1VRTB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
401
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 113
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vrtB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vrtB03
3NBPA 1RA6A 3DOKB 2FJVA 2O5DA 3CJ5A 4U6PA 4J9SA 4IRKA 3M9NB 3QYYA 4O44B 3KLIB 1RT6B 1TL1B 4PQUB 4NYZA 3C6TB 4ECQA 1RA7A 1DTQA 1N6QA 3Q8PB 2IA6A 4O4RA 4TQRA 3DI6B 4B3OB 2ASLA 4I7FB 4IG3A 2BRLA 1S1WA 1K1QA 5DG7A 4RW7B 3UPFA 1RT1B 3ITHB 1S1XA 3FQKA 1S9GA 3DOLB 4ZPBA 3Q8RB 4IFVA 4DEZA 1HMVA 2XI3A 3IG1B 4RW8B 3MR3A 5L1LA 4ZMMA 4ECYA 4HKQA 4ED6A 5J2NB 4M94A 3KLVA 4XO0A 2WOMB 1C0TA 3HVWA 5JXSA 5KFVA 3BSAA 3QZ7A 3BJYA 3KLGB 3LAKA 3LAMA 1S6PB 4URQU 5JUMA 4ECRA 1IM4A 4GC7A 1DTTB 5HBMB 2HNZA 2IC3B 2RKIB 1JX4A 5EWGA 2JEGA 4K4ZA 1FKOB 3RB6A 2XWYA 1SUQA 1LWEA 1LWCA 4KFBB 4TY8B 4LQ9A 4K4VA 4OL8A 4IG0A 3EPIA 3H5SA 1VRUB 2ZE2A 3HVTA 2WHOA 2RDIA 4MKAA 4Y3CA 3CIZA 2FLLA 1T05A 5KFUA 3E01A 5KFYA 2ILYA 4ZVHA 5KFEA 1S9EA 4NLUA 3TQ1A 3KLFB 2HMIB 4ZVFA 4O3OA 5C25A 3PR4A 2I1RA 3LP0A 3C6UA 1LW2B 5I3UB 3VQSA 5KFKA 3I0SB 5J1EB 2OPRA 4ED3A 4K4WA 1BQMB 5C42A 1S4FA 3M8QA 4IQXA 3KLHB 4IRDA 5KFWA 2B5JA 1JLCB 2C2EA 1JLEA 3NBPB 4O3RA 5KT4A 1JLBA 3V4IA 1JIHA 2W9BB 1QAJA 2YNFB 4MIAA 5F8JA 5KFPA 5F8NA 5F9NA 4IH6A 3OHAA 4I2PB 3BSNA 4MFBA 1JLFB 2R8HA 5F8LA 1QE1A 2XCPA 1DTQB 1N6QB 1IKXA 4PWDB 5K14B 2ALZA 2OH2A 2V4RA 3CDUA 2IJFA 3MR2A 4IDKA 1FK9B 4EO8A 1TKXB 1S1XB 5HLFA 1T94A 1S9GB 5CYMA 4ZHRB 4TYAA 1HQEA 3GV5B 5KFRA 4IFVB 3H5UA 1HMVB 4ECZA 4JV2A 2J6UA 1FKPB 4TLRA 4KO0B 2WCXA 1C0TB 1S1TB 4RUCA 3QIPA 5J2MA 4R0EA 4ZP7A 2W8KA 5J2QA 3PW5A 4ECVA 2BANB 4NLDA 3IS9A 2FVRA 1W25A 3N6LA 2RDJA 4DL7A 2RF2A 2IAJB 2HNZB 1TKTA 2AX1A 4Q0BA 4DL4A 1NNDA 2BQUA 1S97A 1TV6A 4ECWA 1LWCB 2VG7B 4LSLA 3DMJB 4NLWA 3MEEA 4IG0B 4K4TA 1RT2A 1JKHB 3HVTB 4RNHA 5C5JA 5KFOA 1S49A 1S1VA 4NRTA 4J9KA 1EETB 5C25B 3BGRA 5KFBA 5KFIA 3SI8A 2I5JB 4MK9A 1S1UA 2YNIA 4RU9A 3D28A 3DRRB 4HYKA 2B6AB 5KT6A 4K4SA 5C42B 4IRCA 2OPSA 3IRXA 3M8QB 1DLOA 4DL5A 3ICLA 3LP2A 5KFQA 4IFYA 4RNMA 2YNGB 5KFHA 1JLEB 3GIKA 3PW7A 1MU2A 1RT5A 4H4MA 1K1SA 4NZ0A 1C1CA 5FDLA 4WZMA 2OPQA 3KK1A 5D3GB 4ED7A 4H4OA 3QIDA 5F8HA 4MFBB 4WZQA 2HNYA 4ZPCA 4YR0A 3I5AA 1IKWB 4DG1B 2QV6A 3CO9A 3KJVA 3HVAA 3QGHA 2WTFA 2JC1A 2YKMA 4U7CA 2JEIA 1HNVA 5KT3A 4NLTA 4Y2AA 3OL8A 1HNIB 4WE1B 1LW0A 3H5YA 3T5KA 3MTKA 2UUTA 3CJ2A 4NCGB 1D0EA 2AWZA 2GIRA 5KFCA 3BQ0A 3CDEA 4TYBA 1EP4A 5J2MB 1RTHA 1RT7A 4QWAA 4QW9A 5DLFA 3KOAA 5HROB 4J9MA 3H4DA 2HWHA 1JLGA 2RF2B 3MFHA 1LWFA 3DYAB 5KFGA 3MEDB 4QWBA 5HP1A 1TVRA 1XR6A 4O3PA 1TV6B 4NLYA 3MECA 1VRTA 3T5HA 5KG3A 4O3NA 3MEEB 2JEJA 1REVA 3MF5A 1JLAA 2CJQA 2E9TA 4WFZA 3KNAA 4RW6B 1IKYA 1RT3A 2IM0A 1C0UA 1JLQB 3MEGA 1TKZA 3JSMA 5EWFA 1HPZA 4KKOB 1R0AB 3IGVA 1SH3A 2YKNA 3QO9A 5KG6A 1BQNA 4RW9A 3EZUA 4QWCA 5L1JA 4QW8A 3D5MA 4NLOA 1KHVA 4NLQA 1UWBA 3MFIA 3I5CA 3RB0A 4Y2CA 2R2SA 4KHRA 3IRXB 1RDRA 4Y34A 3QLHA 4RNOA 2V0NA 4K4YA 4RW4B 4EBDA 4J9NA 3KK3A 4ICLA 4R5PA 4NLVA 2VG6A 3KMSA 5FDLB 3NL0A 4URGA 4LSNA 3PW4A 3NKYA 1WNEA 2OPPA 3OHBA 4F4ZA 3FFIA 2VG5B 2AGPA 3LANA 5EDWA 3KJVB 4ZPDA 1CSJA 2YKMB 4KV8B 4FS1A 4F50A 4WXOA 3DM2A 5KG2A 4DL2A 2AGQA 2JLEA 5KFTA 4WXWA 4I2QA 4TXSA 3T19A 2W9CA 1OS5A 4G1QA 4IKAA 3CDWA 4MIBA 3GILA 4J9QA 4KAIA 1EP4B 1C1BA 4R8UA 2C2RA 5F8MA 4ED1A 5EWEA 1J5OA 4PUOA 4ED0A 3RB4A 1S6QA 2R8KA 5C24A 1S0MA 2BE2A 1RT4A 3EPGA 1JLGB 1YVFA 3V81A 3CJ0A 4WYWA 4IG3B 5F8IA 1S1WB 5KFZA 1KLMA 2J6SA 4NLRA 3G6XA 3MECB 1RAJA 1REVB 4M95A 3Q8QB 5I42A 1IKYB 1C0UB 1HARA 5KFLA 3MEGB 1T03A 1TKZB 1RYSA 4ZP8A 2XGQA 1SV5A 2WONA 1TL3A 2YKNB 4WFXA 3QO9B 3T5LA 3OL9A 2DPJA 4TY9A 3V6DA 2V9WA 3GIIA 3I5BA 3BREA 2QE5A 4MK8A 3GIMA 5L1KA 2UVVA 4NLPA 3KK2A 3JYTA 3GYNA 1SUQB 1LWEB 3FQLA 3QLHB 4XPCA 2ZE2B 5KG4A 3DOKA 4IR1A 3FSIA 3G6VA 1S10A 4KSEB 4ZVGA 4ICLB 1T05B 3G86A 2VG6B 3E01B 2WK4A 2ILZA 3H4BA 1S9EB 4LSNB 4O44A 3KLIA 1RT6A 1N48A 4ZVEA 4KHMA 4PQUA 2OPPB 3UR0A 2C2DA 3LP0B 3C6UB 3C6TA 1KHWA 4IR9A 3FFIB 4K50A 1RYRA 2OPRB 2V4QA 3Q8SB 2XC9A 4B3OA 4EO6A 4I7FA 2FJWA 1NHVA 4ZPAA 2B5JB 3QGIA 5KFXA 4RW7A 3H2LA 1SH0A 3QZ8A 1JLBB 3BQ1A 3V4IB 2AU0A 4URSA 2UVWA 4J9LA 5KG5A 3IG1A 4RW8A 1IKVA 3HHKA 5J2NA 4J9RA 2WOMA 3DRPA 3MR5A 1RTJA 2D7SA 4R8UB 3T1AA 2UVRA 1QE1B 1J5OB 1I6JA 2ZD1A 4PUOB 3NGDA 1IKXB 3OLBA 3IN5A 3NAIA 2IMWP 2F8EX 5C24B 2HAIA 2R8JA 2UUWA 4ID5A 2R2TA 1HYSA 3BSCA 1DTTA 3I0RA 2RKIA 5HBMA 4EEYA 5KT7A 4IDKB 4ECXA 2BQ3A 1FKOA 4EBEA 3TVKA 4TN2A 5HLFB 4KB7A 4KFBA 5J2PA 5CYMB 4KE5A 4TY8A 1HQEB 3BQ2A 2DPIA 3MR6A 4H54A 3KMQA 1JXLA 2IJNA 4EBCA 2YNHA 3QIPB 1SV5B 4F4XA 2IBKA 4O3QA 2WONB 5J2QB 3KLFA 2HMIA 2R8GA 3IS9B 4QPXA 4ZP9A 4EYIB 1N5YA 5DLGA 1LW2A 2R2RA 5I3UA 3RBDA 3SFGA 5J1EA 1TKTB 3LALA 4Q0BB 3KHRA 5F9LA 1S0NA 3OL7A 3KLEA 1BQMA 3KK2B 3JYTB 2XCAA 2R8IA 4LSLB 1ZTWA 1RT2B 4YR3A 1N4LA 3CJ3A 2FVPA 1RTDA 1TQLA 2W9BA 4JV0A 4LQ3A 1S1VB 3QGGA 4J9PA 1N56A 2YNFA 4FBUA 2XGPA 5L1IA 3V6JA 3BGRB 3CWJA 4J9OA 4I2PA 1S1UB 2YNIB 1JLFA 2JEFA 4PWDA 1ZTTA 2ZKUA 1GX6A 5K14A 4IOBA 5KT5A 4K4UA 2OPSB 3LP1A 4FBTA 1DLOB 3NMAA 3LP2B 2J6TA 1XR7A 4IFYB 2W7OA 2ATLA 4YMEA 4RNNA 1FK9A 2IM1A 4MKBA 1TKXA 1TP7A 1MU2B 1RT5B 4H4MB 4ZHRA 3NAHA 4DL6A 3H98A 1C1CB 1MMLA 4O4GA 3DRSA 2OPQB 1IKVB 3KK1B 3IGNA 4NLGA 4IH7A 1FKPA 4H4OB 4KO0A 3DRPB 1S1TA 1RTJB 3M8PA 1GX5A 3V6HA 3OLAA 2HNYB 2ZD1B 4DL3A 2BANA 3DLKA 2E9RX 3DLGA 5DQIA 1S9FA 4ID5B 5L9XA 1HYSB 5DQGA 3TAMA 3I0RB 2IAJA 1HNVB 2FVQA 4YR2A 4ED8A 1LW0B 4ZP6A 1D1UA 3RAQA 3RBEA 4IH5A 4NLSA 3SFUA 3UQSA 3GQCA 2VG7A 5J2PB 2B43A 3N6MA 2VA2A 3DMJA 2IM3A 5CYQA 1JKHA 3DLEA 1NHUA 2YNHB 3M9OB 2WB4A 2E9ZA 1RTHB 1EETA 1RT7B 5KFNA 1RTIA 1N5YB 2I5JA 4GC6A 2W7PA 2AQ4A 3KHLA 1LWFB 3DRRA 4O3SA 2B6AA 2ASJA 4Q43A 5HP1B 1TVRB 3KLEB 3G6YA 4G3IA 1U09A 3BSOA 3PW2A 1VRTB 5KG7A 3KHGA 1JLAB 2HNDA 2YNGA 1XR5A 3CJ4A 3H5XA 4X2BA 3PR5B 1RT3B 3PHEA 5T14A 1RTDB 5KFFA 3JSMB 1HPZB 3FDSA 3PVXA 3PJXA 4NRUA 5D3GA 4EYHB 4WFYA 2FJXA 4RUAA 1BQNB 4RW9B 3DDKA 3KHHA 1ZETA 3HKWA 4Q8FA 4MK7A 1HQUA 2XI2A 4Q44A 4YP3A 4K4XA 1UWBB 1IKWA 4DG1A 3UDLA 5DGBA 2UVUA 4F4YA 3E51A 4NLXA 3LP1B 2W9AA 1S0OA 2HWIA 5F8GA 4QWDA 3GV8B 3PW0A 5DQHA 1Z4UA 2FLPA 1HNIA 4WE1A 1T3NA 4ECUA 4NCGA 3KK3B 4R5PB 3OSPA 5KFDA 1QUVA 3RAXA 2C28A 4O4GB 3DRSB 4JUZA 2GC8A 1QAIA 2R2UA 4WYLA 5DG9A 4ED2A 2EC0A 4RNFA 1TL1A 3M8PB 2AX0A 3CVKA 5EUHA 5KFMA 3PZPA 2FLNA 2VA3A 2BQRA 3DLKB 3DLGB 3DI6A 5HROA 4Q45A 3TAMB 4QWEA 3DYAA 2FVCA 3DM2B 3MEDA 1S48A 1RT1A 3ITHA 4I2QB 3GIJA 2W9CB 4G1QB 3DOLA 4RZRA 4KBIA 5CYQB 3DLEB 4MH8A 4RW6A 1C2PA 4F4WA 5DGAA 1JLQA 3BR9A 1C1BB 2W8LA 4KKOA 3KLGA 1R0AA 4ECSA 1S6QB 3M9MB 2D41A 1RTIB 1S6PA 2BE2B 1RT4B 3RB3A 3V81B 2AGOA 3OSNA 2IC3A 2BRKA 2D3UA 2CKWA 1KLMB 2IM2A 5KG1A 2D3ZA 3OL6A 4ECTA 4JV1A 2BR0A 4TQSA 3H40A 3FRZA 2HNDB 4RW4A 5I42B 3H59A 1VRUA 5KT2A 2ASDA 1T03B 5KG0A 2C22A 5KFSA 3N6NA 3GV7B 4XPEA 1TL3B 3ISND 5KFAA 2JC0A 2FVSA 5DG8A 4YQWA 3T5JA 4FS2A 1SH2A 3V6KA 4Q8EA 3V6DB 1HQUB 5KFJA 2VG5A 3I0SA 3ISNC 2GIQA 2WRMA 4KV8A 3PJWA 3KLHA 1JLCA
chains in the Genus database with same CATH superfamily
1RA6A 1G2EA 2XZDB 3MMCB 4DV2J 2KVQE 4FYDA 4Q7AA 1K1QA 1VIXA 2CQ2A 1F5AA 4OZNA 3M6UA 2HHSA 1XNQF 1WG5A 1M5OC 3H42A 4PXDA 4OZ2A 2RKIB 1SUQA 3D2WA 3M6XA 2ILYA 3R7SB 3CGIA 1R43A 4FN5A 4EGLA 2OTJS 4DJBA 1H0HB 3K8WA 3FJ2A 1UFKA 2YNFB 3OHAA 1MN7A 4HHHA 1IKXA 3H2UB 2LQBA 2FJBB 2R42A 4KC5A 2G9OA 4R0EA 3PW5A 2YXLA 1KRPA 5GAGU 3HHLC 1X0FA 4UOCA 4ECWA 4A8YA 2NQPA 5DDRC 2AZ1A 1TAUA 3OTCA 1S1VA 4MMOA 2ZVSA 5KFBA 2EFOA 2B6AB 5CD4H 2YNGB 1GMWD 4ED7A 1P9QC 3GIRA 2E7WA 5F8HA 1CULB 3MPUB 1OY6A 4YDDB 5IT9U 2HS4A 2GQQA 2V8DA 4TYBA 4F0HA 5LJ5Y 1Y9OA 2R7OA 1E6VA 2DNYA 1CJVA 3TR5A 3KOAA 3DRXA 3DOMA 1NKBA 1TVRA 3MM6A 1UP1A 3AXKA 1K73T 5F0WA 4RW6B 2FTRA 2OLWA 3IGVA 2CQGA 3EZUA 4CRJA 4PRFA 2M70A 5L9NA 4NLVA 2BM0A 1YBUA 2Z58B 5ITHA 2OPPA 1GFWB 2LCWA 1CSJA 2ZH6A 2YY3A 3G71S 2C2ZB 4DFKA 1CJKA 2R8KA 2LMIA 2BE2A 3HJVA 4WBFA 3W2VB 3L95X 2DHXA 5DS7A 3UN5A 1IKYB 2QYCA 4OHYA 4CP5A 2JSXA 1TL3A 2VC1A 4Z2XA 4NE9C 2RDDA 2WSEC 3GIMA 3FQLA 6AT1B 1RZMA 3N9UC 1X9SA 4LSNB 1XQIA 3FFIB 3I82A 2C3PA 4ZPAA 2OIHA 2E5GA 3POTB 5A76A 2D7SA 1Q53A 1J5OB 4CLPA 3IN5A 1HI8A 3D4JA 1U26A 1X9WA 1BQXA 4GO5X 5D4PA 3P96A 4KB7A 2P8IA 5ETMA 2XEXA 1TUWA 1SV5B 3MZIA 3PNIA 1PCAA 3M8RA 2CPDA 1PILA 1TK8A 3KTQA 1AFJA 3A3PB 3OTDA 2C1EB 4FBUA 3CWJA 4RJVA 3UDEA 5EHHA 2DGVA 1L3SA 3JTOA 4EMDA 4B9LA 1D3WA 1WKJA 4F25A 2AHOB 4KGZB 2HHUA 4ES3A 2ZD1B 1HKAA 2E7XA 3LH2S 2IAJA 1SQGA 2W2MP 3HZEA 4CLZA 1HI0P 2KDOA 1FWKA 2VU5A 5BYSA 2HFOA 2GVDA 1HNXJ 1RTHB 2E9ZA 1EETA 1RT7B 3W9JA 2CJAA 1QTNB 5B7WA 4Q43A 1LV5A 5KG7A 4GKJJ 4C7QA 3VGSA 5D3GA 2ZEJA 4YHHJ 2CQBA 3UDLA 4F4YA 4E8UA 4OZ3A 3W60A 4CNZA 1Q81T 1SBRA 3B78A 2BQRA 4PEOA 2MJNA 4C0HA 3ZNJ1 3I87A 4Q2MA 2QLFB 2X3DA 4NEZA 1U0HB 1S99A 2XMVA 3M9MB 3RGIA 3MHYA 4FDFA 2IC3A 1WF1A 4LFAJ 3FRZA 1SJ4P 2HNDB 2RJZA 2KN4A 4AUKA 3OVBA 1FRLA 1HNZF 1O5JA 2ZC4A 3HHNB 4W92B 3QT6A 3JTPA 1Q8BA 1T9XA 3NBPA 4U6PA 1OIAA 3ETMA 4CYUA 2ZZNA 1SKRA 1P8GA 2Q43A 2QSFA 1RA7A 2WB1D 1TMJA 1B64A 4NMLA 5DG7A 3JSYA 1RT1B 2JH3A 4DCPB 2BKOA 4ZPBA 1FT8A 1P1TA 1M5SA 3BJYA 2KVIA 3E3XA 1SKSA 2IBOA 3IBFB 1UVLA 3RB6A 1X0PA 2IPOB 3IP0A 5AE3A 4AFFA 4HTIA 2MEWA 3VZIA 3OTEA 4NMXA 3THPA 4CM0A 3PYGA 3MM8A 2VBWA 1CJTB 2WAQD 4ELUA 3SYZA 5F0UA 1T9TA 3DC2A 4BLGA 4LF7J 2YTCA 4YB6A 4C8NA 4RUCA 3CTRA 2VL1A 3IS9A 3FBCA 1W25A 3N6LA 2DNGA 4GRSA 4X4NA 4DV2F 2AJ4A 4FF2A 3MEEA 1RT2A 3G8TA 4KYZA 4QBUA 3SI8A 5J1NA 1X4HA 2C2KB 4QQBA 2M88A 5KFQA 1MG7A 1Q5YA 2AD9A 1NK0A 3BGLA 2VIHA 4NZ0A 1VQ9S 2FC9A 1PGZA 1U2CA 4ZPVR 3OL8A 2DGQA 3CJ2A 1D0EA 4X4OA 1WOPA 5BXIA 1FXDA 4FF4A 4N76A 4O3PA 4O3NA 4RBVA 1F60B 3OTOF 4J90A 2FHJA 2HZAA 3MM5A 2YKNA 2BA9A 1X4AA 2HQGA 2HGLA 1WEXA 2AEFA 5HQLA 4WTOB 2V63A 1TFYA 3TJ8A 1NPKA 1RU2A 4LFCJ 1VQ8S 4WKRA 3KJVB 2YKMB 4C8YA 3T19A 4I69A 3KDOA 3O3LA 3R6GB 3RB4A 1S0MA 2C3YA 2VDHA 1S1WB 3OFFA 1TFWA 2OSRA 1KC8T 1OYEA 2E1PA 4CO2A 1TKZB 1RYSA 1HWKA 3PYEA 1F2HA 4YB7A 4UZBA 5CA5A 3HXMA 3RU0A 3H4BA 1IQZA 1T8EA 1T9WA 1IXKA 2C2DA 2OD4A 2RHQB 1LNQA 3I6PA 1NHVA 1A9NB 2HRUA 2UVWA 1GAOA 2G2YA 5E33A 4DZ6A 2QL5B 2V68A 3T1AA 3BR8A 1U47A 5M2UA 1YZ7A 2R8JA 1BC6A 4IDKB 4DV1F 2ZWPA 5A8WA 4DDFA 4DFPA 3MAHA 1RAOA 1UMJA 2R7SA 4ZP9A 2ZOFA 2G1DA 4ALZA 1GQEA 4LR9A 3SFGA 4Q0BB 3CIMA 2HWTA 1BQMA 2NXCA 4J9PA 1NSAA 2VBYA 3GCWP 1VOMA 4I2PA 4LF4J 4IOBA 5LSOA 3QRQA 3OXFA 1QM9A 2MTLA 4U8VA 5J1PA 4DL0C 4H4MB 3OR2A 2JVRA 3IGNA 4OQJA 2OFGX 4HVZA 4P7TA 1KVIA 4ZIVA 1JXEA 1VQLS 2CRLA 2E66A 1E6YA 2IM3A 5AE1A 5CYQA 1JKHA 2KYXA 2KRRA 3R27A 5GMEA 1R3NA 4C97A 4LF9J 3F73A 2FJAB 3CCES 1IBLJ 1X4EA 1UWAA 1JLAB 3KFWX 2V2VA 3PHEA 2GS8A 1IVZA 1RCOB 1WG1A 4MK7A 3GV8B 5E3QA 5HJXA 1VCTA 4PR6A 5DQHA 1VC0A 3B6BA 1FXRA 3W9IA 2VKRA 2HQFA 2Z2YB 4NPOA 1QAIA 2CJBA 1V9OA 3M2UB 2M4MA 1FD2A 5A8KB 4ZCKA 3VGVA 4G1QB 3DOLA 5LM7E 1YJRA 2DCLA 2BJ3A 5D8HB 1Y00A 2WVBA 1M90T 1UPPA 3H59A 8RUCA 2N7CA 3T5JA 3CCWA 3QRPA 2DISA 1OO0B 3AHPA 1NH8A 4RX6A 4IRKA 1BXNA 4OYMA 4DZDA 3D3BJ 3J81j 3FK4A 1VQ5S 1AUSL 4RUBA 1N34J 4HACA 4IFVA 2WVEA 2XI3A 2MHEA 2WOMB 1XK8A 3BSAA 4JYAF 2BZ2A 3R5BA 1HW8A 5IT0A 3MXHP 3LP0A 1HNWF 3QAUA 2CWXA 2MZJA 2VQEJ 1Q8KA 2OSQA 3HSGA 5F8JA 4BWMA 4LFAF 4FXDA 2NZCA 2MQMA 3G8SA 3BN7A 3IAM9 1L5UA 1P9YA 3QNWB 4R0JA 3QIPA 3TUZC 2AMCB 2AJ2A 2RF2A 2OP5A 4G1IA 5B08A 4TU7A 3DHXA 1CC8A 2VPXB 5C25B 2RE1A 3D28A 4HYKA 2P2CB 4M5HA 2KB2A 3BYRA 4IFYA 5KFHA 1JLEB 5K9FA 1H2UX 3OFHA 4L73A 2OPQA 2ROPA 2CAJA 4DG1B 2IDEA 2DYAA 3UNYA 4JI7J 1O8BA 2HWHA 3MECA 4QIGA 2LEPA 1R6VA 1CPZA 3HSZA 1EKRA 2PMWA 1KHVA 2PMZD 4N8NA 2IMOA 5D0GA 2X7IA 3D1OA 1PKUA 2Y8WA 1N8RT 3LANA 2KXFA 2ZUGA 3HDSA 2J7UA 4C8LA 4DQIA 4KAIA 2C2RA 1HLWA 3A8IA 3ET6B 4OJGA 2DRDA 3MI7X 4P2XA 4DUZJ 1RHMB 3BGOP 4B3RJ 3B82A 1UA0A 5THWA 4LT6A 4FVCA 5DDOC 3I5BA 3LGHA 3C2PA 3LA0A 4DSKA 1JNZB 3C6TA 1TL7B 1WC5A 3DU6A 1R8AA 2ZUAA 3NGTA 1XJWB 3QZ8A 3V4IB 2AU0A 3GFXA 2W2QP 4PUOB 3M30A 1R27B 2KXHA 2R2TA 4ECXA 3TVKA 4TN2A 4ZVOB 3DHWC 2GHWA 1HBNA 1HWLA 1PC4A 2HBYB 2ZITA 2KO1A 4QPXA 1Q86T 1N5YA 4X4RA 1X4FA 1S0NA 2V50A 1GK8A 1Q5VA 5IT9Y 4Z7YA 4L3NA 2XGPA 5L1IA 4R25A 5IXUA 2J0QD 3NMAA 3MAAA 4IYQA 1FK9A 2O1PA 4FP9A 3QT5A 1SCJB 1FKPA 1RTJB 5T7LA 5L9XA 3I0RB 4DI6A 5ETSA 4ZP6A 3RAQA 2RAQA 3RBEA 2HK3A 4NXNF 4PG6A 5LSRA 4V19X 2VPZB 2MZ1A 4G3IA 5HP1B 3PW2A 2Z2LA 1VRTB 4USUA 2VFVA 2CQ3A 3KUEA 4DSJA 4GVBA 4EYHB 3C14A 2R9LA 2K06A 3ZZUA 3EXCX 4R5PB 2I9SA 1FHTA 3JSRA 1O51A 1LK7A 5HROA 5G4DA 3ZXWA 5GADI 3G96A 3RBXA 2PT0A 3NCPA 2NYHA 5DGAA 1LXJA 4Y2KA 4ECSA 2MKYA 3V81B 3WZ0A 3OL6A 3QJLA 2AP6A 4WPAA 4KHPJ 2POKA 1SI9A 2HYIB 3U1MA 4YDXA 4DV4J 4LBHA 2KL8A 3CJSA 4CWBA 4YS2A 2DRAA 3PO4A 1YJTA 2FJVA 2GHPA 3G2XA 4CO3A 2PD1A 4HI2A 1U7LA 2J9DA 3ZZRA 3A8EA 4LFBJ 3NNAA 3QBCA 3CJRA 4DCOB 2M8DB 4PG5A 4RW7B 3FBFA 2E1AA 4X84A 1EB0A 5B0GA 1AROP 2XYPB 4B08A 1M1KT 4ECRA 5E7OB 5D0HA 2AYEA 2R7VA 4OL8A 3HVTA 2FLLA 3HFZB 1RABB 3BBFA 2HMIB 2DNLA 4LIWA 4OZJA 1QAJA 3SEOA 4IH6A 1V3SA 3BSNA 2R8HA 2ROGA 5K14B 2QGFB 3CJ8A 5AJ3J 3TUPA 1YKWA 1RHJB 4OX8A 2GFFA 4FYVB 4ZP7A 2FB0A 1R8CA 4MKYA 2QL7B 3R6LB 4C8MA 1KFSA 5AXMA 1TV6A 1RAHB 1AXQA 1OPIA 4RNHA 2QLXA 3HZGA 1XMBA 3CF5Q 2ACMA 3MMBA 3TVYA 4WK3A 1MMNA 3VGUA 2XMTA 2WTFA 2JC1A 3TA2A 3MTKA 2UUTA 4U7UK 3DDNA 3G82A 1B4SA 4DX5A 1YRTA 1UZHA 2X1FA 1S12A 3AT1B 2B56A 4FYYB 1NJWA 5FIIA 3H4DA 3A12A 4J91A 4V19J 1ZS6A 2ZH7A 2E9TA 4WFZA 2CNLB 4OHWA 4N8OA 1SL0A 1N5QA 4FF1A 4UW2A 5E3AA 3HF5A 5KG6A 4QWCA 5L1JA 1YITS 4NLOA 4YOEA 1TR0A 5DDPC 3M8YA 3O6QA 1UJ5A 3KK3A 5HSPA 2MSTA 3ZTRA 3B8HA 4N47A 2K1RA 2FLOA 4ZPDA 4FS1A 3TZWA 4F50A 5KFTA 2YX1A 4O23A 3PEJA 4R8UA 5EWEA 5C24A 1VC6A 2V9KA 1TK0A 4DQQA 2VUGA 3MM6B 3W5XA 1Y5NB 1UVKA 5I42A 3W2WA 5IC6B 2WONA 4TY9A 4C8ZA 4ILMA 1PIEA 1SJQA 1UW4A 1HBMA 4Y00A 1YBTA 4XPCA 2LQ5A 1HWJA 2VQFJ 4ERDA 2WK4A 3KNGA 1KQGB 2OPPB 1PJ5A 4LJMA 5GMDA 3X3UA 2MZTA 2YQ0A 2PI5A 4CCHA 1JLBB 5K8NA 1CJKB 2ERRA 2ZBIA 2H1YA 2NXNA 2UXCF 4DPWA 1SC1B 4JI0J 2UUWA 4OYBA 4UQGA 2MKHA 2RKIA 2DPIA 1WF2A 2HRTA 1QY7A 4M63A 3TAPA 2Q1LA 1NK4A 5DLGA 2R2RA 4LSLB 1NRKA 2E1CA 2YNFA 3ENWA 3BGRB 2XLIA 4USIA 2M0GB 3CCLS 2NZ4A 3FRYA 1XR7A 3W9HA 1DJ0A 4YMEA 2GHVC 4MKBA 1FRMA 2HNYB 5GAGI 1FNMA 2IIHA 3ETOA 3UQSA 2B9WA 5AXLA 1QLNA 1X4DA 2WB4A 1RE1B 3K59A 1RTIA 2N3LA 2Z0GA 2B6AA 3BF4A 3FZBA 3IA0A 3G6ES 2YNGA 3CJ4A 5T14A 3KWMA 1YJWS 4NRUA 9ATCB 4RUAA 3IR7B 3KJNB 1HQUA 4PZVA 4K4XA 4DS5A 4X65F 4JI3J 3CMES 4JI4F 4KGMA 1QAXA 3LPYA 2BXJA 2CDRB 2R2UA 3H90A 4WU2A 4NA2A 2YWWA 1AT1B 1HQ2A 3D6MB 2XLKA 2RIJA 2B9YA 3K5LA 4RW6A 2GVDB 3KLGA 4QOTA 1KWMA 5LMUF 3AOAA 3MPWA 4X62J 1JJ4A 1KLMB 4A8FA 5IV3A 4DBQA 1MROA 2FQQB 3TANA 2IRXA 2BYCA 5KG0A 3Q24A 3C15B 2MQNA 3M6WA 3L3CA 1CQMA 5F3TA 4PXCA 2X1GA 2HHHF 3M9NB 2QLWA 4NYZA 4OYOA 1Y7PA 2QMXA 1N6QA 1K44A 3K57A 4M5NA 7FDRA 4I7FB 2CQPA 2B3TB 4PABA 3TQEA 3W2VA 4BDPA 1UETA 4QR2A 2IC3B 5EWGA 1XMOJ 1VFJA 2UUBJ 4LQ9A 3M2VB 2BOAA 2DGXA 4B02A 3JAMU 5C42A 4M8LA 2KHCA 3NBPB 3ELHA 4P7VA 2XY6A 4AXIA 2V8HA 2OH2A 4CQ1A 1YDLA 4DV4F 1H7XA 2CJYB 4CLWA 4PG8A 4W90B 5HK4A 3OV7A 3IWNC 4NLDA 1KFDA 3V5RA 2HVHA 4DL4A 2A6OA 4EZ6A 2Q66A 4DR6F 3W64A 4P52A 2QT7A 5C5JA 1QVFR 2NUUG 4I0WA 4NWBA 3UE2A 3DRRB 3BH7B 5KT6A 2ZDOA 3MM8B 2HBQB 1XTZA 3ULHA 2XO6A 4ETXA 3S1TA 1RKJA 3CO9A 2DNKA 3HVAA 3OJSA 1OY9A 1WSRA 2ATCB 3T3FA 2VOPA 3BQ0A 2AYMA 3K89A 1NJYA 4PYDA 4NOHA 3HPOA 1U4BA 1RTHA 1RT7A 2W2NP 1DURA 4P73A 2V6AA 4F36A 3MEEB 2CJQA 3NNCA 4KKOB 1U6BA 1YG0A 4M5GA 1RQ0A 4QW8A 1VDHA 3CT9A 1SIWB 2J76E 4IO1A 4EBDA 1NK6A 2YKAA 2A1BA 3HMJG 1S7IA 3OHBA 3HCXA 1SVDA 1FJGF 1VQ7S 3CDWA 5CH7B 5H9EJ 2DHSA 2DNQA 1NO8A 1HW9A 1NXIA 4WCEQ 2C3UA 1RP5A 2QC3A 3DGVA 1U0SA 4C11B 4AD6A 4RBTA 4RL1A 3NWRA 4ZP8A 2YKNB 1SL1A 4ZKAA 5B0CA 2Q79A 5IM0B 3OXGA 4DR7F 1LFPA 1RWOB 3E01B 2OEJA 4JI8F 1Q0NA 3IO1A 1RYRA 2XC9A 3CD7A 1VQ6S 1SH0A 1WDTA 3IMQJ 2G0IA 5KG5A 1Y3KA 4J9RA 2LFVA 2ZBPA 4P71A 3F44A 3N01A 3OTBA 4DR1F 4F67A 5DRKA 3VHQA 4EBCA 2F8MA 4C48A 2DJWA 2XYGB 4O3QA 2DY1A 3ZTQA 5B0DA 3OR1B 1RAFB 2DEJA 4DUYF 4YFUA 2XCAA 4DF4A 4WK1A 1ZTWA 1UEKA 1NB2A 1S59A 3CJ3A 1T3OA 5DO2A 1CJTA 4USJC 4DX7A 4AXJA 4I6WA 2LA4A 4GMKA 4P2SA 2KM8B 1ACMB 3QT7A 1TP7A 4XDCA 4DL6A 1C1CB 4O4GA 4HI1A 2GMHA 2VQFF 2R7RA 1JJ2R 2HLTA 1LEOA 2H4YB 3ZZOA 2Y1JA 3N6MA 3T1HF 2P9GA 4P6QA 2Q6BA 1WF0A 3HFKA 3BS9A 3RR7A 1UA1A 3KHLA 2QZ8A 1R8PA 1WC1A 4BS2A 4JI0F 2B4PA 2DB1A 3D3CJ 4ZLPA 1KOOA 1U2FA 1LQ9A 2XMUA 4C0OC 3MOZA 4A8XA 4YP3A 1UWBB 2ZBRA 1Z4UA 2FLPA 7AT1B 3K5PA 3RAXA 4JI6F 3CVKA 4OYPA 5EUHA 2KFZA 2VICA 3EJMA 5KOXA 4KBIA 3CCJS 5CYQB 4MH8A 1C2PA 3SQGB 2BDPA 3ZZTA 5EX0A 3N79A 1NSPA 3ILIA 3RB3A 3QFHA 3OSNA 2RQCA 3G9CA 3MGJA 5L38A 2YX4A 5SUHA 2H48B 5JVHQ 3R8YA 1FCAA 2WRMA 1SJRA 4RBUA 2K7JA 1OJ4A 2FPHX 2JJ4D 1C4AA 1DTQA 2JHEA 3P4UB 2DGSA 4K7QA 2X51A 4UY8T 2J0XA 1S1WA 5U47A 3GE9A 4JI3F 3DOLB 3NNHA 2P6SA 3PO5A 3MR3A 1SKWA 3PX4A 3JS9A 2WBMA 5JUMA 4KH0B 3B4DA 2JNJA 1YRXA 4DU8A 2XWYA 4CO5A 1U49A 4IG0A 2DH8A 3H5SA 2RDIA 4CLTA 5E3CA 1VI7A 5ETRA 3NS6A 2I1RA 2Z56B 1LW2B 2MLYA 4IQXA 5AXNA 1ZA2B 2DEIA 5KFWA 4IRDA 3D9BA 2JLFA 4RO0A 3H2VE 4DR5F 3RUBL 5KFPA 5F8NA 3IM9A 3P45B 1U1NA 1NK9A 1HR0F 4IDKA 4FXWA 4ZHRB 4HACB 1FE4A 4ECZA 4IFVB 1JXVA 4ANDA 2GMLA 3AOCA 3NGUA 3HHLD 4J5OA 4YB5A 2AX1A 4Q0BA 1S97A 5E3PA 2EKNA 2YKPA 3ZZ0A 2KG0A 4CH0S 4E98A 2XMJA 4RU9A 4DR3F 5GAEI 3IRXA 1B0VA 3PKYA 3ICLA 4QR0A 1TZ0A 2RUSA 2IY5B 5BR8J 2DHGA 4H4MA 1L3TA 4DV5J 2OTLS 2OELA 2MSSA 1NKCA 1Q1KA 2KM8C 1RWKB 4ZJOA 4HT7A 4A8WA 1VLYA 1GT8A 2HQCA 4USMA 4QWAA 4QW9A 2CZVC 2RF2B 1BMQB 5KFGA 4N5SA 2WVFA 2W25A 1SXLA 1JLAA 2VOOA 2MZRA 1RWUA 2KT3A 3QO9A 4KPYA 1JK9B 3GR1A 4LRAA 5D77A 3O8WA 1ZZFA 1WG4A 2R2SA 4KHRA 1R6YA 1RWNB 3D1HA 1DFDA 4DSEA 1EZZB 1UVIA 1N33J 3AFGA 1FTCA 1YX2A 1B0PA 2VG5B 2Z2ZA 4WXWA 4G1QA 5DM7Q 3S7RA 1A0OB 4KY3A 2MQ8A 2EFGA 4OJ3A 3HHEA 4LSZB 3MECB 4X4TA 5LXYA 3QWPA 2DR5A 3Q86A 4MK8A 2CPIA 2DR8A 2FGCA 4KSEB 3T9ZA 2F3JA 5GAHU 2ILZA 2HW3A 3LO3A 1EHWA 2IJRA 1GXLA 3UFCX 3W7BA 3Q8SB 2AKWB 4QPTA 3L7UA 2YWKA 4EUVA 5HN0A 3UNGC 1NZ8A 1XN9A 2WOMA 4L75A 3MR5A 3NAIA 3TI0A 4JI5F 1NUEA 5J2PA 1GTHA 3SCJE 4L3KA 2QL9B 2HIQA 5B0FA 3H7HB 2BE7D 1FDDA 5J2QB 3PEHA 2EEYA 1SJ3P 2KRBA 2CPXA 1Q8LA 4RR5A 4WFAQ 2V8VA 2ZH8A 2YNIB 1LWXA 2E5HA 3KG4A 1RT5B 2VZ9A 4KJIA 4A8QA 2YH0A 1GX5A 3SV3A 3M30B 3IWLA 4B3SF 4CLKA 1W2BR 2HHXA 3GQCA 2XYHB 3OPKA 2BJ1A 2AW0A 4AL6A 2IVYA 1X8DA 4OYAA 3CUNA 1N5YB 3HX9A 2ASJA 1KD1T 3MDFA 1U09A 2M9KA 1U48A 2ZC3A 1F9FA 1VQ4S 5HQMA 1BQNB 3P5TL 4Q44A 4DG1A 3L9ZA 2BJEA 2EKYA 2IHR1 3R7NB 3LUYA 1QUVA 2C28A 2GVZA 4ANEA 4ED2A 3I4HX 2VA3A 2NXEA 1WEZA 2IRUA 3ITHA 2VD3A 3MM7B 2GW8A 4ZPTR 2JOQA 5BJRA 2LDIA 2D3ZA 1X60A 2OD6A 4LRCA 3N6NA 3C14B 3ISNC 2BX6A 3UCGA 4KRWA 2CPFA 3G87A 2H65B 3BGFA 1VQPS 4BC7A 1NLKL 2PGCA 2OUGA 2IA6A 2XTJP 4HH0A 4TNOA 3ET6A 2BJDA 3ILOA 5I3QA 2DY9A 5GADU 2KT2A 2O67A 4XO0A 3HVWA 1C0TA 2BE9B 5M2PA 3LAMA 4URQU 3EWGA 3U7JA 4GC7A 4I1TA 4WJBA 1LWCA 4TY8B 2QA1A 2F5GA 3HD1A 3BM7A 5LMNJ 3CW2C 1K47A 3KXDA 2HLUA 3GPAA 5RUBA 1TL7A 1NDPA 1X5SA 2J9CA 1XERA 3M8QA 1IUJA 2MKIA 2RD5C 4RWWA 3V4IA 4DV0F 3EZOA 1JLFB 2G2OA 2CJKA 1FNOA 5A8RA 2V4RA 3WX4A 4V1Ak 2XZWA 4QYZK 1N0UA 3ZNUA 1TKXB 1VQNS 4TYAA 3QRRA 2VFSA 3SDEA 4JV2A 3EGWB 4DFMA 4CTAB 1IBMJ 2LYVA 3UN3A 1PO6A 3THVA 3HI9A 3QAEA 3I4PA 3HVTB 4ILLA 3AD8C 4NRTA 4NYOA 4QIEA 3EDQB 2AJFE 3TUIC 1T02A 4K5RA 1PBUA 4DCJB 1D09B 4U95A 4U7CA 4Y2AA 1RK8A 3TO8A 2UV8G 1FVQA 2QTWA 1EP4A 4QCLA 3VF0B 5HATA 2D69A 3DYAB 4I67A 3DGPB 4KTQA 5HP1A 4EFAC 1TV6B 1VRTA 2UXBJ 3TX0A 3VAGA 4ZLLA 1S0VA 5E41A 1F5CA 2C3OA 4NLQA 1WD6A 2YQ3A 3CD6S 4RNOA 4RW4B 2C2OB 3MMBB 4ICLA 4R5PA 3N5BA 3TUJC 3RW7A 4DV6F 1N36F 4AL7A 3P5BP 1DY3A 1YJ7A 3WC0A 5KG2A 3R2CJ 1LFWA 2OFHX 3G82B 2CG4A 3GILA 3SSSA 1P6TA 5HMYA 5BR8F 3V81A 4DV5F 2X1BA 3JAMY 1IR2A 4Y2MA 2RQKA 1ULRA 4U8YA 1EQ0A 2UVVA 3GU0A 3EGNA 1L3VA 2AYBA 1T05B 3G86A 2LP4A 3PV8A 1OQ6A 3K2YA 2W2PP 3EUNA 4LBPA 4EO6A 2H5EA 3LW5C 2E1RA 2F9JA 4M5DB 4ED4A 1VMBA 3QGIA 4RW7A 5A6WA 3M8SA 3HHKA 4CLUA 4RKUC 4PYAA 2V94A 4R8UB 1NCLA 4OX9J 5C24B 1HYSA 1SQEA 3RJMB 2W4CA 1SB6A 4KE5A 4QIVA 1HQEB 2PSZA 3W2WB 1YLXA 1RLDA 2WONB 2HMIA 2YQ1A 3LALA 3IFEA 1HBMB 2DXDA 4LF5J 3GONA 5A6PA 1ZZNA 3QGGA 3HK2A 3FMBA 4P2FA 5K14A 3LP1A 1RJJA 2NSBA 2MB0B 2MDAA 2D9PA 2XNQA 1RU1A 3DRSA 1PG5B 2OMLA 4Y6IA 2EWHA 1NPPA 2VPYB 2NPFA 3FEXB 1D1UA 3CCQS 3TJAA 4LUBA 4B9TA 3ISZA 1LOUA 2CVEA 4I64A 4LR8A 1B7FA 1C4CA 4KH1B 3L7OA 4IOCQ 5ETQA 1QDUB 2DHAA 1NK8A 5A0YA 5E5NA 2FIUA 2UVUA 1RWPB 2D1CA 1YGYA 3T1YF 1S7HA 3BBBA 4X66J 1KLNA 2BW2A 2J8SA 2ZM6J 4KGXB 1WHYA 5MAOA 3PZPA 1DQ9A 4DQSA 2N4DA 1EARA 3DI6A 3KUHA 1QVGR 4FVMA 4F7VA 1U02A 3FSYA 1C1BB 2W8LA 5ETVA 2UU9J 1RTIB 1FRIA 1KS2A 2BW7A 2F4VJ 2QIFA 5KG1A 2CKWA 3W66A 2F1FA 2W7AA 4IOAQ 5HVHA 2F9DA 4YQWA 1HQUB 4BHQA 4JI2J 1JWWA 1RHUB 2O66A 3FKBA 3MR7A 2L48A 2U1AA 3VR1A 4O44B 4USVA 1V5VA 1CC7A 2N82B 2UXDF 2AJ1A 3IBCB 2DR9A 1RTZA 1WTBA 4B3OB 2ASLA 2FD2A 2BRLA 5CZVA 1Y0HA 3P3DA 5CZXA 5J2NB 3MCOA 3RZAA 1O6XA 3KLGB 5E3RA 1DTTB 2J9DE 1FKOB 4CT9A 1MROB 4L72B 3EPIA 3TQ1A 2CQHA 5I3UB 5J1EB 3LWMA 2DIUA 2UUCJ 1JLBA 1OYDA 3FSXA 3FCVA 1RAGB 5F8LA 1T11A 2AYGA 1IR0A 4PWDB 1N6QB 1B7YB 2E1MC 3OVSA 2W4PA 5JVGQ 3TZXA 2J6UA 1RSCA 2CFXA 2BANB 1DBDA 4NA3A 3HFVA 2B4UA 2VDIA 1NNDA 4X64F 4LSLA 2W4DA 4K4TA 3R9LA 3SCLE 1S49A 1VQYA 4HR2A 3WIUA 3BGRA 3ENVA 3UVJA 5C42B 4LF1A 2DR7A 3GIKA 1FX2A 2X1AA 5FDLA 4DR4J 4ZS6A 3I9ZA 2HNYA 1IKWB 4OX6A 4WE1B 4CO1A 1NB7A 3ILLA 6FDRA 2HHPA 2M52A 1HD1A 2EFQA 3QJJA 2CNOB 4M5MA 1HD0A 2F40A 3EZ5A 3MFHA 4L74A 3TJ9A 3TAQA 4B3MJ 4UOGA 1XIQA 1D8YA 5H1SV 4F4KA 4Y34A 3QLHA 3D0HE 2WVDA 3NS5A 5HMWA 2V34A 3DRYA 1SL2A 1NM2A 4DWIA 3KUGA 4A8MP 2CDQA 1U8SA 1X5TA 5D4OA 1OS5A 5SZTA 2XB2D 1SJFA 3M4XA 2F8HA 1HBOA 3CJ0A 3CULA 4IG3B 4MIWA 1KLMA 2J6SA 4J7CA 2HGNA 1J5EJ 3ONQA 5G0RB 5KFLA 2CG8A 3C8YA 3C15A 3BH6B 3VQTA 2FY8A 4Z37A 4MJKA 2KFYA 1YTYA 2JL9A 2CPJA 2UXBF 4KHMA 4MT1A 2OPRB 3M1VA 2ZKTA 4I7FA 5CXTA 3A8KA 2MKJA 5AE2A 2FC8A 1MW7A 3GG0A 4I68A 5B0AA 3K8VA 3B4MA 8AT1B 1YRUA 4ID5A 3BSCA 4NZ7A 2BQ3A 4EBEA 3Q89A 5CYMB 3I56S 4LF8F 2YNHA 2IBKA 4OX7A 1FRHA 3M2VA 2CZ4A 2BBEA 1U45A 3P6YC 3OL7A 2U2FA 3HO1A 1FDBA 1Q79A 2KZZA 4LQ3A 3I32A 4G65A 4JOUA 1RWXB 4CLFA 1F9HA 4K2JA 4I56A 4ZITA 2BJ7A 5KT5A 4DSIA 1DLOB 3LP2B 3BYPA 1S77D 4B3TJ 5FLXU 2GGPB 3DLBA 2XO7A 3PYFA 4YR2A 1HHSA 2D3OR 1DZ5A 2B43A 5KAKA 4UZCA 3PFEA 1H6KX 1IBKJ 4GC6A 3DRRA 3D67A 2EI5A 1G7CB 1TMMA 3H20A 4DV3J 3JSMB 3FDSA 3GZ7A 2UP1A 5HVFA 4WFYA 3K0JA 2QG9B 4YN3B 3D6HB 1S0OA 3F56A 2RU9A 1HWIA 1T3NA 1I5OB 3OSPA 4O4GB 2E5LJ 4KGKA 2Q3PA 3BEGB 2BM1A 5GMKa 1M1GA 4AQYJ 2I2YA 4GKKJ 2W9CB 2LDYA 4UY85 3BR9A 2EPIA 4KKOA 3AY0A 3CJKB 3GFHA 1RT4B 2D3O1 3JQJA 4P2MA 2KH9A 4ZVQB 1VRUA 5KFAA 3SXLA 2EG2A 2GIQA 4LRFA 3CCZA 1JLCA 2ZBQA 1TTHB 4WIIA 2QMWA 4TQRA 3UCUP 1RBLA 2ASYA 3QSYB 2AF6A 4C11A 3AB2B 5KFVA 3W63A 4A47A 1HIYA 3PJ9A 2LQ8A 4OHZA 5IM0A 2HNZA 3K17A 2ACYA 1NDLA 4C8OA 4XAKA 3E01A 1MWZA 1N32J 3PR4A 2VH7A 1WC0A 2DGWA 1AA1B 3MPDA 1VBYA 2V4JB 4LIRA 4F2RA 4DSFA 3ZZYA 3FEZA 1GEHA 1DTQB 3PHTA 2HBRB 5F41A 2ZHOA 3PX0A 1SQFA 1XNQJ 3MAQA 1IWGA 3PM9A 4KO0B 1RLCL 4GO7X 2G2ZA 2W8KA 2PDAA 1N5SA 3OR1A 2ADBA 3JQKA 1RHRB 1NSKL 3M32B 4IG0B 4AL5A 1PJ7A 2YWGA 3N5FA 4U67Q 2RSQA 5FJ4A 2GO9A 4N56A 3HJFA 2YKOA 1K1SA 1C1CA 4USHA 4DPUA 2PC6A 3I5AA 1Q7LB 4QIWD 4ZA1A 1SKUB 2HKEA 3EICA 1U1LA 3DLJA 4RLEA 1NEEA 3UDVA 1SC4B 2P9EA 3K58A 1JLGA 5BYRA 4DQRA 1WJ9A 3D1QA 1JLQB 4DF8A 5EWFA 1R0AB 3LPEA 2IRYA 1H73A 3KG0A 1BHNA 1UWBA 3RB0A 4JB8B 2HQDA 3IRXB 1NJIT 2DNPA 5GAEU 3A4TA 3UW1A 3N0VA 3KMSA 3C16B 3NL0A 2V67A 3PW4A 2K3IA 4ETZA 2HVZA 3CC4S 2JWNA 4KV8B 1MN9A 4M5IA 2AGQA 2JLEA 1B99A 4HT5A 4NXMJ 1NU4A 3SQGA 1JMTA 4ZJLA 2EFVA 4ZLJA 4OV6A 2NS1B 3AOBA 3OFEA 3PRVA 5F8IA 4DR4F 3IR5B 1BE4A 1SC3B 4DSLA 3DXBA 2HS3A 4OI3A 3THTA 3WC2A 3QO9B 2DPJA 3D68A 1HHTP 3WBZA 4D3GA 3JYTA 1S10A 4OLPA 1VJWA 2W1BA 2FDNA 2V4QA 3NMRA 2RRNA 1FESA 4FPRA 3ZZZA 2YKQA 1QE1B 3MPYA 3GB0A 1VQOS 4MYUA 3MR6A 5C7PA 1JXLA 1NHKL 1HI1A 4F02A 4F4XA 1YZ6A 1I1GA 1LW2A 3RBDA 1ITPA 4DN9A 1HNXF 2XNRA 1NKEA 4ANCA 2ZH9A 2DXEA 4YR3A 1RB0A 1IR1A 4GKJF 1J5EF 1KEKA 2PEHA 5IOLA 4F0KA 2JEFA 3NCRA 4RPFA 1GXTA 2G13A 4YHHF 2J6TA 2W01A 2P6TA 1APSA 3RW6A 2IM1A 4ZHRA 4NEYA 2APOA 2GAHC 3BDEA 4NLGA 4ZVRB 3K7RA 4WWSA 3M8PA 2IVFB 2DITA 3DLGA 1YI2S 1HNVB 1LW0B 4IH5A 1X5OA 5J2PB 1F3FA 3DLEA 5KTQA 2GO8A 2WZ1A 3IAS9 2XMWA 1YSJA 1WI8A 3W8PA 2B7BB 3FEYB 3BSOA 3MCMA 3NG8A 2KTQA 4X2BA 4F3OA 1HPZB 1H7WA 4KIAA 3PVXA 3JB9k 5DGBA 2YWEA 5F8GA 2CJXB 1ZBTA 5LJ3Y 1W26A 1SPBP 1VISA 2R7TA 3PDNA 1TL1A 5KFMA 4C2MA 1Z1ZA 1S48A 4HEA9 2HFVA 4A46A 1IJEB 2VV5A 1PC5A 3OJUA 1FE0A 1S6QB 1G1XA 3Q0AA 4N41A 2AZ3A 2BR0A 2XULA 3WX8A 1UFLA 1NK7A 4C9DA 2G1HA 2GAGC 1DARA 3MM9B 1TK5A 2K3KA 1SH2A 1NZAA 2VG5A 1FDAA 4ZOSA 1OWXA 1IBKF 2QYGA 4IUFA 2GVZB 3KLIB 2C42A 1VK3A 3SSRA 3ITHB 1VR6A 3O5TB 3TZZA 1HMVA 1S5ZA 4M94A 2AT1B 4LF7F 3PKMA 3IWXA 2L9DA 3D54A 3E8OA 5GAHI 1HNZJ 4ZDNA 2WHOA 4ENOA 4M5JA 5KFYA 4LVOP 1WSVA 5KFKA 1UAWA 4ED3A 3QATA 4X4VA 1URRA 4I6AA 3W5YA 2VFRA 5F9NA 4MFBA 1TUGB 1IM6A 2QFIA 1UEVA 3J7ZT 1A6LA 2A2CA 2DBBA 2QN6B 5ADZA 2UUAJ 2FUG9 3HULA 1C0TB 5J2QA 4ECVA 1DQ8A 4XK8C 2DGOA 2VASA 4ZVUB 1LWCB 3PRDA 4ELVA 4PQAA 2YNIA 2PI4A 3M8QB 3W61A 3BBCA 4DL5A 2H5JB 2QRRA 1TELA 4KPCA 1RT5A 3S6EA 4WZMA 4P10A 1WI6A 5A8RB 3DLHA 1N32F 4LFCF 2FZGB 3T5KA 1NAQA 2Z4PA 2AWZA 3SDEB 1Q82T 4Y65A 4WF9Q 5IC4B 2ZNZA 4J9MA 5M2RA 4GVLA 5B0EA 4ES2A 3T5HA 1REVA 3QMQA 1M5VC 1NDKA 1BQNA 4HL9A 2ZH1A 1N0VC 1JNRB 2V0NA 3NGKA 2RRAA 3EXYA 4ES1A 3A8JA 1PJ6A 3GFZA 1PYOB 1PAUB 2QO3A 4A8OA 4BC9A 2EW9A 4FYXB 4UUXA 3MM7A 1EP4B 3OQ2A 2BMBA 2E44A 2EBEA 2I8EA 3OTOJ 1KP6A 4NLRA 4WU3A 3PXGa 5I4MA 2B9XA 1FFGB 2XGQA 4WFXA 1VQSA 4P72A 2V9WA 4OZ5A 1IWAA 3BB5A 2ZE2B 4IR1A 4ICLB 4ZCIA 1S9EB 1N48A 1A7GE 3PYDA 4IQMA 3FMWA 3M2RB 1RHKB 2GMJA 4LF4F 4OYIA 1I3OB 4FYWB 1RGVA 3HSDA 2MKSA 3DRPA 2IFXA 5HMXA 1WELA 1RADB 4CLLA 2OJ3A 5HLFB 2PN6A 4JI1J 4TY8A 1UVJA 3VZHA 3TW0A 1CBKA 2IJNA 4PKDB 4M5KA 1YJVA 4NXMF 3PIPQ 2R8GA 3CC7S 2FY1A 4E2FB 2BJ9A 1LK5A 3FBEA 3PIOQ 2DO4A 1YK9A 3KLEA 2R8IA 2M2BA 3SZ2A 4LF9F 3J80U 3DXSX 1TQLA 4HTJA 3TA0A 1VBZA 1WORA 1IBLF 3V6JA 2VHGA 1S1UB 1JLFA 2B0GA 2H54B 4CLSA 3Q22A 2ATLA 4RNNA 1TKXA 5CHCB 4I4BA 3Q8VA 4DV1J 4DL3A 4CTAA 1HYSB 3TAMA 5IS2A 2HVDA 5HO4A 5IZHA 3OFGA 2RQ4A 1LXNA 2ZOMA 3W8GA 2W7PA 4U9RA 1P27B 4LMZA 3A3NB 1BWVA 3GYGA 1FI4A 2CPYA 3DDKA 4J37A 1TU0B 4ZCLA 3LP1B 2JFKA 1Y5IB 3UD4P 4NCBA 3DRSB 3LWLA 2EC0A 1D9FA 5H9FK 1R7IA 3W5ZA 1L3UA 1CG2A 2NLWA 2XM3A 5L39A 1EIYB 3R2DJ 1R0CB 2LQJA 3DYAA 3DGPA 2R4FA 1Q4RA 5KOWA 4Q5VA 4N77A 2XHWA 1H2VZ 1N34F 1QSLA 1S6PA 4DX6A 5HAOA 4AT1B 5A2QU 5LT5A 3SBMA 2RU3A 4RW4A 4ED5A 4DU7A 2C22A 4XPEA 5A0YB 1UTAA 3RRKA 5KFJA 2FZCB 2B51A 3GWCA 2B4VA 3CJ5A 1MSWD 2RUGA 1NSQA 4DHVA 4FXVA 3TA1A 4PQUB 2VQEF 3Q8PB 3DI6B 4OHXA 4X4UA 2DT9A 1S9GA 3ENAA 3Q8RB 4ED6A 4RW8B 3BPSP 4EU0A 5JXSA 3UCZP 3LAKA 1FO1A 1V3RA 1FTRA 1BD6A 4YY3J 3UD5A 2RS2A 5HBMB 1RI7A 4K4ZA 2JEGA 4KFBB 1F3VA 5LXRA 4K4VA 2ZH4A 1T05A 4OYWA 5FLXY 2FHJD 4CNYA 2HS0A 4M5DA 3CSKA 1QSYA 2BOPA 1MNEA 3BKFA 3EVOA 4FNHA 2ALZA 3SQOP 2EVZA 5EGYA 4ATNA 2R7XA 4EO8A 4P74A 1VC5A 1RISA 1HQEA 2CQDA 4JYAJ 5IWAJ 4TLRA 2QA2A 3F0NA 5DM6Q 3VAMA 3I9V9 3AA8A 1F0XA 3GJSB 1REGX 3VAIA 3GJQB 4JI7F 4CI0B 3K5NA 4NLWA 1S76D 3TZYA 4PG7A 4F8RA 5KFOA 1HNWJ 2ZNYA 2YPZA 1RUSA 2I5JB 1ELOA 3TEHB 5CYJA 4MYTA 4RNMA 3V4MA 4RUHA 3UWTA 3VVTA 2RILA 1WACA 4B9UA 1IJFB 3VGTA 4NLTA 1HBUB 1HNIB 3H5YA 1IN0A 1UJ4A 4NCGB 4NI2A 1CJUB 3F41A 1F6TA 2VBXA 3D0GE 3FCHA 4DS4A 4OI2A 1XBWA 2JEJA 3KNAA 4B9VA 1L3KA 2HG4A 2KHDA 4OZ0A 2UUAF 4DUZF 3D5MA 3UVJB 4E0DA 3MWBA 4B3RF 1RDRA 1WHWA 2WVCA 2VG6A 5FDLB 5HANA 1MWQA 4K8RA 1WNEA 4LVNP 2ZZMA 3TVZA 2R7UA 3NGSA 1X4GA 4MIBA 4J9QA 1RHQB 1C1BA 3ZFVA 2L9WA 4DFJA 3CPWR 4XIUA 4DX8H 1ZM3A 3G6XA 4M95A 1CQNA 3BV8A 3CCRS 2Y1IA 3G4SS 3GIIA 3BREA 1W2IA 2QE5A 2EFPA 3QLHB 4P75A 2DNNA 5KG4A 1GH8A 4O44A 3BO2A 5K8OA 1KHWA 3C6UB 2RNEA 5CQGA 4B3OA 2MMYA 5HMZA 4URSA 1CS4A 5J2NA 1FFSB 5ETKA 1KTVA 3GG1A 4KR0B 1NH7A 1K9MT 3P8BB 2BKNA 3OLBA 2F8EX 3WDOA 2RQMA 1HBOB 2N3OA 1DTTA 1VS3A 1FKOA 1WWHA 1ICEB 3MMAB 2DH9A 3LF0A 3EE3A 4OMFG 4ID8A 5I3UA 2ADCA 5J1EA 1TKTB 2FHMA 1NDCA 5F9LA 2XSJB 3W3SA 2DXFA 1W7WA 1B70B 3M1VB 4PWDA 2ZKUA 2N7YA 2OPSB 1QSSA 3DDIA 1MU2B 4USTA 2CVIA 3KK1B 4WKYA 1FEEA 2FHKA 2AJ0A 2K7KA 4A8SA 2BANA 4UTGA 4ID5B 2GJ2A 3SFUA 3BZQA 2XBPA 3M8ZA 2F65A 2NPIA 2YNHB 1KOHA 1UW9A 4FZVA 1LWFB 5T41A 1N88A 1XR5A 3PR5B 1RT3B 1YWXA 2MQQA 4JI1F 4OLOA 4RW9B 2AEMA 2PFFB 1URNA 4KHPF 1EJ7L 1IKWA 3FBBA 2W9AA 3HT3A 2EC2A 3PTWA 4WE1A 1S6OA 4EK2A 4Y0FA 3CCMS 2K8GA 1RAAB 2MKKA 4NXNJ 3VAJA 2H4WB 1FRJA 4LFBF 2RB7A 2H3EB 1PYSB 3PX6A 1CVJA 3R1HA 2GZOA 3FNNA 3J7YI 5C2GA 4JV1A 1UVNA 1T03B 3ISND 3CD5A 3NXZA 4C8KA 3V6DB 1WEYA 3I0SA 2A18A 4B17A 4YB1P 2XWXA 1BGXT 3DOKB 4L6V3 4BBYA 5LOQA 4ECQA 4O4RA 2DCUB 4IG3A 4KQZA 2EBGA 4USKA 3FQKA 2NREA 5AJ3F 1G4CA 4DEZA 3IG1B 2NSCA 2MGZA 4ECYA 5G0RA 3KLVA 3VAFA 2QSWA 2DGTA 2NXUA 4LR7A 2LEBA 1HWUA 2OKQA 1TL5A 1VRUB 4MKAA 3A3OB 4UOFA 1Y11A 4DR2J 5KFUA 4ZVHA 3CCVS 2XMKA 2L9NA 4TU9A 3OUYA 4UT4A 3WHIA 2OPRA 3SCIE 1S4FA 3TYTA 3SSQA 1JLCB 5FD1A 2W9BB 2OEMA 3NCQA 2VC0A 5IQ6A 3CDUA 2J0SD 3MR2A 1M5PC 5BYQA 5CYMA 4F4AA 5KFRA 4TVAB 3AB4B 3PACA 2HHQA 2J7KA 2WCXA 2HZVA 5J2MA 2ZJPQ 2FVRA 2GQCA 2HNZB 2IDLA 3EYZA 2VPWB 4K5SA 3DMJB 4PPZA 2LKZA 2YWHA 4J9KA 4DXLA 3AJ2A 1KVKA 5KFIA 2J0WA 1YQHA 1DLOA 3LP2A 1XEZA 4YY3F 4QU7A 2A2DA 2XHCA 3CE8A 4G6VB 1XNRJ 1N52B 4W98A 3QIDA 2M7SA 2GGPA 4ZPCA 4YR0A 1R8HA 3BGUA 3CO0P 3CDEA 3IC1A 1XMQJ 4CM2A 3MEDB 2CPEA 2DH7A 2VBZA 4Y28C 1H38A 2IM0A 1C0UA 3MEGA 1PAEX 3JSMA 3IM8A 2HZCA 4J9VA 2RT3A 4U7UD 5IWAF 4PWWA 3LOUA 1H72C 2L41A 4L76A 1T9YA 4H4KC 3W62A 1WOOA 3GR0A 3RYLA 1QTMA 2KJWA 4WXOA 1VQKS 2W9CA 4IKAA 4QU6A 3O44A 3JQMA 4TLQA 2IVMA 4A8KA 1K8AT 5K8PA 3DLLQ 4ER8A 5F8MA 3CJKA 1RT4A 1JLGB 3Q8UA 1U24A 2V2KA 3K5OA 3SMZA 2E29A 2DTJA 3ENQA 2HEKA 3TNVA 1KSPA 3RBZA 5L1KA 3KK2A 1LWEB 3FSIA 2XY7A 1BUXA 4QYZJ 1VHFA 4DLGA 1FX4A 3RTVA 4UF4A 3GJTB 4F26A 1TKDA 3C3LA 2MQLA 3AA9A 2FJWA 2B5JB 4XDDA 3CD0A 3PG9A 3L09A 2KI2A 1NJXA 1IKVA 4ILRA 3HD2A 3GMGA 4ZK7M 5K8MA 1OSDA 1NK5A 2DHHA 3QQCD 2C2NA 2OAUA 3BQ2A 1MMDA 3R5GA 2CA9A 3UDCA 3EX7B 1U1MA 1UPMB 4B9MA 3JYTB 3NRBA 1G3OA 1UJ6A 2FVPA 4JV0A 2BUNA 2B8PA 2V4JA 4J9OA 4Q2LA 1Q8IA 4FBTA 2A6MA 2W7OA 2C3MA 1T95A 3NAHA 3H98A 1F1BB 2UXCJ 5CD4A 4H4OB 4KO0A 1RKIA 2DNZA 2LECA 3DLKA 2E9RX 1S9FA 4OIXA 2VA2A 1ZPWX 3KG1A 3M32A 1VK8A 4NCAA 4KGVB 2RVJA 2MY8A 1OPZA 3WIVA 1GXUA 4O3SA 3QGPA 3S8SA 1VRQC 4OHVA 4X62F 3M05A 3PJXA 2I6WA 3DFEA 3P49B 3KHHA 2L08A 2LU1A 3E51A 3GCXP 1U1KA 1FDNA 1FRXA 1UVMA 3KDNA 4USWA 4JUZA 3CDBA 2MZSA 5HVGA 3M8PB 2AX0A 1FNXH 3LQVA 3DLGB 2E5IA 1M0SA 3DM2B 5K5MA 3E2EA 4I2QB 3U1NA 3DLEB 4F4WA 3LGNA 1JLQA 1GNKA 1R0AA 1FWPA 2YBVA 2IA0A 4W4MA 3MEKA 2BRKA 1UZDA 3ZTPA 1I94J 2QFJA 1NMEB 1XMOF 5KFSA 4X65J 3C16A 5DG8A 4JI4J 2JC0A 2UUBF 2PMHA 4Q8EA 2CIMA 2EK1A 4F3MA 3I55S 2ABYA 4KV8A 3C46A 1UEUA 3KLHA 2BABA 2MQOA 2LXUA 3U1LA 5D6GA 1RT6B 1TL1B 2CWKA 2IYGA 2C2MB 1WUUA 1YHQS 1S1XA 4DLEA 3FUYA 3D6FB 5LMUJ 4HKQA 3TEGA 3J80Y 3J7Z5 1RAIB 1IBCB 3QZ7A 2HVEA 4LF6J 2DK2A 3DCAA 2VKZG 4CO4A 4DV7J 1FERA 4I6YA 3HT0A 4G1PA 4NLUA 3KLFB 1PSDA 3TRGA 2HGMA 2HHHJ 1ZH5A 1JIHA 3SCKE 4QR1A 2MXYA 2P9CA 1QE1A 5IT4A 2CUYA 3H5UA 1HMVB 1S1TB 3L7PA 2YH1A 3UI3A 2WSCC 1TL4A 1TUVA 2VG7B 1VGYA 4KT0C 2M8HA 1WKLA 5C2CA 4MK9A 4OJHA 2XMAA 2B7CB 1AZSB 3CCTA 3U02A 3PW7A 1T9VA 1VQMS 1DRZA 4A48A 4MFBB 4DR2F 3QGHA 1HNVA 1LW0A 5A2QY 4MAKA 2CPHA 3GSDA 2QJ3A 4DR6J 2D9OA 5KG3A 3MF5A 2BKPA 1HPZA 1Y4ZB 3CJTA 4AYBD 1SH3A 3NLCA 3I5CA 1FVSA 1FF2A 2KT5A 2PEBA 1XC9A 2QEXS 3FVYA 4F4ZA 1RBOB 2O01C 2SXLA 3QFWA 3CMAS 4DL2A 2XQCA 2KYZA 4DOZA 2LEAA 3HHLA 1S6QA 3PCOB 4UUWA 1XNRF 3NY0A 1YVFA 4OZLA 1YJNS 1S72S 1R0BG 1ROFA 4HH1A 1REVB 1YJ9S 1IQTA 3MM9A 4LRBA 3T5LA 2WW8A 4CT8A 2J7WA 2BEFA 3OL9A 1WHXA 2ZVIA 4DPXA 1XMQF 2M3DA 1SUQB 2OGUA 3GYNA 5F3ZA 1ZM4A 3TWZA 3EM1A 1YBAA 1U1QA 4ZCMA 3G6VA 4DMZA 3KLIA 5IV4A 1FJGJ 4ZVTB 4WTYA 3AJ1A 2VF3A 5D0EA 3BKTA 3DNCA 3QJPA 1WTFA 1HA1A 2ZHBA 1I6JA 1IKXB 3EGVA 2HAIA 3VTIA 2FZKB 4HHJA 3R5DA 4DUTA 1NJZA 4K0KJ 4DR7J 1OMSA 3CC2S 2X3GA 3JXOA 3AXMA 3MOJB 3BDPA 4JI8J 2FJEB 3LTOA 4ELTA 5DZ6A 3EVMA 1RTDA 1S1VB 1N56A 3DU5A 3K5MA 4EWTA 4CDIA 2GV1A 2HQ3A 2DNMA 2NYIA 2IYIA 2YX7A 4OI4A 1MMLA 3OVAA 4IH7A 2ZHAA 1FA0A 3DRPB 3V6HA 3NS7B 4LBIA 2CADA 4DR1J 2AEJA 3MUMP 5ETPA 1D8ZA 3VALA 1E6VB 4DUYJ 1CLFA 2Y8YA 1CJVB 2WBRA 3R5AA 3I31A 2GJIA 4C3LA 4PCQA 3DOMB 2G0CA 5E0OA 2CYYA 1TVRB 3KLEB 2JFDA 2RH3A 2A3JA 5D78A 5DZ7A 1FD8A 5D4NA 2PA8D 2FJXA 5ETOA 5K20B 3H8YA 2K2PA 1T0TV 2HVIA 5KFDA 2GC8A 4WYLA 3MMCA 1U25A 1RBAA 2FLNA 4Z7CA 1F5BA 3T1HJ 1UKUA 3TAMB 1U2RA 3NGRA 3BO4A 4M1KA 2Z2MA 3GIJA 3RR8A 2VFTA 3SV4A 2D41A 2BE2B 3H25A 4ZN1A 2IM2A 2MZQA 2JLGA 2V8GA 3H40A 2OEKA 5KT2A 3VAHA 1U1OA 1TL3B 1M5HA 1JB0C 3V6KA 2CNNB 3PJWA 4JI6J 1EAYC 4J9SA 1AB8A 3GP9A 3MUTP 3QYYA 1FRKA 3HM9A 4FPIA 4WFBQ 4RU2A 2HFNA 2YWFA 1WOSA 3UPFA 1KONA 2ZZTA 3IBWA 1VIOA 1S6PB 2O3DA 3TARA 3AAWB 3HSJA 3OXLA 2ZE2A 4NA1A 3CIZA 2J9EA 3TOQA 1HL6A 5KFEA 1S9EA 4O3OA 2ZH2A 1R31A 4PXEA 3D7SB 3M2RA 2V8PA 4C6AA 4FF3A 4O3RA 1ZAVA 3CMQA 1Y5LB 4MIAA 1EKSA 4RWXA 1I94F 3CJQA 1JJCB 1CULA 1F2GA 1T94A 5HLFA 2Y0SD 2GQ2A 1S9GB 3GV5B 3UO0A 2W2OP 4WP3A 3KKFA 4DL7A 2Y3YA 2IAJB 3GFYA 1XWLA 2PFDA 1M1HA 2BQUA 1EETB 3I96A 1S1UA 1F9EB 4DR5J 4LF6F 3CCUS 1SJ1A 2FYXA 5DDQC 4DV7F 5D3GB 1HR0J 3QPIA 1N33F 2F4FA 1B0TA 1RCXB 3D66A 2HAFA 4PWUA 2EG1A 1GMVA 2J8AA 2BACA 3MPVA 5DLFA 2CNKB 4NLYA 4BWJA 1IKYA 1KQFB 3V2UC 3CCSS 4XTTA 2NR0A 1FKAF 4DR3J 2ZH3A 3WQPA 3Q23A 5DJBA 4K4YA 1J27A 3KJFB 2MKCA 3ZTSA 4LSNA 3FFIA 1KVJA 1KQKA 3UD3P 4FKXA 3AD7C 4DPYA 2KKHA 1ZAXA 3Q83A 3EVWA 3JTNA 3POTA 4NI2B 4ZN3A 2VJUA 4CYUB 1J5OA 1FJ7A 1VJQA 3AQOA 1UL3A 1RAJA 3EGZA 5L8RC 3Q8QB 1HARA 4YUDA 1SV5A 2OO4A 2KXNB 4ZPWR 5GVQA 4J9UE 3TP2A 4NLPA 2R7WA 2OHDA 2VG6B 1RWMB 5HL7Q 4ZVEA 4PQUA 2ZH5A 2ZFHA 1X7VA 4D3HA 2DR6A 2RMLA 3FCWA 4J9LA 4RW8A 3J7A1 2BVZA 1CEZA 2UVRA 2ZD1A 3R97A 7FD1A 2IMWP 3H0PA 3J81U 4ZIWA 3DKDA 5HBMA 1Z2ZA 4KFBA 3U27A 3KMQA 4DPOA 4CZCA 3ILJA 3IS9B 3PY8A 3EMTA 2R7QA 1KN6A 2D74B 3CNQP 1RT2B 1N4LA 2LXIA 1M5KC 2CJ9A 1MWYA 2MJUA 4LRDA 1CS4B 4OJ1A 2DNHA 2VONA 3AJDA 3OLAA 4JI5J 4OI0A 3CDAA 2OMOA 5AXKA 3R1LA 3FC9A 1QAYA 2QA4G 1NHUA 1U0HA 1Q16B 3G8QA 2I5JA 5CCMA 5HJYA 3G6YA 3S01A 2HNDA 5KFFA 1ZOTA 4F0MA 3L4BC 3MM5B 2LQ9A 3MCSA 4Q8FA 1DAXA 1FXLA 4K0KF 2Z57B 3GYXB 4PAAA 1HBUA 1HNIA 1H74A 2HHWA 4NCGA 1Z2LA 4B3SJ 1V6HA 3GLJA 2DRBA 4RNFA 1CJUA 1FJEB 2HBZB 2B8QA 2EK6A 2VODA 4FNIA 1RT1A 3M8WA 4RZRA 2Z8QA 1AFIA 5JMNA 2VJVA 5EN1A 4C98A 3AD9C 2D3UA 2MY7A 2RHSB 1MLAA 2ZBCA 2DIVA 3GV7B 1WC3A 2FVSA 4FS2A 4K2XA 2DO0A 2YPYA 5LMNF 2HFZA 3ZZPA 2V5HG 1K0TA 1Y10A 2JX2A 2B4OA 4C3MA 3VWSA 4QJVA 2MPUA 1FWLA 4PPDA 4ZMMA 1BLUA 4HHUA 2XS7A 1X4CA 4X4PA 2HFUA 2V2QA 4F04B 4BCAA 1AUDA 1N54B 5ETNA 4O0IA 1IM4A 1WC6A 1JX4A 1P1LA 2I38A 5D0RA 2KJVA 1PBAA 8ATCB 5A8WB 1IBMF 3J7YU 4Y3CA 3FGVA 3BN4A 4ZVFA 2HSEB 3VVUA 2KFNA 4TKTA 3C6UA 3VQSA 1Q7YT 3I0SB 4K4WA 1BQMB 1K0VA 1OQ3A 2DNRA 2C2EA 5KT4A 1RXOB 3OD2A 1KDNA 3CEDA 4I2PB 4OI6A 5IQQA 1X9MA 2XCPA 1WC4A 2HK2A 3N4WA 2IJFA 2H5IB 1ZPVA 2G4BA 3OR2B 4JV5J 2MGZB 3MMAA 2QX0A 2QMUB 3HP6A 4C4WA 3GSIA 1TKTA 2XSJA 1E6YB 4CH1A 3HKZD 1JKHB 1GMWA 2CQ0A 3GJRB 3N28A 3RRGA 3OUYB 2XSFA 3M7VA 5DETA 2H51B 1DHMA 2CQIA 4IRCA 2OPSA 4HLBA 4DV0J 3UN2A 3AODA 1X4BA 1MU2A 2MQPA 2CQ4A 2Z30B 3KK1A 1G6BA 3LGMA 2GJFA 3MD1A 5CCLA 3IRWP 4WZQA 3KJVA 2YKMA 5KT3A 3MTJA 4NL5A 3O1LA 2GIRA 5KFCA 3HHDA 2Y1LB 5J2MB 4TU8A 4H4KA 5MLCV 3HVRA 1LWFA 2NXJA 3HLUA 1Y3JA 3KJQB 4LREA 1RT3A 5LSLA 1TKZA 2Y1RI 4RW9A 1N5VA 3VV2B 4Y2CA 2Y9HA 2QLBB 3MMJA 2CPZA 3ZC4A 4URGA 4QZVB 3NKYA 1T7PA 1KTQA 2AGPA 4OFZA 4UOHA 4WP8A 2PA3A 1ZM2A 2RS8A 4QIFA 1NPRA 4IO9Q 1WHVA 3PFOA 2NUHA 1ZAWA 4ED0A 3EPGA 2HFSA 4OX9F 4PXBA 4Y2IA 1C0UB 3MEGB 1T03A 3RRHA 3V6DA 2HRYA 2XS2A 1D9AA 4OI1A 3DOKA 4DV6J 1N36J 4ZVGA 1QUPA 2AIRB 4JP8A 2VB6A 4LF5F 2LA6A 3UR0A 3LP0B 4K50A 1Q78A 3AQPA 4B9NA 3VAKA 2RRBA 1Q95G 5KFXA 3H2LA 3BQ1A 1B3TA 1VLOA 2VFUA 4EI2A 3IG1A 4HDGA 3NGDA 5CAAA 2N4CA 4EEYA 5KT7A 1RWVB 4H54A 1DQAA 1QD1A 3QIPB 2DVIA 1FEHA 4F2SA 3TX8A 1EQMA 3VCDA 3KHRA 3KK2B 2ZJRQ 2PO4A 3ZO7A 4CIOA 2W9BA 4NYPA 3C19A 4P9SA 3QWUA 3JSBA 3R7BB 1ZTTA 1GX6A 4IFYB 1EX8A 1SC6A 2OPQB 1IKVB 2GX8A 4OYZA 2LXFA 5HI7A 4X66F 1LKZA 3M2UA 3MURP 2DGUA 4OV1A 4K4SA 2ZM6F 4HDHA 4OZ1A 4ED8A 5A8KA 4NLSA 4LF2A 3DMJA 3NEKA 3NOCA 3M9OB 2KG1A 2JRSA 3BKUA 1H3DA 1ZA1B 4MKVA 2HHVA 5D4LA 2UU9F 2L3MA 3MCNA 3KHGA 2F4VF 2G0JA 3H5XA 3W1YC 1U1RA 4K59A 3RAMA 4C0BA 3HKWA 2XI2A 3KYLA 4WFNQ 4ZLNA 9RUBA 3PW0A 2HURA 5LL6d 2FJDB 3J7AN 2BJ8A 4JI2F 4ECUA 2GNKA 1KNZA 5DG9A 4CH7A 3DLKB 4Q45A 4QWEA 2FVCA 3MEDA 3SIPB 3QSIA 1RWWB 3OBIA 2AGOA 3R5CA 2KZMA 4TQSA 4EZ9A 1S4EA 1KKHA 3EDRB 4WP9A 5B09A 3T1YJ 2QLJB 3BO3A 2CQCA 3R3TA 2EFNA 4C3KA 2LLZA 3CB4A 2HIYA 2O5DA 2AJQA 1D9DA 5CABA 2UUCF 4JBCA 1WDDA 2A10A 1R89A 3C6TB 2AV5A 4ZVPB 2HQIA 4MTPA 1ZYQA 5L1LA 2WSFC 2DNOA 4FKYA 2YVSA 3PRBA 5H9EK 1LWEA 1HBNB 3C66A 5C25A 4NX9A 4A4JA 2HHTA 5D15A 5IFMA 3KLHB 2B5JA 2UXDJ 1JLEA 3A13A 2CXEA 2MYFA 4S0MA 1X5PA 2OI2A 4ITSA 1J2VA 3MAAB 1FK9B 1YIJS 1S1XB 2DD8S 3FZ2A 1S79A 1FKPB 3T41A 2W24A 6FD1A 4NZ6A 3W65A 2GA7A 5T7LB 1WKKA 2RDJA 3D6TB 2HPUA 1ZM9A 2B9EA 3T6BA 2EXUA 2MLXA 4B3MF 5H9FJ 1AW0A 2E5JA 4ZVSB 2ZOGA 2E7VA 4GVBB 4H4OA 5ETLA 2BV3A 1I51B 2QV6A 1KQSR 2JEIA 3UR3C 1V5IB 2Y0BB 1AYEA 2UZAA 2XMMA 4X64J 2WW4A 5HROB 1HFEL 2F63A 3CXCR 1H98A 4QWBA 1VHIA 1XR6A 1FFWB 3OT9A 4JV5F 1VYAA 1U1PA 3MFIA 1UCNA 1QJHA 1R8BA 4J9NA 1X31C 5EDWA 3B54A 3DM2A 1BY9A 1GMUA 2LVWA 4UQTA 4PG4A 1OY8A 4I2QA 4TXSA 3T6JA 5L46A 2I0XA 2Q6CA 2R3VA 4ED1A 4PUOA 2QA4S 3BPDA 1JQGA 4WYWA 5KFZA 1O0PA 2COLA 1UFWA 1YJUA 5AT1B 3AH6A 2XY5A 5HQ8A 5ETTA 3NWGA 1KR4A 2J5AA 2CQ1A 2ROEA 4F3QA 2KU7A 1RT6A 1GTEA 4IR9A 2UV8A 1OSCA 2V69A 3R5JB 3T9NA 2A0FB 3Q8YA 1RTJA 3HHLB 2JVOA 4B3TF 2LU2A 3I0RA 4N7TA 1JJHA 5B0BA 3MUVP 2JZ5A 3KLFA 4EYIB 2MHNA 3NP5A 1U6FA 1VBKA 4X4QA 4DPTA 3DN9A 4WIQA 1KBRA 2F7VA 5JJBA 4X4SA 2NCKL 4DV3F 4K4UA 1HHQA 2FGOA 3GTYX 2XZTB 2CZ9A 2XLJA 1S1TA 4DQPA 3IR6B 2E5LF 5DQIA 5DQGA 4DN0A 2FVQA 4LF8J 5EX3A 4M5LA 2VG7A 1S6UA 4AQYF 3O2IA 4U96A 4OYXA 3OW2R 4GKKF 4CLYA 1RACB 5KFNA 2GIFA 1H2TZ 2AQ4A 3RG6A 2XS5A 2H9ZA 1AZSA 2ALYB 2GCFA 4B9SA 4ZJQA 2PE8A 1RTDB 3MD3A 1ZETA 3ADAC 1V3ZA 2ZJQQ 4NLXA 2P5VA 2HWIA 5I3PA 4QWDA 1TAQA 1NBEB 3ZTOA 3KK3B 2V2ZA 3NOGA 3X1LB 1T9UA 1N5TA 1PYTA 3A1YG 2K1RB 2JDJA 2DKOB 4CO0A 5E2QA 2FHOB 1BWEA 4O0NA 2M5YA 1SIZA 1FJCA 2ZWOA 3IXQA 3M6VA 2ZDPA 1U8WA 2MLZA 4ECTA 3US5A 3Q2TC 3Q2SC 1VBXA 5I42B 4AE5A 4QYRA 2ASDA 4YEAA 1RAEB 1S57A 4NASA 1U6ZA 3D0IE 2PIIA 3J81Y 2XG8A 3QT8A
chains in the Genus database with same CATH topology
2BABA 2MQOA 1RA6A 2LXUA 3U1LA 5D6GA 2HHHF 3M9NB 1G2EA 1RT6B 4WIIA 1TL1B 2QLWA 4NYZA 3MMCB 2QMWA 1Y7PA 2IYGA 2QMXA 1N6QA 4TQRA 3UCUP 3K57A 7FDRA 4FYDA 4I7FB 2CQPA 2B3TB 2ASYA 4Q7AA 1K1QA 1VIXA 1YHQS 2CQ2A 1F5AA 1S1XA 4DLEA 3W2VA 2AF6A 4OZNA 3M6UA 4C11A 3AB2B 4HKQA 3J80Y 5KFVA 3J7Z5 2HHSA 3QZ7A 1XNQF 4BDPA 4A47A 1WG5A 1M5OC 1UETA 4PXDA 4OHZA 2DK2A 3DCAA 5IM0A 2HNZA 2IC3B 2RKIB 2VKZG 4QR2A 5EWGA 4CO4A 2ACYA 1VFJA 1SUQA 3D2WA 1FERA 4LQ9A 4C8OA 4XAKA 4I6YA 3M6XA 3E01A 2ILYA 3CGIA 3M2VB 1MWZA 4G1PA 3KLFB 1PSDA 4NLUA 1R43A 3TRGA 2HGMA 2DGXA 3PR4A 4FN5A 4B02A 2VH7A 5C42A 4EGLA 1ZH5A 4M8LA 2OTJS 4DJBA 1H0HB 3K8WA 2DGWA 2KHCA 3NBPB 1VBYA 1JIHA 3FJ2A 3SCKE 2YNFB 4P7VA 2V4JB 4LIRA 2XY6A 4F2RA 4AXIA 3OHAA 4DSFA 4QR1A 3FEZA 3ZZYA 2MXYA 2P9CA 1QE1A 1DTQB 5IT4A 1IKXA 2V8HA 2OH2A 3H2UB 2LQBA 4CQ1A 2FJBB 4DV4F 5F41A 1H7XA 2ZHOA 3PX0A 3MAQA 4PG8A 4KC5A 3H5UA 1HMVB 4W90B 3PM9A 4KO0B 1S1TB 3OV7A 4GO7X 2G9OA 3L7PA 4R0EA 2W8KA 2YH1A 3PW5A 2PDAA 3IWNC 4NLDA 1N5SA 1KFDA 3V5RA 3UI3A 1KRPA 2HVHA 3OR1A 2ADBA 5GAGU 4DL4A 4EZ6A 3HHLC 2WSCC 1X0FA 4UOCA 1TL4A 1TUVA 2VG7B 4ECWA 1VGYA 3M32B 2Q66A 4KT0C 4A8YA 4IG0B 2NQPA 4DR6F 5DDRC 2QT7A 5C5JA 1QVFR 1TAUA 3OTCA 4AL5A 1S1VA 2NUUG 2M8HA 4I0WA 4MMOA 2ZVSA 5KFBA 2YWGA 4MK9A 4NWBA 2EFOA 3UE2A 3N5FA 3DRRB 4OJHA 2B6AB 5KT6A 4U67Q 2RSQA 2ZDOA 2B7CB 3CCTA 5CD4H 3MM8B 2YNGB 5FJ4A 3U02A 2GO9A 4N56A 3PW7A 3HJFA 2YKOA 1VQMS 1K1SA 1C1CA 4USHA 1XTZA 3ULHA 1DRZA 4ED7A 1P9QC 2E7WA 3S1TA 4ETXA 1RKJA 4A48A 4MFBB 5F8HA 2PC6A 3I5AA 4DR2F 3CO9A 2DNKA 3HVAA 1Q7LB 4YDDB 3QGHA 4QIWD 3OJSA 4ZA1A 1HNVA 2HS4A 1LW0A 3T3FA 1U1LA 5A2QY 2VOPA 3DLJA 4RLEA 3BQ0A 2AYMA 2GQQA 2V8DA 1NEEA 4TYBA 1NJYA 5LJ5Y 4MAKA 4NOHA 1Y9OA 3HPOA 2R7OA 1U4BA 1E6VA 2CPHA 1RTHA 2DNYA 1RT7A 2P9EA 3GSDA 3TR5A 3KOAA 3DRXA 1DURA 3K58A 1JLGA 5BYRA 3DOMA 4DQRA 1NKBA 1TVRA 3MM6A 2D9OA 5KG3A