1VRTB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 113
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vrtB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB03
1TVRA 1TKXA 4PQUA 4ECRA 2V4RA 3I0SB 2R2RA 5F9NA 1MMLA 3CDWA 2E9TA 3BSCA 4ZVEA 5F8NA 4G1QB 1C2PA 4O4RA 1JKHB 4F4WA 4IOBA 5EUHA 5KFVA 2OPRB 3H98A 1SH0A 5KFOA 4Q8EA 2OPPB 5J2PB 4EO6A 2C2EA 5J2QA 3QLHA 4FS1A 1T03A 3LP1B 5C24A 5J1EA 5KFRA 2B6AA 4NLTA 3GIMA 2ZD1B 3CDUA 2ASJA 3HKWA 3RB0A 2RKIA 2IJFA 1JLEB 2E9ZA 2ILYA 3MF5A 3M9NB 1JLQB 4IFYB 3KHGA 1EETA 4ZPBA 4I2QA 5KFBA 5KFWA 3M8QB 4ZP8A 5EWFA 3OHBA 4K4XA 1QE1A 5CYQA 3PZPA 2J6UA 5KG6A 4K4ZA 3BGRB 1FKOA 4F50A 3KLIA 3BQ2A 3MTKA 1UWBA 4U7CA 3V6JA 3PW4A 5EWEA 4PUOB 4TXSA 5DGAA 2ZKUA 3MECB 4KO0A 5I3UA 2YKMA 1GX6A 2XCPA 1RT1B 2VA2A 3H2LA 5KFZA 3HVTA 1SUQB 3DRRA 4NLDA 3C6TA 4R8UA 4NYZA 3KLGA 5D3GB 4LQ9A 4YR0A 1JIHA 5HROB 4ECYA 5DLGA 2BQRA 2FJWA 3V81A 2AX0A 2IAJB 3JSMA 4O44A 4DEZA 1S4FA 4R5PA 1NHUA 1RT3A 1EP4B 4KE5A 1HNVA 1IKYB 3IRXB 3UPFA 5KT7A 2W8KA 1JLAB 1RTIA 2VG5A 2FLLA 3KOAA 3M8PB 4ECVA 2ASLA 4Y2AA 3I0SA 1JLGA 2HNYA 4IQXA 2D3UA 3MFIA 4YR2A 1D0EA 1RT7B 2HWHA 1S1XA 1IKXB 4B3OB 1JKHA 5KFLA 5C25B 2D3ZA 4DL7A 5J2PA 4TYAA 3LP1A 1K1SA 4NLVA 3UR0A 4NLRA 2BANA 2ZD1A 5DG7A 1C1CB 4IFYA 4RUCA 3MR3A 4WXOA 1FKPB 1R0AB 3GIKA 2C2RA 1JLBB 3M8QA 1RAJA 3H5UA 2AQ4A 3BGRA 4ECUA 4NLQA 3RB3A 3DRSB 3T1AA 1KHVA 3D5MA 4URGA 5DLFA 5KG4A 1S0OA 3KMQA 3CIZA 1LW0A 2XGQA 1C0UB 2D41A 1LWFB 3BJYA 4PUOA 2VG6A 4TN2A 3RBDA 3MECA 3KLHB 3IS9B 1RT5B 2IMWP 3H4DA 4X2BA 2D7SA 2EC0A 1S1UB 1RT1A 4RW8B 3KLVA 1TL1B 5KFMA 1SUQA 5T14A 2FVRA 4ICLA 5D3GA 4ZVFA 1TKXB 5HROA 1SH3A 4RZRA 2UVRA 2IAJA 4ECSA 4ZP9A 5KT5A 4ED0A 2DPIA 1EP4A 4ZP6A 1IKYA 2BE2A 5CYMB 3G6YA 1RT2B 1JLAA 4IKAA 4PWDB 5KFYA 3HVWA 4LQ3A 5J2QB 4IRDA 2IA6A 1DLOA 3CDEA 3BQ1A 5J1EB 1RT7A 3ISNC 1S9EA 5DGBA 1IKXA 4B3OA 2WB4A 4ECZA 3RBEA 1QUVA 5C25A 2VG7A 2FJXA 5EWGA 4I2QB 4WZQA 4TQRA 4WYLA 1IKVB 1FKOB 3KLIB 2B43A 4NLXA 2C2DA 3MR2A 5F8JA 3OL9A 1C1CA 2R2UA 1VRTB 1R0AA 1JLBA 5L1IA 3M9OB 1C1BB 5I3UB 1S1VA 2YKMB 5F8IA 3KLFA 5KFAA 4IR1A 3QIPA 1C0UA 3DRRB 4IH7A 4R8UB 4K4SA 4KB7A 4QWEA 1N6QB 3N6NA 3DOKB 1D1UA 3KLHA 2YNIB 3V81B 1RT5A 1NHVA 1BQMA 2R8IA 4R5PB 4RW8A 2I5JA 3PW5A 1TL1A 1HPZB 4XPCA 3FDSA 1KHWA 5KFNA 2JC1A 5L1LA 5F8MA 3LANA 1S9GB 5F8LA 4MKBA 3MEEA 4NLPA 4Q0BB 4KHRA 1JLGB 1S6PB 2HNYB 5J2NB 1YVFA 4NZ0A 1S1XB 3H59A 3ICLA 5CYMA 1RT2A 1RTHA 4PWDA 4QWCA 4RNMA 3OSNA 4MK7A 3UQSA 2YNGA 3PW7A 4TY8B 4MFBA 2OPQB 3I0RB 2GC8A 4Q8FA 2XGPA 3BQ0A 2BANB 3CVKA 5DQHA 4YQWA 2IC3B 3NKYA 4QW8A 5F8GA 3BSAA 2B5JB 2C28A 3OHAA 4DG1B 3KK3B 1IKVA 2GIRA 1TP7A 3FQKA 1S97A 5KG1A 1RDRA 1LW0B 3QO9A 5KFXA 1BQNB 1VRTA 3FQLA 2OPSA 1LWEB 2VG6B 3H4BA 1JX4A 1TQLA 4Q45A 5L1JA 1C1BA 4FBUA 4I7FB 1XR6A 2JLEA 3HVAA 3V4IA 2IM3A 3QIDA 3IG1A 4KBIA 3VQSA 4K4YA 5KFJA 4DL4A 4ICLB 4ZHRA 3OLBA 1N6QA 4ED2A 3DOKA 2YNIA 5KG2A 1RT4B 4XPEA 3FRZA 4TQSA 4K4UA 2BE2B 3E01B 4O3NA 5L1KA 3T5HA 1HPZA 4O4GB 3H5YA 2WONA 3KJVB 1S9GA 5FDLA 5JUMA 4Q0BA 3GIJA 1DLOB 1S6PA 4NLUA 4F4XA 5J2NA 1QAJA 1RA7A 3SFGA 1S9EB 2JC0A 1W25A 2ILZA 3PR4A 3EZUA 2VG7B 3GYNA 1CSJA 3SI8A 1T3NA 4TY8A 1QAIA 2OPQA 3I0RA 5KG3A 5KG7A 5KFPA 4DL6A 4ED7A 5JXSA 2HMIA 2WHOA 4HYKA 4QWBA 5L9XA 2IC3A 4YMEA 3N6LA 3V6KA 4RNNA 2IM1A 2B5JA 4O3PA 2UVWA 4RNHA 3G6VA 4ECWA 4DG1A 3KK3A 1S1VB 2WK4A 4H4MB 5KFIA 5HP1B 4WFXA 4J9PA 4WFZA 3KLFB 3KHLA 2IM2A 2YNHA 3QZ7A 3G6XA 4ECTA 3QIPB 4J9RA 3RB4A 1BQNA 2W7PA 2R8GA 4RW6B 1WNEA 2OH2A 1RTJB 1LWEA 4IH6A 4Q44A 3NMAA 1SV5B 2JEFA 1BQMB 4I7FA 2YKNB 1RTDB 2I5JB 2BRKA 2IJNA 4WXWA 1S48A 3IGVA 3HHKA 3DRPA 1ZTWA 4LSNB 1JLFA 4URQU 3MEEB 4M95A 4NLWA 2JEJA 3GIIA 1LW2B 4RW7B 5KFCA 1RT4A 2YNFB 3E01A 5I42A 3DM2A 3ITHB 1RTHB 4O4GA 2GIQA 3DDKA 5KFUA 3Q8SB 4JUZA 3KJVA 2YNGB 4RNOA 2R8JA 4MK9A 3SFUA 4GC7A 4MFBB 2BQ3A 2WTFA 4Y34A 4MK8A 2C22A 3EPIA 1HQEB 4ZVHA 2XC9A 1DTQA 3IGNA 4J9KA 2V9WA 4JV0A 3DLEB 2W9CB 4LSLA 2IBKA 4WE1B 2FVPA 3GV7B 4IR9A 1RYRA 3PW2A 1IM4A 4ED3A 4TLRA 4H4OA 4NCGB 4O3QA 4IG3B 3V6HA 3CJ0A 1N5YB 3NGDA 2ASDA 3KK1B 3QO9B 4NLOA 1ZTTA 2OPSB 4QWDA 4F4YA 2V0NA 4RNFA 4EBDA 1JXLA 3V6DB 4DL5A 1S6QB 4RW4B 3MFHA 4H4MA 5HP1A 3V4IB 3IG1B 1S10A 4RW6A 3DOLB 1RTJA 2HNZA 4ZHRB 5F9LA 3BSOA 2FLNA 4IRCA 1T94A 1SV5A 3FFIB 3DI6A 3DLKA 4IRKA 5J2MB 4DL2A 2YKNA 1RTDA 3KNAA 3PW0A 1RA6A 3PJWA 2WONB 4J9MA 4ED1A 2HWIA 4LSNA 3DMJB 5FDLB 1S49A 3CWJA 4WZMA 1S1TB 1LW2A 4RW7A 3ISND 5KFQA 2YNFA 3I5CA 4K50A 2ZE2B 3KHHA 1HNIB 4ED6A 3ITHA 4ZP7A 2R8HA 1J5OB 3E51A 2W9AA 1TL3B 3DYAA 4ZMMA 5KG0A 5KFGA 3QZ8A 1I6JA 4FBTA 1HQEA 3Q8QB 4IDKB 5KFDA 2HMIB 2XI2A 3DLEA 2W9CA 3OL8A 4HKQA 2FVCA 4WE1A 1C0TB 4F4ZA 5KT4A 3DLGA 4ID5A 4NRTA 1DTTA 3G86A 4FS2A 2VA3A 4NCGA 4IG3A 1JLCB 2CJQA 1N5YA 1RYSA 2YNHB 3NBPA 3KK1A 3NAHA 5KG5A 1HYSA 5HBMB 3PR5B 3IN5A 3V6DA 4H54A 1ZETA 1S6QA 4RW4A 4NRUA 2XCAA 4J9SA 3EPGA 2XWYA 1KLMB 3MEDB 4Y3CA 5KFFA 1Z4UA 2HAIA 2J6SA 3DRPB 3DOLA 1JLFB 5DG8A 2RDJA 3FFIA 3LALA 5J2MA 1SH2A 2V4QA 4NLSA 3T5JA 4IG0A 3MEGA 5I42B 3QGIA 3DM2B 3LP0A 5K14B 3LAMA 1GX5A 2BR0A 1XR5A 4QW9A 1TKTB 3RAXA 3PHEA 3DMJA 1VRUB 3JYTA 4KKOB 1S1TA 2HNDA 3T19A 3D28A 2ZE2A 3Q8PB 1HNIA 1DTQB 4O3OA 1N56A 2R2SA 4ED8A 4OL8A 4K4VA 5HLFA 1J5OA 4LSLB 2UVVA 4KFBA 1HARA 2AGPA 5C42B 3QGHA 3TQ1A 3H5XA 1TL3A 1HQUB 2FVSA 1N48A 1IKWB 3KHRA 1TKZB 4H4OB 2FJVA 2UUWA 2XI3A 3GV5B 1S1WB 3N6MA 2RF2B 4IDKA 5KFTA 1FK9A 2E9RX 5DG9A 1C0TA 2BQUA 1REVA 3CJ2A 4EBCA 3CJ3A 4GC6A 2FVQA 2I1RA 2J6TA 1LWCB 1JLCA 3CJ5A 5DQGA 2R8KA 3MR5A 2WOMB 3TVKA 4IH5A 4MIAA 1U09A 4ZPCA 4G1QA 1XR7A 1S9FA 1NNDA 4XO0A 2HNZB 1MU2B 1TV6B 2OPRA 5HBMA 2OPPA 3DI6B 3DLKB 2CKWA 3I5AA 3T5LA 4ZPAA 1RT6B 1KLMA 4YP3A 3GV8B 3KLEB 3MEDA 4J9NA 4O3RA 3KMSA 3OL7A 4K4WA 2AGQA 3LP2B 3GILA 1JLEA 4QPXA 3RB6A 1JLQA 2W9BB 4I2PB 2AWZA 4YR3A 3CJ4A 4ECXA 4ECQA 1HMVB 4IFVB 3BREA 4J9OA 5KFSA 5F8HA 3OL6A 1S0MA 5K14A 2W7OA 4TYBA 3C6UB 4JV2A 5KFEA 1TKTA 2IM0A 4KV8B 4ZPDA 2WCXA 3PJXA 1VRUA 5DQIA 5KT2A 2AU0A 4KKOA 2FLPA 3DYAB 3TAMB 4Y2CA 3QYYA 5EDWA 2JEGA 4MH8A 1T05B 3NL0A 4WFYA 4MIBA 3M9MB 3UDLA 4RUAA 3KK2B 4RW9B 3OLAA 5C42A 3RAQA 2ALZA 1HQUA 3H40A 5C5JA 4EO8A 1IKWA 1TVRB 3DLGB 4ID5B 1TKZA 1DTTB 2R2TA 4PQUB 2UUTA 2WRMA 1S1WA 3QGGA 4MKAA 1K1QA 2RF2A 4KSEB 1S0NA 3NBPB 3BSNA 3OSPA 3IRXA 1HYSB 3MR6A 4DL3A 4NLGA 2DPJA 4R0EA 3M8PA 3I5BA 3QLHB 4JV1A 1LWCA 1T03B 4NLYA 2WOMA 5C24B 4J9QA 2B6AB 3BR9A 4TY9A 2RKIB 1MU2A 4G3IA 1TV6A 1N4LA 1OS5A 2ATLA 4O3SA 1EETB 3PVXA 5KT6A 4EEYA 1QE1B 1RT6A 3LAKA 3MEGB 4IG0B 5CYQB 3KLEA 3LP0B 4U6PA 4K4TA 4EYHB 3LP2A 3FSIA 1UWBB 3GQCA 3Q8RB 3JYTB 4I2PA 4URSA 4WYWA 4ZVGA 2W9BA 1FKPA 4EBEA 2W8LA 3NAIA 2HNDB 1HMVA 4IFVA 4KHMA 5KFKA 4KO0B 2RDIA 2O5DA 4KAIA 4EYIB 2QV6A 3DRSA 3C6UA 5HLFB 4RU9A 4KFBB 2UVUA 4KV8A 4M94A 4J9LA 3HVTB 1LWFA 3C6TB 4Q43A 3KLGB 4QWAA 2JEIA 3TAMA 2BRLA 2QE5A 5KFHA 2AGOA 3T5KA 3IS9A 1T05A 3JSMB 2F8EX 4O44B 5KT3A 1RT3B 1FK9B 1S1UA 1HNVB 4RW9A 3KK2A 2AX1A 3CO9A 3H5SA 1RTIB 1REVB 2VG5B
chains in the Genus database with same CATH superfamily
1ZPVA 1TKXA 3M30B 4Z7CA 2V4RA 2R2RA 2HBZB 3R5AA 1GNKA 3H90A 4G1QB 3DLHA 4O4RA 2EFPA 4LF5F 4DV7F 4IFYB 5IT4A 3JB9k 5EWFA 5CYQA 1F3FA 3PCOB 3IWNC 3V6JA 3PW4A 4TXSA 5DGAA 3J7A1 3L9ZA 4LF8J 3WX4A 1RT1B 1KOOA 1NB7A 4WPAA 4NL5A 3SCLE 4HH1A 4P9SA 5DLGA 3FMWA 2AX0A 3UPFA 1DBDA 1M90T 2J9EA 4ZITA 1WEYA 4XDDA 3ETOA 5J2PA 4TYAA 1YJWS 3BV8A 4GVBA 4KGKA 1WHYA 2RDDA 3O5TB 1NAQA 3N79A 3QT7A 1TUGB 3MCNA 1UKUA 3VAHA 2CNNB 2VHGA 2J5AA 5GAHI 4ID8A 3MM5A 4NZ6A 1SUQA 3RYLA 4ED0A 3G6YA 1JLAA 4IKAA 5L39A 4K0KF 1GAOA 3HVWA 3CDEA 3K0JA 1VCTA 2HK2A 4I2QB 3N9UC 1MW7A 1JLBA 1FRIA 1IBKJ 3M9OB 5I3UB 5F8IA 2VBZA 4DSKA 3A1YG 2ZH8A 1HPZB 4ANCA 3MEEA 1QD1A 1VRQC 3PX4A 2ZHAA 2XY6A 3PYGA 5DZ6A 3W9JA 5IT9U 4WIQA 3ZFVA 2B9WA 2QG9B 3LPYA 5KFXA 2RQCA 4HR2A 3NCPA 2O3DA 1VQOS 4X4OA 1M1KT 2V68A 3AB4B 4OQJA 1GXUA 3SZ2A 2HHXA 2XYHB 5HI7A 4LFCJ 4UOFA 3AH6A 2GS8A 4I64A 3NGUA 4O3NA 3IXQA 1S9GA 1IQZA 5J2NA 3G8SA 3T1HF 2DNKA 3CJQA 3F0NA 3MCOA 5J1PA 1TFYA 3TQEA 5KOWA 2HMIA 1NK4A 1HHTP 3G6VA 4ECWA 2BEFA 5A8WA 4X4UA 4NXNJ 3NXZA 1UCNA 1U25A 1LWEA 3NMAA 4P2FA 2EFGA 4CNYA 4AL7A 1R27B 2HURA 4WXWA 4USHA 2JLGA 1ZTWA 2EG1A 3M6VA 5L9NA 1UFLA 3UN5A 1RTHB 2F7VA 4F4KA 3CC4S 3MPWA 1TL4A 3EVWA 2XS5A 2XC9A 1I5OB 5E3QA 4NWBA 4WE1B 1RYRA 1RQ0A 3KK1B 2SXLA 2V0NA 1JXLA 3V6DB 1S6QB 3MFHA 4H4MA 3R7BB 3TWZA 2HFVA 2HNZA 4IRCA 1FXLA 1EX8A 3DLKA 2DBBA 1P8GA 2OTJS 2VFSA 1X5OA 4DX5A 4N5SA 5G0RA 1TL5A 5CCLA 4WP8A 1IR1A 2G9OA 2RILA 3Q8QB 3LF0A 3OL8A 2Y1LB 5LXYA 5LMNJ 4NRTA 2DHXA 3PKMA 1VDHA 4KHPF 2CQ1A 3PO4A 5IC4B 2FIUA 4I69A 4ERDA 4ZCMA 1Y11A 4Y3CA 5DG8A 1MMNA 1KNZA 1A6LA 4U7UK 3T3FA 4OX9J 4F36A 1UWAA 3TUZC 4O3OA 3JAMU 4K2XA 4I4BA 5C42B 3FCVA 3H2UB 2YWFA 1C0TA 2AJFE 4G1IA 4ETZA 2BJ7A 5IOLA 3TVZA 2AP6A 3MR5A 2WOMB 2OPPA 1U6FA 4ZPAA 2AGQA 1Y5NB 1HMVB 1VOMA 3K58A 1B99A 2NUUG 2JEGA 5D15A 1YSJA 3M9MB 4RW9B 3BF4A 1IKWA 2QYGA 3KUGA 4IYQA 3AB2B 4X4SA 4C11B 3QLHB 2VD3A 2XZWA 3KLEA 3LP0B 1HWKA 4DN0A 3U1MA 4O0NA 2W9BA 1R8CA 1RHKB 2DVIA 3DRSA 4XAKA 2DGTA 2PSZA 4YDDB 4D3HA 2FD2A 3HT3A 3KK2A 2VF3A 1NPRA 4ECRA 2DKOB 4DR1J 4I6YA 4EMDA 3OW2R 3SDEB 2OPRB 2IVMA 2XHWA 1SKRA 4ZP8A 4K4XA 2PI4A 1FKOA 2GX8A 3BQ2A 2V8PA 4WFBQ 4WKYA 5JVHQ 2XCPA 4MTPA 1LFPA 4CLWA 4A8FA 2FJWA 4HHJA 3OJSA 2VJVA 3CGIA 4R5PA 4FF3A 3KOAA 3M30A 5GAEI 1RT7B 2KHDA 5HANA 3UR0A 1SC3B 1UFWA 4IFYA 4KRWA 3UNYA 5DLFA 5KG4A 2AD9A 2RMLA 4C0BA 4X66J 4DV4J 3KFWX 5LXRA 2IMWP 1CQNA 4LRFA 1RT1A 5KFMA 1F60B 3EGZA 4GKKF 4D3GA 3TEGA 5J2QB 5B7WA 4JI7J 4I6AA 3KKFA 1OY9A 3W2WA 4F3QA 5BYSA 4DR4J 5ETKA 3SQGB 2ZOMA 4CZCA 2I5JA 2X3DA 4GO7X 5HVGA 1NDCA 3ISZA 3FRYA 3H59A 4L3NA 1S7IA 5E3CA 2GGPB 1YJUA 3O3LA 3GLJA 2BJ8A 3BSAA 3K8VA 2C28A 4C8OA 2LA6A 3DHWC 3KK3B 3Q2TC 5H9FJ 3SCKE 3BH7B 2C3PA 3DRYA 1Q8BA 2BJ3A 2R3VA 2BYCA 2RUGA 1H0HB 1SJQA 3I96A 3R2CJ 3OLBA 1YIJS 4MAKA 1YBUA 4FF2A 3HFKA 4ZCIA 1SVDA 1HPZA 1RWPB 1XNRJ 4QPTA 3I6PA 2MQ8A 2E5IA 4CCHA 5KG7A 4ANDA 5CABA 4C3KA 3FSYA 2QO3A 4PG6A 1S1VB 1PO6A 4IO9Q 3GR0A 2LLZA 1CLFA 1S48A 1RUSA 4MYTA 5KFCA 2VPWB 1RZMA 3DM2A 5KFUA 5E41A 1Q4RA 2K3KA 4DV3J 3HK2A 2LXUA 3EPIA 1IXKA 4HLBA 1X4HA 3IGNA 2LXIA 4I68A 2M4MA 4IR9A 4P2SA 3DLJA 4UOCA 4ED3A 4OIXA 1SC4B 5KOXA 2CPIA 5A6WA 1N34J 5I3PA 1WKKA 1LEOA 3L95X 1UVNA 2YPYA 3UN2A 8ATCB 3DI6A 2UXBF 3TARA 4CLFA 4JI0F 3NRBA 2WONB 1PJ7A 2HWIA 2NYHA 3I5CA 2JL9A 2HVEA 4DUYF 3FKBA 2Y1RI 2KTQA 3QZ8A 3B82A 1L3TA 2V69A 1FX4A 3A8IA 1YHQS 5KFDA 3ZTQA 4WE1A 2MLZA 3IM8A 4LUBA 1NK5A 3HULA 3G86A 4FNIA 2NLWA 3KK1A 2C2OB 2QL5B 3V6DA 1RWKB 1S6QA 4NRUA 2XWYA 2H48B 1XNQF 4ES3A 2UV8A 3D9BA 4DPWA 2CQ4A 3BYRA 3JTNA 2BABA 4OZ1A 2N3OA 3QGHA 1T9VA 4C97A 1HQUB 1CQMA 3CULA 3D0GE 2RF2B 4OLOA 1LWCB 3ZZTA 5GAGI 1GMWA 1WSRA 1HIYA 3HVRA 1AA1B 1V5IB 3OL7A 2IRUA 2HHTA 4QPXA 4USJC 3CJ4A 3WBZA 4DQIA 1WC4A 4J9OA 2BW2A 4F4AA 2IM0A 4KV8B 4ZPDA 3VAKA 1NK6A 4RUAA 5C42A 3I9V9 3DLGB 1MN7A 1N5VA 2FUG9 3KNGA 3Q24A 3IBFB 4LBHA 1J5EJ 2XO7A 4NX9A 5IZHA 2NREA 4JV1A 2WOMA 5C24B 5HO4A 2PGCA 3GFYA 5IQQA 4OYAA 5LMUF 3JS9A 3U7JA 1FKPA 3Q8UA 1HMVA 5KFKA 2NR0A 2JEIA 5M2PA 3T5KA 4RW9A 1REVB 3K8WA 2RU9A 2YKQA 4DFJA 3OXLA 2OKQA 4C11A 1AZSB 3QLHA 1N5TA 1W26A 3J7ZT 3U1NA 3GIMA 2BW7A 3CDUA 4DR3J 2QC3A 2YWWA 5KFBA 2UUAJ 1PKUA 1G1XA 4E0DA 3TX8A 3DDNA 4CLPA 3SBMA 5KFZA 4PXDA 5HAOA 1J2VA 3IRXB 2FLLA 1HBUB 1VBYA 3SDEA 4DR6F 3G82B 4FYVB 2WB1D 1Y9OA 5CCMA 1YJTA 1JJCB 3EGNA 1XMOF 1MWZA 3BJYA 3QPIA 2GQQA 3THTA 1TL1B 4LRBA 4PWDB 5F3TA 3KJQB 1RT7A 2RT3A 1RGVA 4DUZF 1OJ4A 1QTNB 3R5GA 2ZITA 3IO1A 2B4PA 4DR5F 1R8HA 5BR8J 2VPXB 2Z8QA 5L1LA 4H4KC 2CADA 3NG8A 1T0TV 3PX0A 1NK9A 2HQ3A 3H8YA 3P8BB 4L72B 2EK1A 2W4DA 1CPZA 2H54B 4QU6A 2O01C 1QJHA 3GZ7A 4K7QA 1JX4A 3VTIA 1RKIA 5KFJA 1S76D 3U27A 3SQGA 4KIAA 2BE2B 1UVIA 3LUYA 2LQBA 3BH6B 5FLXU 1DLOB 2HFSA 3M2RB 4CO2A 2KZZA 2I38A 2ILZA 1CSJA 2GGPA 1UMJA 5KFPA 1K9MT 3M2UA 4QWBA 3A8EA 3KK3A 1DQAA 2GHVC 4WFXA 2QN6B 3DU6A 3KLFB 2YNHA 2BOAA 4QYZK 3ZZ0A 1ELOA 2YVSA 4NCBA 3CE8A 1MSWD 3DDKA 2YNGB 1YBAA 2RQ4A 4RLEA 3EXYA 3LGNA 2YWKA 3PW2A 3RG6A 3D3CJ 1Y10A 5BYRA 1Q8KA 4LFBF 4PXBA 4OV6A 3MM8A 2HS3A 3GSDA 4UTGA 2QFJA 4DL2A 1U0HA 4E98A 3UD4P 3KNAA 4UZBA 3PJWA 2C42A 4PQAA 1X5SA 2ZHBA 1HNIB 3MPUB 1B0VA 1NSQA 2PFFB 3OTCA 1V9OA 1JLCB 2CJQA 2KYZA 1RYSA 2X7IA 1NSPA 5D0GA 3EPGA 4LFCF 1JLFB 2J7KA 1Q86T 4K59A 2V4QA 2Y8WA 1TKTB 3D54A 2JH3A 1HARA 3GG1A 4L3KA 1XEZA 3H5XA 2AGPA 2KHCA 4PXEA 3GV5B 2EG2A 2E5LJ 3ELHA 2BXJA 1KVKA 2HHQA 4PPZA 2QL7B 1YZ6A 3I5AA 4B9TA 1PCAA 1RWMB 2ZBPA 4I2PB 2HPUA 1PBAA 3C6UB 3PJXA 3TYTA 5DQIA 3A3PB 5CA5A 2KXNB 3GR1A 1HQUA 5M2RA 2DGVA 3H40A 3K59A 1W7WA 4EWTA 2RF2A 1TK5A 2DGWA 4DL3A 2EBGA 1LWCA 3PTWA 2B6AB 2BM0A 2GFFA 3AOCA 4K2JA 1VQ5S 1QE1B 4U6PA 3MEGB 2HIQA 3DRXA 1N54B 2RDIA 1RCOB 5IV3A 4KFBB 1QLNA 4KV8A 3ZZUA 3HVTB 4Q43A 3PACA 3IS9A 5LMNF 3L7OA 1HNVB 1RTIB 4GMKA 3CC2S 4YB1P 1N36F 4HEA9 3TA1A 2BV3A 2CVEA 1JKHB 1RWNB 2WVCA 4EO6A 2G2YA 5C24A 5J1EA 3VF0B 2UU9F 2GW8A 2AMCB 2Y0SD 1Y3JA 1X0PA 3OD2A 2GMHA 3RRHA 4KPYA 1SPBP 4A47A 2ZH3A 4EUVA 3QMQA 2DXFA 3CB4A 4DLEA 4DSIA 2GQCA 4B3TF 2ASLA 3N5BA 3NWGA 4IQXA 1NPPA 4RBUA 1UVKA 5C25B 1AZSA 2YWGA 1F9EB 4NLVA 2ZM6F 2DHAA 2G0JA 2HFUA 1UW4A 1R0AB 3JQMA 3ILIA 1RAJA 2A10A 3H5UA 2LEAA 1KHVA 1AW0A 2L9DA 2VG6A 3BB5A 4FYDA 1NDLA 3A3OB 3PIOQ 1N5QA 1U4BA 1R89A 4ZP9A 4ZP6A 3GIRA 3SSQA 5KAKA 1HBUA 1G4CA 3O6QA 1ZPWX 3FSXA 4TU8A 4NLXA 3OL9A 5GMKa 3L09A 5AJ3F 2ZBIA 3HHLA 1YG0A 3BYPA 1U49A 2PFDA 3DRRB 3UDEA 1KQKA 2ZC3A 4KC5A 3N6NA 3DOKB 1FNOA 4JI3F 2R8IA 4ZDNA 2BKNA 1TL1A 1KHWA 1R31A 2F9JA 4DR1F 4C7QA 4PWDA 3HFZB 4RJVA 1NHKL 2OPQB 4M5JA 3CVKA 3DOMB 3QRPA 2Z2MA 1TFWA 1RBOB 4DFPA 3MCSA 4PWWA 4CH1A 3RR7A 1JB0C 5KG1A 3NY0A 3MM6A 1D3WA 1UTAA 4FBUA 1GTHA 3HVAA 1HNWJ 1KTQA 4DL4A 3B6BA 1PJ6A 2EXUA 2G1DA 2KI2A 4FKXA 3BGLA 5FDLA 1EARA 2F40A 4HHUA 4CP5A 3NWRA 1UVJA 4FDFA 5KG3A 1U45A 4ED7A 2R9LA 4LBPA 4RUHA 4RNNA 2IM1A 3L7PA 1QSLA 2WK4A 2ZH9A 2MKJA 3RRGA 3CJKB 3RTVA 1SL2A 5MLCV 4K5RA 1ZAXA 4DPOA 4LRDA 3LGMA 3QT6A 2IIHA 3C66A 5A0YB 2ZOGA 3W9IA 2XO6A 3GJTB 2XSFA 2W1BA 2CQCA 3CXCR 2W9CB 1B70B 4M8LA 3GV7B 1L3SA 5ETSA 1IM4A 2CZ9A 1W2IA 4ZVTB 3EGWB 4NLOA 4A4JA 2G0IA 3BBCA 1Q7YT 3DOLB 3K2YA 1T94A 4B9NA 2VKZG 1Y0HA 2CVIA 2DYAA 5E5NA 3QRQA 1U2RA 2YKAA 1D8ZA 1J5OB 2VQEF 1JJHA 2OP5A 4YFUA 4RPFA 2M7SA 5KFGA 2KVIA 4IDKB 2H5EA 2MKSA 5K5MA 1PJ5A 1RBAA 2F63A 3M32B 3A12A 3TI0A 2HLTA 3A3NB 2OJ3A 3IN5A 3RBZA 5LSRA 2GVZB 1EHWA 3MEDB 4Y2KA 3D6TB 3PNIA 2YWHA 4IG0A 5I42B 2A6OA 1F1BB 5IQ6A 3Q8PB 1HNIA 4BBYA 1OPZA 2H5JB 3V5RA 2FVSA 2NPIA 5B0BA 1XIQA 3AD8C 7FD1A 4ELUA 1CJUB 2I1RA 1CJVB 1JLCA 3TVKA 3W7BA 2FHJA 1RACB 2IFXA 2N82B 2MLYA 1YRXA 4EFAC 5AXNA 2PA3A 2A3JA 4C3LA 4TVAB 3SMZA 2J9CA 5D4PA 4HACB 4DF8A 1TKTA 3V4MA 4PYDA 2K3IA 2UXCF 2G4BA 1FA0A 5AE1A 2CPZA 4EO8A 3OXFA 3B4MA 3MR6A 2HS0A 1N34F 3KTQA 1RLDA 2ATLA 2CIMA 1TZ0A 2CQPA 3FVYA 3MM7B 5HATA 4WFAQ 4OJGA 2OTLS 2J0QD 3JYTB 4I2PA 4LR8A 1A0OB 2MYFA 3C6UA 2V2QA 1XMQF 5CXTA 4NEZA 2OUGA 2QE5A 2F8HA 2CZVC 1RAAB 2FZKB 3W8GA 3CDWA 4DV2J 3G2XA 2HHUA 5HQMA 2C2EA 3QWPA 3CIMA 2B6AA 3T41A 1JLEB 1O0PA 1NSAA 3PYFA 1BE4A 3D6HB 1QE1A 3MTKA 2YWEA 5J1NA 2D3OR 2CJKA 3HVTA 3OUYB 1YJ9S 4LQ9A 1JIHA 3B54A 4ECYA 3V81A 4DEZA 2DCLA 1HNVA 1RTIA 3NS6A 2E1RA 1IKXB 3TANA 1JKHA 1SQFA 5B0GA 5KFLA 3W5ZA 2ZH6A 4TLQA 4X62F 2MY7A 2ROGA 4DHVA 2B3TB 1CJKA 4M1KA 5T7LB 2QYCA 4LVNP 3VAGA 3R7SB 2PT0A 4F04B 2XWXA 4KGZB 2DR7A 5ETTA 1S9EA 2WB4A 4ECZA 5C25A 4ZOSA 3LO3A 2H1YA 1RABB 2XMUA 4UUXA 2YY3A 4Y2IA 1OY6A 2ZH2A 1R0AA 4I0WA 1Q16B 5HVFA 2VBWA 4IR1A 2AJ4A 4RX6A 2FPHX 4K4SA 4KB7A 1QTMA 1FE0A 1HBOB 3NOGA 4TNOA 2HNYB 2IPOB 3CEDA 3QJPA 5U47A 4TY8B 2BANB 3PM9A 3DKDA 2KDOA 3VVTA 4EGLA 4DG1B 2NUHA 2GA7A 1RDRA 1LW0B 2CDRB 1BY9A 2W2NP 4JI2F 3HXMA 2CNKB 3QIDA 5BJRA 4WFNQ 2DR5A 4I67A 3EDQB 4N7TA 3DOKA 3CCLS 1T8EA 1FEHA 3J81U 3AOBA 1F5CA 4BWMA 1W25A 4R0JA 2VG7B 2OPQA 1NCLA 4FXVA 1X7VA 4HYKA 3DOMA 2PE8A 1U2FA 5L9XA 4XK8C 2JX2A 2OIHA 3QZ7A 2ALYB 2AW0A 4Q44A 2LDIA 3KDNA 1QAYA 2LQ5A 3IGVA 3K7RA 4Y2MA 2B4UA 2WSEC 1GMVA 4P2MA 4GC7A 1AFIA 2M0GB 1CG2A 2V9WA 1ICEB 4WJBA 3IBWA 2V6AA 2V67A 3R7NB 2K7JA 4F4YA 1ZZNA 3VGSA 1R43A 3IG1B 3MWBA 1OPIA 3R5CA 5C2GA 4FKYA 2RD5C 5A0YA 5KFQA 3Q89A 3OR1B 3UO0A 1TL3B 4OHYA 1M1HA 2KJVA 1OO0B 5GAHU 2W9CA 3NNHA 4LF4F 4EZ6A 4FS2A 4XDCA 1OYEA 5KG5A 1M5VC 3ZZRA 3DRPB 3DOLA 3BEGB 1HW8A 3K5PA 1WOOA 5LOQA 2DGUA 5B08A 1YJVA 3PIPQ 1GMWD 3HX9A 1JJ2R 1I51B 4PR6A 2R7OA 4CM0A 2HSEB 3GCWP 2R2SA 4OL8A 3W2VA 1J5OA 4RO0A 3A4TA 3DLLQ 4H4OB 2KL8A 1BWEA 4IDKA 4CH0S 4GC6A 3FEYB 3ET6B 2CKWA 2GVZA 3T5LA 4YP3A 3MEDA 4ZPTR 4DQRA 5C2CA 5F8HA 2W7OA 4F3MA 4YHHF 2VOOA 1NH8A 4ZCKA 2VDIA 4KT0C 2ALZA 1TVRB 2ZHOA 2RQMA 1GK8A 3EYZA 1NZ8A 1CJVA 2NZ4A 3BR8A 1OS5A 1N4LA 3PVXA 3LAKA 4EYHB 1FWLA 4DMZA 3EWGA 2WZ1A 1FI4A 3S6EA 1SKWA 4DX7A 3WC2A 5F3ZA 2F8EX 3G71S 1A9NB 4HDHA 2OELA 1HKAA 2DIVA 3NNAA 4Q8EA 4LF2A 2LYVA 3LP1B 1NJIT 3HKWA 3P96A 4ZVQB 3F41A 4YN3B 4X4RA 4KQZA 3CCUS 1YTYA 1P9YA 1VIXA 4A8YA 2HVZA 1U1RA 2HVIA 2M70A 1TKDA 2HFOA 1Y5LB 2BM1A 2ADCA 1NLKL 2YKMA 1GX6A 1WC1A 4WU2A 4C98A 4CO5A 4MJKA 4YR0A 2MZTA 2HHHF 1VJWA 1S4FA 2DNNA 5B0CA 3VGVA 4OZJA 1VBXA 3MMBB 2D3UA 2HWHA 4YUDA 3I82A 5DDQC 1VK3A 3HPOA 1K0VA 3DXSX 1CJTA 5CZXA 2KM8C 3VCDA 1HNZF 3RB3A 3T1AA 3C15B 3D4JA 4TN2A 2DK2A 4DR7J 4QYRA 3OUYA 3HJFA 1EJ7L 4CT8A 2RVJA 3VGUA 1WG1A 2W4PA 2ZZMA 4DV5J 4ED5A 1H7XA 4ILRA 4ANEA 1IKXA 1VC6A 1D09B 1RADB 1TL7A 1N88A 1OMSA 4RBVA 5D0EA 5LT5A 2EPIA 3KLIB 4DR2F 2C2DA 5F8JA 4YOEA 1S99A 5L1IA 2QIFA 3VWSA 2PIIA 3AJ1A 5IV4A 1X4BA 3QIPA 4ZN1A 1CC7A 3TUIC 2DRBA 3OFEA 3EGVA 2Y0BB 2XMTA 3H42A 2QEXS 4BWJA 1AXQA 2V63A 4DV0J 1YVFA 2MB0B 3AJDA 4ZVRB 2E1CA 4QWCA 4U9RA 1WHVA 2IHR1 2RAQA 3AHPA 5ADZA 3B78A 2IC3B 3NKYA 2RB7A 4CO4A 1UZDA 3OHAA 4DCOB 1U1KA 1N32F 4FYXB 2B0GA 2I9SA 2D9PA 4ICLB 1S7HA 3FRZA 3E01B 2RRBA 1HBOA 2J8AA 5DDRC 3GIJA 2LQJA 1UL3A 3NP5A 4TY8A 3N01A 1WG5A 1T3OA 1IQTA 1S12A 2UUCF 5JXSA 1I3OB 4YY3J 1UJ6A 3V6KA 2HRYA 2YPZA 2XG8A 2VPZB 3R2DJ 4DG1A 5D0RA 3HSZA 3HDSA 2W7PA 3PEHA 4B9UA 3CC7S 1N33J 3NOCA 2WVFA 4JI5J 3HHKA 2J7UA 3UWTA 1GEHA 2KFNA 3D2WA 1FE4A 1X0FA 3ZZZA 4DN9A 1DTQA 1MNEA 3QRRA 4NCGB 4O3QA 4IG3B 1OIAA 1U6ZA 2X51A 4DU8A 2QTWA 1RWOB 4RL1A 5GAEU 2JVOA 2QSWA 3WQPA 4G6VB 3CWJA 4WZMA 4DXLA 3FNNA 3QWUA 3ZTOA 1IJEB 2IY5B 2PO4A 4TU9A 2IDEA 4X64F 2KKHA 4AYBD 2E44A 2VA3A 2NXEA 3VHQA 1LKZA 4A8WA 3I55S 1UPPA 4KH0B 4QIFA 1HNWF 4J9SA 1ZM4A 5KFFA 2HAIA 3D1HA 2YKOA 1L3KA 2B8PA 3W9HA 1U6BA 4RUBA 3BPSP 5A6PA 4KKOB 4OZ2A 5A2QU 2GZOA 1HR0J 2A2CA 4P6QA 3OR1A 2IYGA 3IFEA 1TL3A 2UUWA 1ROFA 2UUBF 4KTQA 2XS7A 5RUBA 2LU1A 4YB6A 3CJ5A 3F56A 5EN1A 1PYSB 2VV5A 2AJ2A 4N56A 1VQLS 4J9NA 1JLQA 1PSDA 4MT1A 4AL5A 1U1MA 5JMNA 3QYYA 4OYOA 1IWAA 3FBCA 1GMUA 4HTIA 2WRMA 1DTTB 3M8YA 1TR0A 2GQ2A 2DPJA 2L08A 3CCRS 1WEZA 3I5BA 2B4VA 1F9HA 3ET6A 3CCWA 2MTLA 2N3LA 4FVCA 5KT6A 4BLGA 2G2ZA 4DI6A 2NS1B 1LXJA 2MKKA 2HHVA 4KO0B 2UVUA 1UJ5A 4NA2A 4B08A 2AGOA 1WELA 3VAIA 2GVDB 5F0UA 4KH1B 2J9DE 1TVRA 2AZ1A 3AOAA 2F4VJ 1FNMA 1HBMB 1X4DA 4C8NA 4DV6J 4FS1A 5GMDA 2E9ZA 1M5OC 1NXIA 3BKUA 2WBRA 1QAXA 4NMXA 2DNZA 1KSPA 3D1OA 1NJYA 2XMJA 3N0VA 1JQGA 3US5A 2BUNA 4AQYJ 2POKA 5C7PA 3PJ9A 3H7HB 4GVLA 3J7Z5 3EMTA 2XBPA 5D3GB 4NMLA 3WZ0A 4KE5A 3AD7C 2EFOA 1SL0A 4OYWA 1JLGA 1SJRA 1UETA 1D0EA 4JI6J 3WX8A 3MM9A 2AEMA 2RU3A 2HFNA 3LP1A 3O44A 3HT0A 4KGXB 4GO5X 2QLWA 4WXOA 4PRFA 3TRGA 2AQ4A 3H20A 4NLQA 3BN7A 2VFVA 1C0UB 2DR8A 5BXIA 1S79A 1IN0A 3HO1A 2BKOA 1S1UB 2I6WA 5CH7B 1SH3A 2ZZTA 3HHLD 4ECSA 1SI9A 1U8WA 1RU2A 1TUWA 4HL9A 3MMBA 5DGBA 1IBMJ 2EK6A 2F3JA 2W4CA 4UW2A 1BGXT 4YEAA 1ZS6A 3HZEA 1JNZB 2GO9A 2C3UA 1DURA 1M5HA 5GAGU 4KPCA 3C15A 4B3SF 1WSVA 2KG1A 2MSSA 3PW5A 2JC1A 3L7UA 1FX2A 4DV2F 1TK8A 3K57A 3HSGA 3PFOA 4MK7A 4CLYA 2MKHA 2YH1A 4OZ0A 2OMOA 2A0FB 3A8JA 3CPWR 3H4BA 1PIEA 5L1JA 5JVGQ 3CT9A 4I7FB 3V4IA 4LF7J 3IMQJ 2F4FA 4AD6A 4C3MA 3H5YA 4X65J 4NLUA 1UP1A 3SFGA 1U1OA 2QL9B 2V8VA 2XHCA 3QFWA 4YS2A 2CJXB 4IO1A 2GJIA 2VUGA 3CMQA 2IC3A 4YMEA 1WF2A 1X4GA 2NPFA 1ITPA 1YBTA 2R7XA 1VBKA 5HP1B 2ZH5A 3K89A 1KC8T 4B9LA 4U8VA 5ETOA 3IR5B 5JJBA 2OH2A 2ABYA 3P5TL 2YKNB 2P8IA 1RTDB 1HFEL 1FT8A 1CC8A 4U96A 1N5SA 4JV5J 3E01A 2M2BA 4M5GA 2PDAA 4OI2A 4OYBA 3SFUA 4CYUA 3C8YA 2PC6A 3TAPA 4LSLA 1OSDA 3NEKA 4K8RA 3J7YI 2A6MA 3QO9B 1ZTTA 2FY8A 2V2VA 5B0FA 3RAMA 4OYMA 2QGFB 4DSLA 4ZHRB 2DGOA 3CCZA 2HHWA 3PW0A 3OJUA 1FHTA 4CM2A 2CWKA 5FD1A 2DNQA 4DX6A 1RWWB 3L3CA 4HT7A 4B9VA 4X4VA 1NUEA 4HVZA 5D4LA 4DV1F 2XI2A 4F4ZA 4FPRA 4F0KA 3FJ2A 1SKUB 4NCGA 3D7SB 4IG3A 1NKEA 1HYSA 1RAGB 3PR5B 1ZETA 1SJ1A 5A76A 2HAFA 3THVA 1UEUA 3LAMA 4QW9A 3RAXA 2FHJD 1GT8A 1RBLA 2RUSA 2HNDA 4PXCA 4ZKAA 2NXNA 4ED8A 1X9SA 3MAQA 1MG7A 3NGRA 3FBEA 1YGYA 2UP1A 1FJGF 2AEFA 1KQGB 3MXHP 3TJ8A 2AYEA 2B7CB 3HHLC 4WF9Q 1XR7A 3BN4A 4JI8J 2B51A 4LF6F 4M5NA 3T6JA 4O3RA 2K2PA 3KMSA 1RAEB 4YR3A 5BYQA 3BREA 4NPOA 5DRKA 4NYOA 4JV2A 5KFEA 4KKOA 1XWLA 5ETRA 1WKLA 1VQSA 5E3AA 2L9WA 2IRYA 2XMAA 3TZXA 5C5JA 2UUTA 5IC6B 1IBLF 3MAAB 4HT5A 3OSPA 2BA9A 5CHCB 3M8PA 4U8YA 2ZJQQ 3BR9A 2NXUA 4G3IA 2HZAA 3P5BP 2HZCA 1WF1A 2IDLA 4KHMA 2MHEA 2RH3A 3KLGB 2K06A 1P1LA 4QQBA 1FK9B 4JI1F 4ZVFA 3OTDA 4CO1A 3H0PA 1E6YA 2Q43A 2KRBA 5DDOC 2ZD1B 4QIVA 4ZVSB 4LF5J 3ZTRA 4ZPBA 1AUDA 5KFWA 1O6XA 4NXMJ 3MDFA 4DQQA 3GE9A 3DHXA 4PUOB 1W2BR 4DLGA 3MECB 4KO0A 1EQMA 1FFSB 3D68A 1F3VA 2FGCA 3E2EA 2IAJB 2GVDA 4ENOA 4WU3A 2H65B 3FEXB 3MPVA 5D4NA 3HF5A 3C14A 2COLA 4ECVA 1HBMA 1S1XA 4B3OB 3M4XA 2ZDOA 2AT1B 3NCQA 4L76A 2IVYA 3THPA 2RHQB 5DG7A 1M0SA 2P9GA 4ECUA 4DUTA 2KH9A 1S0OA 1X4EA 2D41A 1LWFB 2ASYA 2D7SA 4RW8B 4J90A 4ELVA 4DFKA 5D3GA 2FDNA 4OJ1A 2CJ9A 4OZNA 1FDDA 5FLXY 3MUVP 1VC0A 5KFYA 4K0KJ 4FVMA 1YJ7A 4W98A 4HI1A 1MN9A 2VODA 1JXEA 2A18A 3ZC4A 4P2XA 1IJFB 3D66A 2XLJA 1R0BG 3GTYX 2DNLA 1DY3A 1S6OA 1C0UA 4R8UB 1HHQA 3TR5A 4J5OA 4ILMA 4ZIWA 2O66A 5F0WA 3OTOJ 2ZUAA 4QZVB 2M3DA 2DD8S 1U8SA 2DNPA 3UQSA 3MMCA 1F2GA 1URRA 3GJRB 1P27B 4C0HA 1VFJA 1FWPA 1KFDA 2C1EB 3F44A 3OXGA 1YJNS 2JLEA 2JNJA 1I94J 3RJMB 1WG4A 3QQCD 1FEEA 3MUMP 3KJVB 2VL1A 4B3MF 2O67A 3T1HJ 3EZUA 3GYNA 4LR7A 2I8EA 3RZAA 1OQ6A 4AE5A 4DCJB 2VC0A 2EI5A 4F8RA 1XJWB 4ECTA 3M8SA 1KN6A 1H74A 4DR7F 1BQMB 4I7FA 3D1QA 1SCJB 4C9DA 5IM0B 3PHTA 2ZJPQ 2IVFB 2N4CA 2M8HA 4OX8A 4MFBB 5G4DA 1HQEB 2JHEA 4PYAA 2FVPA 3KWMA 1PAUB 1RAHB 1NB2A 2V8GA 3CJ0A 1N5YB 2OPSB 1R8BA 1SQEA 1KQFB 1PYOB 2XM3A 4RW4B 1VQ9S 4N41A 5HP1A 2DH8A 5CD4A 1PYTA 3VZHA 3FFIB 2AV5A 1EB0A 2XLIA 2YKNA 1KRPA 1RTDA 3EDRB 1G2EA 4OI0A 2DISA 1KVJA 4LR9A 1HI0P 3N4WA 4DV0F 2DHSA 1WEXA 1YRUA 2CQ0A 1U02A 1Q0NA 3DYAA 1VQ6S 2KRRA 2P2CB 1PILA 1NU4A 3FK4A 1WD6A 2OD4A 4ZVPB 2FVCA 2DY1A 3NAHA 1VQYA 4KHPJ 4P10A 4H54A 2ZNYA 1ZH5A 2ROPA 1S59A 4ZLNA 1Z4UA 2X1GA 2VQFF 1O51A 1T9WA 2OI2A 4MYUA 2P9EA 2W24A 4JBCA 4IQMA 2M8DB 3T19A 3D28A 2NXJA 2YX4A 2H4WB 5AT1B 3OVBA 1H7WA 2ZBRA 4PABA 3QSYB 4A8OA 2FHKA 2Y9HA 1B0TA 2LEPA 3Q8YA 1U09A 4G1QA 4XIUA 1MU2B 2QMUB 4OX7A 2OSQA 5HJYA 4JI5F 1YITS 4KGVB 3S7RA 2VC1A 2W01A 4CTAB 2YQ1A 2CA9A 3OPKA 4TYBA 1IBCB 3PFEA 2D74B 1H2TZ 2DNOA 2V4JB 2AU0A 5KT2A 3PG9A 3TAMB 1X4CA 3NL0A 3RGIA 3I31A 1GQEA 4ID5B 1S0NA 3NBPB 2PEHA 2CJAA 4YB5A 2HBYB 1T03B 4OJ3A 2FQQB 3GG0A 3BO4A 3JTOA 1HNXF 4M5DB 3NAIA 4PG5A 5HLFB 2E1AA 4I6WA 4O44B 3CNQP 5KT3A 3R97A 3P3DA 2JWNA 3MAAA 1GH8A 4DCPB 3GU0A 3KHGA 4I2QA 2FGOA 2DEIA 3MI7X 2CPXA 2GHPA 3PZPA 1P1TA 3CDAA 4U7CA 5EWEA 2CAJA 1WORA 4B17A 5I3UA 5AE2A 3W61A 3H2LA 7FDRA 4ZIVA 2V50A 3KLGA 1F9FA 4H4KA 5KT7A 5K20B 4Y28C 3V2UC 3HCXA 2YKPA 2N4DA 2MEWA 5IS2A 4JI4J 1FXDA 3UCGA 2ZD1A 3ZNUA 1C1CB 5THWA 1KOHA 4OHWA 3LWLA 3GIKA 3BDEA 4URGA 1RAOA 3CIZA 4E8UA 4PUOA 1DQ8A 3RBDA 9RUBA 3MECA 1D8YA 4UQTA 1RHQB 4ZPVR 1TKXB 4GKJJ 2IAJA 2X1AA 3ADAC 2IA6A 4GKKJ 4B3OA 3IAS9 3NGSA 3M7VA 1DQ9A 3PY8A 2X1BA 1VRTB 3QJJA 1PGZA 1YK9A 1DHMA 4Y00A 1UEVA 3X1LB 2YNIB 5K8OA 4RW8A 1SC6A 3LANA 5F8LA 1WJ9A 4MKBA 1U26A 1S6PB 3C2PA 4NOHA 3PXGa 1FFGB 3R5DA 1RTHA 2CQ3A 5KTQA 5E33A 2PMZD 3FEZA 3OSNA 5EHHA 2GC8A 3HZGA 4YQWA 2MQQA 3JSYA 5H9EK 3RU0A 4W92B 2K1RB 2B5JB 3QGPA 1YX2A 4CWBA 2ZOFA 3UR3C 2GV1A 5HVHA 2JFKA 2LDYA 1YZ7A 2H3EB 1U0SA 5A8RB 1RE1B 2EW9A 1RT4B 4XPEA 4A8MP 4LF9F 4JYAF 2J76E 1RA7A 1ZZFA 2VKRA 2VOPA 1KONA 2VFRA 2MGZB 2BKPA 1Y5IB 4J9PA 4WFZA 3RB4A 2MMYA 1H38A 4IH6A 1H72C 4QR2A 2B4OA 2IJNA 5A8KB 2DNRA 2CG8A 3MEEB 3W60A 1AB8A 4Q5VA 3KJVA 4MK9A 4P75A 2BQ3A 3BZQA 4WKRA 3I32A 1VQ8S 3P45B 1M1GA 1AYEA 3NCRA 3Q86A 3NGDA 1VHIA 1B3TA 2BVZA 1KWMA 3WIUA 2B8QA 3C19A 3BSOA 4O0IA 4IRKA 3PYDA 2MZ1A 1RA6A 2UXBJ 5IM0A 4J9MA 4FZVA 2LMIA 2GMJA 3FGVA 3ISND 4BHQA 2ZE2B 3M6WA 2HS4A 3T6BA 4DUYJ 1BMQB 2QT7A 2DNGA 1HQEA 2HMIB 1LXNA 2WVDA 3GFZA 4A48A 2QLJB 2E29A 2RRNA 1N5YA 2I2YA 1CULB 3J80Y 5HBMB 1Q5VA 2XYPB 4RW4A 2ZC4A 4C6AA 1VJQA 1WC3A 1R0CB 3FFIA 2BZ2A 1Q79A 2DXDA 2FHMA 1XNQJ 3LP0A 4LIRA 2MQNA 3CD5A 3VV2B 2PN6A 5KFTA 3DU5A 4OYXA 2BQUA 2QRRA 3PRVA 2R7SA 3CJ2A 1ZYQA 1CBKA 2HNZB 2OPRA 1FRKA 3DLKB 2VFUA 1LOUA 4A8SA 4A46A 4DZDA 4BS2A 3EX7B 4JV5F 2MDAA 4UZCA 5G0RB 3R8YA 3TOQA 1FXRA 3QATA 2M88A 4GRSA 3G6ES 4Y2CA 4ZN3A 5DDPC 5EDWA 1WC0A 2ZKTA 3TZZA 2APOA 5DM6Q 4USIA 2FZCB 2P5VA 4TU7A 2YX1A 4R0EA 1YLXA 1C4AA 4J9QA 1MU2A 2PD1A 3MZIA 1ZA2B 5LMUJ 1UPMB 3C16B 2O5DA 2EKYA 1FRLA 3U1LA 3TAMA 3JSMB 1RT3B 5DETA 1MWYA 4C8MA 4ZVEA 1WI6A 1DFDA 5KFVA 2OPPB 3NGTA 5J2QA 1T03A 2O1PA 3RRKA 3NNCA 3GFHA 5HN0A 3OHBA 4ZK7M 3BGRB 4F50A 4M5DA 1WC5A 2F8MA 4LF8F 1QUPA 2HHPA 4NLDA 5HROB 1Z2ZA 2BQRA 9ATCB 4O44A 3PYEA 4M5KA 1EP4B 3KYLA 3M1VB 1Y3KA 3G8QA 2D3ZA 4DR6J 1Q5YA 4X4PA 2PA8D 2FJBB 2OGUA 4Q2MA 2YBVA 3DRSB 4G65A 5K9FA 4MIWA 1XMOJ 4ZLPA 3KDOA 4RWXA 4WTOB 1RT5B 3SSSA 4AUKA 3MPYA 3W8PA 3J81Y 1BLUA 4RZRA 4OLPA 5KT5A 4DQSA 4ES1A 4IRDA 3C46A 1RWXB 3BQ1A 3ISNC 2DNYA 4DUZJ 3HD2A 1FKOB 3C3LA 3ZZPA 1C1CA 1IBKF 4QCLA 3ILOA 4DR5J 3FCWA 1S1VA 3SQOP 2HKEA 2V5HG 1K73T 2CPDA 1RHMB 3IA0A 4R5PB 4XPCA 4F67A 2CQ2A 4Q0BB 2RS8A 4B9MA 2XGPA 1FRHA 1NH7A 4NXMF 2B9XA 3JQJA 4PCQA 4J37A 3W66A 4DWIA 1VRTA 3N5FA 1Q78A 4C0OC 1S5ZA 3VZIA 3W63A 3IM9A 3PV8A 2BX6A 2YNIA 4TQSA 3SCJE 4O4GB 1CS4B 2WONA 3BPDA 1YDLA 6AT1B 1SIWB 1S6PA 3K5OA 4ES2A 4BC7A 4UQGA 3AXKA 3RW7A 1T3NA 4UY8T 4IOAQ 2E7VA 2B9YA 3W2WB 2K1RA 2B5JA 1FRXA 4P74A 4UF4A 4NXNF 1KBRA 2MZRA 1VIOA 2CPJA 3KHLA 2IM2A 4PAAA 1D9AA 2OLWA 4OYIA 5HMXA 2J7WA 2I5JB 3OFGA 2MSTA 5A8RA 4K5SA 3GIIA 3TVYA 1RT4A 5LSOA 4C8ZA 3BKTA 2NSCA 4JUZA 1RISA 2G13A 1B0PA 4KJIA 4J9KA 1KFSA 2MXYA 4OYZA 1V3ZA 2MGZA 2ASDA 4C8YA 1B7FA 5K8MA 4LFBJ 1VI7A 2LQ9A 1ZAVA 2KXFA 2XTJP 3NLCA 3OTOF 1FO1A 2J0XA 5A8KA 4WIIA 1NKBA 4ED1A 2LXFA 3FBBA 5CZVA 2V34A 4ZP7A 2R8HA 3B4DA 4QYZJ 3R3TA 4NEYA 4ZVUB 4FBTA 1U1QA 2P9CA 5LSLA 2AF6A 1DRZA 2DITA 3DLGA 2QA4S 2FJAB 3BBBA 2BBEA 1X60A 1O8BA 3PRBA 4CT9A 1I94F 2L3MA 1KLMB 2DRDA 4X4TA 4ALZA 3LALA 4PKDB 2KXHA 3T5JA 3DM2B 1GX5A 4OX9F 2J9DA 1WF0A 3HKZD 2ZE2A 1N56A 3GJQB 3BM7A 3OVSA 2ZNZA 3QAEA 3TAQA 1REVA 1QM9A 3A13A 4WBFA 3IR6B 3B8HA 1CULA 1K47A 4UT4A 5HBMA 2QJ3A 3DI6B 5E3PA 2KM8B 2AWZA 3BGUA 5EGYA 3TW0A 4FYWB 5GVQA 4L75A 1YWXA 1VK8A 1TK0A 3RAQA 1WHXA 1FKAF 2QSFA 2B56A 1UA1A 1NO8A 3MMAB 3IRXA 5IWAJ 3UDCA 2FC9A 4HHHA 2BJ9A 4RWWA 4O3SA 3G82A 3PO5A 3IAM9 4M63A 4EYIB 2Q6BA 3FUYA 4J9LA 2LEBA 2W2OP 3MOJB 2XMMA 2OFHX 3GCXP 3HHDA 3PEJA 4CLKA 2BJDA 1N36J 1ZM9A 2B7BB 5F9NA 1MMLA 4YDXA 4F4WA 1FJ7A 2IBOA 1N52B 3ILJA 3SCIE 3M9NB 1SB6A 3K17A 3M8QB 2UU9J 4K4ZA 1E6VB 3BGFA 3OTEA 3VAFA 3C16A 4F26A 3ZTSA 2VA2A 3OQ2A 3CCSS 1RHJB 3JSMA 3MPDA 1NHUA 1RT3A 3GWCA 2W8KA 2DEJA 1EIYB 4B3TJ 2DGQA 3MFIA 4YR2A 2M9KA 2HGMA 2LA4A 1RB0A 2HGLA 2HQDA 4CDIA 2CUYA 3QFHA 2CYYA 2YXLA 2ZM6J 1FKPB 4AT1B 3S8SA 1X4FA 2KG0A 3BGRA 1SJ4P 4X66F 4DV4F 4LREA 3KLHB 3KLVA 1WOSA 3ZXWA 1C4CA 1FD8A 4HDGA 2RIJA 5HROA 3TA2A 1R6YA 3KXDA 5H9FK 1EP4A 2BE2A 3TJ9A 3R5JB 4CO3A 2DIUA 3M1VA 1GFWB 1DLOA 1JK9B 4JI7F 3HHNB 3M2RA 1U24A 2VU5A 3UI3A 3MHYA 2FJXA 4WZQA 3TA0A 2YH0A 5DM7Q 2M5YA 2GAHC 2R2UA 3WIVA 4DR4F 2NYIA 5AJ3J 4L73A 3KLFA 5KFAA 5HK4A 1SXLA 2NCKL 1M5SA 1RT5A 3SIPB 1HWLA 4JI3J 3VAJA 5L8RC 1WACA 4FNHA 1X8DA 2H5IB 4RNMA 2YNGA 5FIIA 3PW7A 5HMYA 2OMLA 1T9UA 1TUVA 4DX8H 2GIRA 2YTCA 1BQNB 1XERA 3FQLA 4USTA 4Q45A 2OD6A 1VMBA 4UOGA 4M5HA 1FJEB 4K4YA 1ULRA 4OI6A 3OR2B 2HBQB 2VICA 1XNRF 1S6UA 1NK7A 1DZ5A 4Q0BA 4MKYA 1X5PA 3PR4A 4JI4F 1HL6A 1TU0B 2GMLA 2WHOA 1Q53A 2XNRA 2H9ZA 3UCZP 1TAQA 4O3PA 1G7CB 2Q1LA 1BWVA 4DPYA 2BACA 4JP8A 1XMBA 1NJXA 2MPUA 4ILLA 4QR0A 4GKJF 4LSNB 1JLFA 2JEJA 1RI7A 1K0TA 3UVJB 2YNFB 4DV3F 5A2QY 4O4GA 1CS4A 3CMAS 3FZ2A 3CCJS 2FC8A 4MK8A 3GPAA 1NDPA 2MKYA 1VQ7S 2BDPA 2HGNA 1M5PC 4U95A 4QWDA 3I56S 1CVJA 4N77A 4IOCQ 3M05A 1T9XA 5L38A 2MY8A 1T02A 4LVOP 2MKIA 2WSCC 4B9SA 2VQEJ 5KG0A 4DFMA 3KG4A 2N7CA 3M2UB 4USMA 5D6GA 1OQ3A 5D4OA 2YNHB 3EE3A 3UW1A 3QBCA 2CJYB 4OI4A 1RWUA 2DGSA 2F9DA 2XLKA 3MEGA 3AT1B 1V3SA 3GB0A 3TEHB 3O8WA 1XN9A 1RP5A 2JZ5A 4K50A 2CFXA 4KFBA 1NPKA 2C3YA 4N8NA 1N8RT 3NGKA 5GADI 3GONA 5AXKA 3CJ3A 2UZAA 4F0MA 4BCAA 4MIAA 4ELTA 1SL1A 3MM8B 3G9CA 1KS2A 3FBFA 4EZ9A 1KLMA 1U0HB 3GV8B 4P7TA 3RBXA 1S0MA 4M5MA 4AXIA 5H1SV 1KDNA 1N0UA 2UXCJ 1T05B 4FP9A 1J5EF 1K1QA 3IC1A 4LFAJ 5ITHA 1FJCA 1UWBB 3Q8RB 3K5NA 4ZPWR 1U1PA 2QV6A 3DFEA 3F73A 3OBIA 4ZCLA 1XMQJ 1MWQA 1H98A 1DAXA 2BRLA 2Y1IA 2BOPA 3H5SA 4Q2LA 1UFKA 3CO9A 1L3VA 3GP9A 3MMAA 1FD2A 2FJDB 3H98A 1SH0A 1S0VA 2OEJA 3EVOA 1K44A 4DR3F 3A8KA 2ZWPA 2IJFA 2UUAF 3MF5A 2EFVA 4WTYA 4DPXA 3J7YU 4KGMA 2WW4A 3TZWA 2W2QP 2ZBCA 2DT9A 4ZLJA 4FYYB 2ZKUA 2ATCB 2V2KA 2QX0A 5I4MA 3W64A 4J91A 3HSDA 2CJBA 3DRRA 1B64A 3HFVA 3I87A 4A8KA 8RUCA 1IKYB 3LTOA 4RR5A 2MZSA 2G1HA 2CQBA 4RUCA 1PG5B 3M8QA 4X62J 3ENAA 3KMQA 1E6VA 2AIRB 4L74A 3IS9B 3ZZYA 1S57A 1FFWB 1NK0A 5CYMB 1XBWA 3R6LB 4LQ3A 1T11A 3TX0A 5J1EB 1HI1A 1YQHA 1FNXH 3W65A 3AA9A 2NZCA 3S1TA 4R25A 3MR2A 3BO2A 5BR8F 3DLBA 2BJ1A 3TO8A 3BKFA 2KZMA 3Q22A 4IH7A 3CJKA 1H3DA 3KLHA 4CRJA 4DSEA 4Y65A 2Y3YA 2LQ8A 1NZAA 3WC0A 4NLPA 2KU7A 4KHRA 2IJRA 1RWVB 1P9QC 3D0HE 3TP2A 3BQ0A 2DNMA 4PG4A 5DQHA 1RCXB 1WHWA 3DC2A 2VB6A 1P6TA 4FPIA 2HG4A 3CUNA 3JQKA 2VG6B 4JI2J 3VQSA 4DZ6A 3KG1A 2VBYA 5KG2A 5B09A 5L1KA 3T5HA 1VS3A 2ZWOA 1H6KX 2CG4A 1LQ9A 1Q7LB 3MTJA 4DU7A 3TUPA 1R8PA 3SI8A 3ENWA 2RJZA 3GFXA 4DL6A 4LRAA 2UVWA 3HHLB 3M32A 1LK5A 2W2MP 3M2VB 1HWUA 2E5HA 6FDRA 1BQNA 3HD1A 3IP0A 2BRKA 1FDBA 3CW2C 1ZOTA 4ZA1A 4NI2B 4RW7B 3OR2A 2NQPA 5I42A 2GJ2A 2IYIA 3Q8SB 4CI0B 1MROB 2D9OA 4RNOA 4AFFA 2F65A 2HRUA 4ZVHA 2C3OA 1S4EA 4JV0A 2IBKA 4DSJA 3CJSA 7AT1B 3MM6B 3MCMA 4DL5A 4OJHA 3HJVA 3PX6A 1CJUA 1UJ4A 4W90B 2BE9B 4CLLA 2KJWA 3H2VE 1FVSA 1IR2A 3MOZA 4LSNA 3DMJB 5FDLB 1S1TB 1U2CA 3UVJA 1NJWA 2DH7A 2YNFA 3U02A 4HACA 3CD7A 2NXCA 1U7LA 3R5BA 2N7YA 4HKQA 3S01A 2ADBA 2B9EA 1PAEX 1XC9A 1KTVA 4LF4J 2E5JA 4I56A 5IFMA 5HMWA 2RQKA 2RDJA 3MM7A 5K14B 2A2DA 1FVQA 2W2PP 3PHEA 3JYTA 1XTZA 1RXOB 3DGPB 4KYZA 2XI3A 4ZJQA 2E5LF 1K8AT 1NEEA 4F02A 4EBCA 2J6TA 2DGXA 4RKUC 4IH5A 4ZPCA 3CCES 3GMGA 1FWKA 5IT9Y 3PDNA 4TKTA 3GILA 1JLEA 4ECXA 5B0DA 2FJEB 2WCXA 2DHHA 4YHHJ 4OHZA 3ONQA 1JNRB 2JJ4D 4V1Ak 3OLAA 5L46A 2GCFA 4PG7A 2R2TA 4MKAA 4PQUB 1WDTA 4CIOA 3BSNA 2WVBA 1VISA 3LGHA 4NLYA 2EFQA 3DGVA 2RKIB 1WDDA 1R6VA 4IG0B 3K5MA 2CPFA 2XB2D 2YQ3A 4WYWA 4J9VA 2HHSA 2V8HA 3OFHA 1T05A 1Q82T 1ZM2A 5T7LA 3D6MB 5IT0A 1KQSR 2QMXA 4DJBA 4IOBA 1QSSA 1H73A 2ZVIA 2QA2A 5KG6A 4WP3A 1UWBA 3ILLA 1V6HA 3LOUA 2Z2ZA 2D1CA 2HIYA 3M8ZA 2XYGB 3O2IA 1VQNS 2DO4A 4PEOA 2HHHJ 4O23A 5ETQA 1F0XA 4LSZB 2DR6A 2HNYA 3IRWP 1IWGA 2ZBQA 3KUEA 4UOHA 5HMZA 5ETMA 3MD3A 1K1SA 4NLRA 2BANA 3CSKA 3DXBA 1ACMB 1Q1KA 3CTRA 3D5MA 1FDNA 1HNZJ 1LW0A 5F41A 2DRAA 3PKYA 3W5YA 1IR0A 4Y0FA 2LU2A 2LKZA 2VFTA 2Q6CA 5T14A 3AQPA 4X4NA 4NYPA 2BJEA 2K8GA 1IKYA 5IWAF 3JAMY 1WOPA 2VG7A 4CLZA 4TQRA 1IKVB 4OX6A 2CQHA 2D69A 1EKSA 4DR2J 4DPUA 1C1BB 1B7YB 1VGYA 2MHNA 3BS9A 3OT9A 3R1LA 3Q23A 1D1UA 3V81B 1RJJA 1NHVA 1RLCL 4AXJA 5E3RA 1X5TA 2CRLA 5KFNA 5F8MA 3SXLA 1FRMA 2ZEJA 1BD6A 4V19J 3ICLA 5CYMA 3CO0P 2Y8YA 3CD6S 2C2MB 2E1PA 4QW8A 1Q8LA 1XK8A 1HD1A 2R4FA 2V9KA 3FQKA 1SJ3P 1N32J 3GJSB 1XR6A 1CJKB 3IG1A 2CWXA 1CEZA 4K4UA 4HI2A 5CD4H 2OSRA 3W62A 3EVMA 1UAWA 2R7RA 1VBZA 1S9EB 2OAUA 1SC1B 1QAIA 2Z2LA 1L3UA 4DS5A 5T41A 2UUCJ 2MLXA 5KFIA 1EKRA 3LQVA 2RSQA 4RW6B 2VASA 4BDPA 2OEMA 2JEFA 1S77D 3L4BC 1SBRA 2Q3PA 5DS7A 3DRPA 1SIZA 4XTTA 4M95A 4NLWA 4Y6IA 1LW2B 3I4HX 2DB1A 2PMHA 2HVHA 2UV8G 4Y34A 6FD1A 4TLRA 4H4OA 2AYBA 4DDFA 2Z30B 5LM7E 3R1HA 3N28A 1U47A 1APSA 3M2VA 2L9NA 1S10A 4N76A 2CXEA 1RK8A 2V2ZA 1VC5A 2W7AA 1YRTA 2WBMA 1F5AA 4G1PA 3CD0A 4NI2A 2R7QA 4RW7A 4ED6A 3T1YJ 1FERA 2W9AA 1TAUA 1MROA 5HQLA 1TMJA 2LP4A 2GJFA 4L6V3 4P7VA 1IUJA 4DS4A 4ED4A 3LH2S 3W3SA 1T9TA 4X64J 4ZVOB 4BC9A 2RNEA 2Z58B 2XCAA 1F6TA 4LT6A 4ITSA 3DNCA 3DMJA 1VRUB 2EC2A 2CNOB 1S1TA 2HQFA 3CJTA 3AAWB 2UVVA 4PPDA 1S1WB 3UCUP 2UUBJ 5D77A 2R8KA 1ZAWA 5LJ3Y 1RT6B 3G96A 4ECQA 4EI2A 3W5XA 4IFVB 5KFSA 5K14A 1XQIA 3QT5A 2FLPA 1YKWA 4KR0B 4MH8A 3DGPA 4MIBA 5HJXA 4B02A 2DXEA 4CH7A 4NLGA 2IMOA 4N8OA 1LK7A 3R27A 2KYXA 1I1GA 1EETB 3LW5C 4X4QA 3GQCA 2QA4G 2W8LA 3QJLA 4C48A 4CQ1A 3W2VB 2MQLA 2CQDA 3C6TB 2ZH7A 2KN4A 3IWLA 3SV4A 3UD3P 1QY7A 1IVZA 2VG5B 2XMWA 4PQUA 3BDPA 2RS2A 3I0SB 2JRSA 5KFOA 4NLTA 2ZFHA 2ASJA 2RKIA 3JTPA 1MMDA 3KLIA 4E2FB 2ERRA 3G8TA 3ETMA 3MGJA 2CPEA 4QOTA 4NCAA 4Y2AA 4Q7AA 4EU0A 3AD9C 4DL7A 3K5LA 4USVA 1HI8A 3ENQA 3MD1A 1UA0A 2BMBA 2KFYA 1FESA 1RHUB 2VPYB 2EC0A 1NKCA 4ICLA 1LV5A 2UVRA 2G2OA 1VLYA 1NRKA 1NDKA 2HQIA 4LFAF 1EAYC 2I0XA 3J80U 2HBRB 4ZLLA 4ATNA 1QUVA 2MJUA 5EWGA 3FZBA 4OI1A 3EZ5A 1Q8IA 1RSCA 4CLSA 2FHOB 3D0IE 3SV3A 1IM6A 5E7OB 4LRCA 2YKMB 2E7XA 2DH9A 5D0HA 3CMES 4B3SJ 1VHFA 2KT5A 5IXUA 2CPHA 2HVDA 3DCAA 3CCMS 1WI8A 4NZ0A 1SQGA 4OZ5A 2AYMA 4J9UE 1CJTB 4M5LA 4DSFA 1IKVA 1FF2A 2Y1JA 2XQCA 4CO0A 1TQLA 1C1BA 2WVEA 1WUUA 3D67A 1GXTA 5JUMA 1VLOA 4F4XA 2CNLB 2C3MA 1TL7B 5HL7Q 4USUA 3VQTA 5D8HB 1DARA 5GMEA 1AROP 5FJ4A 3G6XA 5SUHA 3QIPB 1RTJB 4B3RJ 4UY85 2FYXA 3NS7B 2ROEA 2GIQA 4RBTA 1PBUA 1KLNA 2HLUA 1HW9A 1WC6A 3DLEB 2UXDJ 3O1LA 1KKHA 3KJNB 4C4WA 4OMFG 4RNFA 4EBDA 3T9NA 1RAFB 4RW6A 2XNQA 1REGX 4OHXA 1J27A 4QBUA 1LW2A 2W25A 1FDAA 2ZUGA 2H51B 1VQKS 5D78A 3SSRA 5AXLA 4ZMMA 1VQ4S 3ULHA 2V8DA 3HSJA 4DV1J 1DTTA 3TNVA 5EX3A 3OV7A 2XULA 2J6SA 1HWJA 2DJWA 4DV7J 2FLNA 4NLSA 4QR1A 3QGIA 1XR5A 2MKCA 1DTQB 1NJZA 3TQ1A 1N48A 2WSFC 3KHRA 2D3O1 1EZZB 2HFZA 1FJGJ 2EFNA 2E9RX 1HLWA 1N0VC 2FVQA 1R3NA 2L41A 1NNDA 3CJRA 1TV6B 2Q79A 2XZDB 4LF6J 2XY7A 4WK3A 2Z56B 3M8WA 2RRAA 1S72S 4PG8A 5I3QA 1UW9A 3SEOA 1VRUA 1X9MA 3CCTA 2U1AA 2C2KB 4WFYA 2R42A 2KT2A 1JMTA 1AT1B 1S1WA 2AZ3A 1SJFA 4KSEB 4IUFA 4EK2A 1IBLJ 3ZZOA 2Q66A 5HQ8A 1MLAA 3RW6A 1NK8A 1RT6A 4K4TA 1VQPS 3E8OA 3FSIA 4P71A 4ZVGA 1YJRA 1Z1ZA 4IFVA 4KAIA 3Q0AA 1F5BA 2FTRA 4M94A 2MJNA 5KFHA 4QIGA 1S1UA 2AX1A 3AY0A 4A8XA 2M52A 3DDIA 2FZGB 4JI1J 2GO8A 3CCVS 5F8NA 3BSCA 1C2PA 4OYPA 2DO0A 5KFRA 2EKNA 4JOUA 4P52A 3R6GB 4JB8B 2ILYA 1H2UX 1JLQB 1EETA 2XEXA 2HQCA 4QIWD 3RUBL 2IA0A 1R8AA 1JWWA 1PC4A 1UZHA 2QLBB 4ZJOA 3C6TA 4NYZA 3H25A 4X84A 1TELA 4CLTA 2XMVA 3X3UA 1TMMA 3G87A 2VG5A 1UVLA 5AXMA 3I0SA 4C8KA 4Z2XA 2KT3A 2CQIA 3E3XA 4OHVA 2J8SA 2AKWB 3PRDA 2JLFA 3NS5A 4OI3A 3EJMA 2QMWA 3UFCX 2C2RA 2XMKA 2XGQA 1T9YA 2VDHA 2J0SD 3H4DA 1PC5A 1WKJA 2FVRA 1HWIA 3MEKA 2QLFB 3P49B 4DV5F 1ZA1B 1RT2B 3DN9A 2XY5A 3OFFA 4QU7A 2AYGA 2VONA 4QIEA 2E66A 3RBEA 4NE9C 1VYAA 5ETVA 4ZS6A 5HSPA 2HZVA 2X1FA 1DJ0A 2Z57B 1OY8A 4Z7YA 1T95A 2DHGA 4C2MA 1N6QB 4QWEA 1V5VA 2CQGA 4WK1A 2YX7A 1QVGR 1NM2A 3FDSA 1OSCA 1JLGB 3ZNJ1 3MURP 3JXOA 3AFGA 2XSJB 4ETXA 3MM9B 3KUHA 1KP6A 5B0EA 3I0RB 4Q8FA 4PZVA 4LBIA 3UNGC 2OHDA 5F8GA 2MQMA 3M6UA 3FCHA 4DF4A 4OZ3A 1S97A 2E7WA 1WWHA 3QO9A 1URNA 1AFJA 1RU1A 1LWXA 3POTB 1EQ0A 3I9ZA 4OV1A 4ZHRA 1OYDA 2VJUA 4FXDA 2Z4PA 2KO1A 1FRJA 4NA3A 1QAJA 2ZH4A 2Z0GA 4B3MJ 3OTBA 2OFGX 4U7UD 4YY3F 1NMEB 1LNQA 3N6LA 5DJBA 1GXLA 4RNHA 2HRTA 1N33F 1SV5B 1Y00A 2RHSB 4CLUA 4QJVA 1SKSA 4P72A 2QA1A 1HBNB 3ITHB 2K7KA 2R8JA 4A8QA 1Z2LA 1B4SA 4I1TA 1U48A 1G3OA 4FF4A 1KEKA 5DZ7A 2PEBA 3VALA 5B0AA 3GYGA 3GYXB 3MMJA 4V19X 3V4IB 1RTJA 5F9LA 1BUXA 1V3RA 2HK3A 5J2MB 1R7IA 4YB7A 1S49A 4PWUA 1BHNA 3P4UB 2DTJA 2G0CA 2JSXA 3CCQS 4F2RA 2F1FA 3QAUA 3DLEA 3CF5Q 2R7VA 5KT4A 2MZQA 3TUJC 3UD5A 2AJQA 2C2ZB 3HMJG 2PMWA 2OEKA 1SH2A 2EWHA 2VQFJ 2LVWA 4CYUB 1HR0F 1U1LA 1WTFA 3R9LA 2AJ1A 3TZYA 2ACMA 4K4VA 4LSLB 1NSKL 2PI5A 1GTEA 1TKZB 1HQ2A 4DL0C 2DY9A 1FK9A 3OVAA 3AXMA 1WTBA 5DQGA 4LMZA 1Y4ZB 4XO0A 4WP9A 4ZJLA 2LCWA 4MKVA 3AA8A 4F25A 3LP2B 5K8NA 4N47A 2CPYA 3OL6A 4DPTA 4F7VA 3LA0A 1U1NA 2KFZA 3UDLA 5E0OA 2DCUB 1FTCA 1HYSB 1HD0A 2KB2A 3BGOP 2GIFA 4TY9A 1TV6A 2NSBA 4W4MA 5CYQB 3HLUA 4AL6A 5LL6d 1HNXJ 2HNDB 3T1YF 4J7CA 5MAOA 4RU9A 1LWFA 4OFZA 4C8LA 2BE7D 1YI2S 1RKJA 2F4VF 4P73A 2E9TA 2HWTA 5EX0A 4HH0A 4DV6F 5EUHA 2XS2A 5J2PB 4GVBB 2XZTB 3RB0A 3JSBA 5M2UA 1D9DA 2EBEA 2J6UA 1X31C 2CZ4A 1ZBTA 4AQYF 3EUNA 3BO3A 4F0HA 3MM5B 3J7AN 3T9ZA 1SUQB 3GSIA 4R8UA 2FB0A 4LIWA 1KVIA 1JLAB 3IR7B 2VIHA 3M8PB 4JI6F 3TJAA 3IWXA 2F5GA 2JVRA 3M6XA 3VAMA 5CAAA 3VVUA 2P6TA 1JXVA 3Q8VA 3MAHA 2ZH1A 3MUTP 3WHIA 3MR3A 1JLBB 1X9WA 1RAIB 2MZJA 5AE3A 2KVQE 3CDBA 2FY1A 4NZ7A 2CDQA 4OZLA 4X2BA 5K8PA 2HEKA 1HHSA 1UEKA 1Y7PA 2ZZNA 3LPEA 4USWA 1BQXA 2DPIA 2OO4A 1E6YB 4MMOA 1IBMF 1BXNA 3VGTA 3VR1A 4WYLA 1AUSL 2MQOA 2B43A 1X4AA 1LFWA 4CNZA 1H2VZ 5GADU 3QSIA 3AQOA 2AJ0A 3IBCB 1M5KC 1FTRA 2EVZA 4USKA 1BQMA 1VR6A 4JI0J 3C14B 1S9GB 1BC6A 2E5GA 5J2NB 3J81j 3G4SS 4F2SA 1QDUB 1S1XB 4RU2A 1RT2A 4MFBA 2IRXA 2A1BA 2V94A 3ENVA 2HW3A 3ZTPA 4F3OA 3QT8A 5A8WB 1TP7A 1JJ4A 2OPSA 1LWEB 4LF7F 5CQGA 1HA1A 4KBIA 2IM3A 2WW8A 3AJ2A 2X3GA 2H4YB 1N6QA 4ED2A 1QSYA 4X65F 2VZ9A 3HP6A 4LF9J 4U67Q 4JYAJ 3SYZA 2JC0A 5LJ5Y 2XSJA 4M5IA 3I0RA 2ZDPA 1A7GE 2QZ8A 2ZVSA 4H4MB 5ETNA 3W1YC 2DR9A 1FCAA 4J9RA 2R8GA 1ZM3A 3KG0A 4KY3A 1WNEA 1NBEB 2HYIB 3JSRA 3POTA 4HTJA 5H9EJ 4URQU 1T7PA 3RR8A 5ETLA 2RE1A 3WDOA 3FMBA 5CYJA 2JFDA 3MMCB 1RHRB 2WTFA 5DO2A 2E1MC 2C22A 4WCEQ 2WAQD 3D3BJ 3V6HA 3D6FB 3FC9A 2QLXA 4NA1A 5ETPA 3M8RA 2YQ0A 3EM1A 1SV5A 2EEYA 4FXWA 3EZOA 2MQPA 2LFVA 2HQGA 4DOZA 4CTAA 1HBNA 2R7WA 3KHHA 3ITHA 3E51A 2V4JA 4NASA 2FLOA 3HM9A 2VH7A 1I6JA 3Q2SC 3HI9A 1C0TB 2GNKA 4FN5A 4ID5A 2QFIA 3NBPA 3LWMA 1L5UA 1RTZA 2AEJA 3QNWB 1QVFR 3ZO7A 1G6BA 5J2MA 1KR4A 4UUWA 2J0WA 2R7TA 5E2QA 2L48A 2BR0A 4FF1A 3AODA 3UE2A 2DNHA 3UN3A 2VBXA 2LECA 2ZJRQ 5HLFA 1IKWB 2FJVA 4WWSA 3N6MA 5DG9A 1F2HA 3MR7A 4B3RF 1S9FA 4JI8F 2Z2YB 8AT1B 4ER8A 3CJ8A 1D9FA 3KLEB 4K4WA 1Q95G 2JDJA 3RB6A 2R7UA 2W9BB 2ACYA 1VQMS 3EICA 3I4PA 3DYAB 2AHOB 3KJFB 3NMRA 3KK2B 2UXDF 4EEYA 1TKZA 3QGGA 4LF1A 3EXCX 4S0MA 1OWXA 3HHEA 3UDVA 3BBFA 1Q81T 2GHWA 2JOQA 1TTHB 2P6SA 3P6YC 4DQPA 2GAGC 3LP2A 4URSA 4EBEA 4LJMA 5SZTA 2U2FA 4DBQA 4QWAA 1KD1T 4Z37A 1UVMA 3Q83A 2C2NA 1O5JA
chains in the Genus database with same CATH topology
1ZPVA 1TKXA 3M30B 1KQSR 2V4RA 3P3DA 2R2RA 2JWNA 3CDWA 3R5AA 1GNKA 4G1QB 3DLHA 4O4RA 2QMXA 4DJBA 4IOBA 1QSSA 2HHUA 2EFPA 2C2EA 3QWPA 4LF5F 3CIMA 1GH8A 2B6AA 1JLEB 1O0PA 4DV7F 4IFYB 2QA2A 3KHGA 5IT4A 4I2QA 2FGOA 3MI7X 3JB9k 2CPXA 2GHPA 5EWFA 1QE1A 5CYQA 3PZPA 5KG6A 1P1TA 3CDAA 3IWNC 3MTKA 1UWBA 4U7CA 1V6HA 3LOUA 3V6JA 3PW4A 5EWEA 2D1CA 4B17A 4TXSA 2YWEA 5DGAA 5J1NA 5I3UA 3J7A1 5AE2A 2D3OR 3WX4A 1RT1B 1KOOA 2CJKA 3H2LA 7FDRA 1NB7A 3HVTA 3O2IA 3OUYB 1YJ9S 3KLGA 4LQ9A 4NL5A 1JIHA 3SCLE 4HH1A 4ECYA 5DLGA 3FMWA 3V81A 1VQNS 2AX0A 2DO4A 4DEZA 2DCLA 3UPFA 1HNVA 1DBDA 1F9FA 4H4KA 5KT7A 1RTIA 4O23A 4QU7A 1M90T 1F0XA 2J9EA 4Y28C 3NS6A 2E1RA 2HNYA 1WEYA 3IRWP 4XDDA 1IKXB 3V2UC 1JKHA 5B0GA 3TANA 3ETOA 5KFLA 2YKPA 2N4DA 5J2PA 5HMZA 4TYAA 5IS2A 3MD3A 1YJWS 1FXDA 2ZH6A 1K1SA 4TLQA 3UCGA 4NLRA 2BANA 2ZD1A 4KGKA 1C1CB 5THWA 3CSKA 1KOHA 4OHWA 1WHYA 4X62F 3LWLA 3DXBA 1NAQA 3N79A 3O5TB 3GIKA 3BDEA 1UKUA 3VAHA 1Q1KA 2MY7A 2ROGA 3CTRA 4URGA 3D5MA 1FDNA 3CIZA 1LW0A 5F41A 4DHVA 2DRAA 4E8UA 3PKYA 4PUOA 1IR0A 1DQ8A 3RBDA 3MECA 2J5AA 5GAHI 4Y0FA 2B3TB 4ID8A 2LU2A 1D8YA 4M1KA 3MM5A 2LKZA 2VFTA 5T7LB 2QYCA 4LVNP 4NZ6A 4UQTA 1SUQA 3VAGA 4ZPVR 2Q6CA 5T14A 1TKXB 3AQPA 3RYLA 4X4NA 4NYPA 2BJEA 2K8GA 2IAJA 2PT0A 4ED0A 1IKYA 2X1AA 2XWXA 3G6YA 1JLAA 4IKAA 5L39A 5IWAF 4K0KF 1GAOA 3HVWA 3JAMY 2DR7A 2IA6A 3CDEA 1S9EA 3K0JA 4B3OA 2WB4A 4ECZA 3IAS9 5C25A 2VG7A 4ZOSA 3LO3A 4I2QB 4TQRA 1DQ9A 1IKVB 2XMUA 3PY8A 4UUXA 4OX6A 2X1BA 2YY3A 4Y2IA 2CQHA 1VRTB 3N9UC 3QJJA 2ZH2A 1MW7A 1R0AA 4I0WA 1Q16B 1JLBA 1FRIA 2VBWA 3M9OB 1C1BB 5I3UB 1PGZA 1VGYA 5F8IA 2MHNA 2VBZA 4DSKA 4IR1A 2AJ4A 1DHMA 2FPHX 3BS9A 4RX6A 3A1YG 4Y00A 2ZH8A 3R1LA 4KB7A 4K4SA 3Q23A 1QTMA 1UEVA 1D1UA 3X1LB 2YNIB 3V81B 1RJJA 1NHVA 4AXJA 1FE0A 5K8OA 4RW8A 1HPZB 5E3RA 1X5TA 2CRLA 1SC6A 5KFNA 5F8MA 3SXLA 3LANA 1HBOB 5F8LA 4MKBA 1FRMA 3MEEA