4LF7J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf7J00
3W1YC 1HNXJ 4V1Ak 1XMQJ 4DR2J 4X62J 4JV5J 2KVQE 4LF8J 5LMNJ 4B3RJ 1N34J 1N32J 3D3BJ 4K0KJ 1HNZJ 2E5LJ 4NEZA 4DV2J 2MEWA 4DR3J 2MQ8A 4RJVA 5AJ3J 4LF4J 2UXCJ 5A2QU 4DR5J 2UXDJ 4B3TJ 4KY3A 4HHUA 2VQFJ 1IBKJ 4DV1J 4JI5J 4LFCJ 1N33J 2ZM6J 4B3SJ 4DV5J 4JI4J 4GKJJ 5LM7E 2UUAJ 4AQYJ 1FJGJ 3J7AN 2UXBJ 4NXMJ 4NEYA 4X65J 3J80U 1N36J 2UU9J 2MTLA 3OTOJ 5IWAJ 4NXNJ 4LF7J 4JI0J 5BR8J 4GKKJ 2VQEJ 4DV3J 2HHHJ 4DR7J 2UUCJ 1I94J 4LF5J 4DV4J 1HNWJ 4JI1J 4DR6J 4B3MJ 4OX9J 3D3CJ 1XNRJ 2KL8A 1XMOJ 4KYZA 5FLXU 4DV6J 1IBMJ 4DUYJ 4LFAJ 4JI7J 4JYAJ 3T1YJ 4DR1J 3R2DJ 3JAMU 4LF9J 5IT9U 3T1HJ 4KHPJ 2UUBJ 5LMUJ 3J81U 4JI2J 3IMQJ 4JI3J 1XNQJ 4DV0J 1IBLJ 4X66J 4LF6J 4X64J 4JI8J 4JI6J 4DV7J 4DUZJ 4LFBJ 4PWWA 1J5EJ 4DR4J 2F4VJ 4YY3J 3R2CJ 4YHHJ 1HR0J
chains in the Genus database with same CATH superfamily
2HVHA 3CD7A 4B9UA 1KEKA 1BUXA 1B0VA 4ECTA 4PG5A 3B6BA 5HATA 3TO8A 2OPSB 1NPPA 4N76A 4IH5A 1FRIA 1N48A 4KGXB 2M7SA 3TZWA 2QLXA 3OJUA 4G65A 3QGPA 3FCVA 2M3DA 2BRKA 3F73A 4A8YA 1NSAA 4TYBA 4Y65A 3SV4A 2DHAA 2GMLA 1CS4B 3A4TA 2RDJA 4LF5F 2UUCJ 4BS2A 4FVCA 2KXHA 4ERDA 2ASJA 3ONQA 2R7UA 1S6QA 1JLBA 4RBUA 3NGSA 3OD2A 1B3TA 1UPPA 2IDEA 4DL7A 1S79A 4PG8A 3L7UA 1YSJA 2UUBJ 1QJHA 1ZTWA 2VPXB 3MR6A 1WWHA 3UNGC 4CIOA 2CPFA 4QYZK 3CC7S 2MLZA 2MKIA 4KGVB 2J7KA 1C0TB 4WZMA 4CCHA 4OL8A 4O3OA 4NLXA 4A48A 3MAAA 1RTDB 4LF6F 1C1CB 4ZN3A 5DO2A 3LGMA 2YH0A 5DQHA 4ZHRB 2VF3A 3NY0A 3E01A 4WJBA 5DLFA 1HWUA 1DTTA 2NCKL 4JI4F 3R6LB 3BDEA 2YWWA 2C2KB 1ZAXA 4I67A 1U6BA 3KJQB 3GIIA 4X65J 5ADZA 3SQGB 4QR1A 4PCQA 2GO8A 2C2EA 1WC4A 5D0HA 1CQMA 4Q0BA 1Y7PA 4ZVHA 3R8YA 4OX9F 2Z30B 4PAAA 5CHCB 3MM6B 4FF2A 2HNZA 2GCFA 4QOTA 3Q8SB 4CNZA 5H9FK 3GE9A 4QWEA 1OY9A 3RAQA 3IGNA 2AJ4A 2J8AA 2KM8C 4H4OB 1PAUB 4DR4J 3QIDA 3QO9B 2B5JA 1S48A 4OHYA 1IKYB 4WPAA 2G13A 2IJRA 3M32A 4K0KF 2ZBPA 1Z2LA 3OL9A 2RVJA 1D8ZA 1EQMA 3JTNA 3HVWA 4DWIA 3T41A 2W8KA 1X4DA 4B3TF 1WG4A 2W4PA 5ETNA 2OPRA 3KK3B 4C9DA 1FFSB 1BY9A 1BGXT 4HACA 1C2PA 4P73A 2KZMA 2GA7A 2Q6BA 2RUSA 1RWOB 2YNHA 2UV8A 2W9BB 1T0TV 2V4JA 4PZVA 2W7PA 1WTBA 2VICA 3LO3A 4DR7J 2M8DB 1GQEA 1I94J 2R7RA 4DL3A 4U6PA 3N79A 2UUTA 1WELA 2VDIA 3FCWA 1VBZA 3M2VB 1TP7A 3OW2R 2MY8A 3NS5A 4WP8A 2N4DA 4LMZA 2XSJB 1OYEA 1ELOA 2OPQB 4I4BA 4K4XA 1UP1A 5KFFA 1J2VA 1PJ5A 1VRTB 5DETA 2B51A 4X66F 1YIJS 3Q0AA 1LXJA 2CQ0A 3VQSA 3DN9A 2F4VF 1QAJA 5KFUA 4KKOA 2C3MA 4UY8T 4C3MA 4YB1P 1NH8A 4JI5J 2VH7A 1SH0A 1C4CA 1AB8A 1MROA 3PHTA 1PYSB 5HVGA 4F4XA 3GP9A 2ZH8A 2CWKA 3J80Y 2DXEA 5GAEU 4CLYA 1NCLA 2R2RA 5GVQA 5K8NA 1RWKB 2J8SA 5FIIA 1VQ5S 2YH1A 4DQSA 4CLZA 3JSBA 2QGFB 2NUUG 1WACA 3IGVA 1SI9A 4X4OA 2Y8WA 3R1LA 2OJ3A 3D2WA 4JI7J 2XMVA 4LF1A 1R0CB 4Q7AA 1UWBB 3HMJG 2IBOA 3A12A 6FD1A 2HWTA 3NAIA 5C42A 5KG4A 2DR8A 4KGZB 3U1NA 3G6ES 4LSLB 3GSDA 4OLPA 5DRKA 2KHDA 2Y1JA 2CA9A 3ZZZA 2HW3A 3AD8C 1JLEB 1Q7LB 4RLEA 1FNMA 3LALA 1RLCL 5K8MA 2LQ9A 4DSKA 1AROP 4LFCJ 4NLUA 4F3MA 4OYMA 2KU7A 2Z2LA 3M2UB 1N36J 4BCAA 5J1EA 4O3RA 1M1KT 2XNRA 4OQJA 2J7UA 2DTJA 2KL8A 1LW2B 4F4ZA 2YNGB 4ECSA 4LF9F 4O4RA 2B7BB 4QPXA 2UVRA 4J91A 5C25B 4I2QA 4QR2A 2CWXA 5KFQA 4KGMA 4RW8A 1CJVB 2PMWA 4USUA 1WORA 1FVQA 4IFVA 2IY5B 5LSRA 1IKVB 4E0DA 4L3KA 5GAHU 3MPVA 2M8HA 3QGHA 4FXDA 2R2TA 5HLFB 1UZHA 1IVZA 5CYJA 3AY0A 1NPKA 4OHXA 4IRKA 4ATNA 4OYZA 2E9TA 1YWXA 4UQGA 4DSLA 1PJ7A 3J7YU 3AA9A 2RB7A 2AW0A 3C15B 3CCVS 4WYLA 4IH6A 4IRDA 2DNHA 3UN3A 2ROGA 1H7WA 2I8EA 3G9CA 3VAIA 1IN0A 4LRCA 3PJXA 1JLFA 1RTHA 1NKEA 2J9DE 2H5JB 2WK4A 4LIWA 5CXTA 2E9ZA 4ZVSB 4C11A 5E2QA 1JMTA 1GXLA 3M8QB 2V67A 1ZBTA 3TUPA 1F9FA 4FPIA 1RXOB 2I1RA 1RISA 4M95A 1RTJB 4QIEA 4K50A 3OSPA 5E5NA 5C24A 4F0HA 3WZ0A 4LF4F 4Z2XA 3KOAA 4ZVOB 1RWNB 4LR8A 2E7XA 3W9HA 2FD2A 2R7VA 1U48A 4ZCMA 1CJKB 1QY7A 1VQOS 2VBZA 3GONA 1U09A 4DLGA 3GV7B 4Y2KA 4B02A 1VLYA 4TVAB 3AA8A 4DU8A 2GVZB 3OFHA 1NK8A 2BJ3A 3RU0A 4CLPA 1IQZA 3C6UA 1FRKA 5HSPA 2AX0A 4CLWA 4DR6F 2NYIA 4NXMF 3KG4A 4PYAA 5DM7Q 4XTTA 4M5DB 3UD3P 5CYQA 5A8KB 2IA6A 2FB0A 4NA3A 1VHIA 4F26A 1PO6A 3HJFA 3R7NB 5JUMA 4DV7J 2DNLA 1NK5A 4I1TA 2YPYA 3N01A 4KHRA 2N7YA 3QLHA 2F3JA 4NL5A 3DGPA 4KFBB 2L08A 2IM1A 3VCDA 2WB1D 1LKZA 1NBEB 4LR7A 1HL6A 2OELA 2AD9A 5BXIA 5ITHA 4DF8A 3OL7A 1WG1A 2ZUAA 1S6PA 3J7AN 4Q5VA 5KOWA 3V81B 3QRRA 4WBFA 2D7SA 1CULA 3W62A 2RH3A 2IC3A 1SH3A 1X7VA 4MKAA 4C8NA 4ER8A 2OFHX 2BKPA 2LA6A 2O66A 1ZS6A 1JLCB 2D3O1 2FGOA 2FLNA 1NK4A 4A8QA 2VODA 1W25A 2CQBA 3HZGA 4IR1A 1TK5A 3OTDA 1RGVA 4Y2MA 4LFAJ 3ISZA 1ZPWX 1NJZA 5KFIA 3QT5A 5ETOA 4LF2A 4R0EA 3HZEA 1L3UA 1PAEX 4RNNA 5KFDA 3FCHA 4GC6A 2AZ3A 2QSWA 3NCQA 1FHTA 2OEJA 2YVSA 4LF8J 4KE5A 1YJUA 2WSEC 2XM3A 4IDKA 4I2PB 2VPWB 1X0PA 2V2VA 4JP8A 2G0JA 1K9MT 3MCMA 4ZJQA 2VQFF 2ZM6F 4PEOA 2KXNB 2A0FB 4Y28C 4IG0B 2LQBA 1E6YB 1RTZA 4KV8A 3J7A1 5AE3A 3ADAC 2H9ZA 1T03A 3MCNA 1M90T 4RPFA 4B9NA 1RE1B 1AW0A 2NPFA 1HI1A 4N41A 2QG9B 1TK8A 4NLYA 1BLUA 1VQKS 3LP2A 1NZ8A 5DQGA 4RW6B 4RW7B 3OLAA 4DFPA 3QNWB 3H5YA 2QLFB 4WIIA 4X4TA 1UVNA 3PIOQ 5EWFA 4PUOA 3IBCB 1KD1T 2XCAA 1FRMA 3LP0A 2W01A 5HL7Q 1BE4A 4UOCA 2FC8A 1T95A 4XDCA 4DR2F 1ROFA 1KRPA 5M2UA 2BJDA 4KQZA 1QM9A 2R7XA 1J5OA 3FVYA 2DGSA 1WHVA 3KLGB 1NHKL 3V5RA 1OO0B 3I56S 4WK1A 4G6VB 3PYEA 1NZAA 2I2YA 1SUQA 1URNA 5HBMB 1YZ7A 2ZH4A 3PX6A 1HBUB 5DG7A 3PW5A 3ZC4A 3MUTP 1WC6A 1NSPA 2WBRA 3CC4S 1H0HB 3AXKA 2MTLA 3GR0A 2MSSA 3ZTPA 3CULA 3TW0A 2YKNA 3W5YA 1G2EA 2P8IA 4KR0B 1VQ4S 3A3OB 4LQ9A 4HT7A 3TWZA 4EFAC 4HTIA 3W61A 2LEPA 4USHA 1QUVA 4NA1A 4I6AA 3MUMP 3EYZA 3EXYA 5ETTA 4YR0A 4JI3F 3NP5A 4N7TA 3RAXA 4F0KA 4ZKAA 2W8LA 4X4UA 4UOGA 4ZLPA 3EGZA 4USVA 2R2UA 1OIAA 2CKWA 3ENWA 2LYVA 1FNOA 1R89A 3PW7A 1HNZF 3FZBA 1R0AA 3NG8A 1TKZB 3DRPB 4M5NA 4OIXA 5KG1A 2OO4A 3DLEA 2QTWA 2B56A 1JX4A 5E7OB 3SQOP 3CJKA 5DQIA 1WC3A 1VBXA 3AODA 3Q86A 4HEA9 2BKNA 3CCTA 1YBAA 1U1PA 4ZCLA 3JQKA 4P52A 3QT6A 2OEKA 3NEKA 5F8LA 1Z1ZA 2MKHA 1ULRA 3W9JA 2EI5A 1QVFR 4B3MJ 3D3CJ 2ACYA 1LOUA 2DY1A 1OY8A 2DPIA 1XTZA 2YKPA 2VD3A 3LTOA 2HBYB 3MEKA 4O3QA 1FDBA 2LDIA 2YPZA 2RD5C 2RU3A 5HROB 4X4QA 2UUCF 2XMKA 5LXYA 1HFEL 2B9XA 3DRSA 1IR2A 3V4IB 2F4FA 5KFHA 3HHLD 1U1OA 3UNYA 2HFUA 1XMQF 3PTWA 4UZBA 3R1HA 4X62J 5L8RC 3HF5A 4BC7A 3H25A 2QYCA 2MZSA 2ZNZA 2OMOA 1V5IB 4TNOA 5T7LA 2X7IA 1VQSA 3W2VB 5G4DA 1VOMA 5HK4A 3GR1A 4FVMA 4K4TA 2KJVA 4GKJF 3MECA 4X4RA 2HNYA 2LXUA 1SH2A 5CD4A 4OZ0A 4F02A 3EWGA 5F8MA 4O3NA 4FP9A 1VCTA 2P6TA 3NMAA 4NXNJ 2DGXA 3ZNJ1 3CCJS 2AEFA 1AUSL 1HNWJ 4Q8FA 4IKAA 4ED3A 2V5HG 3QJLA 5CQGA 4NE9C 3H4BA 1U8WA 3DU6A 3MMAA 1L3VA 5CAAA 3MEDA 3CT9A 2HFZA 2E44A 4ZJLA 1FRLA 2PA3A 1LW0B 3DLKB 1J5EJ 4KPYA 4J9VA 2O1PA 3CCWA 2ZH6A 4YY3F 3K0JA 4OI0A 3KNAA 1RT2B 1LK7A 3HHNB 4HR2A 2M9KA 1BQNA 1WF2A 2AZ1A 3GFHA 1A6LA 2HS3A 5F41A 2UXCJ 2FVSA 3SSQA 1N33J 2IVYA 1H74A 4NZ0A 1PKUA 1IKXB 3FKBA 3JQMA 2VG7A 3AJDA 3KDOA 5E41A 3W5ZA 1TKTA 3CCZA 3DI6B 2BOPA 4DL4A 4Y2CA 5HQ8A 1JLGB 1KVJA 1YGYA 3BGRB 1FKOB 3D1QA 3F0NA 1R6VA 2C3OA 3NOCA 5KFKA 3UD4P 4HTJA 4I7FA 5BYSA 2FQQB 5BYQA 3MMCB 2XHCA 3SEOA 1N5YA 3VGVA 3BKUA 1RKIA 3PXGa 3PR5B 4P2XA 3MOZA 5E33A 2IRYA 1RK8A 2NXJA 4B08A 1PCAA 2C42A 3FQKA 4L72B 4NLRA 3BF4A 2HHXA 1WDDA 1QTNB 5KFLA 3IS9A 2BJ1A 3AD9C 4XDDA 2HRUA 1VC0A 2A18A 4I6YA 2CNNB 2QRRA 3KK1B 2R7QA 2KFZA 2GHPA 2DR7A 2QA4G 1YJRA 2R8IA 4YEAA 2WVEA 1JKHA 1QLNA 2YQ0A 3H40A 2UU9F 1XR5A 3E51A 4CH7A 3HVRA 5GAGI 1K0TA 1RQ0A 2ZH3A 3OUYA 3P6YC 2J9CA 1U02A 3DOKB 5LSOA 1WC0A 1S4FA 3OV7A 5KT3A 3CJTA 2A6MA 7FDRA 3DLHA 2AEMA 1HA1A 1U2RA 2HMIB 3HDSA 1HNXJ 2ZD1B 1P27B 2BW2A 3TQ1A 4AL5A 4CYUB 1UVLA 2MGZB 2B4UA 3FGVA 5HJYA 1WF0A 3V4MA 3HFZB 2CYYA 5AXNA 4C97A 1NSQA 1IJFB 2ZHOA 1VGYA 5DGBA 1SV5A 2CPJA 1T9VA 5T14A 3PW4A 5IQQA 1AFJA 3D28A 5GADU 5F9LA 3BSCA 1C1BA 2CPDA 2GMHA 3FSIA 1LNQA 1SQFA 3HPOA 1U4BA 4ED8A 1RCOB 4JI0F 4XPEA 2DB1A 2VIHA 4GKKJ 1RAOA 1WEZA 2NSBA 1FTCA 1P9YA 3PKYA 1SBRA 1UVMA 3BKFA 2GGPA 3CJ5A 4NWBA 4X4PA 1RBAA 4HVZA 3FBEA 4RNMA 2DD8S 4ILMA 4J9OA 2GFFA 2I0XA 3UDCA 4Q43A 1XNQF 3CW2C 4OYOA 3VAJA 3THVA 1FEHA 5F0WA 2XWYA 4PYDA 4J9QA 3K5LA 1S9EA 1S6QB 4ECVA 2CIMA 4WFYA 1F60B 4OZNA 5KT6A 3ITHA 1H72C 5D8HB 2CQHA 2RF2A 2W4DA 3I0SB 3FFIB 2VOPA 4ZLNA 4C3LA 2JH3A 4O3SA 3M7VA 3AAWB 3CB4A 1C0UA 2VG5A 5K5MA 2XI2A 3WC0A 3O5TB 4LR9A 2HAIA 4DV5J 1XR6A 1JLQA 3HXMA 1RT6A 1A9NB 4CM2A 4M5MA 2J76E 3RW7A 2L41A 3KLHA 4M8LA 2VJVA 3OPKA 2YY3A 3BGOP 2QMWA 4W98A 2OH2A 1RAAB 2B0GA 2LEAA 2F40A 4DV6F 4IR9A 1L3SA 5L9XA 3HVTA 3AH6A 2NPIA 3EUNA 5DJBA 4JYAJ 1FE4A 1HW9A 3A8KA 1APSA 4Q0BB 2DGWA 5C2GA 1IBLJ 4O0IA 1BQMB 3FZ2A 2Y0SD 1WKKA 4LFBJ 1XR7A 3M05A 2W25A 2F9JA 2W2OP 5K8OA 1KKHA 3LP1B 2XB2D 2QLBB 1WF1A 2LQ5A 2H54B 1TVRA 3AB2B 1HWJA 2C2ZB 3W64A 2FZCB 5EX0A 3N28A 4NI2B 1DTQB 4F25A 1KNZA 4DV1F 3PKMA 3M9OB 3M32B 4RU9A 4IG3B 4FF3A 1HYSA 2GAHC 4NCBA 2UXBJ 1VJQA 4F0MA 2AJ2A 4F67A 2CVEA 4IQXA 3TZXA 3PJWA 2MKCA 3R5JB 2FJAB 4DN0A 1FX2A 2OPRB 3J80U 2ZOMA 2F65A 1YRUA 4LF7J 3MM7A 1NDCA 2EK1A 3PX0A 2HHTA 4HACB 3IC1A 1PBUA 3MEEB 4URSA 2DNNA 2CPEA 2FHOB 1NU4A 1M1GA 2WB4A 3CDEA 2WOMA 3CO9A 3TAQA 1IR0A 4RUCA 4GC7A 3ENQA 4JI2F 1R6YA 3EXCX 5K14B 1TFWA 4MIBA 2V4QA 1ZH5A 2W9CA 1MWYA 3I5BA 2BANA 1RWWB 2CJ9A 4ZCKA 1NHUA 1BQXA 3R7SB 4ED0A 2QSFA 4EZ9A 5EUHA 4DV2F 5A8WA 4B9VA 3CJRA 1EKRA 5AJ3F 4LRFA 3GILA 1RT1A 1KONA 1MG7A 5DZ7A 4DL6A 4Y3CA 5LM7E 2UP1A 1FJGF 1RA6A 2AGQA 2BMBA 2HVDA 3ZZTA 2UUAJ 2EFOA 4O4GA 4ED1A 1UMJA 1F9HA 1KQFB 4KKOB 1KVIA 2CNKB 1B99A 4ZVFA 4RBVA 3G82B 2C28A 2OTJS 2DH7A 1VQ9S 3HHEA 2D3ZA 3M8PA 3FMWA 1MROB 5JJBA 3WX8A 1RT3A 2H1YA 1T11A 1KP6A 4OMFG 1UL3A 5L1JA 2IYIA 3OTCA 3TI0A 4NRTA 1VS3A 1D1UA 2PEBA 2IM0A 4DR1J 4U8VA 2E1AA 1ICEB 1IWGA 3DDIA 3QAUA 2P6SA 2DNQA 3PCOB 1RWXB 3DLBA 1H2TZ 4UW2A 1MU2A 3T3FA 3NS7B 4JI8J 2MZQA 3UCZP 4EWTA 4PXBA 3NXZA 4C98A 4LFAF 2HWIA 3PDNA 4TYAA 4FYWB 5KFJA 2KHCA 5F8JA 5LMNJ 1U0SA 1HQ2A 1T05A 1REVA 2RS8A 3A8EA 5C42B 3AXMA 1FJCA 5D0GA 2MLXA 3KUHA 1GEHA 4W4MA 4RWWA 2DBBA 4HHHA 1LWEA 3M2RA 2ADCA 2HQDA 5ETVA 4FYYB 1EP4A 3MR7A 2GJFA 1DQ9A 4LSZB 1NB2A 3IN5A 3GB0A 4ID5A 4OI2A 1NKCA 5SZTA 5D4NA 3NRBA 4PWDA 3OTOJ 1TL4A 2DXFA 4C8LA 3JSMA 2V94A 1X5SA 4ZDNA 2F9DA 4YMEA 1KLMA 4ELVA 1XMOF 2AGOA 1WOOA 2NXCA 2ZBIA 1IBMJ 5J1EB 3W2WA 3T1HJ 2AMCB 1VK3A 3RBZA 4X64F 4LRDA 1SC6A 1JXEA 1ZM3A 1JJHA 1U1RA 4K8RA 3FRYA 2HQGA 4DHVA 3ZO7A 4JV5F 1VRUB 4I2QB 3GYGA 4RW9B 2IAJA 3RJMB 3BYPA 5L38A 2AKWB 1EARA 2B8PA 2UXDF 3CIMA 3KG1A 2QFJA 4C3KA 1DJ0A 4RKUC 3DYAA 4IFVB 2AP6A 3QJPA 1UKUA 5HQLA 2YX4A 2A2CA 5F3ZA 3FBBA 1TKDA 3NGUA 3HP6A 1S1WA 2W2MP 3FC9A 3CDUA 3NGKA 3QZ7A 2VBWA 4WKYA 2HHHJ 2IFXA 2YBVA 3BM7A 4K2JA 5E3AA 4NYPA 2J6UA 1RSCA 4DUTA 4USJC 4KHPJ 2KRBA 1YG0A 4DEZA 1HWLA 2GHVC 3DC2A 1HHSA 3Q8VA 3ZTRA 1JLFB 4CWBA 5F8HA 1TK0A 2DGOA 1PIEA 4EYHB 5I42A 2CJKA 1R7IA 3X1LB 4QW9A 1T9WA 4C11B 1CJTA 1MMNA 3N5BA 1ZPVA 2EBGA 3HSZA 3T6BA 1AZSB 2B9EA 2R3VA 1KHVA 2KYZA 2XLIA 2Y1IA 1S1VA 5FD1A 4B3SJ 2LQJA 2W2PP 3US5A 4DJBA 3KLIA 3WDOA 2ADBA 3AOAA 4OZLA 1IXKA 2F7VA 4FNHA 1HHQA 3GFYA 3KMSA 2PDAA 2ILYA 4U7CA 2Y1RI 1F5BA 2LFVA 2ATLA 2QV6A 4DCPB 4ZCIA 2ROEA 2OHDA 2MQQA 2VBXA 1T3OA 1TU0B 1TL7A 5DDOC 2JRSA 2HS0A 5HMXA 5J2QA 4DUYJ 2MHNA 1JNRB 2F8EX 4YR2A 4V19X 2DGUA 1Q8KA 4QU6A 1HMVA 4DV0F 1HBOA 1XEZA 4MT1A 3GG1A 4JBCA 3THPA 1RA7A 5CYQB 4C8MA 2CJXB 1S9GA 1OS5A 5KAKA 1NM2A 3PR4A 1FXDA 3M6WA 1VQ8S 4AXIA 2V6AA 1K0VA 1TL1A 1UVIA 4NMLA 3GLJA 4F3QA 3NCRA 2DH8A 4M63A 4AL7A 4USWA 3QLHB 4WFBQ 1FKAF 3VGSA 1ZZNA 4FNIA 2HHPA 3DGPB 1ZM9A 3H7HB 1F6TA 3N0VA 4D3HA 4ZIWA 4AQYJ 1FJEB 1LWCA 1DFDA 4HDHA 4CO3A 3I5CA 2HVIA 1N56A 1U2CA 2VJUA 2KDOA 1JLAB 2XI3A 2N3OA 3Q8YA 2WVDA 1R0BG 4KJIA 2XZWA 3SBMA 3RBDA 3OXLA 4DV4F 3OVSA 1CULB 2IM3A 4IFYA 4HKQA 3EICA 4DSJA 2X1FA 1B70B 1QSSA 1P8GA 2R8JA 3OR1A 3OBIA 1VQPS 4R5PA 3IBFB 4QYRA 2OPPB 3M1VB 2C3UA 4WWSA 3BN7A 2I5JA 2KO1A 2KZZA 2ZE2A 4M5HA 3MI7X 1WC5A 2MZJA 1N34J 2QX0A 4LVOP 2G1DA 2W9AA 2YNIA 1IBKF 3BDPA 2IVMA 1CSJA 2I9SA 4ETZA 5KT7A 3QJJA 4RUAA 3D67A 4ZPWR 1EX8A 1N88A 4ECRA 3UO0A 1VQYA 5CZVA 3MOJB 5IWAJ 1Q16B 3CPWR 2PA8D 1SL2A 2VKRA 3DXBA 1TKXA 4KV8B 1EETA 2QFIA 5RUBA 2YWFA 4E2FB 1M5KC 1EJ7L 1T03B 1RZMA 1QVGR 3EZ5A 5ETLA 1Q95G 1RAEB 2RNEA 2D74B 4A47A 1Y5LB 2DHXA 3KK2B 1P9QC 1RI7A 5D4LA 2XCPA 4JI6J 5A8RA 1N0UA 2ASLA 1QE1A 4M1KA 2BACA 4PG4A 5F8IA 3GV5B 1FK9A 4ECWA 2OEMA 4EMDA 3HKZD 1H6KX 1S1TA 3NNCA 3LP0B 1WI6A 4ES1A 4DS5A 1RJJA 3LGNA 3W8PA 2ERRA 4IQMA 3KNGA 4QJVA 1NK0A 2XY7A 3BS9A 1IR1A 1NJWA 1XQIA 2KT5A 3D0GE 3CSKA 4NMXA 2XMMA 3UVJA 2Z4PA 3IRWP 4NEYA 3SDEA 2G4BA 3LAKA 1SUQB 2RKIA 3TAPA 3ZZRA 3TUZC 1YLXA 2MYFA 5IS2A 2GS8A 3CD0A 3TA2A 3MXHP 1CS4A 2G2OA 3PRDA 2HEKA 1UVKA 4IOCQ 2MXYA 4UUXA 4J9SA 1RWUA 5ETSA 1R8PA 2ASDA 4EUVA 2KYXA 3WIVA 2YKNB 1RBOB 1KQSR 3UWTA 2CQ2A 3GV8B 1S1UA 4E98A 1RWVB 7FD1A 4F36A 1SPBP 2FVRA 4OFZA 3MD1A 4WCEQ 4YHHF 3AD7C 2V4RA 1OPIA 5CD4H 3G6XA 3KUGA 5IC6B 1C0TA 3V6DA 4KRWA 1UAWA 3J7ZT 5C7PA 2KFNA 1C1CA 3VVUA 1HBNB 2QJ3A 1ZZFA 5CYMB 4QQBA 2IRUA 1TL3B 1VBKA 4H54A 1S5ZA 2DNRA 4OX6A 4A8SA 4ECYA 3GIKA 3V6KA 1S12A 3I0RB 1HD0A 1WHXA 4OZ1A 2E1CA 4C4WA 2J0WA 3A1YG 3LA0A 1TAQA 4M5IA 3DLEB 4IOBA 4WFXA 2CDRB 1SJ3P 5KFRA 3ENVA 2JHEA 4C0BA 1H2VZ 5I3UA 1UFWA 4U8YA 4DL5A 3SQGA 2NREA 3MM5B 3VTIA 2L48A 1X4CA 3SIPB 3FQLA 3QT8A 1FDDA 2XS5A 1FKPB 4LUBA 2A3JA 4KPCA 2W24A 1U47A 2G0CA 4EBEA 4GKKF 2B4VA 3IRXA 2FY1A 3IAM9 2DEJA 5A0YA 2QL9B 5B0GA 3TRGA 3QFHA 1HHTP 2EFQA 3HHLA 4BC9A 2QA1A 4OLOA 1S72S 3TVKA 1V3RA 3PG9A 3TJ9A 3W9IA 5AXKA 2EFVA 2H5IB 1M5PC 2RSQA 1OSCA 4QIVA 5HP1A 3VHQA 4OZ2A 3DMJA 3BO2A 1JIHA 1X4GA 1FF2A 1NHVA 3GMGA 2LECA 3VGUA 3EE3A 3CWJA 5T7LB 3PEHA 3NWRA 4C0HA 1H73A 3K89A 2HHQA 1PYTA 3HFVA 4MH8A 3EDQB 3VZHA 2WW8A 1HI0P 4DV5F 4CLKA 2ZH2A 3L9ZA 3D0HE 2P9EA 2GQ2A 5J1PA 2CZ9A 3OT9A 3JQJA 3E2EA 4TKTA 2VA2A 2GJIA 2B4OA 3O1LA 3CCSS 4CH0S 3OFEA 2VFSA 1XC9A 3GWCA 1CPZA 3DLGB 5KT4A 4ZLLA 2Z58B 2HVZA 3AOCA 3MMAB 4JYAF 1HR0J 2XSJA 3OR2A 3MEDB 2VC1A 3K5NA 2OPQA 4B3RJ 4DSEA 1IBLF 1VRTA 4DR3F 1G3OA 2N3LA 4ED7A 4LFBF 4CDIA 3TX0A 2ZFHA 5KFWA 3OVAA 2R7SA 2XULA 3VF0B 3KUEA 1WKJA 4OYXA 2DNKA 1TUGB 1T9UA 4NLPA 7AT1B 5HMYA 5KFMA 1HNIA 1X60A 3ET6A 3FDSA 4HH0A 2K3IA 1ZM2A 4USIA 1FA0A 1FE0A 3PW0A 3VAFA 2RRAA 5IM0B 4ZPDA 2JX2A 1RTIA 2VG7B 2UXBF 1TKTB 4RBTA 2JEIA 3P5TL 2Z2YB 5IV3A 2XS2A 3L7PA 2FVCA 1S49A 2RS2A 3D54A 4AL6A 3ILOA 3QT7A 5J2MB 3I82A 1WSVA 3R9LA 4PRFA 4I7FB 1RYRA 2DGVA 2EPIA 1UJ4A 3PW2A 4BHQA 1FWPA 2MQPA 2DNOA 2HFSA 3OFFA 1F5CA 3NBPB 2NZ4A 2MB0B 1K47A 2KVQE 1H7XA 2J0XA 5KFZA 2E5LF 3AQOA 3WHIA 4DX8H 4U7UD 3R27A 3N6LA 2PMHA 1SJ4P 3D66A 1JLEA 4TN2A 1MWQA 1CEZA 3PY8A 3OQ2A 4LBPA 2VA3A 5BYRA 4G1QA 3IS9B 3Q22A 1I3OB 4FKXA 3U7JA 2OD4A 3M2UA 4F50A 1N8RT 2OFGX 3MGJA 3QWUA 4LF5J 4F4WA 3QWPA 1JKHB 2V8PA 5HANA 3U1LA 2G1HA 2ZH5A 1FWKA 2C3YA 2UVUA 1N5TA 1KLNA 2C2OB 2ZNYA 2CVIA 4OV6A 1WC1A 5T41A 4HL9A 1X0FA 2FLOA 4EYIB 3AB4B 3S01A 4DS4A 3IFEA 3OUYB 1QUPA 1SIZA 1O51A 1VQLS 2K2PA 5F3TA 2VBYA 4H4MB 2E1RA 3ZZ0A 2K8GA 1FDNA 3Q2SC 3UN5A 4GMKA 4ZPTR 3PYFA 4YR3A 2HK2A 3H4DA 4J9NA 5SUHA 5ETPA 4QIGA 5HLFA 4JI4J 2CADA 5LMNF 5B08A 1SQEA 2M4MA 4XAKA 3NGRA 3JYTB 1SV5B 4C2MA 1YJWS 1YITS 3HK2A 1WHWA 3I4PA 3C15A 4DBQA 2A1BA 2EFGA 1SC3B 4YDXA 4Z37A 2KM8B 3H5XA 3CCLS 4OX9J 1C1BB 3GG0A 1E6VB 1Y5IB 2YTCA 4UT4A 1RU2A 3RW6A 2E5IA 4AYBD 4EBCA 4ZVRB 1M1HA 2EFNA 4JV1A 4XK8C 4DUZF 1GX5A 4CP5A 3RBXA 2H48B 1NJYA 3CCES 1PG5B 5L1KA 1IBMF 1GMWD 5D0RA 3M8QA 2EK6A 3W1YC 3MURP 4P6QA 1VQMS 4NCGA 4FYXB 3BN4A 2CQCA 3LWMA 4K0KJ 3OL6A 2BYCA 3GCWP 2NXEA 3D9BA 4NLSA 1QAYA 3O2IA 4B3TJ 4HYKA 4KY3A 2FIUA 3DGVA 5E3PA 2RF2B 2FJDB 2OGUA 4UTGA 2KH9A 1VQ6S 2RU9A 4HLBA 3WIUA 4DPUA 3BB5A 4NLOA 5CCLA 2F8HA 3U27A 2E66A 2VG5B 3I9V9 2BBEA 3S6EA 3IWLA 1AXQA 3EDRB 1JLQB 1X5OA 3C16A 1RT6B 1YK9A 2JLFA 3TVZA 1T8EA 1R8AA 5HN0A 2DO4A 1FCAA 5HMWA 3DM2B 3KLHB 1LWFA 5IT9Y 3T1YF 4TLQA 4M5DA 5A8KA 3TR5A 3QZ8A 1DQ8A 2HSEB 1Z4UA 1D8YA 2HHHF 2OMLA 4A8OA 2AV5A 3HVTB 3RRKA 5DS7A 2M52A 3VALA 3OSNA 2HHUA 5EHHA 2XEXA 2IBKA 2DR6A 4USKA 4KHPF 2ATCB 4LSNB 3TEGA 4FBUA 2AGPA 1VJWA 1T9YA 3W65A 2ZOFA 5B0DA 3KJVB 3V2UC 2JEJA 2FZKB 3B4DA 5CH7B 2LU2A 2U1AA 1TVRB 4K4SA 3G6VA 3DRRB 1MMLA 3EZOA 2QLWA 2K06A 2DGQA 2WVFA 4A8KA 3EPIA 1XK8A 1F5AA 4DPXA 1S97A 3TNVA 2BW7A 4DQIA 1LV5A 1X5TA 5GAEI 4M5JA 3HVAA 4GRSA 5D3GB 1GMVA 3QSYB 2R7TA 2HYIB 1YJ9S 3IMQJ 4N77A 4FYDA 3BR9A 4CLTA 2MKYA 2FHKA 2U2FA 1LK5A 3WX4A 1RT4B 5LL6d 4DUYF 2XO7A 1X9WA 3R2CJ 3CIZA 2B6AB 1F9EB 2HIYA 4LIRA 4C7QA 1N32F 1HLWA 3C14A 3MPWA 2UVWA 3F41A 2BEFA 2W9CB 3H8YA 5KFNA 2BANB 2DPJA 5ETKA 4DR5F 1T02A 3BPSP 3MZIA 2BE9B 4I68A 4RU2A 1VLOA 3AJ2A 1Q7YT 5A8WB 1OPZA 3N6MA 1IM6A 1M5OC 3DCAA 3KJFB 2W7AA 4NLQA 1K8AT 4ELUA 3CD6S 4WFZA 1EKSA 4WYWA 3UW1A 4P72A 4U9RA 1Y9OA 3OJSA 4K4WA 3B8HA 2YNFB 4K4YA 3D0IE 2DK2A 2Q3PA 4QR0A 1RHQB 1F3VA 1RAIB 1KOOA 2AYEA 2BRLA 1YZ6A 3T6JA 4CZCA 5E3RA 4RW6A 1N5QA 3M8PB 4DX7A 3H90A 1L3KA 1V6HA 3D6FB 1RT3B 2CPHA 4LF9J 1RT5B 1N6QB 4FDFA 2HNDB 1MN7A 3NGTA 1G7CB 2ZJQQ 3SCLE 2MLYA 3PX4A 5EX3A 1S4EA 2B7CB 4WXWA 2XGQA 3RUBL 5KFYA 1IQTA 1RKJA 5H1SV 4M5GA 4IO1A 4ENOA 1URRA 2M88A 4A8FA 4YDDB 2WONB 3G8SA 2MQ8A 4PG6A 3O3LA 1UEUA 2CUYA 5HQMA 3KLGA 2D41A 1NEEA 5GAHI 1REVB 1S1XA 4DQQA 2V2QA 4L76A 2QE5A 2APOA 1FEEA 1FFGB 1Q82T 2J6TA 1V3SA 3PO5A 1LWEB 3M2RB 3TANA 1SXLA 4URQU 3ICLA 1EP4B 1O8BA 3J7YI 4NLGA 3GSIA 3KHGA 3NNHA 3L4BC 2RDIA 2ZC4A 1GAOA 3KYLA 5LMUF 1S0NA 3K5PA 4U95A 3CTRA 2FHMA 3CGIA 1EQ0A 2ALZA 2ZVIA 2D69A 3R5CA 2D9OA 2Z0GA 1K44A 3A8IA 2OSQA 1M5VC 5A6PA 1F1BB 1VC5A 3PJ9A 1T94A 1TKZA 3DRPA 4LF4J 3CO0P 3SI8A 4I56A 2IAJB 3EGVA 3I96A 3TAMA 3EVOA 5IQ6A 5L46A 1T3NA 3CNQP 4M5LA 2BE2A 2RJZA 3JS9A 5D6GA 4PKDB 4IO9Q 2NSCA 2HVEA 3Q89A 4S0MA 1OYDA 1WNEA 3VQTA 2BKOA 1XNRF 4DR6J 1RT7B 1TFYA 2DVIA 4BDPA 3IP0A 3MR2A 4PQAA 2AHOB 2BZ2A 4MKYA 2CPYA 2CQGA 3ILJA 4DZDA 2IA0A 5CZXA 3VWSA 3PZPA 1R27B 2PFFB 4Z7CA 3ZTOA 3V4IA 3A8JA 1PC4A 3DDNA 1N52B 1PGZA 4FS1A 5KG2A 2VASA 2R4FA 2HHSA 3NWGA 4LBHA 2EKYA 4TU7A 5F8GA 2BQRA 4AT1B 1TUVA 3CJ4A 1XWLA 4RL1A 5I42B 1X31C 3W2VA 2FTRA 4DG1A 1CJTB 2ZBCA 5KFTA 1OQ3A 2WRMA 4NX9A 4MIWA 2HHVA 2RAQA 1SL1A 2VG6B 2K3KA 2RQ4A 4ED5A 4HHJA 1FRHA 1WI8A 1VK8A 2NR0A 2YXLA 5BR8F 2H4WB 4WIQA 1RB0A 2EG1A 2A2DA 4JI1F 2ZZMA 2GV1A 4HDGA 3KXDA 2GMJA 4IOAQ 3QGIA 4ANDA 1QD1A 4OJGA 4Q2MA 1TL7B 1VDHA 1LXNA 3POTA 4QWAA 2HFVA 1SKWA 3H0PA 1LW0A 3NS6A 3MEGA 1FJ7A 3GFZA 3HCXA 3ISNC 4ALZA 1SIWB 2HQCA 1RT2A 5DM6Q 4WE1A 3MM9A 2MZTA 4E8UA 2MEWA 1QSYA 1XJWB 1BD6A 4ZIVA 3G2XA 4ID8A 3LUYA 2HZCA 3SV3A 4JUZA 2JEGA 2VQFJ 3IAS9 1TL1B 2ZM6J 4DL0C 2ZHAA 3CCRS 4OZ3A 5HVFA 3LWLA 3BSNA 1B7YB 3ZXWA 1IKXA 4WFNQ 2DIUA 3TEHB 3FUYA 4P7VA 2EVZA 3DI6A 1NUEA 3MCSA 1FKOA 2Q79A 4NZ6A 2XQCA 2JL9A 2R8KA 2OTLS 4X4VA 1WD6A 4Y2AA 4OYPA 2VOOA 4KAIA 2JLEA 1NJIT 1V5VA 2LA4A 3HD2A 3AQPA 4L75A 3GJQB 4A8MP 2GO9A 1PSDA 2Z2MA 3IO1A 4F8RA 5KG7A 3KLFA 4UY85 3OXGA 4P75A 2V50A 3HI9A 4G3IA 1HWIA 3OR1B 2MDAA 1DY3A 4DR2J 1Y00A 5ETQA 4IUFA 4FYVB 1PYOB 2FVPA 4OHZA 3IG1A 1W2IA 3M8YA 1ZOTA 5KFAA 3PFEA 1FTRA 2OLWA 4FXWA 3VAMA 3NMRA 1KTQA 1HW8A 3KK1A 4ZP6A 1JXVA 3KFWX 2XMUA 2YNIB 4J37A 4DPYA 1EHWA 1RLDA 2O01C 4ICLB 2LVWA 2CQ1A 2VQEJ 1QSLA 1VBYA 2ZBRA 4P10A 2ACMA 1NDPA 2BA9A 3CJ3A 2UV8G 1KQGB 1GX6A 2MZRA 3HHDA 2NQPA 3G4SS 2DJWA 4MIAA 4DDFA 1EETB 1Q4RA 4JI3J 2FPHX 1GNKA 2WCXA 4ZN1A 3ULHA 1JQGA 1KFSA 4MMOA 3GTYX 2FUG9 2K7KA 4ZP8A 2HFOA 1WEYA 4LRAA 4ZMMA 1Z2ZA 1M5HA 2ZD1A 4HI2A 2BM0A 3G87A 4XIUA 1HNZJ 4ECQA 2DR5A 5LOQA 2B4PA 2BV3A 1RP5A 2J0QD 3W7BA 4HHUA 4O23A 1BXNA 1S1TB 1G4CA 3UCGA 1FXLA 2MQNA 3QBCA 1NH7A 2XO6A 2IDLA 3C2PA 4WP3A 2KT3A 1KC8T 1O5JA 2PIIA 2DNYA 3OVBA 3GIMA 3NGDA 2X3GA 2BQ3A 1MN9A 3BQ1A 4V19J 4CM0A 3UVJB 3LAMA 4B3OB 3SDEB 2PD1A 2HQFA 2RKIB 4B9LA 3SYZA 2C2DA 3M6UA 2UUBF 3M6VA 5FJ4A 3P49B 5J1NA 4Y0FA 4KO0A 3MAHA 2ZWOA 4N8NA 3A3NB 3VGTA 3GU0A 1XIQA 1WTFA 1XMQJ 3BGLA 1S0VA 1S1UB 4DPOA 1R31A 2H5EA 2UVVA 4ZA1A 3LANA 2JNJA 4C8ZA 3I0SA 3FFIA 1CJUA 2DCLA 4I69A 1RHRB 3RR7A 4F7VA 1MW7A 3EZUA 5M2RA 3KLVA 2ZH7A 3W3SA 4Z7YA 4FF4A 1RACB 4CO1A 3GCXP 3V6DB 3SSRA 1NK7A 2DNZA 4GKJJ 1HQEA 3V6HA 2QN6B 3FSYA 4OYWA 1LWXA 2KG1A 3HT0A 2YKMB 3DDKA 1QDUB 2H4YB 4X65F 3MWBA 2GIRA 4RNHA 4LBIA 2WSCC 2PT0A 4DV3J 4YFUA 3X3UA 5KFBA 1SQGA 1DLOA 2W7OA 4DLEA 4UOFA 4OX7A 5I3UB 4QPTA 4U7UK 2DGTA 1NB7A 2D3UA 4F3OA 3QQCD 3TA0A 2ZDPA 3K8VA 1BQMA 4DR4F 1B64A 2EKNA 2SXLA 4O44B 1OMSA 1FWLA 4QIWD 4YY3J 4QIFA 3M30B 1W26A 3ELHA 4N47A 5G0RA 3IRXB 3PM9A 3N4WA 3LP1A 1A0OB 1D0EA 5A0YB 3DOLA 5I3QA 2EBEA 3VV2B 4EK2A 2V63A 4MTPA 3HHLB 5A2QU 4WZQA 3D6HB 2IMWP 4GO7X 4NI2A 1DTQA 2G2YA 4IG3A 1UJ6A 2FYXA 2ZZTA 2MQLA 3BEGB 3HKWA 5L39A 4ZITA 5HP1B 2GJ2A 5GMKa 4GVBB 2POKA 3DMJB 4PR6A 5D4PA 5IC4B 4DR7F 1I94F 2RDDA 1Q8BA 1JNZB 1R43A 1T7PA 3MEEA 1KFDA 5FDLB 4WU3A 1UCNA 3A3PB 1KTVA 1YJTA 1F3FA 4OI6A 3IR6B 3J81U 4P2SA 5K14A 3DRXA 2ZH9A 3MM8A 3OTEA 3M8RA 3R5AA 3CJQA 3NCPA 4YS2A 2KFYA 1NDLA 4NA2A 2XLKA 1Y5NB 2VFUA 4X4SA 1EIYB 4ETXA 1KS2A 4QBUA 1CG2A 1H2UX 3OR2B 2E29A 3RYLA 4AFFA 4N8OA 2XMJA 4JI5F 1R3NA 1JK9B 2B43A 2LDYA 4J90A 4MJKA 4PXEA 1XERA 2NUHA 3PIPQ 2M2BA 3IR7B 5J2NA 2AJ0A 2BXJA 2XZTB 4L3NA 4CQ1A 3T9ZA 1Q86T 2UU9J 1HQUB 3P4UB 4DPWA 3DOMA 3G82A 4NLWA 4K4ZA 1U1NA 3CEDA 1HNIB 3ET6B 5E0OA 4CT8A 3RB0A 4HH1A 1Q81T 4LJMA 3LPEA 4WTYA 2QT7A 5D78A 4RW4B 5DDRC 1H38A 4JI7F 3BSAA 5DLGA 5CCMA 5E3CA 1RTIB 3PYGA 3K5OA 4ZVUB 3T19A 4EI2A 2LMIA 3EX7B 1P1TA 5L1IA 2BDPA 4UUWA 3D6TB 3FEZA 4RR5A 2BX6A 2YQ1A 4MAKA 2V0NA 9ATCB 2R2SA 4I6WA 2HLTA 5KG6A 2UZAA 4LFCF 5DZ6A 4TQRA 3UR3C 4CLSA 1YBTA 4LRBA 1MSWD 2HURA 4OYBA 1DRZA 1N36F 2YX7A 3JB9k 3MPUB 4JI0J 4KBIA 3QPIA 4G1QB 3QATA 5IFMA 5GADI 3HT3A 2DNMA 4OX8A 1JLBB 2Q43A 3FEYB 2FJXA 4FKYA 1B4SA 4KC5A 2VPYB 1RHUB 2CAJA 3QSIA 4WKRA 4MKBA 2Y8YA 4F2SA 4XPCA 1VMBA 1SKRA 1XNQJ 4NYOA 2MKSA 1RAJA 2QZ8A 2LCWA 4W90B 3M4XA 3O44A 2IPOB 4CT9A 3MPDA 2IRXA 4KH1B 3MAAB 4DU7A 2VDHA 8RUCA 5KFOA 2DNPA 1VRUA 3I31A 4RW9A 3QFWA 3O6QA 1VISA 1BWVA 3E01B 2Y3YA 1DTTB 1O6XA 4YB5A 3P96A 2D1CA 5IZHA 1HARA 2LU1A 3GJRB 2AJ1A 4RO0A 1S9FA 4YB6A 2JJ4D 3GQCA 2V34A 4ES3A 5THWA 3PNIA 1VYAA 3H5SA 1YRTA 2NZCA 1U24A 2L9WA 1NK9A 1NJXA 2HNZB 4EU0A 3OTBA 3K8WA 4DV6J 9RUBA 1N4LA 1FDAA 5IT9U 2JLGA 2CQDA 4MYUA 4USMA 3BQ2A 1G1XA 4YN3B 2B5JB 3RRGA 1ACMB 4PWWA 2CXEA 1UETA 3D68A 1GMWA 4MFBA 4TU8A 1WOPA 5CA5A 1JJ4A 4RJVA 4CO0A 2RQMA 1OJ4A 1AZSA 4J9UE 1IWAA 2XG8A 4NCGB 2DCUB 5HMZA 4DV1J 1VI7A 1NAQA 2F8MA 2YNHB 3Q24A 4X84A 1GK8A 3BQ0A 2V4JB 1UW9A 4LQ3A 3W8GA 3RZAA 2W2QP 2J9EA 1U0HA 4DFJA 1Q8IA 1QAIA 3FBCA 3HHKA 3B54A 4P2MA 3MTKA 2QA4S 1XMBA 4EO8A 1K1SA 3C16B 1A7GE 3FEXB 1EB0A 4JI2J 4BLGA 1RWPB 4TY9A 4DV7F 4WP9A 1LWFB 2PEHA 2MJNA 2V2ZA 1UA0A 3IA0A 2ABYA 2O67A 1GTEA 3FRZA 3N5FA 1N54B 4V1Ak 2BJ8A 4C8OA 1U6ZA 2AYBA 2KJWA 2QC3A 3VAGA 4DV2J 3EPGA 5AJ3J 3Q2TC 3I32A 1AA1B 4PQUA 2JEFA 1VFJA 1KR4A 2VUGA 1Y11A 4WK3A 3ZTQA 1FJGJ 4CO5A 2MSTA 4R0JA 3SFUA 3MMBA 4DX5A 3RAMA 3P8BB 2FJVA 3H2LA 1WG5A 1JLAA 1ITPA 3TA1A 5B0EA 2XSFA 5KG5A 2JDJA 4CTAA 1WKLA 4CH1A 3BSOA 4FS2A 1HBMA 3UR0A 3CMES 4UZCA 1ZAWA 1DARA 3CD5A 2PE8A 2LEBA 2IJFA 3OFGA 2ZJPQ 1GTHA 2D3OR 2PI5A 2DRDA 2OPPA 3M1VA 4UOHA 2DRAA 5KFGA 2I6WA 2GIFA 1Y4ZB 4LF8F 2KI2A 4ZLJA 4ZPCA 2J0SD 1TQLA 3C14B 1H98A 3R5DA 1X4BA 3EVMA 4TY8A 2LQ8A 3HO1A 1S7IA 5DDPC 2OD6A 3UDEA 1TL5A 1Y0HA 1CQNA 3H5UA 2E7VA 1DHMA 1DAXA 3CDWA 4AE5A 2V9WA 4P74A 1HWKA 1KSPA 2FY8A 1CC8A 2IYGA 3TOQA 4QWDA 1Q53A 1XMOJ 4ES2A 1D9DA 1OQ6A 1DURA 5K8PA 1WOSA 2FHJD 3TJ8A 2MZ1A 5C5JA 1R8HA 4X64J 1NK6A 2A10A 1UA1A 3KK2A 1VIXA 1ZAVA 3Q8PB 4RW8B 2DRBA 4L6V3 1Y3KA 3JSYA 2E5GA 1JWWA 3CJ0A 4QW8A 4KTQA 2ZKTA 2AWZA 1X4HA 4JV5J 2C2NA 2RMLA 3G86A 4W92B 4NLVA 4H4KC 1VRQC 4MKVA 6AT1B 1M0SA 5K20B 2FGCA 3A13A 1U8SA 3RB3A 1I51B 2UXDJ 1X4AA 4MK9A 4J9LA 5C2CA 2WTFA 5D15A 2R7OA 5B0FA 3EGWB 2DH9A 2H3EB 1YX2A 2HLUA 1MNEA 2HGNA 3D6MB 2XYGB 3DLLQ 3DRYA 1KDNA 1RAFB 1S1XB 2VC0A 3D1HA 1F0XA 3RB4A 1O0PA 5J2PA 1NXIA 1RTHB 3N9UC 5JXSA 3D4JA 5CABA 2GQQA 1JB0C 2HKEA 3T9NA 2VQEF 2C1EB 3WQPA 1TZ0A 1XBWA 4C0OC 1ZTTA 2YQ3A 4LREA 1D3WA 2HZAA 4Y2IA 2AQ4A 2FZGB 4OJHA 4ZPVR 1Q0NA 5KFVA 3S7RA 3CUNA 5C24B 2GHWA 2QMUB 4NLDA 3RTVA 2EG2A 1KBRA 1KVKA 2Z57B 1HBNA 5CYMA 4R8UA 1TL3A 1X4EA 2WVBA 3I0RA 3BBBA 3F56A 2CG4A 4B9MA 5M2PA 1SJFA 1S0MA 2MQOA 4F4AA 3UE2A 2NS1B 2WVCA 2IIHA 3C6UB 3TAMB 1U1QA 2K1RA 1RWMB 5FLXY 2BE2B 1RABB 4B3MF 3MM5A 2IHR1 2DKOB 3SSSA 3T5KA 3W5XA 1N5VA 4QWCA 4A8WA 2IJNA 1IM4A 3TP2A 2JFKA 3VVTA 1FKPA 1ZYQA 2XMAA 1M5SA 4GO5X 5A76A 4DV0J 2XWXA 3SZ2A 1FT8A 3KHHA 3BBFA 2PI4A 3IXQA 8ATCB 3QIPA 3RGIA 1U1KA 1UWAA 3RR8A 2R42A 4DMZA 3UDLA 5KFXA 4X62F 1RHKB 3TUIC 3MD3A 2PFDA 3EGNA 3E8OA 2Z56B 3VAKA 2QL7B 1UEVA 3S1TA 1X5PA 1GMUA 1R8CA 1B0TA 1U26A 1S10A 2YWEA 2DO0A 2DR9A 1VQNS 5F8NA 1S6PB 1HNVA 2ZDOA 3Q83A 2P2CB 3CMAS 2CPZA 2VL1A 1IKWA 2IC3B 2CRLA 2GZOA 1U25A 1YI2S 4DG1B 2XC9A 4NXNF 3ETMA 4OYIA 2V8HA 4AXJA 5GMDA 4X4NA 1LQ9A 3K5MA 1HNWF 4DV4J 4ZJOA 2HK3A 2RE1A 1Y3JA 4M94A 3JAMY 2PGCA 1BMQB 2NXNA 3CC2S 2X51A 3R97A 4DCJB 1HPZA 4J9MA 4DV3F 4MK8A 3DLGA 1J5EF 1HIYA 2ZITA 3HM9A 1S6UA 4FN5A 3IWNC 2R8HA 2M5YA 2FC9A 3UN2A 4RUHA 3G6YA 4IDKB 2JZ5A 3POTB 5KFEA 3TUJC 2P9CA 4J7CA 2XZDB 5HVHA 3MEGB 3KLEA 2UXCF 2AJQA 1GT8A 5D4OA 3OXFA 3ILLA 3PO4A 1N33F 1IBKJ 4WE1B 3MM9B 2RHQB 2XTJP 2DISA 4A4JA 2O5DA 1PJ6A 3N6NA 3H98A 3BR8A 1UZDA 3IWXA 2CJAA 2JVRA 4ZVPB 1NNDA 1FXRA 3C6TA 3LP2B 4ANCA 5EN1A 5IM0A 1S0OA 4K2XA 1TV6A 2GVDA 1NKBA 2WW4A 3PV8A 2XBPA 5BJRA 4OYAA 4PUOB 3HHLC 1X8DA 1FD8A 4CLLA 3C8YA 1CBKA 2NYHA 5J2MA 1L5UA 2BR0A 4AD6A 3CCMS 2V8GA 3BGUA 4D3GA 2OPSA 3CMQA 2QYGA 3B82A 2VZ9A 3CDAA 2XMTA 1J5OB 4N56A 4DF4A 3NBPA 1SC1B 3KLFB 1Q78A 4RZRA 1AYEA 1Q8LA 2RUGA 1TR0A 1DBDA 2PSZA 3MUVP 3KG0A 1RYSA 4UQTA 3ZZPA 3M9MB 3BGFA 2WAQD 1Y10A 4CNYA 5KFSA 3IG1B 5LJ3Y 4ITSA 4RNFA 4WF9Q 5GAGU 1UW4A 2Y0BB 4KIAA 1SL0A 3ENAA 1N5SA 1UTAA 4B9SA 1MMDA 3KHRA 3PVXA 3C46A 4JOUA 5MAOA 1ZA2B 4F2RA 1IJEB 5IXUA 5KT5A 3H20A 2E1PA 1GH8A 2KRRA 4DFKA 4Y00A 2OP5A 2HGLA 3CJ2A 2F5GA 3K7RA 2FDNA 4C8YA 1BHNA 3LF0A 3GYNA 5ETRA 5F9NA 2R7WA 2FVQA 4AUKA 1RTDA 2HFNA 3JSRA 2XYPB 3HFKA 4DOZA 3LGHA 3R5GA 5LSLA 4YHHJ 1HNXF 4ZHRA 4F4YA 2QLJB 1VQ7S 1R0AB 4H4MA 1U45A 3ETOA 4KSEB 3T1AA 3GJSB 3IM8A 1FI4A 2XYHB 2AT1B 3CJKB 2N7CA 2L9NA 2V69A 2N4CA 2MPUA 4ZVTB 1KQKA 1FNXH 4NRUA 2HRTA 4ILLA 5B0AA 1YDLA 2AF6A 3MM6A 4TU9A 3BBCA 1TTHB 2WSFC 4P7TA 4YOEA 3JYTA 4WU2A 3GYXB 2CZ4A 3DNCA 1RADB 3R6GB 3PYDA 2PN6A 4F4KA 1BWEA 4H4OA 2EEYA 5IV4A 2LP4A 3QO9A 1E6VA 1EAYC 2VFRA 2DEIA 2KTQA 1TMJA 3DRSB 1IKYA 3MHYA 2L3MA 3QMQA 4DN9A 3TJAA 5I4MA 2FLPA 2OSRA 2QIFA 2RQKA 3MTJA 4RWXA 3FNNA 3ZZYA 3NAHA 5HO4A 3L95X 2YWGA 4PXCA 4DZ6A 3L3CA 4FXVA 1U49A 2ROPA 2DHSA 1JJ2R 4ILRA 5H9EJ 5GMEA 1D9AA 1S76D 5L9NA 3G96A 3KK3A 1TMMA 3BKTA 3CE8A 4KO0B 2XY6A 1L3TA 4DCOB 4QCLA 2AYMA 2VU5A 1Q5YA 5KG0A 3MECB 4K4VA 1F2GA 3K17A 2HNYB 3W60A 2W9BA 4Y6IA 2BOAA 3B4MA 4ZK7M 2HQIA 1CJUB 3QYYA 4RUBA 3BO3A 2JWNA 3J81j 2CDQA 2GW8A 5B09A 3CCUS 4G1PA 2B9WA 4LVNP 1HQEB 2XHWA 3M2VA 1RU1A 3K59A 2HPUA 1WHYA 1U1LA 2LKZA 2AYGA 3G8TA 4K4UA 4RX6A 1WEXA 2OKQA 2O3DA 4OZ5A 2JC0A 3EVWA 3DM2A 5D77A 1MWZA 2P5VA 2QA2A 1DLOB 5A2QY 4ECUA 1P1LA 1TUWA 1YRXA 2RHSB 3LW5C 3SMZA 1XN9A 4K59A 1WSRA 3S8SA 1WJ9A 4MK7A 2G0IA 2OIHA 2YX1A 1YQHA 3HX9A 4ELTA 4FPRA 3T5HA 1BQNB 2N82B 1UEKA 4LSNA 2KKHA 3ZFVA 2ZVSA 4DR3J 4FBTA 1P6TA 2DHHA 3R5BA 2J7WA 3ILIA 3W63A 5G0RB 3NL0A 3IM9A 1AUDA 3KJVA 1PILA 3UDVA 4WTOB 5DG9A 4O0NA 3DOLB 2L9DA 1RUSA 4HT5A 3PRVA 3DRRA 3UD5A 4I0WA 3BPDA 2YKAA 3UCUP 4QZVB 3J81Y 3AOBA 4LF7F 2B9YA 3MMJA 2QL5B 2YKQA 1X9MA 1RBLA 5MLCV 3GJTB 2AU0A 2ALYB 1UWBA 2CJBA 3TARA 3QGGA 2J9DA 3RB6A 5DDQC 4KYZA 2CQ3A 2H51B 1N5YB 5D3GA 1HI8A 2ILZA 2W1BA 1D9FA 2VONA 3FSXA 1U2FA 1FRXA 2DNGA 2BUNA 4LSLA 3K57A 3MR3A 2VPZB 2BJ7A 2HZVA 2HS4A 2GIQA 4DQRA 3QAEA 2ZWPA 2D9PA 1R8BA 1RT4A 3EMTA 1WUUA 4ANEA 3ZZOA 1K73T 2F63A 2NXUA 2B6AA 4P2FA 2E5LJ 3NLCA 3D1OA 2ZUGA 3MM8B 1NO8A 2V8DA 1X4FA 3IR5B 3PACA 4XO0A 2UUAF 1ZM4A 2OUGA 1QAXA 2ZHBA 3VR1A 2FLLA 1N0VC 3Q23A 2CFXA 1LW2A 1VIOA 1FESA 3AT1B 4OI3A 1X9SA 2YNGA 1YJNS 5LXRA 3T5JA 2Q66A 5J2NB 2XLJA 1UFLA 2YNFA 2A6OA 2FJWA 5C25A 5EWEA 4DXLA 1REGX 2R8GA 4Y34A 3DOMB 4K5RA 4DR1F 3FMBA 2LLZA 1CJVA 2LXFA 1JJCB 3D5MA 3DLJA 2C2MB 1RT5A 1N6QA 4LF6J 4JI8F 2HNDA 3V6JA 4R25A 3HSGA 1IKVA 1NLKL 3TX8A 2EC2A 2IVFB 3R7BB 1CVJA 3IBWA 2PC6A 1SVDA 2MHEA 3VAHA 4B17A 2GQCA 1U6FA 3MCOA 2DHGA 1S57A 2HHWA 1HKAA 1DZ5A 2WONA 1T9TA 4JB8B 3C19A 2CJYB 3OL8A 1UJ5A 2BJ9A 1I1GA 2ZJRQ 3MF5A 5JMNA 3NKYA 3AHPA 3OTOF 2XNQA 2Q6CA 2AJFE 2M70A 1YJVA 3ZNUA 1GFWB 4P9SA 2GGPB 4OHVA 2CQ4A 2WHOA 5U47A 4L74A 2RRBA 2C2RA 2DY9A 1RDRA 5ETMA 3KHLA 3T1HF 4ECXA 2Y9HA 2IM2A 4OV1A 1S9EB 4A8XA 3RRHA 3DHXA 1OY6A 2E7WA 4DQPA 1RTJA 4DUZJ 3ITHB 3I6PA 3U02A 4TLRA 4CI0B 1W7WA 4ZS6A 3LOUA 5LJ5Y 1GXUA 1DQAA 1VC6A 2HG4A 2CQPA 3OLBA 1U1MA 2CJQA 5L1LA 1CJKA 2IMOA 2COLA 4NEZA 1C0UB 3DXSX 1LFPA 4NOHA 3RBEA 2GVZA 3TQEA 5AE2A 1ZA1B 3MFHA 5IT4A 3GZ7A 3L7OA 1BC6A 1I5OB 1TAUA 3TYTA 3JXOA 4Q8EA 4L73A 3NNAA 1S6OA 3C66A 4BBYA 2MKKA 1IBCB 4EEYA 1YKWA 2MY7A 4FZVA 1RT7A 3TVYA 1F2HA 4YUDA 3T1YJ 3NOGA 2VV5A 3MPYA 1NMEB 4U67Q 1RCXB 3E3XA 2CG8A 2GNKA 3J7Z5 4YB7A 2BE7D 4X66J 5KT2A 3Q8RB 1H3DA 4KFBA 4WFAQ 3KJNB 2HBRB 2F4VJ 1NPRA 2B8QA 3Q8UA 1SB6A 1U7LA 2LXIA 5EWGA 1K1QA 3SCJE 2G2ZA 4URGA 5F0UA 1Q5VA 1SKUB 3CDBA 1SJQA 2JVOA 4ZP7A 4PABA 3V81A 4ED2A 2V2KA 2QMXA 2BM1A 4MFBB 2ZC3A 3R3TA 1HYSB 4B3SF 4UF4A 1JLCA 2XMWA 4OJ3A 3WC2A 1RAGB 4ED6A 4CRJA 5JVHQ 4CO2A 5D0EA 3UFCX 4F04B 4N5SA 2HBQB 2M0GB 4O3PA 3MM7B 5EDWA 2VG6A 1RHMB 2C22A 3M8SA 4OJ1A 4J9RA 2YWHA 1VR6A 3JTPA 2X1BA 1W2BR 2WOMB 2JFDA 3GPAA 4JV0A 3DFEA 1YVFA 1KHWA 1NSKL 3ZZUA 1U0HB 1T9XA 4M5KA 5DG8A 4QYZJ 2EXUA 3M8WA 4I2PA 2VFVA 4GVLA 1RAHB 4U96A 2V9KA 3KWMA 4MYTA 2KG0A 3KKFA 2PMZD 4PPZA 2V68A 2RILA 3O8WA 1N32J 2XS7A 4IG0A 3CF5Q 4ZVGA 1RT1B 1E6YA 4OI4A 4NLTA 2FJEB 4DR5J 2XGPA 1FVSA 2B3TB 3DKDA 3GFXA 3GIJA 3H59A 1D09B 4O4GB 4AQYF 3BREA 1J27A 4ZPBA 4CO4A 4RNOA 5B7WA 3L09A 1YJ7A 2BVZA 4EGLA 4RW7A 2EW9A 4IH7A 2EFPA 4PQUB 3BH6B 3OHAA 2GX8A 4C48A 3G8QA 3MAQA 4K7QA 4DX6A 2FJBB 1S7HA 2ZEJA 4I64A 4H4KA 3MMBB 2DT9A 5H9FJ 3M6XA 1SJ1A 2R9LA 5HJXA 2C3PA 1MU2B 4CTAB 3AJ1A 2GAGC 3CVKA 4BWJA 4PPDA 2I38A 4CLFA 3I5AA 2NLWA 1HBMB 2Q1LA 5H9EK 1GXTA 1T05B 1N34F 1NRKA 4TXSA 2BJEA 3CJSA 2X1GA 5HBMA 2EWHA 3I4HX 1HBUA 1CC7A 2MJUA 3CCQS 3SXLA 2E5HA 2QEXS 4P71A 5KOXA 1I6JA 3C3LA 3UPFA 3BO4A 4Q2LA 5KG3A 4ID5B 3WBZA 2OAUA 2HQ3A 2F1FA 3BJYA 4PWDB 4WXOA 4NZ7A 3JSMB 5IWAF 2RRNA 3CJ8A 5K9FA 4TY8B 1RHJB 1LFWA 1KLMB 2CNLB 4QWBA 4ICLA 4K5SA 3DHWC 3HD1A 4QU7A 2MMYA 3W2WB 2AEJA 4CLUA 5LMUJ 2J6SA 5I3PA 4JI6F 2VHGA 2FHJA 2HAFA 4LT6A 4Q45A 1LEOA 2EC0A 3W66A 2RT3A 2RQCA 3I87A 2KXFA 3ISND 3DYAB 3LPYA 2JC1A 2Y1LB 3UI3A 4YP3A 4IRCA 2UUWA 1IUJA 1FX4A 1YBUA 2XY5A 1S1WB 4NXMJ 5KTQA 2YKOA 2VB6A 1FRJA 4ED4A 3G71S 3QRQA 1SKSA 2Z2ZA 1FERA 5KFCA 4KHMA 1UFKA 1MLAA 3RG6A 5AT1B 4B9TA 1G6BA 5HROA 2CPIA 1Q79A 1V3ZA 1XNRJ 3K2YA 1SC4B 2QO3A 4DI6A 5FLXU 3P45B 4B3OA 5JVGQ 1KOHA 3MR5A 3ZTSA 1OWXA 1EZZB 2VKZG 2W4CA 5J2PB 5EGYA 2HRYA 4PXDA 2ASYA 1VHFA 2KN4A 4NYZA 3FJ2A 4EZ6A 1YHQS 4IYQA 3I9ZA 5B0BA 4KH0B 2RIJA 4A46A 3H42A 5HAOA 3K58A 2ZKUA 3GIRA 5AE1A 3HSDA 2HIQA 1ZETA 3KTQA 2X1AA 2E9RX 2Z8QA 2HBZB 4Q44A 1S1VB 1CLFA 2YWKA 2BQUA 4ZPAA 1UVJA 3PRBA 1PC5A 3KLIB 2AX1A 1KN6A 4R8UB 2ZH1A 2YKMA 3OHBA 2PO4A 2P9GA 1SJRA 5BR8J 4DSIA 2KB2A 3SFGA 3QRPA 2DIVA 4X2BA 3BH7B 2DITA 3MFIA 4KT0C 4JI1J 5J2QB 4ZVQB 1B7FA 3KMQA 3DLKA 5IOLA 1HMVB 1KWMA 3R2DJ 1HBOB 3JAMU 2K1RB 2K7JA 1S99A 3AFGA 4OHWA 1S9GB 3MDFA 2OI2A 4KB7A 2CQIA 3SCIE 1S59A 5HI7A 4O44A 4DL2A 1AT1B 3M30A 3TZYA 3D3BJ 4EO6A 3QIPB 1HD1A 2CNOB 5DGAA 1C4AA 3EJMA 3B78A 2J5AA 1JLGA 3BV8A 3BGRA 4ZOSA 2WZ1A 3Q8QB 1LWCB 1UPMB 1OSDA 1FD2A 1YTYA 5B0CA 1FO1A 1Q1KA 2CZVC 2MQMA 4NPOA 2WBMA 4USTA 4OI1A 4HI1A 3MMCA 6FDRA 1AFIA 1HNVB 3EM1A 4GVBA 2E1MC 4ZVEA 3P3DA 3PHEA 1IKWB 3H2UB 3HULA 5A6WA 3F44A 4NCAA 4IFYB 4OZJA 1QTMA 4FF1A 3P5BP 2ZZNA 4DSFA 5FDLA 5KFPA 2DXDA 4R5PB 1V9OA 2AIRB 3SCKE 2G9OA 4DPTA 8AT1B 3FK4A 2I5JB 5AXMA 4BWMA 4KGKA 2ZE2B 1PBAA 1NDKA 2HWHA 4YQWA 1HR0F 1HPZB 3HLUA 3HSJA 3I55S 4B3RF 3KDNA 2GC8A 1SCJB 3TZZA 4J5OA 3UQSA 2ZBQA 2E5JA 5AXLA 2ZOGA 5IT0A 3M9NB 1S77D 2JSXA 2DYAA 3DU5A 4G1IA 4EBDA 4J9PA 1TELA 3LH2S 2KVIA 4C8KA 4ECZA 3D7SB 2CPXA 3BZQA 1FFWB 2HGMA 2W2NP 3VZIA 3H2VE 3KLEB 2BABA 4C6AA 4DFMA 2VFTA 4NASA 2MKJA 3THTA 2KT2A 3DOKA 1TKXB 1HQUA 3M8ZA 4TQSA 2V8VA 3BYRA 3PFOA 2X3DA 3JTOA 3PEJA 3T5LA 3CXCR 3LQVA 4PG7A 2HMIA 4RW4A 3FBFA 3C6TB 4PWUA 5LT5A 4J9KA 2JOQA 3U1MA 5A8RB 1WDTA 1JXLA 4ZP9A 5E3QA 4CYUA 1TV6B 2GVDB 1B0PA 1QE1B 2H65B 2MGZA 1FK9B 3HJVA 4JV2A
chains in the Genus database with same CATH topology
3W1YC 1HNXJ 4V1Ak 1XMQJ 4DR2J 4X62J 4JV5J 2KVQE 4LF8J 5LMNJ 4B3RJ 1N34J 1N32J 3D3BJ 4K0KJ 1HNZJ 2E5LJ 4NEZA 4DV2J 2MEWA 4DR3J 2MQ8A 4RJVA 5AJ3J 4LF4J 2UXCJ 5A2QU 4DR5J 2UXDJ 4B3TJ 4KY3A 4HHUA 2VQFJ 1IBKJ 4DV1J 4JI5J 4LFCJ 1N33J 2ZM6J 4B3SJ 4DV5J 4JI4J 4GKJJ 5LM7E 2UUAJ 4AQYJ 1FJGJ 3J7AN 2UXBJ 4NXMJ 4NEYA 4X65J 3J80U 1N36J 2UU9J 2MTLA 3OTOJ 5IWAJ 4NXNJ 4LF7J 4JI0J 5BR8J 4GKKJ 2VQEJ 4DV3J 2HHHJ 4DR7J 2UUCJ 1I94J 4LF5J 4DV4J 1HNWJ 4JI1J 4DR6J 4B3MJ 4OX9J 3D3CJ 1XNRJ 2KL8A 1XMOJ 4KYZA 5FLXU 4DV6J 1IBMJ 4DUYJ 4LFAJ 4JI7J 4JYAJ 3T1YJ 4DR1J 3R2DJ 3JAMU 4LF9J 5IT9U 3T1HJ 4KHPJ 2UUBJ 5LMUJ 3J81U 4JI2J 3IMQJ 4JI3J 1XNQJ 4DV0J 1IBLJ 4X66J 4LF6J 4X64J 4JI8J 4JI6J 4DV7J 4DUZJ 4LFBJ 4PWWA 1J5EJ 4DR4J 2F4VJ 4YY3J 3R2CJ 4YHHJ 1HR0J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1Y C;  1HNX J;  4V1A k;  1XMQ J;  4DR2 J;  4X62 J;  4JV5 J;  2KVQ E;  4LF8 J;  5LMN J;  4B3R J;  1N34 J;  1N32 J;  3D3B J;  4K0K J;  1HNZ J;  2E5L J;  4NEZ A;  4DV2 J;  2MEW A;  4DR3 J;  2MQ8 A;  4RJV A;  5AJ3 J;  4LF4 J;  2UXC J;  5A2Q U;  4DR5 J;  2UXD J;  4B3T J;  4KY3 A;  4HHU A;  2VQF J;  1IBK J;  4DV1 J;  4JI5 J;  4LFC J;  1N33 J;  2ZM6 J;  4B3S J;  4DV5 J;  4JI4 J;  4GKJ J;  5LM7 E;  2UUA J;  4AQY J;  1FJG J;  3J7A N;  2UXB J;  4NXM J;  4NEY A;  4X65 J;  3J80 U;  1N36 J;  2UU9 J;  2MTL A;  3OTO J;  5IWA J;  4NXN J;  4LF7 J;  4JI0 J;  5BR8 J;  4GKK J;  2VQE J;  4DV3 J;  2HHH J;  4DR7 J;  2UUC J;  1I94 J;  4LF5 J;  4DV4 J;  1HNW J;  4JI1 J;  4DR6 J;  4B3M J;  4OX9 J;  3D3C J;  1XNR J;  2KL8 A;  1XMO J;  4KYZ A;  5FLX U;  4DV6 J;  1IBM J;  4DUY J;  4LFA J;  4JI7 J;  4JYA J;  3T1Y J;  4DR1 J;  3R2D J;  3JAM U;  4LF9 J;  5IT9 U;  3T1H J;  4KHP J;  2UUB J;  5LMU J;  3J81 U;  4JI2 J;  3IMQ J;  4JI3 J;  1XNQ J;  4DV0 J;  1IBL J;  4X66 J;  4LF6 J;  4X64 J;  4JI8 J;  4JI6 J;  4DV7 J;  4DUZ J;  4LFB J;  4PWW A;  1J5E J;  4DR4 J;  2F4V J;  4YY3 J;  3R2C J;  4YHH J;  1HR0 J; 
#chains in the Genus database with same CATH topology
 2HVH A;  3CD7 A;  4B9U A;  1KEK A;  1BUX A;  1B0V A;  4ECT A;  4PG5 A;  3B6B A;  5HAT A;  3TO8 A;  2OPS B;  1NPP A;  4N76 A;  4IH5 A;  1FRI A;  1N48 A;  4KGX B;  2M7S A;  3TZW A;  2QLX A;  3OJU A;  4G65 A;  3QGP A;  3FCV A;  2M3D A;  2BRK A;  3F73 A;  4A8Y A;  1NSA A;  4TYB A;  4Y65 A;  3SV4 A;  2DHA A;  2GML A;  1CS4 B;  3A4T A;  2RDJ A;  4LF5 F;  2UUC J;  4BS2 A;  4FVC A;  2KXH A;  4ERD A;  2ASJ A;  3ONQ A;  2R7U A;  1S6Q A;  1JLB A;  4RBU A;  3NGS A;  3OD2 A;  1B3T A;  1UPP A;  2IDE A;  4DL7 A;  1S79 A;  4PG8 A;  3L7U A;  1YSJ A;  2UUB J;  1QJH A;  1ZTW A;  2VPX B;  3MR6 A;  1WWH A;  3UNG C;  4CIO A;  2CPF A;  4QYZ K;  3CC7 S;  2MLZ A;  2MKI A;  4KGV B;  2J7K A;  1C0T B;  4WZM A;  4CCH A;  4OL8 A;  4O3O A;  4NLX A;  4A48 A;  3MAA A;  1RTD B;  4LF6 F;  1C1C B;  4ZN3 A;  5DO2 A;  3LGM A;  2YH0 A;  5DQH A;  4ZHR B;  2VF3 A;  3NY0 A;  3E01 A;  4WJB A;  5DLF A;  1HWU A;  1DTT A;  2NCK L;  4JI4 F;  3R6L B;  3BDE A;  2YWW A;  2C2K B;  1ZAX A;  4I67 A;  1U6B A;  3KJQ B;  3GII A;  4X65 J;  5ADZ A;  3SQG B;  4QR1 A;  4PCQ A;  2GO8 A;  2C2E A;  1WC4 A;  5D0H A;  1CQM A;  4Q0B A;  1Y7P A;  4ZVH A;  3R8Y A;  4OX9 F;  2Z30 B;  4PAA A;  5CHC B;  3MM6 B;  4FF2 A;  2HNZ A;  2GCF A;  4QOT A;  3Q8S B;  4CNZ A;  5H9F K;  3GE9 A;  4QWE A;  1OY9 A;  3RAQ A;  3IGN A;  2AJ4 A;  2J8A A;  2KM8 C;  4H4O B;  1PAU B;  4DR4 J;  3QID A;  3QO9 B;  2B5J A;  1S48 A;  4OHY A;  1IKY B;  4WPA A;  2G13 A;  2IJR A;  3M32 A;  4K0K F;  2ZBP A;  1Z2L A;  3OL9 A;  2RVJ A;  1D8Z A;  1EQM A;  3JTN A;  3HVW A;  4DWI A;  3T41 A;  2W8K A;  1X4D A;  4B3T F;  1WG4 A;  2W4P A;  5ETN A;  2OPR A;  3KK3 B;  4C9D A;  1FFS B;  1BY9 A;  1BGX T;  4HAC A;  1C2P A;  4P73 A;  2KZM A;  2GA7 A;  2Q6B A;  2RUS A;  1RWO B;  2YNH A;  2UV8 A;  2W9B B;  1T0T V;  2V4J A;  4PZV A;  2W7P A;  1WTB A;  2VIC A;  3LO3 A;  4DR7 J;  2M8D B;  1GQE A;  1I94 J;  2R7R A;  4DL3 A;  4U6P A;  3N79 A;  2UUT A;  1WEL A;  2VDI A;  3FCW A;  1VBZ A;  3M2V B;  1TP7 A;  3OW2 R;  2MY8 A;  3NS5 A;  4WP8 A;  2N4D A;  4LMZ A;  2XSJ B;  1OYE A;  1ELO A;  2OPQ B;  4I4B A;  4K4X A;  1UP1 A;  5KFF A;  1J2V A;  1PJ5 A;  1VRT B;  5DET A;  2B51 A;  4X66 F;  1YIJ S;  3Q0A A;  1LXJ A;  2CQ0 A;  3VQS A;  3DN9 A;  2F4V F;  1QAJ A;  5KFU A;  4KKO A;  2C3M A;  4UY8 T;  4C3M A;  4YB1 P;  1NH8 A;  4JI5 J;  2VH7 A;  1SH0 A;  1C4C A;  1AB8 A;  1MRO A;  3PHT A;  1PYS B;  5HVG A;  4F4X A;  3GP9 A;  2ZH8 A;  2CWK A;  3J80 Y;  2DXE A;  5GAE U;  4CLY A;  1NCL A;  2R2R A;  5GVQ A;  5K8N A;  1RWK B;  2J8S A;  5FII A;  1VQ5 S;  2YH1 A;  4DQS A;  4CLZ A;  3JSB A;  2QGF B;  2NUU G;  1WAC A;  3IGV A;  1SI9 A;  4X4O A;  2Y8W A;  3R1L A;  2OJ3 A;  3D2W A;  4JI7 J;  2XMV A;  4LF1 A;  1R0C B;  4Q7A A;  1UWB B;  3HMJ G;  2IBO A;  3A12 A;  6FD1 A;  2HWT A;  3NAI A;  5C42 A;  5KG4 A;  2DR8 A;  4KGZ B;  3U1N A;  3G6E S;  4LSL B;  3GSD A;  4OLP A;  5DRK A;  2KHD A;  2Y1J A;  2CA9 A;  3ZZZ A;  2HW3 A;  3AD8 C;  1JLE B;  1Q7L B;  4RLE A;  1FNM A;  3LAL A;  1RLC L;  5K8M A;  2LQ9 A;  4DSK A;  1ARO P;  4LFC J;  4NLU A;  4F3M A;  4OYM A;  2KU7 A;  2Z2L A;  3M2U B;  1N36 J;  4BCA A;  5J1E A;  4O3R A;  1M1K T;  2XNR A;  4OQJ A;  2J7U A;  2DTJ A;  2KL8 A;  1LW2 B;  4F4Z A;  2YNG B;  4ECS A;  4LF9 F;  4O4R A;  2B7B B;  4QPX A;  2UVR A;  4J91 A;  5C25 B;  4I2Q A;  4QR2 A;  2CWX A;  5KFQ A;  4KGM A;  4RW8 A;  1CJV B;  2PMW A;  4USU A;  1WOR A;  1FVQ A;  4IFV A;  2IY5 B;  5LSR A;  1IKV B;  4E0D A;  4L3K A;  5GAH U;  3MPV A;  2M8H A;  3QGH A;  4FXD A;  2R2T A;  5HLF B;  1UZH A;  1IVZ A;  5CYJ A;  3AY0 A;  1NPK A;  4OHX A;  4IRK A;  4ATN A;  4OYZ A;  2E9T A;  1YWX A;  4UQG A;  4DSL A;  1PJ7 A;  3J7Y U;  3AA9 A;  2RB7 A;  2AW0 A;  3C15 B;  3CCV S;  4WYL A;  4IH6 A;  4IRD A;  2DNH A;  3UN3 A;  2ROG A;  1H7W A;  2I8E A;  3G9C A;  3VAI A;  1IN0 A;  4LRC A;  3PJX A;  1JLF A;  1RTH A;  1NKE A;  2J9D E;  2H5J B;  2WK4 A;  4LIW A;  5CXT A;  2E9Z A;  4ZVS B;  4C11 A;  5E2Q A;  1JMT A;  1GXL A;  3M8Q B;  2V67 A;  1ZBT A;  3TUP A;  1F9F A;  4FPI A;  1RXO B;  2I1R A;  1RIS A;  4M95 A;  1RTJ B;  4QIE A;  4K50 A;  3OSP A;  5E5N A;  5C24 A;  4F0H A;  3WZ0 A;  4LF4 F;  4Z2X A;  3KOA A;  4ZVO B;  1RWN B;  4LR8 A;  2E7X A;  3W9H A;  2FD2 A;  2R7V A;  1U48 A;  4ZCM A;  1CJK B;  1QY7 A;  1VQO S;  2VBZ A;  3GON A;  1U09 A;  4DLG A;  3GV7 B;  4Y2K A;  4B02 A;  1VLY A;  4TVA B;  3AA8 A;  4DU8 A;  2GVZ B;  3OFH A;  1NK8 A;  2BJ3 A;  3RU0 A;  4CLP A;  1IQZ A;  3C6U A;  1FRK A;  5HSP A;  2AX0 A;  4CLW A;  4DR6 F;  2NYI A;  4NXM F;  3KG4 A;  4PYA A;  5DM7 Q;  4XTT A;  4M5D B;  3UD3 P;  5CYQ A;  5A8K B;  2IA6 A;  2FB0 A;  4NA3 A;  1VHI A;  4F26 A;  1PO6 A;  3HJF A;  3R7N B;  5JUM A;  4DV7 J;  2DNL A;  1NK5 A;  4I1T A;  2YPY A;  3N01 A;  4KHR A;  2N7Y A;  3QLH A;  2F3J A;  4NL5 A;  3DGP A;  4KFB B;  2L08 A;  2IM1 A;  3VCD A;  2WB1 D;  1LKZ A;  1NBE B;  4LR7 A;  1HL6 A;  2OEL A;  2AD9 A;  5BXI A;  5ITH A;  4DF8 A;  3OL7 A;  1WG1 A;  2ZUA A;  1S6P A;  3J7A N;  4Q5V A;  5KOW A;  3V81 B;  3QRR A;  4WBF A;  2D7S A;  1CUL A;  3W62 A;  2RH3 A;  2IC3 A;  1SH3 A;  1X7V A;  4MKA A;  4C8N A;  4ER8 A;  2OFH X;  2BKP A;  2LA6 A;  2O66 A;  1ZS6 A;  1JLC B;  2D3O 1;  2FGO A;  2FLN A;  1NK4 A;  4A8Q A;  2VOD A;  1W25 A;  2CQB A;  3HZG A;  4IR1 A;  1TK5 A;  3OTD A;  1RGV A;  4Y2M A;  4LFA J;  3ISZ A;  1ZPW X;  1NJZ A;  5KFI A;  3QT5 A;  5ETO A;  4LF2 A;  4R0E A;  3HZE A;  1L3U A;  1PAE X;  4RNN A;  5KFD A;  3FCH A;  4GC6 A;  2AZ3 A;  2QSW A;  3NCQ A;  1FHT A;  2OEJ A;  2YVS A;  4LF8 J;  4KE5 A;  1YJU A;  2WSE C;  2XM3 A;  4IDK A;  4I2P B;  2VPW B;  1X0P A;  2V2V A;  4JP8 A;  2G0J A;  1K9M T;  3MCM A;  4ZJQ A;  2VQF F;  2ZM6 F;  4PEO A;  2KXN B;  2A0F B;  4Y28 C;  4IG0 B;  2LQB A;  1E6Y B;  1RTZ A;  4KV8 A;  3J7A 1;  5AE3 A;  3ADA C;  2H9Z A;  1T03 A;  3MCN A;  1M90 T;  4RPF A;  4B9N A;  1RE1 B;  1AW0 A;  2NPF A;  1HI1 A;  4N41 A;  2QG9 B;  1TK8 A;  4NLY A;  1BLU A;  1VQK S;  3LP2 A;  1NZ8 A;  5DQG A;  4RW6 B;  4RW7 B;  3OLA A;  4DFP A;  3QNW B;  3H5Y A;  2QLF B;  4WII A;  4X4T A;  1UVN A;  3PIO Q;  5EWF A;  4PUO A;  3IBC B;  1KD1 T;  2XCA A;  1FRM A;  3LP0 A;  2W01 A;  5HL7 Q;  1BE4 A;  4UOC A;  2FC8 A;  1T95 A;  4XDC A;  4DR2 F;  1ROF A;  1KRP A;  5M2U A;  2BJD A;  4KQZ A;  1QM9 A;  2R7X A;  1J5O A;  3FVY A;  2DGS A;  1WHV A;  3KLG B;  1NHK L;  3V5R A;  1OO0 B;  3I56 S;  4WK1 A;  4G6V B;  3PYE A;  1NZA A;  2I2Y A;  1SUQ A;  1URN A;  5HBM B;  1YZ7 A;  2ZH4 A;  3PX6 A;  1HBU B;  5DG7 A;  3PW5 A;  3ZC4 A;  3MUT P;  1WC6 A;  1NSP A;  2WBR A;  3CC4 S;  1H0H B;  3AXK A;  2MTL A;  3GR0 A;  2MSS A;  3ZTP A;  3CUL A;  3TW0 A;  2YKN A;  3W5Y A;  1G2E A;  2P8I A;  4KR0 B;  1VQ4 S;  3A3O B;  4LQ9 A;  4HT7 A;  3TWZ A;  4EFA C;  4HTI A;  3W61 A;  2LEP A;  4USH A;  1QUV A;  4NA1 A;  4I6A A;  3MUM P;  3EYZ A;  3EXY A;  5ETT A;  4YR0 A;  4JI3 F;  3NP5 A;  4N7T A;  3RAX A;  4F0K A;  4ZKA A;  2W8L A;  4X4U A;  4UOG A;  4ZLP A;  3EGZ A;  4USV A;  2R2U A;  1OIA A;  2CKW A;  3ENW A;  2LYV A;  1FNO A;  1R89 A;  3PW7 A;  1HNZ F;  3FZB A;  1R0A A;  3NG8 A;  1TKZ B;  3DRP B;  4M5N A;  4OIX A;  5KG1 A;  2OO4 A;  3DLE A;  2QTW A;  2B56 A;  1JX4 A;  5E7O B;  3SQO P;  3CJK A;  5DQI A;  1WC3 A;  1VBX A;  3AOD A;  3Q86 A;  4HEA 9;  2BKN A;  3CCT A;  1YBA A;  1U1P A;  4ZCL A;  3JQK A;  4P52 A;  3QT6 A;  2OEK A;  3NEK A;  5F8L A;  1Z1Z A;  2MKH A;  1ULR A;  3W9J A;  2EI5 A;  1QVF R;  4B3M J;  3D3C J;  2ACY A;  1LOU A;  2DY1 A;  1OY8 A;  2DPI A;  1XTZ A;  2YKP A;  2VD3 A;  3LTO A;  2HBY B;  3MEK A;  4O3Q A;  1FDB A;  2LDI A;  2YPZ A;  2RD5 C;  2RU3 A;  5HRO B;  4X4Q A;  2UUC F;  2XMK A;  5LXY A;  1HFE L;  2B9X A;  3DRS A;  1IR2 A;  3V4I B;  2F4F A;  5KFH A;  3HHL D;  1U1O A;  3UNY A;  2HFU A;  1XMQ F;  3PTW A;  4UZB A;  3R1H A;  4X62 J;  5L8R C;  3HF5 A;  4BC7 A;  3H25 A;  2QYC A;  2MZS A;  2ZNZ A;  2OMO A;  1V5I B;  4TNO A;  5T7L A;  2X7I A;  1VQS A;  3W2V B;  5G4D A;  1VOM A;  5HK4 A;  3GR1 A;  4FVM A;  4K4T A;  2KJV A;  4GKJ F;  3MEC A;  4X4R A;  2HNY A;  2LXU A;  1SH2 A;  5CD4 A;  4OZ0 A;  4F02 A;  3EWG A;  5F8M A;  4O3N A;  4FP9 A;  1VCT A;  2P6T A;  3NMA A;  4NXN J;  2DGX A;  3ZNJ 1;  3CCJ S;  2AEF A;  1AUS L;  1HNW J;  4Q8F A;  4IKA A;  4ED3 A;  2V5H G;  3QJL A;  5CQG A;  4NE9 C;  3H4B A;  1U8W A;  3DU6 A;  3MMA A;  1L3V A;  5CAA A;  3MED A;  3CT9 A;  2HFZ A;  2E44 A;  4ZJL A;  1FRL A;  2PA3 A;  1LW0 B;  3DLK B;  1J5E J;  4KPY A;  4J9V A;  2O1P A;  3CCW A;  2ZH6 A;  4YY3 F;  3K0J A;  4OI0 A;  3KNA A;  1RT2 B;  1LK7 A;  3HHN B;  4HR2 A;  2M9K A;  1BQN A;  1WF2 A;  2AZ1 A;  3GFH A;  1A6L A;  2HS3 A;  5F41 A;  2UXC J;  2FVS A;  3SSQ A;  1N33 J;  2IVY A;  1H74 A;  4NZ0 A;  1PKU A;  1IKX B;  3FKB A;  3JQM A;  2VG7 A;  3AJD A;  3KDO A;  5E41 A;  3W5Z A;  1TKT A;  3CCZ A;  3DI6 B;  2BOP A;  4DL4 A;  4Y2C A;  5HQ8 A;  1JLG B;  1KVJ A;  1YGY A;  3BGR B;  1FKO B;  3D1Q A;  3F0N A;  1R6V A;  2C3O A;  3NOC A;  5KFK A;  3UD4 P;  4HTJ A;  4I7F A;  5BYS A;  2FQQ B;  5BYQ A;  3MMC B;  2XHC A;  3SEO A;  1N5Y A;  3VGV A;  3BKU A;  1RKI A;  3PXG a;  3PR5 B;  4P2X A;  3MOZ A;  5E33 A;  2IRY A;  1RK8 A;  2NXJ A;  4B08 A;  1PCA A;  2C42 A;  3FQK A;  4L72 B;  4NLR A;  3BF4 A;  2HHX A;  1WDD A;  1QTN B;  5KFL A;  3IS9 A;  2BJ1 A;  3AD9 C;  4XDD A;  2HRU A;  1VC0 A;  2A18 A;  4I6Y A;  2CNN B;  2QRR A;  3KK1 B;  2R7Q A;  2KFZ A;  2GHP A;  2DR7 A;  2QA4 G;  1YJR A;  2R8I A;  4YEA A;  2WVE A;  1JKH A;  1QLN A;  2YQ0 A;  3H40 A;  2UU9 F;  1XR5 A;  3E51 A;  4CH7 A;  3HVR A;  5GAG I;  1K0T A;  1RQ0 A;  2ZH3 A;  3OUY A;  3P6Y C;  2J9C A;  1U02 A;  3DOK B;  5LSO A;  1WC0 A;  1S4F A;  3OV7 A;  5KT3 A;  3CJT A;  2A6M A;  7FDR A;  3DLH A;  2AEM A;  1HA1 A;  1U2R A;  2HMI B;  3HDS A;  1HNX J;  2ZD1 B;  1P27 B;  2BW2 A;  3TQ1 A;  4AL5 A;  4CYU B;  1UVL A;  2MGZ B;  2B4U A;  3FGV A;  5HJY A;  1WF0 A;  3V4M A;  3HFZ B;  2CYY A;  5AXN A;  4C97 A;  1NSQ A;  1IJF B;  2ZHO A;  1VGY A;  5DGB A;  1SV5 A;  2CPJ A;  1T9V A;  5T14 A;  3PW4 A;  5IQQ A;  1AFJ A;  3D28 A;  5GAD U;  5F9L A;  3BSC A;  1C1B A;  2CPD A;  2GMH A;  3FSI A;  1LNQ A;  1SQF A;  3HPO A;  1U4B A;  4ED8 A;  1RCO B;  4JI0 F;  4XPE A;  2DB1 A;  2VIH A;  4GKK J;  1RAO A;  1WEZ A;  2NSB A;  1FTC A;  1P9Y A;  3PKY A;  1SBR A;  1UVM A;  3BKF A;  2GGP A;  3CJ5 A;  4NWB A;  4X4P A;  1RBA A;  4HVZ A;  3FBE A;  4RNM A;  2DD8 S;  4ILM A;  4J9O A;  2GFF A;  2I0X A;  3UDC A;  4Q43 A;  1XNQ F;  3CW2 C;  4OYO A;  3VAJ A;  3THV A;  1FEH A;  5F0W A;  2XWY A;  4PYD A;  4J9Q A;  3K5L A;  1S9E A;  1S6Q B;  4ECV A;  2CIM A;  4WFY A;  1F60 B;  4OZN A;  5KT6 A;  3ITH A;  1H72 C;  5D8H B;  2CQH A;  2RF2 A;  2W4D A;  3I0S B;  3FFI B;  2VOP A;  4ZLN A;  4C3L A;  2JH3 A;  4O3S A;  3M7V A;  3AAW B;  3CB4 A;  1C0U A;  2VG5 A;  5K5M A;  2XI2 A;  3WC0 A;  3O5T B;  4LR9 A;  2HAI A;  4DV5 J;  1XR6 A;  1JLQ A;  3HXM A;  1RT6 A;  1A9N B;  4CM2 A;  4M5M A;  2J76 E;  3RW7 A;  2L41 A;  3KLH A;  4M8L A;  2VJV A;  3OPK A;  2YY3 A;  3BGO P;  2QMW A;  4W98 A;  2OH2 A;  1RAA B;  2B0G A;  2LEA A;  2F40 A;  4DV6 F;  4IR9 A;  1L3S A;  5L9X A;  3HVT A;  3AH6 A;  2NPI A;  3EUN A;  5DJB A;  4JYA J;  1FE4 A;  1HW9 A;  3A8K A;  1APS A;  4Q0B B;  2DGW A;  5C2G A;  1IBL J;  4O0I A;  1BQM B;  3FZ2 A;  2Y0S D;  1WKK A;  4LFB J;  1XR7 A;  3M05 A;  2W25 A;  2F9J A;  2W2O P;  5K8O A;  1KKH A;  3LP1 B;  2XB2 D;  2QLB B;  1WF1 A;  2LQ5 A;  2H54 B;  1TVR A;  3AB2 B;  1HWJ A;  2C2Z B;  3W64 A;  2FZC B;  5EX0 A;  3N28 A;  4NI2 B;  1DTQ B;  4F25 A;  1KNZ A;  4DV1 F;  3PKM A;  3M9O B;  3M32 B;  4RU9 A;  4IG3 B;  4FF3 A;  1HYS A;  2GAH C;  4NCB A;  2UXB J;  1VJQ A;  4F0M A;  2AJ2 A;  4F67 A;  2CVE A;  4IQX A;  3TZX A;  3PJW A;  2MKC A;  3R5J B;  2FJA B;  4DN0 A;  1FX2 A;  2OPR B;  3J80 U;  2ZOM A;  2F65 A;  1YRU A;  4LF7 J;  3MM7 A;  1NDC A;  2EK1 A;  3PX0 A;  2HHT A;  4HAC B;  3IC1 A;  1PBU A;  3MEE B;  4URS A;  2DNN A;  2CPE A;  2FHO B;  1NU4 A;  1M1G A;  2WB4 A;  3CDE A;  2WOM A;  3CO9 A;  3TAQ A;  1IR0 A;  4RUC A;  4GC7 A;  3ENQ A;  4JI2 F;  1R6Y A;  3EXC X;  5K14 B;  1TFW A;  4MIB A;  2V4Q A;  1ZH5 A;  2W9C A;  1MWY A;  3I5B A;  2BAN A;  1RWW B;  2CJ9 A;  4ZCK A;  1NHU A;  1BQX A;  3R7S B;  4ED0 A;  2QSF A;  4EZ9 A;  5EUH A;  4DV2 F;  5A8W A;  4B9V A;  3CJR A;  1EKR A;  5AJ3 F;  4LRF A;  3GIL A;  1RT1 A;  1KON A;  1MG7 A;  5DZ7 A;  4DL6 A;  4Y3C A;  5LM7 E;  2UP1 A;  1FJG F;  1RA6 A;  2AGQ A;  2BMB A;  2HVD A;  3ZZT A;  2UUA J;  2EFO A;  4O4G A;  4ED1 A;  1UMJ A;  1F9H A;  1KQF B;  4KKO B;  1KVI A;  2CNK B;  1B99 A;  4ZVF A;  4RBV A;  3G82 B;  2C28 A;  2OTJ S;  2DH7 A;  1VQ9 S;  3HHE A;  2D3Z A;  3M8P A;  3FMW A;  1MRO B;  5JJB A;  3WX8 A;  1RT3 A;  2H1Y A;  1T11 A;  1KP6 A;  4OMF G;  1UL3 A;  5L1J A;  2IYI A;  3OTC A;  3TI0 A;  4NRT A;  1VS3 A;  1D1U A;  2PEB A;  2IM0 A;  4DR1 J;  4U8V A;  2E1A A;  1ICE B;  1IWG A;  3DDI A;  3QAU A;  2P6S A;  2DNQ A;  3PCO B;  1RWX B;  3DLB A;  1H2T Z;  4UW2 A;  1MU2 A;  3T3F A;  3NS7 B;  4JI8 J;  2MZQ A;  3UCZ P;  4EWT A;  4PXB A;  3NXZ A;  4C98 A;  4LFA F;  2HWI A;  3PDN A;  4TYA A;  4FYW B;  5KFJ A;  2KHC A;  5F8J A;  5LMN J;  1U0S A;  1HQ2 A;  1T05 A;  1REV A;  2RS8 A;  3A8E A;  5C42 B;  3AXM A;  1FJC A;  5D0G A;  2MLX A;  3KUH A;  1GEH A;  4W4M A;  4RWW A;  2DBB A;  4HHH A;  1LWE A;  3M2R A;  2ADC A;  2HQD A;  5ETV A;  4FYY B;  1EP4 A;  3MR7 A;  2GJF A;  1DQ9 A;  4LSZ B;  1NB2 A;  3IN5 A;  3GB0 A;  4ID5 A;  4OI2 A;  1NKC A;  5SZT A;  5D4N A;  3NRB A;  4PWD A;  3OTO J;  1TL4 A;  2DXF A;  4C8L A;  3JSM A;  2V94 A;  1X5S A;  4ZDN A;  2F9D A;  4YME A;  1KLM A;  4ELV A;  1XMO F;  2AGO A;  1WOO A;  2NXC A;  2ZBI A;  1IBM J;  5J1E B;  3W2W A;  3T1H J;  2AMC B;  1VK3 A;  3RBZ A;  4X64 F;  4LRD A;  1SC6 A;  1JXE A;  1ZM3 A;  1JJH A;  1U1R A;  4K8R A;  3FRY A;  2HQG A;  4DHV A;  3ZO7 A;  4JV5 F;  1VRU B;  4I2Q B;  3GYG A;  4RW9 B;  2IAJ A;  3RJM B;  3BYP A;  5L38 A;  2AKW B;  1EAR A;  2B8P A;  2UXD F;  3CIM A;  3KG1 A;  2QFJ A;  4C3K A;  1DJ0 A;  4RKU C;  3DYA A;  4IFV B;  2AP6 A;  3QJP A;  1UKU A;  5HQL A;  2YX4 A;  2A2C A;  5F3Z A;  3FBB A;  1TKD A;  3NGU A;  3HP6 A;  1S1W A;  2W2M P;  3FC9 A;  3CDU A;  3NGK A;  3QZ7 A;  2VBW A;  4WKY A;  2HHH J;  2IFX A;  2YBV A;  3BM7 A;  4K2J A;  5E3A A;  4NYP A;  2J6U A;  1RSC A;  4DUT A;  4USJ C;  4KHP J;  2KRB A;  1YG0 A;  4DEZ A;  1HWL A;  2GHV C;  3DC2 A;  1HHS A;  3Q8V A;  3ZTR A;  1JLF B;  4CWB A;  5F8H A;  1TK0 A;  2DGO A;  1PIE A;  4EYH B;  5I42 A;  2CJK A;  1R7I A;  3X1L B;  4QW9 A;  1T9W A;  4C11 B;  1CJT A;  1MMN A;  3N5B A;  1ZPV A;  2EBG A;  3HSZ A;  3T6B A;  1AZS B;  2B9E A;  2R3V A;  1KHV A;  2KYZ A;  2XLI A;  2Y1I A;  1S1V A;  5FD1 A;  4B3S J;  2LQJ A;  2W2P P;  3US5 A;  4DJB A;  3KLI A;  3WDO A;  2ADB A;  3AOA A;  4OZL A;  1IXK A;  2F7V A;  4FNH A;  1HHQ A;  3GFY A;  3KMS A;  2PDA A;  2ILY A;  4U7C A;  2Y1R I;  1F5B A;  2LFV A;  2ATL A;  2QV6 A;  4DCP B;  4ZCI A;  2ROE A;  2OHD A;  2MQQ A;  2VBX A;  1T3O A;  1TU0 B;  1TL7 A;  5DDO C;  2JRS A;  2HS0 A;  5HMX A;  5J2Q A;  4DUY J;  2MHN A;  1JNR B;  2F8E X;  4YR2 A;  4V19 X;  2DGU A;  1Q8K A;  4QU6 A;  1HMV A;  4DV0 F;  1HBO A;  1XEZ A;  4MT1 A;  3GG1 A;  4JBC A;  3THP A;  1RA7 A;  5CYQ B;  4C8M A;  2CJX B;  1S9G A;  1OS5 A;  5KAK A;  1NM2 A;  3PR4 A;  1FXD A;  3M6W A;  1VQ8 S;  4AXI A;  2V6A A;  1K0V A;  1TL1 A;  1UVI A;  4NML A;  3GLJ A;  4F3Q A;  3NCR A;  2DH8 A;  4M63 A;  4AL7 A;  4USW A;  3QLH B;  4WFB Q;  1FKA F;  3VGS A;  1ZZN A;  4FNI A;  2HHP A;  3DGP B;  1ZM9 A;  3H7H B;  1F6T A;  3N0V A;  4D3H A;  4ZIW A;  4AQY J;  1FJE B;  1LWC A;  1DFD A;  4HDH A;  4CO3 A;  3I5C A;  2HVI A;  1N56 A;  1U2C A;  2VJU A;  2KDO A;  1JLA B;  2XI3 A;  2N3O A;  3Q8Y A;  2WVD A;  1R0B G;  4KJI A;  2XZW A;  3SBM A;  3RBD A;  3OXL A;  4DV4 F;  3OVS A;  1CUL B;  2IM3 A;  4IFY A;  4HKQ A;  3EIC A;  4DSJ A;  2X1F A;  1B70 B;  1QSS A;  1P8G A;  2R8J A;  3OR1 A;  3OBI A;  1VQP S;  4R5P A;  3IBF B;  4QYR A;  2OPP B;  3M1V B;  2C3U A;  4WWS A;  3BN7 A;  2I5J A;  2KO1 A;  2KZZ A;  2ZE2 A;  4M5H A;  3MI7 X;  1WC5 A;  2MZJ A;  1N34 J;  2QX0 A;  4LVO P;  2G1D A;  2W9A A;  2YNI A;  1IBK F;  3BDP A;  2IVM A;  1CSJ A;  2I9S A;  4ETZ A;  5KT7 A;  3QJJ A;  4RUA A;  3D67 A;  4ZPW R;  1EX8 A;  1N88 A;  4ECR A;  3UO0 A;  1VQY A;  5CZV A;  3MOJ B;  5IWA J;  1Q16 B;  3CPW R;  2PA8 D;  1SL2 A;  2VKR A;  3DXB A;  1TKX A;  4KV8 B;  1EET A;  2QFI A;  5RUB A;  2YWF A;  4E2F B;  1M5K C;  1EJ7 L;  1T03 B;  1RZM A;  1QVG R;  3EZ5 A;  5ETL A;  1Q95 G;  1RAE B;  2RNE A;  2D74 B;  4A47 A;  1Y5L B;  2DHX A;  3KK2 B;  1P9Q C;  1RI7 A;  5D4L A;  2XCP A;  4JI6 J;  5A8R A;  1N0U A;  2ASL A;  1QE1 A;  4M1K A;  2BAC A;  4PG4 A;  5F8I A;  3GV5 B;  1FK9 A;  4ECW A;  2OEM A;  4EMD A;  3HKZ D;  1H6K X;  1S1T A;  3NNC A;  3LP0 B;  1WI6 A;  4ES1 A;  4DS5 A;  1RJJ A;  3LGN A;  3W8P A;  2ERR A;  4IQM A;  3KNG A;  4QJV A;  1NK0 A;  2XY7 A;  3BS9 A;  1IR1 A;  1NJW A;  1XQI A;  2KT5 A;  3D0G E;  3CSK A;  4NMX A;  2XMM A;  3UVJ A;  2Z4P A;  3IRW P;  4NEY A;  3SDE A;  2G4B A;  3LAK A;  1SUQ B;  2RKI A;  3TAP A;  3ZZR A;  3TUZ C;  1YLX A;  2MYF A;  5IS2 A;  2GS8 A;  3CD0 A;  3TA2 A;  3MXH P;  1CS4 A;  2G2O A;  3PRD A;  2HEK A;  1UVK A;  4IOC Q;  2MXY A;  4UUX A;  4J9S A;  1RWU A;  5ETS A;  1R8P A;  2ASD A;  4EUV A;  2KYX A;  3WIV A;  2YKN B;  1RBO B;  1KQS R;  3UWT A;  2CQ2 A;  3GV8 B;  1S1U A;  4E98 A;  1RWV B;  7FD1 A;  4F36 A;  1SPB P;  2FVR A;  4OFZ A;  3MD1 A;  4WCE Q;  4YHH F;  3AD7 C;  2V4R A;  1OPI A;  5CD4 H;  3G6X A;  3KUG A;  5IC6 B;  1C0T A;  3V6D A;  4KRW A;  1UAW A;  3J7Z T;  5C7P A;  2KFN A;  1C1C A;  3VVU A;  1HBN B;  2QJ3 A;  1ZZF A;  5CYM B;  4QQB A;  2IRU A;  1TL3 B;  1VBK A;  4H54 A;  1S5Z A;  2DNR A;  4OX6 A;  4A8S A;  4ECY A;  3GIK A;  3V6K A;  1S12 A;  3I0R B;  1HD0 A;  1WHX A;  4OZ1 A;  2E1C A;  4C4W A;  2J0W A;  3A1Y G;  3LA0 A;  1TAQ A;  4M5I A;  3DLE B;  4IOB A;  4WFX A;  2CDR B;  1SJ3 P;  5KFR A;  3ENV A;  2JHE A;  4C0B A;  1H2V Z;  5I3U A;  1UFW A;  4U8Y A;  4DL5 A;  3SQG A;  2NRE A;  3MM5 B;  3VTI A;  2L48 A;  1X4C A;  3SIP B;  3FQL A;  3QT8 A;  1FDD A;  2XS5 A;  1FKP B;  4LUB A;  2A3J A;  4KPC A;  2W24 A;  1U47 A;  2G0C A;  4EBE A;  4GKK F;  2B4V A;  3IRX A;  2FY1 A;  3IAM 9;  2DEJ A;  5A0Y A;  2QL9 B;  5B0G A;  3TRG A;  3QFH A;  1HHT P;  2EFQ A;  3HHL A;  4BC9 A;  2QA1 A;  4OLO A;  1S72 S;  3TVK A;  1V3R A;  3PG9 A;  3TJ9 A;  3W9I A;  5AXK A;  2EFV A;  2H5I B;  1M5P C;  2RSQ A;  1OSC A;  4QIV A;  5HP1 A;  3VHQ A;  4OZ2 A;  3DMJ A;  3BO2 A;  1JIH A;  1X4G A;  1FF2 A;  1NHV A;  3GMG A;  2LEC A;  3VGU A;  3EE3 A;  3CWJ A;  5T7L B;  3PEH A;  3NWR A;  4C0H A;  1H73 A;  3K89 A;  2HHQ A;  1PYT A;  3HFV A;  4MH8 A;  3EDQ B;  3VZH A;  2WW8 A;  1HI0 P;  4DV5 F;  4CLK A;  2ZH2 A;  3L9Z A;  3D0H E;  2P9E A;  2GQ2 A;  5J1P A;  2CZ9 A;  3OT9 A;  3JQJ A;  3E2E A;  4TKT A;  2VA2 A;  2GJI A;  2B4O A;  3O1L A;  3CCS S;  4CH0 S;  3OFE A;  2VFS A;  1XC9 A;  3GWC A;  1CPZ A;  3DLG B;  5KT4 A;  4ZLL A;  2Z58 B;  2HVZ A;  3AOC A;  3MMA B;  4JYA F;  1HR0 J;  2XSJ A;  3OR2 A;  3MED B;  2VC1 A;  3K5N A;  2OPQ A;  4B3R J;  4DSE A;  1IBL F;  1VRT A;  4DR3 F;  1G3O A;  2N3L A;  4ED7 A;  4LFB F;  4CDI A;  3TX0 A;  2ZFH A;  5KFW A;  3OVA A;  2R7S A;  2XUL A;  3VF0 B;  3KUE A;  1WKJ A;  4OYX A;  2DNK A;  1TUG B;  1T9U A;  4NLP A;  7AT1 B;  5HMY A;  5KFM A;  1HNI A;  1X60 A;  3ET6 A;  3FDS A;  4HH0 A;  2K3I A;  1ZM2 A;  4USI A;  1FA0 A;  1FE0 A;  3PW0 A;  3VAF A;  2RRA A;  5IM0 B;  4ZPD A;  2JX2 A;  1RTI A;  2VG7 B;  2UXB F;  1TKT B;  4RBT A;  2JEI A;  3P5T L;  2Z2Y B;  5IV3 A;  2XS2 A;  3L7P A;  2FVC A;  1S49 A;  2RS2 A;  3D54 A;  4AL6 A;  3ILO A;  3QT7 A;  5J2M B;  3I82 A;  1WSV A;  3R9L A;  4PRF A;  4I7F B;  1RYR A;  2DGV A;  2EPI A;  1UJ4 A;  3PW2 A;  4BHQ A;  1FWP A;  2MQP A;  2DNO A;  2HFS A;  3OFF A;  1F5C A;  3NBP B;  2NZ4 A;  2MB0 B;  1K47 A;  2KVQ E;  1H7X A;  2J0X A;  5KFZ A;  2E5L F;  3AQO A;  3WHI A;  4DX8 H;  4U7U D;  3R27 A;  3N6L A;  2PMH A;  1SJ4 P;  3D66 A;  1JLE A;  4TN2 A;  1MWQ A;  1CEZ A;  3PY8 A;  3OQ2 A;  4LBP A;  2VA3 A;  5BYR A;  4G1Q A;  3IS9 B;  3Q22 A;  1I3O B;  4FKX A;  3U7J A;  2OD4 A;  3M2U A;  4F50 A;  1N8R T;  2OFG X;  3MGJ A;  3QWU A;  4LF5 J;  4F4W A;  3QWP A;  1JKH B;  2V8P A;  5HAN A;  3U1L A;  2G1H A;  2ZH5 A;  1FWK A;  2C3Y A;  2UVU A;  1N5T A;  1KLN A;  2C2O B;  2ZNY A;  2CVI A;  4OV6 A;  1WC1 A;  5T41 A;  4HL9 A;  1X0F A;  2FLO A;  4EYI B;  3AB4 B;  3S01 A;  4DS4 A;  3IFE A;  3OUY B;  1QUP A;  1SIZ A;  1O51 A;  1VQL S;  2K2P A;  5F3T A;  2VBY A;  4H4M B;  2E1R A;  3ZZ0 A;  2K8G A;  1FDN A;  3Q2S C;  3UN5 A;  4GMK A;  4ZPT R;  3PYF A;  4YR3 A;  2HK2 A;  3H4D A;  4J9N A;  5SUH A;  5ETP A;  4QIG A;  5HLF A;  4JI4 J;  2CAD A;  5LMN F;  5B08 A;  1SQE A;  2M4M A;  4XAK A;  3NGR A;  3JYT B;  1SV5 B;  4C2M A;  1YJW S;  1YIT S;  3HK2 A;  1WHW A;  3I4P A;  3C15 A;  4DBQ A;  2A1B A;  2EFG A;  1SC3 B;  4YDX A;  4Z37 A;  2KM8 B;  3H5X A;  3CCL S;  4OX9 J;  1C1B B;  3GG0 A;  1E6V B;  1Y5I B;  2YTC A;  4UT4 A;  1RU2 A;  3RW6 A;  2E5I A;  4AYB D;  4EBC A;  4ZVR B;  1M1H A;  2EFN A;  4JV1 A;  4XK8 C;  4DUZ F;  1GX5 A;  4CP5 A;  3RBX A;  2H48 B;  1NJY A;  3CCE S;  1PG5 B;  5L1K A;  1IBM F;  1GMW D;  5D0R A;  3M8Q A;  2EK6 A;  3W1Y C;  3MUR P;  4P6Q A;  1VQM S;  4NCG A;  4FYX B;  3BN4 A;  2CQC A;  3LWM A;  4K0K J;  3OL6 A;  2BYC A;  3GCW P;  2NXE A;  3D9B A;  4NLS A;  1QAY A;  3O2I A;  4B3T J;  4HYK A;  4KY3 A;  2FIU A;  3DGV A;  5E3P A;  2RF2 B;  2FJD B;  2OGU A;  4UTG A;  2KH9 A;  1VQ6 S;  2RU9 A;  4HLB A;  3WIU A;  4DPU A;  3BB5 A;  4NLO A;  5CCL A;  2F8H A;  3U27 A;  2E66 A;  2VG5 B;  3I9V 9;  2BBE A;  3S6E A;  3IWL A;  1AXQ A;  3EDR B;  1JLQ B;  1X5O A;  3C16 A;  1RT6 B;  1YK9 A;  2JLF A;  3TVZ A;  1T8E A;  1R8A A;  5HN0 A;  2DO4 A;  1FCA A;  5HMW A;  3DM2 B;  3KLH B;  1LWF A;  5IT9 Y;  3T1Y F;  4TLQ A;  4M5D A;  5A8K A;  3TR5 A;  3QZ8 A;  1DQ8 A;  2HSE B;  1Z4U A;  1D8Y A;  2HHH F;  2OML A;  4A8O A;  2AV5 A;  3HVT B;  3RRK A;  5DS7 A;  2M52 A;  3VAL A;  3OSN A;  2HHU A;  5EHH A;  2XEX A;  2IBK A;  2DR6 A;  4USK A;  4KHP F;  2ATC B;  4LSN B;  3TEG A;  4FBU A;  2AGP A;  1VJW A;  1T9Y A;  3W65 A;  2ZOF A;  5B0D A;  3KJV B;  3V2U C;  2JEJ A;  2FZK B;  3B4D A;  5CH7 B;  2LU2 A;  2U1A A;  1TVR B;  4K4S A;  3G6V A;  3DRR B;  1MML A;  3EZO A;  2QLW A;  2K06 A;  2DGQ A;  2WVF A;  4A8K A;  3EPI A;  1XK8 A;  1F5A A;  4DPX A;  1S97 A;  3TNV A;  2BW7 A;  4DQI A;  1LV5 A;  1X5T A;  5GAE I;  4M5J A;  3HVA A;  4GRS A;  5D3G B;  1GMV A;  3QSY B;  2R7T A;  2HYI B;  1YJ9 S;  3IMQ J;  4N77 A;  4FYD A;  3BR9 A;  4CLT A;  2MKY A;  2FHK A;  2U2F A;  1LK5 A;  3WX4 A;  1RT4 B;  5LL6 d;  4DUY F;  2XO7 A;  1X9W A;  3R2C J;  3CIZ A;  2B6A B;  1F9E B;  2HIY A;  4LIR A;  4C7Q A;  1N32 F;  1HLW A;  3C14 A;  3MPW A;  2UVW A;  3F41 A;  2BEF A;  2W9C B;  3H8Y A;  5KFN A;  2BAN B;  2DPJ A;  5ETK A;  4DR5 F;  1T02 A;  3BPS P;  3MZI A;  2BE9 B;  4I68 A;  4RU2 A;  1VLO A;  3AJ2 A;  1Q7Y T;  5A8W B;  1OPZ A;  3N6M A;  1IM6 A;  1M5O C;  3DCA A;  3KJF B;  2W7A A;  4NLQ A;  1K8A T;  4ELU A;  3CD6 S;  4WFZ A;  1EKS A;  4WYW A;  3UW1 A;  4P72 A;  4U9R A;  1Y9O A;  3OJS A;  4K4W A;  3B8H A;  2YNF B;  4K4Y A;  3D0I E;  2DK2 A;  2Q3P A;  4QR0 A;  1RHQ B;  1F3V A;  1RAI B;  1KOO A;  2AYE A;  2BRL A;  1YZ6 A;  3T6J A;  4CZC A;  5E3R A;  4RW6 A;  1N5Q A;  3M8P B;  4DX7 A;  3H90 A;  1L3K A;  1V6H A;  3D6F B;  1RT3 B;  2CPH A;  4LF9 J;  1RT5 B;  1N6Q B;  4FDF A;  2HND B;  1MN7 A;  3NGT A;  1G7C B;  2ZJQ Q;  3SCL E;  2MLY A;  3PX4 A;  5EX3 A;  1S4E A;  2B7C B;  4WXW A;  2XGQ A;  3RUB L;  5KFY A;  1IQT A;  1RKJ A;  5H1S V;  4M5G A;  4IO1 A;  4ENO A;  1URR A;  2M88 A;  4A8F A;  4YDD B;  2WON B;  3G8S A;  2MQ8 A;  4PG6 A;  3O3L A;  1UEU A;  2CUY A;  5HQM A;  3KLG A;  2D41 A;  1NEE A;  5GAH I;  1REV B;  1S1X A;  4DQQ A;  2V2Q A;  4L76 A;  2QE5 A;  2APO A;  1FEE A;  1FFG B;  1Q82 T;  2J6T A;  1V3S A;  3PO5 A;  1LWE B;  3M2R B;  3TAN A;  1SXL A;  4URQ U;  3ICL A;  1EP4 B;  1O8B A;  3J7Y I;  4NLG A;  3GSI A;  3KHG A;  3NNH A;  3L4B C;  2RDI A;  2ZC4 A;  1GAO A;  3KYL A;  5LMU F;  1S0N A;  3K5P A;  4U95 A;  3CTR A;  2FHM A;  3CGI A;  1EQ0 A;  2ALZ A;  2ZVI A;  2D69 A;  3R5C A;  2D9O A;  2Z0G A;  1K44 A;  3A8I A;  2OSQ A;  1M5V C;  5A6P A;  1F1B B;  1VC5 A;  3PJ9 A;  1T94 A;  1TKZ A;  3DRP A;  4LF4 J;  3CO0 P;  3SI8 A;  4I56 A;  2IAJ B;  3EGV A;  3I96 A;  3TAM A;  3EVO A;  5IQ6 A;  5L46 A;  1T3N A;  3CNQ P;  4M5L A;  2BE2 A;  2RJZ A;  3JS9 A;  5D6G A;  4PKD B;  4IO9 Q;  2NSC A;  2HVE A;  3Q89 A;  4S0M A;  1OYD A;  1WNE A;  3VQT A;  2BKO A;  1XNR F;  4DR6 J;  1RT7 B;  1TFY A;  2DVI A;  4BDP A;  3IP0 A;  3MR2 A;  4PQA A;  2AHO B;  2BZ2 A;  4MKY A;  2CPY A;  2CQG A;  3ILJ A;  4DZD A;  2IA0 A;  5CZX A;  3VWS A;  3PZP A;  1R27 B;  2PFF B;  4Z7C A;  3ZTO A;  3V4I A;  3A8J A;  1PC4 A;  3DDN A;  1N52 B;  1PGZ A;  4FS1 A;  5KG2 A;  2VAS A;  2R4F A;  2HHS A;  3NWG A;  4LBH A;  2EKY A;  4TU7 A;  5F8G A;  2BQR A;  4AT1 B;  1TUV A;  3CJ4 A;  1XWL A;  4RL1 A;  5I42 B;  1X31 C;  3W2V A;  2FTR A;  4DG1 A;  1CJT B;  2ZBC A;  5KFT A;  1OQ3 A;  2WRM A;  4NX9 A;  4MIW A;  2HHV A;  2RAQ A;  1SL1 A;  2VG6 B;  2K3K A;  2RQ4 A;  4ED5 A;  4HHJ A;  1FRH A;  1WI8 A;  1VK8 A;  2NR0 A;  2YXL A;  5BR8 F;  2H4W B;  4WIQ A;  1RB0 A;  2EG1 A;  2A2D A;  4JI1 F;  2ZZM A;  2GV1 A;  4HDG A;  3KXD A;  2GMJ A;  4IOA Q;  3QGI A;  4AND A;  1QD1 A;  4OJG A;  4Q2M A;  1TL7 B;  1VDH A;  1LXN A;  3POT A;  4QWA A;  2HFV A;  1SKW A;  3H0P A;  1LW0 A;  3NS6 A;  3MEG A;  1FJ7 A;  3GFZ A;  3HCX A;  3ISN C;  4ALZ A;  1SIW B;  2HQC A;  1RT2 A;  5DM6 Q;  4WE1 A;  3MM9 A;  2MZT A;  4E8U A;  2MEW A;  1QSY A;  1XJW B;  1BD6 A;  4ZIV A;  3G2X A;  4ID8 A;  3LUY A;  2HZC A;  3SV3 A;  4JUZ A;  2JEG A;  2VQF J;  3IAS 9;  1TL1 B;  2ZM6 J;  4DL0 C;  2ZHA A;  3CCR S;  4OZ3 A;  5HVF A;  3LWL A;  3BSN A;  1B7Y B;  3ZXW A;  1IKX A;  4WFN Q;  2DIU A;  3TEH B;  3FUY A;  4P7V A;  2EVZ A;  3DI6 A;  1NUE A;  3MCS A;  1FKO A;  2Q79 A;  4NZ6 A;  2XQC A;  2JL9 A;  2R8K A;  2OTL S;  4X4V A;  1WD6 A;  4Y2A A;  4OYP A;  2VOO A;  4KAI A;  2JLE A;  1NJI T;  1V5V A;  2LA4 A;  3HD2 A;  3AQP A;  4L75 A;  3GJQ B;  4A8M P;  2GO9 A;  1PSD A;  2Z2M A;  3IO1 A;  4F8R A;  5KG7 A;  3KLF A;  4UY8 5;  3OXG A;  4P75 A;  2V50 A;  3HI9 A;  4G3I A;  1HWI A;  3OR1 B;  2MDA A;  1DY3 A;  4DR2 J;  1Y00 A;  5ETQ A;  4IUF A;  4FYV B;  1PYO B;  2FVP A;  4OHZ A;  3IG1 A;  1W2I A;  3M8Y A;  1ZOT A;  5KFA A;  3PFE A;  1FTR A;  2OLW A;  4FXW A;  3VAM A;  3NMR A;  1KTQ A;  1HW8 A;  3KK1 A;  4ZP6 A;  1JXV A;  3KFW X;  2XMU A;  2YNI B;  4J37 A;  4DPY A;  1EHW A;  1RLD A;  2O01 C;  4ICL B;  2LVW A;  2CQ1 A;  2VQE J;  1QSL A;  1VBY A;  2ZBR A;  4P10 A;  2ACM A;  1NDP A;  2BA9 A;  3CJ3 A;  2UV8 G;  1KQG B;  1GX6 A;  2MZR A;  3HHD A;  2NQP A;  3G4S S;  2DJW A;  4MIA A;  4DDF A;  1EET B;  1Q4R A;  4JI3 J;  2FPH X;  1GNK A;  2WCX A;  4ZN1 A;  3ULH A;  1JQG A;  1KFS A;  4MMO A;  3GTY X;  2FUG 9;  2K7K A;  4ZP8 A;  2HFO A;  1WEY A;  4LRA A;  4ZMM A;  1Z2Z A;  1M5H A;  2ZD1 A;  4HI2 A;  2BM0 A;  3G87 A;  4XIU A;  1HNZ J;  4ECQ A;  2DR5 A;  5LOQ A;  2B4P A;  2BV3 A;  1RP5 A;  2J0Q D;  3W7B A;  4HHU A;  4O23 A;  1BXN A;  1S1T B;  1G4C A;  3UCG A;  1FXL A;  2MQN A;  3QBC A;  1NH7 A;  2XO6 A;  2IDL A;  3C2P A;  4WP3 A;  2KT3 A;  1KC8 T;  1O5J A;  2PII A;  2DNY A;  3OVB A;  3GIM A;  3NGD A;  2X3G A;  2BQ3 A;  1MN9 A;  3BQ1 A;  4V19 J;  4CM0 A;  3UVJ B;  3LAM A;  4B3O B;  3SDE B;  2PD1 A;  2HQF A;  2RKI B;  4B9L A;  3SYZ A;  2C2D A;  3M6U A;  2UUB F;  3M6V A;  5FJ4 A;  3P49 B;  5J1N A;  4Y0F A;  4KO0 A;  3MAH A;  2ZWO A;  4N8N A;  3A3N B;  3VGT A;  3GU0 A;  1XIQ A;  1WTF A;  1XMQ J;  3BGL A;  1S0V A;  1S1U B;  4DPO A;  1R31 A;  2H5E A;  2UVV A;  4ZA1 A;  3LAN A;  2JNJ A;  4C8Z A;  3I0S A;  3FFI A;  1CJU A;  2DCL A;  4I69 A;  1RHR B;  3RR7 A;  4F7V A;  1MW7 A;  3EZU A;  5M2R A;  3KLV A;  2ZH7 A;  3W3S A;  4Z7Y A;  4FF4 A;  1RAC B;  4CO1 A;  3GCX P;  3V6D B;  3SSR A;  1NK7 A;  2DNZ A;  4GKJ J;  1HQE A;  3V6H A;  2QN6 B;  3FSY A;  4OYW A;  1LWX A;  2KG1 A;  3HT0 A;  2YKM B;  3DDK A;  1QDU B;  2H4Y B;  4X65 F;  3MWB A;  2GIR A;  4RNH A;  4LBI A;  2WSC C;  2PT0 A;  4DV3 J;  4YFU A;  3X3U A;  5KFB A;  1SQG A;  1DLO A;  2W7O A;  4DLE A;  4UOF A;  4OX7 A;  5I3U B;  4QPT A;  4U7U K;  2DGT A;  1NB7 A;  2D3U A;  4F3O A;  3QQC D;  3TA0 A;  2ZDP A;  3K8V A;  1BQM A;  4DR4 F;  1B64 A;  2EKN A;  2SXL A;  4O44 B;  1OMS A;  1FWL A;  4QIW D;  4YY3 J;  4QIF A;  3M30 B;  1W26 A;  3ELH A;  4N47 A;  5G0R A;  3IRX B;  3PM9 A;  3N4W A;  3LP1 A;  1A0O B;  1D0E A;  5A0Y B;  3DOL A;  5I3Q A;  2EBE A;  3VV2 B;  4EK2 A;  2V63 A;  4MTP A;  3HHL B;  5A2Q U;  4WZQ A;  3D6H B;  2IMW P;  4GO7 X;  4NI2 A;  1DTQ A;  2G2Y A;  4IG3 A;  1UJ6 A;  2FYX A;  2ZZT A;  2MQL A;  3BEG B;  3HKW A;  5L39 A;  4ZIT A;  5HP1 B;  2GJ2 A;  5GMK a;  4GVB B;  2POK A;  3DMJ B;  4PR6 A;  5D4P A;  5IC4 B;  4DR7 F;  1I94 F;  2RDD A;  1Q8B A;  1JNZ B;  1R43 A;  1T7P A;  3MEE A;  1KFD A;  5FDL B;  4WU3 A;  1UCN A;  3A3P B;  1KTV A;  1YJT A;  1F3F A;  4OI6 A;  3IR6 B;  3J81 U;  4P2S A;  5K14 A;  3DRX A;  2ZH9 A;  3MM8 A;  3OTE A;  3M8R A;  3R5A A;  3CJQ A;  3NCP A;  4YS2 A;  2KFY A;  1NDL A;  4NA2 A;  2XLK A;  1Y5N B;  2VFU A;  4X4S A;  1EIY B;  4ETX A;  1KS2 A;  4QBU A;  1CG2 A;  1H2U X;  3OR2 B;  2E29 A;  3RYL A;  4AFF A;  4N8O A;  2XMJ A;  4JI5 F;  1R3N A;  1JK9 B;  2B43 A;  2LDY A;  4J90 A;  4MJK A;  4PXE A;  1XER A;  2NUH A;  3PIP Q;  2M2B A;  3IR7 B;  5J2N A;  2AJ0 A;  2BXJ A;  2XZT B;  4L3N A;  4CQ1 A;  3T9Z A;  1Q86 T;  2UU9 J;  1HQU B;  3P4U B;  4DPW A;  3DOM A;  3G82 A;  4NLW A;  4K4Z A;  1U1N A;  3CED A;  1HNI B;  3ET6 B;  5E0O A;  4CT8 A;  3RB0 A;  4HH1 A;  1Q81 T;  4LJM A;  3LPE A;  4WTY A;  2QT7 A;  5D78 A;  4RW4 B;  5DDR C;  1H38 A;  4JI7 F;  3BSA A;  5DLG A;  5CCM A;  5E3C A;  1RTI B;  3PYG A;  3K5O A;  4ZVU B;  3T19 A;  4EI2 A;  2LMI A;  3EX7 B;  1P1T A;  5L1I A;  2BDP A;  4UUW A;  3D6T B;  3FEZ A;  4RR5 A;  2BX6 A;  2YQ1 A;  4MAK A;  2V0N A;  9ATC B;  2R2S A;  4I6W A;  2HLT A;  5KG6 A;  2UZA A;  4LFC F;  5DZ6 A;  4TQR A;  3UR3 C;  4CLS A;  1YBT A;  4LRB A;  1MSW D;  2HUR A;  4OYB A;  1DRZ A;  1N36 F;  2YX7 A;  3JB9 k;  3MPU B;  4JI0 J;  4KBI A;  3QPI A;  4G1Q B;  3QAT A;  5IFM A;  5GAD I;  3HT3 A;  2DNM A;  4OX8 A;  1JLB B;  2Q43 A;  3FEY B;  2FJX A;  4FKY A;  1B4S A;  4KC5 A;  2VPY B;  1RHU B;  2CAJ A;  3QSI A;  4WKR A;  4MKB A;  2Y8Y A;  4F2S A;  4XPC A;  1VMB A;  1SKR A;  1XNQ J;  4NYO A;  2MKS A;  1RAJ A;  2QZ8 A;  2LCW A;  4W90 B;  3M4X A;  3O44 A;  2IPO B;  4CT9 A;  3MPD A;  2IRX A;  4KH1 B;  3MAA B;  4DU7 A;  2VDH A;  8RUC A;  5KFO A;  2DNP A;  1VRU A;  3I31 A;  4RW9 A;  3QFW A;  3O6Q A;  1VIS A;  1BWV A;  3E01 B;  2Y3Y A;  1DTT B;  1O6X A;  4YB5 A;  3P96 A;  2D1C A;  5IZH A;  1HAR A;  2LU1 A;  3GJR B;  2AJ1 A;  4RO0 A;  1S9F A;  4YB6 A;  2JJ4 D;  3GQC A;  2V34 A;  4ES3 A;  5THW A;  3PNI A;  1VYA A;  3H5S A;  1YRT A;  2NZC A;  1U24 A;  2L9W A;  1NK9 A;  1NJX A;  2HNZ B;  4EU0 A;  3OTB A;  3K8W A;  4DV6 J;  9RUB A;  1N4L A;  1FDA A;  5IT9 U;  2JLG A;  2CQD A;  4MYU A;  4USM A;  3BQ2 A;  1G1X A;  4YN3 B;  2B5J B;  3RRG A;  1ACM B;  4PWW A;  2CXE A;  1UET A;  3D68 A;  1GMW A;  4MFB A;  4TU8 A;  1WOP A;  5CA5 A;  1JJ4 A;  4RJV A;  4CO0 A;  2RQM A;  1OJ4 A;  1AZS A;  4J9U E;  1IWA A;  2XG8 A;  4NCG B;  2DCU B;  5HMZ A;  4DV1 J;  1VI7 A;  1NAQ A;  2F8M A;  2YNH B;  3Q24 A;  4X84 A;  1GK8 A;  3BQ0 A;  2V4J B;  1UW9 A;  4LQ3 A;  3W8G A;  3RZA A;  2W2Q P;  2J9E A;  1U0H A;  4DFJ A;  1Q8I A;  1QAI A;  3FBC A;  3HHK A;  3B54 A;  4P2M A;  3MTK A;  2QA4 S;  1XMB A;  4EO8 A;  1K1S A;  3C16 B;  1A7G E;  3FEX B;  1EB0 A;  4JI2 J;  4BLG A;  1RWP B;  4TY9 A;  4DV7 F;  4WP9 A;  1LWF B;  2PEH A;  2MJN A;  2V2Z A;  1UA0 A;  3IA0 A;  2ABY A;  2O67 A;  1GTE A;  3FRZ A;  3N5F A;  1N54 B;  4V1A k;  2BJ8 A;  4C8O A;  1U6Z A;  2AYB A;  2KJW A;  2QC3 A;  3VAG A;  4DV2 J;  3EPG A;  5AJ3 J;  3Q2T C;  3I32 A;  1AA1 B;  4PQU A;  2JEF A;  1VFJ A;  1KR4 A;  2VUG A;  1Y11 A;  4WK3 A;  3ZTQ A;  1FJG J;  4CO5 A;  2MST A;  4R0J A;  3SFU A;  3MMB A;  4DX5 A;  3RAM A;  3P8B B;  2FJV A;  3H2L A;  1WG5 A;  1JLA A;  1ITP A;  3TA1 A;  5B0E A;  2XSF A;  5KG5 A;  2JDJ A;  4CTA A;  1WKL A;  4CH1 A;  3BSO A;  4FS2 A;  1HBM A;  3UR0 A;  3CME S;  4UZC A;  1ZAW A;  1DAR A;  3CD5 A;  2PE8 A;  2LEB A;  2IJF A;  3OFG A;  2ZJP Q;  1GTH A;  2D3O R;  2PI5 A;  2DRD A;  2OPP A;  3M1V A;  4UOH A;  2DRA A;  5KFG A;  2I6W A;  2GIF A;  1Y4Z B;  4LF8 F;  2KI2 A;  4ZLJ A;  4ZPC A;  2J0S D;  1TQL A;  3C14 B;  1H98 A;  3R5D A;  1X4B A;  3EVM A;  4TY8 A;  2LQ8 A;  3HO1 A;  1S7I A;  5DDP C;  2OD6 A;  3UDE A;  1TL5 A;  1Y0H A;  1CQN A;  3H5U A;  2E7V A;  1DHM A;  1DAX A;  3CDW A;  4AE5 A;  2V9W A;  4P74 A;  1HWK A;  1KSP A;  2FY8 A;  1CC8 A;  2IYG A;  3TOQ A;  4QWD A;  1Q53 A;  1XMO J;  4ES2 A;  1D9D A;  1OQ6 A;  1DUR A;  5K8P A;  1WOS A;  2FHJ D;  3TJ8 A;  2MZ1 A;  5C5J A;  1R8H A;  4X64 J;  1NK6 A;  2A10 A;  1UA1 A;  3KK2 A;  1VIX A;  1ZAV A;  3Q8P B;  4RW8 B;  2DRB A;  4L6V 3;  1Y3K A;  3JSY A;  2E5G A;  1JWW A;  3CJ0 A;  4QW8 A;  4KTQ A;  2ZKT A;  2AWZ A;  1X4H A;  4JV5 J;  2C2N A;  2RML A;  3G86 A;  4W92 B;  4NLV A;  4H4K C;  1VRQ C;  4MKV A;  6AT1 B;  1M0S A;  5K20 B;  2FGC A;  3A13 A;  1U8S A;  3RB3 A;  1I51 B;  2UXD J;  1X4A A;  4MK9 A;  4J9L A;  5C2C A;  2WTF A;  5D15 A;  2R7O A;  5B0F A;  3EGW B;  2DH9 A;  2H3E B;  1YX2 A;  2HLU A;  1MNE A;  2HGN A;  3D6M B;  2XYG B;  3DLL Q;  3DRY A;  1KDN A;  1RAF B;  1S1X B;  2VC0 A;  3D1H A;  1F0X A;  3RB4 A;  1O0P A;  5J2P A;  1NXI A;  1RTH B;  3N9U C;  5JXS A;  3D4J A;  5CAB A;  2GQQ A;  1JB0 C;  2HKE A;  3T9N A;  2VQE F;  2C1E B;  3WQP A;  1TZ0 A;  1XBW A;  4C0O C;  1ZTT A;  2YQ3 A;  4LRE A;  1D3W A;  2HZA A;  4Y2I A;  2AQ4 A;  2FZG B;  4OJH A;  4ZPV R;  1Q0N A;  5KFV A;  3S7R A;  3CUN A;  5C24 B;  2GHW A;  2QMU B;  4NLD A;  3RTV A;  2EG2 A;  1KBR A;  1KVK A;  2Z57 B;  1HBN A;  5CYM A;  4R8U A;  1TL3 A;  1X4E A;  2WVB A;  3I0R A;  3BBB A;  3F56 A;  2CG4 A;  4B9M A;  5M2P A;  1SJF A;  1S0M A;  2MQO A;  4F4A A;  3UE2 A;  2NS1 B;  2WVC A;  2IIH A;  3C6U B;  3TAM B;  1U1Q A;  2K1R A;  1RWM B;  5FLX Y;  2BE2 B;  1RAB B;  4B3M F;  3MM5 A;  2IHR 1;  2DKO B;  3SSS A;  3T5K A;  3W5X A;  1N5V A;  4QWC A;  4A8W A;  2IJN A;  1IM4 A;  3TP2 A;  2JFK A;  3VVT A;  1FKP A;  1ZYQ A;  2XMA A;  1M5S A;  4GO5 X;  5A76 A;  4DV0 J;  2XWX A;  3SZ2 A;  1FT8 A;  3KHH A;  3BBF A;  2PI4 A;  3IXQ A;  8ATC B;  3QIP A;  3RGI A;  1U1K A;  1UWA A;  3RR8 A;  2R42 A;  4DMZ A;  3UDL A;  5KFX A;  4X62 F;  1RHK B;  3TUI C;  3MD3 A;  2PFD A;  3EGN A;  3E8O A;  2Z56 B;  3VAK A;  2QL7 B;  1UEV A;  3S1T A;  1X5P A;  1GMU A;  1R8C A;  1B0T A;  1U26 A;  1S10 A;  2YWE A;  2DO0 A;  2DR9 A;  1VQN S;  5F8N A;  1S6P B;  1HNV A;  2ZDO A;  3Q83 A;  2P2C B;  3CMA S;  2CPZ A;  2VL1 A;  1IKW A;  2IC3 B;  2CRL A;  2GZO A;  1U25 A;  1YI2 S;  4DG1 B;  2XC9 A;  4NXN F;  3ETM A;  4OYI A;  2V8H A;  4AXJ A;  5GMD A;  4X4N A;  1LQ9 A;  3K5M A;  1HNW F;  4DV4 J;  4ZJO A;  2HK3 A;  2RE1 A;  1Y3J A;  4M94 A;  3JAM Y;  2PGC A;  1BMQ B;  2NXN A;  3CC2 S;  2X51 A;  3R97 A;  4DCJ B;  1HPZ A;  4J9M A;  4DV3 F;  4MK8 A;  3DLG A;  1J5E F;  1HIY A;  2ZIT A;  3HM9 A;  1S6U A;  4FN5 A;  3IWN C;  2R8H A;  2M5Y A;  2FC9 A;  3UN2 A;  4RUH A;  3G6Y A;  4IDK B;  2JZ5 A;  3POT B;  5KFE A;  3TUJ C;  2P9C A;  4J7C A;  2XZD B;  5HVH A;  3MEG B;  3KLE A;  2UXC F;  2AJQ A;  1GT8 A;  5D4O A;  3OXF A;  3ILL A;  3PO4 A;  1N33 F;  1IBK J;  4WE1 B;  3MM9 B;  2RHQ B;  2XTJ P;  2DIS A;  4A4J A;  2O5D A;  1PJ6 A;  3N6N A;  3H98 A;  3BR8 A;  1UZD A;  3IWX A;  2CJA A;  2JVR A;  4ZVP B;  1NND A;  1FXR A;  3C6T A;  3LP2 B;  4ANC A;  5EN1 A;  5IM0 A;  1S0O A;  4K2X A;  1TV6 A;  2GVD A;  1NKB A;  2WW4 A;  3PV8 A;  2XBP A;  5BJR A;  4OYA A;  4PUO B;  3HHL C;  1X8D A;  1FD8 A;  4CLL A;  3C8Y A;  1CBK A;  2NYH A;  5J2M A;  1L5U A;  2BR0 A;  4AD6 A;  3CCM S;  2V8G A;  3BGU A;  4D3G A;  2OPS A;  3CMQ A;  2QYG A;  3B82 A;  2VZ9 A;  3CDA A;  2XMT A;  1J5O B;  4N56 A;  4DF4 A;  3NBP A;  1SC1 B;  3KLF B;  1Q78 A;  4RZR A;  1AYE A;  1Q8L A;  2RUG A;  1TR0 A;  1DBD A;  2PSZ A;  3MUV P;  3KG0 A;  1RYS A;  4UQT A;  3ZZP A;  3M9M B;  3BGF A;  2WAQ D;  1Y10 A;  4CNY A;  5KFS A;  3IG1 B;  5LJ3 Y;  4ITS A;  4RNF A;  4WF9 Q;  5GAG U;  1UW4 A;  2Y0B B;  4KIA A;  1SL0 A;  3ENA A;  1N5S A;  1UTA A;  4B9S A;  1MMD A;  3KHR A;  3PVX A;  3C46 A;  4JOU A;  5MAO A;  1ZA2 B;  4F2R A;  1IJE B;  5IXU A;  5KT5 A;  3H20 A;  2E1P A;  1GH8 A;  2KRR A;  4DFK A;  4Y00 A;  2OP5 A;  2HGL A;  3CJ2 A;  2F5G A;  3K7R A;  2FDN A;  4C8Y A;  1BHN A;  3LF0 A;  3GYN A;  5ETR A;  5F9N A;  2R7W A;  2FVQ A;  4AUK A;  1RTD A;  2HFN A;  3JSR A;  2XYP B;  3HFK A;  4DOZ A;  3LGH A;  3R5G A;  5LSL A;  4YHH J;  1HNX F;  4ZHR A;  4F4Y A;  2QLJ B;  1VQ7 S;  1R0A B;  4H4M A;  1U45 A;  3ETO A;  4KSE B;  3T1A A;  3GJS B;  3IM8 A;  1FI4 A;  2XYH B;  2AT1 B;  3CJK B;  2N7C A;  2L9N A;  2V69 A;  2N4C A;  2MPU A;  4ZVT B;  1KQK A;  1FNX H;  4NRU A;  2HRT A;  4ILL A;  5B0A A;  1YDL A;  2AF6 A;  3MM6 A;  4TU9 A;  3BBC A;  1TTH B;  2WSF C;  4P7T A;  4YOE A;  3JYT A;  4WU2 A;  3GYX B;  2CZ4 A;  3DNC A;  1RAD B;  3R6G B;  3PYD A;  2PN6 A;  4F4K A;  1BWE A;  4H4O A;  2EEY A;  5IV4 A;  2LP4 A;  3QO9 A;  1E6V A;  1EAY C;  2VFR A;  2DEI A;  2KTQ A;  1TMJ A;  3DRS B;  1IKY A;  3MHY A;  2L3M A;  3QMQ A;  4DN9 A;  3TJA A;  5I4M A;  2FLP A;  2OSR A;  2QIF A;  2RQK A;  3MTJ A;  4RWX A;  3FNN A;  3ZZY A;  3NAH A;  5HO4 A;  3L95 X;  2YWG A;  4PXC A;  4DZ6 A;  3L3C A;  4FXV A;  1U49 A;  2ROP A;  2DHS A;  1JJ2 R;  4ILR A;  5H9E J;  5GME A;  1D9A A;  1S76 D;  5L9N A;  3G96 A;  3KK3 A;  1TMM A;  3BKT A;  3CE8 A;  4KO0 B;  2XY6 A;  1L3T A;  4DCO B;  4QCL A;  2AYM A;  2VU5 A;  1Q5Y A;  5KG0 A;  3MEC B;  4K4V A;  1F2G A;  3K17 A;  2HNY B;  3W60 A;  2W9B A;  4Y6I A;  2BOA A;  3B4M A;  4ZK7 M;  2HQI A;  1CJU B;  3QYY A;  4RUB A;  3BO3 A;  2JWN A;  3J81 j;  2CDQ A;  2GW8 A;  5B09 A;  3CCU S;  4G1P A;  2B9W A;  4LVN P;  1HQE B;  2XHW A;  3M2V A;  1RU1 A;  3K59 A;  2HPU A;  1WHY A;  1U1L A;  2LKZ A;  2AYG A;  3G8T A;  4K4U A;  4RX6 A;  1WEX A;  2OKQ A;  2O3D A;  4OZ5 A;  2JC0 A;  3EVW A;  3DM2 A;  5D77 A;  1MWZ A;  2P5V A;  2QA2 A;  1DLO B;  5A2Q Y;  4ECU A;  1P1L A;  1TUW A;  1YRX A;  2RHS B;  3LW5 C;  3SMZ A;  1XN9 A;  4K59 A;  1WSR A;  3S8S A;  1WJ9 A;  4MK7 A;  2G0I A;  2OIH A;  2YX1 A;  1YQH A;  3HX9 A;  4ELT A;  4FPR A;  3T5H A;  1BQN B;  2N82 B;  1UEK A;  4LSN A;  2KKH A;  3ZFV A;  2ZVS A;  4DR3 J;  4FBT A;  1P6T A;  2DHH A;  3R5B A;  2J7W A;  3ILI A;  3W63 A;  5G0R B;  3NL0 A;  3IM9 A;  1AUD A;  3KJV A;  1PIL A;  3UDV A;  4WTO B;  5DG9 A;  4O0N A;  3DOL B;  2L9D A;  1RUS A;  4HT5 A;  3PRV A;  3DRR A;  3UD5 A;  4I0W A;  3BPD A;  2YKA A;  3UCU P;  4QZV B;  3J81 Y;  3AOB A;  4LF7 F;  2B9Y A;  3MMJ A;  2QL5 B;  2YKQ A;  1X9M A;  1RBL A;  5MLC V;  3GJT B;  2AU0 A;  2ALY B;  1UWB A;  2CJB A;  3TAR A;  3QGG A;  2J9D A;  3RB6 A;  5DDQ C;  4KYZ A;  2CQ3 A;  2H51 B;  1N5Y B;  5D3G A;  1HI8 A;  2ILZ A;  2W1B A;  1D9F A;  2VON A;  3FSX A;  1U2F A;  1FRX A;  2DNG A;  2BUN A;  4LSL A;  3K57 A;  3MR3 A;  2VPZ B;  2BJ7 A;  2HZV A;  2HS4 A;  2GIQ A;  4DQR A;  3QAE A;  2ZWP A;  2D9P A;  1R8B A;  1RT4 A;  3EMT A;  1WUU A;  4ANE A;  3ZZO A;  1K73 T;  2F63 A;  2NXU A;  2B6A A;  4P2F A;  2E5L J;  3NLC A;  3D1O A;  2ZUG A;  3MM8 B;  1NO8 A;  2V8D A;  1X4F A;  3IR5 B;  3PAC A;  4XO0 A;  2UUA F;  1ZM4 A;  2OUG A;  1QAX A;  2ZHB A;  3VR1 A;  2FLL A;  1N0V C;  3Q23 A;  2CFX A;  1LW2 A;  1VIO A;  1FES A;  3AT1 B;  4OI3 A;  1X9S A;  2YNG A;  1YJN S;  5LXR A;  3T5J A;  2Q66 A;  5J2N B;  2XLJ A;  1UFL A;  2YNF A;  2A6O A;  2FJW A;  5C25 A;  5EWE A;  4DXL A;  1REG X;  2R8G A;  4Y34 A;  3DOM B;  4K5R A;  4DR1 F;  3FMB A;  2LLZ A;  1CJV A;  2LXF A;  1JJC B;  3D5M A;  3DLJ A;  2C2M B;  1RT5 A;  1N6Q A;  4LF6 J;  4JI8 F;  2HND A;  3V6J A;  4R25 A;  3HSG A;  1IKV A;  1NLK L;  3TX8 A;  2EC2 A;  2IVF B;  3R7B B;  1CVJ A;  3IBW A;  2PC6 A;  1SVD A;  2MHE A;  3VAH A;  4B17 A;  2GQC A;  1U6F A;  3MCO A;  2DHG A;  1S57 A;  2HHW A;  1HKA A;  1DZ5 A;  2WON A;  1T9T A;  4JB8 B;  3C19 A;  2CJY B;  3OL8 A;  1UJ5 A;  2BJ9 A;  1I1G A;  2ZJR Q;  3MF5 A;  5JMN A;  3NKY A;  3AHP A;  3OTO F;  2XNQ A;  2Q6C A;  2AJF E;  2M70 A;  1YJV A;  3ZNU A;  1GFW B;  4P9S A;  2GGP B;  4OHV A;  2CQ4 A;  2WHO A;  5U47 A;  4L74 A;  2RRB A;  2C2R A;  2DY9 A;  1RDR A;  5ETM A;  3KHL A;  3T1H F;  4ECX A;  2Y9H A;  2IM2 A;  4OV1 A;  1S9E B;  4A8X A;  3RRH A;  3DHX A;  1OY6 A;  2E7W A;  4DQP A;  1RTJ A;  4DUZ J;  3ITH B;  3I6P A;  3U02 A;  4TLR A;  4CI0 B;  1W7W A;  4ZS6 A;  3LOU A;  5LJ5 Y;  1GXU A;  1DQA A;  1VC6 A;  2HG4 A;  2CQP A;  3OLB A;  1U1M A;  2CJQ A;  5L1L A;  1CJK A;  2IMO A;  2COL A;  4NEZ A;  1C0U B;  3DXS X;  1LFP A;  4NOH A;  3RBE A;  2GVZ A;  3TQE A;  5AE2 A;  1ZA1 B;  3MFH A;  5IT4 A;  3GZ7 A;  3L7O A;  1BC6 A;  1I5O B;  1TAU A;  3TYT A;  3JXO A;  4Q8E A;  4L73 A;  3NNA A;  1S6O A;  3C66 A;  4BBY A;  2MKK A;  1IBC B;  4EEY A;  1YKW A;  2MY7 A;  4FZV A;  1RT7 A;  3TVY A;  1F2H A;  4YUD A;  3T1Y J;  3NOG A;  2VV5 A;  3MPY A;  1NME B;  4U67 Q;  1RCX B;  3E3X A;  2CG8 A;  2GNK A;  3J7Z 5;  4YB7 A;  2BE7 D;  4X66 J;  5KT2 A;  3Q8R B;  1H3D A;  4KFB A;  4WFA Q;  3KJN B;  2HBR B;  2F4V J;  1NPR A;  2B8Q A;  3Q8U A;  1SB6 A;  1U7L A;  2LXI A;  5EWG A;  1K1Q A;  3SCJ E;  2G2Z A;  4URG A;  5F0U A;  1Q5V A;  1SKU B;  3CDB A;  1SJQ A;  2JVO A;  4ZP7 A;  4PAB A;  3V81 A;  4ED2 A;  2V2K A;  2QMX A;  2BM1 A;  4MFB B;  2ZC3 A;  3R3T A;  1HYS B;  4B3S F;  4UF4 A;  1JLC A;  2XMW A;  4OJ3 A;  3WC2 A;  1RAG B;  4ED6 A;  4CRJ A;  5JVH Q;  4CO2 A;  5D0E A;  3UFC X;  4F04 B;  4N5S A;  2HBQ B;  2M0G B;  4O3P A;  3MM7 B;  5EDW A;  2VG6 A;  1RHM B;  2C22 A;  3M8S A;  4OJ1 A;  4J9R A;  2YWH A;  1VR6 A;  3JTP A;  2X1B A;  1W2B R;  2WOM B;  2JFD A;  3GPA A;  4JV0 A;  3DFE A;  1YVF A;  1KHW A;  1NSK L;  3ZZU A;  1U0H B;  1T9X A;  4M5K A;  5DG8 A;  4QYZ J;  2EXU A;  3M8W A;  4I2P A;  2VFV A;  4GVL A;  1RAH B;  4U96 A;  2V9K A;  3KWM A;  4MYT A;  2KG0 A;  3KKF A;  2PMZ D;  4PPZ A;  2V68 A;  2RIL A;  3O8W A;  1N32 J;  2XS7 A;  4IG0 A;  3CF5 Q;  4ZVG A;  1RT1 B;  1E6Y A;  4OI4 A;  4NLT A;  2FJE B;  4DR5 J;  2XGP A;  1FVS A;  2B3T B;  3DKD A;  3GFX A;  3GIJ A;  3H59 A;  1D09 B;  4O4G B;  4AQY F;  3BRE A;  1J27 A;  4ZPB A;  4CO4 A;  4RNO A;  5B7W A;  3L09 A;  1YJ7 A;  2BVZ A;  4EGL A;  4RW7 A;  2EW9 A;  4IH7 A;  2EFP A;  4PQU B;  3BH6 B;  3OHA A;  2GX8 A;  4C48 A;  3G8Q A;  3MAQ A;  4K7Q A;  4DX6 A;  2FJB B;  1S7H A;  2ZEJ A;  4I64 A;  4H4K A;  3MMB B;  2DT9 A;  5H9F J;  3M6X A;  1SJ1 A;  2R9L A;  5HJX A;  2C3P A;  1MU2 B;  4CTA B;  3AJ1 A;  2GAG C;  3CVK A;  4BWJ A;  4PPD A;  2I38 A;  4CLF A;  3I5A A;  2NLW A;  1HBM B;  2Q1L A;  5H9E K;  1GXT A;  1T05 B;  1N34 F;  1NRK A;  4TXS A;  2BJE A;  3CJS A;  2X1G A;  5HBM A;  2EWH A;  3I4H X;  1HBU A;  1CC7 A;  2MJU A;  3CCQ S;  3SXL A;  2E5H A;  2QEX S;  4P71 A;  5KOX A;  1I6J A;  3C3L A;  3UPF A;  3BO4 A;  4Q2L A;  5KG3 A;  4ID5 B;  3WBZ A;  2OAU A;  2HQ3 A;  2F1F A;  3BJY A;  4PWD B;  4WXO A;  4NZ7 A;  3JSM B;  5IWA F;  2RRN A;  3CJ8 A;  5K9F A;  4TY8 B;  1RHJ B;  1LFW A;  1KLM B;  2CNL B;  4QWB A;  4ICL A;  4K5S A;  3DHW C;  3HD1 A;  4QU7 A;  2MMY A;  3W2W B;  2AEJ A;  4CLU A;  5LMU J;  2J6S A;  5I3P A;  4JI6 F;  2VHG A;  2FHJ A;  2HAF A;  4LT6 A;  4Q45 A;  1LEO A;  2EC0 A;  3W66 A;  2RT3 A;  2RQC A;  3I87 A;  2KXF A;  3ISN D;  3DYA B;  3LPY A;  2JC1 A;  2Y1L B;  3UI3 A;  4YP3 A;  4IRC A;  2UUW A;  1IUJ A;  1FX4 A;  1YBU A;  2XY5 A;  1S1W B;  4NXM J;  5KTQ A;  2YKO A;  2VB6 A;  1FRJ A;  4ED4 A;  3G71 S;  3QRQ A;  1SKS A;  2Z2Z A;  1FER A;  5KFC A;  4KHM A;  1UFK A;  1MLA A;  3RG6 A;  5AT1 B;  4B9T A;  1G6B A;  5HRO A;  2CPI A;  1Q79 A;  1V3Z A;  1XNR J;  3K2Y A;  1SC4 B;  2QO3 A;  4DI6 A;  5FLX U;  3P45 B;  4B3O A;  5JVG Q;  1KOH A;  3MR5 A;  3ZTS A;  1OWX A;  1EZZ B;  2VKZ G;  2W4C A;  5J2P B;  5EGY A;  2HRY A;  4PXD A;  2ASY A;  1VHF A;  2KN4 A;  4NYZ A;  3FJ2 A;  4EZ6 A;  1YHQ S;  4IYQ A;  3I9Z A;  5B0B A;  4KH0 B;  2RIJ A;  4A46 A;  3H42 A;  5HAO A;  3K58 A;  2ZKU A;  3GIR A;  5AE1 A;  3HSD A;  2HIQ A;  1ZET A;  3KTQ A;  2X1A A;  2E9R X;  2Z8Q A;  2HBZ B;  4Q44 A;  1S1V B;  1CLF A;  2YWK A;  2BQU A;  4ZPA A;  1UVJ A;  3PRB A;  1PC5 A;  3KLI B;  2AX1 A;  1KN6 A;  4R8U B;  2ZH1 A;  2YKM A;  3OHB A;  2PO4 A;  2P9G A;  1SJR A;  5BR8 J;  4DSI A;  2KB2 A;  3SFG A;  3QRP A;  2DIV A;  4X2B A;  3BH7 B;  2DIT A;  3MFI A;  4KT0 C;  4JI1 J;  5J2Q B;  4ZVQ B;  1B7F A;  3KMQ A;  3DLK A;  5IOL A;  1HMV B;  1KWM A;  3R2D J;  1HBO B;  3JAM U;  2K1R B;  2K7J A;  1S99 A;  3AFG A;  4OHW A;  1S9G B;  3MDF A;  2OI2 A;  4KB7 A;  2CQI A;  3SCI E;  1S59 A;  5HI7 A;  4O44 A;  4DL2 A;  1AT1 B;  3M30 A;  3TZY A;  3D3B J;  4EO6 A;  3QIP B;  1HD1 A;  2CNO B;  5DGA A;  1C4A A;  3EJM A;  3B78 A;  2J5A A;  1JLG A;  3BV8 A;  3BGR A;  4ZOS A;  2WZ1 A;  3Q8Q B;  1LWC B;  1UPM B;  1OSD A;  1FD2 A;  1YTY A;  5B0C A;  1FO1 A;  1Q1K A;  2CZV C;  2MQM A;  4NPO A;  2WBM A;  4UST A;  4OI1 A;  4HI1 A;  3MMC A;  6FDR A;  1AFI A;  1HNV B;  3EM1 A;  4GVB A;  2E1M C;  4ZVE A;  3P3D A;  3PHE A;  1IKW B;  3H2U B;  3HUL A;  5A6W A;  3F44 A;  4NCA A;  4IFY B;  4OZJ A;  1QTM A;  4FF1 A;  3P5B P;  2ZZN A;  4DSF A;  5FDL A;  5KFP A;  2DXD A;  4R5P B;  1V9O A;  2AIR B;  3SCK E;  2G9O A;  4DPT A;  8AT1 B;  3FK4 A;  2I5J B;  5AXM A;  4BWM A;  4KGK A;  2ZE2 B;  1PBA A;  1NDK A;  2HWH A;  4YQW A;  1HR0 F;  1HPZ B;  3HLU A;  3HSJ A;  3I55 S;  4B3R F;  3KDN A;  2GC8 A;  1SCJ B;  3TZZ A;  4J5O A;  3UQS A;  2ZBQ A;  2E5J A;  5AXL A;  2ZOG A;  5IT0 A;  3M9N B;  1S77 D;  2JSX A;  2DYA A;  3DU5 A;  4G1I A;  4EBD A;  4J9P A;  1TEL A;  3LH2 S;  2KVI A;  4C8K A;  4ECZ A;  3D7S B;  2CPX A;  3BZQ A;  1FFW B;  2HGM A;  2W2N P;  3VZI A;  3H2V E;  3KLE B;  2BAB A;  4C6A A;  4DFM A;  2VFT A;  4NAS A;  2MKJ A;  3THT A;  2KT2 A;  3DOK A;  1TKX B;  1HQU A;  3M8Z A;  4TQS A;  2V8V A;  3BYR A;  3PFO A;  2X3D A;  3JTO A;  3PEJ A;  3T5L A;  3CXC R;  3LQV A;  4PG7 A;  2HMI A;  4RW4 A;  3FBF A;  3C6T B;  4PWU A;  5LT5 A;  4J9K A;  2JOQ A;  3U1M A;  5A8R B;  1WDT A;  1JXL A;  4ZP9 A;  5E3Q A;  4CYU A;  1TV6 B;  2GVD B;  1B0P A;  1QE1 B;  2H65 B;  2MGZ A;  1FK9 B;  3HJV A;  4JV2 A; 
#chains in the Genus database with same CATH homology
 3W1Y C;  1HNX J;  4V1A k;  1XMQ J;  4DR2 J;  4X62 J;  4JV5 J;  2KVQ E;  4LF8 J;  5LMN J;  4B3R J;  1N34 J;  1N32 J;  3D3B J;  4K0K J;  1HNZ J;  2E5L J;  4NEZ A;  4DV2 J;  2MEW A;  4DR3 J;  2MQ8 A;  4RJV A;  5AJ3 J;  4LF4 J;  2UXC J;  5A2Q U;  4DR5 J;  2UXD J;  4B3T J;  4KY3 A;  4HHU A;  2VQF J;  1IBK J;  4DV1 J;  4JI5 J;  4LFC J;  1N33 J;  2ZM6 J;  4B3S J;  4DV5 J;  4JI4 J;  4GKJ J;  5LM7 E;  2UUA J;  4AQY J;  1FJG J;  3J7A N;  2UXB J;  4NXM J;  4NEY A;  4X65 J;  3J80 U;  1N36 J;  2UU9 J;  2MTL A;  3OTO J;  5IWA J;  4NXN J;  4LF7 J;  4JI0 J;  5BR8 J;  4GKK J;  2VQE J;  4DV3 J;  2HHH J;  4DR7 J;  2UUC J;  1I94 J;  4LF5 J;  4DV4 J;  1HNW J;  4JI1 J;  4DR6 J;  4B3M J;  4OX9 J;  3D3C J;  1XNR J;  2KL8 A;  1XMO J;  4KYZ A;  5FLX U;  4DV6 J;  1IBM J;  4DUY J;  4LFA J;  4JI7 J;  4JYA J;  3T1Y J;  4DR1 J;  3R2D J;  3JAM U;  4LF9 J;  5IT9 U;  3T1H J;  4KHP J;  2UUB J;  5LMU J;  3J81 U;  4JI2 J;  3IMQ J;  4JI3 J;  1XNQ J;  4DV0 J;  1IBL J;  4X66 J;  4LF6 J;  4X64 J;  4JI8 J;  4JI6 J;  4DV7 J;  4DUZ J;  4LFB J;  4PWW A;  1J5E J;  4DR4 J;  2F4V J;  4YY3 J;  3R2C J;  4YHH J;  1HR0 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...