3NGKA

Pdua from salmonella enterica typhimurium
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
EALGMVETKGLTAAIEAADAMVKSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Propanediol utilization protein pduA
publication title Structural Insight into the Mechanisms of Transport across the Salmonella enterica Pdu Microcompartment Shell.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 22
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ngkA00
4QIVA 5DJBA 4AXJA 3MPYA 4OLOA 3H8YA 4P7VA 4P7TA 4PPDA 3IA0A 4LIWA 2G13A 2A1BA 3I96A 4P2SA 2A18A 2EWHA 3DNCA 3NWGA 3SSRA 4QIGA 3N79A 3PACA 4OLPA 4OX6A 3SSQA 4DDFA 3CIMA 2A10A 3DN9A 3BN4A 3MPWA 5L38A 4QIEA 4QIFA 4RBUA 3VCDA 4OX8A 4OX7A 4RBVA 4AXIA 3I6PA 3SSSA 4RBTA 3NGKA 3CGIA
chains in the Genus database with same CATH superfamily
4F4XA 5I4MA 1PBAA 1YK9A 2CAJA 2AP6A 5E33A 2G2OA 4LF8F 3ET6A 4JI2F 3H4DA 3BZQA 1GMVA 3SQGA 3Q89A 5C25B 2FJAB 3FQKA 1EZZB 2J6UA 2EEYA 1DARA 2VKRA 4PPZA 4WIQA 1N5YA 2MJNA 4DL2A 3J7Z5 1UWAA 2HW3A 4WFZA 3OPKA 1R0AB 3D28A 3V2UC 1UVJA 4F2SA 4DU7A 1UVIA 4NL5A 4JV5F 2QLXA 1KQFB 2Z30B 1IN0A 4M5LA 1DFDA 2RF2B 4CLWA 1R8AA 1GH8A 5KFKA 3JSMA 1NKBA 1SJQA 3P45B 4HACB 2JNJA 2BJ9A 1SL0A 1XNQJ 4EFAC 2HHUA 4USIA 4ED7A 2C2ZB 4K4XA 4ED2A 1WKKA 1WF1A 2XYPB 2XY5A 1VC0A 2UXBJ 4IO9Q 2K3IA 3Q0AA 3W8PA 3NG8A 1WKJA 4WP3A 4K2XA 4ZDNA 1Y3JA 3LWMA 3OTCA 2ZJRQ 1G2EA 4DG1A 2IAJA 1HL6A 1QDUB 3M6WA 2HHVA 5M2PA 2PI5A 5DM6Q 1ZS6A 4I67A 4P10A 3U1NA 1YWXA 4IH6A 1GAOA 4KHRA 4DV0J 3EICA 1SIZA 1IKYB 2SXLA 3D54A 4OL8A 3ONQA 1KQSR 4RW6B 2J7WA 5KOWA 3DLKA 4J9VA 3MPDA 1WC6A 2FC8A 4Y2IA 4ZPVR 4XDDA 2C2DA 4EO8A 9ATCB 1RWUA 3DLGA 5G0RB 5U47A 2X1AA 2E44A 2APOA 2WSEC 1FKOB 1RT4B 5D4OA 2I2YA 3H5UA 2XQCA 1LFPA 3MAHA 3W9JA 2E9RX 3TUPA 2E1AA 4ZS6A 4OI6A 1KEKA 1S1WA 2FZKB 5SZTA 4J9MA 3G82B 2LDYA 1NK5A 1N4LA 2ZH5A 1NK0A 1P9QC 3IO1A 2KU7A 2Y3YA 3GR0A 2ZKUA 4ZITA 4G6VB 5LL6d 5DGBA 2ZNYA 2RMLA 4B3RF 3ETOA 3FQLA 4J9PA 1IM4A 1C0TA 1YIJS 1MWYA 2UXCF 4KPYA 4H4MA 4DR7F 3EZ5A 2ZWOA 1X5PA 1B0VA 1Y5IB 3AXKA 3Q8VA 4ECQA 2ZOFA 1GX5A 2Y0BB 2BE9B 2XI3A 2DCUB 4F0HA 5KFZA 3W60A 2GHVC 1H2TZ 1B64A 3BYPA 1ZOTA 4NLVA 3HZGA 1SJFA 1GMWA 2RKIB 2HHSA 2O67A 5E3AA 2LQBA 3NY0A 4QU6A 1TELA 1EKRA 4DQIA 3M32B 2DNGA 4ANCA 2KYXA 3TZXA 3EUNA 2VJUA 1FERA 2ZHBA 3IAM9 2DJWA 1BD6A 4DZDA 4H4OB 2HLUA 3TUIC 3MPVA 7FDRA 4O3RA 3TZYA 1KS2A 2RE1A 5DLGA 1LWCA 3B8HA 3QZ7A 2W9BB 2YPZA 3OJUA 4CLZA 1JLEA 3MMBB 4NA1A 4LQ9A 4DUYJ 4CLYA 1TL1B 3FNNA 4YR0A 3K5LA 4YEAA 3DMJB 2X1BA 2W8KA 1MG7A 2HYIB 2GQ2A 2DXFA 2RQ4A 1CJKA 3BS9A 3OVAA 1VQMS 4M1KA 5J2PB 3QBCA 3RBDA 3TYTA 2YTCA 3CJSA 1PYTA 5IOLA 1M0SA 4V1Ak 4KB7A 1Z2LA 4DDFA 3W2VB 5EWGA 1FA0A 4KR0B 2R7QA 4U95A 3RYLA 2MKSA 3BYRA 5IZHA 3IR6B 2LDIA 2Q43A 1WHVA 5CCMA 2UVWA 2C1EB 2K3KA 3W63A 4BC7A 4OYBA 2IDLA 1JXEA 3D9BA 4ES1A 2ZH2A 3DOKB 3M2RB 3MECA 1NCLA 1HBOA 4ID5B 2YKPA 1GXLA 3AD7C 2V63A 3K5MA 1HWJA 2V94A 3DC2A 5A8WB 1P6TA 1WSVA 3HD1A 5IM0A 5K5MA 3HT0A 4D3HA 4KQZA 2MYFA 3V6KA 2W1BA 3DLLQ 3TNVA 2GGPB 5ETRA 3DGVA 2IRUA 3PX6A 1H74A 2HFZA 3FDSA 1I94J 3IS9A 1AROP 1FK9A 1N48A 1J5OA 1G7CB 1MWZA 3AJ1A 2VKZG 5KT3A 2FHJD 1Q53A 4PEOA 5LSLA 4X4VA 3K8VA 2DNMA 2XLJA 3R2CJ 5J1PA 4B9UA 3A8IA 4QIVA 5KFOA 2ZOMA 1WJ9A 3CCTA 1HARA 3EGWB 3QFHA 1Q8IA 4OV6A 2A2CA 2XZWA 2V8HA 3KHHA 1AFJA 1KLMA 2OD4A 3BH6B 4NZ7A 3K0JA 1HMVB 1D9AA 3P4UB 4PPDA 1BE4A 1YRTA 5B0EA 1VHIA 3D0GE 4I1TA 5EDWA 2XS7A 4TQRA 2C22A 5K20B 2CRLA 1SI9A 5A76A 1TL7B 1CULB 5H1SV 1RHKB 2X7IA 2MB0B 2QO3A 1MMLA 8ATCB 3RR7A 2D3O1 2EVZA 3GYGA 2ZWPA 2EW9A 2NXNA 4NCBA 4ECTA 1KTVA 1RT2B 4IRCA 4A8SA 3OV7A 2ADBA 2ZITA 5K8PA 1Y7PA 2UVUA 2EC0A 1CVJA 4EZ9A 4HI2A 5G4DA 3BREA 3LP1B 5JVHQ 1MN7A 5KG3A 1N5TA 1N8RT 1DQAA 3TA1A 2BOPA 5HATA 4N7TA 1R0BG 1U1RA 2FPHX 5EHHA 4M5DA 3VAKA 2YPYA 2G2YA 3US5A 3C16B 2OPPB 2JL9A 3NGSA 1WHXA 1HQEA 1T05A 2XHWA 1S5ZA 1VBYA 4U7UD 4YDXA 3NGUA 3M9NB 2OIHA 3GV8B 1CBKA 4C9DA 4FVCA 1JLAB 2CDRB 2OEKA 5L9NA 2XMUA 3QO9A 2W7PA 1RT7A 3B78A 1EX8A 4DJBA 1FWPA 4UY8T 4OIXA 4A8XA 4LF9F 1K1SA 4WU2A 4ID8A 4PG7A 1TKZB 3NP5A 2AW0A 4IFVA 4QW9A 4PZVA 2W01A 1S72S 3SFGA 1YRUA 2DHXA 1CJTB 4RJVA 4HDHA 3DKDA 3TQEA 3R5CA 2MZSA 1AFIA 2LP4A 3ISND 2HHPA 2ASJA 1KVKA 2GIQA 5DLFA 1ZM3A 1ACMB 4TLQA 5F8MA 4MK9A 4C97A 1SH2A 4B08A 1KFSA 2UP1A 3MEDB 1L3UA 2J7KA 1SQFA 2G0CA 2LLZA 4J37A 4J9NA 2BJ7A 1K47A 2YBVA 2BQRA 2HWHA 2DNHA 3AT1B 4OYZA 1N36F 4DHVA 3THTA 3R2DJ 5BYRA 2GHPA 2X1GA 4LF4F 1DRZA 3VGUA 1F9FA 2MQPA 3BEGB 3DU5A 1ROFA 1NO8A 4WP9A 1SV5A 1NXIA 4HH0A 3G96A 1IQTA 2B4PA 2C28A 2WAQD 4LREA 3LP0B 1YTYA 4X84A 3HSGA 4NLQA 5L1LA 3LGMA 2HQDA 3Q8SB 3UD5A 2BMBA 2PA3A 3K7RA 3V6HA 2EFVA 1M5SA 5BR8F 3PJXA 3MDFA 2PEHA 4A8FA 1Q78A 4J9OA 1VGYA 2LEPA 3W3SA 5BYSA 3O2IA 5L46A 4NA3A 3UR3C 2B3TB 3DDIA 1C1CB 4J9SA 5A8KB 2B4UA 3DRRB 3HXMA 1XNRJ 2MZQA 1VQOS 4J5OA 3VTIA 2Q6CA 2JH3A 1R8BA 3KFWX 2HNZA 5LXRA 4LIWA 3K5NA 4YOEA 4ED5A 2DNLA 3GYXB 3KLEB 2R2UA 5ETTA 4ZP6A 1CJUB 4WZQA 3DDNA 4AXIA 2NXCA 4K0KJ 2DGVA 1Y5NB 1S57A 1UCNA 1PGZA 4V19J 1DAXA 4U67Q 3C6TA 5AE1A 3JAMY 1HI0P 5HL7Q 2R2TA 2J0XA 4XPCA 2O3DA 2RQKA 3CDUA 3BJYA 1Y10A 2YNGA 1VQ6S 1JXLA 3DI6A 4Q45A 3FFIB 4X4RA 1XR6A 3LF0A 3BDPA 3W2WA 1BLUA 3UWTA 3AJDA 2V9WA 3CIZA 3J7A1 1O51A 2GNKA 2QLBB 3DLEB 4XDCA 3P5BP 2H48B 3OR2A 3C15A 5J2MA 2H1YA 3ENWA 4LF7J 4P72A 3VAFA 3J81U 3PG9A 2W4PA 2CQDA 4FS2A 4LR8A 3F44A 2HS4A 1YRXA 3NNCA 1FFGB 3ET6B 2HBRB 2HQCA 3MD3A 4WFYA 2AJ0A 1UJ4A 3J7ZT 3SQGB 5LT5A 3F0NA 3IN5A 3C14A 4HT5A 4GC6A 1RWWB 3V81A 3T1AA 3UN2A 3L4BC 1P1LA 1N5YB 3HF5A 1RCXB 4P75A 1SVDA 1Z4UA 2HURA 2QGFB 4ZPWR 1WOSA 1GMWD 1VYAA 3U7JA 3JSRA 4ZPCA 4G1PA 3ENVA 4ILRA 1RWKB 3EDRB 1U0SA 4K8RA 4DUZJ 1ZZNA 1C0UA 4PYDA 2HVDA 3E8OA 3TANA 2VDHA 2W2PP 4DV6J 3M05A 3JSMB 3T1YJ 3H5XA 2HK3A 1VRTA 2EBEA 1AB8A 3Q8RB 3B4MA 2EG2A 1VI7A 5C2CA 2HAIA 2F40A 4U7CA 4O44B 5KAKA 2F8MA 2WVFA 2IRYA 1JMTA 2FJXA 2JC0A 2ALZA 4DG1B 5EGYA 2IAJB 4P74A 4URGA 4I56A 1R0CB 2RT3A 2BDPA 2K06A 2MQOA 2DITA 2UUAF 2Z2ZA 2YKAA 5ETVA 2L9DA 2NXUA 3UN5A 4NXMJ 3DLKB 3KK2A 2KG0A 2H3EB 5F41A 3I56S 2YKOA 3RJMB 4W90B 3DLGB 1N88A 4K4WA 2B4OA 1S0OA 5ETKA 2M7SA 3FBCA 4O0NA 3Q2TC 2KXFA 2HVEA 4PCQA 3OTOJ 5AJ3J 1S1WB 2R8HA 4B3MJ 1VOMA 3VCDA 1F0XA 4QIWD 2R8JA 2FQQB 4Q44A 5DJBA 5A6WA 1FI4A 2Z57B 1JKHB 5AE2A 3BSAA 4CLPA 2L9NA 2XNQA 3MCNA 3MR6A 3LW5C 3I4HX 3CJQA 5GAGU 2DR6A 5J1NA 1SL2A 3CMES 4DSJA 3AD8C 1VISA 3AQOA 1C0TB 1KOOA 4RKUC 3H2UB 4TNOA 5IWAJ 4PG5A 2JSXA 4H4MB 5ETQA 1S1VA 1SJ4P 1A9NB 1T11A 2RUGA 3PFEA 3WX4A 3U1LA 4JI7J 4DV3F 4J9KA 3T19A 4CO0A 4DPUA 3FCVA 1W7WA 3IWLA 4C8LA 2QTWA 3SIPB 3NS7B 2JRSA 2YX7A 5C42A 4QR2A 3QT6A 1YJ9S 3P49B 3RBZA 2XG8A 5E3CA 3DXBA 4K4YA 1UZDA 2W7OA 1OYDA 1IQZA 2QFIA 4S0MA 1HWIA 4FPIA 3OUYA 2YX1A 5DQGA 1RB0A 3AB4B 3J80U 4JYAF 2KVIA 1FFSB 4I69A 1LWCB 5D78A 3GONA 1X7VA 4OZ1A 4KRWA 4WXWA 1JLEB 2XMTA 1UZHA 4L76A 2FVSA 4URQU 3QLHA 4DFMA 1CJKB 2HQIA 2FY8A 4PXEA 3EXCX 3RAMA 4OI4A 4CH7A 3A3NB 2VQEJ 1RUSA 4Q2LA 5KFYA 2MQNA 2E5IA 3VQSA 1L3SA 4KV8A 1LK5A 1S6QA 5J2NA 4K2JA 3CDAA 4WF9Q 5F8GA 1SC1B 3K2YA 3MF5A 1U2CA 4CWBA 1TAQA 1X4FA 2K7KA 4DR4F 5J2QA 5JXSA 1N6QA 4CNYA 5CAAA 5DDOC 4LFCF 2B51A 3WIVA 2MKCA 3EWGA 3MECB 1IBLF 2BABA 4HEA9 2FHOB 1LXJA 2CJQA 1XK8A 3I5AA 2F65A 1HBOB 3ZZPA 1XMBA 1RCOB 3LALA 1MLAA 2RNEA 3H40A 3VGVA 1M5HA 5IM0B 3PFOA 5FDLA 1XR5A 3K59A 1FDAA 3HVWA 2PO4A 1N32J 2H51B 2UV8G 4IFYB 3R5AA 4DLEA 1LFWA 3IS9B 1FK9B 4ZPAA 3QRRA 1J5OB 3MM9A 2ZUGA 1OY8A 5KG0A 1EQMA 4WK1A 4B9MA 3TA0A 5KT5A 1RDRA 3C3LA 4FF4A 1FFWB 2MSTA 3UDEA 3I31A 3J80Y 1F5CA 1FDNA 4RBVA 2LA4A 3U1MA 5CYMA 2WBRA 3V4MA 3MMCA 2JWNA 4K4ZA 1Q7YT 2D9OA 3OSPA 1M1HA 3UR0A 1KLMB 1U02A 2JEGA 4DR5F 1TZ0A 1OY9A 5KFLA 2CXEA 4NXNJ 2KFNA 1KD1T 2FJDB 2RU3A 1MSWD 4M8LA 4CO5A 5K8NA 3QRQA 3DOMA 1LKZA 1WOPA 3UFCX 4PQUA 2RAQA 1NSPA 2PDAA 2Q6BA 2BXJA 5HMYA 4XK8C 3E3XA 5D4LA 5CXTA 4ITSA 1NUEA 2W2OP 3OT9A 1DZ5A 3GYNA 2XMKA 3T5JA 3SCIE 3WIUA 1X9SA 2R9LA 2VQFJ 2OHDA 3O44A 3QSIA 5ETMA 3GSDA 1AUSL 3EPIA 3KJFB 3TZZA 1NMEB 4EI2A 6AT1B 1ZPWX 2HWTA 3MGJA 2YNFA 3FRYA 1NDPA 5GMEA 3G2XA 4CRJA 2F3JA 1RT5A 4NMLA 1BXNA 1OPIA 2YH0A 4YB7A 5D3GA 1JLQA 2GVDA 1KDNA 3QWUA 4K5RA 1HQEB 2NXJA 1T05B 2J9EA 1D0EA 2HSEB 3UDCA 1BQMA 2G9OA 4B17A 2DEIA 2GO8A 3BBCA 3PM9A 3P6YC 4RUHA 3QO9B 4LVOP 1RT7B 5CZXA 1UEUA 2ATCB 1S99A 1J2VA 4I0WA 4ZLLA 3MXHP 4WK3A 4X4SA 5HROA 4NLTA 1KVIA 4JP8A 2QFJA 4IFVB 3OLBA 4UOHA 3W65A 2BANA 1QUVA 4B3OA 4PXDA 1VQ8S 2V4QA 2DHSA 2V50A 3W5XA 2UU9F 4WTYA 1MU2B 4UZBA 5KFIA 1NHVA 2W2NP 2OJ3A 2GCFA 1T02A 3CCRS 2IPOB 4D3GA 1ZYQA 2Y0SD 4RW9A 4ILMA 4UW2A 1YJUA 2E29A 4IR9A 4ZK7M 3MWBA 4GO7X 3E51A 5CZVA 3MM5A 2F63A 2W2MP 3KNGA 5ADZA 1WWHA 3QIDA 2OELA 4ZIVA 2BOAA 1FXDA 2NUUG 3RW6A 3QYYA 2BACA 2FC9A 3VWSA 3M8PA 2J0WA 4JV1A 1X9WA 2JX2A 1C4CA 4JI2J 2BZ2A 1H3DA 1SKSA 1RHRB 1HD0A 3MR3A 4IQMA 4DWIA 3RW7A 3SDEA 2N82B 2M0GB 1U2RA 5DDPC 1RU2A 2RS2A 2VHGA 4FDFA 2CNOB 3PIOQ 5ETPA 3C46A 5D0GA 2DTJA 2XGQA 5IC6B 3BPDA 1RAIB 3CCLS 2W24A 3MEGA 4OLOA 1TU0B 3G71S 1SV5B 1YLXA 4AT1B 1D8YA 2M88A 2NUHA 1RTHA 4LJMA 2N4CA 3FMWA 3H2LA 1KTQA 4RWXA 2UV8A 2CPYA 2P9EA 3HMJG 4OV1A 4USJC 2KO1A 4MKVA 3IFEA 3OXLA 5KFAA 1RISA 5KFXA 3NMAA 3TJ9A 3RB0A 2E1CA 3BKUA 4WE1A 5F8JA 1RTIA 3PYGA 4QYRA 2AIRB 5K9FA 2F4FA 2KXNB 1Y11A 3N4WA 1Q95G 2VD3A 4GRSA 3AB2B 1GQEA 1QSSA 5THWA 4DQPA 2BM1A 3P3DA 2ADCA 2GJ2A 2CQ3A 3D2WA 3KG1A 2B9XA 1LW0A 1DQ9A 1Q5VA 1X4EA 2HNZB 3OXGA 4CO4A 1RYSA 4X4UA 3DRSA 5HI7A 3VAHA 1NZ8A 2Y1LB 3FK4A 4F4KA 1HFEL 7AT1B 3DLBA 5EWFA 3C6TB 3M2VB 3M8ZA 1FTCA 2P5VA 2IM2A 1S6PA 2RSQA 3Q83A 5T7LA 4ZVSB 1NK6A 2VODA 4J9LA 5GADI 2NPFA 1H6KX 4LSLA 4YHHJ 2HS3A 2YNGB 4HDGA 3DI6B 3I5BA 3KLGA 1NK4A 3W2WB 4Y34A 5F8HA 4B3RJ 3CC7S 3JTOA 5CYQA 3PDNA 3NOCA 3M2UA 3OR2B 3C15B 5J2MB 3HHNB 3OTBA 5IS2A 4F4WA 3OHAA 4ZVFA 3F56A 1JLCA 4ZPTR 2V4JA 1PC4A 2YWKA 2LYVA 5HJXA 3O5TB 5MLCV 4TQSA 2Z56B 3BGFA 2QA1A 4KGVB 3VR1A 4X4QA 2EXUA 1Q8LA 2BM0A 3C14B 1QE1A 1WEXA 2JEFA 4YDDB 1JJCB 2HNDA 2N3LA 4XTTA 1L3VA 2CG8A 3NEKA 1ZBTA 2C2EA 5B0CA 5HSPA 3GFYA 3W66A 1W25A 1WDTA 1U8SA 2UUCF 5KFFA 3JTNA 2AX0A 1EQ0A 3KOAA 4LBIA 1TP7A 3KUGA 2BQUA 3AAWB 3I9V9 4B9LA 5C2GA 5C5JA 2PA8D 1JK9B 3GJSB 1C0UB 4QWAA 1VC5A 4L3NA 4YUDA 3DHXA 1VRTB 4CCHA 3B6BA 1XR7A 1KVJA 3QT5A 2CG4A 3HM9A 1YZ7A 2VG7A 4LF5F 5ETOA 2JEIA 5KFJA 2F9DA 2R2RA 1URRA 2I1RA 3CJ2A 2DEJA 3RR8A 1BMQB 4IH7A 4IQXA 4QIEA 5I3PA 4I2PA 2RD5C 1SC6A 2XCAA 4DV5F 1S49A 2IJFA 2GC8A 2A6OA 4A8WA 3NAIA 4BDPA 3DRXA 1Y4ZB 3HI9A 2CPEA 3JSBA 2IM1A 4EYHB 1X4CA 3SSSA 4MIWA 3WHIA 3JQJA 1CS4B 3CD7A 1OQ6A 4KSEB 1F2GA 3D6HB 4CM2A 2V68A 2JOQA 4ECVA 2IMWP 4KAIA 4OJHA 2UUBF 1NSAA 2M4MA 4DU8A 2U1AA 3MTKA 1H38A 4DX7A 1U1OA 1QTNB 2DR7A 2PFFB 2OGUA 2OO4A 1DY3A 4ZVTB 4I4BA 2IFXA 3MR2A 2H9ZA 3L7OA 2FUG9 3NOGA 3KLIA 2R7WA 2CQBA 3OR1A 3K5PA 3UCZP 4EU0A 1IBKJ 4C0HA 4DPYA 3OHBA 4ZP7A 4ICLA 1U26A 1S1VB 3Q86A 3AA8A 1IJEB 1S1UA 2L9WA 4YR3A 4BWMA 5ETLA 1UEVA 3CD5A 4DR6F 1IKXB 3CDEA 1S0MA 3SMZA 1X4AA 1SJ1A 4PWDA 1TUGB 1V3RA 1FNOA 3K17A 3NGTA 3DRPA 2DGSA 3CCJS 1QM9A 5KT4A 1JJ4A 2XY6A 2JFDA 3PYEA 3ILLA 1KP6A 3TUZC 2RUSA 3FEYB 5C42B 1WEZA 3MD1A 1XMQF 3G6XA 2GAHC 1R27B 4WKYA 4CLKA 4MFBA 4OZ3A 1RWOB 4JI1F 1WTBA 5HMZA 2WCXA 1RTZA 1T9TA 4DEZA 3CJ0A 5LSRA 1L3KA 3MUTP 1S12A 1NLKL 3PO5A 1TL5A 1H7XA 3UNYA 2QRRA 2QLJB 5F8LA 3SBMA 4WCEQ 5L1KA 2VPXB 3G6VA 2FVQA 4X62F 1K0VA 1QAYA 5GVQA 2LVWA 2ZM6F 4KC5A 3QLHB 4QCLA 1UAWA 2ZH7A 2PMWA 2XGPA 4URSA 4ZJOA 1DLOA 3N5BA 2E7XA 1IR2A 4KV8B 1S1XA 1S6QB 5J2NB 3EGZA 3OFGA 2B8PA 4E98A 2Y9HA 2D1CA 4N5SA 2DNKA 1TK0A 1WSRA 1V5IB 5J2QB 2CJYB 1N6QB 3QGGA 2G1DA 4J9QA 2BV3A 3TEGA 3NBPA 4OYPA 2HFSA 4N8NA 1HR0J 3S01A 3GLJA 1RP5A 3NS5A 3N6MA 2KT3A 1S0NA 1SKWA 5KFVA 1S79A 7FD1A 5AXNA 1FJGF 1RTDA 4KGZB 2NZCA 4GMKA 1NJWA 4JI0F 5FDLB 5FIIA 3UDVA 5DZ7A 1S9FA 1HPZA 2XBPA 3IGNA 3TW0A 5HBMA 4A8YA 3BGUA 2LQ8A 3CCVS 4WKRA 4DI6A 1XWLA 2AT1B 3MM9B 3FBEA 3FSIA 3MEKA 4X64J 3KK3A 2UUWA 2MPUA 1R89A 2F5GA 3FEXB 2R42A 2MKKA 3BR9A 2M52A 3G8SA 1K9MT 3GU0A 2H4YB 4ED6A 1RAEB 1N36J 3TOQA 1M1KT 1HNWJ 5CYMB 2YQ1A 3NNAA 3LQVA 3MMCB 5HVGA 3PY8A 3NCRA 3CCQS 4DR1J 3AXMA 4WP8A 3OVBA 1SC3B 1IWAA 2QZ8A 5L39A 3EPGA 1B70B 2G0IA 1N52B 3DOMB 2DNYA 2OFHX 2KRBA 4CO2A 2GX8A 4PQUB 1IR0A 2IVFB 3D66A 3M8RA 3CO9A 2M8DB 4RBTA 1Q5YA 5DQHA 4CT8A 2Z2MA 2VDIA 3G4SS 2UXBF 2J9DE 4ED3A 2ROPA 3M6VA 1ITPA 2WW4A 2C3MA 4ZVEA 1YITS 2DGUA 4DV0F 2EG1A 5HVHA 2OTJS 4QZVB 5T14A 2IDEA 3S1TA 4UTGA 5E7OB 2NZ4A 2H5JB 5CABA 3KG4A 1X5TA 3HDSA 2IIHA 1RA6A 2YNFB 4N47A 4NLRA 2FTRA 2QYCA 4PG6A 4L72B 2ACMA 1RT5B 3PEJA 1PAEX 5D3GB 1JLQB 1FCAA 1FT8A 1O5JA 3PXGa 4RNOA 2QN6B 2WONA 5C24A 2AEJA 3IR5B 2RS8A 1BQMB 1XMOJ 2DGTA 2DRBA 3RB6A 2R7OA 1RYRA 3PW4A 3V6JA 3VAJA 1BQXA 3R5DA 4AXJA 2HZAA 2ZHAA 3PCOB 5GMDA 5HROB 2F4VJ 4CT9A 3BO4A 2LECA 3CJKA 2ASLA 2GW8A 2BANB 4B3OB 4ERDA 4CYUB 2C2MB 3TRGA 3D6TB 4FVMA 2Q66A 4UY85 4IKAA 3GCXP 2HRUA 1U1QA 5LM7E 1CSJA 4RW9B 4OHXA 4N8OA 2CQ1A 4FBTA 1FXLA 2VU5A 1V5VA 4DV4J 3KXDA 2KZMA 3MM5B 4YY3F 2ZBCA 4HH1A 1F5AA 1HI8A 4W98A 4OYWA 2J7UA 5KT6A 1YJTA 2RU9A 3H4BA 1KFDA 3SEOA 2FJWA 3FBBA 2AJ2A 3M8PB 3SCLE 2NSBA 1Q16B 1S1TA 2KHDA 2FGOA 2RH3A 2LKZA 4OZ2A 2MJUA 2BJDA 3SDEB 4TN2A 4F3MA 4UOCA 2DY1A 2R7XA 1DTTA 3I32A 1NJXA 5BJRA 4DF8A 3QZ8A 1RHJB 1NDCA 1RKJA 4DUYF 4NEYA 4NEZA 1KONA 5A8RA 5KG2A 3VALA 3TVYA 2AYBA 2WK4A 2KVQE 4HT7A 1KSPA 1ZM2A 1RTHB 1APSA 1S7IA 1LW2A 2E7VA 3BO3A 3KJQB 2I9SA 3LH2S 2Z2YB 4GC7A 2QMWA 1BWVA 3JXOA 4QYZK 2EFOA 4L75A 4DFPA 1UWBA 2C2KB 3PEHA 4OX9F 3MCSA 3GMGA 4LRAA 1F2HA 4R25A 4WE1B 4USTA 1RTIB 1NJZA 4QJVA 2CVIA 4P2MA 3G8TA 2J76E 2ZEJA 5HANA 3KHLA 2ZBQA 2KZZA 2G4BA 3IM9A 2R7SA 4DSEA 4RLEA 1JJ2R 3HHLA 2GIRA 2V6AA 2UUAJ 1LW0B 4C8KA 5K14A 1Q1KA 1RJJA 1VQ9S 1VFJA 3DRSB 4AUKA 3SFUA 1CG2A 5CA5A 1R7IA 1R6VA 1I94F 2XWYA 5LJ5Y 2HLTA 2CPXA 4KJIA 3FRZA 5IT9U 2D9PA 2MQQA 2K7JA 5LMNJ 5CCLA 3FCHA 2ROGA 1SH0A 1VJQA 1Y0HA 3M6XA 1V9OA 5IQ6A 1S6PB 5T7LB 4IR1A 1RZMA 3DYAA 3OTDA 2WVDA 2FVRA 2MY7A 4YMEA 4TVAB 4LSLB 1FRXA 2IRXA 4H54A 5KT7A 2DCLA 4P71A 1G1XA 3KUHA 1RT1B 4W4MA 3MFIA 1XERA 2BVZA 2DRDA 3ISZA 4CZCA 4GKKJ 4ZN1A 5CYQB 4CLUA 2VIHA 1IKVA 3M2UB 4TU9A 2DNRA 3DDKA 1NPRA 4FYWB 3C2PA 1YBUA 1HBUB 2DH9A 4RUCA 4DV3J 2MLYA 2JHEA 1SUQA 3ZZZA 3CE8A 3FJ2A 5KG5A 1YJWS 1JLCB 3PYFA 2V4JB 1HW8A 1YKWA 3OXFA 3H5SA 4JI5J 4AQYJ 3R7SB 3GSIA 4A47A 5IT4A 1SL1A 4PG8A 4DV7F 2HEKA 3JSYA 2DNQA 5AE3A 1QE1B 1MROA 1GNKA 4O3QA 2HNDB 4NLYA 4WFBQ 3RU0A 1IBCB 3SZ2A 3TWZA 1VK3A 3NGDA 1S59A 2QE5A 3OD2A 1GFWB 1S97A 2KYZA 2VH7A 4I7FA 1FX4A 2DY9A 1BQNA 4FXDA 3HSZA 1FJ7A 2CQGA 4X65J 4LFBJ 4ELVA 5KFEA 3CJ4A 2VBYA 1RTJA 1VCTA 2BE2A 4F4AA 2FJEB 2HHWA 4CI0B 4YN3B 3GJTB 1WC1A 3EZOA 4NYZA 2RJZA 2E9TA 3BV8A 2VG7B 5B0AA 5HMXA 2MTLA 1TKTA 2EC2A 4P9SA 4EZ6A 2AMCB 2X3DA 1FX2A 4I2PB 2FJBB 1RHUB 1SXLA 2LU2A 4DR4J 4FKYA 1LWEA 2WHOA 3BPSP 3OL8A 1O8BA 1RHMB 1NH7A 5DGAA 1WC0A 3J7AN 1TR0A 1FNMA 2CFXA 1B3TA 3B4DA 3NGRA 2GJIA 1TKXA 3CCES 2B7BB 4M95A 3J7YI 2OSRA 4C3LA 2G0JA 5E41A 3SCJE 2YNIA 2AZ1A 5L8RC 3EMTA 1H73A 3VGTA 3PR5B 2ERRA 2J5AA 1FO1A 2LEAA 4Q7AA 4C8OA 1WNEA 2IA6A 1QSLA 1SKRA 3BQ2A 8RUCA 2W25A 4OZLA 1HNZJ 1NH8A 3ZTOA 5B7WA 4F4ZA 3KLIB 2Q3PA 3OR1B 1WOOA 5KFQA 3OJSA 1Y9OA 3H5YA 3R9LA 4HVZA 2GQCA 3QMQA 4DX5A 3U27A 3NL0A 3IRWP 2IBKA 3TUJC 4ICLB 1HWKA 1WF0A 5LJ3Y 3Q2SC 1S1UB 1QAIA 4ES3A 1CQNA 2HVHA 4R0JA 4PWDB 2FDNA 2ZJPQ 3DRPB 1N0UA 1DURA 2P6TA 3DCAA 1AUDA 1RGVA 2FYXA 4R8UA 4YFUA 4ECYA 3TARA 1WG1A 2VZ9A 1HHQA 4MFBB 1VQYA 4LRFA 4KKOA 3RAXA 1UW4A 2OLWA 1C1BA 2QJ3A 3KK1A 1RKIA 3JYTA 1EJ7L 2ZVSA 5L1JA 4QWDA 5EX0A 3PTWA 2ZBRA 1U1LA 4N56A 3BQ0A 2RQMA 3MAAA 4IOAQ 4NLWA 3HSDA 1WUUA 1XNRF 1Q81T 3ZZRA 4WPAA 3UD4P 2VJVA 1H2VZ 1EHWA 5GADU 2CPIA 3QRPA 6FDRA 3AJ2A 5JMNA 2DRAA 3MHYA 1LQ9A 1NKCA 2CPDA 3MPUB 4K0KF 1PC5A 1DLOB 4C0BA 4RWWA 1AZSA 2X51A 1FKPA 4WIIA 1RWMB 4Y0FA 3IGVA 3MTJA 1S1XB 2OPQA 4GVBA 3TQ1A 1HNVA 4KGXB 2J6SA 4NWBA 3D0IE 3L7PA 2FVPA 3AH6A 1B99A 1TMJA 4DV1J 4RW4A 5IXUA 4I6WA 4JB8B 2KXHA 1U6FA 2PD1A 3L7UA 3KMSA 2XI2A 4BC9A 5L1IA 1RTDB 4RNMA 5KG1A 4A48A 4C8NA 4LF7F 4O3PA 4OYMA 2FHMA 1VRUA 3HJVA 4CH0S 2AYEA 2KI2A 1NHUA 1HBNA 1HPZB 1ZAWA 2HVZA 2PN6A 2ZZTA 4RX6A 3CWJA 4GKJJ 4NYOA 3KK3B 1G3OA 3KLHA 4ED1A 1T3NA 1D8ZA 2N7CA 3ENAA 4M94A 4JV0A 2CDQA 3BGOP 4WZMA 4K59A 1NU4A 3KNAA 4AL5A 5IC4B 1S48A 3GV7B 5DRKA 4UUXA 2ZH8A 4FXVA 4H4OA 2V2ZA 5KFWA 4DS4A 2XS5A 4DPWA 5H9FK 1FRMA 2WRMA 4DUZF 2DYAA 1ZAXA 2NCKL 3CJ8A 2B9EA 4DV6F 4OI0A 3T1YF 1X5SA 3T6JA 2BKPA 3ZNUA 2HGMA 4Z2XA 3VAMA 4ETZA 3TVZA 2M5YA 4KGMA 1GXTA 3G8QA 4ECRA 2GZOA 1RK8A 2XMVA 2CUYA 2DNPA 1JNZB 4DR3F 4WFAQ 1X9MA 2E5HA 4P2SA 3O3LA 2J6TA 3HX9A 2UXDF 4C8MA 5BYQA 2AU0A 4Y2AA 2V4RA 4X66J 4TYAA 1KR4A 2HK2A 3GV5B 4NZ6A 5D0RA 4GVLA 1UVNA 1O0PA 3HJFA 4AFFA 3OL7A 1B0PA 3NWGA 2VC0A 4HLBA 3M9OB 4KH0B 4DBQA 3KYLA 2U2FA 2A1BA 1X0FA 1Q86T 2ALYB 3OVSA 2CVEA 5AJ3F 1RLDA 2HFOA 2WONB 4CLSA 3EGNA 5C24B 4B3MF 1NNDA 3N0VA 4ELUA 1FE0A 2HWIA 2VBWA 5IFMA 2UVRA 5A6PA 2RDIA 5D15A 1FESA 5LMUJ 4DV2F 4EBEA 2K2PA 4MK8A 1WI8A 2WB4A 2MZRA 3ILOA 4OX6A 4NX9A 3CC2S 4JI6J 4K7QA 3ITHB 4LIRA 4UQTA 5ETNA 3W62A 4FNIA 4NMXA 4ZLPA 3CJKB 1VLYA 4MIAA 1CC8A 9RUBA 4DS5A 1I51B 4RZRA 3R7NB 4C98A 2QSWA 4DN0A 1RT6A 4FS1A 3UW1A 1J5EJ 3D7SB 2LEBA 2N3OA 3I0RB 2MZJA 1FD2A 1TL3A 4XIUA 2D3OR 3GIKA 2JC1A 3D68A 4KH1B 2QG9B 3R6GB 4OZ5A 3LPEA 3D6FB 2AWZA 4ZP9A 3C66A 4C8YA 8AT1B 4U8YA 4PWWA 2XZDB 2YXLA 1F1BB 4FF1A 1YJVA 5B0GA 1M5OC 3W5ZA 4Y65A 3FVYA 2CWKA 2F9JA 1S1TB 3W5YA 2HFUA 2GJFA 4ZCIA 2FLLA 3FUYA 1AXQA 3PRVA 2GMLA 4DSFA 3HLUA 2MQMA 1N5SA 2V34A 3LGHA 1RT2A 4B9SA 4LR9A 3W64A 3FKBA 1FXRA 5HQMA 1NJIT 1DTTB 3UE2A 3H42A 2DT9A 1AW0A 1S77D 1RA7A 3A3OB 2R7VA 2ZDOA 1U1KA 2B5JA 5A8RB 2UUCJ 4WJBA 3R6LB 5IV3A 1OSDA 3MM7A 2AGPA 1OJ4A 1LW2B 2KM8C 2NYIA 5KFNA 4X4OA 1VIOA 2VQEF 5C7PA 3KG0A 2P9GA 3BN7A 1RLCL 1UWBB 5KFRA 3F73A 1URNA 2IM3A 3QQCD 2ZDPA 2Y1JA 4IOBA 1JLAA 2VL1A 3ZTQA 1U24A 2J0SD 5KFSA 1N56A 1GT8A 4HR2A 4JOUA 4M5NA 5HK4A 5AXMA 2QMXA 4ECWA 1N5VA 1I3OB 2IC3A 3M8YA 1Q7LB 4WTOB 4N41A 4DCOB 3H2VE 4JI8J 1TVRA 2BRLA 3DGPB 1N34F 5K14B 2DHGA 2FHJA 3PVXA 4PABA 2CQHA 4CO3A 2QA4G 2FZCB 2XTJP 3H90A 3T1HJ 4ECZA 2GMJA 1KKHA 1MNEA 1XTZA 3RUBL 3G87A 1ZTWA 4LT6A 4QWBA 1XEZA 4KGKA 2XMAA 2DKOB 1F9HA 3CF5Q 1NDLA 1PJ6A 2QMUB 4E0DA 1R8HA 3DYAB 4U6PA 3W9HA 2BEFA 3MR5A 3QGIA 5JUMA 4V19X 1XBWA 4EGLA 2XSJA 2R4FA 3CGIA 3E01A 1D09B 1VBXA 4F3OA 1DBDA 4M63A 5HQLA 4U9RA 4DL6A 3R27A 1FTRA 1X4BA 4FBUA 4NXNF 3B82A 1IKVB 2GAGC 1IBMF 1TFYA 3Q8YA 3NMRA 2CPJA 1CPZA 4OYIA 4HTJA 4DL4A 4F04B 2NR0A 4ER8A 1SUQB 2HBQB 3B54A 4DR6J 3MI7X 4JI3J 2WOMA 2ACYA 2UVVA 1EKSA 2OMLA 4NRUA 4E8UA 4OLPA 4FNHA 4C7QA 2YNHA 1GMUA 4QOTA 3R8YA 1T9WA 3QPIA 1MROB 2WBMA 2JLGA 1B4SA 4ZN3A 5KFHA 2GVZA 5MAOA 2AGOA 3CCMS 3A1YG 1YJ7A 4P7TA 3UCUP 4QWCA 3V5RA 3GZ7A 4ZHRA 4K4TA 1D3WA 2AV5A 1BQNB 1GTEA 1T9YA 4RR5A 5H9EK 4NCGA 5A8KA 4IRKA 1RTJB 4ZCLA 4CM0A 3MUVP 2BE2B 4ILLA 5GAEI 3L3CA 4F02A 5DG7A 1SBRA 2C2RA 2W8LA 4QYZJ 3D67A 2ABYA 3VAGA 1FF2A 4F3QA 4LBPA 4OYAA 4GO5X 4IRDA 1V3ZA 1JX4A 5BXIA 4HYKA 1TK8A 4JBCA 3KDOA 1S6OA 1TKTB 2XY7A 3CIMA 3R1HA 1VQLS 2RIJA 4KFBA 1SCJB 4MMOA 1EETA 4N77A 1LWEB 2VPYB 3UO0A 2KFYA 1NEEA 4RNHA 3TO8A 3CNQP 2WSFC 1PAUB 2MLZA 5IT0A 5GAHI 1HI1A 3KUEA 2E1MC 4B3SJ 4Z7YA 3KHRA 1PJ7A 4DLGA 2W7AA 5E3RA 1FE4A 4C0OC 3P96A 3HPOA 4JI0J 2YNIB 4ATNA 4ED0A 2RQCA 2EFQA 5M2UA 3J81Y 2CJXB 3PRBA 5K8OA 3NCQA 2FJVA 2V8DA 5F8IA 4M5IA 4DQRA 3EYZA 2YKNA 1L3TA 2XSFA 1TFWA 4TYBA 4WFXA 4YB1P 3GQCA 4TY9A 3QT8A 3GE9A 5L9XA 1RWPB 4IG3A 2GA7A 2JVRA 3OL6A 3K89A 4KTQA 3VV2B 2OPSA 2HHTA 3HHLC 2XYHB 1Q0NA 2XO7A 4QWEA 5HJYA 4CO1A 1GXUA 2MGZA 2A18A 1KHVA 1TTHB 4USWA 2XMWA 1M5KC 3SXLA 4R8UB 4KHPF 1SQGA 1I5OB 4P6QA 2K8GA 4USMA 4DL3A 4JI4J 4DFJA 4G1QA 2I5JA 5I42A 2CZVC 3OL9A 4H4KC 1M5PC 3CCWA 2CJKA 2G2ZA 4KKOB 2FLOA 1RAHB 3HO1A 1C1BB 4O44A 3MMJA 3L09A 3KK1B 3JYTB 5F3TA 3D1QA 2XZTB 3TX0A 3KMQA 3MAAB 2NREA 3D0HE 3DU6A 2DGOA 1YJRA 1WG5A 3CJTA 3FZ2A 4DPXA 1UL3A 4AL6A 4UQGA 3AFGA 2OTLS 4UT4A 1FRLA 5F0UA 3ZC4A 3JQKA 3SV3A 2V67A 3R97A 1WTFA 4ZVHA 5D4NA 2WB1D 1U7LA 4QIGA 1AZSB 4Q2MA 1FKPB 1JNRB 3HKWA 4NOHA 3HFVA 3A13A 1ZA1B 3BSNA 5DETA 3HHEA 5F8NA 2OPQB 4GVBB 3UVJA 1Q4RA 1HNVB 3X3UA 2KRRA 1A6LA 4NLSA 2OUGA 4YS2A 2DO0A 4YHHF 1JKHA 4RO0A 1FVSA 4RW4B 1JLGA 3QWPA 4KPCA 4MKAA 3NGKA 1OQ3A 4M5GA 1IM6A 1YVFA 3FZBA 5E2QA 2D7SA 5DDQC 4BHQA 1HNXF 2V8PA 4J7CA 1GK8A 1T03A 2MHEA 2QV6A 3F41A 4C6AA 2IBOA 1PO6A 2V2VA 1VQKS 2PE8A 1FEEA 1ZPVA 2V9KA 1VRUB 1B0TA 3HHDA 1VMBA 4PQAA 1K0TA 1UMJA 2D3ZA 1HBNB 4NZ0A 2FVCA 4PR6A 2ZH6A 3C6UA 4OYOA 4C8ZA 5KFTA 4YY3J 2FGCA 5CD4A 1S4FA 4A46A 2BR0A 2VA3A 1N0VC 5I3QA 3MEEA 3RTVA 2HNYA 4UF4A 4IYQA 4TY8A 3KLHB 1EB0A 2F7VA 2Z8QA 1S10A 3UN3A 4DR2F 3QGPA 1F9EB 1Y5LB 4KBIA 4DPTA 5L38A 3ENQA 4OX7A 4YQWA 4ZVRB 1YSJA 2B6AA 1RE1B 4X2BA 3LAKA 3PO4A 4LRCA 4Q43A 1JB0C 4DL0C 5D0EA 4PUOA 1Z2ZA 5KG6A 4WWSA 4ZPDA 1NHKL 4B9TA 1HLWA 4ZP8A 2CA9A 1LNQA 4RU9A 2AYMA 1K1QA 1X4DA 4I6AA 3J7YU 1RT3A 3NNHA 2LXUA 2N7YA 1ZM9A 3AODA 3DRYA 1FJEB 4OJGA 3LWLA 4M5MA 2X1FA 2IJRA 4OX9J 2O01C 5E5NA 1RWNB 2EFPA 1DQ8A 3SSQA 3MPWA 2WVEA 4LF1A 2LXIA 4YB6A 2M70A 2HQFA 2OEMA 2AJ1A 2FIUA 2MSSA 1KC8T 5HVFA 2O1PA 1W2IA 2BW7A 1X8DA 1SPBP 3RZAA 1PILA 2XWXA 3TJAA 2LFVA 1VHFA 4M5DB 4ANDA 2XMJA 1WG4A 4ZPBA 3PKYA 1WC4A 2DISA 3V4IA 4IFYA 1P8GA 4ZOSA 3CJ5A 4UUWA 1UTAA 3NKYA 1MW7A 4I64A 1WC5A 4IDKA 5J1EA 1TV6A 2XNRA 3L9ZA 1IBKF 4KIAA 2YX4A 3MOZA 2NXEA 4OFZA 3O8WA 1VDHA 3HVTA 3DFEA 4P52A 4K50A 1RT6B 2GV1A 4B3TJ 1WELA 1TL3B 3OFEA 1QVGR 4OI3A 4OI1A 4DX6A 2E5LJ 1SH3A 3G6YA 1UW9A 3W7BA 4ZLJA 3QAEA 2VICA 3T3FA 3RGIA 2PIIA 1ULRA 3GR1A 1N33F 3HFKA 1N54B 2WVBA 2CPZA 5HP1A 2B56A 4DV7J 4LF8J 3EVOA 2KDOA 2HHHF 2CQPA 2AZ3A 2XEXA 1EIYB 2AGQA 2GQQA 2B8QA 1UFLA 1H72C 2BW2A 1CEZA 4FPRA 5H9FJ 3CCZA 4NI2A 2B5JB 1JQGA 1XIQA 1P1TA 4F36A 4MK7A 3VVUA 2AD9A 2K1RA 3MM7B 2G1HA 1RSCA 2QSFA 3GIMA 1RWXB 4JV5J 2DPJA 3IG1A 2KG1A 4RW7A 3S6EA 2HQGA 2O66A 1RAGB 4LSZB 2ZC4A 5EWEA 3OW2R 1IJFB 5B08A 5HQ8A 4RPFA 3ZFVA 2IYGA 1HR0F 1HWUA 4O4GA 3PW5A 2NYHA 5SUHA 3N9UC 3LO3A 2IC3B 1B7FA 1I6JA 4NPOA 1T8EA 4USHA 3Q8QB 3MUMP 4YP3A 4C3KA 3R3TA 2LQ5A 3AY0A 1UJ5A 1MU2A 1TVRB 2ZH3A 4J9UE 3T6BA 3PHTA 2DGQA 3R7BB 2N4DA 1Q8BA 4J91A 1AA1B 2Y1IA 1HWLA 4LF6F 4C48A 4AE5A 3EX7B 5FLXU 3P8BB 3ZXWA 3BM7A 3X1LB 4DQQA 2J8SA 3WDOA 4X64F 3EZUA 2B9WA 5D0HA 2A10A 3SQOP 3CEDA 2M2BA 2IYIA 2BYCA 3JAMU 1Y00A 4IG0A 1K44A 5AT1B 5ITHA 1HNWF 2XSJB 1NAQA 3E01B 4I68A 2HG4A 2VG5A 4NLXA 4UOGA 3DHWC 1S76D 4DR1F 3C8YA 3HVAA 4MAKA 2DGWA 2DO4A 2UXCJ 2HHXA 4ES2A 4R5PA 1KNZA 1TQLA 2XYGB 3PJWA 4DR7J 2H54B 2ZE2A 4QQBA 2B7CB 2WOMB 2R8IA 2YNHB 3LP2A 1KQGB 4USVA 2C2NA 4O3OA 4I6YA 1UJ6A 3TJ8A 3O1LA 5DM7Q 5HLFA 4RL1A 4DXLA 5HO4A 1X5OA 3I4PA 1VQSA 4DCJB 3RAQA 2GVZB 4P7VA 1R3NA 3V81B 2HAFA 4K4SA 4I2QA 3IBWA 1VC6A 4F67A 4Y6IA 1SJRA 3IRXA 4QPTA 4NLDA 4QR1A 4ZHRB 3GIIA 2VV5A 4HHUA 3ZO7A 2PSZA 2MKHA 5EUHA 2ZOGA 2VOOA 3C19A 1PKUA 3KJNB 4NCGB 3TP2A 3K58A 4R0EA 5KFMA 2OFGX 3M1VA 3RG6A 3HK2A 4F26A 2NS1B 1A7GE 2RVJA 3LGNA 1QAXA 2B43A 1XMOF 3HD2A 3DXSX 1UKUA 3R5JB 2EWHA 3M8QA 2EK1A 4DFKA 1WORA 2COLA 2MKIA 1ZAVA 4L74A 5FLXY 2HZCA 3ZZ0A 1KN6A 2VG6A 3AOCA 2D69A 2HKEA 4KFBB 2A6MA 2P9CA 2VFVA 2F4VF 3M2VA 3M30A 2QEXS 1VQNS 1SIWB 3NCPA 3HFZB 1EETB 3ZZUA 1RQ0A 3DM2A 1BGXT 2PMZD 2DR8A 4PRFA 3PW7A 3MMAA 1U25A 2NLWA 1FRJA 1QJHA 2I0XA 3CUNA 4QR0A 2CIMA 4RBUA 5ETSA 5HMWA 1UEKA 3KK2B 2ZH9A 4DV4F 2C42A 3AD9C 2J8AA 2QL7B 4KY3A 4ZLNA 1X0PA 5CQGA 4ALZA 1KLNA 1VRQC 2H5EA 2R3VA 4RNFA 1JLFA 1LV5A 2PEBA 2GFFA 1GX6A 5GMKa 2YWEA 1PIEA 3TZWA 1E6VA 2MZ1A 2YKNB 3LTOA 3EXYA 2DBBA 2KFZA 4ECSA 1D9FA 2AQ4A 3QAUA 1DTQA 5F9NA 4IG3B 2BQ3A 4MYTA 3T5HA 3OQ2A 2MHNA 1D9DA 2OPSB 2XS2A 3HULA 5DDRC 1C2PA 3A4TA 4X4PA 2MGZB 3FSXA 1UA1A 3WZ0A 1F3VA 5CD4H 3KTQA 2A2DA 1ZM4A 2CKWA 3CCSS 1T94A 1IWGA 4WXOA 3SI8A 1RBOB 4ED4A 2VB6A 4LMZA 4MTPA 2BA9A 3T9NA 1NSQA 4G1QB 2I5JB 5I42B 1E6YA 2HMIA 1SKUB 1X31C 4EMDA 2KT5A 2WVCA 3LUYA 2J9CA 4Q8FA 3OUYB 4TLRA 4DR3J 4TXSA 2G13A 5T41A 5JJBA 2WZ1A 3FSYA 5B0DA 3PYDA 3M8WA 2JLFA 2UXDJ 3CCUS 4ZVPB 5H9EJ 4BLGA 1HKAA 3RBXA 5D8HB 2F1FA 2EFGA 4LUBA 2DXEA 2R7UA 5KFPA 1CS4A 1QUPA 3RRHA 2PFDA 4C11A 2D74B 1HQ2A 2Y1RI 1IR1A 2CQCA 3H20A 4RUBA 2P6SA 2ASYA 5LMNF 2J9DA 3RRGA 3MM6A 1U48A 1MMNA 4CDIA 2DPIA 3WX8A 3LPYA 2VOPA 3UVJB 5KFDA 2RRNA 4K5SA 3GP9A 1QVFR 1G6BA 4DV2J 2W9CA 5E3QA 2L08A 2ZNZA 2HGLA 1JLGB 3IXQA 2Q79A 4LFAF 3ZNJ1 2RILA 2VFRA 1U1NA 2KN4A 3BGRA 3MCMA 4ZVUB 4GKKF 1RXOB 2MY8A 5DS7A 4LF9J 3HVRA 2R2SA 4OZNA 4F7VA 1T03B 2CJBA 4B9NA 2XHCA 1N5QA 1JJHA 1YQHA 5LOQA 1FNXH 4L3KA 3BBFA 1IKXA 2CZ4A 2DGXA 3QJLA 4HHJA 3VVTA 2ZC3A 4OJ3A 1W26A 2ZD1A 1T95A 4JI5F 4AQYF 1RAOA 3C6UB 3MCOA 3ADAC 3HKZD 2JDJA 3ICLA 2DB1A 1UFKA 1YDLA 3RRKA 2FHKA 4WBFA 3MEEB 2HNYB 2BRKA 1IUJA 3IC1A 3ISNC 4TY8B 3NXZA 1ZETA 1OO0B 4C3MA 5GAEU 3PW0A 1LWXA 2DR9A 3LOUA 2OKQA 1WACA 1T9UA 4CP5A 4XPEA 2YY3A 3I5CA 4Z7CA 3PZPA 2CNKB 2VF3A 2DNOA 2F8HA 1JLBA 4EYIB 4CH1A 4X65F 4LFBF 1ZZFA 2B6AB 5KFUA 3GTYX 4ECUA 3MAQA 1OY6A 2V8VA 4O3NA 4LF4J 1Q8KA 1HQUA 1LK7A 5FD1A 1BWEA 2VASA 3SV4A 2ZJQQ 2OPRA 1S9GA 1LWFA 4PUOB 4FYDA 1LXNA 2CYYA 1HHTP 1RU1A 3ETMA 3I0SA 4TKTA 4E2FB 1XNQF 1U0HA 1T9VA 2UUTA 1DHMA 4U96A 4PG4A 1WHWA 3CDBA 2QL5B 4NLGA 4OHVA 2BUNA 5GAHU 4HL9A 1UPMB 1U1PA 3M7VA 2HBZB 3SSRA 1RT3B 4IOCQ 2MMYA 1VBZA 4XO0A 1CC7A 2OAUA 3N5FA 5D77A 2DIUA 3DLJA 2QL9B 6FD1A 4FP9A 1EAYC 2YWGA 1WD6A 2FY1A 1H7WA 5BR8J 2GHWA 3MOJB 3DN9A 1PYOB 2NQPA 3IWNC 1VQ7S 5A0YA 3FBFA 2W2QP 3CPWR 2A3JA 3CJRA 5E3PA 2Z2LA 3D3BJ 4L6V3 3EM1A 4OI2A 1UPPA 2W4DA 1X60A 2AF6A 4MKYA 2QX0A 2GVDB 3N6LA 1N34J 2RDDA 3CMAS 2YQ3A 3W9IA 5KFGA 1UP1A 2V69A 1NB2A 3A8KA 3QJPA 3ZTPA 3V4IB 3BH7B 1RABB 2VFUA 3Q8UA 3GILA 1PG5B 4LQ3A 4ANEA 1HNZF 2KTQA 4Q8EA 4FZVA 5I3UA 2HPUA 2Y8WA 2OP5A 1YZ6A 2BKOA 4IDKB 4F4YA 5J1EB 1TV6B 1GTHA 1NJYA 3N28A 4L73A 3DLHA 2RRAA 1REVA 2FLNA 3CVKA 2DVIA 1OWXA 3QIPA 2LU1A 3HVTB 3KHGA 1VR6A 3OFHA 4Q0BA 3H0PA 1V3SA 3JTPA 4F50A 3AOBA 2VPWB 1UVMA 4CTAA 3NLCA 5DZ6A 3EJMA 1NPPA 2KB2A 1IBMJ 1VS3A 2AYGA 1TUWA 4NA2A 1H0HB 3A3PB 4DSKA 4DZ6A 1BY9A 1R31A 3ZZOA 2HHQA 3GG0A 1T7PA 1F3FA 4O23A 3VGSA 4HHHA 4F8RA 3O6QA 5HP1B 4DL5A 2CNLB 1HYSA 2LA6A 1HBMA 3S8SA 2HZVA 1PJ5A 4LF2A 3MM8A 3LA0A 5EN1A 3GJQB 1REGX 4ZMMA 2DR5A 1TK5A 3R1LA 2MQ8A 4YR2A 2XO6A 2AJ4A 4A8OA 4NI2B 2GIFA 5IV4A 2KH9A 4CQ1A 4ZA1A 2V2KA 4QBUA 1RADB 2M3DA 4KT0C 1U09A 3EE3A 3MEGB 2K1RB 2JLEA 4EBCA 2R7TA 4WU3A 2YKMA 3BF4A 1FVQA 3T5LA 2QT7A 3GFZA 1KWMA 1UA0A 3HHKA 3IG1B 4RW7B 3ZZYA 3VQTA 3D3CJ 2ILZA 3UPFA 3POTA 1RBLA 2VUGA 2HVIA 4DV1F 3CULA 1U6ZA 1FWLA 4O4GB 3DOLA 2RRBA 4RW8A 4OHYA 1X4GA 4JV2A 4F25A 1OS5A 2DH7A 1T3OA 1NM2A 3RB3A 1RWVB 1YBAA 4CYUA 3M6UA 2PI4A 4RUAA 1ELOA 4J9RA 2C3OA 2E7WA 3IMQJ 1FEHA 1XC9A 4A8MP 1NDKA 1TMMA 2E5GA 3MZIA 1FD8A 1BC6A 5KG7A 1KOHA 4KE5A 2YVSA 2IA0A 4DL7A 3NAHA 4P2FA 4GKJF 2YWWA 1U45A 4ENOA 2KJVA 1NSKL 4H4KA 2OD6A 3KLFA 5HN0A 1CJVA 2CWXA 1U1MA 4HTIA 4IG0B 2E1RA 1Q82T 1B7YB 4P2XA 2MDAA 2VG5B 2DIVA 3RBEA 4OHZA 3KLGB 1UETA 2IVYA 4DN9A 4BBYA 3V6DA 1Y3KA 3T41A 4FYYB 4O4RA 1IKWA 4DSIA 5B0BA 4R5PB 2VFTA 3UQSA 3PW2A 2MKJA 4LSNA 1EP4A 1JXVA 2M9KA 2ZE2B 2ZHOA 4F0MA 2GO9A 3ZTSA 4ZJQA 3MURP 3LP2B 4KHPJ 3PV8A 3CO0P 1HNIA 4MH8A 2H65B 3GCWP 4IO1A 4A8KA 1OPZA 5HLFB 3UI3A 3IR7B 3LAMA 4ETXA 3EVWA 4Y2MA 4DPOA 3ILIA 1PYSB 4I2QB 3Q22A 3Q24A 4ZCMA 4X66F 5CYJA 2QC3A 1P9YA 1FRHA 3IRXB 3W61A 1QSYA 2IM0A 3LANA 1OIAA 1RAFB 1K73T 1MN9A 1R43A 4JYAJ 2VBZA 3HZEA 4ZVGA 1XJWB 4KO0A 3M1VB 2IJNA 2PC6A 2GS8A 2VFSA 2E66A 1IXKA 2B4VA 1S0VA 3VZHA 3I6PA 3BDEA 2VC1A 3D5MA 3M8QB 2JJ4D 3ZTRA 4OZJA 5LMUF 2OMOA 1AT1B 3IWXA 2C3YA 2MKYA 1U2FA 1JIHA 4EK2A 1KRPA 2VG6B 4OQJA 4JI6F 3TAMA 5IT9Y 4NCAA 3M30B 1X4HA 2IMOA 3M9MB 2HQ3A 3PNIA 5AXLA 3KJVA 4MJKA 4DSLA 3DM2B 1S9EA 5IQQA 3MMAB 1J5EF 5D6GA 1RT1A 4PXBA 3CSKA 4PKDB 4LFCJ 4FF3A 3GIJA 1Z1ZA 2D41A 3A8JA 1S6UA 2ILYA 4CLTA 3BKTA 1IBLJ 1HNXJ 2MLXA 1H2UX 1U49A 2BBEA 2ZBPA 1HBUA 4MYUA 2P8IA 2FD2A 1JLFB 2LQJA 5F0WA 1HHSA 3H25A 2CQ4A 4NRTA 1E6VB 4IUFA 4RU2A 1RHQB 4U8VA 4G65A 2MEWA 2BJ1A 3GWCA 4Y00A 1M1GA 5C25A 4LR7A 3OFFA 1DTQB 3QATA 4FN5A 1BHNA 2ZZMA 3H7HB 3BBBA 4XAKA 5KFBA 2BX6A 1CLFA 2CJAA 3H98A 3MPYA 4DR2J 1CQMA 1R8CA 5FJ4A 1LEOA 2PGCA 1R0AA 1KQKA 3KLVA 4NYPA 4FYVB 4B02A 3ELHA 4J90A 2AJFE 2C3UA 1VQ5S 4DR5J 1E6YB 1EARA 2RF2A 2HMIB 3FGVA 2HRYA 4HACA 3K8WA 3PX0A 4K4UA 4Y2KA 3I82A 2R7RA 2VBXA 2JFKA 4HI1A 3OLAA 2PMHA 1QD1A 2EFNA 4AD6A 3GJRB 2YWHA 5KT2A 2F8EX 3UCGA 3JQMA 2EKYA 2PT0A 2CQIA 2CQ0A 2I38A 2AEFA 1S7HA 2ASDA 3T5KA 3THVA 4JI8F 2QLFB 4O0IA 4ZCKA 1IKYA 5F9LA 4O3SA 2W9AA 2KJWA 2CQ2A 1HIYA 2ZH4A 3CT9A 1RBAA 4RW6A 2LMIA 1WKLA 2L41A 1VIXA 2XMMA 4USUA 5F3ZA 4OJ1A 3T1HF 2X3GA 3D6MB 4C11B 5G0RA 4QIFA 2JVOA 2CADA 1FKAF 1FKOA 3MM6B 1I1GA 1RT4A 2ZBIA 4DX8H 4PYAA 1FRIA 4WYWA 3G82A 3N79A 4NE9C 2W9CB 4LRDA 5E0OA 4FKXA 3G9CA 2Z4PA 3TR5A 2HIQA 3D1HA 3NBPB 5AXKA 3BGRB 3TI0A 3BKFA 1NK7A 1T0TV 1GEHA 2CPFA 2JZ5A 1O6XA 3I9ZA 1QTMA 2UU9J 3KDNA 4JI3F 1OSCA 1NKEA 3BO2A 4F2RA 1PBUA 2ZD1B 3Q23A 2UZAA 2C2OB 1K8AT 2KM8B 5RUBA 5HBMB 4DMZA 3D1OA 3GIRA 3ULHA 1N33J 4ECXA 2O5DA 2RKIA 1FHTA 4BS2A 3IP0A 1SQEA 3UNGC 2NPIA 5A2QU 4DF4A 2DH8A 1RAAB 2AKWB 4X4NA 3M32A 1F6TA 2VPZB 5KFCA 2D3UA 3PACA 3KWMA 2HHHJ 2E9ZA 2I8EA 1JLBB 1T9XA 5M2RA 1KBRA 2DNZA 2HFVA 1HQUB 2P2CB 4ZKAA 3IM8A 2W9BA 1SJ3P 2V5HG 1YBTA 3R5BA 2OPRB 1S9GB 3QNWB 1LWFB 3BSOA 3MMBA 1U4BA 3R5GA 5DG9A 3I0SB 3OBIA 4TU8A 3TAPA 1TL1A 4ZVOB 2ZKTA 2ZFHA 2OEJA 3THPA 3QGHA 2CNNB 4OYXA 1U0HB 3DMJA 4NASA 3I96A 3IAS9 3T9ZA 3CJ3A 4DQSA 2R8KA 3BSCA 2XULA 1C4AA 1FDBA 3TVKA 5J2PA 4MT1A 1ZTTA 3NRBA 3J81j 1WC3A 1XN9A 3W2VA 2HS0A 2NSCA 3TX8A 4ELTA 3CC4S 3I55S 3QT7A 1WI6A 4LBHA 1YHQS 2MXYA 4FYXB 4EEYA 4NXMF 4W92B 4OHWA 4LVNP 2DHAA 4PAAA 5A0YB 4QW8A 3DOKA 2BKNA 1SC4B 1VLOA 3M2RA 2YQ0A 4B9VA 3CDWA 4X4TA 4B3SF 4OX8A 4ID5A 4M5HA 1U47A 2E1PA 1RI7A 3QFWA 3SCKE 2KL8A 2EBGA 3H8YA 2XB2D 5A8WA 1YX2A 5DQIA 3OTOF 4A8QA 2C3PA 1W2BR 5B09A 2QIFA 2A0FB 2HIYA 5CHCB 2GGPA 2QA2A 4QU7A 2EK6A 1V6HA 4LF6J 2ZZNA 3AHPA 4WYLA 2XLKA 3HHLD 1RACB 4PWUA 5I3UB 2GMHA 5LSOA 1G4CA 2DHHA 1TUVA 2DXDA 3EGVA 2CJ9A 1H98A 1REVB 3FCWA 5A2QY 3QIPB 3I87A 2BJ3A 4DOZA 5IWAF 4Q5VA 1QY7A 5DO2A 1FJCA 2M8HA 4BWJA 5JVGQ 1FRKA 4TU7A 2QYGA 4JI7F 3BGLA 4Q0BB 2Z58B 1TKDA 2RDJA 2RB7A 4KHMA 2XCPA 2KHCA 4CTAB 4P73A 2IVMA 4JI4F 1YI2S 1HMVA 3FEZA 3S7RA 4ED8A 3AA9A 2LXFA 4WFNQ 4UOFA 1ZH5A 5KOXA 3SYZA 5DG8A 1AYEA 4K4VA 1NBEB 1TL7A 3JS9A 1CULA 1HYSB 3G86A 1HBMB 3ZZTA 1NRKA 3MM8B 2ZH1A 1NK9A 4YB5A 3M8SA 4NLUA 2HFNA 3TEHB 3AQPA 3GG1A 4HKQA 2KT2A 3GFHA 3GFXA 3WBZA 1PSDA 2HBYB 2AHOB 1NB7A 3VZIA 3IBCB 4M5KA 1M90T 4U7UK 2YKQA 4CLLA 3LP1A 1R6YA 2EKNA 2YKMB 2XLIA 3PKMA 3P5TL 2E5JA 2B0GA 1NPKA 4KYZA 4F0KA 3QSYB 2H5IB 1VQPS 3OTEA 3TA2A 1HW9A 1F5BA 3N6NA 3PRDA 1UFWA 4IH5A 1P27B 3C16A 4CIOA 1JWWA 2OPPA 3NS6A 2OI2A 1OMSA 2FZGB 1J27A 3DNCA 3POTB 1Q79A 3BB5A 1YG0A 4OZ0A 2EI5A 3WQPA 3UDLA 4LF5J 4G1IA 3DOLB 3M4XA 4RW8B 2QLWA 4M5JA 2L3MA 3ITHA 1VBKA 3WC0A 5HAOA 2LQ9A 2Y8YA 3L95X 3W1YC 1TKZA 3D4JA 4NLOA 1WEYA 1WF2A 2MQLA 3IBFB 4DV5J 2J0QD 1TAUA 3HHLB 2ATLA 1CJTA 2LCWA 4UZCA 3A12A 1A0OB 4NLPA 3I0RA 1XQIA 2R8GA 2H4WB 1ICEB 1VK8A 1YGYA 1N32F 3CXCR 2OH2A 3QJJA 2BJEA 1WHYA 4C2MA 4Y2CA 2OSQA 3CMQA 2DD8S 2CPHA 1FDDA 4AYBD 2V8GA 3MEDA 2EPIA 3KLFB 1LOUA 2UUBJ 1CJVB 4EUVA 3IA0A 3PR4A 3EVMA 1TL4A 2RHQB 2RHSB 3HT3A 2WSCC 1VQ4S 3K57A 4ZVQB 3H59A 3A8EA 3CD6S 2FLPA 3V6DB 5KTQA 2DK2A 1KHWA 1D1UA 3RB4A 4CLFA 4EO6A 1U6BA 2L48A 3FC9A 4FXWA 1IKWB 2JEJA 1F60B 3BN4A 4Y28C 4LSNB 1EP4B 4Y3CA 5LXYA 1NK8A 3BR8A 2BE7D 3PJ9A 3EDQB 3HSJA 4EWTA 3HP6A 4DUTA 4EBDA 3CTRA 3VF0B 1HNIB 3FMBA 2VONA 4MKBA 2XC9A 5GAGI 3LP0A 2ZUAA 3WC2A 4C4WA 2CZ9A 2IY5B 3CW2C 1XMQJ 1YJNS 1WDDA 1S4EA 2AX1A 2YWFA 4OMFG 2VQFF 3TAQA 2KKHA 4JI1J 4A4JA 3GB0A 4DCPB 1PCAA 3PX4A 2Z0GA 5K8MA 3Q8PB 4RNNA 4I7FB 1RAJA 2HGNA 4KO0B 1L5UA 1C1CA 1UVLA 1HA1A 2B9YA 2WW8A 3PIPQ 4LRBA 3DRRA 4FF2A 2W4CA 3DGPA 3K5OA 2HRTA 2DNNA 3CB4A 2I6WA 4BCAA 2XM3A 1MMDA 3GPAA 4X62J 4AL7A 1QAJA 5D4PA 1BUXA 2ZM6J 2MZTA 3N01A 1SB6A 2Q1LA 3G6ES 3KLEA 3BQ1A 1NZAA 4PXCA 2QA4S 3MR7A 2V0NA 3AOAA 1CJUA 3ILJA 4MIBA 2BJ8A 4ZIWA 3TAMB 4USKA 1U8WA 3VHQA 4QPXA 2AJQA 3W8GA 4Z37A 3JB9k 3NWRA 1VJWA 1M5VC 1QLNA 3KJVB 5KG4A 4ZJLA 5EX3A 5B0FA 3HCXA 2V2QA 4JUZA 1S9EB 4G3IA 2WTFA 3PHEA 2AEMA 4LFAJ 4B3TF 1R8PA 2POKA 2VA2A 3FFIA 3VAIA 3UD3P 2ZVIA 1DJ0A 3CD0A 2IHR1 3OSNA 3E2EA 1MWQA 2E5LF 3DLEA 3KKFA 2ROEA 4CNZA 1TKXB 2FB0A 2YH1A 1ZA2B 1IVZA 1OYEA 5CH7B 1FWKA 4N76A 1FJGJ 1UVKA 3U02A 1HD1A 3MFHA
chains in the Genus database with same CATH topology
4TYAA 2W24A 1KR4A 3MEGA 3GV5B 4NZ6A 4OLOA 4F4XA 1G6BA 5I4MA 3G71S 1SV5B 2W9CA 5E3QA 1UVNA 2L08A 1O0PA 2ZNZA 3HJFA 2HGLA 4AFFA 1JLGB 2AP6A 3IXQA 5E33A 1D8YA 2Q79A 3OL7A 4LFAF 2M88A 2NUHA 1B0PA 3NWGA 4LF8F 2RILA 2VFRA 1RTHA 1U1NA 4LJMA 2KN4A 4JI2F 3H4DA 2N4CA 3BZQA 3BGRA 3FMWA 3SQGA 2VC0A 4HLBA 3M9OB 3H2LA 4GKKF 1KTQA 5C25B 2FJAB 4RWXA 3FQKA 4DBQA 2MY8A 5DS7A 2UV8A 3HVRA 2J6UA 3KYLA 2R2SA 1DARA 2CPYA 2P9EA 2VKRA 4OZNA 4PPZA 2U2FA 2A1BA 3HMJG 1T03B 4OV1A 4USJC 2KO1A 2CJBA 4B9NA 1X0FA 1N5YA 1Q86T 3IFEA 3OVSA 3OXLA 2MJNA 5KFAA 2CVEA 5AJ3F 1N5QA 1JJHA 4DL2A 3J7Z5 2HFOA 1RISA 2WONB 1YQHA 3EGNA 5C24B 1FNXH 1NNDA 3N0VA 4B3MF 4ELUA 1FE0A 5KFXA 2HWIA 2HW3A 2VBWA 1IKXA 2CZ4A 2DGXA 3NMAA 5IFMA 2UVRA 4WFZA 5A6PA 3QJLA 2RDIA 3OPKA 3RB0A 1R0AB 4HHJA 3D28A 1FESA 2ZC3A 4OJ3A 4DV2F 2E1CA 2ZD1A 4WE1A 3V2UC 4EBEA 2K2PA 1T95A 1UVJA 4JI5F 4AQYF 5F8JA 1RTIA 4F2SA 4MK8A 3C6UB 3HKZD 1UVIA 4QYRA 1WI8A 5K9FA 2JDJA 2WB4A 3ICLA 2MZRA 2DB1A 4OX6A 4NX9A 2KXNB 3RRKA 3CC2S 4NL5A 3N4WA 4JV5F 2VD3A 2QLXA 3ITHB 3AB2B 4LIRA 4UQTA 2FHKA 4FNIA 1GQEA 3MEEB 1KQFB 2HNYB 2BRKA 1QSSA 1IN0A 5THWA 4ZLPA 4DQPA 2BM1A 1IUJA 3IC1A 3ISNC 3P3DA 3CJKB 2RF2B 2ADCA 1DFDA 4TY8B 2GJ2A 1VLYA 1R8AA 2CQ3A 4MIAA 1ZETA 1OO0B 4C3MA 5GAEU 3D2WA 1GH8A 1CC8A 3PW0A 5KFKA 3JSMA 3KG1A 2B9XA 1NKBA 1SJQA 1LW0A 2DR9A 4DS5A 3LOUA 2OKQA 1SL0A 4EFAC 1DQ9A 1WACA 1X4EA 2HHUA 4USIA 2HNZB 4ED7A 4RZRA 4XPEA 2YY3A 3I5CA 4C98A 2QSWA 4K4XA 4DN0A 1RT6A 3OXGA 4FS1A 4ED2A 3UW1A 4CO4A 1RYSA 4X4UA 3PZPA 1WF1A 3DRSA 2LEBA 2N3OA 5HI7A 3I0RB 2DNOA 2MZJA 1FD2A 1TL3A 2F8HA 2XY5A 1JLBA 1VC0A 4EYIB 4CH1A 4XIUA 3VAHA 4IO9Q 2D3OR 4X65F 4LFBF 2K3IA 1ZZFA 3GIKA 2B6AB 2JC1A 3Q0AA 5KFUA 3NG8A 4K2XA 4F4KA 1HFEL 4ZDNA 4ECUA 3MAQA 1Y3JA 3LWMA 3OTCA 2ZJRQ 2V8VA 4O3NA 4DG1A 1G2EA 1HQUA 1LK7A 3DLBA 2IAJA 5FD1A 1HL6A 3M6WA 5EWFA 1BWEA 4OZ5A 2VASA 2HHVA 3C6TB 2AWZA 3M2VB 5M2PA 2PI5A 3SV4A 4ZP9A 5DM6Q 2ZJQQ 4I67A 2OPRA 1FTCA 1S9GA 3C66A 1YWXA 4IH6A 2P5VA 1GAOA 1LWFA 4KHRA 3U1NA 2IM2A 2SXLA 1SIZA 1IKYB 1S6PA 3D54A 2RSQA 3ONQA 5T7LA 1KQSR 4PUOB 4OL8A 4FYDA 1LXNA 4FF1A 1YJVA 2CYYA 5B0GA 1M5OC 1HHTP 1NK6A 2VODA 4J9LA 5GADI 3I0SA 4RW6B 4TKTA 2J7WA 2NPFA 1XNQF 1H6KX 5KOWA 4Y65A 4LSLA 3FVYA 2F9JA 2HS3A 2YNGB 3DLKA 2UUTA 1DHMA 1S1TB 4HDGA 3DI6B 4PG4A 2FC8A 4Y2IA 3I5BA 4ZCIA 2FLLA 3KLGA 1NK4A 3W2WB 4Y34A 4ZPVR 1WHWA 4XDDA 3CDBA 1AXQA 5F8HA 2C2DA 2GMLA 4EO8A 4NLGA 1RWUA 3DLGA 4OHVA 5G0RB 5U47A 2X1AA 2E44A 2BUNA 4DSFA 3HLUA 5GAHU 2MQMA 4HL9A 1N5SA 3CC7S 2APOA 3JTOA 5CYQA 1RT2A 2WSEC 1FKOB 3PDNA 1RT4B 4B9SA 1U1PA 3SSRA 5D4OA 1RT3B 3M2UA 2I2YA 1FXRA 1NJIT 3H5UA 1DTTB 3UE2A 3OR2B 1LFPA 2MMYA 3MAHA 4IOCQ 5J2MB 1VBZA 2DT9A 1AW0A 4XO0A 2E9RX 1S77D 1CC7A 3HHNB 3OTBA 2OAUA 2E1AA 1RA7A 4ZS6A 3N5FA 4OI6A 5IS2A 2R7VA 5D77A 2ZDOA 1KEKA 2DIUA 1S1WA 1U1KA 4F4WA 5SZTA 4J9MA 2B5JA 3DLJA 5A8RB 2LDYA 1NK5A 1N4LA 6FD1A 3OHAA 2ZH5A 1NK0A 4FP9A 1P9QC 3IO1A 2YWGA 4WJBA 4ZVFA 3F56A 1JLCA 4ZPTR 1WD6A 2FY1A 2V4JA 2KU7A 1H7WA 1PC4A 2YWKA 1OSDA 2LYVA 2GHWA 3O5TB 5MLCV 3MOJB 4TQSA 3DN9A 3GR0A 3MM7A 2AGPA 2NQPA 3BGFA 3IWNC 2QA1A 2ZKUA 1VQ7S 5A0YA 3VR1A 4X4QA 4G6VB 1LW2B 3CPWR 2A3JA 2KM8C 2NYIA 5E3PA 5KFNA 2Z2LA 5LL6d 4L6V3 4X4OA 1Q8LA 5DGBA 1VIOA 2BM0A 2VQEF 2ZNYA 2RMLA 4OI2A 4B3RF 3ETOA 1QE1A 1WEXA 3KG0A 2P9GA 2JEFA 3FQLA 4YDDB 4J9PA 1IM4A 2W4DA 1C0TA 3BN7A 2AF6A 1YIJS 4MKYA 1MWYA 2HNDA 2N3LA 1UWBB 5KFRA 2UXCF 1L3VA 3F73A 1URNA 4KPYA 3N6LA 1ZBTA 2C2EA 5B0CA 4H4MA 3CMAS 2IM3A 4DR7F 2ZDPA 2Y1JA 2YQ3A 3GFYA 4IOBA 5KFGA 1JLAA 1UP1A 1W25A 2VL1A 3EZ5A 1X5PA 1B0VA 1U24A 1Y5IB 1U8SA 5KFSA 3V4IB 2J0SD 3QJPA 2UUCF 5KFFA 2VFUA 3JTNA 2AX0A 1N56A 1GT8A 2ZOFA 4ECQA 3KOAA 1GX5A 4JOUA 3GILA 1TP7A 4LQ3A 5AXMA 2BQUA 3AAWB 2XI3A 1HNZF 2KTQA 2QMXA 4ECWA 2DCUB 4Q8EA 4FZVA 3I9V9 1N5VA 4B9LA 5I3UA 2HPUA 2IC3A 5KFZA 5C5JA 2PA8D 2OP5A 1Q7LB 4IDKB 2GHVC 4F4YA 5J1EB 1TV6B 1JK9B 1GTHA 1NJYA 1H2TZ 1B64A 4N41A 1ZOTA 3N28A 1C0UB 3DLHA 2RRAA 4QWAA 4NLVA 3HZGA 1VC5A 3H2VE 1REVA 2FLNA 1SJFA 2HHSA 2RKIB 1TVRA 3CVKA 2O67A 4L3NA 4YUDA 2DVIA 5E3AA 2BRLA 2LQBA 1OWXA 3QIPA 2LU1A 3DHXA 1VRTB 4QU6A 4CCHA 1XR7A 1KVJA 1N34F 5K14B 3HVTB 3KHGA 2DHGA 2CG4A 3HM9A 4DQIA 2FHJA 3M32B 3PVXA 2DNGA 2VG7A 4LF5F 2JEIA 3OFHA 5KFJA 4Q0BA 2F9DA 2R2RA 1URRA 2I1RA 3CJ2A 2CQHA 4CO3A 2KYXA 2QA4G 1V3SA 3JTPA 3EUNA 4F50A 4ECZA 1FERA 2ZHBA 3RR8A 2GMJA 4IH7A 3IAM9 1MNEA 2DJWA 1XTZA 4IQXA 2VPWB 1BD6A 1ZTWA 1UVMA 4LT6A 4QWBA 4CTAA 1XEZA 3NLCA 4KGKA 4H4OB 2KB2A 4QIEA 2HLUA 1VS3A 5I3PA 2AYGA 3TUIC 3MPVA 7FDRA 4O3RA 4I2PA 1KS2A 2RD5C 4NA2A 2RE1A 5DLGA 1LWCA 1SC6A 3B8HA 3QZ7A 1H0HB 2XCAA 2W9BB 4DV5F 4DSKA 3OJUA 3CF5Q 1S49A 2IJFA 2GC8A 1JLEA 3MMBB 4NA1A 4LQ9A 4E0DA 1R8HA 1BY9A 4A8WA 3DYAB 1R31A 3ZZOA 2HHQA 3GG0A 3NAIA 4U6PA 1TL1B 3FNNA 4YR0A 3MR5A 1T7PA 3QGIA 3DRXA 3K5LA 4BDPA 4O23A 1Y4ZB 5JUMA 3HI9A 4V19X 1XBWA 2CPEA 3JSBA 3DMJB 2IM1A 3O6QA 4YEAA 4EGLA 2X1BA 4DL5A 5HP1B 2W8KA 4EYHB 1X4CA 2HYIB 2GQ2A 3SSSA 1HYSA 2LA6A 1HBMA 4MIWA 2XSJA 3S8SA 2R4FA 3CGIA 3E01A 2RQ4A 1VBXA 4F3OA 3BS9A 3MM8A 1DBDA 4M63A 3OVAA 5EN1A 1VQMS 4U9RA 4DL6A 4M1KA 3R27A 5J2PB 1FTRA 3RBDA 3CD7A 4ZMMA 3TYTA 2YTCA 2DR5A 1TK5A 1X4BA 1M0SA 4KB7A 1OQ6A 1Z2LA 4FBUA 4NXNF 4KSEB 3B82A 4DDFA 1IKVB 3W2VB 5EWGA 1F2GA 3R1LA 1FA0A 1IBMF 1TFYA 4YR2A 4KR0B 2R7QA 2JOQA 4ECVA 2AJ4A 4A8OA 3RYLA 2MKSA 3NMRA 2CPJA 1CPZA 2IMWP 4KAIA 5IZHA 4OJHA 3IR6B 2UUBF 4HTJA 2LDIA 2Q43A 4DL4A 2M4MA 2KH9A 1WHVA 2NR0A 5CCMA 4CQ1A 1SUQB 2UVWA 4ZA1A 2V2KA 4QBUA 3MI7X 2M3DA 4KT0C 2U1AA 1U09A 3MTKA 1H38A 2WOMA 3MEGB 2ACYA 1U1OA 2UVVA 2OMLA 4NRUA 4E8UA 4OLPA 2K1RB 2JLEA 4FNHA 4EBCA 2R7TA 2K3KA 2DR7A 4WU3A 2YNHA 4C7QA 2YKMA 3BF4A 4BC7A 2PFFB 2OO4A 1JXEA 4ES1A 2ZH2A 3DOKB 4I4BA 2IFXA 1FVQA 3MR2A 3M2RB 3MECA 3T5LA 2H9ZA 4QOTA 3L7OA 2FUG9 2QT7A 3KLIA 3GFZA 2CQBA 2R7WA 1HBOA 3QPIA 3OR1A 1UA0A 4ID5B 2YKPA 3HHKA 3IG1B 1GXLA 1MROB 2WBMA 3K5MA 1HWJA 4RW7B 2JLGA 5KFHA 3K5PA 2V94A 3UCZP 3ZZYA 3DC2A 4EU0A 5MAOA 3VQTA 5A8WB 2AGOA 3CCMS 4C0HA 1P6TA 2ILZA 3A1YG 3OHBA 4ZP7A 5IM0A 4ICLA 1U26A 5K5MA 3UPFA 1S1VB 4D3HA 4KQZA 3POTA 2MYFA 3AA8A 3V6KA 1IJEB 1S1UA 2L9WA 4YR3A 4P7TA 3DLLQ 2VUGA 4BWMA 3UCUP 2HVIA 3TNVA 2GGPB 4QWCA 4DV1F 1UEVA 3CD5A 3CULA 1U6ZA 4DR6F 3V5RA 1IKXB 2IRUA 3CDEA 1S0MA 3SMZA 3PX6A 3GZ7A 1X4AA 4O4GB 1SJ1A 4PWDA 4ZHRA 3DOLA 4K4TA 2RRBA 4RW8A 1V3RA 2HFZA 1FNOA 1D3WA 2AV5A 4OHYA 1X4GA 3DRPA 2DGSA 1BQNB 3CCJS 1QM9A 3FDSA 4JV2A 1GTEA 5KT4A 1JJ4A 4F25A 3IS9A 1OS5A 2JFDA 2XY6A 1AROP 1FK9A 2DH7A 3TUZC 3FEYB 1T3OA 5C42B 4NCGA 5A8KA 1N48A 1WEZA 4IRKA 1RTJB 3RB3A 1J5OA 3MD1A 4ZCLA 1G7CB 1XMQF 3G6XA 3MUVP 1MWZA 1YBAA 3AJ1A 2BE2B 2VKZG 5KT3A 3M6UA 4ILLA 2FHJD 2PI4A 5GAEI 1Q53A 1R27B 3L3CA 4WKYA 4F02A 4RUAA 1ELOA 5DG7A 1SBRA 4J9RA 4MFBA 2C3OA 2E7WA 5LSLA 2C2RA 2W8LA 4X4VA 4QYZJ 3VAGA 2ABYA 1FF2A 1FEHA 4F3QA 4JI1F 1XC9A 3K8VA 2DNMA 4GO5X 2XLJA 4IRDA 5J1PA 1V3ZA 4B9UA 1WTBA 5HMZA 4QIVA 5KFOA 1JX4A 4A8MP 2WCXA 2ZOMA 4DEZA 4HYKA 1TK8A 4JBCA 2E5GA 3MZIA 1FD8A 3CJ0A 3CCTA 5LSRA 1BC6A 1S6OA 1L3KA 5KG7A 1HARA 3EGWB 1TKTB 1Q8IA 3MUTP 2A2CA 2XZWA 2XY7A 1KOHA 3CIMA 3R1HA 2V8HA 3KHHA 4KE5A 2RIJA 1VQLS 2YVSA 4KFBA 1AFJA 1KLMA 2OD4A 3K0JA 2IA0A 4NZ7A 4DL7A 3NAHA 3PO5A 1TL5A 1HMVB 4GKJF 1H7XA 1D9AA 4MMOA 1U45A 2QRRA 4PPDA 1YRTA 2KJVA 5B0EA 1EETA 4H4KA 5F8LA 2OD6A 4N77A 3KLFA 4WCEQ 3D0GE 4I1TA 5L1KA 1LWEB 5EDWA 2VPXB 5HN0A 3G6VA 2FVQA 2VPYB 4X62F 4TQRA 2XS7A 1U1MA 4HTIA 2C22A 4IG0B 1K0VA 1QAYA 2KFYA 5GVQA 2CRLA 1NEEA 2E1RA 2LVWA 1SI9A 4RNHA 2ZM6F 4KC5A 3TO8A 1Q82T 3QLHB 5H1SV 4QCLA 2WSFC 2MDAA 1UAWA 5IT0A 2ZH7A 2VG5B 2DIVA 2MB0B 3RBEA 2QO3A 1MMLA 4OHZA 2XGPA 4URSA 3KLGB 5GAHI 1UETA 1DLOA 1HI1A 2IVYA 3RR7A 4DN9A 2E1MC 4BBYA 2EVZA 3N5BA 2E7XA 3KHRA 3V6DA 4DLGA 2EW9A 4KV8B 1S1XA 1KTVA 1S6QB 1Y3KA 2W7AA 5J2NB 4ECTA 4NCBA 3EGZA 1RT2B 5E3RA 3OFGA 1FE4A 4C0OC 4IRCA 4A8SA 3P96A 3HPOA 4O4RA 2YNIB 4E98A 1IKWA 4ATNA 4DSIA 5B0BA 2D1CA 4ED0A 3OV7A 4N5SA 4R5PB 2RQCA 2DNKA 2EFQA 2VFTA 2ZITA 3UQSA 5K8PA 3PW2A 2ADBA 1TK0A 5M2UA 1Y7PA 2UVUA 2MKJA 3J81Y 4LSNA 1EP4A 2M9KA 5J2QB 3PRBA 2ZE2B 2EC0A 5K8OA 1CVJA 4EZ9A 1N6QB 3QGGA 3NCQA 4HI2A 2FJVA 2G1DA 5G4DA 2ZHOA 3BREA 4J9QA 2V8DA 3LP1B 5JVHQ 2BV3A 2GO9A 3MURP 3NBPA 5F8IA 3LP2B 4N8NA 4DQRA 3EYZA 5KG3A 3S01A 3PV8A 1N5TA 1HNIA 2YKNA 1N8RT 1DQAA 3TA1A 2XSFA 4MH8A 1L3TA 1TFWA 4TYBA 4WFXA 1RP5A 2BOPA 3NS5A 4YB1P 3GQCA 3N6MA 4IO1A 4A8KA 4TY9A 1OPZA 2KT3A 5HLFB 3UI3A 3GE9A 1U1RA 5L9XA 1S0NA 2FPHX 3IR7B 3LAMA 5EHHA 4IG3A 4ETXA