4LF7J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf7J00
4X64J 2KVQE 4JV5J 4V1Ak 4B3RJ 4LFCJ 1HNZJ 4DR5J 4X65J 1N32J 4KHPJ 3D3BJ 3R2CJ 4PWWA 2MQ8A 4AQYJ 4DV4J 5FLXU 3JAMU 4KYZA 1HNXJ 1IBKJ 4JI3J 1I94J 4RJVA 4DV5J 2F4VJ 2MEWA 4LF7J 1J5EJ 4JI7J 4DR6J 1N36J 4DUYJ 4YHHJ 4X66J 4JI1J 1XMQJ 3OTOJ 4LF4J 4OX9J 4JI4J 1N33J 3IMQJ 4DR3J 2E5LJ 1HNWJ 4JI5J 4DV6J 4DR4J 4DV1J 4X62J 4LF9J 3R2DJ 3J81U 1N34J 5IT9U 3D3CJ 4NXMJ 4GKJJ 4LF8J 2UUCJ 4K0KJ 4YY3J 4DV2J 3T1HJ 2MTLA 2UU9J 4HHUA 3T1YJ 1HR0J 4LFAJ 5LMNJ 3J80U 5LM7E 2UUBJ 4DR7J 1IBLJ 4DV0J 4DR1J 4NEZA 4LFBJ 5BR8J 2UUAJ 4B3TJ 3W1YC 4B3MJ 5LMUJ 2UXDJ 1FJGJ 5IWAJ 2VQEJ 4LF6J 2HHHJ 4B3SJ 1XNRJ 2ZM6J 4LF5J 2KL8A 4DV3J 4NEYA 1XNQJ 4NXNJ 4JI2J 3J7AN 4DUZJ 4DV7J 4JI8J 4DR2J 2UXBJ 4JI6J 2UXCJ 4JI0J 4KY3A 5A2QU 2VQFJ 4GKKJ 1IBMJ 5AJ3J 1XMOJ 4JYAJ
chains in the Genus database with same CATH superfamily
2V0NA 2BJ9A 4AT1B 3KDNA 1RQ0A 1N32J 4OJ1A 1AA1B 3OSNA 5HVFA 5IV4A 4A4JA 1TVRA 2MQ8A 5FLXU 1EETB 2KB2A 3UPFA 2CQIA 3Q22A 3UCZP 3DI6A 2ZVSA 4ECYA 2XNRA 4IRKA 5DZ6A 3LTOA 3Q8QB 4DPUA 4ED8A 3DYAA 4P7TA 1UW9A 4DR3J 2B8PA 4UUXA 3A4TA 1NDPA 1U09A 1WG1A 4P7VA 2XBPA 3M8QA 4OJ3A 1SH3A 1WKJA 3UDVA 5T7LA 2V50A 3D68A 4QR1A 5CZXA 4BC9A 3B4DA 3WDOA 1TKXB 3GG0A 4QJVA 2JDJA 2QA2A 3GCXP 3OR2A 4EMDA 4TU7A 1Z2ZA 3EYZA 3DRPA 1EKSA 2VQEJ 3R7SB 3PFOA 2CYYA 3H98A 3OTEA 3HM9A 3P96A 2EEYA 2WCXA 3HHEA 4HT7A 3A8IA 1RTHB 2HBYB 3KWMA 2HGNA 1TUVA 2RNEA 5J2PA 1A6LA 3D54A 5EWFA 1WACA 1MWZA 5LJ3Y 1H38A 4ZCIA 4E98A 2ZH8A 4YUDA 3ZZ0A 2GNKA 3M8YA 1NDCA 2YKMA 3R27A 4ICLB 2V34A 2MLZA 3THPA 2QN6B 2RU3A 4J9MA 1DFDA 1HW9A 3OW2R 3I82A 4OHXA 4X4OA 1K0VA 3GMGA 4R5PA 2ZJRQ 3RW6A 1MWQA 2KT5A 1YZ6A 1OIAA 1U6ZA 1TR0A 2XLJA 2HQIA 5H9FJ 3DKDA 2BX6A 2XYGB 1NB7A 2DHSA 2RMLA 1CC8A 4NYPA 1KEKA 1KTQA 1O8BA 2PEHA 4WXOA 4FYYB 1KBRA 3CF5Q 3C14B 4ELVA 4BS2A 3LOUA 2FC9A 3EVWA 2JLFA 4CH0S 3O2IA 4TVAB 5FDLB 1SJ3P 4JP8A 5CXTA 3B4MA 3D66A 3HLUA 1LK7A 3D9BA 4V1Ak 1RAAB 1V9OA 1YRUA 4XK8C 4DV4F 1N5VA 5F8JA 4M5MA 3HVTB 4M5IA 3NG8A 3C15A 5HQLA 5CAAA 2WSEC 4I1TA 1QAJA 1RWVB 4L76A 1LK5A 3BBBA 4LSNB 4K4ZA 3DLGB 2WB4A 3M2RB 1VR6A 2JVRA 1CS4A 2DHGA 5KFPA 4OYIA 4WE1A 3LP0A 4WKRA 2H54B 2VD3A 5CABA 4NLQA 3QWUA 4HDGA 3HSGA 3IGVA 3OHBA 2XTJP 1DLOA 2UUAF 4PQUA 2NR0A 4DPTA 3POTA 2ZDOA 4QW8A 1RAEB 2X1AA 2D74B 1JJ2R 3D1QA 3KXDA 1S7IA 2QFJA 1SXLA 2K06A 2QEXS 5GADI 5HMYA 2W9BA 4NLRA 1B64A 1PYOB 4CNYA 1HPZA 5CYQB 2HFNA 2AX0A 2D3OR 2BRKA 1D9AA 1TKXA 1ZOTA 4FZVA 3R8YA 4YB7A 4BC7A 3N5FA 3T41A 1IBCB 2DY1A 3IM9A 4NZ0A 1HQEB 2NXNA 3UFCX 2MJNA 4YDXA 1DTTB 3NGUA 1R7IA 4IRCA 2GHWA 4MYUA 1TKTB 4OYAA 4X4RA 3BKTA 4LBPA 2A6OA 2H4WB 1HHSA 2HS4A 3Q8SB 3BPDA 1HHTP 2L48A 1GTEA 3MR2A 4CO0A 3Q8UA 3QBCA 2ZNYA 1I1GA 3TAMB 3UVJA 1VC6A 2YWKA 3F0NA 2DCLA 2V2VA 1GX5A 1KLNA 3G82B 2VG7B 4X64J 4WFBQ 2EC0A 2GJIA 4I2PA 4JB8B 2YY3A 3LP2B 1NK8A 3PX0A 3HKWA 4F4KA 3MEGB 2K2PA 1UETA 3H5UA 3I4HX 4PG6A 2J6UA 2D3ZA 2J76E 1VQSA 4C8OA 4I69A 2R7RA 2XO7A 2KO1A 1IBKJ 1B0TA 5KFHA 3CO9A 4URGA 1FRHA 1XMQJ 3CDBA 1JLQB 2OTJS 2LKZA 4ZP8A 1NKCA 4X62J 4UOHA 2F9JA 5DG8A 3BEGB 4EWTA 4WK1A 5FDLA 9RUBA 4DFJA 1SC3B 2BABA 1HQUB 4UOCA 4DQSA 4M5DA 1KHWA 3G8TA 1WELA 3TEHB 5JVHQ 5L46A 5A8KB 4GO5X 3OV7A 4PABA 3CB4A 3KJVB 3HVTA 2G13A 5KG6A 3MM6A 4IG0B 1RT6A 1MMNA 3EUNA 4LSNA 2NSCA 5CD4H 1ZPWX 2CVIA 3TVKA 3DLGA 4PWUA 1MNEA 4HI1A 4PWWA 1OSDA 3SDEB 3W9IA 3DGVA 1GQEA 4M1KA 4RJVA 2EXUA 3H59A 1KR4A 1LWXA 4USVA 1GEHA 1S57A 1UCNA 1FK9A 4DV6F 4OIXA 2YX4A 2D7SA 3GB0A 4MKAA 4NX9A 4NLUA 2DHAA 2DNOA 3MMAB 1WTBA 1SPBP 3H5XA 3BN7A 2W7PA 1PGZA 3CC4S 3FCWA 1CBKA 5LM7E 1HL6A 1S1VA 4N7TA 2QRRA 4B3MF 3QMQA 3IRXB 2BJ3A 4LF6F 4B9VA 4AL7A 1RWUA 1ZM3A 1B99A 1AW0A 1U47A 3W5XA 5J2QB 4X2BA 2AQ4A 4NRTA 2AJ2A 3UN5A 4ZIVA 2JZ5A 4CQ1A 2MQOA 4PUOB 2NQPA 4J9KA 2WK4A 1HQEA 1TKZA 4Y00A 4L74A 3G8QA 4R0JA 1IN0A 2IDEA 3UD4P 2KKHA 5KFVA 4M5GA 2MKIA 4YQWA 5B0AA 2MSSA 3OFGA 2GHVC 3N9UC 1KOOA 3BO2A 3JYTB 2AYGA 2ILZA 1W2IA 5ETOA 4OLPA 3ILJA 5HROB 5G0RB 1RHRB 1TUWA 3TAMA 2EG2A 4CYUB 2UUCJ 3DGPB 1Y5IB 2E7VA 1SJFA 3LANA 3D0IE 5KFAA 2VG7A 5JUMA 1QAYA 2XM3A 1YQHA 2DR6A 3J80U 1WDDA 2LFVA 1S6OA 3QJLA 3OL8A 1VOMA 1RT4B 3KLEB 1E6VB 3PO4A 5L39A 4F3MA 2YKAA 2HHWA 1XNRJ 4WU2A 7FD1A 4U7UK 4NLYA 3QSYB 2KTQA 5CYMA 4TYBA 2VZ9A 1UVNA 5KFGA 3UCGA 4WZQA 3M8ZA 2YXLA 5A6WA 3KNGA 2IRXA 5AJ3J 3PV8A 3CJRA 1JJHA 3LUYA 5KFSA 5F0WA 4XAKA 3CJ4A 4DSFA 2HAFA 2BJEA 3VQSA 3JTOA 3R7NB 4FF2A 2HMIB 1HQUA 2K8GA 1M5PC 4WFNQ 3Q83A 3PEHA 3NCRA 2ZOMA 2DNPA 3KJVA 5HI7A 1YJWS 1TL1B 1FD8A 4IG0A 4DJBA 4HHHA 2NXEA 2ZE2A 3GFXA 1WC0A 2G1DA 4IH7A 1E6YB 1M5OC 3UD5A 2MKSA 4ZA1A 3HX9A 4DR7J 1Y0HA 2BEFA 3CXCR 4KH1B 4DU7A 3E3XA 1UA0A 3AFGA 2QX0A 4ES1A 3J7AN 1JQGA 4ZITA 1U0HA 2VKZG 2VPZB 3TJAA 4X4QA 2BXJA 4QOTA 2DISA 3OFEA 3BQ0A 1LQ9A 1CULB 3NBPA 1S1XB 3W5ZA 4U95A 3FQLA 1VRTB 4C11B 2GFFA 4C0BA 3HO1A 5C24B 1T9YA 4O3NA 3DHXA 1N5YB 1N33J 2J5AA 4LF9J 3IRWP 1FCAA 3U1MA 3MMJA 1Y00A 2VG6B 5IT9U 2DH9A 3QQCD 4CTAA 2MMYA 3TJ9A 3QZ8A 1FDDA 3EM1A 2M88A 2FLLA 4CT9A 1SC4B 1VQKS 4YP3A 4AFFA 2QA1A 3V4MA 3G8SA 4NASA 4NZ7A 2C3MA 3BV8A 4G1IA 2MZ1A 4DOZA 4P2MA 2VQFF 2KYZA 2AWZA 2DH7A 1VLOA 3FSXA 3QFWA 4A8WA 1TFYA 5HATA 4DR5F 3JYTA 1RWWB 1VBZA 2Y8YA 3CCUS 5HROA 1TU0B 3JSMA 3BBFA 3FRYA 3MEEB 2KHDA 4RW8A 4LR8A 1GXUA 2OH2A 1QTMA 3CO0P 2IVMA 4FBUA 4A8XA 1MLAA 4URQU 2W9CB 1RUSA 1FTCA 2NSBA 2HG4A 5B7WA 2OI2A 2CJQA 2H1YA 4F25A 4B9MA 4IUFA 3TUPA 3BR8A 2GQCA 2C2RA 5IQ6A 2N82B 7AT1B 2J7WA 4RL1A 3NGTA 3KLEA 1U2RA 4X4PA 4FN5A 4CO1A 1VIXA 3N6NA 4JI5J 4B9LA 3GJSB 3JS9A 3OLBA 5DETA 3MUTP 3BGFA 5JJBA 2GW8A 2X7IA 4CLTA 5ETTA 4I6AA 1TELA 2IDLA 3T1YJ 5HMZA 3NY0A 3OVAA 2HPUA 3TWZA 3GFHA 3LAMA 2ZJPQ 4DQIA 4WK3A 4DX7A 4FPRA 5F9NA 2DGWA 3MXHP 1FTRA 2VF3A 4OI3A 1N0UA 3UNGC 3PX4A 4K5SA 2HMIA 4FYXB 3BGRB 4HR2A 2ZHAA 4AD6A 5HQ8A 2CZVC 2F8HA 2XY7A 2AJ1A 2AW0A 5DDOC 3HVRA 5MAOA 1JIHA 1AT1B 3OPKA 4ED1A 3KLIB 4DV5F 4KHRA 3CEDA 2YWEA 1NKBA 2ROEA 3GR1A 2R7SA 2BDPA 1E6YA 2RT3A 3KHGA 3JTNA 5KFWA 4IFYA 3BSNA 4IG3B 4BCAA 2FJVA 3QRRA 4RUHA 1ACMB 1NK0A 4A8OA 1UPPA 2P2CB 1WF2A 4DL3A 4ZP6A 4NXMF 2HQDA 4KT0C 1PIEA 2Z8QA 2O5DA 3LA0A 5L1IA 1APSA 2EFOA 3R5CA 3F41A 1HR0F 1X5PA 3CVKA 2L9NA 2Z2YB 4EUVA 1TKDA 4LFBF 1S1XA 4QU6A 2R7QA 4R8UA 3PYEA 4K8RA 4OLOA 3CJTA 2XI3A 3BKUA 2AJFE 3FSIA 3EPIA 3M4XA 1ELOA 3WIVA 2U2FA 3SSRA 4LBIA 1XMOJ 2UV8G 1N5YA 5HLFB 2BE7D 5M2PA 4USWA 3M8PB 2IYIA 4B9UA 2HKEA 2OJ3A 3MMCA 2H4YB 1Y3KA 3MAHA 3W61A 4F7VA 5DJBA 3PJWA 4J9SA 2BOAA 3T5LA 3H7HB 1RAFB 4K59A 1CPZA 4ZVOB 1VQ5S 4IR1A 3I4PA 3JSBA 1YVFA 2AT1B 4RPFA 1HWKA 2BKOA 4USMA 3PW0A 1JLCA 2E66A 3MAAB 2QMWA 2AGPA 2RKIB 3OXGA 3DLKA 2BANA 2C2EA 3GTYX 1X4HA 3OHAA 3K58A 3RBEA 4K0KJ 2WAQD 3H8YA 2O67A 5IZHA 3U1NA 5LSRA 3W66A 2POKA 2C2OB 3VAGA 2IM1A 1UVKA 1S0MA 3KK2A 4ZPCA 3PRBA 2IBOA 1BC6A 2JLEA 2WVBA 2HHHF 1FJGJ 2OFHX 4RNOA 3N5BA 1RSCA 2E1CA 2ZM6J 2F9DA 4LRBA 2WSFC 1BY9A 2DT9A 1NHKL 4CLUA 1CJUB 3DLJA 3HXMA 1LFPA 1PO6A 2B7CB 4IH6A 3TX8A 2B7BB 5J1NA 5AXMA 4A8MP 2RS8A 5HP1B 3W7BA 1NH7A 3GV7B 4UW2A 2YWHA 2CPZA 1RBLA 3RW7A 2DGUA 3ICLA 4M63A 1IJFB 4JV0A 1WD6A 4CLKA 1J5EF 4LF7J 2EI5A 3AXMA 3HF5A 1D9DA 1G1XA 4WP8A 4LRDA 4HH0A 4J5OA 1BGXT 2HZVA 2ZH2A 5CCMA 5SUHA 4EU0A 3K8VA 2LDIA 4OZNA 4FXWA 1UVJA 2VA2A 4ZCKA 3NNAA 4A48A 2CG8A 5ADZA 1G2EA 4GMKA 3PJ9A 1K47A 1BHNA 3ZTRA 2FJDB 3Q89A 4CLLA 3TZYA 3ZTPA 2ATLA 3KHLA 1NJYA 3KLIA 1B0PA 2E9RX 4JI6F 3CDUA 1UFKA 2QGFB 3MUVP 4DR2J 1K8AT 3M6VA 3C19A 4IG3A 2V94A 4QWAA 2FGOA 3R6GB 4Q44A 1FKPB 4LFCF 2ZD1B 1HW8A 2YNGB 4PXEA 4RBTA 1R43A 3RB6A 2XWXA 4U8VA 2LP4A 1QLNA 2DBBA 4PR6A 4DQPA 2G2OA 3RB0A 3TUJC 2FQQB 1YBAA 4DV1F 3OR1A 4I7FB 4DFPA 1N34J 2GVZA 1N6QA 1HFEL 5K8NA 4QIWD 3MR5A 1Q8KA 3DDNA 1WHXA 4C8ZA 4Y3CA 2HEKA 4WIIA 1I5OB 4DX6A 2QIFA 2XZWA 3PYGA 3KMQA 3GIRA 3BPSP 1CG2A 5HANA 3TAPA 5F8GA 3V6DA 1U2CA 1VJWA 3VGUA 3CULA 1VQ4S 2R8HA 4AE5A 1O51A 3GV5B 1ZAVA 1Z1ZA 2LA6A 3MAAA 3TJ8A 3GCWP 2RKIA 4U8YA 1LXJA 3V4IA 4LF1A 1FFWB 3QNWB 1B7FA 2YWGA 2EC2A 3D4JA 3L7OA 5IV3A 5J2NB 1F0XA 1AZSB 1NSQA 2NCKL 4XIUA 4ATNA 1T9VA 1A7GE 2J9DE 3FMWA 2F8MA 1H3DA 3C3LA 2VHGA 1KQGB 1NUEA 4FXVA 3KHHA 4KQZA 1WSVA 3RBDA 2BE9B 4W4MA 4F4AA 1YG0A 3C16B 1NHUA 3SCJE 3QZ7A 4DV2J 2XG8A 4HEA9 4RU2A 1Q86T 2AGOA 2EWHA 2RILA 1RHUB 1CJVB 3AB2B 1JLEB 4DLEA 3MM8B 1JK9B 3I87A 3PRVA 2FGCA 1RT1B 2VBYA 2J9DA 1IBMF 1DHMA 4OHYA 1H73A 3D1HA 4J9PA 3FUYA 2JRSA 3HSDA 3GJQB 2YNIB 4X65F 2Z30B 2KHCA 1VQPS 3H25A 1H7WA 2V8DA 2M52A 1FVSA 2HQ3A 1XERA 1IKVA 3K57A 2VBWA 4DL2A 5DQIA 1OPIA 2PGCA 3AJ1A 2YH1A 3M30B 3V81B 4Q43A 2BJDA 1S48A 1OY6A 2DY9A 2ZH5A 2ZH6A 4Q2MA 3SEOA 1QE1B 1T7PA 3B8HA 4WU3A 4LFAJ 2ZD1A 1UVIA 2YNGA 1LEOA 1EX8A 2HNZB 1U25A 3GYGA 4QIGA 3QGGA 3CWJA 3RG6A 1QDUB 3M6XA 7FDRA 3RBZA 2NZ4A 4FP9A 4J9LA 3O8WA 4FDFA 2OEJA 1J27A 5KT3A 1EHWA 2OTLS 4CLPA 2R4FA 4UQGA 1FE0A 2Q43A 4WP9A 4JV5F 2IM0A 3MPYA 3EZOA 2YNHA 1KQKA 4NLDA 2MZJA 4IFVA 4ID8A 3GG1A 3SQOP 4I7FA 3TP2A 1UJ4A 2HNYB 4ID5B 2MPUA 2UP1A 1R0AA 1PBAA 2CZ9A 2RDIA 4RZRA 2VPYB 1U1RA 4J9RA 2IRUA 1RDRA 3GSDA 3QFHA 5ETVA 3CIMA 2R8JA 1PYSB 3MMBB 3IBWA 2V4QA 1HWIA 2FJXA 2HFVA 2DNYA 4NLGA 3QRQA 4QQBA 5U47A 3W2WB 2BQUA 2COLA 2RVJA 2W2OP 3C8YA 1OY8A 2CKWA 1IR1A 5J2NA 4LF5F 1AZSA 1XNQF 2M8DB 4JI2F 2FTRA 1JXVA 4LBHA 1FJCA 2M0GB 1PJ6A 2UXBF 2FD2A 3Q8YA 3PHEA 1S49A 4WKYA 1JB0C 1HMVA 3H0PA 3PR4A 3QSIA 3BYRA 1CQNA 4DI6A 3NGDA 2D41A 3RTVA 1MU2A 4QPXA 1S1WA 3OXLA 4JI3F 4KSEB 3HHLB 3K8WA 2PO4A 4KYZA 3DNCA 2CNNB 2VPXB 2A6MA 4ZOSA 4DUYF 3KG1A 1EP4B 4CWBA 4PRFA 1CJTA 2JFDA 2OFGX 4PG5A 1FKAF 1CJVA 4DFKA 2LDYA 2B43A 3ISZA 1T9XA 3MI7X 3QAEA 3MM8A 1TL7B 1HBMA 1BQMB 2L9DA 5I3QA 1B0VA 4CRJA 4YR2A 4RWWA 1S77D 2GV1A 1RWOB 2HHSA 4J7CA 3SCIE 2YNIA 2I6WA 3MCMA 2V9WA 4C98A 4B3TF 3CJKB 4MFBB 6FD1A 4NYZA 3AQPA 2V4RA 2RUSA 1X0PA 4I0WA 2YBVA 2RB7A 2GIFA 3CCLS 4RNFA 4ZK7M 4K2JA 3U7JA 2MLYA 2F4VF 3CUNA 1Q81T 4S0MA 1UA1A 5KFXA 2IC3B 5KFDA 2Z2MA 3MZIA 1SKWA 1DZ5A 2BYCA 3U02A 3W9HA 5C42B 1QE1A 4N77A 1JMTA 3NNHA 2CQ3A 1HWJA 1NDKA 1KLMB 5CD4A 2ASDA 1ZA1B 1C4CA 2GHPA 4PG8A 2ZH4A 4HL9A 5A0YB 4PAAA 1DTQB 4JI4F 5E33A 3B82A 3BBCA 2H5IB 3ZFVA 3BREA 2N3OA 4DSLA 2W01A 3BGOP 4HTIA 1FRMA 2HS3A 2XULA 1WKKA 4YN3B 2X51A 2BRLA 1F5AA 3CCSS 2LLZA 3BS9A 2FC8A 2GS8A 2VB6A 2UUBF 2RH3A 3HMJG 4FF3A 1R0BG 5AXLA 5BR8F 1GMWA 4H4KC 4DV0J 5DM6Q 3DM2B 4H4KA 2R7VA 2DR5A 2CQ4A 4YS2A 3QT8A 1UMJA 2MGZB 3TNVA 5H9EJ 1LW2B 3NNCA 3TZWA 4G6VB 1H7XA 5KT2A 4MK7A 3CCQS 2FJEB 2ZC4A 5IOLA 1N32F 3MMBA 2ZJQQ 1S97A 5C2CA 3N6MA 2GGPA 3KTQA 3HJVA 3TVZA 3WBZA 2RRBA 2W2QP 2G0CA 2BQRA 2VJVA 3J7YI 4ZPDA 5DDQC 5CHCB 5D15A 4F8RA 2CJBA 3Q23A 2MEWA 2XEXA 3W2WA 3B6BA 1T02A 5KG2A 4QIEA 3RRGA 5CH7B 4XPCA 5EX3A 5KFMA 2G1HA 3TA2A 2BOPA 4DR3F 5DQGA 2HWTA 4F4WA 4GVBB 2JJ4D 2J9CA 5I3UB 3I56S 2L3MA 2N4DA 4FF1A 3M8SA 2VODA 3G6XA 3I0RA 3CJ2A 2O66A 4C7QA 2FLPA 2DIUA 3FDSA 2DKOB 3OXFA 5H9FK 2AGQA 3CPWR 4WIQA 4ZPWR 3HHLC 1S76D 1X4CA 2VQEF 1XN9A 3D1OA 1F6TA 5LMUJ 1AFIA 1YLXA 4HACB 1Y3JA 2GMHA 4GRSA 1WSRA 3ZZUA 1RYRA 2CPIA 4K2XA 4E2FB 1S72S 1FE4A 4L3NA 1BLUA 2V6AA 2HSEB 3MCSA 3M32B 5LSOA 1X4AA 3GE9A 3MM5A 3CJ3A 1Q7LB 3MEDB 4AQYJ 5HJYA 4ZLNA 1BQMA 2BJ7A 4DU8A 1K1QA 2XHWA 3M6WA 3MD3A 2HHUA 5K8MA 4FBTA 4K4UA 1OY9A 4JV1A 3AOCA 3NGKA 4J91A 4X4TA 4PWDB 4MFBA 3FBCA 3MPWA 4DR4J 2EFQA 3TQ1A 4LVNP 3BB5A 1UVMA 3CDAA 5HJXA 1ZA2B 2H9ZA 1UZDA 3J81j 5HO4A 2IC3A 5E3CA 1Q16B 4O3SA 1QSSA 2V69A 3D6HB 4DR1J 2OPPA 1NPKA 5C42A 1H6KX 3W63A 5B0BA 3OL9A 4TY9A 3G71S 1OWXA 3R5GA 3OT9A 4OZ2A 5A0YA 3QGPA 1DTQA 2C2KB 3BF4A 1MSWD 1EQ0A 2CUYA 2YH0A 2RSQA 1KP6A 3I9V9 2RIJA 1NLKL 2HAIA 3ZNUA 3R7BB 2HFSA 1X9MA 2EG1A 2A1BA 2QLJB 1V3ZA 4EZ6A 4KAIA 2HQCA 1NK5A 4OX7A 3MUMP 3LP1B 3M8WA 1EIYB 4PG7A 2MGZA 9ATCB 1W7WA 1LW2A 2YKNA 4F0MA 2GC8A 4AYBD 1ZS6A 3VWSA 4YY3J 1FJ7A 1NMEB 1Y9OA 3M1VB 3I0SA 3AJDA 1JLFA 3ZZZA 1RAOA 2OD6A 4WPAA 5M2RA 1Q5VA 3ILLA 1U1QA 4ZVSB 1T95A 2PN6A 3QYYA 4ANDA 1HNVB 1SIWB 5A8WB 3KNAA 4CZCA 2U1AA 2ZKTA 3VAKA 3C6UB 4N5SA 2CQBA 4B3RJ 3DXBA 4K7QA 1SKSA 4GVBA 3UR0A 1V3SA 4NMXA 1IQTA 1SH2A 2OGUA 3KK1B 5IS2A 1F3FA 5J1PA 1HIYA 5GAHI 1SBRA 3PM9A 3GLJA 2P9GA 4FNIA 3EPGA 2DGOA 1N48A 1HBUA 4ELUA 1RA6A 1LV5A 3DLLQ 3IWXA 4CLYA 1XJWB 2BE2B 2CPFA 5BYSA 4J9OA 4HACA 2Y1LB 4A8YA 1DAXA 3GYNA 1ZAWA 4TU8A 2DNRA 3Q8RB 1KQSR 2ZBPA 4ZVRB 4HDHA 5THWA 4EGLA 4OV1A 1FJEB 1TL4A 4ERDA 2CPEA 4ECXA 2FYXA 2CQGA 2HVDA 5E7OB 3MEDA 1RT7B 2UXDJ 5ETNA 1TV6A 2ACYA 3PW7A 2E1PA 1WEZA 3AY0A 1DURA 3PHTA 2MQNA 3LWMA 1T9WA 3W3SA 4X64F 2V5HG 2HVZA 4RNMA 4LF2A 4O0IA 1Q1KA 1FI4A 1D3WA 5IXUA 4EI2A 1VK3A 2VFRA 2GAGC 1IBKF 1S0VA 2CQ2A 2VV5A 3K7RA 2IVFB 2W8KA 1JJCB 2B6AB 3R1HA 2P6TA 2MY7A 4V19X 5A76A 1XMQF 2M9KA 4OYBA 3PXGa 4HTJA 1NRKA 3GPAA 4P9SA 4DF8A 2C42A 3A8JA 2B0GA 2E5HA 3OBIA 1YJNS 3CMES 2KM8B 2RU9A 5B0EA 1F2HA 1RISA 5GAEI 2G9OA 3NP5A 4R0EA 5CA5A 1GXLA 2W24A 2WONB 2HNDA 2ROGA 5DG9A 1LWFB 3MPVA 4DCOB 5F8LA 3ZZYA 3W1YC 1S6PA 3T9NA 4Q8FA 1F3VA 4CP5A 4NA2A 3QJPA 2LQ9A 1S1UB 2BUNA 5EGYA 4CM2A 2XY6A 2H65B 4OI0A 4QWEA 3U1LA 3HVWA 4OJGA 2XQCA 3LP1A 3A3OB 3HPOA 2CDRB 2M8HA 1Q8LA 4DS4A 1TVRB 4RKUC 4OZ1A 3M1VA 5B0DA 3OTOJ 4B9TA 5KG3A 4F4YA 5DDRC 3DYAB 3V6HA 4M95A 4MK9A 1IR0A 2YNFB 4C8MA 4YB6A 2LXUA 1MMLA 2HFOA 4ZLLA 1J2VA 1ZTTA 1HNVA 4F3QA 3NEKA 1VHIA 3C6UA 5T7LB 2WB1D 1GK8A 2ASYA 2EKYA 3KUHA 2DXFA 1FEEA 2BM1A 1FX2A 1YTYA 4J37A 1T03B 2E29A 2Q6BA 3BGLA 1JNRB 1PILA 3FGVA 3DLEA 1CVJA 3DRPB 2N3LA 5K8OA 1NSPA 2GQQA 2AYEA 2XYHB 1FXRA 3BO4A 1B70B 2CG4A 1DARA 1REVA 2NXJA 2ZZNA 2PT0A 5AE2A 4ETXA 2HFZA 4MIAA 1ZM9A 2AYBA 3K5LA 2EW9A 2YKMB 1RT3A 3ZZTA 5FD1A 3TZZA 1VRUB 1NPPA 3FK4A 2XS7A 2D69A 1RT7A 2WBRA 5AT1B 1M1HA 1MG7A 4R5PB 4RUAA 2OPRA 2UUCF 2Y0BB 2ZZMA 3NGSA 2DCUB 2NPIA 4WFXA 1XNRF 3OSPA 1XR5A 2I1RA 4EZ9A 1S7HA 2FJAB 2C2MB 5AJ3F 5LJ5Y 1P9QC 1V5IB 2G2YA 3AOBA 2KM8C 2CDQA 2LVWA 3PG9A 4H54A 2JEGA 2J6TA 2M4MA 2L41A 2KI2A 5EDWA 1WEYA 2FHJD 2R42A 2FHOB 5D77A 2MKJA 4JI7J 4OX6A 3BO3A 3C15B 2QL7B 3PNIA 3BSAA 2EK6A 2VL1A 3H2VE 1ZZFA 2B4PA 4ZCMA 3SSQA 1S1UA 2YVSA 3S1TA 2JLGA 1VQLS 2J6SA 1SQFA 4A8SA 1H2UX 3CSKA 3MHYA 2ZH1A 5T14A 3MPUB 2CQ1A 4A8FA 2JEJA 4OI6A 1T9TA 1R89A 1S0OA 2XMTA 3ET6A 4NEZA 1MN9A 2Z0GA 1RWXB 4USKA 1VBXA 1PSDA 4A46A 1DLOB 2WW8A 4PQUB 5K14A 1KTVA 2B5JA 2BW2A 4LREA 2BKNA 3POTB 3OJUA 1R0CB 4Y34A 4NI2A 5FJ4A 2KU7A 2HRUA 3KKFA 1N56A 2ZBRA 3W64A 3PJXA 3A13A 5GAGI 1YJUA 3FSYA 3AD8C 4O44A 3PEJA 2YNFA 3N4WA 1XBWA 3D3BJ 3V5RA 1C2PA 3EX7B 4UOFA 1YJRA 4CI0B 2OMLA 2C3YA 4K50A 3DLBA 2W9BB 1R8PA 4EBEA 2E5GA 4Y28C 1N33F 1HPZB 1U1LA 3G6VA 4TU9A 1HNWJ 2CNLB 3GFZA 4UZBA 2PMHA 4LF9F 1T03A 2K3KA 4ZJQA 4HH1A 1WG4A 4ILRA 2LXFA 3H2UB 2K7JA 4HYKA 1L5UA 3H2LA 3VF0B 3FEYB 3Q86A 1OYDA 5HVGA 2AEMA 2KFZA 3SV4A 5KG7A 3J7ZT 1RZMA 1BD6A 2X1BA 4ZP9A 1P6TA 4FKXA 5IM0A 2IBKA 1NCLA 5GVQA 2Y1RI 2G0IA 5DG7A 1EQMA 1VRUA 2XGPA 2XZTB 3UVJB 3UI3A 2VFTA 1YI2S 3VAHA 5KFNA 2WBMA 4RU9A 1GAOA 2R2UA 5D4LA 1VBKA 4I67A 4KHPJ 4PEOA 4I2PB 2CQCA 5CYJA 3TX0A 2F40A 3ETOA 2XMVA 5B0FA 1Q4RA 3FKBA 2CQ0A 1N52B 1GTHA 3GFYA 3BKFA 3EGZA 4DR6J 4KGVB 3JAMY 4HI2A 2NPFA 4JI5F 3BM7A 4LMZA 8ATCB 1T05A 1DJ0A 1FNOA 1HWLA 1KFSA 4JV2A 2AD9A 4ZVHA 3HFZB 2BW7A 2E1RA 1SKUB 4TLQA 1WF1A 3T1YF 3SCLE 2NXCA 3TZXA 2MTLA 3SQGB 2F65A 3SXLA 5DO2A 3JB9k 3CJSA 4NRUA 3OUYB 4M5DB 4B08A 3D67A 2VH7A 4B3SJ 2GVDA 1ZBTA 3T6BA 3SBMA 3DFEA 4RBUA 4KGXB 4DV7J 1XIQA 4L72B 2W1BA 2F5GA 4ZVGA 5K8PA 3MM6B 3Q2SC 2QL5B 1P1LA 2J7KA 1RT6B 1SJ1A 3G6ES 2IA0A 1SJRA 3UCUP 3CJQA 4WTOB 5A2QY 2SXLA 2Q79A 1OO0B 1RTIB 1KVJA 1T8EA 5FLXY 1Y5NB 3X1LB 4DZDA 4LF4J 1YJTA 3BR9A 5D4OA 4ZHRA 1JLAB 1NZ8A 2E5LJ 3SV3A 2KH9A 4IO1A 4DL7A 5KFOA 4DX8H 1FK9B 2F7VA 4ZVPB 3R97A 3CCMS 2DRDA 2AKWB 1JXLA 3RZAA 1NHVA 5K5MA 2XI2A 1HBNB 2XZDB 1FERA 3A12A 5AE3A 2MJUA 2V4JB 3RAMA 1N5TA 2HS0A 2DH8A 1KHVA 1S1VB 1CJKA 2JHEA 4H4MA 1RU1A 2GQ2A 1ZPVA 5F3ZA 4F36A 3QGIA 3CD7A 5DZ7A 4DSIA 1XMOF 2IHR1 4ILLA 2QV6A 2EBGA 2VBZA 3EMTA 4YR3A 2V2KA 1K9MT 2DGQA 4LR9A 5J1EA 1JLGA 4P2FA 3DOMA 2PEBA 4WFZA 1RAIB 5D0RA 2XLIA 2KRRA 2DTJA 1TKZB 4IQXA 2V2ZA 2W7AA 2D1CA 2ALZA 4W92B 2OIHA 2Z57B 1RLDA 5IC6B 4WYLA 3HULA 3J7A1 4DSJA 2B3TB 1RAJA 3UW1A 2DNMA 1TAQA 4K0KF 4KRWA 1LNQA 4DL0C 2XMUA 1YBUA 3NOGA 3ZO7A 4DL6A 1XTZA 3IN5A 3M9MB 4CO3A 4IDKA 1FJGF 2DNQA 3UWTA 2BR0A 2ZM6F 4PXBA 3OLAA 3TR5A 4ED0A 4JI8J 3HFKA 1U02A 5F3TA 4C9DA 4UY85 4P73A 3BH7B 1X5TA 1FDBA 4A8KA 3CDWA 5CYMB 3MFIA 1RWMB 2ZUAA 1NK7A 3CIZA 4LUBA 1NO8A 4MKVA 3CW2C 4DQRA 2AP6A 2JEIA 4LF7F 1KVKA 2BBEA 3SQGA 4Y2CA 2A18A 2WZ1A 4TY8A 4X66J 2MKKA 3GIMA 4I68A 2XHCA 4DZ6A 3OUYA 5DM7Q 3QT7A 1F5CA 5KG5A 2CZ4A 3HVAA 2O3DA 3HHLD 3J81U 1UAWA 1FNXH 1U24A 1KN6A 3GU0A 3T1HJ 2CJAA 3QATA 3T5KA 2ZE2B 1RGVA 3D6MB 4Q45A 3VZHA 4P6QA 4ECWA 1DQ8A 3DCAA 4B3OB 2HK2A 4FYVB 4DR2F 1XQIA 1RTIA 2VASA 4C2MA 4HHJA 3KMSA 5FIIA 2B9XA 4PZVA 4NOHA 2PA3A 3IBFB 3A8KA 3M9OB 1JLAA 4K4XA 1ZAXA 2WSCC 2YX1A 1U0HB 2UVRA 3VGSA 3R3TA 3G6YA 2NS1B 3DRYA 2HFUA 3V6KA 2YQ3A 3NBPB 1IQZA 1RWPB 4LF8F 1HBNA 1RCXB 3LGHA 2OSRA 2V4JA 2ZH7A 4FVCA 3D0HE 5DLGA 4CIOA 3KG4A 1N34F 1ITPA 2RS2A 2OELA 5HMXA 3EGVA 2W4DA 3IR5B 4B17A 1WHVA 3L3CA 4CTAB 1N4LA 1UKUA 3GZ7A 1ZH5A 1PYTA 4RO0A 3VTIA 3CJ5A 3M2UB 4NZ6A 2CJXB 2EFNA 4M5HA 1CEZA 3HT3A 1QAXA 5GADU 3K2YA 4QBUA 1HI0P 2CJKA 1WHYA 2WRMA 2RDJA 4N8OA 3SCKE 3NKYA 3MECA 1NJXA 4XDCA 2M5YA 1SB6A 4PXCA 3MOZA 1FKOA 2R7XA 1NZAA 4O23A 2GMJA 3JSMB 3IAS9 4DWIA 3BQ1A 4RW8B 1VGYA 1YWXA 5D4NA 2R8IA 1P27B 4KR0B 1AXQA 4JI1J 1RJJA 2AMCB 4OX9J 2ZHOA 3TW0A 1XR7A 4I2QA 3EDQB 1FFGB 3UNYA 2AIRB 2VDHA 3G96A 4NA1A 2BJ8A 1X4DA 4DV2F 4OI2A 1GXTA 5B0CA 2BA9A 5LMNJ 3CCWA 1FRLA 3NMAA 1PAUB 2WHOA 3IFEA 3K17A 4CT8A 3QLHA 1SH0A 4MJKA 4WWSA 5KOWA 2OEMA 1KSPA 1NU4A 4MKBA 4TYAA 3R1LA 4DUZJ 2XC9A 1R6YA 2FZKB 5EHHA 4ED4A 4KPYA 3HSJA 4KFBB 2ACMA 1KRPA 1HNZJ 5L9NA 3AAWB 2V8PA 2A2CA 1X31C 1WC1A 4FS1A 2YPZA 3ADAC 3W5YA 4ZPVR 2DO4A 1IKYB 5ETKA 3OL7A 5ETSA 1I94J 1VS3A 2PI5A 1UWBB 4NPOA 2HBQB 4LIRA 2R8GA 1N36J 5LXRA 3ITHA 4U6PA 3I5BA 4NWBA 1X4FA 3GONA 5J2MB 3HD2A 4IFYB 3PIPQ 2CVEA 3AH6A 4B3OA 5HBMA 1V5VA 2V2QA 1U6FA 4OV6A 5E3PA 5KFIA 2YQ0A 1XEZA 4LFAF 4NLXA 4JBCA 3RUBL 1D1UA 3RB3A 4ED2A 2DK2A 3DOKB 2LMIA 1WG5A 4YB1P 4WF9Q 2J8SA 1XR6A 1VRQC 3NS5A 3MM9A 4R8UB 4DFMA 1U7LA 4Y65A 4UOGA 5BYQA 4RUBA 1QSLA 3ISND 2V8GA 1Q82T 2ZWPA 1Q78A 3ZTQA 4KGKA 3MMCB 2ASJA 3D0GE 3BJYA 4UT4A 1Q5YA 1S1TB 2RUGA 6AT1B 1S9EB 2PIIA 3O5TB 1KD1T 5CCLA 4W98A 1S6UA 3KLGB 5KFBA 4C8LA 3HD1A 3M2UA 2OMOA 1RT5A 3EVOA 2C22A 1CLFA 2ZNZA 1JLCB 4DXLA 1DY3A 1U48A 3PTWA 4KPCA 4U7UD 3DLKB 2BANB 1SIZA 4IQMA 3RAQA 2VFVA 3EICA 4X4UA 4NLSA 1XWLA 1TQLA 2IA6A 2LEPA 4GO7X 3S8SA 4QYRA 3BQ2A 3I32A 2ZBCA 2FVRA 3KK2B 3J80Y 3G87A 3RBXA 3GJRB 2KN4A 4Q0BA 2K7KA 1R8HA 5EX0A 4MIBA 1RA7A 2PMWA 5D4PA 2MZTA 1O0PA 1NKEA 1PG5B 4ECRA 1OQ6A 3MCOA 2J0QD 4ZPAA 2KJWA 2IAJA 4YB5A 2VOPA 5E0OA 1JWWA 3HZEA 3TOQA 2F4VJ 2MHNA 4YR0A 2DEJA 1AYEA 2JL9A 1BQNA 1X4BA 1Y7PA 4KV8B 3ENAA 4C4WA 2GO9A 1SL0A 2OD4A 3FFIA 4NLWA 3ILIA 2QLXA 2ZFHA 1J5OB 4DG1A 1OS5A 4DPYA 1AUSL 1WI6A 1FNMA 1HNIA 1RHMB 4Q5VA 2UVWA 4BDPA 2MZSA 3CJ0A 3I6PA 3HHNB 4KFBA 3CD5A 3FBEA 3N28A 1WHWA 3DOLB 3U27A 2YPYA 4C8YA 1S4EA 3PFEA 3HZGA 1IKYA 1LWCA 1CSJA 1URNA 1P8GA 1UWBA 4NXNJ 3C6TA 3LPYA 1MROB 4P75A 4ZN1A 1RTJA 2ZBQA 2XSFA 1VQ9S 5J2MA 5G4DA 1X5SA 2KT3A 3R5AA 5H9EK 1K0TA 2NXUA 2BJ1A 2EFVA 3MOJB 4Z37A 4J9NA 2ERRA 4Q8EA 5A6PA 2OPQA 2C3OA 1KOHA 1IUJA 2A3JA 1TTHB 3AA9A 1H2VZ 4AL6A 1NSAA 3NCPA 2V9KA 3DOKA 2IPOB 5D78A 2FVSA 1WOOA 1VQNS 5I42B 1JLBA 5DQHA 1RHJB 3OR1B 2EK1A 5K20B 2XS5A 5D8HB 1Q8BA 3UDEA 1I6JA 4RR5A 2AJQA 2GVZB 2UU9J 4IOAQ 1N6QB 4LIWA 5IT9Y 2Y8WA 1U4BA 3T9ZA 3V2UC 4DV0F 2L9WA 1FWLA 4QU7A 2ABYA 2AV5A 4HLBA 2DD8S 2MSTA 1FEHA 4MH8A 4ZPBA 4M8LA 3NS6A 3OVSA 4DLGA 1S1TA 4LT6A 5GMDA 2UXCJ 1S9EA 2M3DA 3KLGA 3V6DB 1UJ6A 4LR7A 3MR7A 3MTJA 3GIJA 4YOEA 3QWPA 1U2FA 3V4IB 5C2GA 3IR6B 5SZTA 2N7CA 2H5JB 5RUBA 4NL5A 1WOPA 1KFDA 4RNNA 3QT6A 3AHPA 2JVOA 4NCBA 4K4YA 2CWKA 2QLWA 2ZH9A 2OPSB 3W2VA 2R7UA 2W4PA 1Y11A 2MKHA 3PIOQ 2VC0A 2J8AA 1LW0B 2W2MP 2X1FA 2X3DA 2VU5A 2HHPA 2B56A 3CCES 5LMUF 4CO2A 2RF2A 4ZJOA 3TVYA 3GR0A 1L3UA 2CNOB 2VDIA 1NAQA 3H90A 3WQPA 1D9FA 1IKXA 1T11A 2D9PA 4KV8A 2A10A 2AX1A 2LU1A 1CC7A 4CO4A 3ELHA 1SUQA 3NXZA 4WZMA 3FCHA 1J5OA 2AZ3A 5E3RA 2D3O1 1M5VC 1FRIA 4AQYF 1IVZA 3IBCB 2CPYA 1DBDA 2QZ8A 3CCJS 3LALA 3SMZA 4PKDB 1NJWA 3NS7B 4KJIA 1IKVB 3DOLA 2DNGA 3NAIA 2R8KA 3PZPA 4DR4F 3FEZA 2FIUA 4C48A 3BN4A 3VVUA 3LWLA 4KGZB 4O4GA 4N76A 3HT0A 2VFSA 1MROA 4O4RA 1SL2A 4RW4B 4ECZA 2FY8A 4OZ0A 5KFRA 3TA0A 4MTPA 4FKYA 1W26A 2EVZA 1L3VA 4ZP7A 3CE8A 2GMLA 3H5YA 4DR1F 3W65A 3HKZD 4KTQA 2AYMA 5IWAJ 5L1KA 3GIIA 2FLOA 2I38A 1U45A 1BMQB 4ZVEA 3AXKA 3CCZA 1L3TA 2FVCA 1TUGB 3D5MA 2UV8A 1FFSB 3DHWC 3H4DA 1EETA 5I42A 2GZOA 4P72A 2YNHB 3ZNJ1 4XDDA 3HFVA 4IFVB 2MY8A 3M9NB 2ZITA 1SI9A 4URSA 3CJ8A 4QWCA 1R0AB 3HK2A 1TL5A 2RRAA 1R31A 4YHHJ 1NDLA 3E01B 2HBZB 3QO9B 4R25A 4DQQA 1IM4A 3IMQJ 4ZMMA 1U8WA 1WEXA 2I5JB 4OYWA 3O1LA 2XMJA 4ZDNA 3W8PA 2JOQA 4ZS6A 2H3EB 4PG4A 4YY3F 1O6XA 1RT2B 2NZCA 1GFWB 4F3OA 3IG1B 5IT4A 1RBAA 5D0EA 2PE8A 4LJMA 1FRKA 2HK3A 5E5NA 5KFCA 5EN1A 4I56A 1RTHA 4RUCA 2DHXA 2KJVA 4ZVUB 3Q8VA 2M2BA 1RU2A 4B3RF 1VIOA 4D3HA 4ICLA 2CQHA 3L4BC 3PCOB 1YGYA 4E0DA 1T9UA 1HMVB 2OPSA 2W2PP 2DNKA 4ZLPA 1UP1A 2IJNA 1FVQA 1MU2B 4YFUA 1S1WB 3IWNC 3WX4A 4PQAA 1LW0A 1H0HB 1X60A 2EPIA 1H72C 2VUGA 3RR8A 5E3AA 5L8RC 4EO8A 2NUUG 2L08A 1CJTB 2DYAA 5KFYA 4WBFA 1RK8A 4Z2XA 1BWVA 4ANCA 2OUGA 5L38A 3V6JA 1SCJB 4MIWA 1HBMB 4AXIA 3P8BB 3K89A 2WVDA 2HWIA 2IM3A 2KXHA 3THTA 4A47A 3C14A 4LVOP 2OKQA 2NLWA 4O3OA 1WNEA 2UXDF 3I96A 3TAQA 2CRLA 3IC1A 1SJQA 4DN9A 3CMQA 4QYZK 4BWMA 3NRBA 5AXKA 1YJ9S 3OVBA 1WOSA 4RX6A 1X4EA 4ZVQB 1S5ZA 3OL6A 3L09A 5DS7A 4RW4A 3MTKA 1QVFR 3BSCA 3FMBA 3OFHA 2DNHA 4C6AA 3M2RA 1PC4A 4ED3A 2HHXA 2E7XA 4H4OB 3QJJA 2C2DA 1H2TZ 2QE5A 2O1PA 5KFUA 3D6TB 3QIDA 1UEUA 4AL5A 1UJ5A 3UN2A 2EFPA 1WC4A 5KAKA 3ZC4A 3SI8A 3I5AA 1ZM4A 1UVLA 2K3IA 1RXOB 3T5JA 1R8BA 4WJBA 1UPMB 2ZEJA 5MLCV 3GV8B 1QJHA 4DV3J 2APOA 2VBXA 4RW6B 2YKPA 3D7SB 4QR0A 4CLWA 1HI8A 2Z4PA 4JI0J 3E01A 3QO9A 4GKKJ 4FNHA 1VC0A 1B4SA 2BQ3A 3VAFA 2I5JA 4GC7A 2GA7A 1RAGB 3P6YC 1X9SA 3K59A 5CYQA 2RQ4A 2CPJA 2R7TA 2RHQB 2CNKB 2KFNA 3KLFB 1ZETA 1RT2A 4F02A 2GGPB 2JSXA 1S4FA 3IG1A 4X4VA 3OTOF 2V8HA 1TK5A 1IKWB 2HZCA 3QAUA 4V19J 1R8CA 5KFTA 2XO6A 1HBOB 1QUVA 3W9JA 1DTTA 4OI1A 1OSCA 2CQDA 4FYWB 1D8YA 1TKTA 5CQGA 1DQAA 2RAQA 4M5NA 2XMAA 3MURP 5F8IA 2CQPA 5JXSA 3IWLA 3I0RB 2LQJA 3HHKA 1IBLJ 5L1JA 4IO9Q 1VQ8S 2XGQA 2E1AA 2DEIA 4ZJLA 1WF0A 3G82A 4C8KA 1FA0A 3N6LA 1R6VA 1PBUA 3H5SA 3LP2A 3WX8A 1M90T 3MEGA 4I64A 2UUWA 4OHVA 2ZH3A 3OTDA 2LU2A 3AOAA 4LSLB 5KOXA 5KFJA 3KFWX 1TP7A 2FHMA 1KWMA 2M70A 2NUHA 2XSJB 1HNXJ 4CLSA 2LEBA 3MM5B 1U1NA 5HN0A 1JLQA 3VQTA 1Q53A 2VPWB 4ZVTB 2JEFA 4XTTA 2JFKA 3JQJA 1YJ7A 2YKQA 4QR2A 3AT1B 3IO1A 1YSJA 1KS2A 4P52A 2Y3YA 2KFYA 2P9EA 1VQ7S 1NJZA 5B0GA 4GKJJ 4DN0A 1RTDB 4Y0FA 3NAHA 3SSSA 4U7CA 4P10A 5A8KA 1JJ4A 3MWBA 1WJ9A 8AT1B 2HVEA 1KC8T 4RWXA 1BWEA 2DPIA 1X8DA 4C0HA 1RWKB 5DDPC 1UWAA 4USIA 4HKQA 2N4CA 3PYDA 1X0FA 1LKZA 4NEYA 2OPPB 4HT5A 2DGSA 3M05A 5B08A 1F5BA 4JYAJ 2ZZTA 4H4OA 4Y2KA 2ZVIA 4K4VA 4OMFG 3SDEA 1C1CB 3O3LA 1RTZA 1TK8A 2QL9B 1D0EA 1YRTA 1PJ5A 4ZLJA 1QY7A 4UQTA 2LQ5A 3EJMA 4JI7F 3GIKA 1MMDA 2DXDA 2ZUGA 3RB4A 2HRYA 2HHVA 4ZPTR 1OYEA 3NMRA 4CLFA 3IA0A 2QYGA 3MMAA 4USUA 2VICA 1YKWA 2BM0A 5H1SV 1TMJA 4RW6A 2R7OA 3KYLA 4CH1A 3NL0A 2DIVA 1MWYA 3PKYA 1BQXA 4ZCLA 1D09B 4FPIA 1WC5A 2OEKA 3UO0A 4RW7B 4KE5A 2YKNB 3IRXA 5IC4B 3X3UA 3MF5A 1YK9A 3THVA 4LRCA 2HHTA 4WCEQ 3L7UA 2UZAA 5KFLA 3I0SB 3KLFA 1JLFB 5KG4A 5J2QA 1C0UB 2ZKUA 3VGTA 4K4WA 4UF4A 2RRNA 4RNHA 1IKWA 1HKAA 4PUOA 2KZZA 4IYQA 1S9GB 1FD2A 4KC5A 1I3OB 4P2XA 4WTYA 1HBOA 1UFWA 1S99A 4ENOA 3VAIA 4MYTA 3VAJA 4KB7A 4CNZA 4NLVA 5M2UA 2I9SA 2HIQA 3CDEA 4CDIA 1QSYA 3KJNB 3ULHA 3G9CA 4U67Q 3RU0A 5G0RA 3OD2A 1HNWF 1G6BA 2IYGA 3A8EA 5JVGQ 1VCTA 4CYUA 3JXOA 3DGPA 3PO5A 3PY8A 2UVUA 4TN2A 2DRAA 1HBUB 1YJVA 4BBYA 3I31A 1RKIA 2VOOA 2FVPA 1RT4A 4Q7AA 3UE2A 1X9WA 4LSLA 1E6VA 5ETQA 2AJ4A 2KG1A 4OZ5A 4NCAA 1VC5A 1KKHA 2FPHX 1U8SA 1S9FA 3CTRA 2WTFA 2XSJA 3R5BA 2KL8A 1SL1A 1O5JA 4OJHA 3MFHA 1TV6B 2LQ8A 4TNOA 2QG9B 5F8HA 4M94A 2KVQE 2KT2A 4OZLA 4O3PA 2FUG9 3LH2S 2A0FB 4KHPF 3G86A 5DGBA 5EWGA 2MB0B 4DV4J 3EZ5A 1RTDA 4IRDA 2IJRA 2GIQA 1YIJS 3TRGA 4QIFA 1JX4A 4DR6F 3DDIA 4RLEA 4C3KA 5IFMA 5HMWA 1RBOB 1TL1A 4K4SA 3UR3C 2IMWP 2VG5B 2K1RB 3L95X 3R2DJ 4AUKA 3KUEA 2JWNA 2YKOA 4GVLA 1NNDA 3T6JA 2JH3A 3QGHA 1T3NA 2IY5B 3UQSA 2AEJA 2R3VA 3M2VB 4DF4A 1R3NA 1C1CA 4F26A 1S0NA 2E9ZA 2UUAJ 3TYTA 2W8LA 4B3SF 1ULRA 2HNDB 5F8NA 2B4UA 4DV7F 1S6PB 3BSOA 3QT5A 4I6WA 1M1GA 1YZ7A 2CPHA 1R8AA 1CULA 1Q0NA 1NK6A 4OZJA 1NPRA 1FX4A 1VRTA 4C11A 2I0XA 3L7PA 5C24A 1VBYA 2HRTA 3US5A 3CGIA 3HI9A 1N5SA 3SFGA 5D0GA 2KRBA 4RW7A 4LF4F 2DPJA 5BJRA 1TAUA 3EZUA 2E5LF 1NJIT 2VG6A 1DRZA 2RD5C 1HQ2A 4OHZA 2HWHA 5BYRA 2HLTA 1S6QB 4TXSA 1RABB 1C0UA 3BZQA 4ECUA 3PW5A 1U1PA 2B4OA 1EARA 3DC2A 4HHUA 3LPEA 1S9GA 3NLCA 3HCXA 2GIRA 5LL6d 3KUGA 2OAUA 3AA8A 1FRJA 2J0SD 4WFAQ 2EKNA 4M5JA 2V67A 3HP6A 5JMNA 2AHOB 5C5JA 4DSEA 2IFXA 4EYHB 4PCQA 3P5TL 2G2ZA 3LQVA 3J7YU 4NLTA 2ZOFA 3DLEB 2MDAA 4ZIWA 3OTCA 4DL4A 2NYIA 3MEEA 1EKRA 2FDNA 3NWGA 4IKAA 1EAYC 4LQ3A 2QLFB 4LSZB 2W9CA 4EFAC 3NGRA 3JQMA 1REVB 3T19A 4MAKA 1KONA 1S12A 2JC0A 2CIMA 2CJYB 4X84A 1FRXA 2BVZA 4LRFA 4Y2MA 4C3LA 1RT3B 3OFFA 1GMUA 3KJQB 2ADCA 4Y2AA 2R2TA 3B54A 4BWJA 4DPXA 4G3IA 2J0WA 2QTWA 2PDAA 4QZVB 1NSKL 2OPRB 5IT0A 4WP3A 3IGNA 1M1KT 2EBEA 4DS5A 3AQOA 3DDKA 5KTQA 3MR3A 3BGRA 1GH8A 1FT8A 2XMWA 5LXYA 3D6FB 4JI8F 3TANA 2B9WA 1M0SA 4F50A 1T94A 4OYMA 2LXIA 2A2DA 4JUZA 3FJ2A 2JC1A 2VG5A 3NWRA 3W62A 2K1RA 5HSPA 1HD1A 5HQMA 2IMOA 1VK8A 5ETRA 4X62F 3LGMA 2I2YA 4ED6A 1JKHB 2W2NP 4X66F 3M2VA 1TFWA 5B09A 1P1TA 2CAJA 3EGNA 1RI7A 2E5JA 1V6HA 4DV6J 2NYHA 1SJ4P 3K0JA 2HQFA 1NEEA 1SQGA 1YBTA 4LF8J 3T1HF 3C46A 4QYZJ 3MR6A 4MMOA 1KVIA 4MT1A 3R6LB 1JXEA 2CWXA 2FY1A 3IR7B 2QMUB 3JTPA 4TLRA 4MKYA 4B3MJ 4LF6J 2YTCA 3ET6B 1FDAA 2XY5A 5HLFA 3M8PA 1RADB 4DEZA 1AFJA 1BXNA 3R5DA 5K14B 2B5JB 2B8QA 3VR1A 2OO4A 1VLYA 3EDRB 4NI2B 1QD1A 2MKYA 1HHQA 4QPTA 1S6QA 2AF6A 4JOUA 2CPXA 1N8RT 5HL7Q 1TL3B 4EK2A 5KT5A 4O44B 1WWHA 4ANEA 2Q1LA 2AU0A 3TARA 2JNJA 4F4XA 2FLNA 3TEGA 2ATCB 2UUTA 3O6QA 1TMMA 4B9NA 4EBCA 2DO0A 2BKPA 2QO3A 3KDOA 4ES3A 4XO0A 2B9YA 3CCVS 1ROFA 3WC0A 2PC6A 2QJ3A 2MZQA 1C0TB 2DRBA 4OYOA 1VI7A 4OQJA 4IR9A 3CD6S 3MM7B 1Q95G 3FEXB 2R7WA 3LO3A 1FWKA 5KFZA 2DJWA 2FHJA 4F0KA 3VGVA 1CJUA 2BMBA 2MHEA 2XYPB 1B7YB 4QW9A 1NK9A 4X4SA 3CT9A 5HP1A 3I55S 5IM0B 5GAHU 2QFIA 2MQLA 3A3PB 3E8OA 2J7UA 3C66A 2IM2A 2F3JA 4EBDA 3S7RA 4TQRA 2DITA 1SC6A 2FZGB 3VCDA 2RQKA 2FJBB 3DMJB 2DHHA 2HZAA 4JI1F 3LF0A 2XMKA 4QWDA 1RWNB 4G1QB 3WIUA 4OX9F 2DNLA 4A8QA 5KFKA 2C3PA 3I5CA 4QWBA 5DLFA 5KT4A 2Y1JA 2ZC3A 4AXJA 4G65A 2GX8A 2FB0A 1T05B 3IM8A 3TUIC 4USHA 3PR5B 4UUWA 4F04B 5LMNF 4EYIB 3W60A 5KG1A 1S79A 4O0NA 3HDSA 3VAMA 3HJFA 4KBIA 2Z2LA 1REGX 3DRRB 1FWPA 5A8RB 2E7WA 4DUZF 4FXDA 2KXFA 3WHIA 1FKPA 1JKHA 5HAOA 3F44A 1P9YA 2GVDB 4CLZA 1RCOB 3M8RA 2XLKA 2PMZD 1HLWA 1HNZF 2CJ9A 5HK4A 4U9RA 3AD7C 5D3GB 1YITS 2RE1A 1WORA 1I94F 1HA1A 3ENVA 4P2SA 1N36F 4PPDA 2J9EA 3NCQA 4ZKAA 3DU6A 5GAEU 4FF4A 2VONA 3FNNA 3Q24A 4DR7F 3B78A 2P6SA 1F2GA 4DUTA 2MYFA 4ZHRB 3EXCX 5ETLA 2KVIA 5F41A 2I8EA 3FBBA 2LQBA 3MD1A 1TZ0A 3CD0A 2LECA 1RB0A 4ETZA 3RGIA 4TKTA 2YX7A 4NCGB 5CZVA 2ZDPA 5T41A 5I4MA 3H20A 1TL3A 2DR9A 1G4CA 3NOCA 1PCAA 2Q6CA 5E3QA 1RHKB 1FO1A 1XK8A 1CJKB 2E1MC 2VQFJ 4H4MB 3FZ2A 5IQQA 2W9AA 2MQMA 2PD1A 4ED5A 3K5PA 3WC2A 2XS2A 2CADA 4DR5J 4ES2A 1Y4ZB 2XCPA 3FCVA 3FZBA 4PYDA 3TA1A 1L3SA 1C0TA 2DGVA 3N01A 4KO0B 2MZRA 4BLGA 1H98A 2XB2D 4IOCQ 1TK0A 5J1EB 1JLGB 3MM7A 3DOMB 1RLCL 2FJWA 3LW5C 3S6EA 2B4VA 3JQKA 4KKOB 3C16A 1FF2A 5LSLA 5KT7A 3ONQA 3D3CJ 3E2EA 1N54B 3P4UB 1IM6A 2MQQA 1QUPA 3QIPB 4M5LA 1NXIA 4RW9B 2AZ1A 4ER8A 1GNKA 1B3TA 1JLEA 3FC9A 1T0TV 1U6BA 3RRHA 3A1YG 2KXNB 3VVTA 1RT1A 1MW7A 5HVHA 3BYPA 2QSWA 4IDKB 1M5HA 2F4FA 3DMJA 3KLHB 2YWFA 4G1QA 3WZ0A 4OI4A 4ECTA 2DGTA 1WC6A 1LXNA 4C8NA 1NH8A 3N0VA 4DDFA 3LGNA 4IOBA 2HVHA 3SYZA 1U26A 4DL5A 3SFUA 3D2WA 4DBQA 2V63A 4EEYA 1VISA 2H48B 4DV5J 4D3GA 1C4AA 4C0OC 3M30A 3V81A 4CO5A 1UW4A 4F4ZA 2MKCA 1F60B 1N5QA 4TY8B 2XCAA 4CM0A 2HVIA 3DRRA 3Q8PB 5A8RA 3MEKA 2D9OA 4WYWA 3RRKA 3H40A 1V3RA 4NXMJ 4N56A 4P71A 2X1GA 1UL3A 2HNZA 4Z7YA 4LRAA 2HBRB 1OMSA 1HWUA 3CMAS 1HR0J 5ETMA 1U1KA 5D3GA 2W25A 2RQMA 1XC9A 4LFBJ 3PX6A 4DHVA 2FZCB 2BACA 4NXNF 3AD9C 1BUXA 3GYXB 4OYXA 3ZTOA 2HW3A 3C2PA 2HGMA 1PKUA 4C97A 2WW4A 2HNYA 4ID5A 2LYVA 1FXLA 2BZ2A 1IR2A 3AJ2A 2MQPA 1UZHA 1RKJA 3O44A 1UTAA 1YX2A 2DVIA 3FBFA 4J9VA 1Z2LA 4UZCA 3T1AA 2HYIB 1N0VC 2WVEA 4I6YA 2QT7A 1HYSB 4J9QA 2GO8A 5D6GA 4NCGA 3CNQP 1M5KC 4PXDA 2Y1IA 1RHQB 4XPEA 3GQCA 3FVYA 3R5JB 2ZWOA 4NLOA 2QA4S 2AJ0A 2UU9F 4USTA 4F67A 4Z7CA 4W90B 2LCWA 4B9SA 2R9LA 1ICEB 5GAGU 2VC1A 3DU5A 2Q66A 2WVCA 4YEAA 1HARA 3I9ZA 4KO0A 2HHHJ 4F2RA 2DGXA 3ZXWA 2UXCF 4DX5A 2QLBB 1W2BR 4DMZA 1IWAA 4WFYA 3VHQA 1YHQS 3GP9A 4B02A 5C7PA 5C25B 4KKOA 3HHLA 4NA3A 3MECB 2VA3A 1GMWD 1EP4A 3IP0A 3R9LA 4OYZA 2IIHA 4OFZA 1WI8A 3QIPA 1FKOB 1JNZB 1MN7A 4RW9A 1J5EJ 2QA4G 2C1EB 4CCHA 3S01A 3HHDA 5DRKA 3T5HA 3F73A 1TL7A 2P8IA 1F9HA 4I2QB 1OPZA 1OJ4A 3P3DA 3KLHA 5AXNA 4ZVFA 4ILMA 2WOMB 3MCNA 2C2NA 3PACA 1LWEB 5K9FA 3CJKA 4G1PA 2CXEA 2GCFA 2WVFA 4Q2LA 3CCTA 4O3RA 2ZBIA 3KLVA 3ETMA 2Y9HA 3VALA 4USJC 1AUDA 3GSIA 1U0SA 3GILA 3P45B 3QLHB 4JI6J 2PFFB 1QTNB 4OL8A 2GJ2A 4HVZA 1WDTA 4C3MA 2CFXA 3KK3B 2N7YA 4ECQA 2E5IA 3ZZPA 5DGAA 1K73T 4LFCJ 2M7SA 4X4NA 1X4GA 1UFLA 1KLMA 1GT8A 2O01C 4OX8A 1F1BB 4ED7A 4IH5A 1AROP 3DRXA 1NK4A 2H5EA 2YQ1A 4L3KA 1PAEX 3PKMA 1VQYA 3GWCA 4PPZA 1VFJA 3ITHB 3TO8A 4DV1J 3M6UA 5E2QA 1IXKA 3RAXA 4DSKA 1GMVA 1H74A 1RP5A 3Q0AA 4KH0B 2EFGA 5HBMB 2H51B 1T3OA 3RYLA 3DM2A 3G4SS 2BV3A 1CQMA 3IS9B 1VQMS 5F0UA 1WUUA 2NREA 3FQKA 1NBEB 3CC7S 1W25A 5IWAF 2V68A 4TQSA 5LT5A 3KG0A 3QRPA 2ZOGA 1EB0A 2HHQA 2V8VA 3ZZRA 1BE4A 4ITSA 2ASLA 1HYSA 3JSYA 3UD3P 2IRYA 4UTGA 4ALZA 3N79A 4Y6IA 3IXQA 3MM9B 4FYDA 1NM2A 5F8MA 1QM9A 3Q2TC 1L3KA 3KHRA 5GMKa 3BDEA 1N88A 3GJTB 2Q3PA 4NE9C 3DN9A 2KG0A 1A0OB 5EUHA 5KFQA 4YHHF 3F56A 1KQFB 3VZIA 1VDHA 2LEAA 5AE1A 3TI0A 2KYXA 5I3UA 4CH7A 3D28A 5BXIA 1Q8IA 1Q7YT 1RT5B 4LQ9A 3PYFA 1U49A 4P74A 3KJFB 2ILYA 4WXWA 1RE1B 5C25A 1F9FA 3HSZA 3SIPB 3PW4A 4PYAA 5I3PA 2D3UA 4YMEA 4DPOA 5KFEA 3CC2S 2ROPA 1YDLA 4Q0BB 3RR7A 1IBMJ 3M32A 2PA8D 2ALYB 1SVDA 4K4TA 3A3NB 3T3FA 2HURA 4X65J 2HLUA 4J90A 4UY8T 3W8GA 1QVGR 2WOMA 2IAJB 2AEFA 1LWEA 4PWDA 4OZ3A 4F2SA 1BQNB 1IJEB 3PVXA 5ITHA 1F9EB 3DRSB 1YRXA 3FFIB 4O3QA 1X7VA 1Q79A 4DG1B 1U1OA 5EWEA 3KK3A 2QMXA 1VMBA 3ISNC 3J81Y 1WKLA 1HNIB 1ZM2A 2RQCA 3IAM9 2HGLA 1S59A 5F9LA 2P9CA 2QSFA 3H4BA 4NLPA 4YDDB 1KDNA 2J0XA 1QAIA 4EO6A 3K5MA 1HD0A 2GJFA 1LWCB 2DB1A 1C1BB 4KY3A 3C6TB 3AB4B 4JV5J 4J9UE 5ETPA 4GC6A 2KZMA 3ZZOA 1RTJB 3K5NA 1D8ZA 2QC3A 2R2RA 1SV5B 2FVQA 4M5KA 3KOAA 2RDDA 1Y10A 2RJZA 5E41A 1K44A 2DNNA 3IS9A 2OPQB 1VHFA 3P49B 1RACB 4MK8A 4DPWA 2F1FA 1VQOS 5KG0A 1U1MA 3UN3A 2UVVA 1S10A 3MAQA 1M5SA 1Z4UA 1JLBB 3BGUA 3DI6B 2OSQA 1IWGA 1DQ9A 1Y5LB 1SKRA 3H42A 4I4BA 1SQEA 6FDRA 3ZTSA 2DR8A 3TUZC 1EJ7L 2B9EA 3MGJA 4BHQA 4KIAA 2CA9A 1G7CB 4DV3F 5KFFA 5A8WA 4LF5J 3M8QB 1XNQJ 4JI2J 4DCPB 2DNZA 2OP5A 4JI0F 4GKKF 2DR7A 3MPDA 1KNZA 3DXSX 2MLXA 4FS2A 2UXBJ 3VV2B 4OYPA 3MDFA 2PFDA 2W7OA 3FRZA 3ILOA 3KK1A 2X3GA 3OR2B 2C2ZB 3BDPA 3EGWB 3PDNA 3R2CJ 1GX6A 4N8NA 3PRDA 4RBVA 3AODA 4JI3J 2Z2ZA 1SC1B 2DXEA 4L73A 1VJQA 1ZTWA 4F0HA 1G3OA 4DUYJ 1I51B 2W4CA 5L9XA 1NB2A 1XMBA 3LAKA 2BE2A 2F8EX 2LA4A 5J2PB 3BH6B 4OHWA 3UDCA 1HI1A 3ENWA 2F63A 1ZYQA 5D0HA 3TQEA 3M7VA 3OJSA 2VFUA 1A9NB 2G0JA 2Z56B 1PJ7A 3EXYA 3J7Z5 4DCJB 5LOQA 3PW2A 4U96A 3W2VB 2B51A 1LOUA 3EE3A 2PSZA 1IBLF 2QYCA 4B3TJ 1RYSA 3G2XA 4N47A 1PC5A 1RAHB 5L1LA 3SZ2A 3ENQA 2P5VA 2Y0SD 2KDOA 4Y2IA 3OTBA 1FXDA 4NMLA 2RF2B 4E8UA 2HIYA 1EZZB 2IVYA 2IJFA 1WC3A 4N41A 1IKXB 1VQ6S 8RUCA 1FHTA 3DRSA 2OHDA 3DLHA 1K1SA 1OQ3A 3E51A 2B6AA 2HQGA 2R2SA 1SUQB 1ZZNA 3EVMA 1HNXF 4K5RA 2JX2A 1VYAA 4L6V3 2G4BA 3JAMU 4ZN3A 2VJUA 4QCLA 2Z58B 2RHSB 4KGMA 2XNQA 2ZHBA 3UDLA 2VKRA 3K5OA 3P5BP 3OQ2A 5GMEA 4KHMA 1FDNA 2E44A 4ECVA 2C28A 4ELTA 1WTFA 4JI4J 2CPDA 1UEVA 5KT6A 4L75A 4GKJF 2MXYA 3CCRS 1AB8A 1FESA 4O4GB 1C1BA 2WONA 2PI4A 1LWFA 2XWYA 1UEKA 2FHKA 2OLWA 2YWWA 2UUBJ 3JSRA 4QIVA 1LFWA 2GAHC 1X5OA 2C3UA 2XMMA 1SV5A 5BR8J 3QPIA 1R27B 4ECSA 1CS4B 3EWGA 2VIHA 3RJMB 2E9TA 4WE1B 3LP0B 4NYOA 3L9ZA 4FVMA 4JYAF 5A2QU 2ADBA 1URRA
chains in the Genus database with same CATH topology
4X64J 2KVQE 4JV5J 4V1Ak 4B3RJ 4LFCJ 1HNZJ 4DR5J 4X65J 1N32J 4KHPJ 3D3BJ 3R2CJ 4PWWA 2MQ8A 4AQYJ 4DV4J 5FLXU 3JAMU 4KYZA 1HNXJ 1IBKJ 4JI3J 1I94J 4RJVA 4DV5J 2F4VJ 2MEWA 4LF7J 1J5EJ 4JI7J 4DR6J 1N36J 4DUYJ 4YHHJ 4X66J 4JI1J 1XMQJ 3OTOJ 4LF4J 4OX9J 4JI4J 1N33J 3IMQJ 4DR3J 2E5LJ 1HNWJ 4JI5J 4DV6J 4DR4J 4DV1J 4X62J 4LF9J 3R2DJ 3J81U 1N34J 5IT9U 3D3CJ 4NXMJ 4GKJJ 4LF8J 2UUCJ 4K0KJ 4YY3J 4DV2J 3T1HJ 2MTLA 2UU9J 4HHUA 3T1YJ 1HR0J 4LFAJ 5LMNJ 3J80U 5LM7E 2UUBJ 4DR7J 1IBLJ 4DV0J 4DR1J 4NEZA 4LFBJ 5BR8J 2UUAJ 4B3TJ 3W1YC 4B3MJ 5LMUJ 2UXDJ 1FJGJ 5IWAJ 2VQEJ 4LF6J 2HHHJ 4B3SJ 1XNRJ 2ZM6J 4LF5J 2KL8A 4DV3J 4NEYA 1XNQJ 4NXNJ 4JI2J 3J7AN 4DUZJ 4DV7J 4JI8J 4DR2J 2UXBJ 4JI6J 2UXCJ 4JI0J 4KY3A 5A2QU 2VQFJ 4GKKJ 1IBMJ 5AJ3J 1XMOJ 4JYAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 J;  2KVQ E;  4JV5 J;  4V1A k;  4B3R J;  4LFC J;  1HNZ J;  4DR5 J;  4X65 J;  1N32 J;  4KHP J;  3D3B J;  3R2C J;  4PWW A;  2MQ8 A;  4AQY J;  4DV4 J;  5FLX U;  3JAM U;  4KYZ A;  1HNX J;  1IBK J;  4JI3 J;  1I94 J;  4RJV A;  4DV5 J;  2F4V J;  2MEW A;  4LF7 J;  1J5E J;  4JI7 J;  4DR6 J;  1N36 J;  4DUY J;  4YHH J;  4X66 J;  4JI1 J;  1XMQ J;  3OTO J;  4LF4 J;  4OX9 J;  4JI4 J;  1N33 J;  3IMQ J;  4DR3 J;  2E5L J;  1HNW J;  4JI5 J;  4DV6 J;  4DR4 J;  4DV1 J;  4X62 J;  4LF9 J;  3R2D J;  3J81 U;  1N34 J;  5IT9 U;  3D3C J;  4NXM J;  4GKJ J;  4LF8 J;  2UUC J;  4K0K J;  4YY3 J;  4DV2 J;  3T1H J;  2MTL A;  2UU9 J;  4HHU A;  3T1Y J;  1HR0 J;  4LFA J;  5LMN J;  3J80 U;  5LM7 E;  2UUB J;  4DR7 J;  1IBL J;  4DV0 J;  4DR1 J;  4NEZ A;  4LFB J;  5BR8 J;  2UUA J;  4B3T J;  3W1Y C;  4B3M J;  5LMU J;  2UXD J;  1FJG J;  5IWA J;  2VQE J;  4LF6 J;  2HHH J;  4B3S J;  1XNR J;  2ZM6 J;  4LF5 J;  2KL8 A;  4DV3 J;  4NEY A;  1XNQ J;  4NXN J;  4JI2 J;  3J7A N;  4DUZ J;  4DV7 J;  4JI8 J;  4DR2 J;  2UXB J;  4JI6 J;  2UXC J;  4JI0 J;  4KY3 A;  5A2Q U;  2VQF J;  4GKK J;  1IBM J;  5AJ3 J;  1XMO J;  4JYA J; 
#chains in the Genus database with same CATH topology
 2V0N A;  2BJ9 A;  4AT1 B;  3KDN A;  1RQ0 A;  1N32 J;  4OJ1 A;  1AA1 B;  3OSN A;  5HVF A;  5IV4 A;  4A4J A;  1TVR A;  2MQ8 A;  5FLX U;  1EET B;  2KB2 A;  3UPF A;  2CQI A;  3Q22 A;  3UCZ P;  3DI6 A;  2ZVS A;  4ECY A;  2XNR A;  4IRK A;  5DZ6 A;  3LTO A;  3Q8Q B;  4DPU A;  4ED8 A;  3DYA A;  4P7T A;  1UW9 A;  4DR3 J;  2B8P A;  4UUX A;  3A4T A;  1NDP A;  1U09 A;  1WG1 A;  4P7V A;  2XBP A;  3M8Q A;  4OJ3 A;  1SH3 A;  1WKJ A;  3UDV A;  5T7L A;  2V50 A;  3D68 A;  4QR1 A;  5CZX A;  4BC9 A;  3B4D A;  3WDO A;  1TKX B;  3GG0 A;  4QJV A;  2JDJ A;  2QA2 A;  3GCX P;  3OR2 A;  4EMD A;  4TU7 A;  1Z2Z A;  3EYZ A;  3DRP A;  1EKS A;  2VQE J;  3R7S B;  3PFO A;  2CYY A;  3H98 A;  3OTE A;  3HM9 A;  3P96 A;  2EEY A;  2WCX A;  3HHE A;  4HT7 A;  3A8I A;  1RTH B;  2HBY B;  3KWM A;  2HGN A;  1TUV A;  2RNE A;  5J2P A;  1A6L A;  3D54 A;  5EWF A;  1WAC A;  1MWZ A;  5LJ3 Y;  1H38 A;  4ZCI A;  4E98 A;  2ZH8 A;  4YUD A;  3ZZ0 A;  2GNK A;  3M8Y A;  1NDC A;  2YKM A;  3R27 A;  4ICL B;  2V34 A;  2MLZ A;  3THP A;  2QN6 B;  2RU3 A;  4J9M A;  1DFD A;  1HW9 A;  3OW2 R;  3I82 A;  4OHX A;  4X4O A;  1K0V A;  3GMG A;  4R5P A;  2ZJR Q;  3RW6 A;  1MWQ A;  2KT5 A;  1YZ6 A;  1OIA A;  1U6Z A;  1TR0 A;  2XLJ A;  2HQI A;  5H9F J;  3DKD A;  2BX6 A;  2XYG B;  1NB7 A;  2DHS A;  2RML A;  1CC8 A;  4NYP A;  1KEK A;  1KTQ A;  1O8B A;  2PEH A;  4WXO A;  4FYY B;  1KBR A;  3CF5 Q;  3C14 B;  4ELV A;  4BS2 A;  3LOU A;  2FC9 A;  3EVW A;  2JLF A;  4CH0 S;  3O2I A;  4TVA B;  5FDL B;  1SJ3 P;  4JP8 A;  5CXT A;  3B4M A;  3D66 A;  3HLU A;  1LK7 A;  3D9B A;  4V1A k;  1RAA B;  1V9O A;  1YRU A;  4XK8 C;  4DV4 F;  1N5V A;  5F8J A;  4M5M A;  3HVT B;  4M5I A;  3NG8 A;  3C15 A;  5HQL A;  5CAA A;  2WSE C;  4I1T A;  1QAJ A;  1RWV B;  4L76 A;  1LK5 A;  3BBB A;  4LSN B;  4K4Z A;  3DLG B;  2WB4 A;  3M2R B;  1VR6 A;  2JVR A;  1CS4 A;  2DHG A;  5KFP A;  4OYI A;  4WE1 A;  3LP0 A;  4WKR A;  2H54 B;  2VD3 A;  5CAB A;  4NLQ A;  3QWU A;  4HDG A;  3HSG A;  3IGV A;  3OHB A;  2XTJ P;  1DLO A;  2UUA F;  4PQU A;  2NR0 A;  4DPT A;  3POT A;  2ZDO A;  4QW8 A;  1RAE B;  2X1A A;  2D74 B;  1JJ2 R;  3D1Q A;  3KXD A;  1S7I A;  2QFJ A;  1SXL A;  2K06 A;  2QEX S;  5GAD I;  5HMY A;  2W9B A;  4NLR A;  1B64 A;  1PYO B;  4CNY A;  1HPZ A;  5CYQ B;  2HFN A;  2AX0 A;  2D3O R;  2BRK A;  1D9A A;  1TKX A;  1ZOT A;  4FZV A;  3R8Y A;  4YB7 A;  4BC7 A;  3N5F A;  3T41 A;  1IBC B;  2DY1 A;  3IM9 A;  4NZ0 A;  1HQE B;  2NXN A;  3UFC X;  2MJN A;  4YDX A;  1DTT B;  3NGU A;  1R7I A;  4IRC A;  2GHW A;  4MYU A;  1TKT B;  4OYA A;  4X4R A;  3BKT A;  4LBP A;  2A6O A;  2H4W B;  1HHS A;  2HS4 A;  3Q8S B;  3BPD A;  1HHT P;  2L48 A;  1GTE A;  3MR2 A;  4CO0 A;  3Q8U A;  3QBC A;  2ZNY A;  1I1G A;  3TAM B;  3UVJ A;  1VC6 A;  2YWK A;  3F0N A;  2DCL A;  2V2V A;  1GX5 A;  1KLN A;  3G82 B;  2VG7 B;  4X64 J;  4WFB Q;  2EC0 A;  2GJI A;  4I2P A;  4JB8 B;  2YY3 A;  3LP2 B;  1NK8 A;  3PX0 A;  3HKW A;  4F4K A;  3MEG B;  2K2P A;  1UET A;  3H5U A;  3I4H X;  4PG6 A;  2J6U A;  2D3Z A;  2J76 E;  1VQS A;  4C8O A;  4I69 A;  2R7R A;  2XO7 A;  2KO1 A;  1IBK J;  1B0T A;  5KFH A;  3CO9 A;  4URG A;  1FRH A;  1XMQ J;  3CDB A;  1JLQ B;  2OTJ S;  2LKZ A;  4ZP8 A;  1NKC A;  4X62 J;  4UOH A;  2F9J A;  5DG8 A;  3BEG B;  4EWT A;  4WK1 A;  5FDL A;  9RUB A;  4DFJ A;  1SC3 B;  2BAB A;  1HQU B;  4UOC A;  4DQS A;  4M5D A;  1KHW A;  3G8T A;  1WEL A;  3TEH B;  5JVH Q;  5L46 A;  5A8K B;  4GO5 X;  3OV7 A;  4PAB A;  3CB4 A;  3KJV B;  3HVT A;  2G13 A;  5KG6 A;  3MM6 A;  4IG0 B;  1RT6 A;  1MMN A;  3EUN A;  4LSN A;  2NSC A;  5CD4 H;  1ZPW X;  2CVI A;  3TVK A;  3DLG A;  4PWU A;  1MNE A;  4HI1 A;  4PWW A;  1OSD A;  3SDE B;  3W9I A;  3DGV A;  1GQE A;  4M1K A;  4RJV A;  2EXU A;  3H59 A;  1KR4 A;  1LWX A;  4USV A;  1GEH A;  1S57 A;  1UCN A;  1FK9 A;  4DV6 F;  4OIX A;  2YX4 A;  2D7S A;  3GB0 A;  4MKA A;  4NX9 A;  4NLU A;  2DHA A;  2DNO A;  3MMA B;  1WTB A;  1SPB P;  3H5X A;  3BN7 A;  2W7P A;  1PGZ A;  3CC4 S;  3FCW A;  1CBK A;  5LM7 E;  1HL6 A;  1S1V A;  4N7T A;  2QRR A;  4B3M F;  3QMQ A;  3IRX B;  2BJ3 A;  4LF6 F;  4B9V A;  4AL7 A;  1RWU A;  1ZM3 A;  1B99 A;  1AW0 A;  1U47 A;  3W5X A;  5J2Q B;  4X2B A;  2AQ4 A;  4NRT A;  2AJ2 A;  3UN5 A;  4ZIV A;  2JZ5 A;  4CQ1 A;  2MQO A;  4PUO B;  2NQP A;  4J9K A;  2WK4 A;  1HQE A;  1TKZ A;  4Y00 A;  4L74 A;  3G8Q A;  4R0J A;  1IN0 A;  2IDE A;  3UD4 P;  2KKH A;  5KFV A;  4M5G A;  2MKI A;  4YQW A;  5B0A A;  2MSS A;  3OFG A;  2GHV C;  3N9U C;  1KOO A;  3BO2 A;  3JYT B;  2AYG A;  2ILZ A;  1W2I A;  5ETO A;  4OLP A;  3ILJ A;  5HRO B;  5G0R B;  1RHR B;  1TUW A;  3TAM A;  2EG2 A;  4CYU B;  2UUC J;  3DGP B;  1Y5I B;  2E7V A;  1SJF A;  3LAN A;  3D0I E;  5KFA A;  2VG7 A;  5JUM A;  1QAY A;  2XM3 A;  1YQH A;  2DR6 A;  3J80 U;  1WDD A;  2LFV A;  1S6O A;  3QJL A;  3OL8 A;  1VOM A;  1RT4 B;  3KLE B;  1E6V B;  3PO4 A;  5L39 A;  4F3M A;  2YKA A;  2HHW A;  1XNR J;  4WU2 A;  7FD1 A;  4U7U K;  4NLY A;  3QSY B;  2KTQ A;  5CYM A;  4TYB A;  2VZ9 A;  1UVN A;  5KFG A;  3UCG A;  4WZQ A;  3M8Z A;  2YXL A;  5A6W A;  3KNG A;  2IRX A;  5AJ3 J;  3PV8 A;  3CJR A;  1JJH A;  3LUY A;  5KFS A;  5F0W A;  4XAK A;  3CJ4 A;  4DSF A;  2HAF A;  2BJE A;  3VQS A;  3JTO A;  3R7N B;  4FF2 A;  2HMI B;  1HQU A;  2K8G A;  1M5P C;  4WFN Q;  3Q83 A;  3PEH A;  3NCR A;  2ZOM A;  2DNP A;  3KJV A;  5HI7 A;  1YJW S;  1TL1 B;  1FD8 A;  4IG0 A;  4DJB A;  4HHH A;  2NXE A;  2ZE2 A;  3GFX A;  1WC0 A;  2G1D A;  4IH7 A;  1E6Y B;  1M5O C;  3UD5 A;  2MKS A;  4ZA1 A;  3HX9 A;  4DR7 J;  1Y0H A;  2BEF A;  3CXC R;  4KH1 B;  4DU7 A;  3E3X A;  1UA0 A;  3AFG A;  2QX0 A;  4ES1 A;  3J7A N;  1JQG A;  4ZIT A;  1U0H A;  2VKZ G;  2VPZ B;  3TJA A;  4X4Q A;  2BXJ A;  4QOT A;  2DIS A;  3OFE A;  3BQ0 A;  1LQ9 A;  1CUL B;  3NBP A;  1S1X B;  3W5Z A;  4U95 A;  3FQL A;  1VRT B;  4C11 B;  2GFF A;  4C0B A;  3HO1 A;  5C24 B;  1T9Y A;  4O3N A;  3DHX A;  1N5Y B;  1N33 J;  2J5A A;  4LF9 J;  3IRW P;  1FCA A;  3U1M A;  3MMJ A;  1Y00 A;  2VG6 B;  5IT9 U;  2DH9 A;  3QQC D;  4CTA A;  2MMY A;  3TJ9 A;  3QZ8 A;  1FDD A;  3EM1 A;  2M88 A;  2FLL A;  4CT9 A;  1SC4 B;  1VQK S;  4YP3 A;  4AFF A;  2QA1 A;  3V4M A;  3G8S A;  4NAS A;  4NZ7 A;  2C3M A;  3BV8 A;  4G1I A;  2MZ1 A;  4DOZ A;  4P2M A;  2VQF F;  2KYZ A;  2AWZ A;  2DH7 A;  1VLO A;  3FSX A;  3QFW A;  4A8W A;  1TFY A;  5HAT A;  4DR5 F;  3JYT A;  1RWW B;  1VBZ A;  2Y8Y A;  3CCU S;  5HRO A;  1TU0 B;  3JSM A;  3BBF A;  3FRY A;  3MEE B;  2KHD A;  4RW8 A;  4LR8 A;  1GXU A;  2OH2 A;  1QTM A;  3CO0 P;  2IVM A;  4FBU A;  4A8X A;  1MLA A;  4URQ U;  2W9C B;  1RUS A;  1FTC A;  2NSB A;  2HG4 A;  5B7W A;  2OI2 A;  2CJQ A;  2H1Y A;  4F25 A;  4B9M A;  4IUF A;  3TUP A;  3BR8 A;  2GQC A;  2C2R A;  5IQ6 A;  2N82 B;  7AT1 B;  2J7W A;  4RL1 A;  3NGT A;  3KLE A;  1U2R A;  4X4P A;  4FN5 A;  4CO1 A;  1VIX A;  3N6N A;  4JI5 J;  4B9L A;  3GJS B;  3JS9 A;  3OLB A;  5DET A;  3MUT P;  3BGF A;  5JJB A;  2GW8 A;  2X7I A;  4CLT A;  5ETT A;  4I6A A;  1TEL A;  2IDL A;  3T1Y J;  5HMZ A;  3NY0 A;  3OVA A;  2HPU A;  3TWZ A;  3GFH A;  3LAM A;  2ZJP Q;  4DQI A;  4WK3 A;  4DX7 A;  4FPR A;  5F9N A;  2DGW A;  3MXH P;  1FTR A;  2VF3 A;  4OI3 A;  1N0U A;  3UNG C;  3PX4 A;  4K5S A;  2HMI A;  4FYX B;  3BGR B;  4HR2 A;  2ZHA A;  4AD6 A;  5HQ8 A;  2CZV C;  2F8H A;  2XY7 A;  2AJ1 A;  2AW0 A;  5DDO C;  3HVR A;  5MAO A;  1JIH A;  1AT1 B;  3OPK A;  4ED1 A;  3KLI B;  4DV5 F;  4KHR A;  3CED A;  2YWE A;  1NKB A;  2ROE A;  3GR1 A;  2R7S A;  2BDP A;  1E6Y A;  2RT3 A;  3KHG A;  3JTN A;  5KFW A;  4IFY A;  3BSN A;  4IG3 B;  4BCA A;  2FJV A;  3QRR A;  4RUH A;  1ACM B;  1NK0 A;  4A8O A;  1UPP A;  2P2C B;  1WF2 A;  4DL3 A;  4ZP6 A;  4NXM F;  2HQD A;  4KT0 C;  1PIE A;  2Z8Q A;  2O5D A;  3LA0 A;  5L1I A;  1APS A;  2EFO A;  3R5C A;  3F41 A;  1HR0 F;  1X5P A;  3CVK A;  2L9N A;  2Z2Y B;  4EUV A;  1TKD A;  4LFB F;  1S1X A;  4QU6 A;  2R7Q A;  4R8U A;  3PYE A;  4K8R A;  4OLO A;  3CJT A;  2XI3 A;  3BKU A;  2AJF E;  3FSI A;  3EPI A;  3M4X A;  1ELO A;  3WIV A;  2U2F A;  3SSR A;  4LBI A;  1XMO J;  2UV8 G;  1N5Y A;  5HLF B;  2BE7 D;  5M2P A;  4USW A;  3M8P B;  2IYI A;  4B9U A;  2HKE A;  2OJ3 A;  3MMC A;  2H4Y B;  1Y3K A;  3MAH A;  3W61 A;  4F7V A;  5DJB A;  3PJW A;  4J9S A;  2BOA A;  3T5L A;  3H7H B;  1RAF B;  4K59 A;  1CPZ A;  4ZVO B;  1VQ5 S;  4IR1 A;  3I4P A;  3JSB A;  1YVF A;  2AT1 B;  4RPF A;  1HWK A;  2BKO A;  4USM A;  3PW0 A;  1JLC A;  2E66 A;  3MAA B;  2QMW A;  2AGP A;  2RKI B;  3OXG A;  3DLK A;  2BAN A;  2C2E A;  3GTY X;  1X4H A;  3OHA A;  3K58 A;  3RBE A;  4K0K J;  2WAQ D;  3H8Y A;  2O67 A;  5IZH A;  3U1N A;  5LSR A;  3W66 A;  2POK A;  2C2O B;  3VAG A;  2IM1 A;  1UVK A;  1S0M A;  3KK2 A;  4ZPC A;  3PRB A;  2IBO A;  1BC6 A;  2JLE A;  2WVB A;  2HHH F;  1FJG J;  2OFH X;  4RNO A;  3N5B A;  1RSC A;  2E1C A;  2ZM6 J;  2F9D A;  4LRB A;  2WSF C;  1BY9 A;  2DT9 A;  1NHK L;  4CLU A;  1CJU B;  3DLJ A;  3HXM A;  1LFP A;  1PO6 A;  2B7C B;  4IH6 A;  3TX8 A;  2B7B B;  5J1N A;  5AXM A;  4A8M P;  2RS8 A;  5HP1 B;  3W7B A;  1NH7 A;  3GV7 B;  4UW2 A;  2YWH A;  2CPZ A;  1RBL A;  3RW7 A;  2DGU A;  3ICL A;  4M63 A;  1IJF B;  4JV0 A;  1WD6 A;  4CLK A;  1J5E F;  4LF7 J;  2EI5 A;  3AXM A;  3HF5 A;  1D9D A;  1G1X A;  4WP8 A;  4LRD A;  4HH0 A;  4J5O A;  1BGX T;  2HZV A;  2ZH2 A;  5CCM A;  5SUH A;  4EU0 A;  3K8V A;  2LDI A;  4OZN A;  4FXW A;  1UVJ A;  2VA2 A;  4ZCK A;  3NNA A;  4A48 A;  2CG8 A;  5ADZ A;  1G2E A;  4GMK A;  3PJ9 A;  1K47 A;  1BHN A;  3ZTR A;  2FJD B;  3Q89 A;  4CLL A;  3TZY A;  3ZTP A;  2ATL A;  3KHL A;  1NJY A;  3KLI A;  1B0P A;  2E9R X;  4JI6 F;  3CDU A;  1UFK A;  2QGF B;  3MUV P;  4DR2 J;  1K8A T;  3M6V A;  3C19 A;  4IG3 A;  2V94 A;  4QWA A;  2FGO A;  3R6G B;  4Q44 A;  1FKP B;  4LFC F;  2ZD1 B;  1HW8 A;  2YNG B;  4PXE A;  4RBT A;  1R43 A;  3RB6 A;  2XWX A;  4U8V A;  2LP4 A;  1QLN A;  2DBB A;  4PR6 A;  4DQP A;  2G2O A;  3RB0 A;  3TUJ C;  2FQQ B;  1YBA A;  4DV1 F;  3OR1 A;  4I7F B;  4DFP A;  1N34 J;  2GVZ A;  1N6Q A;  1HFE L;  5K8N A;  4QIW D;  3MR5 A;  1Q8K A;  3DDN A;  1WHX A;  4C8Z A;  4Y3C A;  2HEK A;  4WII A;  1I5O B;  4DX6 A;  2QIF A;  2XZW A;  3PYG A;  3KMQ A;  3GIR A;  3BPS P;  1CG2 A;  5HAN A;  3TAP A;  5F8G A;  3V6D A;  1U2C A;  1VJW A;  3VGU A;  3CUL A;  1VQ4 S;  2R8H A;  4AE5 A;  1O51 A;  3GV5 B;  1ZAV A;  1Z1Z A;  2LA6 A;  3MAA A;  3TJ8 A;  3GCW P;  2RKI A;  4U8Y A;  1LXJ A;  3V4I A;  4LF1 A;  1FFW B;  3QNW B;  1B7F A;  2YWG A;  2EC2 A;  3D4J A;  3L7O A;  5IV3 A;  5J2N B;  1F0X A;  1AZS B;  1NSQ A;  2NCK L;  4XIU A;  4ATN A;  1T9V A;  1A7G E;  2J9D E;  3FMW A;  2F8M A;  1H3D A;  3C3L A;  2VHG A;  1KQG B;  1NUE A;  4FXV A;  3KHH A;  4KQZ A;  1WSV A;  3RBD A;  2BE9 B;  4W4M A;  4F4A A;  1YG0 A;  3C16 B;  1NHU A;  3SCJ E;  3QZ7 A;  4DV2 J;  2XG8 A;  4HEA 9;  4RU2 A;  1Q86 T;  2AGO A;  2EWH A;  2RIL A;  1RHU B;  1CJV B;  3AB2 B;  1JLE B;  4DLE A;  3MM8 B;  1JK9 B;  3I87 A;  3PRV A;  2FGC A;  1RT1 B;  2VBY A;  2J9D A;  1IBM F;  1DHM A;  4OHY A;  1H73 A;  3D1H A;  4J9P A;  3FUY A;  2JRS A;  3HSD A;  3GJQ B;  2YNI B;  4X65 F;  2Z30 B;  2KHC A;  1VQP S;  3H25 A;  1H7W A;  2V8D A;  2M52 A;  1FVS A;  2HQ3 A;  1XER A;  1IKV A;  3K57 A;  2VBW A;  4DL2 A;  5DQI A;  1OPI A;  2PGC A;  3AJ1 A;  2YH1 A;  3M30 B;  3V81 B;  4Q43 A;  2BJD A;  1S48 A;  1OY6 A;  2DY9 A;  2ZH5 A;  2ZH6 A;  4Q2M A;  3SEO A;  1QE1 B;  1T7P A;  3B8H A;  4WU3 A;  4LFA J;  2ZD1 A;  1UVI A;  2YNG A;  1LEO A;  1EX8 A;  2HNZ B;  1U25 A;  3GYG A;  4QIG A;  3QGG A;  3CWJ A;  3RG6 A;  1QDU B;  3M6X A;  7FDR A;  3RBZ A;  2NZ4 A;  4FP9 A;  4J9L A;  3O8W A;  4FDF A;  2OEJ A;  1J27 A;  5KT3 A;  1EHW A;  2OTL S;  4CLP A;  2R4F A;  4UQG A;  1FE0 A;  2Q43 A;  4WP9 A;  4JV5 F;  2IM0 A;  3MPY A;  3EZO A;  2YNH A;  1KQK A;  4NLD A;  2MZJ A;  4IFV A;  4ID8 A;  3GG1 A;  3SQO P;  4I7F A;  3TP2 A;  1UJ4 A;  2HNY B;  4ID5 B;  2MPU A;  2UP1 A;  1R0A A;  1PBA A;  2CZ9 A;  2RDI A;  4RZR A;  2VPY B;  1U1R A;  4J9R A;  2IRU A;  1RDR A;  3GSD A;  3QFH A;  5ETV A;  3CIM A;  2R8J A;  1PYS B;  3MMB B;  3IBW A;  2V4Q A;  1HWI A;  2FJX A;  2HFV A;  2DNY A;  4NLG A;  3QRQ A;  4QQB A;  5U47 A;  3W2W B;  2BQU A;  2COL A;  2RVJ A;  2W2O P;  3C8Y A;  1OY8 A;  2CKW A;  1IR1 A;  5J2N A;  4LF5 F;  1AZS A;  1XNQ F;  2M8D B;  4JI2 F;  2FTR A;  1JXV A;  4LBH A;  1FJC A;  2M0G B;  1PJ6 A;  2UXB F;  2FD2 A;  3Q8Y A;  3PHE A;  1S49 A;  4WKY A;  1JB0 C;  1HMV A;  3H0P A;  3PR4 A;  3QSI A;  3BYR A;  1CQN A;  4DI6 A;  3NGD A;  2D41 A;  3RTV A;  1MU2 A;  4QPX A;  1S1W A;  3OXL A;  4JI3 F;  4KSE B;  3HHL B;  3K8W A;  2PO4 A;  4KYZ A;  3DNC A;  2CNN B;  2VPX B;  2A6M A;  4ZOS A;  4DUY F;  3KG1 A;  1EP4 B;  4CWB A;  4PRF A;  1CJT A;  2JFD A;  2OFG X;  4PG5 A;  1FKA F;  1CJV A;  4DFK A;  2LDY A;  2B43 A;  3ISZ A;  1T9X A;  3MI7 X;  3QAE A;  3MM8 A;  1TL7 B;  1HBM A;  1BQM B;  2L9D A;  5I3Q A;  1B0V A;  4CRJ A;  4YR2 A;  4RWW A;  1S77 D;  2GV1 A;  1RWO B;  2HHS A;  4J7C A;  3SCI E;  2YNI A;  2I6W A;  3MCM A;  2V9W A;  4C98 A;  4B3T F;  3CJK B;  4MFB B;  6FD1 A;  4NYZ A;  3AQP A;  2V4R A;  2RUS A;  1X0P A;  4I0W A;  2YBV A;  2RB7 A;  2GIF A;  3CCL S;  4RNF A;  4ZK7 M;  4K2J A;  3U7J A;  2MLY A;  2F4V F;  3CUN A;  1Q81 T;  4S0M A;  1UA1 A;  5KFX A;  2IC3 B;  5KFD A;  2Z2M A;  3MZI A;  1SKW A;  1DZ5 A;  2BYC A;  3U02 A;  3W9H A;  5C42 B;  1QE1 A;  4N77 A;  1JMT A;  3NNH A;  2CQ3 A;  1HWJ A;  1NDK A;  1KLM B;  5CD4 A;  2ASD A;  1ZA1 B;  1C4C A;  2GHP A;  4PG8 A;  2ZH4 A;  4HL9 A;  5A0Y B;  4PAA A;  1DTQ B;  4JI4 F;  5E33 A;  3B82 A;  3BBC A;  2H5I B;  3ZFV A;  3BRE A;  2N3O A;  4DSL A;  2W01 A;  3BGO P;  4HTI A;  1FRM A;  2HS3 A;  2XUL A;  1WKK A;  4YN3 B;  2X51 A;  2BRL A;  1F5A A;  3CCS S;  2LLZ A;  3BS9 A;  2FC8 A;  2GS8 A;  2VB6 A;  2UUB F;  2RH3 A;  3HMJ G;  4FF3 A;  1R0B G;  5AXL A;  5BR8 F;  1GMW A;  4H4K C;  4DV0 J;  5DM6 Q;  3DM2 B;  4H4K A;  2R7V A;  2DR5 A;  2CQ4 A;  4YS2 A;  3QT8 A;  1UMJ A;  2MGZ B;  3TNV A;  5H9E J;  1LW2 B;  3NNC A;  3TZW A;  4G6V B;  1H7X A;  5KT2 A;  4MK7 A;  3CCQ S;  2FJE B;  2ZC4 A;  5IOL A;  1N32 F;  3MMB A;  2ZJQ Q;  1S97 A;  5C2C A;  3N6M A;  2GGP A;  3KTQ A;  3HJV A;  3TVZ A;  3WBZ A;  2RRB A;  2W2Q P;  2G0C A;  2BQR A;  2VJV A;  3J7Y I;  4ZPD A;  5DDQ C;  5CHC B;  5D15 A;  4F8R A;  2CJB A;  3Q23 A;  2MEW A;  2XEX A;  3W2W A;  3B6B A;  1T02 A;  5KG2 A;  4QIE A;  3RRG A;  5CH7 B;  4XPC A;  5EX3 A;  5KFM A;  2G1H A;  3TA2 A;  2BOP A;  4DR3 F;  5DQG A;  2HWT A;  4F4W A;  4GVB B;  2JJ4 D;  2J9C A;  5I3U B;  3I56 S;  2L3M A;  2N4D A;  4FF1 A;  3M8S A;  2VOD A;  3G6X A;  3I0R A;  3CJ2 A;  2O66 A;  4C7Q A;  2FLP A;  2DIU A;  3FDS A;  2DKO B;  3OXF A;  5H9F K;  2AGQ A;  3CPW R;  4WIQ A;  4ZPW R;  3HHL C;  1S76 D;  1X4C A;  2VQE F;  1XN9 A;  3D1O A;  1F6T A;  5LMU J;  1AFI A;  1YLX A;  4HAC B;  1Y3J A;  2GMH A;  4GRS A;  1WSR A;  3ZZU A;  1RYR A;  2CPI A;  4K2X A;  4E2F B;  1S72 S;  1FE4 A;  4L3N A;  1BLU A;  2V6A A;  2HSE B;  3MCS A;  3M32 B;  5LSO A;  1X4A A;  3GE9 A;  3MM5 A;  3CJ3 A;  1Q7L B;  3MED B;  4AQY J;  5HJY A;  4ZLN A;  1BQM A;  2BJ7 A;  4DU8 A;  1K1Q A;  2XHW A;  3M6W A;  3MD3 A;  2HHU A;  5K8M A;  4FBT A;  4K4U A;  1OY9 A;  4JV1 A;  3AOC A;  3NGK A;  4J91 A;  4X4T A;  4PWD B;  4MFB A;  3FBC A;  3MPW A;  4DR4 J;  2EFQ A;  3TQ1 A;  4LVN P;  3BB5 A;  1UVM A;  3CDA A;  5HJX A;  1ZA2 B;  2H9Z A;  1UZD A;  3J81 j;  5HO4 A;  2IC3 A;  5E3C A;  1Q16 B;  4O3S A;  1QSS A;  2V69 A;  3D6H B;  4DR1 J;  2OPP A;  1NPK A;  5C42 A;  1H6K X;  3W63 A;  5B0B A;  3OL9 A;  4TY9 A;  3G71 S;  1OWX A;  3R5G A;  3OT9 A;  4OZ2 A;  5A0Y A;  3QGP A;  1DTQ A;  2C2K B;  3BF4 A;  1MSW D;  1EQ0 A;  2CUY A;  2YH0 A;  2RSQ A;  1KP6 A;  3I9V 9;  2RIJ A;  1NLK L;  2HAI A;  3ZNU A;  3R7B B;  2HFS A;  1X9M A;  2EG1 A;  2A1B A;  2QLJ B;  1V3Z A;  4EZ6 A;  4KAI A;  2HQC A;  1NK5 A;  4OX7 A;  3MUM P;  3LP1 B;  3M8W A;  1EIY B;  4PG7 A;  2MGZ A;  9ATC B;  1W7W A;  1LW2 A;  2YKN A;  4F0M A;  2GC8 A;  4AYB D;  1ZS6 A;  3VWS A;  4YY3 J;  1FJ7 A;  1NME B;  1Y9O A;  3M1V B;  3I0S A;  3AJD A;  1JLF A;  3ZZZ A;  1RAO A;  2OD6 A;  4WPA A;  5M2R A;  1Q5V A;  3ILL A;  1U1Q A;  4ZVS B;  1T95 A;  2PN6 A;  3QYY A;  4AND A;  1HNV B;  1SIW B;  5A8W B;  3KNA A;  4CZC A;  2U1A A;  2ZKT A;  3VAK A;  3C6U B;  4N5S A;  2CQB A;  4B3R J;  3DXB A;  4K7Q A;  1SKS A;  4GVB A;  3UR0 A;  1V3S A;  4NMX A;  1IQT A;  1SH2 A;  2OGU A;  3KK1 B;  5IS2 A;  1F3F A;  5J1P A;  1HIY A;  5GAH I;  1SBR A;  3PM9 A;  3GLJ A;  2P9G A;  4FNI A;  3EPG A;  2DGO A;  1N48 A;  1HBU A;  4ELU A;  1RA6 A;  1LV5 A;  3DLL Q;  3IWX A;  4CLY A;  1XJW B;  2BE2 B;  2CPF A;  5BYS A;  4J9O A;  4HAC A;  2Y1L B;  4A8Y A;  1DAX A;  3GYN A;  1ZAW A;  4TU8 A;  2DNR A;  3Q8R B;  1KQS R;  2ZBP A;  4ZVR B;  4HDH A;  5THW A;  4EGL A;  4OV1 A;  1FJE B;  1TL4 A;  4ERD A;  2CPE A;  4ECX A;  2FYX A;  2CQG A;  2HVD A;  5E7O B;  3MED A;  1RT7 B;  2UXD J;  5ETN A;  1TV6 A;  2ACY A;  3PW7 A;  2E1P A;  1WEZ A;  3AY0 A;  1DUR A;  3PHT A;  2MQN A;  3LWM A;  1T9W A;  3W3S A;  4X64 F;  2V5H G;  2HVZ A;  4RNM A;  4LF2 A;  4O0I A;  1Q1K A;  1FI4 A;  1D3W A;  5IXU A;  4EI2 A;  1VK3 A;  2VFR A;  2GAG C;  1IBK F;  1S0V A;  2CQ2 A;  2VV5 A;  3K7R A;  2IVF B;  2W8K A;  1JJC B;  2B6A B;  3R1H A;  2P6T A;  2MY7 A;  4V19 X;  5A76 A;  1XMQ F;  2M9K A;  4OYB A;  3PXG a;  4HTJ A;  1NRK A;  3GPA A;  4P9S A;  4DF8 A;  2C42 A;  3A8J A;  2B0G A;  2E5H A;  3OBI A;  1YJN S;  3CME S;  2KM8 B;  2RU9 A;  5B0E A;  1F2H A;  1RIS A;  5GAE I;  2G9O A;  3NP5 A;  4R0E A;  5CA5 A;  1GXL A;  2W24 A;  2WON B;  2HND A;  2ROG A;  5DG9 A;  1LWF B;  3MPV A;  4DCO B;  5F8L A;  3ZZY A;  3W1Y C;  1S6P A;  3T9N A;  4Q8F A;  1F3V A;  4CP5 A;  4NA2 A;  3QJP A;  2LQ9 A;  1S1U B;  2BUN A;  5EGY A;  4CM2 A;  2XY6 A;  2H65 B;  4OI0 A;  4QWE A;  3U1L A;  3HVW A;  4OJG A;  2XQC A;  3LP1 A;  3A3O B;  3HPO A;  2CDR B;  2M8H A;  1Q8L A;  4DS4 A;  1TVR B;  4RKU C;  4OZ1 A;  3M1V A;  5B0D A;  3OTO J;  4B9T A;  5KG3 A;  4F4Y A;  5DDR C;  3DYA B;  3V6H A;  4M95 A;  4MK9 A;  1IR0 A;  2YNF B;  4C8M A;  4YB6 A;  2LXU A;  1MML A;  2HFO A;  4ZLL A;  1J2V A;  1ZTT A;  1HNV A;  4F3Q A;  3NEK A;  1VHI A;  3C6U A;  5T7L B;  2WB1 D;  1GK8 A;  2ASY A;  2EKY A;  3KUH A;  2DXF A;  1FEE A;  2BM1 A;  1FX2 A;  1YTY A;  4J37 A;  1T03 B;  2E29 A;  2Q6B A;  3BGL A;  1JNR B;  1PIL A;  3FGV A;  3DLE A;  1CVJ A;  3DRP B;  2N3L A;  5K8O A;  1NSP A;  2GQQ A;  2AYE A;  2XYH B;  1FXR A;  3BO4 A;  1B70 B;  2CG4 A;  1DAR A;  1REV A;  2NXJ A;  2ZZN A;  2PT0 A;  5AE2 A;  4ETX A;  2HFZ A;  4MIA A;  1ZM9 A;  2AYB A;  3K5L A;  2EW9 A;  2YKM B;  1RT3 A;  3ZZT A;  5FD1 A;  3TZZ A;  1VRU B;  1NPP A;  3FK4 A;  2XS7 A;  2D69 A;  1RT7 A;  2WBR A;  5AT1 B;  1M1H A;  1MG7 A;  4R5P B;  4RUA A;  2OPR A;  2UUC F;  2Y0B B;  2ZZM A;  3NGS A;  2DCU B;  2NPI A;  4WFX A;  1XNR F;  3OSP A;  1XR5 A;  2I1R A;  4EZ9 A;  1S7H A;  2FJA B;  2C2M B;  5AJ3 F;  5LJ5 Y;  1P9Q C;  1V5I B;  2G2Y A;  3AOB A;  2KM8 C;  2CDQ A;  2LVW A;  3PG9 A;  4H54 A;  2JEG A;  2J6T A;  2M4M A;  2L41 A;  2KI2 A;  5EDW A;  1WEY A;  2FHJ D;  2R42 A;  2FHO B;  5D77 A;  2MKJ A;  4JI7 J;  4OX6 A;  3BO3 A;  3C15 B;  2QL7 B;  3PNI A;  3BSA A;  2EK6 A;  2VL1 A;  3H2V E;  1ZZF A;  2B4P A;  4ZCM A;  3SSQ A;  1S1U A;  2YVS A;  3S1T A;  2JLG A;  1VQL S;  2J6S A;  1SQF A;  4A8S A;  1H2U X;  3CSK A;  3MHY A;  2ZH1 A;  5T14 A;  3MPU B;  2CQ1 A;  4A8F A;  2JEJ A;  4OI6 A;  1T9T A;  1R89 A;  1S0O A;  2XMT A;  3ET6 A;  4NEZ A;  1MN9 A;  2Z0G A;  1RWX B;  4USK A;  1VBX A;  1PSD A;  4A46 A;  1DLO B;  2WW8 A;  4PQU B;  5K14 A;  1KTV A;  2B5J A;  2BW2 A;  4LRE A;  2BKN A;  3POT B;  3OJU A;  1R0C B;  4Y34 A;  4NI2 A;  5FJ4 A;  2KU7 A;  2HRU A;  3KKF A;  1N56 A;  2ZBR A;  3W64 A;  3PJX A;  3A13 A;  5GAG I;  1YJU A;  3FSY A;  3AD8 C;  4O44 A;  3PEJ A;  2YNF A;  3N4W A;  1XBW A;  3D3B J;  3V5R A;  1C2P A;  3EX7 B;  4UOF A;  1YJR A;  4CI0 B;  2OML A;  2C3Y A;  4K50 A;  3DLB A;  2W9B B;  1R8P A;  4EBE A;  2E5G A;  4Y28 C;  1N33 F;  1HPZ B;  1U1L A;  3G6V A;  4TU9 A;  1HNW J;  2CNL B;  3GFZ A;  4UZB A;  2PMH A;  4LF9 F;  1T03 A;  2K3K A;  4ZJQ A;  4HH1 A;  1WG4 A;  4ILR A;  2LXF A;  3H2U B;  2K7J A;  4HYK A;  1L5U A;  3H2L A;  3VF0 B;  3FEY B;  3Q86 A;  1OYD A;  5HVG A;  2AEM A;  2KFZ A;  3SV4 A;  5KG7 A;  3J7Z T;  1RZM A;  1BD6 A;  2X1B A;  4ZP9 A;  1P6T A;  4FKX A;  5IM0 A;  2IBK A;  1NCL A;  5GVQ A;  2Y1R I;  2G0I A;  5DG7 A;  1EQM A;  1VRU A;  2XGP A;  2XZT B;  3UVJ B;  3UI3 A;  2VFT A;  1YI2 S;  3VAH A;  5KFN A;  2WBM A;  4RU9 A;  1GAO A;  2R2U A;  5D4L A;  1VBK A;  4I67 A;  4KHP J;  4PEO A;  4I2P B;  2CQC A;  5CYJ A;  3TX0 A;  2F40 A;  3ETO A;  2XMV A;  5B0F A;  1Q4R A;  3FKB A;  2CQ0 A;  1N52 B;  1GTH A;  3GFY A;  3BKF A;  3EGZ A;  4DR6 J;  4KGV B;  3JAM Y;  4HI2 A;  2NPF A;  4JI5 F;  3BM7 A;  4LMZ A;  8ATC B;  1T05 A;  1DJ0 A;  1FNO A;  1HWL A;  1KFS A;  4JV2 A;  2AD9 A;  4ZVH A;  3HFZ B;  2BW7 A;  2E1R A;  1SKU B;  4TLQ A;  1WF1 A;  3T1Y F;  3SCL E;  2NXC A;  3TZX A;  2MTL A;  3SQG B;  2F65 A;  3SXL A;  5DO2 A;  3JB9 k;  3CJS A;  4NRU A;  3OUY B;  4M5D B;  4B08 A;  3D67 A;  2VH7 A;  4B3S J;  2GVD A;  1ZBT A;  3T6B A;  3SBM A;  3DFE A;  4RBU A;  4KGX B;  4DV7 J;  1XIQ A;  4L72 B;  2W1B A;  2F5G A;  4ZVG A;  5K8P A;  3MM6 B;  3Q2S C;  2QL5 B;  1P1L A;  2J7K A;  1RT6 B;  1SJ1 A;  3G6E S;  2IA0 A;  1SJR A;  3UCU P;  3CJQ A;  4WTO B;  5A2Q Y;  2SXL A;  2Q79 A;  1OO0 B;  1RTI B;  1KVJ A;  1T8E A;  5FLX Y;  1Y5N B;  3X1L B;  4DZD A;  4LF4 J;  1YJT A;  3BR9 A;  5D4O A;  4ZHR A;  1JLA B;  1NZ8 A;  2E5L J;  3SV3 A;  2KH9 A;  4IO1 A;  4DL7 A;  5KFO A;  4DX8 H;  1FK9 B;  2F7V A;  4ZVP B;  3R97 A;  3CCM S;  2DRD A;  2AKW B;  1JXL A;  3RZA A;  1NHV A;  5K5M A;  2XI2 A;  1HBN B;  2XZD B;  1FER A;  3A12 A;  5AE3 A;  2MJU A;  2V4J B;  3RAM A;  1N5T A;  2HS0 A;  2DH8 A;  1KHV A;  1S1V B;  1CJK A;  2JHE A;  4H4M A;  1RU1 A;  2GQ2 A;  1ZPV A;  5F3Z A;  4F36 A;  3QGI A;  3CD7 A;  5DZ7 A;  4DSI A;  1XMO F;  2IHR 1;  4ILL A;  2QV6 A;  2EBG A;  2VBZ A;  3EMT A;  4YR3 A;  2V2K A;  1K9M T;  2DGQ A;  4LR9 A;  5J1E A;  1JLG A;  4P2F A;  3DOM A;  2PEB A;  4WFZ A;  1RAI B;  5D0R A;  2XLI A;  2KRR A;  2DTJ A;  1TKZ B;  4IQX A;  2V2Z A;  2W7A A;  2D1C A;  2ALZ A;  4W92 B;  2OIH A;  2Z57 B;  1RLD A;  5IC6 B;  4WYL A;  3HUL A;  3J7A 1;  4DSJ A;  2B3T B;  1RAJ A;  3UW1 A;  2DNM A;  1TAQ A;  4K0K F;  4KRW A;  1LNQ A;  4DL0 C;  2XMU A;  1YBU A;  3NOG A;  3ZO7 A;  4DL6 A;  1XTZ A;  3IN5 A;  3M9M B;  4CO3 A;  4IDK A;  1FJG F;  2DNQ A;  3UWT A;  2BR0 A;  2ZM6 F;  4PXB A;  3OLA A;  3TR5 A;  4ED0 A;  4JI8 J;  3HFK A;  1U02 A;  5F3T A;  4C9D A;  4UY8 5;  4P73 A;  3BH7 B;  1X5T A;  1FDB A;  4A8K A;  3CDW A;  5CYM B;  3MFI A;  1RWM B;  2ZUA A;  1NK7 A;  3CIZ A;  4LUB A;  1NO8 A;  4MKV A;  3CW2 C;  4DQR A;  2AP6 A;  2JEI A;  4LF7 F;  1KVK A;  2BBE A;  3SQG A;  4Y2C A;  2A18 A;  2WZ1 A;  4TY8 A;  4X66 J;  2MKK A;  3GIM A;  4I68 A;  2XHC A;  4DZ6 A;  3OUY A;  5DM7 Q;  3QT7 A;  1F5C A;  5KG5 A;  2CZ4 A;  3HVA A;  2O3D A;  3HHL D;  3J81 U;  1UAW A;  1FNX H;  1U24 A;  1KN6 A;  3GU0 A;  3T1H J;  2CJA A;  3QAT A;  3T5K A;  2ZE2 B;  1RGV A;  3D6M B;  4Q45 A;  3VZH A;  4P6Q A;  4ECW A;  1DQ8 A;  3DCA A;  4B3O B;  2HK2 A;  4FYV B;  4DR2 F;  1XQI A;  1RTI A;  2VAS A;  4C2M A;  4HHJ A;  3KMS A;  5FII A;  2B9X A;  4PZV A;  4NOH A;  2PA3 A;  3IBF B;  3A8K A;  3M9O B;  1JLA A;  4K4X A;  1ZAX A;  2WSC C;  2YX1 A;  1U0H B;  2UVR A;  3VGS A;  3R3T A;  3G6Y A;  2NS1 B;  3DRY A;  2HFU A;  3V6K A;  2YQ3 A;  3NBP B;  1IQZ A;  1RWP B;  4LF8 F;  1HBN A;  1RCX B;  3LGH A;  2OSR A;  2V4J A;  2ZH7 A;  4FVC A;  3D0H E;  5DLG A;  4CIO A;  3KG4 A;  1N34 F;  1ITP A;  2RS2 A;  2OEL A;  5HMX A;  3EGV A;  2W4D A;  3IR5 B;  4B17 A;  1WHV A;  3L3C A;  4CTA B;  1N4L A;  1UKU A;  3GZ7 A;  1ZH5 A;  1PYT A;  4RO0 A;  3VTI A;  3CJ5 A;  3M2U B;  4NZ6 A;  2CJX B;  2EFN A;  4M5H A;  1CEZ A;  3HT3 A;  1QAX A;  5GAD U;  3K2Y A;  4QBU A;  1HI0 P;  2CJK A;  1WHY A;  2WRM A;  2RDJ A;  4N8O A;  3SCK E;  3NKY A;  3MEC A;  1NJX A;  4XDC A;  2M5Y A;  1SB6 A;  4PXC A;  3MOZ A;  1FKO A;  2R7X A;  1NZA A;  4O23 A;  2GMJ A;  3JSM B;  3IAS 9;  4DWI A;  3BQ1 A;  4RW8 B;  1VGY A;  1YWX A;  5D4N A;  2R8I A;  1P27 B;  4KR0 B;  1AXQ A;  4JI1 J;  1RJJ A;  2AMC B;  4OX9 J;  2ZHO A;  3TW0 A;  1XR7 A;  4I2Q A;  3EDQ B;  1FFG B;  3UNY A;  2AIR B;  2VDH A;  3G96 A;  4NA1 A;  2BJ8 A;  1X4D A;  4DV2 F;  4OI2 A;  1GXT A;  5B0C A;  2BA9 A;  5LMN J;  3CCW A;  1FRL A;  3NMA A;  1PAU B;  2WHO A;  3IFE A;  3K17 A;  4CT8 A;  3QLH A;  1SH0 A;  4MJK A;  4WWS A;  5KOW A;  2OEM A;  1KSP A;  1NU4 A;  4MKB A;  4TYA A;  3R1L A;  4DUZ J;  2XC9 A;  1R6Y A;  2FZK B;  5EHH A;  4ED4 A;  4KPY A;  3HSJ A;  4KFB B;  2ACM A;  1KRP A;  1HNZ J;  5L9N A;  3AAW B;  2V8P A;  2A2C A;  1X31 C;  1WC1 A;  4FS1 A;  2YPZ A;  3ADA C;  3W5Y A;  4ZPV R;  2DO4 A;  1IKY B;  5ETK A;  3OL7 A;  5ETS A;  1I94 J;  1VS3 A;  2PI5 A;  1UWB B;  4NPO A;  2HBQ B;  4LIR A;  2R8G A;  1N36 J;  5LXR A;  3ITH A;  4U6P A;  3I5B A;  4NWB A;  1X4F A;  3GON A;  5J2M B;  3HD2 A;  4IFY B;  3PIP Q;  2CVE A;  3AH6 A;  4B3O A;  5HBM A;  1V5V A;  2V2Q A;  1U6F A;  4OV6 A;  5E3P A;  5KFI A;  2YQ0 A;  1XEZ A;  4LFA F;  4NLX A;  4JBC A;  3RUB L;  1D1U A;  3RB3 A;  4ED2 A;  2DK2 A;  3DOK B;  2LMI A;  1WG5 A;  4YB1 P;  4WF9 Q;  2J8S A;  1XR6 A;  1VRQ C;  3NS5 A;  3MM9 A;  4R8U B;  4DFM A;  1U7L A;  4Y65 A;  4UOG A;  5BYQ A;  4RUB A;  1QSL A;  3ISN D;  2V8G A;  1Q82 T;  2ZWP A;  1Q78 A;  3ZTQ A;  4KGK A;  3MMC B;  2ASJ A;  3D0G E;  3BJY A;  4UT4 A;  1Q5Y A;  1S1T B;  2RUG A;  6AT1 B;  1S9E B;  2PII A;  3O5T B;  1KD1 T;  5CCL A;  4W98 A;  1S6U A;  3KLG B;  5KFB A;  4C8L A;  3HD1 A;  3M2U A;  2OMO A;  1RT5 A;  3EVO A;  2C22 A;  1CLF A;  2ZNZ A;  1JLC B;  4DXL A;  1DY3 A;  1U48 A;  3PTW A;  4KPC A;  4U7U D;  3DLK B;  2BAN B;  1SIZ A;  4IQM A;  3RAQ A;  2VFV A;  3EIC A;  4X4U A;  4NLS A;  1XWL A;  1TQL A;  2IA6 A;  2LEP A;  4GO7 X;  3S8S A;  4QYR A;  3BQ2 A;  3I32 A;  2ZBC A;  2FVR A;  3KK2 B;  3J80 Y;  3G87 A;  3RBX A;  3GJR B;  2KN4 A;  4Q0B A;  2K7K A;  1R8H A;  5EX0 A;  4MIB A;  1RA7 A;  2PMW A;  5D4P A;  2MZT A;  1O0P A;  1NKE A;  1PG5 B;  4ECR A;  1OQ6 A;  3MCO A;  2J0Q D;  4ZPA A;  2KJW A;  2IAJ A;  4YB5 A;  2VOP A;  5E0O A;  1JWW A;  3HZE A;  3TOQ A;  2F4V J;  2MHN A;  4YR0 A;  2DEJ A;  1AYE A;  2JL9 A;  1BQN A;  1X4B A;  1Y7P A;  4KV8 B;  3ENA A;  4C4W A;  2GO9 A;  1SL0 A;  2OD4 A;  3FFI A;  4NLW A;  3ILI A;  2QLX A;  2ZFH A;  1J5O B;  4DG1 A;  1OS5 A;  4DPY A;  1AUS L;  1WI6 A;  1FNM A;  1HNI A;  1RHM B;  4Q5V A;  2UVW A;  4BDP A;  2MZS A;  3CJ0 A;  3I6P A;  3HHN B;  4KFB A;  3CD5 A;  3FBE A;  3N28 A;  1WHW A;  3DOL B;  3U27 A;  2YPY A;  4C8Y A;  1S4E A;  3PFE A;  3HZG A;  1IKY A;  1LWC A;  1CSJ A;  1URN A;  1P8G A;  1UWB A;  4NXN J;  3C6T A;  3LPY A;  1MRO B;  4P75 A;  4ZN1 A;  1RTJ A;  2ZBQ A;  2XSF A;  1VQ9 S;  5J2M A;  5G4D A;  1X5S A;  2KT3 A;  3R5A A;  5H9E K;  1K0T A;  2NXU A;  2BJ1 A;  2EFV A;  3MOJ B;  4Z37 A;  4J9N A;  2ERR A;  4Q8E A;  5A6P A;  2OPQ A;  2C3O A;  1KOH A;  1IUJ A;  2A3J A;  1TTH B;  3AA9 A;  1H2V Z;  4AL6 A;  1NSA A;  3NCP A;  2V9K A;  3DOK A;  2IPO B;  5D78 A;  2FVS A;  1WOO A;  1VQN S;  5I42 B;  1JLB A;  5DQH A;  1RHJ B;  3OR1 B;  2EK1 A;  5K20 B;  2XS5 A;  5D8H B;  1Q8B A;  3UDE A;  1I6J A;  4RR5 A;  2AJQ A;  2GVZ B;  2UU9 J;  4IOA Q;  1N6Q B;  4LIW A;  5IT9 Y;  2Y8W A;  1U4B A;  3T9Z A;  3V2U C;  4DV0 F;  2L9W A;  1FWL A;  4QU7 A;  2ABY A;  2AV5 A;  4HLB A;  2DD8 S;  2MST A;  1FEH A;  4MH8 A;  4ZPB A;  4M8L A;  3NS6 A;  3OVS A;  4DLG A;  1S1T A;  4LT6 A;  5GMD A;  2UXC J;  1S9E A;  2M3D A;  3KLG A;  3V6D B;  1UJ6 A;  4LR7 A;  3MR7 A;  3MTJ A;  3GIJ A;  4YOE A;  3QWP A;  1U2F A;  3V4I B;  5C2G A;  3IR6 B;  5SZT A;  2N7C A;  2H5J B;  5RUB A;  4NL5 A;  1WOP A;  1KFD A;  4RNN A;  3QT6 A;  3AHP A;  2JVO A;  4NCB A;  4K4Y A;  2CWK A;  2QLW A;  2ZH9 A;  2OPS B;  3W2V A;  2R7U A;  2W4P A;  1Y11 A;  2MKH A;  3PIO Q;  2VC0 A;  2J8A A;  1LW0 B;  2W2M P;  2X1F A;  2X3D A;  2VU5 A;  2HHP A;  2B56 A;  3CCE S;  5LMU F;  4CO2 A;  2RF2 A;  4ZJO A;  3TVY A;  3GR0 A;  1L3U A;  2CNO B;  2VDI A;  1NAQ A;  3H90 A;  3WQP A;  1D9F A;  1IKX A;  1T11 A;  2D9P A;  4KV8 A;  2A10 A;  2AX1 A;  2LU1 A;  1CC7 A;  4CO4 A;  3ELH A;  1SUQ A;  3NXZ A;  4WZM A;  3FCH A;  1J5O A;  2AZ3 A;  5E3R A;  2D3O 1;  1M5V C;  1FRI A;  4AQY F;  1IVZ A;  3IBC B;  2CPY A;  1DBD A;  2QZ8 A;  3CCJ S;  3LAL A;  3SMZ A;  4PKD B;  1NJW A;  3NS7 B;  4KJI A;  1IKV B;  3DOL A;  2DNG A;  3NAI A;  2R8K A;  3PZP A;  4DR4 F;  3FEZ A;  2FIU A;  4C48 A;  3BN4 A;  3VVU A;  3LWL A;  4KGZ B;  4O4G A;  4N76 A;  3HT0 A;  2VFS A;  1MRO A;  4O4R A;  1SL2 A;  4RW4 B;  4ECZ A;  2FY8 A;  4OZ0 A;  5KFR A;  3TA0 A;  4MTP A;  4FKY A;  1W26 A;  2EVZ A;  1L3V A;  4ZP7 A;  3CE8 A;  2GML A;  3H5Y A;  4DR1 F;  3W65 A;  3HKZ D;  4KTQ A;  2AYM A;  5IWA J;  5L1K A;  3GII A;  2FLO A;  2I38 A;  1U45 A;  1BMQ B;  4ZVE A;  3AXK A;  3CCZ A;  1L3T A;  2FVC A;  1TUG B;  3D5M A;  2UV8 A;  1FFS B;  3DHW C;  3H4D A;  1EET A;  5I42 A;  2GZO A;  4P72 A;  2YNH B;  3ZNJ 1;  4XDD A;  3HFV A;  4IFV B;  2MY8 A;  3M9N B;  2ZIT A;  1SI9 A;  4URS A;  3CJ8 A;  4QWC A;  1R0A B;  3HK2 A;  1TL5 A;  2RRA A;  1R31 A;  4YHH J;  1NDL A;  3E01 B;  2HBZ B;  3QO9 B;  4R25 A;  4DQQ A;  1IM4 A;  3IMQ J;  4ZMM A;  1U8W A;  1WEX A;  2I5J B;  4OYW A;  3O1L A;  2XMJ A;  4ZDN A;  3W8P A;  2JOQ A;  4ZS6 A;  2H3E B;  4PG4 A;  4YY3 F;  1O6X A;  1RT2 B;  2NZC A;  1GFW B;  4F3O A;  3IG1 B;  5IT4 A;  1RBA A;  5D0E A;  2PE8 A;  4LJM A;  1FRK A;  2HK3 A;  5E5N A;  5KFC A;  5EN1 A;  4I56 A;  1RTH A;  4RUC A;  2DHX A;  2KJV A;  4ZVU B;  3Q8V A;  2M2B A;  1RU2 A;  4B3R F;  1VIO A;  4D3H A;  4ICL A;  2CQH A;  3L4B C;  3PCO B;  1YGY A;  4E0D A;  1T9U A;  1HMV B;  2OPS A;  2W2P P;  2DNK A;  4ZLP A;  1UP1 A;  2IJN A;  1FVQ A;  1MU2 B;  4YFU A;  1S1W B;  3IWN C;  3WX4 A;  4PQA A;  1LW0 A;  1H0H B;  1X60 A;  2EPI A;  1H72 C;  2VUG A;  3RR8 A;  5E3A A;  5L8R C;  4EO8 A;  2NUU G;  2L08 A;  1CJT B;  2DYA A;  5KFY A;  4WBF A;  1RK8 A;  4Z2X A;  1BWV A;  4ANC A;  2OUG A;  5L38 A;  3V6J A;  1SCJ B;  4MIW A;  1HBM B;  4AXI A;  3P8B B;  3K89 A;  2WVD A;  2HWI A;  2IM3 A;  2KXH A;  3THT A;  4A47 A;  3C14 A;  4LVO P;  2OKQ A;  2NLW A;  4O3O A;  1WNE A;  2UXD F;  3I96 A;  3TAQ A;  2CRL A;  3IC1 A;  1SJQ A;  4DN9 A;  3CMQ A;  4QYZ K;  4BWM A;  3NRB A;  5AXK A;  1YJ9 S;  3OVB A;  1WOS A;  4RX6 A;  1X4E A;  4ZVQ B;  1S5Z A;  3OL6 A;  3L09 A;  5DS7 A;  4RW4 A;  3MTK A;  1QVF R;  3BSC A;  3FMB A;  3OFH A;  2DNH A;  4C6A A;  3M2R A;  1PC4 A;  4ED3 A;  2HHX A;  2E7X A;  4H4O B;  3QJJ A;  2C2D A;  1H2T Z;  2QE5 A;  2O1P A;  5KFU A;  3D6T B;  3QID A;  1UEU A;  4AL5 A;  1UJ5 A;  3UN2 A;  2EFP A;  1WC4 A;  5KAK A;  3ZC4 A;  3SI8 A;  3I5A A;  1ZM4 A;  1UVL A;  2K3I A;  1RXO B;  3T5J A;  1R8B A;  4WJB A;  1UPM B;  2ZEJ A;  5MLC V;  3GV8 B;  1QJH A;  4DV3 J;  2APO A;  2VBX A;  4RW6 B;  2YKP A;  3D7S B;  4QR0 A;  4CLW A;  1HI8 A;  2Z4P A;  4JI0 J;  3E01 A;  3QO9 A;  4GKK J;  4FNH A;  1VC0 A;  1B4S A;  2BQ3 A;  3VAF A;  2I5J A;  4GC7 A;  2GA7 A;  1RAG B;  3P6Y C;  1X9S A;  3K59 A;  5CYQ A;  2RQ4 A;  2CPJ A;  2R7T A;  2RHQ B;  2CNK B;  2KFN A;  3KLF B;  1ZET A;  1RT2 A;  4F02 A;  2GGP B;  2JSX A;  1S4F A;  3IG1 A;  4X4V A;  3OTO F;  2V8H A;  1TK5 A;  1IKW B;  2HZC A;  3QAU A;  4V19 J;  1R8C A;  5KFT A;  2XO6 A;  1HBO B;  1QUV A;  3W9J A;  1DTT A;  4OI1 A;  1OSC A;  2CQD A;  4FYW B;  1D8Y A;  1TKT A;  5CQG A;  1DQA A;  2RAQ A;  4M5N A;  2XMA A;  3MUR P;  5F8I A;  2CQP A;  5JXS A;  3IWL A;  3I0R B;  2LQJ A;  3HHK A;  1IBL J;  5L1J A;  4IO9 Q;  1VQ8 S;  2XGQ A;  2E1A A;  2DEI A;  4ZJL A;  1WF0 A;  3G82 A;  4C8K A;  1FA0 A;  3N6L A;  1R6V A;  1PBU A;  3H5S A;  3LP2 A;  3WX8 A;  1M90 T;  3MEG A;  4I64 A;  2UUW A;  4OHV A;  2ZH3 A;  3OTD A;  2LU2 A;  3AOA A;  4LSL B;  5KOX A;  5KFJ A;  3KFW X;  1TP7 A;  2FHM A;  1KWM A;  2M70 A;  2NUH A;  2XSJ B;  1HNX J;  4CLS A;  2LEB A;  3MM5 B;  1U1N A;  5HN0 A;  1JLQ A;  3VQT A;  1Q53 A;  2VPW B;  4ZVT B;  2JEF A;  4XTT A;  2JFK A;  3JQJ A;  1YJ7 A;  2YKQ A;  4QR2 A;  3AT1 B;  3IO1 A;  1YSJ A;  1KS2 A;  4P52 A;  2Y3Y A;  2KFY A;  2P9E A;  1VQ7 S;  1NJZ A;  5B0G A;  4GKJ J;  4DN0 A;  1RTD B;  4Y0F A;  3NAH A;  3SSS A;  4U7C A;  4P10 A;  5A8K A;  1JJ4 A;  3MWB A;  1WJ9 A;  8AT1 B;  2HVE A;  1KC8 T;  4RWX A;  1BWE A;  2DPI A;  1X8D A;  4C0H A;  1RWK B;  5DDP C;  1UWA A;  4USI A;  4HKQ A;  2N4C A;  3PYD A;  1X0F A;  1LKZ A;  4NEY A;  2OPP B;  4HT5 A;  2DGS A;  3M05 A;  5B08 A;  1F5B A;  4JYA J;  2ZZT A;  4H4O A;  4Y2K A;  2ZVI A;  4K4V A;  4OMF G;  3SDE A;  1C1C B;  3O3L A;  1RTZ A;  1TK8 A;  2QL9 B;  1D0E A;  1YRT A;  1PJ5 A;  4ZLJ A;  1QY7 A;  4UQT A;  2LQ5 A;  3EJM A;  4JI7 F;  3GIK A;  1MMD A;  2DXD A;  2ZUG A;  3RB4 A;  2HRY A;  2HHV A;  4ZPT R;  1OYE A;  3NMR A;  4CLF A;  3IA0 A;  2QYG A;  3MMA A;  4USU A;  2VIC A;  1YKW A;  2BM0 A;  5H1S V;  1TMJ A;  4RW6 A;  2R7O A;  3KYL A;  4CH1 A;  3NL0 A;  2DIV A;  1MWY A;  3PKY A;  1BQX A;  4ZCL A;  1D09 B;  4FPI A;  1WC5 A;  2OEK A;  3UO0 A;  4RW7 B;  4KE5 A;  2YKN B;  3IRX A;  5IC4 B;  3X3U A;  3MF5 A;  1YK9 A;  3THV A;  4LRC A;  2HHT A;  4WCE Q;  3L7U A;  2UZA A;  5KFL A;  3I0S B;  3KLF A;  1JLF B;  5KG4 A;  5J2Q A;  1C0U B;  2ZKU A;  3VGT A;  4K4W A;  4UF4 A;  2RRN A;  4RNH A;  1IKW A;  1HKA A;  4PUO A;  2KZZ A;  4IYQ A;  1S9G B;  1FD2 A;  4KC5 A;  1I3O B;  4P2X A;  4WTY A;  1HBO A;  1UFW A;  1S99 A;  4ENO A;  3VAI A;  4MYT A;  3VAJ A;  4KB7 A;  4CNZ A;  4NLV A;  5M2U A;  2I9S A;  2HIQ A;  3CDE A;  4CDI A;  1QSY A;  3KJN B;  3ULH A;  3G9C A;  4U67 Q;  3RU0 A;  5G0R A;  3OD2 A;  1HNW F;  1G6B A;  2IYG A;  3A8E A;  5JVG Q;  1VCT A;  4CYU A;  3JXO A;  3DGP A;  3PO5 A;  3PY8 A;  2UVU A;  4TN2 A;  2DRA A;  1HBU B;  1YJV A;  4BBY A;  3I31 A;  1RKI A;  2VOO A;  2FVP A;  1RT4 A;  4Q7A A;  3UE2 A;  1X9W A;  4LSL A;  1E6V A;  5ETQ A;  2AJ4 A;  2KG1 A;  4OZ5 A;  4NCA A;  1VC5 A;  1KKH A;  2FPH X;  1U8S A;  1S9F A;  3CTR A;  2WTF A;  2XSJ A;  3R5B A;  2KL8 A;  1SL1 A;  1O5J A;  4OJH A;  3MFH A;  1TV6 B;  2LQ8 A;  4TNO A;  2QG9 B;  5F8H A;  4M94 A;  2KVQ E;  2KT2 A;  4OZL A;  4O3P A;  2FUG 9;  3LH2 S;  2A0F B;  4KHP F;  3G86 A;  5DGB A;  5EWG A;  2MB0 B;  4DV4 J;  3EZ5 A;  1RTD A;  4IRD A;  2IJR A;  2GIQ A;  1YIJ S;  3TRG A;  4QIF A;  1JX4 A;  4DR6 F;  3DDI A;  4RLE A;  4C3K A;  5IFM A;  5HMW A;  1RBO B;  1TL1 A;  4K4S A;  3UR3 C;  2IMW P;  2VG5 B;  2K1R B;  3L95 X;  3R2D J;  4AUK A;  3KUE A;  2JWN A;  2YKO A;  4GVL A;  1NND A;  3T6J A;  2JH3 A;  3QGH A;  1T3N A;  2IY5 B;  3UQS A;  2AEJ A;  2R3V A;  3M2V B;  4DF4 A;  1R3N A;  1C1C A;  4F26 A;  1S0N A;  2E9Z A;  2UUA J;  3TYT A;  2W8L A;  4B3S F;  1ULR A;  2HND B;  5F8N A;  2B4U A;  4DV7 F;  1S6P B;  3BSO A;  3QT5 A;  4I6W A;  1M1G A;  1YZ7 A;  2CPH A;  1R8A A;  1CUL A;  1Q0N A;  1NK6 A;  4OZJ A;  1NPR A;  1FX4 A;  1VRT A;  4C11 A;  2I0X A;  3L7P A;  5C24 A;  1VBY A;  2HRT A;  3US5 A;  3CGI A;  3HI9 A;  1N5S A;  3SFG A;  5D0G A;  2KRB A;  4RW7 A;  4LF4 F;  2DPJ A;  5BJR A;  1TAU A;  3EZU A;  2E5L F;  1NJI T;  2VG6 A;  1DRZ A;  2RD5 C;  1HQ2 A;  4OHZ A;  2HWH A;  5BYR A;  2HLT A;  1S6Q B;  4TXS A;  1RAB B;  1C0U A;  3BZQ A;  4ECU A;  3PW5 A;  1U1P A;  2B4O A;  1EAR A;  3DC2 A;  4HHU A;  3LPE A;  1S9G A;  3NLC A;  3HCX A;  2GIR A;  5LL6 d;  3KUG A;  2OAU A;  3AA8 A;  1FRJ A;  2J0S D;  4WFA Q;  2EKN A;  4M5J A;  2V67 A;  3HP6 A;  5JMN A;  2AHO B;  5C5J A;  4DSE A;  2IFX A;  4EYH B;  4PCQ A;  3P5T L;  2G2Z A;  3LQV A;  3J7Y U;  4NLT A;  2ZOF A;  3DLE B;  2MDA A;  4ZIW A;  3OTC A;  4DL4 A;  2NYI A;  3MEE A;  1EKR A;  2FDN A;  3NWG A;  4IKA A;  1EAY C;  4LQ3 A;  2QLF B;  4LSZ B;  2W9C A;  4EFA C;  3NGR A;  3JQM A;  1REV B;  3T19 A;  4MAK A;  1KON A;  1S12 A;  2JC0 A;  2CIM A;  2CJY B;  4X84 A;  1FRX A;  2BVZ A;  4LRF A;  4Y2M A;  4C3L A;  1RT3 B;  3OFF A;  1GMU A;  3KJQ B;  2ADC A;  4Y2A A;  2R2T A;  3B54 A;  4BWJ A;  4DPX A;  4G3I A;  2J0W A;  2QTW A;  2PDA A;  4QZV B;  1NSK L;  2OPR B;  5IT0 A;  4WP3 A;  3IGN A;  1M1K T;  2EBE A;  4DS5 A;  3AQO A;  3DDK A;  5KTQ A;  3MR3 A;  3BGR A;  1GH8 A;  1FT8 A;  2XMW A;  5LXY A;  3D6F B;  4JI8 F;  3TAN A;  2B9W A;  1M0S A;  4F50 A;  1T94 A;  4OYM A;  2LXI A;  2A2D A;  4JUZ A;  3FJ2 A;  2JC1 A;  2VG5 A;  3NWR A;  3W62 A;  2K1R A;  5HSP A;  1HD1 A;  5HQM A;  2IMO A;  1VK8 A;  5ETR A;  4X62 F;  3LGM A;  2I2Y A;  4ED6 A;  1JKH B;  2W2N P;  4X66 F;  3M2V A;  1TFW A;  5B09 A;  1P1T A;  2CAJ A;  3EGN A;  1RI7 A;  2E5J A;  1V6H A;  4DV6 J;  2NYH A;  1SJ4 P;  3K0J A;  2HQF A;  1NEE A;  1SQG A;  1YBT A;  4LF8 J;  3T1H F;  3C46 A;  4QYZ J;  3MR6 A;  4MMO A;  1KVI A;  4MT1 A;  3R6L B;  1JXE A;  2CWX A;  2FY1 A;  3IR7 B;  2QMU B;  3JTP A;  4TLR A;  4MKY A;  4B3M J;  4LF6 J;  2YTC A;  3ET6 B;  1FDA A;  2XY5 A;  5HLF A;  3M8P A;  1RAD B;  4DEZ A;  1AFJ A;  1BXN A;  3R5D A;  5K14 B;  2B5J B;  2B8Q A;  3VR1 A;  2OO4 A;  1VLY A;  3EDR B;  4NI2 B;  1QD1 A;  2MKY A;  1HHQ A;  4QPT A;  1S6Q A;  2AF6 A;  4JOU A;  2CPX A;  1N8R T;  5HL7 Q;  1TL3 B;  4EK2 A;  5KT5 A;  4O44 B;  1WWH A;  4ANE A;  2Q1L A;  2AU0 A;  3TAR A;  2JNJ A;  4F4X A;  2FLN A;  3TEG A;  2ATC B;  2UUT A;  3O6Q A;  1TMM A;  4B9N A;  4EBC A;  2DO0 A;  2BKP A;  2QO3 A;  3KDO A;  4ES3 A;  4XO0 A;  2B9Y A;  3CCV S;  1ROF A;  3WC0 A;  2PC6 A;  2QJ3 A;  2MZQ A;  1C0T B;  2DRB A;  4OYO A;  1VI7 A;  4OQJ A;  4IR9 A;  3CD6 S;  3MM7 B;  1Q95 G;  3FEX B;  2R7W A;  3LO3 A;  1FWK A;  5KFZ A;  2DJW A;  2FHJ A;  4F0K A;  3VGV A;  1CJU A;  2BMB A;  2MHE A;  2XYP B;  1B7Y B;  4QW9 A;  1NK9 A;  4X4S A;  3CT9 A;  5HP1 A;  3I55 S;  5IM0 B;  5GAH U;  2QFI A;  2MQL A;  3A3P B;  3E8O A;  2J7U A;  3C66 A;  2IM2 A;  2F3J A;  4EBD A;  3S7R A;  4TQR A;  2DIT A;  1SC6 A;  2FZG B;  3VCD A;  2RQK A;  2FJB B;  3DMJ B;  2DHH A;  2HZA A;  4JI1 F;  3LF0 A;  2XMK A;  4QWD A;  1RWN B;  4G1Q B;  3WIU A;  4OX9 F;  2DNL A;  4A8Q A;  5KFK A;  2C3P A;  3I5C A;  4QWB A;  5DLF A;  5KT4 A;  2Y1J A;  2ZC3 A;  4AXJ A;  4G65 A;  2GX8 A;  2FB0 A;  1T05 B;  3IM8 A;  3TUI C;  4USH A;  3PR5 B;  4UUW A;  4F04 B;  5LMN F;  4EYI B;  3W60 A;  5KG1 A;  1S79 A;  4O0N A;  3HDS A;  3VAM A;  3HJF A;  4KBI A;  2Z2L A;  1REG X;  3DRR B;  1FWP A;  5A8R B;  2E7W A;  4DUZ F;  4FXD A;  2KXF A;  3WHI A;  1FKP A;  1JKH A;  5HAO A;  3F44 A;  1P9Y A;  2GVD B;  4CLZ A;  1RCO B;  3M8R A;  2XLK A;  2PMZ D;  1HLW A;  1HNZ F;  2CJ9 A;  5HK4 A;  4U9R A;  3AD7 C;  5D3G B;  1YIT S;  2RE1 A;  1WOR A;  1I94 F;  1HA1 A;  3ENV A;  4P2S A;  1N36 F;  4PPD A;  2J9E A;  3NCQ A;  4ZKA A;  3DU6 A;  5GAE U;  4FF4 A;  2VON A;  3FNN A;  3Q24 A;  4DR7 F;  3B78 A;  2P6S A;  1F2G A;  4DUT A;  2MYF A;  4ZHR B;  3EXC X;  5ETL A;  2KVI A;  5F41 A;  2I8E A;  3FBB A;  2LQB A;  3MD1 A;  1TZ0 A;  3CD0 A;  2LEC A;  1RB0 A;  4ETZ A;  3RGI A;  4TKT A;  2YX7 A;  4NCG B;  5CZV A;  2ZDP A;  5T41 A;  5I4M A;  3H20 A;  1TL3 A;  2DR9 A;  1G4C A;  3NOC A;  1PCA A;  2Q6C A;  5E3Q A;  1RHK B;  1FO1 A;  1XK8 A;  1CJK B;  2E1M C;  2VQF J;  4H4M B;  3FZ2 A;  5IQQ A;  2W9A A;  2MQM A;  2PD1 A;  4ED5 A;  3K5P A;  3WC2 A;  2XS2 A;  2CAD A;  4DR5 J;  4ES2 A;  1Y4Z B;  2XCP A;  3FCV A;  3FZB A;  4PYD A;  3TA1 A;  1L3S A;  1C0T A;  2DGV A;  3N01 A;  4KO0 B;  2MZR A;  4BLG A;  1H98 A;  2XB2 D;  4IOC Q;  1TK0 A;  5J1E B;  1JLG B;  3MM7 A;  3DOM B;  1RLC L;  2FJW A;  3LW5 C;  3S6E A;  2B4V A;  3JQK A;  4KKO B;  3C16 A;  1FF2 A;  5LSL A;  5KT7 A;  3ONQ A;  3D3C J;  3E2E A;  1N54 B;  3P4U B;  1IM6 A;  2MQQ A;  1QUP A;  3QIP B;  4M5L A;  1NXI A;  4RW9 B;  2AZ1 A;  4ER8 A;  1GNK A;  1B3T A;  1JLE A;  3FC9 A;  1T0T V;  1U6B A;  3RRH A;  3A1Y G;  2KXN B;  3VVT A;  1RT1 A;  1MW7 A;  5HVH A;  3BYP A;  2QSW A;  4IDK B;  1M5H A;  2F4F A;  3DMJ A;  3KLH B;  2YWF A;  4G1Q A;  3WZ0 A;  4OI4 A;  4ECT A;  2DGT A;  1WC6 A;  1LXN A;  4C8N A;  1NH8 A;  3N0V A;  4DDF A;  3LGN A;  4IOB A;  2HVH A;  3SYZ A;  1U26 A;  4DL5 A;  3SFU A;  3D2W A;  4DBQ A;  2V63 A;  4EEY A;  1VIS A;  2H48 B;  4DV5 J;  4D3G A;  1C4A A;  4C0O C;  3M30 A;  3V81 A;  4CO5 A;  1UW4 A;  4F4Z A;  2MKC A;  1F60 B;  1N5Q A;  4TY8 B;  2XCA A;  4CM0 A;  2HVI A;  3DRR A;  3Q8P B;  5A8R A;  3MEK A;  2D9O A;  4WYW A;  3RRK A;  3H40 A;  1V3R A;  4NXM J;  4N56 A;  4P71 A;  2X1G A;  1UL3 A;  2HNZ A;  4Z7Y A;  4LRA A;  2HBR B;  1OMS A;  1HWU A;  3CMA S;  1HR0 J;  5ETM A;  1U1K A;  5D3G A;  2W25 A;  2RQM A;  1XC9 A;  4LFB J;  3PX6 A;  4DHV A;  2FZC B;  2BAC A;  4NXN F;  3AD9 C;  1BUX A;  3GYX B;  4OYX A;  3ZTO A;  2HW3 A;  3C2P A;  2HGM A;  1PKU A;  4C97 A;  2WW4 A;  2HNY A;  4ID5 A;  2LYV A;  1FXL A;  2BZ2 A;  1IR2 A;  3AJ2 A;  2MQP A;  1UZH A;  1RKJ A;  3O44 A;  1UTA A;  1YX2 A;  2DVI A;  3FBF A;  4J9V A;  1Z2L A;  4UZC A;  3T1A A;  2HYI B;  1N0V C;  2WVE A;  4I6Y A;  2QT7 A;  1HYS B;  4J9Q A;  2GO8 A;  5D6G A;  4NCG A;  3CNQ P;  1M5K C;  4PXD A;  2Y1I A;  1RHQ B;  4XPE A;  3GQC A;  3FVY A;  3R5J B;  2ZWO A;  4NLO A;  2QA4 S;  2AJ0 A;  2UU9 F;  4UST A;  4F67 A;  4Z7C A;  4W90 B;  2LCW A;  4B9S A;  2R9L A;  1ICE B;  5GAG U;  2VC1 A;  3DU5 A;  2Q66 A;  2WVC A;  4YEA A;  1HAR A;  3I9Z A;  4KO0 A;  2HHH J;  4F2R A;  2DGX A;  3ZXW A;  2UXC F;  4DX5 A;  2QLB B;  1W2B R;  4DMZ A;  1IWA A;  4WFY A;  3VHQ A;  1YHQ S;  3GP9 A;  4B02 A;  5C7P A;  5C25 B;  4KKO A;  3HHL A;  4NA3 A;  3MEC B;  2VA3 A;  1GMW D;  1EP4 A;  3IP0 A;  3R9L A;  4OYZ A;  2IIH A;  4OFZ A;  1WI8 A;  3QIP A;  1FKO B;  1JNZ B;  1MN7 A;  4RW9 A;  1J5E J;  2QA4 G;  2C1E B;  4CCH A;  3S01 A;  3HHD A;  5DRK A;  3T5H A;  3F73 A;  1TL7 A;  2P8I A;  1F9H A;  4I2Q B;  1OPZ A;  1OJ4 A;  3P3D A;  3KLH A;  5AXN A;  4ZVF A;  4ILM A;  2WOM B;  3MCN A;  2C2N A;  3PAC A;  1LWE B;  5K9F A;  3CJK A;  4G1P A;  2CXE A;  2GCF A;  2WVF A;  4Q2L A;  3CCT A;  4O3R A;  2ZBI A;  3KLV A;  3ETM A;  2Y9H A;  3VAL A;  4USJ C;  1AUD A;  3GSI A;  1U0S A;  3GIL A;  3P45 B;  3QLH B;  4JI6 J;  2PFF B;  1QTN B;  4OL8 A;  2GJ2 A;  4HVZ A;  1WDT A;  4C3M A;  2CFX A;  3KK3 B;  2N7Y A;  4ECQ A;  2E5I A;  3ZZP A;  5DGA A;  1K73 T;  4LFC J;  2M7S A;  4X4N A;  1X4G A;  1UFL A;  1KLM A;  1GT8 A;  2O01 C;  4OX8 A;  1F1B B;  4ED7 A;  4IH5 A;  1ARO P;  3DRX A;  1NK4 A;  2H5E A;  2YQ1 A;  4L3K A;  1PAE X;  3PKM A;  1VQY A;  3GWC A;  4PPZ A;  1VFJ A;  3ITH B;  3TO8 A;  4DV1 J;  3M6U A;  5E2Q A;  1IXK A;  3RAX A;  4DSK A;  1GMV A;  1H74 A;  1RP5 A;  3Q0A A;  4KH0 B;  2EFG A;  5HBM B;  2H51 B;  1T3O A;  3RYL A;  3DM2 A;  3G4S S;  2BV3 A;  1CQM A;  3IS9 B;  1VQM S;  5F0U A;  1WUU A;  2NRE A;  3FQK A;  1NBE B;  3CC7 S;  1W25 A;  5IWA F;  2V68 A;  4TQS A;  5LT5 A;  3KG0 A;  3QRP A;  2ZOG A;  1EB0 A;  2HHQ A;  2V8V A;  3ZZR A;  1BE4 A;  4ITS A;  2ASL A;  1HYS A;  3JSY A;  3UD3 P;  2IRY A;  4UTG A;  4ALZ A;  3N79 A;  4Y6I A;  3IXQ A;  3MM9 B;  4FYD A;  1NM2 A;  5F8M A;  1QM9 A;  3Q2T C;  1L3K A;  3KHR A;  5GMK a;  3BDE A;  1N88 A;  3GJT B;  2Q3P A;  4NE9 C;  3DN9 A;  2KG0 A;  1A0O B;  5EUH A;  5KFQ A;  4YHH F;  3F56 A;  1KQF B;  3VZI A;  1VDH A;  2LEA A;  5AE1 A;  3TI0 A;  2KYX A;  5I3U A;  4CH7 A;  3D28 A;  5BXI A;  1Q8I A;  1Q7Y T;  1RT5 B;  4LQ9 A;  3PYF A;  1U49 A;  4P74 A;  3KJF B;  2ILY A;  4WXW A;  1RE1 B;  5C25 A;  1F9F A;  3HSZ A;  3SIP B;  3PW4 A;  4PYA A;  5I3P A;  2D3U A;  4YME A;  4DPO A;  5KFE A;  3CC2 S;  2ROP A;  1YDL A;  4Q0B B;  3RR7 A;  1IBM J;  3M32 A;  2PA8 D;  2ALY B;  1SVD A;  4K4T A;  3A3N B;  3T3F A;  2HUR A;  4X65 J;  2HLU A;  4J90 A;  4UY8 T;  3W8G A;  1QVG R;  2WOM A;  2IAJ B;  2AEF A;  1LWE A;  4PWD A;  4OZ3 A;  4F2S A;  1BQN B;  1IJE B;  3PVX A;  5ITH A;  1F9E B;  3DRS B;  1YRX A;  3FFI B;  4O3Q A;  1X7V A;  1Q79 A;  4DG1 B;  1U1O A;  5EWE A;  3KK3 A;  2QMX A;  1VMB A;  3ISN C;  3J81 Y;  1WKL A;  1HNI B;  1ZM2 A;  2RQC A;  3IAM 9;  2HGL A;  1S59 A;  5F9L A;  2P9C A;  2QSF A;  3H4B A;  4NLP A;  4YDD B;  1KDN A;  2J0X A;  1QAI A;  4EO6 A;  3K5M A;  1HD0 A;  2GJF A;  1LWC B;  2DB1 A;  1C1B B;  4KY3 A;  3C6T B;  3AB4 B;  4JV5 J;  4J9U E;  5ETP A;  4GC6 A;  2KZM A;  3ZZO A;  1RTJ B;  3K5N A;  1D8Z A;  2QC3 A;  2R2R A;  1SV5 B;  2FVQ A;  4M5K A;  3KOA A;  2RDD A;  1Y10 A;  2RJZ A;  5E41 A;  1K44 A;  2DNN A;  3IS9 A;  2OPQ B;  1VHF A;  3P49 B;  1RAC B;  4MK8 A;  4DPW A;  2F1F A;  1VQO S;  5KG0 A;  1U1M A;  3UN3 A;  2UVV A;  1S10 A;  3MAQ A;  1M5S A;  1Z4U A;  1JLB B;  3BGU A;  3DI6 B;  2OSQ A;  1IWG A;  1DQ9 A;  1Y5L B;  1SKR A;  3H42 A;  4I4B A;  1SQE A;  6FDR A;  3ZTS A;  2DR8 A;  3TUZ C;  1EJ7 L;  2B9E A;  3MGJ A;  4BHQ A;  4KIA A;  2CA9 A;  1G7C B;  4DV3 F;  5KFF A;  5A8W A;  4LF5 J;  3M8Q B;  1XNQ J;  4JI2 J;  4DCP B;  2DNZ A;  2OP5 A;  4JI0 F;  4GKK F;  2DR7 A;  3MPD A;  1KNZ A;  3DXS X;  2MLX A;  4FS2 A;  2UXB J;  3VV2 B;  4OYP A;  3MDF A;  2PFD A;  2W7O A;  3FRZ A;  3ILO A;  3KK1 A;  2X3G A;  3OR2 B;  2C2Z B;  3BDP A;  3EGW B;  3PDN A;  3R2C J;  1GX6 A;  4N8N A;  3PRD A;  4RBV A;  3AOD A;  4JI3 J;  2Z2Z A;  1SC1 B;  2DXE A;  4L73 A;  1VJQ A;  1ZTW A;  4F0H A;  1G3O A;  4DUY J;  1I51 B;  2W4C A;  5L9X A;  1NB2 A;  1XMB A;  3LAK A;  2BE2 A;  2F8E X;  2LA4 A;  5J2P B;  3BH6 B;  4OHW A;  3UDC A;  1HI1 A;  3ENW A;  2F63 A;  1ZYQ A;  5D0H A;  3TQE A;  3M7V A;  3OJS A;  2VFU A;  1A9N B;  2G0J A;  2Z56 B;  1PJ7 A;  3EXY A;  3J7Z 5;  4DCJ B;  5LOQ A;  3PW2 A;  4U96 A;  3W2V B;  2B51 A;  1LOU A;  3EE3 A;  2PSZ A;  1IBL F;  2QYC A;  4B3T J;  1RYS A;  3G2X A;  4N47 A;  1PC5 A;  1RAH B;  5L1L A;  3SZ2 A;  3ENQ A;  2P5V A;  2Y0S D;  2KDO A;  4Y2I A;  3OTB A;  1FXD A;  4NML A;  2RF2 B;  4E8U A;  2HIY A;  1EZZ B;  2IVY A;  2IJF A;  1WC3 A;  4N41 A;  1IKX B;  1VQ6 S;  8RUC A;  1FHT A;  3DRS A;  2OHD A;  3DLH A;  1K1S A;  1OQ3 A;  3E51 A;  2B6A A;  2HQG A;  2R2S A;  1SUQ B;  1ZZN A;  3EVM A;  1HNX F;  4K5R A;  2JX2 A;  1VYA A;  4L6V 3;  2G4B A;  3JAM U;  4ZN3 A;  2VJU A;  4QCL A;  2Z58 B;  2RHS B;  4KGM A;  2XNQ A;  2ZHB A;  3UDL A;  2VKR A;  3K5O A;  3P5B P;  3OQ2 A;  5GME A;  4KHM A;  1FDN A;  2E44 A;  4ECV A;  2C28 A;  4ELT A;  1WTF A;  4JI4 J;  2CPD A;  1UEV A;  5KT6 A;  4L75 A;  4GKJ F;  2MXY A;  3CCR S;  1AB8 A;  1FES A;  4O4G B;  1C1B A;  2WON A;  2PI4 A;  1LWF A;  2XWY A;  1UEK A;  2FHK A;  2OLW A;  2YWW A;  2UUB J;  3JSR A;  4QIV A;  1LFW A;  2GAH C;  1X5O A;  2C3U A;  2XMM A;  1SV5 A;  5BR8 J;  3QPI A;  1R27 B;  4ECS A;  1CS4 B;  3EWG A;  2VIH A;  3RJM B;  2E9T A;  4WE1 B;  3LP0 B;  4NYO A;  3L9Z A;  4FVM A;  4JYA F;  5A2Q U;  2ADB A;  1URR A; 
#chains in the Genus database with same CATH homology
 4X64 J;  2KVQ E;  4JV5 J;  4V1A k;  4B3R J;  4LFC J;  1HNZ J;  4DR5 J;  4X65 J;  1N32 J;  4KHP J;  3D3B J;  3R2C J;  4PWW A;  2MQ8 A;  4AQY J;  4DV4 J;  5FLX U;  3JAM U;  4KYZ A;  1HNX J;  1IBK J;  4JI3 J;  1I94 J;  4RJV A;  4DV5 J;  2F4V J;  2MEW A;  4LF7 J;  1J5E J;  4JI7 J;  4DR6 J;  1N36 J;  4DUY J;  4YHH J;  4X66 J;  4JI1 J;  1XMQ J;  3OTO J;  4LF4 J;  4OX9 J;  4JI4 J;  1N33 J;  3IMQ J;  4DR3 J;  2E5L J;  1HNW J;  4JI5 J;  4DV6 J;  4DR4 J;  4DV1 J;  4X62 J;  4LF9 J;  3R2D J;  3J81 U;  1N34 J;  5IT9 U;  3D3C J;  4NXM J;  4GKJ J;  4LF8 J;  2UUC J;  4K0K J;  4YY3 J;  4DV2 J;  3T1H J;  2MTL A;  2UU9 J;  4HHU A;  3T1Y J;  1HR0 J;  4LFA J;  5LMN J;  3J80 U;  5LM7 E;  2UUB J;  4DR7 J;  1IBL J;  4DV0 J;  4DR1 J;  4NEZ A;  4LFB J;  5BR8 J;  2UUA J;  4B3T J;  3W1Y C;  4B3M J;  5LMU J;  2UXD J;  1FJG J;  5IWA J;  2VQE J;  4LF6 J;  2HHH J;  4B3S J;  1XNR J;  2ZM6 J;  4LF5 J;  2KL8 A;  4DV3 J;  4NEY A;  1XNQ J;  4NXN J;  4JI2 J;  3J7A N;  4DUZ J;  4DV7 J;  4JI8 J;  4DR2 J;  2UXB J;  4JI6 J;  2UXC J;  4JI0 J;  4KY3 A;  5A2Q U;  2VQF J;  4GKK J;  1IBM J;  5AJ3 J;  1XMO J;  4JYA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...