3GJTB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 19
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjtB00
1RHUB 3P45B 2C1EB 2CNNB 2QLFB 3IBCB 3R5JB 4ZVTB 3EDQB 1RWOB 2C2KB 4JB8B 4DCOB 3R7NB 2CNLB 3KJFB 3GJTB 5K20B 1F9EB 1IBCB 1RHJB 2Y1LB 2HBYB 1PYOB 1SC1B 3P4UB 2H65B 3D6HB 3D6MB 2H48B 2QL7B 3R6LB 3R7BB 1RWXB 2H5JB 1RHRB 4ZVUB 1NMEB 3KJNB 3GJRB 1RWKB 2DKOB 2H54B 2CNKB 2XYGB 1GFWB 2H4YB 2XZTB 3GJQB 5IC6B 2C2MB 4LSZB 3R6GB 1RWWB 3D6FB 2CDRB 4ZVPB 1I3OB 1BMQB 5IC4B 2QLBB 1PAUB 1RWPB 2Y0BB 1SC4B 2FQQB 3IBFB 1I51B 4DCPB 4ZVRB 3RJMB 2CJXB 1RHMB 1RHQB 2HBZB 3GJSB 2C2OB 1ICEB 1RHKB 1RWVB 4DCJB 2C2ZB 1RWNB 1SC3B 2XYPB 2QL5B 1RWMB 2H51B 1RE1B 3NS7B 2CJYB 2QLJB 3EDRB 4ZVSB 2XYHB 1QDUB 3QNWB 1QTNB 2XZDB 2HBQB 2P2CB 2CNOB 3KJQB 4ZVOB 4ZVQB 3R7SB 2H5IB 3SIPB 2H4WB 2QL9B 2HBRB
chains in the Genus database with same CATH superfamily
1OS5A 1X9WA 2AU0A 1WHYA 1GNKA 4E0DA 2XWXA 3JTPA 1R6VA 5K20B 1VFJA 4FXDA 4X4VA 3AXKA 4XPCA 3NBPB 5J2MA 3T6BA 1URNA 4RLEA 4UY85 2I9SA 2BE2A 3KK1B 3MR2A 1BE4A 1WACA 2QE5A 5BJRA 4N76A 2ACMA 2RS8A 2DY1A 1XWLA 1B7YB 1FX4A 3TEHB 3J7YI 2PA3A 3GSDA 2D3ZA 4NL5A 8RUCA 1S6PA 4WP9A 5BYRA 3N01A 2CPJA 3GFYA 3KNAA 4DV0F 2EG1A 2H5EA 4DSJA 5KFEA 2V69A 2BKNA 1VRTA 1HBUB 1RCXB 2XYHB 4RU9A 2O3DA 5IQQA 4HH1A 3FCHA 1VMBA 3KTQA 5KFCA 2ZHAA 4JI7F 3PFOA 1IXKA 1HMVA 2WB4A 2J6SA 3NBPA 4CLLA 3SQGB 3Q2TC 4MIBA 3K17A 3HPOA 4HHUA 4PG4A 3JYTB 4FKYA 2OPSB 1ZZFA 3EGVA 3KK1A 4CT9A 3LA0A 3EPIA 3N9UC 2GQ2A 3RGIA 4JI1J 4DR5F 1NSAA 1K44A 1NLKL 5JVGQ 4J9UE 4ANDA 3C2PA 2DXEA 4M5HA 4C4WA 2DHAA 4DV1F 4D3GA 4DFJA 4KGMA 4RO0A 4IUFA 1OQ3A 1TAQA 1MU2B 2PDAA 3DCAA 3UDCA 1P8GA 1FT8A 3F0NA 3DLBA 4WP3A 1T0TV 2HWHA 1G3OA 3V81B 1RABB 2W8LA 4YR0A 1T7PA 1HBUA 4ED2A 3HX9A 2NPFA 1RAAB 4AXJA 1NU4A 1FWLA 3ULHA 1VJQA 1SC6A 3KLHB 1WD6A 3SQGA 2XEXA 4KTQA 2VKRA 3IGVA 1LK7A 1ZM4A 2CQBA 4JI0F 4JBCA 2OTJS 4K4UA 2A3JA 4ED8A 2PFFB 1I5OB 4DR1J 3N6LA 1TKTB 1H72C 2AGOA 1BY9A 4ZVUB 3T1HF 4YB7A 3QPIA 1SJFA 3K5NA 1FXRA 1N0UA 3HHNB 2P5VA 1WEXA 3K5LA 1MU2A 2HURA 4LF6J 3NWGA 1K9MT 4ZLNA 3L7OA 1XR6A 5MAOA 2KYXA 4Q7AA 4USWA 5IC4B 1FRJA 3V81A 1LWFB 1NSPA 4CO2A 5A8WB 5DM7Q 4PUOB 4URQU 2BA9A 2DY9A 1PSDA 3OSNA 2PO4A 5CHCB 3A8JA 1TL1B 5GVQA 3KLHA 3MCOA 4CP5A 5ITHA 3WIUA 2OHDA 3KNGA 3HLUA 1NKBA 1WG4A 4UOHA 4M5JA 2ZM6J 1OY9A 3R5GA 4ERDA 2BKOA 1REVB 4DSIA 1XMOJ 1BC6A 4BCAA 4A46A 4DL6A 2D3OR 3MPVA 4O4GA 3SZ2A 4IR9A 4RW4B 3TI0A 5CQGA 1T94A 3QRQA 4PG6A 4EK2A 4OYIA 1EAYC 5A76A 5E5NA 2OLWA 2RU9A 4DL7A 2ZBRA 2UU9J 2FVSA 2G1HA 3CCTA 3BBBA 1CLFA 1LWFA 4OZJA 6FDRA 3Q8PB 4ZKAA 4GKJJ 2O67A 2KM8C 2LKZA 4P74A 4PUOA 1RE1B 1FI4A 2YNHB 4IRDA 2IIHA 1AFIA 3RYLA 2HS4A 1TL1A 3Q89A 2CVIA 1LFPA 1NDCA 1TK0A 1NCLA 4NA3A 2N7CA 1MNEA 3GYNA 2EKYA 1WWHA 3I9V9 3PV8A 1Y11A 1B0TA 1JNZB 4N5SA 1U0HB 2Q3PA 4DL5A 1SCJB 1B7FA 1P27B 3TQ1A 4CM2A 1REVA 1T05B 2C3UA 3PJWA 2KHDA 3U1NA 2H48B 1SI9A 3HK2A 2HHQA 1WTBA 4RW4A 4NLWA 4ZOSA 2DIVA 3KG4A 1P9YA 1N0VC 2LQ8A 4RZRA 4NYPA 4DV3J 3QFWA 2JLFA 4X4NA 3M1VB 1VIOA 3C14B 3HI9A 4WZMA 2W7PA 3MWBA 1BMQB 2C2DA 5U47A 5ETLA 3Q8VA 2AMCB 2ADCA 2UUAJ 1N5TA 2E1PA 2YNHA 1OPZA 1C0TA 1ZBTA 2HHPA 4EBCA 1ZM9A 3A3NB 3CW2C 1FEHA 1SH2A 4ZCIA 3IWNC 5FDLA 2C2RA 2AEFA 3TZWA 2GGPB 2LEPA 3M8RA 1TTHB 1FRMA 5KFDA 2HHTA 1U0HA 3E01B 2ZH2A 1DQ9A 3I56S 5T41A 1T05A 3H2UB 3POTB 2YWFA 3O6QA 2KHCA 2HZCA 5HQMA 2MZJA 1YSJA 3HHLC 4DSLA 4B3RJ 2HVIA 4QW9A 1MWQA 3VF0B 4IDKA 3M1VA 1C2PA 3TQEA 3C14A 4TLRA 2YVSA 2BVZA 1VDHA 2QX0A 1RISA 3D6FB 3WHIA 2LEAA 4O3QA 2MLXA 3C16B 1QAJA 2EK6A 1A6LA 4DLEA 5AXNA 2BW7A 2BR0A 5F0UA 3M6VA 2KL8A 2AYEA 3IG1B 1V5IB 4PYDA 3AOBA 2CIMA 3RRGA 2GV1A 5J2NB 5L1KA 1WF0A 2EEYA 1VQOS 2GGPA 3ZZOA 2OFHX 3E01A 4ANEA 1R0CB 4O3PA 1Q0NA 3AB2B 1YJTA 1KHVA 3FBEA 3POTA 3HT3A 3ZTOA 5LSLA 2YX4A 3QLHB 1F5BA 1HD1A 1YTYA 2W01A 4GO5X 1RT5B 2W2OP 1WF1A 4BBYA 1U7LA 5KFXA 5IT9U 2P9EA 4DR7J 3QGPA 2JVOA 2FGOA 4JI2F 1RK8A 1VRQC 3RW7A 4DI6A 3C16A 2CDRB 4I56A 1QM9A 1UJ6A 3OXLA 2E9RX 4WFXA 4LFCJ 2CDQA 1KVKA 3NCPA 4IFYB 3C19A 4DQSA 3HJVA 3SEOA 3IG1A 3PFEA 4QYZJ 2YX7A 4NEZA 2CJQA 5AJ3F 3IN5A 5J2NA 4PG7A 4HH0A 2XM3A 5KFVA 5K5MA 3KK2A 1L3TA 1TKXB 4CLUA 2A0FB 2BXJA 2HSEB 3RAQA 3TUPA 1JWWA 1UJ4A 2ZHOA 1UWAA 3TVZA 1RHUB 3HKWA 2V94A 3BSCA 4QWCA 3QLHA 4BHQA 1RDRA 2P8IA 2MZ1A 4P7VA 4WTYA 1N5YB 3CCWA 5AXKA 1CJVB 2XQCA 2QRRA 2MSSA 3KYLA 3RBEA 1U1LA 5EDWA 1J27A 3Q83A 2OPPB 1L3UA 2W9CB 3BEGB 2BOPA 3RR7A 4AD6A 2XMMA 2XB2D 1YIJS 1IWGA 3GFXA 4DUZJ 3CGIA 2LMIA 1WEYA 1S97A 2I38A 2OMLA 3M6UA 4A48A 3MR3A 1WG5A 2UXBF 2IMOA 4IFYA 4PG5A 3IS9B 3DLHA 4EYHB 2V4QA 1DQAA 4HEA9 1LW2B 3HXMA 2R7OA 2W4CA 4Y34A 2H51B 3PZPA 4ED7A 3PR4A 2GVDB 1TKXA 1S7HA 4L6V3 3PJ9A 2CPDA 2FTRA 3I82A 2ASJA 1R31A 1U4BA 2CWXA 5DQHA 3KFWX 2IA0A 2ZJPQ 4NE9C 4RUAA 3HD2A 1N5YA 1SV5B 4NLGA 2CJAA 3VAJA 5T14A 1CJVA 4JV1A 2Y8YA 2XS2A 2RD5C 2RNEA 4F4KA 3OTOF 4JP8A 2GQQA 2OPPA 2LQ9A 3CIMA 1U2FA 2W9CA 1H0HB 4J9LA 4PQUB 4F8RA 2VQEF 4A8FA 1SQGA 2EVZA 3V6DB 2HEKA 5KT2A 5CZVA 2MMYA 4B3SF 4C8OA 4ICLB 2W2PP 4O44B 4OJGA 4LF8J 1FWKA 3IS9A 3PRDA 2A6OA 3MHYA 2HLTA 3CSKA 4I6YA 1LW2A 5L9XA 4HDGA 1OY8A 1RHQB 3UCGA 2LEBA 4TU8A 3ZZUA 2GVDA 3IO1A 4HHJA 3QIDA 4IRCA 1FX2A 2UVUA 3GZ7A 4USVA 1OYDA 4P9SA 2VFSA 1HR0J 1SKRA 2DO0A 2W7AA 3R97A 4ZJLA 4B3TJ 1TUGB 1SV5A 2FY1A 2KT3A 3PYEA 4MTPA 1RT2B 3H7HB 2LECA 4ED1A 2D41A 1RBOB 1H7XA 1RGVA 3D6MB 5I3QA 4PQUA 3MF5A 3V6DA 4EI2A 2O1PA 1KVJA 3EE3A 2GFFA 4LJMA 4N41A 2CKWA 3GJRB 4EBEA 1FF2A 3D1HA 4ICLA 3OL7A 4O44A 4BDPA 1E6YB 5K8NA 1TV6B 3CD7A 1M5SA 1GMWD 2F8EX 4K50A 4LBIA 5L46A 4LVOP 4DL4A 1X31C 2XO6A 5KFAA 4RWXA 2VC1A 4OLPA 1UVIA 1T02A 2CJXB 1SJ1A 1ZTWA 4FPIA 1KRPA 3HCXA 2UZAA 5DG7A 4DSFA 3C66A 3HVRA 1QTNB 3AH6A 1GMWA 3CE8A 2VICA 2CQ1A 4TNOA 4L73A 2JLEA 2FHJD 3EMTA 2QFIA 4U95A 2G2OA 1RT2A 4K8RA 2VQFF 5KFGA 1JLCA 3GV7B 3D0IE 2AZ3A 4ZLJA 3OQ2A 4WIQA 1YJVA 5F9LA 1XEZA 2M7SA 4O0NA 2FHJA 3PKMA 3AA8A 2BJ8A 2DNMA 3BSNA 3PX6A 2W24A 2V2VA 4CO4A 4J9RA 2HKEA 2M8DB 4DXLA 2AX1A 1TV6A 3TVKA 1CJTB 2XWYA 2DNZA 4DV0J 1I3OB 3IC1A 4AFFA 3GFHA 2CYYA 1M1GA 2KXFA 1MW7A 2YWHA 5JXSA 4B9VA 2YQ3A 1KSPA 1T9UA 3MEGB 4CYUB 3PACA 1ZA2B 4JI7J 4PXCA 1IKWB 1RAEB 4CH7A 5EX0A 2E29A 4DBQA 1HNWF 3DI6B 4M5NA 1YHQS 2E5LF 1XMQF 2IM1A 2D7SA 1VK8A 4QPTA 2CRLA 5CD4A 2XGPA 1S0MA 1U47A 4DR5J 1PYSB 1U1QA 4K4TA 1IVZA 2B4VA 4DV1J 4QIVA 4HT7A 2LP4A 4Z7CA 5HMYA 1S9FA 1CJTA 4FVMA 4NXNF 2HZAA 2DPIA 2RDIA 2GHVC 3C15B 2AJ1A 1T03A 5IT9Y 1RU1A 3U02A 4RNMA 2QLBB 3N6MA 1FVQA 1UAWA 4LIRA 1AB8A 4HI2A 5KFYA 5IFMA 1SH3A 1TMJA 3PEJA 3AODA 3X1LB 3P96A 2R7UA 3PW4A 4ZPCA 3BPDA 5A0YB 3MEGA 4DWIA 4CYUA 2BJ1A 2ZHBA 1IKWA 2JZ5A 1N54B 4DR4J 4OJHA 3PW5A 4WJBA 3C6UB 2DYAA 4MYUA 3DI6A 1RAFB 4PR6A 2QG9B 3EDQB 1UW9A 1T8EA 4RNOA 4CLSA 2X1FA 1RSCA 1GXLA 1I94F 1HLWA 2CQCA 1PYOB 1QSYA 2DH9A 2ZWPA 5C2GA 4CO1A 2QL7B 3QT7A 2VIHA 2WCXA 3J7YU 2UVRA 2AWZA 3OVSA 4PYAA 4RNFA 4PWUA 1W25A 2LQJA 2WB1D 4WIIA 2VZ9A 3HD1A 2HQFA 3IR6B 2RQMA 1LNQA 1FDBA 2R7RA 4F02A 4DPXA 2NR0A 4B02A 4Z37A 1D9AA 2ZBCA 5D0EA 4ZLPA 5A0YA 7FDRA 2ATCB 1GK8A 1RA6A 1S1VB 3VAKA 2YWEA 1M5HA 3SFGA 3D0HE 2V9KA 5AXLA 2GS8A 2VJUA 1IJEB 3F44A 2H1YA 3PYDA 2VA3A 2F8MA 3LP1B 1SQEA 1UP1A 2CQ0A 4QBUA 4XPEA 1S12A 4LF7F 3GR1A 4RNHA 3D1OA 2P6TA 3ZC4A 4DSEA 1RHJB 5KFPA 5A8RB 2EBGA 3PXGa 4NCGA 2ZH6A 1M0SA 2IJNA 4YUDA 3ELHA 3HT0A 4ZVGA 2JX2A 4P72A 1FDAA 2ILYA 2VDIA 2HHVA 1HNVB 1U2RA 4YHHF 2F9DA 2DCLA 5CD4H 1WC3A 3UN3A 1S0VA 2X3DA 3OLAA 1NJWA 2IAJB 3T1AA 2VBZA 2J5AA 2OFGX 4ZVRB 4CRJA 1Z2LA 5JMNA 1S1VA 2AP6A 1N4LA 3HHEA 1QUPA 2HHHJ 5EWFA 2HRUA 1Q8BA 4GMKA 3EDRB 3ENAA 4DV2F 3EVMA 4U67Q 2BABA 2A10A 3NCQA 3H42A 1GXTA 2VBYA 1NSQA 2ZH4A 2V63A 1SUQA 1WSRA 2ZEJA 3MPWA 3LP1A 2VDHA 3TAQA 4B17A 1YBUA 1QVFR 2KRRA 3OR1B 3GG1A 1H73A 3BR8A 4YY3J 2B0GA 3H40A 5KFZA 4LR9A 1M5KC 2RH3A 4J9SA 3EUNA 5A6PA 1EHWA 1Q7LB 1M5PC 3TUZC 4ZLLA 3ILOA 2ATLA 3N5BA 4KFBB 3UD5A 3WZ0A 3KDNA 2YKMB 1HNVA 5LJ3Y 1RT1B 1RADB 3IWXA 1RJJA 4FYWB 3CJQA 3FZBA 1S76D 2MSTA 2XG8A 4LVNP 1U1PA 1LWEB 3VR1A 4RW9B 4TY8B 3RRKA 4OHVA 5KFRA 4QU6A 2RVJA 2XMJA 3W5YA 2JJ4D 2KFNA 1HHTP 2J0QD 4WZQA 2DCUB 4FP9A 1YKWA 1IJFB 1HBNA 1LWXA 4KGZB 2IRXA 2Y9HA 3HZEA 4F4XA 1PJ6A 4XTTA 4K2XA 2NZ4A 1VC0A 1HWUA 4DF8A 3BREA 2XSFA 4OZ0A 3IM9A 3OR1A 4Q2LA 2KFZA 1OYEA 3TRGA 2WVBA 3J7A1 4ED6A 4DX7A 3DM2B 4OI6A 1JNRB 5BYQA 2MKJA 1HBMB 1N5VA 1NK5A 4KFBA 4D3HA 1WOSA 2DGSA 4P52A 2RQCA 2JH3A 2YKMA 1RT1A 5EX3A 4WFBQ 2R2UA 4HT5A 5E3AA 3OVBA 3I32A 4K4YA 2BOAA 3L4BC 1OY6A 3E8OA 3BSAA 3IMQJ 1VLYA 1R7IA 1LWEA 3IR5B 3LWLA 4RW9A 4TY8A 3K8VA 1Q8IA 1C1CA 3P8BB 4IRKA 3CO9A 3SMZA 1UKUA 3CTRA 1LWCB 3VAFA 1H74A 2ASLA 1X4AA 1MLAA 1YJ9S 4G1QB 4Y2MA 3BH6B 2ASDA 3WQPA 3PVXA 5CCMA 2CJBA 3BPSP 5KG6A 3QZ8A 3TAMB 2R7WA 1KC8T 2C1EB 3A1YG 3DM2A 2DGUA 1L3VA 2UP1A 2RAQA 1ELOA 1HBMA 2B43A 2ZBQA 3BKUA 1EX8A 4CT8A 1NK8A 1QJHA 2KM8B 2MQNA 2RQ4A 1UPMB 1F2HA 4J9NA 2WHOA 1NK4A 3Q24A 5KG7A 4KKOB 2PEHA 4OI4A 3RAMA 4GC6A 4ES2A 4QWEA 3HSGA 2AGQA 5I3PA 5K8MA 4MIAA 4YQWA 4P6QA 1VQ6S 3P3DA 5D4OA 4C97A 2WSEC 2LQBA 1LWCA 1TKDA 5KG3A 4C2MA 4XIUA 2XO7A 2ASYA 4U9RA 1IBMF 4G1QA 5HO4A 4CCHA 3G8TA 3OL6A 5G0RB 2NXUA 2FLNA 2ABYA 1C1BB 4YOEA 3H2LA 3VV2B 4PXDA 4I64A 2GJFA 1AUSL 2QGFB 3LANA 4LIWA 4QR0A 3R5JB 1S6UA 4I0WA 5KFHA 2QN6B 3B4MA 3DKDA 1VQNS 4GVBB 3PYFA 4XK8C 5KAKA 2RDJA 2VFVA 3D6HB 5HROA 1UVNA 1U6BA 4DF4A 3Q86A 4KKOA 3OPKA 1YZ6A 3AD7C 3ZTRA 3UDVA 1JJCB 3NGRA 2V4JB 1R43A 3BGUA 1RA7A 1ITPA 4ZVEA 1KQKA 1RLDA 5J1PA 4NLVA 3CB4A 5E41A 2JEIA 4V1Ak 2FJAB 3KMSA 2HFSA 3BM7A 4QWDA 4LRDA 5G0RA 3CVKA 2AJ2A 1O5JA 1C1BA 4RWWA 2LFVA 3OTCA 2VKZG 4JYAF 3N4WA 3MAHA 3UDEA 2Q79A 1CJUA 3RTVA 4QYZK 3TO8A 2DGTA 2RIJA 4IOAQ 3J81j 3DRRB 4L76A 1KBRA 4KQZA 4JI3F 1SC1B 2XMUA 5D4NA 1HQEB 3VZHA 2FZGB 1HHSA 1VBZA 4FBTA 2FHMA 2Q6BA 2Z30B 4JI4J 1P9QC 5CYJA 2YY3A 4B3SJ 2V4JA 3HHLD 1NJXA 2MYFA 4OYXA 5ETNA 1NNDA 3PHTA 2IM3A 1VK3A 3CJ2A 3M7VA 2HMIB 2QYGA 2YQ0A 4FYDA 1KDNA 1WEZA 1ZAVA 4ANCA 1EIYB 4WTOB 4FF3A 4O3RA 2A6MA 1OO0B 5ETKA 1ACMB 2HQGA 4B3OB 1EKRA 3CJ8A 1CBKA 3CCMS 3S6EA 2J76E 3DXBA 4C11B 4LQ3A 1S99A 2GAGC 2UUWA 3K0JA 1RB0A 1ZS6A 1PAUB 2E5HA 1UJ5A 1VR6A 3DRRA 1SKSA 4AXIA 3I9ZA 3A3PB 1VQ4S 1X7VA 2PE8A 1B70B 1X4HA 2LVWA 3THTA 2MTLA 2EXUA 1HQEA 1RKIA 3BKTA 3NGUA 5HI7A 4C6AA 1RBLA 1LW0A 2GO9A 2WSCC 5LMNF 3UI3A 2D3UA 1AROP 1ZM3A 5E3RA 1KFSA 5DLGA 5C25A 3BKFA 2IDLA 3N5FA 2HMIA 3EGZA 2Z0GA 4R25A 4ILMA 4IH7A 2AT1B 2YKQA 4WPAA 3CDWA 2KN4A 2FJDB 3OJSA 4EUVA 1NJYA 4B3OA 4CLWA 3HFKA 4UOGA 4KY3A 3CNQP 4RJVA 2QSFA 1U1RA 4ZPBA 3K8WA 1TL7B 5B7WA 4R0JA 2VQFJ 3SSSA 1UW4A 3M8WA 5AE2A 4LRBA 2FZKB 3P45B 3HZGA 3AXMA 4IQXA 1N34F 2ZJQQ 3UQSA 4KHPJ 1IBCB 1JLEB 4DFMA 2H65B 3FEZA 3MEEA 2JWNA 2M70A 3FCWA 1UTAA 4WXWA 5GAHU 1RWKB 2BZ2A 1GTEA 3V5RA 3Q8YA 2Y8WA 3NGDA 5ETSA 4PQAA 1FDNA 2LLZA 1HWJA 2ZZNA 1U2CA 1FHTA 1RWVB 2C2ZB 1WOOA 3ZZ0A 3KLIB 1TL7A 1MMNA 2V6AA 1G4CA 3W62A 4QJVA 5D4PA 2IVFB 1HNWJ 3TOQA 3GCXP 2E5LJ 1WKKA 4P2MA 1QLNA 1JLBA 2F1FA 3EXYA 1XMQJ 1CVJA 4RUBA 4P2XA 1JLEA 2IRUA 1Y3JA 1SIWB 3W7BA 4WK3A 2MJUA 4X64J 2AJQA 2PN6A 1YI2S 2F9JA 4HTJA 4XDCA 1TP7A 2Z2MA 1SQFA 4NXNJ 4FF4A 4PABA 2DR6A 3DLEB 5H1SV 2AZ1A 3BO4A 4F4YA 1EP4B 2PI5A 3NY0A 3MEKA 3H5SA 3ILIA 4DV5F 4M5LA 3MD1A 3J7AN 3M8ZA 3KLIA 3QRPA 3UNYA 3SV3A 1KOHA 3ZZPA 3B4DA 3MTKA 4KIAA 4PRFA 3OL8A 3J80U 2FVCA 2R9LA 3NRBA 3IFEA 3W63A 5B0BA 1SPBP 1XN9A 5G4DA 1F1BB 4ZVTB 1I94J 2MXYA 3DOKB 3OVAA 1N5SA 2KJVA 3ZTPA 4GKKF 1Q5VA 1NPPA 3MR7A 2X1AA 3RAXA 2XI3A 2JLGA 1XIQA 3DOMB 1ZZNA 3DLEA 1JLGB 1RAGB 1TUVA 1IWAA 1VOMA 4NZ7A 1RHRB 4KGVB 3W5ZA 1M5OC 4ZVFA 3MM9B 3ISZA 1EP4A 4OJ3A 4H4KC 1HD0A 2AJFE 2K1RB 4IG3B 3HF5A 3LPYA 2CQPA 4U7UD 3CEDA 1U8SA 4NLTA 2ZVIA 4DX6A 2ZH3A 1D1UA 1F3VA 4URGA 3UD4P 4AUKA 2M8HA 3R5BA 2DRAA 2L3MA 5IM0B 3FKBA 2I5JB 1RHKB 2KKHA 4W90B 2CQGA 5L8RC 2X1GA 1N6QB 4K5RA 1LQ9A 5C24B 4FYVB 4X62F 3P49B 2XGQA 5B0AA 3MCNA 3ZNUA 3CCUS 3A4TA 2VG7B 1EZZB 1GXUA 4NLPA 3DOKA 3KOAA 2C2KB 4Y2IA 4LRAA 4N8NA 4PCQA 4B3MJ 1U1NA 4CM0A 2UV8A 2YPZA 3J7ZT 2ZH7A 1R0BG 2D9PA 3R5DA 3DOMA 4OJ1A 2K8GA 4PPZA 1JLGA 2VFRA 2V50A 3MM9A 2H5JB 4CWBA 2JEGA 1YWXA 4YHHJ 3DRSA 5SUHA 2K1RA 4IG3A 5FD1A 3FUYA 1FESA 5D15A 4U8YA 4LFCF 4IG0B 3M9OB 4R8UA 1NO8A 2XLIA 1Q16B 5IM0A 1NH8A 4DS4A 1N32F 4YN3B 3WC0A 1NDPA 2MQ8A 3MMBB 2I5JA 3IBFB 2A2DA 1PBUA 1FJEB 3THPA 3KJVB 1N6QA 2IDEA 3MUTP 1SBRA 5C24A 2HK2A 5KFLA 3A8IA 3FZ2A 4IQMA 1Q5YA 2QZ8A 2VG7A 2DR7A 1EJ7L 2AEJA 1XNRJ 2EFOA 2CNOB 4NZ0A 2E1MC 3G71S 3C6TA 1BQMB 5DZ6A 2X51A 4ZJQA 3T1YF 1CPZA 1KD1T 4IO1A 3AA9A 3MMCB 1LEOA 3AD9C 2BEFA 1S1UB 3HFVA 3HP6A 4OZLA 4LFAF 5ETTA 5CXTA 4MK8A 4JV5F 3D4JA 3HDSA 1FJ7A 2CQIA 3T5JA 1RP5A 3HHKA 4OX9F 3ICLA 1OQ6A 3OFGA 4IYQA 2NUHA 2EC2A 1NZ8A 4IG0A 3M4XA 2ZH9A 3Q8SB 2N4CA 4N77A 5GAGI 1MN7A 2ALZA 1MSWD 1VC6A 3MD3A 3KJVA 3OTBA 5K8OA 2FPHX 1VBXA 4TU9A 4DCJB 1A0OB 1V5VA 1UCNA 4DFKA 3DHWC 1HI0P 2NREA 2FVRA 2KVIA 3BDEA 2MKHA 4OX6A 3KMQA 2GVZB 2B4OA 3AD8C 2GMJA 1BQMA 2COLA 2J9EA 3PW0A 2B3TB 1FJGF 2V0NA 4FNIA 3MMCA 2DISA 2FLOA 3V4IB 1S1UA 1S1TA 4LR7A 3KG0A 1BD6A 4CZCA 2IBOA 1NPKA 4ES3A 5H9FJ 1JLQB 1Y5IB 1J5OB 1YRUA 2E1RA 5KG1A 3TZZA 1X0PA 4N8OA 3JQMA 3X3UA 4CNYA 1URRA 3W2VB 3TZYA 4KYZA 3ITHB 4LUBA 3ISNC 2QSWA 2KZZA 4LF2A 5KT4A 2SXLA 3EZOA 2GVZA 4OZ3A 5KT3A 3KUHA 1SL0A 3ONQA 2P2CB 3QAUA 3D1QA 2MPUA 3AY0A 2FJBB 4DR3F 2NXJA 1FERA 4ALZA 1S6QB 3HULA 3TNVA 2V68A 2KXNB 2WOMB 3AJ2A 2XLJA 3MAQA 2G0IA 3VAMA 1RTHA 4X66F 4M95A 4B9TA 1IKXA 2OD6A 4M5GA 3CJKB 5DGAA 1OSCA 5B0FA 5HMXA 2HGNA 1VQMS 2HHXA 1Q4RA 3D0GE 4W98A 3W2VA 3FSIA 2N7YA 1S9EB 1FFSB 1WC4A 2OP5A 3AB4B 4XAKA 3ITHA 1IBMJ 3OHAA 5K9FA 5AXMA 4KPYA 3ZZTA 3LP0B 3NOCA 1QAYA 2PI4A 3NCRA 1WTFA 4DQPA 3TEGA 2C22A 2ZDPA 4UOCA 4F4WA 2FB0A 1CS4B 3ZTSA 2EI5A 2XBPA 2RU3A 3SIPB 1XTZA 3R27A 4OLOA 1CC8A 2EFGA 1U1KA 1UVLA 1QD1A 3OFFA 2G2ZA 3HSJA 1BWEA 3GSIA 2WOMA 4K59A 3W2WB 4WCEQ 5GADI 3J80Y 2QTWA 5LXYA 3K5MA 4WE1B 2XSJB 3CJKA 2K3KA 3W5XA 4OYAA 4ZN1A 5CABA 5DO2A 4F0KA 5THWA 1U45A 1Z1ZA 2M9KA 1S9EA 1KP6A 5D4LA 2W7OA 4DQRA 4NMXA 3LP0A 2VUGA 4GC7A 3MGJA 3GFZA 1XBWA 1UZDA 4DU7A 3CPWR 1RT6B 4OI2A 3NNHA 2FC8A 3GR0A 3G96A 4ZDNA 2XMTA 4A8KA 4Y0FA 1CS4A 3MTJA 2DR8A 4ECYA 5HJYA 3CMES 4JYAJ 1S6OA 3UR3C 2B5JB 3NGSA 2HIYA 2WAQD 3T41A 4ZPWR 3CC2S 2ACYA 1X4FA 3KJQB 4PWWA 3CD5A 4QIGA 3PW2A 2WSFC 3W2WA 2DXDA 4JI3J 2AV5A 4AL7A 2NSCA 5ETOA 4QOTA 5LL6d 2V2KA 4EO6A 1LV5A 4TXSA 4EGLA 1TAUA 4WE1A 1KLMB 2XSJA 4RR5A 1GAOA 2DHXA 5IWAF 5CAAA 2BACA 4RW7B 1YK9A 1GX5A 4ES1A 2I1RA 2E5IA 2K7JA 2ZBIA 4NXMF 4C8KA 3SFUA 4DG1B 3O1LA 1XK8A 2H4YB 4I1TA 3RB3A 5B09A 1XJWB 3L7UA 1X4CA 2W25A 3M2RB 3FJ2A 1T9VA 3H5XA 2CVEA 5F8JA 2XNQA 2V4RA 4ID8A 1RT6A 2R2SA 1T95A 1SJ4P 4RUCA 4DL2A 3VGUA 4CQ1A 2YWGA 1L5UA 3ZNJ1 1AYEA 3DC2A 3CMQA 1H6KX 2QL5B 4DR4F 2RUSA 5F3TA 2B5JA 3FQKA 3TW0A 3JYTA 2OPSA 3CF5Q 4F4ZA 1S7IA 3CO0P 4N47A 3BN7A 4CLYA 3M30B 2VC0A 4KR0B 4BC9A 2Z56B 2QL9B 2K3IA 2QA2A 2HBRB 2MKSA 2QIFA 2GMLA 3OTDA 1FE0A 5CCLA 5DJBA 3DGVA 1R8PA 1KLMA 2QJ3A 2RE1A 3CCQS 3P6YC 4L72B 2HBYB 3JQJA 3UW1A 1T3OA 4ZCMA 5LMNJ 1O6XA 4OYWA 1FD2A 4DG1A 3SSQA 4DR6F 2W2MP 4ECZA 2UUBF 5HQ8A 1TQLA 5B0CA 2WW8A 1RWWB 4HKQA 1IN0A 1Y9OA 3RBZA 4ZVPB 2WVFA 2EFVA 1YZ7A 2IYGA 1RHMB 2WVDA 2IM0A 3MFHA 2B9YA 1UA0A 3PR5B 1K0VA 4WFYA 2VASA 2XI2A 2H9ZA 3DHXA 4CDIA 2A1BA 4ZA1A 4LMZA 1U8WA 2JRSA 2MQOA 2PMZD 1SL1A 4QIWD 3EICA 4PAAA 3M30A 3UN5A 2OSRA 5DRKA 3RUBL 1Y7PA 4KC5A 2B4PA 1U1MA 5IOLA 1TKTA 1MWZA 1N34J 4ZVQB 3SCJE 2QC3A 1QUVA 1AFJA 1Q95G 4KHRA 2EFQA 2VG6B 3FQLA 5EHHA 1UEVA 2QMXA 1RT3B 3W3SA 4OMFG 3BF4A 2CFXA 3CDUA 5GMKa 2J9DA 1NPRA 3GV5B 3NMRA 2WBRA 2W2QP 2C28A 2DITA 3NNCA 1VIXA 3CT9A 2WTFA 5SZTA 3ET6B 3KJNB 2E1CA 3QIPB 3OR2B 5A8WA 1QSSA 2XYGB 5LMUF 1N8RT 1GH8A 4C0BA 2HHHF 1LKZA 2OO4A 2R8HA 2R8JA 5DGBA 3R2DJ 1JXEA 2DGVA 3GLJA 2FQQB 2BRKA 4NLQA 4R0EA 2E5GA 2PIIA 4KRWA 3J81U 2FHOB 3MR5A 2DNLA 2J0WA 1PBAA 3DU6A 1BQNB 1CQNA 2LXFA 1VS3A 2KG1A 1VLOA 3FNNA 4MMOA 2HBQB 3UWTA 3FRYA 2KU7A 4MH8A 2UXCF 3UCZP 1AT1B 2ZZMA 4YY3F 1S10A 1NRKA 2R7SA 3HVAA 1PCAA 4Z7YA 2BDPA 2VG6A 4FF1A 1KWMA 2YH0A 3H0PA 2VA2A 2PGCA 3AHPA 2YQ1A 3I55S 3EVOA 4JV2A 4HLBA 4CH0S 2NYIA 1RU2A 1R0AB 2CZVC 2W8KA 4CLZA 4KJIA 3ET6A 1H2VZ 3QIPA 3LF0A 3OR2A 1HYSB 1YJUA 5LM7E 5B0GA 2OEJA 5LXRA 3R1LA 3BGFA 4J9QA 3B6BA 1J2VA 4DV5J 4A8QA 1OPIA 3AFGA 2DGQA 1ZA1B 1JIHA 3AOCA 5D78A 2AW0A 3NGKA 1NHVA 4F04B 2HGMA 1NM2A 3TJ9A 4NLSA 2VONA 5KFJA 2JVRA 2RKIB 4CLPA 3NKYA 3PJXA 4FYYB 5GMEA 5M2PA 4A47A 4ZMMA 2V5HG 3QT6A 5D0HA 5HSPA 1UZHA 2CAJA 2F4VF 3EJMA 4FS2A 2HHWA 4GKKJ 2OELA 2ZH1A 4U8VA 2HK3A 1AZSB 4P2SA 2DXFA 1G2EA 4OYOA 3N0VA 2G0JA 2R42A 1R0AA 5ETQA 1NXIA 3D5MA 8AT1B 2BMBA 3KLGB 1HYSA 4RNNA 1HNIB 2XULA 3FGVA 4NA1A 1GMUA 3L09A 2E7XA 1SKWA 1O51A 4M1KA 2HHSA 5F3ZA 2Y0BB 4ETXA 3KLVA 2RKIA 4OZNA 3GIMA 4IFVB 2MHEA 4DV6J 4LSNB 1T9XA 4FXVA 1S0OA 4X62J 2QV6A 2VFTA 1YQHA 2MQPA 2G9OA 1PYTA 3U1LA 2PSZA 3QT8A 5EGYA 2FVPA 1FRHA 3TANA 4LRFA 2HW3A 2JFKA 4L3KA 1AZSA 3NS6A 5KFFA 4I69A 2OPQB 4LR8A 2PMWA 4U6PA 4ED5A 4DPOA 3A12A 2LXIA 3BGLA 4G6VB 3H2VE 3DDNA 4H54A 1HNIA 2WW4A 4NLDA 1KFDA 4NCBA 1VYAA 4X4RA 1N32J 3PYGA 5HVHA 4M5IA 4OZ2A 1IBKF 2RJZA 4IFVA 4LSNA 2NQPA 4WWSA 1VHIA 4K4ZA 2XY5A 1FO1A 2I6WA 2ZUGA 3HSDA 3GV8B 4KE5A 1J5EF 1D3WA 2C2NA 2NSBA 3I6PA 2U2FA 2ZE2B 3RB4A 1NKEA 1NDKA 1CSJA 3KKFA 1RT5A 4OZ5A 1LXJA 2E7WA 3HJFA 4PXBA 3T1YJ 1WC5A 3GPAA 2JEJA 3NAIA 3QSYB 1F5CA 2OPQA 4NLUA 2E9TA 3NS5A 4L74A 1WNEA 2BE7D 4LFAJ 2MJNA 2E5JA 4H4MB 1C4AA 4DQQA 4JV5J 3S01A 1GMVA 3MECB 3MM7B 1C0UB 3P4UB 4LF4J 4OX9J 1YJWS 2ZDOA 2L9NA 3ILLA 4OI1A 2J7WA 4LF9F 1CQMA 1H2UX 2CPXA 1RZMA 1I6JA 4TQSA 1RACB 1S48A 1V3RA 5GAEI 4Q44A 4CH1A 1VQLS 3VAIA 1N5QA 2CQ2A 4C48A 2R2TA 4DZDA 2BKPA 2AD9A 1L3KA 4I2QB 4HL9A 3T5KA 4OQJA 4FN5A 1VISA 5L1JA 3JXOA 5HMZA 1WC1A 2M4MA 2M0GB 4LQ9A 1NDLA 3BO3A 1JJHA 2ZE2A 5BYSA 3DDKA 2QLJB 1P6TA 3MM6B 4USJC 5MLCV 1SJ3P 1BWVA 1FJGJ 4F3OA 2Z8QA 1X60A 4QWBA 1WI6A 1KVIA 2KB2A 1R8HA 4C3KA 2A18A 3T6JA 2GW8A 3M8QB 2Y1IA 1FRKA 3PY8A 1C4CA 1IUJA 4QQBA 2UXDF 3OL9A 2M88A 4IKAA 3OJUA 4JI8F 4H4MA 1KTVA 2CNLB 4UF4A 3MECA 4WKRA 2IFXA 3ENWA 3MM7A 1C0UA 2B9EA 5C5JA 2HQIA 1R89A 3M2UB 1JJ2R 5C2CA 4JI4F 2BW2A 4ZHRB 2WVEA 1WJ9A 3FRZA 3RG6A 4F4AA 2KO1A 2XTJP 2J6UA 4RW6B 5IT0A 2FJVA 3LP2B 4NI2B 4NYOA 1W7WA 2DRBA 3EPGA 5IC6B 1TK8A 4RL1A 3KK3B 4I2QA 4CO3A 3AAWB 5E2QA 1YVFA 1RT7B 4ECUA 2QA4G 1ZTTA 3RB6A 4C8ZA 2DNYA 3D54A 4UQGA 4Q2MA 4F3QA 1RWNB 3MM6A 1W26A 4W4MA 5AT1B 1X0FA 3V2UC 3M2VB 4AL5A 4H4KA 5ADZA 4DR3J 3J81Y 2FY8A 4A8XA 4M5KA 1E6VB 2K7KA 1VQPS 1FRXA 3LW5C 3PEHA 4PG8A 2CNNB 2QLFB 1ZPVA 2DNOA 3M2UA 2QA4S 4DV7F 1KHWA 3MPYA 4X66J 4X2BA 4ZHRA 1HQUB 3LPEA 4RW6A 3OXGA 1RWXB 2FUG9 1X5TA 3EGWB 5IXUA 1KLNA 1UFLA 4C8YA 3A8EA 2VOOA 2XZTB 3UR0A 2JEFA 3KK3A 3LAKA 2CPEA 3NEKA 4E8UA 3B82A 4IR1A 5H9FK 5E3CA 1RT7A 4YB5A 1OMSA 4PPDA 2LU1A 4K2JA 3DN9A 2IA6A 4EYIB 4QYRA 5KOXA 2N82B 1UEUA 1VI7A 5L1LA 3M2VA 2GA7A 3KHLA 3LALA 3QATA 1QAXA 2VD3A 3H4BA 1E6VA 4H4OB 3CCLS 3GIRA 4LF5F 2OAUA 1Q8LA 3IXQA 5LSRA 1D8YA 5L38A 4KAIA 3CC4S 5HMWA 2KTQA 3GWCA 5B0EA 3ZZZA 4KHPF 3R5CA 3DLLQ 2PMHA 4EU0A 3VGSA 2DK2A 1HQUA 5FJ4A 2YX1A 1E6YA 1Z4UA 1XR7A 2HRYA 2F65A 1Y4ZB 1S1WB 3LWMA 1G6BA 3FCVA 1KTQA 2J9CA 1RCOB 2DR5A 2DNHA 2MQLA 2CG4A 4CNZA 1HMVB 3I4HX 1G1XA 1GFWB 4EO8A 3ILJA 2L41A 1UEKA 2AJ0A 3O44A 4TN2A 2PC6A 3PM9A 2FJWA 2EG2A 4ZK7M 2GNKA 3GP9A 1NK9A 2CQHA 3VCDA 2D69A 4USTA 1F6TA 2B6AB 1DJ0A 5F0WA 2EFNA 3TWZA 4QU7A 5E3QA 4HI1A 4H4OA 2DGXA 4C9DA 3BQ0A 4X4TA 3BYPA 5KFTA 1FA0A 4B9SA 1DARA 1HPZB 3V6JA 1VQ9S 3CJTA 4X64F 3G9CA 2GCFA 2EBEA 5IWAJ 5D77A 4NWBA 1S1WA 1K73T 3C46A 3G86A 2Z57B 4NXMJ 3KG1A 3OD2A 4BLGA 4K4XA 3AOAA 2X1BA 3GCWP 1JXVA 3UD3P 3VZIA 3FVYA 2P9CA 2HLUA 1DURA 2CPZA 4ECRA 1GT8A 3G4SS 2HNDB 1FKAF 5J2PB 4PXEA 2QEXS 3G8SA 4FVCA 1WDDA 4ZPDA 4RUHA 2B6AA 4KB7A 2OJ3A 4UT4A 5DG8A 4AQYF 1H38A 3CMAS 4WBFA 2MDAA 4M5MA 1XC9A 5E0OA 2UUCF 3ISND 1EQMA 2XY7A 2LCWA 4AYBD 1R8BA 5GADU 1HPZA 1MMDA 3FFIB 1B4SA 1UVMA 2H4WB 5KT5A 3N6NA 4MKYA 4YMEA 3JSRA 1NHKL 3RR8A 1U09A 5EWEA 5B0DA 3C15A 1PJ5A 2F3JA 4DR6J 3H4DA 5DQGA 2ROEA 1NB2A 1B64A 2BX6A 2YBVA 1REGX 1Q1KA 2UUBJ 2QLWA 4DX5A 1WHXA 3DYAB 1HI1A 2KYZA 4RBUA 4TYBA 3IAM9 4WFNQ 1PC4A 2J8SA 2HNDA 1PG5B 3PIOQ 1WF2A 5J2PA 4J9MA 3D7SB 3CUNA 3DOLB 1X4DA 1ZETA 1ZM2A 3ADAC 2GJIA 5CH7B 2DNRA 5HQLA 3KHHA 1NUEA 3C6UA 3PRBA 3CCJS 1NB7A 4BC7A 4O4GB 2YTCA 1WG1A 3W9HA 2BUNA 4TYAA 3VGTA 1VQ7S 2JFDA 3KUEA 3PHEA 2DO4A 4DN9A 2WVCA 5ETMA 2VBXA 3FFIA 4YS2A 3U27A 3A3OB 4LFBF 3KHGA 4JUZA 4B3MF 1Q79A 1PAEX 5KFQA 5H9EJ 1F9FA 4KGXB 3NAHA 5AE3A 1ZYQA 2O5DA 3CDEA 4JI6J 1IR2A 3DYAA 4X4OA 3RU0A 1T9WA 6AT1B 5LMUJ 4TLQA 1TZ0A 9ATCB 4U7UK 4PWDB 4TY9A 4MFBB 3D67A 2HFZA 4Y2CA 1FNXH 3DOLA 2M52A 3JS9A 2XC9A 2HGLA 3SBMA 2W4PA 1WSVA 3L7PA 5M2UA 4DUYF 2HAIA 3I0SB 1RAOA 3M8PB 2F40A 1XNRF 2ZH5A 2FLPA 2UXCJ 2BJ9A 5F41A 1HQ2A 1HFEL 4ZCLA 4ZVSB 3SI8A 4C98A 4OX8A 5A8RA 2R2RA 3OW2R 1XMBA 2H5IB 4P2FA 3VVTA 1S49A 1HA1A 2OH2A 3LAMA 1Q7YT 3IBCB 3U1MA 2YXLA 3SDEB 1U25A 1C0TB 2Z2YB 3UE2A 4NLYA 5BXIA 4TQRA 3B78A 3IR7B 2E1AA 2V9WA 2BJDA 2XS7A 3PG9A 2IAJA 4E98A 3M6WA 1GX6A 4PWDA 5FDLB 3DU5A 4MFBA 2PFDA 4P75A 2OIHA 2R3VA 4CO5A 3QRRA 1N56A 5DDPC 2MB0B 1FJCA 5HANA 3TA2A 2RHQB 4DHVA 2DNNA 3R8YA 1A9NB 3R6GB 5D8HB 1X5PA 2R8IA 1FD8A 4FXWA 2XHCA 3IA0A 3PDNA 3DLJA 1RWUA 1NAQA 3I0SA 1N36F 3D2WA 2GX8A 2VH7A 3M8PA 4YB6A 4AE5A 4ETZA 5E7OB 3D66A 5IZHA 2Q6CA 1Y0HA 2DHSA 4IDKB 3QO9B 4O3NA 4O3SA 2KRBA 1ZAXA 3QGIA 4S0MA 3BGOP 4NZ6A 1Q8KA 4USMA 3JQKA 2F4VJ 2YKOA 4WYLA 3HVTB 3SCIE 4ZP7A 1X9SA 3M9NB 3SDEA 3LUYA 4G65A 5HBMB 1OWXA 2CWKA 3JSYA 3BDPA 4ZCKA 5RUBA 2ZNYA 4WP8A 3Q8RB 1S0NA 4R5PB 1A7GE 2ROGA 3R7BB 4BWMA 4KGKA 2GQCA 2NPIA 2P9GA 1Q82T 1EQ0A 1TU0B 4P7TA 1KQFB 2I0XA 3E51A 4IH5A 2CXEA 1TVRB 4X4SA 4LSZB 5KT6A 3CCSS 2XS5A 1S79A 3HVWA 4DR2F 2DEJA 2UVWA 3OTEA 4FPRA 3L95X 5K14B 3QO9A 4YR2A 1UL3A 3SCLE 3TUIC 1V3SA 2ZOFA 3K59A 4Y00A 5DQIA 3PNIA 4OL8A 1VRUB 2QYCA 3BQ2A 1NK0A 3W61A 3HVTA 3AQOA 3UNGC 3MAAB 1O0PA 4OYMA 4RPFA 2IY5B 1FXLA 2HQDA 1DTQB 3T9ZA 3OHBA 2BJEA 2V8VA 1JJ4A 5HBMA 2KT5A 1RTIB 2AF6A 3FEXB 2CJ9A 1VQ8S 3SSRA 3Q2SC 3B8HA 1UFWA 1FRLA 3K7RA 4R5PA 2J0XA 1TFWA 2CZ4A 3HMJG 1QSLA 3QWUA 3HM9A 3MR6A 6FD1A 4QIFA 3KK2B 3LGNA 1MG7A 3MM8B 4MT1A 2HRTA 3VHQA 3A13A 1KEKA 2AGPA 1TVRA 2V8HA 2EPIA 3EYZA 2W2NP 3I0RB 1NJIT 3G6XA 1IBKJ 2D74B 4ID5B 2C2MB 2E66A 1X8DA 5K14A 4DL0C 1EARA 2C3PA 2J0SD 1WC0A 2FDNA 2DJWA 5F8MA 2YNIB 1J5EJ 3ZZYA 4F2SA 1SVDA 1U6ZA 3TAMA 3BO2A 4ZITA 3I96A 5CYMB 1M5VC 5HVGA 1VCTA 1P1TA 2XYPB 1VRUA 3WX8A 4UZCA 4DJBA 2PEBA 3FSYA 3MAAA 3KLEB 1DTQA 2HFOA 3EVWA 4NPOA 4ED3A 1VQKS 1RTIA 4XO0A 3KWMA 5KOWA 3CJ3A 2AJ4A 3GG0A 5KFKA 3L3CA 3EZ5A 3CCVS 4GRSA 5GMDA 2RILA 3MURP 2H3EB 4K4WA 4K4SA 2MZRA 4LF9J 3MM8A 3O8WA 3TA0A 3EM1A 2DPJA 3I5CA 4JOUA 3V6KA 4KPCA 4ZPVR 2HG4A 3CJRA 2EFPA 1NMEB 3I0RA 4ID5A 2FVQA 1QVGR 1CJKB 2CA9A 2NCKL 5KTQA 1JLAB 4OHWA 2XCPA 3HHLB 1TUWA 5KG0A 2HWIA 5EUHA 4UW2A 2EC0A 2YNIA 3HKZD 2DNKA 4O0IA 3FMBA 5CYMA 5DDRC 4MKAA 1ROFA 4X4UA 3AJ1A 2C2OB 1WELA 3WBZA 1ICEB 3T5LA 1YDLA 1RWMB 1UMJA 2MEWA 3KLEA 3IM8A 3LOUA 2YNFB 2FYXA 9RUBA 3CD6S 2NXCA 4GVBA 1K1SA 2B56A 3PKYA 2V2QA 4V19X 5IT4A 2UXDJ 3FK4A 4JI8J 3DLGB 2BJ7A 2V8DA 3W8GA 4MIWA 3T3FA 3PO5A 3GONA 1Q53A 2OKQA 3CCES 3UN2A 4KH1B 3EZUA 1NK6A 3K5OA 1K8AT 1WKJA 5I42B 1BQXA 3W60A 3TR5A 2GIFA 3D6TB 2GHPA 1LFWA 2CADA 1CJKA 2KH9A 4B9UA 5IV3A 1EB0A 1YX2A 3S7RA 1JLAA 4C8MA 3HHLA 2AX0A 1PJ7A 3H98A 4DSKA 3CCZA 4ECSA 2HIQA 1FDDA 3RBDA 1IR1A 3S8SA 1IBLF 4JI5F 2HQCA 2YNFA 5KG2A 3MI7X 1U02A 1RI7A 3K2YA 1FKPB 5GAHI 1PGZA 1X4GA 4NMLA 2ZZTA 4UOFA 3DLGA 5K8PA 2XMKA 1VBYA 2IC3B 3ETOA 4Y3CA 3M6XA 5JUMA 1VQSA 4DV7J 1NEEA 4M5DB 2KT2A 1XERA 1FRIA 1FTRA 4NEYA 3CWJA 5JJBA 3NXZA 1YJ7A 4LREA 5I42A 4ZIVA 2RS2A 3NOGA 2ZH8A 4LBHA 2CQDA 1G7CB 3UCUP 1M90T 5DDOC 4F3MA 5GAEU 3T9NA 2HPUA 4OZ1A 3TA1A 3BQ1A 2YH1A 3WX4A 2OI2A 2B8PA 4B9LA 1KONA 2M5YA 1OJ4A 3GJQB 4ZS6A 1JLCB 2XMAA 4NLOA 4C11A 3MCSA 5I4MA 1YLXA 4JV0A 1FTCA 5B08A 1NK7A 4PKDB 1H7WA 3K57A 2KG0A 3I5AA 3JSMB 3RJMB 1FKPA 5C7PA 2APOA 4LF5J 2G4BA 2J6TA 2FZCB 1D09B 2W9AA 2CPYA 3QGGA 4F0HA 5LJ5Y 2IC3A 3LGHA 1R8AA 1X5OA 2BM1A 3V4MA 2BE9B 4M5DA 1S72S 3VALA 3VTIA 2CG8A 4C8LA 3MM5B 4Y2KA 5HVFA 2ROPA 1FFWB 2W4DA 4ECWA 1LK5A 2CJKA 4B08A 1Y5LB 2L48A 3BB5A 3GMGA 4USHA 1GEHA 3H25A 4I68A 1RT4B 3FEYB 2DR9A 1NJZA 2XZWA 2BQUA 4KH0B 2HZVA 3Q8QB 2Y3YA 2AIRB 4WFZA 4NX9A 1ZPWX 3JSMA 2R8GA 3W8PA 3CULA 1RWPB 3JB9k 4F2RA 1MMLA 4KO0B 1YRXA 2C2EA 1RYSA 1Y10A 2QMUB 2MQQA 3RBXA 4X65F 3CXCR 1HKAA 3TZXA 3NS7B 4K5SA 7FD1A 1NBEB 3BGRB 1FCAA 1T03B 5KFNA 3A8KA 3M8YA 3DRPB 3RB0A 2R7TA 5HN0A 3SXLA 4DOZA 3CJ0A 3MM5A 4YFUA 3CJSA 1N33F 3SYZA 1GTHA 1WOPA 2VV5A 1IKYB 2E7VA 2MZSA 2KI2A 1DHMA 4OYBA 1RKJA 4USUA 1H98A 1JK9B 2OUGA 3ETMA 3KDOA 2HNZB 1RT4A 4WF9Q 1UA1A 2F63A 2WBMA 3QJLA 5D0RA 2KJWA 2CNKB 3FBCA 4XDDA 1IQTA 4ZJOA 2QT7A 1RTJB 2C42A 1QTMA 2V67A 2MQMA 1KNZA 2M2BA 4KO0A 4AQYJ 1TL3B 2DRDA 1S4FA 2PA8D 3N28A 5F8IA 1U6FA 3MFIA 2RMLA 2R4FA 3EXCX 3EGNA 5ETVA 2UUCJ 3BGRA 4EEYA 1MWYA 3HO1A 2RRAA 5L1IA 3DLKB 3DRPA 3AT1B 4FNHA 1OIAA 2JL9A 4OX7A 2KXHA 1IKYA 2ZC3A 4K0KF 2XLKA 3TUJC 1DY3A 3RW6A 4ILRA 4Q45A 1FXDA 3SV4A 2O66A 2HNZA 3I87A 5LOQA 4ZP8A 4A4JA 1S9GB 4JI0J 3EX7B 2AHOB 2DHGA 4DPTA 4NRUA 2H54B 3NLCA 1BGXT 2J9DE 2MKYA 2FGCA 3SCKE 1RTJA 4W92B 1TR0A 1S59A 5JVHQ 4OI3A 3T1HJ 1TL3A 4DV6F 1VJWA 4Y28C 3P5TL 8ATCB 3UVJB 3H90A 1MROB 4NCGB 3I31A 5IS2A 2EW9A 4P71A 2CQ3A 2NS1B 3JAMU 5HAOA 2EWHA 1AUDA 2IJRA 3DLKA 3NWRA 4MKVA 4LFBJ 3IP0A 1BHNA 2UVVA 4FBUA 5DG9A 2XCAA 1QAIA 3FSXA 3CCRS 1FKOB 4HR2A 3BS9A 4TVAB 1V3ZA 2BQRA 4LBPA 1F2GA 1NSKL 3QSIA 5D6GA 4UY8T 3F41A 2WRMA 4YEAA 2VPXB 1S9GA 3UO0A 4GVLA 3QMQA 1SUQB 3CDAA 1IKVB 3QAEA 3Q23A 2IJFA 3F56A 4ECVA 3TYTA 1D9DA 2C3MA 3PRVA 4DUYJ 2DKOB 3CC7S 4Q8EA 1IQZA 3BH7B 2Q1LA 2VODA 4RW8B 3UVJA 1MROA 1VGYA 4F0MA 4Z2XA 4ECTA 1ZH5A 1IM6A 1YJNS 4U7CA 1EETB 3DGPB 2X3GA 2Q43A 3ZZRA 4ZIWA 5KFBA 1AA1B 1AXQA 2F5GA 4Q5VA 1HNZF 1FKOA 4OYPA 3PX4A 1B99A 4USIA 2VPYB 4MK9A 2YNGB 2QO3A 2XMVA 2LA6A 1TL4A 4LF1A 3CIZA 4LF4F 1HBNB 3QFHA 4CLTA 1DRZA 1Y00A 4WK1A 2IPOB 4AL6A 1JXLA 4OFZA 2HVEA 3I4PA 2DIUA 1IKVA 1DFDA 5H9EK 1KQSR 3MMBA 1JMTA 3D3BJ 3KHRA 2GZOA 3QYYA 2JC0A 4F67A 3GQCA 4RW8A 4Y65A 2OEKA 2NLWA 3B54A 2R7QA 1N36J 3LQVA 1F9HA 1EETA 3DGPA 2IVYA 2Y1RI 1SB6A 1I51B 1W2BR 4HVZA 2HBZB 2B8QA 1IR0A 5KFWA 2ZWOA 1PILA 2DH8A 3MOZA 1RYRA 2HVZA 3CDBA 5AE1A 3UDLA 3HSZA 1JB0C 3D9BA 3TVYA 2D1CA 4CTAB 1X4BA 1C1CB 2YNGA 3MCMA 4G1PA 3VAHA 1PC5A 2R7XA 4J5OA 2BM0A 3O2IA 3G87A 2CQ4A 2AYGA 3QWPA 2Z58B 5F8GA 1M1HA 2UV8G 2V34A 2HYIB 2B7CB 2P6SA 4PZVA 4ZP9A 3GTYX 5FLXU 1VBKA 2ZBPA 4ATNA 1W2IA 4DR2J 4RKUC 2RRNA 2M3DA 2G13A 4K4VA 3AJDA 4RBTA 1L3SA 3VWSA 3D3CJ 4ED4A 3L9ZA 4X4PA 3W9IA 3LO3A 2BBEA 1D8ZA 4QIEA 3V4IA 3OSPA 2DGOA 1QDUB 3DRXA 4CTAA 3W66A 4DV4F 2DNGA 4ELUA 5EWGA 1JLQA 1D0EA 4AT1B 2FHKA 2J7UA 1T9YA 4G1IA 3Q0AA 1NZAA 3H5UA 1J5OA 3GILA 2Y1JA 5BR8F 3W9JA 1X9MA 2L08A 4Y2AA 3VVUA 1EKSA 5ETPA 2ZITA 3R7NB 1R6YA 2JOQA 1SXLA 2ZOMA 5DETA 4ECXA 4C0HA 4N56A 1M1KT 2NXNA 4DU8A 3TAPA 3QJPA 4NLRA 3IRWP 1XNQF 1S1XB 3MEDB 3US5A 1FE4A 4DX8H 2RHSB 3MUMP 3C8YA 1Q81T 1U1OA 2FD2A 2V2ZA 3K58A 4YP3A 2U1AA 5HROB 2CPHA 3OT9A 4JI2J 3FBBA 5F9NA 3DNCA 2F7VA 2BV3A 2OGUA 1S6QA 2FJEB 1NHUA 2QMWA 1HNXF 2CUYA 4HHHA 2RDDA 1B0VA 2DT9A 1Y3KA 4UUXA 4QWAA 2ILZA 3V6HA 4E2FB 2RF2B 4NYZA 2DBBA 5AJ3J 3R7SB 4NOHA 4QZVB 2B4UA 2DD8S 2Z2ZA 3G8QA 2R8KA 4HDHA 1YG0A 5KG4A 2B9WA 4FS1A 1F9EB 5KT7A 2GIRA 1JQGA 1S1XA 1N88A 3MEDA 3QQCD 2MKKA 3KUGA 5E3PA 1CJUB 1FK9B 4O23A 5IV4A 2KZMA 1BLUA 2R7VA 2C3OA 2GO8A 1HWIA 2VU5A 1R3NA 1RQ0A 2MLZA 3F73A 4EBDA 1DLOB 4PEOA 1VQYA 2J7KA 1Z2ZA 2GJ2A 4MJKA 2OSQA 1SC4B 3THVA 2UXBJ 4EZ6A 5J2QB 3G6VA 2IHR1 5HLFB 2ZKTA 2L9DA 3PW7A 4RBVA 1RBAA 4IH6A 3MUVP 1DBDA 4WYWA 5KFOA 1N48A 2RRBA 4BS2A 2RF2A 3JAMY 4K7QA 2XZDB 1HW9A 3DDIA 3E2EA 2GAHC 1YRTA 5LT5A 2DH7A 4NASA 5CZXA 5KFIA 2ALYB 2ZNZA 3QBCA 2RUGA 1JX4A 1MN9A 1RWOB 2HNYB 5HJXA 4L75A 1CULB 1K1QA 4UUWA 3BSOA 2LU2A 1CG2A 1Q78A 2CPFA 4WXOA 2O01C 5HATA 5CYQB 1HARA 4GO7X 4V19J 1S5ZA 4M63A 2B9XA 2HHUA 1FK9A 4LT6A 3MMJA 4DLGA 3OTOJ 4MKBA 2RSQA 1RAJA 2IVMA 1K0TA 2VJVA 4JI1F 1DLOA 2KVQE 2VQEJ 1SJRA 2DEIA 2LQ5A 1IBLJ 3H8YA 3NMAA 4JI5J 2MGZB 3BZQA 4NA2A 4OV1A 2A2CA 5L9NA 1F60B 1VHFA 1LW0B 5J2QA 5HLFA 2ZJRQ 4QCLA 2XMWA 1H2TZ 4A8SA 3TJAA 2ZOGA 1WHVA 2LA4A 4J9VA 2B51A 3PIPQ 4M94A 2POKA 5C25B 1KS2A 2HS0A 2IYIA 3FMWA 1R8CA 1HW8A 4HACB 4YDDB 5KFSA 3I5BA 4RW7A 4ZVOB 2QFJA 3HFZB 1RXOB 4C7QA 2CZ9A 4X84A 2HNYA 2GMHA 1PKUA 4ENOA 4I67A 1U24A 3MPDA 2Z2LA 1RTDB 4DCOB 1CULA 3BR9A 3QZ7A 3IBWA 4EZ9A 3OFEA 2LYVA 3LH2S 3G6ES 5CYQA 3PX0A 4BWJA 4KT0C 2DNQA 4DPYA 3M2RA 4DZ6A 2NZCA 4J9PA 3IRXB 3UFCX 3G2XA 5DS7A 5J1EB 2HAFA 1H3DA 1T3NA 1DTTB 1FNOA 2FC9A 1OSDA 3QT5A 4IOBA 4DPUA 4P10A 1BXNA 2BJ3A 3PCOB 3U7JA 4DR1F 1U26A 5J1NA 2MGZA 3QGHA 2WONB 1GQEA 3NL0A 4UZBA 3MEEB 1F3FA 4UTGA 1KN6A 1ZAWA 5A2QU 4LF6F 1HHQA 3W65A 3O3LA 5T7LB 3ZTQA 1SC3B 2XNRA 3FC9A 3P5BP 2I2YA 4HACA 1XQIA 1WDTA 1WUUA 4ED0A 1WI8A 1UFKA 4I6AA 3GIIA 5HP1B 1ZOTA 4N7TA 2VB6A 5LSOA 4QPXA 1RTDA 4L3NA 2AEMA 4ECQA 1B3TA 4LRCA 4JI6F 4B9MA 4OHXA 3ZXWA 5F8HA 1BUXA 3IRXA 3MXHP 1T9TA 5J1EA 2IRYA 3MDFA 1DTTA 2MKIA 3R6LB 2MHNA 2HWTA 3D28A 1V6HA 2J8AA 3CJ5A 4KHMA 2BQ3A 1HWLA 2AYMA 2YWWA 1B0PA 1JLBB 1DAXA 2ZM6F 4MAKA 4ELTA 4WU3A 1XMOF 4C8NA 3Q22A 3QJJA 2WONA 5D0GA 4ZPTR 2E44A 1TKZB 1SJQA 2JSXA 3NG8A 5FLXY 2YKPA 1DZ5A 3T19A 3GYXB 4X65J 3OLBA 4FF2A 5T7LA 4ER8A 3DMJB 1S57A 4OYZA 2XHWA 2UU9F 3LGMA 4F25A 3HHDA 1YGYA 3WIVA 3PO4A 1UPPA 2HVHA 4GKJF 4KSEB 1RT3A 5DLFA 5M2RA 1KQGB 5HP1A 3ENVA 1RLCL 4NLXA 5C42B 1N33J 1FEEA 2ERRA 2E9ZA 3R2CJ 2G1DA 2AYBA 2G0CA 3H59A 2GIQA 2FJXA 2D3O1 4USKA 2Q66A 1TK5A 2Y1LB 2ADBA 2HFNA 4ELVA 2DHHA 3K5PA 1TFYA 5A6WA 2OD4A 3MMAB 1YBTA 2N3OA 1WORA 2BANB 3BBFA 3TX0A 1BQNA 3GIKA 1TKZA 4RU2A 5DM6Q 3G6YA 4KV8B 3E3XA 4J90A 1JKHB 4DV3F 1JLFB 2LXUA 3DMJA 4O4RA 4QR1A 4NRTA 1CC7A 2MY7A 4CLFA 2HS3A 4I7FB 3MOJB 1RTZA 3GJSB 3BN4A 2BYCA 4F7VA 4C0OC 1LOUA 2CJYB 4Q8FA 5C42A 4CIOA 2UUAF 2DTJA 1S77D 3DXSX 1FWPA 4F26A 4I4BA 4K0KJ 4I2PB 3KLFB 2VBWA 1FFGB 3NP5A 4JB8B 3NNAA 3OV7A 4YR3A 1U48A 4I6WA 1HI8A 4DS5A 4DPWA 5DZ7A 3MMAA 2PD1A 2BANA 2B7BB 2LDYA 1HBOB 4B3RF 3BYRA 2QLXA 4EFAC 4KV8A 2JC1A 4FZVA 3WC2A 1JKHA 1WHWA 2C3YA 1HL6A 2BRLA 4RX6A 4CLKA 1JLFA 1S4EA 2YPYA 4J9KA 2K2PA 3VAGA 4DL3A 4HTIA 3GIJA 2OTLS 4DQIA 4I7FA 1K47A 4Q0BB 2AQ4A 2KDOA 4A8OA 3DRSB 2OPRB 2K06A 4ILLA 4HYKA 4ZN3A 3QNWB 3H5YA 4R8UB 3WDOA 4I2PA 3G82B 1SH0A 3KLGA 3KXDA 3KLFA 4DFPA 1R27B 1UWBB 2ZVSA 4EWTA 4A8MP 3OUYB 3NGTA 2V8PA 4DDFA 2RQKA 3JTNA 4DMZA 1ULRA 3GYGA 3R5AA 4LF7J 2FIUA 3C6TB 1HBOA 3VGVA 5KFUA 2XY6A 4ZVHA 1DQ8A 3PTWA 2ZD1B 4OIXA 5E33A 2UUTA 4WU2A 2RB7A 1PIEA 4OV6A 4DR7F 4Q0BA 2N4DA 2MZQA 2G2YA 2HQ3A 2F8HA 4QW8A 2HFVA 2OPRA 2W9BB 2ZKUA 3GE9A 3OXFA 1HIYA 4F36A 3Q8UA 1HNZJ 2JDJA 3JTOA 2DGWA 2DB1A 2X7IA 3G82A 4MK7A 4OHYA 2GC8A 3TP2A 4MYTA 2MKCA 1UWBA 4CI0B 2YKNB 1PO6A 3UPFA 2N3LA 4DV2J 3OUYA 1KR4A 2RT3A 4TKTA 1RAHB 2DNPA 2OEMA 5DDQC 4Y6IA 3EWGA 5IQ6A 3R9LA 7AT1B 4DEZA 2YWKA 3VQTA 1QE1B 2OMOA 4C3LA 1TL5A 2EK1A 5KG5A 1D9FA 2MZTA 1YITS 1IM4A 4A8YA 1WKLA 5HL7Q 3ENQA 3M9MB 5A8KB 2ZD1A 4ITSA 4C3MA 1U49A 1U0SA 2VOPA 2L9WA 2ZFHA 1CEZA 5I3UB 4ZP6A 1S1TB 2WZ1A 1QY7A 3IGNA 2NYHA 4FYXB 2IM2A 1SKUB 4DUZF 3M32B 3VQSA 3CJ4A 4UQTA 2W9BA 1UVKA 2WK4A 2LDIA 5FIIA 2D9OA 2PT0A 4J37A 3W1YC 3C3LA 1TELA 3AQPA 1V9OA 5A2QY 1AW0A 1N52B 1UETA 2VF3A 2YKNA 4DUTA 4URSA 3IAS9 3R3TA 3O5TB 3OBIA 2MY8A 4EMDA 3TX8A 3DRYA 3KJFB 2IBKA 3OFHA 3FBFA 1QE1A 1RAIB 1TMMA 3W64A 2JHEA 1VQ5S 2AKWB 3MPUB 2VG5B 2I8EA 3S1TA 2Z4PA 5EN1A 5A8KA 1Y5NB 4U96A 3RRHA 2ZUAA 1F0XA 1FNMA 1I1GA 2VPZB 5L39A 5I3UA 5F8LA 4O3OA 4J9OA 3M32A 3FDSA 3K89A 4QR2A 3N79A 3ZFVA 1RTHB 2CPIA 1SIZA 3JSBA 3H20A 4FKXA 1IKXB 4TU7A 3M8QA 4M8LA 4LF8F 4DCPB 2KFYA 2GHWA 4J91A 3TJ8A 4DV4J 1WC6A 1UVJA 1VC5A 3TARA 3BBCA 3IWLA 2VL1A 1YBAA 2JNJA 1P1LA 3MZIA 2FLLA 3D68A 5BR8J 4J7CA 2VPWB 4F50A 3BJYA 3LTOA 4LSLB 2F4FA 5GAGU 3LP2A 1KOOA 5D3GB 4NI2A 3T5HA 2HVDA 1HR0F 3GJTB 3M05A 4X4QA 5F8NA 1XNQJ 3RZAA 2VG5A 4B3TF 5ETRA 3BV8A 4OI0A 5KFMA 2NUUG 3GU0A 4YB1P 4WKYA 1YJRA 5J2MB 1X5SA 1LXNA 4KBIA 5CA5A 2Y0SD 2BE2B 4G3IA 2EKNA 3SQOP 1FVSA 4IOCQ 2W1BA 4A8WA 2VHGA 1NH7A 4DN0A 4P73A 4OHZA 2QA1A 3R1HA 1F5AA 4YDXA 2MLYA 4FDFA 1T11A 1HNXJ 2IMWP 3DFEA 5HK4A 1O8BA 2DVIA 1XR5A 1RUSA 2YKAA 3M8SA 1S6PB 1Q86T 2HFUA 4NCAA 4CO0A 4IO9Q 1KKHA 3CD0A 1APSA 4ZPAA 3GB0A 3ZO7A 1HWKA 2ZC4A 1VRTB 2VFUA 4Q43A 1NKCA 4WFAQ 1SL2A 4B9NA 2V8GA 4LSLA 2NXEA 3J7Z5 1X4EA 5D3GA
chains in the Genus database with same CATH topology
1RHUB 3P45B 2C1EB 2CNNB 2QLFB 3IBCB 3R5JB 4ZVTB 3EDQB 1RWOB 2C2KB 4JB8B 4DCOB 3R7NB 2CNLB 3KJFB 3GJTB 5K20B 1F9EB 1IBCB 1RHJB 2Y1LB 2HBYB 1PYOB 1SC1B 3P4UB 2H65B 3D6HB 3D6MB 2H48B 2QL7B 3R6LB 3R7BB 1RWXB 2H5JB 1RHRB 4ZVUB 1NMEB 3KJNB 3GJRB 1RWKB 2DKOB 2H54B 2CNKB 2XYGB 1GFWB 2H4YB 2XZTB 3GJQB 5IC6B 2C2MB 4LSZB 3R6GB 1RWWB 3D6FB 2CDRB 4ZVPB 1I3OB 1BMQB 5IC4B 2QLBB 1PAUB 1RWPB 2Y0BB 1SC4B 2FQQB 3IBFB 1I51B 4DCPB 4ZVRB 3RJMB 2CJXB 1RHMB 1RHQB 2HBZB 3GJSB 2C2OB 1ICEB 1RHKB 1RWVB 4DCJB 2C2ZB 1RWNB 1SC3B 2XYPB 2QL5B 1RWMB 2H51B 1RE1B 3NS7B 2CJYB 2QLJB 3EDRB 4ZVSB 2XYHB 1QDUB 3QNWB 1QTNB 2XZDB 2HBQB 2P2CB 2CNOB 3KJQB 4ZVOB 4ZVQB 3R7SB 2H5IB 3SIPB 2H4WB 2QL9B 2HBRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHU B;  3P45 B;  2C1E B;  2CNN B;  2QLF B;  3IBC B;  3R5J B;  4ZVT B;  3EDQ B;  1RWO B;  2C2K B;  4JB8 B;  4DCO B;  3R7N B;  2CNL B;  3KJF B;  3GJT B;  5K20 B;  1F9E B;  1IBC B;  1RHJ B;  2Y1L B;  2HBY B;  1PYO B;  1SC1 B;  3P4U B;  2H65 B;  3D6H B;  3D6M B;  2H48 B;  2QL7 B;  3R6L B;  3R7B B;  1RWX B;  2H5J B;  1RHR B;  4ZVU B;  1NME B;  3KJN B;  3GJR B;  1RWK B;  2DKO B;  2H54 B;  2CNK B;  2XYG B;  1GFW B;  2H4Y B;  2XZT B;  3GJQ B;  5IC6 B;  2C2M B;  4LSZ B;  3R6G B;  1RWW B;  3D6F B;  2CDR B;  4ZVP B;  1I3O B;  1BMQ B;  5IC4 B;  2QLB B;  1PAU B;  1RWP B;  2Y0B B;  1SC4 B;  2FQQ B;  3IBF B;  1I51 B;  4DCP B;  4ZVR B;  3RJM B;  2CJX B;  1RHM B;  1RHQ B;  2HBZ B;  3GJS B;  2C2O B;  1ICE B;  1RHK B;  1RWV B;  4DCJ B;  2C2Z B;  1RWN B;  1SC3 B;  2XYP B;  2QL5 B;  1RWM B;  2H51 B;  1RE1 B;  3NS7 B;  2CJY B;  2QLJ B;  3EDR B;  4ZVS B;  2XYH B;  1QDU B;  3QNW B;  1QTN B;  2XZD B;  2HBQ B;  2P2C B;  2CNO B;  3KJQ B;  4ZVO B;  4ZVQ B;  3R7S B;  2H5I B;  3SIP B;  2H4W B;  2QL9 B;  2HBR B; 
#chains in the Genus database with same CATH topology
 1OS5 A;  1X9W A;  2AU0 A;  1WHY A;  1GNK A;  4E0D A;  2XWX A;  3JTP A;  1R6V A;  5K20 B;  1VFJ A;  4FXD A;  4X4V A;  3AXK A;  4XPC A;  3NBP B;  5J2M A;  3T6B A;  1URN A;  4RLE A;  4UY8 5;  2I9S A;  2BE2 A;  3KK1 B;  3MR2 A;  1BE4 A;  1WAC A;  2QE5 A;  5BJR A;  4N76 A;  2ACM A;  2RS8 A;  2DY1 A;  1XWL A;  1B7Y B;  1FX4 A;  3TEH B;  3J7Y I;  2PA3 A;  3GSD A;  2D3Z A;  4NL5 A;  8RUC A;  1S6P A;  4WP9 A;  5BYR A;  3N01 A;  2CPJ A;  3GFY A;  3KNA A;  4DV0 F;  2EG1 A;  2H5E A;  4DSJ A;  5KFE A;  2V69 A;  2BKN A;  1VRT A;  1HBU B;  1RCX B;  2XYH B;  4RU9 A;  2O3D A;  5IQQ A;  4HH1 A;  3FCH A;  1VMB A;  3KTQ A;  5KFC A;  2ZHA A;  4JI7 F;  3PFO A;  1IXK A;  1HMV A;  2WB4 A;  2J6S A;  3NBP A;  4CLL A;  3SQG B;  3Q2T C;  4MIB A;  3K17 A;  3HPO A;  4HHU A;  4PG4 A;  3JYT B;  4FKY A;  2OPS B;  1ZZF A;  3EGV A;  3KK1 A;  4CT9 A;  3LA0 A;  3EPI A;  3N9U C;  2GQ2 A;  3RGI A;  4JI1 J;  4DR5 F;  1NSA A;  1K44 A;  1NLK L;  5JVG Q;  4J9U E;  4AND A;  3C2P A;  2DXE A;  4M5H A;  4C4W A;  2DHA A;  4DV1 F;  4D3G A;  4DFJ A;  4KGM A;  4RO0 A;  4IUF A;  1OQ3 A;  1TAQ A;  1MU2 B;  2PDA A;  3DCA A;  3UDC A;  1P8G A;  1FT8 A;  3F0N A;  3DLB A;  4WP3 A;  1T0T V;  2HWH A;  1G3O A;  3V81 B;  1RAB B;  2W8L A;  4YR0 A;  1T7P A;  1HBU A;  4ED2 A;  3HX9 A;  2NPF A;  1RAA B;  4AXJ A;  1NU4 A;  1FWL A;  3ULH A;  1VJQ A;  1SC6 A;  3KLH B;  1WD6 A;  3SQG A;  2XEX A;  4KTQ A;  2VKR A;  3IGV A;  1LK7 A;  1ZM4 A;  2CQB A;  4JI0 F;  4JBC A;  2OTJ S;  4K4U A;  2A3J A;  4ED8 A;  2PFF B;  1I5O B;  4DR1 J;  3N6L A;  1TKT B;  1H72 C;  2AGO A;  1BY9 A;  4ZVU B;  3T1H F;  4YB7 A;  3QPI A;  1SJF A;  3K5N A;  1FXR A;  1N0U A;  3HHN B;  2P5V A;  1WEX A;  3K5L A;  1MU2 A;  2HUR A;  4LF6 J;  3NWG A;  1K9M T;  4ZLN A;  3L7O A;  1XR6 A;  5MAO A;  2KYX A;  4Q7A A;  4USW A;  5IC4 B;  1FRJ A;  3V81 A;  1LWF B;  1NSP A;  4CO2 A;  5A8W B;  5DM7 Q;  4PUO B;  4URQ U;  2BA9 A;  2DY9 A;  1PSD A;  3OSN A;  2PO4 A;  5CHC B;  3A8J A;  1TL1 B;  5GVQ A;  3KLH A;  3MCO A;  4CP5 A;  5ITH A;  3WIU A;  2OHD A;  3KNG A;  3HLU A;  1NKB A;  1WG4 A;  4UOH A;  4M5J A;  2ZM6 J;  1OY9 A;  3R5G A;  4ERD A;  2BKO A;  1REV B;  4DSI A;  1XMO J;  1BC6 A;  4BCA A;  4A46 A;  4DL6 A;  2D3O R;  3MPV A;  4O4G A;  3SZ2 A;  4IR9 A;  4RW4 B;  3TI0 A;  5CQG A;  1T94 A;  3QRQ A;  4PG6 A;  4EK2 A;  4OYI A;  1EAY C;  5A76 A;  5E5N A;  2OLW A;  2RU9 A;  4DL7 A;  2ZBR A;  2UU9 J;  2FVS A;  2G1H A;  3CCT A;  3BBB A;  1CLF A;  1LWF A;  4OZJ A;  6FDR A;  3Q8P B;  4ZKA A;  4GKJ J;  2O67 A;  2KM8 C;  2LKZ A;  4P74 A;  4PUO A;  1RE1 B;  1FI4 A;  2YNH B;  4IRD A;  2IIH A;  1AFI A;  3RYL A;  2HS4 A;  1TL1 A;  3Q89 A;  2CVI A;  1LFP A;  1NDC A;  1TK0 A;  1NCL A;  4NA3 A;  2N7C A;  1MNE A;  3GYN A;  2EKY A;  1WWH A;  3I9V 9;  3PV8 A;  1Y11 A;  1B0T A;  1JNZ B;  4N5S A;  1U0H B;  2Q3P A;  4DL5 A;  1SCJ B;  1B7F A;  1P27 B;  3TQ1 A;  4CM2 A;  1REV A;  1T05 B;  2C3U A;  3PJW A;  2KHD A;  3U1N A;  2H48 B;  1SI9 A;  3HK2 A;  2HHQ A;  1WTB A;  4RW4 A;  4NLW A;  4ZOS A;  2DIV A;  3KG4 A;  1P9Y A;  1N0V C;  2LQ8 A;  4RZR A;  4NYP A;  4DV3 J;  3QFW A;  2JLF A;  4X4N A;  3M1V B;  1VIO A;  3C14 B;  3HI9 A;  4WZM A;  2W7P A;  3MWB A;  1BMQ B;  2C2D A;  5U47 A;  5ETL A;  3Q8V A;  2AMC B;  2ADC A;  2UUA J;  1N5T A;  2E1P A;  2YNH A;  1OPZ A;  1C0T A;  1ZBT A;  2HHP A;  4EBC A;  1ZM9 A;  3A3N B;  3CW2 C;  1FEH A;  1SH2 A;  4ZCI A;  3IWN C;  5FDL A;  2C2R A;  2AEF A;  3TZW A;  2GGP B;  2LEP A;  3M8R A;  1TTH B;  1FRM A;  5KFD A;  2HHT A;  1U0H A;  3E01 B;  2ZH2 A;  1DQ9 A;  3I56 S;  5T41 A;  1T05 A;  3H2U B;  3POT B;  2YWF A;  3O6Q A;  2KHC A;  2HZC A;  5HQM A;  2MZJ A;  1YSJ A;  3HHL C;  4DSL A;  4B3R J;  2HVI A;  4QW9 A;  1MWQ A;  3VF0 B;  4IDK A;  3M1V A;  1C2P A;  3TQE A;  3C14 A;  4TLR A;  2YVS A;  2BVZ A;  1VDH A;  2QX0 A;  1RIS A;  3D6F B;  3WHI A;  2LEA A;  4O3Q A;  2MLX A;  3C16 B;  1QAJ A;  2EK6 A;  1A6L A;  4DLE A;  5AXN A;  2BW7 A;  2BR0 A;  5F0U A;  3M6V A;  2KL8 A;  2AYE A;  3IG1 B;  1V5I B;  4PYD A;  3AOB A;  2CIM A;  3RRG A;  2GV1 A;  5J2N B;  5L1K A;  1WF0 A;  2EEY A;  1VQO S;  2GGP A;  3ZZO A;  2OFH X;  3E01 A;  4ANE A;  1R0C B;  4O3P A;  1Q0N A;  3AB2 B;  1YJT A;  1KHV A;  3FBE A;  3POT A;  3HT3 A;  3ZTO A;  5LSL A;  2YX4 A;  3QLH B;  1F5B A;  1HD1 A;  1YTY A;  2W01 A;  4GO5 X;  1RT5 B;  2W2O P;  1WF1 A;  4BBY A;  1U7L A;  5KFX A;  5IT9 U;  2P9E A;  4DR7 J;  3QGP A;  2JVO A;  2FGO A;  4JI2 F;  1RK8 A;  1VRQ C;  3RW7 A;  4DI6 A;  3C16 A;  2CDR B;  4I56 A;  1QM9 A;  1UJ6 A;  3OXL A;  2E9R X;  4WFX A;  4LFC J;  2CDQ A;  1KVK A;  3NCP A;  4IFY B;  3C19 A;  4DQS A;  3HJV A;  3SEO A;  3IG1 A;  3PFE A;  4QYZ J;  2YX7 A;  4NEZ A;  2CJQ A;  5AJ3 F;  3IN5 A;  5J2N A;  4PG7 A;  4HH0 A;  2XM3 A;  5KFV A;  5K5M A;  3KK2 A;  1L3T A;  1TKX B;  4CLU A;  2A0F B;  2BXJ A;  2HSE B;  3RAQ A;  3TUP A;  1JWW A;  1UJ4 A;  2ZHO A;  1UWA A;  3TVZ A;  1RHU B;  3HKW A;  2V94 A;  3BSC A;  4QWC A;  3QLH A;  4BHQ A;  1RDR A;  2P8I A;  2MZ1 A;  4P7V A;  4WTY A;  1N5Y B;  3CCW A;  5AXK A;  1CJV B;  2XQC A;  2QRR A;  2MSS A;  3KYL A;  3RBE A;  1U1L A;  5EDW A;  1J27 A;  3Q83 A;  2OPP B;  1L3U A;  2W9C B;  3BEG B;  2BOP A;  3RR7 A;  4AD6 A;  2XMM A;  2XB2 D;  1YIJ S;  1IWG A;  3GFX A;  4DUZ J;  3CGI A;  2LMI A;  1WEY A;  1S97 A;  2I38 A;  2OML A;  3M6U A;  4A48 A;  3MR3 A;  1WG5 A;  2UXB F;  2IMO A;  4IFY A;  4PG5 A;  3IS9 B;  3DLH A;  4EYH B;  2V4Q A;  1DQA A;  4HEA 9;  1LW2 B;  3HXM A;  2R7O A;  2W4C A;  4Y34 A;  2H51 B;  3PZP A;  4ED7 A;  3PR4 A;  2GVD B;  1TKX A;  1S7H A;  4L6V 3;  3PJ9 A;  2CPD A;  2FTR A;  3I82 A;  2ASJ A;  1R31 A;  1U4B A;  2CWX A;  5DQH A;  3KFW X;  2IA0 A;  2ZJP Q;  4NE9 C;  4RUA A;  3HD2 A;  1N5Y A;  1SV5 B;  4NLG A;  2CJA A;  3VAJ A;  5T14 A;  1CJV A;  4JV1 A;  2Y8Y A;  2XS2 A;  2RD5 C;  2RNE A;  4F4K A;  3OTO F;  4JP8 A;  2GQQ A;  2OPP A;  2LQ9 A;  3CIM A;  1U2F A;  2W9C A;  1H0H B;  4J9L A;  4PQU B;  4F8R A;  2VQE F;  4A8F A;  1SQG A;  2EVZ A;  3V6D B;  2HEK A;  5KT2 A;  5CZV A;  2MMY A;  4B3S F;  4C8O A;  4ICL B;  2W2P P;  4O44 B;  4OJG A;  4LF8 J;  1FWK A;  3IS9 A;  3PRD A;  2A6O A;  3MHY A;  2HLT A;  3CSK A;  4I6Y A;  1LW2 A;  5L9X A;  4HDG A;  1OY8 A;  1RHQ B;  3UCG A;  2LEB A;  4TU8 A;  3ZZU A;  2GVD A;  3IO1 A;  4HHJ A;  3QID A;  4IRC A;  1FX2 A;  2UVU A;  3GZ7 A;  4USV A;  1OYD A;  4P9S A;  2VFS A;  1HR0 J;  1SKR A;  2DO0 A;  2W7A A;  3R97 A;  4ZJL A;  4B3T J;  1TUG B;  1SV5 A;  2FY1 A;  2KT3 A;  3PYE A;  4MTP A;  1RT2 B;  3H7H B;  2LEC A;  4ED1 A;  2D41 A;  1RBO B;  1H7X A;  1RGV A;  3D6M B;  5I3Q A;  4PQU A;  3MF5 A;  3V6D A;  4EI2 A;  2O1P A;  1KVJ A;  3EE3 A;  2GFF A;  4LJM A;  4N41 A;  2CKW A;  3GJR B;  4EBE A;  1FF2 A;  3D1H A;  4ICL A;  3OL7 A;  4O44 A;  4BDP A;  1E6Y B;  5K8N A;  1TV6 B;  3CD7 A;  1M5S A;  1GMW D;  2F8E X;  4K50 A;  4LBI A;  5L46 A;  4LVO P;  4DL4 A;  1X31 C;  2XO6 A;  5KFA A;  4RWX A;  2VC1 A;  4OLP A;  1UVI A;  1T02 A;  2CJX B;  1SJ1 A;  1ZTW A;  4FPI A;  1KRP A;  3HCX A;  2UZA A;  5DG7 A;  4DSF A;  3C66 A;  3HVR A;  1QTN B;  3AH6 A;  1GMW A;  3CE8 A;  2VIC A;  2CQ1 A;  4TNO A;  4L73 A;  2JLE A;  2FHJ D;  3EMT A;  2QFI A;  4U95 A;  2G2O A;  1RT2 A;  4K8R A;  2VQF F;  5KFG A;  1JLC A;  3GV7 B;  3D0I E;  2AZ3 A;  4ZLJ A;  3OQ2 A;  4WIQ A;  1YJV A;  5F9L A;  1XEZ A;  2M7S A;  4O0N A;  2FHJ A;  3PKM A;  3AA8 A;  2BJ8 A;  2DNM A;  3BSN A;  3PX6 A;  2W24 A;  2V2V A;  4CO4 A;  4J9R A;  2HKE A;  2M8D B;  4DXL A;  2AX1 A;  1TV6 A;  3TVK A;  1CJT B;  2XWY A;  2DNZ A;  4DV0 J;  1I3O B;  3IC1 A;  4AFF A;  3GFH A;  2CYY A;  1M1G A;  2KXF A;  1MW7 A;  2YWH A;  5JXS A;  4B9V A;  2YQ3 A;  1KSP A;  1T9U A;  3MEG B;  4CYU B;  3PAC A;  1ZA2 B;  4JI7 J;  4PXC A;  1IKW B;  1RAE B;  4CH7 A;  5EX0 A;  2E29 A;  4DBQ A;  1HNW F;  3DI6 B;  4M5N A;  1YHQ S;  2E5L F;  1XMQ F;  2IM1 A;  2D7S A;  1VK8 A;  4QPT A;  2CRL A;  5CD4 A;  2XGP A;  1S0M A;  1U47 A;  4DR5 J;  1PYS B;  1U1Q A;  4K4T A;  1IVZ A;  2B4V A;  4DV1 J;  4QIV A;  4HT7 A;  2LP4 A;  4Z7C A;  5HMY A;  1S9F A;  1CJT A;  4FVM A;  4NXN F;  2HZA A;  2DPI A;  2RDI A;  2GHV C;  3C15 B;  2AJ1 A;  1T03 A;  5IT9 Y;  1RU1 A;  3U02 A;  4RNM A;  2QLB B;  3N6M A;  1FVQ A;  1UAW A;  4LIR A;  1AB8 A;  4HI2 A;  5KFY A;  5IFM A;  1SH3 A;  1TMJ A;  3PEJ A;  3AOD A;  3X1L B;  3P96 A;  2R7U A;  3PW4 A;  4ZPC A;  3BPD A;  5A0Y B;  3MEG A;  4DWI A;  4CYU A;  2BJ1 A;  2ZHB A;  1IKW A;  2JZ5 A;  1N54 B;  4DR4 J;  4OJH A;  3PW5 A;  4WJB A;  3C6U B;  2DYA A;  4MYU A;  3DI6 A;  1RAF B;  4PR6 A;  2QG9 B;  3EDQ B;  1UW9 A;  1T8E A;  4RNO A;  4CLS A;  2X1F A;  1RSC A;  1GXL A;  1I94 F;  1HLW A;  2CQC A;  1PYO B;  1QSY A;  2DH9 A;  2ZWP A;  5C2G A;  4CO1 A;  2QL7 B;  3QT7 A;  2VIH A;  2WCX A;  3J7Y U;  2UVR A;  2AWZ A;  3OVS A;  4PYA A;  4RNF A;  4PWU A;  1W25 A;  2LQJ A;  2WB1 D;  4WII A;  2VZ9 A;  3HD1 A;  2HQF A;  3IR6 B;  2RQM A;  1LNQ A;  1FDB A;  2R7R A;  4F02 A;  4DPX A;  2NR0 A;  4B02 A;  4Z37 A;  1D9A A;  2ZBC A;  5D0E A;  4ZLP A;  5A0Y A;  7FDR A;  2ATC B;  1GK8 A;  1RA6 A;  1S1V B;  3VAK A;  2YWE A;  1M5H A;  3SFG A;  3D0H E;  2V9K A;  5AXL A;  2GS8 A;  2VJU A;  1IJE B;  3F44 A;  2H1Y A;  3PYD A;  2VA3 A;  2F8M A;  3LP1 B;  1SQE A;  1UP1 A;  2CQ0 A;  4QBU A;  4XPE A;  1S12 A;  4LF7 F;  3GR1 A;  4RNH A;  3D1O A;  2P6T A;  3ZC4 A;  4DSE A;  1RHJ B;  5KFP A;  5A8R B;  2EBG A;  3PXG a;  4NCG A;  2ZH6 A;  1M0S A;  2IJN A;  4YUD A;  3ELH A;  3HT0 A;  4ZVG A;  2JX2 A;  4P72 A;  1FDA A;  2ILY A;  2VDI A;  2HHV A;  1HNV B;  1U2R A;  4YHH F;  2F9D A;  2DCL A;  5CD4 H;  1WC3 A;  3UN3 A;  1S0V A;  2X3D A;  3OLA A;  1NJW A;  2IAJ B;  3T1A A;  2VBZ A;  2J5A A;  2OFG X;  4ZVR B;  4CRJ A;  1Z2L A;  5JMN A;  1S1V A;  2AP6 A;  1N4L A;  3HHE A;  1QUP A;  2HHH J;  5EWF A;  2HRU A;  1Q8B A;  4GMK A;  3EDR B;  3ENA A;  4DV2 F;  3EVM A;  4U67 Q;  2BAB A;  2A10 A;  3NCQ A;  3H42 A;  1GXT A;  2VBY A;  1NSQ A;  2ZH4 A;  2V63 A;  1SUQ A;  1WSR A;  2ZEJ A;  3MPW A;  3LP1 A;  2VDH A;  3TAQ A;  4B17 A;  1YBU A;  1QVF R;  2KRR A;  3OR1 B;  3GG1 A;  1H73 A;  3BR8 A;  4YY3 J;  2B0G A;  3H40 A;  5KFZ A;  4LR9 A;  1M5K C;  2RH3 A;  4J9S A;  3EUN A;  5A6P A;  1EHW A;  1Q7L B;  1M5P C;  3TUZ C;  4ZLL A;  3ILO A;  2ATL A;  3N5B A;  4KFB B;  3UD5 A;  3WZ0 A;  3KDN A;  2YKM B;  1HNV A;  5LJ3 Y;  1RT1 B;  1RAD B;  3IWX A;  1RJJ A;  4FYW B;  3CJQ A;  3FZB A;  1S76 D;  2MST A;  2XG8 A;  4LVN P;  1U1P A;  1LWE B;  3VR1 A;  4RW9 B;  4TY8 B;  3RRK A;  4OHV A;  5KFR A;  4QU6 A;  2RVJ A;  2XMJ A;  3W5Y A;  2JJ4 D;  2KFN A;  1HHT P;  2J0Q D;  4WZQ A;  2DCU B;  4FP9 A;  1YKW A;  1IJF B;  1HBN A;  1LWX A;  4KGZ B;  2IRX A;  2Y9H A;  3HZE A;  4F4X A;  1PJ6 A;  4XTT A;  4K2X A;  2NZ4 A;  1VC0 A;  1HWU A;  4DF8 A;  3BRE A;  2XSF A;  4OZ0 A;  3IM9 A;  3OR1 A;  4Q2L A;  2KFZ A;  1OYE A;  3TRG A;  2WVB A;  3J7A 1;  4ED6 A;  4DX7 A;  3DM2 B;  4OI6 A;  1JNR B;  5BYQ A;  2MKJ A;  1HBM B;  1N5V A;  1NK5 A;  4KFB A;  4D3H A;  1WOS A;  2DGS A;  4P52 A;  2RQC A;  2JH3 A;  2YKM A;  1RT1 A;  5EX3 A;  4WFB Q;  2R2U A;  4HT5 A;  5E3A A;  3OVB A;  3I32 A;  4K4Y A;  2BOA A;  3L4B C;  1OY6 A;  3E8O A;  3BSA A;  3IMQ J;  1VLY A;  1R7I A;  1LWE A;  3IR5 B;  3LWL A;  4RW9 A;  4TY8 A;  3K8V A;  1Q8I A;  1C1C A;  3P8B B;  4IRK A;  3CO9 A;  3SMZ A;  1UKU A;  3CTR A;  1LWC B;  3VAF A;  1H74 A;  2ASL A;  1X4A A;  1MLA A;  1YJ9 S;  4G1Q B;  4Y2M A;  3BH6 B;  2ASD A;  3WQP A;  3PVX A;  5CCM A;  2CJB A;  3BPS P;  5KG6 A;  3QZ8 A;  3TAM B;  2R7W A;  1KC8 T;  2C1E B;  3A1Y G;  3DM2 A;  2DGU A;  1L3V A;  2UP1 A;  2RAQ A;  1ELO A;  1HBM A;  2B43 A;  2ZBQ A;  3BKU A;  1EX8 A;  4CT8 A;  1NK8 A;  1QJH A;  2KM8 B;  2MQN A;  2RQ4 A;  1UPM B;  1F2H A;  4J9N A;  2WHO A;  1NK4 A;  3Q24 A;  5KG7 A;  4KKO B;  2PEH A;  4OI4 A;  3RAM A;  4GC6 A;  4ES2 A;  4QWE A;  3HSG A;  2AGQ A;  5I3P A;  5K8M A;  4MIA A;  4YQW A;  4P6Q A;  1VQ6 S;  3P3D A;  5D4O A;  4C97 A;  2WSE C;  2LQB A;  1LWC A;  1TKD A;  5KG3 A;  4C2M A;  4XIU A;  2XO7 A;  2ASY A;  4U9R A;  1IBM F;  4G1Q A;  5HO4 A;  4CCH A;  3G8T A;  3OL6 A;  5G0R B;  2NXU A;  2FLN A;  2ABY A;  1C1B B;  4YOE A;  3H2L A;  3VV2 B;  4PXD A;  4I64 A;  2GJF A;  1AUS L;  2QGF B;  3LAN A;  4LIW A;  4QR0 A;  3R5J B;  1S6U A;  4I0W A;  5KFH A;  2QN6 B;  3B4M A;  3DKD A;  1VQN S;  4GVB B;  3PYF A;  4XK8 C;  5KAK A;  2RDJ A;  2VFV A;  3D6H B;  5HRO A;  1UVN A;  1U6B A;  4DF4 A;  3Q86 A;  4KKO A;  3OPK A;  1YZ6 A;  3AD7 C;  3ZTR A;  3UDV A;  1JJC B;  3NGR A;  2V4J B;  1R43 A;  3BGU A;  1RA7 A;  1ITP A;  4ZVE A;  1KQK A;  1RLD A;  5J1P A;  4NLV A;  3CB4 A;  5E41 A;  2JEI A;  4V1A k;  2FJA B;  3KMS A;  2HFS A;  3BM7 A;  4QWD A;  4LRD A;  5G0R A;  3CVK A;  2AJ2 A;  1O5J A;  1C1B A;  4RWW A;  2LFV A;  3OTC A;  2VKZ G;  4JYA F;  3N4W A;  3MAH A;  3UDE A;  2Q79 A;  1CJU A;  3RTV A;  4QYZ K;  3TO8 A;  2DGT A;  2RIJ A;  4IOA Q;  3J81 j;  3DRR B;  4L76 A;  1KBR A;  4KQZ A;  4JI3 F;  1SC1 B;  2XMU A;  5D4N A;  1HQE B;  3VZH A;  2FZG B;  1HHS A;  1VBZ A;  4FBT A;  2FHM A;  2Q6B A;  2Z30 B;  4JI4 J;  1P9Q C;  5CYJ A;  2YY3 A;  4B3S J;  2V4J A;  3HHL D;  1NJX A;  2MYF A;  4OYX A;  5ETN A;  1NND A;  3PHT A;  2IM3 A;  1VK3 A;  3CJ2 A;  3M7V A;  2HMI B;  2QYG A;  2YQ0 A;  4FYD A;  1KDN A;  1WEZ A;  1ZAV A;  4ANC A;  1EIY B;  4WTO B;  4FF3 A;  4O3R A;  2A6M A;  1OO0 B;  5ETK A;  1ACM B;  2HQG A;  4B3O B;  1EKR A;  3CJ8 A;  1CBK A;  3CCM S;  3S6E A;  2J76 E;  3DXB A;  4C11 B;  4LQ3 A;  1S99 A;  2GAG C;  2UUW A;  3K0J A;  1RB0 A;  1ZS6 A;  1PAU B;  2E5H A;  1UJ5 A;  1VR6 A;  3DRR A;  1SKS A;  4AXI A;  3I9Z A;  3A3P B;  1VQ4 S;  1X7V A;  2PE8 A;  1B70 B;  1X4H A;  2LVW A;  3THT A;  2MTL A;  2EXU A;  1HQE A;  1RKI A;  3BKT A;  3NGU A;  5HI7 A;  4C6A A;  1RBL A;  1LW0 A;  2GO9 A;  2WSC C;  5LMN F;  3UI3 A;  2D3U A;  1ARO P;  1ZM3 A;  5E3R A;  1KFS A;  5DLG A;  5C25 A;  3BKF A;  2IDL A;  3N5F A;  2HMI A;  3EGZ A;  2Z0G A;  4R25 A;  4ILM A;  4IH7 A;  2AT1 B;  2YKQ A;  4WPA A;  3CDW A;  2KN4 A;  2FJD B;  3OJS A;  4EUV A;  1NJY A;  4B3O A;  4CLW A;  3HFK A;  4UOG A;  4KY3 A;  3CNQ P;  4RJV A;  2QSF A;  1U1R A;  4ZPB A;  3K8W A;  1TL7 B;  5B7W A;  4R0J A;  2VQF J;  3SSS A;  1UW4 A;  3M8W A;  5AE2 A;  4LRB A;  2FZK B;  3P45 B;  3HZG A;  3AXM A;  4IQX A;  1N34 F;  2ZJQ Q;  3UQS A;  4KHP J;  1IBC B;  1JLE B;  4DFM A;  2H65 B;  3FEZ A;  3MEE A;  2JWN A;  2M70 A;  3FCW A;  1UTA A;  4WXW A;  5GAH U;  1RWK B;  2BZ2 A;  1GTE A;  3V5R A;  3Q8Y A;  2Y8W A;  3NGD A;  5ETS A;  4PQA A;  1FDN A;  2LLZ A;  1HWJ A;  2ZZN A;  1U2C A;  1FHT A;  1RWV B;  2C2Z B;  1WOO A;  3ZZ0 A;  3KLI B;  1TL7 A;  1MMN A;  2V6A A;  1G4C A;  3W62 A;  4QJV A;  5D4P A;  2IVF B;  1HNW J;  3TOQ A;  3GCX P;  2E5L J;  1WKK A;  4P2M A;  1QLN A;  1JLB A;  2F1F A;  3EXY A;  1XMQ J;  1CVJ A;  4RUB A;  4P2X A;  1JLE A;  2IRU A;  1Y3J A;  1SIW B;  3W7B A;  4WK3 A;  2MJU A;  4X64 J;  2AJQ A;  2PN6 A;  1YI2 S;  2F9J A;  4HTJ A;  4XDC A;  1TP7 A;  2Z2M A;  1SQF A;  4NXN J;  4FF4 A;  4PAB A;  2DR6 A;  3DLE B;  5H1S V;  2AZ1 A;  3BO4 A;  4F4Y A;  1EP4 B;  2PI5 A;  3NY0 A;  3MEK A;  3H5S A;  3ILI A;  4DV5 F;  4M5L A;  3MD1 A;  3J7A N;  3M8Z A;  3KLI A;  3QRP A;  3UNY A;  3SV3 A;  1KOH A;  3ZZP A;  3B4D A;  3MTK A;  4KIA A;  4PRF A;  3OL8 A;  3J80 U;  2FVC A;  2R9L A;  3NRB A;  3IFE A;  3W63 A;  5B0B A;  1SPB P;  1XN9 A;  5G4D A;  1F1B B;  4ZVT B;  1I94 J;  2MXY A;  3DOK B;  3OVA A;  1N5S A;  2KJV A;  3ZTP A;  4GKK F;  1Q5V A;  1NPP A;  3MR7 A;  2X1A A;  3RAX A;  2XI3 A;  2JLG A;  1XIQ A;  3DOM B;  1ZZN A;  3DLE A;  1JLG B;  1RAG B;  1TUV A;  1IWA A;  1VOM A;  4NZ7 A;  1RHR B;  4KGV B;  3W5Z A;  1M5O C;  4ZVF A;  3MM9 B;  3ISZ A;  1EP4 A;  4OJ3 A;  4H4K C;  1HD0 A;  2AJF E;  2K1R B;  4IG3 B;  3HF5 A;  3LPY A;  2CQP A;  4U7U D;  3CED A;  1U8S A;  4NLT A;  2ZVI A;  4DX6 A;  2ZH3 A;  1D1U A;  1F3V A;  4URG A;  3UD4 P;  4AUK A;  2M8H A;  3R5B A;  2DRA A;  2L3M A;  5IM0 B;  3FKB A;  2I5J B;  1RHK B;  2KKH A;  4W90 B;  2CQG A;  5L8R C;  2X1G A;  1N6Q B;  4K5R A;  1LQ9 A;  5C24 B;  4FYV B;  4X62 F;  3P49 B;  2XGQ A;  5B0A A;  3MCN A;  3ZNU A;  3CCU S;  3A4T A;  2VG7 B;  1EZZ B;  1GXU A;  4NLP A;  3DOK A;  3KOA A;  2C2K B;  4Y2I A;  4LRA A;  4N8N A;  4PCQ A;  4B3M J;  1U1N A;  4CM0 A;  2UV8 A;  2YPZ A;  3J7Z T;  2ZH7 A;  1R0B G;  2D9P A;  3R5D A;  3DOM A;  4OJ1 A;  2K8G A;  4PPZ A;  1JLG A;  2VFR A;  2V50 A;  3MM9 A;  2H5J B;  4CWB A;  2JEG A;  1YWX A;  4YHH J;  3DRS A;  5SUH A;  2K1R A;  4IG3 A;  5FD1 A;  3FUY A;  1FES A;  5D15 A;  4U8Y A;  4LFC F;  4IG0 B;  3M9O B;  4R8U A;  1NO8 A;  2XLI A;  1Q16 B;  5IM0 A;  1NH8 A;  4DS4 A;  1N32 F;  4YN3 B;  3WC0 A;  1NDP A;  2MQ8 A;  3MMB B;  2I5J A;  3IBF B;  2A2D A;  1PBU A;  1FJE B;  3THP A;  3KJV B;  1N6Q A;  2IDE A;  3MUT P;  1SBR A;  5C24 A;  2HK2 A;  5KFL A;  3A8I A;  3FZ2 A;  4IQM A;  1Q5Y A;  2QZ8 A;  2VG7 A;  2DR7 A;  1EJ7 L;  2AEJ A;  1XNR J;  2EFO A;  2CNO B;  4NZ0 A;  2E1M C;  3G71 S;  3C6T A;  1BQM B;  5DZ6 A;  2X51 A;  4ZJQ A;  3T1Y F;  1CPZ A;  1KD1 T;  4IO1 A;  3AA9 A;  3MMC B;  1LEO A;  3AD9 C;  2BEF A;  1S1U B;  3HFV A;  3HP6 A;  4OZL A;  4LFA F;  5ETT A;  5CXT A;  4MK8 A;  4JV5 F;  3D4J A;  3HDS A;  1FJ7 A;  2CQI A;  3T5J A;  1RP5 A;  3HHK A;  4OX9 F;  3ICL A;  1OQ6 A;  3OFG A;  4IYQ A;  2NUH A;  2EC2 A;  1NZ8 A;  4IG0 A;  3M4X A;  2ZH9 A;  3Q8S B;  2N4C A;  4N77 A;  5GAG I;  1MN7 A;  2ALZ A;  1MSW D;  1VC6 A;  3MD3 A;  3KJV A;  3OTB A;  5K8O A;  2FPH X;  1VBX A;  4TU9 A;  4DCJ B;  1A0O B;  1V5V A;  1UCN A;  4DFK A;  3DHW C;  1HI0 P;  2NRE A;  2FVR A;  2KVI A;  3BDE A;  2MKH A;  4OX6 A;  3KMQ A;  2GVZ B;  2B4O A;  3AD8 C;  2GMJ A;  1BQM A;  2COL A;  2J9E A;  3PW0 A;  2B3T B;  1FJG F;  2V0N A;  4FNI A;  3MMC A;  2DIS A;  2FLO A;  3V4I B;  1S1U A;  1S1T A;  4LR7 A;  3KG0 A;  1BD6 A;  4CZC A;  2IBO A;  1NPK A;  4ES3 A;  5H9F J;  1JLQ B;  1Y5I B;  1J5O B;  1YRU A;  2E1R A;  5KG1 A;  3TZZ A;  1X0P A;  4N8O A;  3JQM A;  3X3U A;  4CNY A;  1URR A;  3W2V B;  3TZY A;  4KYZ A;  3ITH B;  4LUB A;  3ISN C;  2QSW A;  2KZZ A;  4LF2 A;  5KT4 A;  2SXL A;  3EZO A;  2GVZ A;  4OZ3 A;  5KT3 A;  3KUH A;  1SL0 A;  3ONQ A;  2P2C B;  3QAU A;  3D1Q A;  2MPU A;  3AY0 A;  2FJB B;  4DR3 F;  2NXJ A;  1FER A;  4ALZ A;  1S6Q B;  3HUL A;  3TNV A;  2V68 A;  2KXN B;  2WOM B;  3AJ2 A;  2XLJ A;  3MAQ A;  2G0I A;  3VAM A;  1RTH A;  4X66 F;  4M95 A;  4B9T A;  1IKX A;  2OD6 A;  4M5G A;  3CJK B;  5DGA A;  1OSC A;  5B0F A;  5HMX A;  2HGN A;  1VQM S;  2HHX A;  1Q4R A;  3D0G E;  4W98 A;  3W2V A;  3FSI A;  2N7Y A;  1S9E B;  1FFS B;  1WC4 A;  2OP5 A;  3AB4 B;  4XAK A;  3ITH A;  1IBM J;  3OHA A;  5K9F A;  5AXM A;  4KPY A;  3ZZT A;  3LP0 B;  3NOC A;  1QAY A;  2PI4 A;  3NCR A;  1WTF A;  4DQP A;  3TEG A;  2C22 A;  2ZDP A;  4UOC A;  4F4W A;  2FB0 A;  1CS4 B;  3ZTS A;  2EI5 A;  2XBP A;  2RU3 A;  3SIP B;  1XTZ A;  3R27 A;  4OLO A;  1CC8 A;  2EFG A;  1U1K A;  1UVL A;  1QD1 A;  3OFF A;  2G2Z A;  3HSJ A;  1BWE A;  3GSI A;  2WOM A;  4K59 A;  3W2W B;  4WCE Q;  5GAD I;  3J80 Y;  2QTW A;  5LXY A;  3K5M A;  4WE1 B;  2XSJ B;  3CJK A;  2K3K A;  3W5X A;  4OYA A;  4ZN1 A;  5CAB A;  5DO2 A;  4F0K A;  5THW A;  1U45 A;  1Z1Z A;  2M9K A;  1S9E A;  1KP6 A;  5D4L A;  2W7O A;  4DQR A;  4NMX A;  3LP0 A;  2VUG A;  4GC7 A;  3MGJ A;  3GFZ A;  1XBW A;  1UZD A;  4DU7 A;  3CPW R;  1RT6 B;  4OI2 A;  3NNH A;  2FC8 A;  3GR0 A;  3G96 A;  4ZDN A;  2XMT A;  4A8K A;  4Y0F A;  1CS4 A;  3MTJ A;  2DR8 A;  4ECY A;  5HJY A;  3CME S;  4JYA J;  1S6O A;  3UR3 C;  2B5J B;  3NGS A;  2HIY A;  2WAQ D;  3T41 A;  4ZPW R;  3CC2 S;  2ACY A;  1X4F A;  3KJQ B;  4PWW A;  3CD5 A;  4QIG A;  3PW2 A;  2WSF C;  3W2W A;  2DXD A;  4JI3 J;  2AV5 A;  4AL7 A;  2NSC A;  5ETO A;  4QOT A;  5LL6 d;  2V2K A;  4EO6 A;  1LV5 A;  4TXS A;  4EGL A;  1TAU A;  4WE1 A;  1KLM B;  2XSJ A;  4RR5 A;  1GAO A;  2DHX A;  5IWA F;  5CAA A;  2BAC A;  4RW7 B;  1YK9 A;  1GX5 A;  4ES1 A;  2I1R A;  2E5I A;  2K7J A;  2ZBI A;  4NXM F;  4C8K A;  3SFU A;  4DG1 B;  3O1L A;  1XK8 A;  2H4Y B;  4I1T A;  3RB3 A;  5B09 A;  1XJW B;  3L7U A;  1X4C A;  2W25 A;  3M2R B;  3FJ2 A;  1T9V A;  3H5X A;  2CVE A;  5F8J A;  2XNQ A;  2V4R A;  4ID8 A;  1RT6 A;  2R2S A;  1T95 A;  1SJ4 P;  4RUC A;  4DL2 A;  3VGU A;  4CQ1 A;  2YWG A;  1L5U A;  3ZNJ 1;  1AYE A;  3DC2 A;  3CMQ A;  1H6K X;  2QL5 B;  4DR4 F;  2RUS A;  5F3T A;  2B5J A;  3FQK A;  3TW0 A;  3JYT A;  2OPS A;  3CF5 Q;  4F4Z A;  1S7I A;  3CO0 P;  4N47 A;  3BN7 A;  4CLY A;  3M30 B;  2VC0 A;  4KR0 B;  4BC9 A;  2Z56 B;  2QL9 B;  2K3I A;  2QA2 A;  2HBR B;  2MKS A;  2QIF A;  2GML A;  3OTD A;  1FE0 A;  5CCL A;  5DJB A;  3DGV A;  1R8P A;  1KLM A;  2QJ3 A;  2RE1 A;  3CCQ S;  3P6Y C;  4L72 B;  2HBY B;  3JQJ A;  3UW1 A;  1T3O A;  4ZCM A;  5LMN J;  1O6X A;  4OYW A;  1FD2 A;  4DG1 A;  3SSQ A;  4DR6 F;  2W2M P;  4ECZ A;  2UUB F;  5HQ8 A;  1TQL A;  5B0C A;  2WW8 A;  1RWW B;  4HKQ A;  1IN0 A;  1Y9O A;  3RBZ A;  4ZVP B;  2WVF A;  2EFV A;  1YZ7 A;  2IYG A;  1RHM B;  2WVD A;  2IM0 A;  3MFH A;  2B9Y A;  1UA0 A;  3PR5 B;  1K0V A;  4WFY A;  2VAS A;  2XI2 A;  2H9Z A;  3DHX A;  4CDI A;  2A1B A;  4ZA1 A;  4LMZ A;  1U8W A;  2JRS A;  2MQO A;  2PMZ D;  1SL1 A;  4QIW D;  3EIC A;  4PAA A;  3M30 A;  3UN5 A;  2OSR A;  5DRK A;  3RUB L;  1Y7P A;  4KC5 A;  2B4P A;  1U1M A;  5IOL A;  1TKT A;  1MWZ A;  1N34 J;  4ZVQ B;  3SCJ E;  2QC3 A;  1QUV A;  1AFJ A;  1Q95 G;  4KHR A;  2EFQ A;  2VG6 B;  3FQL A;  5EHH A;  1UEV A;  2QMX A;  1RT3 B;  3W3S A;  4OMF G;  3BF4 A;  2CFX A;  3CDU A;  5GMK a;  2J9D A;  1NPR A;  3GV5 B;  3NMR A;  2WBR A;  2W2Q P;  2C28 A;  2DIT A;  3NNC A;  1VIX A;  3CT9 A;  2WTF A;  5SZT A;  3ET6 B;  3KJN B;  2E1C A;  3QIP B;  3OR2 B;  5A8W A;  1QSS A;  2XYG B;  5LMU F;  1N8R T;  1GH8 A;  4C0B A;  2HHH F;  1LKZ A;  2OO4 A;  2R8H A;  2R8J A;  5DGB A;  3R2D J;  1JXE A;  2DGV A;  3GLJ A;  2FQQ B;  2BRK A;  4NLQ A;  4R0E A;  2E5G A;  2PII A;  4KRW A;  3J81 U;  2FHO B;  3MR5 A;  2DNL A;  2J0W A;  1PBA A;  3DU6 A;  1BQN B;  1CQN A;  2LXF A;  1VS3 A;  2KG1 A;  1VLO A;  3FNN A;  4MMO A;  2HBQ B;  3UWT A;  3FRY A;  2KU7 A;  4MH8 A;  2UXC F;  3UCZ P;  1AT1 B;  2ZZM A;  4YY3 F;  1S10 A;  1NRK A;  2R7S A;  3HVA A;  1PCA A;  4Z7Y A;  2BDP A;  2VG6 A;  4FF1 A;  1KWM A;  2YH0 A;  3H0P A;  2VA2 A;  2PGC A;  3AHP A;  2YQ1 A;  3I55 S;  3EVO A;  4JV2 A;  4HLB A;  4CH0 S;  2NYI A;  1RU2 A;  1R0A B;  2CZV C;  2W8K A;  4CLZ A;  4KJI A;  3ET6 A;  1H2V Z;  3QIP A;  3LF0 A;  3OR2 A;  1HYS B;  1YJU A;  5LM7 E;  5B0G A;  2OEJ A;  5LXR A;  3R1L A;  3BGF A;  4J9Q A;  3B6B A;  1J2V A;  4DV5 J;  4A8Q A;  1OPI A;  3AFG A;  2DGQ A;  1ZA1 B;  1JIH A;  3AOC A;  5D78 A;  2AW0 A;  3NGK A;  1NHV A;  4F04 B;  2HGM A;  1NM2 A;  3TJ9 A;  4NLS A;  2VON A;  5KFJ A;  2JVR A;  2RKI B;  4CLP A;  3NKY A;  3PJX A;  4FYY B;  5GME A;  5M2P A;  4A47 A;  4ZMM A;  2V5H G;  3QT6 A;  5D0H A;  5HSP A;  1UZH A;  2CAJ A;  2F4V F;  3EJM A;  4FS2 A;  2HHW A;  4GKK J;  2OEL A;  2ZH1 A;  4U8V A;  2HK3 A;  1AZS B;  4P2S A;  2DXF A;  1G2E A;  4OYO A;  3N0V A;  2G0J A;  2R42 A;  1R0A A;  5ETQ A;  1NXI A;  3D5M A;  8AT1 B;  2BMB A;  3KLG B;  1HYS A;  4RNN A;  1HNI B;  2XUL A;  3FGV A;  4NA1 A;  1GMU A;  3L09 A;  2E7X A;  1SKW A;  1O51 A;  4M1K A;  2HHS A;  5F3Z A;  2Y0B B;  4ETX A;  3KLV A;  2RKI A;  4OZN A;  3GIM A;  4IFV B;  2MHE A;  4DV6 J;  4LSN B;  1T9X A;  4FXV A;  1S0O A;  4X62 J;  2QV6 A;  2VFT A;  1YQH A;  2MQP A;  2G9O A;  1PYT A;  3U1L A;  2PSZ A;  3QT8 A;  5EGY A;  2FVP A;  1FRH A;  3TAN A;  4LRF A;  2HW3 A;  2JFK A;  4L3K A;  1AZS A;  3NS6 A;  5KFF A;  4I69 A;  2OPQ B;  4LR8 A;  2PMW A;  4U6P A;  4ED5 A;  4DPO A;  3A12 A;  2LXI A;  3BGL A;  4G6V B;  3H2V E;  3DDN A;  4H54 A;  1HNI A;  2WW4 A;  4NLD A;  1KFD A;  4NCB A;  1VYA A;  4X4R A;  1N32 J;  3PYG A;  5HVH A;  4M5I A;  4OZ2 A;  1IBK F;  2RJZ A;  4IFV A;  4LSN A;  2NQP A;  4WWS A;  1VHI A;  4K4Z A;  2XY5 A;  1FO1 A;  2I6W A;  2ZUG A;  3HSD A;  3GV8 B;  4KE5 A;  1J5E F;  1D3W A;  2C2N A;  2NSB A;  3I6P A;  2U2F A;  2ZE2 B;  3RB4 A;  1NKE A;  1NDK A;  1CSJ A;  3KKF A;  1RT5 A;  4OZ5 A;  1LXJ A;  2E7W A;  3HJF A;  4PXB A;  3T1Y J;  1WC5 A;  3GPA A;  2JEJ A;  3NAI A;  3QSY B;  1F5C A;  2OPQ A;  4NLU A;  2E9T A;  3NS5 A;  4L74 A;  1WNE A;  2BE7 D;  4LFA J;  2MJN A;  2E5J A;  4H4M B;  1C4A A;  4DQQ A;  4JV5 J;  3S01 A;  1GMV A;  3MEC B;  3MM7 B;  1C0U B;  3P4U B;  4LF4 J;  4OX9 J;  1YJW S;  2ZDO A;  2L9N A;  3ILL A;  4OI1 A;  2J7W A;  4LF9 F;  1CQM A;  1H2U X;  2CPX A;  1RZM A;  1I6J A;  4TQS A;  1RAC B;  1S48 A;  1V3R A;  5GAE I;  4Q44 A;  4CH1 A;  1VQL S;  3VAI A;  1N5Q A;  2CQ2 A;  4C48 A;  2R2T A;  4DZD A;  2BKP A;  2AD9 A;  1L3K A;  4I2Q B;  4HL9 A;  3T5K A;  4OQJ A;  4FN5 A;  1VIS A;  5L1J A;  3JXO A;  5HMZ A;  1WC1 A;  2M4M A;  2M0G B;  4LQ9 A;  1NDL A;  3BO3 A;  1JJH A;  2ZE2 A;  5BYS A;  3DDK A;  2QLJ B;  1P6T A;  3MM6 B;  4USJ C;  5MLC V;  1SJ3 P;  1BWV A;  1FJG J;  4F3O A;  2Z8Q A;  1X60 A;  4QWB A;  1WI6 A;  1KVI A;  2KB2 A;  1R8H A;  4C3K A;  2A18 A;  3T6J A;  2GW8 A;  3M8Q B;  2Y1I A;  1FRK A;  3PY8 A;  1C4C A;  1IUJ A;  4QQB A;  2UXD F;  3OL9 A;  2M88 A;  4IKA A;  3OJU A;  4JI8 F;  4H4M A;  1KTV A;  2CNL B;  4UF4 A;  3MEC A;  4WKR A;  2IFX A;  3ENW A;  3MM7 A;  1C0U A;  2B9E A;  5C5J A;  2HQI A;  1R89 A;  3M2U B;  1JJ2 R;  5C2C A;  4JI4 F;  2BW2 A;  4ZHR B;  2WVE A;  1WJ9 A;  3FRZ A;  3RG6 A;  4F4A A;  2KO1 A;  2XTJ P;  2J6U A;  4RW6 B;  5IT0 A;  2FJV A;  3LP2 B;  4NI2 B;  4NYO A;  1W7W A;  2DRB A;  3EPG A;  5IC6 B;  1TK8 A;  4RL1 A;  3KK3 B;  4I2Q A;  4CO3 A;  3AAW B;  5E2Q A;  1YVF A;  1RT7 B;  4ECU A;  2QA4 G;  1ZTT A;  3RB6 A;  4C8Z A;  2DNY A;  3D54 A;  4UQG A;  4Q2M A;  4F3Q A;  1RWN B;  3MM6 A;  1W26 A;  4W4M A;  5AT1 B;  1X0F A;  3V2U C;  3M2V B;  4AL5 A;  4H4K A;  5ADZ A;  4DR3 J;  3J81 Y;  2FY8 A;  4A8X A;  4M5K A;  1E6V B;  2K7K A;  1VQP S;  1FRX A;  3LW5 C;  3PEH A;  4PG8 A;  2CNN B;  2QLF B;  1ZPV A;  2DNO A;  3M2U A;  2QA4 S;  4DV7 F;  1KHW A;  3MPY A;  4X66 J;  4X2B A;  4ZHR A;  1HQU B;  3LPE A;  4RW6 A;  3OXG A;  1RWX B;  2FUG 9;  1X5T A;  3EGW B;  5IXU A;  1KLN A;  1UFL A;  4C8Y A;  3A8E A;  2VOO A;  2XZT B;  3UR0 A;  2JEF A;  3KK3 A;  3LAK A;  2CPE A;  3NEK A;  4E8U A;  3B82 A;  4IR1 A;  5H9F K;  5E3C A;  1RT7 A;  4YB5 A;  1OMS A;  4PPD A;  2LU1 A;  4K2J A;  3DN9 A;  2IA6 A;  4EYI B;  4QYR A;  5KOX A;  2N82 B;  1UEU A;  1VI7 A;  5L1L A;  3M2V A;  2GA7 A;  3KHL A;  3LAL A;  3QAT A;  1QAX A;  2VD3 A;  3H4B A;  1E6V A;  4H4O B;  3CCL S;  3GIR A;  4LF5 F;  2OAU A;  1Q8L A;  3IXQ A;  5LSR A;  1D8Y A;  5L38 A;  4KAI A;  3CC4 S;  5HMW A;  2KTQ A;  3GWC A;  5B0E A;  3ZZZ A;  4KHP F;  3R5C A;  3DLL Q;  2PMH A;  4EU0 A;  3VGS A;  2DK2 A;  1HQU A;  5FJ4 A;  2YX1 A;  1E6Y A;  1Z4U A;  1XR7 A;  2HRY A;  2F65 A;  1Y4Z B;  1S1W B;  3LWM A;  1G6B A;  3FCV A;  1KTQ A;  2J9C A;  1RCO B;  2DR5 A;  2DNH A;  2MQL A;  2CG4 A;  4CNZ A;  1HMV B;  3I4H X;  1G1X A;  1GFW B;  4EO8 A;  3ILJ A;  2L41 A;  1UEK A;  2AJ0 A;  3O44 A;  4TN2 A;  2PC6 A;  3PM9 A;  2FJW A;  2EG2 A;  4ZK7 M;  2GNK A;  3GP9 A;  1NK9 A;  2CQH A;  3VCD A;  2D69 A;  4UST A;  1F6T A;  2B6A B;  1DJ0 A;  5F0W A;  2EFN A;  3TWZ A;  4QU7 A;  5E3Q A;  4HI1 A;  4H4O A;  2DGX A;  4C9D A;  3BQ0 A;  4X4T A;  3BYP A;  5KFT A;  1FA0 A;  4B9S A;  1DAR A;  1HPZ B;  3V6J A;  1VQ9 S;  3CJT A;  4X64 F;  3G9C A;  2GCF A;  2EBE A;  5IWA J;  5D77 A;  4NWB A;  1S1W A;  1K73 T;  3C46 A;  3G86 A;  2Z57 B;  4NXM J;  3KG1 A;  3OD2 A;  4BLG A;  4K4X A;  3AOA A;  2X1B A;  3GCW P;  1JXV A;  3UD3 P;  3VZI A;  3FVY A;  2P9C A;  2HLU A;  1DUR A;  2CPZ A;  4ECR A;  1GT8 A;  3G4S S;  2HND B;  1FKA F;  5J2P B;  4PXE A;  2QEX S;  3G8S A;  4FVC A;  1WDD A;  4ZPD A;  4RUH A;  2B6A A;  4KB7 A;  2OJ3 A;  4UT4 A;  5DG8 A;  4AQY F;  1H38 A;  3CMA S;  4WBF A;  2MDA A;  4M5M A;  1XC9 A;  5E0O A;  2UUC F;  3ISN D;  1EQM A;  2XY7 A;  2LCW A;  4AYB D;  1R8B A;  5GAD U;  1HPZ A;  1MMD A;  3FFI B;  1B4S A;  1UVM A;  2H4W B;  5KT5 A;  3N6N A;  4MKY A;  4YME A;  3JSR A;  1NHK L;  3RR8 A;  1U09 A;  5EWE A;  5B0D A;  3C15 A;  1PJ5 A;  2F3J A;  4DR6 J;  3H4D A;  5DQG A;  2ROE A;  1NB2 A;  1B64 A;  2BX6 A;  2YBV A;  1REG X;  1Q1K A;  2UUB J;  2QLW A;  4DX5 A;  1WHX A;  3DYA B;  1HI1 A;  2KYZ A;  4RBU A;  4TYB A;  3IAM 9;  4WFN Q;  1PC4 A;  2J8S A;  2HND A;  1PG5 B;  3PIO Q;  1WF2 A;  5J2P A;  4J9M A;  3D7S B;  3CUN A;  3DOL B;  1X4D A;  1ZET A;  1ZM2 A;  3ADA C;  2GJI A;  5CH7 B;  2DNR A;  5HQL A;  3KHH A;  1NUE A;  3C6U A;  3PRB A;  3CCJ S;  1NB7 A;  4BC7 A;  4O4G B;  2YTC A;  1WG1 A;  3W9H A;  2BUN A;  4TYA A;  3VGT A;  1VQ7 S;  2JFD A;  3KUE A;  3PHE A;  2DO4 A;  4DN9 A;  2WVC A;  5ETM A;  2VBX A;  3FFI A;  4YS2 A;  3U27 A;  3A3O B;  4LFB F;  3KHG A;  4JUZ A;  4B3M F;  1Q79 A;  1PAE X;  5KFQ A;  5H9E J;  1F9F A;  4KGX B;  3NAH A;  5AE3 A;  1ZYQ A;  2O5D A;  3CDE A;  4JI6 J;  1IR2 A;  3DYA A;  4X4O A;  3RU0 A;  1T9W A;  6AT1 B;  5LMU J;  4TLQ A;  1TZ0 A;  9ATC B;  4U7U K;  4PWD B;  4TY9 A;  4MFB B;  3D67 A;  2HFZ A;  4Y2C A;  1FNX H;  3DOL A;  2M52 A;  3JS9 A;  2XC9 A;  2HGL A;  3SBM A;  2W4P A;  1WSV A;  3L7P A;  5M2U A;  4DUY F;  2HAI A;  3I0S B;  1RAO A;  3M8P B;  2F40 A;  1XNR F;  2ZH5 A;  2FLP A;  2UXC J;  2BJ9 A;  5F41 A;  1HQ2 A;  1HFE L;  4ZCL A;  4ZVS B;  3SI8 A;  4C98 A;  4OX8 A;  5A8R A;  2R2R A;  3OW2 R;  1XMB A;  2H5I B;  4P2F A;  3VVT A;  1S49 A;  1HA1 A;  2OH2 A;  3LAM A;  1Q7Y T;  3IBC B;  3U1M A;  2YXL A;  3SDE B;  1U25 A;  1C0T B;  2Z2Y B;  3UE2 A;  4NLY A;  5BXI A;  4TQR A;  3B78 A;  3IR7 B;  2E1A A;  2V9W A;  2BJD A;  2XS7 A;  3PG9 A;  2IAJ A;  4E98 A;  3M6W A;  1GX6 A;  4PWD A;  5FDL B;  3DU5 A;  4MFB A;  2PFD A;  4P75 A;  2OIH A;  2R3V A;  4CO5 A;  3QRR A;  1N56 A;  5DDP C;  2MB0 B;  1FJC A;  5HAN A;  3TA2 A;  2RHQ B;  4DHV A;  2DNN A;  3R8Y A;  1A9N B;  3R6G B;  5D8H B;  1X5P A;  2R8I A;  1FD8 A;  4FXW A;  2XHC A;  3IA0 A;  3PDN A;  3DLJ A;  1RWU A;  1NAQ A;  3I0S A;  1N36 F;  3D2W A;  2GX8 A;  2VH7 A;  3M8P A;  4YB6 A;  4AE5 A;  4ETZ A;  5E7O B;  3D66 A;  5IZH A;  2Q6C A;  1Y0H A;  2DHS A;  4IDK B;  3QO9 B;  4O3N A;  4O3S A;  2KRB A;  1ZAX A;  3QGI A;  4S0M A;  3BGO P;  4NZ6 A;  1Q8K A;  4USM A;  3JQK A;  2F4V J;  2YKO A;  4WYL A;  3HVT B;  3SCI E;  4ZP7 A;  1X9S A;  3M9N B;  3SDE A;  3LUY A;  4G65 A;  5HBM B;  1OWX A;  2CWK A;  3JSY A;  3BDP A;  4ZCK A;  5RUB A;  2ZNY A;  4WP8 A;  3Q8R B;  1S0N A;  4R5P B;  1A7G E;  2ROG A;  3R7B B;  4BWM A;  4KGK A;  2GQC A;  2NPI A;  2P9G A;  1Q82 T;  1EQ0 A;  1TU0 B;  4P7T A;  1KQF B;  2I0X A;  3E51 A;  4IH5 A;  2CXE A;  1TVR B;  4X4S A;  4LSZ B;  5KT6 A;  3CCS S;  2XS5 A;  1S79 A;  3HVW A;  4DR2 F;  2DEJ A;  2UVW A;  3OTE A;  4FPR A;  3L95 X;  5K14 B;  3QO9 A;  4YR2 A;  1UL3 A;  3SCL E;  3TUI C;  1V3S A;  2ZOF A;  3K59 A;  4Y00 A;  5DQI A;  3PNI A;  4OL8 A;  1VRU B;  2QYC A;  3BQ2 A;  1NK0 A;  3W61 A;  3HVT A;  3AQO A;  3UNG C;  3MAA B;  1O0P A;  4OYM A;  4RPF A;  2IY5 B;  1FXL A;  2HQD A;  1DTQ B;  3T9Z A;  3OHB A;  2BJE A;  2V8V A;  1JJ4 A;  5HBM A;  2KT5 A;  1RTI B;  2AF6 A;  3FEX B;  2CJ9 A;  1VQ8 S;  3SSR A;  3Q2S C;  3B8H A;  1UFW A;  1FRL A;  3K7R A;  4R5P A;  2J0X A;  1TFW A;  2CZ4 A;  3HMJ G;  1QSL A;  3QWU A;  3HM9 A;  3MR6 A;  6FD1 A;  4QIF A;  3KK2 B;  3LGN A;  1MG7 A;  3MM8 B;  4MT1 A;  2HRT A;  3VHQ A;  3A13 A;  1KEK A;  2AGP A;  1TVR A;  2V8H A;  2EPI A;  3EYZ A;  2W2N P;  3I0R B;  1NJI T;  3G6X A;  1IBK J;  2D74 B;  4ID5 B;  2C2M B;  2E66 A;  1X8D A;  5K14 A;  4DL0 C;  1EAR A;  2C3P A;  2J0S D;  1WC0 A;  2FDN A;  2DJW A;  5F8M A;  2YNI B;  1J5E J;  3ZZY A;  4F2S A;  1SVD A;  1U6Z A;  3TAM A;  3BO2 A;  4ZIT A;  3I96 A;  5CYM B;  1M5V C;  5HVG A;  1VCT A;  1P1T A;  2XYP B;  1VRU A;  3WX8 A;  4UZC A;  4DJB A;  2PEB A;  3FSY A;  3MAA A;  3KLE B;  1DTQ A;  2HFO A;  3EVW A;  4NPO A;  4ED3 A;  1VQK S;  1RTI A;  4XO0 A;  3KWM A;  5KOW A;  3CJ3 A;  2AJ4 A;  3GG0 A;  5KFK A;  3L3C A;  3EZ5 A;  3CCV S;  4GRS A;  5GMD A;  2RIL A;  3MUR P;  2H3E B;  4K4W A;  4K4S A;  2MZR A;  4LF9 J;  3MM8 A;  3O8W A;  3TA0 A;  3EM1 A;  2DPJ A;  3I5C A;  4JOU A;  3V6K A;  4KPC A;  4ZPV R;  2HG4 A;  3CJR A;  2EFP A;  1NME B;  3I0R A;  4ID5 A;  2FVQ A;  1QVG R;  1CJK B;  2CA9 A;  2NCK L;  5KTQ A;  1JLA B;  4OHW A;  2XCP A;  3HHL B;  1TUW A;  5KG0 A;  2HWI A;  5EUH A;  4UW2 A;  2EC0 A;  2YNI A;  3HKZ D;  2DNK A;  4O0I A;  3FMB A;  5CYM A;  5DDR C;  4MKA A;  1ROF A;  4X4U A;  3AJ1 A;  2C2O B;  1WEL A;  3WBZ A;  1ICE B;  3T5L A;  1YDL A;  1RWM B;  1UMJ A;  2MEW A;  3KLE A;  3IM8 A;  3LOU A;  2YNF B;  2FYX A;  9RUB A;  3CD6 S;  2NXC A;  4GVB A;  1K1S A;  2B56 A;  3PKY A;  2V2Q A;  4V19 X;  5IT4 A;  2UXD J;  3FK4 A;  4JI8 J;  3DLG B;  2BJ7 A;  2V8D A;  3W8G A;  4MIW A;  3T3F A;  3PO5 A;  3GON A;  1Q53 A;  2OKQ A;  3CCE S;  3UN2 A;  4KH1 B;  3EZU A;  1NK6 A;  3K5O A;  1K8A T;  1WKJ A;  5I42 B;  1BQX A;  3W60 A;  3TR5 A;  2GIF A;  3D6T B;  2GHP A;  1LFW A;  2CAD A;  1CJK A;  2KH9 A;  4B9U A;  5IV3 A;  1EB0 A;  1YX2 A;  3S7R A;  1JLA A;  4C8M A;  3HHL A;  2AX0 A;  1PJ7 A;  3H98 A;  4DSK A;  3CCZ A;  4ECS A;  2HIQ A;  1FDD A;  3RBD A;  1IR1 A;  3S8S A;  1IBL F;  4JI5 F;  2HQC A;  2YNF A;  5KG2 A;  3MI7 X;  1U02 A;  1RI7 A;  3K2Y A;  1FKP B;  5GAH I;  1PGZ A;  1X4G A;  4NML A;  2ZZT A;  4UOF A;  3DLG A;  5K8P A;  2XMK A;  1VBY A;  2IC3 B;  3ETO A;  4Y3C A;  3M6X A;  5JUM A;  1VQS A;  4DV7 J;  1NEE A;  4M5D B;  2KT2 A;  1XER A;  1FRI A;  1FTR A;  4NEY A;  3CWJ A;  5JJB A;  3NXZ A;  1YJ7 A;  4LRE A;  5I42 A;  4ZIV A;  2RS2 A;  3NOG A;  2ZH8 A;  4LBH A;  2CQD A;  1G7C B;  3UCU P;  1M90 T;  5DDO C;  4F3M A;  5GAE U;  3T9N A;  2HPU A;  4OZ1 A;  3TA1 A;  3BQ1 A;  2YH1 A;  3WX4 A;  2OI2 A;  2B8P A;  4B9L A;  1KON A;  2M5Y A;  1OJ4 A;  3GJQ B;  4ZS6 A;  1JLC B;  2XMA A;  4NLO A;  4C11 A;  3MCS A;  5I4M A;  1YLX A;  4JV0 A;  1FTC A;  5B08 A;  1NK7 A;  4PKD B;  1H7W A;  3K57 A;  2KG0 A;  3I5A A;  3JSM B;  3RJM B;  1FKP A;  5C7P A;  2APO A;  4LF5 J;  2G4B A;  2J6T A;  2FZC B;  1D09 B;  2W9A A;  2CPY A;  3QGG A;  4F0H A;  5LJ5 Y;  2IC3 A;  3LGH A;  1R8A A;  1X5O A;  2BM1 A;  3V4M A;  2BE9 B;  4M5D A;  1S72 S;  3VAL A;  3VTI A;  2CG8 A;  4C8L A;  3MM5 B;  4Y2K A;  5HVF A;  2ROP A;  1FFW B;  2W4D A;  4ECW A;  1LK5 A;  2CJK A;  4B08 A;  1Y5L B;  2L48 A;  3BB5 A;  3GMG A;  4USH A;  1GEH A;  3H25 A;  4I68 A;  1RT4 B;  3FEY B;  2DR9 A;  1NJZ A;  2XZW A;  2BQU A;  4KH0 B;  2HZV A;  3Q8Q B;  2Y3Y A;  2AIR B;  4WFZ A;  4NX9 A;  1ZPW X;  3JSM A;  2R8G A;  3W8P A;  3CUL A;  1RWP B;  3JB9 k;  4F2R A;  1MML A;  4KO0 B;  1YRX A;  2C2E A;  1RYS A;  1Y10 A;  2QMU B;  2MQQ A;  3RBX A;  4X65 F;  3CXC R;  1HKA A;  3TZX A;  3NS7 B;  4K5S A;  7FD1 A;  1NBE B;  3BGR B;  1FCA A;  1T03 B;  5KFN A;  3A8K A;  3M8Y A;  3DRP B;  3RB0 A;  2R7T A;  5HN0 A;  3SXL A;  4DOZ A;  3CJ0 A;  3MM5 A;  4YFU A;  3CJS A;  1N33 F;  3SYZ A;  1GTH A;  1WOP A;  2VV5 A;  1IKY B;  2E7V A;  2MZS A;  2KI2 A;  1DHM A;  4OYB A;  1RKJ A;  4USU A;  1H98 A;  1JK9 B;  2OUG A;  3ETM A;  3KDO A;  2HNZ B;  1RT4 A;  4WF9 Q;  1UA1 A;  2F63 A;  2WBM A;  3QJL A;  5D0R A;  2KJW A;  2CNK B;  3FBC A;  4XDD A;  1IQT A;  4ZJO A;  2QT7 A;  1RTJ B;  2C42 A;  1QTM A;  2V67 A;  2MQM A;  1KNZ A;  2M2B A;  4KO0 A;  4AQY J;  1TL3 B;  2DRD A;  1S4F A;  2PA8 D;  3N28 A;  5F8I A;  1U6F A;  3MFI A;  2RML A;  2R4F A;  3EXC X;  3EGN A;  5ETV A;  2UUC J;  3BGR A;  4EEY A;  1MWY A;  3HO1 A;  2RRA A;  5L1I A;  3DLK B;  3DRP A;  3AT1 B;  4FNH A;  1OIA A;  2JL9 A;  4OX7 A;  2KXH A;  1IKY A;  2ZC3 A;  4K0K F;  2XLK A;  3TUJ C;  1DY3 A;  3RW6 A;  4ILR A;  4Q45 A;  1FXD A;  3SV4 A;  2O66 A;  2HNZ A;  3I87 A;  5LOQ A;  4ZP8 A;  4A4J A;  1S9G B;  4JI0 J;  3EX7 B;  2AHO B;  2DHG A;  4DPT A;  4NRU A;  2H54 B;  3NLC A;  1BGX T;  2J9D E;  2MKY A;  2FGC A;  3SCK E;  1RTJ A;  4W92 B;  1TR0 A;  1S59 A;  5JVH Q;  4OI3 A;  3T1H J;  1TL3 A;  4DV6 F;  1VJW A;  4Y28 C;  3P5T L;  8ATC B;  3UVJ B;  3H90 A;  1MRO B;  4NCG B;  3I31 A;  5IS2 A;  2EW9 A;  4P71 A;  2CQ3 A;  2NS1 B;  3JAM U;  5HAO A;  2EWH A;  1AUD A;  2IJR A;  3DLK A;  3NWR A;  4MKV A;  4LFB J;  3IP0 A;  1BHN A;  2UVV A;  4FBU A;  5DG9 A;  2XCA A;  1QAI A;  3FSX A;  3CCR S;  1FKO B;  4HR2 A;  3BS9 A;  4TVA B;  1V3Z A;  2BQR A;  4LBP A;  1F2G A;  1NSK L;  3QSI A;  5D6G A;  4UY8 T;  3F41 A;  2WRM A;  4YEA A;  2VPX B;  1S9G A;  3UO0 A;  4GVL A;  3QMQ A;  1SUQ B;  3CDA A;  1IKV B;  3QAE A;  3Q23 A;  2IJF A;  3F56 A;  4ECV A;  3TYT A;  1D9D A;  2C3M A;  3PRV A;  4DUY J;  2DKO B;  3CC7 S;  4Q8E A;  1IQZ A;  3BH7 B;  2Q1L A;  2VOD A;  4RW8 B;  3UVJ A;  1MRO A;  1VGY A;  4F0M A;  4Z2X A;  4ECT A;  1ZH5 A;  1IM6 A;  1YJN S;  4U7C A;  1EET B;  3DGP B;  2X3G A;  2Q43 A;  3ZZR A;  4ZIW A;  5KFB A;  1AA1 B;  1AXQ A;  2F5G A;  4Q5V A;  1HNZ F;  1FKO A;  4OYP A;  3PX4 A;  1B99 A;  4USI A;  2VPY B;  4MK9 A;  2YNG B;  2QO3 A;  2XMV A;  2LA6 A;  1TL4 A;  4LF1 A;  3CIZ A;  4LF4 F;  1HBN B;  3QFH A;  4CLT A;  1DRZ A;  1Y00 A;  4WK1 A;  2IPO B;  4AL6 A;  1JXL A;  4OFZ A;  2HVE A;  3I4P A;  2DIU A;  1IKV A;  1DFD A;  5H9E K;  1KQS R;  3MMB A;  1JMT A;  3D3B J;  3KHR A;  2GZO A;  3QYY A;  2JC0 A;  4F67 A;  3GQC A;  4RW8 A;  4Y65 A;  2OEK A;  2NLW A;  3B54 A;  2R7Q A;  1N36 J;  3LQV A;  1F9H A;  1EET A;  3DGP A;  2IVY A;  2Y1R I;  1SB6 A;  1I51 B;  1W2B R;  4HVZ A;  2HBZ B;  2B8Q A;  1IR0 A;  5KFW A;  2ZWO A;  1PIL A;  2DH8 A;  3MOZ A;  1RYR A;  2HVZ A;  3CDB A;  5AE1 A;  3UDL A;  3HSZ A;  1JB0 C;  3D9B A;  3TVY A;  2D1C A;  4CTA B;  1X4B A;  1C1C B;  2YNG A;  3MCM A;  4G1P A;  3VAH A;  1PC5 A;  2R7X A;  4J5O A;  2BM0 A;  3O2I A;  3G87 A;  2CQ4 A;  2AYG A;  3QWP A;  2Z58 B;  5F8G A;  1M1H A;  2UV8 G;  2V34 A;  2HYI B;  2B7C B;  2P6S A;  4PZV A;  4ZP9 A;  3GTY X;  5FLX U;  1VBK A;  2ZBP A;  4ATN A;  1W2I A;  4DR2 J;  4RKU C;  2RRN A;  2M3D A;  2G13 A;  4K4V A;  3AJD A;  4RBT A;  1L3S A;  3VWS A;  3D3C J;  4ED4 A;  3L9Z A;  4X4P A;  3W9I A;  3LO3 A;  2BBE A;  1D8Z A;  4QIE A;  3V4I A;  3OSP A;  2DGO A;  1QDU B;  3DRX A;  4CTA A;  3W66 A;  4DV4 F;  2DNG A;  4ELU A;  5EWG A;  1JLQ A;  1D0E A;  4AT1 B;  2FHK A;  2J7U A;  1T9Y A;  4G1I A;  3Q0A A;  1NZA A;  3H5U A;  1J5O A;  3GIL A;  2Y1J A;  5BR8 F;  3W9J A;  1X9M A;  2L08 A;  4Y2A A;  3VVU A;  1EKS A;  5ETP A;  2ZIT A;  3R7N B;  1R6Y A;  2JOQ A;  1SXL A;  2ZOM A;  5DET A;  4ECX A;  4C0H A;  4N56 A;  1M1K T;  2NXN A;  4DU8 A;  3TAP A;  3QJP A;  4NLR A;  3IRW P;  1XNQ F;  1S1X B;  3MED B;  3US5 A;  1FE4 A;  4DX8 H;  2RHS B;  3MUM P;  3C8Y A;  1Q81 T;  1U1O A;  2FD2 A;  2V2Z A;  3K58 A;  4YP3 A;  2U1A A;  5HRO B;  2CPH A;  3OT9 A;  4JI2 J;  3FBB A;  5F9N A;  3DNC A;  2F7V A;  2BV3 A;  2OGU A;  1S6Q A;  2FJE B;  1NHU A;  2QMW A;  1HNX F;  2CUY A;  4HHH A;  2RDD A;  1B0V A;  2DT9 A;  1Y3K A;  4UUX A;  4QWA A;  2ILZ A;  3V6H A;  4E2F B;  2RF2 B;  4NYZ A;  2DBB A;  5AJ3 J;  3R7S B;  4NOH A;  4QZV B;  2B4U A;  2DD8 S;  2Z2Z A;  3G8Q A;  2R8K A;  4HDH A;  1YG0 A;  5KG4 A;  2B9W A;  4FS1 A;  1F9E B;  5KT7 A;  2GIR A;  1JQG A;  1S1X A;  1N88 A;  3MED A;  3QQC D;  2MKK A;  3KUG A;  5E3P A;  1CJU B;  1FK9 B;  4O23 A;  5IV4 A;  2KZM A;  1BLU A;  2R7V A;  2C3O A;  2GO8 A;  1HWI A;  2VU5 A;  1R3N A;  1RQ0 A;  2MLZ A;  3F73 A;  4EBD A;  1DLO B;  4PEO A;  1VQY A;  2J7K A;  1Z2Z A;  2GJ2 A;  4MJK A;  2OSQ A;  1SC4 B;  3THV A;  2UXB J;  4EZ6 A;  5J2Q B;  3G6V A;  2IHR 1;  5HLF B;  2ZKT A;  2L9D A;  3PW7 A;  4RBV A;  1RBA A;  4IH6 A;  3MUV P;  1DBD A;  4WYW A;  5KFO A;  1N48 A;  2RRB A;  4BS2 A;  2RF2 A;  3JAM Y;  4K7Q A;  2XZD B;  1HW9 A;  3DDI A;  3E2E A;  2GAH C;  1YRT A;  5LT5 A;  2DH7 A;  4NAS A;  5CZX A;  5KFI A;  2ALY B;  2ZNZ A;  3QBC A;  2RUG A;  1JX4 A;  1MN9 A;  1RWO B;  2HNY B;  5HJX A;  4L75 A;  1CUL B;  1K1Q A;  4UUW A;  3BSO A;  2LU2 A;  1CG2 A;  1Q78 A;  2CPF A;  4WXO A;  2O01 C;  5HAT A;  5CYQ B;  1HAR A;  4GO7 X;  4V19 J;  1S5Z A;  4M63 A;  2B9X A;  2HHU A;  1FK9 A;  4LT6 A;  3MMJ A;  4DLG A;  3OTO J;  4MKB A;  2RSQ A;  1RAJ A;  2IVM A;  1K0T A;  2VJV A;  4JI1 F;  1DLO A;  2KVQ E;  2VQE J;  1SJR A;  2DEI A;  2LQ5 A;  1IBL J;  3H8Y A;  3NMA A;  4JI5 J;  2MGZ B;  3BZQ A;  4NA2 A;  4OV1 A;  2A2C A;  5L9N A;  1F60 B;  1VHF A;  1LW0 B;  5J2Q A;  5HLF A;  2ZJR Q;  4QCL A;  2XMW A;  1H2T Z;  4A8S A;  3TJA A;  2ZOG A;  1WHV A;  2LA4 A;  4J9V A;  2B51 A;  3PIP Q;  4M94 A;  2POK A;  5C25 B;  1KS2 A;  2HS0 A;  2IYI A;  3FMW A;  1R8C A;  1HW8 A;  4HAC B;  4YDD B;  5KFS A;  3I5B A;  4RW7 A;  4ZVO B;  2QFJ A;  3HFZ B;  1RXO B;  4C7Q A;  2CZ9 A;  4X84 A;  2HNY A;  2GMH A;  1PKU A;  4ENO A;  4I67 A;  1U24 A;  3MPD A;  2Z2L A;  1RTD B;  4DCO B;  1CUL A;  3BR9 A;  3QZ7 A;  3IBW A;  4EZ9 A;  3OFE A;  2LYV A;  3LH2 S;  3G6E S;  5CYQ A;  3PX0 A;  4BWJ A;  4KT0 C;  2DNQ A;  4DPY A;  3M2R A;  4DZ6 A;  2NZC A;  4J9P A;  3IRX B;  3UFC X;  3G2X A;  5DS7 A;  5J1E B;  2HAF A;  1H3D A;  1T3N A;  1DTT B;  1FNO A;  2FC9 A;  1OSD A;  3QT5 A;  4IOB A;  4DPU A;  4P10 A;  1BXN A;  2BJ3 A;  3PCO B;  3U7J A;  4DR1 F;  1U26 A;  5J1N A;  2MGZ A;  3QGH A;  2WON B;  1GQE A;  3NL0 A;  4UZB A;  3MEE B;  1F3F A;  4UTG A;  1KN6 A;  1ZAW A;  5A2Q U;  4LF6 F;  1HHQ A;  3W65 A;  3O3L A;  5T7L B;  3ZTQ A;  1SC3 B;  2XNR A;  3FC9 A;  3P5B P;  2I2Y A;  4HAC A;  1XQI A;  1WDT A;  1WUU A;  4ED0 A;  1WI8 A;  1UFK A;  4I6A A;  3GII A;  5HP1 B;  1ZOT A;  4N7T A;  2VB6 A;  5LSO A;  4QPX A;  1RTD A;  4L3N A;  2AEM A;  4ECQ A;  1B3T A;  4LRC A;  4JI6 F;  4B9M A;  4OHX A;  3ZXW A;  5F8H A;  1BUX A;  3IRX A;  3MXH P;  1T9T A;  5J1E A;  2IRY A;  3MDF A;  1DTT A;  2MKI A;  3R6L B;  2MHN A;  2HWT A;  3D28 A;  1V6H A;  2J8A A;  3CJ5 A;  4KHM A;  2BQ3 A;  1HWL A;  2AYM A;  2YWW A;  1B0P A;  1JLB B;  1DAX A;  2ZM6 F;  4MAK A;  4ELT A;  4WU3 A;  1XMO F;  4C8N A;  3Q22 A;  3QJJ A;  2WON A;  5D0G A;  4ZPT R;  2E44 A;  1TKZ B;  1SJQ A;  2JSX A;  3NG8 A;  5FLX Y;  2YKP A;  1DZ5 A;  3T19 A;  3GYX B;  4X65 J;  3OLB A;  4FF2 A;  5T7L A;  4ER8 A;  3DMJ B;  1S57 A;  4OYZ A;  2XHW A;  2UU9 F;  3LGM A;  4F25 A;  3HHD A;  1YGY A;  3WIV A;  3PO4 A;  1UPP A;  2HVH A;  4GKJ F;  4KSE B;  1RT3 A;  5DLF A;  5M2R A;  1KQG B;  5HP1 A;  3ENV A;  1RLC L;  4NLX A;  5C42 B;  1N33 J;  1FEE A;  2ERR A;  2E9Z A;  3R2C J;  2G1D A;  2AYB A;  2G0C A;  3H59 A;  2GIQ A;  2FJX A;  2D3O 1;  4USK A;  2Q66 A;  1TK5 A;  2Y1L B;  2ADB A;  2HFN A;  4ELV A;  2DHH A;  3K5P A;  1TFY A;  5A6W A;  2OD4 A;  3MMA B;  1YBT A;  2N3O A;  1WOR A;  2BAN B;  3BBF A;  3TX0 A;  1BQN A;  3GIK A;  1TKZ A;  4RU2 A;  5DM6 Q;  3G6Y A;  4KV8 B;  3E3X A;  4J90 A;  1JKH B;  4DV3 F;  1JLF B;  2LXU A;  3DMJ A;  4O4R A;  4QR1 A;  4NRT A;  1CC7 A;  2MY7 A;  4CLF A;  2HS3 A;  4I7F B;  3MOJ B;  1RTZ A;  3GJS B;  3BN4 A;  2BYC A;  4F7V A;  4C0O C;  1LOU A;  2CJY B;  4Q8F A;  5C42 A;  4CIO A;  2UUA F;  2DTJ A;  1S77 D;  3DXS X;  1FWP A;  4F26 A;  4I4B A;  4K0K J;  4I2P B;  3KLF B;  2VBW A;  1FFG B;  3NP5 A;  4JB8 B;  3NNA A;  3OV7 A;  4YR3 A;  1U48 A;  4I6W A;  1HI8 A;  4DS5 A;  4DPW A;  5DZ7 A;  3MMA A;  2PD1 A;  2BAN A;  2B7B B;  2LDY A;  1HBO B;  4B3R F;  3BYR A;  2QLX A;  4EFA C;  4KV8 A;  2JC1 A;  4FZV A;  3WC2 A;  1JKH A;  1WHW A;  2C3Y A;  1HL6 A;  2BRL A;  4RX6 A;  4CLK A;  1JLF A;  1S4E A;  2YPY A;  4J9K A;  2K2P A;  3VAG A;  4DL3 A;  4HTI A;  3GIJ A;  2OTL S;  4DQI A;  4I7F A;  1K47 A;  4Q0B B;  2AQ4 A;  2KDO A;  4A8O A;  3DRS B;  2OPR B;  2K06 A;  4ILL A;  4HYK A;  4ZN3 A;  3QNW B;  3H5Y A;  4R8U B;  3WDO A;  4I2P A;  3G82 B;  1SH0 A;  3KLG A;  3KXD A;  3KLF A;  4DFP A;  1R27 B;  1UWB B;  2ZVS A;  4EWT A;  4A8M P;  3OUY B;  3NGT A;  2V8P A;  4DDF A;  2RQK A;  3JTN A;  4DMZ A;  1ULR A;  3GYG A;  3R5A A;  4LF7 J;  2FIU A;  3C6T B;  1HBO A;  3VGV A;  5KFU A;  2XY6 A;  4ZVH A;  1DQ8 A;  3PTW A;  2ZD1 B;  4OIX A;  5E33 A;  2UUT A;  4WU2 A;  2RB7 A;  1PIE A;  4OV6 A;  4DR7 F;  4Q0B A;  2N4D A;  2MZQ A;  2G2Y A;  2HQ3 A;  2F8H A;  4QW8 A;  2HFV A;  2OPR A;  2W9B B;  2ZKU A;  3GE9 A;  3OXF A;  1HIY A;  4F36 A;  3Q8U A;  1HNZ J;  2JDJ A;  3JTO A;  2DGW A;  2DB1 A;  2X7I A;  3G82 A;  4MK7 A;  4OHY A;  2GC8 A;  3TP2 A;  4MYT A;  2MKC A;  1UWB A;  4CI0 B;  2YKN B;  1PO6 A;  3UPF A;  2N3L A;  4DV2 J;  3OUY A;  1KR4 A;  2RT3 A;  4TKT A;  1RAH B;  2DNP A;  2OEM A;  5DDQ C;  4Y6I A;  3EWG A;  5IQ6 A;  3R9L A;  7AT1 B;  4DEZ A;  2YWK A;  3VQT A;  1QE1 B;  2OMO A;  4C3L A;  1TL5 A;  2EK1 A;  5KG5 A;  1D9F A;  2MZT A;  1YIT S;  1IM4 A;  4A8Y A;  1WKL A;  5HL7 Q;  3ENQ A;  3M9M B;  5A8K B;  2ZD1 A;  4ITS A;  4C3M A;  1U49 A;  1U0S A;  2VOP A;  2L9W A;  2ZFH A;  1CEZ A;  5I3U B;  4ZP6 A;  1S1T B;  2WZ1 A;  1QY7 A;  3IGN A;  2NYH A;  4FYX B;  2IM2 A;  1SKU B;  4DUZ F;  3M32 B;  3VQS A;  3CJ4 A;  4UQT A;  2W9B A;  1UVK A;  2WK4 A;  2LDI A;  5FII A;  2D9O A;  2PT0 A;  4J37 A;  3W1Y C;  3C3L A;  1TEL A;  3AQP A;  1V9O A;  5A2Q Y;  1AW0 A;  1N52 B;  1UET A;  2VF3 A;  2YKN A;  4DUT A;  4URS A;  3IAS 9;  3R3T A;  3O5T B;  3OBI A;  2MY8 A;  4EMD A;  3TX8 A;  3DRY A;  3KJF B;  2IBK A;  3OFH A;  3FBF A;  1QE1 A;  1RAI B;  1TMM A;  3W64 A;  2JHE A;  1VQ5 S;  2AKW B;  3MPU B;  2VG5 B;  2I8E A;  3S1T A;  2Z4P A;  5EN1 A;  5A8K A;  1Y5N B;  4U96 A;  3RRH A;  2ZUA A;  1F0X A;  1FNM A;  1I1G A;  2VPZ B;  5L39 A;  5I3U A;  5F8L A;  4O3O A;  4J9O A;  3M32 A;  3FDS A;  3K89 A;  4QR2 A;  3N79 A;  3ZFV A;  1RTH B;  2CPI A;  1SIZ A;  3JSB A;  3H20 A;  4FKX A;  1IKX B;  4TU7 A;  3M8Q A;  4M8L A;  4LF8 F;  4DCP B;  2KFY A;  2GHW A;  4J91 A;  3TJ8 A;  4DV4 J;  1WC6 A;  1UVJ A;  1VC5 A;  3TAR A;  3BBC A;  3IWL A;  2VL1 A;  1YBA A;  2JNJ A;  1P1L A;  3MZI A;  2FLL A;  3D68 A;  5BR8 J;  4J7C A;  2VPW B;  4F50 A;  3BJY A;  3LTO A;  4LSL B;  2F4F A;  5GAG U;  3LP2 A;  1KOO A;  5D3G B;  4NI2 A;  3T5H A;  2HVD A;  1HR0 F;  3GJT B;  3M05 A;  4X4Q A;  5F8N A;  1XNQ J;  3RZA A;  2VG5 A;  4B3T F;  5ETR A;  3BV8 A;  4OI0 A;  5KFM A;  2NUU G;  3GU0 A;  4YB1 P;  4WKY A;  1YJR A;  5J2M B;  1X5S A;  1LXN A;  4KBI A;  5CA5 A;  2Y0S D;  2BE2 B;  4G3I A;  2EKN A;  3SQO P;  1FVS A;  4IOC Q;  2W1B A;  4A8W A;  2VHG A;  1NH7 A;  4DN0 A;  4P73 A;  4OHZ A;  2QA1 A;  3R1H A;  1F5A A;  4YDX A;  2MLY A;  4FDF A;  1T11 A;  1HNX J;  2IMW P;  3DFE A;  5HK4 A;  1O8B A;  2DVI A;  1XR5 A;  1RUS A;  2YKA A;  3M8S A;  1S6P B;  1Q86 T;  2HFU A;  4NCA A;  4CO0 A;  4IO9 Q;  1KKH A;  3CD0 A;  1APS A;  4ZPA A;  3GB0 A;  3ZO7 A;  1HWK A;  2ZC4 A;  1VRT B;  2VFU A;  4Q43 A;  1NKC A;  4WFA Q;  1SL2 A;  4B9N A;  2V8G A;  4LSL A;  2NXE A;  3J7Z 5;  1X4E A;  5D3G A; 
#chains in the Genus database with same CATH homology
 1RHU B;  3P45 B;  2C1E B;  2CNN B;  2QLF B;  3IBC B;  3R5J B;  4ZVT B;  3EDQ B;  1RWO B;  2C2K B;  4JB8 B;  4DCO B;  3R7N B;  2CNL B;  3KJF B;  3GJT B;  5K20 B;  1F9E B;  1IBC B;  1RHJ B;  2Y1L B;  2HBY B;  1PYO B;  1SC1 B;  3P4U B;  2H65 B;  3D6H B;  3D6M B;  2H48 B;  2QL7 B;  3R6L B;  3R7B B;  1RWX B;  2H5J B;  1RHR B;  4ZVU B;  1NME B;  3KJN B;  3GJR B;  1RWK B;  2DKO B;  2H54 B;  2CNK B;  2XYG B;  1GFW B;  2H4Y B;  2XZT B;  3GJQ B;  5IC6 B;  2C2M B;  4LSZ B;  3R6G B;  1RWW B;  3D6F B;  2CDR B;  4ZVP B;  1I3O B;  1BMQ B;  5IC4 B;  2QLB B;  1PAU B;  1RWP B;  2Y0B B;  1SC4 B;  2FQQ B;  3IBF B;  1I51 B;  4DCP B;  4ZVR B;  3RJM B;  2CJX B;  1RHM B;  1RHQ B;  2HBZ B;  3GJS B;  2C2O B;  1ICE B;  1RHK B;  1RWV B;  4DCJ B;  2C2Z B;  1RWN B;  1SC3 B;  2XYP B;  2QL5 B;  1RWM B;  2H51 B;  1RE1 B;  3NS7 B;  2CJY B;  2QLJ B;  3EDR B;  4ZVS B;  2XYH B;  1QDU B;  3QNW B;  1QTN B;  2XZD B;  2HBQ B;  2P2C B;  2CNO B;  3KJQ B;  4ZVO B;  4ZVQ B;  3R7S B;  2H5I B;  3SIP B;  2H4W B;  2QL9 B;  2HBR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...