1H0HB

Tungsten containing formate dehydrogenase from desulfovibrio gigas
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
214
Chain Sequence
SKGFFVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADMEDESAIIHDDATGCVLFTPKTKDLEDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKAAYSDAKLCDPDDVRVIFLTAHNPKLYHEYAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
pubmed doi rcsb
molecule tags Electron transport
molecule keywords FORMATE DEHYDROGENASE SUBUNIT ALPHA
total genus 58
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB02
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h0hB01
1KEKA 1K0TA 1FDAA 3MM8B 2GMJA 3IR6B 1BQXA 5CHCB 4DHVA 1KQFB 1C4AA 1R27B 1H0HB 3MM8A 1FDBA 1H98A 2PA8D 2XSJB 1G3OA 1IQZA 2XSJA 1FD2A 1BC6A 1DAXA 1WTFA 1AXQA 1JNZB 1PC4A 1XERA 3MMAB 3MMCA 2WSEC 1FDDA 1JNRB 1FRJA 3OR1A 1FDNA 1DFDA 4ID8A 1ROFA 2VPZB 5FD1A 3MMBA 5BYRA 2PDAA 3OR2B 3MM5A 4OMFG 4XDDA 1PC5A 2V2KA 1FCAA 1Y5IB 3OR1B 1DURA 3MM7B 3MM9B 1FTCA 2FJBB 2WAQD 2GMHA 1A6LA 1FRHA 2VKRA 2FJEB 2FJAB 1HFEL 3IR7B 1Y5NB 3EGWB 3MM7A 3MM6A 1VJWA 1GTEA 2C42A 1IR0A 2WSCC 1B0PA 4XK8C 1SIWB 4XDCA 3HKZD 4RKUC 5E7OB 2FJDB 1FRKA 4CI0B 1FRXA 6FD1A 6FDRA 1G6BA 1C4CA 1KQGB 1F5CA 7FD1A 1Y4ZB 5BYQA 1FEHA 2WSFC 4KT0C 2FD2A 3EXYA 3MM5B 5L8RC 1F5BA 2ZVSA 1Y5LB 3GYXB 3MM6B 1RGVA 4Y28C 2IVFB 3MMBB 1Q16B 2Y0SD 2C3PA 1D3WA 1FERA 3MM9A 3PNIA 3EUNA 4YDDB 2V4JA 1JB0C 1FRMA 1SJ1A 2VPYB 2VPXB 1GT8A 5CH7B 1FXRA 1GTHA 1BD6A 2PMZD 2VPWB 1GAOA 2FGOA 5BYSA 1FRLA 2WB1D 1H7WA 1FF2A 1CLFA 1BWEA 2V4JB 1B0TA 2C3MA 3LW5C 4L6V3 2C3UA 2O01C 2FDNA 1FRIA 2UZAA 2C3OA 1F2GA 3C8YA 2Z8QA 2C3YA 1SIZA 1H7XA 4OV1A 1FXDA 4AYBD 1BLUA 3MMCB 3MMAA 7FDRA 3OR2A 1B0VA 3IR5B
chains in the Genus database with same CATH superfamily
5LL6d 5HO4A 3FCVA 3DM2A 2V5HG 3KDOA 4DPXA 1SV5B 2WRMA 1F1BB 2QA4S 2HNZB 2ZBCA 2DHSA 1IKWB 3IRWP 2KN4A 4F4XA 3L3CA 4F2RA 1BE4A 2IFXA 2BA9A 3C6UB 2G9OA 1N5TA 2PMWA 3LP1A 4Y2IA 2FZGB 2L9NA 1F9EB 4M5DA 2FTRA 2M52A 3PTWA 3UN2A 4E98A 1RK8A 2IM3A 3DXBA 4ILRA 4PWWA 1OSCA 3C6TB 1S10A 3CC7S 3JAMY 2AEJA 2NPIA 4DSKA 5KFMA 3DRPA 2Y1RI 4HEA9 1NJYA 1PJ5A 2XTJP 1YBAA 5IC4B 4UY85 4L72B 3QO9B 1OO0B 3L09A 5MLCV 2QFIA 3BSOA 3VAGA 2A0FB 4OHVA 5HMZA 3H4BA 4X84A 1YJ9S 1FKAF 1S4FA 2P6TA 2UUBJ 2K3IA 3UO0A 1WI6A 1S1TB 1HNWJ 3N0VA 3M2RA 4LJMA 4CT8A 4O23A 4PXEA 1R6YA 2DTJA 1DQAA 4YB1P 1U1KA 1WHYA 1WC1A 2FJBB 2OP5A 3HHLD 4D3HA 4ED3A 3MR6A 4ICLA 2DNNA 4CO1A 1J27A 2QE5A 2VDHA 3ZZ0A 2J8AA 5KT3A 2FJAB 3OFHA 3T3FA 3BV8A 1QDUB 2UUCJ 2CJXB 2OFGX 3K8VA 4DBQA 5DG8A 2YNIB 3CCWA 3I9V9 1V5IB 1DTQB 3B6BA 4UF4A 1NSQA 5IXUA 3D6MB 3PHTA 2W01A 3R97A 4XDCA 2H4WB 4C3KA 4ES3A 2BE7D 3KHGA 4RW8A 4OX9J 4GC7A 1RUSA 3SZ2A 4RUHA 3J81j 4ECXA 3QT8A 3BBBA 5L9XA 2FHJD 3SQOP 1RXOB 4CLYA 1NDLA 2MLXA 2FC8A 1JLEA 1RU1A 3A3PB 1K1SA 4KGVB 1LFPA 1YX2A 5CZXA 4QW9A 3M9OB 5L1LA 4LFAF 3JSMB 4RLEA 4USTA 3HT3A 2YY3A 4Q2LA 2UUBF 4PG5A 2CQDA 2DGOA 4RBVA 3H0PA 3DRYA 1HWIA 2GA7A 2CQ3A 1X5SA 5K14B 1T7PA 2YTCA 3DLEB 2G2YA 5KFVA 3FRZA 4ALZA 5DQHA 1HD1A 2A3JA 1HNXJ 3N6NA 4DL5A 2E1RA 2FC9A 4OL8A 1C0UB 2NXEA 3E01A 3EUNA 2FGCA 4WFXA 4C7QA 1TU0B 2IRXA 2V8PA 2XZWA 4P72A 4F7VA 2XMUA 3B78A 3JTNA 2W7OA 1PSDA 2KVIA 3QZ8A 1CULB 1RA6A 3IAM9 4K2JA 4RR5A 5KFWA 3M4XA 3GIJA 5LMNF 2GHPA 3JSMA 4BWJA 3JSBA 1Q7YT 5C42A 2GCFA 2LVWA 4OZ2A 1VQOS 1T02A 2ZEJA 1BWEA 1RJJA 3GIRA 3UVJA 2BACA 3IS9A 3WBZA 3GG1A 4C11A 3OL6A 4OI1A 1PKUA 5D3GB 4ID5B 3OTOF 4DR7F 2BOAA 3T6JA 1DQ8A 3TUJC 2W9BA 1RWMB 3FSIA 4DV3J 1N48A 2I5JB 3MOZA 2FJWA 2QLXA 1S1UA 2NZCA 5L9NA 4R8UA 2Z8QA 3TVKA 2GJ2A 2XYPB 3SEOA 4ZPCA 4KAIA 1FJGJ 2JC1A 1FFGB 2JVOA 1NUEA 4QWDA 2C2RA 2V2ZA 3SIPB 3OJSA 4ED5A 4QIVA 5HBMB 2E5HA 2FLNA 4DV7J 3DLBA 5M2UA 2ILZA 4OHYA 2BANA 1B0VA 2KO1A 2QMWA 1IKVA 2VJVA 1CJTA 3KJVA 4DU8A 1KD1T 2HZVA 4MAKA 3SSRA 3NXZA 5FJ4A 4RO0A 2J0SD 3NS6A 2ZDOA 1R7IA 2BANB 1FTRA 2CQHA 2CZ9A 2J9DA 3FBFA 3FNNA 4NX9A 4TY9A 2E29A 5F0WA 4ZPWR 2OPQB 4DHVA 1L3KA 3Q8RB 1L3TA 4U7UD 4N8NA 4BWMA 1R27B 3G86A 2XZTB 3C16A 4I1TA 5D4NA 4LREA 3BM7A 1R8CA 2AZ1A 3PW4A 1FD2A 2BJDA 3UFCX 5KFYA 4FPIA 1C0UA 3K0JA 3KLGA 5DZ7A 2KL8A 1TK8A 3C3LA 3LOUA 2RQ4A 3CD6S 4JI5F 2EEYA 2MMYA 3QT6A 2BE2A 2HHPA 4ER8A 1RAOA 3CIZA 3BN4A 3PM9A 5K14A 2VFTA 4ID8A 2XO7A 4OI6A 1WEZA 1VC6A 2XWYA 2A10A 3LP1B 5KFNA 4DWIA 4USVA 2R7TA 3DOMA 2B9XA 4ZP7A 3DU6A 1SC3B 3NMRA 2OTLS 1N5VA 4WU3A 4RW4A 3W60A 1HBOA 2ZE2B 3UCZP 3E8OA 3MM5A 4YQWA 1RTHB 1D09B 3I5BA 2VQFF 3CJ2A 5T41A 3QZ7A 4JV5J 5CYMA 2U2FA 4A8FA 1YZ7A 1SH3A 3M8PA 5GAGU 4J90A 1Q8IA 2AU0A 3PX0A 1I1GA 3HF5A 1HQUB 2HHTA 2F1FA 3ITHA 3R6GB 5A8KB 4QWEA 3QJPA 3BN7A 4F8RA 5D0HA 2JLGA 2CUYA 5B0CA 3PXGa 4TU8A 3CMAS 3KUHA 4ZPVR 3BYPA 3CT9A 3KJFB 2OJ3A 3GQCA 1OY6A 1IR0A 1U09A 3EDRB 1B0PA 1K47A 2DNQA 3DLKB 3KJQB 2DR9A 1OMSA 1G1XA 1U1NA 2R7WA 1FRKA 2BW2A 1WC6A 3TI0A 1ZTTA 4WKYA 4H4OB 4NOHA 4OZLA 4RUCA 3DRRA 2BJEA 3W2VA 5DRKA 3TA0A 4WXWA 2PT0A 3KUEA 3K8WA 4FS1A 3I5AA 1D9AA 1SQGA 4ENOA 1FX4A 2U1AA 4DS4A 4C8OA 4FF2A 2VH7A 4YB6A 1GNKA 1X7VA 4YHHJ 2XMWA 3K17A 3LPEA 4RW9A 3H8YA 4ATNA 3QRQA 4U7UK 2MZQA 4ED0A 2E1PA 1WF0A 1YWXA 2N7CA 1VRUA 2F8MA 2MKYA 4Y65A 3T5JA 1GXTA 2BRKA 3NAIA 4GVBA 3F56A 3SMZA 2Y3YA 2LECA 3CCQS 1DLOB 1TTHB 2GNKA 4YDDB 3D7SB 4B9LA 4KGMA 1P8GA 4O4RA 1FXRA 4OHXA 2P5VA 1LKZA 3KJNB 4AL5A 2DVIA 3WQPA 1N6QA 3BH6B 4QBUA 2W2PP 1S57A 4I56A 1M1KT 2F5GA 4LVOP 4P9SA 1M5PC 4JV5F 4IYQA 4MKVA 4DUTA 2I1RA 1VQ8S 2P9CA 2CNKB 3M2UA 2OPSB 4DL7A 2PEHA 1GX6A 2MLZA 1JXVA 1LWEB 1MROA 3DRPB 3RG6A 5C25B 2VICA 3DGPB 2ZZNA 5IT0A 4OI0A 3PDNA 4FVMA 1UVNA 1ZM3A 2CZVC 1S7IA 4NZ7A 4Y2AA 1IBKF 3CJSA 3SDEB 2MEWA 1KBRA 1JQGA 1IKWA 2DO4A 2OEMA 3MHYA 4F4KA 1NH7A 2FYXA 1TKXA 4ZIWA 1BLUA 2QYGA 1S1XA 4PRFA 4CLWA 2NXJA 2YWGA 3RYLA 5L38A 2EBGA 3PYFA 2W2MP 4F4YA 4P2FA 2CVEA 3QNWB 3U1MA 5CYJA 3ENVA 2CPEA 2YX4A 3PJXA 1BQXA 4N8OA 1XNRJ 1PYSB 3KWMA 4AD6A 3M30B 3M32B 7AT1B 4WFYA 4J9LA 4NI2B 1ZS6A 2EG2A 3QAUA 3KHHA 2PEBA 1SKWA 4ZDNA 3M05A 2H9ZA 2KXHA 2IM0A 1Y9OA 4FKYA 4NZ6A 1IKYB 4TXSA 5B0GA 4ECUA 4ED6A 4QWCA 5A8KA 2RE1A 2VASA 2HWTA 4CCHA 1HBNB 5KFXA 2LYVA 4B9SA 4NXNF 2NSCA 5F8JA 1R0CB 2QLJB 2HHHF 4IRDA 3VQSA 4PWDB 1RAGB 1O6XA 1FKPA 1DARA 1VLYA 2AV5A 1UW9A 3W5ZA 4C3LA 5IM0A 3PIOQ 3I0SA 3TW0A 1I94F 3OR1A 5L46A 5FD1A 4AUKA 3VWSA 3OFGA 3OBIA 4QIEA 4DZDA 2OLWA 3HSGA 2NZ4A 2PDAA 2MKIA 1LW0B 3HJVA 1YITS 2J0QD 1RWUA 5E41A 3BREA 3OXLA 3QT7A 2XS5A 1PC5A 5DGBA 2X7IA 1JLAB 3GJRB 3KLHB 3BGRB 4ZPTR 2RAQA 1DLOA 1AUDA 1Z2ZA 4R0JA 4ZLNA 3M2VB 3UN3A 4U8VA 4DSLA 3E2EA 4OX8A 2WAQD 1Y10A 2G13A 4DV1F 3CUNA 1NJZA 3IMQJ 4J9QA 1EHWA 4RW6A 5C24A 1FK9B 4XIUA 2E5LJ 4HACB 4DV3F 3BKUA 4MFBB 5D15A 3K58A 2H5EA 2WVCA 5EX3A 2UP1A 1IBCB 5D0RA 4C0OC 3HX9A 3KK2B 3EPGA 2KJWA 1WD6A 4YMEA 3IBCB 4DR2F 2PN6A 4JI2J 2P9GA 4YR2A 3DYAA 1T9XA 2RVJA 1YJTA 4ZVPB 2P8IA 5HQ8A 3BDPA 2XLKA 1GFWB 3GPAA 3JB9k 5BR8J 3ZZOA 2J7WA 4F0HA 2XNRA 1XR7A 2JX2A 3AJDA 3CCTA 3FBCA 5ETQA 3GIIA 3UR0A 5IOLA 2MYFA 3LPYA 5HAOA 3W62A 3PW7A 4DPOA 5SZTA 2MKSA 3MR3A 4DX8H 4DV2J 3UD4P 1N8RT 3GYXB 1RI7A 5KFZA 2BR0A 1OYEA 3VCDA 3PJ9A 3WZ0A 2VG6A 3UCUP 3LGNA 4Q7AA 2Y0SD 3PRDA 2CZ4A 4R5PA 2F9JA 2LQJA 2NUHA 2XB2D 1XK8A 3OUYA 1K0VA 2LA4A 5K8OA 2OIHA 2F7VA 3HHLA 3M32A 2IM1A 1RT6B 1NMEB 4YHHF 1Q86T 2HNDA 3WC2A 1NPRA 3I96A 3IS9B 4J9PA 1U2CA 2CNNB 2VA3A 3TA2A 2QYCA 5I3PA 2ADBA 2W25A 1HBOB 2YVSA 4G65A 1R0AB 2OFHX 4WIQA 1FNXH 1M5KC 2VBXA 3ET6B 3V6DA 5LT5A 1RB0A 5CD4H 2GQ2A 3OL7A 1LOUA 4IRKA 3EGZA 4PQAA 2HVIA 3DFEA 1ACMB 2C3MA 1U8SA 4M1KA 2GJIA 3I5CA 1VK8A 2F63A 3FGVA 2B5JA 4LSLA 3HHKA 4OZ5A 4OV6A 5J1EA 4WFNQ 1MMNA 4IRCA 1YTYA 4PPDA 5HSPA 1FWKA 2JLFA 5ETLA 5DS7A 2DXEA 3OTBA 3NL0A 1RADB 3MD3A 3FDSA 4R25A 5H9FK 2K1RA 3OXFA 3EWGA 4OX6A 2QRRA 1ZOTA 2R3VA 3AFGA 3RBZA 3OTEA 1NK6A 1NK0A 3C14A 2R7OA 3LAMA 3W9JA 1IKXA 4O3PA 5KT6A 1IVZA 2RHSB 1XNQF 3ZNUA 2M2BA 1DTTA 3QATA 4XPEA 3HM9A 2BQUA 3AJ2A 2R7QA 2CQCA 2C2DA 1XEZA 3IWXA 2KM8B 3QBCA 4DV7F 3B54A 2LXFA 3M6UA 4JOUA 1WTBA 2L3MA 3EICA 1NKCA 1CQNA 1N5QA 2F4VF 5K8NA 4DQPA 3H40A 5HROA 1UKUA 4DXLA 1FVSA 1EP4B 1RWKB 3TJ9A 3C6UA 5ETNA 3R5JB 3HVWA 1B3TA 4YR3A 4J9UE 1ZBTA 2VFSA 4KV8B 1RWVB 1WG1A 2MY7A 2CNLB 2V67A 2WK4A 2XMMA 3CJ0A 4LUBA 1DRZA 1G2EA 1A0OB 4EBDA 1ZAXA 3GCWP 4ZJQA 4JI3J 1RLCL 2CDRB 2DGUA 2ZDPA 2LKZA 3MECB 3TO8A 2R7UA 3M2RB 2OEJA 5LXYA 4M5DB 1CJVA 1V6HA 2KRBA 2VPZB 3FZ2A 3QAEA 3HHDA 4KH1B 4H4OA 3MMBA 3IA0A 1LWFA 1QUPA 1S7HA 2KKHA 4ZHRB 1HI8A 5KT2A 1IM4A 4ETZA 2IBOA 2FLLA 3QLHA 5T14A 1VGYA 1KRPA 4OFZA 1XN9A 2H3EB 4XDDA 4IR1A 2BKOA 3OR1B 3ZTRA 2R9LA 4OYXA 1WKKA 4DV5F 4B9NA 1UVJA 2V8DA 2GMHA 2ZZMA 1Q1KA 2ZH8A 2MGZB 1SUQB 1VYAA 2OAUA 3MPDA 4WWSA 4JI2F 3U1LA 3A1YG 3WHIA 1HPZA 1X4CA 2ASLA 3KNAA 1Y5NB 2YNHA 1OYDA 3KG1A 3FQLA 4X4OA 1TAQA 3GZ7A 1M1GA 1TL7A 2C42A 2OSRA 1FJEB 1HWKA 2G2ZA 1RTHA 4P2MA 1S0MA 2X1FA 2COLA 1C1CA 4Y2KA 2KH9A 1CC7A 2AWZA 2O5DA 2JHEA 3NOCA 2Z2MA 3ENQA 5E7OB 3RAMA 3D4JA 4C8LA 1JLQA 3H5SA 2XHCA 5GMEA 1KQGB 3PEHA 4DV6F 2W8KA 3ZFVA 2V8VA 1G7CB 4LFCJ 2RRAA 5ADZA 3M8QA 1VQYA 3T1YF 2ACYA 4EWTA 1SL0A 4NCGB 3GILA 1BWVA 3DDKA 4HHJA 4FXWA 5ETTA 3Q86A 8ATCB 4LSNB 3GFZA 3SDEA 4AQYF 3KK3B 3DHXA 2DHXA 4QR0A 2HGNA 5CZVA 5BXIA 1KVJA 3SQGA 5LSOA 3VZHA 4USKA 2CJBA 5IS2A 1NK7A 2YKNA 2M3DA 3OVBA 1N54B 1QD1A 1WSRA 2HK3A 2YH0A 4Y2MA 3TQEA 1U1PA 1U47A 1QJHA 2FUG9 1X4AA 3W2VB 5C25A 4RBUA 1N32F 3IM9A 5H9FJ 1Q78A 5IWAJ 2OO4A 2RIJA 4IO1A 2KYZA 2M7SA 1LNQA 2XULA 3HFZB 1S76D 1X4HA 5IV3A 4K0KJ 4HHHA 3KG4A 3LA0A 1Q82T 2BQRA 2DJWA 2V50A 4CWBA 4QPTA 5J1EB 2E5JA 1T95A 1X4FA 3MAHA 3HHLC 2N3LA 4FPRA 1RT4A 3FBBA 1YBTA 4RL1A 5KFAA 4HDHA 1QAYA 1GK8A 2C3UA 1WF1A 2R7SA 4OLPA 1HNZF 3GYGA 1JX4A 4TQRA 3JS9A 2R8IA 1HMVB 2QLBB 3S8SA 1NDKA 2BJ7A 2EFGA 2Z56B 3HFVA 4R0EA 4RZRA 2EC0A 3MD1A 1HWLA 1S1WB 1T9TA 3EDQB 1LWCB 4LSLB 3ISNC 2LDYA 4M5IA 4NYZA 3OVSA 3BO2A 2Q43A 2YH1A 1QSYA 2YKAA 4AL6A 4MK7A 3MMCB 2DR5A 1VISA 1WEXA 2ZFHA 4DU7A 3KMQA 1Z2LA 4G1QA 5LMUJ 1IJEB 2V68A 2RUSA 1CVJA 4TKTA 2X1BA 3CB4A 3KLFB 2AJ1A 3C2PA 1WOPA 2AT1B 3HPOA 5C7PA 3W5YA 4JI4F 2HNYA 1WKJA 4KGXB 3AJ1A 2V4RA 2VIHA 1WWHA 5IV4A 4KIAA 3D9BA 5EWFA 1UPMB 5HJXA 1KQFB 2AJ4A 2GQQA 1U2RA 3S01A 4AE5A 5BJRA 1T94A 2OTJS 2IM2A 2NYHA 2E1MC 3CPWR 3CO0P 2QL7B 4Y34A 2UXDF 1J5OA 2CQ4A 3VF0B 2XSJB 1UVMA 3R5AA 3ITHB 3HSJA 2ZZTA 4FBUA 1RT3B 4M5MA 1RAJA 4MKBA 1VBZA 1S9EA 1H73A 1PC4A 1A7GE 3RGIA 4CTAA 2W24A 2A2CA 2N82B 3OSPA 1FRJA 4FKXA 3AD8C 2ZOMA 1RACB 4RW7A 1NSKL 3SQGB 1LWCA 1N52B 3FRYA 3HD1A 3QT5A 3QIPB 2OPPB 3UN5A 3W66A 5B08A 5LJ3Y 5DM6Q 4HACA 4KGKA 1NKBA 4YY3J 2ROEA 3MEEA 3G6YA 3NNAA 2O66A 2OMOA 3QSIA 4OI2A 1WF2A 3EPIA 3BJYA 3DYAB 2Q6CA 1SL1A 1UW4A 2XBPA 3VHQA 1IBLJ 3EM1A 3H42A 4V19X 3P8BB 3BGRA 4N5SA 4RNOA 2HZCA 1JLQB 2DGSA 2FHJA 4LF7J 1FXLA 1J5EF 3PV8A 1SBRA 2X1GA 2Z30B 3AB4B 5I42B 4O4GA 2L9WA 2W9BB 3BZQA 2DY9A 2DCLA 2NYIA 3N6MA 2GS8A 4Q5VA 5L1JA 4DV0F 1VJWA 2UVUA 2FPHX 1TQLA 2E5LF 1NSAA 4W4MA 3T1HJ 2AJ2A 4EFAC 3R27A 4X66F 2FZCB 1T9VA 2DHGA 4A48A 1WJ9A 1UFWA 4BDPA 4B3OB 2CYYA 3GIKA 1Q5YA 4L76A 2FJDB 1FE4A 4ZP8A 1GQEA 4IFYB 3Q8SB 1Q5VA 3IG1A 4K5SA 3RTVA 6FDRA 5I4MA 4K4WA 3O3LA 1HNIB 5BYQA 4LF5F 5AXKA 3T5KA 4KT0C 4WE1A 1C0TB 4ZPBA 2BRLA 1S12A 2WVEA 5B0AA 3BH7B 3MURP 1ZPWX 3O44A 1ELOA 1VMBA 2LQ8A 1YIJS 5J2MB 2LMIA 3KLFA 4J9NA 1MLAA 1LK5A 2KDOA 1YRTA 1MN7A 3TYTA 3ZZUA 3N79A 2HQIA 2R2TA 4A47A 2SXLA 2UUAF 4JI1F 1R8BA 3FC9A 1TKXB 3M30A 4AQYJ 4CLSA 1WORA 1TZ0A 1JB0C 1FRMA 1HQEA 3ONQA 3BQ0A 3NGSA 2HWHA 1EP4A 1GTHA 1M5SA 2IIHA 2MZJA 2RRNA 2VG7A 4FYWB 3UCGA 1N36J 3EJMA 2QJ3A 3CTRA 4RUAA 3K5MA 2VV5A 3FSYA 1HBUA 2YKMA 1T9UA 5IT4A 4DL3A 1NK4A 5EX0A 4ILMA 2GZOA 1MSWD 1SB6A 4OQJA 3CCVS 5JXSA 4LR7A 5ITHA 4K4VA 4Q0BB 4G6VB 1FKOB 5HLFB 4LIRA 2XWXA 3IWLA 4ZVTB 1RT5B 1DQ9A 1VDHA 5KFRA 3A3NB 2IDEA 4QIFA 2DNGA 1IKXB 1EETA 4JI0J 3QGIA 3ISZA 2XYGB 1VBXA 4DLEA 1RWNB 4PAAA 3VR1A 3KLIB 3O8WA 1R8AA 1U49A 3O6QA 2ZJQQ 1KVKA 2RT3A 4KR0B 1KSPA 1S77D 2DCUB 2Q3PA 4QYZK 1RAEB 2OSQA 2MJUA 4NA2A 1U1LA 1I6JA 2W4PA 1R31A 2WBMA 3IXQA 4ED4A 2LEBA 2HGLA 2JJ4D 3HFKA 1O51A 2KT3A 4OYPA 4ANCA 2N7YA 1XMOJ 3TJ8A 4OYMA 1SQEA 2HAIA 1OIAA 2CPIA 2B9WA 4ZCLA 2RQMA 2V9KA 2GX8A 3AXMA 3EVOA 2VC1A 3K89A 1HBUB 2ATCB 3RB0A 5ETSA 2DIVA 2FLOA 4EU0A 1S1VB 1JJ4A 3M6XA 1ZPVA 3LQVA 3Q8YA 1G3OA 2AYMA 2IRYA 3BYRA 3F41A 3MF5A 4OJHA 3IN5A 1W7WA 3NWGA 2ZNZA 3J7YU 3LWMA 3Q83A 5I3UB 3OPKA 4TLRA 2B3TB 2F4FA 1WNEA 5AXLA 4YP3A 3MI7X 4CNYA 2HFUA 2EFNA 3N5BA 4O44A 2DPJA 2R8KA 1NZ8A 5LSRA 2QA2A 3R2CJ 4K4UA 1NCLA 5M2RA 1OPIA 2VG6B 2BMBA 4H4KA 4PXBA 3TARA 4OZ3A 4ZJOA 3EGNA 2JEJA 5E3PA 4G1PA 4P7VA 1FKOA 4NLGA 3RBDA 5H1SV 3GJQB 2MZRA 1A9NB 3GU0A 4WF9Q 5IC6B 2YKMB 3EE3A 4DDFA 1S5ZA 1X4BA 2ZE2A 3HT0A 3CMQA 4YS2A 5ETRA 5KG2A 2GC8A 1U1RA 2YX1A 2DYAA 4DR4J 4IG3A 4O3QA 1FNMA 2VG5B 3VGTA 4C4WA 3M8ZA 1ZA1B 3G82A 2BJ8A 1APSA 2V9WA 3KK2A 1LFWA 2HNDB 2OELA 4CYUB 5RUBA 2ZOFA 3CEDA 2GO8A 2QEXS 1PILA 2E44A 2AZ3A 3I9ZA 3CVKA 2W7PA 4GC6A 2AW0A 4IH7A 4LF5J 1T03A 1LW2B 1IUJA 4CQ1A 4Y0FA 1N5YA 2DNLA 3DM2B 2XMJA 2JFKA 5D4LA 3H5UA 4NYPA 1LWXA 2MHNA 3NRBA 4QIWD 3CDAA 4UUWA 3OHBA 2ZH6A 4MKYA 4Q8FA 4RNFA 2GAHC 5KOXA 4DL0C 3G8TA 2RS8A 4RNMA 2AD9A 2WSFC 2DNPA 5L1KA 1AZSA 2XI2A 3EXYA 4QR1A 2NUUG 5DJBA 4I7FB 1NDPA 4WYLA 3VVUA 4DL4A 2I9SA 3NEKA 4OYBA 3THTA 1S9FA 3MM6B 3Q2TC 5DDOC 3FK4A 3LP2B 3DU5A 3IG1B 3D1QA 4MH8A 3EVWA 2XS7A 2H4YB 2ZJPQ 4J9MA 3V81B 2IAJB 3SFUA 2DXDA 1N32J 2QA1A 1KOHA 3I4HX 4N56A 3V4IA 1YJNS 3OTDA 2HHXA 1ULRA 2JH3A 4K8RA 4PZVA 2M8DB 2UXCJ 5ETPA 2NXUA 2V4JA 3W8PA 3LWLA 3RU0A 4Y00A 3G6VA 4G3IA 1T11A 1UEKA 1IR2A 1NHVA 1BD6A 3NBPA 3AOCA 2HZAA 4ED7A 1U6BA 4JV1A 1KFDA 1LW2A 5IZHA 3I6PA 2ROPA 5HBMA 2MLYA 2Z58B 2UV8A 4ZN1A 2J7KA 3GV5B 3CMES 1BQMB 2GV1A 3TJAA 3NY0A 4PPZA 2C2OB 1NPPA 2W9CA 1N36F 4NLXA 2F3JA 1RLDA 4XTTA 2O01C 4M8LA 1FRIA 4PEOA 2BM1A 3BF4A 5THWA 4BC9A 4CM0A 1HL6A 2HFZA 4UW2A 4DX6A 2XY7A 2KFNA 1EQMA 1TMJA 4I2QB 1NHKL 2UVWA 4ETXA 1UEVA 3DN9A 3FCWA 4ID5A 4RW7B 4A8YA 2ZKUA 4A8OA 2WCXA 3V6JA 3VGSA 1BUXA 2JRSA 4Q44A 1B99A 2AJ0A 1N88A 3MEDA 5LXRA 3SYZA 1S9EB 3F44A 1M5VC 3MDFA 4Q8EA 1U6ZA 3IR5B 4FYYB 4KPYA 2KYXA 2E9TA 3VV2B 2QT7A 3MGJA 1JXLA 3EGVA 3HZEA 1N5YB 3MEDB 4DV2F 3HSZA 4DX7A 4NLSA 2ZH2A 3CIMA 1XTZA 4ZCIA 2IVMA 1C1BA 5DG7A 3T41A 2W9AA 1IBMF 1NPKA 3M8RA 3VAJA 4NWBA 4MIWA 1CS4A 3C19A 2LXIA 4USHA 2ASDA 1T05B 2ZM6F 3PYDA 1WTFA 2KT2A 2LDIA 4H54A 1AXQA 1S49A 1S1XB 3ZTOA 4RPFA 4TLQA 3MMAB 4FZVA 3G6ES 1R0BG 2XLIA 1GXLA 5B0FA 4DSEA 4MKAA 1I5OB 4CLZA 4JYAJ 4KHPJ 2KHDA 2I38A 3N28A 3HVAA 4QYZJ 2NCKL 4PYAA 4AT1B 1PIEA 2W2QP 3PEJA 4IFVA 4LSNA 5CYQA 5BYRA 3GFYA 3PIPQ 2KFYA 3DRSA 3OR2B 4MYTA 4DMZA 3AOAA 5KG7A 2B6AA 3DOKB 4K7QA 2A1BA 2XGQA 3D66A 3DKDA 3IRXA 3QGPA 2VONA 1UVKA 3TA1A 3IO1A 1S99A 1TUVA 3JQMA 4CH1A 4PUOA 2DNKA 3HKWA 3G96A 3FKBA 1NK9A 4GKKJ 2QSFA 4PYDA 1SJQA 3FEYB 1QUVA 1PBUA 2GIRA 5ETMA 2QTWA 1VQPS 1N6QB 4C8KA 1JLBB 2IMOA 4P74A 3VQTA 4JV0A 3BEGB 4LF9F 4CO0A 2UV8G 4BCAA 1I3OB 3HK2A 1QTNB 3NS7B 2XY5A 3R7SB 1RTJA 1QTMA 3RB3A 1HPZB 1YJUA 1YJVA 5J2NB 2VL1A 3WIVA 3HKZD 4GKJJ 2M5YA 1OQ6A 3UPFA 5A2QU 2GVZB 3MAAA 2AQ4A 3OSNA 2GQCA 2Y1IA 4P73A 2Y9HA 3M8PB 1LXNA 4NYOA 4JI8F 3UI3A 4CRJA 1FD8A 3GJTB 3CULA 1HNVA 2FD2A 2E66A 2IDLA 3RB6A 3MR7A 5KFFA 4LF4F 1RT7B 4I6AA 1FJ7A 1RSCA 1WC5A 2B43A 4WK3A 1M5HA 1TVRB 4ZVUB 2PGCA 3O2IA 8AT1B 2UXCF 1UWBB 5J2MA 2GGPB 2QA4G 2LEPA 5B0DA 3FMBA 2A6MA 1C1CB 3NGUA 2BE2B 2DR6A 4Q2MA 2MGZA 1S6QA 4EO6A 1E6YB 3BBCA 5HLFA 5EGYA 3C46A 1RTZA 2E9RX 1CEZA 1KLNA 4J9SA 1JJ2R 2LU2A 4C8NA 3M7VA 2WVFA 2EG1A 5K20B 2DPIA 3US5A 1J2VA 2EWHA 4LR9A 1YI2S 2NR0A 3FFIA 2CQ0A 2MKJA 1AA1B 2YWEA 2PI4A 2RRBA 2WB1D 2ASJA 4X4QA 2O67A 4U95A 4DV5J 1IJFB 2KVQE 2ZBPA 4IOBA 3WDOA 4K4ZA 1TK0A 1HNIA 2AEMA 5KG6A 1ITPA 1EX8A 2JDJA 5F8MA 1S59A 4EYIB 1S6QB 1LK7A 2WHOA 1JIHA 3BGUA 2XNQA 4E2FB 5JMNA 3ADAC 5DQIA 4X64J 4AXJA 1KWMA 3C8YA 1QE1A 1X31C 4F67A 2HRTA 4K50A 2YXLA 3PYGA 1R8HA 2MQMA 2CADA 4PG6A 3MUTP 4NEZA 2AX0A 3CNQP 1BGXT 5CA5A 1MU2A 3H98A 3K5OA 2DR8A 5CAAA 2QX0A 3Q2SC 2V2VA 5A0YB 5AE2A 3I87A 4KKOB 1Q53A 1SXLA 3BSAA 2JC0A 2FHOB 1BC6A 3LGHA 4OX7A 4LF6F 3OHAA 2QIFA 4QW8A 3TAMA 1NB7A 3WX8A 1VS3A 3OFFA 3KHRA 2ZH1A 3BKFA 4B3TJ 3ELHA 4KHMA 1RP5A 4NE9C 1RTJB 1CQMA 4CTAB 1SKSA 1B7FA 3R1HA 4A8WA 5LM7E 4LRBA 1I51B 1T8EA 2HHHJ 5D8HB 2CPFA 2CG8A 3N9UC 1T05A 1RCXB 3IBWA 2XSJA 3OTCA 2CWKA 2EW9A 2VDIA 3NWRA 4I4BA 3MFIA 4DR5F 5AE1A 3RRHA 4JYAF 1U1QA 5F8NA 3U1NA 4U6PA 1FDDA 1YK9A 1N56A 1AZSB 5EWGA 4BHQA 3HCXA 1ZAWA 4USUA 5KFCA 4UZBA 2ZM6J 3OL9A 2HBRB 3HJFA 4NXNJ 3C15B 4HT5A 1HWJA 4LBHA 3ULHA 3BGLA 1D9DA 1RBOB 4TVAB 3R8YA 4DCPB 2WONA 1HQUA 5KG1A 2D41A 5E33A 3UDEA 2XLJA 1F6TA 5LMNJ 2V2KA 4ZN3A 1NEEA 4USJC 2H1YA 1YJ7A 2ZBRA 2ZVIA 5F8HA 2ZH9A 1X9MA 1JWWA 3UVJB 4W90B 3OW2R 2OKQA 1GMWD 2H5IB 2GFFA 5KFOA 1FRHA 1CULA 2CPDA 1PO6A 3V5RA 1RHRB 3RBEA 5EN1A 1FA0A 4FVCA 1EARA 3LAKA 1NU4A 3MM7A 2CPJA 3VALA 3VVTA 3UR3C 1C1BB 1Q8LA 2FVRA 2RB7A 1C0TA 3TVZA 4U7CA 1SIWB 3W9HA 4RKUC 3EZOA 4CLUA 1UFLA 1TR0A 3T5HA 4JI4J 2LQ9A 3H5XA 4B3TF 1D1UA 2HHQA 2HQDA 1C4CA 3M2VA 3M8WA 4JUZA 4G1QB 4RU2A 1H2UX 4DR6F 4OZ1A 4I0WA 2NS1B 3Q8QB 2ALYB 1TK5A 3M6VA 4ZVRB 2YKNB 1BMQB 1S9GA 2NSBA 5DDQC 2CQPA 4ELVA 1VHIA 1W26A 2O1PA 3IGVA 4WIIA 2B7CB 1X4DA 5G4DA 1RTDB 2CDQA 2XI3A 2EC2A 1X5OA 5G0RB 1FI4A 1SC1B 4OJ1A 4Z2XA 4P10A 5F3ZA 2J6SA 2KTQA 3EVMA 4EUVA 3Q8UA 3W63A 2CVIA 3I32A 2VBWA 4WP3A 4HR2A 1QVFR 3MZIA 4J7CA 4MIAA 5KFGA 2OEKA 5J2QB 2VPXB 2IHR1 5LSLA 2VPWB 3OJUA 2FGOA 2MXYA 2IY5B 3KNGA 4PKDB 2X3DA 5GMKa 3CO9A 1S6PA 5AT1B 2Y8YA 5A0YA 1GEHA 2VOPA 4DQRA 2RH3A 1FWPA 2MB0B 2EFOA 1JK9B 5F8LA 5IM0B 1JLAA 2VF3A 3KLHA 2B8PA 1Q95G 1P27B 1R43A 2KI2A 3GB0A 1FE0A 2Z4PA 3TOQA 1VCTA 3LGMA 2N3OA 1K1QA 2ZBQA 3FFIB 5F8IA 2QFJA 1YHQS 1N33J 4EK2A 4WTYA 2W2OP 2D9OA 4X62F 2LLZA 3A4TA 2K2PA 3DRXA 2MQNA 1K9MT 4DZ6A 3GMGA 1Y00A 1HW9A 2MTLA 1KLMA 4ZS6A 3ZO7A 4NCGA 3D0IE 4GRSA 5C5JA 4I69A 1TL1B 2RF2A 1SJFA 2CIMA 4DR4F 2LEAA 4LQ9A 3V2UC 4EO8A 3M8SA 5FDLA 4B9TA 2VODA 1KTVA 1FFSB 3LO3A 2R7VA 3ZZZA 2HVEA 4F25A 1AB8A 2YWHA 2B7BB 1D9FA 2UXBF 3IR6B 3HULA 2J8SA 3M2UB 3J7YI 5I3UA 3THPA 4P2SA 1JLEB 4CLKA 5KT4A 3CJ5A 3FQKA 3OV7A 3UDCA 2PA8D 5KFEA 4Y3CA 1PG5B 3OT9A 4OLOA 2OPRA 4H4MB 2DRAA 1VIXA 4RNNA 4HI2A 1VBKA 2WSEC 1JNRB 2M88A 2OD4A 1VRUB 1MNEA 2MDAA 2QMUB 3GWCA 4QOTA 2J9DE 1M0SA 3FCHA 2K7JA 2XG8A 4EI2A 5KTQA 4XPCA 4DN0A 1VRQC 3A8KA 3CD0A 2CG4A 2BXJA 2EI5A 3PACA 1O8BA 4A8SA 3EX7B 1Q4RA 1QAXA 2P2CB 1RAHB 1T9YA 3C16B 1B70B 4ICLB 4X4TA 2ADCA 3M6WA 2YNFA 4PXCA 4X66J 4X4RA 2RILA 4E8UA 2HW3A 1Y5IB 2IA0A 5ETOA 1WACA 2C1EB 2OPSA 1TP7A 3QQCD 2A2DA 2RSQA 2YBVA 2AYGA 1FJGF 3VAIA 1A6LA 1QY7A 4A4JA 1TKTA 3CE8A 3DLJA 3BO3A 1VLOA 3SCIE 1X0FA 1TMMA 4NEYA 3CDUA 1RU2A 1N4LA 3FMWA 1PAUB 4DQSA 1HHTP 1N0VC 1X8DA 1HA1A 1ZETA 1YGYA 3SSQA 2M0GB 2YX7A 4ECWA 5B0BA 5IT9U 1XJWB 2J9CA 2EKYA 4NLUA 2R7XA 1DTTB 3O1LA 2K7KA 1H74A 1HQ2A 2D1CA 5DLFA 1XNQJ 1CJKB 2CAJA 2EXUA 2KB2A 4MT1A 3UE2A 3Q0AA 2G0JA 1D0EA 2PMHA 4ERDA 1TL4A 4URGA 3MM5B 5L8RC 5C42B 3MOJB 2DNYA 4CP5A 3GV8B 3W2WA 3D0GE 4HTIA 1UMJA 4LSZB 2DGQA 4Y28C 4FN5A 3TZWA 1HI1A 5DM7Q 5EWEA 4UTGA 2WVBA 3NGKA 2J0XA 3I31A 4DN9A 1RT5A 1D3WA 4DL6A 3HO1A 3POTA 4FNIA 2YNGB 4OYWA 2R2RA 3AQPA 1IXKA 2HMIA 4ZOSA 4C0BA 2FIUA 2CQ2A 4YUDA 1SH2A 1IBKJ 3HMJG 2YKQA 4RUBA 4YFUA 4N76A 2ZWOA 3T1AA 4YR0A 2W2NP 1R0AA 4ES1A 4B3OA 2G2OA 4X4PA 4EBCA 2XY6A 1H7WA 1D8ZA 1HQEB 5F9LA 5SUHA 5GAHI 1RHUB 2VBYA 3R7BB 1B0TA 3Q23A 1BQMA 1FNOA 2HHSA 3TUPA 1VRTA 4M94A 4LRAA 2HWIA 4DG1A 3CDEA 2PC6A 5ETVA 2ZWPA 2OD6A 2VKZG 2VD3A 2L9DA 4LF8F 1XMQF 3UNGC 2JVRA 1CC8A 1SIZA 4PXDA 5FLXU 4OIXA 2XMAA 2H65B 2BE9B 2KM8C 1RT1A 1U25A 2W9CB 2F4VJ 3A3OB 2Y8WA 1M5OC 2KJVA 2IJRA 3JAMU 3HP6A 4PQUA 1SC6A 3FJ2A 4OV1A 4W92B 2XSFA 1RCOB 2UUCF 5HATA 1QSLA 4A8QA 3ISND 2CPZA 2G4BA 1HYSA 5GAEU 5G0RA 3NNCA 3QIDA 3NGRA 4GO5X 3J81U 2HPUA 3BGFA 5KFQA 5F41A 2XHWA 2DGVA 2ZH7A 4F26A 3BBFA 4EGLA 1SJ3P 2ZUGA 2O3DA 1S9GB 3W9IA 1FX2A 5CHCB 3DLGA 1U1OA 1VC5A 3DI6B 1HR0F 1C4AA 4V19J 3QGHA 1NB2A 3PFEA 2XQCA 2K8GA 3CCSS 2IAJA 3P45B 1QAIA 4EZ9A 4M5NA 1UWAA 3I56S 1WC0A 2DGXA 3E51A 2HIYA 2RS2A 3GV7B 4PG8A 2HHWA 4F0MA 2DEIA 2CPHA 2B8QA 4O3SA 1G4CA 5AJ3J 3ILJA 4HLBA 5KFIA 4KO0B 4Z7CA 1XNRF 1T3OA 1HBNA 3M8YA 1L3VA 4FXVA 1Q79A 4ED1A 3H7HB 3S7RA 3MXHP 3BPSP 2EFVA 2M4MA 4PWDA 2KZMA 4YB5A 4IR9A 1SL2A 3R9LA 3L7PA 4J9OA 4EEYA 2BDPA 3T9NA 3A8IA 2Q66A 1UZHA 3G2XA 4LFBF 2HBQB 1YZ6A 3KXDA 4C0HA 1URNA 3KDNA 2L41A 2D9PA 4HHUA 4HI1A 5B7WA 5KFLA 3OVAA 3R5GA 2E1CA 4TY8B 5I3QA 4OJ3A 2I2YA 2PI5A 2F9DA 3KLVA 2OI2A 2ZKTA 1SUQA 2IYIA 1EJ7L 3TX8A 3Q8PB 2GVDB 4WFBQ 2F40A 2B9EA 4CLTA 2G0CA 3E01B 2BUNA 1X4GA 2V4QA 4ECQA 1XBWA 2BJ3A 1GTEA 3ZZPA 5HP1A 1N34J 3BB5A 3IM8A 2H51B 2V8HA 3CJRA 5A8WB 3V6HA 3DDIA 1YSJA 3AOBA 1F9FA 4CH0S 3MAQA 5HVFA 1PJ6A 1WG4A 3IP0A 3R6LB 3QWUA 2MQOA 4PUOB 1U7LA 3QJJA 4X4VA 1TUGB 3WIUA 2KG1A 2BQ3A 2E5IA 3R7NB 5KFTA 3R1LA 1XMOF 1RHKB 1Q8KA 1AROP 9ATCB 4F02A 1U0HA 4M5GA 2L08A 1KN6A 6AT1B 3QO9A 2QL9B 2HQ3A 4ZVOB 1UEUA 2X3GA 3MEGB 4IO9Q 2BZ2A 2BKNA 1AW0A 5J2NA 4GVLA 3J7AN 2Z0GA 2DO0A 1LEOA 3MWBA 3N5FA 5HK4A 5DGAA 2AMCB 2W4DA 1U48A 1VQ6S 2VOOA 1GMWA 3PO4A 1U45A 2BYCA 1JJCB 2FY1A 1FHTA 1YRUA 1GT8A 4TNOA 4NZ0A 2PMZD 3U02A 4K4TA 1DHMA 3TR5A 4NLYA 1U0HB 3AA8A 4WBFA 3J7A1 1MWQA 3MCMA 3J80U 2HS3A 2D69A 4I6WA 2ZD1B 2IJNA 3KK1A 4ILLA 3AD7C 1RE1B 1S0VA 3K57A 2AGPA 3K2YA 1FKPB 1P9YA 1IQTA 4Y6IA 3I4PA 5DLGA 4FYXB 1EIYB 4F3QA 4H4MA 2JOQA 4CDIA 2JL9A 4WP8A 4CLLA 4ECTA 4FBTA 1JLCB 2VHGA 1H7XA 1IKYA 1KNZA 1UZDA 4F36A 3ZNJ1 4F04B 4FYVB 1PYOB 5MAOA 2VFRA 3NNHA 2ZH5A 1FXDA 1JMTA 3V4MA 2BKPA 2R4FA 3MMAA 4ZJLA 4ANEA 5M2PA 2HS0A 7FDRA 1UL3A 1WELA 3EMTA 3D1OA 2J5AA 4JI6F 4CO4A 5JVGQ 4DQQA 1KEKA 1S72S 1YBUA 1WHXA 1SVDA 3D6FB 4WK1A 1CJVB 1REVB 2OUGA 4E0DA 4YB7A 5CYMB 2H5JB 2GMJA 1YJWS 1ZM2A 3MTKA 4QR2A 3G8QA 5JJBA 1CJUB 3RR8A 2B56A 1HBMA 2DBBA 3KLEA 2YQ0A 5DZ6A 3KLGB 5H9EK 4JI8J 1OQ3A 2PD1A 2VJUA 2XCAA 1ZH5A 4UOFA 1RKJA 2GVDA 1OPZA 3C15A 4F2SA 3GFXA 4KC5A 1XWLA 2N4DA 2DH7A 4FF1A 2PSZA 3L7OA 2FQQB 4WXOA 4TY8A 4EZ6A 4WE1B 3KMSA 3IAS9 4RWXA 2CJQA 1KLMB 2LCWA 5GVQA 5E3AA 4HYKA 1HHQA 1J5EJ 4KQZA 2XYHB 2D3UA 4O0NA 5D77A 3U27A 2HQFA 2W7AA 5A6PA 4U67Q 3VAKA 3T5LA 4LF9J 5HANA 1RTDA 3I0RB 1CJTB 3KJVB 1KHVA 3L7UA 4MMOA 2MJNA 1S48A 2GAGC 1KQKA 2BOPA 4HKQA 2IC3A 1X0PA 2IYGA 2YKPA 8RUCA 3QSYB 1OWXA 3GSDA 4PQUB 4CIOA 2BV3A 4X4NA 1AFIA 3CJQA 1DURA 2JEFA 2LP4A 4C2MA 4X4UA 4L3NA 4KSEB 1QAJA 4ZVEA 4ANDA 4TU7A 4A8KA 2FLPA 1FTCA 3LP0B 5D4PA 3G87A 3DOKA 5L1IA 3MR2A 3R2DJ 4NA3A 4DL2A 5H9EJ 4ITSA 2HVZA 2WVDA 4IDKA 2R42A 4NLQA 3H59A 2E9ZA 1U02A 3MPVA 3IR7B 4X64F 3GR0A 4F4WA 1MWYA 4ELTA 3ZTQA 2IMWP 4WKRA 2CKWA 2CNOB 2XEXA 4UQGA 1H3DA 1VI7A 1VQSA 1OY9A 2IC3B 2KXNB 1HNWF 5DETA 4C97A 2FHMA 4LF2A 4WCEQ 3V81A 1VQMS 3SCKE 3IWNC 2C2MB 4CI0B 1EKRA 1F60B 1NJXA 3FZBA 1VJQA 5J1PA 2AF6A 2D74B 1F5CA 4ZVFA 1B7YB 3DLKA 3QYYA 3TZZA 1DZ5A 2HAFA 3RJMB 2W8LA 4NLWA 3CCES 1ZM9A 5CCLA 3AT1B 3UWTA 2QSWA 4ZLJA 3PKYA 1RGVA 1RT2B 3A8JA 2AJFE 4JI3F 2J0WA 5T7LB 3VAMA 4LRCA 1PGZA 1V9OA 4D3GA 4A8XA 4K4SA 1FERA 1CJUA 5E3QA 4NA1A 3GLJA 2CJ9A 2DHHA 4CO2A 2MPUA 1BY9A 1FVQA 1SPBP 4TN2A 2IRUA 4IH6A 4I2QA 2GJFA 4OYAA 4N41A 2V0NA 4B17A 1GAOA 2RJZA 4PWUA 2NQPA 4MK9A 4UOGA 3MEKA 2Y0BB 2ZH4A 1TL3A 1DJ0A 4UOCA 1CJKA 1X9WA 1JXEA 3BSNA 1S1WA 1ZM4A 3P96A 3MPWA 4MYUA 2YNGA 2HKEA 1HNXF 1NDCA 1WHWA 3DXSX 4B9VA 5HVHA 3D28A 1IWGA 2C3OA 2HFOA 3D3CJ 2E5GA 5HN0A 3X3UA 1N34F 4KKOA 2GO9A 4M63A 3UNYA 3LP0A 2C2ZB 3DGPA 1CBKA 3AODA 2DHAA 4DJBA 1AT1B 3CC2S 1PBAA 3UD3P 4L3KA 4LF8J 1V5VA 4I2PA 3PFOA 3P4UB 4AYBD 1X60A 4MTPA 5CABA 1X5TA 3M1VB 4OYZA 1UJ5A 4TYBA 4CLPA 2N4CA 5CD4A 2R8JA 2BEFA 4W98A 3GIMA 1WC3A 4NLDA 4DF8A 2FJVA 3TNVA 1N33F 5A8RB 4RW8B 1FDAA 3HXMA 1P1TA 1YDLA 3Q8VA 1RYSA 1KP6A 2CQBA 3H2LA 3Q89A 4LT6A 2VBZA 3GG0A 4IQMA 5JVHQ 1AUSL 1Y11A 3C6TA 2B0GA 1IWAA 1BQNB 2DB1A 4M95A 4YN3B 1UVLA 4ZMMA 2C28A 3OD2A 4MFBA 3OLAA 4C3MA 4I68A 1WKLA 1TKTB 3NG8A 1KQSR 4R8UB 1S0OA 5CXTA 2C2EA 2AHOB 1VK3A 3MMJA 3RB4A 2FVSA 1HBMB 4DR3J 1NJWA 2RNEA 4LQ3A 4CT9A 4C98A 4P6QA 5D3GA 3C66A 2PFFB 1FDNA 5A6WA 2Y1JA 1S1TA 2YNHB 4HH0A 1RA7A 5KFHA 3G6XA 3JYTA 1UWBA 1QE1B 3J81Y 4B08A 4RU9A 4OYIA 3TAQA 1KONA 3ZZTA 3OTOJ 2DR7A 3S6EA 2LQBA 4DFKA 1Z4UA 4L75A 1HNVB 2FJXA 3EXCX 1RKIA 3N4WA 4B9UA 5D4OA 2DNZA 1SV5A 3TAPA 5BR8F 1RQ0A 3SV4A 2RUGA 3J7ZT 3G9CA 4ZVGA 2QLFB 3ILOA 4QPXA 2EFPA 3HLUA 2BABA 2J7UA 4DSJA 3NCRA 4DPWA 3IBFB 1RYRA 1S6UA 4NLTA 2RDIA 2FZKB 1HFEL 1X5PA 1Y7PA 1L3UA 2E7VA 3THVA 3G8SA 3CF5Q 1RT7A 3PW2A 5K5MA 1XR6A 3NAHA 4OZJA 5D6GA 4C9DA 2YWFA 1Q81T 2F8HA 3GFHA 1IM6A 3AB2B 1REVA 4GMKA 4CO5A 2I8EA 3DOMB 5KAKA 1K8AT 2DNMA 4DS5A 3DMJA 1H2TZ 5J2QA 2MQ8A 3LTOA 4KPCA 3QRPA 1VFJA 2DNOA 1Y4ZB 2HFSA 4DPTA 1FEHA 2IPOB 3BKTA 3QFHA 4WZQA 1KFSA 4TQSA 2DXFA 1VHFA 2ACMA 3JXOA 5F3TA 4IG0A 2J9EA 4NLOA 4LBIA 3PY8A 4KV8A 1FO1A 2XM3A 2EBEA 4RW9B 4QYRA 1JLCA 1PJ7A 3PHEA 3SBMA 2FB0A 2KFZA 4NPOA 1EB0A 4DR3F 2W4CA 4ECVA 3QWPA 3PZPA 3DLHA 4C48A 3KUGA 3DLGB 1V3RA 3NCPA 4QU6A 5KOWA 4UOHA 2HLUA 4FS2A 2VPYB 1YLXA 2AX1A 3HI9A 4UZCA 5B09A 1R6VA 2B4PA 2B6AB 3DCAA 3HZGA 1B64A 1NHUA 3PJWA 4PG4A 2VQFJ 5HVGA 4DR7J 2VUGA 3NKYA 2K06A 2EFQA 4BBYA 1FRLA 2ROGA 2ZJRQ 4I2PB 1RZMA 1QM9A 1GXUA 2WB4A 1RAFB 2DGTA 3BPDA 4KY3A 3P5BP 5HP1B 3JTOA 3X1LB 1O5JA 3BGOP 4YDXA 2MZ1A 4KJIA 4URQU 4USIA 2RU9A 5LOQA 3ET6A 5HL7Q 1N0UA 3TX0A 4I6YA 4N77A 1YJRA 3B8HA 4NLPA 4ZCMA 2C3YA 5LJ5Y 3SFGA 2HURA 4ELUA 3PYEA 4CYUA 2X51A 1JKHA 3QPIA 5ETKA 4AFFA 4F3MA 1RT6A 4ZLLA 4K4YA 3AHPA 3I55S 3DNCA 2UXBJ 4PG7A 3V6DB 4X65F 1F0XA 3HVTB 4QQBA 3W3SA 2AJQA 4FF3A 2MY8A 3QMQA 3EZUA 2OHDA 2NREA 1VQ7S 2CRLA 1WOSA 2PFDA 4C8ZA 3GTYX 4YEAA 2I6WA 1J5OB 2CJKA 2DISA 3DDNA 3MM8B 4PR6A 1OS5A 2KZZA 3TEGA 2ZC4A 2YKOA 4DI6A 1U1MA 1W2BR 4J9VA 5EUHA 1FFWB 2R8GA 3GCXP 4HTJA 2WONB 4ZK7M 3MM8A 5T7LA 1FDBA 1H98A 2ALZA 1IQZA 1Y3JA 3B4MA 3A13A 1S4EA 3PG9A 4J37A 4O44B 2R7RA 2D7SA 1TV6B 3MCNA 4OZ0A 3W2WB 4F50A 3CCUS 1SI9A 1URRA 1XERA 2G1HA 3CJ3A 1P9QC 3ETOA 3JQJA 3MMCA 4FP9A 3VZIA 4CLFA 4F0KA 2D3ZA 3CSKA 3V4IB 1NRKA 3CJKA 2YPZA 3HVRA 1DFDA 3GJSB 2ZBIA 2CFXA 3CCLS 2HBZB 5FLXY 3FBEA 3NCQA 2VQEJ 1HIYA 5HMYA 3MTJA 5C2GA 3PKMA 2F65A 2XMTA 2AKWB 1IKVB 2LQ5A 1TL5A 2LXUA 3ENAA 3LALA 1SQFA 2NXNA 3CWJA 3NBPB 3R5DA 1OY8A 3L95X 5HQMA 5DDRC 4DUYJ 1TFWA 1UVIA 2JFDA 1RT4B 3MCSA 1FCAA 5J2PB 4OI4A 4N7TA 3MM9B 4ZA1A 1OJ4A 2D3OR 4KTQA 3NGDA 2PA3A 2MZSA 4ZCKA 5C24B 3W1YC 4RNHA 2CWXA 2VKRA 2FJEB 2QGFB 2GW8A 4UT4A 4ZVHA 1X4EA 2RD5C 3SI8A 4KHPF 5K9FA 2CQGA 4P7TA 3ICLA 3NGTA 4NLRA 2AEFA 3KLIA 4QCLA 2GIFA 5AXNA 4DCJB 1LV5A 2WSCC 2ERRA 1MN9A 4XK8C 2QZ8A 2HSEB 3ZTPA 5KG3A 1HARA 1KDNA 1UFKA 5C2CA 1NAQA 2APOA 1FJCA 1UA0A 1P6TA 3RW7A 3QJLA 2QG9B 3LP2A 6FD1A 4JI7F 4NCBA 2FVCA 4L74A 2HK2A 3DHWC 3H90A 3HSDA 4LVNP 1E6YA 1MU2B 2G0IA 1F5BA 4DR1F 1Y5LB 3VAFA 2RMLA 2UUAJ 4DV4J 2OPRB 4NL5A 3W64A 2QLWA 2MQQA 4B9MA 4JI1J 3DMJB 4M5JA 2BJ9A 1Q16B 3CCJS 4ZPAA 2MKHA 5IT9Y 1SH0A 3IC1A 2C3PA 3QRRA 2XZDB 1T03B 2NXCA 3PR5B 2X1AA 4AL7A 1MW7A 3BQ1A 9RUBA 2HIQA 1UTAA 2VU5A 2B4UA 3G82B 1SJRA 2V2QA 3N6LA 4ECRA 5U47A 4B3RF 2BJ1A 1JJHA 5CH7B 2WBRA 1F9HA 2GVZA 2MSTA 2HRUA 3MAAB 2FVPA 3I82A 4B3MJ 3TVYA 4WZMA 4ZKAA 4B3SJ 2ZHBA 1JLFA 1D8YA 2DH9A 4FXDA 1C2PA 1UPPA 2VFVA 4K5RA 1F3FA 3D68A 3K5LA 5IQQA 3KK1B 4WTOB 4L6V3 1U0SA 4ECZA 5CCMA 3MFHA 3WC0A 2J6UA 3UDVA 4DQIA 1CG2A 1NO8A 3POTB 4IFYA 5E0OA 1JLBA 2UZAA 2ZH3A 2D3O1 2ABYA 2ZNYA 2HHVA 1MWZA 2I0XA 1LWFB 4ZHRA 5KG5A 1WEYA 1Y0HA 5IWAF 3K7RA 1DBDA 4GKKF 4U8YA 4LF7F 4V1Ak 1SKRA 1S6OA 3NMAA 2JNJA 2B9YA 3MECA 3PX6A 2GMLA 3D5MA 1EKSA 1TKZA 2KU7A 4GVBB 4M5KA 2HVHA 3FVYA 2AYEA 4DR5J 4EBEA 2IVYA 1AYEA 4JP8A 2QV6A 3KK3A 2VB6A 4C8YA 1KOOA 5HI7A 4Q45A 1ZYQA 3CCZA 1RWWB 3DOLA 3P5TL 5HMWA 4OJGA 3IRXB 1HW8A 3PRBA 2HGMA 1Q0NA 3L4BC 4NMLA 3CCRS 1VBYA 3DLLQ 4LFCF 3KOAA 4UY8T 4RX6A 1H0HB 1VR6A 2VG7B 4O0IA 1VQ9S 5F0UA 3WX4A 1FESA 1W2IA 2DKOB 1W25A 3R3TA 1FWLA 4LRDA 5E3RA 4ED8A 1T0TV 3MUVP 2HRYA 3KTQA 1T3NA 1JNZB 2WZ1A 2EPIA 1ZAVA 2BW7A 2HNZA 1YQHA 3RZAA 1GH8A 2DH8A 2MKKA 1SCJB 3VGVA 1RBLA 3Q22A 4OZNA 4DLGA 3NP5A 1XC9A 1ROFA 4FF4A 3UD5A 5E5NA 1E6VA 1UCNA 4CNZA 1NKEA 4IQXA 2KG0A 5KT7A 3D54A 2ZC3A 4J9KA 2RKIB 4OMFG 2CJYB 3N01A 4Q0BA 4OYOA 2B5JB 5JUMA 3M9NB 4KE5A 4P52A 1HWUA 1RHQB 1TL3B 1U8WA 3FEZA 4KRWA 3RBXA 3TZYA 2DITA 1EAYC 3NS5A 3EZ5A 4DSIA 1WHVA 1RWOB 4RW4B 2OMLA 2L48A 3GR1A 2YPYA 3T9ZA 4IUFA 1AFJA 2BVZA 2VA2A 4DCOB 2WW4A 4NXMF 1MG7A 4WYWA 5IQ6A 3AA9A 1RHMB 1TVRA 4ZITA 2XO6A 3KYLA 1HNZJ 1XMQJ 2XMKA 4KYZA 4LF4J 4DPYA 1KTQA 4IKAA 5KFKA 4X62J 3H2UB 1I94J 4WU2A 1SJ4P 5KFPA 3G71S 1K73T 1VOMA 1EQ0A 1Z1ZA 5KG4A 3KKFA 4KH0B 2MSSA 4DFPA 3TZXA 4O3RA 3M9MB 2HVDA 2LU1A 4DV4F 1VIOA 7FD1A 1NM2A 4LRFA 4FYDA 4KO0A 2RDJA 4DFMA 4DEZA 5KFSA 2PE8A 4U96A 2XGPA 3F0NA 5KFJA 3PO5A 4I64A 4JI7J 3LF0A 4DOZA 2MKCA 3MEEB 4HDGA 4KFBB 2IVFB 3UDLA 5DQGA 1KS2A 2JLEA 5AJ3F 4CH7A 5I42A 2NPFA 1SC4B 3ZZYA 5EHHA 2FY8A 4K59A 1ZTWA 4USMA 1VQKS 4I7FA 2OGUA 2M8HA 2ZUAA 1FT8A 4L73A 4ZVSB 3DI6A 4TYAA 3MM9A 2MQLA 4ZVQB 4C8MA 5AE3A 3BO4A 1TKDA 4F3OA 1FEEA 3TP2A 3T6BA 2K1RB 4JI0F 3T1YJ 5A2QY 4P2XA 2WOMB 2DD8S 3GYNA 4DX5A 3RW6A 5KT5A 4O4GB 4QZVB 1MMDA 2B4OA 2PIIA 2Q1LA 4DPUA 4HVZA 5BYSA 2R2SA 3TANA 2DRBA 1RAIB 4IFVB 5CYQB 4YY3F 4NI2A 3MR5A 2VQEF 1FF2A 2FHKA 2WW8A 3VAHA 2AGOA 1CLFA 2DY1A 2V4JB 2POKA 3LH2S 1F5AA 3LW5C 1H2VZ 2DK2A 4FDFA 5J1NA 4N47A 2NLWA 1IBLF 3BQ2A 1P1LA 4IG3B 3CJ8A 3LUYA 2E1AA 3OQ2A 4BS2A 3CJ4A 3D67A 4KB7A 4DV0J 1RT3A 4WJBA 4LBPA 2GHWA 2ASYA 4DR2J 2Q79A 5GADI 5GMDA 4KFBA 4OHWA 1LXJA 1CS4B 1VRTB 1TL7B 3AY0A 3IGNA 3MCOA 4PCQA 2JZ5A 4LR8A 2Z2YB 3CJKB 4Q43A 2RQCA 3RRGA 1TELA 3HHLB 2P9EA 3SCLE 2G1DA 1TAUA 1VQ5S 4H4KC 2HFNA 2UXDJ 3S1TA 3BSCA 1Q7LB 3GONA 4XAKA 4LFAJ 4HH1A 4F4AA 2CJAA 4XO0A 5B0EA 2R2UA 1KC8T 1HD0A 1WOOA 2EVZA 1IBMJ 1K0TA 2C2NA 2AYBA 4LMZA 3W61A 3JQKA 5F8GA 3PX4A 5A76A 1RBAA 2Q6BA 3BS9A 5CQGA 2ATLA 1K44A 1PYTA 1U6FA 2QMXA 2RQKA 3QLHB 3D0HE 3T19A 1JKHB 4PABA 2ZITA 1HLWA 1RWXB 3ZXWA 2C22A 1T9WA 2DNHA 2VG5A 3PRVA 4TU9A 4WP9A 3BR8A 1XR5A 2HFVA 2V6AA 5E3CA 5GAHU 3PR4A 1CSJA 3CD5A 3U7JA 1PAEX 2F8EX 1IR1A 2HLTA 2MZTA 3HVTA 4M5LA 4CO3A 4O3NA 1DTQA 1ICEB 3CDBA 1M90T 2P6SA 1HYSB 1OSDA 1H6KX 1RABB 2HEKA 2FVQA 3D1HA 3TUIC 3J7Z5 4U9RA 4WPAA 1KHWA 4DF4A 1ZZNA 1VQ4S 1HMVA 4WFZA 4B02A 4P71A 4OHZA 5DDPC 1BQNA 3ENWA 2WOMA 5AXMA 2EK6A 1NBEB 2QN6B 3MPYA 4ZP9A 4B3MF 1F2HA 1KVIA 5IFMA 5D0GA 3P6YC 3DRRB 2RU3A 2M70A 1B4SA 3JTPA 4C6AA 4AXIA 1BHNA 1IN0A 3QFWA 2ZOGA 3TRGA 1UP1A 3MUMP 4HT7A 3EGWB 3MM6A 4ZLPA 4IOAQ 4EMDA 3W5XA 4M5HA 4ZIVA 4CZCA 4O3OA 2Z2ZA 2H54B 5K8PA 1V3ZA 2XS2A 3M8QB 1WI8A 1EZZB 4K4XA 1RTIB 3KG0A 4MK8A 3DOLB 3BDEA 2W1BA 1YVFA 2CPXA 2ILYA 4OI3A 3AQOA 5D0EA 3SCJE 1NJIT 4X65J 1G6BA 3LANA 2B51A 1KKHA 2KHCA 2KXFA 4NASA 3AXKA 4X4SA 3EYZA 4DFJA 4LF1A 4ZP6A 2BX6A 3R5CA 4RWWA 3W7BA 1TKZB 4KHRA 1MMLA 5GADU 2HYIB 2KT5A 4NRTA 3H5YA 1H38A 2QC3A 2V69A 3RR7A 1PCAA 3SXLA 3FUYA 2XMVA 5KFBA 4DSFA 2MHEA 1XMBA 1WG5A 3CD7A 3MMBB 2CXEA 1RHJB 2CQ1A 1UAWA 3UW1A 1L5UA 1DY3A 3B4DA 3OFEA 3RUBL 2VZ9A 3H25A 4JI5J 2YQ1A 4J5OA 4UQTA 4BC7A 3NLCA 3GE9A 1TL1A 2RF2B 3L9ZA 5GAEI 3FSXA 5HQLA 3F73A 1SKUB 4S0MA 2E7XA 4R5PB 3ILIA 4KGZB 4URSA 2HS4A 3GP9A 1N5SA 5HROB 2HHUA 4JBCA 2Z2LA 4J9RA 1U4BA 1RTIA 3V6KA 5FDLB 3ZZRA 3JYTB 1LQ9A 3DGVA 1L3SA 4B3RJ 3ETMA 1HKAA 3MPUB 4LIWA 5KFUA 4DUZF 2UVRA 2UVVA 5GAGI 4QU7A 1Q8BA 5A8RA 2XC9A 2EK1A 3RAXA 4K0KF 2Z57B 5KG0A 4RBTA 4JB8B 4QIGA 1M1HA 3ZTSA 2JEIA 2IA6A 1WUUA 4QWAA 4F4ZA 1F2GA 2OH2A 1KR4A 2QL5B 1GMVA 2DT9A 1NSPA 2BM0A 1GMUA 3P3DA 1WDDA 2MQPA 2DRDA 3OLBA 1GX5A 2E7WA 3H20A 2V8GA 4GKJF 3PW0A 1S6PB 1NXIA 3HD2A 4DV6J 3PVXA 4WFAQ 3DRSB 3A8EA 3OR2A 4NCAA 4UUXA 3MEGA 2UUTA 1UETA 5DG9A 1CPZA 4FNHA 4DR6J 3KFWX 3CJTA 2J6TA 2Y1LB 1RDRA 3QIPA 4A8MP 3JSYA 4GO7X 4P75A 2QO3A 3M1VA 3RRKA 3TWZA 2AGQA 1VQLS 3W8GA 1NK5A 2OPQA 3DC2A 1S97A 3CDWA 3IFEA 3CC4S 2M9KA 4IH5A 4NRUA 1YG0A 1XQIA 1UJ4A 2CA9A 2IJFA 4QJVA 1TUWA 2OPPA 1EETB 1DAXA 2DGWA 2ZHOA 1S0NA 1JLGB 1HHSA 3C14B 3CCMS 2HMIB 3H4DA 3R5BA 4X2BA 1YKWA 4RJVA 5A8WA 3OL8A 4Z37A 3DLEA 3HDSA 1H72C 1NLKL 4NLVA 5E2QA 4DUZJ 1TV6A 5J2PA 2DEJA 1VC0A 2JEGA 1RT2A 3HHEA 1HR0J 3RAQA 3BR9A 1S1UB 4BLGA 2A6OA 2XCPA 3KLEB 3CGIA 3O5TB 2AIRB 3UQSA 2DIUA 1S79A 2JWNA 1NZAA 2HNYB 2RHQB 1U2FA 4CM2A 1UA1A 3J80Y 3MM7B 1WSVA 4B3SF 1TFYA 1R89A 1O0PA 4I67A 4A46A 4QWBA 4ES2A 1BXNA 3P49B 3PW5A 1WDTA 1R8PA 3D6TB 3GSIA 5FIIA 3K5NA 3T1HF 2HBYB 4J91A 3VTIA 1UJ6A 3TUZC 2HQCA 3ILLA 4DR1J 2K3KA 4YOEA 4Y2CA 1XIQA 2RKIA 2A18A 4IDKB 2BBEA 3OUYB 4RW6B 5HMXA 3E3XA 5HJYA 4ED2A 3H2VE 3G4SS 1NK8A 1FRXA 1E6VB 4DV1J 4IOCQ 2YQ3A 5LMUF 1LWEA 1MROB 4JI6J 2ZD1A 4LF6J 4OX9F 2HG4A 1ZZFA 3K5PA 2YNFB 2ZVSA 2WTFA 5F9NA 1JLGA 3Q24A 2KRRA 1F3VA 2AP6A 4K2XA 1R3NA 1HI0P 1S1VA 1YRXA 3D2WA 5KFDA 3QGGA 1REGX 4IG0B 2J76E 2JSXA 2VFUA 3B82A 1ZA2B 2CQIA 4ECYA 1U24A 2V34A 2R8HA 2DNRA 3PNIA 2UU9F 2YNIA 1Y3KA 2IBKA 1VQNS 1WC4A 1RT1B 3NOGA 5DO2A 1SJ1A 4NMXA 2V63A 3TAMB 2VC0A 3OXGA 3AH6A 2GIQA 3FEXB 4MJKA 1X9SA 1LW0A 1FK9A 5D78A 4JV2A 4LFBJ 1RWPB 2CPYA 2I5JA 3TQ1A 4KBIA 4DG1B 3D3BJ 5L39A 4Z7YA 4HL9A 2GHVC 3SV3A 2PO4A 5EDWA 3TEHB 2UUWA 2LA6A 3AD9C 1U26A 2LFVA 4C11B 4DUYF 2B4VA 2V94A 3CXCR 1QLNA 1RAAB 3W65A 2FDNA 3JSRA 2UU9J 1NH8A 1NNDA 3I0RA 2C2KB 2YWKA 3D6HB 2YWWA 3HHNB 3K59A 3CW2C 1V3SA 4USWA 2HQGA 3I0SB 4ECSA 3AAWB 3PCOB 4MIBA 4NXMJ 3SSSA 2H48B 1JLFB 5K8MA 1QSSA 4G1IA 4ZPDA 4EYHB 1RISA 1QVGR 2ZHAA 3A12A 3ZC4A 3VGUA 3KHLA 2RDDA 2GGPA 2EKNA
chains in the Genus database with same CATH topology
5LL6d 5HO4A 3DM2A 2V5HG 1SV5B 2WRMA 2QA4S 2HNZB 2ZBCA 2DHSA 1IKWB 3IRWP 2KN4A 4F4XA 3L3CA 4F2RA 2IFXA 2BA9A 3C6UB 2G9OA 1N5TA 3LP1A 4Y2IA 2L9NA 4M5DA 2FTRA 2M52A 4E98A 4N41A 1RK8A 2IM3A 3DXBA 4ILRA 1S10A 1OSCA 3C6TB 3CC7S 3JAMY 2NPIA 4DSKA 5KFMA 3DRPA 2Y1RI 4HEA9 1NJYA 1YBAA 4UY85 4L72B 3QO9B 1OO0B 3L09A 5MLCV 3BSOA 3VAGA 4OHVA 5HMZA 3H4BA 4X84A 1YJ9S 1FKAF 1S4FA 2P6TA 2K3IA 1WI6A 1S1TB 3N0VA 3M2RA 4LJMA 4CT8A 4O23A 4PXEA 1R6YA 2DTJA 1DQAA 4YB1P 1U1KA 1WHYA 2FJBB 2OP5A 3HHLD 4D3HA 4ED3A 3MR6A 4ICLA 2DNNA 4CO1A 2QE5A 3ZZ0A 2J8AA 5KT3A 2FJAB 3OFHA 3T3FA 2OFGX 3K8VA 4DBQA 5DG8A 2YNIB 3CCWA 3I9V9 1DTQB 5IXUA 4XDCA 4C3KA 4ES3A 3KHGA 4RW8A 4GC7A 3SZ2A 4RUHA 4ECXA 5L9XA 2FHJD 2FC8A 1JLEA 5CZXA 3M9OB 1K1SA 4QW9A 1LFPA 4LFAF 5L1LA 3JSMB 4RLEA 2YY3A 4Q2LA 2UUBF 4PG5A 2CQDA 2DGOA 4RBVA 3DRYA 1HWIA 2GA7A 2CQ3A 1X5SA 5K14B 1T7PA 2YTCA 3DLEB 5KFVA 5DQHA 3FRZA 4ALZA 1HD1A 2A3JA 3N6NA 4DL5A 2E1RA 2FC9A 4OL8A 1C0UB 3EUNA 3E01A 4WFXA 2FGCA 4C7QA 2IRXA 2XZWA 2XMUA 3B78A 3JTNA 2W7OA 1PSDA 2KVIA 3QZ8A 1RA6A 3IAM9 5KFWA 5LMNF 3M4XA 3GIJA 2GHPA 3JSMA 4BWJA 3JSBA 1Q7YT 5C42A 2GCFA 2LVWA 1VQOS 1T02A 1BWEA 1RJJA 2BACA 3IS9A 3WBZA 3GG1A 4C11A 3OL6A 4OI1A 5D3GB 4DR7F 4ID5B 3OTOF 1N48A 3T6JA 1DQ8A 3TUJC 2W9BA 3FSIA 2I5JB 3MOZA 2FJWA 2QLXA 1S1UA 5L9NA 4R8UA 2Z8QA 3TVKA 2GJ2A 3SEOA 4ZPCA 4KAIA 2JC1A 2JVOA 4QWDA 2C2RA 3OJSA 4ED5A 4QIVA 5HBMB 2E5HA 2FLNA 3DLBA 5M2UA 2ILZA 2BANA 1B0VA 2KO1A 2QMWA 1IKVA 3KJVA 1KD1T 4MAKA 3SSRA 5FJ4A 2J0SD 3NS6A 2ZDOA 1R7IA 2BANB 1FTRA 2CQHA 2J9DA 3FNNA 4NX9A 4TY9A 5D77A 5F0WA 2E29A 4DHVA 4ZPWR 2OPQB 3Q8RB 1L3KA 1L3TA 4N8NA 4BWMA 1R27B 3G86A 4I1TA 5D4NA 3BM7A 1R8CA 3PW4A 1FD2A 2BJDA 3UFCX 5KFYA 1C0UA 3K0JA 3KLGA 1TK8A 3C3LA 3LOUA 2RQ4A 3CD6S 2MMYA 2BE2A 2HHPA 1D1UA 3CIZA 5K14A 3BN4A 3PM9A 1VC6A 2VFTA 4ID8A 2XO7A 4OI6A 1WEZA 4DWIA 2XWYA 2A10A 3LP1B 5KFNA 2R7TA 3DOMA 2B9XA 4ZP7A 3DU6A 3NMRA 2OTLS 1N5VA 4WU3A 4RW4A 1HBOA 2ZE2B 3UCZP 3E8OA 3MM5A 4YQWA 1RTHB 3I5BA 2VQFF 3CJ2A 5T41A 3QZ7A 5CYMA 2U2FA 4A8FA 1SH3A 3M8PA 5GAGU 1Q8IA 2AU0A 3PX0A 1I1GA 3HF5A 1HQUB 2HHTA 2F1FA 3ITHA 5A8KB 4QWEA 3QJPA 3BN7A 4F8RA 2JLGA 5B0CA 3PXGa 4TU8A 3CMAS 4ZPVR 3CT9A 2OJ3A 3GQCA 1IR0A 1U09A 1MSWD 1B0PA 3DLKB 2DNQA 2DR9A 1G1XA 1U1NA 2R7WA 1FRKA 2BW2A 1ZTTA 3TI0A 4WKYA 4H4OB 4NOHA 4OZLA 4RUCA 3DRRA 2BJEA 3W2VA 5DRKA 3TA0A 4WXWA 2PT0A 3K8WA 4FS1A 3I5AA 1D9AA 2U1AA 4DS4A 4FF2A 4C8OA 2VH7A 4YB6A 1GNKA 1X7VA 2XMWA 4RW9A 4ATNA 3H8YA 4U7UK 2MZQA 4ED0A 1WF0A 1YWXA 2N7CA 1VRUA 2F8MA 4Y65A 3T5JA 1GXTA 2BRKA 3NAIA 2LECA 3F56A 3CCQS 1DLOB 2GNKA 4YDDB 4B9LA 4KGMA 1P8GA 4O4RA 1FXRA 4OHXA 2P5VA 1LKZA 4AL5A 2DVIA 1N6QA 4QBUA 4I56A 4JV5F 1M1KT 4LVOP 1M5PC 4IYQA 1VQ8S 2I1RA 2P9CA 3M2UA 4DL7A 2OPSB 2PEHA 1GX6A 5C25B 1MROA 1LWEB 3DRPB 2ZZNA 5IT0A 4OI0A 3PDNA 4FVMA 1UVNA 1ZM3A 2CZVC 4NZ7A 4Y2AA 1IBKF 3SDEB 1IKWA 2DO4A 3MHYA 4F4KA 1NH7A 1TKXA 1BLUA 1S1XA 4PRFA 3RYLA 2YWGA 5L38A 2EBGA 4F4YA 2CVEA 3U1MA 5CYJA 3ENVA 2CPEA 2YX4A 3PJXA 1BQXA 4N8OA 3KWMA 3M30B 3M32B 4WFYA 4J9LA 1SKWA 2EG2A 3QAUA 3KHHA 4ZDNA 3M05A 2H9ZA 2KXHA 2IM0A 1Y9OA 4NZ6A 4TXSA 1IKYB 5B0GA 4ECUA 4ED6A 4QWCA 5A8KA 2RE1A 2VASA 2HWTA 4CCHA 1HBNB 5KFXA 2LYVA 4B9SA 4NXNF 2NSCA 5F8JA 2HHHF 4IRDA 3VQSA 4PWDB 4C3LA 1FKPA 1DARA 1VLYA 2AV5A 5IM0A 3PIOQ 4FF3A 3I0SA 3TW0A 3OR1A 5FD1A 4AUKA 3VWSA 3OFGA 3OBIA 4QIEA 2OLWA 2PDAA 2MKIA 1LW0B 1YITS 2J0QD 1RWUA 5E41A 3BREA 3OXLA 2XS5A 1PC5A 5DGBA 1JLAB 3KLHB 3BGRB 4ZPTR 1AUDA 1DLOA 1Z2ZA 4R0JA 3E2EA 3M2VB 4DSLA 4OX8A 2WAQD 4DV1F 2G13A 3CUNA 1NJZA 4J9QA 5C24A 4RW6A 1FK9B 4XIUA 4DV3F 4MFBB 3K58A 2H5EA 2UP1A 5EX3A 3KK2B 4C0OC 3HX9A 3EPGA 4DR2F 2KJWA 1WD6A 4YMEA 2NZ4A 2PN6A 2P9GA 4YR2A 3DYAA 5HQ8A 2RVJA 1YJTA 2XLKA 3JB9k 3ZZOA 2J7WA 2XNRA 1XR7A 2JX2A 3CCTA 3GIIA 3UR0A 2MYFA 3LPYA 3PW7A 4DPOA 5SZTA 2MKSA 3MR3A 4DX8H 3UD4P 1N8RT 3GYXB 1RI7A 5KFZA 2BR0A 3VCDA 3WZ0A 2VG6A 3UCUP 3LGNA 4Q7AA 2Y0SD 3PRDA 2CZ4A 4R5PA 2F9JA 2LQJA 2NUHA 2XB2D 1XK8A 3OUYA 1K0VA 2LA4A 5K8OA 2OIHA 2F7VA 3HHLA 3M32A 2IM1A 1RT6B 1Q86T 4YHHF 3WC2A 2HNDA 3I96A 3IS9B 4J9PA 2VA3A 3TA2A 2QYCA 5I3PA 2ADBA 2W25A 1HBOB 2YVSA 1R0AB 2OFHX 1FNXH 1M5KC 2VBXA 3V6DA 5LT5A 5CD4H 3OL7A 2GQ2A 1LOUA 4IRKA 3EGZA 4PQAA 2HVIA 3DFEA 3HT3A 1U8SA 2C3MA 4M1KA 2GJIA 3I5CA 1VK8A 3FGVA 4LSLA 2B5JA 5J1EA 3HHKA 4OZ5A 4WFNQ 4IRCA 1MMNA 1YTYA 4PPDA 2JLFA 5DS7A 3OTBA 3NL0A 3MD3A 3FDSA 4R25A 2K1RA 3OXFA 4OX6A 2QRRA 1ZOTA 3OTEA 1NK6A 1NK0A 2R7OA 3LAMA 1IKXA 4O3PA 5KT6A 1XNQF 2BQUA 2M2BA 1DTTA 4XPEA 3HM9A 3AJ2A 2R7QA 2CQCA 2C2DA 1XEZA 3IWXA 2KM8B 4DV7F 1NKCA 2LXFA 3M6UA 4JOUA 1WTBA 2L3MA 1CQNA 1N5QA 2F4VF 5K8NA 4DQPA 3H40A 5HROA 1UKUA 1FVSA 1EP4B 3C6UA 3HVWA 4YR3A 1ZBTA 2VFSA 4KV8B 1WG1A 2MY7A 2WK4A 4LUBA 1G2EA 3CJ0A 2XMMA 1DRZA 4EBDA 1ZAXA 2DGUA 2ZDPA 2LKZA 3MECB 3TO8A 2R7UA 3M2RB 5LXYA 4M5DB 2KRBA 1V6HA 2VPZB 3FZ2A 3QAEA 4EUVA 3HHDA 4H4OA 3MMBA 3IA0A 1LWFA 1QUPA 1S7HA 2KKHA 4ZHRB 1HI8A 5KT2A 1IM4A 4ETZA 2IBOA 2FLLA 3QLHA 5T14A 1VGYA 1KRPA 4OFZA 1XN9A 4XDDA 4IR1A 3OR1B 2R9LA 4DV5F 4B9NA 1UVJA 2V8DA 2GMHA 2ZZMA 1Q1KA 2ZH8A 2MGZB 1SUQB 4JI2F 2OAUA 3U1LA 3A1YG 1HPZA 1X4CA 2ASLA 3KNAA 1Y5NB 2YNHA 3KG1A 3FQLA 4X4OA 1TAQA 3GZ7A 2C42A 2OSRA 1FJEB 1HWKA 1RTHA 1S0MA 2X1FA 2COLA 1C1CA 4Y2KA 2KH9A 1CC7A 2AWZA 2O5DA 2JHEA 5E7OB 2Z2MA 3ENQA 3RAMA 4C8LA 1JLQA 3H5SA 4DV6F 1KQGB 3PEHA 2W8KA 3ZFVA 2V8VA 1G7CB 2RRAA 5ADZA 3M8QA 1VQYA 3T1YF 2ACYA 4EWTA 1SL0A 4NCGB 3GILA 3DDKA 4HHJA 4FXWA 4LSNB 3GFZA 3SDEA 4AQYF 3KK3B 3DHXA 2DHXA 4QR0A 2HGNA 5CZVA 1KVJA 3SQGA 5LSOA 3VZHA 5IS2A 2CJBA 1NK7A 2YKNA 2M3DA 3OVBA 1N54B 2YH0A 4Y2MA 1U47A 1U1PA 1QJHA 2FUG9 1X4AA 3W2VB 5C25A 4RBUA 1N32F 5H9FJ 1Q78A 2OO4A 2RIJA 4IO1A 2KYZA 2M7SA 2XULA 1S76D 1X4HA 3KG4A 1Q82T 2BQRA 2DJWA 4QPTA 5J1EB 2E5JA 1T95A 1X4FA 3MAHA 3HHLC 2N3LA 4FPRA 1RT4A 5KFAA 2R7SA 4HDHA 1QAYA 2C3UA 1WF1A 4OLPA 1HNZF 1JX4A 4TQRA 2R8IA 1HMVB 3S8SA 4R0EA 2EFGA 4RZRA 2EC0A 3MD1A 1HWLA 1S1WB 4NYZA 3BO2A 1LWCB 4LSLB 3ISNC 2LDYA 2YH1A 3OVSA 1I94F 1QSYA 2Q43A 2YKAA 4AL6A 4MK7A 3MMCB 2DR5A 1WEXA 2ZFHA 3KMQA 1Z2LA 4G1QA 1IJEB 1CVJA 4TKTA 2X1BA 3CB4A 3KLFB 2AJ1A 3C2PA 3HPOA 4JI4F 2HNYA 3AJ1A 2V4RA 1WWHA 4KIAA 5EWFA 1KQFB 5BJRA 2AJ4A 2GQQA 1U2RA 3S01A 4AE5A 1T94A 2OTJS 2IM2A 2E1MC 3CPWR 4Y34A 1J5OA 2CQ4A 3VF0B 2XSJB 1UVMA 3R5AA 3ITHB 4FBUA 1RT3B 1RAJA 4MKBA 1VBZA 1S9EA 1PC4A 1A7GE 4CTAA 2W24A 2A2CA 2N82B 3OSPA 1FRJA 2ZOMA 4RW7A 3SQGB 1LWCA 1N52B 3FRYA 4JI5F 5LJ3Y 3QIPB 2OPPB 5DM6Q 5B08A 1NKBA 4KGKA 2ROEA 3MEEA 3G6YA 3NNAA 2O66A 2OMOA 4OI2A 1WF2A 3EPIA 3BJYA 3DYAB 2Q6CA 1SL1A 1UW4A 2XBPA 4V19X 3BGRA 4N5SA 4RNOA 2HZCA 1JLQB 2DGSA 2FHJA 1FXLA 1J5EF 3PV8A 1SBRA 2X1GA 3AB4B 5I42B 4O4GA 2L9WA 2W9BB 3BZQA 4Q5VA 2DCLA 2NYIA 3N6MA 5L1JA 4DV0F 1VJWA 2UVUA 2FPHX 1TQLA 2E5LF 4X66F 4EFAC 3R27A 2DHGA 4A48A 4BDPA 1UFWA 4B3OB 2CYYA 3GIKA 3Q8SB 2FJDB 1FE4A 4ZP8A 1GQEA 4IFYB 3IG1A 4K5SA 3RTVA 6FDRA 5I4MA 4K4WA 3O3LA 1HNIB 5BYQA 4LF5F 5AXKA 3T5KA 4KT0C 4WE1A 1C0TB 4ZPBA 2BRLA 5B0AA 3MURP 1ZPWX 3O44A 1ELOA 1VMBA 1YIJS 5J2MB 2LMIA 3KLFA 4J9NA 1LK5A 2KDOA 1YRTA 3TYTA 3ZZUA 3N79A 2HQIA 2R2TA 4A47A 2SXLA 2UUAF 4JI1F 1R8BA 1TKXB 3M30A 1TZ0A 1JB0C 1FRMA 1HQEA 3ONQA 3BQ0A 2HWHA 1EP4A 1GTHA 1M5SA 2MZJA 2RRNA 2VG7A 3UCGA 3CTRA 4RUAA 3K5MA 2VV5A 3FSYA 1HBUA 2YKMA 4DL3A 5IT4A 1NK4A 5EX0A 4ILMA 1SB6A 4OQJA 3CCVS 5JXSA 5ITHA 4K4VA 4Q0BB 4G6VB 1FKOB 5HLFB 4LIRA 2XWXA 3IWLA 5KFRA 1RT5B 1DQ9A 4QIFA 2DNGA 1IKXB 1EETA 3QGIA 3ISZA 1VBXA 4DLEA 3VR1A 1U49A 3KLIB 3O8WA 1R8AA 3O6QA 2ZJQQ 2RT3A 4KR0B 1KSPA 1S77D 2DCUB 2Q3PA 2OSQA 2MJUA 4NA2A 1U1LA 1I6JA 2W4PA 1R31A 2WBMA 3IXQA 2LEBA 2HGLA 2JJ4D 3HFKA 1O51A 2KT3A 2N7YA