4JI7J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ji7J00
2UXDJ 2KL8A 2UUBJ 4B3MJ 1IBLJ 5LMNJ 2UXBJ 4HHUA 3J81U 4DUZJ 2E5LJ 4NXNJ 4DV3J 5A2QU 3D3BJ 5LM7E 5LMUJ 1N34J 2UUAJ 4LF6J 4LF8J 4DR6J 5IWAJ 4RJVA 4X65J 1FJGJ 4X62J 2VQEJ 4K0KJ 5BR8J 2F4VJ 3R2DJ 4V1Ak 4DR2J 3J80U 4JV5J 2UXCJ 4B3TJ 1XNQJ 4JYAJ 1HNXJ 4LF4J 4AQYJ 4DR4J 4JI7J 4DV7J 1IBMJ 3OTOJ 4DV0J 4NXMJ 4JI6J 4X66J 4JI0J 4DV4J 4OX9J 4KYZA 1IBKJ 3T1YJ 4JI2J 4GKKJ 3J7AN 5AJ3J 2KVQE 4DV6J 3R2CJ 2ZM6J 4DV1J 4B3RJ 4YY3J 1N32J 1I94J 4LFCJ 4DUYJ 4LF9J 2MTLA 1HNWJ 4LFAJ 4JI1J 4LF7J 4JI5J 5FLXU 1XMOJ 4YHHJ 3T1HJ 4DV5J 4KHPJ 3D3CJ 1HR0J 3W1YC 4DR5J 4X64J 1XMQJ 2VQFJ 2HHHJ 4JI4J 3IMQJ 3JAMU 2MEWA 4JI3J 4LF5J 4GKJJ 4KY3A 4PWWA 1J5EJ 2MQ8A 5IT9U 4DR3J 4NEYA 1XNRJ 4DV2J 1HNZJ 2UU9J 1N36J 4DR1J 4JI8J 4DR7J 4LFBJ 2UUCJ 4NEZA 1N33J 4B3SJ
chains in the Genus database with same CATH superfamily
2K3KA 4JI6F 1NJZA 2YKPA 2GVZA 4IDKA 2IHR1 4MAKA 2W25A 2W2OP 1NLKL 4FNHA 4QBUA 2F4VJ 1RT4B 3UQSA 5KT3A 4GC7A 1UJ5A 1FDBA 1HLWA 2I2YA 4F4YA 3T1HF 1IBMJ 1X4DA 4IQMA 5HP1B 1XN9A 2XMMA 3MPYA 1RHRB 3HVTA 2Y1RI 2B5JB 3UNYA 2VKZG 1JLGA 5EWFA 1HBMB 2CKWA 3NBPA 3OBIA 1VRUA 3MPWA 3RGIA 1Y3KA 1RA7A 5AE1A 3QO9A 1LK5A 1H7XA 5C25B 4QIFA 1BQNA 1TKXB 1UETA 1CULB 2QMWA 1KONA 4PPDA 4ANDA 1OQ6A 3ENWA 1EETA 1YBUA 4KAIA 2FHMA 5KFMA 2DGUA 3K0JA 1TL7B 1NCLA 2VBYA 1N54B 1VQ9S 2DPIA 2E5LJ 3MF5A 3KK2A 2AEMA 3WBZA 1Y10A 4OIXA 3GJQB 5IFMA 5A8WB 1IJEB 5K8PA 2FVSA 1O0PA 1UP1A 2DRAA 4M95A 4X64F 4Y2KA 3NNHA 1RTDA 4JP8A 3ZZOA 3OVSA 1IQZA 4PCQA 5E3CA 3C15B 4J37A 1AYEA 1LW0A 4DV2F 2J0QD 4Y2CA 3OL8A 2ATLA 2VBZA 5F8LA 3UFCX 2HW3A 2OSQA 3IM9A 2OO4A 1LV5A 2CZ9A 1SIZA 2RAQA 2I5JB 3OW2R 2MSTA 3D7SB 2UUAF 2AKWB 3G6YA 2JJ4D 9RUBA 1TL5A 2DH9A 2PMHA 2H4YB 5K8MA 4MK9A 4Y3CA 2HHUA 2DPJA 2PFDA 1NMEB 4Z7YA 4XPEA 1RZMA 1GFWB 3PRVA 1WC5A 3CDAA 3B4DA 1D9FA 5FDLA 4UT4A 2HNYB 4X65J 3AOAA 5T41A 3H90A 4KRWA 1KP6A 1OWXA 1U26A 4CO0A 1QTNB 3P96A 2QC3A 2EEYA 4DPXA 2ALZA 2IVMA 1WWHA 2D3ZA 2UXDF 4RNOA 4N8OA 2V68A 1S57A 2QLFB 3HFKA 4LJMA 4FP9A 4ZCIA 4B9LA 1NAQA 4LFBF 4WP8A 3CJTA 2E7XA 1UA1A 2B9WA 3K59A 5KFAA 3ISZA 4QJVA 4DV5J 1WG4A 3NS7B 3GV8B 2N3OA 2OEMA 4DPYA 3Q83A 1U45A 2HBYB 4ZP8A 1ICEB 1RBOB 4J9LA 3KG0A 4XPCA 4HH1A 1GH8A 1C4AA 1OPZA 5HVHA 2LU2A 2ZBIA 2XCPA 4Q5VA 5C2GA 4F25A 4AQYF 4CYUB 2XMKA 1S0OA 4H4KC 4WP3A 3B6BA 1K0TA 3NGRA 3DRSB 4B9UA 2XZWA 4GKKF 1SL2A 1A0OB 1DHMA 3QT6A 2Z2YB 2VC1A 2QSWA 4I6WA 2ZM6F 2V8HA 3WZ0A 2OPRA 2M70A 2BJ3A 4KKOA 4D3HA 5MAOA 3R5JB 4X4VA 2IJRA 5CZVA 2FHKA 5IV4A 2G2ZA 1T9YA 1UAWA 1U1KA 2P8IA 4WYWA 1FWLA 2LDYA 3IWNC 5HANA 4C7QA 1TL1A 1QTMA 4TU7A 4KE5A 4P71A 3JTPA 4RNMA 1ZYQA 2KZZA 3FCWA 1M1GA 3CDEA 1VQOS 4ED4A 2E9RX 1HI1A 3MCMA 1KVIA 3JYTB 3DRPA 4Q0BB 4ZK7M 3QLHB 2IRYA 1AZSA 1J5OB 2VQFJ 5CXTA 3CCTA 3MUVP 3H25A 2V2ZA 4AT1B 3ZTOA 4PXDA 3J81Y 4YUDA 2Y1IA 2B9YA 1UEUA 1XK8A 1UCNA 3OR1A 3FCVA 2J0WA 4ZKAA 1KTVA 3G96A 2HHSA 4N56A 2A6OA 4KFBB 3QRQA 2OD6A 1KS2A 1BGXT 4XK8C 2VB6A 4A8QA 3C14B 1M90T 3SI8A 2DGOA 3OTBA 2B56A 3R2DJ 4USKA 4I0WA 1IR0A 4UW2A 2JZ5A 1TZ0A 1CC8A 1U2CA 5CYMB 3TP2A 1FWKA 1FFGB 2EFOA 3LANA 1AUSL 3I5AA 1TK0A 3SFUA 2ZE2B 2FJAB 3AJ2A 1YJVA 5A8KB 4F4KA 1F5BA 3DGVA 4ELTA 3H98A 4ID5B 2EXUA 4CLPA 3MAAB 1Y11A 3CPWR 3NOCA 3L95X 4DCOB 3JAMU 4OX9F 3NGUA 2KT3A 2XTJP 2YWWA 3CC4S 3MR2A 3ZXWA 1UL3A 2WBRA 3LP1B 3QWUA 2AD9A 4Y34A 4HLBA 2BKNA 4OV1A 3KTQA 4EU0A 3CCWA 5GAEU 3JSRA 3Q2SC 4LIRA 3K57A 5T14A 2XBPA 1P8GA 3FRZA 3M6UA 1VQ5S 2LXIA 3THTA 1JXVA 3GG1A 4DR6J 4HT5A 4OX8A 4FYXB 5HJXA 2Q66A 5KT5A 4NLOA 2V63A 4DCPB 3KLEB 2A2DA 4ANCA 4ED8A 1JJ2R 3OUYB 1KKHA 1CJVA 4PKDB 3V6JA 1IVZA 1XMQF 4WXWA 4KO0A 4DF8A 2EKNA 4DL2A 3C46A 4ED1A 4PPZA 3I4HX 4B9NA 2ZJQQ 3CJ4A 3EVMA 1X4EA 3W8GA 4IFVA 3GR1A 1QLNA 3ITHB 1Z1ZA 5D3GA 4U8VA 2ZC3A 2CQ4A 4UUXA 3M8PB 1U0HB 4O23A 2R2RA 3DLJA 3QAUA 2CQBA 4PUOB 1SC6A 4RW8A 2N82B 2K06A 1WNEA 2PGCA 1SKSA 1KOOA 2BYCA 2XI2A 5KFXA 5KFNA 5GMEA 4ZLLA 1VJQA 3HK2A 2XSFA 5B0EA 2JWNA 1S9GB 2YNIB 2RF2A 4HTIA 3R6LB 4QIWD 2L3MA 2VG7A 1N32F 4C98A 1RTHA 1F9HA 1TAQA 3K8VA 1ELOA 3FZ2A 1CJTB 1DQ9A 4LR9A 4A8WA 2ZH3A 2B4UA 5EWGA 2VIHA 2CQ0A 4DR5F 4QYRA 1WC1A 4ECQA 1NKCA 3DHXA 2W9CB 1H2VZ 3K5MA 3DLKA 4N47A 2ZZNA 3HVRA 1ZM2A 7AT1B 3QBCA 2CAJA 1EAYC 4RUAA 1H0HB 3JSYA 2LDIA 3NP5A 2J6TA 1Q86T 2ZH8A 1B7FA 5CD4H 4YHHJ 4LSZB 2IRXA 2XNRA 3OFFA 4K7QA 4WPAA 5DLFA 2H51B 2JEFA 2DHGA 3FNNA 4RW7A 3FUYA 2B4VA 4MTPA 1OYEA 1RTIA 3GZ7A 4PXEA 2JEIA 2J9DE 2WSEC 3OL9A 2ZBCA 1CPZA 4O0NA 1JLAA 3A8JA 1Q8LA 2HFUA 3DMJB 1VC5A 4LSLB 2X51A 3LPYA 5F9NA 1UVKA 1WOOA 3BQ0A 3S7RA 4FXWA 4X4TA 5HVFA 1C0TB 3M1VB 3D1OA 3AB4B 4OYOA 3D28A 4PR6A 1FDDA 3A13A 5E41A 1RXOB 3RB4A 4KPYA 1T94A 1QUVA 4H54A 1TU0B 2R2UA 2KG0A 2BJ8A 2ILZA 3PJWA 1B4SA 2GO9A 1XR6A 1JNRB 4ZJQA 1APSA 5KFDA 3GWCA 2AJQA 2W2QP 1FEEA 3NKYA 3OPKA 1WSVA 1X8DA 4QW8A 3MR3A 1J5EJ 4U67Q 5IWAF 3BKFA 1FRHA 2W01A 2AJ2A 2DNHA 2LEBA 2D3O1 1XNQF 2W2NP 2V2QA 1YIJS 1FI4A 5D4LA 3KDNA 4LQ9A 2FZKB 2NR0A 4QIGA 2ATCB 3ETOA 3DKDA 4HH0A 2E1RA 3A3OB 2B3TB 5HP1A 1A9NB 3RYLA 2LECA 3KYLA 1FX4A 2U1AA 1MNEA 1K9MT 3MMAA 3J80U 3CMES 1OQ3A 2R8GA 2EFNA 3KJFB 1HBMA 3C2PA 2LXFA 2BJ9A 3ENQA 2QMXA 2HWHA 5C25A 3RBEA 5I3UB 1TKXA 3THPA 4TYAA 1HI8A 6FD1A 3KNAA 2XG8A 4EWTA 2V9KA 1TL7A 3HVAA 1AA1B 3FEXB 2E5HA 2J6SA 3GFZA 2Y3YA 3SSQA 3VGTA 2MYFA 3BGOP 3QJPA 4FDFA 2C3MA 5ETVA 2KHCA 1HWJA 2N7YA 1VDHA 3KKFA 1BY9A 3SBMA 4C8NA 5KTQA 1HBNB 2C2OB 4UF4A 3OXLA 4RNHA 5A8WA 1B3TA 4F8RA 2HHPA 2LU1A 4LRAA 5K14B 2RS2A 3DU6A 2HWTA 5LSOA 2R2TA 3CDWA 2J8AA 1R8HA 3HFZB 4DSEA 3C15A 1YTYA 1X4HA 5L8RC 1SV5B 1KN6A 1VQSA 3SQGB 4USHA 5EX3A 4JI7J 4IR1A 4JI4F 1BMQB 1SJQA 1VQ7S 2LVWA 2GQ2A 3PY8A 5KG4A 5E3QA 3R2CJ 1HWIA 2I5JA 3HULA 1OY6A 3GE9A 5B0CA 3TUIC 3DLHA 3E51A 1GQEA 1UVMA 2MSSA 1HD1A 3NL0A 2MLZA 3LP0B 3RJMB 2AHOB 4DUYJ 2FIUA 4CRJA 1M1HA 1WACA 1KWMA 2ALYB 5D8HB 2DR6A 1FJEB 1GMUA 1ZBTA 3CW2C 3UNGC 3G8TA 2LCWA 1RHQB 1QSLA 4ZVSB 4FKXA 3OD2A 2LKZA 4JI8J 2HNYA 5IS2A 4NMLA 2XWYA 2OMOA 2VF3A 4Q43A 5CCLA 3R7BB 3MI7X 5K5MA 2I9SA 3BBCA 1HL6A 1WD6A 3MOJB 4QPTA 1FT8A 4IRCA 1T8EA 4O44B 1CQMA 5KG1A 2I6WA 4JBCA 3UCZP 3PYDA 2QZ8A 2QLJB 1URNA 5HATA 2HEKA 2RD5C 4NASA 5A76A 2N4CA 1VQNS 4N7TA 2QTWA 5CYJA 8AT1B 1YSJA 1U1NA 3CE8A 1QAXA 4BBYA 2DT9A 2F4VF 2ZBQA 2VUGA 4B3MF 4LF7J 2EKYA 1DLOB 4BWMA 1S6UA 2ROEA 5EGYA 4CYUA 4F02A 2CRLA 3MAQA 1QY7A 4JI3J 3FBFA 2ZKUA 4Y2AA 3HO1A 5ETKA 2PN6A 4UOHA 4NEYA 4KR0B 4YB6A 4C0HA 5DG7A 2C2MB 2GO8A 2W4DA 3FSIA 2ZD1B 4H4OB 1EJ7L 1VK3A 2VFSA 1EQMA 1YJ9S 3J81j 4OZ1A 3P49B 4TXSA 2QSFA 4M5DB 2R42A 2HK2A 1S49A 5KG3A 3BGRA 2HSEB 5D4NA 3FC9A 2R8KA 2ZNYA 3RUBL 3ZZPA 1BC6A 4JV5J 2EWHA 3QWPA 1RAHB 4HYKA 2FVRA 3JYTA 4Q0BA 3QLHA 3N4WA 4X66J 3B82A 2XO6A 3BEGB 3CTRA 1S76D 3CJ2A 2QA4S 2ZBRA 4RO0A 3AXKA 1J5OA 4WYLA 5F0WA 1HNZF 9ATCB 4ECZA 1E6YB 2EG2A 4F0KA 4J90A 4BWJA 2BM0A 4NWBA 1YDLA 2MKJA 4J9RA 2ASYA 4LRFA 2ZJPQ 3LAKA 4P72A 2RRBA 4ZVHA 3EGVA 4YQWA 4CCHA 2Y9HA 3I5CA 2JLFA 3C14A 2V8DA 2KFYA 2WB4A 3PG9A 3K58A 2FJWA 2YKQA 2QA2A 3D66A 5CYMA 3GIKA 2UXBJ 4HACB 2AGPA 5L1IA 2XSJA 2F9DA 3A8KA 2ZE2A 5HQLA 1QAJA 4FYVB 1Z2LA 2YWKA 4ILRA 4L3KA 5A8KA 4YR2A 4ID5A 3N9UC 3MAAA 4AUKA 2FPHX 1ZM3A 4FBUA 4DU8A 2ADBA 2RKIB 4PXBA 5MLCV 3OHAA 2BJ1A 1I94J 3EPIA 1RABB 4RW4B 2XYPB 3K5NA 2EK1A 3LA0A 2YQ0A 4K50A 2RDIA 3GCWP 4WK3A 1N5QA 3M2VB 3D2WA 2Z2ZA 2UUTA 1OSDA 4PABA 5EHHA 3MR5A 3CXCR 1FTRA 1EX8A 1RT6B 3OFGA 4A48A 3MECB 4LQ3A 4AXIA 2D7SA 3EVOA 4OI3A 2C28A 1X4GA 1S79A 3KLEA 4LBHA 3OUYA 2ASJA 2BM1A 4P10A 4UQGA 1FK9B 3G6VA 2HVEA 4ZHRB 3O3LA 2KYXA 2QL5B 3VAMA 3KJNB 2HVIA 1TL3B 1JJHA 5CYQB 3ITHA 4GVLA 3DXBA 1U0HA 5G0RB 3DRXA 5KFUA 3QSIA 1SJ1A 3PW4A 4PUOA 2KXFA 3M8SA 2W4CA 2GFFA 1T3OA 4JI1J 2OHDA 2B51A 4CLSA 3VVTA 4K4UA 2QRRA 1S9GA 2YNIA 2WCXA 8RUCA 2MZSA 3BJYA 2UU9J 5KG7A 1C0UB 2FTRA 3BBFA 1Q5YA 4P6QA 2PMZD 1YRUA 1CJTA 1X9SA 5IQ6A 5C42B 4FF3A 1RHKB 1Q8IA 2W9CA 2NUUG 5JUMA 5C24B 1U1QA 3DLGB 2V69A 2WAQD 1SC3B 4LF9F 1GNKA 2EI5A 1JMTA 1NZ8A 4C3LA 4OYZA 4KYZA 1VRQC 4UQTA 2CQCA 2IJFA 4NYPA 3BH7B 4B3RJ 1LWEB 5DQGA 1NPPA 4PXCA 1HQ2A 2V34A 1FTCA 2GV1A 3LP2B 1FVSA 1TKDA 1WOPA 1HR0J 2YXLA 3PRBA 3GR0A 2AJ4A 4IG0B 4ECWA 3DMJA 2LP4A 2MKKA 2QA1A 5HMYA 2XLIA 2IM1A 4W92B 1F9EB 2OPQB 4YDXA 1C0TA 3M1VA 1OSCA 3OFEA 4N5SA 1WHWA 4GVBB 1VYAA 5DDPC 4M5MA 2D9OA 3SMZA 3ZO7A 3FKBA 3FVYA 2DEJA 4ZLJA 4HHJA 2O66A 4O4GB 2XGPA 3HX9A 2VPYB 5KT2A 4FF4A 4ETXA 4I6YA 2YH1A 2KU7A 2G9OA 2VFTA 1DTTB 5F8MA 1FKOB 2MMYA 2BDPA 4KBIA 2DRDA 3VALA 3W7BA 5B08A 3H5YA 2DCUB 3TOQA 4ZIVA 1IQTA 1D0EA 1Q79A 2C2NA 3T3FA 2G2OA 1Z2ZA 4GMKA 3C66A 2PFFB 4DF4A 1KLMB 2PT0A 5F8NA 2HG4A 2BA9A 5AXNA 1GXUA 4KJIA 2K8GA 2FY1A 3FK4A 1Q5VA 3SIPB 2BJDA 1N5VA 2ZOFA 4USTA 4IRKA 2NXNA 4DHVA 3V6HA 4KB7A 1Y5LB 2RNEA 2K7KA 2RDJA 1NUEA 3OLBA 1T9TA 1UZHA 2QX0A 5I3UA 5D0GA 4LFCF 1RHJB 1U47A 2F5GA 2DNNA 1G3OA 1N0VC 2LQ9A 2PC6A 4CLTA 5CD4A 4JI6J 3PM9A 1S4EA 4CLKA 3KLHB 4N8NA 4G1IA 1XBWA 4HL9A 3ULHA 1NK6A 3Q23A 1VLYA 4WK1A 1U1OA 3T1HJ 1S99A 2DYAA 2PEBA 2M4MA 1W2IA 4X4RA 4NI2B 1RT5B 4WP9A 3IAM9 2FJBB 3KWMA 2P5VA 4Y65A 1IWGA 2LQBA 3T5LA 5GAEI 2YKMB 2DXEA 2HQIA 4DR2F 2BQUA 4JYAF 3I6PA 3V5RA 4RNFA 3HHLC 4FS2A 1YJRA 2E5JA 1SV5A 2YKNB 1D8YA 3SQGA 3QPIA 4L74A 4HEA9 3EDRB 3O1LA 1L3SA 1IBKF 2G0JA 2BJEA 1PBUA 4EK2A 5HQMA 5HLFB 3IR5B 1IN0A 5AXKA 3BO4A 3HJFA 1R6YA 4NCGB 3LP0A 2ZH4A 2MQOA 3PYFA 1TMMA 3V4IB 3MM6B 5IZHA 2FQQB 4A8OA 1XC9A 2FDNA 1HBOB 1FXLA 3TJ8A 3UDCA 4P2SA 3AODA 4YS2A 3UD5A 1SPBP 1EB0A 1Q82T 4X64J 2CQDA 2CIMA 2WB1D 1R8AA 1YG0A 3CIMA 2CQHA 4CI0B 4DV2J 2O1PA 3R8YA 3KUHA 4O44A 2GMHA 1VHIA 1EKRA 3IBCB 3SCJE 2R9LA 3P3DA 1RAIB 1UJ4A 4ANEA 2ZDOA 4WFBQ 1K1QA 3K7RA 3NCRA 2UUAJ 3NCPA 3MWBA 2HGLA 1UJ6A 3QZ8A 4F67A 2BE2B 3JTNA 2IDEA 2L08A 2VV5A 2QYCA 4QW9A 1M5PC 1DLOA 2AYBA 5HSPA 4WWSA 1LXJA 2KN4A 1V5IB 3A8IA 2M7SA 4X4OA 4OFZA 2IBKA 4PEOA 3G6XA 1S10A 3IS9B 1U1RA 2JEGA 3OVBA 4NPOA 3DOKB 2ZD1A 4H4OA 1LEOA 1A7GE 3RRHA 2O67A 5B09A 4ERDA 1FNMA 2MEWA 3ISND 2OELA 2F40A 4M5DA 4J9QA 4K0KF 1RAEB 3CDUA 1UTAA 1S6PB 1IXKA 1X0PA 3PX6A 4LFBJ 4IO1A 1LW2B 3KK3B 4DQQA 3KJVB 1U6BA 4KSEB 3TJAA 4UTGA 4M5GA 2QLWA 2HKEA 2WVDA 5AJ3F 4W4MA 4A8KA 3FFIB 2P9CA 4NLDA 4OJHA 1U25A 2VG6B 3W64A 1EIYB 2P6TA 2XO7A 3UR0A 1E6YA 3AA8A 3HSJA 3FQLA 1D8ZA 2CJYB 4AQYJ 2ADCA 1VISA 4NLRA 3HXMA 1I6JA 1RCOB 3OJSA 1RWOB 1UVLA 2HHVA 3AY0A 2XWXA 4GKKJ 4FZVA 2KDOA 3PRDA 1WF2A 1T02A 2IDLA 2ZM6J 1RAAB 3NBPB 1F6TA 1F3VA 3GSDA 3CCRS 1T05B 5L9NA 3QRRA 4DV3F 4WF9Q 3I82A 3H2LA 4OZ5A 2DGXA 4K2XA 4DN0A 4HACA 5BR8F 2YKOA 1X5TA 1EETB 1XWLA 4HI1A 4ZPCA 3QZ7A 3TA2A 3BPSP 1UMJA 4NRUA 2B6AB 2RDDA 3R1HA 4F3QA 4NLVA 1S1XB 2B9XA 3SFGA 2PI4A 2FVPA 2KM8C 3EM1A 2YPYA 1V3RA 4DG1B 3ENVA 2A18A 2AYEA 2IA0A 4YB7A 5IC6B 3M4XA 2RKIA 4QR1A 4LF2A 1LOUA 4ES2A 5H9EK 2HHWA 3IBFB 3NGDA 4RW4A 3SDEB 1SH0A 1VHFA 3DC2A 1JB0C 1WC0A 2MQQA 4C97A 3QMQA 2IAJA 4CO2A 1H72C 3PJ9A 2BRKA 4A46A 2M88A 3C8YA 2B7BB 3PJXA 3MFIA 1RT6A 2R7QA 4NLWA 5F9LA 4V19X 1SJRA 2GAGC 3WDOA 4DDFA 2CADA 2IFXA 1DZ5A 4UOCA 3POTB 1FK9A 1PGZA 1WUUA 3M8QB 3M6XA 3P8BB 2KXHA 2X3GA 2WTFA 4ED0A 4OJGA 4DV0F 3FEYB 1FEHA 2AJ0A 4ZVGA 4PQUB 1SQFA 1TL3A 2HURA 5CYQA 3Q24A 4USIA 3ILLA 3BYPA 5BYRA 3T5JA 4ZA1A 1TAUA 2J8SA 5G0RA 2X1GA 1L3KA 4A8FA 1TKZB 3EX7B 4U8YA 4NXMJ 4ENOA 3I4PA 3IWLA 3R1LA 2ZUGA 2F65A 2XM3A 3Q8YA 4EZ6A 1XEZA 1KC8T 2AYMA 1ZZNA 4LRCA 3M9NB 1XTZA 1N6QB 2UV8G 4JI5J 1C0UA 1OMSA 2BW2A 4OLPA 1G7CB 1F5CA 3HT0A 4DEZA 1XMQJ 4ED5A 4ECUA 3ZC4A 2ZH2A 2KO1A 4PQAA 5C42A 2I0XA 1TFWA 3G8SA 2BX6A 2JLEA 3BF4A 5C24A 4BC7A 1FX2A 3DLGA 4LF4F 1RAOA 3UD3P 3QJLA 4LSNB 4IKAA 4EO6A 2EFVA 3OSNA 4FNIA 2R7SA 5CZXA 4KKOB 3CCSS 4B08A 3CCVS 4WTOB 3M9MB 4ILMA 4DS4A 1LWEA 1VIXA 4PYAA 1P9QC 2GIRA 1NDCA 2Z2LA 1TL1B 3LP2A 4QR0A 1VS3A 3PYGA 3EMTA 3ZZYA 3ONQA 3AFGA 4TQRA 4IG0A 1R43A 1GMVA 4X4SA 4EMDA 3UPFA 3DN9A 1N32J 1XQIA 4F0HA 4H4MA 1H73A 3TAMA 1LQ9A 2IA6A 2W7AA 3MEKA 2W1BA 2AP6A 4DR5J 1V3ZA 4NXNF 2HHHJ 2K3IA 2EG1A 1QD1A 2DKOB 1FA0A 5FJ4A 4GVBA 2IM0A 2OFGX 1O8BA 3PVXA 2ZH9A 2A10A 1FDAA 3K5OA 2HRUA 4O4GA 1WEYA 1RQ0A 3H4BA 4JB8B 4ELVA 1S4FA 4YEAA 4X4NA 4IRDA 1HQUB 2DHAA 4KGMA 1DTTA 2LA4A 1FKOA 4DPWA 1YX2A 2LEAA 2MKHA 2EW9A 1Y4ZB 3ZZ0A 2RU9A 3TW0A 1HMVA 4GKJF 5LXYA 1ZAWA 2H5EA 4UOFA 1NBEB 2DHSA 1Q78A 3R7NB 3F44A 1KLMA 1JXEA 5IM0B 1JLQA 1NJIT 3LAMA 5CABA 5KG5A 1IBLF 3HVWA 2ZHBA 2QA4G 3BQ2A 1NRKA 3QIDA 5M2PA 4PZVA 4PYDA 5T7LB 4ZLPA 4CLZA 2VA2A 4KQZA 3RW7A 5IT9U 5BYQA 2VICA 4ZMMA 4R25A 1K0VA 2Y0SD 2CDRB 2OPSA 2RE1A 5KFHA 2ZITA 4DFPA 3MPUB 4FVCA 3I96A 1ULRA 2NCKL 3BH6B 4ATNA 2R7XA 4M5JA 2MJUA 2YX1A 3OT9A 2R7TA 3MEDB 2OSRA 5IWAJ 1RT7B 3KLHA 4C8ZA 2V4RA 4QCLA 3FCHA 4BC9A 1M5VC 1XNQJ 1CLFA 3OTCA 4LFAF 4KHPF 1D9AA 5J2PB 1ZS6A 4ZOSA 2HBRB 4YB5A 4ZPWR 3D68A 4O4RA 3CJ8A 3BDEA 3C3LA 3J7AN 3ZFVA 4NI2A 1RT5A 4WZMA 3BR8A 4GRSA 1N36F 4LBIA 2W8LA 2BKPA 1WC3A 2YKMA 3ET6B 1QE1B 4UOGA 5KFKA 1TK8A 3R3TA 3VAGA 5HN0A 1XJWB 3H5SA 4XTTA 3F56A 2YKNA 3PW7A 1OO0B 3D6HB 5IC4B 3UCUP 2DR8A 4ZPAA 1HKAA 1FJGF 3CCLS 1UW4A 4WFYA 4F4XA 2IMOA 4J9UE 1MW7A 3OJUA 1UEVA 2ERRA 2FUG9 3QSYB 5DJBA 4E2FB 3OTOF 1U48A 2G13A 1YRTA 2YVSA 4CIOA 4G6VB 4TU8A 2BE7D 2OP5A 4NCGA 3AJDA 4F2SA 1HR0F 2NXCA 3FJ2A 3V4IA 3MM6A 3NLCA 5K8NA 4YY3F 5DQHA 2COLA 3CJ3A 2RQMA 4KGXB 3TAQA 1GEHA 1HHSA 3AD7C 3DRRB 5K9FA 1HBOA 4OZ2A 1RACB 4NE9C 2MHNA 1U2RA 1YQHA 2IYGA 4DX7A 1T9WA 2HFVA 2XCAA 3O8WA 1NKEA 2DHXA 2LFVA 3D54A 3KHGA 4X2BA 1SBRA 3K5LA 2GGPA 3W5YA 1M5SA 2DO4A 3GU0A 4I64A 4JI4J 2YTCA 2CNNB 1K44A 3VZHA 2R4FA 3CVKA 5GMDA 2VBXA 2EFQA 4DSKA 1AROP 5CAAA 1NSQA 5KFFA 3HHLD 4DN9A 2J76E 5K20B 4AD6A 3DLEB 2BE2A 1NSKL 3EE3A 3VR1A 2BVZA 3TAPA 4FYWB 2AX0A 4IO9Q 1MMDA 4KH0B 1S77D 4XIUA 2FLNA 4U7UK 2WRMA 1NDKA 3D0GE 1SCJB 3Q8SB 2V4QA 3RB3A 1VQ6S 2D1CA 1LKZA 4OYBA 1VQ8S 4F3MA 3IS9A 4Y2MA 2R7UA 1OPIA 3RBXA 3RRKA 4URQU 1RTZA 5F3ZA 2DNGA 2HBQB 2AX1A 3TEHB 4QR2A 1S7IA 4EBDA 1S6PA 2G2YA 3GP9A 3DGPB 2NXUA 4WE1B 4QPXA 3TUJC 3EXYA 3KK3A 3KJVA 5SZTA 1WKLA 2OEJA 3FFIA 2ABYA 4C9DA 2UXCF 3R97A 1B7YB 2VG6A 2F9JA 4B3MJ 3P4UB 2BR0A 4RW6B 3ZNUA 2DTJA 3V4MA 1S5ZA 1PC4A 2XLKA 2V4JB 3DLLQ 1SQGA 3WX8A 3R5DA 2GZOA 3MDFA 3T6JA 3MMAB 2J7UA 4NLQA 4ZVFA 2YX4A 4OZNA 1Y5NB 4QWAA 3PFEA 3IM8A 3NMAA 5HI7A 1JLBB 3MEGA 2NXJA 1R8PA 1VK8A 1O5JA 2B8QA 3LPEA 1V3SA 1T05A 3UDVA 2RS8A 2H48B 4DZDA 3R9LA 1N5SA 5ETMA 2GQCA 1RT2B 3W3SA 1RDRA 1XIQA 3QGIA 4MIWA 4FN5A 2BUNA 4CT8A 4J7CA 3KNGA 4U95A 2B6AA 1T03B 4LRDA 2XS7A 1Y7PA 2JSXA 3IMQJ 1MMNA 2YNFB 3KHRA 1S1XA 1NK8A 4ECTA 1HWUA 5IT9Y 4NYZA 1HNZJ 4IOAQ 4DG1A 1WTFA 4I6AA 2JC0A 1S6QB 4PG7A 3UN5A 1UZDA 2NYIA 1R0AB 3LALA 3CEDA 3L3CA 3THVA 2CPYA 2DEIA 1BUXA 3GSIA 4I2PB 2JX2A 2J0XA 3SDEA 1Q8BA 5J2NA 1YJTA 5KG6A 2XI3A 2V94A 1XMBA 3RR8A 1HBUB 3OVAA 3TVZA 2XHCA 1ZZFA 5KFWA 5F8HA 1U8SA 5C2CA 2FJDB 2DNQA 4L76A 4EYHB 3T1YJ 4CLFA 2BEFA 3PO5A 2CPFA 3J7A1 1N4LA 4NZ0A 2OMLA 2JEJA 1NPKA 3POTA 5IT0A 4WKRA 3M8QA 4DX5A 1FRMA 1MN9A 5JVGQ 2BBEA 3O6QA 3DDNA 2DNLA 3D3CJ 2NUHA 3I31A 4PQUA 1JKHB 4UUWA 2F8EX 1VQMS 1IKWB 1LXNA 4B9MA 1U02A 4CDIA 3CGIA 3V2UC 4LUBA 4IYQA 4J9VA 1IKVB 1TKZA 2ZFHA 4RWWA 2UVUA 3PXGa 1RU2A 1GT8A 4CQ1A 1TL4A 3LTOA 2R7VA 1YJ7A 5LSRA 2YWFA 3M2UB 2F8HA 3AXMA 4E98A 5M2RA 1RWMB 3HHDA 1UA0A 3TJ9A 4RU2A 2YKAA 4OYXA 3PO4A 1N6QA 2B0GA 3GV5B 3OQ2A 3Q0AA 1TUGB 3DOMB 3NAIA 2BANB 4M8LA 5KT4A 2GQQA 3KHLA 1LFPA 4Z7CA 3LF0A 1FNXH 2XMVA 4J9OA 5DDRC 2DNMA 3GYNA 2AEFA 2ZEJA 4ED6A 3V81B 2DISA 2BW7A 4B9SA 4DOZA 1RA6A 3EZOA 2MLXA 4P7TA 4M94A 1V5VA 5E3PA 2VG5B 5LMUF 4GO7X 4NCBA 2JVRA 2MQNA 3RZAA 2M8DB 4LSNA 3PX4A 1VRTB 2XZDB 1FDNA 3NMRA 3S1TA 2QYGA 4NRTA 2KL8A 4HVZA 1M5HA 1F3FA 4HHUA 1EKSA 1Q7YT 2VOOA 3D3BJ 1RYSA 3G4SS 4FF1A 2EBEA 3BGRB 3NNCA 4FBTA 1FCAA 4V1Ak 3FBBA 4NZ7A 4HKQA 1D3WA 1QVGR 4ID8A 1RAFB 2VODA 3HZGA 1N88A 3RW6A 4ZS6A 1F60B 2DXFA 3UD4P 2XB2D 5KFLA 3L7PA 5FLXY 5F8JA 1R8BA 1RWUA 4FF2A 2R7WA 4DQIA 4R0EA 3OTEA 1R3NA 2POKA 5KG0A 4LF9J 4ZN3A 2XMJA 2OKQA 1Z4UA 1DY3A 2M0GB 4RUHA 2ZDPA 3PEJA 3BO2A 4DPUA 5C5JA 2CQGA 5HMXA 1DQ8A 2O3DA 2CUYA 1HQUA 1KVKA 5DZ6A 3A3PB 1TFYA 1N33J 1UWAA 2XYGB 3IAS9 4F26A 2R2SA 4CLLA 3P5BP 3NNAA 2DGWA 1UEKA 3WC2A 3D0HE 4L72B 3I5BA 2XSJB 2A1BA 2JNJA 3WC0A 2PE8A 4DSIA 4TY8B 4EUVA 3Q8PB 3MURP 5IM0A 2IMWP 2IC3B 1OS5A 1WEZA 1H6KX 4WIIA 4X84A 4NMXA 3HJVA 2YQ1A 2H3EB 1TELA 1T7PA 1YRXA 4LIWA 3TX0A 1FRXA 1WC6A 1YBAA 4CO1A 5T7LA 3MTJA 2B4PA 2QV6A 4O3NA 4EEYA 4AXJA 4DLGA 3HSDA 1DARA 2HMIB 4ZP6A 1SQEA 1U2FA 4QIEA 4KGZB 5GADI 3UR3C 1ROFA 1DTQB 3VCDA 2HHTA 4NXMF 1MWQA 2Y8YA 3CD6S 3L7OA 2C3YA 4LF8F 2Z0GA 5M2UA 1I1GA 5KOWA 2VONA 3EGWB 2ZC4A 4HDHA 3MEDA 2DY9A 5THWA 1RT7A 4KT0C 3SV4A 3CJ5A 4JI5F 1AFIA 4OHYA 3PR4A 5J2PA 3H59A 3HFVA 3SCIE 3IO1A 2E1PA 4OYWA 3H5XA 2BACA 5HBMB 2HK3A 1K47A 3KK1B 3ET6A 1QE1A 2YX7A 1WSRA 3T9NA 3H20A 5C7PA 3T5KA 1SC1B 4Q8FA 2AV5A 4R8UB 5DQIA 3MTKA 2DIVA 3DCAA 3PIPQ 1KSPA 1UWBA 5D0EA 2HZVA 4LFCJ 2Y0BB 3M05A 4F4WA 1FFSB 2C3OA 2EC0A 4U7UD 2FHJD 2FLOA 3QFHA 3KDOA 3BN4A 1U8WA 1PBAA 2MQ8A 2LQJA 3BGLA 1H98A 2OPPB 3R5BA 4M5IA 2ASDA 1UKUA 2LEPA 2GJIA 4LRBA 1FRJA 2BABA 1U6FA 1NK5A 1NSAA 4C2MA 2GIFA 3D1QA 3DRRA 4QWBA 3AQOA 1SKUB 2KFZA 3MOZA 4HDGA 5H1SV 2HHHF 4DQRA 1WHYA 2DO0A 1RWNB 3RAQA 2HZCA 1D09B 4DR2J 2KVIA 2JVOA 4JYAJ 3IRXA 2H54B 4CP5A 1Q95G 4ZCLA 3US5A 3MHYA 3JB9k 3FMBA 4JOUA 4AL6A 1IBKJ 3QATA 3LW5C 2ZNZA 1M5KC 4KGVB 1FD2A 4DR1F 4UY8T 3TRGA 1KLNA 2W7OA 4A8SA 2FC8A 5D0RA 4OX6A 4DL3A 3DLEA 4ED3A 4DFMA 3CB4A 2CWXA 3MR7A 2W7PA 1X5PA 2IIHA 5EN1A 4M63A 3CD7A 4ZPBA 2W2MP 1VQKS 2ZKTA 3RR7A 3CJKB 2XULA 4K4WA 5IOLA 1RP5A 3OL6A 5H9EJ 5D78A 2L48A 1RKJA 2XY5A 4WFAQ 3LQVA 1LNQA 3GFHA 1WOSA 3NOGA 4OYAA 2CJAA 4EYIB 4J5OA 5DRKA 2OJ3A 2SXLA 3DGPA 4WE1A 3PW0A 2HLUA 2IVYA 4NLTA 3PDNA 1N52B 5D6GA 1TQLA 1U6ZA 4J9PA 4ED7A 2UUCF 1Y0HA 2V9WA 1UVIA 3FSXA 3GFXA 3HD2A 2OAUA 4DUTA 1NSPA 4GO5X 2OGUA 1VOMA 4DUZF 1X9WA 4OL8A 1RAJA 5DS7A 4RW6A 2WHOA 1T11A 4OJ1A 2V4JA 3PW2A 3KLIB 3C19A 2CPDA 5KFTA 3HDSA 2WK4A 5CH7B 4OI6A 2E1AA 4DR4F 2HAIA 5E3AA 2E5GA 2D69A 4DV4F 2XC9A 1SIWB 3LGHA 1JLBA 1XR7A 2D9PA 4J9MA 1HFEL 3BSCA 1ITPA 3MD3A 2RHSB 3W62A 3LO3A 2F63A 4K0KJ 2WZ1A 4XAKA 2B43A 1HPZA 1QUPA 4TKTA 1RT2A 5ITHA 2Y1JA 1E6VB 3PX0A 3N5FA 3M8RA 5AXLA 3SQOP 2MPUA 4RWXA 1T03A 3CT9A 2XMAA 5AJ3J 1SKRA 2C3UA 2NZ4A 2YNFA 1H38A 3JAMY 4I2QB 2CPEA 3TANA 1N5TA 2GMJA 3IP0A 1S6QA 3AJ1A 1ZA1B 1Y9OA 1R0AA 4KY3A 5SUHA 4C48A 4I2PA 2FGCA 2UV8A 2RQCA 3N5BA 1NH7A 3HT3A 1N56A 5H9FK 2E7WA 4CLWA 3CC7S 1F5AA 2BKOA 4WTYA 2XS5A 4LR8A 3T1AA 2GS8A 4MT1A 1HBUA 2CNOB 2HIYA 2XYHB 5KFGA 1PJ7A 2UUBJ 2ZZTA 4YP3A 4BS2A 3B4MA 4DV3J 2KRBA 2XS2A 2F3JA 3TR5A 3LWMA 1N0UA 4YMEA 5D4PA 1MU2B 3NXZA 6AT1B 3GQCA 4IFYB 5BR8J 2HQ3A 3EDQB 2DJWA 1R0CB 5ETSA 3L4BC 4DV7J 4DSFA 3FBCA 1KD1T 3UI3A 3CNQP 2HNZB 1L3TA 3S01A 1WF0A 2ROGA 4LT6A 4RUBA 3GIIA 3I0RB 3PZPA 4MJKA 1JKHA 2DNYA 4ETZA 4NZ6A 4ZLNA 1WDTA 1IKWA 3SZ2A 2UVVA 2VU5A 4EBCA 3X3UA 2UZAA 5HK4A 3UE2A 4YR0A 4ICLB 2HQFA 4DL0C 4I68A 4I4BA 4M5KA 1H3DA 1IKVA 3Q22A 4P75A 3NG8A 4PWDB 1UPMB 4OI2A 2C1EB 3BYRA 1RWPB 3NAHA 1SKWA 1AW0A 5E2QA 1JXLA 4K5SA 1D1UA 3M2UA 3EGNA 3ILOA 1FE4A 3RBDA 5GAHU 1JWWA 4ECSA 3G9CA 4P2MA 3H8YA 4QZVB 5J2MB 3J81U 2Z8QA 1VIOA 4ZP9A 3DOMA 2BANA 3OFHA 2BQ3A 2HFOA 4RKUC 1L3UA 4ES1A 1F2GA 4DQSA 3M8ZA 4C6AA 4DV0J 2KTQA 2HNDB 3V81A 4GC6A 5KG2A 5DM6Q 1WTBA 2P9GA 3W61A 5L9XA 2VG5A 2EVZA 2C2RA 2IM2A 3KFWX 4OZ0A 1WKJA 2HRTA 1VRTA 4WKYA 5DGBA 2RT3A 1P27B 2YBVA 1GMWD 2VDHA 3SXLA 1BWVA 3E01B 1Q81T 2BOPA 3GILA 2YPZA 3NGSA 4OV6A 2GX8A 3QT5A 4MK8A 3EICA 4OYPA 1WDDA 2FHOB 3FDSA 5E5NA 2V5HG 2VFRA 4I56A 2AT1B 3I9ZA 4DL5A 1F9FA 2W4PA 4FYYB 2CXEA 3CJ0A 3MM8A 2NZCA 1S97A 1TUWA 4KPCA 2CQ3A 5AE2A 4ECVA 2PA8D 3K8WA 2U2FA 2GMLA 2DR5A 4RBTA 4LF4J 2MZRA 2BJ7A 3GIRA 1RT3B 3CF5Q 3MEEB 2JFDA 2UUWA 2ROPA 3RG6A 1CSJA 1S0NA 4P7VA 3ZZRA 1TP7A 3M32B 4OHZA 3JSMB 1A6LA 5IT4A 2ZWOA 1S9EA 4W98A 1RHMB 2VL1A 4K4YA 1H74A 1C2PA 4FPRA 3H0PA 2XY6A 4Y6IA 3ILJA 2M9KA 1NHVA 2C2DA 4O3RA 4FPIA 3GJRB 4IH6A 1NJYA 4ZVQB 3QT7A 3UN3A 4NLSA 3T1YF 2QJ3A 2VQEF 5JJBA 3HMJG 2CZ4A 1RT1B 2M8HA 4CM0A 2HYIB 3D67A 2W2PP 3D6MB 1B70B 3BKTA 3M8YA 4TY8A 5I4MA 3JQJA 3J80Y 1YKWA 2IC3A 2IVFB 2HS3A 1RHUB 3U02A 4NXNJ 4F3OA 3VGVA 3VVUA 1NJWA 1QVFR 2FD2A 3M9OB 2HQCA 4DI6A 4TQSA 2DXDA 3IFEA 5HMWA 3UVJB 2HMIA 1LK7A 1IKYB 4AL5A 4ITSA 2D3UA 4FKYA 1DTQA 3C16A 3QGPA 4CTAB 2W8KA 2FVCA 4JV1A 2G0CA 1MG7A 3VGSA 1XNRF 2IAJB 1CBKA 4WCEQ 1REGX 5KFEA 1S1TB 1OYDA 3J7ZT 3X1LB 1MLAA 4ZDNA 2GC8A 3UCGA 5KFQA 2VFUA 1T95A 2J5AA 1VI7A 3MPDA 1NDPA 4WBFA 4MKAA 1EQ0A 3GB0A 2VC0A 5HO4A 2WBMA 3BS9A 4GKJJ 3TARA 1S48A 5JVHQ 2J6UA 5B0BA 1FRLA 2BRLA 3HHLB 1OY9A 3W66A 1GTEA 3U1LA 5CCMA 5HBMA 1U0SA 2MKCA 3KK1A 1IBLJ 1IR2A 3IC1A 3U27A 2L9NA 2CNKB 3E2EA 4NLGA 4JI2F 1TVRB 3A1YG 4R8UA 3L7UA 3CCUS 4QWCA 4LF6J 2MKSA 3VZIA 3W8PA 3EPGA 1FXRA 2R8JA 3ZTQA 1YJWS 4UY85 1EHWA 1M5OC 4RZRA 2R7OA 3V6DB 3EYZA 5HQ8A 2J9EA 3GMGA 2OPPA 4Z2XA 2XY7A 2DGQA 2CQPA 3N6LA 2GJFA 4L73A 4LFAJ 5GMKa 5LMNF 4KHPJ 2Q43A 1G4CA 2NSBA 1R7IA 4Y28C 3H4DA 1MROB 3TVKA 1VGYA 5HMZA 2VKRA 4RL1A 1N36J 3ZZTA 3LWLA 3P5TL 3VQSA 1YZ6A 2ACYA 3PTWA 2Z2MA 1OIAA 2RIJA 4KV8B 3BM7A 3HM9A 4JI0F 1EP4B 4IG3B 3PNIA 2MDAA 3AD9C 3ZNJ1 1HHQA 2FC9A 3DNCA 1WC4A 1FJGJ 1H7WA 5ETTA 2KG1A 3DDIA 4A4JA 3LGNA 3GJSB 1Y3JA 2IY5B 4ED2A 1JQGA 4K5RA 3OTOJ 2AU0A 1N33F 3AQPA 3EXCX 3HSGA 2CA9A 4LF5F 3OTDA 4WXOA 4CZCA 1VBZA 1SH3A 1B0PA 1WI6A 4DR3F 1X5SA 4QQBA 4YY3J 2E66A 1UW9A 2MGZB 2XMUA 2CPZA 4RW9A 4H4MB 1UFKA 3TAMB 5E3RA 1X9MA 1URRA 7FDRA 3CJKA 1JLEB 4C0OC 3ADAC 3JTOA 3SEOA 5ETRA 4YB1P 2MZJA 1IM4A 4J91A 1KHWA 2KT2A 1VLOA 4AE5A 3HI9A 4C3MA 4WU3A 3CJRA 2MZTA 1VQYA 2XHWA 1QAYA 3A3NB 4DV1F 2VFVA 2AWZA 6FDRA 1S0MA 3VHQA 4HT7A 2CZVC 5L1JA 1RJJA 1GK8A 1FKPB 1RLCL 4ZVOB 1R8CA 3CMQA 3EVWA 1B99A 2FJXA 2DNOA 1HMVB 1EARA 4KC5A 2Z30B 2WW8A 1VCTA 4S0MA 4WFXA 2WVEA 2JC1A 1YI2S 5JXSA 4DR7F 1JLQB 4RU9A 1HHTP 4OI4A 5DG9A 4Y0FA 1SL1A 3KLIA 3G82B 1NH8A 1B64A 2E1MC 1G6BA 5KAKA 3QQCD 3I0SB 2ZBPA 2E1CA 1QAIA 2WONB 2ZHAA 3UWTA 3MM7B 1NHKL 1BWEA 1T9VA 2L9DA 1W2BR 2DNKA 2VDIA 3QIPB 4M5LA 1HNXF 4WIQA 2OPSB 4TY9A 2C42A 3TUZC 5A6WA 1WHXA 2YNGB 2PIIA 2KM8B 3PEHA 1E6VA 1VQLS 1PAUB 1FD8A 4QWDA 2O01C 2APOA 2KJVA 3I9V9 2M5YA 1RWKB 4J9SA 3GIMA 3ZZZA 5LOQA 2HAFA 4I2QA 3BDPA 2UXCJ 1V9OA 3I55S 3VAIA 4NYOA 2C2KB 1TUVA 2RQKA 2Z57B 2CJBA 1T3NA 4KGKA 2UVWA 3RBZA 3PACA 4M5HA 2MQLA 2NPFA 5LXRA 5KFOA 4DQPA 2WW4A 4D3GA 4V19J 3VTIA 1WI8A 2E29A 2L41A 2RRAA 4G3IA 1AB8A 1S1WB 2EC2A 2RMLA 4DSJA 2G0IA 3G86A 5B0GA 2ILYA 3KLFB 4ELUA 1MU2A 1G2EA 4IFYA 2J0SD 3DOLB 3KMQA 2IJNA 2P6SA 2W9BB 3FMWA 3RU0A 5A6PA 4RUCA 2CG4A 4WZQA 3TYTA 2RU3A 4C8OA 1X0FA 3IGNA 4XDCA 2MQMA 1O6XA 2XMTA 4YDDB 3AHPA 2HNZA 4MKYA 1CQNA 3AD8C 1U09A 2E7VA 2MY8A 1Q53A 3N0VA 1PILA 1S1UB 3I0RA 2DHHA 3TA0A 4B17A 2DRBA 3NRBA 4ER8A 1XMOF 1REVB 4DS5A 1LFWA 4ICLA 3BSAA 1WKKA 4F7VA 2B7CB 4B3OB 2AEJA 2I38A 5BJRA 4PWDA 3GCXP 3T6BA 4A8XA 3DM2B 2QLBB 1KEKA 2GJ2A 1FKAF 2F1FA 2DBBA 4P52A 4U96A 2CPXA 2CJ9A 1NNDA 2GGPB 2QL7B 2DVIA 3BR9A 3ZZUA 1JX4A 2HZAA 1N34F 2G1DA 5J2MA 1VC6A 1DRZA 3SV3A 4YOEA 3P45B 3JSBA 1S1VB 2DCLA 4B3TF 2XLJA 5KFZA 5HJYA 3CWJA 3QT8A 2CVEA 2C22A 2KT5A 2WVCA 2HNDA 2IBOA 2QN6B 3S6EA 1FESA 2AJFE 3LUYA 4QU7A 3D9BA 4U6PA 3OSPA 3MZIA 1RT4A 4E8UA 1RI7A 3AAWB 4ZITA 3AT1B 1BD6A 2WOMB 2CPJA 5IQQA 5DO2A 4ES3A 3AOCA 1R0BG 4MYUA 3ICLA 4CNYA 4A47A 4XDDA 2VPZB 3E01A 1HD0A 2B5JA 3MMCB 4IOCQ 2HFSA 1NKBA 4QYZK 3L09A 2RB7A 4B3SF 2L9WA 3K89A 2AGQA 1DQAA 3W2WB 1N5YB 2MY7A 5D4OA 3I87A 2DNRA 3TA1A 1CULA 2JFKA 1VQPS 2CJXB 3M8WA 3TWZA 4DPOA 1X31C 2QFIA 2H4WB 4NLPA 5J2QB 2M3DA 4JV0A 5KFPA 2XZTB 2AJ1A 3PHTA 4LF1A 5CQGA 4RLEA 2J9DA 4C3KA 2NQPA 3WHIA 2EFPA 4EZ9A 1RT3A 4X4PA 3MEEA 1S7HA 3B54A 2K2PA 5LMUJ 3GG0A 4ZCKA 3R5AA 4NA2A 3M32A 3NS5A 2HFNA 3JSMA 4OHXA 1JJCB 1JLFB 1IKXB 2VD3A 1Y00A 4PG4A 5B0AA 3BSNA 2AZ3A 4FXVA 3OR2B 5DG8A 1U24A 2KXNB 3MEGB 5KT7A 4PRFA 4FVMA 4I69A 4J9KA 2UUBF 3DXSX 2G4BA 1FJCA 1JLCB 3RRGA 2HFZA 4ZVTB 2N7CA 3J7Z5 1I5OB 5A0YB 1ZA2B 4MK7A 1RT1A 5HVGA 2DK2A 3OV7A 3Q89A 3BO3A 4OHWA 5KFIA 4Q44A 4DV7F 3D6FB 1BQXA 1SC4B 1LWXA 4K4ZA 5L46A 5ETPA 1CJKB 5DGAA 2RHQB 1R27B 3C6UB 4PG6A 3PIOQ 4DU7A 2V8GA 3UVJA 2V2KA 1PCAA 2DIUA 1IKYA 3NWRA 1CJUB 1HNIB 1ZTWA 4DV6F 3ISNC 3Q86A 5J2NB 1Y5IB 1UFWA 3VWSA 3GFYA 4CTAA 3TEGA 4NLXA 3J7YU 1NU4A 2PI5A 2QEXS 2HIQA 1HNWF 2V8PA 1S1TA 4CNZA 2HVDA 5BYSA 3VQTA 1KHVA 1Q4RA 4FYDA 5J1EB 5HAOA 1S72S 4RNNA 3P6YC 5KFCA 2VH7A 3SSSA 4DSLA 4JV2A 2E9TA 3GJTB 3H2UB 3PW5A 4RPFA 2X7IA 3JQKA 3UO0A 3HHLA 2M52A 1WF1A 2ZHOA 2YWHA 5GAGU 3KXDA 1HIYA 4USVA 2J9CA 2NXEA 3IR7B 1NZAA 4OYIA 3FRYA 1PKUA 4KHRA 4F50A 3Q8RB 1TVRA 5RUBA 1SVDA 1KBRA 3WIVA 2B4OA 3G2XA 4ALZA 4NEZA 4K4SA 4Z37A 2AYGA 1IBMF 1RAGB 3CD0A 4PG8A 3D4JA 2V50A 1X4BA 3AB2B 2VA3A 3DRSA 5A2QU 3T19A 4FS1A 3SYZA 4MIAA 3M2RB 4LF8J 4JUZA 2CYYA 4RJVA 1OJ4A 4U9RA 2PD1A 1CC7A 3V6DA 2H9ZA 1MMLA 5KT6A 1RWXB 1FNOA 4URGA 3GTYX 1ZPVA 5I3QA 3M7VA 1JK9B 1MROA 2BXJA 2I8EA 4HI2A 3DI6B 1C1CB 1R89A 1RGVA 1WJ9A 2NPIA 3TZXA 4F4AA 2NYHA 3NWGA 5CHCB 4EFAC 3C6TB 4KV8A 5L1LA 3W1YC 2E5LF 3ELHA 3MUTP 3MCOA 4DCJB 3IGVA 1EP4A 4IG3A 4PWWA 2HPUA 5GAHI 1BQMB 2LA6A 3CC2S 1L3VA 7FD1A 3QFWA 1RTJB 2OUGA 3MXHP 2UP1A 1DFDA 3K2YA 3HKZD 2D3OR 5F41A 4K2JA 3R27A 2AF6A 5D77A 4KFBA 3ILIA 3KOAA 1BXNA 4NL5A 2ZH5A 4URSA 3HCXA 1S0VA 2KZMA 3PR5B 1YK9A 3DLBA 3WIUA 2QIFA 4F36A 3W60A 3W9JA 5FD1A 1FWPA 2BE9B 1ACMB 1WORA 2VPXB 1AXQA 1NXIA 4ZVRB 2MGZA 4CM2A 1DAXA 3FSYA 3DDKA 1ZM9A 2KYZA 4F0MA 2LXUA 2NS1B 2QG9B 1FERA 1KRPA 3I56S 1JLEA 2E5IA 3O5TB 1AT1B 2Q6BA 3HHKA 1VR6A 3UDEA 5H9FJ 2MTLA 4X4QA 4DX6A 2W24A 5D15A 1HQEB 3MM5B 1RWWB 4ZN1A 2WSFC 1X4AA 3NCQA 1IUJA 4NA3A 1RADB 2Z56B 4X65F 4IH7A 1SJ3P 2RRNA 3LP1A 2MKIA 4CO4A 5ADZA 4DR1J 3G71S 4N77A 4USUA 3IWXA 3RB0A 3BZQA 2Q79A 4OHVA 4NLUA 2HVZA 1HW9A 1WELA 4MFBB 3A4TA 1FKPA 1M0SA 3IBWA 1S59A 5BXIA 2EK6A 1ZAVA 4N41A 2Y8WA 2FYXA 2R8IA 1TK5A 4O3SA 4X62J 4C0BA 4R5PB 2DGVA 1FO1A 1HA1A 5L39A 1MSWD 4C8KA 4DV5F 3TZWA 2FJVA 3HP6A 3G82A 2VHGA 1C4CA 5EUHA 2YY3A 3TX8A 3M6WA 2ZVIA 2N3LA 3I0SA 2CFXA 2WONA 1TR0A 2H5IB 2OFHX 2AMCB 4LF6F 2C3PA 3MM7A 3W65A 3QGHA 1WG5A 4R0JA 1PAEX 1Q16B 3W5XA 1HYSB 2FVQA 3QIPA 4N76A 3M8PA 4E0DA 3M30B 4EI2A 3BB5A 3CCJS 4BLGA 2YNGA 2A0FB 3CCZA 3BGFA 2QGFB 3LOUA 4LR7A 1Q0NA 5K8OA 1FHTA 3R5CA 2HHQA 4ZJLA 2HGNA 1NO8A 2UUCJ 3KMSA 1L5UA 4DPTA 2ZWPA 4IUFA 3EWGA 1YLXA 2WVFA 2GHVC 4Q2MA 4DUZJ 1GXLA 4EO8A 2X1FA 4NCAA 2DITA 4A8YA 5L1KA 4USMA 3KUEA 5A8RB 4P73A 4CH0S 4CO5A 1NB2A 4DR4J 3HZEA 1BE4A 2QMUB 2VQFF 4DV4J 2WVBA 1FRIA 3KLGB 1S1WA 4TLQA 2V6AA 2BV3A 4X4UA 1UWBB 3HHNB 3K5PA 3O2IA 3KLFA 1QSYA 3UN2A 2YH0A 3DOLA 4ZVUB 2I1RA 1WHVA 5EDWA 1X5OA 2W9BA 4M1KA 2FLPA 4YR3A 1HNVB 1YJUA 3HPOA 2HQGA 2Q3PA 2QE5A 4C4WA 2GW8A 2DH7A 4UZCA 3PKYA 4I67A 4DZ6A 4CLUA 2FJEB 4CT9A 2R8HA 3KHHA 2YNHB 3A12A 2H5JB 1S1UA 3TQEA 1RYRA 1W26A 3MMBB 4QOTA 1REVA 3FZBA 2CQ2A 1G1XA 2FLLA 2ASLA 5A2QY 3JS9A 4LSLA 4LBPA 3EZUA 4MYTA 4B3OA 1W7WA 1NK4A 2H65B 1K73T 2FZCB 1KQKA 3DM2A 3TVYA 2OI2A 2AQ4A 4WU2A 3IRXB 1DJ0A 3A8EA 2RILA 2CPHA 3CJQA 1RISA 1T9XA 2HWIA 5KFSA 3HHEA 4IQXA 3VAJA 1RCXB 1SUQB 2ZH7A 4I7FB 3SSRA 2GIQA 1AUDA 2KHDA 3S8SA 1AFJA 3H2VE 3B78A 2ACMA 1S1VA 1KR4A 1T9UA 1RKIA 2PA3A 4PG5A 1NK0A 2DGSA 4DR6F 3MM9B 2AW0A 2HS4A 4TN2A 3FEZA 2MHEA 4NA1A 1J27A 2JRSA 4QWEA 5ETNA 1PYOB 2WOMA 3FBEA 4IOBA 2CVIA 4A8MP 3NEKA 5DM7Q 1GX5A 4M5NA 1H2UX 3PCOB 3NGKA 4B9VA 5KFVA 1ZETA 2LMIA 4Q2LA 4KHMA 4B9TA 3WX4A 2KRRA 3MMCA 2GHPA 3ENAA 1K8AT 1VFJA 5J1NA 3TZYA 2CPIA 4K4VA 3W2WA 2MXYA 3GONA 1P1LA 1N5YA 1LWCB 4HTJA 3HD1A 1KOHA 1TKTB 2ZJRQ 1GX6A 1U1MA 5J2QA 1QJHA 3BSOA 2M2BA 4TU9A 1RB0A 2E9ZA 3QJJA 2OH2A 4C11B 3BREA 2C2EA 2YQ3A 5B0DA 1CEZA 3RB6A 1YWXA 4AL7A 1DBDA 1QM9A 2NREA 3NGTA 3HKWA 1RWVB 4K4TA 3B8HA 1HBNA 1JLFA 1IKXA 3H5UA 2B8PA 3MPVA 1IJFB 3G8QA 4DWIA 1TV6B 3OR2A 5K14A 2OD4A 3CULA 4K4XA 4LVOP 4DJBA 1KQFB 3W2VB 4B02A 1YGYA 5JMNA 1OY8A 2OLWA 1JLCA 2IRUA 4ZJOA 2LQ5A 3R6GB 4OJ3A 1HPZB 2VJUA 3HLUA 5A0YA 1CVJA 4YHHF 2PO4A 1U49A 1JIHA 1F0XA 4C8YA 4CWBA 4UZBA 2P2CB 1KNZA 3KJQB 3N6MA 2FHJA 2KVQE 3D1HA 1PG5B 2GHWA 4DLEA 3MFHA 4QIVA 1CJKA 1MWYA 1IM6A 3C6UA 2DH8A 1QDUB 4FXDA 1P6TA 3BV8A 4IH5A 1CS4B 3EZ5A 5B0FA 3F73A 1I3OB 3VAKA 2AGOA 2CDQA 3D0IE 3DYAB 1CJUA 1HNIA 2JLGA 4YFUA 4F4ZA 4PWUA 1MN7A 1FE0A 2DD8S 2V2VA 2X3DA 8ATCB 2X1AA 1JNZB 2Y1LB 5U47A 5HROB 4DFJA 2AZ1A 4L3NA 2Q6CA 2GVDB 5J1EA 2PMWA 5I42B 4ZPVR 4MKVA 4OX7A 4LREA 2Z58B 3VGUA 2VQEJ 1LWFB 4LVNP 1X7VA 3ZTSA 3QNWB 1PIEA 3FGVA 2QO3A 4RR5A 3RAXA 3W9IA 4BHQA 1J5EF 3F41A 3K17A 3QAEA 4TVAB 5IV3A 3F0NA 1W25A 5AXMA 2A2CA 4TNOA 5KFRA 5DZ7A 2JH3A 2A3JA 3O44A 3IG1B 3MMJA 2LYVA 4YN3B 5FIIA 1VC0A 1S9FA 5EWEA 1XNRJ 1JJ4A 1HWLA 3M2RA 1UFLA 4DBQA 1C1BB 1IR1A 4LMZA 1H2TZ 2HQDA 2UXDJ 2F7VA 2MZQA 3DFEA 3UW1A 4Y2IA 4G1QB 4DL4A 4NX9A 2K1RB 3OLAA 4IR9A 2KJWA 2EPIA 3CCES 4DXLA 1KFDA 2V8VA 1NHUA 3G6ES 3TO8A 1NPRA 3WQPA 5KOXA 5L38A 3V6KA 4OQJA 3DI6A 1C1CA 3VV2B 4F2RA 1GAOA 2GVZB 4IDKB 1GTHA 4Q7AA 2IM3A 4USJC 2F8MA 5ETLA 1RE1B 1S12A 4JI2J 3C6TA 3PV8A 1N8RT 1GXTA 1BQMA 4OLOA 2HGMA 2FGOA 1IWAA 4ZPDA 2HLTA 1RTJA 2V0NA 3DU5A 2VASA 2FY8A 3HVTB 1U1PA 3IN5A 2IYIA 1JLGB 1RSCA 1EZZB 2ZH6A 3MGJA 1VRUB 3MR6A 2HBZB 1ZTTA 2Q1LA 2B9EA 3QO9B 4JI7F 1BQNB 5LMNJ 4CLYA 5GADU 2NLWA 2NSCA 1NM2A 2R7RA 2DGTA 3KG1A 3MM8B 1CG2A 4MIBA 2RQ4A 3MCNA 4DUYF 1FXDA 5E33A 2RUGA 2QL9B 3AH6A 4JI0J 4C8MA 2K7JA 5LT5A 3KK2B 1HQEA 2AIRB 3MM5A 4DX8H 3QGGA 2R3VA 4DL7A 4Q8EA 1HW8A 1S9EB 1ZOTA 1XERA 4CO3A 2XNQA 4O0IA 4JI8F 3HF5A 2FB0A 3JXOA 5AE3A 3MCSA 2QFJA 5G4DA 1RU1A 1RTDB 1ZH5A 3Q8VA 1RBLA 1NJXA 4MFBA 1LW0B 4LF5J 3M2VA 1X4CA 4DR3J 5KFJA 4XO0A 5DLGA 3MECA 4TLRA 2W9AA 4R5PA 1B0VA 2VJVA 1PYSB 4KTQA 1KQGB 2OTJS 2CQ1A 2QT7A 5LM7E 1TTHB 1RBAA 4BCAA 4ZHRA 4OZLA 4OI1A 2PDAA 2CJKA 3LGMA 4I1TA 2KB2A 2RUSA 3N6NA 4USWA 4LF7F 3EJMA 5DETA 4MKBA 1K1SA 1HYSA 3W9HA 4OX9J 3E8OA 4JI3F 5FDLB 1BLUA 3C16B 3M30A 2E44A 3U1NA 3OHBA 2XMWA 4DV1J 5DDOC 5LSLA 4RBUA 5ETQA 2YWGA 1NK9A 4O3OA 3U7JA 2BQRA 3IXQA 2A6MA 2DR7A 3PYEA 1Q7LB 3T9ZA 2BMBA 3PFOA 3CSKA 3KG4A 1VQ4S 1O51A 3TQ1A 4DR7J 4JV5F 3NS6A 5A8RA 5F3TA 3R7SB 4X66F 4OYMA 3Q8UA 1T0TV 4ILLA 2LLZA 2D74B 3J7YI 3BPDA 3D5MA 2HHXA 3TUPA 1J2VA 4RX6A 3KLGA 1ZPWX 1YITS 1WEXA 2GA7A 1S6OA 2MB0B 1HNXJ 4QYZJ 5HL7Q 2PEHA 4CH7A 1VBKA 3GPAA 1Q8KA 1GMWA 3GLJA 2OPRB 2P9EA 1HNVA 5GAGI 1VBYA 2HS0A 3IRWP 1X4FA 4EGLA 2KI2A 2XQCA 2GAHC 2OTLS 2J7WA 3W5ZA 2YNHA 2UXBF 3BGUA 4BDPA 3MMBA 2ZVSA 2MQPA 2RVJA 4ZP7A 2ZOGA 3DRPB 2KFNA 3MD1A 3CJSA 2UVRA 3OXGA 1R6VA 1AZSB 2CWKA 1BHNA 4MMOA 2OPQA 3CDBA 4OMFG 2RSQA 2RH3A 2IPOB 3CO0P 3CCQS 2H1YA 3Q2TC 3CO9A 4DMZA 1SUQA 3OR1B 4I7FA 1U4BA 1I94F 3CCMS 4ZVPB 3SCKE 1SB6A 3H7HB 3GYXB 3H42A 1P9YA 5DDQC 5EX0A 4ZVEA 1ZAXA 4G65A 4H4KA 1VMBA 4Y00A 5B7WA 3Q8QB 2DNZA 2DR9A 2VOPA 3ZTRA 2N4DA 3PKMA 3MM9A 5F8IA 4X62F 3DRYA 1HWKA 4RW9B 5J1PA 3CD5A 1TMJA 1XMOJ 1F2HA 1NDLA 3FQKA 2ZUAA 4W90B 4CH1A 5I3PA 3GV7B 1UVJA 4O3QA 4OI0A 5E0OA 2ZH1A 1HARA 4P9SA 2KKHA 1YBTA 2MLYA 2O5DA 3TNVA 3N79A 1P1TA 1B0TA 4J9NA 1U7LA 3BQ1A 3H40A 3KUGA 1N34J 1LWCA 2C2ZB 2VPWB 2FZGB 2BOAA 3VF0B 3I32A 4AFFA 1TKTA 2G1HA 3T41A 1PJ6A 1PYTA 3VAHA 4B3TJ 1SJ4P 4JI1F 3HSZA 5CA5A 3R5GA 3IR6B 1I51B 3OL7A 3LH2S 4ZPTR 4C11A 2F4FA 2MKYA 1YHQS 1RUSA 2PSZA 2J7KA 5D0HA 1IBCB 2UU9F 1PJ5A 3AOBA 4P2FA 4K8RA 3BKUA 4G1PA 2OEKA 1VBXA 4O3PA 1CJVB 2WSCC 2YWEA 3CUNA 3BBBA 1NK7A 1SH2A 4NOHA 2GCFA 1UVNA 4KO0B 1V6HA 4ECYA 1PSDA 5KFYA 4NLYA 1TV6A 3TI0A 2CNLB 2ZZMA 2CJQA 5F8GA 2EFGA 3QYYA 2JL9A 1HI0P 4HHHA 3EGZA 4ECRA 2V67A 4K59A 1UPPA 3W2VA 4IFVB 3MUMP 5D3GB 1N48A 5F0UA 4B3SJ 1NB7A 2Z4PA 2JDJA 3U1MA 3GIJA 1MWZA 4RBVA 1D9DA 2KH9A 4ZCMA 4WJBA 5ETOA 3VAFA 2VZ9A 2RJZA 4ZIWA 2CQIA 4RW8B 4KH1B 4Q45A 4OZ3A 5HLFA 4B3RF 2BZ2A 3ETMA 4U7CA 3RAMA 2EBGA 3N01A 2JOQA 2DNPA 2X1BA 1U1LA 2RF2B 5AT1B 2DB1A 3EUNA 1FF2A 1CS4A 3DHWC 3IA0A 2VG7B 1FVQA 1DURA 1SJFA 1RTHB 5LJ5Y 3D6TB 2ZOMA 2VBWA 3DYAA 3L9ZA 4L75A 2MJNA 2GNKA 1SI9A 1KDNA 4PAAA 3MAHA 4F04B 1NEEA 2D41A 5IXUA 2OIHA 3DLKB 5HROA 1RLDA 3ZTPA 2HRYA 3NY0A 4QU6A 2GVDA 3UDLA 5I42A 1FJ7A 3BN7A 1ZM4A 1XR5A 1PO6A 4AYBD 1F1BB 4OZJA 3KLVA 1KTQA 4WFNQ 1LWFA 3T5HA 4P2XA 1YZ7A 3G87A 2MZ1A 1QSSA 1FRKA 3AA9A 3N28A 3CIZA 3GYGA 3M6VA 4DL6A 3QRPA 1KVJA 4RW7B 1KFSA 5LJ3Y 1RTIB 4P74A 3E3XA 5LL6d 5GVQA 3RTVA 1YJNS 3CMAS 1JLAB 4L6V3 2CG8A 1WG1A 4C8LA 3PHEA 1VJWA 2XEXA 3IG1A 4WFZA 4DV6J 5E7OB 1SXLA 2HVHA 1R31A 1KQSR 4EBEA 1Q1KA 4TYBA 4DFKA 1SL0A 1M1KT 3W63A 1HNWJ 3DOKA 5FLXU 1C1BA 1PC5A 1YVFA 2XGQA 5KFBA 2QLXA 4KIAA 3JQMA 3SCLE 4G1QA 2JHEA 3OXFA 2K1RA 2LQ8A 1X60A 3TZZA 1FFWB 2DY1A 4MH8A 1RK8A 4ECXA 1LW2A 4HR2A
chains in the Genus database with same CATH topology
2UXDJ 2KL8A 2UUBJ 4B3MJ 1IBLJ 5LMNJ 2UXBJ 4HHUA 3J81U 4DUZJ 2E5LJ 4NXNJ 4DV3J 5A2QU 3D3BJ 5LM7E 5LMUJ 1N34J 2UUAJ 4LF6J 4LF8J 4DR6J 5IWAJ 4RJVA 4X65J 1FJGJ 4X62J 2VQEJ 4K0KJ 5BR8J 2F4VJ 3R2DJ 4V1Ak 4DR2J 3J80U 4JV5J 2UXCJ 4B3TJ 1XNQJ 4JYAJ 1HNXJ 4LF4J 4AQYJ 4DR4J 4JI7J 4DV7J 1IBMJ 3OTOJ 4DV0J 4NXMJ 4JI6J 4X66J 4JI0J 4DV4J 4OX9J 4KYZA 1IBKJ 3T1YJ 4JI2J 4GKKJ 3J7AN 5AJ3J 2KVQE 4DV6J 3R2CJ 2ZM6J 4DV1J 4B3RJ 4YY3J 1N32J 1I94J 4LFCJ 4DUYJ 4LF9J 2MTLA 1HNWJ 4LFAJ 4JI1J 4LF7J 4JI5J 5FLXU 1XMOJ 4YHHJ 3T1HJ 4DV5J 4KHPJ 3D3CJ 1HR0J 3W1YC 4DR5J 4X64J 1XMQJ 2VQFJ 2HHHJ 4JI4J 3IMQJ 3JAMU 2MEWA 4JI3J 4LF5J 4GKJJ 4KY3A 4PWWA 1J5EJ 2MQ8A 5IT9U 4DR3J 4NEYA 1XNRJ 4DV2J 1HNZJ 2UU9J 1N36J 4DR1J 4JI8J 4DR7J 4LFBJ 2UUCJ 4NEZA 1N33J 4B3SJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD J;  2KL8 A;  2UUB J;  4B3M J;  1IBL J;  5LMN J;  2UXB J;  4HHU A;  3J81 U;  4DUZ J;  2E5L J;  4NXN J;  4DV3 J;  5A2Q U;  3D3B J;  5LM7 E;  5LMU J;  1N34 J;  2UUA J;  4LF6 J;  4LF8 J;  4DR6 J;  5IWA J;  4RJV A;  4X65 J;  1FJG J;  4X62 J;  2VQE J;  4K0K J;  5BR8 J;  2F4V J;  3R2D J;  4V1A k;  4DR2 J;  3J80 U;  4JV5 J;  2UXC J;  4B3T J;  1XNQ J;  4JYA J;  1HNX J;  4LF4 J;  4AQY J;  4DR4 J;  4JI7 J;  4DV7 J;  1IBM J;  3OTO J;  4DV0 J;  4NXM J;  4JI6 J;  4X66 J;  4JI0 J;  4DV4 J;  4OX9 J;  4KYZ A;  1IBK J;  3T1Y J;  4JI2 J;  4GKK J;  3J7A N;  5AJ3 J;  2KVQ E;  4DV6 J;  3R2C J;  2ZM6 J;  4DV1 J;  4B3R J;  4YY3 J;  1N32 J;  1I94 J;  4LFC J;  4DUY J;  4LF9 J;  2MTL A;  1HNW J;  4LFA J;  4JI1 J;  4LF7 J;  4JI5 J;  5FLX U;  1XMO J;  4YHH J;  3T1H J;  4DV5 J;  4KHP J;  3D3C J;  1HR0 J;  3W1Y C;  4DR5 J;  4X64 J;  1XMQ J;  2VQF J;  2HHH J;  4JI4 J;  3IMQ J;  3JAM U;  2MEW A;  4JI3 J;  4LF5 J;  4GKJ J;  4KY3 A;  4PWW A;  1J5E J;  2MQ8 A;  5IT9 U;  4DR3 J;  4NEY A;  1XNR J;  4DV2 J;  1HNZ J;  2UU9 J;  1N36 J;  4DR1 J;  4JI8 J;  4DR7 J;  4LFB J;  2UUC J;  4NEZ A;  1N33 J;  4B3S J; 
#chains in the Genus database with same CATH topology
 2K3K A;  4JI6 F;  1NJZ A;  2YKP A;  2GVZ A;  4IDK A;  2IHR 1;  4MAK A;  2W25 A;  2W2O P;  1NLK L;  4FNH A;  4QBU A;  2F4V J;  1RT4 B;  3UQS A;  5KT3 A;  4GC7 A;  1UJ5 A;  1FDB A;  1HLW A;  2I2Y A;  4F4Y A;  3T1H F;  1IBM J;  1X4D A;  4IQM A;  5HP1 B;  1XN9 A;  2XMM A;  3MPY A;  1RHR B;  3HVT A;  2Y1R I;  2B5J B;  3UNY A;  2VKZ G;  1JLG A;  5EWF A;  1HBM B;  2CKW A;  3NBP A;  3OBI A;  1VRU A;  3MPW A;  3RGI A;  1Y3K A;  1RA7 A;  5AE1 A;  3QO9 A;  1LK5 A;  1H7X A;  5C25 B;  4QIF A;  1BQN A;  1TKX B;  1UET A;  1CUL B;  2QMW A;  1KON A;  4PPD A;  4AND A;  1OQ6 A;  3ENW A;  1EET A;  1YBU A;  4KAI A;  2FHM A;  5KFM A;  2DGU A;  3K0J A;  1TL7 B;  1NCL A;  2VBY A;  1N54 B;  1VQ9 S;  2DPI A;  2E5L J;  3MF5 A;  3KK2 A;  2AEM A;  3WBZ A;  1Y10 A;  4OIX A;  3GJQ B;  5IFM A;  5A8W B;  1IJE B;  5K8P A;  2FVS A;  1O0P A;  1UP1 A;  2DRA A;  4M95 A;  4X64 F;  4Y2K A;  3NNH A;  1RTD A;  4JP8 A;  3ZZO A;  3OVS A;  1IQZ A;  4PCQ A;  5E3C A;  3C15 B;  4J37 A;  1AYE A;  1LW0 A;  4DV2 F;  2J0Q D;  4Y2C A;  3OL8 A;  2ATL A;  2VBZ A;  5F8L A;  3UFC X;  2HW3 A;  2OSQ A;  3IM9 A;  2OO4 A;  1LV5 A;  2CZ9 A;  1SIZ A;  2RAQ A;  2I5J B;  3OW2 R;  2MST A;  3D7S B;  2UUA F;  2AKW B;  3G6Y A;  2JJ4 D;  9RUB A;  1TL5 A;  2DH9 A;  2PMH A;  2H4Y B;  5K8M A;  4MK9 A;  4Y3C A;  2HHU A;  2DPJ A;  2PFD A;  1NME B;  4Z7Y A;  4XPE A;  1RZM A;  1GFW B;  3PRV A;  1WC5 A;  3CDA A;  3B4D A;  1D9F A;  5FDL A;  4UT4 A;  2HNY B;  4X65 J;  3AOA A;  5T41 A;  3H90 A;  4KRW A;  1KP6 A;  1OWX A;  1U26 A;  4CO0 A;  1QTN B;  3P96 A;  2QC3 A;  2EEY A;  4DPX A;  2ALZ A;  2IVM A;  1WWH A;  2D3Z A;  2UXD F;  4RNO A;  4N8O A;  2V68 A;  1S57 A;  2QLF B;  3HFK A;  4LJM A;  4FP9 A;  4ZCI A;  4B9L A;  1NAQ A;  4LFB F;  4WP8 A;  3CJT A;  2E7X A;  1UA1 A;  2B9W A;  3K59 A;  5KFA A;  3ISZ A;  4QJV A;  4DV5 J;  1WG4 A;  3NS7 B;  3GV8 B;  2N3O A;  2OEM A;  4DPY A;  3Q83 A;  1U45 A;  2HBY B;  4ZP8 A;  1ICE B;  1RBO B;  4J9L A;  3KG0 A;  4XPC A;  4HH1 A;  1GH8 A;  1C4A A;  1OPZ A;  5HVH A;  2LU2 A;  2ZBI A;  2XCP A;  4Q5V A;  5C2G A;  4F25 A;  4AQY F;  4CYU B;  2XMK A;  1S0O A;  4H4K C;  4WP3 A;  3B6B A;  1K0T A;  3NGR A;  3DRS B;  4B9U A;  2XZW A;  4GKK F;  1SL2 A;  1A0O B;  1DHM A;  3QT6 A;  2Z2Y B;  2VC1 A;  2QSW A;  4I6W A;  2ZM6 F;  2V8H A;  3WZ0 A;  2OPR A;  2M70 A;  2BJ3 A;  4KKO A;  4D3H A;  5MAO A;  3R5J B;  4X4V A;  2IJR A;  5CZV A;  2FHK A;  5IV4 A;  2G2Z A;  1T9Y A;  1UAW A;  1U1K A;  2P8I A;  4WYW A;  1FWL A;  2LDY A;  3IWN C;  5HAN A;  4C7Q A;  1TL1 A;  1QTM A;  4TU7 A;  4KE5 A;  4P71 A;  3JTP A;  4RNM A;  1ZYQ A;  2KZZ A;  3FCW A;  1M1G A;  3CDE A;  1VQO S;  4ED4 A;  2E9R X;  1HI1 A;  3MCM A;  1KVI A;  3JYT B;  3DRP A;  4Q0B B;  4ZK7 M;  3QLH B;  2IRY A;  1AZS A;  1J5O B;  2VQF J;  5CXT A;  3CCT A;  3MUV P;  3H25 A;  2V2Z A;  4AT1 B;  3ZTO A;  4PXD A;  3J81 Y;  4YUD A;  2Y1I A;  2B9Y A;  1UEU A;  1XK8 A;  1UCN A;  3OR1 A;  3FCV A;  2J0W A;  4ZKA A;  1KTV A;  3G96 A;  2HHS A;  4N56 A;  2A6O A;  4KFB B;  3QRQ A;  2OD6 A;  1KS2 A;  1BGX T;  4XK8 C;  2VB6 A;  4A8Q A;  3C14 B;  1M90 T;  3SI8 A;  2DGO A;  3OTB A;  2B56 A;  3R2D J;  4USK A;  4I0W A;  1IR0 A;  4UW2 A;  2JZ5 A;  1TZ0 A;  1CC8 A;  1U2C A;  5CYM B;  3TP2 A;  1FWK A;  1FFG B;  2EFO A;  3LAN A;  1AUS L;  3I5A A;  1TK0 A;  3SFU A;  2ZE2 B;  2FJA B;  3AJ2 A;  1YJV A;  5A8K B;  4F4K A;  1F5B A;  3DGV A;  4ELT A;  3H98 A;  4ID5 B;  2EXU A;  4CLP A;  3MAA B;  1Y11 A;  3CPW R;  3NOC A;  3L95 X;  4DCO B;  3JAM U;  4OX9 F;  3NGU A;  2KT3 A;  2XTJ P;  2YWW A;  3CC4 S;  3MR2 A;  3ZXW A;  1UL3 A;  2WBR A;  3LP1 B;  3QWU A;  2AD9 A;  4Y34 A;  4HLB A;  2BKN A;  4OV1 A;  3KTQ A;  4EU0 A;  3CCW A;  5GAE U;  3JSR A;  3Q2S C;  4LIR A;  3K57 A;  5T14 A;  2XBP A;  1P8G A;  3FRZ A;  3M6U A;  1VQ5 S;  2LXI A;  3THT A;  1JXV A;  3GG1 A;  4DR6 J;  4HT5 A;  4OX8 A;  4FYX B;  5HJX A;  2Q66 A;  5KT5 A;  4NLO A;  2V63 A;  4DCP B;  3KLE B;  2A2D A;  4ANC A;  4ED8 A;  1JJ2 R;  3OUY B;  1KKH A;  1CJV A;  4PKD B;  3V6J A;  1IVZ A;  1XMQ F;  4WXW A;  4KO0 A;  4DF8 A;  2EKN A;  4DL2 A;  3C46 A;  4ED1 A;  4PPZ A;  3I4H X;  4B9N A;  2ZJQ Q;  3CJ4 A;  3EVM A;  1X4E A;  3W8G A;  4IFV A;  3GR1 A;  1QLN A;  3ITH B;  1Z1Z A;  5D3G A;  4U8V A;  2ZC3 A;  2CQ4 A;  4UUX A;  3M8P B;  1U0H B;  4O23 A;  2R2R A;  3DLJ A;  3QAU A;  2CQB A;  4PUO B;  1SC6 A;  4RW8 A;  2N82 B;  2K06 A;  1WNE A;  2PGC A;  1SKS A;  1KOO A;  2BYC A;  2XI2 A;  5KFX A;  5KFN A;  5GME A;  4ZLL A;  1VJQ A;  3HK2 A;  2XSF A;  5B0E A;  2JWN A;  1S9G B;  2YNI B;  2RF2 A;  4HTI A;  3R6L B;  4QIW D;  2L3M A;  2VG7 A;  1N32 F;  4C98 A;  1RTH A;  1F9H A;  1TAQ A;  3K8V A;  1ELO A;  3FZ2 A;  1CJT B;  1DQ9 A;  4LR9 A;  4A8W A;  2ZH3 A;  2B4U A;  5EWG A;  2VIH A;  2CQ0 A;  4DR5 F;  4QYR A;  1WC1 A;  4ECQ A;  1NKC A;  3DHX A;  2W9C B;  1H2V Z;  3K5M A;  3DLK A;  4N47 A;  2ZZN A;  3HVR A;  1ZM2 A;  7AT1 B;  3QBC A;  2CAJ A;  1EAY C;  4RUA A;  1H0H B;  3JSY A;  2LDI A;  3NP5 A;  2J6T A;  1Q86 T;  2ZH8 A;  1B7F A;  5CD4 H;  4YHH J;  4LSZ B;  2IRX A;  2XNR A;  3OFF A;  4K7Q A;  4WPA A;  5DLF A;  2H51 B;  2JEF A;  2DHG A;  3FNN A;  4RW7 A;  3FUY A;  2B4V A;  4MTP A;  1OYE A;  1RTI A;  3GZ7 A;  4PXE A;  2JEI A;  2J9D E;  2WSE C;  3OL9 A;  2ZBC A;  1CPZ A;  4O0N A;  1JLA A;  3A8J A;  1Q8L A;  2HFU A;  3DMJ B;  1VC5 A;  4LSL B;  2X51 A;  3LPY A;  5F9N A;  1UVK A;  1WOO A;  3BQ0 A;  3S7R A;  4FXW A;  4X4T A;  5HVF A;  1C0T B;  3M1V B;  3D1O A;  3AB4 B;  4OYO A;  3D28 A;  4PR6 A;  1FDD A;  3A13 A;  5E41 A;  1RXO B;  3RB4 A;  4KPY A;  1T94 A;  1QUV A;  4H54 A;  1TU0 B;  2R2U A;  2KG0 A;  2BJ8 A;  2ILZ A;  3PJW A;  1B4S A;  2GO9 A;  1XR6 A;  1JNR B;  4ZJQ A;  1APS A;  5KFD A;  3GWC A;  2AJQ A;  2W2Q P;  1FEE A;  3NKY A;  3OPK A;  1WSV A;  1X8D A;  4QW8 A;  3MR3 A;  1J5E J;  4U67 Q;  5IWA F;  3BKF A;  1FRH A;  2W01 A;  2AJ2 A;  2DNH A;  2LEB A;  2D3O 1;  1XNQ F;  2W2N P;  2V2Q A;  1YIJ S;  1FI4 A;  5D4L A;  3KDN A;  4LQ9 A;  2FZK B;  2NR0 A;  4QIG A;  2ATC B;  3ETO A;  3DKD A;  4HH0 A;  2E1R A;  3A3O B;  2B3T B;  5HP1 A;  1A9N B;  3RYL A;  2LEC A;  3KYL A;  1FX4 A;  2U1A A;  1MNE A;  1K9M T;  3MMA A;  3J80 U;  3CME S;  1OQ3 A;  2R8G A;  2EFN A;  3KJF B;  1HBM A;  3C2P A;  2LXF A;  2BJ9 A;  3ENQ A;  2QMX A;  2HWH A;  5C25 A;  3RBE A;  5I3U B;  1TKX A;  3THP A;  4TYA A;  1HI8 A;  6FD1 A;  3KNA A;  2XG8 A;  4EWT A;  2V9K A;  1TL7 A;  3HVA A;  1AA1 B;  3FEX B;  2E5H A;  2J6S A;  3GFZ A;  2Y3Y A;  3SSQ A;  3VGT A;  2MYF A;  3BGO P;  3QJP A;  4FDF A;  2C3M A;  5ETV A;  2KHC A;  1HWJ A;  2N7Y A;  1VDH A;  3KKF A;  1BY9 A;  3SBM A;  4C8N A;  5KTQ A;  1HBN B;  2C2O B;  4UF4 A;  3OXL A;  4RNH A;  5A8W A;  1B3T A;  4F8R A;  2HHP A;  2LU1 A;  4LRA A;  5K14 B;  2RS2 A;  3DU6 A;  2HWT A;  5LSO A;  2R2T A;  3CDW A;  2J8A A;  1R8H A;  3HFZ B;  4DSE A;  3C15 A;  1YTY A;  1X4H A;  5L8R C;  1SV5 B;  1KN6 A;  1VQS A;  3SQG B;  4USH A;  5EX3 A;  4JI7 J;  4IR1 A;  4JI4 F;  1BMQ B;  1SJQ A;  1VQ7 S;  2LVW A;  2GQ2 A;  3PY8 A;  5KG4 A;  5E3Q A;  3R2C J;  1HWI A;  2I5J A;  3HUL A;  1OY6 A;  3GE9 A;  5B0C A;  3TUI C;  3DLH A;  3E51 A;  1GQE A;  1UVM A;  2MSS A;  1HD1 A;  3NL0 A;  2MLZ A;  3LP0 B;  3RJM B;  2AHO B;  4DUY J;  2FIU A;  4CRJ A;  1M1H A;  1WAC A;  1KWM A;  2ALY B;  5D8H B;  2DR6 A;  1FJE B;  1GMU A;  1ZBT A;  3CW2 C;  3UNG C;  3G8T A;  2LCW A;  1RHQ B;  1QSL A;  4ZVS B;  4FKX A;  3OD2 A;  2LKZ A;  4JI8 J;  2HNY A;  5IS2 A;  4NML A;  2XWY A;  2OMO A;  2VF3 A;  4Q43 A;  5CCL A;  3R7B B;  3MI7 X;  5K5M A;  2I9S A;  3BBC A;  1HL6 A;  1WD6 A;  3MOJ B;  4QPT A;  1FT8 A;  4IRC A;  1T8E A;  4O44 B;  1CQM A;  5KG1 A;  2I6W A;  4JBC A;  3UCZ P;  3PYD A;  2QZ8 A;  2QLJ B;  1URN A;  5HAT A;  2HEK A;  2RD5 C;  4NAS A;  5A76 A;  2N4C A;  1VQN S;  4N7T A;  2QTW A;  5CYJ A;  8AT1 B;  1YSJ A;  1U1N A;  3CE8 A;  1QAX A;  4BBY A;  2DT9 A;  2F4V F;  2ZBQ A;  2VUG A;  4B3M F;  4LF7 J;  2EKY A;  1DLO B;  4BWM A;  1S6U A;  2ROE A;  5EGY A;  4CYU A;  4F02 A;  2CRL A;  3MAQ A;  1QY7 A;  4JI3 J;  3FBF A;  2ZKU A;  4Y2A A;  3HO1 A;  5ETK A;  2PN6 A;  4UOH A;  4NEY A;  4KR0 B;  4YB6 A;  4C0H A;  5DG7 A;  2C2M B;  2GO8 A;  2W4D A;  3FSI A;  2ZD1 B;  4H4O B;  1EJ7 L;  1VK3 A;  2VFS A;  1EQM A;  1YJ9 S;  3J81 j;  4OZ1 A;  3P49 B;  4TXS A;  2QSF A;  4M5D B;  2R42 A;  2HK2 A;  1S49 A;  5KG3 A;  3BGR A;  2HSE B;  5D4N A;  3FC9 A;  2R8K A;  2ZNY A;  3RUB L;  3ZZP A;  1BC6 A;  4JV5 J;  2EWH A;  3QWP A;  1RAH B;  4HYK A;  2FVR A;  3JYT A;  4Q0B A;  3QLH A;  3N4W A;  4X66 J;  3B82 A;  2XO6 A;  3BEG B;  3CTR A;  1S76 D;  3CJ2 A;  2QA4 S;  2ZBR A;  4RO0 A;  3AXK A;  1J5O A;  4WYL A;  5F0W A;  1HNZ F;  9ATC B;  4ECZ A;  1E6Y B;  2EG2 A;  4F0K A;  4J90 A;  4BWJ A;  2BM0 A;  4NWB A;  1YDL A;  2MKJ A;  4J9R A;  2ASY A;  4LRF A;  2ZJP Q;  3LAK A;  4P72 A;  2RRB A;  4ZVH A;  3EGV A;  4YQW A;  4CCH A;  2Y9H A;  3I5C A;  2JLF A;  3C14 A;  2V8D A;  2KFY A;  2WB4 A;  3PG9 A;  3K58 A;  2FJW A;  2YKQ A;  2QA2 A;  3D66 A;  5CYM A;  3GIK A;  2UXB J;  4HAC B;  2AGP A;  5L1I A;  2XSJ A;  2F9D A;  3A8K A;  2ZE2 A;  5HQL A;  1QAJ A;  4FYV B;  1Z2L A;  2YWK A;  4ILR A;  4L3K A;  5A8K A;  4YR2 A;  4ID5 A;  3N9U C;  3MAA A;  4AUK A;  2FPH X;  1ZM3 A;  4FBU A;  4DU8 A;  2ADB A;  2RKI B;  4PXB A;  5MLC V;  3OHA A;  2BJ1 A;  1I94 J;  3EPI A;  1RAB B;  4RW4 B;  2XYP B;  3K5N A;  2EK1 A;  3LA0 A;  2YQ0 A;  4K50 A;  2RDI A;  3GCW P;  4WK3 A;  1N5Q A;  3M2V B;  3D2W A;  2Z2Z A;  2UUT A;  1OSD A;  4PAB A;  5EHH A;  3MR5 A;  3CXC R;  1FTR A;  1EX8 A;  1RT6 B;  3OFG A;  4A48 A;  3MEC B;  4LQ3 A;  4AXI A;  2D7S A;  3EVO A;  4OI3 A;  2C28 A;  1X4G A;  1S79 A;  3KLE A;  4LBH A;  3OUY A;  2ASJ A;  2BM1 A;  4P10 A;  4UQG A;  1FK9 B;  3G6V A;  2HVE A;  4ZHR B;  3O3L A;  2KYX A;  2QL5 B;  3VAM A;  3KJN B;  2HVI A;  1TL3 B;  1JJH A;  5CYQ B;  3ITH A;  4GVL A;  3DXB A;  1U0H A;  5G0R B;  3DRX A;  5KFU A;  3QSI A;  1SJ1 A;  3PW4 A;  4PUO A;  2KXF A;  3M8S A;  2W4C A;  2GFF A;  1T3O A;  4JI1 J;  2OHD A;  2B51 A;  4CLS A;  3VVT A;  4K4U A;  2QRR A;  1S9G A;  2YNI A;  2WCX A;  8RUC A;  2MZS A;  3BJY A;  2UU9 J;  5KG7 A;  1C0U B;  2FTR A;  3BBF A;  1Q5Y A;  4P6Q A;  2PMZ D;  1YRU A;  1CJT A;  1X9S A;  5IQ6 A;  5C42 B;  4FF3 A;  1RHK B;  1Q8I A;  2W9C A;  2NUU G;  5JUM A;  5C24 B;  1U1Q A;  3DLG B;  2V69 A;  2WAQ D;  1SC3 B;  4LF9 F;  1GNK A;  2EI5 A;  1JMT A;  1NZ8 A;  4C3L A;  4OYZ A;  4KYZ A;  1VRQ C;  4UQT A;  2CQC A;  2IJF A;  4NYP A;  3BH7 B;  4B3R J;  1LWE B;  5DQG A;  1NPP A;  4PXC A;  1HQ2 A;  2V34 A;  1FTC A;  2GV1 A;  3LP2 B;  1FVS A;  1TKD A;  1WOP A;  1HR0 J;  2YXL A;  3PRB A;  3GR0 A;  2AJ4 A;  4IG0 B;  4ECW A;  3DMJ A;  2LP4 A;  2MKK A;  2QA1 A;  5HMY A;  2XLI A;  2IM1 A;  4W92 B;  1F9E B;  2OPQ B;  4YDX A;  1C0T A;  3M1V A;  1OSC A;  3OFE A;  4N5S A;  1WHW A;  4GVB B;  1VYA A;  5DDP C;  4M5M A;  2D9O A;  3SMZ A;  3ZO7 A;  3FKB A;  3FVY A;  2DEJ A;  4ZLJ A;  4HHJ A;  2O66 A;  4O4G B;  2XGP A;  3HX9 A;  2VPY B;  5KT2 A;  4FF4 A;  4ETX A;  4I6Y A;  2YH1 A;  2KU7 A;  2G9O A;  2VFT A;  1DTT B;  5F8M A;  1FKO B;  2MMY A;  2BDP A;  4KBI A;  2DRD A;  3VAL A;  3W7B A;  5B08 A;  3H5Y A;  2DCU B;  3TOQ A;  4ZIV A;  1IQT A;  1D0E A;  1Q79 A;  2C2N A;  3T3F A;  2G2O A;  1Z2Z A;  4GMK A;  3C66 A;  2PFF B;  4DF4 A;  1KLM B;  2PT0 A;  5F8N A;  2HG4 A;  2BA9 A;  5AXN A;  1GXU A;  4KJI A;  2K8G A;  2FY1 A;  3FK4 A;  1Q5V A;  3SIP B;  2BJD A;  1N5V A;  2ZOF A;  4UST A;  4IRK A;  2NXN A;  4DHV A;  3V6H A;  4KB7 A;  1Y5L B;  2RNE A;  2K7K A;  2RDJ A;  1NUE A;  3OLB A;  1T9T A;  1UZH A;  2QX0 A;  5I3U A;  5D0G A;  4LFC F;  1RHJ B;  1U47 A;  2F5G A;  2DNN A;  1G3O A;  1N0V C;  2LQ9 A;  2PC6 A;  4CLT A;  5CD4 A;  4JI6 J;  3PM9 A;  1S4E A;  4CLK A;  3KLH B;  4N8N A;  4G1I A;  1XBW A;  4HL9 A;  3ULH A;  1NK6 A;  3Q23 A;  1VLY A;  4WK1 A;  1U1O A;  3T1H J;  1S99 A;  2DYA A;  2PEB A;  2M4M A;  1W2I A;  4X4R A;  4NI2 B;  1RT5 B;  4WP9 A;  3IAM 9;  2FJB B;  3KWM A;  2P5V A;  4Y65 A;  1IWG A;  2LQB A;  3T5L A;  5GAE I;  2YKM B;  2DXE A;  2HQI A;  4DR2 F;  2BQU A;  4JYA F;  3I6P A;  3V5R A;  4RNF A;  3HHL C;  4FS2 A;  1YJR A;  2E5J A;  1SV5 A;  2YKN B;  1D8Y A;  3SQG A;  3QPI A;  4L74 A;  4HEA 9;  3EDR B;  3O1L A;  1L3S A;  1IBK F;  2G0J A;  2BJE A;  1PBU A;  4EK2 A;  5HQM A;  5HLF B;  3IR5 B;  1IN0 A;  5AXK A;  3BO4 A;  3HJF A;  1R6Y A;  4NCG B;  3LP0 A;  2ZH4 A;  2MQO A;  3PYF A;  1TMM A;  3V4I B;  3MM6 B;  5IZH A;  2FQQ B;  4A8O A;  1XC9 A;  2FDN A;  1HBO B;  1FXL A;  3TJ8 A;  3UDC A;  4P2S A;  3AOD A;  4YS2 A;  3UD5 A;  1SPB P;  1EB0 A;  1Q82 T;  4X64 J;  2CQD A;  2CIM A;  2WB1 D;  1R8A A;  1YG0 A;  3CIM A;  2CQH A;  4CI0 B;  4DV2 J;  2O1P A;  3R8Y A;  3KUH A;  4O44 A;  2GMH A;  1VHI A;  1EKR A;  3IBC B;  3SCJ E;  2R9L A;  3P3D A;  1RAI B;  1UJ4 A;  4ANE A;  2ZDO A;  4WFB Q;  1K1Q A;  3K7R A;  3NCR A;  2UUA J;  3NCP A;  3MWB A;  2HGL A;  1UJ6 A;  3QZ8 A;  4F67 A;  2BE2 B;  3JTN A;  2IDE A;  2L08 A;  2VV5 A;  2QYC A;  4QW9 A;  1M5P C;  1DLO A;  2AYB A;  5HSP A;  4WWS A;  1LXJ A;  2KN4 A;  1V5I B;  3A8I A;  2M7S A;  4X4O A;  4OFZ A;  2IBK A;  4PEO A;  3G6X A;  1S10 A;  3IS9 B;  1U1R A;  2JEG A;  3OVB A;  4NPO A;  3DOK B;  2ZD1 A;  4H4O A;  1LEO A;  1A7G E;  3RRH A;  2O67 A;  5B09 A;  4ERD A;  1FNM A;  2MEW A;  3ISN D;  2OEL A;  2F40 A;  4M5D A;  4J9Q A;  4K0K F;  1RAE B;  3CDU A;  1UTA A;  1S6P B;  1IXK A;  1X0P A;  3PX6 A;  4LFB J;  4IO1 A;  1LW2 B;  3KK3 B;  4DQQ A;  3KJV B;  1U6B A;  4KSE B;  3TJA A;  4UTG A;  4M5G A;  2QLW A;  2HKE A;  2WVD A;  5AJ3 F;  4W4M A;  4A8K A;  3FFI B;  2P9C A;  4NLD A;  4OJH A;  1U25 A;  2VG6 B;  3W64 A;  1EIY B;  2P6T A;  2XO7 A;  3UR0 A;  1E6Y A;  3AA8 A;  3HSJ A;  3FQL A;  1D8Z A;  2CJY B;  4AQY J;  2ADC A;  1VIS A;  4NLR A;  3HXM A;  1I6J A;  1RCO B;  3OJS A;  1RWO B;  1UVL A;  2HHV A;  3AY0 A;  2XWX A;  4GKK J;  4FZV A;  2KDO A;  3PRD A;  1WF2 A;  1T02 A;  2IDL A;  2ZM6 J;  1RAA B;  3NBP B;  1F6T A;  1F3V A;  3GSD A;  3CCR S;  1T05 B;  5L9N A;  3QRR A;  4DV3 F;  4WF9 Q;  3I82 A;  3H2L A;  4OZ5 A;  2DGX A;  4K2X A;  4DN0 A;  4HAC A;  5BR8 F;  2YKO A;  1X5T A;  1EET B;  1XWL A;  4HI1 A;  4ZPC A;  3QZ7 A;  3TA2 A;  3BPS P;  1UMJ A;  4NRU A;  2B6A B;  2RDD A;  3R1H A;  4F3Q A;  4NLV A;  1S1X B;  2B9X A;  3SFG A;  2PI4 A;  2FVP A;  2KM8 C;  3EM1 A;  2YPY A;  1V3R A;  4DG1 B;  3ENV A;  2A18 A;  2AYE A;  2IA0 A;  4YB7 A;  5IC6 B;  3M4X A;  2RKI A;  4QR1 A;  4LF2 A;  1LOU A;  4ES2 A;  5H9E K;  2HHW A;  3IBF B;  3NGD A;  4RW4 A;  3SDE B;  1SH0 A;  1VHF A;  3DC2 A;  1JB0 C;  1WC0 A;  2MQQ A;  4C97 A;  3QMQ A;  2IAJ A;  4CO2 A;  1H72 C;  3PJ9 A;  2BRK A;  4A46 A;  2M88 A;  3C8Y A;  2B7B B;  3PJX A;  3MFI A;  1RT6 A;  2R7Q A;  4NLW A;  5F9L A;  4V19 X;  1SJR A;  2GAG C;  3WDO A;  4DDF A;  2CAD A;  2IFX A;  1DZ5 A;  4UOC A;  3POT B;  1FK9 A;  1PGZ A;  1WUU A;  3M8Q B;  3M6X A;  3P8B B;  2KXH A;  2X3G A;  2WTF A;  4ED0 A;  4OJG A;  4DV0 F;  3FEY B;  1FEH A;  2AJ0 A;  4ZVG A;  4PQU B;  1SQF A;  1TL3 A;  2HUR A;  5CYQ A;  3Q24 A;  4USI A;  3ILL A;  3BYP A;  5BYR A;  3T5J A;  4ZA1 A;  1TAU A;  2J8S A;  5G0R A;  2X1G A;  1L3K A;  4A8F A;  1TKZ B;  3EX7 B;  4U8Y A;  4NXM J;  4ENO A;  3I4P A;  3IWL A;  3R1L A;  2ZUG A;  2F65 A;  2XM3 A;  3Q8Y A;  4EZ6 A;  1XEZ A;  1KC8 T;  2AYM A;  1ZZN A;  4LRC A;  3M9N B;  1XTZ A;  1N6Q B;  2UV8 G;  4JI5 J;  1C0U A;  1OMS A;  2BW2 A;  4OLP A;  1G7C B;  1F5C A;  3HT0 A;  4DEZ A;  1XMQ J;  4ED5 A;  4ECU A;  3ZC4 A;  2ZH2 A;  2KO1 A;  4PQA A;  5C42 A;  2I0X A;  1TFW A;  3G8S A;  2BX6 A;  2JLE A;  3BF4 A;  5C24 A;  4BC7 A;  1FX2 A;  3DLG A;  4LF4 F;  1RAO A;  3UD3 P;  3QJL A;  4LSN B;  4IKA A;  4EO6 A;  2EFV A;  3OSN A;  4FNI A;  2R7S A;  5CZX A;  4KKO B;  3CCS S;  4B08 A;  3CCV S;  4WTO B;  3M9M B;  4ILM A;  4DS4 A;  1LWE A;  1VIX A;  4PYA A;  1P9Q C;  2GIR A;  1NDC A;  2Z2L A;  1TL1 B;  3LP2 A;  4QR0 A;  1VS3 A;  3PYG A;  3EMT A;  3ZZY A;  3ONQ A;  3AFG A;  4TQR A;  4IG0 A;  1R43 A;  1GMV A;  4X4S A;  4EMD A;  3UPF A;  3DN9 A;  1N32 J;  1XQI A;  4F0H A;  4H4M A;  1H73 A;  3TAM A;  1LQ9 A;  2IA6 A;  2W7A A;  3MEK A;  2W1B A;  2AP6 A;  4DR5 J;  1V3Z A;  4NXN F;  2HHH J;  2K3I A;  2EG1 A;  1QD1 A;  2DKO B;  1FA0 A;  5FJ4 A;  4GVB A;  2IM0 A;  2OFG X;  1O8B A;  3PVX A;  2ZH9 A;  2A10 A;  1FDA A;  3K5O A;  2HRU A;  4O4G A;  1WEY A;  1RQ0 A;  3H4B A;  4JB8 B;  4ELV A;  1S4F A;  4YEA A;  4X4N A;  4IRD A;  1HQU B;  2DHA A;  4KGM A;  1DTT A;  2LA4 A;  1FKO A;  4DPW A;  1YX2 A;  2LEA A;  2MKH A;  2EW9 A;  1Y4Z B;  3ZZ0 A;  2RU9 A;  3TW0 A;  1HMV A;  4GKJ F;  5LXY A;  1ZAW A;  2H5E A;  4UOF A;  1NBE B;  2DHS A;  1Q78 A;  3R7N B;  3F44 A;  1KLM A;  1JXE A;  5IM0 B;  1JLQ A;  1NJI T;  3LAM A;  5CAB A;  5KG5 A;  1IBL F;  3HVW A;  2ZHB A;  2QA4 G;  3BQ2 A;  1NRK A;  3QID A;  5M2P A;  4PZV A;  4PYD A;  5T7L B;  4ZLP A;  4CLZ A;  2VA2 A;  4KQZ A;  3RW7 A;  5IT9 U;  5BYQ A;  2VIC A;  4ZMM A;  4R25 A;  1K0V A;  2Y0S D;  2CDR B;  2OPS A;  2RE1 A;  5KFH A;  2ZIT A;  4DFP A;  3MPU B;  4FVC A;  3I96 A;  1ULR A;  2NCK L;  3BH6 B;  4ATN A;  2R7X A;  4M5J A;  2MJU A;  2YX1 A;  3OT9 A;  2R7T A;  3MED B;  2OSR A;  5IWA J;  1RT7 B;  3KLH A;  4C8Z A;  2V4R A;  4QCL A;  3FCH A;  4BC9 A;  1M5V C;  1XNQ J;  1CLF A;  3OTC A;  4LFA F;  4KHP F;  1D9A A;  5J2P B;  1ZS6 A;  4ZOS A;  2HBR B;  4YB5 A;  4ZPW R;  3D68 A;  4O4R A;  3CJ8 A;  3BDE A;  3C3L A;  3J7A N;  3ZFV A;  4NI2 A;  1RT5 A;  4WZM A;  3BR8 A;  4GRS A;  1N36 F;  4LBI A;  2W8L A;  2BKP A;  1WC3 A;  2YKM A;  3ET6 B;  1QE1 B;  4UOG A;  5KFK A;  1TK8 A;  3R3T A;  3VAG A;  5HN0 A;  1XJW B;  3H5S A;  4XTT A;  3F56 A;  2YKN A;  3PW7 A;  1OO0 B;  3D6H B;  5IC4 B;  3UCU P;  2DR8 A;  4ZPA A;  1HKA A;  1FJG F;  3CCL S;  1UW4 A;  4WFY A;  4F4X A;  2IMO A;  4J9U E;  1MW7 A;  3OJU A;  1UEV A;  2ERR A;  2FUG 9;  3QSY B;  5DJB A;  4E2F B;  3OTO F;  1U48 A;  2G13 A;  1YRT A;  2YVS A;  4CIO A;  4G6V B;  4TU8 A;  2BE7 D;  2OP5 A;  4NCG A;  3AJD A;  4F2S A;  1HR0 F;  2NXC A;  3FJ2 A;  3V4I A;  3MM6 A;  3NLC A;  5K8N A;  4YY3 F;  5DQH A;  2COL A;  3CJ3 A;  2RQM A;  4KGX B;  3TAQ A;  1GEH A;  1HHS A;  3AD7 C;  3DRR B;  5K9F A;  1HBO A;  4OZ2 A;  1RAC B;  4NE9 C;  2MHN A;  1U2R A;  1YQH A;  2IYG A;  4DX7 A;  1T9W A;  2HFV A;  2XCA A;  3O8W A;  1NKE A;  2DHX A;  2LFV A;  3D54 A;  3KHG A;  4X2B A;  1SBR A;  3K5L A;  2GGP A;  3W5Y A;  1M5S A;  2DO4 A;  3GU0 A;  4I64 A;  4JI4 J;  2YTC A;  2CNN B;  1K44 A;  3VZH A;  2R4F A;  3CVK A;  5GMD A;  2VBX A;  2EFQ A;  4DSK A;  1ARO P;  5CAA A;  1NSQ A;  5KFF A;  3HHL D;  4DN9 A;  2J76 E;  5K20 B;  4AD6 A;  3DLE B;  2BE2 A;  1NSK L;  3EE3 A;  3VR1 A;  2BVZ A;  3TAP A;  4FYW B;  2AX0 A;  4IO9 Q;  1MMD A;  4KH0 B;  1S77 D;  4XIU A;  2FLN A;  4U7U K;  2WRM A;  1NDK A;  3D0G E;  1SCJ B;  3Q8S B;  2V4Q A;  3RB3 A;  1VQ6 S;  2D1C A;  1LKZ A;  4OYB A;  1VQ8 S;  4F3M A;  3IS9 A;  4Y2M A;  2R7U A;  1OPI A;  3RBX A;  3RRK A;  4URQ U;  1RTZ A;  5F3Z A;  2DNG A;  2HBQ B;  2AX1 A;  3TEH B;  4QR2 A;  1S7I A;  4EBD A;  1S6P A;  2G2Y A;  3GP9 A;  3DGP B;  2NXU A;  4WE1 B;  4QPX A;  3TUJ C;  3EXY A;  3KK3 A;  3KJV A;  5SZT A;  1WKL A;  2OEJ A;  3FFI A;  2ABY A;  4C9D A;  2UXC F;  3R97 A;  1B7Y B;  2VG6 A;  2F9J A;  4B3M J;  3P4U B;  2BR0 A;  4RW6 B;  3ZNU A;  2DTJ A;  3V4M A;  1S5Z A;  1PC4 A;  2XLK A;  2V4J B;  3DLL Q;  1SQG A;  3WX8 A;  3R5D A;  2GZO A;  3MDF A;  3T6J A;  3MMA B;  2J7U A;  4NLQ A;  4ZVF A;  2YX4 A;  4OZN A;  1Y5N B;  4QWA A;  3PFE A;  3IM8 A;  3NMA A;  5HI7 A;  1JLB B;  3MEG A;  2NXJ A;  1R8P A;  1VK8 A;  1O5J A;  2B8Q A;  3LPE A;  1V3S A;  1T05 A;  3UDV A;  2RS8 A;  2H48 B;  4DZD A;  3R9L A;  1N5S A;  5ETM A;  2GQC A;  1RT2 B;  3W3S A;  1RDR A;  1XIQ A;  3QGI A;  4MIW A;  4FN5 A;  2BUN A;  4CT8 A;  4J7C A;  3KNG A;  4U95 A;  2B6A A;  1T03 B;  4LRD A;  2XS7 A;  1Y7P A;  2JSX A;  3IMQ J;  1MMN A;  2YNF B;  3KHR A;  1S1X A;  1NK8 A;  4ECT A;  1HWU A;  5IT9 Y;  4NYZ A;  1HNZ J;  4IOA Q;  4DG1 A;  1WTF A;  4I6A A;  2JC0 A;  1S6Q B;  4PG7 A;  3UN5 A;  1UZD A;  2NYI A;  1R0A B;  3LAL A;  3CED A;  3L3C A;  3THV A;  2CPY A;  2DEI A;  1BUX A;  3GSI A;  4I2P B;  2JX2 A;  2J0X A;  3SDE A;  1Q8B A;  5J2N A;  1YJT A;  5KG6 A;  2XI3 A;  2V94 A;  1XMB A;  3RR8 A;  1HBU B;  3OVA A;  3TVZ A;  2XHC A;  1ZZF A;  5KFW A;  5F8H A;  1U8S A;  5C2C A;  2FJD B;  2DNQ A;  4L76 A;  4EYH B;  3T1Y J;  4CLF A;  2BEF A;  3PO5 A;  2CPF A;  3J7A 1;  1N4L A;  4NZ0 A;  2OML A;  2JEJ A;  1NPK A;  3POT A;  5IT0 A;  4WKR A;  3M8Q A;  4DX5 A;  1FRM A;  1MN9 A;  5JVG Q;  2BBE A;  3O6Q A;  3DDN A;  2DNL A;  3D3C J;  2NUH A;  3I31 A;  4PQU A;  1JKH B;  4UUW A;  2F8E X;  1VQM S;  1IKW B;  1LXN A;  4B9M A;  1U02 A;  4CDI A;  3CGI A;  3V2U C;  4LUB A;  4IYQ A;  4J9V A;  1IKV B;  1TKZ A;  2ZFH A;  4RWW A;  2UVU A;  3PXG a;  1RU2 A;  1GT8 A;  4CQ1 A;  1TL4 A;  3LTO A;  2R7V A;  1YJ7 A;  5LSR A;  2YWF A;  3M2U B;  2F8H A;  3AXM A;  4E98 A;  5M2R A;  1RWM B;  3HHD A;  1UA0 A;  3TJ9 A;  4RU2 A;  2YKA A;  4OYX A;  3PO4 A;  1N6Q A;  2B0G A;  3GV5 B;  3OQ2 A;  3Q0A A;  1TUG B;  3DOM B;  3NAI A;  2BAN B;  4M8L A;  5KT4 A;  2GQQ A;  3KHL A;  1LFP A;  4Z7C A;  3LF0 A;  1FNX H;  2XMV A;  4J9O A;  5DDR C;  2DNM A;  3GYN A;  2AEF A;  2ZEJ A;  4ED6 A;  3V81 B;  2DIS A;  2BW7 A;  4B9S A;  4DOZ A;  1RA6 A;  3EZO A;  2MLX A;  4P7T A;  4M94 A;  1V5V A;  5E3P A;  2VG5 B;  5LMU F;  4GO7 X;  4NCB A;  2JVR A;  2MQN A;  3RZA A;  2M8D B;  4LSN A;  3PX4 A;  1VRT B;  2XZD B;  1FDN A;  3NMR A;  3S1T A;  2QYG A;  4NRT A;  2KL8 A;  4HVZ A;  1M5H A;  1F3F A;  4HHU A;  1EKS A;  1Q7Y T;  2VOO A;  3D3B J;  1RYS A;  3G4S S;  4FF1 A;  2EBE A;  3BGR B;  3NNC A;  4FBT A;  1FCA A;  4V1A k;  3FBB A;  4NZ7 A;  4HKQ A;  1D3W A;  1QVG R;  4ID8 A;  1RAF B;  2VOD A;  3HZG A;  1N88 A;  3RW6 A;  4ZS6 A;  1F60 B;  2DXF A;  3UD4 P;  2XB2 D;  5KFL A;  3L7P A;  5FLX Y;  5F8J A;  1R8B A;  1RWU A;  4FF2 A;  2R7W A;  4DQI A;  4R0E A;  3OTE A;  1R3N A;  2POK A;  5KG0 A;  4LF9 J;  4ZN3 A;  2XMJ A;  2OKQ A;  1Z4U A;  1DY3 A;  2M0G B;  4RUH A;  2ZDP A;  3PEJ A;  3BO2 A;  4DPU A;  5C5J A;  2CQG A;  5HMX A;  1DQ8 A;  2O3D A;  2CUY A;  1HQU A;  1KVK A;  5DZ6 A;  3A3P B;  1TFY A;  1N33 J;  1UWA A;  2XYG B;  3IAS 9;  4F26 A;  2R2S A;  4CLL A;  3P5B P;  3NNA A;  2DGW A;  1UEK A;  3WC2 A;  3D0H E;  4L72 B;  3I5B A;  2XSJ B;  2A1B A;  2JNJ A;  3WC0 A;  2PE8 A;  4DSI A;  4TY8 B;  4EUV A;  3Q8P B;  3MUR P;  5IM0 A;  2IMW P;  2IC3 B;  1OS5 A;  1WEZ A;  1H6K X;  4WII A;  4X84 A;  4NMX A;  3HJV A;  2YQ1 A;  2H3E B;  1TEL A;  1T7P A;  1YRX A;  4LIW A;  3TX0 A;  1FRX A;  1WC6 A;  1YBA A;  4CO1 A;  5T7L A;  3MTJ A;  2B4P A;  2QV6 A;  4O3N A;  4EEY A;  4AXJ A;  4DLG A;  3HSD A;  1DAR A;  2HMI B;  4ZP6 A;  1SQE A;  1U2F A;  4QIE A;  4KGZ B;  5GAD I;  3UR3 C;  1ROF A;  1DTQ B;  3VCD A;  2HHT A;  4NXM F;  1MWQ A;  2Y8Y A;  3CD6 S;  3L7O A;  2C3Y A;  4LF8 F;  2Z0G A;  5M2U A;  1I1G A;  5KOW A;  2VON A;  3EGW B;  2ZC4 A;  4HDH A;  3MED A;  2DY9 A;  5THW A;  1RT7 A;  4KT0 C;  3SV4 A;  3CJ5 A;  4JI5 F;  1AFI A;  4OHY A;  3PR4 A;  5J2P A;  3H59 A;  3HFV A;  3SCI E;  3IO1 A;  2E1P A;  4OYW A;  3H5X A;  2BAC A;  5HBM B;  2HK3 A;  1K47 A;  3KK1 B;  3ET6 A;  1QE1 A;  2YX7 A;  1WSR A;  3T9N A;  3H20 A;  5C7P A;  3T5K A;  1SC1 B;  4Q8F A;  2AV5 A;  4R8U B;  5DQI A;  3MTK A;  2DIV A;  3DCA A;  3PIP Q;  1KSP A;  1UWB A;  5D0E A;  2HZV A;  4LFC J;  2Y0B B;  3M05 A;  4F4W A;  1FFS B;  2C3O A;  2EC0 A;  4U7U D;  2FHJ D;  2FLO A;  3QFH A;  3KDO A;  3BN4 A;  1U8W A;  1PBA A;  2MQ8 A;  2LQJ A;  3BGL A;  1H98 A;  2OPP B;  3R5B A;  4M5I A;  2ASD A;  1UKU A;  2LEP A;  2GJI A;  4LRB A;  1FRJ A;  2BAB A;  1U6F A;  1NK5 A;  1NSA A;  4C2M A;  2GIF A;  3D1Q A;  3DRR A;  4QWB A;  3AQO A;  1SKU B;  2KFZ A;  3MOZ A;  4HDG A;  5H1S V;  2HHH F;  4DQR A;  1WHY A;  2DO0 A;  1RWN B;  3RAQ A;  2HZC A;  1D09 B;  4DR2 J;  2KVI A;  2JVO A;  4JYA J;  3IRX A;  2H54 B;  4CP5 A;  1Q95 G;  4ZCL A;  3US5 A;  3MHY A;  3JB9 k;  3FMB A;  4JOU A;  4AL6 A;  1IBK J;  3QAT A;  3LW5 C;  2ZNZ A;  1M5K C;  4KGV B;  1FD2 A;  4DR1 F;  4UY8 T;  3TRG A;  1KLN A;  2W7O A;  4A8S A;  2FC8 A;  5D0R A;  4OX6 A;  4DL3 A;  3DLE A;  4ED3 A;  4DFM A;  3CB4 A;  2CWX A;  3MR7 A;  2W7P A;  1X5P A;  2IIH A;  5EN1 A;  4M63 A;  3CD7 A;  4ZPB A;  2W2M P;  1VQK S;  2ZKT A;  3RR7 A;  3CJK B;  2XUL A;  4K4W A;  5IOL A;  1RP5 A;  3OL6 A;  5H9E J;  5D78 A;  2L48 A;  1RKJ A;  2XY5 A;  4WFA Q;  3LQV A;  1LNQ A;  3GFH A;  1WOS A;  3NOG A;  4OYA A;  2CJA A;  4EYI B;  4J5O A;  5DRK A;  2OJ3 A;  2SXL A;  3DGP A;  4WE1 A;  3PW0 A;  2HLU A;  2IVY A;  4NLT A;  3PDN A;  1N52 B;  5D6G A;  1TQL A;  1U6Z A;  4J9P A;  4ED7 A;  2UUC F;  1Y0H A;  2V9W A;  1UVI A;  3FSX A;  3GFX A;  3HD2 A;  2OAU A;  4DUT A;  1NSP A;  4GO5 X;  2OGU A;  1VOM A;  4DUZ F;  1X9W A;  4OL8 A;  1RAJ A;  5DS7 A;  4RW6 A;  2WHO A;  1T11 A;  4OJ1 A;  2V4J A;  3PW2 A;  3KLI B;  3C19 A;  2CPD A;  5KFT A;  3HDS A;  2WK4 A;  5CH7 B;  4OI6 A;  2E1A A;  4DR4 F;  2HAI A;  5E3A A;  2E5G A;  2D69 A;  4DV4 F;  2XC9 A;  1SIW B;  3LGH A;  1JLB A;  1XR7 A;  2D9P A;  4J9M A;  1HFE L;  3BSC A;  1ITP A;  3MD3 A;  2RHS B;  3W62 A;  3LO3 A;  2F63 A;  4K0K J;  2WZ1 A;  4XAK A;  2B43 A;  1HPZ A;  1QUP A;  4TKT A;  1RT2 A;  5ITH A;  2Y1J A;  1E6V B;  3PX0 A;  3N5F A;  3M8R A;  5AXL A;  3SQO P;  2MPU A;  4RWX A;  1T03 A;  3CT9 A;  2XMA A;  5AJ3 J;  1SKR A;  2C3U A;  2NZ4 A;  2YNF A;  1H38 A;  3JAM Y;  4I2Q B;  2CPE A;  3TAN A;  1N5T A;  2GMJ A;  3IP0 A;  1S6Q A;  3AJ1 A;  1ZA1 B;  1Y9O A;  1R0A A;  4KY3 A;  5SUH A;  4C48 A;  4I2P A;  2FGC A;  2UV8 A;  2RQC A;  3N5B A;  1NH7 A;  3HT3 A;  1N56 A;  5H9F K;  2E7W A;  4CLW A;  3CC7 S;  1F5A A;  2BKO A;  4WTY A;  2XS5 A;  4LR8 A;  3T1A A;  2GS8 A;  4MT1 A;  1HBU A;  2CNO B;  2HIY A;  2XYH B;  5KFG A;  1PJ7 A;  2UUB J;  2ZZT A;  4YP3 A;  4BS2 A;  3B4M A;  4DV3 J;  2KRB A;  2XS2 A;  2F3J A;  3TR5 A;  3LWM A;  1N0U A;  4YME A;  5D4P A;  1MU2 B;  3NXZ A;  6AT1 B;  3GQC A;  4IFY B;  5BR8 J;  2HQ3 A;  3EDQ B;  2DJW A;  1R0C B;  5ETS A;  3L4B C;  4DV7 J;  4DSF A;  3FBC A;  1KD1 T;  3UI3 A;  3CNQ P;  2HNZ B;  1L3T A;  3S01 A;  1WF0 A;  2ROG A;  4LT6 A;  4RUB A;  3GII A;  3I0R B;  3PZP A;  4MJK A;  1JKH A;  2DNY A;  4ETZ A;  4NZ6 A;  4ZLN A;  1WDT A;  1IKW A;  3SZ2 A;  2UVV A;  2VU5 A;  4EBC A;  3X3U A;  2UZA A;  5HK4 A;  3UE2 A;  4YR0 A;  4ICL B;  2HQF A;  4DL0 C;  4I68 A;  4I4B A;  4M5K A;  1H3D A;  1IKV A;  3Q22 A;  4P75 A;  3NG8 A;  4PWD B;  1UPM B;  4OI2 A;  2C1E B;  3BYR A;  1RWP B;  3NAH A;  1SKW A;  1AW0 A;  5E2Q A;  1JXL A;  4K5S A;  1D1U A;  3M2U A;  3EGN A;  3ILO A;  1FE4 A;  3RBD A;  5GAH U;  1JWW A;  4ECS A;  3G9C A;  4P2M A;  3H8Y A;  4QZV B;  5J2M B;  3J81 U;  2Z8Q A;  1VIO A;  4ZP9 A;  3DOM A;  2BAN A;  3OFH A;  2BQ3 A;  2HFO A;  4RKU C;  1L3U A;  4ES1 A;  1F2G A;  4DQS A;  3M8Z A;  4C6A A;  4DV0 J;  2KTQ A;  2HND B;  3V81 A;  4GC6 A;  5KG2 A;  5DM6 Q;  1WTB A;  2P9G A;  3W61 A;  5L9X A;  2VG5 A;  2EVZ A;  2C2R A;  2IM2 A;  3KFW X;  4OZ0 A;  1WKJ A;  2HRT A;  1VRT A;  4WKY A;  5DGB A;  2RT3 A;  1P27 B;  2YBV A;  1GMW D;  2VDH A;  3SXL A;  1BWV A;  3E01 B;  1Q81 T;  2BOP A;  3GIL A;  2YPZ A;  3NGS A;  4OV6 A;  2GX8 A;  3QT5 A;  4MK8 A;  3EIC A;  4OYP A;  1WDD A;  2FHO B;  3FDS A;  5E5N A;  2V5H G;  2VFR A;  4I56 A;  2AT1 B;  3I9Z A;  4DL5 A;  1F9F A;  2W4P A;  4FYY B;  2CXE A;  3CJ0 A;  3MM8 A;  2NZC A;  1S97 A;  1TUW A;  4KPC A;  2CQ3 A;  5AE2 A;  4ECV A;  2PA8 D;  3K8W A;  2U2F A;  2GML A;  2DR5 A;  4RBT A;  4LF4 J;  2MZR A;  2BJ7 A;  3GIR A;  1RT3 B;  3CF5 Q;  3MEE B;  2JFD A;  2UUW A;  2ROP A;  3RG6 A;  1CSJ A;  1S0N A;  4P7V A;  3ZZR A;  1TP7 A;  3M32 B;  4OHZ A;  3JSM B;  1A6L A;  5IT4 A;  2ZWO A;  1S9E A;  4W98 A;  1RHM B;  2VL1 A;  4K4Y A;  1H74 A;  1C2P A;  4FPR A;  3H0P A;  2XY6 A;  4Y6I A;  3ILJ A;  2M9K A;  1NHV A;  2C2D A;  4O3R A;  4FPI A;  3GJR B;  4IH6 A;  1NJY A;  4ZVQ B;  3QT7 A;  3UN3 A;  4NLS A;  3T1Y F;  2QJ3 A;  2VQE F;  5JJB A;  3HMJ G;  2CZ4 A;  1RT1 B;  2M8H A;  4CM0 A;  2HYI B;  3D67 A;  2W2P P;  3D6M B;  1B70 B;  3BKT A;  3M8Y A;  4TY8 A;  5I4M A;  3JQJ A;  3J80 Y;  1YKW A;  2IC3 A;  2IVF B;  2HS3 A;  1RHU B;  3U02 A;  4NXN J;  4F3O A;  3VGV A;  3VVU A;  1NJW A;  1QVF R;  2FD2 A;  3M9O B;  2HQC A;  4DI6 A;  4TQS A;  2DXD A;  3IFE A;  5HMW A;  3UVJ B;  2HMI A;  1LK7 A;  1IKY B;  4AL5 A;  4ITS A;  2D3U A;  4FKY A;  1DTQ A;  3C16 A;  3QGP A;  4CTA B;  2W8K A;  2FVC A;  4JV1 A;  2G0C A;  1MG7 A;  3VGS A;  1XNR F;  2IAJ B;  1CBK A;  4WCE Q;  1REG X;  5KFE A;  1S1T B;  1OYD A;  3J7Z T;  3X1L B;  1MLA A;  4ZDN A;  2GC8 A;  3UCG A;  5KFQ A;  2VFU A;  1T95 A;  2J5A A;  1VI7 A;  3MPD A;  1NDP A;  4WBF A;  4MKA A;  1EQ0 A;  3GB0 A;  2VC0 A;  5HO4 A;  2WBM A;  3BS9 A;  4GKJ J;  3TAR A;  1S48 A;  5JVH Q;  2J6U A;  5B0B A;  1FRL A;  2BRL A;  3HHL B;  1OY9 A;  3W66 A;  1GTE A;  3U1L A;  5CCM A;  5HBM A;  1U0S A;  2MKC A;  3KK1 A;  1IBL J;  1IR2 A;  3IC1 A;  3U27 A;  2L9N A;  2CNK B;  3E2E A;  4NLG A;  4JI2 F;  1TVR B;  3A1Y G;  4R8U A;  3L7U A;  3CCU S;  4QWC A;  4LF6 J;  2MKS A;  3VZI A;  3W8P A;  3EPG A;  1FXR A;  2R8J A;  3ZTQ A;  1YJW S;  4UY8 5;  1EHW A;  1M5O C;  4RZR A;  2R7O A;  3V6D B;  3EYZ A;  5HQ8 A;  2J9E A;  3GMG A;  2OPP A;  4Z2X A;  2XY7 A;  2DGQ A;  2CQP A;  3N6L A;  2GJF A;  4L73 A;  4LFA J;  5GMK a;  5LMN F;  4KHP J;  2Q43 A;  1G4C A;  2NSB A;  1R7I A;  4Y28 C;  3H4D A;  1MRO B;  3TVK A;  1VGY A;  5HMZ A;  2VKR A;  4RL1 A;  1N36 J;  3ZZT A;  3LWL A;  3P5T L;  3VQS A;  1YZ6 A;  2ACY A;  3PTW A;  2Z2M A;  1OIA A;  2RIJ A;  4KV8 B;  3BM7 A;  3HM9 A;  4JI0 F;  1EP4 B;  4IG3 B;  3PNI A;  2MDA A;  3AD9 C;  3ZNJ 1;  1HHQ A;  2FC9 A;  3DNC A;  1WC4 A;  1FJG J;  1H7W A;  5ETT A;  2KG1 A;  3DDI A;  4A4J A;  3LGN A;  3GJS B;  1Y3J A;  2IY5 B;  4ED2 A;  1JQG A;  4K5R A;  3OTO J;  2AU0 A;  1N33 F;  3AQP A;  3EXC X;  3HSG A;  2CA9 A;  4LF5 F;  3OTD A;  4WXO A;  4CZC A;  1VBZ A;  1SH3 A;  1B0P A;  1WI6 A;  4DR3 F;  1X5S A;  4QQB A;  4YY3 J;  2E66 A;  1UW9 A;  2MGZ B;  2XMU A;  2CPZ A;  4RW9 A;  4H4M B;  1UFK A;  3TAM B;  5E3R A;  1X9M A;  1URR A;  7FDR A;  3CJK A;  1JLE B;  4C0O C;  3ADA C;  3JTO A;  3SEO A;  5ETR A;  4YB1 P;  2MZJ A;  1IM4 A;  4J91 A;  1KHW A;  2KT2 A;  1VLO A;  4AE5 A;  3HI9 A;  4C3M A;  4WU3 A;  3CJR A;  2MZT A;  1VQY A;  2XHW A;  1QAY A;  3A3N B;  4DV1 F;  2VFV A;  2AWZ A;  6FDR A;  1S0M A;  3VHQ A;  4HT7 A;  2CZV C;  5L1J A;  1RJJ A;  1GK8 A;  1FKP B;  1RLC L;  4ZVO B;  1R8C A;  3CMQ A;  3EVW A;  1B99 A;  2FJX A;  2DNO A;  1HMV B;  1EAR A;  4KC5 A;  2Z30 B;  2WW8 A;  1VCT A;  4S0M A;  4WFX A;  2WVE A;  2JC1 A;  1YI2 S;  5JXS A;  4DR7 F;  1JLQ B;  4RU9 A;  1HHT P;  4OI4 A;  5DG9 A;  4Y0F A;  1SL1 A;  3KLI A;  3G82 B;  1NH8 A;  1B64 A;  2E1M C;  1G6B A;  5KAK A;  3QQC D;  3I0S B;  2ZBP A;  2E1C A;  1QAI A;  2WON B;  2ZHA A;  3UWT A;  3MM7 B;  1NHK L;  1BWE A;  1T9V A;  2L9D A;  1W2B R;  2DNK A;  2VDI A;  3QIP B;  4M5L A;  1HNX F;  4WIQ A;  2OPS B;  4TY9 A;  2C42 A;  3TUZ C;  5A6W A;  1WHX A;  2YNG B;  2PII A;  2KM8 B;  3PEH A;  1E6V A;  1VQL S;  1PAU B;  1FD8 A;  4QWD A;  2O01 C;  2APO A;  2KJV A;  3I9V 9;  2M5Y A;  1RWK B;  4J9S A;  3GIM A;  3ZZZ A;  5LOQ A;  2HAF A;  4I2Q A;  3BDP A;  2UXC J;  1V9O A;  3I55 S;  3VAI A;  4NYO A;  2C2K B;  1TUV A;  2RQK A;  2Z57 B;  2CJB A;  1T3N A;  4KGK A;  2UVW A;  3RBZ A;  3PAC A;  4M5H A;  2MQL A;  2NPF A;  5LXR A;  5KFO A;  4DQP A;  2WW4 A;  4D3G A;  4V19 J;  3VTI A;  1WI8 A;  2E29 A;  2L41 A;  2RRA A;  4G3I A;  1AB8 A;  1S1W B;  2EC2 A;  2RML A;  4DSJ A;  2G0I A;  3G86 A;  5B0G A;  2ILY A;  3KLF B;  4ELU A;  1MU2 A;  1G2E A;  4IFY A;  2J0S D;  3DOL B;  3KMQ A;  2IJN A;  2P6S A;  2W9B B;  3FMW A;  3RU0 A;  5A6P A;  4RUC A;  2CG4 A;  4WZQ A;  3TYT A;  2RU3 A;  4C8O A;  1X0F A;  3IGN A;  4XDC A;  2MQM A;  1O6X A;  2XMT A;  4YDD B;  3AHP A;  2HNZ A;  4MKY A;  1CQN A;  3AD8 C;  1U09 A;  2E7V A;  2MY8 A;  1Q53 A;  3N0V A;  1PIL A;  1S1U B;  3I0R A;  2DHH A;  3TA0 A;  4B17 A;  2DRB A;  3NRB A;  4ER8 A;  1XMO F;  1REV B;  4DS5 A;  1LFW A;  4ICL A;  3BSA A;  1WKK A;  4F7V A;  2B7C B;  4B3O B;  2AEJ A;  2I38 A;  5BJR A;  4PWD A;  3GCX P;  3T6B A;  4A8X A;  3DM2 B;  2QLB B;  1KEK A;  2GJ2 A;  1FKA F;  2F1F A;  2DBB A;  4P52 A;  4U96 A;  2CPX A;  2CJ9 A;  1NND A;  2GGP B;  2QL7 B;  2DVI A;  3BR9 A;  3ZZU A;  1JX4 A;  2HZA A;  1N34 F;  2G1D A;  5J2M A;  1VC6 A;  1DRZ A;  3SV3 A;  4YOE A;  3P45 B;  3JSB A;  1S1V B;  2DCL A;  4B3T F;  2XLJ A;  5KFZ A;  5HJY A;  3CWJ A;  3QT8 A;  2CVE A;  2C22 A;  2KT5 A;  2WVC A;  2HND A;  2IBO A;  2QN6 B;  3S6E A;  1FES A;  2AJF E;  3LUY A;  4QU7 A;  3D9B A;  4U6P A;  3OSP A;  3MZI A;  1RT4 A;  4E8U A;  1RI7 A;  3AAW B;  4ZIT A;  3AT1 B;  1BD6 A;  2WOM B;  2CPJ A;  5IQQ A;  5DO2 A;  4ES3 A;  3AOC A;  1R0B G;  4MYU A;  3ICL A;  4CNY A;  4A47 A;  4XDD A;  2VPZ B;  3E01 A;  1HD0 A;  2B5J A;  3MMC B;  4IOC Q;  2HFS A;  1NKB A;  4QYZ K;  3L09 A;  2RB7 A;  4B3S F;  2L9W A;  3K89 A;  2AGQ A;  1DQA A;  3W2W B;  1N5Y B;  2MY7 A;  5D4O A;  3I87 A;  2DNR A;  3TA1 A;  1CUL A;  2JFK A;  1VQP S;  2CJX B;  3M8W A;  3TWZ A;  4DPO A;  1X31 C;  2QFI A;  2H4W B;  4NLP A;  5J2Q B;  2M3D A;  4JV0 A;  5KFP A;  2XZT B;  2AJ1 A;  3PHT A;  4LF1 A;  5CQG A;  4RLE A;  2J9D A;  4C3K A;  2NQP A;  3WHI A;  2EFP A;  4EZ9 A;  1RT3 A;  4X4P A;  3MEE A;  1S7H A;  3B54 A;  2K2P A;  5LMU J;  3GG0 A;  4ZCK A;  3R5A A;  4NA2 A;  3M32 A;  3NS5 A;  2HFN A;  3JSM A;  4OHX A;  1JJC B;  1JLF B;  1IKX B;  2VD3 A;  1Y00 A;  4PG4 A;  5B0A A;  3BSN A;  2AZ3 A;  4FXV A;  3OR2 B;  5DG8 A;  1U24 A;  2KXN B;  3MEG B;  5KT7 A;  4PRF A;  4FVM A;  4I69 A;  4J9K A;  2UUB F;  3DXS X;  2G4B A;  1FJC A;  1JLC B;  3RRG A;  2HFZ A;  4ZVT B;  2N7C A;  3J7Z 5;  1I5O B;  5A0Y B;  1ZA2 B;  4MK7 A;  1RT1 A;  5HVG A;  2DK2 A;  3OV7 A;  3Q89 A;  3BO3 A;  4OHW A;  5KFI A;  4Q44 A;  4DV7 F;  3D6F B;  1BQX A;  1SC4 B;  1LWX A;  4K4Z A;  5L46 A;  5ETP A;  1CJK B;  5DGA A;  2RHQ B;  1R27 B;  3C6U B;  4PG6 A;  3PIO Q;  4DU7 A;  2V8G A;  3UVJ A;  2V2K A;  1PCA A;  2DIU A;  1IKY A;  3NWR A;  1CJU B;  1HNI B;  1ZTW A;  4DV6 F;  3ISN C;  3Q86 A;  5J2N B;  1Y5I B;  1UFW A;  3VWS A;  3GFY A;  4CTA A;  3TEG A;  4NLX A;  3J7Y U;  1NU4 A;  2PI5 A;  2QEX S;  2HIQ A;  1HNW F;  2V8P A;  1S1T A;  4CNZ A;  2HVD A;  5BYS A;  3VQT A;  1KHV A;  1Q4R A;  4FYD A;  5J1E B;  5HAO A;  1S72 S;  4RNN A;  3P6Y C;  5KFC A;  2VH7 A;  3SSS A;  4DSL A;  4JV2 A;  2E9T A;  3GJT B;  3H2U B;  3PW5 A;  4RPF A;  2X7I A;  3JQK A;  3UO0 A;  3HHL A;  2M52 A;  1WF1 A;  2ZHO A;  2YWH A;  5GAG U;  3KXD A;  1HIY A;  4USV A;  2J9C A;  2NXE A;  3IR7 B;  1NZA A;  4OYI A;  3FRY A;  1PKU A;  4KHR A;  4F50 A;  3Q8R B;  1TVR A;  5RUB A;  1SVD A;  1KBR A;  3WIV A;  2B4O A;  3G2X A;  4ALZ A;  4NEZ A;  4K4S A;  4Z37 A;  2AYG A;  1IBM F;  1RAG B;  3CD0 A;  4PG8 A;  3D4J A;  2V50 A;  1X4B A;  3AB2 B;  2VA3 A;  3DRS A;  5A2Q U;  3T19 A;  4FS1 A;  3SYZ A;  4MIA A;  3M2R B;  4LF8 J;  4JUZ A;  2CYY A;  4RJV A;  1OJ4 A;  4U9R A;  2PD1 A;  1CC7 A;  3V6D A;  2H9Z A;  1MML A;  5KT6 A;  1RWX B;  1FNO A;  4URG A;  3GTY X;  1ZPV A;  5I3Q A;  3M7V A;  1JK9 B;  1MRO A;  2BXJ A;  2I8E A;  4HI2 A;  3DI6 B;  1C1C B;  1R89 A;  1RGV A;  1WJ9 A;  2NPI A;  3TZX A;  4F4A A;  2NYH A;  3NWG A;  5CHC B;  4EFA C;  3C6T B;  4KV8 A;  5L1L A;  3W1Y C;  2E5L F;  3ELH A;  3MUT P;  3MCO A;  4DCJ B;  3IGV A;  1EP4 A;  4IG3 A;  4PWW A;  2HPU A;  5GAH I;  1BQM B;  2LA6 A;  3CC2 S;  1L3V A;  7FD1 A;  3QFW A;  1RTJ B;  2OUG A;  3MXH P;  2UP1 A;  1DFD A;  3K2Y A;  3HKZ D;  2D3O R;  5F41 A;  4K2J A;  3R27 A;  2AF6 A;  5D77 A;  4KFB A;  3ILI A;  3KOA A;  1BXN A;  4NL5 A;  2ZH5 A;  4URS A;  3HCX A;  1S0V A;  2KZM A;  3PR5 B;  1YK9 A;  3DLB A;  3WIU A;  2QIF A;  4F36 A;  3W60 A;  3W9J A;  5FD1 A;  1FWP A;  2BE9 B;  1ACM B;  1WOR A;  2VPX B;  1AXQ A;  1NXI A;  4ZVR B;  2MGZ A;  4CM2 A;  1DAX A;  3FSY A;  3DDK A;  1ZM9 A;  2KYZ A;  4F0M A;  2LXU A;  2NS1 B;  2QG9 B;  1FER A;  1KRP A;  3I56 S;  1JLE A;  2E5I A;  3O5T B;  1AT1 B;  2Q6B A;  3HHK A;  1VR6 A;  3UDE A;  5H9F J;  2MTL A;  4X4Q A;  4DX6 A;  2W24 A;  5D15 A;  1HQE B;  3MM5 B;  1RWW B;  4ZN1 A;  2WSF C;  1X4A A;  3NCQ A;  1IUJ A;  4NA3 A;  1RAD B;  2Z56 B;  4X65 F;  4IH7 A;  1SJ3 P;  2RRN A;  3LP1 A;  2MKI A;  4CO4 A;  5ADZ A;  4DR1 J;  3G71 S;  4N77 A;  4USU A;  3IWX A;  3RB0 A;  3BZQ A;  2Q79 A;  4OHV A;  4NLU A;  2HVZ A;  1HW9 A;  1WEL A;  4MFB B;  3A4T A;  1FKP A;  1M0S A;  3IBW A;  1S59 A;  5BXI A;  2EK6 A;  1ZAV A;  4N41 A;  2Y8W A;  2FYX A;  2R8I A;  1TK5 A;  4O3S A;  4X62 J;  4C0B A;  4R5P B;  2DGV A;  1FO1 A;  1HA1 A;  5L39 A;  1MSW D;  4C8K A;  4DV5 F;  3TZW A;  2FJV A;  3HP6 A;  3G82 A;  2VHG A;  1C4C A;  5EUH A;  2YY3 A;  3TX8 A;  3M6W A;  2ZVI A;  2N3L A;  3I0S A;  2CFX A;  2WON A;  1TR0 A;  2H5I B;  2OFH X;  2AMC B;  4LF6 F;  2C3P A;  3MM7 A;  3W65 A;  3QGH A;  1WG5 A;  4R0J A;  1PAE X;  1Q16 B;  3W5X A;  1HYS B;  2FVQ A;  3QIP A;  4N76 A;  3M8P A;  4E0D A;  3M30 B;  4EI2 A;  3BB5 A;  3CCJ S;  4BLG A;  2YNG A;  2A0F B;  3CCZ A;  3BGF A;  2QGF B;  3LOU A;  4LR7 A;  1Q0N A;  5K8O A;  1FHT A;  3R5C A;  2HHQ A;  4ZJL A;  2HGN A;  1NO8 A;  2UUC J;  3KMS A;  1L5U A;  4DPT A;  2ZWP A;  4IUF A;  3EWG A;  1YLX A;  2WVF A;  2GHV C;  4Q2M A;  4DUZ J;  1GXL A;  4EO8 A;  2X1F A;  4NCA A;  2DIT A;  4A8Y A;  5L1K A;  4USM A;  3KUE A;  5A8R B;  4P73 A;  4CH0 S;  4CO5 A;  1NB2 A;  4DR4 J;  3HZE A;  1BE4 A;  2QMU B;  2VQF F;  4DV4 J;  2WVB A;  1FRI A;  3KLG B;  1S1W A;  4TLQ A;  2V6A A;  2BV3 A;  4X4U A;  1UWB B;  3HHN B;  3K5P A;  3O2I A;  3KLF A;  1QSY A;  3UN2 A;  2YH0 A;  3DOL A;  4ZVU B;  2I1R A;  1WHV A;  5EDW A;  1X5O A;  2W9B A;  4M1K A;  2FLP A;  4YR3 A;  1HNV B;  1YJU A;  3HPO A;  2HQG A;  2Q3P A;  2QE5 A;  4C4W A;  2GW8 A;  2DH7 A;  4UZC A;  3PKY A;  4I67 A;  4DZ6 A;  4CLU A;  2FJE B;  4CT9 A;  2R8H A;  3KHH A;  2YNH B;  3A12 A;  2H5J B;  1S1U A;  3TQE A;  1RYR A;  1W26 A;  3MMB B;  4QOT A;  1REV A;  3FZB A;  2CQ2 A;  1G1X A;  2FLL A;  2ASL A;  5A2Q Y;  3JS9 A;  4LSL A;  4LBP A;  3EZU A;  4MYT A;  4B3O A;  1W7W A;  1NK4 A;  2H65 B;  1K73 T;  2FZC B;  1KQK A;  3DM2 A;  3TVY A;  2OI2 A;  2AQ4 A;  4WU2 A;  3IRX B;  1DJ0 A;  3A8E A;  2RIL A;  2CPH A;  3CJQ A;  1RIS A;  1T9X A;  2HWI A;  5KFS A;  3HHE A;  4IQX A;  3VAJ A;  1RCX B;  1SUQ B;  2ZH7 A;  4I7F B;  3SSR A;  2GIQ A;  1AUD A;  2KHD A;  3S8S A;  1AFJ A;  3H2V E;  3B78 A;  2ACM A;  1S1V A;  1KR4 A;  1T9U A;  1RKI A;  2PA3 A;  4PG5 A;  1NK0 A;  2DGS A;  4DR6 F;  3MM9 B;  2AW0 A;  2HS4 A;  4TN2 A;  3FEZ A;  2MHE A;  4NA1 A;  1J27 A;  2JRS A;  4QWE A;  5ETN A;  1PYO B;  2WOM A;  3FBE A;  4IOB A;  2CVI A;  4A8M P;  3NEK A;  5DM7 Q;  1GX5 A;  4M5N A;  1H2U X;  3PCO B;  3NGK A;  4B9V A;  5KFV A;  1ZET A;  2LMI A;  4Q2L A;  4KHM A;  4B9T A;  3WX4 A;  2KRR A;  3MMC A;  2GHP A;  3ENA A;  1K8A T;  1VFJ A;  5J1N A;  3TZY A;  2CPI A;  4K4V A;  3W2W A;  2MXY A;  3GON A;  1P1L A;  1N5Y A;  1LWC B;  4HTJ A;  3HD1 A;  1KOH A;  1TKT B;  2ZJR Q;  1GX6 A;  1U1M A;  5J2Q A;  1QJH A;  3BSO A;  2M2B A;  4TU9 A;  1RB0 A;  2E9Z A;  3QJJ A;  2OH2 A;  4C11 B;  3BRE A;  2C2E A;  2YQ3 A;  5B0D A;  1CEZ A;  3RB6 A;  1YWX A;  4AL7 A;  1DBD A;  1QM9 A;  2NRE A;  3NGT A;  3HKW A;  1RWV B;  4K4T A;  3B8H A;  1HBN A;  1JLF A;  1IKX A;  3H5U A;  2B8P A;  3MPV A;  1IJF B;  3G8Q A;  4DWI A;  1TV6 B;  3OR2 A;  5K14 A;  2OD4 A;  3CUL A;  4K4X A;  4LVO P;  4DJB A;  1KQF B;  3W2V B;  4B02 A;  1YGY A;  5JMN A;  1OY8 A;  2OLW A;  1JLC A;  2IRU A;  4ZJO A;  2LQ5 A;  3R6G B;  4OJ3 A;  1HPZ B;  2VJU A;  3HLU A;  5A0Y A;  1CVJ A;  4YHH F;  2PO4 A;  1U49 A;  1JIH A;  1F0X A;  4C8Y A;  4CWB A;  4UZB A;  2P2C B;  1KNZ A;  3KJQ B;  3N6M A;  2FHJ A;  2KVQ E;  3D1H A;  1PG5 B;  2GHW A;  4DLE A;  3MFH A;  4QIV A;  1CJK A;  1MWY A;  1IM6 A;  3C6U A;  2DH8 A;  1QDU B;  4FXD A;  1P6T A;  3BV8 A;  4IH5 A;  1CS4 B;  3EZ5 A;  5B0F A;  3F73 A;  1I3O B;  3VAK A;  2AGO A;  2CDQ A;  3D0I E;  3DYA B;  1CJU A;  1HNI A;  2JLG A;  4YFU A;  4F4Z A;  4PWU A;  1MN7 A;  1FE0 A;  2DD8 S;  2V2V A;  2X3D A;  8ATC B;  2X1A A;  1JNZ B;  2Y1L B;  5U47 A;  5HRO B;  4DFJ A;  2AZ1 A;  4L3N A;  2Q6C A;  2GVD B;  5J1E A;  2PMW A;  5I42 B;  4ZPV R;  4MKV A;  4OX7 A;  4LRE A;  2Z58 B;  3VGU A;  2VQE J;  1LWF B;  4LVN P;  1X7V A;  3ZTS A;  3QNW B;  1PIE A;  3FGV A;  2QO3 A;  4RR5 A;  3RAX A;  3W9I A;  4BHQ A;  1J5E F;  3F41 A;  3K17 A;  3QAE A;  4TVA B;  5IV3 A;  3F0N A;  1W25 A;  5AXM A;  2A2C A;  4TNO A;  5KFR A;  5DZ7 A;  2JH3 A;  2A3J A;  3O44 A;  3IG1 B;  3MMJ A;  2LYV A;  4YN3 B;  5FII A;  1VC0 A;  1S9F A;  5EWE A;  1XNR J;  1JJ4 A;  1HWL A;  3M2R A;  1UFL A;  4DBQ A;  1C1B B;  1IR1 A;  4LMZ A;  1H2T Z;  2HQD A;  2UXD J;  2F7V A;  2MZQ A;  3DFE A;  3UW1 A;  4Y2I A;  4G1Q B;  4DL4 A;  4NX9 A;  2K1R B;  3OLA A;  4IR9 A;  2KJW A;  2EPI A;  3CCE S;  4DXL A;  1KFD A;  2V8V A;  1NHU A;  3G6E S;  3TO8 A;  1NPR A;  3WQP A;  5KOX A;  5L38 A;  3V6K A;  4OQJ A;  3DI6 A;  1C1C A;  3VV2 B;  4F2R A;  1GAO A;  2GVZ B;  4IDK B;  1GTH A;  4Q7A A;  2IM3 A;  4USJ C;  2F8M A;  5ETL A;  1RE1 B;  1S12 A;  4JI2 J;  3C6T A;  3PV8 A;  1N8R T;  1GXT A;  1BQM A;  4OLO A;  2HGM A;  2FGO A;  1IWA A;  4ZPD A;  2HLT A;  1RTJ A;  2V0N A;  3DU5 A;  2VAS A;  2FY8 A;  3HVT B;  1U1P A;  3IN5 A;  2IYI A;  1JLG B;  1RSC A;  1EZZ B;  2ZH6 A;  3MGJ A;  1VRU B;  3MR6 A;  2HBZ B;  1ZTT A;  2Q1L A;  2B9E A;  3QO9 B;  4JI7 F;  1BQN B;  5LMN J;  4CLY A;  5GAD U;  2NLW A;  2NSC A;  1NM2 A;  2R7R A;  2DGT A;  3KG1 A;  3MM8 B;  1CG2 A;  4MIB A;  2RQ4 A;  3MCN A;  4DUY F;  1FXD A;  5E33 A;  2RUG A;  2QL9 B;  3AH6 A;  4JI0 J;  4C8M A;  2K7J A;  5LT5 A;  3KK2 B;  1HQE A;  2AIR B;  3MM5 A;  4DX8 H;  3QGG A;  2R3V A;  4DL7 A;  4Q8E A;  1HW8 A;  1S9E B;  1ZOT A;  1XER A;  4CO3 A;  2XNQ A;  4O0I A;  4JI8 F;  3HF5 A;  2FB0 A;  3JXO A;  5AE3 A;  3MCS A;  2QFJ A;  5G4D A;  1RU1 A;  1RTD B;  1ZH5 A;  3Q8V A;  1RBL A;  1NJX A;  4MFB A;  1LW0 B;  4LF5 J;  3M2V A;  1X4C A;  4DR3 J;  5KFJ A;  4XO0 A;  5DLG A;  3MEC A;  4TLR A;  2W9A A;  4R5P A;  1B0V A;  2VJV A;  1PYS B;  4KTQ A;  1KQG B;  2OTJ S;  2CQ1 A;  2QT7 A;  5LM7 E;  1TTH B;  1RBA A;  4BCA A;  4ZHR A;  4OZL A;  4OI1 A;  2PDA A;  2CJK A;  3LGM A;  4I1T A;  2KB2 A;  2RUS A;  3N6N A;  4USW A;  4LF7 F;  3EJM A;  5DET A;  4MKB A;  1K1S A;  1HYS A;  3W9H A;  4OX9 J;  3E8O A;  4JI3 F;  5FDL B;  1BLU A;  3C16 B;  3M30 A;  2E44 A;  3U1N A;  3OHB A;  2XMW A;  4DV1 J;  5DDO C;  5LSL A;  4RBU A;  5ETQ A;  2YWG A;  1NK9 A;  4O3O A;  3U7J A;  2BQR A;  3IXQ A;  2A6M A;  2DR7 A;  3PYE A;  1Q7L B;  3T9Z A;  2BMB A;  3PFO A;  3CSK A;  3KG4 A;  1VQ4 S;  1O51 A;  3TQ1 A;  4DR7 J;  4JV5 F;  3NS6 A;  5A8R A;  5F3T A;  3R7S B;  4X66 F;  4OYM A;  3Q8U A;  1T0T V;  4ILL A;  2LLZ A;  2D74 B;  3J7Y I;  3BPD A;  3D5M A;  2HHX A;  3TUP A;  1J2V A;  4RX6 A;  3KLG A;  1ZPW X;  1YIT S;  1WEX A;  2GA7 A;  1S6O A;  2MB0 B;  1HNX J;  4QYZ J;  5HL7 Q;  2PEH A;  4CH7 A;  1VBK A;  3GPA A;  1Q8K A;  1GMW A;  3GLJ A;  2OPR B;  2P9E A;  1HNV A;  5GAG I;  1VBY A;  2HS0 A;  3IRW P;  1X4F A;  4EGL A;  2KI2 A;  2XQC A;  2GAH C;  2OTL S;  2J7W A;  3W5Z A;  2YNH A;  2UXB F;  3BGU A;  4BDP A;  3MMB A;  2ZVS A;  2MQP A;  2RVJ A;  4ZP7 A;  2ZOG A;  3DRP B;  2KFN A;  3MD1 A;  3CJS A;  2UVR A;  3OXG A;  1R6V A;  1AZS B;  2CWK A;  1BHN A;  4MMO A;  2OPQ A;  3CDB A;  4OMF G;  2RSQ A;  2RH3 A;  2IPO B;  3CO0 P;  3CCQ S;  2H1Y A;  3Q2T C;  3CO9 A;  4DMZ A;  1SUQ A;  3OR1 B;  4I7F A;  1U4B A;  1I94 F;  3CCM S;  4ZVP B;  3SCK E;  1SB6 A;  3H7H B;  3GYX B;  3H42 A;  1P9Y A;  5DDQ C;  5EX0 A;  4ZVE A;  1ZAX A;  4G65 A;  4H4K A;  1VMB A;  4Y00 A;  5B7W A;  3Q8Q B;  2DNZ A;  2DR9 A;  2VOP A;  3ZTR A;  2N4D A;  3PKM A;  3MM9 A;  5F8I A;  4X62 F;  3DRY A;  1HWK A;  4RW9 B;  5J1P A;  3CD5 A;  1TMJ A;  1XMO J;  1F2H A;  1NDL A;  3FQK A;  2ZUA A;  4W90 B;  4CH1 A;  5I3P A;  3GV7 B;  1UVJ A;  4O3Q A;  4OI0 A;  5E0O A;  2ZH1 A;  1HAR A;  4P9S A;  2KKH A;  1YBT A;  2MLY A;  2O5D A;  3TNV A;  3N79 A;  1P1T A;  1B0T A;  4J9N A;  1U7L A;  3BQ1 A;  3H40 A;  3KUG A;  1N34 J;  1LWC A;  2C2Z B;  2VPW B;  2FZG B;  2BOA A;  3VF0 B;  3I32 A;  4AFF A;  1TKT A;  2G1H A;  3T41 A;  1PJ6 A;  1PYT A;  3VAH A;  4B3T J;  1SJ4 P;  4JI1 F;  3HSZ A;  5CA5 A;  3R5G A;  3IR6 B;  1I51 B;  3OL7 A;  3LH2 S;  4ZPT R;  4C11 A;  2F4F A;  2MKY A;  1YHQ S;  1RUS A;  2PSZ A;  2J7K A;  5D0H A;  1IBC B;  2UU9 F;  1PJ5 A;  3AOB A;  4P2F A;  4K8R A;  3BKU A;  4G1P A;  2OEK A;  1VBX A;  4O3P A;  1CJV B;  2WSC C;  2YWE A;  3CUN A;  3BBB A;  1NK7 A;  1SH2 A;  4NOH A;  2GCF A;  1UVN A;  4KO0 B;  1V6H A;  4ECY A;  1PSD A;  5KFY A;  4NLY A;  1TV6 A;  3TI0 A;  2CNL B;  2ZZM A;  2CJQ A;  5F8G A;  2EFG A;  3QYY A;  2JL9 A;  1HI0 P;  4HHH A;  3EGZ A;  4ECR A;  2V67 A;  4K59 A;  1UPP A;  3W2V A;  4IFV B;  3MUM P;  5D3G B;  1N48 A;  5F0U A;  4B3S J;  1NB7 A;  2Z4P A;  2JDJ A;  3U1M A;  3GIJ A;  1MWZ A;  4RBV A;  1D9D A;  2KH9 A;  4ZCM A;  4WJB A;  5ETO A;  3VAF A;  2VZ9 A;  2RJZ A;  4ZIW A;  2CQI A;  4RW8 B;  4KH1 B;  4Q45 A;  4OZ3 A;  5HLF A;  4B3R F;  2BZ2 A;  3ETM A;  4U7C A;  3RAM A;  2EBG A;  3N01 A;  2JOQ A;  2DNP A;  2X1B A;  1U1L A;  2RF2 B;  5AT1 B;  2DB1 A;  3EUN A;  1FF2 A;  1CS4 A;  3DHW C;  3IA0 A;  2VG7 B;  1FVQ A;  1DUR A;  1SJF A;  1RTH B;  5LJ5 Y;  3D6T B;  2ZOM A;  2VBW A;  3DYA A;  3L9Z A;  4L75 A;  2MJN A;  2GNK A;  1SI9 A;  1KDN A;  4PAA A;  3MAH A;  4F04 B;  1NEE A;  2D41 A;  5IXU A;  2OIH A;  3DLK B;  5HRO A;  1RLD A;  3ZTP A;  2HRY A;  3NY0 A;  4QU6 A;  2GVD A;  3UDL A;  5I42 A;  1FJ7 A;  3BN7 A;  1ZM4 A;  1XR5 A;  1PO6 A;  4AYB D;  1F1B B;  4OZJ A;  3KLV A;  1KTQ A;  4WFN Q;  1LWF A;  3T5H A;  4P2X A;  1YZ7 A;  3G87 A;  2MZ1 A;  1QSS A;  1FRK A;  3AA9 A;  3N28 A;  3CIZ A;  3GYG A;  3M6V A;  4DL6 A;  3QRP A;  1KVJ A;  4RW7 B;  1KFS A;  5LJ3 Y;  1RTI B;  4P74 A;  3E3X A;  5LL6 d;  5GVQ A;  3RTV A;  1YJN S;  3CMA S;  1JLA B;  4L6V 3;  2CG8 A;  1WG1 A;  4C8L A;  3PHE A;  1VJW A;  2XEX A;  3IG1 A;  4WFZ A;  4DV6 J;  5E7O B;  1SXL A;  2HVH A;  1R31 A;  1KQS R;  4EBE A;  1Q1K A;  4TYB A;  4DFK A;  1SL0 A;  1M1K T;  3W63 A;  1HNW J;  3DOK A;  5FLX U;  1C1B A;  1PC5 A;  1YVF A;  2XGQ A;  5KFB A;  2QLX A;  4KIA A;  3JQM A;  3SCL E;  4G1Q A;  2JHE A;  3OXF A;  2K1R A;  2LQ8 A;  1X60 A;  3TZZ A;  1FFW B;  2DY1 A;  4MH8 A;  1RK8 A;  4ECX A;  1LW2 A;  4HR2 A; 
#chains in the Genus database with same CATH homology
 2UXD J;  2KL8 A;  2UUB J;  4B3M J;  1IBL J;  5LMN J;  2UXB J;  4HHU A;  3J81 U;  4DUZ J;  2E5L J;  4NXN J;  4DV3 J;  5A2Q U;  3D3B J;  5LM7 E;  5LMU J;  1N34 J;  2UUA J;  4LF6 J;  4LF8 J;  4DR6 J;  5IWA J;  4RJV A;  4X65 J;  1FJG J;  4X62 J;  2VQE J;  4K0K J;  5BR8 J;  2F4V J;  3R2D J;  4V1A k;  4DR2 J;  3J80 U;  4JV5 J;  2UXC J;  4B3T J;  1XNQ J;  4JYA J;  1HNX J;  4LF4 J;  4AQY J;  4DR4 J;  4JI7 J;  4DV7 J;  1IBM J;  3OTO J;  4DV0 J;  4NXM J;  4JI6 J;  4X66 J;  4JI0 J;  4DV4 J;  4OX9 J;  4KYZ A;  1IBK J;  3T1Y J;  4JI2 J;  4GKK J;  3J7A N;  5AJ3 J;  2KVQ E;  4DV6 J;  3R2C J;  2ZM6 J;  4DV1 J;  4B3R J;  4YY3 J;  1N32 J;  1I94 J;  4LFC J;  4DUY J;  4LF9 J;  2MTL A;  1HNW J;  4LFA J;  4JI1 J;  4LF7 J;  4JI5 J;  5FLX U;  1XMO J;  4YHH J;  3T1H J;  4DV5 J;  4KHP J;  3D3C J;  1HR0 J;  3W1Y C;  4DR5 J;  4X64 J;  1XMQ J;  2VQF J;  2HHH J;  4JI4 J;  3IMQ J;  3JAM U;  2MEW A;  4JI3 J;  4LF5 J;  4GKJ J;  4KY3 A;  4PWW A;  1J5E J;  2MQ8 A;  5IT9 U;  4DR3 J;  4NEY A;  1XNR J;  4DV2 J;  1HNZ J;  2UU9 J;  1N36 J;  4DR1 J;  4JI8 J;  4DR7 J;  4LFB J;  2UUC J;  4NEZ A;  1N33 J;  4B3S J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...