4LF7J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf7J00
4NEZA 4KHPJ 1HR0J 4K0KJ 4RJVA 4YHHJ 2VQEJ 5BR8J 3R2CJ 4JI3J 4B3MJ 4X65J 2UXBJ 2KVQE 5LMNJ 1N33J 3D3CJ 2UXDJ 5AJ3J 5FLXU 4X66J 1J5EJ 4DR1J 1I94J 3IMQJ 3T1YJ 1N34J 2ZM6J 4DR2J 5LM7E 1IBKJ 2KL8A 2MEWA 1IBLJ 4NXNJ 4DV2J 2MTLA 4JI4J 2HHHJ 4JI6J 4DV7J 4B3RJ 1XNQJ 4NEYA 4PWWA 4B3SJ 4DUYJ 2UUCJ 4KY3A 4LF7J 1FJGJ 4LFCJ 4OX9J 4AQYJ 4JI0J 4JYAJ 4JV5J 5IWAJ 4DR3J 4LF8J 5A2QU 2MQ8A 1N36J 3D3BJ 3J80U 4DUZJ 1XMOJ 3J7AN 1N32J 4LF4J 4GKKJ 1HNXJ 4JI1J 2E5LJ 4B3TJ 1XMQJ 1IBMJ 2VQFJ 2UUBJ 4YY3J 4KYZA 4JI8J 1XNRJ 4GKJJ 4HHUA 4DR7J 4DR6J 3J81U 4LF9J 5LMUJ 4JI5J 4JI7J 2UXCJ 4JI2J 2F4VJ 4V1Ak 4X62J 4DV6J 3W1YC 4DV3J 2UUAJ 4DR4J 3T1HJ 3JAMU 1HNZJ 4DV0J 4DV1J 4X64J 5IT9U 3OTOJ 1HNWJ 4DV4J 4LFBJ 4DV5J 4DR5J 4NXMJ 4LF6J 3R2DJ 4LFAJ 4LF5J 2UU9J
chains in the Genus database with same CATH superfamily
4Y2IA 4LRBA 1FT8A 1FFGB 3QNWB 3KLGA 1U1MA 2H54B 4WFNQ 3HKWA 5GVQA 4ECVA 3OUYB 2FHKA 5DJBA 2XMJA 4X2BA 4NYZA 2CPYA 4O0IA 3HVWA 1M0SA 4HI1A 4F3MA 2BKOA 1T02A 3OTOF 1S77D 2MLZA 2GQCA 3W7BA 1GFWB 4GO5X 2AP6A 2FB0A 3H7HB 4JI6J 4PWUA 2POKA 3MPVA 1LQ9A 2CWKA 3C8YA 2XO6A 4JI3F 1H2UX 2CQ4A 2I6WA 4DUZJ 1XMOJ 3FEYB 1RAEB 3QLHA 1YJWS 3MUTP 2XQCA 2IBOA 2H4WB 4YB7A 5B0GA 2LEPA 3PVXA 2Y9HA 4DN9A 4C11A 4PQUA 3FMBA 5LSLA 1WI6A 1U1OA 4L75A 3PEJA 2M4MA 4ZVRB 2N7CA 5JXSA 4Y2KA 3TQEA 1FD2A 1SH3A 1YIJS 3UDLA 1T9UA 2W7PA 1WC3A 2F9JA 1BMQB 2EFQA 2CADA 2V2ZA 3SFUA 2CQPA 5LMNJ 2QZ8A 3MEGB 2Q6BA 2MKIA 3PW0A 3DGPA 1WNEA 4YR2A 3JTPA 2BJ8A 2HIQA 3I32A 4DOZA 2GGPA 4DEZA 2QRRA 4D3GA 5C42B 4LR7A 2W7OA 3O1LA 1GXTA 1D3WA 5IT4A 3M7VA 2NUHA 4RBVA 4LF8J 2PD1A 1UWBB 1S0OA 5EN1A 3SCKE 3MM8A 3HJFA 4IDKB 4F26A 3ZZOA 2ILZA 3PEHA 2GIFA 5LJ3Y 3FQKA 3KLIB 4RUAA 1PSDA 3N5FA 1HA1A 2GMLA 4WU2A 1QDUB 3HD1A 1LFWA 1OS5A 3BDPA 3Q8YA 3MCNA 3WBZA 4K4VA 3EWGA 2KG1A 1X4BA 4JI8F 2B4PA 2Q66A 1C1BA 3H40A 4CO2A 2YH0A 2UUWA 2YX1A 2B4VA 4KSEB 4ZN3A 3CO0P 3HDSA 5JVHQ 3JYTB 1TKXA 4MK7A 4B9UA 2ZNYA 2VFRA 4O23A 3RBXA 2YKNB 3IGVA 3EZ5A 2NREA 1S12A 4KRWA 2UXBF 5HVHA 1DHMA 1JLGB 1P27B 5DDRC 4LF4J 1WEYA 2RQCA 4KH1B 3FC9A 4I2PB 2FJBB 2IRXA 4IOCQ 4USWA 3NBPA 4A8WA 4DL4A 5IV3A 5HVFA 1RK8A 4QIFA 4DV2F 1HHTP 1VBYA 2VA3A 1WC0A 1IXKA 3VR1A 4RWWA 4G1QB 1VQKS 5J2QB 1IR1A 1YX2A 3D6FB 4PXEA 2CKWA 4WFXA 4OZ0A 4CO4A 4NASA 1KVJA 5KG4A 1WTFA 3LQVA 2FHMA 3DN9A 4WU3A 4K4SA 3DRSA 2XSJB 5BYRA 4I7FA 4J9SA 3QZ7A 4X4TA 1S0NA 3MMAA 1S0MA 3EX7B 4CLFA 5IM0B 2GHWA 1NDLA 4USMA 3EM1A 5KFPA 3S1TA 5A76A 4B9LA 4TY8A 1SJ1A 4Y0FA 2ZC4A 3GV7B 1Q81T 2XI2A 4DFJA 2J6SA 2DH8A 5J1EB 4CQ1A 3FZBA 5EWGA 1ZM2A 1IVZA 1TK0A 3H4BA 3CMES 4OYBA 5DLGA 4EYHB 1KOOA 2RF2B 4NA2A 2MYFA 5LMUJ 3KWMA 2F9DA 3RR7A 1YSJA 1S76D 2WW8A 4TY9A 3ISZA 3OTDA 3LOUA 1H0HB 2UUCF 3PIOQ 2Z2MA 4RU9A 4LFCF 4UW2A 3ELHA 5G0RB 2M70A 1SJ3P 1ZPVA 2Z58B 4PRFA 3CO9A 2R7SA 1B3TA 3LANA 2E7WA 2LQJA 1CEZA 1TKZA 1SJFA 4EO8A 2DH9A 5LSRA 2K1RA 3OVSA 2BE7D 3DC2A 1R8AA 2J5AA 5KG2A 1C0UB 1AA1B 1SKWA 3J7A1 3AA8A 1L3UA 2UXDF 3FZ2A 4ZP7A 1OYDA 3BKFA 1WC6A 1FO1A 2A3JA 5HROA 2DRDA 1LV5A 4WK3A 5D0HA 3CJ4A 4Y2CA 2CQHA 2FYXA 3QZ8A 4KGVB 1I94F 1RP5A 2HBZB 4ZVQB 2VFSA 3O44A 4PG5A 3GIMA 3RB4A 3BBBA 1SJ4P 2GO9A 1D9AA 4IO9Q 3JXOA 4LQ9A 4DS4A 2LYVA 3A4TA 1ZM4A 3HJVA 1JLBA 2DD8S 1VQ4S 1LW2A 2WBMA 4OZNA 3OV7A 3ICLA 2PMZD 1U1QA 1QD1A 4Q2MA 1HYSA 2WSEC 3GONA 1ZTTA 2JNJA 5L1LA 2G2YA 4G6VB 3GFZA 4KB7A 2XC9A 5A0YB 4A8MP 2R8JA 2XNQA 2IYGA 1X5PA 1BXNA 2KZZA 5U47A 3ZC4A 2W9CA 2BJ7A 2ILYA 4UZCA 5E3PA 3V4MA 3F41A 3C2PA 4FYXB 3GWCA 1B0PA 2DY9A 3SSQA 2HNYA 1YBAA 2CA9A 4B9VA 1D8YA 4LR8A 3RAQA 4UT4A 2FHOB 1O8BA 1S7HA 3QGPA 4ZLLA 4C98A 1N0VC 4E8UA 1FJGJ 4ZA1A 2QN6B 3I96A 2A0FB 5KFUA 2NR0A 3K17A 1DRZA 4R25A 3KYLA 3TJAA 3W65A 1NMEB 4NRUA 1P9YA 1N6QA 4UOCA 4ZVGA 1F2GA 1FCAA 1RB0A 2RMLA 2XZTB 1VRQC 4X4OA 6AT1B 1J5OA 1SXLA 2ZHAA 3ZTSA 2PFFB 1FDNA 3HM9A 3IBCB 4M5MA 4DPWA 5HBMB 3DXSX 1HW8A 3MM6A 5KT3A 3LW5C 2YWHA 1RU1A 1T0TV 5T7LA 4DPOA 3GIJA 3VQTA 2HBQB 2A6MA 2UXDJ 3CCVS 4L76A 3G8SA 1GMWD 2V67A 3OXLA 4X64F 2LQ5A 3MM9B 3BQ0A 1ITPA 4M5DB 4QR1A 3LWLA 4ELUA 2FJDB 2FVRA 1RSCA 1X4FA 2CJYB 4PWWA 3T19A 2Z57B 2X7IA 3FSIA 2XNRA 2BE2B 4CLYA 3L9ZA 3IWXA 5L39A 3HULA 4IFVB 2G13A 3H59A 1BQXA 5IWAF 1EP4B 4DR2F 1RHMB 3Q8VA 4GKJJ 5E41A 4HR2A 2QV6A 1C0TB 2W2PP 4K4TA 4KAIA 3THPA 2A2DA 2V94A 4OX6A 2CNNB 2X3GA 4CLUA 1P6TA 4QWAA 2JDJA 3PXGa 2V2KA 4CNZA 1HQUA 3PZPA 2DRAA 1PBAA 4DL3A 3KG1A 3PM9A 1YJVA 1RCOB 2JEGA 3DOMA 3DLEB 1M5OC 3KHRA 2ASDA 1VISA 4DR1J 1UCNA 5D3GA 1KEKA 3DNCA 4OHXA 2LU1A 2VC0A 2ADCA 1VQ9S 1ZA1B 2ZH9A 3DOKA 2KM8B 2RS2A 4FNIA 3DRRB 2JJ4D 1C1CB 2BQUA 5IS2A 4NZ6A 1R43A 3BV8A 1R0CB 2HGLA 3A3PB 3M8WA 1JB0C 4KPYA 2KVIA 3C46A 1AXQA 3CC7S 3CJTA 5D15A 2KFZA 3I0RA 4HHUA 2KFYA 4X4QA 4ID8A 2HVHA 2Y0BB 1W26A 2EVZA 4RW8A 4IKAA 3CT9A 1Y0HA 2RNEA 2CPHA 2RQ4A 3NMAA 2V4RA 4ZVSB 1Y9OA 3OHBA 2OPRB 3BYPA 1RWOB 3RJMB 2KH9A 2NS1B 4HTIA 3VVUA 2EG2A 3R5GA 2J7KA 3I5BA 4I56A 1NK5A 1HW9A 2DGQA 2VHGA 3GJQB 1U1KA 2XB2D 3SMZA 4E0DA 1X5SA 3KKFA 3JAMY 2FC8A 1U24A 1U26A 2VU5A 2MGZA 3HP6A 2FUG9 3RYLA 4KTQA 2UZAA 2KXFA 5IQ6A 1UVLA 2Q79A 2FGCA 3TZXA 1MMLA 3MEEA 5IWAJ 1RE1B 4L3NA 3ILOA 3KMQA 4OYOA 1UVIA 4I2QB 3SXLA 5DDOC 3C14A 4MJKA 3CB4A 4FS1A 4NLVA 5ETKA 4YQWA 1SUQB 5A8KB 5DM7Q 2AJ0A 3GR0A 2QX0A 2IMOA 3RAXA 4RW4A 4B3SF 4TKTA 4DUYF 1ZAXA 4FXDA 3AJ1A 2VG7A 2J7UA 1VOMA 1WC1A 2HWTA 3PRDA 2ZOGA 2FJWA 2BJDA 1NKEA 3MTKA 4KE5A 3N0VA 4K59A 4OHVA 4FKXA 3T9ZA 5C25A 2PA3A 1WHXA 4DV3F 3VZHA 2KYZA 3I5AA 2EFNA 3NCPA 4C6AA 3KLHA 2VA2A 2W24A 4G1IA 5CZXA 2BDPA 4ZP8A 1T03A 5ETQA 2FPHX 3QLHB 1U0HB 3PJ9A 2VBXA 2YWEA 4YB1P 3C66A 3GSDA 4HT7A 3UN5A 2MQLA 3BO2A 3F44A 3CDAA 2W7AA 4I68A 4DCJB 2DGSA 4JI1F 2HHHF 3CCTA 3EVMA 3C19A 3FMWA 3W2VB 1Y5NB 2HS4A 1HD0A 3BREA 1WORA 3LAKA 2GJIA 2VG6A 1FVQA 3ILIA 2J9EA 4U96A 1QTMA 4PXDA 2LXFA 4O3QA 3M8QB 3J7Z5 2QLBB 2BJ9A 1GQEA 3P4UB 1PJ6A 3TA2A 4M5JA 3ETOA 3SIPB 4M95A 3W66A 2QSWA 4MIBA 4USUA 1WG1A 3T3FA 2VG5B 3DYAA 2HFUA 4F4KA 3NS6A 4ZPAA 1S49A 2DGXA 1T11A 3T41A 3MM7B 2JSXA 4J9KA 2ZZTA 1N56A 4ZN1A 1N32J 1ZS6A 1SKUB 2VICA 1T3OA 1SQEA 3MUVP 1ZAWA 2LQBA 4FDFA 3LP1A 2WTFA 3CJ2A 5EUHA 4LRCA 5I3QA 4C0HA 1CBKA 4KGKA 3RTVA 2NCKL 2DBBA 2GIQA 3H2VE 1JJCB 2I5JB 4NA1A 2D3OR 1TAUA 2V5HG 4DSJA 3BQ2A 5HJYA 3MMJA 4WFYA 3TR5A 5HANA 1YRXA 3IRXB 2PA8D 1U1NA 2CJ9A 2EWHA 2DPIA 1NK0A 3GIIA 1JLQA 5CYMA 5JMNA 2B9XA 3IMQJ 4X4VA 4ZLPA 2ZH3A 4BC7A 4O4RA 3KJVA 5LM7E 3I6PA 4CCHA 1NB2A 5I4MA 1VQMS 2JEIA 2FVCA 4NXMF 2M8DB 2VB6A 4URGA 1M5PC 4A4JA 3ZFVA 3O8WA 3NAHA 3KLEA 5HQLA 1JKHA 3ILLA 4C8LA 3P3DA 4K2XA 1FTCA 4IRKA 4JI1J 3LALA 3KNAA 4XDCA 3MEDB 4PG4A 2HFNA 2ALYB 4NCGA 4DR7J 4FBUA 4JI7J 5IQQA 2XCPA 2XMAA 1KQGB 3OD2A 1TFYA 1I3OB 3IR5B 3A1YG 5F8GA 5IT9U 2DXFA 1RCXB 3ENAA 2M52A 2OTJS 1YJ7A 3N01A 1S9GB 3PDNA 2E5LF 2Q3PA 5BJRA 5D8HB 5IFMA 2GW8A 4CYUB 2CQIA 1NK7A 3QSYB 3TP2A 1RACB 5D4PA 3AB4B 2RDJA 5DLFA 4NXNJ 2W2QP 3OT9A 1FJCA 1PKUA 5F8IA 1X7VA 2ZVIA 3Q8QB 1LWFA 5KG6A 4OZ2A 4OX9J 4JYAJ 2KJVA 4P72A 1SL2A 1X60A 2XYGB 1HFEL 1U6FA 1TAQA 5KFSA 5ADZA 4FYDA 3LP0A 1CS4A 4TVAB 3P8BB 3CCUS 4AUKA 4IG3A 4N76A 3A8KA 4A8XA 2I0XA 2LA6A 3QAUA 2LFVA 3J81U 2XZWA 1JXEA 4YDXA 1NHVA 1RBOB 2FIUA 4U6PA 2DNQA 3AAWB 1G1XA 4UUWA 3NL0A 4WTOB 5JJBA 2AZ3A 1OIAA 3HXMA 3BO4A 3TNVA 4TQRA 1N52B 4K2JA 5M2PA 4C9DA 2GQQA 2IDLA 1JLAA 1Z2ZA 1LOUA 1IQZA 1UJ6A 3R5AA 1CJVA 2C42A 1RT6B 4P71A 4FNHA 4HACA 3Q89A 2UUAF 4B9SA 4W90B 1SC3B 1S6UA 2BM0A 2ZJPQ 1SB6A 2CUYA 1BY9A 3ET6A 3CD7A 1OYEA 5ETPA 3M2RA 2Q43A 2AGPA 3H0PA 3CCSS 3SDEA 4LF5F 5A8RB 1Q8KA 3TEHB 1HBOA 5H9FJ 3PTWA 4CDIA 2WVEA 2JVRA 2QE5A 1V5IB 2HMIA 3FFIB 5C7PA 2PFDA 2W4PA 4CWBA 5CD4H 4ZDNA 1HI0P 3VF0B 1WTBA 4KV8A 1JLBB 4ID5A 1MU2A 1NK4A 3T1HJ 4AQYF 4N77A 3G86A 1R8CA 5B09A 3IR6B 3HHNB 3HX9A 3OFFA 3PX0A 3MZIA 3R7NB 2MQQA 1M1GA 5DZ6A 3CCJS 1DTQA 2MQOA 2M0GB 1S1TA 1OSCA 1JJ4A 2CPXA 5FLXU 2HQ3A 4DX8H 1IR0A 4MMOA 1YLXA 2MJNA 1XC9A 3WX4A 3NS7B 1H72C 4RW7A 4DMZA 4ZOSA 1RWWB 3SI8A 3PJXA 4F50A 2CYYA 3ENVA 2GX8A 5BR8F 3J80U 2J9DA 1E6VB 2VDIA 3GG0A 4WF9Q 1S4FA 1HHQA 5KFYA 3M30B 1HPZA 2OMLA 3LGHA 1R7IA 1FWKA 1YRTA 2F63A 1J5OB 2YY3A 3MAQA 2OEJA 4F2SA 3SQOP 3A8IA 1WC5A 2GMJA 2HZAA 4AL7A 2GZOA 5KFGA 2E5IA 2MB0B 4NPOA 3UPFA 3K5PA 1NNDA 3QJJA 3TZYA 3KHLA 2KYXA 3I31A 2C3OA 2ZFHA 1JJHA 1VFJA 1JQGA 5T7LB 2EXUA 4LFAJ 2IM0A 1TZ0A 1TL4A 4QR2A 3JSRA 3DGVA 2P6TA 2F65A 4IH7A 2HZCA 3N4WA 5DQGA 1BD6A 1L3TA 2YQ0A 5SUHA 4F3QA 3OVAA 1JLFA 3HVTB 2HPUA 3MR6A 1ICEB 5CQGA 3CJ0A 4NLXA 4K50A 5E2QA 4X65F 3VQSA 5E7OB 1JIHA 1VS3A 3GE9A 4Y00A 2HS3A 2XWYA 1U49A 1FKPA 3GJSB 5GAEI 1WSRA 2BXJA 3G71S 3ITHA 2L41A 1PYSB 2ZH4A 1U1LA 1S1XA 3ISND 4X4UA 5I3UA 3V6JA 2DNOA 1KWMA 3WC0A 4F0HA 5C24A 1Z1ZA 1DAXA 4DV7F 3AOBA 3GPAA 3PHEA 4EK2A 1NK8A 4OZJA 2HYIB 3BGUA 3MUMP 3G82B 3H4DA 3UN2A 1HQUB 2ZH6A 5AXNA 1OY8A 1R8HA 1VJWA 3ZXWA 3KUGA 1AW0A 2L9WA 4WP8A 2MLYA 1Y5IB 5KFDA 2HNDA 2RAQA 4F4WA 4Q45A 2PMWA 2J76E 1M5HA 4NMXA 3D3CJ 2V34A 1NPKA 5D3GB 1VI7A 2W9BA 2VQEF 4W98A 3HO1A 3EMTA 4MT1A 3W61A 3DOKB 4OYIA 4NZ0A 5AT1B 2PEBA 2KXNB 4I69A 5D77A 4CT8A 1F9EB 1QJHA 2VPWB 4P73A 2VASA 4A8KA 2AYEA 2CQCA 2CPIA 1MSWD 4HHHA 5KFQA 4QZVB 1NZAA 1BQMA 4M5HA 4OHYA 3ILJA 3QYYA 5HQ8A 4QWDA 2KRBA 1X9WA 2KRRA 4FS2A 3CC4S 4UOFA 2FZKB 2E5JA 2UV8A 4ED6A 4PG7A 4CLSA 1CJKA 3OR2B 3M2UB 1CQMA 3TX0A 1NJXA 2ASLA 4ILMA 2ZKTA 2IAJB 4N8NA 3T6JA 4F2RA 4WKYA 3IGNA 4DXLA 3UDEA 1PC5A 2VKRA 1RUSA 4FVMA 2XMKA 4FPIA 3C6UA 4P9SA 8ATCB 1X0FA 2EK6A 2PI5A 4ED1A 5LL6d 1YKWA 4USTA 2HQIA 3IM8A 4CP5A 4X65J 1XNRF 1RHJB 4DDFA 4NLTA 5J1NA 5HLFB 4Z7CA 2AU0A 4Q0BB 1U45A 3EUNA 4K4XA 3OFEA 3FJ2A 3VCDA 1PJ5A 5F8HA 4HYKA 4J9PA 1T8EA 2LEBA 5THWA 5ITHA 1SKSA 1S6PB 3OR1A 5KFZA 2Z56B 1NSKL 1AUSL 2R2RA 1FNXH 4RNFA 4ZJQA 4CIOA 9RUBA 2Y8YA 5A6PA 4WE1B 2UUBJ 1F3VA 1TVRA 3OBIA 1QAIA 3G96A 3W62A 1YJNS 2VG7B 3RZAA 2CQ2A 2PSZA 4ALZA 1TKTB 4LR9A 3UWTA 2B6AA 3IWNC 2ZDOA 5HK4A 3AH6A 1HD1A 1I51B 1S1VB 4DLGA 1VC5A 2QL9B 1FRHA 5CH7B 4NEZA 2NSCA 5C25B 2N3LA 2VQEJ 3BEGB 1RAJA 4X4SA 5CCMA 2UXCF 4GMKA 3EJMA 3CIMA 1DTTB 3EGZA 1KP6A 4O0NA 1NKBA 1WOOA 2AMCB 4IRCA 2YWFA 4O4GA 1T03B 3I55S 4NI2A 3SCJE 2DVIA 5L8RC 3JTOA 4USJC 2YX4A 4N47A 1RJJA 4I6WA 4OX8A 4QW8A 3BZQA 1UL3A 5A8WB 1L3KA 2NXJA 3KK1B 3RB0A 4CT9A 2ZD1A 2HWHA 2HKEA 4Q8EA 1RT5A 1IN0A 1C4AA 3TUIC 4EI2A 2K06A 2IA6A 1V9OA 4JOUA 1TL5A 5KT4A 3QWPA 2DNKA 4PQAA 1EX8A 1NBEB 4CO5A 4ZHRA 3L7UA 2I38A 1RAOA 4XPEA 4QBUA 3B4MA 1X5OA 2OP5A 1R3NA 1HWKA 1B99A 2V8GA 2ZWOA 1NO8A 5L1IA 1V3SA 3WIUA 2A6OA 2DH7A 3HKZD 3DYAB 1Q7YT 2B9WA 2F4VF 1OQ3A 4ED2A 3BH6B 2AKWB 3ZTOA 4IOBA 4QYRA 1N8RT 3MD3A 2Y8WA 3MR2A 5CYQB 2WONB 1CLFA 3LUYA 1IBCB 4UUXA 2HQDA 2RDIA 2D69A 3JTNA 4DWIA 4IG0A 1NJIT 4DR3J 1Q16B 4YOEA 3M6VA 1FVSA 3CXCR 3IWLA 1S99A 1RBAA 2RKIA 3B4DA 2PGCA 2R7TA 4JV5F 4OI6A 3AA9A 2DNYA 3EDRB 5HAOA 1WHYA 1MN9A 4LBHA 2HHVA 3KK3A 3AJ2A 4PG8A 1KVIA 4FF3A 1LXJA 2OPQA 4B3RF 3CDUA 2D74B 2HSEB 4F4ZA 1Q4RA 2MKKA 2ATLA 4JI0F 3ZO7A 3H2UB 5IC6B 1JLCA 1IKYB 3M9MB 5CYMB 1BUXA 4JV1A 2NLWA 3GILA 1ZAVA 5M2UA 3KJVB 2XLKA 2MPUA 3M2VA 1FDBA 4PWDA 4NRTA 1FX2A 1MMNA 1UVMA 2MJUA 2MEWA 1BWVA 2Q6CA 1T05A 3DFEA 2DCUB 1JKHB 3HD2A 2OTLS 3JSYA 3GCWP 4LSNB 2IC3A 1K44A 3MURP 3BPSP 2DKOB 1H7XA 5DQIA 2W2MP 1J5EF 2UVUA 4QR0A 3K0JA 3IR7B 4DSLA 4LF1A 3LF0A 3MPUB 4DFPA 2LDYA 4X62J 4WYLA 3M32A 2MY8A 4QPXA 3OLBA 4AXIA 4BCAA 1K47A 1FK9B 2QT7A 1VGYA 1HWJA 1VR6A 4ECWA 1VRUA 1OSDA 2YNFA 2VC1A 4DF8A 2R8HA 2H5EA 3OL7A 2QFIA 1WKJA 3AD7C 3NMRA 4QCLA 3AQPA 3ONQA 2LP4A 3BR8A 2KI2A 4LF9F 2KO1A 1VQSA 4KO0B 2GVZB 3NGRA 2HIYA 2EFVA 5DGBA 1WOSA 3E3XA 3KTQA 3KNGA 2HQFA 4AD6A 4QW9A 2CJAA 3ZNJ1 1Q5YA 1YHQS 4JV5J 4CM0A 3LP0B 1CS4B 3JSMA 2VODA 2XEXA 4ELTA 1X4HA 1OQ6A 4TU8A 2HBRB 1RTHB 4NOHA 1U25A 1Q95G 4MKAA 1GNKA 3C6TA 1R89A 2BW2A 4L73A 3D6MB 2Y1LB 2V68A 3BSNA 4G65A 3WQPA 1HI1A 4DV6J 5IOLA 4R0JA 4DV0J 2IDEA 1JXLA 1S1WA 2LVWA 3VHQA 3A3NB 2XYPB 2U1AA 3R2DJ 1JLAB 3QBCA 4B08A 4B3OB 1IBMF 4WZMA 1AUDA 1F9FA 4JV2A 3M8RA 4CTAA 4HACB 2G9OA 1QAXA 3OSPA 1G4CA 1AYEA 2ZZMA 3KLFA 1FXLA 2OUGA 1VQ7S 2B5JA 2RDDA 5D0EA 2LQ9A 1S1UA 1NU4A 3N5BA 4DR5F 1Q79A 4QWEA 1QSSA 4EBCA 2OPPA 2FY1A 2AIRB 2ZBCA 2MQ8A 3B78A 7FDRA 3FKBA 1U6BA 3F56A 3NCQA 2DNGA 1M1KT 2HHTA 5AXKA 4KV8B 3V4IB 2H5JB 3D54A 5CD4A 1EAYC 4RZRA 2AZ1A 1DLOB 3TUZC 2Z2ZA 2H48B 3UFCX 1LW0A 2YQ3A 1U8SA 4QYZJ 4MK8A 2YKAA 4YB5A 3MMCB 5IT9Y 3CCES 2DK2A 2E1AA 3L3CA 3R6LB 3OTEA 1DJ0A 3CD5A 2ADBA 1RXOB 1FERA 3OXGA 3QO9A 3ETMA 5AJ3J 2BJ3A 2EBEA 3G8QA 4ECRA 2BANA 4Y2MA 1AZSA 3TAMB 1RT7B 4CLWA 3C16A 4ZK7M 2MMYA 5D6GA 2DNHA 2ROPA 2XMWA 2OSQA 4ES3A 3W2WB 1QE1A 4OYMA 4E98A 4DS5A 3N79A 1XWLA 3CD6S 3D68A 1HPZB 2C1EB 3MDFA 4OI0A 4PG6A 4KKOA 4F0MA 3I0SA 1GMUA 2QTWA 4PXBA 5H9FK 2ZC3A 3A3OB 3GB0A 3VAFA 5GAEU 5DG8A 1ROFA 5K20B 3CEDA 3BYRA 4NLGA 3JAMU 3PR5B 4NMLA 1WWHA 1IKXA 4LF7F 1XJWB 3BSOA 7FD1A 3J81Y 3LA0A 1QSLA 2GCFA 1F5AA 3EDQB 1KONA 3V2UC 2MLXA 3CTRA 2HNZB 2AEJA 4RX6A 3MECB 3ZZZA 3CULA 2XBPA 2DNZA 5L1KA 2W01A 3K7RA 1HQ2A 3PV8A 4F02A 2VDHA 1TMMA 1TUWA 3SEOA 1FESA 4A46A 3V5RA 2VZ9A 5ETRA 2JOQA 3BKTA 4ZPVR 2K7KA 3T5KA 4PPDA 1RI7A 1RADB 2R7UA 4N8OA 2IY5B 4NCAA 2E7VA 3MM5B 3K5MA 1HQEA 1TV6A 1UTAA 2FHJD 1RABB 5CAAA 2YNHB 3R7SB 3QJPA 4QJVA 1CJUB 1R31A 3E01B 1WKLA 1T95A 4N5SA 4ECSA 2C2RA 2OPSA 2MHNA 2F4FA 2J9CA 1R0AA 3CC2S 3HK2A 3R1HA 4LVNP 4ITSA 1PO6A 4AXJA 3QGGA 2XO7A 1KTVA 2WCXA 3HHEA 3HVAA 1O51A 2UU9J 3UVJA 1UFLA 1AROP 2KT2A 2DR5A 4FYWB 2W9BB 4H4MA 1Y5LB 4B9TA 3W3SA 2GVDA 1KLMA 3NGDA 4CZCA 1HARA 2JLEA 2VONA 4X66J 4FZVA 2FLPA 4ZLNA 4ER8A 3M8PB 2F3JA 4WBFA 1M90T 2H3EB 2RS8A 4QOTA 1VK3A 2RVJA 2B0GA 3IM9A 2C2KB 3J7YI 2JHEA 4NLYA 1HI8A 1CJTA 3I82A 2J0QD 4ECTA 3OLAA 4K0KF 4CH1A 3GZ7A 3U7JA 1NZ8A 2DO0A 3AOCA 4YEAA 4DL5A 2QL7B 3MMBA 4MKVA 1ZYQA 2ZNZA 3J80Y 1TR0A 3HZGA 2YQ1A 2MHEA 1M5VC 4V19X 3EXCX 1I5OB 2DRBA 2P2CB 4GC7A 4FN5A 1HBNB 1VQ8S 3HI9A 2V69A 3FDSA 2HVIA 1D1UA 3V6HA 2K3IA 1F6TA 1TK5A 2D9OA 4ZPTR 3BO3A 4B3TF 1S9EB 2Z4PA 4YHHJ 2XM3A 1K8AT 2NXCA 2IMWP 3DI6A 2Y1JA 3K8VA 4ZMMA 1EJ7L 2JLGA 2OFHX 5IXUA 4IFYB 4DX7A 1N34J 2R4FA 1HNZF 1IBLJ 3IS9B 4J9RA 3MI7X 2EBGA 3QT8A 1VBXA 3OR1B 2VOPA 4K5SA 1BHNA 1NJWA 1HR0F 3DRPA 4Q8FA 1LK5A 1LWXA 3TO8A 3NKYA 1N33F 4HDHA 2EEYA 4DUTA 3TOQA 5KOXA 4ZVFA 1HBUA 3G87A 3CCZA 4LSLA 2CJQA 3AD8C 3Q2SC 3EVWA 2QLJB 1IKVB 2RU3A 2B6AB 3MCSA 1TL7B 4DR4J 3ZZUA 2QLFB 3TVKA 4YFUA 2RRAA 2VIHA 1W2BR 1EIYB 2YPYA 4CNYA 3HVRA 3E51A 1SV5A 4PZVA 3KLVA 3TJ8A 4KGZB 5L1JA 4KFBA 2XS5A 2DIUA 3SYZA 1UAWA 1URNA 1ZA2B 3T5LA 3HHDA 1TMJA 1MNEA 1RAAB 2I9SA 1WACA 1H6KX 4OFZA 4YB6A 4J9VA 4ZIWA 1VQPS 4M5KA 1YZ7A 2OD6A 3M9NB 1PJ7A 3JSBA 2CJXB 3RB6A 2ZD1B 2JZ5A 1YVFA 2WVFA 3RU0A 1XIQA 4CH0S 3AHPA 3V81A 2VL1A 1XMQJ 1K1QA 1RTJB 4C97A 4J37A 3CJKA 5KFLA 8RUCA 1ULRA 1UA0A 3CCMS 2VUGA 1ZM3A 3UDVA 3HHLA 2VBWA 4U7CA 3KXDA 4ICLB 2RD5C 2HHSA 2JC0A 1JLEB 3NG8A 1RWMB 3T5JA 5I42B 3HSZA 1FFWB 4BS2A 3K8WA 1RYRA 4HI2A 4EO6A 4QIVA 1QM9A 2WSCC 4U8YA 1G3OA 5EWEA 5J2NA 1SKRA 1LWEA 4Z2XA 3M1VA 2DR6A 1RT4A 2CPDA 3X3UA 1N5YA 1MLAA 1T3NA 3HF5A 4P2MA 4GVLA 2M3DA 3VGTA 1HNWF 2HAIA 3SZ2A 3UD5A 2P6SA 2RQMA 4ANEA 3IP0A 1K9MT 2VFTA 2XS2A 2N4CA 1HWIA 4GO7X 5A2QU 3FCHA 1H7WA 3OUYA 2AYBA 4ILLA 5GMKa 5K8PA 4NZ7A 4WPAA 3OTBA 3OVBA 3WC2A 4RO0A 3RW6A 4FXVA 3KK3B 1QVGR 1M1HA 3DHXA 1N5QA 4ZVUB 5GMDA 4C4WA 2COLA 4ZVPB 1Y10A 1VK8A 4HEA9 3MFIA 1UEKA 2B4OA 3QSIA 2X1BA 4FKYA 2HHQA 1URRA 2ZUAA 5F0WA 3OTOJ 1NLKL 5HJXA 1HNXF 2LXIA 3OW2R 5GAGU 1WOPA 1RHRB 3PJWA 1EETB 4PWDB 5KT2A 4JI3J 2X1GA 3GV5B 1NDKA 2A1BA 1RAGB 4DR6F 1T05B 1F9HA 1IKWB 4ANCA 3TX8A 3IA0A 2ATCB 2YWGA 2BJEA 5E3QA 4RW9B 1TUVA 5DS7A 3SCIE 1FKOA 4OI2A 5C2GA 2IHR1 3NXZA 1ZM9A 3PFEA 2HHWA 2JRSA 2G4BA 1LWCB 4DPYA 3MEGA 2XYHB 3NRBA 5HL7Q 1UVNA 1X9MA 4K7QA 2JFDA 2V8HA 2AD9A 5GMEA 2UP1A 4J9OA 1YQHA 4NLSA 4KYZA 2L48A 1NH8A 3M32B 5C42A 4UF4A 3GFHA 2G2ZA 1L3VA 2R7WA 4M8LA 1HBMB 1EZZB 2DNMA 4MFBA 4WIQA 2HFOA 3I4HX 1IWAA 1UWBA 3DLLQ 1U4BA 2V9KA 4IDKA 4ECYA 5B0AA 4L74A 1X4CA 3GYXB 3D5MA 2VBZA 2ABYA 4CO0A 3MF5A 2ROEA 3F0NA 1GX5A 5EGYA 1S5ZA 1Q53A 2YWKA 3LO3A 1RWVB 5IV4A 2MY7A 2NUUG 3QIPA 4NLPA 4EFAC 4C0BA 1VBZA 2VPZB 5HI7A 4C48A 2GFFA 2RIJA 2AJFE 4LJMA 1MWZA 1VQYA 2WVDA 4I6YA 2QSFA 4K4WA 2W4CA 2E9ZA 3SCLE 4DQQA 4A48A 1N36F 4F3OA 3JYTA 2D41A 3QIDA 4JI8J 1RDRA 4A8SA 1Q1KA 4ENOA 1UETA 5RUBA 1FNOA 2L9DA 5KT6A 3S6EA 5KOWA 3FRYA 2YKNA 1JNZB 2VOOA 2JWNA 1NK9A 1XNQF 2WOMB 1GK8A 3BB5A 2XY5A 1N4LA 3TAQA 2G1DA 4J9UE 2ZOMA 1WKKA 4YMEA 4I2PA 1FD8A 4QWCA 3EICA 3ZTPA 1GXLA 1U02A 1H98A 2LXUA 2UXBJ 3KLFB 2KVQE 4LSZB 3U27A 3G6YA 3CPWR 2B5JB 4IR1A 4JI2F 2RJZA 2FJAB 1S1UB 4MKYA 1WF1A 2J8AA 2ZBIA 3PX6A 5B0EA 5HVGA 3POTA 2E1CA 1Y11A 5J2QA 4B02A 2OPPB 4DV2J 3W9JA 5ETVA 1MROB 4ZS6A 3GJRB 4JUZA 3DHWC 4KY3A 1X4EA 4EBDA 2DGVA 3IN5A 4O3RA 4B3MF 3D28A 2XSJA 2YPZA 1WI8A 3BBFA 3L95X 3MCOA 2RU9A 1HNVB 1GEHA 3QJLA 3PCOB 5IM0A 4LUBA 2HRUA 4XAKA 3G6XA 1HNIB 4RUHA 1FXDA 2DR9A 1A0OB 3JQJA 1W7WA 3HFZB 1R0BG 4O3PA 3HHLC 3UE2A 5J2PB 4XO0A 2LLZA 1KRPA 3DKDA 4W4MA 2MZTA 4X84A 4NLRA 3QO9B 4TNOA 2RF2A 2BANB 1SIZA 4OLOA 2YKOA 1SQGA 4YUDA 1MW7A 2B43A 4QU7A 4ZJOA 2DT9A 3PR4A 3DLKB 2VBYA 1P1LA 3ZTQA 1FDDA 5G0RA 4M5GA 1F0XA 2E1PA 3DLGA 3K5OA 1VLYA 2AV5A 3BKUA 3KHHA 1D0EA 2X51A 4DL7A 2D3UA 4AL6A 3UNYA 2R7OA 5GAHU 4OLPA 3SSRA 2V2VA 2WRMA 1HWLA 4HTJA 5KFCA 1OY6A 2UUCJ 4LFCJ 1N36J 1OPZA 2O66A 1B7YB 4RLEA 1C0UA 1Y3KA 4AE5A 5C5JA 1XERA 3M6UA 1RISA 2KN4A 2P8IA 4UTGA 2HW3A 4DG1A 5CXTA 1CVJA 2NXEA 4CLLA 3KJQB 4I6AA 1NK6A 4OQJA 5CYJA 1F5BA 3IG1A 2I1RA 4TXSA 2BJ1A 2HFZA 2XLJA 2OKQA 1EB0A 4L3KA 4WJBA 2QA4S 4P52A 1CG2A 2MSTA 1ZPWX 3NCRA 2CRLA 1RWNB 2MKHA 2ZBPA 3ADAC 1G7CB 5E5NA 2PE8A 4PABA 2MQNA 2LEAA 2BW7A 4QQBA 4QYZK 2VFVA 3VWSA 2FJVA 4ETXA 2AW0A 2YNIB 1YJRA 1I94J 3TI0A 1NAQA 3T5HA 1NCLA 3GIRA 3JS9A 3FSYA 3GIKA 2GNKA 3DM2B 3H98A 3CJRA 5F41A 4DX6A 2HS0A 5KT7A 5A0YA 3UCUP 2DNRA 3D0IE 4ED4A 1RTIA 5AE3A 3J7YU 2JC1A 2OPSB 4TLRA 3SQGA 5F8JA 3J81j 2OLWA 1UEUA 3M4XA 4PUOA 1NSPA 2FJXA 5DETA 4ZKAA 5BYQA 3DLJA 1RWUA 2E44A 3SBMA 3ULHA 3CJ5A 2BACA 4GKKF 3I87A 3B54A 5KFNA 2B7BB 2GVDB 1KLMB 1MG7A 1SIWB 1HMVB 2MSSA 1CQNA 1SBRA 2V4JB 2ZJRQ 2CPZA 2N7YA 1KC8T 2AT1B 5FDLA 2O5DA 4HH0A 4DV4F 4V19J 5HBMA 4DV5F 4FBTA 3Q83A 1RA6A 4LF6F 3RW7A 1N5VA 2RHSB 3VALA 1ZOTA 3MMBB 2QG9B 1IUJA 1Q7LB 4G1PA 1RU2A 4WTYA 4K4YA 1A6LA 1OPIA 5MLCV 2FVPA 5LSOA 3MM9A 5EHHA 2J0XA 1VC0A 2IJFA 4M5DA 1JNRB 3PKYA 3MR7A 2C3PA 3DU5A 2CNKB 3DXBA 2QGFB 1REVB 4UQTA 4YY3F 1KKHA 4O3NA 1T7PA 5HATA 4DQIA 3UO0A 4HL9A 4X64J 2CWXA 2YWWA 4J5OA 4P6QA 2BE2A 2YTCA 2QC3A 3VAHA 5D0RA 2XHCA 1FI4A 4R8UB 1RTDB 1E6YB 4RW6B 3OJUA 4TQSA 3Q8PB 3P49B 2R8GA 1FEEA 1C0TA 4AYBD 1GTHA 4MYTA 3UCGA 1NHUA 4DR2J 1RT2B 1T9YA 2G0CA 2JFKA 3PO4A 1S97A 1PAUB 2QIFA 3KUEA 2EI5A 1TP7A 1DY3A 4UY85 3W64A 1FRLA 5K14B 4M94A 3CJ3A 1HBUB 3AXMA 3CJQA 2ZE2B 4LSLB 5F8LA 4U7UD 1N5SA 1T9WA 2DNLA 3IO1A 3T9NA 2ZITA 3KLGB 3DRXA 3MOZA 2Y0SD 4BDPA 3DRRA 4JI6F 1C1CA 3H25A 3A8JA 4O44A 2LKZA 2DGWA 4H54A 3B8HA 3FEZA 2N3OA 1SH0A 4KGXB 4DUZF 1XMOF 4BWMA 2I2YA 1WUUA 1V3RA 1SJRA 3TA0A 3Q8RB 1CPZA 2JEFA 2QLWA 4PKDB 2NQPA 1Q86T 1REGX 1RLDA 5LJ5Y 3TQ1A 1DBDA 3G9CA 2BUNA 3MXHP 2J6TA 2MKCA 2QO3A 3A13A 1FEHA 4ZP9A 4DZDA 2FZCB 2E1RA 3EGVA 3VAKA 4J9MA 1DQ8A 2OPRA 1TTHB 4DL6A 1BGXT 4C11B 4R5PA 3IRWP 4FVCA 4PQUB 3AXKA 2ASJA 3D1OA 5LMNF 3BS9A 4USVA 4EZ6A 2E66A 3V6KA 1XR6A 1SQFA 3M6XA 2X1FA 4YY3J 3HHLB 3QRQA 2WZ1A 3GQCA 3WX8A 1NHKL 4ES2A 3TWZA 2ZEJA 3I56S 3NGSA 3DMJA 3P5BP 3DGPB 2GGPB 4KIAA 4LF8F 3NWRA 2NSBA 5J2NB 4IQXA 4I2QA 1LWEB 1KQFB 1QAJA 1UA1A 2V50A 2BKNA 3QRRA 4N7TA 3UDCA 1SUQA 2IPOB 5A8KA 5KTQA 3MM8B 3L09A 1NRKA 1X4AA 1S4EA 2DHXA 2X3DA 3R5CA 2LU2A 5F3TA 3K57A 3N6MA 1JXVA 4B3SJ 4DUYJ 5K8OA 3HCXA 1KSPA 4YDDB 3LGMA 2A18A 1S6QA 2P9GA 2V0NA 3I9ZA 3CW2C 2V8VA 1PYTA 3PO5A 2KKHA 1FWPA 5KG7A 1ZTWA 4OZ5A 4LRFA 1C1BB 4ATNA 3NGTA 3TJ9A 3IAS9 4EZ9A 4DV3J 3HMJG 3Q24A 1U0HA 2EW9A 4ZCMA 2AWZA 2ZH2A 2KU7A 4USKA 4URSA 1TKXB 4ZJLA 2BVZA 4LF4F 5LT5A 4OJGA 4K5RA 1IM6A 3RAMA 4F25A 3TVZA 4WXOA 2L3MA 4NX9A 1FA0A 3K5NA 2HLTA 2LA4A 4OZ1A 2ASYA 2HZVA 2AJ2A 4UY8T 3W2VA 3L7PA 3MAHA 1FKOB 4MH8A 3NBPB 2CQBA 4M63A 3T1YF 2HHHJ 1TQLA 3MWBA 1MN7A 4EWTA 3M8QA 2B4UA 5H9EJ 1KFSA 1KS2A 5B08A 3DOLA 5E3AA 1XMBA 2CPFA 2DGUA 4F4YA 2Z0GA 4EMDA 2VG5A 2AEFA 1R27B 3PW5A 3HSGA 3H8YA 5F9NA 1K0VA 1ZBTA 3MM7A 5HMZA 3DRSB 4MFBB 4I7FB 1TKDA 5GADU 2B9EA 4RNOA 1YBTA 2G0JA 4DU7A 5KFMA 2MKSA 3MMAB 4WFZA 2AHOB 3BSAA 3WZ0A 1QSYA 2F1FA 3FBFA 4TY8B 4ZIVA 3I5CA 4KHMA 5K9FA 1IM4A 1F5CA 4TU7A 2UVVA 3G6ES 2XI3A 5LMUF 1GXUA 3AY0A 1NPRA 5T41A 1SVDA 2E5GA 2J7WA 2ZH1A 5H1SV 2LCWA 3QIPB 2HWIA 4AL5A 1BQNA 2RUGA 4OX7A 2XMTA 2DIVA 3CCLS 4HKQA 3ENQA 3NOGA 2I5JA 4W92B 3OXFA 2CJBA 2DB1A 1Q5VA 1OY9A 2RT3A 3CCQS 3QT5A 4LBIA 3A12A 3D9BA 3IRXA 4MK9A 2G2OA 3JB9k 4WXWA 2V8DA 2RB7A 1QTNB 5A2QY 2VV5A 4KR0B 1TKZB 2QLXA 1L5UA 2H51B 2R7XA 2K1RB 1VQ6S 2PMHA 3FNNA 1TELA 4MTPA 3RG6A 2CIMA 1XQIA 2CZ9A 2KM8C 4I1TA 1YJUA 2EKYA 4LMZA 3D1HA 4Q2LA 1DARA 4NXMJ 2JL9A 3MEDA 1P8GA 3C15A 1M5SA 5B0CA 5HROB 1JJ2R 4HH1A 2WB4A 3GYNA 3H5YA 3QMQA 3POTB 3T1YJ 1B0TA 3U1NA 5B0DA 1MWYA 4KBIA 4J91A 1S9GA 4OJHA 2AGQA 2BABA 2EG1A 4U9RA 2YKQA 1W2IA 4ZP6A 2ZH5A 2AGOA 2HGMA 3KG0A 4CYUA 2WVBA 3R5DA 1LW2B 2E9RX 2WVCA 2NYIA 4C8MA 2E5LJ 2BYCA 3D7SB 3PY8A 2DR7A 3GCXP 1UVKA 2J9DE 1HYSB 2Y1RI 2MZQA 4FYYB 1A9NB 2ZJQQ 1KQSR 3OFHA 4CH7A 3H90A 3I4PA 2W9CB 3MOJB 4KC5A 2HHXA 1FJGF 4Y6IA 3FCVA 2HNYB 4FP9A 2ZHBA 2WB1D 2CDRB 3CMQA 2XLIA 1Y4ZB 5F0UA 5K5MA 2XTJP 4ZPCA 2VFUA 3R5JB 4P75A 5HQMA 3TEGA 1NDPA 1NJZA 3JQMA 2DXEA 3DLGB 1PILA 1XK8A 1ZETA 1N6QB 3UCZP 2C2MB 1H74A 4EGLA 3P96A 4MIWA 1Z2LA 1H3DA 4P7TA 2O01C 1YJ9S 3AB2B 4MAKA 1YWXA 2V2QA 1RT6A 4DG1B 5HMXA 3MM6B 3QQCD 4ZVHA 5ETOA 3FSXA 4IH6A 5C2CA 1EHWA 3IG1B 2QYGA 1VHIA 1U8WA 5A8RA 4V1Ak 3ZZRA 2UUAJ 3G6VA 3ZZYA 4USHA 5E3CA 2CZVC 2XY7A 3FFIA 3VAIA 4LF5J 1VQ5S 2P9CA 5M2RA 2CFXA 2MZRA 1KTQA 4IQMA 4LIWA 4GKJF 1VQNS 3AJDA 4MYUA 3MPDA 2J0WA 3RRHA 1LK7A 1EKSA 2ZOFA 2BEFA 6FDRA 1RTIB 1D9FA 4M5IA 3PIPQ 4AQYJ 3PYFA 1PYOB 1YI2S 3SQGB 3G2XA 3TANA 1RQ0A 2QEXS 2FGOA 2HHUA 5L38A 4DR1F 2KHCA 4PUOB 1LXNA 4TYAA 1MMDA 4ZLJA 1RAIB 3M9OB 4ANDA 4XTTA 1YDLA 3DOMB 4JB8B 1Q78A 1RT3A 3VAGA 3EGWB 2W1BA 5F3ZA 3MGJA 1N88A 1FWLA 3AFGA 2GA7A 1E6VA 1PAEX 4P2FA 3HZEA 2LMIA 3HSDA 2OAUA 3M30A 2ZH8A 1TL3A 1WELA 5KFOA 2R8IA 2KT5A 5BR8J 5HO4A 2V9WA 3OJSA 3CDEA 4GVBA 2EK1A 5FDLB 5KAKA 2MZJA 4RU2A 2C2DA 2ZZNA 2FLNA 4HHJA 5E3RA 2FD2A 1NKCA 3GU0A 3I0RB 1WEXA 4RW8B 2C2EA 1D9DA 3IFEA 3MEKA 2DHHA 1RHQB 2CAJA 3HVTA 2RUSA 4NYOA 3GSIA 1WF2A 2HQCA 3L4BC 1RGVA 1R6VA 2GMHA 2AEMA 5L9XA 1IQTA 2MZ1A 2OH2A 2DXDA 3KOAA 3PW2A 3RBEA 2PT0A 2A10A 2NYHA 1P1TA 4MKBA 2MGZB 1U48A 4RUCA 4DQRA 1B0VA 2RHQB 2GS8A 3ENWA 2GAHC 1Q8IA 3R2CJ 2EKNA 2DHGA 3MEEB 2DO4A 2V8PA 1IJEB 3M8ZA 1LNQA 2GJ2A 4PEOA 2BA9A 3G82A 3S8SA 1F1BB 4LRDA 2ACYA 2FZGB 4G3IA 3C14B 3KMSA 4DV7J 1HWUA 1XR7A 1UW4A 4O3OA 1KLNA 3GFYA 3W60A 8AT1B 4RW4B 4MIAA 4TU9A 2VPYB 3GR1A 5IC4B 5DM6Q 3PW4A 4DJBA 4N41A 4XPCA 2OEMA 4C8KA 1X31C 1UPMB 3CJ8A 3FCWA 4NLDA 2PDAA 3I9V9 3EE3A 2Y1IA 2EPIA 2D1CA 2VKZG 2V63A 4ZITA 4M5LA 4O44B 3CDWA 2EC2A 1HHSA 4JV0A 1OO0B 1RTZA 3Q2TC 3EXYA 3N6NA 2HBYB 3Q23A 2C3MA 3KLHB 1FRMA 1P9QC 3IXQA 2DGOA 1GMWA 2BKPA 3GP9A 4C3KA 3QWUA 3OL6A 2CQGA 3LGNA 3OR2A 3M2UA 2OEKA 3AD9C 2HEKA 5FD1A 3PNIA 2IAJA 4OHZA 2E1MC 2ACMA 4KH0B 2A2CA 3PG9A 4R5PB 2CQ3A 4LBPA 3VV2B 3N28A 3Q0AA 2IA0A 3EZUA 3N6LA 1WC4A 2K7JA 2YX7A 3PYDA 3K5LA 2CQ1A 2AJ1A 1I6JA 2H1YA 4L6V3 2VG6B 1YBUA 5HLFA 1GT8A 3AOAA 3CIZA 3PYEA 3QT6A 2R2UA 4Q0BA 3DMJB 2ZBQA 1GAOA 2BQRA 1XNRJ 2PC6A 2DGTA 4DL0C 2VQFF 2OHDA 1D09B 3CUNA 3QAEA 2UUTA 1S6PA 3R97A 4YP3A 5KG5A 1N32F 4ED7A 4WE1A 3D6HB 3IBFB 1WG4A 1RKIA 1M5KC 2BM1A 4LFBF 5DG7A 5KFKA 1DQAA 1UEVA 2O1PA 2YNGA 1VDHA 2CVEA 1UJ4A 2PN6A 2HVEA 2IJNA 1TKTA 5F9LA 4RNHA 2DISA 1FJEB 3LP1B 2J6UA 1S1VA 1Q0NA 2E29A 3LH2S 1WDTA 1VCTA 4OI3A 2WAQD 5HMYA 1S6QB 4ED8A 4H4OA 3P45B 1S79A 2F5GA 2GIRA 1WHVA 4BWJA 4OYAA 4I4BA 1DTTA 3R1LA 1GMVA 1F3FA 2O67A 2RQKA 2WBRA 3NAIA 3M8SA 1U09A 4DQPA 2UXCJ 2AJ4A 1JLQB 2B56A 4A8YA 2LECA 2C2NA 5A8WA 4PPZA 3V6DA 2HAFA 2QA1A 3KK1A 4ERDA 1RYSA 1F60B 2M9KA 1RA7A 2F7VA 2K2PA 4U8VA 3LP2A 1UKUA 5HN0A 4A47A 3UW1A 3KLEB 4UZBA 4FYVB 3O6QA 4DR7F 4JI7F 4RKUC 5ETSA 1FKAF 3CD0A 4NCGB 2XMVA 1D8ZA 4XDDA 4ECXA 3DOLB 2HRTA 1NH7A 2OIHA 2GQ2A 2IIHA 5GAGI 4GRSA 3KFWX 3RGIA 2VQFJ 1RHKB 2M7SA 1FRJA 1CULA 1TL1A 5CYQA 2WONA 5KFFA 5A6WA 4NXNF 1H2TZ 4PAAA 3TVYA 4F7VA 2F4VJ 4BC9A 3B6BA 4IO1A 4DL2A 3RUBL 2H65B 3OQ2A 1O6XA 5KG3A 3FBCA 4OX9F 4JYAF 4LFBJ 4KJIA 5CHCB 1U2FA 3PRBA 2FQQB 1AFIA 4WYWA 2Z2LA 3MR5A 4ECZA 1VRTA 2EC0A 1LWFB 3NS5A 4QIWD 4DSKA 5BXIA 1X4GA 1BQNB 4KHPF 4NYPA 1Y00A 2OELA 2IRUA 2XSFA 2FLLA 2DHAA 2SXLA 4IG3B 5B0BA 2R7RA 1LFPA 1S59A 4GC6A 5D4OA 1R8PA 2UV8G 3W5ZA 1IKYA 2BR0A 4B3RJ 4TLQA 2AX1A 2WW4A 1YG0A 4HLBA 2BQ3A 4JI0J 2QYCA 3TUJC 4RNNA 1G2EA 4QIGA 1K1SA 2KB2A 5HP1A 4C8YA 5H9EK 1EQMA 4ZVEA 2LDIA 1F2HA 2N4DA 4WZQA 3HT3A 2BOPA 1CJVB 5CA5A 1V6HA 2H9ZA 4LSNA 1VMBA 3W5XA 3DLHA 1X5TA 1KDNA 4J7CA 4DSFA 3G8TA 3C15B 3HPOA 3ET6B 3FGVA 2KG0A 3TZWA 3M2RB 2HK2A 2VJUA 3SDEB 3VGUA 3MAAA 1HBOB 4DCPB 3BGLA 4RBTA 1S7IA 2O3DA 2IJRA 1N48A 2R8KA 3RB3A 1J5EJ 3B82A 2F8EX 4OYZA 2HMIB 3R8YA 3T1HF 1NSQA 1BE4A 3Q22A 3HSJA 1FK9A 3F73A 1YGYA 3U1MA 2CNLB 3EGNA 3TA1A 4RPFA 3D67A 4ID5B 2CDQA 1MU2B 3R6GB 1TK8A 2CVIA 2M8HA 4DU8A 1Z4UA 4NA3A 3PW7A 1X0PA 4KO0A 3W9HA 2GVZA 1YITS 1K0TA 1JK9B 1VJQA 1DTQB 3E2EA 1JWWA 1PCAA 3JQKA 1S1TB 4LF9J 1KNZA 4DFMA 3BM7A 1KHWA 5K8MA 5F8NA 5KFHA 2ZBRA 5LOQA 2C22A 2YKPA 3R27A 5I3PA 4UOGA 4Q5VA 1RTHA 4IOAQ 3KDNA 4RW7B 2FJEB 4DV1F 4ES1A 4WP3A 4KHPJ 1DURA 2BV3A 2DY1A 3J7ZT 4LT6A 3BGRA 4C3LA 2J0SD 3NLCA 2IRYA 2HRYA 5KFIA 3QFHA 1SPBP 3C3LA 9ATCB 5ETNA 1U6ZA 4PXCA 2NPIA 4K4ZA 5L46A 1ZZFA 4A8OA 4B3OA 4LFAF 5IZHA 4Q43A 3MPWA 4OYPA 3LTOA 4JI4F 3CJSA 3D3BJ 2W2NP 3J7AN 1NXIA 1IBMJ 3PHTA 1EKRA 3BQ1A 2B8QA 2W4DA 2L08A 4A8QA 2QL5B 2R7QA 1SJQA 4M1KA 4P2SA 1SC6A 1B4SA 1JLFB 4B17A 3HT0A 3HFKA 4LIRA 3PYGA 2HLUA 1UMJA 3KHGA 2XGPA 5GAHI 3VVTA 1YK9A 3EYZA 2CQ0A 2RRNA 4DR5J 2OMOA 2GV1A 2WHOA 2MDAA 1YRUA 3V4IA 4PYAA 1QVFR 1Q8LA 4KPCA 4C8NA 4ED0A 1RT1A 1FKPB 1R6YA 4FF4A 1DLOA 4Y3CA 2QMXA 1FRIA 4OV1A 3ITHB 4R0EA 2RH3A 4ECUA 1S1XB 5I3UB 1WHWA 2DEIA 2W9AA 3MMCA 1T9VA 4Q44A 1B7FA 5EX0A 5DDQC 1O0PA 5C24B 2MZSA 2W8LA 3RR8A 4FF1A 4ZPBA 2OFGX 1IJFB 3OL8A 3UNGC 3NP5A 3RRKA 2V6AA 1GH8A 3TAMA 1RT7A 2ZVSA 2HFSA 3BJYA 4TYBA 2OJ3A 2HNDB 1RT3B 3K59A 3KK2A 1XR5A 5J1PA 3W2WA 2FLOA 1U47A 2ZH7A 3O5TB 4KQZA 2CNOB 4DV1J 2BRKA 4NLOA 2YKMA 5DZ7A 2DJWA 2NZCA 3DDKA 1XEZA 1TL3B 4QPTA 4E2FB 1HL6A 4GVBB 4PR6A 2C3YA 4DSEA 3BGOP 2G1HA 1RWXB 1BQMB 4YR3A 2CXEA 4EYIB 3NEKA 4X4RA 4H4KA 2D3O1 5AXLA 4Q7AA 2E9TA 4OZ3A 1KD1T 3M8YA 1N54B 4DPUA 3W9IA 2FDNA 2JH3A 3OFGA 4J90A 4CLKA 1CJKB 6FD1A 2MTLA 4JI4J 2ZUGA 2HNZA 5J2MA 1LKZA 2R9LA 4WWSA 4LF7J 3MECA 1EARA 5AE1A 3DU6A 4B9NA 3D4JA 5G4DA 3TAPA 4IH5A 4OJ1A 1XN9A 3C6UB 3FEXB 1S6OA 4DN0A 2YH1A 4WFAQ 4Y34A 4ZCLA 4Y65A 1AB8A 5E33A 2CPEA 2BOAA 3QT7A 2YXLA 4JP8A 3NOCA 2RE1A 3MM5A 1O5JA 3G4SS 1KQKA 2QA2A 4CLZA 3VGVA 4J9QA 3ZZ0A 2YNHA 3SV4A 2W25A 3GMGA 1CJUA 3HHLD 3E01A 2B7CB 2MXYA 2UUBF 4RJVA 2OSRA 5ETMA 2DNPA 3NNCA 2H5IB 2K3KA 1V3ZA 2Q1LA 4ILRA 2KZMA 4LF2A 1VBKA 2M88A 4CO3A 4TN2A 5KFTA 1OMSA 3O2IA 4IRDA 1FX4A 1TVRB 4AFFA 5KG1A 4C8ZA 1UZHA 3EPGA 3U1LA 3K2YA 2HURA 3RBZA 1UZDA 4HT5A 3M8PA 3LPYA 2UVRA 5KFBA 2XULA 3RRGA 2E5HA 3ZZTA 3MR3A 3BPDA 2UVWA 1CC8A 3QGHA 1H2VZ 4ZPWR 2OI2A 3BSCA 5T14A 4Z37A 4UQGA 3OTCA 4WFBQ 5AXMA 3E8OA 2FVQA 4OYWA 4O4GB 4OZLA 4ZPDA 4NI2B 2K8GA 4K0KJ 5KFAA 4X4NA 4P74A 4CM2A 1VQLS 2AX0A 2JEJA 4U95A 2GO8A 3D1QA 4OMFG 2P9EA 5AE2A 3OSNA 1HBNA 2JVOA 2ZWPA 3IC1A 3Q86A 1U1PA 4ZVTB 2N82B 2IM2A 5KFVA 1S10A 1KFDA 1RT5B 2C2OB 2XWXA 4UOHA 1QLNA 1KN6A 2QMWA 5D78A 3CDBA 3KUHA 1S9EA 1L3SA 5KFRA 1TU0B 5KT5A 1UFWA 1G6BA 4ZHRB 3WIVA 4F04B 2G0IA 2IVYA 4IFYA 3PRVA 1VYAA 4B3TJ 3IS9A 4K8RA 3NWGA 4IR9A 1BC6A 4C8OA 3UD4P 3HFVA 5KFJA 4EUVA 1HNZJ 5KFXA 2IFXA 3UR0A 5DG9A 4IYQA 1X4DA 4DR3F 2ALZA 3W8GA 4I64A 1FNMA 2NXNA 1VC6A 2YNGB 1NM2A 2GJFA 1HR0J 2H4YB 2DTJA 4JBCA 1ZZNA 2D7SA 2CG4A 4IG0B 1PBUA 1PG5B 1FHTA 2IVFB 1IKVA 1N33J 3QPIA 5CZVA 1TL7A 4WIIA 2RKIB 3BF4A 4EU0A 3EVOA 3AODA 3IBWA 1N5TA 3NNAA 2CPJA 3AQOA 3D0GE 5FJ4A 4C0OC 2AQ4A 4H4OB 2R7VA 1S0VA 3BDEA 4DZ6A 2EFOA 1OWXA 2OPQB 4NEYA 1U1RA 5CABA 2HG4A 2XY6A 5KFWA 3OHAA 2KDOA 1KVKA 2F8HA 1R8BA 2M2BA 3AT1B 2RILA 5SZTA 3H42A 1JLCB 4BBYA 3CE8A 2X1AA 1ZH5A 4ELVA 1OJ4A 3S01A 3V6DB 3KDOA 3M2VB 1U0SA 1RWKB 3CNQP 1PIEA 1B70B 3LP2B 5ETLA 3QFWA 5KG0A 3MTJA 3DLBA 4ED3A 2I8EA 1JX4A 1RTJA 4WKRA 2U2FA 1DFDA 2RRBA 2IC3B 2HGNA 2L9NA 1VLOA 3Q8SB 2YBVA 3LWMA 4X62F 2KXHA 4ICLA 3SFGA 5BYSA 4H4KC 4F4AA 1JLEA 3BN4A 4F36A 5I42A 1UW9A 3H5XA 5EX3A 2R3VA 1LEOA 2ZM6F 4YS2A 3MCMA 1FF2A 1PC4A 1WDDA 4EEYA 1QUPA 1CULB 1TL1B 1VRUB 2YNFB 3D2WA 3UR3C 4DQSA 2HVDA 4LQ3A 2DITA 1T9TA 5B7WA 1VHFA 3UN3A 4NLQA 2R2SA 2DNNA 2EFGA 4S0MA 1HNWJ 1VRTB 3KLIA 4OYXA 3A8EA 2D9PA 1SC4B 4OIXA 2DR8A 5DO2A 4OHWA 4DFKA 4Y2AA 3GYGA 4DX5A 4QU6A 3JSMB 4QWBA 3PKMA 1J27A 3W8PA 3BN7A 4DV6F 3NNHA 3R5BA 1SC1B 4DV0F 3SV3A 4DPTA 2VH7A 3C6TB 2FY8A 2IM1A 2XS7A 3EZOA 5GADI 1C4CA 3M05A 5DRKA 3UQSA 5K8NA 1IR2A 1KBRA 2E7XA 1WG5A 1XBWA 4LRAA 1EETA 1KOHA 1S1WB 2KT3A 4RR5A 3S7RA 2C28A 5HP1B 1NB7A 4WP9A 1HNXJ 4DPXA 2IVMA 1B64A 1IKWA 4RNMA 2OD4A 2RSQA 1JLGA 5JUMA 2V4QA 1QAYA 4RW9A 4CTAB 3VAJA 2GHVC 4DR6J 1NSAA 4FF2A 2XHWA 3NGKA 1ACMB 1LWCA 2XG8A 3KG4A 1ELOA 3MAAB 3TARA 3THTA 1GX6A 1NJYA 2R42A 3FVYA 4G1QA 1SI9A 1X8DA 4I67A 1FE0A 4NL5A 1WJ9A 4FPRA 3WDOA 4Y28C 1Q82T 5MAOA 2ZM6J 1HBMA 3H20A 2XMMA 2NZ4A 2MQMA 3GFXA 1FJ7A 4DBQA 3PACA 2WSFC 2QMUB 3H2LA 3QATA 1IBKF 2FVSA 1XTZA 4Z7YA 1LW0B 3KJFB 2IM3A 5IT0A 1SL0A 1UPPA 3ISNC 1RLCL 2HK3A 5AJ3F 2PI4A 4OL8A 3LAMA 2FTRA 2QA4G 5J1EA 4X4PA 4J9NA 4ZCIA 3UI3A 2DEJA 5D4NA 1S9FA 3CWJA 3WHIA 1H38A 2VD3A 2VF3A 4B9MA 3K58A 2BRLA 4A8FA 1RAHB 4XK8C 4OJ3A 4YR0A 5LXRA 1AZSB 3BH7B 2GC8A 3Q8UA 1U2RA 4C7QA 3C16B 1UP1A 2CJKA 1SL1A 5JVGQ 2Y3YA 3BGRB 3CGIA 3ZNUA 1DQ9A 2C3UA 1QE1B 1S72S 2HHPA 1AT1B 4F4XA 1WF0A 4KHRA 3FBBA 2VPXB 4KKOB 3CCRS 1S57A 1U7LA 2WOMA 3H5UA 2LQ8A 3I0SB 2J8SA 3D66A 3SSSA 2KL8A 1IWGA 4NLWA 1HIYA 2HVZA 2FC9A 1BLUA 3TW0A 1UJ5A 3NY0A 2C2ZB 1J2VA 5DGAA 4HDGA 3KJNB 4KGMA 1XNQJ 2NPFA 2M5YA 2AF6A 1IKXB 4P10A 4N56A 4NWBA 3U02A 1GTEA 2GAGC 2ZKUA 2BBEA 5ETTA 1QUVA 1KHVA 2AJQA 3R9LA 3PX4A 1W25A 3FRZA 3LPEA 4CO1A 1JMTA 4DCOB 3OL9A 4JI2J 2D3ZA 1MROA 4OI4A 2AYMA 1RAFB 4ED5A 1NPPA 4HVZA 3CSKA 1I1GA 1RT1B 3GJTB 4WCEQ 1HNVA 4OV6A 1DZ5A 7AT1B 3GG1A 3PFOA 1HNIA 4B3MJ 4RUBA 1PGZA 2KFNA 1HQEB 1TV6B 5F8MA 4NLUA 3D6TB 1EQ0A 3CVKA 1FXRA 1IBKJ 3DDNA 3GLJA 5J2PA 2BMBA 2PEHA 2KTQA 1APSA 3O3LA 1R0AB 4FXWA 2UU9F 1A7GE 2MKYA 2IBKA 1TUGB 4ETZA 1VIXA 2MQPA 2QJ3A 5KFEA 1VIOA 5D4LA 4C2MA 3FBEA 3TRGA 5EDWA 3DLKA 4QIEA 2APOA 4X66F 2EFPA 3KK2B 3UVJB 1FDAA 1FFSB 3N9UC 4DF4A 2WK4A 3VTIA 4H4MB 3NGUA 3HLUA 2YKMB 2IYIA 3W1YC 4CI0B 4DSIA 1UWAA 4WK1A 4PYDA 5FIIA 1YJTA 3TUPA 4F8RA 2XGQA 4BHQA 4JI5F 1RHUB 4LVOP 4F67A 1CC7A 2YVSA 1CJTB 1T94A 3DRYA 1FRKA 1BWEA 4F0KA 4NE9C 3OPKA 1RWPB 1NEEA 3R7BB 3MPYA 3TYTA 1WD6A 2B8PA 3VAMA 2CQDA 3VZIA 5J2MB 1AFJA 2CZ4A 5D0GA 3BBCA 1V5VA 3FQLA 2ROGA 2NXUA 2XZDB 4J9LA 1NUEA 5DQHA 2HFVA 4M5NA 1TFWA 2KHDA 4YHHF 1UVJA 1HKAA 1YTYA 3ZZPA 2B9YA 2Z8QA 4O3SA 3K89A 4DLEA 2YNIA 2ZDPA 4RL1A 2BE9B 1SH2A 1C2PA 1N34F 2CG8A 3IAM9 1IBLF 1X9SA 3L7OA 4IFVA 3DI6B 4K4UA 4XIUA 1EP4A 2BX6A 3DM2A 4L72B 4P2XA 3QRPA 1H73A 3EPIA 4U67Q 2F8MA 3M6WA 2F40A 2DHSA 1CSJA 2W8KA 2PIIA 2W2OP 3VGSA 3R3TA 4RBUA 3DRPB 1FRXA 3HHKA 3BR9A 4RWXA 3P6YC 4D3HA 4USIA 1FTRA 3QGIA 4DR4F 1U2CA 3DLEA 3DDIA 4BLGA 5HSPA 2PO4A 2VJVA 3THVA 3MD1A 5HMWA 4ECQA 2DCLA 3BGFA 2GHPA 3X1LB 3W63A 4C3MA 4ZVOB 1HMVA 2OO4A 4IUFA 3MFHA 2V4JA 4CRJA 3D0HE 4GKKJ 3TZZA 5FLXY 4P7VA 1RZMA 4YN3B 1SV5B 1Q8BA 3H5SA 4KFBB 1HLWA 3MHYA 5L9NA 2BZ2A 1Y7PA 4JI5J 4NCBA 2Z30B 3CCWA 4DV4J 1WSVA 3FK4A 4DV5J 1WEZA 3P5TL 1KR4A 4LF6J 4CLPA 3T1AA 3GTYX 1XMQF 4LREA 2P5VA 1NDCA 2OGUA 5E0OA 5EWFA 1MWQA 1SCJB 1FE4A 1T9XA 1REVA 4EBEA 4ZCKA 1K73T 2DPJA 4CLTA 3V81B 2B3TB 3UD3P 3CJKB 1RKJA 1VQOS 4OI1A 2Z2YB 5LXYA 3US5A 3ZTRA 2FHJA 4KT0C 4R8UA 1RTDA 1E6YA 4RW6A 1RBLA 3GV8B 4AT1B 3DCAA 3RBDA 1QY7A 2R2TA 4U7UK 4DI6A 2XCAA 1N0UA 1S48A 2KJWA 3CF5Q 2QFJA 3W5YA 5DDPC 2B51A 1RT2A 2JX2A 1YZ6A 1UFKA 1Y3JA 4URQU 2HQGA 5B0FA 3FUYA 3M1VB 2ZHOA 1RT4B 2JLFA 4PCQA 5K14A 2AYGA 1N5YB 5CCLA 4I0WA 2DYAA 2XMUA 2ZE2A 2ERRA 3T6BA 2MKJA 4DHVA 3CMAS
chains in the Genus database with same CATH topology
4NEZA 4KHPJ 1HR0J 4K0KJ 4RJVA 4YHHJ 2VQEJ 5BR8J 3R2CJ 4JI3J 4B3MJ 4X65J 2UXBJ 2KVQE 5LMNJ 1N33J 3D3CJ 2UXDJ 5AJ3J 5FLXU 4X66J 1J5EJ 4DR1J 1I94J 3IMQJ 3T1YJ 1N34J 2ZM6J 4DR2J 5LM7E 1IBKJ 2KL8A 2MEWA 1IBLJ 4NXNJ 4DV2J 2MTLA 4JI4J 2HHHJ 4JI6J 4DV7J 4B3RJ 1XNQJ 4NEYA 4PWWA 4B3SJ 4DUYJ 2UUCJ 4KY3A 4LF7J 1FJGJ 4LFCJ 4OX9J 4AQYJ 4JI0J 4JYAJ 4JV5J 5IWAJ 4DR3J 4LF8J 5A2QU 2MQ8A 1N36J 3D3BJ 3J80U 4DUZJ 1XMOJ 3J7AN 1N32J 4LF4J 4GKKJ 1HNXJ 4JI1J 2E5LJ 4B3TJ 1XMQJ 1IBMJ 2VQFJ 2UUBJ 4YY3J 4KYZA 4JI8J 1XNRJ 4GKJJ 4HHUA 4DR7J 4DR6J 3J81U 4LF9J 5LMUJ 4JI5J 4JI7J 2UXCJ 4JI2J 2F4VJ 4V1Ak 4X62J 4DV6J 3W1YC 4DV3J 2UUAJ 4DR4J 3T1HJ 3JAMU 1HNZJ 4DV0J 4DV1J 4X64J 5IT9U 3OTOJ 1HNWJ 4DV4J 4LFBJ 4DV5J 4DR5J 4NXMJ 4LF6J 3R2DJ 4LFAJ 4LF5J 2UU9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEZ A;  4KHP J;  1HR0 J;  4K0K J;  4RJV A;  4YHH J;  2VQE J;  5BR8 J;  3R2C J;  4JI3 J;  4B3M J;  4X65 J;  2UXB J;  2KVQ E;  5LMN J;  1N33 J;  3D3C J;  2UXD J;  5AJ3 J;  5FLX U;  4X66 J;  1J5E J;  4DR1 J;  1I94 J;  3IMQ J;  3T1Y J;  1N34 J;  2ZM6 J;  4DR2 J;  5LM7 E;  1IBK J;  2KL8 A;  2MEW A;  1IBL J;  4NXN J;  4DV2 J;  2MTL A;  4JI4 J;  2HHH J;  4JI6 J;  4DV7 J;  4B3R J;  1XNQ J;  4NEY A;  4PWW A;  4B3S J;  4DUY J;  2UUC J;  4KY3 A;  4LF7 J;  1FJG J;  4LFC J;  4OX9 J;  4AQY J;  4JI0 J;  4JYA J;  4JV5 J;  5IWA J;  4DR3 J;  4LF8 J;  5A2Q U;  2MQ8 A;  1N36 J;  3D3B J;  3J80 U;  4DUZ J;  1XMO J;  3J7A N;  1N32 J;  4LF4 J;  4GKK J;  1HNX J;  4JI1 J;  2E5L J;  4B3T J;  1XMQ J;  1IBM J;  2VQF J;  2UUB J;  4YY3 J;  4KYZ A;  4JI8 J;  1XNR J;  4GKJ J;  4HHU A;  4DR7 J;  4DR6 J;  3J81 U;  4LF9 J;  5LMU J;  4JI5 J;  4JI7 J;  2UXC J;  4JI2 J;  2F4V J;  4V1A k;  4X62 J;  4DV6 J;  3W1Y C;  4DV3 J;  2UUA J;  4DR4 J;  3T1H J;  3JAM U;  1HNZ J;  4DV0 J;  4DV1 J;  4X64 J;  5IT9 U;  3OTO J;  1HNW J;  4DV4 J;  4LFB J;  4DV5 J;  4DR5 J;  4NXM J;  4LF6 J;  3R2D J;  4LFA J;  4LF5 J;  2UU9 J; 
#chains in the Genus database with same CATH topology
 4Y2I A;  4LRB A;  1FT8 A;  1FFG B;  3QNW B;  3KLG A;  1U1M A;  2H54 B;  4WFN Q;  3HKW A;  5GVQ A;  4ECV A;  3OUY B;  2FHK A;  5DJB A;  2XMJ A;  4X2B A;  4NYZ A;  2CPY A;  4O0I A;  3HVW A;  1M0S A;  4HI1 A;  4F3M A;  2BKO A;  1T02 A;  3OTO F;  1S77 D;  2MLZ A;  2GQC A;  3W7B A;  1GFW B;  4GO5 X;  2AP6 A;  2FB0 A;  3H7H B;  4JI6 J;  4PWU A;  2POK A;  3MPV A;  1LQ9 A;  2CWK A;  3C8Y A;  2XO6 A;  4JI3 F;  1H2U X;  2CQ4 A;  2I6W A;  4DUZ J;  1XMO J;  3FEY B;  1RAE B;  3QLH A;  1YJW S;  3MUT P;  2XQC A;  2IBO A;  2H4W B;  4YB7 A;  5B0G A;  2LEP A;  3PVX A;  2Y9H A;  4DN9 A;  4C11 A;  4PQU A;  3FMB A;  5LSL A;  1WI6 A;  1U1O A;  4L75 A;  3PEJ A;  2M4M A;  4ZVR B;  2N7C A;  5JXS A;  4Y2K A;  3TQE A;  1FD2 A;  1SH3 A;  1YIJ S;  3UDL A;  1T9U A;  2W7P A;  1WC3 A;  2F9J A;  1BMQ B;  2EFQ A;  2CAD A;  2V2Z A;  3SFU A;  2CQP A;  5LMN J;  2QZ8 A;  3MEG B;  2Q6B A;  2MKI A;  3PW0 A;  3DGP A;  1WNE A;  4YR2 A;  3JTP A;  2BJ8 A;  2HIQ A;  3I32 A;  4DOZ A;  2GGP A;  4DEZ A;  2QRR A;  4D3G A;  5C42 B;  4LR7 A;  2W7O A;  3O1L A;  1GXT A;  1D3W A;  5IT4 A;  3M7V A;  2NUH A;  4RBV A;  4LF8 J;  2PD1 A;  1UWB B;  1S0O A;  5EN1 A;  3SCK E;  3MM8 A;  3HJF A;  4IDK B;  4F26 A;  3ZZO A;  2ILZ A;  3PEH A;  2GIF A;  5LJ3 Y;  3FQK A;  3KLI B;  4RUA A;  1PSD A;  3N5F A;  1HA1 A;  2GML A;  4WU2 A;  1QDU B;  3HD1 A;  1LFW A;  1OS5 A;  3BDP A;  3Q8Y A;  3MCN A;  3WBZ A;  4K4V A;  3EWG A;  2KG1 A;  1X4B A;  4JI8 F;  2B4P A;  2Q66 A;  1C1B A;  3H40 A;  4CO2 A;  2YH0 A;  2UUW A;  2YX1 A;  2B4V A;  4KSE B;  4ZN3 A;  3CO0 P;  3HDS A;  5JVH Q;  3JYT B;  1TKX A;  4MK7 A;  4B9U A;  2ZNY A;  2VFR A;  4O23 A;  3RBX A;  2YKN B;  3IGV A;  3EZ5 A;  2NRE A;  1S12 A;  4KRW A;  2UXB F;  5HVH A;  1DHM A;  1JLG B;  1P27 B;  5DDR C;  4LF4 J;  1WEY A;  2RQC A;  4KH1 B;  3FC9 A;  4I2P B;  2FJB B;  2IRX A;  4IOC Q;  4USW A;  3NBP A;  4A8W A;  4DL4 A;  5IV3 A;  5HVF A;  1RK8 A;  4QIF A;  4DV2 F;  1HHT P;  1VBY A;  2VA3 A;  1WC0 A;  1IXK A;  3VR1 A;  4RWW A;  4G1Q B;  1VQK S;  5J2Q B;  1IR1 A;  1YX2 A;  3D6F B;  4PXE A;  2CKW A;  4WFX A;  4OZ0 A;  4CO4 A;  4NAS A;  1KVJ A;  5KG4 A;  1WTF A;  3LQV A;  2FHM A;  3DN9 A;  4WU3 A;  4K4S A;  3DRS A;  2XSJ B;  5BYR A;  4I7F A;  4J9S A;  3QZ7 A;  4X4T A;  1S0N A;  3MMA A;  1S0M A;  3EX7 B;  4CLF A;  5IM0 B;  2GHW A;  1NDL A;  4USM A;  3EM1 A;  5KFP A;  3S1T A;  5A76 A;  4B9L A;  4TY8 A;  1SJ1 A;  4Y0F A;  2ZC4 A;  3GV7 B;  1Q81 T;  2XI2 A;  4DFJ A;  2J6S A;  2DH8 A;  5J1E B;  4CQ1 A;  3FZB A;  5EWG A;  1ZM2 A;  1IVZ A;  1TK0 A;  3H4B A;  3CME S;  4OYB A;  5DLG A;  4EYH B;  1KOO A;  2RF2 B;  4NA2 A;  2MYF A;  5LMU J;  3KWM A;  2F9D A;  3RR7 A;  1YSJ A;  1S76 D;  2WW8 A;  4TY9 A;  3ISZ A;  3OTD A;  3LOU A;  1H0H B;  2UUC F;  3PIO Q;  2Z2M A;  4RU9 A;  4LFC F;  4UW2 A;  3ELH A;  5G0R B;  2M70 A;  1SJ3 P;  1ZPV A;  2Z58 B;  4PRF A;  3CO9 A;  2R7S A;  1B3T A;  3LAN A;  2E7W A;  2LQJ A;  1CEZ A;  1TKZ A;  1SJF A;  4EO8 A;  2DH9 A;  5LSR A;  2K1R A;  3OVS A;  2BE7 D;  3DC2 A;  1R8A A;  2J5A A;  5KG2 A;  1C0U B;  1AA1 B;  1SKW A;  3J7A 1;  3AA8 A;  1L3U A;  2UXD F;  3FZ2 A;  4ZP7 A;  1OYD A;  3BKF A;  1WC6 A;  1FO1 A;  2A3J A;  5HRO A;  2DRD A;  1LV5 A;  4WK3 A;  5D0H A;  3CJ4 A;  4Y2C A;  2CQH A;  2FYX A;  3QZ8 A;  4KGV B;  1I94 F;  1RP5 A;  2HBZ B;  4ZVQ B;  2VFS A;  3O44 A;  4PG5 A;  3GIM A;  3RB4 A;  3BBB A;  1SJ4 P;  2GO9 A;  1D9A A;  4IO9 Q;  3JXO A;  4LQ9 A;  4DS4 A;  2LYV A;  3A4T A;  1ZM4 A;  3HJV A;  1JLB A;  2DD8 S;  1VQ4 S;  1LW2 A;  2WBM A;  4OZN A;  3OV7 A;  3ICL A;  2PMZ D;  1U1Q A;  1QD1 A;  4Q2M A;  1HYS A;  2WSE C;  3GON A;  1ZTT A;  2JNJ A;  5L1L A;  2G2Y A;  4G6V B;  3GFZ A;  4KB7 A;  2XC9 A;  5A0Y B;  4A8M P;  2R8J A;  2XNQ A;  2IYG A;  1X5P A;  1BXN A;  2KZZ A;  5U47 A;  3ZC4 A;  2W9C A;  2BJ7 A;  2ILY A;  4UZC A;  5E3P A;  3V4M A;  3F41 A;  3C2P A;  4FYX B;  3GWC A;  1B0P A;  2DY9 A;  3SSQ A;  2HNY A;  1YBA A;  2CA9 A;  4B9V A;  1D8Y A;  4LR8 A;  3RAQ A;  4UT4 A;  2FHO B;  1O8B A;  1S7H A;  3QGP A;  4ZLL A;  4C98 A;  1N0V C;  4E8U A;  1FJG J;  4ZA1 A;  2QN6 B;  3I96 A;  2A0F B;  5KFU A;  2NR0 A;  3K17 A;  1DRZ A;  4R25 A;  3KYL A;  3TJA A;  3W65 A;  1NME B;  4NRU A;  1P9Y A;  1N6Q A;  4UOC A;  4ZVG A;  1F2G A;  1FCA A;  1RB0 A;  2RML A;  2XZT B;  1VRQ C;  4X4O A;  6AT1 B;  1J5O A;  1SXL A;  2ZHA A;  3ZTS A;  2PFF B;  1FDN A;  3HM9 A;  3IBC B;  4M5M A;  4DPW A;  5HBM B;  3DXS X;  1HW8 A;  3MM6 A;  5KT3 A;  3LW5 C;  2YWH A;  1RU1 A;  1T0T V;  5T7L A;  4DPO A;  3GIJ A;  3VQT A;  2HBQ B;  2A6M A;  2UXD J;  3CCV S;  4L76 A;  3G8S A;  1GMW D;  2V67 A;  3OXL A;  4X64 F;  2LQ5 A;  3MM9 B;  3BQ0 A;  1ITP A;  4M5D B;  4QR1 A;  3LWL A;  4ELU A;  2FJD B;  2FVR A;  1RSC A;  1X4F A;  2CJY B;  4PWW A;  3T19 A;  2Z57 B;  2X7I A;  3FSI A;  2XNR A;  2BE2 B;  4CLY A;  3L9Z A;  3IWX A;  5L39 A;  3HUL A;  4IFV B;  2G13 A;  3H59 A;  1BQX A;  5IWA F;  1EP4 B;  4DR2 F;  1RHM B;  3Q8V A;  4GKJ J;  5E41 A;  4HR2 A;  2QV6 A;  1C0T B;  2W2P P;  4K4T A;  4KAI A;  3THP A;  2A2D A;  2V94 A;  4OX6 A;  2CNN B;  2X3G A;  4CLU A;  1P6T A;  4QWA A;  2JDJ A;  3PXG a;  2V2K A;  4CNZ A;  1HQU A;  3PZP A;  2DRA A;  1PBA A;  4DL3 A;  3KG1 A;  3PM9 A;  1YJV A;  1RCO B;  2JEG A;  3DOM A;  3DLE B;  1M5O C;  3KHR A;  2ASD A;  1VIS A;  4DR1 J;  1UCN A;  5D3G A;  1KEK A;  3DNC A;  4OHX A;  2LU1 A;  2VC0 A;  2ADC A;  1VQ9 S;  1ZA1 B;  2ZH9 A;  3DOK A;  2KM8 B;  2RS2 A;  4FNI A;  3DRR B;  2JJ4 D;  1C1C B;  2BQU A;  5IS2 A;  4NZ6 A;  1R43 A;  3BV8 A;  1R0C B;  2HGL A;  3A3P B;  3M8W A;  1JB0 C;  4KPY A;  2KVI A;  3C46 A;  1AXQ A;  3CC7 S;  3CJT A;  5D15 A;  2KFZ A;  3I0R A;  4HHU A;  2KFY A;  4X4Q A;  4ID8 A;  2HVH A;  2Y0B B;  1W26 A;  2EVZ A;  4RW8 A;  4IKA A;  3CT9 A;  1Y0H A;  2RNE A;  2CPH A;  2RQ4 A;  3NMA A;  2V4R A;  4ZVS B;  1Y9O A;  3OHB A;  2OPR B;  3BYP A;  1RWO B;  3RJM B;  2KH9 A;  2NS1 B;  4HTI A;  3VVU A;  2EG2 A;  3R5G A;  2J7K A;  3I5B A;  4I56 A;  1NK5 A;  1HW9 A;  2DGQ A;  2VHG A;  3GJQ B;  1U1K A;  2XB2 D;  3SMZ A;  4E0D A;  1X5S A;  3KKF A;  3JAM Y;  2FC8 A;  1U24 A;  1U26 A;  2VU5 A;  2MGZ A;  3HP6 A;  2FUG 9;  3RYL A;  4KTQ A;  2UZA A;  2KXF A;  5IQ6 A;  1UVL A;  2Q79 A;  2FGC A;  3TZX A;  1MML A;  3MEE A;  5IWA J;  1RE1 B;  4L3N A;  3ILO A;  3KMQ A;  4OYO A;  1UVI A;  4I2Q B;  3SXL A;  5DDO C;  3C14 A;  4MJK A;  3CB4 A;  4FS1 A;  4NLV A;  5ETK A;  4YQW A;  1SUQ B;  5A8K B;  5DM7 Q;  2AJ0 A;  3GR0 A;  2QX0 A;  2IMO A;  3RAX A;  4RW4 A;  4B3S F;  4TKT A;  4DUY F;  1ZAX A;  4FXD A;  3AJ1 A;  2VG7 A;  2J7U A;  1VOM A;  1WC1 A;  2HWT A;  3PRD A;  2ZOG A;  2FJW A;  2BJD A;  1NKE A;  3MTK A;  4KE5 A;  3N0V A;  4K59 A;  4OHV A;  4FKX A;  3T9Z A;  5C25 A;  2PA3 A;  1WHX A;  4DV3 F;  3VZH A;  2KYZ A;  3I5A A;  2EFN A;  3NCP A;  4C6A A;  3KLH A;  2VA2 A;  2W24 A;  4G1I A;  5CZX A;  2BDP A;  4ZP8 A;  1T03 A;  5ETQ A;  2FPH X;  3QLH B;  1U0H B;  3PJ9 A;  2VBX A;  2YWE A;  4YB1 P;  3C66 A;  3GSD A;  4HT7 A;  3UN5 A;  2MQL A;  3BO2 A;  3F44 A;  3CDA A;  2W7A A;  4I68 A;  4DCJ B;  2DGS A;  4JI1 F;  2HHH F;  3CCT A;  3EVM A;  3C19 A;  3FMW A;  3W2V B;  1Y5N B;  2HS4 A;  1HD0 A;  3BRE A;  1WOR A;  3LAK A;  2GJI A;  2VG6 A;  1FVQ A;  3ILI A;  2J9E A;  4U96 A;  1QTM A;  4PXD A;  2LXF A;  4O3Q A;  3M8Q B;  3J7Z 5;  2QLB B;  2BJ9 A;  1GQE A;  3P4U B;  1PJ6 A;  3TA2 A;  4M5J A;  3ETO A;  3SIP B;  4M95 A;  3W66 A;  2QSW A;  4MIB A;  4USU A;  1WG1 A;  3T3F A;  2VG5 B;  3DYA A;  2HFU A;  4F4K A;  3NS6 A;  4ZPA A;  1S49 A;  2DGX A;  1T11 A;  3T41 A;  3MM7 B;  2JSX A;  4J9K A;  2ZZT A;  1N56 A;  4ZN1 A;  1N32 J;  1ZS6 A;  1SKU B;  2VIC A;  1T3O A;  1SQE A;  3MUV P;  1ZAW A;  2LQB A;  4FDF A;  3LP1 A;  2WTF A;  3CJ2 A;  5EUH A;  4LRC A;  5I3Q A;  4C0H A;  1CBK A;  4KGK A;  3RTV A;  2NCK L;  2DBB A;  2GIQ A;  3H2V E;  1JJC B;  2I5J B;  4NA1 A;  2D3O R;  1TAU A;  2V5H G;  4DSJ A;  3BQ2 A;  5HJY A;  3MMJ A;  4WFY A;  3TR5 A;  5HAN A;  1YRX A;  3IRX B;  2PA8 D;  1U1N A;  2CJ9 A;  2EWH A;  2DPI A;  1NK0 A;  3GII A;  1JLQ A;  5CYM A;  5JMN A;  2B9X A;  3IMQ J;  4X4V A;  4ZLP A;  2ZH3 A;  4BC7 A;  4O4R A;  3KJV A;  5LM7 E;  3I6P A;  4CCH A;  1NB2 A;  5I4M A;  1VQM S;  2JEI A;  2FVC A;  4NXM F;  2M8D B;  2VB6 A;  4URG A;  1M5P C;  4A4J A;  3ZFV A;  3O8W A;  3NAH A;  3KLE A;  5HQL A;  1JKH A;  3ILL A;  4C8L A;  3P3D A;  4K2X A;  1FTC A;  4IRK A;  4JI1 J;  3LAL A;  3KNA A;  4XDC A;  3MED B;  4PG4 A;  2HFN A;  2ALY B;  4NCG A;  4DR7 J;  4FBU A;  4JI7 J;  5IQQ A;  2XCP A;  2XMA A;  1KQG B;  3OD2 A;  1TFY A;  1I3O B;  3IR5 B;  3A1Y G;  5F8G A;  5IT9 U;  2DXF A;  1RCX B;  3ENA A;  2M52 A;  2OTJ S;  1YJ7 A;  3N01 A;  1S9G B;  3PDN A;  2E5L F;  2Q3P A;  5BJR A;  5D8H B;  5IFM A;  2GW8 A;  4CYU B;  2CQI A;  1NK7 A;  3QSY B;  3TP2 A;  1RAC B;  5D4P A;  3AB4 B;  2RDJ A;  5DLF A;  4NXN J;  2W2Q P;  3OT9 A;  1FJC A;  1PKU A;  5F8I A;  1X7V A;  2ZVI A;  3Q8Q B;  1LWF A;  5KG6 A;  4OZ2 A;  4OX9 J;  4JYA J;  2KJV A;  4P72 A;  1SL2 A;  1X60 A;  2XYG B;  1HFE L;  1U6F A;  1TAQ A;  5KFS A;  5ADZ A;  4FYD A;  3LP0 A;  1CS4 A;  4TVA B;  3P8B B;  3CCU S;  4AUK A;  4IG3 A;  4N76 A;  3A8K A;  4A8X A;  2I0X A;  2LA6 A;  3QAU A;  2LFV A;  3J81 U;  2XZW A;  1JXE A;  4YDX A;  1NHV A;  1RBO B;  2FIU A;  4U6P A;  2DNQ A;  3AAW B;  1G1X A;  4UUW A;  3NL0 A;  4WTO B;  5JJB A;  2AZ3 A;  1OIA A;  3HXM A;  3BO4 A;  3TNV A;  4TQR A;  1N52 B;  4K2J A;  5M2P A;  4C9D A;  2GQQ A;  2IDL A;  1JLA A;  1Z2Z A;  1LOU A;  1IQZ A;  1UJ6 A;  3R5A A;  1CJV A;  2C42 A;  1RT6 B;  4P71 A;  4FNH A;  4HAC A;  3Q89 A;  2UUA F;  4B9S A;  4W90 B;  1SC3 B;  1S6U A;  2BM0 A;  2ZJP Q;  1SB6 A;  2CUY A;  1BY9 A;  3ET6 A;  3CD7 A;  1OYE A;  5ETP A;  3M2R A;  2Q43 A;  2AGP A;  3H0P A;  3CCS S;  3SDE A;  4LF5 F;  5A8R B;  1Q8K A;  3TEH B;  1HBO A;  5H9F J;  3PTW A;  4CDI A;  2WVE A;  2JVR A;  2QE5 A;  1V5I B;  2HMI A;  3FFI B;  5C7P A;  2PFD A;  2W4P A;  4CWB A;  5CD4 H;  4ZDN A;  1HI0 P;  3VF0 B;  1WTB A;  4KV8 A;  1JLB B;  4ID5 A;  1MU2 A;  1NK4 A;  3T1H J;  4AQY F;  4N77 A;  3G86 A;  1R8C A;  5B09 A;  3IR6 B;  3HHN B;  3HX9 A;  3OFF A;  3PX0 A;  3MZI A;  3R7N B;  2MQQ A;  1M1G A;  5DZ6 A;  3CCJ S;  1DTQ A;  2MQO A;  2M0G B;  1S1T A;  1OSC A;  1JJ4 A;  2CPX A;  5FLX U;  2HQ3 A;  4DX8 H;  1IR0 A;  4MMO A;  1YLX A;  2MJN A;  1XC9 A;  3WX4 A;  3NS7 B;  1H72 C;  4RW7 A;  4DMZ A;  4ZOS A;  1RWW B;  3SI8 A;  3PJX A;  4F50 A;  2CYY A;  3ENV A;  2GX8 A;  5BR8 F;  3J80 U;  2J9D A;  1E6V B;  2VDI A;  3GG0 A;  4WF9 Q;  1S4F A;  1HHQ A;  5KFY A;  3M30 B;  1HPZ A;  2OML A;  3LGH A;  1R7I A;  1FWK A;  1YRT A;  2F63 A;  1J5O B;  2YY3 A;  3MAQ A;  2OEJ A;  4F2S A;  3SQO P;  3A8I A;  1WC5 A;  2GMJ A;  2HZA A;  4AL7 A;  2GZO A;  5KFG A;  2E5I A;  2MB0 B;  4NPO A;  3UPF A;  3K5P A;  1NND A;  3QJJ A;  3TZY A;  3KHL A;  2KYX A;  3I31 A;  2C3O A;  2ZFH A;  1JJH A;  1VFJ A;  1JQG A;  5T7L B;  2EXU A;  4LFA J;  2IM0 A;  1TZ0 A;  1TL4 A;  4QR2 A;  3JSR A;  3DGV A;  2P6T A;  2F65 A;  4IH7 A;  2HZC A;  3N4W A;  5DQG A;  1BD6 A;  1L3T A;  2YQ0 A;  5SUH A;  4F3Q A;  3OVA A;  1JLF A;  3HVT B;  2HPU A;  3MR6 A;  1ICE B;  5CQG A;  3CJ0 A;  4NLX A;  4K50 A;  5E2Q A;  4X65 F;  3VQS A;  5E7O B;  1JIH A;  1VS3 A;  3GE9 A;  4Y00 A;  2HS3 A;  2XWY A;  1U49 A;  1FKP A;  3GJS B;  5GAE I;  1WSR A;  2BXJ A;  3G71 S;  3ITH A;  2L41 A;  1PYS B;  2ZH4 A;  1U1L A;  1S1X A;  3ISN D;  4X4U A;  5I3U A;  3V6J A;  2DNO A;  1KWM A;  3WC0 A;  4F0H A;  5C24 A;  1Z1Z A;  1DAX A;  4DV7 F;  3AOB A;  3GPA A;  3PHE A;  4EK2 A;  1NK8 A;  4OZJ A;  2HYI B;  3BGU A;  3MUM P;  3G82 B;  3H4D A;  3UN2 A;  1HQU B;  2ZH6 A;  5AXN A;  1OY8 A;  1R8H A;  1VJW A;  3ZXW A;  3KUG A;  1AW0 A;  2L9W A;  4WP8 A;  2MLY A;  1Y5I B;  5KFD A;  2HND A;  2RAQ A;  4F4W A;  4Q45 A;  2PMW A;  2J76 E;  1M5H A;  4NMX A;  3D3C J;  2V34 A;  1NPK A;  5D3G B;  1VI7 A;  2W9B A;  2VQE F;  4W98 A;  3HO1 A;  3EMT A;  4MT1 A;  3W61 A;  3DOK B;  4OYI A;  4NZ0 A;  5AT1 B;  2PEB A;  2KXN B;  4I69 A;  5D77 A;  4CT8 A;  1F9E B;  1QJH A;  2VPW B;  4P73 A;  2VAS A;  4A8K A;  2AYE A;  2CQC A;  2CPI A;  1MSW D;  4HHH A;  5KFQ A;  4QZV B;  1NZA A;  1BQM A;  4M5H A;  4OHY A;  3ILJ A;  3QYY A;  5HQ8 A;  4QWD A;  2KRB A;  1X9W A;  2KRR A;  4FS2 A;  3CC4 S;  4UOF A;  2FZK B;  2E5J A;  2UV8 A;  4ED6 A;  4PG7 A;  4CLS A;  1CJK A;  3OR2 B;  3M2U B;  1CQM A;  3TX0 A;  1NJX A;  2ASL A;  4ILM A;  2ZKT A;  2IAJ B;  4N8N A;  3T6J A;  4F2R A;  4WKY A;  3IGN A;  4DXL A;  3UDE A;  1PC5 A;  2VKR A;  1RUS A;  4FVM A;  2XMK A;  4FPI A;  3C6U A;  4P9S A;  8ATC B;  1X0F A;  2EK6 A;  2PI5 A;  4ED1 A;  5LL6 d;  1YKW A;  4UST A;  2HQI A;  3IM8 A;  4CP5 A;  4X65 J;  1XNR F;  1RHJ B;  4DDF A;  4NLT A;  5J1N A;  5HLF B;  4Z7C A;  2AU0 A;  4Q0B B;  1U45 A;  3EUN A;  4K4X A;  3OFE A;  3FJ2 A;  3VCD A;  1PJ5 A;  5F8H A;  4HYK A;  4J9P A;  1T8E A;  2LEB A;  5THW A;  5ITH A;  1SKS A;  1S6P B;  3OR1 A;  5KFZ A;  2Z56 B;  1NSK L;  1AUS L;  2R2R A;  1FNX H;  4RNF A;  4ZJQ A;  4CIO A;  9RUB A;  2Y8Y A;  5A6P A;  4WE1 B;  2UUB J;  1F3V A;  1TVR A;  3OBI A;  1QAI A;  3G96 A;  3W62 A;  1YJN S;  2VG7 B;  3RZA A;  2CQ2 A;  2PSZ A;  4ALZ A;  1TKT B;  4LR9 A;  3UWT A;  2B6A A;  3IWN C;  2ZDO A;  5HK4 A;  3AH6 A;  1HD1 A;  1I51 B;  1S1V B;  4DLG A;  1VC5 A;  2QL9 B;  1FRH A;  5CH7 B;  4NEZ A;  2NSC A;  5C25 B;  2N3L A;  2VQE J;  3BEG B;  1RAJ A;  4X4S A;  5CCM A;  2UXC F;  4GMK A;  3EJM A;  3CIM A;  1DTT B;  3EGZ A;  1KP6 A;  4O0N A;  1NKB A;  1WOO A;  2AMC B;  4IRC A;  2YWF A;  4O4G A;  1T03 B;  3I55 S;  4NI2 A;  3SCJ E;  2DVI A;  5L8R C;  3JTO A;  4USJ C;  2YX4 A;  4N47 A;  1RJJ A;  4I6W A;  4OX8 A;  4QW8 A;  3BZQ A;  1UL3 A;  5A8W B;  1L3K A;  2NXJ A;  3KK1 B;  3RB0 A;  4CT9 A;  2ZD1 A;  2HWH A;  2HKE A;  4Q8E A;  1RT5 A;  1IN0 A;  1C4A A;  3TUI C;  4EI2 A;  2K06 A;  2IA6 A;  1V9O A;  4JOU A;  1TL5 A;  5KT4 A;  3QWP A;  2DNK A;  4PQA A;  1EX8 A;  1NBE B;  4CO5 A;  4ZHR A;  3L7U A;  2I38 A;  1RAO A;  4XPE A;  4QBU A;  3B4M A;  1X5O A;  2OP5 A;  1R3N A;  1HWK A;  1B99 A;  2V8G A;  2ZWO A;  1NO8 A;  5L1I A;  1V3S A;  3WIU A;  2A6O A;  2DH7 A;  3HKZ D;  3DYA B;  1Q7Y T;  2B9W A;  2F4V F;  1OQ3 A;  4ED2 A;  3BH6 B;  2AKW B;  3ZTO A;  4IOB A;  4QYR A;  1N8R T;  3MD3 A;  2Y8W A;  3MR2 A;  5CYQ B;  2WON B;  1CLF A;  3LUY A;  1IBC B;  4UUX A;  2HQD A;  2RDI A;  2D69 A;  3JTN A;  4DWI A;  4IG0 A;  1NJI T;  4DR3 J;  1Q16 B;  4YOE A;  3M6V A;  1FVS A;  3CXC R;  3IWL A;  1S99 A;  1RBA A;  2RKI A;  3B4D A;  2PGC A;  2R7T A;  4JV5 F;  4OI6 A;  3AA9 A;  2DNY A;  3EDR B;  5HAO A;  1WHY A;  1MN9 A;  4LBH A;  2HHV A;  3KK3 A;  3AJ2 A;  4PG8 A;  1KVI A;  4FF3 A;  1LXJ A;  2OPQ A;  4B3R F;  3CDU A;  2D74 B;  2HSE B;  4F4Z A;  1Q4R A;  2MKK A;  2ATL A;  4JI0 F;  3ZO7 A;  3H2U B;  5IC6 B;  1JLC A;  1IKY B;  3M9M B;  5CYM B;  1BUX A;  4JV1 A;  2NLW A;  3GIL A;  1ZAV A;  5M2U A;  3KJV B;  2XLK A;  2MPU A;  3M2V A;  1FDB A;  4PWD A;  4NRT A;  1FX2 A;  1MMN A;  1UVM A;  2MJU A;  2MEW A;  1BWV A;  2Q6C A;  1T05 A;  3DFE A;  2DCU B;  1JKH B;  3HD2 A;  2OTL S;  3JSY A;  3GCW P;  4LSN B;  2IC3 A;  1K44 A;  3MUR P;  3BPS P;  2DKO B;  1H7X A;  5DQI A;  2W2M P;  1J5E F;  2UVU A;  4QR0 A;  3K0J A;  3IR7 B;  4DSL A;  4LF1 A;  3LF0 A;  3MPU B;  4DFP A;  2LDY A;  4X62 J;  4WYL A;  3M32 A;  2MY8 A;  4QPX A;  3OLB A;  4AXI A;  4BCA A;  1K47 A;  1FK9 B;  2QT7 A;  1VGY A;  1HWJ A;  1VR6 A;  4ECW A;  1VRU A;  1OSD A;  2YNF A;  2VC1 A;  4DF8 A;  2R8H A;  2H5E A;  3OL7 A;  2QFI A;  1WKJ A;  3AD7 C;  3NMR A;  4QCL A;  3AQP A;  3ONQ A;  2LP4 A;  3BR8 A;  2KI2 A;  4LF9 F;  2KO1 A;  1VQS A;  4KO0 B;  2GVZ B;  3NGR A;  2HIY A;  2EFV A;  5DGB A;  1WOS A;  3E3X A;  3KTQ A;  3KNG A;  2HQF A;  4AD6 A;  4QW9 A;  2CJA A;  3ZNJ 1;  1Q5Y A;  1YHQ S;  4JV5 J;  4CM0 A;  3LP0 B;  1CS4 B;  3JSM A;  2VOD A;  2XEX A;  4ELT A;  1X4H A;  1OQ6 A;  4TU8 A;  2HBR B;  1RTH B;  4NOH A;  1U25 A;  1Q95 G;  4MKA A;  1GNK A;  3C6T A;  1R89 A;  2BW2 A;  4L73 A;  3D6M B;  2Y1L B;  2V68 A;  3BSN A;  4G65 A;  3WQP A;  1HI1 A;  4DV6 J;  5IOL A;  4R0J A;  4DV0 J;  2IDE A;  1JXL A;  1S1W A;  2LVW A;  3VHQ A;  3A3N B;  2XYP B;  2U1A A;  3R2D J;  1JLA B;  3QBC A;  4B08 A;  4B3O B;  1IBM F;  4WZM A;  1AUD A;  1F9F A;  4JV2 A;  3M8R A;  4CTA A;  4HAC B;  2G9O A;  1QAX A;  3OSP A;  1G4C A;  1AYE A;  2ZZM A;  3KLF A;  1FXL A;  2OUG A;  1VQ7 S;  2B5J A;  2RDD A;  5D0E A;  2LQ9 A;  1S1U A;  1NU4 A;  3N5B A;  4DR5 F;  1Q79 A;  4QWE A;  1QSS A;  4EBC A;  2OPP A;  2FY1 A;  2AIR B;  2ZBC A;  2MQ8 A;  3B78 A;  7FDR A;  3FKB A;  1U6B A;  3F56 A;  3NCQ A;  2DNG A;  1M1K T;  2HHT A;  5AXK A;  4KV8 B;  3V4I B;  2H5J B;  3D54 A;  5CD4 A;  1EAY C;  4RZR A;  2AZ1 A;  1DLO B;  3TUZ C;  2Z2Z A;  2H48 B;  3UFC X;  1LW0 A;  2YQ3 A;  1U8S A;  4QYZ J;  4MK8 A;  2YKA A;  4YB5 A;  3MMC B;  5IT9 Y;  3CCE S;  2DK2 A;  2E1A A;  3L3C A;  3R6L B;  3OTE A;  1DJ0 A;  3CD5 A;  2ADB A;  1RXO B;  1FER A;  3OXG A;  3QO9 A;  3ETM A;  5AJ3 J;  2BJ3 A;  2EBE A;  3G8Q A;  4ECR A;  2BAN A;  4Y2M A;  1AZS A;  3TAM B;  1RT7 B;  4CLW A;  3C16 A;  4ZK7 M;  2MMY A;  5D6G A;  2DNH A;  2ROP A;  2XMW A;  2OSQ A;  4ES3 A;  3W2W B;  1QE1 A;  4OYM A;  4E98 A;  4DS5 A;  3N79 A;  1XWL A;  3CD6 S;  3D68 A;  1HPZ B;  2C1E B;  3MDF A;  4OI0 A;  4PG6 A;  4KKO A;  4F0M A;  3I0S A;  1GMU A;  2QTW A;  4PXB A;  5H9F K;  2ZC3 A;  3A3O B;  3GB0 A;  3VAF A;  5GAE U;  5DG8 A;  1ROF A;  5K20 B;  3CED A;  3BYR A;  4NLG A;  3JAM U;  3PR5 B;  4NML A;  1WWH A;  1IKX A;  4LF7 F;  1XJW B;  3BSO A;  7FD1 A;  3J81 Y;  3LA0 A;  1QSL A;  2GCF A;  1F5A A;  3EDQ B;  1KON A;  3V2U C;  2MLX A;  3CTR A;  2HNZ B;  2AEJ A;  4RX6 A;  3MEC B;  3ZZZ A;  3CUL A;  2XBP A;  2DNZ A;  5L1K A;  2W01 A;  3K7R A;  1HQ2 A;  3PV8 A;  4F02 A;  2VDH A;  1TMM A;  1TUW A;  3SEO A;  1FES A;  4A46 A;  3V5R A;  2VZ9 A;  5ETR A;  2JOQ A;  3BKT A;  4ZPV R;  2K7K A;  3T5K A;  4PPD A;  1RI7 A;  1RAD B;  2R7U A;  4N8O A;  2IY5 B;  4NCA A;  2E7V A;  3MM5 B;  3K5M A;  1HQE A;  1TV6 A;  1UTA A;  2FHJ D;  1RAB B;  5CAA A;  2YNH B;  3R7S B;  3QJP A;  4QJV A;  1CJU B;  1R31 A;  3E01 B;  1WKL A;  1T95 A;  4N5S A;  4ECS A;  2C2R A;  2OPS A;  2MHN A;  2F4F A;  2J9C A;  1R0A A;  3CC2 S;  3HK2 A;  3R1H A;  4LVN P;  4ITS A;  1PO6 A;  4AXJ A;  3QGG A;  2XO7 A;  1KTV A;  2WCX A;  3HHE A;  3HVA A;  1O51 A;  2UU9 J;  3UVJ A;  1UFL A;  1ARO P;  2KT2 A;  2DR5 A;  4FYW B;  2W9B B;  4H4M A;  1Y5L B;  4B9T A;  3W3S A;  2GVD A;  1KLM A;  3NGD A;  4CZC A;  1HAR A;  2JLE A;  2VON A;  4X66 J;  4FZV A;  2FLP A;  4ZLN A;  4ER8 A;  3M8P B;  2F3J A;  4WBF A;  1M90 T;  2H3E B;  2RS8 A;  4QOT A;  1VK3 A;  2RVJ A;  2B0G A;  3IM9 A;  2C2K B;  3J7Y I;  2JHE A;  4NLY A;  1HI8 A;  1CJT A;  3I82 A;  2J0Q D;  4ECT A;  3OLA A;  4K0K F;  4CH1 A;  3GZ7 A;  3U7J A;  1NZ8 A;  2DO0 A;  3AOC A;  4YEA A;  4DL5 A;  2QL7 B;  3MMB A;  4MKV A;  1ZYQ A;  2ZNZ A;  3J80 Y;  1TR0 A;  3HZG A;  2YQ1 A;  2MHE A;  1M5V C;  4V19 X;  3EXC X;  1I5O B;  2DRB A;  2P2C B;  4GC7 A;  4FN5 A;  1HBN B;  1VQ8 S;  3HI9 A;  2V69 A;  3FDS A;  2HVI A;  1D1U A;  3V6H A;  2K3I A;  1F6T A;  1TK5 A;  2D9O A;  4ZPT R;  3BO3 A;  4B3T F;  1S9E B;  2Z4P A;  4YHH J;  2XM3 A;  1K8A T;  2NXC A;  2IMW P;  3DI6 A;  2Y1J A;  3K8V A;  4ZMM A;  1EJ7 L;  2JLG A;  2OFH X;  5IXU A;  4IFY B;  4DX7 A;  1N34 J;  2R4F A;  1HNZ F;  1IBL J;  3IS9 B;  4J9R A;  3MI7 X;  2EBG A;  3QT8 A;  1VBX A;  3OR1 B;  2VOP A;  4K5S A;  1BHN A;  1NJW A;  1HR0 F;  3DRP A;  4Q8F A;  1LK5 A;  1LWX A;  3TO8 A;  3NKY A;  1N33 F;  4HDH A;  2EEY A;  4DUT A;  3TOQ A;  5KOX A;  4ZVF A;  1HBU A;  3G87 A;  3CCZ A;  4LSL A;  2CJQ A;  3AD8 C;  3Q2S C;  3EVW A;  2QLJ B;  1IKV B;  2RU3 A;  2B6A B;  3MCS A;  1TL7 B;  4DR4 J;  3ZZU A;  2QLF B;  3TVK A;  4YFU A;  2RRA A;  2VIH A;  1W2B R;  1EIY B;  2YPY A;  4CNY A;  3HVR A;  3E51 A;  1SV5 A;  4PZV A;  3KLV A;  3TJ8 A;  4KGZ B;  5L1J A;  4KFB A;  2XS5 A;  2DIU A;  3SYZ A;  1UAW A;  1URN A;  1ZA2 B;  3T5L A;  3HHD A;  1TMJ A;  1MNE A;  1RAA B;  2I9S A;  1WAC A;  1H6K X;  4OFZ A;  4YB6 A;  4J9V A;  4ZIW A;  1VQP S;  4M5K A;  1YZ7 A;  2OD6 A;  3M9N B;  1PJ7 A;  3JSB A;  2CJX B;  3RB6 A;  2ZD1 B;  2JZ5 A;  1YVF A;  2WVF A;  3RU0 A;  1XIQ A;  4CH0 S;  3AHP A;  3V81 A;  2VL1 A;  1XMQ J;  1K1Q A;  1RTJ B;  4C97 A;  4J37 A;  3CJK A;  5KFL A;  8RUC A;  1ULR A;  1UA0 A;  3CCM S;  2VUG A;  1ZM3 A;  3UDV A;  3HHL A;  2VBW A;  4U7C A;  3KXD A;  4ICL B;  2RD5 C;  2HHS A;  2JC0 A;  1JLE B;  3NG8 A;  1RWM B;  3T5J A;  5I42 B;  3HSZ A;  1FFW B;  4BS2 A;  3K8W A;  1RYR A;  4HI2 A;  4EO6 A;  4QIV A;  1QM9 A;  2WSC C;  4U8Y A;  1G3O A;  5EWE A;  5J2N A;  1SKR A;  1LWE A;  4Z2X A;  3M1V A;  2DR6 A;  1RT4 A;  2CPD A;  3X3U A;  1N5Y A;  1MLA A;  1T3N A;  3HF5 A;  4P2M A;  4GVL A;  2M3D A;  3VGT A;  1HNW F;  2HAI A;  3SZ2 A;  3UD5 A;  2P6S A;  2RQM A;  4ANE A;  3IP0 A;  1K9M T;  2VFT A;  2XS2 A;  2N4C A;  1HWI A;  4GO7 X;  5A2Q U;  3FCH A;  1H7W A;  3OUY A;  2AYB A;  4ILL A;  5GMK a;  5K8P A;  4NZ7 A;  4WPA A;  3OTB A;  3OVB A;  3WC2 A;  4RO0 A;  3RW6 A;  4FXV A;  3KK3 B;  1QVG R;  1M1H A;  3DHX A;  1N5Q A;  4ZVU B;  5GMD A;  4C4W A;  2COL A;  4ZVP B;  1Y10 A;  1VK8 A;  4HEA 9;  3MFI A;  1UEK A;  2B4O A;  3QSI A;  2X1B A;  4FKY A;  2HHQ A;  1URR A;  2ZUA A;  5F0W A;  3OTO J;  1NLK L;  5HJX A;  1HNX F;  2LXI A;  3OW2 R;  5GAG U;  1WOP A;  1RHR B;  3PJW A;  1EET B;  4PWD B;  5KT2 A;  4JI3 J;  2X1G A;  3GV5 B;  1NDK A;  2A1B A;  1RAG B;  4DR6 F;  1T05 B;  1F9H A;  1IKW B;  4ANC A;  3TX8 A;  3IA0 A;  2ATC B;  2YWG A;  2BJE A;  5E3Q A;  4RW9 B;  1TUV A;  5DS7 A;  3SCI E;  1FKO A;  4OI2 A;  5C2G A;  2IHR 1;  3NXZ A;  1ZM9 A;  3PFE A;  2HHW A;  2JRS A;  2G4B A;  1LWC B;  4DPY A;  3MEG A;  2XYH B;  3NRB A;  5HL7 Q;  1UVN A;  1X9M A;  4K7Q A;  2JFD A;  2V8H A;  2AD9 A;  5GME A;  2UP1 A;  4J9O A;  1YQH A;  4NLS A;  4KYZ A;  2L48 A;  1NH8 A;  3M32 B;  5C42 A;  4UF4 A;  3GFH A;  2G2Z A;  1L3V A;  2R7W A;  4M8L A;  1HBM B;  1EZZ B;  2DNM A;  4MFB A;  4WIQ A;  2HFO A;  3I4H X;  1IWA A;  1UWB A;  3DLL Q;  1U4B A;  2V9K A;  4IDK A;  4ECY A;  5B0A A;  4L74 A;  1X4C A;  3GYX B;  3D5M A;  2VBZ A;  2ABY A;  4CO0 A;  3MF5 A;  2ROE A;  3F0N A;  1GX5 A;  5EGY A;  1S5Z A;  1Q53 A;  2YWK A;  3LO3 A;  1RWV B;  5IV4 A;  2MY7 A;  2NUU G;  3QIP A;  4NLP A;  4EFA C;  4C0B A;  1VBZ A;  2VPZ B;  5HI7 A;  4C48 A;  2GFF A;  2RIJ A;  2AJF E;  4LJM A;  1MWZ A;  1VQY A;  2WVD A;  4I6Y A;  2QSF A;  4K4W A;  2W4C A;  2E9Z A;  3SCL E;  4DQQ A;  4A48 A;  1N36 F;  4F3O A;  3JYT A;  2D41 A;  3QID A;  4JI8 J;  1RDR A;  4A8S A;  1Q1K A;  4ENO A;  1UET A;  5RUB A;  1FNO A;  2L9D A;  5KT6 A;  3S6E A;  5KOW A;  3FRY A;  2YKN A;  1JNZ B;  2VOO A;  2JWN A;  1NK9 A;  1XNQ F;  2WOM B;  1GK8 A;  3BB5 A;  2XY5 A;  1N4L A;  3TAQ A;  2G1D A;  4J9U E;  2ZOM A;  1WKK A;  4YME A;  4I2P A;  1FD8 A;  4QWC A;  3EIC A;  3ZTP A;  1GXL A;  1U02 A;  1H98 A;  2LXU A;  2UXB J;  3KLF B;  2KVQ E;  4LSZ B;  3U27 A;  3G6Y A;  3CPW R;  2B5J B;  4IR1 A;  4JI2 F;  2RJZ A;  2FJA B;  1S1U B;  4MKY A;  1WF1 A;  2J8A A;  2ZBI A;  3PX6 A;  5B0E A;  5HVG A;  3POT A;  2E1C A;  1Y11 A;  5J2Q A;  4B02 A;  2OPP B;  4DV2 J;  3W9J A;  5ETV A;  1MRO B;  4ZS6 A;  3GJR B;  4JUZ A;  3DHW C;  4KY3 A;  1X4E A;  4EBD A;  2DGV A;  3IN5 A;  4O3R A;  4B3M F;  3D28 A;  2XSJ A;  2YPZ A;  1WI8 A;  3BBF A;  3L95 X;  3MCO A;  2RU9 A;  1HNV B;  1GEH A;  3QJL A;  3PCO B;  5IM0 A;  4LUB A;  2HRU A;  4XAK A;  3G6X A;  1HNI B;  4RUH A;  1FXD A;  2DR9 A;  1A0O B;  3JQJ A;  1W7W A;  3HFZ B;  1R0B G;  4O3P A;  3HHL C;  3UE2 A;  5J2P B;  4XO0 A;  2LLZ A;  1KRP A;  3DKD A;  4W4M A;  2MZT A;  4X84 A;  4NLR A;  3QO9 B;  4TNO A;  2RF2 A;  2BAN B;  1SIZ A;  4OLO A;  2YKO A;  1SQG A;  4YUD A;  1MW7 A;  2B43 A;  4QU7 A;  4ZJO A;  2DT9 A;  3PR4 A;  3DLK B;  2VBY A;  1P1L A;  3ZTQ A;  1FDD A;  5G0R A;  4M5G A;  1F0X A;  2E1P A;  3DLG A;  3K5O A;  1VLY A;  2AV5 A;  3BKU A;  3KHH A;  1D0E A;  2X51 A;  4DL7 A;  2D3U A;  4AL6 A;  3UNY A;  2R7O A;  5GAH U;  4OLP A;  3SSR A;  2V2V A;  2WRM A;  1HWL A;  4HTJ A;  5KFC A;  1OY6 A;  2UUC J;  4LFC J;  1N36 J;  1OPZ A;  2O66 A;  1B7Y B;  4RLE A;  1C0U A;  1Y3K A;  4AE5 A;  5C5J A;  1XER A;  3M6U A;  1RIS A;  2KN4 A;  2P8I A;  4UTG A;  2HW3 A;  4DG1 A;  5CXT A;  1CVJ A;  2NXE A;  4CLL A;  3KJQ B;  4I6A A;  1NK6 A;  4OQJ A;  5CYJ A;  1F5B A;  3IG1 A;  2I1R A;  4TXS A;  2BJ1 A;  2HFZ A;  2XLJ A;  2OKQ A;  1EB0 A;  4L3K A;  4WJB A;  2QA4 S;  4P52 A;  1CG2 A;  2MST A;  1ZPW X;  3NCR A;  2CRL A;  1RWN B;  2MKH A;  2ZBP A;  3ADA C;  1G7C B;  5E5N A;  2PE8 A;  4PAB A;  2MQN A;  2LEA A;  2BW7 A;  4QQB A;  4QYZ K;  2VFV A;  3VWS A;  2FJV A;  4ETX A;  2AW0 A;  2YNI B;  1YJR A;  1I94 J;  3TI0 A;  1NAQ A;  3T5H A;  1NCL A;  3GIR A;  3JS9 A;  3FSY A;  3GIK A;  2GNK A;  3DM2 B;  3H98 A;  3CJR A;  5F41 A;  4DX6 A;  2HS0 A;  5KT7 A;  5A0Y A;  3UCU P;  2DNR A;  3D0I E;  4ED4 A;  1RTI A;  5AE3 A;  3J7Y U;  2JC1 A;  2OPS B;  4TLR A;  3SQG A;  5F8J A;  3J81 j;  2OLW A;  1UEU A;  3M4X A;  4PUO A;  1NSP A;  2FJX A;  5DET A;  4ZKA A;  5BYQ A;  3DLJ A;  1RWU A;  2E44 A;  3SBM A;  3ULH A;  3CJ5 A;  2BAC A;  4GKK F;  3I87 A;  3B54 A;  5KFN A;  2B7B B;  2GVD B;  1KLM B;  1MG7 A;  1SIW B;  1HMV B;  2MSS A;  1CQN A;  1SBR A;  2V4J B;  2ZJR Q;  2CPZ A;  2N7Y A;  1KC8 T;  2AT1 B;  5FDL A;  2O5D A;  4HH0 A;  4DV4 F;  4V19 J;  5HBM A;  4DV5 F;  4FBT A;  3Q83 A;  1RA6 A;  4LF6 F;  3RW7 A;  1N5V A;  2RHS B;  3VAL A;  1ZOT A;  3MMB B;  2QG9 B;  1IUJ A;  1Q7L B;  4G1P A;  1RU2 A;  4WTY A;  4K4Y A;  1A6L A;  1OPI A;  5MLC V;  2FVP A;  5LSO A;  3MM9 A;  5EHH A;  2J0X A;  1VC0 A;  2IJF A;  4M5D A;  1JNR B;  3PKY A;  3MR7 A;  2C3P A;  3DU5 A;  2CNK B;  3DXB A;  2QGF B;  1REV B;  4UQT A;  4YY3 F;  1KKH A;  4O3N A;  1T7P A;  5HAT A;  4DQI A;  3UO0 A;  4HL9 A;  4X64 J;  2CWX A;  2YWW A;  4J5O A;  4P6Q A;  2BE2 A;  2YTC A;  2QC3 A;  3VAH A;  5D0R A;  2XHC A;  1FI4 A;  4R8U B;  1RTD B;  1E6Y B;  4RW6 B;  3OJU A;  4TQS A;  3Q8P B;  3P49 B;  2R8G A;  1FEE A;  1C0T A;  4AYB D;  1GTH A;  4MYT A;  3UCG A;  1NHU A;  4DR2 J;  1RT2 B;  1T9Y A;  2G0C A;  2JFK A;  3PO4 A;  1S97 A;  1PAU B;  2QIF A;  3KUE A;  2EI5 A;  1TP7 A;  1DY3 A;  4UY8 5;  3W64 A;  1FRL A;  5K14 B;  4M94 A;  3CJ3 A;  1HBU B;  3AXM A;  3CJQ A;  2ZE2 B;  4LSL B;  5F8L A;  4U7U D;  1N5S A;  1T9W A;  2DNL A;  3IO1 A;  3T9N A;  2ZIT A;  3KLG B;  3DRX A;  3MOZ A;  2Y0S D;  4BDP A;  3DRR A;  4JI6 F;  1C1C A;  3H25 A;  3A8J A;  4O44 A;  2LKZ A;  2DGW A;  4H54 A;  3B8H A;  3FEZ A;  2N3O A;  1SH0 A;  4KGX B;  4DUZ F;  1XMO F;  4BWM A;  2I2Y A;  1WUU A;  1V3R A;  1SJR A;  3TA0 A;  3Q8R B;  1CPZ A;  2JEF A;  2QLW A;  4PKD B;  2NQP A;  1Q86 T;  1REG X;  1RLD A;  5LJ5 Y;  3TQ1 A;  1DBD A;  3G9C A;  2BUN A;  3MXH P;  2J6T A;  2MKC A;  2QO3 A;  3A13 A;  1FEH A;  4ZP9 A;  4DZD A;  2FZC B;  2E1R A;  3EGV A;  3VAK A;  4J9M A;  1DQ8 A;  2OPR A;  1TTH B;  4DL6 A;  1BGX T;  4C11 B;  4R5P A;  3IRW P;  4FVC A;  4PQU B;  3AXK A;  2ASJ A;  3D1O A;  5LMN F;  3BS9 A;  4USV A;  4EZ6 A;  2E66 A;  3V6K A;  1XR6 A;  1SQF A;  3M6X A;  2X1F A;  4YY3 J;  3HHL B;  3QRQ A;  2WZ1 A;  3GQC A;  3WX8 A;  1NHK L;  4ES2 A;  3TWZ A;  2ZEJ A;  3I56 S;  3NGS A;  3DMJ A;  3P5B P;  3DGP B;  2GGP B;  4KIA A;  4LF8 F;  3NWR A;  2NSB A;  5J2N B;  4IQX A;  4I2Q A;  1LWE B;  1KQF B;  1QAJ A;  1UA1 A;  2V50 A;  2BKN A;  3QRR A;  4N7T A;  3UDC A;  1SUQ A;  2IPO B;  5A8K A;  5KTQ A;  3MM8 B;  3L09 A;  1NRK A;  1X4A A;  1S4E A;  2DHX A;  2X3D A;  3R5C A;  2LU2 A;  5F3T A;  3K57 A;  3N6M A;  1JXV A;  4B3S J;  4DUY J;  5K8O A;  3HCX A;  1KSP A;  4YDD B;  3LGM A;  2A18 A;  1S6Q A;  2P9G A;  2V0N A;  3I9Z A;  3CW2 C;  2V8V A;  1PYT A;  3PO5 A;  2KKH A;  1FWP A;  5KG7 A;  1ZTW A;  4OZ5 A;  4LRF A;  1C1B B;  4ATN A;  3NGT A;  3TJ9 A;  3IAS 9;  4EZ9 A;  4DV3 J;  3HMJ G;  3Q24 A;  1U0H A;  2EW9 A;  4ZCM A;  2AWZ A;  2ZH2 A;  2KU7 A;  4USK A;  4URS A;  1TKX B;  4ZJL A;  2BVZ A;  4LF4 F;  5LT5 A;  4OJG A;  4K5R A;  1IM6 A;  3RAM A;  4F25 A;  3TVZ A;  4WXO A;  2L3M A;  4NX9 A;  1FA0 A;  3K5N A;  2HLT A;  2LA4 A;  4OZ1 A;  2ASY A;  2HZV A;  2AJ2 A;  4UY8 T;  3W2V A;  3L7P A;  3MAH A;  1FKO B;  4MH8 A;  3NBP B;  2CQB A;  4M63 A;  3T1Y F;  2HHH J;  1TQL A;  3MWB A;  1MN7 A;  4EWT A;  3M8Q A;  2B4U A;  5H9E J;  1KFS A;  1KS2 A;  5B08 A;  3DOL A;  5E3A A;  1XMB A;  2CPF A;  2DGU A;  4F4Y A;  2Z0G A;  4EMD A;  2VG5 A;  2AEF A;  1R27 B;  3PW5 A;  3HSG A;  3H8Y A;  5F9N A;  1K0V A;  1ZBT A;  3MM7 A;  5HMZ A;  3DRS B;  4MFB B;  4I7F B;  1TKD A;  5GAD U;  2B9E A;  4RNO A;  1YBT A;  2G0J A;  4DU7 A;  5KFM A;  2MKS A;  3MMA B;  4WFZ A;  2AHO B;  3BSA A;  3WZ0 A;  1QSY A;  2F1F A;  3FBF A;  4TY8 B;  4ZIV A;  3I5C A;  4KHM A;  5K9F A;  1IM4 A;  1F5C A;  4TU7 A;  2UVV A;  3G6E S;  2XI3 A;  5LMU F;  1GXU A;  3AY0 A;  1NPR A;  5T41 A;  1SVD A;  2E5G A;  2J7W A;  2ZH1 A;  5H1S V;  2LCW A;  3QIP B;  2HWI A;  4AL5 A;  1BQN A;  2RUG A;  4OX7 A;  2XMT A;  2DIV A;  3CCL S;  4HKQ A;  3ENQ A;  3NOG A;  2I5J A;  4W92 B;  3OXF A;  2CJB A;  2DB1 A;  1Q5V A;  1OY9 A;  2RT3 A;  3CCQ S;  3QT5 A;  4LBI A;  3A12 A;  3D9B A;  3IRX A;  4MK9 A;  2G2O A;  3JB9 k;  4WXW A;  2V8D A;  2RB7 A;  1QTN B;  5A2Q Y;  2VV5 A;  4KR0 B;  1TKZ B;  2QLX A;  1L5U A;  2H51 B;  2R7X A;  2K1R B;  1VQ6 S;  2PMH A;  3FNN A;  1TEL A;  4MTP A;  3RG6 A;  2CIM A;  1XQI A;  2CZ9 A;  2KM8 C;  4I1T A;  1YJU A;  2EKY A;  4LMZ A;  3D1H A;  4Q2L A;  1DAR A;  4NXM J;  2JL9 A;  3MED A;  1P8G A;  3C15 A;  1M5S A;  5B0C A;  5HRO B;  1JJ2 R;  4HH1 A;  2WB4 A;  3GYN A;  3H5Y A;  3QMQ A;  3POT B;  3T1Y J;  1B0T A;  3U1N A;  5B0D A;  1MWY A;  4KBI A;  4J91 A;  1S9G A;  4OJH A;  2AGQ A;  2BAB A;  2EG1 A;  4U9R A;  2YKQ A;  1W2I A;  4ZP6 A;  2ZH5 A;  2AGO A;  2HGM A;  3KG0 A;  4CYU A;  2WVB A;  3R5D A;  1LW2 B;  2E9R X;  2WVC A;  2NYI A;  4C8M A;  2E5L J;  2BYC A;  3D7S B;  3PY8 A;  2DR7 A;  3GCX P;  1UVK A;  2J9D E;  1HYS B;  2Y1R I;  2MZQ A;  4FYY B;  1A9N B;  2ZJQ Q;  1KQS R;  3OFH A;  4CH7 A;  3H90 A;  3I4P A;  2W9C B;  3MOJ B;  4KC5 A;  2HHX A;  1FJG F;  4Y6I A;  3FCV A;  2HNY B;  4FP9 A;  2ZHB A;  2WB1 D;  2CDR B;  3CMQ A;  2XLI A;  1Y4Z B;  5F0U A;  5K5M A;  2XTJ P;  4ZPC A;  2VFU A;  3R5J B;  4P75 A;  5HQM A;  3TEG A;  1NDP A;  1NJZ A;  3JQM A;  2DXE A;  3DLG B;  1PIL A;  1XK8 A;  1ZET A;  1N6Q B;  3UCZ P;  2C2M B;  1H74 A;  4EGL A;  3P96 A;  4MIW A;  1Z2L A;  1H3D A;  4P7T A;  2O01 C;  1YJ9 S;  3AB2 B;  4MAK A;  1YWX A;  2V2Q A;  1RT6 A;  4DG1 B;  5HMX A;  3MM6 B;  3QQC D;  4ZVH A;  5ETO A;  3FSX A;  4IH6 A;  5C2C A;  1EHW A;  3IG1 B;  2QYG A;  1VHI A;  1U8W A;  5A8R A;  4V1A k;  3ZZR A;  2UUA J;  3G6V A;  3ZZY A;  4USH A;  5E3C A;  2CZV C;  2XY7 A;  3FFI A;  3VAI A;  4LF5 J;  1VQ5 S;  2P9C A;  5M2R A;  2CFX A;  2MZR A;  1KTQ A;  4IQM A;  4LIW A;  4GKJ F;  1VQN S;  3AJD A;  4MYU A;  3MPD A;  2J0W A;  3RRH A;  1LK7 A;  1EKS A;  2ZOF A;  2BEF A;  6FDR A;  1RTI B;  1D9F A;  4M5I A;  3PIP Q;  4AQY J;  3PYF A;  1PYO B;  1YI2 S;  3SQG B;  3G2X A;  3TAN A;  1RQ0 A;  2QEX S;  2FGO A;  2HHU A;  5L38 A;  4DR1 F;  2KHC A;  4PUO B;  1LXN A;  4TYA A;  1MMD A;  4ZLJ A;  1RAI B;  3M9O B;  4AND A;  4XTT A;  1YDL A;  3DOM B;  4JB8 B;  1Q78 A;  1RT3 A;  3VAG A;  3EGW B;  2W1B A;  5F3Z A;  3MGJ A;  1N88 A;  1FWL A;  3AFG A;  2GA7 A;  1E6V A;  1PAE X;  4P2F A;  3HZE A;  2LMI A;  3HSD A;  2OAU A;  3M30 A;  2ZH8 A;  1TL3 A;  1WEL A;  5KFO A;  2R8I A;  2KT5 A;  5BR8 J;  5HO4 A;  2V9W A;  3OJS A;  3CDE A;  4GVB A;  2EK1 A;  5FDL B;  5KAK A;  2MZJ A;  4RU2 A;  2C2D A;  2ZZN A;  2FLN A;  4HHJ A;  5E3R A;  2FD2 A;  1NKC A;  3GU0 A;  3I0R B;  1WEX A;  4RW8 B;  2C2E A;  1D9D A;  3IFE A;  3MEK A;  2DHH A;  1RHQ B;  2CAJ A;  3HVT A;  2RUS A;  4NYO A;  3GSI A;  1WF2 A;  2HQC A;  3L4B C;  1RGV A;  1R6V A;  2GMH A;  2AEM A;  5L9X A;  1IQT A;  2MZ1 A;  2OH2 A;  2DXD A;  3KOA A;  3PW2 A;  3RBE A;  2PT0 A;  2A10 A;  2NYH A;  1P1T A;  4MKB A;  2MGZ B;  1U48 A;  4RUC A;  4DQR A;  1B0V A;  2RHQ B;  2GS8 A;  3ENW A;  2GAH C;  1Q8I A;  3R2C J;  2EKN A;  2DHG A;  3MEE B;  2DO4 A;  2V8P A;  1IJE B;  3M8Z A;  1LNQ A;  2GJ2 A;  4PEO A;  2BA9 A;  3G82 A;  3S8S A;  1F1B B;  4LRD A;  2ACY A;  2FZG B;  4G3I A;  3C14 B;  3KMS A;  4DV7 J;  1HWU A;  1XR7 A;  1UW4 A;  4O3O A;  1KLN A;  3GFY A;  3W60 A;  8AT1 B;  4RW4 B;  4MIA A;  4TU9 A;  2VPY B;  3GR1 A;  5IC4 B;  5DM6 Q;  3PW4 A;  4DJB A;  4N41 A;  4XPC A;  2OEM A;  4C8K A;  1X31 C;  1UPM B;  3CJ8 A;  3FCW A;  4NLD A;  2PDA A;  3I9V 9;  3EE3 A;  2Y1I A;  2EPI A;  2D1C A;  2VKZ G;  2V63 A;  4ZIT A;  4M5L A;  4O44 B;  3CDW A;  2EC2 A;  1HHS A;  4JV0 A;  1OO0 B;  1RTZ A;  3Q2T C;  3EXY A;  3N6N A;  2HBY B;  3Q23 A;  2C3M A;  3KLH B;  1FRM A;  1P9Q C;  3IXQ A;  2DGO A;  1GMW A;  2BKP A;  3GP9 A;  4C3K A;  3QWU A;  3OL6 A;  2CQG A;  3LGN A;  3OR2 A;  3M2U A;  2OEK A;  3AD9 C;  2HEK A;  5FD1 A;  3PNI A;  2IAJ A;  4OHZ A;  2E1M C;  2ACM A;  4KH0 B;  2A2C A;  3PG9 A;  4R5P B;  2CQ3 A;  4LBP A;  3VV2 B;  3N28 A;  3Q0A A;  2IA0 A;  3EZU A;  3N6L A;  1WC4 A;  2K7J A;  2YX7 A;  3PYD A;  3K5L A;  2CQ1 A;  2AJ1 A;  1I6J A;  2H1Y A;  4L6V 3;  2VG6 B;  1YBU A;  5HLF A;  1GT8 A;  3AOA A;  3CIZ A;  3PYE A;  3QT6 A;  2R2U A;  4Q0B A;  3DMJ B;  2ZBQ A;  1GAO A;  2BQR A;  1XNR J;  2PC6 A;  2DGT A;  4DL0 C;  2VQF F;  2OHD A;  1D09 B;  3CUN A;  3QAE A;  2UUT A;  1S6P A;  3R97 A;  4YP3 A;  5KG5 A;  1N32 F;  4ED7 A;  4WE1 A;  3D6H B;  3IBF B;  1WG4 A;  1RKI A;  1M5K C;  2BM1 A;  4LFB F;  5DG7 A;  5KFK A;  1DQA A;  1UEV A;  2O1P A;  2YNG A;  1VDH A;  2CVE A;  1UJ4 A;  2PN6 A;  2HVE A;  2IJN A;  1TKT A;  5F9L A;  4RNH A;  2DIS A;  1FJE B;  3LP1 B;  2J6U A;  1S1V A;  1Q0N A;  2E29 A;  3LH2 S;  1WDT A;  1VCT A;  4OI3 A;  2WAQ D;  5HMY A;  1S6Q B;  4ED8 A;  4H4O A;  3P45 B;  1S79 A;  2F5G A;  2GIR A;  1WHV A;  4BWJ A;  4OYA A;  4I4B A;  1DTT A;  3R1L A;  1GMV A;  1F3F A;  2O67 A;  2RQK A;  2WBR A;  3NAI A;  3M8S A;  1U09 A;  4DQP A;  2UXC J;  2AJ4 A;  1JLQ B;  2B56 A;  4A8Y A;  2LEC A;  2C2N A;  5A8W A;  4PPZ A;  3V6D A;  2HAF A;  2QA1 A;  3KK1 A;  4ERD A;  1RYS A;  1F60 B;  2M9K A;  1RA7 A;  2F7V A;  2K2P A;  4U8V A;  3LP2 A;  1UKU A;  5HN0 A;  4A47 A;  3UW1 A;  3KLE B;  4UZB A;  4FYV B;  3O6Q A;  4DR7 F;  4JI7 F;  4RKU C;  5ETS A;  1FKA F;  3CD0 A;  4NCG B;  2XMV A;  1D8Z A;  4XDD A;  4ECX A;  3DOL B;  2HRT A;  1NH7 A;  2OIH A;  2GQ2 A;  2IIH A;  5GAG I;  4GRS A;  3KFW X;  3RGI A;  2VQF J;  1RHK B;  2M7S A;  1FRJ A;  1CUL A;  1TL1 A;  5CYQ A;  2WON A;  5KFF A;  5A6W A;  4NXN F;  1H2T Z;  4PAA A;  3TVY A;  4F7V A;  2F4V J;  4BC9 A;  3B6B A;  4IO1 A;  4DL2 A;  3RUB L;  2H65 B;  3OQ2 A;  1O6X A;  5KG3 A;  3FBC A;  4OX9 F;  4JYA F;  4LFB J;  4KJI A;  5CHC B;  1U2F A;  3PRB A;  2FQQ B;  1AFI A;  4WYW A;  2Z2L A;  3MR5 A;  4ECZ A;  1VRT A;  2EC0 A;  1LWF B;  3NS5 A;  4QIW D;  4DSK A;  5BXI A;  1X4G A;  1BQN B;  4KHP F;  4NYP A;  1Y00 A;  2OEL A;  2IRU A;  2XSF A;  2FLL A;  2DHA A;  2SXL A;  4IG3 B;  5B0B A;  2R7R A;  1LFP A;  1S59 A;  4GC6 A;  5D4O A;  1R8P A;  2UV8 G;  3W5Z A;  1IKY A;  2BR0 A;  4B3R J;  4TLQ A;  2AX1 A;  2WW4 A;  1YG0 A;  4HLB A;  2BQ3 A;  4JI0 J;  2QYC A;  3TUJ C;  4RNN A;  1G2E A;  4QIG A;  1K1S A;  2KB2 A;  5HP1 A;  4C8Y A;  5H9E K;  1EQM A;  4ZVE A;  2LDI A;  1F2H A;  2N4D A;  4WZQ A;  3HT3 A;  2BOP A;  1CJV B;  5CA5 A;  1V6H A;  2H9Z A;  4LSN A;  1VMB A;  3W5X A;  3DLH A;  1X5T A;  1KDN A;  4J7C A;  4DSF A;  3G8T A;  3C15 B;  3HPO A;  3ET6 B;  3FGV A;  2KG0 A;  3TZW A;  3M2R B;  2HK2 A;  2VJU A;  3SDE B;  3VGU A;  3MAA A;  1HBO B;  4DCP B;  3BGL A;  4RBT A;  1S7I A;  2O3D A;  2IJR A;  1N48 A;  2R8K A;  3RB3 A;  1J5E J;  3B82 A;  2F8E X;  4OYZ A;  2HMI B;  3R8Y A;  3T1H F;  1NSQ A;  1BE4 A;  3Q22 A;  3HSJ A;  1FK9 A;  3F73 A;  1YGY A;  3U1M A;  2CNL B;  3EGN A;  3TA1 A;  4RPF A;  3D67 A;  4ID5 B;  2CDQ A;  1MU2 B;  3R6G B;  1TK8 A;  2CVI A;  2M8H A;  4DU8 A;  1Z4U A;  4NA3 A;  3PW7 A;  1X0P A;  4KO0 A;  3W9H A;  2GVZ A;  1YIT S;  1K0T A;  1JK9 B;  1VJQ A;  1DTQ B;  3E2E A;  1JWW A;  1PCA A;  3JQK A;  1S1T B;  4LF9 J;  1KNZ A;  4DFM A;  3BM7 A;  1KHW A;  5K8M A;  5F8N A;  5KFH A;  2ZBR A;  5LOQ A;  2C22 A;  2YKP A;  3R27 A;  5I3P A;  4UOG A;  4Q5V A;  1RTH A;  4IOA Q;  3KDN A;  4RW7 B;  2FJE B;  4DV1 F;  4ES1 A;  4WP3 A;  4KHP J;  1DUR A;  2BV3 A;  2DY1 A;  3J7Z T;  4LT6 A;  3BGR A;  4C3L A;  2J0S D;  3NLC A;  2IRY A;  2HRY A;  5KFI A;  3QFH A;  1SPB P;  3C3L A;  9ATC B;  5ETN A;  1U6Z A;  4PXC A;  2NPI A;  4K4Z A;  5L46 A;  1ZZF A;  4A8O A;  4B3O A;  4LFA F;  5IZH A;  4Q43 A;  3MPW A;  4OYP A;  3LTO A;  4JI4 F;  3CJS A;  3D3B J;  2W2N P;  3J7A N;  1NXI A;  1IBM J;  3PHT A;  1EKR A;  3BQ1 A;  2B8Q A;  2W4D A;  2L08 A;  4A8Q A;  2QL5 B;  2R7Q A;  1SJQ A;  4M1K A;  4P2S A;  1SC6 A;  1B4S A;  1JLF B;  4B17 A;  3HT0 A;  3HFK A;  4LIR A;  3PYG A;  2HLU A;  1UMJ A;  3KHG A;  2XGP A;  5GAH I;  3VVT A;  1YK9 A;  3EYZ A;  2CQ0 A;  2RRN A;  4DR5 J;  2OMO A;  2GV1 A;  2WHO A;  2MDA A;  1YRU A;  3V4I A;  4PYA A;  1QVF R;  1Q8L A;  4KPC A;  4C8N A;  4ED0 A;  1RT1 A;  1FKP B;  1R6Y A;  4FF4 A;  1DLO A;  4Y3C A;  2QMX A;  1FRI A;  4OV1 A;  3ITH B;  4R0E A;  2RH3 A;  4ECU A;  1S1X B;  5I3U B;  1WHW A;  2DEI A;  2W9A A;  3MMC A;  1T9V A;  4Q44 A;  1B7F A;  5EX0 A;  5DDQ C;  1O0P A;  5C24 B;  2MZS A;  2W8L A;  3RR8 A;  4FF1 A;  4ZPB A;  2OFG X;  1IJF B;  3OL8 A;  3UNG C;  3NP5 A;  3RRK A;  2V6A A;  1GH8 A;  3TAM A;  1RT7 A;  2ZVS A;  2HFS A;  3BJY A;  4TYB A;  2OJ3 A;  2HND B;  1RT3 B;  3K59 A;  3KK2 A;  1XR5 A;  5J1P A;  3W2W A;  2FLO A;  1U47 A;  2ZH7 A;  3O5T B;  4KQZ A;  2CNO B;  4DV1 J;  2BRK A;  4NLO A;  2YKM A;  5DZ7 A;  2DJW A;  2NZC A;  3DDK A;  1XEZ A;  1TL3 B;  4QPT A;  4E2F B;  1HL6 A;  4GVB B;  4PR6 A;  2C3Y A;  4DSE A;  3BGO P;  2G1H A;  1RWX B;  1BQM B;  4YR3 A;  2CXE A;  4EYI B;  3NEK A;  4X4R A;  4H4K A;  2D3O 1;  5AXL A;  4Q7A A;  2E9T A;  4OZ3 A;  1KD1 T;  3M8Y A;  1N54 B;  4DPU A;  3W9I A;  2FDN A;  2JH3 A;  3OFG A;  4J90 A;  4CLK A;  1CJK B;  6FD1 A;  2MTL A;  4JI4 J;  2ZUG A;  2HNZ A;  5J2M A;  1LKZ A;  2R9L A;  4WWS A;  4LF7 J;  3MEC A;  1EAR A;  5AE1 A;  3DU6 A;  4B9N A;  3D4J A;  5G4D A;  3TAP A;  4IH5 A;  4OJ1 A;  1XN9 A;  3C6U B;  3FEX B;  1S6O A;  4DN0 A;  2YH1 A;  4WFA Q;  4Y34 A;  4ZCL A;  4Y65 A;  1AB8 A;  5E33 A;  2CPE A;  2BOA A;  3QT7 A;  2YXL A;  4JP8 A;  3NOC A;  2RE1 A;  3MM5 A;  1O5J A;  3G4S S;  1KQK A;  2QA2 A;  4CLZ A;  3VGV A;  4J9Q A;  3ZZ0 A;  2YNH A;  3SV4 A;  2W25 A;  3GMG A;  1CJU A;  3HHL D;  3E01 A;  2B7C B;  2MXY A;  2UUB F;  4RJV A;  2OSR A;  5ETM A;  2DNP A;  3NNC A;  2H5I B;  2K3K A;  1V3Z A;  2Q1L A;  4ILR A;  2KZM A;  4LF2 A;  1VBK A;  2M88 A;  4CO3 A;  4TN2 A;  5KFT A;  1OMS A;  3O2I A;  4IRD A;  1FX4 A;  1TVR B;  4AFF A;  5KG1 A;  4C8Z A;  1UZH A;  3EPG A;  3U1L A;  3K2Y A;  2HUR A;  3RBZ A;  1UZD A;  4HT5 A;  3M8P A;  3LPY A;  2UVR A;  5KFB A;  2XUL A;  3RRG A;  2E5H A;  3ZZT A;  3MR3 A;  3BPD A;  2UVW A;  1CC8 A;  3QGH A;  1H2V Z;  4ZPW R;  2OI2 A;  3BSC A;  5T14 A;  4Z37 A;  4UQG A;  3OTC A;  4WFB Q;  5AXM A;  3E8O A;  2FVQ A;  4OYW A;  4O4G B;  4OZL A;  4ZPD A;  4NI2 B;  2K8G A;  4K0K J;  5KFA A;  4X4N A;  4P74 A;  4CM2 A;  1VQL S;  2AX0 A;  2JEJ A;  4U95 A;  2GO8 A;  3D1Q A;  4OMF G;  2P9E A;  5AE2 A;  3OSN A;  1HBN A;  2JVO A;  2ZWP A;  3IC1 A;  3Q86 A;  1U1P A;  4ZVT B;  2N82 B;  2IM2 A;  5KFV A;  1S10 A;  1KFD A;  1RT5 B;  2C2O B;  2XWX A;  4UOH A;  1QLN A;  1KN6 A;  2QMW A;  5D78 A;  3CDB A;  3KUH A;  1S9E A;  1L3S A;  5KFR A;  1TU0 B;  5KT5 A;  1UFW A;  1G6B A;  4ZHR B;  3WIV A;  4F04 B;  2G0I A;  2IVY A;  4IFY A;  3PRV A;  1VYA A;  4B3T J;  3IS9 A;  4K8R A;  3NWG A;  4IR9 A;  1BC6 A;  4C8O A;  3UD4 P;  3HFV A;  5KFJ A;  4EUV A;  1HNZ J;  5KFX A;  2IFX A;  3UR0 A;  5DG9 A;  4IYQ A;  1X4D A;  4DR3 F;  2ALZ A;  3W8G A;  4I64 A;  1FNM A;  2NXN A;  1VC6 A;  2YNG B;  1NM2 A;  2GJF A;  1HR0 J;  2H4Y B;  2DTJ A;  4JBC A;  1ZZN A;  2D7S A;  2CG4 A;  4IG0 B;  1PBU A;  1PG5 B;  1FHT A;  2IVF B;  1IKV A;  1N33 J;  3QPI A;  5CZV A;  1TL7 A;  4WII A;  2RKI B;  3BF4 A;  4EU0 A;  3EVO A;  3AOD A;  3IBW A;  1N5T A;  3NNA A;  2CPJ A;  3AQO A;  3D0G E;  5FJ4 A;  4C0O C;  2AQ4 A;  4H4O B;  2R7V A;  1S0V A;  3BDE A;  4DZ6 A;  2EFO A;  1OWX A;  2OPQ B;  4NEY A;  1U1R A;  5CAB A;  2HG4 A;  2XY6 A;  5KFW A;  3OHA A;  2KDO A;  1KVK A;  2F8H A;  1R8B A;  2M2B A;  3AT1 B;  2RIL A;  5SZT A;  3H42 A;  1JLC B;  4BBY A;  3CE8 A;  2X1A A;  1ZH5 A;  4ELV A;  1OJ4 A;  3S01 A;  3V6D B;  3KDO A;  3M2V B;  1U0S A;  1RWK B;  3CNQ P;  1PIE A;  1B70 B;  3LP2 B;  5ETL A;  3QFW A;  5KG0 A;  3MTJ A;  3DLB A;  4ED3 A;  2I8E A;  1JX4 A;  1RTJ A;  4WKR A;  2U2F A;  1DFD A;  2RRB A;  2IC3 B;  2HGN A;  2L9N A;  1VLO A;  3Q8S B;  2YBV A;  3LWM A;  4X62 F;  2KXH A;  4ICL A;  3SFG A;  5BYS A;  4H4K C;  4F4A A;  1JLE A;  3BN4 A;  4F36 A;  5I42 A;  1UW9 A;  3H5X A;  5EX3 A;  2R3V A;  1LEO A;  2ZM6 F;  4YS2 A;  3MCM A;  1FF2 A;  1PC4 A;  1WDD A;  4EEY A;  1QUP A;  1CUL B;  1TL1 B;  1VRU B;  2YNF B;  3D2W A;  3UR3 C;  4DQS A;  2HVD A;  4LQ3 A;  2DIT A;  1T9T A;  5B7W A;  1VHF A;  3UN3 A;  4NLQ A;  2R2S A;  2DNN A;  2EFG A;  4S0M A;  1HNW J;  1VRT B;  3KLI A;  4OYX A;  3A8E A;  2D9P A;  1SC4 B;  4OIX A;  2DR8 A;  5DO2 A;  4OHW A;  4DFK A;  4Y2A A;  3GYG A;  4DX5 A;  4QU6 A;  3JSM B;  4QWB A;  3PKM A;  1J27 A;  3W8P A;  3BN7 A;  4DV6 F;  3NNH A;  3R5B A;  1SC1 B;  4DV0 F;  3SV3 A;  4DPT A;  2VH7 A;  3C6T B;  2FY8 A;  2IM1 A;  2XS7 A;  3EZO A;  5GAD I;  1C4C A;  3M05 A;  5DRK A;  3UQS A;  5K8N A;  1IR2 A;  1KBR A;  2E7X A;  1WG5 A;  1XBW A;  4LRA A;  1EET A;  1KOH A;  1S1W B;  2KT3 A;  4RR5 A;  3S7R A;  2C28 A;  5HP1 B;  1NB7 A;  4WP9 A;  1HNX J;  4DPX A;  2IVM A;  1B64 A;  1IKW A;  4RNM A;  2OD4 A;  2RSQ A;  1JLG A;  5JUM A;  2V4Q A;  1QAY A;  4RW9 A;  4CTA B;  3VAJ A;  2GHV C;  4DR6 J;  1NSA A;  4FF2 A;  2XHW A;  3NGK A;  1ACM B;  1LWC A;  2XG8 A;  3KG4 A;  1ELO A;  3MAA B;  3TAR A;  3THT A;  1GX6 A;  1NJY A;  2R42 A;  3FVY A;  4G1Q A;  1SI9 A;  1X8D A;  4I67 A;  1FE0 A;  4NL5 A;  1WJ9 A;  4FPR A;  3WDO A;  4Y28 C;  1Q82 T;  5MAO A;  2ZM6 J;  1HBM A;  3H20 A;  2XMM A;  2NZ4 A;  2MQM A;  3GFX A;  1FJ7 A;  4DBQ A;  3PAC A;  2WSF C;  2QMU B;  3H2L A;  3QAT A;  1IBK F;  2FVS A;  1XTZ A;  4Z7Y A;  1LW0 B;  3KJF B;  2IM3 A;  5IT0 A;  1SL0 A;  1UPP A;  3ISN C;  1RLC L;  2HK3 A;  5AJ3 F;  2PI4 A;  4OL8 A;  3LAM A;  2FTR A;  2QA4 G;  5J1E A;  4X4P A;  4J9N A;  4ZCI A;  3UI3 A;  2DEJ A;  5D4N A;  1S9F A;  3CWJ A;  3WHI A;  1H38 A;  2VD3 A;  2VF3 A;  4B9M A;  3K58 A;  2BRL A;  4A8F A;  1RAH B;  4XK8 C;  4OJ3 A;  4YR0 A;  5LXR A;  1AZS B;  3BH7 B;  2GC8 A;  3Q8U A;  1U2R A;  4C7Q A;  3C16 B;  1UP1 A;  2CJK A;  1SL1 A;  5JVG Q;  2Y3Y A;  3BGR B;  3CGI A;  3ZNU A;  1DQ9 A;  2C3U A;  1QE1 B;  1S72 S;  2HHP A;  1AT1 B;  4F4X A;  1WF0 A;  4KHR A;  3FBB A;  2VPX B;  4KKO B;  3CCR S;  1S57 A;  1U7L A;  2WOM A;  3H5U A;  2LQ8 A;  3I0S B;  2J8S A;  3D66 A;  3SSS A;  2KL8 A;  1IWG A;  4NLW A;  1HIY A;  2HVZ A;  2FC9 A;  1BLU A;  3TW0 A;  1UJ5 A;  3NY0 A;  2C2Z B;  1J2V A;  5DGA A;  4HDG A;  3KJN B;  4KGM A;  1XNQ J;  2NPF A;  2M5Y A;  2AF6 A;  1IKX B;  4P10 A;  4N56 A;  4NWB A;  3U02 A;  1GTE A;  2GAG C;  2ZKU A;  2BBE A;  5ETT A;  1QUV A;  1KHV A;  2AJQ A;  3R9L A;  3PX4 A;  1W25 A;  3FRZ A;  3LPE A;  4CO1 A;  1JMT A;  4DCO B;  3OL9 A;  4JI2 J;  2D3Z A;  1MRO A;  4OI4 A;  2AYM A;  1RAF B;  4ED5 A;  1NPP A;  4HVZ A;  3CSK A;  1I1G A;  1RT1 B;  3GJT B;  4WCE Q;  1HNV A;  4OV6 A;  1DZ5 A;  7AT1 B;  3GG1 A;  3PFO A;  1HNI A;  4B3M J;  4RUB A;  1PGZ A;  2KFN A;  1HQE B;  1TV6 B;  5F8M A;  4NLU A;  3D6T B;  1EQ0 A;  3CVK A;  1FXR A;  1IBK J;  3DDN A;  3GLJ A;  5J2P A;  2BMB A;  2PEH A;  2KTQ A;  1APS A;  3O3L A;  1R0A B;  4FXW A;  2UU9 F;  1A7G E;  2MKY A;  2IBK A;  1TUG B;  4ETZ A;  1VIX A;  2MQP A;  2QJ3 A;  5KFE A;  1VIO A;  5D4L A;  4C2M A;  3FBE A;  3TRG A;  5EDW A;  3DLK A;  4QIE A;  2APO A;  4X66 F;  2EFP A;  3KK2 B;  3UVJ B;  1FDA A;  1FFS B;  3N9U C;  4DF4 A;  2WK4 A;  3VTI A;  4H4M B;  3NGU A;  3HLU A;  2YKM B;  2IYI A;  3W1Y C;  4CI0 B;  4DSI A;  1UWA A;  4WK1 A;  4PYD A;  5FII A;  1YJT A;  3TUP A;  4F8R A;  2XGQ A;  4BHQ A;  4JI5 F;  1RHU B;  4LVO P;  4F67 A;  1CC7 A;  2YVS A;  1CJT B;  1T94 A;  3DRY A;  1FRK A;  1BWE A;  4F0K A;  4NE9 C;  3OPK A;  1RWP B;  1NEE A;  3R7B B;  3MPY A;  3TYT A;  1WD6 A;  2B8P A;  3VAM A;  2CQD A;  3VZI A;  5J2M B;  1AFJ A;  2CZ4 A;  5D0G A;  3BBC A;  1V5V A;  3FQL A;  2ROG A;  2NXU A;  2XZD B;  4J9L A;  1NUE A;  5DQH A;  2HFV A;  4M5N A;  1TFW A;  2KHD A;  4YHH F;  1UVJ A;  1HKA A;  1YTY A;  3ZZP A;  2B9Y A;  2Z8Q A;  4O3S A;  3K89 A;  4DLE A;  2YNI A;  2ZDP A;  4RL1 A;  2BE9 B;  1SH2 A;  1C2P A;  1N34 F;  2CG8 A;  3IAM 9;  1IBL F;  1X9S A;  3L7O A;  4IFV A;  3DI6 B;  4K4U A;  4XIU A;  1EP4 A;  2BX6 A;  3DM2 A;  4L72 B;  4P2X A;  3QRP A;  1H73 A;  3EPI A;  4U67 Q;  2F8M A;  3M6W A;  2F40 A;  2DHS A;  1CSJ A;  2W8K A;  2PII A;  2W2O P;  3VGS A;  3R3T A;  4RBU A;  3DRP B;  1FRX A;  3HHK A;  3BR9 A;  4RWX A;  3P6Y C;  4D3H A;  4USI A;  1FTR A;  3QGI A;  4DR4 F;  1U2C A;  3DLE A;  3DDI A;  4BLG A;  5HSP A;  2PO4 A;  2VJV A;  3THV A;  3MD1 A;  5HMW A;  4ECQ A;  2DCL A;  3BGF A;  2GHP A;  3X1L B;  3W63 A;  4C3M A;  4ZVO B;  1HMV A;  2OO4 A;  4IUF A;  3MFH A;  2V4J A;  4CRJ A;  3D0H E;  4GKK J;  3TZZ A;  5FLX Y;  4P7V A;  1RZM A;  4YN3 B;  1SV5 B;  1Q8B A;  3H5S A;  4KFB B;  1HLW A;  3MHY A;  5L9N A;  2BZ2 A;  1Y7P A;  4JI5 J;  4NCB A;  2Z30 B;  3CCW A;  4DV4 J;  1WSV A;  3FK4 A;  4DV5 J;  1WEZ A;  3P5T L;  1KR4 A;  4LF6 J;  4CLP A;  3T1A A;  3GTY X;  1XMQ F;  4LRE A;  2P5V A;  1NDC A;  2OGU A;  5E0O A;  5EWF A;  1MWQ A;  1SCJ B;  1FE4 A;  1T9X A;  1REV A;  4EBE A;  4ZCK A;  1K73 T;  2DPJ A;  4CLT A;  3V81 B;  2B3T B;  3UD3 P;  3CJK B;  1RKJ A;  1VQO S;  4OI1 A;  2Z2Y B;  5LXY A;  3US5 A;  3ZTR A;  2FHJ A;  4KT0 C;  4R8U A;  1RTD A;  1E6Y A;  4RW6 A;  1RBL A;  3GV8 B;  4AT1 B;  3DCA A;  3RBD A;  1QY7 A;  2R2T A;  4U7U K;  4DI6 A;  2XCA A;  1N0U A;  1S48 A;  2KJW A;  3CF5 Q;  2QFJ A;  3W5Y A;  5DDP C;  2B51 A;  1RT2 A;  2JX2 A;  1YZ6 A;  1UFK A;  1Y3J A;  4URQ U;  2HQG A;  5B0F A;  3FUY A;  3M1V B;  2ZHO A;  1RT4 B;  2JLF A;  4PCQ A;  5K14 A;  2AYG A;  1N5Y B;  5CCL A;  4I0W A;  2DYA A;  2XMU A;  2ZE2 A;  2ERR A;  3T6B A;  2MKJ A;  4DHV A;  3CMA S; 
#chains in the Genus database with same CATH homology
 4NEZ A;  4KHP J;  1HR0 J;  4K0K J;  4RJV A;  4YHH J;  2VQE J;  5BR8 J;  3R2C J;  4JI3 J;  4B3M J;  4X65 J;  2UXB J;  2KVQ E;  5LMN J;  1N33 J;  3D3C J;  2UXD J;  5AJ3 J;  5FLX U;  4X66 J;  1J5E J;  4DR1 J;  1I94 J;  3IMQ J;  3T1Y J;  1N34 J;  2ZM6 J;  4DR2 J;  5LM7 E;  1IBK J;  2KL8 A;  2MEW A;  1IBL J;  4NXN J;  4DV2 J;  2MTL A;  4JI4 J;  2HHH J;  4JI6 J;  4DV7 J;  4B3R J;  1XNQ J;  4NEY A;  4PWW A;  4B3S J;  4DUY J;  2UUC J;  4KY3 A;  4LF7 J;  1FJG J;  4LFC J;  4OX9 J;  4AQY J;  4JI0 J;  4JYA J;  4JV5 J;  5IWA J;  4DR3 J;  4LF8 J;  5A2Q U;  2MQ8 A;  1N36 J;  3D3B J;  3J80 U;  4DUZ J;  1XMO J;  3J7A N;  1N32 J;  4LF4 J;  4GKK J;  1HNX J;  4JI1 J;  2E5L J;  4B3T J;  1XMQ J;  1IBM J;  2VQF J;  2UUB J;  4YY3 J;  4KYZ A;  4JI8 J;  1XNR J;  4GKJ J;  4HHU A;  4DR7 J;  4DR6 J;  3J81 U;  4LF9 J;  5LMU J;  4JI5 J;  4JI7 J;  2UXC J;  4JI2 J;  2F4V J;  4V1A k;  4X62 J;  4DV6 J;  3W1Y C;  4DV3 J;  2UUA J;  4DR4 J;  3T1H J;  3JAM U;  1HNZ J;  4DV0 J;  4DV1 J;  4X64 J;  5IT9 U;  3OTO J;  1HNW J;  4DV4 J;  4LFB J;  4DV5 J;  4DR5 J;  4NXM J;  4LF6 J;  3R2D J;  4LFA J;  4LF5 J;  2UU9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...