4ES3A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
84
Chain Sequence
HMMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLNYKVEHIGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0342 protein
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 21
structure length 84
sequence length 88
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es3A00
4M1KA 1ELOA 1P9QC 4TNOA 4MYTA 4ES3A 2ZITA 3OQ2A 1N0VC 1ZM4A 3LH2S 1U2RA 2J7KA 4MYUA 4ES1A 4ZCKA 3ZZTA 2CVEA 1ZM9A 3B78A 4QR0A 3ZZ0A 1ZM2A 3EXCX 4FN5A 1FNMA 1N0UA 2EFGA 3E3XA 2BM0A 1ZM3A 1DARA 4ZCMA 3B82A 4ES2A 1T95A 1ZPWX 4MAKA 2XEXA 2E1RA 3ZZUA 4QR2A 2I0XA 3B8HA 4ZCLA 2BM1A 3UI3A 1VI7A 2I8EA 2IVYA 2KDOA 2BV3A 5G4DA 1KTVA 2NPFA 4QR1A 2WBMA 4ZCIA 2L9NA
chains in the Genus database with same CATH superfamily
4PXDA 2V9KA 3ISZA 3GMGA 3CCRS 1S0OA 1IBLF 1REVB 2ZH7A 5F9NA 4DPTA 5DQIA 4WFZA 2CPFA 2KL8A 1FKOB 2XNRA 1LW2A 2BOPA 2PEBA 1WKJA 4LF6J 1NK5A 5BYRA 1XTZA 3OFGA 2JDJA 3FC9A 1X5SA 1RXOB 3HSZA 3PZPA 3GPAA 2ADCA 5KFQA 1S79A 4MT1A 5KT7A 2BW7A 2V4QA 2LECA 1U48A 4ZS6A 1CJVA 1SBRA 5F8MA 1TK8A 1RISA 4CQ1A 1F2GA 4NRTA 3LW5C 1S7HA 1NSQA 1L5UA 5DLGA 1Z2ZA 2ERRA 4NLWA 2NXJA 4A8XA 3UD3P 1U1PA 2ASJA 4GMKA 4B3SF 1CPZA 3JSMA 1Y3KA 2PGCA 3SFUA 4YR2A 2MY8A 1CEZA 1Q81T 2HFNA 4DQRA 3ZTQA 2QGFB 4JI8F 1HI0P 2MMYA 2QMXA 4HDGA 2AD9A 2F5GA 2BEFA 2PDAA 3DOLB 3TZXA 3QSYB 5HMWA 5A8WB 3KMSA 3BH7B 3BGLA 1YZ6A 1RWPB 2WW8A 2AYMA 4EGLA 1MU2B 4J9PA 1JB0C 4CNZA 2XTJP 3GILA 4ZVHA 2DH8A 3L95X 1VQ6S 4EK2A 1FJ7A 3RRHA 2RDJA 5M2RA 2ZD1A 4NLXA 1N56A 4E0DA 2R4FA 4DLEA 5LOQA 3JTOA 3E01B 4DG1B 1NDKA 4TQRA 4DV0F 2QYCA 3P96A 4B9SA 3JB9k 5RUBA 2HZVA 1N8RT 1RT5A 1L3UA 1KQKA 2E29A 1T03B 2IVFB 4A8SA 2W4DA 3PJWA 1V3SA 4KFBA 1O8BA 1RKIA 2X51A 1CJKB 3R2CJ 2CQ3A 2VG7B 3G4SS 4PYAA 2Y1JA 4U7UD 3D68A 3UFCX 8RUCA 2MDAA 1PJ6A 3D3BJ 4C8ZA 1WJ9A 2J6UA 2CJAA 3C15B 3FZ2A 3LUYA 2KI2A 4ZVQB 3OUYB 1KVJA 2OJ3A 3MECB 3KMQA 4TN2A 4WYLA 3AXKA 1SJRA 2GQ2A 2MKCA 3AXMA 1J5OB 4O0IA 2C2MB 4ZLPA 1IKYB 3TI0A 4P73A 5HK4A 3GSIA 4WFAQ 3HJFA 1FA0A 4PG4A 1KN6A 5JXSA 1SKUB 4LF6F 4ZCKA 4UOCA 2DKOB 1JIHA 4DSIA 3H40A 2HZCA 1NSAA 2ZBCA 3BQ2A 2OO4A 3FMBA 1U6ZA 3C6UA 1PYTA 2GGPA 1Q8BA 3CEDA 2GMJA 3K7RA 2VONA 3FKBA 3BO4A 1SIZA 3NEKA 3FFIB 3PW0A 3IAS9 4LFAJ 4O23A 3HHKA 2F3JA 4NZ7A 1SQGA 2V2VA 1OSDA 3V4IB 4KT0C 5K14B 2B9YA 5B0GA 5CCMA 3SCKE 3H59A 4LF2A 3S01A 4QWCA 2P9CA 2VASA 1EP4B 5DM6Q 1SL2A 2ACMA 2B4PA 2DYAA 2KM8B 2Y3YA 1CJTA 3T6JA 4MFBB 1NHKL 1AYEA 2F1FA 2AF6A 2XGPA 1MLAA 3H4DA 2F40A 4EYIB 1TMMA 3JS9A 3OR1A 5L1IA 1DTTA 5U47A 2KHCA 1VBZA 4IG0B 5L38A 3LPEA 4I7FB 4ZJQA 4LVNP 2KYXA 3FCHA 4IUFA 2XSFA 3DRSB 4CYUA 4M8LA 4LQ3A 1TKTB 1APSA 1RAEB 1Q1KA 2BUNA 2HFZA 3A8IA 1AFIA 3R1HA 2J0XA 2HLUA 3W5YA 3MTJA 1R3NA 4UT4A 2Z2LA 3RAXA 5A76A 4ED8A 3QT8A 3VVUA 4USMA 3FSXA 4C8KA 2VG6A 1RYRA 4USUA 3KLGA 4DXLA 3PCOB 1U02A 5KFOA 2SXLA 1X60A 2QIFA 2L9NA 1WTBA 1VRTA 1KOOA 1Q78A 1NRKA 1XIQA 2YWKA 4YUDA 1KQFB 1UJ6A 4NYZA 4XPCA 3PYEA 5HQ8A 2WB4A 2YNIB 4OIXA 3D0IE 1XBWA 3TNVA 2OPRA 1S1XB 4C11A 1ZA2B 4OFZA 3HHLA 1CC8A 4A48A 4TLRA 2ZWPA 2V8GA 1N36J 1NHVA 4WCEQ 4MIWA 4B9NA 3IMQJ 2R3VA 2J6TA 3I9ZA 4U95A 3MEDA 3MR6A 2XULA 4K59A 3DRRA 3R5DA 1NB2A 5D4OA 3I0SB 2JLEA 1S77D 1JLBB 1LWEB 5B08A 2A2DA 5KFUA 1HHSA 2C22A 4LFAF 3HCXA 3S6EA 1B4SA 2B8PA 2XMUA 2N7YA 4LVOP 2V50A 2PFFB 2YNFA 2GC8A 2HPUA 4ZPTR 3TUZC 1S9GB 3UDEA 4KYZA 2R2SA 4IQMA 3IBCB 5KFVA 2EG1A 3VWSA 1NK4A 1SKSA 2F65A 3C2PA 2HQGA 4LF1A 2DNGA 4ZVGA 2BJ3A 1UPMB 2FJAB 2JEJA 1GXUA 4KAIA 1HBNA 4PWDA 4DPWA 4PPDA 3GYNA 2YKNA 1VK8A 4RZRA 4DR5J 4QR1A 2AJFE 1WHXA 4DN0A 1F3FA 3ZZYA 3RAQA 1HNIA 5KFSA 1BQMB 4OX9J 3ITHB 3IA0A 3I31A 1RTJA 2Y1LB 3CGIA 1W25A 1S9EB 1WUUA 2NSBA 4TXSA 3C6TA 5KOXA 3MEEB 2DGUA 4DSJA 2CQIA 3Q8UA 1N54B 5K20B 3UD5A 3BSCA 2QTWA 3JQKA 3J81j 3M8PB 3A8KA 2K7JA 4QWEA 4OYXA 1FESA 4K4TA 3EJMA 3N9UC 1YJTA 2H51B 1R8BA 2VFUA 2BRLA 3CJKA 2EKYA 1FX4A 2VH7A 1TMJA 1ZM2A 2RHSB 4QIVA 2OH2A 2R7UA 4Y2AA 1S97A 2ACYA 5CH7B 4A4JA 3W62A 1N36F 3DI6A 1JMTA 4U67Q 1RTDB 3W9IA 4NLTA 2DR8A 4I64A 3CPWR 3ZZ0A 2HRUA 2HURA 4ED0A 1VQSA 2VD3A 3X1LB 3W2WB 2OKQA 3W65A 3ZTPA 1DAXA 2E1PA 2LXFA 4MJKA 3GQCA 2W24A 9ATCB 2VUGA 1UW4A 2ROPA 1OSCA 1PBUA 1WKKA 1YJVA 2HK3A 3RB6A 2FLPA 3DC2A 4ANCA 4W98A 4Y28C 2ZE2B 2NQPA 3ILOA 4EMDA 2O01C 1QAJA 4KO0B 2CNKB 3D54A 3RBDA 4ZVRB 1RT1A 3V6JA 5FLXY 2YH1A 5EN1A 1HD1A 4WU2A 5D4LA 2O66A 2XYPB 1FXDA 5DDQC 3EPGA 2VFSA 4Q8EA 3M9OB 1NH7A 4ECYA 1RAOA 3HO1A 1BXNA 4DR5F 5LXYA 3H8YA 5IS2A 2GVZB 2LYVA 2YKPA 4FYXB 3WX8A 1EHWA 3L09A 3SCIE 4DR4J 5J1EA 3U7JA 1RWMB 2VBZA 4EUVA 3M9NB 1VI7A 2FVSA 1S12A 1VR6A 2R8IA 4H4MB 4OX9F 2W01A 2GV1A 3UW1A 4RWXA 4ZPDA 4YDXA 2HVZA 1YKWA 2E5LJ 2MLYA 1KLMB 4YEAA 2CRLA 2CIMA 1LEOA 5A0YB 4IQXA 3CD7A 2E1MC 2DNHA 3PO5A 3DLHA 2O3DA 1RHJB 1YJRA 1RA7A 4UZCA 5J1PA 5ETOA 2KXHA 3ENVA 5E3AA 1KOHA 3D67A 4Q2MA 4FYVB 3TJAA 2R42A 3LP0A 1JXVA 4CLWA 2R8JA 5H1SV 3L4BC 1WF0A 1WELA 3CCMS 1Q8IA 4WTYA 2VB6A 5ETLA 3CJ3A 1KFDA 3J7AN 3LALA 2GCFA 1H7XA 3D6MB 4URQU 3I6PA 3TOQA 1SC3B 1TUVA 4PR6A 2MQOA 3THVA 1FRKA 2GNKA 3UVJA 3H90A 2OSRA 2O5DA 3U1MA 1Y7PA 4HH1A 1VQLS 3OVAA 3OT9A 3T3FA 3WX4A 2HMIA 4LFBJ 4G1QA 4EU0A 1FERA 3AHPA 2ZZMA 1TUGB 4CLKA 2OI2A 1TTHB 1GNKA 1IR2A 3TA1A 2DRBA 2J7WA 1WEXA 2RU9A 2HGLA 2C2RA 1T9YA 2HBZB 5F3TA 4NZ6A 4PYDA 1X4BA 4GVBA 3IC1A 1NJWA 2AJ2A 3FDSA 1R27B 2RU3A 2RJZA 3M2UA 4ER8A 2JFDA 3OJSA 5GAHI 2ZDPA 2VA3A 2AV5A 4RNFA 4K4VA 5JVGQ 2KJWA 3BREA 3HHLD 2MY7A 5T7LB 3BV8A 1FJGJ 1RT7A 1GX6A 5LT5A 8AT1B 4PZVA 4JI2J 3WQPA 5IT9U 2B6AB 5KT5A 4DR4F 2JLFA 3MCSA 1UP1A 4ES1A 4O4GA 3JYTB 2W9BB 2XS5A 2AZ3A 2XSJA 2HNZA 2MKJA 2FLLA 4BC9A 3HFKA 6FD1A 3OHAA 2XEXA 4Y2KA 4IFVB 2VKRA 2CPIA 2YVSA 2P6TA 2WBRA 2E5LF 4F7VA 3K0JA 1FFGB 4OI0A 2CYYA 3HVWA 2V2QA 1I6JA 5MLCV 1JLGA 3K8VA 1TL7A 2RMLA 4Y65A 3QAUA 3PYGA 1W2IA 4KHMA 2XI2A 2HHSA 2FDNA 4B3MJ 2UUAJ 4X2BA 1NZ8A 3DDIA 2CWKA 3H7HB 1VQ4S 1U6FA 2QLJB 3DLEB 3OR2B 2DB1A 3DYAA 4OHXA 1D9DA 3GFXA 1IKXA 2VODA 2WVBA 2XI3A 2HHUA 2DY9A 2GAGC 3PYDA 5ETMA 1ZM3A 1SQFA 3MAAB 2XZWA 4F4AA 1F5AA 2DR9A 4WFBQ 4I69A 1NU4A 1RK8A 3A12A 4KE5A 1QTMA 4F4KA 1CC7A 1K8AT 3DU6A 2RD5C 4OYOA 1CJUB 3KLFB 3BGUA 1UWAA 2EI5A 4LFBF 3H5XA 3ZNJ1 1G2EA 3M9MB 4Y2CA 2E1CA 3BGFA 4LSZB 1F6TA 2XWYA 4Y2IA 1ICEB 4EZ6A 1WDDA 2V63A 2DIUA 3EPIA 3KJQB 1TP7A 3CDEA 2IJRA 5F8HA 1RTHA 3QT5A 3CW2C 1SIWB 5HL7Q 3NY0A 4GO5X 1YHQS 1F2HA 1NK8A 3AY0A 1Y5LB 3QIPB 1SI9A 4OI2A 3VAGA 1HKAA 5ETTA 1CSJA 2FVPA 1DBDA 1EQ0A 1FJGF 2FD2A 1CS4A 3GIIA 2J9EA 1OQ6A 2HS3A 4J5OA 5I3QA 4RBTA 3UNGC 5KG1A 3GJTB 2QA4S 5KFHA 4JI2F 3H2VE 2D69A 4S0MA 3JTNA 4H4KA 2AEJA 3TVZA 1K0TA 4JP8A 3MM9B 3MWBA 1OY6A 2DXEA 3RUBL 1XWLA 5ADZA 4DX7A 4ZPAA 3HHLC 3SYZA 2LU1A 1X9WA 3CO9A 4Q7AA 3CD5A 4QBUA 1VRUA 1CJVB 4HHJA 4U8VA 2NYIA 4XK8C 2DD8S 4ZVTB 2JC1A 3UDCA 2HVHA 2I1RA 2BACA 2ZUGA 5J2NB 5KG5A 1NK7A 2P9EA 1F1BB 2HFOA 2A10A 2UUAF 4NEYA 5KFYA 2D74B 2FZCB 3GWCA 3Q8RB 2EK6A 3N6MA 2WVCA 1SL0A 3KTQA 2KTQA 1IJFB 1XMQJ 4QYZK 2FZGB 3RW7A 4YB7A 3CVKA 1SH0A 4ANDA 4FS1A 3Q23A 4WF9Q 2GJ2A 1H74A 1FI4A 1RAGB 3RR7A 2ZH6A 2Y8WA 2K8GA 3KLIB 4NCGB 3UDLA 5HROA 1VGYA 3D1QA 3TJ8A 2V0NA 4OYWA 2B3TB 2HFVA 2MXYA 2LA4A 3QLHB 5D4PA 5I3PA 2CDQA 4DR6J 2CJXB 4N77A 1NKEA 3I4HX 3V2UC 1FT8A 2R2RA 2E1RA 1U6BA 4DFKA 5EUHA 3UPFA 4DZDA 1C0TA 3P3DA 4N8OA 1GH8A 4ZDNA 2Z30B 2OMLA 1HBUA 3I32A 5A2QY 1E6VA 3OFEA 3O3LA 3TVKA 2AW0A 2R8GA 5D4NA 1QTNB 3HT0A 4OZLA 5HBMB 1VRQC 4JI6J 1IWAA 2QA1A 4DL0C 5LSOA 2QLFB 2IYIA 2C3MA 3O5TB 1R0AA 4DLGA 2J0WA 4ZLJA 2CNLB 2M2BA 1JKHB 4DL4A 4KJIA 2GA7A 4NEZA 4CTAA 2QA2A 5K8MA 1K44A 2HYIB 2Y0BB 3BDEA 2UUWA 3ISND 4OYIA 1DFDA 2LQBA 4C0BA 3C6UB 2GGPB 2WONB 4L72B 4OZJA 1WWHA 3LQVA 2I8EA 2VBWA 3HI9A 2R8KA 2M52A 1LQ9A 3MFIA 5AJ3J 4PQUB 4LSLA 2VL1A 3DMJA 4IRCA 3R3TA 3TX8A 1R6VA 3ZZOA 3TX0A 5IT0A 2CZVC 2C1EB 1H2VZ 1FO1A 3MEGB 4P2SA 3GE9A 1UW9A 1YGYA 1HWJA 4MH8A 2DR6A 4RUAA 2ZEJA 4KGMA 4FXWA 3ET6A 3GJSB 3E3XA 1WC0A 2UUBJ 3R1LA 3ZZUA 3JQJA 5C25A 1HR0J 3VGVA 3HPOA 1FDAA 4NI2B 3V5RA 4DN9A 2CQDA 5CAAA 2VDHA 1CULB 2IPOB 2RRAA 1XK8A 1JX4A 3H0PA 4X4QA 3CJ0A 4ANEA 4OMFG 1UZDA 3MR5A 4P10A 3CNQP 3MM7A 4R25A 4BHQA 1XMQF 2VFVA 2B5JA 1HYSA 3UDVA 3SV3A 1TV6A 4ED4A 2N4CA 4KHRA 1WHYA 1KEKA 3MMBA 4M5GA 3R7NB 5D8HB 4N47A 3OTEA 1TVRB 2BJ1A 5HLFA 2IVMA 5KFCA 3TEGA 3OBIA 3K58A 4QPXA 4PUOA 2MKSA 4HYKA 1JWWA 1D9AA 2IM3A 1BD6A 1EX8A 4ZA1A 2XLIA 2BQ3A 4F4XA 4DR6F 2GIFA 3IR7B 3GJRB 2IVYA 3VAFA 3C16A 5F8JA 2EVZA 1RT2A 1FFSB 3M32B 2DO4A 1S1UB 3BYPA 2W7PA 1OY8A 3UR0A 5IZHA 4LSNA 3PIOQ 2UU9J 1AUSL 1NJZA 2Z58B 4I6WA 2C2OB 1G4CA 5IV4A 3PHTA 2FJBB 4OJ1A 4JI6F 3G8SA 1S0VA 5DJBA 4B3TJ 3MPWA 4OZ1A 2OPRB 1PJ5A 4WZMA 2RDDA 4C11B 2UUCJ 2H5JB 2ZWOA 1SJ1A 4DWIA 2DRDA 3HHLB 3G6YA 4EYHB 4HH0A 4B9MA 5L39A 2XYGB 4P2FA 1BY9A 3MEDB 2M3DA 1SJQA 2R7OA 1GMUA 4LFCJ 4J37A 3DRRB 4HHHA 1YJ9S 4DV5J 4TU8A 3DRPA 1NPPA 5AJ3F 1RT6B 1DARA 3VF0B 1VHFA 4X66J 1YI2S 2CNNB 2HRTA 3BSAA 4WP8A 6FDRA 1WHVA 4QIFA 3B78A 3MAQA 4LJMA 3ISNC 1S7IA 4RNOA 2XMKA 2B7CB 4H4OA 1D9FA 3PR4A 3HDSA 2UUBF 1TU0B 3GR1A 1HR0F 1YWXA 3IN5A 1LWFA 5B0AA 1V3RA 3VALA 2XMJA 3PR5B 1K0VA 4ZP7A 1S1VA 2AT1B 3GIMA 1EQMA 2YKNB 3BH6B 3I55S 3KK3B 1RHKB 1CQMA 5JJBA 2E5IA 3JAMU 3CJ2A 3TANA 4G1PA 4ECUA 1SB6A 3TO8A 3U1LA 2A6MA 2FQQB 1S1TA 1HNIB 2X3GA 5K5MA 2DHAA 2F4FA 5DRKA 3D3CJ 2GAHC 1RTJB 3SBMA 4A8KA 2MQPA 1WSRA 2VPXB 4U96A 4HEA9 3C6TB 3LP1A 3CJ4A 1T9XA 3EVOA 4K8RA 4N41A 4K5RA 2YWEA 1MMLA 3DCAA 3VTIA 3OV7A 1OMSA 5CZVA 3HD1A 2M5YA 2UU9F 1AB8A 5C2GA 4LBPA 1LKZA 2HHVA 2AYEA 1MN9A 2FIUA 1LK5A 3M8QA 1MWQA 2IDEA 1KRPA 4B3TF 1HMVA 2UUCF 4OZNA 1YDLA 2B4OA 2VG5B 3HVAA 2ALYB 3DI6B 3DRYA 2XMMA 5IV3A 5DDOC 3MMCA 2I9SA 4LFCF 1PC4A 3CC2S 4DV5F 4C98A 4B3RJ 2DNPA 1UVMA 1CLFA 2LKZA 4OZ3A 2L9DA 5B0EA 2AJQA 4X66F 1RAJA 3CIZA 4AE5A 3BGOP 1X0PA 2LQJA 1PIEA 3B8HA 4D3HA 5K8OA 2OHDA 4NA3A 1RT3A 4J9VA 1HWKA 4FYDA 5F9LA 5FIIA 1OIAA 2YWWA 2MEWA 3NXZA 4RW7A 4OYPA 4ICLA 3AB2B 3EMTA 3IBFB 4TVAB 3LANA 3OXFA 2Y8YA 2Z0GA 1WG5A 3NNAA 2Z2YB 2DNRA 3D0GE 4RLEA 4F4YA 3J7A1 1RHQB 4HI2A 3D5MA 2G0IA 2B9XA 2QN6B 3K5OA 2CPDA 1U24A 3TARA 3CJRA 1BLUA 1U1OA 2P9GA 3M4XA 2BA9A 4C3LA 4ED5A 1T9WA 1KFSA 4JOUA 3OXLA 1UVJA 2VQFJ 1ZM9A 2G13A 1DURA 2ZZTA 1WI8A 2EFGA 1F60B 2G2OA 3V81A 3IM9A 5F8GA 3QZ8A 3O2IA 5J2QA 2HBQB 4KB7A 4E2FB 4H4KC 3MUVP 2F8HA 1EETB 2I5JA 1WG1A 1Q53A 1RYSA 4IOBA 4A8YA 2MSTA 4BCAA 3DKDA 4TY8A 3AD7C 5BR8J 4MKYA 2W7AA 4L74A 4P2MA 1I3OB 4ZKAA 2QYGA 2GQCA 3DNCA 2ZJQQ 3NG8A 4O44A 3MZIA 1N32J 2ASLA 1M5SA 1HQEA 1NKCA 2V6AA 1SPBP 2OPSA 3MEKA 4YB6A 4YMEA 4IOCQ 2P2CB 4CH7A 1FHTA 4XTTA 3ENQA 4KTQA 1WG4A 2JEIA 5KTQA 2Q1LA 2FVCA 3R8YA 3T9NA 4UZBA 2O67A 4X65J 1HHTP 3TW0A 1Q4RA 2KG1A 2N3LA 1S6UA 2WHOA 5KFJA 3SCLE 2BANA 3B4MA 1NM2A 4TQSA 1U4BA 1SKWA 4WFNQ 1XR5A 2E44A 4B3RF 2HMIB 2GMLA 4DDFA 3FJ2A 4AT1B 1QDUB 4N5SA 3OLAA 2XY7A 4BWJA 4DPOA 2LQ9A 2CPZA 1JLAA 2VOOA 2B4UA 2IYGA 3TR5A 1OJ4A 4CLPA 1JLFA 3BSNA 3EICA 2H48B 4XIUA 2IHR1 1DTQA 1N4LA 3NMAA 4I4BA 3T41A 1VLYA 1U25A 5DGAA 1IQTA 1M5HA 4JI7J 3G6ES 3E8OA 3MPYA 1NBEB 2BQUA 4M94A 2WK4A 5AE2A 5KT4A 1H73A 3RB0A 3H98A 4NL5A 1RT7B 3DN9A 1TL3A 1SVDA 3Q8SB 1P9QC 1D09B 2DH7A 4DR2J 5C2CA 3R9LA 5K8NA 2KVIA 3DM2B 3K89A 2VQFF 1JXEA 1R43A 2A0FB 3TYTA 4U7UK 3PTWA 2HNZB 4F67A 1H98A 2DGQA 4EBDA 1RTZA 4QWBA 3K59A 1FF2A 1S99A 2J8SA 2E5JA 4GKJJ 4E8UA 1FD8A 2F8MA 2MQQA 2ROEA 2U2FA 3BF4A 4ERDA 3I96A 1JLGB 1S72S 3RW6A 5J2PA 4X4VA 3SSSA 5BR8F 2W2MP 2LDIA 2GVDA 3DLKA 2V8PA 2G0JA 2H3EB 2ZOMA 1N32F 3VAMA 3OXGA 4CNYA 2FGCA 3A4TA 3DYAB 4DFJA 1IKXB 1VC5A 3UI3A 1SL1A 2RS8A 1X5TA 2IC3A 4X4UA 4U6PA 5D0RA 4X4NA 1FDBA 4C0OC 2QMWA 3LP2B 3W2VA 3BR9A 4X65F 1FVQA 4ZITA 2DGWA 4FKXA 3DGPA 1VQPS 1RWOB 3KWMA 2CFXA 2PFDA 4YDDB 4F4WA 4EWTA 2QMUB 2FYXA 4LBHA 1S6QA 3LOUA 4XAKA 1R8HA 3GTYX 1GTEA 4M95A 3W1YC 4N8NA 4AUKA 2C3OA 2VBYA 4DL3A 2RF2A 3VQTA 3QFWA 4USHA 2O1PA 4QW9A 3PACA 5B09A 2NXNA 3VAIA 1RTHB 2JVRA 3KJFB 1VBXA 3BYRA 1VBYA 2YPYA 3LAMA 2B9WA 1VQKS 3AQPA 2BJDA 4JBCA 3NWGA 2RH3A 4JI7F 3QO9A 2KRRA 3FCVA 4J91A 1VJQA 3W8PA 1U8SA 1KNZA 4M5MA 1QD1A 1YRUA 3PNIA 2GO9A 3NCRA 4BBYA 1BE4A 1DZ5A 1CS4B 3GIJA 4DR2F 2NUUG 3NS5A 5KG0A 4QJVA 2OPPB 4USVA 5L1JA 4OLPA 1QAYA 3WZ0A 4U8YA 2EEYA 4NLSA 2ZH4A 3TAQA 3MR3A 3MOZA 3F0NA 3UWTA 2ALZA 4ZVSB 4WJBA 3N0VA 4G6VB 1KTVA 1X5OA 1PC5A 1FEHA 2CQGA 3W3SA 1YVFA 4JV0A 4ES3A 2R8HA 4GKJF 1VRUB 4BDPA 3BN7A 1OYEA 4OYBA 5L9XA 4DU8A 2YH0A 2PMHA 4ZPVR 1JQGA 5M2UA 3GYGA 1J27A 5DO2A 4FBUA 3NGRA 1IWGA 3MPVA 5FD1A 4AXJA 1G1XA 2RVJA 2HHPA 2GJIA 3NAIA 2BE9B 2AEMA 5BYQA 1S1WB 2ZITA 2C2KB 2BOAA 2BMBA 2CQBA 2ZVIA 3HKWA 1UVKA 4ZCLA 1CVJA 3KUHA 3LO3A 3WIUA 4CO3A 3M6XA 3RAMA 2AWZA 2HS0A 3KJVA 3IR5B 4IYQA 1RGVA 3EGNA 1V5VA 4CM0A 4PABA 1A9NB 3LWLA 2M0GB 3W7BA 2W8LA 2EFOA 3OVSA 2BE7D 4Y2MA 2KDOA 1J5EJ 4J9UE 4IRKA 5HROB 2KO1A 1S10A 1U2RA 2MGZA 2B4VA 2FJDB 3HVTA 2E9RX 1FXLA 4C6AA 4ZLNA 1Y3JA 1UJ5A 1S6PA 3RRKA 3TWZA 4LF7J 2RHQB 2NYHA 1M5PC 3G8TA 3LF0A 1H0HB 4LR8A 1Z1ZA 3MPDA 4J9MA 4YS2A 2COLA 5HSPA 3DRXA 3D7SB 1RLCL 5CA5A 1E6VB 2FJEB 5IOLA 5FLXU 1R8PA 3QT7A 2WZ1A 2FHMA 5EWFA 4U7CA 1RWXB 1VJWA 5LSLA 1R0AB 1U1NA 1ELOA 5KFEA 2UXDJ 2C3YA 2Y9HA 4DQIA 2CJKA 4KPYA 4CTAB 3CMQA 2RILA 4DF4A 3J7Z5 3NGKA 1FKOA 1KVIA 1TKZA 5A8RB 5HATA 2NXEA 2FLNA 1UKUA 1OPIA 4DV4J 1IR0A 2VC1A 4X62J 4YB1P 1WC3A 1T8EA 4ZJOA 4HDHA 1JJ4A 2XCAA 4ILMA 3DMJB 4ZN3A 2EFQA 4CO5A 1M5OC 1FDDA 2PI5A 3P5BP 2KKHA 1ZYQA 2RQ4A 5DZ6A 1RAHB 3EDQB 1RWVB 4IRDA 2UV8G 2Z57B 2ZHBA 2HIYA 3BO2A 2KFNA 2K3IA 3X3UA 3G2XA 3ET6B 1N48A 4ELUA 4KV8A 3IP0A 1X7VA 1Q16B 2VKZG 1H6KX 3ENAA 1PKUA 4IR1A 5ETVA 3SI8A 1M1GA 4I2QB 3M6UA 4YR0A 1FFWB 3FK4A 4FF1A 3N28A 5HI7A 2R7XA 3MM7B 4QR0A 2B5JB 3QJJA 2QLWA 3DOLA 4EBCA 1HYSB 5A8WA 3MM6B 1TV6B 2CWXA 1UZHA 2Q3PA 3QMQA 2FGOA 3OFHA 4LUBA 3IO1A 3WBZA 2FLOA 4Q44A 5IFMA 1NJYA 5HLFB 2WW4A 1J5EF 4YR3A 3RBEA 2K1RB 4L73A 3QT6A 1W7WA 1YITS 4CLSA 2GIQA 3TP2A 2HHQA 2NR0A 5KFPA 2AGQA 2W4PA 4RW4A 4XO0A 2V2KA 3PM9A 4Z2XA 1TKXA 5B7WA 1U47A 3EXYA 3E01A 4P72A 4LF7F 3GIRA 2YQ3A 4OI1A 4ZP6A 3QSIA 1W26A 2IAJA 5DQHA 3KYLA 1F9EB 1RT2B 4NLGA 1T03A 4V1Ak 3KK2B 4Q0BA 3HHNB 4QU6A 3IFEA 3EGVA 2HGMA 1YSJA 4LSNB 5EX3A 1TK5A 3HLUA 1L3KA 2CAJA 1C1CB 3G96A 3PDNA 1RZMA 2AJ0A 2X1GA 4DPXA 3QAEA 1P8GA 4JV1A 1RWNB 2LP4A 5I3UB 2V68A 1GTHA 3NNHA 4JB8B 3C15A 3H2LA 2UXDF 3MECA 3VZHA 2C2ZB 4O0NA 3ZXWA 3R5GA 3O6QA 2CPXA 4KKOA 2ZH1A 1FKPB 1FRXA 2QX0A 3PW7A 1IKYA 3ZZPA 5KFFA 5D77A 4DV4F 4PXEA 3DDKA 4MKBA 4PKDB 4X62F 4ZN1A 3HSGA 4F0MA 3N5FA 3DRPB 4CO4A 4OJHA 5KT2A 3VAJA 2IMOA 2IFXA 2KFYA 2IA0A 2K7KA 1NB7A 5JUMA 3SMZA 1H7WA 1VFJA 3BDPA 2Q79A 4FYYB 3I5AA 4OX7A 1KBRA 3T1AA 1I1GA 2UVVA 2MKKA 3M1VB 3CD0A 2XBPA 4G3IA 4NE9C 2GHPA 2LQ8A 4CIOA 1HNXJ 4LR9A 2R2TA 4KY3A 3VGSA 2QL9B 3Q24A 1LOUA 1LWFB 2FY8A 3NCQA 2AX0A 3QGGA 1ITPA 3BQ1A 2Z8QA 3RRGA 1B3TA 4V19J 1S1VB 4MIBA 2DGXA 4NRUA 5AXNA 4AD6A 4K4ZA 5AT1B 4RNHA 3J7YI 2XHWA 3ULHA 3NCPA 1EAYC 3KHGA 2HAFA 2V8DA 1LW0B 4F0KA 2FC9A 3BBFA 4DUTA 1X4FA 2ZKTA 3CC7S 1S1TB 3OTDA 2Q6BA 4P75A 4Z37A 3QPIA 4CRJA 1QE1A 5I42A 1IKWA 2ZH8A 2CG4A 3GG1A 4IG0A 3MR7A 2EFPA 2JFKA 5F8LA 4NMXA 4DUYJ 1GX5A 3VVTA 3DRSA 3KJNB 3PRDA 2ZH3A 1WD6A 3AQOA 3EZUA 1LXNA 3LP1B 4B3OA 1S0MA 3KUGA 3ELHA 3CTRA 4F0HA 2VJVA 2VIHA 2UUTA 4UTGA 4LMZA 4K4SA 3MFHA 3FZBA 1TK0A 2XO7A 1Z4UA 4DI6A 5IM0A 4WKYA 3MXHP 2IIHA 3PFOA 4LF9J 4IFYA 3HT3A 1B0PA 2QZ8A 3BZQA 1YRXA 4K4WA 2BKOA 3M8QB 3OTBA 5F8NA 4P7TA 4LF8J 2KN4A 2X3DA 4QWDA 1RHUB 2OEKA 1F9FA 2F63A 1HMVB 2YXLA 3GLJA 1NHUA 1T7PA 4P71A 3R5CA 2IDLA 4CLLA 2DNNA 1TAUA 1K47A 1TL4A 2D1CA 3VAHA 2OMOA 4J9KA 5H9FJ 2V2ZA 2EFVA 2QFJA 3V6KA 2OSQA 3MMCB 5GAHU 3MCNA 4ENOA 3R5AA 2BX6A 1ZTTA 1YTYA 4FF3A 1VQNS 3CC4S 1IJEB 2ZBRA 3SQGA 2AX1A 3H5UA 3KOAA 2FHJD 1HW8A 4WK1A 3I0SA 2MZRA 4NZ0A 5DETA 3SEOA 2YWFA 3DGVA 1JLBA 1LWEA 1RT3B 3RTVA 4C3MA 1FD2A 2X7IA 3PRVA 3M2RA 3M30A 2AJ4A 1NSPA 4I68A 4RW7B 4ED7A 2V69A 4DJBA 2NZCA 3ZNUA 1N5QA 2RDIA 1HARA 1Q5VA 1HNXF 1L3SA 5FDLB 4EZ9A 3DLGA 2QE5A 1UJ4A 2FB0A 1NDCA 3TVYA 4OHVA 1S9GA 3FBCA 2IMWP 4OLOA 1O5JA 3EZ5A 5B0BA 1NH8A 3DXBA 2PA3A 3FRZA 2D9OA 1HQUA 4XDDA 4TLQA 4W90B 1Z2LA 3C14B 4R0EA 5HVHA 2IRUA 2ZVSA 4CO1A 1UVIA 3AAWB 2OEJA 2LVWA 4MK9A 3D6FB 1SJ3P 1RSCA 2VC0A 1RADB 5IXUA 1P6TA 4DUYF 4I6AA 5DG7A 3ZC4A 4BS2A 2WB1D 5C5JA 1BQMA 2V9WA 3T5JA 2W9CB 2J6SA 4UQTA 3ITHA 2RIJA 3EZOA 1H2TZ 3MEEA 1Q86T 4B9LA 4LF9F 4ZHRB 1RBLA 2DXFA 4O44B 2EC0A 2CPYA 5A2QU 2BQRA 2I0XA 4LF8F 3M8PA 3MMJA 2OPSB 5AE3A 1T94A 4YQWA 2E9TA 1NZAA 1WHWA 4DQSA 3BGRB 4Z7YA 1M5VC 3PKMA 1UFKA 3OD2A 1ROFA 4WTOB 3IR6B 4K4UA 3Q86A 1U8WA 2FHOB 4R8UB 4JI4J 3CJQA 1C0UB 1RP5A 1QM9A 2ATCB 2CQ4A 3MURP 4F3OA 1S49A 4DSFA 3POTA 4X84A 4DHVA 4F2RA 2QT7A 3GZ7A 1UEUA 5BXIA 1RTDA 4OZ2A 1S4EA 2BYCA 4NLDA 4O3PA 1U45A 5IQQA 1NEEA 4NX9A 2UV8A 3U27A 4RW9A 3SFGA 2ZH9A 3QGHA 1S48A 2HNDA 2DNKA 3AA9A 3CDUA 1JLAB 1B7YB 2U1AA 1JLFB 3QRQA 4HKQA 3J7ZT 4KBIA 1V5IB 3AT1B 2Q6CA 4IKAA 3W5ZA 4M5JA 3MCMA 4OHZA 1GMWA 1NXIA 1ZZNA 1RCOB 2L3MA 4R5PA 2ZE2A 3CDWA 1P27B 2NPFA 4J9NA 1X8DA 2GO8A 2BJ7A 3FMWA 5LL6d 1NK0A 2ZM6J 2D41A 4ZK7M 1YJWS 2HWIA 2AIRB 1T9UA 4I1TA 3KK1B 5DS7A 3PW2A 3DDNA 1YJ7A 2V94A 1M1HA 2HSEB 2YKOA 2C3PA 1SC4B 4X4TA 4HLBA 2BDPA 2YQ0A 3TUIC 3KNGA 1R6YA 2GVZA 3G9CA 1X0FA 4KRWA 4ECZA 3HP6A 4NPOA 3A1YG 1T11A 1ZBTA 3ILIA 2JVOA 1U0HA 3ZFVA 1O6XA 4LR7A 6AT1B 3RB3A 5J2PB 3MMAA 1MN7A 3DLKB 1Y4ZB 3C3LA 5A0YA 1G3OA 1RUSA 3T5KA 4DX5A 1KS2A 1D1UA 1VQOS 4OYAA 5E41A 7AT1B 1UFLA 5F0WA 3ZZZA 2MKIA 5CYMB 2DJWA 4O3NA 4CH0S 1D0EA 3I0RB 1JLCA 1HFEL 5A6WA 5G0RA 3W2VB 4F3MA 4JI4F 2LXIA 2BKPA 3ZTRA 4DR1J 4YP3A 3DGPB 3LGHA 4DR3J 3CCJS 3CJ8A 3UN5A 3R6GB 4IDKB 3F56A 4ZCIA 2OPQB 4YOEA 4OJ3A 2R2UA 2AGPA 1S6QB 2IY5B 5HP1B 3FEXB 3OL7A 1VIXA 2B8QA 3CCVS 3D6HB 3BB5A 1S59A 1N6QA 2ZBQA 2RF2B 3OL9A 5BYSA 1TZ0A 3RYLA 3I4PA 1PG5B 1WTFA 2OUGA 1NCLA 1LFWA 3T19A 3S8SA 4GVLA 2KVQE 1IBMJ 3H5SA 1LK7A 1AUDA 3M8WA 4PXCA 2CVIA 5E3PA 2LU2A 2RKIA 2KXFA 3J80Y 3QO9B 3W9HA 2ATLA 3LAKA 2N82B 1RTIA 1VC0A 1O51A 1KKHA 1XN9A 1VQ9S 2ZM6F 1WC1A 1V6HA 1F5BA 2CPEA 3M2VA 4I2PA 4AQYJ 2XC9A 4WFYA 3OTOJ 1RABB 2ILZA 3THTA 1FJEB 1YK9A 1F5CA 2BRKA 1HA1A 1N33J 2CXEA 2J5AA 3Q22A 5T7LA 5E2QA 1W2BR 3KXDA 2FVRA 2WBMA 2FPHX 3UNYA 4OZ5A 4RW8B 1VCTA 2GS8A 1MMNA 5KFXA 2M70A 4URGA 1N52B 1QAXA 3BJYA 1E6YA 2B6AA 2QEXS 4C9DA 3I87A 1Q82T 3JYTA 2P8IA 4JV5J 2J0SD 3QFHA 3U02A 1HD0A 1H72C 2C3UA 2E5GA 4C4WA 2W25A 3J81Y 2OD4A 4JI1J 3RBZA 3G82A 2EPIA 1LWCB 2XCPA 3UE2A 1TKDA 2RSQA 3M8ZA 5CYQA 2E7XA 5EWEA 2CG8A 4OHWA 1LXJA 2UVWA 3UQSA 2VBXA 2C2DA 4DV2J 3IWNC 4B9UA 2YKAA 1N34J 4F4ZA 4DOZA 2WAQD 3HK2A 1IQZA 5E5NA 4MAKA 2G2YA 3CCLS 3SDEB 4ZVFA 4C7QA 1Q8LA 2IBKA 2R7TA 1RB0A 2QG9B 2LCWA 3DLEA 3OR2A 2YWGA 2GHVC 1K1SA 1S57A 2LXUA 3KJVB 1XC9A 2MQNA 3GG0A 4PEOA 4DR1F 4P9SA 3M05A 1DJ0A 3HFZB 4DR3F 4RBUA 4OYZA 4YN3B 5F41A 5KFDA 3HX9A 1BGXT 4ES2A 1JJCB 4FNHA 2IJNA 3CCTA 3BKFA 2XQCA 2MGZB 1CJUA 1G7CB 3HHEA 1REGX 4X4SA 3MI7X 5C7PA 4NLOA 4AL6A 4DCOB 3IRXA 1HNVA 1TL1B 3BEGB 4EO8A 1XMBA 2VU5A 4NYPA 2HHHJ 4ZVEA 1K9MT 1HPZB 2HW3A 2HFSA 1VC6A 1IBMF 2DNOA 1LNQA 2J9CA 1FK9A 3M7VA 1RCXB 1N5TA 4FNIA 3R6LB 4QZVB 4YB5A 4C8YA 5MAOA 3BKUA 2V67A 3TQ1A 2AJ1A 2BZ2A 3EVMA 4TY9A 5G4DA 3ZZRA 3SQOP 2G1DA 4AQYF 2G1HA 3JTPA 1F3VA 4N56A 3QIPA 2HAIA 4ZMMA 3Q8QB 3OTOF 4P7VA 4ZIVA 1C1BB 1X4CA 3GYXB 5D15A 3G71S 1KQSR 1N33F 2QC3A 3HFVA 4ALZA 5HVGA 4H54A 2PSZA 2PD1A 2XMVA 4DX8H 5LMUJ 1NO8A 3NGTA 2VJUA 3CE8A 3OFFA 3PXGa 1TKZB 4DSLA 2NCKL 3A3OB 4HACA 1X9SA 3FCWA 3UCZP 1ZTWA 1NJIT 2F4VJ 2B51A 5ETSA 4F02A 1S76D 4J9OA 3CMAS 3MM9A 5D6GA 4JV5F 1GXLA 1YJNS 4TU7A 1P1LA 2MHEA 1ZPWX 4JI1F 3QATA 3FBBA 3MTKA 3LPYA 1WF1A 1Q8KA 1GMWD 1QY7A 4RU2A 4DV2F 5D3GB 3QJLA 3CJTA 4UUWA 1N34F 2HG4A 4KV8B 2RT3A 3VQSA 4QOTA 2KRBA 8ATCB 5J2NA 1IUJA 2CJQA 2LEBA 3FVYA 2DPIA 4YY3J 2QRRA 3DOMB 1JLQA 1MROA 2J7UA 2HGNA 1UPPA 3HZEA 4WP9A 3PEJA 2XB2D 1QUPA 1MNEA 2H65B 4DCJB 1Y0HA 5DZ7A 5AE1A 4DS4A 3F41A 3HKZD 1KQGB 1DRZA 2MQ8A 4F8RA 1V3ZA 1H38A 2F8EX 2P5VA 1RDRA 4DL5A 2HRYA 3W60A 1LW2B 3T9ZA 2FZKB 4OZ0A 1U0SA 4NXNJ 1FNMA 2LFVA 4RW4B 5A8KA 1TKXB 3ETOA 2B9EA 3KLIA 4NCGA 4IR9A 4ZVPB 1QSYA 4OI3A 4MMOA 2RUSA 2IAJB 5ETPA 2HHHF 2CJ9A 1K1QA 2DK2A 2YY3A 4PWUA 4BWMA 5BJRA 1VQMS 2LQ5A 3QLHA 3UR3C 4Q0BB 3IAM9 3FSYA 5HMYA 4RWWA 3CD6S 4FP9A 2ILYA 4WE1A 2ZH2A 3FEYB 4TKTA 2XZTB 4F25A 3BO3A 1ZOTA 2ZNYA 3JSMB 3HJVA 2DR7A 2IM2A 1YZ7A 1TL5A 2CUYA 4JI5J 1B0VA 5HBMA 2AYBA 4P2XA 1MMDA 4RJVA 4KKOB 3HMJG 5LMUF 3H25A 4WK3A 3BPSP 4J9SA 3UCGA 3VR1A 4USWA 2XGQA 1JKHA 1AT1B 1JNZB 2VPWB 2F4VF 4Y34A 2Y1IA 2F9JA 1VBKA 2MZSA 1ZA1B 3KG1A 5KFAA 4O3SA 5KFBA 2E5HA 4PG6A 3B54A 2MJNA 2J9DA 2ZD1B 2KU7A 1Q5YA 3M6VA 2BKNA 2WONA 4OX6A 4RUCA 1XNQJ 4PQUA 3TAPA 4HL9A 5L1LA 2VA2A 1RT5B 1UVNA 5H9EJ 4DFMA 1S0NA 1EKRA 4KFBB 3FSIA 2KT3A 2L48A 1Q95G 4QCLA 4ZP8A 3MEGA 4ZOSA 2CQPA 1VHIA 1UEVA 3KLHA 3OJUA 1H3DA 4YY3F 2Q66A 5F8IA 2FVQA 3HHDA 3V4MA 3ILLA 4Q5VA 4C0HA 7FD1A 2L41A 1WSVA 4NI2A 2QLBB 1SCJB 2R9LA 3U1NA 2CZ4A 1CULA 2HLTA 2E7WA 3PFEA 1S4FA 2WSFC 5GMEA 5KFLA 2X1FA 1KHVA 1MG7A 1WNEA 4KQZA 2MYFA 1TUWA 3CJSA 1T9VA 2XMTA 5J2MA 3PRBA 2ZUAA 5GADI 3IM8A 3AJ2A 1DQ8A 1QE1B 5I42B 1IKWB 4NXNF 3ILJA 2R7VA 4G1IA 3FGVA 3AA8A 2CQ2A 1IR1A 3HZGA 2D3OR 4PWWA 1TVRA 5HMZA 2G0CA 3WIVA 2ZDOA 2E7VA 4B3OB 2MZTA 1GAOA 3V6HA 2CQCA 2C2EA 5ETQA 1WACA 1RE1B 3P6YC 2Z2MA 4WYWA 2CVEA 3NOCA 5IM0B 3N6LA 4IFYB 1AZSA 3M32A 3CSKA 5L46A 1S1UA 2QL7B 2BJEA 1GT8A 2UVRA 3K5PA 1Q7YT 2BV3A 3PIPQ 5THWA 2YNGA 2V4JA 5D0EA 2HKEA 1TR0A 2YKMA 4DFPA 4WBFA 4ZP9A 3FEZA 4NLPA 4JI5F 3BPDA 3R5JB 4EI2A 2BM1A 4EBEA 5L9NA 3KLEA 1CJTB 3IS9A 4J9RA 3R7BB 1WOSA 1D8ZA 4GKKJ 4BC7A 4O3RA 3RG6A 4ILRA 4ELTA 1U1MA 4ZVUB 4M5DA 4ECWA 3OR1B 3TA0A 3SQGB 5E3QA 1DTTB 1RWUA 2WSCC 5L1KA 4FDFA 4CYUB 3MDFA 2MLZA 1XNQF 1ZS6A 1RT6A 4OX8A 3JXOA 3NOGA 3M8YA 2I6WA 2XS2A 4C97A 4KIAA 3M2RB 5DDPC 3M30B 2PO4A 4JI3J 2MPUA 1ZAVA 2JC0A 4M5LA 2VPYB 2VG6B 1ACMB 4UF4A 2XM3A 3PYFA 3DLGB 3KLGB 5E0OA 3DLJA 2ROGA 4LQ9A 2VFRA 2D3ZA 1VRTB 4CCHA 4K4XA 1HQUB 2OLWA 3KDOA 4F26A 5ITHA 4ZPBA 2YX1A 1TELA 3WC0A 3BM7A 5DG8A 5KFIA 2FC8A 1U2CA 5KOWA 2XWXA 2F9DA 3N79A 4OJGA 3MM8A 3KK3A 4ITSA 4EO6A 1UMJA 3R27A 3LH2S 1RAAB 2WVDA 3LGMA 2QSFA 1ZAXA 2MJUA 3AOCA 4X64J 5B0DA 1Y5NB 1FE0A 3ETMA 3GFHA 1Y10A 2PC6A 1EKSA 2CDRB 4M63A 2XMAA 2EKNA 2JH3A 2MQMA 3PX4A 2KB2A 4QPTA 4B9TA 2POKA 5EDWA 5D0HA 1NJXA 2YPZA 4CO0A 2QSWA 2YNFB 2MSSA 5CZXA 4DV6J 2WVFA 1GK8A 4NMLA 3I56S 2GZOA 1RU2A 4FPRA 2AGOA 2JJ4D 3D2WA 1R0BG 3GV8B 3OLBA 1U7LA 2YNHA 1VQ5S 5CCLA 2I2YA 1SH3A 1TAQA 1SQEA 3GONA 4GKKF 3CWJA 3POTB 4O3QA 3T1HJ 1HBNB 4J7CA 3GV5B 4PWDB 4WXWA 2VG5A 2CADA 2W2OP 2AYGA 3OPKA 1UL3A 2GHWA 1X4EA 2IJFA 4M5NA 2XG8A 2WOMA 1VMBA 4WKRA 4IH6A 4RW9B 1FVSA 1JJHA 3OQ2A 4X4RA 2HNDB 2Q43A 3IXQA 4LRCA 4ZLLA 1XJWB 5IWAJ 4FXVA 2R7SA 3NAHA 2VV5A 3F73A 1XNRJ 2MB0B 3Q89A 4ZPCA 1NAQA 3W5XA 3SSRA 1HBMA 2PMZD 2H1YA 4JI3F 3N4WA 5DG9A 4OYMA 1VIOA 4B08A 1JXLA 4NOHA 4PRFA 4OI6A 4R5PB 3CULA 2EG2A 1IN0A 5KFZA 4QYRA 1RI7A 2EWHA 4P52A 2DTJA 3F44A 2BE2A 2OEMA 2CPHA 4ED3A 1R8CA 2BVZA 4LF5J 2HNYA 3CJKB 1HL6A 1F0XA 3FQKA 1IXKA 3H4BA 1D8YA 1JK9B 2AQ4A 4NLQA 4O3OA 1FCAA 3NRBA 4HHUA 2C2NA 1RT4A 1RWWB 2KG0A 2W7OA 2XNQA 3Q8VA 1WDTA 3KLVA 1U0HB 4GRSA 4MTPA 2MQLA 4X64F 2Y0SD 2PN6A 3IGVA 3TZWA 1U1QA 1LV5A 2G4BA 3E51A 3MMAB 4RUBA 4Q45A 1EETA 2K2PA 3HM9A 3EXCX 1HI1A 1P9YA 3KHRA 1QSSA 1D3WA 2MKHA 4QR2A 2OIHA 3Q8YA 4RKUC 4DV6F 3GIKA 5HVFA 5HO4A 3G87A 1JJ2R 5KG2A 1JLCB 1DQ9A 2DO0A 4FPIA 3S7RA 4LIWA 3MUMP 5G0RB 4DV3J 3L7OA 1RT1B 1NDPA 2ZZNA 3NLCA 3PVXA 2E1AA 1NKBA 2YX4A 5LJ5Y 4ED1A 1YBTA 1C4AA 3EYZA 3SXLA 3T1HF 3GFZA 1NK9A 4K4YA 4N7TA 3AD9C 2ZH5A 2ZBPA 1U1KA 3G8QA 1X4GA 3IRWP 2AKWB 3THPA 5C42A 2IA6A 4RL1A 4WU3A 1N5SA 2LA6A 5J1EB 1PBAA 1HLWA 1AXQA 2NXUA 4PPZA 2VHGA 3QRPA 3SZ2A 1N6QB 1PJ7A 2ASYA 3NKYA 3M6WA 4DX6A 5IWAF 1X4DA 4B9VA 4DQQA 1XNRF 2RE1A 5EWGA 4K50A 1CG2A 1KSPA 2AZ1A 3VHQA 2ZC3A 5EHHA 3IGNA 1YBAA 3OSNA 4ZPWR 2E9ZA 1OO0B 2ZBIA 2RKIB 2DGTA 3QIDA 1X9MA 2F7VA 1SC1B 1WKLA 2UXBJ 2OTLS 3A8JA 1RTIB 4AXIA 1FRJA 3M2VB 4NLUA 3V6DA 4I2PB 3BBCA 2ZC4A 2HVIA 2NS1B 5F0UA 3IG1A 2HIQA 3QJPA 4WXOA 2X1BA 3MPUB 4KR0B 2QJ3A 4CLYA 3LP0B 4LF5F 3N01A 1U49A 4DL7A 4UOHA 2NZ4A 4J90A 1B70B 2JEFA 4QIGA 1UWBA 3P5TL 4FVCA 2HHTA 3KHLA 2C42A 4RBVA 4KGZB 1VQ8S 4IG3A 3CCUS 1BQNA 3DM2A 5EX0A 1E6YB 2UZAA 1IKVA 2RQMA 1MWYA 3MCOA 1AFJA 1PILA 4NCBA 4R0JA 1T05A 3UVJB 1Y5IB 4A8FA 4J9LA 5HN0A 1X4AA 1U26A 2GJFA 2AU0A 3G82B 5B0CA 1N0VC 3L9ZA 4G1QB 5CYQB 5D0GA 5DM7Q 1BHNA 4CDIA 2K3KA 5I4MA 3A8EA 1NNDA 5KG7A 1YX2A 2W2QP 2ADBA 4CWBA 3UN3A 4DQPA 1C2PA 2ZKUA 1GEHA 4NASA 3UO0A 3D9BA 2JX2A 2VQEJ 2BM0A 3VGTA 3PO4A 1EJ7L 4GVBB 4NLYA 3A13A 4HT7A 4DV3F 1B99A 3M2UB 5HANA 2I38A 1N5YA 3W63A 5ETKA 4A46A 4PG7A 3RGIA 3FNNA 4B02A 2UVUA 3LP2A 4UUXA 2NLWA 1FRHA 3HXMA 5KFGA 4JUZA 1MSWD 1YQHA 2CJYB 4ZIWA 3KKFA 4FKYA 3FBFA 4O4GB 3AH6A 2QO3A 2XSJB 3IRXB 1HNVB 4ETXA 3TQEA 3RB4A 3DXSX 3CT9A 1RACB 5ETRA 1RBAA 3QZ7A 1N0UA 3ONQA 1FK9B 5LXRA 3ADAC 4LRFA 1NSKL 3CCQS 2NXCA 3TAMA 4OL8A 3D28A 1VQ7S 2UXBF 1R7IA 4WPAA 3Q8PB 2E66A 1M90T 2W1BA 1TL7B 4A8WA 1T3OA 4Z7CA 4F50A 4USJC 3G86A 2LMIA 2HQIA 5JVHQ 1KP6A 1WC6A 2KZZA 2CPJA 1A7GE 2H5IB 3GV7B 2DPJA 2EC2A 3DHWC 4EFAC 3WDOA 4DCPB 3TEHB 3T5LA 3DOKA 5DDRC 2GFFA 4I67A 3NNCA 1FTCA 1PSDA 2YTCA 3BSOA 3NGDA 3W61A 4HACB 2NUHA 4MK8A 1DLOA 2OPPA 1XERA 4DU7A 2DISA 4AFFA 3J7YU 2FY1A 3D4JA 4ELVA 4NWBA 1P1TA 3KG4A 2DCLA 1FWKA 2G2ZA 4A8QA 4J9QA 3VAKA 1RJJA 1S5ZA 3SV4A 4QQBA 4MYTA 2YX7A 1NUEA 3NBPA 3D0HE 4E98A 4K0KJ 1RQ0A 3IWXA 2VQEF 3I5CA 2DH9A 4B3MF 1S9FA 1RAIB 1JLQB 1MROB 2CQ0A 4RW6A 2DNMA 1KLNA 2YBVA 1KONA 3RBXA 3K5MA 5LMNJ 1VQYA 2JSXA 1S1WA 5C24A 3Q2TC 3JQMA 2D3O1 4KPCA 4CH1A 1IBKJ 3MM5A 3RU0A 4C2MA 3GB0A 2W4CA 2MTLA 4V19X 3B4DA 3OL8A 2MKYA 4ILLA 1TQLA 4TYAA 4ATNA 3ZO7A 1FJCA 5A8KB 4QIEA 3PEHA 1SV5A 2RQKA 1LFPA 1N5VA 3OL6A 3TZYA 3HULA 5J1NA 2N4DA 4DUZJ 2WRMA 4ID5A 2ASDA 1CBKA 4JI0J 2BJ9A 4MIAA 3NS6A 1SH2A 2ZOGA 4OHYA 2CQHA 1X5PA 2Y1RI 1WI6A 1JLEA 4ECSA 4PG5A 5KT3A 1NK6A 4HTIA 4WE1B 2KH9A 5LSRA 1IBCB 2IM1A 2MLXA 3RZAA 1UEKA 2J9DE 2V8VA 1NMEB 1R31A 4I6YA 1M1KT 3VGUA 2ZJRQ 3PJ9A 3EVWA 4NCAA 2DNZA 2OELA 4L76A 1SUQA 1IVZA 3K8WA 3EGZA 2KZMA 1FRIA 1UTAA 4QIWD 1HBOA 5GAEU 2HVDA 3WHIA 2A18A 4LT6A 1DHMA 4PCQA 5DLFA 5T41A 1KDNA 1Y11A 5A8RA 2ZJPQ 2IBOA 2OAUA 3BR8A 4WP3A 4KGXB 1H2UX 4M1KA 5E3CA 5LM7E 3L3CA 5B0FA 2Z2ZA 4DEZA 1QAIA 2VF3A 2PIIA 1QVFR 3TUPA 4OQJA 3CMES 4DL2A 2OFGX 2W8KA 3ENWA 3KLHB 4K0KF 3HF5A 1IM6A 2W9AA 1FTRA 1T02A 2GQQA 4C8NA 1YIJS 1C0TB 2M8DB 3SIPB 3US5A 1SC6A 5H9FK 5LMNF 2YQ1A 1HBUB 1Q7LB 4O4RA 1U1LA 2BABA 3NWRA 4ZJLA 2JNJA 4XPEA 4I2QA 1FRMA 1OWXA 1IBKF 1WEYA 2HQ3A 2DXDA 1PAUB 1VDHA 4DZ6A 5IT4A 5J2MB 3MM6A 2MZ1A 1REVA 4K2JA 2RQCA 3PV8A 5KFKA 2A1BA 4IOAQ 3AOAA 1X4HA 2K1RA 1NPRA 4U9RA 1FEEA 3MF5A 2DBBA 4DUZF 3K5NA 3R2DJ 2V8HA 4LIRA 4JI0F 5EGYA 3CCWA 4KHPJ 4PQAA 4IH7A 4FF2A 2UXCJ 4LSLB 2HHXA 4DS5A 1WOPA 4UOGA 3M8SA 2A6OA 2M8HA 4Q43A 1AZSB 1M5KC 3KK2A 3JSBA 3J80U 2M4MA 5E3RA 1EIYB 2JL9A 3AOBA 2HZAA 2YNGB 2V4JB 4L3NA 2JHEA 4WFXA 1C1CA 2YKMB 1VS3A 3H2UB 1YRTA 3HVRA 2LLZA 5D78A 2H5EA 2V4RA 1GQEA 5C25B 3CDBA 4ED2A 5HJXA 3CCSS 3CCZA 3M8RA 3K57A 2LDYA 1BMQB 5I3UA 3KLEB 3VCDA 3IS9B 3K17A 3PW4A 4CT8A 3GCWP 2J7KA 2KT5A 4CZCA 4M5DB 2OP5A 3HSJA 1UETA 3B82A 1FKPA 2WVEA 3H42A 1MU2A 3MMBB 4RUHA 3BKTA 2DGSA 1R0CB 3OW2R 1BC6A 2DEJA 1DY3A 1YBUA 3PJXA 4I56A 3WC2A 4PUOB 1QLNA 3KNAA 4FVMA 3J81U 4RX6A 3GSDA 2HHWA 4PG8A 3MUTP 3CF5Q 1XR6A 3P49B 4GC7A 2EBEA 1KR4A 2V34A 4DG1A 2CNOB 1BUXA 1T0TV 3GP9A 2XMWA 3C16B 2VPZB 2Z4PA 3QWPA 1T95A 1OYDA 1RHRB 2YWHA 3M1VA 4FBTA 5CABA 1CJKA 4C8LA 4K7QA 2VG7A 4OV6A 4Y3CA 2BR0A 2HVEA 1UVLA 2R7QA 2XS7A 1XQIA 1QJHA 1OQ3A 3C66A 1XMOJ 5SZTA 3MM8B 1YJUA 5SUHA 2NPIA 3OUYA 2PA8D 4ZVOB 2RUGA 3FQLA 1LW0A 3CXCR 4HVZA 1J5OA 2GW8A 2FJXA 1G6BA 1WORA 1U2FA 2OGUA 4A8OA 4K2XA 4ZCMA 4KHPF 1KHWA 2EW9A 4F04B 1WF2A 2UXCF 2NSCA 4QYZJ 5KFNA 3HD2A 3N6NA 3CO0P 2M7SA 4LBIA 2DR5A 5HAOA 1YLXA 1PCAA 3TRGA 3NL0A 3EE3A 1HI8A 3FFIA 1S6OA 4TNOA 4H4OB 3GFYA 3EM1A 5KG4A 4MKAA 2YNHB 3V4IA 3FRYA 2H4YB 3P45B 2KT2A 2DITA 2BBEA 4EEYA 4PXBA 5K14A 1HNWJ 2XY5A 3LWMA 3QRRA 3K5LA 1ZM4A 2DY1A 1T3NA 4CLTA 1AW0A 1EZZB 1EP4A 4UY85 3MGJA 4DV1J 4LRDA 3KDNA 1LWXA 1FKAF 4GC6A 3OSPA 3NGUA 4MFBA 5KFRA 1Y00A 4MKVA 2WOMB 3EDRB 1KVKA 1UA0A 1URRA 4RNNA 2M88A 5IT9Y 3T5HA 3T6BA 5CD4A 1SXLA 1I5OB 4DL6A 4LREA 5GAGU 3Q83A 2DNQA 1ZZFA 4I7FA 2HWTA 2R7RA 1HIYA 2UP1A 2A3JA 1QVGR 1HBMB 1TKTA 4Y0FA 1B64A 2HQFA 2DHHA 4WZQA 2L08A 2DGOA 3AJ1A 1I94J 4LRBA 2BXJA 2JEGA 3VV2B 2RB7A 3CIMA 5HQLA 2BE2B 4FF4A 4A8MP 3I9V9 2L9WA 5CD4H 4RNMA 2ABYA 3KHHA 3ZTSA 5FDLA 4NLRA 3TJ9A 3QQCD 2B0GA 4LF4J 4DMZA 2HNYB 2FHKA 1PYOB 2K06A 4KH0B 1XMOF 4C8MA 1XR7A 4GO7X 1RT4B 1GFWB 3P8BB 2YNIA 5HQMA 3IBWA 1OS5A 3C14A 5KAKA 4ID8A 3NGSA 1S1XA 2H9ZA 3GCXP 4NYOA 3EX7B 4L75A 4M5KA 3Q2SC 3TUJC 3DHXA 3QGIA 2JLGA 4M5HA 3NMRA 2WTFA 4FZVA 3D1OA 3G6XA 5GVQA 2JOQA 1R8AA 1FWLA 2XZDB 5E33A 4QU7A 2RRBA 3CJ5A 5DGBA 3H5YA 1Q79A 3G6VA 2KXNB 1HWUA 2W9CA 3KG0A 3SSQA 2CQ1A 2DIVA 2J0QD 2QFIA 3PW5A 2AP6A 5AXLA 1TFYA 3D6TB 4ZHRA 2ZOFA 3C19A 3DLBA 4ICLB 4N76A 5AXMA 2LEAA 2D7SA 1WEZA 2MZJA 3QBCA 1A6LA 1R89A 1HNWF 3VZIA 4CT9A 3BGRA 2Z56B 5GAEI 4UQGA 4JYAJ 1NPKA 1RBOB 4AL5A 3GU0A 3EUNA 4ED6A 4NXMJ 4DV1F 4DR7J 4YHHJ 4R8UA 1KD1T 1I51B 1C0UA 1Q0NA 4KSEB 2HWHA 1IM4A 3B6BA 1GXTA 5C42B 4ECTA 2H54B 4Y00A 2AMCB 1VOMA 4RPFA 5CHCB 3FUYA 3MHYA 4DPUA 3V81B 3PKYA 3CUNA 1NDLA 2J8AA 3RJMB 5J2QB 5K9FA 4C3KA 1B0TA 1GMVA 3QGPA 3AB4B 1HNZJ 3AJDA 1HWLA 2EK1A 4ECVA 2FJVA 1WC5A 1ZETA 5AXKA 4HTJA 4HT5A 2N7CA 1PYSB 2I5JB 1I94F 4C48A 2GIRA 4TYBA 1S9EA 4OI4A 2MHNA 4TY8B 2BW2A 3V6DB 4CLFA 1U1RA 5ETNA 1O0PA 4MYUA 2EFNA 3IG1B 4OV1A 2IRYA 4LF4F 1QUVA 5KFWA 2RRNA 1HQEB 2N3OA 2DCUB 1UWBB 5IQ6A 4Q2LA 3KK1A 1A0OB 1J2VA 3R97A 5T14A 4IG3B 1BQNB 2XLJA 1IKVB 4WIQA 5L8RC 3BN4A 4JV2A 2AHOB 4D3GA 2VOPA 2PI4A 1T05B 2P6SA 2JWNA 3QNWB 3E2EA 3QWUA 4IO9Q 4DPYA 3W64A 2ZNZA 4RR5A 5CYJA 1TFWA 2KHDA 2BANB 4Y6IA 3FBEA 3MAHA 2D3UA 1UA1A 1RA6A 3IWLA 3DU5A 3MOJB 1JNRB 3W2WA 1EARA 1UFWA 1AA1B 4DV7J 2HBRB 2RS2A 2EBGA 1T9TA 5KT6A 2CJBA 3QYYA 2HK2A 3P4UB 1RAFB 2XHCA 4IO1A 3O44A 5F3ZA 3ZZTA 1DTQB 2DHXA 3D66A 3PX6A 4ECRA 5IC4B 5CYMA 1VYAA 1PGZA 2DRAA 1N5YB 1BWVA 4JYAF 3I0RA 1HHQA 3AFGA 4KO0A 2W2PP 1ZH5A 3C46A 4NXMF 2KFZA 4DR7F 9RUBA 4YHHF 1TL3B 5CXTA 3LTOA 3GR0A 2OTJS 4CLUA 4UOFA 4CM2A 5HJYA 4ECXA 2QA4G 4P74A 4CP5A 4FYWB 4IDKA 2OPQA 5E7OB 2YKQA 4ECQA 3KUEA 3W9JA 5HP1A 4W92B 4QWAA 3A3NB 1QSLA 2XY6A 2JZ5A 1WOOA 1Y9OA 1HNZF 4BLGA 3LGNA 3O1LA 4Q8FA 4H4MA 3TAMB 2B7BB 1HW9A 3KFWX 2PEHA 1VLOA 4F2SA 3PY8A 3R5BA 1RHMB 4NA2A 3T1YJ 4DBQA 1FWPA 3JSRA 1KWMA 2CKWA 2JRSA 2PT0A 1YG0A 1WC4A 1KLMA 2GVDB 2WSEC 4LRAA 1RLDA 1VISA 3EWGA 4X4PA 2FJWA 5FJ4A 2B56A 3D1HA 1MW7A 4AL7A 4X4OA 1ULRA 3EGWB 1V9OA 1OY9A 1PO6A 3DOKB 2MZQA 1FXRA 1MWZA 2IC3B 2AEFA 2QL5B 3CB4A 7FDRA 3W8GA 4KH1B 2KJVA 4WIIA 1DLOB 3NS7B 3AD8C 5KFTA 1HQ2A 5CQGA 2LEPA 4TU9A 3OVBA 5GMDA 4RW8A 1URNA 4RO0A 4NLVA 4DSKA 1RWKB 2DNYA 3DFEA 2BJ8A 3MD1A 4URSA 3TA2A 3S1TA 1BQXA 1KC8T 1EB0A 2M9KA 2X1AA 3UN2A 3SCJE 5GADU 2IM0A 4UW2A 5KFMA 1BWEA 3AODA 2DT9A 4ETZA 4DV7F 2PE8A 3N5BA 5KG6A 3Q0AA 4WWSA 2QLXA 5HMXA 1LWCA 2IRXA 3NBPB 4CLZA 3ZTOA 1RKJA 2OFHX 1FNXH 4A47A 2A2CA 4RW6B 4XDCA 4HR2A 3RR8A 4HI1A 5JMNA 4USIA 3BQ0A 3SDEA 4L6V3 2DEIA 5C24B 1L3VA 2FUG9 2XO6A 1XEZA 2B43A 3MM5B 1C4CA 1DQAA 2ZFHA 1FRLA 2D9PA 2NREA 3TZZA 1IBLJ 1M0SA 4USKA 1SJ4P 4PAAA 4KGVB 2W2NP 1SV5B 2DHGA 4C8OA 4MK7A 2HBYB 2CA9A 3PHEA 2GMHA 5GAGI 1SKRA 2H4WB 4IH5A 5H9EK 2RAQA 2HQDA 5KG3A 2HFUA 4ID5B 2ZHOA 2XYHB 1PAEX 1KTQA 2VDIA 4CO2A 3UCUP 2W9BA 3BBBA 3L7UA 2DNLA 1TL1A 4USTA 4AYBD 4UY8T 1B7FA 2CZ9A 2FHJA 5LJ3Y 1JLEB 3I82A 3I5BA 4CI0B 4I0WA 5DQGA 4IFVA 3T1YF 1HPZA 3JSYA 4F3QA 2RNEA 2VFTA 4FN5A 1L3TA 4P6QA 1ZPVA 2FTRA 2VICA 2XLKA 4NA1A 4K5SA 3MD3A 1K73T 3CCES 2KYZA 1UCNA 1ZAWA 2C28A 2HS4A 5GMKa 3C8YA 4DF8A 4M5IA 4B3SJ 2OD6A 4DSEA 1SUQB 2QV6A 2DHSA 1C1BA 4FS2A 1FDNA 3DLLQ 2J76E 5IC6B 1HBOB 5M2PA 4QW8A 2HEKA 4JI8J 1U09A 3CDAA 2V5HG 3PG9A 3HSDA 3MR2A 3R7SB 4F36A 4RU9A 2APOA 3ICLA 1CQNA 3GJQB 3MAAA 3O8WA 2R7WA 5A6PA 1F9HA 5K8PA 3UD4P 4KC5A 1N88A 1AROP 2HQCA 3JAMY 3OHBA 4W4MA 2KM8C 4KGKA 3KLFA 1SJFA 3HVTB 1HWIA 1RU1A 2DGVA 1FX2A 4L3KA 3PX0A 1S6PB 1OPZA 3W66A 1X31C 4DV0J 1UAWA 2DVIA 3H20A 3BS9A 1NLKL 4YFUA 4FXDA 2GX8A 2G9OA 3OTCA 2ZHAA 3A3PB 2VZ9A 1FE4A 5D3GA 2EXUA 3NP5A 3L7PA 4B17A 3K2YA 1VK3A 4G65A 1FNOA 3LA0A 3DOMA 2WCXA 2PMWA
chains in the Genus database with same CATH topology
4OJ1A 1M5VC 3PKMA 2I38A 4PXDA 4JI6F 1ROFA 3G8SA 1N5YA 2V9KA 3ISZA 3IR6B 1S0VA 4K4UA 5DJBA 3MPWA 3GMGA 4OZ1A 4A46A 2OPRB 4PG7A 3FNNA 2FHOB 3CCRS 4WZMA 4C11B 1S0OA 1IBLF 4B02A 4R8UB 2UVUA 3LP2A 1REVB 2ZH7A 1SJ1A 4UUXA 1C0UB 1RP5A 2NLWA 1QM9A 1FRHA 3HXMA 4DWIA 2CQ4A 5F9NA 5KFGA 3HHLB 3MURP 4F3OA 1S49A 4DSFA 3G6YA 3POTA 4X84A 5DQIA 4DHVA 4F2RA 4WFZA 2QT7A 4JUZA 2CPFA 4EYHB 4HH0A 1FKOB 4B9MA 5L39A 2XNRA 1MSWD 1YQHA 3GZ7A 1UEUA 1LW2A 2BOPA 1RTDA 1BY9A 2BYCA 4NLDA 3KKFA 4O3PA 1U45A 3MEDB 2M3DA 1SJQA 2R7OA 4O4GB 3AH6A 5IQQA 2QO3A 2XSJB 3IRXB 1NEEA 1NK5A 1HNVB 4J37A 3DRRB 5BYRA 1XTZA 4ETXA 1YJ9S 3RB4A 3DXSX 4NX9A 2UV8A 3CT9A 3OFGA 3U27A 2JDJA 4TU8A 3DRPA 1X5SA 3QZ7A 4RW9A 5AJ3F 3SFGA 3PZPA 1N0UA 3ONQA 1RT6B 2ZH9A 3QGHA 1DARA 2ADCA 3VF0B 5KFQA 1S48A 2HNDA 2DNKA 3AA9A 3CDUA 1JLAB 1S79A 1FK9B 5LXRA 1VHFA 2U1AA 5KT7A 2V4QA 3CCQS 3TAMA 1JLFB 2LECA 1U48A 1YI2S 3J7ZT 4HKQA 4KBIA 3D28A 4ZS6A 4OL8A 3BSAA 2Q6CA 6FDRA 1VQ7S 1WHVA 4IKAA 2UXBF 1R7IA 1SBRA 4QIFA 5F8MA 1TK8A 3B78A 3Q8PB 1RISA 2E66A 1M90T 3MAQA 4CQ1A 4OHZA 4A8WA 1F2GA 1T3OA 3LW5C 4LJMA 4NRTA 1S7HA 4F50A 4USJC 3ISNC 3G86A 1ZZNA 4RNOA 2LMIA 2XMKA 1L5UA 2HQIA 2L3MA 2B7CB 2ZE2A 4H4OA 5DLGA 4R5PA 5JVHQ 1D9FA 1Z2ZA 3CDWA 3PR4A 2ERRA 4NLWA 3HDSA 1P27B 2NPFA 4J9NA 2UUBF 1X8DA 2KZZA 2CPJA 3GR1A 2GO8A 4A8XA 1HR0F 3UD3P 1U1PA 1A7GE 3FMWA 2ASJA 4GMKA 5LL6d 4B3SF 1CPZA 1NK0A 1YWXA 3JSMA 2D41A 4ZK7M 1Y3KA 3GV7B 1YJWS 2PGCA 2DPJA 3SFUA 2HWIA 4YR2A 2MY8A 3DHWC 3IN5A 4EFAC 1LWFA 5B0AA 1CEZA 3WDOA 1Q81T 2HFNA 4DQRA 1V3RA 4I1TA 3KK1B 3T5LA 3DOKA 4JI8F 2GFFA 5DDRC 5DS7A 2XMJA 2MMYA 2QMXA 3VALA 1FTCA 4HDGA 3PR5B 1PSDA 4ZP7A 3PW2A 3NNCA 3DDNA 1K0VA 2AD9A 2YTCA 2PDAA 1S1VA 3DOLB 3BSOA 3NGDA 2V94A 5HMWA 3GIMA 5A8WB 3KMSA 3BGLA 2YKOA 2WW8A 2C3PA 2NUHA 2AYMA 2YKNB 4EGLA 1MU2B 4X4TA 4MK8A 3I55S 1DLOA 4HLBA 3KK3B 4J9PA 2BDPA 1JB0C 1XERA 2OPPA 2DISA 4CNZA 3TUIC 1CQMA 3GILA 5JJBA 2E5IA 4ZVHA 3KNGA 1R6YA 2DH8A 3G9CA 3CJ2A 3TANA 1X0FA 4G1PA 4KRWA 3L95X 1SB6A 4ECUA 3TO8A 3U1LA 4ECZA 1VQ6S 3HP6A 4AFFA 1FJ7A 3RRHA 2RDJA 3J7YU 4NPOA 1S1TA 1HNIB 3A1YG 2FY1A 4ELVA 2X3GA 5M2RA 5K5MA 2DHAA 1ZBTA 4NWBA 2JVOA 1P1TA 2ZD1A 3KG4A 4NLXA 2DCLA 1N56A 4E0DA 4A8QA 2R4FA 4DLEA 4J9QA 3JTOA 3VAKA 5DRKA 3ZFVA 3E01B 4DG1B 1RJJA 4TQRA 1RTJB 2QYCA 3P96A 4DV0F 3SV4A 4A8KA 4B9SA 2MQPA 2VPXB 3JB9k 4QQBA 4HEA9 3C6TB 4MYTA 1N8RT 2YX7A 3LP1A 1RT5A 3RB3A 1L3UA 3CJ4A 1KQKA 5J2PB 2E29A 1T03B 2IVFB 3MMAA 4A8SA 2W4DA 3PJWA 1V3SA 3DLKB 4N41A 3NBPA 3D0HE 4K5RA 4KFBA 1O8BA 1Y4ZB 2YWEA 3C3LA 5A0YA 1G3OA 1RKIA 3T5KA 1MMLA 3DCAA 3VTIA 4E98A 3OV7A 1KS2A 2X51A 1RQ0A 3IWXA 2VQEF 1D1UA 1VQOS 3I5CA 2DH9A 5CZVA 5E41A 4B3MF 1S9FA 2M5YA 2UU9F 1UFLA 1JLQB 1MROB 2CQ3A 2CQ0A 2VG7B 4RW6A 5F0WA 2DNMA 3G4SS 1KLNA 3ZZZA 1LKZA 2MKIA 5CYMB 2DJWA 4O3NA 1KONA 2Y1JA 2HHVA 2AYEA 3K5MA 3UFCX 2FIUA 4CH0S 1D0EA 1VQYA 3I0RB 1JLCA 1LK5A 2JSXA 1S1WA 2MDAA 3M8QA 4C8ZA 5C24A 2J6UA 1HFEL 2CJAA 1KRPA 3Q2TC 4B3TF 3FZ2A 3LUYA 2KI2A 5G0RA 5A6WA 3W2VB 4F3MA 3OUYB 1KVJA 1HMVA 4CH1A 2UUCF 3MM5A 4JI4F 3RU0A 2OJ3A 4C2MA 3MECB 3GB0A 4OZNA 3KMQA 4TN2A 4WYLA 2LXIA 2W4CA 2B4OA 1SJRA 2VG5B 2GQ2A 2MKCA 4V19X 1J5OB 4YP3A 3HVAA 4O0IA 3B4DA 3DI6B 3OL8A 4ZLPA 3CCJS 1IKYB 4ILLA 3TI0A 3DRYA 1TQLA 4TYAA 4IDKB 2XMMA 4WFAQ 3HJFA 3F56A 4ZCIA 1FA0A 2OPQB 4PG4A 4ATNA 5DDOC 4YOEA 1FJCA 5A8KB 4OJ3A 3MMCA 1KN6A 4QIEA 5JXSA 2R2UA 3PEHA 4LF6F 1SV5A 2I9SA 2RQKA 2AGPA 4LFCF 4ZCKA 1S6QB 1LFPA 1N5VA 3OL6A 1PC4A 4UOCA 5HP1B 3FEXB 3OL7A 1VIXA 1JIHA 3CC2S 4DSIA 3CCVS 3H40A 4DV5F 5J1NA 2HZCA 2N4DA 3BB5A 2ZBCA 3BQ2A 2OO4A 2WRMA 4C98A 4ID5A 3FMBA 2ASDA 1U6ZA 1N6QA 2DNPA 2RF2B 1UVMA 3OL9A 4MIAA 3C6UA 5BYSA 1TZ0A 1CLFA 2LKZA 2L9DA 3NS6A 5B0EA 2AJQA 3RYLA 2GGPA 3I4PA 1SH2A 2ZOGA 4OHYA 2CQHA 1X5PA 1Q8BA 1WTFA 2Y1RI 1WI6A 3CEDA 2GMJA 4X66F 1RAJA 3CIZA 3K7RA 2VONA 1JLEA 3BO4A 1LFWA 3T19A 4AE5A 3S8SA 1SIZA 1X0PA 4ECSA 4PG5A 2LQJA 3FFIB 3B8HA 3H5SA 5KT3A 1NK6A 4D3HA 5K8OA 4HTIA 1LK7A 4NA3A 1RT3A 4WE1B 2KH9A 1HWKA 3IAS9 5LSRA 3PW0A 4FYDA 4O23A 5F9LA 5FIIA 2IM1A 1AUDA 4PXCA 3HHKA 2CVIA 5E3PA 2F3JA 1OIAA 2LU2A 2RKIA 2KXFA 4NZ7A 3J80Y 3QO9B 4RW7A 2ATLA 3LAKA 1OSDA 3RZAA 4ICLA 3AB2B 3V4IB 2N82B 3LANA 3OXFA 2J9DE 1RTIA 2V8VA 1VC0A 2Z0GA 4KT0C 1R31A 5K14B 1O51A 4I6YA 1WG5A 1XN9A 2B9YA 5B0GA 1M1KT 2ZM6F 2DNRA 1VQ9S 5CCMA 3SCKE 3D0GE 3NNAA 2ZJRQ 1V6HA 1F5BA 2CPEA 3M2VA 4RLEA 4F4YA 4I2PA 3J7A1 2XC9A 3H59A 4WFYA 4NCAA 3S01A 4HI2A 4QWCA 2P9CA 2VASA 3D5MA 1EP4B 2B9XA 5DM6Q 2DNZA 1SL2A 2ILZA 3K5OA 1SUQA 2CPDA 3THTA 1FJEB 2B4PA 1F5CA 1U24A 2BRKA 3K8WA 3EGZA 1HA1A 2KZMA 2J5AA 2KM8B 1FRIA 4QIWD 3TARA 3T6JA 3Q22A 1HBOA 4I67A 1BLUA 5T7LA 1U1OA 5GAEU 4MFBB 5E2QA 2P9GA 3M4XA 1W2BR 2A18A 4LT6A 2AF6A 2BA9A 2F1FA 2XGPA 1DHMA 4C3LA 2WBMA 2FPHX 4ED5A 4OZ5A 3H4DA 4RW8B 4PCQA 2F40A 1KFSA 4JOUA 4EYIB 3OXLA 1MMNA 5T41A 5DLFA 1UVJA 5KFXA 1ZM9A 2G13A 1DURA 2M70A 1WI8A 4URGA 1N52B 1QAXA 5A8RA 2EFGA 3BJYA 1E6YA 2B6AA 3OR1A 1F60B 2ZJPQ 2QEXS 4C9DA 3I87A 2IBOA 3V81A 5L1IA 1DTTA 5U47A 2KHCA 5F8GA 3QZ8A 1Q82T 1VBZA 3JYTA 4IG0B 5L38A 2J0SD 3O2IA 5J2QA 2OAUA 1HD0A 3U02A 4I7FB 3BR8A 4LVNP 2KYXA 3FCHA 4IUFA 1H2UX 2XSFA 3DRSB 4M1KA 5E3CA 2C3UA 2E5GA 3L3CA 4M8LA 4C4WA 5B0FA 4KB7A 2W25A 4LQ3A 3J81Y 1TKTB 2OD4A 1APSA 4H4KC 1Q1KA 2BUNA 2HFZA 1AFIA 3MUVP 4DEZA 1HI0P 1QAIA 2EPIA 1LWCB 2XCPA 3R1HA 3UE2A 1TKDA 2J0XA 2RSQA 2F8HA 1EETB 5CYQA 2I5JA 2HLUA 2PIIA 2E7XA 1QVFR 5EWEA 1WG1A 4OQJA 1Q53A 3MTJA 1RYSA 4OHWA 4IOBA 4DL2A 3CMES 1LXJA 1R3NA 2UVWA 2Z2LA 4A8YA 3RAXA 2OFGX 3UQSA 2W8KA 4ED8A 3ENWA 3KLHB 4K0KF 2VBXA 3HF5A 2C2DA 2MSTA 3IWNC 2W9AA 4BCAA 1FTRA 4B9UA 1T02A 3FSXA 2YKAA 4TY8A 4C8KA 2GQQA 2VG6A 4F4ZA 4C8NA 4DOZA 2WAQD 1YIJS 1RYRA 4MKYA 3HK2A 1C0TB 2M8DB 3KLGA 1IQZA 5E5NA 2W7AA 4MAKA 5KFOA 3US5A 4ZKAA 1SC6A 2GQCA 2SXLA 3SDEB 3CCLS 3DNCA 5LMNF 4ZVFA 2ZJQQ 4C7QA 1Q8LA 3NG8A 2QIFA 1HBUB 1Q7LB 4O44A 3MZIA 4O4RA 1U1LA 2IBKA 2L9NA 1WTBA 1VRTA 2BABA 1KOOA 1Q78A 2ASLA 1NRKA 2R7TA 1M5SA 2LCWA 4XPEA 2YWKA 4YUDA 4I2QA 1HQEA 1NKCA 1FRMA 1KQFB 2OPSA 3DLEA 3OR2A 1UJ6A 2YWGA 2GHVC 4NYZA 4XPCA 1K1SA 1OWXA 1IBKF 5HQ8A 2WB4A 2LXUA 1WEYA 2YNIB 2HQ3A 3KJVB 4OIXA 1XC9A 2MQNA 3GG0A 3MEKA 4YB6A 4DR1F 4YMEA 4IOCQ 3D0IE 3M05A 1XBWA 3TNVA 5IT4A 2OPRA 4CH7A 3MM6A 5J2MB 1FHTA 1S1XB 4C11A 1DJ0A 2MZ1A 3ENQA 4KTQA 4DR3F 1WG4A 2JEIA 5KTQA 4RBUA 1REVA 2Q1LA 2FVCA 2RQCA 3PV8A 3T9NA 4OFZA 5F41A 2O67A 3HHLA 5KFKA 1CC8A 4A48A 3TW0A 3HX9A 5KFDA 1HHTP 2A1BA 4TLRA 4IOAQ 1Q4RA 2V8GA 1BGXT 4ES2A 1NHVA 4WCEQ 4MIWA 4B9NA 1X4HA 2KG1A 4FNHA 2IJNA 2K1RA 2N3LA 3CCTA 1S6UA 2WHOA 5KFJA 3SCLE 2MGZB 2BANA 2J6TA 4U9RA 1G7CB 1FEEA 3HHEA 3I9ZA 3MF5A 2DBBA 4X4SA 4DUZF 3K5NA 3B4MA 2V8HA 3MI7X 4NLOA 4TQSA 1U4BA 1SKWA 4WFNQ 3MEDA 1XR5A 2E44A 3MR6A 4LIRA 4JI0F 5EGYA 3CCWA 4AL6A 4B3RF 2XULA 2HMIB 2GMLA 4DDFA 3FJ2A 3IRXA 4K59A 4PQAA 1HNVA 1TL1B 3BEGB 4IH7A 3DRRA 3R5DA 4EO8A 4N5SA 3OLAA 4FF2A 5D4OA 1XMBA 2XY7A 3I0SB 4BWJA 4NYPA 4LSLB 2JLEA 1S77D 4DS5A 2HHXA 3M8SA 4DPOA 4ZVEA 1K9MT 1JLBB 1HPZB 1LWEB 5B08A 2LQ9A 2HW3A 2A2DA 4DQSA 2CPZA 1VC6A 5KFUA 1IBMF 2DNOA 1JLAA 1HHSA 1FK9A 2J9CA 2M8HA 4Q43A 1M5KC 1N5TA 2VOOA 2B4UA 2IYGA 3KK2A 2C22A 4LFAF 3TR5A 3JSBA 4FNIA 1JLFA 3BSNA 3S6EA 2M4MA 5E3RA 4QZVB 4YB5A 2JL9A 2XMUA 2N7YA 2YNGB 4LVOP 2V4JB 4C8YA 4L3NA 2JHEA 4WFXA 2IHR1 5MAOA 4XIUA 2PFFB 1C1CA 2YNFA 2YKMB 1DTQA 2GC8A 2HPUA 4ZPTR 1VS3A 2AJ1A 2BZ2A 3H2UB 4TY9A 3TQ1A 4I4BA 1N4LA 3NMAA 5G4DA 3ZZRA 1VLYA 1YRTA 1U25A 3HVRA 2LLZA 3TUZC 5DGAA 1IQTA 2G1DA 5D78A 1M5HA 4AQYF 3JTPA 2H5EA 3G6ES 2V4RA 1GQEA 5C25B 3CDBA 4N56A 4ED2A 3E8OA 3QIPA 1S9GB 3MPYA 2HAIA 4ZMMA 3CCSS 2R2SA 3Q8QB 3CCZA 4IQMA 3OTOF 2BQUA 3M8RA 3K57A 4P7VA 5KFVA 1C1BB 2LDYA 5I3UA 4M94A 3KLEB 1X4CA 2EG1A 2WK4A 3IS9B 3VCDA 3VWSA 3GYXB 5AE2A 5KT4A 1NK4A 3G71S 3RB0A 1KQSR 3H98A 4NL5A 1SKSA 1N33F 3PW4A 4ALZA 3C2PA 4H54A 1RT7B 2PSZA 4CT8A 3DN9A 1TL3A 2PD1A 3Q8SB 2XMVA 1P9QC 2DNGA 4DX8H 4ZVGA 1NO8A 2DH7A 2J7KA 2KT5A 2FJAB 4CZCA 2JEJA 1GXUA 4KAIA 1HBNA 3CE8A 3OFFA 4PWDA 5K8NA 2KVIA 4M5DB 3PXGa 1TKZB 3DM2B 4DSLA 2OP5A 4PPDA 3GYNA 1UETA 3B82A 1FKPA 2YKNA 1MU2A 1VK8A 1JXEA 3MMBB 2VQFF 1R43A 1X9SA 3UCZP 4RZRA 1ZTWA 4RUHA 3TYTA 1NJIT 4U7UK 2B51A 4QR1A 4F02A 2DGSA 1S76D 2AJFE 1WHXA 3CMAS 4DN0A 4J9OA 2HNZB 3MM9A 3OW2R 5D6GA 1BC6A 4JV5F 1GXLA 3ZZYA 4F67A 1H98A 1YJNS 3PJXA 4I56A 3RAQA 3WC2A 4PUOB 1QLNA 4TU7A 3KNAA 2DGQA 4FVMA