1H0HB

Tungsten containing formate dehydrogenase from desulfovibrio gigas
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
214
Chain Sequence
SKGFFVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADMEDESAIIHDDATGCVLFTPKTKDLEDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKAAYSDAKLCDPDDVRVIFLTAHNPKLYHEYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FORMATE DEHYDROGENASE SUBUNIT ALPHA
total genus 58
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB02
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB01
1BLUA 1FRXA 4OV1A 3IR7B 1Y4ZB 1BD6A 1Y5NB 2WSEC 3OR2A 2V2KA 1FEHA 1H98A 1FRLA 2V4JA 5BYQA 1FTCA 1GTHA 1FCAA 2C3OA 2FJDB 3MMAA 4ID8A 2XSJA 1JB0C 1FXRA 3IR6B 2C3YA 2VKRA 6FD1A 5L8RC 1SIWB 2C3MA 2WSCC 1BWEA 1A6LA 3MMBB 4AYBD 1DAXA 2FJAB 1B0PA 1H7XA 3MM9A 2Y0SD 3MM5A 3MM9B 1BC6A 1FDNA 1SJ1A 1FDAA 1C4CA 1H0HB 1B0TA 1Y5LB 3EUNA 3MMBA 4YDDB 2FJEB 4XDCA 1CLFA 1FRHA 1DURA 1ROFA 2PA8D 3MM6B 1AXQA 1F5CA 4RKUC 1PC4A 1JNZB 1FRKA 1FD2A 1K0TA 1Q16B 3MMAB 1D3WA 1G3OA 1KQGB 2VPYB 2C3UA 2V4JB 2VPXB 1FRIA 1H7WA 3EGWB 2VPWB 1IQZA 4DHVA 3MM7B 5BYSA 2WAQD 2PMZD 5CHCB 1FDDA 1RGVA 1FRJA 2FGOA 2VPZB 2IVFB 3GYXB 4CI0B 7FDRA 1SIZA 3MMCA 1B0VA 4XDDA 2GMHA 3MM7A 1R27B 3OR2B 1F5BA 2FJBB 4L6V3 1GAOA 2WB1D 1F2GA 3IR5B 2FDNA 6FDRA 3EXYA 1IR0A 3C8YA 3MM6A 3MM8A 1XERA 3LW5C 1DFDA 2Z8QA 1FRMA 5E7OB 1FXDA 1GT8A 2UZAA 2ZVSA 1C4AA 2GMJA 1KEKA 3PNIA 1PC5A 1GTEA 1JNRB 7FD1A 4KT0C 1KQFB 1Y5IB 2C42A 1G6BA 1FERA 4XK8C 1WTFA 2XSJB 3MMCB 1BQXA 3OR1A 3OR1B 2WSFC 1FF2A 3MM5B 5FD1A 5BYRA 2C3PA 1HFEL 1FDBA 3MM8B 4OMFG 1VJWA 2PDAA 2O01C 3HKZD 4Y28C 2FD2A 5CH7B
chains in the Genus database with same CATH superfamily
4CO2A 2WVDA 4USHA 3BO3A 1FNXH 4QYZK 3GV7B 3BEGB 3ET6B 3DLKB 4A48A 1LFPA 2MZQA 4PQAA 4Q7AA 3CC2S 3B8HA 2K06A 3C16A 2HPUA 2ZBRA 3FQLA 5I3QA 2MKJA 1J2VA 5IT4A 1WEXA 3JXOA 2HHHJ 2UXCF 1ZPVA 2QIFA 2DO0A 2V4JA 3AQOA 4FXWA 4TXSA 3IXQA 1N5SA 3EPIA 5E3AA 3SCIE 2MXYA 1HQUB 1RHJB 3CE8A 3OJSA 1L3TA 4GKKF 1XQIA 1VQ6S 3A8IA 4B9UA 1RXOB 3HD2A 1LXNA 2XTJP 3RB3A 3IP0A 1WG4A 2DRDA 4M5JA 4CNYA 1M5OC 2C3MA 4DSIA 2WSCC 4HACA 3E2EA 2VBZA 5IFMA 2ILZA 1R8AA 1C0UB 1V3SA 4MIBA 5HVGA 1DTTA 3MUVP 4IYQA 1RT5B 2JX2A 4IH7A 3GONA 1FE4A 2WZ1A 3GSIA 3M2VB 5C24A 3FMBA 1DZ5A 2HVDA 3H0PA 3AA8A 2IJRA 3DRPA 3I5CA 4QIEA 4YR3A 2VODA 4LFBF 3MEGB 3AB4B 3R1LA 1JJHA 2NXUA 3U27A 2W1BA 1FFGB 2QLBB 4OZLA 4O23A 3SEOA 3WDOA 1VQPS 1IBCB 5GAHI 3BR9A 1Z1ZA 1OY9A 3KLIA 4ZLLA 4DV2F 4IQXA 3DHXA 2YWGA 1I6JA 2B9WA 2PA8D 5JXSA 3KLEB 1SJ4P 2DGSA 1SL1A 4B9LA 4DXLA 1IUJA 4ECRA 4LF6F 2JRSA 5DQIA 2OJ3A 2AJFE 4LRCA 1U09A 1EKSA 2FZKB 2ZM6F 4C8MA 4ZLJA 3CCWA 2HFNA 4MMOA 1JKHA 4LF7J 1SUQB 2I9SA 2C3UA 2VG6A 1IBMJ 1R89A 3QYYA 4KHPF 2RAQA 1B99A 1RJJA 2YQ1A 5J1EA 2RHQB 2J5AA 4MKVA 2B8PA 2F3JA 1Q5YA 3SCJE 1X4HA 3VTIA 3PJXA 2YXLA 4P71A 3U1MA 1NCLA 1LV5A 2HG4A 1KS2A 2RRAA 5DDPC 3HFZB 7FDRA 8ATCB 1Q8LA 2EBEA 4X64F 4AT1B 2J7UA 1FK9B 5C42A 3N4WA 4XIUA 3HO1A 1R27B 5D4LA 1N5VA 3W7BA 1SH0A 1VJQA 3HM9A 3HZEA 3BREA 5I4MA 3NG8A 2VB6A 2J7WA 3KUHA 4HACB 1G2EA 3R5JB 1L3KA 3H7HB 5KG6A 1ZPWX 2F4VF 1J5EF 3L09A 2HBRB 2LEPA 2QG9B 3UD3P 2RH3A 1IR0A 2FYXA 2KT3A 2MZTA 2O1PA 3MCMA 2ZE2A 3TA1A 2R2TA 4KHPJ 4RBUA 2I38A 3UCZP 1RWMB 2YKMA 2ZUAA 3GJQB 1PBAA 2OGUA 3ISZA 1U2FA 3SDEB 1M1KT 4PQUB 5HROA 1NBEB 4C6AA 3C2PA 2K2PA 4F0HA 1PBUA 1NPPA 3CMAS 1EQMA 4I7FB 4GC6A 1DTQA 1TL7A 3GB0A 4J9OA 5A76A 4K4UA 1C2PA 2A6MA 4WIIA 3VCDA 4A47A 4G1IA 2ZVIA 1CG2A 4RNHA 5L9XA 4ES2A 2RDDA 1IKYA 4USMA 3OL6A 1S57A 2R8JA 5M2UA 1ZM3A 1XJWB 1UFLA 2DYAA 2HBYB 3BPSP 5ETLA 2XSJB 2M4MA 3RGIA 5C2CA 1EX8A 4CLPA 2ZJRQ 2AGPA 3OV7A 1O5JA 2IC3A 2PSZA 2ABYA 2QV6A 2RRBA 3TJAA 2CIMA 5AE1A 5GAGI 3R97A 1ZTTA 1S0MA 2OH2A 1PYTA 4LFCF 2CPZA 1W2BR 1HWKA 1NDCA 4Y2IA 1U1LA 1SL2A 2YNIA 1RK8A 1X4DA 4OI4A 1P8GA 3SFGA 2KXFA 5GAGU 3V6KA 4IFYB 3PW5A 1EQ0A 1HWIA 2XNQA 1URNA 1NH7A 3BM7A 3B4MA 3GR1A 3V5RA 2KFYA 3JAMU 2LMIA 1HNIB 1TUGB 3LAMA 2ZH6A 2VASA 1X5OA 4F36A 3PHTA 2XYPB 2IM0A 2OP5A 2BJ9A 3P96A 4UQTA 4N8OA 2FLPA 3GIKA 3G82A 3TA0A 2YKQA 4FF2A 4QWBA 9ATCB 1E6VB 4X4NA 3KK1B 2PMWA 4PYAA 3UFCX 4WFZA 4DN9A 4DR5F 3FDSA 4B9TA 4ID8A 3DI6A 1JB0C 1I51B 1QAXA 5EX3A 2RRNA 3EGNA 1N0UA 1GK8A 5HI7A 5HMYA 2ZD1A 3I5AA 4WU3A 3M8WA 3LP0A 3DYAB 1YRTA 5KG0A 5J2QB 1A6LA 2EFOA 2HS0A 2KT5A 3B82A 2HFUA 3A3OB 5KFKA 1RTIA 4UTGA 4JV2A 1OS5A 2L9WA 1EETB 4ER8A 2R42A 2IA0A 1UEKA 3Q8QB 3V6DA 1EJ7L 1QAYA 2DNMA 2CQIA 3MI7X 4Y3CA 4Q43A 2MKHA 3EZ5A 1FDAA 2KN4A 4HH1A 3PIPQ 1AT1B 1FJCA 1FXLA 2XYGB 3GSDA 3CJKB 3OFGA 1DURA 1Y9OA 3ETOA 5IOLA 5KT3A 5F3TA 2J7KA 2AMCB 5LMNF 5EWGA 2AJ2A 3Q86A 1UKUA 2HAIA 2ZOMA 4NA1A 5EX0A 1SBRA 3HFVA 4C8KA 2OMOA 3M2UA 3R3TA 1RT7A 2DT9A 4KKOA 3MCSA 5EWEA 2Z30B 3PJ9A 2BVZA 3TAMB 3DLHA 4AL5A 1T9YA 2KDOA 3NMRA 4X4UA 2N4DA 2IAJB 3GILA 5CHCB 4RNFA 4NXMF 3LWMA 3OSNA 3EXCX 8RUCA 1FRJA 1RKIA 1VRUA 2F63A 3FSXA 3JS9A 4KGXB 4KRWA 2IVFB 3GIJA 4DV4F 4JI2F 4S0MA 4KQZA 2NYHA 4NL5A 3FCHA 4NMXA 3TAMA 5C24B 1N48A 3HHEA 2ATLA 2ZHAA 1N34J 1NHVA 4IR1A 2M2BA 2FJBB 2M5YA 2D41A 2YY3A 3LP2B 1HYSA 3LPEA 3HSJA 2F65A 1HD0A 3K57A 3AD8C 4A8OA 4CDIA 3CMES 5C7PA 4KTQA 1TL5A 2COLA 5D8HB 5AE3A 4IG3A 5D6GA 1Q7LB 2E5IA 2HFSA 3DRRB 4R8UB 4NZ0A 4KHMA 3W63A 3EX7B 2VHGA 1X4BA 2WOMA 3NS7B 4OQJA 3ZFVA 2AEJA 3C14A 2R7RA 3DRPB 1C4AA 3JQMA 4D3HA 2CPHA 3OTCA 1LW0A 4CLTA 3BDEA 3T1AA 3JTPA 3QSIA 2MQLA 2OKQA 3M8YA 3IG1B 5HQLA 4DV1J 4ELTA 1VLOA 2CQHA 3LO3A 2CJAA 4G65A 1N6QA 4O3RA 3IM9A 2XGPA 2L08A 2KG0A 3GR0A 2VG6B 4J37A 1M5PC 2Y1RI 3OR1A 4NXNJ 1RTZA 2MJNA 4GKKJ 2UU9J 2WSFC 1R8CA 2AHOB 5C25B 3LQVA 4L73A 1AA1B 4NZ7A 1KVIA 1RAHB 2GHPA 3M30B 1U6ZA 2V0NA 2BRLA 3G2XA 3H2LA 1YG0A 3QIPA 3PDNA 1Q8BA 2NYIA 5AXNA 4DJBA 3M9NB 1HBMB 3HJFA 4MFBB 1RI7A 1KWMA 2BMBA 3SCKE 1SJ3P 3QO9A 3R2DJ 1JLBA 3QZ8A 2HKEA 3EGZA 1XNRJ 4JYAF 2HZVA 1Q0NA 1S12A 3M2RB 3TRGA 1UCNA 2DXEA 1D09B 2RB7A 1GTHA 2XWXA 2MPUA 3OD2A 2ZBQA 2C2ZB 1WC3A 4NX9A 4NLPA 4YP3A 4LIRA 1YWXA 2BE9B 2ZH2A 4U8YA 4E2FB 1KTQA 2GAGC 2H4YB 4ELVA 4LFAJ 5KOXA 3T1HF 4USVA 1GH8A 5KFBA 1S48A 3BKUA 2QA4S 4K50A 3WX8A 4WKRA 5F0UA 5CABA 2GJIA 1RU1A 5M2PA 3DRSB 4HL9A 1XK8A 3D1OA 4MH8A 4M5MA 2J9EA 1Y3JA 4C2MA 5KFJA 3W5XA 2UVWA 3L9ZA 3Q8VA 5J2MB 3LA0A 2KJWA 3LALA 2JC1A 4DV7F 1HKAA 1H7XA 2FHJA 1FE0A 4KAIA 3UCGA 4PXEA 2DNQA 3W61A 4CO3A 3GJTB 5HROB 4HYKA 3HHLD 4ECQA 1T94A 2Y9HA 1DRZA 2Q3PA 3ISNC 5CD4H 5ETOA 1QM9A 3MPDA 1LOUA 2DH8A 3HZGA 4X65F 4HH0A 2VF3A 3P5TL 3DLGB 4CZCA 4CLWA 2ZH4A 1X31C 3MEEA 1KLMA 3FBBA 1FESA 3G87A 4AFFA 2EI5A 2U2FA 3SZ2A 3GP9A 1S76D 1Q5VA 2OTLS 5CAAA 4HDHA 1N5TA 3ZZOA 4LUBA 4NLXA 1K44A 3T41A 1G3OA 5EHHA 1RTJA 2HHWA 2YX4A 4I0WA 2QMUB 2W7AA 3JSYA 1YVFA 2V9KA 5HL7Q 3K5LA 3AOBA 4J9UE 3BO4A 2RHSB 3NMAA 2QA4G 1G7CB 5E3QA 1WORA 1TAUA 2FLOA 2F4FA 1NZ8A 3GLJA 4QPTA 4DQPA 4OHZA 4NEZA 3RAXA 2B6AB 4RW8B 1SIZA 1UZHA 4DR4J 1MSWD 2GA7A 2OPQB 3I9ZA 1HNZF 4IRDA 1TUVA 4CYUB 1PILA 2CZ4A 2D74B 3UQSA 1OSDA 3VVTA 1RAOA 1NB2A 3I6PA 3CCSS 2V8PA 2IM3A 2YQ0A 2E7XA 1JKHB 3W9JA 3VAHA 2WB1D 3KYLA 4ZP9A 3I32A 1RT6A 4WK3A 1RYRA 1N4LA 2FB0A 4DV6F 6FDRA 4HDGA 2B9YA 1FNOA 1FT8A 1TUWA 3T19A 2KI2A 2OPSA 2V50A 3KLEA 4NRUA 2SXLA 4EZ6A 4JV5F 2LU1A 1XERA 2J9DA 3NCPA 4I56A 2DNRA 4WK1A 3AT1B 2ASJA 2Z8QA 4RW6B 4L74A 1FJ7A 9RUBA 4QIFA 2FVRA 3TW0A 1FXDA 2CNLB 3HVTB 3NGUA 3C6TA 4B9NA 3QWPA 2RU9A 3M32A 1WKKA 2DPIA 5CYJA 2EG2A 2MGZA 4MIWA 4NA3A 2VQEJ 3CCLS 1R0AA 1NDPA 4USJC 4Y2AA 5KAKA 3WC2A 1EAYC 2XZWA 2ROEA 4ED4A 3G96A 2RQMA 4ZVPB 1KQFB 5DGAA 1SJQA 2BE2B 2GCFA 1SUQA 3DOLB 1W25A 1XMQF 1IKXB 3TO8A 2FHOB 4KV8A 2ASLA 4CLYA 1ULRA 1JX4A 3ENAA 4IFVB 4OHXA 1FKPB 1ZTWA 2PDAA 2XZDB 3BF4A 4OYXA 5KFZA 4ECYA 2KVIA 4MTPA 3UN5A 4DR3J 2IRYA 4Z2XA 3GTYX 2LXIA 4ZIVA 1KD1T 2E5HA 1F9FA 5ETPA 4C9DA 3PY8A 2VKZG 3DLEB 4M1KA 3CCVS 3M9OB 3F56A 3NOCA 5GMDA 4ETZA 4DL2A 1SB6A 1LWEA 4WE1A 5IXUA 3OUYB 3E01B 1BMQB 1TL4A 5KG4A 4K59A 3KOAA 3T5LA 1C0UA 4DL5A 1J5OB 5KFDA 4DG1B 2LQ9A 4ILMA 1HW9A 3BGRA 3Q8YA 3RBXA 2UV8G 1RT1B 1JLBB 2ZNYA 3CIMA 2ZH9A 1PSDA 2G0CA 2WK4A 5IWAF 4AXIA 4QWAA 3I55S 3G8SA 5JVHQ 2IRXA 2XCAA 4WWSA 3QPIA 2VV5A 2BQRA 5ETMA 4BDPA 3NL0A 1AFIA 2AF6A 3TUIC 4ATNA 2DNGA 3TP2A 2E7WA 2IRUA 2H48B 2BXJA 2RF2B 4FS1A 1S9EB 4H4MB 2CKWA 1UVNA 1DAXA 3DXBA 4DCPB 1F5AA 3VGSA 4Q0BA 4OZ3A 3A13A 1EETA 1TKZA 1Q7YT 2PI4A 1H74A 3EE3A 2DGTA 1JLEB 2OPPA 2W2QP 4PUOB 2NPFA 1ZAVA 2Y3YA 1N6QB 1LWEB 1A0OB 1IM6A 3D6TB 1VC6A 3ZTQA 4B02A 3VF0B 2HVIA 4KHRA 4JI4J 3CD7A 2H5EA 4J9RA 4D3GA 2JEIA 2FGCA 2GO9A 3LF0A 4Y00A 5JVGQ 3EM1A 1FRIA 1CULA 5ITHA 1IQZA 2FUG9 1RKJA 3D7SB 3ILJA 1FDDA 2RJZA 5B0FA 1RHUB 2Q1LA 4OX9F 3TA2A 4QIGA 4LF7F 5EN1A 3GFZA 5LXYA 3GYXB 3WC0A 4CI0B 1RTHA 5LT5A 4PYDA 4XDDA 1TP7A 3FSYA 1WKJA 3BGRB 2L3MA 3ITHB 3PW4A 2W4CA 2XMTA 1XMQJ 3HK2A 2BJ7A 2NSBA 4OHYA 1PYOB 2B5JA 3G8QA 3MAHA 2C2EA 3I9V9 1M1GA 3K5NA 3N5FA 1CVJA 3UW1A 4LSNA 2HBZB 1N54B 2QA1A 4NYOA 3V4MA 3S01A 3HHLC 2G2ZA 3LUYA 2QC3A 1VC0A 2KFNA 3M1VB 2CWKA 1FHTA 3F44A 3FEYB 2PD1A 2ALYB 3GG0A 1JLGA 1YITS 3POTA 1OY8A 2QLXA 3KJVB 2UXDJ 4ZJLA 4KSEB 4OJGA 1EP4B 2OD6A 3FCVA 1SCJB 2VFTA 5E7OB 3TQ1A 2B3TB 1GT8A 1LEOA 2AP6A 4TVAB 3W65A 5D4OA 2UUTA 3JSRA 1RU2A 2YNGB 1X4EA 1UA1A 3HHNB 5A8KB 3CDUA 1N5QA 3LGHA 3TARA 1TMJA 4EK2A 1SC6A 1UWAA 2FVPA 3DNCA 5AXKA 4NWBA 1Y5IB 4OYOA 2CPJA 2QSFA 2V8GA 4WP3A 5CQGA 3FSIA 4DZ6A 3C6TB 1Q4RA 2NXNA 2ZZTA 4RW8A 2YKNB 1SC3B 1WC0A 2HK3A 3M32B 4ZHRB 2X1FA 4ZMMA 3J7A1 2KH9A 1GX6A 3NLCA 3CD6S 5I42B 1RE1B 4CO5A 1VBYA 4X4SA 2Q79A 2IAJA 1B70B 2VU5A 4OYMA 5IS2A 5HP1A 3D67A 2M8HA 4I1TA 4NI2B 1Q95G 2XG8A 3UNYA 4F4YA 2GC8A 2CPYA 3RB4A 3R5BA 5LSRA 2GMLA 5GAHU 3BH6B 1RT7B 4KKOB 5F9NA 4Q44A 4HI2A 4N77A 1SKSA 2CADA 2LDYA 3KUEA 2VFVA 1TK8A 4DF4A 3IS9A 4FXVA 4LF9J 4DV1F 2R3VA 4JI1F 4NLGA 5KFYA 1T05A 2VA3A 1FTRA 3NRBA 4MYTA 3O1LA 1SKWA 4DR5J 1XEZA 3HP6A 1LWCA 1TK0A 3G82B 1HNVA 3IBWA 5ETQA 4JI5F 2DY9A 2OEMA 3NEKA 4CH1A 1S4FA 4ZLPA 1SL0A 2O67A 5J1NA 2LXUA 3IGNA 1FXRA 5LJ3Y 3QWUA 1ZAWA 2J6TA 4V1Ak 5L8RC 2VONA 1PIEA 3OSPA 3Q2SC 4L72B 2RU3A 2M3DA 4ECVA 4ECZA 1X9MA 2HVHA 1WSVA 5E41A 2UXBJ 1CPZA 5HP1B 5LOQA 3DRSA 4F25A 4M5IA 4LIWA 2NXEA 4DR6J 3E8OA 2MLXA 5CZVA 1WEZA 4AYBD 3X1LB 4FXDA 2Z0GA 3MM9A 1BE4A 4PG5A 4RBTA 1BC6A 4C8LA 1TV6A 1Y0HA 3NY0A 4KGVB 3KLHB 4RU9A 2HBQB 1T02A 1CLFA 1TKTA 1WG1A 1EARA 1IKWA 3EJMA 3M8PB 1V3ZA 2G1HA 4MYUA 4X4PA 4LFAF 2JJ4D 3BYPA 1AXQA 3BBBA 1M0SA 3DLGA 4OZNA 1U1PA 4K4ZA 2BW7A 3BGFA 1R8BA 1HBOB 1S59A 2DCUB 4R0EA 5KFSA 4GKJJ 5KFVA 5I42A 3NGRA 1MMLA 4OHVA 1A7GE 2E44A 2P2CB 2V68A 4WPAA 3C46A 2ZZNA 3CSKA 1RYSA 1EHWA 2V4JB 2F9JA 4TYBA 4USWA 5DQGA 1T03B 4OL8A 1CULB 1H7WA 3IA0A 4KO0A 1DQ9A 1Y7PA 2B9EA 2N3LA 3MM7B 5L9NA 5HANA 4UZBA 1IR2A 1U25A 2GHVC 1PJ5A 1S9GA 2DJWA 4NLRA 1S0OA 3DLKA 2W2PP 1M1HA 4F4AA 2DD8S 2KJVA 3TEHB 1LWFB 1BY9A 3VGUA 2JWNA 1S1WA 3CPWR 2DITA 2CUYA 1RWOB 2E1RA 3M6XA 1O8BA 2HHTA 3AOAA 4HKQA 1JXVA 2K3IA 3GYGA 3S1TA 5HK4A 3TZYA 2R2RA 4JI8J 4PUOA 4CLUA 4DBQA 4B3SJ 1V6HA 4GMKA 2IVYA 1JWWA 1G4CA 2AJ4A 2IMOA 1JJ4A 2XCPA 4GKJF 3FGVA 3BYRA 1C1CA 4LSZB 1WI8A 3FRYA 2XYHB 3R6LB 3MR3A 2CQBA 3PZPA 5J2MA 2C2OB 2PMHA 3QIPB 2YKMB 3MUTP 4CCHA 1YJWS 1M5KC 2MTLA 2CVEA 2R7VA 4JV0A 4PPZA 1ZA1B 3JQKA 2H51B 2PIIA 4O0IA 2R2SA 1TKXA 3RBZA 2WBMA 1VRTA 2HWHA 2ZVSA 4HT7A 4I6AA 5D4NA 3DDKA 5L38A 4A8QA 3ENWA 2HVEA 1WHXA 2MMYA 1FWLA 2VC0A 1WF0A 1ZM2A 1Y00A 3W64A 2RUGA 2OIHA 2FC9A 1DHMA 1ZM4A 2OUGA 3NBPA 2G2YA 1FERA 4OI2A 3RZAA 3SBMA 4DZDA 3KK3A 2AX0A 3CNQP 1JK9B 5HVFA 3CJRA 3U02A 4DSJA 1F0XA 1MN9A 2FLNA 4Q0BB 3CXCR 4W92B 4WTOB 2V69A 3UN2A 3K58A 1LK7A 2QTWA 4EFAC 4UY85 1RA6A 3FEZA 3MECA 3OQ2A 5E33A 5CD4A 4OX9J 1UVMA 2AIRB 3UN3A 4U7UD 3M2UB 4UT4A 1JLCA 1SVDA 1PYSB 2LP4A 5CH7B 3U7JA 6AT1B 4Z37A 2BJ8A 2DHHA 4L75A 4USIA 3V6HA 2IBOA 1W7WA 2QX0A 2YBVA 4LRAA 4F7VA 4WFXA 3MR2A 2N7YA 1NK5A 1B7YB 1ZETA 1L3VA 2VFSA 3OR2A 4CTAA 1XNQJ 1WOOA 3LP2A 3QAUA 1U1KA 1JXLA 2VIHA 5C5JA 4NPOA 1YJ7A 3EGVA 1OO0B 1APSA 3MPUB 3ILIA 3P3DA 3SSRA 2K7JA 1U0HA 3C19A 3SQOP 3MEKA 1YBUA 2ZC4A 4F2RA 4M94A 3MEGA 1SIWB 4LR7A 1UEVA 3PJWA 2DGOA 5KFLA 2MZJA 3KK3B 3TUJC 1TTHB 4R8UA 4RW6A 5IC6B 2RNEA 5I3UB 5KFNA 4DV7J 1NLKL 5KG1A 2KXNB 4ES3A 2DTJA 2GVDB 5MAOA 3PW7A 3NXZA 2DR8A 4HT5A 2FVQA 1R3NA 2CQDA 4OZ2A 3BQ0A 4F02A 1S1TA 1KP6A 2DHAA 1KFDA 4LR9A 4M5NA 2DBBA 3BPDA 4FPIA 1NUEA 1TL3A 2GJFA 5E3RA 4YHHF 1HHQA 4KB7A 4NXMJ 1HQUA 1X5SA 3CJ0A 3SSSA 4C48A 4EBEA 2Y1IA 3TVKA 4M5DB 3THPA 1B3TA 1ROFA 4DV4J 4DL3A 4HHHA 4LR8A 2LFVA 4QIWD 1F5CA 3NGKA 4C3LA 1FKAF 4YY3J 2KT2A 1KBRA 4C3KA 4DR2F 1VBZA 3PW0A 2DGWA 3BKFA 4J9SA 3AH6A 1ZA2B 1VQ7S 4JI7F 4AXJA 4C0HA 3ZZTA 3V81B 1V9OA 1QUVA 2CQCA 5B0AA 1WNEA 5LSOA 2F40A 3I0RB 1NKBA 2XB2D 1CJKA 3RUBL 4O3QA 3RJMB 5KOWA 3HSDA 2VC1A 1KKHA 1S4EA 3NAHA 2OEKA 1YJNS 3QFHA 2DNYA 3ZZUA 4Q8EA 2ZJPQ 2VJVA 1GX5A 1UW9A 3H59A 2G9OA 2ILYA 4KPCA 3J7YI 4XPEA 2EFGA 1SKRA 5KFPA 3NP5A 1VIXA 2B4UA 5DO2A 4G6VB 4CH7A 2UP1A 2ZBPA 3MM7A 3Q8PB 1U1OA 1UFWA 4DUYJ 4WJBA 2KZMA 2YWHA 5JMNA 3CDWA 3HD1A 5KFWA 4RW9A 2A2DA 3EWGA 1D8YA 2I2YA 3D9BA 5HATA 1MLAA 1UJ5A 1NPRA 1BQMA 2BX6A 2OO4A 1OQ6A 4URGA 2RKIA 4HHUA 2XHCA 4MAKA 5ETNA 5CYQB 3ADAC 1RT4A 1HLWA 4I2QA 3WZ0A 1DFDA 4RBVA 3TX0A 4DV2J 4BWMA 1YZ6A 3PW2A 4K4XA 4CWBA 3KLHA 1RWKB 3I87A 2YPZA 1HNXF 2D9OA 4QCLA 1SJFA 4K2JA 2X7IA 3E3XA 1WF1A 2FC8A 2H5JB 3DDIA 2YNFA 1UAWA 3QLHA 3CJSA 4G1QA 4NLYA 3SSQA 5A2QU 1PC5A 1KLNA 2D9PA 3QT7A 2XY5A 2I8EA 1HPZB 1MWYA 3RAMA 2C42A 3FFIA 5F9LA 5J2PA 4U96A 1N88A 2QRRA 3J80Y 4FBTA 2XMUA 3VAMA 2R7UA 3UVJA 2GVZB 1RHRB 3K7RA 3H4BA 3TVZA 1H2UX 1MW7A 3D28A 4DOZA 2Z58B 4DWIA 4X64J 2RQCA 2CG4A 1FDBA 2E5GA 5EWFA 2A0FB 1NM2A 3PYGA 4KFBA 2N4CA 1N5YB 2AD9A 5A0YA 3QGHA 4FNHA 4H4KA 5HMZA 1AUSL 1BLUA 4OJ1A 5JJBA 1ZS6A 3N9UC 2LEBA 1FJGF 2HS4A 3OTEA 3MD3A 3MEDB 1NEEA 2DH9A 3D0GE 3IR7B 4I2PA 4RW7A 5G4DA 3BSCA 3TJ8A 1J27A 4JI8F 2WSEC 4YY3F 1FVSA 3WIVA 2CQGA 2EC0A 2DH7A 2HWIA 3M2RA 3KJVA 3OL7A 3A8KA 1QLNA 1FTCA 5LM7E 1LW0B 4IOCQ 2HFOA 2H54B 3AXMA 3CULA 1QTNB 3AD9C 4MFBA 3OLAA 3C14B 4OX7A 5IC4B 5H9EK 3OW2R 1NPKA 4X65J 3OVAA 4GRSA 4DV0J 2QFIA 4RL1A 2CNNB 3LP1A 3RG6A 1HQ2A 3DC2A 3H2UB 3AA9A 2RQKA 1S6QB 1FD8A 5DZ7A 3DXSX 4UQGA 3S7RA 3MAAA 5DETA 1KOOA 3KHGA 1GXUA 5K8PA 2MSTA 4DR7F 3ICLA 3TANA 2F5GA 1SJ1A 3VQTA 3UR0A 1EP4A 4CO1A 3J7Z5 2NZ4A 4LF4J 2Q66A 2C28A 3QT8A 2JNJA 4XDCA 3MTJA 1WD6A 2AJ0A 2GQ2A 4J9VA 3HKWA 3GWCA 4UOGA 4A8FA 2XWYA 1HBNB 4J9LA 4A8YA 1FRKA 3H2VE 4J9PA 2A6OA 1QVFR 2GIRA 4LSNB 5L1IA 4YR0A 2D3O1 3SV4A 2RS2A 4MT1A 3M2VA 2ROGA 4J5OA 4K7QA 3AD7C 2YH1A 5SUHA 5AE2A 1YQHA 1GMUA 3IWXA 3ITHA 3KG4A 4DX8H 5ETRA 5DJBA 4CLFA 2M0GB 2XMMA 4O44B 4YOEA 4PCQA 3ZC4A 1SI9A 2D7SA 4YEAA 3JSBA 1IBMF 1TKZB 3W2VB 5GMKa 2J8AA 1N5YA 2PA3A 3HVWA 4FP9A 3G8TA 2CJBA 2GX8A 3HSZA 1H2TZ 4O0NA 1M5SA 3TX8A 2HQ3A 5B7WA 2DGUA 2DHGA 1CJVA 1KHWA 2EXUA 3MECB 1CJVB 4NLTA 4CM2A 5KFAA 1ZBTA 4ZPBA 2QLWA 1RWPB 1GXTA 2C2NA 2EW9A 1N36F 2V94A 3CDAA 2OD4A 4FKYA 3IR5B 3CCQS 3ZZPA 2VJUA 1NSPA 1RWVB 1VQLS 1DLOA 2FDNA 4PWDA 1R6VA 3D5MA 3CO0P 1S10A 2W4DA 2BJ1A 1RA7A 4CO4A 2BR0A 4QYZJ 1N52B 1RHQB 4W90B 2HGMA 3AJDA 1WWHA 3Q8RB 1X0FA 3Q24A 4P6QA 4RJVA 3P6YC 4QOTA 3J7YU 1R6YA 3UE2A 4K4VA 2C2DA 1D1UA 4B3SF 1U02A 4PKDB 4DR3F 3ZTSA 1UZDA 4I69A 1HBNA 2LA4A 4OJ3A 4RLEA 3KLFB 3F41A 3KNGA 1T9WA 2ADCA 5HLFB 1S0NA 3Q2TC 2GHWA 3M30A 4IOBA 4NE9C 3C16B 5F0WA 2NPIA 3W9IA 4DN0A 1AW0A 2NREA 4ZOSA 3PX4A 2O3DA 2VQFJ 3A8JA 3L7UA 3UO0A 1K73T 2F4VJ 2DCLA 1HBOA 3D54A 5KT6A 4JI2J 4O44A 3C3LA 1MMDA 4HI1A 4P2MA 4ZPAA 3HCXA 4DX6A 2KM8C 1S1XB 1YDLA 3H5YA 4DSEA 1NK8A 4HTIA 2ACYA 3V6DB 2O01C 3RBEA 2H5IB 2KYZA 1NJIT 5ETVA 1M5VC 2JEGA 1RWUA 4JI3F 3C8YA 2BEFA 3ZZYA 3KJQB 4ILLA 2W9BB 2ZJQQ 1UA0A 5F8JA 1X5TA 3H40A 4F2SA 3CCRS 4Y65A 2DR9A 4DUTA 2B51A 2HNDB 2VD3A 3RU0A 1Y4ZB 2R7WA 1H3DA 1CQMA 2W2NP 2AEMA 1VK8A 2EKNA 3D6FB 5D3GA 3W66A 2ZH7A 4J9QA 4DR1J 2XMVA 3J7AN 4IRKA 1TMMA 2GGPA 2KRBA 4OYBA 1S7HA 5IM0B 4EZ9A 4L76A 1WKLA 4WYLA 4C8OA 1W2IA 1SC4B 2XI3A 3DGVA 4OIXA 2VKRA 3L3CA 2BE2A 3QGGA 3QQCD 5DRKA 1Q8IA 2YNIB 3OFEA 4ID5A 3HHKA 2G2OA 3H5UA 1QSSA 1IVZA 1F3FA 1XMBA 1VI7A 1MG7A 4UW2A 3MAQA 3VGVA 1J5OA 1BWEA 5AJ3F 4DFKA 1RAGB 3I4HX 3PHEA 2XLIA 2B4PA 4OLPA 2YNGA 1XNQF 3DMJA 2V6AA 5K9FA 1L3UA 4PG4A 4DPOA 2XO6A 3KK2A 2HRUA 1HHTP 3CCUS 3MM9B 4JI4F 3VHQA 3IS9B 3KMSA 1VMBA 1NSAA 3R27A 4KH0B 4WBFA 5LMUF 5T7LA 1FVQA 3W5YA 3CUNA 3FFIB 5DZ6A 2ASYA 2JH3A 1XTZA 5HJXA 2IPOB 2CDQA 3VZIA 2F7VA 1T9UA 3MPVA 1V5IB 4LF2A 2DY1A 3RB6A 4DV3J 1Q8KA 1AFJA 4KY3A 4PR6A 2ALZA 1PC4A 1QY7A 1T7PA 2BKPA 3A1YG 2JLGA 4OHWA 5KT2A 4GVLA 5IV4A 3V4IA 3PV8A 3T1YJ 1OPZA 5KFFA 1KQGB 1IXKA 3MDFA 1S99A 3J81Y 3BSNA 2LVWA 2Z57B 4V19J 4KFBB 4XPCA 1BQNB 3NCRA 4DHVA 1R7IA 3NKYA 3S6EA 2OLWA 2CNKB 3TR5A 3KLGA 3HVRA 2LECA 4YB6A 1YJTA 2FZGB 4UY8T 1MNEA 2BE7D 5H1SV 2MEWA 4NASA 2Z4PA 3DFEA 4DFJA 3DOKB 2MHNA 5T41A 2M8DB 1VFJA 3PTWA 2F9DA 4C11A 3KLIB 4CH0S 1BHNA 2HQGA 4CRJA 5J1PA 1RTJB 2BABA 2OHDA 4RO0A 1Q53A 3O8WA 4WCEQ 1RQ0A 1YI2S 2A2CA 3TVYA 2NZCA 4LF1A 2OPRB 4PG7A 4CT8A 1UVLA 2DVIA 3EXYA 1T3NA 3ULHA 4DV5F 1RAFB 2XY7A 4O4RA 2DO4A 2KYXA 2UUWA 2JDJA 1VLYA 1QVGR 3R2CJ 3PYFA 1N33J 3EZUA 4I2QB 3OVBA 3OJUA 2D69A 2V67A 1SV5B 2XI2A 2OI2A 1HBUB 3OHAA 4EEYA 1UPMB 2JLFA 3VAJA 5FJ4A 4DR1F 1WJ9A 3FZ2A 3QZ7A 4F3QA 4KIAA 3K5PA 3O2IA 2ZKUA 3QJJA 1KEKA 1LXJA 4DU7A 3JSMB 2AZ1A 2JFDA 4EBCA 4OYAA 1JLGB 3KLFA 2V63A 2DK2A 2DGVA 1GTEA 1NHUA 5HLFA 2HEKA 5J2NA 2HHQA 1RACB 3DLBA 3BZQA 1WTBA 1G6BA 2EBGA 4I68A 1U47A 5CZXA 2HZCA 1ITPA 1HNWF 4B3RJ 4GC7A 1XC9A 2IC3B 1U2CA 2AJ1A 1R0CB 2DKOB 3OR1B 5C2GA 1KRPA 2QMXA 3MWBA 5A6PA 2QEXS 4DL0C 2C3PA 2E5LJ 3M8QA 2KXHA 1VBXA 1VC5A 1YGYA 1DQ8A 1T95A 1ZH5A 2HIQA 4YB7A 1HWLA 2JLEA 1N33F 2DEIA 4DLGA 4PWDB 4DPYA 3FBFA 4L3KA 4ZVSB 3Q0AA 2DISA 2OSRA 3K89A 1HBMA 1NXIA 4ZP8A 2WOMB 4OV1A 3UPFA 2CDRB 4TNOA 4ZK7M 1TAQA 1RDRA 2EK1A 3BN7A 3KMQA 2BM0A 2FHJD 4K4SA 1JLAA 1WHVA 3BR8A 5K5MA 3MR5A 5KFIA 3GIIA 1OMSA 1HWUA 1RWXB 1S97A 4PQUA 4JV5J 2KG1A 1B4SA 3N6LA 1VHIA 2CNOB 1P9QC 1U1RA 4FPRA 2BW2A 1FX2A 1O51A 2B43A 4P75A 1F2HA 4PWUA 5HSPA 4DSKA 3RB0A 3QT6A 2IHR1 5K20B 4IH6A 3TZWA 2VG7B 1NZAA 5THWA 2W7PA 3BSAA 2EEYA 5AXLA 3ZNUA 3CF5Q 2PI5A 2BJ3A 4DL4A 4DPXA 1XR7A 2AU0A 3KJFB 1U48A 4ED8A 5FLXU 3NGSA 3BH7B 2CJKA 4IUFA 4FDFA 2ATCB 2VUGA 3EZOA 1VQOS 1S1UB 4NMLA 1VQNS 2MKCA 2ZOGA 1U0SA 4TLRA 4Z7YA 1KDNA 2GQQA 5HN0A 4TN2A 2L48A 2DRBA 3PVXA 3LH2S 4OYIA 4P2SA 2BANA 4BC7A 3CDEA 5C25A 2MQOA 4FVMA 2BYCA 3MMAB 4RNMA 4C8ZA 5ETTA 1VQ4S 2HSEB 1N32F 2VPYB 4XAKA 1OJ4A 2K8GA 2WBRA 4NLUA 2NUHA 2MQ8A 2QJ3A 3IWNC 3UCUP 4NZ6A 1BQNA 4P7VA 4W4MA 5DDQC 3SI8A 2EFVA 3SMZA 2HQCA 1WELA 1C0TB 1REVA 2Z2LA 3KKFA 4NLVA 4B9MA 4IDKB 3KLVA 1KN6A 3M6VA 4B3OB 1RLCL 3BBCA 2X1BA 3A12A 3PR5B 3SV3A 1CS4A 4LSLA 2ZUGA 2K7KA 3KDNA 5A6WA 4X4RA 3PKYA 1NSKL 1B0VA 4L3NA 4F0MA 2GJ2A 5B0DA 3GCXP 3JYTA 1M90T 2Z2ZA 1NJWA 1URRA 4DCJB 4ZVOB 2BUNA 3IAM9 3HT3A 5IT9Y 2GAHC 1QE1B 2XMKA 4OZ1A 2KFZA 2VDIA 3DU5A 1JLFA 2YX7A 1NSQA 2HVZA 4YN3B 4KPYA 2ZDOA 1UMJA 5K8OA 2GIFA 1D8ZA 3J7ZT 5FDLA 1PGZA 4N8NA 4QIVA 3CJ3A 3VAGA 4K4YA 1XBWA 2QYCA 1N8RT 1QAJA 4DV6J 2IA6A 3NNAA 1CJTA 2EG1A 4P10A 5D0HA 5HMWA 4ED6A 2I5JA 4B3MJ 4B9VA 1XN9A 1UVKA 1EB0A 3PO5A 3KHLA 2HHSA 3MOJB 1QAIA 2MZ1A 1VRUB 1JMTA 2RE1A 4F3MA 5HBMB 3PNIA 5E3CA 5HQ8A 4WFAQ 2HURA 4QR1A 4B08A 4DU8A 3G6VA 2ZH1A 1VHFA 3ENVA 3QJLA 3LP0B 4FKXA 5J2QA 2UUBJ 4RR5A 3MR6A 3MHYA 1CC7A 1IKWB 1K8AT 1F1BB 3R1HA 4TY8B 5CXTA 2H65B 1S1WB 1MWZA 1YTYA 3GQCA 2RILA 4O3NA 5DG7A 4C98A 5KTQA 1VQMS 1S9GB 4P2XA 5ADZA 1RT4B 1TL1B 1VJWA 1I1GA 2IDLA 3A3PB 2QT7A 2XNRA 4A8WA 4I67A 2EC2A 2MYFA 1YX2A 4F50A 1IJEB 2OPQA 1DARA 3AOCA 4P2FA 5EUHA 2JHEA 3GG1A 5AJ3J 1NK0A 4PG6A 1S9FA 2HNYA 1HMVB 1U6BA 3BO2A 1NK6A 2IM1A 4N7TA 2KHCA 1IWGA 2AX1A 2RIJA 3I56S 1B7FA 2EFNA 2VDHA 2UUCJ 1Q86T 3FEXB 1H98A 5D3GB 4K0KJ 4GO5X 2J9DE 4K8RA 5A8RA 3OL9A 1RAIB 2G0IA 1TU0B 1UFKA 1KHVA 2JSXA 5DDRC 3CJ2A 3PRVA 1D9DA 2C3YA 2OEJA 3BN4A 3SFUA 2X1GA 1VRQC 2AT1B 1CJKB 3CT9A 3IAS9 4ENOA 4DFMA 3B6BA 5A8RB 1UEUA 3ILLA 3HT0A 3V81A 1WHYA 2KO1A 2W4PA 2CWXA 3Q23A 1U4BA 2CZVC 1HA1A 5F8IA 2OFHX 1VISA 3I5BA 1TKDA 3P5BP 1LKZA 5FLXY 2XO7A 4DSFA 3TI0A 1SQFA 2KU7A 4IDKA 4LF6J 1ZZNA 2CPIA 2K1RB 2DIVA 2EKYA 3IN5A 1MU2A 2OMLA 3UNGC 4QW9A 3H4DA 5J1EB 4O3SA 4ALZA 1RCOB 2R8KA 4ECTA 4ZPWR 3D6MB 3VR1A 2HMIA 4CLZA 2AYGA 3EDRB 3MXHP 3LANA 1H72C 1OYDA 2MSSA 2ZITA 4WKYA 5DG9A 2MKIA 4TY8A 4YDXA 3VAFA 4JI1J 4ZPVR 4U9RA 3POTB 4Q45A 5C42B 3TAPA 1OWXA 1E6YB 2VG5B 3OXLA 1AUDA 1NDLA 3QO9B 3RAQA 1LQ9A 2CQ0A 2HHVA 1DTQB 1TL7B 5B08A 1UJ4A 3HLUA 3B54A 2R8HA 2LU2A 2DNZA 4P74A 1WC1A 2FIUA 5G0RB 4IKAA 4DR6F 1CJTB 3H25A 3I31A 2IMWP 4LREA 3P45B 3TEGA 4DR4F 3JQJA 1NNDA 3OR2B 3Q8UA 5IT9U 1F5BA 4OYZA 4MK9A 5BXIA 3C15A 4Y2MA 2I6WA 1X9SA 1S5ZA 1F2GA 3X3UA 3AJ1A 5KFMA 2PE8A 1X4FA 4QQBA 2JZ5A 2BANB 2WVBA 3FCWA 1HW8A 1UWBB 1CBKA 4C8NA 4CLKA 3OXFA 3TOQA 2QO3A 1VDHA 3H5SA 3MM8A 5D78A 2LDIA 4CLLA 4YUDA 1JQGA 4Q8FA 2E5LF 4R0JA 1YJUA 2LQ5A 3PG9A 1RLDA 3HVAA 2KHDA 1GXLA 3LP1B 1LWXA 4U95A 3BGUA 5KFTA 5KT4A 1FK9A 2F1FA 3FQKA 3NGTA 2NXJA 4DEZA 2QLJB 3ET6A 2C2MB 4PXBA 2P9CA 4WTYA 4X84A 3GMGA 1XR6A 4B3OA 2UXCJ 2MZSA 4PXDA 1RT2B 1XWLA 2PEHA 3I0SB 5HO4A 2F8EX 1C0TA 1REVB 3H98A 4QU6A 2VQFF 3L95X 3CJTA 4LVNP 4NLWA 2VZ9A 3OTOJ 4ITSA 3OTBA 3GFXA 4M95A 2R4FA 1UPPA 3L7PA 3DI6B 2Z2MA 3MMCB 1GEHA 1VYAA 4LFCJ 4R5PB 2MKKA 4TLQA 4Y34A 3K0JA 3MM5B 2APOA 4WZQA 3BGLA 1LW2A 3OL8A 3LAKA 3AAWB 2FJVA 1JLAB 3PRBA 1NDKA 4LF5F 4F26A 3F0NA 1X5PA 3ILOA 3ETMA 4DS5A 3MR7A 4FYVB 2CPXA 2HNYB 2J0WA 3MD1A 2YWEA 3PACA 1VCTA 3RRKA 3UDVA 4CM0A 2CQ2A 2C1EB 2VG5A 2Q43A 3MURP 1MROA 2IYIA 4NLSA 1WDTA 1WDDA 1OIAA 4BHQA 1YRXA 4DPWA 2YWFA 3V6JA 2YNFB 1I94F 2J6SA 2WVFA 4GVBB 4WXWA 2CQ3A 3OVSA 2BDPA 3DLLQ 1C1BA 1RT3B 2MJUA 4LVOP 4NLQA 2WVCA 5IV3A 4YFUA 4AL6A 1RADB 2VBWA 2XSJA 3LOUA 2LYVA 1SQGA 3K8WA 1HR0J 2PT0A 1Q79A 4M8LA 1T9XA 3CIZA 5IQ6A 2J0QD 4CLSA 3BS9A 5J2NB 3ZZRA 2R7XA 4PEOA 3CCES 4EBDA 1BUXA 2QLFB 4M5LA 3CJKA 4A8MP 3D3CJ 4I7FA 4IFVA 1K9MT 2GVZA 2FJAB 4C4WA 3EICA 4J90A 4KV8B 1REGX 4P73A 2WTFA 3N28A 2W8KA 1HBUA 2ZM6J 3EUNA 5DGBA 2JEFA 2NCKL 1YKWA 3CEDA 2CJQA 4Q2LA 3OUYA 3QLHB 3J81U 1U1MA 1R0BG 1HQEB 3Q89A 4ZVUB 2XM3A 2XLKA 1T0TV 4JI5J 3HDSA 4DF8A 2AGOA 4WYWA 3IC1A 3V4IB 1BGXT 1LWFA 4CT9A 3HVTA 4F4WA 5KFHA 2W25A 4LMZA 1SQEA 5RUBA 1HR0F 2KRRA 1D9FA 2FY8A 2VPXB 3N5BA 2W8LA 1U1NA 2VPWB 3JYTB 4KO0B 5F8HA 2A1BA 1R8HA 3JB9k 3BGOP 2PFFB 3N79A 3W8PA 4Q5VA 4F04B 1X4GA 2VPZB 1WC5A 3WIUA 2QYGA 4NYZA 4ZPCA 2RVJA 4A46A 3DN9A 4DCOB 3DOMA 3DOLA 5GADU 1FNMA 2CVIA 1N34F 4NCAA 1HNVB 2M70A 1IM4A 2GMHA 1PAEX 4K4WA 2G4BA 5EGYA 2CG8A 2BZ2A 1KR4A 3NCQA 5F8MA 3ZTPA 3HI9A 2UVVA 5L39A 1IBLJ 3CD0A 2LCWA 2WHOA 2HQIA 2V2QA 3N6NA 2XMAA 1WACA 4EI2A 1RBOB 2BM1A 4ZPTR 4DQRA 3T9NA 4AQYF 2E9RX 4MKAA 3OFFA 1SH2A 2GS8A 4ZITA 2POKA 4ZS6A 1GMWA 4BBYA 1LK5A 3FZBA 2PFDA 4HVZA 2B8QA 4FYYB 1AB8A 2CRLA 2D1CA 2UXDF 2I5JB 4WU2A 4OX6A 1RHMB 2M52A 2XS5A 3DMJB 5T14A 4JI3J 4M5GA 1DBDA 1HQEA 4OLOA 2YKOA 3I82A 3BQ1A 2XSFA 4ECXA 4DL7A 2MY8A 3QNWB 1P9YA 2E1PA 2XEXA 4IH5A 2HK2A 4DR7J 4URQU 1NJXA 1FFSB 3H5XA 1NHKL 2HNZB 4LF4F 1U8SA 2E9ZA 2FHKA 3VZHA 5KG3A 3ISND 1IBKJ 2OSQA 1S72S 1F6TA 1T9TA 1QSLA 4P9SA 2JVRA 2LXFA 2E5JA 3GPAA 4KBIA 1JLQB 2V8VA 4PPDA 2RS8A 2XS2A 2AYBA 3C6UB 3HKZD 1D0EA 1RWWB 3OXGA 1QTMA 2GW8A 1RHKB 2NLWA 2V8HA 3BV8A 4TQRA 3NBPB 1NB7A 2V2KA 4ZVGA 4F3OA 1Y10A 1QSYA 2RMLA 4PZVA 7AT1B 1KFSA 3OLBA 5H9FJ 3KWMA 3PM9A 4EU0A 5U47A 1L3SA 1HNXJ 1PKUA 1HI1A 3K5OA 4WZMA 1M5HA 1RBAA 2IDEA 2HFZA 2ZBIA 3LTOA 2KKHA 3VGTA 1IQTA 6FD1A 3D1QA 1ZAXA 4BLGA 5KFOA 3P49B 2QE5A 3MGJA 4X66J 2VBYA 5LMUJ 3NAIA 3BQ2A 2JFKA 3DDNA 4DI6A 2ASDA 2K1RA 3IBFB 1GMWD 1OY6A 4XTTA 1UL3A 4ZA1A 3DM2A 3T5KA 2IVMA 1IJFB 2A3JA 1X4AA 4IOAQ 4QU7A 2QSWA 2Y0SD 2IJNA 2AEFA 1VS3A 2Z56B 3GU0A 3MM5A 4TY9A 2HAFA 3PR4A 4ZVQB 1HWJA 2GNKA 4DG1A 1C4CA 1OSCA 2XY6A 4U7UK 3EDQB 4J7CA 2BV3A 3MCNA 2G13A 3DRYA 3AODA 2BQ3A 1NK9A 2FVSA 4X4VA 1EIYB 4DS4A 3M4XA 1YK9A 2B7CB 2OPRA 4IR9A 4CNZA 3PIOQ 4B9SA 4I6WA 4RUHA 3MPYA 4DUZJ 2EFPA 2QFJA 3C6UA 2CQ4A 4LBHA 2HYIB 4NLDA 4RUCA 4J9MA 1F9EB 4RWWA 4X66F 2ZEJA 3TAQA 3HJVA 2DR7A 2P6SA 2P5VA 4LRFA 5KFCA 3OBIA 1FX4A 1WG5A 1P1TA 3K2YA 5KT7A 2FGOA 3CGIA 4B3TJ 1CEZA 4LBPA 2UVUA 2B7BB 3US5A 5A8WA 3MMCA 3QFWA 2ZWOA 2FHMA 2BJDA 1I94J 4JB8B 1WOPA 4JI0F 3DRXA 3GFHA 4ANCA 2W9CB 1NJYA 4CO0A 2F8MA 1TKTB 2XMWA 3VAKA 2QN6B 4PG8A 4NCBA 4JOUA 2GV1A 4RUAA 2A18A 4DQIA 1TV6B 3LWLA 5DG8A 1NH8A 3IMQJ 3J81j 1K47A 5BJRA 4DR2J 1DLOB 2HHPA 1WC4A 2W2OP 3QAEA 4AD6A 2DNNA 2XBPA 2ACMA 2CYYA 2M9KA 3MMJA 1S9EA 5B0GA 1FKPA 1P6TA 4C11B 1VBKA 3H20A 1HNWJ 3RYLA 1RTDB 2E66A 3MCOA 2X3DA 4FYXB 4ED7A 5GVQA 3TJ9A 5A2QY 3D4JA 5GADI 4RW7B 3R7SB 4AUKA 4DFPA 2CPFA 1VQYA 3KTQA 4M5KA 3GFYA 2MQQA 4NA2A 4QWCA 2AYEA 2Q6CA 2R7QA 2C2RA 4J9KA 3O3LA 3FBEA 1NMEB 3W5ZA 2J8SA 4TU8A 2QZ8A 4I64A 4JI0J 2W7OA 4KGMA 4LJMA 2R9LA 4K4TA 1RSCA 3F73A 1GMVA 3OTDA 4ZCLA 3HULA 4JI6F 1T05B 1NRKA 2V2ZA 2ZKTA 2GFFA 4I6YA 3NNCA 5HQMA 2EK6A 5BR8F 3UVJB 1QE1A 2ADBA 1U8WA 2HGNA 2GGPB 2DHSA 2YH0A 3FUYA 2DGQA 2Y0BB 2XGQA 2YPYA 1PAUB 3UDCA 1E6YA 1SJRA 4QWEA 2QA2A 2R7TA 1BWVA 5D77A 1RBLA 2MY7A 5KFQA 4LF8F 4DL6A 1OYEA 3DCAA 2FD2A 2NS1B 1A9NB 3T1YF 2VBXA 4FVCA 2YKPA 3FJ2A 4UOCA 3OTOF 3IRWP 3G4SS 5F8LA 2F8HA 3VAIA 3ZO7A 4WF9Q 4KGKA 3EVWA 1Y5NB 3PYDA 2CAJA 3QT5A 4YQWA 1KLMB 1U26A 2IJFA 2ZHOA 3P4UB 4ZCIA 4KC5A 5IZHA 3OFHA 5BYQA 3QGIA 3GV5B 4X2BA 1S6QA 4P72A 2PEBA 2C3OA 2FJDB 2RKIB 3FKBA 3N6MA 4ED3A 3K8VA 3MMAA 4U6PA 3QIDA 4OI0A 5DLFA 2XS7A 4J91A 4BC9A 2R8IA 1S6UA 2IM2A 2PN6A 3IRXB 1T8EA 2L9DA 4ZKAA 4ANDA 3R8YA 4IFYA 1RUSA 1YSJA 2WRMA 4ZVFA 1MWQA 2RD5C 1YJ9S 1OPIA 5HVHA 3M1VA 3KXDA 4IO9Q 2E1AA 3T6BA 2OPSB 4DV0F 2B9XA 3A4TA 1KQKA 4N47A 2MLYA 1NU4A 3M8SA 2MKYA 3MEDA 2QMWA 2AWZA 2YNHA 3CTRA 4I2PB 3QSYB 3BDPA 4Z7CA 4F4ZA 5F3ZA 1B0TA 2VG7A 4YDDB 4TU9A 1WEYA 2FJEB 2HMIB 1CQNA 4IRCA 1N32J 5MLCV 3RW6A 3R5GA 1F60B 2DB1A 3MM6B 4C0OC 4LFBJ 3NOGA 1FKOA 1ELOA 4ID5B 4CYUA 3WX4A 5IT0A 4RW4A 2MQNA 1XMOF 1IBKF 4CQ1A 2C22A 4O4GA 1HNIA 1BQMB 2UVRA 1K0TA 4ES1A 2UXBF 3ELHA 3NNHA 2EWHA 5IQQA 1U45A 1EKRA 4WP8A 2VL1A 5HJYA 2HHUA 4USTA 4U8VA 1YLXA 4ZN3A 3HPOA 1FKOB 2GIQA 4TKTA 2ZH3A 2PO4A 4USUA 4JI7J 4HTJA 5BYSA 1CC8A 2WAQD 1NK7A 3HHLB 4WIQA 3W9HA 1AZSB 4YS2A 2JEJA 4NXNF 1P27B 3DGPA 2IY5B 4A8XA 1T3OA 3CCZA 4DMZA 3FRZA 3FNNA 2BOPA 3JAMY 5DQHA 3IBCB 2JVOA 4QPXA 4EMDA 2R2UA 1T11A 1C1BB 1RT3A 3V2UC 2J6UA 2GVDA 4NYPA 2UU9F 3CC4S 4FF1A 3DLJA 3OT9A 4UUWA 2BKOA 1ICEB 2HS3A 4L6V3 3FVYA 4NCGB 2A10A 3C66A 1ACMB 1AROP 1DQAA 1S49A 1Z2ZA 2WVEA 2HFVA 3HSGA 1UW4A 2EFQA 2P9GA 4M5HA 5M2RA 3T6JA 4U7CA 4RNOA 3MUMP 1XMOJ 1T9VA 3QRPA 2I0XA 1RZMA 3IGVA 4H4MA 3I4PA 4YMEA 3LGNA 2B56A 3G6XA 5E5NA 2MQPA 4ZIWA 2ROPA 5FDLB 5B09A 2O5DA 3TZZA 4C3MA 5F41A 2PC6A 3Q8SB 4F4XA 4NLOA 4JYAJ 4YHHJ 1TQLA 2DNPA 5KT5A 4IG0B 2AYMA 4MKBA 3PO4A 4DSLA 1JLFB 4LRDA 2HW3A 4P52A 3AB2B 2UZAA 4UOFA 3CD5A 1JIHA 3MAAB 4G1PA 4MK7A 2CXEA 2KTQA 4OV6A 1HL6A 1O6XA 2MHEA 4OYWA 4ICLB 4GVBA 2UV8A 3FBCA 3N0VA 4E0DA 3E01A 3I0SA 4Y0FA 3IG1A 3CDBA 5I3UA 7FD1A 4KT0C 2ZWPA 3HF5A 4GO7X 2R7SA 3DLEA 2ZNZA 4PXCA 4UOHA 3G9CA 4XK8C 2YWWA 2CQPA 2FY1A 3M9MB 4ED5A 3A8EA 3LGMA 4O3OA 3TWZA 2ERRA 3D0IE 3D2WA 3M6UA 1IN0A 4K5RA 4M63A 3T5JA 5F8GA 2Y8YA 3HHDA 3CC7S 3U1NA 4Y6IA 2BOAA 2RF2A 2KZZA 1KVKA 1HFEL 1R31A 2B4VA 2HQDA 3MM8B 4B3TF 1VQSA 4OMFG 4H4OA 1S77D 1MMNA 4YB1P 3CO9A 2E1CA 2FTRA 5A8KA 1R43A 4WFYA 3SQGB 4DQQA 4KJIA 4LRBA 3T9ZA 5KFUA 3W2WB 4LF8J 2J0XA 1QDUB 1WF2A 4CP5A 5JUMA 1S1TB 5IWAJ 3R5DA 4WE1B 1MU2B 1N0VC 3MTKA 4KGZB 3DU6A 2MGZB 1R0AB 3BBFA 1RT2A 3KUGA 1RP5A 3CJ8A 4F0KA 2IFXA 3GIRA 1IWAA 4ERDA 2DNKA 2N7CA 1H2VZ 1HNZJ 3IR6B 4ZVTB 4HR2A 3IM8A 4RZRA 2Y8WA 3W3SA 3GJSB 4RPFA 4Y2KA 4B17A 2EPIA 3MPWA 3CMQA 3DHWC 4ZVRB 2BKNA 2CJXB 3GCWP 3D3BJ 1RT5A 5K14B 4DQSA 2W9CA 3I96A 1O0PA 4UZCA 2CPEA 2H3EB 2HNZA 2MDAA 4CTAB 2UUAJ 4FF3A 2V4QA 2J0SD 2BA9A 3KK2B 5L46A 4ED0A 2YX1A 1RTHB 3KFWX 1RT6B 3ZTRA 4OI3A 1TELA 2V2VA 2QL5B 3TYTA 3SQGA 1AZSA 2N3OA 1H0HB 2HQFA 4FS2A 3MMBA 4DPUA 1NK4A 3UI3A 1K1SA 3EVOA 1FRHA 4Y2CA 2XQCA 1VQ8S 4NOHA 1V5VA 4EWTA 2YTCA 3G6ES 2R7OA 5L1KA 4DUYF 3PEHA 2GO8A 3OHBA 5CYMA 1HHSA 4F8RA 2WW8A 1FEEA 2NQPA 4RX6A 2KL8A 2L41A 1ZM9A 5IM0A 1U7LA 1HIYA 3M8ZA 4RW9B 1TK5A 1RAJA 1KC8T 1DJ0A 4RNNA 3DYAA 1DY3A 4PABA 3EGWB 2VOOA 4ECWA 3TUPA 3M7VA 1RAEB 3GJRB 4PWWA 4W98A 1FO1A 5LMNJ 4BWJA 5ETKA 2VQEF 2P9EA 3D0HE 2HZAA 5E0OA 1RGVA 2LKZA 5B0EA 4AL7A 2UUAF 2NSCA 2V5HG 4N41A 4WXOA 1TFWA 2YVSA 2ZC3A 4ECUA 4IG0A 1ZZFA 5B0CA 4MJKA 4QWDA 1S79A 1VGYA 3UDEA 3KK1A 4J9NA 3RTVA 5KFEA 1D9AA 4QBUA 2CZ9A 3D6HB 2FZCB 5HBMA 3KHHA 1VOMA 4H4KC 3CCJS 3IRXA 4TQSA 2QGFB 3E51A 3K5MA 2ZZMA 2DEJA 5KG5A 5CYMB 1PO6A 2FVCA 4RW4B 2U1AA 1HMVA 4MKYA 4OI6A 1N36J 5DLGA 5D0RA 2BRKA 1Z4UA 4UF4A 3MM6A 5AXMA 4K0KF 3NS5A 1JJ2R 1X0PA 2LQBA 3TNVA 1X4CA 2H4WB 2AV5A 1TL3B 2ZD1B 3W1YC 2YNHB 4OX8A 1JXEA 4DDFA 4OYPA 1CJUB 2BQUA 1PJ7A 1KTVA 4QZVB 3NGDA 2Y1JA 3R9LA 1E6VA 2KB2A 4RWXA 3AFGA 1FJGJ 2LLZA 2DNOA 1U2RA 3T1HJ 3M05A 3AJ2A 3KG1A 4OFZA 1TFYA 2AKWB 3PFOA 4ZDNA 1MROB 2DNLA 1YHQS 1LNQA 3KNAA 4LF5J 4ZP6A 4KE5A 5E2QA 1CS4B 4LSLB 1PJ6A 4OZ0A 1BQXA 4NEYA 1IKXA 2YWKA 4QR0A 2D3OR 3QJPA 1HD1A 2HLUA 5FD1A 3OPKA 4O4GB 1VQKS 3QBCA 3VWSA 2FJXA 1VIOA 3KLGB 2W2MP 3TZXA 1X9WA 1UVIA 1KVJA 1AYEA 5KFGA 2ZFHA 1TL1A 2H1YA 5K8NA 1YRUA 4M5DA 2X1AA 4FF4A 2CFXA 1FWKA 1WSRA 2OAUA 4R5PA 2DRAA 1HARA 5AT1B 3THVA 4N5SA 1FRXA 1YBTA 1NJZA 2L9NA 1NKEA 2I1RA 1WUUA 3AXKA 5GAEI 1X7VA 2ZH5A 4H4OB 4FNIA 1I5OB 5ETSA 2ZBCA 1RTDA 1FEHA 1FWPA 1FRLA 1SXLA 1SH3A 4LBIA 3I0RA 3BKTA 3RW7A 3PX6A 4B3MF 1SKUB 4Q2MA 3PFEA 1FCAA 4ECSA 4HEA9 2HWTA 2WW4A 2MZRA 2NUUG 3PKMA 1U24A 3BJYA 4ZN1A 1BXNA 2FPHX 1U1QA 2HIYA 2DPJA 2E9TA 3QMQA 3FMWA 4V19X 1SPBP 4U67Q 2FJWA 1F9HA 4X4OA 2W01A 1GNKA 2KVQE 3DRRA 3R7NB 4FN5A 2EVZA 1DTTB 2QL9B 4WFBQ 2N82B 3KHRA 1LW2B 3KJNB 3HFKA 5LL6d 2W24A 4YR2A 2CPDA 4LQ3A 1VQ9S 1Q82T 1S6PA 1B0PA 1S6PB 3KG0A 1YBAA 3H90A 5A8WB 1UTAA 1WC6A 2XMJA 3DOMB 4HLBA 2KM8B 3CCMS 4RU2A 1CSJA 1F3VA 1FI4A 1Y5LB 2MLZA 3SCLE 2RSQA 4ZVHA 2G0JA 2GQCA 4OZJA 4WP9A 5K14A 2IYGA 3EMTA 2DNHA 4RKUC 4EO6A 4TU7A 3RR8A 3B78A 1FJEB 3M6WA 3R6GB 3M8RA 3GE9A 3VALA 2G1DA 2E1MC 1NO8A 1U0HB 3WQPA 2UUCF 1D3WA 1LFWA 1PG5B 4URSA 2B5JB 2YKNA 2CQ1A 2WB4A 4IG3B 2HHXA 2Q6BA 3UWTA 3RRGA 2MQMA 3TQEA 4FBUA 1RCXB 2H9ZA 1YIJS 2WONB 2PMZD 2DHXA 1T03A 3K59A 3CJQA 1K0VA 2VH7A 1JLEA 3W2WA 4OI1A 3UR3C 1UETA 4FYWB 2P8IA 1V3RA 3DGPB 3THTA 1VRTB 4AQYJ 3C15B 4USKA 5EDWA 3G71S 5A0YB 2BBEA 1S0VA 2XHWA 1JLCB 1ZYQA 1W26A 2FQQB 3BB5A 2ZOFA 1K1QA 2IBKA 2VICA 2R8GA 8AT1B 2V9WA 2QL7B 3T3FA 4EUVA 3JSMA 2NXCA 1RAAB 4PRFA 3D68A 5CA5A 2HHHF 4LF9F 1HI0P 3ZZZA 1KQSR 2VA2A 3PCOB 2C2KB 2LEAA 2VFRA 2XULA 3UD4P 1U49A 2J9CA 1YJRA 1RTIB 5H9EJ 1YZ7A 4ZJQA 1FA0A 3EVMA 4QYRA 3JTNA 3LW5C 3N01A 4NRTA 1QUPA 4DV5J 4YB5A 3IO1A 1FRMA 2GZOA 1U6FA 3M8QB 4X4TA 4DLEA 2CA9A 2XC9A 3W62A 1TKXB 2JOQA 1IKVA 2K3KA 1WOSA 3EYZA 1N56A 4LT6A 2GMJA 3DM2B 3W60A 2OELA 3RBDA 3QATA 1R8PA 3S8SA 3R5AA 5DDOC 3PX0A 2OFGX 3HX9A 4EO8A 3G86A 4ZJOA 1S7IA 4DX5A 2DXDA 1WTFA 1GQEA 1QJHA 4O3PA 3MZIA 3W2VA 5CCMA 3ZZ0A 1KSPA 5SZTA 3H8YA 1KNZA 3PXGa 1I3OB 3CCTA 3IWLA 5BYRA 3KDOA 3IFEA 1Y3KA 5KFXA 1Q1KA 4JUZA 4C7QA 2B0GA 3O44A 4ILRA 4DX7A 4ZLNA 3J80U 3EPGA 5L1JA 3T5HA 1NKCA 2B4OA 3MFIA 3M8PA 3P8BB 4K5SA 5D15A 5GMEA 3MOZA 2OPPB 5L1LA 3ONQA 1ZOTA 3W8GA 5D0EA 2AQ4A 2DR5A 1FFWB 1IBLF 3HHLA 1BD6A 4A4JA 2XZTB 5KG7A 2DGXA 4NI2A 1TVRB 4ZP7A 1JLQA 3MF5A 3R5CA 2V4RA 4KH1B 1MN7A 2RT3A 3DOKA 1X8DA 5DS7A 4JV1A 1HI8A 5T7LB 2E7VA 1OQ3A 3AHPA 1TR0A 5E3PA 4FZVA 3DKDA 4ZVEA 5B0BA 4EYHB 1JJCB 4DV3F 1UWBA 2D3ZA 2RUSA 3UDLA 4FYDA 4PAAA 5CCLA 3BSOA 3RRHA 1HYSB 3AQPA 3SDEA 2LQJA 1SV5A 2HLTA 1J5EJ 3VV2B 3GIMA 3ENQA 3MMBB 3O5TB 4ED2A 1XR5A 2AJQA 2ZE2B 1UJ6A 2P6TA 3CWJA 4C97A 2DXFA 4DUZF 4ED1A 2MB0B 3QRQA 3PEJA 5G0RA 3TUZC 1WI6A 2NR0A 1WHWA 1B64A 1H6KX 2PGCA 2X51A 4ZCMA 1FDNA 1Z2LA 1UP1A 2W9AA 4BS2A 1IKYB 3LPYA 3Q22A 4H54A 4R25A 4QW8A 3AY0A 3PYEA 2RDJA 1G1XA 2DIUA 3VVUA 1S1VB 1Q81T 2O66A 1UVJA 2YQ3A 2V34A 1KONA 3NWRA 3SXLA 4G1QB 3CVKA 1JNZB 2AZ3A 5HAOA 2ZHBA 1FD2A 2HNDA 1Q16B 2RQ4A 4K2XA 4A8SA 1VK3A 3L7OA 4UUXA 3GYNA 4ZCKA 4JBCA 5LXRA 3CW2C 3GV8B 4RUBA 4CIOA 3CJ4A 2M88A 4ZHRA 3ZTOA 4I4BA 4JP8A 2HGLA 1LWCB 3G6YA 3MEEB 3NS6A 1H73A 1RABB 2E29A 4KR0B 4AE5A 5FIIA 3O6QA 5KG2A 2JC0A 1Y11A 5CYQA 2IIHA 3GZ7A 1Q78A 1RISA 2RDIA 3VQSA 3RR7A 4HHJA 1QD1A 4N76A 3R7BB 4QJVA 4E98A 4ZPDA 2ZH8A 1EZZB 3WHIA 1HPZA 3CJ5A 1S6OA 1TZ0A 1GFWB 3NWGA 4BCAA 2X3GA 5J2PB 1S1UA 2D3UA 4IQMA 1S1VA 3CB4A 4XO0A 4MIAA 5GAEU 4A8KA 1GAOA 1TVRA 2CJ9A 3QGPA 2VFUA 3U1LA 3D1HA 1XIQA 2W9BA 3Q83A 4X62F 1CJUA 4B3RF 2BACA 3UD5A 2ZDPA 3QRRA 2LA6A 4DPTA 5F8NA 2J76E 4JI6J 1YJVA 2WCXA 1RWNB 1S1XA 4E8UA 4ICLA 4P7TA 4OJHA 3ZNJ1 1P1LA 2AW0A 4TYAA 5LSLA 1X60A 4N56A 2HRYA 5HMXA 3MFHA 4IO1A 4ANEA 2LQ8A 1RB0A 5LJ5Y 2XLJA 1VQ5S 1IR1A 4G3IA 4F4KA 2OTJS 4X4QA 1SC1B 3FK4A 3HXMA 3H42A 2B6AA 2JL9A 4EGLA 4MK8A 5BR8J 2YKAA 4QR2A 5D4PA 2UUBF 5DM6Q 4EYIB 2DR6A 3D66A 1NAQA 3SYZA 4C0BA 1JNRB 2HRTA 3WBZA 1C1CB 3JTOA 3HMJG 4LQ9A 5K8MA 1IKVB 5D0GA 1VR6A 1RT1A 1H38A 3SIPB 1XNRF 4C8YA 1KOHA 2MKSA 5DM7Q 2FLLA 4KYZA 2VOPA 2M7SA 4NCGA 4F67A 4WFNQ 1FF2A 5H9FK 2CJYB 3B4DA 4OZ5A 4ETXA 2BJEA 3A3NB 2WONA 3PRDA 1PCAA 4X62J 4ELUA 5KFRA 3FC9A 2Y1LB 3L4BC 3K17A 2Z2YB 2V8DA 5I3PA 2AGQA 3ZXWA 4Y28C 1L5UA
chains in the Genus database with same CATH topology
4CO2A 4USHA 1FNXH 3BO3A 3GV7B 3BEGB 3DLKB 4A48A 1LFPA 2MZQA 4PQAA 4Q7AA 3CC2S 3B8HA 3FQLA 5I3QA 2HPUA 5IT4A 2MKJA 1J2VA 1WEXA 2UXCF 1ZPVA 2QIFA 2DO0A 2V4JA 3AQOA 4FXWA 4TXSA 3IXQA 1N5SA 3EPIA 5E3AA 3SCIE 2MXYA 1HQUB 3CE8A 3OJSA 1L3TA 4GKKF 1VQ6S 4B9UA 3RB3A 1LXNA 1M5OC 4CNYA 1WG4A 3E2EA 2C3MA 4DSIA 2WSCC 2VBZA 5IFMA 2ILZA 1R8AA 1C0UB 1V3SA 4MIBA 3MUVP 1DTTA 2IBKA 4IYQA 1RT5B 2JX2A 4IH7A 1FE4A 5C24A 3M2VB 1DZ5A 3FMBA 3AA8A 3DRPA 3I5CA 4QIEA 4YR3A 2VODA 4LFBF 3MEGB 3AB4B 3R1LA 1JJHA 2NXUA 3U27A 4OZLA 3SEOA 4O23A 3WDOA 1VQPS 5GAHI 3BR9A 1Z1ZA 3KLIA 4DV2F 4IQXA 3DHXA 2YWGA 1I6JA 2B9WA 2PA8D 5JXSA 3KLEB 1SJ4P 2DGSA 1SL1A 4B9LA 4ECRA 1IUJA 4LF6F 2JRSA 5DQIA 2OJ3A 2AJFE 1U09A 2ZM6F 4C8MA 3CCWA 2HFNA 4MMOA 1JKHA 1SUQB 2I9SA 2C3UA 2VG6A 4KHPF 1R89A 3QYYA 1RJJA 5J1EA 2J5AA 2F3JA 3SCJE 1X4HA 3VTIA 3PJXA 3U1MA 1LV5A 2HG4A 1KS2A 2RRAA 5DDPC 7FDRA 1Q8LA 2EBEA 4X64F 2J7UA 1FK9B 5C42A 3N4WA 4XIUA 3HO1A 1R27B 5D4LA 1N5VA 3W7BA 1SH0A 3HM9A 3HZEA 3BREA 5I4MA 3NG8A 2VB6A 2J7WA 1G2EA 1L3KA 5KG6A 2F4VF 1ZPWX 1J5EF 3L09A 2LEPA 3UD3P 2RH3A 1IR0A 2KT3A 2MZTA 2O1PA 2R2TA 2ZE2A 3TA1A 4RBUA 2I38A 3UCZP 2YKMA 3ISZA 3SDEB 1M1KT 1U2FA 4PQUB 5HROA 3C2PA 2K2PA 3CMAS 4I7FB 4GC6A 1DTQA 4J9OA 3GB0A 4K4UA 1C2PA 4WIIA 3VCDA 4A47A 4G1IA 4ES2A 1CG2A 4RNHA 5L9XA 3OL6A 1IKYA 2R8JA 5M2UA 1ZM3A 1UFLA 2XSJB 2M4MA 2ZJRQ 2AGPA 3OV7A 1O5JA 2IC3A 2PSZA 2ABYA 2QV6A 2RRBA 5GAGI 2CIMA 5AE1A 1ZTTA 1S0MA 2OH2A 4LFCF 2CPZA 1W2BR 1HWKA 1U1LA 4Y2IA 1SL2A 2YNIA 1RK8A 1X4DA 4OI4A 1P8GA 3SFGA 2KXFA 5GAGU 3V6KA 4IFYB 3PW5A 1HWIA 2XNQA 1URNA 1NH7A 3BM7A 3B4MA 3GR1A 3V5RA 2KFYA 2LMIA 1HNIB 3LAMA 2ZH6A 2VASA 1X5OA 2IM0A 2OP5A 3P96A 4UQTA 4N8OA 2FLPA 3GIKA 4FF2A 3TA0A 2YKQA 4QWBA 1E6VB 4X4NA 3KK1B 3UFCX 4WFZA 4DN9A 4DR5F 3FDSA 4B9TA 4ID8A 3DI6A 1JB0C 1QAXA 5EX3A 2RRNA 3EGNA 1N0UA 5HMYA 5HI7A 2ZD1A 3I5AA 4WU3A 3LP0A 3DYAB 1YRTA 5KG0A 5J2QB 1A6LA 2EFOA 2HS0A 2KT5A 3B82A 5KFKA 1RTIA 4JV2A 1OS5A 2L9WA 1EETB 3V6DA 2IA0A 3Q8QB 1QAYA 2DNMA 2CQIA 3MI7X 4Y3CA 4Q43A 2MKHA 3EZ5A 1FDAA 2KN4A 4HH1A 3PIPQ 1FJCA 1FXLA 3GSDA 3CJKB 3OFGA 1DURA 1Y9OA 3ETOA 5KT3A 5F3TA 2J7KA 5LMNF 5EWGA 1UKUA 2HAIA 2ZOMA 4NA1A 5EX0A 1SBRA 4C8KA 2OMOA 3M2UA 3R3TA 1RT7A 2DT9A 4KKOA 3MCSA 5EWEA 4AL5A 2BVZA 3TAMB 3DLHA 4X4UA 2KDOA 3NMRA 2N4DA 2IAJB 3GILA 5CHCB 4RNFA 4NXMF 3LWMA 3OSNA 3EXCX 1FRJA 1RKIA 1VRUA 4DV4F 3FSXA 3GIJA 2IVFB 4KRWA 4IOCQ 4JI2F 4KQZA 4NL5A 3FCHA 3TAMA 5C24B 1N48A 3HHEA 2ATLA 2ZHAA 1NHVA 4IR1A 2M2BA 2FJBB 2M5YA 2D41A 2YY3A 3LP2B 1HYSA 1HD0A 3K57A 4A8OA 3CMES 4KTQA 1TL5A 2COLA 5D8HB 5AE3A 4IG3A 5D6GA 1Q7LB 2E5IA 3DRRB 4R8UB 4NZ0A 4KHMA 3EX7B 1X4BA 2WOMA 4OQJA 3ZFVA 2R7RA 3DRPB 1C4AA 4D3HA 2CPHA 3OTCA 1LW0A 3BDEA 3T1AA 3JTPA 2MQLA 2OKQA 3IG1B 4ELTA 2CQHA 3LO3A 2CJAA 1N6QA 4O3RA 2XGPA 2L08A 2KG0A 3GR0A 2VG6B 4J37A 1M5PC 2Y1RI 3OR1A 2MJNA 2WSFC 1R8CA 1KVIA 5C25B 3LQVA 4NZ7A 2GHPA 3M30B 1U6ZA 2V0NA 2BRLA 3H2LA 1YG0A 3QIPA 3PDNA 1Q8BA 2NYIA 5AXNA 4DJBA 3M9NB 1HBMB 3HJFA 4MFBB 1RI7A 3SCKE 3QO9A 1JLBA 3QZ8A 3EGZA 4JYAF 3TRGA 3M2RB 2RB7A 1GTHA 2XWXA 2MPUA 4NX9A 4NLPA 4YP3A 4LIRA 1YWXA 2ZH2A 1KTQA 4ELVA 5KOXA 1GH8A 5KFBA 1S48A 2QA4S 4K50A 4WKRA 5F0UA 5M2PA 2GJIA 3DRSB 4HL9A 1XK8A 3D1OA 4MH8A 4C2MA 2J9EA 1Y3JA 5KFJA 2UVWA 3DLLQ 5J2MB 2KJWA 3LALA 2JC1A 4DV7F 2FHJA 1H7XA 4KAIA 1FE0A 3UCGA 4PXEA 2DNQA 4CO3A 4HYKA 5HROB 4ECQA 3HHLD 1T94A 1DRZA 2Q3PA 3ISNC 5CD4H 1QM9A 1LOUA 2DH8A 3HZGA 4X65F 4HH0A 3P5TL 3DLGB 4CZCA 2ZH4A 4DSFA 2AU0A 3MEEA 1KLMA 4AFFA 1FESA 3SZ2A 2EI5A 2U2FA 1S76D 4HDHA 1N5TA 3ZZOA 4LUBA 4NLXA 2HHWA 1G3OA 5EHHA 1RTJA 2YX4A 4I0WA 2W7AA 3JSYA 1YVFA 2V9KA 5HL7Q 3K5LA 3BO4A 3NMAA 2QA4G 1G7CB 5E3QA 1TAUA 2FLOA 4DQPA 4QPTA 4OHZA 3RAXA 2B6AB 4RW8B 1SIZA 1MSWD 2GA7A 2OPQB 3I9ZA 1HNZF 4IRDA 1TUVA 1PILA 2CZ4A 2D74B 3UQSA 1OSDA 3CCSS 3I6PA 2IM3A 2E7XA 1JKHB 3VAHA 2WB1D 3KYLA 4ZP9A 3I32A 1RT6A 4WK3A 1RYRA 1N4LA 2FB0A 4DV6F 6FDRA 4HDGA 2B9YA 1FNOA 1FT8A 3T19A 2KI2A 2OPSA 3KLEA 4JV5F 4NRUA 2SXLA 4EZ6A 2LU1A 1XERA 2J9DA 3NCPA 4I56A 2DNRA 4WK1A 2ASJA 2Z8QA 4RW6B 1FJ7A 4QIFA 2FVRA 3TW0A 1FXDA 3HVTB 3C6TA 4B9NA 3QWPA 2RU9A 3M32A 2DPIA 5CYJA 2EG2A 2MGZA 4MIWA 4NA3A 3CCLS 1R0AA 4USJC 4Y2AA 5KAKA 3WC2A 3G96A 2XZWA 2ROEA 2RQMA 1KQFB 5DGAA 1SJQA 2BE2B 2GCFA 1SUQA 3DOLB 1W25A 1XMQF 1IKXB 3TO8A 2FHOB 4KV8A 2ASLA 1ULRA 1JX4A 4IFVB 4OHXA 1ZTWA 1FKPB 2PDAA 3BF4A 5KFZA 4ECYA 2KVIA 4MTPA 2IRYA 4Z2XA 2LXIA 1KD1T 2E5HA 1F9FA 4C9DA 3PY8A 2VKZG 3DLEB 4M1KA 3CCVS 3M9OB 3F56A 4ETZA 4DL2A 1SB6A 1LWEA 4WE1A 5IXUA 3OUYB 3E01B 3KOAA 1TL4A 5KG4A 4K59A 3T5LA 1C0UA 1J5OB 5KFDA 4DG1B 2LQ9A 4ILMA 1HW9A 3BGRA 2UV8G 1RT1B 1JLBB 3CIMA 2ZNYA 2ZH9A 1PSDA 2G0CA 2WK4A 5IWAF 4AXIA 4QWAA 3I55S 3G8SA 5JVHQ 2IRXA 2XCAA 3QPIA 2VV5A 2BQRA 4BDPA 3NL0A 1AFIA 2AF6A 3TUIC 4ATNA 2DNGA 3TP2A 2E7WA 2BXJA 2IRUA 2RF2B 4FS1A 1S9EB 4H4MB 2CKWA 1UVNA 1DAXA 3DXBA 4Q0BA 1F5AA 1EETA 1TKZA 1Q7YT 2PI4A 2DGTA 1JLEB 2OPPA 4PUOB 2NPFA 1ZAVA 1N6QB 1LWEB 1VC6A 4B02A 3VF0B 2HVIA 4KHRA 3CD7A 2H5EA 4J9RA 4D3GA 2JEIA 2FGCA 2GO9A 3LF0A 4Y00A 5JVGQ 1FRIA 5ITHA 1IQZA 2FUG9 1RKJA 1FDDA 2RJZA 5B0FA 4OX9F 2Q1LA 3TA2A 4LF7F 4QIGA 5EN1A 3GFZA 5LXYA 3GYXB 3WC0A 4CI0B 1RTHA 5LT5A 4XDDA 1TP7A 3FSYA 3PW4A 3BGRB 2L3MA 3ITHB 2W4CA 2XMTA 3HK2A 2NSBA 4OHYA 2B5JA 3G8QA 3MAHA 2C2EA 3I9V9 1CVJA 3K5NA 3N5FA 3UW1A 4LSNA 2QA1A 1N54B 4NYOA 3V4MA 3S01A 3HHLC 3LUYA 1VC0A 2KFNA 3M1VB 1FHTA 3F44A 3FEYB 2PD1A 1YITS 3GG0A 1JLGA 3POTA 2QLXA 3KJVB 4KSEB 4OJGA 1EP4B 2OD6A 2VFTA 5E7OB 3TQ1A 2B3TB 1GT8A 2AP6A 5D4OA 2UUTA 3JSRA 2YNGB 1X4EA 1UA1A 3HHNB 5A8KB 3CDUA 1N5QA 3TARA 1SC6A 2FVPA 3DNCA 5AXKA 4NWBA 1Y5IB 5CQGA 2CPJA 2QSFA 2V8GA 3FSIA 3H4BA 3C6TB 1Q4RA 4ZHRB 4RW8A 2X1FA 2YKNB 3M32B 4ZMMA 3J7A1 2KH9A 1GX6A 3NLCA 3CD6S 5I42B 4CO5A 1VBYA 4X4SA 2Q79A 2IAJA 5IS2A 5HP1A 4F4YA 2M8HA 4I1TA 3RB4A 1VQKS 2XG8A 2GC8A 2CPYA 3R5BA 5LSRA 2GMLA 5GAHU 5F9NA 1RT7B 4KKOB 4Q44A 1SKSA 4HI2A 4N77A 1TK8A 2LDYA 2VFVA 4DF4A 3IS9A 4FXVA 4DV1F 4JI1F 4NLGA 5KFYA 1T05A 2VA3A 1FTRA 3NRBA 4MYTA 3O1LA 1SKWA 1XEZA 3HP6A 1LWCA 1TK0A 1HNVA 3IBWA 4JI5F 4CH1A 1S4FA 4ZLPA 1SL0A 2O67A 5J1NA 2LXUA 3IGNA 1FXRA 5LJ3Y 3QWUA 1ZAWA 2J6TA 5L8RC 2VONA 3OSPA 3Q2SC 4L72B 2RU3A 2M3DA 4ECVA 4ECZA 1X9MA 2HVHA 5E41A 1CPZA 5HP1B 3DRSA 4F25A 4LIWA 3E8OA 5CZVA 1WEZA 4AYBD 3X1LB 4FXDA 2Z0GA 3MM9A 4PG5A 4RBTA 1BC6A 4C8LA 1TV6A 1Y0HA 3KLHB 4RU9A 1T02A 1CLFA 1TKTA 1WG1A 1IKWA 3M8PB 1V3ZA 4MYUA 4X4PA 4LFAF 2JJ4D 1U1PA 1AXQA 3DLGA 1M0SA 4OZNA 4K4ZA 3BGFA 4R0EA 1R8BA 1HBOB 2DCUB 5KFSA 5KFVA 5I42A 1MMLA 4OHVA 1A7GE 2E44A 3C46A 2ZZNA 3CSKA 1RYSA 4TYBA 2V4JB 2F9JA 5DQGA 4OL8A 1H7WA 3IA0A 4KO0A 1DQ9A 1Y7PA 2N3LA 5L9NA 3MM7B 1U25A 2GHVC 4NLRA 1S9GA 2DJWA 1S0OA 3DLKA 2DD8S 2KJVA 1LWFB 1BY9A 2JWNA 1S1WA 3CPWR 2DITA 2E1RA 3M6XA 1O8BA 2HHTA 4HKQA 2K3IA 2R2RA 3S1TA 4PUOA 4DBQA 1V6HA 4GMKA 2IVYA 1JWWA 2AJ4A 2IMOA 1JJ4A 2XCPA 4GKJF 3FGVA 1C1CA 1WI8A 3FRYA 3MR3A 2CQBA 3PZPA 5J2MA 2PMHA 3QIPB 2YKMB 3MUTP 4CCHA 1YJWS 1M5KC 2CVEA 2R7VA 4JV0A 4PPZA 2R2SA 2PIIA 4O0IA 1TKXA 2WBMA 1VRTA 2HWHA 2ZVSA 4HT7A 4I6AA 5D4NA 3DDKA 5L38A 4A8QA 3ENWA 1WHXA 2MMYA 2VC0A 1WF0A 1ZM2A 1Y00A 2RUGA 2OIHA 2FC9A 1DHMA 1ZM4A 3NBPA 1FERA 4OI2A 3RZAA 3KK3A 1SJ3P 1FJGF 2AX0A 3U02A 1JK9B 4DSJA 1F0XA 2FLNA 4Q0BB 3CXCR 4W92B 3K58A 1LK7A 4UY85 4EFAC 1RA6A 3FEZA 3MECA 3OQ2A 5E33A 1UVMA 3M2UB 1JLCA 5CH7B 3U7JA 4Z37A 4USIA 3V6HA 2IBOA 2UUBF 2HMIB 1L3VA 1VQNS 1NK5A 4WFXA 3MR2A 2N7YA 1ZETA 2VFSA 3OR2A 4CTAA 3LP2A 3QAUA 1U1KA 1JXLA 5C5JA 4NPOA 1OO0B 1APSA 3P3DA 3SSRA 2K7JA 3MEKA 4F2RA 2ZC4A 4M94A 3MEGA 1SIWB 3KK3B 1UEVA 3PJWA 2DGOA 5KFLA 2MZJA 3TUJC 4R8UA 4RW6A 5I3UB 2RNEA 5KFNA