3GJTB

Caspase-3 binds diverse p4 residues in peptides
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3 subunit p17
publication title Caspase-3 binds diverse P4 residues in peptides as revealed by crystallography and structural modeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 19
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2009-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3gjtB00
2QLFB 2H65B 2FQQB 2DKOB 1RHMB 2QL7B 2HBRB 2XYGB 2QLBB 2XYHB 4DCOB 2XZDB 2C1EB 1RHUB 2CDRB 1RWVB 3IBFB 1RWPB 4DCJB 3QNWB 2H4WB 2H51B 2HBQB 3KJQB 3P45B 1RHQB 5IC4B 1SC3B 3RJMB 1RE1B 1RWNB 3GJSB 3D6FB 1QDUB 1BMQB 2QL5B 4ZVPB 3R6LB 4ZVOB 2QL9B 1RHRB 2CJYB 3D6HB 3P4UB 1RWKB 2HBZB 3D6MB 3SIPB 2C2OB 1PYOB 1QTNB 4JB8B 1I51B 4ZVQB 2HBYB 3KJFB 3R7NB 3EDQB 2CNOB 2H54B 4ZVTB 2CJXB 5K20B 2QLJB 1RHJB 2XYPB 2H5JB 4ZVRB 1PAUB 1NMEB 3R5JB 1GFWB 2CNLB 1F9EB 1ICEB 3IBCB 2Y0BB 1RWXB 3NS7B 2H5IB 2CNKB 2P2CB 3EDRB 2Y1LB 3GJRB 1IBCB 2XZTB 4DCPB 2C2KB 4ZVSB 3KJNB 1RHKB 2H4YB 1SC1B 2C2MB 3R7SB 1RWOB 3R7BB 1SC4B 2CNNB 5IC6B 2H48B 4LSZB 1RWWB 3R6GB 3GJQB 1RWMB 1I3OB 3GJTB 4ZVUB 2C2ZB
chains in the Genus database with same CATH superfamily
1D9DA 3Q23A 1TAUA 4OX9J 5IT9Y 3B4MA 1RHUB 2DYAA 2CDRB 4NYZA 3DRSA 3G87A 2CJBA 2HFNA 2PC6A 1T05B 1RAOA 5KT6A 2UVUA 2HHWA 5KFGA 1KQSR 5G0RB 2YTCA 3ISND 3CSKA 1RK8A 3CCES 4U95A 1YRUA 5AXKA 4ZCIA 3CGIA 1PJ7A 1Y3JA 2PMHA 3CJKA 4ZP7A 1RTHB 4B3SF 4QBUA 4UUXA 2GHVC 4Y0FA 3OLBA 4QZVB 2RS2A 4CLSA 4BLGA 4RR5A 1KS2A 2B4VA 1K44A 3F41A 2R2UA 2WONB 1LFWA 4M5JA 2JC1A 1TVRB 1FX2A 5KFKA 2ZH1A 3G8SA 3NGKA 3PYFA 2GW8A 2V9WA 1NK9A 4I64A 3H90A 5F9NA 4NL5A 1UW4A 1LK5A 4WWSA 2CUYA 3CJ2A 3FBFA 3IMQJ 5KG6A 5EWFA 4WP9A 1DRZA 4DR7F 3GTYX 2GS8A 3FEXB 5AJ3F 4CLLA 4ZP9A 1RAAB 1VQNS 1JKHA 3BGRA 2XZWA 3WC0A 1NSPA 3L3CA 2FHJA 2DEJA 9RUBA 3RRHA 4C7QA 4R8UA 4GO5X 4AUKA 4D3HA 4JI3J 5FIIA 1TL7A 1EQ0A 2GCFA 3O2IA 1MW7A 4A4JA 2W8KA 2GQCA 4NLOA 4ED4A 1WC4A 1FDBA 1F5CA 2YKQA 2CIMA 4F4YA 2HRUA 4B9NA 4GKKF 2IVMA 1V3ZA 2W4PA 2Y1LB 4EZ6A 4CO4A 2HZVA 3MAAB 4TN2A 2QSWA 1EARA 1RTDA 1CJVB 5ETSA 2F8EX 3B54A 2E7WA 3A8JA 2J6UA 1I5OB 2BKNA 1XMOF 3K7RA 1QVFR 4QU7A 1GEHA 2GO9A 2DKOB 3CTRA 2ZWOA 2N3OA 1AZSB 3F73A 3DLKA 3QYYA 5E41A 2V8PA 3SCKE 1YWXA 4ANDA 1HMVB 4JI1F 2GAHC 5DDRC 3Q8YA 2VA2A 1FKAF 4USKA 2WCXA 4K4SA 1FERA 2GMJA 2HAFA 1OPIA 2XMVA 3T1YJ 3TX8A 2UXDJ 3HFZB 1PSDA 4B9VA 3CCVS 1FE4A 3EZUA 4ZPCA 3CT9A 2WZ1A 2AV5A 2AIRB 2XHWA 3TZZA 1EX8A 1UL3A 1LNQA 2BQUA 4PXDA 1X4GA 2DXDA 2MKJA 3O3LA 3H98A 2BW7A 2JC0A 1X9MA 2DPJA 4O23A 3HCXA 2VDIA 4X62J 4OYWA 4IG0B 3H5UA 2VQFJ 4U67Q 3IRXA 4YB7A 2L41A 1BQMA 1FI4A 3LPYA 1NSKL 4IFYB 3DCAA 5A6PA 2RHSB 3WBZA 2JLFA 2V2VA 3D0IE 3DOLA 2RUSA 2ZD1A 3MCOA 5F8LA 1IKYB 4DF4A 4L76A 2O67A 4X66F 4F2SA 2AJ0A 1NXIA 3BBCA 3CWJA 2V9KA 1I94J 1SL0A 4FBUA 2CVEA 2F40A 2G2YA 3VAFA 4F4XA 4YY3F 2RD5C 2K7KA 4RW9A 3ZTQA 2QL5B 1FFSB 1S79A 3RB3A 5KFFA 4UOGA 2B9EA 1U0HB 1JXVA 3GV5B 4JI7F 2LQ9A 4CT9A 1HQEB 3BN4A 5K8OA 3DLGB 3MCSA 2Y1IA 2EFOA 1U26A 4USIA 3QRQA 1HFEL 1LW2A 2ZFHA 3MPUB 4MKAA 4HLBA 4HT7A 1N4LA 5HROA 2HVZA 3G71S 4TYAA 5GMEA 5KFBA 5L1KA 4M5DA 3EXYA 1QTMA 1RSCA 1CULB 4C8YA 4M63A 4O3OA 4HH1A 3QFWA 3BKFA 2IBKA 1D0EA 1IKWA 2XSJA 2DNOA 4WP8A 4U9RA 5LSOA 5KFRA 2WOMB 2PO4A 4Y65A 3OD2A 2HHHJ 2W2PP 3BZQA 2BKPA 3KLVA 4EYIB 4C8KA 4E2FB 2JFKA 1A0OB 2OPQB 1OY8A 2KO1A 2NYIA 2OPPA 4ECQA 1DBDA 4FVMA 5LXRA 2FC9A 4NZ0A 4LF2A 3ZZ0A 2E1MC 3KG1A 2MMYA 3L7PA 4CQ1A 3TX0A 1RZMA 1K1SA 4NLWA 4DSEA 2HLTA 2OSQA 1S1UB 1R0AB 2RHQB 4EGLA 3WDOA 2EPIA 3K5MA 4LBIA 3KXDA 3VZIA 3O8WA 2KT5A 2C42A 5D4PA 5J2MB 5H9EJ 3UCUP 1D9AA 1Y00A 1M1GA 4EO8A 2DNYA 1SPBP 2CNNB 2DO4A 3PW4A 3OUYB 4DR5J 1U1KA 4HH0A 4QIWD 1XNQF 1T05A 2GIFA 4ZMMA 2ZE2B 5G0RA 5DGBA 2R3VA 3R5DA 1N54B 1U48A 2QYGA 3RBDA 1FJGF 3NNAA 5K5MA 1IKVB 5IC4B 4FP9A 4DV7F 1RTHA 2AJ4A 2YNHB 1ZAWA 4DSJA 2V8HA 1SVDA 1C0UB 4ELVA 3W5ZA 2J76E 4LRBA 4GC7A 1PCAA 1QAJA 2HK2A 5C24B 2CJKA 3LQVA 4J9LA 1K0TA 4C98A 1NNDA 1TVRA 4DV1F 3N6MA 1AROP 5JMNA 4RPFA 3X3UA 3PKYA 2QTWA 3TR5A 3EDRB 2EW9A 1S6PB 4FYXB 2KL8A 5HBMB 1EJ7L 3O1LA 2MLYA 1ZM4A 5C42B 5IC6B 1K0VA 2R42A 4Z2XA 1UPMB 2VPZB 3HSZA 2WW4A 2VD3A 3SSSA 1WI6A 1KQGB 1VK3A 5KFDA 3GIMA 4DV5F 4WFXA 4QWEA 4FPIA 1Q7YT 1WHWA 3SV4A 1M1HA 3HMJG 3PX6A 2Y9HA 3NCPA 2LKZA 3IM8A 2E5LF 2LU1A 4EO6A 2VIHA 2ADBA 3NL0A 3FGVA 3D6MB 3BKUA 4X64J 2XB2D 4MK8A 4EYHB 1S7IA 2A10A 1UVIA 2MJNA 3H8YA 4C3LA 4UQGA 1RT5B 3PEJA 1R0BG 3TAPA 1SJRA 2GJFA 1CJVA 2DD8S 5F3ZA 4ZIWA 1UAWA 1REVB 2LQ8A 2FLNA 1R8CA 3OTOJ 3FC9A 1WEXA 4QWCA 2BQ3A 3CCMS 3MEEB 1VQ9S 4B3MF 3RR8A 1FKOA 3U02A 2GGPB 3BS9A 1AZSA 1FTCA 4B3RF 5MLCV 3BF4A 1HMVA 3CVKA 2F1FA 2E1PA 2HNZA 3AA9A 4DCOB 3PFEA 3CCLS 3I31A 4B3TF 1FD8A 5DETA 3PJ9A 2YKPA 2L08A 2QZ8A 1HW9A 2EFGA 5DDOC 3R5GA 4ELTA 3QO9B 3GFHA 2HIYA 3OHBA 1Q8KA 3BQ1A 1IVZA 2XO7A 1WG4A 3KDOA 3ISNC 2CPJA 2MQMA 3DRPB 4KHPJ 4PWUA 1VRUB 1APSA 1QAIA 2ZITA 2IVYA 1HNZJ 1ZYQA 1XR6A 2LXIA 2VUGA 4DV4F 1FWKA 1NMEB 4UY8T 3HM9A 4WP3A 3M8QB 4UZCA 4OZ1A 2IA6A 2Z2YB 3HLUA 4X65F 2DGQA 1QUPA 3EVOA 2PEBA 1ZA1B 1FF2A 3U1MA 1VQPS 1HWIA 2Q43A 5KFTA 3BH7B 3RB4A 1IKYA 3M2VB 1JLCB 2GHPA 1RWUA 2MKKA 2EI5A 2EK1A 4OYZA 4P75A 1HR0F 1U1QA 3A1YG 3BGLA 3J7YU 2Z0GA 2C22A 3C8YA 4DF8A 2HK3A 4KYZA 3MM9A 1U45A 1KR4A 4WF9Q 1U0HA 2AEJA 1RAFB 1A7GE 4X4UA 5L38A 4EFAC 1LWXA 2W8LA 3DGVA 1S1WB 4PABA 3UDVA 5IZHA 3DLGA 5KFAA 1FXRA 3R1HA 1CC7A 4QJVA 1QM9A 1X5TA 4G65A 2I0XA 2K1RB 2ZH7A 1Q5YA 3S8SA 5KFJA 1JLQB 2M2BA 2CJAA 4DFMA 2Z58B 3H5SA 3CDAA 2ZM6F 4L72B 1UVMA 1AA1B 2E29A 2VOPA 4CO1A 4DR4F 3N79A 3DI6B 4KQZA 1CULA 2YX7A 2PDAA 4J9QA 2NXCA 3IXQA 2GJIA 2D3OR 2IHR1 4NE9C 4C0BA 2YXLA 3GWCA 2DR8A 4LQ3A 3MGJA 3GJTB 2K3KA 1PC5A 1V3RA 2GV1A 3OJUA 1LEOA 1N5YB 2H65B 2E5GA 2WOMA 2WAQD 3I4PA 3RUBL 2V4QA 4LBPA 4KY3A 3QNWB 4J9PA 3CMES 1Q5VA 5EDWA 3P45B 2OPQA 2CQCA 1HBMB 4PR6A 1DFDA 1V3SA 2G2OA 5C7PA 2H1YA 3R6LB 4ECSA 2FLPA 4EWTA 3RTVA 5IV4A 3OR2B 3S01A 3OW2R 1R0AA 3FSYA 5EHHA 2RE1A 3TANA 3LP1B 4QIFA 1CQNA 2CG8A 2VOOA 1KONA 2C28A 3RAXA 3ONQA 4HHJA 2CQPA 2EFVA 4PUOB 3ENWA 5LMNJ 1Z1ZA 3PR5B 3ILOA 3A3PB 3UVJB 4LFAF 1EQMA 2AJFE 3PG9A 2W2MP 3CUNA 3T3FA 3A3OB 2C3OA 4MK9A 1HWLA 4K59A 4NLQA 3OFGA 5E3RA 2R9LA 4KFBA 2F65A 2KRRA 2RU3A 2OPRB 4LF8J 4V1Ak 2Y8WA 2YNHA 4F02A 4KV8B 4KPYA 4LFBJ 3CDEA 3P6YC 4C8OA 5KT2A 5I42B 2ZHBA 5C24A 3ZZYA 2G1HA 3J81j 2ZH6A 1IJFB 2KM8C 1YRXA 1X8DA 3VF0B 3MMBB 4PXEA 1S7HA 1QTNB 5JUMA 4LSLB 2IMWP 4ECXA 3U7JA 5FLXU 8RUCA 1C4AA 4C3MA 2HGMA 1TFWA 1GXUA 3FBBA 1S6PA 3BO2A 5HBMA 4A8MP 1I6JA 2CXEA 1GMWD 5E3CA 4EUVA 4IOAQ 5C42A 2MZTA 5EWEA 4MTPA 3BSNA 3MM8B 4ZOSA 4J9VA 4LR7A 2E9RX 2YWWA 3TVYA 3BYRA 4LRDA 4Z37A 1VQ7S 5CA5A 1KVJA 5ADZA 3Q86A 4QPXA 5HATA 5HJYA 2MZ1A 1T8EA 3CEDA 4M8LA 3HVTB 3V6DB 4WK3A 2HFZA 1OQ3A 1IUJA 2A6OA 2VHGA 2RT3A 3PACA 2VU5A 4NZ7A 2RU9A 4QW9A 4E98A 2CPYA 3DXSX 2JX2A 4Q8EA 3IA0A 4WFZA 1RT5A 4ZPTR 2VASA 1Q8LA 2CPXA 1REVA 2E5JA 1TFYA 3QGIA 2M5YA 3FEZA 4RW6B 4XDCA 1P1LA 2RB7A 2XGQA 2ASDA 1MLAA 2CQ2A 1U7LA 1KDNA 2F7VA 4ZA1A 4Q2LA 1FKPB 3DNCA 3FDSA 1SC1B 3PJWA 3PX0A 3WQPA 4JI6F 1L3UA 3ZXWA 4B3SJ 1UVJA 4NRUA 1SC6A 2CWXA 4O44B 2KZMA 3C15A 3QO9A 2F3JA 3ZTSA 4EBEA 1FNXH 1R8AA 2IPOB 3PIPQ 7AT1B 2ACYA 2MKIA 2YVSA 3DRYA 1Q0NA 1SC3B 5JVGQ 5D3GA 1TL1B 4ED1A 2DR9A 4KHRA 1U09A 1HNXJ 4DV3J 1JIHA 3DRPA 1VRUA 3UW1A 3QRRA 3HHEA 4F3OA 3MZIA 1X7VA 5HQMA 3D54A 3ZZZA 4XAKA 3VAIA 3V4IB 1QAXA 1FEHA 3M8QA 1H74A 5HLFB 3W65A 3LTOA 1WC6A 2R7RA 1FXLA 5IM0B 2D1CA 4DR7J 1S57A 3TAMB 3G8QA 2YWKA 4UZBA 3M2VA 1JLCA 2P2CB 4YHHJ 1WF2A 2MHEA 4TLRA 3CCUS 2XM3A 2V4RA 4K7QA 1SIZA 3KDNA 1LWEB 2NXUA 4DPTA 3E01B 1VBZA 3EPIA 1S0VA 1RACB 3TVZA 2LVWA 2H48B 2KG1A 4L3KA 4KGXB 3Q8RB 2RSQA 3V6HA 1SB6A 3MEGA 1UTAA 2P9CA 3M6VA 4P73A 3MEDB 3HFVA 4ZVEA 3FUYA 2DK2A 1S1WA 2EVZA 3AAWB 4R0JA 2OSRA 4GKKJ 5GADU 1P9QC 2K1RA 1HI8A 2GMHA 2R7WA 4RL1A 4ZCLA 1JLQA 4PG5A 4ZCKA 1JQGA 4RW7A 4WJBA 4DL6A 1M5VC 2E66A 4OHYA 4FF2A 1F9HA 3R7NB 1SKSA 1BQNA 1S59A 3K2YA 3QZ7A 3FFIB 2I38A 4GVLA 2PN6A 4WU2A 5HQ8A 4DUZF 1TUGB 3NS7B 4OX8A 4AYBD 2JRSA 4KPCA 5DGAA 2FGOA 2UUCJ 3JTPA 1C1CB 4ED5A 3NOGA 4DX5A 3GJQB 4B17A 5B0GA 4P2XA 2AD9A 1HBMA 1GTHA 3UO0A 2Q1LA 2QIFA 3FZ2A 2PFDA 4IG3B 5HO4A 3PO4A 3HZGA 2BV3A 3OR2A 4YB5A 4DR6F 3THPA 2FB0A 3MECB 4NPOA 2XS2A 4IUFA 3LP1A 1PO6A 2J8SA 3MMAA 3HSDA 3K8WA 2DNRA 1RWKB 1AYEA 3C6UB 3M8WA 1S1VA 4Y6IA 4PUOA 2Z2LA 4DX7A 3HFKA 3OXLA 3UI3A 2PE8A 1VOMA 3V5RA 4PQAA 3UVJA 2E1CA 5CYQB 4ZPWR 4ED0A 3VHQA 1RT7B 4LF9J 2LA6A 4ANCA 4YY3J 2GIRA 1RISA 3OTDA 1X9SA 2QRRA 4H4MA 3MMCA 4K2JA 2C2MB 4X4PA 2DTJA 1SKUB 4KGKA 3BO4A 1X4BA 1PAEX 1YZ6A 2CPDA 4KV8A 3ZTRA 1VRTB 1IWAA 4A47A 2L48A 4FDFA 3M32B 2I9SA 3R8YA 1M90T 5I42A 4Y3CA 3H0PA 4KT0C 3G9CA 3QRPA 2J9DE 3KUHA 2YWGA 1CG2A 1PGZA 3GCWP 1NO8A 1M5PC 1N34F 1LWCA 3MMBA 2MGZA 1JJ2R 4EZ9A 3DU5A 3TOQA 4LSLA 5GAGU 3CJ0A 1RT1B 2YX4A 4TU9A 4ES1A 3KK2A 4LUBA 4RLEA 3EUNA 2D7SA 3N4WA 3DLLQ 3NS5A 4KBIA 4DPYA 2XSFA 3MM8A 4TLQA 1AXQA 4F04B 1WC0A 3AJDA 3J81Y 1FFGB 1F9EB 2J0SD 2V2ZA 5ETRA 1TUVA 8ATCB 3PO5A 2NSBA 5HN0A 2DITA 4ZITA 1NJYA 4A8FA 1RDRA 2MKHA 3HVTA 3V6DA 1HW8A 3RRGA 2QO3A 2VJUA 2ZBCA 3EX7B 2J6TA 2AYGA 2U1AA 1F5AA 4NA3A 3DGPB 5T7LB 4J5OA 3Q24A 3FRYA 3UE2A 4P52A 3TWZA 5CYJA 1TKTB 1LWFB 2VFUA 4RW8B 1WKJA 4QIVA 2ALYB 3B6BA 2DNZA 4UF4A 4OI1A 5D77A 2DGWA 2QA4S 1RAJA 1KP6A 4HHHA 2DGSA 1SKRA 4P6QA 1YBAA 4RW6A 2CFXA 4F36A 2Q6CA 4QR1A 2W9AA 3KJFB 3IR5B 2VBZA 1KD1T 1FKPA 3M6WA 4NEZA 1FA0A 3QQCD 2PT0A 5MAOA 3I82A 2DR6A 1S6UA 2X1GA 4DV7J 5AE3A 3DU6A 3LH2S 3BR8A 1NB7A 1Y7PA 4FYYB 4O44A 2ZBIA 1YJUA 4RX6A 3AOCA 3VAGA 4MIWA 1UFKA 4DR2J 5F3TA 3J80Y 1TKDA 2BM0A 2C2ZB 2C2EA 4I1TA 5KFNA 1RU1A 1TL1A 4F7VA 3QIPA 4JYAF 1IN0A 2HPUA 4JI8J 1WEYA 4TY8B 5DG9A 4HYKA 5IWAF 2FLOA 4J9NA 2X51A 3UFCX 1L3VA 3UN3A 3V4IA 1HD1A 4HACA 2APOA 4FYDA 4QWAA 2MDAA 4JV5F 2W7AA 5HLFA 1A9NB 1N32J 3JSRA 3KHLA 5IM0A 2RAQA 3TUPA 3D1OA 2HHQA 2B5JB 3TAMA 3DLHA 3EVWA 2W2QP 3SYZA 3FJ2A 1S0MA 4V19X 3TAQA 2KJWA 4DV5J 4WCEQ 4K4WA 1HD0A 1AB8A 4DLGA 2RJZA 1K47A 3BGOP 4ENOA 3SMZA 1Q53A 4O3QA 2NLWA 4NI2B 1TTHB 4Q8FA 1UWBA 5C2CA 1RUSA 1VGYA 2HWIA 1QJHA 3SV3A 1YK9A 1HNWF 1GXLA 3EYZA 3RW6A 3UR3C 1R27B 5CHCB 3MEDA 2V6AA 3CD6S 1LV5A 2OEJA 2Z2MA 3D28A 4XO0A 3KK1A 4NCGB 3JSMB 2BBEA 2VG7B 2QMXA 2RDJA 3CMQA 3C14B 5K8NA 3GCXP 2J0XA 2BDPA 2AJ2A 2FJXA 4B3MJ 1FXDA 4OV1A 3BREA 1NEEA 5I3PA 1GMWA 3S7RA 3PW0A 3SIPB 2G9OA 1HKAA 3GONA 3MOJB 1AUSL 4ES3A 3UN2A 2WBMA 4NMXA 5AT1B 3BPSP 4ZJQA 4B3TJ 3KMSA 2LQJA 4JI0F 1SI9A 4YFUA 1MWYA 2XBPA 2ATCB 1C1CA 1SH3A 3MUTP 5B08A 3K59A 2IDEA 1YG0A 3GJRB 2WK4A 1PILA 3EE3A 4K4UA 2QX0A 3MCMA 4FNHA 6FD1A 2GVDB 2LEPA 1H98A 1KLNA 1RTIB 4IG3A 3VAMA 2YPZA 2F4FA 3TW0A 3HHNB 4DPWA 2FVQA 3TA2A 1UJ6A 1FK9B 3A8IA 2IYIA 4RNMA 3MECA 2EK6A 2KH9A 1VR6A 4OLOA 4DV4J 3FSIA 2FGCA 4Q0BB 3TQ1A 2DXFA 1JMTA 2MQOA 5AE2A 5L1JA 1NRKA 1R0CB 3VAJA 2FHMA 1KLMB 4X65J 5FJ4A 3DLJA 1RCOB 4IR1A 3NNHA 2HWHA 1J5EF 1QLNA 3LO3A 1W2BR 1ZPVA 2XMMA 1U8WA 1RT7A 3CE8A 1ZTTA 1HBNB 4Q44A 4DX8H 2LFVA 1SBRA 3NBPB 3KUEA 2IIHA 4A8YA 3BB5A 2UUBF 4PYDA 2PIIA 4NLRA 1FDNA 2OTLS 4K5SA 2B9WA 2CNKB 2M0GB 3HVRA 2XI2A 1VRTA 4ECTA 1VHIA 3EWGA 1RHKB 1B70B 1SCJB 1MN9A 4OI0A 2QSFA 4RNOA 3LPEA 1G7CB 2RMLA 1JXEA 2YY3A 4A8XA 4UQTA 5HVHA 5IFMA 4OYAA 2MQ8A 1R89A 4I7FB 1HARA 1O8BA 1U24A 4PG6A 3L9ZA 3K17A 2ZM6J 2VONA 1RT1A 2RQMA 3UD5A 1S5ZA 1VDHA 4DR4J 3LA0A 3D7SB 3UNGC 1NU4A 3TEHB 2ZBPA 4OL8A 4MFBB 4G6VB 3DC2A 3T6BA 4YOEA 5GVQA 1MWQA 3GMGA 3HHLC 3VGSA 2E7XA 3M4XA 5A8WB 4DQRA 4JP8A 2V2QA 2R8IA 4BC9A 1G2EA 4O3RA 5EX0A 2M70A 1U1RA 1LXJA 1RLDA 3GFXA 4YR2A 3BBBA 3P5BP 2AWZA 2IM0A 3U1LA 2AHOB 1U1OA 2C3PA 3JS9A 2EKYA 2UV8G 3VVUA 4DWIA 4LF6F 4A8SA 2IBOA 4LF4F 4DL5A 3NOCA 3DGPA 5T7LA 1F5BA 3QWUA 3UPFA 1TKTA 1ZZFA 4F4KA 4ZVUB 4K4YA 4RW8A 1NZ8A 2NXEA 2HBRB 3LF0A 4IH5A 1RAIB 1V6HA 3G82B 4ZVFA 4JI5J 1XERA 2J9CA 2Z30B 3M9OB 5CCMA 3GG1A 2CQGA 2WVFA 4XTTA 4UOHA 2EFPA 3HULA 1SUQB 4NLTA 3TZWA 1S12A 2BE7D 3TZXA 2CAJA 1OMSA 2FVRA 4AL6A 2M3DA 3G86A 1TKZB 2KHDA 3Q8SB 3EGVA 3L7OA 3M8PB 1X60A 5D4OA 1KKHA 5KOWA 2BQRA 4A8OA 2NQPA 3DMJB 3C46A 1HLWA 4MAKA 4IO1A 1VQMS 2IRUA 1N0UA 4USMA 5DS7A 3SDEB 2DRBA 1QUVA 4DZ6A 1BE4A 4DXLA 5DDPC 1RTZA 3QLHA 1HNVB 4TY8A 2VL1A 3AQPA 3PTWA 4DBQA 4FZVA 5DJBA 3IR6B 2MXYA 3PXGa 3FCHA 4QCLA 5D0EA 2VH7A 3NRBA 4CLFA 3GR1A 3HHDA 4ZPAA 2FLLA 4F0HA 3JAMU 2P5VA 4OI3A 2BX6A 3THVA 2B5JA 3F56A 3ZZOA 1TR0A 2NYHA 2P6SA 4F3MA 1LW0B 1WC1A 5A8RA 1NAQA 1GMUA 4CP5A 4EBCA 4N8OA 4DN0A 4OHWA 4ZLPA 5ETPA 3FZBA 3T1AA 4NI2A 1X9WA 2HRYA 1O51A 4O4RA 1N36F 4A46A 2JWNA 1NJIT 4ECZA 2YX1A 2DGUA 3MHYA 5DM7Q 4K0KJ 1S9EB 1WG5A 4NCGA 2KB2A 1ZS6A 1JLGB 5D15A 4O4GA 3IGNA 1QVGR 1VBKA 1Q78A 2VG7A 4HHUA 3H7HB 4HKQA 3C14A 4TU8A 3IR7B 2KVIA 5AXLA 2Z57B 5KFHA 3T6JA 2HKEA 3K57A 1KFSA 2ABYA 3R2CJ 4DUTA 4DR1F 1GAOA 3BGUA 3M05A 1NK6A 2QA4G 4OJGA 4LFCF 3IG1B 3MM5B 3I9ZA 2XMUA 4K4TA 1KNZA 1T9XA 1C2PA 2PI4A 2WSCC 1OWXA 4TU7A 1U25A 3C2PA 2G2ZA 4ZN3A 5KG0A 4WTOB 3W63A 3IO1A 2G1DA 3R2DJ 4FF1A 2NS1B 2CJYB 4JI6J 3ET6A 4DI6A 3NMRA 4N47A 4HTIA 4GRSA 5F8IA 4KIAA 1VQ8S 1GTEA 1ZBTA 1RTJB 3A8KA 1YGYA 4AQYJ 2JNJA 3N6NA 3Q8UA 3B78A 4R0EA 3GG0A 2F4VJ 3K5OA 2BANB 2VFSA 4Q5VA 4HDHA 3WIUA 2GVDA 2HNDB 1RTIA 2VDHA 2H5IB 2FJDB 2HQCA 2R2TA 1NKBA 1EZZB 5B0BA 4G3IA 3PY8A 1FK9A 3H2VE 1NDLA 3CMAS 3AA8A 2YKAA 3AOAA 3R7BB 3MEKA 5IT0A 5SZTA 5FDLB 4X4VA 4Q0BA 1T11A 3TUJC 4ED7A 2EBGA 5DQIA 4ZJOA 4LRFA 3HX9A 1RLCL 3I0RB 1KLMA 3GE9A 2RRNA 3AH6A 1KVKA 2PI5A 4O0NA 4ZCMA 1UWAA 1S97A 4CLZA 4KKOA 2IVFB 3B4DA 4WU3A 2VA3A 3RBXA 1S1XB 3VVTA 1HBNA 4FF4A 1WC3A 3NBPA 4L73A 3GILA 3T5LA 4DLEA 3Q8VA 2UVWA 3OSNA 1X5PA 3N5BA 4NXMJ 5ITHA 3PW5A 5HSPA 4B9MA 4JV2A 5L46A 1TV6A 2ZHAA 4KGZB 2DBBA 4J7CA 2AEFA 2ZEJA 2HYIB 1Y9OA 3HKWA 4C8NA 2LXFA 4U8VA 1B64A 1T3OA 1D1UA 4I7FA 3KK3B 2OI2A 4EEYA 3EXCX 4IRDA 3VV2B 4B3OA 4KAIA 2V63A 1Q82T 1F6TA 2DY9A 5J2PB 4MFBA 1O0PA 2OJ3A 4DG1B 2Q6BA 2ZBQA 5ETQA 1LK7A 1TL5A 4G1QB 4M5HA 1RE1B 1QDUB 1N8RT 3O6QA 4ZVHA 2DNPA 3W66A 4LBHA 3SSRA 2LMIA 2XO6A 2ZZTA 5GAHI 5HK4A 4LR9A 4XK8C 2A1BA 5JVHQ 3ELHA 1ZM2A 4OYXA 2B4UA 1WEZA 3TQEA 1PYOB 1M0SA 3W9IA 5B0FA 2D3ZA 2R8JA 4BBYA 1CBKA 3CCTA 1QAYA 1CS4A 3H4DA 2N7CA 1ICEB 1XK8A 2YWFA 2OP5A 4DMZA 1GMVA 3MD3A 1TK5A 2ADCA 5KFSA 4PPDA 3D3BJ 2VPYB 4OX9F 1N6QB 4C97A 2E5HA 1G4CA 3R6GB 4PWDB 1I1GA 1OQ6A 4DV6F 2AYMA 4K4ZA 1G3OA 2FJBB 3E3XA 2PA3A 3RYLA 4ZKAA 1OYDA 5DM6Q 1CC8A 1U2CA 2ASJA 4M5LA 1SUQA 3V6KA 1V9OA 2YNGA 1J27A 3E2EA 2EC2A 3VGVA 1FRMA 2JEGA 5KFWA 1RT3B 1TKZA 2OEKA 4X4QA 3M8PA 2CQBA 2KXHA 1U1PA 1WDDA 3THTA 1YKWA 2R7OA 3KNGA 3M6UA 4GVBA 4TY9A 3GFZA 3A4TA 2GNKA 1ZZNA 4USUA 4RNHA 3ADAC 1W26A 3GQCA 3NGTA 1N34J 3TA1A 2XY7A 2C3MA 2DH7A 4Y2AA 3FVYA 4OJHA 1HNVA 3K5LA 5KFLA 2LA4A 4F26A 3QATA 4IO9Q 2YWHA 5DQHA 1GQEA 1CVJA 3H59A 1GX5A 3L7UA 2MPUA 2ERRA 1VQ6S 4ID8A 1SV5B 2P9EA 3UCZP 2GMLA 1U4BA 3P3DA 2DT9A 4EMDA 4DCJB 4I69A 1LW0A 5D6GA 1RAGB 1ZOTA 2K3IA 1P1TA 2V5HG 3J7Z5 4JI3F 4IQXA 1RBLA 1VQLS 4YMEA 2G13A 1HHTP 3D67A 3EVMA 1M5OC 5G4DA 1Y5NB 1ACMB 4CH1A 4WXWA 1JLGA 4QR2A 2QA2A 1MU2B 4OJ1A 2D3O1 4LVOP 1XR5A 2EC0A 1XNRF 3SSQA 5ETVA 3M8RA 4R5PB 5J1NA 3ITHB 4ZPVR 4X84A 1LXNA 4NEYA 1K9MT 3KUGA 3AFGA 4ER8A 3W3SA 3LP2B 3IG1A 3MM5A 2ZH4A 2BYCA 1JLAB 2EG2A 3OBIA 1NPRA 3OFFA 3M30A 3T1YF 1FFWB 5A2QU 2UXDF 1RT4B 1FX4A 1R8BA 4KH0B 4L6V3 1VBXA 4LRCA 5LSRA 2OAUA 2KZZA 4O0IA 2ZVIA 1RTJA 2DNNA 1UZDA 3LALA 1QE1A 1NB2A 2G0IA 2BANA 3ZFVA 3ICLA 1ZETA 1X4EA 2DCLA 3BKTA 3KLIA 3RAQA 1NHVA 5K20B 4JYAJ 1TK0A 3UD3P 4DUYF 1RJJA 4F8RA 1S48A 4F25A 1S6OA 3MPWA 5FDLA 5DLFA 5BR8J 2CVIA 2CPHA 5GAGI 2R8KA 5H9FK 3GIKA 1J2VA 1Y5IB 4JV5J 1VLYA 4M5IA 3I0RA 1R31A 5C5JA 2PGCA 1DQ9A 3F44A 3DYAB 5KG4A 4HTJA 1I94F 4MH8A 1VQ5S 1L3SA 5HJXA 3EZOA 2ROEA 1PBUA 1S1XA 1KEKA 2MZSA 4FXVA 3RAMA 1W7WA 2UXCJ 2EXUA 1FRHA 5F8GA 1B4SA 2PFFB 4ANEA 1IJEB 4DQPA 4ZVOB 3QSYB 1HNWJ 3NGUA 2B43A 4G1PA 4H54A 3PR4A 4YQWA 4FF3A 1RU2A 3D5MA 3VAKA 4K4VA 3MMJA 2L3MA 3HVWA 1RCXB 2H54B 2HQDA 4OZ3A 4DFJA 2AZ1A 3T9NA 1UFLA 1N5TA 4E0DA 1R8PA 2V68A 2EG1A 3KK3A 5CQGA 5AXNA 3OVSA 3KTQA 2WVBA 2V2KA 3CIMA 4LQ9A 4DU7A 3UR0A 2Y1JA 2D69A 5KT5A 3GZ7A 3W62A 4RBUA 1NDPA 1T9TA 2MQLA 1UEVA 3V4MA 5J2PA 2QFJA 2JHEA 4ED2A 4IQMA 5A6WA 3VR1A 4ED3A 1I3OB 5ETMA 3D4JA 1FDAA 1SJ1A 3T9ZA 4WFBQ 4CNYA 4I56A 2L9DA 3LUYA 3DM2B 2FJWA 2FVCA 3I6PA 2BABA 5KTQA 2FY8A 4O3PA 4YUDA 2FDNA 1S9FA 1RHQB 1KHWA 4LRAA 4L75A 2I6WA 4I6AA 1SKWA 5DRKA 1S0NA 3MR6A 4OZLA 1NHKL 1UPPA 4PAAA 2RQKA 3UQSA 1WTFA 4PQUB 2WW8A 3P4UB 3NWGA 2ALZA 1G6BA 1Q8IA 5E33A 4YDDB 2HZAA 3T5KA 4QU6A 1DLOB 1R3NA 1OY9A 2JOQA 4ECRA 3W2VB 1JLFA 2YQ0A 6AT1B 4ZVRB 4LJMA 3H40A 3ENAA 1N6QA 2YBVA 4J9MA 4C3KA 2LXUA 4DR5F 3POTB 3BBFA 1D09B 4PWDA 2BZ2A 3D9BA 1Y0HA 2XCPA 4RBVA 2C2KB 4IRKA 2ZC4A 3PX4A 1XJWB 3M9NB 1SIWB 4NA1A 2IY5B 4DX6A 2FHJD 5D0RA 2BW2A 2Z8QA 3SZ2A 1JJ4A 3I5AA 2XWYA 4PRFA 4C4WA 2NREA 2SXLA 3TRGA 4IH6A 4FVCA 1RT3A 2B7BB 2FD2A 1H7WA 1B0TA 5F8NA 2HBQB 1URRA 4X4SA 2AYBA 2AW0A 1EETA 1PJ6A 2BKOA 2OUGA 2YNIB 2OHDA 1L3TA 2R7XA 1RYRA 1RHRB 4CM0A 4MJKA 3GSIA 1HQUB 1YJ9S 3CPWR 1Z4UA 2DHHA 1X5OA 1CJKB 1F3VA 1FD2A 2DNMA 5FLXY 4CZCA 3NNCA 2BM1A 3PRDA 1WWHA 2VKZG 2WBRA 4U96A 3H42A 2DISA 3BN7A 3AT1B 2KXFA 4WZMA 1MWZA 3RW7A 1NJZA 2RQ4A 4UUWA 2RQCA 2PMZD 1SH0A 5SUHA 1SV5A 3LGMA 3GV8B 3LWMA 3PM9A 1BXNA 1SQEA 4NLDA 4CLYA 2FVPA 1RKJA 5J1EB 2DRAA 4CLWA 3PW7A 2DRDA 2KHCA 1L5UA 3SCLE 2LEBA 2V4JB 1RHMB 1EP4B 3BM7A 3OR1B 3LGHA 3R5AA 1A6LA 2DGVA 2JFDA 2U2FA 2KJVA 2LQBA 1BQXA 2HNYB 1WHYA 3PHTA 5BYRA 2RKIB 2ZH9A 2WONA 2XQCA 1S76D 1UA1A 2MSSA 4QWDA 4LF6J 2NPFA 3BO3A 4LF4J 3GFYA 3N0VA 3CD5A 1VMBA 2HQIA 4RW4B 3NGDA 3AXKA 2H3EB 4Q43A 4A8QA 4W4MA 3OTOF 2Z56B 1ZAVA 2H5EA 2J0QD 2R7UA 3AJ2A 4DZDA 1B0VA 3GPAA 3ENQA 5C25B 3ITHA 1M1KT 3H25A 2BOPA 1WELA 1OIAA 2VPWB 4PG8A 3LP2A 4PCQA 4CM2A 3SQGB 1WSVA 2XNQA 1TAQA 2KM8B 3P96A 4CH0S 5DQGA 5RUBA 1BGXT 1RT4A 5K9FA 5KAKA 2XMWA 5ETLA 1AT1B 3H2LA 2XG8A 2ZUAA 5CXTA 4BWJA 2V34A 3TA0A 3HJVA 3MI7X 4RUAA 3IFEA 4FXDA 5KT4A 2IDLA 4I2QB 2WTFA 1YDLA 2O01C 4KHPF 2C3YA 3VGUA 3MAAA 1K1QA 2UU9J 2MY7A 2A3JA 3QGHA 5EGYA 3FNNA 1T03B 4Q2MA 1NK4A 2FIUA 1AUDA 2BJ7A 3DDNA 3TNVA 3DOKB 2BJ1A 1FRLA 3OTEA 1TK8A 2HZCA 3IM9A 4IYQA 4PWWA 3DYAA 1PYSB 1JKHB 2VG6B 3BGRB 1IWGA 3PW2A 4MK7A 4PXBA 3OT9A 1SJQA 4QIGA 4R8UB 2OGUA 4PKDB 3CULA 3NCQA 1HQ2A 3MURP 2JEFA 3SEOA 1UEUA 4ECWA 2VV5A 2CQ1A 4M1KA 3KWMA 1KN6A 2H4WB 5L8RC 2V8VA 2AQ4A 4UW2A 1P6TA 1KHVA 2N7YA 4WE1B 5HANA 4USHA 2ZBRA 4IG0A 4DQIA 5EN1A 5BYSA 5JXSA 2VC0A 4IFYA 1YSJA 3ZZPA 4CO5A 3QGPA 2OTJS 2C3UA 4LFCJ 2CNLB 1HHSA 5H9FJ 2JSXA 4FS2A 2IRYA 2MKYA 2OMLA 2IJFA 1OJ4A 4OQJA 1ROFA 2OPSB 5EX3A 4W92B 2RH3A 3TUZC 5KFMA 4RNFA 3NAHA 1F60B 1YX2A 5BJRA 5D0GA 3KLGB 3DHXA 2UP1A 2RS8A 2B4PA 1HQEA 2K7JA 5T41A 4N8NA 1FEEA 5D0HA 4USVA 4PQUA 1ITPA 1YTYA 5LMUJ 8AT1B 2HURA 2D3UA 1T94A 1U49A 4OX7A 3HDSA 3IS9B 3CO0P 1SL2A 3IP0A 1DLOA 2ZZMA 2CQHA 3W2VA 2HHSA 4XIUA 4IOCQ 5CYMB 2DNLA 2A2CA 1XQIA 3CCWA 4RWXA 3Q0AA 4DL0C 2QT7A 2UXBF 3LANA 2ILYA 4KH1B 2QLWA 4YDXA 3SFGA 2VFRA 3HSGA 3POTA 2E1RA 2CZVC 1KVIA 2YQ3A 4BCAA 3MWBA 3DLBA 2DNHA 1DQ8A 2RF2B 4AL7A 2KXNB 1X0PA 1FO1A 2J9DA 4P9SA 2VPXB 4OI2A 2QJ3A 3IWLA 4LFBF 2O66A 2VQEJ 2BE9B 5B09A 2F8HA 3C3LA 4ZS6A 1LKZA 2IMOA 2HW3A 2YNIA 1RQ0A 1XMQJ 3I5BA 2XTJP 2H51B 2VODA 1S1UA 3CJQA 3JQJA 4OHVA 1HQUA 5HROB 3HXMA 3OLAA 2RRBA 4NX9A 1CJTB 4YP3A 1CJKA 4FNIA 5J2MA 5D8HB 1BHNA 1ZPWX 5HVGA 3CCQS 2P9GA 4LR8A 3OUYA 4DHVA 1VC0A 4PXCA 2QG9B 3ZZRA 1RA7A 2ZE2A 3A3NB 1LQ9A 3S6EA 3I87A 3GIRA 1UVKA 2XSJB 2ZJPQ 2XS5A 1NPKA 3KG4A 4C2MA 5J1EA 1IKVA 2D9OA 2UUTA 3PYDA 2JH3A 4Y34A 1T7PA 3V81B 2DHXA 1S9GB 1N5VA 4ZP6A 2V4JA 3NGSA 3G6YA 1RB0A 1SJ4P 1EP4A 3OR1A 1C0UA 3NS6A 1B3TA 2UUWA 2UVRA 5CD4H 3MFIA 1MN7A 4KGMA 2IA0A 2ZH3A 2HNYA 2MHNA 2AGOA 2XYHB 1WOSA 2MZQA 1YJVA 2AX0A 3MPVA 1HWUA 2OH2A 1T02A 3AB4B 1H2TZ 3C66A 4RW4A 1M5HA 2CZ9A 1U2RA 2NZCA 3CJTA 1TMJA 2NUUG 2R7QA 1HPZB 2AGQA 5KFZA 3IAM9 2ZOFA 4ID5B 4LIRA 5JJBA 4MIBA 3S1TA 1FCAA 3P5TL 4QR0A 3H5XA 4NLVA 1TL4A 4DV6J 4ZLJA 5C25A 4XPCA 2AYEA 2LEAA 4DL4A 5M2PA 4DL7A 1BWEA 4J91A 1N5SA 4PG4A 3SQGA 4N7TA 3M2RB 4RBTA 5B0DA 2MEWA 5U47A 5KT3A 2NPIA 4OZ5A 1Y11A 1HBUB 3FBEA 4DSLA 4URGA 4UT4A 2AT1B 2X1AA 3U27A 5DG7A 3RZAA 1RT6B 2OMOA 1FRXA 4WFYA 4KO0B 1VQ4S 3WHIA 4I2QA 2YKMB 1HNXF 4DV3F 3SFUA 4IFVB 3G2XA 4FXWA 3TJ9A 2HVHA 4CH7A 2FTRA 3CCSS 3QJPA 2W9CB 2HRTA 3ZNJ1 3VCDA 3MEEA 1H6KX 1T03A 4WZQA 3QT6A 3GU0A 3HF5A 4MYUA 2GGPA 4Q7AA 3EJMA 5DZ7A 2P6TA 1NDCA 4FYVB 1YVFA 2M52A 3DOKA 1RT2B 1S1TB 3K58A 4WPAA 3CJ5A 4OMFG 1M5SA 4YHHF 2XMAA 4X4RA 2VG6A 4NWBA 2XYPB 4ALZA 4YR3A 1JK9B 4J9SA 5CZXA 4NYPA 2AMCB 5ETOA 2KVQE 1NLKL 4Q45A 2OD6A 4ES2A 3BH6B 1BWVA 1F2GA 3LAKA 2G4BA 5KT7A 5A76A 4FN5A 3UDCA 3EM1A 1URNA 1NSAA 4BC7A 2FUG9 4C48A 4LSZB 2XLJA 3N9UC 3BYPA 3SCIE 4RO0A 1Q95G 4WE1A 3P49B 1GNKA 4DEZA 1KQKA 3WX4A 2BJDA 1H2UX 2W2NP 3AY0A 5GMKa 3J7A1 2QE5A 1FKOB 4AFFA 3QMQA 5KG7A 1XNRJ 1UVNA 4X4OA 4ZVPB 4JBCA 1XEZA 5DDQC 4KRWA 2MLZA 3DLEB 3HZEA 5AJ3J 5F8JA 2A2DA 2QMWA 4P71A 2HNZB 3QWPA 2RILA 2EBEA 3BGFA 3AQOA 2QA1A 2OPSA 4DQQA 1RGVA 4DPXA 2C2NA 2UUCF 2BXJA 4N41A 4LF7F 2AJ1A 3H4BA 2B8QA 2UUAF 2B3TB 4LIWA 4JI4F 1FJEB 1VBYA 3D1HA 4AXJA 3MM7B 5K8MA 4Y2MA 5IT4A 2I5JB 1IKXB 5IQ6A 3KLGA 2XCAA 1VFJA 4WKYA 2MQPA 1LFPA 3GYXB 4IKAA 1S77D 2JJ4D 4LF5F 3HHLD 2B4OA 3ULHA 1KSPA 3N01A 4A8KA 3MR5A 3UDEA 2MY8A 2K2PA 2GO8A 5F41A 3IS9A 3QSIA 4F0KA 2WSFC 2ZVSA 4DUYJ 2QYCA 4OZNA 2EEYA 1XMOJ 5CYMA 2POKA 1VQOS 3OHAA 2J6SA 1WG1A 3DI6A 3O5TB 3PV8A 2HGNA 1HI0P 4DR3F 4NLYA 4A48A 3O44A 4K2XA 4ZHRB 4JI1J 2HBZB 4ERDA 3N28A 2CDQA 3TVKA 1X4AA 3KFWX 4LF9F 1N0VC 2RF2A 3I56S 3TZYA 3RBEA 1N5YA 2AU0A 1ULRA 3GSDA 1HWKA 4QW8A 2LDIA 3MM9B 3NCRA 2XNRA 3CD0A 1SXLA 3M6XA 4A8WA 4NLXA 2DGOA 4HR2A 2ZNYA 2DNKA 2CQIA 4ZDNA 4BWMA 2ZZNA 2BE2B 2DO0A 1RWOB 1SC4B 2B56A 4URQU 3MTKA 3T1HF 4ILMA 2BMBA 3EGZA 2MTLA 3NY0A 2DHAA 2HAIA 4IDKB 4TNOA 1CJTA 4YB6A 5KFPA 4YB1P 3GIIA 5F9LA 3A13A 4QOTA 4Y2CA 1L3KA 4ITSA 3LOUA 2B8PA 3D68A 2N4CA 1F1BB 4B9UA 4X66J 3I9V9 1WOOA 1WI8A 4OYOA 4ZPDA 4WBFA 3CW2C 2GZOA 3HO1A 1FWLA 4FPRA 5E5NA 4J9OA 1VRQC 2CG4A 2ZJQQ 3NKYA 2CPEA 3V81A 3SXLA 4M5NA 2OPRA 1S9GA 3BJYA 3MPYA 1UJ4A 2ACMA 1FNOA 4JI7J 2XULA 4TQRA 1D3WA 2LP4A 3G6VA 3ZZTA 3FMWA 5I3UB 1Y5LB 4OZ0A 2FZCB 3VALA 2WVCA 3PRVA 2OKQA 2C1EB 4DDFA 4USTA 1TKXB 2J7WA 1HPZA 1XN9A 1U47A 2Q3PA 1MG7A 4ID5A 4G1IA 5E3PA 5LSLA 4L3NA 2R4FA 1P9YA 1WUUA 3DRRB 1UJ5A 2J0WA 2E5IA 3M8YA 3KKFA 3CF5Q 2A0FB 4OYBA 4MT1A 4KFBB 3M2RA 3W64A 1NKEA 1VQYA 4OFZA 2FVSA 2MJUA 4WFAQ 1HBUA 2OEMA 4RJVA 1N48A 1RT6A 2J9EA 4J37A 1ELOA 1QSYA 1JXLA 1OSDA 4DR2F 5HP1B 4KO0A 4CIOA 4M95A 1YZ7A 1DTQB 1ZTWA 3RB6A 4JV1A 3B82A 2YKMA 1FJCA 4I67A 2W4DA 4UTGA 2GQ2A 2JLEA 2A6MA 2FPHX 2DNGA 4IFVA 4JI8F 2V0NA 3HHLB 1YHQS 3QT8A 3EZ5A 2W9CA 1FESA 5IT9U 5KFVA 1NHUA 3R5CA 1Y10A 3NGRA 4UOCA 4Z7CA 5CABA 4F4AA 2IC3B 3KJQB 1GXTA 2VICA 5IQQA 3DRXA 3BSCA 1N32F 1XNQJ 2LYVA 3MAQA 3JAMY 1RT2A 1S1TA 4OV6A 4HVZA 4EBDA 5KG5A 3UN5A 3BSAA 1IBLF 1DHMA 1M5KC 1FJGJ 4B9SA 4ZPBA 2CADA 1FHTA 4U7CA 4CLPA 1V5VA 3FQKA 3D0HE 2LECA 3IWNC 1T9UA 2QLXA 2Y0BB 1E6VB 4NCBA 5HQLA 2O1PA 1J5OB 2D74B 2XZTB 3I96A 4CRJA 3P8BB 3FRZA 4DV1J 4ELUA 1EHWA 3QIDA 2QMUB 1KRPA 2XMTA 3NWRA 3IGVA 4ED6A 3MM6B 1BD6A 4HT5A 1NH8A 1VCTA 5E2QA 3NG8A 5DZ6A 4DSFA 2MB0B 3KOAA 1RP5A 2IM2A 4YEAA 3DLEA 4EK2A 4NASA 4EU0A 3PJXA 1BMQB 2XMJA 2HVDA 3OVAA 1YBUA 3OL6A 1S49A 4DV0F 3CJSA 4O3NA 3OL8A 1LWEA 2E44A 1V5IB 5L1LA 3E01A 2WHOA 1VISA 3M2UB 3PCOB 3DHWC 2L9WA 3C15B 4NYOA 4P7TA 2E5LJ 5F0WA 3PRBA 2CJQA 3PKMA 3MM7A 1JX4A 1HYSB 4RWWA 4NA2A 2I5JA 1TL3B 1IKXA 3R5JB 4J9RA 4CNZA 3BDPA 5D3GB 4OYIA 2CRLA 1NKCA 2ZWPA 1MMDA 5BXIA 3EGWB 2K06A 4AXIA 4USJC 1NZAA 4KE5A 2KRBA 3UNYA 2WVEA 1MMLA 1CSJA 4BHQA 2LDYA 1NBEB 3W9JA 4DJBA 3Q8PB 2YWEA 3FMBA 1IR2A 4F2RA 1B7FA 1Y3KA 1VC6A 5KOXA 2HHTA 4B3RJ 1RWVB 4NMLA 3FFIA 1WC5A 3TUIC 3NP5A 2MKCA 4ZHRA 1WKKA 3KHHA 1DTTB 5B0CA 3HT0A 4C6AA 4Y00A 3QAUA 2B7CB 2JLGA 1FWPA 4B9TA 2GVZB 2VJVA 2ZKTA 3CIZA 4FS1A 2B51A 4TXSA 3MEGB 2ZH5A 1OS5A 2V67A 3KHGA 2KT3A 2BE2A 4GKJF 4F4WA 1BC6A 1H38A 1VIXA 1TMMA 4OX6A 3J7ZT 2D9PA 2LQ5A 3PFOA 3D1QA 2DPIA 2CWKA 2ZH8A 1JLBB 4IDKA 2GJ2A 2WB1D 4RW7B 5LJ5Y 5KFCA 4CLUA 1DZ5A 2QGFB 1VLOA 1DARA 3C6UA 3W9HA 4NXNF 3W61A 1BQNB 1YJTA 4WIQA 2X1FA 4ZLLA 4ZIVA 3ISZA 1K8AT 3JTOA 1ZM9A 3JQMA 2Y8YA 1UW9A 5CYQA 1KQFB 1HR0J 2HG4A 4P2SA 3MR3A 1SQFA 2IYGA 3OPKA 1OO0B 3FKBA 5KFXA 2W1BA 2RIJA 1I51B 5KFUA 3FCWA 1CEZA 4C8LA 4CLKA 5HMYA 1IR0A 1CPZA 4B02A 3M32A 2MLXA 2CJXB 1WHVA 2GQQA 3Q8QB 1U6BA 3W7BA 1UMJA 5I3UA 3TJ8A 4OJ3A 4QQBA 2KTQA 1VJQA 3MMAB 2JEIA 2ATLA 2R8HA 4K4XA 1N88A 1VQSA 2CA9A 3AJ1A 4KR0B 4W90B 1TKXA 1S1VB 1RAHB 5HMZA 4NZ6A 1IQTA 2UXBJ 4JI5F 4K5RA 3FBCA 2W9BB 3OV7A 2R2SA 4OI4A 3DRRA 2XWXA 3L09A 3PIOQ 2D41A 5A8KB 1IBMF 2FY1A 3DFEA 1NJWA 3GJSB 2DVIA 4KTQA 3D6FB 4H4MB 5CD4A 3MMCB 1GT8A 1Y4ZB 3QT5A 3A12A 4CCHA 2ROGA 4J9UE 1S4FA 3K0JA 1WNEA 5D78A 2RUGA 5D4LA 1Q8BA 3M9MB 5THWA 4RU2A 1Q7LB 3K5PA 3F0NA 4Z7YA 2M9KA 2F9DA 5HP1A 1UVLA 4QWBA 1DTQA 4HI2A 4S0MA 2CPIA 1X31C 1LWCB 5F8HA 2IM1A 2MGZB 1LWFA 3UDLA 3HHLA 2BRKA 2DIVA 2KT2A 4LREA 1IBCB 4DCPB 4DL2A 1R8HA 5LXYA 1RAEB 2E1AA 3KK2B 2QEXS 2J5AA 3GR0A 3RU0A 2IC3A 4FBTA 2QV6A 2HIQA 2YNFB 3D2WA 1WHXA 4LFAJ 2R8GA 2X3GA 2BEFA 3MTJA 2A18A 4LMZA 3Q83A 3U1NA 1T3NA 4U7UD 1C4CA 2WVDA 2X1BA 3OL9A 1KTVA 2IJNA 5L1IA 1N33F 4ICLB 1UA0A 3J7AN 5HVFA 3RGIA 1H3DA 3L4BC 1D8YA 5KFQA 3HJFA 3I0SB 1G1XA 5K14B 3J7YI 5GMDA 2KFNA 1SH2A 2PA8D 1BLUA 4ZJLA 1Z2ZA 4KJIA 5J1PA 2F5GA 1T9WA 1EKRA 4EI2A 3EPGA 1DQAA 3HHKA 3CJ8A 1E6VA 2PD1A 4K0KF 4YS2A 1J5OA 4D3GA 1H7XA 3OTBA 3T5HA 4F4ZA 3G8TA 1T95A 2AGPA 5BYQA 4I6WA 2WSEC 5LT5A 3MM6A 2DNQA 2E9ZA 1VC5A 3OQ2A 3VWSA 2VB6A 2HMIB 2DH9A 3M1VB 5J2NB 1YBTA 1UKUA 2DR5A 1PJ5A 5ETTA 1UZHA 2HFSA 5GAEU 4B9LA 3RRKA 4KB7A 1YJRA 1IBKF 3T19A 5GAHU 4TQSA 1WORA 2NR0A 5A2QY 2VG5B 4FKXA 4JI2F 5F0UA 1HBOB 2GHWA 3QFHA 3OXGA 2EWHA 1NPPA 4E8UA 2DEIA 3M2UA 5HL7Q 1GH8A 4AQYF 2HFOA 3RR7A 4OIXA 3CC4S 1HYSA 1XTZA 2F4VF 1TL3A 3PYEA 4AD6A 2GA7A 2Q79A 4RUBA 2VC1A 3QIPB 2BUNA 5KFOA 1VQKS 1T0TV 5J2QB 3L95X 2QLJB 4RUHA 3VQTA 1HA1A 3JSMA 3WIVA 3TO8A 4ETZA 1EB0A 1RABB 2Y1RI 4P72A 5AE1A 4M5GA 4HACB 3MDFA 1CQMA 2OD4A 2BJ3A 4V19J 3R1LA 4ZLNA 3V6JA 3ENVA 3C19A 5CCLA 2V8GA 2MYFA 2ZDOA 4WFNQ 1RA6A 1X4FA 2NZ4A 2ZHOA 4TYBA 3H5YA 4N76A 1KBRA 1DTTA 4CYUB 1FE0A 1KWMA 2YPYA 3LWLA 2OFHX 2VZ9A 2GVZA 3KNAA 4ZP8A 1UWBB 3MD1A 3JSBA 2B9XA 2HQGA 1NJXA 2KFYA 4CLTA 2CPZA 3AHPA 4I0WA 4NXMF 4OYMA 3CC7S 1YIJS 3IAS9 3Q22A 2OIHA 5CAAA 3KK1B 2DJWA 1S99A 3ETOA 1RBOB 4OZJA 1GX6A 1NK5A 1NH7A 2RRAA 1JLBA 1X4DA 2CZ4A 3TYTA 4AT1B 2R7TA 3KMQA 4ILLA 1QSLA 5LJ3Y 1OSCA 2OFGX 2MKSA 2DGXA 2JVRA 3DOMB 1K73T 1NDKA 3OXFA 1RWMB 4DSIA 2QLBB 4OHZA 4LF7J 2MZRA 1NK8A 1DAXA 5B7WA 3ILLA 3OFHA 2UUAJ 1YRTA 2FHKA 5KG1A 1FRIA 4DV2F 4JI4J 3MOZA 2P8IA 4TVAB 1U1NA 4I4BA 3CCJS 4LF5J 4P2MA 1TU0B 3PVXA 2ZKUA 4WKRA 3UD4P 2XLIA 3KJVB 2Q66A 4AE5A 3MF5A 3GP9A 3LAMA 1U0SA 1Q79A 2W01A 1YQHA 1EAYC 1FJ7A 4TKTA 4CI0B 1RYSA 2ZH2A 2UVVA 2MSTA 1KFDA 4C8MA 1FT8A 4DR3J 2W9BA 3IN5A 3CC2S 4WTYA 1N56A 4DUZJ 3K8VA 4X4NA 4OHXA 5A8KA 5A8WA 3OJSA 3TARA 2FC8A 3ILJA 5DO2A 5CH7B 4MKBA 1Q81T 5KFEA 1H2VZ 1TZ0A 1FRKA 1HWJA 1NCLA 5B0EA 3ZC4A 1SQGA 4H4OB 4GC6A 4ATNA 1PYTA 1H0HB 3FCVA 5L39A 1WKLA 3SBMA 3SI8A 4DQSA 2DR7A 2LCWA 4U8YA 2IJRA 1YLXA 2Z4PA 1VJWA 2XY5A 3PHEA 3T1HJ 3IC1A 1OYEA 2HQFA 4RKUC 4DR6J 3TI0A 4CO0A 2HBYB 2HHUA 3CB4A 4UOFA 4K8RA 4CT8A 1NK7A 4CWBA 1QD1A 5I4MA 4Y2KA 5LL6d 3ZNUA 1RKIA 3G82A 3ZTPA 1ZA2B 3I4HX 1S6QB 3CO9A 1F3FA 4ZVGA 2HLUA 1S72S 2ASYA 2YNFA 3G6ES 3W2WB 2VFVA 3HKZD 2N3LA 3R27A 1B0PA 4ICLA 2QLFB 3CXCR 1UETA 2L9NA 3D0GE 3D66A 2ZNZA 4CO2A 5IS2A 3I0SA 5K14A 2F63A 1WF1A 3BDEA 4HEA9 4UY85 4DFPA 4NLPA 3DMJA 2HS4A 2B9YA 4CTAB 4I2PB 4WYWA 2KFZA 1X0FA 4MMOA 3WZ0A 2I8EA 1YITS 4N56A 2R7SA 4Y2IA 4PPZA 3SDEA 1U8SA 4NOHA 5GADI 2ZOGA 3C6TB 4DS5A 1VHFA 4QPTA 1S0OA 2HVEA 3EGNA 2H5JB 5HI7A 1PAUB 4U6PA 2OLWA 2HMIA 3JYTB 3NMAA 3M1VA 3IBCB 5IV3A 1RWXB 5J2NA 3N5FA 1XWLA 2BRLA 3B8HA 4ZVSB 1XR7A 2H4YB 1MROB 2W4CA 1FRJA 4I68A 1SJFA 1R7IA 5E3QA 1NSQA 4RU9A 2VG5A 1W2IA 1HBOA 2AX1A 3LW5C 3V2UC 1LOUA 2YKOA 2W24A 3IBFB 3ILIA 3ZTOA 1FNMA 3PZPA 4CO3A 4JOUA 4QYZK 3PYGA 4DS4A 2K8GA 1Q16B 4HI1A 4M94A 2ZUGA 2YH0A 2YKNB 2UZAA 1S9EA 4DPOA 5J2QA 1NUEA 3D6HB 3AOBA 1B7YB 3QLHB 4MKVA 2JDJA 3PDNA 1AW0A 2NCKL 1JNRB 3M8ZA 4X4TA 3EDQB 5BR8F 3R5BA 2FJVA 2GC8A 1NM2A 1PIEA 3HVAA 1P8GA 1KOOA 3KG0A 2AF6A 3QPIA 3NAIA 2C2RA 2EFNA 1IBLJ 4N77A 2VFTA 3W1YC 5A8RB 1REGX 2FZGB 4LSNB 4DN9A 1YI2S 4CYUA 2MQNA 4L74A 2O3DA 1RI7A 4P2FA 2UXCF 3MCNA 2GFFA 2M7SA 2XYGB 1X5SA 7FD1A 2W7OA 2J7KA 1VYAA 5A0YB 4C0OC 3HPOA 1TUWA 3C16B 1IM4A 1JB0C 3KLEB 2HNDA 4KSEB 3E51A 4X62F 3BPDA 3DDIA 2XEXA 2VQFF 3FSXA 4O4GB 2N82B 3W60A 2OO4A 5IWAJ 2BA9A 2C2OB 2PSZA 2QN6B 3OSPA 1WACA 1JLEB 4NLUA 3CCRS 3SQOP 1GFWB 1D9FA 5L9NA 3HP6A 3DOMA 4MYTA 4DPUA 4DFKA 1R43A 9ATCB 2XS7A 3AD8C 1JJCB 2VBWA 2E9TA 4B08A 4DV0J 1E6YB 2XC9A 2JEJA 3ET6B 1MMNA 2KN4A 2G0CA 1DURA 2FQQB 1WJ9A 4DOZA 5FD1A 3QAEA 2M8DB 2X7IA 3MFHA 2KYZA 2B6AB 2M4MA 1U2FA 3Q89A 4YR0A 4C8ZA 5HAOA 3US5A 2RDDA 2XGPA 3KJVA 2QL9B 2OELA 5CZVA 3MR7A 3W8GA 4K50A 2BR0A 3UWTA 2HS0A 3Q2TC 1S4EA 2R7VA 4H4KC 2AP6A 2CNOB 1BY9A 3H20A 4ZVTB 1SL1A 3KLFB 3M8SA 4URSA 1F0XA 3MUVP 2DHSA 3G4SS 4DG1A 4KKOB 4F50A 4G1QA 3IWXA 3DDKA 2HHHF 4C9DA 2W2OP 1IM6A 2GX8A 3TJAA 1XMBA 4JI0J 2WRMA 4PG7A 2NXNA 2V50A 1FTRA 1JNZB 4H4OA 2G0JA 3VQSA 2IAJB 1VK8A 2DY1A 4QYRA 3CJ3A 3PEHA 2N4DA 4H4KA 1KC8T 2F8MA 1TV6B 4Y28C 5DLGA 3NXZA 3MUMP 2O5DA 4GKJJ 3CJ4A 2FJEB 3QGGA 2DCUB 1U02A 2MZJA 3SCJE 3FQLA 1Q4RA 2JL9A 2WB4A 4N5SA 1CJUB 4J9KA 2CQ0A 1HHQA 2V69A 4C0HA 1WDTA 5L9XA 4B3OB 1R6YA 3KLHB 2VBYA 1RBAA 4NXNJ 3FK4A 3CNQP 1HL6A 1R6VA 1S6QA 3AB2B 2Y0SD 4QIEA 1J5EJ 1C1BB 3W2WA 3Q2SC 1HNIB 4P74A 4WXOA 3GLJA 2FYXA 1TELA 2ASLA 1FVSA 2VF3A 2KI2A 1PG5B 1PKUA 2UUBJ 5AXMA 1N52B 4PZVA 4I6YA 3ZO7A 5H1SV 4M5KA 5KFIA 3CD7A 3HT3A 1KOHA 4GMKA 3MXHP 3TEGA 2X3DA 4CTAA 3BQ2A 1CS4B 4I2PA 2CPFA 2IM3A 3JB9k 2W7PA 4NCAA 5LOQA 2DH8A 3R3TA 5K8PA 2M8HA 2V8DA 3C6TA 1QY7A 3AD7C 1W25A 2J7UA 2FHOB 3AD9C 3JYTA 4ZVQB 1QSSA 2Y3YA 1WSRA 3LP0B 1S10A 2HEKA 1JWWA 3RBZA 3J81U 1MROA 2YNGB 5C2GA 1IBMJ 3BSOA 4C11B 3QT7A 3KJNB 1Z2LA 4PYAA 3GV7B 1CLFA 1T9YA 3EMTA 4GVBB 2CYYA 3G6XA 2HFUA 2ROPA 3QBCA 4X64F 3CDBA 5ETKA 7FDRA 1X4CA 1PBAA 3RG6A 1IR1A 2QL7B 2EFQA 4RNNA 1X4HA 2UU9F 4ECVA 3HK2A 2YKNA 3BV8A 1C0TB 1U1LA 2Z2ZA 2XLKA 1H73A 4IOBA 1MU2A 5IOLA 3DRSB 1IXKA 5LM7E 4F0MA 4R5PA 1AFJA 3HI9A 4LF1A 3BQ0A 4OZ2A 5IXUA 3HD2A 1JLAA 3GYGA 3CJKB 3KHRA 1F2HA 4LSNA 1N33J 3BR9A 5M2UA 2QC3A 2HHVA 5DG8A 2CQDA 1EIYB 3N6LA 1Q1KA 1UP1A 2HVIA 4BS2A 3E8OA 2GIQA 4WK1A 2JZ5A 3VAHA 4M5MA 3J80U 2I1RA 5A0YA 1VIOA 2NUHA 1XBWA 1O6XA 2HSEB 4DSKA 3C16A 2HS3A 3G96A 3KLEA 1JJHA 4QYZJ 4IR9A 1HNZF 4PEOA 3OVBA 1VI7A 3DKDA 2FJAB 3A8EA 3IRWP 4NLGA 2C2DA 2CJ9A 1OPZA 1XIQA 3JXOA 1VS3A 5D4NA 1JLEA 2BJ9A 3OL7A 3GIJA 3GB0A 2HHPA 2CQ4A 1B99A 2DHGA 4O3SA 4U7UK 2CKWA 4LT6A 3I32A 3QJJA 2HGLA 2ZJRQ 2IRXA 4F67A 2H9ZA 3M30B 1IQZA 1IBKJ 1U1MA 1KTQA 3VTIA 2BACA 4JI2J 1E6YA 1GK8A 3R97A 1U6FA 1YJNS 4F3QA 3CDWA 1WF0A 5E3AA 1NK0A 1TL7B 3UCGA 2DGTA 3ZZUA 4R25A 4OYPA 1N36J 3W5YA 1QE1B 4JUZA 1P27B 2CQ3A 1RWWB 1DJ0A 1FDDA 3KLIB 3T41A 2VKRA 5LMUF 2QFIA 2B6AA 1WD6A 1ZAXA 2ILZA 1RTDB 1YJ7A 3K89A 1EKSA 1D8ZA 2BJEA 2XZDB 4RUCA 2IFXA 2M88A 3JQKA 2RNEA 1RWPB 3RJMB 2VBXA 1RWNB 2NXJA 3NEKA 5B0AA 3DLKB 3MPDA 4DR1J 2LLZA 3HD1A 4RZRA 1N5QA 1OY6A 4FKYA 2I2YA 2COLA 3KYLA 3DN9A 3R9LA 3KLFA 4ZN1A 3W8PA 4AL5A 5EWGA 3CJRA 3OFEA 1SJ3P 4WYLA 2LU2A 2V94A 3DM2A 1HI1A 3LGNA 1WTBA 4MKYA 3HSJA 2HHXA 2VQEF 4OI6A 4ECUA 4ED8A 2F9JA 2YH1A 4NLSA 2IAJA 3MR2A 2FZKB 4X2BA 4J90A 1XMQF 4XDDA 4BDPA 1UEKA 5E7OB 1ZM3A 4HDGA 5KG2A 2KG0A 2AEMA 3X1LB 2DXEA 4YN3B 3NLCA 5F8MA 3IRXB 1TQLA 2AKWB 5HMXA 1CJUA 3M7VA 2XY6A 6FDRA 3FEYB 1BQMB 3D3CJ 2KKHA 3RB0A 4XPEA 3GYNA 4MIAA 5HMWA 3K5NA 5KFYA 5LMNF 2HFVA 3KLHA 3DOLB 2NSCA 2ZD1B 2W25A 1DY3A 2GAGC 3D6TB 1U6ZA 2EKNA 2YQ1A 4W98A 3QZ8A 1ZH5A 3WX8A 2AJQA 4ETXA 5T14A 2XMKA 1Q86T 2XHCA 5KG3A 1PC4A 1C1BA 4JB8B 3T5JA 4RW9B 3VZHA 1HNIA 1RADB 5GAEI 3WC2A 4ZK7M 2BJ8A 2AZ3A 3H2UB 1BUXA 2R2RA 4LF8F 1RHJB 4P7VA 4ECYA 4OLPA 3AODA 3CCZA 2E7VA 1FVQA 2KDOA 4KGVB 4NRTA 4KC5A 5EUHA 4WIIA 4DV2J 4HL9A 4IRCA 4IH7A 1MSWD 3IBWA 3VGTA 2BOAA 3I5CA 2DIUA 4DL3A 3TP2A 3R7SB 2PMWA 1TP7A 1XC9A 1LW2B 1RXOB 3MAHA 5H9EK 1H72C 2MQQA 4JV0A 1JLFB 1O5JA 2ZC3A 3W5XA 2JVOA 3CDUA 4DU8A 4M5DB 2HQ3A 2HWTA 3JTNA 2KYXA 2XI3A 4KHMA 1WOPA 5I3QA 4ILRA 4P10A 1MNEA 4GO7X 4FYWB 1AFIA 2PEHA 3PNIA 1IKWB 3LP0A 2B0GA 3ETMA 2RVJA 1F9FA 5E0OA 4USWA 2J8AA 4C11A 1T9VA 3QJLA 3I55S 2KU7A 3AXMA 2DB1A 1UFWA 2OPPB 2RDIA 4CDIA 2ZDPA 2BVZA 3DXBA 1EETB 1HIYA 4LVNP 2RKIA 2UV8A 5ETNA 3BEGB 2ZOMA 3EICA 1UCNA 5M2RA 3OTCA 3JSYA 1YJWS 1C0TA
chains in the Genus database with same CATH topology
2QLFB 2H65B 2FQQB 2DKOB 1RHMB 2QL7B 2HBRB 2XYGB 2QLBB 2XYHB 4DCOB 2XZDB 2C1EB 1RHUB 2CDRB 1RWVB 3IBFB 1RWPB 4DCJB 3QNWB 2H4WB 2H51B 2HBQB 3KJQB 3P45B 1RHQB 5IC4B 1SC3B 3RJMB 1RE1B 1RWNB 3GJSB 3D6FB 1QDUB 1BMQB 2QL5B 4ZVPB 3R6LB 4ZVOB 2QL9B 1RHRB 2CJYB 3D6HB 3P4UB 1RWKB 2HBZB 3D6MB 3SIPB 2C2OB 1PYOB 1QTNB 4JB8B 1I51B 4ZVQB 2HBYB 3KJFB 3R7NB 3EDQB 2CNOB 2H54B 4ZVTB 2CJXB 5K20B 2QLJB 1RHJB 2XYPB 2H5JB 4ZVRB 1PAUB 1NMEB 3R5JB 1GFWB 2CNLB 1F9EB 1ICEB 3IBCB 2Y0BB 1RWXB 3NS7B 2H5IB 2CNKB 2P2CB 3EDRB 2Y1LB 3GJRB 1IBCB 2XZTB 4DCPB 2C2KB 4ZVSB 3KJNB 1RHKB 2H4YB 1SC1B 2C2MB 3R7SB 1RWOB 3R7BB 1SC4B 2CNNB 5IC6B 2H48B 4LSZB 1RWWB 3R6GB 3GJQB 1RWMB 1I3OB 3GJTB 4ZVUB 2C2ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLF B;  2H65 B;  2FQQ B;  2DKO B;  1RHM B;  2QL7 B;  2HBR B;  2XYG B;  2QLB B;  2XYH B;  4DCO B;  2XZD B;  2C1E B;  1RHU B;  2CDR B;  1RWV B;  3IBF B;  1RWP B;  4DCJ B;  3QNW B;  2H4W B;  2H51 B;  2HBQ B;  3KJQ B;  3P45 B;  1RHQ B;  5IC4 B;  1SC3 B;  3RJM B;  1RE1 B;  1RWN B;  3GJS B;  3D6F B;  1QDU B;  1BMQ B;  2QL5 B;  4ZVP B;  3R6L B;  4ZVO B;  2QL9 B;  1RHR B;  2CJY B;  3D6H B;  3P4U B;  1RWK B;  2HBZ B;  3D6M B;  3SIP B;  2C2O B;  1PYO B;  1QTN B;  4JB8 B;  1I51 B;  4ZVQ B;  2HBY B;  3KJF B;  3R7N B;  3EDQ B;  2CNO B;  2H54 B;  4ZVT B;  2CJX B;  5K20 B;  2QLJ B;  1RHJ B;  2XYP B;  2H5J B;  4ZVR B;  1PAU B;  1NME B;  3R5J B;  1GFW B;  2CNL B;  1F9E B;  1ICE B;  3IBC B;  2Y0B B;  1RWX B;  3NS7 B;  2H5I B;  2CNK B;  2P2C B;  3EDR B;  2Y1L B;  3GJR B;  1IBC B;  2XZT B;  4DCP B;  2C2K B;  4ZVS B;  3KJN B;  1RHK B;  2H4Y B;  1SC1 B;  2C2M B;  3R7S B;  1RWO B;  3R7B B;  1SC4 B;  2CNN B;  5IC6 B;  2H48 B;  4LSZ B;  1RWW B;  3R6G B;  3GJQ B;  1RWM B;  1I3O B;  3GJT B;  4ZVU B;  2C2Z B; 
#chains in the Genus database with same CATH topology
 1D9D A;  3Q23 A;  1TAU A;  4OX9 J;  5IT9 Y;  3B4M A;  1RHU B;  2DYA A;  2CDR B;  4NYZ A;  3DRS A;  3G87 A;  2CJB A;  2HFN A;  2PC6 A;  1T05 B;  1RAO A;  5KT6 A;  2UVU A;  2HHW A;  5KFG A;  1KQS R;  5G0R B;  2YTC A;  3ISN D;  3CSK A;  1RK8 A;  3CCE S;  4U95 A;  1YRU A;  5AXK A;  4ZCI A;  3CGI A;  1PJ7 A;  1Y3J A;  2PMH A;  3CJK A;  4ZP7 A;  1RTH B;  4B3S F;  4QBU A;  4UUX A;  2GHV C;  4Y0F A;  3OLB A;  4QZV B;  2RS2 A;  4CLS A;  4BLG A;  4RR5 A;  1KS2 A;  2B4V A;  1K44 A;  3F41 A;  2R2U A;  2WON B;  1LFW A;  4M5J A;  2JC1 A;  1TVR B;  1FX2 A;  5KFK A;  2ZH1 A;  3G8S A;  3NGK A;  3PYF A;  2GW8 A;  2V9W A;  1NK9 A;  4I64 A;  3H90 A;  5F9N A;  4NL5 A;  1UW4 A;  1LK5 A;  4WWS A;  2CUY A;  3CJ2 A;  3FBF A;  3IMQ J;  5KG6 A;  5EWF A;  4WP9 A;  1DRZ A;  4DR7 F;  3GTY X;  2GS8 A;  3FEX B;  5AJ3 F;  4CLL A;  4ZP9 A;  1RAA B;  1VQN S;  1JKH A;  3BGR A;  2XZW A;  3WC0 A;  1NSP A;  3L3C A;  2FHJ A;  2DEJ A;  9RUB A;  3RRH A;  4C7Q A;  4R8U A;  4GO5 X;  4AUK A;  4D3H A;  4JI3 J;  5FII A;  1TL7 A;  1EQ0 A;  2GCF A;  3O2I A;  1MW7 A;  4A4J A;  2W8K A;  2GQC A;  4NLO A;  4ED4 A;  1WC4 A;  1FDB A;  1F5C A;  2YKQ A;  2CIM A;  4F4Y A;  2HRU A;  4B9N A;  4GKK F;  2IVM A;  1V3Z A;  2W4P A;  2Y1L B;  4EZ6 A;  4CO4 A;  2HZV A;  3MAA B;  4TN2 A;  2QSW A;  1EAR A;  1RTD A;  1CJV B;  5ETS A;  2F8E X;  3B54 A;  2E7W A;  3A8J A;  2J6U A;  1I5O B;  2BKN A;  1XMO F;  3K7R A;  1QVF R;  4QU7 A;  1GEH A;  2GO9 A;  2DKO B;  3CTR A;  2ZWO A;  2N3O A;  1AZS B;  3F73 A;  3DLK A;  3QYY A;  5E41 A;  2V8P A;  3SCK E;  1YWX A;  4AND A;  1HMV B;  4JI1 F;  2GAH C;  5DDR C;  3Q8Y A;  2VA2 A;  1FKA F;  4USK A;  2WCX A;  4K4S A;  1FER A;  2GMJ A;  2HAF A;  1OPI A;  2XMV A;  3T1Y J;  3TX8 A;  2UXD J;  3HFZ B;  1PSD A;  4B9V A;  3CCV S;  1FE4 A;  3EZU A;  4ZPC A;  3CT9 A;  2WZ1 A;  2AV5 A;  2AIR B;  2XHW A;  3TZZ A;  1EX8 A;  1UL3 A;  1LNQ A;  2BQU A;  4PXD A;  1X4G A;  2DXD A;  2MKJ A;  3O3L A;  3H98 A;  2BW7 A;  2JC0 A;  1X9M A;  2DPJ A;  4O23 A;  3HCX A;  2VDI A;  4X62 J;  4OYW A;  4IG0 B;  3H5U A;  2VQF J;  4U67 Q;  3IRX A;  4YB7 A;  2L41 A;  1BQM A;  1FI4 A;  3LPY A;  1NSK L;  4IFY B;  3DCA A;  5A6P A;  2RHS B;  3WBZ A;  2JLF A;  2V2V A;  3D0I E;  3DOL A;  2RUS A;  2ZD1 A;  3MCO A;  5F8L A;  1IKY B;  4DF4 A;  4L76 A;  2O67 A;  4X66 F;  4F2S A;  2AJ0 A;  1NXI A;  3BBC A;  3CWJ A;  2V9K A;  1I94 J;  1SL0 A;  4FBU A;  2CVE A;  2F40 A;  2G2Y A;  3VAF A;  4F4X A;  4YY3 F;  2RD5 C;  2K7K A;  4RW9 A;  3ZTQ A;  2QL5 B;  1FFS B;  1S79 A;  3RB3 A;  5KFF A;  4UOG A;  2B9E A;  1U0H B;  1JXV A;  3GV5 B;  4JI7 F;  2LQ9 A;  4CT9 A;  1HQE B;  3BN4 A;  5K8O A;  3DLG B;  3MCS A;  2Y1I A;  2EFO A;  1U26 A;  4USI A;  3QRQ A;  1HFE L;  1LW2 A;  2ZFH A;  3MPU B;  4MKA A;  4HLB A;  4HT7 A;  1N4L A;  5HRO A;  2HVZ A;  3G71 S;  4TYA A;  5GME A;  5KFB A;  5L1K A;  4M5D A;  3EXY A;  1QTM A;  1RSC A;  1CUL B;  4C8Y A;  4M63 A;  4O3O A;  4HH1 A;  3QFW A;  3BKF A;  2IBK A;  1D0E A;  1IKW A;  2XSJ A;  2DNO A;  4WP8 A;  4U9R A;  5LSO A;  5KFR A;  2WOM B;  2PO4 A;  4Y65 A;  3OD2 A;  2HHH J;  2W2P P;  3BZQ A;  2BKP A;  3KLV A;  4EYI B;  4C8K A;  4E2F B;  2JFK A;  1A0O B;  2OPQ B;  1OY8 A;  2KO1 A;  2NYI A;  2OPP A;  4ECQ A;  1DBD A;  4FVM A;  5LXR A;  2FC9 A;  4NZ0 A;  4LF2 A;  3ZZ0 A;  2E1M C;  3KG1 A;  2MMY A;  3L7P A;  4CQ1 A;  3TX0 A;  1RZM A;  1K1S A;  4NLW A;  4DSE A;  2HLT A;  2OSQ A;  1S1U B;  1R0A B;  2RHQ B;  4EGL A;  3WDO A;  2EPI A;  3K5M A;  4LBI A;  3KXD A;  3VZI A;  3O8W A;  2KT5 A;  2C42 A;  5D4P A;  5J2M B;  5H9E J;  3UCU P;  1D9A A;  1Y00 A;  1M1G A;  4EO8 A;  2DNY A;  1SPB P;  2CNN B;  2DO4 A;  3PW4 A;  3OUY B;  4DR5 J;  1U1K A;  4HH0 A;  4QIW D;  1XNQ F;  1T05 A;  2GIF A;  4ZMM A;  2ZE2 B;  5G0R A;  5DGB A;  2R3V A;  3R5D A;  1N54 B;  1U48 A;  2QYG A;  3RBD A;  1FJG F;  3NNA A;  5K5M A;  1IKV B;  5IC4 B;  4FP9 A;  4DV7 F;  1RTH A;  2AJ4 A;  2YNH B;  1ZAW A;  4DSJ A;  2V8H A;  1SVD A;  1C0U B;  4ELV A;  3W5Z A;  2J76 E;  4LRB A;  4GC7 A;  1PCA A;  1QAJ A;  2HK2 A;  5C24 B;  2CJK A;  3LQV A;  4J9L A;  1K0T A;  4C98 A;  1NND A;  1TVR A;  4DV1 F;  3N6M A;  1ARO P;  5JMN A;  4RPF A;  3X3U A;  3PKY A;  2QTW A;  3TR5 A;  3EDR B;  2EW9 A;  1S6P B;  4FYX B;  2KL8 A;  5HBM B;  1EJ7 L;  3O1L A;  2MLY A;  1ZM4 A;  5C42 B;  5IC6 B;  1K0V A;  2R42 A;  4Z2X A;  1UPM B;  2VPZ B;  3HSZ A;  2WW4 A;  2VD3 A;  3SSS A;  1WI6 A;  1KQG B;  1VK3 A;  5KFD A;  3GIM A;  4DV5 F;  4WFX A;  4QWE A;  4FPI A;  1Q7Y T;  1WHW A;  3SV4 A;  1M1H A;  3HMJ G;  3PX6 A;  2Y9H A;  3NCP A;  2LKZ A;  3IM8 A;  2E5L F;  2LU1 A;  4EO6 A;  2VIH A;  2ADB A;  3NL0 A;  3FGV A;  3D6M B;  3BKU A;  4X64 J;  2XB2 D;  4MK8 A;  4EYH B;  1S7I A;  2A10 A;  1UVI A;  2MJN A;  3H8Y A;  4C3L A;  4UQG A;  1RT5 B;  3PEJ A;  1R0B G;  3TAP A;  1SJR A;  2GJF A;  1CJV A;  2DD8 S;  5F3Z A;  4ZIW A;  1UAW A;  1REV B;  2LQ8 A;  2FLN A;  1R8C A;  3OTO J;  3FC9 A;  1WEX A;  4QWC A;  2BQ3 A;  3CCM S;  3MEE B;  1VQ9 S;  4B3M F;  3RR8 A;  1FKO A;  3U02 A;  2GGP B;  3BS9 A;  1AZS A;  1FTC A;  4B3R F;  5MLC V;  3BF4 A;  1HMV A;  3CVK A;  2F1F A;  2E1P A;  2HNZ A;  3AA9 A;  4DCO B;  3PFE A;  3CCL S;  3I31 A;  4B3T F;  1FD8 A;  5DET A;  3PJ9 A;  2YKP A;  2L08 A;  2QZ8 A;  1HW9 A;  2EFG A;  5DDO C;  3R5G A;  4ELT A;  3QO9 B;  3GFH A;  2HIY A;  3OHB A;  1Q8K A;  3BQ1 A;  1IVZ A;  2XO7 A;  1WG4 A;  3KDO A;  3ISN C;  2CPJ A;  2MQM A;  3DRP B;  4KHP J;  4PWU A;  1VRU B;  1APS A;  1QAI A;  2ZIT A;  2IVY A;  1HNZ J;  1ZYQ A;  1XR6 A;  2LXI A;  2VUG A;  4DV4 F;  1FWK A;  1NME B;  4UY8 T;  3HM9 A;  4WP3 A;  3M8Q B;  4UZC A;  4OZ1 A;  2IA6 A;  2Z2Y B;  3HLU A;  4X65 F;  2DGQ A;  1QUP A;  3EVO A;  2PEB A;  1ZA1 B;  1FF2 A;  3U1M A;  1VQP S;  1HWI A;  2Q43 A;  5KFT A;  3BH7 B;  3RB4 A;  1IKY A;  3M2V B;  1JLC B;  2GHP A;  1RWU A;  2MKK A;  2EI5 A;  2EK1 A;  4OYZ A;  4P75 A;  1HR0 F;  1U1Q A;  3A1Y G;  3BGL A;  3J7Y U;  2Z0G A;  2C22 A;  3C8Y A;  4DF8 A;  2HK3 A;  4KYZ A;  3MM9 A;  1U45 A;  1KR4 A;  4WF9 Q;  1U0H A;  2AEJ A;  1RAF B;  1A7G E;  4X4U A;  5L38 A;  4EFA C;  1LWX A;  2W8L A;  3DGV A;  1S1W B;  4PAB A;  3UDV A;  5IZH A;  3DLG A;  5KFA A;  1FXR A;  3R1H A;  1CC7 A;  4QJV A;  1QM9 A;  1X5T A;  4G65 A;  2I0X A;  2K1R B;  2ZH7 A;  1Q5Y A;  3S8S A;  5KFJ A;  1JLQ B;  2M2B A;  2CJA A;  4DFM A;  2Z58 B;  3H5S A;  3CDA A;  2ZM6 F;  4L72 B;  1UVM A;  1AA1 B;  2E29 A;  2VOP A;  4CO1 A;  4DR4 F;  3N79 A;  3DI6 B;  4KQZ A;  1CUL A;  2YX7 A;  2PDA A;  4J9Q A;  2NXC A;  3IXQ A;  2GJI A;  2D3O R;  2IHR 1;  4NE9 C;  4C0B A;  2YXL A;  3GWC A;  2DR8 A;  4LQ3 A;  3MGJ A;  3GJT B;  2K3K A;  1PC5 A;  1V3R A;  2GV1 A;  3OJU A;  1LEO A;  1N5Y B;  2H65 B;  2E5G A;  2WOM A;  2WAQ D;  3I4P A;  3RUB L;  2V4Q A;  4LBP A;  4KY3 A;  3QNW B;  4J9P A;  3CME S;  1Q5V A;  5EDW A;  3P45 B;  2OPQ A;  2CQC A;  1HBM B;  4PR6 A;  1DFD A;  1V3S A;  2G2O A;  5C7P A;  2H1Y A;  3R6L B;  4ECS A;  2FLP A;  4EWT A;  3RTV A;  5IV4 A;  3OR2 B;  3S01 A;  3OW2 R;  1R0A A;  3FSY A;  5EHH A;  2RE1 A;  3TAN A;  3LP1 B;  4QIF A;  1CQN A;  2CG8 A;  2VOO A;  1KON A;  2C28 A;  3RAX A;  3ONQ A;  4HHJ A;  2CQP A;  2EFV A;  4PUO B;  3ENW A;  5LMN J;  1Z1Z A;  3PR5 B;  3ILO A;  3A3P B;  3UVJ B;  4LFA F;  1EQM A;  2AJF E;  3PG9 A;  2W2M P;  3CUN A;  3T3F A;  3A3O B;  2C3O A;  4MK9 A;  1HWL A;  4K59 A;  4NLQ A;  3OFG A;  5E3R A;  2R9L A;  4KFB A;  2F65 A;  2KRR A;  2RU3 A;  2OPR B;  4LF8 J;  4V1A k;  2Y8W A;  2YNH A;  4F02 A;  4KV8 B;  4KPY A;  4LFB J;  3CDE A;  3P6Y C;  4C8O A;  5KT2 A;  5I42 B;  2ZHB A;  5C24 A;  3ZZY A;  2G1H A;  3J81 j;  2ZH6 A;  1IJF B;  2KM8 C;  1YRX A;  1X8D A;  3VF0 B;  3MMB B;  4PXE A;  1S7H A;  1QTN B;  5JUM A;  4LSL B;  2IMW P;  4ECX A;  3U7J A;  5FLX U;  8RUC A;  1C4A A;  4C3M A;  2HGM A;  1TFW A;  1GXU A;  3FBB A;  1S6P A;  3BO2 A;  5HBM A;  4A8M P;  1I6J A;  2CXE A;  1GMW D;  5E3C A;  4EUV A;  4IOA Q;  5C42 A;  2MZT A;  5EWE A;  4MTP A;  3BSN A;  3MM8 B;  4ZOS A;  4J9V A;  4LR7 A;  2E9R X;  2YWW A;  3TVY A;  3BYR A;  4LRD A;  4Z37 A;  1VQ7 S;  5CA5 A;  1KVJ A;  5ADZ A;  3Q86 A;  4QPX A;  5HAT A;  5HJY A;  2MZ1 A;  1T8E A;  3CED A;  4M8L A;  3HVT B;  3V6D B;  4WK3 A;  2HFZ A;  1OQ3 A;  1IUJ A;  2A6O A;  2VHG A;  2RT3 A;  3PAC A;  2VU5 A;  4NZ7 A;  2RU9 A;  4QW9 A;  4E98 A;  2CPY A;  3DXS X;  2JX2 A;  4Q8E A;  3IA0 A;  4WFZ A;  1RT5 A;  4ZPT R;  2VAS A;  1Q8L A;  2CPX A;  1REV A;  2E5J A;  1TFY A;  3QGI A;  2M5Y A;  3FEZ A;  4RW6 B;  4XDC A;  1P1L A;  2RB7 A;  2XGQ A;  2ASD A;  1MLA A;  2CQ2 A;  1U7L A;  1KDN A;  2F7V A;  4ZA1 A;  4Q2L A;  1FKP B;  3DNC A;  3FDS A;  1SC1 B;  3PJW A;  3PX0 A;  3WQP A;  4JI6 F;  1L3U A;  3ZXW A;  4B3S J;  1UVJ A;  4NRU A;  1SC6 A;  2CWX A;  4O44 B;  2KZM A;  3C15 A;  3QO9 A;  2F3J A;  3ZTS A;  4EBE A;  1FNX H;  1R8A A;  2IPO B;  3PIP Q;  7AT1 B;  2ACY A;  2MKI A;  2YVS A;  3DRY A;  1Q0N A;  1SC3 B;  5JVG Q;  5D3G A;  1TL1 B;  4ED1 A;  2DR9 A;  4KHR A;  1U09 A;  1HNX J;  4DV3 J;  1JIH A;  3DRP A;  1VRU A;  3UW1 A;  3QRR A;  3HHE A;  4F3O A;  3MZI A;  1X7V A;  5HQM A;  3D54 A;  3ZZZ A;  4XAK A;  3VAI A;  3V4I B;  1QAX A;  1FEH A;  3M8Q A;  1H74 A;  5HLF B;  3W65 A;  3LTO A;  1WC6 A;  2R7R A;  1FXL A;  5IM0 B;  2D1C A;  4DR7 J;  1S57 A;  3TAM B;  3G8Q A;  2YWK A;  4UZB A;  3M2V A;  1JLC A;  2P2C B;  4YHH J;  1WF2 A;  2MHE A;  4TLR A;  3CCU S;  2XM3 A;  2V4R A;  4K7Q A;  1SIZ A;  3KDN A;  1LWE B;  2NXU A;  4DPT A;  3E01 B;  1VBZ A;  3EPI A;  1S0V A;  1RAC B;  3TVZ A;  2LVW A;  2H48 B;  2KG1 A;  4L3K A;  4KGX B;  3Q8R B;  2RSQ A;  3V6H A;  1SB6 A;  3MEG A;  1UTA A;  2P9C A;  3M6V A;  4P73 A;  3MED B;  3HFV A;  4ZVE A;  3FUY A;  2DK2 A;  1S1W A;  2EVZ A;  3AAW B;  4R0J A;  2OSR A;  4GKK J;  5GAD U;  1P9Q C;  2K1R A;  1HI8 A;  2GMH A;  2R7W A;  4RL1 A;  4ZCL A;  1JLQ A;  4PG5 A;  4ZCK A;  1JQG A;  4RW7 A;  4WJB A;  4DL6 A;  1M5V C;  2E66 A;  4OHY A;  4FF2 A;  1F9H A;  3R7N B;  1SKS A;  1BQN A;  1S59 A;  3K2Y A;  3QZ7 A;  3FFI B;  2I38 A;  4GVL A;  2PN6 A;  4WU2 A;  5HQ8 A;  4DUZ F;  1TUG B;  3NS7 B;  4OX8 A;  4AYB D;  2JRS A;  4KPC A;  5DGA A;  2FGO A;  2UUC J;  3JTP A;  1C1C B;  4ED5 A;  3NOG A;  4DX5 A;  3GJQ B;  4B17 A;  5B0G A;  4P2X A;  2AD9 A;  1HBM A;  1GTH A;  3UO0 A;  2Q1L A;  2QIF A;  3FZ2 A;  2PFD A;  4IG3 B;  5HO4 A;  3PO4 A;  3HZG A;  2BV3 A;  3OR2 A;  4YB5 A;  4DR6 F;  3THP A;  2FB0 A;  3MEC B;  4NPO A;  2XS2 A;  4IUF A;  3LP1 A;  1PO6 A;  2J8S A;  3MMA A;  3HSD A;  3K8W A;  2DNR A;  1RWK B;  1AYE A;  3C6U B;  3M8W A;  1S1V A;  4Y6I A;  4PUO A;  2Z2L A;  4DX7 A;  3HFK A;  3OXL A;  3UI3 A;  2PE8 A;  1VOM A;  3V5R A;  4PQA A;  3UVJ A;  2E1C A;  5CYQ B;  4ZPW R;  4ED0 A;  3VHQ A;  1RT7 B;  4LF9 J;  2LA6 A;  4ANC A;  4YY3 J;  2GIR A;  1RIS A;  3OTD A;  1X9S A;  2QRR A;  4H4M A;  3MMC A;  4K2J A;  2C2M B;  4X4P A;  2DTJ A;  1SKU B;  4KGK A;  3BO4 A;  1X4B A;  1PAE X;  1YZ6 A;  2CPD A;  4KV8 A;  3ZTR A;  1VRT B;  1IWA A;  4A47 A;  2L48 A;  4FDF A;  3M32 B;  2I9S A;  3R8Y A;  1M90 T;  5I42 A;  4Y3C A;  3H0P A;  4KT0 C;  3G9C A;  3QRP A;  2J9D E;  3KUH A;  2YWG A;  1CG2 A;  1PGZ A;  3GCW P;  1NO8 A;  1M5P C;  1N34 F;  1LWC A;  3MMB A;  2MGZ A;  1JJ2 R;  4EZ9 A;  3DU5 A;  3TOQ A;  4LSL A;  5GAG U;  3CJ0 A;  1RT1 B;  2YX4 A;  4TU9 A;  4ES1 A;  3KK2 A;  4LUB A;  4RLE A;  3EUN A;  2D7S A;  3N4W A;  3DLL Q;  3NS5 A;  4KBI A;  4DPY A;  2XSF A;  3MM8 A;  4TLQ A;  1AXQ A;  4F04 B;  1WC0 A;  3AJD A;  3J81 Y;  1FFG B;  1F9E B;  2J0S D;  2V2Z A;  5ETR A;  1TUV A;  8ATC B;  3PO5 A;  2NSB A;  5HN0 A;  2DIT A;  4ZIT A;  1NJY A;  4A8F A;  1RDR A;  2MKH A;  3HVT A;  3V6D A;  1HW8 A;  3RRG A;  2QO3 A;  2VJU A;  2ZBC A;  3EX7 B;  2J6T A;  2AYG A;  2U1A A;  1F5A A;  4NA3 A;  3DGP B;  5T7L B;  4J5O A;  3Q24 A;  3FRY A;  3UE2 A;  4P52 A;  3TWZ A;  5CYJ A;  1TKT B;  1LWF B;  2VFU A;  4RW8 B;  1WKJ A;  4QIV A;  2ALY B;  3B6B A;  2DNZ A;  4UF4 A;  4OI1 A;  5D77 A;  2DGW A;  2QA4 S;  1RAJ A;  1KP6 A;  4HHH A;  2DGS A;  1SKR A;  4P6Q A;  1YBA A;  4RW6 A;  2CFX A;  4F36 A;  2Q6C A;  4QR1 A;  2W9A A;  3KJF B;  3IR5 B;  2VBZ A;  1KD1 T;  1FKP A;  3M6W A;  4NEZ A;  1FA0 A;  3QQC D;  2PT0 A;  5MAO A;  3I82 A;  2DR6 A;  1S6U A;  2X1G A;  4DV7 J;  5AE3 A;  3DU6 A;  3LH2 S;  3BR8 A;  1NB7 A;  1Y7P A;  4FYY B;  4O44 A;  2ZBI A;  1YJU A;  4RX6 A;  3AOC A;  3VAG A;  4MIW A;  1UFK A;  4DR2 J;  5F3T A;  3J80 Y;  1TKD A;  2BM0 A;  2C2Z B;  2C2E A;  4I1T A;  5KFN A;  1RU1 A;  1TL1 A;  4F7V A;  3QIP A;  4JYA F;  1IN0 A;  2HPU A;  4JI8 J;  1WEY A;  4TY8 B;  5DG9 A;  4HYK A;  5IWA F;  2FLO A;  4J9N A;  2X51 A;  3UFC X;  1L3V A;  3UN3 A;  3V4I A;  1HD1 A;  4HAC A;  2APO A;  4FYD A;  4QWA A;  2MDA A;  4JV5 F;  2W7A A;  5HLF A;  1A9N B;  1N32 J;  3JSR A;  3KHL A;  5IM0 A;  2RAQ A;  3TUP A;  3D1O A;  2HHQ A;  2B5J B;  3TAM A;  3DLH A;  3EVW A;  2W2Q P;  3SYZ A;  3FJ2 A;  1S0M A;  4V19 X;  3TAQ A;  2KJW A;  4DV5 J;  4WCE Q;  4K4W A;  1HD0 A;  1AB8 A;  4DLG A;  2RJZ A;  1K47 A;  3BGO P;  4ENO A;  3SMZ A;  1Q53 A;  4O3Q A;  2NLW A;  4NI2 B;  1TTH B;  4Q8F A;  1UWB A;  5C2C A;  1RUS A;  1VGY A;  2HWI A;  1QJH A;  3SV3 A;  1YK9 A;  1HNW F;  1GXL A;  3EYZ A;  3RW6 A;  3UR3 C;  1R27 B;  5CHC B;  3MED A;  2V6A A;  3CD6 S;  1LV5 A;  2OEJ A;  2Z2M A;  3D28 A;  4XO0 A;  3KK1 A;  4NCG B;  3JSM B;  2BBE A;  2VG7 B;  2QMX A;  2RDJ A;  3CMQ A;  3C14 B;  5K8N A;  3GCX P;  2J0X A;  2BDP A;  2AJ2 A;  2FJX A;  4B3M J;  1FXD A;  4OV1 A;  3BRE A;  1NEE A;  5I3P A;  1GMW A;  3S7R A;  3PW0 A;  3SIP B;  2G9O A;  1HKA A;  3GON A;  3MOJ B;  1AUS L;  4ES3 A;  3UN2 A;  2WBM A;  4NMX A;  5AT1 B;  3BPS P;  4ZJQ A;  4B3T J;  3KMS A;  2LQJ A;  4JI0 F;  1SI9 A;  4YFU A;  1MWY A;  2XBP A;  2ATC B;  1C1C A;  1SH3 A;  3MUT P;  5B08 A;  3K59 A;  2IDE A;  1YG0 A;  3GJR B;  2WK4 A;  1PIL A;  3EE3 A;  4K4U A;  2QX0 A;  3MCM A;  4FNH A;  6FD1 A;  2GVD B;  2LEP A;  1H98 A;  1KLN A;  1RTI B;  4IG3 A;  3VAM A;  2YPZ A;  2F4F A;  3TW0 A;  3HHN B;  4DPW A;  2FVQ A;  3TA2 A;  1UJ6 A;  1FK9 B;  3A8I A;  2IYI A;  4RNM A;  3MEC A;  2EK6 A;  2KH9 A;  1VR6 A;  4OLO A;  4DV4 J;  3FSI A;  2FGC A;  4Q0B B;  3TQ1 A;  2DXF A;  1JMT A;  2MQO A;  5AE2 A;  5L1J A;  1NRK A;  1R0C B;  3VAJ A;  2FHM A;  1KLM B;  4X65 J;  5FJ4 A;  3DLJ A;  1RCO B;  4IR1 A;  3NNH A;  2HWH A;  1J5E F;  1QLN A;  3LO3 A;  1W2B R;  1ZPV A;  2XMM A;  1U8W A;  1RT7 A;  3CE8 A;  1ZTT A;  1HBN B;  4Q44 A;  4DX8 H;  2LFV A;  1SBR A;  3NBP B;  3KUE A;  2IIH A;  4A8Y A;  3BB5 A;  2UUB F;  4PYD A;  2PII A;  4NLR A;  1FDN A;  2OTL S;  4K5S A;  2B9W A;  2CNK B;  2M0G B;  3HVR A;  2XI2 A;  1VRT A;  4ECT A;  1VHI A;  3EWG A;  1RHK B;  1B70 B;  1SCJ B;  1MN9 A;  4OI0 A;  2QSF A;  4RNO A;  3LPE A;  1G7C B;  2RML A;  1JXE A;  2YY3 A;  4A8X A;  4UQT A;  5HVH A;  5IFM A;  4OYA A;  2MQ8 A;  1R89 A;  4I7F B;  1HAR A;  1O8B A;  1U24 A;  4PG6 A;  3L9Z A;  3K17 A;  2ZM6 J;  2VON A;  1RT1 A;  2RQM A;  3UD5 A;  1S5Z A;  1VDH A;  4DR4 J;  3LA0 A;  3D7S B;  3UNG C;  1NU4 A;  3TEH B;  2ZBP A;  4OL8 A;  4MFB B;  4G6V B;  3DC2 A;  3T6B A;  4YOE A;  5GVQ A;  1MWQ A;  3GMG A;  3HHL C;  3VGS A;  2E7X A;  3M4X A;  5A8W B;  4DQR A;  4JP8 A;  2V2Q A;  2R8I A;  4BC9 A;  1G2E A;  4O3R A;  5EX0 A;  2M70 A;  1U1R A;  1LXJ A;  1RLD A;  3GFX A;  4YR2 A;  3BBB A;  3P5B P;  2AWZ A;  2IM0 A;  3U1L A;  2AHO B;  1U1O A;  2C3P A;  3JS9 A;  2EKY A;  2UV8 G;  3VVU A;  4DWI A;  4LF6 F;  4A8S A;  2IBO A;  4LF4 F;  4DL5 A;  3NOC A;  3DGP A;  5T7L A;  1F5B A;  3QWU A;  3UPF A;  1TKT A;  1ZZF A;  4F4K A;  4ZVU B;  4K4Y A;  4RW8 A;  1NZ8 A;  2NXE A;  2HBR B;  3LF0 A;  4IH5 A;  1RAI B;  1V6H A;  3G82 B;  4ZVF A;  4JI5 J;  1XER A;  2J9C A;  2Z30 B;  3M9O B;  5CCM A;  3GG1 A;  2CQG A;  2WVF A;  4XTT A;  4UOH A;  2EFP A;  3HUL A;  1SUQ B;  4NLT A;  3TZW A;  1S12 A;  2BE7 D;  3TZX A;  2CAJ A;  1OMS A;  2FVR A;  4AL6 A;  2M3D A;  3G86 A;  1TKZ B;  2KHD A;  3Q8S B;  3EGV A;  3L7O A;  3M8P B;  1X60 A;  5D4O A;  1KKH A;  5KOW A;  2BQR A;  4A8O A;  2NQP A;  3DMJ B;  3C46 A;  1HLW A;  4MAK A;  4IO1 A;  1VQM S;  2IRU A;  1N0U A;  4USM A;  5DS7 A;  3SDE B;  2DRB A;  1QUV A;  4DZ6 A;  1BE4 A;  4DXL A;  5DDP C;  1RTZ A;  3QLH A;  1HNV B;  4TY8 A;  2VL1 A;  3AQP A;  3PTW A;  4DBQ A;  4FZV A;  5DJB A;  3IR6 B;  2MXY A;  3PXG a;  3FCH A;  4QCL A;  5D0E A;  2VH7 A;  3NRB A;  4CLF A;  3GR1 A;  3HHD A;  4ZPA A;  2FLL A;  4F0H A;  3JAM U;  2P5V A;  4OI3 A;  2BX6 A;  3THV A;  2B5J A;  3F56 A;  3ZZO A;  1TR0 A;  2NYH A;  2P6S A;  4F3M A;  1LW0 B;  1WC1 A;  5A8R A;  1NAQ A;  1GMU A;  4CP5 A;  4EBC A;  4N8O A;  4DN0 A;  4OHW A;  4ZLP A;  5ETP A;  3FZB A;  3T1A A;  4NI2 A;  1X9W A;  2HRY A;  1O51 A;  4O4R A;  1N36 F;  4A46 A;  2JWN A;  1NJI T;  4ECZ A;  2YX1 A;  2DGU A;  3MHY A;  5DM7 Q;  4K0K J;  1S9E B;  1WG5 A;  4NCG A;  2KB2 A;  1ZS6 A;  1JLG B;  5D15 A;  4O4G A;  3IGN A;  1QVG R;  1VBK A;  1Q78 A;  2VG7 A;  4HHU A;  3H7H B;  4HKQ A;  3C14 A;  4TU8 A;  3IR7 B;  2KVI A;  5AXL A;  2Z57 B;  5KFH A;  3T6J A;  2HKE A;  3K57 A;  1KFS A;  2ABY A;  3R2C J;  4DUT A;  4DR1 F;  1GAO A;  3BGU A;  3M05 A;  1NK6 A;  2QA4 G;  4OJG A;  4LFC F;  3IG1 B;  3MM5 B;  3I9Z A;  2XMU A;  4K4T A;  1KNZ A;  1T9X A;  1C2P A;  2PI4 A;  2WSC C;  1OWX A;  4TU7 A;  1U25 A;  3C2P A;  2G2Z A;  4ZN3 A;  5KG0 A;  4WTO B;  3W63 A;  3IO1 A;  2G1D A;  3R2D J;  4FF1 A;  2NS1 B;  2CJY B;  4JI6 J;  3ET6 A;  4DI6 A;  3NMR A;  4N47 A;  4HTI A;  4GRS A;  5F8I A;  4KIA A;  1VQ8 S;  1GTE A;  1ZBT A;  1RTJ B;  3A8K A;  1YGY A;  4AQY J;  2JNJ A;  3N6N A;  3Q8U A;  3B78 A;  4R0E A;  3GG0 A;  2F4V J;  3K5O A;  2BAN B;  2VFS A;  4Q5V A;  4HDH A;  3WIU A;  2GVD A;  2HND B;  1RTI A;  2VDH A;  2H5I B;  2FJD B;  2HQC A;  2R2T A;  1NKB A;  1EZZ B;  5B0B A;  4G3I A;  3PY8 A;  1FK9 A;  3H2V E;  1NDL A;  3CMA S;  3AA8 A;  2YKA A;  3AOA A;  3R7B B;  3MEK A;  5IT0 A;  5SZT A;  5FDL B;  4X4V A;  4Q0B A;  1T11 A;  3TUJ C;  4ED7 A;  2EBG A;  5DQI A;  4ZJO A;  4LRF A;  3HX9 A;  1RLC L;  3I0R B;  1KLM A;  3GE9 A;  2RRN A;  3AH6 A;  1KVK A;  2PI5 A;  4O0N A;  4ZCM A;  1UWA A;  1S97 A;  4CLZ A;  4KKO A;  2IVF B;  3B4D A;  4WU3 A;  2VA3 A;  3RBX A;  1S1X B;  3VVT A;  1HBN A;  4FF4 A;  1WC3 A;  3NBP A;  4L73 A;  3GIL A;  3T5L A;  4DLE A;  3Q8V A;  2UVW A;  3OSN A;  1X5P A;  3N5B A;  4NXM J;  5ITH A;  3PW5 A;  5HSP A;  4B9M A;  4JV2 A;  5L46 A;  1TV6 A;  2ZHA A;  4KGZ B;  2DBB A;  4J7C A;  2AEF A;  2ZEJ A;  2HYI B;  1Y9O A;  3HKW A;  4C8N A;  2LXF A;  4U8V A;  1B64 A;  1T3O A;  1D1U A;  4I7F A;  3KK3 B;  2OI2 A;  4EEY A;  3EXC X;  4IRD A;  3VV2 B;  4B3O A;  4KAI A;  2V63 A;  1Q82 T;  1F6T A;  2DY9 A;  5J2P B;  4MFB A;  1O0P A;  2OJ3 A;  4DG1 B;  2Q6B A;  2ZBQ A;  5ETQ A;  1LK7 A;  1TL5 A;  4G1Q B;  4M5H A;  1RE1 B;  1QDU B;  1N8R T;  3O6Q A;  4ZVH A;  2DNP A;  3W66 A;  4LBH A;  3SSR A;  2LMI A;  2XO6 A;  2ZZT A;  5GAH I;  5HK4 A;  4LR9 A;  4XK8 C;  2A1B A;  5JVH Q;  3ELH A;  1ZM2 A;  4OYX A;  2B4U A;  1WEZ A;  3TQE A;  1PYO B;  1M0S A;  3W9I A;  5B0F A;  2D3Z A;  2R8J A;  4BBY A;  1CBK A;  3CCT A;  1QAY A;  1CS4 A;  3H4D A;  2N7C A;  1ICE B;  1XK8 A;  2YWF A;  2OP5 A;  4DMZ A;  1GMV A;  3MD3 A;  1TK5 A;  2ADC A;  5KFS A;  4PPD A;  3D3B J;  2VPY B;  4OX9 F;  1N6Q B;  4C97 A;  2E5H A;  1G4C A;  3R6G B;  4PWD B;  1I1G A;  1OQ6 A;  4DV6 F;  2AYM A;  4K4Z A;  1G3O A;  2FJB B;  3E3X A;  2PA3 A;  3RYL A;  4ZKA A;  1OYD A;  5DM6 Q;  1CC8 A;  1U2C A;  2ASJ A;  4M5L A;  1SUQ A;  3V6K A;  1V9O A;  2YNG A;  1J27 A;  3E2E A;  2EC2 A;  3VGV A;  1FRM A;  2JEG A;  5KFW A;  1RT3 B;  1TKZ A;  2OEK A;  4X4Q A;  3M8P A;  2CQB A;  2KXH A;  1U1P A;  1WDD A;  3THT A;  1YKW A;  2R7O A;  3KNG A;  3M6U A;  4GVB A;  4TY9 A;  3GFZ A;  3A4T A;  2GNK A;  1ZZN A;  4USU A;  4RNH A;  3ADA C;  1W26 A;  3GQC A;  3NGT A;  1N34 J;  3TA1 A;  2XY7 A;  2C3M A;  2DH7 A;  4Y2A A;  3FVY A;  4OJH A;  1HNV A;  3K5L A;  5KFL A;  2LA4 A;  4F26 A;  3QAT A;  4IO9 Q;  2YWH A;  5DQH A;  1GQE A;  1CVJ A;  3H59 A;  1GX5 A;  3L7U A;  2MPU A;  2ERR A;  1VQ6 S;  4ID8 A;  1SV5 B;  2P9E A;  3UCZ P;  2GML A;  1U4B A;  3P3D A;  2DT9 A;  4EMD A;  4DCJ B;  4I69 A;  1LW0 A;  5D6G A;  1RAG B;  1ZOT A;  2K3I A;  1P1T A;  2V5H G;  3J7Z 5;  4JI3 F;  4IQX A;  1RBL A;  1VQL S;  4YME A;  2G13 A;  1HHT P;  3D67 A;  3EVM A;  1M5O C;  5G4D A;  1Y5N B;  1ACM B;  4CH1 A;  4WXW A;  1JLG A;  4QR2 A;  2QA2 A;  1MU2 B;  4OJ1 A;  2D3O 1;  4LVO P;  1XR5 A;  2EC0 A;  1XNR F;  3SSQ A;  5ETV A;  3M8R A;  4R5P B;  5J1N A;  3ITH B;  4ZPV R;  4X84 A;  1LXN A;  4NEY A;  1K9M T;  3KUG A;  3AFG A;  4ER8 A;  3W3S A;  3LP2 B;  3IG1 A;  3MM5 A;  2ZH4 A;  2BYC A;  1JLA B;  2EG2 A;  3OBI A;  1NPR A;  3OFF A;  3M30 A;  3T1Y F;  1FFW B;  5A2Q U;  2UXD F;  1RT4 B;  1FX4 A;  1R8B A;  4KH0 B;  4L6V 3;  1VBX A;  4LRC A;  5LSR A;  2OAU A;  2KZZ A;  4O0I A;  2ZVI A;  1RTJ A;  2DNN A;  1UZD A;  3LAL A;  1QE1 A;  1NB2 A;  2G0I A;  2BAN A;  3ZFV A;  3ICL A;  1ZET A;  1X4E A;  2DCL A;  3BKT A;  3KLI A;  3RAQ A;  1NHV A;  5K20 B;  4JYA J;  1TK0 A;  3UD3 P;  4DUY F;  1RJJ A;  4F8R A;  1S48 A;  4F25 A;  1S6O A;  3MPW A;  5FDL A;  5DLF A;  5BR8 J;  2CVI A;  2CPH A;  5GAG I;  2R8K A;  5H9F K;  3GIK A;  1J2V A;  1Y5I B;  4JV5 J;  1VLY A;  4M5I A;  3I0R A;  1R31 A;  5C5J A;  2PGC A;  1DQ9 A;  3F44 A;  3DYA B;  5KG4 A;  4HTJ A;  1I94 F;  4MH8 A;  1VQ5 S;  1L3S A;  5HJX A;  3EZO A;  2ROE A;  1PBU A;  1S1X A;  1KEK A;  2MZS A;  4FXV A;  3RAM A;  1W7W A;  2UXC J;  2EXU A;  1FRH A;  5F8G A;  1B4S A;  2PFF B;  4ANE A;  1IJE B;  4DQP A;  4ZVO B;  3QSY B;  1HNW J;  3NGU A;  2B43 A;  4G1P A;  4H54 A;  3PR4 A;  4YQW A;  4FF3 A;  1RU2 A;  3D5M A;  3VAK A;  4K4V A;  3MMJ A;  2L3M A;  3HVW A;  1RCX B;  2H54 B;  2HQD A;  4OZ3 A;  4DFJ A;  2AZ1 A;  3T9N A;  1UFL A;  1N5T A;  4E0D A;  1R8P A;  2V68 A;  2EG1 A;  3KK3 A;  5CQG A;  5AXN A;  3OVS A;  3KTQ A;  2WVB A;  2V2K A;  3CIM A;  4LQ9 A;  4DU7 A;  3UR0 A;  2Y1J A;  2D69 A;  5KT5 A;  3GZ7 A;  3W62 A;  4RBU A;  1NDP A;  1T9T A;  2MQL A;  1UEV A;  3V4M A;  5J2P A;  2QFJ A;  2JHE A;  4ED2 A;  4IQM A;  5A6W A;  3VR1 A;  4ED3 A;  1I3O B;  5ETM A;  3D4J A;  1FDA A;  1SJ1 A;  3T9Z A;  4WFB Q;  4CNY A;  4I56 A;  2L9D A;  3LUY A;  3DM2 B;  2FJW A;  2FVC A;  3I6P A;  2BAB A;  5KTQ A;  2FY8 A;  4O3P A;  4YUD A;  2FDN A;  1S9F A;  1RHQ B;  1KHW A;  4LRA A;  4L75 A;  2I6W A;  4I6A A;  1SKW A;  5DRK A;  1S0N A;  3MR6 A;  4OZL A;  1NHK L;  1UPP A;  4PAA A;  2RQK A;  3UQS A;  1WTF A;  4PQU B;  2WW8 A;  3P4U B;  3NWG A;  2ALZ A;  1G6B A;  1Q8I A;  5E33 A;  4YDD B;  2HZA A;  3T5K A;  4QU6 A;  1DLO B;  1R3N A;  1OY9 A;  2JOQ A;  4ECR A;  3W2V B;  1JLF A;  2YQ0 A;  6AT1 B;  4ZVR B;  4LJM A;  3H40 A;  3ENA A;  1N6Q A;  2YBV A;  4J9M A;  4C3K A;  2LXU A;  4DR5 F;  3POT B;  3BBF A;  1D09 B;  4PWD A;  2BZ2 A;  3D9B A;  1Y0H A;  2XCP A;  4RBV A;  2C2K B;  4IRK A;  2ZC4 A;  3PX4 A;  1XJW B;  3M9N B;  1SIW B;  4NA1 A;  2IY5 B;  4DX6 A;  2FHJ D;  5D0R A;  2BW2 A;  2Z8Q A;  3SZ2 A;  1JJ4 A;  3I5A A;  2XWY A;  4PRF A;  4C4W A;  2NRE A;  2SXL A;  3TRG A;  4IH6 A;  4FVC A;  1RT3 A;  2B7B B;  2FD2 A;  1H7W A;  1B0T A;  5F8N A;  2HBQ B;  1URR A;  4X4S A;  2AYB A;  2AW0 A;  1EET A;  1PJ6 A;  2BKO A;  2OUG A;  2YNI B;  2OHD A;  1L3T A;  2R7X A;  1RYR A;  1RHR B;  4CM0 A;  4MJK A;  3GSI A;  1HQU B;  1YJ9 S;  3CPW R;  1Z4U A;  2DHH A;  1X5O A;  1CJK B;  1F3V A;  1FD2 A;  2DNM A;  5FLX Y;  4CZC A;  3NNC A;  2BM1 A;  3PRD A;  1WWH A;  2VKZ G;  2WBR A;  4U96 A;  3H42 A;  2DIS A;  3BN7 A;  3AT1 B;  2KXF A;  4WZM A;  1MWZ A;  3RW7 A;  1NJZ A;  2RQ4 A;  4UUW A;  2RQC A;  2PMZ D;  1SH0 A;  5SUH A;  1SV5 A;  3LGM A;  3GV8 B;  3LWM A;  3PM9 A;  1BXN A;  1SQE A;  4NLD A;  4CLY A;  2FVP A;  1RKJ A;  5J1E B;  2DRA A;  4CLW A;  3PW7 A;  2DRD A;  2KHC A;  1L5U A;  3SCL E;  2LEB A;  2V4J B;  1RHM B;  1EP4 B;  3BM7 A;  3OR1 B;  3LGH A;  3R5A A;  1A6L A;  2DGV A;  2JFD A;  2U2F A;  2KJV A;  2LQB A;  1BQX A;  2HNY B;  1WHY A;  3PHT A;  5BYR A;  2RKI B;  2ZH9 A;  2WON A;  2XQC A;  1S76 D;  1UA1 A;  2MSS A;  4QWD A;  4LF6 J;  2NPF A;  3BO3 A;  4LF4 J;  3GFY A;  3N0V A;  3CD5 A;  1VMB A;  2HQI A;  4RW4 B;  3NGD A;  3AXK A;  2H3E B;  4Q43 A;  4A8Q A;  4W4M A;  3OTO F;  2Z56 B;  1ZAV A;  2H5E A;  2J0Q D;  2R7U A;  3AJ2 A;  4DZD A;  1B0V A;  3GPA A;  3ENQ A;  5C25 B;  3ITH A;  1M1K T;  3H25 A;  2BOP A;  1WEL A;  1OIA A;  2VPW B;  4PG8 A;  3LP2 A;  4PCQ A;  4CM2 A;  3SQG B;  1WSV A;  2XNQ A;  1TAQ A;  2KM8 B;  3P96 A;  4CH0 S;  5DQG A;  5RUB A;  1BGX T;  1RT4 A;  5K9F A;  5KAK A;  2XMW A;  5ETL A;  1AT1 B;  3H2L A;  2XG8 A;  2ZUA A;  5CXT A;  4BWJ A;  2V34 A;  3TA0 A;  3HJV A;  3MI7 X;  4RUA A;  3IFE A;  4FXD A;  5KT4 A;  2IDL A;  4I2Q B;  2WTF A;  1YDL A;  2O01 C;  4KHP F;  2C3Y A;  3VGU A;  3MAA A;  1K1Q A;  2UU9 J;  2MY7 A;  2A3J A;  3QGH A;  5EGY A;  3FNN A;  1T03 B;  4Q2M A;  1NK4 A;  2FIU A;  1AUD A;  2BJ7 A;  3DDN A;  3TNV A;  3DOK B;  2BJ1 A;  1FRL A;  3OTE A;  1TK8 A;  2HZC A;  3IM9 A;  4IYQ A;  4PWW A;  3DYA A;  1PYS B;  1JKH B;  2VG6 B;  3BGR B;  1IWG A;  3PW2 A;  4MK7 A;  4PXB A;  3OT9 A;  1SJQ A;  4QIG A;  4R8U B;  2OGU A;  4PKD B;  3CUL A;  3NCQ A;  1HQ2 A;  3MUR P;  2JEF A;  3SEO A;  1UEU A;  4ECW A;  2VV5 A;  2CQ1 A;  4M1K A;  3KWM A;  1KN6 A;  2H4W B;  5L8R C;  2V8V A;  2AQ4 A;  4UW2 A;  1P6T A;  1KHV A;  2N7Y A;  4WE1 B;  5HAN A;  4USH A;  2ZBR A;  4IG0 A;  4DQI A;  5EN1 A;  5BYS A;  5JXS A;  2VC0 A;  4IFY A;  1YSJ A;  3ZZP A;  4CO5 A;  3QGP A;  2OTJ S;  2C3U A;  4LFC J;  2CNL B;  1HHS A;  5H9F J;  2JSX A;  4FS2 A;  2IRY A;  2MKY A;  2OML A;  2IJF A;  1OJ4 A;  4OQJ A;  1ROF A;  2OPS B;  5EX3 A;  4W92 B;  2RH3 A;  3TUZ C;  5KFM A;  4RNF A;  3NAH A;  1F60 B;  1YX2 A;  5BJR A;  5D0G A;  3KLG B;  3DHX A;  2UP1 A;  2RS8 A;  2B4P A;  1HQE A;  2K7J A;  5T41 A;  4N8N A;  1FEE A;  5D0H A;  4USV A;  4PQU A;  1ITP A;  1YTY A;  5LMU J;  8AT1 B;  2HUR A;  2D3U A;  1T94 A;  1U49 A;  4OX7 A;  3HDS A;  3IS9 B;  3CO0 P;  1SL2 A;  3IP0 A;  1DLO A;  2ZZM A;  2CQH A;  3W2V A;  2HHS A;  4XIU A;  4IOC Q;  5CYM B;  2DNL A;  2A2C A;  1XQI A;  3CCW A;  4RWX A;  3Q0A A;  4DL0 C;  2QT7 A;  2UXB F;  3LAN A;  2ILY A;  4KH1 B;  2QLW A;  4YDX A;  3SFG A;  2VFR A;  3HSG A;  3POT A;  2E1R A;  2CZV C;  1KVI A;  2YQ3 A;  4BCA A;  3MWB A;  3DLB A;  2DNH A;  1DQ8 A;  2RF2 B;  4AL7 A;  2KXN B;  1X0P A;  1FO1 A;  2J9D A;  4P9S A;  2VPX B;  4OI2 A;  2QJ3 A;  3IWL A;  4LFB F;  2O66 A;  2VQE J;  2BE9 B;  5B09 A;  2F8H A;  3C3L A;  4ZS6 A;  1LKZ A;  2IMO A;  2HW3 A;  2YNI A;  1RQ0 A;  1XMQ J;  3I5B A;  2XTJ P;  2H51 B;  2VOD A;  1S1U A;  3CJQ A;  3JQJ A;  4OHV A;  1HQU A;  5HRO B;  3HXM A;  3OLA A;  2RRB A;  4NX9 A;  1CJT B;  4YP3 A;  1CJK A;  4FNI A;  5J2M A;  5D8H B;  1BHN A;  1ZPW X;  5HVG A;  3CCQ S;  2P9G A;  4LR8 A;  3OUY A;  4DHV A;  1VC0 A;  4PXC A;  2QG9 B;  3ZZR A;  1RA7 A;  2ZE2 A;  3A3N B;  1LQ9 A;  3S6E A;  3I87 A;  3GIR A;  1UVK A;  2XSJ B;  2ZJP Q;  2XS5 A;  1NPK A;  3KG4 A;  4C2M A;  5J1E A;  1IKV A;  2D9O A;  2UUT A;  3PYD A;  2JH3 A;  4Y34 A;  1T7P A;  3V81 B;  2DHX A;  1S9G B;  1N5V A;  4ZP6 A;  2V4J A;  3NGS A;  3G6Y A;  1RB0 A;  1SJ4 P;  1EP4 A;  3OR1 A;  1C0U A;  3NS6 A;  1B3T A;  2UUW A;  2UVR A;  5CD4 H;  3MFI A;  1MN7 A;  4KGM A;  2IA0 A;  2ZH3 A;  2HNY A;  2MHN A;  2AGO A;  2XYH B;  1WOS A;  2MZQ A;  1YJV A;  2AX0 A;  3MPV A;  1HWU A;  2OH2 A;  1T02 A;  3AB4 B;  1H2T Z;  3C66 A;  4RW4 A;  1M5H A;  2CZ9 A;  1U2R A;  2NZC A;  3CJT A;  1TMJ A;  2NUU G;  2R7Q A;  1HPZ B;  2AGQ A;  5KFZ A;  3IAM 9;  2ZOF A;  4ID5 B;  4LIR A;  5JJB A;  4MIB A;  3S1T A;  1FCA A;  3P5T L;  4QR0 A;  3H5X A;  4NLV A;  1TL4 A;  4DV6 J;  4ZLJ A;  5C25 A;  4XPC A;  2AYE A;  2LEA A;  4DL4 A;  5M2P A;  4DL7 A;  1BWE A;  4J91 A;  1N5S A;  4PG4 A;  3SQG A;  4N7T A;  3M2R B;  4RBT A;  5B0D A;  2MEW A;  5U47 A;  5KT3 A;  2NPI A;  4OZ5 A;  1Y11 A;  1HBU B;  3FBE A;  4DSL A;  4URG A;  4UT4 A;  2AT1 B;  2X1A A;  3U27 A;  5DG7 A;  3RZA A;  1RT6 B;  2OMO A;  1FRX A;  4WFY A;  4KO0 B;  1VQ4 S;  3WHI A;  4I2Q A;  2YKM B;  1HNX F;  4DV3 F;  3SFU A;  4IFV B;  3G2X A;  4FXW A;  3TJ9 A;  2HVH A;  4CH7 A;  2FTR A;  3CCS S;  3QJP A;  2W9C B;  2HRT A;  3ZNJ 1;  3VCD A;  3MEE A;  1H6K X;  1T03 A;  4WZQ A;  3QT6 A;  3GU0 A;  3HF5 A;  4MYU A;  2GGP A;  4Q7A A;  3EJM A;  5DZ7 A;  2P6T A;  1NDC A;  4FYV B;  1YVF A;  2M52 A;  3DOK A;  1RT2 B;  1S1T B;  3K58 A;  4WPA A;  3CJ5 A;  4OMF G;  1M5S A;  4YHH F;  2XMA A;  4X4R A;  2VG6 A;  4NWB A;  2XYP B;  4ALZ A;  4YR3 A;  1JK9 B;  4J9S A;  5CZX A;  4NYP A;  2AMC B;  5ETO A;  2KVQ E;  1NLK L;  4Q45 A;  2OD6 A;  4ES2 A;  3BH6 B;  1BWV A;  1F2G A;  3LAK A;  2G4B A;  5KT7 A;  5A76 A;  4FN5 A;  3UDC A;  3EM1 A;  1URN A;  1NSA A;  4BC7 A;  2FUG 9;  4C48 A;  4LSZ B;  2XLJ A;  3N9U C;  3BYP A;  3SCI E;  4RO0 A;  1Q95 G;  4WE1 A;  3P49 B;  1GNK A;  4DEZ A;  1KQK A;  3WX4 A;  2BJD A;  1H2U X;  2W2N P;  3AY0 A;  5GMK a;  3J7A 1;  2QE5 A;  1FKO B;  4AFF A;  3QMQ A;  5KG7 A;  1XNR J;  1UVN A;  4X4O A;  4ZVP B;  4JBC A;  1XEZ A;  5DDQ C;  4KRW A;  2MLZ A;  3DLE B;  3HZE A;  5AJ3 J;  5F8J A;  2A2D A;  2QMW A;  4P71 A;  2HNZ B;  3QWP A;  2RIL A;  2EBE A;  3BGF A;  3AQO A;  2QA1 A;  2OPS A;  4DQQ A;  1RGV A;  4DPX A;  2C2N A;  2UUC F;  2BXJ A;  4N41 A;  4LF7 F;  2AJ1 A;  3H4B A;  2B8Q A;  2UUA F;  2B3T B;  4LIW A;  4JI4 F;  1FJE B;  1VBY A;  3D1H A;  4AXJ A;  3MM7 B;  5K8M A;  4Y2M A;  5IT4 A;  2I5J B;  1IKX B;  5IQ6 A;  3KLG A;  2XCA A;  1VFJ A;  4WKY A;  2MQP A;  1LFP A;  3GYX B;  4IKA A;  1S77 D;  2JJ4 D;  4LF5 F;  3HHL D;  2B4O A;  3ULH A;  1KSP A;  3N01 A;  4A8K A;  3MR5 A;  3UDE A;  2MY8 A;  2K2P A;  2GO8 A;  5F41 A;  3IS9 A;  3QSI A;  4F0K A;  2WSF C;  2ZVS A;  4DUY J;  2QYC A;  4OZN A;  2EEY A;  1XMO J;  5CYM A;  2POK A;  1VQO S;  3OHA A;  2J6S A;  1WG1 A;  3DI6 A;  3O5T B;  3PV8 A;  2HGN A;  1HI0 P;  4DR3 F;  4NLY A;  4A48 A;  3O44 A;  4K2X A;  4ZHR B;  4JI1 J;  2HBZ B;  4ERD A;  3N28 A;  2CDQ A;  3TVK A;  1X4A A;  3KFW X;  4LF9 F;  1N0V C;  2RF2 A;  3I56 S;  3TZY A;  3RBE A;  1N5Y A;  2AU0 A;  1ULR A;  3GSD A;  1HWK A;  4QW8 A;  2LDI A;  3MM9 B;  3NCR A;  2XNR A;  3CD0 A;  1SXL A;  3M6X A;  4A8W A;  4NLX A;  2DGO A;  4HR2 A;  2ZNY A;  2DNK A;  2CQI A;  4ZDN A;  4BWM A;  2ZZN A;  2BE2 B;  2DO0 A;  1RWO B;  1SC4 B;  2B56 A;  4URQ U;  3MTK A;  3T1H F;  4ILM A;  2BMB A;  3EGZ A;  2MTL A;  3NY0 A;  2DHA A;  2HAI A;  4IDK B;  4TNO A;  1CJT A;  4YB6 A;  5KFP A;  4YB1 P;  3GII A;  5F9L A;  3A13 A;  4QOT A;  4Y2C A;  1L3K A;  4ITS A;  3LOU A;  2B8P A;  3D68 A;  2N4C A;  1F1B B;  4B9U A;  4X66 J;  3I9V 9;  1WOO A;  1WI8 A;  4OYO A;  4ZPD A;  4WBF A;  3CW2 C;  2GZO A;  3HO1 A;  1FWL A;  4FPR A;  5E5N A;  4J9O A;  1VRQ C;  2CG4 A;  2ZJQ Q;  3NKY A;  2CPE A;  3V81 A;  3SXL A;  4M5N A;  2OPR A;  1S9G A;  3BJY A;  3MPY A;  1UJ4 A;  2ACM A;  1FNO A;  4JI7 J;  2XUL A;  4TQR A;  1D3W A;  2LP4 A;  3G6V A;  3ZZT A;  3FMW A;  5I3U B;  1Y5L B;  4OZ0 A;  2FZC B;  3VAL A;  2WVC A;  3PRV A;  2OKQ A;  2C1E B;  4DDF A;  4UST A;  1TKX B;  2J7W A;  1HPZ A;  1XN9 A;  1U47 A;  2Q3P A;  1MG7 A;  4ID5 A;  4G1I A;  5E3P A;  5LSL A;  4L3N A;  2R4F A;  1P9Y A;  1WUU A;  3DRR B;  1UJ5 A;  2J0W A;  2E5I A;  3M8Y A;  3KKF A;  3CF5 Q;  2A0F B;  4OYB A;  4MT1 A;  4KFB B;  3M2R A;  3W64 A;  1NKE A;  1VQY A;  4OFZ A;  2FVS A;  2MJU A;  4WFA Q;  1HBU A;  2OEM A;  4RJV A;  1N48 A;  1RT6 A;  2J9E A;  4J37 A;  1ELO A;  1QSY A;  1JXL A;  1OSD A;  4DR2 F;  5HP1 B;  4KO0 A;  4CIO A;  4M95 A;  1YZ7 A;  1DTQ B;  1ZTW A;  3RB6 A;  4JV1 A;  3B82 A;  2YKM A;  1FJC A;  4I67 A;  2W4D A;  4UTG A;  2GQ2 A;  2JLE A;  2A6M A;  2FPH X;  2DNG A;  4IFV A;  4JI8 F;  2V0N A;  3HHL B;  1YHQ S;  3QT8 A;  3EZ5 A;  2W9C A;  1FES A;  5IT9 U;  5KFV A;  1NHU A;  3R5C A;  1Y10 A;  3NGR A;  4UOC A;  4Z7C A;  5CAB A;  4F4A A;  2IC3 B;  3KJQ B;  1GXT A;  2VIC A;  5IQQ A;  3DRX A;  3BSC A;  1N32 F;  1XNQ J;  2LYV A;  3MAQ A;  3JAM Y;  1RT2 A;  1S1T A;  4OV6 A;  4HVZ A;  4EBD A;  5KG5 A;  3UN5 A;  3BSA A;  1IBL F;  1DHM A;  1M5K C;  1FJG J;  4B9S A;  4ZPB A;  2CAD A;  1FHT A;  4U7C A;  4CLP A;  1V5V A;  3FQK A;  3D0H E;  2LEC A;  3IWN C;  1T9U A;  2QLX A;  2Y0B B;  1E6V B;  4NCB A;  5HQL A;  2O1P A;  1J5O B;  2D74 B;  2XZT B;  3I96 A;  4CRJ A;  3P8B B;  3FRZ A;  4DV1 J;  4ELU A;  1EHW A;  3QID A;  2QMU B;  1KRP A;  2XMT A;  3NWR A;  3IGV A;  4ED6 A;  3MM6 B;  1BD6 A;  4HT5 A;  1NH8 A;  1VCT A;  5E2Q A;  3NG8 A;  5DZ6 A;  4DSF A;  2MB0 B;  3KOA A;  1RP5 A;  2IM2 A;  4YEA A;  3DLE A;  4EK2 A;  4NAS A;  4EU0 A;  3PJX A;  1BMQ B;  2XMJ A;  2HVD A;  3OVA A;  1YBU A;  3OL6 A;  1S49 A;  4DV0 F;  3CJS A;  4O3N A;  3OL8 A;  1LWE A;  2E44 A;  1V5I B;  5L1L A;  3E01 A;  2WHO A;  1VIS A;  3M2U B;  3PCO B;  3DHW C;  2L9W A;  3C15 B;  4NYO A;  4P7T A;  2E5L J;  5F0W A;  3PRB A;  2CJQ A;  3PKM A;  3MM7 A;  1JX4 A;  1HYS B;  4RWW A;  4NA2 A;  2I5J A;  1TL3 B;  1IKX A;  3R5J B;  4J9R A;  4CNZ A;  3BDP A;  5D3G B;  4OYI A;  2CRL A;  1NKC A;  2ZWP A;  1MMD A;  5BXI A;  3EGW B;  2K06 A;  4AXI A;  4USJ C;  1NZA A;  4KE5 A;  2KRB A;  3UNY A;  2WVE A;  1MML A;  1CSJ A;  4BHQ A;  2LDY A;  1NBE B;  3W9J A;  4DJB A;  3Q8P B;  2YWE A;  3FMB A;  1IR2 A;  4F2R A;  1B7F A;  1Y3K A;  1VC6 A;  5KOX A;  2HHT A;  4B3R J;  1RWV B;  4NML A;  3FFI A;  1WC5 A;  3TUI C;  3NP5 A;  2MKC A;  4ZHR A;  1WKK A;  3KHH A;  1DTT B;  5B0C A;  3HT0 A;  4C6A A;  4Y00 A;  3QAU A;  2B7C B;  2JLG A;  1FWP A;  4B9T A;  2GVZ B;  2VJV A;  2ZKT A;  3CIZ A;  4FS1 A;  2B51 A;  4TXS A;  3MEG B;  2ZH5 A;  1OS5 A;  2V67 A;  3KHG A;  2KT3 A;  2BE2 A;  4GKJ F;  4F4W A;  1BC6 A;  1H38 A;  1VIX A;  1TMM A;  4OX6 A;  3J7Z T;  2D9P A;  2LQ5 A;  3PFO A;  3D1Q A;  2DPI A;  2CWK A;  2ZH8 A;  1JLB B;  4IDK A;  2GJ2 A;  2WB1 D;  4RW7 B;  5LJ5 Y;  5KFC A;  4CLU A;  1DZ5 A;  2QGF B;  1VLO A;  1DAR A;  3C6U A;  3W9H A;  4NXN F;  3W61 A;  1BQN B;  1YJT A;  4WIQ A;  2X1F A;  4ZLL A;  4ZIV A;  3ISZ A;  1K8A T;  3JTO A;  1ZM9 A;  3JQM A;  2Y8Y A;  1UW9 A;  5CYQ A;  1KQF B;  1HR0 J;  2HG4 A;  4P2S A;  3MR3 A;  1SQF A;  2IYG A;  3OPK A;  1OO0 B;  3FKB A;  5KFX A;  2W1B A;  2RIJ A;  1I51 B;  5KFU A;  3FCW A;  1CEZ A;  4C8L A;  4CLK A;  5HMY A;  1IR0 A;  1CPZ A;  4B02 A;  3M32 A;  2MLX A;  2CJX B;  1WHV A;  2GQQ A;  3Q8Q B;  1U6B A;  3W7B A;  1UMJ A;  5I3U A;  3TJ8 A;  4OJ3 A;  4QQB A;  2KTQ A;  1VJQ A;  3MMA B;  2JEI A;  2ATL A;  2R8H A;  4K4X A;  1N88 A;  1VQS A;  2CA9 A;  3AJ1 A;  4KR0 B;  4W90 B;  1TKX A;  1S1V B;  1RAH B;  5HMZ A;  4NZ6 A;  1IQT A;  2UXB J;  4JI5 F;  4K5R A;  3FBC A;  2W9B B;  3OV7 A;  2R2S A;  4OI4 A;  3DRR A;  2XWX A;  3L09 A;  3PIO Q;  2D41 A;  5A8K B;  1IBM F;  2FY1 A;  3DFE A;  1NJW A;  3GJS B;  2DVI A;  4KTQ A;  3D6F B;  4H4M B;  5CD4 A;  3MMC B;  1GT8 A;  1Y4Z B;  3QT5 A;  3A12 A;  4CCH A;  2ROG A;  4J9U E;  1S4F A;  3K0J A;  1WNE A;  5D78 A;  2RUG A;  5D4L A;  1Q8B A;  3M9M B;  5THW A;  4RU2 A;  1Q7L B;  3K5P A;  3F0N A;  4Z7Y A;  2M9K A;  2F9D A;  5HP1 A;  1UVL A;  4QWB A;  1DTQ A;  4HI2 A;  4S0M A;  2CPI A;  1X31 C;  1LWC B;  5F8H A;  2IM1 A;  2MGZ B;  1LWF A;  3UDL A;  3HHL A;  2BRK A;  2DIV A;  2KT2 A;  4LRE A;  1IBC B;  4DCP B;  4DL2 A;  1R8H A;  5LXY A;  1RAE B;  2E1A A;  3KK2 B;  2QEX S;  2J5A A;  3GR0 A;  3RU0 A;  2IC3 A;  4FBT A;  2QV6 A;  2HIQ A;  2YNF B;  3D2W A;  1WHX A;  4LFA J;  2R8G A;  2X3G A;  2BEF A;  3MTJ A;  2A18 A;  4LMZ A;  3Q83 A;  3U1N A;  1T3N A;  4U7U D;  1C4C A;  2WVD A;  2X1B A;  3OL9 A;  1KTV A;  2IJN A;  5L1I A;  1N33 F;  4ICL B;  1UA0 A;  3J7A N;  5HVF A;  3RGI A;  1H3D A;  3L4B C;  1D8Y A;  5KFQ A;  3HJF A;  3I0S B;  1G1X A;  5K14 B;  3J7Y I;  5GMD A;  2KFN A;  1SH2 A;  2PA8 D;  1BLU A;  4ZJL A;  1Z2Z A;  4KJI A;  5J1P A;  2F5G A;  1T9W A;  1EKR A;  4EI2 A;  3EPG A;  1DQA A;  3HHK A;  3CJ8 A;  1E6V A;  2PD1 A;  4K0K F;  4YS2 A;  1J5O A;  4D3G A;  1H7X A;  3OTB A;  3T5H A;  4F4Z A;  3G8T A;  1T95 A;  2AGP A;  5BYQ A;  4I6W A;  2WSE C;  5LT5 A;  3MM6 A;  2DNQ A;  2E9Z A;  1VC5 A;  3OQ2 A;  3VWS A;  2VB6 A;  2HMI B;  2DH9 A;  3M1V B;  5J2N B;  1YBT A;  1UKU A;  2DR5 A;  1PJ5 A;  5ETT A;  1UZH A;  2HFS A;  5GAE U;  4B9L A;  3RRK A;  4KB7 A;  1YJR A;  1IBK F;  3T19 A;  5GAH U;  4TQS A;  1WOR A;  2NR0 A;  5A2Q Y;  2VG5 B;  4FKX A;  4JI2 F;  5F0U A;  1HBO B;  2GHW A;  3QFH A;  3OXG A;  2EWH A;  1NPP A;  4E8U A;  2DEI A;  3M2U A;  5HL7 Q;  1GH8 A;  4AQY F;  2HFO A;  3RR7 A;  4OIX A;  3CC4 S;  1HYS A;  1XTZ A;  2F4V F;  1TL3 A;  3PYE A;  4AD6 A;  2GA7 A;  2Q79 A;  4RUB A;  2VC1 A;  3QIP B;  2BUN A;  5KFO A;  1VQK S;  1T0T V;  5J2Q B;  3L95 X;  2QLJ B;  4RUH A;  3VQT A;  1HA1 A;  3JSM A;  3WIV A;  3TO8 A;  4ETZ A;  1EB0 A;  1RAB B;  2Y1R I;  4P72 A;  5AE1 A;  4M5G A;  4HAC B;  3MDF A;  1CQM A;  2OD4 A;  2BJ3 A;  4V19 J;  3R1L A;  4ZLN A;  3V6J A;  3ENV A;  3C19 A;  5CCL A;  2V8G A;  2MYF A;  2ZDO A;  4WFN Q;  1RA6 A;  1X4F A;  2NZ4 A;  2ZHO A;  4TYB A;  3H5Y A;  4N76 A;  1KBR A;  1DTT A;  4CYU B;  1FE0 A;  1KWM A;  2YPY A;  3LWL A;  2OFH X;  2VZ9 A;  2GVZ A;  3KNA A;  4ZP8 A;  1UWB B;  3MD1 A;  3JSB A;  2B9X A;  2HQG A;  1NJX A;  2KFY A;  4CLT A;  2CPZ A;  3AHP A;  4I0W A;  4NXM F;  4OYM A;  3CC7 S;  1YIJ S;  3IAS 9;  3Q22 A;  2OIH A;  5CAA A;  3KK1 B;  2DJW A;  1S99 A;  3ETO A;  1RBO B;  4OZJ A;  1GX6 A;  1NK5 A;  1NH7 A;  2RRA A;  1JLB A;  1X4D A;  2CZ4 A;  3TYT A;  4AT1 B;  2R7T A;  3KMQ A;  4ILL A;  1QSL A;  5LJ3 Y;  1OSC A;  2OFG X;  2MKS A;  2DGX A;  2JVR A;  3DOM B;  1K73 T;  1NDK A;  3OXF A;  1RWM B;  4DSI A;  2QLB B;  4OHZ A;  4LF7 J;  2MZR A;  1NK8 A;  1DAX A;  5B7W A;  3ILL A;  3OFH A;  2UUA J;  1YRT A;  2FHK A;  5KG1 A;  1FRI A;  4DV2 F;  4JI4 J;  3MOZ A;  2P8I A;  4TVA B;  1U1N A;  4I4B A;  3CCJ S;  4LF5 J;  4P2M A;  1TU0 B;  3PVX A;  2ZKU A;  4WKR A;  3UD4 P;  2XLI A;  3KJV B;  2Q66 A;  4AE5 A;  3MF5 A;  3GP9 A;  3LAM A;  1U0S A;  1Q79 A;  2W01 A;  1YQH A;  1EAY C;  1FJ7 A;  4TKT A;  4CI0 B;  1RYS A;  2ZH2 A;  2UVV A;  2MST A;  1KFD A;  4C8M A;  1FT8 A;  4DR3 J;  2W9B A;  3IN5 A;  3CC2 S;  4WTY A;  1N56 A;  4DUZ J;  3K8V A;  4X4N A;  4OHX A;  5A8K A;  5A8W A;  3OJS A;  3TAR A;  2FC8 A;  3ILJ A;  5DO2 A;  5CH7 B;  4MKB A;  1Q81 T;  5KFE A;  1H2V Z;  1TZ0 A;  1FRK A;  1HWJ A;  1NCL A;  5B0E A;  3ZC4 A;  1SQG A;  4H4O B;  4GC6 A;  4ATN A;  1PYT A;  1H0H B;  3FCV A;  5L39 A;  1WKL A;  3SBM A;  3SI8 A;  4DQS A;  2DR7 A;  2LCW A;  4U8Y A;  2IJR A;  1YLX A;  2Z4P A;  1VJW A;  2XY5 A;  3PHE A;  3T1H J;  3IC1 A;  1OYE A;  2HQF A;  4RKU C;  4DR6 J;  3TI0 A;  4CO0 A;  2HBY B;  2HHU A;  3CB4 A;  4UOF A;  4K8R A;  4CT8 A;  1NK7 A;  4CWB A;  1QD1 A;  5I4M A;  4Y2K A;  5LL6 d;  3ZNU A;  1RKI A;  3G82 A;  3ZTP A;  1ZA2 B;  3I4H X;  1S6Q B;  3CO9 A;  1F3F A;  4ZVG A;  2HLU A;  1S72 S;  2ASY A;  2YNF A;  3G6E S;  3W2W B;  2VFV A;  3HKZ D;  2N3L A;  3R27 A;  1B0P A;  4ICL A;  2QLF B;  3CXC R;  1UET A;  2L9N A;  3D0G E;  3D66 A;  2ZNZ A;  4CO2 A;  5IS2 A;  3I0S A;  5K14 A;  2F63 A;  1WF1 A;  3BDE A;  4HEA 9;  4UY8 5;  4DFP A;  4NLP A;  3DMJ A;  2HS4 A;  2B9Y A;  4CTA B;  4I2P B;  4WYW A;  2KFZ A;  1X0F A;  4MMO A;  3WZ0 A;  2I8E A;  1YIT S;  4N56 A;  2R7S A;  4Y2I A;  4PPZ A;  3SDE A;  1U8S A;  4NOH A;  5GAD I;  2ZOG A;  3C6T B;  4DS5 A;  1VHF A;  4QPT A;  1S0O A;  2HVE A;  3EGN A;  2H5J B;  5HI7 A;  1PAU B;  4U6P A;  2OLW A;  2HMI A;  3JYT B;  3NMA A;  3M1V A;  3IBC B;  5IV3 A;  1RWX B;  5J2N A;  3N5F A;  1XWL A;  2BRL A;  3B8H A;  4ZVS B;  1XR7 A;  2H4Y B;  1MRO B;  2W4C A;  1FRJ A;  4I68 A;  1SJF A;  1R7I A;  5E3Q A;  1NSQ A;  4RU9 A;  2VG5 A;  1W2I A;  1HBO A;  2AX1 A;  3LW5 C;  3V2U C;  1LOU A;  2YKO A;  2W24 A;  3IBF B;  3ILI A;  3ZTO A;  1FNM A;  3PZP A;  4CO3 A;  4JOU A;  4QYZ K;  3PYG A;  4DS4 A;  2K8G A;  1Q16 B;  4HI1 A;  4M94 A;  2ZUG A;  2YH0 A;  2YKN B;  2UZA A;  1S9E A;  4DPO A;  5J2Q A;  1NUE A;  3D6H B;  3AOB A;  1B7Y B;  3QLH B;  4MKV A;  2JDJ A;  3PDN A;  1AW0 A;  2NCK L;  1JNR B;  3M8Z A;  4X4T A;  3EDQ B;  5BR8 F;  3R5B A;  2FJV A;  2GC8 A;  1NM2 A;  1PIE A;  3HVA A;  1P8G A;  1KOO A;  3KG0 A;  2AF6 A;  3QPI A;  3NAI A;  2C2R A;  2EFN A;  1IBL J;  4N77 A;  2VFT A;  3W1Y C;  5A8R B;  1REG X;  2FZG B;  4LSN B;  4DN9 A;  1YI2 S;  4CYU A;  2MQN A;  4L74 A;  2O3D A;  1RI7 A;  4P2F A;  2UXC F;  3MCN A;  2GFF A;  2M7S A;  2XYG B;  1X5S A;  7FD1 A;  2W7O A;  2J7K A;  1VYA A;  5A0Y B;  4C0O C;  3HPO A;  1TUW A;  3C16 B;  1IM4 A;  1JB0 C;  3KLE B;  2HND A;  4KSE B;  3E51 A;  4X62 F;  3BPD A;  3DDI A;  2XEX A;  2VQF F;  3FSX A;  4O4G B;  2N82 B;  3W60 A;  2OO4 A;  5IWA J;  2BA9 A;  2C2O B;  2PSZ A;  2QN6 B;  3OSP A;  1WAC A;  1JLE B;  4NLU A;  3CCR S;  3SQO P;  1GFW B;  1D9F A;  5L9N A;  3HP6 A;  3DOM A;  4MYT A;  4DPU A;  4DFK A;  1R43 A;  9ATC B;  2XS7 A;  3AD8 C;  1JJC B;  2VBW A;  2E9T A;  4B08 A;  4DV0 J;  1E6Y B;  2XC9 A;  2JEJ A;  3ET6 B;  1MMN A;  2KN4 A;  2G0C A;  1DUR A;  2FQQ B;  1WJ9 A;  4DOZ A;  5FD1 A;  3QAE A;  2M8D B;  2X7I A;  3MFH A;  2KYZ A;  2B6A B;  2M4M A;  1U2F A;  3Q89 A;  4YR0 A;  4C8Z A;  5HAO A;  3US5 A;  2RDD A;  2XGP A;  3KJV A;  2QL9 B;  2OEL A;  5CZV A;  3MR7 A;  3W8G A;  4K50 A;  2BR0 A;  3UWT A;  2HS0 A;  3Q2T C;  1S4E A;  2R7V A;  4H4K C;  2AP6 A;  2CNO B;  1BY9 A;  3H20 A;  4ZVT B;  1SL1 A;  3KLF B;  3M8S A;  4URS A;  1F0X A;  3MUV P;  2DHS A;  3G4S S;  4DG1 A;  4KKO B;  4F50 A;  4G1Q A;  3IWX A;  3DDK A;  2HHH F;  4C9D A;  2W2O P;  1IM6 A;  2GX8 A;  3TJA A;  1XMB A;  4JI0 J;  2WRM A;  4PG7 A;  2NXN A;  2V50 A;  1FTR A;  1JNZ B;  4H4O A;  2G0J A;  3VQS A;  2IAJ B;  1VK8 A;  2DY1 A;  4QYR A;  3CJ3 A;  3PEH A;  2N4D A;  4H4K A;  1KC8 T;  2F8M A;  1TV6 B;  4Y28 C;  5DLG A;  3NXZ A;  3MUM P;  2O5D A;  4GKJ J;  3CJ4 A;  2FJE B;  3QGG A;  2DCU B;  1U02 A;  2MZJ A;  3SCJ E;  3FQL A;  1Q4R A;  2JL9 A;  2WB4 A;  4N5S A;  1CJU B;  4J9K A;  2CQ0 A;  1HHQ A;  2V69 A;  4C0H A;  1WDT A;  5L9X A;  4B3O B;  1R6Y A;  3KLH B;  2VBY A;  1RBA A;  4NXN J;  3FK4 A;  3CNQ P;  1HL6 A;  1R6V A;  1S6Q A;  3AB2 B;  2Y0S D;  4QIE A;  1J5E J;  1C1B B;  3W2W A;  3Q2S C;  1HNI B;  4P74 A;  4WXO A;  3GLJ A;  2FYX A;  1TEL A;  2ASL A;  1FVS A;  2VF3 A;  2KI2 A;  1PG5 B;  1PKU A;  2UUB J;  5AXM A;  1N52 B;  4PZV A;  4I6Y A;  3ZO7 A;  5H1S V;  4M5K A;  5KFI A;  3CD7 A;  3HT3 A;  1KOH A;  4GMK A;  3MXH P;  3TEG A;  2X3D A;  4CTA A;  3BQ2 A;  1CS4 B;  4I2P A;  2CPF A;  2IM3 A;  3JB9 k;  2W7P A;  4NCA A;  5LOQ A;  2DH8 A;  3R3T A;  5K8P A;  2M8H A;  2V8D A;  3C6T A;  1QY7 A;  3AD7 C;  1W25 A;  2J7U A;  2FHO B;  3AD9 C;  3JYT A;  4ZVQ B;  1QSS A;  2Y3Y A;  1WSR A;  3LP0 B;  1S10 A;  2HEK A;  1JWW A;  3RBZ A;  3J81 U;  1MRO A;  2YNG B;  5C2G A;  1IBM J;  3BSO A;  4C11 B;  3QT7 A;  3KJN B;  1Z2L A;  4PYA A;  3GV7 B;  1CLF A;  1T9Y A;  3EMT A;  4GVB B;  2CYY A;  3G6X A;  2HFU A;  2ROP A;  3QBC A;  4X64 F;  3CDB A;  5ETK A;  7FDR A;  1X4C A;  1PBA A;  3RG6 A;  1IR1 A;  2QL7 B;  2EFQ A;  4RNN A;  1X4H A;  2UU9 F;  4ECV A;  3HK2 A;  2YKN A;  3BV8 A;  1C0T B;  1U1L A;  2Z2Z A;  2XLK A;  1H73 A;  4IOB A;  1MU2 A;  5IOL A;  3DRS B;  1IXK A;  5LM7 E;  4F0M A;  4R5P A;  1AFJ A;  3HI9 A;  4LF1 A;  3BQ0 A;  4OZ2 A;  5IXU A;  3HD2 A;  1JLA A;  3GYG A;  3CJK B;  3KHR A;  1F2H A;  4LSN A;  1N33 J;  3BR9 A;  5M2U A;  2QC3 A;  2HHV A;  5DG8 A;  2CQD A;  1EIY B;  3N6L A;  1Q1K A;  1UP1 A;  2HVI A;  4BS2 A;  3E8O A;  2GIQ A;  4WK1 A;  2JZ5 A;  3VAH A;  4M5M A;  3J80 U;  2I1R A;  5A0Y A;  1VIO A;  2NUH A;  1XBW A;  1O6X A;  2HSE B;  4DSK A;  3C16 A;  2HS3 A;  3G96 A;  3KLE A;  1JJH A;  4QYZ J;  4IR9 A;  1HNZ F;  4PEO A;  3OVB A;  1VI7 A;  3DKD A;  2FJA B;  3A8E A;  3IRW P;  4NLG A;  2C2D A;  2CJ9 A;  1OPZ A;  1XIQ A;  3JXO A;  1VS3 A;  5D4N A;  1JLE A;  2BJ9 A;  3OL7 A;  3GIJ A;  3GB0 A;  2HHP A;  2CQ4 A;  1B99 A;  2DHG A;  4O3S A;  4U7U K;  2CKW A;  4LT6 A;  3I32 A;  3QJJ A;  2HGL A;  2ZJR Q;  2IRX A;  4F67 A;  2H9Z A;  3M30 B;  1IQZ A;  1IBK J;  1U1M A;  1KTQ A;  3VTI A;  2BAC A;  4JI2 J;  1E6Y A;  1GK8 A;  3R97 A;  1U6F A;  1YJN S;  4F3Q A;  3CDW A;  1WF0 A;  5E3A A;  1NK0 A;  1TL7 B;  3UCG A;  2DGT A;  3ZZU A;  4R25 A;  4OYP A;  1N36 J;  3W5Y A;  1QE1 B;  4JUZ A;  1P27 B;  2CQ3 A;  1RWW B;  1DJ0 A;  1FDD A;  3KLI B;  3T41 A;  2VKR A;  5LMU F;  2QFI A;  2B6A A;  1WD6 A;  1ZAX A;  2ILZ A;  1RTD B;  1YJ7 A;  3K89 A;  1EKS A;  1D8Z A;  2BJE A;  2XZD B;  4RUC A;  2IFX A;  2M88 A;  3JQK A;  2RNE A;  1RWP B;  3RJM B;  2VBX A;  1RWN B;  2NXJ A;  3NEK A;  5B0A A;  3DLK B;  3MPD A;  4DR1 J;  2LLZ A;  3HD1 A;  4RZR A;  1N5Q A;  1OY6 A;  4FKY A;  2I2Y A;  2COL A;  3KYL A;  3DN9 A;  3R9L A;  3KLF A;  4ZN1 A;  3W8P A;  4AL5 A;  5EWG A;  3CJR A;  3OFE A;  1SJ3 P;  4WYL A;  2LU2 A;  2V94 A;  3DM2 A;  1HI1 A;  3LGN A;  1WTB A;  4MKY A;  3HSJ A;  2HHX A;  2VQE F;  4OI6 A;  4ECU A;  4ED8 A;  2F9J A;  2YH1 A;  4NLS A;  2IAJ A;  3MR2 A;  2FZK B;  4X2B A;  4J90 A;  1XMQ F;  4XDD A;  4BDP A;  1UEK A;  5E7O B;  1ZM3 A;  4HDG A;  5KG2 A;  2KG0 A;  2AEM A;  3X1L B;  2DXE A;  4YN3 B;  3NLC A;  5F8M A;  3IRX B;  1TQL A;  2AKW B;  5HMX A;  1CJU A;  3M7V A;  2XY6 A;  6FDR A;  3FEY B;  1BQM B;  3D3C J;  2KKH A;  3RB0 A;  4XPE A;  3GYN A;  4MIA A;  5HMW A;  3K5N A;  5KFY A;  5LMN F;  2HFV A;  3KLH A;  3DOL B;  2NSC A;  2ZD1 B;  2W25 A;  1DY3 A;  2GAG C;  3D6T B;  1U6Z A;  2EKN A;  2YQ1 A;  4W98 A;  3QZ8 A;  1ZH5 A;  3WX8 A;  2AJQ A;  4ETX A;  5T14 A;  2XMK A;  1Q86 T;  2XHC A;  5KG3 A;  1PC4 A;  1C1B A;  4JB8 B;  3T5J A;  4RW9 B;  3VZH A;  1HNI A;  1RAD B;  5GAE I;  3WC2 A;  4ZK7 M;  2BJ8 A;  2AZ3 A;  3H2U B;  1BUX A;  2R2R A;  4LF8 F;  1RHJ B;  4P7V A;  4ECY A;  4OLP A;  3AOD A;  3CCZ A;  2E7V A;  1FVQ A;  2KDO A;  4KGV B;  4NRT A;  4KC5 A;  5EUH A;  4WII A;  4DV2 J;  4HL9 A;  4IRC A;  4IH7 A;  1MSW D;  3IBW A;  3VGT A;  2BOA A;  3I5C A;  2DIU A;  4DL3 A;  3TP2 A;  3R7S B;  2PMW A;  1TP7 A;  1XC9 A;  1LW2 B;  1RXO B;  3MAH A;  5H9E K;  1H72 C;  2MQQ A;  4JV0 A;  1JLF B;  1O5J A;  2ZC3 A;  3W5X A;  2JVO A;  3CDU A;  4DU8 A;  4M5D B;  2HQ3 A;  2HWT A;  3JTN A;  2KYX A;  2XI3 A;  4KHM A;  1WOP A;  5I3Q A;  4ILR A;  4P10 A;  1MNE A;  4GO7 X;  4FYW B;  1AFI A;  2PEH A;  3PNI A;  1IKW B;  3LP0 A;  2B0G A;  3ETM A;  2RVJ A;  1F9F A;  5E0O A;  4USW A;  2J8A A;  4C11 A;  1T9V A;  3QJL A;  3I55 S;  2KU7 A;  3AXM A;  2DB1 A;  1UFW A;  2OPP B;  2RDI A;  4CDI A;  2ZDP A;  2BVZ A;  3DXB A;  1EET B;  1HIY A;  4LVN P;  2RKI A;  2UV8 A;  5ETN A;  3BEG B;  2ZOM A;  3EIC A;  1UCN A;  5M2R A;  3OTC A;  3JSY A;  1YJW S;  1C0T A; 
#chains in the Genus database with same CATH homology
 2QLF B;  2H65 B;  2FQQ B;  2DKO B;  1RHM B;  2QL7 B;  2HBR B;  2XYG B;  2QLB B;  2XYH B;  4DCO B;  2XZD B;  2C1E B;  1RHU B;  2CDR B;  1RWV B;  3IBF B;  1RWP B;  4DCJ B;  3QNW B;  2H4W B;  2H51 B;  2HBQ B;  3KJQ B;  3P45 B;  1RHQ B;  5IC4 B;  1SC3 B;  3RJM B;  1RE1 B;  1RWN B;  3GJS B;  3D6F B;  1QDU B;  1BMQ B;  2QL5 B;  4ZVP B;  3R6L B;  4ZVO B;  2QL9 B;  1RHR B;  2CJY B;  3D6H B;  3P4U B;  1RWK B;  2HBZ B;  3D6M B;  3SIP B;  2C2O B;  1PYO B;  1QTN B;  4JB8 B;  1I51 B;  4ZVQ B;  2HBY B;  3KJF B;  3R7N B;  3EDQ B;  2CNO B;  2H54 B;  4ZVT B;  2CJX B;  5K20 B;  2QLJ B;  1RHJ B;  2XYP B;  2H5J B;  4ZVR B;  1PAU B;  1NME B;  3R5J B;  1GFW B;  2CNL B;  1F9E B;  1ICE B;  3IBC B;  2Y0B B;  1RWX B;  3NS7 B;  2H5I B;  2CNK B;  2P2C B;  3EDR B;  2Y1L B;  3GJR B;  1IBC B;  2XZT B;  4DCP B;  2C2K B;  4ZVS B;  3KJN B;  1RHK B;  2H4Y B;  1SC1 B;  2C2M B;  3R7S B;  1RWO B;  3R7B B;  1SC4 B;  2CNN B;  5IC6 B;  2H48 B;  4LSZ B;  1RWW B;  3R6G B;  3GJQ B;  1RWM B;  1I3O B;  3GJT B;  4ZVU B;  2C2Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...