOA 4OHVA 4ZA1A 3RU0A 4N56A 3R1LA 4TQSA 2C3OA 4YUDA 5D4NA 3KJVB 2I5JA 4CO0A 4ICLA 2HHPA 3TVKA 4GC6A 1H3DA 3T6JA 2DRBA 2JC0A 2KRRA 1JLFA 1U48A 2BJEA 4EGLA 2J76E 3OFGA 4I6AA 5H9EJ 4N77A 4OL8A 1TQLA 2BQRA 4F50A 3KOAA 1OSCA 5FD1A 4WFZA 1SL0A 1G1XA 4LQ9A 4MIWA 3RW6A 2DNHA 1UW4A 2MJUA 3OJSA 3HHLC 4Q5VA 3Q8SB 3CULA 2VA2A 1S1VB 3PV8A 3UCZP 2VG5A 1HQEB 3QWUA 5EDWA 4D3GA 5DLFA 4WK3A 4CI0B 2XLJA 1G7CB 1GQEA 4IH7A 4X4TA 3MR2A 3BZQA 4MKAA 2IMWP 3SMZA 1DTTA 2HHQA 1SV5A 4LJMA 5J1EA 3IGVA 3I56S 1MSWD 3QPIA 5A6PA 1KQKA 4QR2A 3J81Y 1CQNA 4FVMA 4R8UB 3CWJA 4B17A 4UY8T 3CJKB 4O4GB 4UW2A 3O6QA 2ZZMA 1X0PA 4TU7A 3T1HF 4MFBB 2BM0A 2Y1JA 3P6YC 3DLKA 5IT9Y 1YQHA 2EBEA 1G2EA 1KLMA 2PMHA 1IKXA 5DDQC 4JI8F 4ATNA 2NREA 4K0KF 4QQBA 1UVIA 3WDOA 1R6YA 2IRXA 3M9MB 3K57A 3FSIA 1E6YA 1HNVB 4O3RA 2KJWA 1AUDA 1TAUA 3IBWA 1Q79A 2LECA 1GXLA 1CG2A 4NZ0A 4WFXA 4D3HA 4ZHRA 1KD1T 5KT3A 3MURP 1SBRA 1VC0A 2NUUG 5L1KA 2LEAA 2ZJRQ 3SDEB 5F41A 5EGYA 1JB0C 2CQ2A 1N6QB 3G8TA 2FJWA 2RB7A 2R7RA 3PFOA 3RYLA 3BSNA 2IAJB 1S0MA 5IWAF 3WC0A 1Y7PA 1B0PA 1JLBA 2CJBA 4U7UK 5DJBA 4RU9A 3R1HA 4BDPA 2RRNA 3OHAA 3AQOA 5B7WA 1RT6B 2HRYA 2MSSA 1VQPS 2C28A 3BR8A 2A1BA 2BRKA 4OJGA 5KFDA 5GADU 4NCGB 3PW5A 4ERDA 4Q2LA 1S49A 4K4YA 3K7RA 2LA6A 5KFJA 4BC7A 1U1LA 1U26A 2DNPA 5E33A 1QJHA 4LFAF 3C6UA 4BWMA 3MGJA 2R7OA 2CPFA 5J2MB 2ILZA 2KN4A 4MYTA 4ZVGA 3CIMA 2L41A 3RR8A 3H98A 1BQXA 4ZPWR 2HVZA 3ENWA 2MB0B 3KLHB 4J9MA 1XMQF 2D41A 4NPOA 5KOXA 2O5DA 3TOQA 5AE1A 3JYTA 3MECB 1SIZA 3BSCA 3E3XA 5E3CA 3TUZC 4IKAA 4K4SA 1S6UA 5A8RA 2OJ3A 1P8GA 2DNNA 2SXLA 1YRUA 1X9SA 5T14A 3DOMA 1ROFA 4IH5A 1TAQA 4X65F 4ZP8A 2Z2MA 3TAQA 3FSYA 1MMDA 2R8KA 3MZIA 4DFKA 3PEJA 2A10A 3JSBA 3TYTA 2RSQA 2V8DA 2E5HA 2QSWA 4KT0C 1HMVA 5EX0A 1VQMS 3VAKA 4M8LA 3NL0A 2RJZA 2RQ4A 4A48A 4ZOSA 1Z2ZA 3NAHA 2OMLA 1PO6A 2EC0A 2KI2A 1Y3KA 3M4XA 1FDDA 4WU2A 3OTEA 3IAM9 2G9OA 1R8AA 4DL0C 3IRXB 2V8HA 1D1UA 4J9RA 5LSRA 4Q8FA 1FNXH 2B4PA 4HDGA 2ZBCA 3X3UA 3MDFA 3KHLA 2FGCA 1SH2A 4DG1A 2IJFA 1X9MA 3AA8A 2HHTA 2AX1A 2HGMA 4IR1A 1Z1ZA 4O3NA 3O44A 3BGLA 1MWYA 3MMAA 4WF9Q 3RRHA 1SJ4P 4ETZA 3V6DB 2A2CA 3P3DA 1VQNS 1S9GB 4KIAA 3HMJG 2CPHA 4NLQA 5B0DA 3BR9A 1JIHA 3H4DA 2HHSA 3HHLA 1SKWA 2XS5A 1RTIB 4TY8A 2YKMA 5DG7A 2XB2D 3BDEA 3FJ2A 4WFYA 2KXNB 1VBZA 3U1MA 1VQKS 2X1BA 1IKWB 2FUG9 1NK8A 3EZUA 4DSEA 4OJ1A 3E01A 2DGTA 2B6AB 2QLXA 3POTA 3U1LA 2DH7A 3VF0B 1FK9A 5GAHU 3FEYB 3KK2A 3PKMA 3EYZA 2HPUA 4PG4A 1U1PA 1X4HA 3O2IA 3V6JA 4PQUA 2WBRA 4IYQA 2HNYB 4UY85 2XZWA 4C0OC 1W25A 3T5KA 1U1MA 5LXYA 1XERA 2JH3A 2QYCA 4H4KC 2CPJA 2HFZA 4NLWA 3KMSA 1XR5A 2KYZA 3BSAA 5D4OA 3N5FA 1Q8LA 3ZC4A 5HP1B 3CCMS 1N5QA 3KLGA 2PE8A 1R7IA 5AJ3F 2IA0A 1RK8A 3SCIE 2D9PA 3IFEA 5KAKA 1WI6A 4OV1A 3ZZZA 4CO4A 4NLTA 1YG0A 1KVIA 4RUCA 5J2QA 1QAYA 1VBYA 1QE1B 2XWYA 4NLVA 1GAOA 3K5PA 2R2UA 3KG0A 5CA5A 1K73T 4KHRA 3QGIA 4M5DA 3C8YA 4ZVHA 3TO8A 1RT4A 2EFGA 3KNGA 1KRPA 3IR7B 1NH7A 3WX4A 3CCWA 1X9WA 2EBGA 3VAFA 4HHJA 4B3SF 3UNGC 5LXRA 1N36F 1HHSA 4MK7A 5FDLB 3SSRA 4U6PA 4DUYF 2DNMA 4I2QA 2L3MA 1UVMA 3N6MA 4RNHA 4DV1F 3MXHP 1B64A 1H6KX 1FERA 4USIA 5E7OB 2ERRA 5DQIA 3HVWA 2JVRA 1RGVA 3MM5A 2MGZA 1Q86T 2ZOGA 1LQ9A 1ZZFA 1MMLA 3FRYA 2M9KA 3AH6A 2NYIA