5IT9Y

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5it9Y00
5FLXY 3J80Y 5LL6d 3J81Y 5A2QY 3JAMY 5IT9Y 3J7A1
chains in the Genus database with same CATH superfamily
3PW7A 1LWCB 4G1QB 1OWXA 1FFWB 3G87A 3R7SB 3IA0A 3KYLA 1OS5A 1NHUA 1T9VA 1KEKA 2XI2A 3NAIA 3J7YI 2ZZTA 4GVBA 5FDLB 1XMQJ 1I5OB 4M5LA 1YI2S 1O0PA 2UUCJ 3NEKA 4NCAA 1BQMB 3N4WA 2ZC4A 4HACA 1T9UA 3TANA 1TL7B 1E6YA 3BSCA 2XLIA 1JMTA 2HVDA 2BBEA 3NG8A 3TA2A 4Z7CA 1HI0P 1REVB 3P5TL 3NGSA 4R0EA 3ZNJ1 4B9LA 3V5RA 3F41A 3BPSP 1FHTA 2J8SA 2FLNA 2OEKA 2ADCA 3CJ4A 1YQHA 3QLHB 4N56A 4FVCA 1TQLA 1D9DA 1SQGA 1U1OA 3BR8A 5KFIA 1RK8A 5HQLA 1NU4A 1VCTA 4V19X 3H5UA 2F8HA 3DGPB 3JAMU 4B3OA 4XDCA 2CZ9A 2YXLA 4M5MA 3W1YC 5M2PA 1RWVB 2ZHAA 3AA9A 2M5YA 2AV5A 4K4VA 3SFGA 2GV1A 3NOGA 5F3TA 2MKHA 2XTJP 4P2XA 2PT0A 3M2VA 1M5VC 4C6AA 1KRPA 3DHXA 5CA5A 4J9VA 3NGTA 4OYMA 3MFIA 2ZE2A 2O67A 1TKXB 3D66A 5CHCB 4A47A 3J81Y 4PQUB 1A0OB 2MLYA 4BHQA 3L09A 1RACB 1SIWB 2CDQA 4MT1A 3N6NA 2B5JA 5ETMA 2UUBF 2YNHA 2A0FB 4CNZA 1DLOA 3KHLA 5U47A 4ZPVR 3MAAB 3OFHA 4GVBB 3CO9A 4RNFA 4W98A 3W65A 4HACB 1QSYA 3MOZA 1E6YB 3EICA 1SJFA 4R8UA 2RDIA 4DR3J 1WJ9A 1T7PA 2MHEA 3D6TB 3CCSS 2IC3A 2RB7A 2VA3A 1RADB 4NRTA 1R27B 4WZQA 1VQ9S 3ZZPA 5MAOA 2EVZA 2QC3A 4BWMA 1LOUA 5D0HA 1MU2B 1RWMB 3ZXWA 4HKQA 1TAUA 1Y9OA 4X4PA 3AJDA 1PO6A 1FJGJ 2X1FA 5CXTA 2FHKA 4BWJA 1NDPA 4B3OB 1CPZA 2Q6CA 3MUVP 3AJ2A 4DQSA 3QYYA 4PYDA 1FRMA 4N47A 4ZN1A 2IRUA 3HM9A 2MJUA 3M2VB 4RNNA 2AIRB 2EKYA 3DGVA 2P5VA 2ZE2B 4NMXA 3D7SB 4P72A 4M95A 1LK7A 4B9VA 3C66A 5KG6A 2VJUA 3V6DA 1N32J 1TR0A 2B5JB 4URQU 4OIXA 2ASLA 2BKPA 2ILZA 3TUZC 1NH8A 1H2UX 1DLOB 3P96A 4RR5A 2OHDA 2NUHA 1RTZA 1U7LA 5CQGA 1WC4A 1I51B 2E1CA 3C16A 3D1HA 2AGPA 3UDLA 3CJ3A 3C46A 2C2MB 2I5JA 2EKNA 5DDOC 1UETA 4R8UB 5KFMA 3T6JA 4ZVGA 3HKZD 3ZZRA 2IC3B 4KBIA 1N33J 2CXEA 2OP5A 1H6KX 4DFJA 4ZCLA 3VVUA 2RE1A 2BV3A 1DAXA 1IUJA 1S77D 4UOFA 3D2WA 3LTOA 2Q1LA 3M8SA 4WK3A 1IQZA 2ZBIA 1WKLA 1VC5A 1MLAA 4GO5X 2VC0A 1V9OA 4URSA 3HHKA 2V4JB 5DZ7A 4C0OC 2VHGA 3MZIA 3LAKA 1LW0A 3LP1A 2MSTA 3U1MA 1S6UA 3DDKA 3BPDA 4C8MA 1VQKS 1D8ZA 5LXYA 5LMUF 2R7VA 4QIWD 3OTOF 4JI0F 3T1HF 2F4VF 3OL6A 4XTTA 2CJQA 4LT6A 2E5LF 1PG5B 2WHOA 3O1LA 2FVRA 3V6DB 4RUBA 3MCSA 2YWWA 2ZBPA 2OMOA 2NYIA 3M9OB 1ZAVA 4QJVA 3UDEA 1FRJA 5IV4A 2IJRA 2XS7A 1NK0A 4ECZA 3D67A 3C2PA 3C16B 2KKHA 2I5JB 1B64A 1XTZA 4KE5A 5KG1A 5LXRA 1B0PA 3D0IE 4KGVB 4LR7A 5KFJA 2RH3A 1S6QB 3Q2SC 4A8OA 1WOOA 1YRXA 1IBCB 2Q79A 2RRBA 2IRYA 4ILRA 1HBOA 1RT3B 4DV4J 1BXNA 2GMHA 3DFEA 2FHMA 2C2NA 2HPUA 4TY8A 2UVVA 3OD2A 4P73A 5F8IA 1JLGA 1S76D 3Q23A 2UXBJ 2YWHA 2MKJA 4DCPB 4IH7A 3AOCA 3FBCA 2Z2YB 2RQKA 2DHAA 2MKSA 3NKYA 4JYAJ 2VASA 1OQ3A 2CQIA 3CJRA 4J9OA 4UZCA 3BGUA 1IWGA 2KFYA 2QTWA 2IA0A 2QA2A 2ZC3A 3FCVA 1LW0B 1N8RT 1U24A 3KTQA 1Q1KA 3LP1B 2GHWA 3D3CJ 2ZZMA 3J7A1 3QGHA 1XMBA 4OYAA 5T7LA 1BLUA 2GJ2A 1CQMA 3EUNA 1XR6A 1GT8A 1RT7A 3GWCA 2CQ1A 4CLWA 1Q8LA 4YHHF 2CPIA 1I1GA 5KFGA 2D41A 4L76A 4HHUA 4KQZA 4N8OA 4K2XA 2ATLA 2MZQA 3JS9A 4IQMA 4DZDA 1JXEA 3CJ2A 3R3TA 3VGSA 4EYHB 4TU9A 3IG1A 3ZTSA 3J7YU 4DL5A 2HSEB 5F0WA 4KAIA 2E29A 4C3LA 1I94J 1PGZA 4FYYB 1Q79A 2DGOA 2B3TB 3AD8C 5A2QU 3VTIA 4TLQA 3OTBA 1HBOB 2QG9B 4WFZA 2FVPA 2KYXA 2DHGA 1DQAA 4TY8B 1RTDA 1FEEA 1HD0A 4LBIA 4DL4A 1JLGB 2DTJA 4WXWA 3UE2A 2WVBA 5THWA 2VBYA 1WOPA 4O0IA 1XERA 3DLGA 1FFGB 4LSNA 1EHWA 5EWGA 2HFNA 4YMEA 3NMAA 3GIJA 1KC8T 3GIMA 2ZHOA 5B0EA 1KWMA 3E3XA 1KN6A 4MKYA 4EUVA 1GQEA 3OL9A 3RUBL 1WDTA 3OR1B 2V0NA 5ETVA 2V63A 3SI8A 4ED5A 2KJVA 5KFHA 4B02A 4R5PA 3R2DJ 1P6TA 5T7LB 2C42A 2AHOB 3W2VA 2G0JA 1RT7B 5B7WA 4HH0A 5F8HA 3PDNA 1T9YA 1X4FA 2PFFB 5C2CA 4DV6F 1X31C 3PYDA 2H1YA 2FJAB 3UNGC 5HJYA 2V8GA 1PYSB 1NSAA 5CYJA 3IG1B 3W64A 1AUDA 5B0CA 2WBMA 4J9KA 4FS2A 4LRFA 2HRUA 9ATCB 3RB4A 1U2FA 3QT5A 1F9HA 2DEJA 2LYVA 2KT2A 4YDXA 4RZRA 3PX6A 3HVRA 3AY0A 2R8IA 2HRTA 3EVOA 1RTDB 3HVTA 4PAAA 4KH1B 1V3SA 5EWEA 3DLGB 1RE1B 4LSNB 2FPHX 3BV8A 2CQ3A 4QU6A 2NPFA 1S0MA 1URRA 5E33A 5DZ6A 4LF7J 4U6PA 5IOLA 2LKZA 1FRKA 1VQ4S 4K59A 3A3OB 4PXBA 1HWIA 2OPQA 1REGX 2FD2A 2KN4A 3J80U 4Y2KA 1RTIA 4KHPF 2U1AA 3B78A 3TWZA 1EARA 4R5PB 1HMVA 3W2VB 1HNIB 4WXOA 1VQ8S 2VPZB 3TNVA 2MQQA 2AEFA 2VONA 4M5DA 3CB4A 4PUOB 2Z30B 2F8MA 2HW3A 4A8WA 2D69A 2FC9A 1HL6A 2FJXA 1GX6A 2C2OB 5ADZA 4PEOA 4Q5VA 3G86A 3WHIA 4IDKA 2A6OA 1R89A 5KFNA 4PG4A 2BOPA 2VB6A 1CJVA 1TKDA 4B9NA 2ZVSA 1HNXF 4C2MA 2V8PA 3TA0A 2W9CA 4Q8FA 2VQEF 3G6XA 3HSJA 4FPIA 4CP5A 3NBPA 3KNGA 2ZM6J 3PKYA 3CDBA 2HNDA 2EFNA 4O4RA 4P10A 2OEMA 3OFFA 3IRWP 2DHSA 1S4FA 4FXVA 3AQPA 1QAXA 4ZVFA 1JJ4A 2PN6A 2DNYA 1HR0F 3J7Z5 2HFSA 1FD2A 4N41A 4KC5A 2CJ9A 3RZAA 3TZYA 2QA4S 4C8OA 3HVTB 2KYZA 2LCWA 4C9DA 5F9NA 3PHEA 1IBKJ 1B4SA 2B7BB 3GIRA 3PO5A 3F0NA 4IH6A 2DR8A 1Z1ZA 5M2UA 2DH8A 4CYUA 3IGNA 2OPQB 4A48A 4UT4A 1UPPA 2DXFA 1RTIB 4TVAB 1VQMS 3BYRA 4X4QA 4F26A 3W5XA 5E3QA 1UL3A 1JK9B 4PKDB 3KDNA 3NGUA 3PW2A 2JC1A 3SMZA 2N4DA 4M5DB 1X60A 5IT0A 2DGTA 3IRXA 3EXYA 4ZHRA 1OIAA 2FJEB 5CYQA 4LREA 3SIPB 4OI3A 1PYOB 4ZVSB 2HBQB 3JXOA 4IDKB 3Q86A 3FBFA 2E7WA 3TQEA 1SJ1A 2DH9A 2E9TA 3KG0A 1M5PC 2BE2A 3R5DA 2W9CB 4F02A 2BRKA 4K4ZA 2PA8D 1F9EB 1AFIA 3NBPB 2FHJD 3A3PB 4X64F 3SCKE 3R7BB 4B3TJ 4OV6A 4UOHA 3CCVS 3EMTA 1LXJA 2FJWA 4LJMA 1HBMB 5DDRC 2MEWA 2IVYA 1SKWA 5D4NA 1SC4B 1FCAA 2W7PA 1BQXA 3MR2A 2UVWA 4LRBA 3EPIA 2CPXA 3RB3A 3Q2TC 1WC6A 1S12A 4J9NA 1M5OC 3IO1A 4DR7J 5E3PA 4GKKF 4LF8J 3KNAA 3E8OA 3EGWB 1FF2A 1VIXA 3JAMY 4URGA 2DISA 2H54B 2M2BA 4EBCA 4JB8B 5IWAF 4CYUB 2HWIA 2K1RA 1LEOA 5DG7A 5GAHI 2GIFA 3HD2A 2SXLA 4TXSA 3CT9A 2GHVC 1FNMA 2J9DE 2J0XA 4NLVA 2OPSA 3IRXB 3Q8SB 3M8YA 1R8CA 3DM2A 1XMOF 4Q43A 5CYQB 2NZ4A 4OZ2A 5K8OA 2UXDF 4KGXB 4KT0C 3W2WA 4IG0A 1ZM4A 3SDEA 3Q22A 4C0HA 2CA9A 1S1VA 2BOAA 1FFSB 4DPUA 2BE2B 1ZBTA 3CJSA 2DPIA 2M8DB 4DR2J 1YJNS 4FYWB 3P3DA 5KFUA 2DVIA 1VLOA 2ABYA 1MMLA 2HS0A 3OHAA 4WIIA 3BKUA 1H7WA 3BO2A 4FBTA 2JVRA 3GONA 3VQTA 2YKQA 2BJ8A 4ED8A 4E98A 3EE3A 1FI4A 4RNMA 2RHSB 2ZUAA 3GYNA 2MKYA 2HHHJ 1D9AA 3FKBA 3KUHA 4ATNA 1RLCL 4KJIA 5I3QA 3VHQA 5CYMA 2F3JA 3VAHA 2G0CA 3MM8A 2QN6B 1SUQA 1BWVA 1TKZA 4JI5F 2JZ5A 3CCMS 4JI6J 2EFOA 3GFZA 3TJ9A 4IUFA 4JI7F 4XPCA 3A8IA 2LEAA 4CLPA 1QY7A 2K1RB 2HQ3A 4JP8A 3FNNA 1PJ6A 2WTFA 2MY7A 1N34J 4UY8T 2B9XA 1IR1A 4QWAA 1YJVA 4G6VB 4YB6A 1U1RA 5KFKA 1IJEB 3MD1A 4DG1A 4NZ0A 2OPSB 3DM2B 1Q78A 4LF1A 4ES1A 2IVMA 3KFWX 4Y2CA 3W2WB 3PHTA 2LA6A 4EWTA 1N5TA 1NJIT 4WKYA 3IM8A 2GIRA 3SDEB 3UVJB 3JQMA 1S1VB 2MY8A 3DRPA 3THPA 1XNQJ 1QE1A 3QQCD 4G3IA 2O5DA 1SJQA 3K5LA 4LF4F 3US5A 5HATA 4DPTA 4GKJF 2B0GA 1UEKA 2ZWOA 2IRXA 2FQQB 4AL7A 4PCQA 3GTYX 1YJ9S 2HWTA 2FZCB 1NSQA 1X4CA 4G65A 3MM7A 1IBLJ 4IOAQ 2DNPA 1EIYB 1KFSA 4ECUA 1H72C 5G4DA 3JTNA 4FF3A 2GJIA 2V2QA 3LP2A 2DO0A 1A6LA 3OFEA 5KG4A 3CJKB 4NL5A 2CZ4A 1CLFA 5CYMB 3VAJA 4M5JA 4JI4J 1SUQB 4NLPA 1TKZB 2QL7B 3M8QB 4UY85 1YLXA 2LEBA 1UVLA 2VQFF 2VKZG 2JOQA 2A6MA 3I55S 2QSFA 3KJQB 2UUAJ 4NLSA 1QSLA 5I42A 3R5AA 3GB0A 2P6SA 1TKTA 4ZPAA 2BW7A 3IBWA 2V50A 4WE1A 3AXKA 1RAHB 1ZYQA 2C1EB 2AEMA 5DRKA 1FTRA 3NCPA 2DR5A 2FLOA 1YTYA 3T9ZA 1T03B 5HBMA 2HK3A 2QO3A 4LF9F 2FJBB 2F7VA 3DRPB 2VFUA 4AXIA 1RT2B 1S7IA 1RWNB 1QE1B 4U9RA 4DU7A 1L5UA 2V8DA 3PW5A 1QVFR 5IC4B 3A1YG 2YNFB 3EXCX 4JUZA 5E7OB 2RMLA 4NCGA 2OELA 1DTTA 2XBPA 3VV2B 3X3UA 1GMUA 4MKAA 4DUTA 2D3ZA 3QT6A 3LP2B 4CLZA 2W2MP 4ZPTR 1KOHA 2GGPA 2L9DA 4LRAA 1Y00A 2DNZA 1LV5A 3C15A 3MAHA 5J1EB 3HHNB 1FXLA 4CM2A 4X65F 3PIOQ 4ZLLA 1JXVA 2IM0A 2HHTA 3WBZA 4DR1J 4B3MJ 2XMVA 5KT3A 1S1UA 5I42B 3HZGA 4JI3J 3D6FB 1TKTB 3VZIA 3ZTRA 5CH7B 2WONA 2EC0A 4WE1B 1HFEL 2DR9A 2P8IA 3MM5A 1QAIA 2CQPA 3PX4A 1FVSA 4WPAA 5H9FK 2DD8S 1O51A 3CO0P 4ZLJA 3V81A 5HBMB 3PTWA 1M1GA 1FE0A 1U8WA 2FGOA 3MPVA 4C97A 4N76A 1U6FA 3L3CA 2CQ2A 4NLXA 3M05A 4A8XA 4Q8EA 2VD3A 4JI2J 4C8NA 1WACA 2YX7A 5M2RA 5KOWA 5KTQA 3I31A 1FK9A 4DX7A 1GX5A 5J2MA 3MECA 1UAWA 3BGFA 1SJRA 2WRMA 4NCGB 2KHCA 2BW2A 1GAOA 1QUVA 3LWLA 4LFCJ 5A8WA 3HF5A 2OH2A 4DSJA 1DY3A 2GGPB 3NS6A 4F3QA 3VGUA 3NNCA 3MCNA 1MROA 4EO6A 4XPEA 3CXCR 3C15B 2C3MA 1RB0A 1OY9A 4X62J 3CC7S 3HHEA 2XMKA 3PFOA 3ZNUA 1NZ8A 2BMBA 1VDHA 2QLJB 5LSOA 1S1UB 5DQIA 1JNZB 3DLJA 4K4YA 1UWBB 4H4MA 3TAMA 5DGAA 5D3GA 2WONB 1FX4A 4RW4A 4CH7A 1X4DA 1FJCA 3GCXP 2MZSA 3MM5B 3SBMA 1NPPA 3B82A 3DOLA 4Q2MA 2XSJA 2UUWA 4DUZJ 3DMJB 3PRVA 3L7OA 1ULRA 1WEYA 1GXTA 3L4BC 2FJVA 5B0FA 3V81B 3K0JA 2E5GA 4L3NA 1Y5NB 2PGCA 1AUSL 2KG0A 4MKVA 2X3DA 2A3JA 2V8HA 1NHKL 1VGYA 1T02A 4HLBA 1RTHB 5HP1A 1G7CB 2L08A 4ZITA 5IT9U 3CUNA 3FEZA 5DLFA 2IY5B 1LWEA 4B08A 1H2VZ 1FK9B 1K0TA 4LBHA 1HKAA 3E2EA 3MECB 4NMLA 2ATCB 1VQSA 1Q7LB 3A8EA 4H4KC 2Q66A 3I87A 8RUCA 1EQ0A 1JJCB 2AYEA 5A8WB 1GFWB 2RRAA 3EVWA 4TQSA 1SKUB 1MROB 4ZVHA 3R1LA 2WK4A 4KB7A 2ZH8A 2HVHA 5CCLA 3CGIA 1CVJA 4J7CA 4ITSA 1KR4A 1Q16B 1V5IB 1G4CA 2Y1IA 1B3TA 3GV5B 1R7IA 3J80Y 1NK6A 1WC5A 1KLNA 3OVAA 4H4MB 4FS1A 3TAMB 4YY3J 2Q3PA 5BR8F 1FRLA 1SC6A 4RW4B 1NRKA 1YBUA 2ERRA 3CPWR 1WC3A 2A10A 2QL5B 3QWPA 3DOLB 2CRLA 2XSJB 4M5NA 5FLXU 4MYUA 1S79A 2M3DA 4DV0F 1NMEB 3QNWB 2YY3A 3A8KA 2R8GA 2HG4A 3MCMA 1CS4B 1N6QA 5DO2A 1JLCA 2ZH2A 2OSQA 2RAQA 3Q0AA 3WX4A 2YKNA 3SSQA 3UDVA 4PRFA 4OHYA 4JOUA 5HP1B 2IVFB 3LAMA 1SL2A 2AGOA 4X66F 2VDIA 3ILJA 1RT5A 1OYDA 4OX7A 1HBNB 4XO0A 1J5EF 3THTA 1H74A 4ZIWA 3ET6A 4U8VA 2D74B 1MW7A 2KZZA 3PEHA 2KTQA 4QPTA 3W9JA 4ZMMA 1WNEA 1B70B 1YRTA 4DMZA 1R43A 1X9WA 3CJ0A 2VKRA 2AD9A 2DCLA 3CD6S 2XQCA 2YVSA 1F1BB 4TLRA 2BABA 4ICLA 5C24B 1WF2A 2G9OA 3MHYA 1ZA1B 4IFVA 3T19A 3W62A 5D4PA 1IQTA 1MMNA 2IDLA 2W8LA 3DN9A 1WHVA 3OQ2A 2BJ1A 3QRRA 3ITHA 1XMQF 1CC8A 2UUCF 3DLHA 2HHVA 4F7VA 4ECXA 1PSDA 1Y4ZB 4L3KA 3KK2B 2HZAA 1YIJS 2C2RA 1WELA 5KFOA 3RB6A 2VA2A 3I6PA 5H9EK 1RT5B 2CPZA 1N48A 1SQFA 1EETA 4OMFG 3DI6A 3MUTP 4LSZB 1QVGR 1J27A 2QFJA 5AXKA 3QWUA 4P2SA 2OPPA 3K5PA 4USIA 3M8ZA 5JJBA 3DDNA 1V6HA 3H59A 2Q6BA 2R7RA 5E3RA 2D9OA 4O3NA 1R8HA 3T5HA 2N4CA 5HL7Q 4K8RA 2AWZA 3WQPA 3BBBA 4MAKA 2HHUA 4ZVRB 1SPBP 3R8YA 5EHHA 5JUMA 1WKKA 3GIKA 1HYSB 2B6AB 1X4GA 1JKHA 4IFVB 4LIWA 4RW6B 1R8AA 1ROFA 3NRBA 1F2HA 1HHSA 2IJNA 4NCBA 3TEHB 4Z37A 1MWZA 3R5BA 1YZ6A 2DGVA 2QL9B 2HS4A 1FT8A 4QYZK 2ZDOA 5C25A 2W7AA 4QCLA 3NNAA 4UW2A 3S8SA 3ITHB 2WOMA 4LBPA 1KS2A 3OW2R 3WIVA 2VG7B 3VAIA 4YB7A 3H2UB 1S1WB 2ASYA 1U1LA 4B17A 3UW1A 1WG1A 5L1JA 2G2OA 5DM6Q 1B7FA 3JYTB 4DR4J 4DR3F 5DDPC 4UF4A 3KHHA 1XBWA 4FYDA 3PCOB 2F63A 5D6GA 3LALA 3PY8A 4OZJA 2GQCA 4Y28C 1V3RA 2W7OA 2ZVIA 4DPYA 1S7HA 2ZH9A 1TVRB 2B4UA 1EETB 4OHVA 1GTHA 1WHYA 3E01A 5L1KA 1UTAA 3CJ8A 5J2NA 3OPKA 2OPPB 1ELOA 1HQ2A 1FJGF 2FHJA 1KQGB 1TK8A 4WP3A 3H7HB 4DUYF 3N79A 2W24A 3R1HA 2XGQA 4NX9A 3R5GA 4ELTA 1PAEX 3HMJG 4WTYA 2DGSA 3PJXA 2XLJA 2R7SA 1F60B 2V6AA 5DS7A 2J9CA 1AT1B 4BS2A 4ID5B 1JKHB 4NYZA 4D3HA 3K8WA 2QFIA 4PPDA 3NNHA 4DR6J 1N32F 3H0PA 3OVSA 2BZ2A 4I0WA 3MMJA 1TAQA 2R8KA 3IFEA 3OTOJ 4IRKA 3IC1A 5C25B 1NKCA 1FXDA 2WOMB 5IM0A 1Q5YA 3TQ1A 3UR3C 4DV7J 4I2QB 2XC9A 4FYXB 4FNIA 1U48A 1BQNA 4ID8A 1M0SA 2CQGA 3O6QA 2ZUGA 4X84A 2R7TA 4RW7B 2NUUG 1U09A 3KKFA 3PRDA 1N33F 4ES3A 3N28A 3K8VA 1NCLA 1EX8A 1IN0A 2ROEA 2OFHX 4QW8A 3GILA 3O3LA 5HLFA 3E01B 4ECWA 5J2NB 4OJHA 1U26A 3U1LA 2B4OA 1OY8A 3CC4S 2CG4A 1T9TA 5B0DA 2ZBRA 2MB0B 2Z57B 4KPCA 6AT1B 2I0XA 1BMQB 1GTEA 1YKWA 1S0OA 3JSYA 2EBEA 1TUGB 2E7VA 1ZM9A 4E8UA 4NZ7A 4KHMA 1WUUA 2HWHA 2M70A 1S9EA 4CLSA 1KKHA 2MQPA 3MMCA 2J6SA 1W7WA 2KXHA 4OLOA 3MCOA 2IAJA 1CJTA 4IO1A 5D0EA 4K2JA 5L8RC 2DRAA 1U2RA 1UJ5A 3AB4B 2HHPA 1SJ4P 1HHTP 2EC2A 2VFSA 1VRUA 2NXUA 5IM0B 1RTJA 3WDOA 2ZZNA 1LFPA 4X4NA 2AT1B 1CULA 1RP5A 3PYGA 3PKMA 3D1QA 2PDAA 3AT1B 1BQNB 1X0PA 1T11A 5FJ4A 4HH1A 1N4LA 3B4DA 4NA2A 1L3VA 4DU8A 3ISND 1RWWB 4RPFA 1TL1A 1H38A 4DV4F 4RUHA 2IA6A 4Y65A 4IR9A 3EM1A 1Y3KA 3O44A 3ISZA 3CDUA 2IBKA 4J5OA 4WU2A 1UA0A 4HL9A 1OPZA 5F8MA 2NZCA 4FKXA 3AJ1A 2L3MA 3K89A 2OTJS 1P8GA 1WI6A 5HLFB 3S01A 2DEIA 4JYAF 2NREA 2CPJA 1C1CA 3O2IA 3BS9A 2F9DA 2JFKA 2JSXA 3PX0A 4I56A 4U8YA 4ETZA 1I3OB 1Q8IA 4WTOB 1S97A 4BDPA 1XEZA 3AQOA 4FXWA 2ZOFA 4KKOA 4UQGA 2DR6A 2RKIB 2KH9A 3MPYA 1NB7A 4EBDA 3MMCB 2WB1D 4FN5A 4LR8A 1RHUB 4MK8A 4I2PA 2DY1A 4F2SA 3KLHA 1K1SA 1D9FA 1FJEB 5ETPA 4CH1A 1WD6A 5KG0A 2ZBQA 1FE4A 1RWXB 4A8KA 1RTJB 2CNKB 2EFVA 2N82B 2HIQA 5KFQA 1SL1A 1WTBA 1I94F 1V5VA 3KLEA 1S9FA 2JEIA 1NPKA 1LWFA 2XZTB 3J7AN 1TL1B 5EWFA 3PEJA 3ENVA 2N7CA 2WVFA 5C2GA 4OLPA 1IKWA 1BE4A 1SKSA 1HNWJ 1RBOB 1RI7A 2CJBA 2H5JB 1XWLA 2ZH6A 2BRLA 1RGVA 7FD1A 3RAXA 3BGLA 1C1CB 3CC2S 1LNQA 2GFFA 1VLYA 2IM2A 2XEXA 1H3DA 1L3KA 3AA8A 4QR0A 2NSBA 4ELVA 1FDNA 2EPIA 3M9NB 4NLGA 5BYRA 4USVA 4RW9A 2KL8A 1HD1A 4NLYA 3TJAA 4NA3A 1TFYA 1NPRA 4C7QA 1HA1A 3PW4A 3CULA 4OJ3A 3P6YC 4AE5A 1UW4A 4DSLA 3N6LA 2KG1A 2DNMA 4LFAJ 3TUPA 2IHR1 4I2PB 1Q5VA 2Y0BB 3CCZA 4CZCA 1S72S 1TMMA 4MIAA 2HHSA 2L41A 2GCFA 1KLMA 4GC6A 1RT1A 3GU0A 1U1NA 2GZOA 4PPZA 3HHLA 2VOOA 1RU1A 4BC9A 1S1TA 2MKCA 3DRSA 4DS4A 5SZTA 3UN3A 3K59A 1MWQA 2XS5A 3KLEB 1RYRA 4ZJLA 1LWFB 4OYIA 3ZFVA 5HQMA 1HNXJ 5KG2A 4JI1F 4PWDA 2XS2A 2RQMA 3T41A 1F9FA 1U1PA 1IKWB 4RBTA 1G6BA 4KY3A 5F41A 5IT9Y 4U67Q 2MZRA 1HPZB 3VR1A 2MQ8A 1RAGB 2QLXA 3M2UA 3M30A 2R9LA 2YWFA 4QWEA 4A8YA 5KFTA 1U4BA 4DV2F 1PC5A 3HD1A 4LF7F 4DX8H 1TZ0A 3DRRA 2OLWA 1DRZA 2RDDA 4MIBA 4J9SA 2APOA 5KFWA 4RW9B 3PACA 3RR8A 2MLXA 2DKOB 5HVHA 3VF0B 3RRHA 3UWTA 4P75A 2XGPA 2IFXA 3D1OA 4P7VA 3GP9A 3F56A 2W4CA 4ZLPA 2FVCA 4RNHA 3GFXA 4DWIA 2QMUB 2F65A 4EU0A 1P9YA 1R0AB 1U1KA 1SKRA 3T5LA 2YBVA 1RT1B 1P9QC 3H5SA 1P27B 3HHLB 2ZH3A 4PG6A 5FLXY 4WIQA 2GA7A 1XR7A 4KV8B 2K8GA 1S1TB 5DM7Q 2BKOA 2G4BA 1VQNS 1WI8A 3NL0A 1T05B 4C98A 3C6TA 2ZM6F 1FKOA 1KVJA 2LECA 3QGIA 1VQPS 1UWAA 1IXKA 2XM3A 7AT1B 3EWGA 2DNOA 1TUVA 2OAUA 2BM1A 4E0DA 3M30B 1CJUA 1IBKF 3DRYA 5D0RA 4NEYA 3OJUA 1TTHB 3AOBA 4JV1A 1RISA 1VOMA 4ALZA 4K4WA 1S9GA 1DQ8A 3FFIA 2KO1A 1UZDA 2B7CB 1AYEA 4DPOA 2WAQD 1HW9A 1K44A 4DR5J 3FJ2A 4DSIA 4LF5F 2J9DA 2C3OA 3D0GE 3NAHA 1RDRA 1UFWA 4O44A 4A46A 3J81U 2U2FA 1FNOA 5KFVA 1MWYA 4JV5J 2BR0A 4HVZA 3U1NA 1RA6A 3I9ZA 1L3SA 3P49B 2FHOB 1TV6A 4X4SA 3C14A 4DI6A 2E5IA 1NK8A 2CQ0A 4R0JA 1XMOJ 2QGFB 3PIPQ 1AB8A 4WCEQ 1UEVA 2MPUA 3CD0A 2JHEA 4DV3J 4CNYA 3EDRB 3C6TB 1FKOB 1WORA 2JEFA 3POTA 4DL3A 4ED3A 4A8QA 4B3TF 1DJ0A 5CD4A 8AT1B 2KRRA 3TVKA 2PD1A 1TUWA 4QYRA 4M8LA 2WSEC 1FVQA 5JMNA 3VAMA 2UU9J 2YNHB 1SXLA 2OD6A 1M1KT 5K9FA 1CJUB 2QIFA 4DR7F 5LJ5Y 4LF8F 2VPXB 4B3SF 3VQSA 1YGYA 1S9GB 3OV7A 2J0QD 4IFYA 2KVIA 3ZC4A 3BSNA 2IIHA 3GJRB 4ERDA 3G9CA 4JI5J 1U1QA 2NPIA 1I6JA 4TQRA 2R7WA 4DQQA 2X1AA 5DG8A 4RNOA 4O44B 4WFBQ 3T1YJ 3HXMA 4O3QA 3KK1A 3MMAA 1F0XA 3OXGA 4RW8A 1U0SA 1FXRA 2HAIA 1TV6B 2J7UA 5KFSA 1UW9A 2HK2A 4PABA 4NZ6A 3LQVA 3HX9A 3QIPA 4ED6A 3EGVA 3NWGA 4OZNA 1R8BA 2P6TA 4DR2F 1NDCA 2J0SD 5F8JA 3H25A 1F5CA 3WC2A 3T3FA 4ECTA 4HT5A 5KFBA 1VIOA 2Z2ZA 4B9SA 5IT4A 3KJNB 1KQSR 3UR0A 3V6KA 1TL3A 4HT7A 1VQLS 1DHMA 1UFLA 2Y1JA 2HHHF 3MR7A 3OVBA 5K5MA 3MM6A 2CPEA 2CPFA 5KFEA 2B43A 3GE9A 4JI6F 2XMAA 5D4LA 4U7UK 2BANA 1F3VA 5IFMA 5JVHQ 4IFYB 2RS2A 5DGBA 4NLWA 3JTPA 2Z58B 1N34F 2MDAA 1U45A 1S6OA 1HI1A 3ENAA 2H9ZA 3T5JA 1DTQA 2VQFJ 3FGVA 3J81j 4J9RA 1Q0NA 3GJTB 1UCNA 1N5YA 2HQFA 2YX1A 2NXNA 3GSIA 2R7QA 5B09A 2KXNB 3KK1B 3K2YA 3MMAB 2HFZA 3M6VA 2DIVA 5LL6d 1ACMB 5I3UA 1GH8A 2E44A 1VYAA 3RGIA 3WIUA 2BM0A 3QIPB 5AJ3J 3TZZA 1XNQF 2AQ4A 1F5BA 2KI2A 4USUA 2J6TA 2LQ5A 1ZAWA 2MQLA 4PWWA 3BDPA 2XMMA 2EK1A 5E0OA 4LVOP 4N7TA 4LF9J 2ACYA 3BN4A 4CCHA 5D8HB 2ALYB 3MFHA 2F1FA 3CEDA 1YJ7A 3MEGA 4DFKA 5I4MA 2GQ2A 3CE8A 2K06A 3ICLA 3D9BA 1Y10A 5J2PA 3MURP 2FDNA 3IXQA 3QZ7A 2XWXA 1N36J 2EFQA 3RAQA 2KFNA 2DB1A 3CJQA 5H1SV 2VBWA 1KTVA 2IPOB 3MM6B 3K5MA 1MN7A 4KHRA 2JLGA 2CG8A 4JI4F 3GPAA 5EGYA 1C0UA 2ZITA 2OPRA 4M5KA 3G8TA 2ZDPA 1WG5A 2BANB 4USWA 4DV1J 3W9IA 2HMIA 2JL9A 3MPWA 1RCXB 1KDNA 1N52B 2XY5A 4I69A 1YK9A 5C5JA 5BJRA 4X65J 1DTQB 4IG3A 4ECVA 4FZVA 2YKMA 3UNYA 3ZTOA 2XY7A 1RAJA 3KHGA 4TKTA 4NI2A 3RBXA 2E66A 2H4YB 1UA1A 1RHJB 2MZTA 4LQ9A 1GMWD 1X4EA 4ECSA 2DYAA 4UUXA 4EMDA 3HHLC 1DQ9A 2YTCA 2FYXA 3HT3A 1F5AA 3CDAA 5KT6A 3R9LA 1XK8A 1PCAA 3W9HA 5I3UB 5GAEI 2OEJA 4KPYA 2B9WA 4AXJA 3MMBA 4U7CA 2L9WA 2AYGA 4NLUA 3G8QA 4D3GA 2KHDA 2GAHC 4C0BA 1GK8A 4G1PA 2BDPA 2PI4A 3KLGA 4I68A 2EG2A 1UVIA 2AU0A 1X5TA 1S48A 4ZA1A 1RHQB 4PXCA 5J2PB 1KTQA 1T3NA 3L95X 2EXUA 5ETQA 1AZSA 2BXJA 1F3FA 4NXMJ 2C2KB 3VAGA 3EX7B 3NY0A 5KFPA 3FVYA 4RWWA 2OPRB 5F8GA 4K4XA 5ETRA 3UO0A 1ZM3A 2HMIB 3QATA 3H8YA 4B3MF 3MEDA 8ATCB 3NCRA 1H2TZ 4I6WA 3ZZZA 1R8PA 3ENWA 4IG3B 4ETXA 2G1DA 1FDAA 4NI2B 5ETOA 2FLLA 2ROPA 3N01A 2LA4A 3J7ZT 1EAYC 3CDEA 2YQ0A 1IKYA 2LQBA 3D54A 1C1BA 1CEZA 3FC9A 1JLEA 4ECYA 5LSLA 4ZVUB 1NK9A 3Q89A 3MMBB 1K9MT 1BWEA 2DXEA 3A8JA 3SXLA 3TRGA 1IM6A 1XIQA 4JI2F 1VMBA 4KFBA 5IXUA 2R8HA 3QZ8A 5AE1A 2J7KA 3KLGB 2NCKL 4AUKA 1PILA 3EDQB 4ZPBA 1K73T 1IKVA 2JLFA 2MTLA 4MMOA 3CCRS 5K8NA 4K50A 2Z0GA 3TUJC 4IQXA 1R31A 1T3OA 1KQFB 2HS3A 4L75A 2N7YA 2P9CA 3ENQA 4CWBA 4C8LA 1VRTA 2FIUA 2VG6A 2WB4A 1K8AT 1U8SA 3VAKA 4DSFA 1AZSB 2DXDA 2W01A 4DL6A 1ZZFA 2NXCA 1VRQC 3LP0A 2P2CB 3G71S 3V4MA 2DGWA 5L9XA 1WEXA 3EPGA 2K7JA 2QEXS 1K47A 2V4QA 4X62F 4F25A 2B4PA 2AKWB 2Z56B 1RKJA 4Z7YA 2IJFA 2HQCA 3MEDB 3QO9A 1Q4RA 3Q8PB 2CQBA 1Y5IB 3TOQA 5LM7E 3MD3A 4KH0B 3BSAA 2WSCC 1ZA2B 2DRDA 1SH2A 3KXDA 4KO0A 3KLVA 4C8YA 4NYOA 3FQLA 2ZNYA 3UCZP 4NWBA 2XY6A 2QSWA 3Q24A 4ZPWR 4PYAA 4DUZF 1DURA 2HGLA 3DHWC 1PKUA 1IKYB 2PA3A 2V2KA 3D68A 2A18A 1C1BB 4MIWA 2CADA 4USHA 1J2VA 4P2FA 1ZTTA 5FDLA 4WKRA 2J5AA 3QFHA 3DOKA 3PM9A 4DV0J 4ILLA 3C6UA 1ZPWX 2DR7A 3W66A 1HMVB 1VJQA 2RU3A 5A76A 4KFBB 1X7VA 1MG7A 4OX9J 3G8SA 3MR3A 3T1AA 2FZGB 2NS1B 1IKVB 2DNRA 3K5OA 4ZS6A 3MM9A 5KT4A 3BEGB 2XYGB 1QD1A 3BGRA 4J91A 5K8MA 1NLKL 5KG5A 3H5YA 1OSCA 5KFCA 2AJ2A 3S6EA 2DNKA 3FDSA 1VRTB 3KK3A 5L39A 1CJVB 4A8MP 4ZN3A 3QLHA 2KXFA 2MQMA 1HNVA 3LP0B 4HDGA 3RBDA 4F2RA 1NK7A 4MH8A 3TA1A 1IR2A 2WSFC 2OSRA 3DGPA 2G2ZA 3TZWA 2HNDB 2HHQA 4Q2LA 2HGMA 4Q45A 3NGDA 3UN2A 2JDJA 2ZOMA 4DX5A 3GIIA 3R2CJ 4CO3A 1WC1A 1SI9A 4EFAC 4YY3F 3BB5A 3L7PA 3PFEA 3S7RA 5DQGA 4LF6J 4DX6A 1Q7YT 1VQYA 4NRUA 4PQUA 1HLWA 4FXDA 3I5AA 3ZZOA 4CH0S 4PXDA 1WDDA 2UXCJ 2RS8A 3C19A 2XSFA 3IM9A 2HURA 3MAAA 3TVZA 1EZZB 4N5SA 3HLUA 2VDHA 4USTA 3DOKB 2CKWA 4TU7A 4LFBJ 3KLFA 2CVIA 3IBCB 1Y3JA 1JLBA 3C6UB 3DRXA 2D9PA 1W2IA 3BH7B 3ZZTA 2W9BA 2VFRA 3CCJS 3PR4A 3P8BB 4BBYA 3CD5A 1QTNB 3CSKA 1W25A 1X5OA 3O8WA 5LMNF 3SYZA 1KFDA 4ZHRB 2XWYA 4RU2A 3MM9B 5HANA 2QMWA 2W8KA 4NPOA 3BGRB 2B4VA 1S5ZA 4AQYJ 2JEGA 4CT9A 4ZCIA 3KK3B 4HEA9 1MU2A 4ANCA 1LQ9A 4Y6IA 1HNVB 2ZFHA 1YITS 1Z2LA 2LDIA 5DDQC 1MSWD 4O0NA 2K3IA 2DGXA 3I5BA 3OLBA 3QBCA 1H7XA 1HHQA 3UI3A 3I32A 3GFYA 3FK4A 2HHWA 3CF5Q 4O3RA 3LOUA 2GMLA 4J9MA 2E1PA 3DU5A 1NM2A 2F9JA 4DL7A 2PIIA 1NNDA 3SSSA 4ED0A 2E9ZA 1N54B 1TFWA 4K4TA 1RWUA 1BUXA 4P6QA 4FDFA 3I0SA 2KRBA 1DZ5A 2PEBA 2V8VA 5ETLA 5EUHA 2FGCA 2XI3A 3MEEA 1FERA 3EZ5A 2JLEA 4CLLA 2D1CA 1RBAA 3N5FA 4YEAA 4V19J 2XZDB 5GAEU 3KLFB 4HTJA 5KFFA 2Y9HA 1JLBB 2DNGA 3IBFB 2J8AA 3H98A 1SL0A 2GC8A 2W9BB 3ILIA 2I38A 1PIEA 5LT5A 4ZOSA 2C2ZB 4OI2A 4USJC 4JI8F 3L9ZA 5KFRA 2B8PA 4IG0B 1X0FA 1X9MA 4B9UA 2O3DA 4ZJOA 2HRYA 2H65B 2B56A 4OHZA 1NKEA 3RU0A 5HN0A 3B4MA 4OHWA 3VGTA 3MI7X 3F44A 2RHQB 1H0HB 2LDYA 1TMJA 2CNOB 2Z8QA 2V4JA 2HBRB 2VBXA 5IC6B 5GADI 4DUYJ 1UMJA 1HARA 1RYSA 3CIMA 5AE2A 1GEHA 4RL1A 4ZCKA 2CNNB 3G6YA 2BVZA 3C8YA 1Y7PA 1C4AA 1KHWA 5AXMA 3NGKA 2X1GA 4PZVA 4HR2A 1NK5A 3H20A 2XHCA 4ZK7M 1PBAA 7FDRA 5KOXA 5C7PA 3PG9A 3UD3P 1FNXH 2RDJA 3VWSA 1HNZJ 4JV2A 3I0SB 4OYZA 5B08A 1VS3A 3AD9C 1RHKB 4CO2A 4P52A 3MM8B 1HWKA 2Y8YA 3CVKA 3D28A 1FEHA 3BM7A 1HWJA 3MEEB 2ASJA 2DITA 4IRDA 4DR4F 4NLQA 2QLBB 3G6ES 3G4SS 3AAWB 4WFXA 3CW2C 2KFZA 1XNRF 3TW0A 4RBUA 4DFMA 4DCOB 3RW6A 5EDWA 1F6TA 4NEZA 1S6QA 3M8WA 4NXNJ 1TU0B 1EJ7L 2V2ZA 1RABB 3V4IA 4DG1B 1RT3A 4AYBD 4FNHA 1ZOTA 4CO0A 2RT3A 5F9LA 4ZJQA 1JLFA 3P5BP 1SB6A 2ZHBA 4F4WA 2AJ1A 2BUNA 1B0TA 4LUBA 2LU2A 1FTCA 1T0TV 2DIUA 3OR2A 4OZLA 1N5VA 2W1BA 1N56A 4F50A 1IBMJ 4DV5J 1NJYA 1APSA 1SC1B 2BQRA 2DGQA 4Y00A 3BF4A 4I7FA 4FF2A 5RUBA 4OZ0A 1VISA 5EX3A 2E1RA 1YG0A 3SCLE 2Z2MA 3HI9A 3MM7B 1X4HA 1WF0A 4DR6F 2H5IB 5F3ZA 4I1TA 4KRWA 3HO1A 2CPDA 3D5MA 3TUIC 3M6XA 4DXLA 3IWLA 5HO4A 4B9MA 1PC4A 3GFHA 2MZ1A 3EGNA 3FCHA 3CJ5A 3FEXB 1D1UA 3HVAA 5IZHA 4ZPDA 3BDEA 1SH3A 2R7OA 4DV7F 4QW9A 2LQ9A 3CMQA 3NS5A 4PG8A 1UZHA 4RLEA 3TO8A 2E7XA 1JB0C 4OQJA 5L46A 2FY8A 3MEKA 5HROA 3RYLA 1JIHA 5MLCV 2V4RA 5D15A 1JLAA 2FJDB 2RF2A 3C3LA 2OJ3A 1NKBA 2M8HA 3VALA 3SV3A 2BYCA 2DJWA 1Q81T 4OZ3A 4Q7AA 3M8PA 1OYEA 1BGXT 4WK1A 3CIZA 1D09B 1KQKA 4CIOA 3Q8UA 5HJXA 4PR6A 5HAOA 1JWWA 4NLDA 2JH3A 3V4IB 3ISNC 3UCUP 2BJEA 1XR5A 4MK7A 3I56S 2MKIA 4RBVA 2I9SA 1JLFB 2PMHA 1UEUA 4ZLNA 2BJ7A 3MGJA 4DN0A 2MKKA 2HIYA 3WZ0A 2XCAA 4TU8A 3QT8A 3OR2B 4Y0FA 3TZXA 4EEYA 2C2DA 4AL5A 4IYQA 4TN2A 1Q95G 2UV8G 2KM8B 2PC6A 2W2QP 4DEZA 4HHHA 4DJBA 4I7FB 3BKFA 5A2QY 1WSRA 3OR1A 3FUYA 1OMSA 4OYOA 2A2DA 3JSRA 4ED2A 1DTTB 1WWHA 4K0KJ 3E51A 4DCJB 2RRNA 1YHQS 2BJ3A 4DS5A 2Y3YA 1U25A 1NH7A 2VODA 4JBCA 1VR6A 3N0VA 1CQNA 5KFLA 2V9KA 4KSEB 3FMWA 3OXLA 5HROB 3UN5A 2C3UA 3NMRA 2AP6A 2D3OR 1JLAB 3HFVA 3SQGA 1R0CB 2RF2B 2WW4A 2I2YA 2WCXA 1AROP 2GO9A 3ONQA 3K5NA 3AHPA 3M8PB 4OX6A 2J6UA 2OGUA 3P45B 3R7NB 2I1RA 2QLFB 3QPIA 2HYIB 4B3RJ 2P9EA 3F73A 3S1TA 2WVEA 4FYVB 1HQUA 2MJNA 3G6VA 2HZVA 2E9RX 1DFDA 2GVDA 3BN7A 3ZTPA 3R27A 3LF0A 2XZWA 2ZNZA 4IR1A 5DETA 5EX0A 2FC8A 3MXHP 5LOQA 2M52A 2QZ8A 4WBFA 4BLGA 4RWXA 4NLOA 4C8ZA 4MK9A 2LXUA 2LXFA 3LANA 3D0HE 4WP9A 9RUBA 1S0VA 4LRCA 5DJBA 5J2MB 1FRXA 4BC7A 1VFJA 1HNIA 3BSOA 3WC0A 3TX0A 4ZVQB 4XK8C 1RKIA 4J9UE 3OHBA 1D8YA 1D3WA 4PUOA 1RCOB 4C11A 3PJ9A 1M5HA 4DF4A 1FRHA 4DQIA 1YDLA 3IAS9 2O01C 4O3SA 2HFVA 4AL6A 3FBEA 3RR7A 2ZH7A 3MAQA 1QUPA 1MNEA 1UP1A 3SQGB 1GMWA 3AB2B 2MSSA 3IR6B 3U7JA 2YWGA 1HNWF 5D3GB 4N8NA 2B8QA 2VBZA 3Q8RB 1UVJA 2CJXB 2JVOA 5KG7A 5D0GA 2BQUA 3LA0A 2G1HA 2DH7A 5KG3A 3NOCA 5ITHA 4JI1J 3QRQA 3TR5A 3A12A 3KWMA 1QAYA 5CCMA 4LIRA 1HQUB 2D3UA 3PYFA 2HNZA 3FQKA 3QJLA 3IR5B 3L7UA 3JQKA 2G0IA 2GVDB 2HZCA 4J90A 5HQ8A 4DBQA 4DV2J 2IMOA 4PQAA 3QAUA 2GNKA 2CYYA 4ZVEA 2WVDA 1RAFB 3W60A 3UD5A 5GMEA 3JSMA 1LWEB 2ZOGA 2MXYA 4LFAF 5JVGQ 5KT5A 2W4DA 1LKZA 1UVKA 1YJWS 5GADU 4YOEA 1RAEB 4X4VA 2OMLA 2YNGA 2HHXA 2AF6A 1CJKA 2COLA 3HSZA 1RA7A 2GVZA 2HLTA 3EYZA 2FVQA 4OI0A 1IJFB 1ZTWA 4C4WA 3LGMA 4C11B 3I82A 4CDIA 1U6ZA 1PAUB 3A13A 4TYAA 1EB0A 2DO4A 5E41A 3W5YA 3V6JA 3LH2S 1YZ7A 2A2CA 3LPYA 1FKPA 4U95A 3QSYB 2XMWA 5A8RA 4WJBA 3H2VE 2CQHA 3LW5C 1VBXA 2UV8A 2LXIA 3IGVA 1G1XA 1U49A 1RAAB 2J7WA 1HQEA 1SVDA 1VBZA 4WFNQ 2B9EA 3HK2A 2KU7A 2WZ1A 3BQ1A 1QDUB 4DL2A 1OQ6A 2MYFA 2QT7A 4HHJA 4ANDA 3QRPA 1HBMA 3HCXA 4QIFA 4WYLA 4DLGA 3BO3A 1RAOA 2HNZB 2RILA 1W2BR 4Y34A 2HFOA 3DU6A 2H4WB 2ZH4A 1N6QB 2UUBJ 5ETSA 5KT2A 1JXLA 1JLCB 2VF3A 3NS7B 2DNLA 1AFJA 4JV0A 2GS8A 2YKNB 3BR9A 2QJ3A 4AD6A 3K7RA 4YUDA 2FVSA 2EFGA 3K17A 3EVMA 3HFZB 1NJXA 1T8EA 3JSMB 2QLWA 2FZKB 5BYSA 4CLUA 5F8NA 5HVGA 4ELUA 3ET6B 3SEOA 4K5RA 2YNGB 1NSKL 1DBDA 1Z2ZA 4GMKA 5HVFA 1ZETA 1CJKB 5KT7A 2POKA 4LF5J 2VFVA 2GVZB 4CTAA 2LMIA 1FA0A 1VK3A 4ILMA 2ZKTA 4C3KA 5CD4H 4RUAA 1RLDA 2CZVC 2F40A 3HFKA 5E3CA 1KP6A 2LLZA 1ICEB 3H90A 1E6VA 1G3OA 3PYEA 4UOCA 4H54A 1D0EA 1FKPB 2KT3A 3HP6A 3CCQS 2GJFA 3NGRA 2P9GA 1SIZA 3UDCA 1FD8A 5A8RB 2H51B 2XB2D 2NSCA 4M5IA 1DARA 4ICLB 2KB2A 2NLWA 1HQEB 4MYTA 1EKSA 1S1XA 2GQQA 4QOTA 2YNIA 3PJWA 3DC2A 3U02A 3OT9A 1VK8A 2EW9A 1B99A 4F0HA 4KTQA 2VC1A 4ZIVA 2R4FA 2R7UA 4LF2A 1NJZA 2QX0A 2DHHA 3PZPA 1VI7A 2EI5A 5GMDA 1FKAF 3IAM9 2KM8C 1S49A 4IOBA 2PE8A 4NLRA 4H4KA 3W61A 5J1NA 2RJZA 4DDFA 5D4OA 2CJAA 3WX8A 2VPWB 4DR5F 4I6AA 4B3SJ 2G2YA 1J5OA 3TEGA 3HJFA 4W90B 4F4YA 3DI6B 5F0UA 3W63A 1YBAA 1R0BG 4P7TA 4TNOA 4P2MA 4JV5F 4EYIB 5DG9A 4N77A 4CTAB 4WP8A 2VZ9A 3OSNA 3BYPA 1VBYA 2GAGC 2DNQA 4DHVA 2E5HA 3RAMA 3A3NB 1KBRA 1PJ7A 2O1PA 1T9XA 3ELHA 1AW0A 1UVMA 4P71A 5GAGI 4F4AA 1E6VB 2HVIA 5KFZA 4DV3F 2VL1A 4X4UA 1SJ3P 2LEPA 3UVJA 1RWPB 2HBYB 2M88A 3JB9k 4L74A 4OYPA 1ITPA 4BCAA 1JJ2R 2MQNA 1N5QA 3LUYA 2NQPA 2VH7A 1S1XB 4DN9A 2YNIB 2UU9F 5LMUJ 5FD1A 4YR0A 3SV4A 1YJRA 1SBRA 2HEKA 2CWKA 3M8RA 4JI0J 3T1HJ 2F4VJ 2UZAA 3OTEA 1CSJA 3H5XA 2MQOA 3MOJB 2ALZA 2E5LJ 5KFDA 4FPRA 3H42A 3SZ2A 3FSYA 1WF1A 4WU3A 3ETOA 4QU7A 3PW0A 2ASDA 2JNJA 1A9NB 4DPWA 3M6WA 5ETNA 3CJKA 4WF9Q 2VJVA 4A8FA 1K1QA 1F2GA 2JRSA 3IP0A 1UKUA 4OYBA 1KVIA 3Q8YA 1KSPA 3M8QA 1ZPVA 2PO4A 1J5OB 4F4ZA 2CQ4A 1FO1A 3MF5A 4IKAA 3TAPA 2AJQA 2YKAA 2J76E 2R2TA 1VHIA 3T1YF 5GVQA 4AFFA 3VCDA 4HI2A 4X4OA 2CDRB 4IO9Q 1HIYA 1ZM2A 2NYHA 4OZ1A 3U27A 5KFAA 1GXLA 1Q8KA 2M0GB 2JC0A 3CCUS 2FLPA 4CI0B 1KOOA 3UD4P 2VICA 1T03A 3TVYA 1T94A 3G2XA 3ILOA 1M5KC 1JJHA 3CDWA 5EN1A 4NYPA 1XN9A 1KD1T 4NLTA 1RAIB 3MR5A 3CNQP 1X4BA 1RT2A 2BJ9A 1NZAA 3V2UC 2OTLS 4DL0C 3M4XA 1RUSA 4FVMA 2XYPB 4RU9A 3VZHA 1NK4A 2YNFA 3HVWA 5A8KA 5L38A 4Y2AA 5E5NA 1L3TA 4G1IA 4Y3CA 3ZZYA 3W8GA 2MZJA 4NOHA 4OL8A 3HSDA 3DXSX 4YHHJ 5K8PA 2DK2A 2RVJA 2J9EA 1VQ6S 1U6BA 2ZJRQ 1N0UA 2LU1A 3M9MB 2PEHA 4NA1A 5A6PA 3GMGA 3R97A 2XULA 3X1LB 3BQ0A 2C22A 2V9WA 2NR0A 3MPUB 3SFUA 3G96A 5J1EA 1YX2A 4ED4A 1NAQA 2B51A 1ZZNA 2ZEJA 1PBUA 2UXBF 4QPXA 5HI7A 2V34A 1U47A 3PXGa 3NP5A 6FDRA 1VHFA 1NJWA 3MTKA 1GNKA 3FZBA 1H73A 3RW7A 1RT4A 5J2QA 3RRGA 5AJ3F 1N88A 2CUYA 4YB1P 3OL7A 2V5HG 2VOPA 3G82A 3TARA 4I64A 1C4CA 4QIEA 4DSEA 1S9EB 4XAKA 1JLQA 4OJGA 3Q8VA 4K5SA 1TELA 3CCWA 5CZXA 2CAJA 2WVCA 1VQOS 2XMUA 2IAJB 1CJTB 4WFAQ 2YQ1A 1RSCA 1NUEA 2G13A 2PMZD 4HI1A 3D3BJ 1M1HA 5A8KB 1P1TA 1IM4A 1N36F 1VRUB 4PXEA 4P9SA 3OBIA 2CJYB 1CULB 4DV6J 2IM1A 3M7VA 2GIQA 4QIVA 4YR3A 1S57A 3GQCA 4DV1F 2JWNA 3GLJA 1U0HA 3DDIA 5AT1B 4CO4A 3OSPA 4OYXA 4ED1A 3CTRA 1RU2A 1YJUA 4CO1A 1YWXA 3UCGA 3HHLD 3H4DA 2IBOA 4C3MA 4U96A 1UWBA 2YX4A 5HSPA 2DPJA 4DSKA 4F36A 4CM0A 1NSPA 2LQ8A 3NCQA 1B0VA 2QA4G 1RT4B 4QZVB 5J2QB 3RB0A 5L1IA 3EJMA 3V6HA 3DMJA 3TYTA 2CIMA 3G82B 4L72B 2DRBA 2FTRA 2J0WA 4F8RA 4KKOB 4CQ1A 5BYQA 3M6UA 2HVEA 4P74A 4F0KA 3N9UC 1JLQB 2ACMA 3B6BA 1RTHA 4QWDA 3AOAA 1RXOB 1S10A 3KLHB 3DLLQ 3N5BA 4F04B 4KHPJ 1PYTA 4IRCA 4DZ6A 3CCES 2XMTA 3GYGA 1Q82T 3BO4A 1U2CA 2RSQA 4NXMF 4F4KA 4LMZA 2X51A 1RBLA 3A4TA 1RWOB 3JSBA 4Q0BA 3HKWA 4X2BA 4CLFA 3OTCA 1YSJA 2DGUA 3FCWA 1KNZA 5B0GA 4YDDB 1MMDA 1U0HB 4ZP9A 3RBEA 2CQCA 2WW8A 3OUYA 2VQEJ 2R2RA 3MR6A 1FDDA 4GO7X 3OLAA 2MGZA 2CVEA 1ZS6A 1X5PA 2CJKA 5HMYA 1W26A 3GYXB 1RQ0A 4GC7A 3GCWP 4IOCQ 2OUGA 5A0YA 3FRYA 4C8KA 1HR0J 3TAQA 1O6XA 5HMXA 5GAHU 1YRUA 1V3ZA 4USMA 2GO8A 2E5JA 3IR7B 1RJJA 2GMJA 4I6YA 3VVTA 4DQRA 4YFUA 4LVNP 4CT8A 4Y2MA 3HJVA 4UZBA 1CS4A 1WTFA 2AJFE 1BHNA 2AJ0A 5I3PA 1G2EA 3RJMB 4W92B 5GAGU 4QR2A 5CABA 1FWPA 3EZOA 4A4JA 2M4MA 1YJTA 4OJ1A 4ZKAA 1SV5A 2KZMA 4J9LA 2Y8WA 2V68A 5CAAA 4J9PA 3HT0A 2XLKA 4ZVTB 1N0VC 1HBNA 1BY9A 2A1BA 2QA1A 2D3O1 1KLMB 2DT9A 2ZH1A 3LGHA 1OSDA 1Q53A 3FRZA 2OFGX 3GJQB 4YS2A 3DRSB 4Q0BB 1SC3B 3FEYB 1VBKA 4ENOA 4DF8A 2HFUA 3Q83A 3CMES 2AYBA 3QAEA 4PWDB 4ZDNA 2FY1A 3OUYB 1FESA 4F67A 3PV8A 1WKJA 2MGZB 1JNRB 1Y11A 2YPZA 4J9QA 2W2NP 2ROGA 5LSRA 4C48A 1Y5LB 3GJSB 4K7QA 4X64J 1CC7A 5A0YB 3DOMA 3M2UB 4PWUA 5C24A 4QBUA 3CD7A 3KJFB 4OFZA 2IYIA 4M5HA 3DRRB 1Y0HA 2AX0A 2ZH5A 1X4AA 3BBFA 1NBEB 2V69A 4QQBA 1IVZA 1UJ4A 2QV6A 1SQEA 3LO3A 3ZO7A 2W2OP 4OZ5A 1IWAA 4GKKJ 1RHMB 4A8SA 5L9NA 1C2PA 3RG6A 1N5SA 1HWLA 3D4JA 3KK2A 4OX9F 1Z4UA 3DKDA 5IWAJ 3SSRA 3QGGA 4ECRA 1SV5B 3DNCA 4YB5A 3QGPA 4RJVA 2BA9A 2VU5A 2V2VA 4GVLA 5SUHA 2HBZB 5IQQA 2RQCA 3GR1A 4HTIA 2M7SA 3JTOA 2GHPA 3T9NA 1R6VA 2XNRA 5LMNJ 4M1KA 1URNA 3M2RA 1TL5A 2DNHA 2PMWA 3QT7A 4UUWA 2UXDJ 2YPYA 3OTDA 1NB2A 3CCLS 2EFPA 1LXNA 3KG1A 1TK5A 3KJVA 4DQPA 2YKPA 3K57A 3UFCX 3FZ2A 2WBRA 4F3OA 1X8DA 4PG5A 3FBBA 3NLCA 4MJKA 2AEJA 3GV7B 4CO5A 3B8HA 3K58A 5HMWA 1VQ5S 5CZVA 4OI4A 3D6HB 2AMCB 3BJYA 1HYSA 1U1MA 1HW8A 4LF6F 2XO7A 4ZP8A 3DOMB 2B6AA 1RZMA 2JJ4D 1FX2A 4EO8A 4RW6A 4FBUA 2R8JA 3D6MB 3KOAA 2UXCF 2YH0A 2EK6A 2HAFA 4K4SA 2YQ3A 4EBEA 3HDSA 3FFIB 2QE5A 3HHDA 1S4EA 2ZBCA 3OL8A 1EP4A 1KVKA 4J37A 4ER8A 2W25A 3GG0A 2HKEA 1CBKA 3DLKA 1K0VA 2ZKUA 5B0BA 2PSZA 4LFBF 2VG7A 3M32A 2CWXA 2BEFA 1QLNA 4FF1A 1S1WA 2NXEA 2JX2A 3RRKA 1S59A 2YWEA 3ZZUA 2DY9A 3DLBA 5T41A 1RHRB 2C2EA 3JYTA 4JI7J 4ZP6A 3SQOP 3GR0A 4W4MA 4S0MA 3Q8QB 3MPDA 3THVA 4O4GA 3FSXA 2R7XA 3W8PA 3KLIA 5L1LA 1PJ5A 4KGZB 2LVWA 4ECQA 5A6WA 1TVRA 1O8BA 4AQYF 2AGQA 4YP3A 2JEJA 2OD4A 3C14B 4U7UD 4Z2XA 3ULHA 3AODA 4JI8J 1Q8BA 3M2RB 2ZJQQ 1XJWB 4WYWA 2YKOA 4RX6A 4YQWA 4M94A 2I8EA 2L9NA 3KJVB 3ETMA 2XG8A 3AH6A 3POTB 2IM3A 1NDLA 2GW8A 1GMVA 4UQTA 2ZD1A 2AJ4A 4O3PA 1TP7A 1A7GE 2ZWPA 4IH5A 4LF4J 2LQJA 4WWSA 1UPMB 2IMWP 5J1PA 4GKJJ 4PG7A 3DCAA 2Y1LB 2ZJPQ 2CPYA 2AW0A 2BX6A 2BQ3A 3LGNA 3CJTA 1T9WA 3ZZ0A 4ID5A 5GMKa 2EWHA 1L3UA 5IQ6A 1FWLA 2Z4PA 5H9FJ 4KIAA 3KMSA 2RNEA 1QTMA 1O5JA 4TY9A 4FP9A 2DBBA 4F0MA 4F4XA 1EP4B 1VQ7S 3DLKB 3M32B 4I2QA 1IKXA 1EKRA 2Q43A 2OO4A 4ED7A 1TK0A 1ZH5A 3ADAC 4EK2A 3TI0A 4X4TA 2ADBA 2UVRA 4RW7A 1HWUA 3DYAA 3VAFA 2MMYA 4GRSA 1VC6A 2R2SA 4O4GB 4L73A 2Z2LA 4XDDA 1FRIA 1XNRJ 3KLIB 3KMQA 4KGMA 4M5GA 4RW8B 2F5GA 4FKYA 2K7KA 3QMQA 2YH1A 3NWRA 1AXQA 3LPEA 3I9V9 3TP2A 2CQDA 1OO0B 5C42A 2F8EX 2BE9B 2V67A 3IWNC 2V94A 1M90T 5G0RA 1CG2A 1FWKA 2ZD1B 1EQMA 1IBLF 6FD1A 4F3MA 4QIGA 2L48A 1LFWA 3MDFA 1Q86T 4EI2A 1TL3B 2F4FA 1XQIA 2RD5C 3BBCA 1X9SA 3I0RA 1HI8A 1MN9A 2UVUA 1WC0A 2BE7D 3H2LA 3CCTA 3DLEA 1HBUA 4CLTA 1WHXA 3BZQA 1HNZF 5AXNA 1S99A 3PRBA 3O5TB 1TL4A 3MUMP 4UOGA 2PFDA 2RUGA 3JQJA 2CPHA 4Q44A 4L6V3 5AXLA 1S6PA 3OJSA 2UUAF 2AX1A 2XYHB 4ZVOB 5F8LA 1IKXB 3HPOA 3I96A 2VUGA 5D77A 3HSGA 1R6YA 1WSVA 4NXNF 2N3OA 3DYAB 3VGVA 4NE9C 2MHNA 1N5YB 2NXJA 3UQSA 4B9TA 2DCUB 1QM9A 2H5EA 2B9YA 4HDHA 1C0TA 2XHWA 2DHXA 3AD7C 2C28A 2FUG9 4OV1A 1WOSA 1FDBA 1KONA 3IS9A 4OYWA 2R2UA 1NDKA 2LP4A 1QJHA 1LWXA 3QJPA 3TX8A 4HYKA 3I4HX 4QWCA 5ETTA 3ZTQA 1IBMF 4DV5F 2VG5A 1NO8A 5C42B 2Y1RI 2EEYA 3QIDA 1NHVA 4OI1A 3R6GB 4H4OA 3BKTA 3AFGA 3BGOP 1RT6A 2H3EB 2X1BA 5G0RB 1KHVA 3MEGB 1YBTA 4RKUC 2XMJA 4I67A 4DFPA 3H40A 4KGKA 2M9KA 2RKIA 4EZ6A 3CMAS 4MKBA 4USKA 5D78A 3I0RB 3W5ZA 4CLKA 3PO4A 4Y2IA 4CRJA 3DLEB 2E1MC 1HBUB 1LK5A 3CWJA 2XCPA 2W2PP 3KUEA 1BD6A 4DOZA 2OKQA 4ZPCA 2HQGA 3HZEA 3M1VA 1C0UB 2H48B 3ILLA 3EGZA 4ZP7A 1QAJA 3P4UB 4DLEA 3SCIE 5HMZA 4MFBA 4FF4A 4DR1F 3PR5B 1S6PB 4OHXA 3R5JB 3R5CA 2HNYA 1FJ7A 5FIIA 1OY6A 4JI3F 2HQIA 3BQ2A 2Y0SD 3GSDA 4LSLA 3GV8B 2YKMB 2C3PA 2BJDA 1XC9A 1OPIA 2AYMA 2IYGA 1C0TB 1VJWA 4LR9A 4KYZA 4E2FB 1WG4A 2W9AA 4K4UA 2QYGA 3IS9B 2RIJA 4RUCA 3DXBA 5K14A 4YN3B 5KAKA 3KDOA 3SCJE 1JQGA 5KFYA 2PI5A 2BKNA 2EBGA 2VFTA 2X7IA 3BREA 1X5SA 2VG5B 5K20B 2JFDA 4LRDA 2HLUA 4RO0A 3IWXA 3HULA 2QMXA 4H4OB 1RT6B 3UPFA 1R3NA 1T95A 2OI2A 1BC6A 4QWBA 2KDOA 4WFYA 5ETKA 2I6WA 4K0KF 4KR0B 4UTGA 5T14A 1SH0A 4AT1B 2VPYB 4YR2A 3QFWA 4LFCF 1NXIA 3FSIA 1AA1B 1SCJB 2FB0A 2HQDA 3GZ7A 1WHWA 3LWMA 3B54A 1RWKB 4ES2A 2GX8A 3W3SA 2OIHA 1WEZA 2C3YA 5DQHA 3M1VB 1NEEA 2QRRA 1JX4A 2AZ1A 1OJ4A 3KHRA 2KJWA 3BH6B 3MTJA 4MTPA 1IR0A 4MFBB 2UUTA 5E3AA 2R42A 4QR1A 1GXUA 3KG4A 2HNYB 1U02A 2HVZA 1H98A 3H4BA 4XIUA 3W7BA 2CNLB 1QSSA 5H9EJ 4LSLB 4OX8A 5BXIA 2AZ3A 4B3RF 5E2QA 1LW2A 4ZVPB 2YWKA 1UJ6A 4V1Ak 2QYCA 1LWCA 2MLZA 4G1QA 1UVNA 3I4PA 5JXSA 5BR8J 3OXFA 4DPXA 3NXZA 1HPZA 2O66A 2BACA 1M5SA 3PNIA 2KVQE 2VV5A 1JLEB 1YVFA 5K14B 2HGNA 5DLGA 5B0AA 2VIHA 1B7YB 2XO6A 3IN5A 2R3VA 2K3KA 4R25A 1ZAXA 1BQMA 2IDEA 2K2PA 2D7SA 2EG1A 1TL7A 2X3GA 2RQ4A 3R6LB 5IS2A 2XNQA 3AXMA 3IMQJ 4O23A 2LFVA 4LQ3A 3OFGA 4I4BA 1REVA 3I5CA 4X66J 2ILYA 2E1AA 5LJ3Y 2DNNA 1J5EJ 4CLYA 1S0NA 2N3LA 2VG6B 4QYZJ 5AE3A 3PVXA 3KUGA 4X4RA 2CFXA 4ZCMA 1R0AA 2UP1A 4OI6A 4M63A 3QJJA 4WZMA 4ANEA 3EZUA 2RUSA 3MWBA 1VC0A 5HK4A 3TJ8A 4EZ9A 3QSIA 4O3OA 2RU9A 4EGLA 3T5KA 3N6MA 3RTVA 3QO9B 4KV8A 4TYBA 2KT5A 3GG1A 1P1LA 1UFKA 1T05A 5KFXA 3FMBA 3RBZA 5IV3A 3T6BA 4KO0B 2W4PA 1LW2B 1TKXA 4NASA
chains in the Genus database with same CATH topology
1XNQF 1QUVA 3LWLA 3PW7A 1LWCB 2AQ4A 1F5BA 2KI2A 4G1QB 1J5OA 2LQ5A 2J6TA 3HJFA 1ZAWA 1OWXA 4W90B 4F4YA 5A8WA 2MQLA 3DI6B 5F0UA 3BDPA 3HF5A 2XMMA 2OH2A 4DSJA 2EK1A 1YBAA 3IA0A 2GGPB 5E0OA 3KYLA 3NS6A 1OS5A 4LVOP 4F3QA 4P7TA 4TNOA 1NHUA 1KEKA 2ACYA 3BN4A 3NNCA 2XI2A 4JV5F 4CCHA 5D8HB 3NAIA 3J7YI 1MROA 4EO6A 4XPEA 2F1FA 3MFHA 3CXCR 4EYIB 2C3MA 5DG9A 5FDLB 3CEDA 4N77A 4CTAB 3MEGA 4DFKA 3CC7S 3HHEA 2XMKA 3PFOA 5I4MA 2VZ9A 2GQ2A 3CE8A 3OSNA 3ICLA 1VBYA 1YI2S 1O0PA 2DNQA 4DHVA 2E5HA 4NCAA 5J2PA 1BQMB 5LSOA 3MURP 3RAMA 1S1UB 3N4WA 2FDNA 2ZC4A 2O1PA 5DQIA 1JNZB 3DLJA 4K4YA 3TANA 1AW0A 4PKDB 1UVMA 3MOJB 1UWBB 1E6YA 4H4MA 3IXQA 3TAMA 3QZ7A 5GAGI 3PW2A 2XWXA 1E6VB 2HVIA 3BSCA 2EFQA 5DGAA 2XLIA 5D3GA 5KFZA 4DV3F 2WONB 3RAQA 1JMTA 2KFNA 2VL1A 2DB1A 4RW4A 1SJ3P 4X4UA 4CH7A 5H1SV 2LEPA 2VBWA 2BBEA 1KTVA 1X4DA 3MM6B 3K5MA 1FJCA 3NG8A 4KHRA 3TA2A 2JLGA 1HI0P 2MZSA 1REVB 3MM5B 4JI4F 3P5TL 3B82A 5EGYA 1C0UA 2ZITA 3DOLA 4Q2MA 2M88A 4R0EA 2OPRA 3JB9k 2XSJA 4B9LA 3G8TA 2ZDPA 3V5RA 3F41A 4BCAA 2MQNA 1JJ2R 1FHTA 1WG5A 2BANB 1N5QA 2UUWA 3LUYA 2NQPA 2VH7A 3DMJB 2HMIA 2FLNA 2JL9A 3L7OA 1S1XB 3MPWA 4DN9A 1ULRA 1WEYA 1GXTA 2FJVA 2YNIB 5B0FA 3V81B 3CJ4A 2ADCA 1N52B 2UU9F 3K0JA 1YQHA 2E5GA 3QLHB 4L3NA 4N56A 4FVCA 5FD1A 1Y5NB 4YR0A 2XY5A 3SV4A 1YJRA 2PGCA 1SBRA 1TQLA 1D9DA 1U1OA 3BR8A 5KFIA 1RK8A 3M8RA 4I69A 2UZAA 2KG0A 3OTEA 5C5JA 1CSJA 3H5XA 1NU4A 5BJRA 2A3JA 2V8HA 2MQOA 2ALZA 1DTQB 1VGYA 1T02A 4HLBA 3H5UA 4IG3A 2F8HA 1RTHB 4FPRA 4FZVA 5KFDA 4ECVA 2YKMA 3SZ2A 2XY7A 4B3OA 3FSYA 1RAJA 4XDCA 4TKTA 3KHGA 5HP1A 1G7CB 2L08A 1WF1A 2E66A 4WU3A 3ETOA 4QU7A 3CUNA 1UA1A 5M2PA 2MZTA 2ZHAA 3FEZA 3PW0A 4LQ9A 2ASDA 5DLFA 1X4EA 1A9NB 3AA9A 2M5YA 4ECSA 1LWEA 2AV5A 4B08A 4K4VA 1H2VZ 4UUXA 2GV1A 3SFGA 1FK9B 3HHLC 1K0TA 5F3TA 1DQ9A 3M6WA 2YTCA 2MKHA 3E2EA 3CJKA 1F5AA 3CDAA 3HT3A 4WF9Q 5KT6A 1XK8A 3MECB 4NMLA 2PT0A 4A8FA 1K1QA 1VQSA 1F2GA 2JRSA 3M2VA 1M5VC 5I3UB 5GAEI 1Q7LB 1KRPA 3DHXA 5CA5A 1UKUA 1KVIA 3A8EA 4H4KC 3MFIA 2ZE2A 2O67A 4KPYA 2Q66A 1TKXB 2B9WA 1KSPA 3M8QA 4AXJA 5CHCB 1ZPVA 4A47A 3I87A 3J81Y 4PQUB 2PO4A 1J5OB 3MMBA 4F4ZA 2AYEA 2CQ4A 4BHQA 5A8WB 4U7CA 2L9WA 1FO1A 3L09A 3MF5A 4IKAA 1SIWB 4NLUA 3TAPA 2CDQA 2AYGA 2RRAA 3G8QA 4D3GA 3N6NA 2AJQA 2B5JA 2YKAA 2J76E 2R2TA 2KHDA 3T1YF 5GVQA 4C0BA 4AFFA 2UUBF 2YNHA 4G1PA 4TQSA 3VCDA 4HI2A 2BDPA 1MROB 4CNZA 4X4OA 2PI4A 4ZVHA 1DLOA 4I68A 3KLGA 2EG2A 1UVIA 4IO9Q 3KHLA 5U47A 4ZPVR 3OFHA 3R1LA 1ZM2A 2AU0A 2WK4A 3CO9A 4KB7A 4OZ1A 2ZH8A 2HVHA 4RNFA 5CCLA 1X5TA 3CGIA 1S48A 1CVJA 3U27A 5KFAA 1GXLA 4ITSA 1KR4A 4ZA1A 1Q16B 2M0GB 4PXCA 5J2PB 2Y1IA 2JC0A 3CCUS 3GV5B 1R7IA 1KTQA 3J80Y 1NK6A 1QSYA 2FLPA 3MOZA 3OVAA 4H4MB 1E6YB 4FS1A 3TAMB 3L95X 4CI0B 1T3NA 1SJFA 1KLNA 1KOOA 4R8UA 2Q3PA 2RDIA 5BR8F 3UD4P 1FRLA 1T7PA 1T03A 3TVYA 1SC6A 1T94A 4RW4B 1NRKA 2BXJA 2MHEA 2ERRA 3CCSS 1M5KC 3VAGA 3EX7B 1JJHA 3CPWR 3CDWA 5EN1A 4NYPA 1XN9A 1KD1T 2IC3A 2A10A 4NLTA 2RB7A 3MR5A 5KFPA 2VA3A 3QWPA 4NRTA 1R27B 3FVYA 1X4BA 3DOLB 4WZQA 1RT2A 1NZAA 4RWWA 2OPRB 2CRLA 1VQ9S 5F8GA 3ZZPA 2XSJB 3V2UC 5MAOA 4K4XA 2OTLS 4MYUA 1S79A 2EVZA 2M3DA 4DL0C 3M4XA 4DV0F 1ZM3A 4BWMA 2HMIB 3H8YA 1LOUA 4FVMA 1MU2B 4B3MF 2YY3A 3MEDA 4HKQA 2R8GA 1TAUA 2HG4A 4RU9A 1N6QA 3NCRA 3VZHA 1NK4A 2YNFA 3HVWA 1H2TZ 1Y9OA 5DO2A 5A8KA 5L38A 4I6WA 4Y2AA 1JLCA 5E5NA 4G1IA 2ZH2A 1L3TA 3ZZZA 2OSQA 4X4PA 1R8PA 3Q0AA 3ENWA 4Y3CA 3ZZYA 3WX4A 2MZJA 2YKNA 3SSQA 4NOHA 1PO6A 4OL8A 3DXSX 4PRFA 2X1FA 5CXTA 4IG3B 4ETXA 2FHKA 4BWJA 4OHYA 5K8PA 4JOUA 2G1DA 2DK2A 4B3OB 2RVJA 2J9EA 1FDAA 5HP1B 1CPZA 1VQ6S 2IVFB 2Q6CA 3LAMA 1SL2A 2FLLA 1U6BA 2ROPA 3MUVP 2AGOA 3N01A 4X66F 2ZJRQ 3AJ2A 2LA4A 3J7ZT 1RT5A 4OX7A 1N0UA 1HBNB 2LU1A 4XO0A 1J5EF 3M9MB 3CDEA 3THTA 2PEHA 4DQSA 3QYYA 4NA1A 5A6PA 1FRMA 3GMGA 4N47A 1IKYA 2XULA 2IRUA 2LQBA 3X1LB 3D54A 3HM9A 1C1BA 2MJUA 3BQ0A 3M2VB 1CEZA 2D74B 2C22A 2V9WA 1MW7A 4RNNA 2KZZA 1JLEA 2NR0A 3PEHA 2EKYA 4ECYA 3SFUA 3G96A 2P5VA 5J1EA 2ZE2B 5LSLA 2KTQA 1NK9A 4M95A 1LK7A 1NAQA 4B9VA 4QPTA 2B51A 1ZZNA 3MMBB 1K9MT 1BWEA 3C66A 5KG6A 3V6DA 4ZMMA 2UXBF 3SXLA 3TRGA 1WNEA 1TR0A 4QPXA 2B5JB 5HI7A 1YRTA 4URQU 4JI2F 4OIXA 1U47A 2ASLA 1VMBA 2ILZA 4KFBA 1R43A 3PXGa 4DMZA 5IXUA 3TUZC 2R8HA 3QZ8A 5AE1A 1NH8A 2J7KA 4V19X 1H2UX 1DLOB 3KLGB 3NP5A 1X9WA 3P96A 6FDRA 4AUKA 2NUHA 1PILA 1VHFA 3CJ0A 1NJWA 4ZPBA 1U7LA 2VKRA 5CQGA 2AD9A 1K73T 2DCLA 1IKVA 2JLFA 2E1CA 3MTKA 3CD6S 4MMOA 3CCRS 2YVSA 1GNKA 3D1HA 5K8NA 2AGPA 4K50A 3FZBA 3RW7A 3UDLA 1RT4A 2Z0GA 3TUJC 4TLRA 5J2QA 4IQXA 3CJ3A 3C46A 1R31A 3RRGA 1T3OA 2BABA 4ICLA 2I5JA 5AJ3F 1N88A 5C24B 1WF2A 1KQFB 2G9OA 2HS3A 3MHYA 4IFVA 4YB1P 3T19A 2N7YA 2P9CA 3ENQA 5DDOC 3OL7A 4C8LA 1VRTA 2FIUA 2VG6A 2WB4A 5D4PA 2V5HG 1U8SA 1UETA 4R8UB 5KFMA 1K8AT 2VOPA 3VAKA 3T6JA 4ZVGA 4DSFA 1IQTA 3TARA 4I64A 1MMNA 1C4CA 4QIEA 4DL6A 1ZZFA 4DSEA 3HKZD 3ZZRA 2W8LA 3LP0A 1S9EB 3G71S 2IC3B 3DN9A 3V4MA 4KBIA 2DGWA 5L9XA 2OP5A 1WEXA 1WHVA 3OQ2A 4XAKA 1JLQA 3EPGA 2K7JA 4OJGA 2QEXS 4K5SA 3ITHA 2V4QA 1XMQF 4X62F 1CC8A 3CCWA 5CZXA 4F25A 2B4PA 1VQOS 1RKJA 2XMUA 1H6KX 4DFJA 4ZCLA 2IAJB 2IJFA 2RE1A 4WFAQ 2BV3A 1DAXA 2UUCF 3DLHA 3MEDB 1IUJA 2G13A 3QO9A 1Q4RA 3Q8PB 1S77D 2CQBA 2PMZD 3D2WA 2HHVA 4HI1A 2Q1LA 3M8SA 4WK3A 4ECXA 5A8KB 1P1TA 1PSDA 1IQZA 1Y5IB 2ZBIA 3TOQA 1Y4ZB 3KK2B 1IM4A 1VC5A 3MD3A 1N36F 1VRUB 4PXEA 3BSAA 3OBIA 4GO5X 2WSCC 2VC0A 1YIJS 1V9OA 4URSA 2C2RA 1SH2A 3HHKA 1WELA 2V4JB 4KO0A 3KLVA 4C8YA 4NYOA 3FQLA 2ZNYA 5KFOA 4C0OC 2IM1A 3UCZP 3RB6A 4NWBA 2GIQA 3MZIA 2VA2A 3I6PA 3LAKA 1LW0A 4QIVA 4YR3A 2XY6A 1RT5B 3LP1A 2QSWA 2CPZA 1N48A 2MSTA 3U1MA 3Q24A 1S6UA 3GQCA 4ZPWR 4DV1F 1EETA 4DUZF 4OMFG 3DI6A 3MUTP 3DDKA 2JWNA 4C8MA 1VQKS 1D8ZA 5LXYA 1QVGR 1DURA 2HGLA 3DHWC 2QFJA 2PA3A 1IKYB 2V2KA 5LMUF 5AXKA 2R7VA 2A18A 1C1BB 4MIWA 3QWUA 4P2SA 4USHA 2OPPA 4QIWD 4CO4A 3K5PA 1J2VA 3OTOF 4USIA 4JI0F 3T1HF 2F4VF 1ZTTA 5JJBA 3OL6A 5FDLA 3OSPA 2CJQA 4WKRA 2J5AA 3DDNA 4LT6A 2E5LF 1V6HA 3H59A 3DOKA 2WHOA 3PM9A 2Q6BA 3O1LA 2R7RA 4ILLA 5E3RA 2D9OA 4O3NA 2FVRA 1R8HA 3CTRA 4ED1A 3T5HA 1YJUA 4CO1A 3C6UA 3V6DB 1YWXA 3MCSA 3UCGA 1ZPWX 3HHLD 2DR7A 3H4DA 2IBOA 2N4CA 4C3MA 5HL7Q 1HMVB 2OMOA 2RU3A 4KFBB 1UWBA 1X7VA 2AWZA 2YX4A 2DPJA 3G8SA 4DSKA 3MR3A 4MAKA 2NYIA 3T1AA 1ZAVA 4QJVA 3M9OB 2HHUA 1FRJA 2XS7A 2NS1B 5EHHA 1NK0A 3NCQA 4ECZA 1B0VA 5JUMA 1IKVB 3C2PA 2QA4G 3GIKA 2DNRA 3K5OA 4ZS6A 3MM9A 1HYSB 5KT4A 3BEGB 1RT4B 4QZVB 5J2QB 2KKHA 2I5JB 3BGRA 3RB0A 5K8MA 2B6AB 5L1IA 1X4GA 1JKHA 1B64A 1XTZA 5KG5A 3H5YA 1OSCA 4KE5A 5KG1A 4IFVB 5KFCA 4LIWA 3S6EA 5LXRA 4RW6B 2DNKA 1R8AA 1B0PA 3D0IE 3FDSA 3V6HA 1VRTB 1ROFA 3DMJA 3TYTA 3NRBA 3KK3A 5KFJA 2CIMA 2RH3A 1HHSA 1S6QB 3Q2SC 4L72B 4A8OA 2FTRA 2IJNA 5L39A 2DRBA 4NCBA 2J0WA 4Z37A 4F8RA 1MWZA 1YRXA 3R5BA 4KKOB 3QLHA 2KXFA 4CQ1A 4A8MP 2Q79A 2RRBA 2IRYA 2MQMA 4ILRA 5BYQA 2DGVA 2HS4A 1HNVA 1HBOA 1RT3B 1FT8A 3LP0B 3M6UA 4HDGA 3RBDA 4F2RA 2ZDOA 1NK7A 4MH8A 2GMHA 5C25A 2W7AA 3DFEA 2FHMA 4QCLA 3TA1A 3NNAA 4UW2A 3N9UC 1JLQB 3S8SA 2HPUA 2WSFC 3ITHB 2WOMA 4TY8A 2OSRA 1KS2A 1RTHA 4QWDA 3DGPA 2UVVA 3OW2R 5F8IA 1JLGA 1S76D 1S10A 2HNDB 3KLHB 2VG7B 4Q2LA 3Q23A 3DLLQ 2HHQA 3N5BA 2HGMA 2YWHA 4Q45A 3VAIA 3NGDA 2MKJA 4YB7A 3H2UB 1S1WB 4IH7A 2JDJA 2ZOMA 2ASYA 4IRCA 2RQKA 1U1LA 4B17A 3GIIA 2DHAA 2MKSA 2XMTA 1WG1A 3NKYA 3UW1A 2VASA 4CO3A 3CCES 5L1JA 1Q82T 5DM6Q 1SI9A 1OQ3A 2CQIA 1B7FA 4EFAC 3BO4A 3JYTB 4YY3F 3BB5A 4DR3F 5DDPC 4J9OA 3KHHA 1XBWA 3L7PA 3BGUA 3PFEA 2RSQA 2KFYA 4FYDA 4NXMF 4F4KA 3S7RA 4LMZA 5D6GA 3LALA 5DQGA 2X51A 3PY8A 2IA0A 4OZJA 2QA2A 2ZC3A 3JSBA 1Q7YT 2GQCA 1LW0B 1VQYA 1U24A 4NRUA 4Y28C 1N8RT 3HKWA 3KTQA 4Q0BA 4X2BA 1Q1KA 1V3RA 3LP1B 2W7OA 4PQUA 2GHWA 3OTCA 2ZZMA 3J7A1 1S7HA 2ZH9A 1TVRB 1YSJA 2B4UA 3I5AA 2DGUA 3ZZOA 4CH0S 1EETB 4OHVA 1KNZA 3QGHA 4PXDA 1GTHA 5B0GA 4YDDB 1XMBA 1MMDA 1WHYA 2RS8A 5T7LA 3E01A 1BLUA 4ZP9A 5L1KA 2XSFA 2GJ2A 1CQMA 3RBEA 3EUNA 2CQCA 1XR6A 2WW8A 3OPKA 2OPPB 5J2NA 3OUYA 2R2RA 1GT8A 1ELOA 1RT7A 3GWCA 2CQ1A 3MR6A 1FDDA 4GO7X 3TVZA 3OLAA 2MGZA 4N5SA 3HLUA 1Q8LA 2CVEA 1FJGF 1X5PA 2FHJA 4YHHF 2CJKA 1KQGB 2CPIA 5HMYA 1TK8A 3DOKB 2CKWA 3GYXB 4TU7A 3KLFA 1I1GA 2CVIA 1RQ0A 4GC7A 1Y3JA 4DUYF 5KFGA 1JLBA 2D41A 3C6UB 3DRXA 3N79A 2D9PA 4KQZA 4N8OA 4IOCQ 5A0YA 3FRYA 1W2IA 4C8KA 4K2XA 2ATLA 2W24A 3R1HA 3ZZTA 2W9BA 2VFRA 3CCJS 2MZQA 2XGQA 3PR4A 3TAQA 4NX9A 4BBYA 4IQMA 3CD5A 1JXEA 3CJ2A 3CSKA 4ELTA 3R3TA 5HMXA 1W25A 1X5OA 5GAHU 4EYHB 3HMJG 1YRUA 4TU9A 4WTYA 3IG1A 3O8WA 1V3ZA 5LMNF 3SYZA 2GO8A 2DGSA 1KFDA 2E5JA 4ZHRB 2XWYA 3PJXA 4RU2A 3J7YU 3MM9B 4DL5A 2XLJA 2R7SA 3IR7B 5F0WA 4KAIA 2QMWA 2W8KA 4NPOA 1F60B 2E29A 5DS7A 2J9CA 4BS2A 3BGRB 2B4VA 4ID5B 4C3LA 1JKHB 4NYZA 1RJJA 1PGZA 4D3HA 1Q79A 2JEGA 2GMJA 4I6YA 2DGOA 4DQRA