1VRTB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 113
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vrtB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB03
1JIHA 4QWDA 5KFCA 4KHRA 4QWCA 4PWDA 3GQCA 2RF2B 4O3PA 1FKPB 4KKOB 4RNNA 5DG9A 1I6JA 2FVSA 2AGQA 1GX5A 3T5KA 3CVKA 3MR6A 2OPSB 5DGBA 4FBTA 4PQUA 3DLKB 1S6PA 3IS9A 2D41A 1S1VA 5C42A 2IM2A 2QV6A 4ED7A 3CDWA 3V6KA 2DPIA 4I2PB 3UDLA 4JV1A 1RTIA 3NAIA 1SH3A 2BANB 3HVWA 4F4XA 1LWEA 4K4YA 5KFYA 1RTHA 1IKWB 3RAQA 5K14B 1WNEA 4MIAA 1S1WA 1RT1B 1FKOB 3NBPB 3V6DB 5J1EA 3CIZA 1U09A 4WYLA 2YNFB 1J5OA 1JLAB 3NAHA 4LSLA 5KFXA 1S1XA 4TQRA 4X2BA 3H5SA 4IRKA 2BE2A 2JEIA 4U6PA 2JEJA 1SV5A 3H2LA 2RDIA 1ZETA 3ITHB 4LQ9A 3MFIA 5KFUA 1FK9A 3M8QA 3LP2A 2R8IA 2IM3A 2WONA 2XI2A 2XGPA 3BSAA 3DRRB 3KLGA 5C24B 4WYWA 5F8GA 3DRSB 3MEDB 4IH5A 3DRPA 4Y3CA 2YKNA 3NL0A 5CYMA 1BQMA 5KT4A 3DYAB 1DLOA 3DM2A 4XPEA 1S4FA 3MR2A 2O5DA 3MEGB 3KMSA 2OPQB 3FFIA 1S0OA 4WE1B 3MTKA 3LALA 1MU2A 3LP1B 5HLFA 2I5JA 4I7FA 4R8UA 4ECYA 4ZVFA 4YP3A 3Q8PB 3KLEB 2JEGA 5KG2A 1ZTTA 2XCAA 5DLGA 2YNIB 1C1CA 1MMLA 1VRUB 3DOLA 3FDSA 4ZPAA 1HNIA 4K4WA 4ECUA 2HWHA 4PUOB 4IG3B 4R5PB 5EWFA 1RT2A 3VQSA 2VG7A 4RU9A 4ECVA 3V81B 2D7SA 5KFDA 2UVRA 3LAKA 5KFJA 4Q43A 2YNHA 4RW6A 2HMIB 1LW2A 2HNYA 2CJQA 4YR2A 4RW9A 3MECB 3BQ0A 3CDEA 4RNHA 4IQXA 5KFZA 5F9LA 3DDKA 4QWAA 1UWBB 4WFYA 4F4ZA 3PW7A 2BR0A 5T14A 1RYSA 4U7CA 4FBUA 4IH7A 1T94A 4DG1A 4H54A 2ZE2A 1HMVB 2ASJA 4IRCA 1T05A 1EP4B 4IKAA 2HNDA 4DL3A 1TKTB 3GILA 3EPIA 3BGRB 3KLHB 4DL4A 3QO9A 2AWZA 5I3UB 4LSNB 5J2PA 2HWIA 1TVRA 2V0NA 3E01A 3DOKB 1KLMA 3DLGA 4IFVA 3QZ7A 2ZD1B 4O4GA 1N5YB 4Q8EA 3V4IA 2IAJB 5EWGA 4GC6A 2C2DA 2IM1A 1JLQA 3BREA 3LP0A 4WXOA 3SI8A 1IKXA 3NKYA 4R0EA 3HKWA 4ZMMA 3BJYA 3KK1A 4Q0BB 3ISND 2BRKA 2QE5A 5FDLB 1C0TB 3HVTB 2JC1A 4MH8A 1JLFA 3I0RB 1S1TA 3TAMA 4IDKB 1RT4A 2UUWA 3JSMA 2OPRB 3LAMA 2W7OA 4WZQA 1JKHB 1TV6B 2R2TA 1S0MA 2FLNA 4K4TA 3V6HA 1C1BA 3KLFA 1W25A 2CKWA 4JV2A 4NLOA 4IG0B 5F8JA 1TQLA 3Q8RB 2ASLA 1JLBA 3QLHB 4TN2A 5DQGA 4NLQA 5J2NA 3MEEB 4QW8A 3PW5A 4YMEA 1EETA 4J9OA 3E51A 4KFBB 4J9QA 5KT6A 4MK9A 3KLVA 1S1VB 1TL3B 5C42B 3GV5B 5DLFA 3KMQA 4RW4B 3T19A 2JLEA 4RW7A 2JEFA 4ED8A 5KFAA 1HQEA 5D3GA 3I0SB 5J2QA 1S1WB 4KHMA 3KHLA 4K4XA 1HARA 1RTJB 2IJNA 2WK4A 3I5CA 1RDRA 1IKVB 5KFVA 4LSLB 2YNGB 1ZTWA 4ED6A 3QYYA 2BE2B 2BQRA 4TQSA 3LANA 4H4OA 4ZP8A 1QAJA 1S9FA 5HROA 1QUVA 4O44A 2UVWA 4ZVEA 1JXLA 3UQSA 3N6LA 4H4MA 2VG6A 3KHHA 5KFQA 1T03A 1JLCB 2OPPB 2ILZA 5HBMA 1S1UA 4IH6A 4QPXA 1BQNA 3QGGA 2B6AB 3OHAA 4YR0A 4O3SA 4Q45A 3DLEB 5KG1A 1LWFA 2RKIA 4ECQA 3M9MB 2J6TA 1S9GB 2WOMB 5EUHA 4DL6A 3GV7B 3SFGA 4ICLB 4Y34A 1RT5B 3KK2B 4B3OB 4KO0B 3OL6A 4MFBB 3EPGA 2W7PA 2EC0A 1N6QA 3CJ4A 3RBEA 5I42A 4NLSA 5KT3A 3T5JA 2J6SA 1S9EB 4ZPCA 2ASDA 1TKXA 4DL5A 5KG4A 2IA6A 4J9SA 2FJVA 3OLBA 4I2QA 2YNHB 3GIJA 2IM0A 2W9CA 4K50A 1SUQB 5F8LA 3C6TA 2R8KA 3BQ2A 1TL1B 4ZP9A 5KFGA 1RTDB 4QWBA 4MKBA 3IRXA 3M8PA 2R2RA 3KJVA 1XR5A 1SH0A 5KFWA 2R2SA 4NYZA 1R0AB 5JUMA 4YQWA 1S49A 3IG1A 4J9PA 1DTQB 1Z4UA 3BSCA 5KG0A 2HNZB 5CYQA 1K1SA 2I1RA 3DMJA 3PHEA 2FLLA 2VG5B 3KK3B 1HQUB 3MR5A 4ZPBA 2W9BA 3TVKA 4MK8A 3RB6A 3GIMA 1JLEA 3E01B 1LWCA 2R8HA 4IFYA 4RW8A 5EWEA 4FS2A 1DTTB 5L9XA 3V4IB 3BQ1A 2BRLA 4ID5A 2W8KA 4J9LA 2RF2A 4KV8B 5KFLA 1IKXB 4G1QA 1FKPA 3KLIB 4KKOA 2ZKUA 3ICLA 1RA7A 4MKAA 3QIPB 1IM4A 5L1KA 2OPSA 1JLGB 4TY8B 3DI6B 3DLKA 1S1TB 4EBCA 3JSMB 2UUTA 3MR3A 4Y2CA 4ECSA 1C1BB 2BANA 4J9NA 1C0UB 4EBDA 1N56A 1RT6B 5KFEA 3TQ1A 1HYSA 3OLAA 1RT1A 1FKOA 1JLBB 5C5JA 4HKQA 3NBPA 4NLWA 1TKZB 1RT3B 3JYTB 3V6DA 2W9AA 2IC3B 2YNFA 4NZ0A 1JLAA 2B5JA 2YKMB 1HNVB 1HPZB 2RDJA 1S6QB 4WXWA 4NRTA 5KFRA 5F9NA 3C6UB 4NLGA 1RT7B 1S48A 4KAIA 3ITHA 3IN5A 4O3RA 3GYNA 5F8MA 4ZVGA 4FS1A 3T5HA 5J2QB 3H59A 5DG7A 3DRRA 2V9WA 5C24A 3DRSA 3MEDA 3PW0A 4ZPDA 2AGPA 4XO0A 3MEGA 2VA2A 4DL7A 2OPQA 1LW0B 1LWEB 3LP1A 1QE1B 1N48A 4MIBA 4IR1A 4NLYA 4O3OA 4PWDB 3OL9A 2YNIA 4JV0A 2C28A 1YVFA 3H40A 4PUOA 4IG3A 4YR3A 4F50A 1K1QA 4G3IA 3V81A 4PQUB 1S6PB 4MK7A 3IS9B 3CJ5A 3PJXA 5KT2A 2BQUA 1RAJA 4J9KA 4NCGA 1XR6A 3RBDA 3T5LA 2HMIA 1RTIB 3FRZA 2F8EX 1RTHB 3QGHA 3PR4A 3OSPA 4K4ZA 4XPCA 5I42B 3RAXA 5J1EB 1J5OB 1S97A 3OL7A 1IKYA 2AQ4A 4ED1A 2DPJA 1JX4A 4ZP7A 1S1XB 4KSEB 1SV5B 4J9MA 5KT7A 4RZRA 4I2QB 2B43A 1EP4A 1FK9B 3M8QB 4O3NA 3LP2B 1TKTA 3CDUA 3BGRA 3KLHA 2AX1A 2WONB 5I3UA 4LSNA 3KLGB 1GX6A 2BQ3A 2D3ZA 3DOKA 3DRPB 5KFKA 2YKNB 5J2MA 5CYMB 2ZD1A 1N5YA 1BQMB 1DLOB 3DM2B 2IAJA 3H4BA 3FFIB 5L1IA 4HYKA 4R8UB 4DEZA 1MU2B 5HLFB 2I5JB 4I7FB 4WFXA 2XGQA 2WRMA 4URSA 3EZUA 3I5AA 3D5MA 4RNFA 5C25A 5DG8A 2ATLA 4Q0BA 4ZHRA 1CSJA 3H5UA 4IOBA 2W8LA 1JLEB 1C1CB 5FDLA 1LWCB 1C0TA 3DOLB 1REVA 1HNIB 3HVTA 2D3UA 3I0RA 5KFNA 5KG5A 4IDKA 3PR5B 4ECZA 2OPRA 1JKHA 1TV6A 1RT2B 3GV8B 2VG7B 5KFOA 4ID5B 4NLDA 4F4YA 3KHRA 2HAIA 1N4LA 2IBKA 1VRTA 4G1QB 4IG0A 1KHVA 3H5YA 3H5XA 1T3NA 3KHGA 3QLHA 4RW6B 3G6YA 1LW2B 2HNYB 5HP1A 4QWEA 3GIIA 2WCXA 4NLTA 3GIKA 3MEEA 4RW9B 5KG3A 3ISNC 4KFBA 4EBEA 5KFSA 1TL3A 2FVRA 3M9OB 4KB7A 4RW4A 1QAIA 4TYAA 4DG1B 2R8JA 2FVQA 3KNAA 2ZE2B 3I0SA 1HYSB 1TP7A 4ECTA 2FVPA 1T05B 4ECXA 1RTJA 3RB3A 2HNDB 2XWYA 4TLRA 1IKVA 2B5JB 2J6UA 3QO9B 4TYBA 2YNGA 4K4UA 4J9RA 3CJ0A 5KFPA 5J2PB 3G6VA 1TVRB 3V6JA 3G86A 1KLMB 3DLGB 4IFVB 4EO8A 4O4GB 3PZPA 4ED0A 4RUCA 2UVVA 5KT5A 4NLXA 2FJWA 4ED3A 1JLQB 4ECWA 3LP0B 4O3QA 1JLCA 4WZMA 2OPPA 2V4QA 2JC0A 2WB4A 4Q8FA 3KK1B 2B6AA 3IGVA 4K4VA 2XCPA 5DGAA 1C2PA 2FLPA 4IRDA 2R8GA 3DLEA 4OL8A 3HVAA 1JLFB 2WTFA 3TAMB 1S9GA 2WOMA 2FVCA 1RT4B 2GC8A 3CWJA 3MFHA 4EYHB 4ICLA 5KFIA 3HHKA 4I2PA 1RT5A 3KK2A 4B3OA 4KO0A 4ED2A 3KLFB 2XI3A 4NRUA 4ZP6A 2XC9A 1IKWA 4MFBA 5K14A 5KFFA 2WHOA 3QZ8A 2UVUA 5F8NA 5J2NB 4KBIA 2E9ZA 4KE5A 1EETB 1S9EA 2R2UA 1OS5A 5F8IA 5KFBA 3G6XA 4M94A 1XR7A 5KG7A 4NCGB 4JUZA 4NLVA 3NGDA 4RW7B 1SUQA 1HQEB 5D3GB 4ZVHA 5L1LA 2OH2A 4TXSA 1TL1A 1RTDA 4NLRA 1IKYB 2FJXA 2V4RA 1R0AA 3RB4A 1DTQA 3DYAA 3IGNA 4H4OB 4RNMA 2HNZA 5HROB 3I5BA 3N6NA 3PVXA 4O44B 4WE1A 4F4WA 2E9RX 4QW9A 2VG5A 3KK3A 4GC7A 1HQUA 1NHUA 5EDWA 4H4MB 2VG6B 3H98A 4URQU 5JXSA 3KLEA 3SFUA 3Q8QB 3FQKA 1T03B 1VRUA 5HBMB 1S1UB 3FSIA 2ALZA 2C22A 1BQNB 5J2MB 2AGOA 1DTTA 4R5PA 4NLUA 3OL8A 1LWFB 4Y2AA 2RKIB 5DQHA 4LQ3A 4KV8A 2C2EA 3KLIA 2ILYA 3OHBA 1RA6A 5C25B 3PW4A 4ZHRB 2AX0A 3QIPA 4WFZA 3N6MA 3MECA 1JLGA 3CJ2A 1REVB 3DI6A 3D28A 4TY8A 5F8HA 4EO6A 1N6QB 1NHVA 2AU0A 3KOAA 4DL2A 1UWBA 3QIDA 2GIQA 3BR9A 5L1JA 4RUAA 3UR0A 5DQIA 1TKXB 1C0UA 1RT6A 1VRTB 1HMVA 3RB0A 4RNOA 2VA3A 3CO9A 2E9TA 4K4SA 1D0EA 5HP1B 1D1UA 1TKZA 1RT3A 3JYTA 4Q44A 3C6TB 2IC3A 2W9CB 3T1AA 3BSNA 1S10A 5KFMA 4IR9A 2YKMA 3FQLA 1HNVA 1HPZA 4URGA 1S6QA 4TY9A 3PJWA 3C6UA 3IRXB 3OSNA 3M8PB 1KHWA 4ECRA 3KJVB 1RT7A 4O4RA 5KFTA 4NLPA 3MF5A 3QGIA 4EYIB 3PW2A 3IG1B 2IMWP 1RYRA 5KG6A 2GIRA 5CYQB 3H4DA 4EEYA 3DMJB 4M95A 2C2RA 1SH2A 2IJFA 3Q8SB 3CJ3A 1S0NA 2W9BB 5KFHA 3BSOA 3M9NB 3UPFA 3NMAA 1LW0A 4IFYB 4RW8B 1NNDA 1QE1A
chains in the Genus database with same CATH superfamily
3QPIA 4X64J 4WF9Q 4ZVPB 1FE0A 2AGQA 2E5LJ 2HHUA 4OHWA 1Y9OA 1S6PA 2EBEA 1S1VA 1H98A 4F4XA 2E29A 5IM0B 2GO8A 1S1WA 3HZEA 1KVKA 2FZKB 1J5OA 2DNQA 3IM8A 1CJUA 2OGUA 4TQRA 4UY8T 2KFZA 2U2FA 3R5DA 4DSFA 3ETOA 2HHQA 1G6BA 1UVKA 1PJ6A 4ECYA 5IQQA 3EZOA 4PUOB 2PFDA 3PM9A 2MQOA 2YNHA 1LW2A 2MQNA 4G65A 4LF1A 2DNMA 5F0WA 1HNWJ 1LK7A 3VAIA 3CEDA 4LBIA 4E98A 4QYZJ 1YWXA 1WKKA 4FPRA 2BE9B 4UOGA 3BREA 3T41A 4HEA9 3HKWA 4M5IA 2Y1IA 2XTJP 2QE5A 3FEZA 1GAOA 2E44A 2R2TA 1BUXA 2HQGA 2ZKTA 3WIUA 3ZTRA 2VPWB 3TW0A 5F8JA 3BF4A 4TN2A 2XM3A 2J5AA 5KT6A 3KMQA 4OLPA 2MMYA 4HACA 2CJKA 2EFOA 2QG9B 2BXJA 2ERRA 4X62F 1VLYA 2E5IA 2PC6A 5LL6d 1R8CA 4DZ6A 1KFSA 2VG6A 3HHDA 2QLXA 3OHAA 2WSCC 1U1NA 4B3TJ 3PX6A 4JI2J 2L08A 3VAJA 5I42A 1X4EA 3W1YC 4ZPCA 4J9SA 3OLBA 3P4UB 4CT8A 4ZP9A 2KYXA 1XR5A 2VJVA 1AFIA 4X64F 5CCMA 3DGVA 3QWPA 3RW7A 4KV8B 4G1QA 3MMCB 1U2RA 1IUJA 1UPPA 1YGYA 1Z2LA 3JSMB 4FN5A 4J9NA 5GAHU 2C3UA 4Q7AA 3NBPA 1TKZB 3CIMA 4CLTA 4Q2MA 1MROB 2BVZA 3ZFVA 2ZH8A 2DNLA 1P27B 3T5HA 5D78A 2G2YA 4ANEA 4M8LA 1OQ3A 2YKOA 1N5SA 4DL7A 4ZITA 1XIQA 1O6XA 5FJ4A 1KBRA 4U67Q 4F7VA 1B7FA 1S6PB 1NSAA 4PWUA 4FF1A 3CB4A 1HNWF 4ALZA 3Q83A 5HL7Q 1JMTA 1O5JA 3EXYA 2F5GA 3QRQA 1J5OB 4ED1A 2RNEA 1CJUB 2E1MC 3IA0A 2ACYA 2G0IA 1YI2S 4P73A 1EP4A 3NWRA 3KLHA 4I0WA 2ZZTA 4ZLLA 1DHMA 4HTJA 3H25A 4XDCA 2DHXA 2MKSA 3VV2B 1S76D 2K1RA 1GQEA 3FNNA 1N34J 4ECZA 3KDOA 5CAAA 4X4TA 2VONA 1LW2B 1RE1B 3LQVA 2PMHA 5J1PA 2KI2A 3PYEA 3O2IA 2Z4PA 2D69A 3HVRA 2C3MA 4GO5X 3Q0AA 3CCWA 2LXFA 2ZBPA 4B3RJ 1B3TA 1FRIA 3MGJA 4O3QA 3VGTA 4B3TF 1G2EA 3AJ2A 4Q8FA 4K4VA 2FLPA 2VU5A 3ETMA 3HVAA 5A8KA 4JI2F 2WOMA 4NPOA 4KO0A 1KTVA 2C2OB 5F8NA 4HI1A 1Y7PA 3OVSA 2QRRA 4FXVA 3R2DJ 4HACB 4U95A 2RB7A 4FF4A 1GMWA 4I6WA 5HMXA 1XBWA 1NHUA 2VG6B 3H98A 3SFUA 1YJRA 4ANCA 1CEZA 3OHBA 4Y2IA 1VMBA 4LF8J 1JJCB 3A8JA 2W24A 2GIQA 4C8NA 1ZBTA 1RT7A 5KFTA 3MF5A 4QR0A 5KG6A 3CJ3A 2K2PA 2ZVIA 5BR8J 1F3VA 2F7VA 3TAPA 4PWDA 3FUYA 3BGFA 5IT9Y 3T5KA 2RSQA 5DGBA 3NGSA 1RTIA 1NH8A 4PG5A 5B0FA 4OZNA 3NBPB 4Y0FA 3UW1A 3BO4A 3NAHA 1VRQC 1JJHA 2MZRA 1NK7A 3J7ZT 4LQ9A 2IM3A 5HJXA 1S6OA 4PPDA 5F8GA 3AD9C 5CD4A 4IH5A 2KG1A 1BQMA 1N34F 3DM2A 4YHHJ 1UZDA 4X4NA 1NUEA 2OIHA 5KG2A 2U1AA 2VKZG 1VRUB 3JSBA 4N7TA 4EZ6A 4RWXA 1DFDA 2WVFA 4Q43A 2F3JA 4OHXA 3DDKA 4F4ZA 1LEOA 4DS4A 2DO0A 2LVWA 3RAMA 3RW6A 1EP4B 1SPBP 2BKPA 3OVAA 4B3RF 1TK5A 3KLHB 5ITHA 4ZJLA 2HWIA 2V8VA 2DISA 1RTZA 2IDLA 2MXYA 2K1RB 3TJAA 2YWFA 2M8HA 3HSGA 2W7OA 3WQPA 1U26A 3A3OB 1KP6A 1VFJA 1JLBA 1YIJS 3L9ZA 9RUBA 4J9OA 1K0VA 2HK3A 3ZXWA 2JEFA 1HWJA 3M1VA 3KHLA 4ZLNA 4W4MA 2I9SA 1ZTWA 1F2GA 2BE7D 2RDDA 3DLLQ 2WSFC 1U8WA 4ZDNA 3NGRA 4IH6A 2OEMA 3KNGA 2AEJA 5A8KB 4LF8F 4ECQA 1W2IA 2AMCB 5A6PA 2WOMB 1HI1A 4KO0B 4ZK7M 3OD2A 5KG4A 5IV4A 1SC1B 1LQ9A 2I38A 3M32B 1WEXA 4CT9A 1SH0A 1WKLA 3IO1A 4U7UK 5G4DA 1GTHA 3EDRB 5BR8F 4CQ1A 1N54B 3CJRA 2BJ9A 3TO8A 4ID5A 2FY8A 4ER8A 3N28A 1WHYA 4DR5J 1RA7A 2QYCA 1TL5A 1YRTA 2VPYB 4Y00A 4ECSA 1FVSA 3GSDA 5KFEA 4PPZA 3IM9A 3OT9A 1PBUA 2CZVC 1B0PA 2YY3A 2CPDA 2Y0BB 3MOZA 4WXWA 1RT7B 4WK3A 4YHHF 4FS1A 2ZH1A 4QIWD 4L72B 4MIBA 2DRAA 4PWDB 3RU0A 3H40A 4LRCA 4F50A 2HKEA 3BH7B 3HF5A 2BQUA 3IAS9 5F0UA 1U1PA 1RTIB 1IXKA 3QRPA 5J1NA 1IQTA 5E2QA 4ZP7A 2MKKA 3TJ9A 1DQAA 4RKUC 5KT7A 3T3FA 2V2QA 1NMEB 2D3ZA 3ULHA 4DOZA 1V3SA 3S01A 1BQMB 3DM2B 4HYKA 1EKRA 4WFXA 2F1FA 4IOBA 1JLEB 5FDLA 3HVTA 3MR7A 2IFXA 4DQRA 4EWTA 4AL6A 3GZ7A 2DGWA 3G6YA 2IVMA 4DJBA 5KG3A 5HVGA 1UVLA 2W4CA 2GVDA 4ECTA 5LXRA 1T9VA 2XWYA 4L6V3 3V6JA 3MAAA 4OYMA 1WHXA 3HD1A 3W9HA 3M8WA 4WIQA 2OPPA 3M2RA 1IBLF 3CD7A 3TUZC 3HKZD 3VR1A 3PYFA 2WBMA 3CWJA 3S8SA 3G4SS 4GKKJ 3BN7A 4I2PA 2XC9A 3ZZOA 3M30A 4OYPA 4C8LA 1ACMB 2DHGA 1ZM9A 1RTDA 1VHIA 4AUKA 1HBOA 5A2QU 2E7XA 1RAGB 3I5BA 2BOPA 2VG5A 4GC7A 4OYZA 4U8VA 3KLEA 1MW7A 2C22A 4DR5F 4X4PA 2AGOA 3B6BA 2W2NP 1MG7A 5T7LB 2AJ4A 4DF8A 4HR2A 2NQPA 3QIDA 1KVJA 3W5YA 2VA3A 2E9TA 2IC3A 4JI8J 4URGA 2M0GB 4DCOB 5K8OA 3PW2A 5IFMA 2A2CA 3Q8SB 2QT7A 2HVDA 4PXCA 1LWEA 3FEYB 1AUDA 3MR6A 2CNLB 3NRBA 4XDDA 4W98A 2QX0A 1U4BA 1I3OB 4A8KA 3TZWA 4ZVTB 1FHTA 2CUYA 1BHNA 1UVMA 2ZH2A 2BE2A 4X66F 1IM6A 1H7WA 1ZAVA 2YKNA 4OX7A 4DLGA 5GMDA 3DYAB 3POTA 4OX6A 3ZTQA 4OJGA 2KRBA 2XG8A 4I7FA 1WWHA 2NCKL 5H9EK 2CDRB 2JEGA 3G2XA 1MMLA 3BR8A 3SBMA 4FZVA 4YR2A 3MECB 2C2MB 3CE8A 5C7PA 2EKNA 2BW7A 5E3RA 2FPHX 1GFWB 1BD6A 2FY1A 1TVRA 3BGLA 2W7AA 4NCBA 4GKKF 3K5NA 4E2FB 3KK1A 1WUUA 2NSCA 3KFWX 5FDLB 3HVTB 2FJDB 5M2RA 4NA3A 1S0MA 1J27A 3T1YJ 4YDDB 1W25A 4QU7A 2POKA 1GMUA 5J2NA 2MGZA 3LOUA 3SSSA 3MM6A 5DLFA 2GVDB 2XZTB 2D9OA 4V1Ak 1S7IA 3DGPA 2MJUA 3NS5A 3DLHA 1CBKA 1RDRA 4NEYA 4LSLB 3K8WA 3O1LA 4ED6A 1Q81T 2CVEA 2HVZA 3MAAB 2HQCA 1RUSA 2VFTA 4P2FA 2J7UA 5BYSA 3NP5A 3N4WA 1T03A 3HPOA 2OPPB 3M2RB 4C3LA 3SYZA 2EFVA 4PWWA 3QQCD 3KXDA 1VC6A 3LO3A 4ZPWR 3BKUA 3U7JA 3BKTA 2ZH4A 3CJ4A 3VHQA 2XBPA 1TUWA 1K0TA 4CM0A 2JSXA 4JI8F 3FMBA 4I2QA 5ETTA 3TR5A 4ERDA 2B0GA 2VH7A 2GNKA 1RTDB 1HBOB 4NYZA 5F41A 2ZC3A 2HQDA 1K1SA 2VG5B 4LFAJ 3DU5A 4C2MA 4B3MJ 2X1BA 2GV1A 4NLWA 1G1XA 2IC3B 1GNKA 2BJ3A 4O3RA 2LLZA 1RWWB 3K2YA 3DRSA 2HS0A 1IQZA 3NEKA 5IT0A 1LWEB 1RK8A 2DGSA 3MCMA 2I0XA 3G8QA 4X4OA 1FD2A 2DRDA 1RAJA 2RILA 1M0SA 3ENAA 4L75A 3Q24A 1ZPWX 2UUBJ 2D3O1 2AQ4A 3BBFA 5E5NA 2P8IA 1SC6A 2GVZA 4R0JA 3PY8A 2B43A 1NAQA 3BGRA 2E7VA 3HLUA 3VVTA 4ZN1A 2YKNB 1UP1A 3JS9A 3POTB 1VC5A 4I7FB 3T1YF 1HLWA 1VQ5S 3B4DA 3W60A 3FCWA 2GQCA 3ONQA 4K5SA 2GGPA 4FYYB 3C14A 3NOGA 1HFEL 4NYOA 2B5JB 5AJ3F 2MHEA 1TVRB 1YRXA 3IBFB 4UZCA 4M5GA 4ED3A 4ZLJA 2V4QA 1NDLA 1Q7YT 3KK1B 4CH1A 4DCPB 4K59A 2LQ8A 3U02A 1Y11A 3OUYA 5J2NB 2E9ZA 2MGZB 1WEZA 3VWSA 5KFBA 1QSLA 4A8WA 4DR3J 1KONA 3DGPB 4TXSA 5B08A 2HZAA 1FNMA 1B64A 4NLRA 3DOMA 4YOEA 3RB4A 2R7WA 2Q43A 4LFAF 1M90T 4P7TA 1S6UA 1T03B 4KYZA 4B3MF 4KIAA 2ALYB 3W5XA 2ZH9A 4ZHRB 2ADBA 2XWXA 4WFZA 1P1LA 2Z2LA 3D28A 1HBNA 1K9MT 4EO6A 2CQPA 2V4JB 3LWMA 4PEOA 1FI4A 3I31A 4TY9A 4DV3J 3QGIA 2DYAA 2EFGA 3H4DA 2C2RA 4ETZA 4CTAB 1VK8A 2QL7B 2B56A 3M9NB 2LECA 1FFGB 5GAEU 3AOAA 5IV3A 3CD0A 1FCAA 4DPYA 2XY5A 1Q95G 2UUBF 4BLGA 4JV1A 3MI7X 4MTPA 1WNEA 3I6PA 2KXNB 1M1HA 3H5SA 1X0PA 3H2LA 3QJJA 4X65J 4DLEA 2XI2A 3DRSB 3NXZA 5CYMA 5KT4A 2I2YA 1S0OA 2XLKA 1M5SA 2B4PA 5A0YB 3ISZA 3VGSA 5ETSA 4R5PB 3VF0B 2PO4A 1VI7A 3MZIA 1KKHA 4ANDA 4ZIVA 1UWBB 3ILIA 1F5AA 4A4JA 1Y5LB 1T05A 3LF0A 4IKAA 4TU9A 3EPIA 4Q5VA 3BGRB 2W2MP 4QZVB 1IR0A 1N8RT 2JH3A 2JC1A 1RABB 1C1BA 4OZ5A 3Q8RB 3GFXA 4DR3F 4WPAA 3GJRB 3PG9A 4DL0C 2GGPB 1SJQA 2CQDA 3KLVA 1V5VA 1LFWA 3C14B 3JQKA 2X3DA 1VQMS 1IVZA 4Z7CA 4OFZA 1RBOB 4UQGA 1HARA 1DRZA 2H3EB 2CPJA 5SUHA 2LYVA 5L38A 4H4MA 2GQ2A 2V94A 2QJ3A 3QGGA 2AT1B 3MPYA 4WP9A 3EPGA 4QOTA 1IJEB 3OUYB 1RISA 4DV3F 3MM7A 3C6TA 3BQ2A 4BHQA 3HP6A 3IRXA 5KOWA 3DOMB 3CNQP 1FJCA 2LFVA 2FLLA 2LQJA 5AE2A 2M3DA 2O3DA 3GIMA 2MYFA 1UVIA 3I87A 3GSIA 4UQTA 4F0MA 2KM8C 2NPIA 3KG1A 5IT4A 1HBNB 4HHJA 1CS4A 2R7SA 2ZJPQ 2BANA 5C5JA 1VGYA 2MZQA 5K8NA 4ZJQA 2PSZA 2EFNA 2DKOB 4NLGA 1R3NA 1VS3A 3IN5A 3K5MA 3CDAA 4J7CA 3OXFA 1VHFA 1FWLA 4LBHA 1ZM2A 4WTYA 2HZCA 4ZVSB 4DV0F 1N48A 2R7RA 1TKDA 3CTRA 1FEHA 1MSWD 2XLJA 1LKZA 2KB2A 4DV2J 4FDFA 2KXFA 2KT5A 2AX1A 3V4MA 1LV5A 4B9TA 5CYMB 1TK0A 1NKEA 3TVYA 1VOMA 2OEJA 3VAKA 4IG0A 3H5YA 1T3NA 2IA0A 2EG2A 2ZJQQ 1LOUA 4EK2A 1IBMJ 1A9NB 1HI8A 3J7AN 2NPFA 1B70B 4TYAA 2R8JA 1HYSB 4JI5J 1T05B 3RB3A 2JVRA 1W26A 2AYGA 4A8QA 4P2MA 4RUCA 4DSLA 1JLCA 2PI5A 2UV8G 4N56A 5DGAA 3CO0P 4ZJOA 3BDPA 1CJKA 1RQ0A 3NNHA 4OYAA 2UXDJ 2KYZA 3OTDA 2DEJA 2RS2A 3DHXA 4YB1P 4RNMA 4U9RA 2QFIA 1ZM3A 4DFKA 4H4MB 5JXSA 3HULA 2CADA 1WEYA 2XZWA 3GYGA 1RHKB 5C25B 4NXNJ 3CJKA 3AT1B 3DRXA 4PKDB 3KOAA 2BJ8A 2JVOA 3MDFA 1H3DA 1HMVA 4UOFA 3HD2A 4B08A 1S10A 3C6TB 2VPXB 5BYQA 3W9IA 4EUVA 3IRXB 1TTHB 1HNXJ 4F0HA 2RQMA 2RQCA 4LF5J 1S0NA 3R6GB 1HNZJ 3Q8PB 3UD4P 2VD3A 3N79A 2BYCA 3AFGA 3ZC4A 3QAEA 2D74B 3G96A 2WVBA 2B4UA 3WBZA 1CS4B 4OIXA 3CDWA 4YB5A 2BANB 4NA1A 3O6QA 2VC0A 3WHIA 4ES3A 4IRKA 4OYIA 3VALA 5KFUA 2PMZD 4QYRA 6AT1B 3DRPA 2QFJA 3HSJA 3MR2A 2CPZA 1FTCA 3LPYA 1ZOTA 3W62A 4C7QA 2GX8A 4CIOA 2BJ1A 3VQSA 1IBMF 4EZ9A 2H5IB 1NZ8A 1V9OA 1HIYA 2C2NA 4JI5F 3CDEA 1U48A 1Q8LA 5IC6B 4CCHA 2FLOA 1GT8A 5B0CA 1VIXA 2DGOA 1HWUA 4WJBA 3RR8A 3B8HA 2C2ZB 2XMVA 5H1SV 4BC7A 1JLQA 1VBYA 3AY0A 3ISND 4CO3A 1S1TA 2PIIA 5E41A 4WKYA 2BKNA 1NJYA 3KLFA 2CKWA 4NLOA 4IG0B 4WBFA 2HHSA 3H2VE 4UTGA 5DQGA 4FPIA 2GFFA 4YS2A 3SZ2A 3TX0A 1RLCL 3TQEA 1X5PA 2JLEA 1L3KA 5J2QA 5JMNA 3P3DA 1AYEA 4FKXA 2D9PA 1D09B 2X51A 3ZTOA 1JLCB 1Y10A 4NXNF 2IDEA 3GFHA 4O3SA 4DPXA 1Q0NA 4DL6A 4ZN3A 1V3RA 5E33A 3MCSA 1DQ8A 2NR0A 3EUNA 1YKWA 1TKXA 1S99A 5GAEI 3QSYB 1CJKB 4XAKA 3D6FB 4LF5F 4MT1A 4F3QA 3A13A 1Z4UA 1FDAA 2V8GA 3Q22A 1YQHA 1SC3B 3THTA 4IFYA 3UDCA 3QFHA 3QNWB 3V4IB 3MTJA 4ZA1A 1IM4A 3CJKB 4DF4A 1OSCA 3DLKA 5A8WB 2VPZB 4TLQA 2CNKB 3MR3A 2HFOA 1H74A 4RBVA 2VDHA 4CLPA 1FKAF 4I6YA 3VCDA 1HWLA 5DDQC 4NRTA 3J7YU 2HK2A 3MMBA 2HFUA 1U6ZA 3GIRA 4LIRA 3OFHA 1F3FA 1IR2A 1T9TA 4IR1A 2QA4S 3OL9A 3UVJA 1HBMB 1FFWB 5EGYA 4RR5A 5DS7A 2ZNYA 2KFYA 2UP1A 2YPZA 1QD1A 3AB2B 3DRPB 2DY9A 2ZOMA 2OTLS 2XQCA 2IVYA 3HJVA 3AXKA 5DG8A 1C0TA 3LGHA 1RWNB 3I0RA 2NUHA 1L3VA 3O8WA 2CQBA 1NPPA 1NB2A 3RGIA 5L1IA 2ZZMA 2QLBB 4M5HA 3ZNJ1 3RRKA 3VTIA 3I0SA 2YWKA 3SQOP 2PA8D 3C15B 1VBXA 3GE9A 2J9DA 2APOA 4EO8A 1JLQB 2QA1A 1F0XA 3FBBA 4NZ7A 1Y3KA 2B7BB 2ZUGA 1HKAA 1U24A 1RT5A 3KLFB 2MQ8A 2RRAA 2WHOA 5HQMA 2ZEJA 4KE5A 1NKBA 4NCGB 4CYUA 2OH2A 1U6BA 2AJ1A 1YG0A 3G87A 3OXLA 2HNZA 2ZBRA 2B9XA 4F4WA 3AHPA 3IP0A 4RUHA 2WB1D 2F40A 1UEKA 3FSIA 2DR6A 2DR9A 3GCWP 5IXUA 3DI6A 1YBTA 5H9FK 1TKXB 2W4PA 4PXBA 4LFCJ 3UI3A 1CLFA 3HFZB 2X1FA 4X4RA 3PIOQ 4USMA 3FCHA 3PJWA 4ECRA 4M5KA 2XMUA 1FJ7A 4DX7A 2DIVA 3TZYA 2OMLA 4IFYB 1JIHA 1HA1A 2H5JB 4OI1A 3BKFA 3IXQA 1I6JA 2B51A 1G4CA 3AD7C 4C8KA 2OAUA 3DLKB 3L7OA 4DQQA 3RAQA 2EW9A 2COLA 1BY9A 2VIHA 4U6PA 2BUNA 4O23A 1OYEA 2WW8A 3MMBB 2OSRA 2MQPA 2EFQA 4WIIA 3QFWA 1S4FA 4R8UA 2Y9HA 3K17A 2VQFJ 1OPZA 3UVJB 3FDSA 2N4CA 3BBBA 2P2CB 1XMOJ 2W2QP 3A8EA 2GJIA 4LJMA 4RU9A 4ELTA 2VOOA 3GFYA 2HNYA 1VQ9S 4MKYA 3PACA 5KFZA 3PW7A 2HPUA 4FBUA 2CQ1A 2A6MA 4DG1A 3NS6A 2CQ3A 5HMYA 2HNDA 5D4NA 1U1RA 2Y8WA 5LSLA 4OX9J 2BKOA 1KLMA 4A48A 2OEKA 3FKBA 5D6GA 1IKXA 2LXIA 3N5BA 1C0TB 3I0RB 1RT4A 4WZQA 5LOQA 1NBEB 3JTNA 4BBYA 1GEHA 3PFEA 3PW5A 3HX9A 3OFEA 2V50A 4B9UA 4MK9A 1QM9A 5C42B 3T19A 4RW7A 1G3OA 3I0SB 4KHMA 5AXNA 2DGUA 3OR2A 2YH0A 1QAJA 4O44A 4YR0A 1X60A 2J0WA 1LWFA 2HGMA 5EUHA 2IIHA 3HO1A 1RT5B 4LFCF 1U1LA 3WX8A 1RKIA 2BM0A 1WORA 4C8OA 3EX7B 1NK0A 2R8KA 2YTCA 4QR1A 4KC5A 2HNZB 3PHEA 4OI6A 3PHTA 1Q8BA 2DD8S 1PILA 8ATCB 5I3PA 1XMBA 3DI6B 1WD6A 2CXEA 4NEZA 3IWXA 2E5HA 4DSEA 2DH7A 2VL1A 2QN6B 3NGTA 1FRMA 3DRRA 2ZBQA 3MEDA 3OFFA 1NSQA 7FDRA 2VQFF 4LVOP 1Q16B 4E0DA 2VA2A 1XMOF 3SEOA 2X1AA 2R9LA 2HVIA 2CJAA 3CJ5A 4CLFA 2RD5C 4B02A 1X4CA 4ZVUB 2MKJA 2JHEA 1BWEA 3DDNA 4OX9F 2YQ1A 4J9MA 1WF0A 2XSFA 2RU3A 4HHHA 1X5TA 5KFKA 2RVJA 3LA0A 2PE8A 2M7SA 1TAUA 2CDQA 1AROP 4R8UB 1VQNS 2F9JA 4W90B 2B8QA 4H4KA 4PXEA 4YN3B 2HGLA 3PNIA 4URSA 3H5UA 2W8LA 3MD1A 3D7SB 3M6VA 1X4HA 2OPRA 3UO0A 1QVFR 3D9BA 2HNYB 4QWEA 2DO4A 3MEEA 3CCES 2VFSA 4RPFA 2FVRA 2DH8A 4DG1B 2FVQA 1KS2A 2HNDB 2QLFB 4K4UA 4J9RA 2EK1A 3QMQA 3CJ0A 4A47A 3OTBA 1NPKA 3G86A 1KLMB 2MZSA 3MPWA 4USVA 2GAGC 4YB6A 1RT4B 3AODA 2KVIA 5D4OA 5KFIA 4L3KA 3NCRA 2GIFA 5K14A 3HHLA 5KAKA 2PDAA 4RW7B 3FEXB 3TUIC 2GQQA 4DQIA 2KTQA 4QR2A 3G8SA 3OR2B 3CXCR 2RUGA 4O44B 4WE1A 2VF3A 4JOUA 5A76A 5EDWA 3EVWA 3JQMA 4Q2LA 3V5RA 5E7OB 2B4OA 3HJFA 3J7YI 1LWFB 1UA0A 2PI4A 2ZBIA 2LA4A 4ES2A 1Y3JA 5F8HA 1REVB 4ZVOB 4X4VA 4USIA 2XMJA 1RT6A 1VRTB 3CO9A 4DUTA 1Y0HA 1M5HA 3BSNA 4IR9A 2YKMA 3CT9A 2DNHA 3C6UA 4UZBA 4GVBB 2JL9A 3WZ0A 1RWVB 3HI9A 3L7PA 5IWAJ 1WTFA 3NMAA 3EZUA 2AKWB 4LBPA 1PYSB 2DNNA 2J7KA 2QV6A 1WKJA 3UDLA 3UCZP 5KFYA 5BJRA 4MIAA 3F56A 1N5QA 3DFEA 3OTCA 2LEAA 3H7HB 1N0UA 2V5HG 3M8QA 2R8IA 2H65B 3DRRB 5H9FJ 3MEDB 2EC2A 5T41A 2CFXA 3NL0A 4C8YA 1RAEB 3FFIA 4K2JA 5HLFA 3RBZA 1N52B 4YP3A 5E3AA 2QMWA 4OJ3A 1XNQJ 3DOLA 4RLEA 5EWFA 1RT2A 5DM6Q 4OV1A 3OR1A 1WF2A 5T14A 5ADZA 1PG5B 4A8MP 3OTEA 2AWZA 4ZLPA 4IFVA 4O4GA 3K59A 2KZMA 1AT1B 4TKTA 2O66A 2V69A 4F4AA 2W1BA 4OZ3A 4DSIA 1BGXT 1A0OB 3ET6A 2VC1A 2OPRB 4DBQA 3TZZA 2FLNA 4K4TA 2RAQA 2R4FA 1KWMA 1T9YA 1TQLA 8RUCA 2Z56B 3D1QA 1XERA 3MEEB 1QAXA 4OLOA 1EETA 2EFPA 3D1OA 2ZH5A 2Q79A 2MPUA 3W9JA 2EXUA 1EX8A 3SSRA 2VKRA 3I5CA 3TUPA 2H5EA 5HQ8A 4ZP8A 2UVWA 3UD3P 2HIYA 3VAHA 1BQNA 5B7WA 5A2QY 2MKHA 2A0FB 2FQQB 2EC0A 1MWQA 2FGOA 1N6QA 3NNCA 3PEJA 3HHLB 3BZQA 1RP5A 3NWGA 1VQKS 5L8RC 4P2XA 1K44A 1W7WA 2HHPA 5IWAF 1XK8A 1VQSA 1URRA 1UJ5A 3RB6A 1IJFB 2LEPA 3E01B 1LWCA 3DU6A 1B99A 1U25A 5KFLA 2NUUG 2V9KA 2KVQE 2RJZA 2IVFB 2E7WA 2MKCA 2LU1A 3IWLA 3CC4S 2FIUA 1N56A 1RT6B 1NB7A 3OLAA 1FKOA 4C11B 5CZVA 3IR7B 2YKMB 1KDNA 3C6UB 3BM7A 4C98A 2LDYA 3UDVA 3ITHA 1RHUB 1SVDA 4A8FA 4C6AA 4OYWA 4XTTA 1L3SA 2D1CA 1XNQF 2ZH3A 1EB0A 3FBEA 3NCPA 3MURP 4MK7A 3KG4A 1JXVA 4QQBA 3NCQA 2A10A 3PR4A 5F3ZA 3M8QB 1TKTA 1T0TV 1SQGA 2LKZA 2YH1A 1DAXA 5E3CA 3BBCA 2ZD1A 2DB1A 1EQ0A 1FX4A 3FFIB 1D3WA 5HLFB 2GMHA 4AL5A 3DOLB 4BCAA 2G4BA 4IDKA 3CUNA 4C3KA 1RT2B 1KNZA 1CQMA 1PIEA 2DXDA 1TFWA 8AT1B 4EU0A 3OR1B 2YQ3A 2KT3A 3ISNC 4V19J 1AW0A 2J9EA 1U7LA 3M8SA 3GB0A 4EI2A 4R25A 5LSRA 2CAJA 1PC5A 1RTJA 2XMTA 1IKVA 3H42A 1X9SA 3VZIA 3G6VA 4IFVB 1UL3A 4O4GB 1SJRA 3PZPA 2UVVA 4DFPA 2W01A 2HHVA 2R7OA 2JC0A 2FYXA 3ET6B 3S7RA 4ICLA 1AXQA 3FC9A 3MMAA 3JTOA 4AQYJ 2UVUA 3QWUA 1EETB 2R2UA 2KO1A 1XNRJ 1HHTP 2HS4A 4B3SJ 3BYPA 1WTBA 2RE1A 2X3GA 2DR7A 1NXIA 3UN5A 4FNHA 4AXJA 4X4UA 3BS9A 3IRWP 1ZAXA 1BQNB 3QSIA 2Y1JA 1LFPA 5A6WA 3FK4A 5D15A 3KLIA 4J9VA 2BZ2A 1NJWA 2UUAJ 4TY8A 1N6QB 2GA7A 5L1JA 3SCJE 1NZAA 1F9FA 2AP6A 2CQHA 3ZZZA 4RU2A 1H72C 1ZYQA 3TANA 2KM8B 4EYIB 2Q66A 3Q2SC 1ZS6A 2W2PP 2RIJA 1HWKA 3UPFA 2HW3A 1NNDA 4OI0A 3IBCB 5KFCA 4O3PA 5CD4H 1KD1T 4LSZB 3MPDA 1XMQJ 3HMJG 2UZAA 3F44A 2DPIA 4OHZA 1FKOB 2AJ0A 2J76E 2J0XA 5GADU 4DV7F 1DARA 3FBFA 1SKWA 3QJPA 3HHLD 3ITHB 2XHCA 3LP2A 3HSDA 2XGPA 1Q82T 1VBZA 2C42A 1SL0A 1H0HB 4ZCLA 1VBKA 2RU9A 4ZVFA 1SJ1A 3KJFB 3OJSA 3B54A 2HQ3A 2CVIA 3PO5A 5KFJA 4IQXA 1D9FA 2JFDA 4H54A 2ASJA 5LJ3Y 3SDEA 1TKTB 3GILA 1UCNA 3QO9A 1S5ZA 1L5UA 1U1MA 2ZD1B 3QJLA 4GC6A 4ZVQB 2KH9A 4W92B 2Z2ZA 2M70A 2BRKA 4AQYF 2UUWA 2BV3A 4IDKB 4CLYA 1AA1B 4HTIA 3UN2A 1U02A 2KRRA 4CLKA 2ROPA 1FRJA 1XNRF 2R7QA 1QTMA 2M9KA 4B3SF 1GXTA 1S1VB 5D0EA 1S1WB 1RTJB 2Q6BA 1NRKA 4Y2KA 1IKVB 4TQSA 3CULA 4KT0C 1S9FA 1JXLA 2M4MA 4I1TA 2ZHBA 5HBMA 4HT7A 1S72S 2UUAF 2XEXA 2J6TA 4ICLB 1WC5A 4EFAC 4JV5J 1NJXA 3MMAB 3DN9A 3BPDA 2YX7A 2J6SA 2YNHB 2DNPA 4WK1A 4AXIA 1Y4ZB 2IYIA 5KFGA 3JXOA 4MKBA 1I1GA 2EEYA 2CJ9A 2KKHA 2EK6A 3GCXP 3MUTP 1F2HA 3HT0A 2R8HA 2BRLA 2LP4A 2C3PA 1XMQF 3UWTA 3KLIB 1TUGB 4TY8B 2NYIA 4HH1A 2WW4A 3V2UC 4Y65A 4OI2A 2RMLA 2Y1LB 2MHNA 2NS1B 2J0QD 1KFDA 3CMQA 4ZVGA 4M63A 4OHYA 2CPHA 2DNGA 2UUCJ 4LUBA 2B7CB 4AL7A 1WJ9A 3J81Y 2LEBA 4DR6J 1EQMA 2FHOB 1TFYA 2EWHA 4J9KA 1C4AA 4F3MA 4K4ZA 5HMWA 1S12A 5I42B 3RAXA 3KYLA 2HVHA 1UAWA 1LXNA 4CLZA 3LP2B 3EVMA 4Z2XA 2BA9A 3H4BA 2E66A 4LF9J 1LWXA 1P6TA 3B78A 4G1QB 2OO4A 5HP1A 4CLSA 5CCLA 2VASA 2QMXA 3NNAA 3ILLA 4AT1B 4FVMA 3SDEB 1Q79A 4TLRA 3QO9B 2QL9B 4UOHA 2KHCA 1UFLA 1NDKA 4QIGA 3SQGA 4JV5F 3VAGA 2B6AA 3WC0A 5I3QA 4OL8A 2RRNA 2RQ4A 4WFAQ 4NRUA 4ZP6A 3HZGA 1IKWA 1X5OA 1Q5YA 4NX9A 2DNYA 5LMUJ 4CLLA 2HFZA 3IC1A 2HZVA 3WX4A 3NMRA 4JUZA 4ZVHA 2R7VA 3PJ9A 1RAAB 4KJIA 3QT8A 1YDLA 5DETA 1YJTA 2OELA 5HBMB 1AFJA 1DTTA 2DJWA 4Y2AA 4CZCA 2AJQA 2C2EA 1JWWA 2ILYA 2HG4A 1NHVA 3HK2A 1RAHB 1VR6A 3DRYA 3HXMA 2CG4A 1HNVA 1HPZA 1U1OA 4CLWA 4DR7J 3ENVA 2G2OA 1PJ7A 2UUCF 3TJ8A 2YQ0A 2NZ4A 4UF4A 3HHNB 4DHVA 2XNQA 4JP8A 3P5BP 4DR6F 1CC8A 2K7KA 2UXCJ 4QWDA 3CGIA 1EJ7L 3RRGA 5AE3A 2VODA 1JJ2R 1TELA 1IBLJ 2MQLA 3B82A 1WOPA 1U09A 4ILMA 2DGQA 2Z0GA 4K7QA 2JEJA 2F8MA 2CA9A 1E6VA 1FK9A 3G6ES 3BSAA 4LF9F 4EMDA 2ZDPA 4J37A 4N47A 5HATA 3MTKA 4U96A 4DPOA 4ECVA 3GR0A 3P45B 2D7SA 3ZZYA 5KFDA 2UVRA 3TEHB 2ROGA 1WC3A 1FO1A 3KKFA 3MUMP 7FD1A 2HHTA 2DR5A 3SCKE 2QSFA 1SI9A 1YZ7A 3NKYA 3BJYA 1X4GA 1QAYA 4B9SA 1JLFA 3I56S 3TAMA 4P75A 1HD0A 3LAMA 5LMUF 3A4TA 1NK5A 3GFZA 4DQPA 3JSRA 2ACMA 1Q53A 4KGMA 5KFAA 3F73A 3A8KA 1AUSL 1N5VA 1SB6A 4KGVB 1BWVA 2BQRA 2ZITA 2NXCA 4WP8A 1M5OC 4HH0A 5KFQA 3SQGB 2ILZA 4QPXA 3MCOA 1VYAA 2B6AB 4X66J 4CDIA 1VQOS 1LK5A 1QJHA 2Z58B 3RZAA 3P49B 5KT3A 1UZHA 4DR7F 3C3LA 2DK2A 2ATCB 2QLWA 2W9CA 1UEVA 3DC2A 5ETLA 4NCAA 1KN6A 5DRKA 5JUMA 2VJUA 2LU2A 4C9DA 3PYDA 4C0OC 2UXCF 5BXIA 2ZZNA 5HAOA 5GADI 1UPMB 3R5GA 1P9QC 4RW8A 1EHWA 2L3MA 1DTTB 5EWEA 2E5JA 4QPTA 3AQOA 3PRDA 4DR4J 1RKJA 2OPSA 2NXJA 4WTOB 1RAOA 3IR6B 3TQ1A 1RT1A 1JLBB 1OQ6A 3C16A 1HNVB 1HPZB 5F9NA 2RT3A 1FDNA 5F8MA 5DG7A 3M1VB 2ZDOA 3D66A 5HANA 3I9ZA 1UFWA 2Z2MA 2AGPA 2YKQA 5ETQA 2OPQA 1U0HA 4O3OA 4AE5A 4FXDA 3OVBA 1N33J 1NPRA 1SJFA 3QGHA 1QLNA 4IUFA 2KJWA 3EICA 1IKYA 3UNYA 2DPJA 3W64A 2KG0A 1WC6A 2E1AA 4KSEB 1E6VB 1FK9B 2EG1A 5D0HA 1GX6A 2BQ3A 3DOKA 2J8AA 5J2MA 2MJNA 3CPWR 2I6WA 2K3KA 1KVIA 3CD6S 3VGVA 3M4XA 2MTLA 2V2KA 2RH3A 2C3OA 5KFNA 5KG5A 3FRYA 4MAKA 4JI7F 4ID5B 5D4PA 4UUXA 3D4JA 2SXLA 2N3LA 5KFSA 4KB7A 4HVZA 4N41A 3OJUA 4IOAQ 4LF6J 2JDJA 3CMAS 2ZH6A 1R0BG 3EGWB 2BM1A 2JNJA 4HI2A 5IZHA 4OZ0A 3J81j 4PR6A 1JLFB 2WTFA 3TAMB 2MY7A 3W3SA 4CM2A 1RZMA 2XI3A 1TZ0A 5IM0A 1KQKA 2AZ1A 4OMFG 4QJVA 1S9EA 4P9SA 2AYEA 1PSDA 1B7YB 3H8YA 4N5SA 5FIIA 3BDEA 4DX8H 2HIQA 3KDNA 2DNRA 3TI0A 3KK3A 4URQU 2LQ5A 2MLYA 4PZVA 3FQKA 4IQMA 1WG5A 4DR4F 2ALZA 4IO1A 3UE2A 2XS5A 4LF7J 2MZ1A 1N88A 3J7A1 1RB0A 3WC2A 2F4FA 2MY8A 2WBRA 2W9CB 4ZCIA 1C4CA 2ZUAA 1U47A 4NLPA 1UKUA 1NK8A 2ZFHA 2DHSA 3E8OA 5LJ5Y 2YWHA 1SH2A 2ZWOA 1YITS 4Y28C 3BSOA 3X3UA 4RL1A 1XTZA 1CULA 4RW8B 1QE1A 3DCAA 4D3GA 1N33F 3HSZA 2V8HA 2G0JA 1U49A 3EYZA 5AJ3J 1LNQA 1VQ8S 2FVSA 1GX5A 4KR0B 2AF6A 2OPSB 1M5VC 3R1LA 1OSDA 4I2PB 1SH3A 4TU7A 1RTHA 2BOAA 1RT1B 3M30B 3C16B 3K89A 1QSYA 4C0HA 2JEIA 2LA6A 2C2KB 2OI2A 1J2VA 1IBCB 2DNZA 4PRFA 3ZZ0A 2R7UA 1M5KC 3KMSA 2OPQB 1U0HB 2HLTA 3KLEB 3MMJA 5DLGA 4ZKAA 3D2WA 5AT1B 3CJQA 5L46A 3IBWA 2VFRA 2YWWA 3TRGA 4RW6A 2MSTA 4YDXA 1FTRA 4LF6F 4CNZA 1OO0B 1UFKA 2VFUA 1H2TZ 2IRXA 1TR0A 4DL4A 1H6KX 4JI3J 5J2PA 4YEAA 3DOKB 1FRLA 4DZDA 1R6YA 3ZTPA 3OW2R 4LR7A 1WC4A 3L09A 1D8YA 3I32A 2L9NA 4C8ZA 3JSMA 5AXMA 3Q89A 3SSQA 3W5ZA 1R8BA 4BWJA 4DV1J 5D0GA 1V6HA 2CJYB 3AXMA 1MN7A 9ATCB 2MQMA 3IR5B 3GV5B 1YBUA 2BABA 1FX2A 4K4XA 2WK4A 3QYYA 2BE2B 2HURA 2I8EA 4LF7F 2J9CA 3N6LA 3H2UB 4S0MA 4JI4J 4GMKA 3C2PA 1IR1A 2W7PA 2B9EA 2H1YA 1S9EB 1PCAA 2IA6A 3GIJA 1H73A 4H4KC 1DJ0A 4J9PA 4CNYA 4UW2A 1TL7A 1FE4A 5CYQA 3DMJA 2ADCA 4Y6IA 3KK3B 1F5CA 4FS2A 3GU0A 2G2ZA 2R7XA 2V67A 3ILJA 1XJWB 2CIMA 5HSPA 2BBEA 3IMQJ 7AT1B 3BO2A 1TMJA 4DX6A 2A6OA 1Y5NB 2RDJA 3MM6B 4RWWA 3TA2A 2FUG9 1S4EA 1I94J 3PW0A 2WAQD 1NM2A 2BW2A 1X4DA 1FDBA 3R3TA 1CULB 3HHLC 3LP1A 1QE1B 3IAM9 1WC1A 4NLYA 1VQ4S 4A8XA 5B0GA 3AA9A 2GHVC 4ZOSA 2F8EX 1RTHB 3MUVP 4DPUA 1WG1A 4DI6A 4JI3F 2MLXA 3PIPQ 1VQLS 4I2QB 3TP2A 5HQLA 4PABA 1CJTA 3CSKA 4WP3A 1O8BA 2QMUB 3R5AA 2DRBA 4DEZA 4ZPVR 4DV1F 1O0PA 2CZ9A 3D6TB 2GJ2A 4MIWA 2ATLA 3PR5B 2D3UA 1F60B 3JQJA 4NLDA 3NY0A 3KTQA 4RW6B 4EBEA 2L48A 1TL3A 1PO6A 5CABA 1JNRB 2DGXA 2FVPA 4ECXA 4PAAA 2P6SA 4JI4F 1VDHA 5KFPA 5J2PB 4ED0A 2E5LF 3J81U 1UA1A 3BEGB 4CRJA 1S79A 1S9GA 4B3OA 1U2CA 1T02A 4B9NA 4DV0J 2K8GA 2ZHAA 2CQIA 2PA3A 2F63A 1T11A 4C97A 3OPKA 4N8NA 2CQ0A 2IRYA 1R7IA 4IO9Q 1PC4A 1R0AA 4NE9C 2GVZB 4FYXB 4GKJJ 4GRSA 1YK9A 2CQ2A 1VRUA 3PTWA 2DH9A 3EGNA 1EAYC 3J80Y 3OL8A 2KFNA 2E1CA 3L95X 3AJ1A 1L3UA 2P6TA 3TNVA 3CJ2A 1MWZA 3I9V9 3R7NB 1C0UA 1OJ4A 1NK6A 1D1UA 4F4KA 1YBAA 3T1AA 3PRVA 5HK4A 2XLIA 5D8HB 2Z57B 1I94F 3K5OA 5H9EJ 3G8TA 4PCQA 1TL7B 5CYQB 3DMJB 2GZOA 2LQBA 5K8MA 2IJFA 4QU6A 1WC0A 4QWCA 4M5DA 3FCVA 2HSEB 2OHDA 4RNNA 4UUWA 2DGTA 3R97A 2D41A 1AZSA 2IM2A 4CH0S 3EWGA 1FEEA 2LDIA 4C0BA 4FYDA 5D77A 3R2CJ 2XYHB 3CC2S 5D4LA 5HJYA 4L74A 3M8RA 3KLGA 4WYWA 1YJWS 1HHSA 1DLOA 5G0RA 1S57A 1RU2A 3CJSA 3LP1B 1DY3A 1NEEA 1C1CA 1QUPA 1FJGJ 4PG7A 3W2WA 3CCTA 3C66A 4LR9A 1X0FA 5GAGI 2DHHA 3M32A 3EVOA 1RYSA 2FJAB 4USJC 2ZHOA 4BDPA 3O3LA 4DL3A 4LF2A 2CG8A 1CJTB 2CWXA 2ZC4A 2J7WA 2CPIA 2RRBA 4KGKA 3LP0A 3SI8A 3HFVA 2FC9A 3PRBA 1U2FA 1RAIB 4MH8A 1PGZA 3P5TL 2PEHA 2BJ7A 3KUHA 1TL3B 3K58A 4ED8A 2MKYA 5K8PA 5HI7A 4FYVB 4IYQA 2OJ3A 4GKJF 4C8MA 4FP9A 5KFVA 1RXOB 5DDRC 3QAUA 4DX5A 4ZVEA 3AB4B 4DCJB 1RACB 5ETKA 2IRUA 4CO2A 3HFKA 2RKIA 1S9GB 4DV4J 4Y34A 4B3OB 2GMLA 2ZNZA 4RUBA 1XEZA 1RHJB 1EIYB 1SC4B 2LXUA 3T9NA 5DDOC 2HRUA 4FVCA 3F41A 5F8LA 1HWIA 5KFWA 1R0AB 1S49A 3M6XA 3SCIE 5B0EA 3OQ2A 4E8UA 1KR4A 1JLEA 3QBCA 4Y2MA 2D3OR 1WF1A 1WHWA 1X4AA 3L3CA 2RF2A 2NREA 3ICLA 3NS7B 2UUTA 4Y2CA 1C1BB 4EBDA 4DV6J 1C0UB 1Q7LB 2VFVA 1YSJA 4KGXB 3V6DA 3D6MB 1JLAA 1S48A 4AFFA 3BB5A 1X4BA 3H59A 2V9WA 3I4PA 3MM9A 3RYLA 4ID8A 4XO0A 4DQSA 1VQ6S 2V6AA 1FJGF 1I51B 2F65A 3TOQA 3R5BA 2FD2A 3MCNA 3ZZPA 4M5DB 3X1LB 2Y3YA 1MLAA 4IG3A 3CCQS 4IOCQ 1YJNS 4HL9A 1AZSB 2G0CA 4ETXA 2HMIA 3HM9A 4XPCA 3PV8A 1HHQA 1S97A 2QSWA 3KUGA 4BS2A 4DDFA 3R5JB 1FXRA 3MM7B 2LQ9A 3KLGB 4G6VB 1N5YA 1DLOB 5G0RB 1NH7A 3MAQA 5T7LA 3D5MA 5THWA 5K5MA 4JYAJ 1C1CB 3N01A 3VAMA 1R0CB 2IJRA 3W2WB 3K0JA 1DBDA 3GV8B 2EBGA 4F4YA 1IWGA 5C2CA 5JVHQ 3BH6B 2ZM6J 1OY8A 1S0VA 1QTNB 1N32J 2HHWA 1TP7A 1EZZB 3BO3A 3PYGA 1CPZA 2YNGA 2K06A 1SQFA 4LRFA 2L9DA 2OSQA 3LP0B 1FDDA 4DV4F 2JZ5A 2DT9A 4UOCA 5RUBA 4EYHB 3HHKA 4P72A 2M2BA 4ED2A 5AXKA 2B4VA 2GO9A 3CCSS 2QYGA 2H9ZA 2HQFA 3G6XA 3LGMA 5KG7A 3DLBA 1SIZA 1NKCA 2CNOB 1LXJA 2XSJA 4QIVA 2V4RA 1Y00A 2BMBA 3DYAA 3IGNA 1NU4A 1TU0B 3FZ2A 1HQUA 2Z8QA 3MWBA 3M6WA 2RKIB 5GMEA 3M8ZA 1G7CB 1Q86T 4DV6F 3N6MA 3MECA 1OWXA 3RTVA 2CPEA 1K8AT 3UR0A 4X84A 1PAUB 4OJ1A 3PEHA 3PDNA 1D9AA 2DBBA 1RHMB 1JXEA 2PT0A 2H48B 2FZCB 4EGLA 1WOSA 1FRXA 5CA5A 1X9MA 3BV8A 1VIOA 3ILOA 3W65A 4L3NA 2OFGX 3GQCA 2RF2B 2JOQA 5HVHA 3P6YC 2M5YA 4XIUA 1S59A 2KL8A 3T1HJ 2A1BA 2B8PA 4JB8B 1SQEA 4UT4A 1H7XA 3FVYA 2EVZA 3V6DB 3CIZA 2WVEA 1JLAB 4LSLA 4DPWA 2QLJB 1KQFB 1SV5A 4DN0A 2WONA 3MM9B 3I55S 4JYAF 2P9EA 2I5JA 2QIFA 2HWHA 2ZM6F 4IG3B 1RCOB 3C46A 2HMIB 1N32F 1BMQB 3D67A 3NOCA 5CXTA 1T94A 3MHYA 1HMVB 2V2ZA 4IRCA 4P71A 5GAHI 1PYTA 5KTQA 1HQ2A 3ADAC 3DLGA 2XMAA 1RBLA 1N5YB 2AYBA 2M52A 3GG1A 2FGCA 2V2VA 2W4DA 2ASLA 1ITPA 3MM5A 1WHVA 4A8SA 1WG4A 4OX8A 3E3XA 3D0GE 3TAQA 4D3HA 1MMDA 4P10A 2YNGB 3LANA 4H4OA 5HROA 1QSSA 1B0TA 1BXNA 3KHHA 1S1UA 5HO4A 1YHQS 3AH6A 4CP5A 2CZ4A 3A1YG 3M9MB 3GV7B 4DXLA 3CCZA 3K8VA 2LCWA 4LFBJ 3AOCA 3UNGC 3M05A 2XSJB 5JJBA 3FBCA 1O51A 2AJ2A 4BWMA 2R2RA 3KJVA 3AJDA 2FHKA 4YQWA 1RLDA 1R8HA 3BSCA 5KG0A 2G1DA 3FSXA 5SZTA 2I1RA 3AD8C 1HQUB 4BC9A 1GMWD 3FGVA 3Q2TC 2K3IA 2IYGA 2EI5A 2RUSA 2VBZA 2JWNA 2W8KA 3T1HF 1NSPA 4RJVA 3MXHP 1S1TB 4HT5A 3LGNA 1JB0C 4CH7A 2VBWA 2XS7A 1NK9A 4HKQA 1T9WA 2W9AA 1U45A 2B5JA 3FSYA 4WU2A 3CCJS 1V5IB 5A8RA 3GYNA 5LT5A 5J2QB 4ES1A 4NWBA 1RBAA 1WI6A 5C24A 2XNRA 2P5VA 3MEGA 4PG8A 2OUGA 1YZ6A 2E1RA 2DVIA 2G9OA 3SCLE 3PJXA 5KT2A 2R3VA 5HN0A 3RBDA 3T5LA 2OD4A 3OSPA 2R7TA 4F67A 4B9LA 1SV5B 4DUZJ 3ENWA 2WONB 4N76A 3U27A 1BQXA 1UETA 2NXNA 2IAJA 5B0AA 1NSKL 1KEKA 2I5JB 4ZHRA 2A2DA 4JV2A 2RS8A 5CQGA 2V4JA 4DU8A 4X4SA 3KHRA 2HAIA 4RO0A 3KG0A 2JRSA 4KY3A 1KHVA 1HW8A 3QLHA 4NLTA 4RW4A 4RX6A 3ENQA 1BC6A 1HBUA 1QY7A 2MQQA 1NLKL 2J6UA 4CTAA 4Z37A 2VUGA 4UY85 2UU9J 3DLGB 1S77D 2ASYA 4KH0B 4K2XA 4B17A 4NLXA 5B0DA 4I6AA 2WB4A 2WVDA 4IRDA 1C2PA 4GO7X 6FD1A 1B4SA 1VISA 1MN9A 4LFBF 1UJ6A 2FJEB 5KFFA 1N5TA 3MM5B 1U1KA 1OS5A 1XR7A 4KTQA 5GVQA 4H4OB 5HROB 3N6NA 4FNIA 1RGVA 3EXCX 2E9RX 5A0YA 1Q8KA 2DXEA 3N5FA 4MMOA 3D3CJ 1S1UB 4R5PA 5U47A 1WACA 2IPOB 1RWMB 4WU3A 1A7GE 2AX0A 1JLGA 1UWBA 3RB0A 1R6VA 2J8SA 4CWBA 1YJUA 3GP9A 3Q86A 3JYTA 3FQLA 2F8HA 1CC7A 3KJVB 4FF2A 2XS2A 2GIRA 4Z7YA 3K5LA 5ETOA 5IQ6A 1SJ4P 1X7VA 5CH7B 1LW0A 1F5BA 4C48A 4A8YA 4HHUA 4PXDA 1ROFA 4M5JA 1HL6A 3NAIA 3R7SB 2XHWA 4DUZF 2QC3A 3R1HA 5J1EA 2VBXA 2B9YA 4X2BA 1S1XA 3I96A 4ENOA 5I4MA 2V63A 4CO5A 5A8RB 4CYUB 4OJHA 1SL2A 3CCLS 5C24B 4FF3A 1R89A 3J80U 3MEGB 1X8DA 1MU2A 4HDGA 1JJ4A 1N0VC 3CMES 1SKUB 2XCAA 5IS2A 4K4WA 2VG7A 2MB0B 5MLCV 1GH8A 2K7JA 4RW9A 1ZZFA 3GTYX 4U7CA 2N7YA 2ZE2A 1KOOA 2UU9F 2V8DA 1SCJB 1OMSA 3ZNUA 4CO4A 1T8EA 2IAJB 2C2DA 4O0IA 1HD1A 5LXYA 2BEFA 3CCVS 3RRHA 3V6HA 1GXUA 3QLHB 1FXDA 4J9QA 3G9CA 3BYRA 4RW4B 3EMTA 1ZPVA 1HW9A 1HBUB 3THVA 2QEXS 3I82A 4LVNP 1ELOA 1YTYA 2CQGA 2ABYA 5AE1A 4LREA 3UFCX 1QVGR 2MKIA 2DGVA 5KG1A 3KWMA 3SFGA 1AB8A 2CJBA 2B9WA 4DL5A 2ZVSA 3K7RA 3M8PA 4P74A 5F3TA 2AHOB 1FD8A 1Q5VA 2JFKA 1WELA 2HHXA 5DDPC 3QRRA 3BQ1A 4OYBA 4J9LA 1IKXB 2NXUA 1JLGB 4EBCA 3UR3C 2VOPA 4LRDA 1SIWB 3GJTB 1HYSA 1VK3A 3JYTB 2PGCA 2YNFA 1L3TA 1UWAA 3NGKA 3JAMY 5KFRA 5FD1A 3M8YA 4ZIWA 5IT9U 1UW9A 4KGZB 1SXLA 4JI1J 1LW0B 4AD6A 4OQJA 2OTJS 1FVQA 1NO8A 4ELUA 1H2UX 2YNIA 5E0OA 2OP5A 2O1PA 3AQPA 3FRZA 3US5A 4DV5J 3OTOJ 5J1EB 1R31A 5MAOA 3OL7A 2GHPA 2HYIB 1S1XB 2HHHJ 4RZRA 5ETVA 4USKA 2DCUB 5I3UA 4LSNA 2YKPA 3JTPA 3UCUP 1RWPB 1XC9A 1MU2B 2XGQA 2WRMA 3DXBA 3I5AA 5C25A 4O0NA 2RHSB 4U7UD 1FJEB 1JKHA 1TV6A 2VG7B 2BJDA 2F4VJ 2HBYB 1FA0A 1N4LA 4J9UE 3D54A 4QIFA 4RW9B 3FZBA 2GW8A 4KFBA 2MSSA 4ZVRB 3T9ZA 2ZE2B 1P1TA 4OZ2A 4OV6A 2V34A 4TYBA 2HGNA 1H2VZ 2YX1A 2XO7A 2ROEA 3J7Z5 2R42A 3DLJA 4DPTA 3VAFA 1WI8A 3BN4A 2F9DA 4L76A 3CJTA 1F6TA 2FVCA 2KDOA 4KH1B 4MFBA 4ILRA 3QZ8A 2GAHC 2OMOA 4X65F 4KBIA 3G82A 2AD9A 3KJNB 2DNKA 1J5EJ 4B9VA 2M88A 4MKVA 1DTQA 5DO2A 1DURA 2J0SD 2VB6A 1OYDA 1Q78A 2X7IA 3RBXA 4L73A 3GR1A 3JB9k 4LQ3A 4KRWA 1RWKB 1RA6A 2NSBA 3QIPA 2DITA 3UN3A 2DNOA 3BR9A 5EX3A 1M5PC 1TMMA 3L7UA 1D0EA 1DQ9A 2HBQB 3DKDA 2XY7A 3TWZA 1RCXB 3OSNA 3M8PB 4J90A 1RYRA 4JI1F 2X1GA 1KOHA 4EEYA 4M95A 2XO6A 2GCFA 4JI6J 4ITSA 1SKSA 4DUYJ 4KHRA 4DV5F 3OTOF 3IS9A 2Q1LA 2Q6CA 4PG4A 2HHHF 1FF2A 5K14B 3TA0A 2YNFB 3LTOA 4OZLA 4F2RA 3LH2S 2RDIA 1UW4A 1ZETA 4JBCA 3THPA 4KQZA 1SBRA 3L4BC 2GJFA 4CLUA 5DM7Q 1FESA 5ETPA 2DY1A 4X4QA 4WE1B 2F4VF 3U1MA 1OY6A 1IBKJ 2YNIB 2BACA 4ZPAA 1MWYA 3DDIA 1H38A 3BQ0A 3VZHA 3CCMS 5F9LA 4QWAA 1GMVA 4P7VA 3RG6A 2CQCA 5LM7E 4NL5A 4DN9A 5FLXY 5I3UB 4LSNB 2YWGA 5JVGQ 2L41A 2GHWA 4Q8EA 3V4IA 3NGUA 4R0EA 2MLZA 5A8WA 2HFNA 1JKHB 1TV6B 1W2BR 3W66A 1NDCA 4I64A 3N9UC 1NHKL 1J5EF 1X31C 1E6YA 4KFBB 4M5LA 4J91A 4TNOA 1ICEB 5D3GA 4LIWA 3CDBA 2FC8A 3D68A 5EHHA 1IN0A 1F1BB 1QUVA 4QCLA 3HT3A 3GWCA 4DV7J 4ZPTR 4WFNQ 1Q8IA 1HBMA 4Q45A 1T9UA 2ZWPA 4LRAA 5AXLA 4DV2F 4MFBB 5K20B 2HBRB 4F36A 3T5JA 2ASDA 3G82B 3AAWB 2MZJA 2VQEJ 2IM0A 4K50A 4WWSA 3MD3A 1CVJA 2LMIA 3LWLA 2R2SA 1RHRB 4CO0A 3IG1A 1DTQB 1D9DA 3VQTA 4JI6F 3GLJA 3BPSP 4DUYF 3CC7S 2E1PA 4TU8A 1YJ9S 1FKPA 2OD6A 4DS5A 3QIPB 5L1KA 2XYGB 1PJ5A 3M2UA 3C15A 2XULA 4NZ0A 1T7PA 4P6QA 3DXSX 4ZPDA 1YX2A 2YX4A 1Z2ZA 1ZZNA 1IBKF 5L9NA 1TAQA 3R6LB 5E3QA 5C2GA 2BDPA 5M2UA 1YVFA 2C28A 2UXDF 4YR3A 3V81A 3IS9B 2XMMA 3PFOA 3AA8A 4NCGA 1XR6A 3EGVA 4RBTA 3DHWC 4NYPA 2RHQB 4DMZA 2DTJA 4O3NA 5K9FA 3CDUA 2XYPB 2P9CA 4I56A 3VVUA 2Y0SD 4RBUA 1FRHA 4Q0BA 2Y1RI 1LWCB 4NA2A 3SXLA 2KXHA 5KFOA 4I4BA 3TYTA 2IBKA 1GTEA 3MM8A 2FZGB 3ZZTA 2ZJRQ 2L9WA 3TEGA 2WCXA 3LW5C 2JLGA 1HNXF 2DIUA 4OYXA 2IY5B 3D0HE 4MYUA 3N0VA 5HMZA 3KNAA 1FNXH 1HNZF 2PD1A 3T6BA 3A8IA 4DWIA 2AV5A 5KT5A 1D8ZA 2FJWA 4ECWA 1X9WA 3IGVA 2XCPA 3G71S 4DU7A 1XN9A 4LF4J 2N4DA 4AYBD 3KK2A 3D0IE 1T3OA 3M2VA 2VQEF 3TA1A 1TK8A 1E6YB 1R8AA 4M94A 1CG2A 1SUQA 5D3GB 1TL1A 2XZDB 1N36J 3CW2C 3S1TA 2FJXA 3GYXB 4F2SA 4P2SA 2CJXB 4NXMJ 1TL4A 2HEKA 2Z2YB 3A3PB 4I67A 3CJ8A 4USUA 4DSJA 3CF5Q 2KZZA 3KJQB 4NMXA 4NLUA 1UVJA 1MMNA 2HBZB 1PKUA 4USTA 2MZTA 2V8PA 3BGUA 2XMWA 4DL2A 1OIAA 2QGFB 4RUAA 2C1EB 3PCOB 5KOXA 4RNOA 2Z30B 5EX0A 2WZ1A 1RT3A 4Q44A 5E3PA 3IG1B 3JSYA 3H20A 2N3OA 2VICA 2FHJA 1U1QA 3P8BB 4A8OA 3R27A 2XMKA 1FKPB 1REGX 2CPFA 1Z1ZA 5C42A 4ED7A 3M2UB 3KUEA 4WFBQ 5KFXA 2W2OP 1PAEX 3UCGA 3C8YA 4FYWB 1P9YA 1Q4RA 2FDNA 3W8PA 3P96A 4F3OA 2YBVA 4XPEA 1NDPA 4N8OA 3LALA 4GVLA 1ZTTA 4ECUA 1GK8A 1HNIA 3AOBA 5HVFA 1WSRA 2NLWA 3EJMA 3V81B 3LAKA 2KJVA 4WFYA 2ZOGA 3TX8A 1RWXB 2QA2A 3WDOA 3W2VA 3QZ7A 2GMJA 4YFUA 4CO1A 4LF4F 4YUDA 4Q0BB 1CJVA 4OI3A 2BX6A 3MM8B 2HLUA 3PO4A 1OY9A 4YMEA 1N36F 1KTQA 1Q1KA 3Q23A 2IBOA 3UDEA 4NXMF 1NJIT 2FHMA 5DZ6A 3K57A 4TVAB 2YVSA 1DZ5A 3UQSA 1WOOA 4F0KA 1YRUA 4J5OA 2CWKA 6FDRA 4F04B 2HWTA 2ZH7A 1QDUB 1F9HA 5BYRA 4V19X 2DHAA 3DNCA 4ED4A 1FNOA 4USWA 2G13A 3KK2B 3M2VB 3RBEA 1CQNA 4NLSA 1YLXA 2FJVA 3B4MA 1SUQB 1TL1B 4YY3J 2CRLA 2QZ8A 2H54B 3R8YA 2ZOFA 2MDAA 4NI2A 3TVKA 1VLOA 2N82B 4OHVA 5L9XA 4YB7A 5CYJA 2YXLA 4N77A 4KKOA 2ZKUA 5ETMA 3TZXA 2HVEA 5EN1A 2VDIA 2UV8A 4NZ6A 1RI7A 3PXGa 4PYAA 3O44A 1RT3B 1YJ7A 1K73T 4USHA 4MYTA 1NK4A 3W8GA 2PFFB 1MNEA 1ZM4A 1WDTA 5ETRA 3EE3A 3D1HA 1XQIA 2VV5A 4ELVA 2XB2D 4F8RA 1K1QA 4G3IA 2V68A 3W61A 4DFMA 5D0RA 2WSEC 1JX4A 3SV4A 3CCUS 4LR8A 3NG8A 2JJ4D 1KQSR 3PKYA 2DR8A 4C3MA 1P8GA 3U1NA 5L39A 1CSJA 5CZXA 4FXWA 3C19A 4NASA 1REVA 1HNIB 2YWEA 4FKYA 1R27B 4MJKA 2Y8YA 1B0VA 1VRTA 3GJQB 3GIKA 1RWOB 1KSPA 2M8DB 1VJWA 3A3NB 3JAMU 2HFSA 2N7CA 3M9OB 4DR2J 4GVBA 3GJSB 1UJ4A 2A3JA 1U6FA 2NZCA 3OV7A 1JQGA 3W2VB 1RU1A 3ZZUA 4XK8C 2QA4G 3D3BJ 2A18A 1OPIA 2AIRB 3TARA 2R8GA 3DLEA 1CJVB 3MFHA 3EM1A 2W25A 1KQGB 3T6JA 1KLNA 2PEBA 4ILLA 2IMOA 3MAHA 4YY3F 1ZA2B 3ZO7A 2JLFA 3NGDA 5L1LA 4ZCMA 2PN6A 1A6LA 4P52A 3LUYA 4NOHA 1PYOB 4QW9A 4ZS6A 1EARA 1FERA 3Q8QB 4G1IA 1ULRA 4LT6A 3GONA 5DQHA 3EGZA 3PW4A 3QT5A 2AU0A 1NCLA 2HRTA 4M1KA 5DQIA 4LMZA 4K4SA 3CCRS 5HP1B 1IWAA 3NLCA 4JI7J 3U1LA 1S6QA 4ED5A 1FXLA 4O4RA 1VC0A 2IMWP 1T95A 1YJVA 1BLUA 4NI2B 1ZA1B 4HDHA 5DZ7A 3MOJB 4MKAA 2OKQA 1FFSB 3EDQB 2CQ4A 4KKOB 5DG9A 2AZ3A 3OBIA 3CVKA 4FBTA 4PQUA 4QYZK 1SL1A 1PBAA 3V6KA 3QT7A 3HVWA 4K4YA 1IKWB 1U0SA 2FTRA 4WYLA 2YKAA 1K47A 3MFIA 3F0NA 5IOLA 1RAFB 1Y5IB 1T9XA 4PYDA 4Y3CA 1F9EB 4F02A 2O5DA 3M6UA 2DEIA 3Q8UA 1RWUA 1WSVA 2VBYA 3MEKA 3H0PA 1JNZB 4KPCA 2EKYA 4DR1J 2KU7A 1XWLA 1UTAA 2H51B 3SIPB 3HDSA 2CJQA 4DR2F 4RNHA 4K0KJ 3R7BB 2BR0A 1URNA 4IH7A 2H4WB 2AEFA 2RQKA 3A12A 2V0NA 2PMWA 3E01A 5M2PA 3SV3A 1HR0J 5GMKa 4QBUA 5EWGA 2IM1A 2YPYA 2O01C 4WXOA 2VZ9A 3Q8VA 3ZTSA 4ZMMA 2CYYA 2FHJD 1VQ7S 2J9DE 4C11A 4NLQA 2QO3A 4QW8A 3TVZA 3E51A 1FT8A 2FB0A 1RSCA 3PX4A 2AYMA 1HQEA 4K5RA 4PQAA 2IJNA 2OLWA 3VGUA 1TUVA 3ZZRA 3ELHA 2KN4A 2QTWA 3GG0A 3DLEB 4M5NA 3R9LA 3IWNC 4PG6A 4KHPJ 3OL6A 1FRKA 2AW0A 4HLBA 1SKRA 3MPUB 3W7BA 2UXBJ 1X5SA 2AJFE 5FLXU 4OYOA 4QWBA 1S7HA 2NYHA 5IC4B 5LMNJ 3QATA 4DFJA 2VHGA 3D6HB 4JI0J 3MR5A 4ZPBA 2W9BA 4MK8A 1VQYA 1APSA 2HFVA 5GAGU 2CPXA 3R5CA 1UEUA 3S6EA 2P9GA 2OFHX 2DCLA 1HI0P 3TUJC 3Q8YA 1RADB 1BE4A 1ZH5A 2DXFA 3GMGA 1U8SA 1S6QB 2C3YA 4KAIA 3UD5A 2H4YB 4DSKA 4F26A 4QIEA 1RHQB 3H90A 4CI0B 3PX0A 4DR1F 4JV0A 3FJ2A 4PUOA 4NMLA 3IFEA 4PQUB 4K0KF 1NJZA 2E5GA 3MPVA 2ZBCA 1FWKA 1R43A 3HCXA 5CHCB 3QGPA 4B9MA 3OFGA 2BJEA 4F25A 1FWPA 2MEWA 5B09A 1HR0F 4LRBA 3CD5A 2KHDA 2QL5B 2WVCA 2AEMA 1WDDA 4RNFA 2B3TB 3GPAA 2HRYA 4U8YA 1ZAWA 4C4WA 2CNNB 3M7VA 3H5XA 3KHGA 3GIIA 1V3ZA 1SJ3P 2NXEA 3LPEA 1VCTA 1QAIA 1VQPS 2FJBB 4KPYA 1M1GA 2GS8A 1RJJA 3PKMA 3W63A 1R8PA 2KT2A 1M1KT 3SMZA 3EZ5A 4WZMA 1GXLA 4KHPF 4I68A 4K8RA 4ATNA 5DJBA 2GC8A 3I4HX 4A46A 1VJQA 2UXBF 1KC8T 4ZCKA 2O67A 5F8IA 5LMNF 1I5OB 2JX2A 4NLVA 1UMJA 1UVNA 1HQEB 4JI0F 3FMWA 3WIVA 3BGOP 1IKYB 1KRPA 2IHR1 1X4FA 3QT6A 3PVXA 4X62J 1EKSA 2CPYA 1JK9B 2HQIA 3O5TB 5J2MB 2HAFA 4OZ1A 4WCEQ 3K5PA 4KV8A 3MMCA 3OXGA 3RUBL 5ETNA 3RR7A 4OZJA 3E2EA 1TKZA 2Q3PA 5KFMA 2HS3A 4I69A 2EPIA 1KHWA 1MROA 4OI4A 2XY6A 3HHEA 2G1HA 5B0BA 4G1PA 4WKRA 5LSOA 5KFHA 2W9BB 3RJMB 4M5MA
chains in the Genus database with same CATH topology
3UD4P 2VD3A 3N79A 2BYCA 1F5BA 3QPIA 4WF9Q 4QWDA 3CGIA 3RRGA 1FE0A 3ZC4A 3QAEA 4A8YA 2D74B 3G96A 5AE3A 4PXDA 2AGQA 2VODA 1ROFA 2B4UA 2HHUA 4OHWA 1Y9OA 1S6PA 3WBZA 2EBEA 1S1VA 4OIXA 1JJ2R 1HL6A 3CDWA 3NAIA 4YB5A 2BANB 1H98A 2XHWA 4NA1A 2E29A 4F4XA 3O6QA 5IM0B 2GO8A 2MQLA 1S1WA 2VC0A 3HZEA 4DUZF 3R1HA 5J1EA 3B82A 1U09A 4ILMA 1J5OA 2DGQA 2Z0GA 2VBXA 2DNQA 4ES3A 2B9YA 4X2BA 1S1XA 4TQRA 3I96A 5I4MA 4IRKA 4UY8T 2JEJA 2F8MA 4CO5A 2U2FA 5A8RB 3R5DA 2KFZA 3VALA 5KFUA 1E6VA 1FK9A 4OJHA 4DSFA 1SL2A 3G6ES 2PMZD 3ETOA 3BSAA 4QYRA 3CCLS 4LF9F 5C24B 4FF3A 2HHQA 1R89A 1G6BA 3DRPA 1UVKA 2QFJA 2ZDPA 4J37A 4N47A 3MR2A 3MEGB 1X8DA 3MTKA 2CPZA 1FTCA 1MU2A 4HDGA 1JJ4A 1N0VC 4ECYA 3LPYA 3CMES 1ZOTA 4C7QA 2XCAA 5IQQA 5IS2A 2GX8A 4CIOA 4K4WA 4PUOB 4DPOA 3VQSA 4ECVA 2VG7A 1IBMF 3GR0A 2MB0B 5MLCV 1GH8A 3PM9A 4EZ9A 2D7SA 3ZZYA 5KFDA 2UVRA 2MQOA 2K7JA 1V9OA 2YNHA 1LW2A 2ROGA 4RW9A 1ZZFA 2MQNA 4JI5F 3CDEA 1U48A 1Q8LA 2DNMA 5F0WA 4U7CA 4CCHA 1LK7A 3VAIA 1FO1A 1GT8A 2FLOA 2N7YA 5B0CA 2ZE2A 1KOOA 3CEDA 2UU9F 2V8DA 3KKFA 3MUMP 1VIXA 4E98A 2DGOA 1HWUA 4QYZJ 7FD1A 1YWXA 2HHTA 4WJBA 3SCKE 4CO4A 4FPRA 2DR5A 3RR8A 3B8HA 2QSFA 1T8EA 2XMVA 2IAJB 5H1SV 2C2DA 1SI9A 4BC7A 1JLQA 3BREA 4HEA9 4O0IA 3NKYA 3HKWA 1HD1A 3BJYA 1VBYA 1X4GA 1QAYA 2Y1IA 3AY0A 3ISND 2QE5A 4CO3A 4B9SA 3FEZA 1JLFA 3I56S 3TAMA 1S1TA 2PIIA 5LXYA 5E41A 1HD0A 3LAMA 5LMUF 1GAOA 4WKYA 3CCVS 2E44A 2R2TA 3RRHA 3V6HA 1GXUA 2ZKTA 1NJYA 3KLFA 2CKWA 2VPWB 4NLOA 4IG0B 2HHSA 3TW0A 3GFZA 1NK5A 3H2VE 4DQPA 3BF4A 5F8JA 3JSRA 4TN2A 3QLHB 1FXDA 5DQGA 1Q53A 2GFFA 2J5AA 4J9QA 5KT6A 3SZ2A 3G9CA 3KMQA 4OLPA 2MMYA 4RW4B 1X5PA 2JLEA 4KGMA 1ZPVA 2CJKA 5KFAA 3F73A 1L3KA 2EFOA 5J2QA 1HW9A 1HBUB 3THVA 2QEXS 3I82A 2BXJA 1ELOA 3P3DA 4LVNP 2ERRA 1YTYA 1N5VA 1SB6A 4X62F 1VLYA 2CQGA 2E5IA 2PC6A 2BQRA 2ABYA 2ZITA 5LL6d 5AE1A 1R8CA 1M5OC 2D9PA 1KFSA 2VG6A