1H0HB

Tungsten containing formate dehydrogenase from desulfovibrio gigas
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
214
Chain Sequence
SKGFFVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADMEDESAIIHDDATGCVLFTPKTKDLEDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKAAYSDAKLCDPDDVRVIFLTAHNPKLYHEYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FORMATE DEHYDROGENASE SUBUNIT ALPHA
total genus 58
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB02
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB01
4XDDA 3MMBA 5CHCB 1SIWB 1H7WA 1D3WA 1WTFA 1R27B 2WB1D 2WAQD 3MM5A 1FRLA 4CI0B 2FJEB 3MM9A 2PA8D 4XK8C 2FDNA 1A6LA 1FRXA 2VKRA 1ROFA 1C4AA 7FD1A 3MM8A 4YDDB 2PDAA 3IR5B 1FERA 1FRJA 3MMCB 5CH7B 1G6BA 2C42A 6FDRA 1B0TA 1IQZA 3OR2A 2C3PA 1C4CA 1FTCA 1F5BA 1JB0C 2FJBB 3OR2B 2FD2A 1Y5LB 2C3YA 1G3OA 4ID8A 1GT8A 1BC6A 2ZVSA 1KQGB 1IR0A 4AYBD 1BWEA 1DAXA 2FJDB 1FF2A 1FXRA 1SJ1A 2GMJA 2VPWB 2VPZB 1AXQA 1FXDA 5BYRA 1SIZA 2C3MA 1H7XA 3MMAA 1BLUA 3MM9B 1FDBA 2C3UA 3MMCA 2PMZD 3MMAB 2V4JA 2GMHA 1HFEL 7FDRA 1Q16B 4RKUC 1KEKA 4Y28C 2FGOA 3MM7B 1CLFA 2UZAA 2C3OA 4OMFG 1Y4ZB 2FJAB 2Z8QA 2WSEC 3C8YA 3IR6B 3EGWB 1GTHA 2VPYB 5BYQA 1FEHA 1KQFB 2IVFB 4DHVA 1FCAA 1PC4A 1GTEA 5L8RC 2WSFC 3OR1A 3LW5C 1H98A 1FDAA 5FD1A 3EXYA 1GAOA 1VJWA 3IR7B 1BD6A 2Y0SD 3MM5B 5E7OB 6FD1A 2V4JB 1FRMA 4L6V3 3GYXB 1FRHA 3OR1B 3MM7A 1B0VA 2VPXB 3HKZD 3MM8B 1DURA 1JNRB 1FD2A 1F5CA 1BQXA 1FRKA 1Y5NB 1PC5A 3MM6B 5BYSA 2O01C 1XERA 4OV1A 3MM6A 1DFDA 1B0PA 1K0TA 1RGVA 2XSJA 1Y5IB 1H0HB 1F2GA 1JNZB 3EUNA 1FDDA 2XSJB 1FDNA 3PNIA 4KT0C 4XDCA 1FRIA 3MMBB 2V2KA 2WSCC
chains in the Genus database with same CATH superfamily
5A0YA 3JSRA 1XMOJ 3BO3A 1R43A 4OZ0A 3SCKE 1U1MA 4EMDA 1VQOS 3VAHA 2BRLA 2I2YA 2IYGA 3TA1A 3L7PA 1CJTB 1PG5B 2MGZA 4OYPA 4J37A 1QTNB 4DOZA 5G4DA 1VQNS 1S76D 3M6WA 4I67A 5E3RA 4M8LA 1VBKA 2J7WA 2OJ3A 3KLHB 4FF3A 3R5GA 1V6HA 1B4SA 4KH0B 2ZOMA 1UJ6A 5KT7A 1R0BG 1YQHA 2OFGX 5LSOA 4X4OA 2FJWA 2MZ1A 3VQSA 4UQGA 1CC7A 1HNIA 1SJ4P 3PFEA 1R8HA 1DLOB 1XMQF 1SQGA 2HKEA 4A48A 3A8IA 1EJ7L 2ASLA 1AUDA 9ATCB 2GC8A 3VAIA 2HNDB 1UVKA 3JQMA 3SDEB 2V8DA 2AT1B 1X5SA 4ZP7A 3KG0A 1VQYA 3G2XA 4ZCLA 1Y5LB 3UFCX 4CO2A 1FTRA 5CYMA 2PMWA 2DXFA 3ITHB 4CO1A 4DL0C 1NK9A 3A8JA 3RW7A 2OPRA 3TZYA 1SKRA 2HIYA 2PI5A 2MHEA 1WNEA 1IR0A 2D69A 3NOGA 1IUJA 3A13A 3KK3B 5C24B 3TA2A 3LWMA 4C0HA 5KT5A 3TQ1A 3R1LA 1S0OA 4ED6A 4WPAA 1NK6A 1D9DA 3NS7B 3H5SA 2ABYA 2VPZB 4DFMA 2AYGA 2FHOB 1F6TA 1RHJB 1PBAA 2KVIA 4E8UA 2CNKB 4UOHA 2VG7A 1MMDA 1HNVA 5IQQA 5A2QU 3QSYB 4MIBA 1R0AB 3QGHA 4IOAQ 4FYDA 1JLEB 1XR7A 1UW4A 5EGYA 4X64J 3PDNA 1ZPWX 4GC7A 1QD1A 4WP3A 1VQ6S 1REGX 1PCAA 2JEFA 2W9BB 1UWBB 3J80Y 4LVNP 5J2PA 4JI1J 3HVWA 2A18A 3LALA 3R5AA 3KXDA 2Q1LA 4ZIWA 4WFNQ 4OMFG 1ZM2A 3RR8A 2QGFB 2J6TA 3R7NB 8RUCA 2CZ9A 2XYHB 3LGHA 4DU8A 1VBZA 4PQUB 2GGPA 1AB8A 2YKNA 1ZM9A 2IFXA 4IQMA 2CDQA 1OY6A 2DY1A 2HSEB 1SQEA 3M8RA 4IUFA 3C3LA 2NZ4A 2HGMA 2OPSA 5K8OA 1DHMA 2NXCA 4NXNF 3Q8VA 3J7A1 1TL7B 3GCXP 3BO4A 4CYUB 3H5YA 3W61A 2JX2A 1SKSA 2WCXA 2P9GA 3RB4A 1M5SA 1LWCA 2QV6A 1T95A 4BWJA 3JSMA 4AQYF 1JX4A 2J0QD 5BJRA 2HHQA 4ZOSA 2AZ1A 1KS2A 2GHWA 3DM2A 2EPIA 3VF0B 1SPBP 3ZZ0A 4NEYA 3KLGB 1B70B 3LGNA 1KLMA 2OELA 4DZ6A 2XCAA 1VC5A 3EM1A 1FRHA 4ED5A 4CP5A 3RGIA 3OLAA 2B4UA 2B4VA 4ZCKA 3W2WB 5IT4A 5IV4A 3RB0A 2IJNA 3DMJA 1S0NA 3IG1B 3T6JA 2J0SD 3GZ7A 4LSNB 4RW7B 3MUTP 1RBLA 1KD1T 3IGVA 3C14A 2DCLA 3GYGA 1LWXA 4OV1A 1T9UA 2QSFA 4X4SA 3IM9A 3TEGA 3K7RA 4FZVA 2DB1A 5GMKa 1TMJA 2J6UA 1F3VA 3HVTB 4JV5J 1RAIB 3KLEA 2BANB 3N9UC 4M5DA 1ZH5A 1X9MA 4GVBB 2KM8B 3BSOA 1RYRA 1YX2A 1IKXB 3DRPB 1RT1A 2YY3A 3K5PA 3OFHA 4DPUA 4NI2A 1QVGR 3MMBB 2XO6A 4NLUA 4EGLA 1RAGB 3E01B 3HSZA 3OW2R 2HWIA 1EHWA 3QT7A 2KHDA 4MKVA 3PACA 1R27B 1R8BA 2VFUA 1X5TA 3GV7B 1N5TA 2R7VA 2FY8A 1CPZA 3JSBA 1G1XA 2IAJA 3GIIA 2QTWA 2RAQA 1B7FA 2F4FA 3DKDA 3KG4A 1Y3KA 2DGXA 1U8WA 2XGQA 5KG0A 5KOWA 2K1RB 3HFVA 4ECYA 3DI6B 4I2PA 5B0BA 3E2EA 3MUVP 4YOEA 4MAKA 3N0VA 5GMEA 3FEYB 4WIQA 2V8VA 2R7RA 3NY0A 1UVLA 3MM8A 4A8SA 2RMLA 1DQAA 2ZVIA 4ANEA 2W2MP 4UOFA 4AQYJ 1PYSB 2H5IB 4OJGA 2BXJA 2MY8A 3D5MA 2ZHAA 4B9TA 3V2UC 3HHLD 4GVBA 1TL3A 4I68A 4NZ0A 4Y2IA 1F9EB 1NB2A 4FYVB 3NRBA 3ZC4A 4KJIA 2HZCA 2A6MA 1QE1B 3NGRA 2UXBF 3LP2B 3JTNA 1RTDB 3NGSA 3K5LA 2WOMB 5LXRA 1R8PA 2P8IA 3PO4A 2ZZNA 1GK8A 1RWXB 3H5UA 4PG6A 5GAGI 1P27B 3IBFB 1LOUA 2MZTA 1URRA 5E3CA 4FNIA 5GAEI 4J9KA 2IM0A 3MDFA 4PG7A 3JTOA 3JYTB 3HM9A 3FSYA 1TVRB 2PT0A 3B4MA 3GE9A 5HATA 5AXNA 3Q23A 4DSIA 1VOMA 2CPZA 1UEKA 1R0CB 4OYMA 3KMQA 1Q8LA 2BJ9A 3DM2B 3Q83A 1U49A 3PIOQ 1N88A 4FVMA 1RA7A 3RRKA 3BH6B 2QX0A 2LQ5A 3ZNJ1 4O23A 4NXMF 4B08A 5DO2A 2YWGA 3VZIA 2QL5B 1RT4B 4GO7X 2IRXA 4NXNJ 2V4JA 3TAMB 2J7UA 2KT5A 2YNGB 3QBCA 2PFFB 5IT9Y 2FPHX 3HJFA 2M2BA 1MU2A 2J9EA 4OI4A 4FF1A 2L9NA 1T9YA 2KT2A 1WI6A 4EYIB 1XBWA 1CLFA 2RNEA 1VCTA 1CS4A 2FLPA 5JXSA 3LOUA 4DR5F 1UA0A 4DJBA 2AJ1A 2ZBRA 3M2VA 1RLDA 3UN2A 3J81Y 2GA7A 4J7CA 2EW9A 1LWEB 1GXTA 2Y0BB 2BUNA 5ETLA 3VHQA 3KLIB 5DG9A 2J5AA 2FZKB 2PEBA 1JLBA 2VPYB 3D6FB 5E3AA 5ETVA 3MR6A 1LWEA 4MK9A 2CPEA 1KTVA 4WTOB 2YTCA 4XIUA 3POTA 4Q8FA 3PJWA 5L8RC 2CQGA 2IHR1 5SUHA 4HEA9 2F4VJ 2AV5A 4DR4J 4KRWA 3KTQA 3R7SB 4GO5X 4G1QA 4DPTA 1HNVB 2EI5A 2POKA 1G4CA 2DHAA 1ZA1B 4Y65A 5E7OB 1C2PA 1RTZA 4FYWB 2V4JB 3I5BA 4R25A 3GIMA 1S79A 1SH0A 5LSLA 2HMIB 4LR8A 5DJBA 4ECRA 1M5KC 3HD2A 3MD1A 4NLSA 1O8BA 4U96A 3AXMA 3EZ5A 1E6YA 1S4FA 1B0VA 5D4NA 4W98A 3QLHB 2C2DA 3R6GB 2F65A 2MLXA 2BOAA 4H4MA 4KQZA 4N76A 1RWOB 4C8NA 5D0RA 1FJ7A 4USUA 2MKYA 1RWMB 3OVBA 5CQGA 5BYSA 2FZCB 3MPVA 4URSA 3RBEA 1XERA 4MMOA 2V4RA 1U26A 2EFVA 3K0JA 4C11A 1T9XA 3KLFA 4KBIA 3MECB 3MPYA 3M05A 3M32A 5A8RA 2D3UA 5I3PA 3PRVA 4XPEA 5D78A 1JNZB 3G4SS 2LU1A 1WHYA 2CQPA 3GCWP 3M9OB 2E5LF 1CVJA 2OD6A 3HCXA 1S1WB 1NZAA 2IYIA 4DCJB 3D1QA 2P2CB 1HNXJ 1K9MT 2FC9A 3CCRS 4GKKF 1CSJA 3S8SA 3CJKA 3R9LA 3MEDB 4HI2A 1BQNB 2C2NA 1ZS6A 4ZVTB 4UOGA 3UDEA 1RWNB 2Y9HA 3FK4A 3MUMP 3AOAA 4IRCA 3MM9A 4XK8C 1K8AT 2AQ4A 4YR0A 3MTKA 2A0FB 4WWSA 3DRXA 4RPFA 2JEGA 2GHPA 3OTOF 3CD6S 1X4CA 2WOMA 4ZCMA 3CB4A 4DSLA 2J9DE 4FXWA 5KFQA 2GJIA 1NRKA 4OZJA 3UD3P 3BN7A 3R5CA 1XTZA 4KGVB 1RE1B 2W24A 1VI7A 4MKAA 1H38A 3CC7S 4Y0FA 1FFWB 3HKWA 3UVJB 2DRDA 3EICA 3AODA 4OYXA 6FDRA 2UUAJ 3D6HB 3PR5B 2O5DA 4CLKA 3EYZA 3MFHA 4DBQA 1F9FA 1MROA 1W2BR 3NL0A 5D4LA 3BF4A 2H51B 3GIRA 4B02A 4LFCF 2AMCB 4TYBA 2HZVA 2DD8S 2E1AA 2W2OP 3A8KA 2AGQA 3PHEA 1PSDA 3CCZA 4DR3F 1OSCA 4NXMJ 1U1OA 3DRRA 5B7WA 1RT5B 2DNHA 2LEAA 3DCAA 2VD3A 1FXDA 1VQMS 2RF2A 3G8SA 4JI4J 2KG0A 2C3MA 1FKAF 1U2RA 2XWYA 5D0EA 4KH1B 1WHWA 3WX8A 2NREA 1S7IA 4U67Q 1R8AA 2XS2A 1HPZA 3ICLA 2K2PA 2Z2MA 3UO0A 1D0EA 3W7BA 3HHKA 1BWVA 2IC3A 3M1VB 3K8WA 1UVJA 4HI1A 1UVNA 2A1BA 3NNAA 3T5LA 1RUSA 4RNFA 2VU5A 2JRSA 2YNFA 4CIOA 3FRYA 1QSYA 2DH7A 2D74B 3RU0A 3HT0A 2UZAA 4DLEA 3SCLE 4DV2J 2XZWA 4M5LA 4G1QB 3DNCA 3NNHA 1FWLA 3T19A 1QDUB 1H3DA 2ZJPQ 1LFPA 2BE2B 1NKCA 1JWWA 3ENVA 4I6YA 3GU0A 5T7LA 1S12A 1S1WA 4DV3F 4O0IA 2IVFB 1L3VA 4CLYA 2DXDA 3CD0A 3OXGA 2NYHA 4RW6B 5J2QA 2PN6A 3H59A 5B08A 2B6AA 4M5NA 1E6YB 1RI7A 2G0CA 2LQJA 2NXNA 3E8OA 4ILRA 1EETA 4R0JA 4CO4A 4X66F 3MR7A 1SV5B 1KP6A 1TV6B 2JC1A 4HTJA 2CQ2A 2D9PA 2P6TA 1U0HA 3LTOA 4ICLB 2YVSA 1U1KA 6FD1A 5EHHA 1RTIA 4TU7A 3K57A 2QEXS 2G9OA 2KYXA 4RNMA 1U47A 5DLFA 2H5EA 1DJ0A 1S4EA 2L9WA 3IMQJ 2KO1A 3QLHA 3DDNA 4LQ9A 1TKTA 3MM7A 4NZ6A 2OTJS 2HHSA 2EKNA 2VFTA 5KFIA 2R9LA 1Y0HA 4NLGA 2W4PA 3CVKA 4N47A 1FVSA 1U6FA 1QUPA 5F41A 5K9FA 4Z37A 3LWLA 1T9WA 5HMXA 3QMQA 3HHLB 3JTPA 4A47A 3KLIA 5F9NA 1CJUB 5ITHA 5JVHQ 2RQKA 5BXIA 1RHKB 2VV5A 5ETQA 2O01C 3A3OB 3A1YG 1S1VB 1KFSA 3TUJC 5SZTA 4HVZA 3OTEA 2OMLA 4LRFA 3KHLA 2EWHA 4AUKA 3P96A 3IXQA 4ECXA 1FI4A 5D15A 1IKWB 3MR3A 1HA1A 2CPDA 5CZXA 5HBMA 3AD8C 1J5OB 1SL0A 4XDCA 3W5YA 1IKWA 4RJVA 1LQ9A 2V2KA 2W8LA 1SJFA 4WZMA 2JFDA 2CYYA 2BRKA 3DYAA 4LSLB 4AL7A 2KKHA 2IVMA 2V50A 4DV4F 1C0TB 1MMNA 2NZCA 3UPFA 2XMKA 1Z1ZA 3J81j 4BDPA 1NH8A 4UUXA 1N6QB 1IQTA 4WFXA 1WC3A 5KFFA 2L41A 5HP1B 4J9OA 2FDNA 1OS5A 1R8CA 2CWKA 3RRHA 5K14A 4KB7A 1RU2A 1CJTA 2MGZB 2R2TA 1AZSB 4GVLA 5KFEA 3BYPA 2BKPA 4RU2A 4M94A 3BKFA 4X4VA 4JI5J 3CCES 1N32F 4FVCA 2VH7A 3I82A 1BQMB 4ZJOA 5IS2A 3IS9A 2A2CA 2WHOA 2ACMA 5T41A 4CH7A 1NXIA 3LGMA 4ILMA 2QA2A 4IH7A 5KFDA 5KFLA 4K4XA 3MI7X 1VLOA 5CA5A 2C3PA 5B0AA 2B8QA 3FNNA 1YTYA 4ECSA 5B0EA 3UWTA 2IDLA 2FD2A 4ZVSB 1HI1A 2YX7A 4NA2A 5T14A 3Q24A 3V81B 4O3NA 1F1BB 4FPIA 4KV8B 4AL5A 1RWUA 1FE0A 1ZOTA 1BC6A 2YH1A 4ZKAA 1HW8A 1JLCA 1NCLA 1Z4UA 3DXBA 1LW2B 2YWEA 3N28A 2FVSA 3QSIA 1N5YA 5A0YB 1YJRA 2DGSA 4OLOA 5D3GA 1KHVA 2UXBJ 2DNZA 1YRXA 2M0GB 4CH0S 1RHMB 2MYFA 3EGNA 4RW4A 2DGOA 2QYGA 3HHEA 3MCNA 5IM0B 1VYAA 1DTQB 2BQUA 2UVVA 3QWPA 1WHVA 4TXSA 4RUAA 1UZHA 3MTJA 5HMYA 4ED4A 1DTQA 1LK7A 3U02A 1X5OA 1T05A 3JS9A 1NPPA 3BDEA 3KFWX 1WOPA 1T9VA 4YQWA 3UN5A 3ZTQA 3SCJE 2HS0A 3R6LB 3SSSA 1PAUB 1YG0A 3GFXA 2ZJRQ 1WD6A 2C3OA 5CYJA 2KHCA 2PFDA 4NYZA 4QYRA 1XQIA 1SQFA 1T03A 4LSNA 4OJ1A 5J2NB 4CLZA 5L46A 5EX0A 3V6JA 3LANA 5ETKA 1S48A 2QFIA 2ACYA 1WORA 2R8GA 1WC4A 1TELA 2HNYA 3DRSB 3OR1A 2BANA 1MLAA 2V67A 3HI9A 2BDPA 5KFBA 2MJNA 2LYVA 1W26A 2B9XA 4M5JA 1S77D 2ZUGA 3PW4A 1LKZA 2Y0SD 3MM5B 8ATCB 3T5HA 5THWA 4CO5A 4IR1A 4W4MA 3QO9B 1SUQA 4RBTA 4ZLNA 2BKNA 5DM6Q 1NB7A 2VL1A 4FDFA 2NLWA 5KT6A 4C11B 3HHNB 2RHSB 5A8WA 2OEKA 3LH2S 1FFSB 5JJBA 1NK5A 1Q4RA 4HHUA 3ZZUA 4ES2A 4W90B 2WTFA 2DY9A 1J5OA 5KG4A 3U1LA 4HH1A 2PO4A 5G0RB 1JLQB 5GAHU 1K1QA 4X4PA 2BJ3A 3CJRA 1DARA 3LPYA 4KGZB 2RUSA 1EP4B 2M4MA 1RWWB 1U6ZA 2RDDA 4ZITA 3CXCR 2OPQA 5IOLA 2XO7A 2OEJA 2VICA 1NHUA 1N6QA 1L3KA 4RW9A 1JJCB 4P6QA 5KFRA 4DQRA 3ENAA 2M7SA 4M63A 3KHHA 2E5HA 1RTIB 2QRRA 2KRRA 4LSLA 4ZPDA 4B9UA 4K7QA 4MFBA 5IV3A 3HMJG 2XTJP 4ZVQB 2G2OA 2AZ3A 3OXFA 4AXJA 4F02A 3MECA 1RYSA 1MSWD 4ID5B 2F63A 3B78A 4WE1B 4JI3J 4OX6A 4PG5A 1LWCB 2LCWA 4IH5A 5KFHA 4NLWA 2P5VA 4NYOA 2R7OA 1A6LA 2HURA 3QIPB 3G96A 3KLHA 1KLMB 2YNHB 3LPEA 4KKOB 1S1TA 4TLRA 1KVKA 1RTHA 5CZVA 3F73A 4DL7A 4GKJF 5H9EK 1UEVA 2YX1A 4FF2A 4MYUA 2DR5A 4I7FB 2KZZA 2PDAA 2RB7A 1GMVA 4F7VA 4YR2A 3PYDA 1ZAWA 4JV0A 4JI1F 2EBEA 4PXCA 1UKUA 3KUHA 3GLJA 3M8QA 4KFBA 2RHQB 2XMUA 3I32A 4IG3A 4ZLLA 4UZBA 1IR1A 2L9DA 4ZPCA 4JI0F 2IVYA 1F5BA 1JB0C 1GNKA 3OR2B 1OO0B 3D0GE 3PYEA 1N52B 1RHRB 3PYGA 2RDJA 2EK1A 4B3SJ 4WKRA 1X60A 1KQGB 1U2FA 1WACA 4OIXA 1JLBB 1KTQA 1OSDA 5HO4A 1U1LA 4C3MA 3M6UA 2CPHA 3K8VA 3B82A 1FXRA 3QQCD 4PXEA 4ZP6A 2FHKA 4QW8A 2VDHA 2HRTA 2ZEJA 3CWJA 2FHMA 1YJVA 4KGKA 5DZ7A 3TO8A 1KWMA 3PJ9A 5DS7A 3UR0A 4IRDA 3ZZPA 2GX8A 4KO0B 3RAMA 3M8WA 5C25B 1RBOB 5DDPC 1V3ZA 3ADAC 3BS9A 1ZAVA 2IDEA 4HHJA 2Y1JA 1JJ2R 3IWLA 4LJMA 4YP3A 1TVRA 2AKWB 4ZPAA 4DV5F 2H9ZA 5ETRA 1PJ5A 1P8GA 3MMJA 4M5MA 1NO8A 4QOTA 3SDEA 1RT3B 2FGOA 4NL5A 2F5GA 1N34F 1OWXA 4ELVA 2Z30B 1HMVB 5JMNA 3C2PA 3O6QA 1RT7B 4C7QA 3A3NB 1HPZB 3W8PA 5GAGU 3TUZC 2OPQB 4KIAA 4TYAA 4FBTA 3HFZB 1VMBA 2YPYA 2JJ4D 5L1KA 2QA4S 2I5JA 4XAKA 2HGNA 2BQRA 1FKOB 3KUGA 5HQLA 3GWCA 1HKAA 2I5JB 3W66A 1WKJA 4LF4J 4HHHA 2IA6A 1W7WA 3IP0A 4M5HA 3J7YU 1NK7A 2ZE2A 1Q7LB 4ALZA 3CF5Q 3BGFA 3I5CA 2DHSA 2OGUA 3OV7A 1HNZJ 4EUVA 1TKXA 4A8FA 3RW6A 2JEIA 2IM1A 1T05B 3ISNC 2YWWA 2R8HA 2DGQA 1X9SA 2MY7A 4A8WA 1VC6A 4B3SF 3P6YC 3KG1A 2Q66A 3MEDA 4R5PB 4G1PA 1S7HA 4XPCA 1CULA 3AH6A 3MM8B 3P5TL 2MKKA 5C2CA 3U27A 3IG1A 3SV4A 1YJ9S 3PYFA 3AA8A 3D9BA 4F3QA 1RT7A 4PUOB 2JFKA 4ZVFA 1X0PA 5KFVA 3HLUA 5GAEU 2MB0B 2UV8A 2V68A 4HT7A 5KFYA 5HMWA 2FY1A 3G8TA 4QIEA 1SJRA 1IWAA 1N8RT 2HQIA 4U7UK 1S9EB 2I1RA 4WK3A 5KG2A 3Q2TC 3CJ2A 1RT2B 4LT6A 1XIQA 1VQ9S 1KQKA 1F2GA 2N82B 3EUNA 3DLEB 3H8YA 5ETNA 5LXYA 2ADBA 3OBIA 4YUDA 1HR0F 4O3RA 2CJAA 4DV2F 1FX2A 3DOMB 1PYTA 3DRPA 1RB0A 3KHGA 3UCGA 1UZDA 3IBWA 5DRKA 5C25A 2XI3A 5HROB 4DXLA 5C2GA 4EWTA 4QIFA 5EUHA 4DN0A 3SQGA 2DTJA 2Y8WA 2V8GA 2AWZA 2DNRA 2FJEB 2QLBB 2UUWA 1HLWA 3C6UB 4O4RA 4J90A 1IBCB 2PA8D 4JI2F 3RUBL 3H90A 3KLGA 4ZJLA 1UCNA 2ZH7A 2DR7A 2DR6A 5KG1A 1S1UB 2FTRA 4HACA 1QAJA 1TUWA 5DQIA 4IKAA 1ROFA 3M4XA 1YRTA 2RU9A 4P71A 3WBZA 2UUBF 4ES3A 1RAHB 3QAUA 4X65J 4YDDB 4LFCJ 1J27A 2E66A 2FUG9 1N54B 2WRMA 2VA3A 4CLUA 3TI0A 2MZSA 2LA6A 5H1SV 3QZ8A 4DR5J 4DSEA 2W01A 5IC6B 3VWSA 1K73T 4DR7J 1AYEA 4KYZA 2B9EA 3ELHA 1FT8A 3KK3A 1HBUA 5KFSA 2ZVSA 3D7SB 3CPWR 4ECUA 3LUYA 3O8WA 3AA9A 5DDOC 4DL5A 5KFUA 2FVRA 1WF0A 1TUGB 2JLEA 2LP4A 5KFNA 4LF1A 3AJ1A 1X9WA 4LF7J 3HD1A 5DGAA 1M0SA 4O4GA 2O66A 5A6WA 4PYAA 1NKBA 4RLEA 3VAFA 4PYDA 4L73A 3NEKA 1R7IA 4Z7YA 1HD1A 1VQ4S 1NJIT 2ZOGA 3DLGB 2C2OB 2HQCA 5BR8J 1I51B 1YJ7A 1U2CA 3AJDA 2VC1A 3LF0A 3GONA 2OH2A 3VZHA 3OHAA 2WW8A 4CCHA 1TKTB 3MM7B 4USTA 4QWDA 3UR3C 3C46A 1IBKF 4CH1A 1XNRJ 3I87A 2IM2A 3MPWA 2GIRA 1HBUB 1V5VA 4WK1A 3SFUA 1WF1A 2EFNA 1CJKA 1VBYA 1RTDA 4X4RA 4NCAA 1HHSA 3WIUA 1NDPA 2ZBCA 5C24A 3M2UB 3IWXA 3NWRA 4DPOA 1L5UA 3W3SA 2BE2A 4P74A 1WKLA 3HPOA 4NEZA 1M5VC 3QRPA 1KVJA 1GTEA 4RBVA 4Y6IA 3VGSA 2CPFA 2DNGA 3W62A 4F25A 4R5PA 1VRQC 4DX5A 2W9AA 2V94A 1OIAA 1RAFB 2B56A 3EXYA 3US5A 3GSDA 5FLXU 2GQQA 1M5OC 3IR7B 2OPPB 4OZ2A 4OI1A 3DLLQ 1SV5A 4ZJQA 5KOXA 2O1PA 1ZETA 4TU9A 4OL8A 1BUXA 3D6MB 3VCDA 1LXNA 3MAAB 3GYXB 3BQ2A 5CD4H 3PX4A 1AW0A 5KFOA 1ITPA 2QSWA 1X4EA 4IFYB 4ER8A 3KLEB 4UW2A 1N33F 1CS4B 2MKCA 1UJ4A 4LBHA 4B3TJ 3OL6A 1JNRB 3HULA 2G1HA 2LEBA 3M2RA 5AE2A 3ULHA 2DJWA 4PKDB 2DIVA 2GCFA 1H74A 1WDDA 4ZN1A 2VUGA 3CDEA 5LJ3Y 2KDOA 3FRZA 3DOLA 3CJ4A 3E01A 2ZH3A 4M5DB 2RRBA 3M6XA 3GILA 4J9UE 1RAJA 1WG4A 4F4KA 3E51A 1MG7A 1IKVB 1Y5IB 1H0HB 2NCKL 3CDAA 2FIUA 3N5BA 5E0OA 1NPKA 5A8KA 1OPZA 2BA9A 2X51A 2ZE2B 2AD9A 3BH7B 1FNOA 1K47A 4AFFA 1LK5A 2ALZA 2XB2D 5DDQC 2B43A 3LP0A 3N79A 4ZDNA 5L9NA 1MWQA 2H54B 2GQCA 2IM3A 1URNA 3VVUA 1OJ4A 3QFWA 4IH6A 1WTFA 5EN1A 1REVB 4RWXA 5C7PA 4M5GA 4DWIA 1XEZA 4C8LA 1RTJA 5ETTA 1NHKL 2MQOA 4PXBA 3NLCA 2YWKA 1X4BA 3ISZA 3T1AA 3UDVA 1C1CA 2XYGB 3KJFB 1JJ4A 1C4AA 2KYZA 1AZSA 4JB8B 4RW4B 2ROPA 3BPSP 4F0KA 2CFXA 4NRUA 1HBNA 3UVJA 4DV3J 3UDLA 2XYPB 3IS9B 3DU6A 2N7CA 5IFMA 4DUZJ 3THVA 3I0SB 4IO9Q 3TARA 2V6AA 2RD5C 1S1XA 2H1YA 2ZM6J 3G87A 2MSTA 1JJHA 4S0MA 3WHIA 1DBDA 4URQU 2KXNB 3CCUS 2ZBQA 4DL2A 5KFPA 4P2XA 2ASDA 1BHNA 1Q5VA 2BJEA 1C0UB 2R7TA 5FJ4A 1HW9A 2CJ9A 1ZPVA 2GO9A 3KOAA 1IN0A 3NP5A 1WEZA 2BW2A 1YITS 1VRUA 1F0XA 4DI6A 3BEGB 2MXYA 3PM9A 4TQRA 1VHIA 2CIMA 3GJQB 5HVHA 2FJDB 4P52A 4N41A 1OQ6A 1SJ1A 2C2MB 5HMZA 2Z58B 2LECA 3R3TA 1AXQA 2OLWA 2GS8A 1C1BB 2AJ4A 4USVA 3KK1B 1J5EJ 2MQPA 2KJWA 2X1FA 1HMVA 1YSJA 1VS3A 1HQEB 2I9SA 4NLRA 4WU2A 2QN6B 3HSGA 4NX9A 1D1UA 2F40A 2K8GA 3EVOA 5I42B 1V5IB 1FDBA 2YWHA 3DLGA 2N3OA 2IMWP 5EDWA 2VOOA 2GMHA 2PMHA 7FDRA 2EFOA 1NKEA 3X3UA 1FFGB 1L3TA 4EO8A 1X4AA 4CM2A 3TAPA 2KG1A 1CJVA 3DGPB 1VQKS 3HVRA 3EGVA 4KPCA 4QWCA 1X4GA 2ZD1B 3DLHA 3N6NA 4KO0A 2ATLA 1CJKB 4NZ7A 2MZQA 5KG3A 2M88A 1WELA 2GIQA 3B6BA 3TVYA 5L39A 1QAIA 1VBXA 2IRYA 2HFUA 2WONB 2EG2A 3TWZA 2JVRA 3I4HX 1HWUA 1OQ3A 2UUTA 2G2ZA 2Q79A 2YBVA 4L75A 4OFZA 4ETZA 5C42A 5K8MA 2CRLA 3L95X 1LFWA 4YN3B 3N5FA 2GJ2A 5ETOA 5LMUF 3U7JA 1A9NB 4DV5J 3LW5C 1SJQA 5JVGQ 1FDAA 1S6QB 1X4DA 3FBEA 1VK8A 4RW9B 3FQKA 1VJWA 2V9KA 3D4JA 3SSQA 1S6UA 1TTHB 5F8NA 5F8GA 5F8JA 5J1NA 5J2MB 3NXZA 1IBMJ 4OI0A 1FRMA 1Q7YT 2DPJA 3M9NB 4DR4F 2CQDA 3TNVA 3CCVS 3QT6A 3CJ5A 4USIA 1RKJA 2UVRA 3OR1B 3EPIA 1S0VA 2UU9J 3MCMA 1YZ7A 1MN7A 1RT6A 3FGVA 3IAM9 3MPDA 1U45A 3ZZZA 1Y5NB 2XQCA 1VC0A 1JLFA 1J5EF 3DOMA 2XNRA 3W8GA 3TP2A 3I0SA 4F04B 2M8DB 4X2BA 4N7TA 2M5YA 3NMAA 2MHNA 2MTLA 2HW3A 1DFDA 5G0RA 2MDAA 4NLPA 2EC0A 1HIYA 2B6AB 2ZH4A 1RA6A 3RJMB 2VASA 4CLLA 1NU4A 1U1PA 4NWBA 2QL9B 3C6UA 3BV8A 2W1BA 1Q8KA 3PNIA 3L09A 1NZ8A 2D3O1 1TU0B 4NASA 3D0HE 3SXLA 2XWXA 3MEEB 3W9HA 1EP4A 1WSRA 3KJQB 1PGZA 1FNXH 2QMUB 4ILLA 3MM5A 4H4OB 2E44A 2Z4PA 2BX6A 1CQNA 1S57A 4NI2B 1HWIA 2NUHA 5GAHI 4EZ6A 1SB6A 4QPTA 2F3JA 4DCOB 2MQQA 1RWVB 3BSCA 3DOLB 4YHHJ 2R8IA 2UVUA 3SEOA 4DQPA 1BWEA 1HBNB 4A8MP 3MWBA 4FXVA 1HNWF 5KT3A 4P2FA 3CC4S 1KONA 2W8KA 5LSRA 1XNQF 2JNJA 4ELTA 1VJQA 3VQTA 1VIOA 1AT1B 2FHJA 2C42A 1MW7A 2HVIA 1FE4A 1Q78A 3FUYA 4ATNA 2JLGA 1IM4A 4EEYA 2N7YA 3Q8QB 4BCAA 1UMJA 3TOQA 3VR1A 2GW8A 1WOOA 3MEGA 5LMNF 4ED8A 1RCOB 2PE8A 4K4SA 3ILOA 3G6XA 1YJWS 4WFYA 2QL7B 1B3TA 4NCGB 5LM7E 4H4OA 4KV8A 4MKBA 4ZLPA 4ZPBA 5DDRC 1APSA 4ECWA 1UPPA 2QMXA 3SIPB 3J81U 2DPIA 2B5JA 2CJXB 3GMGA 3DLKB 2J8SA 3CCMS 1P6TA 1TKDA 3NGUA 5BYRA 2QZ8A 4X84A 5K5MA 3C6TB 1NK8A 2A3JA 2QG9B 5HSPA 3B4DA 4G3IA 1YJUA 2CDRB 2J0XA 3GIJA 4DV0F 3EVMA 2G1DA 1TL1B 1WC0A 4NA3A 5IM0A 1EKSA 1IBMF 2Z2LA 2VFRA 4I6WA 4LR7A 4I2QA 2QFJA 4UY8T 4KHRA 3OL8A 3G6VA 3RRGA 4Y28C 3Q8RB 1Q82T 1QVFR 1FEEA 4OLPA 4L76A 2HQDA 3UD4P 1T0TV 2UP1A 2YX4A 2VQEF 3L4BC 2B4PA 5B09A 3GR1A 4Y00A 5L38A 3PW2A 1WEXA 2KT3A 4R8UA 4V1Ak 3R5BA 2V2QA 4IG3B 3ZTSA 2KM8C 1Q86T 1KQFB 5HQMA 1TP7A 3I56S 3EZOA 2LDYA 3ETOA 4CRJA 3V6DB 4OZ3A 3BBCA 2IBOA 1IBLF 5K20B 4CT8A 1S59A 3LO3A 1TL5A 3NS5A 4V19X 5BYQA 3BJYA 1X8DA 3UW1A 3SV3A 4Q44A 4OZLA 4PWDB 4K0KF 4KGXB 4CYUA 1FXLA 2V2VA 3M2UA 3BQ0A 4JI3F 3T5KA 4U6PA 2CADA 4QYZK 5DGBA 1N5QA 3POTB 1CJVB 3DGPA 3NBPB 2MMYA 3OQ2A 3WX4A 2C2EA 2AU0A 1HYSA 4WF9Q 2QT7A 3GFHA 2HPUA 2XLIA 3OVAA 1DURA 4KAIA 3V6HA 2NR0A 4JI0J 5RUBA 4PPZA 5F0WA 2HFOA 2HQFA 3DXSX 2AX1A 1CEZA 3I9ZA 2ZDOA 5CABA 2BZ2A 3HSDA 5E3PA 3EE3A 1U09A 2RKIA 1NK4A 4ANCA 1UPMB 1R31A 4LBIA 1UEUA 2HHHJ 2W2PP 1RSCA 1M5HA 3ZZYA 5IZHA 2R2RA 1KNZA 2BABA 3IWNC 1C0TA 2GAHC 1OYDA 2YKOA 4RR5A 2UU9F 3QZ7A 4X62J 4J9MA 1FDDA 2ILYA 1RAAB 3AFGA 3F0NA 3TA0A 1F3FA 2XZDB 2XZTB 4AL6A 3V4MA 4USMA 1VQ8S 1R6VA 4DQQA 1HBOB 2C2ZB 3CMAS 2WVDA 4ZHRB 5H9EJ 4Q8EA 1M1HA 2DEIA 3SBMA 4RUBA 4QZVB 4CO3A 1Y9OA 2V0NA 2ZC3A 3HSJA 4IG0B 4LQ3A 2AJFE 2WB4A 4YY3J 1NDKA 2RQ4A 2WB1D 4L3NA 1MWZA 1UL3A 1YLXA 5ADZA 3TUPA 4ID5A 4OYOA 1N34J 2RVJA 3BR8A 4ZCIA 5F8HA 1AUSL 4J9LA 3D66A 3PJXA 3KJVA 2DITA 4DV4J 1Q8IA 2XLKA 1FRXA 4KGMA 1YWXA 3QGPA 3LAKA 5F0UA 4ZVGA 2K06A 4OYIA 2BR0A 3OTDA 4UF4A 3DI6A 4I2PB 4PWUA 1RZMA 3HFKA 2E7XA 2BBEA 3WZ0A 2JHEA 3H4DA 3OSPA 3PRDA 2FVPA 1DLOA 3VGUA 2DGVA 2IAJB 3LQVA 1PJ7A 1TAQA 3ILJA 3BDPA 2B0GA 2BQ3A 1TFWA 2R7SA 1BMQB 2ZKTA 5J2NA 3P5BP 1RT5A 1YGYA 2CVIA 1HARA 5DZ6A 4J9SA 2GHVC 1UJ5A 2FJBB 2HBZB 5FIIA 3D67A 2ZH9A 1KR4A 2HHUA 4WFAQ 5KFZA 3Q8YA 4H54A 2D3OR 2MSSA 3EX7B 2BE7D 4L3KA 4ZS6A 1F5AA 3H4BA 2FLNA 4AD6A 2XM3A 3MGJA 1DTTA 1WUUA 3RG6A 2FZGB 1QE1A 2MKSA 2OMOA 4TVAB 1S1XB 3CUNA 4ED2A 1ZTWA 2IY5B 3TVZA 5MAOA 3VAKA 1I94F 4LVOP 1NSPA 2ERRA 4DSJA 3N4WA 3S6EA 1K0VA 3CO9A 1PAEX 3THPA 3CCWA 1V3RA 1SXLA 3AJ2A 1Q81T 1NM2A 1TKZB 2HGLA 2X7IA 3KJNB 3LAMA 2PMZD 3Q86A 2M9KA 5IQ6A 5KG5A 1L3SA 3Q22A 2W9CA 1NHVA 1RT3A 1ULRA 2DEJA 2B8PA 2OO4A 2FVCA 3BGUA 4NCBA 1P1TA 1S97A 1U24A 2FJVA 3BKTA 3RAXA 3UN3A 2CA9A 4UTGA 1FJCA 1T03B 3HVTA 3C66A 2LU2A 3DMJB 1F9HA 5ETMA 2E9ZA 3KDNA 1ZYQA 2J8AA 2NSCA 2R8JA 4PZVA 1NJYA 1GMWD 1PBUA 2AYEA 1XJWB 3BM7A 3F41A 4TN2A 1FNMA 1RT1B 2LA4A 3R8YA 1RAOA 4C2MA 3V4IB 3D6TB 4LF5J 4QWBA 1SL1A 3I9V9 3MOZA 3L9ZA 1OPIA 2VQFF 1FJGF 3RAQA 1JMTA 2WVBA 3CD5A 3CW2C 2N4DA 1NEEA 3FVYA 4MKYA 4WP8A 1Q53A 2DNQA 5KFJA 1TL7A 2WVEA 2C1EB 3BGOP 3FEZA 3LP0B 4YB6A 2A6OA 3G86A 1HWJA 1O5JA 4MJKA 5JUMA 2EC2A 4L6V3 4FKXA 1TK5A 3M8PA 4MK8A 4C0BA 3PCOB 4ZVRB 2VIHA 2BM0A 2J9DA 2G0JA 3NCQA 3W64A 3EPGA 1D09B 2HRYA 3HKZD 1GH8A 3IRWP 2KTQA 2HHXA 1JLEA 2DVIA 4GKJJ 4PQUA 1D9AA 3GFYA 3QAEA 2RKIB 1T02A 1X5PA 5J2MA 5K8PA 1NDLA 1PC5A 2YKNB 2E7WA 5J2PB 3JAMU 1M90T 1HQUA 2DISA 1JIHA 1H73A 1N0UA 1CBKA 2LQ9A 5GMDA 2QMWA 4DU7A 4LUBA 1HWKA 3W9IA 4LFBJ 1SCJB 4MH8A 4WP9A 4B9MA 1NSKL 2OPSB 3F56A 4IG0A 4MIWA 1JKHA 4UZCA 1S99A 1RXOB 3QGIA 3ZNUA 4QW9A 1VQLS 3GTYX 1OMSA 4DX6A 1CC8A 3H5XA 4TU8A 1FDNA 1WC1A 4ZHRA 2W2QP 3FMWA 4X4UA 2VG6A 3A8EA 5HLFA 3WDOA 1N33J 2CJYB 5I4MA 4LRBA 4D3GA 2ROEA 1U25A 4OI3A 4I7FA 2HEKA 2QA4G 2DR9A 3M32B 4UQTA 1SH2A 2JLFA 3N6LA 3ET6A 2CPXA 2V9WA 4R0EA 2QA1A 1JLGB 2DNLA 2Q43A 2W7PA 2FQQB 2XY6A 4ZA1A 2WBRA 3I55S 4ECQA 5HI7A 1WJ9A 1JLQA 1NSQA 1MU2B 4DV1J 3T9ZA 3G6YA 3O44A 1MNEA 1NUEA 3UD5A 5E3QA 1RACB 1RP5A 1S9EA 5CYMB 4O3PA 4URGA 4J9VA 3DOKB 4IDKB 1SKUB 1UFWA 3JSYA 3UCZP 3N01A 2OTLS 3KWMA 3W2VB 3M2VB 4PCQA 1PKUA 4N5SA 2CKWA 2VG6B 1GMUA 3AQPA 5HLFB 3DLKA 5ETPA 3AY0A 4C9DA 1KN6A 2ALYB 3ITHA 2RILA 3G82B 1N0VC 2HHWA 2JL9A 3W63A 2NYIA 1GFWB 2VF3A 2ASJA 2HNZA 3M8YA 3I96A 4AYBD 2AJ2A 2IPOB 4LRDA 3QIDA 1FJEB 5IC4B 2JVOA 1BXNA 4LFBF 3TEHB 4EFAC 3ENWA 3PV8A 3IAS9 4ZPVR 4EI2A 4RW6A 4EO6A 1HHTP 4RWWA 1K1SA 2XMJA 1L3UA 4ETXA 4LFAJ 1RT4A 1O51A 2HHPA 4G1IA 3RBXA 1PYOB 3MMCA 3PHTA 3QYYA 4GRSA 1V3SA 2EFPA 1VQPS 1T3NA 4G6VB 4NE9C 1SKWA 2UVWA 3R2DJ 1JXLA 4F4XA 2G0IA 1QSSA 4KR0B 4LIRA 5B0DA 3LP1A 2XGPA 4OYZA 2BJ7A 1VQSA 3PFOA 4P10A 1E6VB 1Y4ZB 3MPUB 2MZJA 1UW9A 2Z8QA 3TRGA 4CWBA 4QQBA 4EU0A 4Q7AA 1KVIA 1U7LA 1RT2A 1WC5A 2Q3PA 4O0NA 3Q8PB 3EMTA 4DSKA 4NA1A 3FJ2A 4K5RA 2CWXA 4DV0J 1NDCA 3WQPA 2VBWA 4RUHA 2IBKA 2DNYA 3PRBA 4J91A 1ZBTA 1DZ5A 1LNQA 1YKWA 3MAAA 4O44B 2KVQE 3CCJS 3SMZA 3MOJB 1VIXA 4DN9A 4DUYJ 3QWUA 5HL7Q 2DK2A 3R7BB 4U8YA 2F8EX 2D9OA 2AEMA 2UXDJ 4PUOA 4QYZJ 1YDLA 3HZGA 1Z2LA 2HZAA 3VTIA 2WZ1A 2W7OA 5HN0A 4F3MA 3HVAA 2ASYA 4C8OA 1NJXA 5AE1A 2R2SA 2J6SA 2KZMA 2QYCA 4LSZB 2DHHA 2B7CB 1UA1A 3I0RB 1H2TZ 4YFUA 5HAOA 4EBCA 3LP1B 1D8ZA 3O2IA 4Q2LA 3K5NA 2KFZA 2R7XA 4OYBA 4F3OA 3ZXWA 2FGCA 2VJVA 2G2YA 4JI7J 3JXOA 2QIFA 1IKXA 1S10A 2YKPA 2JC0A 1NBEB 2OAUA 2YNIA 3CJ0A 4LRCA 5EWGA 2H65B 1SVDA 1XWLA 2RIJA 3HO1A 3CE8A 4OX9F 3KKFA 1JLFB 3BGLA 3BREA 4RNNA 3H2VE 3CJKB 4F26A 4FXDA 3Q89A 2J7KA 3T9NA 4N77A 2ZWPA 4DCPB 2HVDA 3HHLC 4EZ9A 4HDHA 4F4AA 3J7YI 3ET6B 2HVEA 1S6QA 3GQCA 3W60A 4F50A 2GMLA 2PI4A 2OSRA 2DCUB 3FFIB 3D1HA 1UVMA 1U1RA 2UV8G 4DR3J 1FRLA 4Z2XA 1IBLJ 4NLTA 4N8NA 4L74A 4U9RA 3KK2A 1I6JA 2RS8A 3DC2A 5CYQB 2U2FA 4KSEB 4ZVUB 3T6BA 4K2XA 2IJFA 4DR1J 3RB6A 3M30A 2E5LJ 2NQPA 2OFHX 3KDOA 4CLPA 4C48A 3MURP 2VC0A 4X64F 1RT6B 1SI9A 2DH8A 3D2WA 1FERA 5E5NA 3UE2A 3W2VA 3P49B 3GG1A 4DF8A 4JI5F 5CH7B 4P73A 1Y00A 1SC6A 4A8QA 2XY5A 3OJUA 3QRRA 4LF9J 3GJSB 2P9CA 5K14B 5J1PA 1B99A 1IQZA 3FCWA 3HX9A 1IJEB 3DGVA 4KTQA 2B9WA 1KRPA 4I0WA 1RTHB 4PEOA 1LWFA 4QIVA 5E33A 4BC9A 5B0CA 4YHHF 3OTOJ 1QAXA 4MK7A 2CNOB 5D8HB 2K3IA 4UOCA 1H6KX 5DM7Q 4DQIA 2CVEA 1RHUB 3OT9A 3TVKA 1YHQS 4WZQA 3M8QB 1LEOA 2GV1A 2AYBA 1QUVA 3H0PA 1PIEA 2DYAA 1UWBA 2GNKA 2VBZA 3TR5A 3PKYA 2YKMA 4DPYA 2XCPA 2QLFB 2MLYA 3DFEA 3FFIA 3FEXB 1SIZA 3SFGA 3UQSA 4ZK7M 3OHBA 1EETB 3IC1A 4HDGA 1WOSA 3THTA 2FHJD 4DQSA 1C1BA 3KK1A 2A2DA 4ZPWR 2VG5A 4DL3A 2DNMA 4QIWD 3MEKA 4HLBA 2F8HA 5KG6A 3TZWA 2BJ8A 3NAIA 4AE5A 1Y10A 4CLWA 4Q0BA 3HXMA 1P9YA 4BBYA 5F8MA 3Q8SB 3OFGA 1XMOF 1KEKA 4DS5A 4U8VA 3R5DA 3RBZA 4K4YA 1IKYB 1EARA 3DN9A 5D0GA 4OHZA 2WK4A 4CLFA 2P9EA 3EWGA 5MLCV 2WONA 4DR6J 4ZVPB 5DETA 4M1KA 5BR8F 2HYIB 1FO1A 2E9TA 3CJ8A 4UT4A 1N36F 1RWPB 1VRTA 4LF6F 2HVHA 4Y2AA 1XK8A 2LVWA 2D1CA 3RBDA 1FCAA 2HK2A 4QJVA 1NK0A 3P3DA 4K59A 2HWHA 2WSFC 2MKHA 4I1TA 5H9FJ 1CULB 3TZZA 4DUYF 1RJJA 1H72C 3M2RB 1T9TA 3VGVA 3T1HJ 2DO0A 2GQ2A 4YS2A 4K4TA 2FLLA 5HJXA 2IC3B 3M1VA 5KFXA 1RTJB 4CTAA 2DXEA 3TJ9A 5AJ3J 3BO2A 3CDBA 1KDNA 2PD1A 1KOOA 1VLYA 2DBBA 5DG7A 1MMLA 2X1AA 1YBUA 3GB0A 1SUQB 2DNNA 3K5MA 4C8ZA 2I8EA 3OTCA 2V5HG 4JUZA 4YB1P 3L7UA 3CJQA 4K4UA 4BHQA 4LF5F 3FSXA 1S5ZA 1XR5A 3D68A 1NLKL 1Q8BA 4C6AA 3VALA 2E1RA 2F9JA 1BQXA 3RB3A 3F44A 3J7AN 3O1LA 2ZOFA 3IM8A 1KLNA 2X1BA 3QGGA 4U95A 4I69A 3HDSA 3E3XA 2CPIA 2ZBIA 1IKVA 5A8KB 5C5JA 3L3CA 1LW0B 1WSVA 1BQMA 4J5OA 2R7WA 4K0KJ 4Y2KA 4Y2MA 1REVA 1K0TA 1QTMA 3ETMA 3H2LA 1Y11A 1LW0A 2FYXA 4P72A 1QAYA 5GVQA 3UCUP 2E7VA 3AD7C 3EDRB 4KT0C 2AJQA 4USWA 4O44A 1FRIA 2YQ1A 2KN4A 4KHMA 4A8YA 2OUGA 2RDIA 3OD2A 3PVXA 3O3LA 3FMBA 2H4YB 4OX9J 2EVZA 3TAQA 1H7WA 5IXUA 4IFYA 2I6WA 3EJMA 2XHCA 3OL7A 2HQGA 2GVDA 4NLDA 3DU5A 1RQ0A 4QWAA 4IR9A 3GG0A 3CD7A 5CCLA 3I31A 3QPIA 4DMZA 2AEFA 4PG4A 1XNRF 2MLZA 2ZHOA 2VKRA 4UY85 2DKOB 2HFZA 2DGWA 5I3QA 1N4LA 7FD1A 3ILIA 5LT5A 3G9CA 2ADCA 3G82A 2CXEA 4FN5A 4EBEA 3IR5B 3QNWB 3DDKA 4C97A 3OUYA 3PKMA 4BS2A 1FRJA 1HQ2A 1W25A 4U7UD 3GJRB 4DFKA 4B3MJ 4ZLJA 4FKYA 1N56A 1Y7PA 2WVFA 2WVCA 3JQJA 4USHA 5M2RA 4GKKJ 2VQEJ 2W2NP 1VRTB 4DPWA 2H48B 4CDIA 1FTCA 2YKMB 2DRBA 3V5RA 1HI0P 1VQ5S 2ILZA 4J9PA 1K44A 1T7PA 3WC2A 2JDJA 5D4OA 4WYWA 2W4DA 2EKYA 3ZZRA 2OIHA 2F1FA 2DNPA 4D3HA 1N5YB 2BJ1A 4PG8A 4P9SA 1FWKA 1U02A 4JP8A 4IRKA 5KFWA 1U0HB 1HI8A 2DGUA 3AOBA 1FF2A 2DNKA 5M2UA 3FSIA 3DYAB 1H2UX 3V6KA 2E29A 1U1NA 2WW4A 3CIMA 2Q6BA 2VG5B 1I3OB 3PR4A 1PILA 2IA0A 1HYSB 4AT1B 2MEWA 4DSFA 3MMAA 5HP1A 2H5JB 5I3UB 2HNZB 2ZITA 1T11A 3CJTA 2HBRB 2ZH5A 3QIPA 1DRZA 3MMAB 3NMRA 1G7CB 2GO8A 3M8PB 4P75A 3H20A 3BSNA 4DV6F 4ELUA 2ZH1A 1H2VZ 1VK3A 2AIRB 4ZMMA 4IOCQ 4Z7CA 5GADU 4O4GB 3DRYA 4F0MA 1PO6A 3IGNA 4B3OB 3AHPA 1GMWA 2HLUA 1KFDA 1TV6A 2JWNA 2V69A 3C8YA 3GSIA 5HQ8A 1R0AA 4B3OA 4FYXB 1FEHA 3W9JA 3FKBA 3P45B 5HBMB 2QLWA 2ZKUA 2C28A 2W9BA 2VFSA 4P2MA 2XY7A 2B4OA 4LF6J 1JKHB 5ETSA 1S9GB 2R3VA 3C6TA 4PWDA 2K7JA 2UUCF 2IJRA 4ICLA 3DLEA 1CG2A 2LMIA 2E1PA 3QT5A 1FESA 2HVZA 4WE1A 1RKIA 1IXKA 1FK9A 2UUCJ 2XG8A 3CJ3A 1JXEA 1NAQA 1ZZNA 1CJUA 2BKOA 3U1MA 1YJTA 3UI3A 4YY3F 4JV2A 1YIJS 4B3RF 4DFJA 1HR0J 4OZ1A 4DG1A 3G8QA 1ICEB 2Y1IA 4ZVHA 1QM9A 4L72B 2NPFA 5HROA 2SXLA 1ZTTA 3CSKA 8AT1B 5FLXY 5F9LA 3ZZOA 1EZZB 1TKZA 2QLJB 3FCVA 3CMQA 3NWGA 5AXLA 1F5CA 4PRFA 2KFNA 3GR0A 4K4WA 2HHVA 1MWYA 2ZC4A 4NYPA 4N56A 3MHYA 5D77A 4C98A 4B17A 2MKIA 2RRNA 4WKYA 4JI2J 2HNDA 4RUCA 4ERDA 4UUWA 1GQEA 1KOHA 2O67A 2HNYB 3DRSA 4IYQA 2UUAF 2XSJA 3SI8A 3GP9A 4QR1A 3PZPA 4LF9F 2GVDB 3GV8B 1TK0A 3AXKA 2XS7A 3HJVA 2FC8A 2CPJA 3LP2A 1W2IA 3V4IA 4YMEA 4TQSA 2XHWA 3M8ZA 3NGDA 4ECZA 4YR3A 3OJSA 4KE5A 4JV1A 3HF5A 3MMBA 4QPXA 2VJUA 2BVZA 2AHOB 3TUIC 4RNOA 2CJKA 2VBXA 2AJ0A 2OI2A 3GJTB 4YEAA 1DY3A 5B0GA 4C3LA 1U48A 1JXVA 3UDCA 1UWAA 4OJHA 3DLBA 1ZM3A 4O3QA 2ATCB 2ZH8A 5U47A 3OVSA 4A46A 4HKQA 5AE3A 5EX3A 2DIUA 3KJVB 2DO4A 2HK3A 2MZRA 3J80U 3NG8A 3NOCA 4WXWA 2UUBJ 1JQGA 3MMCB 3BKUA 2E1CA 5IT9U 2UXDF 2OKQA 4RO0A 4U7CA 2JEJA 1LW2A 3CJSA 9RUBA 4KHPJ 4C0OC 2QE5A 3OR2A 5CD4A 1XNQJ 3IO1A 1C4CA 3S01A 4ANDA 1TK8A 4ZVEA 2BMBA 7AT1B 1YRUA 2HFSA 2VHGA 4J9QA 4FPRA 4DV7F 1E6VA 5C42B 3PY8A 4ID8A 2R7UA 4I64A 4RNHA 3FBBA 2FLOA 2RJZA 1NPRA 3SCIE 3HK2A 1T8EA 4JI7F 1P9QC 2ZHBA 2E1MC 4FS1A 2RQMA 4CT9A 4QU6A 4DX7A 2XEXA 1SC1B 3J7Z5 3JB9k 2KXFA 1NJZA 3DHWC 4W92B 4OX7A 1U6BA 1MROB 4PAAA 3RYLA 4K4ZA 2BE9B 2RUGA 3AOCA 5AJ3F 2YH0A 4LBPA 2R2UA 2VG7B 3D3BJ 2AYMA 2CQ3A 3CULA 4XO0A 2Y3YA 2C22A 1X4FA 2LKZA 5KG7A 1Q1KA 4TNOA 4AXIA 3PXGa 1HNZF 1UFLA 2CQHA 1S9GA 4Q2MA 2AX0A 4NOHA 1T3OA 3W2WA 3KNAA 1VR6A 4DV6J 2BEFA 3OL9A 4A8XA 1ZA2B 1WHXA 2M8HA 4USKA 1EB0A 2B7BB 3EGWB 4LRAA 1OY9A 4KFBB 2F4VF 1RAEB 1RCXB 2CJBA 3NAHA 1GTHA 4KC5A 4CTAB 1U0SA 2X1GA 2CPYA 3C19A 4OI6A 4DHVA 4ITSA 3QATA 1PC4A 2KFYA 2YXLA 1N5VA 5KFCA 1VDHA 2ZD1A 2NSBA 3MCSA 2ZH2A 2AGOA 2FVQA 4YDXA 4ZPTR 2Z0GA 2QC3A 5FD1A 4ED7A 2F7VA 2XSFA 2COLA 2I38A 2VODA 3AQOA 1S9FA 3D3CJ 4DR2F 4M5KA 2EBGA 2MQLA 5A8WB 1X31C 1YBAA 2YKQA 4WCEQ 1F60B 1U8SA 2VDIA 3K5OA 4WTYA 1M5PC 1B7YB 1QLNA 3GFZA 1KHWA 2BYCA 5D0HA 2W4CA 4QU7A 3KK2B 2EXUA 1KKHA 1XN9A 4F67A 2HAFA 1EQMA 2IRUA 3A12A 2XMAA 1ACMB 1FKPB 4ZP8A 4H4MB 2CZ4A 4OJ3A 1B64A 3PTWA 1NSAA 1WC6A 5IT0A 2MPUA 3PW7A 3RZAA 4JI6F 4KY3A 5CAAA 4A8OA 2GIFA 3K89A 3MAQA 5CXTA 1MN9A 2AGPA 1TR0A 4PQAA 2F8MA 4ZN3A 5KTQA 3PX0A 4LF4F 4PPDA 2P6SA 2FJXA 1SC3B 1EAYC 1HBMA 3BB5A 4WJBA 4A4JA 5CHCB 5LOQA 1YJNS 2YPZA 3A3PB 3H98A 2W25A 1WI8A 2DHGA 1LXJA 2XULA 2WAQD 3BBFA 3ILLA 4OQJA 2KB2A 5KFGA 4CLTA 3CNQP 4EBDA 2X3DA 3G6ES 1LV5A 3ISND 5E2QA 5FDLB 2HBQB 3DLJA 2YWFA 2N3LA 5J1EB 1KC8T 1ZM4A 5AXKA 1VGYA 2L48A 4LFAF 3TAMA 4HL9A 2KJVA 1RADB 2CJQA 2ZNYA 3NS6A 3TJAA 2GVZB 3IRXB 5A6PA 2W7AA 5KFAA 1C1CB 4DS4A 3MEGB 2ZJQQ 3TANA 1WF2A 2F9DA 2XMTA 4QBUA 1EX8A 4LIWA 1G6BA 3C16B 4RW8A 4ENOA 3H40A 1HL6A 2A10A 3MFIA 2R8KA 1IBKJ 5A76A 2Z56B 3CEDA 5D3GB 5HANA 2Y8YA 2PA3A 4F36A 5DG8A 2GFFA 1X0FA 4OHWA 2YKAA 3PEHA 4RU9A 3CCLS 1G3OA 2HFVA 2CQ4A 1DTTB 1RISA 1GT8A 3EDQB 3BBBA 4WXOA 3QJJA 4DV7J 4ED1A 1OY8A 5L1IA 4JV5F 3KHRA 5LL6d 1AFIA 4EYHB 3FBCA 5FDLA 4CM0A 5J1EA 3JSMB 2W9CB 1NNDA 4GMKA 4TKTA 4J9NA 2DR8A 4V19J 3T41A 1DQ9A 4C4WA 2VPWB 2PGCA 2GVZA 3IRXA 4OYAA 4Y34A 2AW0A 2VB6A 1AA1B 2RE1A 2NS1B 2XBPA 1EQ0A 1H7XA 4WBFA 4OHVA 1BLUA 3HZEA 2RSQA 5KFMA 2KRBA 2HHHF 2UXCJ 4NCGA 3BGRB 2CZVC 2ZBPA 4I56A 4LR9A 1XMBA 4Q5VA 1Q16B 2EK6A 4FP9A 4RKUC 2V4QA 4JYAF 3BGRA 2JZ5A 2MJUA 4BLGA 2V63A 2GAGC 3T1YJ 1A0OB 3C14B 4DF4A 5D6GA 1TFYA 2M70A 2FJAB 2KXHA 1UETA 1RK8A 2DHXA 5DLGA 4HH0A 3C16A 4RW8B 5F8IA 1YK9A 4RZRA 1FHTA 2DT9A 4K8RA 3VGTA 3H25A 3WC0A 2RT3A 3OTBA 2AP6A 1TKXB 1WKKA 1QJHA 3NGKA 4CQ1A 1XC9A 4DG1B 3C15A 3PO5A 4B3TF 4X4NA 6AT1B 4G65A 1AROP 2G4BA 5KT2A 4LF2A 2OHDA 3R27A 1UTAA 3L7OA 5K8NA 2OPPA 4BWMA 4DR1F 1GAOA 2HS4A 1D8YA 4ECVA 3IBCB 3NKYA 2HMIA 2KL8A 2VFVA 1TL4A 4RW7A 1KSPA 1JLGA 3CT9A 4DX8H 3W1YC 3NCPA 1U4BA 1EIYB 4LREA 2HBYB 2PIIA 3VAJA 4FF4A 3AB2B 2DH9A 4DR6F 1M1KT 2B51A 4FYYB 4KPYA 4YB7A 4K2JA 1TZ0A 4RL1A 1SBRA 2J0WA 4CNZA 1TAUA 3DOKA 4IDKA 4OYWA 3U1NA 4ZP9A 1YI2S 3R97A 3KLFB 4DZDA 3CTRA 4NMXA 3NBPA 3EVWA 3SQOP 1VQ7S 2B3TB 4IOBA 2ZZTA 4CO0A 3TX0A 4Q45A 2ZM6F 1ZZFA 4JYAJ 4NMLA 4JI6J 2JSXA 2MQ8A 1RABB 3HHLA 1G2EA 4PABA 5E41A 3TJ8A 5J2QB 3BYRA 2PSZA 1P1LA 1R3NA 1S1TB 3MCOA 4PWWA 4XTTA 3BSAA 1FD8A 1NH7A 4XDDA 1SIWB 2LQ8A 3SQGB 1SJ3P 3W5XA 2GZOA 3ZZTA 1XMQJ 4C8YA 5LJ5Y 2VOPA 2AEJA 1RDRA 4LF8F 2ZWOA 1O6XA 3K59A 4CI0B 1FX4A 4F4YA 1S1UA 4HACB 5DQHA 3H7HB 4QIGA 1R6YA 4ZIVA 1N48A 3D54A 4NPOA 3EGZA 1TUVA 4P7VA 4MFBB 1SL2A 1HQUB 5IWAJ 4LF8J 3BQ1A 3CO0P 2BW7A 3FBFA 4DDFA 4JI8F 3SYZA 4EK2A 4WFBQ 1HQEA 1S72S 3D28A 2NXUA 2CG4A 1HHQA 3I4PA 1TL1A 1HD0A 4WU3A 2XC9A 2CAJA 1WWHA 2VKZG 1WTBA 1V9OA 2B9YA 1LWFB 2HFNA 2YQ0A 4PXDA 3S7RA 2HQ3A 4N8OA 3Q0AA 2HLTA 4DR7F 2QJ3A 3B8HA 2OD4A 3T1HF 2IIHA 4M5IA 5AT1B 3NGTA 3OUYB 1U1QA 1BE4A 1FA0A 2VONA 4A8KA 1C0UA 2EFQA 1A7GE 1HNXF 1M1GA 3ENQA 5LMNJ 4DL4A 3DRRB 4OZNA 1S6PA 2Y1LB 1UP1A 4RX6A 5T7LB 2DGTA 3M9MB 3NNCA 3K17A 4X65F 1ZAXA 2GMJA 4I6AA 4P7TA 2C2KB 3TQEA 3TW0A 3LA0A 4QWEA 2M52A 3M30B 3X1LB 4LMZA 2QO3A 2ZDPA 4F2RA 4B3MF 1R89A 3A4TA 3KLVA 3CCQS 4IO1A 3GV5B 4E0DA 4ED3A 3ZFVA 4HYKA 2LQBA 4DR2J 3MM9B 2E9RX 2C3UA 4QR2A 2PC6A 3BPDA 2YNFB 1SC4B 2XNQA 3QO9A 2LLZA 4NLXA 4O3OA 1Q5YA 1IM6A 2HS3A 5F3ZA 3IN5A 3C15B 3IA0A 1FVQA 3MZIA 5H9FK 1GXUA 1XR6A 2M3DA 2PEHA 2RRAA 2I0XA 1QY7A 2WSEC 3T1YF 4MT1A 4USJC 1VRUB 2RU3A 5D4PA 2YNIB 1GXLA 2Y1RI 2VZ9A 3D1OA 2OSQA 4E2FB 1OYEA 3UNYA 3SSRA 4X4QA 1Z2ZA 3ZTRA 4C3KA 1VFJA 3GYNA 3HT3A 4ED0A 1GX6A 2V8HA 4DL6A 3FDSA 3OFFA 2HG4A 2MKJA 1WDTA 2CQIA 3AAWB 1QSLA 3QJPA 5HJYA 4KHPF 2CQBA 3PG9A 2G13A 5DQGA 1X7VA 1VHFA 1BD6A 2K7KA 3HP6A 2XI2A 4OZ5A 1WG5A 4WYLA 3CGIA 4MTPA 1FK9B 4FBUA 1IVZA 3N6MA 2JOQA 2Q6CA 2RF2B 1SH3A 1FKOA 2OEMA 3AT1B 4HR2A 4P2SA 2X3GA 3PW5A 4HT5A 3PIPQ 3S1TA 2DNOA 2RH3A 5A8RB 5GADI 4IQXA 4DLGA 3OSNA 4K4VA 3MAHA 2VA2A 3OPKA 4F0HA 1Q79A 2FB0A 4M95A 4RBUA 3UNGC 1HBMB 1IKYA 5AXMA 3KMSA 1NJWA 2CQ0A 1D9FA 2KH9A 2APOA 4TLQA 4PR6A 1TMMA 2BACA 3BN4A 3P8BB 5F3TA 4DFPA 5F8LA 1S49A 2XMVA 4X4TA 1BQNA 1RGVA 4OHYA 1JK9B 4GC6A 3V81A 1TQLA 4NLVA 2V8PA 2CQ1A 2CG8A 2R7QA 2V34A 2XSJB 3OXLA 3QFHA 4E98A 2LFVA 1KQSR 3T3FA 3MR2A 4MIAA 2HHTA 4Y2CA 1FKPA 1JLCB 2V2ZA 4TY9A 5L1JA 1S6PB 3ZTPA 3R2CJ 2HAIA 1JLAA 2XMWA 3P4UB 3CMES 2WSCC 1GEHA 3M6VA 3BZQA 1IJFB 3M7VA 4JOUA 4NLYA 3VAMA 3PW0A 2LXFA 1D3WA 5L9XA 1UVIA 3W65A 1GX5A 1RLCL 2IMOA 2VBYA 2L08A 1ELOA 1CQMA 1AFJA 1YBTA 4JI8J 5EWFA 1YZ6A 2LXIA 4C8MA 2ZUAA 4Q0BB 4IFVB 2RS2A 3IFEA 4H4KA 3PEJA 3RR7A 2E5GA 4B9LA 1BGXT 4OI2A 4IFVA 1WEYA 2YNHA 1FWPA 2HRUA 3I5AA 3NCRA 4B9NA 2HIQA 2YQ3A 2CUYA 2JH3A 5KFTA 5I3UA 1HWLA 4JI4F 3QJLA 2Z57B 2CQCA 2MQNA 2O3DA 4I2QB 3MXHP 1B0TA 1IR2A 2ROGA 3FCHA 4NLOA 1S1VA 4R8UB 5A2QY 3CDWA 2K3KA 4KKOA 1JLAB 3MF5A 4F8RA 4DUTA 3KUEA 4J9RA 4B9VA 3K58A 3AD9C 3RTVA 4FS2A 2C3YA 3KNGA 4YB5A 3VVTA 4CNYA 1IWGA 5I42A 2H3EB 3KYLA 1TL3B 3OLBA 3D0IE 5EWEA 2OP5A 1HBOA 1DAXA 2YNGA 2BM1A 3HHDA 3R5JB 1UAWA 4QR0A 5CYQA 1RU1A 3CDUA 4OX8A 4CZCA 4JBCA 3V6DA 1WG1A 3Q8UA 1T94A 3EXCX 5KAKA 5HVFA 4FNHA 2CNNB 4F4WA 1EKRA 5HK4A 5KT4A 3EZUA 2NXJA 4I4BA 3MR5A 4DUZF 1I94J 1I5OB 1Y3JA 2VQFJ 4B3RJ 2KI2A 2OPRB 3G71S 4F4ZA 3PX6A 2AF6A 3FC9A 3CC2S 4LF7F 4DV1F 1HNWJ 4DEZA 3MD3A 3QT8A 4B9SA 4X66J 3JYTA 1N32J 1HFEL 2R4FA 4H4KC 2E5JA 4ES1A 2H4WB 3W5ZA 3B54A 4DPXA 1N5SA 2LEPA 3H42A 2LXUA 2XLJA 1DQ8A 1HNIB 2D41A 2BV3A 2ZFHA 3IR6B 3Q2SC 4MYTA 2D7SA 3OFEA 2J9CA 1KBRA 3GPAA 4TY8B 5LMUJ 3JAMY 2UXCF 2NXEA 2QLXA 2B5JB 3ONQA 3WIVA 1N36J 2Z2YB 1O0PA 5KFKA 2XS5A 1H98A 2ZNZA 3O5TB 3MEEA 4ZVOB 4NRTA 1S6OA 3ZO7A 3VAGA 1FJGJ 4Y3CA 3AB4B 2Z2ZA 2BJDA 1Q95G 2R42A 2MQMA 3CIZA 3CCTA 2L3MA 3DDIA 3FZ2A 3I0RA 1RHQB 4NLQA 4C8KA 2WBMA 1PJ6A 1I1GA 4K50A 3FQLA 3TX8A 4X62F 2GJFA 3T5JA 2ZH6A 2EEYA 3H2UB 4F2SA 3TYTA 1BY9A 2CNLB 1YVFA 2VPXB 4ECTA 2LDIA 2N4CA 1FD2A 2EG1A 3M8SA 1F2HA 1RBAA 2DRAA 1FRKA 1Q0NA 3K2YA 1X4HA 5IWAF 5CCMA 3CCSS 1UFKA 1J2VA 2K1RA 3BR9A 2ZZMA 2J76E 3MM6B 4K5SA 2EFGA 3TZXA 3FZBA 5M2PA 5L1LA 2HWTA 3DHXA 2U1AA 3MM6A 4HTIA 4CLSA 5HVGA 3J7ZT 1B0PA 2NPIA 3SZ2A 2NUUG 2GGPB 4OV6A 2RQCA 4Q43A 2E5IA 2XMMA 3I6PA 3ZTOA 3QRQA 2BOPA 4TY8A 1S0MA 4O3SA 4QCLA 1VISA 4OHXA 4WIIA 5B0FA 3VV2B 3GIKA 3R1HA 2D3ZA 4WFZA 4BC7A 2C2RA 1RWKB 2KU7A 3JQKA 1NMEB
chains in the Genus database with same CATH topology
5A0YA 3JSRA 3BO3A 1R43A 4OZ0A 3SCKE 1U1MA 1VQOS 3VAHA 2BRLA 2I2YA 2IYGA 3TA1A 3L7PA 2MGZA 4J37A 4DOZA 5G4DA 1VQNS 1S76D 3M6WA 4I67A 5E3RA 4M8LA 2J7WA 2OJ3A 3KLHB 4FF3A 1V6HA 2FJWA 2ZOMA 1UJ6A 5KT7A 1YQHA 2OFGX 5LSOA 4X4OA 2MZ1A 3VQSA 4UQGA 1CC7A 1HNIA 1SJ4P 3PFEA 1R8HA 1DLOB 1XMQF 2ASLA 1AUDA 4A48A 2GC8A 3VAIA 2HNDB 1UVKA 3SDEB 2V8DA 1X5SA 4ZP7A 3KG0A 1VQYA 4ZCLA 1Y5LB 3UFCX 4CO2A 1FTRA 5CYMA 3ITHB 4CO1A 4DL0C 1NK9A 4O3RA 3RW7A 2OPRA 1SKRA 2PI5A 1WNEA 2MHEA 1IR0A 3TQ1A 1IUJA 3KK3B 5C24B 3TA2A 3LWMA 4C0HA 5KT5A 3R1LA 1S0OA 4ED6A 1NK6A 1D9DA 3H5SA 2ABYA 2VPZB 4DFMA 2AYGA 2FHOB 2KVIA 4E8UA 2VG7A 1MMDA 1HNVA 5IQQA 4MIBA 1R0AB 3QGHA 4IOAQ 4FYDA 1JLEB 1XR7A 1UW4A 5EGYA 1ZPWX 4GC7A 1VQ6S 2JEFA 2W9BB 1UWBB 3J80Y 4LVNP 5J2PA 3HVWA 2A18A 3LALA 3R5AA 2Q1LA 4WFNQ 4OMFG 1ZM2A 3RR8A 2J6TA 4PQUB 1VBZA 2GGPA 2YKNA 1ZM9A 2IFXA 4IQMA 2CDQA 1SQEA 3M8RA 4IUFA 3C3LA 2NZ4A 2HGMA 2OPSA 5K8OA 1DHMA 4NXNF 3J7A1 3BO4A 3H5YA 2JX2A 1SKSA 2WCXA 2P9GA 3RB4A 1M5SA 1LWCA 2QV6A 1T95A 4BWJA 3JSMA 4AQYF 1JX4A 2J0QD 5BJRA 2HHQA 4ZOSA 2GHWA 1KS2A 3DM2A 3VF0B 2EPIA 3ZZ0A 3KLGB 1U1KA 3LGNA 1VC5A 1KLMA 2XCAA 4ED5A 1FRHA 3OLAA 2B4UA 2B4VA 4ZCKA 3W2WB 5IT4A 3RB0A 2IJNA 3DMJA 1S0NA 3IG1B 3T6JA 2J0SD 3GZ7A 4LSNB 4RW7B 3MUTP 1KD1T 3IGVA 2DCLA 4OV1A 3J7Z5 2QSFA 4X4SA 2J6UA 3K7RA 4FZVA 2DB1A 5GMKa 3HVTB 3KLEA 2BANB 3N9UC 4M5DA 1ZH5A 1X9MA 2KM8B 3BSOA 1RYRA 3DRPB 1IKXB 1RT1A 2YY3A 3K5PA 3OFHA 1QVGR 3MMBB 4NLUA 4EGLA 3E01B 3OW2R 2HWIA 2KHDA 3PACA 1R27B 1R8BA 2VFUA 1X5TA 3GV7B 1N5TA 2R7VA 1CPZA 3JSBA 1G1XA 2IAJA 3GIIA 1B7FA 3KG4A 2ALZA 1Y3KA 2DGXA 2XGQA 5KG0A 5KOWA 2K1RB 4ECYA 3DI6B 4I2PA 5B0BA 3E2EA 3MUVP 4YOEA 4MAKA 3N0VA 3FEYB 2R7RA 2V8VA 1UVLA 3MM8A 4A8SA 2RMLA 1DQAA 4B9TA 4OJGA 2BXJA 2MY8A 3D5MA 2ZHAA 3V2UC 3HHLD 4I68A 1TL3A 4NZ0A 4Y2IA 3ZC4A 2UXBF 3NRBA 4KJIA 2HZCA 1QE1B 3LP2B 3JTNA 1RTDB 3K5LA 2WOMB 5LXRA 1R8PA 2ZZNA 4PG6A 3H5UA 5GAGI 1P27B 1LOUA 2MZTA 1URRA 5E3CA 4FNIA 5GAEI 4J9KA 2IM0A 3MDFA 4PG7A 3JTOA 3JYTB 3HM9A 3FSYA 1TVRB 2PT0A 3B4MA 3GE9A 5AXNA 3Q23A 4DSIA 3P6YC 1VOMA 2CPZA 3KMQA 1Q8LA 3DM2B 1U49A 3PIOQ 1N88A 4FVMA 1RA7A 3RRKA 2LQ5A 4O23A 4NXMF 4B08A 5DO2A 2YWGA 3VZIA 1RT4B 4GO7X 2IRXA 2V4JA 3TAMB 2J7UA 2KT5A 2YNGB 2PFFB 5IT9Y 2FPHX 3HJFA 2M2BA 1MU2A 2J9EA 4OI4A 4FF1A 2L9NA 2KT2A 1WI6A 4EYIB 1XBWA 1CLFA 2RNEA 2FLPA 5JXSA 3LOUA 4DR5F 1UA0A 4DJBA 2AJ1A 3M2VA 3J81Y 2GA7A 4QWEA 2EW9A 1LWEB 1GXTA 5DG9A 2BUNA 3GIJA 3KLIB 3MR6A 2J5AA 1JLBA 2VPYB 5E3AA 1LWEA 4MK9A 2CPEA 1KTVA 4XIUA 2YTCA 4Q8FA 3POTA 3PJWA 5L8RC 2CQGA 2IHR1 5SUHA 4HEA9 2AV5A 4KRWA 3KTQA 4GO5X 4G1QA 1HNVB 2EI5A 2POKA 2DHAA 4Y65A 5E7OB 1C2PA 3GIMA 2V4JB 3I5BA 4R25A 1S79A 1SH0A 5LSLA 2HMIB 5DJBA 4ECRA 1M5KC 3MD1A 4NLSA 1O8BA 3EZ5A 1E6YA 1S4FA 1B0VA 5D4NA 3QLHB 2C2DA 4H4MA 4KQZA 4N76A 1FJ7A 4C8NA 3OVBA 5CQGA 5BYSA 3MPVA 4URSA 3RBEA 1XERA 4MMOA 2V4RA 1U26A 2EFVA 3K0JA 4C11A 3KLFA 4KBIA 3MECB 3MPYA 3M05A 3M32A 5A8RA 2D3UA 5I3PA 4XPEA 5D78A 1JNZB 3G4SS 2LU1A 1WHYA 2CQPA 2E5LF 3M9OB 1CVJA 2OD6A 1S1WB 1NZAA 2IYIA 3D1QA 1K9MT 2FC9A 3CCRS 4GKKF 1CSJA 3S8SA 3CJKA 3MEDB 4HI2A 1BQNB 3MUMP 4IRCA 3MM9A 4XK8C 1K8AT 2AQ4A 4YR0A 3MTKA 3DRXA 2JEGA 2GHPA 3OTOF 3CD6S 1X4CA 2WOMA 4ZCMA 3CB4A 4DSLA 2J9DE 4FXWA 5KFQA 2GJIA 1NRKA 4OZJA 3UD3P 3BN7A 3R5CA 1XTZA 2W24A 1VI7A 4MKAA 3CC7S 4Y0FA 3HKWA 6FDRA 3PR5B 2O5DA 3EYZA 3MFHA 4DBQA 1F9FA 1MROA 1W2BR 3NL0A 5D4LA 3BF4A 4B02A 4LFCF 4TYBA 2DD8S 2E1AA 2AGQA 3PHEA 1PSDA 3CCZA 4DR3F 1OSCA 1U1OA 3DRRA 5B7WA 1RT5B 2DNHA 2LEAA 3DCAA 2VD3A 1FXDA 1VQMS 2RF2A 3G8SA 2KG0A 2C3MA 1FKAF 2XWYA 1U2RA 1WHWA 2XS2A 2NREA 4U67Q 1R8AA 1HPZA 3ICLA 2K2PA 2Z2MA 1D0EA 3W7BA 3HHKA 2IC3A 3M1VB 3K8WA 1UVJA 4HI1A 1UVNA 2A1BA 3NNAA 3T5LA 4RNFA 4CIOA 2JRSA 2YNFA 1QSYA 3FRYA 2DH7A 2D74B 3RU0A 2UZAA 4DLEA 3SCLE 2XZWA 4G1QB 3DNCA 3NNHA 3T19A 1H3DA 2ZJPQ 1LFPA 2BE2B 1NKCA 3ENVA 4I6YA 5T7LA 1S1WA 4DV3F 4O0IA 2IVFB 1L3VA 3CD0A 3OXGA 4RW6B 5J2QA 2VODA 2PN6A 3H59A 5B08A 2B6AA 5C42B 1E6YB 1RI7A 2G0CA 2LQJA 3E8OA 4ILRA 4R0JA 1EETA 4CO4A 4X66F 1SV5B 1TV6B 2JC1A 4HTJA 2CQ2A 2D9PA 2P6TA 1JWWA 4ICLB 2YVSA 6FD1A 5EHHA 1RTIA 4TU7A 3K57A 2QEXS 2G9OA 2KYXA 4RNMA 1U47A 5DLFA 2H5EA 1DJ0A 2L9WA 2KO1A 3QLHA 3DDNA 4LQ9A 1TKTA 3MM7A 4NZ6A 2OTJS 2HHSA 2VFTA 5KFIA 2R9LA 4NLGA 1Y0HA 2W4PA 3CVKA 4N47A 1FVSA 1U6FA 1QUPA 5F41A 5K9FA 4Z37A 3LWLA 5HMXA 3QMQA 3HHLB 3JTPA 4A47A 3KLIA 5F9NA 5ITHA 5JVHQ 3PO4A 2RQKA 2VV5A 2O01C 3A1YG 1S1VB 1KFSA 3TUJC 5SZTA 4HVZA 3OTEA 2OMLA 3KHLA 2EWHA 4AUKA 3P96A 3IXQA 4ECXA 1IKWB 3MR3A 1HA1A 2CPDA 5CZXA 5HBMA 1J5OB 1SL0A 4XDCA 1IKWA 1LQ9A 2V2KA 2W8LA 1SJFA 4WZMA 2JFDA 2CYYA 2BRKA 3DYAA 4LSLB 4AL7A 2KKHA 2IVMA 4DV4F 1C0TB 1MMNA 3UPFA 2XMKA 1Z1ZA 4BDPA 1NH8A 4UUXA 1N6QB 1IQTA 4WFXA 5KFFA 2L41A 5HP1B 4J9OA 2FDNA 1OS5A 1R8CA 3RRHA 5K14A 4KB7A 2MGZB 2R2TA 5KFEA 4RU2A 4M94A 4X4VA 3CCES 1N32F 4FVCA 2VH7A 3I82A 1BQMB 5IS2A 3IS9A 2A2CA 2WHOA 5T41A 4CH7A 3LGMA 4ILMA 2QA2A 4IH7A 5KFDA 5KFLA 4K4XA 3MI7X 5CA5A 2C3PA 5B0AA 3FNNA 1YTYA 4ECSA 5B0EA 3UWTA 2FD2A 5T14A 1HI1A 2YX7A 4NA2A 3V81B 3Q24A 4O3NA 4KV8B 4AL5A 1RWUA 1FE0A 1ZOTA 1BC6A 2YH1A 4ZKAA 1HW8A 1JLCA 1Z4UA 3DXBA 1LW2B 2YWEA 3N28A 2FVSA 1N5YA 5A0YB 1YJRA 2DGSA 4OLOA 5D3GA 1KHVA 2DNZA 1YRXA 2M0GB 4CH0S 2MYFA 3EGNA 4RW4A 2DGOA 3HHEA 5IM0B 2BQUA 2UVVA 1DTQB 3QWPA 1WHVA 4TXSA 4RUAA 3MTJA 5HMYA 1DTQA 1LK7A 3U02A 1X5OA 1T05A 3BDEA 3KFWX 4YQWA 3SCJE 2HS0A 2ZJRQ 3SSSA 3GFXA 1YG0A 1WD6A 2C3OA 5CYJA 2KHCA 4NYZA 4QYRA 1T03A 4LSNA 4OJ1A 5J2NB 5EX0A 3V6JA 3LANA 1S48A 2ACYA 2R8GA 2HNYA 3DRSB 3OR1A 2BANA 2BDPA 3HI9A 5KFBA 2MJNA 2LYVA 2B9XA 1S77D 2ZUGA 3PW4A 1LKZA 2Y0SD 3MM5B 3T5HA 5THWA 4CO5A 4IR1A 3QO9B 1SUQA 4RBTA 5DM6Q 1NB7A 2VL1A 2NLWA 5KT6A 4C11B 3HHNB 5A8WA 3LH2S 5JJBA 1NK5A 1Q4RA 3ZZUA 4ES2A 4W90B 2WTFA 1J5OA 5KG4A 3U1LA 4HH1A 2PO4A 5G0RB 1JLQB 5GAHU 1K1QA 4X4PA 3LPYA 1DARA 1EP4B 2M4MA 1U6ZA 3UCZP 3CXCR 2OPQA 2XO7A 1NHUA 1N6QA 1L3KA 4RW9A 4P6QA 5KFRA 4DQRA 2M7SA 4M63A 3KHHA 2E5HA 1RTIB 2QRRA 2KRRA 4LSLA 4ZPDA 4B9UA 4MFBA 3HMJG 4AXJA 3OXFA 4F02A 3MECA 1RYSA 1MSWD 4ID5B 3B78A 4WE1B 4OX6A 4PG5A 1LWCB 2LCWA 4IH5A 5KFHA 4NLWA 2P5VA 4NYOA 2R7OA 1A6LA 3QIPB 3G96A 3KLHA 1KLMB 2YNHB 4KKOB 1S1TA 4TLRA 3F73A 1RTHA 5CZVA 4DL7A 1UEVA 2YX1A 4FF2A 4MYUA 2DR5A 4I7FB 2KZZA 2PDAA 2RB7A 4YR2A 1ZAWA 4JV0A 4JI1F 2EBEA 4PXCA 1UKUA 3M8QA 4KFBA 2XMUA 3I32A 4IG3A 2L9DA 4ZPCA 4JI0F 2IVYA 1F5BA 1JB0C 1GNKA 3OR2B 1OO0B 3D0GE 1N52B 2RDJA 2EK1A 4WKRA 1KQGB 1U2FA 1WACA 4OIXA 1JLBB 1KTQA 1OSDA 5HO4A 1U1LA 4C3MA 3M6UA 2CPHA 3K8VA 3B82A 1FXRA 5C25B 4PXEA 4ZP6A 2FHKA 4QW8A 3CWJA 3TO8A 2FHMA 1YJVA 4KGKA 3UR0A 4IRDA 5DS7A 3ZZPA 2GX8A 4KO0B 3RAMA 5DDPC 1V3ZA 3BS9A 1ZAVA 4HHJA 2Y1JA 1JJ2R 3IWLA 4LJMA 4YP3A 1TVRA 4ZPAA 4DV5F 2H9ZA 1P8GA 3MMJA 4QOTA 1NO8A 3SDEA 1N34F 1RT3B 2FGOA 4NL5A 1OWXA 4ELVA 1HMVB 3C2PA 3O6QA 1RT7B 4C7QA 5GAGU 1HPZB 3TUZC 2OPQB 4KIAA 4TYAA 4FBTA 1VMBA 2JJ4D 5L1KA 2QA4S 2I5JA 4XAKA 2HGNA 2BQRA 1FKOB 3GWCA 2I5JB 2IA6A 3J7YU 1NK7A 2ZE2A 1Q7LB 4ALZA 3CF5Q 3BGFA 3I5CA 2DHSA 3OV7A 4A8FA 3RW6A 4EUVA 1TKXA 2JEIA 2IM1A 1T05B 3ISNC 2R8HA 2DGQA 1X9SA 2MY7A 4A8WA 1VC6A 4B3SF 3KG1A 2Q66A 3MEDA 4R5PB 4G1PA 1S7HA 4XPCA 3AH6A 3MM8B 3P5TL 2MKKA 3SV4A 1YJ9S 3U27A 3IG1A 4PUOB 3AA8A 4F3QA 1RT7A 2JFKA 4ZVFA 1X0PA 5KFVA 3HLUA 5GAEU 2MB0B 2UV8A 4HT7A 5KFYA 5HMWA 2FY1A 3G8TA 4QIEA 1SJRA 1N8RT 2HQIA 4U7UK 1S9EB 2I1RA 4WK3A 5KG2A 3Q2TC 3CJ2A 1RT2B 4LT6A 1VQ9S 1F2GA 1KQKA 2N82B 3EUNA 3DLEB 3H8YA 5LXYA 2ADBA 3OBIA 4YUDA 1HR0F 2CJAA 4DV2F 3DRPA 3KHGA 3UCGA 5DRKA 3IBWA 5C25A 2XI3A 5HROB 4EWTA 4QIFA 5EUHA 4DN0A 3SQGA 2DTJA 2V8GA 2AWZA 2DNRA 2FJEB 3C6UB 2UUWA 4O4RA 3QZ7A