4JI7J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ji7J00
4LFCJ 3J81U 4V1Ak 1XMQJ 1N32J 2E5LJ 4NXMJ 4NXNJ 4LF4J 3T1YJ 5A2QU 4DUZJ 4YY3J 2UUAJ 4LF9J 4GKKJ 1FJGJ 2MEWA 1IBLJ 4JI5J 4KYZA 4X62J 1XNQJ 1N33J 4DV4J 4LF5J 4LFAJ 2MQ8A 3D3BJ 1IBMJ 4JI4J 2F4VJ 4DV1J 1XMOJ 4KHPJ 3IMQJ 4DR6J 4YHHJ 2KL8A 5LMUJ 4B3RJ 4K0KJ 1XNRJ 3R2DJ 4NEYA 2UUCJ 4NEZA 3J7AN 3D3CJ 2VQEJ 1HNZJ 4JI3J 3W1YC 1HNWJ 4DR5J 3R2CJ 4DR2J 4JI8J 5BR8J 4X64J 4B3TJ 4DR7J 1HR0J 3T1HJ 4X66J 4JV5J 1J5EJ 4DR1J 1N34J 5AJ3J 5LM7E 4B3MJ 4JI6J 4JI7J 4JI0J 5LMNJ 4DV6J 4GKJJ 4OX9J 4DV0J 5IWAJ 2UUBJ 4KY3A 3JAMU 5FLXU 2MTLA 4DV2J 4LF7J 5IT9U 4AQYJ 2UU9J 4DR4J 4LFBJ 2KVQE 2ZM6J 1N36J 2UXDJ 2HHHJ 4HHUA 4JI2J 4JYAJ 4X65J 4JI1J 2VQFJ 4DUYJ 4RJVA 2UXBJ 4DR3J 1I94J 3OTOJ 1IBKJ 4LF6J 4B3SJ 4DV5J 4DV3J 4PWWA 4LF8J 2UXCJ 3J80U 1HNXJ 4DV7J
chains in the Genus database with same CATH superfamily
3OL8A 2KM8B 2XY6A 1M5KC 4E8UA 3EXCX 1KDNA 1FX2A 1KWMA 5GVQA 3BKUA 2R7SA 2DGXA 4JI5J 5DDQC 1C0TA 4WFYA 1WHXA 2YWFA 2FD2A 2RS8A 3VGUA 4USJC 2E9ZA 5CA5A 2C3UA 2CJKA 3EYZA 4ZPBA 1TKDA 4JI8J 4YB7A 1RA7A 1S1TB 2RQMA 5JJBA 4KAIA 1X4HA 1NDKA 1FJGF 2OSRA 2WSCC 2GVDA 4ED6A 2JZ5A 3TUZC 4WK1A 2YX4A 1S6UA 1Q78A 3ISNC 3MMCA 3ZXWA 3E51A 2C2NA 4WCEQ 4JV1A 3UR0A 1NSQA 2XNRA 5K20B 5A0YA 1HQEB 3H59A 1RI7A 1H3DA 1WKLA 4QIVA 1RT4A 4H4MA 1VDHA 2MQMA 3BR9A 1CG2A 2OPSA 3NS6A 2BM1A 2FJDB 1B0PA 3FZBA 2VBZA 2L9NA 3TA2A 4HR2A 4OX6A 3TANA 3AH6A 3NLCA 3QGGA 5A8WA 1Y4ZB 4DX7A 1QUPA 3ZZTA 4FF4A 1X0FA 3DDNA 2RAQA 4YMEA 1ZZNA 2XTJP 3W5YA 1NB7A 3OT9A 2FVPA 2NLWA 4OIXA 2Q43A 2V34A 1RTDB 2CG8A 4DV2F 2HHVA 1FJCA 2HHSA 2A2CA 2DIVA 2CJBA 4GVBB 2DISA 5KFDA 2C2ZB 2AYBA 4LT6A 5DDPC 3N6MA 2IVFB 4RZRA 4DG1B 2YNHA 4OJGA 4F4XA 2BQRA 2PEBA 3BV8A 2JEFA 1SJ1A 5KFHA 4I1TA 3GV8B 2HQFA 3HZEA 1WC0A 5D0RA 2W9CA 1P8GA 2QG9B 4ED0A 3IA0A 2LQ9A 1QVGR 2ZFHA 3T5HA 3HI9A 3ILIA 3W61A 1S57A 2W9AA 5J2PA 2Q66A 3QLHB 3CCMS 1RTZA 4LR9A 2AKWB 2KT5A 4E2FB 2DXFA 3RW6A 4QU6A 3GZ7A 1WHYA 5J2MB 1S72S 5J2NA 4HYKA 1F9FA 2P9CA 2MSSA 3T1HF 3I5CA 4K4WA 2R7WA 5H9FJ 4F7VA 4ECWA 1ZBTA 4ZLJA 4NL5A 3FVYA 3VAJA 5GMDA 3MMAB 2ZH3A 3Q8SB 3WX4A 2G13A 3SCLE 5JVGQ 2P6SA 3R5BA 2MLZA 4NRTA 3B8HA 1U48A 2ZUAA 5IOLA 2P6TA 4KFBA 5KFMA 2RQKA 3OLAA 4KY3A 5IM0A 4R25A 2HMIB 3FCHA 3HKZD 2ILZA 2VOOA 2R8JA 3GQCA 3BBBA 2OIHA 1ITPA 1S9EA 3HSGA 1VISA 2I2YA 3DGPA 4C7QA 1BUXA 4K4TA 2IIHA 2NXNA 3MEGB 4O4RA 1FFSB 4NLYA 1X31C 1LWEB 2YKMB 1YITS 1LK7A 4LQ3A 5ETOA 5D3GA 1N6QB 1ZAVA 1EETB 4KGKA 1U26A 2UUCJ 3BQ2A 3OR2A 4DR5J 1TKZB 3E01A 3AQPA 4YDXA 1OJ4A 5KFEA 1NSPA 1RB0A 4ZOSA 2BX6A 4ED5A 1SKSA 4UQTA 1REVA 1UTAA 2JNJA 3CC7S 2KZZA 5DO2A 4AQYJ 1TL7B 5KFVA 3E3XA 1PJ7A 2RHQB 2H65B 2W7OA 2UXDJ 3QJJA 2DT9A 4IUFA 2YTCA 1U47A 2HQ3A 5C7PA 4USTA 4Z7YA 2PGCA 4P2MA 4TN2A 1LW2B 3FBCA 4GMKA 1IKYA 3PW0A 2W9BB 2ZKTA 1C2PA 1S0MA 1TK0A 1T3OA 2R7UA 3K2YA 4RW7A 3GP9A 1UW9A 1Z4UA 3FUYA 1C1CA 4ZHRA 2RNEA 2BRKA 1LXNA 1TKTA 2RU9A 3K8VA 1HNWJ 2RUSA 1VQ6S 4R8UB 2C2EA 2PA3A 2X1AA 2Z4PA 5CAAA 3TJAA 3FBEA 1C4AA 3JSMB 4NLWA 3MFHA 3KJFB 2EEYA 3W2VA 2PO4A 4PZVA 4JI0J 3MM7A 3W8GA 2XB2D 3UD4P 1FI4A 4RPFA 3UDVA 4GO7X 4B17A 3NRBA 4K59A 3H42A 1YRXA 2R3VA 5J1EA 2GV1A 2CJAA 1ULRA 5HQLA 2C3OA 1VOMA 3WIUA 5IQ6A 2GFFA 1N34F 4LIRA 4CLPA 4C8YA 1VQ9S 1LWCB 2EG2A 1SC4B 2GHVC 2EK6A 4DV6F 4QR0A 2XY7A 5KG0A 2IVMA 2QYCA 1H38A 2LECA 3GFXA 1IQTA 2BVZA 3QBCA 5CCLA 3QT7A 1EARA 4C3LA 3FK4A 1OPZA 1U1QA 1EJ7L 2MQPA 2DGTA 3BDEA 2BJ1A 4A8SA 2ZC3A 1LFWA 1GMVA 3IWNC 9ATCB 4LRFA 2YNIA 3OFHA 1HBUA 2PFDA 2XM3A 2J6SA 4L6V3 4TQSA 2ASYA 1R6YA 1HNVA 4ZP9A 3T9ZA 2FGCA 4M5GA 1DQAA 2HAIA 3AA9A 4FF1A 4JI1J 4DPUA 4NMLA 3FCVA 1E6VA 4ECSA 2BJ8A 2RRAA 2IM3A 1VQ7S 1UEUA 2IRUA 1JWWA 1NHUA 2DITA 3VGVA 4Q45A 5E2QA 4F26A 3BGUA 1WDTA 4NPOA 1G3OA 1NK7A 1UVKA 4KV8A 2KT2A 2KRBA 2UUAJ 2JX2A 4C0HA 2CJ9A 5DM6Q 2PSZA 2DRDA 3SV4A 2NZ4A 2Z2MA 3MZIA 4DL3A 4I56A 4OHYA 4LSZB 5I3UA 4QQBA 1ZETA 1KNZA 3UDEA 4I0WA 1HQUA 2K1RB 1FJ7A 2FVSA 4FBUA 1F9EB 4I68A 2WAQD 4OI3A 4NMXA 2HS3A 3PX0A 3MAQA 2ASLA 2QEXS 2V6AA 1N32F 2HKEA 2Q3PA 3AD8C 2YX7A 4QWCA 5KFWA 4GKKF 4ZVRB 3H5XA 4NE9C 4IOCQ 4DR4J 2FY1A 2B3TB 1RTHA 2HHHJ 2B4VA 2IM2A 1V6HA 1HWUA 1RTIA 2VG6B 3VZHA 2GAGC 2ALYB 1D9FA 1HW9A 5HLFB 2OHDA 1Q5YA 3NBPB 5L39A 1WC4A 3M32A 5F8JA 4DL0C 2V4JA 2HEKA 2IDEA 3D3BJ 3PW5A 3CMAS 2ZD1A 3DI6B 1R43A 1EQ0A 5B0CA 3W9IA 1RCOB 2AHOB 3GR0A 1RT5B 4NLUA 1FRJA 2G0IA 2C2DA 1X4FA 1HMVB 4C98A 2RJZA 4B3SF 2AD9A 1XMQF 2C2KB 3NMAA 4TU7A 4DJBA 1FTCA 1O6XA 4C0OC 2ZUGA 3NCQA 3CJTA 1X9WA 4B3MJ 3CD0A 1VQNS 3Q8PB 3D67A 1KLMA 1IBLF 2H48B 5HL7Q 4U7UD 4LF5F 4HLBA 1IBMF 4JI4F 4LF8F 3MUMP 2R9LA 1Y5LB 1WWHA 3EUNA 2Y1JA 4RUCA 3FEYB 3W63A 2HNYA 4CT8A 1KLNA 3N6NA 2V0NA 1B99A 2J0XA 3QPIA 1VLOA 3GR1A 1HI8A 5LJ5Y 4RW8B 1CQNA 5GAEU 1LWFA 3CJRA 2ZOGA 2KFNA 4J9UE 4C3KA 4X4TA 1SXLA 2AJQA 3K58A 1CPZA 2HWHA 1QSYA 1QM9A 2MQOA 1LW0B 1WI6A 4EFAC 1MROA 1PCAA 3SIPB 1H98A 4RWWA 4RW6A 3ITHA 3PO5A 5HBMA 2UXBF 4QYZK 5AXLA 3DOMB 2XCAA 2DRBA 3MR3A 2QSWA 4KO0A 3BKFA 3VAIA 2L9WA 5HATA 2I38A 2V8PA 4ECZA 1WC1A 1S1UA 2WVFA 3LPEA 3AJDA 2ZH9A 1UETA 2JHEA 2CVEA 1SVDA 1CEZA 4K4SA 2PEHA 1KQKA 1HBNB 2Y8WA 2OPQA 3CDBA 1KQFB 4WZMA 3VGSA 2AEFA 1VLYA 1HYSA 3UD3P 1S79A 4EO8A 3BB5A 5K8PA 1WNEA 2XWYA 2KZMA 2B43A 4FVMA 2J6UA 3CDAA 3PYDA 3CF5Q 4GC6A 5I42A 1M5PC 2J9DA 2NYHA 3VZIA 4K4VA 2E5JA 4YB5A 3HK2A 1S99A 2F9DA 3JB9k 5F3TA 2V68A 2GX8A 1RYSA 2E44A 1NXIA 1SCJB 1CJUA 2HGNA 2QMUB 1GQEA 4L73A 1OMSA 3C66A 3CW2C 2IC3B 4O3OA 5KG1A 1RT3A 4NA2A 2ZEJA 1JLBB 1QJHA 4Y6IA 2BXJA 2VQEJ 1DTQA 2E5HA 4IFVA 4YR3A 4WXOA 2NUUG 3CJ2A 1SUQA 3QJLA 1SV5A 1S0NA 2DGOA 2OMOA 4DOZA 3GCXP 3FNNA 4CYUA 1TAQA 4Y28C 3C16A 3JAMU 2OSQA 2OH2A 1QAIA 4WE1A 3HLUA 2VICA 1RABB 1FRKA 4JI2J 1WOOA 1GMWA 2CWKA 3BKTA 4QJVA 4PPDA 3MUTP 5ETRA 1KSPA 1GTEA 1I94J 2BJDA 1SC3B 4CTAA 3LA0A 4F50A 2QIFA 1Y3JA 3CJ8A 4DI6A 4LFCJ 4PABA 1C0TB 3G8SA 3ENVA 1WELA 3N79A 4DR6F 1J27A 1DRZA 1RE1B 3HSZA 3SCKE 5ETMA 4K7QA 3HHNB 1XMOJ 2W7PA 3IN5A 2MGZA 2RT3A 4F3QA 2R2TA 3PEHA 1NZAA 1T9YA 5BYSA 4B9SA 3LQVA 2J0SD 4F0MA 3R5DA 3IRXB 3IS9A 3TVZA 2XNQA 3SEOA 2GVDB 5KG4A 4CLUA 2BKOA 1SC6A 1RAIB 2HK2A 3MMCB 1FVQA 3BPSP 2F65A 4U8YA 3TAQA 2VASA 1YJ7A 4GKJJ 1R3NA 5A0YB 1XNQF 4P75A 2MTLA 4CIOA 3KDNA 3ETOA 3MM9A 2B9XA 1RT4B 1TL3A 2FC9A 3ELHA 4H4MB 2AJ1A 4WP8A 4CLWA 2OPSB 2GJIA 3V4IA 3ZZPA 5FDLA 3GJRB 3LP1A 2G9OA 1SH2A 1D8YA 4DV7J 4X4VA 1S6PA 3J81U 5A8WB 3GILA 4PWUA 3MF5A 2Y0BB 5E3AA 5F8MA 3M6WA 3GSDA 1EQMA 1CJTA 1VHFA 3QATA 4ED4A 1TUWA 1WTFA 3CCLS 1HFEL 2DR5A 4RNMA 1S76D 2MQNA 1BQXA 4ID8A 4XTTA 2K2PA 1N5YA 3KG4A 3F41A 4PG5A 1HD1A 1N5SA 1QE1A 1FK9A 1GFWB 2YNHB 4HACA 3Q23A 4MH8A 1PO6A 2W2QP 4WWSA 4PWDA 4JV5J 3MXHP 3BH7B 4P10A 5AJ3J 1R0CB 4HHJA 3DKDA 3K7RA 2W9CB 4X62F 1NKCA 5M2PA 3NNHA 4OI6A 5ITHA 4PYDA 2O01C 2HWIA 4UOFA 4O3RA 4O0NA 5J2PB 1Q79A 4K8RA 4YS2A 6AT1B 5IV4A 1UVIA 3PYEA 5CYMA 4EYIB 1H2VZ 5J2NB 3Q8VA 1MNEA 4WFBQ 2AGOA 4IOAQ 5A6PA 3I0SA 4FXDA 3NEKA 2C3MA 1OSDA 1UJ5A 5HROA 1NPPA 2GIQA 6FDRA 1P9QC 5A8KA 2BKPA 3QT5A 4OJ1A 4HTJA 3EMTA 5B0AA 4OZJA 1TELA 3TAMA 2ATLA 3MCNA 3ZZOA 4LRCA 1A9NB 2YKPA 1O0PA 2DCUB 4KFBB 3T6JA 3IAM9 3DHXA 5IM0B 2EWHA 4KQZA 1EX8A 3V2UC 1M5SA 2R7OA 1VI7A 1NCLA 5HK4A 1K0TA 1ZZFA 2DH7A 2F1FA 3K89A 2LU1A 1S9EB 2AX1A 1Y5NB 3TJ8A 1WOSA 2HVZA 4MMOA 2M0GB 1R8CA 3DGPB 3VCDA 3K5PA 3G96A 2J0QD 3TA0A 3DOLA 4DV3J 1RWOB 2A10A 1HNXJ 4B3TF 4DR7F 4DFMA 4DQRA 1JB0C 1F0XA 2QFIA 3A3OB 4IQMA 2M88A 1MN9A 5THWA 3DMJA 4J9KA 3C6UA 4ED1A 3N5FA 1DLOA 3OR2B 2XI3A 2RHSB 4U7UK 3JSBA 4KSEB 4BWJA 5B09A 2X3GA 2GJ2A 1SL1A 3I96A 3KFWX 1U8WA 3E01B 1XWLA 2XO6A 1FRLA 3M6UA 1UWAA 3DDIA 4A4JA 2FZKB 4USMA 4OLOA 3OL9A 2MYFA 4Y2KA 4NXNF 1RAOA 3A12A 3R7SB 2W8LA 1OO0B 3T5JA 3MPDA 2QMWA 5D4PA 5HANA 1XR6A 3NKYA 1MU2A 4O4GA 2M9KA 3V6HA 1QY7A 3IR5B 3M7VA 3CCRS 1MWZA 3K59A 2EC2A 5EWEA 2W4PA 2B0GA 1IKYB 4YB1P 2HQIA 5LXRA 4FZVA 2Z2ZA 2KB2A 4RW7B 4USIA 4B9TA 4KT0C 4I2PA 2DCLA 3HT3A 2DPIA 1YLXA 3OLBA 4ZHRB 5KFKA 2HW3A 1U0HA 2CUYA 2F9JA 1FRHA 1TKTB 2CQBA 1VQKS 2B8PA 2AJ2A 2K7KA 2W4DA 5MLCV 2KL8A 1Q5VA 1W25A 3SCIE 3ZO7A 3CCTA 1RQ0A 3W2VB 4DWIA 3N9UC 2AZ1A 3MM7B 2YWKA 3A13A 3GYXB 3T1YF 4YY3F 1GT8A 3SV3A 5J1EB 1TUGB 4MK7A 1RA6A 3RB4A 3LF0A 1RT2A 2OFHX 2X3DA 4ZP6A 1BQNB 4NCAA 1J5OA 5CD4A 2E9RX 1Z1ZA 2DNHA 4DLEA 2GIRA 1U1NA 3OBIA 3BYRA 4PG8A 3EWGA 4HH0A 4PXBA 2K7JA 3NGTA 5K14A 3P5TL 1JLGB 2IHR1 3GIRA 3W2WA 4UTGA 3GFZA 2DHHA 2MQ8A 4OZ5A 1UEVA 8ATCB 2DR7A 2VA2A 5KFAA 5A6WA 4FKYA 1N36F 1X7VA 3DFEA 2MZTA 4ZJQA 4NLTA 2CZ4A 3PFEA 1NSKL 3TNVA 2MSTA 2QC3A 1IBKF 1I6JA 3X3UA 1F5BA 1HBUB 3R6GB 2MJUA 1YHQS 5KFJA 2X7IA 1HNVB 4X66J 2QSFA 2NUHA 4MAKA 3B6BA 2D3ZA 2MZRA 3HHLC 4A47A 1E6VB 4CRJA 3F56A 4ECXA 1U49A 4IFYA 5KAKA 4B9NA 2XMVA 2AMCB 4ZP7A 1RHQB 1N0VC 4AE5A 3TR5A 3MM6A 1VFJA 3S1TA 3A4TA 4DUYJ 5C2GA 4KV8B 4DR3J 3CD5A 4A8XA 1N33F 1HI0P 2J5AA 3V6DA 1WEXA 1RWMB 5E41A 2QL9B 2MB0B 2ROGA 2OTJS 2E7WA 3OR1A 2H5EA 3I6PA 4CLFA 1P6TA 1KP6A 3QMQA 4BHQA 1T3NA 2PE8A 3T9NA 4YN3B 1PSDA 2X1GA 3NL0A 1FNXH 1N5QA 1SQGA 5KG2A 1ELOA 4R5PB 3V6JA 1SKWA 3R2DJ 1HNZJ 4MIWA 5G0RA 5DG7A 4M5IA 1S4EA 5B7WA 4QR2A 3ZTPA 2K3IA 4C8OA 2CG4A 3HD2A 3GJSB 1TTHB 2DH9A 2DHAA 3HCXA 4OI4A 1NJIT 5FLXU 1RTIB 4YOEA 1SBRA 2GZOA 3W65A 2V5HG 4ED3A 4ZCIA 2HVIA 2UV8A 4OYMA 1Q16B 3GFYA 1PC4A 3M32B 5H1SV 2V4JB 2A6OA 4IKAA 3OJSA 4G6VB 1C0UA 2ZD1B 5CCMA 5LMNF 2P5VA 2D9OA 1BXNA 1O8BA 3BSCA 3K5MA 1D1UA 1U1OA 1CS4B 4DR1F 2B6AA 3DRRA 4B3OB 3BSNA 3CJKA 2RS2A 2B5JA 1KLMB 5IS2A 3HJFA 3DN9A 2YVSA 2ZVIA 5GAGI 3G2XA 2ZVSA 1JK9B 4OFZA 2M52A 2H54B 3CULA 2HNYB 3MEDA 1D09B 4OX9J 4DQQA 5I3QA 5KTQA 4DV4F 1EP4A 3PRDA 4QBUA 1NPKA 3POTB 2ZH8A 2MHNA 3OV7A 1NHVA 3FQKA 1JXEA 2H9ZA 3DDKA 2I5JA 4FF2A 1LWFB 1JLAA 5IV3A 3RAXA 2RE1A 3O2IA 4K4YA 4CO2A 1HHSA 2BQ3A 2CPXA 1Q4RA 1UZDA 4NA1A 4I2QB 1MROB 4RLEA 1RAFB 4ZS6A 4JP8A 2CIMA 2CPJA 3TZYA 1UW4A 1XR7A 4OYIA 3CDEA 1MMLA 4RW6B 3ITHB 3UO0A 5HBMB 4Y2IA 1FXDA 3HVRA 4ZVHA 1ZM9A 4P6QA 3HHLA 3UI3A 2H5JB 3D1OA 2E1RA 4KO0B 3PJXA 1F2GA 2N7YA 3QFHA 2HZVA 2OP5A 3BO2A 1S1UB 2R7RA 1NSAA 1VQYA 4J5OA 2RSQA 4KH0B 2XGPA 4IG0A 1FESA 4NYPA 4QYRA 2OPQB 2ZBQA 1FFWB 3EPIA 1OY8A 1WF0A 3PM9A 1HYSB 2KFZA 1Q82T 1VHIA 3HD1A 2DKOB 3FBFA 3L9ZA 1RKJA 4LF7J 4PG4A 4FYYB 4KTQA 3CIZA 3PJWA 2X51A 3B82A 1VRQC 3IBWA 3FMWA 3BREA 3MMBA 4J9NA 3H5UA 1SL2A 4GC7A 5EX0A 3TI0A 2FHJA 3GIKA 3D9BA 3MPWA 4Q2MA 2J0WA 1E6YA 1MW7A 2BE2A 4Q7AA 3IWXA 4MT1A 2D7SA 1KONA 3MAAB 1RT3B 1RT6A 3G6YA 2FZGB 1Q1KA 3KLFA 1RDRA 1U6BA 1DTQB 1NRKA 1SUQB 5F3ZA 1TL5A 1SV5B 4A8WA 2IM0A 3US5A 2W8KA 1VIXA 2RD5C 4CYUB 2MPUA 4RWXA 4PQUA 1KVJA 1JJHA 5L8RC 4U67Q 3C16B 4DL2A 1RT7B 1WDDA 1FHTA 2DEJA 4WE1B 2ZHOA 2EFQA 5KOWA 3LTOA 3CC2S 1QTNB 1FKAF 1WG1A 3UVJA 1T94A 3R5CA 2J7KA 3R5GA 2LQ5A 2LEPA 3HP6A 3O44A 3H8YA 4CO4A 1AZSA 4DUTA 1TVRA 4EU0A 3RB0A 1RWPB 1CSJA 2HHPA 4DN0A 2CJYB 3TZZA 4V19X 3QO9A 1AA1B 1F9HA 4ZVSB 2HURA 4DPTA 1HR0F 1IWGA 4V1Ak 2AJ0A 4ZJOA 2V2VA 3AOBA 3F0NA 2MGZB 3VAHA 1FJGJ 1HBMA 2WBRA 1QAXA 2QA4S 3UCGA 3F44A 2CXEA 3M2VA 3FBBA 3WC0A 4UQGA 2CQ3A 3IS9B 1FWPA 4O44A 3EE3A 5ETVA 2UVWA 4IYQA 3CC4S 1U09A 4ZVPB 1HBOA 2RB7A 1R7IA 1WC6A 1TAUA 2UVVA 4BLGA 5HN0A 4WZQA 3HSDA 1KN6A 3MM9B 4MYTA 1TL3B 1NUEA 2XLKA 4ZA1A 3MD3A 3V4IB 4DL7A 1S6PB 2Q6BA 3G87A 1M1GA 4PRFA 3M2RA 2LEAA 4ES3A 1YJTA 4X84A 5C25A 4FDFA 2V8HA 1B3TA 3K0JA 1F3VA 1CJTB 2DNPA 1FKOA 4P73A 1N0UA 4ZVGA 4F2RA 1NU4A 4C11A 3M2UA 1T7PA 4HI1A 3DU6A 2Z0GA 3M8QA 4QIWD 4R0EA 2NCKL 3M4XA 2POKA 3D68A 1QE1B 1FK9B 4M8LA 1Q8IA 4HACB 3G9CA 1M5HA 2RILA 2VG5A 2V2ZA 1RBLA 4PWDB 4NEZA 3J7YU 4OZ3A 3N6LA 1HI1A 3CWJA 1GX6A 5DQHA 3PACA 2QLFB 2OD4A 2KVIA 2UXDF 4LRBA 1Q81T 3W5ZA 4HDGA 5GAHI 3ZZUA 3MGJA 2RVJA 4BS2A 1KOHA 4FPIA 5HI7A 3T41A 1V5IB 2QL7B 2N4CA 3Q24A 4ETXA 2LQJA 5CYMB 3MTJA 1G7CB 3ICLA 3Q8UA 1UWBA 2J8SA 4WJBA 5D0HA 4JI3F 4ELUA 3I0SB 3GIJA 3B78A 5BR8F 3TARA 3H90A 3BO4A 3FGVA 3AQOA 4Q2LA 3AB4B 1SQEA 4A8QA 4OI0A 5HROB 3ILOA 4UUWA 3GTYX 5A8KB 2KT3A 3WQPA 4QWEA 1HNWF 1IR0A 1Q95G 3TAMB 4BC7A 1S9GA 1YJNS 3HFVA 4YHHJ 1OIAA 4FKXA 2ADCA 1S1WA 4EBEA 1OY9A 3EGWB 3NNCA 2XMUA 1CJVA 2VFVA 2E29A 1TP7A 1U4BA 3OFGA 3NS7B 3RTVA 2Y1IA 7AT1B 1PC5A 2UV8G 2CJQA 4AFFA 1Q8LA 3DOLB 1BHNA 2ABYA 2EK1A 3EDRB 3BYPA 3NAHA 1FRMA 3ULHA 2BW2A 2I9SA 5GADU 2DD8S 1OQ3A 2ZH6A 3DMJB 4LBHA 2Y0SD 2YY3A 3C6UB 1IM6A 2JC0A 1WACA 3HF5A 2H3EB 3P6YC 3CJ4A 4K2XA 2V4RA 4LSLA 3KHRA 4UUXA 1T9VA 2MKJA 3LGNA 2BKNA 2FLOA 2ZITA 5KT2A 2ZBCA 4KHPJ 2E1AA 2DGQA 2V94A 2OPRA 1YZ6A 4B9UA 3M8RA 4P7TA 3QJPA 2WSEC 3GYGA 1KQSR 1FEHA 3BH6B 3HHEA 2HBYB 3TUPA 4X4SA 2EKYA 2R7QA 4ZPTR 2QA1A 1MU2B 3JTOA 4O4GB 2DNYA 2V8GA 4DX5A 1UA0A 4WPAA 3AXKA 2E5GA 3HKWA 4AL7A 3G86A 2F4VF 2Y8YA 2FY8A 3VQTA 1KOOA 2HGMA 4F25A 2XYPB 3L7UA 4I6YA 5HMXA 4ZVQB 4J9SA 3BO3A 4WIIA 5KFRA 3TO8A 3IO1A 1LWXA 3EXYA 4WFZA 4I2PB 3J80U 4FBTA 3V4MA 2A18A 2YQ0A 3H40A 5EWFA 1U0HB 1YG0A 2PDAA 3DNCA 2V9WA 2DRAA 3DRSA 1XJWB 2KH9A 1F5AA 1A6LA 4Y65A 4ENOA 1KQGB 2MZ1A 4Q44A 3THVA 5C2CA 5KFTA 5HMZA 3JYTA 5K8MA 4X65F 2XMTA 3IR6B 5HVFA 2HWTA 2R42A 5CHCB 2QT7A 3HVTA 1T95A 3DRPA 3JQMA 1S7IA 4ZIWA 1N34J 3DLEA 1PBUA 4PAAA 3J80Y 4DUZF 1VQOS 4LF9F 2KG1A 1RT2B 3UW1A 4N5SA 3FC9A 4DV6J 2DNOA 5KT6A 4LJMA 2VFUA 2AX0A 1OS5A 4RR5A 4ED7A 4YB6A 3W8PA 2H5IB 4KGVB 2AGQA 5K14B 3CSKA 2VUGA 3IAS9 2ZC4A 3R5JB 3M9NB 2VIHA 4C2MA 3W2WB 2Z8QA 4DPXA 5E33A 2PN6A 4J9VA 2FHMA 1RHUB 1S77D 3TOQA 1K47A 4QIGA 3JSRA 4RL1A 5B0GA 1UFKA 5AXMA 5KFFA 1FNMA 5C42A 1JLCA 3PW4A 3OTDA 1LEOA 2G0CA 4ZITA 1H6KX 3RBEA 5DG8A 4DL4A 3MPVA 4ZCKA 5AE2A 4PYAA 4M5LA 3BZQA 4B02A 1QD1A 2PA8D 4KB7A 2UXCF 3KLHA 3M8SA 4ZCLA 3R8YA 1U7LA 2AIRB 4IFYB 1MG7A 4DQSA 4C8ZA 2APOA 4E98A 4Y2AA 4I6WA 2NXJA 2WW4A 3O3LA 3RAMA 3V6DB 1FTRA 2AYMA 1X60A 4J9PA 1VQ8S 1M0SA 2VPXB 5IFMA 4P2FA 4TY9A 2FJBB 4IRCA 1FXLA 2CPHA 2W7AA 1N32J 2XZDB 1OSCA 4DL5A 2CQCA 4HT7A 4GKKJ 4C4WA 3OXGA 5DLFA 2WRMA 5F8LA 5HQ8A 3Q8RB 2LXFA 4CH1A 5J1NA 2BABA 2ZJPQ 5G0RB 3V81A 3HVWA 2VZ9A 4QU7A 3BDPA 2VQFF 2ZBIA 3UD5A 2HBZB 4KPCA 2GA7A 2NS1B 2G2YA 3ZTRA 5HMYA 4OZLA 3DOKA 2QMXA 3SZ2A 2EFGA 2RKIA 2CA9A 3IGVA 1G1XA 5L1LA 2IYIA 1EZZB 4P74A 2KRRA 4R0JA 3TYTA 2H51B 1H2UX 3NWGA 3QT8A 1BWEA 3NGSA 2VC1A 4PKDB 2FHJD 1QTMA 1JLEA 1YKWA 1D8ZA 2DK2A 2AYGA 4WF9Q 2BOAA 1IJFB 3S7RA 1Y0HA 4LRAA 1RWVB 3HFKA 4B3SJ 1WSVA 1A7GE 1L3UA 2E66A 3CCVS 1XMQJ 1RU2A 2CNKB 3LWMA 1N5VA 4NLDA 4JI7F 1ZM2A 3TWZA 1IBLJ 3PZPA 4LF5J 4JI4J 1IBMJ 3RGIA 1YI2S 2YKNA 3DRRB 3CJKB 3D0IE 2ZDPA 4NLQA 1FJEB 1RP5A 4X4PA 3OXLA 4C0BA 2OTLS 3HJVA 4BC9A 5A8RA 4O0IA 2L41A 1DQ8A 3MCMA 3KYLA 3MEDB 3VVUA 3IBFB 1ZTWA 3DLGA 1EP4B 3ZZYA 1RAEB 1R0AB 2PI5A 2DHSA 1KFDA 3SDEA 4N77A 2XQCA 1WJ9A 2I5JB 2YWWA 1AXQA 1JLAB 4ILLA 1FCAA 1ZAXA 1VBXA 1RHJB 4TKTA 2F7VA 2KXNB 2WVEA 1JJ2R 1X4DA 2PMWA 4BWMA 3GB0A 2MLXA 2UXBJ 3PO4A 4K5SA 1S1TA 3SQOP 3NOGA 4TYBA 2ZHBA 3M9OB 3ZTOA 2CQPA 4H4KC 3AD7C 4NRUA 4OYXA 4KIAA 2DNQA 3HHLB 3TX8A 1ZA2B 5MAOA 2LQBA 4DV0F 2VFRA 2CRLA 2FYXA 1P1LA 4ZLNA 2MQQA 4DCPB 4KBIA 4IG0B 4DBQA 1YJUA 3CB4A 1JX4A 3SQGB 3TJ9A 3NGKA 3UWTA 2V2KA 4IDKA 4RU2A 4NZ7A 2ROPA 2HFOA 2YWEA 2COLA 2IMWP 3VQSA 3R6LB 2DGWA 1X5PA 1PAUB 3Q86A 2HVHA 4TU9A 2Y3YA 2KDOA 2W4CA 2L3MA 2RDDA 5D6GA 1N54B 2XMMA 4URGA 4LF2A 2MHEA 2HZAA 2MZSA 2C3PA 2QE5A 2BA9A 2AEMA 5C5JA 5EWGA 2L48A 4LRDA 3RZAA 3A8EA 1ZS6A 4KJIA 1RWNB 1F3FA 1WEZA 5ADZA 2GQ2A 4L72B 1E6YB 1Y9OA 1FFGB 2XGQA 2RRNA 1JXLA 1HIYA 3OVBA 2E1PA 5A2QY 3KUGA 4U96A 1RT6B 4USHA 2VKRA 4I64A 4DX6A 4Y00A 2G2OA 3KLFB 3RRKA 2QYGA 3H5YA 5EDWA 1GEHA 3EDQB 3OUYA 2NSCA 4P7VA 3KTQA 3H7HB 1S5ZA 1U2CA 4PQUB 5EHHA 5AJ3F 4NOHA 3HXMA 3M30A 3ZTSA 3R2CJ 1UEKA 3LOUA 1TL1B 5DQGA 3PVXA 2EFVA 1V3SA 3WHIA 4FVCA 3N4WA 3I56S 1AZSB 4FYDA 1GMUA 1VRUA 1JKHB 3ZZRA 1TVRB 5L9NA 2MLYA 1AUSL 4QCLA 1DARA 2B4PA 2XHWA 2G2ZA 3U1NA 4DX8H 1K44A 3QO9B 4LFBJ 2P9GA 2P9EA 3MMAA 4HT5A 5DDOC 2CQIA 4OX7A 2HFNA 4HH1A 1U25A 1HBMB 4ZK7M 4WK3A 1DBDA 2HVDA 2VC0A 3M2VB 1S49A 2Y1LB 3RBZA 1TMMA 2BUNA 1RWWB 2FLNA 1XNQJ 4DSFA 2C28A 4HVZA 2PC6A 1HBOB 2KTQA 3TEGA 1YK9A 2J7UA 3M1VA 3TVKA 3UFCX 2HVEA 3C2PA 4DQPA 3I82A 3NNAA 3K5OA 4FNHA 1NH7A 4IR9A 3MEGA 1ZTTA 2NQPA 4H4KA 4NZ6A 3GYNA 1LWEA 5GAHU 3WC2A 3CCUS 2XO7A 5GMKa 3O5TB 1N6QA 4OL8A 3IC1A 1EETA 2ZH1A 1V3ZA 4KPYA 2AW0A 4KKOA 2ZNZA 5LXYA 1IM4A 3PIPQ 1FKOB 1SH3A 1IKWA 5CZXA 1VR6A 5CABA 2JLGA 3M2UB 3CJ0A 2E7VA 1TKZA 2EFPA 3NOCA 4EYHB 2FB0A 3M8QB 4ZVTB 1VC5A 4N47A 2DNZA 3DRYA 3MDFA 1VC0A 4UY85 1U45A 2LKZA 3I4PA 4WKYA 4X62J 2VG5B 2JWNA 5LJ3Y 2HQGA 3KK3A 2IA0A 1PGZA 4F4KA 5EX3A 3U7JA 3CJQA 2XS5A 2VU5A 3D66A 5AXNA 1P9YA 3OTOF 4F4WA 3PG9A 4WFNQ 3KOAA 2H1YA 5EN1A 1S6OA 3I5BA 1W7WA 2VDHA 4CH0S 2RF2A 3NWRA 5IT0A 3D1QA 5BJRA 3OHAA 1UWBB 2YPYA 2YNFA 2ZDOA 3PKMA 1YJWS 4XDDA 4IH5A 2R7TA 4N76A 2GHWA 2G4BA 3M8YA 4U95A 3IFEA 3SSRA 3EICA 1PG5B 5ETTA 4O3PA 2IDLA 1U1MA 1T11A 4CLSA 1NK0A 3PHTA 1S9GB 3KMSA 2FJXA 2BZ2A 5G4DA 5H9FK 3MM8A 3LAKA 2EW9A 1GNKA 2BMBA 5HO4A 1S1WB 3IRWP 1XQIA 1UZHA 3G6ES 1SJQA 1URRA 4CZCA 4A46A 2FJEB 4DF8A 1UVMA 1CJVB 3EVMA 2FHKA 4B3RJ 1AROP 3UN5A 3J7AN 2FLPA 2XI2A 4NASA 2WTFA 3CNQP 4B3TJ 1HLWA 3KNGA 4DR7J 1U6FA 2BQUA 4CP5A 2LFVA 1LWCA 3X1LB 4NCGB 1W2IA 3I0RA 4RBVA 4OMFG 1QSSA 1SC1B 3MM5B 2MQLA 2IRXA 1AFIA 2KYXA 2XG8A 3NG8A 3I55S 2C42A 3P8BB 1R6VA 2YWHA 1XR5A 4MYUA 2HSEB 5LMUF 1TKXA 1IWAA 1HWJA 1SJ4P 1W2BR 1VK3A 5M2RA 2VPYB 4LSLB 2WONA 2XZTB 4K50A 3QRQA 2BDPA 4QWAA 4NXNJ 1M5VC 1S1VB 2VJVA 3VTIA 3QZ8A 5H9EJ 2OPRB 1TZ0A 2A3JA 1ZH5A 2DXDA 3K17A 5KFNA 4P2XA 5HP1A 2OEKA 2XMJA 1KVIA 3QIPA 4PG6A 1FA0A 4X66F 3BJYA 2B9YA 1J2VA 2RH3A 2QFJA 5KFCA 2DR8A 1NKEA 5AE3A 3DXSX 1KR4A 7FDRA 1RUSA 4LF6F 1PYTA 1N52B 1NO8A 3D6TB 1SB6A 1V9OA 3D0GE 3S8SA 3ILJA 4DUYF 4UZBA 2SXLA 1AFJA 5D77A 2UZAA 8AT1B 3MUVP 1NM2A 1S1XA 3KUEA 3VAMA 2BRLA 1T0TV 3W5XA 2JEJA 3KXDA 2XSFA 1DTTA 1XNRF 4LREA 3QQCD 4ZLPA 3UNYA 2WSFC 3GG1A 1X4GA 1M5OC 3DRSB 4K4XA 4ZMMA 3T1YJ 2XMAA 1CC8A 5ETPA 3P45B 3UQSA 1WC5A 4YY3J 1VBZA 2XS2A 5L1KA 4J9RA 3JYTB 1H2TZ 4NI2A 1HNZF 2BJ9A 3AJ1A 4MKBA 1SIWB 3W9JA 3DCAA 3IR7B 4NLPA 1Q0NA 1P27B 1LXJA 2DNMA 5T7LA 3ETMA 4AUKA 2AJFE 3D28A 4GO5X 3DRPB 2W25A 5EUHA 3DLEB 3PX6A 2U2FA 4DS4A 2GQCA 2RQ4A 3Q0AA 3GWCA 1VQMS 3NBPA 2M4MA 1S0OA 4M5KA 2W2MP 5IXUA 2G0JA 2R8KA 1XK8A 2IY5B 1D9AA 1RHRB 1BC6A 3THTA 3GONA 4J9MA 4IRDA 2WOMA 4Y34A 1VJQA 4OYAA 1UFLA 2LVWA 1N36J 1TFYA 4CDIA 2YNGA 4FYXB 2HHUA 4ZPDA 3OD2A 2KKHA 1IBKJ 2FJWA 2QLWA 5ETSA 4MKAA 3WX8A 4X64F 1F2HA 2MKCA 3GG0A 2BYCA 4LF4J 2F3JA 1UMJA 1T8EA 2OGUA 5C42B 1JLCB 2H4YB 2OEJA 3K5LA 3BGFA 4TY8A 4LBIA 2NXCA 2HZCA 3KLHB 2W2PP 4KGZB 4RW8A 3Q8QB 2YKQA 4EUVA 4DFPA 2OUGA 4P9SA 5HVGA 1KKHA 4NLGA 4FXWA 3H4BA 4M5MA 4M5DA 4URQU 3CPWR 2DIUA 3LGHA 1RLCL 4WIQA 2RRBA 4TQRA 2QLBB 2NXUA 3C15A 2ZHAA 2V9KA 3KMQA 1FDAA 1OY6A 4USUA 1HWIA 2CFXA 3MTKA 3CCWA 2KFYA 4EZ9A 3DU5A 1NBEB 2EBGA 1HARA 2PT0A 1YBAA 4PWWA 1VMBA 1QLNA 3P5BP 2ZBPA 2QX0A 2HGLA 4KRWA 4TYAA 2K8GA 3DLBA 2OJ3A 2F8EX 2FGOA 2V2QA 2GQQA 3E8OA 3V81B 3PY8A 3RR7A 2KI2A 3K8WA 4HKQA 3N0VA 2GW8A 2OEMA 2XBPA 5H9EK 5L1IA 3KHGA 3DOKB 2XS7A 2NZCA 1RHMB 2VFTA 2BV3A 1O5JA 2GMHA 4CI0B 3AA8A 4K0KJ 1VS3A 2RKIB 2EXUA 4IH7A 2RDJA 3VALA 2WW8A 4OLPA 2UUWA 5KFXA 2FQQB 2BACA 2LXUA 2CQ1A 2IJFA 3EVWA 2ACYA 2M2BA 2Q79A 5LMNJ 3AJ2A 4LBPA 3JTPA 3QWPA 1IBCB 2QO3A 4CLTA 4NLXA 1LK5A 1PJ6A 1NEEA 3GIMA 4HHUA 2BEFA 2YKAA 4CWBA 5BYRA 4C48A 4DPOA 1B0VA 3MOJB 3M8ZA 1APSA 1FX4A 2R2RA 1ZYQA 2KHDA 5KFOA 3TQEA 4UF4A 3BBFA 3HM9A 5IC4B 1KTQA 1GXUA 5SUHA 4JI6F 3Q22A 3KWMA 5LT5A 1I5OB 3EGZA 4DV4J 3ZC4A 3CMQA 3SCJE 1H7WA 1ROFA 4X4UA 1KHWA 5A8RB 1RKIA 4J37A 1U2FA 4MFBA 1ZOTA 3DLGB 2G1DA 1D9DA 4X2BA 5AE1A 5GMEA 5DG9A 3U1MA 5JUMA 4OZ1A 4YFUA 4IOBA 3SDEB 2OAUA 1IQZA 5LL6d 4NLRA 4FF3A 1FERA 3TZWA 3KJVA 2QLJB 3P3DA 3WZ0A 1RWXB 2VH7A 2OPPA 1K1SA 1RJJA 1WOPA 1U0SA 4EK2A 1S97A 2I6WA 5KFYA 2V8DA 4CLLA 4IRKA 3KJNB 3MFIA 2CNLB 2JJ4D 4IG3A 4M1KA 4ECQA 1R8HA 1KS2A 3AODA 4IH6A 2XULA 4N56A 4CQ1A 2AQ4A 3IRXA 1RAGB 1U1RA 4N8NA 1Q53A 3CUNA 2JVOA 2E1CA 1F5CA 1UAWA 1J5EF 2CQHA 1MN7A 4TLRA 3OQ2A 1OYEA 3LH2S 4XK8C 2GAHC 3B54A 1JLQA 1FF2A 4DSEA 2Y9HA 4IDKB 3CE8A 3P4UB 4NYOA 4M63A 6FD1A 5F8NA 2D1CA 3LGMA 3A1YG 5KG5A 5U47A 3W3SA 1T9WA 4FS1A 3DGVA 3OVSA 1HWLA 1FE0A 4NLVA 4O3QA 1VQSA 2C2MB 4DSKA 3GSIA 3SXLA 3BSAA 5HVHA 2N3OA 3CD7A 2CAJA 3FSIA 2HHQA 2HQCA 3I32A 1JNZB 4OYBA 4RUAA 4DV1F 2WB1D 3G4SS 2KVQE 1FRIA 3T5KA 4WTYA 2LA4A 2RU3A 2KU7A 2VODA 3PW7A 3FEXB 3GLJA 4DR2F 3NAIA 4M95A 3GV7B 1EIYB 3UR3C 1Q8BA 1JLFA 3KK2A 1ZPVA 3L3CA 3D0HE 3OUYB 2PI4A 1QVFR 4UOHA 4X4QA 5DJBA 3FEZA 3LALA 1RGVA 2VPZB 2DBBA 3M30B 3AY0A 3PJ9A 4UOGA 1Q7LB 4J7CA 2FJAB 2LEBA 3PV8A 2JLEA 1R8BA 2D3O1 2HHWA 3D3CJ 4ID5A 1UFWA 1VRUB 1BWVA 3CCQS 1HR0J 3LWLA 3C8YA 3KLVA 3G6XA 3PYFA 3BN4A 2GO8A 3PFOA 1TUVA 2ZH2A 2V8VA 4LFAF 8RUCA 3KHHA 2ZH4A 5E3QA 4F3OA 3EX7B 4M5NA 4Q8FA 3MMJA 1FDBA 4PXEA 5IC6B 1YBUA 3NY0A 3PRBA 4DDFA 5D3GB 1RAAB 1HHTP 1GK8A 2HBQB 4RNOA 1T02A 5RUBA 4WFXA 4YHHF 3KK1A 1JMTA 1DY3A 2HPUA 1YQHA 3QIDA 7FD1A 2VV5A 3M1VB 1K8AT 5KFBA 4ECVA 2HRYA 1NH8A 1REVB 5CYQA 5DETA 3D6HB 1Z2LA 2ZWPA 4CO5A 1UP1A 3KLIA 3I9ZA 4X4NA 4CO0A 2Z2YB 2KJWA 1RISA 3GJQB 1XERA 5HSPA 3IG1A 3U02A 2GHPA 4DSLA 2W01A 4NXMF 2VONA 5KT5A 3ZZ0A 2BR0A 4KKOB 2CPYA 3MAHA 1IKWB 3S01A 5IT9U 3OL6A 3RU0A 3SMZA 2ALZA 4N8OA 2KXHA 3BEGB 2G1HA 1UCNA 2D3UA 2BJ7A 1N5TA 2MDAA 1C1CB 2AJ4A 3LP2A 1R0BG 4KHPF 2HRUA 4C6AA 4LR8A 3KK3B 1SJFA 3R7NB 3LO3A 2IRYA 3CCJS 4I67A 2H4WB 4AXJA 4KYZA 3V6KA 2F63A 4N41A 2UU9F 3GU0A 1UVNA 1TFWA 4OX8A 1F6TA 1NK5A 2HS0A 2UVUA 2ERRA 5IT9Y 2FC8A 4I7FA 1SI9A 3MECA 2OI2A 3HULA 3S6EA 4JI3J 2VA3A 2RF2B 2B8QA 1JJ4A 2QLXA 2J9EA 5BR8J 4G65A 3BBCA 1CJKA 1KVKA 2QA2A 5KT3A 1X0PA 3PHEA 2E5LF 1RAJA 2YNFB 3OPKA 3CJ5A 2WB4A 3MHYA 9RUBA 4B08A 4V19J 2HFSA 3H4DA 2ZZTA 3LAMA 2FTRA 4M94A 4LIWA 5HJYA 5E3CA 2QGFB 4EEYA 2ROEA 1X5TA 1R27B 3U1LA 1NHKL 4KH1B 2LYVA 2JFKA 3FRZA 4HL9A 4S0MA 3A3NB 1QDUB 2DVIA 1KRPA 3MM8B 2R4FA 3NCPA 3ILLA 3T5LA 1KD1T 2WBMA 1HA1A 4E0DA 2YNIB 4EI2A 3SI8A 2UUBF 3M05A 4KE5A 3LANA 2XEXA 2VJUA 3SSSA 3L7PA 1BQNA 2JC1A 3G82A 1NDLA 1B4SA 5D78A 1B64A 4NEYA 2VOPA 3EVOA 2C22A 1NAQA 4YP3A 3J81j 2GS8A 3CJSA 1ACMB 3B4MA 3I0RB 2C1EB 4RBUA 2YH0A 4QYZJ 2MMYA 1JLGA 2D69A 1WHWA 2CNNB 4PPZA 1N48A 2DEIA 2W1BA 4L74A 4F04B 5IWAJ 1T05A 1TKXB 4LVNP 1FKPA 1VK8A 4ECYA 2EC0A 2WONB 3RYLA 2J6TA 2QV6A 4J91A 2LMIA 3TP2A 5I3UB 1NDCA 3OFEA 4OHVA 1YSJA 1HQUB 5E5NA 1NJYA 3FFIA 1DQ9A 2HRTA 3MCOA 3ZFVA 5HP1B 2F5GA 4TNOA 3QIPB 4OZNA 4MKYA 1D3WA 4W98A 1UJ6A 3MOZA 3UDLA 3CD6S 2F4VJ 4Y2CA 4ZVFA 1GX5A 2XSJA 2ZM6F 3CT9A 4LMZA 2BJ3A 2HIQA 4ZP8A 3RBXA 2KXFA 1RTHB 2DGUA 2NREA 5HQMA 3FQLA 1VQPS 4ZPCA 3KG0A 2C2OB 3BR8A 3VWSA 2HLTA 3KJQB 1S1XB 3MI7X 4DSIA 4A48A 2HG4A 3QNWB 5HMWA 3Q83A 1DTTB 3W7BA 3MR7A 2YQ3A 3RRHA 2MKYA 1JXVA 1YWXA 3MEEA 4CNZA 4R5PA 3FSXA 4EMDA 2EFOA 4OJHA 2HLUA 4X65J 2J76E 5KOXA 1Y3KA 1PBAA 2RDIA 2MY7A 1HHQA 3M9MB 2PFFB 4YEAA 1HQ2A 3PW2A 1Q8KA 2DO0A 1F60B 2CQ4A 4NI2B 3MCSA 4ZKAA 1RACB 1DURA 4K5RA 1B7YB 3G8QA 2M5YA 4DUZJ 1XTZA 3I9V9 5T7LB 4LF9J 3P49B 1NJWA 1UL3A 2C3YA 4KHRA 3ISZA 3R1LA 1Y5IB 4ALZA 3OTBA 1UKUA 5F8GA 1S0VA 4D3HA 4NZ0A 3QWUA 3PYGA 3MPUB 2W2NP 5D0EA 2AWZA 4DV5F 3I4HX 5KFUA 1AB8A 4USKA 1PYOB 4W92B 2Q6CA 2QJ3A 3DLKA 4C9DA 2WOMB 1CLFA 4AL6A 2R7VA 1R8PA 3R97A 1ICEB 3JQJA 1EKRA 1EAYC 4QOTA 2FZCB 2YNGB 3ZZZA 4JI5F 4A8FA 5K9FA 2UP1A 3QT6A 1CS4A 4GRSA 3QYYA 4UY8T 1H0HB 2CWXA 4U8VA 2JFDA 4FS2A 4UOCA 1OYDA 4B3OA 2DHXA 4JI8F 2UXCJ 3BPDA 4CLZA 1RK8A 4QPXA 4WYLA 5F0WA 3NP5A 2Z30B 4AT1B 4F36A 4TY8B 1Y00A 5JVHQ 3KDOA 3QSIA 3POTA 2ZWOA 5DZ6A 2D3OR 4AXIA 2CDRB 1WI8A 1S59A 2DTJA 2YH1A 1FXRA 3T6BA 4FN5A 4M5DB 2Z58B 3OTCA 3OJUA 2HBRB 1RTJA 4Y0FA 4I2QA 4WTOB 5FIIA 4RW4A 2V4QA 2JEGA 2B9EA 5I42B 3BQ1A 3C15B 1RWKB 3KKFA 2GC8A 4PUOA 1DHMA 2B9WA 3NGRA 3ZTQA 2VPWB 1VQ4S 4QZVB 1SL0A 2HQDA 2AF6A 1CVJA 1CJUB 1V3RA 5KFIA 1N4LA 4LQ9A 3PR4A 3RR8A 2AP6A 2PIIA 4JYAJ 4DFKA 2VQFJ 4NA3A 5C24A 4C8LA 4DCJB 2IAJA 5L38A 1S10A 5T14A 2GNKA 5F8IA 3OHBA 4IFVB 3PKYA 2CADA 2AV5A 3RAQA 4RUBA 1T9XA 3PX4A 4JUZA 2FHOB 1L5UA 1ZAWA 2BM0A 2MZQA 2QL5B 3SFUA 3ET6A 3K5NA 1WUUA 1JQGA 3IM9A 4NCBA 4LF1A 5DGAA 4G1QA 1IKVA 4XDCA 3OVAA 4LSNA 3W1YC 4F67A 4EO6A 4UT4A 4CTAB 4ZN3A 4ER8A 1HPZA 3A3PB 3HX9A 3MAAA 2ATCB 2KJVA 1QUVA 1FD2A 4JI7J 4WXWA 1IXKA 4B9MA 1KBRA 3A8JA 3PNIA 4CM0A 4KHMA 3W66A 2DY9A 3QGIA 4K4ZA 2JEIA 4G1PA 2KG0A 3BGRA 4HEA9 4DEZA 4H4OA 1BQMA 2AEJA 1H74A 3FRYA 3RRGA 3KLEA 3HMJG 1RT7A 3H2UB 3ZNJ1 4LR7A 1JIHA 2OFGX 1EKSA 2BANA 5I3PA 4ICLA 1G4CA 1AYEA 1U1PA 4MFBB 1TV6A 1N88A 5B08A 4ZCMA 2CZ9A 1M1KT 1XIQA 1GH8A 1FWKA 3R5AA 4XO0A 3DRXA 2I8EA 3FDSA 1VQ5S 1UA1A 4BDPA 4DZ6A 3RB3A 4L3KA 1I51B 3IP0A 3RB6A 4Q0BA 3CO0P 3KJVB 1NLKL 4XIUA 1UVJA 4HHHA 2HK3A 2OPPB 5FDLB 3EGNA 3C3LA 3LP1B 1FRXA 3DYAA 4LFBF 1VBKA 3O6QA 3JAMY 1VCTA 4IG3B 3R27A 3MR5A 4FXVA 2W2OP 3GV5B 4DV0J 5FJ4A 5D15A 4DV2J 1T03A 4Z37A 2BE7D 2CNOB 1VC6A 3EM1A 2B56A 1K1QA 1IKXA 2AT1B 2Q1LA 4X4OA 1N5YB 2UUCF 4RJVA 2L08A 5BXIA 1H7XA 4DR5F 3HT0A 3NCRA 3UNGC 4DN9A 1XEZA 1JLQB 1MMNA 3UN2A 3L7OA 4HI2A 2I1RA 1BE4A 2WZ1A 4C8NA 4OHXA 3C14A 2MY8A 3KLGA 2IJNA 4AQYF 4QWDA 2ASJA 2JRSA 2OKQA 3O8WA 3CJ3A 3KHLA 2DYAA 2Y1RI 1FVSA 4MK9A 4W4MA 4YR2A 4DF4A 5E7OB 3ISND 3QGPA 1QAJA 2QN6B 2XY5A 5K8NA 4ES2A 4RW9A 3T1HJ 5DRKA 4ANDA 1R8AA 3SSQA 5KFPA 3MPYA 4ERDA 5LSRA 3RW7A 4NWBA 2MKIA 3FMBA 1JLFB 3KK2B 4EBCA 2DR6A 1YBTA 4PCQA 4ILMA 2O3DA 3J81Y 2R2UA 4YUDA 2B7CB 3EZUA 2N7CA 2MKSA 3D6MB 3IWLA 4AD6A 1U02A 3FZ2A 4USVA 4LUBA 3H2VE 1P1TA 4OV1A 1X9MA 2I0XA 1FD8A 4JI0F 2E7XA 2GIFA 1FWLA 4CM2A 3I31A 3ENWA 5B0DA 3OXFA 2BJEA 1U8SA 4ID5B 1Y7PA 1GXLA 2F40A 4ANCA 4ZVUB 1UJ4A 1X5SA 4DCOB 3TX0A 1WEYA 1NPRA 2KN4A 2FIUA 3IGNA 3M8PA 3H20A 4ZPVR 4G1IA 3J7YI 5KFQA 4U9RA 3LP0A 3C19A 4QW8A 1FEEA 1QAYA 1KFSA 2NSBA 4WBFA 3N5BA 3TUJC 3E2EA 1SJ3P 4M5JA 4EBDA 4CT9A 1VYAA 2YX1A 4QPTA 5D8HB 3VAKA 1KTVA 5F9NA 2BBEA 3C6TA 1DLOB 2XYHB 3AFGA 3JS9A 3NGDA 5D0GA 3DLJA 5LOQA 4OZ0A 3KK1B 2R7XA 3J7Z5 4JV2A 5LSLA 2IMOA 5CYQB 3BGLA 4B3RF 1Z2ZA 3I5AA 4L75A 3KLIB 4RU9A 2LDIA 1YRTA 1DZ5A 1I3OB 2ACMA 4JI1F 3IG1B 2MXYA 3H5SA 3RJMB 1WKJA 1B7FA 4FNIA 2ZZNA 4ZDNA 5ETLA 5IT4A 1XBWA 2RIJA 5CH7B 3MWBA 1SJRA 2UUAF 4O3SA 1CQMA 1N8RT 4QIFA 3PRVA 1X4AA 2IYGA 5ETQA 2FPHX 3CVKA 4DXLA 1JNRB 3LP2B 2GJFA 3NXZA 1RSCA 1LQ9A 3OTOJ 2IPOB 5CD4H 3Q2TC 3PCOB 1ZPWX 5DZ7A 3GE9A 3BQ0A 2GVZA 1DAXA 3BN7A 5IZHA 4OV6A 5GADI 2O67A 3EJMA 1F1BB 3LUYA 4I7FB 4D3GA 3MECB 3DC2A 3HVAA 4DR4F 1RAHB 2HHHF 3HHKA 4RBTA 1CJKB 4NLOA 4DL6A 3AT1B 2HNDA 1PYSB 2ILYA 1J5OB 1LNQA 1U6ZA 2V50A 2NR0A 1B70B 4P52A 3UN3A 4C3MA 4J90A 4WP3A 2KM8C 3ONQA 4ZPWR 5ETKA 2UVRA 3DM2A 3VVTA 1TMJA 5ETNA 3BF4A 3GFHA 4A8OA 3VAFA 3AOAA 1K73T 4U7CA 1LOUA 3VV2B 2FDNA 3U27A 2PMZD 2IFXA 3R9LA 2VF3A 3WDOA 2VKZG 1NDPA 1HNIA 3QAUA 2RUGA 2A2DA 1X5OA 4P2SA 2YXLA 4DU7A 2XYGB 2IM1A 4M5HA 1NKBA 1X8DA 3D5MA 2BE9B 4ECUA 1A0OB 2HNZA 1RHKB 3CO9A 1GTHA 3QRPA 4DPYA 4B3MF 1S6QA 1YRUA 4Y2MA 3MR2A 1PKUA 3G82B 1FDNA 1YDLA 2E1MC 4RX6A 4Q5VA 4DS5A 1VRTA 4DPWA 1M90T 4CLKA 2ZH5A 5LMUJ 4RUHA 1KC8T 3MM6B 1HWKA 4XPCA 4I6AA 1NNDA 1T05B 4F3MA 5KG3A 1FKPB 1TL4A 5LM7E 4CO3A 1PAEX 1R31A 3QSYB 4HTIA 2AGPA 4A8KA 3RUBL 4W90B 3EPGA 3OR1B 4IO1A 5B0BA 3EZOA 4USWA 3WIVA 3JSYA 3FFIB 4LF4F 2CPFA 3T19A 5J2QA 2DNGA 4LF6J 2R8GA 1W26A 2CJXB 2F8HA 2ZNYA 2E5IA 3Q89A 1AUDA 1RWUA 1NMEB 4JV0A 2XSJB 4ECRA 2XLJA 2GGPA 2CYYA 2NPIA 4F0HA 3HO1A 1RXOB 1RCXB 2XWXA 2B7BB 3CDUA 1CC7A 4OI1A 1XNRJ 5J1PA 4TXSA 5GAGU 2V69A 2M3DA 4XAKA 2FVRA 1AT1B 2R2SA 4U6PA 1S7HA 4A8MP 5DDRC 1BD6A 1YX2A 2VG7A 1VBYA 2ZE2A 3FSYA 4FYVB 1BLUA 4KC5A 3MEEB 2QTWA 1RT1A 3HZGA 1C0UB 3FKBA 4WU3A 1T9UA 5KG7A 3OFFA 1CULA 2LA6A 2D41A 4ELTA 3D2WA 3BM7A 1NJXA 2VQEF 4HDHA 3PIOQ 2B6AB 4LF8J 2QZ8A 2EBEA 1C1BA 1X4EA 3L4BC 5A76A 2B5JB 4TLQA 1H72C 2DNLA 4Z7CA 1S4FA 2KYZA 3NGUA 4K0KF 4EWTA 3H0PA 3RBDA 5CYJA 2CPIA 4F4ZA 3KUHA 4OQJA 4ZLLA 1XN9A 3CEDA 3PEJA 2EVZA 1YIJS 5HAOA 4JI2F 4ED2A 4F8RA 5K5MA 2F8MA 3DLKB 3D1HA 2U1AA 4ELVA 1I94F 3OL7A 2PMHA 4A8YA 2A6MA 2R8HA 2CQ2A 4X64J 4LFCF 3GJTB 5K8OA 3UE2A 3GMGA 5BYQA 5FLXY 4AL5A 3PR5B 1EHWA 3C46A 2DPJA 3H2LA 3MEKA 1XMOF 4BBYA 4RNHA 1OQ6A 5L9XA 4OYPA 2ZJRQ 2IA6A 4ZVEA 4EZ6A 3MD1A 1M1HA 1U2RA 3OTEA 4PXCA 2FVCA 1GMWD 3D4JA 1R0AA 1OPIA 1HQEA 3QAEA 4ED8A 5A2QU 1CBKA 2F4FA 1REGX 1URNA 4GKJF 1IUJA 5CZVA 2WVBA 3VGTA 1KHVA 3UCZP 1RTJB 1TK8A 2GMJA 1ZM4A 3MR6A 2DGVA 3GIIA 4RW4B 2ZOFA 3MMBB 4PUOB 4DV7F 1UPPA 2ADBA 3ENQA 4QR1A 1WG4A 5JMNA 4EGLA 3AHPA 3CXCR 4WP9A 3G71S 4UW2A 2BE2B 1RTDA 2M7SA 3TZXA 4DU8A 3WBZA 4OYZA 3IBCB 4CH7A 5C24B 2DY1A 4GVBA 2ASDA 2IAJB 3JXOA 1MMDA 5F41A 3THPA 3L09A 3K57A 3HSJA 3SQGA 4DG1A 1XMBA 2XLIA 3QRRA 4DZDA 3D7SB 1C4CA 2YPZA 2Z2LA 4OI2A 2NYIA 1IR1A 2HYIB 4B9LA 4NLSA 2DNRA 1D0EA 1ZM3A 1SKRA 1LFPA 4JV5F 1WC3A 5DM7Q 3ET6B 4Q8EA 2VBXA 1R89A 1RADB 3H25A 2C2RA 2CVIA 2ZH7A 1YTYA 2DH8A 3TEHB 3QLHA 1BMQB 4G1QB 3LW5C 4ZJLA 4WFAQ 1IKVB 3UVJB 2D74B 4LSNB 1YGYA 4I4BA 3SYZA 2LP4A 3IMQJ 5J2MA 4DR6J 3H98A 2EI5A 4JB8B 2IBKA 1HPZB 2FLLA 1EB0A 2VHGA 3VAGA 2VBYA 4DMZA 2RQCA 1LV5A 3CCSS 3W9HA 5M2UA 3D6FB 2HFVA 4JI6J 3J7A1 1L3TA 2DNKA 5L1JA 3BGRB 4H4OB 1FO1A 2EG1A 1BQMB 4DQIA 4QW9A 5DLGA 3KLEB 1X9SA 2GO9A 1PJ5A 5KT7A 2JLFA 4L76A 2BANB 1TL1A 2V67A 1VGYA 1TK5A 4ICLB 3T1AA 2HMIA 4O44B 3HHDA 4OYOA 1NZ8A 4ZN1A 3T3FA 1TV6B 2YKOA 3DLLQ 3NS5A 5B0FA 1JKHA 3W64A 4P71A 3EZ5A 2J8AA 5JXSA 5KG6A 1MWYA 3W60A 3JTNA 4Q0BB 3TRGA 3N28A 3NMRA 3QFWA 2Z56B 1BGXT 2IVYA 2JL9A 4OJ3A 4C8KA 4L3NA 3DYAB 2X1BA 2UUTA 4ZIVA 2PD1A 5IQQA 2YKMA 4DV3F 3HPOA 1HNXF 3M2RB 2VD3A 1FNOA 5C25B 4PXDA 1J5EJ 1T03B 1TU0B 4PEOA 1JJCB 1WKKA 2B51A 3VHQA 2X1FA 1IKXB 4PQAA 4C11B 3W62A 1NB2A 2VL1A 2VFSA 3UDCA 2VDIA 1RLDA 2JH3A 5E0OA 4O23A 4K2JA 3SBMA 3P96A 1IN0A 1XC9A 1WORA 4WYWA 3BS9A 3IXQA 1TL7A 3HFZB 3O1LA 3C14B 3KLGB 4ZPAA 2OO4A 1VQLS 2DR9A 1LW2A 3G6VA 1QSLA 3G8TA 2CPEA 3DXBA 2YBVA 1T9TA 1G2EA 4DV1J 5L46A 2O1PA 4MJKA 2WVDA 2W9BA 4ETZA 4RW9B 3OSNA 2VBWA 2ZOMA 4DR2J 3DLHA 4P72A 4J9QA 3AB2B 4CCHA 1Q7YT 2HS4A 2KHCA 1Q86T 4R8UA 1GXTA 4PG7A 3CIMA 4LVOP 2DXEA 2HAFA 2RMLA 3JSMA 2JVRA 4Q43A 2K3KA 2DB1A 3JQKA 2B4UA 2FVQA 4NX9A 4CLYA 2CPDA 3A8IA 3SFGA 2EFNA 4URSA 5DQIA 1WTBA 3AOCA 2Z57B 4WU2A 3CCZA 1G6BA 5AT1B 3VR1A 2K06A 3KG1A 3A8KA 4C97A 3Q2SC 5B0EA 2GMLA 3R7BB 4LFAJ 4Z2XA 2HHXA 2LCWA 2KO1A 1PILA 2E9TA 2BW7A 2AZ3A 2DNNA 4FP9A 3M8PB 1X4CA 2YWGA 4QIEA 4TVAB 2N4DA 4PR6A 3LP0B 2XCPA 1I1GA 2LDYA 4KR0B 2LU2A 3RG6A 1FE4A 2CKWA 2YQ1A 3MURP 3HDSA 2EKNA 2CQ0A 2WCXA 5E3RA 3B4DA 3C6TB 3TW0A 5F9LA 5I4MA 1U24A 3TQ1A 3VF0B 2OD6A 4ILRA 1RBAA 3LPYA 1YJVA 1L3VA 2DGSA 2EPIA 1N56A 1H73A 3I87A 1NK8A 3QGHA 1UVLA 1S9FA 1YVFA 1HW8A 2A0FB 1TR0A 4UZCA 1YJRA 1NJZA 2M8HA 4NCGA 4YR0A 4NXMJ 2QRRA 4RNNA 2OLWA 3V5RA 3MM5A 3IM8A 3ENAA 3M6VA 1HD0A 2MJNA 1VIOA 3F73A 4YDDB 4J9LA 4X4RA 2OMLA 1SH0A 3PXGa 4F0KA 4TU8A 2FJVA 2AU0A 4KGMA 2VB6A 3TAPA 5HJXA 2P2CB 1WF2A 5KFSA 4DR3F 2CPZA 4CNYA 4F4YA 5IWAF 4OZ2A 5F0UA 5LSOA 2LLZA 4DLGA 2XMKA 4MIBA 1S1VA 2O5DA 3CCES 2XZWA 3FCWA 5SZTA 2K1RA 1GAOA 2MKHA 5CQGA 1WD6A 2GCFA 1RZMA 4DSJA 4ATNA 4FYWB 2P8IA 4IO9Q 2UU9J 4JBCA 1HL6A 2FUG9 4XPEA 4IQXA 2GVZB 1MSWD 3Q8YA 1WSRA 3GPAA 5KFLA 2ZZMA 3TUIC 2E5LJ 2VG6A 1U1LA 3CGIA 1TQLA 3HVTB 5T41A 1NK4A 2N3LA 5DS7A 4GVLA 2CZVC 5HLFA 2WHOA 3AXMA 4C8MA 2BOPA 4QWBA 1FT8A 2HNDB 2IBOA 4RKUC 2M70A 4KGXB 5EGYA 2HFZA 3ZNUA 1DJ0A 5D4OA 4MIAA 3DI6A 2XMWA 3AD9C 2CQGA 2JSXA 3DM2B 4BCAA 2LXIA 1S12A 4MTPA 5CXTA 4ES1A 4NYZA 1RT5A 3L95X 1Y10A 1HMVA 1SPBP 1RYRA 4OHZA 3D54A 3UPFA 1SIZA 2UUBJ 2DJWA 2V63A 1OWXA 1HNIB 1KEKA 4O3NA 2OELA 5D4LA 4G3IA 2N82B 3CMES 3CTRA 4AYBD 4FPRA 2HNZB 2CQDA 1S6QB 4J9OA 4F02A 4CO1A 2HIYA 3QZ7A 5AXKA 5KFGA 4YQWA 2J9DE 4F2SA 1VRTB 3BGOP 1BY9A 5FD1A 3BSOA 2DHGA 4OX9F 2D9PA 4OYWA 1N33J 1Y11A 1WG5A 2JOQA 5E3PA 1WHVA 5KT4A 3M6XA 2WK4A 3OSPA 1LW0A 1IR2A 5D4NA 1UPMB 1LKZA 3R3TA 1SQFA 1K0VA 4WKRA 2J7WA 1RBOB 2MKKA 3EGVA 3FJ2A 4F4AA 1IJEB 1WF1A 1YZ7A 3TA1A 1S48A 1K9MT 4RO0A 2ZBRA 3DOMA 1L3KA 4MK8A 3OW2R 1MWQA 4I69A 5J2QB 1V5VA 2ZKUA 1YJ9S 4H54A 2W24A 2ZM6J 2J9CA 2B4OA 2NXEA 2NPFA 4IR1A 3CDWA 5GAEI 2R8IA 1FDDA 1HBNA 1ZA1B 2A1BA 5DGBA 2HHTA 3M8WA 1NK6A 2GGPB 4B9VA 3UCUP 2IJRA 3PDNA 3KNAA 3N01A 4ANEA 3GCWP 5KFZA 1NK9A 4DHVA 3R1HA 2MEWA 2QA4G 4RNFA 4LF7F 4DFJA 1VJWA 4ECTA 2MZJA 2AYEA 4MKVA 2O66A 2HFUA 1JLEB 3HHLD 1DFDA 2WVCA 2VG7B 2ZE2B 2IC3A 1RT1B 1SKUB 2L9DA 1CULB 1HKAA 1JLBA 4DR1J 4ZVOB 2DO4A 4ITSA 2XC9A 4JYAF 4OHWA 3PTWA 1AW0A 4N7TA 3J7ZT 3ADAC 1X4BA 1L3SA 4Y3CA 1PIEA 3AAWB 1RU1A 1U1KA 2LQ8A 4JOUA 2JDJA 2XHCA 1MLAA 2YKNB 1C1BB 2ZJQQ 1O51A 2M8DB 2CDQA 5F8HA 3TVYA 1B0TA 4K4UA 1IVZA 4DV5J 3DHWC
chains in the Genus database with same CATH topology
4LFCJ 3J81U 4V1Ak 1XMQJ 1N32J 2E5LJ 4NXMJ 4NXNJ 4LF4J 3T1YJ 5A2QU 4DUZJ 4YY3J 2UUAJ 4LF9J 4GKKJ 1FJGJ 2MEWA 1IBLJ 4JI5J 4KYZA 4X62J 1XNQJ 1N33J 4DV4J 4LF5J 4LFAJ 2MQ8A 3D3BJ 1IBMJ 4JI4J 2F4VJ 4DV1J 1XMOJ 4KHPJ 3IMQJ 4DR6J 4YHHJ 2KL8A 5LMUJ 4B3RJ 4K0KJ 1XNRJ 3R2DJ 4NEYA 2UUCJ 4NEZA 3J7AN 3D3CJ 2VQEJ 1HNZJ 4JI3J 3W1YC 1HNWJ 4DR5J 3R2CJ 4DR2J 4JI8J 5BR8J 4X64J 4B3TJ 4DR7J 1HR0J 3T1HJ 4X66J 4JV5J 1J5EJ 4DR1J 1N34J 5AJ3J 5LM7E 4B3MJ 4JI6J 4JI7J 4JI0J 5LMNJ 4DV6J 4GKJJ 4OX9J 4DV0J 5IWAJ 2UUBJ 4KY3A 3JAMU 5FLXU 2MTLA 4DV2J 4LF7J 5IT9U 4AQYJ 2UU9J 4DR4J 4LFBJ 2KVQE 2ZM6J 1N36J 2UXDJ 2HHHJ 4HHUA 4JI2J 4JYAJ 4X65J 4JI1J 2VQFJ 4DUYJ 4RJVA 2UXBJ 4DR3J 1I94J 3OTOJ 1IBKJ 4LF6J 4B3SJ 4DV5J 4DV3J 4PWWA 4LF8J 2UXCJ 3J80U 1HNXJ 4DV7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC J;  3J81 U;  4V1A k;  1XMQ J;  1N32 J;  2E5L J;  4NXM J;  4NXN J;  4LF4 J;  3T1Y J;  5A2Q U;  4DUZ J;  4YY3 J;  2UUA J;  4LF9 J;  4GKK J;  1FJG J;  2MEW A;  1IBL J;  4JI5 J;  4KYZ A;  4X62 J;  1XNQ J;  1N33 J;  4DV4 J;  4LF5 J;  4LFA J;  2MQ8 A;  3D3B J;  1IBM J;  4JI4 J;  2F4V J;  4DV1 J;  1XMO J;  4KHP J;  3IMQ J;  4DR6 J;  4YHH J;  2KL8 A;  5LMU J;  4B3R J;  4K0K J;  1XNR J;  3R2D J;  4NEY A;  2UUC J;  4NEZ A;  3J7A N;  3D3C J;  2VQE J;  1HNZ J;  4JI3 J;  3W1Y C;  1HNW J;  4DR5 J;  3R2C J;  4DR2 J;  4JI8 J;  5BR8 J;  4X64 J;  4B3T J;  4DR7 J;  1HR0 J;  3T1H J;  4X66 J;  4JV5 J;  1J5E J;  4DR1 J;  1N34 J;  5AJ3 J;  5LM7 E;  4B3M J;  4JI6 J;  4JI7 J;  4JI0 J;  5LMN J;  4DV6 J;  4GKJ J;  4OX9 J;  4DV0 J;  5IWA J;  2UUB J;  4KY3 A;  3JAM U;  5FLX U;  2MTL A;  4DV2 J;  4LF7 J;  5IT9 U;  4AQY J;  2UU9 J;  4DR4 J;  4LFB J;  2KVQ E;  2ZM6 J;  1N36 J;  2UXD J;  2HHH J;  4HHU A;  4JI2 J;  4JYA J;  4X65 J;  4JI1 J;  2VQF J;  4DUY J;  4RJV A;  2UXB J;  4DR3 J;  1I94 J;  3OTO J;  1IBK J;  4LF6 J;  4B3S J;  4DV5 J;  4DV3 J;  4PWW A;  4LF8 J;  2UXC J;  3J80 U;  1HNX J;  4DV7 J; 
#chains in the Genus database with same CATH topology
 3OL8 A;  2KM8 B;  2XY6 A;  1M5K C;  4E8U A;  3EXC X;  1KDN A;  1FX2 A;  1KWM A;  5GVQ A;  3BKU A;  2R7S A;  2DGX A;  4JI5 J;  5DDQ C;  1C0T A;  4WFY A;  1WHX A;  2YWF A;  2FD2 A;  2RS8 A;  3VGU A;  4USJ C;  2E9Z A;  5CA5 A;  2C3U A;  2CJK A;  3EYZ A;  4ZPB A;  1TKD A;  4JI8 J;  4YB7 A;  1RA7 A;  1S1T B;  2RQM A;  5JJB A;  4KAI A;  1X4H A;  1NDK A;  1FJG F;  2OSR A;  2WSC C;  2GVD A;  4ED6 A;  2JZ5 A;  3TUZ C;  4WK1 A;  2YX4 A;  1S6U A;  1Q78 A;  3ISN C;  3MMC A;  3ZXW A;  3E51 A;  2C2N A;  4WCE Q;  4JV1 A;  3UR0 A;  1NSQ A;  2XNR A;  5K20 B;  5A0Y A;  1HQE B;  3H59 A;  1RI7 A;  1H3D A;  1WKL A;  4QIV A;  1RT4 A;  4H4M A;  1VDH A;  2MQM A;  3BR9 A;  1CG2 A;  2OPS A;  3NS6 A;  2BM1 A;  2FJD B;  1B0P A;  3FZB A;  2VBZ A;  2L9N A;  3TA2 A;  4HR2 A;  4OX6 A;  3TAN A;  3AH6 A;  3NLC A;  3QGG A;  5A8W A;  1Y4Z B;  4DX7 A;  1QUP A;  3ZZT A;  4FF4 A;  1X0F A;  3DDN A;  2RAQ A;  4YME A;  1ZZN A;  2XTJ P;  3W5Y A;  1NB7 A;  3OT9 A;  2FVP A;  2NLW A;  4OIX A;  2Q43 A;  2V34 A;  1RTD B;  2CG8 A;  4DV2 F;  2HHV A;  1FJC A;  2HHS A;  2A2C A;  2DIV A;  2CJB A;  4GVB B;  2DIS A;  5KFD A;  2C2Z B;  2AYB A;  4LT6 A;  5DDP C;  3N6M A;  2IVF B;  4RZR A;  4DG1 B;  2YNH A;  4OJG A;  4F4X A;  2BQR A;  2PEB A;  3BV8 A;  2JEF A;  1SJ1 A;  5KFH A;  4I1T A;  3GV8 B;  2HQF A;  3HZE A;  1WC0 A;  5D0R A;  2W9C A;  1P8G A;  2QG9 B;  4ED0 A;  3IA0 A;  2LQ9 A;  1QVG R;  2ZFH A;  3T5H A;  3HI9 A;  3ILI A;  3W61 A;  1S57 A;  2W9A A;  5J2P A;  2Q66 A;  3QLH B;  3CCM S;  1RTZ A;  4LR9 A;  2AKW B;  2KT5 A;  4E2F B;  2DXF A;  3RW6 A;  4QU6 A;  3GZ7 A;  1WHY A;  5J2M B;  1S72 S;  5J2N A;  4HYK A;  1F9F A;  2P9C A;  2MSS A;  3T1H F;  3I5C A;  4K4W A;  2R7W A;  5H9F J;  4F7V A;  4ECW A;  1ZBT A;  4ZLJ A;  4NL5 A;  3FVY A;  3VAJ A;  5GMD A;  3MMA B;  2ZH3 A;  3Q8S B;  3WX4 A;  2G13 A;  3SCL E;  5JVG Q;  2P6S A;  3R5B A;  2MLZ A;  4NRT A;  3B8H A;  1U48 A;  2ZUA A;  5IOL A;  2P6T A;  4KFB A;  5KFM A;  2RQK A;  3OLA A;  4KY3 A;  5IM0 A;  4R25 A;  2HMI B;  3FCH A;  3HKZ D;  2ILZ A;  2VOO A;  2R8J A;  3GQC A;  3BBB A;  2OIH A;  1ITP A;  1S9E A;  3HSG A;  1VIS A;  2I2Y A;  3DGP A;  4C7Q A;  1BUX A;  4K4T A;  2IIH A;  2NXN A;  3MEG B;  4O4R A;  1FFS B;  4NLY A;  1X31 C;  1LWE B;  2YKM B;  1YIT S;  1LK7 A;  4LQ3 A;  5ETO A;  5D3G A;  1N6Q B;  1ZAV A;  1EET B;  4KGK A;  1U26 A;  2UUC J;  3BQ2 A;  3OR2 A;  4DR5 J;  1TKZ B;  3E01 A;  3AQP A;  4YDX A;  1OJ4 A;  5KFE A;  1NSP A;  1RB0 A;  4ZOS A;  2BX6 A;  4ED5 A;  1SKS A;  4UQT A;  1REV A;  1UTA A;  2JNJ A;  3CC7 S;  2KZZ A;  5DO2 A;  4AQY J;  1TL7 B;  5KFV A;  3E3X A;  1PJ7 A;  2RHQ B;  2H65 B;  2W7O A;  2UXD J;  3QJJ A;  2DT9 A;  4IUF A;  2YTC A;  1U47 A;  2HQ3 A;  5C7P A;  4UST A;  4Z7Y A;  2PGC A;  4P2M A;  4TN2 A;  1LW2 B;  3FBC A;  4GMK A;  1IKY A;  3PW0 A;  2W9B B;  2ZKT A;  1C2P A;  1S0M A;  1TK0 A;  1T3O A;  2R7U A;  3K2Y A;  4RW7 A;  3GP9 A;  1UW9 A;  1Z4U A;  3FUY A;  1C1C A;  4ZHR A;  2RNE A;  2BRK A;  1LXN A;  1TKT A;  2RU9 A;  3K8V A;  1HNW J;  2RUS A;  1VQ6 S;  4R8U B;  2C2E A;  2PA3 A;  2X1A A;  2Z4P A;  5CAA A;  3TJA A;  3FBE A;  1C4A A;  3JSM B;  4NLW A;  3MFH A;  3KJF B;  2EEY A;  3W2V A;  2PO4 A;  4PZV A;  4JI0 J;  3MM7 A;  3W8G A;  2XB2 D;  3UD4 P;  1FI4 A;  4RPF A;  3UDV A;  4GO7 X;  4B17 A;  3NRB A;  4K59 A;  3H42 A;  1YRX A;  2R3V A;  5J1E A;  2GV1 A;  2CJA A;  1ULR A;  5HQL A;  2C3O A;  1VOM A;  3WIU A;  5IQ6 A;  2GFF A;  1N34 F;  4LIR A;  4CLP A;  4C8Y A;  1VQ9 S;  1LWC B;  2EG2 A;  1SC4 B;  2GHV C;  2EK6 A;  4DV6 F;  4QR0 A;  2XY7 A;  5KG0 A;  2IVM A;  2QYC A;  1H38 A;  2LEC A;  3GFX A;  1IQT A;  2BVZ A;  3QBC A;  5CCL A;  3QT7 A;  1EAR A;  4C3L A;  3FK4 A;  1OPZ A;  1U1Q A;  1EJ7 L;  2MQP A;  2DGT A;  3BDE A;  2BJ1 A;  4A8S A;  2ZC3 A;  1LFW A;  1GMV A;  3IWN C;  9ATC B;  4LRF A;  2YNI A;  3OFH A;  1HBU A;  2PFD A;  2XM3 A;  2J6S A;  4L6V 3;  4TQS A;  2ASY A;  1R6Y A;  1HNV A;  4ZP9 A;  3T9Z A;  2FGC A;  4M5G A;  1DQA A;  2HAI A;  3AA9 A;  4FF1 A;  4JI1 J;  4DPU A;  4NML A;  3FCV A;  1E6V A;  4ECS A;  2BJ8 A;  2RRA A;  2IM3 A;  1VQ7 S;  1UEU A;  2IRU A;  1JWW A;  1NHU A;  2DIT A;  3VGV A;  4Q45 A;  5E2Q A;  4F26 A;  3BGU A;  1WDT A;  4NPO A;  1G3O A;  1NK7 A;  1UVK A;  4KV8 A;  2KT2 A;  2KRB A;  2UUA J;  2JX2 A;  4C0H A;  2CJ9 A;  5DM6 Q;  2PSZ A;  2DRD A;  3SV4 A;  2NZ4 A;  2Z2M A;  3MZI A;  4DL3 A;  4I56 A;  4OHY A;  4LSZ B;  5I3U A;  4QQB A;  1ZET A;  1KNZ A;  3UDE A;  4I0W A;  1HQU A;  2K1R B;  1FJ7 A;  2FVS A;  4FBU A;  1F9E B;  4I68 A;  2WAQ D;  4OI3 A;  4NMX A;  2HS3 A;  3PX0 A;  3MAQ A;  2ASL A;  2QEX S;  2V6A A;  1N32 F;  2HKE A;  2Q3P A;  3AD8 C;  2YX7 A;  4QWC A;  5KFW A;  4GKK F;  4ZVR B;  3H5X A;  4NE9 C;  4IOC Q;  4DR4 J;  2FY1 A;  2B3T B;  1RTH A;  2HHH J;  2B4V A;  2IM2 A;  1V6H A;  1HWU A;  1RTI A;  2VG6 B;  3VZH A;  2GAG C;  2ALY B;  1D9F A;  1HW9 A;  5HLF B;  2OHD A;  1Q5Y A;  3NBP B;  5L39 A;  1WC4 A;  3M32 A;  5F8J A;  4DL0 C;  2V4J A;  2HEK A;  2IDE A;  3D3B J;  3PW5 A;  3CMA S;  2ZD1 A;  3DI6 B;  1R43 A;  1EQ0 A;  5B0C A;  3W9I A;  1RCO B;  2AHO B;  3GR0 A;  1RT5 B;  4NLU A;  1FRJ A;  2G0I A;  2C2D A;  1X4F A;  1HMV B;  4C98 A;  2RJZ A;  4B3S F;  2AD9 A;  1XMQ F;  2C2K B;  3NMA A;  4TU7 A;  4DJB A;  1FTC A;  1O6X A;  4C0O C;  2ZUG A;  3NCQ A;  3CJT A;  1X9W A;  4B3M J;  3CD0 A;  1VQN S;  3Q8P B;  3D67 A;  1KLM A;  1IBL F;  2H48 B;  5HL7 Q;  4U7U D;  4LF5 F;  4HLB A;  1IBM F;  4JI4 F;  4LF8 F;  3MUM P;  2R9L A;  1Y5L B;  1WWH A;  3EUN A;  2Y1J A;  4RUC A;  3FEY B;  3W63 A;  2HNY A;  4CT8 A;  1KLN A;  3N6N A;  2V0N A;  1B99 A;  2J0X A;  3QPI A;  1VLO A;  3GR1 A;  1HI8 A;  5LJ5 Y;  4RW8 B;  1CQN A;  5GAE U;  1LWF A;  3CJR A;  2ZOG A;  2KFN A;  4J9U E;  4C3K A;  4X4T A;  1SXL A;  2AJQ A;  3K58 A;  1CPZ A;  2HWH A;  1QSY A;  1QM9 A;  2MQO A;  1LW0 B;  1WI6 A;  4EFA C;  1MRO A;  1PCA A;  3SIP B;  1H98 A;  4RWW A;  4RW6 A;  3ITH A;  3PO5 A;  5HBM A;  2UXB F;  4QYZ K;  5AXL A;  3DOM B;  2XCA A;  2DRB A;  3MR3 A;  2QSW A;  4KO0 A;  3BKF A;  3VAI A;  2L9W A;  5HAT A;  2I38 A;  2V8P A;  4ECZ A;  1WC1 A;  1S1U A;  2WVF A;  3LPE A;  3AJD A;  2ZH9 A;  1UET A;  2JHE A;  2CVE A;  1SVD A;  1CEZ A;  4K4S A;  2PEH A;  1KQK A;  1HBN B;  2Y8W A;  2OPQ A;  3CDB A;  1KQF B;  4WZM A;  3VGS A;  2AEF A;  1VLY A;  1HYS A;  3UD3 P;  1S79 A;  4EO8 A;  3BB5 A;  5K8P A;  1WNE A;  2XWY A;  2KZM A;  2B43 A;  4FVM A;  2J6U A;  3CDA A;  3PYD A;  3CF5 Q;  4GC6 A;  5I42 A;  1M5P C;  2J9D A;  2NYH A;  3VZI A;  4K4V A;  2E5J A;  4YB5 A;  3HK2 A;  1S99 A;  2F9D A;  3JB9 k;  5F3T A;  2V68 A;  2GX8 A;  1RYS A;  2E44 A;  1NXI A;  1SCJ B;  1CJU A;  2HGN A;  2QMU B;  1GQE A;  4L73 A;  1OMS A;  3C66 A;  3CW2 C;  2IC3 B;  4O3O A;  5KG1 A;  1RT3 A;  4NA2 A;  2ZEJ A;  1JLB B;  1QJH A;  4Y6I A;  2BXJ A;  2VQE J;  1DTQ A;  2E5H A;  4IFV A;  4YR3 A;  4WXO A;  2NUU G;  3CJ2 A;  1SUQ A;  3QJL A;  1SV5 A;  1S0N A;  2DGO A;  2OMO A;  4DOZ A;  3GCX P;  3FNN A;  4CYU A;  1TAQ A;  4Y28 C;  3C16 A;  3JAM U;  2OSQ A;  2OH2 A;  1QAI A;  4WE1 A;  3HLU A;  2VIC A;  1RAB B;  1FRK A;  4JI2 J;  1WOO A;  1GMW A;  2CWK A;  3BKT A;  4QJV A;  4PPD A;  3MUT P;  5ETR A;  1KSP A;  1GTE A;  1I94 J;  2BJD A;  1SC3 B;  4CTA A;  3LA0 A;  4F50 A;  2QIF A;  1Y3J A;  3CJ8 A;  4DI6 A;  4LFC J;  4PAB A;  1C0T B;  3G8S A;  3ENV A;  1WEL A;  3N79 A;  4DR6 F;  1J27 A;  1DRZ A;  1RE1 B;  3HSZ A;  3SCK E;  5ETM A;  4K7Q A;  3HHN B;  1XMO J;  2W7P A;  3IN5 A;  2MGZ A;  2RT3 A;  4F3Q A;  2R2T A;  3PEH A;  1NZA A;  1T9Y A;  5BYS A;  4B9S A;  3LQV A;  2J0S D;  4F0M A;  3R5D A;  3IRX B;  3IS9 A;  3TVZ A;  2XNQ A;  3SEO A;  2GVD B;  5KG4 A;  4CLU A;  2BKO A;  1SC6 A;  1RAI B;  2HK2 A;  3MMC B;  1FVQ A;  3BPS P;  2F65 A;  4U8Y A;  3TAQ A;  2VAS A;  1YJ7 A;  4GKJ J;  1R3N A;  5A0Y B;  1XNQ F;  4P75 A;  2MTL A;  4CIO A;  3KDN A;  3ETO A;  3MM9 A;  2B9X A;  1RT4 B;  1TL3 A;  2FC9 A;  3ELH A;  4H4M B;  2AJ1 A;  4WP8 A;  4CLW A;  2OPS B;  2GJI A;  3V4I A;  3ZZP A;  5FDL A;  3GJR B;  3LP1 A;  2G9O A;  1SH2 A;  1D8Y A;  4DV7 J;  4X4V A;  1S6P A;  3J81 U;  5A8W B;  3GIL A;  4PWU A;  3MF5 A;  2Y0B B;  5E3A A;  5F8M A;  3M6W A;  3GSD A;  1EQM A;  1CJT A;  1VHF A;  3QAT A;  4ED4 A;  1TUW A;  1WTF A;  3CCL S;  1HFE L;  2DR5 A;  4RNM A;  1S76 D;  2MQN A;  1BQX A;  4ID8 A;  4XTT A;  2K2P A;  1N5Y A;  3KG4 A;  3F41 A;  4PG5 A;  1HD1 A;  1N5S A;  1QE1 A;  1FK9 A;  1GFW B;  2YNH B;  4HAC A;  3Q23 A;  4MH8 A;  1PO6 A;  2W2Q P;  4WWS A;  4PWD A;  4JV5 J;  3MXH P;  3BH7 B;  4P10 A;  5AJ3 J;  1R0C B;  4HHJ A;  3DKD A;  3K7R A;  2W9C B;  4X62 F;  1NKC A;  5M2P A;  3NNH A;  4OI6 A;  5ITH A;  4PYD A;  2O01 C;  2HWI A;  4UOF A;  4O3R A;  4O0N A;  5J2P B;  1Q79 A;  4K8R A;  4YS2 A;  6AT1 B;  5IV4 A;  1UVI A;  3PYE A;  5CYM A;  4EYI B;  1H2V Z;  5J2N B;  3Q8V A;  1MNE A;  4WFB Q;  2AGO A;  4IOA Q;  5A6P A;  3I0S A;  4FXD A;  3NEK A;  2C3M A;  1OSD A;  1UJ5 A;  5HRO A;  1NPP A;  2GIQ A;  6FDR A;  1P9Q C;  5A8K A;  2BKP A;  3QT5 A;  4OJ1 A;  4HTJ A;  3EMT A;  5B0A A;  4OZJ A;  1TEL A;  3TAM A;  2ATL A;  3MCN A;  3ZZO A;  4LRC A;  1A9N B;  2YKP A;  1O0P A;  2DCU B;  4KFB B;  3T6J A;  3IAM 9;  3DHX A;  5IM0 B;  2EWH A;  4KQZ A;  1EX8 A;  3V2U C;  1M5S A;  2R7O A;  1VI7 A;  1NCL A;  5HK4 A;  1K0T A;  1ZZF A;  2DH7 A;  2F1F A;  3K89 A;  2LU1 A;  1S9E B;  2AX1 A;  1Y5N B;  3TJ8 A;  1WOS A;  2HVZ A;  4MMO A;  2M0G B;  1R8C A;  3DGP B;  3VCD A;  3K5P A;  3G96 A;  2J0Q D;  3TA0 A;  3DOL A;  4DV3 J;  1RWO B;  2A10 A;  1HNX J;  4B3T F;  4DR7 F;  4DFM A;  4DQR A;  1JB0 C;  1F0X A;  2QFI A;  3A3O B;  4IQM A;  2M88 A;  1MN9 A;  5THW A;  3DMJ A;  4J9K A;  3C6U A;  4ED1 A;  3N5F A;  1DLO A;  3OR2 B;  2XI3 A;  2RHS B;  4U7U K;  3JSB A;  4KSE B;  4BWJ A;  5B09 A;  2X3G A;  2GJ2 A;  1SL1 A;  3I96 A;  3KFW X;  1U8W A;  3E01 B;  1XWL A;  2XO6 A;  1FRL A;  3M6U A;  1UWA A;  3DDI A;  4A4J A;  2FZK B;  4USM A;  4OLO A;  3OL9 A;  2MYF A;  4Y2K A;  4NXN F;  1RAO A;  3A12 A;  3R7S B;  2W8L A;  1OO0 B;  3T5J A;  3MPD A;  2QMW A;  5D4P A;  5HAN A;  1XR6 A;  3NKY A;  1MU2 A;  4O4G A;  2M9K A;  3V6H A;  1QY7 A;  3IR5 B;  3M7V A;  3CCR S;  1MWZ A;  3K59 A;  2EC2 A;  5EWE A;  2W4P A;  2B0G A;  1IKY B;  4YB1 P;  2HQI A;  5LXR A;  4FZV A;  2Z2Z A;  2KB2 A;  4RW7 B;  4USI A;  4B9T A;  4KT0 C;  4I2P A;  2DCL A;  3HT3 A;  2DPI A;  1YLX A;  3OLB A;  4ZHR B;  5KFK A;  2HW3 A;  1U0H A;  2CUY A;  2F9J A;  1FRH A;  1TKT B;  2CQB A;  1VQK S;  2B8P A;  2AJ2 A;  2K7K A;  2W4D A;  5MLC V;  2KL8 A;  1Q5V A;  1W25 A;  3SCI E;  3ZO7 A;  3CCT A;  1RQ0 A;  3W2V B;  4DWI A;  3N9U C;  2AZ1 A;  3MM7 B;  2YWK A;  3A13 A;  3GYX B;  3T1Y F;  4YY3 F;  1GT8 A;  3SV3 A;  5J1E B;  1TUG B;  4MK7 A;  1RA6 A;  3RB4 A;  3LF0 A;  1RT2 A;  2OFH X;  2X3D A;  4ZP6 A;  1BQN B;  4NCA A;  1J5O A;  5CD4 A;  2E9R X;  1Z1Z A;  2DNH A;  4DLE A;  2GIR A;  1U1N A;  3OBI A;  3BYR A;  4PG8 A;  3EWG A;  4HH0 A;  4PXB A;  2K7J A;  3NGT A;  5K14 A;  3P5T L;  1JLG B;  2IHR 1;  3GIR A;  3W2W A;  4UTG A;  3GFZ A;  2DHH A;  2MQ8 A;  4OZ5 A;  1UEV A;  8ATC B;  2DR7 A;  2VA2 A;  5KFA A;  5A6W A;  4FKY A;  1N36 F;  1X7V A;  3DFE A;  2MZT A;  4ZJQ A;  4NLT A;  2CZ4 A;  3PFE A;  1NSK L;  3TNV A;  2MST A;  2QC3 A;  1IBK F;  1I6J A;  3X3U A;  1F5B A;  1HBU B;  3R6G B;  2MJU A;  1YHQ S;  5KFJ A;  2X7I A;  1HNV B;  4X66 J;  2QSF A;  2NUH A;  4MAK A;  3B6B A;  2D3Z A;  2MZR A;  3HHL C;  4A47 A;  1E6V B;  4CRJ A;  3F56 A;  4ECX A;  1U49 A;  4IFY A;  5KAK A;  4B9N A;  2XMV A;  2AMC B;  4ZP7 A;  1RHQ B;  1N0V C;  4AE5 A;  3TR5 A;  3MM6 A;  1VFJ A;  3S1T A;  3A4T A;  4DUY J;  5C2G A;  4KV8 B;  4DR3 J;  3CD5 A;  4A8X A;  1N33 F;  1HI0 P;  2J5A A;  3V6D A;  1WEX A;  1RWM B;  5E41 A;  2QL9 B;  2MB0 B;  2ROG A;  2OTJ S;  2E7W A;  3OR1 A;  2H5E A;  3I6P A;  4CLF A;  1P6T A;  1KP6 A;  3QMQ A;  4BHQ A;  1T3N A;  2PE8 A;  3T9N A;  4YN3 B;  1PSD A;  2X1G A;  3NL0 A;  1FNX H;  1N5Q A;  1SQG A;  5KG2 A;  1ELO A;  4R5P B;  3V6J A;  1SKW A;  3R2D J;  1HNZ J;  4MIW A;  5G0R A;  5DG7 A;  4M5I A;  1S4E A;  5B7W A;  4QR2 A;  3ZTP A;  2K3I A;  4C8O A;  2CG4 A;  3HD2 A;  3GJS B;  1TTH B;  2DH9 A;  2DHA A;  3HCX A;  4OI4 A;  1NJI T;  5FLX U;  1RTI B;  4YOE A;  1SBR A;  2GZO A;  3W65 A;  2V5H G;  4ED3 A;  4ZCI A;  2HVI A;  2UV8 A;  4OYM A;  1Q16 B;  3GFY A;  1PC4 A;  3M32 B;  5H1S V;  2V4J B;  2A6O A;  4IKA A;  3OJS A;  4G6V B;  1C0U A;  2ZD1 B;  5CCM A;  5LMN F;  2P5V A;  2D9O A;  1BXN A;  1O8B A;  3BSC A;  3K5M A;  1D1U A;  1U1O A;  1CS4 B;  4DR1 F;  2B6A A;  3DRR A;  4B3O B;  3BSN A;  3CJK A;  2RS2 A;  2B5J A;  1KLM B;  5IS2 A;  3HJF A;  3DN9 A;  2YVS A;  2ZVI A;  5GAG I;  3G2X A;  2ZVS A;  1JK9 B;  4OFZ A;  2M52 A;  2H54 B;  3CUL A;  2HNY B;  3MED A;  1D09 B;  4OX9 J;  4DQQ A;  5I3Q A;  5KTQ A;  4DV4 F;  1EP4 A;  3PRD A;  4QBU A;  1NPK A;  3POT B;  2ZH8 A;  2MHN A;  3OV7 A;  1NHV A;  3FQK A;  1JXE A;  2H9Z A;  3DDK A;  2I5J A;  4FF2 A;  1LWF B;  1JLA A;  5IV3 A;  3RAX A;  2RE1 A;  3O2I A;  4K4Y A;  4CO2 A;  1HHS A;  2BQ3 A;  2CPX A;  1Q4R A;  1UZD A;  4NA1 A;  4I2Q B;  1MRO B;  4RLE A;  1RAF B;  4ZS6 A;  4JP8 A;  2CIM A;  2CPJ A;  3TZY A;  1UW4 A;  1XR7 A;  4OYI A;  3CDE A;  1MML A;  4RW6 B;  3ITH B;  3UO0 A;  5HBM B;  4Y2I A;  1FXD A;  3HVR A;  4ZVH A;  1ZM9 A;  4P6Q A;  3HHL A;  3UI3 A;  2H5J B;  3D1O A;  2E1R A;  4KO0 B;  3PJX A;  1F2G A;  2N7Y A;  3QFH A;  2HZV A;  2OP5 A;  3BO2 A;  1S1U B;  2R7R A;  1NSA A;  1VQY A;  4J5O A;  2RSQ A;  4KH0 B;  2XGP A;  4IG0 A;  1FES A;  4NYP A;  4QYR A;  2OPQ B;  2ZBQ A;  1FFW B;  3EPI A;  1OY8 A;  1WF0 A;  3PM9 A;  1HYS B;  2KFZ A;  1Q82 T;  1VHI A;  3HD1 A;  2DKO B;  3FBF A;  3L9Z A;  1RKJ A;  4LF7 J;  4PG4 A;  4FYY B;  4KTQ A;  3CIZ A;  3PJW A;  2X51 A;  3B82 A;  1VRQ C;  3IBW A;  3FMW A;  3BRE A;  3MMB A;  4J9N A;  3H5U A;  1SL2 A;  4GC7 A;  5EX0 A;  3TI0 A;  2FHJ A;  3GIK A;  3D9B A;  3MPW A;  4Q2M A;  2J0W A;  1E6Y A;  1MW7 A;  2BE2 A;  4Q7A A;  3IWX A;  4MT1 A;  2D7S A;  1KON A;  3MAA B;  1RT3 B;  1RT6 A;  3G6Y A;  2FZG B;  1Q1K A;  3KLF A;  1RDR A;  1U6B A;  1DTQ B;  1NRK A;  1SUQ B;  5F3Z A;  1TL5 A;  1SV5 B;  4A8W A;  2IM0 A;  3US5 A;  2W8K A;  1VIX A;  2RD5 C;  4CYU B;  2MPU A;  4RWX A;  4PQU A;  1KVJ A;  1JJH A;  5L8R C;  4U67 Q;  3C16 B;  4DL2 A;  1RT7 B;  1WDD A;  1FHT A;  2DEJ A;  4WE1 B;  2ZHO A;  2EFQ A;  5KOW A;  3LTO A;  3CC2 S;  1QTN B;  1FKA F;  1WG1 A;  3UVJ A;  1T94 A;  3R5C A;  2J7K A;  3R5G A;  2LQ5 A;  2LEP A;  3HP6 A;  3O44 A;  3H8Y A;  4CO4 A;  1AZS A;  4DUT A;  1TVR A;  4EU0 A;  3RB0 A;  1RWP B;  1CSJ A;  2HHP A;  4DN0 A;  2CJY B;  3TZZ A;  4V19 X;  3QO9 A;  1AA1 B;  1F9H A;  4ZVS B;  2HUR A;  4DPT A;  1HR0 F;  1IWG A;  4V1A k;  2AJ0 A;  4ZJO A;  2V2V A;  3AOB A;  3F0N A;  2MGZ B;  3VAH A;  1FJG J;  1HBM A;  2WBR A;  1QAX A;  2QA4 S;  3UCG A;  3F44 A;  2CXE A;  3M2V A;  3FBB A;  3WC0 A;  4UQG A;  2CQ3 A;  3IS9 B;  1FWP A;  4O44 A;  3EE3 A;  5ETV A;  2UVW A;  4IYQ A;  3CC4 S;  1U09 A;  4ZVP B;  1HBO A;  2RB7 A;  1R7I A;  1WC6 A;  1TAU A;  2UVV A;  4BLG A;  5HN0 A;  4WZQ A;  3HSD A;  1KN6 A;  3MM9 B;  4MYT A;  1TL3 B;  1NUE A;  2XLK A;  4ZA1 A;  3MD3 A;  3V4I B;  4DL7 A;  1S6P B;  2Q6B A;  3G87 A;  1M1G A;  4PRF A;  3M2R A;  2LEA A;  4ES3 A;  1YJT A;  4X84 A;  5C25 A;  4FDF A;  2V8H A;  1B3T A;  3K0J A;  1F3V A;  1CJT B;  2DNP A;  1FKO A;  4P73 A;  1N0U A;  4ZVG A;  4F2R A;  1NU4 A;  4C11 A;  3M2U A;  1T7P A;  4HI1 A;  3DU6 A;  2Z0G A;  3M8Q A;  4QIW D;  4R0E A;  2NCK L;  3M4X A;  2POK A;  3D68 A;  1QE1 B;  1FK9 B;  4M8L A;  1Q8I A;  4HAC B;  3G9C A;  1M5H A;  2RIL A;  2VG5 A;  2V2Z A;  1RBL A;  4PWD B;  4NEZ A;  3J7Y U;  4OZ3 A;  3N6L A;  1HI1 A;  3CWJ A;  1GX6 A;  5DQH A;  3PAC A;  2QLF B;  2OD4 A;  2KVI A;  2UXD F;  4LRB A;  1Q81 T;  3W5Z A;  4HDG A;  5GAH I;  3ZZU A;  3MGJ A;  2RVJ A;  4BS2 A;  1KOH A;  4FPI A;  5HI7 A;  3T41 A;  1V5I B;  2QL7 B;  2N4C A;  3Q24 A;  4ETX A;  2LQJ A;  5CYM B;  3MTJ A;  1G7C B;  3ICL A;  3Q8U A;  1UWB A;  2J8S A;  4WJB A;  5D0H A;  4JI3 F;  4ELU A;  3I0S B;  3GIJ A;  3B78 A;  5BR8 F;  3TAR A;  3H90 A;  3BO4 A;  3FGV A;  3AQO A;  4Q2L A;  3AB4 B;  1SQE A;  4A8Q A;  4OI0 A;  5HRO B;  3ILO A;  4UUW A;  3GTY X;  5A8K B;  2KT3 A;  3WQP A;  4QWE A;  1HNW F;  1IR0 A;  1Q95 G;  3TAM B;  4BC7 A;  1S9G A;  1YJN S;  3HFV A;  4YHH J;  1OIA A;  4FKX A;  2ADC A;  1S1W A;  4EBE A;  1OY9 A;  3EGW B;  3NNC A;  2XMU A;  1CJV A;  2VFV A;  2E29 A;  1TP7 A;  1U4B A;  3OFG A;  3NS7 B;  3RTV A;  2Y1I A;  7AT1 B;  1PC5 A;  2UV8 G;  2CJQ A;  4AFF A;  1Q8L A;  3DOL B;  1BHN A;  2ABY A;  2EK1 A;  3EDR B;  3BYP A;  3NAH A;  1FRM A;  3ULH A;  2BW2 A;  2I9S A;  5GAD U;  2DD8 S;  1OQ3 A;  2ZH6 A;  3DMJ B;  4LBH A;  2Y0S D;  2YY3 A;  3C6U B;  1IM6 A;  2JC0 A;  1WAC A;  3HF5 A;  2H3E B;  3P6Y C;  3CJ4 A;  4K2X A;  2V4R A;  4LSL A;  3KHR A;  4UUX A;  1T9V A;  2MKJ A;  3LGN A;  2BKN A;  2FLO A;  2ZIT A;  5KT2 A;  2ZBC A;  4KHP J;  2E1A A;  2DGQ A;  2V94 A;  2OPR A;  1YZ6 A;  4B9U A;  3M8R A;  4P7T A;  3QJP A;  2WSE C;  3GYG A;  1KQS R;  1FEH A;  3BH6 B;  3HHE A;  2HBY B;  3TUP A;  4X4S A;  2EKY A;  2R7Q A;  4ZPT R;  2QA1 A;  1MU2 B;  3JTO A;  4O4G B;  2DNY A;  2V8G A;  4DX5 A;  1UA0 A;  4WPA A;  3AXK A;  2E5G A;  3HKW A;  4AL7 A;  3G86 A;  2F4V F;  2Y8Y A;  2FY8 A;  3VQT A;  1KOO A;  2HGM A;  4F25 A;  2XYP B;  3L7U A;  4I6Y A;  5HMX A;  4ZVQ B;  4J9S A;  3BO3 A;  4WII A;  5KFR A;  3TO8 A;  3IO1 A;  1LWX A;  3EXY A;  4WFZ A;  4I2P B;  3J80 U;  4FBT A;  3V4M A;  2A18 A;  2YQ0 A;  3H40 A;  5EWF A;  1U0H B;  1YG0 A;  2PDA A;  3DNC A;  2V9W A;  2DRA A;  3DRS A;  1XJW B;  2KH9 A;  1F5A A;  1A6L A;  4Y65 A;  4ENO A;  1KQG B;  2MZ1 A;  4Q44 A;  3THV A;  5C2C A;  5KFT A;  5HMZ A;  3JYT A;  5K8M A;  4X65 F;  2XMT A;  3IR6 B;  5HVF A;  2HWT A;  2R42 A;  5CHC B;  2QT7 A;  3HVT A;  1T95 A;  3DRP A;  3JQM A;  1S7I A;  4ZIW A;  1N34 J;  3DLE A;  1PBU A;  4PAA A;  3J80 Y;  4DUZ F;  1VQO S;  4LF9 F;  2KG1 A;  1RT2 B;  3UW1 A;  4N5S A;  3FC9 A;  4DV6 J;  2DNO A;  5KT6 A;  4LJM A;  2VFU A;  2AX0 A;  1OS5 A;  4RR5 A;  4ED7 A;  4YB6 A;  3W8P A;  2H5I B;  4KGV B;  2AGQ A;  5K14 B;  3CSK A;  2VUG A;  3IAS 9;  2ZC4 A;  3R5J B;  3M9N B;  2VIH A;  4C2M A;  3W2W B;  2Z8Q A;  4DPX A;  5E33 A;  2PN6 A;  4J9V A;  2FHM A;  1RHU B;  1S77 D;  3TOQ A;  1K47 A;  4QIG A;  3JSR A;  4RL1 A;  5B0G A;  1UFK A;  5AXM A;  5KFF A;  1FNM A;  5C42 A;  1JLC A;  3PW4 A;  3OTD A;  1LEO A;  2G0C A;  4ZIT A;  1H6K X;  3RBE A;  5DG8 A;  4DL4 A;  3MPV A;  4ZCK A;  5AE2 A;  4PYA A;  4M5L A;  3BZQ A;  4B02 A;  1QD1 A;  2PA8 D;  4KB7 A;  2UXC F;  3KLH A;  3M8S A;  4ZCL A;  3R8Y A;  1U7L A;  2AIR B;  4IFY B;  1MG7 A;  4DQS A;  4C8Z A;  2APO A;  4E98 A;  4Y2A A;  4I6W A;  2NXJ A;  2WW4 A;  3O3L A;  3RAM A;  3V6D B;  1FTR A;  2AYM A;  1X60 A;  4J9P A;  1VQ8 S;  1M0S A;  2VPX B;  5IFM A;  4P2F A;  4TY9 A;  2FJB B;  4IRC A;  1FXL A;  2CPH A;  2W7A A;  1N32 J;  2XZD B;  1OSC A;  4DL5 A;  2CQC A;  4HT7 A;  4GKK J;  4C4W A;  3OXG A;  5DLF A;  2WRM A;  5F8L A;  5HQ8 A;  3Q8R B;  2LXF A;  4CH1 A;  5J1N A;  2BAB A;  2ZJP Q;  5G0R B;  3V81 A;  3HVW A;  2VZ9 A;  4QU7 A;  3BDP A;  2VQF F;  2ZBI A;  3UD5 A;  2HBZ B;  4KPC A;  2GA7 A;  2NS1 B;  2G2Y A;  3ZTR A;  5HMY A;  4OZL A;  3DOK A;  2QMX A;  3SZ2 A;  2EFG A;  2RKI A;  2CA9 A;  3IGV A;  1G1X A;  5L1L A;  2IYI A;  1EZZ B;  4P74 A;  2KRR A;  4R0J A;  3TYT A;  2H51 B;  1H2U X;  3NWG A;  3QT8 A;  1BWE A;  3NGS A;  2VC1 A;  4PKD B;  2FHJ D;  1QTM A;  1JLE A;  1YKW A;  1D8Z A;  2DK2 A;  2AYG A;  4WF9 Q;  2BOA A;  1IJF B;  3S7R A;  1Y0H A;  4LRA A;  1RWV B;  3HFK A;  4B3S J;  1WSV A;  1A7G E;  1L3U A;  2E66 A;  3CCV S;  1XMQ J;  1RU2 A;  2CNK B;  3LWM A;  1N5V A;  4NLD A;  4JI7 F;  1ZM2 A;  3TWZ A;  1IBL J;  3PZP A;  4LF5 J;  4JI4 J;  1IBM J;  3RGI A;  1YI2 S;  2YKN A;  3DRR B;  3CJK B;  3D0I E;  2ZDP A;  4NLQ A;  1FJE B;  1RP5 A;  4X4P A;  3OXL A;  4C0B A;  2OTL S;  3HJV A;  4BC9 A;  5A8R A;  4O0I A;  2L41 A;  1DQ8 A;  3MCM A;  3KYL A;  3MED B;  3VVU A;  3IBF B;  1ZTW A;  3DLG A;  1EP4 B;  3ZZY A;  1RAE B;  1R0A B;  2PI5 A;  2DHS A;  1KFD A;  3SDE A;  4N77 A;  2XQC A;  1WJ9 A;  2I5J B;  2YWW A;  1AXQ A;  1JLA B;  4ILL A;  1FCA A;  1ZAX A;  1VBX A;  1RHJ B;  4TKT A;  2F7V A;  2KXN B;  2WVE A;  1JJ2 R;  1X4D A;  2PMW A;  4BWM A;  3GB0 A;  2MLX A;  2UXB J;  3PO4 A;  4K5S A;  1S1T A;  3SQO P;  3NOG A;  4TYB A;  2ZHB A;  3M9O B;  3ZTO A;  2CQP A;  4H4K C;  3AD7 C;  4NRU A;  4OYX A;  4KIA A;  2DNQ A;  3HHL B;  3TX8 A;  1ZA2 B;  5MAO A;  2LQB A;  4DV0 F;  2VFR A;  2CRL A;  2FYX A;  1P1L A;  4ZLN A;  2MQQ A;  4DCP B;  4KBI A;  4IG0 B;  4DBQ A;  1YJU A;  3CB4 A;  1JX4 A;  3SQG B;  3TJ9 A;  3NGK A;  3UWT A;  2V2K A;  4IDK A;  4RU2 A;  4NZ7 A;  2ROP A;  2HFO A;  2YWE A;  2COL A;  2IMW P;  3VQS A;  3R6L B;  2DGW A;  1X5P A;  1PAU B;  3Q86 A;  2HVH A;  4TU9 A;  2Y3Y A;  2KDO A;  2W4C A;  2L3M A;  2RDD A;  5D6G A;  1N54 B;  2XMM A;  4URG A;  4LF2 A;  2MHE A;  2HZA A;  2MZS A;  2C3P A;  2QE5 A;  2BA9 A;  2AEM A;  5C5J A;  5EWG A;  2L48 A;  4LRD A;  3RZA A;  3A8E A;  1ZS6 A;  4KJI A;  1RWN B;  1F3F A;  1WEZ A;  5ADZ A;  2GQ2 A;  4L72 B;  1E6Y B;  1Y9O A;  1FFG B;  2XGQ A;  2RRN A;  1JXL A;  1HIY A;  3OVB A;  2E1P A;  5A2Q Y;  3KUG A;  4U96 A;  1RT6 B;  4USH A;  2VKR A;  4I64 A;  4DX6 A;  4Y00 A;  2G2O A;  3KLF B;  3RRK A;  2QYG A;  3H5Y A;  5EDW A;  1GEH A;  3EDQ B;  3OUY A;  2NSC A;  4P7V A;  3KTQ A;  3H7H B;  1S5Z A;  1U2C A;  4PQU B;  5EHH A;  5AJ3 F;  4NOH A;  3HXM A;  3M30 A;  3ZTS A;  3R2C J;  1UEK A;  3LOU A;  1TL1 B;  5DQG A;  3PVX A;  2EFV A;  1V3S A;  3WHI A;  4FVC A;  3N4W A;  3I56 S;  1AZS B;  4FYD A;  1GMU A;  1VRU A;  1JKH B;  3ZZR A;  1TVR B;  5L9N A;  2MLY A;  1AUS L;  4QCL A;  1DAR A;  2B4P A;  2XHW A;  2G2Z A;  3U1N A;  4DX8 H;  1K44 A;  3QO9 B;  4LFB J;  2P9G A;  2P9E A;  3MMA A;  4HT5 A;  5DDO C;  2CQI A;  4OX7 A;  2HFN A;  4HH1 A;  1U25 A;  1HBM B;  4ZK7 M;  4WK3 A;  1DBD A;  2HVD A;  2VC0 A;  3M2V B;  1S49 A;  2Y1L B;  3RBZ A;  1TMM A;  2BUN A;  1RWW B;  2FLN A;  1XNQ J;  4DSF A;  2C28 A;  4HVZ A;  2PC6 A;  1HBO B;  2KTQ A;  3TEG A;  1YK9 A;  2J7U A;  3M1V A;  3TVK A;  3UFC X;  2HVE A;  3C2P A;  4DQP A;  3I82 A;  3NNA A;  3K5O A;  4FNH A;  1NH7 A;  4IR9 A;  3MEG A;  1ZTT A;  2NQP A;  4H4K A;  4NZ6 A;  3GYN A;  1LWE A;  5GAH U;  3WC2 A;  3CCU S;  2XO7 A;  5GMK a;  3O5T B;  1N6Q A;  4OL8 A;  3IC1 A;  1EET A;  2ZH1 A;  1V3Z A;  4KPY A;  2AW0 A;  4KKO A;  2ZNZ A;  5LXY A;  1IM4 A;  3PIP Q;  1FKO B;  1SH3 A;  1IKW A;  5CZX A;  1VR6 A;  5CAB A;  2JLG A;  3M2U B;  3CJ0 A;  2E7V A;  1TKZ A;  2EFP A;  3NOC A;  4EYH B;  2FB0 A;  3M8Q B;  4ZVT B;  1VC5 A;  4N47 A;  2DNZ A;  3DRY A;  3MDF A;  1VC0 A;  4UY8 5;  1U45 A;  2LKZ A;  3I4P A;  4WKY A;  4X62 J;  2VG5 B;  2JWN A;  5LJ3 Y;  2HQG A;  3KK3 A;  2IA0 A;  1PGZ A;  4F4K A;  5EX3 A;  3U7J A;  3CJQ A;  2XS5 A;  2VU5 A;  3D66 A;  5AXN A;  1P9Y A;  3OTO F;  4F4W A;  3PG9 A;  4WFN Q;  3KOA A;  2H1Y A;  5EN1 A;  1S6O A;  3I5B A;  1W7W A;  2VDH A;  4CH0 S;  2RF2 A;  3NWR A;  5IT0 A;  3D1Q A;  5BJR A;  3OHA A;  1UWB B;  2YPY A;  2YNF A;  2ZDO A;  3PKM A;  1YJW S;  4XDD A;  4IH5 A;  2R7T A;  4N76 A;  2GHW A;  2G4B A;  3M8Y A;  4U95 A;  3IFE A;  3SSR A;  3EIC A;  1PG5 B;  5ETT A;  4O3P A;  2IDL A;  1U1M A;  1T11 A;  4CLS A;  1NK0 A;  3PHT A;  1S9G B;  3KMS A;  2FJX A;  2BZ2 A;  5G4D A;  5H9F K;  3MM8 A;  3LAK A;  2EW9 A;  1GNK A;  2BMB A;  5HO4 A;  1S1W B;  3IRW P;  1XQI A;  1UZH A;  3G6E S;  1SJQ A;  1URR A;  4CZC A;  4A46 A;  2FJE B;  4DF8 A;  1UVM A;  1CJV B;  3EVM A;  2FHK A;  4B3R J;  1ARO P;  3UN5 A;  3J7A N;  2FLP A;  2XI2 A;  4NAS A;  2WTF A;  3CNQ P;  4B3T J;  1HLW A;  3KNG A;  4DR7 J;  1U6F A;  2BQU A;  4CP5 A;  2LFV A;  1LWC A;  3X1L B;  4NCG B;  1W2I A;  3I0R A;  4RBV A;  4OMF G;  1QSS A;  1SC1 B;  3MM5 B;  2MQL A;  2IRX A;  1AFI A;  2KYX A;  2XG8 A;  3NG8 A;  3I55 S;  2C42 A;  3P8B B;  1R6V A;  2YWH A;  1XR5 A;  4MYU A;  2HSE B;  5LMU F;  1TKX A;  1IWA A;  1HWJ A;  1SJ4 P;  1W2B R;  1VK3 A;  5M2R A;  2VPY B;  4LSL B;  2WON A;  2XZT B;  4K50 A;  3QRQ A;  2BDP A;  4QWA A;  4NXN J;  1M5V C;  1S1V B;  2VJV A;  3VTI A;  3QZ8 A;  5H9E J;  2OPR B;  1TZ0 A;  2A3J A;  1ZH5 A;  2DXD A;  3K17 A;  5KFN A;  4P2X A;  5HP1 A;  2OEK A;  2XMJ A;  1KVI A;  3QIP A;  4PG6 A;  1FA0 A;  4X66 F;  3BJY A;  2B9Y A;  1J2V A;  2RH3 A;  2QFJ A;  5KFC A;  2DR8 A;  1NKE A;  5AE3 A;  3DXS X;  1KR4 A;  7FDR A;  1RUS A;  4LF6 F;  1PYT A;  1N52 B;  1NO8 A;  3D6T B;  1SB6 A;  1V9O A;  3D0G E;  3S8S A;  3ILJ A;  4DUY F;  4UZB A;  2SXL A;  1AFJ A;  5D77 A;  2UZA A;  8AT1 B;  3MUV P;  1NM2 A;  1S1X A;  3KUE A;  3VAM A;  2BRL A;  1T0T V;  3W5X A;  2JEJ A;  3KXD A;  2XSF A;  1DTT A;  1XNR F;  4LRE A;  3QQC D;  4ZLP A;  3UNY A;  2WSF C;  3GG1 A;  1X4G A;  1M5O C;  3DRS B;  4K4X A;  4ZMM A;  3T1Y J;  2XMA A;  1CC8 A;  5ETP A;  3P45 B;  3UQS A;  1WC5 A;  4YY3 J;  1VBZ A;  2XS2 A;  5L1K A;  4J9R A;  3JYT B;  1H2T Z;  4NI2 A;  1HNZ F;  2BJ9 A;  3AJ1 A;  4MKB A;  1SIW B;  3W9J A;  3DCA A;  3IR7 B;  4NLP A;  1Q0N A;  1P27 B;  1LXJ A;  2DNM A;  5T7L A;  3ETM A;  4AUK A;  2AJF E;  3D28 A;  4GO5 X;  3DRP B;  2W25 A;  5EUH A;  3DLE B;  3PX6 A;  2U2F A;  4DS4 A;  2GQC A;  2RQ4 A;  3Q0A A;  3GWC A;  1VQM S;  3NBP A;  2M4M A;  1S0O A;  4M5K A;  2W2M P;  5IXU A;  2G0J A;  2R8K A;  1XK8 A;  2IY5 B;  1D9A A;  1RHR B;  1BC6 A;  3THT A;  3GON A;  4J9M A;  4IRD A;  2WOM A;  4Y34 A;  1VJQ A;  4OYA A;  1UFL A;  2LVW A;  1N36 J;  1TFY A;  4CDI A;  2YNG A;  4FYX B;  2HHU A;  4ZPD A;  3OD2 A;  2KKH A;  1IBK J;  2FJW A;  2QLW A;  5ETS A;  4MKA A;  3WX8 A;  4X64 F;  1F2H A;  2MKC A;  3GG0 A;  2BYC A;  4LF4 J;  2F3J A;  1UMJ A;  1T8E A;  2OGU A;  5C42 B;  1JLC B;  2H4Y B;  2OEJ A;  3K5L A;  3BGF A;  4TY8 A;  4LBI A;  2NXC A;  2HZC A;  3KLH B;  2W2P P;  4KGZ B;  4RW8 A;  3Q8Q B;  2YKQ A;  4EUV A;  4DFP A;  2OUG A;  4P9S A;  5HVG A;  1KKH A;  4NLG A;  4FXW A;  3H4B A;  4M5M A;  4M5D A;  4URQ U;  3CPW R;  2DIU A;  3LGH A;  1RLC L;  4WIQ A;  2RRB A;  4TQR A;  2QLB B;  2NXU A;  3C15 A;  2ZHA A;  2V9K A;  3KMQ A;  1FDA A;  1OY6 A;  4USU A;  1HWI A;  2CFX A;  3MTK A;  3CCW A;  2KFY A;  4EZ9 A;  3DU5 A;  1NBE B;  2EBG A;  1HAR A;  2PT0 A;  1YBA A;  4PWW A;  1VMB A;  1QLN A;  3P5B P;  2ZBP A;  2QX0 A;  2HGL A;  4KRW A;  4TYA A;  2K8G A;  3DLB A;  2OJ3 A;  2F8E X;  2FGO A;  2V2Q A;  2GQQ A;  3E8O A;  3V81 B;  3PY8 A;  3RR7 A;  2KI2 A;  3K8W A;  4HKQ A;  3N0V A;  2GW8 A;  2OEM A;  2XBP A;  5H9E K;  5L1I A;  3KHG A;  3DOK B;  2XS7 A;  2NZC A;  1RHM B;  2VFT A;  2BV3 A;  1O5J A;  2GMH A;  4CI0 B;  3AA8 A;  4K0K J;  1VS3 A;  2RKI B;  2EXU A;  4IH7 A;  2RDJ A;  3VAL A;  2WW8 A;  4OLP A;  2UUW A;  5KFX A;  2FQQ B;  2BAC A;  2LXU A;  2CQ1 A;  2IJF A;  3EVW A;  2ACY A;  2M2B A;  2Q79 A;  5LMN J;  3AJ2 A;  4LBP A;  3JTP A;  3QWP A;  1IBC B;  2QO3 A;  4CLT A;  4NLX A;  1LK5 A;  1PJ6 A;  1NEE A;  3GIM A;  4HHU A;  2BEF A;  2YKA A;  4CWB A;  5BYR A;  4C48 A;  4DPO A;  1B0V A;  3MOJ B;  3M8Z A;  1APS A;  1FX4 A;  2R2R A;  1ZYQ A;  2KHD A;  5KFO A;  3TQE A;  4UF4 A;  3BBF A;  3HM9 A;  5IC4 B;  1KTQ A;  1GXU A;  5SUH A;  4JI6 F;  3Q22 A;  3KWM A;  5LT5 A;  1I5O B;  3EGZ A;  4DV4 J;  3ZC4 A;  3CMQ A;  3SCJ E;  1H7W A;  1ROF A;  4X4U A;  1KHW A;  5A8R B;  1RKI A;  4J37 A;  1U2F A;  4MFB A;  1ZOT A;  3DLG B;  2G1D A;  1D9D A;  4X2B A;  5AE1 A;  5GME A;  5DG9 A;  3U1M A;  5JUM A;  4OZ1 A;  4YFU A;  4IOB A;  3SDE B;  2OAU A;  1IQZ A;  5LL6 d;  4NLR A;  4FF3 A;  1FER A;  3TZW A;  3KJV A;  2QLJ B;  3P3D A;  3WZ0 A;  1RWX B;  2VH7 A;  2OPP A;  1K1S A;  1RJJ A;  1WOP A;  1U0S A;  4EK2 A;  1S97 A;  2I6W A;  5KFY A;  2V8D A;  4CLL A;  4IRK A;  3KJN B;  3MFI A;  2CNL B;  2JJ4 D;  4IG3 A;  4M1K A;  4ECQ A;  1R8H A;  1KS2 A;  3AOD A;  4IH6 A;  2XUL A;  4N56 A;  4CQ1 A;  2AQ4 A;  3IRX A;  1RAG B;  1U1R A;  4N8N A;  1Q53 A;  3CUN A;  2JVO A;  2E1C A;  1F5C A;  1UAW A;  1J5E F;  2CQH A;  1MN7 A;  4TLR A;  3OQ2 A;  1OYE A;  3LH2 S;  4XK8 C;  2GAH C;  3B54 A;  1JLQ A;  1FF2 A;  4DSE A;  2Y9H A;  4IDK B;  3CE8 A;  3P4U B;  4NYO A;  4M63 A;  6FD1 A;  5F8N A;  2D1C A;  3LGM A;  3A1Y G;  5KG5 A;  5U47 A;  3W3S A;  1T9W A;  4FS1 A;  3DGV A;  3OVS A;  1HWL A;  1FE0 A;  4NLV A;  4O3Q A;  1VQS A;  2C2M B;  4DSK A;  3GSI A;  3SXL A;  3BSA A;  5HVH A;  2N3O A;  3CD7 A;  2CAJ A;  3FSI A;  2HHQ A;  2HQC A;  3I32 A;  1JNZ B;  4OYB A;  4RUA A;  4DV1 F;  2WB1 D;  3G4S S;  2KVQ E;  1FRI A;  3T5K A;  4WTY A;  2LA4 A;  2RU3 A;  2KU7 A;  2VOD A;  3PW7 A;  3FEX B;  3GLJ A;  4DR2 F;  3NAI A;  4M95 A;  3GV7 B;  1EIY B;  3UR3 C;  1Q8B A;  1JLF A;  3KK2 A;  1ZPV A;  3L3C A;  3D0H E;  3OUY B;  2PI4 A;  1QVF R;  4UOH A;  4X4Q A;  5DJB A;  3FEZ A;  3LAL A;  1RGV A;  2VPZ B;  2DBB A;  3M30 B;  3AY0 A;  3PJ9 A;  4UOG A;  1Q7L B;  4J7C A;  2FJA B;  2LEB A;  3PV8 A;  2JLE A;  1R8B A;  2D3O 1;  2HHW A;  3D3C J;  4ID5 A;  1UFW A;  1VRU B;  1BWV A;  3CCQ S;  1HR0 J;  3LWL A;  3C8Y A;  3KLV A;  3G6X A;  3PYF A;  3BN4 A;  2GO8 A;  3PFO A;  1TUV A;  2ZH2 A;  2V8V A;  4LFA F;  8RUC A;  3KHH A;  2ZH4 A;  5E3Q A;  4F3O A;  3EX7 B;  4M5N A;  4Q8F A;  3MMJ A;  1FDB A;  4PXE A;  5IC6 B;  1YBU A;  3NY0 A;  3PRB A;  4DDF A;  5D3G B;  1RAA B;  1HHT P;  1GK8 A;  2HBQ B;  4RNO A;  1T02 A;  5RUB A;  4WFX A;  4YHH F;  3KK1 A;  1JMT A;  1DY3 A;  2HPU A;  1YQH A;  3QID A;  7FD1 A;  2VV5 A;  3M1V B;  1K8A T;  5KFB A;  4ECV A;  2HRY A;  1NH8 A;  1REV B;  5CYQ A;  5DET A;  3D6H B;  1Z2L A;  2ZWP A;  4CO5 A;  1UP1 A;  3KLI A;  3I9Z A;  4X4N A;  4CO0 A;  2Z2Y B;  2KJW A;  1RIS A;  3GJQ B;  1XER A;  5HSP A;  3IG1 A;  3U02 A;  2GHP A;  4DSL A;  2W01 A;  4NXM F;  2VON A;  5KT5 A;  3ZZ0 A;  2BR0 A;  4KKO B;  2CPY A;  3MAH A;  1IKW B;  3S01 A;  5IT9 U;  3OL6 A;  3RU0 A;  3SMZ A;  2ALZ A;  4N8O A;  2KXH A;  3BEG B;  2G1H A;  1UCN A;  2D3U A;  2BJ7 A;  1N5T A;  2MDA A;  1C1C B;  2AJ4 A;  3LP2 A;  1R0B G;  4KHP F;  2HRU A;  4C6A A;  4LR8 A;  3KK3 B;  1SJF A;  3R7N B;  3LO3 A;  2IRY A;  3CCJ S;  4I67 A;  2H4W B;  4AXJ A;  4KYZ A;  3V6K A;  2F63 A;  4N41 A;  2UU9 F;  3GU0 A;  1UVN A;  1TFW A;  4OX8 A;  1F6T A;  1NK5 A;  2HS0 A;  2UVU A;  2ERR A;  5IT9 Y;  2FC8 A;  4I7F A;  1SI9 A;  3MEC A;  2OI2 A;  3HUL A;  3S6E A;  4JI3 J;  2VA3 A;  2RF2 B;  2B8Q A;  1JJ4 A;  2QLX A;  2J9E A;  5BR8 J;  4G65 A;  3BBC A;  1CJK A;  1KVK A;  2QA2 A;  5KT3 A;  1X0P A;  3PHE A;  2E5L F;  1RAJ A;  2YNF B;  3OPK A;  3CJ5 A;  2WB4 A;  3MHY A;  9RUB A;  4B08 A;  4V19 J;  2HFS A;  3H4D A;  2ZZT A;  3LAM A;  2FTR A;  4M94 A;  4LIW A;  5HJY A;  5E3C A;  2QGF B;  4EEY A;  2ROE A;  1X5T A;  1R27 B;  3U1L A;  1NHK L;  4KH1 B;  2LYV A;  2JFK A;  3FRZ A;  4HL9 A;  4S0M A;  3A3N B;  1QDU B;  2DVI A;  1KRP A;  3MM8 B;  2R4F A;  3NCP A;  3ILL A;  3T5L A;  1KD1 T;  2WBM A;  1HA1 A;  4E0D A;  2YNI B;  4EI2 A;  3SI8 A;  2UUB F;  3M05 A;  4KE5 A;  3LAN A;  2XEX A;  2VJU A;  3SSS A;  3L7P A;  1BQN A;  2JC1 A;  3G82 A;  1NDL A;  1B4S A;  5D78 A;  1B64 A;  4NEY A;  2VOP A;  3EVO A;  2C22 A;  1NAQ A;  4YP3 A;  3J81 j;  2GS8 A;  3CJS A;  1ACM B;  3B4M A;  3I0R B;  2C1E B;  4RBU A;  2YH0 A;  4QYZ J;  2MMY A;  1JLG A;  2D69 A;  1WHW A;  2CNN B;  4PPZ A;  1N48 A;  2DEI A;  2W1B A;  4L74 A;  4F04 B;  5IWA J;  1T05 A;  1TKX B;  4LVN P;  1FKP A;  1VK8 A;  4ECY A;  2EC0 A;  2WON B;  3RYL A;  2J6T A;  2QV6 A;  4J91 A;  2LMI A;  3TP2 A;  5I3U B;  1NDC A;  3OFE A;  4OHV A;  1YSJ A;  1HQU B;  5E5N A;  1NJY A;  3FFI A;  1DQ9 A;  2HRT A;  3MCO A;  3ZFV A;  5HP1 B;  2F5G A;  4TNO A;  3QIP B;  4OZN A;  4MKY A;  1D3W A;  4W98 A;  1UJ6 A;  3MOZ A;  3UDL A;  3CD6 S;  2F4V J;  4Y2C A;  4ZVF A;  1GX5 A;  2XSJ A;  2ZM6 F;  3CT9 A;  4LMZ A;  2BJ3 A;  2HIQ A;  4ZP8 A;  3RBX A;  2KXF A;  1RTH B;  2DGU A;  2NRE A;  5HQM A;  3FQL A;  1VQP S;  4ZPC A;  3KG0 A;  2C2O B;  3BR8 A;  3VWS A;  2HLT A;  3KJQ B;  1S1X B;  3MI7 X;  4DSI A;  4A48 A;  2HG4 A;  3QNW B;  5HMW A;  3Q83 A;  1DTT B;  3W7B A;  3MR7 A;  2YQ3 A;  3RRH A;  2MKY A;  1JXV A;  1YWX A;  3MEE A;  4CNZ A;  4R5P A;  3FSX A;  4EMD A;  2EFO A;  4OJH A;  2HLU A;  4X65 J;  2J76 E;  5KOX A;  1Y3K A;  1PBA A;  2RDI A;  2MY7 A;  1HHQ A;  3M9M B;  2PFF B;  4YEA A;  1HQ2 A;  3PW2 A;  1Q8K A;  2DO0 A;  1F60 B;  2CQ4 A;  4NI2 B;  3MCS A;  4ZKA A;  1RAC B;  1DUR A;  4K5R A;  1B7Y B;  3G8Q A;  2M5Y A;  4DUZ J;  1XTZ A;  3I9V 9;  5T7L B;  4LF9 J;  3P49 B;  1NJW A;  1UL3 A;  2C3Y A;  4KHR A;  3ISZ A;  3R1L A;  1Y5I B;  4ALZ A;  3OTB A;  1UKU A;  5F8G A;  1S0V A;  4D3H A;  4NZ0 A;  3QWU A;  3PYG A;  3MPU B;  2W2N P;  5D0E A;  2AWZ A;  4DV5 F;  3I4H X;  5KFU A;  1AB8 A;  4USK A;  1PYO B;  4W92 B;  2Q6C A;  2QJ3 A;  3DLK A;  4C9D A;  2WOM B;  1CLF A;  4AL6 A;  2R7V A;  1R8P A;  3R97 A;  1ICE B;  3JQJ A;  1EKR A;  1EAY C;  4QOT A;  2FZC B;  2YNG B;  3ZZZ A;  4JI5 F;  4A8F A;  5K9F A;  2UP1 A;  3QT6 A;  1CS4 A;  4GRS A;  3QYY A;  4UY8 T;  1H0H B;  2CWX A;  4U8V A;  2JFD A;  4FS2 A;  4UOC A;  1OYD A;  4B3O A;  2DHX A;  4JI8 F;  2UXC J;  3BPD A;  4CLZ A;  1RK8 A;  4QPX A;  4WYL A;  5F0W A;  3NP5 A;  2Z30 B;  4AT1 B;  4F36 A;  4TY8 B;  1Y00 A;  5JVH Q;  3KDO A;  3QSI A;  3POT A;  2ZWO A;  5DZ6 A;  2D3O R;  4AXI A;  2CDR B;  1WI8 A;  1S59 A;  2DTJ A;  2YH1 A;  1FXR A;  3T6B A;  4FN5 A;  4M5D B;  2Z58 B;  3OTC A;  3OJU A;  2HBR B;  1RTJ A;  4Y0F A;  4I2Q A;  4WTO B;  5FII A;  4RW4 A;  2V4Q A;  2JEG A;  2B9E A;  5I42 B;  3BQ1 A;  3C15 B;  1RWK B;  3KKF A;  2GC8 A;  4PUO A;  1DHM A;  2B9W A;  3NGR A;  3ZTQ A;  2VPW B;  1VQ4 S;  4QZV B;  1SL0 A;  2HQD A;  2AF6 A;  1CVJ A;  1CJU B;  1V3R A;  5KFI A;  1N4L A;  4LQ9 A;  3PR4 A;  3RR8 A;  2AP6 A;  2PII A;  4JYA J;  4DFK A;  2VQF J;  4NA3 A;  5C24 A;  4C8L A;  4DCJ B;  2IAJ A;  5L38 A;  1S10 A;  5T14 A;  2GNK A;  5F8I A;  3OHB A;  4IFV B;  3PKY A;  2CAD A;  2AV5 A;  3RAQ A;  4RUB A;  1T9X A;  3PX4 A;  4JUZ A;  2FHO B;  1L5U A;  1ZAW A;  2BM0 A;  2MZQ A;  2QL5 B;  3SFU A;  3ET6 A;  3K5N A;  1WUU A;  1JQG A;  3IM9 A;  4NCB A;  4LF1 A;  5DGA A;  4G1Q A;  1IKV A;  4XDC A;  3OVA A;  4LSN A;  3W1Y C;  4F67 A;  4EO6 A;  4UT4 A;  4CTA B;  4ZN3 A;  4ER8 A;  1HPZ A;  3A3P B;  3HX9 A;  3MAA A;  2ATC B;  2KJV A;  1QUV A;  1FD2 A;  4JI7 J;  4WXW A;  1IXK A;  4B9M A;  1KBR A;  3A8J A;  3PNI A;  4CM0 A;  4KHM A;  3W66 A;  2DY9 A;  3QGI A;  4K4Z A;  2JEI A;  4G1P A;  2KG0 A;  3BGR A;  4HEA 9;  4DEZ A;  4H4O A;  1BQM A;  2AEJ A;  1H74 A;  3FRY A;  3RRG A;  3KLE A;  3HMJ G;  1RT7 A;  3H2U B;  3ZNJ 1;  4LR7 A;  1JIH A;  2OFG X;  1EKS A;  2BAN A;  5I3P A;  4ICL A;  1G4C A;  1AYE A;  1U1P A;  4MFB B;  1TV6 A;  1N88 A;  5B08 A;  4ZCM A;  2CZ9 A;  1M1K T;  1XIQ A;  1GH8 A;  1FWK A;  3R5A A;  4XO0 A;  3DRX A;  2I8E A;  3FDS A;  1VQ5 S;  1UA1 A;  4BDP A;  4DZ6 A;  3RB3 A;  4L3K A;  1I51 B;  3IP0 A;  3RB6 A;  4Q0B A;  3CO0 P;  3KJV B;  1NLK L;  4XIU A;  1UVJ A;  4HHH A;  2HK3 A;  2OPP B;  5FDL B;  3EGN A;  3C3L A;  3LP1 B;  1FRX A;  3DYA A;  4LFB F;  1VBK A;  3O6Q A;  3JAM Y;  1VCT A;  4IG3 B;  3R27 A;  3MR5 A;  4FXV A;  2W2O P;  3GV5 B;  4DV0 J;  5FJ4 A;  5D15 A;  4DV2 J;  1T03 A;  4Z37 A;  2BE7 D;  2CNO B;  1VC6 A;  3EM1 A;  2B56 A;  1K1Q A;  1IKX A;  2AT1 B;  2Q1L A;  4X4O A;  1N5Y B;  2UUC F;  4RJV A;  2L08 A;  5BXI A;  1H7X A;  4DR5 F;  3HT0 A;  3NCR A;  3UNG C;  4DN9 A;  1XEZ A;  1JLQ B;  1MMN A;  3UN2 A;  3L7O A;  4HI2 A;  2I1R A;  1BE4 A;  2WZ1 A;  4C8N A;  4OHX A;  3C14 A;  2MY8 A;  3KLG A;  2IJN A;  4AQY F;  4QWD A;  2ASJ A;  2JRS A;  2OKQ A;  3O8W A;  3CJ3 A;  3KHL A;  2DYA A;  2Y1R I;  1FVS A;  4MK9 A;  4W4M A;  4YR2 A;  4DF4 A;  5E7O B;  3ISN D;  3QGP A;  1QAJ A;  2QN6 B;  2XY5 A;  5K8N A;  4ES2 A;  4RW9 A;  3T1H J;  5DRK A;  4AND A;  1R8A A;  3SSQ A;  5KFP A;  3MPY A;  4ERD A;  5LSR A;  3RW7 A;  4NWB A;  2MKI A;  3FMB A;  1JLF B;  3KK2 B;  4EBC A;  2DR6 A;  1YBT A;  4PCQ A;  4ILM A;  2O3D A;  3J81 Y;  2R2U A;  4YUD A;  2B7C B;  3EZU A;  2N7C A;  2MKS A;  3D6M B;  3IWL A;  4AD6 A;  1U02 A;  3FZ2 A;  4USV A;  4LUB A;  3H2V E;  1P1T A;  4OV1 A;  1X9M A;  2I0X A;  1FD8 A;  4JI0 F;  2E7X A;  2GIF A;  1FWL A;  4CM2 A;  3I31 A;  3ENW A;  5B0D A;  3OXF A;  2BJE A;  1U8S A;  4ID5 B;  1Y7P A;  1GXL A;  2F40 A;  4ANC A;  4ZVU B;  1UJ4 A;  1X5S A;  4DCO B;  3TX0 A;  1WEY A;  1NPR A;  2KN4 A;  2FIU A;  3IGN A;  3M8P A;  3H20 A;  4ZPV R;  4G1I A;  3J7Y I;  5KFQ A;  4U9R A;  3LP0 A;  3C19 A;  4QW8 A;  1FEE A;  1QAY A;  1KFS A;  2NSB A;  4WBF A;  3N5B A;  3TUJ C;  3E2E A;  1SJ3 P;  4M5J A;  4EBD A;  4CT9 A;  1VYA A;  2YX1 A;  4QPT A;  5D8H B;  3VAK A;  1KTV A;  5F9N A;  2BBE A;  3C6T A;  1DLO B;  2XYH B;  3AFG A;  3JS9 A;  3NGD A;  5D0G A;  3DLJ A;  5LOQ A;  4OZ0 A;  3KK1 B;  2R7X A;  3J7Z 5;  4JV2 A;  5LSL A;  2IMO A;  5CYQ B;  3BGL A;  4B3R F;  1Z2Z A;  3I5A A;  4L75 A;  3KLI B;  4RU9 A;  2LDI A;  1YRT A;  1DZ5 A;  1I3O B;  2ACM A;  4JI1 F;  3IG1 B;  2MXY A;  3H5S A;  3RJM B;  1WKJ A;  1B7F A;  4FNI A;  2ZZN A;  4ZDN A;  5ETL A;  5IT4 A;  1XBW A;  2RIJ A;  5CH7 B;  3MWB A;  1SJR A;  2UUA F;  4O3S A;  1CQM A;  1N8R T;  4QIF A;  3PRV A;  1X4A A;  2IYG A;  5ETQ A;  2FPH X;  3CVK A;  4DXL A;  1JNR B;  3LP2 B;  2GJF A;  3NXZ A;  1RSC A;  1LQ9 A;  3OTO J;  2IPO B;  5CD4 H;  3Q2T C;  3PCO B;  1ZPW X;  5DZ7 A;  3GE9 A;  3BQ0 A;  2GVZ A;  1DAX A;  3BN7 A;  5IZH A;  4OV6 A;  5GAD I;  2O67 A;  3EJM A;  1F1B B;  3LUY A;  4I7F B;  4D3G A;  3MEC B;  3DC2 A;  3HVA A;  4DR4 F;  1RAH B;  2HHH F;  3HHK A;  4RBT A;  1CJK B;  4NLO A;  4DL6 A;  3AT1 B;  2HND A;  1PYS B;  2ILY A;  1J5O B;  1LNQ A;  1U6Z A;  2V50 A;  2NR0 A;  1B70 B;  4P52 A;  3UN3 A;  4C3M A;  4J90 A;  4WP3 A;  2KM8 C;  3ONQ A;  4ZPW R;  5ETK A;  2UVR A;  3DM2 A;  3VVT A;  1TMJ A;  5ETN A;  3BF4 A;  3GFH A;  4A8O A;  3VAF A;  3AOA A;  1K73 T;  4U7C A;  1LOU A;  3VV2 B;  2FDN A;  3U27 A;  2PMZ D;  2IFX A;  3R9L A;  2VF3 A;  3WDO A;  2VKZ G;  1NDP A;  1HNI A;  3QAU A;  2RUG A;  2A2D A;  1X5O A;  4P2S A;  2YXL A;  4DU7 A;  2XYG B;  2IM1 A;  4M5H A;  1NKB A;  1X8D A;  3D5M A;  2BE9 B;  4ECU A;  1A0O B;  2HNZ A;  1RHK B;  3CO9 A;  1GTH A;  3QRP A;  4DPY A;  4B3M F;  1S6Q A;  1YRU A;  4Y2M A;  3MR2 A;  1PKU A;  3G82 B;  1FDN A;  1YDL A;  2E1M C;  4RX6 A;  4Q5V A;  4DS5 A;  1VRT A;  4DPW A;  1M90 T;  4CLK A;  2ZH5 A;  5LMU J;  4RUH A;  1KC8 T;  3MM6 B;  1HWK A;  4XPC A;  4I6A A;  1NND A;  1T05 B;  4F3M A;  5KG3 A;  1FKP B;  1TL4 A;  5LM7 E;  4CO3 A;  1PAE X;  1R31 A;  3QSY B;  4HTI A;  2AGP A;  4A8K A;  3RUB L;  4W90 B;  3EPG A;  3OR1 B;  4IO1 A;  5B0B A;  3EZO A;  4USW A;  3WIV A;  3JSY A;  3FFI B;  4LF4 F;  2CPF A;  3T19 A;  5J2Q A;  2DNG A;  4LF6 J;  2R8G A;  1W26 A;  2CJX B;  2F8H A;  2ZNY A;  2E5I A;  3Q89 A;  1AUD A;  1RWU A;  1NME B;  4JV0 A;  2XSJ B;  4ECR A;  2XLJ A;  2GGP A;  2CYY A;  2NPI A;  4F0H A;  3HO1 A;  1RXO B;  1RCX B;  2XWX A;  2B7B B;  3CDU A;  1CC7 A;  4OI1 A;  1XNR J;  5J1P A;  4TXS A;  5GAG U;  2V69 A;  2M3D A;  4XAK A;  2FVR A;  1AT1 B;  2R2S A;  4U6P A;  1S7H A;  4A8M P;  5DDR C;  1BD6 A;  1YX2 A;  2VG7 A;  1VBY A;  2ZE2 A;  3FSY A;  4FYV B;  1BLU A;  4KC5 A;  3MEE B;  2QTW A;  1RT1 A;  3HZG A;  1C0U B;  3FKB A;  4WU3 A;  1T9U A;  5KG7 A;  3OFF A;  1CUL A;  2LA6 A;  2D41 A;  4ELT A;  3D2W A;  3BM7 A;  1NJX A;  2VQE F;  4HDH A;  3PIO Q;  2B6A B;  4LF8 J;  2QZ8 A;  2EBE A;  1C1B A;  1X4E A;  3L4B C;  5A76 A;  2B5J B;  4TLQ A;  1H72 C;  2DNL A;  4Z7C A;  1S4F A;  2KYZ A;  3NGU A;  4K0K F;  4EWT A;  3H0P A;  3RBD A;  5CYJ A;  2CPI A;  4F4Z A;  3KUH A;  4OQJ A;  4ZLL A;  1XN9 A;  3CED A;  3PEJ A;  2EVZ A;  1YIJ S;  5HAO A;  4JI2 F;  4ED2 A;  4F8R A;  5K5M A;  2F8M A;  3DLK B;  3D1H A;  2U1A A;  4ELV A;  1I94 F;  3OL7 A;  2PMH A;  4A8Y A;  2A6M A;  2R8H A;  2CQ2 A;  4X64 J;  4LFC F;  3GJT B;  5K8O A;  3UE2 A;  3GMG A;  5BYQ A;  5FLX Y;  4AL5 A;  3PR5 B;  1EHW A;  3C46 A;  2DPJ A;  3H2L A;  3MEK A;  1XMO F;  4BBY A;  4RNH A;  1OQ6 A;  5L9X A;  4OYP A;  2ZJR Q;  2IA6 A;  4ZVE A;  4EZ6 A;  3MD1 A;  1M1H A;  1U2R A;  3OTE A;  4PXC A;  2FVC A;  1GMW D;  3D4J A;  1R0A A;  1OPI A;  1HQE A;  3QAE A;  4ED8 A;  5A2Q U;  1CBK A;  2F4F A;  1REG X;  1URN A;  4GKJ F;  1IUJ A;  5CZV A;  2WVB A;  3VGT A;  1KHV A;  3UCZ P;  1RTJ B;  1TK8 A;  2GMJ A;  1ZM4 A;  3MR6 A;  2DGV A;  3GII A;  4RW4 B;  2ZOF A;  3MMB B;  4PUO B;  4DV7 F;  1UPP A;  2ADB A;  3ENQ A;  4QR1 A;  1WG4 A;  5JMN A;  4EGL A;  3AHP A;  3CXC R;  4WP9 A;  3G71 S;  4UW2 A;  2BE2 B;  1RTD A;  2M7S A;  3TZX A;  4DU8 A;  3WBZ A;  4OYZ A;  3IBC B;  4CH7 A;  5C24 B;  2DY1 A;  4GVB A;  2ASD A;  2IAJ B;  3JXO A;  1MMD A;  5F41 A;  3THP A;  3L09 A;  3K57 A;  3HSJ A;  3SQG A;  4DG1 A;  1XMB A;  2XLI A;  3QRR A;  4DZD A;  3D7S B;  1C4C A;  2YPZ A;  2Z2L A;  4OI2 A;  2NYI A;  1IR1 A;  2HYI B;  4B9L A;  4NLS A;  2DNR A;  1D0E A;  1ZM3 A;  1SKR A;  1LFP A;  4JV5 F;  1WC3 A;  5DM7 Q;  3ET6 B;  4Q8E A;  2VBX A;  1R89 A;  1RAD B;  3H25 A;  2C2R A;  2CVI A;  2ZH7 A;  1YTY A;  2DH8 A;  3TEH B;  3QLH A;  1BMQ B;  4G1Q B;  3LW5 C;  4ZJL A;  4WFA Q;  1IKV B;  3UVJ B;  2D74 B;  4LSN B;  1YGY A;  4I4B A;  3SYZ A;  2LP4 A;  3IMQ J;  5J2M A;  4DR6 J;  3H98 A;  2EI5 A;  4JB8 B;  2IBK A;  1HPZ B;  2FLL A;  1EB0 A;  2VHG A;  3VAG A;  2VBY A;  4DMZ A;  2RQC A;  1LV5 A;  3CCS S;  3W9H A;  5M2U A;  3D6F B;  2HFV A;  4JI6 J;  3J7A 1;  1L3T A;  2DNK A;  5L1J A;  3BGR B;  4H4O B;  1FO1 A;  2EG1 A;  1BQM B;  4DQI A;  4QW9 A;  5DLG A;  3KLE B;  1X9S A;  2GO9 A;  1PJ5 A;  5KT7 A;  2JLF A;  4L76 A;  2BAN B;  1TL1 A;  2V67 A;  1VGY A;  1TK5 A;  4ICL B;  3T1A A;  2HMI A;  4O44 B;  3HHD A;  4OYO A;  1NZ8 A;  4ZN1 A;  3T3F A;  1TV6 B;  2YKO A;  3DLL Q;  3NS5 A;  5B0F A;  1JKH A;  3W64 A;  4P71 A;  3EZ5 A;  2J8A A;  5JXS A;  5KG6 A;  1MWY A;  3W60 A;  3JTN A;  4Q0B B;  3TRG A;  3N28 A;  3NMR A;  3QFW A;  2Z56 B;  1BGX T;  2IVY A;  2JL9 A;  4OJ3 A;  4C8K A;  4L3N A;  3DYA B;  2X1B A;  2UUT A;  4ZIV A;  2PD1 A;  5IQQ A;  2YKM A;  4DV3 F;  3HPO A;  1HNX F;  3M2R B;  2VD3 A;  1FNO A;  5C25 B;  4PXD A;  1J5E J;  1T03 B;  1TU0 B;  4PEO A;  1JJC B;  1WKK A;  2B51 A;  3VHQ A;  2X1F A;  1IKX B;  4PQA A;  4C11 B;  3W62 A;  1NB2 A;  2VL1 A;  2VFS A;  3UDC A;  2VDI A;  1RLD A;  2JH3 A;  5E0O A;  4O23 A;  4K2J A;  3SBM A;  3P96 A;  1IN0 A;  1XC9 A;  1WOR A;  4WYW A;  3BS9 A;  3IXQ A;  1TL7 A;  3HFZ B;  3O1L A;  3C14 B;  3KLG B;  4ZPA A;  2OO4 A;  1VQL S;  2DR9 A;  1LW2 A;  3G6V A;  1QSL A;  3G8T A;  2CPE A;  3DXB A;  2YBV A;  1T9T A;  1G2E A;  4DV1 J;  5L46 A;  2O1P A;  4MJK A;  2WVD A;  2W9B A;  4ETZ A;  4RW9 B;  3OSN A;  2VBW A;  2ZOM A;  4DR2 J;  3DLH A;  4P72 A;  4J9Q A;  3AB2 B;  4CCH A;  1Q7Y T;  2HS4 A;  2KHC A;  1Q86 T;  4R8U A;  1GXT A;  4PG7 A;  3CIM A;  4LVO P;  2DXE A;  2HAF A;  2RML A;  3JSM A;  2JVR A;  4Q43 A;  2K3K A;  2DB1 A;  3JQK A;  2B4U A;  2FVQ A;  4NX9 A;  4CLY A;  2CPD A;  3A8I A;  3SFG A;  2EFN A;  4URS A;  5DQI A;  1WTB A;  3AOC A;  2Z57 B;  4WU2 A;  3CCZ A;  1G6B A;  5AT1 B;  3VR1 A;  2K06 A;  3KG1 A;  3A8K A;  4C97 A;  3Q2S C;  5B0E A;  2GML A;  3R7B B;  4LFA J;  4Z2X A;  2HHX A;  2LCW A;  2KO1 A;  1PIL A;  2E9T A;  2BW7 A;  2AZ3 A;  2DNN A;  4FP9 A;  3M8P B;  1X4C A;  2YWG A;  4QIE A;  4TVA B;  2N4D A;  4PR6 A;  3LP0 B;  2XCP A;  1I1G A;  2LDY A;  4KR0 B;  2LU2 A;  3RG6 A;  1FE4 A;  2CKW A;  2YQ1 A;  3MUR P;  3HDS A;  2EKN A;  2CQ0 A;  2WCX A;  5E3R A;  3B4D A;  3C6T B;  3TW0 A;  5F9L A;  5I4M A;  1U24 A;  3TQ1 A;  3VF0 B;  2OD6 A;  4ILR A;  1RBA A;  3LPY A;  1YJV A;  1L3V A;  2DGS A;  2EPI A;  1N56 A;  1H73 A;  3I87 A;  1NK8 A;  3QGH A;  1UVL A;  1S9F A;  1YVF A;  1HW8 A;  2A0F B;  1TR0 A;  4UZC A;  1YJR A;  1NJZ A;  2M8H A;  4NCG A;  4YR0 A;  4NXM J;  2QRR A;  4RNN A;  2OLW A;  3V5R A;  3MM5 A;  3IM8 A;  3ENA A;  3M6V A;  1HD0 A;  2MJN A;  1VIO A;  3F73 A;  4YDD B;  4J9L A;  4X4R A;  2OML A;  1SH0 A;  3PXG a;  4F0K A;  4TU8 A;  2FJV A;  2AU0 A;  4KGM A;  2VB6 A;  3TAP A;  5HJX A;  2P2C B;  1WF2 A;  5KFS A;  4DR3 F;  2CPZ A;  4CNY A;  4F4Y A;  5IWA F;  4OZ2 A;  5F0U A;  5LSO A;  2LLZ A;  4DLG A;  2XMK A;  4MIB A;  1S1V A;  2O5D A;  3CCE S;  2XZW A;  3FCW A;  5SZT A;  2K1R A;  1GAO A;  2MKH A;  5CQG A;  1WD6 A;  2GCF A;  1RZM A;  4DSJ A;  4ATN A;  4FYW B;  2P8I A;  4IO9 Q;  2UU9 J;  4JBC A;  1HL6 A;  2FUG 9;  4XPE A;  4IQX A;  2GVZ B;  1MSW D;  3Q8Y A;  1WSR A;  3GPA A;  5KFL A;  2ZZM A;  3TUI C;  2E5L J;  2VG6 A;  1U1L A;  3CGI A;  1TQL A;  3HVT B;  5T41 A;  1NK4 A;  2N3L A;  5DS7 A;  4GVL A;  2CZV C;  5HLF A;  2WHO A;  3AXM A;  4C8M A;  2BOP A;  4QWB A;  1FT8 A;  2HND B;  2IBO A;  4RKU C;  2M70 A;  4KGX B;  5EGY A;  2HFZ A;  3ZNU A;  1DJ0 A;  5D4O A;  4MIA A;  3DI6 A;  2XMW A;  3AD9 C;  2CQG A;  2JSX A;  3DM2 B;  4BCA A;  2LXI A;  1S12 A;  4MTP A;  5CXT A;  4ES1 A;  4NYZ A;  1RT5 A;  3L95 X;  1Y10 A;  1HMV A;  1SPB P;  1RYR A;  4OHZ A;  3D54 A;  3UPF A;  1SIZ A;  2UUB J;  2DJW A;  2V63 A;  1OWX A;  1HNI B;  1KEK A;  4O3N A;  2OEL A;  5D4L A;  4G3I A;  2N82 B;  3CME S;  3CTR A;  4AYB D;  4FPR A;  2HNZ B;  2CQD A;  1S6Q B;  4J9O A;  4F02 A;  4CO1 A;  2HIY A;  3QZ7 A;  5AXK A;  5KFG A;  4YQW A;  2J9D E;  4F2S A;  1VRT B;  3BGO P;  1BY9 A;  5FD1 A;  3BSO A;  2DHG A;  4OX9 F;  2D9P A;  4OYW A;  1N33 J;  1Y11 A;  1WG5 A;  2JOQ A;  5E3P A;  1WHV A;  5KT4 A;  3M6X A;  2WK4 A;  3OSP A;  1LW0 A;  1IR2 A;  5D4N A;  1UPM B;  1LKZ A;  3R3T A;  1SQF A;  1K0V A;  4WKR A;  2J7W A;  1RBO B;  2MKK A;  3EGV A;  3FJ2 A;  4F4A A;  1IJE B;  1WF1 A;  1YZ7 A;  3TA1 A;  1S48 A;  1K9M T;  4RO0 A;  2ZBR A;  3DOM A;  1L3K A;  4MK8 A;  3OW2 R;  1MWQ A;  4I69 A;  5J2Q B;  1V5V A;  2ZKU A;  1YJ9 S;  4H54 A;  2W24 A;  2ZM6 J;  2J9C A;  2B4O A;  2NXE A;  2NPF A;  4IR1 A;  3CDW A;  5GAE I;  2R8I A;  1FDD A;  1HBN A;  1ZA1 B;  2A1B A;  5DGB A;  2HHT A;  3M8W A;  1NK6 A;  2GGP B;  4B9V A;  3UCU P;  2IJR A;  3PDN A;  3KNA A;  3N01 A;  4ANE A;  3GCW P;  5KFZ A;  1NK9 A;  4DHV A;  3R1H A;  2MEW A;  2QA4 G;  4RNF A;  4LF7 F;  4DFJ A;  1VJW A;  4ECT A;  2MZJ A;  2AYE A;  4MKV A;  2O66 A;  2HFU A;  1JLE B;  3HHL D;  1DFD A;  2WVC A;  2VG7 B;  2ZE2 B;  2IC3 A;  1RT1 B;  1SKU B;  2L9D A;  1CUL B;  1HKA A;  1JLB A;  4DR1 J;  4ZVO B;  2DO4 A;  4ITS A;  2XC9 A;  4JYA F;  4OHW A;  3PTW A;  1AW0 A;  4N7T A;  3J7Z T;  3ADA C;  1X4B A;  1L3S A;  4Y3C A;  1PIE A;  3AAW B;  1RU1 A;  1U1K A;  2LQ8 A;  4JOU A;  2JDJ A;  2XHC A;  1MLA A;  2YKN B;  1C1B B;  2ZJQ Q;  1O51 A;  2M8D B;  2CDQ A;  5F8H A;  3TVY A;  1B0T A;  4K4U A;  1IVZ A;  4DV5 J;  3DHW C; 
#chains in the Genus database with same CATH homology
 4LFC J;  3J81 U;  4V1A k;  1XMQ J;  1N32 J;  2E5L J;  4NXM J;  4NXN J;  4LF4 J;  3T1Y J;  5A2Q U;  4DUZ J;  4YY3 J;  2UUA J;  4LF9 J;  4GKK J;  1FJG J;  2MEW A;  1IBL J;  4JI5 J;  4KYZ A;  4X62 J;  1XNQ J;  1N33 J;  4DV4 J;  4LF5 J;  4LFA J;  2MQ8 A;  3D3B J;  1IBM J;  4JI4 J;  2F4V J;  4DV1 J;  1XMO J;  4KHP J;  3IMQ J;  4DR6 J;  4YHH J;  2KL8 A;  5LMU J;  4B3R J;  4K0K J;  1XNR J;  3R2D J;  4NEY A;  2UUC J;  4NEZ A;  3J7A N;  3D3C J;  2VQE J;  1HNZ J;  4JI3 J;  3W1Y C;  1HNW J;  4DR5 J;  3R2C J;  4DR2 J;  4JI8 J;  5BR8 J;  4X64 J;  4B3T J;  4DR7 J;  1HR0 J;  3T1H J;  4X66 J;  4JV5 J;  1J5E J;  4DR1 J;  1N34 J;  5AJ3 J;  5LM7 E;  4B3M J;  4JI6 J;  4JI7 J;  4JI0 J;  5LMN J;  4DV6 J;  4GKJ J;  4OX9 J;  4DV0 J;  5IWA J;  2UUB J;  4KY3 A;  3JAM U;  5FLX U;  2MTL A;  4DV2 J;  4LF7 J;  5IT9 U;  4AQY J;  2UU9 J;  4DR4 J;  4LFB J;  2KVQ E;  2ZM6 J;  1N36 J;  2UXD J;  2HHH J;  4HHU A;  4JI2 J;  4JYA J;  4X65 J;  4JI1 J;  2VQF J;  4DUY J;  4RJV A;  2UXB J;  4DR3 J;  1I94 J;  3OTO J;  1IBK J;  4LF6 J;  4B3S J;  4DV5 J;  4DV3 J;  4PWW A;  4LF8 J;  2UXC J;  3J80 U;  1HNX J;  4DV7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...