3GJTB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjtB00
4LSZB 1RWMB 2DKOB 1RE1B 2QL7B 3EDQB 4DCJB 3R5JB 2C2KB 2QL5B 1ICEB 4JB8B 3R7SB 2XZDB 2QLFB 2C1EB 4ZVSB 3P45B 3D6HB 1RWNB 1PYOB 1SC1B 2HBRB 2H48B 1PAUB 1QDUB 3R7NB 3QNWB 3RJMB 3KJQB 1GFWB 1F9EB 1RWXB 2CNLB 3GJSB 4DCOB 2QLBB 2CDRB 1RHMB 1NMEB 2XYHB 2Y0BB 2P2CB 2XZTB 3R6GB 2H5JB 1RHJB 3KJNB 2HBYB 1RHRB 2C2MB 2FQQB 1RWWB 3EDRB 2H4WB 3GJQB 3GJTB 2H4YB 3D6FB 3NS7B 3SIPB 5IC6B 2CNOB 2XYPB 1RHQB 3IBCB 2CJYB 2HBZB 1I3OB 2QLJB 1QTNB 2H54B 1RHKB 1BMQB 2CNKB 4ZVTB 3IBFB 4ZVPB 4ZVRB 4ZVQB 1RWPB 2CNNB 1I51B 1IBCB 2C2ZB 4DCPB 3GJRB 2H65B 4ZVOB 2CJXB 3KJFB 3P4UB 4ZVUB 1SC3B 2H5IB 3R6LB 2XYGB 1RHUB 5IC4B 5K20B 2HBQB 2QL9B 3D6MB 3R7BB 2H51B 2Y1LB 1RWKB 1RWVB 2C2OB 1RWOB 1SC4B
chains in the Genus database with same CATH superfamily
5DLFA 1DTTA 3GILA 4CLWA 1Q7YT 5RUBA 4KH0B 3W64A 3DXBA 1N48A 1ULRA 4MYTA 4C3KA 2VODA 4MKBA 4B3OA 2ZE2A 3IG1B 2Z2YB 5K9FA 1R27B 2I5JB 3DCAA 3T9ZA 2JVRA 3NNHA 2C2DA 1PIEA 4HH1A 5AJ3F 4EBDA 2D3OR 1D09B 4KAIA 2NZCA 3H5YA 2AJ2A 1B7FA 4HTIA 1WNEA 3HSZA 3EZOA 1RT4B 1U1MA 2GIQA 4I64A 1BC6A 3PCOB 1PCAA 5CABA 3WBZA 3DLGB 3PR4A 2X1BA 3HSJA 3NL0A 2E5LF 4LF5J 1R6YA 5C25B 4RNOA 7FDRA 1EIYB 4N8NA 4JV5F 2H5IB 2VL1A 2CIMA 1IBMF 2FIUA 3TVZA 3M6WA 3MD3A 5DG7A 4I2PA 3KG0A 1WOSA 1U26A 1M0SA 2E9RX 2XY5A 1ZA1B 1T9TA 4DUTA 3R5CA 1DY3A 2VOOA 2UUAJ 4YUDA 4ES1A 3UN2A 2OPRA 3ZZZA 3MAAA 2HIQA 3BKFA 1RWXB 2E1RA 4ZN3A 5IXUA 2CDRB 1TL1A 3DYAB 3MFHA 5HP1A 3C6TB 5CYMB 1M1GA 1X4EA 1FKOB 5K8MA 1FERA 2RRAA 4AQYF 2OELA 1FWKA 2C2MB 4UZCA 3GR1A 3MM7B 2DHXA 2R8GA 1JLQB 1IKXB 4AL6A 5IT9Y 1W26A 4KGXB 4NYZA 1R89A 2KN4A 5ADZA 4WFXA 1SH3A 2C3UA 4MK9A 3G8SA 5HI7A 4K4YA 3G82B 2Y1RI 1NDCA 2HBQB 5LMUJ 2C2OB 4RUAA 1S6UA 2LXFA 5KFAA 1H7XA 4PXDA 1DZ5A 3QGHA 3KG4A 3H25A 3PIOQ 2GQ2A 3M9OB 1LFWA 4QWDA 1M1KT 3HFVA 2RHQB 1UTAA 4IG0B 3KHGA 3HX9A 1NK9A 1SC1B 4LF4J 1CBKA 3SV3A 4DSFA 2LEPA 4R0JA 4FXDA 5JMNA 1P27B 1FJCA 1S5ZA 4DV3J 2QE5A 4IG3A 3LP1B 2AV5A 2DISA 4ZHRA 2F4VF 1VJWA 1VC6A 1FRHA 4JI0F 1OWXA 4TU9A 2FHOB 2EC2A 2QZ8A 4F4ZA 1TKTA 1WHWA 4HYKA 5BYQA 4DBQA 2WBMA 3ISZA 3MR2A 2B7BB 2Z2LA 3FEZA 3JTPA 1U2RA 2QYCA 1TUWA 1WEXA 4ZVOB 5DLGA 1FFWB 2KJWA 2ZH7A 2CQBA 3T19A 2OO4A 1S77D 1Q5VA 4C8KA 1H2VZ 2RE1A 2UVWA 5L1IA 1NH8A 4DR1F 3CJKB 1UJ4A 3JXOA 1CS4B 4OJGA 4YQWA 4RW9A 3NS6A 2LXUA 4JI1F 1F5AA 3JTNA 1R43A 2XMVA 1WHXA 2AYMA 2AZ1A 4QYRA 3T6JA 2H1YA 2OLWA 4RBVA 3TX0A 2R8IA 5L46A 1VQ9S 1RBLA 3IMQJ 3GYXB 3THVA 4R25A 4Z7CA 3L95X 4OI2A 1U2CA 5A0YA 4KBIA 1RHRB 4P52A 2F5GA 4QIVA 1CJTB 4LR8A 4NXMJ 3SYZA 3R1LA 2YH1A 4I6AA 4ZN1A 3N79A 1DQAA 1VK3A 2LU1A 2YY3A 2ZJQQ 2CPIA 2G2ZA 4P10A 2HRUA 1RAGB 4K59A 5KTQA 3IS9B 1T9VA 3JSRA 3B4MA 1TFYA 5F0WA 1TP7A 3HHLC 1AZSB 4DPWA 1ZYQA 1HBNB 2DNKA 1U25A 4C9DA 4DV7F 4CLKA 1ZM4A 4ECYA 3H4DA 3MM8B 2I6WA 2RDIA 2ATCB 4XDDA 1C1BA 2BKNA 3C46A 3GCWP 5CYJA 5AXNA 2EK1A 3J7Z5 1N52B 3A1YG 3DLKA 5KFTA 4ZCMA 1VQ5S 1U49A 5IM0B 2F3JA 4XIUA 3C14B 3VAFA 5A8RB 5DDOC 3R27A 4NMLA 2CPXA 2MKJA 3KLIB 4OZJA 3GR0A 4DV2J 1PILA 3KK1A 1W2IA 3F56A 1NJWA 1YVFA 5K5MA 2Q43A 2UXCF 4DR6J 1YSJA 5IC6B 1I5OB 1JLGA 1S0MA 3KLGA 1S4FA 3W61A 4EWTA 3V6HA 2Y9HA 1RWPB 3DGPA 4RUHA 2C2ZB 1NSKL 4RNNA 5C42A 2XGPA 3GYGA 4PG7A 4WYLA 4J91A 4LF9J 3CCES 1ZBTA 4N56A 2ZH6A 1PC5A 4KB7A 4QJVA 2C2KB 3MURP 4QYZK 1TQLA 2BABA 3M8SA 4IH5A 2L41A 8ATCB 1QAJA 2QA4S 4B3RJ 2C28A 3RJMB 2RQ4A 1LW0A 3VALA 5KG3A 4ES2A 4JI3F 4QPTA 5DGBA 1RT6B 1SIWB 5KOXA 4Z37A 2OSQA 4DL3A 2IM3A 4UZBA 1B0PA 3PRVA 3Q8RB 1FDDA 3QWUA 3DKDA 1RAEB 2BJ8A 2CPEA 5FDLA 2K06A 2XLKA 1VRUA 4NXNF 3HF5A 3G86A 2F63A 4WU3A 2CNKB 4YHHJ 4CI0B 5GMEA 3QRRA 1NHVA 1WC3A 2AJQA 3Q22A 1WTFA 3DDKA 3FMWA 1RB0A 1RWVB 4ZLPA 3NGDA 1HPZA 1N6QA 3ULHA 4YDXA 3WQPA 2AGPA 3RAXA 2DPJA 1C1CB 2CFXA 2MQLA 3EUNA 4ECXA 3DRRB 4LF4F 5HLFB 2XHCA 1RA6A 3SQGB 4LUBA 1HR0J 2E7VA 1RAAB 4UOHA 3DHXA 3OL7A 4PWUA 2VASA 3MOZA 4X4TA 2JSXA 1QM9A 3PV8A 3FRYA 1T3OA 3KK2B 1VQ8S 2B3TB 1Y9OA 1OPZA 4DQQA 3NGTA 1MNEA 5AE1A 3VCDA 5GAGI 2YKPA 4NLGA 2AX1A 2LA6A 4GKJF 4B9NA 3IG1A 5HVGA 2MB0B 5H9EJ 3S6EA 4DR5J 2I5JA 4S0MA 2BKOA 4W98A 3WZ0A 2N82B 3HHEA 4KGVB 1LV5A 3OJSA 3FQKA 3Q8VA 3CMQA 3AOCA 1WC6A 2BRLA 2VDHA 3PW0A 5BR8J 1RT4A 1Q82T 2EBEA 4I6YA 2HRTA 2M52A 5CH7B 3VZHA 1T7PA 1YIJS 4L74A 3IO1A 2GS8A 4IR9A 2LFVA 5HATA 4FYVB 3I96A 4YB7A 1FX4A 5GADI 3CD5A 1XK8A 2F8EX 3VZIA 4PZVA 2OIHA 1U8SA 3LGNA 3DRPB 4A46A 2FLNA 3V81B 1P9YA 2ZWPA 5HO4A 4RNHA 1U48A 4Y2KA 3RRHA 4FS2A 1TELA 2UV8A 2DGUA 3JB9k 4CP5A 5KAKA 3UDCA 3W7BA 5EWGA 5IQ6A 3AT1B 1D0EA 3DYAA 4J9MA 2EI5A 3ZNJ1 1HLWA 2QL5B 3DDNA 5DZ6A 3J80Y 3J7A1 2J7UA 1T9XA 2RIJA 1NNDA 5JJBA 2FJBB 3MM7A 2AJ0A 4WK1A 2ZH5A 2V94A 4XPEA 2EFVA 2YWKA 1SQGA 3M4XA 4OIXA 4NA2A 2HFOA 3L7OA 4DQSA 1ZPVA 4EUVA 3G82A 1OYEA 1SVDA 4WFBQ 1CULA 2LEBA 2BYCA 4WTYA 1C0TB 1K73T 2BXJA 2RT3A 3ET6B 1MN9A 3NCRA 2P9CA 3NOCA 4FKXA 3FBFA 4IG0A 2VF3A 1RYRA 1WSRA 4QOTA 1S1WA 4FBTA 1AW0A 2XS7A 3C16B 3VGTA 1RXOB 4EYHB 3E2EA 4RPFA 3EJMA 2RILA 4LT6A 4H4MA 4NZ6A 3CULA 2PMHA 1FCAA 3BGUA 1V9OA 2RDDA 5A76A 1D8YA 3OTDA 2KHDA 5KFJA 1CQNA 4G6VB 2I2YA 4F4WA 3JSBA 1D9FA 5DZ7A 2LA4A 4CT8A 3VR1A 2WHOA 1AUDA 5K14A 2KU7A 4ZPDA 1WHVA 1LWFA 1YJTA 4O44B 2QLJB 1Y00A 3HHDA 4LQ3A 3K0JA 4N7TA 4DCPB 5HMXA 2AF6A 1V5VA 2QLWA 2ZKTA 3EPGA 4ANEA 4QBUA 2W2NP 2UUBF 3KUHA 1B4SA 2MZJA 4P75A 1TR0A 5E3RA 1HHTP 2CJAA 1XMOJ 3UNGC 2N7CA 4UOCA 4ZP7A 1SH2A 1YRTA 1FDBA 1WKJA 3H2VE 4WJBA 2VQFJ 4A8FA 1NEEA 2WONB 3N4WA 2IA6A 4LQ9A 1YI2S 3I87A 2DGTA 4DL5A 1UFKA 2HS4A 3ZNUA 4CLLA 1NMEB 3V5RA 4K4TA 2XYHB 2YWHA 4U95A 4QZVB 3RU0A 1S4EA 1UJ5A 4Y2IA 4USUA 4C8OA 1WORA 3FFIA 4K50A 4DX7A 1NKEA 3DLEB 2WOMA 3DRXA 3FCVA 4XO0A 4DOZA 4DX8H 2VH7A 4JI8J 1XNQJ 2CZ9A 3O2IA 3OSNA 2HS0A 3MM8A 1VRTB 1FVQA 4JI7J 3RW6A 3OSPA 3E51A 4LF8F 2BQ3A 4WK3A 2ZBIA 5IM0A 3DC2A 2EC0A 3OJUA 2VG7A 4WP3A 5KFHA 3CB4A 2MKSA 2M8DB 5A8RA 3PEJA 2L9DA 2BJ1A 4PABA 1JKHA 1SPBP 2HHUA 5KG1A 3UO0A 4XTTA 3TJ9A 3E01B 2N4CA 2FJXA 3NAHA 2YKNA 1GFWB 1GQEA 2YNHB 5MLCV 3PNIA 3QATA 1KFSA 3TAPA 2Y3YA 2V69A 1NM2A 1T9WA 4NRUA 1U24A 4OHYA 3SSSA 3KMSA 2RH3A 3AQOA 4HHJA 3QZ7A 2XYPB 2OKQA 4BWMA 2HHTA 3EGNA 5GMDA 2P5VA 3EZUA 1FNOA 1S97A 4DWIA 3CMES 2HWIA 1YWXA 1HQUA 3N6MA 1RAJA 4OZNA 1SJ4P 1QD1A 2K1RA 5KFKA 2AZ3A 3MEDB 3PG9A 1UVJA 4E8UA 2WVFA 4F04B 2QEXS 2XYGB 5C24B 4ZPBA 1D8ZA 2YWEA 5DGAA 1O51A 3CDAA 3FSIA 3HVTB 2VFVA 4LSZB 1RT6A 4LIWA 3BREA 3TAQA 1S6QB 4G3IA 3HHLD 1KDNA 1RCXB 3CO9A 2W9AA 1HHSA 3R7NB 4ZK7M 3Q23A 2OMOA 2R42A 3MM6A 2ZHOA 4LREA 3G6YA 3KJVA 4FYWB 5IS2A 4NLUA 4JOUA 3PVXA 3L4BC 3AA9A 1KD1T 4BBYA 3UCZP 1A6LA 3OR2B 3UN5A 3QPIA 3FBEA 5D6GA 4ECSA 2JH3A 4USIA 4LSLB 1JJ4A 2R2UA 2MZSA 4FZVA 3PX6A 1G7CB 1F5CA 5CAAA 2HNDA 2RQMA 3O1LA 3T6BA 2CG8A 1C1CA 4ILMA 3TOQA 2W2OP 5IWAJ 5DETA 2VQEJ 3MPDA 2C22A 3I5BA 4DF8A 2UUWA 5ETSA 2IBKA 3M6XA 2M3DA 4Y2MA 2NSCA 2AT1B 1RKIA 4ED6A 3D6HB 1U1QA 3MUMP 3NWGA 1V3ZA 2H48B 1QDUB 3UDEA 1HWIA 2GVZA 2IA0A 1SBRA 1RGVA 2GIFA 4CYUA 2AD9A 4OX7A 3I55S 1DJ0A 4ITSA 4A4JA 3I0SB 2ZH3A 3ELHA 3FUYA 2CJKA 4JI2J 2R4FA 2UP1A 4LRFA 1UEVA 5F8LA 3R6GB 1ZA2B 1G3OA 6FD1A 3CE8A 3LF0A 2C2RA 5LJ3Y 4ZLNA 2CNOB 1QUVA 3D0GE 3TAMB 3IGVA 1VFJA 3QAUA 4I56A 2UVVA 2D41A 2JC1A 2KB2A 1YK9A 2YNFA 5B08A 2LP4A 5DQIA 2G0JA 2AGOA 3F44A 2GVDB 2F9JA 4JV1A 4DUYJ 1IM6A 1UFLA 1OSDA 3TRGA 4F0HA 1QAYA 2ZBQA 2C3PA 4DFMA 1IBKF 5D4OA 1YJ7A 3OTCA 5JUMA 1JJ2R 4LSNB 1X60A 1FE4A 1NLKL 1VR6A 4QR1A 1BQNB 1A9NB 4DN9A 5KFBA 1ZH5A 4A8YA 3D3CJ 5LT5A 4OL8A 1EB0A 1Q78A 2A18A 4ED3A 1UEKA 5F8HA 4OZ0A 3HT3A 5J2NA 2UXDJ 3IM9A 2PN6A 4IRCA 1BQMB 2YWWA 4PYDA 2V0NA 1DBDA 2NZ4A 3HJFA 3NS7B 2GZOA 4YR0A 1OJ4A 4DN0A 2RMLA 2FJWA 1DAXA 1XNQF 4MKVA 2IYGA 2L9NA 1YX2A 3OL8A 4OYPA 3OW2R 4OYAA 2R7SA 4CLTA 1MW7A 4KKOB 5L1LA 2QN6B 2KFNA 5KFLA 5EUHA 2W25A 4O3RA 1JLFB 5KFSA 2WSFC 4USVA 4QIGA 4YEAA 2HQIA 4M5JA 2W8LA 1WWHA 2VPYB 1KFDA 2NLWA 1FEEA 1B99A 1RI7A 2EFOA 3D54A 3CJ5A 3VGSA 4JI6J 2HS3A 3KXDA 5B09A 3ET6A 3LALA 4DQRA 2M5YA 4OJ3A 4OYZA 1R8BA 4ENOA 1P1TA 2AHOB 3POTB 4U7CA 3CIMA 8RUCA 4U8VA 1Q1KA 3NRBA 1VC5A 2XULA 1VC0A 2R7WA 5DDQC 4M63A 1RT3B 3C16A 2NXNA 3BH6B 3ZZOA 5LXRA 3T5JA 5CQGA 3PHTA 4NPOA 2D9OA 2Q3PA 1HNZF 2WVDA 5D77A 4DR3J 3ITHA 3ZXWA 2DK2A 4J90A 2CYYA 2HHHJ 3P4UB 2CJQA 1DARA 2WW4A 3VAKA 2CKWA 4R5PB 1SUQA 6AT1B 3IRWP 1ITPA 4DPOA 3TZYA 1N5YA 3MEGB 2Y1LB 4C6AA 3MCOA 2ZBRA 4UY85 4DCJB 4HDGA 3D0HE 2YKAA 1LXNA 3VF0B 4NCGB 4EZ9A 4J9RA 3U1LA 1RAIB 1YJUA 1FKPB 1UWBB 3CCJS 2VG5B 1BHNA 3ZZUA 3H5SA 4PG6A 2DB1A 3K17A 2NS1B 1VQYA 3QT5A 3LP0A 1Z1ZA 3IRXB 1N0VC 3BSAA 5HROB 5ETMA 4LFAJ 3GIRA 4OI3A 3PDNA 4NOHA 2FVPA 4QU7A 1NCLA 1T11A 1SL1A 2CAJA 2LEAA 4OI4A 1SI9A 4M5IA 3JQMA 3NAIA 3TUIC 3IBFB 1SCJB 4HHUA 2V8PA 3AJ1A 2EK6A 3OD2A 1EQ0A 2XCPA 4N77A 3IR7B 5DM6Q 1FT8A 5KG2A 2R9LA 1QSSA 5LJ5Y 2V5HG 2ZVIA 2APOA 3E8OA 5E3PA 2ROGA 1Y0HA 4X2BA 4PUOB 3UPFA 4C7QA 2H3EB 2XM3A 3EDQB 3PW4A 1FJGJ 2VQEF 4DV0J 3R5AA 1I6JA 1S59A 4NLXA 3RB6A 2K8GA 1RTIB 2FVQA 5KG0A 5CHCB 5KT4A 2RUSA 1B0TA 2VKRA 3Q8SB 3GV8B 1NK4A 1N34F 4TVAB 2WSCC 2J0SD 1K1QA 2DRDA 3E3XA 1IKWA 1EQMA 1FVSA 3V6DA 3LWLA 3W5XA 2L48A 3MGJA 2XBPA 2EEYA 3FRZA 5DS7A 4DV1F 1N56A 3E01A 2ZVSA 3M2UA 4DR4J 2X3DA 5AXMA 4OX9J 2RF2B 4J9LA 3QGGA 2LCWA 3CCUS 4I69A 2MZ1A 2BOAA 4KT0C 3G71S 3KLVA 2A3JA 3CDEA 3N28A 3M9NB 3QBCA 2XEXA 3Q8UA 1WI8A 4WXWA 3HVRA 2D7SA 4ZVSB 4OYMA 4G65A 1S7IA 2BANB 1L3SA 1UVIA 1XN9A 1PYSB 2EG1A 4FYYB 3VAIA 4QQBA 3RBDA 4R8UA 3MEDA 3GMGA 3MTKA 1EHWA 1RT1A 3W9IA 3DMJB 2NXEA 2DNQA 4WKYA 1ZZNA 4UQGA 1XBWA 4MK7A 1SKWA 1VQSA 3BJYA 2M2BA 2J8SA 2B4OA 2EG2A 1LWEB 3BYPA 4X62F 1IKYB 4RL1A 1HNXJ 1APSA 4WE1B 5KFZA 1HNWF 2BUNA 4ZPAA 2HBZB 3UDLA 3A8JA 3W62A 1NJIT 1EX8A 2AYGA 3QFHA 5HMYA 2U2FA 2YWFA 2O5DA 3MAQA 3MCMA 4AL7A 4Q0BB 1CJKB 5T7LB 3TYTA 4P7VA 2VZ9A 5E3QA 2IVMA 3W2WB 3IAS9 2YQ0A 1FJEB 2NREA 1HWKA 1S48A 5E3AA 4OYBA 1SJ1A 2XC9A 3FGVA 2OD4A 4I2QB 3L9ZA 2F9DA 4P6QA 1DRZA 1U1OA 1PAUB 2W2PP 4KHPF 3MMBA 1FJ7A 2DYAA 4FYDA 5D15A 4TXSA 2ACYA 4LSLA 3U27A 4JI6F 3GU0A 2HIYA 2ZH4A 1HD1A 3KLHB 2DGQA 2HQGA 5J1EB 1VQPS 4LBIA 1TKZA 4OI0A 2A6OA 2LLZA 2V4JB 2E1CA 3CJ8A 2C2NA 3C2PA 1S1UA 4KQZA 1KSPA 2FC9A 3M8ZA 1RTHB 4K5RA 4AXIA 3MPYA 2CVIA 3CW2C 4ETZA 2RB7A 2EKNA 3MEEB 1RACB 1LK7A 3QSYB 2BW7A 2L08A 3I0SA 1CSJA 3IR5B 2JC0A 4A8SA 1RAHB 3IWXA 1SC4B 4O4GB 4OHWA 2Y0SD 1IR0A 3THTA 4H4OB 2BE9B 3R8YA 5FIIA 9ATCB 2YNGA 3NS5A 3QNWB 2HYIB 5GAGU 5I42B 3W8GA 4J9OA 1FE0A 3FZ2A 1RTZA 1F6TA 4WFYA 1XMBA 4X66J 2R2SA 3FVYA 5HVHA 2W2QP 1PBUA 4OZ2A 3J7ZT 1MSWD 4RWXA 1FD2A 4WKRA 3JQKA 3C8YA 1YRXA 4Q43A 2UUCF 2RNEA 3NCQA 5AT1B 5IZHA 4J9KA 4F0MA 3SDEB 4LFAF 2RD5C 2IAJB 3A8KA 1E6YB 1YZ6A 4LSNA 2MDAA 5EX3A 5KT5A 3TVYA 4V19J 5KFWA 1BQNA 4KIAA 3DI6A 2R7UA 1FRJA 4KGKA 3JSMB 3AAWB 2OD6A 2H5EA 4K0KJ 2DRBA 3UVJA 3KLEB 1N32J 4OYIA 5GAEU 4DL6A 2DNYA 2IJRA 3ILLA 1AT1B 3R5JB 4DQIA 2RKIA 3QMQA 3T9NA 2MKIA 3VAJA 1Q8BA 3UI3A 1SH0A 2QRRA 3NMRA 2W9CB 1OQ3A 3H2UB 1RLCL 2B5JB 3NGKA 4DPYA 2BVZA 1XNRJ 4IQMA 3IWLA 2A0FB 3IBWA 2IHR1 1HBUA 2BQRA 4X4VA 4AE5A 3HT0A 1R8HA 5B0GA 4U7UK 4KKOA 1YG0A 3UR3C 1JJHA 4UTGA 3UN3A 4DPUA 5DO2A 4GC7A 3K8VA 1X0PA 2RDJA 1SJRA 1JLFA 1GNKA 4LFCF 3Q0AA 2BM1A 4C8LA 1Q86T 3RB3A 3RBXA 4LF7F 4O4RA 2J0QD 4YB5A 1NRKA 2D9PA 3EM1A 3CCRS 3DLBA 2FVCA 3BM7A 3DRSB 4DR4F 2KTQA 3PIPQ 2D3O1 3CSKA 3POTA 1RA7A 1KHWA 2E44A 4DFPA 3W8PA 1SKRA 3G2XA 4EEYA 1NPKA 3MR7A 3UD3P 3TJ8A 1FXRA 3I0RB 3W9HA 2UXBF 5FD1A 3T3FA 2DD8S 4J9PA 4GKKF 4F25A 3KYLA 1RAOA 4CRJA 1T03B 4EO6A 2FC8A 5HQLA 1NHKL 1K0TA 2C42A 2Q6CA 1SV5A 3HDSA 2MJUA 3P5BP 2UV8G 2XO6A 2EWHA 2WZ1A 4X4NA 3S01A 2Z8QA 4HHHA 1QJHA 1SC6A 3MEGA 3PX4A 4ZLLA 2C3MA 3ZZ0A 3D2WA 2CQ0A 1NK0A 3KNAA 3BO2A 1R6VA 4WIIA 1I3OB 4KV8B 1NJZA 3W5ZA 2F65A 3F41A 4EO8A 2YPZA 4NCGA 1FKPA 1UWBA 2R2TA 3MR6A 2XI3A 4OZLA 4K2XA 3U02A 2KXFA 1GTEA 1VQLS 5AJ3J 3IGNA 2V2KA 4B3MF 1F5BA 4YOEA 4F4XA 2X51A 5HROA 3QIDA 2C1EB 2W7AA 1TU0B 1WOPA 1UCNA 1X4AA 3R5GA 1QAIA 3GSIA 3NGRA 2YNIB 4ZJOA 2L3MA 3MM9B 3EXCX 1UMJA 1TKDA 2F4FA 2E5LJ 1N36F 3C6UB 4ELVA 4MFBB 2DVIA 3X1LB 4JI4F 4ECTA 5A8WB 4JV5J 1U8WA 3A3PB 3LAKA 1XR6A 4JI5F 4L76A 4WIQA 1IJFB 3CD7A 1LFPA 2ZKUA 3CDBA 3OUYA 3IFEA 3FDSA 3QZ8A 1HIYA 4UQTA 2YKOA 5JVHQ 3KJFB 2E9ZA 2W9BA 1NK8A 3HD1A 1HNIA 1XWLA 1RTIA 3J81j 3DLJA 1S0VA 4RBUA 3DLLQ 4RW4B 4CH0S 2YBVA 2CWXA 3RRKA 3QJLA 3EGZA 2EVZA 1T8EA 1U6FA 3BGFA 1NXIA 3P49B 2DKOB 2EKYA 2F7VA 3DLHA 1VQ7S 1ZM3A 1PJ7A 3TA0A 3CIZA 4X64F 3ENAA 1TZ0A 3PEHA 3MPWA 2OAUA 4O3OA 5E41A 4KFBA 5E3CA 2VPZB 3BV8A 3TARA 4DF4A 1XR5A 3DDIA 5HANA 3TX8A 1YGYA 4PEOA 2XZTB 2CWKA 4MIBA 1V5IB 5JVGQ 4F8RA 2V34A 2JFKA 2M70A 2IM0A 1RABB 4OX6A 2LQ5A 2QSFA 4DSIA 1WF0A 3PO5A 3UE2A 3V2UC 3OXLA 2FTRA 1F60B 5A8KB 4KYZA 3CXCR 3BSNA 1S49A 1RT2A 3BPDA 4I67A 4Y0FA 4RZRA 5EGYA 3O5TB 2XZWA 1S9EB 2GAHC 1HARA 3PW5A 4RNMA 2N4DA 1YJVA 2VUGA 4ED8A 4M5KA 2HZCA 2M8HA 3LQVA 2OEKA 1G4CA 3CDWA 3ETMA 2HVDA 3GB0A 1KHVA 2F4VJ 2DNPA 4K0KF 4QWAA 3TUPA 4JI0J 4UF4A 2VJVA 4Q7AA 4TN2A 1YJNS 2VA3A 1F2HA 1KQGB 5HQ8A 1EAYC 4DZDA 4KH1B 3LGHA 3GYNA 4ZIWA 1IKYA 5HQMA 3M7VA 1ROFA 1WC1A 4WE1A 3FCHA 3LWMA 1OY9A 4DFJA 5DG9A 1RQ0A 5L9NA 1FDNA 3W2VA 1WACA 2OSRA 2GQCA 3NBPB 2DIUA 1SKSA 4Q8EA 2KH9A 3TUJC 5F8NA 1S10A 4A8MP 5D0EA 4C0OC 3T5HA 2IYIA 1EZZB 4Q0BA 1CJKA 3PM9A 2ERRA 3W60A 2CQIA 4JYAF 1TK5A 1R31A 3W2WA 2HMIB 4B3SF 3M1VB 4HI2A 4DG1B 1V6HA 2DNNA 1HD0A 4DR1J 4I2QA 4ZVTB 1JLBB 2MKYA 5ETQA 1H72C 3WX8A 5B0CA 4QIFA 4K7QA 1L3TA 4M1KA 4JI1J 4ZCLA 2JJ4D 1NH7A 3M2VB 1URNA 1A0OB 4JV0A 3MMCB 3FEYB 2BJ9A 1Y11A 3HZGA 4C11B 3GFYA 4N8OA 3R5BA 2FY1A 1GAOA 3FZBA 2AJ4A 1IQTA 2MEWA 3KLHA 3GPAA 5J1EA 3Q89A 1BD6A 3SI8A 3R5DA 2WVCA 2HGLA 3DOLB 1TL7B 1TUVA 2V4JA 1RU1A 3WHIA 4PWDA 4F0KA 1FO1A 2AIRB 4TLRA 2ZH1A 2VA2A 4DCOB 2PFFB 4ZPTR 4O23A 3PHEA 4X4QA 4P7TA 5KG5A 3H4BA 4H4KC 2DR8A 3RBZA 1HMVB 3OT9A 2MQ8A 2HQCA 1IUJA 2LQ9A 2PGCA 2H4YB 5C2GA 2Q79A 2DNHA 1S6PB 2ZDPA 3OQ2A 4BLGA 1YRUA 3J7YU 1LKZA 4QPXA 2N3LA 3DOKB 5CZVA 3FBCA 3KUGA 4DV7J 1YJWS 2VKZG 1JNZB 4H4OA 4C3MA 4K2JA 5I3UB 3LA0A 2ROEA 2Y1JA 4ZPVR 5HN0A 3L7UA 5D78A 1CJUA 4F3QA 3R2DJ 5E5NA 4F2RA 2OHDA 3SBMA 3BGRA 2FHJD 4ED0A 1FF2A 1RE1B 2XNQA 1FRXA 2BR0A 1SL2A 1J5OB 4IFYB 1HYSB 5EN1A 4HI1A 2KFZA 3BZQA 4Y6IA 1WEZA 2QTWA 4HLBA 4AD6A 5I3PA 2DJWA 3CWJA 2XY6A 2UXCJ 1BE4A 2DGVA 2IAJA 5KFOA 5F8GA 2BX6A 2VC1A 1E6YA 4QR0A 4IOAQ 1P9QC 4USKA 3MR3A 2XLJA 3N9UC 2IC3B 2HHPA 4ZP9A 2GC8A 3PKMA 2ROPA 2VV5A 2PSZA 1VDHA 2P2CB 5AE3A 2J9DE 4HACB 3JSMA 2RUGA 4FKYA 3CCLS 3CC2S 3S7RA 3WC2A 5DG8A 4CTAA 2CJBA 5T14A 2MY8A 1JX4A 1WF1A 4NZ0A 1IKVB 1S1TB 4OYXA 3ZZYA 3R3TA 1AXQA 3OXGA 3G4SS 2KZMA 1QSLA 2YQ3A 1WC4A 2W9CA 1MG7A 2B5JA 3MR5A 2HQFA 3NEKA 2XB2D 5LXYA 5F8MA 2GJIA 4F02A 1HQEB 1Q4RA 1RT5B 4JI3J 2AYEA 1Y7PA 2JDJA 3AOAA 3M30B 4CCHA 2J9DA 3FC9A 1OYDA 4H4KA 2ASYA 3N01A 4ECUA 1T94A 4NXNJ 3AB4B 1NB2A 1FRKA 4TY8B 2Y8YA 2JRSA 3QQCD 2GO8A 2XI2A 4F67A 2QMUB 1GEHA 3DRSA 2VJUA 2SXLA 2AP6A 4MIAA 3LANA 5L39A 5LSOA 2O01C 4LBPA 2IRYA 3JS9A 5HAOA 3Q86A 3HSDA 2FJVA 3MOJB 3M2RA 1NAQA 2HNZB 4FF1A 3RB4A 3R9LA 1I51B 4FPIA 1CEZA 1YKWA 2B4PA 1VQ6S 4IO9Q 3AJ2A 1KRPA 3NCPA 2XMAA 4HKQA 2CADA 4HVZA 4LVNP 5D3GA 2GHPA 4RW7B 3MMAB 1X5SA 2GA7A 1HI0P 1WUUA 1A7GE 1XERA 1GXUA 2XMWA 4PG4A 2QLFB 3VVUA 1RWNB 2GGPA 4PPZA 1XC9A 3K5PA 1MROA 2PDAA 1Y5IB 1F9FA 1S12A 1FX2A 4DU8A 3GIMA 3D1QA 4PQUA 3CC4S 1C4CA 2AW0A 1UA1A 2RVJA 2MQOA 3NMAA 1VLYA 1IBLF 4J5OA 4GKJJ 4NEYA 2HG4A 3F73A 1WD6A 4UW2A 2ZD1B 4LRDA 1LW2B 3AB2B 3H20A 2OP5A 2CQDA 1S1XA 1J27A 1LK5A 3HKWA 2MLZA 2BJEA 3RRGA 2ILYA 1K44A 4DR2F 5KG4A 4PG8A 3GCXP 2MHEA 2OTLS 2C3OA 2V2ZA 3EVWA 1LWCA 1JLCB 4FS1A 3HJVA 3MM5A 4FVMA 3MTJA 2WW8A 3C6UA 3UQSA 1Q81T 3IA0A 4MFBA 2CA9A 3FEXB 1QE1B 4DL7A 4RU2A 4ID5B 2HVEA 2OPQB 1B3TA 2UU9F 5L1KA 4NWBA 3R1HA 1PJ6A 1MWZA 4U6PA 4GVBB 2QX0A 3BBFA 2ZZNA 1H98A 2FZCB 2G2OA 4OYOA 2MLYA 5DQHA 4IDKA 4NLRA 3TEGA 2WB4A 1T02A 2FZGB 1R0CB 4RW4A 2Z58B 3TA1A 3ISND 2HFNA 5CD4H 3CPWR 2P9EA 3O3LA 1IBCB 4DSEA 4N41A 1JXLA 3KNGA 2ZUGA 3AHPA 2G2YA 2ZE2B 2VPXB 1SJQA 2KYZA 3AQPA 4JP8A 1REVA 5K8OA 1HI8A 1F3FA 3CEDA 3QAEA 3Q24A 1SL0A 2AEFA 2QGFB 2QLXA 2XZDB 3HXMA 2EFPA 4QYZJ 1B0VA 4B9LA 1HBMB 4WXOA 3D28A 2NYIA 2MSSA 1KC8T 4MAKA 2KVIA 1RT7B 5A8KA 2BA9A 2BBEA 3TI0A 4HT7A 4OYWA 4TYBA 1AFIA 2NR0A 5G4DA 1LXJA 2CQGA 4F36A 2QT7A 1Q79A 1B70B 3GTYX 1H2TZ 3T1HF 2IMWP 4ZJQA 2V9WA 2GQQA 4I2PB 2BQUA 3M8PB 4DDFA 5HMWA 4K4SA 2H54B 1LOUA 3EE3A 3KFWX 3MPVA 2PA3A 1H7WA 5E33A 2OFGX 1MU2B 3OR1B 4TU7A 4YY3F 2KDOA 3QO9B 2KO1A 1C2PA 1DLOA 4W4MA 4B9MA 5K20B 2UVUA 5D4LA 3P3DA 4Y65A 2QL9B 2Y8WA 2VBWA 1E6VB 1Y10A 2CPDA 1S79A 1UVMA 3I56S 1TL1B 5DJBA 4Q44A 5HP1B 3BN4A 1BLUA 3QT7A 1RK8A 2HLTA 1TAUA 1ZAWA 3M8RA 2ADBA 1JIHA 3B4DA 2HMIA 3ZTPA 3M1VA 1X5PA 2CZVC 4UY8T 4DG1A 4FP9A 4IUFA 3BQ0A 2PC6A 4NE9C 2ZWOA 2VC0A 4LIRA 1K0VA 4XK8C 3HHLA 2KG1A 4FXWA 3PO4A 2D74B 4WPAA 2JLEA 3IAM9 3Q8YA 1TV6B 2MKHA 4JBCA 2PMZD 2UUBJ 3MMCA 2NUHA 4C11A 1H3DA 2FHKA 3GZ7A 4GVLA 3KLFB 3W1YC 2CQ1A 4YS2A 1D3WA 2OH2A 4DV4F 3QRPA 4P9SA 3L7PA 2W1BA 3DOLA 4CWBA 2MPUA 3PYGA 4NLWA 3GV5B 2NSBA 3QLHA 4ZPCA 3EICA 2VPWB 2MKCA 1REGX 2A6MA 4IYQA 4KHMA 4IG3B 3EGVA 2OPSB 5MAOA 1RAFB 1EARA 5A2QU 1HMVA 2M7SA 3OTEA 4NX9A 4WZMA 3PFEA 1MMNA 1TKTB 1PC4A 1WHYA 2FGOA 1OSCA 3C15A 2HNYB 3EWGA 3DOKA 4ANCA 3AXKA 1LWXA 1TL4A 2GW8A 3BSOA 2QJ3A 2PT0A 2XMUA 2FPHX 4WYWA 4J9NA 4UOFA 1JLAB 3SSQA 4LF8J 2HBYB 1PO6A 4P72A 1FHTA 2YX1A 2J9CA 3CDUA 4HH0A 1OIAA 1NHUA 5A2QY 1Y5NB 1RHQB 4NLSA 4ICLB 4B3TF 4X4SA 3L3CA 1X8DA 3BQ1A 4P71A 1ZPWX 1J5OA 2DNZA 2CNNB 3PJ9A 2OUGA 5HJXA 4X65J 3NGSA 1SC3B 4NLPA 3A4TA 1QTMA 2Z30B 5KFVA 2HSEB 1KKHA 3CJ2A 2IM2A 3PX0A 3DLGA 3K2YA 5THWA 4NLYA 4J9QA 3A13A 3H7HB 4LRAA 4EFAC 3HULA 5DDRC 4Z2XA 5C25A 5J2QB 2QFIA 3IC1A 1JB0C 1U09A 5GAEI 2EBGA 2HAFA 1VQ4S 2YH0A 5M2RA 2E7XA 1IKVA 1S1TA 1WSVA 4BWJA 4HL9A 4ZIVA 2JEGA 2QC3A 4KPCA 2H5JB 5KFGA 4ILLA 4M5NA 2A2DA 4MTPA 4CM0A 1N33F 4IO1A 1JXVA 2ZH2A 5CZXA 3JTOA 1NDPA 1HQEA 3HP6A 1RT5A 3SIPB 4ALZA 4NASA 2EFNA 2FJAB 2PI4A 3OTOF 4YB1P 3M30A 4AT1B 4MYUA 3EZ5A 1S0OA 4WBFA 3C6TA 4DQPA 2IDLA 5ITHA 5CYMA 3GJRB 3TQ1A 1FKOA 2XHWA 1C1BB 2BMBA 4ERDA 5KG6A 2J7WA 2A1BA 1JLQA 5ETVA 3RYLA 1IKXA 4TY8A 3K5MA 1KP6A 2IJFA 4BHQA 3B54A 1Q0NA 3GWCA 4E0DA 1GXLA 3PJWA 2IRUA 3VQSA 3G8TA 3KKFA 3K58A 4YP3A 4RUBA 1WKLA 2QYGA 2MQNA 1HKAA 2FDNA 4TQRA 4LR9A 4DS5A 4IRDA 3I5CA 4NLTA 2FD2A 2HVHA 1MWQA 4DL0C 4I4BA 6FDRA 5E2QA 5LMNF 1S7HA 4PR6A 2LMIA 3JQJA 5J2PB 4DV5F 2J5AA 2ZFHA 2ZC3A 4RW7A 1DURA 2V68A 3QGPA 4C0HA 3LP1A 2EFGA 2MMYA 2E7WA 1X7VA 2AJFE 2BV3A 1SIZA 4IQXA 2G1DA 2J7KA 2YX4A 4V19X 3CCSS 3PRBA 4ES3A 1VBYA 2M0GB 1K9MT 2Q1LA 4HTJA 1TL3B 3LTOA 4EZ6A 3CJSA 4G1PA 2R2RA 4BS2A 1PJ5A 2MTLA 3AOBA 3CD6S 1G2EA 5DDPC 3MCNA 1Y3KA 3EPIA 4DL2A 3FNNA 4Y3CA 5I3QA 5F0UA 1LW2A 4P2SA 3RW7A 3NLCA 4MK8A 4W92B 8AT1B 2VONA 5FDLB 2E1AA 2DHGA 4FXVA 3CJTA 1OO0B 2U1AA 4DSKA 3CJKA 3RR8A 1CS4A 2P9GA 1YTYA 4OLOA 1CC7A 4D3HA 1GMUA 3CO0P 1JLCA 2CDQA 5D0HA 1QUPA 4KPYA 3GJTB 2XGQA 5F3ZA 3QT8A 3DXSX 1QE1A 1IBKJ 4WFNQ 2OPQA 5SZTA 1NK6A 2DIVA 3ZO7A 2GX8A 1RTDB 2GJFA 5GAHU 3G96A 1ZTWA 4IH6A 1VGYA 1W2BR 1CJTA 2A10A 1J5EF 3M32B 3VWSA 1ICEB 2JEIA 5E7OB 2B43A 2DT9A 3CJ4A 2LQBA 2IRXA 3OL9A 3TA2A 3IS9A 1ZAVA 3R2CJ 5DM7Q 3OBIA 3US5A 1AZSA 1F9HA 1IXKA 4F4KA 3DM2B 1HBNA 2COLA 4OMFG 2NXCA 1XMQF 5KOWA 1CVJA 2FUG9 5A6WA 2OJ3A 1R8PA 2FQQB 1KVJA 1PYTA 4C8YA 2FJEB 4CLUA 4ER8A 4YN3B 2ZOMA 3V6KA 5KG7A 1XJWB 4NL5A 2PEBA 3C14A 1U1KA 2CQ4A 1HBMA 2FLLA 3KLIA 1Q8KA 1DTQB 3QRQA 2DH9A 4LVOP 2RHSB 4X65F 2MLXA 4KY3A 1RT7A 3T1YF 4X84A 1M5VC 1UPPA 1NU4A 2V4RA 1JWWA 1VQNS 4F4AA 3UCGA 5A6PA 4CT9A 3OTBA 4EGLA 1JNRB 4CLZA 3G6ES 2V8HA 3HMJG 3H42A 1KBRA 2XS5A 3KDNA 2GCFA 4L3KA 3CT9A 3GONA 2LVWA 1RKJA 3M8PA 2KRRA 4DLEA 1UVNA 1HNZJ 1RCOB 5IT9U 4CLYA 1V3RA 1MU2A 1WG5A 3OR1A 3RZAA 5B0BA 5FLXU 3QO9A 4ED1A 5D0RA 2GNKA 3BSCA 3AH6A 4DUZJ 1E6VA 1H6KX 5B7WA 5KT6A 1UKUA 3VAHA 2QA1A 4EU0A 1U1LA 3WC0A 4P2FA 2R7QA 1L3UA 4ZVRB 4PWWA 2PD1A 4DJBA 5GMKa 4DU7A 3GQCA 4RKUC 3PYFA 2MYFA 2E5GA 1GMWD 1YZ7A 3EYZA 2IY5B 1MLAA 2V9KA 1UA0A 1GH8A 4O3SA 5FLXY 2DHSA 2JWNA 1TV6A 1S0NA 1FEHA 5KFRA 2AYBA 1CULB 2BE2B 1KNZA 3D67A 3H8YA 3KLFA 2P6SA 4OLPA 1GT8A 4KC5A 3V4MA 1WEYA 1LQ9A 2DGSA 4K8RA 1QVFR 1NK7A 2MZTA 3PFOA 1AFJA 1KTVA 3CCTA 5F41A 3PJXA 4KTQA 2EXUA 4WZQA 3DU5A 1S1WB 2HEKA 3DHWC 2I9SA 1WTBA 4PXEA 2OPSA 3DRRA 4NYPA 4Q2LA 5HLFA 3SQGA 3UWTA 4KO0B 2QIFA 3PZPA 4H4MB 3NNCA 3K57A 2IVFB 2HHQA 3ENWA 4FF2A 1Z4UA 3I5AA 3J7YI 2FVRA 2I38A 2HNYA 3KK2A 1VRQC 2V6AA 2VG6B 2KT5A 3LPEA 3D6MB 2OGUA 1RWUA 4B02A 4CQ1A 1Z2LA 1JLAA 1OS5A 2N7YA 3JYTB 1N34J 1F2GA 4ZVEA 5K14B 1TUGB 3D3BJ 4DR7J 1FRMA 4A8WA 1WF2A 3T5LA 4ICLA 4CO0A 2B7CB 4U8YA 4K5SA 4NLDA 2DR9A 5CD4A 1LWFB 4PYAA 1NSAA 1BGXT 1IR1A 3N0VA 4DHVA 4DV1J 1RHMB 4XAKA 1X0FA 3U1MA 2QMWA 2WBRA 3LUYA 3FKBA 2GHVC 2PIIA 4KRWA 2G13A 3T5KA 4RR5A 3G9CA 1IVZA 3NXZA 3G87A 4FPRA 4O3PA 4K4UA 2VFSA 5J2QA 3BDPA 5B0EA 4RU9A 1DQ8A 2DO0A 1HW8A 2NXUA 4WFZA 2F40A 4KGZB 2ZNYA 3DRPA 2BJDA 4QCLA 3V81A 3SCKE 3FJ2A 5IQQA 1U1RA 2J8AA 1RWMB 4A8XA 2QL7B 5I4MA 2XCAA 2MJNA 5K8PA 3PKYA 3FFIB 1NJXA 4X62J 5M2PA 1T95A 3TANA 2WOMB 1HNWJ 5M2UA 4LJMA 1EKRA 1TK0A 4ECRA 1U02A 2B51A 4I1TA 3B82A 3G8QA 2BRKA 3EVOA 2JEJA 3MMJA 3KJNB 3QYYA 1RWWB 2B9WA 4U7UD 1QLNA 4L75A 2VG7B 5L8RC 3C3LA 2KHCA 3VV2B 3RGIA 1JKHB 2ZZTA 3IM8A 3SSRA 2IIHA 4JV2A 4KHPJ 4QWBA 2YKNB 5CCLA 4WTOB 3ENVA 2Z2ZA 5IC4B 3MCSA 1C0TA 3AJDA 4UOGA 1HWJA 3THPA 5HBMB 3VVTA 1U7LA 2W8KA 3LO3A 3Q8PB 2DXDA 2IFXA 2IPOB 1MMDA 2VBXA 4LF5F 4JB8B 2FJDB 3HHNB 5KFQA 3BKUA 4Y34A 1T05B 2DITA 2V4QA 1VJQA 5J2PA 2YX7A 5KFNA 1UFWA 5BXIA 4ILRA 3W9JA 4LF1A 4YMEA 3Q2SC 1RP5A 3EGWB 3SZ2A 3VQTA 3RTVA 1VISA 2NPFA 1HQUB 2K1RB 2OI2A 2NYHA 2QG9B 2ZOFA 1T0TV 2BACA 1RHJB 4E98A 4E2FB 4U9RA 3KMQA 1TL3A 2UUAF 2E1PA 3BR8A 2BDPA 3D6FB 1S76D 5IT0A 1Y5LB 4OHVA 1L3VA 4MMOA 1M90T 4DUZF 3TO8A 3UR0A 2ATLA 2CQCA 1LEOA 2DXFA 5F8IA 2ACMA 4FN5A 5D8HB 4LF2A 3W63A 3CUNA 3QGIA 3ETOA 4ED4A 1D9AA 4OI6A 4OHZA 4Y2CA 1OQ6A 1EJ7L 2B6AB 2CVEA 3MM6B 1AB8A 3UFCX 2AKWB 4O44A 3KJVB 2F8HA 4WWSA 4F4YA 2EFQA 2RS8A 3H5UA 1U1PA 1RISA 4EBEA 2JX2A 3GSDA 1Q8IA 2DNGA 5H9FJ 2UUCJ 4K4VA 2HBRB 3AD9C 3MEKA 4USHA 2Y1IA 3UCUP 4IR1A 2D69A 3Q2TC 3KWMA 4QWCA 2GV1A 5J2MB 2YTCA 3M8QB 4O0NA 3LAMA 3AFGA 3FSYA 4OX8A 3UNYA 5LMUF 2MZQA 2WSEC 4CZCA 2WTFA 2QLBB 1RADB 3CJ3A 3HK2A 1H74A 2HNDB 1RTDA 3D4JA 2WONA 4NI2B 1O8BA 1JK9B 3EDRB 2GFFA 3H0PA 5BJRA 2DGXA 2OPPB 4UT4A 3ZTQA 2KYXA 3IBCB 3M32A 1DQ9A 1SB6A 2HFSA 4DV3F 1H73A 2O1PA 5ETPA 4URGA 3C19A 2QV6A 4PRFA 2V50A 3CCQS 4NA3A 3TR5A 3I32A 5U47A 1RSCA 4J9SA 5KFXA 4OQJA 5H9FK 2P6TA 1FA0A 2GVZB 5D0GA 1K47A 1VQMS 4CYUB 3VGVA 4Y28C 4LMZA 2R7XA 1UWAA 1VIOA 3DLEA 3DM2A 1RWOB 4MKAA 4Q8FA 3MECB 1D9DA 1IR2A 1NUEA 1F0XA 3JSYA 3BH7B 4LFBJ 1VRTA 4YDDB 4DX5A 3VGUA 4OJ1A 2DY9A 5B0FA 3QT6A 3HFZB 5CXTA 4LFCJ 3MUTP 4C8ZA 4DR7F 4UUXA 5ETOA 3RG6A 3IWNC 3PACA 4LF7J 3PYDA 3UDVA 4CIOA 1VBZA 3GFXA 1JQGA 1DTQA 4G1QB 2YNFB 5CYQB 2ILZA 4KHRA 4ZLJA 4C97A 1UETA 1KEKA 2AX0A 1UAWA 2DNMA 2YNHA 1UL3A 2VD3A 3OL6A 1PKUA 1RHKB 2AMCB 2XTJP 2N3OA 4DSLA 4RBTA 2B9EA 2AWZA 1NZAA 1H2UX 3KTQA 4M5LA 3CJRA 2JLFA 2UXBJ 3J80U 3OPKA 5H9EK 4GKKJ 3MUVP 1H0HB 1Y3JA 4WP9A 3J81U 4PCQA 1HWUA 2C2EA 1U0HB 4RLEA 4EBCA 1CJVB 5B0DA 5KFCA 3OVBA 2ZITA 4NXMF 1CLFA 1KQKA 1ZM2A 3BBBA 5J2NB 5IT4A 3BN7A 5KT2A 2FY8A 3FMBA 1O5JA 2KI2A 3UD4P 4B08A 2XSJB 5C24A 3A3NB 3GIJA 2GIRA 2HPUA 4CO4A 2W7PA 3HVTA 1WI6A 4TQSA 3J81Y 4ANDA 4EYIB 1S6QA 1N54B 2DY1A 2E5HA 2AEMA 3EVMA 2GMJA 3RAMA 5L38A 2FHMA 2MZRA 5H1SV 2LU2A 4CM2A 1FXDA 4EK2A 1NDLA 2DCUB 3FSXA 1N0UA 3P8BB 4WU2A 3D1OA 5G0RB 4B3MJ 4GO5X 1V3SA 1HFEL 1U45A 2J6TA 2BE2A 3FBBA 4DV2F 3OR2A 2HZAA 2R7OA 4DR6F 3NY0A 2DEJA 2LDYA 2OEMA 1N36J 1M5SA 3H40A 1NK5A 1LNQA 3GFHA 1YHQS 2CPFA 1ZS6A 4JI4J 2MY7A 4TU8A 4CH1A 1YBAA 4A8KA 2FYXA 4X4OA 4ZJLA 4JI5J 4PXCA 3BF4A 4LF9F 1D1UA 4KO0A 2ZJPQ 1YDLA 2RAQA 3C66A 1G1XA 4QIEA 1CQMA 3DRYA 3ITHB 4ZP6A 2VIHA 1F3VA 1N5VA 3V4IB 2VG6A 2F8MA 1P1LA 1SUQB 4B3RF 3OVSA 1VYAA 4LF6J 1N5YB 2H4WB 4ZDNA 1S9GB 2CQHA 2K3KA 4M5DB 3JYTA 4X64J 1EKSA 2CJ9A 3FQLA 2FVSA 4CH7A 1FESA 1Y4ZB 4U67Q 1U0SA 1N5QA 2DNRA 3MAHA 2A2CA 1CG2A 2G0CA 3LP0B 3MF5A 3TAMA 4O3NA 2DXEA 3K5NA 4YHHF 2NQPA 2V67A 1NKBA 1YITS 4GO7X 3QFWA 3NG8A 3BB5A 2AQ4A 2Z56B 1FKAF 2E29A 2GVDA 2WB1D 3AY0A 3TEHB 2FHJA 3LGMA 1CC8A 1TL5A 4USWA 2W7OA 2MQQA 3QJJA 2IVYA 2HFZA 4OFZA 1YJ9S 2FGCA 1VQKS 2QFJA 2HHWA 3NKYA 4YFUA 4WF9Q 2HRYA 5C2CA 3U1NA 2O3DA 2Q66A 2POKA 4ZPWR 2XMMA 4YR2A 2CJYB 3D9BA 5HMZA 1TMMA 1VHFA 3I9V9 1HR0F 2MXYA 3J7AN 5KFMA 3QJPA 4LRCA 5BYRA 4IOBA 1BQMA 4F50A 4ECZA 1IQZA 3T41A 1FWLA 2YKMB 1BY9A 2VU5A 3ZTOA 3GLJA 4ID8A 4QW9A 4FDFA 2K7KA 3D0IE 1X5OA 4V1Ak 3P6YC 3MHYA 3I82A 1XEZA 4AUKA 3BDEA 4QWEA 4CNZA 2ZH9A 4JYAJ 1M5KC 4LFBF 2WAQD 1IKWB 2KL8A 4C48A 4B3SJ 4DR5F 3V6DB 2W2MP 2ZOGA 3H90A 3GJSB 2XQCA 2DCLA 2KVQE 2HGMA 2B9XA 3M2UB 1NDKA 2DR5A 2RJZA 2DNOA 2DH7A 1S1VB 5BR8F 1VBKA 3TQEA 2HGNA 1P8GA 3M8WA 2KZZA 5KFDA 1RUSA 2EPIA 3AD7C 1UW9A 3BO3A 4GMKA 3H98A 3BYRA 3QIPB 5HBMA 1QSYA 1P6TA 4KGMA 3OLBA 1TKXB 2CUYA 2WK4A 3HKZD 1T05A 5HVFA 4IFVB 4ZVUB 5F9LA 1RT3A 1I94J 1KOOA 4FVCA 4J9UE 5F3TA 5KFYA 3HZEA 3R7BB 4F7VA 4TLQA 3OFGA 3OFFA 4R8UB 1RT1B 4OZ3A 1WOOA 2JVOA 3TP2A 4C4WA 3NGUA 2KJVA 3BGLA 1U6BA 3ISNC 5CCMA 2YXLA 1B7YB 1HNVB 2RQKA 1NO8A 1UZHA 4R5PA 2O67A 1FXLA 3WDOA 2QA4G 1WG4A 1X4FA 4ED7A 1VLOA 9RUBA 1KLMB 2V2VA 4BC7A 2VFUA 2Z0GA 3RBEA 4QU6A 2B6AA 2VG5A 4ZP8A 1PBAA 1SJFA 1GTHA 4X4UA 1NPPA 4NCAA 1UVKA 1YBTA 2B4VA 3ZC4A 1FNXH 4ZA1A 1N5TA 2XMTA 1KR4A 3IRXA 4K4XA 2NUUG 3MMBB 5D4PA 4ZITA 5J2MA 4YR3A 1TVRB 3CMAS 3M8QA 1F1BB 3N6LA 4N47A 3WIVA 2H51B 1KVKA 2V8GA 2CPZA 4BC9A 4L72B 4WCEQ 3VAMA 5GAHI 1N4LA 2R7VA 2ZHAA 4NI2A 4FNIA 1VIXA 1QAXA 3GE9A 2DH8A 4CLPA 3F0NA 1TKZB 2OPPA 1TTHB 4O3QA 5FJ4A 1S1UB 1VBXA 3D7SB 5LSLA 3PW2A 2BEFA 4PUOA 2KG0A 1XIQA 3X3UA 1L3KA 3MXHP 1PAEX 1GMVA 3DOMB 1IJEB 5C7PA 1IWAA 2GO9A 1XTZA 1X9WA 1HA1A 1Q7LB 2D3ZA 3P96A 2ZJRQ 5ETKA 4LF6F 3MECA 2VBYA 2FLPA 4UUWA 4AYBD 1TAQA 4P2MA 2MQMA 1KVIA 4I68A 2DO4A 2YNGB 3BO4A 3R6LB 2CG4A 2PFDA 1GK8A 1WC0A 7FD1A 2IJNA 1R3NA 4ZOSA 4USTA 2CPYA 1MN7A 5SUHA 3NNAA 2ASLA 3M05A 3KHHA 2YKQA 2MKKA 3TW0A 4G1QA 2VBZA 2WRMA 5CYQA 1W25A 2RF2A 3ILIA 2HVIA 4OHXA 3N5BA 2JHEA 3M6VA 2X1AA 4ED5A 4NLOA 3NOGA 5T41A 1XMOF 3MWBA 4L73A 2VFTA 5EDWA 2KM8B 1KOHA 1GX6A 3DI6B 3I4PA 3VAGA 2VQFF 4ECQA 2ZM6J 4HDHA 1H38A 1U0HA 3K59A 1SQFA 5KFFA 3LH2S 2BANA 4RW8B 2PI5A 1CJVA 1FRLA 3UVJB 1NZ8A 1U2FA 1JLEB 2Z4PA 2DTJA 1WKKA 1QTNB 2NXJA 4ZS6A 2CPHA 3DMJA 2RKIB 4NRTA 1NBEB 5KFPA 1QY7A 2LQJA 3ZTRA 2XSJA 2JEFA 1R0BG 5F9NA 3CJQA 4ELUA 2XWXA 4DXLA 1LWEA 1Q5YA 2G9OA 3Q83A 5KFUA 4MJKA 4JI8F 2HQ3A 1X9SA 4X4PA 3CCWA 4I6WA 1HBUB 2ZH8A 1IBLJ 1T9UA 3MD1A 1X4HA 3H59A 1Q8LA 5BYSA 4JI7F 1Q53A 2KXHA 3TNVA 1EP4B 2KRBA 3FCWA 4OZ5A 5T7LA 5G0RA 4AXJA 2R7RA 5GVQA 3OHBA 2YQ1A 2VB6A 1BWEA 4K4ZA 4DR2J 1FTRA 2W4PA 4L6V3 4C98A 3L09A 2CQ3A 1HI1A 2HLUA 3TWZA 5KFEA 5B0AA 2ALZA 3BPSP 1RBOB 4FNHA 2RSQA 5EWEA 1BMQB 1KWMA 1RJJA 2UU9J 2G0IA 3MPUB 3SV4A 2HHSA 5KT3A 1Q16B 3HM9A 2H65B 2RU9A 1FRIA 3NP5A 3FK4A 2AEJA 3S1TA 1TFWA 1AYEA 2GHWA 4GC6A 1I94F 1SXLA 1EETB 1RTHA 3OFHA 5LM7E 1SV5B 3PW7A 1RTJB 2E5IA 1FWPA 2DR7A 4A48A 1KN6A 3V4IA 3NWRA 4DFKA 3O44A 2C3YA 3MEEA 2E5JA 2I8EA 1S9GA 2M88A 2HFUA 1M5HA 4NA1A 2K3IA 3TZZA 3VTIA 3AXMA 4M5DA 4X4RA 3IN5A 3SXLA 2FZKB 4O4GA 2O66A 2K7JA 1SJ3P 2AGQA 3B8HA 4C0BA 3B6BA 3SFGA 5HL7Q 3LPYA 4A47A 1Q95G 4NCBA 2VFRA 2OMLA 3SQOP 4C2MA 1R0AB 2J6SA 1VK8A 1SKUB 5I42A 2VHGA 1BUXA 5J1NA 1FI4A 1RBAA 4CLSA 1HW9A 1X4GA 2DHHA 3ADAC 2IDEA 3DNCA 4O0IA 4NEZA 1FFGB 3HPOA 4HT5A 4OV6A 1O0PA 3CC7S 5ETRA 3SDEA 2J6UA 4FBUA 2BKPA 2QO3A 3WX4A 5CA5A 3CGIA 5EWFA 4DV6J 1QVGR 1L5UA 3R7SB 3RAQA 3H2LA 1AUSL 2HHVA 2XG8A 1FTCA 3T1HJ 2K2PA 3M9MB 1FK9B 3SCJE 3KLEA 3LP2B 5IWAF 3ILOA 3O8WA 1TK8A 4PAAA 4DSJA 3OUYB 4YY3J 1ZM9A 2W9BB 2W4CA 2RQCA 3A8EA 1HNIB 2YKMA 1XQIA 5D4NA 1GXTA 1ZTTA 3R97A 3VHQA 1S6OA 4ZVPB 2HK3A 2CZ4A 4JI2F 3OXFA 1HBOB 2B56A 5JXSA 2RS2A 1IN0A 1UVLA 1YBUA 1PGZA 4KFBB 2QA2A 1VS3A 2VDIA 2PE8A 4YB6A 1K1SA 3HCXA 2J76E 2BW2A 1RLDA 1S72S 3KHLA 2J0WA 1S1VA 1I1GA 2G1HA 2XY7A 1T3NA 4ZVFA 2R3VA 3V6JA 3UD5A 4P2XA 3QIPA 3GV7B 1M5PC 3N6NA 4DUYF 4URSA 4C8MA 2WVEA 2X3GA 1TKXA 4J37A 1F9EB 1IWGA 1WJ9A 2ZUAA 4DV4J 2Y0BB 3D66A 1RT2B 4IFVA 4KJIA 2KT3A 4FYXB 4DZ6A 4Q2MA 3I0RA 4CO5A 2HURA 2EW9A 1HWLA 4M5HA 4ZVGA 2HK2A 3SCIE 4MIWA 2ZM6F 4CO3A 1BWVA 1X4CA 2OFHX 2UZAA 1T03A 1RZMA 3D1HA 4CDIA 2ZDOA 4XPCA 4I7FB 3Q8QB 2RRNA 4C8NA 2UXDF 1HNVA 4EI2A 4F3OA 3IP0A 3GFZA 2CRLA 4MT1A 3W2VB 4KSEB 4A8QA 4B17A 1KLMA 3MDFA 4KV8A 3K5LA 1M5OC 2IBOA 4CNYA 3G6VA 2RRBA 2HHXA 2KM8C 4B3TJ 1S9FA 1C0UB 3U7JA 5IV3A 2HAIA 5AXLA 4J7CA 4J9VA 4DX6A 1JMTA 1BQXA 4Q45A 4QW8A 1TVRA 1OY8A 1W7WA 3BR9A 2JFDA 1VMBA 1RYSA 3BBCA 3GJQB 2YNIA 3MM9A 4RW6B 1RU2A 3SFUA 4HEA9 5AXKA 4IOCQ 2MQPA 3GG1A 1OMSA 2YPYA 2HZVA 2CJXB 5A8WA 4AFFA 2MGZB 4K4WA 5ETNA 2V63A 1GX5A 5LSRA 4P74A 4HR2A 4PWDB 2WCXA 4Q5VA 4TKTA 2OEJA 4U96A 3A8IA 4G1IA 2LYVA 2QMXA 2M9KA 2B4UA 2DBBA 1KONA 4TY9A 3DOMA 2KFYA 1X5TA 2ABYA 4CLFA 4DR3F 1N33J 3P45B 3HLUA 1Z2ZA 4TNOA 2HHHF 2XMKA 3KK3B 1WDTA 2ZHBA 2QSWA 3BS9A 4RWWA 4PKDB 4GRSA 2CNLB 3OTOJ 2CQPA 3PY8A 1RDRA 1DTTB 3SCLE 1UEUA 2DPIA 2P8IA 2R8HA 3HHKA 4DS4A 1KTQA 5HJYA 4BDPA 1CJUB 2MSTA 4D3GA 3K7RA 2X1FA 4B3OB 3MI7X 3BKTA 4M5GA 5DQGA 3RB0A 3BGRB 4ECWA 2KT2A 2R7TA 3KOAA 4ELTA 1JJCB 4DPXA 3I6PA 1B64A 4ZVHA 3H5XA 1RWKB 1NSPA 4A8OA 1R8AA 2XMJA 2XO7A 2DGOA 5LMNJ 4DV6F 3TJAA 5GADU 1PYOB 4RW8A 4CTAB 2PMWA 1S9EA 3CVKA 4DV5J 3HVAA 1WC5A 3CCMS 1JLEA 2W24A 3ONQA 3BQ2A 4IRKA 4LBHA 2ZNZA 4L3NA 2UUTA 1VI7A 3N5FA 2R8KA 5LOQA 2LXIA 4JUZA 3PR5B 1FJGF 5IFMA 4DV0F 1X31C 2HVZA 1X9MA 1ZAXA 4OV1A 2DR6A 3QSIA 2OPRB 1UJ6A 3AD8C 4PXBA 3MAAB 3NBPA 2AU0A 3WIUA 3LW5C 4RJVA 3CCZA 2CXEA 3GIIA 4ETXA 1S57A 4R0EA 1EP4A 4ED2A 4DPTA 3OLAA 1UW4A 4IKAA 1MMLA 4QIWD 4OJHA 3O6QA 3SEOA 3OV7A 4IH7A 1U1NA 3ZFVA 7AT1B 5F8JA 1JLBA 4KR0B 1CPZA 3EXYA 2IM1A 2Z2MA 3K5OA 4M94A 1GMWA 1WG1A 1VCTA 4OX9F 3A3OB 3M2VA 3P5TL 2JZ5A 2X7IA 3B78A 1O6XA 4B9SA 4ZCKA 4ECVA 4F26A 2ALYB 3M2RB 3K89A 2HW3A 4W90B 2L9WA 3EX7B 2D3UA 1FDAA 1DHMA 3OFEA 1R8CA 3W66A 1TL7A 1HQ2A 2GMHA 2I1RA 3RUBL 5J1PA 5D3GB 1J5EJ 3KUEA 2HWHA 1ZZFA 1EETA 4DMZA 1RTJA 2F1FA 1VHIA 1YQHA 4ZVQB 3SMZA 4OZ1A 4F2SA 4ZHRB 4BCAA 3W3SA 4Y2AA 1PSDA 2GGPB 3S8SA 2JNJA 3LOUA 1MROB 3RR7A 3KHRA 2R8JA 3I9ZA 3PXGa 4RUCA 1WELA 2WVBA 5EHHA 1URRA 1HNXF 4PQUB 1S6PA 3PYEA 3GG0A 4ZCIA 1XMQJ 4MH8A 1C4AA 2BJ7A 2BOPA 3OVAA 5I3UA 1X4BA 4N5SA 2B0GA 4LRBA 3HFKA 3CF5Q 2VICA 2E1MC 5EX0A 3TZWA 3I31A 1R0AA 1G6BA 4ZKAA 5L1JA 3ILJA 4NMXA 2LECA 1S1XB 1UP1A 2W01A 2XLIA 4USJC 4IFYA 1HYSA 2JOQA 2LQ8A 3D6TB 4RW9B 4RNFA 1JXEA 1LWCB 3ZTSA 2BZ2A 3QWPA 3DGVA 4URQU 2PEHA 3MM5B 2DNLA 3T1YJ 4M5MA 1N5SA 1X4DA 2IC3A 5E0OA 2I0XA 3HSGA 3D68A 2XWYA 4CO2A 4HACA 2KXNB 1IBMJ 1VOMA 1ELOA 5A0YB 3CTRA 1RHUB 2AJ1A 1FK9A 2DHAA 1XR7A 5IOLA 1M1HA 3LP2A 3AA8A 3CNQP 4CO1A 4IDKB 4PG5A 1NPRA 3DFEA 4ATNA 4FF4A 5IV4A 1VQOS 2ZBCA 1T9YA 2NPIA 2ADCA 3JAMU 5K8NA 4TYAA 3OHAA 2BJ3A 2XSFA 2J9EA 4AL5A 1HHQA 5HSPA 2M4MA 1YLXA 1ZOTA 4QR2A 1NSQA 1FD8A 3CJ0A 2X1GA 2ZZMA 1BXNA 2E66A 4F3MA 2KKHA 1HBOA 3DU6A 4AQYJ 3HI9A 4DLGA 3HD2A 3I4HX 1J2VA 3KG1A 4M8LA 1SQEA 3GP9A 4DL4A 5ETTA 4B9TA 1REVB 5DRKA 3M8YA 1NJYA 2HWTA 3TVKA 3JAMY 2E9TA 3DLKB 4LR7A 2ZBPA 4KE5A 2HQDA 1NKCA 2PA8D 4X66F 2ASJA 4NYOA 3A12A 3CCVS 1UZDA 5LL6d 1U4BA 1OY6A 2DRAA 1N88A 3KK1B 2XS2A 2HFVA 3MZIA 4NLQA 2UVRA 1U6ZA 2Q6BA 2VOPA 1FNMA 4NZ7A 2BE7D 3W5YA 4DI6A 1JLGB 4P73A 4USMA 2HNZA 1AA1B 4XDCA 3KLGB 1FFSB 4RX6A 3G6XA 3DGPB 4B9VA 2J0XA 5C42B 3KJQB 1S99A 2IMOA 4B9UA 4ZMMA 2CQ2A 1IM4A 2BM0A 5L9XA 2GJ2A 3MMAA 2Z57B 4I7FA 4FF3A 2HKEA 2MHNA 3HO1A 1N32F 2H9ZA 5KFIA 2DGWA 3MFIA 3ZZRA 2V8VA 3HVWA 2RU3A 3CD0A 3EMTA 4N76A 1DLOB 3AODA 3TUZC 1KQFB 1XNRF 2B8PA 1LW0B 4DEZA 2JL9A 3W65A 5ETLA 3KDOA 1K8AT 2YWGA 4Z7YA 3ZZTA 2ZD1A 2GMLA 1C0UA 2OTJS 2D1CA 4WP8A 1VRUB 3HHLB 5AE2A 2G4BA 4NLVA 1DFDA 3UW1A 2YVSA 3GIKA 5HK4A 2JLGA 1NB7A 1ZETA 3PRDA 4H54A 2PO4A 4RO0A 4Y00A 4OI1A 1KQSR 4RW6A 2DEIA 3D5MA 3TZXA 2LKZA 4MKYA 3T1AA 1OPIA 2LDIA 2FLOA 1U47A 2V8DA 1HPZB 2B8QA 3IR6B 1N6QB 4ID5A 2MGZA 4EMDA 1ACMB 1MWYA 3BEGB 3QLHB 2V2QA 2GAGC 4GVBA 3DN9A 2ZC4A 3BGOP 2ZEJA 4PQAA 1R7IA 3ICLA 4M95A 1YJRA 1PG5B 2B9YA 3PTWA 5KT7A 2W4DA 3K8WA 3KK3A 4PPDA 5C5JA 2XNRA 1KS2A 3ENQA 4C3LA 1N8RT 1AROP 3ZZPA 3C15B 1HL6A 1UPMB 1KLNA 2CPJA 3IXQA 2FB0A 4I0WA 1WDDA 4WFAQ 1TMJA 3M6UA 2ASDA 2NCKL
chains in the Genus database with same CATH topology
4LSZB 1RWMB 2DKOB 1RE1B 2QL7B 3EDQB 4DCJB 3R5JB 2C2KB 2QL5B 1ICEB 4JB8B 3R7SB 2XZDB 2QLFB 2C1EB 4ZVSB 3P45B 3D6HB 1RWNB 1PYOB 1SC1B 2HBRB 2H48B 1PAUB 1QDUB 3R7NB 3QNWB 3RJMB 3KJQB 1GFWB 1F9EB 1RWXB 2CNLB 3GJSB 4DCOB 2QLBB 2CDRB 1RHMB 1NMEB 2XYHB 2Y0BB 2P2CB 2XZTB 3R6GB 2H5JB 1RHJB 3KJNB 2HBYB 1RHRB 2C2MB 2FQQB 1RWWB 3EDRB 2H4WB 3GJQB 3GJTB 2H4YB 3D6FB 3NS7B 3SIPB 5IC6B 2CNOB 2XYPB 1RHQB 3IBCB 2CJYB 2HBZB 1I3OB 2QLJB 1QTNB 2H54B 1RHKB 1BMQB 2CNKB 4ZVTB 3IBFB 4ZVPB 4ZVRB 4ZVQB 1RWPB 2CNNB 1I51B 1IBCB 2C2ZB 4DCPB 3GJRB 2H65B 4ZVOB 2CJXB 3KJFB 3P4UB 4ZVUB 1SC3B 2H5IB 3R6LB 2XYGB 1RHUB 5IC4B 5K20B 2HBQB 2QL9B 3D6MB 3R7BB 2H51B 2Y1LB 1RWKB 1RWVB 2C2OB 1RWOB 1SC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSZ B;  1RWM B;  2DKO B;  1RE1 B;  2QL7 B;  3EDQ B;  4DCJ B;  3R5J B;  2C2K B;  2QL5 B;  1ICE B;  4JB8 B;  3R7S B;  2XZD B;  2QLF B;  2C1E B;  4ZVS B;  3P45 B;  3D6H B;  1RWN B;  1PYO B;  1SC1 B;  2HBR B;  2H48 B;  1PAU B;  1QDU B;  3R7N B;  3QNW B;  3RJM B;  3KJQ B;  1GFW B;  1F9E B;  1RWX B;  2CNL B;  3GJS B;  4DCO B;  2QLB B;  2CDR B;  1RHM B;  1NME B;  2XYH B;  2Y0B B;  2P2C B;  2XZT B;  3R6G B;  2H5J B;  1RHJ B;  3KJN B;  2HBY B;  1RHR B;  2C2M B;  2FQQ B;  1RWW B;  3EDR B;  2H4W B;  3GJQ B;  3GJT B;  2H4Y B;  3D6F B;  3NS7 B;  3SIP B;  5IC6 B;  2CNO B;  2XYP B;  1RHQ B;  3IBC B;  2CJY B;  2HBZ B;  1I3O B;  2QLJ B;  1QTN B;  2H54 B;  1RHK B;  1BMQ B;  2CNK B;  4ZVT B;  3IBF B;  4ZVP B;  4ZVR B;  4ZVQ B;  1RWP B;  2CNN B;  1I51 B;  1IBC B;  2C2Z B;  4DCP B;  3GJR B;  2H65 B;  4ZVO B;  2CJX B;  3KJF B;  3P4U B;  4ZVU B;  1SC3 B;  2H5I B;  3R6L B;  2XYG B;  1RHU B;  5IC4 B;  5K20 B;  2HBQ B;  2QL9 B;  3D6M B;  3R7B B;  2H51 B;  2Y1L B;  1RWK B;  1RWV B;  2C2O B;  1RWO B;  1SC4 B; 
#chains in the Genus database with same CATH topology
 5DLF A;  1DTT A;  3GIL A;  4CLW A;  1Q7Y T;  5RUB A;  4KH0 B;  3W64 A;  3DXB A;  1N48 A;  1ULR A;  4MYT A;  4C3K A;  2VOD A;  4MKB A;  4B3O A;  2ZE2 A;  3IG1 B;  2Z2Y B;  5K9F A;  1R27 B;  2I5J B;  3DCA A;  3T9Z A;  2JVR A;  3NNH A;  2C2D A;  1PIE A;  4HH1 A;  5AJ3 F;  4EBD A;  2D3O R;  1D09 B;  4KAI A;  2NZC A;  3H5Y A;  2AJ2 A;  1B7F A;  4HTI A;  1WNE A;  3HSZ A;  3EZO A;  1RT4 B;  1U1M A;  2GIQ A;  4I64 A;  1BC6 A;  3PCO B;  1PCA A;  5CAB A;  3WBZ A;  3DLG B;  3PR4 A;  2X1B A;  3HSJ A;  3NL0 A;  2E5L F;  4LF5 J;  1R6Y A;  5C25 B;  4RNO A;  7FDR A;  1EIY B;  4N8N A;  4JV5 F;  2H5I B;  2VL1 A;  2CIM A;  1IBM F;  2FIU A;  3TVZ A;  3M6W A;  3MD3 A;  5DG7 A;  4I2P A;  3KG0 A;  1WOS A;  1U26 A;  1M0S A;  2E9R X;  2XY5 A;  1ZA1 B;  1T9T A;  4DUT A;  3R5C A;  1DY3 A;  2VOO A;  2UUA J;  4YUD A;  4ES1 A;  3UN2 A;  2OPR A;  3ZZZ A;  3MAA A;  2HIQ A;  3BKF A;  1RWX B;  2E1R A;  4ZN3 A;  5IXU A;  2CDR B;  1TL1 A;  3DYA B;  3MFH A;  5HP1 A;  3C6T B;  5CYM B;  1M1G A;  1X4E A;  1FKO B;  5K8M A;  1FER A;  2RRA A;  4AQY F;  2OEL A;  1FWK A;  2C2M B;  4UZC A;  3GR1 A;  3MM7 B;  2DHX A;  2R8G A;  1JLQ B;  1IKX B;  4AL6 A;  5IT9 Y;  1W26 A;  4KGX B;  4NYZ A;  1R89 A;  2KN4 A;  5ADZ A;  4WFX A;  1SH3 A;  2C3U A;  4MK9 A;  3G8S A;  5HI7 A;  4K4Y A;  3G82 B;  2Y1R I;  1NDC A;  2HBQ B;  5LMU J;  2C2O B;  4RUA A;  1S6U A;  2LXF A;  5KFA A;  1H7X A;  4PXD A;  1DZ5 A;  3QGH A;  3KG4 A;  3H25 A;  3PIO Q;  2GQ2 A;  3M9O B;  1LFW A;  4QWD A;  1M1K T;  3HFV A;  2RHQ B;  1UTA A;  4IG0 B;  3KHG A;  3HX9 A;  1NK9 A;  1SC1 B;  4LF4 J;  1CBK A;  3SV3 A;  4DSF A;  2LEP A;  4R0J A;  4FXD A;  5JMN A;  1P27 B;  1FJC A;  1S5Z A;  4DV3 J;  2QE5 A;  4IG3 A;  3LP1 B;  2AV5 A;  2DIS A;  4ZHR A;  2F4V F;  1VJW A;  1VC6 A;  1FRH A;  4JI0 F;  1OWX A;  4TU9 A;  2FHO B;  2EC2 A;  2QZ8 A;  4F4Z A;  1TKT A;  1WHW A;  4HYK A;  5BYQ A;  4DBQ A;  2WBM A;  3ISZ A;  3MR2 A;  2B7B B;  2Z2L A;  3FEZ A;  3JTP A;  1U2R A;  2QYC A;  1TUW A;  1WEX A;  4ZVO B;  5DLG A;  1FFW B;  2KJW A;  2ZH7 A;  2CQB A;  3T19 A;  2OO4 A;  1S77 D;  1Q5V A;  4C8K A;  1H2V Z;  2RE1 A;  2UVW A;  5L1I A;  1NH8 A;  4DR1 F;  3CJK B;  1UJ4 A;  3JXO A;  1CS4 B;  4OJG A;  4YQW A;  4RW9 A;  3NS6 A;  2LXU A;  4JI1 F;  1F5A A;  3JTN A;  1R43 A;  2XMV A;  1WHX A;  2AYM A;  2AZ1 A;  4QYR A;  3T6J A;  2H1Y A;  2OLW A;  4RBV A;  3TX0 A;  2R8I A;  5L46 A;  1VQ9 S;  1RBL A;  3IMQ J;  3GYX B;  3THV A;  4R25 A;  4Z7C A;  3L95 X;  4OI2 A;  1U2C A;  5A0Y A;  4KBI A;  1RHR B;  4P52 A;  2F5G A;  4QIV A;  1CJT B;  4LR8 A;  4NXM J;  3SYZ A;  3R1L A;  2YH1 A;  4I6A A;  4ZN1 A;  3N79 A;  1DQA A;  1VK3 A;  2LU1 A;  2YY3 A;  2ZJQ Q;  2CPI A;  2G2Z A;  4P10 A;  2HRU A;  1RAG B;  4K59 A;  5KTQ A;  3IS9 B;  1T9V A;  3JSR A;  3B4M A;  1TFY A;  5F0W A;  1TP7 A;  3HHL C;  1AZS B;  4DPW A;  1ZYQ A;  1HBN B;  2DNK A;  1U25 A;  4C9D A;  4DV7 F;  4CLK A;  1ZM4 A;  4ECY A;  3H4D A;  3MM8 B;  2I6W A;  2RDI A;  2ATC B;  4XDD A;  1C1B A;  2BKN A;  3C46 A;  3GCW P;  5CYJ A;  5AXN A;  2EK1 A;  3J7Z 5;  1N52 B;  3A1Y G;  3DLK A;  5KFT A;  4ZCM A;  1VQ5 S;  1U49 A;  5IM0 B;  2F3J A;  4XIU A;  3C14 B;  3VAF A;  5A8R B;  5DDO C;  3R27 A;  4NML A;  2CPX A;  2MKJ A;  3KLI B;  4OZJ A;  3GR0 A;  4DV2 J;  1PIL A;  3KK1 A;  1W2I A;  3F56 A;  1NJW A;  1YVF A;  5K5M A;  2Q43 A;  2UXC F;  4DR6 J;  1YSJ A;  5IC6 B;  1I5O B;  1JLG A;  1S0M A;  3KLG A;  1S4F A;  3W61 A;  4EWT A;  3V6H A;  2Y9H A;  1RWP B;  3DGP A;  4RUH A;  2C2Z B;  1NSK L;  4RNN A;  5C42 A;  2XGP A;  3GYG A;  4PG7 A;  4WYL A;  4J91 A;  4LF9 J;  3CCE S;  1ZBT A;  4N56 A;  2ZH6 A;  1PC5 A;  4KB7 A;  4QJV A;  2C2K B;  3MUR P;  4QYZ K;  1TQL A;  2BAB A;  3M8S A;  4IH5 A;  2L41 A;  8ATC B;  1QAJ A;  2QA4 S;  4B3R J;  2C28 A;  3RJM B;  2RQ4 A;  1LW0 A;  3VAL A;  5KG3 A;  4ES2 A;  4JI3 F;  4QPT A;  5DGB A;  1RT6 B;  1SIW B;  5KOX A;  4Z37 A;  2OSQ A;  4DL3 A;  2IM3 A;  4UZB A;  1B0P A;  3PRV A;  3Q8R B;  1FDD A;  3QWU A;  3DKD A;  1RAE B;  2BJ8 A;  2CPE A;  5FDL A;  2K06 A;  2XLK A;  1VRU A;  4NXN F;  3HF5 A;  3G86 A;  2F63 A;  4WU3 A;  2CNK B;  4YHH J;  4CI0 B;  5GME A;  3QRR A;  1NHV A;  1WC3 A;  2AJQ A;  3Q22 A;  1WTF A;  3DDK A;  3FMW A;  1RB0 A;  1RWV B;  4ZLP A;  3NGD A;  1HPZ A;  1N6Q A;  3ULH A;  4YDX A;  3WQP A;  2AGP A;  3RAX A;  2DPJ A;  1C1C B;  2CFX A;  2MQL A;  3EUN A;  4ECX A;  3DRR B;  4LF4 F;  5HLF B;  2XHC A;  1RA6 A;  3SQG B;  4LUB A;  1HR0 J;  2E7V A;  1RAA B;  4UOH A;  3DHX A;  3OL7 A;  4PWU A;  2VAS A;  3MOZ A;  4X4T A;  2JSX A;  1QM9 A;  3PV8 A;  3FRY A;  1T3O A;  3KK2 B;  1VQ8 S;  2B3T B;  1Y9O A;  1OPZ A;  4DQQ A;  3NGT A;  1MNE A;  5AE1 A;  3VCD A;  5GAG I;  2YKP A;  4NLG A;  2AX1 A;  2LA6 A;  4GKJ F;  4B9N A;  3IG1 A;  5HVG A;  2MB0 B;  5H9E J;  3S6E A;  4DR5 J;  2I5J A;  4S0M A;  2BKO A;  4W98 A;  3WZ0 A;  2N82 B;  3HHE A;  4KGV B;  1LV5 A;  3OJS A;  3FQK A;  3Q8V A;  3CMQ A;  3AOC A;  1WC6 A;  2BRL A;  2VDH A;  3PW0 A;  5BR8 J;  1RT4 A;  1Q82 T;  2EBE A;  4I6Y A;  2HRT A;  2M52 A;  5CH7 B;  3VZH A;  1T7P A;  1YIJ S;  4L74 A;  3IO1 A;  2GS8 A;  4IR9 A;  2LFV A;  5HAT A;  4FYV B;  3I96 A;  4YB7 A;  1FX4 A;  5GAD I;  3CD5 A;  1XK8 A;  2F8E X;  3VZI A;  4PZV A;  2OIH A;  1U8S A;  3LGN A;  3DRP B;  4A46 A;  2FLN A;  3V81 B;  1P9Y A;  2ZWP A;  5HO4 A;  4RNH A;  1U48 A;  4Y2K A;  3RRH A;  4FS2 A;  1TEL A;  2UV8 A;  2DGU A;  3JB9 k;  4CP5 A;  5KAK A;  3UDC A;  3W7B A;  5EWG A;  5IQ6 A;  3AT1 B;  1D0E A;  3DYA A;  4J9M A;  2EI5 A;  3ZNJ 1;  1HLW A;  2QL5 B;  3DDN A;  5DZ6 A;  3J80 Y;  3J7A 1;  2J7U A;  1T9X A;  2RIJ A;  1NND A;  5JJB A;  2FJB B;  3MM7 A;  2AJ0 A;  4WK1 A;  2ZH5 A;  2V94 A;  4XPE A;  2EFV A;  2YWK A;  1SQG A;  3M4X A;  4OIX A;  4NA2 A;  2HFO A;  3L7O A;  4DQS A;  1ZPV A;  4EUV A;  3G82 A;  1OYE A;  1SVD A;  4WFB Q;  1CUL A;  2LEB A;  2BYC A;  4WTY A;  1C0T B;  1K73 T;  2BXJ A;  2RT3 A;  3ET6 B;  1MN9 A;  3NCR A;  2P9C A;  3NOC A;  4FKX A;  3FBF A;  4IG0 A;  2VF3 A;  1RYR A;  1WSR A;  4QOT A;  1S1W A;  4FBT A;  1AW0 A;  2XS7 A;  3C16 B;  3VGT A;  1RXO B;  4EYH B;  3E2E A;  4RPF A;  3EJM A;  2RIL A;  4LT6 A;  4H4M A;  4NZ6 A;  3CUL A;  2PMH A;  1FCA A;  3BGU A;  1V9O A;  2RDD A;  5A76 A;  1D8Y A;  3OTD A;  2KHD A;  5KFJ A;  1CQN A;  4G6V B;  2I2Y A;  4F4W A;  3JSB A;  1D9F A;  5DZ7 A;  2LA4 A;  4CT8 A;  3VR1 A;  2WHO A;  1AUD A;  5K14 A;  2KU7 A;  4ZPD A;  1WHV A;  1LWF A;  1YJT A;  4O44 B;  2QLJ B;  1Y00 A;  3HHD A;  4LQ3 A;  3K0J A;  4N7T A;  4DCP B;  5HMX A;  2AF6 A;  1V5V A;  2QLW A;  2ZKT A;  3EPG A;  4ANE A;  4QBU A;  2W2N P;  2UUB F;  3KUH A;  1B4S A;  2MZJ A;  4P75 A;  1TR0 A;  5E3R A;  1HHT P;  2CJA A;  1XMO J;  3UNG C;  2N7C A;  4UOC A;  4ZP7 A;  1SH2 A;  1YRT A;  1FDB A;  1WKJ A;  3H2V E;  4WJB A;  2VQF J;  4A8F A;  1NEE A;  2WON B;  3N4W A;  2IA6 A;  4LQ9 A;  1YI2 S;  3I87 A;  2DGT A;  4DL5 A;  1UFK A;  2HS4 A;  3ZNU A;  4CLL A;  1NME B;  3V5R A;  4K4T A;  2XYH B;  2YWH A;  4U95 A;  4QZV B;  3RU0 A;  1S4E A;  1UJ5 A;  4Y2I A;  4USU A;  4C8O A;  1WOR A;  3FFI A;  4K50 A;  4DX7 A;  1NKE A;  3DLE B;  2WOM A;  3DRX A;  3FCV A;  4XO0 A;  4DOZ A;  4DX8 H;  2VH7 A;  4JI8 J;  1XNQ J;  2CZ9 A;  3O2I A;  3OSN A;  2HS0 A;  3MM8 A;  1VRT B;  1FVQ A;  4JI7 J;  3RW6 A;  3OSP A;  3E51 A;  4LF8 F;  2BQ3 A;  4WK3 A;  2ZBI A;  5IM0 A;  3DC2 A;  2EC0 A;  3OJU A;  2VG7 A;  4WP3 A;  5KFH A;  3CB4 A;  2MKS A;  2M8D B;  5A8R A;  3PEJ A;  2L9D A;  2BJ1 A;  4PAB A;  1JKH A;  1SPB P;  2HHU A;  5KG1 A;  3UO0 A;  4XTT A;  3TJ9 A;  3E01 B;  2N4C A;  2FJX A;  3NAH A;  2YKN A;  1GFW B;  1GQE A;  2YNH B;  5MLC V;  3PNI A;  3QAT A;  1KFS A;  3TAP A;  2Y3Y A;  2V69 A;  1NM2 A;  1T9W A;  4NRU A;  1U24 A;  4OHY A;  3SSS A;  3KMS A;  2RH3 A;  3AQO A;  4HHJ A;  3QZ7 A;  2XYP B;  2OKQ A;  4BWM A;  2HHT A;  3EGN A;  5GMD A;  2P5V A;  3EZU A;  1FNO A;  1S97 A;  4DWI A;  3CME S;  2HWI A;  1YWX A;  1HQU A;  3N6M A;  1RAJ A;  4OZN A;  1SJ4 P;  1QD1 A;  2K1R A;  5KFK A;  2AZ3 A;  3MED B;  3PG9 A;  1UVJ A;  4E8U A;  2WVF A;  4F04 B;  2QEX S;  2XYG B;  5C24 B;  4ZPB A;  1D8Z A;  2YWE A;  5DGA A;  1O51 A;  3CDA A;  3FSI A;  3HVT B;  2VFV A;  4LSZ B;  1RT6 A;  4LIW A;  3BRE A;  3TAQ A;  1S6Q B;  4G3I A;  3HHL D;  1KDN A;  1RCX B;  3CO9 A;  2W9A A;  1HHS A;  3R7N B;  4ZK7 M;  3Q23 A;  2OMO A;  2R42 A;  3MM6 A;  2ZHO A;  4LRE A;  3G6Y A;  3KJV A;  4FYW B;  5IS2 A;  4NLU A;  4JOU A;  3PVX A;  3L4B C;  3AA9 A;  1KD1 T;  4BBY A;  3UCZ P;  1A6L A;  3OR2 B;  3UN5 A;  3QPI A;  3FBE A;  5D6G A;  4ECS A;  2JH3 A;  4USI A;  4LSL B;  1JJ4 A;  2R2U A;  2MZS A;  4FZV A;  3PX6 A;  1G7C B;  1F5C A;  5CAA A;  2HND A;  2RQM A;  3O1L A;  3T6B A;  2CG8 A;  1C1C A;  4ILM A;  3TOQ A;  2W2O P;  5IWA J;  5DET A;  2VQE J;  3MPD A;  2C22 A;  3I5B A;  4DF8 A;  2UUW A;  5ETS A;  2IBK A;  3M6X A;  2M3D A;  4Y2M A;  2NSC A;  2AT1 B;  1RKI A;  4ED6 A;  3D6H B;  1U1Q A;  3MUM P;  3NWG A;  1V3Z A;  2H48 B;  1QDU B;  3UDE A;  1HWI A;  2GVZ A;  2IA0 A;  1SBR A;  1RGV A;  2GIF A;  4CYU A;  2AD9 A;  4OX7 A;  3I55 S;  1DJ0 A;  4ITS A;  4A4J A;  3I0S B;  2ZH3 A;  3ELH A;  3FUY A;  2CJK A;  4JI2 J;  2R4F A;  2UP1 A;  4LRF A;  1UEV A;  5F8L A;  3R6G B;  1ZA2 B;  1G3O A;  6FD1 A;  3CE8 A;  3LF0 A;  2C2R A;  5LJ3 Y;  4ZLN A;  2CNO B;  1QUV A;  3D0G E;  3TAM B;  3IGV A;  1VFJ A;  3QAU A;  4I56 A;  2UVV A;  2D41 A;  2JC1 A;  2KB2 A;  1YK9 A;  2YNF A;  5B08 A;  2LP4 A;  5DQI A;  2G0J A;  2AGO A;  3F44 A;  2GVD B;  2F9J A;  4JV1 A;  4DUY J;  1IM6 A;  1UFL A;  1OSD A;  3TRG A;  4F0H A;  1QAY A;  2ZBQ A;  2C3P A;  4DFM A;  1IBK F;  5D4O A;  1YJ7 A;  3OTC A;  5JUM A;  1JJ2 R;  4LSN B;  1X60 A;  1FE4 A;  1NLK L;  1VR6 A;  4QR1 A;  1BQN B;  1A9N B;  4DN9 A;  5KFB A;  1ZH5 A;  4A8Y A;  3D3C J;  5LT5 A;  4OL8 A;  1EB0 A;  1Q78 A;  2A18 A;  4ED3 A;  1UEK A;  5F8H A;  4OZ0 A;  3HT3 A;  5J2N A;  2UXD J;  3IM9 A;  2PN6 A;  4IRC A;  1BQM B;  2YWW A;  4PYD A;  2V0N A;  1DBD A;  2NZ4 A;  3HJF A;  3NS7 B;  2GZO A;  4YR0 A;  1OJ4 A;  4DN0 A;  2RML A;  2FJW A;  1DAX A;  1XNQ F;  4MKV A;  2IYG A;  2L9N A;  1YX2 A;  3OL8 A;  4OYP A;  3OW2 R;  4OYA A;  2R7S A;  4CLT A;  1MW7 A;  4KKO B;  5L1L A;  2QN6 B;  2KFN A;  5KFL A;  5EUH A;  2W25 A;  4O3R A;  1JLF B;  5KFS A;  2WSF C;  4USV A;  4QIG A;  4YEA A;  2HQI A;  4M5J A;  2W8L A;  1WWH A;  2VPY B;  1KFD A;  2NLW A;  1FEE A;  1B99 A;  1RI7 A;  2EFO A;  3D54 A;  3CJ5 A;  3VGS A;  4JI6 J;  2HS3 A;  3KXD A;  5B09 A;  3ET6 A;  3LAL A;  4DQR A;  2M5Y A;  4OJ3 A;  4OYZ A;  1R8B A;  4ENO A;  1P1T A;  2AHO B;  3POT B;  4U7C A;  3CIM A;  8RUC A;  4U8V A;  1Q1K A;  3NRB A;  1VC5 A;  2XUL A;  1VC0 A;  2R7W A;  5DDQ C;  4M63 A;  1RT3 B;  3C16 A;  2NXN A;  3BH6 B;  3ZZO A;  5LXR A;  3T5J A;  5CQG A;  3PHT A;  4NPO A;  2D9O A;  2Q3P A;  1HNZ F;  2WVD A;  5D77 A;  4DR3 J;  3ITH A;  3ZXW A;  2DK2 A;  4J90 A;  2CYY A;  2HHH J;  3P4U B;  2CJQ A;  1DAR A;  2WW4 A;  3VAK A;  2CKW A;  4R5P B;  1SUQ A;  6AT1 B;  3IRW P;  1ITP A;  4DPO A;  3TZY A;  1N5Y A;  3MEG B;  2Y1L B;  4C6A A;  3MCO A;  2ZBR A;  4UY8 5;  4DCJ B;  4HDG A;  3D0H E;  2YKA A;  1LXN A;  3VF0 B;  4NCG B;  4EZ9 A;  4J9R A;  3U1L A;  1RAI B;  1YJU A;  1FKP B;  1UWB B;  3CCJ S;  2VG5 B;  1BHN A;  3ZZU A;  3H5S A;  4PG6 A;  2DB1 A;  3K17 A;  2NS1 B;  1VQY A;  3QT5 A;  3LP0 A;  1Z1Z A;  3IRX B;  1N0V C;  3BSA A;  5HRO B;  5ETM A;  4LFA J;  3GIR A;  4OI3 A;  3PDN A;  4NOH A;  2FVP A;  4QU7 A;  1NCL A;  1T11 A;  1SL1 A;  2CAJ A;  2LEA A;  4OI4 A;  1SI9 A;  4M5I A;  3JQM A;  3NAI A;  3TUI C;  3IBF B;  1SCJ B;  4HHU A;  2V8P A;  3AJ1 A;  2EK6 A;  3OD2 A;  1EQ0 A;  2XCP A;  4N77 A;  3IR7 B;  5DM6 Q;  1FT8 A;  5KG2 A;  2R9L A;  1QSS A;  5LJ5 Y;  2V5H G;  2ZVI A;  2APO A;  3E8O A;  5E3P A;  2ROG A;  1Y0H A;  4X2B A;  4PUO B;  3UPF A;  4C7Q A;  2H3E B;  2XM3 A;  3EDQ B;  3PW4 A;  1FJG J;  2VQE F;  4DV0 J;  3R5A A;  1I6J A;  1S59 A;  4NLX A;  3RB6 A;  2K8G A;  1RTI B;  2FVQ A;  5KG0 A;  5CHC B;  5KT4 A;  2RUS A;  1B0T A;  2VKR A;  3Q8S B;  3GV8 B;  1NK4 A;  1N34 F;  4TVA B;  2WSC C;  2J0S D;  1K1Q A;  2DRD A;  3E3X A;  1IKW A;  1EQM A;  1FVS A;  3V6D A;  3LWL A;  3W5X A;  2L48 A;  3MGJ A;  2XBP A;  2EEY A;  3FRZ A;  5DS7 A;  4DV1 F;  1N56 A;  3E01 A;  2ZVS A;  3M2U A;  4DR4 J;  2X3D A;  5AXM A;  4OX9 J;  2RF2 B;  4J9L A;  3QGG A;  2LCW A;  3CCU S;  4I69 A;  2MZ1 A;  2BOA A;  4KT0 C;  3G71 S;  3KLV A;  2A3J A;  3CDE A;  3N28 A;  3M9N B;  3QBC A;  2XEX A;  3Q8U A;  1WI8 A;  4WXW A;  3HVR A;  2D7S A;  4ZVS B;  4OYM A;  4G65 A;  1S7I A;  2BAN B;  1L3S A;  1UVI A;  1XN9 A;  1PYS B;  2EG1 A;  4FYY B;  3VAI A;  4QQB A;  3RBD A;  4R8U A;  3MED A;  3GMG A;  3MTK A;  1EHW A;  1RT1 A;  3W9I A;  3DMJ B;  2NXE A;  2DNQ A;  4WKY A;  1ZZN A;  4UQG A;  1XBW A;  4MK7 A;  1SKW A;  1VQS A;  3BJY A;  2M2B A;  2J8S A;  2B4O A;  2EG2 A;  1LWE B;  3BYP A;  4X62 F;  1IKY B;  4RL1 A;  1HNX J;  1APS A;  4WE1 B;  5KFZ A;  1HNW F;  2BUN A;  4ZPA A;  2HBZ B;  3UDL A;  3A8J A;  3W62 A;  1NJI T;  1EX8 A;  2AYG A;  3QFH A;  5HMY A;  2U2F A;  2YWF A;  2O5D A;  3MAQ A;  3MCM A;  4AL7 A;  4Q0B B;  1CJK B;  5T7L B;  3TYT A;  4P7V A;  2VZ9 A;  5E3Q A;  2IVM A;  3W2W B;  3IAS 9;  2YQ0 A;  1FJE B;  2NRE A;  1HWK A;  1S48 A;  5E3A A;  4OYB A;  1SJ1 A;  2XC9 A;  3FGV A;  2OD4 A;  4I2Q B;  3L9Z A;  2F9D A;  4P6Q A;  1DRZ A;  1U1O A;  1PAU B;  2W2P P;  4KHP F;  3MMB A;  1FJ7 A;  2DYA A;  4FYD A;  5D15 A;  4TXS A;  2ACY A;  4LSL A;  3U27 A;  4JI6 F;  3GU0 A;  2HIY A;  2ZH4 A;  1HD1 A;  3KLH B;  2DGQ A;  2HQG A;  5J1E B;  1VQP S;  4LBI A;  1TKZ A;  4OI0 A;  2A6O A;  2LLZ A;  2V4J B;  2E1C A;  3CJ8 A;  2C2N A;  3C2P A;  1S1U A;  4KQZ A;  1KSP A;  2FC9 A;  3M8Z A;  1RTH B;  4K5R A;  4AXI A;  3MPY A;  2CVI A;  3CW2 C;  4ETZ A;  2RB7 A;  2EKN A;  3MEE B;  1RAC B;  1LK7 A;  3QSY B;  2BW7 A;  2L08 A;  3I0S A;  1CSJ A;  3IR5 B;  2JC0 A;  4A8S A;  1RAH B;  3IWX A;  1SC4 B;  4O4G B;  4OHW A;  2Y0S D;  1IR0 A;  3THT A;  4H4O B;  2BE9 B;  3R8Y A;  5FII A;  9ATC B;  2YNG A;  3NS5 A;  3QNW B;  2HYI B;  5GAG U;  5I42 B;  3W8G A;  4J9O A;  1FE0 A;  3FZ2 A;  1RTZ A;  1F6T A;  4WFY A;  1XMB A;  4X66 J;  2R2S A;  3FVY A;  5HVH A;  2W2Q P;  1PBU A;  4OZ2 A;  3J7Z T;  1MSW D;  4RWX A;  1FD2 A;  4WKR A;  3JQK A;  3C8Y A;  1YRX A;  4Q43 A;  2UUC F;  2RNE A;  3NCQ A;  5AT1 B;  5IZH A;  4J9K A;  4F0M A;  3SDE B;  4LFA F;  2RD5 C;  2IAJ B;  3A8K A;  1E6Y B;  1YZ6 A;  4LSN A;  2MDA A;  5EX3 A;  5KT5 A;  3TVY A;  4V19 J;  5KFW A;  1BQN A;  4KIA A;  3DI6 A;  2R7U A;  1FRJ A;  4KGK A;  3JSM B;  3AAW B;  2OD6 A;  2H5E A;  4K0K J;  2DRB A;  3UVJ A;  3KLE B;  1N32 J;  4OYI A;  5GAE U;  4DL6 A;  2DNY A;  2IJR A;  3ILL A;  1AT1 B;  3R5J B;  4DQI A;  2RKI A;  3QMQ A;  3T9N A;  2MKI A;  3VAJ A;  1Q8B A;  3UI3 A;  1SH0 A;  2QRR A;  3NMR A;  2W9C B;  1OQ3 A;  3H2U B;  1RLC L;  2B5J B;  3NGK A;  4DPY A;  2BVZ A;  1XNR J;  4IQM A;  3IWL A;  2A0F B;  3IBW A;  2IHR 1;  1HBU A;  2BQR A;  4X4V A;  4AE5 A;  3HT0 A;  1R8H A;  5B0G A;  4U7U K;  4KKO A;  1YG0 A;  3UR3 C;  1JJH A;  4UTG A;  3UN3 A;  4DPU A;  5DO2 A;  4GC7 A;  3K8V A;  1X0P A;  2RDJ A;  1SJR A;  1JLF A;  1GNK A;  4LFC F;  3Q0A A;  2BM1 A;  4C8L A;  1Q86 T;  3RB3 A;  3RBX A;  4LF7 F;  4O4R A;  2J0Q D;  4YB5 A;  1NRK A;  2D9P A;  3EM1 A;  3CCR S;  3DLB A;  2FVC A;  3BM7 A;  3DRS B;  4DR4 F;  2KTQ A;  3PIP Q;  2D3O 1;  3CSK A;  3POT A;  1RA7 A;  1KHW A;  2E44 A;  4DFP A;  3W8P A;  1SKR A;  3G2X A;  4EEY A;  1NPK A;  3MR7 A;  3UD3 P;  3TJ8 A;  1FXR A;  3I0R B;  3W9H A;  2UXB F;  5FD1 A;  3T3F A;  2DD8 S;  4J9P A;  4GKK F;  4F25 A;  3KYL A;  1RAO A;  4CRJ A;  1T03 B;  4EO6 A;  2FC8 A;  5HQL A;  1NHK L;  1K0T A;  2C42 A;  2Q6C A;  1SV5 A;  3HDS A;  2MJU A;  3P5B P;  2UV8 G;  2XO6 A;  2EWH A;  2WZ1 A;  4X4N A;  3S01 A;  2Z8Q A;  4HHH A;  1QJH A;  1SC6 A;  3MEG A;  3PX4 A;  4ZLL A;  2C3M A;  3ZZ0 A;  3D2W A;  2CQ0 A;  1NK0 A;  3KNA A;  3BO2 A;  1R6V A;  4WII A;  1I3O B;  4KV8 B;  1NJZ A;  3W5Z A;  2F65 A;  3F41 A;  4EO8 A;  2YPZ A;  4NCG A;  1FKP A;  1UWB A;  2R2T A;  3MR6 A;  2XI3 A;  4OZL A;  4K2X A;  3U02 A;  2KXF A;  1GTE A;  1VQL S;  5AJ3 J;  3IGN A;  2V2K A;  4B3M F;  1F5B A;  4YOE A;  4F4X A;  2X51 A;  5HRO A;  3QID A;  2C1E B;  2W7A A;  1TU0 B;  1WOP A;  1UCN A;  1X4A A;  3R5G A;  1QAI A;  3GSI A;  3NGR A;  2YNI B;  4ZJO A;  2L3M A;  3MM9 B;  3EXC X;  1UMJ A;  1TKD A;  2F4F A;  2E5L J;  1N36 F;  3C6U B;  4ELV A;  4MFB B;  2DVI A;  3X1L B;  4JI4 F;  4ECT A;  5A8W B;  4JV5 J;  1U8W A;  3A3P B;  3LAK A;  1XR6 A;  4JI5 F;  4L76 A;  4WIQ A;  1IJF B;  3CD7 A;  1LFP A;  2ZKU A;  3CDB A;  3OUY A;  3IFE A;  3FDS A;  3QZ8 A;  1HIY A;  4UQT A;  2YKO A;  5JVH Q;  3KJF B;  2E9Z A;  2W9B A;  1NK8 A;  3HD1 A;  1HNI A;  1XWL A;  1RTI A;  3J81 j;  3DLJ A;  1S0V A;  4RBU A;  3DLL Q;  4RW4 B;  4CH0 S;  2YBV A;  2CWX A;  3RRK A;  3QJL A;  3EGZ A;  2EVZ A;  1T8E A;  1U6F A;  3BGF A;  1NXI A;  3P49 B;  2DKO B;  2EKY A;  2F7V A;  3DLH A;  1VQ7 S;  1ZM3 A;  1PJ7 A;  3TA0 A;  3CIZ A;  4X64 F;  3ENA A;  1TZ0 A;  3PEH A;  3MPW A;  2OAU A;  4O3O A;  5E41 A;  4KFB A;  5E3C A;  2VPZ B;  3BV8 A;  3TAR A;  4DF4 A;  1XR5 A;  3DDI A;  5HAN A;  3TX8 A;  1YGY A;  4PEO A;  2XZT B;  2CWK A;  4MIB A;  1V5I B;  5JVG Q;  4F8R A;  2V34 A;  2JFK A;  2M70 A;  2IM0 A;  1RAB B;  4OX6 A;  2LQ5 A;  2QSF A;  4DSI A;  1WF0 A;  3PO5 A;  3UE2 A;  3V2U C;  3OXL A;  2FTR A;  1F60 B;  5A8K B;  4KYZ A;  3CXC R;  3BSN A;  1S49 A;  1RT2 A;  3BPD A;  4I67 A;  4Y0F A;  4RZR A;  5EGY A;  3O5T B;  2XZW A;  1S9E B;  2GAH C;  1HAR A;  3PW5 A;  4RNM A;  2N4D A;  1YJV A;  2VUG A;  4ED8 A;  4M5K A;  2HZC A;  2M8H A;  3LQV A;  2OEK A;  1G4C A;  3CDW A;  3ETM A;  2HVD A;  3GB0 A;  1KHV A;  2F4V J;  2DNP A;  4K0K F;  4QWA A;  3TUP A;  4JI0 J;  4UF4 A;  2VJV A;  4Q7A A;  4TN2 A;  1YJN S;  2VA3 A;  1F2H A;  1KQG B;  5HQ8 A;  1EAY C;  4DZD A;  4KH1 B;  3LGH A;  3GYN A;  4ZIW A;  1IKY A;  5HQM A;  3M7V A;  1ROF A;  1WC1 A;  4WE1 A;  3FCH A;  3LWM A;  1OY9 A;  4DFJ A;  5DG9 A;  1RQ0 A;  5L9N A;  1FDN A;  3W2V A;  1WAC A;  2OSR A;  2GQC A;  3NBP B;  2DIU A;  1SKS A;  4Q8E A;  2KH9 A;  3TUJ C;  5F8N A;  1S10 A;  4A8M P;  5D0E A;  4C0O C;  3T5H A;  2IYI A;  1EZZ B;  4Q0B A;  1CJK A;  3PM9 A;  2ERR A;  3W60 A;  2CQI A;  4JYA F;  1TK5 A;  1R31 A;  3W2W A;  2HMI B;  4B3S F;  3M1V B;  4HI2 A;  4DG1 B;  1V6H A;  2DNN A;  1HD0 A;  4DR1 J;  4I2Q A;  4ZVT B;  1JLB B;  2MKY A;  5ETQ A;  1H72 C;  3WX8 A;  5B0C A;  4QIF A;  4K7Q A;  1L3T A;  4M1K A;  4JI1 J;  4ZCL A;  2JJ4 D;  1NH7 A;  3M2V B;  1URN A;  1A0O B;  4JV0 A;  3MMC B;  3FEY B;  2BJ9 A;  1Y11 A;  3HZG A;  4C11 B;  3GFY A;  4N8O A;  3R5B A;  2FY1 A;  1GAO A;  3FZB A;  2AJ4 A;  1IQT A;  2MEW A;  3KLH A;  3GPA A;  5J1E A;  3Q89 A;  1BD6 A;  3SI8 A;  3R5D A;  2WVC A;  2HGL A;  3DOL B;  1TL7 B;  1TUV A;  2V4J A;  1RU1 A;  3WHI A;  4PWD A;  4F0K A;  1FO1 A;  2AIR B;  4TLR A;  2ZH1 A;  2VA2 A;  4DCO B;  2PFF B;  4ZPT R;  4O23 A;  3PHE A;  4X4Q A;  4P7T A;  5KG5 A;  3H4B A;  4H4K C;  2DR8 A;  3RBZ A;  1HMV B;  3OT9 A;  2MQ8 A;  2HQC A;  1IUJ A;  2LQ9 A;  2PGC A;  2H4Y B;  5C2G A;  2Q79 A;  2DNH A;  1S6P B;  2ZDP A;  3OQ2 A;  4BLG A;  1YRU A;  3J7Y U;  1LKZ A;  4QPX A;  2N3L A;  3DOK B;  5CZV A;  3FBC A;  3KUG A;  4DV7 J;  1YJW S;  2VKZ G;  1JNZ B;  4H4O A;  4C3M A;  4K2J A;  5I3U B;  3LA0 A;  2ROE A;  2Y1J A;  4ZPV R;  5HN0 A;  3L7U A;  5D78 A;  1CJU A;  4F3Q A;  3R2D J;  5E5N A;  4F2R A;  2OHD A;  3SBM A;  3BGR A;  2FHJ D;  4ED0 A;  1FF2 A;  1RE1 B;  2XNQ A;  1FRX A;  2BR0 A;  1SL2 A;  1J5O B;  4IFY B;  1HYS B;  5EN1 A;  4HI1 A;  2KFZ A;  3BZQ A;  4Y6I A;  1WEZ A;  2QTW A;  4HLB A;  4AD6 A;  5I3P A;  2DJW A;  3CWJ A;  2XY6 A;  2UXC J;  1BE4 A;  2DGV A;  2IAJ A;  5KFO A;  5F8G A;  2BX6 A;  2VC1 A;  1E6Y A;  4QR0 A;  4IOA Q;  1P9Q C;  4USK A;  3MR3 A;  2XLJ A;  3N9U C;  2IC3 B;  2HHP A;  4ZP9 A;  2GC8 A;  3PKM A;  2ROP A;  2VV5 A;  2PSZ A;  1VDH A;  2P2C B;  5AE3 A;  2J9D E;  4HAC B;  3JSM A;  2RUG A;  4FKY A;  3CCL S;  3CC2 S;  3S7R A;  3WC2 A;  5DG8 A;  4CTA A;  2CJB A;  5T14 A;  2MY8 A;  1JX4 A;  1WF1 A;  4NZ0 A;  1IKV B;  1S1T B;  4OYX A;  3ZZY A;  3R3T A;  1AXQ A;  3OXG A;  3G4S S;  2KZM A;  1QSL A;  2YQ3 A;  1WC4 A;  2W9C A;  1MG7 A;  2B5J A;  3MR5 A;  2HQF A;  3NEK A;  2XB2 D;  5LXY A;  5F8M A;  2GJI A;  4F02 A;  1HQE B;  1Q4R A;  1RT5 B;  4JI3 J;  2AYE A;  1Y7P A;  2JDJ A;  3AOA A;  3M30 B;  4CCH A;  2J9D A;  3FC9 A;  1OYD A;  4H4K A;  2ASY A;  3N01 A;  4ECU A;  1T94 A;  4NXN J;  3AB4 B;  1NB2 A;  1FRK A;  4TY8 B;  2Y8Y A;  2JRS A;  3QQC D;  2GO8 A;  2XI2 A;  4F67 A;  2QMU B;  1GEH A;  3DRS A;  2VJU A;  2SXL A;  2AP6 A;  4MIA A;  3LAN A;  5L39 A;  5LSO A;  2O01 C;  4LBP A;  2IRY A;  3JS9 A;  5HAO A;  3Q86 A;  3HSD A;  2FJV A;  3MOJ B;  3M2R A;  1NAQ A;  2HNZ B;  4FF1 A;  3RB4 A;  3R9L A;  1I51 B;  4FPI A;  1CEZ A;  1YKW A;  2B4P A;  1VQ6 S;  4IO9 Q;  3AJ2 A;  1KRP A;  3NCP A;  2XMA A;  4HKQ A;  2CAD A;  4HVZ A;  4LVN P;  5D3G A;  2GHP A;  4RW7 B;  3MMA B;  1X5S A;  2GA7 A;  1HI0 P;  1WUU A;  1A7G E;  1XER A;  1GXU A;  2XMW A;  4PG4 A;  2QLF B;  3VVU A;  1RWN B;  2GGP A;  4PPZ A;  1XC9 A;  3K5P A;  1MRO A;  2PDA A;  1Y5I B;  1F9F A;  1S12 A;  1FX2 A;  4DU8 A;  3GIM A;  3D1Q A;  4PQU A;  3CC4 S;  1C4C A;  2AW0 A;  1UA1 A;  2RVJ A;  2MQO A;  3NMA A;  1VLY A;  1IBL F;  4J5O A;  4GKJ J;  4NEY A;  2HG4 A;  3F73 A;  1WD6 A;  4UW2 A;  2ZD1 B;  4LRD A;  1LW2 B;  3AB2 B;  3H20 A;  2OP5 A;  2CQD A;  1S1X A;  1J27 A;  1LK5 A;  3HKW A;  2MLZ A;  2BJE A;  3RRG A;  2ILY A;  1K44 A;  4DR2 F;  5KG4 A;  4PG8 A;  3GCX P;  2MHE A;  2OTL S;  2C3O A;  2V2Z A;  3EVW A;  1LWC A;  1JLC B;  4FS1 A;  3HJV A;  3MM5 A;  4FVM A;  3MTJ A;  2WW8 A;  3C6U A;  3UQS A;  1Q81 T;  3IA0 A;  4MFB A;  2CA9 A;  3FEX B;  1QE1 B;  4DL7 A;  4RU2 A;  4ID5 B;  2HVE A;  2OPQ B;  1B3T A;  2UU9 F;  5L1K A;  4NWB A;  3R1H A;  1PJ6 A;  1MWZ A;  4U6P A;  4GVB B;  2QX0 A;  3BBF A;  2ZZN A;  1H98 A;  2FZC B;  2G2O A;  4OYO A;  2MLY A;  5DQH A;  4IDK A;  4NLR A;  3TEG A;  2WB4 A;  1T02 A;  2FZG B;  1R0C B;  4RW4 A;  2Z58 B;  3TA1 A;  3ISN D;  2HFN A;  5CD4 H;  3CPW R;  2P9E A;  3O3L A;  1IBC B;  4DSE A;  4N41 A;  1JXL A;  3KNG A;  2ZUG A;  3AHP A;  2G2Y A;  2ZE2 B;  2VPX B;  1SJQ A;  2KYZ A;  3AQP A;  4JP8 A;  1REV A;  5K8O A;  1HI8 A;  1F3F A;  3CED A;  3QAE A;  3Q24 A;  1SL0 A;  2AEF A;  2QGF B;  2QLX A;  2XZD B;  3HXM A;  2EFP A;  4QYZ J;  1B0V A;  4B9L A;  1HBM B;  4WXO A;  3D28 A;  2NYI A;  2MSS A;  1KC8 T;  4MAK A;  2KVI A;  1RT7 B;  5A8K A;  2BA9 A;  2BBE A;  3TI0 A;  4HT7 A;  4OYW A;  4TYB A;  1AFI A;  2NR0 A;  5G4D A;  1LXJ A;  2CQG A;  4F36 A;  2QT7 A;  1Q79 A;  1B70 B;  3GTY X;  1H2T Z;  3T1H F;  2IMW P;  4ZJQ A;  2V9W A;  2GQQ A;  4I2P B;  2BQU A;  3M8P B;  4DDF A;  5HMW A;  4K4S A;  2H54 B;  1LOU A;  3EE3 A;  3KFW X;  3MPV A;  2PA3 A;  1H7W A;  5E33 A;  2OFG X;  1MU2 B;  3OR1 B;  4TU7 A;  4YY3 F;  2KDO A;  3QO9 B;  2KO1 A;  1C2P A;  1DLO A;  4W4M A;  4B9M A;  5K20 B;  2UVU A;  5D4L A;  3P3D A;  4Y65 A;  2QL9 B;  2Y8W A;  2VBW A;  1E6V B;  1Y10 A;  2CPD A;  1S79 A;  1UVM A;  3I56 S;  1TL1 B;  5DJB A;  4Q44 A;  5HP1 B;  3BN4 A;  1BLU A;  3QT7 A;  1RK8 A;  2HLT A;  1TAU A;  1ZAW A;  3M8R A;  2ADB A;  1JIH A;  3B4D A;  2HMI A;  3ZTP A;  3M1V A;  1X5P A;  2CZV C;  4UY8 T;  4DG1 A;  4FP9 A;  4IUF A;  3BQ0 A;  2PC6 A;  4NE9 C;  2ZWO A;  2VC0 A;  4LIR A;  1K0V A;  4XK8 C;  3HHL A;  2KG1 A;  4FXW A;  3PO4 A;  2D74 B;  4WPA A;  2JLE A;  3IAM 9;  3Q8Y A;  1TV6 B;  2MKH A;  4JBC A;  2PMZ D;  2UUB J;  3MMC A;  2NUH A;  4C11 A;  1H3D A;  2FHK A;  3GZ7 A;  4GVL A;  3KLF B;  3W1Y C;  2CQ1 A;  4YS2 A;  1D3W A;  2OH2 A;  4DV4 F;  3QRP A;  4P9S A;  3L7P A;  2W1B A;  3DOL A;  4CWB A;  2MPU A;  3PYG A;  4NLW A;  3GV5 B;  2NSB A;  3QLH A;  4ZPC A;  3EIC A;  2VPW B;  2MKC A;  1REG X;  2A6M A;  4IYQ A;  4KHM A;  4IG3 B;  3EGV A;  2OPS B;  5MAO A;  1RAF B;  1EAR A;  5A2Q U;  1HMV A;  2M7S A;  3OTE A;  4NX9 A;  4WZM A;  3PFE A;  1MMN A;  1TKT B;  1PC4 A;  1WHY A;  2FGO A;  1OSC A;  3C15 A;  2HNY B;  3EWG A;  3DOK A;  4ANC A;  3AXK A;  1LWX A;  1TL4 A;  2GW8 A;  3BSO A;  2QJ3 A;  2PT0 A;  2XMU A;  2FPH X;  4WYW A;  4J9N A;  4UOF A;  1JLA B;  3SSQ A;  4LF8 J;  2HBY B;  1PO6 A;  4P72 A;  1FHT A;  2YX1 A;  2J9C A;  3CDU A;  4HH0 A;  1OIA A;  1NHU A;  5A2Q Y;  1Y5N B;  1RHQ B;  4NLS A;  4ICL B;  4B3T F;  4X4S A;  3L3C A;  1X8D A;  3BQ1 A;  4P71 A;  1ZPW X;  1J5O A;  2DNZ A;  2CNN B;  3PJ9 A;  2OUG A;  5HJX A;  4X65 J;  3NGS A;  1SC3 B;  4NLP A;  3A4T A;  1QTM A;  2Z30 B;  5KFV A;  2HSE B;  1KKH A;  3CJ2 A;  2IM2 A;  3PX0 A;  3DLG A;  3K2Y A;  5THW A;  4NLY A;  4J9Q A;  3A13 A;  3H7H B;  4LRA A;  4EFA C;  3HUL A;  5DDR C;  4Z2X A;  5C25 A;  5J2Q B;  2QFI A;  3IC1 A;  1JB0 C;  1U09 A;  5GAE I;  2EBG A;  2HAF A;  1VQ4 S;  2YH0 A;  5M2R A;  2E7X A;  1IKV A;  1S1T A;  1WSV A;  4BWJ A;  4HL9 A;  4ZIV A;  2JEG A;  2QC3 A;  4KPC A;  2H5J B;  5KFG A;  4ILL A;  4M5N A;  2A2D A;  4MTP A;  4CM0 A;  1N33 F;  4IO1 A;  1JXV A;  2ZH2 A;  5CZX A;  3JTO A;  1NDP A;  1HQE A;  3HP6 A;  1RT5 A;  3SIP B;  4ALZ A;  4NAS A;  2EFN A;  2FJA B;  2PI4 A;  3OTO F;  4YB1 P;  3M30 A;  4AT1 B;  4MYU A;  3EZ5 A;  1S0O A;  4WBF A;  3C6T A;  4DQP A;  2IDL A;  5ITH A;  5CYM A;  3GJR B;  3TQ1 A;  1FKO A;  2XHW A;  1C1B B;  2BMB A;  4ERD A;  5KG6 A;  2J7W A;  2A1B A;  1JLQ A;  5ETV A;  3RYL A;  1IKX A;  4TY8 A;  3K5M A;  1KP6 A;  2IJF A;  4BHQ A;  3B54 A;  1Q0N A;  3GWC A;  4E0D A;  1GXL A;  3PJW A;  2IRU A;  3VQS A;  3G8T A;  3KKF A;  3K58 A;  4YP3 A;  4RUB A;  1WKL A;  2QYG A;  2MQN A;  1HKA A;  2FDN A;  4TQR A;  4LR9 A;  4DS5 A;  4IRD A;  3I5C A;  4NLT A;  2FD2 A;  2HVH A;  1MWQ A;  4DL0 C;  4I4B A;  6FDR A;  5E2Q A;  5LMN F;  1S7H A;  4PR6 A;  2LMI A;  3JQJ A;  5J2P B;  4DV5 F;  2J5A A;  2ZFH A;  2ZC3 A;  4RW7 A;  1DUR A;  2V68 A;  3QGP A;  4C0H A;  3LP1 A;  2EFG A;  2MMY A;  2E7W A;  1X7V A;  2AJF E;  2BV3 A;  1SIZ A;  4IQX A;  2G1D A;  2J7K A;  2YX4 A;  4V19 X;  3CCS S;  3PRB A;  4ES3 A;  1VBY A;  2M0G B;  1K9M T;  2Q1L A;  4HTJ A;  1TL3 B;  3LTO A;  4EZ6 A;  3CJS A;  4G1P A;  2R2R A;  4BS2 A;  1PJ5 A;  2MTL A;  3AOB A;  3CD6 S;  1G2E A;  5DDP C;  3MCN A;  1Y3K A;  3EPI A;  4DL2 A;  3FNN A;  4Y3C A;  5I3Q A;  5F0U A;  1LW2 A;  4P2S A;  3RW7 A;  3NLC A;  4MK8 A;  4W92 B;  8AT1 B;  2VON A;  5FDL B;  2E1A A;  2DHG A;  4FXV A;  3CJT A;  1OO0 B;  2U1A A;  4DSK A;  3CJK A;  3RR8 A;  1CS4 A;  2P9G A;  1YTY A;  4OLO A;  1CC7 A;  4D3H A;  1GMU A;  3CO0 P;  1JLC A;  2CDQ A;  5D0H A;  1QUP A;  4KPY A;  3GJT B;  2XGQ A;  5F3Z A;  3QT8 A;  3DXS X;  1QE1 A;  1IBK J;  4WFN Q;  2OPQ A;  5SZT A;  1NK6 A;  2DIV A;  3ZO7 A;  2GX8 A;  1RTD B;  2GJF A;  5GAH U;  3G96 A;  1ZTW A;  4IH6 A;  1VGY A;  1W2B R;  1CJT A;  2A10 A;  1J5E F;  3M32 B;  3VWS A;  1ICE B;  2JEI A;  5E7O B;  2B43 A;  2DT9 A;  3CJ4 A;  2LQB A;  2IRX A;  3OL9 A;  3TA2 A;  3IS9 A;  1ZAV A;  3R2C J;  5DM7 Q;  3OBI A;  3US5 A;  1AZS A;  1F9H A;  1IXK A;  4F4K A;  3DM2 B;  1HBN A;  2COL A;  4OMF G;  2NXC A;  1XMQ F;  5KOW A;  1CVJ A;  2FUG 9;  5A6W A;  2OJ3 A;  1R8P A;  2FQQ B;  1KVJ A;  1PYT A;  4C8Y A;  2FJE B;  4CLU A;  4ER8 A;  4YN3 B;  2ZOM A;  3V6K A;  5KG7 A;  1XJW B;  4NL5 A;  2PEB A;  3C14 A;  1U1K A;  2CQ4 A;  1HBM A;  2FLL A;  3KLI A;  1Q8K A;  1DTQ B;  3QRQ A;  2DH9 A;  4LVO P;  2RHS B;  4X65 F;  2MLX A;  4KY3 A;  1RT7 A;  3T1Y F;  4X84 A;  1M5V C;  1UPP A;  1NU4 A;  2V4R A;  1JWW A;  1VQN S;  4F4A A;  3UCG A;  5A6P A;  4CT9 A;  3OTB A;  4EGL A;  1JNR B;  4CLZ A;  3G6E S;  2V8H A;  3HMJ G;  3H42 A;  1KBR A;  2XS5 A;  3KDN A;  2GCF A;  4L3K A;  3CT9 A;  3GON A;  2LVW A;  1RKJ A;  3M8P A;  2KRR A;  4DLE A;  1UVN A;  1HNZ J;  1RCO B;  5IT9 U;  4CLY A;  1V3R A;  1MU2 A;  1WG5 A;  3OR1 A;  3RZA A;  5B0B A;  5FLX U;  3QO9 A;  4ED1 A;  5D0R A;  2GNK A;  3BSC A;  3AH6 A;  4DUZ J;  1E6V A;  1H6K X;  5B7W A;  5KT6 A;  1UKU A;  3VAH A;  2QA1 A;  4EU0 A;  1U1L A;  3WC0 A;  4P2F A;  2R7Q A;  1L3U A;  4ZVR B;  4PWW A;  2PD1 A;  4DJB A;  5GMK a;  4DU7 A;  3GQC A;  4RKU C;  3PYF A;  2MYF A;  2E5G A;  1GMW D;  1YZ7 A;  3EYZ A;  2IY5 B;  1MLA A;  2V9K A;  1UA0 A;  1GH8 A;  4O3S A;  5FLX Y;  2DHS A;  2JWN A;  1TV6 A;  1S0N A;  1FEH A;  5KFR A;  2AYB A;  1CUL B;  2BE2 B;  1KNZ A;  3D67 A;  3H8Y A;  3KLF A;  2P6S A;  4OLP A;  1GT8 A;  4KC5 A;  3V4M A;  1WEY A;  1LQ9 A;  2DGS A;  4K8R A;  1QVF R;  1NK7 A;  2MZT A;  3PFO A;  1AFJ A;  1KTV A;  3CCT A;  5F41 A;  3PJX A;  4KTQ A;  2EXU A;  4WZQ A;  3DU5 A;  1S1W B;  2HEK A;  3DHW C;  2I9S A;  1WTB A;  4PXE A;  2OPS A;  3DRR A;  4NYP A;  4Q2L A;  5HLF A;  3SQG A;  3UWT A;  4KO0 B;  2QIF A;  3PZP A;  4H4M B;  3NNC A;  3K57 A;  2IVF B;  2HHQ A;  3ENW A;  4FF2 A;  1Z4U A;  3I5A A;  3J7Y I;  2FVR A;  2I38 A;  2HNY A;  3KK2 A;  1VRQ C;  2V6A A;  2VG6 B;  2KT5 A;  3LPE A;  3D6M B;  2OGU A;  1RWU A;  4B02 A;  4CQ1 A;  1Z2L A;  1JLA A;  1OS5 A;  2N7Y A;  3JYT B;  1N34 J;  1F2G A;  4ZVE A;  5K14 B;  1TUG B;  3D3B J;  4DR7 J;  1FRM A;  4A8W A;  1WF2 A;  3T5L A;  4ICL A;  4CO0 A;  2B7C B;  4U8Y A;  4K5S A;  4NLD A;  2DR9 A;  5CD4 A;  1LWF B;  4PYA A;  1NSA A;  1BGX T;  1IR1 A;  3N0V A;  4DHV A;  4DV1 J;  1RHM B;  4XAK A;  1X0F A;  3U1M A;  2QMW A;  2WBR A;  3LUY A;  3FKB A;  2GHV C;  2PII A;  4KRW A;  2G13 A;  3T5K A;  4RR5 A;  3G9C A;  1IVZ A;  3NXZ A;  3G87 A;  4FPR A;  4O3P A;  4K4U A;  2VFS A;  5J2Q A;  3BDP A;  5B0E A;  4RU9 A;  1DQ8 A;  2DO0 A;  1HW8 A;  2NXU A;  4WFZ A;  2F40 A;  4KGZ B;  2ZNY A;  3DRP A;  2BJD A;  4QCL A;  3V81 A;  3SCK E;  3FJ2 A;  5IQQ A;  1U1R A;  2J8A A;  1RWM B;  4A8X A;  2QL7 B;  5I4M A;  2XCA A;  2MJN A;  5K8P A;  3PKY A;  3FFI B;  1NJX A;  4X62 J;  5M2P A;  1T95 A;  3TAN A;  2WOM B;  1HNW J;  5M2U A;  4LJM A;  1EKR A;  1TK0 A;  4ECR A;  1U02 A;  2B51 A;  4I1T A;  3B82 A;  3G8Q A;  2BRK A;  3EVO A;  2JEJ A;  3MMJ A;  3KJN B;  3QYY A;  1RWW B;  2B9W A;  4U7U D;  1QLN A;  4L75 A;  2VG7 B;  5L8R C;  3C3L A;  2KHC A;  3VV2 B;  3RGI A;  1JKH B;  2ZZT A;  3IM8 A;  3SSR A;  2IIH A;  4JV2 A;  4KHP J;  4QWB A;  2YKN B;  5CCL A;  4WTO B;  3ENV A;  2Z2Z A;  5IC4 B;  3MCS A;  1C0T A;  3AJD A;  4UOG A;  1HWJ A;  3THP A;  5HBM B;  3VVT A;  1U7L A;  2W8K A;  3LO3 A;  3Q8P B;  2DXD A;  2IFX A;  2IPO B;  1MMD A;  2VBX A;  4LF5 F;  4JB8 B;  2FJD B;  3HHN B;  5KFQ A;  3BKU A;  4Y34 A;  1T05 B;  2DIT A;  2V4Q A;  1VJQ A;  5J2P A;  2YX7 A;  5KFN A;  1UFW A;  5BXI A;  4ILR A;  3W9J A;  4LF1 A;  4YME A;  3Q2S C;  1RP5 A;  3EGW B;  3SZ2 A;  3VQT A;  3RTV A;  1VIS A;  2NPF A;  1HQU B;  2K1R B;  2OI2 A;  2NYH A;  2QG9 B;  2ZOF A;  1T0T V;  2BAC A;  1RHJ B;  4E98 A;  4E2F B;  4U9R A;  3KMQ A;  1TL3 A;  2UUA F;  2E1P A;  3BR8 A;  2BDP A;  3D6F B;  1S76 D;  5IT0 A;  1Y5L B;  4OHV A;  1L3V A;  4MMO A;  1M90 T;  4DUZ F;  3TO8 A;  3UR0 A;  2ATL A;  2CQC A;  1LEO A;  2DXF A;  5F8I A;  2ACM A;  4FN5 A;  5D8H B;  4LF2 A;  3W63 A;  3CUN A;  3QGI A;  3ETO A;  4ED4 A;  1D9A A;  4OI6 A;  4OHZ A;  4Y2C A;  1OQ6 A;  1EJ7 L;  2B6A B;  2CVE A;  3MM6 B;  1AB8 A;  3UFC X;  2AKW B;  4O44 A;  3KJV B;  2F8H A;  4WWS A;  4F4Y A;  2EFQ A;  2RS8 A;  3H5U A;  1U1P A;  1RIS A;  4EBE A;  2JX2 A;  3GSD A;  1Q8I A;  2DNG A;  5H9F J;  2UUC J;  4K4V A;  2HBR B;  3AD9 C;  3MEK A;  4USH A;  2Y1I A;  3UCU P;  4IR1 A;  2D69 A;  3Q2T C;  3KWM A;  4QWC A;  2GV1 A;  5J2M B;  2YTC A;  3M8Q B;  4O0N A;  3LAM A;  3AFG A;  3FSY A;  4OX8 A;  3UNY A;  5LMU F;  2MZQ A;  2WSE C;  4CZC A;  2WTF A;  2QLB B;  1RAD B;  3CJ3 A;  3HK2 A;  1H74 A;  2HND B;  1RTD A;  3D4J A;  2WON A;  4NI2 B;  1O8B A;  1JK9 B;  3EDR B;  2GFF A;  3H0P A;  5BJR A;  2DGX A;  2OPP B;  4UT4 A;  3ZTQ A;  2KYX A;  3IBC B;  3M32 A;  1DQ9 A;  1SB6 A;  2HFS A;  4DV3 F;  1H73 A;  2O1P A;  5ETP A;  4URG A;  3C19 A;  2QV6 A;  4PRF A;  2V50 A;  3CCQ S;  4NA3 A;  3TR5 A;  3I32 A;  5U47 A;  1RSC A;  4J9S A;  5KFX A;  4OQJ A;  5H9F K;  2P6T A;  1FA0 A;  2GVZ B;  5D0G A;  1K47 A;  1VQM S;  4CYU B;  3VGV A;  4Y28 C;  4LMZ A;  2R7X A;  1UWA A;  1VIO A;  3DLE A;  3DM2 A;  1RWO B;  4MKA A;  4Q8F A;  3MEC B;  1D9D A;  1IR2 A;  1NUE A;  1F0X A;  3JSY A;  3BH7 B;  4LFB J;  1VRT A;  4YDD B;  4DX5 A;  3VGU A;  4OJ1 A;  2DY9 A;  5B0F A;  3QT6 A;  3HFZ B;  5CXT A;  4LFC J;  3MUT P;  4C8Z A;  4DR7 F;  4UUX A;  5ETO A;  3RG6 A;  3IWN C;  3PAC A;  4LF7 J;  3PYD A;  3UDV A;  4CIO A;  1VBZ A;  3GFX A;  1JQG A;  1DTQ A;  4G1Q B;  2YNF B;  5CYQ B;  2ILZ A;  4KHR A;  4ZLJ A;  4C97 A;  1UET A;  1KEK A;  2AX0 A;  1UAW A;  2DNM A;  2YNH A;  1UL3 A;  2VD3 A;  3OL6 A;  1PKU A;  1RHK B;  2AMC B;  2XTJ P;  2N3O A;  4DSL A;  4RBT A;  2B9E A;  2AWZ A;  1NZA A;  1H2U X;  3KTQ A;  4M5L A;  3CJR A;  2JLF A;  2UXB J;  3J80 U;  3OPK A;  5H9E K;  4GKK J;  3MUV P;  1H0H B;  1Y3J A;  4WP9 A;  3J81 U;  4PCQ A;  1HWU A;  2C2E A;  1U0H B;  4RLE A;  4EBC A;  1CJV B;  5B0D A;  5KFC A;  3OVB A;  2ZIT A;  4NXM F;  1CLF A;  1KQK A;  1ZM2 A;  3BBB A;  5J2N B;  5IT4 A;  3BN7 A;  5KT2 A;  2FY8 A;  3FMB A;  1O5J A;  2KI2 A;  3UD4 P;  4B08 A;  2XSJ B;  5C24 A;  3A3N B;  3GIJ A;  2GIR A;  2HPU A;  4CO4 A;  2W7P A;  3HVT A;  1WI6 A;  4TQS A;  3J81 Y;  4AND A;  4EYI B;  1S6Q A;  1N54 B;  2DY1 A;  2E5H A;  2AEM A;  3EVM A;  2GMJ A;  3RAM A;  5L38 A;  2FHM A;  2MZR A;  5H1S V;  2LU2 A;  4CM2 A;  1FXD A;  4EK2 A;  1NDL A;  2DCU B;  3FSX A;  1N0U A;  3P8B B;  4WU2 A;  3D1O A;  5G0R B;  4B3M J;  4GO5 X;  1V3S A;  1HFE L;  1U45 A;  2J6T A;  2BE2 A;  3FBB A;  4DV2 F;  3OR2 A;  2HZA A;  2R7O A;  4DR6 F;  3NY0 A;  2DEJ A;  2LDY A;  2OEM A;  1N36 J;  1M5S A;  3H40 A;  1NK5 A;  1LNQ A;  3GFH A;  1YHQ S;  2CPF A;  1ZS6 A;  4JI4 J;  2MY7 A;  4TU8 A;  4CH1 A;  1YBA A;  4A8K A;  2FYX A;  4X4O A;  4ZJL A;  4JI5 J;  4PXC A;  3BF4 A;  4LF9 F;  1D1U A;  4KO0 A;  2ZJP Q;  1YDL A;  2RAQ A;  3C66 A;  1G1X A;  4QIE A;  1CQM A;  3DRY A;  3ITH B;  4ZP6 A;  2VIH A;  1F3V A;  1N5V A;  3V4I B;  2VG6 A;  2F8M A;  1P1L A;  1SUQ B;  4B3R F;  3OVS A;  1VYA A;  4LF6 J;  1N5Y B;  2H4W B;  4ZDN A;  1S9G B;  2CQH A;  2K3K A;  4M5D B;  3JYT A;  4X64 J;  1EKS A;  2CJ9 A;  3FQL A;  2FVS A;  4CH7 A;  1FES A;  1Y4Z B;  4U67 Q;  1U0S A;  1N5Q A;  2DNR A;  3MAH A;  2A2C A;  1CG2 A;  2G0C A;  3LP0 B;  3MF5 A;  3TAM A;  4O3N A;  2DXE A;  3K5N A;  4YHH F;  2NQP A;  2V67 A;  1NKB A;  1YIT S;  4GO7 X;  3QFW A;  3NG8 A;  3BB5 A;  2AQ4 A;  2Z56 B;  1FKA F;  2E29 A;  2GVD A;  2WB1 D;  3AY0 A;  3TEH B;  2FHJ A;  3LGM A;  1CC8 A;  1TL5 A;  4USW A;  2W7O A;  2MQQ A;  3QJJ A;  2IVY A;  2HFZ A;  4OFZ A;  1YJ9 S;  2FGC A;  1VQK S;  2QFJ A;  2HHW A;  3NKY A;  4YFU A;  4WF9 Q;  2HRY A;  5C2C A;  3U1N A;  2O3D A;  2Q66 A;  2POK A;  4ZPW R;  2XMM A;  4YR2 A;  2CJY B;  3D9B A;  5HMZ A;  1TMM A;  1VHF A;  3I9V 9;  1HR0 F;  2MXY A;  3J7A N;  5KFM A;  3QJP A;  4LRC A;  5BYR A;  4IOB A;  1BQM A;  4F50 A;  4ECZ A;  1IQZ A;  3T41 A;  1FWL A;  2YKM B;  1BY9 A;  2VU5 A;  3ZTO A;  3GLJ A;  4ID8 A;  4QW9 A;  4FDF A;  2K7K A;  3D0I E;  1X5O A;  4V1A k;  3P6Y C;  3MHY A;  3I82 A;  1XEZ A;  4AUK A;  3BDE A;  4QWE A;  4CNZ A;  2ZH9 A;  4JYA J;  1M5K C;  4LFB F;  2WAQ D;  1IKW B;  2KL8 A;  4C48 A;  4B3S J;  4DR5 F;  3V6D B;  2W2M P;  2ZOG A;  3H90 A;  3GJS B;  2XQC A;  2DCL A;  2KVQ E;  2HGM A;  2B9X A;  3M2U B;  1NDK A;  2DR5 A;  2RJZ A;  2DNO A;  2DH7 A;  1S1V B;  5BR8 F;  1VBK A;  3TQE A;  2HGN A;  1P8G A;  3M8W A;  2KZZ A;  5KFD A;  1RUS A;  2EPI A;  3AD7 C;  1UW9 A;  3BO3 A;  4GMK A;  3H98 A;  3BYR A;  3QIP B;  5HBM A;  1QSY A;  1P6T A;  4KGM A;  3OLB A;  1TKX B;  2CUY A;  2WK4 A;  3HKZ D;  1T05 A;  5HVF A;  4IFV B;  4ZVU B;  5F9L A;  1RT3 A;  1I94 J;  1KOO A;  4FVC A;  4J9U E;  5F3T A;  5KFY A;  3HZE A;  3R7B B;  4F7V A;  4TLQ A;  3OFG A;  3OFF A;  4R8U B;  1RT1 B;  4OZ3 A;  1WOO A;  2JVO A;  3TP2 A;  4C4W A;  3NGU A;  2KJV A;  3BGL A;  1U6B A;  3ISN C;  5CCM A;  2YXL A;  1B7Y B;  1HNV B;  2RQK A;  1NO8 A;  1UZH A;  4R5P A;  2O67 A;  1FXL A;  3WDO A;  2QA4 G;  1WG4 A;  1X4F A;  4ED7 A;  1VLO A;  9RUB A;  1KLM B;  2V2V A;  4BC7 A;  2VFU A;  2Z0G A;  3RBE A;  4QU6 A;  2B6A A;  2VG5 A;  4ZP8 A;  1PBA A;  1SJF A;  1GTH A;  4X4U A;  1NPP A;  4NCA A;  1UVK A;  1YBT A;  2B4V A;  3ZC4 A;  1FNX H;  4ZA1 A;  1N5T A;  2XMT A;  1KR4 A;  3IRX A;  4K4X A;  2NUU G;  3MMB B;  5D4P A;  4ZIT A;  5J2M A;  4YR3 A;  1TVR B;  3CMA S;  3M8Q A;  1F1B B;  3N6L A;  4N47 A;  3WIV A;  2H51 B;  1KVK A;  2V8G A;  2CPZ A;  4BC9 A;  4L72 B;  4WCE Q;  3VAM A;  5GAH I;  1N4L A;  2R7V A;  2ZHA A;  4NI2 A;  4FNI A;  1VIX A;  1QAX A;  3GE9 A;  2DH8 A;  4CLP A;  3F0N A;  1TKZ B;  2OPP A;  1TTH B;  4O3Q A;  5FJ4 A;  1S1U B;  1VBX A;  3D7S B;  5LSL A;  3PW2 A;  2BEF A;  4PUO A;  2KG0 A;  1XIQ A;  3X3U A;  1L3K A;  3MXH P;  1PAE X;  1GMV A;  3DOM B;  1IJE B;  5C7P A;  1IWA A;  2GO9 A;  1XTZ A;  1X9W A;  1HA1 A;  1Q7L B;  2D3Z A;  3P96 A;  2ZJR Q;  5ETK A;  4LF6 F;  3MEC A;  2VBY A;  2FLP A;  4UUW A;  4AYB D;  1TAQ A;  4P2M A;  2MQM A;  1KVI A;  4I68 A;  2DO4 A;  2YNG B;  3BO4 A;  3R6L B;  2CG4 A;  2PFD A;  1GK8 A;  1WC0 A;  7FD1 A;  2IJN A;  1R3N A;  4ZOS A;  4UST A;  2CPY A;  1MN7 A;  5SUH A;  3NNA A;  2ASL A;  3M05 A;  3KHH A;  2YKQ A;  2MKK A;  3TW0 A;  4G1Q A;  2VBZ A;  2WRM A;  5CYQ A;  1W25 A;  2RF2 A;  3ILI A;  2HVI A;  4OHX A;  3N5B A;  2JHE A;  3M6V A;  2X1A A;  4ED5 A;  4NLO A;  3NOG A;  5T41 A;  1XMO F;  3MWB A;  4L73 A;  2VFT A;  5EDW A;  2KM8 B;  1KOH A;  1GX6 A;  3DI6 B;  3I4P A;  3VAG A;  2VQF F;  4ECQ A;  2ZM6 J;  4HDH A;  1H38 A;  1U0H A;  3K59 A;  1SQF A;  5KFF A;  3LH2 S;  2BAN A;  4RW8 B;  2PI5 A;  1CJV A;  1FRL A;  3UVJ B;  1NZ8 A;  1U2F A;  1JLE B;  2Z4P A;  2DTJ A;  1WKK A;  1QTN B;  2NXJ A;  4ZS6 A;  2CPH A;  3DMJ A;  2RKI B;  4NRT A;  1NBE B;  5KFP A;  1QY7 A;  2LQJ A;  3ZTR A;  2XSJ A;  2JEF A;  1R0B G;  5F9N A;  3CJQ A;  4ELU A;  2XWX A;  4DXL A;  1LWE A;  1Q5Y A;  2G9O A;  3Q83 A;  5KFU A;  4MJK A;  4JI8 F;  2HQ3 A;  1X9S A;  4X4P A;  3CCW A;  4I6W A;  1HBU B;  2ZH8 A;  1IBL J;  1T9U A;  3MD1 A;  1X4H A;  3H59 A;  1Q8L A;  5BYS A;  4JI7 F;  1Q53 A;  2KXH A;  3TNV A;  1EP4 B;  2KRB A;  3FCW A;  4OZ5 A;  5T7L A;  5G0R A;  4AXJ A;  2R7R A;  5GVQ A;  3OHB A;  2YQ1 A;  2VB6 A;  1BWE A;  4K4Z A;  4DR2 J;  1FTR A;  2W4P A;  4L6V 3;  4C98 A;  3L09 A;  2CQ3 A;  1HI1 A;  2HLU A;  3TWZ A;  5KFE A;  5B0A A;  2ALZ A;  3BPS P;  1RBO B;  4FNH A;  2RSQ A;  5EWE A;  1BMQ B;  1KWM A;  1RJJ A;  2UU9 J;  2G0I A;  3MPU B;  3SV4 A;  2HHS A;  5KT3 A;  1Q16 B;  3HM9 A;  2H65 B;  2RU9 A;  1FRI A;  3NP5 A;  3FK4 A;  2AEJ A;  3S1T A;  1TFW A;  1AYE A;  2GHW A;  4GC6 A;  1I94 F;  1SXL A;  1EET B;  1RTH A;  3OFH A;  5LM7 E;  1SV5 B;  3PW7 A;  1RTJ B;  2E5I A;  1FWP A;  2DR7 A;  4A48 A;  1KN6 A;  3V4I A;  3NWR A;  4DFK A;  3O44 A;  2C3Y A;  3MEE A;  2E5J A;  2I8E A;  1S9G A;  2M88 A;  2HFU A;  1M5H A;  4NA1 A;  2K3I A;  3TZZ A;  3VTI A;  3AXM A;  4M5D A;  4X4R A;  3IN5 A;  3SXL A;  2FZK B;  4O4G A;  2O66 A;  2K7J A;  1SJ3 P;  2AGQ A;  3B8H A;  4C0B A;  3B6B A;  3SFG A;  5HL7 Q;  3LPY A;  4A47 A;  1Q95 G;  4NCB A;  2VFR A;  2OML A;  3SQO P;  4C2M A;  1R0A B;  2J6S A;  1VK8 A;  1SKU B;  5I42 A;  2VHG A;  1BUX A;  5J1N A;  1FI4 A;  1RBA A;  4CLS A;  1HW9 A;  1X4G A;  2DHH A;  3ADA C;  2IDE A;  3DNC A;  4O0I A;  4NEZ A;  1FFG B;  3HPO A;  4HT5 A;  4OV6 A;  1O0P A;  3CC7 S;  5ETR A;  3SDE A;  2J6U A;  4FBU A;  2BKP A;  2QO3 A;  3WX4 A;  5CA5 A;  3CGI A;  5EWF A;  4DV6 J;  1QVG R;  1L5U A;  3R7S B;  3RAQ A;  3H2L A;  1AUS L;  2HHV A;  2XG8 A;  1FTC A;  3T1H J;  2K2P A;  3M9M B;  1FK9 B;  3SCJ E;  3KLE A;  3LP2 B;  5IWA F;  3ILO A;  3O8W A;  1TK8 A;  4PAA A;  4DSJ A;  3OUY B;  4YY3 J;  1ZM9 A;  2W9B B;  2W4C A;  2RQC A;  3A8E A;  1HNI B;  2YKM A;  1XQI A;  5D4N A;  1GXT A;  1ZTT A;  3R97 A;  3VHQ A;  1S6O A;  4ZVP B;  2HK3 A;  2CZ4 A;  4JI2 F;  3OXF A;  1HBO B;  2B56 A;  5JXS A;  2RS2 A;  1IN0 A;  1UVL A;  1YBU A;  1PGZ A;  4KFB B;  2QA2 A;  1VS3 A;  2VDI A;  2PE8 A;  4YB6 A;  1K1S A;  3HCX A;  2J76 E;  2BW2 A;  1RLD A;  1S72 S;  3KHL A;  2J0W A;  1S1V A;  1I1G A;  2G1H A;  2XY7 A;  1T3N A;  4ZVF A;  2R3V A;  3V6J A;  3UD5 A;  4P2X A;  3QIP A;  3GV7 B;  1M5P C;  3N6N A;  4DUY F;  4URS A;  4C8M A;  2WVE A;  2X3G A;  1TKX A;  4J37 A;  1F9E B;  1IWG A;  1WJ9 A;  2ZUA A;  4DV4 J;  2Y0B B;  3D66 A;  1RT2 B;  4IFV A;  4KJI A;  2KT3 A;  4FYX B;  4DZ6 A;  4Q2M A;  3I0R A;  4CO5 A;  2HUR A;  2EW9 A;  1HWL A;  4M5H A;  4ZVG A;  2HK2 A;  3SCI E;  4MIW A;  2ZM6 F;  4CO3 A;  1BWV A;  1X4C A;  2OFH X;  2UZA A;  1T03 A;  1RZM A;  3D1H A;  4CDI A;  2ZDO A;  4XPC A;  4I7F B;  3Q8Q B;  2RRN A;  4C8N A;  2UXD F;  1HNV A;  4EI2 A;  4F3O A;  3IP0 A;  3GFZ A;  2CRL A;  4MT1 A;  3W2V B;  4KSE B;  4A8Q A;  4B17 A;  1KLM A;  3MDF A;  4KV8 A;  3K5L A;  1M5O C;  2IBO A;  4CNY A;  3G6V A;  2RRB A;  2HHX A;  2KM8 C;  4B3T J;  1S9F A;  1C0U B;  3U7J A;  5IV3 A;  2HAI A;  5AXL A;  4J7C A;  4J9V A;  4DX6 A;  1JMT A;  1BQX A;  4Q45 A;  4QW8 A;  1TVR A;  1OY8 A;  1W7W A;  3BR9 A;  2JFD A;  1VMB A;  1RYS A;  3BBC A;  3GJQ B;  2YNI A;  3MM9 A;  4RW6 B;  1RU2 A;  3SFU A;  4HEA 9;  5AXK A;  4IOC Q;  2MQP A;  3GG1 A;  1OMS A;  2YPY A;  2HZV A;  2CJX B;  5A8W A;  4AFF A;  2MGZ B;  4K4W A;  5ETN A;  2V63 A;  1GX5 A;  5LSR A;  4P74 A;  4HR2 A;  4PWD B;  2WCX A;  4Q5V A;  4TKT A;  2OEJ A;  4U96 A;  3A8I A;  4G1I A;  2LYV A;  2QMX A;  2M9K A;  2B4U A;  2DBB A;  1KON A;  4TY9 A;  3DOM A;  2KFY A;  1X5T A;  2ABY A;  4CLF A;  4DR3 F;  1N33 J;  3P45 B;  3HLU A;  1Z2Z A;  4TNO A;  2HHH F;  2XMK A;  3KK3 B;  1WDT A;  2ZHB A;  2QSW A;  3BS9 A;  4RWW A;  4PKD B;  4GRS A;  2CNL B;  3OTO J;  2CQP A;  3PY8 A;  1RDR A;  1DTT B;  3SCL E;  1UEU A;  2DPI A;  2P8I A;  2R8H A;  3HHK A;  4DS4 A;  1KTQ A;  5HJY A;  4BDP A;  1CJU B;  2MST A;  4D3G A;  3K7R A;  2X1F A;  4B3O B;  3MI7 X;  3BKT A;  4M5G A;  5DQG A;  3RB0 A;  3BGR B;  4ECW A;  2KT2 A;  2R7T A;  3KOA A;  4ELT A;  1JJC B;  4DPX A;  3I6P A;  1B64 A;  4ZVH A;  3H5X A;  1RWK B;  1NSP A;  4A8O A;  1R8A A;  2XMJ A;  2XO7 A;  2DGO A;  5LMN J;  4DV6 F;  3TJA A;  5GAD U;  1PYO B;  4RW8 A;  4CTA B;  2PMW A;  1S9E A;  3CVK A;  4DV5 J;  3HVA A;  1WC5 A;  3CCM S;  1JLE A;  2W24 A;  3ONQ A;  3BQ2 A;  4IRK A;  4LBH A;  2ZNZ A;  4L3N A;  2UUT A;  1VI7 A;  3N5F A;  2R8K A;  5LOQ A;  2LXI A;  4JUZ A;  3PR5 B;  1FJG F;  5IFM A;  4DV0 F;  1X31 C;  2HVZ A;  1X9M A;  1ZAX A;  4OV1 A;  2DR6 A;  3QSI A;  2OPR B;  1UJ6 A;  3AD8 C;  4PXB A;  3MAA B;  3NBP A;  2AU0 A;  3WIU A;  3LW5 C;  4RJV A;  3CCZ A;  2CXE A;  3GII A;  4ETX A;  1S57 A;  4R0E A;  1EP4 A;  4ED2 A;  4DPT A;  3OLA A;  1UW4 A;  4IKA A;  1MML A;  4QIW D;  4OJH A;  3O6Q A;  3SEO A;  3OV7 A;  4IH7 A;  1U1N A;  3ZFV A;  7AT1 B;  5F8J A;  1JLB A;  4KR0 B;  1CPZ A;  3EXY A;  2IM1 A;  2Z2M A;  3K5O A;  4M94 A;  1GMW A;  1WG1 A;  1VCT A;  4OX9 F;  3A3O B;  3M2V A;  3P5T L;  2JZ5 A;  2X7I A;  3B78 A;  1O6X A;  4B9S A;  4ZCK A;  4ECV A;  4F26 A;  2ALY B;  3M2R B;  3K89 A;  2HW3 A;  4W90 B;  2L9W A;  3EX7 B;  2D3U A;  1FDA A;  1DHM A;  3OFE A;  1R8C A;  3W66 A;  1TL7 A;  1HQ2 A;  2GMH A;  2I1R A;  3RUB L;  5J1P A;  5D3G B;  1J5E J;  3KUE A;  2HWH A;  1ZZF A;  1EET A;  4DMZ A;  1RTJ A;  2F1F A;  1VHI A;  1YQH A;  4ZVQ B;  3SMZ A;  4OZ1 A;  4F2S A;  4ZHR B;  4BCA A;  3W3S A;  4Y2A A;  1PSD A;  2GGP B;  3S8S A;  2JNJ A;  3LOU A;  1MRO B;  3RR7 A;  3KHR A;  2R8J A;  3I9Z A;  3PXG a;  4RUC A;  1WEL A;  2WVB A;  5EHH A;  1URR A;  1HNX F;  4PQU B;  1S6P A;  3PYE A;  3GG0 A;  4ZCI A;  1XMQ J;  4MH8 A;  1C4A A;  2BJ7 A;  2BOP A;  3OVA A;  5I3U A;  1X4B A;  4N5S A;  2B0G A;  4LRB A;  3HFK A;  3CF5 Q;  2VIC A;  2E1M C;  5EX0 A;  3TZW A;  3I31 A;  1R0A A;  1G6B A;  4ZKA A;  5L1J A;  3ILJ A;  4NMX A;  2LEC A;  1S1X B;  1UP1 A;  2W01 A;  2XLI A;  4USJ C;  4IFY A;  1HYS A;  2JOQ A;  2LQ8 A;  3D6T B;  4RW9 B;  4RNF A;  1JXE A;  1LWC B;  3ZTS A;  2BZ2 A;  3QWP A;  3DGV A;  4URQ U;  2PEH A;  3MM5 B;  2DNL A;  3T1Y J;  4M5M A;  1N5S A;  1X4D A;  2IC3 A;  5E0O A;  2I0X A;  3HSG A;  3D68 A;  2XWY A;  4CO2 A;  4HAC A;  2KXN B;  1IBM J;  1VOM A;  1ELO A;  5A0Y B;  3CTR A;  1RHU B;  2AJ1 A;  1FK9 A;  2DHA A;  1XR7 A;  5IOL A;  1M1H A;  3LP2 A;  3AA8 A;  3CNQ P;  4CO1 A;  4IDK B;  4PG5 A;  1NPR A;  3DFE A;  4ATN A;  4FF4 A;  5IV4 A;  1VQO S;  2ZBC A;  1T9Y A;  2NPI A;  2ADC A;  3JAM U;  5K8N A;  4TYA A;  3OHA A;  2BJ3 A;  2XSF A;  2J9E A;  4AL5 A;  1HHQ A;  5HSP A;  2M4M A;  1YLX A;  1ZOT A;  4QR2 A;  1NSQ A;  1FD8 A;  3CJ0 A;  2X1G A;  2ZZM A;  1BXN A;  2E66 A;  4F3M A;  2KKH A;  1HBO A;  3DU6 A;  4AQY J;  3HI9 A;  4DLG A;  3HD2 A;  3I4H X;  1J2V A;  3KG1 A;  4M8L A;  1SQE A;  3GP9 A;  4DL4 A;  5ETT A;  4B9T A;  1REV B;  5DRK A;  3M8Y A;  1NJY A;  2HWT A;  3TVK A;  3JAM Y;  2E9T A;  3DLK B;  4LR7 A;  2ZBP A;  4KE5 A;  2HQD A;  1NKC A;  2PA8 D;  4X66 F;  2ASJ A;  4NYO A;  3A12 A;  3CCV S;  1UZD A;  5LL6 d;  1U4B A;  1OY6 A;  2DRA A;  1N88 A;  3KK1 B;  2XS2 A;  2HFV A;  3MZI A;  4NLQ A;  2UVR A;  1U6Z A;  2Q6B A;  2VOP A;  1FNM A;  4NZ7 A;  2BE7 D;  3W5Y A;  4DI6 A;  1JLG B;  4P73 A;  4USM A;  2HNZ A;  1AA1 B;  4XDC A;  3KLG B;  1FFS B;  4RX6 A;  3G6X A;  3DGP B;  4B9V A;  2J0X A;  5C42 B;  3KJQ B;  1S99 A;  2IMO A;  4B9U A;  4ZMM A;  2CQ2 A;  1IM4 A;  2BM0 A;  5L9X A;  2GJ2 A;  3MMA A;  2Z57 B;  4I7F A;  4FF3 A;  2HKE A;  2MHN A;  3HO1 A;  1N32 F;  2H9Z A;  5KFI A;  2DGW A;  3MFI A;  3ZZR A;  2V8V A;  3HVW A;  2RU3 A;  3CD0 A;  3EMT A;  4N76 A;  1DLO B;  3AOD A;  3TUZ C;  1KQF B;  1XNR F;  2B8P A;  1LW0 B;  4DEZ A;  2JL9 A;  3W65 A;  5ETL A;  3KDO A;  1K8A T;  2YWG A;  4Z7Y A;  3ZZT A;  2ZD1 A;  2GML A;  1C0U A;  2OTJ S;  2D1C A;  4WP8 A;  1VRU B;  3HHL B;  5AE2 A;  2G4B A;  4NLV A;  1DFD A;  3UW1 A;  2YVS A;  3GIK A;  5HK4 A;  2JLG A;  1NB7 A;  1ZET A;  3PRD A;  4H54 A;  2PO4 A;  4RO0 A;  4Y00 A;  4OI1 A;  1KQS R;  4RW6 A;  2DEI A;  3D5M A;  3TZX A;  2LKZ A;  4MKY A;  3T1A A;  1OPI A;  2LDI A;  2FLO A;  1U47 A;  2V8D A;  1HPZ B;  2B8Q A;  3IR6 B;  1N6Q B;  4ID5 A;  2MGZ A;  4EMD A;  1ACM B;  1MWY A;  3BEG B;  3QLH B;  2V2Q A;  2GAG C;  4GVB A;  3DN9 A;  2ZC4 A;  3BGO P;  2ZEJ A;  4PQA A;  1R7I A;  3ICL A;  4M95 A;  1YJR A;  1PG5 B;  2B9Y A;  3PTW A;  5KT7 A;  2W4D A;  3K8W A;  3KK3 A;  4PPD A;  5C5J A;  2XNR A;  1KS2 A;  3ENQ A;  4C3L A;  1N8R T;  1ARO P;  3ZZP A;  3C15 B;  1HL6 A;  1UPM B;  1KLN A;  2CPJ A;  3IXQ A;  2FB0 A;  4I0W A;  1WDD A;  4WFA Q;  1TMJ A;  3M6U A;  2ASD A;  2NCK L; 
#chains in the Genus database with same CATH homology
 4LSZ B;  1RWM B;  2DKO B;  1RE1 B;  2QL7 B;  3EDQ B;  4DCJ B;  3R5J B;  2C2K B;  2QL5 B;  1ICE B;  4JB8 B;  3R7S B;  2XZD B;  2QLF B;  2C1E B;  4ZVS B;  3P45 B;  3D6H B;  1RWN B;  1PYO B;  1SC1 B;  2HBR B;  2H48 B;  1PAU B;  1QDU B;  3R7N B;  3QNW B;  3RJM B;  3KJQ B;  1GFW B;  1F9E B;  1RWX B;  2CNL B;  3GJS B;  4DCO B;  2QLB B;  2CDR B;  1RHM B;  1NME B;  2XYH B;  2Y0B B;  2P2C B;  2XZT B;  3R6G B;  2H5J B;  1RHJ B;  3KJN B;  2HBY B;  1RHR B;  2C2M B;  2FQQ B;  1RWW B;  3EDR B;  2H4W B;  3GJQ B;  3GJT B;  2H4Y B;  3D6F B;  3NS7 B;  3SIP B;  5IC6 B;  2CNO B;  2XYP B;  1RHQ B;  3IBC B;  2CJY B;  2HBZ B;  1I3O B;  2QLJ B;  1QTN B;  2H54 B;  1RHK B;  1BMQ B;  2CNK B;  4ZVT B;  3IBF B;  4ZVP B;  4ZVR B;  4ZVQ B;  1RWP B;  2CNN B;  1I51 B;  1IBC B;  2C2Z B;  4DCP B;  3GJR B;  2H65 B;  4ZVO B;  2CJX B;  3KJF B;  3P4U B;  4ZVU B;  1SC3 B;  2H5I B;  3R6L B;  2XYG B;  1RHU B;  5IC4 B;  5K20 B;  2HBQ B;  2QL9 B;  3D6M B;  3R7B B;  2H51 B;  2Y1L B;  1RWK B;  1RWV B;  2C2O B;  1RWO B;  1SC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...