5IT9Y

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
b'SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEKASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF01282 Ribosomal_S24e Ribosomal protein S24e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5it9Y00
3J80Y 3J7A1 5FLXY 3JAMY 5A2QY 5IT9Y 5LL6d 3J81Y
chains in the Genus database with same CATH superfamily
3D28A 1YJTA 9RUBA 2HQ3A 3OUYB 2VKRA 3HFZB 4DFMA 4B9MA 3KKFA 1LV5A 5F0WA 3G8TA 3TUIC 2GO9A 3ULHA 4RW8B 3DOKB 2YQ1A 4H4KC 2YNFB 1U0HB 3KLEA 4RUCA 5GAHU 4NX9A 4CIOA 1S57A 2Z8QA 1W2BR 4R25A 4F4XA 3K7RA 1S1VA 4JI4J 1QTNB 4LIRA 4KKOB 2BVZA 2CIMA 2YKMB 4OI3A 4KGKA 4V19J 4JYAF 2P9EA 3UN2A 2KXFA 4W90B 3NEKA 4QW9A 1U1RA 4NLQA 4QYRA 3HHLB 3PJXA 2EXUA 1ZS6A 4ZVUB 1RAEB 3D6FB 5DDOC 4DI6A 1ZZNA 1YBAA 2UU9J 1C0UA 1R8CA 1NK9A 1BQXA 5DLGA 4QWCA 3MURP 3W7BA 2CQ2A 3DOLB 2FHJA 1YI2S 2AYBA 1D3WA 2XG8A 4RW8A 5J2NB 2KXNB 2R2RA 1WNEA 2HHVA 1Y3KA 2YNFA 1G3OA 3OD2A 4KQZA 4U8VA 1OWXA 3CIMA 3FEXB 3M30A 4HL9A 1ZM2A 1R0CB 2B3TB 1M90T 4TY8A 3D0HE 3BR9A 1RAAB 4WK1A 5LM7E 1IBMF 2PA8D 4Y2MA 4GKJJ 3EZUA 3VGTA 2OTJS 1PSDA 4RO0A 1S6QA 2MEWA 3R9LA 3BJYA 2BA9A 5I4MA 2W9CB 4RUAA 1FNMA 4QYZK 3I32A 2JFKA 2VFRA 4EGLA 3CC2S 3T1HF 5CYJA 3D1QA 3NXZA 4MK8A 4YR0A 4IKAA 2UUWA 4OV6A 1H73A 4C8KA 2DGUA 3TW0A 1PJ6A 4OLOA 1FXLA 4HTJA 3IXQA 3QATA 1HBUB 1SJRA 4ZLLA 1SH3A 2HVEA 5CQGA 1U8WA 3AH6A 4E98A 1YIJS 2V2ZA 2WVBA 5D15A 4HT5A 4NYOA 1JXLA 2ZH4A 2ZHAA 1S99A 3BZQA 1BXNA 2ASDA 5CAAA 2IAJB 2R7UA 3G9CA 2RVJA 1T7PA 1F2GA 3MF5A 1KC8T 3P8BB 2XSFA 4WIQA 1R89A 1S0VA 2ROEA 3W63A 1R8PA 3H5SA 1K0TA 3CCSS 1SJ3P 2QGFB 1KQSR 2DNNA 1TFWA 2W4DA 4NLXA 3GSIA 2BXJA 3MPVA 4NLTA 1WUUA 4LJMA 1U1NA 2GAHC 2FLLA 2QJ3A 5KFQA 3FZBA 3NCQA 3VZIA 1WC4A 5D4NA 2WVDA 3EXYA 1GFWB 2WBMA 2XMTA 2HWIA 2XO6A 4KHMA 1UPMB 4DF8A 1NDCA 3WHIA 1D8YA 2V50A 3BKTA 2IAJA 4GKKJ 3CEDA 5DG8A 3QO9B 4OHZA 1O51A 1IJFB 4FBUA 2Y1IA 1VRQC 1I3OB 5KFVA 2HMIB 5JUMA 2DCUB 4LREA 5JXSA 3WX4A 1HWIA 1L3VA 3BM7A 1NLKL 3KNGA 2ZJPQ 3GB0A 5K8OA 4X64J 2Z0GA 2J6SA 3WBZA 3DFEA 1N5SA 4TY9A 2AD9A 2C2EA 2WSCC 2IYGA 2BE7D 4CQ1A 4N56A 3N5BA 3GIIA 2BKNA 1K44A 3PM9A 2FJXA 2M3DA 3KUEA 1ZAXA 4GRSA 4DQSA 2HHUA 4ZP9A 8ATCB 2HW3A 5KG1A 3HCXA 1HW8A 4E8UA 3CJ8A 1RXOB 2CPHA 2JLFA 2K1RA 3NY0A 5HVFA 1NPPA 1FK9A 2Z2ZA 4M5IA 2FJVA 3KHHA 2HMIA 5LOQA 4O23A 4JI0F 2YPYA 3PACA 5CYMB 3I55S 4YY3F 5DETA 2PDAA 2D7SA 3MPDA 2A6MA 4J9PA 3BSNA 2BQRA 1NSPA 1ZBTA 1FJGJ 2YPZA 2HGNA 2NZCA 2CQPA 3DDIA 3PW7A 4C11A 5LMUJ 3TUZC 1L3SA 2VQFF 3MUMP 1JLQB 4HDGA 4QYZJ 5JVHQ 2J7WA 3L09A 2CJKA 5DGAA 5KFTA 4NA3A 2DISA 1HWJA 4NLWA 2M88A 1NRKA 3OL9A 3HVTB 4FKXA 5KFMA 4Y2KA 5D4PA 1N6QB 1CVJA 3G82B 2QMXA 1V5VA 4NLRA 3GV5B 3DLJA 2MY8A 2HEKA 4Y34A 1KQGB 1IQZA 2Z4PA 5F8HA 4N76A 4ZDNA 3KLGA 3ZZPA 1IBCB 5KG5A 3QT6A 2D3OR 3SQGA 1U24A 2QYGA 2YBVA 5KOXA 2CQGA 1S6OA 3C15B 4MJKA 3O44A 2EG2A 4NLGA 2F8EX 3RBXA 3W9IA 1H98A 1H0HB 1S12A 5B7WA 5EN1A 3H42A 4CLTA 4ED5A 2MZ1A 5C2CA 1JLQA 2MJUA 2MZQA 3D2WA 1WF2A 5IFMA 2FHMA 3D3BJ 4DV7J 2C22A 4DV6F 4HTIA 2B9XA 1Y5IB 2ACYA 3IBCB 1S5ZA 3R97A 3OR1B 2Z2MA 1KONA 3DRSB 3QJPA 3NAHA 2VC0A 2MKKA 5KFPA 1F0XA 2BJEA 5AXMA 3FRZA 1N6QA 1CJVB 2AX0A 2VJVA 6AT1B 4JUZA 1AT1B 2E9TA 3QGGA 2DVIA 3H4BA 4ID5A 4DLGA 1LXNA 1M0SA 4UOCA 1HQ2A 5DRKA 4P7VA 1KS2A 1PYOB 3IG1B 4CH0S 3KLFB 1G6BA 5HBMB 2CPXA 3RB0A 5KT3A 2G0IA 2B0GA 1DTTB 4BHQA 4DV3J 2BOPA 2BKOA 2FYXA 1CSJA 4RWXA 1SJFA 2CADA 5AJ3J 2XCPA 1FE0A 2K3IA 2BJDA 2RF2A 2MXYA 4CO1A 3DRSA 2ZD1B 1GXUA 1UVJA 1NUEA 1N48A 2AJ0A 2H4YB 2A2DA 3RRHA 1CJVA 1UFWA 5KFZA 4C3KA 2J9DE 4CLFA 2GC8A 5CYQA 2XHWA 1SC1B 2B6AB 3W5XA 4OJHA 4C8LA 1WOPA 4OZLA 4K4YA 3QLHB 4C8MA 2HURA 2VBZA 5HBMA 3T6BA 3D3CJ 3AXKA 3B6BA 2IMOA 2C42A 2UV8G 2Q79A 4QIFA 2JEGA 3K89A 5JVGQ 4Q7AA 4FKYA 2H3EB 1EP4B 5KFAA 2ZM6F 1X0FA 5E3CA 3LH2S 1M5HA 2AJ1A 2GJIA 2R7OA 3DYAA 3W9HA 2WOMA 3ET6B 1X4DA 5IWAF 1GQEA 2RD5C 2BBEA 2IPOB 2RSQA 2CPDA 1X5OA 3EZOA 4ECYA 3UD4P 1U45A 1DQ8A 1N5QA 3ENQA 1J2VA 3AAWB 1MG7A 5J1NA 2X51A 1NDLA 3MEEB 3W3SA 4IQMA 2VU5A 2HQDA 1HPZA 2R42A 5K8PA 4FF1A 1FWKA 4ZHRB 5KT5A 1U2FA 2KU7A 4WP8A 4ED6A 4BC9A 2QO3A 2NQPA 1XNQF 2G13A 1EJ7L 2G0JA 1EP4A 2CQ3A 2ZKTA 2UUBF 1FDBA 4IOCQ 4TQRA 3PW2A 1KLNA 2L08A 3GV7B 3L95X 2CNLB 4DJBA 2MZJA 3HHKA 4DR3J 2OEJA 4B3TF 2D9PA 3NGKA 3RU0A 2DNKA 1EETB 2CVEA 1NK0A 2I0XA 5DG7A 3CCQS 2MQMA 5DM6Q 4LR9A 2PGCA 5GAEI 1HYSA 2VL1A 1UMJA 2YNIA 3H59A 4F25A 5B08A 4OX9J 2JZ5A 4ZHRA 2B56A 3J7A1 2R7WA 1VS3A 1NHKL 3TVKA 2XS5A 1U0SA 4CH7A 3IAS9 2AWZA 4F4ZA 2DJWA 1WORA 4KIAA 3TZXA 1HFEL 1UPPA 5A2QY 5ETTA 2E5IA 3DOMB 3NP5A 4X62F 2AGPA 4ER8A 3CMAS 3N6MA 4RW6B 4EZ6A 1UW4A 4E0DA 3KK1A 4DR7J 1EETA 1H2TZ 1NEEA 2YX7A 3D6MB 2EFNA 2PEHA 3QFWA 4ILLA 3MPWA 4OYPA 1RE1B 4F7VA 2GQ2A 2L9NA 4JYAJ 3I4HX 1N54B 4OYIA 1SC3B 3EZ5A 1Q8IA 2XZWA 4LR7A 4EMDA 4CT9A 1NHUA 4ZP7A 4A47A 1S9EB 1TVRB 4BS2A 3JB9k 2DYAA 3GWCA 1KQKA 3AB4B 3ISZA 2E7WA 4DR2F 1Q5VA 1CULB 1SQEA 3VHQA 3ZZZA 2LFVA 2JX2A 4RWWA 3GFZA 4HLBA 1NKCA 2HWTA 3NWRA 5AE3A 1QUPA 5D8HB 2IM1A 1FCAA 1G4CA 2HZVA 3LAKA 1VQPS 4A8KA 3BQ1A 2PI5A 1NJZA 1RAHB 2PMZD 1X4GA 2DR6A 3R5AA 4DEZA 4X4TA 4Q0BA 2HRYA 3AD7C 5A76A 3OLAA 2IRXA 2HVIA 2RS8A 2Y0BB 1S9EA 1TVRA 4WK3A 4DL4A 1I6JA 4H4MA 2HPUA 4O4RA 1CQNA 3HZEA 2FUG9 3DRYA 1CULA 4B9SA 3PW0A 1XMOJ 1J5EJ 1UVNA 2ZZMA 3AXMA 2HYIB 1PC4A 5I3PA 4PCQA 2HHTA 1C1CA 4YP3A 3D54A 2DNYA 2JWNA 4JV0A 4N7TA 3B54A 2NSBA 3LP1B 2XMWA 3E51A 1K1SA 1JLCB 1SH0A 1TKXB 3H5UA 2AF6A 4OHWA 4J9MA 3R5DA 4DBQA 2A10A 3IS9B 1S1WB 4A46A 2KVIA 2FVRA 2QX0A 1LW0B 4IH6A 3L7PA 2EG1A 3THPA 2HHXA 3R7NB 4MIAA 1WWHA 4NCAA 1NNDA 1MW7A 2GMLA 1EZZB 1OQ6A 3HHLC 2VF3A 5L9NA 5LXYA 4RJVA 3RRKA 4EBCA 3GLJA 3SZ2A 1VQSA 1TAUA 1JXVA 5HJXA 1Z2ZA 2YWKA 4C3LA 1UCNA 2W8KA 3Q8UA 3PVXA 3KMQA 4EO6A 4FVMA 1T11A 5C7PA 3WIVA 2NUHA 2ZWOA 3HKWA 2WRMA 4ES2A 2MKYA 1JLCA 2OSRA 1I94F 4LQ9A 4IO1A 5KG6A 3IS9A 4YFUA 2F63A 1S9GA 3WQPA 4YMEA 3I56S 4DQQA 1BC6A 2AYEA 3KYLA 2D69A 4OI2A 2IVYA 4DU7A 1DQ9A 3AQOA 3M2RB 1P9YA 1XJWB 2F4FA 4LRFA 2R7RA 4P72A 2W4CA 3BYRA 2B4PA 3T5HA 2LA6A 4MIWA 3OBIA 2JLGA 1FDDA 4DX8H 4DPTA 1WDTA 4G1PA 4URQU 2HVZA 1LW2B 5L1IA 2LCWA 1UETA 2LQBA 1F60B 4WFXA 4CNYA 3HSZA 2CQBA 4RW9A 2KM8B 3M2VB 1KLMB 3SCKE 2BX6A 3I4PA 4JI3J 1WG1A 3DGPB 1VLYA 2F9DA 2GX8A 3K8WA 2ZBCA 4ZIWA 4JI0J 1HHTP 3UE2A 4YY3J 5A8WA 5KT2A 1D1UA 3OTOF 4ELTA 1BMQB 1V3SA 4PRFA 2O66A 2PA3A 2V2VA 2FHKA 3IR7B 1R3NA 1S0NA 1VFJA 1TELA 5C24A 5J2MB 2PD1A 1NAQA 4LBPA 1D9FA 1LW2A 5T7LA 3EUNA 4F2SA 1QDUB 2FY1A 4F0HA 1YK9A 2VQFJ 3M2VA 1KLMA 3GR1A 5K8NA 4DLEA 3UO0A 4H54A 3ENWA 4FYDA 3DGPA 4J90A 2ZH8A 3J80Y 3RAMA 1URRA 4HHUA 1R31A 4DPOA 4RNHA 2GHWA 3MM6B 2V5HG 1IKXA 3GYNA 2AHOB 3UNGC 4C97A 3I5BA 2ASYA 3VAJA 1L3TA 3GP9A 2B9EA 5AXNA 2RIJA 3EVWA 2CZ4A 2FHJD 2HIYA 1V3ZA 2E7VA 2VHGA 1PKUA 3GIMA 3X1LB 2Y8WA 2XI2A 3LAMA 3H5YA 1TU0B 4DDFA 1HBOB 2BMBA 4IYQA 3IM9A 2WHOA 2PIIA 1KEKA 4DV4F 4RX6A 3M32B 1VBKA 2AEMA 2BACA 1A7GE 3BO3A 3GYGA 3MEGB 2CKWA 4NEZA 2V6AA 1HIYA 3CJ5A 5F9NA 2W2QP 3MM6A 1N33F 3HHLD 1HNXJ 5HP1A 3A8EA 1QLNA 5D6GA 4AT1B 1HBMB 3GCXP 1X9MA 2ZOGA 2N3OA 3W8GA 4OYWA 2FVQA 3DXBA 1RT4B 1FWLA 1FRIA 1RJJA 2UXCF 2PFFB 2FC9A 1VRUA 1HBOA 3MZIA 3SBMA 3CDBA 4YEAA 5DM7Q 1S77D 3CUNA 3K59A 2HVHA 4F02A 3Q2TC 4I6AA 5ETOA 2UXDJ 3HULA 3PG9A 5LT5A 4PYDA 3PKMA 4I7FA 4LSZB 4DL3A 1PGZA 2OFHX 2KHDA 2NPFA 2JDJA 3R5GA 1Y7PA 2VG5B 4NMXA 2V8HA 3AFGA 2P9CA 1UA0A 4O0NA 2CJQA 1WHWA 4L76A 1HBMA 4UOGA 1SKUB 4J9SA 1T03B 3IRXA 3MMCB 4ZA1A 3F0NA 1N34F 1RT4A 3NBPB 5HQLA 4C3MA 2HHPA 1XBWA 5BYQA 4DV1F 3FFIB 3TYTA 4F04B 1DRZA 4CLUA 3MOJB 3MAQA 4D3HA 3ZZYA 6FDRA 2LVWA 4JBCA 2J76E 1N0UA 5C42B 4P2XA 2HLTA 4K4ZA 4E2FB 1J5OB 4B3SJ 3VAGA 3MCOA 4QIWD 3NGUA 2FY8A 2DR9A 4BDPA 5BXIA 4IRKA 3W66A 1S1TB 4OJ3A 1S76D 2IA6A 1U2RA 1T03A 4M5JA 1MWQA 1U49A 2KT3A 4NWBA 3NBPA 4ZVFA 3LOUA 3NGTA 3QZ7A 3IO1A 1RYSA 2XO7A 2KFYA 4HI1A 4DFJA 4L6V3 4Y2AA 1NB7A 1JJ2R 3TI0A 3TZZA 4CCHA 3DLKA 4Q5VA 5CXTA 5H1SV 1VQMS 3ZTSA 3KHRA 2BUNA 2V9WA 1J5OA 1TKZB 1EQMA 1XR5A 3CCWA 3KUGA 1TK8A 1M1GA 2WK4A 2VQEF 3ONQA 4LSNB 1UP1A 2OPSB 2XSJA 2R7VA 2PSZA 2L3MA 1P1TA 3QYYA 2YNHA 5EX3A 3KJQB 1B70B 1LWCB 3FQKA 1IR0A 3W2VB 2FLPA 4IUFA 2CQCA 4O44A 2DBBA 2IA0A 2PE8A 4MK9A 4A8YA 1N32F 3OTBA 1GK8A 2DH8A 2MQLA 2ZEJA 2KJVA 4LT6A 3WC2A 3A4TA 1HBNB 3KWMA 1U4BA 2C3UA 5D78A 2RRNA 2VFUA 3BDPA 2GHVC 4JI7J 3O3LA 4B3RJ 2GIRA 2V63A 4LSNA 3RZAA 2DHSA 2VH7A 3L7UA 4KB7A 3I6PA 1R6YA 1S6PB 1Q0NA 2FD2A 1RGVA 1HNWJ 2VICA 2N7CA 3I0SB 2JHEA 4P74A 2J5AA 1LWCA 1SL2A 3W2VA 3VGVA 4HT7A 1M5SA 2I38A 2C3PA 3UVJA 4PPZA 5KOWA 3OVSA 2XYPB 2ZDOA 2EI5A 3NAIA 1R43A 3SXLA 5G4DA 5DQIA 1UEVA 1X4HA 3IWNC 4LVOP 4C4WA 4IG3A 2B9YA 3U1NA 4W4MA 5IZHA 3P96A 1XMQF 1VQLS 3QMQA 2RRAA 3ILLA 1KRPA 3QIPB 1S1UA 4PWUA 2ERRA 1S6PA 2B9WA 4UY85 2R3VA 3I0SA 1FJCA 4LFAJ 3AOCA 4P75A 4QW8A 2OEKA 1RWNB 1WEZA 3QSIA 1Y10A 1MSWD 3W65A 2LEPA 2VC1A 3R5BA 2GJFA 4UQGA 2W9BB 1SL0A 1E6YA 2QN6B 4UZCA 4AL6A 1RT6B 4IG0A 1B0PA 5SZTA 4FXDA 2DGSA 3Q89A 2HHSA 4MYUA 1QVGR 1VMBA 2GVZA 2DCLA 4M5HA 4HHHA 1WOSA 1SIWB 1FFGB 5E2QA 3X3UA 3EYZA 4ED8A 4QPTA 3T19A 5CH7B 3PY8A 2UV8A 3DNCA 1S0MA 2M2BA 2DH9A 3F44A 4AXJA 3MR2A 2MQPA 3IA0A 1CQMA 3MXHP 1VK8A 5FDLA 3G6VA 3HDSA 3KMSA 5DQGA 1N36J 4F0MA 1BY9A 1VIOA 1GEHA 3HT3A 1CJUA 1RTIB 4CT8A 3CJ0A 3VAHA 1RQ0A 2W9BA 1QY7A 4QWBA 2WONA 4H4KA 1ZH5A 4MK7A 3CDUA 1FTRA 1YTYA 2E1PA 1T9WA 3OV7A 3HO1A 2RDIA 4LF5J 1TUWA 1JK9B 1Q8BA 4OI6A 3S8SA 3M6VA 4UQTA 3HPOA 4Z37A 1JX4A 5A8RB 1TL7B 1IBLJ 3W2WA 2HIQA 4TLRA 3NNCA 1SPBP 2XI3A 4USTA 3CWJA 4X66F 1HW9A 2AGQA 2J0SD 1YJRA 4R5PA 2RILA 2BJ1A 4M8LA 2OFGX 1CBKA 4EK2A 4DFKA 3MD3A 4OX8A 2V8PA 2HZCA 2MKCA 1FERA 5E7OB 1S4FA 2JSXA 6FD1A 2DK2A 3M8SA 3FJ2A 4I1TA 4L74A 5F9LA 2Y1JA 4FPRA 2XMAA 2DITA 2VPZB 3EE3A 1IWGA 1WTBA 3PFOA 1HWLA 4DN9A 5IC6B 2RHQB 1QJHA 3VAMA 4OLPA 1TL7A 1WSVA 3MD1A 4N77A 4WWSA 1E6VB 3HD2A 3OHAA 2OH2A 5AXKA 3KLHB 2XWYA 2CDQA 3ISND 3Q24A 2LA4A 1I1GA 4K7QA 2IFXA 1RKJA 5ETKA 1RSCA 2RKIB 3DU5A 5DZ6A 1O0PA 3T1YJ 3F56A 2CQ0A 4F3OA 4MKYA 2HFZA 2R2UA 2Y0SD 4O3NA 1U6BA 4NZ0A 3Q22A 1TUGB 4PWWA 5J2QA 5A8KA 1PBAA 1RT2A 2L48A 4CM0A 2RQMA 1DHMA 4PG7A 4I67A 2B43A 3KDNA 1NPRA 7FDRA 2UUTA 3ZNJ1 3CD5A 1XERA 4HVZA 2HQCA 1E6VA 3E01A 3HT0A 2KRRA 2ZH6A 1H7XA 3EGZA 4K0KJ 1GT8A 2RQCA 2MLYA 3HX9A 2XS7A 3K5NA 3W5YA 1FXRA 1KFSA 3GZ7A 1C4AA 2XZDB 2R8KA 2ASLA 4X4UA 4DV5F 3N6LA 4FF3A 2LMIA 1GMVA 3DRRA 3W60A 1TL3A 2GIFA 4ZPBA 1KVKA 5L1LA 4ZJOA 1IKYA 1XMBA 4ED1A 2HWHA 5LMNF 3HK2A 2IVFB 2ALYB 1ZAWA 2E5HA 2R8IA 4FF2A 4KPYA 5GAGI 3KG4A 1KKHA 3C14B 2XTJP 4XPCA 1SJ4P 1BWVA 4UTGA 4DZDA 2RS2A 2DIUA 5E0OA 3TEHB 1U25A 3PX6A 1IVZA 2OPRA 4DG1B 2I2YA 1FKOB 1RLCL 3EPIA 2VFSA 5ETVA 2EKNA 3KHLA 5BYSA 1KFDA 4WXWA 2KM8C 1CLFA 1AROP 2MQNA 3S01A 3OVAA 1RBOB 3M8QA 4QJVA 5KG2A 3R27A 4P73A 1H72C 2CUYA 1AB8A 4CTAB 2F65A 3GJSB 4J9UE 3C14A 3RW7A 2MQQA 3G87A 4RUHA 4J5OA 4CO0A 4TU7A 1RWKB 1VLOA 3FSXA 2HNZB 1QM9A 2VODA 2JLEA 2CRLA 1Q95G 2V4JB 1JLBB 3N4WA 4CLLA 2XY7A 3MR6A 4DG1A 3GR0A 3GILA 4WF9Q 2I8EA 2BW7A 3RGIA 4JI8F 4DL0C 2OAUA 2XCAA 4O3RA 1Y11A 3ADAC 3BN7A 3N79A 2I5JA 1JJ4A 2ZHBA 5ETSA 1MWYA 3HXMA 2DPJA 1HR0F 2G9OA 2DD8S 1Q8KA 3V6JA 5KFIA 3FBCA 2R8GA 1BLUA 1B7FA 3PEHA 2A18A 4ZVPB 4WBFA 1FJ7A 1XIQA 2RU9A 1N34J 4Y28C 3R1LA 4I2QA 1JLBA 3MEKA 4FXWA 1EB0A 3GPAA 3GJTB 3DRPA 1SQGA 3T9ZA 4FP9A 1SH2A 1VRTB 3G6ES 4OV1A 1QSSA 1X7VA 3JAMY 2JEIA 2EC0A 5DZ7A 2NXUA 3PHEA 4A8OA 3IWLA 3QRRA 3LP2A 4CO5A 4M94A 1I5OB 3MMAA 4X4NA 2OD4A 4AQYF 2B7CB 2E5LF 5L1KA 3H7HB 3KNAA 5M2RA 3BBCA 2GQCA 1KVIA 5ETMA 1QD1A 2VG6A 1D0EA 3CJKB 2HQGA 4KTQA 2FGOA 2FLNA 1AYEA 3GU0A 2HS3A 4X4PA 4FDFA 2ASJA 1RDRA 1P9QC 2DB1A 3C6UB 3AD9C 1RUSA 3JQKA 1X5PA 4F36A 4ECVA 3MFHA 1R0AB 2BQUA 1TZ0A 5J1EB 2FDNA 4ZVHA 1UVKA 2VUGA 4I56A 1VOMA 3M05A 3DGVA 5B0GA 4KHPF 3IGNA 4JI2F 1RZMA 4JV1A 3C6TB 4DPWA 3D5MA 3PR4A 3OTEA 2V0NA 4L73A 5C5JA 3DHWC 1CJTA 4C9DA 2J6TA 3V5RA 5U47A 3VR1A 1S59A 4LF7J 4OHXA 2GW8A 3TAQA 3PX4A 2EW9A 3K2YA 3C3LA 3R6LB 3B82A 1T9YA 1RLDA 1B4SA 2KJWA 2XNQA 1G2EA 3QT7A 2QA2A 4ANEA 4LFBF 5C25B 1N4LA 1WELA 2HZAA 2YX4A 1FHTA 1B3TA 2PI4A 4RW4A 5AXLA 3IR5B 1V6HA 2EPIA 3NOCA 1BGXT 2WSFC 3CW2C 1RT3A 2CPIA 1F5CA 3KLVA 3VTIA 1K0VA 1SUQB 2QYCA 2QV6A 4NRUA 5BJRA 4DS4A 1AZSA 2EFOA 3MWBA 4P6QA 1UWAA 3N5FA 3N28A 3NKYA 3TP2A 2LEBA 3BPSP 5GMEA 4LF6J 4TU9A 3IGVA 3NL0A 4CM2A 4LFCF 4C8OA 3PV8A 2V69A 2DNGA 4BBYA 5MAOA 5GAHI 2Z56B 2ATCB 3AA9A 3QIDA 5HMXA 2CPZA 2YX1A 4TXSA 1ZETA 1HQEB 1YKWA 1UL3A 5HVHA 3OXGA 2QC3A 5BR8J 1TL1A 1RAGB 2W25A 3JS9A 2DO0A 2CQDA 3VQSA 4PWDB 1FKPB 4LSLB 2FJBB 1R8BA 3J7YU 1SUQA 3W61A 1W7WA 1RB0A 3W64A 1XMQJ 2ZNYA 4Q2LA 4M5MA 3AOAA 2P9GA 4CLWA 2ZOMA 3Q2SC 1NKBA 1PO6A 3LP0B 2LXFA 3FSIA 3UD5A 2MTLA 2XMUA 4DQPA 1KP6A 1R6VA 2OJ3A 4QCLA 3KXDA 4ZKAA 3LGMA 3DN9A 2H1YA 1HQEA 4A8XA 2QLJB 4JI6J 2HRTA 2QL7B 3BN4A 2D41A 1X4EA 2DGTA 4ZVEA 1YSJA 3DI6A 4HHJA 3JYTA 2H4WB 3IN5A 1U02A 5KFXA 3W8PA 3V81B 1UAWA 4LF4F 2FQQB 4ATNA 2IRUA 2QEXS 5CZXA 4NA1A 1IBKF 1HHQA 3H20A 4ZJLA 2ZBIA 4DUTA 2EFQA 1H6KX 4YN3B 2QMWA 2VFVA 2XY6A 4M1KA 2FB0A 2EKYA 4DSFA 4A8FA 3H0PA 4I0WA 4IRDA 1NB2A 3NLCA 4DX7A 3CIZA 4LBIA 1PAUB 4KGMA 3G6YA 1L5UA 2POKA 1OSCA 2HGLA 4PG8A 4NLSA 1YZ7A 3D68A 3FMWA 1FDNA 3M1VB 3DM2B 2HHHJ 4DSIA 3CJRA 4B9VA 5IM0A 2EC2A 1DY3A 3GFXA 4DMZA 4WYWA 1P6TA 1PCAA 5KFRA 2PC6A 4HKQA 1S48A 4ZP6A 4F67A 3CCTA 1VI7A 5I3UB 1FFWB 3AJDA 2V34A 2E1AA 1MROB 3AA8A 3V6DA 4PG5A 5L38A 1VQ5S 2DNOA 3QAUA 2QLFB 4X65J 3GG1A 2XB2D 5FLXU 2R8JA 3D0GE 5DJBA 2NR0A 2CDRB 3OJSA 3A8KA 4QR0A 4C8ZA 3W5ZA 3BSAA 4WU3A 2OHDA 3UN3A 4B3MF 1WTFA 3FCHA 1LNQA 4FYXB 4J9NA 1MWZA 4KGZB 2ADBA 4KR0B 2IJRA 4ICLB 2Y8YA 1UVLA 3EICA 4OFZA 2YH1A 1LK5A 4JOUA 3OJUA 4V19X 1ITPA 5DDQC 4RW7B 3Q0AA 2W2OP 1MROA 3P49B 2ATLA 2XQCA 2IY5B 4KBIA 3LGNA 1P8GA 1WF0A 3QNWB 1RU1A 4J9OA 3ZXWA 3A13A 3OFFA 4UT4A 3OQ2A 4CYUA 1QE1B 3OUYA 2F4VF 3UCGA 1RTDB 3U7JA 4GMKA 4DL7A 4CWBA 2CJYB 4NI2B 1C0TB 2ILZA 1V9OA 4RBVA 1IKWB 3DOKA 4FS1A 4CZCA 1FE4A 1U0HA 1VQ6S 4DX5A 3MAHA 4N8OA 4WCEQ 3QJJA 4GC6A 3C46A 1KOHA 2K06A 1OY9A 4KKOA 3OLBA 3PYDA 2I9SA 1YHQS 1FA0A 2ZWPA 4PQUB 2DNQA 2EWHA 2YKMA 2YWGA 2DPIA 3MHYA 4RW7A 2RUSA 1Q78A 4YDXA 1OO0B 1RWMB 1KSPA 3UDVA 1LWEB 2CPFA 2VOOA 4IH7A 3HHLA 1IN0A 3T3FA 2AX1A 3HHEA 5JJBA 4Q8EA 1YVFA 1GTHA 4DV5J 2CQ4A 4IFVB 3BBFA 3DOLA 2NXNA 4EEYA 4ZVSB 5KFDA 1C0TA 1EQ0A 2EBGA 2AEJA 1IKWA 3DLGB 5J2NA 1WF1A 4F26A 4A48A 4C8NA 2PN6A 4IR1A 2MKHA 1MU2B 5HANA 4P2SA 1UFKA 4AFFA 3IMQJ 2QE5A 1VBXA 4O3QA 1F6TA 2DXFA 3ZC4A 3EGVA 1BWEA 3CD0A 2IHR1 3MM7B 2R7XA 2DIVA 5KFSA 4DR5F 2HVDA 1NJXA 4PUOB 2HNDB 2W9CA 2CNOB 2DH7A 3EX7B 1LWEA 3FCWA 5LSLA 3UPFA 2AP6A 5LJ5Y 4X84A 4ZIVA 4M5KA 2JEFA 4DX6A 4USIA 3QFHA 3ILIA 4IFVA 4I68A 2ROGA 5H9FK 1GH8A 5B09A 4C0HA 1VJQA 1GNKA 2LDIA 1SV5B 1VQ4S 2D1CA 3T5JA 2BW2A 1HBUA 2J8AA 3Q23A 2C2NA 3CO0P 5KG0A 3DLLQ 4LF9J 2MSTA 3D1OA 1IKVB 4EWTA 4PUOA 2HNDA 2ACMA 1Y0HA 1S4EA 4X4SA 3BO4A 2ZH1A 1J27A 2DGVA 1WHVA 3MTJA 2IJFA 2YNGB 3OFEA 3PW5A 3P5BP 1OMSA 2QRRA 1T3NA 2WB4A 4JI1J 1R7IA 3G4SS 2HAFA 4I4BA 1YBTA 2IDEA 4CLKA 7FD1A 1RK8A 4DV0J 5DDRC 5CZVA 3KFWX 4N5SA 2ILYA 2BJ8A 4USWA 4KGXB 3O2IA 3N6NA 3ZTRA 1FF2A 4ECUA 1G7CB 4PG4A 1FFSB 3BV8A 1TV6B 2J0WA 4ILRA 1TKTB 3ZTQA 4P7TA 3QO9A 1DFDA 1Q7YT 4F4AA 1WEXA 2O3DA 4KY3A 1NSAA 4AE5A 1APSA 4I2PB 1RCXB 2KRBA 3JQJA 4GKJF 4Y2IA 5HJYA 4F3MA 4ZPWR 3HLUA 1BQNB 4Z7YA 3CT9A 4EYIB 3BREA 3FZ2A 5F8NA 1HHSA 2AQ4A 2ZFHA 3BSOA 1YG0A 1NBEB 2UP1A 2MMYA 4M5LA 3K5OA 3TA2A 3PRDA 4DCOB 2IDLA 4NLVA 2XYGB 4ERDA 1U26A 1S72S 4ELUA 5LJ3Y 1FO1A 4HI2A 1NH8A 5EDWA 1MMLA 1QTMA 2VA2A 2E7XA 2P2CB 3RYLA 3HHDA 2ZZNA 5D3GB 1NMEB 3H5XA 3BDEA 3BQ0A 2UXBJ 2Q3PA 4I2PA 2NLWA 3CCMS 2N3LA 2QT7A 2E5JA 4P10A 3RB3A 4LF8J 1NCLA 1TFYA 4KFBB 2XLJA 1Q16B 5CYMA 3Q86A 1BQNA 3N01A 2ZBPA 3TA1A 2NYIA 2V94A 5KFBA 1NSKL 3I82A 3PYGA 3PR5B 2Q43A 2QL5B 3J81Y 2J0QD 1LXJA 4YUDA 2XS2A 2JVOA 3CJTA 1JNRB 3POTB 4K5SA 2P6TA 3MMBB 3SCJE 1YJ9S 4B9LA 1FVQA 2ZH2A 1RTJB 2YKNB 4LFBJ 1C4CA 1Q81T 2O67A 5HSPA 4MH8A 3JSYA 4CI0B 2UUCJ 4KFBA 3HVTA 3MI7X 5A0YB 3G82A 4GKKF 1GMUA 4CRJA 2ZJQQ 4QIGA 2E44A 3ZZTA 1FRKA 3EMTA 1N5TA 4NMLA 2PT0A 3DDKA 3PX0A 2JRSA 3MPYA 4DL6A 3C15A 4NL5A 1HWKA 2HS0A 2O5DA 1ZPWX 2B7BB 4X64F 1X9SA 4ZMMA 3POTA 1SI9A 1KVJA 3NGDA 1RKIA 5IOLA 1KQFB 4CDIA 3TJAA 3D67A 1TL4A 1RTHB 5IC4B 3FUYA 3TA0A 3OR1A 2DGOA 4A8SA 4JI5J 2KYZA 4URSA 3QGHA 4GO7X 4OJGA 5AE1A 1RAOA 1RYRA 2JOQA 2RUGA 2VZ9A 3GYXB 3V2UC 1RISA 1XNRJ 3A1YG 1KR4A 1LWXA 3EDRB 1HNVB 1KOOA 5DGBA 3R7SB 2DT9A 1BE4A 1VQYA 4LVNP 3MM9B 2JVRA 4F4KA 4IOBA 2BE9B 2RB7A 3IG1A 3OFHA 4WTOB 3G86A 2V2KA 2CPJA 3KLFA 4DPXA 1S0OA 3BGLA 2B5JB 2CZ9A 2CFXA 2W2NP 2EFGA 1DTTA 1FJGF 1WI6A 1WKJA 2XC9A 4KO0B 4ES1A 4TYBA 2CQIA 1RT7B 1TAQA 1EIYB 3Q8QB 2ZD1A 5LMUF 1M5VC 3KOAA 4RKUC 3BS9A 4FVCA 2M8DB 1F5BA 3MFIA 4NYPA 4DPUA 4C48A 4K50A 2YQ3A 4FNIA 2W9AA 3TUJC 2B6AA 4P52A 2U1AA 3P6YC 3T9NA 5KFCA 1VHIA 2MHEA 3QLHA 4QPXA 3QRPA 2GCFA 1DARA 3SEOA 2XWXA 1WDDA 1N5YB 3UDCA 3VZHA 2AJFE 4WFAQ 4DR1F 1KNZA 2R4FA 4CP5A 3LQVA 4FYYB 5D4LA 4JV5J 2A2CA 3EJMA 2BDPA 2XBPA 3KLIB 5K9FA 2C28A 3F41A 2J7KA 4U8YA 1MN7A 4PXDA 2A1BA 1Q8LA 2VOPA 3AHPA 4O4GB 2IBKA 1UW9A 4UF4A 3ET6A 3MTKA 2HHWA 5HQMA 3WIUA 3NWGA 1NK8A 4PQAA 4J9QA 2MDAA 1N52B 2PO4A 2X7IA 1RAJA 4NXNF 4F4YA 3PFEA 1KD1T 2DY1A 3D0IE 4MKBA 2ZC3A 3D6HB 1R0BG 2C2DA 3VGUA 2CQ1A 1YDLA 3MCMA 1DLOB 3L9ZA 2H5IB 3HD1A 3MEEA 4PPDA 3BBBA 4J91A 3F73A 4DF4A 4RU2A 4ZOSA 1RTZA 3TVZA 2ZE2B 3CSKA 4S0MA 3PTWA 4ED7A 1Y3JA 2FGCA 5B0CA 5LSRA 1KN6A 2B4OA 2FZCB 3HVAA 4O4GA 2EK6A 2FZKB 4G6VB 2GFFA 5A2QU 4YB1P 5AJ3F 3LWLA 1MMNA 3RR7A 2CG8A 4IO9Q 3BH7B 2ZITA 3FBBA 2NS1B 1S6UA 4DHVA 4IR9A 3JQMA 2YKOA 2D3UA 3C8YA 1U7LA 2VG7B 2KTQA 4USMA 2LU1A 4LF1A 2F8HA 3TAMB 3FC9A 3N0VA 2AIRB 2IC3B 4DL5A 2LXUA 3ITHB 4WE1B 3VAFA 4ETZA 1AUDA 1JB0C 3M8WA 1VBYA 2ADCA 3HM9A 2OPPB 2BKPA 2ZE2A 1YJWS 2CYYA 5HVGA 4KE5A 2N4DA 5GADU 1DTQB 1T9TA 3G2XA 3DOMA 4KAIA 4JV2A 2F4VJ 4MFBB 1TQLA 4P2MA 2E1MC 1N5VA 2VBWA 2C2ZB 4ED0A 2YWWA 4RW6A 5CCMA 3PW4A 3MUVP 1YITS 2XHCA 3J7Z5 1D9AA 1HNZF 3M6XA 2YKPA 4OYBA 1JJCB 1Q53A 1Q86T 1IBMJ 1FD8A 2Y1LB 3MDFA 3U02A 2WW4A 3TAMA 1YJVA 1X5TA 5KFEA 3QPIA 5I42B 3ITHA 3PIPQ 3V6HA 5B0AA 2W7AA 4OQJA 2IYIA 2WVCA 3T1HJ 2YWEA 4KV8B 2JNJA 2N7YA 3WZ0A 2OPQB 3DLEB 3M4XA 4BLGA 3AODA 3IBWA 3HKZD 3CJQA 2ZZTA 3CGIA 1XK8A 1DTQA 2YVSA 4MFBA 1NO8A 3EPGA 5BYRA 4V1Ak 1Z1ZA 4M5DB 3SV4A 2G1DA 3MM8B 1FWPA 2ZH5A 2HQFA 4QWEA 3UR3C 4NLPA 1GX6A 3R5CA 3BF4A 4DR3F 1RI7A 1ZOTA 5E3RA 3M8PB 5HK4A 3GCWP 5IXUA 3NNHA 3TARA 3ICLA 3AOBA 5ETRA 1RT1B 3CC7S 1ZZFA 3VAIA 2KVQE 3NNAA 2HFUA 2OPQA 3UFCX 3KTQA 3ELHA 4OX9F 2VB6A 4M5DA 1M5PC 1ICEB 1VQOS 1EARA 2WAQD 2FVPA 1VC0A 2HBRB 2HG4A 2OKQA 3VALA 1SC6A 4U7UD 2HFNA 1OSDA 1WD6A 3T41A 2QA4S 5T41A 3QT8A 1SJQA 3LP1A 4OYMA 2WZ1A 2OLWA 3MAAB 1TKXA 2GS8A 1WEYA 3M8PA 1S1WA 2ZVIA 3M30B 2Z58B 1LEOA 1LW0A 2J7UA 3Q8PB 4NZ6A 3GONA 4DR7F 2E1RA 5F8LA 1RT1A 4TY8B 1ZPVA 4QBUA 1QAXA 2LKZA 2KH9A 2CJXB 1S6QB 4PAAA 1RCOB 3BSCA 4WZMA 1X4BA 4KH1B 4FZVA 4KPCA 2LQ8A 2CJ9A 2LYVA 5SUHA 4A8QA 3JTOA 3MAAA 2F40A 1WHYA 4XPEA 1B7YB 4LRDA 2KZMA 3BKFA 4QWAA 5FJ4A 3CCRS 3I87A 1L3KA 1RBLA 2Q6BA 2LEAA 3GIJA 3M6WA 2IVMA 4ANDA 4NEYA 1RACB 1TTHB 3BR8A 3T5LA 5H9EK 3U1LA 2V2QA 3PYEA 4ITSA 1QAIA 4WFZA 4ID8A 5IV4A 2XMMA 4YDDB 2J9EA 1FRXA 3M2RA 3UCUP 2PFDA 1U1OA 3M6UA 2LP4A 4TVAB 1GMWD 3UI3A 3ETOA 1RA7A 1KHVA 4I6WA 4WKRA 2B8QA 2H5EA 4P2FA 1YX2A 4B08A 2MLZA 3SSRA 2QA4G 2P6SA 3D4JA 3UN5A 3TR5A 1BUXA 3EDQB 5B0EA 1XMOF 1J5EF 2H65B 4X2BA 3OSPA 1Q82T 3H2VE 5KT7A 3UNYA 4EYHB 4ZPDA 1UVMA 5A6WA 2AZ1A 5DO2A 2ALZA 2VASA 3HSJA 3R5JB 1U1KA 2OI2A 3J80U 2W1BA 3CXCR 3T6JA 2YH0A 4QWDA 5KFUA 4RBTA 1U1LA 1HKAA 5LSOA 1T95A 3K57A 2EFVA 1NH7A 4DCPB 4DWIA 2EFPA 3VF0B 4OI0A 1B0TA 4KT0C 5J2MA 2I1RA 4Y65A 3QZ8A 2E9ZA 3EGWB 4KYZA 4ZPVR 1NJIT 3I96A 1VC5A 1NJWA 1MMDA 1RWOB 4KHRA 4DV6J 5LXRA 4L3KA 1HI1A 4PXEA 5B0DA 2NZ4A 2DXEA 4B3OB 5KFGA 1WOOA 4PEOA 5RUBA 1H3DA 2KG1A 4O3SA 2J9DA 4DOZA 2AEFA 1OS5A 2E5GA 2LU2A 3D1HA 3K17A 3NG8A 3I5AA 2K1RB 2KYXA 2ZJRQ 1AFIA 4ZVTB 1CS4B 4HDHA 1FK9B 3S7RA 3BGFA 3CCVS 4CLZA 3AJ2A 2DNLA 4RL1A 2E66A 1LK7A 3RR8A 4C8YA 4QZVB 1DZ5A 4FXVA 2ZH7A 3RBZA 1OPZA 2RRBA 2MLXA 4OZJA 2QSWA 4Y6IA 1W2IA 1VHFA 2L9WA 2KG0A 3E2EA 1UZHA 2BE2B 2J8SA 4PABA 3M32A 3CD6S 4CLSA 3W1YC 4OYOA 2C2MB 4DN0A 3K5PA 3MEGA 2D74B 4C11B 2JL9A 1KTQA 3I0RB 3TJ9A 4B3OA 2CVIA 3JSBA 2ZKUA 4DSLA 4JI3F 2RMLA 4U95A 3CJSA 1SIZA 1CS4A 1NDKA 2R2TA 2YY3A 1YQHA 2AGOA 2G2ZA 3OW2R 2PMHA 3M8YA 3OL7A 1BHNA 4ZPAA 4DS5A 1X4AA 2XLIA 3KLGB 2BV3A 1C1BB 4GO5X 2BE2A 3IAM9 2FTRA 3SQGB 4NLYA 5H9EJ 2ZBQA 4ZVOB 2AJ4A 3TZYA 1R8AA 1F3FA 1S1XB 2VG5A 1WG4A 4N41A 3IR6B 3I0RA 2ZM6J 3TEGA 2ZC4A 4LRAA 1RU2A 2CXEA 1U1MA 3W62A 3LTOA 1JLAB 3MMCA 3GMGA 5IWAJ 4PXBA 3AB2B 2HFVA 1F9FA 4WP3A 2F1FA 2VPYB 4YS2A 4RNMA 3KUHA 3FFIA 2D3ZA 3B4MA 4OX6A 4HACB 3GG0A 5D0EA 1VQ9S 1D8ZA 1ZYQA 3T5KA 4DV2F 2DNMA 5C42A 1C1BA 4DR1J 4ID5B 5HMZA 5L1JA 1YZ6A 3OL6A 2VA3A 4B9NA 3ZO7A 1LOUA 1XNQJ 5ADZA 3OTDA 2P8IA 2W2PP 2UUBJ 5D0GA 1S1XA 2QLWA 4ED3A 3Q8YA 5EWEA 2BRKA 3IWXA 3BGUA 3TRGA 1H2VZ 1T9XA 2QZ8A 3M9NB 1S1TA 3H90A 1NM2A 2VONA 5KAKA 1DQAA 1YJ7A 1JLAA 2RF2B 4B3TJ 4NXNJ 3CO9A 3SFGA 3OPKA 3C16B 1UJ6A 2MJNA 1HNXF 3THVA 2C2KB 4ZP8A 4HACA 1JXEA 4MIBA 3O5TB 5CYQB 4YR2A 1U2CA 1X9WA 1JLFB 1TKZA 4DPYA 4K4SA 3P5TL 1RP5A 1VYAA 4USKA 2IRYA 2E1CA 4X62J 2CNKB 2UXDF 2OPSA 3JSRA 3K8VA 4MKAA 3B4DA 2A6OA 2XZTB 2CJAA 3VQTA 3SYZA 1OYEA 2VDIA 2O01C 1NPKA 4ZLJA 4UY8T 1VIXA 2CPEA 3C16A 2DHXA 4P71A 3MECB 1FVSA 2YTCA 2RQ4A 5KT4A 3IC1A 2KDOA 1JIHA 3DYAB 2GZOA 2WOMB 3TNVA 4OL8A 3C2PA 4MYTA 3KJFB 1Q5YA 3TQ1A 2DNHA 4FNHA 2GAGC 1SVDA 1HBNA 1HA1A 1JLFA 1SL1A 4ETXA 1IQTA 2LDYA 4DR2J 4Q45A 3BB5A 1D9DA 3Q8SB 1HPZB 2DNZA 2LQ9A 3JXOA 1VGYA 4DZ6A 3RAQA 2ZDPA 5KG3A 1HNZJ 4B3SF 3GIRA 3H25A 4OYAA 3MECA 2CPYA 2FVCA 2CQHA 2ZVSA 2DXDA 3OXFA 5CD4A 5L39A 3LF0A 2Z57B 2DRDA 2HFOA 2UVWA 2IM3A 4NYZA 2BR0A 2VIHA 4K4UA 3Q8VA 4RR5A 4KC5A 1U1PA 2U2FA 2HGMA 2BEFA 4J9RA 4UOFA 1HYSB 4QIEA 1D09B 1R8HA 2EVZA 2YNIB 4YB6A 1RA6A 3H4DA 1H7WA 3KJVB 2RU3A 4CLPA 2QL9B 3QIPA 3A3PB 1WI8A 3P45B 2ZOFA 2M4MA 2BANB 2C3MA 2DHHA 3QT5A 5K5MA 3CCJS 3A3NB 3SDEB 2RE1A 3GQCA 5KFJA 3R2CJ 4Q44A 1SB6A 4ECRA 4C0BA 2FHOB 2DKOB 3PZPA 4J37A 1MLAA 2AJ2A 1JWWA 1S79A 3QSYB 1XWLA 1K1QA 1ZAVA 2MZSA 1SJ1A 3KK1B 2CA9A 2DY9A 2XMJA 2HLUA 3W9JA 1RT6A 2ABYA 5E33A 3VWSA 4Z2XA 3MCSA 2OSQA 2HSEB 2NUUG 4DL2A 2VV5A 2KXHA 3KJVA 3BGOP 2OEMA 4AL5A 4MMOA 3D66A 5KFHA 2WTFA 5ETQA 2CWXA 2RDDA 3OXLA 3MGJA 2BANA 4R8UB 3V4IB 2HS4A 3MOZA 4K2XA 3LALA 2AJQA 3CDAA 3SDEA 4PKDB 1Q79A 3ZZOA 4ECXA 1JJHA 4JI7F 2AYMA 5GVQA 4B3RF 1I94J 1OY8A 3R1HA 1PYSB 5I3QA 1RTIA 4I6YA 4WIIA 3HP6A 1HNWF 4UUXA 3TO8A 2E9RX 4OJ1A 3RW6A 2GVDB 1UFLA 4EO8A 1VQKS 4U7CA 2D9OA 3GIKA 3PNIA 5A8RA 3R7BB 3TJ8A 1RBAA 2F3JA 4C98A 5KFWA 2K3KA 2WVEA 4Q0BB 1TMJA 3ENAA 3RTVA 4EFAC 4R8UA 1VCTA 3V4IA 4CNZA 3NRBA 5DDPC 4H4MB 4K4WA 2YWFA 3NMAA 2FPHX 4ZCIA 2DEIA 2MY7A 1OY6A 5KFNA 2QMUB 2CAJA 4NASA 5KT6A 2H5JB 2RHSB 3OFGA 3BYPA 4U6PA 1C1CB 3QAEA 2UVRA 4ZPTR 2UUAF 3I9V9 1ELOA 3DDNA 5KG7A 4LFAF 1WC5A 1S9FA 3DLHA 2AKWB 2C3YA 3H8YA 3UR0A 2GVDA 2ZHOA 1DAXA 3V4MA 4WP9A 5T14A 1EKSA 4K5RA 3OTOJ 5IQQA 2DR5A 3P4UB 4L3NA 2IM2A 2LQJA 3PIOQ 2P5VA 2UZAA 2M7SA 4RZRA 4DUZF 4Y0FA 4QR1A 3KLHA 2MSSA 1TR0A 1Y9OA 2K7KA 3SI8A 1HLWA 4B9TA 5THWA 2EBEA 2RKIA 5C2GA 3GTYX 3DHXA 2W7OA 1NU4A 4EI2A 4RPFA 3C19A 4Y00A 3V6KA 5IV3A 1UEKA 1N36F 2FVSA 1Q4RA 4BWMA 2FJEB 1WHXA 1SKRA 4KGVB 1S9GB 2JC0A 2V68A 4X4RA 1FRJA 2KFZA 2M5YA 3ETMA 3KDOA 4QU6A 3U1MA 4W92B 1NJYA 5IT0A 1VQNS 2MB0B 3LPEA 4LF5F 5GAEU 4OZ5A 3NGRA 3TAPA 1WACA 1IBLF 4WU2A 1K8AT 2KT2A 3KG0A 3K5MA 4X4QA 3PRBA 4DV4J 1CC8A 3S1TA 3CPWR 3E3XA 3AD8C 4XK8C 1EAYC 1N88A 3L4BC 2H51B 2KL8A 1N33J 4RW9B 2CWKA 3BGRB 5L46A 3VGSA 3MMJA 1T3OA 2YXLA 3K58A 4EU0A 3MPUB 3PO5A 4IH5A 3KHGA 4TU8A 3L7OA 4USJC 3FCVA 2WSEC 4Y2CA 3RG6A 3RB4A 1FX2A 1CC7A 4OX7A 3LANA 5A8WB 2UXCJ 2V8VA 1FKOA 2MHNA 2APOA 1UVIA 5E3PA 4XDDA 3RBEA 2VBXA 1WG5A 2OP5A 3ZTOA 4U67Q 2DRAA 1U6FA 5C24B 4G65A 1LKZA 2YKAA 2L41A 3K5LA 5T7LB 2J9CA 3CJ3A 4CTAA 5L8RC 3T1YF 4DR4F 3I5CA 3BGRA 2FC8A 4ZN1A 1FDAA 4M5NA 4N8NA 2ZH9A 1WC6A 5MLCV 3PKYA 1VBZA 2OUGA 3UWTA 2HNZA 2CG4A 3GV8B 2V4JA 2OTLS 4ZN3A 3HSDA 3J7YI 4DV1J 1IKXB 1WKKA 2XNRA 2CNNB 1HNIB 1ZTWA 5K8MA 3SSSA 4ZLNA 3QWUA 2DO4A 4OIXA 2CZVC 4X4VA 4WXOA 2BOAA 4K0KF 1FXDA 1WC3A 2NSCA 3JAMU 5F8GA 1S7HA 1JLEB 4I69A 4LIWA 4OZNA 3RBDA 4Y3CA 4O3OA 3UDEA 4ZCMA 2AV5A 2XY5A 5K14B 4L72B 5L9XA 2JH3A 2XGQA 1LQ9A 1PILA 3JTPA 3TZWA 1A6LA 4UW2A 2H48B 1FNOA 4F0KA 2HHQA 3US5A 1FJEB 3TOQA 5ETLA 3FK4A 2WBRA 5HP1B 3IM8A 4OZ1A 1VRTA 1HNIA 2W01A 1RWVB 1QSYA 2X1BA 3CD7A 2KN4A 1SC4B 3A8JA 3O1LA 2KKHA 2V67A 4DV2J 5A6PA 1EX8A 2GGPB 3PRVA 5ETPA 3UD3P 1JLEA 2GV1A 1JNZB 2QSFA 2AU0A 1L3UA 1VRUB 3VCDA 4ED4A 4KRWA 4HEA9 4CO2A 2VQEJ 3LPYA 3M8ZA 3CJKA 1KDNA 1QSLA 7AT1B 5K14A 1YRXA 4I7FB 3CNQP 2HBQB 3MM5B 4G1IA 1K9MT 2WVFA 3M2UB 1GTEA 3DMJB 3SMZA 3C6UA 3TX8A 3FVYA 2BJ7A 3DLBA 2RAQA 2BM1A 1R0AA 2VJUA 3FBEA 1Y4ZB 2VFTA 5J1EA 2X3DA 4EBEA 1AA1B 3TVYA 1N32J 3IRXB 3I9ZA 4QIVA 3EGNA 2GGPA 8AT1B 3AQPA 5DG9A 1XC9A 1RHKB 3C6TA 3NCRA 1K47A 2HQIA 2W2MP 3ZZRA 4ZLPA 2GMJA 1FD2A 1FRHA 2BZ2A 1U48A 1YRUA 5KFOA 1RADB 2E29A 3G6XA 5FIIA 4NOHA 3G8SA 5CD4H 4CH1A 4U7UK 3MM5A 2NXEA 1UEUA 3M2UA 3DMJA 1IM6A 1EKRA 1H2UX 4OI4A 4C6AA 5C25A 2OO4A 3H2UB 1FTCA 2Y3YA 3QJLA 2QTWA 3R2DJ 1VK3A 3RUBL 2HRUA 1IM4A 4B17A 1URNA 4K4VA 4PG6A 1QAYA 3S6EA 2JC1A 4A8WA 3FEYB 2QLBB 3EWGA 3LWMA 4NXMF 2PMWA 1WKLA 4XTTA 1JLGB 2QA1A 1B0VA 2MQ8A 1VDHA 3M7VA 3DLKB 4G1QB 3CDEA 4QU7A 2GJ2A 4PZVA 1FT8A 2RJZA 4G3IA 3Q8RB 1JKHB 3UW1A 3QQCD 3A3OB 5GMDA 3TANA 3HVRA 1EHWA 3AY0A 3VVTA 2HKEA 4RNOA 5E3AA 3PYFA 4YHHF 2XSJB 1ULRA 3CJ2A 2FIUA 1S49A 4W98A 4F3QA 1K73T 2YNHB 4HH1A 4OMFG 1NK4A 3KK2B 2MGZB 1CJKB 2EEYA 5F3ZA 4PWDA 1FKPA 4LSLA 4ELVA 1JLGA 4O44B 3SFUA 3G71S 3IP0A 2AMCB 1GAOA 1YGYA 3P3DA 3K0JA 4O3PA 4G1QA 5EWFA 5EHHA 4ES3A 5G0RB 2R7TA 1JKHA 3HFVA 1REGX 1YJNS 3LP0A 3CE8A 1O6XA 1T02A 2HNYB 2G4BA 3KG1A 3UCZP 3R8YA 1AW0A 1HMVB 3VVUA 4LF7F 3NGSA 3G8QA 2MZRA 3WC0A 2XLKA 2W4PA 4DU8A 1NHVA 5D0HA 2ZUAA 1U47A 2XYHB 4USUA 2DGWA 2QLXA 1GXTA 4D3GA 4CLYA 3KK2A 2MGZA 1CJKA 1ZM4A 4Q43A 1QAJA 1F9EB 4TNOA 1O5JA 3UVJB 2GQQA 3V81A 3FQLA 2NXCA 3B78A 4HYKA 2M0GB 1HWUA 1TL5A 3RB6A 5DS7A 4AD6A 4UZBA 4I64A 5G0RA 4X66J 1U6ZA 2L9DA 4IG3B 1BQMB 5HMYA 4DR6F 2B51A 1H74A 4XAKA 2DGQA 2HAIA 4MTPA 2HNYA 4NE9C 4U9RA 1B99A 3LO3A 2A0FB 2OMOA 1VJWA 3J7AN 1GMWA 2BYCA 1HMVA 2KO1A 4RNFA 2VPXB 1XTZA 1OPIA 4KH0B 5EGYA 3SSQA 4LF6F 1S1UB 2QG9B 1SQFA 2VD3A 3ISNC 2F7VA 3DXSX 1RHMB 5F3TA 2I6WA 4AUKA 3CCLS 1Q7LB 5HMWA 4EZ9A 4AXIA 4TYAA 1SCJB 4WZQA 3M1VA 3DM2A 4RU9A 3HF5A 2QFIA 3OL8A 1M5OC 1B64A 4OYZA 1IUJA 2F5GA 2QIFA 4ANCA 2K8GA 2O1PA 3GJRB 5BR8F 1E6YB 4IG0B 1UA1A 2IMWP 5I3UA 5ETNA 1BQMA 2GVZB 3NS6A 1SKSA 4ALZA 1TMMA 3U27A 4DUYF 2CJBA 4NA2A 3IRWP 4J9VA 1TK0A 2D3O1 1S10A 1HI0P 4FPIA 2RT3A 5FDLB 1NSQA 4AYBD 4DQRA 1ZTTA 2EK1A 2UUAJ 3WDOA 3OTCA 4IFYB 1MN9A 2M52A 1X4FA 3QGIA 4K4XA 4B02A 1V3RA 4F2RA 1CJUB 4WFNQ 1RWXB 2Q66A 3JSMB 2FJDB 3OSNA 2LECA 4ICLA 3ZZUA 3RJMB 4DCJB 3GFHA 4DUZJ 2WONB 4JI6F 3GJQB 2OMLA 2QFJA 2BJ3A 4IOAQ 1UWBB 1XEZA 1A9NB 1DBDA 1Z4UA 2RDJA 3FGVA 3W2WB 4BC7A 1QE1A 4FYWB 5AE2A 4R5PB 1YBUA 1RTDA 1NZ8A 4UUWA 1PAEX 4NI2A 4MT1A 1RHRB 1Y5NB 2GMHA 4DSJA 4IFYA 1TK5A 3OVBA 4ECWA 1NK6A 5LMNJ 3PJWA 4NRTA 4GVBB 3CC4S 3NMRA 2BM0A 3JSMA 1XR7A 5E5NA 3H40A 1PJ5A 4PQUA 5AT1B 1FNXH 5IT4A 1F3VA 1N56A 1UWBA 3DCAA 4NLDA 3EXCX 2HHHF 4YR3A 2V9KA 4DSEA 4ZVGA 4LRBA 5LL6d 2M9KA 3PCOB 3FKBA 3D6TB 1UTAA 1ACMB 3MEDB 2F8MA 1S97A 5HAOA 4Q8FA 5HL7Q 4K59A 2OIHA 3MR7A 4ECZA 2MQOA 3DLGA 2NPIA 1U8SA 2X3GA 4LF2A 1YWXA 4BWJA 1MU2A 4X65F 4GVBA 2B8PA 5KTQA 2C2RA 1ZA2B 3H98A 1SXLA 2YQ0A 3FRYA 3FDSA 4DXLA 1DJ0A 3MM7A 3R3TA 2NREA 2IIHA 4QR2A 5D4OA 4FBTA 3NS7B 2G2YA 1YLXA 5J2QB 5A8KB 1RT2B 3L3CA 4ECQA 2G0CA 4F4WA 2JFDA 1T94A 1NZAA 4JI4F 2YKQA 3UDLA 4ZJQA 4GC7A 3MEDA 4GVLA 4JI8J 5CA5A 1UKUA 4OZ3A 3MR3A 3E01B 4K2JA 2NXJA 2ZUGA 3CMES 4MKVA 1V5IB 3EM1A 1RAFB 2G1HA 3CB4A 4NPOA 1SV5A 3OHBA 2MZTA 4ZK7M 1FX4A 5F8IA 5F8MA 4OYXA 3QRQA 1HR0J 3HZGA 4IRCA 2UU9F 1HQUB 2V4RA 4YOEA 4ED2A 4DR4J 2Y1RI 3HJVA 4B9UA 3DRRB 1TL3B 2IBOA 4NLOA 3M9MB 4A4JA 1IKVA 4PR6A 3UQSA 3FBFA 1GXLA 3H2LA 1IKYB 2DRBA 1F5AA 3GE9A 5KFLA 4LMZA 3B8HA 1HI8A 4O0IA 4HH0A 3IFEA 2FLOA 4DSKA 3SV3A 5KFYA 2KI2A 2YNGA 5E41A 2DNRA 1NKEA 2XM3A 1ZM9A 3J81j 1CPZA 2B4VA 3LW5C 3NS5A 5D77A 2GNKA 3HMJG 1F9HA 1RWUA 1T0TV 3NCPA 2OPRB 2V4QA 2B4UA 2OGUA 3QWPA 4AQYJ 2E5LJ 4L75A 4FS2A 4J7CA 1TUVA 4WKYA 3WX8A 3T1AA 3N9UC 1HQUA 2FZGB 4J9KA 4XO0A 3IBFB 4IDKB 4NCGB 1T9VA 3LUYA 4CO4A 1KBRA 1TV6A 3M8QB 1KTVA 1TKTA 4WPAA 4OI1A 1XQIA 1JQGA 4Q2MA 5F8JA 2OELA 4R0JA 2HK3A 1BD6A 1KWMA 2KT5A 3PHTA 1T05B 5KFKA 4WFBQ 4UOHA 2BJ9A 4K4TA 1Y5LB 5F41A 2UVVA 2KHCA 4KHPJ 4JI2J 4WFYA 4IQXA 1RWWB 4OZ2A 3PO4A 2KB2A 5F0UA 4BCAA 1I51B 3MCNA 5B0FA 2LXIA 4IDKA 3J81U 4NCGA 1RHJB 1X60A 1SKWA 2H9ZA 2I5JB 5EX0A 1FI4A 2ZNZA 5D3GA 4F8RA 2XMKA 1R27B 2W24A 4JP8A 2XEXA 1C2PA 1DURA 1T05A 2AYGA 2RNEA 5ITHA 1X31C 4LF9F 2K7JA 3PJ9A 4ILMA 1F1BB 1QVFR 5H9FJ 1T9UA 5CABA 4I2QB 5KG4A 3PXGa 3CCUS 4USHA 3DRPB 3GSDA 1U1QA 4OZ0A 3ENVA 3M8RA 4FN5A 1WC1A 4KSEB 1M5KC 1S7IA 3O6QA 5M2UA 4U96A 1VQ7S 2XGPA 4TKTA 1U09A 2RH3A 3SCIE 4WJBA 2WW8A 3MMBA 3LP2B 4JI1F 4TN2A 3OR2B 3MMAB 1FRMA 2R2SA 1OIAA 3TUPA 4LFCJ 4DV0F 1RTJA 3CCES 3CJ4A 1PIEA 2YKNA 3M9OB 1VR6A 2VG6B 2Z2YB 3ILOA 4KJIA 3ZTPA 2M70A 2V8GA 3CCZA 4NZ7A 5IQ6A 5HROB 4LUBA 4HR2A 2OD6A 1MNEA 1Q1KA 1W25A 5A0YA 5DLFA 4WTYA 2DEJA 4NXMJ 1XN9A 4DQIA 2Q1LA 3BQ2A 2N4CA 1Y00A 2J0XA 1REVB 1UJ4A 5HI7A 2Q6CA 1LFPA 4A8MP 3BKUA 1LFWA 4LQ3A 3FNNA 5FD1A 3JTNA 5GADI 1IXKA 4F50A 3BH6B 2R8HA 4EUVA 5IS2A 3OR2A 5D0RA 3KK3B 4R0EA 4C2MA 3HHNB 1WC0A 4URGA 1FEEA 1RHQB 1AFJA 2KFNA 3A8IA 1CJTB 2MPUA 1VC6A 1RTHA 3FSYA 5K20B 1M1HA 3ZFVA 1ROFA 5HROA 1RABB 2J6UA 2VDHA 5HLFB 1NK7A 1RWPB 4YHHJ 5KFFA 1GX5A 3RRGA 5CCLA 3ZZ0A 5CHCB 5E3QA 4PXCA 3BO2A 4NCBA 3THTA 2XULA 2UXBF 5HATA 1HNVA 4FYVB 1REVA 2GA7A 5EWGA 1RHUB 2DGXA 1OQ3A 3MM9A 4LF8F 2YWHA 4K8RA 1JMTA 2WCXA 4LF4J 3O8WA 4RNNA 5GAGU 4RW4B 2X1AA 1FRLA 2DR8A 1IBKJ 1XR6A 4YB5A 2B5JA 3SQOP 1VQ8S 3KK3A 1RT3B 2FJAB 1CEZA 4DFPA 1OYDA 3CDWA 2LQ5A 3DU6A 4NLUA 3TX0A 3HFKA 2HBZB 1X8DA 3QBCA 4YQWA 4KO0A 4MAKA 4XDCA 1AZSB 4ZCKA 1RT7A 1ZA1B 1IR1A 5HO4A 3BPDA 5HLFA 3TWZA 4TLQA 3C66A 4M5GA 1HARA 1YRTA 2DHGA 1T8EA 1PYTA 2DTJA 3BEGB 2FJWA 3Q83A 2V8DA 4DV7F 1PBUA 2R9LA 5DQHA 2HBYB 2A3JA 1VISA 2UUCF 3FMBA 8RUCA 2MKJA 3ZNUA 1LWFB 4RLEA 2LLZA 3LA0A 1AUSL 4RUBA 4ZS6A 1TL1B 2MYFA 2IJNA 1N5YA 3PDNA 5M2PA 1WSRA 3KJNB 4DR6J 1RT5B 2C1EB 1PJ7A 4ZITA 2UVUA 1X5SA 2AZ3A 2MKSA 4C0OC 3KLIA 4TQSA 3HI9A 1FEHA 3SCLE 4LRCA 1PG5B 2SXLA 2C2OB 4ENOA 3HSGA 4ECTA 2R7SA 4DV3F 1M1KT 3GFYA 3I31A 1IJEB 1F2HA 2PEBA 3MR5A 4B3MJ 1AXQA 3J7ZT 4JI5F 3TQEA 2VBYA 3EVOA 3CULA 4ZPCA 9ATCB 1DLOA 1LWFA 2IM0A 3FEZA 1FKAF 4LR8A 1XNRF 2N82B 1UZDA 3LGHA 4YB7A 1RT5A 2BABA 2XMVA 3DI6B 3JYTB 4AL7A 1ZM3A 5GMKa 4CO3A 3G96A 3QGPA 2DNPA 4DUYJ 2C3OA 4JB8B 2X1FA 1YJUA 1NDPA 4OHVA 1X4CA 4USVA 3DKDA 3MUTP 2COLA 1P27B 1IR2A 2VPWB 1WJ9A 1QUVA 3CTRA 5HN0A 1UJ5A 3DC2A 3VAKA 2ZH3A 3SIPB 1PC5A 2HK2A 5B0BA 2G2OA 2VG7A 1TKDA 4EBDA 4ZCLA 2W8LA 2IC3A 5J2PB 2JEJA 3HVWA 4WE1A 1G1XA 1TP7A 4LBHA 1HD1A 1KHWA 1SBRA 3HJFA 4N47A 2OPPA 5IM0B 1OJ4A 2GO8A 2AW0A 2JJ4D 2M8HA 2BRLA 3AJ1A 3E8OA 4H4OB 3D7SB 4ZVRB 4QOTA 5HQ8A 2BQ3A 1W26A 4ZVQB 3VV2B 3V6DB 5JMNA 4X4OA 2GIQA 1N0VC 2RQKA 1NK5A 2Y9HA 4JV5F 2ZBRA 2W7PA 4FF4A 3CMQA 2GHPA 1HD0A 3R6GB 4QQBA 4OHYA 1H38A 4P9SA 2R7QA 2DR7A 2NYHA 2KZZA 1A0OB 4DR5J 2VKZG 1NXIA 1O8BA 4C7QA 2Z2LA 5J2PA 5I42A 3NOGA 4XIUA 2H54B 3KLEB 3ILJA 1RAIB 1HL6A 4Z7CA 4J9LA 1S1VB 2F9JA 4RBUA 4KV8A 4M95A 2WB1D 4M63A 2DHAA 3DLEA 2Z30B 4H4OA 5J1PA 3AT1B 4WYLA 1X0PA 3PEJA 1CG2A 2K2PA 3CF5Q 1IWAA 5IT9Y 3OT9A 1Z2LA 2HFSA 3DRXA 2X1GA 5EUHA 5FLXY 2ROPA 3EVMA 2MKIA 3A12A 4ECSA 1P1LA 2NCKL 3D9BA 3MM8A 4PYAA 3RAXA 5IT9U 1N8RT 2AT1B 1C0UB 4CYUB 3CVKA 1FESA
chains in the Genus database with same CATH topology
2ZJQQ 3D28A 1U4BA 4QIGA 2C3UA 1YJTA 5D78A 2E44A 3ZZTA 1FRKA 2HQ3A 2RRNA 3MMJA 3OUYB 1T3OA 2VFUA 1N5TA 3BDPA 2VKRA 3K58A 4EU0A 2GHVC 4NMLA 2PT0A 3O3LA 4DFMA 4B9MA 3DDKA 3PO5A 2GIRA 4LSNA 3KKFA 4IH5A 3RZAA 3PX0A 5F0WA 3KHGA 1LV5A 2JRSA 3L7OA 3MPYA 4USJC 4TU8A 3G8TA 3TUIC 2DHSA 2GO9A 3ULHA 4DL6A 4RW8B 3DOKB 2WSEC 2VH7A 4Y2CA 3RB4A 4H4KC 2YNFB 4NL5A 4KB7A 1CC7A 4OX7A 3KLEA 1HWKA 2HS0A 1R6YA 2O5DA 1ZPWX 2B7BB 1S6PB 3I6PA 4RUCA 4X64F 3LANA 5A8WB 5GAHU 1X9SA 4NX9A 4CIOA 4ZMMA 2Z8QA 3POTA 1SI9A 4R25A 1W2BR 1KVJA 2V8VA 1FKOA 4F4XA 2FD2A 3NGDA 3K7RA 1RGVA 1S1VA 2MHNA 2APOA 1UVIA 5E3PA 4XDDA 3RBEA 2VBXA 2N7CA 1RKIA 3I0SB 1WG5A 1KQFB 2JHEA 4LIRA 2J5AA 2OP5A 4KKOB 1LWCA 4U67Q 1SL2A 3W2VA 2DRAA 2BVZA 1TL4A 2CIMA 4HT7A 1RTHB 1U6FA 1M5SA 2I38A 2C3PA 2YKMB 4OI3A 4KGKA 4V19J 4JYAF 3TA0A 2P9EA 3OR1A 5C24B 2KXFA 2DGOA 4A8SA 4PPZA 4W90B 5KOWA 3OVSA 1LKZA 2KYZA 2YKAA 2L41A 4QW9A 3K5LA 2ZDOA 5T7LB 4URSA 3QGHA 4GO7X 4OJGA 2J9CA 2EI5A 5AE1A 4NLQA 4QYRA 1U1RA 1RYRA 3HHLB 3NAIA 3PJXA 1R43A 2JOQA 2RUGA 3SXLA 3CJ3A 2VZ9A 5G4DA 5DDOC 4CTAA 1UEVA 5L8RC 5DQIA 3GYXB 3T1YF 4DR4F 1ZZNA 1X4HA 3V2UC 3IWNC 1RISA 1YBAA 3I5CA 3BGRA 4LVOP 2FC8A 4C4WA 4IG3A 2B9YA 1C0UA 3A1YG 3U1NA 1KR4A 1FDAA 1R8CA 5IZHA 4N8NA 1NK9A 1HNVB 2ZH9A 1BQXA 5DLGA 3P96A 4QWCA 5MLCV 3MURP 3PKYA 3W7BA 1VBZA 1KOOA 5DGBA 2CQ2A 3DOLB 1XMQF 2DT9A 2FHJA 3UWTA 1YI2S 1VQYA 4LVNP 3MM9B 2JVRA 1VQLS 4F4KA 3QMQA 2HNZA 2AYBA 4IOBA 1D3WA 2CG4A 2RRAA 3GV8B 2XG8A 2V4JA 2RB7A 3IG1A 3OFHA 4RW8A 5J2NB 2KXNB 2R2RA 1KRPA 1WNEA 3G86A 2OTLS 3QIPB 2HHVA 1Y3KA 2YNFA 1G3OA 4KQZA 2V2KA 1OWXA 3CIMA 3FEXB 2CPJA 3J7YI 1S1UA 4PWUA 3KLFA 2ERRA 1S6PA 3M30A 2B9WA 4HL9A 1IKXB 1ZM2A 4UY85 1S0OA 3BGLA 2XNRA 2B5JB 2B3TB 1M90T 4TY8A 1HNIB 3D0HE 1ZTWA 5K8MA 2CFXA 3BR9A 3SSSA 4WK1A 3I0SA 3QWUA 2DO4A 1IBMF 1FJCA 2EFGA 1DTTA 4OIXA 1FJGF 2PA8D 4Y2MA 2CZVC 4X4VA 1WI6A 3EZUA 4WXOA 1PSDA 2OTJS 4QW8A 2XC9A 1S6QA 4KO0B 1WEZA 4ES1A 4K0KF 1FXDA 3BJYA 4TYBA 2BA9A 5I4MA 2NSCA 2CQIA 1MSWD 1RT7B 2W9CB 5F8GA 2LEPA 1TAQA 2VC1A 1S7HA 4RUAA 3Q8QB 3R5BA 1FNMA 2ZD1A 5LMUF 1M5VC 3KOAA 1JLEB 3I32A 4RKUC 4UQGA 2JFKA 3BS9A 4I69A 4LIWA 2W9BB 1SL0A 2VFRA 4EGLA 1E6YA 3CC2S 3T1HF 4OZNA 4AL6A 1RT6B 4FVCA 4IG0A 5CYJA 1B0PA 3D1QA 5SZTA 3RBDA 2DGSA 2M8DB 4FXDA 2HHSA 1F5BA 3MFIA 4MK8A 4NYPA 4Y3CA 4IKAA 4MYUA 4YR0A 4O3OA 4ZCMA 1QVGR 4K50A 2YQ3A 4FNIA 2AV5A 2XY5A 2W9AA 1VMBA 5K14B 3TUJC 2UUWA 2DCLA 4L72B 1SIWB 5E2QA 5L9XA 3X3UA 4C8KA 2DGUA 2JH3A 3EYZA 2B6AA 1LQ9A 3TW0A 2XGQA 4ED8A 4QPTA 2U1AA 3P6YC 1PILA 3JTPA 3T19A 3T9NA 5CH7B 3PY8A 2UV8A 3DNCA 1S0MA 2M2BA 1A6LA 4UW2A 2DH9A 3F44A 4OLOA 5KFCA 4AXJA 2MHEA 3QLHA 3MR2A 1FNOA 4QPXA 1FXLA 4HTJA 2GCFA 3IXQA 1DARA 2HHQA 3US5A 2MQPA 1HBUB 1SJRA 3IA0A 1FJEB 3SEOA 3TOQA 1CQMA 2WBRA 5HP1B 2XWXA 3MXHP 1VK8A 1SH3A 4OZ1A 5FDLA 1VRTA 1HNIA 3UDCA 1N5YB 3VZHA 5CQGA 3G6VA 1QSYA 2X1BA 3HDSA 3AH6A 3CD7A 2KN4A 2AJFE 4E98A 3KMSA 3O1LA 1YIJS 4WFAQ 2KKHA 4DR1F 5DQGA 1KNZA 5A6PA 4HT5A 4NYOA 1JXLA 2R4FA 2ZH4A 2ZHAA 1S99A 2GGPB 3LQVA 1BY9A 3BZQA 5D4LA 1VIOA 2A2CA 2BDPA 2ASDA 2XBPA 3KLIB 2IAJB 2R7UA 5K9FA 3HT3A 2C28A 1RTIB 3G9CA 3F41A 2RVJA 4CT8A 1T7PA 3UD3P 2J7KA 1F2GA 1JLEA 2GV1A 1JNZB 2QSFA 3CJ0A 3MF5A 4PXDA 3VAHA 2AU0A 1RQ0A 2A1BA 2W9BA 1VRUB 1L3UA 1Q8LA 1KC8T 2XSFA 1QY7A 4QWBA 2VOPA 2WONA 3AHPA 4H4KA 1ZH5A 1R89A 4O4GB 3VCDA 2IBKA 4MK7A 1S0VA 3CDUA 2ROEA 4KRWA 4HEA9 4CO2A 1FTRA 3LPYA 3CJKA 1R8PA 3H5SA 1K0TA 3CCSS 1YTYA 1SJ3P 1QSLA 3MTKA 5K14A 2HHWA 1KQSR 3NWGA 1NK8A 3OV7A 1YRXA 3HO1A 2RDIA 4I7FB 4PQAA 4J9QA 2MDAA 1N52B 2DNNA 1JK9B 2PO4A 1Q8BA 3MM5B 4G1IA 4OI6A 1K9MT 1TFWA 3S8SA 1RAJA 3M6VA 4F4YA 3PFEA 2W4DA 4NLXA 3D0IE 1KD1T 4UQTA 3HPOA 4MKBA 2BXJA 3M2UB 2ZC3A 1GTEA 3DMJB 3SMZA 3C6UA 4Z37A 1JX4A 5A8RB 2C2DA 3TX8A 2CQ1A 3MPVA 3FVYA 3W2WA 2HIQA 4NLTA 3DLBA 4TLRA 3NNCA 1DLOB 2XI3A 4LJMA 1U1NA 2FLLA 3CWJA 4X66F 1HW9A 5KFQA 2BM1A 2AGQA 1R0AA 2J0SD 1YJRA 3FZBA 3NCQA 3MEEA 4R5PA 3VZIA 2RILA 1Y4ZB 2VFTA 4PPDA 5D4NA 4M8LA 2OFGX 5J1EA 4EBEA 3TVYA 4DFKA 3MD3A 4OX8A 3EXYA 3F73A 2WBMA 2XMTA 4DF4A 3IRXB 2HWIA 3I9ZA 4QIVA 4KHMA 3EGNA 4DF8A 4RU2A 4ZOSA 2HZCA 2GGPA 2MKCA 3AQPA 3TVZA 5DG9A 2ZE2B 1XC9A 3CSKA 3C6TA 1FERA 1D8YA 5E7OB 1S4FA 4ED7A 2IAJA 2JSXA 3NCRA 6FD1A 1Y3JA 3CEDA 5DG8A 3QO9B 2HQIA 2FGCA 5B0CA 3ZZRA 4OHZA 4ZLPA 2DK2A 2GMJA 1O51A 5LSRA 1KN6A 1FD2A 3M8SA 2B4OA 1IJFB 1FRHA 4FBUA 2BZ2A 1U48A 1YRUA 2Y1IA 3FJ2A 5KFOA 3HVAA 4I1TA 4O4GA 2E29A 5F9LA 2Y1JA 3G6XA 2EK6A 5FIIA 4NOHA 4G6VB 5KFVA 4FPRA 2HMIB 2GFFA 5JUMA 2DCUB 5JXSA 3WX4A 4YB1P 1HWIA 2DITA 3G8SA 2VPZB 1L3VA 5AJ3F 3BM7A 5CD4H 3LWLA 1MMNA 1WTBA 3PFOA 3RR7A 4CH1A 3KNGA 1HWLA 4DN9A 2ZJPQ 3GB0A 4U7UK 5K8OA 2Z0GA 2J6SA 4IO9Q 3MM5A 3WBZA 2ZITA 3DFEA 1UEUA 3M2UA 2NS1B 3DMJA 1N5SA 1QJHA 1S6UA 4DHVA 3VAMA 4TY9A 4IR9A 2AD9A 4OLPA 2C2EA 2YKOA 2D3UA 2WSCC 3C8YA 3MD1A 4N77A 1U7LA 2VG7B 2IYGA 2KTQA 1H2UX 4OI4A 1E6VB 4CQ1A 2LU1A 4N56A 3OHAA 5C25A 2OO4A 3H2UB 3N5BA 1FTCA 2F8HA 3TAMB 3GIIA 3QJLA 3N0VA 2IC3B 2OH2A 3PM9A 5AXKA 4DL5A 2LXUA 3ITHB 4WE1B 3KLHB 2XWYA 2FJXA 2M3DA 2CDQA 3ISND 1VK3A 3VAFA 4ETZA 1AUDA 1JB0C 2HRUA 3Q24A 2LA4A 1IM4A 1I1GA 4B17A 1VBYA 1ZAXA 2IFXA 1RKJA 1URNA 2ADCA 3HM9A 2OPPB 1QAYA 2RKIB 4PG6A 4DQSA 4K4VA 2HHUA 4ZP9A 2ZE2A 1YJWS 3DU5A 3S6EA 2JC1A 2HW3A 5KG1A 4A8WA 3FEYB 1HW8A 4E8UA 3LWMA 2CYYA 1O0PA 4NXMF 2CPHA 2JLFA 2K1RA 3F56A 2CQ0A 4F3OA 4MKYA 1JLGB 2HFZA 2R2UA 2QA1A 1B0VA 2Y0SD 4KE5A 2N4DA 4O3NA 5GADU 1U6BA 1DTQB 4NZ0A 3Q22A 1FK9A 3DOMA 4KAIA 4JV2A 4MFBB 1TQLA 3DLKB 2E1MC 1N5VA 2VBWA 3KHHA 4G1QB 2FJVA 2HMIA 3CDEA 4ED0A 2GJ2A 5A8KA 5J2QA 4O23A 4JI0F 4QU7A 1RT2A 2L48A 3PACA 4RW6A 5CCMA 5CYMB 2RQMA 1FT8A 3I55S 4YY3F 3PW4A 3MUVP 1DHMA 4PG7A 2RJZA 5DETA 4I67A 2PDAA 1YITS 2B43A 4G3IA 2D7SA 3J7Z5 1D9AA 3Q8RB 1JKHB 1HNZF 7FDRA 3M6XA 2YKPA 4J9PA 3UW1A 2UUTA 3BSNA 1Q53A 1Q86T 2BQRA 3TANA 3CD5A 1ZBTA 1XERA 4HVZA 1FD8A 3HVRA 1E6VA 3E01A 3AY0A 3MDFA 2KRRA 3U02A 2ZH6A 1H7XA 3TAMA 4RNOA 1YJVA 5E3AA 3EGZA 1X5TA 5KFEA 1GT8A 2HGNA 3QPIA 5I42B 3ITHA 3PIPQ 2RQCA 3HX9A 2CQPA 2XS7A 4YHHF 3K5NA 2XSJB 3PW7A 1FXRA 4C11A 1ULRA 3TUZC 3CJ2A 2FIUA 1L3SA 1S49A 3V6HA 5B0AA 1KFSA 2W7AA 4F3QA 1K73T 3GZ7A 2YNHB 4OQJA 1C4AA 2VQFF 2IYIA 4HH1A 2YWEA 3MUMP 4KV8B 4OMFG 2R8KA 1JLQB 1NK4A 2N7YA 2MGZB 3KK2B 2ASLA 4X4UA 3WZ0A 4DV5F 2OPQB 4HDGA 3N6LA 5F3ZA 3DLEB 4FF3A 4QYZJ 4PWDA 2LMIA 3M4XA 1FKPA 4LSLA 5JVHQ 4ELVA 1JLGA 2J7WA 3DRRA 3IBWA 3HKZD 1TL3A 3L09A 4O44B 3SFUA 3G71S 3CGIA 1XK8A 2CJKA 1DTQA 5DGAA 1GAOA 1YGYA 4ZPBA 5KFTA 4NA3A 2YVSA 4MFBA 1NO8A 3P3DA 5L1LA 3K0JA 3EPGA 2DISA 4O3PA 4G1QA 1IKYA 1HWJA 5BYRA 1XMBA 1Z1ZA 4M5DB 3SV4A 4ED1A 5EWFA 2HWHA 4NLWA 5LMNF 5EHHA 4ES3A 3HK2A 2IVFB 2M88A 1NRKA 3OL9A 3HVTB 5G0RB 5KFMA 2R7TA 4Y2KA 2G1DA 3MM8B 1JKHA 5D4PA 1N6QB 1CVJA 1ZAWA 2E5HA 2QMXA 2ZH5A 1YJNS 2R8IA 4FF2A 4KPYA 3GV5B 4NLRA 3DLJA 2MY8A 3LP0A 5GAGI 4Y34A 3KG4A 1KQGB 4QWEA 1IQZA 3CE8A 3UR3C 2Z4PA 5F8HA 4NLPA 4N76A 4ZDNA 1T02A 3KLGA 1GX6A 3ZZPA 2HNYB 3R5CA 2G4BA 4XPCA 5KG5A 3KG1A 1SJ4P 2D3OR 3UCZP 3BF4A 3SQGA 4DR3F 1RI7A 1U24A 1AW0A 1HMVB 5KOXA 2CQGA 2RS2A 1ZOTA 4LF7F 5E3RA 2DIUA 5E0OA 1S6OA 3M8PB 1U25A 3G8QA 4MJKA 2MZRA 3WC0A 5IXUA 3PX6A 2OPRA 2W4PA 3O44A 2XLKA 4DG1B 3TARA 2EG2A 3NNHA 3ICLA 4NLGA 1NHVA 2F8EX 2I2YA 1H98A 1H0HB 1U47A 5B7WA 5EN1A 1FKOB 1RT1B 3CC7S 2DGWA 2QLXA 1GXTA 1ZZFA 2VFSA 4D3GA 3EPIA 2MZ1A 3VAIA 4ED5A 1JLQA 3NNAA 3KK2A 2MGZA 1ZM4A 4Q43A 2OPQA 2MJUA 3UFCX 3KHLA 5BYSA 2MZQA 3KTQA 1KFDA 3D2WA 1QAJA 1WF2A 5IFMA 2FHMA 4WXWA 4TNOA 2KM8C 1O5JA 4DV6F 2C22A 1CLFA 4HTIA 1AROP 2B9XA 1Y5IB 2ACYA 2MQNA 3S01A 2GQQA 3V81A 3OR1B 2Z2MA 3FQLA 1KONA 3B78A 3DRSB 4OX9F 4HYKA 3OVAA 3M8QA 4QJVA 5KG2A 3R27A 2M0GB 1HWUA 2VB6A 3QJPA 1TL5A 4M5DA 1M5PC 3RB6A 5DS7A 3NAHA 4I64A 2VC0A 2MKKA 1VQOS 2WAQD 2FVPA 1VC0A 5G0RA 5KFPA 1F0XA 2HG4A 2BJEA 2OKQA 5AXMA 1SC6A 3FRZA 3VALA 2HFNA 1N6QA 2AX0A 4CTAB 1U6ZA 2L9DA 1OSDA 1WD6A 2QA4S 4IG3B 4JUZA 1BQMB 5T41A 5HMYA 4DR6F 2B51A 1SJQA 3LP1A 4XAKA 3RW7A 2MQQA 4RUHA 2E9TA 2DGQA 4J5OA 2OLWA 3QGGA 2HAIA 2DVIA 3H4BA 4MTPA 2HNYA 4CO0A 4ID5A 4TU7A 1LXNA 1M0SA 4U9RA 4DLGA 1TKXA 4UOCA 3LO3A 5DRKA 2OMOA 4P7VA 3FSXA 1VJWA 2HNZB 1QM9A 1KS2A 2VODA 2JLEA 2BYCA 1HMVA 2CRLA 2KO1A 2V4JB 1WEYA 2VPXB 3IG1B 1JLBB 3M8PA 1XTZA 1OPIA 3N4WA 1S1WA 5EGYA 2XY7A 3MR6A 4DG1A 3GR0A 3SSQA 4CH0S 1S1UB 3KLFB 3GILA 4LF6F 3M30B 3Q8PB 1LW0A 2J7UA 1G6BA 5HBMB 2CPXA 4NZ6A 4DR7F 2E1RA 4WF9Q 3RB0A 5F8LA 2I8EA 2VD3A 5KT3A 1RT1A 3ISNC 2F7VA 4TY8B 1ZPVA 3DXSX 4QBUA 5F3TA 1QAXA 2B0GA 4JI8F 2LKZA 4AUKA 1DTTB 3CCLS 4BHQA 4DL0C 2BOPA 1Q7LB 2KH9A 1CSJA 2OAUA 5HMWA 4EZ9A 4RWXA 1SJFA 4AXIA 4TYAA 1S6QB 2XCAA 2XCPA 4O3RA 4WZQA 3M1VA 3DM2A 1FE0A 2K3IA 4RU9A 2BJDA 2RF2A 3HF5A 2MXYA