4ES3A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
84
Chain Sequence
HMMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLNYKVEHIGAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BH0342 protein
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 21
structure length 84
sequence length 88
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es3A00
3UI3A 1N0UA 3B8HA 4FN5A 3OQ2A 4ZCIA 2EFGA 3ZZTA 1ELOA 4QR1A 2BV3A 1KTVA 4ZCLA 1FNMA 2KDOA 2XEXA 4QR2A 2I8EA 1VI7A 2BM1A 4ES1A 5G4DA 3ZZUA 3B78A 4MYTA 2E1RA 1ZM4A 2ZITA 4M1KA 2L9NA 4ES3A 3ZZ0A 1ZM2A 2J7KA 2BM0A 4QR0A 4ZCMA 2NPFA 1DARA 1T95A 2WBMA 1P9QC 3LH2S 4TNOA 3E3XA 1U2RA 4MAKA 3EXCX 4ZCKA 1N0VC 4ES2A 1ZM3A 3B82A 1ZPWX 2I0XA 2CVEA 2IVYA 4MYUA 1ZM9A
chains in the Genus database with same CATH superfamily
1QUPA 4ED2A 2GVZB 2D3UA 3TWZA 5ETKA 3GQCA 4M5NA 2IC3A 2C2ZB 1M5PC 4IR1A 2BA9A 4HACB 1KFSA 4QIVA 3W9IA 1GQEA 4RUAA 3BN7A 1T3NA 2A2DA 2HQGA 3HK2A 2DXFA 2OLWA 4DL6A 4KGVB 2QE5A 4UOHA 4DR6F 4Y3CA 4OL8A 3T5LA 3DNCA 1RYRA 1HHSA 2OSQA 5ETVA 2W7AA 3R6LB 4CZCA 2ZH8A 2J0QD 4CLYA 1F5CA 1VQ5S 1X5TA 3AXKA 3CMQA 2DGSA 3IA0A 1TKXA 2VFSA 1CQNA 3OTOJ 2CQ0A 3G9CA 4DX5A 4J9OA 1JXLA 1K8AT 4KTQA 2FVPA 2KYZA 3CJ3A 1UEVA 2PGCA 1SV5B 4DR1F 3KUHA 2FLLA 4J91A 3EGNA 4Q7AA 3PIOQ 1WKKA 2NXCA 1S1TB 1NHVA 2KKHA 1JXEA 3NAHA 3JSYA 4ZOSA 1F3VA 3SQGB 4JV1A 2AP6A 1U24A 3PR5B 3I5BA 2DH8A 4BWJA 2IJFA 2H54B 1O0PA 1RU2A 1XMBA 2IA6A 3BH6B 2VQEF 5C2GA 3SCIE 4Y00A 1H74A 4ZPCA 5A6PA 4ZP6A 4QBUA 4ES2A 1ZA2B 3FNNA 4P2MA 3IR7B 2HHPA 2ILYA 3H0PA 3TRGA 3L4BC 1KFDA 5HLFB 3PJ9A 1S9GA 4K2JA 1JJ4A 2R7SA 3QGHA 3W66A 2JFDA 3CSKA 4QR2A 3ZXWA 3CO0P 1Z1ZA 1S12A 4CO2A 1VS3A 1FJGF 4KJIA 2GHWA 1XN9A 1JLFA 1RTZA 4PCQA 2AKWB 4PXDA 1LW0B 4F4WA 4IFVB 3MHYA 5A6WA 2GVZA 3OSNA 3GFXA 2KXFA 2XGPA 3KKFA 3P4UB 3RBEA 1UEKA 1IBMJ 2FC9A 3UFCX 5F9LA 2QYGA 1RT6B 2ZH2A 1MROA 4CQ1A 8ATCB 3TUZC 5CHCB 3T6JA 5IWAJ 4EUVA 1KOOA 1RAOA 3CJ2A 5KFQA 5KG4A 2V69A 2DEIA 4X4PA 4DQRA 1FTCA 1R8BA 4EZ6A 5DM6Q 1GNKA 5K8OA 5KT6A 3Q86A 2ZHBA 2DR5A 3KTQA 1X4DA 3DOLA 3LAKA 4D3GA 1NLKL 1LWEB 3G6VA 1L3VA 1RHUB 1SV5A 2ZH5A 2XTJP 1V3ZA 1REVA 2V8VA 2DTJA 4JI2F 3NNCA 2N3LA 3HULA 4FYDA 3H4DA 1NB7A 1JLBB 4OJ1A 3HVRA 3SQGA 3SV4A 4TY8A 3R5CA 1TELA 1MSWD 2XCAA 2MHEA 4J9KA 1Y3JA 3MAHA 3FZ2A 1KQKA 4FBUA 1RSCA 3MM9A 2J9EA 4LR9A 2RUGA 2H5EA 2M7SA 2DIVA 1ULRA 4J9SA 4NA1A 5L1IA 4YR0A 2DITA 2PMWA 1B0TA 4OYWA 3FVYA 3HHLB 1PBUA 1FNXH 1P8GA 4ANCA 2LLZA 2HRTA 4K4XA 1CG2A 1TV6B 3RJMB 1H73A 4YY3F 4C4WA 4M63A 1P27B 3A8IA 4J7CA 2BOPA 5HVGA 4OYZA 2VB6A 3SI8A 3QIPA 3M8YA 2HIQA 2WOMB 3BQ2A 3D6TB 2QT7A 3DRRB 1N0VC 2EKYA 3CJKA 1NBEB 1SJQA 4QYRA 1LW0A 1S1WB 2AMCB 4RUCA 3JQMA 4CYUB 2MZSA 4DQQA 1HD1A 2VASA 2YH0A 4JI4F 2BJ8A 2ZWPA 1BE4A 4C11A 3CJSA 4M94A 2HNYB 4ZITA 2GX8A 1OMSA 4B9VA 1FEEA 3GIRA 1KSPA 3VV2B 4ZHRA 4R0EA 1K0VA 2XHWA 2DR9A 2IVFB 4DZDA 2CPDA 1K1QA 3IM8A 5K8PA 1TKDA 3O8WA 1W26A 4O3NA 1G6BA 4DLGA 3WC2A 4HHHA 3JQJA 1MWYA 2FTRA 2BJ9A 2BBEA 5M2RA 2B6AB 1VR6A 1ITPA 2RQCA 2HHHF 2RE1A 2QLBB 2WCXA 4ZPWR 2QFJA 2MQ8A 2AGOA 3G96A 3O5TB 3HHNB 1T11A 2ZVSA 3M2RB 1S57A 4EU0A 2L48A 2Z2MA 2DHAA 3M30B 2OFGX 4ECVA 1MN9A 4J5OA 3MECB 3L9ZA 1T9YA 2K7KA 3J7AN 5DLGA 4QWAA 5CYQB 1X0PA 2ROPA 3SZ2A 1PSDA 3V4MA 1MN7A 3ZZTA 5D0EA 3T9NA 1VRUB 1RWKB 3PKMA 3JXOA 3FEZA 2K7JA 1HWLA 4ETZA 5CXTA 2CNKB 4LREA 1NJZA 3EMTA 4B3TF 3L7OA 1U2RA 5AXLA 5E7OB 4MIWA 2GQ2A 1TL4A 5E3CA 2RMLA 2VF3A 2W01A 3JYTA 4ILMA 5F8NA 4ZLPA 1U49A 4CLTA 1VK3A 1KNZA 1RT1B 1D3WA 2QL5B 3DDNA 2C3OA 1FRJA 1OY8A 2W9AA 2GCFA 3C6TA 5KFJA 2B7CB 1I6JA 4ZS6A 1UVKA 4DF8A 2WRMA 3PYGA 3C14B 4P52A 4LRAA 4OYBA 5K9FA 3I96A 3W62A 3Q8VA 3ENVA 5DDRC 3CXCR 1DBDA 1YRXA 1EETB 5BR8J 2QTWA 1RWUA 2LDYA 4EEYA 3ILIA 1T3OA 1P6TA 5KFPA 5GAHU 4ED5A 4N7TA 3O1LA 4HDHA 2KZZA 4OYXA 3MCMA 4IDKA 1WOOA 2BOAA 1VHFA 2HHQA 2JVOA 4ZVGA 1X0FA 1QUVA 5D15A 1BY9A 4NPOA 3ZZUA 4CWBA 1N34F 2RF2B 2I2YA 3FFIA 2BJ7A 3TZXA 1M5VC 3M2RA 4URQU 2E5LF 1I94F 5G0RB 3M30A 5LM7E 5J2PB 3H90A 4QOTA 2C3UA 3NBPB 3AA9A 1C4CA 2B9WA 2KM8B 4OZJA 3AQOA 3MECA 4A8SA 3QJJA 4MAKA 2IIHA 1I5OB 3AQPA 2OTJS 2QRRA 2LMIA 2C2NA 5D0GA 4N77A 1T05B 2WONB 1GT8A 1T03B 4Q0BA 1OY6A 3MAAA 2F5GA 2CJKA 2XNQA 3PW7A 4O3PA 3EXYA 4CH0S 4O4GA 1IM6A 3KJVB 1APSA 1HR0F 1T8EA 3V6HA 5D4NA 2CPXA 3NGTA 5KFAA 3W63A 4M5MA 4ZA1A 3EPGA 1QAIA 1FDNA 5J1NA 3FRYA 3FBBA 3BSOA 3IMQJ 3MR5A 3NCRA 4FPRA 2DNGA 3SFUA 1XNRF 1S6UA 3NMRA 2FJAB 1X8DA 4NLSA 1S1VB 3TR5A 2XGQA 4X66J 1WWHA 1CULA 3H2LA 3CCRS 1JLCA 4JI6J 4LFBJ 3HKZD 2H5IB 1K44A 3K0JA 2EG2A 3M32B 1R7IA 2L9NA 4MIBA 1FXDA 4Q5VA 2WSEC 1VFJA 2KT3A 4MK9A 2JOQA 3GJSB 1LK7A 3IS9B 2Z4PA 2KFYA 4W92B 3M6VA 3IM9A 2OJ3A 3NS5A 3CDEA 3TX0A 1ACMB 3DMJB 2X7IA 2R42A 3HVAA 1VMBA 5D6GA 3MR7A 3HJFA 1XWLA 4FXVA 1S79A 5AE2A 2CVEA 4Z37A 2J6TA 2ZUGA 1QSSA 2R2RA 3G8TA 4NX9A 2RNEA 2CQCA 2DT9A 4IOCQ 3GSIA 3JAMY 2ASYA 3LP1B 4ES3A 4YB1P 3GYGA 2RKIA 1WACA 4K4SA 2K8GA 2QA2A 4NEZA 5D4PA 5K20B 3MEDB 4RW4B 2R3VA 2YQ1A 5G0RA 2HMIB 2IMOA 2PI4A 1TKZB 1FFSB 3SV3A 1HNWJ 3HSZA 4YFUA 1FRHA 2QV6A 4OLPA 3QO9B 5KFFA 3HFVA 2MGZA 3Q2TC 5D8HB 1SUQB 4QWEA 3PNIA 1T03A 1NHUA 3O44A 1HL6A 1DLOA 3C15B 4DCOB 2DGOA 1C1BB 1HBUA 1S77D 5AJ3J 3K5OA 3QLHA 3THPA 4EGLA 2M9KA 4WYWA 1DARA 4ZVFA 3UCUP 2RRAA 3DLKA 2AZ1A 1K9MT 5HMXA 3WDOA 5C5JA 2CPJA 1Q8LA 1RT2B 1NAQA 2R2UA 1VQ6S 4JV2A 2ZOGA 4ECQA 2XG8A 1N6QA 4ZN3A 3G8QA 4DL7A 3QT8A 2DO0A 3MM8A 5CD4H 1RYSA 1HNZJ 4WK1A 3CE8A 1JB0C 5DGBA 5ADZA 4J9UE 4L6V3 5RUBA 2JLEA 3IS9A 1S1UA 1N8RT 3M8SA 2D74B 2DNMA 4YHHF 2P9CA 3UD4P 1K0TA 5DLFA 3VAFA 3D6MB 3AFGA 1XMOJ 3EYZA 3I6PA 1DTQB 4A46A 5FJ4A 4WJBA 4DEZA 4RLEA 4O0NA 1QVGR 5KT2A 3OFEA 3CPWR 3MD3A 4FYXB 3TJ9A 3LP1A 2DBBA 3KMSA 4JI7J 4C8YA 3VF0B 2YKNB 1DQ9A 4RJVA 4HI2A 3DYAB 5CYMB 3RU0A 4ZVPB 4WIIA 2APOA 2ACYA 1NDLA 1ZM4A 2HMIA 1S6OA 3V4IA 2VOPA 4OI4A 4RW8B 2FDNA 4KHRA 4OX9F 1UA0A 3TZZA 4NLXA 1NNDA 3DGPB 3WIUA 4GKKF 3PX4A 2KN4A 4M1KA 3ZC4A 1I3OB 1C2PA 4DV6J 1TQLA 2M4MA 4V19X 2HKEA 2YNHB 2GQQA 3DLEA 7AT1B 2DY1A 1C1BA 5LMNJ 1IR2A 1G7CB 3C16A 4OHWA 5AT1B 1ZM2A 4O3QA 3L7UA 2AZ3A 2VD3A 2XBPA 2YKOA 1VQSA 3TNVA 4F2RA 4K4VA 3RB6A 5I3QA 4LFCF 2CPIA 2DXEA 3D28A 1KONA 3W65A 4OYIA 3RZAA 1KWMA 1RLDA 3ONQA 3PXGa 1SIZA 5KFWA 3RBXA 2AYMA 3UDVA 3FSYA 1M5HA 4DCPB 2Z56B 2QO3A 2V0NA 5HMYA 3FSIA 5M2PA 3OXLA 3LUYA 3Q8YA 2JJ4D 4RBTA 1ICEB 5CQGA 1TP7A 4WYLA 4PWWA 4XO0A 2C3PA 4WPAA 3CCSS 2LU2A 4FDFA 1RWPB 1HNIB 1DAXA 2BACA 2G0JA 2J9DE 2ZEJA 1NK5A 1KOHA 3HHKA 2B9XA 2UXBF 3OFHA 5GAGU 1UAWA 2XMMA 1AROP 2R8HA 4ZVOB 1GXUA 2I1RA 3NWRA 3QSYB 5LSOA 4DV5F 4QIEA 4JV5J 1WC1A 4NLYA 2Y0BB 3SDEB 4DV1F 4U8YA 2Q6BA 2YKNA 3QATA 2CPEA 1FCAA 5CYMA 1NPKA 4J9MA 4DV3F 2GZOA 4GC7A 3TAMB 1YHQS 5KAKA 2AJ1A 3M8QA 1IBKJ 1LWFA 5L1JA 3HVTA 1HI1A 1CJUB 2V8PA 2EG1A 2HQ3A 3IC1A 1PGZA 4B9SA 3SYZA 1I1GA 2J0XA 5JUMA 2M2BA 4NZ6A 4CNZA 2YNHA 1QD1A 4CNYA 3M6XA 1VQLS 2V8HA 1VLOA 2P6TA 4JI8F 5IT9Y 3RGIA 2RDDA 3OTDA 1B7YB 3AA8A 2BM1A 4CO3A 4J37A 2LQ9A 2FHOB 4PRFA 3EZ5A 2UUBF 3ZZPA 4PUOA 2FZKB 4PQUB 3CCTA 5LMUF 2LA6A 4OHYA 4F4AA 1TK0A 5K14B 5D4OA 3QRPA 4K4UA 2Q3PA 3ZTQA 1FERA 4F3QA 3T1YJ 2DH7A 2H3EB 1TVRB 3NAIA 3Q24A 4P75A 2E5HA 2JFKA 3KYLA 3FEYB 5I42B 4C8KA 4DV0J 4RNMA 1MU2B 1HNIA 4DX8H 4WTYA 4U8VA 4Q8FA 4RNFA 2EPIA 1ZOTA 2BANB 4N56A 1VJWA 1ZETA 2PT0A 5U47A 3W2VA 3BBCA 4RU2A 4CO4A 4HI1A 3M8WA 3UE2A 2NYIA 1JK9B 1EQ0A 2XMJA 2R2TA 4QR0A 1NKBA 4RUHA 3E3XA 4CDIA 4OZLA 3T5KA 1AFIA 3TYTA 1WOSA 3IWLA 3TUIC 2OPRB 3F41A 2LECA 4CCHA 2KM8C 1ELOA 1FKPB 2QIFA 4ZPVR 4LR7A 1JWWA 1VI7A 2DB1A 3AXMA 1HW9A 3IRWP 3ILLA 5LOQA 4IUFA 4X4VA 3K17A 5DETA 2W8KA 3W8PA 4PYAA 3VAHA 4QWBA 2BQUA 3A8KA 3CDUA 1NRKA 2W24A 2W25A 3C8YA 3W9HA 2AJ0A 2VICA 4USUA 3S8SA 3KHGA 2DJWA 4DWIA 3GJTB 3A3PB 1HMVB 4ZCLA 3BBBA 5THWA 4C3LA 4F50A 1S1XB 2PN6A 2JEJA 2DNKA 4AQYF 5F41A 3OXGA 1FX4A 3PACA 3B82A 2V9WA 3MOZA 4IR9A 3K8VA 3DLHA 2EFNA 1O5JA 4S0MA 4C8NA 4JI1F 2HS0A 1HWUA 1L5UA 4NXMF 2QX0A 2QA1A 4X4RA 2DPJA 5K14A 2YKQA 4P2SA 2JHEA 3M4XA 3HO1A 4LF6J 3TEHB 2EC2A 4ZIWA 1HQEB 5MAOA 3HXMA 4RBVA 4NCAA 3V6JA 5I42A 3TUPA 3RAMA 3ISNC 2UZAA 3ZZ0A 2GVDA 2W2OP 4C48A 2XYGB 2VDIA 3OXFA 5B09A 1C0UB 4RNHA 4DR5J 1R3NA 3FC9A 4CLWA 4X4SA 3TA2A 2BE2A 2YKMB 2PA3A 4W4MA 2J0SD 2B5JB 1UWBA 3P5TL 4F3MA 3FGVA 2V34A 2OD4A 4DQIA 4B3OA 1NEEA 5HQMA 4ZP7A 2RB7A 3LANA 4X4QA 5B0EA 4OFZA 4H4OB 4BDPA 4GKJF 1QY7A 4ANDA 2HHHJ 1FRKA 2HQCA 2DNQA 3I4HX 3Q0AA 2MQLA 3EUNA 3TZWA 5CA5A 1H2UX 3OJUA 3LPYA 1R6YA 2FB0A 1KKHA 2DNHA 4C0OC 4FF4A 3PCOB 4KE5A 5LXYA 1F9FA 2JC0A 1S97A 1GXTA 1N5YA 4RNOA 2D9PA 4IG0A 3PRBA 4CLZA 3G86A 3BBFA 3JQKA 4OLOA 1S1XA 3K59A 1VDHA 2F9JA 3IWXA 4UW2A 4JI3J 4AL5A 2C2OB 2CQ3A 3F44A 3A1YG 4I4BA 2MKCA 5EHHA 2RVJA 4B3RJ 4DS5A 1C4AA 1CVJA 2KXNB 4KY3A 4B3TJ 5D0HA 1AUSL 3T1HF 1BUXA 4AYBD 2VC1A 4WKYA 1P9QC 2AGPA 3DGVA 3KOAA 2YQ0A 3J7ZT 4NLUA 4P71A 4I6WA 1N36F 3MAQA 2F4FA 2I6WA 4XDDA 4ZKAA 2J8AA 1WOPA 1RT4A 2CNNB 5D4LA 5KG2A 2G0CA 4YOEA 2FGCA 3N5FA 4PAAA 3C46A 4PZVA 4R5PB 2E5GA 4GVBA 2L41A 1OPZA 4TU8A 2FVCA 2ASJA 3H5XA 2Q66A 4MT1A 1YVFA 3R7SB 5E3AA 4B9LA 3FUYA 3SQOP 4IG3B 3GFYA 1RUSA 3CJQA 4I2PA 3GIMA 2EK6A 3VGSA 4X4UA 5HO4A 2K1RB 1VJQA 1VRQC 4LMZA 2ZNZA 3HHDA 4ILLA 4ELUA 3FEXB 1U47A 4CLKA 4ENOA 2NREA 5B0BA 4KPYA 1RHMB 1HWJA 3THTA 4HHJA 3PW0A 4K5SA 1YJ9S 3HF5A 3I0RB 2ZJQQ 3CCUS 4AD6A 1YI2S 1VBYA 1LW2B 4LF9F 3NS7B 4F36A 3F73A 4J9PA 4USHA 3GONA 2QLWA 1KQSR 3HX9A 3WX8A 2J8SA 2H48B 2YNGA 1TAQA 1WHVA 1IQTA 1PYOB 4LRFA 1RTHA 1NSAA 3MURP 1GTEA 2B0GA 3U27A 4HEA9 1EB0A 4WFZA 3W9JA 4DMZA 4GC6A 4NLQA 4B17A 1AYEA 4BC9A 4F3OA 2MKYA 1YLXA 2O3DA 4F4KA 5CZVA 2LEAA 3UN5A 2BE7D 1HPZA 4U7UK 4RZRA 3NNHA 1WI6A 2J5AA 2RJZA 1FK9A 2ZH9A 3Q22A 2R4FA 3ADAC 2X1GA 4ID8A 3NS6A 1Y5NB 5GMKa 2HFUA 3WX4A 4ECZA 4DL0C 2Q6CA 3K5NA 3AY0A 3VGVA 2KG0A 3AB2B 4FZVA 5ETQA 4J9LA 1N5SA 2KDOA 5HBMB 3B78A 3Q8RB 1UTAA 1XNQJ 3J7YI 4PR6A 1ZPWX 3W61A 1WC4A 4MYUA 4BWMA 2JNJA 3MMBB 1N0UA 4A48A 1KS2A 2F63A 2D1CA 1RT7B 2F8EX 3LWLA 2D3ZA 2VPWB 2HS4A 1WSRA 1X4EA 3DFEA 2HHWA 5DO2A 4E0DA 2AEJA 4ZJOA 2MKJA 3E2EA 1UW9A 1YJ7A 2VA3A 6FDRA 5J2QB 3J80Y 4L74A 1B7FA 4L75A 1IKYB 5T41A 4USKA 3CD5A 3TEGA 1OSDA 2KB2A 3VCDA 1F2GA 1OIAA 4F4ZA 1Q7YT 4WIQA 5IC6B 2X51A 1WSVA 5A2QY 2Y1IA 1U0HB 1Y4ZB 1PIEA 3BGRB 3TW0A 2QMXA 4F26A 1TK8A 5ITHA 4KHPJ 3I31A 3G6ES 5LJ3Y 1X4HA 2I8EA 1DZ5A 2VL1A 2V68A 1V9OA 2MB0B 3JSMB 1PJ6A 4CM0A 1D9FA 3CMES 4NLPA 5T14A 4NLVA 2F65A 2E1RA 1WHXA 3CO9A 4FYVB 3BN4A 2ZE2A 5L8RC 2XCPA 4DBQA 1IR1A 2XMVA 3IFEA 1CJKA 5GMEA 2CRLA 3N6NA 1LWCA 3VQTA 1FFWB 1OPIA 4ICLA 1FDDA 5C25A 3HFKA 4ECRA 1YX2A 2HQFA 3ZTRA 4P74A 2A6OA 5EWEA 5HROB 3GG0A 2XWYA 3BQ0A 5IM0A 3Q8SB 2MQQA 5JMNA 1ZTTA 2GA7A 3Q2SC 1FRIA 1Q79A 2RT3A 4ED4A 4ZLNA 2AV5A 1WUUA 4DS4A 2QFIA 5J2NB 1HYSA 5HBMA 4DPYA 3DDKA 3D5MA 2V2QA 4NXNJ 2DD8S 2CDQA 2V4QA 2HSEB 1Q0NA 2YWKA 2D3OR 2B9EA 4X64F 4L3NA 2ADCA 4DV4J 1EP4B 2HRUA 1UMJA 3SFGA 2MEWA 2AQ4A 1T0TV 3UVJA 2NPFA 4LSNA 3MMCA 1UJ5A 5C7PA 4DOZA 1G1XA 2BKNA 4D3HA 2BZ2A 4HHUA 2F8HA 2QLXA 3OR2A 5J2QA 5ETSA 3M8ZA 2ILZA 5HK4A 3UNYA 4G3IA 1AZSB 4I7FA 2DK2A 1U6ZA 1K47A 1UVMA 2HGMA 1N5QA 3DLGA 4MK8A 2PDAA 3TP2A 1JLAB 1NZ8A 3CCZA 2NUUG 1CS4A 2QA4G 4XIUA 3RRGA 4KIAA 2HYIB 1RTIA 1N32F 1T02A 1B64A 4G6VB 2ZBIA 5T7LB 1WG1A 5CD4A 3QGPA 4USJC 4I6AA 2POKA 3JSMA 3E8OA 2DVIA 5L46A 3UPFA 2X1FA 4L76A 1YITS 2HFSA 4HLBA 5K5MA 4ED3A 3BZQA 3C66A 5A0YB 1NDPA 2GHPA 1KHVA 1YRUA 4WP8A 5KT4A 2OH2A 4LR8A 3KLFA 1IXKA 3CVKA 3PEJA 4ED6A 4PABA 4NCGB 2HZCA 4URSA 2HBZB 3QNWB 2IJRA 3FKBA 4DV7J 3S7RA 2OEMA 1MLAA 4EI2A 3CC2S 2MMYA 1YDLA 3RB4A 2F4VF 4DPUA 2H1YA 1NKEA 2J7UA 5ETRA 1VQNS 4FP9A 3MCNA 5GADU 3RAXA 5ETLA 4RL1A 4ZCIA 3BREA 2MZJA 4ATNA 1SC3B 1ZH5A 4NA2A 4QYZJ 2MYFA 2YTCA 3PDNA 4FYYB 3MEKA 4HVZA 3N6LA 1Q5VA 2WVEA 1TMMA 1FRMA 3JSRA 2BV3A 2W2MP 3H59A 4P72A 1YRTA 3T5JA 4KFBB 3T9ZA 2BQ3A 3V81B 3CCQS 3N5BA 5DZ6A 4YP3A 2NQPA 4WZQA 3UDCA 3BR9A 1JXVA 3D2WA 4HL9A 4M95A 1AZSA 5DDPC 3PEHA 4LF4J 1F0XA 1S9FA 4RO0A 3EE3A 4OIXA 5ETNA 2FVQA 1AA1B 2ZFHA 1Q8KA 1SI9A 3DKDA 4JOUA 5IQ6A 3GWCA 3OLBA 4X62F 2GGPA 3L95X 3H98A 5DQGA 1H2VZ 2XMTA 4K5RA 5EUHA 4U7CA 3HHLD 3LH2S 4FS1A 1RTJB 3OBIA 2R7QA 3UQSA 1SL0A 1RHRB 4EZ9A 5GAEI 5GAGI 1U2FA 4CT9A 4Y6IA 3A8EA 2MHNA 4M5LA 2WBMA 3ZZOA 3RB0A 4DFJA 4WE1B 3M05A 2BJDA 4Y28C 1U02A 2V8GA 2P2CB 2F1FA 2EFPA 4X65F 4UZBA 1HIYA 3P6YC 5HATA 1Q4RA 2IYGA 3ITHB 1SJ1A 1YQHA 4WP3A 5DZ7A 3OSPA 1FFGB 3K57A 2OEJA 2UXCF 3IG1A 1NH8A 2DCLA 4OYMA 3DRPA 4MKVA 2CPHA 2ZBQA 3GV7B 3TAQA 5ETOA 2UUBJ 1RAHB 4ZJQA 1EHWA 1OS5A 2OPQB 2XSJB 2EFVA 1YKWA 3LALA 2VFUA 4TU9A 1RADB 1A7GE 3NXZA 3P5BP 1XK8A 4LF8J 4EO8A 2OD6A 3G82B 3G2XA 2GIFA 5I3UB 2NXUA 1T9TA 3AJDA 4DUYJ 1TL3B 3QT7A 3GYNA 3IRXB 3A13A 2HHTA 4PXBA 1NJIT 5G4DA 3OL7A 4ECTA 3KLIB 4USWA 2MJNA 5A2QU 2CZ9A 4ZDNA 1HQUA 3ICLA 1FJCA 3DOKB 3QIDA 3KHLA 4WXWA 2EBEA 4RPFA 1J5EF 2KRBA 1XR7A 4M5IA 3ENQA 1VIXA 2O01C 1URRA 1UZHA 1NK8A 2P9GA 2BJ3A 3ETOA 1J5OA 2LXUA 5J2MB 4OQJA 3EGZA 2K3IA 3BB5A 2NSBA 5HP1B 3BO4A 1F3FA 3K8WA 2G2OA 1FVQA 5C42A 1HBNA 3BYRA 4DX7A 2I5JA 3WIVA 4O3OA 2BRKA 3RW6A 2FHJA 1VQ9S 1JLGA 4QIGA 1WKLA 3GB0A 2A18A 2YNFB 2ZD1B 3HVWA 2VQFF 2EFOA 2ZBCA 4MFBB 4WE1A 2KZMA 2BYCA 1F6TA 2ZM6J 5IZHA 2DHHA 3C3LA 2VHGA 4YR2A 1IJEB 1ZYQA 4RW7B 1SQEA 2ATCB 3CW2C 5BYRA 4HTJA 4U6PA 1JMTA 2UUCF 2C28A 1Q5YA 2ATLA 3PY8A 3R5GA 3OJSA 4PXCA 4DSFA 1J27A 1RBLA 2JZ5A 3CJRA 4NXMJ 4EWTA 1NM2A 1M1KT 4K0KF 2OPQA 2XSJA 2J6UA 1F5BA 4DR3J 1NK0A 4M5JA 3KG4A 2UUAF 5F8LA 1WKJA 1CPZA 1SXLA 3HMJG 1QTNB 1G3OA 1TUVA 4WFBQ 3OLAA 2HK2A 1YGYA 2WW4A 1TKXB 5I3UA 1P9YA 1FF2A 2LQJA 5E41A 2O66A 3O3LA 4ZVEA 3LGMA 5E2QA 2QJ3A 2VG5B 2OIHA 2ZKUA 2NSCA 4NEYA 2F7VA 4UT4A 2W9CB 3KG0A 3PV8A 3DI6A 1D1UA 3DOKA 3SMZA 3GIJA 4IRKA 2GIQA 1SH0A 2CWXA 2YX7A 3MZIA 4F2SA 4PWDA 3RTVA 2FLPA 3NP5A 3CCWA 3GFHA 1TU0B 2SXLA 4HKQA 4KGXB 2LEPA 3Q83A 4H4MA 2C2RA 4YEAA 1WELA 2GNKA 4LF7J 4UUXA 2V50A 1RU1A 3EXCX 1GH8A 5H9FJ 3H5YA 2B43A 2M88A 1FWKA 5DJBA 1IR0A 3MMJA 1GMVA 3GMGA 4KAIA 3RAQA 1KQGB 4R8UA 4K4ZA 4PPDA 4GMKA 3DC2A 2WB4A 3NCPA 2AEFA 2ZZMA 4MJKA 4R25A 4K50A 4YR3A 3IP0A 1YIJS 5KFOA 2JL9A 2GS8A 1SC6A 3RBZA 1JLFB 1XR6A 1WDTA 4RW7A 2Z57B 1UL3A 1DTTA 2CWKA 4DJBA 3DRSA 3OPKA 3I9V9 1ZAWA 2XMAA 2R2SA 3OTOF 3A8JA 4NOHA 2VZ9A 3JS9A 1W2BR 2CQ1A 1F9HA 2QSFA 3UW1A 3I0SB 2HFZA 2RQMA 1SC1B 4C7QA 3UDEA 1MROB 3KJQB 4CLPA 2ZKTA 1Q78A 5EN1A 2R7VA 5KFBA 4O23A 2EC0A 2VBZA 2HEKA 3R5JB 4OJGA 3X1LB 3OV7A 4Y2AA 2RQKA 3CDWA 3P3DA 2DISA 1LQ9A 3BO2A 3BGOP 4LIRA 2MKKA 2KL8A 3SSRA 2OP5A 4OV1A 3J81U 2VG5A 1UVIA 1QE1B 1T9XA 4USMA 3DOLB 1URNA 2HQDA 2W9CA 1FO1A 3SXLA 1PYSB 4UTGA 3OL6A 1REVB 2UXDJ 1LFWA 5A76A 1PC5A 4FF2A 4KR0B 1U25A 1H0HB 2ZDPA 3VWSA 1T95A 3MPVA 4TY8B 1RT3A 3BJYA 5J1EA 3QRRA 1TTHB 2R7RA 4RNNA 1B4SA 2DRBA 4JP8A 2IDEA 3UWTA 4K4WA 4NA3A 4C6AA 2ASLA 3MM9B 4TQSA 3AODA 2VG7A 3I5AA 4CH1A 3KHRA 3EICA 2Z0GA 5F8HA 4V19J 1XMQJ 3IAM9 4USVA 1UVNA 2BEFA 2BXJA 3MUMP 2WSFC 3KK2B 4YB7A 4LSLA 1IWAA 2VG6B 1TFWA 2JVRA 4FF1A 2EKNA 4R0JA 4WU3A 2ZWOA 1IBMF 5F8MA 3QIPB 3EZUA 4RU9A 2ZITA 3OT9A 1UETA 2FYXA 2U1AA 4QW9A 5L38A 3CJKB 2DPIA 5IWAF 2W7PA 2LXIA 3BS9A 4NLWA 2MQNA 3UD5A 1S76D 4O0IA 4DX6A 3N28A 4J9RA 1L3TA 5LT5A 4QWDA 2WVFA 5L39A 1NK4A 3T19A 4C11B 4ERDA 1HA1A 3OFGA 3I0SA 4IRDA 2K06A 1HNXF 1C1CA 4FVMA 4Y34A 3M1VA 4ZHRB 2N7CA 1GK8A 3QFHA 2MZQA 3M9OB 4WXOA 1Q8IA 3EDQB 5HVFA 1U8WA 1M90T 1RAEB 5KOXA 4C98A 2DNRA 2LP4A 1R0CB 3FDSA 1NPRA 3OTEA 3SSQA 1WF2A 2LQBA 1QE1A 3HP6A 1LXNA 1KHWA 1H6KX 4C8OA 3MI7X 1N33F 2IAJA 2HZAA 4LFAJ 3D0HE 1IQZA 2HHSA 4NLDA 5KFIA 2IY5B 5KG5A 4YN3B 4QW8A 1BLUA 4USTA 1HWIA 4A8MP 4IH5A 2CA9A 1VCTA 1RQ0A 2L9DA 4CP5A 4KKOB 2BX6A 5AXNA 1T9VA 3OR1A 5B0DA 2BMBA 3R7BB 3MFHA 4OV6A 2ROEA 4ETXA 4EBEA 4DL2A 3AJ1A 1TL1A 1RA7A 1FT8A 2IBKA 2DGVA 1HWKA 1GMWD 3KUGA 3WC0A 1TKTA 2OUGA 1T9WA 4AL7A 3FBCA 2HS3A 2JDJA 2B8QA 4DU7A 3KK2A 3R2CJ 3SBMA 3W5YA 2VG6A 1Q81T 5LSLA 4N8OA 1UFLA 3BH7B 4DSIA 4DR7J 3DM2B 1X4CA 3JYTB 3UR3C 5HSPA 2A6MA 2HBYB 4CO1A 3UN3A 2KT2A 4GRSA 4OYAA 2IVMA 4TY9A 3K5MA 3HKWA 5FIIA 1SL2A 2LQ8A 1ZBTA 4ZVQB 1T7PA 1OYDA 1N54B 2YXLA 5KFRA 3NKYA 1R0AB 4OI3A 4WFAQ 1GXLA 3C6TB 3PM9A 1TAUA 2MQMA 1HBMB 2ZZNA 2GW8A 2VBYA 1HD0A 4DL5A 3CJ5A 4N76A 3FRZA 4G1QA 4UOGA 2HZVA 1WC6A 2QN6B 3D1QA 1VGYA 5IS2A 1IJFB 2AX0A 4IOAQ 1BMQB 5KFSA 1U4BA 4P2FA 2BJ1A 4QR1A 2OTLS 3QZ7A 2FJVA 3VVUA 3LP0B 1HQ2A 3SIPB 1RCXB 4M5KA 4OZ5A 4F04B 2A0FB 4IDKB 2RHQB 3LGHA 1RISA 3DRXA 1BWVA 2LU1A 3FFIB 5KFEA 1Y9OA 4QPTA 5GMDA 2QZ8A 2MPUA 3EGWB 3MTJA 4LRCA 2R7TA 4KKOA 4BLGA 1B70B 1PKUA 1JQGA 2YBVA 1T94A 3BGLA 1REGX 5KFDA 1Q8BA 4ZVUB 2VKRA 2AD9A 1UFKA 2O67A 5HJYA 4A47A 3T3FA 2EK1A 2W9BA 4Q0BB 3MAAB 4NRTA 2IYIA 5DQHA 2BR0A 4K4YA 4ZCKA 3H5SA 4O4GB 5KFKA 2CZVC 4CI0B 3QMQA 4WWSA 2FHJD 1W25A 3DOMB 2XZDB 1S0MA 2XEXA 4ZLLA 2RU9A 3DM2A 5E3PA 3PVXA 1NCLA 5A8WA 4X4NA 2G2YA 4FNHA 5L1KA 1NJXA 3HSGA 3AH6A 1N88A 2YQ3A 3AT1B 3KDNA 4ES1A 1LWXA 4O4RA 1R0AA 5BR8F 1QDUB 2YPZA 1X7VA 1X4BA 1CULB 1RABB 3QAUA 1JLCB 1XERA 3H2VE 1A9NB 1TUWA 3MM6A 5DG9A 1HBMA 4IH6A 4DI6A 2DKOB 4J90A 4ZPBA 3CGIA 4AXIA 2W7OA 3OD2A 4I1TA 3TVKA 1SJRA 3QFWA 4LRDA 3PRDA 5HVHA 2L9WA 4DUZJ 2WVCA 1Y11A 3R3TA 3LP0A 3GP9A 1BQXA 1TR0A 3N79A 2MKIA 1NSKL 2GJ2A 7FD1A 3BEGB 2CJYB 3BPSP 4ZIVA 1FHTA 1UCNA 4UY8T 1SQGA 2ZC4A 2KHDA 3NG8A 1VLYA 3NEKA 3CULA 4M5DB 3TARA 4ZN1A 5DM7Q 4OZ2A 1Y00A 1S10A 4WFNQ 2KHCA 4ILRA 2BW2A 2RKIB 2PA8D 3BM7A 1H7WA 2BE9B 2G13A 2JEIA 1FWLA 3I56S 1YJUA 4PWUA 3PW4A 1KEKA 2V9KA 2DCUB 1AFJA 2I0XA 1ZM9A 3B8HA 2Z2YB 3GTYX 5FLXY 5GADI 3K5LA 2MGZB 4NI2A 3KMQA 1WF1A 2VH7A 4Z7YA 2C3MA 2EVZA 5KG6A 4ED8A 1X9SA 3AOCA 1JJCB 3PFEA 1DLOB 2V4JB 1HBUB 1WI8A 2YWEA 4X66F 3QLHB 2H51B 3HLUA 3DOMA 5KFNA 3NGDA 4MYTA 4JI6F 3IR5B 2CJBA 2GHVC 3DLKB 2J0WA 4MTPA 4I6YA 1X9WA 4ITSA 2Y0SD 2EFGA 2XULA 4NYOA 1RZMA 3GFZA 5L9NA 4YQWA 3R97A 4J9QA 4RWXA 1HHQA 1N6QB 4X65J 2FGOA 3MM8B 3WHIA 4ANEA 1PC4A 3UO0A 3CDBA 4KHMA 4HH0A 5F0UA 4EBCA 2XLJA 4WP9A 1YJNS 1U2CA 2KO1A 3B6BA 4KO0A 2A2CA 1S1UB 3BGFA 2ABYA 4GO7X 4YMEA 3CB4A 1WG5A 4TNOA 2FVSA 4MMOA 1HARA 2HFVA 4XTTA 4JYAJ 2H65B 3D66A 3HZEA 1R8PA 4J9NA 4YDXA 5KFMA 2XQCA 3BDPA 2MZ1A 1OQ3A 5F8JA 1SKRA 2W2QP 2E7WA 4M5DA 1HNWF 5ETTA 3P8BB 2KH9A 3SCKE 1R27B 1PBAA 2J6SA 1RBOB 1TL5A 5GVQA 1J2VA 2ZOFA 4ID5A 2YX1A 4H54A 1VQ4S 5IT0A 1T9UA 2UV8G 1R8CA 1Q7LB 3V4IB 1FNOA 1IM4A 3KDOA 1S0NA 4F0KA 5AJ3F 2O1PA 1JLEA 5F9NA 1GX6A 1UWAA 3MEEB 5K8NA 4B9UA 3PYFA 4PG6A 1QAXA 1D9AA 1JJHA 4PEOA 2VBXA 1OWXA 1S9EA 1WEZA 3R6GB 1H3DA 3MCSA 1IUJA 2LXFA 5EWGA 2QLFB 2V67A 1SC4B 2V4JA 3DLEB 4JI0J 3GLJA 4DR2J 3ZZRA 1SJ3P 4WZMA 3C16B 2OPPA 3BO3A 4W98A 4MKAA 3TA0A 1OQ6A 4FKYA 4U9RA 2PEBA 1P1LA 4HDGA 3QQCD 3PR4A 4Y2CA 1PAUB 1AUDA 3JSBA 1HNZF 2Z2LA 4F25A 1S6PB 3NGRA 3TVZA 4LBIA 3PRVA 4K7QA 4YS2A 4Q43A 3CCVS 2KVQE 2FZCB 4C0BA 1XMOF 4JI5J 5E5NA 3ILJA 2HWHA 3A3OB 1H98A 5DGAA 2RRNA 1XC9A 3IWNC 3CCMS 2C3YA 3MDFA 2RAQA 2CNLB 2CADA 4P73A 1KVKA 2QL7B 3TVYA 4Y0FA 2QL9B 1KQFB 3MTKA 2JSXA 2VJVA 2I38A 5A8KB 2C2MB 2ZJRQ 2RDJA 3CCES 2BW7A 4AFFA 1LXJA 1PILA 1VRTB 3DHXA 1S0OA 2MSSA 1MG7A 5F3ZA 2Y9HA 5KFCA 4IYQA 3TI0A 4DR4F 1KD1T 1YBTA 2QMUB 4DV6F 1R31A 3DRYA 2WZ1A 2NZ4A 3K58A 3B54A 4DU8A 3HCXA 1I51B 3NLCA 3M8QB 3G71S 1LWFB 2WVDA 5LMNF 3HVTB 4DFKA 2VPXB 2CUYA 4MK7A 3MEEA 1NMEB 4Y2MA 2YX4A 1RAAB 4TXSA 2A3JA 3KFWX 4O3SA 3LWMA 5CCLA 3U1MA 2IM0A 4LF5J 2B4OA 4PKDB 3OVBA 4LQ3A 2OO4A 1EZZB 2XS5A 5KOWA 2M8DB 2QYCA 2MJUA 3W2WA 4OZ3A 4O44B 1S59A 3D67A 1WC5A 2E7VA 3EVOA 1L3SA 3OTCA 3SCLE 2VFVA 3IR6B 1IKWA 1S6PA 2CNOB 4DCJB 2Y1JA 3KLVA 2E44A 4B3SF 2MKHA 4PUOB 2E1PA 1IBLJ 2QEXS 4DFMA 3W1YC 2RD5C 2O5DA 1WORA 3HM9A 3H7HB 2HNDA 1KLNA 3C19A 4JV5F 3CCJS 4H4KA 3Q8PB 4UY85 4TLRA 3CMAS 2HW3A 3LW5C 1YZ7A 4DR6J 3X3UA 3Q23A 2BQRA 3AAWB 1RTDA 2FHMA 2HAFA 3W2VB 3KLEA 3U1NA 3W5ZA 2CXEA 5A8KA 1IBKF 1NUEA 2B51A 3MWBA 4DFPA 3CJ0A 1VRTA 1VK8A 4WFYA 2OSRA 1DFDA 4FPIA 3MPUB 1HLWA 1NK7A 4NYPA 5KFUA 2Y1LB 3JTOA 5FLXU 2GC8A 1E6VB 3BYPA 3QGGA 4DR1J 1V3RA 4RW6A 2BJEA 3M2VB 2KXHA 2ZH1A 2CQIA 2XI3A 2DNYA 3V5RA 2W2NP 1FD8A 3P45B 5AXKA 3HJVA 5FD1A 5F0WA 4ZLJA 4I56A 4F4YA 3CIZA 4WKRA 3HI9A 2VQEJ 3NL0A 3M9MB 3I87A 4AUKA 5DDOC 5KFHA 4PXEA 1SBRA 2UUTA 3HD2A 3M2UB 4O44A 2VOOA 2VFRA 3PTWA 2C2EA 4XK8C 4CT8A 1N5TA 1UFWA 1SKUB 4NLRA 1GFWB 3V2UC 3T1YF 4EK2A 4QU6A 2EEYA 2C1EB 3CD0A 3HZGA 4HACA 3AD8C 2KRRA 4UUWA 2JX2A 4P10A 4DV0F 3GR0A 2XZTB 1FJGJ 1L3KA 4OJ3A 3MCOA 5CYJA 4P2XA 1UJ6A 5SZTA 2V2KA 4IKAA 2WTFA 1U0SA 2GIRA 1FRLA 3VZHA 4UF4A 4Z2XA 4X84A 1U1PA 4CTAB 2VC0A 2Z8QA 1UPPA 2GVDB 4DSKA 2NPIA 4LJMA 5I4MA 3FCWA 4KGMA 3NCQA 1VBXA 3D3BJ 1HNXJ 2CPYA 2HWTA 3I5CA 3OVSA 2R7XA 4I2QB 4TLQA 2BE2B 4OHXA 1S1TA 2V5HG 4YUDA 5AE1A 2R8JA 1SH3A 1BD6A 1UWBB 2BRLA 2XMKA 2OMLA 1V3SA 2XC9A 4C2MA 3OVAA 2XS7A 2NYHA 3C2PA 4B3OB 3NNAA 1Q1KA 4F0MA 4LSZB 1E6VA 1SJFA 1N33J 1BGXT 1M1HA 1JKHB 3M2VA 2MY8A 2LVWA 4CRJA 3K7RA 1FD2A 2XYPB 4JI2J 1SH2A 3MGJA 4OZNA 2AW0A 3AD7C 2DGQA 2MTLA 5HLFA 4KB7A 1N5YB 2DR8A 5BYSA 2FHKA 4IG0B 1NSQA 2DO4A 1WEXA 1V5IB 2PEHA 4NLGA 2Z2ZA 1X4AA 3QWPA 2U2FA 1F9EB 4YB6A 3T1AA 2IA0A 2Y1RI 3M2UA 2ACMA 3C6UB 2HGLA 4I64A 3GE9A 1VQ8S 4IFVA 4LF6F 4M5HA 4DL4A 3IN5A 4NRUA 4PG8A 2FLNA 1U7LA 1DHMA 2ZC3A 4OMFG 4LRBA 4YY3J 3DDIA 3MOJB 1TMJA 2B56A 1RB0A 2FJEB 1FKOB 1TK5A 1Z4UA 1FDBA 1RT6A 5E33A 4LVOP 1BQMB 3ZNJ1 2M8HA 2KU7A 1H72C 3MPWA 2BM0A 4TN2A 3TAPA 1RT4B 2OFHX 3IGNA 3PJWA 4DR5F 1Y5IB 4B9TA 2EI5A 3EVMA 2DNZA 3DXSX 2UVUA 1WHYA 1Q82T 4KGZB 4UZCA 1U1KA 3QPIA 3DU5A 2IM1A 4JI4J 4CTAA 4GVBB 2DHXA 2V8DA 4QWCA 1BHNA 3K5PA 3LTOA 1LWEA 4I67A 4Q8EA 2Y8WA 5KFXA 2DGUA 4N41A 2DNOA 2YH1A 2AGQA 4WK3A 4I2PB 4QU7A 4I2QA 4F67A 2GO9A 3OL8A 1U45A 1Z2ZA 1VQMS 4KGKA 5KG7A 5KT7A 1JLBA 1IWGA 3IBFB 2VODA 2OELA 1KTVA 2OGUA 3QBCA 3W3SA 2DY9A 1O6XA 3BQ1A 1EQMA 2G9OA 1LV5A 2ZOMA 1A6LA 1VQPS 3PX0A 2J76E 2IMWP 2XSFA 1VC6A 1CBKA 1JKHA 1ZA1B 1N56A 4DV2F 3HFZB 2E1CA 3UCGA 2XO6A 4JI3F 2ERRA 2CG8A 1X5OA 2HK3A 4A8FA 3BSCA 1ZZNA 2HURA 2YNGB 4B3RF 3W5XA 3UR0A 3HHLA 1HBOB 1VQ7S 1KVJA 2BUNA 4QIFA 1RTHB 3QT5A 4Q2LA 4G65A 1AXQA 1TV6A 2OPSB 2VA2A 1RBAA 3UD3P 2DR6A 2FJXA 3VAMA 4RKUC 2OI2A 2D9OA 2WOMA 4DG1B 2CAJA 1S4EA 3DRRA 3RBDA 3C6UA 2G0IA 8AT1B 4PPZA 5EX3A 2X1BA 1S48A 1S1WA 4NYZA 5HJXA 5IXUA 1FJEB 4CYUA 2XB2D 4QIWD 1SB6A 2XYHB 1HPZB 2YVSA 1K1SA 1YJRA 1FK9B 3BKUA 1FKOA 2ALYB 4NLTA 2HRYA 2HNYA 1BQMA 2WVBA 3PO5A 1ZAXA 1IKVB 4H4KC 3AJ2A 3H8YA 3CD6S 3TQEA 1WTBA 3ISZA 3CT9A 4OI6A 2GJIA 4LBPA 4ELTA 5BJRA 3RB3A 1FVSA 1KR4A 2XY7A 1VOMA 2B6AA 2DNLA 5DG7A 3F56A 1FE4A 2D69A 5KFTA 2W8LA 1WEYA 2UVVA 2UU9F 5CH7B 3QRQA 2FLOA 5JXSA 2WB1D 5HAOA 3M6UA 1B3TA 1OY9A 1JJ2R 3KUEA 1S7IA 5KG1A 2EBGA 1F60B 2J7WA 5CYQA 4ELVA 3T5HA 1N34J 3H25A 2CPFA 2QG9B 1UKUA 2CQBA 3J7YU 1VRUA 3GJRB 3QAEA 2DNNA 4ECYA 2E5LJ 8RUCA 2AYGA 4PG5A 1I94J 1HBOA 1QAJA 1Q16B 3HSDA 4ZP8A 4B9MA 2B3TB 2OPSA 4HTIA 3WBZA 1WC0A 4DG1A 5GAHI 2C2DA 3O6QA 2PC6A 5E3QA 3GV8B 5C24B 1RT1A 2PFDA 3BV8A 2L08A 4DPWA 1HW8A 4BC7A 2ZE2B 3G87A 2GQCA 3MF5A 1HR0J 1CJKB 5ETMA 1LK5A 5JVHQ 1FESA 1U1LA 1LWCB 1XNQF 3JTPA 2IJNA 2V2VA 3R1HA 4ICLB 4C3MA 3C14A 5C25B 2ZHAA 3PFOA 3E01B 4CLLA 1IKVA 3A3NB 1TZ0A 3MMAB 1WTFA 4B02A 5LXRA 5IM0B 2YNIB 5FDLB 1XNRJ 3OQ2A 3ZFVA 3CJ8A 1WG4A 1EETA 2DRAA 1HYSB 2XHCA 1PJ7A 1F5AA 2DGWA 5EDWA 2GO8A 4NZ0A 1K73T 2KFZA 4EYHB 2DRDA 2HGNA 3US5A 4WTOB 1ZTWA 2AJ4A 2CDRB 2R8KA 3S01A 3UVJB 2R7UA 2C22A 4LSNB 1N52B 4RWWA 2RF2A 3MMCB 4IRCA 2M3DA 3B4MA 4K8RA 1FKAF 1S49A 4ECXA 2B4UA 3OR2B 2M5YA 2YPYA 2JEFA 3UNGC 5J2PA 3HSJA 3NBPA 2ZJPQ 4KHPF 2HVIA 4G1IA 4ZVRB 2F9DA 2W4CA 1U1QA 2F40A 4I7FB 2J9CA 3DLGB 3F0NA 1X60A 1R6VA 5IC4B 3GCXP 1NSPA 4C9DA 1CS4B 1T05A 4F02A 2KI2A 2WONA 2YKAA 2RRBA 2HIYA 2UUWA 4USIA 1RTIB 4GO5X 1UPMB 2K2PA 1PJ5A 1VIOA 1RE1B 3PO4A 2PD1A 5BXIA 4IH7A 1OSCA 2DEJA 3KJVA 2HHXA 4QJVA 1NZAA 2EW9A 2MZRA 2R8GA 2AYEA 3KNAA 1HI8A 2DIUA 3OTBA 1O51A 1YBAA 2IRXA 3ULHA 4U7UD 1NK9A 4P7VA 3VQSA 1EARA 4UOCA 2PMHA 3I32A 4LT6A 5C24A 1UEUA 2KTQA 2COLA 3QWUA 3OHAA 1S1VA 2CQ2A 3VHQA 4KQZA 1AT1B 2R9LA 2LKZA 3DLJA 3VVTA 4NXNF 1P1TA 2GV1A 4A8XA 3KLFB 2V94A 4TU7A 4LIWA 2FJWA 2IFXA 3M32A 4RUBA 4I0WA 2AT1B 2JC1A 3E01A 3N01A 3I9ZA 3PHTA 3D54A 4DV4F 3MMAA 1A0OB 1VC5A 4N47A 1Q53A 1YG0A 5F8IA 2CJXB 2YNIA 2CQPA 1E6YB 5FDLA 3RUBL 3MEGB 4K4TA 4A8YA 5HI7A 1X4FA 2VPYB 1B0PA 4DSLA 2WAQD 3MR6A 3DMJA 4OX8A 3S1TA 1RKIA 1RKJA 2WSCC 1S4FA 2K3KA 1YWXA 2KT5A 3R5DA 3QYYA 1RLCL 1L3UA 3JB9k 4YHHJ 2MQOA 2IVYA 1FE0A 2CJAA 3TZYA 3DXBA 2B4VA 3MEDA 3OUYB 4RW4A 3D7SB 3NRBA 2IRYA 3FCVA 4DLEA 1TKZA 3HHEA 3SCJE 3P96A 1UZDA 2HFNA 4LUBA 3D9BA 2R7WA 1DJ0A 3HHLC 5KG3A 4QPXA 2V6AA 3QO9A 4DPTA 4X4OA 1S5ZA 5DDQC 2Z30B 1BWEA 1RXOB 1SUQA 2GMHA 4DR4J 4BHQA 4ZJLA 1V6HA 2HVZA 4Y2IA 1Q86T 2H9ZA 1Y0HA 2UVWA 2GGPB 2P8IA 5IV4A 2D7SA 3C15A 1RP5A 3K2YA 4O3RA 4TYAA 4CLSA 2AIRB 3VAIA 2YWGA 3MM7B 4OX9J 4FNIA 4AT1B 3NMAA 2RSQA 3G8SA 1NHKL 2XMUA 5KG0A 3EDRB 4KH0B 1D0EA 5L1LA 5DG8A 1DURA 4GKKJ 5CABA 3J7Z5 2LYVA 2CVIA 1CSJA 2DGTA 1RT2A 2YY3A 3TQ1A 4DV7F 4C3KA 2VFTA 2IBOA 3UCZP 4KH1B 4EYIB 4A8OA 1FNMA 2E5JA 3ZTPA 6FD1A 2AX1A 4LFCJ 3IG1B 3DRPB 3BKFA 4IO1A 1E6YA 3LQVA 1MW7A 4Z7CA 1JIHA 3MEGA 1Y7PA 3EZOA 4B3SJ 3AOAA 2RILA 3CNQP 3KLHB 1DTQA 4RX6A 4Q45A 3EPIA 2F8MA 5GAEU 4F7VA 3UN2A 4MKYA 3PHEA 2W4DA 2WK4A 5LJ5Y 4LF4F 2CPZA 4HYKA 2X3DA 1M5SA 3AB4B 4IFYB 2EFQA 1BC6A 5B0FA 3RG6A 3DYAA 1O8BA 2ZH7A 1XJWB 3CIMA 3EVWA 2UXBJ 4QZVB 3CWJA 3OUYA 2PIIA 3BSNA 1HQUB 4OYPA 2ZUAA 2GMLA 4LF2A 4DV5J 4RW8A 2XNRA 2V2ZA 4JB8B 4ZVSB 3J81Y 4DV1J 2A1BA 3DCAA 5AE3A 3ET6B 4KYZA 1QVFR 3DGPA 3M8PB 4E2FB 3ETMA 2LA4A 1OJ4A 3PYDA 4DV3J 1J5OB 1GMWA 3G4SS 3MUVP 1CC7A 1F2HA 4ZP9A 1NH7A 1UW4A 3RRHA 3E51A 3MM7A 1AB8A 4QCLA 1XIQA 3DU6A 1RCOB 5C42B 2DNPA 1HBNB 2PO4A 2V63A 2I5JB 1X5SA 3KJFB 3K89A 3DLLQ 3PJXA 5L9XA 2CFXA 1JLGB 3CCLS 2ZH6A 2NXEA 3HDSA 5DQIA 1TL7B 4RW9B 2RUSA 4B3MF 4C97A 3GV5B 1FTRA 4G1PA 3GYXB 3R2DJ 4N5SA 3LA0A 4JI8J 1WD6A 2IHR1 4IQXA 4FYWB 3TA1A 3PZPA 4ZVTB 4LF8F 2MY7A 1CJVB 2HWIA 4KSEB 3D1HA 3FSXA 2E7XA 4DUYF 5KT5A 3JAMU 4QYZK 2D41A 5LMUJ 3CF5Q 1VC0A 2HG4A 1NO8A 3KLHA 3THVA 2KYXA 1G2EA 5B0GA 3QZ8A 1UVJA 3LPEA 1QM9A 3SDEA 1UP1A 2J9DA 1KN6A 1ZS6A 4IFYA 1X9MA 3FMBA 3UI3A 2E9ZA 4NMXA 2QGFB 1FWPA 2CZ4A 2E66A 3CC7S 2ALZA 2FJBB 1HHTP 1GEHA 1SQFA 3DI6B 3TAMA 2DR7A 2ASDA 4ECWA 4ZMMA 1CJUA 4P9SA 1RI7A 3ET6A 4PWDB 4OYOA 2ROGA 3M8PA 1R89A 1AW0A 4IO9Q 5D78A 2FQQB 3R1LA 2FUG9 2W2PP 4H4MB 1MMDA 3R5AA 1U09A 4XPEA 2ZM6F 1MWQA 4F8RA 3PG9A 2HAIA 3GU0A 2AWZA 1M5OC 4MH8A 4Q2MA 3D4JA 1QSLA 2HHVA 3GPAA 4R8UB 2CIMA 4I69A 5MLCV 2JEGA 1TL7A 2YKPA 4RW9A 1BQNB 2G4BA 3A12A 2I9SA 2H5JB 4AQYJ 4PQUA 2JLFA 3W60A 1D8ZA 4K2XA 1S6QB 2OKQA 4DR3F 4DDFA 3WZ0A 3EGVA 3ZZZA 1DTTB 1TVRA 1TFYA 3DRSB 1S7HA 1CLFA 4JI1J 1CJVA 2B8PA 2FVRA 4XPCA 2BKOA 2NCKL 3TUJC 1MU2A 1SKSA 1ROFA 3CC4S 1QTMA 3KLGB 2OAUA 1PG5B 3MPDA 2NXJA 2BANA 4CO0A 2C42A 5KT3A 2XY6A 2HFOA 2JWNA 3W8GA 4HT7A 1UJ4A 4WF9Q 3I82A 1HFEL 2D3O1 1NXIA 2Q43A 3H4BA 5IT4A 1U1RA 1HKAA 2GAHC 3TJ8A 3KHHA 9RUBA 1RGVA 2OPRA 2EWHA 2YWWA 1FKPA 1SIWB 4ED7A 1D9DA 4CM2A 4B08A 2CQDA 4K59A 3IBCB 1CJTB 1SPBP 1DQAA 1LEOA 2AJQA 3OW2R 2H4WB 4XDCA 4L73A 4LF7F 1R43A 4X2BA 2IM2A 1RT3B 5J1EB 1RHKB 1DRZA 2QC3A 5B7WA 2DHSA 3ZTOA 3G6YA 4FN5A 1D8YA 2HLTA 4Y2KA 3T41A 2KG1A 1HMVA 4GKJJ 2LCWA 1QAYA 4DV2J 3NGKA 2VG7B 4FXDA 4C0HA 4NLOA 1RWXB 2E5IA 1NB2A 1EAYC 5E0OA 2Y8YA 3VGUA 3G6XA 4B9NA 2P5VA 4OX6A 2CKWA 3L09A 3FQLA 4LSLB 1VQYA 5IV3A 3MFIA 4UQGA 3RRKA 1W2IA 1BQNA 1FI4A 3IO1A 2AJFE 4CLFA 1KDNA 2IM3A 5J1PA 1NPPA 1S6QA 4P6QA 1FEHA 1CQMA 2N4DA 3T1HJ 2N82B 1FDAA 5SUHA 1PAEX 3RR7A 1HQEA 2XLIA 4MIAA 1S0VA 3H40A 1N36J 1KP6A 3KLGA 3TJAA 2B4PA 1C1CB 4HT5A 1C0UA 3M1VB 4WCEQ 4DZ6A 4CLUA 1RA6A 3ISND 3BR8A 2QLJB 2XLKA 4DSJA 2YKMA 2UXDF 3NWGA 2B5JA 1U1OA 1WHWA 1RHJB 3P49B 3LF0A 2HLUA 2CQGA 2YWFA 2N4CA 1KRPA 4RBUA 2R7OA 4NMLA 1WJ9A 3L3CA 1NDCA 3FQKA 4ER8A 4H4OA 3MR3A 2IAJB 4LVNP 4ALZA 1CJTA 4DL3A 2F3JA 2JRSA 2UU9J 5B0CA 5I3PA 1VISA 4C8MA 1XMQF 2H4YB 4N8NA 2CJQA 5H9FK 5AXMA 4DUTA 3OR1B 4DQPA 1ZAVA 5IT9U 2ZH4A 2IRUA 3VR1A 4IQMA 1M0SA 1TL1B 1EKRA 2DYAA 4LF9J 3ILOA 3CUNA 2DGXA 1TKTB 1RWNB 2NXNA 5KFVA 5KFYA 5K8MA 3CEDA 2ZH3A 2FC8A 2GJFA 2NZCA 4ECUA 2AEMA 4KT0C 4HH1A 1FRXA 1VQOS 1SCJB 1WDDA 4ED0A 4A4JA 1X31C 4OX7A 4AXJA 2P9EA 3CJTA 3BKTA 4PYDA 3D0IE 1NDKA 3IGVA 2VU5A 1VBKA 3V6KA 2XWXA 4E98A 3DHWC 1QSYA 2BVZA 4YDDB 4BCAA 1MNEA 1R8AA 3KK1B 3HPOA 4R5PA 1N48A 3H42A 1G4CA 3N9UC 1R8HA 2RHSB 3MD1A 4XAKA 1RHQB 3BGUA 1PO6A 2ZDOA 4G1QB 4EO6A 4KBIA 3PW5A 2XM3A 4LFAF 2HQIA 3M9NB 2XS2A 4IG3A 4URGA 1ZZFA 9ATCB 2N3OA 3PIPQ 2K1RA 4Q44A 4WFXA 1TUGB 2BKPA 3Q8UA 4FBTA 4FF3A 2XMWA 3M8RA 4F0HA 4LQ9A 1YJVA 2XI2A 3NOCA 2MKSA 3GR1A 4KV8B 4M8LA 2HVEA 5M2UA 5E3RA 5CCMA 2PI5A 3I0RA 4WBFA 1FXRA 1LW2A 1IBCB 1U6FA 4ZPAA 3M7VA 2A10A 4DF4A 2EXUA 5CZXA 3TX8A 5B0AA 1SL1A 1YSJA 4YB5A 2MZTA 3D68A 1WF0A 2ZBRA 3NY0A 4RR5A 1Y5LB 3CDAA 3ELHA 1NU4A 3TANA 1RWVB 1SVDA 1H38A 1U48A 4FVCA 5D77A 4DR7F 4FXWA 2CQ4A 2AF6A 3LOUA 2Z58B 4MKBA 2W9BB 4DSEA 1CC8A 5HANA 2VDHA 1V5VA 3KXDA 2VV5A 2MLXA 1IKXB 1M5KC 3EWGA 1EKSA 2Y3YA 1Y10A 3VZIA 2BABA 1NK6A 3OFFA 4CO5A 2GMJA 2X3GA 3D0GE 5H9EJ 5A8WB 3ENAA 5H1SV 4JBCA 1VBZA 4A8WA 3L7PA 1KC8T 3QGIA 4FKXA 4HR2A 5JJBA 2NUHA 5EWFA 2ADBA 1YJWS 1KBRA 3POTB 2E1AA 3KJNB 4OI1A 3FBFA 2ZZTA 1GX5A 2LEBA 3QSIA 3KK1A 3V6DB 3MM6B 2QA4S 1UA1A 1XTZA 4BS2A 1LKZA 4ZPDA 2PFFB 3MMBA 3H2UB 4C8ZA 1RDRA 4J9VA 2DXDA 5HMZA 4LF1A 2UV8A 4KRWA 3CTRA 2J7KA 1RT7A 3DLBA 3KWMA 3M6WA 1HNVB 5DS7A 3R7NB 4TKTA 1Q95G 4TQRA 2RU3A 4CH7A 3BF4A 1U1MA 1R0BG 4KV8A 4X64J 3R8YA 1IKYA 4X4TA 3GZ7A 1UVLA 2ZVIA 2FD2A 3R9LA 2HBQB 5D3GB 5KFZA 3I4PA 1RAJA 5KFLA 1N5VA 2E9RX 2GFFA 5KTQA 3FZBA 2G1HA 3BPDA 1U0HA 4EMDA 1WC3A 1C0TB 3BGRA 1IN0A 4ED1A 2RS8A 3TO8A 2KVIA 2XO7A 3OL9A 1X5PA 1BXNA 3FK4A 2X1AA 3LP2B 4ZCMA 3SEOA 3FBEA 3FMWA 3VGTA 1RT5B 1QLNA 4NI2B 4V1Ak 4KC5A 3RYLA 5HMWA 2MSTA 2P6SA 5H9EK 1Y3KA 2MXYA 4NZ7A 3GIKA 1N32J 4IOBA 1JNZB 1IKXA 4GVLA 1IVZA 2VUGA 2CJ9A 1EX8A 4DN9A 3U02A 3B4DA 3MXHP 1H2TZ 2CQHA 3N4WA 2G2ZA 4A8KA 5HROA 4FS2A 1LOUA 1VHIA 3POTA 2N7YA 1W7WA 1XR5A 4OZ0A 5J2NA 4EBDA 5EX0A 1SKWA 5D0RA 2FY1A 4DUZF 2AYBA 1ZM3A 3V6DA 4OZ1A 1B0VA 5JVGQ 3ZNUA 2E29A 1XBWA 2Q1LA 3A4TA 1EP4A 3PKYA 2R8IA 2HNZB 4M5GA 4KO0B 3IAS9 1OO0B 4DXLA 2BDPA 3GG1A 4LBHA 4P7TA 5BYQA 4L3KA 2L3MA 3CD7A 3RW7A 2F4VJ 4JUZA 1HNVA 3RR8A 1RAIB 2M52A 4EFAC 2XZWA 3LO3A 3LAMA 1KLMB 1RWMB 5IFMA 3VALA 3NGUA 2RDIA 4TYBA 5D3GA 4OI0A 2VKZG 3GILA 1RAGB 1JLAA 3HT3A 3N6MA 3D3CJ 2W1BA 4ID5B 1F1BB 1C0TA 3EM1A 2FIUA 1XQIA 2PSZA 1S99A 1FX2A 1MMLA 2WHOA 5T7LA 1QJHA 6AT1B 1GAOA 2AJ2A 3LP2A 4KPCA 1JLEB 4NASA 1Z2LA 4Y65A 1LNQA 2MDAA 1RT5A 1U26A 3DN9A 2YWHA 3GCWP 4OJHA 2B9YA 1S9EB 4X62J 3VAKA 5EGYA 5A0YA 2NLWA 2WBRA 4U95A 3U1LA 3N0VA 5C2CA 2HHUA 2RH3A 2OPPB 2V4RA 1FA0A 2JH3A 1SJ4P 2FZGB 5A8RB 4LFBF 1GTHA 2RQ4A 1DY3A 4TVAB 3NOGA 3VTIA 2M0GB 3J81j 1N4LA 1YJTA 4WU2A 2HBRB 4NCGA 4A8QA 2XY5A 1YK9A 2E9TA 4PG4A 4DPOA 4UQTA 3MR2A 2C2KB 1S72S 3J7A1 2FY8A 1JLQB 2Q79A 3U7JA 4B3MJ 3W64A 2FJDB 7FDRA 1RACB 2QMWA 4W90B 2VPZB 5HQ8A 3NGSA 4C8LA 3EX7B 4AL6A 3R5BA 4JYAF 1PCAA 3PW2A 2HNZA 4JV0A 1H7XA 2HPUA 2UXCJ 1RAFB 3J80U 4U96A 4NCBA 4I68A 2WW8A 3TOQA 3KK3B 4ZVHA 4OHVA 5IQQA 4DQSA 2G1DA 2MQPA 5F8GA 4NWBA 2VJUA 3D1OA 4KFBA 2M70A 3V81A 3QJPA 2RIJA 4CIOA 3UDLA 1KLMA 3ENWA 3WQPA 2FPHX 2VBWA 1YTYA 3KG1A 1ZPVA 1U1NA 2VONA 5DRKA 4PQAA 3ZO7A 2OMOA 1M1GA 1JX4A 5IOLA 2RS2A 3GIIA 4U67Q 3FCHA 1RWOB 3MM5B 3EJMA 2E1MC 4DHVA 1HI0P 1CEZA 4OI2A 5ETPA 3R27A 4JI0F 4QQBA 4DR2F 1J5EJ 2MLYA 3ZZYA 3HD1A 2OEKA 1RWWB 4NE9C 1RTJA 3W7BA 1NKCA 1YBUA 4NL5A 3AHPA 1YZ6A 2ZHOA 1XEZA 1DQ8A 2AHOB 3BSAA 1NJYA 1LFPA 4AE5A 3KNGA 4PG7A 3OHBA 2DHGA 3VAJA 4F4XA 2LQ5A 1EIYB 5KFGA 1MMNA 1MWZA 4E8UA 3W2WB 1WNEA 4UOFA 5B08A 2HVHA 5A8RA 1JNRB 3HT0A 4JI5F 1KTQA 3ZTSA 3ITHA 2IDLA 1U6BA 2W4PA 4ZPTR 3AOBA 1IKWB 2VQFJ 2IC3B 2ZBPA 1JLQA 3GSDA 3VAGA 3GJQB 2QSWA 4L72B 2ZNYA 1NJWA 3QT6A 1RK8A 2HNDB 3AD9C 2UUCJ 2DH9A 4ECSA 3D6HB 3Q8QB 3H20A 1OYEA 2NS1B 5LL6d 3G82A 3KK3A 2UVRA 1D09B 3MPYA 5HQLA 1TL3A 4K0KJ 4JI7F 2NR0A 3IRXA 2OHDA 1RTDB 2CG4A 1GMUA 2UUAJ 3KLIA 3KLEB 2JLGA 2KFNA 2B7BB 2IPOB 2VIHA 3H5UA 3BDEA 1FXLA 3QJLA 2LFVA 3IBWA 1EJ7L 5LSRA 1U8SA 5F3TA 2MLZA 3Q89A 4OHZA 4LF5F 3MM5A 5J2MA 2UP1A 2GAGC 1KVIA 3CJ4A 4RW6B 3PX6A 3T6BA 3LGNA 5HP1A 4DN0A 2KJVA 1RJJA 1VYAA 1FJ7A 3FJ2A 5HN0A 5HL7Q 1B99A 4ZK7M 2PMZD 2KJWA 3S6EA 3I55S 3D6FB 4DPXA 1S9GB 2YNFA 2HVDA 2ZD1A 4MFBA 2AU0A 2CYYA 3SSSA 3JTNA 4BBYA 1PYTA 3MUTP 1X4GA 2PE8A 1IBLF 3PYEA 1VQKS 2LDIA 3O2IA 5CAAA 3IXQA
chains in the Genus database with same CATH topology
1N88A 1QUPA 4ED2A 2YQ3A 2D3UA 3GQCA 4I6WA 4EYIB 1N36F 4A8OA 1FNMA 2E5JA 3MAQA 4ES1A 2IC3A 1M5PC 4IR1A 4O4RA 2BA9A 6FD1A 1KFSA 4QIVA 1GQEA 4RUAA 1R0AA 3BN7A 5BR8F 1T3NA 2A2DA 3HK2A 2OLWA 1X7VA 4DL6A 2AX1A 1X4BA 3QAUA 4XDDA 4ZKAA 1JLCB 2QE5A 2J8AA 4Y3CA 4DR6F 4OL8A 3T5LA 1XERA 3H2VE 1A9NB 3DNCA 1RT4A 3IG1B 1RYRA 1HHSA 2OSQA 3MM6A 5DG9A 1HBMA 5D4LA 5KG2A 3DRPB 2G0CA 2W7AA 4CZCA 4IH6A 2ZH8A 4YOEA 2FGCA 4IO1A 1E6YA 2J0QD 3LQVA 1MW7A 1JIHA 1F5CA 3N5FA 4ZPBA 3MEGA 1VQ5S 3C46A 1Y7PA 3CGIA 4AXIA 1X5TA 2E5GA 4R5PB 4I1TA 2W7OA 3TVKA 2L41A 2DGSA 2RILA 1SJRA 1OPZA 4TU8A 2FVCA 3IA0A 3KLHB 1TKXA 1DTQA 2ASJA 4RX6A 4Q45A 2VFSA 3EPIA 3H5XA 1CQNA 2F8MA 2Q66A 2CQ0A 3G9CA 3PRDA 5GAEU 1YVFA 4MKYA 5E3AA 4J9OA 4B9LA 3PHEA 2L9WA 2W4DA 2WK4A 3R3TA 5LJ5Y 3LP0A 1JXLA 4LF4F 1BQXA 2CPZA 1K8AT 4IG3B 4HYKA 3GFYA 4KTQA 1TR0A 4I2PA 3GIMA 3N79A 2MKIA 2EK6A 1M5SA 2FVPA 3AB4B 4X4UA 5HO4A 2KYZA 2K1RB 4IFYB 2GJ2A 3CJ3A 3BEGB 7FD1A 4LMZA 2ZNZA 1UEVA 1FHTA 2EFQA 4UY8T 3HHDA 2PGCA 1BC6A 4ILLA 1SV5B 2ZC4A 5B0FA 2KHDA 3NG8A 4DR1F 4ELUA 1VLYA 3DYAA 1O8BA 3CULA 2FLLA 3EGNA 3FEXB 4Q7AA 3PIOQ 2ZH7A 1U47A 2NREA 5B0BA 4M5DB 3CIMA 3TARA 5DM7Q 4KPYA 1S1TB 1Y00A 1S10A 4WFNQ 1HWJA 4QZVB 1NHVA 3THTA 3CWJA 2KHCA 3OUYA 4ILRA 4HHJA 2BW2A 2KKHA 2PIIA 1JXEA 3BSNA 3NAHA 1HQUB 3JSYA 4ZOSA 3PW0A 2RKIB 3SQGB 4JV1A 2PA8D 2GMLA 3BM7A 4K5SA 2AP6A 1U24A 1H7WA 1YJ9S 3HF5A 3PR5B 3I0RB 2ZJQQ 3CCUS 3I5BA 4RW8A 1YI2S 2DH8A 2XNRA 1VBYA 4BWJA 2G13A 1LW2B 2JEIA 4LF9F 2IJFA 3J81Y 1O0PA 1XMBA 2A1BA 3DCAA 2IA6A 3F73A 4J9PA 5AE3A 4USHA 2VQEF 1QVFR 3SCIE 2QLWA 1KQSR 4Y00A 3DGPA 3HX9A 3I56S 1YJUA 4ZPCA 3M8PB 5A6PA 2YNGA 4PWUA 2LA4A 1TAQA 4ZP6A 4QBUA 3PW4A 1KEKA 4ES2A 2V9KA 1WHVA 2DCUB 1AFJA 2I0XA 1IQTA 1ZM9A 1J5OB 3FNNA 3IR7B 3B8HA 1RTHA 3G4SS 2HHPA 3MUVP 1CC7A 5FLXY 3K5LA 2ILYA 5GADI 4ZP9A 2MGZB 1NH7A 3TRGA 3MURP 1UW4A 3RRHA 1GTEA 3KMQA 2B0GA 3U27A 1WF1A 3E51A 2VH7A 4HEA9 2C3MA 1KFDA 2EVZA 4WFZA 3MM7A 5KG6A 4DMZA 5HLFB 4ED8A 1X9SA 4QCLA 3DU6A 4GC6A 2XY7A 3PFEA 1DLOB 4NLQA 4B17A 1S9GA 5C42B 2DNPA 1HBNB 4BC9A 2PO4A 4F3OA 1JJ4A 2R7SA 2V4JB 2O3DA 2I5JB 3QGHA 1HBUB 1WI8A 1X5SA 2JFDA 3CSKA 5CZVA 4F4KA 2YWEA 3DLLQ 4X66F 3QLHB 4QR2A 3PJXA 3HLUA 3DOMA 5L9XA 5KFNA 2CFXA 3NGDA 1Z1ZA 4MYTA 1JLGB 4JI6F 4CO2A 3CCLS 1VS3A 2LEAA 1FJGF 2ZH6A 4KJIA 3IR5B 2CJBA 3HDSA 2GHVC 5DQIA 2GHWA 1XN9A 3DLKB 1JLFA 4RW9B 2J0WA 4PCQA 1HPZA 4MTPA 4U7UK 4I6YA 1X9WA 4RZRA 4PXDA 4B3MF 3NNHA 4C97A 1WI6A 1LW0B 3GV5B 2J5AA 2RJZA 1FK9A 4IFVB 2ZH9A 4F4WA 1FTRA 4ITSA 3MHYA 5A6WA 2Y0SD 2EFGA 2XULA 3OSNA 4G1PA 4NYOA 3GYXB 3GFZA 3GFXA 5L9NA 4N5SA 3Q22A 2KXFA 4YQWA 2XGPA 2R4FA 1WD6A 4ID8A 2X1GA 2IHR1 3KKFA 3NS6A 4IQXA 4J9QA 1Y5NB 5GMKa 3WX4A 4RWXA 3TA1A 3RBEA 3PZPA 4ECZA 4DL0C 2FC9A 2Q6CA 1N6QB 3UFCX 3K5NA 3AY0A 5F9LA 2KG0A 3AB2B 2FGOA 4LF8F 2MY7A 4FZVA 1RT6B 2HWIA 3MM8B 4J9LA 1N5SA 4KSEB 3D1HA 2ZH2A 2KDOA 1PC4A 1MROA 4CQ1A 3TUZC 5HBMB 5CHCB 3FSXA 3B78A 2E7XA 3T6JA 3Q8RB 3CDBA 4KHMA 4DUYF 4EUVA 1KOOA 5KT5A 4HH0A 5F0UA 4EBCA 2D41A 4PR6A 3J7YI 2XLJA 3CJ2A 3CF5Q 2KO1A 5KFQA 1YJNS 1VC0A 4KO0A 2HG4A 5KG4A 1NO8A 2A2CA 4X4PA 4DQRA 1FTCA 1S1UB 1R8BA 1ZPWX 3KLHA 3THVA 4EZ6A 4MYUA 4BWMA 3MMBB 3BGFA 1N0UA 2KYXA 2ABYA 5DM6Q 4GO7X 1GNKA 4A48A 1KS2A 5K8OA 5KT6A 1G2EA 5B0GA 3QZ8A 1UVJA 2D1CA 2ZHBA 2DR5A 1RT7B 4YMEA 3KTQA 3CB4A 2F8EX 3LWLA 1X4DA 1WG5A 2D3ZA 2VPWB 3DOLA 4TNOA 2FVSA 3LAKA 4D3GA 1QM9A 4MMOA 3SDEA 1UP1A 1HARA 1LWEB 2HS4A 3G6VA 2J9DA 1KN6A 1X4EA 1R8PA 3DFEA 3HZEA 4IFYA 4J9NA 2HHWA 5DO2A 1L3VA 1X9MA 4YDXA 3FMBA 3UI3A 5KFMA 4E0DA 3BDPA 2MZ1A 2E9ZA 2MKJA 1OQ3A 3E2EA 1SV5A 2ZH5A 5F8JA 1SKRA 2CZ4A 2VA3A 6FDRA 2E66A 2E7WA 4M5DA 1HNWF 1V3ZA 5J2QB 3J80Y 1REVA 2V8VA 2KH9A 3CC7S 2DTJA 4JI2F 3SCKE 3NNCA 2ALZA 1B7FA 2FJBB 1HHTP 1IKYB 1R27B 2N3LA 3DI6B 2J6SA 4FYDA 3TAMA 1TL5A 2DR7A 5T41A 2ASDA 3H4DA 1NB7A 1JLBB 3CD5A 4OJ1A 3SQGA 5GVQA 4TY8A 1OSDA 3HVRA 3SV4A 3R5CA 2KB2A 1J2VA 2ZOFA 3VCDA 1F2GA 1OIAA 4F4ZA 1MSWD 4ID5A 4ECWA 2YX1A 2XCAA 4H54A 2MHEA 4J9KA 4ZMMA 5IT0A 1Q7YT 1VQ4S 1Y3JA 3MAHA 3FZ2A 1RI7A 2UV8G 1R8CA 2X51A 4PWDB 1Q7LB 3V4IB 1FNOA 2ROGA 1KQKA 4FBUA 1IM4A 1S0NA 5A2QY 2Y1IA 3MM9A 1Y4ZB 2J9EA 3M8PA 3BGRB 1R89A 2RUGA 2H5EA 2M7SA 2DIVA 5AJ3F 1AW0A 4IO9Q 5D78A 2O1PA 3TW0A 2QMXA 1JLEA 5F9NA 1GX6A 3R1LA 4F26A 3MEEB 1TK8A 1ULRA 2FUG9 5ITHA 3I31A 3G6ES 5K8NA 5LJ3Y 4H4MB 4J9SA 4B9UA 4PG6A 4NA1A 1QAXA 1X4HA 2I8EA 1D9AA 5L1IA 1DZ5A 1MMDA 2VL1A 3R5AA 4YR0A 1JJHA 1U09A 2DITA 4XPEA 2ZM6F 1V9OA 2MB0B 1B0TA 3JSMB 2VBXA 4F8RA 3FVYA 3HHLB 1OWXA 1S9EA 1FNXH 1P8GA 1WEZA 1D9FA 1H3DA 3CMES 2HAIA 2LLZA 3MCSA 1IUJA 2LXFA 5EWGA 4NLPA 4K4XA 1CG2A 5T14A 2AWZA 1TV6B 2V4JA 3DLEB 4NLVA 1M5OC 4MH8A 4YY3F 4Q2MA 4C4WA 4M63A 3ZZRA 1P27B 1SJ3P 4WZMA 2OPPA 3BO3A 1QSLA 4MKAA 2BOPA 2HHVA 2E1RA 3TA0A 2VB6A 3SI8A 1OQ6A 1WHXA 3QIPA 4R8UB 4U9RA 2HIQA 2WOMB 3CO9A 2CIMA 3BQ2A 1P1LA 3BN4A 2ZE2A 4HDGA 4I69A 5MLCV 2QT7A 5L8RC 2JEGA 3PR4A 3DRRB 4Y2CA 1N0VC 2EKYA 4DBQA 2YKPA 2XMVA 3IFEA 2XCPA 4RW9A 1AUDA 2CRLA 3JSBA 1BQNB 3CJKA 1HNZF 2G4BA 1SJQA 2I9SA 4QYRA 2Z2LA 4F25A 3N6NA 1LW0A 1LWCA 1S1WB 3VQTA 4RUCA 4PQUA 2JLFA 1S6PB 2MZSA 4ICLA 1OPIA 4DQQA 1D8ZA 1FDDA 4K2XA 1S6QB 2OKQA 5C25A 4DR3F 3HFKA 4DDFA 3TVZA 4ECRA 3WZ0A 1HD1A 3ZZZA 5EWEA 1DTTB 2VASA 2YH0A 1TVRA 1TFYA 3DRSB 4JI4F 1S7HA 5HROB 3GG0A 2XWYA 4Q43A 3CCVS 3BQ0A 1CLFA 4C0BA 4C11A 1XMOF 5IM0A 3Q8SB 2MQQA 5E5NA 4M94A 2HNYB 1ZTTA 2GA7A 3Q2SC 1FRIA 1Q79A 2RT3A 2GX8A 2AV5A 2HWHA 4DS4A 2FVRA 4XPCA 1H98A 5J2NB 5DGAA 5HBMA 1HYSA 3DDKA 3D5MA 4B9VA 1FEEA 2RRNA 1XC9A 3IWNC 2DD8S 2CDQA 1KSPA 3TUJC 2V4QA 4ZHRA 1MU2A 4R0EA 1SKSA 1ROFA 3CC4S 1K0VA 2XHWA 2DR9A 1QTMA 3CCMS 3KLGB 2IVFB 2OAUA 2C3YA 2YWKA 2CPDA 3MDFA 2D3OR 4CO0A 2BANA 2C42A 4X64F 4L3NA 2ADCA 5KT3A 1EP4B 2XY6A 1K1QA 2HRUA 1TKDA 5K8PA 1UMJA 2HFOA 3O8WA 3SFGA 2AQ4A 3TVYA 4O3NA 2JWNA 2NPFA 1G6BA 4Y0FA 4HT7A 1UJ4A 1KQFB 4DLGA 3WC2A 4LSNA 4WF9Q 3MTKA 3I82A 1HFEL 2Q43A 3H4BA 1MWYA 5IT4A 1U1RA 2JSXA 2FTRA 3MMCA 2BBEA 5M2RA 2B6AB 1UJ5A 2I38A 3KHHA 4DOZA 5A8KB 1G1XA 1RGVA 2OPRA 2EWHA 4D3HA 2BZ2A 2ZJRQ 2RDJA 2F8HA 1FKPA 3CCES 1SIWB 2QLXA 2RQCA 3OR2A 2HHHF 2RE1A 4AFFA 5J2QA 2WCXA 4ZPWR 2QFJA 4ED7A 1D9DA 1LXJA 1PILA 1VRTB 2AGOA 2ILZA 3O5TB 3DHXA 3G96A 1S0OA 2UXBF 2MSSA 3HHNB 4B08A 2CQDA 4K59A 5F3ZA 4G3IA 2ZVSA 5KFCA 3M2RB 4IYQA 4I7FA 2DK2A 1U6ZA 1UVMA 1DQAA 4EU0A 2HGMA 3TI0A 2AJQA 4DR4F 1N5QA 3DLGA 3OW2R 1KD1T 2L48A 2Z2MA 4XDCA 2DHAA 4LF7F 4MK8A 3M30B 4DV6F 2PDAA 3TP2A 1JLAB 2OFGX 1R31A 3DRYA 1R43A 4ECVA 2NZ4A 4X2BA 2IM2A 3K58A 4J5OA 3CCZA 3MECB 3NLCA 1RT3B 2NUUG 3M8QB 2QA4G 2K7KA 5J1EB 4XIUA 3G71S 1LWFB 5DLGA 4QWAA 5LMNF 3HVTB 1DRZA 3RRGA 4KIAA 1X0PA 5CYQB 2ROPA 2HYIB 5B7WA 4DFKA 2DHSA 2VPXB 1RTIA 4MK7A 3SZ2A 3G6YA 4FN5A 1N32F 1T02A 1PSDA 3MEEA 3V4MA 4G6VB 1B64A 3ZZTA 1D8YA 2ZBIA 2HLTA 4Y2KA 4Y2MA 5T7LB 1VRUB 2YX4A 1WG1A 3T9NA 2KG1A 3PKMA 1HMVA 3FEZA 4TXSA 2LCWA 2K7JA 1HWLA 1QAYA 4ETZA 3QGPA 2A3JA 4USJC 4I6AA 3NGKA 5CXTA 3KFWX 4O3SA 3LWMA 2VG7B 4FXDA 1NJZA 2POKA 3JSMA 4C0HA 5CCLA 4B3TF 3U1MA 3L7OA 2IM0A 1U2RA 3E8OA 4NLOA 2DVIA 2E5IA 5AXLA 2B4OA 4PKDB 3OVBA 4LQ3A 2OO4A 5E7OB 2XS5A 3UPFA 5KOWA 5E0OA 2X1FA 4MIWA 2M8DB 2QYCA 1YITS 2MJUA 3W2WA 2GQ2A 3G6XA 4B9NA 1TL4A 2P5VA 4OX6A 4HLBA 5K5MA 2CKWA 5E3CA 3L09A 4O44B 4ED3A 2RMLA 3BZQA 3C66A 5A0YB 3FQLA 2GHPA 3JYTA 4LSLB 4ILMA 1VQYA 5F8NA 1L3SA 3OTCA 1KHVA 1YRUA 3MFIA 4UQGA 3RRKA 4ZLPA 1W2IA 1U49A 5KT4A 3SCLE 1BQNA 2OH2A 3IO1A 2AJFE 1VK3A 2VFVA 1KNZA 1RT1B 1D3WA 3DDNA 3IR6B 3KLFA 1IKWA 2IM3A 1S6PA 1IXKA 2C3OA 3CVKA 5J1PA 1FRJA 2W9AA 1S6QA 3PEJA 2GCFA 4ED6A 4P6QA 2Y1JA 1FEHA 3KLVA 4NCGB 1CQMA 2HZCA 3C6TA 4URSA 5KFJA 2B7CB 2N4DA 2E44A 1I6JA 4B3SF 4ZS6A 2MKHA 2N82B 4PUOB 1FDAA 1UVKA 4DF8A 2QEXS 5SUHA 4DFMA 3RR7A 2RD5C 3S7RA 2O5DA 2WRMA 3HM9A 1HQEA 2XLIA 4MIAA 3CC2S 2HNDA 1S0VA 2MMYA 5K9FA 3I96A 3RB4A 1KLNA 3H40A 2F4VF 3ENVA 1NKEA 5DDRC 3CXCR 2J7UA 1DBDA 1VQNS 4FP9A 5GADU 4JV5F 3CCJS 3RAXA 4H4KA 3KLGA 1YRXA 3Q8PB 1EETB 1RWUA 4UY85 4ZCIA 4TLRA 3CMAS 2LDYA 2B4PA 1C1CB 3BREA 4HT5A 2HW3A 3LW5C 4EEYA 1C0UA 2MZJA 3M1VB 1T3OA 3X3UA 4ATNA 4WCEQ 3Q23A 2BQRA 1ZH5A 1P6TA 4NA2A 5KFPA 3AAWB 1RTDA 2FHMA 1RA6A 5GAHU 3ISND 4QYZJ 3BR8A 2XLKA 4DSJA 2MYFA 4ED5A 2YKMA 2UXDF 2YTCA 3O1LA 3NWGA 4HDHA 2KZZA 3PDNA 2B5JA 3W2VB 3KLEA 1U1OA 3MEKA 1WHWA 4HVZA 3U1NA 3N6LA 4IDKA 3P49B 1FRMA 1VHFA 2HHQA 2JVOA 2BV3A 3JSRA 4ZVGA