4ES3A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
84
Chain Sequence
HMMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLNYKVEHIGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
molecule keywords BH0342 protein
total genus 21
structure length 84
sequence length 88
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es3A00
4M1KA 1N0UA 4ES1A 1ZM3A 4ZCIA 4MYTA 3B8HA 1N0VC 1U2RA 2BM1A 3B82A 1ZM4A 3UI3A 2BM0A 4ZCKA 2ZITA 3B78A 1VI7A 4TNOA 4ES3A 1P9QC 1ELOA 2XEXA 3EXCX 2EFGA 1KTVA 2BV3A 2J7KA 3LH2S 1DARA 1FNMA 1ZPWX 4FN5A 4MAKA 4QR1A 4QR2A 1T95A 2I0XA 2I8EA 2KDOA 4ZCLA 3E3XA 2CVEA 4QR0A 5G4DA 2NPFA 3ZZ0A 2E1RA 4ZCMA 4MYUA 3ZZTA 3ZZUA 2WBMA 4ES2A 2L9NA 1ZM2A 2IVYA 3OQ2A 1ZM9A
chains in the Genus database with same CATH superfamily
4ETZA 1M90T 3BBBA 2COLA 3H0PA 3NGKA 4HL9A 2O01C 2CJQA 3R6LB 1F2HA 1U26A 4NL5A 5I42B 3HT3A 2G0CA 3EXYA 3VWSA 5L1JA 2LXIA 4N8OA 2VJVA 2LA6A 4QWAA 3OSNA 3FBEA 3W9IA 2XULA 2BJ1A 2UUTA 3KK2A 1KD1T 2AP6A 2CPIA 2DXEA 1HQUA 1YDLA 1NBEB 1FRMA 1HW8A 4LSNB 2PSZA 4ZVRB 5EX3A 3ZTRA 8ATCB 4ER8A 2NXJA 3IA0A 2ERRA 4X62F 2HMIB 2AGOA 2IA6A 2FGCA 3ILLA 2XYHB 3GYNA 1NXIA 2NUUG 3ET6A 4C8NA 1T3NA 1BE4A 2J0XA 3ENWA 3GG1A 4ED4A 1CJTB 3PW7A 2KFYA 1B70B 1N5VA 4TQRA 3WC2A 1AA1B 1LFWA 2JNJA 4B9MA 4LF6F 1MSWD 2EPIA 2FYXA 3DDNA 4CLFA 3BS9A 4YR0A 2R7TA 2O1PA 1JJ2R 2GA7A 3HHNB 3MURP 3MF5A 1JK9B 2UUBF 4B3TJ 4DPTA 4MH8A 1KSPA 1TAQA 4YB6A 1C0UA 1KLMB 3TWZA 5F8GA 2VBWA 1NPPA 1ULRA 1DJ0A 5DG7A 1YJ7A 3IRWP 4XPCA 4PWDA 5G0RA 3A4TA 4JI0F 4CWBA 3EPGA 5A6WA 4FXVA 1L3UA 3AJ2A 4Y65A 1IBLJ 1MROA 4A8QA 2CJYB 1NKCA 1WHYA 2LP4A 2XY7A 5HMZA 4K4VA 2CQPA 4FNHA 4MK8A 3KHRA 1YJ9S 3V4MA 4UY85 2XGPA 1DLOB 5HBMB 2C42A 1B7FA 1TKXB 1UL3A 3QAEA 3DLKA 4EU0A 2V0NA 3ILOA 5CD4A 2CWKA 3A3PB 2MLZA 2WVCA 3ULHA 3ZO7A 3HMJG 5A8KA 2DR6A 2IYIA 3I32A 2WW4A 4A8WA 1JLBA 1X60A 2HVEA 2ZH9A 1FD2A 3M7VA 1UFLA 2QA1A 4KSEB 2Z2ZA 2CJKA 2KKHA 2V2VA 2CFXA 2ZH2A 5LMNF 2VOPA 1CQMA 2Q43A 2MMYA 1DTQB 1XR6A 3ILJA 5H9EJ 4DR5J 1EIYB 3EGNA 4LFAF 4K0KJ 2FGOA 1RDRA 1GMWD 4RUBA 1LW0A 2ZM6J 1Q78A 4CTAB 3KLEA 2ZHBA 1OPZA 1O51A 2AEJA 4B9SA 4CT9A 2YKQA 3RRGA 4IRCA 5D6GA 5KFBA 4K2JA 1FI4A 2ZH7A 4L76A 3FEXB 5LXRA 5LJ3Y 1RT5B 1ZTTA 2OELA 1C4AA 2HFSA 3BR8A 2J7KA 3DLEB 3RZAA 4X66J 1QE1A 2VONA 3AOBA 3DDKA 1U0HB 2F4VJ 3D3BJ 4ZVOB 3I5BA 3NP5A 4ZLPA 5M2PA 4ECVA 4JOUA 1TKDA 4DV7J 2VPXB 3MEEA 4NCAA 5IV4A 1GEHA 4OI3A 3HULA 1Q8KA 4NYPA 3DGVA 4NLTA 2JC0A 2POKA 5KG5A 2N7CA 4YHHF 2WOMB 1X9SA 2XMVA 3MM7A 3MM8A 2FVQA 1VBKA 1R43A 1D3WA 2JJ4D 2QLBB 4ANEA 1WD6A 3IWLA 5GADU 2X1AA 4HVZA 2AJFE 4CRJA 4WTYA 2UU9J 2IPOB 4DHVA 5SZTA 3KHGA 2GMHA 3GMGA 4M5LA 4QZVB 3ONQA 4KFBB 2G0IA 2WRMA 3QBCA 4Y2CA 3TZWA 1YKWA 4DS4A 1EHWA 1MROB 4HHJA 3QGHA 1RHMB 4OZ5A 1HD1A 2V6AA 1S4FA 3M4XA 2V4JB 2PO4A 3CDAA 2MQPA 1NEEA 3OJUA 4QR2A 2UXDF 4ANCA 2EFNA 1RWWB 2QLFB 3PFEA 4Q2LA 3JAMU 1NK6A 1HWLA 1NSQA 4QYZJ 1M1HA 3OXGA 3GR1A 2E1RA 2KVQE 5IWAF 1J5OB 2QMWA 4WJBA 3W2WA 1QVGR 1JXLA 1EETB 4RW7A 2LQBA 1GX5A 4PAAA 5HK4A 1N54B 3JYTB 2JLGA 4IUFA 2BBEA 3KJNB 5HJXA 5F8LA 2BKOA 2PN6A 4ZVEA 5KFHA 1NNDA 2ZNZA 3W1YC 2ZZMA 1VOMA 2XCPA 4IQXA 1DQ9A 2GO8A 4ATNA 1IKYA 3OBIA 2M9KA 1FWPA 3OR2B 3UDEA 4LF6J 2DIUA 1MNEA 3AQOA 3AHPA 1DQ8A 1I3OB 4P6QA 2VDHA 3MMBB 1KQKA 4CIOA 5T7LA 2QA4S 2V8HA 4JB8B 1BQXA 2J6UA 3K8VA 4B9UA 2DNOA 3JQKA 4R0JA 2W9BB 4DQSA 4P2SA 4ED7A 1QSSA 2GHPA 3HLUA 3MAHA 3O8WA 3MMCB 2QT7A 1GXLA 1SUQB 4FYYB 2ATCB 3GFZA 5G4DA 3TJAA 5KT4A 1JLAA 3OTBA 2XSFA 4RW9A 4QIWD 5FD1A 4F4KA 2PEHA 5FJ4A 3SCKE 2HWIA 1S1UA 2UZAA 4JI0J 1UTAA 2RQMA 1NDCA 2DD8S 3PJXA 3LWLA 2MGZB 3PX0A 3MPVA 3TYTA 3FRYA 2XCAA 2XLIA 3RB3A 1WC4A 2Z30B 3DCAA 2UUCF 3QJPA 1NM2A 1GK8A 5L1KA 1UEKA 2YNIA 2HZVA 3DLGB 5DRKA 2ZFHA 2BM0A 3MM8B 4Y2AA 4CLUA 4R5PA 3V6KA 4X4UA 1K44A 2RSQA 1RWKB 3CTRA 1Q5YA 4OJHA 2KXFA 3H40A 1T9TA 6FD1A 4BCAA 5AT1B 3KJVB 1MMNA 2SXLA 1SPBP 4G1PA 1EARA 2EKYA 1Q4RA 4IQMA 1FK9B 3A1YG 5LL6d 4DLEA 4A8YA 3PW4A 5KT6A 2IDEA 2W4DA 2WB4A 3D3CJ 4ZVUB 3CJKB 2VFTA 3FEZA 3RU0A 2B9YA 1S12A 2Z57B 2Y1JA 5DM7Q 2M3DA 2D3OR 1FRLA 3OTEA 2R7QA 3D54A 1HWJA 3TAQA 3CMES 4U6PA 1FJGF 2W25A 5K20B 1MWYA 1FX2A 1IR1A 2CNOB 5E0OA 1HBNA 3O5TB 4I7FA 1RT2B 5B0AA 3OL7A 4EI2A 1I5OB 2X3GA 4P73A 3HHEA 1KOOA 3MPWA 4PYAA 4DPYA 1VQNS 4CLWA 4M8LA 1NK0A 2HHHJ 3IAM9 4HDHA 4RZRA 2AYGA 3JAMY 4DR3J 2OKQA 2ZBCA 3IAS9 3HK2A 1UPPA 4PG5A 2AZ3A 3OFGA 2ADCA 4I0WA 2XNQA 3BZQA 4FP9A 5B0BA 1MMDA 2EI5A 2HVDA 3IG1B 3T6JA 4NA2A 4J9KA 3PVXA 4ID5A 2VFSA 4O3RA 3FMBA 2B3TB 2DK2A 3HHDA 4F2SA 1FERA 1LWFB 1Q8IA 3HD2A 2Y0BB 2FY1A 2B8QA 2UVUA 5HQ8A 1NCLA 1SL0A 3CVKA 2HFUA 4JI2J 4J9UE 2E1AA 1LW0B 1WTFA 2W2QP 3KG4A 4ZP6A 4WP9A 5T7LB 2WHOA 1XTZA 3TNVA 3ZNUA 2O3DA 2ZH3A 2LEPA 3CT9A 1WWHA 1KEKA 1XNQJ 3BGRA 3DRXA 3M8QA 3AT1B 3D7SB 1X4DA 4NMLA 4O4RA 4XO0A 4QU7A 5KFDA 2H48B 1S1TA 3GG0A 5T41A 4ZVSB 3GQCA 2AHOB 1U0SA 2HS0A 1Y4ZB 3JSBA 2IIHA 1RKJA 2CQHA 2E44A 4B3OA 1RAGB 2AX0A 4X65F 3MEDA 4ITSA 4P9SA 2KXNB 2C2EA 4ILMA 4F3QA 2DGSA 1YHQS 3LTOA 2Z2YB 2E5GA 2ROEA 2QSWA 2ABYA 3AXKA 5KG6A 4LRAA 2E1MC 4AFFA 3O1LA 4HACA 1NSKL 2Z58B 5E3AA 4ICLB 3THPA 4TU7A 4DR6F 2QTWA 4AXIA 3B54A 2MTLA 2QL5B 4U7UK 2RILA 2XO7A 2NREA 4URQU 4DZDA 2ZJRQ 2IC3A 2J7UA 2B51A 4A46A 2RHQB 5SUHA 5GAHU 4DV7F 5GMDA 1FNOA 1CJVB 4DL2A 4PKDB 2HNYA 1H2TZ 2VA3A 1EQMA 3UD4P 3MFHA 1IM6A 2JX2A 2M0GB 3K7RA 4FYWB 3P49B 3PHEA 1PBAA 1IKXB 1RI7A 4K59A 5KT5A 1VDHA 2C2ZB 3V6JA 2N7YA 1ZA1B 4HR2A 2UU9F 4OX8A 4OYWA 2XBPA 1JQGA 2A6MA 2DEJA 3EJMA 2HYIB 3E8OA 2ZBPA 2KT5A 2H65B 4Y3CA 3UW1A 3RW7A 1RAAB 2G2OA 4DR7F 2Z4PA 1SKUB 1RACB 3THTA 2IRYA 4B17A 1TMMA 3L4BC 3D28A 4Y2IA 2AW0A 4PG4A 2C2NA 4ED1A 9RUBA 2EWHA 5ETTA 3BV8A 4DQPA 3FC9A 3BQ2A 2QZ8A 2BR0A 4KHPJ 3FQKA 1RTHB 3FNNA 1AZSA 4NLOA 4YB1P 2GIRA 3NBPA 3AFGA 4KV8B 1P9QC 4EGLA 1IKWA 3CCRS 3T1HJ 1X4HA 1K73T 4LF1A 1F2GA 1AYEA 1WHWA 1N34J 2XMTA 2FHMA 4H4OA 1UW4A 2HSEB 5LT5A 1MU2A 3M32B 1OYDA 2RHSB 2JLEA 3I5CA 3NS6A 4KGZB 1FKPA 2VICA 4DR2F 2E9ZA 2B7BB 4OJ1A 3MDFA 3SIPB 2LQ9A 2QGFB 4K4SA 1T9XA 4DR6J 5DGAA 4NLQA 2YX1A 2HQIA 2ASLA 4DEZA 2E66A 4NLPA 3DLLQ 3ZNJ1 5IT0A 5KG2A 1IWGA 1NAQA 2YKNB 3N4WA 3HX9A 4HI2A 4KAIA 4YB5A 1F60B 5ETVA 3B78A 3CXCR 2VIHA 4PUOA 1C0UB 1KLMA 5JVGQ 3JXOA 4CO5A 3V6HA 2R7XA 2L3MA 1UETA 4KTQA 1D8YA 4N5SA 3EMTA 1R7IA 2HHXA 1MWZA 5KFJA 3N5FA 5KFYA 2MZ1A 3TI0A 2CQ4A 1AXQA 1IXKA 3K0JA 2Q3PA 5JVHQ 4LFBJ 3FMWA 2IRXA 1FT8A 2XI3A 2AJ2A 3N6MA 2YX4A 3P8BB 4ALZA 4AL7A 1FTCA 1HQEB 4HHUA 1YJVA 4MYUA 2MXYA 3VHQA 1YJRA 3QSYB 1G1XA 3CO9A 1PC5A 1JLFA 1Z2LA 2OMOA 1VQ9S 2NXUA 1HNXJ 3T1HF 1VC6A 4HKQA 4BWMA 5DG9A 4C8KA 2ASJA 2QIFA 5RUBA 3PNIA 3EWGA 4WFZA 1DAXA 2HNDB 1SVDA 1RADB 2DH7A 4XK8C 2W2MP 2VQFF 4HYKA 4MMOA 3R2CJ 3BKFA 4XAKA 2RT3A 2IMOA 4QWDA 4ED2A 1K0TA 3BBFA 4TY8A 4LSLB 2P2CB 2R2TA 2KHCA 4TQSA 2DHSA 3LUYA 5HQLA 2PT0A 3OXFA 3HPOA 4KHRA 2KT2A 4HI1A 2MQLA 2HRTA 2B5JB 3POTB 4G1IA 3PX6A 3J81j 5D0RA 2RNEA 1RA6A 4P2XA 1FDAA 3JQMA 3QIDA 4WZMA 4OZ0A 2RB7A 1S49A 1DY3A 4CLZA 2HMIA 3OVBA 3CJQA 4C3KA 3BGFA 1IBLF 4Q45A 1WOOA 4BBYA 3UR3C 4ZJOA 2F9JA 3I0RB 4MFBB 5CH7B 1FTRA 2VZ9A 4C0HA 1TL3B 1JLEA 2FJDB 1SI9A 1Q86T 3RBXA 4FF1A 4R8UA 1R0CB 2CPHA 1MLAA 3W2VA 1U0HA 3RRKA 3W7BA 1S0OA 2YWEA 4ECWA 4DSKA 4F8RA 4EBEA 1WHVA 1EZZB 1FESA 5CQGA 1M5KC 4DUZJ 1QSYA 4A8OA 1TTHB 1KHWA 1X4CA 2BACA 4NXMF 6AT1B 4IYQA 2ZBRA 1U2CA 3DOLB 2WSFC 3I0SB 5LSLA 2HFZA 1S9EA 2F63A 4FNIA 4ZHRA 4OYXA 3VZIA 3LANA 4AE5A 3KUEA 3MR3A 4IR1A 1Q7LB 1HBOB 4EK2A 2EKNA 3HP6A 4DS5A 2XYPB 2ZH6A 2C2RA 1IBMJ 3PRDA 2VQEF 4LF9F 3I55S 2V8VA 1C1CB 3LAMA 3OVAA 1DTTB 2A2CA 1N32F 3SSSA 4QWBA 2G9OA 2MSSA 1TKZA 2GFFA 1IKXA 2OLWA 5C42B 1FD8A 1RXOB 2B43A 4KGKA 4A4JA 4EMDA 1VS3A 3OFFA 2Y8WA 3MCOA 2YH1A 1X5OA 4NA1A 5A8WB 1P1LA 1FVQA 5DQGA 1S6PA 3D1HA 2W1BA 3FVYA 3TA0A 3MAAB 4OJ3A 3CJ4A 3SDEA 4XPEA 5A76A 3VQTA 3HSZA 1TV6A 1QAYA 1SXLA 4LJMA 4C6AA 3B4DA 2HBZB 4DR2J 3FCHA 4RNOA 1RLDA 1RT1B 2EBGA 3MM5A 3T9ZA 3CCMS 2NZ4A 2D9PA 4RL1A 3GYGA 1E6VB 3N0VA 2J9DE 1Y3KA 2W01A 1QVFR 4M5DB 1S0MA 1UJ4A 3VZHA 4J7CA 2VOOA 2IJRA 1AB8A 3G87A 1QTMA 1YJNS 4PZVA 3W8GA 1D09B 5KFKA 4FZVA 2R7VA 1FNMA 1VK8A 1I6JA 1VQKS 5CYQB 1SJQA 5IOLA 3QJLA 4TU9A 2YKMA 3VAJA 3CJTA 5GAHI 1HFEL 2XM3A 1ZPVA 1S1VB 3BPSP 3ZZ0A 4LBHA 5AE3A 3H90A 3D6FB 2F8HA 3CCZA 4M94A 1HPZB 3MZIA 4TYAA 2NSCA 3LOUA 5BYQA 2XHCA 2LA4A 2X51A 4WF9Q 2FVPA 2G2YA 2OSQA 2GHVC 1VCTA 4RNNA 1NK5A 2J6TA 2KVIA 2OEKA 2HFVA 2ZJQQ 3TAMA 2VG5A 4Z2XA 4I67A 1FWKA 1SKRA 3N5BA 3OW2R 1N8RT 5B0EA 1CJUB 3LP1B 4KKOA 3TZXA 2CUYA 5HVFA 4G6VB 1HBOA 2NYIA 2WB1D 3ETOA 4WBFA 4OX6A 5KFWA 1RUSA 1WHXA 3GFHA 4XDDA 4KFBA 3QNWB 1QAXA 2XY6A 5KFZA 3AJ1A 4Y2MA 4ECZA 3ISZA 1HNIB 4LVNP 4NZ0A 3J81U 1PAUB 1V6HA 5GAEI 5CZVA 2O66A 3ICLA 3MECA 3NWGA 1PGZA 4LFCF 1AW0A 1LKZA 5I3UB 4MKVA 3MOJB 4IFVB 1IBCB 2J5AA 2VDIA 3M2RA 2AD9A 2NCKL 2VBZA 1IWAA 3TW0A 3C14B 4X4VA 3WX4A 3OJSA 2CQ3A 4A8KA 4ECSA 1MN7A 4J9SA 5KFEA 1N0VC 1PAEX 4ZVFA 2CKWA 1TUWA 2AWZA 4O44B 2CG4A 1TKZB 1NDPA 2J7WA 3QPIA 1KQGB 4ZPWR 3MPDA 1HR0J 1HMVA 4KB7A 2HLUA 4KO0A 2MQNA 3K5LA 4C3LA 2GHWA 1ZAWA 3K59A 2ZJPQ 2QSFA 2RAQA 4RX6A 3GFYA 3MEKA 4I6WA 1D0EA 4LSLA 5KFGA 5GAGI 1U02A 2H5JB 4O23A 4UT4A 3QZ8A 2FHOB 5KFNA 1Y5NB 4QPXA 5F8IA 2AQ4A 3M8SA 2IM3A 2EG1A 2HK2A 1WF0A 2DXDA 3G8TA 4ZN1A 3ETMA 2Z0GA 1R27B 2QL7B 2ZHOA 2VQFJ 2W24A 2W4PA 3ZTSA 2CNNB 1RHRB 2XZDB 3AAWB 5DM6Q 2W9BA 4MYTA 4X64J 1WC1A 1DRZA 3W60A 4ENOA 1V3ZA 1H73A 1KFDA 4WFYA 5HAOA 1X4GA 2ZOGA 1S1UB 2XMUA 3GE9A 1B0PA 3GP9A 3CJ8A 4L72B 5ETMA 3TOQA 4CT8A 4N56A 4Q0BB 3KOAA 1FXLA 2CPDA 4ZMMA 4DR1F 1K9MT 4X2BA 4IG3A 3SCLE 3I4HX 2I9SA 2MKHA 3MPUB 1Q53A 4RUCA 4E0DA 4QYZK 1HD0A 2UUWA 4WIIA 1L5UA 2G0JA 5HO4A 3MEDB 1H72C 4LF9J 3TA2A 2YY3A 5AXLA 4B9VA 1Q8BA 2I0XA 1RHJB 2HVIA 2R7UA 5IT9U 4QR0A 2PA8D 3SCIE 3V6DB 4W90B 1FO1A 5AXMA 2ZH8A 1SL2A 2K7JA 2RUSA 3P45B 3CUNA 1PKUA 1RWVB 4QYRA 2L08A 3G2XA 5KFXA 4AT1B 5D3GB 4NX9A 1SBRA 4Y0FA 3MUTP 1XEZA 2ZOMA 2DIVA 3GCWP 2R7RA 1LOUA 2CA9A 4HDGA 1SKWA 3J80Y 2HHTA 4IR9A 2Y1LB 3D68A 3QGIA 2V8GA 4J91A 2H1YA 2RKIB 4UW2A 4QWCA 3OL6A 2KRBA 3RGIA 1IJFB 2Q79A 2QJ3A 3MHYA 2F8EX 3LP0B 4HLBA 4XTTA 4DL3A 3MECB 4O44A 4ZLNA 2V63A 5LJ5Y 3OL8A 4P71A 2VUGA 2HGLA 4NLXA 2RDJA 4JI2F 3I82A 4BWJA 1FEHA 2K3KA 1NHKL 5ETRA 4DV5F 3RBDA 4GO5X 1J5EF 1Q95G 2AZ1A 3CD6S 3N28A 3C16B 1IBMF 1LWEB 3QT5A 5ETNA 4F4AA 1IBKF 1UVJA 2IJNA 4WU3A 3C6TA 4F3MA 4RNFA 4DF4A 2QV6A 3UQSA 4DPWA 4Y34A 5D4PA 3ZZPA 2XMMA 2M88A 3CSKA 3UR0A 2LVWA 3HJVA 2RS2A 1YJUA 4Q8FA 2J9EA 4OYPA 3K2YA 1B3TA 2J6SA 1CEZA 5IS2A 2HBRB 2CZ4A 4FPRA 1UPMB 4H4MB 3T5HA 1U2FA 4GC6A 4JV1A 3BEGB 4PXDA 1XMOF 7FDRA 1Y3JA 2W7AA 2ZZTA 3IC1A 3T3FA 4OI0A 1AFIA 3G71S 3SQGA 4EZ6A 4DPOA 1U6FA 1VRQC 2Z2MA 1SUQA 3IGVA 4OZ2A 2F7VA 2PMZD 2AIRB 4AXJA 4ZJQA 3PR5B 2V9WA 4AL5A 5DDOC 3OTOF 4ZP7A 3R6GB 3G86A 3MR6A 3K57A 1Y9OA 2DR7A 2W8LA 1YI2S 4DV0F 4JI1F 2KRRA 4OYOA 3LALA 2HFOA 3ENVA 4IG0A 5CCLA 5K8OA 1X4EA 2MKKA 1BWVA 1HARA 5FDLB 4JI8F 2DNQA 4NXNJ 5E7OB 1S57A 1IR2A 2ZNYA 2KL8A 3TX0A 3OT9A 4Q43A 2LLZA 1PO6A 3IS9A 4C98A 4C8OA 3KLGB 4IRDA 1K8AT 3B82A 3NOCA 4WWSA 4F36A 4ZK7M 4LQ3A 1M1KT 2HG4A 1KR4A 4D3GA 3R7BB 3WHIA 2BQUA 2OGUA 4DV5J 5J1NA 2PIIA 3WDOA 5ETLA 4USJC 2XLJA 4JI7F 1JNZB 2DNRA 3FBCA 3CJKA 2IC3B 3OVSA 2I1RA 1IR0A 2J8AA 2YPZA 1OPIA 4G1QA 4WTOB 1S9EB 5KFRA 1D9AA 1M5HA 2EW9A 2MZJA 2VC1A 3IM8A 1KTQA 3HHKA 1IQZA 1QM9A 1WOSA 4NLSA 5A8RB 5DETA 3EZ5A 4NRUA 3HHLD 5HLFA 3FGVA 3GB0A 2VPWB 4CH1A 1VJWA 3HO1A 3I9V9 1CG2A 2XZTB 3OHAA 1TMJA 3K5MA 1RHUB 3GIRA 1DQAA 1HBUB 2EC0A 4CYUA 2HZAA 1KHVA 1OY9A 4I2PA 1CSJA 5A2QY 1TK8A 1R89A 3BREA 3PYEA 1RK8A 4RJVA 1R8CA 3CCES 3JYTA 3CDWA 1Q7YT 2JRSA 2J0SD 4RWWA 5A8KB 4DSLA 2MDAA 3QGPA 5KFCA 4C8ZA 2N3LA 2JC1A 3E2EA 1HW9A 4YEAA 4JV5F 3F41A 4KGMA 3SXLA 4AQYF 4C0BA 1VQPS 2QLWA 2R3VA 4GKKJ 1B64A 3LH2S 5KFTA 2G1HA 3M6WA 4DR1J 4EO6A 2CNKB 4NI2B 4ETXA 1G7CB 3BBCA 3R5GA 1CS4B 2RF2B 3KK1B 2XY5A 3ET6B 3N79A 1HNWJ 4FS1A 3QJJA 1UKUA 3P5BP 3AY0A 4OYBA 4QQBA 3OHBA 2ZE2B 4M1KA 1CQNA 3KKFA 3NKYA 4ZPTR 2C3MA 5M2RA 3WX8A 1RTDB 2DPIA 3CCWA 4O0NA 3MXHP 1UA1A 2QC3A 4M5GA 3Q2SC 2DTJA 2IBOA 3DLEA 3I0RA 4MFBA 4IFYA 3TARA 3O6QA 4KIAA 2DYAA 3CD5A 5KFMA 3FEYB 3UD3P 1HPZA 3JTNA 3M2VB 4F3OA 4K0KF 1FWLA 3MWBA 4KH1B 4OZLA 4OYZA 1SC3B 4DX8H 1IN0A 1R8HA 2GO9A 4DR5F 3RRHA 1KONA 2R8IA 1REVB 2FIUA 2I5JB 2Y0SD 4Q5VA 2O5DA 2BE7D 2BXJA 2BANB 3OTCA 4MK9A 3MAQA 2FLOA 4CLTA 1VRUA 4U7CA 1FVSA 1V9OA 4HACB 4X84A 1K0VA 1FDDA 4MT1A 2ZC4A 1N48A 1U6ZA 1N6QB 1H2UX 5D4OA 3ZZYA 5AE2A 3CCJS 1XR7A 1WI8A 2EEYA 2B7CB 3TP2A 4ES1A 3BQ0A 2PFDA 4OYAA 1PCAA 1WDDA 4I1TA 1DHMA 1UWBA 4NYZA 3QT7A 2M8HA 1JLFB 5E2QA 4F2RA 5J2QA 2VFUA 4LQ9A 4IO9Q 2V8DA 3M9MB 3V81A 4F02A 1RSCA 1VIOA 3TUJC 2YWKA 1S97A 3PRBA 4QU6A 5I3UA 4J9MA 5CD4H 1KRPA 1APSA 3HCXA 5E3CA 1YRXA 4TYBA 5HROB 4ECQA 4FF3A 4ZP8A 2OD4A 2HHVA 5I42A 2JVRA 1HBUA 4CH0S 1ZZFA 3CW2C 4M5MA 1SQGA 1I94J 4I69A 4NCGA 4DG1B 5HMXA 1CBKA 1FE4A 2N3OA 2OTJS 1IKYB 1YBUA 2XMJA 2VL1A 1SQFA 2OPSB 3EZOA 3M1VA 4PG8A 4NI2A 3RB4A 4OLOA 1NK8A 5CXTA 4A8FA 4W92B 3R5JB 2QYGA 2MQQA 5K5MA 2A2DA 3MM5B 1KOHA 3I4PA 3ITHA 4TY8B 4WK3A 3SFUA 4DUTA 3CCSS 1R0AB 2JOQA 1WG4A 3MMBA 2G2ZA 4RNHA 1NLKL 1J5EJ 2OEMA 2H5IB 2WW8A 4CLKA 4C0OC 1RTIA 3OSPA 4NXNF 1LWCB 4OI4A 1JJCB 1PJ5A 4OMFG 1Y5IB 2PDAA 3VAGA 2W9CB 3VGVA 4FDFA 2QFJA 2QLJB 3J7YI 2H4YB 3PEHA 5F8HA 2CPEA 4DZ6A 1VBXA 4LF5J 4LIWA 2XMKA 2Y9HA 1BWEA 3J7AN 1HNZF 2DGXA 1N5YB 4R8UB 2FB0A 2M5YA 3L95X 4KY3A 3G9CA 2R2RA 3PIOQ 1FKAF 2IFXA 4A47A 3CJRA 1HA1A 1RT3B 2RJZA 4IFYB 2R9LA 3M6XA 1VRUB 3AD8C 3NCRA 2BKNA 1EP4B 1U1OA 3T1YF 3BR9A 3KG0A 1W26A 3O2IA 4C3MA 1E6YB 3QAUA 5ADZA 5J1EB 1B0TA 2FQQB 2I6WA 1REVA 2I5JA 3TVKA 4O0IA 2ZITA 4KKOB 2FLNA 2QX0A 3CWJA 1M0SA 4KBIA 3ENQA 1AROP 2D74B 5HATA 4YMEA 3DRPA 2KH9A 2BQRA 2OTLS 3MR7A 4C97A 3NCQA 2WONB 3H4BA 3Q0AA 2EC2A 1JKHA 3C46A 3BSCA 3LWMA 2YKAA 1T11A 3NNCA 2PI5A 3DLBA 1VBZA 4WFAQ 1QTNB 2GJFA 5J2PA 5IM0A 1WUUA 3RB6A 1S6UA 3HSGA 4NLVA 3U1MA 1NH7A 2WVDA 3GWCA 3JSRA 3V5RA 1QAIA 2C3PA 2GJIA 2KI2A 2V94A 3C14A 3HHLC 1O8BA 4BS2A 4JI4J 1JLCB 4RW4A 1OS5A 2J9CA 3DM2B 2P6SA 5KG1A 2X1BA 1T9UA 2EFPA 4A8XA 2OPRA 4DUYJ 4K4WA 5ITHA 3KHHA 3OL9A 4ED6A 1G3OA 1H6KX 2FHKA 2J76E 3GZ7A 3AD7C 5BJRA 3SBMA 3MR2A 4LMZA 1F1BB 2DHGA 3UDVA 2DVIA 2PI4A 2Z8QA 1VBYA 2HNZB 2E5HA 5DQIA 3K8WA 3KLEB 1U1RA 1H38A 4FYDA 4PG6A 4O3SA 3I56S 4CM2A 4JI3F 3DNCA 3VGSA 3PW2A 1N33J 2EK6A 2LEAA 2MKJA 2VC0A 3UDCA 4UQTA 3V2UC 1NDKA 1RAOA 1WKLA 1N5QA 1T0TV 2B9XA 3KJFB 3ZFVA 1G2EA 3TZZA 3GV5B 2CYYA 2P5VA 3DRSA 1UEVA 2IAJB 3UO0A 4AQYJ 3PHTA 1OSDA 1S79A 1SH0A 3QATA 4OX9J 2GIFA 3BYPA 4AUKA 2FJAB 3HKWA 2MGZA 1ZYQA 1LQ9A 3W9JA 2W9CA 4OYIA 1N56A 3FBFA 4DFPA 1TL3A 3OD2A 1RHQB 5AJ3J 1FXRA 1V3SA 3R5BA 5GMEA 4JI5F 3TA1A 2VBXA 4ZPCA 2JEGA 4AL6A 3D0GE 3QGGA 4QIGA 5KFIA 3KYLA 1CVJA 3PZPA 1RWOB 2VPZB 3IN5A 1HNVA 2KM8C 3H5UA 2NLWA 3AOAA 4I68A 3CD7A 2DISA 1RCXB 2DHHA 4P52A 4WK1A 3MMJA 3BO2A 1H98A 3UNGC 1FEEA 3I0SA 3H4DA 2HZCA 2HNYB 3CMQA 4OHWA 4CO4A 3DLHA 4WP8A 2AT1B 2VBYA 1CJKB 2ZH1A 5F0UA 1SIZA 3M6VA 2HHSA 4CO2A 5KOXA 4KC5A 3NGUA 3US5A 1PBUA 2W2OP 4ZPBA 4M5KA 3W5XA 2OEJA 2XQCA 2DBBA 2ZUGA 1FNXH 4FF2A 3DM2A 3EICA 4QIEA 3M2RB 2YNFB 2AGPA 4B9NA 2XS5A 2DGWA 1FFGB 1PIEA 1HQ2A 3PG9A 3PYFA 3PJWA 4UF4A 2EFVA 5BXIA 2VPYB 4LFAJ 4EBCA 1TP7A 1A9NB 2QA4G 1RT7A 2LYVA 3DLJA 3GIJA 3T9NA 4DL6A 2BQ3A 2FLPA 3D9BA 3JQJA 1IUJA 2P9CA 2V5HG 1JJ4A 2GVDB 4W98A 2MZSA 4YDXA 4CNYA 1AUDA 4K5RA 3M8YA 2RU3A 1F9EB 2B4VA 4LR9A 1X5TA 2OPSA 1X8DA 3JS9A 3NG8A 4O3PA 3W65A 3KMQA 1C1BB 2A6OA 5LOQA 2FZGB 3AOCA 3BN7A 4L74A 5E3RA 3J7ZT 2IAJA 3BN4A 2NR0A 2C1EB 1SC6A 4LSNA 2YQ3A 4RW9B 4DDFA 1RWMB 1WG1A 2FC9A 1S1XA 4YS2A 3KMSA 1T7PA 4ES3A 4WPAA 3TUZC 4Z7YA 5K9FA 2UP1A 4FKYA 2OP5A 1JB0C 1SV5B 5LMNJ 2OHDA 4FVCA 4S0MA 2V2KA 2PD1A 1EAYC 2DY1A 2OPQB 3S01A 3W2VB 4XIUA 2ZWPA 4FYVB 2LQ8A 1U6BA 4H4KA 1Q79A 4ZVGA 2JEJA 2N4CA 4DL7A 4PUOB 3OR1B 1YQHA 1A7GE 2HGNA 3CB4A 4IH7A 4M5JA 1N52B 4DJBA 4L3KA 3TAMB 3CDUA 4V1Ak 2BABA 4PPDA 4FVMA 2RRNA 2EG2A 5L39A 4USHA 4NLWA 2J9DA 3DN9A 1FRXA 1HNVB 3E01A 2LECA 2QYCA 1ZH5A 1U1QA 3W9HA 1U1MA 3M05A 3N6NA 4URGA 4PRFA 3NXZA 4RLEA 1OQ3A 1EKRA 1X31C 2CQ0A 4PYDA 2V2QA 1JMTA 1VR6A 4WIQA 2UV8G 1HNIA 2BW7A 4DL0C 3CCQS 1HIYA 4ED0A 4ECRA 1X7VA 2JH3A 4RKUC 3UFCX 2B6AB 3MMAA 2Q66A 2C3YA 1NHVA 2KB2A 4N41A 1UVKA 2JWNA 2VF3A 2YH0A 3VV2B 1J27A 1M5OC 5DDQC 4P2MA 1J5OA 2XMAA 3HSDA 3K5OA 4LR7A 3DLKB 3W66A 2E7WA 1O5JA 1HLWA 1WEXA 2XS7A 5CAAA 4A48A 1TVRB 4A8SA 2RE1A 4DLGA 1TV6B 3OTOJ 4CNZA 2BYCA 3JSYA 3QZ7A 1HI8A 2UXDJ 2VFVA 1KDNA 3BGOP 2CQDA 3DRYA 4ZIWA 4DV0J 2CQIA 1HI1A 3P3DA 3POTA 2R8KA 4Q44A 4YQWA 2HHWA 1HWIA 1AUSL 1QUPA 4DF8A 3BDEA 4K50A 2HAIA 3U7JA 3NGRA 3NLCA 5F9LA 4ERDA 1N36F 4DMZA 4M5NA 2G4BA 3LP2A 5I4MA 1FJEB 1RBLA 1Z4UA 4L73A 1RT5A 4DN9A 1FJCA 3M2UA 3MM9B 4C4WA 2F40A 2GVZB 4DCPB 3ZXWA 4F67A 1D9FA 1TK5A 1XERA 3CIMA 2EBEA 1XC9A 2MYFA 3AB4B 1NMEB 3QO9A 4TVAB 3W8PA 1RGVA 1UFKA 2AEMA 2LU2A 5KAKA 1UA0A 2MB0B 4HH0A 7FD1A 4K5SA 4ILRA 4M5IA 1BQNB 4NLDA 1JXVA 5D78A 2LXFA 4IKAA 4MKAA 4RR5A 2EVZA 2ZC3A 4EUVA 1T05B 4ZCKA 1TL5A 4FBTA 3IFEA 4IG0B 2JEIA 1SC4B 1PYSB 3EVWA 2IJFA 3JTPA 3M8WA 4PCQA 5KFQA 5B09A 3KLGA 5JUMA 4J9QA 4GKKF 1Y7PA 2V34A 4FN5A 2BJ7A 3Q8UA 2ASYA 2BUNA 4EBDA 1DBDA 5D4NA 3IS9B 3KG1A 3BH6B 2CAJA 5E5NA 4ZCLA 1EP4A 3G96A 4ECXA 2NPFA 2IVFB 2FHJA 1S6QB 2GS8A 4LF7F 4YY3J 1FKOA 2HHHF 3KUHA 2JEFA 3GPAA 4LBPA 2FVCA 1SH2A 2UUCJ 3DXBA 3MEGB 4GVBA 4LUBA 3SV4A 2XB2D 4QCLA 3EVOA 4J90A 3B4MA 4FXWA 2Q6BA 4NRTA 1RE1B 2KHDA 2GMJA 1ZM3A 4Y2KA 1HBNB 2NXNA 1ZAVA 3B8HA 4YB7A 4ZPAA 5AE1A 4ECTA 4UUWA 1WC3A 4Y00A 1VQMS 3O44A 2F8MA 1OYEA 1YX2A 2YWFA 4MJKA 1BHNA 2FUG9 3PXGa 5JMNA 5LMUF 5HN0A 1U4BA 1NK4A 4J37A 1EETA 4RW7B 5M2UA 2RUGA 4JYAJ 1RT6A 1QLNA 4PXEA 4K2XA 3HVRA 2PMHA 1VQYA 3PACA 2UVWA 4OFZA 1MMLA 1N5SA 3QT6A 4UY8T 3D1QA 2C3UA 3HJFA 4L6V3 3DMJB 2A0FB 1BXNA 2LDYA 4X4QA 2DJWA 1HQUB 3KLHA 3Q22A 1HHTP 1JJHA 3VVTA 2NUHA 4OLPA 2N4DA 2O67A 5KG4A 3AA9A 1IKWB 3TRGA 3WIVA 4HTIA 4DQIA 3DDIA 4WYLA 2CVIA 4DFJA 2CQBA 2B5JA 3BGLA 1P1TA 1TU0B 1L3KA 1X4FA 1XBWA 4M5DA 3M2UB 2DR5A 3JB9k 3M8PB 3UN2A 1K1SA 5IQ6A 2FZCB 1IM4A 2KFNA 3LPEA 4YUDA 2D3ZA 5DJBA 1GXUA 4CI0B 5H9EK 2E5LJ 3SFGA 3QO9B 1Y0HA 3MM6A 3TJ9A 3OUYB 2DNNA 3RG6A 4EYHB 3PY8A 2KO1A 2V67A 3HHLA 2CDRB 4YR3A 1YSJA 5F3ZA 4B3MJ 3D5MA 2V69A 4J9RA 3FDSA 3WZ0A 1S1VA 3DI6B 1ZPWX 4UZCA 4MAKA 5DS7A 2DNGA 3IP0A 4NLYA 4ZVPB 3HF5A 2Y1RI 2ADBA 2KZMA 2KDOA 4B9LA 1TL1B 4BC9A 3W61A 4WFNQ 3J80U 4RUHA 2CIMA 4GO7X 3KJVA 4NMXA 4QBUA 2KJWA 2ZUAA 2DNHA 3OXLA 2R4FA 3EUNA 5EWFA 4NLRA 1FFWB 2YNIB 3PRVA 5HQMA 2YNHB 1N88A 3GTYX 3H7HB 3M8ZA 1VISA 1NK7A 3TZYA 3R27A 1OY8A 2LU1A 3FCWA 4F0MA 5KG3A 2QRRA 3A8EA 3FUYA 1URNA 4OI6A 3R5DA 3M30A 5IT9Y 2ALYB 3PKYA 3HFVA 4J9OA 3OFHA 4FXDA 4V19X 4UOCA 5U47A 2BV3A 2IMWP 4C48A 2MLXA 5D0HA 1F0XA 1FFSB 4DOZA 2DCLA 2B6AA 3MMAB 4F04B 4NZ7A 2RS8A 5GADI 4K4YA 3E3XA 1ROFA 3BO4A 3KNAA 3J7Z5 2MLYA 1U24A 1WC5A 1R6VA 1WKJA 3BF4A 1HMVB 2FHJD 2BX6A 2DNMA 2HLTA 4DV3F 1GNKA 1QD1A 5ETKA 4USKA 4JP8A 3DOMB 4ZA1A 2OSRA 4HT7A 3QWUA 4ZDNA 1VQ7S 1REGX 1D8ZA 2WVEA 2OI2A 4GRSA 4C7QA 5D15A 3KLFA 2HQCA 3LAKA 1DTQA 3D67A 3QYYA 4LFCJ 4LF4J 2XNRA 2FC8A 4DV1J 4YN3B 5T14A 5FIIA 2F4VF 4ZN3A 1WOPA 1X9WA 4NASA 3R2DJ 5CA5A 4DU7A 3JTOA 4LF5F 2BA9A 4O3NA 1U1NA 2OIHA 2GGPB 1A6LA 4RBVA 2CJ9A 2MQOA 1YLXA 3CDEA 3KK3B 1MW7A 5DQHA 4ZVTB 2K2PA 2Z2LA 1O0PA 2ZEJA 4U96A 3NAHA 2QG9B 1LWCA 1KKHA 2YQ1A 4YDDB 1D9DA 4UTGA 4IG3B 1O6XA 1PSDA 2GV1A 2Q6CA 4LRFA 4P10A 4DBQA 3FSIA 3OUYA 4KPYA 3IO1A 2UVVA 3AODA 2E9RX 2KFZA 3HVTB 1BQMA 4CLYA 4DPXA 2Q1LA 3U1NA 4ECYA 4G3IA 1UMJA 4LFBF 2HWTA 2WOMA 1RT3A 2EK1A 2NS1B 2XWXA 2YNHA 2R2UA 1S6OA 1I1GA 1FXDA 4RO0A 2YKOA 1YWXA 3DOKB 3DKDA 2HHPA 1VHFA 3KXDA 3PW0A 1E6YA 1T3OA 4ZIVA 5DG8A 2C28A 4WU2A 2FJEB 2BANA 5IC4B 4QR1A 3MI7X 3U27A 3PIPQ 3Q8RB 4DV3J 3G6VA 1C0TA 4WE1A 1IQTA 3VR1A 1UVMA 5DDRC 4RW8A 5F8JA 2W4CA 1NPRA 2QMXA 3P6YC 1TKTB 4M63A 3LQVA 3D2WA 3FBBA 2DH9A 3NNAA 1VGYA 4X65J 2UUAF 1ZTWA 3W63A 3HT0A 1UWBB 2AEFA 1ZM9A 4B02A 4DPUA 5HMWA 1WF1A 3Q8SB 3MUVP 3G4SS 4J5OA 4OZ1A 4ELTA 4ED5A 4OI1A 3C66A 3K5NA 2ROGA 2B4UA 5K14B 5KFFA 1R8PA 3PKMA 1TUVA 3L9ZA 3GFXA 1WEYA 3D6HB 3RBZA 1RAEB 2ZM6F 3PYDA 3CULA 3T41A 2ZKUA 2FJVA 4U67Q 2DY9A 2FZKB 4DV4F 1S7IA 2MEWA 2BJ3A 4IH5A 4CLLA 1CULA 3HVAA 3S7RA 2HNZA 4JYAF 3HD1A 3HZGA 3NS7B 4RW6A 5HSPA 3RAMA 1S1WB 3ADAC 1B0VA 1YZ6A 2CPYA 3BGUA 3LO3A 4B08A 5K8NA 8RUCA 3FZ2A 3KTQA 2CG8A 4DSJA 1BC6A 3EVMA 5JJBA 1QJHA 1RP5A 1DURA 1SCJB 2ZDPA 3BH7B 2F3JA 2MJNA 2AV5A 1ACMB 3NWRA 4GMKA 4IH6A 2W2PP 1XMQF 3IBCB 4MIAA 1M1GA 1JLEB 2DNLA 4RU2A 1VLYA 2H3EB 4YP3A 1IKVB 3V4IB 3R1LA 2CQCA 3G6YA 5EHHA 1N5YA 2MKCA 4UOFA 3G8QA 1R6YA 3UWTA 3BO3A 1VQOS 4NCBA 4N77A 4TY9A 2V9KA 2VQEJ 1S77D 2ZVSA 3LGMA 3KFWX 2MQMA 5KFVA 4DU8A 2HQDA 2FTRA 3L7PA 3IGNA 2D3O1 2GAGC 3AH6A 1KQSR 2CPZA 4O4GB 3UCGA 3H2VE 1N5TA 3G6ES 2J8SA 4DR3F 1HYSA 4L75A 2HPUA 1RAHB 4NZ6A 3RR8A 1FK9A 4G65A 4LF2A 3M30B 4PPZA 4USWA 3UVJA 2LCWA 4BHQA 3S8SA 4X4PA 5CYJA 2VU5A 3R3TA 2D41A 2KXHA 1YGYA 9ATCB 1TKTA 2IRUA 1DZ5A 2IM2A 4F4WA 5DO2A 5J2PB 1RABB 4R0EA 3C15B 5C42A 5KT2A 5DDPC 3CC7S 5L1LA 1YJTA 4CQ1A 5EN1A 5B0DA 1TZ0A 5J2QB 2P9EA 2YXLA 4LRCA 3OLAA 2YNFA 3PCOB 1UP1A 2XMWA 2MKYA 4JI7J 1NSPA 1CULB 1PJ6A 4OZJA 1M5VC 1TR0A 4DCJB 4EFAC 3EZUA 1ZA2B 5KT3A 4OHZA 1BGXT 1XMQJ 1RT7B 1DFDA 3I96A 4I64A 4KT0C 1S76D 2RH3A 1ZZNA 1FX4A 3MFIA 3L3CA 3Q2TC 4CO1A 4YFUA 2R7OA 4IDKB 3TVYA 1GTHA 4BLGA 2BW2A 2CJBA 2NQPA 2RF2A 4E98A 2Z56B 2N82B 1HNXF 3EGZA 3AB2B 3DC2A 3FFIB 2I2YA 3S1TA 1IJEB 1U09A 2ATLA 4X4TA 2EFGA 1A0OB 2FJBB 2RD5C 3RW6A 2VG6B 3EM1A 3O3LA 5CYQA 1P9YA 5KFLA 3RB0A 5HJYA 4K4UA 1T03A 2YPYA 2MKSA 2DO4A 3H5SA 1UCNA 1RTDA 2GVZA 4J9LA 3GYXB 2MQ8A 2A3JA 2WK4A 2E1PA 3HHLB 4USIA 3BGRB 1NRKA 3M8QB 2KTQA 1WI6A 2Y3YA 3ISNC 4I6AA 3TEGA 3TVZA 2P6TA 7AT1B 4UZBA 3CC4S 3QWPA 2UXCJ 1CPZA 1GTEA 1IKVA 3V4IA 3W62A 3H25A 2UUAJ 3JSMB 5IC6B 1NDLA 2H9ZA 5MAOA 3R1HA 1TL4A 2P8IA 3EDQB 3DOLA 2VKZG 2OMLA 4ZVQB 4ED8A 3BJYA 3GR0A 4HEA9 3OR1A 3MEEB 3SV3A 4LBIA 5IZHA 1RBOB 3D0HE 2J0WA 4H4KC 1F3VA 2CADA 2XEXA 2DR9A 4DSIA 5F3TA 3Q8PB 5C25A 1RZMA 3DRRA 5KFAA 1VQ6S 3D6TB 3PTWA 4USMA 3VTIA 1JLQA 2AJ4A 2YNGA 2JDJA 2R8JA 4IRKA 3QQCD 2XS2A 1S48A 3CDBA 3PX4A 2K06A 3LP0A 4IFVA 3NY0A 2NPIA 4DV4J 2E7VA 2V8PA 2K3IA 3TUPA 1NPKA 3I5AA 1VYAA 3OQ2A 3R9LA 1UVNA 3A8KA 3TX8A 1NZAA 1NB2A 1JLGA 3NEKA 4BC7A 4X64F 3KLVA 3D6MB 1H7XA 4M95A 1RT2A 3UPFA 4MTPA 4N76A 4I2PB 4RW4B 3TQEA 2NXEA 1DTTA 4X62J 4RWXA 4Q8EA 3F44A 5A0YA 2BMBA 4FYXB 4WP3A 1U1PA 4ILLA 2AJQA 2HQFA 3BPDA 1W2IA 1RISA 1PYOB 3A3OB 3VF0B 4USVA 3DXSX 2GVDA 3MPYA 4KGVB 1S72S 1XNQF 2U1AA 1OQ6A 4LRDA 3T1AA 5L8RC 3RTVA 2DXFA 1S9GB 3QIPA 1X4AA 3CCUS 3PV8A 4ZS6A 2MZQA 3DU6A 3ZZTA 1OWXA 4ELVA 1M5SA 5IQQA 2RU9A 4YR2A 3OR2A 4IDKA 1FE0A 4LRBA 4CO0A 4USTA 1RTHA 2VG7A 4X4OA 2IY5B 1B7YB 1FKPB 2FVRA 2MPUA 2HHQA 1TFWA 1R8AA 1UZDA 2BZ2A 3UE2A 5H9FJ 4CZCA 4FS2A 1XK8A 1Y11A 4DX6A 1KVJA 4H4OB 1ZETA 3R7SB 2APOA 1U8SA 2ZVIA 2YX7A 1TUGB 2XC9A 3HM9A 1EQ0A 1BMQB 4Y28C 4IOAQ 3THVA 2NXCA 1RAFB 4FKXA 1S1TB 5CYMA 5EGYA 4I6YA 2GQ2A 5HVGA 5EWEA 4WZQA 1OSCA 1GXTA 4ANDA 1RA7A 1U1KA 2KM8B 3HVTA 3RAQA 3AXMA 5IV3A 1BQNA 2CQ2A 5J1EA 3WBZA 3AJDA 3KLIB 1FRJA 4EWTA 1WTBA 1S99A 2OPPA 1H3DA 5FLXY 2IBKA 1H74A 4NA3A 4R5PB 2HIQA 5L46A 1U7LA 2M52A 3KNGA 4JI3J 1V5VA 2QA2A 4GKJF 1NU4A 4GC7A 3CCTA 1HYSB 1WG5A 3CJ0A 5A8RA 4IO1A 1VRTB 3OTDA 5K8MA 1R8BA 2IM1A 1YZ7A 2CQ1A 2OFHX 3X3UA 2Y8YA 4WKRA 5D0GA 2D7SA 2XWYA 3ZZRA 1HHSA 4YOEA 2FJWA 3BB5A 3GIIA 2BJ9A 2FJXA 3BKTA 2GC8A 4JBCA 2W7OA 2F5GA 3D66A 2H54B 2FPHX 4LSZB 5D4LA 3HZEA 5BYRA 4OYMA 3DHWC 3W5ZA 4M5HA 5B08A 2XGQA 1KVIA 4RBTA 3SMZA 4OX7A 1JLGB 4TN2A 4KE5A 2RQ4A 4IOCQ 2HS3A 2OO4A 1RLCL 4WFXA 5CCMA 3C6TB 2ILYA 3FSYA 2D1CA 2DNYA 4PG7A 3Q8YA 4TU8A 1FRIA 4QIFA 2F9DA 3KLFB 1QY7A 4AYBD 4WYWA 3IR6B 3GSIA 3T5KA 1C1BA 1FDBA 2BM1A 4P2FA 2VG7B 4NLGA 4J9NA 3SSRA 1YVFA 2HQ3A 1S7HA 1KN6A 5AXNA 2WTFA 4P72A 2ASDA 3K58A 1PG5B 3M6UA 3A12A 4I2QB 2UXCF 1GAOA 2F65A 1T02A 3D0IE 3FFIA 2JFDA 5ETSA 4QW9A 3UCUP 4JI4F 2GCFA 2GQQA 1R0BG 3MM6B 1YBTA 2X1FA 3OPKA 1WSVA 2ZZNA 2G13A 2DH8A 2DPJA 4PQUA 3DRSB 1V3RA 3CNQP 2LFVA 3A13A 3DU5A 4OV1A 5GMKa 3GV8B 2VJUA 5L9XA 2CZVC 3HXMA 4ZLLA 2ACMA 1LW2B 4RPFA 5AXKA 2I38A 3CCLS 4X4SA 5KOWA 3KLIA 3M9NB 2AGQA 5J1PA 2VB6A 3PJ9A 1I51B 1HL6A 2FY8A 2HFNA 5F41A 4PABA 3T5LA 4MIWA 3M8RA 2ZH5A 2R2SA 1X9MA 1F6TA 3A8JA 3HFKA 1YITS 5D3GA 5IWAJ 1OJ4A 2A18A 1TL7A 2Y1IA 1NKBA 2OPPB 2X3DA 3R8YA 2LEBA 2WZ1A 5EWGA 3QLHB 4OX9F 3V6DA 3WIUA 4LVOP 4DWIA 5BR8F 3VAIA 3G6XA 2I8EA 1C4CA 3FKBA 1L3SA 1UAWA 1VQ5S 2XI2A 4WKYA 3ZZOA 4DXLA 2HURA 5K8PA 5AJ3F 1EX8A 1S5ZA 4DV1F 4DX5A 2JL9A 1ZAXA 2GAHC 1U48A 2BOPA 1W2BR 3UVJB 2HBQB 3H20A 1RKIA 2GQCA 1RCOB 2PA3A 3UN3A 4DQRA 1OO0B 1HBMB 1W7WA 3AQPA 1Y00A 2MKIA 3A3NB 3ELHA 2U2FA 3LGHA 3K17A 1V5IB 2RMLA 4L3NA 3EYZA 3C15A 4DV2F 4JV0A 4Z37A 5HI7A 3Q23A 3IWXA 1T94A 2VA2A 1H0HB 1RWNB 2HNDA 4K4TA 1E6VA 1T9YA 2DHAA 2FDNA 1RJJA 4USUA 3NCPA 3MUMP 4A8MP 1JLBB 2XO6A 3KLHB 5KG0A 1JWWA 1RU2A 2QFIA 1XQIA 4ZITA 4C11A 3CEDA 2UXBF 3ZTQA 1VQSA 4ZVHA 3N6LA 4K7QA 1YRUA 1WJ9A 5C2CA 2HVZA 3HDSA 5L38A 3X1LB 1S1WA 4OI2A 2KN4A 1RB0A 5THWA 4UOHA 4DN0A 2AYBA 1LV5A 3KDNA 4H4MA 3MM9A 2KU7A 1JLAB 3GILA 4BDPA 1B99A 4F4YA 1U2RA 3BSOA 4NXMJ 1S59A 2BOAA 4ELUA 2XZWA 1MU2B 3M32A 2CRLA 1WC0A 5JXSA 3E51A 2VODA 1U1LA 3UD5A 3U1LA 5BYSA 1RTJB 5C7PA 5BR8J 4E2FB 2AKWB 1WELA 4CO3A 4F50A 1NJXA 2OPQA 5F8MA 1JXEA 2DNKA 2R7SA 1FJGJ 2RQCA 1TL1A 2IYGA 3H2UB 2WAQD 3EE3A 3NL0A 1FA0A 2DCUB 3LW5C 2RRAA 1GFWB 1XN9A 3J81Y 1SJFA 1JIHA 3Q89A 5FDLA 3DRPB 1G6BA 2VD3A 2LKZA 3I31A 3C6UA 3T19A 3DGPB 3H5YA 1S10A 3Q86A 4EO8A 3SCJE 2C2OB 2D3UA 2EXUA 2DKOB 2H5EA 4WE1B 4PXBA 1WC6A 5KT7A 5E3QA 1OMSA 1HR0F 4O3QA 2KT3A 3NAIA 2ROPA 3WC0A 4ZHRB 5HP1A 1N4LA 2HHUA 1C0TB 1KNZA 3MD1A 4OQJA 2H51B 4RBUA 1I94F 1EKSA 2BEFA 4QPTA 2DGQA 1X0FA 3UI3A 1HNWF 1GH8A 1UWAA 5A2QU 2AX1A 1MG7A 4WXWA 3G82A 2XHWA 1C1CA 4W4MA 4K4XA 2HRYA 4AD6A 1NJYA 2G1DA 4JV2A 5H1SV 3GV7B 3RYLA 2IA0A 2K1RB 1UJ6A 1NZ8A 2M7SA 2DT9A 4XDCA 5IXUA 4ECUA 1S9FA 4DL4A 2JLFA 4DR4J 2W7PA 1QSLA 3UN5A 2VASA 2OFGX 1M5PC 2HVHA 4DX7A 2GMLA 1ICEB 2JHEA 4ZCMA 1LFPA 3DOMA 5A8WA 3DFEA 2ZH4A 1U45A 1VQ4S 4OJGA 3VAHA 3M1VB 2BRLA 2E5JA 4ZLJA 4C11B 4QOTA 5D77A 1VK3A 3PEJA 1D1UA 4UUXA 3WQPA 1L3TA 5DZ6A 1BD6A 1P6TA 2IM0A 2ZD1B 5C24B 2HAFA 1RT1A 3IG1A 1LXJA 1HNZJ 1NHUA 3H2LA 3J7A1 1X5PA 2OUGA 1VQ8S 3HKZD 1RYRA 1RTIB 3J7YU 1RQ0A 2CPXA 2D9OA 2EFQA 3L09A 1T9VA 1VHIA 2PC6A 3CJ5A 3L7UA 4C8MA 1S1XB 2KG1A 3G8SA 4KRWA 4URSA 2QEXS 1SC1B 5ETQA 4OZ3A 2DB1A 2LXUA 1RT4B 2YWHA 3CIZA 3IBWA 3VVUA 2CNLB 1T03B 1XMBA 5E3PA 5GAEU 2B9EA 3FK4A 3C2PA 3BDPA 3H59A 8AT1B 3MTJA 4RU9A 4UQGA 5ETOA 4N7TA 5HANA 3RBEA 1VLOA 3TJ8A 2YBVA 2L9NA 3UNYA 4F7VA 3PR4A 1NK9A 4Q0BA 2C22A 3ZTOA 1UFWA 3CGIA 5CZXA 3SSQA 4ZKAA 2XYGB 4PR6A 3ISND 4HH1A 2BJ8A 1X0PA 4F25A 1VQLS 1R3NA 2YWWA 3DYAA 2C2KB 3CO0P 5G0RB 3PDNA 3MM7B 1EJ7L 1YRTA 1YBAA 3M2VA 3FJ2A 4HTJA 3S6EA 4F4ZA 1RWUA 3UDLA 3SQOP 1FCAA 3C19A 4CLSA 4DR7J 3MOZA 4GKJJ 3R5CA 4LREA 3D1OA 4O4GA 4K4ZA 2BJEA 1FDNA 1JLQB 2DEIA 2L9WA 3L7OA 5KFUA 1Y10A 4KGXB 1WF2A 3KWMA 5HVHA 4DFKA 1KBRA 1N6QA 2RVJA 4DL5A 2ACYA 4OZNA 2NYHA 2L48A 5HBMA 3SYZA 4TLQA 5KFPA 4KHPF 1CJVA 2HIYA 1RT6B 1FHTA 3CJ2A 3P5TL 1TELA 3QMQA 2WVBA 4EEYA 4ED3A 3TANA 1F3FA 3KDOA 3ZTPA 2RKIA 3PFOA 5K14A 4CDIA 2B9WA 3C16A 4I56A 1SH3A 2ZBIA 4OIXA 2DGVA 2WSEC 2OPRB 1RBAA 3DMJA 4J9VA 5ETPA 4DI6A 1RAIB 1S0NA 3QT8A 2YTCA 3F0NA 4LF7J 2PGCA 3Q83A 1YK9A 2WCXA 5KG7A 3GJQB 2VHGA 5HROA 1NJWA 2LMIA 1NSAA 2DITA 1WSRA 2AJ0A 2HQGA 4Z7CA 4LF8J 1GMUA 1SIWB 4LF4F 2ZKTA 3M8PA 1WORA 2NSBA 5CABA 4R25A 5L1IA 2M8DB 2DGOA 1T95A 5LMUJ 4MIBA 1K1QA 3SQGB 6FDRA 5FLXU 5DLFA 4DV2J 5J2MB 3VAFA 4C8YA 5F9NA 2L9DA 1UVLA 2X1GA 5B0GA 1XIQA 1AZSB 5KFSA 1F5BA 2PFFB 2GZOA 2B4OA 4I2QA 3C3LA 1CJTA 1F9HA 3ENAA 4B3RJ 4WXOA 2AYEA 2CQGA 1FJ7A 1QE1B 4ZCIA 2DRDA 2B56A 2OAUA 2A1BA 5EDWA 1YJWS 1LK5A 4NYOA 3GJRB 1KP6A 1NJZA 1T8EA 1PJ7A 4DFMA 3I9ZA 4MKYA 1RT4A 3W3SA 2UXBJ 4X4NA 2VKRA 3DI6A 4JUZA 2DHXA 2GNKA 2R7WA 3VALA 2ZOFA 2E9TA 2V50A 1GT8A 1KVKA 1TQLA 4F4XA 3MCSA 4QJVA 3ZC4A 1Q0NA 1J2VA 3MD3A 3TO8A 1PYTA 3U02A 4B3SJ 1WNEA 2DRAA 1CC8A 1XNRF 3VCDA 1OY6A 4QWEA 3QRRA 3P4UB 1IVZA 3CPWR 1FKOB 2KZZA 4RW8B 4B3MF 2UV8A 3MCMA 2YNGB 3PYGA 2HEKA 2IVYA 4ZPDA 5A0YB 4X66F 5HLFB 2DR8A 1WKKA 2AF6A 3DRRB 5IM0B 2V4JA 1MN9A 1H2VZ 1VRTA 3VAMA 4JI5J 1IBKJ 5HP1B 3LF0A 1FRHA 3OFEA 4P75A 2ALZA 2WONA 2CJXB 3GCXP 3BKUA 4WFBQ 4G1QB 4LR8A 4CYUB 3OV7A 3EPIA 4DSFA 4KJIA 1L3VA 1BY9A 3PO5A 2XLKA 3NMAA 4Q2MA 1Q8LA 4U9RA 3CCVS 3W2WB 2XG8A 4Q7AA 3B6BA 3RUBL 1SL1A 3IMQJ 2CZ9A 1AT1B 1TVRA 4ZPVR 5A6PA 4NWBA 3C8YA 1VC5A 1CLFA 1HBMA 4DQQA 1XMOJ 3MCNA 2VFRA 4B3RF 2DO0A 2MY7A 2CJAA 2R42A 5C5JA 3NGDA 1KFSA 5J2NB 5I3PA 2ZHAA 1ZS6A 3KK2B 4JI6J 3LPYA 3MGJA 2GIQA 2WBMA 3MAAA 3SDEB 3EGVA 1PC4A 3PM9A 1TK0A 2PMWA 5IT4A 2E1CA 1S0VA 3SZ2A 1NKEA 1Q82T 1U49A 1SJRA 2JZ5A 3FCVA 3LP2B 5C24A 2JFKA 3NOGA 3KK3A 4PXCA 5E33A 2RDDA 4DR4F 3PO4A 4OHXA 2ZE2A 5DLGA 3I87A 2GGPA 2HKEA 4ZP9A 2B8PA 4DUZF 4B3SF 2E7XA 3H42A 4F26A 2DRBA 1VI7A 2KYXA 2BRKA 1RHKB 2X7IA 4OHVA 4TNOA 4N47A 1JNRB 2L41A 5J2MA 2KYZA 3IRXA 3HI9A 2CPJA 4MK7A 3UCZP 3QFWA 1SV5A 2YKMB 1ITPA 1T05A 3I6PA 5F0WA 4QW8A 2HW3A 4NLUA 1LK7A 1UJ5A 5GVQA 4O3OA 1NB7A 2IHR1 4KQZA 1F5AA 3T6BA 5CHCB 1BQMB 1LW2A 1Z2ZA 3RR7A 3IM9A 1RAJA 4DV6F 1FF2A 2GW8A 5B0FA 2A10A 4C9DA 3DOKA 1VMBA 1VIXA 1RTJA 2D69A 2PE8A 4N8NA 3DLGA 3VAKA 2WSCC 2R8GA 1N32J 4CP5A 3JSMA 2RQKA 1C2PA 3AD9C 3BSAA 1XR5A 4GVLA 5HL7Q 2KG0A 4OL8A 2BE9B 4RNMA 1RYSA 4ICLA 2P9GA 3HVWA 4H54A 1UEUA 1BUXA 3GU0A 3IR5B 3ILIA 1G4CA 3LGNA 3MEGA 4GVBB 2LDIA 4KPCA 4KHMA 2AYMA 3VQSA 4F0HA 2W9AA 2W2NP 1T9WA 3C6UB 1ELOA 3IXQA 3KUGA 2OJ3A 2AMCB 2V4QA 4DSEA 4CLPA 3H5XA 4WCEQ 2XTJP 4JI6F 4JI8J 1VC0A 1H7WA 2HGMA 5IFMA 3NMRA 3CF5Q 2UVRA 2K8GA 3TR5A 1NH8A 2BE2A 1NUEA 2OD6A 4CM0A 5KFOA 4V19J 1MWQA 3V81B 5H9FK 1ZM2A 1KWMA 2CDQA 2IVMA 2MHNA 4FPIA 2HRUA 4NCGB 2MHEA 5L9NA 3AA8A 2J0QD 3CE8A 2K1RA 3RAXA 4KH0B 3NRBA 4KYZA 5F8NA 1LXNA 2QE5A 2WBRA 1ZM4A 3VGUA 1YTYA 1WACA 4KO0B 1OIAA 1Q16B 1LWXA 3FSXA 4P7TA 5B7WA 4RW6B 1RWXB 3M9OB 1LWFA 2V68A 1LWEA 2E5IA 3H8YA 4HHHA 4X4RA 1X5SA 1Y5LB 4DG1A 5J2NA 3IWNC 4ID5B 3K5PA 3NGTA 4U8YA 1XWLA 1R31A 3BSNA 1SJ4P 2CXEA 5LXYA 1GMVA 1UW9A 2ZD1A 2W8KA 3IBFB 1RTZA 2VG6A 3IRXB 2FLLA 4U7UD 2VH7A 1YG0A 1RWPB 2QLXA 1HKAA 2QO3A 3R7NB 1CS4A 4ES2A 1N34F 4U8VA 3CMAS 4PQAA 1ZBTA 4JV5J 2HBYB 4LF8F 3GJSB 3ZZZA 2RRBA 5KTQA 2V4RA 2MZRA 3DHXA 4B3OB 2FD2A 3FQLA 4F0KA 2C2MB 5CYMB 4YY3F 4ID8A 3EX7B 4OHYA 4J9PA 2ZBQA 3CJSA 2OH2A 1SJ1A 1VJQA 2DGTA 1GQEA 2VG5B 3EXCX 3VGTA 4ZOSA 3QRPA 1F9FA 3TAPA 4EZ9A 3KJQB 1RU1A 3GIKA 4PWDB 5HMYA 1TFYA 1KS2A 2XSJB 1JKHB 1NO8A 2ILZA 3F56A 4DCOB 5E41A 3N9UC 3QLHA 3DGPA 2JVOA 1CJUA 3LP1A 4D3HA 3NGSA 1TL7B 1U25A 2VV5A 2MSTA 1ZOTA 2QN6B 2WVFA 3A8IA 4PWUA 5EX0A 1N33F 3TEHB 1HQEA 2ZWOA 5DZ7A 3E01B 1N0UA 4IOBA 4KR0B 5LM7E 2MY8A 4UOGA 3KHLA 4FF4A 2R8HA 3N01A 2GX8A 2RDIA 2YVSA 1GX6A 2DNZA 1K47A 2M4MA 3GONA 4HT5A 4K8RA 1YIJS 1XNRJ 4NOHA 3QRQA 3W64A 1Z1ZA 2CPFA 2QL9B 3NNHA 2RIJA 3QSIA 2E29A 4NEYA 3T5JA 1S4EA 1JX4A 3EGWB 2BE2B 1P27B 3SI8A 1KTVA 3MR5A 3R5AA 1DARA 5GAGU 2LQ5A 1NJIT 1KLNA 2BDPA 1SQEA 4QIVA 3SEOA 1JLCA 2E5LF 2CVEA 1S6PB 3CD0A 3CJ3A 2DNPA 2MJUA 2BKPA 3FRZA 2CWXA 2KJVA 2M70A 1HWKA 3P96A 3NBPB 1LNQA 1S9GA 3QIPB 1PILA 4KV8A 5C2GA 1WEZA 1XJWB 4U95A 1URRA 4EYIB 2F4FA 1HWUA 3W5YA 5LSRA 4CCHA 1UVIA 5D0EA 3Q8QB 4I4BA 3HSJA 4C8LA 4CTAA 3ITHB 5B0CA 3MMCA 3RJMB 4DV6J 2BJDA 4OV6A 5MLCV 1R0AA 1GMWA 3GIMA 1SKSA 2B4PA 2HS4A 1WDTA 1F5CA 2C2DA 1Q1KA 2BVZA 2B0GA 3QFHA 1CC7A 4E8UA 1QDUB 3K89A 1U8WA 2F1FA 2HWHA 2YWGA 2LQJA 2M2BA 3OLBA 3KK1A 3T1YJ 4MKBA 4P74A 2AU0A 4NEZA 4PQUB 1X4BA 4ZJLA 3GLJA 3BYRA 1U47A 3LA0A 4JI1J 5LSOA 2AJ1A 3BM7A 1HI0P 5D8HB 3BQ1A 1Q81T 3TQ1A 3MTKA 4TXSA 3HFZB 2YQ0A 2YKPA 5EUHA 3ZZUA 1SB6A 4PWWA 1LEOA 3D4JA 1N36J 2XSJA 3IR7B 4LIRA 2JSXA 3EDRB 4TKTA 2GJ2A 2NZCA 2YKNA 1HHQA 1KQFB 3PW5A 1AFJA 3DYAB 1P8GA 1S6QA 4PEOA 4TLRA 2V2ZA 5C25B 5DGBA 1EB0A 3Q8VA 4LT6A 4CH7A 2IDLA 1CJKA 4NE9C 3GJTB 4P7VA 3CC2S 1QUVA 1Q5VA 1UZHA 3GSDA 3NS5A 2FVSA 4FBUA 2DGUA 2C3OA 2HK3A 4DUYF 1BLUA 4NPOA 4C2MA 4Y6IA 3FZBA 1TKXA 1W25A 4I7FB 3R97A 1VFJA 1SJ3P 5I3QA 1QAJA 1FRKA 2EFOA 3H98A 2UUBJ 4B3TF 4YHHJ 1KC8T 1B4SA 2H4WB 4B9TA 3TUIC 1DLOA 2ZDOA 4RUAA 1TAUA 3F73A 2MZTA 3G82B 2PEBA 2K7KA 3Q24A 2QMUB
chains in the Genus database with same CATH topology
4ETZA 1M90T 2COLA 3NGKA 4HL9A 2O01C 2CJQA 1U26A 4NL5A 5I42B 3HT3A 2G0CA 3EXYA 3VWSA 5L1JA 2LXIA 4N8OA 2LA6A 4QWAA 3OSNA 1KD1T 2XULA 3KK2A 2UUTA 2AP6A 2CPIA 1HQUA 1FRMA 1HW8A 4LSNB 2PSZA 5EX3A 3IA0A 2ERRA 4X62F 2HMIB 2AGOA 2IA6A 2FGCA 3GYNA 2NUUG 4C8NA 1T3NA 2J0XA 3ENWA 3GG1A 3PW7A 2KFYA 1N5VA 4TQRA 3WC2A 1LFWA 4B9MA 4LF6F 1MSWD 2EPIA 3DDNA 3BS9A 4YR0A 2R7TA 2O1PA 1JJ2R 2GA7A 3HHNB 3MURP 3MF5A 1JK9B 2UUBF 4MH8A 1TAQA 4YB6A 1C0UA 1KLMB 5F8GA 2VBWA 1ULRA 1DJ0A 5DG7A 3IRWP 4XPCA 4PWDA 5G0RA 4JI0F 3EPGA 5A6WA 4FXVA 1L3UA 3AJ2A 4Y65A 1MROA 4A8QA 1NKCA 1WHYA 2XY7A 5HMZA 4K4VA 2CQPA 4FNHA 4MK8A 3KHRA 1YJ9S 3V4MA 4UY85 2XGPA 1DLOB 5HBMB 2C42A 1B7FA 1TKXB 1UL3A 3QAEA 3DLKA 4EU0A 2V0NA 3ULHA 3HMJG 5A8KA 2IYIA 3I32A 4A8WA 1JLBA 2ZH9A 1FD2A 1UFLA 2QA1A 4KSEB 2CJKA 2KKHA 2ZH2A 2CFXA 5LMNF 1CQMA 2Q43A 2MMYA 1DTQB 1XR6A 5H9EJ 4LFAF 3EGNA 2FGOA 1RDRA 1LW0A 1Q78A 4CTAB 3KLEA 2ZHBA 1OPZA 1O51A 4B9SA 4CT9A 2YKQA 3RRGA 4IRCA 5D6GA 5KFBA 2ZH7A 3FEXB 5LXRA 5LJ3Y 1RT5B 1C4AA 3BR8A 2J7KA 3DLEB 3RZAA 2VONA 1QE1A 3DDKA 3I5BA 3NP5A 4ZLPA 5M2PA 4ECVA 4JOUA 1TKDA 4NCAA 2VPXB 3MEEA 4OI3A 4NYPA 4NLTA 5KG5A 2JC0A 2POKA 2N7CA 4YHHF 2WOMB 1X9SA 2XMVA 3MM7A 3MM8A 2FVQA 1R43A 1D3WA 2JJ4D 2X1AA 1WD6A 3IWLA 5GADU 4HVZA 2AJFE 4WTYA 4DHVA 5SZTA 3KHGA 2GMHA 3GMGA 4QZVB 3ONQA 4KFBB 2WRMA 4Y2CA 4DS4A 1MROB 4HHJA 3QGHA 4OZ5A 1HD1A 1S4FA 3M4XA 2V4JB 2PO4A 3CDAA 2MQPA 1NEEA 3OJUA 4QR2A 2UXDF 2EFNA 3PFEA 4Q2LA 1NK6A 1HWLA 4QYZJ 3OXGA 3GR1A 2E1RA 5IWAF 1J5OB 2QMWA 4WJBA 3W2WA 1QVGR 1JXLA 1EETB 4RW7A 2LQBA 1GX5A 1N54B 3JYTB 2JLGA 4IUFA 2BBEA 5F8LA 2PN6A 4ZVEA 5KFHA 1NNDA 2ZNZA 1VOMA 2XCPA 4IQXA 1DQ9A 2GO8A 4ATNA 1IKYA 3OBIA 2M9KA 3OR2B 2DIUA 1MNEA 3AQOA 3AHPA 1DQ8A 4P6QA 4AYBD 3MMBB 4CIOA 1KQKA 5T7LA 2QA4S 2V8HA 2J6UA 1BQXA 4B9UA 3K8VA 2DNOA 4R0JA 2W9BB 4DQSA 4P2SA 4ED7A 1QSSA 2GHPA 3HLUA 3MAHA 3O8WA 3MMCB 2QT7A 1GXLA 1SUQB 5G4DA 3GFZA 5KT4A 1K0TA 1JLAA 3OTBA 2XSFA 4RW9A 4QIWD 5FD1A 4F4KA 2PEHA 5FJ4A 3SCKE 2HWIA 1S1UA 2UZAA 2RQMA 2DD8S 3LWLA 3PJXA 2MGZB 3PX0A 3MPVA 3TYTA 3FRYA 2XCAA 2XLIA 3RB3A 2UUCF 3DCAA 3QJPA 5L1KA 2YNIA 3DLGB 5DRKA 2ZFHA 2BM0A 3MM8B 4Y2AA 4R5PA 3V6KA 4X4UA 3CTRA 2RSQA 4OJHA 2KXFA 3H40A 6FD1A 4BCAA 3KJVB 1MMNA 2SXLA 4G1PA 2EKYA 1Q4RA 4IQMA 1FK9B 3A1YG 5LL6d 4DLEA 4A8YA 3PW4A 5KT6A 2W4DA 2WB4A 3CJKB 2VFTA 3FEZA 3RU0A 2B9YA 2Y1JA 5DM7Q 2M3DA 1FRLA 3OTEA 2R7QA 3D54A 1HWJA 3TAQA 3CMES 4U6PA 1FJGF 2W25A 1MWYA 5E0OA 1HBNA 3O5TB 4I7FA 1RT2B 5B0AA 3OL7A 2X3GA 3HHEA 1KOOA 3MPWA 4M8LA 1NK0A 3IAM9 4HDHA 4RZRA 2AYGA 3JAMY 2OKQA 2ZBCA 3IAS9 3HK2A 4PG5A 3OFGA 2ADCA 4I0WA 2XNQA 3BZQA 4FP9A 5B0BA 1MMDA 2EI5A 3IG1B 3T6JA 4NA2A 4J9KA 3PVXA 4ID5A 2VFSA 4O3RA 3FMBA 2B3TB 2DK2A 3HHDA 4F2SA 1FERA 1LWFB 1Q8IA 2FY1A 2UVUA 5HQ8A 1SL0A 3CVKA 2E1AA 1LW0B 1WTFA 3KG4A 4ZP6A 5T7LB 2WHOA 1XTZA 3TNVA 2O3DA 2ZH3A 2LEPA 3CT9A 1WWHA 1KEKA 3BGRA 3DRXA 3M8QA 4NMLA 4O4RA 1X4DA 4QU7A 4XO0A 5KFDA 3GG0A 1S1TA 5T41A 3GQCA 2HS0A 1Y4ZB 3JSBA 1RKJA 2CQHA 2E44A 4B3OA 2AX0A 4X65F 3MEDA 4ITSA 2KXNB 2C2EA 4ILMA 4F3QA 2DGSA 1YHQS 2E5GA 2ROEA 2QSWA 2ABYA 5KG6A 4AFFA 2E1MC 3O1LA 5E3AA 4ICLB 3THPA 4TU7A 4DR6F 4AXIA 4U7UK 2RILA 2XO7A 2NREA 4URQU 2ZJRQ 2IC3A 2J7UA 2B51A 4A46A 5SUHA 5GAHU 4DV7F 4DL2A 3RB6A 1FNOA 3BDPA 4PKDB 2HNYA 1H2TZ 2VA3A 3MFHA 2JX2A 3K7RA 2M0GB 3P49B 3PHEA 4K59A 1IKXB 1RI7A 5KT5A 3V6JA 2N7YA 2UU9F 4OX8A 2XBPA 2HYIB 3E8OA 2KT5A 4Y3CA 3UW1A 3RW7A 4DR7F 2Z4PA 3THTA 2IRYA 4B17A 3D28A 4Y2IA 2AW0A 4PG4A 4ED1A 2EWHA 4DQPA 3BQ2A 2BR0A 2QZ8A 3FQKA 1RTHB 3FNNA 4NLOA 4YB1P 3CCRS 2GIRA 3NBPA 4KV8B 4EGLA 1P9QC 1K73T 1IKWA 1F2GA 1X4HA 1WHWA 2XMTA 2FHMA 4H4OA 1UW4A 5LT5A 1MU2A 3M32B 3NS6A 2JLEA 3I5CA 1FKPA 4DR2F 2E9ZA 2B7BB 4OJ1A 3MDFA 4K4SA 2LQ9A 5DGAA 4NLQA 2YX1A 2HQIA 2ASLA 4DEZA 2E66A 4NLPA 3DLLQ 5IT0A 5KG2A 4HI2A 1NAQA 2YKNB 3N4WA 3HX9A 4KAIA 4YB5A 3TA2A 1F60B 3CXCR 3B78A 4PUOA 1C0UB 1KLMA 5JVGQ 4CO5A 2R7XA 2L3MA 1UETA 4KTQA 1D8YA 4N5SA 1R7IA 2HHXA 1MWZA 5KFJA 3N5FA 5KFYA 2MZ1A 3TI0A 2CQ4A 1AXQA 1IXKA 3K0JA 2Q3PA 5JVHQ 3FMWA 2IRXA 1FT8A 2XI3A 3N6MA 4ALZA 2YX4A 4AL7A 1X0FA 1FTCA 1HQEB 4MYUA 1YJVA 2MXYA 1YJRA 1G1XA 3CO9A 1PC5A 1JLFA 1Z2LA 2OMOA 1VQ9S 2NXUA 3T1HF 1VC6A 4HKQA 4BWMA 5DG9A 4C8KA 2ASJA 2QIFA 3PNIA 4WFZA 1DAXA 2HNDB 2DH7A 4HYKA 4XK8C 2VQFF 4MMOA 4XAKA 2RT3A 2IMOA 4QWDA 4ED2A 4TY8A 4LSLB 2R2TA 2KHCA 4TQSA 2DHSA 3LUYA 2PT0A 3OXFA 3HPOA 4KHRA 2KT2A 4HI1A 2MQLA 2B5JB 3POTB 4G1IA 3PX6A 2RNEA 1RA6A 1FDAA 3QIDA 4OZ0A 2RB7A 1S49A 2HMIA 3OVBA 4C3KA 3BGFA 1IBLF 4Q45A 4BBYA 3UR3C 2F9JA 3I0RB 4MFBB 5CH7B 1FTRA 2VZ9A 4C0HA 1TL3B 1JLEA 2FJDB 1SI9A 1Q86T 4FF1A 4R8UA 2CPHA 3W2VA 3RRKA 3W7BA 1S0OA 2YWEA 4ECWA 4DSKA 4F8RA 4EBEA 1WHVA 5CQGA 1FESA 1M5KC 1QSYA 1KHWA 1X4CA 2BACA 4NXMF 4IYQA 3DOLB 2WSFC 3I0SB 5LSLA 2HFZA 1S9EA 4FNIA 4ZHRA 3VZIA 3LANA 4AE5A 3MR3A 4IR1A 1Q7LB 1HBOB 3HP6A 4DS5A 2C2RA 2ZH6A 3PRDA 2VQEF 4LF9F 3I55S 2V8VA 1C1CB 3LAMA 3OVAA 1DTTB 2A2CA 1N32F 3SSSA 4QWBA 2G9OA 2MSSA 1TKZA 2GFFA 1IKXA 2OLWA 5C42B 1FD8A 2B43A 4KGKA 4A4JA 1VS3A 3OFFA 2YH1A 1X5OA 4NA1A 5A8WB 1P1LA 1FVQA 5DQGA 1S6PA 3D1HA 3FVYA 3TA0A 4OJ3A 3SDEA 3CJ4A 4XPEA 3VQTA 1TV6A 1QAYA 1SXLA 4LJMA 3B4DA 3FCHA 4RNOA 1RT1B 2EBGA 3MM5A 3T9ZA 3CCMS 2NZ4A 2D9PA 1E6VB 3N0VA 2J9DE 1Y3KA 1QVFR 4M5DB 1S0MA 1UJ4A 3VZHA 1QTMA 1YJNS 5KFKA 2R7VA 4FZVA 1FNMA 1VK8A 1I6JA 1VQKS 5CYQB 1SJQA 3QJLA 4TU9A 2YKMA 3VAJA 5GAHI 1HFEL 1ZPVA 1S1VB 3ZZ0A 5AE3A 4M94A 2F8HA 3CCZA 1HPZB 3MZIA 4TYAA 2NSCA 3LOUA 5BYQA 4WF9Q 2LA4A 2X51A 2FVPA 2OSQA 2GHVC 4RNNA 1NK5A 2J6TA 2KVIA 2ZJQQ 3TAMA 2VG5A 4Z2XA 4I67A 1SKRA 3N5BA 3OW2R 1N8RT 5B0EA 3LP1B 4KKOA 4G6VB 1HBOA 2NYIA 2WB1D 3ETOA 5KFWA 4OX6A 1WHXA 3GFHA 4XDDA 4KFBA 1QAXA 2XY6A 5KFZA 3AJ1A 4Y2MA 4ECZA 3ISZA 1HNIB 4LVNP 4NZ0A 1V6HA 1PGZA 5GAEI 5CZVA 2O66A 3ICLA 3MECA 3NWGA 4LFCF 1AW0A 1LKZA 5I3UB 3MOJB 4IFVB 2J5AA 3M2RA 2AD9A 2VBZA 3TW0A 4X4VA 3WX4A 3OJSA 2CQ3A 4A8KA 4ECSA 4J9SA 5KFEA 1N0VC 4ZVFA 2CKWA 2AWZA 4O44B 2CG4A 1TKZB 2J7WA 3QPIA 4ZPWR 1KQGB 1HMVA 4KB7A 2HLUA 4KO0A 2MQNA 3K5LA 4C3LA 2GHWA 1ZAWA 3K59A 2ZJPQ 2QSFA 4RX6A 3GFYA 3MEKA 4I6WA 1D0EA 4LSLA 5KFGA 5GAGI 4O23A 3QZ8A 2FHOB 5KFNA 1Y5NB 4QPXA 5F8IA 2AQ4A 3M8SA 2IM3A 2EG1A 3G8TA 1WF0A 2Z0GA 1R27B 2ZHOA 2W24A 2W4PA 2DR7A 3AAWB 5DM6Q 2W9BA 4MYTA 1DRZA 1V3ZA 1KFDA 4WFYA 1X4GA 2ZOGA 1S1UB 2XMUA 3GE9A 1B0PA 4L72B 4CT8A 4N56A 4Q0BB 3TOQA 1FXLA 3KOAA 4X2BA 2CPDA 4ZMMA 4DR1F 1K9MT 4IG3A 3SCLE 3I4HX 2I9SA 2MKHA 1Q53A 4RUCA 4E0DA 1HD0A 2UUWA 4WIIA 1L5UA 5HO4A 3MEDB 4B9VA 2YY3A 5AXLA 2R7UA 1Q8BA 2I0XA 2HVIA 4QR0A 2PA8D 3SCIE 3V6DB 4W90B 1FO1A 5AXMA 2ZH8A 1SL2A 2K7JA 3CUNA 4QYRA 2L08A 5KFXA 5D3GB 4NX9A 1SBRA 4Y0FA 3MUTP 1XEZA 2ZOMA 2DIVA 2R7RA 1LOUA 1SKWA 4HDGA 3J80Y 2HHTA 4IR9A 3QGIA 2V8GA 2RKIB 4WZMA 4UW2A 4QWCA 3OL6A 2KRBA 4DL3A 1IJFB 2Q79A 3MHYA 4IRDA 2F8EX 3LP0B 4HLBA 2ZZMA 3MECB 4O44A 5LJ5Y 3OL8A 2VUGA 2HGLA 4NLXA 2RDJA 4JI2F 3I82A 4BWJA 1FEHA 2K3KA 4DV5F 3RBDA 4GO5X 1J5EF 3CD6S 3N28A 1IBMF 1LWEB 1IBKF 1UVJA 2IJNA 4WU3A 3C6TA 4F3MA 4RNFA 4DF4A 2QV6A 3UQSA 4Y34A 5D4PA 3ZZPA 2XMMA 2M88A 3CSKA 3UR0A 2LVWA 2RS2A 1YJUA 4Q8FA 2J9EA 3K2YA 2J6SA 1CEZA 5IS2A 4FPRA 2CZ4A 4H4MB 3T5HA 1U2FA 4GC6A 4JV1A 3BEGB 4PXDA 1XMOF 7FDRA 1Y3JA 2W7AA 3T3FA 3IC1A 4OI0A 1AFIA 3G71S 3SQGA 4EZ6A 4DPOA 1U6FA 2Z2MA 3IGVA 1SUQA 2PMZD 4AXJA 2F7VA 2V9WA 4AL5A 3PR5B 5DDOC 3OTOF 4ZP7A 3G86A 3MR6A 3K57A 1Y9OA 2W8LA 1YI2S 4DV0F 4JI1F 2KRRA 3LALA 2HFOA 3ENVA 4IG0A 5CCLA 5K8OA 1X4EA 2MKKA 1HARA 5FDLB 4JI8F 2DNQA 5E7OB 2ZNYA 4Q43A 2LLZA 1PO6A 3IS9A 4C98A 4C8OA 3KLGB 1K8AT 3B82A 4ZK7M 4LQ3A 1M1KT 2HG4A 1KR4A 4D3GA 2BQUA 5J1NA 2PIIA 3WDOA 4JI7F 4USJC 2XLJA 1JNZB 2DNRA 3CJKA 3OVSA 2IC3B 2I1RA 1IR0A 2J8AA 4G1QA 1OPIA 1S9EB 5KFRA 1D9AA 1M5HA 2EW9A 2MZJA 2VC1A 1KTQA 3HHKA 1IQZA 1QM9A 4NLSA 5A8RB 5DETA 3EZ5A 4NRUA 3HHLD 5HLFA 3FGVA 3GB0A 2VPWB 4CH1A 1VJWA 3HO1A 3I9V9 1CG2A 3OHAA 3K5MA 2EC0A 1DQAA 1HBUB 1KHVA 4I2PA 1CSJA 5A2QY 1TK8A 1R89A 3BREA 1RK8A 1R8CA 3CCES 3JYTA 3CDWA 1Q7YT 2JRSA 2J0SD 4RWWA 5A8KB 4DSLA 2MDAA 3QGPA 5KFCA 4C8ZA 2N3LA 2JC1A 3E2EA 1HW9A 4YEAA 4JV5F 3F41A 4KGMA 3SXLA 4AQYF 4C0BA 1VQPS 2QLWA 3LH2S 5KFTA 3M6WA 4EO6A 4ETXA 1G7CB 2RF2B 3KK1B 2XY5A 3N79A 4FS1A 3QJJA 1UKUA 3AY0A 3OHBA 4QQBA 2ZE2B 4M1KA 1CQNA 3KKFA 3NKYA 4ZPTR 2C3MA 5M2RA 1RTDB 2DPIA 3CCWA 3MXHP 1UA1A 3Q2SC 2DTJA 2IBOA 3DLEA 3I0RA 4MFBA 4IFYA 3TARA 3O6QA