1H0HB

Tungsten containing formate dehydrogenase from desulfovibrio gigas
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
214
Chain Sequence
SKGFFVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADMEDESAIIHDDATGCVLFTPKTKDLEDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKAAYSDAKLCDPDDVRVIFLTAHNPKLYHEYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FORMATE DEHYDROGENASE SUBUNIT ALPHA
publication title Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
pubmed doi rcsb
total genus 58
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB02
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB01
2PMZD 2XSJA 1B0TA 1FRXA 3MMCB 5E7OB 1SJ1A 3C8YA 1Y5LB 1BC6A 5CHCB 1JNZB 3MMCA 1FRJA 1FRKA 7FD1A 1DFDA 4ID8A 1DURA 4KT0C 2C3PA 3IR5B 5FD1A 1FERA 2GMHA 1G3OA 2FGOA 2C3MA 2VPXB 3EGWB 3IR6B 3MMAB 2IVFB 2V2KA 4RKUC 3OR1A 2FJDB 1KQGB 3EUNA 3MMAA 3MM8B 2C42A 2WSCC 1FRMA 4XK8C 3MM6B 1KQFB 3OR2B 2WSFC 5CH7B 1FEHA 1SIWB 2Y0SD 2WB1D 3MM8A 3MM6A 2VPWB 2V4JB 3OR2A 4OV1A 5BYQA 1SIZA 1ROFA 6FDRA 2C3YA 1PC5A 1Y5IB 2V4JA 1F5BA 3MM7B 1KEKA 1B0PA 1GAOA 2WSEC 1FDAA 1H0HB 3MM7A 6FD1A 7FDRA 1Q16B 4Y28C 1B0VA 1Y5NB 2FJAB 1R27B 4XDCA 1H7WA 1K0TA 1BD6A 1C4AA 1HFEL 2C3UA 3EXYA 2PA8D 2FDNA 2O01C 2FJEB 1H7XA 2UZAA 1BLUA 1FTCA 5L8RC 4YDDB 1AXQA 1CLFA 1JB0C 1FXDA 1IQZA 2FD2A 1C4CA 2WAQD 1XERA 4L6V3 1BWEA 3MM9A 1VJWA 1BQXA 4XDDA 1FDBA 1FDNA 4DHVA 1DAXA 2C3OA 1IR0A 5BYRA 1FRHA 1FF2A 1FXRA 3GYXB 4CI0B 4OMFG 2VKRA 2PDAA 3LW5C 4AYBD 1FDDA 2Z8QA 1FRLA 1GTHA 2FJBB 3OR1B 1FRIA 1G6BA 1GT8A 5BYSA 1F2GA 1H98A 1Y4ZB 3IR7B 3MM5B 1GTEA 1F5CA 3MMBB 2GMJA 1JNRB 1RGVA 2VPYB 3MM5A 3MM9B 1FCAA 1WTFA 1PC4A 2VPZB 3MMBA 3PNIA 2XSJB 1D3WA 2ZVSA 1FD2A 3HKZD 1A6LA
chains in the Genus database with same CATH superfamily
1XEZA 2AV5A 4WIQA 4M5LA 5AE1A 1QTNB 1TVRB 2H4WB 1A0OB 2IDEA 1TFYA 3NGTA 4PG4A 3DGPA 1HHSA 3EUNA 2DY1A 4CO3A 3Q8QB 3V5RA 1QM9A 4DR7F 2EFVA 2VZ9A 2D3O1 4J9UE 2LU2A 1WSRA 3UPFA 2O1PA 4TLQA 2R42A 3QIDA 2D9OA 2Q6BA 2LDIA 3KUEA 4K0KJ 3D6FB 1NKEA 2RF2A 2ZZNA 2CPFA 5HL7Q 4DLEA 1TL3B 4WCEQ 1C0TA 1JLAA 2KG1A 1RAGB 1KR4A 3MMJA 2JEJA 4ZLPA 4HHUA 5BJRA 2KDOA 3BREA 1VS3A 1OJ4A 2YNGA 4ZHRB 1HMVA 3TO8A 1WF2A 3T1YF 5DLFA 3P96A 1U8WA 3T1AA 3ZTRA 5BYRA 4B3RF 2RDDA 4KBIA 3B78A 1LWFB 1UFWA 2U2FA 4CT9A 3MEGB 1J5EJ 3LALA 4OI4A 4R8UA 2EXUA 2YH0A 1HQUA 4WFAQ 3KHLA 4KT0C 2BKPA 1N54B 2BE7D 4HT7A 4LREA 2FGOA 4TYBA 5DZ6A 1WDDA 4IH5A 4QWCA 5CD4H 2YWEA 2V2ZA 1SL2A 1I1GA 3OBIA 1X60A 4QIFA 2HHQA 2XZTB 3TEGA 3UD5A 4PABA 3KHGA 1FDAA 1V3ZA 3I9V9 2DCUB 1HBNA 2WB4A 4J7CA 4J9LA 4ED2A 3I9ZA 1U1MA 4ECYA 1PAUB 1RWOB 3SSQA 5DQGA 3LWMA 1NH7A 4LF7F 2HHWA 1Q1KA 1FDNA 2BRLA 2FJWA 2Q6CA 2P2CB 2MZTA 2V8DA 2YNIB 4K4VA 2EG1A 3H0PA 2E5JA 2QZ8A 1NK7A 4MMOA 4NLYA 2BW7A 5K8MA 3M8QB 5H9EK 3M6WA 5KG1A 2BKNA 3OVAA 5F9NA 4F0MA 2HBRB 4NX9A 2NZCA 4N77A 5D4PA 4YB7A 3BM7A 3UD4P 5GAGU 4NLPA 2XMAA 3SSRA 3C15A 3CIMA 1SJ3P 4PRFA 4B17A 2UUAF 7AT1B 4K4WA 4EBCA 1IBMJ 3PY8A 1YQHA 1PYTA 3M8WA 4HEA9 4OI3A 1HWLA 2FHJA 1H73A 3MI7X 4K7QA 3MTJA 5MLCV 1FXDA 2VFSA 4Q43A 2Z2LA 2HRTA 5J2MB 2M4MA 1RAFB 2W2PP 2DGTA 4DI6A 2DIVA 4Q45A 4XDDA 5BR8J 3HULA 3M8PB 3GLJA 1DAXA 2C3OA 3U1LA 3OJSA 2B4UA 2DH8A 2P6TA 2Z8QA 1FRLA 1RTJA 3WHIA 2D41A 1HBOA 4ES2A 1YSJA 1F9HA 1MROB 5LOQA 2CQ1A 3I0SA 3GWCA 2C22A 1PJ5A 2D3ZA 1S97A 2GHWA 1SJ1A 1N4LA 3T5JA 1A9NB 1Y5LB 1X4GA 2OEJA 1JJCB 4MK9A 4EGLA 4PWDA 1IKYA 1FK9A 2E9RX 4DDFA 3QSIA 3MM6B 4Q0BA 4R0EA 1FFSB 3PYEA 4NLSA 4PWWA 4Y2KA 1KONA 3VGTA 3JYTA 3OUYB 3CCRS 1K1SA 2Y1JA 2UXBJ 2FHJD 5IC6B 5IWAJ 4LFAF 3C6UB 4DSIA 2CNOB 3O3LA 3EXYA 2JLEA 4PG6A 1OPZA 3QT7A 2GW8A 1VGYA 1IJFB 1B99A 3M7VA 4FKXA 2VU5A 1IWAA 2BR0A 5F3ZA 2V94A 4ZP8A 4ZVFA 4C8YA 2LXIA 3MHYA 4P73A 1FXRA 4USWA 1U25A 2XLIA 1D9FA 1G4CA 3QBCA 4AXJA 2GO8A 5KFXA 4DFPA 3MM5B 2Y0BB 3CW2C 2OHDA 1FD2A 3MECA 2VHGA 5CABA 2AIRB 2VFRA 1WD6A 1PSDA 1IR2A 2J5AA 1DHMA 2IVFB 2R7VA 3NBPA 2DXEA 2HAFA 2GVDB 2X51A 6AT1B 2DNRA 2QG9B 4HR2A 4X65J 4J9NA 3OLAA 4DR5J 1FJGF 2D1CA 2HQFA 3GB0A 3UD3P 3V6JA 4YR3A 2VC1A 2CUYA 3EWGA 1D8ZA 2MQLA 4DS4A 1U2CA 1NSAA 1H7WA 1JXEA 1RAEB 4RW7B 4IRKA 4YB5A 2CVIA 2AWZA 4I6WA 4YFUA 4P74A 2DR7A 4LF8J 4OLOA 2W4DA 5G0RA 3O1LA 4DHVA 3DCAA 2YH1A 1X4DA 2K7JA 3UI3A 1VRTB 1RT4B 4FKYA 3HVTA 5CYMA 3MAQA 1FI4A 2AYEA 4FP9A 3HJFA 1B0TA 1WKJA 3D1OA 1RT1A 1TKXA 2RQCA 5C42A 1NPKA 4HH1A 1DURA 1IR1A 3M2VB 3J81U 1PG5B 2HKEA 3AD7C 3MM8A 5H9EJ 3OTDA 3DYAA 2UVUA 4NASA 1YWXA 5E41A 2MKHA 4HDHA 4WE1B 4DUZF 2MQNA 4JI4F 1NSKL 3HHLB 1YZ7A 2E5LJ 4A8SA 2G2ZA 4BCAA 2OSRA 2GC8A 5CD4A 1QVFR 5B0AA 4A8QA 3R1HA 2YBVA 2HRUA 4Q8FA 4ZVHA 3NLCA 2ZE2B 4B9SA 1TAQA 3OTCA 4WFZA 5L9NA 1TV6A 2E5HA 4OX9J 2CZ9A 2FHKA 2B5JB 2CQ4A 3H90A 2L9NA 4X4VA 2VOPA 4CM0A 4DV7F 5IT4A 3CJ3A 4DU7A 2QA1A 2M8DB 2DO4A 1R6YA 3FEZA 1U24A 3TANA 3SXLA 1BQNA 4NRTA 2E1PA 1QVGR 4U7UD 1Q5YA 2I5JB 3E01A 4LBHA 4R5PB 5EN1A 4UTGA 4WK3A 3R7NB 3OXFA 5HROA 4ECVA 3BPDA 4DV6J 3VAFA 3IO1A 1S7IA 2HNDB 3EX7B 3QO9B 5DZ7A 4DL2A 1TU0B 4ZPTR 1RHQB 2OAUA 4OIXA 2EKYA 2UUBJ 5BYQA 3B82A 4X66J 3DKDA 1GFWB 1EQMA 2XTJP 3SEOA 2K1RB 4DV3F 2FJAB 2YWKA 3EZOA 1CPZA 4OZLA 2LQBA 2EVZA 1KSPA 3PYGA 4BHQA 2JFDA 1X4HA 3CJ0A 4DF4A 3V2UC 3NGKA 2FYXA 4D3GA 3TX8A 3IS9B 2BJ7A 4QWBA 2HFZA 1MNEA 2N3OA 3G8SA 4RPFA 1OYEA 5D8HB 1TELA 1Q5VA 4M94A 1J2VA 4CLWA 2OPPA 2HHPA 4X4TA 4NEYA 1BE4A 1HL6A 3H42A 1B3TA 3FQLA 3AH6A 1X4CA 5KFDA 4BS2A 2B51A 3SFGA 1AT1B 1SKUB 1NPRA 4ED4A 1EP4A 1ZTWA 3U27A 1U7LA 4L73A 2UXDJ 3TZYA 2R8JA 3MMAA 4OHXA 3EMTA 1L3UA 5KFJA 2KTQA 3OTOJ 3R1LA 1VRUA 3UN3A 1D09B 3QJLA 3DDIA 2QA4G 3WC0A 2DNGA 4TYAA 3KUHA 2DB1A 1B0VA 2HFSA 2PA8D 4OZ2A 5H1SV 1TKTB 1U6ZA 4NLWA 4DL3A 1RYSA 2BXJA 2R7XA 4HI1A 1HBMB 2QEXS 2HK2A 1X8DA 1RB0A 1YKWA 1YJTA 3Q8UA 3WIUA 5JMNA 3G6XA 3UNYA 5J2QA 3GYXB 4GVBB 4C0BA 3HCXA 1UVLA 4DQPA 2HS4A 1GTHA 4WFYA 1FRIA 3TYTA 1GTEA 5FJ4A 4HVZA 1MMLA 5HLFB 1X7VA 1AW0A 1UCNA 1SV5A 3KFWX 5D78A 2BMBA 4C4WA 2MY7A 1S0VA 3M8ZA 3TVZA 1VQ5S 3BGOP 5KFCA 3IWNC 1MG7A 4GRSA 5F41A 1JX4A 4LRAA 4KRWA 4CTAB 1FJCA 4HL9A 1S6PB 6FDRA 4E2FB 4USVA 2HG4A 3N5FA 3I4PA 1O0PA 4USUA 1KD1T 2CAJA 2R2RA 5SZTA 1BLUA 1U09A 2XMJA 2CNLB 2LYVA 4IR1A 2G0CA 5HP1B 4HT5A 3V6DB 2WW8A 4MFBA 3MEEB 4KGMA 4JYAF 2KHDA 4G6VB 2XZWA 3G4SS 1FKPA 2AJFE 3W5YA 1UVKA 4KV8B 2UUWA 1R89A 1VJQA 4DPOA 3H7HB 1Y0HA 2ZE2A 2F63A 1PC4A 3RRHA 3CDUA 5HMZA 1EJ7L 1NSPA 2RIJA 2QL5B 4NCAA 3TARA 1XWLA 1ZBTA 3IG1B 3H2VE 5A8WA 3M2UB 4TY8B 5A2QU 2F8MA 1FERA 2R7TA 4V1Ak 4FXVA 3NOGA 1VQMS 2VASA 2B9WA 3QAEA 1S6UA 4IDKA 3TJAA 1FWKA 3W3SA 2V4RA 3M6UA 4F2SA 1SIZA 1ROFA 3RBXA 4QOTA 2RS2A 2YX4A 3BBBA 3SYZA 1QJHA 2P8IA 4W92B 3SCLE 4MAKA 2R7UA 1XR5A 1GAOA 4PKDB 2MZJA 1VQYA 4EI2A 1HFEL 1X4AA 3GMGA 3K5OA 4AL5A 2DH7A 1LW2A 3ENQA 1LW0B 1N5YB 5K14A 3JSRA 3IRXB 3DRPA 1NB7A 4DR6J 3ILLA 3ZZUA 2J0XA 1H2UX 1AROP 3FK4A 3KXDA 2N4DA 1FT8A 2PO4A 2VPYB 3K5NA 4FPRA 1R31A 2AJQA 3GJTB 4X4RA 3IP0A 3LF0A 3M8YA 4XIUA 3KDNA 1SH0A 2WOMA 2AD9A 5L1KA 3VQTA 1RT7A 2XC9A 3G96A 4OHWA 4CNYA 1YHQS 3V6KA 4DL5A 1OSDA 2D3OR 2DIUA 1CJVA 1PGZA 2IVMA 1VQSA 1YJ7A 3H2UB 1VFJA 3HSJA 2ZH6A 5H9FK 2VQEF 1XNRF 3JSBA 4DSKA 1LV5A 1S6QB 4F4ZA 3FBEA 1N6QB 2FQQB 3T41A 2XLJA 3HHKA 2WONA 4X4QA 2E7XA 1HWIA 4IOAQ 1W25A 3LAMA 4X4PA 3PW2A 2DGSA 2HIQA 1NJIT 1CJKA 1GX6A 1T9TA 5JVGQ 1FDDA 1G6BA 3R8YA 2JVOA 3MAAB 4ILMA 2WW4A 2KRRA 5SUHA 2XCAA 2XMTA 3PJXA 4K4XA 4NMXA 5IT9U 2NYIA 2RU9A 3DHXA 1KLMA 1ULRA 2IY5B 1HQEB 1TUGB 2RHQB 3BSOA 3D6TB 3LP0A 1GXLA 2CXEA 3PZPA 1GQEA 2J7UA 2BANA 2IPOB 1F5BA 1DRZA 4C2MA 1NNDA 1MWQA 1VCTA 1U2FA 4F4XA 4C0OC 1XBWA 1K0TA 3M8RA 2RRBA 1S48A 3MUVP 4DX7A 1TMMA 1SC3B 2DO0A 1VI7A 4PQUA 1LWEB 2EBEA 4IOBA 3CE8A 4KH1B 4P72A 5K8NA 1KC8T 3CD0A 4GMKA 4ZVUB 4YP3A 1F5AA 2MQOA 4I2QB 4BLGA 3DLEB 1IM4A 3TZZA 1EKSA 1RP5A 4DXLA 4A8WA 2VFUA 3CTRA 5DQIA 3JXOA 1OSCA 2VG6B 2GMJA 1LWCA 2KZZA 2G4BA 5FLXY 1RA6A 1VQOS 1D3WA 5AXLA 4F0KA 2AGQA 3AODA 2NLWA 1DQ9A 3FKBA 2Y8WA 2DGWA 4OJ3A 2C2ZB 2QSWA 5FDLB 5A0YA 3CMES 5CQGA 4KAIA 2POKA 4LF9J 4ANEA 5J1PA 2KN4A 3MPWA 4ZVRB 1YRUA 1UZHA 2L9DA 4DX6A 5C25A 4ZPBA 3Q8VA 3GZ7A 2AZ3A 4USHA 1L3KA 3LO3A 3GIKA 4CH7A 4F3MA 2ZDPA 2E1AA 3W62A 1CBKA 3RR7A 4RNNA 2DXFA 1WEZA 4CRJA 2GIFA 3TZWA 2AJ0A 3QZ7A 2EBGA 4QCLA 2HRYA 2QJ3A 3CJ2A 4WFNQ 3AOBA 3ZC4A 4L74A 2CG4A 1YJNS 2DXDA 3ZZRA 3IBFB 3N6MA 2CNNB 3RAQA 2J9DA 3ISNC 1T9XA 5JXSA 2OP5A 3FCHA 1GX5A 1QTMA 5KG3A 2QYCA 2F4FA 2VFVA 3FRZA 1TK8A 4O44B 3P5TL 4PG5A 5F8HA 1WTFA 5HBMB 1TQLA 2KT2A 2W2QP 2ZOMA 3J80U 1RT6A 2ZZTA 3W2WB 4LR8A 3FCVA 1S9GA 1P1TA 5HQLA 2VPXB 3SQOP 3ICLA 3FMWA 3SMZA 3FSYA 2FVCA 2KB2A 3Q83A 4MYTA 1WWHA 2M88A 2QLBB 1REVA 2QMUB 3S6EA 2HBYB 1KOHA 4YB6A 3OL7A 1YG0A 2Y1LB 2FC8A 1ZAWA 5M2UA 3A8KA 3I56S 5I3QA 1N48A 5B7WA 3N79A 4CWBA 5KOXA 3TAPA 1RISA 4NXNF 1JLBA 3CJKA 3PX4A 1YJWS 3W7BA 4LRDA 2VJUA 3SV3A 4LF5F 3F44A 1I6JA 1T3NA 2HK3A 2B9EA 5H9FJ 1S1XA 3Q8PB 1N6QA 1X0FA 3QNWB 4F3OA 4LFBJ 4PG7A 5HMXA 5CCLA 4PWUA 1BC6A 4DL0C 3LPEA 3PYFA 4M5NA 2MZQA 3P8BB 4DR1J 3UDLA 3LP1A 2AHOB 5EWFA 1TKZA 2R7RA 3J7Z5 1LK7A 3PDNA 4M5GA 2C2MB 4ECUA 5EX0A 5J2PB 1FTRA 1T05A 2MY8A 5DETA 4K59A 1KHVA 3IAS9 4C6AA 1C1CB 1QUPA 3EPGA 2D3UA 4PZVA 5KFEA 2V67A 4OV6A 2Z2ZA 4P75A 1RLDA 1HYSB 1O8BA 2FIUA 2LKZA 2ABYA 5ETTA 5LT5A 1ZAXA 1UEKA 2VKZG 1DJ0A 2UUCJ 3PX6A 3P45B 3B6BA 1L5UA 2ZC3A 2YX7A 1LWXA 4OYPA 2XULA 1RTHB 5C7PA 3CO0P 1JLCB 4H54A 4DEZA 1WC3A 2IA0A 5AE3A 1CEZA 4ZPAA 1DQ8A 3SBMA 4J9VA 3MPYA 2A2DA 2VG5A 4TNOA 3TWZA 2NPIA 4GKJF 4ANDA 1AUDA 4FYXB 2VF3A 2WVDA 3HD2A 3TQ1A 4OV1A 4LRFA 1Y5IB 1HBUB 4YUDA 5T7LB 1HNVB 2NXUA 1CQNA 4R25A 2L41A 2NREA 1QE1B 1QD1A 3D9BA 3D68A 4Q2MA 4RW8A 4K0KF 1WI6A 2XNQA 4IQMA 5CAAA 2RKIA 2IA6A 4WXWA 2KU7A 3CULA 2RS8A 2CRLA 2HHHJ 5HQMA 2QYGA 2FY1A 4CIOA 3NCPA 1R7IA 3J7A1 3BYRA 3B8HA 4YEAA 3GYGA 2PMZD 2B7CB 2XLKA 1WF1A 4OFZA 4KSEB 2X7IA 1S1VB 1J5EF 1HNZJ 2DRDA 2HPUA 2V6AA 2XYHB 1SVDA 3BKUA 3ZFVA 1PJ7A 5KFVA 2WSFC 5HJYA 2HHXA 3TQEA 3ZZTA 4J9OA 1WHVA 3MM7B 1M1KT 6FD1A 5J1EA 4IUFA 2XO7A 3H59A 1KNZA 3MPDA 2W01A 3W9JA 3OFHA 1D9DA 4ZJLA 2AP6A 1Q86T 1AXQA 1CLFA 1OY6A 1VOMA 4A8KA 1NDLA 4LF4J 2DHSA 1SBRA 4CLLA 2XMUA 1I51B 1YBUA 5K20B 1E6VB 2W7AA 1TK5A 4DQSA 3PHTA 5LXYA 3C16B 2VL1A 3AAWB 2VBZA 3BSAA 2EFNA 4JV5J 3N0VA 2E29A 1VK8A 3KLFB 4WPAA 4ITSA 2G2OA 3AA8A 2IVYA 2IC3A 3AD8C 4G1IA 2GIQA 2AQ4A 2Z0GA 1M5KC 1RKJA 5KG5A 2P9EA 3J81Y 5M2RA 3W65A 2ZC4A 4NCGB 2GIRA 4PCQA 1T03B 2V34A 4NLOA 2YX1A 5DDRC 3MURP 4UY85 1BGXT 1SH2A 1UMJA 2RU3A 2BJ9A 2A3JA 4ZPVR 2C3UA 2HNZB 2OELA 1M5SA 1IBMF 3ZO7A 4YDDB 2OEMA 3M1VB 3M32A 3JTNA 1HI0P 4KHPJ 1CSJA 1VJWA 4UOGA 3VAHA 1RT2A 2W25A 5KFKA 4YY3J 5J2NA 3GJQB 3P49B 3PFOA 5KG2A 2N3LA 2GGPB 3BQ1A 2VDIA 2VC0A 4OZJA 5BR8F 1RGVA 1U4BA 3MMBA 4B9UA 5KG7A 2MGZB 4KKOB 2YQ3A 1HWKA 2OLWA 2ZD1B 5AE2A 1HQ2A 4MIWA 4DS5A 3T9ZA 4QIVA 3DNCA 5D3GB 4BC7A 3CIZA 1RWUA 3OR2B 4H4OB 2Y0SD 5KFGA 3K5PA 3R5BA 1PYOB 1RLCL 4CZCA 1D0EA 2NYHA 4LFCJ 5E3CA 2R7WA 3A3NB 5K8PA 4CP5A 3Q2SC 5RUBA 2AJ1A 2YNHA 2HVHA 4D3HA 2DKOB 2VIHA 1ZAVA 4ZOSA 3I32A 2J6SA 3WQPA 3BF4A 5CZVA 1H7XA 2UXBF 4RNFA 1ZETA 5IWAF 3KLVA 4EWTA 2V2VA 2M5YA 5A8KA 3I5AA 2MTLA 4CLZA 4DZDA 2G2YA 2H65B 2PE8A 4C98A 1D8YA 1NMEB 1KRPA 5KFBA 2ZUAA 3H4DA 3OR1B 4M5DB 1P27B 3CDEA 3THVA 1FE0A 2CQGA 2K06A 1G1XA 5B0BA 1ELOA 4AL6A 4O3RA 1VBZA 1WSVA 4MTPA 3H40A 4U8YA 4RO0A 1S57A 3KK1A 5IZHA 2LEAA 2C3PA 4YN3B 5L39A 1S1WB 4NLVA 3U1MA 1Q7YT 4I7FB 4QW9A 2XS2A 2OMOA 3PJWA 3G71S 3LP2A 3DXBA 3DLKA 4UF4A 3K58A 2WK4A 2V9KA 1B7YB 2B4OA 3CEDA 2Z56B 4LT6A 4X65F 2MHNA 4DR5F 4P9SA 4XPEA 3ITHA 3CCWA 3DRRB 2LEPA 3MTKA 4J91A 3WIVA 3CDWA 3KLGB 4RW4A 4QJVA 3UR3C 1FRHA 1FJEB 3B4DA 5KFTA 4LF8F 3DOKA 2AMCB 3RUBL 3M30A 1JLFB 2AJ2A 1JLEB 2FHOB 3K5LA 2X3DA 4F0HA 3OSNA 3T1HJ 1S6OA 3HSDA 2JEGA 2ZH8A 3MCOA 2VQFJ 2A2CA 4FXWA 3SIPB 4NLGA 2C3MA 2CPHA 2LQ5A 1MW7A 2DGVA 1U0HB 3CDAA 3M9MB 2CVEA 3I6PA 4K8RA 3BO2A 3UVJA 2BE2B 2ROEA 3C14B 5LMUJ 3RR8A 3GIJA 2NZ4A 2MJNA 4EMDA 3HO1A 2M2BA 3MPVA 3G8TA 3I5BA 1MU2A 3H20A 3I0RA 2KH9A 2GVZB 3ISZA 4LSNA 2HMIB 2O5DA 4YQWA 3DDKA 4B3OB 2E5LF 2OIHA 1YRTA 2IJRA 1WC6A 4CLYA 1CJUB 4G1QA 1FKOA 4NLDA 4NLQA 3KJVB 5A6WA 3DLJA 2FJBB 3KK3A 4OZ3A 1YIJS 2GJFA 1K47A 1TL7A 4OX9F 3HI9A 3CCMS 5E7OB 3T19A 4KB7A 3I4HX 3PR5B 3V4IA 1WC5A 3D28A 3LGHA 5A2QY 2NCKL 1S5ZA 3W8GA 4NEZA 4ZCMA 3JTPA 2YKOA 4M5JA 3GG0A 4Q7AA 5ITHA 4K4SA 3ULHA 3D67A 2X1GA 4RBTA 4DV6F 1IKXB 3H8YA 2P5VA 2G1HA 4NE9C 4LQ3A 4Y6IA 3H2LA 4JI3J 3BV8A 2F5GA 2UUBF 2HBZB 1T8EA 2XYGB 4X66F 5GMEA 1XMQJ 2DHGA 3NWGA 1T9VA 2RT3A 4FYVB 4U95A 1IBCB 1WEXA 3GFYA 3ET6A 3L9ZA 5A8RA 3ONQA 4EYIB 3I96A 1TUWA 2M70A 1YBTA 1RAOA 3ENVA 4MH8A 2AJ4A 2ASLA 2RQKA 2NSBA 4HTIA 2XSJB 1LFPA 1RU1A 2ZVSA 2XHCA 1LOUA 2YKMB 1NHKL 4A8YA 5E3QA 1UVMA 3GCXP 1JLGB 1FESA 2IRXA 2B9YA 2YNFB 3OR1A 3X1LB 5LMNJ 2BZ2A 1S1TB 3W64A 4RW9A 2OPSB 1V3RA 3DRXA 2UXDF 1KFDA 1FKAF 4P2MA 2CFXA 3R7SB 5L46A 4K50A 3OTOF 2UU9J 3LUYA 4K4TA 4WKRA 1NK5A 4JV0A 2F4VJ 2XCPA 1JB0C 2APOA 4LSLB 4J90A 2J7KA 3NRBA 4DQRA 5GADI 2C2EA 3W9HA 5EGYA 2BDPA 1RBLA 1EKRA 1FDBA 5THWA 1QSLA 4Q2LA 4H4MB 2B6AB 4KO0A 3POTA 1Y10A 3ELHA 1NPPA 4HACA 3NMAA 2JH3A 3FNNA 3PW0A 1Y4ZB 5ETQA 3FDSA 2W8KA 4X62J 1YDLA 3ZXWA 2EWHA 4FDFA 1KHWA 3MM9A 1VQNS 2V63A 1PO6A 1H3DA 2F40A 2UXCJ 2AGOA 2E7VA 3TJ9A 4U9RA 1UPPA 1U6FA 5DLGA 1RBAA 2PIIA 1HNIA 4UT4A 1RJJA 2V4JB 5AJ3J 1SUQB 4FVCA 3HVAA 1NBEB 3DM2A 1LK5A 1RT3A 2XS7A 4DV0J 5EX3A 5HVGA 4I2PA 3M9NB 3CD5A 4DJBA 2DR8A 3TI0A 1WC0A 2AYBA 2HS0A 2DEIA 3QJJA 2QGFB 2AF6A 2WAQD 2Y8YA 4S0MA 3QZ8A 4YHHJ 1WACA 1DTQB 1RDRA 4IFYA 5GADU 1LEOA 4EU0A 3KLIA 1ZA2B 3R6LB 1RWVB 5B0GA 5KFIA 3OVSA 2DNKA 3GTYX 2Q79A 2OPQB 2VKRA 5ETVA 4C9DA 4NI2B 3C6TA 4B9VA 2CZ4A 4AE5A 1CS4B 2F9JA 3R5CA 3GJRB 1K1QA 4DR4J 1IKWB 1B7FA 3A12A 3R5AA 5IOLA 1S1UB 3UDEA 5FD1A 3RRGA 1T11A 2QA2A 2VA2A 3T9NA 1OQ6A 3MEDA 1IJEB 4ZN3A 3PEHA 4HDGA 4IG0B 2LQJA 9ATCB 2Y1RI 5MAOA 3R97A 1HW8A 3HX9A 4RX6A 3EYZA 4ID5A 2LA6A 3MXHP 4BWMA 2EFGA 3CCVS 2DK2A 1OS5A 1NSQA 3A8EA 3M2RA 4CYUA 1UW4A 4UOFA 3KUGA 4DL7A 3RBZA 2UP1A 5C2CA 3BQ0A 4K4ZA 1SCJB 4OI1A 1U48A 1TFWA 1HPZB 2EG2A 3PXGa 4ED0A 3OD2A 2XEXA 3OT9A 2C2KB 4O4GB 4LMZA 5EWGA 3CJRA 1C0UB 3DRSA 2DNNA 4LF6J 2YWGA 2FVQA 4DR6F 2I8EA 3THTA 1SKSA 2YKNB 3IGVA 1FJ7A 1M5PC 1XR7A 3PW7A 3SCKE 3MMCB 2DVIA 3EGZA 3PRVA 2GZOA 2W1BA 3KK2A 4U7UK 4RU2A 1XJWB 3CJ8A 3EE3A 3D3CJ 1DTTA 5GMKa 5CYQB 4RU9A 1HI8A 4PYAA 3ZZOA 4C0HA 1BQMA 2OI2A 1KQGB 3OXGA 2HEKA 3BS9A 3Q8RB 1T7PA 4ALZA 2XBPA 3QGGA 3BJYA 2CKWA 3NGRA 4C11A 4C8OA 5DM6Q 3LWLA 3T5LA 3K17A 5T41A 3O44A 1JQGA 5LM7E 5AXKA 2E5IA 2JC0A 2QE5A 1U0SA 1B4SA 4OX6A 3J7YU 2AU0A 2JSXA 1IKVA 3OVBA 2QIFA 3HFKA 4I4BA 2IAJB 3NEKA 1V3SA 3DOLB 4OYOA 4JI5J 4OLPA 4DG1A 1VC6A 1DZ5A 2OJ3A 3QT6A 3PIOQ 2DNLA 5HVHA 2H54B 1TL5A 1S59A 2FZGB 4ED7A 4ZVEA 1E6YA 3IWXA 2MQPA 3LQVA 5ETPA 3IR5B 3DLHA 5JVHQ 3D66A 3W60A 1S9EA 5D0GA 1N34J 2W2NP 4NLRA 2QMXA 1S0MA 3SDEB 3J7AN 1JIHA 4DQQA 2V5HG 4ECSA 4XTTA 4IFVB 3JAMY 2OPRB 4RNHA 4IO1A 3PM9A 2R7OA 2DT9A 2AGPA 4TU9A 2B4PA 3M05A 3EM1A 4Q5VA 5I42B 1RTIA 1SJQA 5HI7A 3QLHB 4CT8A 5IC4B 4L75A 2VDHA 4I64A 2BV3A 2E5GA 3KJQB 2KYZA 2ILYA 4I0WA 2RQMA 2CPYA 3TUIC 2DISA 1N0VC 2MYFA 4P71A 3KLEA 3VTIA 2M52A 2OEKA 5L9XA 1P8GA 1PKUA 1KVJA 1H98A 1N32J 1HNWJ 3KG1A 3GFZA 4FVMA 1W7WA 1N52B 3A13A 3C2PA 5DDQC 4CQ1A 3N01A 3W2VA 4ZPDA 2FLPA 2HNYA 1KBRA 2EKNA 4TU8A 3B54A 1EETA 5ETSA 4O3SA 4F4AA 1RZMA 4N76A 2DR9A 2CJ9A 3C19A 3KNGA 1XR6A 1R0AB 3BGRA 2MLYA 4LF9F 3VALA 1REGX 1VC0A 3FVYA 4QWDA 2CQPA 2MB0B 3TEHB 1R8HA 5EWEA 4KFBB 3DOMA 2KJVA 2LP4A 2FB0A 1CULB 3MUTP 3CXCR 4QWEA 3BO3A 1WTBA 3TA1A 2GS8A 3FQKA 3OSPA 3JQKA 3H25A 3MR5A 5DDPC 1DBDA 3CMQA 1V5IB 3VAKA 2CQDA 2RNEA 3VQSA 4FBUA 5GAGI 2QA4S 4OYBA 4J9MA 2D9PA 1ZPWX 1UW9A 1FRKA 1AZSA 3LGMA 2HLTA 2OD4A 2GMHA 2HWTA 1Y9OA 1S0NA 2VH7A 2IRUA 4PXCA 3ENAA 2Z58B 1HHTP 2HQIA 5HJXA 4MIAA 2CQIA 3AJ2A 2YQ0A 4IG3A 2NXEA 5DQHA 1JK9B 2AKWB 3EGVA 4ECXA 3QYYA 2FZKB 1C4AA 5KFNA 3QIPB 2OKQA 3SQGA 4B3SJ 3AJ1A 2O3DA 3LGNA 5KG4A 1SQEA 3DFEA 1VK3A 2PGCA 1C2PA 3MR7A 2IM0A 2OMLA 4NWBA 1M5VC 2D74B 5D6GA 3NOCA 2HFOA 4DR3J 4H4KA 1JLQA 2HVIA 2PT0A 1Q8LA 2YKPA 3MFHA 4DSFA 2IMWP 3ZZ0A 3GE9A 2ZKUA 3N28A 3Q8SB 1JKHA 1DFDA 2XWYA 4LIWA 5EUHA 3CCSS 3HT0A 1GMWA 5I3UB 2JOQA 4LFBF 3G82B 1RAAB 3DLGA 4QIGA 4A47A 1OQ3A 1NK6A 3Q2TC 4ZPWR 5BXIA 4DR1F 3RRKA 2HGLA 3LA0A 5DRKA 3HLUA 5C24B 1S12A 1EZZB 1FFGB 2C2RA 1VHIA 1WF0A 4P2SA 3M8SA 2N4CA 2OSQA 5L8RC 2H5JB 2C2NA 3UDVA 4JV2A 4ER8A 2B7BB 1CJTB 2GQ2A 1MWYA 3CCJS 1WOOA 1F2HA 1HARA 5GVQA 2QTWA 4IH6A 4XAKA 3AXKA 3IBCB 2ZH1A 3P5BP 1F1BB 4PQAA 4I1TA 1Y00A 1TAUA 4OHYA 2JJ4D 2GCFA 3ADAC 2UUCF 3DI6A 2DH9A 1GMWD 2CQ0A 2MQMA 4ZVGA 1ZM4A 4URSA 1S49A 1H6KX 2LLZA 1TVRA 3SCIE 3AJDA 4ZP7A 2RB7A 5L38A 2DYAA 4BDPA 4FF1A 1MWZA 4IR9A 2IDLA 3NCQA 2WTFA 3L7PA 2MZRA 1J27A 1NZ8A 1RHKB 2ZH7A 4KTQA 1B0PA 2RJZA 3KLHB 1RT5B 4ZITA 4LR7A 1SJFA 2QSFA 3CSKA 3CMAS 4M5KA 2PI5A 2R8GA 1Q8KA 3TA2A 4W90B 1TL3A 1RI7A 2ZWPA 3OPKA 1FFWB 3G86A 2H5EA 2EW9A 2V69A 1BWEA 8RUCA 2KVIA 4ZHRA 1V9OA 3AOCA 2N7CA 2J0QD 3GU0A 3UE2A 1LWFA 2CJQA 2DNZA 2MKJA 3I31A 3OLBA 3MWBA 3MEGA 3RW6A 1M5OC 3GR0A 1C1BB 2HZAA 2XGQA 3FCWA 2X1FA 3DN9A 2HHHF 1LKZA 3HFZB 3BSNA 1FWLA 3GG1A 1SB6A 3TJ8A 2LECA 2XSFA 4KJIA 3KDOA 2GNKA 4ELVA 3GYNA 1DARA 1NCLA 2Z2MA 1HNZF 2EFPA 5HAOA 3AY0A 5F0UA 3D1HA 2BJEA 3GFHA 2UVWA 1EB0A 5IV3A 8ATCB 1UWBB 2OH2A 3C46A 3MR2A 1FTCA 2KM8B 4I6AA 5IM0B 1SL1A 3HHNB 2H4YB 3RB3A 2ZJRQ 4JI2J 4E98A 4O3NA 4J5OA 3GIRA 1VBXA 4DX8H 4DV2J 1RHJB 2NUHA 3VWSA 1IR0A 4KC5A 4WYLA 4TY9A 1SQFA 4LF4F 3L7OA 2YNIA 2VOOA 2ZM6J 3MGJA 1U1NA 4USMA 4DSLA 3M8QA 4R0JA 3G6ES 5A6PA 4JV5F 2BRKA 3CJ5A 4GC6A 4ICLB 1FRJA 4ZCLA 3HVWA 4IKAA 4TLRA 3S7RA 3MFIA 1M0SA 4B9MA 1SH3A 4K2XA 1FNOA 2VG7B 4JI0J 1H72C 3DMJB 5ETLA 1ITPA 2HQ3A 4P52A 1T9YA 2IJFA 4NLXA 2KVQE 1Q16B 2QLFB 2Z4PA 1BD6A 2XS5A 5F8IA 4DV5J 1HLWA 4X64J 4U96A 4WK1A 3BO4A 2K2PA 4RW6B 3W66A 3TNVA 5J2MA 2BQUA 2FJVA 4N56A 4GO7X 4YOEA 2GHVC 1RTDB 4DN0A 2GAGC 3BYPA 1HW9A 4OJ1A 5KG0A 4I6YA 3M8PA 2XGPA 3BR9A 4KHPF 2AT1B 4DV1J 1TL1B 4YY3F 1HD1A 3TVKA 2FGCA 3H98A 2PA3A 4ED1A 1MROA 5A76A 4MK7A 2V4QA 1J5OB 2FPHX 2V9WA 5KT7A 2MKYA 2XMWA 5GMDA 5EDWA 8AT1B 3R2CJ 1HHQA 5M2PA 2HWHA 4PUOB 4JI8J 1QY7A 2ZH5A 1YBAA 4Z7YA 3GIIA 2LVWA 1D9AA 1GXUA 1SIWB 1WG5A 1DLOB 1P1LA 3MM6A 2IIHA 4F50A 4USJC 2FJXA 1TUVA 5KT4A 2XO6A 3MCSA 2DEJA 3OUYA 3TAMB 1X4FA 4O0NA 4LRCA 2QLJB 2DBBA 4DMZA 2PMHA 3C6UA 1KTVA 4LFCF 4UOHA 2PMWA 3ENWA 2B56A 2F1FA 5HSPA 1NJYA 2RRNA 2ZBPA 3KJFB 3PHEA 1BQXA 3I55S 1D1UA 3FFIB 4FNHA 2UV8A 2W9BB 4NZ0A 3NNAA 2YY3A 1BMQB 2W9CB 5AT1B 1YI2S 3IR7B 3ETOA 3MM5A 4DZ6A 4G3IA 4QYZJ 4TVAB 2AEFA 2C1EB 1FXLA 1Q0NA 2ZJQQ 1N88A 4MT1A 5F8GA 3UO0A 3L3CA 1UEVA 3DGPB 1X0PA 3FBFA 1ZH5A 3KMSA 1L3SA 2MLZA 2YPYA 1EHWA 1WORA 2GVDA 4QZVB 4RBVA 2HHTA 3AQPA 5CZXA 3VVTA 2HFUA 3E8OA 1G7CB 3FJ2A 2V8GA 3R9LA 2RF2B 5F8LA 4CO0A 2VV5A 3MUMP 1C0TB 1JLAB 3IN5A 2ROGA 3DXSX 2V68A 1RWXB 4RW7A 2JEIA 3OL9A 2YNGB 3DU5A 3GCWP 1HMVB 2MSTA 3DLBA 4JI6J 2EFQA 5D77A 4DPXA 2ADBA 1NDCA 1VHFA 4NMLA 3OXLA 3Q22A 4WFXA 3PV8A 1UFKA 2A6OA 4JV1A 3PCOB 3NS7B 4DUYJ 1VRTA 4R8UB 3AHPA 3KHRA 1RT4A 3EICA 1LXJA 3US5A 2G0JA 3IC1A 1HQUB 4X4UA 3TW0A 4URQU 1VBYA 4F4WA 2ASJA 2B43A 1OWXA 2WBRA 3HM9A 3L7UA 2DITA 2XI2A 1FHTA 3K8WA 5HMYA 4NPOA 3T1HF 1NEEA 3M2VA 1WEYA 1WC4A 1FEHA 1K73T 1XNQJ 2YWFA 3PACA 4OYMA 3ZZZA 2VQFF 5CXTA 3O5TB 3KYLA 3KKFA 3ETMA 2PSZA 4WE1A 1HBNB 4DX5A 2DJWA 3VAJA 4RR5A 1QLNA 1URNA 3IXQA 3HHLA 5LMUF 3O8WA 2J8SA 3R7BB 3TRGA 3QGPA 5KFFA 1TMJA 2WZ1A 1NUEA 2BJ1A 2J6UA 5F0WA 1T9UA 3BGLA 2FLNA 1R8CA 4EBDA 2CA9A 2H3EB 4NL5A 1NK0A 2PFFB 3AQOA 4UUXA 1RWMB 1F60B 2QO3A 4LF5J 2HVDA 4PYDA 1KQSR 1TP7A 2J9EA 3NNHA 2B5JA 3RU0A 2BKOA 1YLXA 2NXNA 1ZM9A 2VPZB 1R0BG 3VF0B 4K5SA 4YMEA 2XMVA 3ZNUA 4FBTA 4LUBA 4O3OA 4A8FA 1UA1A 2I5JA 2K3IA 3JSMB 2CZVC 3EGWB 4R5PA 2BA9A 3PO4A 1KKHA 2FJDB 1AFIA 3C15B 1U26A 2DHAA 4QR0A 2HNDA 3QO9A 4HH0A 3KNAA 2C3YA 1PC5A 1KVIA 2EK6A 2FC9A 5ETRA 4ZLNA 3HHLD 4CCHA 5C2GA 1RKIA 2JZ5A 2M3DA 1U1OA 4B08A 3DU6A 3P6YC 3Q23A 2YKQA 2K1RA 4C8KA 1X4EA 4MKYA 3OL8A 3BN7A 3X3UA 2R2TA 2W2MP 1RSCA 4JI3F 4ZLJA 4TXSA 2R8KA 3WZ0A 1RAHB 4KHRA 3RBDA 1NKBA 4QPXA 4NZ7A 3SSSA 4MKBA 1XMQF 1RTJB 2IM2A 3IS9A 2CWXA 2BEFA 4AL7A 1Q7LB 2QT7A 1HBOB 2DR6A 3I0SB 1EAYC 1S99A 4Y00A 2IM1A 2NXJA 1T3OA 4PPZA 2Y1IA 7FD1A 4PWDB 4RBUA 4ECWA 1IKYB 1FK9B 2WBMA 4Q0BB 1YTYA 2V0NA 2AW0A 2WSCC 1HNXJ 5CH7B 1BHNA 1JJ4A 1ZYQA 3JYTB 3T3FA 3FGVA 4LVNP 3HSGA 2ACMA 3PRDA 3FRYA 4WP8A 4P7TA 2H5IB 3FZBA 5B09A 1SJRA 5LMNF 3HF5A 1AA1B 4ILRA 4KH0B 4G65A 3EGNA 1KVKA 3RB6A 3RYLA 2XY7A 2XQCA 1RHRB 4DWIA 1TKTA 5GAHI 1XK8A 4OQJA 5GAEU 1P9YA 2YWWA 1HBMA 4Y2CA 1NH8A 3I87A 5I3PA 2UU9F 3QMQA 4DF8A 1T94A 3PG9A 4KGKA 5D0HA 2F4VF 3OHAA 5F8NA 3AA9A 4A4JA 1FO1A 3RBEA 4Y2MA 1M5HA 3CCZA 1GT8A 4GVBA 5LSOA 5BYSA 3NWRA 1WHYA 1HR0J 5HLFA 3MECB 2QC3A 3VVUA 1RQ0A 2B4VA 4RUBA 5KFZA 3CC4S 3NBPB 4X62F 1QAYA 2K8GA 4CO1A 1BUXA 4A8XA 2OGUA 2DRBA 3GSIA 2UXCF 4F02A 4CTAA 3EVWA 4MYUA 5IT0A 1S6PA 4RWXA 2DD8S 2WSEC 2N82B 2GQQA 2OFHX 5HATA 2CPJA 1UETA 5AJ3F 1R8AA 2UZAA 3OTBA 3DGVA 4B3TJ 5GAHU 2RILA 1FNXH 3QFWA 4DV0F 2JLGA 5HP1A 1T02A 3CB4A 5G0RB 3V6DA 5KFRA 4WTOB 3NL0A 4F2RA 3MEEA 3HHDA 3HVTB 5CYMB 1VQLS 4YHHF 4X4SA 2H1YA 4KV8A 3U1NA 2F65A 3R2DJ 4OJHA 4AQYJ 4A8OA 2HGNA 3EZUA 4NXMJ 2R4FA 1VQKS 4BBYA 1RT1B 1TKXB 2ADCA 5C42B 2MMYA 1VRQC 3IG1A 3M2UA 4O23A 4TY8A 4DR4F 3GIMA 2R7SA 4OZNA 2V50A 1PJ6A 3MM8B 4ZCKA 3DYAB 5DO2A 2ERRA 2BQ3A 4GKKJ 1YJ9S 2QL9B 4KHMA 3JSMA 4PXDA 4X84A 2I6WA 2EI5A 2WVFA 1GH8A 2FJEB 3ZZYA 3BEGB 1WDTA 2CG8A 3MCMA 1X5OA 4N8OA 1NJZA 1TV6B 3MDFA 2WHOA 5KFHA 4QYRA 2CQ3A 1LW0A 3G6VA 3G87A 1N5YA 2MXYA 2KJWA 3IRXA 2MKKA 3EJMA 3DLLQ 3TAQA 1FX4A 2QN6B 4NYPA 2D7SA 3Q24A 3PKYA 2ZFHA 1VYAA 1KFSA 1BQNB 4JI1J 5B0DA 3SZ2A 3E01B 2YVSA 2ALZA 4MKVA 1JNZB 1RYRA 4LF6F 1WOPA 5HROB 2BJDA 4LR9A 3CPWR 1KDNA 2J0WA 3PVXA 3HSZA 3CVKA 1FX2A 5B0CA 2SXLA 5IFMA 4IO9Q 1Q79A 1IUJA 4TQSA 5HMWA 2RQ4A 1VIOA 2BUNA 3PYDA 4M5HA 4DBQA 1UWAA 4DV4J 1S6QA 5F8JA 2QX0A 5DDOC 3EDQB 4F4YA 4NCBA 3ZTQA 1NKCA 2XM3A 4Q44A 2KHCA 2C2OB 4LRBA 1XIQA 3R6GB 1XMBA 5L1IA 2OPPB 5ETKA 2VBYA 1S77D 4JI5F 2ZZMA 5K8OA 3MAAA 2KZMA 4JI7J 3EDRB 4CH0S 1KOOA 1EP4B 4ED6A 4Y34A 4MIBA 5D4OA 4WFBQ 3IR6B 3MMAB 4YS2A 3EZ5A 1NM2A 1VQPS 3LANA 4CLTA 1VRUB 4N5SA 5KFLA 3J7ZT 3VCDA 3CF5Q 3WBZA 1HQEA 2DTJA 4KPYA 5CCMA 1N34F 3KTQA 4MJKA 4QU7A 2HQDA 2ZITA 4X4OA 3R5GA 2HS3A 3E2EA 1N36J 3TVYA 3A8JA 2EPIA 1PBUA 1Y7PA 1Z2LA 1N5QA 5F9LA 1T9WA 3MCNA 5HN0A 4EYHB 1K9MT 2DPIA 1LWEA 4NA3A 3NMRA 5J2QB 4ZIWA 4U8VA 4PXBA 1FF2A 4I2QA 4Z7CA 5LJ3Y 3DLEA 3HP6A 3AB4B 3MAHA 1NLKL 2MQ8A 1U45A 3HK2A 2VG6A 5B0FA 1SV5B 2H51B 1FCAA 3SI8A 3K8VA 3SFUA 4F7VA 4J9QA 1SQGA 3GV7B 4ZLLA 1N32F 3R3TA 1ZZNA 1HNWF 2PD1A 2IMOA 3H5SA 1Q8IA 2KM8C 3EXCX 4M8LA 1NJWA 5FDLA 4WU3A 1XMOJ 2A1BA 3MR3A 2VONA 2L3MA 1APSA 1VBKA 1SC4B 2KYXA 2L9WA 4OZ5A 2FHMA 2KKHA 3OV7A 2XY6A 4DL6A 5KFQA 2ZHBA 1UZDA 2DNPA 2B8QA 2H9ZA 5HO4A 2R2UA 4MFBB 2ZHAA 1IBKJ 1FKPB 2DPJA 2DCLA 2DGUA 1W2IA 1JJ2R 2L48A 2Q1LA 4HHHA 5CYJA 3UN2A 2JL9A 4CM2A 2CWKA 3KHHA 3LH2S 4O44A 4M5MA 1IBLJ 5HBMA 4UQGA 4C8ZA 5A8WB 3D2WA 1RHUB 1YVFA 3W2WA 2LCWA 3GP9A 3W8PA 3NG8A 2ZBRA 4U6PA 4C8NA 2GFFA 1X9WA 4FF2A 1ZTTA 3VZHA 4IDKB 2LDYA 3PIPQ 4WZQA 3V81B 4BC9A 2FVRA 4LVOP 2LMIA 5JUMA 5FIIA 3AXMA 2YKAA 4LIRA 4U67Q 2OO4A 4ZVPB 1LW2B 4ED3A 2XI3A 2BJ8A 3NP5A 4KGXB 1MN9A 1H38A 3CD7A 5K14B 3QGHA 4OJGA 4RZRA 3DRYA 3AOAA 3DRPB 4CLKA 4B3SF 4ECTA 4RUCA 3D4JA 1PYSB 4J37A 5LL6d 2CPIA 4CI0B 3HHEA 2RE1A 3HJVA 1F2GA 3T6BA 2KXNB 2KXFA 1QSYA 1F5CA 2XYPB 4A48A 3D0IE 3WX8A 4DR3F 2WOMB 4C3LA 4HHJA 2F7VA 1B64A 5CHCB 1U02A 1RT7B 2LU1A 2KL8A 1SXLA 2V2KA 1HA1A 5E3RA 3MOZA 4YR2A 4DSEA 4O0IA 1UPMB 3UWTA 4EBEA 1CJVB 2J9CA 1WUUA 2GO9A 1RBOB 4PEOA 3Q8YA 2JVRA 4UY8T 5J2PA 4WKYA 4UZBA 5G4DA 4HLBA 1U1PA 2RDIA 2BQRA 2IYGA 4IRCA 4LSZB 1TKDA 4ZVOB 1A7GE 1HI1A 4B02A 4B9NA 4DL4A 1RTZA 3H5UA 2ZOFA 2WONB 1C1CA 1G2EA 3CUNA 2E44A 2DGOA 1BXNA 3B4MA 4RNOA 3HFVA 3N9UC 3K7RA 2CJAA 3RG6A 1F9FA 1HYSA 1CJKB 3RAMA 3E3XA 2QLXA 3OW2R 1HWUA 1ZA1B 3PR4A 4LBIA 4KY3A 4AXIA 2IFXA 4C48A 3PNIA 2JDJA 1P6TA 3VAGA 2ZEJA 2BE9B 1RTHA 2CQHA 2RH3A 5KFPA 1JLCA 2IRYA 2XNRA 2B9XA 2NUUG 3BKFA 1KLMB 2IM3A 1Y11A 1QAIA 2WRMA 5E0OA 1GMUA 4WZMA 3MD1A 1YK9A 3LP0B 3VAMA 2FVPA 5F3TA 4JUZA 2BANB 5D0RA 3MR6A 1RK8A 4IRDA 3MD3A 2KFNA 1HBUA 5T7LA 2BACA 1QAXA 1HNVA 2GMLA 3PX0A 1QE1A 1U1LA 1P9QC 2W4PA 3NXZA 1HIYA 2HWIA 1XERA 4PQUB 4GVLA 3PFEA 5B0EA 1YZ6A 3DHWC 4EO6A 2QLWA 2E9TA 4DPWA 1URRA 2MJUA 1ZM3A 2J7WA 1L3VA 4JP8A 1VQ4S 1R3NA 4WXOA 1S10A 1RHMB 3NS6A 4PAAA 1LWCB 2EC2A 2ZOGA 2KRBA 3G8QA 1ICEB 3S01A 1ZS6A 4FYYB 4HTJA 2F8HA 5A0YB 1S1VA 5C25B 1G3OA 1IM6A 3OFFA 3Q89A 2KT5A 3C3LA 4ANCA 3WDOA 1GEHA 5HVFA 2N7YA 1X9SA 1RAJA 1U47A 1KEKA 2JNJA 1X5PA 1YGYA 3MM7A 2R8HA 1Y3KA 2LQ9A 1TTHB 3OQ2A 2CJXB 3IWLA 4C97A 2X1BA 1IQZA 1MLAA 4H4KC 4F4KA 3V81A 2W4CA 4JBCA 3D3BJ 5K5MA 4J9SA 1RU2A 3JQJA 1E6VA 3N4WA 4JI2F 1IQTA 2F9DA 1NAQA 1N33J 3C16A 2UV8G 1FD8A 3OL6A 2HVEA 4WJBA 4DV2F 2CDRB 3KLFA 2NR0A 2BX6A 1OPIA 1RT6B 2JC1A 4L3NA 3LTOA 1RACB 2ZM6F 1S9GB 2NPFA 4DN9A 1HD0A 4I68A 4V19J 3F73A 3LPYA 4PPDA 4NCGA 1REVB 2MKIA 2JHEA 1T03A 2DR5A 3FZ2A 1B70B 1KLNA 3VV2B 1YX2A 4Y28C 1R27B 4JI0F 2W7OA 3TA0A 2O01C 2HNZA 4NLUA 1JLBB 3CJKB 3QT8A 1C4CA 3M1VA 3UCZP 2DNMA 3BH6B 4DR2J 1N5SA 3T5HA 1JXLA 3CDBA 1NK9A 2M8HA 1NHVA 1U6BA 4DV5F 4X64F 4V19X 2IJNA 3N5BA 2PDAA 1S1XB 1X5TA 2GGPA 2M0GB 4QBUA 3ILIA 2CYYA 1I94J 3D6HB 1S79A 2A0FB 2MGZA 4KKOA 1BWVA 1PBAA 2FLLA 4DV1F 1JXVA 2HYIB 3CC7S 4OYXA 3IMQJ 2ZD1A 4B3MJ 3RGIA 1PIEA 4O4RA 3LP1B 4TKTA 3TUZC 1TKZB 4WF9Q 3CCQS 4WU2A 2HBQB 4ZN1A 2AX1A 5D3GA 2XHWA 4DFMA 4ECZA 3OR2A 4H4OA 4DCOB 1T05B 1Z1ZA 5L1JA 4JI8F 3K57A 4NYOA 3W5XA 1TL4A 1KWMA 3MZIA 1UAWA 2Y9HA 1F0XA 2XB2D 3JSYA 3IM8A 2F8EX 1N0UA 2K3KA 2B0GA 4UQTA 3GV8B 2HIYA 3R5JB 2BM1A 2IYIA 3BZQA 2G0IA 2COLA 3I5CA 4M5DA 4DSJA 4LF1A 1N5VA 2MKSA 4FS1A 4DFKA 4BWJA 3C8YA 5I4MA 2Y3YA 4DR7J 4ED5A 2QFIA 4QR1A 1LFWA 1M90T 4HI2A 2OTJS 2VG5B 1ZPVA 4ATNA 3EVMA 2HHUA 2FY8A 3QWUA 1WKKA 3UR0A 4K4UA 3O6QA 3HT3A 1W2BR 1S1WA 3NGSA 5E5NA 4I7FA 4F67A 5KT3A 5KFYA 2GQCA 1SC6A 2BW2A 5D4LA 2MPUA 3EPIA 2A6MA 4ZJOA 1WNEA 2J8AA 2ZBCA 4RW8B 2R9LA 4RWWA 3W9IA 3T1YJ 1K44A 3AB2B 4OL8A 4Y65A 4DOZA 3GILA 2CPDA 2VUGA 4B3RJ 4WP9A 3K0JA 4RUAA 3DRRA 2RKIB 1S9FA 3HDSA 4FYDA 1U8SA 3GR1A 3QGIA 3CJ4A 3H5XA 4ECQA 3TUJC 3KLGA 4FN5A 5IT9Y 3UNGC 3LW5C 4JI6F 2G9OA 4I69A 3NNCA 4ETZA 4EFAC 3GSDA 4QIWD 1TR0A 2PI4A 2XMKA 1JLFA 3HKZD 3W61A 3CJTA 1JLEA 4DUYF 4O3QA 2RHSB 2ZBIA 4EO8A 1RE1B 4ES1A 4CO2A 3W63A 3O2IA 1U0HA 3NKYA 4HKQA 3QJPA 4L76A 5DGBA 4WBFA 3QRQA 1Y3JA 4I67A 2BE2A 3C14A 1VMBA 4P2FA 3CD6S 5J1EB 1H0HB 1KQKA 4CNZA 1XNQF 2HW3A 1RWWB 4E8UA 2GV1A 1XQIA 3V6HA 4LF7J 4C7QA 2GVZA 4JOUA 2HMIA 1JJHA 3FUYA 1NO8A 3PKMA 4TN2A 4B3OA 4PG8A 1PCAA 2PN6A 4OYIA 1CJUA 3PW5A 4UUWA 2HHVA 5LXRA 1S0OA 2CIMA 3Q0AA 3KJVA 4P2XA 2V8HA 3IA0A 3D6MB 1OY9A 3TR5A 1NJXA 2DGQA 2IC3B 1UL3A 2DGXA 3JQMA 3T6JA 1UEUA 3NY0A 4EZ6A 1YJUA 4ZJQA 5KT5A 2UUAJ 3PEJA 3MF5A 1H2VZ 5IQQA 2PEBA 1TZ0A 1WHXA 1NU4A 1TK0A 3QATA 1GNKA 2V2QA 3J7YI 5ADZA 2JEFA 5AXMA 4LQ9A 1SJ4P 1IKXA 4E0DA 1Y5NB 3TUPA 2VBXA 4QPTA 2WCXA 1S4FA 2Z2YB 1Q78A 1UJ5A 2Z57B 4OHVA 3M32B 2KT3A 3OHBA 2QRRA 4N41A 3CGIA 1UTAA 4IQXA 3HPOA 3JAMU 3TX0A 1RT2B 2BOPA 3J80Y 1M1HA 5E3PA 5J2NB 4FNIA 2JRSA 1O51A 1SC1B 4KE5A 4Y2IA 1EQ0A 2W8LA 2RD5C 4XPCA 2P9CA 2NS1B 4FS2A 2BBEA 3MMBB 3PTWA 1ACMB 4K5RA 4L3KA 3FMBA 4NRUA 2XSJA 3IM9A 1RCOB 4IYQA 2YKMA 4OI6A 2E1RA 2IHR1 1JLGA 1HKAA 2DNQA 2YNFA 1AUSL 4C3KA 1FRMA 4OX8A 5E33A 4LFAJ 1UA0A 3D0HE 1S1TA 3R5DA 1RA7A 4EZ9A 2OPSA 2YNHB 2BM0A 4DQIA 2O67A 2OD6A 4ZVSB 1HNXF 3GFXA 3FBBA 3BDPA 4K2JA 3OFEA 2YWHA 1VQ7S 3K5MA 3A8IA 3E51A 4KPCA 4ZVTB 4Q8EA 5A8KB 4LSLA 4YB1P 4P10A 1RXOB 5D0EA 2JLFA 1FVQA 3DC2A 1VC5A 4H4MA 1WOSA 1FE4A 2B6AA 1JWWA 2ZH3A 2VA3A 2RMLA 4Z37A 3OFGA 4F25A 1MMDA 4FYWB 3THPA 3OTEA 4M95A 2FLOA 2IBOA 1GMVA 4FF4A 3CCUS 3ILOA 3KK1B 2MDAA 2CPZA 5E3AA 2BYCA 2UVRA 1FJGJ 1HR0F 2DRAA 1S76D 2BOAA 4C8MA 5KT6A 1VQ6S 3HHLC 1K0VA 4K4YA 4TQRA 2J76E 3LP2B 1O5JA 2G13A 3DLKB 1Q8BA 3AFGA 2V4JA 3G9CA 1SUQA 4OYZA 1S72S 4DCPB 4M63A 3QSYB 2DY9A 1NK8A 2E66A 2HGMA 1VDHA 4W98A 1HWJA 3H4BA 3ITHB 4ZK7M 3QRPA 4RJVA 3G6YA 4ED8A 4B9LA 3SV4A 2R7QA 4Y2AA 1XN9A 4NOHA 2O66A 4RW4B 4USIA 1CC8A 1DTQA 3DDNA 1NRKA 4J9KA 3H5YA 3UCUP 4B3TF 2KXHA 4P6QA 1CVJA 4ZCIA 2I1RA 2D69A 2VICA 2HURA 3DOKB 3BBFA 3MOJB 1KP6A 1FVSA 1S7HA 2OPQA 4RUHA 3M30B 2XZDB 2Z30B 4W4MA 4NI2A 1WI8A 4ZKAA 2LFVA 1CS4A 1IN0A 2ZH4A 2W7PA 4CLPA 1IKWA 1WELA 4AQYF 2J6TA 2HQGA 4ES3A 1S1UA 3FBCA 3IBWA 4NXMF 4DCJB 5DG9A 4DLGA 1VIXA 4DUZJ 2VBWA 4JI4J 3UVJB 2BJ3A 4IG0A 4A8MP 2XY5A 1YJVA 4P7VA 5AXNA 4X4NA 1Z2ZA 3ILJA 4RNMA 5CA5A 1NDKA 1OY8A 1MU2B 2R3VA 2FZCB 3UDCA 2AEJA 4DUTA 2RRAA 3I0RB 2CPXA 2EK1A 4DPTA 3BR8A 3Q86A 2F3JA 4LSNB 2QL7B 4OI0A 4QIEA 2IBKA 4GKKF 3ZZPA 2RAQA 1SPBP 2ZDOA 1Z4UA 5KFUA 1UJ6A 4G1QB 3F41A 1K8AT 1FKOB 1UKUA 4EEYA 3CJQA 4DV7J 1HPZA 3GV5B 2W24A 4YDXA 4PXEA 2WVCA 3KK3B 4AYBD 4QR2A 1RUSA 4O4GA 1TL7B 2LEBA 1C0UA 3JTOA 1KTQA 2HQCA 2RDJA 1RADB 5DS7A 2YKNA 3V4IB 1IXKA 2MKCA 2CQBA 3MMCA 1NDPA 2QMWA 1V6HA 2I38A 5T14A 1IWGA 1VQ8S 4JI1F 3PW4A 2MZ1A 5CYQA 4F8RA 4UZCA 3RW7A 4DV3J 1LNQA 1KS2A 2WB1D 3QWPA 3VAIA 1IVZA 3ZTPA 3BDEA 2ZH2A 4ZP6A 3RAXA 3U7JA 4MK8A 1N5TA 3KOAA 2FUG9 3A1YG 4QWAA 4ZMMA 3IFEA 3V4MA 5HQ8A 3VGSA 4WYWA 4KGVB 2LXUA 4EUVA 2VFTA 4LJMA 3ET6B 4L6V3 1WG1A 5A8RB 5KFMA 5HK4A 1S4EA 1KN6A 2IAJA 1W26A 4DV4F 3DOLA 3FSXA 1AYEA 4OMFG 1PILA 3BH7B 1ZOTA 5ETNA 3BGFA 4F36A 3I82A 1WHWA 4MKAA 3BN4A 4NA1A 1T95A 3K89A 1WC1A 3BB5A 1VISA 5KFWA 3S8SA 3N6NA 1VQ9S 1SI9A 3P3DA 4JI7F 2YTCA 3M9OB 2X3GA 4XK8C 4DPUA 4RW9B 4KR0B 1U2RA 1WJ9A 1UP1A 1GK8A 1U1RA 3SDEA 4CH1A 4OYAA 1F6TA 5KOWA 3EVOA 4NLTA 3BQ2A 3PRBA 4IFVA 2CJYB 2OPRA 1OIAA 4M5IA 3IGNA 3WX4A 4PR6A 2NSCA 3D5MA 3NAHA 5I42A 3N6LA 2VB6A 2P9GA 3NCRA 4WWSA 4CLSA 3HMJG 5ETMA 2CQ2A 3QLHA 4IH7A 3AD9C 4OI2A 1N56A 4Y0FA 1N36F 4KO0B 2AYMA 3HVRA 3C66A 3POTB 3CJSA 4HACB 5K9FA 2L08A 1EX8A 2RUSA 1R8BA 1T0TV 1O6XA 1UVIA 2W9AA 4OZ0A 4Z2XA 3GQCA 3AT1B 3HZEA 3MM9B 1Q4RA 1R8PA 5IQ6A 4FXDA 1MMNA 5LJ5Y 2ACYA 5KFAA 3VR1A 3A3OB 2UVVA 2ZHOA 2WVBA 1F3FA 1DQAA 1UVNA 1NZAA 4G1PA 3D54A 2VD3A 2C42A 1HNIB 3RTVA 2MZSA 2J9DE 4ZA1A 1LQ9A 5ETOA 2G1DA 3DM2B 1RT3B 4KYZA 4F04B 3D7SB 4QYZK 4CLFA 1L3TA 2DNYA 1R0AA 1XMOF 1I3OB 1Q53A 2MHEA 3BSCA 3PO5A 4I2PB 4ELUA 3NS5A 2I9SA 2ZNZA 2R8IA 2BABA 3CNQP 4KFBA 2HZCA 3UFCX 1NK4A 3CC2S 4JYAJ 4IFYB 4UOCA 4O3PA 1CULA 3KLIB 3BPSP 3HKWA 2CQCA 3M6VA 2ALYB 4B9TA 4FPIA 1XC9A 3MEKA 1EIYB 3C6TB 2AYGA 1NHUA 4ERDA 3GONA 5KFOA 1IBKF 4AFFA 3D1QA 3W5ZA 3BKTA 3RB0A 4X2BA 2RUGA 3K59A 1FEEA 1I5OB 5DG8A 3WC2A 1Q95G 3M4XA 3MEDB 1IBLF 2HSEB 3IAM9 3KG4A 4N8NA 2C28A 1H74A 4GO5X 4ID5B 4ILLA 3VGUA 2XMMA 5IS2A 4IOCQ 1AFJA 3M2RB 4CYUB 1BY9A 4WIIA 3G2XA 2I0XA 1U1KA 2QFJA 3D0GE 1CC7A 1GXTA 2MSSA 3QIPA 3HZGA 2KFZA 5E2QA 3W1YC 3F56A 2EFOA 5JJBA 1AB8A 4USTA 4ZVQB 4C8LA 1N8RT 2W2OP 2RVJA 5KG6A 2HLUA 2CJBA 2HVZA 3DRSB 3QQCD 4DU8A 3RZAA 4N47A 2V8PA 2ZWOA 5J1NA 5DM7Q 2MLXA 3KK2B 3CT9A 2CADA 3QPIA 2PC6A 1FWPA 5HANA 1DTTB 3MPUB 4J9PA 4DFJA 1MN7A 4ID8A 1BQMB 5IXUA 2GHPA 3ZTSA 3CCTA 4ZIVA 1RWNB 5I3UA 3T5KA 2HAIA 4GC7A 2VODA 3G82A 3KG0A 2VPWB 4KIAA 2VQEJ 1XNRJ 2KI2A 4NYZA 3S1TA 4U7CA 4C11B 2I2YA 5C24A 5LSLA 3R27A 3TP2A 2ILZA 4ETXA 3FSIA 2ASYA 1IKVB 4NA2A 2CPEA 2KG0A 3K2YA 2XWXA 2J0SD 1NB2A 1VR6A 4F3QA 4DG1B 3CCES 1X5SA 1MSWD 3TZXA 2MEWA 1CJTA 2ZJPQ 1PAEX 4QQBA 4AT1B 2VJVA 3ISND 1UJ4A 5D4NA 2E7WA 1WKLA 4ZP9A 1QDUB 1JNRB 4WP3A 4J9RA 4WTYA 4JB8B 1E6YB 3VHQA 4C3MA 1R43A 2ASDA 3M6XA 1S9EB 1R6VA 4RKUC 4LF2A 2ZKTA 4OYWA 4FZVA 5KAKA 2JWNA 1YRXA 1YJRA 4QU6A 3UCGA 1QSSA 2YPZA 1JMTA 4LBPA 3U02A 5IV4A 4ZPCA 2GJIA 3BGUA 3CCLS 4QW8A 2Q66A 1X31C 4CO4A 3KLHA 1RT5A 4XDCA 2HFVA 1RTIB 3UN5A 4AD6A 3PJ9A 1F3VA 3NGDA 3SCJE 3BBCA 2EC0A 1OMSA 3L4BC 4TU7A 1RWKB 5KT2A 2B8PA 4XO0A 2KFYA 2BVZA 4OHZA 3KLEB 2DNHA 1SL0A 4URGA 4UW2A 1U1QA 3GJSB 1LXNA 5C5JA 2HFNA 4USKA 3VZIA 1C1BA 2FVSA 2A18A 3FC9A 3ZNJ1 4I56A 2FTRA 1QUVA 5F8MA 4KGZB 3W2VB 4ELTA 2HNYB 2HZVA 1EETB 2LQ8A 3KMQA 2M7SA 2NQPA 3IRWP 1FA0A 4RLEA 3BGRB 4F26A 2NXCA 4CO5A 1ZZFA 3L95X 3QAUA 3L09A 2OTLS 1DY3A 2CDQA 2C2DA 7FDRA 3QFHA 2GA7A 4N7TA 2Q3PA 3CO9A 3DOMB 4M1KA 1EARA 2FDNA 2QV6A 2E1MC 1U49A 1UWBA 1CG2A 3RJMB 2FD2A 1Q81T 5B08A 5IM0A 2LXFA 3QRRA 4ECRA 2H48B 3KWMA 2B3TB 2AZ1A 2DNOA 3HXMA 1VLOA 4ZDNA 2UUTA 5L1LA 1WG4A 2DHXA 2AX0A 2PEHA 2EEYA 5KFSA 2ATCB 1R0CB 1YITS 5DGAA 4Y3CA 3JB9k 3J81j 1N33F 1UFLA 2ROPA 5U47A 1FRXA 3CWJA 1AZSB 1RCXB 3LOUA 4ICLA 3TOQA 3JS9A 2PFDA 1UVJA 4CDIA 2WVEA 1F9EB 3LAKA 2CNKB 1KQFB 2R2SA 1ZM2A 2A10A 4HYKA 4IG3B 4RL1A 2VG7A 5D15A 4YR0A 3DMJA 3FEXB 2MQQA 2ZBQA 4NXNJ 2U1AA 3SQGB 4AUKA 1RWPB 2OUGA 3A3PB 1X9MA 5DJBA 4KQZA 3VGVA 5KTQA 2V8VA 3A4TA 4RW6A 3NAIA 1NXIA 2LA4A 1CQMA 2JFKA 1RTDA 2E1CA 1RABB 1JLQB 2M9KA 2ATLA 4DR2F 2HHSA 2JX2A 3OJUA 3ZTOA 1SKRA 4CLUA 1TL1A 4EK2A 3P4UB 1A6LA 1QAJA 1JKHB 1OYDA 2X1AA 2Q43A 1J5OA 5LSRA 2ZUGA 1I94F 2GX8A 4DPYA 3DLGB 4ENOA 2GAHC 2K7KA 1FNMA 3F0NA 4OX7A 5DG7A 4PUOA 2YQ1A 3FEYB 2P6SA 3NGUA 5EHHA 4B3MF 4NZ6A 1DLOA 3KJNB 5GAEI 1RAIB 3QT5A 2DHHA 2XG8A 2ZNYA 1X4BA 2YXLA 4A46A 3TAMA 1XTZA 3GPAA 1M1GA 2ZH9A 4OZ1A 9RUBA 2CJKA 2GJ2A 1OO0B 3RB4A 1H2TZ 1V5VA 2OFGX 3UQSA 4FF3A 3HD1A 1Q82T 2AEMA 4L72B 1VLYA 2ZVIA 3UW1A 2E9ZA 3FFIA 2KO1A 2W9BA 1SKWA 4ZS6A 2W9CA 2RSQA 5FLXU 3DI6B 4GKJJ
chains in the Genus database with same CATH topology
2PMZD 3G6ES 1S79A 1XEZA 2B7CB 5A6PA 2XLKA 1WF1A 2BRKA 3CJ5A 4GC6A 4JV5F 4OFZA 4KKOA 2MGZA 2AV5A 4ICLB 4KSEB 2FLLA 5AE1A 4DV1F 1S1VB 1J5EF 1FRJA 2HYIB 3CC7S 1TVRB 4ZCLA 2ZD1A 2HPUA 3HVWA 4IKAA 4TLRA 3S7RA 3MFIA 4O4RA 1M0SA 1TFYA 3LP1B 4TKTA 4PG4A 3TUZC 1TKZB 4WF9Q 4B9MA 3CCQS 3DGPA 4WU2A 1SH3A 1HHSA 3EUNA 3ZFVA 4K2XA 4CO3A 3Q8QB 3V5RA 1FNOA 5KFVA 1QM9A 2AX1A 4DR7F 5D3GA 2WSFC 2XHWA 2EFVA 4DFMA 2VG7B 2VZ9A 4ECZA 2HHXA 3OR2A 2LU2A 4H4OA 3DMJB 3ZZTA 3UPFA 4J9OA 2O1PA 1T05B 4TLQA 1Z1ZA 2D9OA 3QIDA 5L1JA 2HQ3A 1WHVA 2Q6BA 3MM7B 2IJFA 2LDIA 4JI8F 1M1KT 4NLXA 3K57A 6FD1A 5J1EA 1Q16B 4IUFA 2XO7A 3H59A 1NKEA 4NYOA 2Z4PA 1KNZA 1TL4A 2RF2A 2ZZNA 2CPFA 1BD6A 5HL7Q 2XS5A 4DLEA 3OFHA 5F8IA 1TL3B 4WCEQ 1D9DA 1C0TA 1JLAA 3MZIA 2AP6A 1Q86T 1AXQA 1UAWA 2KG1A 1CLFA 1KR4A 1VOMA 1F0XA 2XB2D 3MMJA 2JEJA 3JSYA 4ZLPA 4WK1A 5BJRA 4A8KA 2F8EX 2KDOA 3BO4A 2K2PA 3BREA 1VS3A 2DHSA 2YNGA 4RW6B 4ZHRB 1HMVA 1SBRA 1N0UA 3TNVA 3TO8A 5J2MA 2BQUA 2K3KA 2XMUA 2FJVA 4N56A 4GO7X 1WF2A 4YOEA 2GHVC 1RTDB 3T1YF 1E6VB 2W7AA 4DN0A 1TK5A 5DLFA 2B0GA 3P96A 4DQSA 4UQTA 3GV8B 1HW9A 3T1AA 4OJ1A 5KG0A 5BYRA 4I6YA 5LXYA 3M8PA 2XGPA 4B3RF 3BR9A 4KBIA 2VL1A 1LWFB 1UFWA 2BM1A 2IYIA 2VBZA 3AAWB 3B78A 3BSAA 4KHPF 2U2FA 2EFNA 3N0VA 4CT9A 3BZQA 3MEGB 2E29A 1VK8A 3KLFB 3LALA 2COLA 4OI4A 1TL1B 4R8UA 3I5CA 4M5DA 4DSJA 4YY3F 1HD1A 2YH0A 4ITSA 3TVKA 1N5VA 2MKSA 2FGCA 4FS1A 3H98A 4BWJA 1HQUA 2PA3A 3AA8A 4ED1A 1MROA 4DFKA 2IVYA 3C8YA 4MK7A 2V4QA 5I4MA 2IC3A 4ED5A 4WFAQ 2FPHX 1J5OB 4QR1A 2V9WA 1LFWA 5KT7A 3KHLA 2XMWA 4G1IA 1M90T 2GIQA 4HI2A 2OTJS 4KT0C 2VG5B 1N54B 1ZPVA 4ATNA 5EDWA 2HHUA 4HT7A 2AQ4A 2FGOA 4TYBA 2Z0GA 1M5KC 1RKJA 5KG5A 3QWUA 5M2PA 3UR0A 4IH5A 2HWHA 4QWCA 2P9EA 4PUOB 5CD4H 1QY7A 3J81Y 2ZH5A 1YBAA 3GIIA 2YWEA 4K4UA 2LVWA 5M2RA 1D9AA 1SL2A 1GXUA 1I1GA 3O6QA 2ZC4A 4NCGB 2GIRA 3OBIA 4PCQA 1SIWB 1WG5A 1DLOB 1T03B 3HT3A 1W2BR 1S1WA 1P1LA 3MM6A 5E5NA 4I7FA 4QIFA 4F67A 4F50A 2HHQA 4USJC 2FJXA 4NLOA 2YX1A 5DDRC 5KT3A 5KFYA 2GQCA 1TUVA 3MURP 4UY85 3KHGA 1SC6A 1BGXT 2BW2A 5D4LA 5KT4A 3MCSA 1SH2A 3OUYA 1FDAA 1UMJA 2RU3A 3TAMB 1V3ZA 2MPUA 3I9V9 2A3JA 1X4FA 2DCUB 4ZPVR 3EPIA 1HBNA 1WNEA 2C3UA 2DBBA 2HNZB 2J8AA 2WB4A 2PMHA 4DMZA 2ZBCA 3C6UA 1KTVA 4RW8B 2R9LA 4RWWA 4LFCF 1M5SA 1IBMF 4OL8A 3AB2B 4YDDB 4J9LA 3M1VB 4Y65A 4DOZA 3GILA 4ED2A 2CPDA 3M32A 3ENWA 2B56A 2VUGA 3I9ZA 2F1FA 1U1MA 3JTNA 1HI0P 4ECYA 1NJYA 2RRNA 3K0JA 4RUAA 3DRRA 3PHEA 2RKIB 3SSQA 5DQGA 1CSJA 1VJWA 3VAHA 1BQXA 1S9FA 3HDSA 3LWMA 4FYDA 1U8SA 1NH7A 4LF7F 1RT2A 2W25A 3GR1A 2HHWA 5KFKA 1Q1KA 1FDNA 2BRLA 3CJ4A 3QGIA 3I55S 4ECQA 1D1UA 3H5XA 5J2NA 3FFIB 2Q6CA 2FJWA 3TUJC 3KLGA 4FNHA 4FN5A 2MZTA 2UV8A 2V8DA 2YNIB 3P49B 4K4VA 3UNGC 5IT9Y 2EG1A 3PFOA 3LW5C 4JI6F 2W9BB 5KG2A 4NZ0A 2N3LA 3NNAA 2G9OA 2E5JA 2GGPB 2YY3A 4I69A 3BQ1A 2QZ8A 2W9CB 4ETZA 3NNCA 4EFAC 1NK7A 4MMOA 3GSDA 4NLYA 4QIWD 1YI2S 2VC0A 4OZJA 3IR7B 5K8MA 3M8QB 3ETOA 5BR8F 1RGVA 1U4BA 3M6WA 3MM5A 1TR0A 3MMBA 4B9UA 5KG1A 4G3IA 2PI4A 4QYZJ 3OVAA 5KG7A 2MGZB 2XMKA 4KKOB 5F9NA 1JLFA 3HKZD 1JLEA 1FXLA 2YQ3A 2ZJQQ 4DUYF 1HWKA 1N88A 2OLWA 2ZD1B 5AE2A 4O3QA 5F8GA 3L3CA 2ZBIA 1UEVA 4EO8A 4MIWA 4DS5A 4NX9A 3T9ZA 1X0PA 4ES1A 1ZH5A 4QIVA 3KMSA 1L3SA 3DNCA 4N77A 5D4PA 5D3GB 4CO2A 4YB7A 4BC7A 3BM7A 3O2IA 3CIZA 3UD4P 5GAGU 1RWUA 3NKYA 3OR2B 4HKQA 4H4OB 2Y0SD 5KFGA 4NLPA 4QZVB 3QJPA 3SSRA 3CIMA 4RBVA 2HHTA 3AQPA 5CZXA 3K5PA 5DGBA 3R5BA 1SJ3P 4B17A 4PRFA 1Y3JA 4I67A 2BE2A 2UUAF 4CZCA 1D0EA 3E8OA 1VMBA 1G7CB 5E3CA 2R7WA 4K4WA 3CD6S 4EBCA 5K8PA 1YQHA 3PY8A 3Q2SC 3FJ2A 5J1EB 2V8GA 2AJ1A 2YNHA 2HVHA 4HEA9 4D3HA 1H0HB 2RF2B 4OI3A 5F8LA 1HWLA 1ZAVA 1KQKA 4CO0A 2VV5A 3MUMP 4CNZA 1XNQF 1C0TB 1JLAB 4ZOSA 2HW3A 2FHJA 3I32A 4E8UA 2GV1A 3MI7X 2ROGA 3DXSX 3IN5A 2J6SA 3V6HA 3BF4A 5CZVA 4C7QA 1H7XA 3MTJA 5MLCV 4JOUA 2UXBF 1FXDA 4RW7A 4RNFA 2VFSA 2HMIA 4Q43A 2JEIA 3OL9A 2YNGB 3DU5A 1ZETA 1HMVB 1JJHA 2MSTA 2Z2LA 5IWAF 3DLBA 3KLVA 5J2MB 4EWTA 2EFQA 2M4MA 2M5YA 1NO8A 5D77A 3PKMA 5A8KA 4TN2A 4B3OA 2ADBA 2DGTA 2DIVA 4PG8A 3I5AA 4Q45A 4XDDA 1VHFA 2PN6A 4NMLA 3PW5A 3M8PB 4UUWA 2HHVA 1DAXA 3OXLA 5LXRA 2C3OA 1S0OA 3U1LA 2CIMA 3Q22A 2PE8A 3OJSA 4WFXA 3PV8A 3Q0AA 2B4UA 4C98A 1D8YA 3KJVA 2DH8A 2V8HA 2P6TA 4JV1A 1KRPA 5KFBA 2Z8QA 1FRLA 1VRTA 1RTJA 3H4DA 3OR1B 4R8UB 3IA0A 3AHPA 4M5DB 3KHRA 1P27B 1RT4A 3CDEA 3THVA 1LXJA 3US5A 3IC1A 1FE0A 2CQGA 2D41A 1HBOA 4ES2A 1HQUB 1YSJA 5B0BA 1G1XA 1MROB 1ELOA 4X4UA 3TW0A 2CQ1A 3TR5A 4AL6A 1NJXA 4O3RA 2DGQA 4URQU 2IC3B 3I0SA 3GWCA 2C22A 1VBZA 1VBYA 4F4WA 2D3ZA 1UL3A 2DGXA 2GHWA 1S97A 1SJ1A 1N4LA 2ASJA 3T5JA 1A9NB 1Y5LB 2B43A 4MTPA 3H40A 3T6JA 1OWXA 1UEUA 3KK1A 2WBRA 1X4GA 1YJUA 5IZHA 3HM9A 4EZ6A 2LEAA 2C3PA 2DITA 2XI2A 4MK9A 4EGLA 5KT5A 1FHTA 4PWDA 3PEJA 3K8WA 3MF5A 5HMYA 1IKYA 1H2VZ 1FK9A 4NPOA 2E9RX 5IQQA 4DDFA 1TZ0A 3T1HF 1NEEA 5L39A 3M2VA 1S1WB 1WHXA 3MM6B 4NLVA 3U1MA 1Q7YT 4I7FB 1NU4A 1WEYA 4Q0BA 4R0EA 1FEHA 1K73T 1TK0A 4QW9A 4NLSA 2XS2A 1GNKA 2OMOA 2YWFA 3PACA 4Y2KA 3ZZZA 1KONA 3J7YI 5ADZA 2VQFF 3PJWA 3G71S 5CXTA 3LP2A 3O5TB 3JYTA 3OUYB 2JEFA 3CCRS 3KYLA 3DXBA 3DLKA 1K1SA 3KKFA 2Y1JA 2FHJD 3K58A 5AXMA 2PSZA 4WE1A 1HBNB 2WK4A 2DJWA 3VAJA 4LQ9A 2V9KA 1IKXA 1SJ4P 1URNA 1QLNA 4E0DA 4LFAF 2B4OA 1Y5NB 3CEDA 3IXQA 3C6UB 4LT6A 3HHLA 5LMUF 3O3LA 4X65F 4DSIA 2MHNA 2VBXA 3EXYA 3O8WA 2JLEA 4DR5F 4PG6A 1OPZA 4QPTA 2WCXA 1S4FA 3TRGA 1Q78A 1UJ5A 3QGPA 5KFFA 4OHVA 2GW8A 3M32B 4XPEA 2KT3A 3OHBA 2QRRA 1VGYA 4N41A 2J6UA 3CGIA 5F0WA 1IJFB 3BGLA 3ITHA 3CCWA 3DRRB 4IQXA 2LEPA 2FLNA 1R8CA 3HPOA 4EBDA 3MTKA 2BR0A 1RT2B 5F3ZA 2BOPA 3J80Y 3CDWA 5E3PA 5J2NB 4FNIA 4NL5A 3KLGB 4RW4A 1NK0A 2PFFB 2JRSA 2V94A 4ZP8A 3AQOA 4QJVA 1O51A 4UUXA 4ZVFA 3UR3C 4C8YA 1FRHA 2LXIA 1F60B 3MHYA 4KE5A 1FXRA 4Y2IA 2QO3A 1U25A 2XLIA 1FJEB 2W8LA 2RD5C 1KQSR 3B4DA 5KFTA 4XPCA 1D9FA 4LF8F 2P9CA 1TP7A 2NS1B 3DOKA 4AXJA 2GO8A 4FS2A 2J9EA 5KFXA 2B5JA 3RU0A 3NNHA 2BBEA 4DFPA 3MM5B 3MMBB 3M30A 1JLFB 1ZM9A 4K5RA 2VPZB 1JLEB 2FHOB 3FMBA 3K5LA 1FD2A 4NRUA 2XSJA 3OSNA 1S6OA 3MECA 3VF0B 2JEGA 4K5SA 4YMEA 2XMVA 4IYQA 2YKMA 2ZH8A 2VFRA 4OI6A 1WD6A 1PSDA 4FBTA 4LUBA 4O3OA 4A8FA 2J5AA 2E1RA 1UA1A 2A2CA 2I5JA 1DHMA 2IHR1 2K3IA 4FXWA 2C3MA 3JSMB 4NLGA 2CZVC 3EGWB 1JLGA 2CPHA 2LQ5A 2IVFB 2DNQA 2R7VA 3NBPA 2BA9A 4R5PA 3PO4A 2YNFA 1MW7A 2FJDB 2DGVA 4C3KA 3CDAA 1AFIA 1U26A 1FRMA 2DHAA 4OX8A 5E33A 2CVEA 3M9MB 2X51A 4QR0A 2DNRA 3I6PA 3BO2A 2HNDA 2BE2B 3QO9A 2ROEA 1UA0A 3D0HE 1S1TA 3OLAA 4J9NA 3RR8A 2D1CA 3GIJA 1FJGF 3GB0A 4HH0A 3KNAA 2NZ4A 2C3YA 3R5DA 3UD3P 1PC5A 1RA7A 3V6JA 1KVIA 2EK6A 2FC9A 2MJNA 2OPSA 4YR3A 2YNHB 4EZ9A 2BM0A 3HHLD 2VC1A 4CCHA 2M2BA 3MPVA 4DQIA 3HO1A 3G8TA 3I5BA 1D8ZA 1RKIA 2O67A 2OD6A 2JZ5A 2M3DA 1MU2A 2MQLA 1U1OA 1HNXF 4DS4A 3H20A 3GFXA 4B08A 3DU6A 3BDPA 3P6YC 3I0RA 3Q23A 2YKQA 1H7WA 2K1RA 2KH9A 4C8KA 1X4EA 3OFEA 1JXEA 3ISZA 2YWHA 4LSNA 3BN7A 3OL8A 3K5MA 4RW7B 1VQ7S 4MKYA 3X3UA 2R2TA 2HMIB 3E51A 4IRKA 2O5DA 4YB5A 2CVIA 4Q8EA 4YQWA 3DDKA 5A8KB 4B3OB 2AWZA 4I6WA 2E5LF 2OIHA 4JI3F 4LSLA 1YRTA 4TXSA 2R8KA 4YFUA 3WZ0A 4YB1P 2DR7A 4G1QA 4KHRA 1FKOA 4NLDA 4OLOA 2W4DA 3RBDA 1NKBA 5G0RA 4QPXA 4NZ7A 2JLFA 3SSSA 3O1LA 4DHVA 4NLQA 3KJVB 1FVQA 3DC2A 4MKBA 1XMQF 1VC5A 5EN1A 3DCAA 2YH1A 1X4DA 2K7JA 5A6WA 3UI3A 1VRTB 1RTJB 1FE4A 2B6AA 2IM2A 4H4MA 3IS9A 3DLJA 1RT4B 1JWWA 3HVTA 5CYMA 2FJBB 3KK3A 2ZH3A 3MAQA 4AL7A 1Q7LB 2QT7A 1YIJS 2AYEA 2VA3A 1HBOB 4FP9A 2RMLA 4Z37A 3OFGA 4F25A 1MMDA 4OX9F 3THPA 3I0SB 1S99A 3OTEA 3HI9A 4M95A 4Y00A 2FLOA 2IBOA 2IM1A 3HJFA 3CCMS 4FF4A 1B0TA 3CCUS 5E7OB 3T19A 1T3OA 4KB7A 3KK1B 2MDAA 3D1OA 1RT1A 1TKXA 3I4HX 4PPZA 3PR5B 2CPZA 5E3AA 2RQCA 2Y1IA 5C42A 2BYCA 7FD1A 3V4IA