4ES3A

Double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
84
Chain Sequence
b'HMMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLNYKVEHIGAKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0342 protein
publication title Double-stranded endonuclease activity in Bacillus halodurans clustered regularly interspaced short palindromic repeats (CRISPR)-associated Cas2 protein.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 21
structure length 84
sequence length 88
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4es3A00
1U2RA 4QR2A 2NPFA 4ZCIA 4FN5A 3ZZTA 1VI7A 3E3XA 1ZM4A 4ZCLA 3UI3A 2WBMA 4MYTA 4ES3A 3ZZ0A 1T95A 5G4DA 4TNOA 3EXCX 4QR1A 2CVEA 2IVYA 4M1KA 4ES1A 4ZCMA 2I8EA 4MAKA 2KDOA 1FNMA 2BV3A 3LH2S 1DARA 1ZM3A 1ELOA 2J7KA 2XEXA 3B78A 1P9QC 2E1RA 2I0XA 2L9NA 1N0UA 4MYUA 1N0VC 4QR0A 4ZCKA 2ZITA 1ZM2A 3B82A 4ES2A 2BM1A 3OQ2A 3ZZUA 2BM0A 2EFGA 1KTVA 1ZM9A 1ZPWX 3B8HA
chains in the Genus database with same CATH superfamily
3DN9A 4OI1A 2QL9B 2IY5B 1IBLF 1Q1KA 3DLGA 4DHVA 4DX6A 1NDPA 2IJRA 2UV8A 4D3GA 4I6WA 5AE3A 2GGPA 2JFDA 4B3OB 1HMVA 5KFGA 1QM9A 2YPYA 1LNQA 3DOKA 4USKA 1RYRA 2Z2LA 3NEKA 2VDHA 2O1PA 1HBMA 2JLGA 1B4SA 5J1PA 3QMQA 1TU0B 5J2MA 3CCVS 1TKZB 2GJIA 1YGYA 3NLCA 2HNZB 3PYGA 4GKJF 3V2UC 2OJ3A 1QTMA 4CLUA 1XERA 2UVUA 2FVSA 2UXDF 4B9SA 3BB5A 2J76E 5AXNA 2LEBA 1X4FA 4DUYJ 2DNHA 3MTJA 3KLIB 4O3QA 2BDPA 4LSLA 1F1BB 4ECUA 3GJRB 1XNRJ 3SQOP 3IWLA 2B5JB 4MIWA 4M94A 4A4JA 5CCMA 1YJTA 3NWRA 3IR7B 4B9NA 5A2QY 2OSQA 4ED3A 2POKA 3ZNJ1 3OJSA 1YSJA 3GPAA 2XWXA 1TVRA 3BGRA 2VICA 3DRXA 2DR6A 3BSOA 1S12A 4ZOSA 3FCVA 3QAUA 1S6QB 1C1CB 2IBOA 3C6UA 2CPYA 3WIUA 4OZLA 5MAOA 4Q8FA 4WPAA 3D1OA 1ELOA 4P6QA 3PRDA 4IKAA 2QRRA 4X84A 1X8DA 1RT7A 1R0BG 3LA0A 1S4FA 3BO4A 2BZ2A 2DHGA 4LR8A 1MROA 1KC8T 3M1VA 1CULA 2F8EX 5DO2A 2LFVA 5D77A 5E2QA 2XSFA 2C3MA 2HHPA 2PT0A 5J2NB 3RAQA 3SQGB 4DLGA 2E66A 4NMXA 1WHYA 4X64J 3CO9A 1VRUB 3HSGA 3DI6A 2C3PA 4HYKA 2ZVSA 1RDRA 5AJ3F 2C3YA 2CFXA 4F4KA 3QGHA 4USIA 4C7QA 1JLAB 2IYGA 3T1HF 4O0NA 4ZDNA 1TR0A 1RQ0A 1TKZA 2RHQB 3G9CA 4O3RA 3SXLA 4F36A 1IBLJ 2K7KA 2XZTB 1QLNA 3GYNA 2CNNB 2H4WB 3ENWA 5KFCA 1U1KA 3JTPA 2Z30B 1FDNA 5H9FK 2AYBA 2YBVA 1PC4A 1FKPB 5F8HA 3UI3A 1G2EA 1WDDA 1Q5YA 2GJFA 4N41A 2B43A 2XI3A 4K50A 1V5IB 4C0HA 2ZH2A 2B5JA 3TVYA 1R7IA 3O6QA 3VAJA 1GNKA 2NCKL 1MN9A 2GV1A 5GADI 4KTQA 4TY8A 4OYZA 4GKJJ 1OQ6A 2ZJPQ 3T19A 2VA3A 3CW2C 2WVCA 2GO8A 3N0VA 5KFSA 4USMA 2UXDJ 2CZVC 1SH3A 3OSNA 1S0NA 3P4UB 1NK7A 2AX0A 4OI3A 1C1CA 4DSKA 5KG6A 4USVA 2EFNA 5JVGQ 4R8UB 1V3ZA 3GCWP 2OPRB 1R31A 3UWTA 2MSSA 1SKWA 2MKIA 2AT1B 1DBDA 1DAXA 4C0OC 2QL7B 3EDQB 1SH0A 3GLJA 3PTWA 1BHNA 3DKDA 1U6BA 5LM7E 4NLSA 4TNOA 4RNNA 4LQ3A 2Y1RI 1E6YB 2R2RA 2L48A 5K8NA 1VC0A 2X3DA 2V4JA 4OZ2A 4Y65A 1VQYA 5J2NA 2UVRA 2R7RA 4PAAA 4CH0S 6AT1B 1DARA 3C66A 1XQIA 1KN6A 3GJSB 4CM0A 3LUYA 3PW2A 2DGOA 1WC6A 2BOPA 2VASA 1RWXB 3JYTB 1FRJA 1MNEA 2F63A 1REVA 1RBAA 2BX6A 1FT8A 3DLKB 4BDPA 3OFGA 2OMOA 2C2ZB 4CDIA 2E29A 2HBYB 5GMDA 1FA0A 1R0CB 4DV4F 4ZIWA 4ZS6A 5EWFA 2DHHA 1RBLA 4HHJA 2HSEB 1DFDA 1FF2A 2JL9A 3RYLA 3MEGB 1FKPA 3RGIA 3H0PA 4NXNF 2FHJD 5A0YB 5AJ3J 4BWMA 1N8RT 4JB8B 2J7WA 3MEDB 3QO9A 2AYEA 2CPIA 3IGVA 3T1HJ 4JI0F 3MPVA 3TI0A 2OEJA 1K73T 1GX5A 4GVBA 4Y2KA 4OI0A 4HVZA 1RAFB 4LSNA 4F67A 5B08A 2XM3A 1FTRA 3V5RA 3DM2B 3JAMU 2AF6A 2Z56B 1UTAA 4DV3F 2OTLS 2AMCB 3PVXA 2DVIA 1RLCL 2OPSB 1CEZA 3BO3A 1TKTB 3UDEA 2I9SA 1KQSR 3QJPA 1RWMB 4LF2A 1PC5A 3KKFA 2M70A 4H4OB 1M5OC 5K8MA 2XYPB 2CPFA 2BMBA 1Q5VA 4KH1B 2YKOA 3FBFA 1TK8A 2EKNA 4MT1A 5IS2A 3JSMB 3PKMA 3J81Y 3H40A 1ZPWX 1GAOA 1X4CA 4PR6A 1CC7A 3A13A 1HQUA 3N5BA 3DRPA 4KGVB 2H65B 3NS7B 5DG9A 3FCHA 1KLNA 4OHYA 1ZZNA 2RQMA 2V8DA 4WXWA 2BOAA 3TW0A 2AJ4A 2BM1A 2YH1A 3U1LA 3M9OB 5BYRA 4NI2B 2BACA 4KGXB 2PFDA 1RISA 3OL8A 1X31C 4YB7A 5HLFB 4B9MA 1IQTA 1EAYC 2QSWA 1FNMA 1VS3A 3T6BA 1Q16B 3X3UA 1K44A 1PYTA 4X4OA 3M7VA 3NG8A 3N5FA 2L9WA 3EGWB 4UZCA 1APSA 3LAMA 4RW7A 2BJ1A 4ZVRB 1VQNS 1EX8A 2W7AA 4ZVFA 1U02A 2I6WA 3GG1A 2LDIA 4UZBA 3GFHA 3QJLA 5A0YA 2Z4PA 2AD9A 2NPFA 2XGQA 4M5DA 5D0EA 3MEDA 3IGNA 4W4MA 2KM8C 2CZ4A 1ROFA 4ECZA 2IM2A 3T5LA 1Q53A 1UP1A 4WCEQ 3QWPA 4EO6A 2FVQA 4F4YA 3A8KA 1S1WB 3R2CJ 2KKHA 3B54A 6FDRA 3DM2A 3HT3A 1Y5LB 2D41A 4ZPWR 2NQPA 1JKHB 2NXCA 2HWTA 2PEBA 2B4VA 1RTZA 4KC5A 1TKTA 3G8SA 3ZTPA 4ZKAA 2D3UA 3IAS9 5E5NA 4OZ1A 4W92B 1S59A 5CYJA 4K4TA 3IRWP 2ILZA 1GH8A 2R8JA 4ANCA 4ZA1A 2DXEA 2OD6A 3JSMA 1MWZA 3M6VA 3RW7A 1HBOA 2GMLA 4KGKA 4M8LA 4N7TA 4CO3A 4JI6J 3ZZPA 5A2QU 2DNNA 3EUNA 1HL6A 2F4FA 4LVNP 4IH7A 4PPDA 3HI9A 2CQ4A 2G0IA 2ROEA 5HO4A 4ILLA 4JBCA 2Y3YA 5HLFA 2NPIA 3RRGA 4YUDA 3K5MA 4RWWA 3RJMB 4G1IA 1KFSA 1NDLA 3EE3A 4U6PA 3BSCA 3FMWA 5DLFA 1HD1A 3M8PB 2LEPA 2GIQA 3MEKA 1YDLA 2EI5A 3IM9A 5B0FA 1EETB 4PWUA 2W01A 1WC5A 1MSWD 2FJVA 3J7Z5 2ZE2B 1KQFB 1WORA 2YWEA 3MCNA 2CJ9A 3UDLA 3KMQA 4C98A 4RNFA 2EEYA 4AFFA 4ED2A 1CSJA 3VHQA 4KKOA 5KG4A 1HYSB 2MKCA 2RUSA 4DR5J 1VBXA 1X5TA 4AXIA 5B0DA 1C4CA 4QPTA 4Y6IA 2N82B 3GJTB 4KYZA 2BKNA 4ZVUB 2FLLA 4YB5A 5EHHA 4LFAF 5IM0A 2VG7A 3UDCA 3KTQA 1JKHA 3K7RA 4V19J 2W24A 5B0GA 3L7PA 4LF8F 3T5KA 5K9FA 2RRAA 1FKOB 1I1GA 1PAEX 4QIFA 4QIWD 1U2FA 4GMKA 3CMAS 2E44A 4QIEA 1XK8A 3ZTSA 3VAKA 3FFIB 4UQTA 2KN4A 2P9GA 3PV8A 3D6FB 1P8GA 4X4NA 2W4CA 3I96A 2BV3A 5ETLA 5KT5A 1LV5A 5E3CA 5F3ZA 3Q0AA 1Y00A 1HBNA 1S10A 4P52A 3TX0A 2BYCA 2AJ2A 3JQJA 1W25A 1WDTA 2RE1A 3OR2A 2YQ0A 2RIJA 4OIXA 4P9SA 1S79A 5ETMA 4DV5J 3T1AA 1JJ2R 1CS4A 1HI8A 1U7LA 3LW5C 1RWPB 3CJKA 3QNWB 2EC0A 4QJVA 1VIOA 2R7XA 3CJ4A 1AZSA 2HFZA 3M8PA 1VQKS 1NPRA 3IM8A 2R9LA 3J7ZT 1OPZA 1UVIA 4ZP9A 4L75A 1SUQB 4ECSA 4NLWA 4YDXA 4OV1A 1HKAA 2ZE2A 3H5SA 1U1MA 4ZLPA 2Q1LA 4DWIA 1GEHA 3CUNA 2ZH6A 1BQNB 1EHWA 1S1XB 4LVOP 3D4JA 2UVVA 5CABA 1HYSA 2IAJA 1D8YA 1WI8A 5LSLA 5FJ4A 2XMUA 1HBUA 1IQZA 4Q0BB 3TX8A 2OEKA 1RA6A 4Q8EA 3FSXA 1AYEA 3A8EA 2HNYB 2KFZA 2M2BA 3NAIA 2XMMA 5F8GA 3R5JB 2A6OA 3LGHA 1HW8A 2RDDA 2ATLA 3M2RA 4X62F 5L38A 3J7A1 2DEIA 4FYYB 3FRZA 2YX1A 4ZVTB 4WF9Q 1FKOA 1RHUB 2R7VA 1I6JA 4C0BA 1RSCA 4A48A 3R5AA 3DFEA 2GMHA 5KFYA 1KONA 1F0XA 4LT6A 4X65J 3FFIA 4JP8A 2F9DA 4ZLNA 3KMSA 1HI0P 4KY3A 5I3QA 5J1EA 4JI4F 2GCFA 2N7YA 2KHCA 4QWBA 3JQMA 3K57A 4P7VA 4L3KA 2W8LA 1XMOF 4F4ZA 2XY5A 5GAEU 1SQFA 4DPUA 3NGRA 4U95A 3I32A 1XJWB 3AD9C 3PX4A 4C3MA 4I69A 4IO9Q 1Q8IA 1ZM4A 3CJSA 3PHEA 3HD1A 3RR8A 1C0UA 4R0JA 5SZTA 1UETA 2DKOB 3A8IA 2Z0GA 5FLXY 3NXZA 1SJ4P 2YQ3A 2QJ3A 2OIHA 1NJZA 2E5LF 2J9CA 1RACB 4BLGA 2HRTA 1QE1B 2FVCA 1PBAA 4DR1J 3BR9A 5HANA 3DYAB 1WEZA 1NKCA 4G6VB 2QLWA 2GX8A 2VPWB 1HR0F 2UUCF 2VV5A 3H20A 4P72A 3HP6A 4TU7A 2KVQE 3AD7C 2HRYA 2FJDB 2PA3A 2Y8WA 2A2CA 1KTVA 1RTJA 4HDGA 1UPPA 2LQ8A 3PZPA 3BS9A 1YQHA 2C2OB 2GA7A 4DV6F 5CZVA 3Q22A 3WZ0A 1UKUA 3QJJA 4DCJB 2CUYA 2V0NA 5E0OA 5C7PA 2IBKA 1RHQB 3QT6A 3CCJS 5M2UA 1T9WA 1NCLA 1ZS6A 4NLDA 3I4PA 3K59A 3KLHB 5IC6B 4J9MA 2HS4A 4ZCIA 1SQEA 4ANEA 1UVJA 1LWCB 2G0JA 2KJWA 4FDFA 3FDSA 1QAJA 3FK4A 1T0TV 3QPIA 4K0KF 3N6MA 4YEAA 4F4WA 3E01B 1RAHB 3LP1B 5D0RA 2HQDA 3MCOA 4W98A 4RW6B 4B9LA 3KJQB 2VDIA 1FFWB 1EQMA 1I3OB 4DX5A 3I9V9 2H4YB 2XMWA 1FHTA 5HVGA 4CYUB 3N28A 2DY1A 2ZD1A 3ISND 1IR0A 1R8HA 2V34A 1S72S 2IIHA 1S5ZA 9ATCB 1N48A 4DSIA 3RW6A 3Q23A 3WQPA 3NWGA 2AGOA 4X4SA 5GMKa 4GC7A 1FXDA 4Z2XA 2Z8QA 4ES3A 1XMOJ 1NZ8A 1QE1A 2H5IB 1K47A 1SPBP 3MR3A 3ULHA 1PGZA 5J2PB 3JTNA 3QBCA 1AB8A 1PJ7A 2MGZA 2Z58B 2VB6A 3CMQA 2LQJA 2R8HA 2JNJA 5I3UB 2IHR1 2DJWA 4ZP8A 4AYBD 5HMXA 1RT3A 2K7JA 3ZZOA 4J9SA 2E5LJ 4J9RA 5H9FJ 2VPZB 1TFWA 4ED4A 2ALYB 2E9RX 4EMDA 2PE8A 1FRLA 4O3OA 2X1GA 3EDRB 5GAGU 3P49B 1HHSA 2UUCJ 1HR0J 4LIRA 2WVDA 2WSCC 2OI2A 1IBKF 2BQRA 4QWDA 2H1YA 2KZMA 1H2TZ 1S0VA 2PA8D 1LWCA 4QZVB 5K8PA 2RDIA 4TXSA 1S57A 4ZITA 1TV6B 2G9OA 3TAPA 1R8PA 3LP2B 4CLYA 4DV6J 2W2NP 2HZCA 4DBQA 3CCTA 4AQYF 2V4QA 1PCAA 3UCZP 4DSLA 3R7NB 2NYHA 1S6UA 2EG2A 2MJUA 1UVNA 5EWEA 4ECYA 4ZJLA 3LANA 1P9QC 5GAHU 1M5SA 3MEEB 1FEHA 3CJ3A 3PW0A 4IFYB 4O44A 2X1BA 5DGAA 1HWKA 2BKOA 3THTA 4DPYA 3DOLB 3B4DA 4K0KJ 5E3PA 3KK1A 2VD3A 3HKZD 4OX7A 1RGVA 2VU5A 3GSDA 4YOEA 4J7CA 3NS6A 1T9XA 4QQBA 4RW8B 3ITHB 2VFRA 2V9KA 2HVZA 3R97A 2E1RA 3IP0A 2GHWA 4N77A 1F2HA 2IA6A 4X66F 3BSAA 3O44A 2RNEA 1TP7A 2Y1JA 4FYXB 2KH9A 4DZ6A 2CPEA 4DFKA 1YI2S 5D78A 1H0HB 1LFPA 1C1BB 4ZPAA 2HQ3A 4OLOA 5HN0A 4JYAF 4CO4A 4PYDA 2NS1B 1SC1B 3OFEA 2JC1A 2F7VA 3W8PA 2NZ4A 4FYVB 3HSJA 2M88A 2NZCA 4W90B 2OFHX 4DR3J 2CJKA 1FRXA 3AB2B 3C46A 4L74A 1F3VA 1PKUA 3O1LA 2G1HA 1X9MA 3ET6B 1ITPA 5HVHA 4Y28C 2DH9A 1VOMA 2BE2B 2RKIB 4H54A 4O0IA 2UVWA 4TVAB 2BJEA 3VAGA 3D1QA 4HKQA 1XR6A 2XQCA 4DSJA 2HRUA 1UVLA 2RB7A 4RX6A 3M05A 2XY7A 1TV6A 2WZ1A 4LF7F 2ZH4A 2P9EA 2NXEA 1NHUA 3LAKA 4TU9A 1ZH5A 4URQU 2FZCB 4JI2F 3HHKA 2AHOB 4OL8A 2G13A 1IVZA 3C8YA 1DURA 2M4MA 4BCAA 3JSYA 1U0SA 4PRFA 4JV2A 5DJBA 2PMZD 2F5GA 4BWJA 3SCLE 1Q81T 3EYZA 4WIQA 4ED6A 2BABA 4BC7A 1G6BA 1RLDA 3PM9A 2Z2ZA 2MKJA 4CH1A 1S9EB 2R8IA 1GTEA 4NCGB 3R5BA 2IVMA 1YJNS 3POTA 3TZWA 5D4OA 3CMES 4DOZA 3TARA 3JS9A 1RBOB 3K5LA 2ZNYA 3ZTOA 3CT9A 3VCDA 3OL7A 1S1VA 3BV8A 2DGXA 3NGUA 4DFJA 2MZRA 1X5OA 3RAXA 3KJFB 1CJUB 3CD5A 5DDOC 1DTQB 4U9RA 2P8IA 1UEUA 1TTHB 2JJ4D 3BYPA 4CT8A 1RWVB 1JMTA 5LJ5Y 4WP3A 4QPXA 1VJWA 3F56A 3FGVA 4N76A 4ECRA 3I31A 4X4RA 3PEHA 4KO0B 4JI3F 5FLXU 2FPHX 2VQEF 2V50A 1GMVA 3S8SA 4M5LA 2GC8A 4ED1A 4URGA 2HFUA 1J5OA 3FKBA 3PJXA 4PUOB 4UF4A 2NLWA 1BY9A 1T11A 2NUHA 2BE2A 1S6PB 4ZK7M 1KWMA 2QYGA 4NYPA 4JYAJ 2JDJA 2FUG9 4J9OA 2W8KA 1J5EF 2PN6A 4I6AA 4RUCA 3V6KA 5DDRC 1KEKA 3KJVB 2UUTA 2G2YA 2F1FA 2G2OA 4USWA 4GVLA 2PSZA 3PYFA 1XMQF 4KFBA 4TQRA 4NLXA 3SI8A 4OYIA 4RWXA 1JLGB 1KHVA 4H4KA 3GWCA 2ZNZA 2EFPA 2XMVA 1HQEB 3CIMA 4DV2F 4DUTA 3MXHP 2RH3A 5B0AA 2LQBA 2LXFA 3ETMA 1CJVB 1N5TA 1FFGB 1RTIB 2A6MA 1EZZB 2DK2A 3BM7A 3IG1A 4NCGA 5AXKA 1H2VZ 4JI2J 4ILMA 4ELTA 1OY6A 5A8WB 4XDDA 3BJYA 4MKVA 1S1UB 4LIWA 2PFFB 3CC4S 4S0MA 2OP5A 4P73A 1J27A 2J0SD 2FJWA 2W4DA 4YP3A 4ETXA 1CQMA 3G86A 4ALZA 1DTQA 4PG5A 3SCIE 2GZOA 3KLGB 4ED0A 4KH0B 1N5YB 2HBQB 5IOLA 3MFHA 3HZGA 1NJWA 3IS9B 1UW9A 5C42A 1DY3A 3H5YA 3LPYA 1Y3JA 4IUFA 3PEJA 1IR2A 1ZBTA 3KG0A 2BR0A 1UJ6A 1QSLA 3IC1A 3TQ1A 4RW9B 2FDNA 4RKUC 1JX4A 3CEDA 2QFIA 2K3IA 1TL7A 2FZGB 5KFTA 5F3TA 2KXHA 2NREA 1AXQA 3QIPA 1O0PA 2G4BA 1IBMJ 1TUVA 4B9VA 4N8OA 4U96A 4DR7F 4K4ZA 3Q8YA 4NWBA 3KJVA 2CAJA 3UCGA 2MPUA 1WACA 1NPKA 1Q8BA 4A8FA 1F9FA 1H3DA 4PQUB 1JLCA 2E5HA 3T6JA 1HA1A 2J6TA 2BRKA 1CC8A 2CQ2A 2XZWA 2DNZA 1RYSA 4NLOA 4C11B 4EUVA 1VQ7S 3LO3A 2I38A 2GNKA 1PJ6A 2KU7A 3D1HA 1J5EJ 1OWXA 5CYQB 3TUZC 3UVJB 1RTIA 1E6VB 1KR4A 3WC2A 4HHUA 3SIPB 4ES2A 3H4DA 2OKQA 1XMQJ 4DG1A 5H9EJ 1U49A 5KG2A 1S1UA 3DLHA 2MMYA 1Q95G 2JX2A 3DHXA 2V2VA 3UN5A 1ULRA 4YFUA 1JLBB 3A12A 1UZHA 1RWUA 4DV2J 2HS3A 4CI0B 1NKEA 1IKWB 2OO4A 4E98A 4TQSA 5L1JA 3KLGA 4X4QA 1N5YA 4NZ0A 2ROPA 3IS9A 4CLZA 4WFZA 3WDOA 1OPIA 5LL6d 1RAIB 3QFWA 2BANB 4K4SA 1NAQA 2WCXA 2CA9A 2AKWB 4LRDA 3R8YA 1NK5A 1WELA 1F5AA 1N5QA 5LMNF 2CQDA 3DDKA 3R2DJ 2PMWA 4RW9A 2G1DA 2E1PA 4IG0A 3TNVA 2N4DA 2HHHF 2O3DA 3RU0A 3TZZA 4O4RA 3BEGB 3P96A 4LRAA 2EKYA 4MKBA 3OLAA 2EFQA 4JV0A 5IWAF 4U8VA 2DR9A 4WYLA 4CLSA 5LXRA 2E5JA 5E33A 3CNQP 3K8WA 4PQUA 3AOAA 2IMOA 3WBZA 1JIHA 3JSRA 2M8DB 3SDEA 3D0GE 2UXBJ 2QIFA 2BQUA 4UOFA 4C11A 2LQ9A 4CLWA 1XNQJ 2NXNA 4OX6A 3MFIA 2HLTA 4PG8A 1GT8A 2ZWPA 3TUJC 5CYQA 2IM1A 2HNDA 1M5PC 3CDUA 2HLUA 3OVSA 3HSDA 1RUSA 1Y4ZB 4QYRA 1YJ7A 4K4WA 1WOPA 3MF5A 2GVZA 5F0UA 1QDUB 4ID5B 2EK6A 3FMBA 1XIQA 2RDJA 1B3TA 1JLBA 3LH2S 1VJQA 3SSQA 4DX7A 2W7OA 1G4CA 4G1QA 1M90T 1FVQA 1QD1A 3I9ZA 4DL4A 3Q86A 1NJIT 2QG9B 2KO1A 5K14A 1FEEA 2GHVC 4I2QA 3DGPA 2W9CB 2VOPA 4MYUA 2RS2A 5J2QB 3D28A 2O01C 2BANA 3G82B 3GU0A 3GIKA 1MWQA 3Q8RB 1Y9OA 1QSSA 3EICA 3TJAA 2UP1A 3H7HB 4DV7F 2WVEA 3EXYA 4DMZA 3LGNA 3KUEA 1VK3A 2VBXA 3NOCA 5T41A 2YVSA 1YG0A 2ZBCA 3KG4A 1PYSB 1T05B 3KLFB 2HHTA 3PX6A 1XC9A 4Q2MA 2ACYA 1SKUB 3FSYA 3RB6A 1SBRA 5A76A 2QZ8A 2KFYA 4A8SA 3L09A 2WOMB 4I67A 2B8PA 3D0IE 4C8KA 5LMNJ 3HO1A 1GMWD 3HCXA 4C8YA 4UT4A 1Q8LA 1JLQA 4TYAA 3M8SA 2C42A 4DFMA 2CG8A 4CCHA 1SL0A 2HS0A 2KJVA 2VJUA 4C4WA 2HHHJ 4DS4A 2OPPB 3D66A 4I56A 4ECQA 2WSEC 1VYAA 3IO1A 2HGMA 2WAQD 3DLEB 3FBEA 1BE4A 2YWGA 3HJVA 3TZYA 5IWAJ 5M2RA 1FXLA 3DMJB 4U7CA 1TELA 4PXEA 3EGZA 4TLQA 1P1LA 1WC0A 3AJ2A 1R0AB 1KLMA 1WEYA 4ID5A 1XEZA 3THPA 1K0TA 2O66A 5B0CA 2XS5A 5JJBA 4LF6F 4NMLA 1RK8A 5L8RC 1IKXB 3KK2A 1FRIA 2VFVA 3PYEA 4A8MP 2ROGA 3VZIA 1X4AA 4HT5A 1Q0NA 3UCUP 5T7LB 5ETKA 2RSQA 3MTKA 1FRHA 3ILLA 4EU0A 5CD4A 2W9CA 3G6ES 2KL8A 4C2MA 3RBZA 4PABA 5J2QA 1Z1ZA 1VQMS 2DR8A 1QAYA 4JV5F 3H90A 1RWWB 3F0NA 3G82A 1FK9B 1Q86T 2JEIA 4NE9C 2QLBB 2MKSA 1LW2B 4YY3F 1Y5IB 2BE9B 2V8GA 2DPJA 2R7QA 4I0WA 3C14B 3AD8C 4QYZK 4KV8B 3DHWC 4WP9A 1H7XA 4NRTA 5DQIA 1CLFA 2ACMA 4ANDA 3HX9A 2LEAA 3O8WA 2H3EB 1T05A 3KLFA 4K8RA 1GMUA 2CJQA 2ZHAA 2ZHOA 5F8IA 2ZUGA 2E7XA 3M6UA 1F9EB 3U1NA 4F8RA 3HKWA 2WOMA 2OD4A 4UUWA 4WU2A 3FRYA 2DT9A 4Y2AA 2DHXA 4NLGA 4AL6A 3KDNA 2H48B 1WHWA 2ZVIA 3M2VB 4DPXA 4QW8A 2COLA 2FJEB 5I42A 1KOOA 4DS5A 4DV7J 2OPPA 3CXCR 5HROA 1EB0A 4ZVQB 4QU6A 4OFZA 4R25A 4XTTA 3UE2A 4F26A 5D15A 2E9ZA 4CNYA 1DRZA 2L08A 3AT1B 3DLEA 1K0VA 1R6YA 2RVJA 3TZXA 3OVBA 1XR7A 5IXUA 1LXNA 4WKRA 1MG7A 1LWEB 1HNZF 1NHVA 1PO6A 1OJ4A 5CAAA 1NPPA 1GFWB 2B9EA 2QL5B 5IZHA 3AJ1A 2WSFC 2PIIA 4WE1B 4Q2LA 1IKXA 3KFWX 2HHWA 5EUHA 2IRUA 3SV3A 2JWNA 2WW4A 1UJ4A 3QATA 4LF9F 3KG1A 1S9GB 1ZYQA 1HFEL 4IDKB 3KK3B 1EKSA 1FKAF 2HHUA 5KFWA 1FK9A 2Q6CA 1LW0B 1Z4UA 3C6TB 4MK9A 1GXLA 3M30A 5DM7Q 1T03A 2YH0A 2GVDA 1EJ7L 1N0UA 5KFUA 5EDWA 3VAMA 2QLJB 2L3MA 9RUBA 2CQHA 5JVHQ 4QU7A 3PACA 2RD5C 4K5RA 1K8AT 1W26A 1BQMB 3M8ZA 3LP0B 4OI6A 1O5JA 3PX0A 4U67Q 1QUPA 4JV5J 4FS2A 3ZZTA 2RILA 2E1AA 4MYTA 3GYXB 1G7CB 5B0BA 1D09B 4YY3J 1DTTB 2QMWA 2RT3A 1HNIA 3W9HA 3UQSA 1ICEB 4LRFA 2YKPA 3AXMA 3EPGA 2R2TA 2MQ8A 3I4HX 3OT9A 3M2VA 2KYXA 1QVGR 1NMEB 2IM0A 1CJTB 4ZCMA 1YJVA 1AROP 3IWNC 4I2PB 2HIQA 1YX2A 2FHMA 3MMCB 3X1LB 1NSQA 1IN0A 4I4BA 1NSPA 5G4DA 3BGUA 1RHJB 1U1QA 2FVRA 4MAKA 2B4PA 1LWEA 1ZM3A 4ICLB 4LMZA 1N88A 1NK8A 2FY8A 4LREA 2BJ8A 5B0EA 5F8NA 4RJVA 4H4MA 2KXFA 1WEXA 1DLOA 3DRSB 4PKDB 4DL3A 3TJ8A 4CLFA 1BLUA 3HM9A 1D9FA 4ER8A 2W2PP 3Q8UA 2PI5A 2AP6A 2W9BB 1AT1B 2J0XA 2IVFB 4X4PA 3D2WA 2QC3A 1YWXA 4WP8A 3HFKA 1W7WA 2K2PA 2R7WA 2BEFA 2JSXA 2YNHA 3MM7B 3K5NA 5KFNA 1S9GA 4IDKA 2ZUAA 4DUZF 3BO2A 1O51A 3GIJA 3R3TA 3KK3A 1RT5B 1RAAB 3D6MB 2B9YA 1LW0A 3BPDA 2JEGA 4B3MJ 2ABYA 2AW0A 1FJGF 2CXEA 4N47A 2RHSB 1HI1A 2LQ5A 2BRLA 2BBEA 1KS2A 4RL1A 3TUIC 5IFMA 4P2FA 4XPEA 3AXKA 3CDWA 4M95A 5EX3A 3KNGA 3T9ZA 4EGLA 1S6OA 3ONQA 3LP0A 2VKRA 1WTBA 3OBIA 5J1NA 2B6AB 4M5GA 3DLLQ 2P6SA 1KBRA 2FLOA 4FYWB 2F40A 3A3NB 4HI1A 5F8LA 2GHPA 1FRMA 2CQPA 2UXCJ 2HFSA 3TEHB 2OAUA 3K58A 2J6UA 1YJWS 1IKYB 3I56S 3NBPB 1HNXJ 3H2VE 5KFPA 1S4EA 1DQAA 1NB7A 4IG3B 4I64A 1CJTA 5HJYA 4KGMA 2QMXA 2JVOA 3AY0A 3BH6B 3M32B 4I2PA 3HK2A 1S1TB 4DXLA 1LEOA 2ZBQA 3MMCA 2ZOMA 1FXRA 2HVEA 4RNHA 3NGDA 1A6LA 2C2MB 4A46A 2ZBIA 2OGUA 3DRSA 5KFEA 2E5IA 1TZ0A 1N6QB 2W9BA 2DY9A 2VFSA 3HHLD 2MZJA 2XC9A 3ILIA 4B3OA 4LF4F 1V3RA 3LWLA 2J0QD 5IQ6A 4OMFG 4X4UA 3JSBA 1NNDA 4RO0A 2RQKA 1X5SA 3P3DA 5L39A 2HQIA 1SKRA 3KHHA 3DLJA 3W2VB 2MEWA 1B64A 4JI8F 1V5VA 2HNZA 3CCQS 4LFCF 2M8HA 4KPCA 3MMAB 1WHVA 3MUTP 2ZOGA 1LXJA 2PDAA 1YKWA 2YNIB 4ED8A 4MH8A 4KPYA 3HSZA 4DX8H 3TA2A 2DISA 4OX9F 2MXYA 5ETPA 3KLIA 3MOZA 2IYIA 2KT3A 2MZSA 2E1CA 2C2DA 1WKJA 4KBIA 3FNNA 4BS2A 4P7TA 3R27A 3PDNA 3J80Y 4OX8A 5F41A 4E8UA 1VISA 1RWOB 1RAJA 3HJFA 4CO5A 4NZ7A 1FJGJ 2XZDB 5G0RB 1N0VC 4QOTA 1QVFR 5DM6Q 2LP4A 4J9KA 1VR6A 3UN3A 2KM8B 2DGSA 2DH7A 5DGBA 1S6QA 3N6LA 5AT1B 1X4EA 1UFWA 2YX7A 2V4RA 4IG3A 3D6HB 4CM2A 3C16B 3BH7B 4Y2MA 3SYZA 4OI4A 3IA0A 2VKZG 4D3HA 2NYIA 3KNAA 1IR1A 1UEVA 2C3OA 3CJ5A 4Y2IA 2AJ1A 3H2UB 4NEYA 5CXTA 1N54B 2XLIA 3UO0A 2XMTA 4ZPDA 1H73A 2WTFA 3HPOA 1BGXT 2HKEA 3TVKA 5LXYA 1HPZB 1XBWA 1NU4A 3SQGA 5THWA 4Y0FA 1N6QA 4ZVHA 1M0SA 3MM6B 2IM3A 1VRUA 3PFOA 3GFYA 1WSRA 1JXLA 2ASLA 5SUHA 3VTIA 5DQGA 4IRKA 4ECWA 2J9EA 2JRSA 4RPFA 3V4IB 2CG4A 2CADA 3EXCX 1N5SA 3ENQA 4PXCA 3H4BA 3QLHB 4Z37A 5GADU 4RNMA 1FESA 1JLAA 5CH7B 3BZQA 3OD2A 2V8HA 3I87A 3KLEB 4NA1A 1RT6B 4IOCQ 3BYRA 3MUMP 3PJWA 2ASDA 3CJ8A 2XY6A 2HHQA 3OXFA 2YNIA 3KHLA 2R4FA 2FZKB 4ECXA 2QN6B 2WONB 4XPCA 1VQ4S 4GO7X 1RWKB 3AOBA 1NK4A 4FNHA 4OJHA 4LF4J 2C2NA 1UMJA 3EMTA 1VQOS 2RUGA 3M2UB 4ID8A 2CQCA 1CJKB 1L3SA 2HZAA 1ZAXA 3FSIA 3DXBA 4OLPA 4JI8J 3Q2TC 2LXUA 4OJ1A 4M63A 4U7UD 3W5ZA 3I5CA 3BREA 2XNQA 3AOCA 4K5SA 1P9YA 2CQGA 3ADAC 4K59A 1HHQA 1GXUA 5G0RA 5A6PA 3RAMA 1YBAA 1VFJA 4N56A 1U24A 4OX9J 1NKBA 1VQSA 1OO0B 3IMQJ 3MECB 1YBUA 3THVA 4R8UA 4JOUA 5KFLA 2OPRA 3C16A 3T1YF 5FDLB 1ACMB 2R3VA 3Q24A 2C2KB 1RU1A 1HNWF 4HACB 4RLEA 2RAQA 3NMRA 1O6XA 4HH0A 5AXMA 4CIOA 1NK6A 1XWLA 3CJRA 3OPKA 2FGOA 3GE9A 3C15B 2KRBA 2EK1A 4RZRA 2RRNA 3AH6A 4NX9A 1E6YA 1L3UA 1QSYA 2DO0A 4JI7F 5F8MA 4NRUA 2AGPA 4DEZA 3ZFVA 4URSA 1RABB 2HFVA 2CVEA 1KVIA 3MM6A 3EPIA 1NJXA 3HD2A 3DOMB 4TLRA 5K5MA 1Q79A 2CJBA 3PNIA 3BBBA 1QTNB 3PRBA 5HBMB 3JYTA 1R3NA 1TKXB 5HMYA 4JI1F 2RS8A 2MQLA 3QLHA 3A3PB 2YKMB 1U8SA 3ELHA 1F60B 1AUSL 2MLYA 4J37A 1X0PA 1R27B 3DLKA 3FEYB 5DRKA 2AZ1A 2GJ2A 3MGJA 3JTOA 1RT6A 3IN5A 1WUUA 3CIZA 4C6AA 4QWCA 2Y8YA 1KTQA 2PMHA 3UR0A 2WONA 3N4WA 1ZTTA 3MD3A 3H42A 1C0TB 1TL5A 5KFZA 2V6AA 3MEGA 3F73A 2VF3A 5A8RB 2GQCA 5M2PA 3M2UA 2XMJA 3DU5A 4FKYA 4NPOA 3GONA 1R89A 1CJKA 1D3WA 4WFAQ 2HPUA 2M3DA 4A47A 4YB1P 2LA6A 4K2JA 2LXIA 4DI6A 4PQAA 4C8OA 1FERA 4EBCA 4DV4J 1OY9A 4ZPBA 4DV1F 2A2DA 2GO9A 4TU8A 2E7VA 1HD0A 2I2YA 1HW9A 1HWUA 1SJFA 5D0HA 4NXNJ 2OPSA 4OYPA 3MECA 2V2QA 4PYAA 1V9OA 1A0OB 2MLZA 1FNXH 3G96A 3ZTRA 1B0VA 4H4OA 3AB4B 4JI0J 1L3VA 4MKYA 4HACA 2HURA 4J9QA 5IT4A 4RU9A 3MAQA 3EGNA 1YLXA 2DRDA 6FD1A 4DF4A 3VQTA 3C15A 2VG6B 1VQ6S 5LMUF 4DV3J 2NXJA 3BKUA 2D3ZA 3R5GA 3W61A 2FLNA 4ZVPB 3HHEA 5C25B 2D69A 3D67A 3T1YJ 1SQGA 5A8KB 3DOMA 2OSRA 3UFCX 2QYCA 1HNWJ 3KLVA 2ASYA 2HAIA 2H5EA 4NI2A 3CPWR 3W62A 1O8BA 1D1UA 1VGYA 1WSVA 5HATA 5HK4A 1RAOA 5HBMA 2YX4A 3AQPA 2YKMA 1WG4A 2DR5A 4WFXA 4QR0A 4JI7J 2YKNB 2OH2A 1Q7LB 4NLVA 2IC3B 2ZFHA 2XYHB 1Y5NB 4DQRA 1KVJA 3IBCB 2BA9A 1X7VA 5DZ6A 4RUAA 2YWFA 4B08A 2V2KA 4J9PA 1RT1B 3LGMA 4NA3A 2KHDA 2FGCA 4DQQA 2GAHC 4DU7A 1IM4A 1DQ8A 1DZ5A 3V4MA 4F0KA 3V6JA 5L1KA 4WKYA 2VFTA 3SFGA 4WK3A 2P9CA 2RMLA 2MHNA 3HHLC 3QT8A 5HP1B 3R6GB 1HIYA 2JVRA 4C8MA 4PZVA 4OYBA 2JHEA 3PR5B 2UU9F 1MLAA 3OSPA 1U25A 3OR1B 4V1Ak 1S1WA 1NK9A 4FKXA 4HR2A 4EFAC 1X0FA 4QYZJ 3FEZA 5CZXA 4FZVA 3H5UA 4CP5A 4PG4A 4L73A 1JJ4A 3QRQA 2ZWOA 3W1YC 1FO1A 4HT7A 1D0EA 1H7WA 4TYBA 4NCBA 4DLEA 1WI6A 4YDDB 4EYHB 1NO8A 3UN2A 3MAAB 4DPTA 3CDAA 2A10A 5DG8A 1VLOA 4EYIB 1SJRA 1AUDA 2VG6A 4OZ3A 2ZBPA 3J80U 2QA4S 5L9NA 4IFVB 3D54A 2GQ2A 2FHJA 3ENVA 3CJQA 1UA0A 1WKLA 2V63A 2H54B 1WG5A 1U26A 5C25A 1M1KT 1KHWA 2XS7A 2XULA 5A8KA 2Y0SD 2QEXS 2KB2A 3A1YG 2JFKA 1AFIA 1FNOA 5AE1A 5AXLA 4DV0F 4DUYF 3N79A 1HMVB 1H72C 3CJTA 1MW7A 2XHWA 3DOKB 2J8AA 3RB3A 3MCMA 2HFOA 1KVKA 1HBMB 4C8LA 1LOUA 3JAMY 2YKNA 2IC3A 2DEJA 5J2MB 1CVJA 1EETA 2GIRA 3NL0A 5DZ7A 3MPYA 4Q5VA 1VQ5S 4X2BA 5BXIA 1EKRA 3DRRB 3NCRA 3VR1A 4Y3CA 1D8ZA 2IPOB 1VDHA 3JQKA 3AAWB 1VCTA 3CCZA 1EQ0A 4KSEB 3NOGA 5K20B 2XSJB 5CCLA 5HMZA 3ENAA 3VAIA 2QO3A 4B3RF 5KFAA 1FDDA 3CD0A 5HP1A 5I3PA 2W4PA 1SJ1A 3PW4A 1TK5A 3PYDA 3OR1A 1H98A 3R1HA 3LF0A 1NXIA 2YKQA 3MHYA 3BPSP 1UPMB 2VA2A 5D8HB 3GYGA 5HSPA 1TVRB 4KQZA 2CPDA 3RUBL 2XYGB 1OSCA 5D4NA 4NL5A 3AFGA 4KGZB 3G2XA 1SC6A 4UQGA 2YQ1A 1IXKA 5KFXA 3GIRA 3OXGA 1RT7B 1BD6A 4ZLLA 3ILJA 4LFAJ 1MROB 5KG3A 3M1VB 1CULB 3B82A 4I68A 4LF8J 2DNLA 4IFVA 1NUEA 3W65A 2ADBA 1F5CA 2MZQA 3KDOA 2CPJA 3D5MA 3NGSA 2MYFA 2CWKA 2F3JA 4ELVA 4AXJA 2XGPA 2K1RB 4IRDA 2XHCA 1M5VC 1UVKA 5C24B 2F8HA 1TAQA 3DI6B 1S9FA 5F9LA 2KT2A 4CLLA 2YWWA 4Y34A 3W64A 4LQ9A 2W2QP 3W5XA 3QAEA 2LA4A 2CJXB 4PWWA 4FXVA 3OFFA 3US5A 4OJGA 1FFSB 1SUQA 2NR0A 2M5YA 3DRRA 4MKAA 4YS2A 1YITS 2XCPA 3J81U 4J90A 5D0GA 4B3SF 1SH2A 1BQNA 1UZDA 2ATCB 3D7SB 4IOBA 1S1XA 4DV0J 1W2BR 2A18A 2XSJA 4A8WA 1LQ9A 2VBZA 4K4UA 4NEZA 2Q66A 1RTHB 5KFJA 3PW5A 3CVKA 4Q0BA 2ZH9A 5KT6A 1B7FA 2DCUB 4ZJQA 2V8VA 2CNOB 4JI5F 2N3LA 2HNYA 1SC4B 2FJXA 4TY8B 2C3UA 1WOSA 4DZDA 2Q79A 3GFZA 2MLXA 3R1LA 2KXNB 2ALZA 4DDFA 2EXUA 3OJUA 2QX0A 4B3RJ 1NHKL 4WZMA 1JNRB 4NYZA 3H98A 2YKAA 2AJFE 1S7HA 2CJAA 4HL9A 1L3TA 3PIOQ 1UL3A 4X62J 4DPOA 1SL2A 3FUYA 4NOHA 3BQ1A 2V4JB 5IV3A 4I7FB 4NCAA 1YIJS 1VQLS 2K1RA 4B02A 4GRSA 3S6EA 5C24A 5F9NA 2DXDA 3BN7A 1R43A 4ZVOB 1N32F 3CSKA 3MPUB 3VQSA 3AA9A 3M6WA 3WHIA 3NS5A 5KFHA 4JI4J 2QMUB 1VC6A 1REVB 4DCOB 1QY7A 3C2PA 1VQ8S 3KUHA 3VGTA 3GIIA 3ICLA 1IWAA 2JOQA 4ZN1A 2DNOA 1PIEA 4OHXA 1XTZA 2OPQB 2HZVA 3SSSA 2MJNA 4M5MA 2OEMA 4A8OA 3EVMA 3FZBA 3DYAA 2DH8A 4LFBF 4ZIVA 3R5DA 2ZZMA 5JUMA 2GMJA 4G3IA 2QA1A 3M8QB 2UUAF 1RTHA 4E0DA 4M5JA 3Q2SC 1BXNA 2WK4A 4RUHA 5DG7A 3ZZUA 3QO9B 4CLPA 5JMNA 3MI7X 4QR2A 4GVBB 5BYSA 3MM8B 3H2LA 3H5XA 4LSNB 1AA1B 4B3SJ 1UFKA 4XAKA 2LVWA 4TKTA 1WF0A 2HAFA 4MK8A 1UVMA 3K2YA 3MAHA 4N8NA 4I1TA 4DL2A 2R42A 1OYDA 1B99A 2CYYA 3KLHA 5L1IA 4JI5J 4P2SA 3FJ2A 3VGSA 1UEKA 4U7UK 4NZ6A 4CRJA 4CQ1A 4L76A 3BGFA 1S7IA 2MHEA 1PBUA 3E01A 3LP1A 5HJXA 1HQUB 3DRPB 4RW6A 4I7FA 3Q8VA 3RBEA 1RAEB 2B4OA 2MZ1A 4F7VA 5KFMA 5E41A 1IJEB 1NSKL 2B7BB 1U48A 3BSNA 7AT1B 3PY8A 4CYUA 3E8OA 3AA8A 4DFPA 3EX7B 2GAGC 1FRKA 2K3KA 3W2WB 3G6VA 2W1BA 2XTJP 4WU3A 3VAFA 3CGIA 1S48A 2V94A 1VI7A 3HZEA 3GFXA 2NUUG 3NNAA 2OPQA 4RW7B 4LJMA 4DN0A 3C19A 2APOA 1K1QA 4CT9A 1W2IA 1N32J 1FDAA 4ZLJA 3QGGA 4TN2A 4EK2A 1YJRA 3AQOA 2J5AA 5J2PA 2K06A 2P5VA 3CB4A 1MMNA 1KSPA 3G87A 3M8QA 3S7RA 3OV7A 3GSIA 5I3UA 3O3LA 3D3BJ 5AE2A 1UCNA 4XIUA 2L9NA 4M5DB 2DNQA 2HQFA 1T9TA 1SL1A 1HLWA 2MSTA 1RE1B 4DPWA 4OI2A 3QSYB 4NLRA 3MM8A 2HWHA 4RR5A 1HNVB 1KRPA 1NZAA 2R7TA 3GQCA 4KHPF 4LSZB 4LFBJ 4JI6F 4F0HA 2MDAA 1U1OA 2KI2A 1YTYA 2UUAJ 1VRQC 2B8QA 5KG1A 5L9XA 2ZJRQ 1S77D 4GO5X 3E2EA 5HL7Q 2FHOB 3G6YA 3EZUA 2DNYA 4HI2A 2VC0A 3W60A 1T9YA 5KOWA 5KG7A 4IQXA 4FF1A 2ZDPA 4PXDA 4USUA 2V9WA 1NBEB 3LP2A 4KHMA 4P2MA 2WB1D 1UAWA 4ITSA 4J9UE 2CPHA 1HBOB 4RBUA 2LMIA 3B6BA 1U4BA 3QT5A 2B3TB 3UNYA 3V6HA 2Q3PA 1IBKJ 1D9DA 1N5VA 3MEEA 3HVTB 2IMWP 4IFYA 4MK7A 3CCMS 3NGTA 2EBGA 2FJBB 3KOAA 3W9IA 1JNZB 3H8YA 3FQKA 3QIDA 1FJ7A 2HMIB 2N4CA 3DOLA 1YJUA 4DR5F 2OLWA 3W2WA 5HMWA 2FTRA 4AQYJ 1OMSA 2JLFA 3MMJA 1RKIA 4RW8A 3PKYA 3HVWA 3ITHA 4J9NA 2CPXA 3M9MB 3MDFA 1WG1A 2BJ3A 3OTCA 5LT5A 3LALA 5IQQA 3CTRA 2XLJA 4A8KA 3AJDA 1I94F 1FWKA 4KKOB 4UUXA 2ZZNA 5ETSA 2BW2A 1C1BA 2QSFA 2AEFA 1QAXA 3O5TB 1HNVA 3EZ5A 3PFEA 4P74A 1YJ9S 5IM0B 4G1PA 4ATNA 2VG7B 1B0PA 2ZOFA 3CJ0A 4CWBA 5HAOA 1BMQB 3ZZYA 5DLGA 2FHKA 1BQXA 4X66J 2JLEA 3NMAA 2KVIA 1YHQS 3VALA 2MQMA 3ET6A 2YWKA 1FTCA 3GR0A 2RKIA 2J0WA 1B70B 3P6YC 1VBKA 1BC6A 5BYQA 4ED5A 4DR6F 3FEXB 5D4LA 1T02A 4DV5F 3M8RA 2GFFA 2IRYA 1LK7A 1Y11A 3PRVA 2VHGA 3RBDA 3CCRS 1F9HA 3F41A 2H9ZA 3OFHA 3V81B 2ZKUA 4NA2A 2QA4G 4KHPJ 2KG1A 2DO4A 3SBMA 1CG2A 4ERDA 4Z7CA 4CO1A 2XMKA 2DTJA 3OTDA 1HBNB 4FPIA 3ZZ0A 3S1TA 2NSBA 4DCPB 2B9WA 3NAHA 2D74B 3TQEA 1T9UA 3I0RB 1LWFB 4ZCKA 3HVTA 3OR2B 2ZZTA 3A8JA 2C2EA 4NXMF 2ZC4A 4FN5A 4DF8A 4DR4F 1B7YB 4EWTA 1NRKA 3RTVA 1CS4B 2KFNA 4LF7J 2BVZA 2DRAA 3CJKB 2HMIA 2DNMA 1S9EA 1EIYB 4CNZA 1AZSB 3N6NA 2YNFB 4LF5F 3CE8A 1DQ9A 3TO8A 4QWEA 1FX4A 3PXGa 3HHDA 1CJUA 4YQWA 1JQGA 3GR1A 4F3QA 4USJC 2C22A 4M5IA 1YK9A 4PXBA 2IAJB 4IR1A 3MR7A 4Q43A 3W3SA 4B3TF 1HBUB 2DR7A 2HW3A 3FBBA 3ISNC 2Y9HA 4RBVA 4X65F 1U45A 2EW9A 3I5AA 2RU9A 4KO0A 4NLPA 1JLFB 3M2RB 8AT1B 1P1TA 3GV5B 2RQ4A 2ZDOA 4PUOA 1I94J 2D3OR 1S6PA 1FWLA 2SXLA 1UW4A 4HHHA 2LDYA 1AFJA 2HVDA 2EFGA 2XG8A 4YHHF 4ZVGA 3BKTA 5CQGA 2G0CA 5J1EB 2HBZB 3LTOA 3NGKA 4C8NA 1XMBA 3V81A 4JI3J 1NH7A 5FIIA 2FQQB 2VQEJ 4HTJA 4K7QA 3H59A 1S99A 1JLGA 3HVRA 1T9VA 5EWGA 4J91A 1N4LA 1X4HA 1RKJA 5H9EK 3FBCA 1HQEA 3I0RA 1LWFA 5KFVA 8ATCB 2XO7A 4DR1F 3L3CA 2VODA 2JEJA 1Y7PA 4DR6J 2EBEA 1CJVA 3M4XA 3KHGA 1HHTP 2H51B 2MQQA 2C1EB 2ZH8A 4FNIA 1C0UB 1FWPA 1ZAVA 5CYMB 3DGVA 4F50A 4PG7A 1MMDA 1JK9B 5A8WA 4FXWA 4FYDA 1FI4A 2YNFA 3QRRA 2W7PA 3T3FA 1J2VA 4AE5A 2EC2A 2WVFA 4E2FB 3R7BB 1S76D 3FQLA 4YN3B 1X9SA 3MD1A 2AZ3A 3S01A 3CCSS 5GAEI 4NXMJ 1X4BA 3MURP 2ZEJA 4DR4J 1T3NA 2RU3A 4PG6A 2V68A 4FVCA 5KFFA 1T94A 1S0OA 1U1RA 4FF3A 2CKWA 4ELUA 2K8GA 1RTJB 4WYWA 1LFWA 4BBYA 4LF5J 1EP4B 1GTHA 2A1BA 3HVAA 1JLFA 2QE5A 5ETRA 3SSRA 1ZM2A 4FVMA 2CNKB 3LOUA 2XO6A 4HEA9 3L9ZA 2R7UA 1GX6A 1YRTA 2FD2A 4K4XA 3L7OA 2CZ9A 4B3TJ 3OHBA 2JZ5A 5DQHA 3TVZA 3VZHA 1N36F 3M8WA 5KT4A 1WKKA 1R8BA 3CC7S 1FD2A 4NLYA 1X5PA 3G4SS 2AGQA 4Y00A 2R7OA 3AODA 4O23A 3JB9k 2M9KA 2E1MC 2OMLA 5KFDA 3DC2A 2I5JB 4EZ9A 2D1CA 2IDLA 2LECA 5ITHA 2XB2D 3Q8PB 2RQCA 4MMOA 4WK1A 3BGOP 1SJ3P 3BGLA 1M1GA 4IH6A 2OFGX 5U47A 2MQPA 2DNPA 4YHHJ 2KG0A 4DQSA 4DR7J 3PCOB 4UY85 3UVJA 2ZD1B 1E6VA 5CYMA 1MWYA 3I82A 1U2CA 1HARA 4CLKA 2BW7A 2PGCA 2MY8A 3CO0P 1YZ6A 5C2CA 1RTDB 4OHZA 1SXLA 5KAKA 4C97A 4WFYA 5BR8F 1IKWA 1RA7A 4WWSA 2CQIA 2MGZB 2ZH1A 3TYTA 2LYVA 3LWMA 5KFKA 1X60A 3DXSX 1H2UX 3EVWA 4ZP7A 2HEKA 5DETA 1HQ2A 2ZJQQ 2D3O1 1RT3B 1EP4A 4F04B 2JC0A 2AU0A 1VC5A 1WTFA 3ISZA 4YB6A 4UTGA 1EARA 5F8JA 4RW4B 5ETNA 3ZC4A 1IBCB 4Z7YA 2FC8A 3PHTA 4JV1A 4L72B 4AT1B 4OQJA 3VVUA 2J9DE 5KT7A 1VQ9S 1NLKL 4KIAA 4PEOA 5E3AA 1RCOB 4OYMA 5KFBA 5KTQA 2AWZA 2JH3A 3Q8QB 4AD6A 5D4PA 1MN7A 2AYMA 1SVDA 3DLBA 4JUZA 3SFUA 3UD3P 3BQ0A 4ZJOA 3MM9B 2I5JA 4WTOB 3VWSA 1DHMA 1WJ9A 3PIPQ 5DS7A 4ZPVR 2E9TA 5GAGI 3F44A 1N34F 2W25A 3NNCA 4UY8T 5HQMA 3W66A 3QYYA 2F9JA 1N36J 4CO2A 2CDQA 1JB0C 4O44B 2QTWA 1H74A 4C8ZA 4FS1A 2HGLA 4AL5A 4ECVA 1WC1A 3KK1B 2J8SA 2OTJS 2WW8A 1F3FA 3SCKE 3MPDA 1YRXA 1RTDA 1HWLA 2FC9A 2W9AA 5I4MA 3GZ7A 1NDKA 4ED7A 2WB4A 2JEFA 3MR6A 2W2OP 4M5KA 1R6VA 5D6GA 5GAHI 5GVQA 4DR3F 2J7UA 4L3NA 4FF2A 2X51A 2ZH7A 2KT5A 5KG0A 1KDNA 3N01A 4IQMA 2R7SA 2E5GA 2J6SA 1VLYA 2DCLA 1VBZA 4WFBQ 5LSOA 4J9VA 2AIRB 2LKZA 1WF1A 5RUBA 4RW4A 3K8VA 4ECTA 1IKVB 2RJZA 5BR8J 3OL9A 1TL1B 4HDHA 3TP2A 1U8WA 1CQNA 1GXTA 1LK5A 3BKFA 2AYGA 3I55S 1Q7YT 4P2XA 1QAIA 2R8GA 4OZ0A 2EVZA 2GIFA 2VPXB 3RZAA 3GMGA 3G71S 1Q4RA 2PC6A 2U1AA 2ZKTA 3D9BA 3OTBA 4LBPA 1WNEA 1ZA1B 3MM9A 4Q45A 5C5JA 3W63A 2UUBF 2QA2A 2ZHBA 3J7AN 1S0MA 4OZJA 1RCXB 3TANA 4USHA 3TA0A 4F2SA 4WZQA 2MZTA 4NLQA 3GG0A 1RXOB 3IAM9 4OYOA 2DPIA 4IRCA 4DL7A 3ILOA 3DMJA 1JJHA 2NXUA 2VIHA 1OQ3A 2IJNA 3RR7A 3A4TA 3NCQA 1NJYA 2L41A 3IBWA 1R0AA 1C4AA 1B0TA 3POTB 3ZNUA 3K17A 4DN9A 1UA1A 3M8YA 1N34J 3D6TB 1S1VB 2XI2A 2MQOA 3OUYB 4PWDB 3UNGC 3FCWA 2R2UA 3FZ2A 1ZAWA 2WBMA 3LQVA 2DYAA 5T7LA 4A8YA 1F6TA 3D3CJ 3GIMA 4PCQA 2CNLB 4KAIA 3WX8A 3K5PA 2XCAA 2W2MP 2VJVA 5L46A 3ETOA 2KYZA 1HWIA 4CTAB 3CCUS 5IT0A 1LW2A 1TMJA 4RU2A 1WWHA 3U27A 4LF6J 3MMBB 3TWZA 3C14A 1IKVA 4KV8A 2R2SA 1TL1A 1SI9A 2WBRA 1NK0A 3TJ9A 2F65A 3P8BB 2KTQA 2XLKA 2X1AA 3E3XA 1GQEA 1OSDA 3H25A 3VF0B 3GJQB 1J5OB 1H38A 1KP6A 2V2ZA 5CA5A 3MWBA 3HXMA 1LWXA 2XBPA 3MR2A 3MOJB 2IFXA 3HMJG 2VBYA 1VK8A 3QZ7A 5LSRA 1TL3B 4DL6A 3EM1A 1WC3A 2V5HG 2B4UA 3T9NA 2XNRA 2QLXA 1JXEA 1VQPS 3W7BA 2IA0A 2J9DA 4KFBB 3WIVA 3IFEA 5KT2A 5DDPC 1RJJA 4LBIA 4M1KA 2DIVA 1T7PA 3RBXA 2I0XA 1RT2B 2VFUA 2L9DA 3TA1A 2HBRB 4MFBB 3UR3C 4HLBA 3CF5Q 4OHVA 4FBTA 2V8PA 2VOOA 3BR8A 4C9DA 5MLCV 1N52B 3IG1B 2MB0B 4F3MA 3BBFA 1R8CA 1U1PA 3J81j 1KOHA 4LBHA 5KG5A 1RAGB 2UUBJ 2AEJA 4ENOA 3BQ2A 1PYOB 5KT3A 4HH1A 4WE1A 2WHOA 2Z57B 1Z2ZA 3MM5B 1YBTA 3OUYA 3GCXP 1QJHA 4PWDA 3RG6A 2Y0BB 1VBYA 2LU2A 2MY7A 8RUCA 4LF1A 1SB6A 3GV8B 2VZ9A 3ZO7A 4X4VA 1HNZJ 4UW2A 2XS2A 1GMWA 1D9AA 4R5PB 5C42B 1IBMF 3T41A 3D68A 1FE0A 4CTAA 3C6TA 4ZCLA 3OHAA 4KRWA 1OY8A 2HWIA 4IH5A 1JLEB 3MMBA 2LU1A 2MKHA 3HFZB 1PG5B 5IV4A 4ZN3A 2F8MA 3B8HA 4WBFA 3FVYA 3KJNB 2QV6A 4F3OA 5E3QA 4LF9J 1TL7B 1UFLA 4B9TA 4KHRA 3HF5A 1BQMA 3K89A 3SZ2A 4DU8A 4RNOA 3QIPB 3V6DB 3NNHA 1QUVA 4KB7A 2ADCA 1Y10A 3OTEA 5HQLA 1TL3A 1WD6A 1DTTA 4KJIA 1SIWB 3BF4A 4ZMMA 5FD1A 1ZTWA 3RB4A 1CBKA 4XDCA 3EZOA 2VG5B 4ZHRB 2HYIB 3T5JA 2MQNA 2E7WA 1JLCB 2DD8S 2DHSA 1N33F 2HHVA 1RT2A 4B17A 2D9OA 2ILYA 3IR6B 4L6V3 2EWHA 2XWYA 3I0SB 4MFBA 1SC3B 3QQCD 4DR2F 1ZA2B 5ETTA 3SEOA 2VBWA 1TAUA 4ICLA 3K0JA 5CD4H 1IWGA 4DSEA 3PR4A 2H5JB 2FJAB 3QT7A 3CWJA 1SV5B 3A3OB 1CPZA 1ZOTA 4DG1B 5JXSA 2X1FA 5ETQA 2G2ZA 2DGWA 1C2PA 4EZ6A 2CPZA 3OXLA 5B09A 3OL6A 3ZXWA 3CCWA 3MM5A 3OW2R 2PD1A 2UZAA 1VHFA 1NSAA 3HT0A 1DJ0A 3MM7A 1RT4B 2DXFA 2GS8A 3IBFB 3W9JA 3M9NB 3QGIA 4MTPA 2CIMA 4R5PA 4WFNQ 2HK2A 1RT5A 1FX2A 1UWAA 1JJCB 2DGTA 3ZZRA 4QIGA 1OS5A 5HQ8A 2CVIA 5KOXA 1JLEA 2UUWA 3BBCA 3UD4P 5D3GB 2B7CB 3WC0A 2BUNA 4IYQA 2HK3A 2CQ1A 4IG0B 4P75A 4RUBA 3G8QA 2ASJA 4QR1A 1NM2A 2IJFA 4DUZJ 3J7YI 2UXBF 3V6DA 1XNQF 1FVSA 4AL7A 2B6AA 5CHCB 4P71A 2VPYB 5LJ3Y 4WXOA 4H4KC 3OLBA 2B9XA 4HTIA 1Z2LA 5ADZA 5A6WA 4A8XA 3DNCA 3CULA 2HQGA 4FF4A 4OV6A 4GC6A 4R0EA 1Y0HA 2BJ9A 1FCAA 1UJ5A 2HHSA 1IKYA 2VG5A 3NBPA 4ZHRA 1T95A 1WF2A 3L95X 3VVTA 1VRTB 2CQBA 3DRYA 1FDBA 4CLTA 4Q44A 4OYWA 2AJ0A 1IUJA 3PO5A 3SDEB 4IR9A 3U1MA 4Q7AA 3M32A 3OTOF 1S1TA 1URRA 4NYOA 3I0SA 2MKKA 4A8QA 2HNDB 2I1RA 3R9LA 2YXLA 2OHDA 5HVFA 4F02A 3EJMA 2R8KA 4FPRA 3MZIA 3UPFA 4QBUA 4OJ3A 1SV5A 2AQ4A 2DIUA 1U2RA 3UW1A 2GVZB 5EX0A 1IM6A 4AUKA 1N33J 2M52A 3QSIA 1YRUA 4F4XA 7FDRA 2BJ7A 2AJQA 5IT9Y 1F2GA 3PG9A 1F5BA 4G1QB 2Z2YB 3J7YU 2CDRB 5E7OB 1JWWA 2YPZA 3HFVA 4DR2J 2B51A 2CRLA 1RT4A 4UOCA 4C3LA 4J9LA 5K14B 4I2QB 3DGPB 3W2VA 3DU6A 1M5KC 2IDEA 4O3SA 3EWGA 2ZBRA 3CD6S 4YMEA 2N3OA 4B9UA 1TQLA 1V6HA 3MMAA 1TK0A 1PSDA 1U1LA 2KZZA 7FD1A 4FP9A 1X4DA 1KKHA 3KXDA 5D3GA 1URNA 1ZPVA 2BM0A 3TEGA 2DRBA 1L3KA 2HQCA 1FD8A 4YR2A 2ZM6F 3MUVP 4M5HA 2DGQA 2HVHA 3SCJE 5KFIA 2BXJA 4YR0A 2EG1A 4N5SA 3BDPA 3CDBA 3NY0A 2CWXA 4IO1A 1R8AA 1K1SA 4LFCJ 5ETOA 1UWBB 1SJQA 1Q78A 3MPWA 3Q89A 4GKKF 5B7WA 3AHPA 3B78A 3HHLB 3CCLS 3K5OA 2YY3A 3ZZZA 2C28A 3RRKA 2FIUA 1JLQB 5C2GA 4FBUA 5ETVA 2AX1A 4ETZA 1VRTA 1BUXA 4WJBA 1TFYA 3I6PA 3T5HA 1KD1T 2Y1LB 4K4VA 4OZNA 2DBBA 2BE7D 3OVAA 2VONA 1S49A 1LKZA 4BHQA 4X4TA 3G6XA 4K2XA 2DHAA 1REGX 1MMLA 1KQKA 5LOQA 2YWHA 1TUGB 4O4GB 1HPZA 1KLMB 2IRXA 4OHWA 3KWMA 2CJYB 2ZH5A 1RP5A 2IVYA 4YR3A 1U47A 4G65A 3OTOJ 3KK2B 4I6YA 1VHIA 3G8TA 3JXOA 4CZCA 4O3NA 1NEEA 3V4IA 1P27B 4FXDA 3NP5A 2O67A 3M6XA 3PJ9A 4PPZA 3KHRA 1RU2A 2X3GA 2FB0A 2X7IA 3KLEA 2CQ0A 3RB0A 1FJEB 2Q43A 3IR5B 3WX4A 4KT0C 2J7KA 4LRBA 4IOAQ 2F4VF 2DGUA 2YTCA 3D0HE 3LPEA 4LUBA 2VH7A 5EN1A 5EGYA 2PO4A 3RRHA 3TAMB 4ZPTR 2VL1A 1BWVA 3E51A 5L1LA 2AEMA 3KYLA 3BN4A 3N9UC 3TRGA 3GILA 4CO0A 2EFVA 2FY1A 2EPIA 3MR5A 3CDEA 4XK8C 1UWBA 1NB2A 4NASA 1IJFB 1RZMA 1K9MT 3CC2S 2BKPA 3R5CA 3HHLA 3Q8SB 2WRMA 4DL0C 1YVFA 1P6TA 2Z2MA 3VV2B 3TUPA 3DDIA 1A7GE 2RRBA 4XO0A 2ZM6J 2XMAA 3R7SB 5I42B 5FDLA 5HROB 1RHRB 1RWNB 2YNGB 4RBTA 1RADB 2CQ3A 4DJBA 3W5YA 4EBEA 2A0FB 2DNRA 2GW8A 1T8EA 2VC1A 1XR5A 2MKYA 3SV4A 2HHXA 4GKKJ 3HULA 5KFQA 1X9WA 5BJRA 4ZVSB 4DL5A 2BJDA 3VGUA 4O4GA 3TR5A 1TUWA 4OZ5A 4K4YA 4DQPA 4UOGA 3BDEA 5KFOA 2FVPA 1H6KX 2XEXA 2MTLA 1XN9A 2HG4A 3HDSA 2EFOA 1ZZFA 3CCES 3DDNA 3OQ2A 2NSCA 2HIYA 3PW7A 2ERRA 1PJ5A 4MIAA 2N7CA 1SIZA 3QWUA 4J5OA 2FLPA 2UV8G 1TKXA 4Y2CA 1TMMA 1YZ7A 2ZH3A 4ES1A 5GMEA 3SMZA 1U1NA 1S97A 3GV7B 4OYAA 1U6FA 4ZVEA 3UD5A 1WHXA 3NRBA 5IC4B 4EI2A 4QIVA 1RI7A 4F0MA 4MIBA 4ZPCA 4NLTA 4ZP6A 3M30B 1T03B 2GVDB 4F2RA 2Q6BA 1C0TA 3I5BA 1GK8A 2BQ3A 3VGVA 2V67A 1U09A 3TAMA 2ZC3A 5A8RA 1G1XA 4JI1J 3IRXB 5HI7A 2O5DA 3VAHA 2FYXA 4EEYA 1M5HA 1SKSA 4UOHA 1BWEA 2PEHA 2VQFF 3UDVA 2U2FA 2QFJA 2LCWA 3B4MA 2AV5A 1V3SA 2RF2B 2D7SA 1U0HB 4OYXA 1VIXA 1M1HA 1HNIB 2F4VJ 4CH7A 1MU2B 2LLZA 3QGPA 1A9NB 2OELA 3U02A 1PAUB 1RB0A 2QGFB 3CJ2A 3GTYX 3P5BP 4ILRA 2YNGA 2HVIA 3O2IA 3HHNB 1ZM9A 1KQGB 4F25A 4F4AA 1KFDA 3KUGA 4EBDA 2C2RA 2P2CB 4MJKA 3P5TL 1OIAA 1NH8A 3NKYA 4O3PA 4DV1J 2D9PA 4DSFA 2HFNA 1Y3KA 4M5NA 3ZTQA 4H4MB 1FE4A 1WC4A 4EO8A 1DLOB 4LR9A 4B3MF 3DLGB 2KDOA 2ZITA 3U7JA 1L5UA 2M0GB 2GGPB 4WTYA 1SCJB 4LRCA 2P6TA 2VUGA 2YNHB 5LMUJ 4QWAA 3GP9A 1XNRF 3EVOA 3L4BC 1RHMB 2OUGA 3TOQA 3NCPA 1WOOA 1RHKB 3TAQA 2WVBA 4TY9A 5K8OA 2B0GA 4U8YA 3W8GA 5T14A 1NDCA 5DDQC 2QLFB 1TKDA 4WIIA 1TL4A 1VMBA 2A3JA 1RT1A 1U6ZA 1JXVA 2B56A 2KRRA 1HWJA 2UXCF 2M7SA 1AW0A 3PO4A 4C3KA 1X4GA 2HGNA 3HLUA 2QT7A 4P10A 1HNXF 4LSLB 3IRXA 3IXQA 1I51B 5E3RA 4BC9A 2DB1A 2GQQA 5IT9U 4USTA 1FJCA 1I5OB 1Q82T 2DNKA 5F0WA 3QZ8A 1N56A 1PILA 3GB0A 2DGVA 4QW9A 1OYEA 2RF2A 3L7UA 4C48A 1U0HA 4DQIA 2DNGA 5KFRA 3QFHA 3DCAA 1MU2A 3BGRB 3P45B 4KE5A 3EGVA 3C6UB 3Q83A 3QRPA 2V69A 1T3OA 3C3LA 2PI4A 2I8EA 2Y1IA 4NLUA 3MAAA 3IWXA 4X64F 1Q8KA 3R6LB 2VQFJ 2UU9J 4V19X 4LR7A 1KNZA 1ZETA 3FC9A 4QCLA 3MCSA 5H1SV 2DITA 3CD7A 1G3OA 4KR0B
chains in the Genus database with same CATH topology
3SCLE 3DN9A 2AGPA 4DEZA 4OI1A 1Q81T 3EYZA 4UY85 3ZFVA 1IBLF 4URSA 1Q1KA 2ZD1B 4ED6A 2BABA 4BC7A 1G6BA 1E6VA 2CVEA 1KVIA 3MM6A 3DLGA 4DHVA 3PM9A 3EPIA 1NJXA 5CYMA 2MKJA 4CH1A 1S9EB 2R8IA 1GTEA 1MWYA 3I82A 4NCGB 2UV8A 4D3GA 4I6WA 1HARA 4TLRA 3R5BA 5K5MA 1Q79A 2IVMA 2PGCA 1YJNS 2MY8A 2CJBA 3PNIA 3POTA 5D4OA 5AE3A 3CMES 4DOZA 3PRBA 2GGPA 2JFDA 3TARA 4B3OB 1HMVA 5KFGA 1QM9A 3K5LA 2ZNYA 5HBMB 3JYTA 1R3NA 1TKXB 3DOKA 5HMYA 3CT9A 3VCDA 1RTDB 4JI1F 2RS8A 4OHZA 2MQLA 3OL7A 1RYRA 2Z2LA 1S1VA 1SXLA 5KAKA 3QLHA 2YKMB 1U8SA 2O1PA 4C97A 1F60B 1HBMA 2JLGA 5J1PA 3QMQA 4WFYA 5BR8F 2DGXA 4J37A 1X0PA 5J2MA 1R27B 1IKWA 3DLKA 3FEYB 3CCVS 4DFJA 1TKZB 2MZRA 1X5OA 3RAXA 5DRKA 2GJIA 1RA7A 2GJ2A 2CQIA 3CD5A 3MGJA 3JTOA 1RT6A 3IN5A 1YGYA 3NLCA 2HNZB 5DDOC 1DTQB 4U9RA 2MGZB 3CIZA 4GKJF 2ZH1A 1UEUA 3TYTA 3V2UC 2LYVA 4QWCA 3LWMA 2OJ3A 1KTQA 2PMHA 1QTMA 2JJ4D 3UR0A 5KFKA 1XERA 2UVUA 4CT8A 2WONA 3DXSX 3N4WA 2FVSA 1ZTTA 2UXDF 1JMTA 5LJ5Y 1H2UX 3MD3A 1C0TB 4ZP7A 4B9SA 1TL5A 3BB5A 5KFZA 3MEGA 2J76E 4QPXA 3F73A 5DETA 1VJWA 5AXNA 2ZJQQ 1RT3B 3F56A 2LEBA 1EP4A 1X4FA 3FGVA 5A8RB 2JC0A 4N76A 4ECRA 2AU0A 1VC5A 2DNHA 2GQCA 3I31A 3MTJA 3KLIB 4O3QA 2BDPA 1WTFA 5M2PA 4LSLA 5LMNF 3M2UA 3ISZA 2XMJA 4YB6A 3DU5A 3PEHA 4X4RA 4NPOA 1R89A 4ECUA 5F8JA 4RW4B 3IWLA 3ZC4A 1D3WA 2B5JB 4KO0B 4JI3F 4WFAQ 2FPHX 2VQEF 2FC8A 2HPUA 4MIWA 3S8SA 4M94A 4JV1A 4A4JA 2GC8A 4L72B 4ED1A 2M3DA 4URGA 4A47A 5CCMA 4YB1P 1YJTA 4OQJA 2LA6A 2J9DE 3IR7B 2LXIA 1J5OA 5KT7A 4B9NA 5A2QY 2OSQA 1VQ9S 4C8OA 4PQAA 1FERA 3PJXA 4ED3A 4PUOB 4KIAA 4EBCA 5E3AA 2NLWA 2POKA 4ZPBA 1BY9A 2NUHA 2BE2A 1S6PB 4ZK7M 3OJSA 1YSJA 4DV1F 2XWXA 1TVRA 5KFBA 2A2DA 2GO9A 3BGRA 5KTQA 4TU8A 1HD0A 3DRXA 2AWZA 4NYPA 2I2YA 1HW9A 1HWUA 2JDJA 3BSOA 2FUG9 4ZOSA 4J9OA 2W8KA 1SJFA 1J5EF 3QAUA 2JH3A 2OPSA 2PN6A 1S6QB 3Q8QB 1C1CB 2IBOA 4I6AA 3C6UA 3MECA 4RUCA 3V6KA 1V9OA 5DDRC 5D4PA 2CPYA 1KEKA 3KJVB 2UUTA 2AYMA 4OZLA 5MAOA 4Q8FA 1FNXH 3G96A 3DLBA 4JUZA 2F1FA 3D1OA 1ELOA 4P6QA 3PRDA 1B0VA 4H4OA 4IKAA 3AB4B 3SFUA 3UD3P 2PSZA 1L3VA 3BQ0A 4MKYA 3MM9B 2I5JA 1XMQF 4KFBA 4J9QA 2QRRA 4NLXA 4TQRA 5IT4A 4RU9A 3MAQA 3SI8A 4X84A 1X8DA 1DHMA 3EGNA 3VWSA 3PIPQ 1RT7A 4RWXA 1JLGB 5DS7A 4ZPVR 2E9TA 6FD1A 1KHVA 4DF4A 4H4KA 5GAGI 3VQTA 2VG6B 3GWCA 1S4FA 3BO4A 2ZNZA 3F44A 2BZ2A 2DHGA 5LMUF 2W25A 1N34F 1VQ6S 3NNCA 1MROA 2EFPA 1KC8T 2XMVA 1HQEB 3CIMA 3M1VA 4UY8T 3QYYA 4DV2F 2F8EX 2D3ZA 2F9JA 3MXHP 4CO2A 5DO2A 2CDQA 5D77A 2RH3A 1JB0C 4O44B 5E2QA 2FLNA 5B0AA 2XSFA 2LQBA 2LXFA 3HHEA 2C3MA 2HHPA 1N5TA 2PT0A 5J2NB 3RAQA 1RTIB 5C25B 3SQGB 2DK2A 4DLGA 3BM7A 2E66A 3IG1A 4C8ZA 4FS1A 5A8KB 2HGLA 4AL5A 4ECVA 3DOMA 4NCGA 5AXKA 1WHYA 2OSRA 3UFCX 3CO9A 2QYCA 1H2VZ 1VRUB 3KK1B 3DI6A 4ILMA 4ELTA 3KLVA 5A8WB 2OTJS 4XDDA 2ASYA 3BJYA 2HAIA 2H5EA 1S1UB 4LIWA 3CPWR 2C3PA 2WW8A 1O8BA 1D1UA 4HYKA 1VGYA 3SCKE 2ZVSA 1RDRA 5HBMA 2PFFB 1YRXA 3CC4S 5AJ3F 2YX4A 3AQPA 1RTDA 2C3YA 2CFXA 2OP5A 4F4KA 1HWLA 2YKMA 2FC9A 3QGHA 1WG4A 4USIA 2W9AA 2DR5A 4WFXA 4QR0A 5I4MA 3GZ7A 4C7QA 2J0SD 1JLAB 2IYGA 2FJWA 3T1HF 4ED7A 2W4DA 2WB4A 4ZDNA 1TR0A 1RQ0A 4YP3A 2YKNB 3MR6A 1Q7LB 1TKZA 4NLVA 2JEFA 2IC3B 2ZFHA 2OH2A 3G9CA 4ETXA 4O3RA 5D6GA 3SXLA 1CQMA 3G86A 1Y5NB 5GAHI 4ALZA 4DQRA 5GVQA 1DTQA 2K7KA 4DR3F 1KVJA 2J7UA 4L3NA 4PG5A 4FF2A 2X51A 1QLNA 3GYNA 2BA9A 5KFCA 1X7VA 3ENWA 3SCIE 3KLGB 2ZH7A 4ED0A 4RUAA 2KT5A 2YWFA 2V2KA 5KG0A 4B08A 1N5YB 4J9PA 1RT1B 3JTPA 3LGMA 2KHDA 2FGCA 4NA3A 4DQQA 1U1KA 3MFHA 3HZGA 1NJWA 3IS9B 1FDNA 3N01A 4IQMA 2AYBA 1IM4A 1DQ8A 5C42A 1DZ5A 2R7SA 2E5GA 2J6SA 1VLYA 2DCLA 3V4MA 3H5YA 3LPYA 1Y3JA 1PC4A 4IUFA 3PEJA 1FKPB 5F8HA 3V6JA 5L1KA 3UI3A 1VBZA 4WFBQ 1G2EA 1ZBTA 4WKYA 2VFTA 3SFGA 5LSOA 2LKZA 4N41A 4WK3A 1WF1A 3KG0A 2B43A 2P9CA 2XI3A 2BR0A 4K50A 4RW4A 2RMLA 2MHNA 3HHLC 3K8VA 4C0HA 2ZH2A 2B5JA 5HP1B 4ECTA 1IKVB 2JVRA 1UJ6A 2RJZA 3TVYA 3OL9A 4C8MA 1R7IA 1TL1B 3O6QA 2JHEA 1QSLA 3IC1A 3TQ1A 4HDHA 3TP2A 3PR5B 2UU9F 4RW9B 3VAJA 1CQNA 1GNKA 1GXTA 2FDNA 4RKUC 2GV1A 1LK5A 5GADI 3OSPA 1U25A 3CEDA 3OR1B 1JX4A 4KTQA 4TY8A 2K3IA 2AYGA 1S1WA 1OQ6A 3I55S 2ZJPQ 1Q7YT 5KFTA 1NK9A 4EFAC 4QYZJ 1X0FA 1QAIA 3FEZA 2KXHA 5F3TA 3T19A 2VA3A 2NREA 5CZXA 1AXQA 4FZVA 4OZ0A 2GO8A 3H5UA 3QIPA 2R8GA 3N0VA 1O0PA 2G4BA 2EVZA 5KFSA 2CZVC 4PG4A 1SH3A 2VPXB 1TUVA 3OSNA 1S0NA 1JJ4A 3RZAA 3GMGA 1NK7A 4B9VA 2AX0A 4N8OA 4OI3A 4DR7F 1FO1A 4HT7A 3G71S 1C1CA 1Q4RA 2PC6A 1D0EA 4DSKA 1H7WA 4K4ZA 5KG6A 2U1AA 2EFNA 4TYBA 5JVGQ 4NWBA 4NCBA 2ZKTA 4DLEA 1WI6A 4YDDB 3KJVA 3OTBA 4R8UB 1V3ZA 4EYHB 1NO8A 2OPRB 1R31A 3UWTA 1WNEA 3UCGA 2MPUA 2MSSA 1SKWA 2MKIA 1DBDA 1DAXA 1WACA 4C0OC 3MM9A 1Q8BA 4Q45A 3CDAA 5C5JA 4A8FA 2A10A 5DG8A 1F9FA 1H3DA 1SH0A 2UUBF 4EYIB 4PQUB 1JLCA 2QA2A 2ZHBA 2E5HA 3T6JA 1HA1A 1SJRA 1U6BA 4NLSA 2J6TA 1S0MA 4TNOA 1AUDA 4OZJA 2VG6A 2BRKA 1CC8A 4RNNA 4LQ3A 2CQ2A 2XZWA 2Y1RI 3TANA 1E6YB 2QA4S 2R2RA 4USHA 3TA0A 4F2SA 2DNZA 1RYSA 4NLOA 4C11B 4EUVA 4WZQA 1VQ7S 2MZTA 3LO3A 2I38A 5L9NA 2GNKA 2KU7A 4NLQA 2L48A 4IFVB 5K8NA 3D1HA 3GG0A 3D54A 2GQ2A 1OWXA 2FHJA 3ENVA 3IAM9 5CYQB 3TUZC 1VC0A 1UA0A 2V4JA 2DPIA 4IRCA 4Y65A 1VQYA 5J2NA 2UVRA 4DL7A 1RTIA 2R7RA 1WG5A 1U26A 5C25A 3DMJA 1JJHA 1M1KT 2NXUA 1KHWA 2XS7A 1E6VB 1KR4A 4CH0S 3WC2A 2XULA 5A8KA 1DARA 2Y0SD 4ES2A 3C66A 2QEXS 2KB2A 1OQ3A 2IJNA 3H4DA 3A1YG 2JFKA 3RR7A 3NCQA 2OKQA 1KN6A 1NJYA 2L41A 3LUYA 3IBWA 1R0AA 1AFIA 1FNOA 1C4AA 4DG1A 5H9EJ 1U49A 5AE1A 5KG2A 1S1UA 5AXLA 3DLHA 3PW2A 1B0TA 2MMYA 3POTB 2DGOA 4DV0F 2BOPA 4DUYF 3N79A 1HMVB 2VASA 4DN9A 2JX2A 3DHXA 1MW7A 3JYTB 1ULRA 4YFUA 1UA1A 1FRJA 1MNEA 2XHWA 3DOKB 2J8AA 3RB3A 2HFOA 1JLBB 1REVA 1S1VB 2XI2A 2MQOA 1HBMB 4C8LA 1RWUA 1LOUA 2HS3A 3JAMY 3OUYB 4PWDB 4CI0B 1FT8A 3UNGC 2YKNA 2IC3A 5J2MB 2R2UA 3DLKB 1IKWB 1NKEA 2OO4A 4BDPA 1CVJA 1EETA 3OFGA 3FZ2A 4E98A 1ZAWA 2OMOA 4TQSA 2GIRA 5L1JA 2WBMA 3LQVA 3NL0A 3MPYA 2E29A 4Q5VA 5T7LA 1VQ5S 4X2BA 4A8YA 3DRRB 3NCRA 3VR1A 3GIMA 4PCQA 1FA0A 3KLGA 4KAIA 4X4QA 1N5YA 3K5PA 4DV4F 4ZS6A 4NZ0A 5EWFA 4Y3CA 2XCAA 2ROPA 3IS9A 1D8ZA 4WFZA 3ETOA 2KYZA 3WDOA 4HHJA 1OPIA 3AAWB 5LL6d 1DFDA 1FF2A 1HWIA 2JL9A 3CCZA 3RYLA 3MEGB 1FKPA 4CTAB 4KSEB 3CCUS 2BANB 5IT0A 2XSJB 4NXNF 5CCLA 4K4SA 5HMZA 1LW2A 2FHJD 3VAIA 5A0YB 4RU2A 2QO3A 1NAQA 4B3RF 2WCXA 1WWHA 4BWMA 5KFAA 3U27A 1N8RT 1NK5A 1FDDA 3MMBB 3CD0A 5HP1A 1WELA 1F5AA 1N5QA 1IKVA 2CQDA 2J7WA 3MEDB 3QO9A 4KV8A 2AYEA 5I3PA 2CPIA 1TL1A 1SI9A 3IGVA 2R2SA 2W4PA 3DDKA 4JI0F 3MPVA 2WBRA 1NK0A 3TI0A 2KTQA 1SJ1A 2XLKA 3PW4A 4RW9A 1K73T 1UVJA 2G1DA 1TK5A 2X1AA 3E3XA 1GX5A 1H98A 3OR1A 4IG0A 3TNVA 1GQEA 1OSDA 3H25A 3R1HA 3VF0B 4Y2KA 1J5OB 3LF0A 4OI0A 1H38A 2N4DA 4HVZA 2YKQA 5CA5A 4LSNA 4F67A 3MWBA 5B08A 2HHHF 1FTRA 3HXMA 2O3DA 3RU0A 3V5RA 3DM2B 3MHYA 2AF6A 4O4RA 2XBPA 4DV3F 2VA2A 3MR2A 2OTLS 3MOJB 5D8HB 1TVRB 2IFXA 4KQZA 3PVXA 3HMJG 2DVIA 3BEGB 3P96A 2CPDA 2VBYA 1OSCA 1VK8A 2OPSB 5D4NA 3BO3A 1CEZA 1TKTB 4NL5A 3QZ7A 2EKYA 2I9SA 4MKBA 3OLAA 2EFQA 4JV0A 1KQSR 5IWAF 5LSRA 1TL3B 2DR9A 4DL6A 3QJPA 4WYLA 2V5HG 2B4UA 3T9NA 2XNRA 1SC6A 2QLXA 4UQGA 1PC5A 3KKFA 1JXEA 2M70A 1VQPS 5LXRA 1IXKA 4H4OB 2E5JA 3W7BA 2IA0A 5E33A 5KFXA 1M5OC 2J9DA 4KFBB 5K8MA 3OXGA 3K8WA 3IFEA 1RT7B 4PQUA 2CPFA 5KT2A 1BD6A 2IMOA 3WBZA 5DDPC 1RJJA 1JIHA 2YKOA 3JSRA 4M1KA 2M8DB 3SDEA 3D0GE 1TK8A 1MROB 2DIVA 2QIFA 5IS2A 2BQUA 2I0XA 3JSMB 1RT2B 1T7PA 3J81Y 3PKMA 5KG3A 3M1VB 2VFUA 3H40A 4C11A 3B82A 2LQ9A 4I68A 4OX6A 2HLTA 4PG8A 1ZPWX 2L9DA 2DNLA 3MFIA 1GT8A 1GAOA 3TA1A 1X4CA 4IFVA 4PR6A 1CC7A 3TUJC 1F5CA 2ADBA 4MFBB 3UR3C 2MZQA 4HLBA 5CYQA 3CF5Q 4OHVA 2IM1A 4FBTA 1HQUA 2HNDA 3N5BA 1M5PC 2VOOA 3DRPA 3CDUA 2CPJA 3D5MA 2HLUA 3BR8A 3OVSA 2MYFA 5DG9A 4C9DA 5MLCV 3FCHA 1KLNA 1N52B 2F3JA 4ELVA 1Y4ZB 4QYRA 2K1RB 4AXJA 2XGPA 4OHYA 1ZZNA 4IRDA 3IG1B 2RQMA 2V8DA 4WXWA 3TW0A 1UVKA 1M5VC 2AJ4A 4K4WA 2MB0B 5C24B 4F3MA 2BM1A 2YH1A 3U1LA 2F8HA 3M9OB 1TAQA 1R8CA 1U1PA 3DI6B 1S9FA 1KOHA 5KG5A 3MF5A 5BYRA 5F9LA 5F0UA 2KT2A 2BACA 4ID5B 2EK6A 1RISA 3FMBA 3OL8A 4YB7A 5HLFB 4B9MA 3BQ2A 5KT3A 1IQTA 4Y34A 4HH1A 2RDJA 2QSWA 4LQ9A 4WE1A 1JLBA 1FNMA 3LH2S 2WHOA 3QAEA 2LA4A 3SSQA 2W7OA 1VS3A 1Z2ZA 3MM5B 3T6BA 1Q16B 3X3UA 4FXVA 3OUYA 3OFFA 1QJHA 4PWDA 4X4OA 4G1QA 1M90T 3NG8A 3N5FA 1FVQA 3US5A 2L9WA 3EGWB 1VBYA 3I9ZA 2LU2A 2MY7A 4OJGA 1SB6A 1SUQA 4DL4A 1NJIT 1APSA 2NR0A 2M5YA 3DRRA 4MKAA 3GV8B 3LAMA 4RW7A 2VZ9A 4X4VA 1YITS 2KO1A 2XCPA 5K14A 1FEEA 2GHVC 1VQNS 4UW2A