1H0HB

Tungsten containing formate dehydrogenase from desulfovibrio gigas
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
214
Chain Sequence
b'SKGFFVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADMEDESAIIHDDATGCVLFTPKTKDLEDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKAAYSDAKLCDPDDVRVIFLTAHNPKLYHEYAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMATE DEHYDROGENASE SUBUNIT ALPHA
publication title Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
pubmed doi rcsb
molecule tags Electron transport
total genus 58
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB02
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB01
1FRJA 3EGWB 3GYXB 2V2KA 1A6LA 3IR6B 3MMAA 1F5CA 2Z8QA 1GAOA 1PC5A 3MM5B 3OR1B 5FD1A 1IQZA 1DURA 3LW5C 1H7WA 1BC6A 6FDRA 3MM8B 1KQFB 2PMZD 1BQXA 1SIWB 1GTEA 2WSCC 3MM8A 4Y28C 1JB0C 1F2GA 4XDCA 2FJBB 2O01C 5L8RC 1XERA 1B0VA 3MM7B 1B0PA 1IR0A 1F5BA 1DAXA 4KT0C 1FXRA 2FJAB 4YDDB 4L6V3 1Y5IB 1PC4A 1FRLA 3OR2A 1FDBA 2WSFC 2FJDB 3IR7B 2PA8D 3PNIA 4OMFG 2VKRA 3MMAB 3MMCA 7FDRA 1WTFA 1JNZB 2VPXB 1Q16B 3HKZD 1FDAA 1H0HB 2C3YA 5BYQA 3IR5B 1FRKA 2Y0SD 1RGVA 3MM6A 1B0TA 1FTCA 1AXQA 1ROFA 1SJ1A 2ZVSA 1G6BA 4XDDA 3EXYA 2C3MA 5CH7B 1FRIA 4XK8C 3C8YA 3OR2B 6FD1A 1SIZA 1G3OA 2FD2A 4ID8A 7FD1A 1FEHA 3MM9A 1K0TA 2VPYB 5CHCB 1FRHA 1VJWA 3MMCB 1R27B 2PDAA 2VPZB 1GT8A 4AYBD 1BWEA 1FD2A 1GTHA 5E7OB 2WB1D 2C3UA 3MM6B 2FJEB 1H7XA 1BD6A 2C3PA 3MMBA 2WAQD 4RKUC 1FCAA 1DFDA 2FGOA 2XSJA 1Y5LB 2GMJA 1FERA 1Y4ZB 3MM9B 1HFEL 4CI0B 2VPWB 1FF2A 1KEKA 1FDNA 2C3OA 1Y5NB 2IVFB 2GMHA 1C4AA 1FRXA 3MM5A 1FDDA 2XSJB 3OR1A 2FDNA 2UZAA 1JNRB 1FXDA 4DHVA 1FRMA 1H98A 3EUNA 5BYRA 5BYSA 1KQGB 4OV1A 1C4CA 2C42A 1D3WA 1CLFA 3MM7A 3MMBB 2V4JB 1BLUA 2V4JA 2WSEC
chains in the Genus database with same CATH superfamily
2GQCA 3NLCA 3CDUA 1IWAA 4YOEA 4FKXA 5C24B 4RNMA 3IFEA 3H5SA 1T05A 5AXMA 2DGSA 4QBUA 3MR2A 4RX6A 4LRFA 3MUMP 2RHSB 1TVRB 4UY85 5IZHA 1JK9B 2FHKA 4JI4J 4KTQA 2EPIA 4DJBA 1JX4A 3HHKA 4UQTA 3W2WA 3OHAA 3G6YA 1WKKA 5HVHA 4JI6J 1DQAA 1FKAF 2VFUA 3FBFA 1LW2A 5G4DA 1ZBTA 4JOUA 1H7XA 2MKSA 5KFTA 1FKPB 2H5EA 1LWXA 3DHWC 3DKDA 4ZK7M 3EICA 4OI1A 4ECXA 2HBQB 4OX9J 1YJ7A 3RBXA 5EUHA 1N0VC 3HLUA 4UZCA 5DETA 4OLOA 4A8QA 4N8NA 1Y3KA 1Q82T 2MQOA 1U24A 3N01A 4RW4B 4NLDA 1NK7A 1RA7A 2ZJPQ 1FDBA 1RT5B 4CO0A 1J5OA 1RWMB 2VKRA 1T02A 3I4PA 2JDJA 5DM6Q 2BDPA 1CC8A 1WC3A 3GCWP 1HWIA 4NLOA 3LGNA 6FD1A 2MQNA 1AFIA 3C16A 1FJCA 5D8HB 2DR7A 2DH8A 4B3SJ 4ES3A 1QAYA 1HBNA 2C3UA 2BQRA 3E3XA 2FJEB 2UVVA 1Q8IA 2ZHAA 4OI4A 1NHKL 3KLFA 2CPJA 4DL2A 3I0SA 1TKXB 2C42A 2CPXA 1VHFA 1TL4A 4PUOB 4IG0A 1TKTB 4ZLLA 4Q44A 3FRYA 4USVA 3ISZA 1KHVA 5AXKA 1KRPA 1N4LA 5DRKA 3A3NB 4EYIB 3W9JA 2AT1B 1M5VC 3HD1A 4CLFA 2RF2B 4R0JA 3RU0A 5DQIA 1PJ5A 3QWUA 1NKBA 4EO6A 3HZEA 4QIGA 3MPUB 3KNAA 1M1KT 1KS2A 4KKOA 1I1GA 2OGUA 4DV6J 3UD5A 3PW2A 1SKSA 3G4SS 4H54A 4IOBA 2COLA 1U6FA 1VR6A 3E2EA 3DGPB 6AT1B 2WAQD 1OJ4A 3W2WB 2KDOA 3TAPA 3H20A 2LEPA 3TZZA 3IMQJ 1GMWA 4WWSA 2LQ5A 4DBQA 4USMA 3JQMA 2JSXA 2HPUA 2B4UA 2BUNA 1WEXA 2DR6A 1DQ8A 2Q6CA 1B70B 4NZ6A 3D6MB 1O51A 1UL3A 5K8MA 1WF2A 5K8OA 3I82A 2MQMA 1IKWA 3QT6A 1NK5A 5KG7A 4XDDA 3W63A 2JFKA 1IKYA 3TUJC 3T1YJ 5KG1A 4M5KA 1J5OB 4DS5A 4CLWA 2EG1A 2KO1A 1E6VA 1GT8A 2AP6A 2B43A 1HKAA 4IG3A 4NXMF 4C6AA 1FI4A 2LKZA 4C0OC 1LXJA 3NS7B 3CCZA 4V19J 3ZZ0A 4DMZA 2BVZA 3G8TA 1C4AA 3QLHB 4FP9A 4Q0BA 2PEHA 2MB0B 4EFAC 4F0KA 1HBNB 5DDRC 3ETMA 3EVOA 2IC3A 4E0DA 5J2MA 3MI7X 3DDIA 1RT7A 2CDQA 2X3DA 1WEYA 2OKQA 4GKKF 1U49A 4F4KA 2MZSA 4X2BA 3UN3A 1H6KX 3KLFB 1H7WA 3I0SB 2VG7B 2HZAA 2YTCA 4WFAQ 3LUYA 5AJ3J 1BHNA 1S9GA 3EWGA 3W66A 7FDRA 2H5JB 4DLEA 5KFWA 2J9DA 1VBYA 3CO0P 1ACMB 2DB1A 2C2ZB 3Q24A 2P2CB 1QM9A 2R9LA 3OTEA 3AD7C 2QT7A 1YZ6A 2VBWA 4B3RF 4M5IA 3GIJA 3W9IA 1RK8A 2HLUA 3RRGA 3GB0A 5C25A 2D3OR 4KGVB 3H2LA 3OFEA 3UDCA 2AYEA 2NXEA 4RU9A 4KKOB 1YJUA 5K8PA 1X5SA 1RYRA 3WDOA 1PILA 2GIFA 1HHSA 1S1TA 4MIBA 2VFTA 4U6PA 2ZBPA 2H1YA 4OYXA 4RLEA 3O5TB 3IA0A 2QFIA 4AL5A 3JQKA 1NPPA 2CG4A 2FVQA 4LBIA 4KHMA 5JVHQ 1T11A 3DN9A 5F8HA 3JTOA 3T6BA 1WHWA 4DV7F 2ZOMA 2GZOA 2J5AA 2HIYA 3KG1A 3E01B 4CO5A 4OI3A 1WC6A 2W2QP 2VFSA 4Q2MA 1RB0A 3M9OB 4WTOB 1AZSA 2GO9A 4U9RA 4JI3F 2IJRA 5HMWA 2Z2ZA 4ZS6A 3V6HA 2MHNA 3Q8UA 2XEXA 2B8QA 4JI5J 1RHKB 2E5LJ 4JP8A 5ETSA 2F8HA 1V9OA 2I9SA 2QMUB 2D41A 3TO8A 2EFGA 1IKWB 4IR1A 1LWFA 2L48A 2EBEA 3NGDA 2JFDA 2Q43A 2QL5B 4A4JA 1IKYB 4IOCQ 5LXYA 2IRUA 1RKIA 5D4NA 3GE9A 2XYGB 1E6VB 4FN5A 3DRYA 2M8DB 4HDHA 5CXTA 2VDIA 3KUHA 4IG3B 3L09A 1V3RA 3T1HF 4TN2A 4YR2A 4RL1A 3QZ7A 2E1PA 2G0JA 1F6TA 4Q0BB 2MLZA 2HBRB 1X4CA 1NSPA 2J0QD 4J9KA 2IC3B 3C15A 1MSWD 5L9XA 4DL0C 5J2MB 1R8CA 2ZH8A 1RT7B 1HARA 5IC6B 2FJXA 1TK8A 3PNIA 1N0UA 5KFFA 3D9BA 2K06A 2ACMA 1RAIB 4LVOP 3FQKA 3DLJA 3IRWP 1SL1A 2HHSA 4FYXB 3BM7A 3I96A 1IM6A 3DLEA 1U8WA 3MAHA 2MQQA 3VAHA 3HT3A 5HK4A 4ZPDA 3LF0A 3SCIE 4PG8A 5D0HA 5C25B 2PD1A 5BYRA 4AT1B 1TFYA 4YMEA 2CVEA 4RNNA 2FHJD 2JLEA 2PN6A 2XQCA 7AT1B 4IDKA 4NCAA 4JI8F 2V9WA 3FZ2A 1N32J 4OYWA 4DX6A 4PG6A 1HR0F 4Y2CA 1NZAA 3H42A 3R7BB 1F9EB 4B9LA 2R7UA 1EAYC 5KG6A 1FESA 2CQGA 1K73T 3RG6A 1Q86T 3LGMA 1PBAA 1N5QA 3BZQA 4L3NA 5CH7B 4ZHRA 2L3MA 1SJ4P 3PTWA 1Y11A 1AZSB 5B7WA 4LF5F 1RAHB 3BGUA 2WOMA 3J7ZT 1JLQB 3MPVA 3CCTA 5C5JA 4LRBA 4JV0A 2GMJA 1D09B 1LV5A 4LF4F 1R8PA 2FZKB 4NI2A 3HI9A 1LWFB 1RWVB 2JRSA 3H40A 4EBEA 2R2SA 4A8SA 1D8YA 5LJ3Y 1RADB 5KT7A 3I5BA 2G1HA 1F5AA 3GYGA 1MMNA 2CDRB 1RKJA 3EJMA 3OLBA 3EGZA 4X66J 3HMJG 5JUMA 4IFVA 5LOQA 2PEBA 3PVXA 1JLAA 1TL3A 4U8YA 4JUZA 3AB4B 3C15B 3ZC4A 3PYGA 5ETRA 1PJ7A 1NH7A 1YBUA 4DX5A 3T5HA 2UUBF 5J2NA 4NEZA 5LMNF 2D7SA 2QYCA 3KUEA 4F4YA 4ID5A 1SKUB 2F9JA 3A3PB 5AXLA 3CPWR 1CJVA 1UFWA 1NB2A 4LJMA 4JI1F 2CUYA 3TP2A 1U1NA 1F3VA 2UP1A 2W25A 5J1NA 2KI2A 4L76A 1M5KC 4PXEA 1OYDA 3A4TA 2ZUAA 4ZPTR 2DRBA 3DLEB 5KFJA 4PXDA 1JMTA 3UCUP 1KNZA 3FQLA 4MKVA 4BHQA 4W90B 1CLFA 2NXCA 3DI6B 2IPOB 2GJ2A 4MFBA 2HQDA 2Y9HA 3PW4A 1TTHB 2BMBA 3UCGA 5KFIA 1MW7A 3I6PA 2NQPA 3D0GE 4HI2A 3OHBA 1N6QA 1RCOB 3PM9A 2VQFF 4EZ9A 4FXDA 1WC4A 5I3PA 4P10A 4IDKB 4C3KA 1F0XA 2HFSA 2HVZA 1JNZB 3VV2B 3MDFA 1HW8A 3QJJA 1U1MA 2DHXA 5EWGA 1RP5A 1SQGA 4IH5A 4M1KA 5B08A 2DHHA 4DUZJ 1GEHA 3W60A 3K5MA 3QRRA 2DTJA 1QAXA 4HKQA 2AJFE 5JVGQ 4N8OA 3HZGA 3RB4A 3SEOA 5BR8F 1YGYA 2J76E 4DV1J 3ZTOA 1NJIT 3MEEA 3QT8A 3HHEA 1CVJA 3N9UC 1PAEX 3HVRA 2GMHA 4OX8A 1GQEA 2G13A 1W25A 1MROA 2I8EA 3CJKA 4OZ2A 3LP0A 4N5SA 2WOMB 1XMOF 3GSIA 3MM7A 1HNVA 2W4CA 2V68A 3GJSB 1S7HA 4M5JA 4JV1A 2QSWA 1A6LA 1NM2A 4JBCA 4JI4F 2ZZMA 1WDDA 1RAJA 2XGQA 3QJPA 3R1HA 2GMLA 3VQTA 2EFVA 3CCJS 1TAQA 4Y2AA 1KDNA 4RW9A 3PRBA 2FGCA 2N3LA 2I2YA 5KFEA 2K7KA 1RBOB 2AX0A 4GVBA 3GMGA 4MIWA 4OJ3A 1HMVA 2CWXA 1ROFA 1R0CB 2J7UA 2RHQB 2XNQA 4ID8A 2BR0A 1IBMF 1Q79A 5GAHU 3U7JA 3VCDA 4OX9F 3MGJA 4J9MA 3H8YA 3TW0A 4P2XA 1HD1A 3R97A 4F3OA 1U25A 2MKIA 1FXLA 3BBCA 3I5AA 2XB2D 4DOZA 4HR2A 4ID5B 3Q8YA 1N52B 3LH2S 4PG7A 5E0OA 2CPEA 3JXOA 4Y00A 4BC9A 1HQUB 4DSJA 2QLWA 4USKA 4DU8A 2GIRA 1U1OA 4NCGA 5IXUA 4J9QA 2QZ8A 5C7PA 3IWLA 3K5PA 4MFBB 3G96A 3KFWX 4RWWA 3KHHA 1M0SA 5CYQA 4B3SF 2NUHA 5ETVA 4CM2A 3OT9A 4BC7A 3TARA 1X5OA 3I55S 2H4YB 3HCXA 4LF8J 2HSEB 5ETKA 3UI3A 2FZCB 2J8SA 3HSJA 1FKOA 3OFGA 1NAQA 3MCNA 5KOWA 2RDDA 2LXUA 1Q95G 1R0BG 1AB8A 1WHYA 4OZNA 4L74A 3MEKA 3CVKA 1RXOB 3RGIA 1J27A 1ZPVA 4RBTA 3PRDA 2DGOA 2G0IA 4L75A 3MEEB 1AUSL 2BQ3A 1YITS 4A8YA 2YQ1A 4AFFA 2BOAA 3F56A 5KFNA 3ZZUA 1XC9A 2CQBA 3DLBA 1FTRA 1MROB 5E5NA 1N36J 1Y10A 3LP0B 5IOLA 4DSLA 3ZZZA 3IS9A 3MM7B 1HNVB 4O3RA 3SMZA 3EZOA 2W7PA 1UETA 3GYNA 4IH6A 1UVLA 5A8KA 3ISND 4NZ7A 3DYAA 4CRJA 4URQU 1KQKA 2QL9B 4FNHA 4WK1A 3KLGA 3M8ZA 3KK2B 4RW9B 4C8OA 3UFCX 4GVBB 3DXBA 1BWEA 3M6WA 3TA2A 1HMVB 2YKMB 5L9NA 4HL9A 3CCSS 1Y7PA 3IWXA 3AA8A 3QGGA 1W2IA 3RYLA 3UD3P 4M63A 3OR1A 2YY3A 2P9GA 2DPJA 5HN0A 2E5GA 2BANA 2BOPA 3K2YA 3QMQA 4J9UE 2Y1LB 4NEYA 1VC0A 3GPAA 2VODA 4XTTA 1SKRA 1C0UA 4I2QA 5F8LA 2F4VF 3MPYA 3IXQA 4JI2F 2R2RA 1EETA 3AAWB 2DNHA 3CF5Q 4Z2XA 1G3OA 4WE1B 2F8MA 5CYQB 2MJNA 5CHCB 1ZAVA 2VPZB 4ES2A 1M5OC 5DM7Q 3IBWA 4DUYF 4I68A 3MMBA 2VG5A 3K8WA 4C0BA 2RJZA 1M90T 1OQ6A 3ICLA 3OSNA 3VWSA 5LXRA 1S0MA 1AT1B 3B78A 1RA6A 1DTQA 4I2PA 2OSRA 2AQ4A 3GFYA 1LWEA 1H98A 5AJ3F 2QMWA 4DR3F 1PCAA 1WDTA 2A3JA 4F2SA 3TVYA 3NGSA 2DCUB 3THVA 3ENQA 2FJBB 2YNIA 1UWBA 2DCLA 4DV4F 1NNDA 1OWXA 4WKRA 2ZH7A 1RWOB 3OL6A 5HMZA 2ZOFA 3O44A 1Q16B 3PJ9A 2LCWA 2E44A 4DZDA 4RW8A 3J7AN 3MAAB 1S1VB 5FLXY 2IM2A 1YIJS 1U6BA 4FXVA 2YKOA 4F04B 5F0WA 3F44A 2B9YA 3J7YI 3M6XA 2DGWA 4K59A 5J2PA 3OTDA 1P27B 4GRSA 3VQSA 1N88A 3ZXWA 4N7TA 4RKUC 3RRHA 3KLGB 3Q23A 4F02A 2IM0A 2DEIA 4QIEA 1XR7A 1HI0P 2EG2A 3K5OA 3MTJA 3Q8PB 1IN0A 2YH0A 3HHLA 4NLWA 3D6TB 2BW2A 3LA0A 3OR1B 3ZTQA 1KQSR 3V6JA 5KT3A 2UVRA 2BANB 3ZZPA 2HHPA 4JI5F 4GO5X 3LO3A 4OMFG 3M2RB 4LRDA 2ZJRQ 3X1LB 1XMQJ 1U26A 4USJC 2FPHX 2XMTA 4I2QB 3KUGA 4O3SA 3LPYA 5IT9U 4I7FB 4I69A 2YKQA 4YR3A 4NOHA 1WKLA 2DNGA 2ZBRA 2M88A 4W98A 1JJHA 1EETB 1WWHA 1P6TA 4QPXA 1Z2ZA 2V94A 1SV5B 2QO3A 1D8ZA 3MR3A 3OLAA 2IBKA 1A9NB 3ILLA 1KLMA 5HMXA 2F5GA 2EC0A 3CULA 2HIQA 4DFMA 1K1QA 4ENOA 2G9OA 3TX8A 4GMKA 1S6PB 3TVKA 3MMBB 2VG5B 1YLXA 2W7AA 4QWBA 3LGHA 2YWKA 1N34J 4I2PB 1FX2A 1Q81T 2LVWA 1LWEB 4ZMMA 1U09A 5FLXU 4CNYA 3QFWA 1QD1A 3KLIB 2EK1A 4RNOA 2VONA 4H4OB 4CLTA 5D6GA 1WOOA 3LWLA 2R8GA 3K58A 3M4XA 2HWHA 3IGVA 5C2CA 5BYQA 3EVMA 5HATA 5B0FA 4XPEA 3RB6A 3MCSA 1UWBB 1KC8T 1I3OB 3SCKE 1S7IA 4PXBA 1IR1A 2UUTA 4UOCA 1R27B 1HPZB 2XMJA 2ZM6F 3NL0A 4RW8B 1VRUA 2HNYA 1IBKJ 4K4VA 1X9WA 1N32F 2L9NA 3DOLA 3HPOA 2VC0A 3D1HA 2UXDF 4ZVTB 4WJBA 3S7RA 5J2PB 1J5EJ 3JSMA 1IR2A 3AQOA 3BREA 3CJSA 4N77A 3TA0A 3CIZA 1SJFA 4ZVEA 3PW5A 5KFXA 2WVFA 4YFUA 1U7LA 1NH8A 4K2JA 2GAGC 4OJ1A 3CJQA 2OLWA 4X4TA 2DNKA 1Q4RA 4DF8A 4YDDB 3HHLB 4H4KC 4X4UA 4B3TJ 3M9NB 4ZLPA 1MNEA 3HKZD 2C3YA 1XWLA 3MR7A 1B0TA 2DIVA 3TOQA 4Q8FA 3SBMA 2HGLA 3AY0A 2ROEA 2KB2A 1VDHA 1U1KA 3GU0A 1JJ2R 4ALZA 2V2QA 1RWKB 4DPTA 2BJ3A 4C0HA 1D0EA 1X5TA 2ZH1A 2DITA 3MTKA 4X65J 4OYBA 5KFDA 4ZCIA 3PFOA 1NJZA 2KZMA 4K7QA 2YX1A 5KFBA 5BYSA 2J8AA 1RUSA 4X66F 3FMWA 2NYHA 2N82B 1M1HA 1KLMB 4NLUA 5KG5A 3CMES 2A10A 5EN1A 3VGTA 4B9SA 2GFFA 1KQFB 4O4RA 4UT4A 2BYCA 4NMXA 2HG4A 5DJBA 1Y5IB 2CNOB 2NSCA 4M95A 3HX9A 3DMJB 2XG8A 2ADCA 2E1CA 1FFGB 4DU7A 3HHLC 2C2KB 2NYIA 5HLFA 3OSPA 3KNGA 2D9OA 3MCOA 1K9MT 3G8QA 5HSPA 3M2VA 1SQEA 3DCAA 3TR5A 4ANCA 2R7VA 3PW7A 5HBMB 3AH6A 1T3NA 1U0HB 4LRAA 4X4SA 1VRUB 2HNYB 1S76D 3SIPB 2LQ8A 3RAMA 2ZBCA 2PMWA 1LNQA 5EWFA 1VIOA 1XN9A 4Y65A 4AQYJ 2R7QA 2HZVA 1VQYA 4ECQA 4Z37A 3VR1A 5LSOA 1S77D 3JSMB 4DV2J 4DUZF 4EEYA 1U6ZA 3H0PA 4B9VA 3OD2A 1DAXA 4Q8EA 1N5TA 3SV3A 2G2ZA 3ITHA 1EJ7L 1EZZB 3A3OB 3CIMA 1OQ3A 4MYTA 5SUHA 1ELOA 3MEGB 4DV1F 1TR0A 1UJ6A 1WELA 4DFPA 4Q45A 2AZ3A 3PIPQ 2XNRA 5K14A 4C8NA 3KK1B 3EPIA 2VC1A 3POTB 4QYRA 3Q0AA 3IM8A 4OJHA 1QUVA 1S48A 1FRHA 2RB7A 3IC1A 4LR8A 4OHWA 5BJRA 4ZP8A 5KFHA 2HBYB 5EGYA 1IBCB 1KLNA 1F3FA 2CWKA 4I0WA 1HNIB 2OO4A 4DR2J 3WZ0A 2G2OA 3A12A 1SC3B 4JV5F 3H90A 4RPFA 1S6UA 1JXVA 1WUUA 3V81A 1VRTA 5DG7A 3IWNC 1U45A 4O3OA 2JWNA 1TMMA 2XBPA 1HI8A 2HEKA 4NLQA 2GW8A 4PG4A 2HVIA 1UTAA 2Z56B 3BGRA 4LSNB 2IFXA 4OZ5A 3U1MA 2HNDB 4ZVPB 3EPGA 1CULA 2I0XA 4XDCA 3BEGB 1FXRA 4C9DA 3JSRA 3J7A1 3TWZA 2R7SA 3M1VA 5E3PA 5I42A 2UVWA 1ZM3A 5H1SV 3RBDA 2HRUA 3J80Y 1JLBB 2HS4A 4F4ZA 1VBXA 4DLGA 2M9KA 4ECSA 2HRYA 4AE5A 8ATCB 1LKZA 3ZNUA 1HWKA 4ZA1A 2WBRA 3C8YA 2A6MA 3CNQP 4IKAA 3CMAS 3BYRA 2IIHA 4DL7A 3OXFA 2MKYA 3BN4A 5E7OB 4B3OA 2LQBA 2DEJA 2XTJP 3MR6A 4HI1A 1R8AA 4DCJB 3G8SA 4B3MF 2E9RX 3VAJA 5DGAA 4J9RA 4FYDA 3C6UA 3T9NA 5HLFB 1RT6B 2DIUA 2B9EA 1QVFR 1F1BB 2E5IA 2QEXS 3M2VB 3W7BA 3IO1A 1UW9A 3LWMA 4QR1A 1YJRA 3QRQA 3PO5A 3GTYX 3A8EA 1WORA 1RTDB 4NCBA 2CQ0A 3I9V9 3FJ2A 1NO8A 4H4MB 5D77A 4WIQA 3JTNA 4X4PA 3D3CJ 1NPRA 1HBMA 5AE2A 3BJYA 2A2DA 5KG3A 3M05A 3IGNA 2IA0A 2FQQB 3N6LA 1HQEA 2RRBA 4W4MA 4JI0J 4DFJA 3GV8B 2XMAA 3MOJB 3ZZRA 3HJFA 2Y1RI 5J2QA 1S97A 3QATA 2HHXA 2MZRA 3SQOP 3ENWA 3DOKB 3QT7A 2H3EB 2LXFA 2EFQA 3CDEA 3C66A 1KOOA 3GILA 1M5SA 1VOMA 2EWHA 2HS3A 2QJ3A 2F40A 4HH0A 4ICLA 1CBKA 3DXSX 1KVJA 2KVQE 1ZETA 2RS2A 1N36F 2DBBA 2VD3A 2PE8A 4M5NA 2KYXA 5AT1B 4HVZA 3AOCA 3L4BC 3BO4A 4YS2A 1FK9A 3TZYA 4R0EA 1WOPA 2AEFA 3J80U 1WG1A 1C1BB 4AXJA 4ILMA 1U1PA 4YUDA 1VRTB 2WHOA 1E6YB 3DC2A 3D3BJ 3FCHA 3W9HA 2E7WA 1JWWA 4DSKA 3KK3A 4F7VA 2RH3A 3BGRB 1UPMB 3KWMA 2WONA 3KDOA 2WTFA 2DD8S 4LSLB 1CULB 2GJFA 1GXTA 3K59A 1ZAWA 4C48A 3VAMA 3M1VB 3P96A 2YKAA 1XNRJ 3PX6A 3SXLA 3UW1A 2W4DA 5KG0A 1PGZA 2AIRB 4QQBA 4MT1A 1Z4UA 4OZ3A 2UXBJ 2H5IB 2R3VA 4EZ6A 3DLGA 2JEFA 1Y3JA 2KTQA 2HRTA 4HHJA 3ADAC 3CCLS 2VH7A 1RHMB 2HZCA 5KT2A 1L3SA 4Y2KA 3RZAA 2KVIA 5B0EA 4J91A 3EVWA 1YJ9S 3Q22A 4UZBA 1TFWA 3CJTA 1QJHA 2P8IA 2HQ3A 3GLJA 1NZ8A 3C6UB 2CADA 1LK7A 4OYIA 3H2VE 3T9ZA 4FVCA 2VKZG 1JB0C 1XERA 1YHQS 4QU7A 2ASYA 3B8HA 1G1XA 2DO0A 4MKYA 2WSFC 2RMLA 3PCOB 1HNZJ 1CEZA 1TUVA 4RUBA 4FDFA 2OH2A 4RO0A 1KR4A 1HW9A 2ZVSA 2MKHA 1RTHA 4WKYA 3V2UC 4NYZA 3M2UA 2D3O1 1VQ5S 2ACYA 4U67Q 1YK9A 1S12A 4ETZA 1S72S 2B4PA 4O3NA 2EK6A 4LRCA 2HVHA 3W61A 1S6QA 3SI8A 2GHVC 4KQZA 4GC7A 2HYIB 3W3SA 2IRXA 4PPZA 5ETLA 4CO1A 3BR9A 1U2FA 1TK0A 3D54A 3R1LA 4UUXA 1AUDA 2YPZA 4ICLB 2JOQA 1R89A 1MLAA 1RDRA 4ZP9A 3GG0A 3AJ2A 1RWNB 2AJ4A 1SJQA 4ZDNA 3CDWA 1IKVA 3D28A 1FK9B 2KT2A 2N4DA 3UN5A 1WTFA 4CT8A 4NLXA 4V19X 4LUBA 1BQNA 4FF2A 2CG8A 1RABB 1U4BA 1FX4A 2C2OB 2V2VA 3QT5A 3CJ3A 4IOAQ 5K8NA 3J7YU 1VQMS 2K1RA 3KLVA 4QCLA 4ED0A 2DHGA 4P7TA 2EXUA 4PZVA 4TKTA 1Y4ZB 3PG9A 2XWXA 4LF9J 4BWMA 3MMJA 5JMNA 4DUTA 4URSA 1VS3A 4RW7B 1HNWJ 3SV4A 3UVJA 5CQGA 3DLGB 1N33F 3P5TL 5EHHA 4TVAB 3C14A 3NRBA 1WHXA 3ZZYA 3SQGA 2WW8A 1XMQF 3MUTP 2WRMA 2JH3A 3MM8A 1CSJA 2NZ4A 3M32A 3MF5A 1C1CA 1P1LA 2ZH9A 2J9CA 3N4WA 4IH7A 2JHEA 1EKSA 4MJKA 1UJ5A 2B6AA 3A1YG 5CABA 2RKIA 2ZJQQ 3R2DJ 1O8BA 2BJDA 2K3IA 3BYPA 4N76A 2KU7A 2UUCJ 2DRAA 4KO0A 3WHIA 3HHNB 3T3FA 2DT9A 3X3UA 2V8DA 1RTHB 3M2UB 4YHHJ 4X4OA 4DV3F 4GKJJ 4WU2A 1N34F 9ATCB 4KE5A 2XLJA 2J7WA 1HWUA 4MK7A 1EX8A 4JV2A 2XO7A 1S6QB 1KTQA 3IAM9 5EDWA 4DR1J 1RTZA 5CCMA 2CPYA 5KFCA 2KKHA 2YNHA 2FHOB 3ENVA 4PG5A 4LFBJ 3LW5C 1JLEA 3IG1A 4F3QA 2J9DE 2OMOA 3UDLA 1EHWA 1TKZA 4R5PA 4TQRA 4QZVB 2FVCA 3P8BB 3H4BA 2ZHOA 2V4QA 3F73A 2DXFA 2XZWA 4RJVA 4DQPA 4IRCA 3H5XA 2YWEA 4F4XA 2CJXB 2C3MA 5KFPA 4NE9C 3ZNJ1 3UCZP 4UW2A 1UWAA 3CJRA 4JI7F 2R8IA 2QLBB 5FDLA 4P2FA 2KH9A 3F0NA 3M7VA 2FIUA 4ZIVA 3G6VA 2WB1D 4FF3A 2GJIA 3PHEA 5F8IA 5LSRA 4DPXA 4DR5F 1BQNB 2HGMA 1HIYA 2KL8A 4F0HA 4DN9A 3VAIA 4PXCA 5IT0A 4UQGA 3I87A 4UOGA 4DL6A 1BWVA 1HHTP 3ETOA 2K1RB 4BLGA 1CS4A 1FRMA 2W9CA 3MFIA 4F36A 3E51A 2FY8A 5EX3A 5HQMA 2MKCA 1T9VA 4ITSA 1SXLA 2MY7A 2P9EA 3HHDA 1APSA 1EQMA 4A8KA 2V8PA 1IQZA 3C46A 1RBAA 2XWYA 3OFFA 3UVJB 3BQ2A 1VGYA 1FVSA 1JLFA 1NDPA 2FB0A 1O5JA 4O3QA 5GAHI 3BDPA 3HF5A 2FTRA 1TMJA 1VRQC 1AROP 2FC8A 3SQGB 4K8RA 2OPSB 4M5DA 1REVB 4DG1A 3M32B 3LP2A 2FY1A 1UVMA 3TVZA 1R8HA 4YP3A 1C1CB 2PIIA 5LMUF 4Z7YA 3QGIA 3EZ5A 5A8RB 2GA7A 3OL8A 4WFYA 2B6AB 3PKYA 1VISA 2RKIB 1PYOB 3N5FA 2CZ9A 2H48B 2GHWA 3CJ0A 2UV8G 4DN0A 4CI0B 1UA0A 4KO0B 3DHXA 3CB4A 3P3DA 3W8PA 4J9OA 2XY6A 1RTJB 1X7VA 2B9XA 1SBRA 2ZH5A 1OSDA 3ILJA 1RYSA 5E33A 4F0MA 2X51A 2L08A 3WC2A 1XBWA 4R8UA 2IJNA 4TLRA 2B7BB 3AD9C 2PC6A 3G86A 1X4DA 4ES1A 2BV3A 4QIVA 3K8VA 5DDQC 2AD9A 1B7YB 2H51B 1WHVA 4NPOA 2UXCF 1PG5B 1JLEB 2EI5A 2V6AA 1RU1A 4L73A 4FNIA 4ZVOB 1TKZB 4ZP7A 4R5PB 3NCPA 2YBVA 5HL7Q 4TY8B 3N6NA 4J7CA 3QYYA 2CJAA 1BGXT 2IHR1 1MMDA 5DG9A 1W7WA 4A8OA 3MM9A 3RB3A 3KG0A 3U1NA 2NXUA 3EDQB 2NZCA 2V63A 4P9SA 1T7PA 2P9CA 4CCHA 2KRBA 2VF3A 3MECB 4UUWA 4ZVGA 4F4AA 4ECZA 2EC2A 4DQIA 2QE5A 1HNXF 4AQYF 5FDLB 4IRKA 1KFSA 3KJVB 3CGIA 1DZ5A 2AV5A 1KD1T 4ECUA 1NDKA 4Z7CA 3BV8A 3LAKA 3ELHA 1SH0A 3QNWB 2XI2A 5M2UA 4KIAA 4ZCLA 1OS5A 3KKFA 3GYXB 4F2RA 4PWDA 3U27A 4DR7F 1N48A 3PIOQ 2R2TA 3C19A 5F8MA 1CS4B 3O2IA 1T05B 2W9CB 3OVBA 2BJ8A 2JEIA 2HURA 4C98A 1CJTA 2E9ZA 3MZIA 3Q89A 3RBZA 1RISA 3OL7A 3R5CA 3DDNA 1F9HA 3VAKA 4NA1A 1RHJB 2Z58B 3BDEA 2B9WA 1IJEB 4LFAJ 2MQPA 1NU4A 3J81Y 2GVDA 2AGOA 4DR2F 1U48A 4QWDA 3EM1A 1HI1A 2MSTA 1QAIA 3VGUA 3ZTRA 2Q1LA 1LW2B 4L72B 2XI3A 1GTHA 2DO4A 4M5DB 3Q86A 4DG1B 1FWPA 2I1RA 3LP2B 3KLEA 1QVGR 2LXIA 3ET6A 1FE0A 3RW7A 2HFVA 4MAKA 4QJVA 1SH3A 4DHVA 3TYTA 1RACB 1UMJA 4FS2A 1S79A 5H9FJ 2V4JA 1I5OB 4BCAA 3OTOF 3EGWB 1NXIA 2R42A 4LQ9A 5B0GA 4ZPBA 5F8GA 1GAOA 3MOZA 2VA2A 2PMZD 1KN6A 2MY8A 1GMUA 3OBIA 1TUWA 1TL7A 4CT9A 1TELA 3M6UA 2HWIA 1FRLA 1ZTTA 4C3MA 4ZVFA 2H9ZA 5B0CA 5KG2A 4ED1A 3CCMS 4R8UB 1NBEB 2CJ9A 1T8EA 1U1LA 4X4RA 2B51A 4WYLA 2V67A 2AJ0A 3GG1A 2OPQA 2HS0A 2V2ZA 3C16B 4P75A 1RWWB 2V50A 2ATCB 2CZVC 1D1UA 2VASA 3CD0A 4AYBD 1GMWD 1YBAA 5F0UA 4IYQA 2HBZB 5IWAF 3CCQS 3RB0A 2JJ4D 3EZUA 2CZ4A 3MM9B 1HFEL 4J9PA 1FDNA 4JYAF 4M5MA 2C3OA 4ZVUB 1VQ4S 3Q2TC 3CCES 1WSRA 1TV6A 3ZZOA 2CA9A 2J0WA 2RIJA 1C4CA 2OPPA 3T41A 4DPYA 3KHGA 5D0EA 1B4SA 2B4VA 1BY9A 3LP1A 2RDJA 4IG0B 3GJQB 2H4WB 1L3VA 3KHRA 1H2VZ 1H2UX 3PO4A 1K1SA 4CH1A 2ZBQA 4OHZA 2OELA 3J81U 2LA4A 2IM3A 3S1TA 1B0VA 1NK9A 2MHEA 1CC7A 1OPZA 3OPKA 2PA8D 1Q78A 1VBZA 2FVPA 1IXKA 4ECYA 2W9AA 5A8WA 3BSCA 2DY9A 2VA3A 1H2TZ 1LFWA 2F4FA 3TZWA 3NNAA 1FEHA 4GKKJ 4ELUA 1T9TA 1R8BA 3FVYA 1FD2A 1FT8A 3MHYA 2Z2MA 1S99A 2KXFA 2LLZA 2YWGA 1NK8A 1RLDA 5GAEI 3TQ1A 4G6VB 2RQMA 2E1RA 2KFNA 1S4EA 1DLOA 3CJ2A 4NLRA 4EYHB 2CIMA 5DS7A 3EYZA 3FK4A 3BPSP 1Z2LA 1X4AA 4X64F 3W5YA 3A8JA 4XPCA 5KT4A 3ET6B 3TJAA 1SC1B 3NGKA 2C2MB 2IMWP 4NLYA 1IQTA 4DV0J 1XQIA 3CWJA 3AB2B 2XM3A 3PZPA 2LEAA 1GH8A 2FJAB 1Y0HA 1AW0A 2DNPA 3CDBA 2CVIA 4NWBA 1IKXA 2CPFA 2UXBF 1YZ7A 1FJGJ 1TL7B 1SJ1A 2IVMA 2MMYA 4EBCA 4Q2LA 2CPDA 4WZMA 2DR9A 1XIQA 4URGA 4XO0A 2R7TA 2GQQA 4WP3A 4FF1A 2WZ1A 2QA4S 2BJ1A 1ICEB 1SCJB 5KOXA 4KFBA 5D3GA 1YX2A 2LU1A 1N5VA 3N79A 2CAJA 2UZAA 4N47A 2FZGB 1X4EA 2XMKA 3CT9A 4JI3J 4OJGA 4HYKA 3JSBA 1HNZF 4F25A 4ED6A 1ZM4A 1Q0NA 3T19A 4EWTA 3M8PA 4ZVHA 5KFZA 1VQNS 2Z0GA 4QWAA 1S0NA 2VBXA 2OPPB 3NCQA 4RNFA 2K2PA 3GCXP 1S9GB 3Q8RB 3EDRB 2VPXB 2UU9J 1VK3A 4KSEB 3CE8A 5E2QA 2CPIA 3JB9k 1JLCA 4M5HA 5KFQA 3MEDA 1SQFA 1RHUB 2Y0BB 4U7UD 4ZCKA 3I0RA 5A8WB 1FWLA 4C11A 1F2HA 4KHPF 2X1BA 1Q5YA 3WIUA 5F8JA 1N5YA 3W62A 2MKJA 1XNQJ 1XTZA 3BR8A 4CQ1A 3G71S 1S1UA 1S1TB 3ULHA 4RUCA 2VG6A 2X3GA 2Q3PA 5A0YA 4OFZA 2FVRA 1YG0A 2VDHA 3MXHP 2RQCA 3QO9A 1DLOB 4NMLA 4LF6F 2ZH4A 4ER8A 3K7RA 4YEAA 1UPPA 1NEEA 3T5KA 4ECTA 2HHWA 3OXLA 2EEYA 1PC4A 3DM2A 5KFLA 2G2YA 4WFXA 3GP9A 3VF0B 4X4QA 1FDAA 2KFZA 2KM8B 5I3QA 2GQ2A 3KOAA 2VOPA 2Y8YA 2KT5A 1ULRA 1XJWB 4OI6A 4DQQA 4CLYA 2LQ9A 1IBLF 1IKXB 3PHTA 1VMBA 5KFGA 1UAWA 2EKYA 4DPUA 4M5GA 1RT3A 3BKFA 1N54B 1HR0J 1VC6A 3W64A 1Y5LB 3FSYA 3UWTA 1FERA 4PR6A 1FNMA 3WIVA 4G3IA 2PFDA 3VTIA 2OHDA 2J9EA 1HQ2A 1I6JA 2JC1A 3TNVA 2IJFA 4RBVA 3SZ2A 4DCPB 3FKBA 5C24A 1N8RT 2HK2A 1UKUA 3D67A 4LF5J 1QSSA 3M8RA 5CYMA 3WX4A 4OZ1A 4LQ3A 3OJUA 2G4BA 2ALYB 1ZA2B 2N7CA 1RHQB 2ASDA 4DS4A 1U1RA 3M8PB 2HFUA 1TVRA 2D9PA 4FPRA 4LF4J 1Q7LB 2LP4A 4Y2MA 4YHHF 3M6VA 3NOCA 3WBZA 5JXSA 1CJKA 5T7LA 2KYZA 4DR1F 4EBDA 1JLCB 2GCFA 4QIFA 2KM8C 1OO0B 2RRNA 4LFBF 4ILRA 3DRSA 3HD2A 2QGFB 2BX6A 3I32A 1BXNA 2MZQA 2QLXA 1Q5VA 1S1UB 1FWKA 3UQSA 2VG6B 5LMNJ 2UUAF 2J7KA 2OD6A 3W1YC 5A0YB 4U96A 5CZXA 4OIXA 1VK8A 2QLFB 3Q83A 3ZO7A 2XMVA 4A8MP 4RW4A 2ILZA 5T14A 2XS7A 2W8LA 4ANDA 3RR8A 2CPHA 2HLTA 1NCLA 4MKBA 2XCPA 4QOTA 4USUA 2FJWA 1DQ9A 2LEBA 2Q6BA 3DM2B 4ZHRB 2J6UA 4K4WA 3P6YC 1M1GA 5IV4A 2BJ7A 4CIOA 5K9FA 4IFYA 3EXCX 4MIAA 1LQ9A 2LQJA 2K8GA 4FVMA 2VJUA 2VQFJ 2MZJA 2AU0A 2KG1A 4OI2A 4J90A 4NI2B 4U7UK 5H9EJ 3DGVA 2BW7A 3LOUA 2NR0A 3BPDA 2K3KA 4U95A 2YWWA 4RW6A 4USIA 2A0FB 2V2KA 1TP7A 4JI6F 4PUOA 5D4LA 4C3LA 3BH6B 2D69A 2XMWA 5CCLA 3W2VA 3N5BA 3R5AA 2V69A 2IVYA 4CO4A 4PRFA 4IFVB 4NASA 1YRXA 5DO2A 1CPZA 2OIHA 3FDSA 1JLAB 1PYSB 3US5A 2NREA 1TL3B 4B17A 5HAOA 2VU5A 3PJXA 3PRVA 3OXGA 1SVDA 4LF7J 2RF2A 4GO7X 2QLJB 1CQNA 5CYMB 1FD8A 3NNHA 1XMOJ 2MLXA 5J2NB 4XK8C 3AODA 1RBLA 3L7UA 3IP0A 2HQCA 3W5ZA 2AYBA 4FBUA 4NXNJ 2C22A 1CJVB 1IM4A 2JLFA 2ASJA 1AA1B 4G1PA 3QPIA 4Y34A 1Q8BA 3DGPA 2DK2A 1H3DA 2FGOA 3RTVA 2X7IA 3NEKA 4A46A 2W2PP 1CJKB 1RJJA 5DZ6A 3SFGA 5T7LB 4XAKA 3VAFA 2QSFA 3PEJA 2HQGA 3BKTA 3T5LA 4EUVA 3E8OA 2IA6A 2HFZA 5KG4A 2OD4A 4USWA 3J81j 2JL9A 2Q79A 3DRSB 4K4UA 2O67A 1VQ6S 1IBMJ 3NS5A 5DG8A 1N6QB 3FZBA 2O01C 1GFWB 2HFOA 2FJDB 4DZ6A 3T5JA 4NL5A 2XS5A 2DGTA 4I4BA 4OYMA 4NLGA 3FGVA 3IM9A 1UFLA 2M7SA 3M30A 3CEDA 3PDNA 3UR0A 3KMQA 5E41A 8AT1B 2NXJA 5DDPC 1LXNA 1C0TA 1WC5A 2CKWA 4I6AA 1JXEA 3G6XA 4B9TA 1YQHA 5HROA 5KT5A 4P6QA 2ALZA 3QIDA 1S1XA 2ZDPA 4E8UA 4UOHA 3Q8SB 3QLHA 4IFYB 3CJKB 3DNCA 1SUQA 4WZQA 3S6EA 1NSAA 1EB0A 2XSFA 5EWEA 4V1Ak 4K2XA 2Z57B 4DV6F 2FC9A 4DQRA 2HNZA 1WOSA 2VOOA 4LMZA 1WI8A 3QGHA 2V8HA 4ED3A 2FLPA 4IRDA 4LFAF 3EGNA 4B9MA 4QR2A 2V8VA 2VG7A 1T95A 2ILYA 4PWWA 5KFKA 1D9FA 1FE4A 4RW6B 5KFOA 4DX8H 2O66A 3GIKA 3NAHA 3W2VB 2ZITA 2DJWA 1X0PA 4A48A 1DJ0A 3ILOA 4RWXA 2E66A 1XR5A 1R6VA 4HTJA 1KP6A 2AKWB 4MMOA 1QTMA 4WFBQ 3NG8A 2A1BA 4OYPA 4F26A 2JVOA 2YNGA 3HFKA 2I5JA 1SKWA 3VGVA 1PYTA 3QAEA 3VZHA 2CQCA 1V6HA 2XZDB 2D3UA 3MM5A 3CD6S 2B5JA 2XC9A 4LR9A 3MR5A 1NK6A 3KDNA 2I38A 3T1YF 4QPTA 2ZH3A 4DI6A 2WVCA 1P9YA 2FJVA 3FSXA 1VC5A 4NCGB 2WSCC 1GTEA 1WTBA 1F2GA 5F3ZA 4Y0FA 3TUPA 4OX7A 4CDIA 1VQ8S 3TA1A 3E01A 2WW4A 4Y3CA 4TNOA 5A2QY 4USHA 5F3TA 4OHYA 3TAMA 3V5RA 2NS1B 3OUYA 4OX6A 4K4YA 2PMHA 3LTOA 5KFUA 5IT9Y 3HSDA 5FJ4A 2PGCA 1H73A 4F50A 1WF1A 2CJQA 3GJRB 4J5OA 2VBZA 1FKOB 3M30B 3QQCD 4PPDA 2F4VJ 4M94A 2XGPA 2ZWOA 4I6YA 4O0IA 1C0TB 4JI2J 3LAMA 4KY3A 2VZ9A 3C6TA 1NDLA 4FKYA 5HROB 4M5LA 3CCRS 1S1XB 3GONA 4WP8A 2R8JA 2C2RA 3GIIA 4KHRA 6FDRA 3HP6A 1SUQB 3CSKA 3TZXA 3IS9B 3QGPA 1RE1B 2AZ1A 4DUYJ 2Q66A 2HNZB 3CW2C 1TU0B 4LBHA 2XY7A 1NLKL 4KGXB 5A8KB 1RI7A 3DYAB 4P74A 1AYEA 2E1AA 4YY3J 3EX7B 4DR3J 1HL6A 2M70A 1QSLA 2CXEA 1HBOA 2XZTB 1PAUB 2DNMA 4HLBA 2E1MC 1VQSA 2HHVA 3NMRA 3JS9A 5GAEU 3TEGA 4IO1A 4A8XA 5GADI 1VLYA 3MWBA 4DV4J 2OAUA 4HEA9 1EIYB 4DV0F 3P5BP 3GIMA 4CLPA 3AQPA 4UY8T 2YNGB 2PI5A 2I5JB 2W9BA 1NK4A 5B0DA 2E5LF 3BN7A 5HVFA 4PQAA 5A2QU 4OYZA 3M8YA 4S0MA 2LMIA 2IRYA 3MM5B 5FD1A 2B5JB 1SPBP 4DPOA 1FJGF 1C0UB 2BEFA 5KTQA 5L1JA 3R5DA 2UVUA 4NLPA 1B0PA 1L3UA 2FHMA 2XLKA 1WG5A 1O6XA 2WVBA 2ATLA 5HP1A 4ED2A 2DGUA 1XR6A 1YBTA 5B0BA 1FNXH 2QA4G 4I67A 2DNNA 2QRRA 3SFUA 1VJWA 5D0RA 2YKPA 5DDOC 2BA9A 3T6JA 4ZJOA 4X4NA 4PQUA 3TAMB 2B4OA 5HVGA 3HHLD 2KXHA 2KHDA 3OUYB 4LVNP 2W7OA 1JLQA 4E98A 2YH1A 4PAAA 1WSVA 2OSQA 1DTQB 1FVQA 1S9FA 1ZYQA 2ABYA 5EX0A 2XO6A 2M2BA 1YTYA 4CLZA 2RT3A 3R7NB 1NHUA 2E29A 5J1EA 1P8GA 2LDYA 1QAJA 1UW4A 5MLCV 2UU9F 3FSIA 3D66A 5CZVA 1BQXA 3C6TB 2QTWA 2YNIB 5THWA 2M3DA 3D4JA 4KR0B 2XYHB 1HYSA 1YVFA 1REGX 3CD7A 2JLGA 3PV8A 2VV5A 3OFHA 2FHJA 4CYUA 4WFNQ 1PIEA 2X1AA 1UFKA 2A18A 3M8WA 2Y0SD 2U2FA 3U02A 2IY5B 2EFNA 2WVEA 1XNQF 4ZN3A 5AXNA 3UDEA 1DRZA 1PBUA 4UOFA 3L7OA 4BS2A 2VHGA 4NA3A 4LIRA 1QTNB 1EARA 4QIWD 3NP5A 2W01A 4WIIA 2AJ1A 2DH7A 2FYXA 3DRPA 4DEZA 1JIHA 2R8KA 1HBOB 3BSNA 1FNOA 5F41A 3AJ1A 5D0GA 2MKKA 3HO1A 2W8KA 1VQ7S 3D1OA 1VQLS 1NPKA 2E7XA 4C7QA 3I5CA 1X4FA 4USTA 4M8LA 4DR6J 4WCEQ 3HFZB 4I64A 1U47A 3DI6A 2BRKA 4DXLA 4IO9Q 1WI6A 2VICA 2DNLA 2BKOA 2M5YA 1EP4A 3QAUA 5JJBA 2P6TA 1U8SA 3OJSA 1RT1A 4CP5A 1YJTA 5GVQA 1PJ6A 3Q8VA 2W9BB 2ZM6J 1RT4A 3GIRA 3CTRA 4JB8B 1YSJA 4G1IA 1IVZA 1QUPA 3UO0A 5CD4A 4I56A 3RRKA 3MMCA 2BABA 1Z1ZA 4DV5J 2J6TA 1YJVA 5CD4H 4YB1P 1RGVA 3H4DA 2R8HA 2ERRA 2UXDJ 2R7XA 1UVKA 2ZKUA 3MD3A 2QN6B 3VVUA 3C2PA 1TUGB 2AEMA 2CPZA 1NK0A 2QG9B 2MEWA 1R0AA 2ZWPA 4OI0A 3SYZA 5HP1B 2XLIA 4FYWB 3GFXA 1IWGA 2OP5A 2QV6A 4PKDB 2PI4A 2V4RA 4PQUB 3I9ZA 2PA3A 1FXDA 4HDGA 1UCNA 4CLUA 4OV1A 3K89A 1YWXA 1YJWS 4CM0A 3PY8A 4WBFA 4DWIA 5KFMA 3BBBA 1JKHA 3UPFA 3B4DA 3FCVA 4CTAA 3CC7S 4X62J 1F5BA 2CQDA 5J1EB 1OSCA 1W26A 2P6SA 5GMKa 2AX1A 4MK8A 1L3KA 4A47A 2CQ4A 1RAEB 3TJ9A 1H38A 3THTA 1H0HB 2W2NP 1RAAB 1EQ0A 1KBRA 1HYSB 5HO4A 3S01A 1YRTA 4CYUB 4FPIA 2B0GA 2Z30B 2EKNA 5SZTA 1NJXA 1ZM9A 1LK5A 3JYTA 2IDEA 1NJYA 2VL1A 5GMEA 2QA2A 2DNQA 3DOLB 1KWMA 4OQJA 4DX7A 3G2XA 5E3RA 1FDDA 3PX4A 4Y2IA 2Y8WA 2QC3A 3G87A 1K44A 3H5UA 1YI2S 3DRPB 2YXLA 1Q7YT 2O3DA 2RD5C 1HQUA 3MMAA 3N6MA 4C4WA 1O0PA 1SIWB 4J9LA 2A2CA 5IQQA 1TAUA 3LPEA 2QMXA 3R6LB 2VQEJ 2V8GA 5F8NA 1TKDA 1EP4B 2CFXA 2ZC3A 4FYYB 1LOUA 1RT1B 3OVSA 2DY1A 2OEMA 5IC4B 1RT4B 1F9FA 1RQ0A 2YX4A 4L3KA 2HK3A 4DCOB 3FFIA 3CJ4A 3TQEA 3MMCB 2Y3YA 2WB4A 2C1EB 3N28A 4O4GA 5M2PA 1VHIA 3NNCA 3PJWA 1T94A 4DL3A 2GGPA 4WFZA 3H59A 3CC4S 4WF9Q 4J9VA 1R0AB 1FRXA 2QFJA 3D6FB 5ETQA 2ZHBA 3V4IA 4NRTA 4FF4A 2K7JA 2HAFA 4WXWA 1B3TA 2HWTA 4DDFA 1VQOS 3IBFB 3NGTA 3KJNB 4P2SA 4LF7F 4P7VA 3H98A 1SC4B 2DKOB 4KAIA 5L8RC 4EGLA 2YPYA 1UZHA 2BRLA 2IYIA 1VCTA 4NYOA 3NGRA 4NXNF 1JKHB 2OFHX 5C2GA 3KHLA 4AUKA 4TLQA 4JV5J 4DR4J 2U1AA 4N41A 4NX9A 4CTAB 2L9DA 2JZ5A 4ILLA 3TAQA 3H7HB 3RJMB 3KK2A 4FXWA 4ZN1A 2XULA 4ZLNA 4NLTA 2GAHC 2B7CB 3HFVA 4AD6A 1U1QA 2GIQA 1X4HA 4P73A 2FLNA 5DLGA 3FRZA 3CUNA 1FHTA 2YKMA 3L7PA 1R43A 3CDAA 1P1TA 3IBCB 2CQIA 3I56S 3QJLA 3VALA 2BE9B 5HI7A 4LF8F 3IRXA 2JX2A 2F8EX 4D3GA 3JYTB 4AL6A 5DGBA 4C8MA 3O1LA 3DOMA 3D6HB 4LFCJ 2D74B 3W65A 2OTJS 5U47A 3O6QA 3L9ZA 2RE1A 4QWCA 2PO4A 1FO1A 4NA2A 4C8LA 3ITHB 2DR5A 2KT3A 3MMAB 4B3MJ 5CAAA 4Q7AA 3V6KA 2RVJA 3OV7A 1X5PA 4ZITA 4RU2A 1FTCA 5K14B 4K0KJ 3RAXA 1ITPA 1X8DA 2ZH2A 3CJ5A 3MD1A 4KRWA 4C8KA 3MCMA 2ADBA 4WE1A 5IQ6A 1HBUA 4FBTA 5GAGI 5GMDA 2OUGA 1WACA 3PR4A 2GVZA 4ED5A 2ASLA 3FFIB 4Y6IA 4X4VA 3UD4P 2W4PA 3ZZTA 4J37A 3V81B 4Q5VA 1M5HA 4O4GB 2HW3A 2W24A 3THPA 1D3WA 2DGXA 2GGPB 1RAGB 1WC0A 2HMIA 3KXDA 1NSKL 2IBOA 1R31A 3CJ8A 2Z8QA 1NB7A 1JQGA 1T9XA 3I4HX 3CCWA 3V4IB 4ELVA 4NZ0A 1NHVA 2ZE2A 3D5MA 1DY3A 3SSSA 3VVTA 1OYEA 2GV1A 4WYWA 5I42B 2V5HG 2VB6A 2R7WA 4CO2A 3VAGA 2RRAA 4P2MA 3VZIA 1QY7A 4ZIWA 2R7OA 5G0RA 1GK8A 4OHVA 3MAAA 1S1VA 3EXYA 1G4CA 3TUZC 4DL5A 3PXGa 2M0GB 3R8YA 4ECVA 3DLKA 3FBBA 4AL7A 3K5NA 4B3OB 2QYGA 2EW9A 3G6ES 2J0XA 2X1FA 3QWPA 4QW9A 2L41A 1D9DA 4KBIA 4A8WA 3CO9A 4ERDA 2MJUA 4KGKA 1NKCA 1T9WA 2NPFA 4TXSA 2ZVIA 3KYLA 4HTIA 3AXMA 4OYAA 5A6WA 3DLHA 2DNRA 4CLKA 5A6PA 5ITHA 2IMOA 3SDEA 5L38A 3CCVS 2HHHJ 2CQ1A 3ILIA 1N56A 1ZOTA 1B64A 1SL2A 4EU0A 3IRXB 1HD0A 1HBMB 2ZNYA 3DDKA 3OTBA 3JSYA 4YB5A 2NUUG 1WKJA 1HQEB 2GX8A 4ETXA 3DOMB 1I94J 1VFJA 3MAQA 2KG0A 4OHXA 2YX7A 3BGLA 4LT6A 2DXDA 1G7CB 3M2RA 5J2QB 2E5JA 4IR9A 1FRKA 3FMBA 1M5PC 2YQ3A 4I7FA 3K57A 2HGNA 3QSIA 1GMVA 1Y00A 3FBEA 5AE3A 4C8ZA 4KPCA 4W92B 3IAS9 2XCAA 2AMCB 1BD6A 3PYDA 1SV5A 2HVEA 1HBUB 2E5HA 2VPWB 5IM0A 1KEKA 2MTLA 1H74A 2QX0A 3H5YA 3K5LA 1AFJA 3D68A 1WF0A 3OQ2A 3CMQA 1BUXA 2GVZB 2EBGA 4H4KA 1PSDA 4WPAA 1S6PA 4NLVA 3Q2SC 3M8QA 3WQPA 1OMSA 2IDLA 2G0CA 2L9WA 2MLYA 3NS6A 3B82A 4IQMA 3R2CJ 4YY3F 1V5IB 1URRA 4NRUA 2ZZNA 3PEHA 4PCQA 2YNFA 3IN5A 2DNZA 2HMIB 4EI2A 3KK3B 3KLIA 3FCWA 3DU6A 4H4OA 2CJKA 2RS8A 2MQ8A 2WONB 1T03A 1RWXB 3C3LA 2NLWA 2ZE2B 3R9LA 5B09A 1GXLA 3QZ8A 4ZOSA 3TANA 1YDLA 3A8IA 2PDAA 1HPZA 4K4ZA 1KOHA 5G0RB 1P9QC 3CC2S 3GR0A 4P52A 3TRGA 3HVTA 2E9TA 2SXLA 4X84A 2RAQA 2AGPA 1DTTA 2H54B 3MPDA 5GADU 3DLKB 4O44A 5K5MA 4IUFA 2FDNA 1N5SA 4ZKAA 4RNHA 5DZ7A 3RAQA 4K5RA 3R7SB 3FNNA 4GVLA 1BLUA 4ED7A 3NCRA 4U8VA 3PW0A 4RR5A 1FJ7A 3SCJE 2HAIA 4J9SA 3O8WA 1YJNS 2M4MA 2AYMA 2AW0A 4LSZB 4HHUA 4OYOA 3SDEB 3ISNC 1BE4A 3HVWA 3B54A 1XEZA 4MTPA 4ECWA 2VIHA 2VBYA 1OY6A 1DARA 3NWRA 3L95X 3WX8A 2WK4A 2FD2A 5HQ8A 2KZZA 1N33J 4HT5A 3JQJA 5ETTA 4I1TA 2HQFA 1S59A 1MWZA 3UR3C 4BDPA 3HDSA 1JJ4A 2VUGA 4WK3A 5KT6A 3KLHA 2HHUA 2YWHA 4CWBA 4ED8A 1SC6A 4R25A 5KFVA 1G2EA 4HH1A 4FZVA 2BKPA 1SJ3P 1JJCB 2B56A 2OEJA 4OL8A 1TL5A 1IUJA 1S1WA 1JNRB 1MMLA 1ZS6A 4CNZA 5T41A 2JEJA 3HSGA 2AJQA 2RILA 5IM0B 3R6GB 1F5CA 1X4GA 4RBUA 1IBKF 1IKVB 3DRXA 3G9CA 2W1BA 3M8QB 1S9EA 4DV3J 1S10A 5H9FK 1J5EF 1SJRA 1Q8LA 2LECA 1HLWA 3DMJA 2HHQA 1TZ0A 3UNGC 2XHCA 4WU3A 2YNFB 2KXNB 5IFMA 4KYZA 2G1DA 3HXMA 5KFAA 4KPYA 2F7VA 4NYPA 1ZPWX 3GSDA 1T03B 4QWEA 1U2CA 4B9NA 3BQ0A 2FUG9 4DR6F 5L39A 5D78A 4Q43A 1DFDA 4UTGA 3R27A 4B3TF 3CD5A 2B3TB 5F9NA 1LWCA 2Z2YB 5C42A 3TUIC 5HBMA 1U0HA 2GS8A 4PABA 2BACA 2F65A 4WXOA 3HVTB 4KH0B 1DTTB 3C14B 4WTYA 4DV5F 2CQPA 4G65A 4O44B 1KVIA 4JI7J 3OW2R 2HHTA 2NCKL 2M8HA 3MM8B 2CQ2A 5LSLA 4Y28C 2HQIA 3KMSA 1Q53A 4X65F 3TEHB 4DR5J 1KFDA 4OV6A 3AOAA 2V0NA 5ETPA 3MEGA 4UF4A 4P71A 4ATNA 1WNEA 2MGZA 4J9NA 3QRPA 3U1LA 1U02A 9RUBA 5LJ5Y 1FRIA 1VYAA 4BBYA 3KK1A 1T0TV 2CNLB 3EE3A 3MFHA 3POTA 4YB7A 3W8GA 1K0TA 1HWJA 1RU2A 1J2VA 1XMBA 1UP1A 2M52A 3H25A 1H72C 1V3SA 1GNKA 2J0SD 2GNKA 1DBDA 1RTIA 4YR0A 5FIIA 1FF2A 1HNIA 4TU8A 5HQLA 1S6OA 3B6BA 3DRRA 4TYBA 1UA1A 3KLHB 4K50A 1UVNA 3SCLE 4X62F 3UDVA 1R7IA 4KV8A 2YNHB 5LL6d 2CNNB 1KHWA 4PEOA 3UE2A 5LMUJ 1HHQA 3IG1B 1MN7A 1S1WB 4LSNA 1BQMA 2HNDA 3CXCR 4ZJLA 5I3UA 2RUGA 5E3QA 2QL7B 2KJWA 1X4BA 1JLBA 5MAOA 2C28A 3D0HE 4QU6A 3ZFVA 1OIAA 2ZFHA 4KJIA 2P5VA 1S9EB 2QIFA 5M2RA 2IYGA 1L5UA 1FJEB 3AJDA 4K5SA 2W2MP 1FFSB 4DV2F 1QDUB 2BZ2A 5J1PA 2JEGA 4CH0S 3KJFB 2VFRA 3RBEA 3DFEA 2ZH6A 1SH2A 2JVRA 2C3PA 1FCAA 2MZTA 5RUBA 1UVIA 3HJVA 3F41A 1L3TA 3HULA 1QLNA 2UXCJ 1RT6A 3AHPA 3GQCA 4P72A 5ETNA 2VQEF 2RQ4A 1RCXB 3MPWA 2ZC4A 1LWCB 1RTDA 1DURA 5C42B 3PYEA 3ZTPA 1UEKA 1YKWA 4H4MA 1JLFB 3GWCA 2D3ZA 4K4SA 2NPIA 2RSQA 1S57A 4WP9A 4N56A 1UEVA 2ZNZA 4DL4A 1HNXJ 3HT0A 4QR0A 4OZLA 2BM0A 4TYAA 2MZ1A 1NJWA 1X9SA 5KFRA 1V3ZA 2AF6A 1Y9OA 1MWQA 2AEJA 2LFVA 3DOKA 4DR7J 4O23A 3Q8QB 3FUYA 3BO3A 2EFOA 2ZZTA 3UNYA 2KHCA 2RU9A 2MGZB 2HVDA 3NY0A 2O1PA 3MUVP 1VI7A 4TU9A 5DQHA 2BM1A 4NLSA 3J7Z5 3NWGA 2XS2A 8RUCA 3S8SA 1RWUA 1U0SA 1K8AT 3VGSA 2XMUA 1RTIB 3GJTB 5LT5A 2WCXA 1X60A 1C1BA 3DRRB 5E3CA 2RDIA 1BC6A 4DR4F 1UEUA 3SSQA 2VFVA 1TQLA 3BSOA 2H65B 4ELTA 4ZCMA 4KV8B 1E6YA 3P4UB 1RT2A 2MQLA 2LA6A 3OR2A 2MDAA 2D1CA 1V5VA 1ZA1B 1R6YA 3R5GA 5K20B 3RW6A 3BBFA 1BQMB 3BF4A 4LSLA 3R5JB 1VJQA 2XYPB 1AXQA 1G6BA 1RAOA 2AYGA 3SSRA 4K4XA 1B99A 3PX0A 3JTPA 4K4TA 1SIZA 5I3UB 3GFHA 3OTOJ 1VLOA 1CG2A 3NOGA 5IT4A 2BJ9A 4FYVB 3PKMA 3KTQA 3WC0A 2YKNA 2KRRA 1T3OA 1QE1A 3B4MA 3V6DA 4JI0F 4EO8A 4LFCF 2XSJA 1CQMA 3NBPA 2GC8A 5E3AA 3GFZA 4DSEA 2C2EA 4YQWA 3HK2A 1WEZA 4O0NA 4YB6A 3TX0A 5KFYA 3D2WA 3EUNA 5KFSA 3LQVA 3TJ8A 2W2OP 4RZRA 3G82A 4NXMJ 2B8PA 3NAIA 1W2BR 4PYDA 2J6SA 3K0JA 4PWDB 3D1QA 5IV3A 2PSZA 4DQSA 2AHOB 3V4MA 3PFEA 1ZTWA 2DGQA 5HANA 4K0KF 1F60B 3ENAA 2QA1A 4BWJA 1CJTB 3QFHA 5IWAJ 2F63A 2IAJA 3AOBA 4HACA 5F9LA 3IR7B 3FEXB 3FC9A 4ECRA 4JYAJ 3K17A 3D7SB 1S4FA 3IR5B 3P45B 1URNA 2GVDB 4KB7A 3H2UB 1RHRB 2DHSA 1C2PA 1S49A 4HHHA 2OI2A 4ZVRB 4F4WA 2N7YA 1ZH5A 1HA1A 3FEZA 4GC6A 5GAGU 1RLCL 3HSZA 1S0VA 4O3PA 2OPRA 4TY9A 1KTVA 2ZD1A 3KLEB 3NGUA 4U7CA 2BBEA 4DSIA 4F3MA 5AE1A 1LFPA 3DU5A 4LF1A 1A7GE 4B3RJ 3P49B 2AWZA 5ETOA 5L1LA 1NMEB 2GO8A 1LEOA 1GX6A 1NDCA 2KN4A 2JNJA 2V4JB 4ZPCA 1XNRF 2Y1IA 1MN9A 3CCUS 4OZ0A 2XMMA 2YVSA 1KKHA 1NUEA 2V34A 2KJVA 1LW0A 4TQSA 4LIWA 1Q1KA 4KT0C 2XY5A 4C8YA 2DNOA 5A76A 3AT1B 1I51B 5HMYA 2BKNA 5KAKA 3FBCA 1WG4A 4DPWA 3OTCA 1UJ4A 4FS1A 1FA0A 2FLLA 4QYZK 4X64J 4CLSA 3OL9A 1KONA 4DV7J 2EFPA 1RT2B 2OPQB 3BGOP 3OR2B 2UUWA 2OEKA 7FD1A 2X1GA 1ZZFA 1NKEA 1NRKA 2UV8A 5BXIA 1FEEA 2ROGA 1KSPA 2OFGX 3UN2A 3HKWA 1BMQB 4OLPA 1MU2A 3QBCA 4LBPA 4KH1B 1FFWB 1R3NA 3LALA 2HHHF 2BXJA 1SB6A 3GZ7A 4CZCA 1S5ZA 1EKRA 1TV6B 2DHAA 4AXIA 2ZBIA 4RW7A 1CJUA 2YKNB 4D3HA 2HFNA 4EK2A 1JXLA 1QE1B 1UVJA 3V6DB 1I94F 1HWLA 3LP1B 3BS9A 2XSJB 2CYYA 3NBPB 3BB5A 2BQUA 2EVZA 2ZDOA 1VIXA 3O3LA 2POKA 1K0VA 4DSFA 1D9AA 3GR1A 4I6WA 2BE2A 4F67A 3VHQA 1U2RA 2CJBA 3G82B 1IR0A 2CJYB 1VBKA 1WD6A 5H9EK 3T1HJ 1T9UA 1RSCA 3FEYB 1TL1A 4LR7A 3NKYA 4YN3B 2IAJB 5D4OA 4HACB 2WVDA 2VPYB 4ZPAA 3ZTSA 2AGQA 3EGVA 3PR5B 3AXKA 3KG4A 1SI9A 1JLGA 3I31A 1QSYA 2GHPA 4C97A 2DNYA 3EMTA 3KJQB 3JAMY 2DPIA 4PYAA 3QIPA 1KVKA 2IVFB 1Y5NB 4CO3A 2OJ3A 1K47A 2OPRB 2ZD1B 2CQHA 3T1AA 2C2NA 5CYJA 1Q8KA 4ANEA 4CLLA 2R4FA 4G1QA 4F8RA 3M9MB 5CA5A 2F3JA 2V9KA 2DRDA 4YDXA 4KHPJ 2YWFA 2OTLS 2BJEA 3DLLQ 5L1KA 2PT0A 4LF9F 4L6V3 2F9DA 2NXNA 3BH7B 5L1IA 2DVIA 3ONQA 1HNWF 3RUBL 4RUHA 4JI8J 1WC1A 4C2MA 2LU2A 3HVAA 1LW0B 1GXUA 3MM6A 4IQXA 3BGFA 4B02A 1WJ9A 2IM1A 2ZUGA 1TK5A 2CRLA 3AA9A 3L3CA 4EMDA 1YRUA 1VQPS 2BE7D 2R7RA 2Y1JA 2CQ3A 5B0AA 2I6WA 3BO2A 3BKUA 4LF6J 4XIUA 1GX5A 3RR7A 5D4PA 1OPIA 4E2FB 2N3OA 4KFBB 5D3GB 2RQKA 1S0OA 2DH9A 2MPUA 3R3TA 4TU7A 1ZZNA 1MU2B 2DGVA 3BQ1A 1IJFB 1MG7A 3R5BA 2FVSA 3N0VA 2UUCF 3A8KA 4MH8A 1B7FA 1VQKS 3BSAA 2F1FA 3IR6B 1PC5A 1RZMA 4ZP6A 1X0FA 3M8SA 4ED4A 1CJUB 1VQ9S 2ZEJA 1IBLJ 2Z2LA 4GKJF 2HKEA 4ZPWR 2ROPA 1NSQA 4B08A 2RU3A 2ZKTA 2VJVA 2O5DA 3GV7B 4ZVSB 4DFKA 3AFGA 1XK8A 2OPSA 2BE2B 4LREA 1REVA 4MYUA 3MEDB 3JAMU 1SL0A 1FKPA 2DISA 1ZAXA 3AD8C 5D15A 3I0RB 3D0IE 4C11B 2A6OA 5IS2A 5A8RA 1TL1B 1N5YB 1OY8A 4MK9A 2PFFB 1PO6A 4HT7A 3PACA 3LANA 4QYZJ 2UUBJ 4B9UA 2Z4PA 4OZJA 2XHWA 3A13A 2DYAA 1DHMA 5I4MA 1JLGB 5DLFA 4JI1J 3QO9B 2APOA 2KFYA 4LF2A 5ADZA 1PKUA 2WSEC 4KC5A 1FRJA 1MWYA 3QIPB 1RTJA 2E7VA 1RT5A 3NMAA 2ZOGA 2MSSA 2YQ0A 2DR8A 2R2UA 2AJ2A 5ETMA 3OVAA 4QW8A 4ZJQA 4G1QB 2RNEA 4MKAA 3NXZA 1ZM2A 3W5XA 3TI0A 4ZPVR 3QSYB 1X9MA 5HJXA 2NSBA 1RWPB 3MURP 4A8FA 2FLOA 1A0OB 4TY8A 2DXEA 1RAFB 2WBMA 4ZLJA 3GV5B 2OMLA 4RUAA 2LYVA 4KGZB 2UUAJ 1TKXA 3MM6B 3HM9A 1RT3B 5LM7E 3MECA 2JC0A 2MXYA 2MYFA 2CNKB 1TKTA 2LDIA 3PYFA 1UZDA 3KJVA 4ZVQB 5HJYA 4CH7A 5L46A 5DQGA 5BR8J 4DF4A 2N4CA 1T9YA 1KQGB 4PWUA 4KGMA 1OY9A 2C2DA 2RUSA 1X31C
chains in the Genus database with same CATH topology
2GQCA 3DOMA 2W7AA 3NLCA 3CDUA 4QWBA 2D74B 2YWKA 3NGKA 2OTJS 4YOEA 2IMWP 5U47A 5C24B 4NLYA 4RNMA 4I2PB 3IFEA 3O6QA 1IQTA 1Q81T 2RE1A 2LVWA 3H5SA 1LWEB 4ZMMA 1U09A 1T05A 4QWCA 2PO4A 1FO1A 4NA2A 3CWJA 5AXMA 4CNYA 3AB2B 3PZPA 2DGSA 4C8LA 4QBUA 2LEAA 1GH8A 3MR2A 2FJAB 3KLIB 4RX6A 2EK1A 4RNOA 2VONA 3MUMP 3ITHB 4H4OB 2DR5A 1Y0HA 5D6GA 1AW0A 2DNPA 2KT3A 3MMAB 3LWLA 2R8GA 1TVRB 3K58A 3M4XA 3CDBA 2CVIA 4UY85 5IZHA 4Q7AA 3V6KA 4NWBA 1JK9B 2FHKA 1IKXA 2HWHA 2CPFA 2RVJA 3IGVA 3OV7A 2EPIA 4KTQA 5BYQA 2UXBF 1X5PA 5B0FA 4XPEA 4DJBA 3RB6A 1JX4A 4RU2A 1FTCA 3MCSA 5K14B 1SJ1A 1UWBB 2IVMA 3RAXA 1KC8T 1X8DA 2MMYA 4EBCA 3HHKA 3SCKE 3CJ5A 3MD1A 4UQTA 2ZH2A 4Q2LA 4PXBA 3W2WA 2CPDA 4KRWA 4C8KA 3OHAA 4WZMA 2ADBA 4WE1A 5IQ6A 1HBUA 3G6YA 4FBTA 2UUTA 4UOCA 5GAGI 2DR9A 1R27B 1HPZB 1DQAA 1WACA 1FKAF 2VFUA 1LW2A 3PR4A 2XMJA 4URGA 4XO0A 5G4DA 2R7TA 2ZM6F 3NL0A 1ZBTA 2GQQA 4RW8B 4FF1A 2QA4S 4JOUA 1VRUA 1H7XA 2MKSA 2HNYA 4ED5A 5KFTA 2ASLA 4K4VA 5KOXA 1X9WA 1FKPB 2H5EA 3FFIB 4KFBA 5D3GA 4Y6IA 4X4VA 3UD4P 2LU1A 1N5VA 1N32F 2L9NA 2W4PA 3DHWC 3N79A 3DOLA 3ZZTA 3HPOA 4J37A 2VC0A 3D1HA 2UXDF 2UZAA 3V81B 4Q5VA 1M5HA 4N47A 4O4GB 4WJBA 4ZK7M 2HW3A 3S7RA 5J2PB 1X4EA 2XMKA 2W24A 3JSMA 3CT9A 3THPA 4OJGA 3AQOA 1D3WA 4HYKA 2DGXA 3BREA 4OI1A 2GGPB 4ECXA 3JSBA 4N77A 3TA0A 3CIZA 1SJFA 2HMIA 5EUHA 1N0VC 4ZVEA 1HNZF 3PW5A 5KFXA 4F25A 3HLUA 4ED6A 1ZM4A 2IBOA 1R31A 5DETA 3T19A 4EWTA 2Z8QA 4YFUA 3M8PA 1U7LA 4OLOA 1NB7A 1NH8A 3I4HX 4ZVHA 5KFZA 3CCWA 4A8QA 3V4IB 1VQNS 2Z0GA 4QWAA 4ELVA 1S0NA 2VBXA 4OJ1A 4NZ0A 1NHVA 4N8NA 2ZE2A 1Y3KA 2OLWA 2OPPB 4X4TA 1Q82T 3D5MA 1U24A 2MQOA 2DNKA 3NCQA 3N01A 4RW4B 4RNFA 3SSSA 1Q4RA 4NLDA 4DF8A 1NK7A 1RA7A 4YDDB 2K2PA 3HHLB 2GV1A 4WYWA 2ZJPQ 1S9GB 1FDBA 4H4KC 5I42B 3Q8RB 1RT5B 4CO0A 1J5OA 2V5HG 2VB6A 4X4UA 2VKRA 1T02A 3I4PA 2JDJA 5DM6Q 3M9NB 2VPXB 4ZLPA 2R7WA 2BDPA 1MNEA 1VK3A 3HKZD 4KSEB 1CC8A 4CO2A 2C3YA 3VAGA 2RRAA 3CE8A 5E2QA 3VZIA 2CPIA 3JB9k 1QY7A 1XWLA 1JLCA 2R7OA 1B0TA 2DIVA 5G0RA 3TOQA 4Q8FA 5KFQA 4OHVA 1S1VA 1HWIA 3EXYA 3MEDA 4NLOA 2HGLA 3AY0A 3LGNA 2ROEA 6FD1A 3TUZC 2MQNA 4DL5A 3PXGa 2M0GB 4ECVA 2KB2A 1AFIA 1U1KA 3DLKA 1FJCA 5D8HB 4AL7A 3K5NA 4ZCKA 2DR7A 2DH8A 1JJ2R 4ES3A 3I0RA 4ALZA 5A8WB 4B3OB 4C11A 1QAYA 2EW9A 4KHPF 1HBNA 3G6ES 2C3UA 2X1BA 2J0XA 2X1FA 5F8JA 2BQRA 3E3XA 2FJEB 1N5YA 2UVVA 3QWPA 4C0HA 1D0EA 1X5TA 2ZH1A 4QW9A 2DITA 1Q8IA 2L41A 2ZHAA 4KBIA 1D9DA 4A8WA 3MTKA 2MKJA 1XTZA 3BR8A 5KFDA 4CQ1A 4OI4A 3G71S 3CO9A 4ZCIA 4ERDA 3PFOA 2MJUA 1NJZA 1S1UA 1S1TB 3ULHA 4RUCA 2VG6A 4KGKA 2KZMA 1NKCA 3KLFA 2X3GA 2NPFA 2CPJA 2Q3PA 5A0YA 4TXSA 4DL2A 2YX1A 3I0SA 4OFZA 2FVRA 1YG0A 3KYLA 4HTIA 1TKXB 5KFBA 5BYSA 3MXHP 2C42A 2CPXA 2RQCA 2J8AA 5A6WA 4X66F 3DLHA 1VHFA 3QO9A 2DNRA 3FMWA 1TL4A 5A6PA 5ITHA 2IMOA 1DLOB 3SDEA 4PUOB 5L38A 4NMLA 4IG0A 4LF6F 2ZH4A 1TKTB 2N82B 3CCVS 1KLMB 4NLUA 2CQ1A 5KG5A 4Q44A 3CMES 1N56A 1ZOTA 2A10A 1B64A 3K7RA 4YEAA 5EN1A 3FRYA 1SL2A 4B9SA 2GFFA 1KQFB 1NEEA 4EU0A 3ISZA 3T5KA 3IRXB 1HD0A 1KHVA 1HBMB 4O4RA 2ZNYA 3DDKA 5AXKA 4ECTA 1KRPA 2BYCA 3OTBA 1N4LA 3JSYA 4YB5A 2NUUG 5DRKA 2HG4A 1HQEB 2GX8A 2HHWA 5DJBA 3OXLA 4EYIB 4ETXA 1Y5IB 3DM2A 1PC4A 1VFJA 5KFLA 3MAQA 2KG0A 4OHXA 1M5VC 2YX7A 3BGLA 4LT6A 4WFXA 3VF0B 1G7CB 3M2RA 4X4QA 2RF2B 4R0JA 1FDAA 2NSCA 2KFZA 2KM8B 5I3QA 5J2QB 4M95A 2E5JA 4IR9A 2GQ2A 3HX9A 3DMJB 3RU0A 1FRKA 3FMBA 5DQIA 3KOAA 3QWUA 1NKBA 4EO6A 2VOPA 3HZEA 1M5PC 4QIGA 3KNAA 1M1KT 2XG8A 1KS2A 2KT5A 2YQ3A 4KKOA 2ADCA 1ULRA 4I7FA 1I1GA 2E1CA 3K57A 4OI6A 2HGNA 4DQQA 3HHLC 2LQ9A 1Y00A 3PW2A 1SKSA 2NYIA 5AE3A 5HLFA 1IKXB 1IBLF 3G4SS 4H54A 3KNGA 4IOBA 3OSPA 2COLA 4C8ZA 1U6FA 2D9OA 1VMBA 5KFGA 3IAS9 4W92B 1K9MT 3G8QA 1UAWA 2XCAA 2EKYA 3E2EA 1RT3A 1N54B 1SQEA 3M2VA 1BD6A 3DCAA 1VC6A 2WAQD 3W2WB 1SV5A 2KDOA 1Y5LB 3FSYA 3UWTA 1FERA 4PR6A 1HBUB 2E5HA 2VPWB 1FNMA 5IM0A 1KEKA 3TR5A 3TAPA 3H5YA 2R7VA 3K5LA 1AFJA 4G3IA 3PW7A 1WF0A 5HBMB 3AH6A 1T3NA 4BDPA 3H20A 2LEPA 3OQ2A 3VTIA 4X4SA 2J9EA 2EBGA 1VRUB 2HNYB 1I6JA 2JC1A 4H4KA 3TNVA 1S76D 1PSDA 3RAMA 1S6PA 2IJFA 4NLVA 4RBVA 3SZ2A 2ZBCA 3Q2SC 2LQ5A 5EWFA 3M8QA 1VIOA 1XN9A 4DBQA 4Y65A 2JSXA 2HPUA 2B4UA 2G0CA 2BUNA 2R7QA 1VQYA 5C24A 2L9WA 3NS6A 4Z37A 4ECQA 1N8RT 3B82A 3VR1A 5LSOA 4IQMA 1S77D 3JSMB 1UKUA 4YY3F 4DUZF 1QSSA 1URRA 4EEYA 4NRUA 1WEXA 1U6ZA 4B9VA 2ZZNA 3PEHA 3M8RA 1DQ8A 5CYMA 3WX4A 4PCQA 1DAXA 2Q6CA 2YNFA 4OZ1A 4LQ3A 4Q8EA 3OJUA 3IN5A 2DNZA 2HMIB 2G4BA 3KK3B 3KLIA 4NZ6A 1N5TA 3DU6A 3SV3A 3ITHA 4H4OA 2N7CA 2RS8A 2ASDA 2CJKA 4DS4A 2WONB 1O51A 1U1RA 1UL3A 5K8MA 3CIMA 1OQ3A 3M8PB 4MYTA 1TVRA 1WF2A 5SUHA 1ELOA 1T03A 3C3LA 3MEGB 4DV1F 2D9PA 4FPRA 1TR0A 5K8OA 1UJ6A 2NLWA 3I82A 2MQMA 2ZE2B 1WELA 1IKWA 1Q7LB 4Y2MA 1NK5A 4DFPA 4Q45A 5B09A 3PIPQ 5KG7A 4YHHF 2XNRA 4XDDA 5K14A 4C8NA 3M6VA 3KK1B 3EPIA 2VC1A 1GXLA 3QZ8A 2JFKA 3POTB 4QYRA 4ZOSA 1IKYA 3TUJC 3Q0AA 3TANA 5KG1A 4OJHA 1J5OB 3WBZA 1QUVA 1S48A 4DS5A 1FRHA 4R8UA 2EG1A 2KO1A 2RB7A 2PDAA 5JXSA 3IC1A 4OHWA 5BJRA 1E6VA 1HPZA 1GT8A 1KOHA 2AP6A 2KYZA 4ZP8A 5T7LA 5KFHA 4K4ZA 2B43A 4DR1F 5EGYA 4EBDA 1JLCB 2GCFA 4IG3A 4NXMF 5G0RB 4QIFA 1KLNA 1P9QC 2LKZA 4C0OC 3CC2S 3GR0A 2KM8C 1LXJA 1OO0B 3CCZA 4V19J 3TRGA 3ZZ0A 4DMZA 2BVZA 3HVTA 2E9TA 2SXLA 4X84A 4I0WA 2AGPA 2RRNA 3G8TA 1DTTA 1HNIB 4LFBF 2OO4A 4ILRA 3WZ0A 5GADU 3DLKB 4O44A 3DRSA 4JV5F 1C4AA 3QLHB 4FP9A 5K5MA 4IUFA 2PEHA 2FDNA 1N5SA 1S6UA 4RNHA 4ZKAA 2MB0B 4Q0BA 4EFAC 1HBNB 5DDRC 3I32A 3V81A 1VRTA 5DG7A 3RAQA 3IWNC 4K5RA 2IC3A 1U45A 4O3OA 2JWNA 3FNNA 4E0DA 2MZQA 2XBPA 2QLXA 5J2MA 1HI8A 3MI7X 1BLUA 4ED7A 1RT7A 2CDQA 3NCRA 1WEYA 4NLQA 2OKQA 4GKKF 1U49A 4F4KA 2GW8A 3PW0A 4PG4A 2MZSA 2HVIA 4X2BA 1S1UB 3UQSA 3BGRA 1H6KX 2VG6B 4LSNB 3KLFB 3SCJE 2UUAF 1FJ7A 2J7KA 2HAIA 1H7WA 2IFXA 4J9SA 2OD6A 4OZ5A 3U1MA 5A0YB 2HNDB 3I0SB 3O8WA 2VG7B 3EPGA 2I0XA 4XDCA 5CZXA 1YJNS 2YTCA 1VK8A 4OIXA 2M4MA 3LUYA 4WFAQ 2AYMA 3BEGB 2AW0A 2XMVA 4A8MP 1FXRA 4C9DA 3JSRA 2ILZA 4RW4A 3J7A1 2R7SA 3M1VA 3SDEB 5T14A 2XS7A 3ISNC 1S9GA 2W8LA 5E3PA 5I42A 3RR8A 2CPHA 1ZM3A 5H1SV 2UVWA 7FDRA 3HVWA 4MTPA 1XEZA 2HRUA 2HLTA 3J80Y 4ECWA 3RBDA 1JLBB 4DLEA 5KFWA 2HS4A 2VBYA 4F4ZA 1VBXA 2J9DA 4DLGA 1VBYA 2M9KA 4MKBA 2XCPA 2DB1A 4ECSA 1DARA 2HRYA 4QOTA 4AE5A 1LKZA 3Q24A 2FJWA 2R9LA 1QM9A 1DQ9A 2LEBA 2Q6BA 3OTEA 3L95X 2QT7A 1HWKA 4ZA1A 2WBRA 3C8YA 3DM2B 2WK4A 4ZHRB 2FD2A 5HQ8A 2KZZA 2VBWA 4IKAA 4B3RF 4HT5A 3GIJA 2J6UA 3CMAS 4K4WA 3P6YC 1RK8A 2HLUA 4DL7A 3RRGA 3GB0A 3OXFA 5C25A 2D3OR 3BN4A 4I1TA 4CIOA 5K9FA 1MWZA 4IFYA 5E7OB 3EXCX 3H2LA 2LQBA 3HDSA 3OFEA 4MIAA 3UR3C 2VUGA 1JJ4A 4WK3A 3UDCA 5KT6A 3KLHA 1LQ9A 2AYEA 2LQJA 2HHUA 3MR6A 4HI1A 2K8GA 2YWHA 4FVMA 4ED8A 4RU9A 1SC6A 4R25A 5KFVA 4KKOB 1YJUA 1R8AA 1G2EA 3G8SA 4HH1A 5K8PA 4B3MF 1X5SA 2E9RX 2MZJA 2AU0A 4FZVA 3VAJA 1SJ3P 2B56A 4OL8A 1RYRA 3WDOA 5DGAA 1PILA 1TL5A 4J9RA 4FYDA 1IUJA 3C6UA 1HHSA 3T9NA 2KG1A 1S1TA 4OI2A 4MIBA 5HLFB 1S1WA 4U7UK 2VFTA 1JNRB 5H9EJ 1MMLA 1RT6B 4U6PA 4CNZA 2DIUA 1QVFR 5T41A 2JEJA 4RLEA 2E5IA 3LOUA 3O5TB 2QEXS 3IA0A 3M2VB 2NR0A 4AL5A 3W7BA 3IO1A 2K3KA 3LWMA 4QR1A 4RW6A 1YJRA 2CG4A 2AJQA 2FVQA 4USIA 3PO5A 2V2KA 1TP7A 4KHMA 4JI6F 3A8EA 2RILA 4PUOA 5IM0B 5JVHQ 5D4LA 4C3LA 2XMWA 1RTDB 1F5CA 4NCBA 2CQ0A 3DN9A 1X4GA 5CCLA 3W2VA 3I9V9 3FJ2A 3N5BA 1NO8A 3R5AA 4H4MB 4RBUA 5D77A 5F8HA 3JTOA 3T6BA 1WHWA 4DV7F 3JTNA 2ZOMA 4X4PA 1IBKF 1HBMA 1IKVB 2IVYA 5AE2A 3BJYA 2A2DA 5KG3A 4CO4A 3DRXA 4PRFA 2J5AA 3G9CA 3M05A 3IGNA 2IA0A 4IFVB 3N6LA 1HQEA 1YRXA 3KG1A 5DO2A 3M8QB 1CPZA 3E01B 2RRBA 2OIHA 1S9EA 3FDSA 1JLAB 3US5A 4CO5A 4DFJA 2NREA 4OI3A 3GV8B 1TL3B 4B17A 1S10A 2VFSA 4Q2MA 3PJXA 3M9OB 1J5EF 1SJRA 3MOJB 1Q8LA 3ZZRA 3OXGA 2LECA 2GO9A